2Y4YA

Structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
82
Chain Sequence
IKPDETRVKQFLEGFNIETFEMVGTLSNAQGTFALVKGAGGVHRVRVGDYLGRNDGKVVGISKIDVIEIVPWLERPRSLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PILP PROTEIN
publication title Structure of a Domain from the Type Iv Pilus Biogenesis Lipoprotein Pilp, from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Biosynthetic protein
total genus 12
structure length 82
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2y4yA00
2LNVA 2Y4XA 2LC4A 3OSSC 2IVWA 2Y4YA
chains in the Genus database with same CATH superfamily
3I56A 3PNWC 1RLPC 3PGGA 2ROTA 1V29B 1WJRA 2ZCFB 3TREA 2AT1B 2H3EB 4M7AB 1FX7A 5J3BA 2HAXA 1AD5A 1WHLA 2VC8A 3ZFJA 3QDRB 3GOXA 3VU3C 3PMTA 1VQ8A 4XQ3A 3RIRA 1W2BA 1H8KA 3M55A 4RTXA 3QJ6A 1I8FA 2RHUA 3EH2A 1UDLA 2CYZB 1M3CA 4F14A 2JS0A 1WQ7A 3RBBB 1UECA 1NJIC 2YHTA 3P8DA 1LVKA 1AVZC 2FG0A 5KCOA 5C6SA 3OW2S 4QW2A 4BD3A 3EFSA 1YHQA 3RNJA 1NE8A 3VYGA 3M59A 2BZXA 3JCMJ 2HQEA 3G6ET 2QA4Q 2O9VA 2L0AA 1AZGB 2AZSA 1NLOC 3LGFA 3OS2A 1ZSZA 3OYAA 2DTHA 5IH2A 1Q7YC 1XNIA 1YJ9A 2X4XA 1D1CA 4KBMB 2E3HA 2XG8D 2ZPFB 1AEYA 4OF1A 3CC4A 1YJNQ 4EDUA 4M7DG 1KHCA 2LRQA 2JOYA 1K73C 2KE9A 2O9SA 5GJWB 1CSKA 1KC8U 2F1LA 2QQSA 4A4EA 2E65A 3OS5A 5GAN2 1Y0MA 2SRCA 4M77D 3PT9A 1M2VB 3OMGA 3EHRA 4OMPA 5IHKA 1KC8R 1OX9A 2D0QB 2RB6A 2VGNA 5GANg 1M3BA 2FL7A 4FU6A 2PNIA 3FC3A 1WJQA 5GAOl 2RI5A 4ME7A 6AT1B 1QKXA 1BI2A 4M77B 1RI9A 3JCMg 4LUDA 2D8HA 3OYIA 3M0TA 1UJ0A 3FEOA 4HXJA 1OPKA 2HL3A 2KK4A 2NUTA 2QGFB 4R0KA 3HKSA 2Y90A 1AWXA 1X27A 1S72T 4RTVA 2E5KA 1YIJQ 1MNEA 2YRVA 4J7IA 3LX7A 2M1HA 2OAUA 1OYXA 3GNFB 2RJDA 3PMIA 3CCRT 2HSPA 4X9CA 3UA7A 4OMLA 1EIFA 3OYCA 1R0CB 2CP5A 1VQMT 1K8AC 2NUPA 4IKFA 1VQ6T 1RAIB 1H641 2DL8A 4QQGA 1IO6A 2HCKA 1R8OB 5KE3A 4ZGEB 2FB7A 1MV0B 4II1A 1Y71A 3O5ZA 2KI7A 3LH5A 2DMOA 4LE9A 5EG2A 4PNOA 3QPHA 3OSSC 2Z0WA 3VS6A 3CCLQ 3OBYA 2DA9A 3R6NA 3GNGA 1M4ZA 3FJ5A 2V8IA 1F1BB 2J6KA 1D1AA 2HMAA 4F04B 2QQ9A 4HVUA 3CMEQ 3JB9G 1VQ4A 1VQ9T 2M9UA 4CI0C 3CC7T 1QVFP 3JV3A 3GPLA 4OB2B 3BW1A 5GAN7 3QXEB 5KYNA 4KH1B 4JJDA 2JN0A 2KY9A 4C8QD 4OGEA 1WPYA 2LMJA 4D8DA 3CMAT 1WXBA 1SHFA 2A7YA 3WVEB 1NG2A 1W70A 5GAN4 4QT7A 1QW1A 1HSQA 1SRMA 2LT1A 3FRNA 4JS4A 1QVFA 3EG1A 5D6WA 2J6FA 2RQTA 2QGGA 3DLMA 3I9QA 3LH0A 2MCNA 1PSEA 1N5ZA 1XJWB 1D3BA 3JSCA 5CAIA 2E1HA 4M4ZA 4BE2A 4DOVA 4C5HA 3H0IA 3CPWP 1RI0A 1Y07A 1OULA 1WHGA 2E70A 3LGLA 1NYFA 4RCCA 2CP6A 3JCMX 3L2UA 2DF6A 1U1TA 2F5KA 3CBOA 2ZPBB 3RKWA 2DBMA 2PZ1A 2W0ZA 3CXCP 4LDYA 2EIFA 2RF0A 1VQ7Q 5GAMd 1VQLT 2DD4A 1QP2A 1SSFA 3BFMA 5IHNA 2QA4A 2HL5C 4M75E 3X25B 2CP2A 4IUQA 1U8RA 3CD6T 1T0JA 3QHSA 2XK0A 1VQOT 5KYYA 4M7AA 3L2QA 1N8RC 1K0XA 1B34B 2JJ9A 3D7SB 4A63B 1I1JA 2RK1A 3OMCA 5GANd 2DO3A 3CXCA 3NTHA 3C0CA 2DJQA 1PRLC 1TH7A 1YJNA 3TU4K 3JCMd 5GMKm 1RLQC 2DXCA 4M7AC 2VUBA 4N4GA 5GMKi 1VQKT 3MP1A 4C92D 3DKMA 4PL6A 3M54A 2RJCA 3M0RA 5GAOr 2XDBA 4C5IA 4M78G 3G71T 3T9NA 3CCVT 2EJGA 1YITT 4C92B 2L8DA 1IRXA 1NZ9A 2LTOA 4XU1A 1K4US 5KYXA 2EKOA 4NOYA 2CGHA 1YIJA 3PE0A 1X2KA 1UJYA 3PVLA 4C0DB 2LCCA 4JDSA 4L5GA 2XU8A 1X75C 1RACB 4L6V5 4CC7A 3CCST 1T3SA 4ELZC 1GCPA 1K73U 1M3AA 4J9EA 5KYUA 2RM4A 2L3RA 2E4HA 4M7DD 3I56Q 3UA6A 5IAYA 3ASKA 2R5AA 1NPRA 5LJ3g 1K73R 2FHDA 3GIBA 2QQBA 3HFOA 1E6GA 4A4FA 2EWNA 1U5SA 5LL6S 1MGQA 2OI3A 2DM1A 4LDVA 3P8HA 2BTTA 3L2VA 3G6EQ 3J7AF 2EGCA 5CIUA 4QQDA 1B7TA 1OV3A 2ED1A 1RL2A 4V2SA 2YDLA 4AG1C 3MJXA 1KC8C 4KGXB 1ZLMA 2WSEE 4RTUA 3E1SA 1C6VX 2ED0A 3CCLA 4JRKA 4OMQA 4JZ4A 4M77C 3CCMT 1JJ2S 4D8KA 1OU9A 2P0KA 2QEXT 2K4YA 4BACA 3CMEA 2HQXA 1WHJA 4QVDA 3H6ZA 2LT4A 3OS1A 2EVRA 2DAQA 3JCMW 2RJEA 3LYIA 4TVRA 1IHVA 3HRSA 4ZNXA 1SKUB 4IUUA 1ARKA 4CC2A 1BK2A 2CP0A 2V1RA 4EMGA 2FVUA 1D09B 1Z9QA 2DZ9A 1U3OA 4ZTJA 3VV0A 2OTJT 4C0FA 4J9CA 1N9SA 4A54A 3M4YA 2DL7A 1S72Q 2F5TX 3A8OB 2DRMA 3CCJT 3CCET 3JRZA 2LNHB 1KJWA 2BIVA 3CCRQ 5KH6A 2B86A 2LCLA 1OX8A 1MMNA 1KQ1A 4JPBW 4OB3B 2EQMA 1VQMQ 1Y57A 2C0OA 2R57A 3CCQT 3QWXX 1VQ6Q 1TUDA 2MMPA 2K7AA 1VQ7A 5KYWB 1UTIA 2RHYA 3V8JA 4AMCA 4BB7A 2F69A 5LJ5f 3CPFA 2JZ2A 1PD0A 2RH2A 5GAN6 3V8LA 4ANJA 3VS3A 2EJ9A 2IPOB 1G5VA 2QQRA 2F2XA 3C12A 2EGAA 2FPEA 1ZBXA 4RCBA 3UATA 3BDLA 4DBRA 2CSQA 2CP7A 2K2MA 5CQXA 2QDYB 2A37A 2DETA 4DA4A 2DL5A 3TSZA 3LWIA 1W6XA 2H8HA 4PJJA 2A08A 4YTLA 1VQ9Q 3CC7Q 2CSIA 2DJZA 1QKWA 2RO0A 1GRIA 1TWBA 1WI7A 3PVQA 3A5ZB 2ENMA 3BY7A 2YSQA 4PJLA 1WZOA 1G8XA 3A8MB 2BZ8A 4A4GA 2J7IA 4JJNK 1QCNA 1B34A 4UC4A 2M0YA 2DXUA 3M56A 4BUGA 1M2OA 1PSFA 4OMNA 5HCKA 3IQLA 1VIFA 1BI0A 3EG0A 2K3BA 2ATCB 3VS1A 4MMKA 4KRTA 2E41A 4M77E 1AWOA 2LQNA 1K76A 2YRCA 1JXOA 1GCQA 1YWOA 2IVWA 4F7UB 5M9OA 1G2BA 1BIAA 1TUCA 3QZ5B 4Y91A 1X43A 4FIBA 4KT0E 1ZBJA 2D9TA 3JB9H 3M0QA 2P0QA 1VQLQ 4C5EA 5FW9A 4FL6A 1QVGP 3G6EA 3SDZA 5A0GA 3TSWA 1XTDA 3ZBDA 4PK4A 1GCQC 2HKNA 2F2WA 1BIBA 2LVMA 5D6XA 4M78D 1TUGB 4J9BA 2M51A 5AYFA 3TCJA 2LX9A 4KGZB 1KQ2A 3CQTA 2CP3A 1I5OB 5CO7A 4XU3A 4AFQC 2EPDA 1KQSS 4C92C 4M78B 3AHUA 1UB4A 1RAFB 1Y96B 3NTIA 3M9QA 1MMGA 1IREB 1QVGA 1GBRA 1YFNA 5CKFA 2L3QA 4DBFA 1IGUA 4E47A 1VQKQ 1UHFA 2D6FA 2DNUA 4PJNA 5I2SA 2ZPEB 2DILA 3G71Q 1VQNT 3CCVQ 1YITQ 3OYLA 3QYGB 1XQHA 4IUTA 4J9GA 2DXBA 2J06A 5GAMg 3MEVA 4M75A 2YT6A 3ZL7C 1W4SA 1PRMC 3EGUA 1G3TA 2X9HA 1S72A 2ZPIB 3G4ST 4XTYA 3J81E 1WX6A 1VQ8T 3EGDB 2I0NA 3CCRA 3KUFA 5L8RE 3MEUA 4Y28E 1WHKA 1Y7XA 1VUBA 2KSSA 4M7AF 4DBQA 2GCXA 4M75C 3EH1A 4LDUA 3JB9I 5CVIA 1CKAA 3VRZA 4C8QE 1UGVA 1VQMA 3H8ZA 1VQ6A 1R0BG 2RQWA 3OS0A 3I35A 4QKUA 2LX7A 1YI2T 2QYZA 2X4WA 2MAMA 3SWNA 2LNVA 1RAHB 1BI3A 4JJBA 2AKLA 2L3SA 3REAB 4A4KA 2ZGWA 4C5GA 3MEAA 1X2QA 1FWZA 2PUOB 2NWMA 2WSFE 4LD9K 5A2QE 2O2OA 2EQIA 1UG1A 3CCMQ 1JU5C 3SWNC 3CC4T 2K5LA 4LDWA 2QEXQ 5GAN5 4LNPA 1PG5B 3UT1A 1VQ9A 3L2RA 3RKYA 3FLGA 3QUIA 3CC7A 2YUQA 3NHNA 2DPPB 1JRIA 5CKEA 3QDFA 3FIFA 3AT1B 1KD1C 1H92A 4KH0B 2KVQG 3EFRA 1RAGB 5GAOn 1LNXA 1OZ3A 1PHTA 4HCKA 2ROLA 1W1FA 1KK7A 2Y4XA 2DVEA 1Q82U 1MMAA 1Q86U 3A8GB 2LJ0A 2C0IA 1Q82R 2DYBA 3EGXA 2K2VA 1Q86R 4XTWA 3EG9B 4FYXB 3OYFA 4M77F 2KXCA 4J6XA 3SEMA 1NBEB 2YUNA 2R5MA 3CCJQ 3CCEQ 1TOVA 2K9GA 3L42A 3HSBA 2X35A 5J39A 5L23A 1ZUUA 2O4XA 2EKHA 1AHJB 4C92E 1GFDA 3QG1A 4J6YA 2LZ6B 2O88A 1V76A 5GJVB 2G3RA 2A36A 2EYQA 3CCQQ 2OTLQ 5CKHA 3KBGA 2KAFA 2LQKA 2QQAA 2EYYA 3HFNA 4J6WA 4C8QB 3RUXA 3OYYA 1VQLA 4PJOD 5IT9E 5AT1B 1WDXA 1UHCA 2EBPA 2GBQA 3OYNA 2DTOA 2JS2A 4K11A 1VQOA 4HCBA 3S3MA 4F17A 1ZSGA 5CKDA 5I22A 4PJOB 2AK5A 2FYKA 3EFOB 4DEYA 2AIRB 3R6OA 4MDWA 1ACMB 2YRDA 2BE9B 3HHTB 3VUBA 1WGSA 3PIPA 3UWNA 2XMFA 1X69A 4M7DE 2FEIA 4C0GA 4X9DA 1VQKA 1CKBA 3E19A 3CPWA 1K1ZA 8AT1B 1AOJA 2GFAA 2O01E 2C06A 2EQUA 5GMKh 1HJDA 3G71A 3CCVA 1YITA 2M02A 3ZEHA 5GANf 1W2BS 1FXXA 2AKKA 2KRMA 2HEQA 3V7SA 1IZ6A 4DEXA 1VQ5T 2M16A 3JCMf 2CH4A 4LN2A 1WJSA 4XTUA 1SF9A 1AZEA 1S1NA 3M53A 1Y96A 2OAWA 1D0XA 1PKTA 1RADB 1MV3A 4GBQA 4M7AG 2HKQB 1M27C 1QQJA 1X6OA 2QAZA 2LJ1A 4ESRA 2GTOA 4PLIA 3THKA 1ZUKA 1BCOA 5GAOm 2GNCA 1GXIE 2H3JA 2QA4T 2EYWA 4PFZA 3DLLA 1LOJA 3ER0A 4VUBA 3MKDA 4IUPA 2RHIA 4HKEA 2VV5A 2RI3A 3CCUT 3NTKA 3E2UA 1WFWA 3C95A 4BY6B 1M8MA 4EMHA 1X6BA 2NUZA 2KT1A 5CKBA 5GMKj 3CCMA 3OW2P 1C1AA 1M2VA 2A28A 2QEXA 4ZGJB 3M58A 1WXUA 2M0OA 2EGEA 2KEAA 5HK3A 4P5NA 1TSFA 4M77A 3H0HA 1NM7A 2C0TA 2KMTA 2COYA 1RABB 3FJPA 1BB9A 4AT1B 4M7DB 5GMKe 1GFCA 1KSWA 4FM4B 2QK0A 4DBHA 3OY9A 2X3WD 4J5YA 3LWHA 3OW2A 4Z02A 1J3TA 4IIMA 4XTVA 1VQNQ 3SB2A 2I2LA 4RG8A 4O6JA 2VYTA 4Z89A 3H0FA 1ZSZB 4XAXB 4ZN3A 3JAME 3G4SQ 1UGQB 1YN8A 1V1CA 3CCEA 3CCJA 1RAAB 2F2VA 1NPPA 1Q81U 4OB0B 2L2PA 4M77G 4C92F 1K9MU 1D0ZA 1QLYA 4N4HA 1Q81R 1K9MR 4PFOA 2DKGA 1SSHA 1Z9ZA 2RQRA 3CCQA 2OTLA 4N4IA 4MMLA 2BE7D 2BZYA 2KT8A 3QYHB 2LJ3A 4CC3A 1YI2Q 2K79A 4ZGDB 3QBYA 1KD1U 4XTXA 1KG1A 2VWFA 5J26A 1JO8A 3CBPA 3V8KA 1KD1R 2PU9B 2RPNA 1ZA2B 4Z88A 2COWA 2NUTB 2D8JA 3L1AA 4A53A 1U1SA 4FCYA 5GAN3 1HXDA 2RQUA 2E5QA 2EW3A 4FSSA 4F7UE 3FB9A 1TXQA 4RTWA 3EG2A 3QKJA 4J9IA 3CMET 2ZAEA 4M75F 2HBWA 4AFSC 2HBPA 4LUEA 3JB9D 1Q82C 2CS7A 1Q86C 1UGPB 2RK2A 1G3YA 2DVJA 3OYMA 2EJFA 2NUPB 3TEEA 4N0AC 4C8QA 3X28B 1YCYA 2RHXA 3RKXA 1QVFS 2XDDA 2JTEA 1ZA1B 3V7CA 1VA7A 4XU0A 3I55T 1BYMA 3V7RA 4CC4B 2MOXA 1E6HA 2MK5A 1VOMA 4M78E 4B9XA 2HQHA 2EYXA 1UEBA 1FMKA 2YXYA 4XU2A 2EFIA 2X4JA 2V26A 4J9HA 4C8QC 1JQQA 1K0SA 1BBZA 3VKIA 2HZYA 2DL4A 1G3SA 2EAYA 4FT4A 3JCMb 3VRYA 2JMCA 2P4RA 2LDMA 4FYYB 1YJWT 3LLRA 4FYVB 2JVVA 2EYZA 1I4K1 2NYSA 1PCXA 4KUDK 3CMAQ 4PJOC 4PKCC 2E10A 2CT4A 3JCMc 2GQVA 3TQ7P 4JLIA 4JUVA 1QVPA 3G7ZA 1SHGA 4FT2A 2QTVA 4CRIA 1QCFA 2JW4A 4HVVA 1EZZB 1H3ZA 3CXCS 2CREA 3VS7A 2V1QA 2YUPA 2L5QA 2VB6A 3NMZC 3EAEA 5LJ3f 4ZN1A 3QIIA 4HT8A 1O75A 4Z8AA 3X20B 4AG2C 4JZ3A 1QMCA 5EC7A 1Q95G 5DY9A 3MPUB 2QXFA 1JB0E 1WIEA 2PVDB 3OSVA 3GP8A 2XKOC 3E9FA 1H3HA 4RKUE 4BE1A 3S3NA 3VS2A 2DEUA 2DLPA 2RNAA 3NFCA 1NLPC 4C92A 1M1KU 1WA7A 1MNDA 4RUGA 5I21A 2L3PA 3OYKA 3CD6Q 5A0LA 3CC2T 1VQOQ 3A1PA 4M7AD 4NL2A 4OGCA 1M1KR 2W10A 4GY5A 1LJOA 4C0ZA 1VQNA 1VQPT 1WLPB 3META 2V8JA 3M5AA 3I5SA 5KYYB 3G4SA 1VQ5Q 4E6RA 5DLQE 2O31A 4Y92A 3HPWA 1KFZA 1M9SA 2CUBA 3M0SA 4BE0A 2E12A 4C92G 3PFSA 4ORZA 2FZCB 4C0DC 4BY6C 1OU8A 2E6NA 3VS0A 1MUZA 5HY6A 3I56T 4M7DA 1MMDA 1YCSB 1YI2A 3M0UA 3MP8A 5LJ5h 3I5RA 7AT1B 5FLXE 4KULA 4R55A 2DIQA 4F7UF 2DXTA 2DFUA 4LDXA 3QSUA 5IXFA 4JRQA 2EQJA 2GTJA 3CCUQ 1HD3A 2J05A 2LP5A 3OB9A 5KYXB 1KIKA 4M7DC 4OMOA 4E2FB 2B8AA 5GMKl 1N9RA 1C0MA 1QP3A 1I81A 2VXFA 5FROA 3CCSQ 1AT1B 2PVOB 2JTMA 4MZTA 1WNLA 3X24B 2R58A 2DK3A 4HT9A 2CH4W 1ZSZC 4M75G 2JXBA 3EG3A 4QQ6A 1YHQT 1O9SA 2JNGA 3O8VA 5FRNA 5KYUB 3OQ5A 1B3QA 4FSXA 4M78F 5CR2A 5D7UA 4PJOE 3Q1JA 1JJ2P 2Y4YA 4ZTFA 2JTFA 2HDAA 2RHZA 1Q81C 3C94A 1K9MC 1YJ9T 1D1BA 4FW1A 4OMMA 1QCOA 3GF5A 3M4GA 3M57A 5FU7B 5LJ5j 2JT4A 1BKBA 1E7OA 2LC4A 5LJ3h 1NEBA 1BI1A 3H41A 3BDUA 3LW5E 5D6YA 1JJ2A 1TTHB 3OA6A 1M30A 2MIOA 5KYWA 3CMAA 1SRLA 2RJFA 2JM9A 2YUOA 2AZVA 3UF4A 2PUKB 3S6WA 5FRMA 1JEGA 4IIOA 5LJ5e 2OTJQ 4JJCA 2DBKA 2CKKA 4EMKB 1D0YA 2ZPHB 3PTAA 3MEWA 3E9GA 5I2MA 2JUFA 3HP9A 1EFNA 2SEMA 2RQVA 2LQWA 2MWPA 2CZ1B 2KYBA 2A0FB 1TG0A 1AWWA 4HCCA 4HA8A 4NS5A 2FPFA 2FPDA 1FMWA 4BDYA 1TU0B 3A8HB 3QWYA 4RG2A 1HK9A 3JB9J 4J9DA 4RTTA 3J80E 3GBQA 3MO8A 4X1VA 4J9FA 1AWJA 1ABQA 1PM3A 2JMAA 4XK8E 2K57A 1ZUYA 4AFUC 2QI2A 4GLKA 5LJ3j 2GGRA 1HYOA 1N27A 1FMVA 2KGTA 3CD6A 4MZPA 1A0NB 1QWFA 4WTOB 3I55Q 4O5VA 3MP6A 1VYUA 1B07A 3VUZA 3VYHB 5CCAA 2DZCA 1M90U 2DE0X 3HTRA 5FU6B 5LJ3e 1VQ5A 3OYHA 1VQ4T 1M90R 1G83A 3BE3A 2GQIA 5GAN8 3REBB 2DL3A 4F7UA 5GAMf 4HVWA 1RUWA 1M5Q1 3OYGA 2VGMA 4NL3A 1YJWQ 1BCMA 2MYSA 2OX7A 2ABLA 2MI6A 2L89A 1BU1A 1UGRB 4GLMA 4E7ZA 1ABOA 3MCAB 4E7HA 3OYEA 1TS9A 2D1XA 2KQWA 4BI8B 1ZX6A 5IXBA 1UUEA 1I07A 3HRTA 1QWEA 2ESWA 2FZGB 1SPKA 4F16A 8ATCB 4J83A 4MZMA 5CQYA 1YNZA 2CZ7B 4F7UG 3CCUA 3KXTA 2MWOA 4X34A 3RMSA 4M78A 4E7KA 1LPLA 4C8QF 1IB8A 2CDTA 1SEMA 1QVGS 2D0NA 4OVAA 2J6OA 4IURA 3SD4A 2DRKA 2IG0A 2K6DA 3VS5A 5LJ5g 1MHNA 3CCSA 3URGA 2DTIA 1M1KC 4JRPA 1FYNA 1PNJA 2DD5A 4PJMA 2BUDA 2OJ2A 1LCKA 4PJOF 4KGVB 4M78C 5HKCA 4IUVA 2QTXA 2XIDA 4AFZC 1YP5A 4BI4A 1NYGA 3MHXA 2FZKB 2JM8A 2VKNA 1NJIU 2X51A 3DB3A 3CC2Q 2VASA 1KQSP 3INZA 2P4TA 3H9NA 2FO0A 1NJIR 1VQPQ 3QO3A 2DX1A 3EGDA 2VVKA 3KFVA 1M1GA 4Q5WA 5HK0A 1YJNT 3RDVA 2YWWA 5DM7R 2BKDN 4JS5A 1Q7YU 3TVTA 1OPLA 4RTYA 2PQWA 4D6WA 2RI2A 4EIKA 1Q7YR 1KQSA 2MF2A 3RMQA 3U23A 4XTZA 4OP0A 3P8BB 1RAEB 4FW2A 9ATCB 3ME9A 2KNBB 4DOWA 5IN1A 2ECZA 3DB4A 4E7JA 1NEGA 2OTJA 3CBMA 4M75D 1YWPA 2QDLA 5GAOp 4JLGA 1YIJT 2KBTA 1VYTA 2DYIA 2CT3A 3QZ9B 2KRNA 2CUDA 3JCMQ 1VQ8Q 3A8LB 4M75B 1IXDA 2NLUA 4HCZA 2GF7A 1T3LA 3F70A 1WQWA 1R77A 2AHJB 4B9WA 1X6GA 2X3XD 4JRIA 2CZ6B 1UE9A 4E7IA 2RA2A 3N5BB 2E64A 2P84A 5GAMh 3WXMB 1DJ7B 5GAOq 2HD0A 1YHQQ 2KROA 5FU7C 5IHIA 1JBMA 2P0PA 2V8KA 3PIOA 3C4SA 4EMKA 2RD1A 4DQ2A 5KE2A 1K8AU 1WYXA 2DEQA 5ECAA 4PLLA 2K5FA 3L2ZA 3SWNB 4RMOA 3EG9A 3I55A 4E7LA 4QVCA 1K8AR 5GANh 2YLCA 3GLXA 3X26B 1WHHA 3CCLT 1YJ9Q 4LD6A 1I5LA 4J8OA 1EX4A 4N0AA 2E6ZA 4M7DF 4WCIA 3RERA 2IIMA 4BI3A 3CC4Q 2HSEB 1GL5A 2RN8A 1WXTA 3JCMh 1OQKA 4EMKC 5DLOA 1GBQA 1YBYA 1VYVA 2XHCA 2EQKA 2KRSA 2XDPA 3UPUA 2E3IA 1IGQA 3EHQA 1M8VA 1IHWA 1I0CA 3SFMA 2ZZDA 2LCSA 1YJWA 1WHMA 1M1FA 2QG9B 2MPXC 4OMFB 5I11A 2KXDA 2OTLT 4M7AE 1UGSB 4RTZA 3JCMV 3WVDB 1OOTA 3G1JA 5LJ5d 2PTKA 3OYDA 4FYWB 3HRUA 2FRYA 4PJOA 2LQ8A 4PFPA 4KUIA 2KR3A 3HL8A 4WF2A 5GAMj 2WSCE 4L59A 5CK9A 3EFOA 3SHWA 1ZHIA 1ZQ1A 3FDRA 3EGXB 3OBWA 1U06A 1G3WA 2K3XA 1VIEA 2WACA 2VXEA 4MDXA 1OEBA 1SG5A 4C8QG 1K9AA 2HNIA 2K5IA 2FRWA 2YLBA 2X4YA 4J7FA 2DIGA 4A4HA 3VJPA 5GANj 1PWTA 2A3LA 3CPWS 1PKSA 5GAMe 3OYJA 1VQ7T 5FU6C 2O4XB 1JXMA 3CEYA 1N6AA 4ELYC 4PJOG 2RMOA 4B6MA 4EPCA 5KCHA 1M90C 2K3YA 4BDZA 2G6FX 2PVGB 2XICA 2KYMA 5FWCA 5C0MA 2COZA 4R56A 3CC2A 5GANe 2XD0A 3NGPA 2QASA 1PC0A 4OB1B 1VQPA 1KHIA 3RESA 1T0HA 1PD1A 1D3BB 3ULRB 5A0DA 5FWBA 3L2WA 3S3OA 1XOVA 3QJYA 3JCMe 3JB9F 2GFUA 2XI9A 1OZ2A 3NPFA 4ATOA 1VQ4Q 3VS4A 1N8RU 3RR6A 5LJ3d 3OYBA 1UFFA 4E7SA 4QVZA 2CZ0B 3A98A 1N8RR 4LXCA 3JCMP 2ZPGB 1W2BP 1P92A 3M0PA 1OI1A 1X01A 3UDCA 2DERA 2KDSA
chains in the Genus database with same CATH topology
4XTUA 3I56A 3PNWC 3CMAA 2F5TX 3PGGA 2RJFA 3A8OB 3M53A 1Y96A 3CCJT 3CCET 1V29B 1WJRA 3JRZA 2ZCFB 3TREA 2PUKB 3S6WA 5FRMA 4M7AB 5LJ5e 1FX7A 2BIVA 5J3BA 5KH6A 2HAXA 2VC8A 3ZFJA 2CKKA 4M7AG 4EMKB 3QDRB 2ZPHB 3GOXA 1X6OA 3VU3C 3PMTA 3MEWA 2LCLA 3PTAA 1VQ8A 4XQ3A 3RIRA 4PLIA 3E9GA 1W2BA 1KQ1A 2JUFA 5I2MA 3HP9A 3M55A 4OB3B 3QJ6A 5GAOm 1I8FA 2RHUA 2MWPA 2CZ1B 2EQMA 1GXIE 3CCQT 2CYZB 2R57A 2H3JA 2QA4T 2MMPA 4HA8A 4HCCA 1WQ7A 3DLLA 1LOJA 1VQ7A 3ER0A 4NS5A 4VUBA 2RHYA 3V8JA 1NJIC 4IUPA 2YHTA 2RHIA 4HKEA 2F69A 2VV5A 3CPFA 3P8DA 4BB7A 5LJ5f 4BDYA 2JZ2A 2RI3A 3A8HB 3NTKA 3CCUT 2RH2A 5GAN6 4RG2A 1HK9A 3C95A 4BY6B 3V8LA 5KCOA 3JB9J 5C6SA 3OW2S 4EMHA 4QW2A 4BD3A 3EFSA 3J80E 1YHQA 2EJ9A 1NE8A 3MO8A 3VYGA 3M59A 2QQRA 1G5VA 5CKBA 5GMKj 3CCMA 3C12A 3JCMJ 2HQEA 3G6ET 1ZBXA 2QEXA 4RCBA 3BDLA 4XK8E 2K57A 5CQXA 4ZGJB 3M58A 2M0OA 2QDYB 3LGFA 3OS2A 2QI2A 4GLKA 2DTHA 5LJ3j 5HK3A 3OYAA 4DA4A 1Q7YC 3LWIA 4P5NA 1N27A 4M77A 1XNIA 1YJ9A 3CD6A 2X4XA 4YTLA 4MZPA 4KBMB 2KMTA 2XG8D 2ZPFB 3FJPA 4OF1A 3CC4A 2DJZA 4M7DB 4O5VA 3MP6A 5GMKe 2RO0A 4FM4B 4EDUA 3VUZA 1KHCA 2LRQA 1M90U 4M7DG 2JOYA 1K73C 3VYHB 3OY9A 5CCAA 3A5ZB 2DZCA 4J5YA 3LWHA 3OW2A 1KC8U 3BY7A 4Z02A 2QQSA 4A4EA 2E65A 3OS5A 5GAN2 4XTVA 3SB2A 5FU6B 2I2LA 4M77D 4RG8A 3PT9A 5LJ3e 1VQ5A 4O6JA 3OYHA 3OMGA 2VYTA 1VQ4T 2D0QB 2RB6A 2VGNA 3A8MB 5GANg 2FL7A 4FU6A 3FC3A 1WJQA 5GAN8 5GAOl 2RI5A 4A4GA 4ME7A 4XAXB 4ZN3A 3JAME 4F7UA 5GAMf 1UGQB 1M5Q1 1BI2A 3OYGA 4M77B 3CCEA 3CCJA 2VGMA 3JCMg 4NL3A 1NPPA 4JJNK 1B34A 4UC4A 4OB0B 1Q81U 4M77G 2DXUA 3OYIA 4C92F 3M56A 2MI6A 1K9MU 2L89A 3FEOA 4BUGA 1UGRB 1PSFA 2KK4A 3MCAB 4N4HA 3HKSA 2Y90A 4E7HA 3OYEA 1VIFA 1BI0A 2KQWA 1S72T 4BI8B 2DKGA 2YRVA 4J7IA 3LX7A 4MMKA 2M1HA 2OAUA 2E41A 4M77E 3CCQA 2OTLA 4N4IA 4LDXA 1OYXA 3GNFB 4MMLA 2RJDA 3HRTA 3PMIA 3QYHB 3CCRT 4X9CA 4ZGDB 2IVWA 4F7UB 5M9OA 3QBYA 4J83A 1KD1U 4XTXA 4MZMA 1BIAA 5CQYA 2CZ7B 3QZ5B 1KG1A 4F7UG 1EIFA 4Y91A 3CCUA 3KXTA 2MWOA 4X34A 3RMSA 4M78A 3OYCA 4E7KA 3OA6A 4C8QF 4FIBA 5J26A 3CBPA 1QVGS 3V8KA 4KT0E 2PU9B 4OVAA 1VQMT 1K8AC 2D9TA 3JB9H 4IURA 3SD4A 2IG0A 4IKFA 1VQ6T 1H641 2P0QA 4C5EA 5LJ5g 1MHNA 4FL6A 3CCSA 3L1AA 4A53A 4QQGA 3SDZA 1U1SA 3URGA 5A0GA 3G6EA 2DTIA 1M1KC 5GAN3 1XTDA 1HXDA 3ZBDA 4JRPA 1R8OB 2E5QA 4ZGEB 5KE3A 2FB7A 4F7UE 2DD5A 4II1A 1BIBA 2LVMA 3FB9A 2BUDA 5D6XA 4M78D 1Y71A 3QKJA 4PJOF 5AYFA 4M78C 5HKCA 4IUVA 2QTXA 2XIDA 2LX9A 3TCJA 1KQ2A 3CMET 4M75F 5CO7A 2HBPA 3JB9D 4BI4A 5EG2A 4XU3A 1Q82C 2CS7A 3MHXA 4PNOA 3QPHA 1KQSS 3OSSC 4C92C 4M78B 1NJIU 1Q86C 3AHUA 1UGPB 3DB3A 3OBYA 1UB4A 2RK2A 1Y96B 3GNGA 1G3YA 1M4ZA 1IREB 3M9QA 3NTIA 3OYMA 2V8IA 2P4TA 3INZA 2EJFA 1QVGA 5CKFA 3TEEA 4N0AC 4C8QA 3X28B 1YCYA 2RHXA 3RKXA 3QO3A 4E47A 1QVFS 2XDDA 2QQ9A 3JB9G 1VQ4A 1VQ9T 2D6FA 2M9UA 3V7CA 4CI0C 4XU0A 3I55T 3CC7T 1BYMA 3V7RA 1M1GA 3GPLA 4OB2B 4Q5WA 5HK0A 1YJNT 3BW1A 5GAN7 5I2SA 3QXEB 2BKDN 5DM7R 4M78E 4JS5A 2ZPEB 4B9XA 2JN0A 2KY9A 1Q7YU 1UEBA 4XU2A 1VQNT 2EFIA 2X4JA 4C8QD 3OYLA 4OGEA 1WPYA 3QYGB 3CMAT 2PQWA 1XQHA 4IUTA 2DXBA 2A7YA 4C8QC 2RI2A 4D6WA 5GAMg 3WVEB 3MEVA 2MF2A 4M75A 3RMQA 1KQSA 3VKIA 1W4SA 4XTZA 1G3SA 1G3TA 2EAYA 4FT4A 5GAN4 4OP0A 3P8BB 1QW1A 1S72A 2ZPIB 3G4ST 3JCMb 4XTYA 3J81E 2LT1A 2LDMA 3FRNA 3ME9A 1YJWT 3LLRA 1VQ8T 4JS4A 2JVVA 1QVFA 5D6WA 4DOWA 5IN1A 3DLMA 1I4K1 3DB4A 4E7JA 3LH0A 3CCRA 3KUFA 4KUDK 5L8RE 1PSEA 2OTJA 4PJOC 3CBMA 3MEUA 1D3BA 3JSCA 4PKCC 4Y28E 1Y7XA 4M75D 1VUBA 2E1HA 2E10A 5CAIA 2KSSA 4BE2A 4DOVA 4C5HA 4M7AF 3JCMc 2GCXA 2GQVA 4M75C 4JLIA 4JUVA 5GAOp 4JLGA 1RI0A 4LDUA 3JB9I 1YIJT 1Y07A 1QVPA 5CVIA 2E70A 3LGLA 4RCCA 3G7ZA 4C8QE 3QZ9B 1VQMA 3JCMX 3JCMQ 3A8LB 3L2UA 3H8ZA 1VQ6A 1U1TA 4FT2A 2F5KA 4M75B 4CRIA 2NLUA 3OS0A 4HCZA 1YI2T 1H3ZA 3CXCS 2GF7A 2X4WA 3CBOA 3F70A 1WQWA 2MAMA 2L5QA 2ZPBB 3SWNA 3RKWA 2LNVA 3EAEA 2AHJB 1BI3A 4B9WA 5LJ3f 4LDYA 4ZN1A 3QIIA 4HT8A 4A4KA 2EIFA 2CZ6B 4JRIA 4E7IA 1O75A 2ZGWA 5GAMd 4C5GA 2RA2A 3X20B 3MEAA 1VQLT 2DD4A 1FWZA 1QP2A 1SSFA 2PUOB 3BFMA 2QA4A 2WSFE 4M75E 4LD9K 3N5BB 3X25B 2E64A 4IUQA 5DY9A 5GAMh 5A2QE 3WXMB 1DJ7B 1U8RA 2QXFA 5GAOq 3CD6T 1JB0E 2HD0A 3QHSA 2XK0A 1VQOT 2PVDB 3OSVA 5FU7C 3GP8A 1JBMA 2P0PA 3SWNC 3L2QA 2XKOC 4M7AA 1N8RC 2V8KA 3CC4T 1B34B 2K5LA 3E9FA 3PIOA 4LDWA 5GAN5 3C4SA 4RKUE 4EMKA 4BE1A 3S3NA 2RD1A 4DQ2A 5KE2A 1K8AU 2RK1A 3OMCA 5GANd 2DEQA 4M7DC 2DO3A 4PLLA 2K5FA 3UT1A 3CXCA 1VQ9A 3NTHA 3L2ZA 3L2RA 3SWNB 3NFCA 4RMOA 3RKYA 1TH7A 3FLGA 3QUIA 4C92A 4QVCA 3I55A 3CC7A 4E7LA 1M1KU 2DPPB 1JRIA 5CKEA 5GANh 2YLCA 3GLXA 3X26B 5I21A 3CCLT 3OYKA 3TU4K 5A0LA 4LD6A 1I5LA 3CC2T 3JCMd 4J8OA 5GMKm 4M7AD 4NL2A 4OGCA 3FIFA 4N0AA 2E6ZA 1KD1C 4M7DF 3RERA 2KVQG 1LJOA 2DXCA 3EFRA 4GY5A 4BI3A 4C0ZA 2VUBA 5GAOn 1VQPT 1VQNA 1LNXA 4M7AC 4N4GA 1OZ3A 5GMKi 3JCMh 3META 1VQKT 2V8JA 4EMKC 3M5AA 5DLOA 3MP1A 1YBYA 2XHCA 2Y4XA 2DVEA 1Q82U 4C92D 2EQKA 3DKMA 2XDPA 4PL6A 3UPUA 1Q86U 3A8GB 3M54A 3G4SA 1M8VA 3SFMA 2RJCA 2ZZDA 5DLQE 5GAOr 4C5IA 4M78G 1YJWA 2XDBA 3G71T 3T9NA 3CCVT 1M1FA 2EJGA 2K2VA 1YITT 4XTWA 3OYFA 4C92B 2L8DA 3HPWA 1M9SA 4J6XA 4M77F 4OMFB 4BE0A 2E12A 2R5MA 4C92G 1NZ9A 3PFSA 2LTOA 4XU1A 2OTLT 4C0DC 3L42A 4M7AE 1UGSB 2EKOA 4NOYA 3JCMV 2CGHA 4BY6C 1YIJA 3HSBA 2E6NA 3WVDB 2X35A 5LJ5d 5HY6A 5J39A 3OYDA 3I56T 3HRUA 4M7DA 4C0DB 4PJOA 2LCCA 2LQ8A 2O4XA 4KUIA 3HL8A 4WF2A 4JDSA 1AHJB 4L5GA 5GAMj 2WSCE 2XU8A 4C92E 1YI2A 1X75C 3MP8A 3QG1A 4J6YA 4L59A 5CK9A 5LJ5h 2G3RA 4L6V5 1ZHIA 2EYQA 1ZQ1A 3FDRA 5CKHA 5FLXE 4KULA 3CCST 3KBGA 3OBWA 2KAFA 2LQKA 1G3WA 2QQAA 2K3XA 3HFNA 4J6WA 4ELZC 4R55A 2DIQA 4F7UF 2DXTA 4C8QB 1VIEA 2WACA 1K73U 3RUXA 3OYYA 2EQJA 4JRQA 2VXEA 3QSUA 2RM4A 4MDXA 2L3RA 4C8QG 4M7DD 2HNIA 1VQLA 2K5IA 2YLBA 5IAYA 4PJOD 3ASKA 2R5AA 5IT9E 1NPRA 2X4YA 3OB9A 2DIGA 4J7FA 2FHDA 4A4HA 5LJ3g 2QQBA 3HFOA 3VJPA 3GIBA 2B8AA 5GMKl 1N9RA 3OYNA 2DTOA 1QP3A 2A3LA 3CPWS 4A4FA 5GANj 1I81A 2EWNA 1VQOA 5LL6S 4HCBA 1MGQA 5GAMe 3S3MA 2VXFA 5FROA 4LDVA 5CKDA 3OYJA 3P8HA 3L2VA 2PVOB 3J7AF 5CIUA 4PJOB 4QQDA 1VQ7T 5FU6C 2O4XB 2JTMA 4MZTA 3CEYA 1N6AA 4ELYC 1RL2A 4PJOG 4V2SA 4EPCA 2FYKA 1WNLA 5KCHA 3X24B 1KC8C 1M90C 2K3YA 2DK3A 2PVGB 2R58A 3R6OA 4BDZA 2XICA 4MDWA 2WSEE 4HT9A 3E1SA 4M75G 4QQ6A 5C0MA 3CCLA 4JRKA 4R56A 1YHQT 3CC2A 1O9SA 3HHTB 4M77C 2JNGA 3O8VA 3VUBA 3CCMT 1WGSA 5GANe 5FRNA 3OQ5A 1JJ2S 4FSXA 3PIPA 2P0KA 2QEXT 2K4YA 4M78F 3UWNA 5CR2A 2XD0A 4OB1B 1VQPA 4C0GA 4M7DE 1KHIA 3RESA 4BACA 4PJOE 3Q1JA 4X9DA 1VQKA 2Y4YA 3CMEA 2HQXA 4ZTFA 1D3BB 3L2WA 5A0DA 3S3OA 4QVDA 1XOVA 2JTFA 3H6ZA 3E19A 3QJYA 2LT4A 3JCMe 3OS1A 3CPWA 2RHZA 3JB9F 2GFUA 2XI9A 1Q81C 2DAQA 2GFAA 3C94A 2RJEA 1OZ2A 2O01E 3LYIA 4TVRA 3JCMW 1K9MC 1YJ9T 2C06A 3HRSA 4IUUA 2EQUA 4ATOA 5GMKh 1N8RU 3G71A 5LJ3d 3OYBA 3CCVA 1YITA 4QVZA 3GF5A 3M4GA 3ZEHA 2CZ0B 4EMGA 5GANf 1W2BS 1FXXA 3M57A 2FVUA 5FU7B 5LJ5j 1BKBA 2LC4A 5LJ3h 2DZ9A 3JCMP 3V7SA 1BI1A 1IZ6A 2ZPGB 4ZTJA 1P92A 3VV0A 3BDUA 3LW5E 2OTJT 5D6YA 4C0FA 1VQ5T 1JJ2A 1YJNA 2M16A 3JCMf 1OI1A 1N9SA 1X01A 3UDCA 1WJSA 4A54A 3M4YA 2KDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNV A;  2Y4X A;  2LC4 A;  3OSS C;  2IVW A;  2Y4Y A; 
#chains in the Genus database with same CATH topology
 3I56 A;  3PNW C;  1RLP C;  3PGG A;  2ROT A;  1V29 B;  1WJR A;  2ZCF B;  3TRE A;  2AT1 B;  2H3E B;  4M7A B;  1FX7 A;  5J3B A;  2HAX A;  1AD5 A;  1WHL A;  2VC8 A;  3ZFJ A;  3QDR B;  3GOX A;  3VU3 C;  3PMT A;  1VQ8 A;  4XQ3 A;  3RIR A;  1W2B A;  1H8K A;  3M55 A;  4RTX A;  3QJ6 A;  1I8F A;  2RHU A;  3EH2 A;  1UDL A;  2CYZ B;  1M3C A;  4F14 A;  2JS0 A;  1WQ7 A;  3RBB B;  1UEC A;  1NJI C;  2YHT A;  3P8D A;  1LVK A;  1AVZ C;  2FG0 A;  5KCO A;  5C6S A;  3OW2 S;  4QW2 A;  4BD3 A;  3EFS A;  1YHQ A;  3RNJ A;  1NE8 A;  3VYG A;  3M59 A;  2BZX A;  3JCM J;  2HQE A;  3G6E T;  2QA4 Q;  2O9V A;  2L0A A;  1AZG B;  2AZS A;  1NLO C;  3LGF A;  3OS2 A;  1ZSZ A;  3OYA A;  2DTH A;  5IH2 A;  1Q7Y C;  1XNI A;  1YJ9 A;  2X4X A;  1D1C A;  4KBM B;  2E3H A;  2XG8 D;  2ZPF B;  1AEY A;  4OF1 A;  3CC4 A;  1YJN Q;  4EDU A;  4M7D G;  1KHC A;  2LRQ A;  2JOY A;  1K73 C;  2KE9 A;  2O9S A;  5GJW B;  1CSK A;  1KC8 U;  2F1L A;  2QQS A;  4A4E A;  2E65 A;  3OS5 A;  5GAN 2;  1Y0M A;  2SRC A;  4M77 D;  3PT9 A;  1M2V B;  3OMG A;  3EHR A;  4OMP A;  5IHK A;  1KC8 R;  1OX9 A;  2D0Q B;  2RB6 A;  2VGN A;  5GAN g;  1M3B A;  2FL7 A;  4FU6 A;  2PNI A;  3FC3 A;  1WJQ A;  5GAO l;  2RI5 A;  4ME7 A;  6AT1 B;  1QKX A;  1BI2 A;  4M77 B;  1RI9 A;  3JCM g;  4LUD A;  2D8H A;  3OYI A;  3M0T A;  1UJ0 A;  3FEO A;  4HXJ A;  1OPK A;  2HL3 A;  2KK4 A;  2NUT A;  2QGF B;  4R0K A;  3HKS A;  2Y90 A;  1AWX A;  1X27 A;  1S72 T;  4RTV A;  2E5K A;  1YIJ Q;  1MNE A;  2YRV A;  4J7I A;  3LX7 A;  2M1H A;  2OAU A;  1OYX A;  3GNF B;  2RJD A;  3PMI A;  3CCR T;  2HSP A;  4X9C A;  3UA7 A;  4OML A;  1EIF A;  3OYC A;  1R0C B;  2CP5 A;  1VQM T;  1K8A C;  2NUP A;  4IKF A;  1VQ6 T;  1RAI B;  1H64 1;  2DL8 A;  4QQG A;  1IO6 A;  2HCK A;  1R8O B;  5KE3 A;  4ZGE B;  2FB7 A;  1MV0 B;  4II1 A;  1Y71 A;  3O5Z A;  2KI7 A;  3LH5 A;  2DMO A;  4LE9 A;  5EG2 A;  4PNO A;  3QPH A;  3OSS C;  2Z0W A;  3VS6 A;  3CCL Q;  3OBY A;  2DA9 A;  3R6N A;  3GNG A;  1M4Z A;  3FJ5 A;  2V8I A;  1F1B B;  2J6K A;  1D1A A;  2HMA A;  4F04 B;  2QQ9 A;  4HVU A;  3CME Q;  3JB9 G;  1VQ4 A;  1VQ9 T;  2M9U A;  4CI0 C;  3CC7 T;  1QVF P;  3JV3 A;  3GPL A;  4OB2 B;  3BW1 A;  5GAN 7;  3QXE B;  5KYN A;  4KH1 B;  4JJD A;  2JN0 A;  2KY9 A;  4C8Q D;  4OGE A;  1WPY A;  2LMJ A;  4D8D A;  3CMA T;  1WXB A;  1SHF A;  2A7Y A;  3WVE B;  1NG2 A;  1W70 A;  5GAN 4;  4QT7 A;  1QW1 A;  1HSQ A;  1SRM A;  2LT1 A;  3FRN A;  4JS4 A;  1QVF A;  3EG1 A;  5D6W A;  2J6F A;  2RQT A;  2QGG A;  3DLM A;  3I9Q A;  3LH0 A;  2MCN A;  1PSE A;  1N5Z A;  1XJW B;  1D3B A;  3JSC A;  5CAI A;  2E1H A;  4M4Z A;  4BE2 A;  4DOV A;  4C5H A;  3H0I A;  3CPW P;  1RI0 A;  1Y07 A;  1OUL A;  1WHG A;  2E70 A;  3LGL A;  1NYF A;  4RCC A;  2CP6 A;  3JCM X;  3L2U A;  2DF6 A;  1U1T A;  2F5K A;  3CBO A;  2ZPB B;  3RKW A;  2DBM A;  2PZ1 A;  2W0Z A;  3CXC P;  4LDY A;  2EIF A;  2RF0 A;  1VQ7 Q;  5GAM d;  1VQL T;  2DD4 A;  1QP2 A;  1SSF A;  3BFM A;  5IHN A;  2QA4 A;  2HL5 C;  4M75 E;  3X25 B;  2CP2 A;  4IUQ A;  1U8R A;  3CD6 T;  1T0J A;  3QHS A;  2XK0 A;  1VQO T;  5KYY A;  4M7A A;  3L2Q A;  1N8R C;  1K0X A;  1B34 B;  2JJ9 A;  3D7S B;  4A63 B;  1I1J A;  2RK1 A;  3OMC A;  5GAN d;  2DO3 A;  3CXC A;  3NTH A;  3C0C A;  2DJQ A;  1PRL C;  1TH7 A;  1YJN A;  3TU4 K;  3JCM d;  5GMK m;  1RLQ C;  2DXC A;  4M7A C;  2VUB A;  4N4G A;  5GMK i;  1VQK T;  3MP1 A;  4C92 D;  3DKM A;  4PL6 A;  3M54 A;  2RJC A;  3M0R A;  5GAO r;  2XDB A;  4C5I A;  4M78 G;  3G71 T;  3T9N A;  3CCV T;  2EJG A;  1YIT T;  4C92 B;  2L8D A;  1IRX A;  1NZ9 A;  2LTO A;  4XU1 A;  1K4U S;  5KYX A;  2EKO A;  4NOY A;  2CGH A;  1YIJ A;  3PE0 A;  1X2K A;  1UJY A;  3PVL A;  4C0D B;  2LCC A;  4JDS A;  4L5G A;  2XU8 A;  1X75 C;  1RAC B;  4L6V 5;  4CC7 A;  3CCS T;  1T3S A;  4ELZ C;  1GCP A;  1K73 U;  1M3A A;  4J9E A;  5KYU A;  2RM4 A;  2L3R A;  2E4H A;  4M7D D;  3I56 Q;  3UA6 A;  5IAY A;  3ASK A;  2R5A A;  1NPR A;  5LJ3 g;  1K73 R;  2FHD A;  3GIB A;  2QQB A;  3HFO A;  1E6G A;  4A4F A;  2EWN A;  1U5S A;  5LL6 S;  1MGQ A;  2OI3 A;  2DM1 A;  4LDV A;  3P8H A;  2BTT A;  3L2V A;  3G6E Q;  3J7A F;  2EGC A;  5CIU A;  4QQD A;  1B7T A;  1OV3 A;  2ED1 A;  1RL2 A;  4V2S A;  2YDL A;  4AG1 C;  3MJX A;  1KC8 C;  4KGX B;  1ZLM A;  2WSE E;  4RTU A;  3E1S A;  1C6V X;  2ED0 A;  3CCL A;  4JRK A;  4OMQ A;  4JZ4 A;  4M77 C;  3CCM T;  1JJ2 S;  4D8K A;  1OU9 A;  2P0K A;  2QEX T;  2K4Y A;  4BAC A;  3CME A;  2HQX A;  1WHJ A;  4QVD A;  3H6Z A;  2LT4 A;  3OS1 A;  2EVR A;  2DAQ A;  3JCM W;  2RJE A;  3LYI A;  4TVR A;  1IHV A;  3HRS A;  4ZNX A;  1SKU B;  4IUU A;  1ARK A;  4CC2 A;  1BK2 A;  2CP0 A;  2V1R A;  4EMG A;  2FVU A;  1D09 B;  1Z9Q A;  2DZ9 A;  1U3O A;  4ZTJ A;  3VV0 A;  2OTJ T;  4C0F A;  4J9C A;  1N9S A;  4A54 A;  3M4Y A;  2DL7 A;  1S72 Q;  2F5T X;  3A8O B;  2DRM A;  3CCJ T;  3CCE T;  3JRZ A;  2LNH B;  1KJW A;  2BIV A;  3CCR Q;  5KH6 A;  2B86 A;  2LCL A;  1OX8 A;  1MMN A;  1KQ1 A;  4JPB W;  4OB3 B;  2EQM A;  1VQM Q;  1Y57 A;  2C0O A;  2R57 A;  3CCQ T;  3QWX X;  1VQ6 Q;  1TUD A;  2MMP A;  2K7A A;  1VQ7 A;  5KYW B;  1UTI A;  2RHY A;  3V8J A;  4AMC A;  4BB7 A;  2F69 A;  5LJ5 f;  3CPF A;  2JZ2 A;  1PD0 A;  2RH2 A;  5GAN 6;  3V8L A;  4ANJ A;  3VS3 A;  2EJ9 A;  2IPO B;  1G5V A;  2QQR A;  2F2X A;  3C12 A;  2EGA A;  2FPE A;  1ZBX A;  4RCB A;  3UAT A;  3BDL A;  4DBR A;  2CSQ A;  2CP7 A;  2K2M A;  5CQX A;  2QDY B;  2A37 A;  2DET A;  4DA4 A;  2DL5 A;  3TSZ A;  3LWI A;  1W6X A;  2H8H A;  4PJJ A;  2A08 A;  4YTL A;  1VQ9 Q;  3CC7 Q;  2CSI A;  2DJZ A;  1QKW A;  2RO0 A;  1GRI A;  1TWB A;  1WI7 A;  3PVQ A;  3A5Z B;  2ENM A;  3BY7 A;  2YSQ A;  4PJL A;  1WZO A;  1G8X A;  3A8M B;  2BZ8 A;  4A4G A;  2J7I A;  4JJN K;  1QCN A;  1B34 A;  4UC4 A;  2M0Y A;  2DXU A;  3M56 A;  4BUG A;  1M2O A;  1PSF A;  4OMN A;  5HCK A;  3IQL A;  1VIF A;  1BI0 A;  3EG0 A;  2K3B A;  2ATC B;  3VS1 A;  4MMK A;  4KRT A;  2E41 A;  4M77 E;  1AWO A;  2LQN A;  1K76 A;  2YRC A;  1JXO A;  1GCQ A;  1YWO A;  2IVW A;  4F7U B;  5M9O A;  1G2B A;  1BIA A;  1TUC A;  3QZ5 B;  4Y91 A;  1X43 A;  4FIB A;  4KT0 E;  1ZBJ A;  2D9T A;  3JB9 H;  3M0Q A;  2P0Q A;  1VQL Q;  4C5E A;  5FW9 A;  4FL6 A;  1QVG P;  3G6E A;  3SDZ A;  5A0G A;  3TSW A;  1XTD A;  3ZBD A;  4PK4 A;  1GCQ C;  2HKN A;  2F2W A;  1BIB A;  2LVM A;  5D6X A;  4M78 D;  1TUG B;  4J9B A;  2M51 A;  5AYF A;  3TCJ A;  2LX9 A;  4KGZ B;  1KQ2 A;  3CQT A;  2CP3 A;  1I5O B;  5CO7 A;  4XU3 A;  4AFQ C;  2EPD A;  1KQS S;  4C92 C;  4M78 B;  3AHU A;  1UB4 A;  1RAF B;  1Y96 B;  3NTI A;  3M9Q A;  1MMG A;  1IRE B;  1QVG A;  1GBR A;  1YFN A;  5CKF A;  2L3Q A;  4DBF A;  1IGU A;  4E47 A;  1VQK Q;  1UHF A;  2D6F A;  2DNU A;  4PJN A;  5I2S A;  2ZPE B;  2DIL A;  3G71 Q;  1VQN T;  3CCV Q;  1YIT Q;  3OYL A;  3QYG B;  1XQH A;  4IUT A;  4J9G A;  2DXB A;  2J06 A;  5GAM g;  3MEV A;  4M75 A;  2YT6 A;  3ZL7 C;  1W4S A;  1PRM C;  3EGU A;  1G3T A;  2X9H A;  1S72 A;  2ZPI B;  3G4S T;  4XTY A;  3J81 E;  1WX6 A;  1VQ8 T;  3EGD B;  2I0N A;  3CCR A;  3KUF A;  5L8R E;  3MEU A;  4Y28 E;  1WHK A;  1Y7X A;  1VUB A;  2KSS A;  4M7A F;  4DBQ A;  2GCX A;  4M75 C;  3EH1 A;  4LDU A;  3JB9 I;  5CVI A;  1CKA A;  3VRZ A;  4C8Q E;  1UGV A;  1VQM A;  3H8Z A;  1VQ6 A;  1R0B G;  2RQW A;  3OS0 A;  3I35 A;  4QKU A;  2LX7 A;  1YI2 T;  2QYZ A;  2X4W A;  2MAM A;  3SWN A;  2LNV A;  1RAH B;  1BI3 A;  4JJB A;  2AKL A;  2L3S A;  3REA B;  4A4K A;  2ZGW A;  4C5G A;  3MEA A;  1X2Q A;  1FWZ A;  2PUO B;  2NWM A;  2WSF E;  4LD9 K;  5A2Q E;  2O2O A;  2EQI A;  1UG1 A;  3CCM Q;  1JU5 C;  3SWN C;  3CC4 T;  2K5L A;  4LDW A;  2QEX Q;  5GAN 5;  4LNP A;  1PG5 B;  3UT1 A;  1VQ9 A;  3L2R A;  3RKY A;  3FLG A;  3QUI A;  3CC7 A;  2YUQ A;  3NHN A;  2DPP B;  1JRI A;  5CKE A;  3QDF A;  3FIF A;  3AT1 B;  1KD1 C;  1H92 A;  4KH0 B;  2KVQ G;  3EFR A;  1RAG B;  5GAO n;  1LNX A;  1OZ3 A;  1PHT A;  4HCK A;  2ROL A;  1W1F A;  1KK7 A;  2Y4X A;  2DVE A;  1Q82 U;  1MMA A;  1Q86 U;  3A8G B;  2LJ0 A;  2C0I A;  1Q82 R;  2DYB A;  3EGX A;  2K2V A;  1Q86 R;  4XTW A;  3EG9 B;  4FYX B;  3OYF A;  4M77 F;  2KXC A;  4J6X A;  3SEM A;  1NBE B;  2YUN A;  2R5M A;  3CCJ Q;  3CCE Q;  1TOV A;  2K9G A;  3L42 A;  3HSB A;  2X35 A;  5J39 A;  5L23 A;  1ZUU A;  2O4X A;  2EKH A;  1AHJ B;  4C92 E;  1GFD A;  3QG1 A;  4J6Y A;  2LZ6 B;  2O88 A;  1V76 A;  5GJV B;  2G3R A;  2A36 A;  2EYQ A;  3CCQ Q;  2OTL Q;  5CKH A;  3KBG A;  2KAF A;  2LQK A;  2QQA A;  2EYY A;  3HFN A;  4J6W A;  4C8Q B;  3RUX A;  3OYY A;  1VQL A;  4PJO D;  5IT9 E;  5AT1 B;  1WDX A;  1UHC A;  2EBP A;  2GBQ A;  3OYN A;  2DTO A;  2JS2 A;  4K11 A;  1VQO A;  4HCB A;  3S3M A;  4F17 A;  1ZSG A;  5CKD A;  5I22 A;  4PJO B;  2AK5 A;  2FYK A;  3EFO B;  4DEY A;  2AIR B;  3R6O A;  4MDW A;  1ACM B;  2YRD A;  2BE9 B;  3HHT B;  3VUB A;  1WGS A;  3PIP A;  3UWN A;  2XMF A;  1X69 A;  4M7D E;  2FEI A;  4C0G A;  4X9D A;  1VQK A;  1CKB A;  3E19 A;  3CPW A;  1K1Z A;  8AT1 B;  1AOJ A;  2GFA A;  2O01 E;  2C06 A;  2EQU A;  5GMK h;  1HJD A;  3G71 A;  3CCV A;  1YIT A;  2M02 A;  3ZEH A;  5GAN f;  1W2B S;  1FXX A;  2AKK A;  2KRM A;  2HEQ A;  3V7S A;  1IZ6 A;  4DEX A;  1VQ5 T;  2M16 A;  3JCM f;  2CH4 A;  4LN2 A;  1WJS A;  4XTU A;  1SF9 A;  1AZE A;  1S1N A;  3M53 A;  1Y96 A;  2OAW A;  1D0X A;  1PKT A;  1RAD B;  1MV3 A;  4GBQ A;  4M7A G;  2HKQ B;  1M27 C;  1QQJ A;  1X6O A;  2QAZ A;  2LJ1 A;  4ESR A;  2GTO A;  4PLI A;  3THK A;  1ZUK A;  1BCO A;  5GAO m;  2GNC A;  1GXI E;  2H3J A;  2QA4 T;  2EYW A;  4PFZ A;  3DLL A;  1LOJ A;  3ER0 A;  4VUB A;  3MKD A;  4IUP A;  2RHI A;  4HKE A;  2VV5 A;  2RI3 A;  3CCU T;  3NTK A;  3E2U A;  1WFW A;  3C95 A;  4BY6 B;  1M8M A;  4EMH A;  1X6B A;  2NUZ A;  2KT1 A;  5CKB A;  5GMK j;  3CCM A;  3OW2 P;  1C1A A;  1M2V A;  2A28 A;  2QEX A;  4ZGJ B;  3M58 A;  1WXU A;  2M0O A;  2EGE A;  2KEA A;  5HK3 A;  4P5N A;  1TSF A;  4M77 A;  3H0H A;  1NM7 A;  2C0T A;  2KMT A;  2COY A;  1RAB B;  3FJP A;  1BB9 A;  4AT1 B;  4M7D B;  5GMK e;  1GFC A;  1KSW A;  4FM4 B;  2QK0 A;  4DBH A;  3OY9 A;  2X3W D;  4J5Y A;  3LWH A;  3OW2 A;  4Z02 A;  1J3T A;  4IIM A;  4XTV A;  1VQN Q;  3SB2 A;  2I2L A;  4RG8 A;  4O6J A;  2VYT A;  4Z89 A;  3H0F A;  1ZSZ B;  4XAX B;  4ZN3 A;  3JAM E;  3G4S Q;  1UGQ B;  1YN8 A;  1V1C A;  3CCE A;  3CCJ A;  1RAA B;  2F2V A;  1NPP A;  1Q81 U;  4OB0 B;  2L2P A;  4M77 G;  4C92 F;  1K9M U;  1D0Z A;  1QLY A;  4N4H A;  1Q81 R;  1K9M R;  4PFO A;  2DKG A;  1SSH A;  1Z9Z A;  2RQR A;  3CCQ A;  2OTL A;  4N4I A;  4MML A;  2BE7 D;  2BZY A;  2KT8 A;  3QYH B;  2LJ3 A;  4CC3 A;  1YI2 Q;  2K79 A;  4ZGD B;  3QBY A;  1KD1 U;  4XTX A;  1KG1 A;  2VWF A;  5J26 A;  1JO8 A;  3CBP A;  3V8K A;  1KD1 R;  2PU9 B;  2RPN A;  1ZA2 B;  4Z88 A;  2COW A;  2NUT B;  2D8J A;  3L1A A;  4A53 A;  1U1S A;  4FCY A;  5GAN 3;  1HXD A;  2RQU A;  2E5Q A;  2EW3 A;  4FSS A;  4F7U E;  3FB9 A;  1TXQ A;  4RTW A;  3EG2 A;  3QKJ A;  4J9I A;  3CME T;  2ZAE A;  4M75 F;  2HBW A;  4AFS C;  2HBP A;  4LUE A;  3JB9 D;  1Q82 C;  2CS7 A;  1Q86 C;  1UGP B;  2RK2 A;  1G3Y A;  2DVJ A;  3OYM A;  2EJF A;  2NUP B;  3TEE A;  4N0A C;  4C8Q A;  3X28 B;  1YCY A;  2RHX A;  3RKX A;  1QVF S;  2XDD A;  2JTE A;  1ZA1 B;  3V7C A;  1VA7 A;  4XU0 A;  3I55 T;  1BYM A;  3V7R A;  4CC4 B;  2MOX A;  1E6H A;  2MK5 A;  1VOM A;  4M78 E;  4B9X A;  2HQH A;  2EYX A;  1UEB A;  1FMK A;  2YXY A;  4XU2 A;  2EFI A;  2X4J A;  2V26 A;  4J9H A;  4C8Q C;  1JQQ A;  1K0S A;  1BBZ A;  3VKI A;  2HZY A;  2DL4 A;  1G3S A;  2EAY A;  4FT4 A;  3JCM b;  3VRY A;  2JMC A;  2P4R A;  2LDM A;  4FYY B;  1YJW T;  3LLR A;  4FYV B;  2JVV A;  2EYZ A;  1I4K 1;  2NYS A;  1PCX A;  4KUD K;  3CMA Q;  4PJO C;  4PKC C;  2E10 A;  2CT4 A;  3JCM c;  2GQV A;  3TQ7 P;  4JLI A;  4JUV A;  1QVP A;  3G7Z A;  1SHG A;  4FT2 A;  2QTV A;  4CRI A;  1QCF A;  2JW4 A;  4HVV A;  1EZZ B;  1H3Z A;  3CXC S;  2CRE A;  3VS7 A;  2V1Q A;  2YUP A;  2L5Q A;  2VB6 A;  3NMZ C;  3EAE A;  5LJ3 f;  4ZN1 A;  3QII A;  4HT8 A;  1O75 A;  4Z8A A;  3X20 B;  4AG2 C;  4JZ3 A;  1QMC A;  5EC7 A;  1Q95 G;  5DY9 A;  3MPU B;  2QXF A;  1JB0 E;  1WIE A;  2PVD B;  3OSV A;  3GP8 A;  2XKO C;  3E9F A;  1H3H A;  4RKU E;  4BE1 A;  3S3N A;  3VS2 A;  2DEU A;  2DLP A;  2RNA A;  3NFC A;  1NLP C;  4C92 A;  1M1K U;  1WA7 A;  1MND A;  4RUG A;  5I21 A;  2L3P A;  3OYK A;  3CD6 Q;  5A0L A;  3CC2 T;  1VQO Q;  3A1P A;  4M7A D;  4NL2 A;  4OGC A;  1M1K R;  2W10 A;  4GY5 A;  1LJO A;  4C0Z A;  1VQN A;  1VQP T;  1WLP B;  3MET A;  2V8J A;  3M5A A;  3I5S A;  5KYY B;  3G4S A;  1VQ5 Q;  4E6R A;  5DLQ E;  2O31 A;  4Y92 A;  3HPW A;  1KFZ A;  1M9S A;  2CUB A;  3M0S A;  4BE0 A;  2E12 A;  4C92 G;  3PFS A;  4ORZ A;  2FZC B;  4C0D C;  4BY6 C;  1OU8 A;  2E6N A;  3VS0 A;  1MUZ A;  5HY6 A;  3I56 T;  4M7D A;  1MMD A;  1YCS B;  1YI2 A;  3M0U A;  3MP8 A;  5LJ5 h;  3I5R A;  7AT1 B;  5FLX E;  4KUL A;  4R55 A;  2DIQ A;  4F7U F;  2DXT A;  2DFU A;  4LDX A;  3QSU A;  5IXF A;  4JRQ A;  2EQJ A;  2GTJ A;  3CCU Q;  1HD3 A;  2J05 A;  2LP5 A;  3OB9 A;  5KYX B;  1KIK A;  4M7D C;  4OMO A;  4E2F B;  2B8A A;  5GMK l;  1N9R A;  1C0M A;  1QP3 A;  1I81 A;  2VXF A;  5FRO A;  3CCS Q;  1AT1 B;  2PVO B;  2JTM A;  4MZT A;  1WNL A;  3X24 B;  2R58 A;  2DK3 A;  4HT9 A;  2CH4 W;  1ZSZ C;  4M75 G;  2JXB A;  3EG3 A;  4QQ6 A;  1YHQ T;  1O9S A;  2JNG A;  3O8V A;  5FRN A;  5KYU B;  3OQ5 A;  1B3Q A;  4FSX A;  4M78 F;  5CR2 A;  5D7U A;  4PJO E;  3Q1J A;  1JJ2 P;  2Y4Y A;  4ZTF A;  2JTF A;  2HDA A;  2RHZ A;  1Q81 C;  3C94 A;  1K9M C;  1YJ9 T;  1D1B A;  4FW1 A;  4OMM A;  1QCO A;  3GF5 A;  3M4G A;  3M57 A;  5FU7 B;  5LJ5 j;  2JT4 A;  1BKB A;  1E7O A;  2LC4 A;  5LJ3 h;  1NEB A;  1BI1 A;  3H41 A;  3BDU A;  3LW5 E;  5D6Y A;  1JJ2 A;  1TTH B;  3OA6 A;  1M30 A;  2MIO A;  5KYW A;  3CMA A;  1SRL A;  2RJF A;  2JM9 A;  2YUO A;  2AZV A;  3UF4 A;  2PUK B;  3S6W A;  5FRM A;  1JEG A;  4IIO A;  5LJ5 e;  2OTJ Q;  4JJC A;  2DBK A;  2CKK A;  4EMK B;  1D0Y A;  2ZPH B;  3PTA A;  3MEW A;  3E9G A;  5I2M A;  2JUF A;  3HP9 A;  1EFN A;  2SEM A;  2RQV A;  2LQW A;  2MWP A;  2CZ1 B;  2KYB A;  2A0F B;  1TG0 A;  1AWW A;  4HCC A;  4HA8 A;  4NS5 A;  2FPF A;  2FPD A;  1FMW A;  4BDY A;  1TU0 B;  3A8H B;  3QWY A;  4RG2 A;  1HK9 A;  3JB9 J;  4J9D A;  4RTT A;  3J80 E;  3GBQ A;  3MO8 A;  4X1V A;  4J9F A;  1AWJ A;  1ABQ A;  1PM3 A;  2JMA A;  4XK8 E;  2K57 A;  1ZUY A;  4AFU C;  2QI2 A;  4GLK A;  5LJ3 j;  2GGR A;  1HYO A;  1N27 A;  1FMV A;  2KGT A;  3CD6 A;  4MZP A;  1A0N B;  1QWF A;  4WTO B;  3I55 Q;  4O5V A;  3MP6 A;  1VYU A;  1B07 A;  3VUZ A;  3VYH B;  5CCA A;  2DZC A;  1M90 U;  2DE0 X;  3HTR A;  5FU6 B;  5LJ3 e;  1VQ5 A;  3OYH A;  1VQ4 T;  1M90 R;  1G83 A;  3BE3 A;  2GQI A;  5GAN 8;  3REB B;  2DL3 A;  4F7U A;  5GAM f;  4HVW A;  1RUW A;  1M5Q 1;  3OYG A;  2VGM A;  4NL3 A;  1YJW Q;  1BCM A;  2MYS A;  2OX7 A;  2ABL A;  2MI6 A;  2L89 A;  1BU1 A;  1UGR B;  4GLM A;  4E7Z A;  1ABO A;  3MCA B;  4E7H A;  3OYE A;  1TS9 A;  2D1X A;  2KQW A;  4BI8 B;  1ZX6 A;  5IXB A;  1UUE A;  1I07 A;  3HRT A;  1QWE A;  2ESW A;  2FZG B;  1SPK A;  4F16 A;  8ATC B;  4J83 A;  4MZM A;  5CQY A;  1YNZ A;  2CZ7 B;  4F7U G;  3CCU A;  3KXT A;  2MWO A;  4X34 A;  3RMS A;  4M78 A;  4E7K A;  1LPL A;  4C8Q F;  1IB8 A;  2CDT A;  1SEM A;  1QVG S;  2D0N A;  4OVA A;  2J6O A;  4IUR A;  3SD4 A;  2DRK A;  2IG0 A;  2K6D A;  3VS5 A;  5LJ5 g;  1MHN A;  3CCS A;  3URG A;  2DTI A;  1M1K C;  4JRP A;  1FYN A;  1PNJ A;  2DD5 A;  4PJM A;  2BUD A;  2OJ2 A;  1LCK A;  4PJO F;  4KGV B;  4M78 C;  5HKC A;  4IUV A;  2QTX A;  2XID A;  4AFZ C;  1YP5 A;  4BI4 A;  1NYG A;  3MHX A;  2FZK B;  2JM8 A;  2VKN A;  1NJI U;  2X51 A;  3DB3 A;  3CC2 Q;  2VAS A;  1KQS P;  3INZ A;  2P4T A;  3H9N A;  2FO0 A;  1NJI R;  1VQP Q;  3QO3 A;  2DX1 A;  3EGD A;  2VVK A;  3KFV A;  1M1G A;  4Q5W A;  5HK0 A;  1YJN T;  3RDV A;  2YWW A;  5DM7 R;  2BKD N;  4JS5 A;  1Q7Y U;  3TVT A;  1OPL A;  4RTY A;  2PQW A;  4D6W A;  2RI2 A;  4EIK A;  1Q7Y R;  1KQS A;  2MF2 A;  3RMQ A;  3U23 A;  4XTZ A;  4OP0 A;  3P8B B;  1RAE B;  4FW2 A;  9ATC B;  3ME9 A;  2KNB B;  4DOW A;  5IN1 A;  2ECZ A;  3DB4 A;  4E7J A;  1NEG A;  2OTJ A;  3CBM A;  4M75 D;  1YWP A;  2QDL A;  5GAO p;  4JLG A;  1YIJ T;  2KBT A;  1VYT A;  2DYI A;  2CT3 A;  3QZ9 B;  2KRN A;  2CUD A;  3JCM Q;  1VQ8 Q;  3A8L B;  4M75 B;  1IXD A;  2NLU A;  4HCZ A;  2GF7 A;  1T3L A;  3F70 A;  1WQW A;  1R77 A;  2AHJ B;  4B9W A;  1X6G A;  2X3X D;  4JRI A;  2CZ6 B;  1UE9 A;  4E7I A;  2RA2 A;  3N5B B;  2E64 A;  2P84 A;  5GAM h;  3WXM B;  1DJ7 B;  5GAO q;  2HD0 A;  1YHQ Q;  2KRO A;  5FU7 C;  5IHI A;  1JBM A;  2P0P A;  2V8K A;  3PIO A;  3C4S A;  4EMK A;  2RD1 A;  4DQ2 A;  5KE2 A;  1K8A U;  1WYX A;  2DEQ A;  5ECA A;  4PLL A;  2K5F A;  3L2Z A;  3SWN B;  4RMO A;  3EG9 A;  3I55 A;  4E7L A;  4QVC A;  1K8A R;  5GAN h;  2YLC A;  3GLX A;  3X26 B;  1WHH A;  3CCL T;  1YJ9 Q;  4LD6 A;  1I5L A;  4J8O A;  1EX4 A;  4N0A A;  2E6Z A;  4M7D F;  4WCI A;  3RER A;  2IIM A;  4BI3 A;  3CC4 Q;  2HSE B;  1GL5 A;  2RN8 A;  1WXT A;  3JCM h;  1OQK A;  4EMK C;  5DLO A;  1GBQ A;  1YBY A;  1VYV A;  2XHC A;  2EQK A;  2KRS A;  2XDP A;  3UPU A;  2E3I A;  1IGQ A;  3EHQ A;  1M8V A;  1IHW A;  1I0C A;  3SFM A;  2ZZD A;  2LCS A;  1YJW A;  1WHM A;  1M1F A;  2QG9 B;  2MPX C;  4OMF B;  5I11 A;  2KXD A;  2OTL T;  4M7A E;  1UGS B;  4RTZ A;  3JCM V;  3WVD B;  1OOT A;  3G1J A;  5LJ5 d;  2PTK A;  3OYD A;  4FYW B;  3HRU A;  2FRY A;  4PJO A;  2LQ8 A;  4PFP A;  4KUI A;  2KR3 A;  3HL8 A;  4WF2 A;  5GAM j;  2WSC E;  4L59 A;  5CK9 A;  3EFO A;  3SHW A;  1ZHI A;  1ZQ1 A;  3FDR A;  3EGX B;  3OBW A;  1U06 A;  1G3W A;  2K3X A;  1VIE A;  2WAC A;  2VXE A;  4MDX A;  1OEB A;  1SG5 A;  4C8Q G;  1K9A A;  2HNI A;  2K5I A;  2FRW A;  2YLB A;  2X4Y A;  4J7F A;  2DIG A;  4A4H A;  3VJP A;  5GAN j;  1PWT A;  2A3L A;  3CPW S;  1PKS A;  5GAM e;  3OYJ A;  1VQ7 T;  5FU6 C;  2O4X B;  1JXM A;  3CEY A;  1N6A A;  4ELY C;  4PJO G;  2RMO A;  4B6M A;  4EPC A;  5KCH A;  1M90 C;  2K3Y A;  4BDZ A;  2G6F X;  2PVG B;  2XIC A;  2KYM A;  5FWC A;  5C0M A;  2COZ A;  4R56 A;  3CC2 A;  5GAN e;  2XD0 A;  3NGP A;  2QAS A;  1PC0 A;  4OB1 B;  1VQP A;  1KHI A;  3RES A;  1T0H A;  1PD1 A;  1D3B B;  3ULR B;  5A0D A;  5FWB A;  3L2W A;  3S3O A;  1XOV A;  3QJY A;  3JCM e;  3JB9 F;  2GFU A;  2XI9 A;  1OZ2 A;  3NPF A;  4ATO A;  1VQ4 Q;  3VS4 A;  1N8R U;  3RR6 A;  5LJ3 d;  3OYB A;  1UFF A;  4E7S A;  4QVZ A;  2CZ0 B;  3A98 A;  1N8R R;  4LXC A;  3JCM P;  2ZPG B;  1W2B P;  1P92 A;  3M0P A;  1OI1 A;  1X01 A;  3UDC A;  2DER A;  2KDS A; 
#chains in the Genus database with same CATH homology
 4XTU A;  3I56 A;  3PNW C;  3CMA A;  2F5T X;  3PGG A;  2RJF A;  3A8O B;  3M53 A;  1Y96 A;  3CCJ T;  3CCE T;  1V29 B;  1WJR A;  3JRZ A;  2ZCF B;  3TRE A;  2PUK B;  3S6W A;  5FRM A;  4M7A B;  5LJ5 e;  1FX7 A;  2BIV A;  5J3B A;  5KH6 A;  2HAX A;  2VC8 A;  3ZFJ A;  2CKK A;  4M7A G;  4EMK B;  3QDR B;  2ZPH B;  3GOX A;  1X6O A;  3VU3 C;  3PMT A;  3MEW A;  2LCL A;  3PTA A;  1VQ8 A;  4XQ3 A;  3RIR A;  4PLI A;  3E9G A;  1W2B A;  1KQ1 A;  2JUF A;  5I2M A;  3HP9 A;  3M55 A;  4OB3 B;  3QJ6 A;  5GAO m;  1I8F A;  2RHU A;  2MWP A;  2CZ1 B;  2EQM A;  1GXI E;  3CCQ T;  2CYZ B;  2R57 A;  2H3J A;  2QA4 T;  2MMP A;  4HA8 A;  4HCC A;  1WQ7 A;  3DLL A;  1LOJ A;  1VQ7 A;  3ER0 A;  4NS5 A;  4VUB A;  2RHY A;  3V8J A;  1NJI C;  4IUP A;  2YHT A;  2RHI A;  4HKE A;  2F69 A;  2VV5 A;  3CPF A;  3P8D A;  4BB7 A;  5LJ5 f;  4BDY A;  2JZ2 A;  2RI3 A;  3A8H B;  3NTK A;  3CCU T;  2RH2 A;  5GAN 6;  4RG2 A;  1HK9 A;  3C95 A;  4BY6 B;  3V8L A;  5KCO A;  3JB9 J;  5C6S A;  3OW2 S;  4EMH A;  4QW2 A;  4BD3 A;  3EFS A;  3J80 E;  1YHQ A;  2EJ9 A;  1NE8 A;  3MO8 A;  3VYG A;  3M59 A;  2QQR A;  1G5V A;  5CKB A;  5GMK j;  3CCM A;  3C12 A;  3JCM J;  2HQE A;  3G6E T;  1ZBX A;  2QEX A;  4RCB A;  3BDL A;  4XK8 E;  2K57 A;  5CQX A;  4ZGJ B;  3M58 A;  2M0O A;  2QDY B;  3LGF A;  3OS2 A;  2QI2 A;  4GLK A;  2DTH A;  5LJ3 j;  5HK3 A;  3OYA A;  4DA4 A;  1Q7Y C;  3LWI A;  4P5N A;  1N27 A;  4M77 A;  1XNI A;  1YJ9 A;  3CD6 A;  2X4X A;  4YTL A;  4MZP A;  4KBM B;  2KMT A;  2XG8 D;  2ZPF B;  3FJP A;  4OF1 A;  3CC4 A;  2DJZ A;  4M7D B;  4O5V A;  3MP6 A;  5GMK e;  2RO0 A;  4FM4 B;  4EDU A;  3VUZ A;  1KHC A;  2LRQ A;  1M90 U;  4M7D G;  2JOY A;  1K73 C;  3VYH B;  3OY9 A;  5CCA A;  3A5Z B;  2DZC A;  4J5Y A;  3LWH A;  3OW2 A;  1KC8 U;  3BY7 A;  4Z02 A;  2QQS A;  4A4E A;  2E65 A;  3OS5 A;  5GAN 2;  4XTV A;  3SB2 A;  5FU6 B;  2I2L A;  4M77 D;  4RG8 A;  3PT9 A;  5LJ3 e;  1VQ5 A;  4O6J A;  3OYH A;  3OMG A;  2VYT A;  1VQ4 T;  2D0Q B;  2RB6 A;  2VGN A;  3A8M B;  5GAN g;  2FL7 A;  4FU6 A;  3FC3 A;  1WJQ A;  5GAN 8;  5GAO l;  2RI5 A;  4A4G A;  4ME7 A;  4XAX B;  4ZN3 A;  3JAM E;  4F7U A;  5GAM f;  1UGQ B;  1M5Q 1;  1BI2 A;  3OYG A;  4M77 B;  3CCE A;  3CCJ A;  2VGM A;  3JCM g;  4NL3 A;  1NPP A;  4JJN K;  1B34 A;  4UC4 A;  4OB0 B;  1Q81 U;  4M77 G;  2DXU A;  3OYI A;  4C92 F;  3M56 A;  2MI6 A;  1K9M U;  2L89 A;  3FEO A;  4BUG A;  1UGR B;  1PSF A;  2KK4 A;  3MCA B;  4N4H A;  3HKS A;  2Y90 A;  4E7H A;  3OYE A;  1VIF A;  1BI0 A;  2KQW A;  1S72 T;  4BI8 B;  2DKG A;  2YRV A;  4J7I A;  3LX7 A;  4MMK A;  2M1H A;  2OAU A;  2E41 A;  4M77 E;  3CCQ A;  2OTL A;  4N4I A;  4LDX A;  1OYX A;  3GNF B;  4MML A;  2RJD A;  3HRT A;  3PMI A;  3QYH B;  3CCR T;  4X9C A;  4ZGD B;  2IVW A;  4F7U B;  5M9O A;  3QBY A;  4J83 A;  1KD1 U;  4XTX A;  4MZM A;  1BIA A;  5CQY A;  2CZ7 B;  3QZ5 B;  1KG1 A;  4F7U G;  1EIF A;  4Y91 A;  3CCU A;  3KXT A;  2MWO A;  4X34 A;  3RMS A;  4M78 A;  3OYC A;  4E7K A;  3OA6 A;  4C8Q F;  4FIB A;  5J26 A;  3CBP A;  1QVG S;  3V8K A;  4KT0 E;  2PU9 B;  4OVA A;  1VQM T;  1K8A C;  2D9T A;  3JB9 H;  4IUR A;  3SD4 A;  2IG0 A;  4IKF A;  1VQ6 T;  1H64 1;  2P0Q A;  4C5E A;  5LJ5 g;  1MHN A;  4FL6 A;  3CCS A;  3L1A A;  4A53 A;  4QQG A;  3SDZ A;  1U1S A;  3URG A;  5A0G A;  3G6E A;  2DTI A;  1M1K C;  5GAN 3;  1XTD A;  1HXD A;  3ZBD A;  4JRP A;  1R8O B;  2E5Q A;  4ZGE B;  5KE3 A;  2FB7 A;  4F7U E;  2DD5 A;  4II1 A;  1BIB A;  2LVM A;  3FB9 A;  2BUD A;  5D6X A;  4M78 D;  1Y71 A;  3QKJ A;  4PJO F;  5AYF A;  4M78 C;  5HKC A;  4IUV A;  2QTX A;  2XID A;  2LX9 A;  3TCJ A;  1KQ2 A;  3CME T;  4M75 F;  5CO7 A;  2HBP A;  3JB9 D;  4BI4 A;  5EG2 A;  4XU3 A;  1Q82 C;  2CS7 A;  3MHX A;  4PNO A;  3QPH A;  1KQS S;  3OSS C;  4C92 C;  4M78 B;  1NJI U;  1Q86 C;  3AHU A;  1UGP B;  3DB3 A;  3OBY A;  1UB4 A;  2RK2 A;  1Y96 B;  3GNG A;  1G3Y A;  1M4Z A;  1IRE B;  3M9Q A;  3NTI A;  3OYM A;  2V8I A;  2P4T A;  3INZ A;  2EJF A;  1QVG A;  5CKF A;  3TEE A;  4N0A C;  4C8Q A;  3X28 B;  1YCY A;  2RHX A;  3RKX A;  3QO3 A;  4E47 A;  1QVF S;  2XDD A;  2QQ9 A;  3JB9 G;  1VQ4 A;  1VQ9 T;  2D6F A;  2M9U A;  3V7C A;  4CI0 C;  4XU0 A;  3I55 T;  3CC7 T;  1BYM A;  3V7R A;  1M1G A;  3GPL A;  4OB2 B;  4Q5W A;  5HK0 A;  1YJN T;  3BW1 A;  5GAN 7;  5I2S A;  3QXE B;  2BKD N;  5DM7 R;  4M78 E;  4JS5 A;  2ZPE B;  4B9X A;  2JN0 A;  2KY9 A;  1Q7Y U;  1UEB A;  4XU2 A;  1VQN T;  2EFI A;  2X4J A;  4C8Q D;  3OYL A;  4OGE A;  1WPY A;  3QYG B;  3CMA T;  2PQW A;  1XQH A;  4IUT A;  2DXB A;  2A7Y A;  4C8Q C;  2RI2 A;  4D6W A;  5GAM g;  3WVE B;  3MEV A;  2MF2 A;  4M75 A;  3RMQ A;  1KQS A;  3VKI A;  1W4S A;  4XTZ A;  1G3S A;  1G3T A;  2EAY A;  4FT4 A;  5GAN 4;  4OP0 A;  3P8B B;  1QW1 A;  1S72 A;  2ZPI B;  3G4S T;  3JCM b;  4XTY A;  3J81 E;  2LT1 A;  2LDM A;  3FRN A;  3ME9 A;  1YJW T;  3LLR A;  1VQ8 T;  4JS4 A;  2JVV A;  1QVF A;  5D6W A;  4DOW A;  5IN1 A;  3DLM A;  1I4K 1;  3DB4 A;  4E7J A;  3LH0 A;  3CCR A;  3KUF A;  4KUD K;  5L8R E;  1PSE A;  2OTJ A;  4PJO C;  3CBM A;  3MEU A;  1D3B A;  3JSC A;  4PKC C;  4Y28 E;  1Y7X A;  4M75 D;  1VUB A;  2E1H A;  2E10 A;  5CAI A;  2KSS A;  4BE2 A;  4DOV A;  4C5H A;  4M7A F;  3JCM c;  2GCX A;  2GQV A;  4M75 C;  4JLI A;  4JUV A;  5GAO p;  4JLG A;  1RI0 A;  4LDU A;  3JB9 I;  1YIJ T;  1Y07 A;  1QVP A;  5CVI A;  2E70 A;  3LGL A;  4RCC A;  3G7Z A;  4C8Q E;  3QZ9 B;  1VQM A;  3JCM X;  3JCM Q;  3A8L B;  3L2U A;  3H8Z A;  1VQ6 A;  1U1T A;  4FT2 A;  2F5K A;  4M75 B;  4CRI A;  2NLU A;  3OS0 A;  4HCZ A;  1YI2 T;  1H3Z A;  3CXC S;  2GF7 A;  2X4W A;  3CBO A;  3F70 A;  1WQW A;  2MAM A;  2L5Q A;  2ZPB B;  3SWN A;  3RKW A;  2LNV A;  3EAE A;  2AHJ B;  1BI3 A;  4B9W A;  5LJ3 f;  4LDY A;  4ZN1 A;  3QII A;  4HT8 A;  4A4K A;  2EIF A;  2CZ6 B;  4JRI A;  4E7I A;  1O75 A;  2ZGW A;  5GAM d;  4C5G A;  2RA2 A;  3X20 B;  3MEA A;  1VQL T;  2DD4 A;  1FWZ A;  1QP2 A;  1SSF A;  2PUO B;  3BFM A;  2QA4 A;  2WSF E;  4M75 E;  4LD9 K;  3N5B B;  3X25 B;  2E64 A;  4IUQ A;  5DY9 A;  5GAM h;  5A2Q E;  3WXM B;  1DJ7 B;  1U8R A;  2QXF A;  5GAO q;  3CD6 T;  1JB0 E;  2HD0 A;  3QHS A;  2XK0 A;  1VQO T;  2PVD B;  3OSV A;  5FU7 C;  3GP8 A;  1JBM A;  2P0P A;  3SWN C;  3L2Q A;  2XKO C;  4M7A A;  1N8R C;  2V8K A;  3CC4 T;  1B34 B;  2K5L A;  3E9F A;  3PIO A;  4LDW A;  5GAN 5;  3C4S A;  4RKU E;  4EMK A;  4BE1 A;  3S3N A;  2RD1 A;  4DQ2 A;  5KE2 A;  1K8A U;  2RK1 A;  3OMC A;  5GAN d;  2DEQ A;  4M7D C;  2DO3 A;  4PLL A;  2K5F A;  3UT1 A;  3CXC A;  1VQ9 A;  3NTH A;  3L2Z A;  3L2R A;  3SWN B;  3NFC A;  4RMO A;  3RKY A;  1TH7 A;  3FLG A;  3QUI A;  4C92 A;  4QVC A;  3I55 A;  3CC7 A;  4E7L A;  1M1K U;  2DPP B;  1JRI A;  5CKE A;  5GAN h;  2YLC A;  3GLX A;  3X26 B;  5I21 A;  3CCL T;  3OYK A;  3TU4 K;  5A0L A;  4LD6 A;  1I5L A;  3CC2 T;  3JCM d;  4J8O A;  5GMK m;  4M7A D;  4NL2 A;  4OGC A;  3FIF A;  4N0A A;  2E6Z A;  1KD1 C;  4M7D F;  3RER A;  2KVQ G;  1LJO A;  2DXC A;  3EFR A;  4GY5 A;  4BI3 A;  4C0Z A;  2VUB A;  5GAO n;  1VQP T;  1VQN A;  1LNX A;  4M7A C;  4N4G A;  1OZ3 A;  5GMK i;  3JCM h;  3MET A;  1VQK T;  2V8J A;  4EMK C;  3M5A A;  5DLO A;  3MP1 A;  1YBY A;  2XHC A;  2Y4X A;  2DVE A;  1Q82 U;  4C92 D;  2EQK A;  3DKM A;  2XDP A;  4PL6 A;  3UPU A;  1Q86 U;  3A8G B;  3M54 A;  3G4S A;  1M8V A;  3SFM A;  2RJC A;  2ZZD A;  5DLQ E;  5GAO r;  4C5I A;  4M78 G;  1YJW A;  2XDB A;  3G71 T;  3T9N A;  3CCV T;  1M1F A;  2EJG A;  2K2V A;  1YIT T;  4XTW A;  3OYF A;  4C92 B;  2L8D A;  3HPW A;  1M9S A;  4J6X A;  4M77 F;  4OMF B;  4BE0 A;  2E12 A;  2R5M A;  4C92 G;  1NZ9 A;  3PFS A;  2LTO A;  4XU1 A;  2OTL T;  4C0D C;  3L42 A;  4M7A E;  1UGS B;  2EKO A;  4NOY A;  3JCM V;  2CGH A;  4BY6 C;  1YIJ A;  3HSB A;  2E6N A;  3WVD B;  2X35 A;  5LJ5 d;  5HY6 A;  5J39 A;  3OYD A;  3I56 T;  3HRU A;  4M7D A;  4C0D B;  4PJO A;  2LCC A;  2LQ8 A;  2O4X A;  4KUI A;  3HL8 A;  4WF2 A;  4JDS A;  1AHJ B;  4L5G A;  5GAM j;  2WSC E;  2XU8 A;  4C92 E;  1YI2 A;  1X75 C;  3MP8 A;  3QG1 A;  4J6Y A;  4L59 A;  5CK9 A;  5LJ5 h;  2G3R A;  4L6V 5;  1ZHI A;  2EYQ A;  1ZQ1 A;  3FDR A;  5CKH A;  5FLX E;  4KUL A;  3CCS T;  3KBG A;  3OBW A;  2KAF A;  2LQK A;  1G3W A;  2QQA A;  2K3X A;  3HFN A;  4J6W A;  4ELZ C;  4R55 A;  2DIQ A;  4F7U F;  2DXT A;  4C8Q B;  1VIE A;  2WAC A;  1K73 U;  3RUX A;  3OYY A;  2EQJ A;  4JRQ A;  2VXE A;  3QSU A;  2RM4 A;  4MDX A;  2L3R A;  4C8Q G;  4M7D D;  2HNI A;  1VQL A;  2K5I A;  2YLB A;  5IAY A;  4PJO D;  3ASK A;  2R5A A;  5IT9 E;  1NPR A;  2X4Y A;  3OB9 A;  2DIG A;  4J7F A;  2FHD A;  4A4H A;  5LJ3 g;  2QQB A;  3HFO A;  3VJP A;  3GIB A;  2B8A A;  5GMK l;  1N9R A;  3OYN A;  2DTO A;  1QP3 A;  2A3L A;  3CPW S;  4A4F A;  5GAN j;  1I81 A;  2EWN A;  1VQO A;  5LL6 S;  4HCB A;  1MGQ A;  5GAM e;  3S3M A;  2VXF A;  5FRO A;  4LDV A;  5CKD A;  3OYJ A;  3P8H A;  3L2V A;  2PVO B;  3J7A F;  5CIU A;  4PJO B;  4QQD A;  1VQ7 T;  5FU6 C;  2O4X B;  2JTM A;  4MZT A;  3CEY A;  1N6A A;  4ELY C;  1RL2 A;  4PJO G;  4V2S A;  4EPC A;  2FYK A;  1WNL A;  5KCH A;  3X24 B;  1KC8 C;  1M90 C;  2K3Y A;  2DK3 A;  2PVG B;  2R58 A;  3R6O A;  4BDZ A;  2XIC A;  4MDW A;  2WSE E;  4HT9 A;  3E1S A;  4M75 G;  4QQ6 A;  5C0M A;  3CCL A;  4JRK A;  4R56 A;  1YHQ T;  3CC2 A;  1O9S A;  3HHT B;  4M77 C;  2JNG A;  3O8V A;  3VUB A;  3CCM T;  1WGS A;  5GAN e;  5FRN A;  3OQ5 A;  1JJ2 S;  4FSX A;  3PIP A;  2P0K A;  2QEX T;  2K4Y A;  4M78 F;  3UWN A;  5CR2 A;  2XD0 A;  4OB1 B;  1VQP A;  4C0G A;  4M7D E;  1KHI A;  3RES A;  4BAC A;  4PJO E;  3Q1J A;  4X9D A;  1VQK A;  2Y4Y A;  3CME A;  2HQX A;  4ZTF A;  1D3B B;  3L2W A;  5A0D A;  3S3O A;  4QVD A;  1XOV A;  2JTF A;  3H6Z A;  3E19 A;  3QJY A;  2LT4 A;  3JCM e;  3OS1 A;  3CPW A;  2RHZ A;  3JB9 F;  2GFU A;  2XI9 A;  1Q81 C;  2DAQ A;  2GFA A;  3C94 A;  2RJE A;  1OZ2 A;  2O01 E;  3LYI A;  4TVR A;  3JCM W;  1K9M C;  1YJ9 T;  2C06 A;  3HRS A;  4IUU A;  2EQU A;  4ATO A;  5GMK h;  1N8R U;  3G71 A;  5LJ3 d;  3OYB A;  3CCV A;  1YIT A;  4QVZ A;  3GF5 A;  3M4G A;  3ZEH A;  2CZ0 B;  4EMG A;  5GAN f;  1W2B S;  1FXX A;  3M57 A;  2FVU A;  5FU7 B;  5LJ5 j;  1BKB A;  2LC4 A;  5LJ3 h;  2DZ9 A;  3JCM P;  3V7S A;  1BI1 A;  1IZ6 A;  2ZPG B;  4ZTJ A;  1P92 A;  3VV0 A;  3BDU A;  3LW5 E;  2OTJ T;  5D6Y A;  4C0F A;  1VQ5 T;  1JJ2 A;  1YJN A;  2M16 A;  3JCM f;  1OI1 A;  1N9S A;  1X01 A;  3UDC A;  1WJS A;  4A54 A;  3M4Y A;  2KDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...