2RJDA

Crystal structure of l3mbtl1 protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
325
structure length
321
Chain Sequence
ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 321
sequence length 325
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjdA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjdA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjdA03
3PNWC 4NS5A 3OYGA 3OYAA 3META 5FROA 4PLLA 1N27A 3UT1A 4PL6A 2R57A 3M9QA 2RJDA 2VYTA 5KE3A 2DAQA 2M16A 3MEWA 3L2QA 3ASKA 3OYKA 3S3OA 5CIUA 2XDPA 4LD6A 4UC4A 3OYMA 2F5KA 2BIVA 3FLGA 3OB9A 2YRVA 3OYCA 4E7LA 1WJRA 3OMCA 3OYHA 5C6SA 3L2RA 3DB3A 3DB4A 4BE1A 2X4WA 2GFUA 2R5AA 3NTKA 3PMTA 4BDZA 1KHCA 2D9TA 4FU6A 3SD4A 4C5GA 3S3NA 3LLRA 3L2WA 4ZTFA 2E5QA 3P8DA 2LDMA 4ZTJA 3E9GA 3OYEA 3L42A 5J26A 4IUUA 2RJCA 2RI2A 3PFSA 3CEYA 4IURA 4A4HA 2G3RA 3QIIA 3L2VA 4E7HA 1WJQA 2EQKA 4QVZA 3OYFA 2L8DA 4BDYA 2EFIA 1WGSA 4BE2A 1OI1A 4IKFA 5IN1A 2RHXA 4N4IA 3LGFA 3LH0A 3MP1A 2QQRA 2RI5A 1G5VA 2X4XA 2JZ2A 2NLUA 3LX7A 3QJ6A 4II1A 4Q5WA 4RG2A 3OY9A 1OZ2A 2BKDN 2M1HA 3OYDA 2P0KA 3OA6A 5FRMA 2WACA 3UWNA 2DIQA 4QQ6A 4CRIA 4IUPA 3LYIA 3C4SA 3MEVA 4IUVA 2GFAA 2K3YA 4N4HA 2HQEA 2LTOA 3ME9A 4E7JA 2RHYA 5J39A 4E7KA 2RO0A 2LVMA 1MHNA 1XNIA 2MWOA 2LCCA 3H6ZA 4A4GA 3OYIA 4QQGA 3MEAA 4C5EA 2EQMA 3FDRA 2O4XB 4A4FA 5KCHA 4BACA 2B8AA 3F70A 3GOXA 2IG0A 2BUDA 3OS0A 2X35A 4PLIA 2X4YA 3ZEHA 2RHUA 4N4GA 3OS2A 2XK0A 2QQSA 3BDLA 5D6WA 1SSFA 3OYBA 2MWPA 2EKOA 4E7IA 2RJEA 3OYLA 3L2UA 2EQUA 5D6YA 4EDUA 1WJSA 4QW2A 2L3RA 3H8ZA 2L89A 3NTIA 4Z02A 3MEUA 3MO8A 2K3XA 3QKJA 1H3ZA 1RI0A 3Q1JA 4BD3A 4X34A 3OQ5A 3NTHA 3E9FA 4FL6A 3OYNA 3FEOA 2LRQA 3QBYA 3KUFA 4B9XA 2HQXA 5KCOA 4BE0A 3PMIA 4A4EA 2O4XA 3S6WA 2EQJA 2M0OA 2RHIA 5FRNA 2PQWA 3DLMA 3O8VA 4B9WA 3OS1A 4L59A 3EAEA 4IUTA 4IUQA 5KE2A 5M9OA 2E6NA 4HCZA 2R5MA 2GF7A 2RHZA 2CKKA 5D6XA 4C5IA 3MP6A 4QQDA 3S3MA 4OVAA 3OMGA 3MP8A 3OYJA 5C0MA 2RI3A 2RJFA 3P8HA 2DIGA 1OZ3A 4GY5A 4C5HA 3FC3A 5KH6A 1OYXA 3LGLA 2JTFA 2R58A 2FHDA 5IAYA
chains in the Genus database with same CATH superfamily
4OMFB 2BZXA 1UGSB 1OULA 5L23A 4HCKA 2DEUA 4JZ4A 3M4YA 2G6FX 1K73C 2AHJB 4UC4A 2F5KA 5FU6C 1IRXA 1WJRA 1TXQA 2BZ8A 4DA4A 3L2WA 1VQOT 3P8DA 3WXMB 2QG9B 1O75A 2KT8A 4X1VA 2XICA 2ZPBB 3JCMc 4QVZA 3OYFA 2EYWA 2L3QA 2H3JA 1TOVA 2HBWA 2C0TA 4FSXA 1YWOA 3R6OA 5GAN6 2GQVA 3LH0A 1OEBA 1KD1C 3A1PA 2M02A 4F7UB 3OYDA 3QG1A 5L8RE 2QTXA 5KYNA 2CH4W 3VKIA 2ZPIB 2QEXQ 5GANf 1VQ5T 2LTOA 4E7JA 4PJOF 1NJIU 2EQMA 4A4FA 2DL5A 3G7ZA 5GAOr 2EYYA 3E2UA 1K0SA 4XTYA 4JJDA 4DBFA 1U5SA 1VQ8Q 4N4GA 1ZBJA 2Y4XA 1VQ9Q 1MMNA 4PJJA 1BK2A 3VS1A 3CCJT 3OYBA 4E7IA 2XIDA 1BCMA 1UHCA 2L2PA 2EAYA 1X27A 4BY6C 1VQMQ 4LDVA 2RB6A 2HSPA 2AZSA 1AWOA 1TUGB 3MO8A 4BD3A 1M3CA 4KH1B 4F7UG 4HT9A 3JCMb 1B34A 2PTKA 3H9NA 1XTDA 1JEGA 4JS4A 2RHIA 3M5AA 2D8JA 5FRNA 4BI4A 1D3BA 2K7AA 2H3EB 1XQHA 5CVIA 3CCEA 2SEMA 3VS7A 2F2XA 4GY5A 2QDYB 5FU7C 5GAOm 2FO0A 2X4JA 3MPUB 2OTJA 2A7YA 3RUXA 1G3WA 1ZSZB 2CYZB 1Y57A 2IVWA 1S1NA 3M4GA 1W6XA 4DBRA 3JCMX 4RMOA 5EC7A 3S3OA 5GAMf 1M1KU 1QP2A 3VS0A 1JXOA 1LNXA 2BIVA 1NJIR 2QDLA 4E7LA 2EYZA 3SD4A 3RDVA 1EX4A 3H41A 2RQUA 5LJ3e 1S72Q 5J26A 1JBMA 1VYTA 1WJQA 1WGSA 2JM9A 3V7CA 1HK9A 1UB4A 3WVDB 4EMGA 2ROTA 2NLUA 4Q5WA 1RABB 3UA7A 4XTWA 2DIQA 3MEVA 2OX7A 1VQ7T 2K6DA 2MPXC 3C95A 1YI2T 2DVJA 2LVMA 2LCCA 3OYIA 4QQGA 2DEQA 3GNFB 1RAFB 2JS2A 3FDRA 4HVUA 2SRCA 4E2FB 4M7AB 3F70A 1QMCA 1D09B 2XK0A 2HAXA 1YIJA 1K9AA 2LZ6B 4ZGDB 2YXYA 2HKQB 3VS2A 2EQUA 4M78G 3VS3A 4EDUA 4F7UF 4M77C 1AWXA 1OOTA 3TEEA 3JB9G 1M1KR 1VQKA 2WSCE 4M78D 4AFZC 2YRCA 4R0KA 1VQ6Q 3KUFA 5LJ5d 2FRYA 1KC8U 2CT4A 3G6EA 4J83A 3DLMA 1NPRA 4RTTA 2J6KA 2E6NA 2R5MA 2E41A 1M90U 4KGVB 2LC4A 3CCQQ 3OMGA 4M7AG 2EIFA 3MP8A 4FYYB 4FSSA 4M75A 4PJOC 4C0DB 2O01E 3UF4A 1M4ZA 1N9SA 1H8KA 3RKYA 3VUBA 1H641 1Q82C 4M7AD 4JJCA 4JS5A 3ASKA 1IHWA 3QZ9B 3EG3A 4J6WA 2XI9A 2XU8A 4MDWA 2XDBA 1VQ4A 3CCSQ 1MNEA 2FVUA 1W2BS 3HHTB 1V76A 3S3NA 1KHIA 2CREA 5KYXA 3L42A 4M77A 5GMKi 4PJMA 4JZ3A 1NLOC 1GXIE 2HL3A 3LX7A 4JRKA 2P0PA 1B07A 5CR2A 3DLLA 4IUVA 1M9SA 1KC8R 5GAN7 1AOJA 2A08A 1QKWA 4PJOA 4C5EA 1F1BB 2IPOB 3EG9A 1M90R 4HT8A 2JNGA 2X4YA 4MMKA 4QVCA 4M78F 2C0OA 2RD1A 1FMWA 5GAN5 2AZVA 3C94A 3I56T 3V8KA 1TTHB 4RKUE 1K8AU 1M30A 1T3LA 3CPFA 3CCLA 3HFNA 3QBYA 4B9XA 2VC8A 3HRTA 1SEMA 4M7AF 1VYVA 1X6OA 1BIAA 1GBRA 1YJ9A 2RHZA 4HXJA 1YJNT 3A8OB 1OV3A 1PKTA 2V26A 2D8HA 3A8MB 2E3IA 1VQPA 1W2BP 2CP3A 2IIMA 3UT1A 1ZBXA 1N5ZA 5KYUA 4EMKB 3L2QA 1MV3A 1Q95G 4KULA 5AT1B 1XOVA 3G6ET 5DM7R 3IQLA 3ULRB 4HVVA 2CP6A 2KXDA 5GANd 2GNCA 3OYEA 2BE9B 3BE3A 3PFSA 1BIBA 2EVRA 1Y96B 4PNOA 3CMET 4KGXB 2QAZA 2NUPB 1TS9A 2DX1A 1K8AR 2OAUA 2RN8A 1YIJQ 2M51A 3QSUA 3M0SA 3LYIA 3CC2A 2EJFA 1JJ2A 1XNIA 1VQ4T 3EG1A 1UGQB 2ED0A 3LH5A 2O4XB 1E6GA 1QCNA 2CGHA 3JAME 2BUDA 2QQBA 3THKA 1VQKQ 2CSIA 4OMQA 2DBMA 3OS2A 2ABLA 1QVFA 4PK4A 2HL5C 5D6WA 3KXTA 2FPFA 2EQIA 4D6WA 2BE7D 1YNZA 3BY7A 1JU5C 8AT1B 2EGEA 3SB2A 1D1CA 4X9DA 2FYKA 4J9BA 4F7UA 1NPPA 4DBQA 2P0QA 1VYUA 5GANg 2YSQA 1AVZC 2COYA 1GBQA 1B3QA 3NTHA 2JTEA 5HY6A 4BE0A 1TUCA 1ZSZC 2L0AA 1RUWA 1LJOA 3CPWA 4J9GA 2QEXA 1Q7YR 4BUGA 2DF6A 3CCUA 1ZHIA 2FHDA 3JRZA 3OYGA 1VQ8A 1UGVA 2YWWA 2RH2A 2VYTA 3VV0A 1M1GA 3I9QA 3OB9A 2YRVA 4ME7A 2YT6A 1WX6A 8ATCB 1UDLA 2EYXA 3PMTA 2E3HA 4OF1A 2E4HA 4LXCA 4XAXB 3CBMA 4M7AC 4FW2A 4BE2A 5LJ5f 4HA8A 2P4TA 3EHRA 3M58A 1UE9A 1N8RU 4F17A 5GAMg 4WCIA 1K0XA 4IUPA 4DQ2A 1NM7A 2YRDA 2YUOA 3RMSA 2V1QA 3EGUA 1H92A 1G3TA 3NFCA 2MCNA 1WXUA 3HFOA 3UDCA 2QGFB 3FB9A 2CSQA 3SWNB 2O2OA 3MJXA 5CCAA 3JCMQ 3CCLQ 1YITQ 2F1LA 4M78A 1BI2A 4BB7A 4XU2A 1UGPB 3X24B 4CC2A 1H3HA 1YJ9Q 4C8QE 4M77D 3UPUA 1MGQA 4DOVA 4C0DC 5A0DA 1SHGA 2CT3A 1G3YA 1VA7A 4J9DA 2E10A 2EGCA 2L5QA 1U06A 5CQXA 2HQXA 2ROLA 1VQPQ 3QO3A 1WQWA 1QVGP 1K9MC 4M7AA 1G3SA 2D0NA 1YP5A 3EAEA 1JJ2S 2ZPHB 2VXEA 3S3MA 1OX9A 1TH7A 3I55A 1N9RA 5LJ3h 2DIGA 3FC3A 3PVQA 3NHNA 1FYNA 1N8RR 1QVFS 3OYAA 1OU8A 5GAOq 2R57A 2DTHA 2HZYA 3LWHA 4O6JA 1M5Q1 2XDPA 5HK0A 3OYCA 2B86A 3P8BB 1QCOA 2LQWA 3CXCP 3VYGA 3LLRA 2LDMA 2QEXT 2EJGA 3CC2Q 3HL8A 4FM4B 3VUZA 1QLYA 1SRLA 5GJWB 1VQ6A 1LCKA 5EG2A 2E1HA 2QA4A 5IHIA 1VQ8T 2JZ2A 1VQ9T 3CCQA 2HSEB 2DXCA 4GBQA 1DJ7B 4CRIA 1GCQC 1BYMA 3RBBB 1C1AA 1I81A 3VYHB 4WTOB 1VQMT 3N5BB 4M77F 3RERA 3MHXA 3JCMV 2QXFA 1UJ0A 4Z8AA 1SSFA 4J8OA 5HCKA 3CCSA 2DLPA 3V8JA 1RADB 1PM3A 1SRMA 4RTUA 2MF2A 2KR3A 1JJ2P 2DRKA 2K3XA 2QGGA 2HBPA 3CCUQ 2WSEE 2BTTA 3HRUA 4FW1A 3A98A 4XTVA 1PRLC 2QI2A 3OYNA 1IHVA 4EMKC 2D1XA 2CZ0B 3M56A 3OW2S 4C5IA 4OMOA 4CI0C 2A37A 3HSBA 4GLMA 1RL2A 4D8DA 1WLPB 1GCQA 1QCFA 4RG8A 2DA9A 4AMCA 2HKNA 2LCLA 1JO8A 3GIBA 1S72T 2COWA 2K5IA 3GF5A 2GTJA 4M4ZA 4RTVA 1BBZA 2ZGWA 2DTIA 1R77A 2DJQA 5FWCA 1TSFA 1A0NB 3OYHA 2K5FA 3L2RA 4BE1A 3KBGA 5AYFA 2FZKB 3NTKA 2FZGB 2D9TA 2E65A 1NEBA 1KSWA 3C0CA 4IUUA 2LQKA 3VS6A 1WHLA 2K3BA 1SHFA 2ENMA 9ATCB 5GAOl 2PUKB 1EFNA 2RQWA 5KYYA 5GAOp 2OTLT 2PUOB 3MP1A 3QPHA 5GAMe 2A3LA 2AKLA 4QT7A 3CCMA 2KRMA 4XTUA 4EMKA 5KYWB 5GMKm 2K3YA 4ZGJB 1AWJA 2VVKA 1ABQA 3ZBDA 4J9IA 2HMAA 5J39A 2L3SA 3CCRQ 5GAN8 4JUVA 4KBMB 2H8HA 1EZZB 5GMKl 5KCHA 5GAN3 4F16A 3QYGB 3OS0A 1Y7XA 3QWXX 5GANj 1VQ6T 3EGDB 1Y96A 2CUDA 1BKBA 4MDXA 4RTXA 5CKHA 1JXMA 1W1FA 4FT4A 4QW2A 2NUPA 2V1RA 5LJ3f 4LUEA 3OW2P 3I55Q 3BDUA 3EG0A 1JB0E 2AKKA 2P4RA 3OS5A 5KCOA 4CC7A 2O4XA 4FYXB 3S6WA 2DFUA 4J9EA 3E1SA 1BI3A 1PG5B 1IB8A 1IXDA 4X9CA 4OB3B 2FPDA 1FXXA 1V29B 1BCOA 2YLBA 2J06A 4J7IA 3MP6A 4QQDA 5GAOn 3UA6A 2ESWA 3CCST 1HD3A 4BI3A 3JCMh 4C5HA 2CZ6B 3LGLA 2JTFA 4ELZC 3OSVA 1YJWQ 4JDSA 1WQ7A 3TCJA 4MZTA 2NUTA 4RCBA 3G71Q 1PCXA 1RLQC 2QYZA 3JB9D 5IHKA 1OPKA 2DVEA 2D0QB 2QA4Q 2CZ7B 2R5AA 2LNVA 1PNJA 1Y71A 4HCBA 1IZ6A 5GAMj 1D0YA 3FJ5A 2DL4A 1AWWA 1E7OA 1D1AA 2QQAA 3L2VA 4OP0A 4J6YA 1Q86U 2RHXA 3SWNC 4II1A 4RG2A 5FRMA 1NLPC 3M0QA 1T0HA 3NGPA 4QQ6A 3C4SA 1AT1B 1V1CA 4WF2A 5A0GA 4C92E 1YCSB 2JOYA 2RO0A 3EGXB 2MWOA 4A4GA 2MMPA 3RNJA 4XU1A 4E47A 1MUZA 3X25B 3CCET 2FB7A 2IG0A 2X35A 4Y92A 1KQSA 4KT0E 4ZN1A 5LJ5g 2NWMA 2OTJT 1NJIC 2KSSA 2EKOA 3T9NA 1YWPA 4XU0A 1IGQA 2X3XD 1Q81U 3INZA 3I5SA 2O9SA 3MEUA 1RI0A 2KYBA 3Q1JA 1FX7A 3J7AF 3TSZA 1IO6A 2M0OA 2DL8A 4IIOA 5M9OA 1U1SA 5KE2A 2GF7A 1VQLQ 3SWNA 3JB9F 1I4K1 2JTMA 2CH4A 1UECA 1Q86R 3QHSA 2V8IA 5FLXE 2J6OA 3VRZA 1P92A 4M75E 3JB9I 3CCVQ 1GCPA 5FROA 2RPNA 1YITA 1I8FA 2JJ9A 5CKFA 3CC4A 2DAQA 4A63B 4XTZA 2Y90A 2MIOA 3X20B 2DL7A 1SPKA 1YIJT 3CCMQ 1D1BA 2K9GA 2EKHA 3EH2A 5CQYA 4Z88A 3VS4A 2F2VA 1M1KC 2RJCA 2F5TX 4J6XA 2W10A 4ANJA 1D3BB 1FMKA 2Y4YA 2COZA 2RA2A 3KFVA 1SG5A 2DD4A 1Q81R 3WVEB 1PC0A 1VQKT 1VQNA 3PTAA 2PU9B 3A5ZB 1G5VA 1I07A 2JMAA 4M7DE 2KGTA 4AFQC 2ZPFB 2HQEA 1KFZA 1D0XA 1B7TA 2Z0WA 3QJYA 5CK9A 2MI6A 3CMAA 2ZCFB 3SEMA 1QQJA 1YN8A 3G4SA 5CKDA 1NBEB 4RUGA 1Q7YU 4PJOE 1OU9A 4JRIA 1PWTA 2KT1A 3OYYA 3PIPA 4FT2A 1YHQA 4RCCA 1WHJA 5D6YA 2E5KA 1WHHA 2DXUA 3M0PA 4D8KA 1UTIA 1YFNA 2L3RA 3JCMf 2ECZA 2PZ1A 2KY9A 1YBYA 2DO3A 3QDRB 2J05A 5A0LA 4C92B 2EYQA 2YHTA 1RAAB 3OS1A 4BI8B 4CC4B 3C12A 3LWIA 3FIFA 1KC8C 3P8HA 2C06A 1K73U 1OYXA 3CC7Q 2KI7A 1AZEA 2QTVA 4NOYA 1KQSS 4LDYA 2KAFA 1M90C 1N27A 4MZMA 4AT1B 2M16A 2GCXA 3OYKA 4JLGA 2QQ9A 5CIUA 1NEGA 2KEAA 1ARKA 4VUBA 4XK8E 2HNIA 2OI3A 5IHNA 1KK7A 2E5QA 1X6GA 2ZPEB 1KD1U 3CQTA 1ZLMA 2JVVA 2G3RA 3R6NA 3VJPA 4C0ZA 3FRNA 4M75B 1CKBA 2RI5A 3CCLT 1YITT 1I5OB 2F69A 4Y28E 3U23A 1M3BA 1N6AA 4OMNA 2A36A 1YJ9T 4LNPA 5LJ3d 2LX9A 2M9UA 1UHFA 4A54A 4R55A 2FPEA 4L5GA 4PLIA 2LJ3A 5LJ5e 2L3PA 1VQPT 1K73R 4OB0B 2P84A 2VASA 2MWPA 2DJZA 3G1JA 1X43A 1PRMC 2RJEA 1ZSZA 4FIBA 1I5LA 5KYXB 3CD6Q 4RTYA 3VRYA 2JMCA 1R8OB 2YLCA 4M7DB 5KYWA 2JN0A 1PD1A 4F7UE 4JJBA 5GAN2 2FEIA 2RK2A 1X01A 3V7SA 3H0HA 1RAGB 4JRQA 1M2OA 3CC4Q 1KD1R 1VQ5A 1M1FA 1K8AC 2YUNA 2OAWA 1ACMB 5GAN4 3EGDA 3CCRA 1RACB 2XD0A 1GRIA 2V8KA 4JJNK 5IAYA 5LJ3g 3JCMJ 3CC2T 5DLOA 3CCJA 3DKMA 2MYSA 3A8LB 5GAMh 2E70A 4K11A 2C0IA 4Y91A 1ZX6A 3QDFA 3SHWA 1NYGA 4LDWA 3JV3A 4M7DG 1VQNQ 3L1AA 2DXTA 4ZTFA 4IIMA 1C6VX 4OGCA 1UFFA 3M57A 4E7HA 3CMAQ 2X51A 1RLPC 1UG1A 2XKOC 3G4SQ 3M54A 1CKAA 4ZGEB 3X28B 3LGFA 1GFDA 3PT9A 1ZQ1A 1VOMA 2X4XA 1OQKA 2KE9A 1OZ2A 3OA6A 1YHQQ 1Q7YC 2PVDB 4RTZA 1HJDA 5LJ5j 2RHYA 1YJWA 2XMFA 3MEAA 2DYBA 3OBWA 4AG1C 3JSCA 3CCUT 3G71A 2ATCB 4DBHA 3CPWS 2ED1A 2E6ZA 1G2BA 4LUDA 4HVWA 3L2UA 4M78E 4KUIA 1RAHB 1WJSA 2RQTA 4EMHA 3GPLA 2L89A 2DYIA 1WFWA 2VKNA 4FYVB 4MMLA 1YCYA 2YUQA 1XJWB 3EGXA 4MZPA 4A4EA 5A2QE 1J3TA 1X6BA 2DZ9A 4B9WA 1VQ7A 2YUPA 4IUTA 1YI2A 4AFSC 1Q82U 5DLQE 1ZUYA 4M7AE 1AZGB 1WHGA 4ORZA 4ZNXA 2CDTA 2RI3A 1SF9A 4OB1B 5GANe 1KJWA 4J9FA 3EH1A 4J9HA 3META 3QZ5B 2EBPA 3V7RA 4M7DF 3M9QA 1ZA2B 3EFRA 5FWBA 3OYMA 4JRPA 3I5RA 1QVFP 5ECAA 3DB3A 2HDAA 4XTXA 1TG0A 4BDZA 1X2KA 4C5GA 1ABOA 4KRTA 2K5LA 2K2VA 2QASA 4PFPA 2RK1A 3M0UA 3GP8A 3EFOB 2KROA 1PHTA 1TWBA 1PKSA 3CCRT 2EJ9A 1WDXA 2EQKA 3JCMW 4C8QB 4NL3A 4N0AC 2LJ1A 2KQWA 3I35A 4HCCA 2QQRA 1VQLA 4CC3A 3QJ6A 2M1HA 4ATOA 1UEBA 4OMLA 3CPWP 1VQOQ 1JRIA 2PVGB 1ZUUA 3MKDA 4E7KA 1OX8A 3JCMd 1N8RC 2DXBA 3CCVA 1W2BA 1HXDA 2DRMA 3I55T 3GOXA 1Q82R 1T3SA 3BFMA 3AHUA 2JM8A 4C92C 2KYMA 1ZA1B 3ZEHA 1O9SA 2QQSA 2E12A 4Z89A 1BI1A 1VQ5Q 3NPFA 1VIEA 4TVRA 4C8QG 4Z02A 1KIKA 2HD0A 4XQ3A 2MK5A 3OQ5A 1WA7A 1WYXA 1YJWT 2A28A 4C8QD 4F04B 3CCJQ 2KDSA 2VV5A 3G71T 1Z9QA 2CP0A 4IUQA 5FW9A 4N0AA 3JB9J 1MMGA 1UJYA 5GMKe 1R0BG 5D6XA 2DK3A 4J5YA 2AK5A 2QA4T 4OVAA 3OYJA 2RJFA 1AD5A 3CCQT 2DM1A 1M3AA 4M78B 4NS5A 3JCMg 3X26B 3RKWA 2OJ2A 1RAEB 4PL6A 3QWYA 1MV0B 5KE3A 1MMAA 2HCKA 5HKCA 3I56A 4M75C 4C92A 5CO7A 3HKSA 2VWFA 4R56A 3DB4A 5IXFA 3SFMA 1RI9A 2DERA 2KVQG 2O9VA 4ZN3A 5I22A 1M2VB 5GJVB 1WPYA 1X69A 2VXFA 1SSHA 3GNGA 4IURA 2OTLQ 1WXBA 2L8DA 1M8VA 2DPPB 1YJNA 4N4IA 2DZCA 1FWZA 2P0KA 5I2SA 4J7FA 1JQQA 1I0CA 1WZOA 4N4HA 3CC7A 2V8JA 3ME9A 1AEYA 7AT1B 3UATA 2CS7A 5I11A 5I2MA 3PGGA 4M7DC 4BACA 2KNBB 4B6MA 2XDDA 4FCYA 2DBKA 3BW1A 2RHUA 1QVPA 2EGAA 4C8QF 4QKUA 1FMVA 1VUBA 2FL7A 4C0GA 1VQ7Q 1VQLT 1YI2Q 2DE0X 3EFSA 3H8ZA 5CKBA 4YTLA 3ZL7C 5GMKj 2NUZA 2I0NA 3E9FA 3CMEA 4LDUA 1NYFA 3HPWA 1UUEA 3EG2A 3CCVT 3PMIA 1Y07A 5LJ3j 3REAB 2PQWA 2RQVA 2CP5A 3O8VA 1AHJB 4OMPA 3REBB 2VB6A 2XG8D 1OZ3A 3CCMT 3TU4K 4DEYA 2DNUA 2O31A 4J9CA 2VUBA 1W4SA 2MOXA 1KQ1A 2DL3A 3PNWC 1NE8A 1NZ9A 4M7DA 3M53A 4LDXA 4E7ZA 4LD6A 4LD9K 3CD6A 3OMCA 2M0YA 2X4WA 1C0MA 2KMTA 3FJPA 1VIFA 4ZTJA 3E9GA 1LOJA 3HP9A 4PKCC 3QIIA 5LJ5h 4L6V5 1QVGA 4NL2A 3J81E 4EPCA 1HSQA 3QXEB 4OGEA 1PSFA 5FU6B 4V2SA 3OY9A 2BKDN 2GFAA 2RNAA 1T0JA 3CCEQ 2HQHA 2DILA 3A8GB 1B34B 2ZZDA 1CSKA 2EWNA 3RMQA 3A8HB 1SKUB 2OTJQ 4M77E 3VU3C 3BDLA 3M0RA 5HK3A 2WSFE 4KGZB 1G8XA 4LN2A 2JT4A 1WNLA 3M59A 3OYLA 3CXCA 1WHMA 4P5NA 1K9MU 1H3ZA 5KYYB 4E6RA 5IT9E 3CC7T 3GLXA 3E19A 3GBQA 5D7UA 1EIFA 1UGRB 1BI0A 2AT1B 2BZYA 3FEOA 3M55A 3RKXA 3AT1B 2CP7A 5LL6S 2EQJA 3HTRA 2PNIA 4LE9A 3I56Q 5I21A 2LMJA 4BY6B 3H0IA 2R58A 3TQ7P 3TSWA 3JCMe 3JB9H 4O5VA 1M8MA 3TVTA 3OSSC 1Y0MA 2X3WD 2RF0A 2EPDA 1WIEA 1QW1A 1D0ZA 2DMOA 4C8QC 4RTWA 3MEWA 1W70A 3FLGA 1YJNQ 1PD0A 1WXTA 2J6FA 2O88A 5C6SA 3NMZC 3PIOA 2LQNA 2GFUA 3LW5E 6AT1B 2PVOB 2DKGA 5FU7B 1TUDA 3HRSA 3ZFJA 4KUDK 2RI2A 3CEYA 4IKFA 2GTOA 1PSEA 3QYHB 3M0TA 4BDYA 2EFIA 2W0ZA 1OI1A 5IN1A 1K76A 3PVLA 2GGRA 2MAMA 1K9MR 2LNHB 3G6EQ 1X2QA 2HEQA 2VGNA 2WACA 3UWNA 1RAIB 2JS0A 1WI7A 2K2MA 2NUTB 1Q86C 2KRSA 3CD6T 2FRWA 4C92G 1TU0B 4E7SA 1KQ2A 3EHQA 2RQRA 1Z9ZA 4A53A 2B8AA 2YDLA 1R0CB 3EFOA 4C92D 1IGUA 2LJ0A 3CMEQ 5GAMd 1M27C 1QKXA 2K79A 5IH2A 2FG0A 1QP3A 1HYOA 4HKEA 4C8QA 1U8RA 1K4US 3CBOA 3CC4T 1QWFA 2A0FB 2LQ8A 2CUBA 5GANh 1VQ4Q 2ZPGB 3CBPA 4ELYC 3NTIA 2FZCB 1QVGS 2LP5A 3QUIA 2F2WA 1NG2A 2K57A 2GQIA 4GLKA 4M78C 1MNDA 4F14A 4FL6A 1VQ9A 2RM4A 1Q81C 4PJLA 4L59A 4HCZA 1VQOA 1VQMA 2CKKA 1GFCA 4DEXA 4JLIA 1VQNT 4M77B 4FYWB 4PFOA 1BU1A 2KXCA 1IREB 1E6HA 2LX7A 2VGMA 2JXBA 4M75G 2GBQA 2DTOA 4PLLA 3ER0A 3OBYA 3CMAT 2DD5A 2RJDA 2CP2A 5DY9A 3G4ST 3CXCS 2K4YA 2AIRB 4OB2B 1KQSP 4M75D 2LT4A 1LVKA 4QVDA 4PJOB 2QK0A 5IXBA 1GL5A 1YHQT 1KHCA 4FU6A 2CZ1B 3EG9B 3OW2A 4C0FA 4PFZA 3TREA 4A4HA 2ZAEA 2X9HA 1MMDA 1WHKA 4M77G 5CKEA 4XU3A 1LPLA 2E64A 4C92F 3D7SB 3RR6A 2KRNA 3MCAB 2DETA 5CAIA 3VS5A 3O5ZA 4PJNA 1S72A 4KH0B 2LCSA 1MHNA 2KBTA 3H6ZA 4ESRA 5J3BA 4M7DD 2RMOA 3J80E 2I2LA 1X75C 2D6FA 1M2VA 1OPLA 4PJOG 3JCMP 5GMKh 1I1JA 3H0FA 1U1TA 4DOWA 2XHCA 3RIRA 1U3OA 4PJOD 1ZUKA 1KG1A 3SDZA 1G83A 3URGA 2JUFA 4A4KA 3QKJA 2JW4A 4OMMA 2OTLA 4EIKA 5KYUB 4X34A 2J7IA 4AFUC 2LT1A 1QWEA 2NYSA 2LRQA 3RESA 1K1ZA 4AG2C 3L2ZA 1BB9A 2KK4A 4M75F 3PE0A 4JPBW 1ZSGA 5C0MA 5KH6A 3V8LA 2EW3A
chains in the Genus database with same CATH topology
1P92A 4M75E 4OMFB 4M78B 4NS5A 3JCMg 3X26B 1UGSB 3JB9I 3OYGA 3RKWA 5FROA 1VQ8A 4PL6A 1YITA 1I8FA 5CKFA 3CC4A 2RH2A 2VYTA 5KE3A 2DAQA 3VV0A 3M4YA 5HKCA 1K73C 2AHJB 1M1GA 3I56A 4UC4A 2F5KA 4M75C 3OB9A 2Y90A 2YRVA 4ME7A 4XTZA 5CO7A 5FU6C 4C92A 1WJRA 3HKSA 3X20B 4R56A 3DB4A 4DA4A 1YIJT 3PMTA 3SFMA 2KVQG 3L2WA 1VQOT 4OF1A 3P8DA 5CQYA 3WXMB 4ZN3A 1WPYA 1O75A 1M1KC 2VXFA 4XAXB 2RJCA 3CBMA 3GNGA 2XICA 4IURA 2F5TX 2ZPBB 4J6XA 3JCMc 4QVZA 3OYFA 1D3BB 2L8DA 4M7AC 4BE2A 1M8VA 2Y4YA 2H3JA 2RA2A 4HA8A 2P4TA 2DPPB 5LJ5f 4FSXA 1YJNA 3M58A 3R6OA 2DD4A 5GAN6 4N4IA 2GQVA 3WVEB 3LH0A 1N8RU 1VQKT 1VQNA 3PTAA 2PU9B 3A5ZB 2DZCA 1KD1C 1G5VA 4F7UB 1FWZA 5GAMg 3QG1A 2P0KA 5L8RE 3OYDA 2QTXA 4M7DE 5I2SA 4J7FA 4IUPA 3VKIA 2ZPIB 4N4HA 2V8JA 2HQEA 2ZPFB 4DQ2A 3CC7A 5GANf 1VQ5T 2LTOA 3ME9A 4E7JA 3RMSA 5CK9A 3QJYA 4PJOF 2MI6A 3CMAA 2CS7A 2ZCFB 1NJIU 3G4SA 2EQMA 5I2MA 3PGGA 1G3TA 3NFCA 4A4FA 5CKDA 4M7DC 3G7ZA 5GAOr 4BACA 2XDDA 1Q7YU 3HFOA 3UDCA 3FB9A 4XTYA 4PJOE 4JRIA 3SWNB 3BW1A 2RHUA 3OYYA 1QVPA 4N4GA 3PIPA 3JCMQ 2Y4XA 4FT2A 5CCAA 1YHQA 4M78A 1BI2A 4BB7A 4C8QF 3CCJT 3OYBA 4XU2A 1UGPB 4E7IA 2XIDA 4RCCA 1VUBA 2FL7A 3X24B 4C0GA 2EAYA 5D6YA 2DXUA 1VQLT 4C8QE 3EFSA 4BY6C 4M77D 3UPUA 2L3RA 1MGQA 2RB6A 3H8ZA 4LDVA 4DOVA 5CKBA 3JCMf 4C0DC 5A0DA 4YTLA 3MO8A 1G3YA 4BD3A 2E10A 5GMKj 2KY9A 3E9FA 3CMEA 1YBYA 2DO3A 3QDRB 2L5QA 4LDUA 5CQXA 4F7UG 4C92B 5A0LA 3HPWA 4HT9A 3JCMb 3CCVT 2EYQA 1B34A 2HQXA 3PMIA 3QO3A 1WQWA 1XTDA 4JS4A 1K9MC 1Y07A 2RHIA 3M5AA 5LJ3j 1G3SA 2PQWA 3O8VA 2YHTA 4BI4A 5FRNA 3OS1A 1AHJB 4M7AA 3EAEA 1JJ2S 1D3BA 2ZPHB 4BI8B 1XQHA 2VXEA 5CVIA 3S3MA 3C12A 1TH7A 3CCEA 3LWIA 3I55A 2XG8D 3FIFA 1KC8C 1N9RA 3P8HA 2DIGA 5LJ3h 1OZ3A 4GY5A 3FC3A 1K73U 2C06A 1OYXA 3CCMT 3TU4K 2QDYB 5FU7C 5GAOm 4NOYA 2VUBA 1W4SA 2X4JA 4LDYA 1KQ1A 3PNWC 1KQSS 3OYAA 1QVFS 1NE8A 2KAFA 1M90C 2OTJA 1N27A 1NZ9A 2A7YA 4MZMA 5GAOq 2R57A 1G3WA 2DTHA 3RUXA 2CYZB 2IVWA 3M4GA 4M7DA 3LWHA 2M16A 3JCMX 4RMOA 2GCXA 4O6JA 3M53A 3OYKA 4JLGA 5GAMf 3S3OA 2QQ9A 4LDXA 1M5Q1 5CIUA 1QP2A 2XDPA 5HK0A 4LD6A 1M1KU 1LNXA 2BIVA 4LD9K 3OYCA 4E7LA 3CD6A 4VUBA 3OMCA 4XK8E 3P8BB 2HNIA 2X4WA 3SD4A 2KMTA 3VYGA 3LLRA 3FJPA 2E5QA 1VIFA 2ZPEB 1KD1U 2LDMA 2QEXT 4ZTJA 2EJGA 3E9GA 3HL8A 4FM4B 1LOJA 5LJ3e 2JVVA 5J26A 3VUZA 3HP9A 1JBMA 4PKCC 1VQ6A 2G3RA 3QIIA 5LJ5h 5EG2A 1WJQA 4L6V5 3VJPA 1QVGA 1WGSA 4NL2A 3V7CA 3J81E 4C0ZA 4EPCA 1HK9A 1UB4A 3FRNA 2E1HA 3WVDB 4EMGA 3QXEB 2QA4A 4M75B 4OGEA 1VQ8T 2RI5A 1PSFA 5FU6B 2JZ2A 2NLUA 4Q5WA 3CCLT 1YITT 4V2SA 3OY9A 3CCQA 2BKDN 1VQ9T 2F69A 2DXCA 4Y28E 4XTWA 2DIQA 1DJ7B 4CRIA 1BYMA 1N6AA 3MEVA 2GFAA 1VQ7T 1I81A 3C95A 1YI2T 3VYHB 1YJ9T 2LVMA 2LCCA 5LJ3d 3A8GB 2LX9A 1VQMT 1B34B 4QQGA 3OYIA 2ZZDA 2DEQA 2M9UA 3GNFB 3FDRA 3N5BB 4M77F 4A54A 2EWNA 4M7AB 4R55A 3F70A 3RMQA 4L5GA 3A8HB 3RERA 4PLIA 3MHXA 3JCMV 2QXFA 5LJ5e 4M77E 2XK0A 2HAXA 3VU3C 1YIJA 1VQPT 3BDLA 4OB0B 4ZGDB 2WSFE 5HK3A 1SSFA 4J8OA 3CCSA 2MWPA 2DJZA 1WNLA 2RJEA 3M59A 4FIBA 3OYLA 1I5LA 3V8JA 2EQUA 3CXCA 4M78G 4EDUA 4P5NA 4F7UF 2MF2A 4M77C 1K9MU 3TEEA 2YLCA 1R8OB 2K3XA 3JB9G 4M7DB 2HBPA 1H3ZA 5IT9E 3CC7T 3GLXA 2WSEE 3E19A 1VQKA 1EIFA 1UGRB 2JN0A 2WSCE 3HRUA 4M78D 4F7UE 5GAN2 4XTVA 1BI0A 2QI2A 3M55A 3FEOA 2RK2A 3RKXA 3KUFA 5LJ5d 3OYNA 1KC8U 1X01A 3V7SA 5LL6S 4JRQA 2EQJA 3G6EA 4J83A 4EMKC 3DLMA 1NPRA 1VQ5A 1M1FA 2CZ0B 3M56A 1K8AC 2E6NA 3OW2S 2R5MA 2E41A 4C5IA 1M90U 2LC4A 5GAN4 5I21A 4BY6B 3OMGA 4CI0C 2EIFA 3MP8A 3HSBA 4M75A 4M7AG 4PJOC 1RL2A 2O01E 4C0DB 3CCRA 2XD0A 1M4ZA 2R58A 2V8KA 4JJNK 1N9SA 5IAYA 4RG8A 3JCMe 3JB9H 4O5VA 5LJ3g 2LCLA 3RKYA 3VUBA 3OSSC 3JCMJ 1H641 3CC2T 1Q82C 3GIBA 4M7AD 1S72T 5DLOA 3CCJA 3DKMA 2K5IA 1QW1A 3GF5A 3A8LB 4C8QC 5GAMh 2E70A 4JS5A 2ZGWA 3MEWA 3ASKA 2DTIA 4Y91A 3QZ9B 3FLGA 4J6WA 4LDWA 2XI9A 4M7DG 2XU8A 4MDWA 3OYHA 2XDBA 5C6SA 2K5FA 3L1AA 3PIOA 3L2RA 4BE1A 1VQ4A 2FVUA 2DXTA 2GFUA 3HHTB 3KBGA 3LW5E 3NTKA 5AYFA 2PVOB 1W2BS 2D9TA 2E65A 3S3NA 4ZTFA 2DKGA 1KHIA 5FU7B 3HRSA 3ZFJA 4OGCA 3L42A 4M77A 3M57A 4IUUA 2LQKA 4KUDK 2RI2A 4E7HA 3CEYA 4IKFA 1PSEA 3QYHB 5GMKi 2XKOC 4BDYA 2EFIA 1OI1A 3M54A 5IN1A 5GAOl 2PUKB 2OTLT 5GAOp 4ZGEB 2PUOB 3X28B 2MAMA 3LGFA 3PT9A 3MP1A 1ZQ1A 3QPHA 1GXIE 2X4XA 3LX7A 2A3LA 5GAMe 4JRKA 1OZ2A 2P0PA 3CCMA 3OA6A 4XTUA 2VGNA 2WACA 3UWNA 5CR2A 3DLLA 4EMKA 2PVDB 1Q7YC 4IUVA 5GMKm 1M9SA 2K3YA 4ZGJB 5LJ5j 1Q86C 3ZBDA 3CD6T 2RHYA 5J39A 5GAN7 4C92G 1YJWA 4PJOA 4C5EA 3MEAA 3OBWA 4JUVA 4KBMB 5GAN8 1KQ2A 5GMKl 4A53A 5KCHA 5GAN3 3JSCA 3CCUT 2B8AA 3G71A 4HT8A 3QYGB 3OS0A 2JNGA 1Y7XA 2X4YA 4MMKA 4C92D 4QVCA 3CPWS 5GANj 4M78F 1VQ6T 5GAMd 2E6ZA 1U8RA 1Y96A 1QP3A 4HKEA 2RD1A 4C8QA 3CBOA 3CC4T 5GAN5 2LQ8A 3L2UA 1BKBA 4M78E 4MDXA 4KUIA 5CKHA 5GANh 3C94A 1WJSA 3V8KA 3I56T 2ZPGB 3CBPA 4FT4A 4QW2A 4EMHA 4ELYC 3NTIA 2L89A 3GPLA 5LJ3f 1QVGS 3QUIA 4MMLA 4RKUE 1K8AU 3BDUA 2K57A 1JB0E 1YCYA 3CPFA 4GLKA 4M78C 3OS5A 3CCLA 3HFNA 4FL6A 1VQ9A 4MZPA 3QBYA 5KCOA 4B9XA 2VC8A 3HRTA 4A4EA 5A2QE 2RM4A 2DZ9A 2O4XA 1Q81C 4M7AF 3S6WA 3E1SA 1BI3A 4B9WA 1VQ7A 1X6OA 1BIAA 4L59A 4IUTA 1YI2A 4X9CA 4HCZA 4OB3B 1VQOA 1YJ9A 1Q82U 1FXXA 1V29B 2CKKA 2RHZA 5DLQE 1YJNT 2YLBA 4JLIA 1VQMA 4M7AE 4J7IA 3MP6A 3A8OB 4QQDA 5GAOn 1VQNT 4M77B 3CCST 2RI3A 4BI3A 1IREB 3JCMh 4C5HA 2CZ6B 3LGLA 2JTFA 4OB1B 2VGMA 4ELZC 5GANe 3A8MB 3OSVA 4JDSA 1WQ7A 3TCJA 4M75G 1VQPA 3META 2DTOA 4MZTA 3QZ5B 4PLLA 4RCBA 3V7RA 3UT1A 4M7DF 3ER0A 3OBYA 3M9QA 3CMAT 1ZBXA 2DD5A 2RJDA 5DY9A 3G4ST 4EMKB 3CXCS 3L2QA 4KULA 3JB9D 3EFRA 2K4YA 4OB2B 3OYMA 4M75D 2DVEA 4JRPA 2D0QB 1XOVA 2LT4A 2CZ7B 3DB3A 4QVDA 3G6ET 4PJOB 4XTXA 5DM7R 2R5AA 1YHQT 2LNVA 4BDZA 1KHCA 4FU6A 1Y71A 2CZ1B 4C5GA 1IZ6A 3OW2A 4HCBA 2K5LA 4C0FA 5GANd 2K2VA 5GAMj 2RK1A 3GP8A 3OYEA 3TREA 2QQAA 3PFSA 4A4HA 1BIBA 3CCRT 3L2VA 2EJ9A 2EQKA 1Y96B 4OP0A 3JCMW 4C8QB 4NL3A 4PNOA 4J6YA 1Q86U 4N0AC 2RHXA 4M77G 2KQWA 5CKEA 3SWNC 4HCCA 2QQRA 4XU3A 1VQLA 3QJ6A 3CMET 2E64A 4C92F 4II1A 4RG2A 5FRMA 2M1HA 2OAUA 4ATOA 1UEBA 4QQ6A 3MCAB 3QSUA 3LYIA 3C4SA 5CAIA 4WF2A 3CC2A 2EJFA 1JRIA 5A0GA 4C92E 1S72A 2PVGB 1JJ2A 2JOYA 4E7KA 2RO0A 4A4GA 1MHNA 1XNIA 2MMPA 2MWOA 1UGQB 3H6ZA 3JCMd 1VQ4T 1N8RC 2DXBA 3CCVA 1W2BA 4XU1A 5J3BA 4E47A 4M7DD 2O4XB 1HXDA 3X25B 3CCET 3J80E 2I2LA 3I55T 2FB7A 3GOXA 2CGHA 2IG0A 3JAME 3BFMA 2BUDA 2QQBA 1X75C 2D6FA 3AHUA 2X35A 4PJOG 4C92C 3ZEHA 1O9SA 3JCMP 3OS2A 1QVFA 1KQSA 2QQSA 4KT0E 4ZN1A 5GMKh 5LJ5g 5D6WA 3KXTA 2OTJT 1NJIC 2KSSA 4D6WA 1U1TA 2E12A 2EKOA 3BY7A 4DOWA 2XHCA 3RIRA 1BI1A 3T9NA 3SB2A 4PJOD 4XU0A 1VIEA 1KG1A 4X9DA 4TVRA 1Q81U 4C8QG 3SDZA 2FYKA 4F7UA 3INZA 2JUFA 4Z02A 3URGA 1NPPA 2P0QA 3MEUA 2HD0A 4XQ3A 3QKJA 4A4KA 1RI0A 5GANg 3Q1JA 2OTLA 4X34A 1FX7A 3OQ5A 2LT1A 3NTHA 3J7AF 1YJWT 4C8QD 2LRQA 3RESA 5HY6A 4BE0A 2KDSA 2M0OA 2VV5A 3G71T 3L2ZA 4IUQA 5M9OA 1U1SA 4N0AA 5KE2A 1LJOA 3JB9J 2GF7A 3CPWA 3SWNA 5GMKe 5D6XA 3JB9F 2DK3A 2QEXA 1I4K1 2JTMA 4J5YA 2KK4A 4M75F 2QA4T 4OVAA 4BUGA 3CCUA 3OYJA 5C0MA 2RJFA 3QHSA 2V8IA 5FLXE 3CCQT 5KH6A 1ZHIA 2FHDA 3V8LA 3JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNW C;  4NS5 A;  3OYG A;  3OYA A;  3MET A;  5FRO A;  4PLL A;  1N27 A;  3UT1 A;  4PL6 A;  2R57 A;  3M9Q A;  2RJD A;  2VYT A;  5KE3 A;  2DAQ A;  2M16 A;  3MEW A;  3L2Q A;  3ASK A;  3OYK A;  3S3O A;  5CIU A;  2XDP A;  4LD6 A;  4UC4 A;  3OYM A;  2F5K A;  2BIV A;  3FLG A;  3OB9 A;  2YRV A;  3OYC A;  4E7L A;  1WJR A;  3OMC A;  3OYH A;  5C6S A;  3L2R A;  3DB3 A;  3DB4 A;  4BE1 A;  2X4W A;  2GFU A;  2R5A A;  3NTK A;  3PMT A;  4BDZ A;  1KHC A;  2D9T A;  4FU6 A;  3SD4 A;  4C5G A;  3S3N A;  3LLR A;  3L2W A;  4ZTF A;  2E5Q A;  3P8D A;  2LDM A;  4ZTJ A;  3E9G A;  3OYE A;  3L42 A;  5J26 A;  4IUU A;  2RJC A;  2RI2 A;  3PFS A;  3CEY A;  4IUR A;  4A4H A;  2G3R A;  3QII A;  3L2V A;  4E7H A;  1WJQ A;  2EQK A;  4QVZ A;  3OYF A;  2L8D A;  4BDY A;  2EFI A;  1WGS A;  4BE2 A;  1OI1 A;  4IKF A;  5IN1 A;  2RHX A;  4N4I A;  3LGF A;  3LH0 A;  3MP1 A;  2QQR A;  2RI5 A;  1G5V A;  2X4X A;  2JZ2 A;  2NLU A;  3LX7 A;  3QJ6 A;  4II1 A;  4Q5W A;  4RG2 A;  3OY9 A;  1OZ2 A;  2BKD N;  2M1H A;  3OYD A;  2P0K A;  3OA6 A;  5FRM A;  2WAC A;  3UWN A;  2DIQ A;  4QQ6 A;  4CRI A;  4IUP A;  3LYI A;  3C4S A;  3MEV A;  4IUV A;  2GFA A;  2K3Y A;  4N4H A;  2HQE A;  2LTO A;  3ME9 A;  4E7J A;  2RHY A;  5J39 A;  4E7K A;  2RO0 A;  2LVM A;  1MHN A;  1XNI A;  2MWO A;  2LCC A;  3H6Z A;  4A4G A;  3OYI A;  4QQG A;  3MEA A;  4C5E A;  2EQM A;  3FDR A;  2O4X B;  4A4F A;  5KCH A;  4BAC A;  2B8A A;  3F70 A;  3GOX A;  2IG0 A;  2BUD A;  3OS0 A;  2X35 A;  4PLI A;  2X4Y A;  3ZEH A;  2RHU A;  4N4G A;  3OS2 A;  2XK0 A;  2QQS A;  3BDL A;  5D6W A;  1SSF A;  3OYB A;  2MWP A;  2EKO A;  4E7I A;  2RJE A;  3OYL A;  3L2U A;  2EQU A;  5D6Y A;  4EDU A;  1WJS A;  4QW2 A;  2L3R A;  3H8Z A;  2L89 A;  3NTI A;  4Z02 A;  3MEU A;  3MO8 A;  2K3X A;  3QKJ A;  1H3Z A;  1RI0 A;  3Q1J A;  4BD3 A;  4X34 A;  3OQ5 A;  3NTH A;  3E9F A;  4FL6 A;  3OYN A;  3FEO A;  2LRQ A;  3QBY A;  3KUF A;  4B9X A;  2HQX A;  5KCO A;  4BE0 A;  3PMI A;  4A4E A;  2O4X A;  3S6W A;  2EQJ A;  2M0O A;  2RHI A;  5FRN A;  2PQW A;  3DLM A;  3O8V A;  4B9W A;  3OS1 A;  4L59 A;  3EAE A;  4IUT A;  4IUQ A;  5KE2 A;  5M9O A;  2E6N A;  4HCZ A;  2R5M A;  2GF7 A;  2RHZ A;  2CKK A;  5D6X A;  4C5I A;  3MP6 A;  4QQD A;  3S3M A;  4OVA A;  3OMG A;  3MP8 A;  3OYJ A;  5C0M A;  2RI3 A;  2RJF A;  3P8H A;  2DIG A;  1OZ3 A;  4GY5 A;  4C5H A;  3FC3 A;  5KH6 A;  1OYX A;  3LGL A;  2JTF A;  2R58 A;  2FHD A;  5IAY A; 
#chains in the Genus database with same CATH topology
 4OMF B;  2BZX A;  1UGS B;  1OUL A;  5L23 A;  4HCK A;  2DEU A;  4JZ4 A;  3M4Y A;  2G6F X;  1K73 C;  2AHJ B;  4UC4 A;  2F5K A;  5FU6 C;  1IRX A;  1WJR A;  1TXQ A;  2BZ8 A;  4DA4 A;  3L2W A;  1VQO T;  3P8D A;  3WXM B;  2QG9 B;  1O75 A;  2KT8 A;  4X1V A;  2XIC A;  2ZPB B;  3JCM c;  4QVZ A;  3OYF A;  2EYW A;  2L3Q A;  2H3J A;  1TOV A;  2HBW A;  2C0T A;  4FSX A;  1YWO A;  3R6O A;  5GAN 6;  2GQV A;  3LH0 A;  1OEB A;  1KD1 C;  3A1P A;  2M02 A;  4F7U B;  3OYD A;  3QG1 A;  5L8R E;  2QTX A;  5KYN A;  2CH4 W;  3VKI A;  2ZPI B;  2QEX Q;  5GAN f;  1VQ5 T;  2LTO A;  4E7J A;  4PJO F;  1NJI U;  2EQM A;  4A4F A;  2DL5 A;  3G7Z A;  5GAO r;  2EYY A;  3E2U A;  1K0S A;  4XTY A;  4JJD A;  4DBF A;  1U5S A;  1VQ8 Q;  4N4G A;  1ZBJ A;  2Y4X A;  1VQ9 Q;  1MMN A;  4PJJ A;  1BK2 A;  3VS1 A;  3CCJ T;  3OYB A;  4E7I A;  2XID A;  1BCM A;  1UHC A;  2L2P A;  2EAY A;  1X27 A;  4BY6 C;  1VQM Q;  4LDV A;  2RB6 A;  2HSP A;  2AZS A;  1AWO A;  1TUG B;  3MO8 A;  4BD3 A;  1M3C A;  4KH1 B;  4F7U G;  4HT9 A;  3JCM b;  1B34 A;  2PTK A;  3H9N A;  1XTD A;  1JEG A;  4JS4 A;  2RHI A;  3M5A A;  2D8J A;  5FRN A;  4BI4 A;  1D3B A;  2K7A A;  2H3E B;  1XQH A;  5CVI A;  3CCE A;  2SEM A;  3VS7 A;  2F2X A;  4GY5 A;  2QDY B;  5FU7 C;  5GAO m;  2FO0 A;  2X4J A;  3MPU B;  2OTJ A;  2A7Y A;  3RUX A;  1G3W A;  1ZSZ B;  2CYZ B;  1Y57 A;  2IVW A;  1S1N A;  3M4G A;  1W6X A;  4DBR A;  3JCM X;  4RMO A;  5EC7 A;  3S3O A;  5GAM f;  1M1K U;  1QP2 A;  3VS0 A;  1JXO A;  1LNX A;  2BIV A;  1NJI R;  2QDL A;  4E7L A;  2EYZ A;  3SD4 A;  3RDV A;  1EX4 A;  3H41 A;  2RQU A;  5LJ3 e;  1S72 Q;  5J26 A;  1JBM A;  1VYT A;  1WJQ A;  1WGS A;  2JM9 A;  3V7C A;  1HK9 A;  1UB4 A;  3WVD B;  4EMG A;  2ROT A;  2NLU A;  4Q5W A;  1RAB B;  3UA7 A;  4XTW A;  2DIQ A;  3MEV A;  2OX7 A;  1VQ7 T;  2K6D A;  2MPX C;  3C95 A;  1YI2 T;  2DVJ A;  2LVM A;  2LCC A;  3OYI A;  4QQG A;  2DEQ A;  3GNF B;  1RAF B;  2JS2 A;  3FDR A;  4HVU A;  2SRC A;  4E2F B;  4M7A B;  3F70 A;  1QMC A;  1D09 B;  2XK0 A;  2HAX A;  1YIJ A;  1K9A A;  2LZ6 B;  4ZGD B;  2YXY A;  2HKQ B;  3VS2 A;  2EQU A;  4M78 G;  3VS3 A;  4EDU A;  4F7U F;  4M77 C;  1AWX A;  1OOT A;  3TEE A;  3JB9 G;  1M1K R;  1VQK A;  2WSC E;  4M78 D;  4AFZ C;  2YRC A;  4R0K A;  1VQ6 Q;  3KUF A;  5LJ5 d;  2FRY A;  1KC8 U;  2CT4 A;  3G6E A;  4J83 A;  3DLM A;  1NPR A;  4RTT A;  2J6K A;  2E6N A;  2R5M A;  2E41 A;  1M90 U;  4KGV B;  2LC4 A;  3CCQ Q;  3OMG A;  4M7A G;  2EIF A;  3MP8 A;  4FYY B;  4FSS A;  4M75 A;  4PJO C;  4C0D B;  2O01 E;  3UF4 A;  1M4Z A;  1N9S A;  1H8K A;  3RKY A;  3VUB A;  1H64 1;  1Q82 C;  4M7A D;  4JJC A;  4JS5 A;  3ASK A;  1IHW A;  3QZ9 B;  3EG3 A;  4J6W A;  2XI9 A;  2XU8 A;  4MDW A;  2XDB A;  1VQ4 A;  3CCS Q;  1MNE A;  2FVU A;  1W2B S;  3HHT B;  1V76 A;  3S3N A;  1KHI A;  2CRE A;  5KYX A;  3L42 A;  4M77 A;  5GMK i;  4PJM A;  4JZ3 A;  1NLO C;  1GXI E;  2HL3 A;  3LX7 A;  4JRK A;  2P0P A;  1B07 A;  5CR2 A;  3DLL A;  4IUV A;  1M9S A;  1KC8 R;  5GAN 7;  1AOJ A;  2A08 A;  1QKW A;  4PJO A;  4C5E A;  1F1B B;  2IPO B;  3EG9 A;  1M90 R;  4HT8 A;  2JNG A;  2X4Y A;  4MMK A;  4QVC A;  4M78 F;  2C0O A;  2RD1 A;  1FMW A;  5GAN 5;  2AZV A;  3C94 A;  3I56 T;  3V8K A;  1TTH B;  4RKU E;  1K8A U;  1M30 A;  1T3L A;  3CPF A;  3CCL A;  3HFN A;  3QBY A;  4B9X A;  2VC8 A;  3HRT A;  1SEM A;  4M7A F;  1VYV A;  1X6O A;  1BIA A;  1GBR A;  1YJ9 A;  2RHZ A;  4HXJ A;  1YJN T;  3A8O B;  1OV3 A;  1PKT A;  2V26 A;  2D8H A;  3A8M B;  2E3I A;  1VQP A;  1W2B P;  2CP3 A;  2IIM A;  3UT1 A;  1ZBX A;  1N5Z A;  5KYU A;  4EMK B;  3L2Q A;  1MV3 A;  1Q95 G;  4KUL A;  5AT1 B;  1XOV A;  3G6E T;  5DM7 R;  3IQL A;  3ULR B;  4HVV A;  2CP6 A;  2KXD A;  5GAN d;  2GNC A;  3OYE A;  2BE9 B;  3BE3 A;  3PFS A;  1BIB A;  2EVR A;  1Y96 B;  4PNO A;  3CME T;  4KGX B;  2QAZ A;  2NUP B;  1TS9 A;  2DX1 A;  1K8A R;  2OAU A;  2RN8 A;  1YIJ Q;  2M51 A;  3QSU A;  3M0S A;  3LYI A;  3CC2 A;  2EJF A;  1JJ2 A;  1XNI A;  1VQ4 T;  3EG1 A;  1UGQ B;  2ED0 A;  3LH5 A;  2O4X B;  1E6G A;  1QCN A;  2CGH A;  3JAM E;  2BUD A;  2QQB A;  3THK A;  1VQK Q;  2CSI A;  4OMQ A;  2DBM A;  3OS2 A;  2ABL A;  1QVF A;  4PK4 A;  2HL5 C;  5D6W A;  3KXT A;  2FPF A;  2EQI A;  4D6W A;  2BE7 D;  1YNZ A;  3BY7 A;  1JU5 C;  8AT1 B;  2EGE A;  3SB2 A;  1D1C A;  4X9D A;  2FYK A;  4J9B A;  4F7U A;  1NPP A;  4DBQ A;  2P0Q A;  1VYU A;  5GAN g;  2YSQ A;  1AVZ C;  2COY A;  1GBQ A;  1B3Q A;  3NTH A;  2JTE A;  5HY6 A;  4BE0 A;  1TUC A;  1ZSZ C;  2L0A A;  1RUW A;  1LJO A;  3CPW A;  4J9G A;  2QEX A;  1Q7Y R;  4BUG A;  2DF6 A;  3CCU A;  1ZHI A;  2FHD A;  3JRZ A;  3OYG A;  1VQ8 A;  1UGV A;  2YWW A;  2RH2 A;  2VYT A;  3VV0 A;  1M1G A;  3I9Q A;  3OB9 A;  2YRV A;  4ME7 A;  2YT6 A;  1WX6 A;  8ATC B;  1UDL A;  2EYX A;  3PMT A;  2E3H A;  4OF1 A;  2E4H A;  4LXC A;  4XAX B;  3CBM A;  4M7A C;  4FW2 A;  4BE2 A;  5LJ5 f;  4HA8 A;  2P4T A;  3EHR A;  3M58 A;  1UE9 A;  1N8R U;  4F17 A;  5GAM g;  4WCI A;  1K0X A;  4IUP A;  4DQ2 A;  1NM7 A;  2YRD A;  2YUO A;  3RMS A;  2V1Q A;  3EGU A;  1H92 A;  1G3T A;  3NFC A;  2MCN A;  1WXU A;  3HFO A;  3UDC A;  2QGF B;  3FB9 A;  2CSQ A;  3SWN B;  2O2O A;  3MJX A;  5CCA A;  3JCM Q;  3CCL Q;  1YIT Q;  2F1L A;  4M78 A;  1BI2 A;  4BB7 A;  4XU2 A;  1UGP B;  3X24 B;  4CC2 A;  1H3H A;  1YJ9 Q;  4C8Q E;  4M77 D;  3UPU A;  1MGQ A;  4DOV A;  4C0D C;  5A0D A;  1SHG A;  2CT3 A;  1G3Y A;  1VA7 A;  4J9D A;  2E10 A;  2EGC A;  2L5Q A;  1U06 A;  5CQX A;  2HQX A;  2ROL A;  1VQP Q;  3QO3 A;  1WQW A;  1QVG P;  1K9M C;  4M7A A;  1G3S A;  2D0N A;  1YP5 A;  3EAE A;  1JJ2 S;  2ZPH B;  2VXE A;  3S3M A;  1OX9 A;  1TH7 A;  3I55 A;  1N9R A;  5LJ3 h;  2DIG A;  3FC3 A;  3PVQ A;  3NHN A;  1FYN A;  1N8R R;  1QVF S;  3OYA A;  1OU8 A;  5GAO q;  2R57 A;  2DTH A;  2HZY A;  3LWH A;  4O6J A;  1M5Q 1;  2XDP A;  5HK0 A;  3OYC A;  2B86 A;  3P8B B;  1QCO A;  2LQW A;  3CXC P;  3VYG A;  3LLR A;  2LDM A;  2QEX T;  2EJG A;  3CC2 Q;  3HL8 A;  4FM4 B;  3VUZ A;  1QLY A;  1SRL A;  5GJW B;  1VQ6 A;  1LCK A;  5EG2 A;  2E1H A;  2QA4 A;  5IHI A;  1VQ8 T;  2JZ2 A;  1VQ9 T;  3CCQ A;  2HSE B;  2DXC A;  4GBQ A;  1DJ7 B;  4CRI A;  1GCQ C;  1BYM A;  3RBB B;  1C1A A;  1I81 A;  3VYH B;  4WTO B;  1VQM T;  3N5B B;  4M77 F;  3RER A;  3MHX A;  3JCM V;  2QXF A;  1UJ0 A;  4Z8A A;  1SSF A;  4J8O A;  5HCK A;  3CCS A;  2DLP A;  3V8J A;  1RAD B;  1PM3 A;  1SRM A;  4RTU A;  2MF2 A;  2KR3 A;  1JJ2 P;  2DRK A;  2K3X A;  2QGG A;  2HBP A;  3CCU Q;  2WSE E;  2BTT A;  3HRU A;  4FW1 A;  3A98 A;  4XTV A;  1PRL C;  2QI2 A;  3OYN A;  1IHV A;  4EMK C;  2D1X A;  2CZ0 B;  3M56 A;  3OW2 S;  4C5I A;  4OMO A;  4CI0 C;  2A37 A;  3HSB A;  4GLM A;  1RL2 A;  4D8D A;  1WLP B;  1GCQ A;  1QCF A;  4RG8 A;  2DA9 A;  4AMC A;  2HKN A;  2LCL A;  1JO8 A;  3GIB A;  1S72 T;  2COW A;  2K5I A;  3GF5 A;  2GTJ A;  4M4Z A;  4RTV A;  1BBZ A;  2ZGW A;  2DTI A;  1R77 A;  2DJQ A;  5FWC A;  1TSF A;  1A0N B;  3OYH A;  2K5F A;  3L2R A;  4BE1 A;  3KBG A;  5AYF A;  2FZK B;  3NTK A;  2FZG B;  2D9T A;  2E65 A;  1NEB A;  1KSW A;  3C0C A;  4IUU A;  2LQK A;  3VS6 A;  1WHL A;  2K3B A;  1SHF A;  2ENM A;  9ATC B;  5GAO l;  2PUK B;  1EFN A;  2RQW A;  5KYY A;  5GAO p;  2OTL T;  2PUO B;  3MP1 A;  3QPH A;  5GAM e;  2A3L A;  2AKL A;  4QT7 A;  3CCM A;  2KRM A;  4XTU A;  4EMK A;  5KYW B;  5GMK m;  2K3Y A;  4ZGJ B;  1AWJ A;  2VVK A;  1ABQ A;  3ZBD A;  4J9I A;  2HMA A;  5J39 A;  2L3S A;  3CCR Q;  5GAN 8;  4JUV A;  4KBM B;  2H8H A;  1EZZ B;  5GMK l;  5KCH A;  5GAN 3;  4F16 A;  3QYG B;  3OS0 A;  1Y7X A;  3QWX X;  5GAN j;  1VQ6 T;  3EGD B;  1Y96 A;  2CUD A;  1BKB A;  4MDX A;  4RTX A;  5CKH A;  1JXM A;  1W1F A;  4FT4 A;  4QW2 A;  2NUP A;  2V1R A;  5LJ3 f;  4LUE A;  3OW2 P;  3I55 Q;  3BDU A;  3EG0 A;  1JB0 E;  2AKK A;  2P4R A;  3OS5 A;  5KCO A;  4CC7 A;  2O4X A;  4FYX B;  3S6W A;  2DFU A;  4J9E A;  3E1S A;  1BI3 A;  1PG5 B;  1IB8 A;  1IXD A;  4X9C A;  4OB3 B;  2FPD A;  1FXX A;  1V29 B;  1BCO A;  2YLB A;  2J06 A;  4J7I A;  3MP6 A;  4QQD A;  5GAO n;  3UA6 A;  2ESW A;  3CCS T;  1HD3 A;  4BI3 A;  3JCM h;  4C5H A;  2CZ6 B;  3LGL A;  2JTF A;  4ELZ C;  3OSV A;  1YJW Q;  4JDS A;  1WQ7 A;  3TCJ A;  4MZT A;  2NUT A;  4RCB A;  3G71 Q;  1PCX A;  1RLQ C;  2QYZ A;  3JB9 D;  5IHK A;  1OPK A;  2DVE A;  2D0Q B;  2QA4 Q;  2CZ7 B;  2R5A A;  2LNV A;  1PNJ A;  1Y71 A;  4HCB A;  1IZ6 A;  5GAM j;  1D0Y A;  3FJ5 A;  2DL4 A;  1AWW A;  1E7O A;  1D1A A;  2QQA A;  3L2V A;  4OP0 A;  4J6Y A;  1Q86 U;  2RHX A;  3SWN C;  4II1 A;  4RG2 A;  5FRM A;  1NLP C;  3M0Q A;  1T0H A;  3NGP A;  4QQ6 A;  3C4S A;  1AT1 B;  1V1C A;  4WF2 A;  5A0G A;  4C92 E;  1YCS B;  2JOY A;  2RO0 A;  3EGX B;  2MWO A;  4A4G A;  2MMP A;  3RNJ A;  4XU1 A;  4E47 A;  1MUZ A;  3X25 B;  3CCE T;  2FB7 A;  2IG0 A;  2X35 A;  4Y92 A;  1KQS A;  4KT0 E;  4ZN1 A;  5LJ5 g;  2NWM A;  2OTJ T;  1NJI C;  2KSS A;  2EKO A;  3T9N A;  1YWP A;  4XU0 A;  1IGQ A;  2X3X D;  1Q81 U;  3INZ A;  3I5S A;  2O9S A;  3MEU A;  1RI0 A;  2KYB A;  3Q1J A;  1FX7 A;  3J7A F;  3TSZ A;  1IO6 A;  2M0O A;  2DL8 A;  4IIO A;  5M9O A;  1U1S A;  5KE2 A;  2GF7 A;  1VQL Q;  3SWN A;  3JB9 F;  1I4K 1;  2JTM A;  2CH4 A;  1UEC A;  1Q86 R;  3QHS A;  2V8I A;  5FLX E;  2J6O A;  3VRZ A;  1P92 A;  4M75 E;  3JB9 I;  3CCV Q;  1GCP A;  5FRO A;  2RPN A;  1YIT A;  1I8F A;  2JJ9 A;  5CKF A;  3CC4 A;  2DAQ A;  4A63 B;  4XTZ A;  2Y90 A;  2MIO A;  3X20 B;  2DL7 A;  1SPK A;  1YIJ T;  3CCM Q;  1D1B A;  2K9G A;  2EKH A;  3EH2 A;  5CQY A;  4Z88 A;  3VS4 A;  2F2V A;  1M1K C;  2RJC A;  2F5T X;  4J6X A;  2W10 A;  4ANJ A;  1D3B B;  1FMK A;  2Y4Y A;  2COZ A;  2RA2 A;  3KFV A;  1SG5 A;  2DD4 A;  1Q81 R;  3WVE B;  1PC0 A;  1VQK T;  1VQN A;  3PTA A;  2PU9 B;  3A5Z B;  1G5V A;  1I07 A;  2JMA A;  4M7D E;  2KGT A;  4AFQ C;  2ZPF B;  2HQE A;  1KFZ A;  1D0X A;  1B7T A;  2Z0W A;  3QJY A;  5CK9 A;  2MI6 A;  3CMA A;  2ZCF B;  3SEM A;  1QQJ A;  1YN8 A;  3G4S A;  5CKD A;  1NBE B;  4RUG A;  1Q7Y U;  4PJO E;  1OU9 A;  4JRI A;  1PWT A;  2KT1 A;  3OYY A;  3PIP A;  4FT2 A;  1YHQ A;  4RCC A;  1WHJ A;  5D6Y A;  2E5K A;  1WHH A;  2DXU A;  3M0P A;  4D8K A;  1UTI A;  1YFN A;  2L3R A;  3JCM f;  2ECZ A;  2PZ1 A;  2KY9 A;  1YBY A;  2DO3 A;  3QDR B;  2J05 A;  5A0L A;  4C92 B;  2EYQ A;  2YHT A;  1RAA B;  3OS1 A;  4BI8 B;  4CC4 B;  3C12 A;  3LWI A;  3FIF A;  1KC8 C;  3P8H A;  2C06 A;  1K73 U;  1OYX A;  3CC7 Q;  2KI7 A;  1AZE A;  2QTV A;  4NOY A;  1KQS S;  4LDY A;  2KAF A;  1M90 C;  1N27 A;  4MZM A;  4AT1 B;  2M16 A;  2GCX A;  3OYK A;  4JLG A;  2QQ9 A;  5CIU A;  1NEG A;  2KEA A;  1ARK A;  4VUB A;  4XK8 E;  2HNI A;  2OI3 A;  5IHN A;  1KK7 A;  2E5Q A;  1X6G A;  2ZPE B;  1KD1 U;  3CQT A;  1ZLM A;  2JVV A;  2G3R A;  3R6N A;  3VJP A;  4C0Z A;  3FRN A;  4M75 B;  1CKB A;  2RI5 A;  3CCL T;  1YIT T;  1I5O B;  2F69 A;  4Y28 E;  3U23 A;  1M3B A;  1N6A A;  4OMN A;  2A36 A;  1YJ9 T;  4LNP A;  5LJ3 d;  2LX9 A;  2M9U A;  1UHF A;  4A54 A;  4R55 A;  2FPE A;  4L5G A;  4PLI A;  2LJ3 A;  5LJ5 e;  2L3P A;  1VQP T;  1K73 R;  4OB0 B;  2P84 A;  2VAS A;  2MWP A;  2DJZ A;  3G1J A;  1X43 A;  1PRM C;  2RJE A;  1ZSZ A;  4FIB A;  1I5L A;  5KYX B;  3CD6 Q;  4RTY A;  3VRY A;  2JMC A;  1R8O B;  2YLC A;  4M7D B;  5KYW A;  2JN0 A;  1PD1 A;  4F7U E;  4JJB A;  5GAN 2;  2FEI A;  2RK2 A;  1X01 A;  3V7S A;  3H0H A;  1RAG B;  4JRQ A;  1M2O A;  3CC4 Q;  1KD1 R;  1VQ5 A;  1M1F A;  1K8A C;  2YUN A;  2OAW A;  1ACM B;  5GAN 4;  3EGD A;  3CCR A;  1RAC B;  2XD0 A;  1GRI A;  2V8K A;  4JJN K;  5IAY A;  5LJ3 g;  3JCM J;  3CC2 T;  5DLO A;  3CCJ A;  3DKM A;  2MYS A;  3A8L B;  5GAM h;  2E70 A;  4K11 A;  2C0I A;  4Y91 A;  1ZX6 A;  3QDF A;  3SHW A;  1NYG A;  4LDW A;  3JV3 A;  4M7D G;  1VQN Q;  3L1A A;  2DXT A;  4ZTF A;  4IIM A;  1C6V X;  4OGC A;  1UFF A;  3M57 A;  4E7H A;  3CMA Q;  2X51 A;  1RLP C;  1UG1 A;  2XKO C;  3G4S Q;  3M54 A;  1CKA A;  4ZGE B;  3X28 B;  3LGF A;  1GFD A;  3PT9 A;  1ZQ1 A;  1VOM A;  2X4X A;  1OQK A;  2KE9 A;  1OZ2 A;  3OA6 A;  1YHQ Q;  1Q7Y C;  2PVD B;  4RTZ A;  1HJD A;  5LJ5 j;  2RHY A;  1YJW A;  2XMF A;  3MEA A;  2DYB A;  3OBW A;  4AG1 C;  3JSC A;  3CCU T;  3G71 A;  2ATC B;  4DBH A;  3CPW S;  2ED1 A;  2E6Z A;  1G2B A;  4LUD A;  4HVW A;  3L2U A;  4M78 E;  4KUI A;  1RAH B;  1WJS A;  2RQT A;  4EMH A;  3GPL A;  2L89 A;  2DYI A;  1WFW A;  2VKN A;  4FYV B;  4MML A;  1YCY A;  2YUQ A;  1XJW B;  3EGX A;  4MZP A;  4A4E A;  5A2Q E;  1J3T A;  1X6B A;  2DZ9 A;  4B9W A;  1VQ7 A;  2YUP A;  4IUT A;  1YI2 A;  4AFS C;  1Q82 U;  5DLQ E;  1ZUY A;  4M7A E;  1AZG B;  1WHG A;  4ORZ A;  4ZNX A;  2CDT A;  2RI3 A;  1SF9 A;  4OB1 B;  5GAN e;  1KJW A;  4J9F A;  3EH1 A;  4J9H A;  3MET A;  3QZ5 B;  2EBP A;  3V7R A;  4M7D F;  3M9Q A;  1ZA2 B;  3EFR A;  5FWB A;  3OYM A;  4JRP A;  3I5R A;  1QVF P;  5ECA A;  3DB3 A;  2HDA A;  4XTX A;  1TG0 A;  4BDZ A;  1X2K A;  4C5G A;  1ABO A;  4KRT A;  2K5L A;  2K2V A;  2QAS A;  4PFP A;  2RK1 A;  3M0U A;  3GP8 A;  3EFO B;  2KRO A;  1PHT A;  1TWB A;  1PKS A;  3CCR T;  2EJ9 A;  1WDX A;  2EQK A;  3JCM W;  4C8Q B;  4NL3 A;  4N0A C;  2LJ1 A;  2KQW A;  3I35 A;  4HCC A;  2QQR A;  1VQL A;  4CC3 A;  3QJ6 A;  2M1H A;  4ATO A;  1UEB A;  4OML A;  3CPW P;  1VQO Q;  1JRI A;  2PVG B;  1ZUU A;  3MKD A;  4E7K A;  1OX8 A;  3JCM d;  1N8R C;  2DXB A;  3CCV A;  1W2B A;  1HXD A;  2DRM A;  3I55 T;  3GOX A;  1Q82 R;  1T3S A;  3BFM A;  3AHU A;  2JM8 A;  4C92 C;  2KYM A;  1ZA1 B;  3ZEH A;  1O9S A;  2QQS A;  2E12 A;  4Z89 A;  1BI1 A;  1VQ5 Q;  3NPF A;  1VIE A;  4TVR A;  4C8Q G;  4Z02 A;  1KIK A;  2HD0 A;  4XQ3 A;  2MK5 A;  3OQ5 A;  1WA7 A;  1WYX A;  1YJW T;  2A28 A;  4C8Q D;  4F04 B;  3CCJ Q;  2KDS A;  2VV5 A;  3G71 T;  1Z9Q A;  2CP0 A;  4IUQ A;  5FW9 A;  4N0A A;  3JB9 J;  1MMG A;  1UJY A;  5GMK e;  1R0B G;  5D6X A;  2DK3 A;  4J5Y A;  2AK5 A;  2QA4 T;  4OVA A;  3OYJ A;  2RJF A;  1AD5 A;  3CCQ T;  2DM1 A;  1M3A A;  4M78 B;  4NS5 A;  3JCM g;  3X26 B;  3RKW A;  2OJ2 A;  1RAE B;  4PL6 A;  3QWY A;  1MV0 B;  5KE3 A;  1MMA A;  2HCK A;  5HKC A;  3I56 A;  4M75 C;  4C92 A;  5CO7 A;  3HKS A;  2VWF A;  4R56 A;  3DB4 A;  5IXF A;  3SFM A;  1RI9 A;  2DER A;  2KVQ G;  2O9V A;  4ZN3 A;  5I22 A;  1M2V B;  5GJV B;  1WPY A;  1X69 A;  2VXF A;  1SSH A;  3GNG A;  4IUR A;  2OTL Q;  1WXB A;  2L8D A;  1M8V A;  2DPP B;  1YJN A;  4N4I A;  2DZC A;  1FWZ A;  2P0K A;  5I2S A;  4J7F A;  1JQQ A;  1I0C A;  1WZO A;  4N4H A;  3CC7 A;  2V8J A;  3ME9 A;  1AEY A;  7AT1 B;  3UAT A;  2CS7 A;  5I11 A;  5I2M A;  3PGG A;  4M7D C;  4BAC A;  2KNB B;  4B6M A;  2XDD A;  4FCY A;  2DBK A;  3BW1 A;  2RHU A;  1QVP A;  2EGA A;  4C8Q F;  4QKU A;  1FMV A;  1VUB A;  2FL7 A;  4C0G A;  1VQ7 Q;  1VQL T;  1YI2 Q;  2DE0 X;  3EFS A;  3H8Z A;  5CKB A;  4YTL A;  3ZL7 C;  5GMK j;  2NUZ A;  2I0N A;  3E9F A;  3CME A;  4LDU A;  1NYF A;  3HPW A;  1UUE A;  3EG2 A;  3CCV T;  3PMI A;  1Y07 A;  5LJ3 j;  3REA B;  2PQW A;  2RQV A;  2CP5 A;  3O8V A;  1AHJ B;  4OMP A;  3REB B;  2VB6 A;  2XG8 D;  1OZ3 A;  3CCM T;  3TU4 K;  4DEY A;  2DNU A;  2O31 A;  4J9C A;  2VUB A;  1W4S A;  2MOX A;  1KQ1 A;  2DL3 A;  3PNW C;  1NE8 A;  1NZ9 A;  4M7D A;  3M53 A;  4LDX A;  4E7Z A;  4LD6 A;  4LD9 K;  3CD6 A;  3OMC A;  2M0Y A;  2X4W A;  1C0M A;  2KMT A;  3FJP A;  1VIF A;  4ZTJ A;  3E9G A;  1LOJ A;  3HP9 A;  4PKC C;  3QII A;  5LJ5 h;  4L6V 5;  1QVG A;  4NL2 A;  3J81 E;  4EPC A;  1HSQ A;  3QXE B;  4OGE A;  1PSF A;  5FU6 B;  4V2S A;  3OY9 A;  2BKD N;  2GFA A;  2RNA A;  1T0J A;  3CCE Q;  2HQH A;  2DIL A;  3A8G B;  1B34 B;  2ZZD A;  1CSK A;  2EWN A;  3RMQ A;  3A8H B;  1SKU B;  2OTJ Q;  4M77 E;  3VU3 C;  3BDL A;  3M0R A;  5HK3 A;  2WSF E;  4KGZ B;  1G8X A;  4LN2 A;  2JT4 A;  1WNL A;  3M59 A;  3OYL A;  3CXC A;  1WHM A;  4P5N A;  1K9M U;  1H3Z A;  5KYY B;  4E6R A;  5IT9 E;  3CC7 T;  3GLX A;  3E19 A;  3GBQ A;  5D7U A;  1EIF A;  1UGR B;  1BI0 A;  2AT1 B;  2BZY A;  3FEO A;  3M55 A;  3RKX A;  3AT1 B;  2CP7 A;  5LL6 S;  2EQJ A;  3HTR A;  2PNI A;  4LE9 A;  3I56 Q;  5I21 A;  2LMJ A;  4BY6 B;  3H0I A;  2R58 A;  3TQ7 P;  3TSW A;  3JCM e;  3JB9 H;  4O5V A;  1M8M A;  3TVT A;  3OSS C;  1Y0M A;  2X3W D;  2RF0 A;  2EPD A;  1WIE A;  1QW1 A;  1D0Z A;  2DMO A;  4C8Q C;  4RTW A;  3MEW A;  1W70 A;  3FLG A;  1YJN Q;  1PD0 A;  1WXT A;  2J6F A;  2O88 A;  5C6S A;  3NMZ C;  3PIO A;  2LQN A;  2GFU A;  3LW5 E;  6AT1 B;  2PVO B;  2DKG A;  5FU7 B;  1TUD A;  3HRS A;  3ZFJ A;  4KUD K;  2RI2 A;  3CEY A;  4IKF A;  2GTO A;  1PSE A;  3QYH B;  3M0T A;  4BDY A;  2EFI A;  2W0Z A;  1OI1 A;  5IN1 A;  1K76 A;  3PVL A;  2GGR A;  2MAM A;  1K9M R;  2LNH B;  3G6E Q;  1X2Q A;  2HEQ A;  2VGN A;  2WAC A;  3UWN A;  1RAI B;  2JS0 A;  1WI7 A;  2K2M A;  2NUT B;  1Q86 C;  2KRS A;  3CD6 T;  2FRW A;  4C92 G;  1TU0 B;  4E7S A;  1KQ2 A;  3EHQ A;  2RQR A;  1Z9Z A;  4A53 A;  2B8A A;  2YDL A;  1R0C B;  3EFO A;  4C92 D;  1IGU A;  2LJ0 A;  3CME Q;  5GAM d;  1M27 C;  1QKX A;  2K79 A;  5IH2 A;  2FG0 A;  1QP3 A;  1HYO A;  4HKE A;  4C8Q A;  1U8R A;  1K4U S;  3CBO A;  3CC4 T;  1QWF A;  2A0F B;  2LQ8 A;  2CUB A;  5GAN h;  1VQ4 Q;  2ZPG B;  3CBP A;  4ELY C;  3NTI A;  2FZC B;  1QVG S;  2LP5 A;  3QUI A;  2F2W A;  1NG2 A;  2K57 A;  2GQI A;  4GLK A;  4M78 C;  1MND A;  4F14 A;  4FL6 A;  1VQ9 A;  2RM4 A;  1Q81 C;  4PJL A;  4L59 A;  4HCZ A;  1VQO A;  1VQM A;  2CKK A;  1GFC A;  4DEX A;  4JLI A;  1VQN T;  4M77 B;  4FYW B;  4PFO A;  1BU1 A;  2KXC A;  1IRE B;  1E6H A;  2LX7 A;  2VGM A;  2JXB A;  4M75 G;  2GBQ A;  2DTO A;  4PLL A;  3ER0 A;  3OBY A;  3CMA T;  2DD5 A;  2RJD A;  2CP2 A;  5DY9 A;  3G4S T;  3CXC S;  2K4Y A;  2AIR B;  4OB2 B;  1KQS P;  4M75 D;  2LT4 A;  1LVK A;  4QVD A;  4PJO B;  2QK0 A;  5IXB A;  1GL5 A;  1YHQ T;  1KHC A;  4FU6 A;  2CZ1 B;  3EG9 B;  3OW2 A;  4C0F A;  4PFZ A;  3TRE A;  4A4H A;  2ZAE A;  2X9H A;  1MMD A;  1WHK A;  4M77 G;  5CKE A;  4XU3 A;  1LPL A;  2E64 A;  4C92 F;  3D7S B;  3RR6 A;  2KRN A;  3MCA B;  2DET A;  5CAI A;  3VS5 A;  3O5Z A;  4PJN A;  1S72 A;  4KH0 B;  2LCS A;  1MHN A;  2KBT A;  3H6Z A;  4ESR A;  5J3B A;  4M7D D;  2RMO A;  3J80 E;  2I2L A;  1X75 C;  2D6F A;  1M2V A;  1OPL A;  4PJO G;  3JCM P;  5GMK h;  1I1J A;  3H0F A;  1U1T A;  4DOW A;  2XHC A;  3RIR A;  1U3O A;  4PJO D;  1ZUK A;  1KG1 A;  3SDZ A;  1G83 A;  3URG A;  2JUF A;  4A4K A;  3QKJ A;  2JW4 A;  4OMM A;  2OTL A;  4EIK A;  5KYU B;  4X34 A;  2J7I A;  4AFU C;  2LT1 A;  1QWE A;  2NYS A;  2LRQ A;  3RES A;  1K1Z A;  4AG2 C;  3L2Z A;  1BB9 A;  2KK4 A;  4M75 F;  3PE0 A;  4JPB W;  1ZSG A;  5C0M A;  5KH6 A;  3V8L A;  2EW3 A; 
#chains in the Genus database with same CATH homology
 1P92 A;  4M75 E;  4OMF B;  4M78 B;  4NS5 A;  3JCM g;  3X26 B;  1UGS B;  3JB9 I;  3OYG A;  3RKW A;  5FRO A;  1VQ8 A;  4PL6 A;  1YIT A;  1I8F A;  5CKF A;  3CC4 A;  2RH2 A;  2VYT A;  5KE3 A;  2DAQ A;  3VV0 A;  3M4Y A;  5HKC A;  1K73 C;  2AHJ B;  1M1G A;  3I56 A;  4UC4 A;  2F5K A;  4M75 C;  3OB9 A;  2Y90 A;  2YRV A;  4ME7 A;  4XTZ A;  5CO7 A;  5FU6 C;  4C92 A;  1WJR A;  3HKS A;  3X20 B;  4R56 A;  3DB4 A;  4DA4 A;  1YIJ T;  3PMT A;  3SFM A;  2KVQ G;  3L2W A;  1VQO T;  4OF1 A;  3P8D A;  5CQY A;  3WXM B;  4ZN3 A;  1WPY A;  1O75 A;  1M1K C;  2VXF A;  4XAX B;  2RJC A;  3CBM A;  3GNG A;  2XIC A;  4IUR A;  2F5T X;  2ZPB B;  4J6X A;  3JCM c;  4QVZ A;  3OYF A;  1D3B B;  2L8D A;  4M7A C;  4BE2 A;  1M8V A;  2Y4Y A;  2H3J A;  2RA2 A;  4HA8 A;  2P4T A;  2DPP B;  5LJ5 f;  4FSX A;  1YJN A;  3M58 A;  3R6O A;  2DD4 A;  5GAN 6;  4N4I A;  2GQV A;  3WVE B;  3LH0 A;  1N8R U;  1VQK T;  1VQN A;  3PTA A;  2PU9 B;  3A5Z B;  2DZC A;  1KD1 C;  1G5V A;  4F7U B;  1FWZ A;  5GAM g;  3QG1 A;  2P0K A;  5L8R E;  3OYD A;  2QTX A;  4M7D E;  5I2S A;  4J7F A;  4IUP A;  3VKI A;  2ZPI B;  4N4H A;  2V8J A;  2HQE A;  2ZPF B;  4DQ2 A;  3CC7 A;  5GAN f;  1VQ5 T;  2LTO A;  3ME9 A;  4E7J A;  3RMS A;  5CK9 A;  3QJY A;  4PJO F;  2MI6 A;  3CMA A;  2CS7 A;  2ZCF B;  1NJI U;  3G4S A;  2EQM A;  5I2M A;  3PGG A;  1G3T A;  3NFC A;  4A4F A;  5CKD A;  4M7D C;  3G7Z A;  5GAO r;  4BAC A;  2XDD A;  1Q7Y U;  3HFO A;  3UDC A;  3FB9 A;  4XTY A;  4PJO E;  4JRI A;  3SWN B;  3BW1 A;  2RHU A;  3OYY A;  1QVP A;  4N4G A;  3PIP A;  3JCM Q;  2Y4X A;  4FT2 A;  5CCA A;  1YHQ A;  4M78 A;  1BI2 A;  4BB7 A;  4C8Q F;  3CCJ T;  3OYB A;  4XU2 A;  1UGP B;  4E7I A;  2XID A;  4RCC A;  1VUB A;  2FL7 A;  3X24 B;  4C0G A;  2EAY A;  5D6Y A;  2DXU A;  1VQL T;  4C8Q E;  3EFS A;  4BY6 C;  4M77 D;  3UPU A;  2L3R A;  1MGQ A;  2RB6 A;  3H8Z A;  4LDV A;  4DOV A;  5CKB A;  3JCM f;  4C0D C;  5A0D A;  4YTL A;  3MO8 A;  1G3Y A;  4BD3 A;  2E10 A;  5GMK j;  2KY9 A;  3E9F A;  3CME A;  1YBY A;  2DO3 A;  3QDR B;  2L5Q A;  4LDU A;  5CQX A;  4F7U G;  4C92 B;  5A0L A;  3HPW A;  4HT9 A;  3JCM b;  3CCV T;  2EYQ A;  1B34 A;  2HQX A;  3PMI A;  3QO3 A;  1WQW A;  1XTD A;  4JS4 A;  1K9M C;  1Y07 A;  2RHI A;  3M5A A;  5LJ3 j;  1G3S A;  2PQW A;  3O8V A;  2YHT A;  4BI4 A;  5FRN A;  3OS1 A;  1AHJ B;  4M7A A;  3EAE A;  1JJ2 S;  1D3B A;  2ZPH B;  4BI8 B;  1XQH A;  2VXE A;  5CVI A;  3S3M A;  3C12 A;  1TH7 A;  3CCE A;  3LWI A;  3I55 A;  2XG8 D;  3FIF A;  1KC8 C;  1N9R A;  3P8H A;  2DIG A;  5LJ3 h;  1OZ3 A;  4GY5 A;  3FC3 A;  1K73 U;  2C06 A;  1OYX A;  3CCM T;  3TU4 K;  2QDY B;  5FU7 C;  5GAO m;  4NOY A;  2VUB A;  1W4S A;  2X4J A;  4LDY A;  1KQ1 A;  3PNW C;  1KQS S;  3OYA A;  1QVF S;  1NE8 A;  2KAF A;  1M90 C;  2OTJ A;  1N27 A;  1NZ9 A;  2A7Y A;  4MZM A;  5GAO q;  2R57 A;  1G3W A;  2DTH A;  3RUX A;  2CYZ B;  2IVW A;  3M4G A;  4M7D A;  3LWH A;  2M16 A;  3JCM X;  4RMO A;  2GCX A;  4O6J A;  3M53 A;  3OYK A;  4JLG A;  5GAM f;  3S3O A;  2QQ9 A;  4LDX A;  1M5Q 1;  5CIU A;  1QP2 A;  2XDP A;  5HK0 A;  4LD6 A;  1M1K U;  1LNX A;  2BIV A;  4LD9 K;  3OYC A;  4E7L A;  3CD6 A;  4VUB A;  3OMC A;  4XK8 E;  3P8B B;  2HNI A;  2X4W A;  3SD4 A;  2KMT A;  3VYG A;  3LLR A;  3FJP A;  2E5Q A;  1VIF A;  2ZPE B;  1KD1 U;  2LDM A;  2QEX T;  4ZTJ A;  2EJG A;  3E9G A;  3HL8 A;  4FM4 B;  1LOJ A;  5LJ3 e;  2JVV A;  5J26 A;  3VUZ A;  3HP9 A;  1JBM A;  4PKC C;  1VQ6 A;  2G3R A;  3QII A;  5LJ5 h;  5EG2 A;  1WJQ A;  4L6V 5;  3VJP A;  1QVG A;  1WGS A;  4NL2 A;  3V7C A;  3J81 E;  4C0Z A;  4EPC A;  1HK9 A;  1UB4 A;  3FRN A;  2E1H A;  3WVD B;  4EMG A;  3QXE B;  2QA4 A;  4M75 B;  4OGE A;  1VQ8 T;  2RI5 A;  1PSF A;  5FU6 B;  2JZ2 A;  2NLU A;  4Q5W A;  3CCL T;  1YIT T;  4V2S A;  3OY9 A;  3CCQ A;  2BKD N;  1VQ9 T;  2F69 A;  2DXC A;  4Y28 E;  4XTW A;  2DIQ A;  1DJ7 B;  4CRI A;  1BYM A;  1N6A A;  3MEV A;  2GFA A;  1VQ7 T;  1I81 A;  3C95 A;  1YI2 T;  3VYH B;  1YJ9 T;  2LVM A;  2LCC A;  5LJ3 d;  3A8G B;  2LX9 A;  1VQM T;  1B34 B;  4QQG A;  3OYI A;  2ZZD A;  2DEQ A;  2M9U A;  3GNF B;  3FDR A;  3N5B B;  4M77 F;  4A54 A;  2EWN A;  4M7A B;  4R55 A;  3F70 A;  3RMQ A;  4L5G A;  3A8H B;  3RER A;  4PLI A;  3MHX A;  3JCM V;  2QXF A;  5LJ5 e;  4M77 E;  2XK0 A;  2HAX A;  3VU3 C;  1YIJ A;  1VQP T;  3BDL A;  4OB0 B;  4ZGD B;  2WSF E;  5HK3 A;  1SSF A;  4J8O A;  3CCS A;  2MWP A;  2DJZ A;  1WNL A;  2RJE A;  3M59 A;  4FIB A;  3OYL A;  1I5L A;  3V8J A;  2EQU A;  3CXC A;  4M78 G;  4EDU A;  4P5N A;  4F7U F;  2MF2 A;  4M77 C;  1K9M U;  3TEE A;  2YLC A;  1R8O B;  2K3X A;  3JB9 G;  4M7D B;  2HBP A;  1H3Z A;  5IT9 E;  3CC7 T;  3GLX A;  2WSE E;  3E19 A;  1VQK A;  1EIF A;  1UGR B;  2JN0 A;  2WSC E;  3HRU A;  4M78 D;  4F7U E;  5GAN 2;  4XTV A;  1BI0 A;  2QI2 A;  3M55 A;  3FEO A;  2RK2 A;  3RKX A;  3KUF A;  5LJ5 d;  3OYN A;  1KC8 U;  1X01 A;  3V7S A;  5LL6 S;  4JRQ A;  2EQJ A;  3G6E A;  4J83 A;  4EMK C;  3DLM A;  1NPR A;  1VQ5 A;  1M1F A;  2CZ0 B;  3M56 A;  1K8A C;  2E6N A;  3OW2 S;  2R5M A;  2E41 A;  4C5I A;  1M90 U;  2LC4 A;  5GAN 4;  5I21 A;  4BY6 B;  3OMG A;  4CI0 C;  2EIF A;  3MP8 A;  3HSB A;  4M75 A;  4M7A G;  4PJO C;  1RL2 A;  2O01 E;  4C0D B;  3CCR A;  2XD0 A;  1M4Z A;  2R58 A;  2V8K A;  4JJN K;  1N9S A;  5IAY A;  4RG8 A;  3JCM e;  3JB9 H;  4O5V A;  5LJ3 g;  2LCL A;  3RKY A;  3VUB A;  3OSS C;  3JCM J;  1H64 1;  3CC2 T;  1Q82 C;  3GIB A;  4M7A D;  1S72 T;  5DLO A;  3CCJ A;  3DKM A;  2K5I A;  1QW1 A;  3GF5 A;  3A8L B;  4C8Q C;  5GAM h;  2E70 A;  4JS5 A;  2ZGW A;  3MEW A;  3ASK A;  2DTI A;  4Y91 A;  3QZ9 B;  3FLG A;  4J6W A;  4LDW A;  2XI9 A;  4M7D G;  2XU8 A;  4MDW A;  3OYH A;  2XDB A;  5C6S A;  2K5F A;  3L1A A;  3PIO A;  3L2R A;  4BE1 A;  1VQ4 A;  2FVU A;  2DXT A;  2GFU A;  3HHT B;  3KBG A;  3LW5 E;  3NTK A;  5AYF A;  2PVO B;  1W2B S;  2D9T A;  2E65 A;  3S3N A;  4ZTF A;  2DKG A;  1KHI A;  5FU7 B;  3HRS A;  3ZFJ A;  4OGC A;  3L42 A;  4M77 A;  3M57 A;  4IUU A;  2LQK A;  4KUD K;  2RI2 A;  4E7H A;  3CEY A;  4IKF A;  1PSE A;  3QYH B;  5GMK i;  2XKO C;  4BDY A;  2EFI A;  1OI1 A;  3M54 A;  5IN1 A;  5GAO l;  2PUK B;  2OTL T;  5GAO p;  4ZGE B;  2PUO B;  3X28 B;  2MAM A;  3LGF A;  3PT9 A;  3MP1 A;  1ZQ1 A;  3QPH A;  1GXI E;  2X4X A;  3LX7 A;  2A3L A;  5GAM e;  4JRK A;  1OZ2 A;  2P0P A;  3CCM A;  3OA6 A;  4XTU A;  2VGN A;  2WAC A;  3UWN A;  5CR2 A;  3DLL A;  4EMK A;  2PVD B;  1Q7Y C;  4IUV A;  5GMK m;  1M9S A;  2K3Y A;  4ZGJ B;  5LJ5 j;  1Q86 C;  3ZBD A;  3CD6 T;  2RHY A;  5J39 A;  5GAN 7;  4C92 G;  1YJW A;  4PJO A;  4C5E A;  3MEA A;  3OBW A;  4JUV A;  4KBM B;  5GAN 8;  1KQ2 A;  5GMK l;  4A53 A;  5KCH A;  5GAN 3;  3JSC A;  3CCU T;  2B8A A;  3G71 A;  4HT8 A;  3QYG B;  3OS0 A;  2JNG A;  1Y7X A;  2X4Y A;  4MMK A;  4C92 D;  4QVC A;  3CPW S;  5GAN j;  4M78 F;  1VQ6 T;  5GAM d;  2E6Z A;  1U8R A;  1Y96 A;  1QP3 A;  4HKE A;  2RD1 A;  4C8Q A;  3CBO A;  3CC4 T;  5GAN 5;  2LQ8 A;  3L2U A;  1BKB A;  4M78 E;  4MDX A;  4KUI A;  5CKH A;  5GAN h;  3C94 A;  1WJS A;  3V8K A;  3I56 T;  2ZPG B;  3CBP A;  4FT4 A;  4QW2 A;  4EMH A;  4ELY C;  3NTI A;  2L89 A;  3GPL A;  5LJ3 f;  1QVG S;  3QUI A;  4MML A;  4RKU E;  1K8A U;  3BDU A;  2K57 A;  1JB0 E;  1YCY A;  3CPF A;  4GLK A;  4M78 C;  3OS5 A;  3CCL A;  3HFN A;  4FL6 A;  1VQ9 A;  4MZP A;  3QBY A;  5KCO A;  4B9X A;  2VC8 A;  3HRT A;  4A4E A;  5A2Q E;  2RM4 A;  2DZ9 A;  2O4X A;  1Q81 C;  4M7A F;  3S6W A;  3E1S A;  1BI3 A;  4B9W A;  1VQ7 A;  1X6O A;  1BIA A;  4L59 A;  4IUT A;  1YI2 A;  4X9C A;  4HCZ A;  4OB3 B;  1VQO A;  1YJ9 A;  1Q82 U;  1FXX A;  1V29 B;  2CKK A;  2RHZ A;  5DLQ E;  1YJN T;  2YLB A;  4JLI A;  1VQM A;  4M7A E;  4J7I A;  3MP6 A;  3A8O B;  4QQD A;  5GAO n;  1VQN T;  4M77 B;  3CCS T;  2RI3 A;  4BI3 A;  1IRE B;  3JCM h;  4C5H A;  2CZ6 B;  3LGL A;  2JTF A;  4OB1 B;  2VGM A;  4ELZ C;  5GAN e;  3A8M B;  3OSV A;  4JDS A;  1WQ7 A;  3TCJ A;  4M75 G;  1VQP A;  3MET A;  2DTO A;  4MZT A;  3QZ5 B;  4PLL A;  4RCB A;  3V7R A;  3UT1 A;  4M7D F;  3ER0 A;  3OBY A;  3M9Q A;  3CMA T;  1ZBX A;  2DD5 A;  2RJD A;  5DY9 A;  3G4S T;  4EMK B;  3CXC S;  3L2Q A;  4KUL A;  3JB9 D;  3EFR A;  2K4Y A;  4OB2 B;  3OYM A;  4M75 D;  2DVE A;  4JRP A;  2D0Q B;  1XOV A;  2LT4 A;  2CZ7 B;  3DB3 A;  4QVD A;  3G6E T;  4PJO B;  4XTX A;  5DM7 R;  2R5A A;  1YHQ T;  2LNV A;  4BDZ A;  1KHC A;  4FU6 A;  1Y71 A;  2CZ1 B;  4C5G A;  1IZ6 A;  3OW2 A;  4HCB A;  2K5L A;  4C0F A;  5GAN d;  2K2V A;  5GAM j;  2RK1 A;  3GP8 A;  3OYE A;  3TRE A;  2QQA A;  3PFS A;  4A4H A;  1BIB A;  3CCR T;  3L2V A;  2EJ9 A;  2EQK A;  1Y96 B;  4OP0 A;  3JCM W;  4C8Q B;  4NL3 A;  4PNO A;  4J6Y A;  1Q86 U;  4N0A C;  2RHX A;  4M77 G;  2KQW A;  5CKE A;  3SWN C;  4HCC A;  2QQR A;  4XU3 A;  1VQL A;  3QJ6 A;  3CME T;  2E64 A;  4C92 F;  4II1 A;  4RG2 A;  5FRM A;  2M1H A;  2OAU A;  4ATO A;  1UEB A;  4QQ6 A;  3MCA B;  3QSU A;  3LYI A;  3C4S A;  5CAI A;  4WF2 A;  3CC2 A;  2EJF A;  1JRI A;  5A0G A;  4C92 E;  1S72 A;  2PVG B;  1JJ2 A;  2JOY A;  4E7K A;  2RO0 A;  4A4G A;  1MHN A;  1XNI A;  2MMP A;  2MWO A;  1UGQ B;  3H6Z A;  3JCM d;  1VQ4 T;  1N8R C;  2DXB A;  3CCV A;  1W2B A;  4XU1 A;  5J3B A;  4E47 A;  4M7D D;  2O4X B;  1HXD A;  3X25 B;  3CCE T;  3J80 E;  2I2L A;  3I55 T;  2FB7 A;  3GOX A;  2CGH A;  2IG0 A;  3JAM E;  3BFM A;  2BUD A;  2QQB A;  1X75 C;  2D6F A;  3AHU A;  2X35 A;  4PJO G;  4C92 C;  3ZEH A;  1O9S A;  3JCM P;  3OS2 A;  1QVF A;  1KQS A;  2QQS A;  4KT0 E;  4ZN1 A;  5GMK h;  5LJ5 g;  5D6W A;  3KXT A;  2OTJ T;  1NJI C;  2KSS A;  4D6W A;  1U1T A;  2E12 A;  2EKO A;  3BY7 A;  4DOW A;  2XHC A;  3RIR A;  1BI1 A;  3T9N A;  3SB2 A;  4PJO D;  4XU0 A;  1VIE A;  1KG1 A;  4X9D A;  4TVR A;  1Q81 U;  4C8Q G;  3SDZ A;  2FYK A;  4F7U A;  3INZ A;  2JUF A;  4Z02 A;  3URG A;  1NPP A;  2P0Q A;  3MEU A;  2HD0 A;  4XQ3 A;  3QKJ A;  4A4K A;  1RI0 A;  5GAN g;  3Q1J A;  2OTL A;  4X34 A;  1FX7 A;  3OQ5 A;  2LT1 A;  3NTH A;  3J7A F;  1YJW T;  4C8Q D;  2LRQ A;  3RES A;  5HY6 A;  4BE0 A;  2KDS A;  2M0O A;  2VV5 A;  3G71 T;  3L2Z A;  4IUQ A;  5M9O A;  1U1S A;  4N0A A;  5KE2 A;  1LJO A;  3JB9 J;  2GF7 A;  3CPW A;  3SWN A;  5GMK e;  5D6X A;  3JB9 F;  2DK3 A;  2QEX A;  1I4K 1;  2JTM A;  4J5Y A;  2KK4 A;  4M75 F;  2QA4 T;  4OVA A;  4BUG A;  3CCU A;  3OYJ A;  5C0M A;  2RJF A;  3QHS A;  2V8I A;  5FLX E;  3CCQ T;  5KH6 A;  1ZHI A;  2FHD A;  3V8L A;  3JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...