2Y4YA

Structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
82
Chain Sequence
IKPDETRVKQFLEGFNIETFEMVGTLSNAQGTFALVKGAGGVHRVRVGDYLGRNDGKVVGISKIDVIEIVPWLERPRSLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Biosynthetic protein
molecule keywords PILP PROTEIN
publication title Structure of a Domain from the Type Iv Pilus Biogenesis Lipoprotein Pilp, from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 12
structure length 82
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2y4yA00
2IVWA 3OSSC 2Y4XA 2LC4A 2Y4YA 2LNVA
chains in the Genus database with same CATH superfamily
2DXUA 4OB0B 2QYZA 4RG2A 1QWEA 4F7UB 3M0PA 2GTOA 3OBWA 1V29B 1BYMA 2KT1A 3SWNA 5GMKm 1M90U 4F7UE 4JJDA 2AK5A 3I9QA 1WHHA 2HQXA 1Q82C 1VQ9Q 4XTVA 1JJ2P 2FRYA 1WXTA 3JB9F 3VU3C 1D09B 1YITA 3FC3A 1SEMA 2PVOB 2ZGWA 8AT1B 1Q81U 3QSUA 2FPDA 1M3CA 3CCRA 4KULA 5D6WA 2XKOC 1KFZA 2FG0A 2YUQA 4PKCC 1VQMT 3ZL7C 4C0ZA 4GBQA 4KH0B 1PC0A 4M77A 4J9DA 3VRZA 4EDUA 3AHUA 1QVFS 3FB9A 2ESWA 2CP7A 2DL3A 1WI7A 3M4GA 3CC4Q 3TEEA 1VQPQ 3EGXA 5GAOl 4ZGDB 1I07A 4WTOB 2ABLA 3FLGA 3QPHA 1QVGP 3CCQA 3R6NA 1RI9A 5GAMf 3H9NA 2A3LA 2DD5A 3E9GA 2BZ8A 2CZ1B 1C0MA 2EQIA 3HP9A 1VYVA 1M27C 4O6JA 2SRCA 1K4US 1X01A 1Z9QA 1VQKT 4M78B 4Z02A 4J5YA 2C06A 4WCIA 3CXCP 4PJMA 2B86A 1M30A 4FW2A 3QIIA 3RUXA 4M7AA 1HYOA 2ZPIB 3JCMb 4ZTFA 4C92B 2YDLA 2VYTA 1M90R 3RMQA 1KQSP 2RJEA 2DILA 4IUQA 2DETA 5FU7C 1W2BP 4QVCA 4MMKA 1MGQA 2DBMA 2KRSA 1R0BG 1Y71A 2NUPB 3QJ6A 2DTOA 3KUFA 3QJYA 4FYXB 2YT6A 3J7AF 2DFUA 4FW1A 2YWWA 4CC7A 3NGPA 5IHKA 2RK2A 4HCZA 2EYXA 4C8QG 4EMKB 1U8RA 2DO3A 3MKDA 3CMEA 2F2XA 2BZXA 3OYCA 1Y96B 3G4SA 2PTKA 2L3PA 1GBQA 2RQWA 3JB9D 4A54A 2DA9A 3OYYA 1NLOC 2HL5C 2ROLA 2KROA 1KIKA 2CREA 1W1FA 1Q82U 2COZA 4A4HA 2O31A 2BKDN 2PNIA 3CC2Q 1SSHA 1SRMA 5IN1A 5GAOq 3OYIA 3X20B 4KT0E 5GAN6 2NLUA 4J9BA 4OMOA 5GANj 2QXFA 2QAZA 1MMAA 2EFIA 3CCUQ 1I1JA 4C8QF 1UEBA 1WHMA 3L2WA 3JAME 1W70A 3ZFJA 2DAQA 2RHYA 1O9SA 2EGAA 2JS0A 4XTZA 3VS6A 2K2MA 4JRIA 3CMET 1PHTA 1T0JA 2E6NA 2R57A 1BCOA 2K57A 1JU5C 2ZAEA 1YCYA 1XTDA 4C0GA 2LC4A 3RKXA 1U1SA 1H92A 4OB2B 4E7LA 4XQ3A 2WSCE 1H3HA 4LDVA 2A28A 2ECZA 1OPLA 1TWBA 3OW2A 2A08A 2YRVA 4M77G 3UDCA 4LUEA 5GAMh 2D0QB 2XD0A 3OBYA 2MPXC 1HJDA 2XDPA 3S3MA 3DB3A 4O5VA 2VGMA 1QVPA 4N0AA 1UFFA 1NYGA 1ZSZC 1VQ9A 4JRQA 4L6V5 4PK4A 5KYNA 3L2UA 5GAMg 4CC2A 2JNGA 2PVGB 1TU0B 4HVVA 1JJ2S 4OMMA 2XU8A 3QDRB 4KH1B 2LJ3A 4R55A 4N4HA 1BI1A 2MWOA 2RD1A 1MNEA 4FIBA 5D6YA 1RAAB 3CCLQ 1TUGB 5M9OA 3THKA 2JM8A 1N27A 1C1AA 3QKJA 2CP0A 4A4EA 2LX7A 2DXBA 2M51A 1FYNA 4AFZC 3CC4A 4NS5A 1ZUYA 4J7FA 3UATA 2D0NA 4M7AG 1K76A 1KD1R 4M7DB 1E6GA 2NWMA 1BB9A 3CCEA 1SRLA 5IXBA 2KYBA 2X3XD 3LX7A 1LCKA 3LWHA 1VQ7Q 1B07A 3HL8A 4CC4B 2GTJA 1VQ9T 2QGGA 1QVGS 1RADB 1RLPC 2DMOA 2JJ9A 2ZPEB 1R0CB 1IXDA 3F70A 1IRXA 5FLXE 4FSXA 4E6RA 2Y4YA 1JB0E 4C8QD 1CSKA 4BI8B 1AWXA 5CO7A 4C8QE 1HXDA 1K73U 3L2QA 3CXCS 4M78A 3FJ5A 2RHXA 2YUNA 1V76A 2KI7A 3JSCA 4A4KA 5FRNA 4FU6A 3X28B 3CCVQ 1M1KC 1BK2A 1VQPT 2KT8A 3GBQA 2K5FA 3P8DA 1KQSS 3OYGA 4JS5A 4C92A 1JQQA 1X2QA 1YJNQ 3JV3A 3GNGA 5CKFA 2RI5A 1W2BS 2LCSA 2HKQB 1TUDA 2XDBA 2XK0A 2EKHA 2LQNA 2VC8A 1Y57A 2NUPA 3PMIA 4WF2A 5GAMe 2EJ9A 2A7YA 1SPKA 1KQ2A 2KXCA 4PJOC 4QQDA 1UUEA 1I5OB 2XG8D 4RKUE 2ENMA 1VIFA 4RCBA 1GXIE 1Y96A 1OV3A 3UA7A 2YRCA 1KQSA 4XAXB 3CC2A 5GMKl 2E10A 3RKWA 2BE7D 3V8KA 2E3HA 1W2BA 4L5GA 3OMGA 2DYIA 3MEWA 1GRIA 4M77B 1ZQ1A 4Z8AA 4J8OA 3CCUA 1E6HA 1JEGA 1ZUKA 4BE1A 4M77E 1Q7YR 3CCRQ 2DZ9A 4QVZA 3QBYA 1RABB 1UTIA 1N9SA 4J7IA 1M2OA 4LDUA 2HDAA 4Q5WA 1WNLA 1I8FA 1ARKA 4XU1A 2AT1B 3MP8A 2CZ7B 2GFAA 2QA4T 2HL3A 1K73R 2D9TA 2I2LA 2ZZDA 3CMAQ 1WPYA 1TSFA 5IAYA 2QQAA 3TQ7P 4BACA 1VQOQ 4V2SA 5GMKi 3WVDB 4KBMB 4OB1B 3CC7Q 1MUZA 3BDLA 3G7ZA 2L3QA 2QDLA 2OI3A 1B3QA 4PLIA 3CCQQ 4ELZC 1U5SA 5CVIA 4FYYB 4JLIA 1G5VA 1QLYA 3LH0A 1M90C 2DTHA 3FRNA 1RAIB 4X34A 2CH4W 4M7AB 2GFUA 3VYHB 3QDFA 4PJJA 2DXCA 4DBFA 4F7UF 2FPEA 1G3WA 4M7AE 2J6OA 3QUIA 1I5LA 2AZVA 1AWJA 1NYFA 2COYA 1X75C 3C94A 4JRKA 1M1KU 4J9EA 4M75B 4BI3A 1X27A 1KK7A 3QZ5B 5I2MA 2QEXA 4E7KA 2IPOB 5FU6C 4QKUA 3X26B 5D6XA 4D8KA 2H3JA 4HCCA 3GLXA 1OEBA 1M3BA 2YHTA 3PGGA 4AFSC 4M78G 3UF4A 4E7ZA 1SKUB 1YJWT 2E5QA 5GANf 2YLCA 3H0HA 2NUZA 1VQ7A 1YN8A 1H3ZA 1QCOA 4C92G 4XTXA 5IXFA 2RPNA 4M7DA 3GP8A 2B8AA 1UE9A 4FM4B 4BUGA 3OW2P 1PRMC 2PU9B 2K3YA 2RNAA 1MMGA 2KVQG 4F17A 1Q86U 4CI0C 4C0DC 4LUDA 5GANd 4CC3A 1YI2Q 1O75A 1JO8A 3DKMA 3V7RA 3CCLT 2JM9A 1RAEB 1YCSB 4MDWA 4BDZA 3UA6A 2DF6A 2DTIA 1VIEA 2J6KA 3CEYA 4M78F 3TSWA 4F16A 3GOXA 4MDXA 2FHDA 2OTLQ 5KCOA 1YJNA 2M1HA 2E3IA 4PFZA 4MZMA 2QTXA 2M16A 5CIUA 3G6EQ 4CRIA 3VS1A 4IUUA 5KYWB 1VQ7T 1WYXA 2CT4A 2VB6A 1V1CA 3RMSA 4QW2A 2MCNA 2DX1A 2DXTA 2JUFA 2KMTA 5HK0A 4NOYA 3QYHB 3I56Q 2PZ1A 3VUZA 2ZPGB 2GNCA 5GMKj 4FT2A 2EGCA 2C0IA 2VUBA 3URGA 1UGQB 3V8LA 1VQNA 3RR6A 3DB4A 4Z88A 3CCVT 2G3RA 2XIDA 3TVTA 3EG1A 2ZCFB 1X69A 4YTLA 3G71Q 1YJNT 3EG0A 3OSVA 1KD1C 2CKKA 3HKSA 1D0XA 4ANJA 3GNFB 1Q86R 2KXDA 1ZX6A 2RB6A 2FB7A 3R6OA 2LT4A 2L2PA 3H41A 3HTRA 1WXBA 3RIRA 3CMAA 2DL8A 4B9XA 1EX4A 2QG9B 5AYFA 4LD9K 1TTHB 1VQOA 1MMDA 2DVEA 2LZ6B 3MP1A 5GANh 3BDUA 3PIPA 2LQKA 3CC7A 3ER0A 2NYSA 4JJCA 2D8JA 2YUOA 3CCEQ 3EG9B 4XTUA 2FZGB 2YUPA 1G83A 5DM7R 3PNWC 1XQHA 2LMJA 1OOTA 3PT9A 3M56A 3CBPA 2OAWA 5DLOA 2R5AA 5GANg 2CGHA 1XJWB 2O4XB 4OB3B 2MK5A 1YITT 1FWZA 4M78D 1HSQA 4DBQA 4OF1A 3CCRT 2G6FX 4M78E 2BE9B 5GAOn 3EFOB 4B6MA 4JLGA 7AT1B 3HRSA 4M4ZA 4KRTA 3SHWA 4M7DG 3EFRA 5CK9A 1GL5A 3FJPA 2KY9A 2F1LA 1E7OA 1U3OA 1K0XA 4LXCA 4C92E 3CMAT 6AT1B 2JMAA 4C5HA 2HSPA 3A5ZB 3LW5E 4PNOA 4RCCA 3CCSQ 1ZA1B 1LJOA 3CC7T 3SB2A 3CD6A 3KBGA 4OMNA 2CT3A 1OU9A 4M75A 3ME9A 2JS2A 1TXQA 1VQ8A 3HPWA 3CCQT 2CP5A 2WACA 4JZ3A 1TOVA 2KRMA 1MV0B 1NEGA 2ROTA 2EPDA 4J6WA 2COWA 3EG2A 1X6OA 3OYDA 2E65A 1Y0MA 1OZ2A 5LJ3f 4E7JA 4RTYA 2K2VA 4M7DF 3JCMW 1Q7YC 3H8ZA 2KEAA 5I2SA 1YI2A 3RDVA 2ED0A 2OTJQ 1IZ6A 1WJQA 4FCYA 2X35A 3SDZA 3OW2S 1PRLC 1LOJA 5KCHA 3REBB 1UJYA 4AFQC 1K73C 1YHQA 2LCCA 2V1QA 5LJ3d 2K3BA 2OX7A 1NJIC 2MIOA 1KD1U 2OTLA 1T3SA 4ZN3A 2HEQA 1P92A 5GAN2 2E5KA 3G6EA 4OGEA 4KGXB 2L5QA 2ZPFB 3EHRA 1K9AA 2P0KA 5GANe 2OAUA 3G4ST 4F14A 4JJBA 4IIOA 2IIMA 4GY5A 3I56A 3FIFA 3NTKA 3EAEA 1YFNA 3QG1A 4C8QC 2HD0A 2EAYA 5KYWA 4ZTJA 1VQ6Q 1YI2T 3E9FA 1PM3A 5FU7B 3JCMV 5GAOp 1D1CA 2DL7A 2F2VA 2HNIA 4EIKA 2EYWA 2DBKA 1N6AA 1VYTA 1J3TA 1WZOA 2QK0A 3UWNA 3HRUA 4IIMA 3A8LB 3M0TA 3VS3A 2FYKA 2RQUA 3G71A 5ECAA 3JB9H 1NLPC 2DZCA 2CUDA 1T3LA 3RBBB 2XDDA 1OU8A 2F5TX 3G6ET 1X43A 2DJQA 4HXJA 3JB9J 3CPFA 2MOXA 2QQRA 3H6ZA 2FEIA 2QEXQ 4M77F 1UECA 2EKOA 5CKDA 1G3SA 4JRPA 3CPWA 4MZPA 2H8HA 3T9NA 4AG2C 1VQ4Q 3I56T 1OZ3A 4EMHA 1NE8A 2PVDB 2YLBA 2LP5A 2DYBA 3I55Q 2MI6A 4M7DD 1GBRA 2XHCA 5GAOm 4M7DE 4K11A 3I35A 5LJ3h 3GF5A 2V8KA 5C0MA 4XU0A 4MMLA 4M75G 1K0SA 3EG9A 1Q7YU 3M0RA 1UGVA 4DA4A 3G71T 4HT8A 1VQLQ 2EWNA 2O9VA 1VQ5Q 3M53A 3V8JA 2DKGA 2CP2A 3L42A 5HK3A 3META 1QQJA 4Y92A 4PFPA 4HCKA 5LJ3g 2O4XA 3OYKA 1K8AR 2RO0A 4M7AF 2LQ8A 2GF7A 3BE3A 4BD3A 3LWIA 1NJIU 3SD4A 3MEUA 3CC4T 4KUDK 4XTWA 2K5IA 2RM4A 3EFOA 1AD5A 2RHZA 4DBHA 2PUOB 3OY9A 3CCSA 2QGFB 5CKBA 1KC8R 5J26A 3V7CA 3HRTA 2V8IA 1S72Q 1YNZA 1ZSZB 1W4SA 4HVUA 3M0SA 2LVMA 2ED1A 2K3XA 1G8XA 1ZUUA 3CCET 1IHWA 2YRDA 4LE9A 8ATCB 2RI2A 5CAIA 4M75F 1IGUA 3NTHA 1IHVA 4OMFB 2XICA 1M2VB 1RLQC 3HSBA 4A4GA 2IVWA 2QQBA 1PNJA 3QXEB 4OMQA 2LJ1A 1BIAA 1ZBXA 1VQMQ 4RMOA 1SHGA 4OP0A 3KFVA 2CH4A 3I5RA 1KJWA 1RACB 2OTJA 1Q86C 1VQNQ 2YSQA 2AHJB 4HA8A 4RTZA 3OYBA 5C6SA 1IGQA 5J39A 1FMVA 3VUBA 4BY6C 4M77D 3CQTA 2F69A 4RTWA 4XTYA 5FWCA 1PD1A 1ZSGA 1UHCA 1BKBA 1RUWA 3S3OA 1LVKA 5LJ3j 4TVRA 5I22A 2M02A 2P4RA 4PFOA 1VQKQ 1GCQC 3E19A 2X4JA 3ULRB 2DIGA 1M8MA 2R5MA 1JXOA 2CP3A 2FPFA 1NJIR 1F1BB 5CQYA 2CSQA 4PJNA 1ABOA 1N5ZA 4OMLA 3CCMA 1N8RR 1VQ6A 5LJ3e 1MV3A 3MJXA 3Q1JA 2DRMA 5KYUB 3OSSC 3CC2T 2EQUA 2EW3A 3OA6A 2O9SA 3EH1A 4ZGEB 2J05A 4C5GA 3OYAA 2KBTA 4HKEA 3MP6A 3JCMQ 4M7AD 1RAHB 3VKIA 3CCUT 1OPKA 5FW9A 2O01E 3OS0A 3LH5A 5GMKh 2X4YA 4IURA 1WLPB 2LJ0A 4BI4A 2KAFA 1X2KA 1WIEA 1RL2A 4R56A 1WQWA 2KGTA 4PJOB 1B7TA 4LDYA 1UG1A 3A98A 3NFCA 3OMCA 3VS7A 2W10A 1EZZB 4Z89A 4L59A 2CSIA 4M75D 4E7HA 3LGLA 1QCFA 3KXTA 3RNJA 2L3RA 3C0CA 1VQ4A 4M75E 4J9GA 3ZBDA 3CBOA 2VVKA 3QWXX 3OYFA 4X9DA 3CD6Q 1YBYA 2DLPA 3QZ9B 1VQ6T 3I55A 1M3AA 2L3SA 1VQ8Q 4RG8A 1T0HA 2SEMA 2DERA 3A8HB 2RHUA 1NG2A 1RAFB 2HQEA 4ZNXA 4EPCA 1KSWA 3BFMA 4J9IA 2JMCA 1TG0A 1D3BB 5GAN8 4PJLA 4KUIA 1UHFA 3JCMJ 3H0IA 1QCNA 2AIRB 1VQLA 1VQ5A 2EYZA 2LX9A 2P4TA 3MEAA 3VJPA 2D1XA 1AT1B 1BI2A 5CQXA 2E6ZA 2MYSA 3P8HA 3V7SA 2QEXT 1YHQQ 1GCPA 1BU1A 3L2VA 2L89A 3UT1A 2E12A 2RQVA 2RF0A 2OJ2A 3NMZC 3L2ZA 1IO6A 2QTVA 1DJ7B 1ZA2B 2EQJA 3GIBA 4ESRA 1W6XA 3JCMf 1S72A 2CP6A 2E41A 1UB4A 3I55T 4C92F 1B34A 4C5EA 1SSFA 3J81E 5CKHA 5DLQE 2QASA 1VOMA 2DJZA 3MCAB 5GJVB 1Z9ZA 2D8HA 2RK1A 3G1JA 2KQWA 2ZPHB 1K1ZA 1ZSZA 2EYYA 3JB9G 3CPWP 4N4GA 1CKBA 5A0LA 1VA7A 2FL7A 1JBMA 4M78C 3JCMd 1VQMA 1N9RA 4J6XA 1VQLT 1VQ5T 1FMWA 3AT1B 3N5BB 3RESA 4PL6A 1M2VA 2JVVA 2HAXA 1AVZC 2C0TA 3OS1A 1PD0A 5FU6B 1NPRA 4RTTA 4C92C 3EFSA 1I81A 1Y7XA 2W0ZA 2AZSA 5I21A 3PFSA 1MHNA 5GMKe 2M0YA 1AHJB 1JXMA 4ORZA 2XI9A 4J9FA 1UGPB 1QKXA 3MHXA 4R0KA 3L2RA 2J6FA 1S72T 3FEOA 5KH6A 2VXFA 1JRIA 5HCKA 4FYWB 5KYYB 4A63B 2BUDA 1R8OB 4EMKC 2DL4A 2FO0A 1TUCA 3M5AA 1VQKA 1X6BA 1WHKA 1UDLA 5KYXB 3O8VA 3A8GB 4C0DB 2BIVA 2EBPA 2CYZB 3OYEA 4D6WA 3J80E 4NL2A 2VKNA 1VQNT 2KDSA 1K8AC 3OQ5A 5LJ5f 2LT1A 2NUTA 2RJDA 4JUVA 2FRWA 1YJ9Q 2EGEA 5KYUA 1D0YA 4OMPA 1X6GA 2DVJA 2MF2A 1KC8C 1M9SA 1YIJQ 4LDXA 1H641 2WSFE 5HY6A 4JJNK 1K9MR 2IG0A 2DPPB 2O2OA 4C92D 5LJ5d 2KSSA 4QQGA 1AWWA 1GFDA 5KE2A 3JCMh 4XU3A 1QVFA 2JT4A 3M58A 2RQTA 4J83A 1TH7A 3JB9I 1VQOT 2BZYA 4JZ4A 1ACMB 5GAMd 3OYLA 4PJOA 3S6WA 2VASA 3PVQA 4ATOA 2CDTA 2EYQA 2QQSA 4AFUC 5GAOr 3JCMg 4QVDA 3VRYA 4PLLA 1XNIA 3CCJQ 2RHIA 4KGVB 1Q81R 1VYUA 1PKTA 3M59A 4FSSA 5GAN3 5FWBA 2JW4A 4J9HA 2K7AA 3M54A 1CKAA 2VWFA 3BY7A 3C4SA 5EG2A 2QA4Q 1H8KA 3REAB 2J06A 2DIQA 3X25B 3OYHA 1D3BA 3VS4A 2K79A 2RJCA 1M5Q1 4RTXA 2CUBA 1M1FA 4ZN1A 5GAN7 2R58A 4XU2A 5J3BA 2A36A 3VV0A 1GCQA 4J9CA 4QT7A 5GJWB 2YXYA 5A2QE 1N8RC 2GCXA 3CD6T 4A4FA 2DK3A 4M7DC 2E1HA 1QP2A 5IHIA 2QQ9A 1VQ8T 2HBWA 1YWOA 5LL6S 3I5SA 2RH2A 3UPUA 2KE9A 3VS0A 2DEQA 2EJGA 3BW1A 1AZGB 4Y28E 1BBZA 4ELYC 3S3NA 4C0FA 2PQWA 3EGDB 3VS2A 3FDRA 1IREB 3CCMQ 2ZPBB 2KYMA 3ASKA 1NZ9A 1NEBA 2A37A 4JDSA 5LJ5h 3CPWS 5CKEA 1K8AU 1QP3A 3VS5A 1SHFA 1LPLA 1AEYA 2JOYA 1RAGB 1NPPA 1SF9A 1WXUA 3L1AA 1YHQT 3SEMA 3OYNA 1UJ0A 2KRNA 1OULA 1KC8U 2DE0X 2OTLT 4IUTA 2MMPA 1YJWQ 1Y07A 4NL3A 5LJ5g 4UC4A 2HKNA 1QKWA 4GLKA 3X24B 3JCMe 4F7UA 1MNDA 1EFNA 3SFMA 3PE0A 2BTTA 5IT9E 2CZ6B 3HFOA 3QWYA 1GFCA 4VUBA 3OS2A 1OX9A 1FX7A 1LNXA 3SWNC 3PMTA 5KYYA 2DRKA 5HKCA 2FVUA 4II1A 1UGSB 1G3YA 3MEVA 1Q82R 4BE2A 2JN0A 5KYXA 2A0FB 3ZEHA 3OYMA 5GAN4 1VQPA 1QMCA 2L0AA 2EQMA 1IB8A 1OYXA 4DEYA 4PJOG 1WDXA 1PSEA 2O88A 2LRQA 4M77C 4GLMA 2AKKA 1D0ZA 3D7SB 1NBEB 1AZEA 1YJ9A 5FROA 4LD6A 4E47A 1WA7A 2CZ0B 4HT9A 2ATCB 3P8BB 1ZHIA 5AT1B 1YIJA 3EGUA 4DBRA 4X9CA 1JJ2A 1KHIA 4RUGA 1XOVA 4E7SA 1ZBJA 3HFNA 1HD3A 1S1NA 4LN2A 5A0GA 1ZLMA 3QO3A 1B34B 4C8QB 2DD4A 2EJFA 4JPBW 1BCMA 1N8RU 4J6YA 1WFWA 2HBPA 4IKFA 2VGNA 3TU4K 3WVEB 3U23A 5LJ5j 3M0QA 3PTAA 1FMKA 2V8JA 3A8OB 2MWPA 3HHTB 9ATCB 2HMAA 4PJOF 1MMNA 2HCKA 2JXBA 5IHNA 2HSEB 1NM7A 4F04B 2GQIA 2L8DA 2Z0WA 4DQ2A 5GAMj 2E64A 1AOJA 3RERA 4M7AC 1M8VA 3EHQA 2P0QA 3CCJA 3JCMc 2X4XA 1QVGA 2LTOA 4ZGJB 5LJ5e 1WHJA 1YJ9T 3TCJA 4AT1B 2RQRA 1OX8A 2PUKB 1PKSA 4E2FB 1PG5B 1YIJT 2EVRA 2DEUA 2QA4A 2V26A 2C0OA 4Y91A 3SWNB 1KHCA 3GPLA 4E7IA 2DL5A 3M9QA 4DEXA 4BE0A 2FZKB 4M75C 1RI0A 4EMKA 3CXCA 5GAN5 1WX6A 1WGSA 3PIOA 4ME7A 3JCMP 1C6VX 4FL6A 1D1AA 2LNVA 3CCST 4FT4A 4BB7A 4IUPA 4EMGA 2J7IA 5I11A 1VUBA 2KNBB 4D8DA 3EG3A 2E70A 3CBMA 5L8RE 2P84A 4RTVA 1YITQ 3CCJT 1QVFP 1Q95G 1QW1A 3EGXB 4F7UG 3JRZA 2GQVA 1G3TA 1BI0A 3A8MB 2LDMA 4X1VA 2NUTB 2D6FA 2DNUA 2OTJT 2QDYB 1K9MC 4LNPA 4AG1C 2HZYA 3EGDA 4BDYA 1PSFA 1WQ7A 2K9GA 1BIBA 1U06A 2AKLA 4DOVA 3MPUB 1UGRB 2RMOA 1ABQA 2Y4XA 5DY9A 3MO8A 3RKYA 2KK4A 1YJWA 2X3WD 2GBQA 3INZA 3OYJA 5EC7A 2HQHA 4C5IA 2KR3A 4JS4A 1M1GA 1R77A 2RN8A 2K4YA 4PJOD 5KE3A 3LGFA 4KGZB 4XK8E 1KQ1A 1QWFA 3LLRA 4PJOE 3OB9A 4OGCA 3E2UA 2K6DA 2M9UA 4N0AC 1Q81C 4N4IA 4AMCA 3M57A 3CCMT 1OQKA 3CCLA 1G2BA 2VV5A 1I0CA 4FYVB 3C12A 1SG5A 2FZCB 3M4YA 3NTIA 3WXMB 2EIFA 3DLMA 4BY6B 3E1SA 4OVAA 2MAMA 2X9HA 1FXXA 4HCBA 1HK9A 2JTFA 1I4K1 2F5KA 3A1PA 3TSZA 1YP5A 4B9WA 1D1BA 4MZTA 2M0OA 2H3EB 3CMEQ 2I0NA 2LNHB 3C95A 2Y90A 3G4SQ 2JTMA 2VXEA 2LQWA 3TREA 3M0UA 3NPFA 2X51A 2CS7A 3EH2A 3QYGB 1AWOA 2RI3A 4IUVA 5FRMA 4LDWA 2LCLA 4HVWA 4DOWA 1WJRA 2JZ2A 5D7UA 2P0PA 1PWTA 4A53A 2DM1A 1KG1A 1VQ4T 2XMFA 1A0NB 1WHGA 1TS9A 2K5LA 2JTEA 3IQLA 2WSEE 1WJSA 5L23A 2GGRA 4P5NA 1OI1A 3CCVA 2QI2A 4C8QA 5CCAA 3NHNA 1M4ZA 2E4HA 2F2WA 3LYIA 3H0FA 3QHSA 3PVLA 2EQKA 2RA2A 5A0DA 3JCMX 3M55A 3O5ZA 5CR2A 1BI3A 4QQ6A 1U1TA 1YWPA 1K9MU 5IH2A 4RTUA 1WHLA 2X4WA 1EIFA 3VYGA 2V1RA 1M1KR 1PCXA 2RJFA 3OS5A 3DLLA
chains in the Genus database with same CATH topology
4PLIA 5C0MA 2DXUA 4OB0B 3BY7A 5CVIA 4ELZC 4XU0A 3C4SA 4JLIA 4MMLA 4M75G 1G5VA 4RG2A 4F7UB 5EG2A 1Q7YU 3LH0A 1M90C 2DTHA 2DIQA 3FRNA 3OBWA 4DA4A 1V29B 4X34A 3X25B 3OYHA 1D3BA 3G71T 4HT8A 1BYMA 2EWNA 4M7AB 3M53A 2RJCA 3SWNA 1M5Q1 2DKGA 3V8JA 2GFUA 5GMKm 1M90U 4F7UE 1M1FA 3L42A 3VYHB 4ZN1A 5HK3A 5GAN7 3META 2DXCA 2R58A 2HQXA 4F7UF 1Q82C 4XU2A 5J3BA 5LJ3g 1G3WA 4M7AE 2O4XA 3VV0A 4XTVA 3QUIA 3OYKA 1I5LA 2RO0A 4M7AF 2LQ8A 3JB9F 2GF7A 5A2QE 4BD3A 3VU3C 2GCXA 3LWIA 1N8RC 1NJIU 3CD6T 3SD4A 4A4FA 2DK3A 4M7DC 3MEUA 3CC4T 1X75C 1QP2A 2E1HA 4XTWA 2K5IA 2QQ9A 2PVOB 2RM4A 2ZGWA 5LL6S 2RHZA 3FC3A 3C94A 1Q81U 3QSUA 4JRKA 1M1KU 3CCRA 2PUOB 4KULA 4M75B 5D6WA 4BI3A 3OY9A 2XKOC 3CCSA 3QZ5B 5I2MA 2QEXA 4PKCC 5CKBA 1VQMT 2RH2A 3UPUA 4C0ZA 4E7KA 5J26A 3V7CA 3HRTA 2V8IA 5FU6C 4M77A 2DEQA 1W4SA 2EJGA 3BW1A 2LVMA 2K3XA 3CCET 3X26B 4Y28E 5D6XA 2H3JA 4ELYC 3S3NA 4EDUA 4HCCA 3GLXA 4C0FA 3AHUA 2PQWA 2RI2A 3FB9A 2YHTA 3PGGA 1QVFS 5CAIA 4M75F 3NTHA 4M78G 3FDRA 4OMFB 2XICA 3M4GA 1IREB 3TEEA 3HSBA 2ZPBB 4A4GA 5GAOl 2IVWA 2QQBA 1YJWT 3ASKA 3QXEB 1NZ9A 4ZGDB 2E5QA 5GANf 2YLCA 4JDSA 5LJ5h 3CPWS 5CKEA 1BIAA 1K8AU 1ZBXA 3FLGA 1VQ7A 1QP3A 3QPHA 1H3ZA 4RMOA 4C92G 4XTXA 4OP0A 3CCQA 2JOYA 4M7DA 3GP8A 1NPPA 1YHQT 3L1AA 2B8AA 4FM4B 5GAMf 3OYNA 2OTJA 1Q86C 2A3LA 4BUGA 2DD5A 3E9GA 1KC8U 2CZ1B 2PU9B 2OTLT 3HP9A 2AHJB 2K3YA 4HA8A 2KVQG 1Q86U 4IUTA 2MMPA 4O6JA 4C0DC 4CI0C 5GANd 1Y07A 3OYBA 4NL3A 5C6SA 5LJ5g 1X01A 5J39A 4M78B 4UC4A 1O75A 4Z02A 1VQKT 3DKMA 3VUBA 4BY6C 3V7RA 4M77D 3CCLT 4J5YA 4GLKA 3X24B 3JCMe 2C06A 4F7UA 2F69A 4XTYA 4MDWA 3SFMA 4BDZA 5IT9E 2DTIA 3QIIA 2CZ6B 1VIEA 3HFOA 3RUXA 4M7AA 2ZPIB 1BKBA 4VUBA 3CEYA 3JCMb 3OS2A 4M78F 4ZTFA 1LNXA 1FX7A 3SWNC 4C92B 3S3OA 2VYTA 3GOXA 4MDXA 3RMQA 3PMTA 2FHDA 5LJ3j 2RJEA 5KCOA 4TVRA 1YJNA 4IUQA 1YITA 2M1HA 5FU7C 5HKCA 4QVCA 2FVUA 4II1A 4MMKA 1MGQA 3E19A 2QTXA 4MZMA 1UGSB 2X4JA 1G3YA 2DIGA 2M16A 1Y71A 3MEVA 5CIUA 4BE2A 3QJ6A 2JN0A 2R5MA 2DTOA 4CRIA 3KUFA 3QJYA 3ZEHA 4IUUA 1VQ7T 5CQYA 3OYMA 3J7AF 5GAN4 1VQPA 3CCMA 2EQMA 3RMSA 1VQ6A 2RK2A 1OYXA 4HCZA 4QW2A 4C8QG 4EMKB 5LJ3e 1U8RA 2DXTA 2DO3A 2JUFA 2KMTA 4PJOG 5HK0A 1PSEA 3CMEA 4NOYA 2LRQA 3Q1JA 3QYHB 4M77C 3OYCA 3VUZA 2ZPGB 1Y96B 3OSSC 5GMKj 2EQUA 3CC2T 4FT2A 3G4SA 3OA6A 4ZGEB 1YJ9A 5FROA 4LD6A 4E47A 2CZ0B 4HT9A 2VUBA 4C5GA 3OYAA 4HKEA 5FRMA 3MP6A 3P8BB 1ZHIA 3JCMQ 4M7AD 3URGA 1UGQB 1YIJA 3JB9D 4X9CA 4A54A 3V8LA 1KHIA 1JJ2A 1XOVA 3OYYA 1VQNA 3VKIA 3CCUT 3DB4A 3HFNA 2O01E 3OS0A 3CCVT 1Q82U 5A0GA 2G3RA 2XIDA 4A4HA 5GMKh 2X4YA 4IURA 2BKDN 3QO3A 1B34B 4BI4A 2KAFA 4C8QB 2ZCFB 2DD4A 2EJFA 4YTLA 1RL2A 4R56A 1WQWA 4PJOB 4LDYA 5IN1A 1YJNT 1N8RU 4J6YA 2HBPA 3NFCA 5GAOq 3OYIA 2VGNA 3OMCA 3OSVA 1KD1C 4IKFA 3X20B 3TU4K 4KT0E 2CKKA 5GAN6 4L59A 2NLUA 3WVEB 3HKSA 4E7HA 4M75D 5GANj 5LJ5j 2QXFA 3LGLA 3PTAA 2V8JA 3A8OB 3GNFB 2MWPA 3KXTA 3HHTB 2EFIA 2RB6A 4C8QF 2L3RA 1VQ4A 2FB7A 3R6OA 4M75E 4PJOF 2LT4A 1UEBA 3ZBDA 3CBOA 3L2WA 3JAME 3OYFA 4X9DA 3ZFJA 2DAQA 2RHYA 1O9SA 4XTZA 3RIRA 1YBYA 2L8DA 3CMAA 3QZ9B 4DQ2A 5GAMj 1VQ6T 2E64A 3I55A 4B9XA 3RERA 4RG8A 4JRIA 4M7AC 1M8VA 3CMET 5AYFA 4LD9K 3A8HB 2E6NA 1VQOA 2P0QA 3CCJA 2DVEA 2R57A 2X4XA 3MP1A 3JCMc 2LTOA 3BDUA 2K57A 4ZGJB 5GANh 2LQKA 2RHUA 5LJ5e 3PIPA 3CC7A 1YCYA 3ER0A 1XTDA 2HQEA 4C0GA 2LC4A 3RKXA 1U1SA 1YJ9T 3TCJA 4OB2B 4E7LA 4XQ3A 4EPCA 2WSCE 3BFMA 4LDVA 4XTUA 2PUKB 3OW2A 1YIJT 1D3BB 2YRVA 4M77G 3UDCA 5GAN8 2QA4A 5GAMh 2D0QB 2XD0A 4KUIA 3PNWC 4Y91A 3SWNB 3OBYA 5DM7R 2XDPA 1KHCA 3GPLA 1XQHA 4E7IA 3JCMJ 3M9QA 3PT9A 1VQLA 3M56A 1VQ5A 4BE0A 3CBPA 3S3MA 3DB3A 4O5VA 5DLOA 2R5AA 4M75C 2VGMA 1RI0A 4EMKA 5GANg 2CGHA 2O4XB 2LX9A 3CXCA 5GAN5 1QVPA 2P4TA 3MEAA 4N0AA 1WGSA 4OB3B 3VJPA 3PIOA 4ME7A 3JCMP 1YITT 1FWZA 4M78D 1VQ9A 4JRQA 4OF1A 1BI2A 4FL6A 3CCRT 4L6V5 2LNVA 2E6ZA 5CQXA 3CCST 3P8HA 3V7SA 2QEXT 4M78E 3L2UA 5GAOn 4FT4A 4JLGA 4BB7A 4IUPA 2L89A 3L2VA 5GAMg 3UT1A 2E12A 3HRSA 4EMGA 4M7DG 2JNGA 2PVGB 3EFRA 5CK9A 3L2ZA 1VUBA 1JJ2S 2XU8A 3FJPA 2KY9A 1DJ7B 3QDRB 2E70A 3CBMA 2EQJA 5L8RE 3GIBA 4R55A 4N4HA 1BI1A 3JCMf 2MWOA 2RD1A 1S72A 4C92E 3CMAT 2E41A 1UB4A 4FIBA 5D6YA 3I55T 5M9OA 4C5HA 4C92F 3A5ZB 1B34A 3CCJT 1N27A 3LW5E 4C5EA 4PNOA 1SSFA 3OS5A 3QKJA 4RCCA 1LJOA 4A4EA 5CKHA 5DLQE 3J81E 3SB2A 3CC7T 1QW1A 4F7UG 3CD6A 2DXBA 3JRZA 3KBGA 4M75A 2DJZA 2GQVA 3MCAB 3CC4A 1G3TA 3ME9A 1BI0A 4NS5A 3A8MB 2LDMA 1VQ8A 3HPWA 3CCQT 2RK1A 2WACA 4J7FA 2D6FA 2KQWA 2ZPHB 4M7AG 3JB9G 4N4GA 5A0LA 2FL7A 2OTJT 1JBMA 2QDYB 4M78C 3JCMd 1VQMA 1N9RA 4J6XA 1K9MC 4M7DB 4BDYA 1PSFA 1VQLT 1VQ5T 3CCEA 4J6WA 3N5BB 1X6OA 1WQ7A 1BIBA 3RESA 3LX7A 4PL6A 4DOVA 2JVVA 3OYDA 2HAXA 1UGRB 3LWHA 2E65A 3HL8A 3OS1A 1OZ2A 5LJ3f 4E7JA 5FU6B 1NPRA 2K2VA 2Y4XA 5DY9A 3EFSA 3MO8A 1I81A 4C92C 1Y7XA 3RKYA 3JCMW 1VQ9T 1Q7YC 2KK4A 1QVGS 4M7DF 3H8ZA 1YJWA 2ZPEB 5I21A 3PFSA 5I2SA 1YI2A 3INZA 3OYJA 3F70A 1MHNA 1IZ6A 5GMKe 1WJQA 4C5IA 2X35A 3SDZA 4JS4A 1M1GA 5FLXE 3OW2S 1AHJB 4FSXA 1LOJA 2XI9A 2Y4YA 5KCHA 1JB0E 4C8QD 1UGPB 2K4YA 3MHXA 4PJOD 1K73C 1YHQA 5KE3A 3L2RA 1S72T 3FEOA 5KH6A 2VXFA 1JRIA 2LCCA 3LGFA 1KQ1A 4XK8E 5CO7A 4BI8B 5LJ3d 4C8QE 1HXDA 3LLRA 4PJOE 2BUDA 1K73U 3L2QA 1NJIC 3CXCS 4M78A 1R8OB 4EMKC 1KD1U 2OTLA 2RHXA 3OB9A 4OGCA 2M9UA 3JSCA 4N0AC 4A4KA 4ZN3A 1Q81C 5FRNA 4N4IA 4FU6A 3X28B 1P92A 1M1KC 5GAN2 3M5AA 1VQKA 3M57A 1VQPT 3CCMT 3CCLA 3O8VA 2VV5A 2K5FA 3G6EA 4OGEA 3P8DA 1KQSS 3OYGA 3A8GB 2L5QA 3C12A 4JS5A 4C0DB 4C92A 5CKFA 3GNGA 2ZPFB 2BIVA 2RI5A 1W2BS 2P0KA 3M4YA 3NTIA 5GANe 2CYZB 3WXMB 2EIFA 3DLMA 4BY6B 2OAUA 2XDBA 3E1SA 3G4ST 4OVAA 2MAMA 2XK0A 4GY5A 1FXXA 4HCBA 1HK9A 2VC8A 2JTFA 4D6WA 3J80E 1I4K1 3OYEA 1QVGA 3I56A 3FIFA 3NTKA 4NL2A 3EAEA 2F5KA 3PMIA 1VQNT 2KDSA 4WF2A 5GAMe 3QG1A 2EJ9A 1K8AC 4C8QC 2A7YA 2EAYA 2HD0A 3OQ5A 4B9WA 4ZTJA 1KQ2A 4PJOC 4MZTA 2M0OA 4QQDA 1YI2T 3E9FA 5LJ5f 5FU7B 2XG8D 3JCMV 5GAOp 2LT1A 4RKUE 1VIFA 3C95A 2HNIA 2Y90A 4RCBA 2RJDA 1GXIE 2JTMA 4JUVA 2VXEA 1N6AA 1Y96A 3TREA 3UWNA 3HRUA 3A8LB 2MF2A 1KC8C 2CS7A 3QYGB 1VQ8T 2RI3A 1M9SA 4IUVA 1KQSA 4LDXA 4LDWA 2LCLA 4DOWA 1H641 2FYKA 1WJRA 2JZ2A 2WSFE 2P0PA 2E10A 4XAXB 5HY6A 3RKWA 3V8KA 4A53A 5GMKl 4JJNK 3G71A 1W2BA 2IG0A 3JB9H 2DPPB 1VQ4T 1KG1A 4L5GA 3OMGA 4C92D 3MEWA 2DZCA 5LJ5d 2KSSA 4QQGA 4M77B 2XDDA 3CC2A 2F5TX 1ZQ1A 2K5LA 5KE2A 3JCMh 2WSEE 4XU3A 1QVFA 3G6ET 1WJSA 4J8OA 3M58A 3CCUA 4J83A 1TH7A 3JB9J 4P5NA 3CPFA 3JB9I 4M77E 4BE1A 1VQOT 1OI1A 3CCVA 2QI2A 2QQRA 4C8QA 2DZ9A 4PJOA 5GAMd 3OYLA 3H6ZA 4QVZA 3S6WA 5CCAA 1M4ZA 4M77F 2EKOA 3QBYA 5CKDA 3LYIA 1G3SA 3QHSA 4JRPA 3CPWA 1N9SA 4J7IA 2EQKA 4MZPA 4LDUA 3T9NA 4Q5WA 1WNLA 2RA2A 1I8FA 5A0DA 4ATOA 3I56T 4XU1A 1OZ3A 3MP8A 2CZ7B 1NE8A 2GFAA 2EYQA 2PVDB 4EMHA 2QA4T 4KUDK 2D9TA 2QQSA 2I2LA 3M55A 2YLBA 2ZZDA 3JCMg 5CR2A 3JCMX 5GAOr 1WPYA 1BI3A 2MI6A 4QQ6A 5IAYA 4M7DD 4QVDA 1U1TA 2QQAA 1XNIA 4PLLA 4BACA 1K9MU 2X4WA 1EIFA 2RHIA 4V2SA 5GMKi 2XHCA 3WVDB 5GAOm 4KBMB 4OB1B 3VYGA 4M7DE 3BDLA 3G7ZA 3M59A 5LJ3h 5GAN3 2RJFA 3M54A 3GF5A 2V8KA 3DLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVW A;  3OSS C;  2Y4X A;  2LC4 A;  2Y4Y A;  2LNV A; 
#chains in the Genus database with same CATH topology
 2DXU A;  4OB0 B;  2QYZ A;  4RG2 A;  1QWE A;  4F7U B;  3M0P A;  2GTO A;  3OBW A;  1V29 B;  1BYM A;  2KT1 A;  3SWN A;  5GMK m;  1M90 U;  4F7U E;  4JJD A;  2AK5 A;  3I9Q A;  1WHH A;  2HQX A;  1Q82 C;  1VQ9 Q;  4XTV A;  1JJ2 P;  2FRY A;  1WXT A;  3JB9 F;  3VU3 C;  1D09 B;  1YIT A;  3FC3 A;  1SEM A;  2PVO B;  2ZGW A;  8AT1 B;  1Q81 U;  3QSU A;  2FPD A;  1M3C A;  3CCR A;  4KUL A;  5D6W A;  2XKO C;  1KFZ A;  2FG0 A;  2YUQ A;  4PKC C;  1VQM T;  3ZL7 C;  4C0Z A;  4GBQ A;  4KH0 B;  1PC0 A;  4M77 A;  4J9D A;  3VRZ A;  4EDU A;  3AHU A;  1QVF S;  3FB9 A;  2ESW A;  2CP7 A;  2DL3 A;  1WI7 A;  3M4G A;  3CC4 Q;  3TEE A;  1VQP Q;  3EGX A;  5GAO l;  4ZGD B;  1I07 A;  4WTO B;  2ABL A;  3FLG A;  3QPH A;  1QVG P;  3CCQ A;  3R6N A;  1RI9 A;  5GAM f;  3H9N A;  2A3L A;  2DD5 A;  3E9G A;  2BZ8 A;  2CZ1 B;  1C0M A;  2EQI A;  3HP9 A;  1VYV A;  1M27 C;  4O6J A;  2SRC A;  1K4U S;  1X01 A;  1Z9Q A;  1VQK T;  4M78 B;  4Z02 A;  4J5Y A;  2C06 A;  4WCI A;  3CXC P;  4PJM A;  2B86 A;  1M30 A;  4FW2 A;  3QII A;  3RUX A;  4M7A A;  1HYO A;  2ZPI B;  3JCM b;  4ZTF A;  4C92 B;  2YDL A;  2VYT A;  1M90 R;  3RMQ A;  1KQS P;  2RJE A;  2DIL A;  4IUQ A;  2DET A;  5FU7 C;  1W2B P;  4QVC A;  4MMK A;  1MGQ A;  2DBM A;  2KRS A;  1R0B G;  1Y71 A;  2NUP B;  3QJ6 A;  2DTO A;  3KUF A;  3QJY A;  4FYX B;  2YT6 A;  3J7A F;  2DFU A;  4FW1 A;  2YWW A;  4CC7 A;  3NGP A;  5IHK A;  2RK2 A;  4HCZ A;  2EYX A;  4C8Q G;  4EMK B;  1U8R A;  2DO3 A;  3MKD A;  3CME A;  2F2X A;  2BZX A;  3OYC A;  1Y96 B;  3G4S A;  2PTK A;  2L3P A;  1GBQ A;  2RQW A;  3JB9 D;  4A54 A;  2DA9 A;  3OYY A;  1NLO C;  2HL5 C;  2ROL A;  2KRO A;  1KIK A;  2CRE A;  1W1F A;  1Q82 U;  2COZ A;  4A4H A;  2O31 A;  2BKD N;  2PNI A;  3CC2 Q;  1SSH A;  1SRM A;  5IN1 A;  5GAO q;  3OYI A;  3X20 B;  4KT0 E;  5GAN 6;  2NLU A;  4J9B A;  4OMO A;  5GAN j;  2QXF A;  2QAZ A;  1MMA A;  2EFI A;  3CCU Q;  1I1J A;  4C8Q F;  1UEB A;  1WHM A;  3L2W A;  3JAM E;  1W70 A;  3ZFJ A;  2DAQ A;  2RHY A;  1O9S A;  2EGA A;  2JS0 A;  4XTZ A;  3VS6 A;  2K2M A;  4JRI A;  3CME T;  1PHT A;  1T0J A;  2E6N A;  2R57 A;  1BCO A;  2K57 A;  1JU5 C;  2ZAE A;  1YCY A;  1XTD A;  4C0G A;  2LC4 A;  3RKX A;  1U1S A;  1H92 A;  4OB2 B;  4E7L A;  4XQ3 A;  2WSC E;  1H3H A;  4LDV A;  2A28 A;  2ECZ A;  1OPL A;  1TWB A;  3OW2 A;  2A08 A;  2YRV A;  4M77 G;  3UDC A;  4LUE A;  5GAM h;  2D0Q B;  2XD0 A;  3OBY A;  2MPX C;  1HJD A;  2XDP A;  3S3M A;  3DB3 A;  4O5V A;  2VGM A;  1QVP A;  4N0A A;  1UFF A;  1NYG A;  1ZSZ C;  1VQ9 A;  4JRQ A;  4L6V 5;  4PK4 A;  5KYN A;  3L2U A;  5GAM g;  4CC2 A;  2JNG A;  2PVG B;  1TU0 B;  4HVV A;  1JJ2 S;  4OMM A;  2XU8 A;  3QDR B;  4KH1 B;  2LJ3 A;  4R55 A;  4N4H A;  1BI1 A;  2MWO A;  2RD1 A;  1MNE A;  4FIB A;  5D6Y A;  1RAA B;  3CCL Q;  1TUG B;  5M9O A;  3THK A;  2JM8 A;  1N27 A;  1C1A A;  3QKJ A;  2CP0 A;  4A4E A;  2LX7 A;  2DXB A;  2M51 A;  1FYN A;  4AFZ C;  3CC4 A;  4NS5 A;  1ZUY A;  4J7F A;  3UAT A;  2D0N A;  4M7A G;  1K76 A;  1KD1 R;  4M7D B;  1E6G A;  2NWM A;  1BB9 A;  3CCE A;  1SRL A;  5IXB A;  2KYB A;  2X3X D;  3LX7 A;  1LCK A;  3LWH A;  1VQ7 Q;  1B07 A;  3HL8 A;  4CC4 B;  2GTJ A;  1VQ9 T;  2QGG A;  1QVG S;  1RAD B;  1RLP C;  2DMO A;  2JJ9 A;  2ZPE B;  1R0C B;  1IXD A;  3F70 A;  1IRX A;  5FLX E;  4FSX A;  4E6R A;  2Y4Y A;  1JB0 E;  4C8Q D;  1CSK A;  4BI8 B;  1AWX A;  5CO7 A;  4C8Q E;  1HXD A;  1K73 U;  3L2Q A;  3CXC S;  4M78 A;  3FJ5 A;  2RHX A;  2YUN A;  1V76 A;  2KI7 A;  3JSC A;  4A4K A;  5FRN A;  4FU6 A;  3X28 B;  3CCV Q;  1M1K C;  1BK2 A;  1VQP T;  2KT8 A;  3GBQ A;  2K5F A;  3P8D A;  1KQS S;  3OYG A;  4JS5 A;  4C92 A;  1JQQ A;  1X2Q A;  1YJN Q;  3JV3 A;  3GNG A;  5CKF A;  2RI5 A;  1W2B S;  2LCS A;  2HKQ B;  1TUD A;  2XDB A;  2XK0 A;  2EKH A;  2LQN A;  2VC8 A;  1Y57 A;  2NUP A;  3PMI A;  4WF2 A;  5GAM e;  2EJ9 A;  2A7Y A;  1SPK A;  1KQ2 A;  2KXC A;  4PJO C;  4QQD A;  1UUE A;  1I5O B;  2XG8 D;  4RKU E;  2ENM A;  1VIF A;  4RCB A;  1GXI E;  1Y96 A;  1OV3 A;  3UA7 A;  2YRC A;  1KQS A;  4XAX B;  3CC2 A;  5GMK l;  2E10 A;  3RKW A;  2BE7 D;  3V8K A;  2E3H A;  1W2B A;  4L5G A;  3OMG A;  2DYI A;  3MEW A;  1GRI A;  4M77 B;  1ZQ1 A;  4Z8A A;  4J8O A;  3CCU A;  1E6H A;  1JEG A;  1ZUK A;  4BE1 A;  4M77 E;  1Q7Y R;  3CCR Q;  2DZ9 A;  4QVZ A;  3QBY A;  1RAB B;  1UTI A;  1N9S A;  4J7I A;  1M2O A;  4LDU A;  2HDA A;  4Q5W A;  1WNL A;  1I8F A;  1ARK A;  4XU1 A;  2AT1 B;  3MP8 A;  2CZ7 B;  2GFA A;  2QA4 T;  2HL3 A;  1K73 R;  2D9T A;  2I2L A;  2ZZD A;  3CMA Q;  1WPY A;  1TSF A;  5IAY A;  2QQA A;  3TQ7 P;  4BAC A;  1VQO Q;  4V2S A;  5GMK i;  3WVD B;  4KBM B;  4OB1 B;  3CC7 Q;  1MUZ A;  3BDL A;  3G7Z A;  2L3Q A;  2QDL A;  2OI3 A;  1B3Q A;  4PLI A;  3CCQ Q;  4ELZ C;  1U5S A;  5CVI A;  4FYY B;  4JLI A;  1G5V A;  1QLY A;  3LH0 A;  1M90 C;  2DTH A;  3FRN A;  1RAI B;  4X34 A;  2CH4 W;  4M7A B;  2GFU A;  3VYH B;  3QDF A;  4PJJ A;  2DXC A;  4DBF A;  4F7U F;  2FPE A;  1G3W A;  4M7A E;  2J6O A;  3QUI A;  1I5L A;  2AZV A;  1AWJ A;  1NYF A;  2COY A;  1X75 C;  3C94 A;  4JRK A;  1M1K U;  4J9E A;  4M75 B;  4BI3 A;  1X27 A;  1KK7 A;  3QZ5 B;  5I2M A;  2QEX A;  4E7K A;  2IPO B;  5FU6 C;  4QKU A;  3X26 B;  5D6X A;  4D8K A;  2H3J A;  4HCC A;  3GLX A;  1OEB A;  1M3B A;  2YHT A;  3PGG A;  4AFS C;  4M78 G;  3UF4 A;  4E7Z A;  1SKU B;  1YJW T;  2E5Q A;  5GAN f;  2YLC A;  3H0H A;  2NUZ A;  1VQ7 A;  1YN8 A;  1H3Z A;  1QCO A;  4C92 G;  4XTX A;  5IXF A;  2RPN A;  4M7D A;  3GP8 A;  2B8A A;  1UE9 A;  4FM4 B;  4BUG A;  3OW2 P;  1PRM C;  2PU9 B;  2K3Y A;  2RNA A;  1MMG A;  2KVQ G;  4F17 A;  1Q86 U;  4CI0 C;  4C0D C;  4LUD A;  5GAN d;  4CC3 A;  1YI2 Q;  1O75 A;  1JO8 A;  3DKM A;  3V7R A;  3CCL T;  2JM9 A;  1RAE B;  1YCS B;  4MDW A;  4BDZ A;  3UA6 A;  2DF6 A;  2DTI A;  1VIE A;  2J6K A;  3CEY A;  4M78 F;  3TSW A;  4F16 A;  3GOX A;  4MDX A;  2FHD A;  2OTL Q;  5KCO A;  1YJN A;  2M1H A;  2E3I A;  4PFZ A;  4MZM A;  2QTX A;  2M16 A;  5CIU A;  3G6E Q;  4CRI A;  3VS1 A;  4IUU A;  5KYW B;  1VQ7 T;  1WYX A;  2CT4 A;  2VB6 A;  1V1C A;  3RMS A;  4QW2 A;  2MCN A;  2DX1 A;  2DXT A;  2JUF A;  2KMT A;  5HK0 A;  4NOY A;  3QYH B;  3I56 Q;  2PZ1 A;  3VUZ A;  2ZPG B;  2GNC A;  5GMK j;  4FT2 A;  2EGC A;  2C0I A;  2VUB A;  3URG A;  1UGQ B;  3V8L A;  1VQN A;  3RR6 A;  3DB4 A;  4Z88 A;  3CCV T;  2G3R A;  2XID A;  3TVT A;  3EG1 A;  2ZCF B;  1X69 A;  4YTL A;  3G71 Q;  1YJN T;  3EG0 A;  3OSV A;  1KD1 C;  2CKK A;  3HKS A;  1D0X A;  4ANJ A;  3GNF B;  1Q86 R;  2KXD A;  1ZX6 A;  2RB6 A;  2FB7 A;  3R6O A;  2LT4 A;  2L2P A;  3H41 A;  3HTR A;  1WXB A;  3RIR A;  3CMA A;  2DL8 A;  4B9X A;  1EX4 A;  2QG9 B;  5AYF A;  4LD9 K;  1TTH B;  1VQO A;  1MMD A;  2DVE A;  2LZ6 B;  3MP1 A;  5GAN h;  3BDU A;  3PIP A;  2LQK A;  3CC7 A;  3ER0 A;  2NYS A;  4JJC A;  2D8J A;  2YUO A;  3CCE Q;  3EG9 B;  4XTU A;  2FZG B;  2YUP A;  1G83 A;  5DM7 R;  3PNW C;  1XQH A;  2LMJ A;  1OOT A;  3PT9 A;  3M56 A;  3CBP A;  2OAW A;  5DLO A;  2R5A A;  5GAN g;  2CGH A;  1XJW B;  2O4X B;  4OB3 B;  2MK5 A;  1YIT T;  1FWZ A;  4M78 D;  1HSQ A;  4DBQ A;  4OF1 A;  3CCR T;  2G6F X;  4M78 E;  2BE9 B;  5GAO n;  3EFO B;  4B6M A;  4JLG A;  7AT1 B;  3HRS A;  4M4Z A;  4KRT A;  3SHW A;  4M7D G;  3EFR A;  5CK9 A;  1GL5 A;  3FJP A;  2KY9 A;  2F1L A;  1E7O A;  1U3O A;  1K0X A;  4LXC A;  4C92 E;  3CMA T;  6AT1 B;  2JMA A;  4C5H A;  2HSP A;  3A5Z B;  3LW5 E;  4PNO A;  4RCC A;  3CCS Q;  1ZA1 B;  1LJO A;  3CC7 T;  3SB2 A;  3CD6 A;  3KBG A;  4OMN A;  2CT3 A;  1OU9 A;  4M75 A;  3ME9 A;  2JS2 A;  1TXQ A;  1VQ8 A;  3HPW A;  3CCQ T;  2CP5 A;  2WAC A;  4JZ3 A;  1TOV A;  2KRM A;  1MV0 B;  1NEG A;  2ROT A;  2EPD A;  4J6W A;  2COW A;  3EG2 A;  1X6O A;  3OYD A;  2E65 A;  1Y0M A;  1OZ2 A;  5LJ3 f;  4E7J A;  4RTY A;  2K2V A;  4M7D F;  3JCM W;  1Q7Y C;  3H8Z A;  2KEA A;  5I2S A;  1YI2 A;  3RDV A;  2ED0 A;  2OTJ Q;  1IZ6 A;  1WJQ A;  4FCY A;  2X35 A;  3SDZ A;  3OW2 S;  1PRL C;  1LOJ A;  5KCH A;  3REB B;  1UJY A;  4AFQ C;  1K73 C;  1YHQ A;  2LCC A;  2V1Q A;  5LJ3 d;  2K3B A;  2OX7 A;  1NJI C;  2MIO A;  1KD1 U;  2OTL A;  1T3S A;  4ZN3 A;  2HEQ A;  1P92 A;  5GAN 2;  2E5K A;  3G6E A;  4OGE A;  4KGX B;  2L5Q A;  2ZPF B;  3EHR A;  1K9A A;  2P0K A;  5GAN e;  2OAU A;  3G4S T;  4F14 A;  4JJB A;  4IIO A;  2IIM A;  4GY5 A;  3I56 A;  3FIF A;  3NTK A;  3EAE A;  1YFN A;  3QG1 A;  4C8Q C;  2HD0 A;  2EAY A;  5KYW A;  4ZTJ A;  1VQ6 Q;  1YI2 T;  3E9F A;  1PM3 A;  5FU7 B;  3JCM V;  5GAO p;  1D1C A;  2DL7 A;  2F2V A;  2HNI A;  4EIK A;  2EYW A;  2DBK A;  1N6A A;  1VYT A;  1J3T A;  1WZO A;  2QK0 A;  3UWN A;  3HRU A;  4IIM A;  3A8L B;  3M0T A;  3VS3 A;  2FYK A;  2RQU A;  3G71 A;  5ECA A;  3JB9 H;  1NLP C;  2DZC A;  2CUD A;  1T3L A;  3RBB B;  2XDD A;  1OU8 A;  2F5T X;  3G6E T;  1X43 A;  2DJQ A;  4HXJ A;  3JB9 J;  3CPF A;  2MOX A;  2QQR A;  3H6Z A;  2FEI A;  2QEX Q;  4M77 F;  1UEC A;  2EKO A;  5CKD A;  1G3S A;  4JRP A;  3CPW A;  4MZP A;  2H8H A;  3T9N A;  4AG2 C;  1VQ4 Q;  3I56 T;  1OZ3 A;  4EMH A;  1NE8 A;  2PVD B;  2YLB A;  2LP5 A;  2DYB A;  3I55 Q;  2MI6 A;  4M7D D;  1GBR A;  2XHC A;  5GAO m;  4M7D E;  4K11 A;  3I35 A;  5LJ3 h;  3GF5 A;  2V8K A;  5C0M A;  4XU0 A;  4MML A;  4M75 G;  1K0S A;  3EG9 A;  1Q7Y U;  3M0R A;  1UGV A;  4DA4 A;  3G71 T;  4HT8 A;  1VQL Q;  2EWN A;  2O9V A;  1VQ5 Q;  3M53 A;  3V8J A;  2DKG A;  2CP2 A;  3L42 A;  5HK3 A;  3MET A;  1QQJ A;  4Y92 A;  4PFP A;  4HCK A;  5LJ3 g;  2O4X A;  3OYK A;  1K8A R;  2RO0 A;  4M7A F;  2LQ8 A;  2GF7 A;  3BE3 A;  4BD3 A;  3LWI A;  1NJI U;  3SD4 A;  3MEU A;  3CC4 T;  4KUD K;  4XTW A;  2K5I A;  2RM4 A;  3EFO A;  1AD5 A;  2RHZ A;  4DBH A;  2PUO B;  3OY9 A;  3CCS A;  2QGF B;  5CKB A;  1KC8 R;  5J26 A;  3V7C A;  3HRT A;  2V8I A;  1S72 Q;  1YNZ A;  1ZSZ B;  1W4S A;  4HVU A;  3M0S A;  2LVM A;  2ED1 A;  2K3X A;  1G8X A;  1ZUU A;  3CCE T;  1IHW A;  2YRD A;  4LE9 A;  8ATC B;  2RI2 A;  5CAI A;  4M75 F;  1IGU A;  3NTH A;  1IHV A;  4OMF B;  2XIC A;  1M2V B;  1RLQ C;  3HSB A;  4A4G A;  2IVW A;  2QQB A;  1PNJ A;  3QXE B;  4OMQ A;  2LJ1 A;  1BIA A;  1ZBX A;  1VQM Q;  4RMO A;  1SHG A;  4OP0 A;  3KFV A;  2CH4 A;  3I5R A;  1KJW A;  1RAC B;  2OTJ A;  1Q86 C;  1VQN Q;  2YSQ A;  2AHJ B;  4HA8 A;  4RTZ A;  3OYB A;  5C6S A;  1IGQ A;  5J39 A;  1FMV A;  3VUB A;  4BY6 C;  4M77 D;  3CQT A;  2F69 A;  4RTW A;  4XTY A;  5FWC A;  1PD1 A;  1ZSG A;  1UHC A;  1BKB A;  1RUW A;  3S3O A;  1LVK A;  5LJ3 j;  4TVR A;  5I22 A;  2M02 A;  2P4R A;  4PFO A;  1VQK Q;  1GCQ C;  3E19 A;  2X4J A;  3ULR B;  2DIG A;  1M8M A;  2R5M A;  1JXO A;  2CP3 A;  2FPF A;  1NJI R;  1F1B B;  5CQY A;  2CSQ A;  4PJN A;  1ABO A;  1N5Z A;  4OML A;  3CCM A;  1N8R R;  1VQ6 A;  5LJ3 e;  1MV3 A;  3MJX A;  3Q1J A;  2DRM A;  5KYU B;  3OSS C;  3CC2 T;  2EQU A;  2EW3 A;  3OA6 A;  2O9S A;  3EH1 A;  4ZGE B;  2J05 A;  4C5G A;  3OYA A;  2KBT A;  4HKE A;  3MP6 A;  3JCM Q;  4M7A D;  1RAH B;  3VKI A;  3CCU T;  1OPK A;  5FW9 A;  2O01 E;  3OS0 A;  3LH5 A;  5GMK h;  2X4Y A;  4IUR A;  1WLP B;  2LJ0 A;  4BI4 A;  2KAF A;  1X2K A;  1WIE A;  1RL2 A;  4R56 A;  1WQW A;  2KGT A;  4PJO B;  1B7T A;  4LDY A;  1UG1 A;  3A98 A;  3NFC A;  3OMC A;  3VS7 A;  2W10 A;  1EZZ B;  4Z89 A;  4L59 A;  2CSI A;  4M75 D;  4E7H A;  3LGL A;  1QCF A;  3KXT A;  3RNJ A;  2L3R A;  3C0C A;  1VQ4 A;  4M75 E;  4J9G A;  3ZBD A;  3CBO A;  2VVK A;  3QWX X;  3OYF A;  4X9D A;  3CD6 Q;  1YBY A;  2DLP A;  3QZ9 B;  1VQ6 T;  3I55 A;  1M3A A;  2L3S A;  1VQ8 Q;  4RG8 A;  1T0H A;  2SEM A;  2DER A;  3A8H B;  2RHU A;  1NG2 A;  1RAF B;  2HQE A;  4ZNX A;  4EPC A;  1KSW A;  3BFM A;  4J9I A;  2JMC A;  1TG0 A;  1D3B B;  5GAN 8;  4PJL A;  4KUI A;  1UHF A;  3JCM J;  3H0I A;  1QCN A;  2AIR B;  1VQL A;  1VQ5 A;  2EYZ A;  2LX9 A;  2P4T A;  3MEA A;  3VJP A;  2D1X A;  1AT1 B;  1BI2 A;  5CQX A;  2E6Z A;  2MYS A;  3P8H A;  3V7S A;  2QEX T;  1YHQ Q;  1GCP A;  1BU1 A;  3L2V A;  2L89 A;  3UT1 A;  2E12 A;  2RQV A;  2RF0 A;  2OJ2 A;  3NMZ C;  3L2Z A;  1IO6 A;  2QTV A;  1DJ7 B;  1ZA2 B;  2EQJ A;  3GIB A;  4ESR A;  1W6X A;  3JCM f;  1S72 A;  2CP6 A;  2E41 A;  1UB4 A;  3I55 T;  4C92 F;  1B34 A;  4C5E A;  1SSF A;  3J81 E;  5CKH A;  5DLQ E;  2QAS A;  1VOM A;  2DJZ A;  3MCA B;  5GJV B;  1Z9Z A;  2D8H A;  2RK1 A;  3G1J A;  2KQW A;  2ZPH B;  1K1Z A;  1ZSZ A;  2EYY A;  3JB9 G;  3CPW P;  4N4G A;  1CKB A;  5A0L A;  1VA7 A;  2FL7 A;  1JBM A;  4M78 C;  3JCM d;  1VQM A;  1N9R A;  4J6X A;  1VQL T;  1VQ5 T;  1FMW A;  3AT1 B;  3N5B B;  3RES A;  4PL6 A;  1M2V A;  2JVV A;  2HAX A;  1AVZ C;  2C0T A;  3OS1 A;  1PD0 A;  5FU6 B;  1NPR A;  4RTT A;  4C92 C;  3EFS A;  1I81 A;  1Y7X A;  2W0Z A;  2AZS A;  5I21 A;  3PFS A;  1MHN A;  5GMK e;  2M0Y A;  1AHJ B;  1JXM A;  4ORZ A;  2XI9 A;  4J9F A;  1UGP B;  1QKX A;  3MHX A;  4R0K A;  3L2R A;  2J6F A;  1S72 T;  3FEO A;  5KH6 A;  2VXF A;  1JRI A;  5HCK A;  4FYW B;  5KYY B;  4A63 B;  2BUD A;  1R8O B;  4EMK C;  2DL4 A;  2FO0 A;  1TUC A;  3M5A A;  1VQK A;  1X6B A;  1WHK A;  1UDL A;  5KYX B;  3O8V A;  3A8G B;  4C0D B;  2BIV A;  2EBP A;  2CYZ B;  3OYE A;  4D6W A;  3J80 E;  4NL2 A;  2VKN A;  1VQN T;  2KDS A;  1K8A C;  3OQ5 A;  5LJ5 f;  2LT1 A;  2NUT A;  2RJD A;  4JUV A;  2FRW A;  1YJ9 Q;  2EGE A;  5KYU A;  1D0Y A;  4OMP A;  1X6G A;  2DVJ A;  2MF2 A;  1KC8 C;  1M9S A;  1YIJ Q;  4LDX A;  1H64 1;  2WSF E;  5HY6 A;  4JJN K;  1K9M R;  2IG0 A;  2DPP B;  2O2O A;  4C92 D;  5LJ5 d;  2KSS A;  4QQG A;  1AWW A;  1GFD A;  5KE2 A;  3JCM h;  4XU3 A;  1QVF A;  2JT4 A;  3M58 A;  2RQT A;  4J83 A;  1TH7 A;  3JB9 I;  1VQO T;  2BZY A;  4JZ4 A;  1ACM B;  5GAM d;  3OYL A;  4PJO A;  3S6W A;  2VAS A;  3PVQ A;  4ATO A;  2CDT A;  2EYQ A;  2QQS A;  4AFU C;  5GAO r;  3JCM g;  4QVD A;  3VRY A;  4PLL A;  1XNI A;  3CCJ Q;  2RHI A;  4KGV B;  1Q81 R;  1VYU A;  1PKT A;  3M59 A;  4FSS A;  5GAN 3;  5FWB A;  2JW4 A;  4J9H A;  2K7A A;  3M54 A;  1CKA A;  2VWF A;  3BY7 A;  3C4S A;  5EG2 A;  2QA4 Q;  1H8K A;  3REA B;  2J06 A;  2DIQ A;  3X25 B;  3OYH A;  1D3B A;  3VS4 A;  2K79 A;  2RJC A;  1M5Q 1;  4RTX A;  2CUB A;  1M1F A;  4ZN1 A;  5GAN 7;  2R58 A;  4XU2 A;  5J3B A;  2A36 A;  3VV0 A;  1GCQ A;  4J9C A;  4QT7 A;  5GJW B;  2YXY A;  5A2Q E;  1N8R C;  2GCX A;  3CD6 T;  4A4F A;  2DK3 A;  4M7D C;  2E1H A;  1QP2 A;  5IHI A;  2QQ9 A;  1VQ8 T;  2HBW A;  1YWO A;  5LL6 S;  3I5S A;  2RH2 A;  3UPU A;  2KE9 A;  3VS0 A;  2DEQ A;  2EJG A;  3BW1 A;  1AZG B;  4Y28 E;  1BBZ A;  4ELY C;  3S3N A;  4C0F A;  2PQW A;  3EGD B;  3VS2 A;  3FDR A;  1IRE B;  3CCM Q;  2ZPB B;  2KYM A;  3ASK A;  1NZ9 A;  1NEB A;  2A37 A;  4JDS A;  5LJ5 h;  3CPW S;  5CKE A;  1K8A U;  1QP3 A;  3VS5 A;  1SHF A;  1LPL A;  1AEY A;  2JOY A;  1RAG B;  1NPP A;  1SF9 A;  1WXU A;  3L1A A;  1YHQ T;  3SEM A;  3OYN A;  1UJ0 A;  2KRN A;  1OUL A;  1KC8 U;  2DE0 X;  2OTL T;  4IUT A;  2MMP A;  1YJW Q;  1Y07 A;  4NL3 A;  5LJ5 g;  4UC4 A;  2HKN A;  1QKW A;  4GLK A;  3X24 B;  3JCM e;  4F7U A;  1MND A;  1EFN A;  3SFM A;  3PE0 A;  2BTT A;  5IT9 E;  2CZ6 B;  3HFO A;  3QWY A;  1GFC A;  4VUB A;  3OS2 A;  1OX9 A;  1FX7 A;  1LNX A;  3SWN C;  3PMT A;  5KYY A;  2DRK A;  5HKC A;  2FVU A;  4II1 A;  1UGS B;  1G3Y A;  3MEV A;  1Q82 R;  4BE2 A;  2JN0 A;  5KYX A;  2A0F B;  3ZEH A;  3OYM A;  5GAN 4;  1VQP A;  1QMC A;  2L0A A;  2EQM A;  1IB8 A;  1OYX A;  4DEY A;  4PJO G;  1WDX A;  1PSE A;  2O88 A;  2LRQ A;  4M77 C;  4GLM A;  2AKK A;  1D0Z A;  3D7S B;  1NBE B;  1AZE A;  1YJ9 A;  5FRO A;  4LD6 A;  4E47 A;  1WA7 A;  2CZ0 B;  4HT9 A;  2ATC B;  3P8B B;  1ZHI A;  5AT1 B;  1YIJ A;  3EGU A;  4DBR A;  4X9C A;  1JJ2 A;  1KHI A;  4RUG A;  1XOV A;  4E7S A;  1ZBJ A;  3HFN A;  1HD3 A;  1S1N A;  4LN2 A;  5A0G A;  1ZLM A;  3QO3 A;  1B34 B;  4C8Q B;  2DD4 A;  2EJF A;  4JPB W;  1BCM A;  1N8R U;  4J6Y A;  1WFW A;  2HBP A;  4IKF A;  2VGN A;  3TU4 K;  3WVE B;  3U23 A;  5LJ5 j;  3M0Q A;  3PTA A;  1FMK A;  2V8J A;  3A8O B;  2MWP A;  3HHT B;  9ATC B;  2HMA A;  4PJO F;  1MMN A;  2HCK A;  2JXB A;  5IHN A;  2HSE B;  1NM7 A;  4F04 B;  2GQI A;  2L8D A;  2Z0W A;  4DQ2 A;  5GAM j;  2E64 A;  1AOJ A;  3RER A;  4M7A C;  1M8V A;  3EHQ A;  2P0Q A;  3CCJ A;  3JCM c;  2X4X A;  1QVG A;  2LTO A;  4ZGJ B;  5LJ5 e;  1WHJ A;  1YJ9 T;  3TCJ A;  4AT1 B;  2RQR A;  1OX8 A;  2PUK B;  1PKS A;  4E2F B;  1PG5 B;  1YIJ T;  2EVR A;  2DEU A;  2QA4 A;  2V26 A;  2C0O A;  4Y91 A;  3SWN B;  1KHC A;  3GPL A;  4E7I A;  2DL5 A;  3M9Q A;  4DEX A;  4BE0 A;  2FZK B;  4M75 C;  1RI0 A;  4EMK A;  3CXC A;  5GAN 5;  1WX6 A;  1WGS A;  3PIO A;  4ME7 A;  3JCM P;  1C6V X;  4FL6 A;  1D1A A;  2LNV A;  3CCS T;  4FT4 A;  4BB7 A;  4IUP A;  4EMG A;  2J7I A;  5I11 A;  1VUB A;  2KNB B;  4D8D A;  3EG3 A;  2E70 A;  3CBM A;  5L8R E;  2P84 A;  4RTV A;  1YIT Q;  3CCJ T;  1QVF P;  1Q95 G;  1QW1 A;  3EGX B;  4F7U G;  3JRZ A;  2GQV A;  1G3T A;  1BI0 A;  3A8M B;  2LDM A;  4X1V A;  2NUT B;  2D6F A;  2DNU A;  2OTJ T;  2QDY B;  1K9M C;  4LNP A;  4AG1 C;  2HZY A;  3EGD A;  4BDY A;  1PSF A;  1WQ7 A;  2K9G A;  1BIB A;  1U06 A;  2AKL A;  4DOV A;  3MPU B;  1UGR B;  2RMO A;  1ABQ A;  2Y4X A;  5DY9 A;  3MO8 A;  3RKY A;  2KK4 A;  1YJW A;  2X3W D;  2GBQ A;  3INZ A;  3OYJ A;  5EC7 A;  2HQH A;  4C5I A;  2KR3 A;  4JS4 A;  1M1G A;  1R77 A;  2RN8 A;  2K4Y A;  4PJO D;  5KE3 A;  3LGF A;  4KGZ B;  4XK8 E;  1KQ1 A;  1QWF A;  3LLR A;  4PJO E;  3OB9 A;  4OGC A;  3E2U A;  2K6D A;  2M9U A;  4N0A C;  1Q81 C;  4N4I A;  4AMC A;  3M57 A;  3CCM T;  1OQK A;  3CCL A;  1G2B A;  2VV5 A;  1I0C A;  4FYV B;  3C12 A;  1SG5 A;  2FZC B;  3M4Y A;  3NTI A;  3WXM B;  2EIF A;  3DLM A;  4BY6 B;  3E1S A;  4OVA A;  2MAM A;  2X9H A;  1FXX A;  4HCB A;  1HK9 A;  2JTF A;  1I4K 1;  2F5K A;  3A1P A;  3TSZ A;  1YP5 A;  4B9W A;  1D1B A;  4MZT A;  2M0O A;  2H3E B;  3CME Q;  2I0N A;  2LNH B;  3C95 A;  2Y90 A;  3G4S Q;  2JTM A;  2VXE A;  2LQW A;  3TRE A;  3M0U A;  3NPF A;  2X51 A;  2CS7 A;  3EH2 A;  3QYG B;  1AWO A;  2RI3 A;  4IUV A;  5FRM A;  4LDW A;  2LCL A;  4HVW A;  4DOW A;  1WJR A;  2JZ2 A;  5D7U A;  2P0P A;  1PWT A;  4A53 A;  2DM1 A;  1KG1 A;  1VQ4 T;  2XMF A;  1A0N B;  1WHG A;  1TS9 A;  2K5L A;  2JTE A;  3IQL A;  2WSE E;  1WJS A;  5L23 A;  2GGR A;  4P5N A;  1OI1 A;  3CCV A;  2QI2 A;  4C8Q A;  5CCA A;  3NHN A;  1M4Z A;  2E4H A;  2F2W A;  3LYI A;  3H0F A;  3QHS A;  3PVL A;  2EQK A;  2RA2 A;  5A0D A;  3JCM X;  3M55 A;  3O5Z A;  5CR2 A;  1BI3 A;  4QQ6 A;  1U1T A;  1YWP A;  1K9M U;  5IH2 A;  4RTU A;  1WHL A;  2X4W A;  1EIF A;  3VYG A;  2V1R A;  1M1K R;  1PCX A;  2RJF A;  3OS5 A;  3DLL A; 
#chains in the Genus database with same CATH homology
 4PLI A;  5C0M A;  2DXU A;  4OB0 B;  3BY7 A;  5CVI A;  4ELZ C;  4XU0 A;  3C4S A;  4JLI A;  4MML A;  4M75 G;  1G5V A;  4RG2 A;  4F7U B;  5EG2 A;  1Q7Y U;  3LH0 A;  1M90 C;  2DTH A;  2DIQ A;  3FRN A;  3OBW A;  4DA4 A;  1V29 B;  4X34 A;  3X25 B;  3OYH A;  1D3B A;  3G71 T;  4HT8 A;  1BYM A;  2EWN A;  4M7A B;  3M53 A;  2RJC A;  3SWN A;  1M5Q 1;  2DKG A;  3V8J A;  2GFU A;  5GMK m;  1M90 U;  4F7U E;  1M1F A;  3L42 A;  3VYH B;  4ZN1 A;  5HK3 A;  5GAN 7;  3MET A;  2DXC A;  2R58 A;  2HQX A;  4F7U F;  1Q82 C;  4XU2 A;  5J3B A;  5LJ3 g;  1G3W A;  4M7A E;  2O4X A;  3VV0 A;  4XTV A;  3QUI A;  3OYK A;  1I5L A;  2RO0 A;  4M7A F;  2LQ8 A;  3JB9 F;  2GF7 A;  5A2Q E;  4BD3 A;  3VU3 C;  2GCX A;  3LWI A;  1N8R C;  1NJI U;  3CD6 T;  3SD4 A;  4A4F A;  2DK3 A;  4M7D C;  3MEU A;  3CC4 T;  1X75 C;  1QP2 A;  2E1H A;  4XTW A;  2K5I A;  2QQ9 A;  2PVO B;  2RM4 A;  2ZGW A;  5LL6 S;  2RHZ A;  3FC3 A;  3C94 A;  1Q81 U;  3QSU A;  4JRK A;  1M1K U;  3CCR A;  2PUO B;  4KUL A;  4M75 B;  5D6W A;  4BI3 A;  3OY9 A;  2XKO C;  3CCS A;  3QZ5 B;  5I2M A;  2QEX A;  4PKC C;  5CKB A;  1VQM T;  2RH2 A;  3UPU A;  4C0Z A;  4E7K A;  5J26 A;  3V7C A;  3HRT A;  2V8I A;  5FU6 C;  4M77 A;  2DEQ A;  1W4S A;  2EJG A;  3BW1 A;  2LVM A;  2K3X A;  3CCE T;  3X26 B;  4Y28 E;  5D6X A;  2H3J A;  4ELY C;  3S3N A;  4EDU A;  4HCC A;  3GLX A;  4C0F A;  3AHU A;  2PQW A;  2RI2 A;  3FB9 A;  2YHT A;  3PGG A;  1QVF S;  5CAI A;  4M75 F;  3NTH A;  4M78 G;  3FDR A;  4OMF B;  2XIC A;  3M4G A;  1IRE B;  3TEE A;  3HSB A;  2ZPB B;  4A4G A;  5GAO l;  2IVW A;  2QQB A;  1YJW T;  3ASK A;  3QXE B;  1NZ9 A;  4ZGD B;  2E5Q A;  5GAN f;  2YLC A;  4JDS A;  5LJ5 h;  3CPW S;  5CKE A;  1BIA A;  1K8A U;  1ZBX A;  3FLG A;  1VQ7 A;  1QP3 A;  3QPH A;  1H3Z A;  4RMO A;  4C92 G;  4XTX A;  4OP0 A;  3CCQ A;  2JOY A;  4M7D A;  3GP8 A;  1NPP A;  1YHQ T;  3L1A A;  2B8A A;  4FM4 B;  5GAM f;  3OYN A;  2OTJ A;  1Q86 C;  2A3L A;  4BUG A;  2DD5 A;  3E9G A;  1KC8 U;  2CZ1 B;  2PU9 B;  2OTL T;  3HP9 A;  2AHJ B;  2K3Y A;  4HA8 A;  2KVQ G;  1Q86 U;  4IUT A;  2MMP A;  4O6J A;  4C0D C;  4CI0 C;  5GAN d;  1Y07 A;  3OYB A;  4NL3 A;  5C6S A;  5LJ5 g;  1X01 A;  5J39 A;  4M78 B;  4UC4 A;  1O75 A;  4Z02 A;  1VQK T;  3DKM A;  3VUB A;  4BY6 C;  3V7R A;  4M77 D;  3CCL T;  4J5Y A;  4GLK A;  3X24 B;  3JCM e;  2C06 A;  4F7U A;  2F69 A;  4XTY A;  4MDW A;  3SFM A;  4BDZ A;  5IT9 E;  2DTI A;  3QII A;  2CZ6 B;  1VIE A;  3HFO A;  3RUX A;  4M7A A;  2ZPI B;  1BKB A;  4VUB A;  3CEY A;  3JCM b;  3OS2 A;  4M78 F;  4ZTF A;  1LNX A;  1FX7 A;  3SWN C;  4C92 B;  3S3O A;  2VYT A;  3GOX A;  4MDX A;  3RMQ A;  3PMT A;  2FHD A;  5LJ3 j;  2RJE A;  5KCO A;  4TVR A;  1YJN A;  4IUQ A;  1YIT A;  2M1H A;  5FU7 C;  5HKC A;  4QVC A;  2FVU A;  4II1 A;  4MMK A;  1MGQ A;  3E19 A;  2QTX A;  4MZM A;  1UGS B;  2X4J A;  1G3Y A;  2DIG A;  2M16 A;  1Y71 A;  3MEV A;  5CIU A;  4BE2 A;  3QJ6 A;  2JN0 A;  2R5M A;  2DTO A;  4CRI A;  3KUF A;  3QJY A;  3ZEH A;  4IUU A;  1VQ7 T;  5CQY A;  3OYM A;  3J7A F;  5GAN 4;  1VQP A;  3CCM A;  2EQM A;  3RMS A;  1VQ6 A;  2RK2 A;  1OYX A;  4HCZ A;  4QW2 A;  4C8Q G;  4EMK B;  5LJ3 e;  1U8R A;  2DXT A;  2DO3 A;  2JUF A;  2KMT A;  4PJO G;  5HK0 A;  1PSE A;  3CME A;  4NOY A;  2LRQ A;  3Q1J A;  3QYH B;  4M77 C;  3OYC A;  3VUZ A;  2ZPG B;  1Y96 B;  3OSS C;  5GMK j;  2EQU A;  3CC2 T;  4FT2 A;  3G4S A;  3OA6 A;  4ZGE B;  1YJ9 A;  5FRO A;  4LD6 A;  4E47 A;  2CZ0 B;  4HT9 A;  2VUB A;  4C5G A;  3OYA A;  4HKE A;  5FRM A;  3MP6 A;  3P8B B;  1ZHI A;  3JCM Q;  4M7A D;  3URG A;  1UGQ B;  1YIJ A;  3JB9 D;  4X9C A;  4A54 A;  3V8L A;  1KHI A;  1JJ2 A;  1XOV A;  3OYY A;  1VQN A;  3VKI A;  3CCU T;  3DB4 A;  3HFN A;  2O01 E;  3OS0 A;  3CCV T;  1Q82 U;  5A0G A;  2G3R A;  2XID A;  4A4H A;  5GMK h;  2X4Y A;  4IUR A;  2BKD N;  3QO3 A;  1B34 B;  4BI4 A;  2KAF A;  4C8Q B;  2ZCF B;  2DD4 A;  2EJF A;  4YTL A;  1RL2 A;  4R56 A;  1WQW A;  4PJO B;  4LDY A;  5IN1 A;  1YJN T;  1N8R U;  4J6Y A;  2HBP A;  3NFC A;  5GAO q;  3OYI A;  2VGN A;  3OMC A;  3OSV A;  1KD1 C;  4IKF A;  3X20 B;  3TU4 K;  4KT0 E;  2CKK A;  5GAN 6;  4L59 A;  2NLU A;  3WVE B;  3HKS A;  4E7H A;  4M75 D;  5GAN j;  5LJ5 j;  2QXF A;  3LGL A;  3PTA A;  2V8J A;  3A8O B;  3GNF B;  2MWP A;  3KXT A;  3HHT B;  2EFI A;  2RB6 A;  4C8Q F;  2L3R A;  1VQ4 A;  2FB7 A;  3R6O A;  4M75 E;  4PJO F;  2LT4 A;  1UEB A;  3ZBD A;  3CBO A;  3L2W A;  3JAM E;  3OYF A;  4X9D A;  3ZFJ A;  2DAQ A;  2RHY A;  1O9S A;  4XTZ A;  3RIR A;  1YBY A;  2L8D A;  3CMA A;  3QZ9 B;  4DQ2 A;  5GAM j;  1VQ6 T;  2E64 A;  3I55 A;  4B9X A;  3RER A;  4RG8 A;  4JRI A;  4M7A C;  1M8V A;  3CME T;  5AYF A;  4LD9 K;  3A8H B;  2E6N A;  1VQO A;  2P0Q A;  3CCJ A;  2DVE A;  2R57 A;  2X4X A;  3MP1 A;  3JCM c;  2LTO A;  3BDU A;  2K57 A;  4ZGJ B;  5GAN h;  2LQK A;  2RHU A;  5LJ5 e;  3PIP A;  3CC7 A;  1YCY A;  3ER0 A;  1XTD A;  2HQE A;  4C0G A;  2LC4 A;  3RKX A;  1U1S A;  1YJ9 T;  3TCJ A;  4OB2 B;  4E7L A;  4XQ3 A;  4EPC A;  2WSC E;  3BFM A;  4LDV A;  4XTU A;  2PUK B;  3OW2 A;  1YIJ T;  1D3B B;  2YRV A;  4M77 G;  3UDC A;  5GAN 8;  2QA4 A;  5GAM h;  2D0Q B;  2XD0 A;  4KUI A;  3PNW C;  4Y91 A;  3SWN B;  3OBY A;  5DM7 R;  2XDP A;  1KHC A;  3GPL A;  1XQH A;  4E7I A;  3JCM J;  3M9Q A;  3PT9 A;  1VQL A;  3M56 A;  1VQ5 A;  4BE0 A;  3CBP A;  3S3M A;  3DB3 A;  4O5V A;  5DLO A;  2R5A A;  4M75 C;  2VGM A;  1RI0 A;  4EMK A;  5GAN g;  2CGH A;  2O4X B;  2LX9 A;  3CXC A;  5GAN 5;  1QVP A;  2P4T A;  3MEA A;  4N0A A;  1WGS A;  4OB3 B;  3VJP A;  3PIO A;  4ME7 A;  3JCM P;  1YIT T;  1FWZ A;  4M78 D;  1VQ9 A;  4JRQ A;  4OF1 A;  1BI2 A;  4FL6 A;  3CCR T;  4L6V 5;  2LNV A;  2E6Z A;  5CQX A;  3CCS T;  3P8H A;  3V7S A;  2QEX T;  4M78 E;  3L2U A;  5GAO n;  4FT4 A;  4JLG A;  4BB7 A;  4IUP A;  2L89 A;  3L2V A;  5GAM g;  3UT1 A;  2E12 A;  3HRS A;  4EMG A;  4M7D G;  2JNG A;  2PVG B;  3EFR A;  5CK9 A;  3L2Z A;  1VUB A;  1JJ2 S;  2XU8 A;  3FJP A;  2KY9 A;  1DJ7 B;  3QDR B;  2E70 A;  3CBM A;  2EQJ A;  5L8R E;  3GIB A;  4R55 A;  4N4H A;  1BI1 A;  3JCM f;  2MWO A;  2RD1 A;  1S72 A;  4C92 E;  3CMA T;  2E41 A;  1UB4 A;  4FIB A;  5D6Y A;  3I55 T;  5M9O A;  4C5H A;  4C92 F;  3A5Z B;  1B34 A;  3CCJ T;  1N27 A;  3LW5 E;  4C5E A;  4PNO A;  1SSF A;  3OS5 A;  3QKJ A;  4RCC A;  1LJO A;  4A4E A;  5CKH A;  5DLQ E;  3J81 E;  3SB2 A;  3CC7 T;  1QW1 A;  4F7U G;  3CD6 A;  2DXB A;  3JRZ A;  3KBG A;  4M75 A;  2DJZ A;  2GQV A;  3MCA B;  3CC4 A;  1G3T A;  3ME9 A;  1BI0 A;  4NS5 A;  3A8M B;  2LDM A;  1VQ8 A;  3HPW A;  3CCQ T;  2RK1 A;  2WAC A;  4J7F A;  2D6F A;  2KQW A;  2ZPH B;  4M7A G;  3JB9 G;  4N4G A;  5A0L A;  2FL7 A;  2OTJ T;  1JBM A;  2QDY B;  4M78 C;  3JCM d;  1VQM A;  1N9R A;  4J6X A;  1K9M C;  4M7D B;  4BDY A;  1PSF A;  1VQL T;  1VQ5 T;  3CCE A;  4J6W A;  3N5B B;  1X6O A;  1WQ7 A;  1BIB A;  3RES A;  3LX7 A;  4PL6 A;  4DOV A;  2JVV A;  3OYD A;  2HAX A;  1UGR B;  3LWH A;  2E65 A;  3HL8 A;  3OS1 A;  1OZ2 A;  5LJ3 f;  4E7J A;  5FU6 B;  1NPR A;  2K2V A;  2Y4X A;  5DY9 A;  3EFS A;  3MO8 A;  1I81 A;  4C92 C;  1Y7X A;  3RKY A;  3JCM W;  1VQ9 T;  1Q7Y C;  2KK4 A;  1QVG S;  4M7D F;  3H8Z A;  1YJW A;  2ZPE B;  5I21 A;  3PFS A;  5I2S A;  1YI2 A;  3INZ A;  3OYJ A;  3F70 A;  1MHN A;  1IZ6 A;  5GMK e;  1WJQ A;  4C5I A;  2X35 A;  3SDZ A;  4JS4 A;  1M1G A;  5FLX E;  3OW2 S;  1AHJ B;  4FSX A;  1LOJ A;  2XI9 A;  2Y4Y A;  5KCH A;  1JB0 E;  4C8Q D;  1UGP B;  2K4Y A;  3MHX A;  4PJO D;  1K73 C;  1YHQ A;  5KE3 A;  3L2R A;  1S72 T;  3FEO A;  5KH6 A;  2VXF A;  1JRI A;  2LCC A;  3LGF A;  1KQ1 A;  4XK8 E;  5CO7 A;  4BI8 B;  5LJ3 d;  4C8Q E;  1HXD A;  3LLR A;  4PJO E;  2BUD A;  1K73 U;  3L2Q A;  1NJI C;  3CXC S;  4M78 A;  1R8O B;  4EMK C;  1KD1 U;  2OTL A;  2RHX A;  3OB9 A;  4OGC A;  2M9U A;  3JSC A;  4N0A C;  4A4K A;  4ZN3 A;  1Q81 C;  5FRN A;  4N4I A;  4FU6 A;  3X28 B;  1P92 A;  1M1K C;  5GAN 2;  3M5A A;  1VQK A;  3M57 A;  1VQP T;  3CCM T;  3CCL A;  3O8V A;  2VV5 A;  2K5F A;  3G6E A;  4OGE A;  3P8D A;  1KQS S;  3OYG A;  3A8G B;  2L5Q A;  3C12 A;  4JS5 A;  4C0D B;  4C92 A;  5CKF A;  3GNG A;  2ZPF B;  2BIV A;  2RI5 A;  1W2B S;  2P0K A;  3M4Y A;  3NTI A;  5GAN e;  2CYZ B;  3WXM B;  2EIF A;  3DLM A;  4BY6 B;  2OAU A;  2XDB A;  3E1S A;  3G4S T;  4OVA A;  2MAM A;  2XK0 A;  4GY5 A;  1FXX A;  4HCB A;  1HK9 A;  2VC8 A;  2JTF A;  4D6W A;  3J80 E;  1I4K 1;  3OYE A;  1QVG A;  3I56 A;  3FIF A;  3NTK A;  4NL2 A;  3EAE A;  2F5K A;  3PMI A;  1VQN T;  2KDS A;  4WF2 A;  5GAM e;  3QG1 A;  2EJ9 A;  1K8A C;  4C8Q C;  2A7Y A;  2EAY A;  2HD0 A;  3OQ5 A;  4B9W A;  4ZTJ A;  1KQ2 A;  4PJO C;  4MZT A;  2M0O A;  4QQD A;  1YI2 T;  3E9F A;  5LJ5 f;  5FU7 B;  2XG8 D;  3JCM V;  5GAO p;  2LT1 A;  4RKU E;  1VIF A;  3C95 A;  2HNI A;  2Y90 A;  4RCB A;  2RJD A;  1GXI E;  2JTM A;  4JUV A;  2VXE A;  1N6A A;  1Y96 A;  3TRE A;  3UWN A;  3HRU A;  3A8L B;  2MF2 A;  1KC8 C;  2CS7 A;  3QYG B;  1VQ8 T;  2RI3 A;  1M9S A;  4IUV A;  1KQS A;  4LDX A;  4LDW A;  2LCL A;  4DOW A;  1H64 1;  2FYK A;  1WJR A;  2JZ2 A;  2WSF E;  2P0P A;  2E10 A;  4XAX B;  5HY6 A;  3RKW A;  3V8K A;  4A53 A;  5GMK l;  4JJN K;  3G71 A;  1W2B A;  2IG0 A;  3JB9 H;  2DPP B;  1VQ4 T;  1KG1 A;  4L5G A;  3OMG A;  4C92 D;  3MEW A;  2DZC A;  5LJ5 d;  2KSS A;  4QQG A;  4M77 B;  2XDD A;  3CC2 A;  2F5T X;  1ZQ1 A;  2K5L A;  5KE2 A;  3JCM h;  2WSE E;  4XU3 A;  1QVF A;  3G6E T;  1WJS A;  4J8O A;  3M58 A;  3CCU A;  4J83 A;  1TH7 A;  3JB9 J;  4P5N A;  3CPF A;  3JB9 I;  4M77 E;  4BE1 A;  1VQO T;  1OI1 A;  3CCV A;  2QI2 A;  2QQR A;  4C8Q A;  2DZ9 A;  4PJO A;  5GAM d;  3OYL A;  3H6Z A;  4QVZ A;  3S6W A;  5CCA A;  1M4Z A;  4M77 F;  2EKO A;  3QBY A;  5CKD A;  3LYI A;  1G3S A;  3QHS A;  4JRP A;  3CPW A;  1N9S A;  4J7I A;  2EQK A;  4MZP A;  4LDU A;  3T9N A;  4Q5W A;  1WNL A;  2RA2 A;  1I8F A;  5A0D A;  4ATO A;  3I56 T;  4XU1 A;  1OZ3 A;  3MP8 A;  2CZ7 B;  1NE8 A;  2GFA A;  2EYQ A;  2PVD B;  4EMH A;  2QA4 T;  4KUD K;  2D9T A;  2QQS A;  2I2L A;  3M55 A;  2YLB A;  2ZZD A;  3JCM g;  5CR2 A;  3JCM X;  5GAO r;  1WPY A;  1BI3 A;  2MI6 A;  4QQ6 A;  5IAY A;  4M7D D;  4QVD A;  1U1T A;  2QQA A;  1XNI A;  4PLL A;  4BAC A;  1K9M U;  2X4W A;  1EIF A;  2RHI A;  4V2S A;  5GMK i;  2XHC A;  3WVD B;  5GAO m;  4KBM B;  4OB1 B;  3VYG A;  4M7D E;  3BDL A;  3G7Z A;  3M59 A;  5LJ3 h;  5GAN 3;  2RJF A;  3M54 A;  3GF5 A;  2V8K A;  3DLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...