2RJDA

Crystal structure of l3mbtl1 protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
325
structure length
321
Chain Sequence
ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 82
structure length 321
sequence length 325
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjdA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjdA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjdA03
2FHDA 4ZTFA 2EKOA 4II1A 3FEOA 4FU6A 5KE3A 3MEUA 3OB9A 3C4SA 2BUDA 4NS5A 3OYCA 4B9WA 2QQRA 3S6WA 3OYFA 4E7KA 2GF7A 4HCZA 2LTOA 3CEYA 3MEAA 3L2UA 2R5MA 3QIIA 5KCOA 5FRNA 2XDPA 3ASKA 4IUUA 4N4HA 2RHUA 4E7HA 3DB3A 3LGLA 2L3RA 2R58A 4ZTJA 4OVAA 4UC4A 3ZEHA 5C0MA 3OYIA 3LX7A 2L89A 2K3YA 5FROA 3OMGA 5KH6A 2WACA 5D6YA 2RHYA 2K3XA 4B9XA 2MWPA 2RI5A 3F70A 5D6XA 2BIVA 2IG0A 1XNIA 3LGFA 3H6ZA 2X35A 4EDUA 2BKDN 3MEWA 5CIUA 2F5KA 3OYDA 3GOXA 4C5HA 4A4FA 3NTIA 2VYTA 3Q1JA 3OYMA 4PLLA 2EFIA 3O8VA 3OYJA 4CRIA 3PMIA 3OYHA 5IN1A 3OYLA 2EQMA 3LH0A 4A4EA 3L2QA 1WJRA 2X4WA 5J39A 4LD6A 4BDYA 2M16A 3MEVA 5IAYA 3S3NA 4N4GA 5FRMA 4BE0A 4C5IA 3NTHA 2DIQA 2XK0A 2R5AA 2CKKA 3LYIA 4IUVA 5KE2A 2RHXA 3EAEA 4IURA 2DAQA 4IUQA 3OS2A 3FC3A 3OQ5A 3MP1A 4GY5A 3PFSA 3OYAA 2RJEA 1OI1A 2RI3A 2RHIA 3MO8A 3OY9A 3L2RA 5D6WA 4A4HA 2M0OA 2YRVA 3DLMA 3QJ6A 2RHZA 1OZ3A 1OZ2A 2RJCA 4QVZA 4E7IA 2DIGA 3UWNA 3S3OA 3MP6A 3MP8A 4QW2A 3P8HA 1WGSA 4BD3A 3ME9A 5J26A 4IUPA 4QQGA 2R57A 4PLIA 2EQKA 4QQ6A 3UT1A 3OYKA 1KHCA 3OS0A 3L42A 5KCHA 2GFAA 3P8DA 2EQUA 2GFUA 2RO0A 3OS1A 4E7JA 3E9GA 4N4IA 1SSFA 4BDZA 4C5GA 3NTKA 2MWOA 3OYBA 3QBYA 4Q5WA 1RI0A 2LVMA 2NLUA 2RJFA 4L59A 2G3RA 3OA6A 2E5QA 2HQXA 2RI2A 2JTFA 2D9TA 2QQSA 4QQDA 3LLRA 3SD4A 1H3ZA 1OYXA 4BE1A 2B8AA 4E7LA 3KUFA 2L8DA 2O4XA 4PL6A 1N27A 1MHNA 2RJDA 2O4XB 3M9QA 3L2WA 4IKFA 3L2VA 2P0KA 4BACA 3PMTA 2JZ2A 3S3MA 3BDLA 2M1HA 5M9OA 2E6NA 2X4XA 3H8ZA 3OYNA 3PNWC 3QKJA 4BE2A 3DB4A 2LCCA 4X34A 1WJSA 2LDMA 2PQWA 4RG2A 4FL6A 3OYGA 1WJQA 4C5EA 4IUTA 2X4YA 4A4GA 3OYEA 2LRQA 2HQEA 3META 5C6SA 3OMCA 4Z02A 2EQJA 1G5VA 3FLGA 3E9FA 3FDRA
chains in the Genus database with same CATH superfamily
3N5BB 1YI2Q 3FEOA 1LVKA 1ZSZA 1VQ7Q 5CVIA 2LX9A 5LJ5h 2EWNA 4DBQA 1X6OA 3CCET 5FU7C 3OMGA 5CKHA 3HSBA 4B9XA 4L5GA 1YFNA 1XNIA 2X35A 5CIUA 3CCVQ 1U3OA 3A8GB 4PLLA 2QEXT 4CRIA 1YIJA 3DKMA 3OYLA 2ZPGB 1PD0A 4OMNA 1WJRA 2X4WA 1J3TA 2QXFA 4TVRA 1K8AR 4C5IA 1RAHB 2GTJA 2EGCA 1Q7YC 2DAQA 4HT8A 4JJCA 5KYUA 5GMKm 4D8DA 2V1RA 1U1TA 4R55A 1M1KU 3DLMA 4JRPA 4C92E 2D6FA 1YJWQ 1WGSA 1UEBA 2EGAA 2R57A 2IVWA 1VQ9T 2EKHA 3L42A 2OTLQ 4J6YA 3P8DA 1ABQA 2DTHA 3VKIA 2LVMA 3CXCP 2VVKA 1TOVA 3JCMd 2FVUA 3NGPA 2QQSA 1TWBA 2JN0A 1I5OB 2O4XA 2RJDA 1KC8R 1TUGB 3EG2A 3PMTA 1CSKA 3CC2A 3PVLA 1NBEB 2AK5A 3BFMA 3PE0A 1XTDA 1VQ8Q 2EJGA 5KYWA 2DFUA 2DLPA 1E7OA 1VIEA 2DYIA 2EQJA 3GF5A 1M27C 3EGXB 2FO0A 5GANf 4C92G 3I55Q 1YITT 4N4HA 1I0CA 3VRYA 2CT4A 3CPWS 4JLGA 1PKSA 2RHYA 1X6GA 1AZGB 1M9SA 2BE9B 4FYYB 1ZUYA 2ZPBB 3GNFB 1HD3A 4A63B 2NUTA 2OTJA 2LJ0A 4RTZA 1X2KA 3HRUA 2EQMA 4Z88A 1YBYA 4GBQA 4BI8B 3MEVA 5DY9A 2DX1A 4X9CA 4FCYA 2RPNA 3JV3A 1OX8A 3CCQQ 2COZA 1NJIR 3MP1A 1VQNQ 2KXDA 1O9SA 2X4JA 4ZGEB 2OAWA 3M59A 2KQWA 4QKUA 1OPLA 4JJNK 3CC4T 2DL5A 4C92D 5GAMh 1VOMA 2FPFA 5J26A 1VQLT 3RIRA 1VQ6Q 1VQPQ 5EC7A 4LDXA 3OYKA 1N8RC 4PJOC 3P8BB 3I5RA 3RERA 3H0IA 2GFUA 3A8LB 4OMMA 3PTAA 2JXBA 1VQKQ 3LH5A 4QVDA 2KRNA 4M75C 2VASA 1R0BG 1K9MR 2RB6A 1IO6A 1AWWA 2OJ2A 2CSIA 2E10A 1Z9QA 1RABB 1QCNA 1TXQA 3URGA 3QKJA 1RAFB 3CC2T 1RADB 2GNCA 4WCIA 4A4GA 3JCMb 2BTTA 2LRQA 5C6SA 2O9SA 3JCMf 2QA4Q 2K6DA 3QJ6A 2KXCA 4KULA 3EG1A 4DQ2A 2DL7A 1GFCA 1AVZC 3OB9A 1SSHA 5CKFA 5I21A 3QXEB 3TREA 2YXYA 3L2ZA 3QDRB 2L3RA 4ZTJA 2BZXA 3CCMA 2KBTA 2WACA 5D6YA 1Q7YU 1NJIU 1VQ4Q 3C94A 4M77G 3PIPA 3GNGA 1IREB 2P84A 2D1XA 1VQ5T 2K2MA 2EYXA 4J9EA 1JXOA 5GAOm 2DPPB 3J81E 3VU3C 4PJJA 1UB4A 4Z8AA 3V8KA 1HYOA 1G3TA 2EJ9A 3A5ZB 4E2FB 2KEAA 1AOJA 2J05A 1HK9A 2RQUA 2DRMA 3OW2A 3V7CA 1WXTA 1KQSS 3IQLA 3P8HA 4ZGDB 1D3BA 3GLXA 4M77C 1NE8A 1M8VA 1NPPA 2DD5A 3EHQA 5HK3A 2NUPB 1T0JA 5A0GA 2P4TA 2EQUA 4JRQA 4E7JA 2LQNA 1K9AA 2ROLA 1Q82C 3NTKA 1RI0A 1UG1A 2CSQA 3A8MB 4C92B 1X75C 1HXDA 2JTFA 1ZSZB 5L23A 4HXJA 4ANJA 2ROTA 4BE1A 4E7LA 1ZBJA 1IXDA 1TS9A 3PGGA 1YJNA 2E6NA 4NOYA 4M7DA 4M7AC 2COYA 2LDMA 5GMKh 2COWA 1BIBA 4C5EA 2DNUA 2X4YA 2J7IA 4FYWB 4C92F 2QYZA 2CP3A 4KBMB 2K5FA 2ATCB 2L0AA 4ZTFA 2MK5A 5CKDA 3UATA 4GLKA 2MI6A 3OSSC 1S72Q 5KE3A 3BDUA 1VQMT 1QKWA 2LTOA 2A0FB 2X51A 2KVQG 2V1QA 1RAIB 5LJ3h 5C0MA 2JM8A 3OYIA 2CDTA 3HHTB 1VUBA 2DEQA 3FRNA 2QTVA 5KYUB 3CCUQ 3H9NA 4J9HA 4M78A 1Q86C 2RM4A 2AKLA 3VS6A 4HVVA 3X28B 4FYXB 4DOVA 1WLPB 2QGFB 3QWXX 3M58A 2XD0A 3TU4K 2EYWA 1QVPA 1N8RU 1GCPA 1BI2A 4M7DE 2XHCA 2CP2A 1OI1A 2RI3A 2M0YA 2CYZB 2FRWA 1JQQA 3ZFJA 7AT1B 1IHWA 2AT1B 2V26A 3M53A 5LJ5e 4XTVA 4BD3A 4FW1A 3VS4A 1W4SA 4IUPA 5GJWB 3VS3A 5HKCA 3QYGB 1Y7XA 3UT1A 2JT4A 2CP5A 3SHWA 4LDUA 5KYWB 2JVVA 2KSSA 4OMLA 4EIKA 4EMGA 5CR2A 2FPEA 4ORZA 4C8QE 2L3SA 1D0XA 2MF2A 4JUVA 1FMKA 4IKFA 5L8RE 2CZ7B 2E5KA 2RA2A 4CC4B 4DEXA 3CPWP 1YJ9T 4E6RA 2YHTA 2H8HA 4LN2A 3CPWA 4M78E 1YI2T 4A54A 4M77B 2XG8D 3JCMW 3CD6A 2JMAA 4IIOA 1VQ7T 2DETA 2FYKA 3E1SA 3UA6A 2HQEA 1OULA 5GAN5 1QCOA 3I56Q 5AYFA 1UFFA 2PZ1A 1M1KC 1PNJA 2NUTB 1OQKA 3HP9A 1GCQC 2R5MA 3TSZA 1YHQA 4J7FA 3CCVT 4LUEA 3CMEA 3H41A 1M3BA 3REBB 2DL4A 4E7ZA 1F1BB 1VYTA 2BKDN 4CI0C 1JBMA 1NPRA 5GANj 1M8MA 3OYJA 5LJ5g 2CP7A 1IGQA 1YWPA 3LH0A 3CCEA 1RACB 3GPLA 1YJWT 3NTHA 2E12A 1QQJA 3BE3A 4IURA 1Q82U 4IUQA 3CMAQ 4MMKA 1QWEA 1TTHB 2YUOA 2RK2A 4J7IA 2W0ZA 2QAZA 2RHZA 2RJCA 4OP0A 3G7ZA 1PHTA 2VGMA 4O5VA 4C5GA 1WHKA 3QBYA 3H0HA 4J5YA 2DBKA 1X27A 5KYXA 2KGTA 1VQ8T 1M3CA 3M0QA 3AHUA 1EZZB 2B86A 3OYYA 3KUFA 4FSSA 3J80E 2P0KA 2M1HA 1VQ9A 1GL5A 3RUXA 1NM7A 3JB9G 3MCAB 1LOJA 2OAUA 4BI3A 1WJQA 3A98A 1AZEA 3QPHA 5A0DA 3I55T 2RD1A 4D6WA 1K0XA 5KYNA 3FIFA 1KSWA 3PIOA 1SKUB 3HFOA 2YSQA 5GAMe 2CGHA 3MHXA 1KC8C 4E7KA 1W1FA 4ELZC 3G6EA 4E7HA 2BE7D 3OW2S 2L89A 3CBMA 5KH6A 2K57A 5FLXE 1KQSP 1YCSB 3LWHA 2CP0A 2YDLA 1KQSA 1EIFA 1B34B 3GOXA 4YTLA 1WHGA 3HPWA 3I9QA 3CCQT 1YITA 3OYHA 1VQNT 5GMKl 1I5LA 2ZPHB 4LD6A 3JB9D 1SHFA 2E70A 2O88A 4XTZA 2CZ0B 2L5QA 2YUNA 3M5AA 5CQXA 2I0NA 1VQ6T 1VQPT 2A3LA 3FC3A 1KG1A 3SWNB 3OYAA 2EYZA 1QKXA 1QCFA 1VQKT 4KT0E 2YRVA 2HCKA 4QVZA 2ENMA 4RTWA 5IHIA 3MP8A 1H641 4QQGA 4PJOA 2K5IA 1CKAA 2GFAA 4JRIA 1NYFA 1O75A 2M51A 2P4RA 4BDZA 1AHJB 4EMKA 2PU9B 1LNXA 1VYUA 2DD4A 1NJIC 4J6WA 3OA6A 3J7AF 4KRTA 4N0AC 3CPFA 3CC4A 2L8DA 5GAMg 1Y96B 2PVOB 4M4ZA 1VQLA 4PFZA 2QA4T 1KQ1A 4JRKA 1WYXA 3JCMP 3GIBA 3VS7A 4HCKA 1I81A 3OYGA 2E6ZA 2KI7A 4XU0A 5HCKA 4C0GA 2MCNA 1YWOA 3QZ5B 3UF4A 5GMKi 2DK3A 4ELYC 2FHDA 2EKOA 1K9MC 2BZYA 2KT1A 2DA9A 3L2UA 3CEYA 4KH0B 2PNIA 1VQ4T 3DB3A 3G4SQ 3G6ET 2K3BA 1G2BA 2LMJA 1VQOQ 4C0FA 3AT1B 5GAOn 4QVCA 1WZOA 2ZPEB 1TU0B 1Y57A 3EHRA 4PJOE 4DBRA 2MIOA 2QK0A 2FB7A 2XDDA 3D7SB 4RTTA 3M4YA 1PC0A 1G3YA 2VGNA 4JPBW 1U8RA 1K73R 1K0SA 2YLBA 2M02A 1Y71A 4JLIA 3SEMA 2CH4A 2LJ1A 1OU9A 1A0NB 4F14A 3L2QA 5GMKe 2J6KA 3EG0A 1R77A 3X24B 5CK9A 1JJ2A 1AWXA 5IAYA 2E65A 4XU2A 5EG2A 1YNZA 1BIAA 2DIQA 2JOYA 2CKKA 1K8AU 2DL8A 3EAEA 3CCJA 2MYSA 2Y4XA 4V2SA 3G71Q 3VS5A 2KK4A 1VQ5A 4VUBA 2L2PA 5FW9A 4CC2A 1BI0A 5LJ3e 1ZSGA 1B07A 3REAB 5HY6A 5GAOp 3CCSQ 2ZGWA 3OS0A 4RTUA 4XU3A 3T9NA 2D8JA 1SSFA 3MPUB 2KR3A 4KGVB 3I35A 3X25B 2YT6A 1FXXA 3G1JA 1QWFA 4C92C 2E3HA 1VYVA 2E5QA 2DMOA 2G6FX 2RI2A 1SF9A 3JB9F 1ZSZC 1W2BA 1DJ7B 5KYYA 3CCRA 1PRLC 2JMCA 3O5ZA 3M9QA 2IIMA 3UDCA 1KC8U 4PJNA 4F7UA 5GAN3 2HSEB 2LCCA 1S72T 3ZBDA 1IHVA 1MNEA 1EX4A 3OMCA 8AT1B 8ATCB 2JJ9A 3MKDA 2EYYA 1ZQ1A 4ZNXA 4OMFB 1K73U 1C6VX 3FJPA 3JAME 2A36A 3CCUT 1KQ2A 4EMHA 4DBHA 3QJYA 4OB2B 4XTYA 2QEXQ 3F70A 4XTXA 3LGFA 2QI2A 2VB6A 4PJOD 2EW3A 3QHSA 4NL2A 1I1JA 1UDLA 1M2OA 1VQMA 3Q1JA 2EFIA 3PMIA 5J3BA 3QDFA 5FU6B 5LJ3g 2RNAA 5J39A 2M16A 2V8KA 4RMOA 5FRMA 4F7UE 2A28A 3EFSA 4M7AE 3R6NA 4O6JA 3RMSA 5GANh 3CCJT 3CCLQ 2M0OA 4DA4A 2HZYA 3UWNA 2DYBA 1ZX6A 3TCJA 4DBFA 2KRMA 5I2MA 1WIEA 1KHCA 1KHIA 1PSEA 1UGQB 1M90R 2E4HA 3RBBB 2D0QB 2J6OA 4F04B 2X3WD 1UUEA 3A8HB 3CC7A 2C0TA 1K9MU 3E2UA 3OW2P 5FWBA 4BACA 3CCRT 1IRXA 2JZ2A 3I56T 3H8ZA 3RKXA 1CKBA 1BCMA 3FJ5A 2KYBA 1Y0MA 2DVEA 1UTIA 4PJMA 1ZBXA 1OOTA 2XICA 2PUKB 3PT9A 2XU8A 1JRIA 2ECZA 1NEGA 1BB9A 2MMPA 1ZA2B 4OMOA 1YJ9A 3INZA 4JZ3A 2MOXA 1YI2A 1ZUUA 2FZCB 2HKQB 2LCSA 1IZ6A 5I11A 1VQ7A 3LGLA 2OX7A 2R58A 1MGQA 4OVAA 4AG2C 1EFNA 3X26B 2JUFA 1WXUA 5CKBA 1D1CA 1YP5A 1C0MA 2BZ8A 1KD1R 1YIJQ 4OB3B 1BBZA 1MV3A 2DO3A 3O8VA 4DEYA 3CMAT 5IN1A 1I4K1 1X69A 2FRYA 3VRZA 1WI7A 4AFQC 3CCVA 5LL6S 3HKSA 6AT1B 5AT1B 3JCMh 3M0RA 4B6MA 2CP6A 3EG9A 1M90U 2GTOA 4C8QA 5LJ5d 2V8JA 3LYIA 4IUVA 1H92A 4XU1A 2D0NA 4GY5A 2JTMA 3VUZA 1D1BA 3L2RA 2JW4A 4J6XA 1M4ZA 4MDWA 4EPCA 2DIGA 3ME9A 2LQWA 4FT2A 2FPDA 4PJOF 1TUDA 1YJWA 3RNJA 3DLLA 1KIKA 1PSFA 2OTLA 3M55A 3KBGA 3LLRA 2HBPA 3CC2Q 3M0PA 2GBQA 3CC7T 4PL6A 1SHGA 3V7SA 2O4XB 2SEMA 3GBQA 1I07A 3JB9J 5GAN6 4KGXB 1ZHIA 1SPKA 3FB9A 4FL6A 2EBPA 3LWIA 3OYEA 4OGEA 1JJ2S 1MNDA 1NLPC 2ZPIB 3E9FA 1VQ8A 1M5Q1 4OGCA 2JM9A 3EGXA 1KD1U 4FU6A 4NS5A 2BUDA 3ULRB 5KCOA 1NYGA 2YRCA 2FZGB 5IXBA 1PM3A 2HKNA 3I55A 1OPKA 2OTJQ 1YN8A 2IG0A 1Y07A 4EDUA 4M7DG 3QG1A 1N5ZA 4OB1B 2CREA 3NFCA 5GAOq 1WQ7A 4HCBA 1W2BS 1VIFA 1M3AA 2P0QA 1WXBA 2ED0A 4MZPA 2E41A 4BE0A 4C0DB 5CQYA 1QP3A 4MZTA 2C0OA 4J9FA 2YUPA 3SWNC 1V76A 4J9IA 2L3PA 1QVGA 2CUBA 5D6WA 5KYYB 3CCQA 3S3OA 4C8QG 1VQNA 2CH4W 2F2VA 3EGDA 1YCYA 2DF6A 2M9UA 2DJZA 5ECAA 2LT1A 3HTRA 3PVQA 1ARKA 1WQWA 3OS1A 2WSCE 4N4IA 4M78G 5LJ5f 1VQ6A 3OSVA 1VQPA 4RCCA 2NLUA 2RJFA 3M0TA 4XK8E 3JCMc 1D1AA 4M7DD 4LUDA 2OTLT 4QQDA 1WNLA 4N0AA 1VQKA 1H3ZA 1AWJA 1PWTA 1X2QA 4PFOA 4F7UF 3L2WA 2GQIA 3VV0A 1XOVA 3BW1A 1UGSB 1UHFA 4J8OA 2ZAEA 5IT9E 2KMTA 4RG2A 4RTVA 2MAMA 1Q81R 5GAMd 1K8AC 4IIMA 1NZ9A 3META 1TSFA 1KK7A 2HL3A 1GBRA 2HAXA 9ATCB 5DLOA 1VQOT 2HBWA 1HSQA 2QDLA 3OYCA 4C8QD 2QA4A 4R0KA 4HCZA 2K5LA 3CCMQ 5FRNA 3VS0A 3V8JA 3R6OA 1FMVA 3LX7A 1G8XA 4CC3A 4M78D 2HEQA 1OEBA 3EFOA 3SFMA 3HRTA 2DE0X 2PTKA 3EH1A 4KUDK 2KDSA 3JCMX 3MEWA 2EYQA 1GRIA 1SG5A 4RUGA 4XTUA 2CZ1B 2E3IA 2VYTA 1Q95G 2LZ6B 4J9BA 1VQ4A 2ZPFB 4AT1B 4LXCA 1U5SA 3G71T 2CZ6B 1PD1A 2WSFE 3CCST 3EG3A 1QLYA 3JCMV 3C0CA 3PFSA 2RJEA 2DXCA 1RAAB 1K73C 3VYGA 4A4HA 2DL3A 3THKA 1OZ3A 4E7IA 3I5SA 2RK1A 2GGRA 1B7TA 1D3BB 3TQ7P 1G3SA 4PLIA 2NUPA 4QQ6A 4X9DA 5KCHA 4ME7A 1ZLMA 2RO0A 1XQHA 2GCXA 2VXEA 1Q81U 4P5NA 2HL5C 1BKBA 1YJNQ 4JDSA 3VUBA 5DLQE 2AHJB 2JNGA 2LQKA 1ABOA 1MHNA 1MMNA 4OF1A 3BDLA 3QYHB 2F2WA 4M7DB 4JJBA 1G83A 3CQTA 4Z89A 3JCMJ 1UGVA 5GANe 2K7AA 4E47A 3TVTA 1M2VA 1RAEB 4M75A 2DVJA 4RCBA 1D09B 4PNOA 2QGGA 4ATOA 3C4SA 2DEUA 3MJXA 3NMZC 3MEAA 1FMWA 3QIIA 4BI4A 4F16A 4M7DF 4IUUA 2RHUA 2VC8A 1JXMA 1S72A 3ZEHA 1WHHA 5GAMf 3GP8A 2QQAA 3EG9B 4C8QB 2EVRA 2MWPA 4BY6B 2BIVA 1G3WA 3C12A 2F5KA 4FIBA 3OYDA 4LD9K 2K4YA 4M78B 2VKNA 2FEIA 1ZUKA 2EJFA 3CCUA 1BU1A 4ESRA 5FU6C 2DXTA 4ZGJB 4LNPA 3A8OB 4LDVA 3CCLT 2DTIA 1AD5A 1WFWA 2D8HA 2HD0A 4C8QF 1OX9A 3RMQA 4CC7A 3KXTA 2R5AA 1WHLA 3E19A 5LJ3d 5IHNA 3OS2A 3CXCA 1M1GA 3ZL7C 2I2LA 1RAGB 4M78F 1RL2A 1LJOA 4M75E 2AIRB 1AWOA 4QW2A 4RTXA 1WHMA 3OS5A 2X9HA 1UGRB 1WPYA 4JJDA 1JJ2P 1MV0B 3JB9I 2QASA 2LQ8A 2K79A 5IXFA 2MWOA 2O2OA 3OYBA 5GANg 1GFDA 4E7SA 2F2XA 1UHCA 4AFSC 3SD4A 2A37A 1GXIE 2K9GA 3CD6Q 2LT4A 1N9SA 3L2VA 1Z9ZA 5M9OA 4M77A 3JCMe 3V8LA 3A1PA 4WF2A 2SRCA 1K4US 1BYMA 1QP2A 1M90C 4AFUC 4IUTA 2EQIA 2F5TX 3HL8A 1LPLA 2YLCA 3M0SA 5GAN7 2DBMA 2RN8A 1YHQQ 4II1A 3TSWA 4PJOG 1W2BP 3VS2A 1ACMB 2NWMA 1WX6A 1C1AA 1WHJA 2GF7A 3I56A 2LP5A 1SEMA 3KFVA 3CMEQ 1QVGS 3ASKA 1YIJT 4M75G 3VYHB 4M7AA 2KYMA 5FROA 5FU7B 3BY7A 1KJWA 1BI3A 3M0UA 1Q7YR 2HSPA 3X20B 3M4GA 3WXMB 3RDVA 4K11A 1TH7A 3CCEQ 2QDYB 3OYMA 2YWWA 2X3XD 3EGDB 2V8IA 1LCKA 3VS1A 4X1VA 2XDBA 4BDYA 3EH2A 2J6FA 1IGUA 4M77E 4EMKC 1NG2A 4HA8A 2HNIA 1KD1C 3OY9A 1WDXA 4R56A 5GAOl 5CO7A 4RTYA 5GJVB 3CMAA 4HCCA 3MP6A 2RQTA 4MMLA 4M75D 1TG0A 3V7RA 2EIFA 3JCMg 3RESA 4F17A 1FWZA 4ZN1A 1BI1A 1QVFP 2Y90A 1QVFA 2VWFA 2MPXC 5LJ3f 2GQVA 2DM1A 4HVUA 4AFZC 3NPFA 2XMFA 5KYXB 1VQ9Q 1R8OB 2CS7A 1PCXA 4J9GA 4LDWA 4MDXA 1E6GA 1UECA 2RMOA 4FW2A 4L6V5 3WVEB 4BE2A 2LJ3A 2JTEA 2KT8A 2XKOC 1N6AA 5LJ5j 4FT4A 2W10A 2DXUA 3EFOB 1XJWB 1GBQA 4Y28E 2NYSA 3FDRA 2AKKA 3G6EQ 2LC4A 4FM4B 4XQ3A 3S6WA 3OYFA 1RI9A 2OTJT 1UE9A 5CAIA 3RKWA 2DZCA 2RQRA 1RLQC 2ZZDA 1X43A 1I8FA 4BUGA 1TUCA 2E1HA 4OB0B 1JEGA 1PKTA 2PVDB 4XAXB 1WA7A 2QQBA 4F7UG 2JS2A 1YITQ 1VA7A 4M7AG 4DOWA 1B34A 4C5HA 4A4FA 4ZN3A 2PUOB 3NTIA 1K76A 1GCQA 3ER0A 2F1LA 3M57A 1SRLA 4OMPA 3UPUA 2ABLA 1N8RR 2O01E 2KRSA 4C0DC 2CUDA 5I2SA 5KE2A 2QQ9A 2RHXA 1PG5B 1W6XA 2QTXA 5GAOr 1JB0E 4D8KA 4M77D 1P92A 3SWNA 3OQ5A 1OV3A 1NEBA 2RHIA 2ESWA 2Y4YA 1JU5C 4RKUE 1FX7A 2H3EB 4PJOB 2Z0WA 2A08A 2OI3A 2KROA 2RQWA 4Q5WA 2RF0A 4L59A 4EMKB 3LW5E 4BB7A 3CC4Q 1M2VB 2J06A 4M75B 2H3JA 1QW1A 1AEYA 1VQLQ 4M7AD 3UA7A 2D9TA 1AT1B 1RLPC 2B8AA 2DZ9A 1Y96A 2C06A 1E6HA 1N27A 3JCMQ 2F69A 1R0CB 2WSEE 3S3MA 3EGUA 4NL3A 3OYNA 1M1FA 1SRMA 1H8KA 5FWCA 2PQWA 4JZ4A 4PKCC 3SB2A 1OU8A 4Y91A 3CCMT 1RUWA 4M75F 2YUQA 2P0PA 4Z02A 4J9CA 1G5VA 3FLGA 2QG9B 2AZVA 3OBWA 4WTOB 1H3HA 3CXCS 2O9VA 2O31A 4FSXA 2XDPA 4KUIA 4MZMA 2E64A 1X01A 3M56A 2VUBA 1Q81C 2CT3A 2KAFA 2K3XA 3G4SA 2RI5A 1MMAA 4LDYA 4XTWA 5D6XA 5I22A 1VQOA 2LX7A 1B3QA 3C95A 1W70A 5GAN2 1MMDA 3HFNA 1N9RA 2FG0A 2HDAA 2NUZA 3SDZA 5GAN8 4RG8A 1HJDA 4J83A 4JS5A 3CCJQ 1BCOA 5GAMj 2XI9A 1Q82R 3QZ9B 4Y92A 1VQ5Q 4LE9A 1KFZA 4C0ZA 2KNBB 1IB8A 2AZSA 4HVWA 3RKYA 2LCLA 3G71A 1YJNT 2FZKB 2JS0A 3NHNA 1MMGA 2DJQA 2XIDA 4KGZB 3QUIA 1X6BA 3CCSA 3CCRQ 3H0FA 3QO3A 2L3QA 2HQXA 2EPDA 1QVGP 4HKEA 1M30A 2LNHB 3JSCA 2KY9A 4M77F 2FL7A 3RR6A 1D0ZA 4F7UB 2X4XA 2LNVA 3DB4A 4M7AB 4M7DC 4X34A 5HK0A 4HT9A 2DRKA 4GLMA 1Q86R 3VJPA 3QWYA 2HQHA 3MEUA 5GAN4 3TEEA 4B9WA 2QQRA 3QSUA 5A2QE 4M7AF 3WVDB 2EAYA 2VXFA 1BK2A 1UJYA 4UC4A 1QMCA 4A53A 5DM7R 4KH1B 2K3YA 1T3SA 2DKGA 4C8QC 3L1AA 4PJLA 4OMQA 2HMAA 1VQMQ 5IHKA 3M54A 4BY6C 5CCAA 1PRMC 2YRDA 1UJ0A 5D7UA 3G4ST 2KE9A 3H6ZA 1MUZA 1QVFS 1U1SA 2C0IA 2QEXA 4M78C 2DILA 3JRZA 1T0HA 3HRSA 4PFPA 4JS4A 4A4EA 1U06A 3S3NA 4N4GA 2ED1A 2PVGB 2XK0A 5CKEA 2RQVA 1FYNA 4AG1C 2VV5A 3CBPA 4J9DA 3MO8A 2RH2A 1JO8A 2K2VA 1OZ2A 3U23A 3EFRA 3CBOA 3CCLA 2ZCFB 2EQKA 3CD6T 3E9GA 2A7YA 5A0LA 3CC7Q 4A4KA 4FYVB 5GMKj 2G3RA 4PK4A 4QT7A 1S1NA 2DTOA 1M1KR 1OYXA 4AMCA 2EGEA 1Q86U 1K1ZA 5GANd 1V1CA 2DXBA 3OBYA 2DERA 1NLOC 3PNWC 1YHQT 1T3LA 1WJSA 1D0YA 2IPOB 5IH2A 1V29B 5LJ3j 3CMET 1ZA1B 4C92A 1YJ9Q 1UGPB 3JB9H
chains in the Genus database with same CATH topology
3N5BB 5AYFA 4II1A 1JRIA 4PJOG 3FEOA 1M1KC 2MMPA 1YJ9A 3HP9A 5CVIA 3INZA 2LX9A 2GF7A 3I56A 2R5MA 1YI2A 1YHQA 1QVGS 3ASKA 5LJ5h 1IZ6A 1YIJT 4J7FA 4M75G 2EWNA 1VQ7A 3VYHB 3LGLA 2R58A 1MGQA 4OVAA 4M7AA 1X6OA 3CCVT 3CCET 5FU7C 5FU7B 5FROA 3X26B 2JUFA 3BY7A 3OMGA 5CKHA 3CMEA 3HSBA 5CKBA 1BI3A 4B9XA 3X20B 4L5GA 3M4GA 3WXMB 3JB9G 1XNIA 2X35A 2BKDN 4CI0C 5CIUA 1JBMA 1TH7A 1NPRA 4OB3B 5GANj 2QDYB 3A8GB 3OYMA 2DO3A 3O8VA 4PLLA 3OYJA 2QEXT 4CRIA 5LJ5g 3CMAT 1YIJA 5IN1A 3DKMA 1I4K1 2ZPGB 3OYLA 2V8IA 3LH0A 3CCVA 1WJRA 2X4WA 5LL6S 2XDBA 3HKSA 3CCEA 4BDYA 2QXFA 3JCMh 3GPLA 4TVRA 1YJWT 4C5IA 3NTHA 2E12A 1M90U 4M77E 4C8QA 5LJ5d 4EMKC 2V8JA 3LYIA 4IUVA 4IURA 4HA8A 1Q7YC 1Q82U 2DAQA 4IUQA 4HT8A 3JB9H 4MMKA 4XU1A 5GMKm 4GY5A 2RK2A 2HNIA 4J7IA 2JTMA 1KD1C 3OY9A 3VUZA 3L2RA 4J6XA 4R56A 5GAOl 1M4ZA 1U1TA 5CO7A 4R55A 1M1KU 3DLMA 4JRPA 4C92E 2RHZA 4MDWA 2RJCA 3CMAA 4HCCA 4EPCA 2D6FA 2DIGA 4OP0A 3MP6A 4MMLA 1WGSA 1UEBA 3ME9A 4FT2A 4PJOF 4M75D 3G7ZA 2R57A 2EIFA 3V7RA 3JCMg 2IVWA 1VQ9T 3RESA 2VGMA 5CCAA 3L42A 1YJWA 1FWZA 4J6YA 1BI1A 3P8DA 4O5VA 4ZN1A 3DLLA 2DTHA 2Y90A 1QVFA 3VKIA 3PT9A 4C5GA 3QBYA 5LJ3f 2GQVA 2LVMA 4J5YA 1PSFA 2OTLA 3JCMd 2FVUA 3M55A 3KBGA 2QQSA 3LLRA 1VQ8T 2HBPA 1R8OB 2JN0A 3AHUA 2CS7A 3OYYA 3KUFA 4PL6A 2O4XA 3V7SA 2RJDA 3J80E 4LDWA 2O4XB 4MDXA 2P0KA 3JB9J 3PMTA 2M1HA 1VQ9A 3CC2A 4L6V5 3WVEB 3RUXA 4BE2A 5GAN6 1ZHIA 3FB9A 2XKOC 3BFMA 1XTDA 1N6AA 3MCAB 1LOJA 2OAUA 4FL6A 1WJQA 4FT4A 4BI3A 5LJ5j 2EJGA 2DXUA 3QPHA 3LWIA 3OYEA 5A0DA 3I55T 4OGEA 1JJ2S 1VIEA 2RD1A 4D6WA 2EQJA 4Y28E 2ZPIB 3GF5A 3E9FA 3FDRA 3FIFA 1M5Q1 1VQ8A 4OGCA 3PIOA 1KD1U 3HFOA 2LC4A 4FU6A 4FM4B 4NS5A 4XQ3A 2BUDA 5GAMe 2CGHA 5GANf 3MHXA 3S6WA 3OYFA 4E7KA 1KC8C 2OTJT 5CAIA 5KCOA 3RKWA 2DZCA 4C92G 4ELZC 3G6EA 1YITT 4N4HA 4E7HA 2ZZDA 3OW2S 1I8FA 4BUGA 4OB0B 2E1HA 2L89A 3CBMA 3CPWS 5KH6A 4JLGA 3I55A 2K57A 5FLXE 2PVDB 2RHYA 4XAXB 1M9SA 2QQBA 4F7UG 2IG0A 1Y07A 4EDUA 3LWHA 2ZPBB 3GNFB 1KQSA 4M7AG 1EIFA 1B34A 4DOWA 4M7DG 3QG1A 1B34B 3GOXA 4C5HA 4A4FA 4ZN3A 4YTLA 2PUOB 3NTIA 4OB1B 2OTJA 3NFCA 3HPWA 5GAOq 3ER0A 3M57A 3CCQT 1YITA 3OYHA 1WQ7A 1VQNT 5GMKl 4HCBA 3HRUA 2EQMA 1W2BS 1VIFA 1YBYA 1I5LA 3UPUA 2ZPHB 2P0QA 2O01E 4LD6A 4BI8B 3MEVA 5DY9A 3JB9D 4X9CA 4MZPA 2E41A 2E70A 4C0DC 4C0DB 4BE0A 5CQYA 4XTZA 2CZ0B 2L5QA 1QP3A 5I2SA 5KE2A 2QQ9A 2RHXA 3M5AA 5CQXA 2QTXA 4MZTA 5GAOr 1VQPT 2A3LA 1JB0E 3FC3A 1VQ6T 4M77D 1P92A 3SWNA 1KG1A 3OQ5A 3MP1A 3SWNC 3SWNB 3OYAA 2RHIA 1O9SA 2X4JA 4ZGEB 1QVGA 2Y4YA 3M59A 5D6WA 1VQKT 2KQWA 2YRVA 4KT0E 3CCQA 4QVZA 3S3OA 4C8QG 4JJNK 4RKUE 3MP8A 3CC4T 1VQNA 1FX7A 4C92D 1H641 5GAMh 5J26A 1VQLT 1YCYA 4QQGA 3RIRA 2M9UA 2DJZA 4LDXA 3OYKA 4PJOA 1N8RC 4PJOC 2K5IA 4PJOB 2GFAA 3P8BB 2LT1A 4JRIA 3RERA 1WQWA 2GFUA 3OS1A 2WSCE 1O75A 4N4IA 3A8LB 4M78G 3PTAA 5LJ5f 4BDZA 1VQ6A 1AHJB 3OSVA 4RCCA 4QVDA 1VQPA 4EMKA 4Q5WA 4L59A 2RJFA 2NLUA 2PU9B 1LNXA 3LW5E 4XK8E 3JCMc 2DD4A 4BB7A 4M75C 4M75B 1NJIC 2H3JA 1QW1A 4J6WA 3OA6A 4M7AD 3J7AF 4M7DD 2D9TA 4QQDA 1WNLA 4N0AA 1VQKA 2OTLT 4N0AC 1H3ZA 2RB6A 3CPFA 2B8AA 3CC4A 2DZ9A 1Y96A 2L8DA 5GAMg 1N27A 4F7UF 1Y96B 2F69A 2PVOB 2E10A 3JCMQ 3L2WA 1VQLA 2WSEE 2QA4T 4NL3A 3S3MA 3OYNA 1KQ1A 4JRKA 3URGA 1M1FA 3QKJA 3JCMP 3GIBA 3VV0A 1XOVA 3BW1A 1UGSB 4J8OA 5IT9E 1I81A 3CC2T 2KMTA 2PQWA 4RG2A 4PKCC 3SB2A 3OYGA 2MAMA 5GAMd 4Y91A 1K8AC 3CCMT 2E6ZA 4A4GA 4XU0A 3JCMb 2LRQA 1NZ9A 3META 4M75F 5C6SA 4C0GA 2P0PA 4Z02A 5GMKi 2HAXA 3QZ5B 3JCMf 3FLGA 1G5VA 2DK3A 3QJ6A 4ELYC 5DLOA 2FHDA 1VQOT 2EKOA 1K9MC 4KULA 4DQ2A 3OBWA 3OYCA 3OB9A 5CKFA 4C8QD 3CXCS 2QA4A 5I21A 4HCZA 3QXEB 3L2UA 2K5LA 3CEYA 5FRNA 3TREA 4FSXA 2XDPA 4KUIA 1VQ4T 3V8JA 3DB3A 3L2ZA 2E64A 1X01A 2L3RA 3QDRB 3R6OA 4MZMA 4ZTJA 3G6ET 3LX7A 3CCMA 4M78D 3M56A 2VUBA 4C0FA 5GAOn 4QVCA 1Q81C 2ZPEB 2WACA 5D6YA 2KAFA 2K3XA 3G4SA 4PJOE 3SFMA 3HRTA 2RI5A 4KUDK 4LDYA 4XTWA 2FB7A 5D6XA 2XDDA 1VQOA 2KDSA 1Q7YU 1NJIU 3M4YA 3JCMX 1G3YA 3C95A 3C94A 3MEWA 4M77G 2VGNA 5GAN2 3PIPA 3GNGA 2EYQA 1U8RA 1IREB 3HFNA 2CZ1B 2YLBA 4XTUA 2VYTA 1N9RA 1VQ5T 1Y71A 4JLIA 3SDZA 1VQ4A 2ZPFB 5GAN8 4RG8A 3L2QA 4J83A 5GMKe 5CK9A 3G71T 3X24B 4JS5A 1JJ2A 5GAMj 5IAYA 5GAOm 2CZ6B 2E65A 2XI9A 2WSFE 4XU2A 2DPPB 5EG2A 1BIAA 2DIQA 2JOYA 3QZ9B 2CKKA 3VU3C 3J81E 1UB4A 1K8AU 3V8KA 3EAEA 3CCJA 3CCST 2Y4XA 4C0ZA 1G3TA 2EJ9A 3A5ZB 3JCMV 4V2SA 3PFSA 2RJEA 2DXCA 4EMKB 1HK9A 1K73C 2KK4A 3VYGA 4A4HA 1VQ5A 4VUBA 3OW2A 1OZ3A 3V7CA 4E7IA 2RK1A 1KQSS 3RKYA 3P8HA 1BI0A 1D3BA 4ZGDB 2LCLA 5LJ3e 3G71A 1D3BB 1YJNT 3GLXA 4M77C 1NE8A 1G3SA 5HY6A 5GAOp 1M8VA 4PLIA 1NPPA 2DD5A 2ZGWA 4QQ6A 5HK3A 4X9DA 5KCHA 4ME7A 3OS0A 5A0GA 4XU3A 3T9NA 2P4TA 2EQUA 2RO0A 1XQHA 2GCXA 2VXEA 2XIDA 4JRQA 4E7JA 1SSFA 1Q82C 1Q81U 4P5NA 3NTKA 3QUIA 3CCSA 3X25B 1RI0A 1FXXA 4C92C 4C92B 3A8MB 3QO3A 1BKBA 1X75C 2E5QA 2HQXA 1HXDA 2RI2A 4JDSA 2JTFA 5DLQE 2AHJB 2JNGA 3VUBA 3JB9F 4HKEA 1W2BA 4BE1A 2LQKA 1DJ7B 3CCRA 4E7LA 1MHNA 3M9QA 3PGGA 3JSCA 4OF1A 2KY9A 4M77F 3UDCA 2FL7A 1YJNA 1KC8U 3BDLA 4F7UA 4F7UB 2E6NA 2X4XA 3QYHB 5GAN3 4NOYA 2LNVA 4M7DA 3DB4A 2LCCA 4M7AB 4M7DC 4M7AC 4M7DB 4X34A 5HK0A 3ZBDA 1S72T 2LDMA 5GMKh 1BIBA 4C5EA 3JCMJ 2X4YA 4C92F 4HT9A 5GANe 3OMCA 4E47A 4KBMB 2K5FA 4M75A 4ZTFA 5CKDA 1ZQ1A 4RCBA 4GLKA 2MI6A 4OMFB 3OSSC 4PNOA 5GAN5 3VJPA 5KE3A 1K73U 3MEUA 5GAN4 3C4SA 4ATOA 3TEEA 3BDUA 4B9WA 2QQRA 3QSUA 1VQMT 2LTOA 3FJPA 3MEAA 3QIIA 5A2QE 3JAME 4BI4A 2KVQG 4M7AF 3WVDB 3CCUT 2EAYA 2VXFA 4IUUA 2RHUA 1KQ2A 2VC8A 1S72A 4M7DF 5LJ3h 4EMHA 5C0MA 4UC4A 3ZEHA 4A53A 5DM7R 3OYIA 2K3YA 5GAMf 2DKGA 3GP8A 2QQAA 4C8QC 4C8QB 3L1AA 3QJYA 4OB2B 4XTYA 2MWPA 3HHTB 1VUBA 2DEQA 3F70A 3M54A 4BY6C 4BY6B 2BIVA 1G3WA 3FRNA 3LGFA 4XTXA 2QI2A 3H6ZA 3G4ST 4PJOD 1QVFS 3C12A 1U1SA 2F5KA 4FIBA 3OYDA 3QHSA 4NL2A 2QEXA 4LD9K 4M78A 1Q86C 3CC7T 2K4YA 4M78C 4M78B 1VQMA 3Q1JA 2RM4A 2EFIA 3JRZA 2EJFA 3PMIA 3X28B 3CCUA 5J3BA 5FU6C 5FU6B 2DXTA 3HRSA 4DOVA 4ZGJB 5LJ3g 4JS4A 4A4EA 3A8OB 4LDVA 3CCLT 2DTIA 5J39A 3M58A 2XD0A 3TU4K 2M16A 2V8KA 4RMOA 3S3NA 2HD0A 4N4GA 1QVPA 4C8QF 1N8RU 3RMQA 5FRMA 4F7UE 2PVGB 3KXTA 2XK0A 2R5AA 1BI2A 3EFSA 5CKEA 4M7AE 3E19A 4M7DE 5LJ3d 4O6JA 3OS2A 3RMSA 2VV5A 5GANh 3CXCA 1M1GA 2XHCA 3CCJT 2I2LA 3CBPA 2C06A 1OI1A 2RI3A 3MO8A 2CYZB 4M78F 3ZFJA 2RH2A 1RL2A 2M0OA 4DA4A 2K2VA 1OZ2A 1LJOA 4M75E 3UWNA 3M53A 4QW2A 5LJ5e 3OS5A 4XTVA 3EFRA 4BD3A 3CBOA 1UGRB 1W4SA 2ZCFB 1WPYA 4IUPA 3TCJA 3CCLA 5HKCA 2EQKA 1Y7XA 3QYGB 5I2MA 1KHCA 1KHIA 3UT1A 3JB9I 3CD6T 1PSEA 2LQ8A 1UGQB 3E9GA 2A7YA 5A0LA 4LDUA 2MWOA 3OYBA 4A4KA 2D0QB 5GANg 2JVVA 2KSSA 5GMKj 2G3RA 4EMGA 5CR2A 3A8HB 4C8QE 3CC7A 3SD4A 2DTOA 1OYXA 1GXIE 1K9MU 1Q86U 2MF2A 4JUVA 4IKFA 5L8RE 2CZ7B 2LT4A 5GANd 1N9SA 3L2VA 4BACA 2RA2A 3CCRT 2DXBA 3OBYA 1YJ9T 2JZ2A 2YHTA 3I56T 5M9OA 3CPWA 3H8ZA 3RKXA 4M77A 4M78E 3PNWC 3V8LA 4A54A 4M77B 2XG8D 3JCMe 3JCMW 1YHQT 1YI2T 3CD6A 1VQ7T 1WJSA 4WF2A 1V29B 2FYKA 1QP2A 2DVEA 1M90C 1BYMA 3E1SA 4IUTA 5LJ3j 1ZBXA 3CMET 2HQEA 2F5TX 2XICA 3HL8A 2YLCA 4C92A 1UGPB 2PUKB 5GAN7 2XU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHD A;  4ZTF A;  2EKO A;  4II1 A;  3FEO A;  4FU6 A;  5KE3 A;  3MEU A;  3OB9 A;  3C4S A;  2BUD A;  4NS5 A;  3OYC A;  4B9W A;  2QQR A;  3S6W A;  3OYF A;  4E7K A;  2GF7 A;  4HCZ A;  2LTO A;  3CEY A;  3MEA A;  3L2U A;  2R5M A;  3QII A;  5KCO A;  5FRN A;  2XDP A;  3ASK A;  4IUU A;  4N4H A;  2RHU A;  4E7H A;  3DB3 A;  3LGL A;  2L3R A;  2R58 A;  4ZTJ A;  4OVA A;  4UC4 A;  3ZEH A;  5C0M A;  3OYI A;  3LX7 A;  2L89 A;  2K3Y A;  5FRO A;  3OMG A;  5KH6 A;  2WAC A;  5D6Y A;  2RHY A;  2K3X A;  4B9X A;  2MWP A;  2RI5 A;  3F70 A;  5D6X A;  2BIV A;  2IG0 A;  1XNI A;  3LGF A;  3H6Z A;  2X35 A;  4EDU A;  2BKD N;  3MEW A;  5CIU A;  2F5K A;  3OYD A;  3GOX A;  4C5H A;  4A4F A;  3NTI A;  2VYT A;  3Q1J A;  3OYM A;  4PLL A;  2EFI A;  3O8V A;  3OYJ A;  4CRI A;  3PMI A;  3OYH A;  5IN1 A;  3OYL A;  2EQM A;  3LH0 A;  4A4E A;  3L2Q A;  1WJR A;  2X4W A;  5J39 A;  4LD6 A;  4BDY A;  2M16 A;  3MEV A;  5IAY A;  3S3N A;  4N4G A;  5FRM A;  4BE0 A;  4C5I A;  3NTH A;  2DIQ A;  2XK0 A;  2R5A A;  2CKK A;  3LYI A;  4IUV A;  5KE2 A;  2RHX A;  3EAE A;  4IUR A;  2DAQ A;  4IUQ A;  3OS2 A;  3FC3 A;  3OQ5 A;  3MP1 A;  4GY5 A;  3PFS A;  3OYA A;  2RJE A;  1OI1 A;  2RI3 A;  2RHI A;  3MO8 A;  3OY9 A;  3L2R A;  5D6W A;  4A4H A;  2M0O A;  2YRV A;  3DLM A;  3QJ6 A;  2RHZ A;  1OZ3 A;  1OZ2 A;  2RJC A;  4QVZ A;  4E7I A;  2DIG A;  3UWN A;  3S3O A;  3MP6 A;  3MP8 A;  4QW2 A;  3P8H A;  1WGS A;  4BD3 A;  3ME9 A;  5J26 A;  4IUP A;  4QQG A;  2R57 A;  4PLI A;  2EQK A;  4QQ6 A;  3UT1 A;  3OYK A;  1KHC A;  3OS0 A;  3L42 A;  5KCH A;  2GFA A;  3P8D A;  2EQU A;  2GFU A;  2RO0 A;  3OS1 A;  4E7J A;  3E9G A;  4N4I A;  1SSF A;  4BDZ A;  4C5G A;  3NTK A;  2MWO A;  3OYB A;  3QBY A;  4Q5W A;  1RI0 A;  2LVM A;  2NLU A;  2RJF A;  4L59 A;  2G3R A;  3OA6 A;  2E5Q A;  2HQX A;  2RI2 A;  2JTF A;  2D9T A;  2QQS A;  4QQD A;  3LLR A;  3SD4 A;  1H3Z A;  1OYX A;  4BE1 A;  2B8A A;  4E7L A;  3KUF A;  2L8D A;  2O4X A;  4PL6 A;  1N27 A;  1MHN A;  2RJD A;  2O4X B;  3M9Q A;  3L2W A;  4IKF A;  3L2V A;  2P0K A;  4BAC A;  3PMT A;  2JZ2 A;  3S3M A;  3BDL A;  2M1H A;  5M9O A;  2E6N A;  2X4X A;  3H8Z A;  3OYN A;  3PNW C;  3QKJ A;  4BE2 A;  3DB4 A;  2LCC A;  4X34 A;  1WJS A;  2LDM A;  2PQW A;  4RG2 A;  4FL6 A;  3OYG A;  1WJQ A;  4C5E A;  4IUT A;  2X4Y A;  4A4G A;  3OYE A;  2LRQ A;  2HQE A;  3MET A;  5C6S A;  3OMC A;  4Z02 A;  2EQJ A;  1G5V A;  3FLG A;  3E9F A;  3FDR A; 
#chains in the Genus database with same CATH topology
 3N5B B;  1YI2 Q;  3FEO A;  1LVK A;  1ZSZ A;  1VQ7 Q;  5CVI A;  2LX9 A;  5LJ5 h;  2EWN A;  4DBQ A;  1X6O A;  3CCE T;  5FU7 C;  3OMG A;  5CKH A;  3HSB A;  4B9X A;  4L5G A;  1YFN A;  1XNI A;  2X35 A;  5CIU A;  3CCV Q;  1U3O A;  3A8G B;  4PLL A;  2QEX T;  4CRI A;  1YIJ A;  3DKM A;  3OYL A;  2ZPG B;  1PD0 A;  4OMN A;  1WJR A;  2X4W A;  1J3T A;  2QXF A;  4TVR A;  1K8A R;  4C5I A;  1RAH B;  2GTJ A;  2EGC A;  1Q7Y C;  2DAQ A;  4HT8 A;  4JJC A;  5KYU A;  5GMK m;  4D8D A;  2V1R A;  1U1T A;  4R55 A;  1M1K U;  3DLM A;  4JRP A;  4C92 E;  2D6F A;  1YJW Q;  1WGS A;  1UEB A;  2EGA A;  2R57 A;  2IVW A;  1VQ9 T;  2EKH A;  3L42 A;  2OTL Q;  4J6Y A;  3P8D A;  1ABQ A;  2DTH A;  3VKI A;  2LVM A;  3CXC P;  2VVK A;  1TOV A;  3JCM d;  2FVU A;  3NGP A;  2QQS A;  1TWB A;  2JN0 A;  1I5O B;  2O4X A;  2RJD A;  1KC8 R;  1TUG B;  3EG2 A;  3PMT A;  1CSK A;  3CC2 A;  3PVL A;  1NBE B;  2AK5 A;  3BFM A;  3PE0 A;  1XTD A;  1VQ8 Q;  2EJG A;  5KYW A;  2DFU A;  2DLP A;  1E7O A;  1VIE A;  2DYI A;  2EQJ A;  3GF5 A;  1M27 C;  3EGX B;  2FO0 A;  5GAN f;  4C92 G;  3I55 Q;  1YIT T;  4N4H A;  1I0C A;  3VRY A;  2CT4 A;  3CPW S;  4JLG A;  1PKS A;  2RHY A;  1X6G A;  1AZG B;  1M9S A;  2BE9 B;  4FYY B;  1ZUY A;  2ZPB B;  3GNF B;  1HD3 A;  4A63 B;  2NUT A;  2OTJ A;  2LJ0 A;  4RTZ A;  1X2K A;  3HRU A;  2EQM A;  4Z88 A;  1YBY A;  4GBQ A;  4BI8 B;  3MEV A;  5DY9 A;  2DX1 A;  4X9C A;  4FCY A;  2RPN A;  3JV3 A;  1OX8 A;  3CCQ Q;  2COZ A;  1NJI R;  3MP1 A;  1VQN Q;  2KXD A;  1O9S A;  2X4J A;  4ZGE B;  2OAW A;  3M59 A;  2KQW A;  4QKU A;  1OPL A;  4JJN K;  3CC4 T;  2DL5 A;  4C92 D;  5GAM h;  1VOM A;  2FPF A;  5J26 A;  1VQL T;  3RIR A;  1VQ6 Q;  1VQP Q;  5EC7 A;  4LDX A;  3OYK A;  1N8R C;  4PJO C;  3P8B B;  3I5R A;  3RER A;  3H0I A;  2GFU A;  3A8L B;  4OMM A;  3PTA A;  2JXB A;  1VQK Q;  3LH5 A;  4QVD A;  2KRN A;  4M75 C;  2VAS A;  1R0B G;  1K9M R;  2RB6 A;  1IO6 A;  1AWW A;  2OJ2 A;  2CSI A;  2E10 A;  1Z9Q A;  1RAB B;  1QCN A;  1TXQ A;  3URG A;  3QKJ A;  1RAF B;  3CC2 T;  1RAD B;  2GNC A;  4WCI A;  4A4G A;  3JCM b;  2BTT A;  2LRQ A;  5C6S A;  2O9S A;  3JCM f;  2QA4 Q;  2K6D A;  3QJ6 A;  2KXC A;  4KUL A;  3EG1 A;  4DQ2 A;  2DL7 A;  1GFC A;  1AVZ C;  3OB9 A;  1SSH A;  5CKF A;  5I21 A;  3QXE B;  3TRE A;  2YXY A;  3L2Z A;  3QDR B;  2L3R A;  4ZTJ A;  2BZX A;  3CCM A;  2KBT A;  2WAC A;  5D6Y A;  1Q7Y U;  1NJI U;  1VQ4 Q;  3C94 A;  4M77 G;  3PIP A;  3GNG A;  1IRE B;  2P84 A;  2D1X A;  1VQ5 T;  2K2M A;  2EYX A;  4J9E A;  1JXO A;  5GAO m;  2DPP B;  3J81 E;  3VU3 C;  4PJJ A;  1UB4 A;  4Z8A A;  3V8K A;  1HYO A;  1G3T A;  2EJ9 A;  3A5Z B;  4E2F B;  2KEA A;  1AOJ A;  2J05 A;  1HK9 A;  2RQU A;  2DRM A;  3OW2 A;  3V7C A;  1WXT A;  1KQS S;  3IQL A;  3P8H A;  4ZGD B;  1D3B A;  3GLX A;  4M77 C;  1NE8 A;  1M8V A;  1NPP A;  2DD5 A;  3EHQ A;  5HK3 A;  2NUP B;  1T0J A;  5A0G A;  2P4T A;  2EQU A;  4JRQ A;  4E7J A;  2LQN A;  1K9A A;  2ROL A;  1Q82 C;  3NTK A;  1RI0 A;  1UG1 A;  2CSQ A;  3A8M B;  4C92 B;  1X75 C;  1HXD A;  2JTF A;  1ZSZ B;  5L23 A;  4HXJ A;  4ANJ A;  2ROT A;  4BE1 A;  4E7L A;  1ZBJ A;  1IXD A;  1TS9 A;  3PGG A;  1YJN A;  2E6N A;  4NOY A;  4M7D A;  4M7A C;  2COY A;  2LDM A;  5GMK h;  2COW A;  1BIB A;  4C5E A;  2DNU A;  2X4Y A;  2J7I A;  4FYW B;  4C92 F;  2QYZ A;  2CP3 A;  4KBM B;  2K5F A;  2ATC B;  2L0A A;  4ZTF A;  2MK5 A;  5CKD A;  3UAT A;  4GLK A;  2MI6 A;  3OSS C;  1S72 Q;  5KE3 A;  3BDU A;  1VQM T;  1QKW A;  2LTO A;  2A0F B;  2X51 A;  2KVQ G;  2V1Q A;  1RAI B;  5LJ3 h;  5C0M A;  2JM8 A;  3OYI A;  2CDT A;  3HHT B;  1VUB A;  2DEQ A;  3FRN A;  2QTV A;  5KYU B;  3CCU Q;  3H9N A;  4J9H A;  4M78 A;  1Q86 C;  2RM4 A;  2AKL A;  3VS6 A;  4HVV A;  3X28 B;  4FYX B;  4DOV A;  1WLP B;  2QGF B;  3QWX X;  3M58 A;  2XD0 A;  3TU4 K;  2EYW A;  1QVP A;  1N8R U;  1GCP A;  1BI2 A;  4M7D E;  2XHC A;  2CP2 A;  1OI1 A;  2RI3 A;  2M0Y A;  2CYZ B;  2FRW A;  1JQQ A;  3ZFJ A;  7AT1 B;  1IHW A;  2AT1 B;  2V26 A;  3M53 A;  5LJ5 e;  4XTV A;  4BD3 A;  4FW1 A;  3VS4 A;  1W4S A;  4IUP A;  5GJW B;  3VS3 A;  5HKC A;  3QYG B;  1Y7X A;  3UT1 A;  2JT4 A;  2CP5 A;  3SHW A;  4LDU A;  5KYW B;  2JVV A;  2KSS A;  4OML A;  4EIK A;  4EMG A;  5CR2 A;  2FPE A;  4ORZ A;  4C8Q E;  2L3S A;  1D0X A;  2MF2 A;  4JUV A;  1FMK A;  4IKF A;  5L8R E;  2CZ7 B;  2E5K A;  2RA2 A;  4CC4 B;  4DEX A;  3CPW P;  1YJ9 T;  4E6R A;  2YHT A;  2H8H A;  4LN2 A;  3CPW A;  4M78 E;  1YI2 T;  4A54 A;  4M77 B;  2XG8 D;  3JCM W;  3CD6 A;  2JMA A;  4IIO A;  1VQ7 T;  2DET A;  2FYK A;  3E1S A;  3UA6 A;  2HQE A;  1OUL A;  5GAN 5;  1QCO A;  3I56 Q;  5AYF A;  1UFF A;  2PZ1 A;  1M1K C;  1PNJ A;  2NUT B;  1OQK A;  3HP9 A;  1GCQ C;  2R5M A;  3TSZ A;  1YHQ A;  4J7F A;  3CCV T;  4LUE A;  3CME A;  3H41 A;  1M3B A;  3REB B;  2DL4 A;  4E7Z A;  1F1B B;  1VYT A;  2BKD N;  4CI0 C;  1JBM A;  1NPR A;  5GAN j;  1M8M A;  3OYJ A;  5LJ5 g;  2CP7 A;  1IGQ A;  1YWP A;  3LH0 A;  3CCE A;  1RAC B;  3GPL A;  1YJW T;  3NTH A;  2E12 A;  1QQJ A;  3BE3 A;  4IUR A;  1Q82 U;  4IUQ A;  3CMA Q;  4MMK A;  1QWE A;  1TTH B;  2YUO A;  2RK2 A;  4J7I A;  2W0Z A;  2QAZ A;  2RHZ A;  2RJC A;  4OP0 A;  3G7Z A;  1PHT A;  2VGM A;  4O5V A;  4C5G A;  1WHK A;  3QBY A;  3H0H A;  4J5Y A;  2DBK A;  1X27 A;  5KYX A;  2KGT A;  1VQ8 T;  1M3C A;  3M0Q A;  3AHU A;  1EZZ B;  2B86 A;  3OYY A;  3KUF A;  4FSS A;  3J80 E;  2P0K A;  2M1H A;  1VQ9 A;  1GL5 A;  3RUX A;  1NM7 A;  3JB9 G;  3MCA B;  1LOJ A;  2OAU A;  4BI3 A;  1WJQ A;  3A98 A;  1AZE A;  3QPH A;  5A0D A;  3I55 T;  2RD1 A;  4D6W A;  1K0X A;  5KYN A;  3FIF A;  1KSW A;  3PIO A;  1SKU B;  3HFO A;  2YSQ A;  5GAM e;  2CGH A;  3MHX A;  1KC8 C;  4E7K A;  1W1F A;  4ELZ C;  3G6E A;  4E7H A;  2BE7 D;  3OW2 S;  2L89 A;  3CBM A;  5KH6 A;  2K57 A;  5FLX E;  1KQS P;  1YCS B;  3LWH A;  2CP0 A;  2YDL A;  1KQS A;  1EIF A;  1B34 B;  3GOX A;  4YTL A;  1WHG A;  3HPW A;  3I9Q A;  3CCQ T;  1YIT A;  3OYH A;  1VQN T;  5GMK l;  1I5L A;  2ZPH B;  4LD6 A;  3JB9 D;  1SHF A;  2E70 A;  2O88 A;  4XTZ A;  2CZ0 B;  2L5Q A;  2YUN A;  3M5A A;  5CQX A;  2I0N A;  1VQ6 T;  1VQP T;  2A3L A;  3FC3 A;  1KG1 A;  3SWN B;  3OYA A;  2EYZ A;  1QKX A;  1QCF A;  1VQK T;  4KT0 E;  2YRV A;  2HCK A;  4QVZ A;  2ENM A;  4RTW A;  5IHI A;  3MP8 A;  1H64 1;  4QQG A;  4PJO A;  2K5I A;  1CKA A;  2GFA A;  4JRI A;  1NYF A;  1O75 A;  2M51 A;  2P4R A;  4BDZ A;  1AHJ B;  4EMK A;  2PU9 B;  1LNX A;  1VYU A;  2DD4 A;  1NJI C;  4J6W A;  3OA6 A;  3J7A F;  4KRT A;  4N0A C;  3CPF A;  3CC4 A;  2L8D A;  5GAM g;  1Y96 B;  2PVO B;  4M4Z A;  1VQL A;  4PFZ A;  2QA4 T;  1KQ1 A;  4JRK A;  1WYX A;  3JCM P;  3GIB A;  3VS7 A;  4HCK A;  1I81 A;  3OYG A;  2E6Z A;  2KI7 A;  4XU0 A;  5HCK A;  4C0G A;  2MCN A;  1YWO A;  3QZ5 B;  3UF4 A;  5GMK i;  2DK3 A;  4ELY C;  2FHD A;  2EKO A;  1K9M C;  2BZY A;  2KT1 A;  2DA9 A;  3L2U A;  3CEY A;  4KH0 B;  2PNI A;  1VQ4 T;  3DB3 A;  3G4S Q;  3G6E T;  2K3B A;  1G2B A;  2LMJ A;  1VQO Q;  4C0F A;  3AT1 B;  5GAO n;  4QVC A;  1WZO A;  2ZPE B;  1TU0 B;  1Y57 A;  3EHR A;  4PJO E;  4DBR A;  2MIO A;  2QK0 A;  2FB7 A;  2XDD A;  3D7S B;  4RTT A;  3M4Y A;  1PC0 A;  1G3Y A;  2VGN A;  4JPB W;  1U8R A;  1K73 R;  1K0S A;  2YLB A;  2M02 A;  1Y71 A;  4JLI A;  3SEM A;  2CH4 A;  2LJ1 A;  1OU9 A;  1A0N B;  4F14 A;  3L2Q A;  5GMK e;  2J6K A;  3EG0 A;  1R77 A;  3X24 B;  5CK9 A;  1JJ2 A;  1AWX A;  5IAY A;  2E65 A;  4XU2 A;  5EG2 A;  1YNZ A;  1BIA A;  2DIQ A;  2JOY A;  2CKK A;  1K8A U;  2DL8 A;  3EAE A;  3CCJ A;  2MYS A;  2Y4X A;  4V2S A;  3G71 Q;  3VS5 A;  2KK4 A;  1VQ5 A;  4VUB A;  2L2P A;  5FW9 A;  4CC2 A;  1BI0 A;  5LJ3 e;  1ZSG A;  1B07 A;  3REA B;  5HY6 A;  5GAO p;  3CCS Q;  2ZGW A;  3OS0 A;  4RTU A;  4XU3 A;  3T9N A;  2D8J A;  1SSF A;  3MPU B;  2KR3 A;  4KGV B;  3I35 A;  3X25 B;  2YT6 A;  1FXX A;  3G1J A;  1QWF A;  4C92 C;  2E3H A;  1VYV A;  2E5Q A;  2DMO A;  2G6F X;  2RI2 A;  1SF9 A;  3JB9 F;  1ZSZ C;  1W2B A;  1DJ7 B;  5KYY A;  3CCR A;  1PRL C;  2JMC A;  3O5Z A;  3M9Q A;  2IIM A;  3UDC A;  1KC8 U;  4PJN A;  4F7U A;  5GAN 3;  2HSE B;  2LCC A;  1S72 T;  3ZBD A;  1IHV A;  1MNE A;  1EX4 A;  3OMC A;  8AT1 B;  8ATC B;  2JJ9 A;  3MKD A;  2EYY A;  1ZQ1 A;  4ZNX A;  4OMF B;  1K73 U;  1C6V X;  3FJP A;  3JAM E;  2A36 A;  3CCU T;  1KQ2 A;  4EMH A;  4DBH A;  3QJY A;  4OB2 B;  4XTY A;  2QEX Q;  3F70 A;  4XTX A;  3LGF A;  2QI2 A;  2VB6 A;  4PJO D;  2EW3 A;  3QHS A;  4NL2 A;  1I1J A;  1UDL A;  1M2O A;  1VQM A;  3Q1J A;  2EFI A;  3PMI A;  5J3B A;  3QDF A;  5FU6 B;  5LJ3 g;  2RNA A;  5J39 A;  2M16 A;  2V8K A;  4RMO A;  5FRM A;  4F7U E;  2A28 A;  3EFS A;  4M7A E;  3R6N A;  4O6J A;  3RMS A;  5GAN h;  3CCJ T;  3CCL Q;  2M0O A;  4DA4 A;  2HZY A;  3UWN A;  2DYB A;  1ZX6 A;  3TCJ A;  4DBF A;  2KRM A;  5I2M A;  1WIE A;  1KHC A;  1KHI A;  1PSE A;  1UGQ B;  1M90 R;  2E4H A;  3RBB B;  2D0Q B;  2J6O A;  4F04 B;  2X3W D;  1UUE A;  3A8H B;  3CC7 A;  2C0T A;  1K9M U;  3E2U A;  3OW2 P;  5FWB A;  4BAC A;  3CCR T;  1IRX A;  2JZ2 A;  3I56 T;  3H8Z A;  3RKX A;  1CKB A;  1BCM A;  3FJ5 A;  2KYB A;  1Y0M A;  2DVE A;  1UTI A;  4PJM A;  1ZBX A;  1OOT A;  2XIC A;  2PUK B;  3PT9 A;  2XU8 A;  1JRI A;  2ECZ A;  1NEG A;  1BB9 A;  2MMP A;  1ZA2 B;  4OMO A;  1YJ9 A;  3INZ A;  4JZ3 A;  2MOX A;  1YI2 A;  1ZUU A;  2FZC B;  2HKQ B;  2LCS A;  1IZ6 A;  5I11 A;  1VQ7 A;  3LGL A;  2OX7 A;  2R58 A;  1MGQ A;  4OVA A;  4AG2 C;  1EFN A;  3X26 B;  2JUF A;  1WXU A;  5CKB A;  1D1C A;  1YP5 A;  1C0M A;  2BZ8 A;  1KD1 R;  1YIJ Q;  4OB3 B;  1BBZ A;  1MV3 A;  2DO3 A;  3O8V A;  4DEY A;  3CMA T;  5IN1 A;  1I4K 1;  1X69 A;  2FRY A;  3VRZ A;  1WI7 A;  4AFQ C;  3CCV A;  5LL6 S;  3HKS A;  6AT1 B;  5AT1 B;  3JCM h;  3M0R A;  4B6M A;  2CP6 A;  3EG9 A;  1M90 U;  2GTO A;  4C8Q A;  5LJ5 d;  2V8J A;  3LYI A;  4IUV A;  1H92 A;  4XU1 A;  2D0N A;  4GY5 A;  2JTM A;  3VUZ A;  1D1B A;  3L2R A;  2JW4 A;  4J6X A;  1M4Z A;  4MDW A;  4EPC A;  2DIG A;  3ME9 A;  2LQW A;  4FT2 A;  2FPD A;  4PJO F;  1TUD A;  1YJW A;  3RNJ A;  3DLL A;  1KIK A;  1PSF A;  2OTL A;  3M55 A;  3KBG A;  3LLR A;  2HBP A;  3CC2 Q;  3M0P A;  2GBQ A;  3CC7 T;  4PL6 A;  1SHG A;  3V7S A;  2O4X B;  2SEM A;  3GBQ A;  1I07 A;  3JB9 J;  5GAN 6;  4KGX B;  1ZHI A;  1SPK A;  3FB9 A;  4FL6 A;  2EBP A;  3LWI A;  3OYE A;  4OGE A;  1JJ2 S;  1MND A;  1NLP C;  2ZPI B;  3E9F A;  1VQ8 A;  1M5Q 1;  4OGC A;  2JM9 A;  3EGX A;  1KD1 U;  4FU6 A;  4NS5 A;  2BUD A;  3ULR B;  5KCO A;  1NYG A;  2YRC A;  2FZG B;  5IXB A;  1PM3 A;  2HKN A;  3I55 A;  1OPK A;  2OTJ Q;  1YN8 A;  2IG0 A;  1Y07 A;  4EDU A;  4M7D G;  3QG1 A;  1N5Z A;  4OB1 B;  2CRE A;  3NFC A;  5GAO q;  1WQ7 A;  4HCB A;  1W2B S;  1VIF A;  1M3A A;  2P0Q A;  1WXB A;  2ED0 A;  4MZP A;  2E41 A;  4BE0 A;  4C0D B;  5CQY A;  1QP3 A;  4MZT A;  2C0O A;  4J9F A;  2YUP A;  3SWN C;  1V76 A;  4J9I A;  2L3P A;  1QVG A;  2CUB A;  5D6W A;  5KYY B;  3CCQ A;  3S3O A;  4C8Q G;  1VQN A;  2CH4 W;  2F2V A;  3EGD A;  1YCY A;  2DF6 A;  2M9U A;  2DJZ A;  5ECA A;  2LT1 A;  3HTR A;  3PVQ A;  1ARK A;  1WQW A;  3OS1 A;  2WSC E;  4N4I A;  4M78 G;  5LJ5 f;  1VQ6 A;  3OSV A;  1VQP A;  4RCC A;  2NLU A;  2RJF A;  3M0T A;  4XK8 E;  3JCM c;  1D1A A;  4M7D D;  4LUD A;  2OTL T;  4QQD A;  1WNL A;  4N0A A;  1VQK A;  1H3Z A;  1AWJ A;  1PWT A;  1X2Q A;  4PFO A;  4F7U F;  3L2W A;  2GQI A;  3VV0 A;  1XOV A;  3BW1 A;  1UGS B;  1UHF A;  4J8O A;  2ZAE A;  5IT9 E;  2KMT A;  4RG2 A;  4RTV A;  2MAM A;  1Q81 R;  5GAM d;  1K8A C;  4IIM A;  1NZ9 A;  3MET A;  1TSF A;  1KK7 A;  2HL3 A;  1GBR A;  2HAX A;  9ATC B;  5DLO A;  1VQO T;  2HBW A;  1HSQ A;  2QDL A;  3OYC A;  4C8Q D;  2QA4 A;  4R0K A;  4HCZ A;  2K5L A;  3CCM Q;  5FRN A;  3VS0 A;  3V8J A;  3R6O A;  1FMV A;  3LX7 A;  1G8X A;  4CC3 A;  4M78 D;  2HEQ A;  1OEB A;  3EFO A;  3SFM A;  3HRT A;  2DE0 X;  2PTK A;  3EH1 A;  4KUD K;  2KDS A;  3JCM X;  3MEW A;  2EYQ A;  1GRI A;  1SG5 A;  4RUG A;  4XTU A;  2CZ1 B;  2E3I A;  2VYT A;  1Q95 G;  2LZ6 B;  4J9B A;  1VQ4 A;  2ZPF B;  4AT1 B;  4LXC A;  1U5S A;  3G71 T;  2CZ6 B;  1PD1 A;  2WSF E;  3CCS T;  3EG3 A;  1QLY A;  3JCM V;  3C0C A;  3PFS A;  2RJE A;  2DXC A;  1RAA B;  1K73 C;  3VYG A;  4A4H A;  2DL3 A;  3THK A;  1OZ3 A;  4E7I A;  3I5S A;  2RK1 A;  2GGR A;  1B7T A;  1D3B B;  3TQ7 P;  1G3S A;  4PLI A;  2NUP A;  4QQ6 A;  4X9D A;  5KCH A;  4ME7 A;  1ZLM A;  2RO0 A;  1XQH A;  2GCX A;  2VXE A;  1Q81 U;  4P5N A;  2HL5 C;  1BKB A;  1YJN Q;  4JDS A;  3VUB A;  5DLQ E;  2AHJ B;  2JNG A;  2LQK A;  1ABO A;  1MHN A;  1MMN A;  4OF1 A;  3BDL A;  3QYH B;  2F2W A;  4M7D B;  4JJB A;  1G83 A;  3CQT A;  4Z89 A;  3JCM J;  1UGV A;  5GAN e;  2K7A A;  4E47 A;  3TVT A;  1M2V A;  1RAE B;  4M75 A;  2DVJ A;  4RCB A;  1D09 B;  4PNO A;  2QGG A;  4ATO A;  3C4S A;  2DEU A;  3MJX A;  3NMZ C;  3MEA A;  1FMW A;  3QII A;  4BI4 A;  4F16 A;  4M7D F;  4IUU A;  2RHU A;  2VC8 A;  1JXM A;  1S72 A;  3ZEH A;  1WHH A;  5GAM f;  3GP8 A;  2QQA A;  3EG9 B;  4C8Q B;  2EVR A;  2MWP A;  4BY6 B;  2BIV A;  1G3W A;  3C12 A;  2F5K A;  4FIB A;  3OYD A;  4LD9 K;  2K4Y A;  4M78 B;  2VKN A;  2FEI A;  1ZUK A;  2EJF A;  3CCU A;  1BU1 A;  4ESR A;  5FU6 C;  2DXT A;  4ZGJ B;  4LNP A;  3A8O B;  4LDV A;  3CCL T;  2DTI A;  1AD5 A;  1WFW A;  2D8H A;  2HD0 A;  4C8Q F;  1OX9 A;  3RMQ A;  4CC7 A;  3KXT A;  2R5A A;  1WHL A;  3E19 A;  5LJ3 d;  5IHN A;  3OS2 A;  3CXC A;  1M1G A;  3ZL7 C;  2I2L A;  1RAG B;  4M78 F;  1RL2 A;  1LJO A;  4M75 E;  2AIR B;  1AWO A;  4QW2 A;  4RTX A;  1WHM A;  3OS5 A;  2X9H A;  1UGR B;  1WPY A;  4JJD A;  1JJ2 P;  1MV0 B;  3JB9 I;  2QAS A;  2LQ8 A;  2K79 A;  5IXF A;  2MWO A;  2O2O A;  3OYB A;  5GAN g;  1GFD A;  4E7S A;  2F2X A;  1UHC A;  4AFS C;  3SD4 A;  2A37 A;  1GXI E;  2K9G A;  3CD6 Q;  2LT4 A;  1N9S A;  3L2V A;  1Z9Z A;  5M9O A;  4M77 A;  3JCM e;  3V8L A;  3A1P A;  4WF2 A;  2SRC A;  1K4U S;  1BYM A;  1QP2 A;  1M90 C;  4AFU C;  4IUT A;  2EQI A;  2F5T X;  3HL8 A;  1LPL A;  2YLC A;  3M0S A;  5GAN 7;  2DBM A;  2RN8 A;  1YHQ Q;  4II1 A;  3TSW A;  4PJO G;  1W2B P;  3VS2 A;  1ACM B;  2NWM A;  1WX6 A;  1C1A A;  1WHJ A;  2GF7 A;  3I56 A;  2LP5 A;  1SEM A;  3KFV A;  3CME Q;  1QVG S;  3ASK A;  1YIJ T;  4M75 G;  3VYH B;  4M7A A;  2KYM A;  5FRO A;  5FU7 B;  3BY7 A;  1KJW A;  1BI3 A;  3M0U A;  1Q7Y R;  2HSP A;  3X20 B;  3M4G A;  3WXM B;  3RDV A;  4K11 A;  1TH7 A;  3CCE Q;  2QDY B;  3OYM A;  2YWW A;  2X3X D;  3EGD B;  2V8I A;  1LCK A;  3VS1 A;  4X1V A;  2XDB A;  4BDY A;  3EH2 A;  2J6F A;  1IGU A;  4M77 E;  4EMK C;  1NG2 A;  4HA8 A;  2HNI A;  1KD1 C;  3OY9 A;  1WDX A;  4R56 A;  5GAO l;  5CO7 A;  4RTY A;  5GJV B;  3CMA A;  4HCC A;  3MP6 A;  2RQT A;  4MML A;  4M75 D;  1TG0 A;  3V7R A;  2EIF A;  3JCM g;  3RES A;  4F17 A;  1FWZ A;  4ZN1 A;  1BI1 A;  1QVF P;  2Y90 A;  1QVF A;  2VWF A;  2MPX C;  5LJ3 f;  2GQV A;  2DM1 A;  4HVU A;  4AFZ C;  3NPF A;  2XMF A;  5KYX B;  1VQ9 Q;  1R8O B;  2CS7 A;  1PCX A;  4J9G A;  4LDW A;  4MDX A;  1E6G A;  1UEC A;  2RMO A;  4FW2 A;  4L6V 5;  3WVE B;  4BE2 A;  2LJ3 A;  2JTE A;  2KT8 A;  2XKO C;  1N6A A;  5LJ5 j;  4FT4 A;  2W10 A;  2DXU A;  3EFO B;  1XJW B;  1GBQ A;  4Y28 E;  2NYS A;  3FDR A;  2AKK A;  3G6E Q;  2LC4 A;  4FM4 B;  4XQ3 A;  3S6W A;  3OYF A;  1RI9 A;  2OTJ T;  1UE9 A;  5CAI A;  3RKW A;  2DZC A;  2RQR A;  1RLQ C;  2ZZD A;  1X43 A;  1I8F A;  4BUG A;  1TUC A;  2E1H A;  4OB0 B;  1JEG A;  1PKT A;  2PVD B;  4XAX B;  1WA7 A;  2QQB A;  4F7U G;  2JS2 A;  1YIT Q;  1VA7 A;  4M7A G;  4DOW A;  1B34 A;  4C5H A;  4A4F A;  4ZN3 A;  2PUO B;  3NTI A;  1K76 A;  1GCQ A;  3ER0 A;  2F1L A;  3M57 A;  1SRL A;  4OMP A;  3UPU A;  2ABL A;  1N8R R;  2O01 E;  2KRS A;  4C0D C;  2CUD A;  5I2S A;  5KE2 A;  2QQ9 A;  2RHX A;  1PG5 B;  1W6X A;  2QTX A;  5GAO r;  1JB0 E;  4D8K A;  4M77 D;  1P92 A;  3SWN A;  3OQ5 A;  1OV3 A;  1NEB A;  2RHI A;  2ESW A;  2Y4Y A;  1JU5 C;  4RKU E;  1FX7 A;  2H3E B;  4PJO B;  2Z0W A;  2A08 A;  2OI3 A;  2KRO A;  2RQW A;  4Q5W A;  2RF0 A;  4L59 A;  4EMK B;  3LW5 E;  4BB7 A;  3CC4 Q;  1M2V B;  2J06 A;  4M75 B;  2H3J A;  1QW1 A;  1AEY A;  1VQL Q;  4M7A D;  3UA7 A;  2D9T A;  1AT1 B;  1RLP C;  2B8A A;  2DZ9 A;  1Y96 A;  2C06 A;  1E6H A;  1N27 A;  3JCM Q;  2F69 A;  1R0C B;  2WSE E;  3S3M A;  3EGU A;  4NL3 A;  3OYN A;  1M1F A;  1SRM A;  1H8K A;  5FWC A;  2PQW A;  4JZ4 A;  4PKC C;  3SB2 A;  1OU8 A;  4Y91 A;  3CCM T;  1RUW A;  4M75 F;  2YUQ A;  2P0P A;  4Z02 A;  4J9C A;  1G5V A;  3FLG A;  2QG9 B;  2AZV A;  3OBW A;  4WTO B;  1H3H A;  3CXC S;  2O9V A;  2O31 A;  4FSX A;  2XDP A;  4KUI A;  4MZM A;  2E64 A;  1X01 A;  3M56 A;  2VUB A;  1Q81 C;  2CT3 A;  2KAF A;  2K3X A;  3G4S A;  2RI5 A;  1MMA A;  4LDY A;  4XTW A;  5D6X A;  5I22 A;  1VQO A;  2LX7 A;  1B3Q A;  3C95 A;  1W70 A;  5GAN 2;  1MMD A;  3HFN A;  1N9R A;  2FG0 A;  2HDA A;  2NUZ A;  3SDZ A;  5GAN 8;  4RG8 A;  1HJD A;  4J83 A;  4JS5 A;  3CCJ Q;  1BCO A;  5GAM j;  2XI9 A;  1Q82 R;  3QZ9 B;  4Y92 A;  1VQ5 Q;  4LE9 A;  1KFZ A;  4C0Z A;  2KNB B;  1IB8 A;  2AZS A;  4HVW A;  3RKY A;  2LCL A;  3G71 A;  1YJN T;  2FZK B;  2JS0 A;  3NHN A;  1MMG A;  2DJQ A;  2XID A;  4KGZ B;  3QUI A;  1X6B A;  3CCS A;  3CCR Q;  3H0F A;  3QO3 A;  2L3Q A;  2HQX A;  2EPD A;  1QVG P;  4HKE A;  1M30 A;  2LNH B;  3JSC A;  2KY9 A;  4M77 F;  2FL7 A;  3RR6 A;  1D0Z A;  4F7U B;  2X4X A;  2LNV A;  3DB4 A;  4M7A B;  4M7D C;  4X34 A;  5HK0 A;  4HT9 A;  2DRK A;  4GLM A;  1Q86 R;  3VJP A;  3QWY A;  2HQH A;  3MEU A;  5GAN 4;  3TEE A;  4B9W A;  2QQR A;  3QSU A;  5A2Q E;  4M7A F;  3WVD B;  2EAY A;  2VXF A;  1BK2 A;  1UJY A;  4UC4 A;  1QMC A;  4A53 A;  5DM7 R;  4KH1 B;  2K3Y A;  1T3S A;  2DKG A;  4C8Q C;  3L1A A;  4PJL A;  4OMQ A;  2HMA A;  1VQM Q;  5IHK A;  3M54 A;  4BY6 C;  5CCA A;  1PRM C;  2YRD A;  1UJ0 A;  5D7U A;  3G4S T;  2KE9 A;  3H6Z A;  1MUZ A;  1QVF S;  1U1S A;  2C0I A;  2QEX A;  4M78 C;  2DIL A;  3JRZ A;  1T0H A;  3HRS A;  4PFP A;  4JS4 A;  4A4E A;  1U06 A;  3S3N A;  4N4G A;  2ED1 A;  2PVG B;  2XK0 A;  5CKE A;  2RQV A;  1FYN A;  4AG1 C;  2VV5 A;  3CBP A;  4J9D A;  3MO8 A;  2RH2 A;  1JO8 A;  2K2V A;  1OZ2 A;  3U23 A;  3EFR A;  3CBO A;  3CCL A;  2ZCF B;  2EQK A;  3CD6 T;  3E9G A;  2A7Y A;  5A0L A;  3CC7 Q;  4A4K A;  4FYV B;  5GMK j;  2G3R A;  4PK4 A;  4QT7 A;  1S1N A;  2DTO A;  1M1K R;  1OYX A;  4AMC A;  2EGE A;  1Q86 U;  1K1Z A;  5GAN d;  1V1C A;  2DXB A;  3OBY A;  2DER A;  1NLO C;  3PNW C;  1YHQ T;  1T3L A;  1WJS A;  1D0Y A;  2IPO B;  5IH2 A;  1V29 B;  5LJ3 j;  3CME T;  1ZA1 B;  4C92 A;  1YJ9 Q;  1UGP B;  3JB9 H; 
#chains in the Genus database with same CATH homology
 3N5B B;  5AYF A;  4II1 A;  1JRI A;  4PJO G;  3FEO A;  1M1K C;  2MMP A;  1YJ9 A;  3HP9 A;  5CVI A;  3INZ A;  2LX9 A;  2GF7 A;  3I56 A;  2R5M A;  1YI2 A;  1YHQ A;  1QVG S;  3ASK A;  5LJ5 h;  1IZ6 A;  1YIJ T;  4J7F A;  4M75 G;  2EWN A;  1VQ7 A;  3VYH B;  3LGL A;  2R58 A;  1MGQ A;  4OVA A;  4M7A A;  1X6O A;  3CCV T;  3CCE T;  5FU7 C;  5FU7 B;  5FRO A;  3X26 B;  2JUF A;  3BY7 A;  3OMG A;  5CKH A;  3CME A;  3HSB A;  5CKB A;  1BI3 A;  4B9X A;  3X20 B;  4L5G A;  3M4G A;  3WXM B;  3JB9 G;  1XNI A;  2X35 A;  2BKD N;  4CI0 C;  5CIU A;  1JBM A;  1TH7 A;  1NPR A;  4OB3 B;  5GAN j;  2QDY B;  3A8G B;  3OYM A;  2DO3 A;  3O8V A;  4PLL A;  3OYJ A;  2QEX T;  4CRI A;  5LJ5 g;  3CMA T;  1YIJ A;  5IN1 A;  3DKM A;  1I4K 1;  2ZPG B;  3OYL A;  2V8I A;  3LH0 A;  3CCV A;  1WJR A;  2X4W A;  5LL6 S;  2XDB A;  3HKS A;  3CCE A;  4BDY A;  2QXF A;  3JCM h;  3GPL A;  4TVR A;  1YJW T;  4C5I A;  3NTH A;  2E12 A;  1M90 U;  4M77 E;  4C8Q A;  5LJ5 d;  4EMK C;  2V8J A;  3LYI A;  4IUV A;  4IUR A;  4HA8 A;  1Q7Y C;  1Q82 U;  2DAQ A;  4IUQ A;  4HT8 A;  3JB9 H;  4MMK A;  4XU1 A;  5GMK m;  4GY5 A;  2RK2 A;  2HNI A;  4J7I A;  2JTM A;  1KD1 C;  3OY9 A;  3VUZ A;  3L2R A;  4J6X A;  4R56 A;  5GAO l;  1M4Z A;  1U1T A;  5CO7 A;  4R55 A;  1M1K U;  3DLM A;  4JRP A;  4C92 E;  2RHZ A;  4MDW A;  2RJC A;  3CMA A;  4HCC A;  4EPC A;  2D6F A;  2DIG A;  4OP0 A;  3MP6 A;  4MML A;  1WGS A;  1UEB A;  3ME9 A;  4FT2 A;  4PJO F;  4M75 D;  3G7Z A;  2R57 A;  2EIF A;  3V7R A;  3JCM g;  2IVW A;  1VQ9 T;  3RES A;  2VGM A;  5CCA A;  3L42 A;  1YJW A;  1FWZ A;  4J6Y A;  1BI1 A;  3P8D A;  4O5V A;  4ZN1 A;  3DLL A;  2DTH A;  2Y90 A;  1QVF A;  3VKI A;  3PT9 A;  4C5G A;  3QBY A;  5LJ3 f;  2GQV A;  2LVM A;  4J5Y A;  1PSF A;  2OTL A;  3JCM d;  2FVU A;  3M55 A;  3KBG A;  2QQS A;  3LLR A;  1VQ8 T;  2HBP A;  1R8O B;  2JN0 A;  3AHU A;  2CS7 A;  3OYY A;  3KUF A;  4PL6 A;  2O4X A;  3V7S A;  2RJD A;  3J80 E;  4LDW A;  2O4X B;  4MDX A;  2P0K A;  3JB9 J;  3PMT A;  2M1H A;  1VQ9 A;  3CC2 A;  4L6V 5;  3WVE B;  3RUX A;  4BE2 A;  5GAN 6;  1ZHI A;  3FB9 A;  2XKO C;  3BFM A;  1XTD A;  1N6A A;  3MCA B;  1LOJ A;  2OAU A;  4FL6 A;  1WJQ A;  4FT4 A;  4BI3 A;  5LJ5 j;  2EJG A;  2DXU A;  3QPH A;  3LWI A;  3OYE A;  5A0D A;  3I55 T;  4OGE A;  1JJ2 S;  1VIE A;  2RD1 A;  4D6W A;  2EQJ A;  4Y28 E;  2ZPI B;  3GF5 A;  3E9F A;  3FDR A;  3FIF A;  1M5Q 1;  1VQ8 A;  4OGC A;  3PIO A;  1KD1 U;  3HFO A;  2LC4 A;  4FU6 A;  4FM4 B;  4NS5 A;  4XQ3 A;  2BUD A;  5GAM e;  2CGH A;  5GAN f;  3MHX A;  3S6W A;  3OYF A;  4E7K A;  1KC8 C;  2OTJ T;  5CAI A;  5KCO A;  3RKW A;  2DZC A;  4C92 G;  4ELZ C;  3G6E A;  1YIT T;  4N4H A;  4E7H A;  2ZZD A;  3OW2 S;  1I8F A;  4BUG A;  4OB0 B;  2E1H A;  2L89 A;  3CBM A;  3CPW S;  5KH6 A;  4JLG A;  3I55 A;  2K57 A;  5FLX E;  2PVD B;  2RHY A;  4XAX B;  1M9S A;  2QQB A;  4F7U G;  2IG0 A;  1Y07 A;  4EDU A;  3LWH A;  2ZPB B;  3GNF B;  1KQS A;  4M7A G;  1EIF A;  1B34 A;  4DOW A;  4M7D G;  3QG1 A;  1B34 B;  3GOX A;  4C5H A;  4A4F A;  4ZN3 A;  4YTL A;  2PUO B;  3NTI A;  4OB1 B;  2OTJ A;  3NFC A;  3HPW A;  5GAO q;  3ER0 A;  3M57 A;  3CCQ T;  1YIT A;  3OYH A;  1WQ7 A;  1VQN T;  5GMK l;  4HCB A;  3HRU A;  2EQM A;  1W2B S;  1VIF A;  1YBY A;  1I5L A;  3UPU A;  2ZPH B;  2P0Q A;  2O01 E;  4LD6 A;  4BI8 B;  3MEV A;  5DY9 A;  3JB9 D;  4X9C A;  4MZP A;  2E41 A;  2E70 A;  4C0D C;  4C0D B;  4BE0 A;  5CQY A;  4XTZ A;  2CZ0 B;  2L5Q A;  1QP3 A;  5I2S A;  5KE2 A;  2QQ9 A;  2RHX A;  3M5A A;  5CQX A;  2QTX A;  4MZT A;  5GAO r;  1VQP T;  2A3L A;  1JB0 E;  3FC3 A;  1VQ6 T;  4M77 D;  1P92 A;  3SWN A;  1KG1 A;  3OQ5 A;  3MP1 A;  3SWN C;  3SWN B;  3OYA A;  2RHI A;  1O9S A;  2X4J A;  4ZGE B;  1QVG A;  2Y4Y A;  3M59 A;  5D6W A;  1VQK T;  2KQW A;  2YRV A;  4KT0 E;  3CCQ A;  4QVZ A;  3S3O A;  4C8Q G;  4JJN K;  4RKU E;  3MP8 A;  3CC4 T;  1VQN A;  1FX7 A;  4C92 D;  1H64 1;  5GAM h;  5J26 A;  1VQL T;  1YCY A;  4QQG A;  3RIR A;  2M9U A;  2DJZ A;  4LDX A;  3OYK A;  4PJO A;  1N8R C;  4PJO C;  2K5I A;  4PJO B;  2GFA A;  3P8B B;  2LT1 A;  4JRI A;  3RER A;  1WQW A;  2GFU A;  3OS1 A;  2WSC E;  1O75 A;  4N4I A;  3A8L B;  4M78 G;  3PTA A;  5LJ5 f;  4BDZ A;  1VQ6 A;  1AHJ B;  3OSV A;  4RCC A;  4QVD A;  1VQP A;  4EMK A;  4Q5W A;  4L59 A;  2RJF A;  2NLU A;  2PU9 B;  1LNX A;  3LW5 E;  4XK8 E;  3JCM c;  2DD4 A;  4BB7 A;  4M75 C;  4M75 B;  1NJI C;  2H3J A;  1QW1 A;  4J6W A;  3OA6 A;  4M7A D;  3J7A F;  4M7D D;  2D9T A;  4QQD A;  1WNL A;  4N0A A;  1VQK A;  2OTL T;  4N0A C;  1H3Z A;  2RB6 A;  3CPF A;  2B8A A;  3CC4 A;  2DZ9 A;  1Y96 A;  2L8D A;  5GAM g;  1N27 A;  4F7U F;  1Y96 B;  2F69 A;  2PVO B;  2E10 A;  3JCM Q;  3L2W A;  1VQL A;  2WSE E;  2QA4 T;  4NL3 A;  3S3M A;  3OYN A;  1KQ1 A;  4JRK A;  3URG A;  1M1F A;  3QKJ A;  3JCM P;  3GIB A;  3VV0 A;  1XOV A;  3BW1 A;  1UGS B;  4J8O A;  5IT9 E;  1I81 A;  3CC2 T;  2KMT A;  2PQW A;  4RG2 A;  4PKC C;  3SB2 A;  3OYG A;  2MAM A;  5GAM d;  4Y91 A;  1K8A C;  3CCM T;  2E6Z A;  4A4G A;  4XU0 A;  3JCM b;  2LRQ A;  1NZ9 A;  3MET A;  4M75 F;  5C6S A;  4C0G A;  2P0P A;  4Z02 A;  5GMK i;  2HAX A;  3QZ5 B;  3JCM f;  3FLG A;  1G5V A;  2DK3 A;  3QJ6 A;  4ELY C;  5DLO A;  2FHD A;  1VQO T;  2EKO A;  1K9M C;  4KUL A;  4DQ2 A;  3OBW A;  3OYC A;  3OB9 A;  5CKF A;  4C8Q D;  3CXC S;  2QA4 A;  5I21 A;  4HCZ A;  3QXE B;  3L2U A;  2K5L A;  3CEY A;  5FRN A;  3TRE A;  4FSX A;  2XDP A;  4KUI A;  1VQ4 T;  3V8J A;  3DB3 A;  3L2Z A;  2E64 A;  1X01 A;  2L3R A;  3QDR B;  3R6O A;  4MZM A;  4ZTJ A;  3G6E T;  3LX7 A;  3CCM A;  4M78 D;  3M56 A;  2VUB A;  4C0F A;  5GAO n;  4QVC A;  1Q81 C;  2ZPE B;  2WAC A;  5D6Y A;  2KAF A;  2K3X A;  3G4S A;  4PJO E;  3SFM A;  3HRT A;  2RI5 A;  4KUD K;  4LDY A;  4XTW A;  2FB7 A;  5D6X A;  2XDD A;  1VQO A;  2KDS A;  1Q7Y U;  1NJI U;  3M4Y A;  3JCM X;  1G3Y A;  3C95 A;  3C94 A;  3MEW A;  4M77 G;  2VGN A;  5GAN 2;  3PIP A;  3GNG A;  2EYQ A;  1U8R A;  1IRE B;  3HFN A;  2CZ1 B;  2YLB A;  4XTU A;  2VYT A;  1N9R A;  1VQ5 T;  1Y71 A;  4JLI A;  3SDZ A;  1VQ4 A;  2ZPF B;  5GAN 8;  4RG8 A;  3L2Q A;  4J83 A;  5GMK e;  5CK9 A;  3G71 T;  3X24 B;  4JS5 A;  1JJ2 A;  5GAM j;  5IAY A;  5GAO m;  2CZ6 B;  2E65 A;  2XI9 A;  2WSF E;  4XU2 A;  2DPP B;  5EG2 A;  1BIA A;  2DIQ A;  2JOY A;  3QZ9 B;  2CKK A;  3VU3 C;  3J81 E;  1UB4 A;  1K8A U;  3V8K A;  3EAE A;  3CCJ A;  3CCS T;  2Y4X A;  4C0Z A;  1G3T A;  2EJ9 A;  3A5Z B;  3JCM V;  4V2S A;  3PFS A;  2RJE A;  2DXC A;  4EMK B;  1HK9 A;  1K73 C;  2KK4 A;  3VYG A;  4A4H A;  1VQ5 A;  4VUB A;  3OW2 A;  1OZ3 A;  3V7C A;  4E7I A;  2RK1 A;  1KQS S;  3RKY A;  3P8H A;  1BI0 A;  1D3B A;  4ZGD B;  2LCL A;  5LJ3 e;  3G71 A;  1D3B B;  1YJN T;  3GLX A;  4M77 C;  1NE8 A;  1G3S A;  5HY6 A;  5GAO p;  1M8V A;  4PLI A;  1NPP A;  2DD5 A;  2ZGW A;  4QQ6 A;  5HK3 A;  4X9D A;  5KCH A;  4ME7 A;  3OS0 A;  5A0G A;  4XU3 A;  3T9N A;  2P4T A;  2EQU A;  2RO0 A;  1XQH A;  2GCX A;  2VXE A;  2XID A;  4JRQ A;  4E7J A;  1SSF A;  1Q82 C;  1Q81 U;  4P5N A;  3NTK A;  3QUI A;  3CCS A;  3X25 B;  1RI0 A;  1FXX A;  4C92 C;  4C92 B;  3A8M B;  3QO3 A;  1BKB A;  1X75 C;  2E5Q A;  2HQX A;  1HXD A;  2RI2 A;  4JDS A;  2JTF A;  5DLQ E;  2AHJ B;  2JNG A;  3VUB A;  3JB9 F;  4HKE A;  1W2B A;  4BE1 A;  2LQK A;  1DJ7 B;  3CCR A;  4E7L A;  1MHN A;  3M9Q A;  3PGG A;  3JSC A;  4OF1 A;  2KY9 A;  4M77 F;  3UDC A;  2FL7 A;  1YJN A;  1KC8 U;  3BDL A;  4F7U A;  4F7U B;  2E6N A;  2X4X A;  3QYH B;  5GAN 3;  4NOY A;  2LNV A;  4M7D A;  3DB4 A;  2LCC A;  4M7A B;  4M7D C;  4M7A C;  4M7D B;  4X34 A;  5HK0 A;  3ZBD A;  1S72 T;  2LDM A;  5GMK h;  1BIB A;  4C5E A;  3JCM J;  2X4Y A;  4C92 F;  4HT9 A;  5GAN e;  3OMC A;  4E47 A;  4KBM B;  2K5F A;  4M75 A;  4ZTF A;  5CKD A;  1ZQ1 A;  4RCB A;  4GLK A;  2MI6 A;  4OMF B;  3OSS C;  4PNO A;  5GAN 5;  3VJP A;  5KE3 A;  1K73 U;  3MEU A;  5GAN 4;  3C4S A;  4ATO A;  3TEE A;  3BDU A;  4B9W A;  2QQR A;  3QSU A;  1VQM T;  2LTO A;  3FJP A;  3MEA A;  3QII A;  5A2Q E;  3JAM E;  4BI4 A;  2KVQ G;  4M7A F;  3WVD B;  3CCU T;  2EAY A;  2VXF A;  4IUU A;  2RHU A;  1KQ2 A;  2VC8 A;  1S72 A;  4M7D F;  5LJ3 h;  4EMH A;  5C0M A;  4UC4 A;  3ZEH A;  4A53 A;  5DM7 R;  3OYI A;  2K3Y A;  5GAM f;  2DKG A;  3GP8 A;  2QQA A;  4C8Q C;  4C8Q B;  3L1A A;  3QJY A;  4OB2 B;  4XTY A;  2MWP A;  3HHT B;  1VUB A;  2DEQ A;  3F70 A;  3M54 A;  4BY6 C;  4BY6 B;  2BIV A;  1G3W A;  3FRN A;  3LGF A;  4XTX A;  2QI2 A;  3H6Z A;  3G4S T;  4PJO D;  1QVF S;  3C12 A;  1U1S A;  2F5K A;  4FIB A;  3OYD A;  3QHS A;  4NL2 A;  2QEX A;  4LD9 K;  4M78 A;  1Q86 C;  3CC7 T;  2K4Y A;  4M78 C;  4M78 B;  1VQM A;  3Q1J A;  2RM4 A;  2EFI A;  3JRZ A;  2EJF A;  3PMI A;  3X28 B;  3CCU A;  5J3B A;  5FU6 C;  5FU6 B;  2DXT A;  3HRS A;  4DOV A;  4ZGJ B;  5LJ3 g;  4JS4 A;  4A4E A;  3A8O B;  4LDV A;  3CCL T;  2DTI A;  5J39 A;  3M58 A;  2XD0 A;  3TU4 K;  2M16 A;  2V8K A;  4RMO A;  3S3N A;  2HD0 A;  4N4G A;  1QVP A;  4C8Q F;  1N8R U;  3RMQ A;  5FRM A;  4F7U E;  2PVG B;  3KXT A;  2XK0 A;  2R5A A;  1BI2 A;  3EFS A;  5CKE A;  4M7A E;  3E19 A;  4M7D E;  5LJ3 d;  4O6J A;  3OS2 A;  3RMS A;  2VV5 A;  5GAN h;  3CXC A;  1M1G A;  2XHC A;  3CCJ T;  2I2L A;  3CBP A;  2C06 A;  1OI1 A;  2RI3 A;  3MO8 A;  2CYZ B;  4M78 F;  3ZFJ A;  2RH2 A;  1RL2 A;  2M0O A;  4DA4 A;  2K2V A;  1OZ2 A;  1LJO A;  4M75 E;  3UWN A;  3M53 A;  4QW2 A;  5LJ5 e;  3OS5 A;  4XTV A;  3EFR A;  4BD3 A;  3CBO A;  1UGR B;  1W4S A;  2ZCF B;  1WPY A;  4IUP A;  3TCJ A;  3CCL A;  5HKC A;  2EQK A;  1Y7X A;  3QYG B;  5I2M A;  1KHC A;  1KHI A;  3UT1 A;  3JB9 I;  3CD6 T;  1PSE A;  2LQ8 A;  1UGQ B;  3E9G A;  2A7Y A;  5A0L A;  4LDU A;  2MWO A;  3OYB A;  4A4K A;  2D0Q B;  5GAN g;  2JVV A;  2KSS A;  5GMK j;  2G3R A;  4EMG A;  5CR2 A;  3A8H B;  4C8Q E;  3CC7 A;  3SD4 A;  2DTO A;  1OYX A;  1GXI E;  1K9M U;  1Q86 U;  2MF2 A;  4JUV A;  4IKF A;  5L8R E;  2CZ7 B;  2LT4 A;  5GAN d;  1N9S A;  3L2V A;  4BAC A;  2RA2 A;  3CCR T;  2DXB A;  3OBY A;  1YJ9 T;  2JZ2 A;  2YHT A;  3I56 T;  5M9O A;  3CPW A;  3H8Z A;  3RKX A;  4M77 A;  4M78 E;  3PNW C;  3V8L A;  4A54 A;  4M77 B;  2XG8 D;  3JCM e;  3JCM W;  1YHQ T;  1YI2 T;  3CD6 A;  1VQ7 T;  1WJS A;  4WF2 A;  1V29 B;  2FYK A;  1QP2 A;  2DVE A;  1M90 C;  1BYM A;  3E1S A;  4IUT A;  5LJ3 j;  1ZBX A;  3CME T;  2HQE A;  2F5T X;  2XIC A;  3HL8 A;  2YLC A;  4C92 A;  1UGP B;  2PUK B;  5GAN 7;  2XU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...