1WLPB

Solution structure of the p22phox-p47phox complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
138
structure length
138
Chain Sequence
GSDITGPIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytochrome b-245 light chain
publication title NMR solution structure of the tandem Src homology 3 domains of p47phox complexed with a p22phox-derived proline-rich peptide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/signaling protein
total genus 14
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wlpB01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wlpB02
1UECA 4RTUA 2M0YA 4GBQA 3EG3A 1QWFA 1SPKA 1KJWA 1Y57A 2L0AA 1ZUYA 1OEBA 1G2BA 2DBMA 4CC3A 2DILA 2O88A 1NYGA 2KRMA 3EHQA 3TVTA 2KXCA 1X6BA 2DNUA 1NM7A 2LNHB 2RQWA 1QCFA 1PRMC 4RTWA 1YNZA 1ABQA 2AZSA 2LMJA 1OPLA 5IHNA 4CC7A 2RN8A 3C0CA 4AG2C 2LQWA 2K9GA 2W0ZA 2J7IA 2DL8A 3EGUA 1TUCA 2KR3A 1U3OA 1QLYA 1JQQA 1G83A 4J9IA 2A08A 2F2WA 2H8HA 2EYXA 1GCPA 2CSIA 1SSHA 2CH4W 2QDLA 2L3SA 2VWFA 1BU1A 1JXOA 2EW3A 2DYBA 2VKNA 2LJ1A 4HCKA 3LH5A 1B3QA 5EC7A 2O2OA 2JW4A 2YUNA 2DE0X 3IQLA 2EPDA 2LP5A 1T3LA 4OMQA 4AFZC 1W6XA 4R0KA 1K76A 1YWOA 3I5SA 1JU5C 1GFDA 3VS5A 2YUOA 3RNJA 4M4ZA 3UA7A 2BZYA 2HCKA 1IO6A 1UG1A 2DX1A 1X27A 2IIMA 2KROA 1ZSGA 2GTOA 2C0TA 2NUZA 3EHRA 1RI9A 2ED0A 2DMOA 1PRLC 1MV0B 1PNJA 4GLMA 2DLPA 3VS3A 1Z9ZA 2ROTA 1LCKA 1ABOA 1ZLMA 1M30A 2KEAA 1W1FA 1QKXA 2RNAA 2SEMA 4Z89A 2OJ2A 5IH2A 2AK5A 1OV3A 1QKWA 4JJDA 2HBWA 1EFNA 4LUEA 2BZ8A 2K2MA 2DF6A 2D8JA 1AWOA 2JMCA 2KYBA 3QWYA 1X2QA 1Y0MA 2L3QA 2EYYA 1KSWA 5ECAA 5IXBA 2FPEA 2PZ1A 3TSWA 3RBBB 4LE9A 1QWEA 2KE9A 1T0JA 4RTYA 1NEBA 1X2KA 2DM1A 4ZNXA 2EGAA 4A63B 2JT4A 1NEGA 1TUDA 2VVKA 1NYFA 5I22A 5FWCA 3CQTA 2A37A 4F14A 2O9SA 4HVWA 2CT3A 1XOVA 1SHGA 1UE9A 4KRTA 1PHTA 1X43A 1ARKA 2EYWA 1UHFA 1WYXA 2OI3A 3M0RA 1NLPC 4CC2A 3VS1A 4D8DA 3EG1A 3I9QA 2GGRA 2EVRA 4ORZA 3UF4A 2DA9A 4K11A 2F2XA 1V1CA 2X3XD 1VA7A 3H0IA 5FW9A 1UJYA 4OMPA 1GL5A 1E6GA 2YUPA 2BZXA 3SHWA 2D1XA 2JS2A 2AKLA 1HJDA 1WXUA 2GTJA 4AG1C 4OMMA 1ZUKA 2DJQA 4AFSC 2CUDA 3ZL7C 3UATA 4JJBA 2DL7A 3M0PA 5HCKA 2C0IA 3PE0A 2KBTA 4OMOA 4JPBW 3O5ZA 1M8MA 1T0HA 4IIMA 2DRMA 5GJWB 2O9VA 3M0TA 1SEMA 2B86A 3U23A 1RUWA 5IHIA 1H8KA 2DL4A 5L23A 2D0NA 2GBQA 2FRWA 4D8KA 4J9HA 3KFVA 2HDAA 1RLPC 3PVLA 1GCQA 2A36A 1AEYA 2YDLA 1B07A 2EGCA 3JV3A 4RTZA 4LNPA 3M0SA 1YCSB 2RQUA 1AZGB 4Z88A 1I1JA 1WI7A 2AZVA 2KT8A 2MCNA 4J9FA 1M27C 3M0UA 2J6KA 2KGTA 3TSZA 2L2PA 2MIOA 2DRKA 4EIKA 2FG0A 3VS0A 3I35A 1UFFA 2F2VA 4X1VA 1U5SA 1M3CA 1UGVA 2P4RA 1UUEA 2DBKA 1AOJA 3H0FA 1VYVA 2ECZA 2LX7A 2HEQA 1PKTA 4HVUA 1WLPB 2CT4A 1JO8A 1ZX6A 4HXJA 3EG0A 1PWTA 1S1NA 2KXDA 4RTTA 5FWBA 2ROLA 2FRYA 1FYNA 2KNBB 2J06A 4JZ3A 2ESWA 4FSSA 2M51A 2DL5A 2YT6A 4J9DA 3GBQA 1WIEA 2LCSA 1WDXA 2V1QA 3A98A 2PTKA 2ED1A 1GFCA 3H41A 3VS4A 4AFUC 2RQVA 2A28A 2EYZA 2J6FA 3VRZA 2EQIA 3VS7A 2FPFA 2ENMA 1JXMA 1W70A 2E5KA 1GBQA 2RMOA 1UJ0A 1ZBJA 1CKAA 2CH4A 5I11A 5IHKA 2KRNA 4J9GA 3UA6A 4J9EA 1H92A 1WXBA 1TG0A 4RTXA 1I0CA 3EG2A 2LQNA 1WFWA 2HSPA 2OAWA 3NHNA 1WX6A 2GNCA 1K0XA 1X6GA 1PKSA 5IXFA 2PNIA 1AWJA 1Z9QA 1K4US 2L3PA 2XMFA 2CUBA 4Y92A 1JEGA 4HVVA 2LJ3A 2EGEA 3NGPA 2I0NA 4LN2A 4Z8AA 3M0QA 4WCIA 4RUGA 3VS2A 2K6DA 2KRSA 1T3SA 1I07A 1K1ZA 1AD5A 2JM8A 3NMZC 2YSQA 2KT1A 2SRCA 3QWXX 3THKA 3PVQA 1VYUA 3REBB 1VYTA 4F16A 2K3BA 4F17A 1AWXA 2V1RA 1MV3A 2CDTA 5GJVB 1HD3A 1NLOC 1UHCA 1OPKA 4IIOA 1SRMA 2GQIA 2AKKA 1N5ZA 1RLQC 1BK2A 4DEXA 1YWPA 2JM9A 4CC4B 1M3BA 1GRIA 2RPNA 1HSQA 2NWMA 3FJ5A 2JMAA 2JS0A 1OOTA 2D8HA 1FMKA 1AVZC 4QT7A 4J9CA 2LJ0A 2KYMA 2FPDA 2K79A 1YN8A 3SEMA 1KIKA 1SHFA 3NPFA 2CSQA 4DEYA 1CKBA 1AZEA 1X69A 3REAB 2FEIA 1GBRA 1A0NB 4E6RA 4LUDA 2O31A 3I5RA 4J9BA 3R6NA 2RQTA 2LZ6B 1MUZA 2EKHA 2CREA 1AWWA 2JXBA 1GCQC 1NG2A 4AFQC 2RQRA 3H0HA 4JZ4A 1E7OA 1ZUUA 1BB9A 2RF0A 2J05A 2J6OA 1KFZA 1UDLA 3VS6A 1J3TA 1BBZA 2JTEA 2DVJA 4OMLA 4OMNA 1UTIA 3VRYA 2YUQA 1SRLA 2K7AA 1U06A 2X3WD 4RTVA 1CSKA 2W10A 1WA7A 1YP5A 1H3HA 1E6HA 2ABLA 2G6FX 2MOXA 4JJCA 3ULRB 2BTTA 2C0OA 4ESRA 2EBPA 1K0SA 1K9AA 1M3AA 2DL3A 1WXTA 2FO0A
chains in the Genus database with same CATH superfamily
3JB9I 2M0YA 3V7CA 3EG3A 1QWFA 1SPKA 1IGQA 4KGZB 1Y57A 3L2UA 3JCMP 2G3RA 1ZUYA 2L0AA 2XD0A 2OTJT 3CCVQ 1M90U 4FM4B 3PMIA 1I8FA 4DA4A 2HL3A 2R58A 5CR2A 3CMAT 1QMCA 3EGXA 1LVKA 3JCMd 3CCSA 2KRMA 4BUGA 3QO3A 2DNUA 3G6ET 2AIRB 2LNHB 5D7UA 1PRMC 1QP2A 5GMKh 1YITT 1OPLA 5IHNA 4C8QG 2BE9B 1RAIB 5J39A 3SWNA 4P5NA 1R0CB 1W4SA 4FYWB 2E3IA 2CZ0B 2EQKA 2W0ZA 2J7IA 3QDRB 2O01E 4RG8A 2RHZA 3GLXA 5GAOl 1PCXA 2MAMA 4HT8A 1QLYA 2JOYA 3HTRA 4PLLA 2F2WA 2H8HA 2EIFA 1GCPA 1WHKA 1SSHA 2JN0A 2QAZA 1VQ9A 1RAAB 4J6WA 1UGPB 2VWFA 1VQ6A 1YJWT 3CCLQ 2LJ1A 1SF9A 2Z0WA 4M7AG 1VQKT 3OMGA 3LH5A 1B3QA 1VQPA 1Q82U 3A8HB 4KT0E 3J7AF 1W6XA 3ER0A 1JB0E 3PIOA 4M78C 2BZYA 1IO6A 1UG1A 3JSCA 1ZSGA 2GTOA 1B34B 2ED0A 2DMOA 1PRLC 1MV0B 1PNJA 4N4HA 1Z9ZA 2ROTA 3ZFJA 1WHMA 1ZLMA 3J80E 2SEMA 2RNAA 2YWWA 4Z89A 2AHJB 1WNLA 1QKWA 4JJDA 1WZOA 2E4HA 2COYA 2RK2A 1M90C 4C0ZA 2YLCA 2HAXA 1G8XA 1AWOA 1KQSA 5IN1A 2L3QA 4QVCA 1KSWA 4LDVA 5ECAA 4X9CA 4BI4A 3GPLA 3JCMb 2ATCB 2JTFA 1WJSA 4ZNXA 5LJ5g 2JT4A 5GANf 3EGXB 3OBYA 3N5BB 1OZ2A 5FWCA 2B8AA 2A37A 2MK5A 2O9SA 4HVWA 4F7UF 3QDFA 1UE9A 3SWNB 4RCBA 2IPOB 4HT9A 1X01A 1NLPC 2R5AA 2DXTA 1YJNT 3UDCA 5LJ3e 4OB2B 3I56Q 5CKDA 2DA9A 5CKBA 4K11A 2F2XA 4EMKC 1V1CA 3H0IA 1VA7A 1YBYA 1Q82C 3SHWA 4A4GA 2OTLA 1WPYA 2K2VA 4L5GA 4AG1C 3H6ZA 4BI3A 3PFSA 4FCYA 5LJ3d 2HSEB 4AFSC 3ZL7C 2RHXA 2YLBA 3BFMA 3M0PA 1R77A 1X6OA 3MKDA 5GAMf 3I55Q 1NJIR 1C1AA 4X9DA 4JRQA 5FU7B 3V8JA 1M1GA 1M8MA 4IIMA 1JJ2P 2O9VA 3M0TA 2RHUA 3JAME 4JLIA 3EG9A 2D0NA 5L8RE 2FRWA 4M77D 3KFVA 2HKQB 1RLPC 4PNOA 5D6XA 3CXCS 1B07A 1JJ2S 4ZN3A 1YCSB 2DETA 4Z88A 1I1JA 1WI7A 4X34A 4FSXA 4AMCA 1JBMA 1M27C 3CCST 2FZKB 3DLLA 3TSZA 3OS2A 3JCMg 2DRKA 3X24B 3VS0A 3I35A 4ZTFA 5AT1B 2H3JA 1BI1A 4X1VA 3SFMA 5FRMA 5CCAA 2LCLA 3P8DA 3H0FA 1VYVA 3FDRA 1PKTA 1LNXA 2ZPGB 2K5LA 4HXJA 2P4TA 5DM7R 1H3ZA 2FRYA 4M75B 1VQ9T 4A4EA 3R6OA 1FYNA 2J06A 4JZ3A 2M51A 1VQ6T 2YT6A 4C8QF 1VQPT 2ED1A 4V2SA 3H41A 4DOWA 2A28A 2EYZA 3MCAB 3ME9A 2FB7A 4WF2A 4QW2A 3MHXA 1F1BB 1GBQA 1VQ7A 3E19A 1CKAA 8AT1B 3A8MB 5CQXA 2YRDA 1M2VB 2KRNA 2M16A 3L42A 1VQ8Q 4DBFA 2QA4Q 4M77G 3HL8A 5EG2A 4HCZA 3OYCA 1QVFS 3C4SA 2XK0A 4D6WA 4M7AF 2HSPA 1WX6A 1XQHA 2RI5A 1UGQB 3AT1B 1KQ1A 3CCUA 2XIDA 3UT1A 1OU9A 8ATCB 3QYGB 4LN2A 4Z8AA 4BE2A 1H641 2K6DA 3MPUB 1I07A 3PNWC 3QG1A 4M78A 3CCMA 1ZBXA 4QQ6A 2EQUA 3MP8A 3REBB 2O4XA 1KG1A 1AWXA 4II1A 5GJVB 2KVQG 1NLOC 5GMKm 1LPLA 1UHCA 2DJZA 2PVOB 1SKUB 3M59A 1WHHA 1RLQC 3VV0A 1BK2A 2H3EB 2PUKB 4DEXA 1GRIA 2KSSA 4C5IA 3FJ5A 3CXCA 2JMAA 2JS0A 1JJ2A 1VQNQ 1VQ4Q 2ZPIB 4J9CA 2KYMA 2OTLT 3OB9A 4M7DD 4C8QC 4DEYA 1VQMA 1AZEA 2LC4A 1X69A 5LJ3j 1D1AA 5LJ3g 2RQTA 2LQKA 3CC4Q 2CREA 4E7IA 2Y4YA 1YITA 5KCHA 2RQRA 4HKEA 1ZUUA 4RKUE 2RF0A 3EFOB 3CCRA 3TQ7P 3HRUA 2J6OA 2MF2A 2VC8A 1UDLA 3OW2P 1KFZA 3VS6A 2P84A 3V8LA 4FIBA 4OMLA 1UTIA 1W2BP 2DD4A 3FIFA 4OGEA 2A7YA 1OULA 1SRLA 4J8OA 1U06A 3NTKA 4ELYC 4XTWA 1KQ2A 4N4IA 4M7AC 4XU3A 4KH1B 5I2SA 1EX4A 4EMKA 2CP5A 5HK0A 1YP5A 3QBYA 3CCQA 3QYHB 3OW2S 4IUQA 4C5HA 2D9TA 3GOXA 1M3AA 1X75C 1PC0A 1MMDA 2RH2A 2FHDA 4GBQA 2EJGA 2LT4A 4LD9K 3M56A 2RI2A 1UGSB 4GLKA 5LJ5h 1NPRA 4AT1B 3FC3A 2LCCA 4BDZA 2P0KA 2DILA 4M78B 1QVFA 1VQLQ 2RQWA 5KYXA 2LMJA 3GNFB 1D0YA 3C0CA 4AG2C 4OMFB 2LQWA 4M7DG 3CCEQ 3HKSA 4E7ZA 2E12A 4OB0B 4F7UG 3G1JA 1JQQA 4J9IA 1Q95G 2WSEE 3T9NA 2XG8D 1U1SA 5KE2A 2QG9B 3NFCA 2EYXA 3F70A 1N8RU 2E1HA 4FW2A 2HL5C 2L3SA 1VQ7T 5LJ5d 4KUIA 5IAYA 2EW3A 2RD1A 1OZ3A 1Q82R 3CBOA 1O75A 1VQ5Q 4F7UA 1B7TA 1PSEA 4XTUA 2GCXA 1YHQQ 1JU5C 2DX1A 3CCUT 1ZSZC 2NUZA 1RI9A 3G4SA 5GAN4 4PJOD 2VXFA 2RJDA 3HHTB 4GLMA 2DLPA 1K73U 1VQOA 2NUPA 3PT9A 4M77F 1ABOA 4BDYA 2KEAA 1W1FA 3M54A 3CD6Q 5GANe 3NTIA 2HBWA 1EFNA 3CCMT 3JCMh 3H9NA 3CMEA 3MJXA 4OVAA 2JJ9A 2JMCA 3QWYA 1X2QA 3JRZA 2EYYA 3X25B 4XU2A 4EDUA 4B9XA 3TSWA 1FMWA 1QWEA 2WSFE 3BDLA 4QVDA 2QI2A 1NEBA 4VUBA 3L2VA 1M8VA 4PJLA 2OTJQ 2VVKA 1ZQ1A 1GXIE 4R56A 1WQWA 1DJ7B 4FYVB 5GAOq 1MNEA 1Q86U 3GP8A 1M1KU 3CMAQ 3OYBA 3OW2A 1XOVA 2EKOA 3VUZA 5DLQE 5CAIA 1ARKA 2EYWA 3CBMA 1OQKA 2V8IA 3G6EQ 1TWBA 1N8RC 1W2BA 2YRCA 4D8DA 3QSUA 1YITQ 4BY6C 1VQMT 2GGRA 1I4K1 3V7SA 2DXCA 1FMVA 1I81A 5KYYB 2DEUA 4XK8E 4FW1A 2QQBA 5FW9A 1GL5A 1D1BA 1QVGS 1Y96A 2L8DA 3CCRT 2IVWA 4IUUA 3WXMB 2GTJA 3META 4KGVB 1TXQA 3FRNA 3MEWA 4KH0B 1RADB 1YCYA 4PJOG 4OGCA 1ZA2B 1YJWQ 3PE0A 4TVRA 2KBTA 4OMOA 1AT1B 4C92D 3O5ZA 5GAOp 1VQKQ 3OS5A 2DRMA 3CCQT 1K73C 1SEMA 2B86A 3E9FA 3U23A 1VIEA 1RUWA 4C8QA 1S72A 2GBQA 2CZ1B 5GMKe 4EMGA 4J9HA 3VU3C 2HDAA 5KH6A 5CIUA 4M77C 1WHLA 2L3RA 4RTZA 1PD0A 3OBWA 3KXTA 3JCMJ 2PUOB 4L59A 2E5QA 4NL2A 3OYDA 3GNGA 3UPUA 2VYTA 2XDPA 2BKDN 4ATOA 1UFFA 2K57A 4M7AA 2VXEA 5FRNA 2F2VA 3CCJA 2HQEA 1U5SA 1M3CA 1D1CA 2P4RA 1Q86C 1M1KC 1UUEA 3RERA 2FVUA 2DVEA 3RIRA 1MHNA 2ECZA 1WLPB 2DTHA 2YRVA 1S1NA 5D6WA 2E6NA 2RK1A 2ROLA 5KE3A 5LJ5j 4FYYB 4J9DA 3EAEA 2LNVA 3SDZA 1M2OA 5LJ3h 4M7DF 2QYZA 1GFCA 3VS4A 4C92G 2RQVA 2C06A 2J6FA 3VRZA 4JRPA 2EQIA 4Y28E 4PKCC 1YJNQ 1W70A 3JCMV 1MGQA 4B6MA 2CH4A 2FYKA 2DIQA 4OB1B 5I11A 4DBHA 4J9GA 3FLGA 4M78E 3FJPA 4PFPA 4A54A 4F04B 2QK0A 3G4ST 1U8RA 3EG2A 4EMHA 2LQNA 3SD4A 1WFWA 3LWIA 1VQOT 1X6GA 3HP9A 1TS9A 4ZGDB 1PKSA 5IXFA 4C92A 4O5VA 2XMFA 2CUBA 2VGMA 2NLUA 2XKOC 3JCMf 2LJ3A 2PU9B 1QVGA 2DKGA 3CMET 2E64A 2I0NA 4NS5A 2NYSA 3TREA 3M0QA 1TSFA 3CXCP 4JS5A 2KRSA 1T3SA 3A8GB 3JB9J 2QGGA 7AT1B 4MMKA 2KT1A 3THKA 1QCOA 3PVQA 5FU6C 1BCOA 1VYTA 2K3BA 1ZSZA 4F17A 1YJ9A 1OI1A 1D0ZA 3RMSA 4M7AB 2V26A 2LDMA 4ZTJA 2LRQA 1OPKA 2KMTA 4IIOA 3RMQA 3PIPA 3CCSQ 2EFIA 1YI2A 2DAQA 5GAOr 2GQIA 4C5GA 1WQ7A 2D6FA 2AKKA 2JNGA 5LL6S 4XAXB 2JM9A 1M3BA 2BIVA 2DIGA 3S6WA 4CRIA 1OOTA 1V76A 3M53A 4L6V5 5GAN2 4IUPA 4QT7A 2VB6A 3A8LB 4RCCA 2K79A 1KHIA 3SEMA 1QP3A 3G71A 4M7DC 1VQ9Q 2O31A 1HXDA 1HYOA 4J9BA 2LZ6B 1VQ6Q 1GCQC 1NG2A 4AFQC 1RAHB 1XJWB 5GAOn 2J05A 2YXYA 1VQPQ 3CC2A 3PGGA 1J3TA 1BBZA 2GQVA 1G3WA 2CS7A 1MMNA 4JJNK 3QPHA 3LWHA 2R57A 3OQ5A 3VRYA 2QQ9A 2YUQA 3O8VA 1S72T 2CGHA 2LT1A 5CK9A 2QQAA 2OX7A 5GMKl 2X3WD 1QVFP 2RI3A 3RKWA 1CSKA 2FL7A 4PJOF 3AHUA 1TUGB 2BTTA 2C0OA 4MZPA 2HNIA 2CP3A 4LDUA 1BCMA 2V8KA 3RESA 4IURA 1RABB 5GAN6 1R0BG 4C5EA 2RHIA 1XNIA 3QJ6A 4C0FA 1G2BA 3CCJT 6AT1B 2DFUA 1PM3A 1NZ9A 4CC3A 3OMCA 4XQ3A 4Z02A 1WJRA 2QEXA 3EG9B 2O88A 3LW5E 4ELZC 3EHQA 2QGFB 2KXCA 3E2UA 1NM7A 1MMGA 4F7UE 1QCFA 5CQYA 4FT2A 2AZSA 2IG0A 2X4JA 4CC7A 2RN8A 1V29B 3M4GA 4DBQA 2K9GA 2X51A 4M77A 1VIFA 4FU6A 3EGDA 1VUBA 4IUTA 4ANJA 2DL8A 3EGUA 1U3OA 5LJ3f 2LX9A 2XHCA 3HSBA 2A08A 3V8KA 1N8RR 2K4YA 2MMPA 5KYWA 3HFOA 2CH4W 2GFUA 2QDLA 2X4WA 1BU1A 1JXOA 2DYBA 2DD5A 2E10A 1QW1A 1IXDA 3HRTA 4A4KA 2YUNA 2DE0X 3IQLA 3A1PA 2LP5A 2OTLQ 1FXXA 4OMQA 1KD1U 4AFZC 4JDSA 1K76A 1YWOA 5HKCA 4C92F 1IGUA 3CC7A 1YIJA 4M4ZA 4JS4A 1M1FA 3UA7A 3JCMQ 4JLGA 3QJYA 1RL2A 1X27A 5GAN8 2KROA 3JCMW 4IUVA 2C0TA 1BIAA 1K73R 2XU8A 4RMOA 4PK4A 1UGRB 3Q1JA 3CBPA 3CEYA 5J26A 4PJOC 2QTXA 1WJQA 1M30A 2F5KA 4ZGJB 2AK5A 3QKJA 4MZMA 1OV3A 1OYXA 1NBEB 3CCVA 2QASA 4LUEA 3OS0A 2BZ8A 5HK3A 2F69A 2DF6A 2PQWA 1YJ9T 1Y0MA 2QXFA 4IKFA 4CI0C 5IXBA 2I2LA 2FPEA 3RBBB 1VOMA 4LE9A 1T0JA 4RTYA 3P8HA 1YI2T 2DM1A 4J6YA 4HCBA 2CP0A 1NYFA 1Q86R 5I22A 1M1KR 3VYGA 4F14A 2CT3A 2VV5A 3RKYA 3TCJA 3TEEA 1K8AU 1SHGA 1Y71A 4KRTA 5A0GA 1PHTA 2HKNA 2JUFA 4M77B 4C0GA 1AHJB 3EGDB 1WYXA 2OI3A 4C8QE 3VUBA 4CC2A 3G71T 4QQGA 3EG1A 3I9QA 3RDVA 4J5YA 4XU1A 1IZ6A 4E7JA 3SB2A 4ORZA 2O4XB 4N0AC 3UF4A 3CCLA 1Q7YR 3EH1A 2X3XD 1NPPA 5KYWB 4LDYA 2R5MA 4PJNA 1UJYA 1D0XA 4OMPA 4HCCA 3CC2T 3LGLA 4KUDK 3E9GA 1KD1C 5C6SA 1KC8U 2CUDA 2DERA 2DL7A 1VQ7Q 1N27A 5HCKA 2V8JA 2C0IA 3WVDB 2JVVA 1Y7XA 4M7AE 2ZAEA 2KY9A 2L5QA 2GF7A 3LX7A 1T0HA 4C92C 1BI2A 5IHIA 5L23A 4M7DA 4BD3A 1OX9A 4J83A 1G3SA 4OB3B 4PJMA 3PVLA 1GCQA 3G7ZA 3CCUQ 2A36A 2COWA 2YDLA 3JV3A 2RO0A 4A4FA 2DO3A 3M0SA 2RQUA 2RM4A 3QXEB 2AZVA 2DZ9A 5DY9A 2ZPHB 2QEXT 4MZTA 1TH7A 2KGTA 2L2PA 2MIOA 1ZHIA 2DTIA 2FG0A 2DK3A 4EMKB 2KAFA 3CCMQ 2DXUA 3DLMA 4E7KA 1KK7A 2DBKA 2KK4A 4PFOA 2D0QB 1K8AC 3RKXA 1BI3A 2LX7A 1C6VX 4XTXA 4HVUA 2MPXC 2CT4A 2X9HA 3EG0A 1PWTA 4NL3A 2KXDA 3MO8A 5KYNA 1WHJA 3I56A 2CP7A 3MEUA 4C92E 4FSSA 1N6AA 1D3BA 2GFAA 3GBQA 3M4YA 5GANd 2LCSA 2V1QA 4Y91A 3A98A 1KHCA 5FU6B 2XICA 4J7IA 3VS7A 2FPFA 3A8OB 5KYXB 2ENMA 1KC8C 4E7LA 1QVGP 2E5KA 1VQMQ 1ZBJA 3HFNA 3I55A 3CPWS 2VGNA 3CC7T 2Y90A 1YIJT 1XTDA 3OYJA 1H92A 1WXBA 1IHWA 4HA8A 4RTXA 3CCRQ 5GAMe 2CP2A 1I0CA 4ZN1A 3M55A 1Q7YU 2GNCA 4MMLA 3DB3A 1RAFB 2PNIA 2NUTA 1AWJA 1Z9QA 1K4US 2L3PA 3J81E 2CKKA 4Y92A 3L1AA 3CCVT 4M7DB 4M75D 5GAMd 2E6ZA 2EQMA 1PG5B 3CCQQ 3NGPA 1EZZB 4F7UB 3HRSA 2AT1B 5CO7A 3S3NA 1K1ZA 1AD5A 4KBMB 3OYAA 2M1HA 4C0DC 3MEAA 3QHSA 4LD6A 2YSQA 3QWXX 1VYUA 1N9SA 4F16A 4LXCA 1R8OB 1JRIA 2DYIA 2V1RA 2F1LA 1MV3A 2CDTA 1RAEB 3V7RA 5DLOA 1SSFA 2NUPB 3JB9H 4PJOA 1SRMA 5LJ5f 1I5LA 5CKEA 2E70A 1YWPA 3OSVA 2RPNA 4E2FB 2KDSA 3CCLT 3EH2A 4BB7A 2D8HA 2X35A 2JTMA 1FMKA 1AVZC 3P8BB 1D3BB 1Q81U 1KIKA 2M02A 3NPFA 1CKBA 1C0MA 3REAB 2FZGB 3VJPA 4E6RA 4LUDA 3M9QA 3DB4A 2EKHA 1AWWA 2EJFA 2JXBA 1VQ8A 2QA4A 2MYSA 3GF5A 3H0HA 1E7OA 2PVGB 2BE7D 1OX8A 1NE8A 2JTEA 4JRKA 1Q7YC 4OMNA 4PL6A 4M75G 1M9SA 2RJFA 1QVPA 3BY7A 5GAOm 2WACA 4N0AA 4RTVA 3OYIA 4M77E 1IRXA 1WA7A 1Y96B 2K3XA 1H3HA 2EJ9A 3FEOA 2ABLA 2G6FX 2MOXA 1M4ZA 2NUTB 2BUDA 3ULRB 2MI6A 3G4SQ 4UC4A 1K9MR 2EBPA 2YHTA 2DL3A 1VQOQ 1QCNA 3X20B 1UECA 1N9RA 4RTUA 1BYMA 4M75A 3M58A 3CPWA 1KJWA 1BIBA 2CZ6B 4YTLA 1OEBA 3L2RA 1PD1A 4OP0A 2DBMA 1UEBA 5FROA 3CMEQ 3D7SB 4C8QB 1G3YA 3CPFA 3OS1A 1NYGA 3TVTA 4XTYA 9ATCB 1X6BA 2PVDB 2WSCE 2E65A 2ZGWA 4RTWA 1YNZA 1ABQA 4BI8B 3OYKA 3I56T 2K3YA 4PJOB 4LDWA 3M57A 1M2VA 4BACA 3ASKA 1VQNA 1VQ4A 1TUCA 3OA6A 3JB9D 2M9UA 5GANj 2KR3A 2LQ8A 5M9OA 2ZPEB 1G83A 2DEQA 5GANg 1D09B 2X4YA 1Q81C 3QIIA 2MWOA 2CSIA 4A53A 1SG5A 2L89A 3I55T 3CC4A 2ZZDA 2VKNA 1TU0B 4DBRA 4HCKA 2RJEA 5EC7A 2O2OA 2JW4A 2KI7A 2P0PA 2EPDA 2EAYA 1KD1R 5D6YA 1T3LA 1UB4A 3MEVA 4R0KA 4FT4A 4M78D 3I5SA 2P0QA 1GFDA 3VS5A 2YUOA 3RNJA 4A4HA 2HCKA 4QVZA 2A3LA 2F5TX 3HPWA 4O6JA 3RUXA 2IIMA 4J7FA 5A0DA 3EHRA 4KGXB 3C12A 4XTVA 4OF1A 5GAMj 5GAMg 3VS3A 4BE0A 4FYXB 1LCKA 1S72Q 3OSSC 1QKXA 4WTOB 5IH2A 2OJ2A 3BDUA 1LJOA 1PSFA 4ZGEB 2M0OA 2K2MA 2D8JA 2QDYB 2KYBA 3EFRA 3L2ZA 2HQXA 3M5AA 1VQLA 2PZ1A 4C92B 2KE9A 3JB9G 1X2KA 4A63B 2EGAA 1NEGA 2K5IA 4E7HA 3CCEA 1TUDA 1K9MU 1WHGA 2DZCA 3FB9A 3CCJQ 2RB6A 3CQTA 3DKMA 1K8AR 5GMKj 3WVEB 5I21A 3EFOA 1X43A 2MWPA 3X28B 2E3HA 1UHFA 3M0RA 2FZCB 3VS1A 3VYHB 4JUVA 4M7DE 3INZA 2EVRA 4NOYA 2QTVA 1ZSZB 3RR6A 2RA2A 3OYGA 1EIFA 1MNDA 4M78G 1VQ8T 1E6GA 2YUPA 2QA4T 1ACMB 2BZXA 5AYFA 2D1XA 2JS2A 2AKLA 4E47A 1HJDA 1WXUA 3TU4K 1VQ5A 2EQJA 1I5OB 3KUFA 1KC8R 4OMMA 2E41A 1ZUKA 2DJQA 3UATA 4JJBA 1YHQA 4JPBW 2LVMA 1NJIU 5GJWB 3L2WA 3GIBA 3OYLA 2COZA 1P92A 1H8KA 4XU0A 2DL4A 2DTOA 2JZ2A 3UWNA 3CD6A 4D8KA 3KBGA 1YFNA 2Y4XA 5HY6A 4M75F 3SWNC 3JCMc 3OYMA 1AEYA 4Q5WA 2EGCA 3VKIA 4LNPA 1AZGB 3BE3A 1OU8A 4JRIA 2KT8A 2MCNA 4J9FA 3PMTA 4LDXA 4BY6B 3M0UA 2J6KA 2OAUA 4EIKA 1K9MC 2OTJA 1MMAA 1UGVA 1RI0A 3E1SA 1YJ9Q 4RG2A 4DOVA 3CMAA 1AOJA 1ZA1B 5A0LA 1VQNT 4R55A 1VQ4T 3OYHA 4XTZA 2HEQA 3G6EA 4PLIA 3OYFA 2QQSA 3LYIA 1JO8A 1ZX6A 4KULA 5FU7C 4FL6A 1YI2Q 1IB8A 4RTTA 4BE1A 5FWBA 5A2QE 2DXBA 2KNBB 3A5ZB 3ZEHA 2ESWA 4QQDA 2DL5A 3CC4T 4PJJA 1WIEA 4C0DB 1WDXA 5I2MA 2PTKA 4DQ2A 2RHYA 3EFSA 4AFUC 5KCOA 4J6XA 1JXMA 3G71Q 2RMOA 1UJ0A 1RAGB 1YJWA 5IHKA 3PTAA 1NJIC 3LLRA 3QZ9B 3JCMX 1VQKA 3UA6A 2HQHA 1W2BS 4J9EA 1TG0A 3MP6A 3CC2Q 1Y07A 3QZ5B 1M90R 2QQRA 2OAWA 3NHNA 4PJOE 1K0XA 1IREB 5J3BA 3ZBDA 5KYUA 4QKUA 2ZPBB 1JEGA 4HVVA 2EGEA 4M75C 3S3OA 1QQJA 4PFZA 3LGFA 4WCIA 4RUGA 3VS2A 4MDXA 5LJ5e 1VQLT 1G3TA 2JM8A 2HD0A 3C94A 3NMZC 2X4XA 2SRCA 4N4GA 1FX7A 3S3MA 5KYYA 3CCET 2KQWA 2HMAA 2A0FB 3OYNA 2DPPB 1HD3A 1TTHB 5CKFA 1HK9A 1FWZA 2QEXQ 4MDWA 2LTOA 1BKBA 1TOVA 3OYEA 5IT9E 5FLXE 2VASA 1N5ZA 5GANh 2CZ7B 4CC4B 3L2QA 3LH0A 4ME7A 1HSQA 2NWMA 3JB9F 1WGSA 3BW1A 1KQSP 2EWNA 2LJ0A 4C8QD 2FPDA 1Q81R 2XI9A 3OYYA 1LOJA 1YN8A 3QUIA 3MP1A 2VUBA 4GY5A 1VQ5T 1YJNA 1SHFA 2CSQA 1U1TA 1GBRA 2FEIA 1A0NB 2HZYA 2RJCA 3OY9A 3I5RA 5CVIA 3X26B 3R6NA 1YHQT 1MUZA 2ZPFB 4M75E 1O9SA 2HBPA 3C95A 4JZ4A 5C0MA 1BB9A 1KQSS 3CPWP 1G5VA 4EPCA 2DVJA 2ZCFB 5CKHA 4M78F 2CYZB 3URGA 2XDDA 1IHVA 3NTHA 4M7AD 1BI0A 2K7AA 1B34A 3H8ZA 5GAMh 2XDBA 5GMKi 3CD6T 3CC7Q 1YIJQ 4E7SA 2CP6A 2W10A 1E6HA 4JJCA 2EYQA 4ESRA 5KYUB 1RACB 5GAN7 1K0SA 1K9AA 1WXTA 3JCMe 4B9WA 5GAN5 2FO0A 5GAN3 2K5FA 1M5Q1
chains in the Genus database with same CATH topology
1UECA 4RTUA 2M0YA 4GBQA 3EG3A 1QWFA 1SPKA 1KJWA 1Y57A 2L0AA 1ZUYA 1OEBA 1G2BA 2DBMA 4CC3A 2DILA 2O88A 1NYGA 2KRMA 3EHQA 3TVTA 2KXCA 1X6BA 2DNUA 1NM7A 2LNHB 2RQWA 1QCFA 1PRMC 4RTWA 1YNZA 1ABQA 2AZSA 2LMJA 1OPLA 5IHNA 4CC7A 2RN8A 3C0CA 4AG2C 2LQWA 2K9GA 2W0ZA 2J7IA 2DL8A 3EGUA 1TUCA 2KR3A 1U3OA 1QLYA 1JQQA 1G83A 4J9IA 2A08A 2F2WA 2H8HA 2EYXA 1GCPA 2CSIA 1SSHA 2CH4W 2QDLA 2L3SA 2VWFA 1BU1A 1JXOA 2EW3A 2DYBA 2VKNA 2LJ1A 4HCKA 3LH5A 1B3QA 5EC7A 2O2OA 2JW4A 2YUNA 2DE0X 3IQLA 2EPDA 2LP5A 1T3LA 4OMQA 4AFZC 1W6XA 4R0KA 1K76A 1YWOA 3I5SA 1JU5C 1GFDA 3VS5A 2YUOA 3RNJA 4M4ZA 3UA7A 2BZYA 2HCKA 1IO6A 1UG1A 2DX1A 1X27A 2IIMA 2KROA 1ZSGA 2GTOA 2C0TA 2NUZA 3EHRA 1RI9A 2ED0A 2DMOA 1PRLC 1MV0B 1PNJA 4GLMA 2DLPA 3VS3A 1Z9ZA 2ROTA 1LCKA 1ABOA 1ZLMA 1M30A 2KEAA 1W1FA 1QKXA 2RNAA 2SEMA 4Z89A 2OJ2A 5IH2A 2AK5A 1OV3A 1QKWA 4JJDA 2HBWA 1EFNA 4LUEA 2BZ8A 2K2MA 2DF6A 2D8JA 1AWOA 2JMCA 2KYBA 3QWYA 1X2QA 1Y0MA 2L3QA 2EYYA 1KSWA 5ECAA 5IXBA 2FPEA 2PZ1A 3TSWA 3RBBB 4LE9A 1QWEA 2KE9A 1T0JA 4RTYA 1NEBA 1X2KA 2DM1A 4ZNXA 2EGAA 4A63B 2JT4A 1NEGA 1TUDA 2VVKA 1NYFA 5I22A 5FWCA 3CQTA 2A37A 4F14A 2O9SA 4HVWA 2CT3A 1XOVA 1SHGA 1UE9A 4KRTA 1PHTA 1X43A 1ARKA 2EYWA 1UHFA 1WYXA 2OI3A 3M0RA 1NLPC 4CC2A 3VS1A 4D8DA 3EG1A 3I9QA 2GGRA 2EVRA 4ORZA 3UF4A 2DA9A 4K11A 2F2XA 1V1CA 2X3XD 1VA7A 3H0IA 5FW9A 1UJYA 4OMPA 1GL5A 1E6GA 2YUPA 2BZXA 3SHWA 2D1XA 2JS2A 2AKLA 1HJDA 1WXUA 2GTJA 4AG1C 4OMMA 1ZUKA 2DJQA 4AFSC 2CUDA 3ZL7C 3UATA 4JJBA 2DL7A 3M0PA 5HCKA 2C0IA 3PE0A 2KBTA 4OMOA 4JPBW 3O5ZA 1M8MA 1T0HA 4IIMA 2DRMA 5GJWB 2O9VA 3M0TA 1SEMA 2B86A 3U23A 1RUWA 5IHIA 1H8KA 2DL4A 5L23A 2D0NA 2GBQA 2FRWA 4D8KA 4J9HA 3KFVA 2HDAA 1RLPC 3PVLA 1GCQA 2A36A 1AEYA 2YDLA 1B07A 2EGCA 3JV3A 4RTZA 4LNPA 3M0SA 1YCSB 2RQUA 1AZGB 4Z88A 1I1JA 1WI7A 2AZVA 2KT8A 2MCNA 4J9FA 1M27C 3M0UA 2J6KA 2KGTA 3TSZA 2L2PA 2MIOA 2DRKA 4EIKA 2FG0A 3VS0A 3I35A 1UFFA 2F2VA 4X1VA 1U5SA 1M3CA 1UGVA 2P4RA 1UUEA 2DBKA 1AOJA 3H0FA 1VYVA 2ECZA 2LX7A 2HEQA 1PKTA 4HVUA 1WLPB 2CT4A 1JO8A 1ZX6A 4HXJA 3EG0A 1PWTA 1S1NA 2KXDA 4RTTA 5FWBA 2ROLA 2FRYA 1FYNA 2KNBB 2J06A 4JZ3A 2ESWA 4FSSA 2M51A 2DL5A 2YT6A 4J9DA 3GBQA 1WIEA 2LCSA 1WDXA 2V1QA 3A98A 2PTKA 2ED1A 1GFCA 3H41A 3VS4A 4AFUC 2RQVA 2A28A 2EYZA 2J6FA 3VRZA 2EQIA 3VS7A 2FPFA 2ENMA 1JXMA 1W70A 2E5KA 1GBQA 2RMOA 1UJ0A 1ZBJA 1CKAA 2CH4A 5I11A 5IHKA 2KRNA 4J9GA 3UA6A 4J9EA 1H92A 1WXBA 1TG0A 4RTXA 1I0CA 3EG2A 2LQNA 1WFWA 2HSPA 2OAWA 3NHNA 1WX6A 2GNCA 1K0XA 1X6GA 1PKSA 5IXFA 2PNIA 1AWJA 1Z9QA 1K4US 2L3PA 2XMFA 2CUBA 4Y92A 1JEGA 4HVVA 2LJ3A 2EGEA 3NGPA 2I0NA 4LN2A 4Z8AA 3M0QA 4WCIA 4RUGA 3VS2A 2K6DA 2KRSA 1T3SA 1I07A 1K1ZA 1AD5A 2JM8A 3NMZC 2YSQA 2KT1A 2SRCA 3QWXX 3THKA 3PVQA 1VYUA 3REBB 1VYTA 4F16A 2K3BA 4F17A 1AWXA 2V1RA 1MV3A 2CDTA 5GJVB 1HD3A 1NLOC 1UHCA 1OPKA 4IIOA 1SRMA 2GQIA 2AKKA 1N5ZA 1RLQC 1BK2A 4DEXA 1YWPA 2JM9A 4CC4B 1M3BA 1GRIA 2RPNA 1HSQA 2NWMA 3FJ5A 2JMAA 2JS0A 1OOTA 2D8HA 1FMKA 1AVZC 4QT7A 4J9CA 2LJ0A 2KYMA 2FPDA 2K79A 1YN8A 3SEMA 1KIKA 1SHFA 3NPFA 2CSQA 4DEYA 1CKBA 1AZEA 1X69A 3REAB 2FEIA 1GBRA 1A0NB 4E6RA 4LUDA 2O31A 3I5RA 4J9BA 3R6NA 2RQTA 2LZ6B 1MUZA 2EKHA 2CREA 1AWWA 2JXBA 1GCQC 1NG2A 4AFQC 2RQRA 3H0HA 4JZ4A 1E7OA 1ZUUA 1BB9A 2RF0A 2J05A 2J6OA 1KFZA 1UDLA 3VS6A 1J3TA 1BBZA 2JTEA 2DVJA 4OMLA 4OMNA 1UTIA 3VRYA 2YUQA 1SRLA 2K7AA 1U06A 2X3WD 4RTVA 1CSKA 2W10A 1WA7A 1YP5A 1H3HA 1E6HA 2ABLA 2G6FX 2MOXA 4JJCA 3ULRB 2BTTA 2C0OA 4ESRA 2EBPA 1K0SA 1K9AA 1M3AA 2DL3A 1WXTA 2FO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UEC A;  4RTU A;  2M0Y A;  4GBQ A;  3EG3 A;  1QWF A;  1SPK A;  1KJW A;  1Y57 A;  2L0A A;  1ZUY A;  1OEB A;  1G2B A;  2DBM A;  4CC3 A;  2DIL A;  2O88 A;  1NYG A;  2KRM A;  3EHQ A;  3TVT A;  2KXC A;  1X6B A;  2DNU A;  1NM7 A;  2LNH B;  2RQW A;  1QCF A;  1PRM C;  4RTW A;  1YNZ A;  1ABQ A;  2AZS A;  2LMJ A;  1OPL A;  5IHN A;  4CC7 A;  2RN8 A;  3C0C A;  4AG2 C;  2LQW A;  2K9G A;  2W0Z A;  2J7I A;  2DL8 A;  3EGU A;  1TUC A;  2KR3 A;  1U3O A;  1QLY A;  1JQQ A;  1G83 A;  4J9I A;  2A08 A;  2F2W A;  2H8H A;  2EYX A;  1GCP A;  2CSI A;  1SSH A;  2CH4 W;  2QDL A;  2L3S A;  2VWF A;  1BU1 A;  1JXO A;  2EW3 A;  2DYB A;  2VKN A;  2LJ1 A;  4HCK A;  3LH5 A;  1B3Q A;  5EC7 A;  2O2O A;  2JW4 A;  2YUN A;  2DE0 X;  3IQL A;  2EPD A;  2LP5 A;  1T3L A;  4OMQ A;  4AFZ C;  1W6X A;  4R0K A;  1K76 A;  1YWO A;  3I5S A;  1JU5 C;  1GFD A;  3VS5 A;  2YUO A;  3RNJ A;  4M4Z A;  3UA7 A;  2BZY A;  2HCK A;  1IO6 A;  1UG1 A;  2DX1 A;  1X27 A;  2IIM A;  2KRO A;  1ZSG A;  2GTO A;  2C0T A;  2NUZ A;  3EHR A;  1RI9 A;  2ED0 A;  2DMO A;  1PRL C;  1MV0 B;  1PNJ A;  4GLM A;  2DLP A;  3VS3 A;  1Z9Z A;  2ROT A;  1LCK A;  1ABO A;  1ZLM A;  1M30 A;  2KEA A;  1W1F A;  1QKX A;  2RNA A;  2SEM A;  4Z89 A;  2OJ2 A;  5IH2 A;  2AK5 A;  1OV3 A;  1QKW A;  4JJD A;  2HBW A;  1EFN A;  4LUE A;  2BZ8 A;  2K2M A;  2DF6 A;  2D8J A;  1AWO A;  2JMC A;  2KYB A;  3QWY A;  1X2Q A;  1Y0M A;  2L3Q A;  2EYY A;  1KSW A;  5ECA A;  5IXB A;  2FPE A;  2PZ1 A;  3TSW A;  3RBB B;  4LE9 A;  1QWE A;  2KE9 A;  1T0J A;  4RTY A;  1NEB A;  1X2K A;  2DM1 A;  4ZNX A;  2EGA A;  4A63 B;  2JT4 A;  1NEG A;  1TUD A;  2VVK A;  1NYF A;  5I22 A;  5FWC A;  3CQT A;  2A37 A;  4F14 A;  2O9S A;  4HVW A;  2CT3 A;  1XOV A;  1SHG A;  1UE9 A;  4KRT A;  1PHT A;  1X43 A;  1ARK A;  2EYW A;  1UHF A;  1WYX A;  2OI3 A;  3M0R A;  1NLP C;  4CC2 A;  3VS1 A;  4D8D A;  3EG1 A;  3I9Q A;  2GGR A;  2EVR A;  4ORZ A;  3UF4 A;  2DA9 A;  4K11 A;  2F2X A;  1V1C A;  2X3X D;  1VA7 A;  3H0I A;  5FW9 A;  1UJY A;  4OMP A;  1GL5 A;  1E6G A;  2YUP A;  2BZX A;  3SHW A;  2D1X A;  2JS2 A;  2AKL A;  1HJD A;  1WXU A;  2GTJ A;  4AG1 C;  4OMM A;  1ZUK A;  2DJQ A;  4AFS C;  2CUD A;  3ZL7 C;  3UAT A;  4JJB A;  2DL7 A;  3M0P A;  5HCK A;  2C0I A;  3PE0 A;  2KBT A;  4OMO A;  4JPB W;  3O5Z A;  1M8M A;  1T0H A;  4IIM A;  2DRM A;  5GJW B;  2O9V A;  3M0T A;  1SEM A;  2B86 A;  3U23 A;  1RUW A;  5IHI A;  1H8K A;  2DL4 A;  5L23 A;  2D0N A;  2GBQ A;  2FRW A;  4D8K A;  4J9H A;  3KFV A;  2HDA A;  1RLP C;  3PVL A;  1GCQ A;  2A36 A;  1AEY A;  2YDL A;  1B07 A;  2EGC A;  3JV3 A;  4RTZ A;  4LNP A;  3M0S A;  1YCS B;  2RQU A;  1AZG B;  4Z88 A;  1I1J A;  1WI7 A;  2AZV A;  2KT8 A;  2MCN A;  4J9F A;  1M27 C;  3M0U A;  2J6K A;  2KGT A;  3TSZ A;  2L2P A;  2MIO A;  2DRK A;  4EIK A;  2FG0 A;  3VS0 A;  3I35 A;  1UFF A;  2F2V A;  4X1V A;  1U5S A;  1M3C A;  1UGV A;  2P4R A;  1UUE A;  2DBK A;  1AOJ A;  3H0F A;  1VYV A;  2ECZ A;  2LX7 A;  2HEQ A;  1PKT A;  4HVU A;  1WLP B;  2CT4 A;  1JO8 A;  1ZX6 A;  4HXJ A;  3EG0 A;  1PWT A;  1S1N A;  2KXD A;  4RTT A;  5FWB A;  2ROL A;  2FRY A;  1FYN A;  2KNB B;  2J06 A;  4JZ3 A;  2ESW A;  4FSS A;  2M51 A;  2DL5 A;  2YT6 A;  4J9D A;  3GBQ A;  1WIE A;  2LCS A;  1WDX A;  2V1Q A;  3A98 A;  2PTK A;  2ED1 A;  1GFC A;  3H41 A;  3VS4 A;  4AFU C;  2RQV A;  2A28 A;  2EYZ A;  2J6F A;  3VRZ A;  2EQI A;  3VS7 A;  2FPF A;  2ENM A;  1JXM A;  1W70 A;  2E5K A;  1GBQ A;  2RMO A;  1UJ0 A;  1ZBJ A;  1CKA A;  2CH4 A;  5I11 A;  5IHK A;  2KRN A;  4J9G A;  3UA6 A;  4J9E A;  1H92 A;  1WXB A;  1TG0 A;  4RTX A;  1I0C A;  3EG2 A;  2LQN A;  1WFW A;  2HSP A;  2OAW A;  3NHN A;  1WX6 A;  2GNC A;  1K0X A;  1X6G A;  1PKS A;  5IXF A;  2PNI A;  1AWJ A;  1Z9Q A;  1K4U S;  2L3P A;  2XMF A;  2CUB A;  4Y92 A;  1JEG A;  4HVV A;  2LJ3 A;  2EGE A;  3NGP A;  2I0N A;  4LN2 A;  4Z8A A;  3M0Q A;  4WCI A;  4RUG A;  3VS2 A;  2K6D A;  2KRS A;  1T3S A;  1I07 A;  1K1Z A;  1AD5 A;  2JM8 A;  3NMZ C;  2YSQ A;  2KT1 A;  2SRC A;  3QWX X;  3THK A;  3PVQ A;  1VYU A;  3REB B;  1VYT A;  4F16 A;  2K3B A;  4F17 A;  1AWX A;  2V1R A;  1MV3 A;  2CDT A;  5GJV B;  1HD3 A;  1NLO C;  1UHC A;  1OPK A;  4IIO A;  1SRM A;  2GQI A;  2AKK A;  1N5Z A;  1RLQ C;  1BK2 A;  4DEX A;  1YWP A;  2JM9 A;  4CC4 B;  1M3B A;  1GRI A;  2RPN A;  1HSQ A;  2NWM A;  3FJ5 A;  2JMA A;  2JS0 A;  1OOT A;  2D8H A;  1FMK A;  1AVZ C;  4QT7 A;  4J9C A;  2LJ0 A;  2KYM A;  2FPD A;  2K79 A;  1YN8 A;  3SEM A;  1KIK A;  1SHF A;  3NPF A;  2CSQ A;  4DEY A;  1CKB A;  1AZE A;  1X69 A;  3REA B;  2FEI A;  1GBR A;  1A0N B;  4E6R A;  4LUD A;  2O31 A;  3I5R A;  4J9B A;  3R6N A;  2RQT A;  2LZ6 B;  1MUZ A;  2EKH A;  2CRE A;  1AWW A;  2JXB A;  1GCQ C;  1NG2 A;  4AFQ C;  2RQR A;  3H0H A;  4JZ4 A;  1E7O A;  1ZUU A;  1BB9 A;  2RF0 A;  2J05 A;  2J6O A;  1KFZ A;  1UDL A;  3VS6 A;  1J3T A;  1BBZ A;  2JTE A;  2DVJ A;  4OML A;  4OMN A;  1UTI A;  3VRY A;  2YUQ A;  1SRL A;  2K7A A;  1U06 A;  2X3W D;  4RTV A;  1CSK A;  2W10 A;  1WA7 A;  1YP5 A;  1H3H A;  1E6H A;  2ABL A;  2G6F X;  2MOX A;  4JJC A;  3ULR B;  2BTT A;  2C0O A;  4ESR A;  2EBP A;  1K0S A;  1K9A A;  1M3A A;  2DL3 A;  1WXT A;  2FO0 A; 
#chains in the Genus database with same CATH topology
 3JB9 I;  2M0Y A;  3V7C A;  3EG3 A;  1QWF A;  1SPK A;  1IGQ A;  4KGZ B;  1Y57 A;  3L2U A;  3JCM P;  2G3R A;  1ZUY A;  2L0A A;  2XD0 A;  2OTJ T;  3CCV Q;  1M90 U;  4FM4 B;  3PMI A;  1I8F A;  4DA4 A;  2HL3 A;  2R58 A;  5CR2 A;  3CMA T;  1QMC A;  3EGX A;  1LVK A;  3JCM d;  3CCS A;  2KRM A;  4BUG A;  3QO3 A;  2DNU A;  3G6E T;  2AIR B;  2LNH B;  5D7U A;  1PRM C;  1QP2 A;  5GMK h;  1YIT T;  1OPL A;  5IHN A;  4C8Q G;  2BE9 B;  1RAI B;  5J39 A;  3SWN A;  4P5N A;  1R0C B;  1W4S A;  4FYW B;  2E3I A;  2CZ0 B;  2EQK A;  2W0Z A;  2J7I A;  3QDR B;  2O01 E;  4RG8 A;  2RHZ A;  3GLX A;  5GAO l;  1PCX A;  2MAM A;  4HT8 A;  1QLY A;  2JOY A;  3HTR A;  4PLL A;  2F2W A;  2H8H A;  2EIF A;  1GCP A;  1WHK A;  1SSH A;  2JN0 A;  2QAZ A;  1VQ9 A;  1RAA B;  4J6W A;  1UGP B;  2VWF A;  1VQ6 A;  1YJW T;  3CCL Q;  2LJ1 A;  1SF9 A;  2Z0W A;  4M7A G;  1VQK T;  3OMG A;  3LH5 A;  1B3Q A;  1VQP A;  1Q82 U;  3A8H B;  4KT0 E;  3J7A F;  1W6X A;  3ER0 A;  1JB0 E;  3PIO A;  4M78 C;  2BZY A;  1IO6 A;  1UG1 A;  3JSC A;  1ZSG A;  2GTO A;  1B34 B;  2ED0 A;  2DMO A;  1PRL C;  1MV0 B;  1PNJ A;  4N4H A;  1Z9Z A;  2ROT A;  3ZFJ A;  1WHM A;  1ZLM A;  3J80 E;  2SEM A;  2RNA A;  2YWW A;  4Z89 A;  2AHJ B;  1WNL A;  1QKW A;  4JJD A;  1WZO A;  2E4H A;  2COY A;  2RK2 A;  1M90 C;  4C0Z A;  2YLC A;  2HAX A;  1G8X A;  1AWO A;  1KQS A;  5IN1 A;  2L3Q A;  4QVC A;  1KSW A;  4LDV A;  5ECA A;  4X9C A;  4BI4 A;  3GPL A;  3JCM b;  2ATC B;  2JTF A;  1WJS A;  4ZNX A;  5LJ5 g;  2JT4 A;  5GAN f;  3EGX B;  3OBY A;  3N5B B;  1OZ2 A;  5FWC A;  2B8A A;  2A37 A;  2MK5 A;  2O9S A;  4HVW A;  4F7U F;  3QDF A;  1UE9 A;  3SWN B;  4RCB A;  2IPO B;  4HT9 A;  1X01 A;  1NLP C;  2R5A A;  2DXT A;  1YJN T;  3UDC A;  5LJ3 e;  4OB2 B;  3I56 Q;  5CKD A;  2DA9 A;  5CKB A;  4K11 A;  2F2X A;  4EMK C;  1V1C A;  3H0I A;  1VA7 A;  1YBY A;  1Q82 C;  3SHW A;  4A4G A;  2OTL A;  1WPY A;  2K2V A;  4L5G A;  4AG1 C;  3H6Z A;  4BI3 A;  3PFS A;  4FCY A;  5LJ3 d;  2HSE B;  4AFS C;  3ZL7 C;  2RHX A;  2YLB A;  3BFM A;  3M0P A;  1R77 A;  1X6O A;  3MKD A;  5GAM f;  3I55 Q;  1NJI R;  1C1A A;  4X9D A;  4JRQ A;  5FU7 B;  3V8J A;  1M1G A;  1M8M A;  4IIM A;  1JJ2 P;  2O9V A;  3M0T A;  2RHU A;  3JAM E;  4JLI A;  3EG9 A;  2D0N A;  5L8R E;  2FRW A;  4M77 D;  3KFV A;  2HKQ B;  1RLP C;  4PNO A;  5D6X A;  3CXC S;  1B07 A;  1JJ2 S;  4ZN3 A;  1YCS B;  2DET A;  4Z88 A;  1I1J A;  1WI7 A;  4X34 A;  4FSX A;  4AMC A;  1JBM A;  1M27 C;  3CCS T;  2FZK B;  3DLL A;  3TSZ A;  3OS2 A;  3JCM g;  2DRK A;  3X24 B;  3VS0 A;  3I35 A;  4ZTF A;  5AT1 B;  2H3J A;  1BI1 A;  4X1V A;  3SFM A;  5FRM A;  5CCA A;  2LCL A;  3P8D A;  3H0F A;  1VYV A;  3FDR A;  1PKT A;  1LNX A;  2ZPG B;  2K5L A;  4HXJ A;  2P4T A;  5DM7 R;  1H3Z A;  2FRY A;  4M75 B;  1VQ9 T;  4A4E A;  3R6O A;  1FYN A;  2J06 A;  4JZ3 A;  2M51 A;  1VQ6 T;  2YT6 A;  4C8Q F;  1VQP T;  2ED1 A;  4V2S A;  3H41 A;  4DOW A;  2A28 A;  2EYZ A;  3MCA B;  3ME9 A;  2FB7 A;  4WF2 A;  4QW2 A;  3MHX A;  1F1B B;  1GBQ A;  1VQ7 A;  3E19 A;  1CKA A;  8AT1 B;  3A8M B;  5CQX A;  2YRD A;  1M2V B;  2KRN A;  2M16 A;  3L42 A;  1VQ8 Q;  4DBF A;  2QA4 Q;  4M77 G;  3HL8 A;  5EG2 A;  4HCZ A;  3OYC A;  1QVF S;  3C4S A;  2XK0 A;  4D6W A;  4M7A F;  2HSP A;  1WX6 A;  1XQH A;  2RI5 A;  1UGQ B;  3AT1 B;  1KQ1 A;  3CCU A;  2XID A;  3UT1 A;  1OU9 A;  8ATC B;  3QYG B;  4LN2 A;  4Z8A A;  4BE2 A;  1H64 1;  2K6D A;  3MPU B;  1I07 A;  3PNW C;  3QG1 A;  4M78 A;  3CCM A;  1ZBX A;  4QQ6 A;  2EQU A;  3MP8 A;  3REB B;  2O4X A;  1KG1 A;  1AWX A;  4II1 A;  5GJV B;  2KVQ G;  1NLO C;  5GMK m;  1LPL A;  1UHC A;  2DJZ A;  2PVO B;  1SKU B;  3M59 A;  1WHH A;  1RLQ C;  3VV0 A;  1BK2 A;  2H3E B;  2PUK B;  4DEX A;  1GRI A;  2KSS A;  4C5I A;  3FJ5 A;  3CXC A;  2JMA A;  2JS0 A;  1JJ2 A;  1VQN Q;  1VQ4 Q;  2ZPI B;  4J9C A;  2KYM A;  2OTL T;  3OB9 A;  4M7D D;  4C8Q C;  4DEY A;  1VQM A;  1AZE A;  2LC4 A;  1X69 A;  5LJ3 j;  1D1A A;  5LJ3 g;  2RQT A;  2LQK A;  3CC4 Q;  2CRE A;  4E7I A;  2Y4Y A;  1YIT A;  5KCH A;  2RQR A;  4HKE A;  1ZUU A;  4RKU E;  2RF0 A;  3EFO B;  3CCR A;  3TQ7 P;  3HRU A;  2J6O A;  2MF2 A;  2VC8 A;  1UDL A;  3OW2 P;  1KFZ A;  3VS6 A;  2P84 A;  3V8L A;  4FIB A;  4OML A;  1UTI A;  1W2B P;  2DD4 A;  3FIF A;  4OGE A;  2A7Y A;  1OUL A;  1SRL A;  4J8O A;  1U06 A;  3NTK A;  4ELY C;  4XTW A;  1KQ2 A;  4N4I A;  4M7A C;  4XU3 A;  4KH1 B;  5I2S A;  1EX4 A;  4EMK A;  2CP5 A;  5HK0 A;  1YP5 A;  3QBY A;  3CCQ A;  3QYH B;  3OW2 S;  4IUQ A;  4C5H A;  2D9T A;  3GOX A;  1M3A A;  1X75 C;  1PC0 A;  1MMD A;  2RH2 A;  2FHD A;  4GBQ A;  2EJG A;  2LT4 A;  4LD9 K;  3M56 A;  2RI2 A;  1UGS B;  4GLK A;  5LJ5 h;  1NPR A;  4AT1 B;  3FC3 A;  2LCC A;  4BDZ A;  2P0K A;  2DIL A;  4M78 B;  1QVF A;  1VQL Q;  2RQW A;  5KYX A;  2LMJ A;  3GNF B;  1D0Y A;  3C0C A;  4AG2 C;  4OMF B;  2LQW A;  4M7D G;  3CCE Q;  3HKS A;  4E7Z A;  2E12 A;  4OB0 B;  4F7U G;  3G1J A;  1JQQ A;  4J9I A;  1Q95 G;  2WSE E;  3T9N A;  2XG8 D;  1U1S A;  5KE2 A;  2QG9 B;  3NFC A;  2EYX A;  3F70 A;  1N8R U;  2E1H A;  4FW2 A;  2HL5 C;  2L3S A;  1VQ7 T;  5LJ5 d;  4KUI A;  5IAY A;  2EW3 A;  2RD1 A;  1OZ3 A;  1Q82 R;  3CBO A;  1O75 A;  1VQ5 Q;  4F7U A;  1B7T A;  1PSE A;  4XTU A;  2GCX A;  1YHQ Q;  1JU5 C;  2DX1 A;  3CCU T;  1ZSZ C;  2NUZ A;  1RI9 A;  3G4S A;  5GAN 4;  4PJO D;  2VXF A;  2RJD A;  3HHT B;  4GLM A;  2DLP A;  1K73 U;  1VQO A;  2NUP A;  3PT9 A;  4M77 F;  1ABO A;  4BDY A;  2KEA A;  1W1F A;  3M54 A;  3CD6 Q;  5GAN e;  3NTI A;  2HBW A;  1EFN A;  3CCM T;  3JCM h;  3H9N A;  3CME A;  3MJX A;  4OVA A;  2JJ9 A;  2JMC A;  3QWY A;  1X2Q A;  3JRZ A;  2EYY A;  3X25 B;  4XU2 A;  4EDU A;  4B9X A;  3TSW A;  1FMW A;  1QWE A;  2WSF E;  3BDL A;  4QVD A;  2QI2 A;  1NEB A;  4VUB A;  3L2V A;  1M8V A;  4PJL A;  2OTJ Q;  2VVK A;  1ZQ1 A;  1GXI E;  4R56 A;  1WQW A;  1DJ7 B;  4FYV B;  5GAO q;  1MNE A;  1Q86 U;  3GP8 A;  1M1K U;  3CMA Q;  3OYB A;  3OW2 A;  1XOV A;  2EKO A;  3VUZ A;  5DLQ E;  5CAI A;  1ARK A;  2EYW A;  3CBM A;  1OQK A;  2V8I A;  3G6E Q;  1TWB A;  1N8R C;  1W2B A;  2YRC A;  4D8D A;  3QSU A;  1YIT Q;  4BY6 C;  1VQM T;  2GGR A;  1I4K 1;  3V7S A;  2DXC A;  1FMV A;  1I81 A;  5KYY B;  2DEU A;  4XK8 E;  4FW1 A;  2QQB A;  5FW9 A;  1GL5 A;  1D1B A;  1QVG S;  1Y96 A;  2L8D A;  3CCR T;  2IVW A;  4IUU A;  3WXM B;  2GTJ A;  3MET A;  4KGV B;  1TXQ A;  3FRN A;  3MEW A;  4KH0 B;  1RAD B;  1YCY A;  4PJO G;  4OGC A;  1ZA2 B;  1YJW Q;  3PE0 A;  4TVR A;  2KBT A;  4OMO A;  1AT1 B;  4C92 D;  3O5Z A;  5GAO p;  1VQK Q;  3OS5 A;  2DRM A;  3CCQ T;  1K73 C;  1SEM A;  2B86 A;  3E9F A;  3U23 A;  1VIE A;  1RUW A;  4C8Q A;  1S72 A;  2GBQ A;  2CZ1 B;  5GMK e;  4EMG A;  4J9H A;  3VU3 C;  2HDA A;  5KH6 A;  5CIU A;  4M77 C;  1WHL A;  2L3R A;  4RTZ A;  1PD0 A;  3OBW A;  3KXT A;  3JCM J;  2PUO B;  4L59 A;  2E5Q A;  4NL2 A;  3OYD A;  3GNG A;  3UPU A;  2VYT A;  2XDP A;  2BKD N;  4ATO A;  1UFF A;  2K57 A;  4M7A A;  2VXE A;  5FRN A;  2F2V A;  3CCJ A;  2HQE A;  1U5S A;  1M3C A;  1D1C A;  2P4R A;  1Q86 C;  1M1K C;  1UUE A;  3RER A;  2FVU A;  2DVE A;  3RIR A;  1MHN A;  2ECZ A;  1WLP B;  2DTH A;  2YRV A;  1S1N A;  5D6W A;  2E6N A;  2RK1 A;  2ROL A;  5KE3 A;  5LJ5 j;  4FYY B;  4J9D A;  3EAE A;  2LNV A;  3SDZ A;  1M2O A;  5LJ3 h;  4M7D F;  2QYZ A;  1GFC A;  3VS4 A;  4C92 G;  2RQV A;  2C06 A;  2J6F A;  3VRZ A;  4JRP A;  2EQI A;  4Y28 E;  4PKC C;  1YJN Q;  1W70 A;  3JCM V;  1MGQ A;  4B6M A;  2CH4 A;  2FYK A;  2DIQ A;  4OB1 B;  5I11 A;  4DBH A;  4J9G A;  3FLG A;  4M78 E;  3FJP A;  4PFP A;  4A54 A;  4F04 B;  2QK0 A;  3G4S T;  1U8R A;  3EG2 A;  4EMH A;  2LQN A;  3SD4 A;  1WFW A;  3LWI A;  1VQO T;  1X6G A;  3HP9 A;  1TS9 A;  4ZGD B;  1PKS A;  5IXF A;  4C92 A;  4O5V A;  2XMF A;  2CUB A;  2VGM A;  2NLU A;  2XKO C;  3JCM f;  2LJ3 A;  2PU9 B;  1QVG A;  2DKG A;  3CME T;  2E64 A;  2I0N A;  4NS5 A;  2NYS A;  3TRE A;  3M0Q A;  1TSF A;  3CXC P;  4JS5 A;  2KRS A;  1T3S A;  3A8G B;  3JB9 J;  2QGG A;  7AT1 B;  4MMK A;  2KT1 A;  3THK A;  1QCO A;  3PVQ A;  5FU6 C;  1BCO A;  1VYT A;  2K3B A;  1ZSZ A;  4F17 A;  1YJ9 A;  1OI1 A;  1D0Z A;  3RMS A;  4M7A B;  2V26 A;  2LDM A;  4ZTJ A;  2LRQ A;  1OPK A;  2KMT A;  4IIO A;  3RMQ A;  3PIP A;  3CCS Q;  2EFI A;  1YI2 A;  2DAQ A;  5GAO r;  2GQI A;  4C5G A;  1WQ7 A;  2D6F A;  2AKK A;  2JNG A;  5LL6 S;  4XAX B;  2JM9 A;  1M3B A;  2BIV A;  2DIG A;  3S6W A;  4CRI A;  1OOT A;  1V76 A;  3M53 A;  4L6V 5;  5GAN 2;  4IUP A;  4QT7 A;  2VB6 A;  3A8L B;  4RCC A;  2K79 A;  1KHI A;  3SEM A;  1QP3 A;  3G71 A;  4M7D C;  1VQ9 Q;  2O31 A;  1HXD A;  1HYO A;  4J9B A;  2LZ6 B;  1VQ6 Q;  1GCQ C;  1NG2 A;  4AFQ C;  1RAH B;  1XJW B;  5GAO n;  2J05 A;  2YXY A;  1VQP Q;  3CC2 A;  3PGG A;  1J3T A;  1BBZ A;  2GQV A;  1G3W A;  2CS7 A;  1MMN A;  4JJN K;  3QPH A;  3LWH A;  2R57 A;  3OQ5 A;  3VRY A;  2QQ9 A;  2YUQ A;  3O8V A;  1S72 T;  2CGH A;  2LT1 A;  5CK9 A;  2QQA A;  2OX7 A;  5GMK l;  2X3W D;  1QVF P;  2RI3 A;  3RKW A;  1CSK A;  2FL7 A;  4PJO F;  3AHU A;  1TUG B;  2BTT A;  2C0O A;  4MZP A;  2HNI A;  2CP3 A;  4LDU A;  1BCM A;  2V8K A;  3RES A;  4IUR A;  1RAB B;  5GAN 6;  1R0B G;  4C5E A;  2RHI A;  1XNI A;  3QJ6 A;  4C0F A;  1G2B A;  3CCJ T;  6AT1 B;  2DFU A;  1PM3 A;  1NZ9 A;  4CC3 A;  3OMC A;  4XQ3 A;  4Z02 A;  1WJR A;  2QEX A;  3EG9 B;  2O88 A;  3LW5 E;  4ELZ C;  3EHQ A;  2QGF B;  2KXC A;  3E2U A;  1NM7 A;  1MMG A;  4F7U E;  1QCF A;  5CQY A;  4FT2 A;  2AZS A;  2IG0 A;  2X4J A;  4CC7 A;  2RN8 A;  1V29 B;  3M4G A;  4DBQ A;  2K9G A;  2X51 A;  4M77 A;  1VIF A;  4FU6 A;  3EGD A;  1VUB A;  4IUT A;  4ANJ A;  2DL8 A;  3EGU A;  1U3O A;  5LJ3 f;  2LX9 A;  2XHC A;  3HSB A;  2A08 A;  3V8K A;  1N8R R;  2K4Y A;  2MMP A;  5KYW A;  3HFO A;  2CH4 W;  2GFU A;  2QDL A;  2X4W A;  1BU1 A;  1JXO A;  2DYB A;  2DD5 A;  2E10 A;  1QW1 A;  1IXD A;  3HRT A;  4A4K A;  2YUN A;  2DE0 X;  3IQL A;  3A1P A;  2LP5 A;  2OTL Q;  1FXX A;  4OMQ A;  1KD1 U;  4AFZ C;  4JDS A;  1K76 A;  1YWO A;  5HKC A;  4C92 F;  1IGU A;  3CC7 A;  1YIJ A;  4M4Z A;  4JS4 A;  1M1F A;  3UA7 A;  3JCM Q;  4JLG A;  3QJY A;  1RL2 A;  1X27 A;  5GAN 8;  2KRO A;  3JCM W;  4IUV A;  2C0T A;  1BIA A;  1K73 R;  2XU8 A;  4RMO A;  4PK4 A;  1UGR B;  3Q1J A;  3CBP A;  3CEY A;  5J26 A;  4PJO C;  2QTX A;  1WJQ A;  1M30 A;  2F5K A;  4ZGJ B;  2AK5 A;  3QKJ A;  4MZM A;  1OV3 A;  1OYX A;  1NBE B;  3CCV A;  2QAS A;  4LUE A;  3OS0 A;  2BZ8 A;  5HK3 A;  2F69 A;  2DF6 A;  2PQW A;  1YJ9 T;  1Y0M A;  2QXF A;  4IKF A;  4CI0 C;  5IXB A;  2I2L A;  2FPE A;  3RBB B;  1VOM A;  4LE9 A;  1T0J A;  4RTY A;  3P8H A;  1YI2 T;  2DM1 A;  4J6Y A;  4HCB A;  2CP0 A;  1NYF A;  1Q86 R;  5I22 A;  1M1K R;  3VYG A;  4F14 A;  2CT3 A;  2VV5 A;  3RKY A;  3TCJ A;  3TEE A;  1K8A U;  1SHG A;  1Y71 A;  4KRT A;  5A0G A;  1PHT A;  2HKN A;  2JUF A;  4M77 B;  4C0G A;  1AHJ B;  3EGD B;  1WYX A;  2OI3 A;  4C8Q E;  3VUB A;  4CC2 A;  3G71 T;  4QQG A;  3EG1 A;  3I9Q A;  3RDV A;  4J5Y A;  4XU1 A;  1IZ6 A;  4E7J A;  3SB2 A;  4ORZ A;  2O4X B;  4N0A C;  3UF4 A;  3CCL A;  1Q7Y R;  3EH1 A;  2X3X D;  1NPP A;  5KYW B;  4LDY A;  2R5M A;  4PJN A;  1UJY A;  1D0X A;  4OMP A;  4HCC A;  3CC2 T;  3LGL A;  4KUD K;  3E9G A;  1KD1 C;  5C6S A;  1KC8 U;  2CUD A;  2DER A;  2DL7 A;  1VQ7 Q;  1N27 A;  5HCK A;  2V8J A;  2C0I A;  3WVD B;  2JVV A;  1Y7X A;  4M7A E;  2ZAE A;  2KY9 A;  2L5Q A;  2GF7 A;  3LX7 A;  1T0H A;  4C92 C;  1BI2 A;  5IHI A;  5L23 A;  4M7D A;  4BD3 A;  1OX9 A;  4J83 A;  1G3S A;  4OB3 B;  4PJM A;  3PVL A;  1GCQ A;  3G7Z A;  3CCU Q;  2A36 A;  2COW A;  2YDL A;  3JV3 A;  2RO0 A;  4A4F A;  2DO3 A;  3M0S A;  2RQU A;  2RM4 A;  3QXE B;  2AZV A;  2DZ9 A;  5DY9 A;  2ZPH B;  2QEX T;  4MZT A;  1TH7 A;  2KGT A;  2L2P A;  2MIO A;  1ZHI A;  2DTI A;  2FG0 A;  2DK3 A;  4EMK B;  2KAF A;  3CCM Q;  2DXU A;  3DLM A;  4E7K A;  1KK7 A;  2DBK A;  2KK4 A;  4PFO A;  2D0Q B;  1K8A C;  3RKX A;  1BI3 A;  2LX7 A;  1C6V X;  4XTX A;  4HVU A;  2MPX C;  2CT4 A;  2X9H A;  3EG0 A;  1PWT A;  4NL3 A;  2KXD A;  3MO8 A;  5KYN A;  1WHJ A;  3I56 A;  2CP7 A;  3MEU A;  4C92 E;  4FSS A;  1N6A A;  1D3B A;  2GFA A;  3GBQ A;  3M4Y A;  5GAN d;  2LCS A;  2V1Q A;  4Y91 A;  3A98 A;  1KHC A;  5FU6 B;  2XIC A;  4J7I A;  3VS7 A;  2FPF A;  3A8O B;  5KYX B;  2ENM A;  1KC8 C;  4E7L A;  1QVG P;  2E5K A;  1VQM Q;  1ZBJ A;  3HFN A;  3I55 A;  3CPW S;  2VGN A;  3CC7 T;  2Y90 A;  1YIJ T;  1XTD A;  3OYJ A;  1H92 A;  1WXB A;  1IHW A;  4HA8 A;  4RTX A;  3CCR Q;  5GAM e;  2CP2 A;  1I0C A;  4ZN1 A;  3M55 A;  1Q7Y U;  2GNC A;  4MML A;  3DB3 A;  1RAF B;  2PNI A;  2NUT A;  1AWJ A;  1Z9Q A;  1K4U S;  2L3P A;  3J81 E;  2CKK A;  4Y92 A;  3L1A A;  3CCV T;  4M7D B;  4M75 D;  5GAM d;  2E6Z A;  2EQM A;  1PG5 B;  3CCQ Q;  3NGP A;  1EZZ B;  4F7U B;  3HRS A;  2AT1 B;  5CO7 A;  3S3N A;  1K1Z A;  1AD5 A;  4KBM B;  3OYA A;  2M1H A;  4C0D C;  3MEA A;  3QHS A;  4LD6 A;  2YSQ A;  3QWX X;  1VYU A;  1N9S A;  4F16 A;  4LXC A;  1R8O B;  1JRI A;  2DYI A;  2V1R A;  2F1L A;  1MV3 A;  2CDT A;  1RAE B;  3V7R A;  5DLO A;  1SSF A;  2NUP B;  3JB9 H;  4PJO A;  1SRM A;  5LJ5 f;  1I5L A;  5CKE A;  2E70 A;  1YWP A;  3OSV A;  2RPN A;  4E2F B;  2KDS A;  3CCL T;  3EH2 A;  4BB7 A;  2D8H A;  2X35 A;  2JTM A;  1FMK A;  1AVZ C;  3P8B B;  1D3B B;  1Q81 U;  1KIK A;  2M02 A;  3NPF A;  1CKB A;  1C0M A;  3REA B;  2FZG B;  3VJP A;  4E6R A;  4LUD A;  3M9Q A;  3DB4 A;  2EKH A;  1AWW A;  2EJF A;  2JXB A;  1VQ8 A;  2QA4 A;  2MYS A;  3GF5 A;  3H0H A;  1E7O A;  2PVG B;  2BE7 D;  1OX8 A;  1NE8 A;  2JTE A;  4JRK A;  1Q7Y C;  4OMN A;  4PL6 A;  4M75 G;  1M9S A;  2RJF A;  1QVP A;  3BY7 A;  5GAO m;  2WAC A;  4N0A A;  4RTV A;  3OYI A;  4M77 E;  1IRX A;  1WA7 A;  1Y96 B;  2K3X A;  1H3H A;  2EJ9 A;  3FEO A;  2ABL A;  2G6F X;  2MOX A;  1M4Z A;  2NUT B;  2BUD A;  3ULR B;  2MI6 A;  3G4S Q;  4UC4 A;  1K9M R;  2EBP A;  2YHT A;  2DL3 A;  1VQO Q;  1QCN A;  3X20 B;  1UEC A;  1N9R A;  4RTU A;  1BYM A;  4M75 A;  3M58 A;  3CPW A;  1KJW A;  1BIB A;  2CZ6 B;  4YTL A;  1OEB A;  3L2R A;  1PD1 A;  4OP0 A;  2DBM A;  1UEB A;  5FRO A;  3CME Q;  3D7S B;  4C8Q B;  1G3Y A;  3CPF A;  3OS1 A;  1NYG A;  3TVT A;  4XTY A;  9ATC B;  1X6B A;  2PVD B;  2WSC E;  2E65 A;  2ZGW A;  4RTW A;  1YNZ A;  1ABQ A;  4BI8 B;  3OYK A;  3I56 T;  2K3Y A;  4PJO B;  4LDW A;  3M57 A;  1M2V A;  4BAC A;  3ASK A;  1VQN A;  1VQ4 A;  1TUC A;  3OA6 A;  3JB9 D;  2M9U A;  5GAN j;  2KR3 A;  2LQ8 A;  5M9O A;  2ZPE B;  1G83 A;  2DEQ A;  5GAN g;  1D09 B;  2X4Y A;  1Q81 C;  3QII A;  2MWO A;  2CSI A;  4A53 A;  1SG5 A;  2L89 A;  3I55 T;  3CC4 A;  2ZZD A;  2VKN A;  1TU0 B;  4DBR A;  4HCK A;  2RJE A;  5EC7 A;  2O2O A;  2JW4 A;  2KI7 A;  2P0P A;  2EPD A;  2EAY A;  1KD1 R;  5D6Y A;  1T3L A;  1UB4 A;  3MEV A;  4R0K A;  4FT4 A;  4M78 D;  3I5S A;  2P0Q A;  1GFD A;  3VS5 A;  2YUO A;  3RNJ A;  4A4H A;  2HCK A;  4QVZ A;  2A3L A;  2F5T X;  3HPW A;  4O6J A;  3RUX A;  2IIM A;  4J7F A;  5A0D A;  3EHR A;  4KGX B;  3C12 A;  4XTV A;  4OF1 A;  5GAM j;  5GAM g;  3VS3 A;  4BE0 A;  4FYX B;  1LCK A;  1S72 Q;  3OSS C;  1QKX A;  4WTO B;  5IH2 A;  2OJ2 A;  3BDU A;  1LJO A;  1PSF A;  4ZGE B;  2M0O A;  2K2M A;  2D8J A;  2QDY B;  2KYB A;  3EFR A;  3L2Z A;  2HQX A;  3M5A A;  1VQL A;  2PZ1 A;  4C92 B;  2KE9 A;  3JB9 G;  1X2K A;  4A63 B;  2EGA A;  1NEG A;  2K5I A;  4E7H A;  3CCE A;  1TUD A;  1K9M U;  1WHG A;  2DZC A;  3FB9 A;  3CCJ Q;  2RB6 A;  3CQT A;  3DKM A;  1K8A R;  5GMK j;  3WVE B;  5I21 A;  3EFO A;  1X43 A;  2MWP A;  3X28 B;  2E3H A;  1UHF A;  3M0R A;  2FZC B;  3VS1 A;  3VYH B;  4JUV A;  4M7D E;  3INZ A;  2EVR A;  4NOY A;  2QTV A;  1ZSZ B;  3RR6 A;  2RA2 A;  3OYG A;  1EIF A;  1MND A;  4M78 G;  1VQ8 T;  1E6G A;  2YUP A;  2QA4 T;  1ACM B;  2BZX A;  5AYF A;  2D1X A;  2JS2 A;  2AKL A;  4E47 A;  1HJD A;  1WXU A;  3TU4 K;  1VQ5 A;  2EQJ A;  1I5O B;  3KUF A;  1KC8 R;  4OMM A;  2E41 A;  1ZUK A;  2DJQ A;  3UAT A;  4JJB A;  1YHQ A;  4JPB W;  2LVM A;  1NJI U;  5GJW B;  3L2W A;  3GIB A;  3OYL A;  2COZ A;  1P92 A;  1H8K A;  4XU0 A;  2DL4 A;  2DTO A;  2JZ2 A;  3UWN A;  3CD6 A;  4D8K A;  3KBG A;  1YFN A;  2Y4X A;  5HY6 A;  4M75 F;  3SWN C;  3JCM c;  3OYM A;  1AEY A;  4Q5W A;  2EGC A;  3VKI A;  4LNP A;  1AZG B;  3BE3 A;  1OU8 A;  4JRI A;  2KT8 A;  2MCN A;  4J9F A;  3PMT A;  4LDX A;  4BY6 B;  3M0U A;  2J6K A;  2OAU A;  4EIK A;  1K9M C;  2OTJ A;  1MMA A;  1UGV A;  1RI0 A;  3E1S A;  1YJ9 Q;  4RG2 A;  4DOV A;  3CMA A;  1AOJ A;  1ZA1 B;  5A0L A;  1VQN T;  4R55 A;  1VQ4 T;  3OYH A;  4XTZ A;  2HEQ A;  3G6E A;  4PLI A;  3OYF A;  2QQS A;  3LYI A;  1JO8 A;  1ZX6 A;  4KUL A;  5FU7 C;  4FL6 A;  1YI2 Q;  1IB8 A;  4RTT A;  4BE1 A;  5FWB A;  5A2Q E;  2DXB A;  2KNB B;  3A5Z B;  3ZEH A;  2ESW A;  4QQD A;  2DL5 A;  3CC4 T;  4PJJ A;  1WIE A;  4C0D B;  1WDX A;  5I2M A;  2PTK A;  4DQ2 A;  2RHY A;  3EFS A;  4AFU C;  5KCO A;  4J6X A;  1JXM A;  3G71 Q;  2RMO A;  1UJ0 A;  1RAG B;  1YJW A;  5IHK A;  3PTA A;  1NJI C;  3LLR A;  3QZ9 B;  3JCM X;  1VQK A;  3UA6 A;  2HQH A;  1W2B S;  4J9E A;  1TG0 A;  3MP6 A;  3CC2 Q;  1Y07 A;  3QZ5 B;  1M90 R;  2QQR A;  2OAW A;  3NHN A;  4PJO E;  1K0X A;  1IRE B;  5J3B A;  3ZBD A;  5KYU A;  4QKU A;  2ZPB B;  1JEG A;  4HVV A;  2EGE A;  4M75 C;  3S3O A;  1QQJ A;  4PFZ A;  3LGF A;  4WCI A;  4RUG A;  3VS2 A;  4MDX A;  5LJ5 e;  1VQL T;  1G3T A;  2JM8 A;  2HD0 A;  3C94 A;  3NMZ C;  2X4X A;  2SRC A;  4N4G A;  1FX7 A;  3S3M A;  5KYY A;  3CCE T;  2KQW A;  2HMA A;  2A0F B;  3OYN A;  2DPP B;  1HD3 A;  1TTH B;  5CKF A;  1HK9 A;  1FWZ A;  2QEX Q;  4MDW A;  2LTO A;  1BKB A;  1TOV A;  3OYE A;  5IT9 E;  5FLX E;  2VAS A;  1N5Z A;  5GAN h;  2CZ7 B;  4CC4 B;  3L2Q A;  3LH0 A;  4ME7 A;  1HSQ A;  2NWM A;  3JB9 F;  1WGS A;  3BW1 A;  1KQS P;  2EWN A;  2LJ0 A;  4C8Q D;  2FPD A;  1Q81 R;  2XI9 A;  3OYY A;  1LOJ A;  1YN8 A;  3QUI A;  3MP1 A;  2VUB A;  4GY5 A;  1VQ5 T;  1YJN A;  1SHF A;  2CSQ A;  1U1T A;  1GBR A;  2FEI A;  1A0N B;  2HZY A;  2RJC A;  3OY9 A;  3I5R A;  5CVI A;  3X26 B;  3R6N A;  1YHQ T;  1MUZ A;  2ZPF B;  4M75 E;  1O9S A;  2HBP A;  3C95 A;  4JZ4 A;  5C0M A;  1BB9 A;  1KQS S;  3CPW P;  1G5V A;  4EPC A;  2DVJ A;  2ZCF B;  5CKH A;  4M78 F;  2CYZ B;  3URG A;  2XDD A;  1IHV A;  3NTH A;  4M7A D;  1BI0 A;  2K7A A;  1B34 A;  3H8Z A;  5GAM h;  2XDB A;  5GMK i;  3CD6 T;  3CC7 Q;  1YIJ Q;  4E7S A;  2CP6 A;  2W10 A;  1E6H A;  4JJC A;  2EYQ A;  4ESR A;  5KYU B;  1RAC B;  5GAN 7;  1K0S A;  1K9A A;  1WXT A;  3JCM e;  4B9W A;  5GAN 5;  2FO0 A;  5GAN 3;  2K5F A;  1M5Q 1; 
#chains in the Genus database with same CATH homology
 1UEC A;  4RTU A;  2M0Y A;  4GBQ A;  3EG3 A;  1QWF A;  1SPK A;  1KJW A;  1Y57 A;  2L0A A;  1ZUY A;  1OEB A;  1G2B A;  2DBM A;  4CC3 A;  2DIL A;  2O88 A;  1NYG A;  2KRM A;  3EHQ A;  3TVT A;  2KXC A;  1X6B A;  2DNU A;  1NM7 A;  2LNH B;  2RQW A;  1QCF A;  1PRM C;  4RTW A;  1YNZ A;  1ABQ A;  2AZS A;  2LMJ A;  1OPL A;  5IHN A;  4CC7 A;  2RN8 A;  3C0C A;  4AG2 C;  2LQW A;  2K9G A;  2W0Z A;  2J7I A;  2DL8 A;  3EGU A;  1TUC A;  2KR3 A;  1U3O A;  1QLY A;  1JQQ A;  1G83 A;  4J9I A;  2A08 A;  2F2W A;  2H8H A;  2EYX A;  1GCP A;  2CSI A;  1SSH A;  2CH4 W;  2QDL A;  2L3S A;  2VWF A;  1BU1 A;  1JXO A;  2EW3 A;  2DYB A;  2VKN A;  2LJ1 A;  4HCK A;  3LH5 A;  1B3Q A;  5EC7 A;  2O2O A;  2JW4 A;  2YUN A;  2DE0 X;  3IQL A;  2EPD A;  2LP5 A;  1T3L A;  4OMQ A;  4AFZ C;  1W6X A;  4R0K A;  1K76 A;  1YWO A;  3I5S A;  1JU5 C;  1GFD A;  3VS5 A;  2YUO A;  3RNJ A;  4M4Z A;  3UA7 A;  2BZY A;  2HCK A;  1IO6 A;  1UG1 A;  2DX1 A;  1X27 A;  2IIM A;  2KRO A;  1ZSG A;  2GTO A;  2C0T A;  2NUZ A;  3EHR A;  1RI9 A;  2ED0 A;  2DMO A;  1PRL C;  1MV0 B;  1PNJ A;  4GLM A;  2DLP A;  3VS3 A;  1Z9Z A;  2ROT A;  1LCK A;  1ABO A;  1ZLM A;  1M30 A;  2KEA A;  1W1F A;  1QKX A;  2RNA A;  2SEM A;  4Z89 A;  2OJ2 A;  5IH2 A;  2AK5 A;  1OV3 A;  1QKW A;  4JJD A;  2HBW A;  1EFN A;  4LUE A;  2BZ8 A;  2K2M A;  2DF6 A;  2D8J A;  1AWO A;  2JMC A;  2KYB A;  3QWY A;  1X2Q A;  1Y0M A;  2L3Q A;  2EYY A;  1KSW A;  5ECA A;  5IXB A;  2FPE A;  2PZ1 A;  3TSW A;  3RBB B;  4LE9 A;  1QWE A;  2KE9 A;  1T0J A;  4RTY A;  1NEB A;  1X2K A;  2DM1 A;  4ZNX A;  2EGA A;  4A63 B;  2JT4 A;  1NEG A;  1TUD A;  2VVK A;  1NYF A;  5I22 A;  5FWC A;  3CQT A;  2A37 A;  4F14 A;  2O9S A;  4HVW A;  2CT3 A;  1XOV A;  1SHG A;  1UE9 A;  4KRT A;  1PHT A;  1X43 A;  1ARK A;  2EYW A;  1UHF A;  1WYX A;  2OI3 A;  3M0R A;  1NLP C;  4CC2 A;  3VS1 A;  4D8D A;  3EG1 A;  3I9Q A;  2GGR A;  2EVR A;  4ORZ A;  3UF4 A;  2DA9 A;  4K11 A;  2F2X A;  1V1C A;  2X3X D;  1VA7 A;  3H0I A;  5FW9 A;  1UJY A;  4OMP A;  1GL5 A;  1E6G A;  2YUP A;  2BZX A;  3SHW A;  2D1X A;  2JS2 A;  2AKL A;  1HJD A;  1WXU A;  2GTJ A;  4AG1 C;  4OMM A;  1ZUK A;  2DJQ A;  4AFS C;  2CUD A;  3ZL7 C;  3UAT A;  4JJB A;  2DL7 A;  3M0P A;  5HCK A;  2C0I A;  3PE0 A;  2KBT A;  4OMO A;  4JPB W;  3O5Z A;  1M8M A;  1T0H A;  4IIM A;  2DRM A;  5GJW B;  2O9V A;  3M0T A;  1SEM A;  2B86 A;  3U23 A;  1RUW A;  5IHI A;  1H8K A;  2DL4 A;  5L23 A;  2D0N A;  2GBQ A;  2FRW A;  4D8K A;  4J9H A;  3KFV A;  2HDA A;  1RLP C;  3PVL A;  1GCQ A;  2A36 A;  1AEY A;  2YDL A;  1B07 A;  2EGC A;  3JV3 A;  4RTZ A;  4LNP A;  3M0S A;  1YCS B;  2RQU A;  1AZG B;  4Z88 A;  1I1J A;  1WI7 A;  2AZV A;  2KT8 A;  2MCN A;  4J9F A;  1M27 C;  3M0U A;  2J6K A;  2KGT A;  3TSZ A;  2L2P A;  2MIO A;  2DRK A;  4EIK A;  2FG0 A;  3VS0 A;  3I35 A;  1UFF A;  2F2V A;  4X1V A;  1U5S A;  1M3C A;  1UGV A;  2P4R A;  1UUE A;  2DBK A;  1AOJ A;  3H0F A;  1VYV A;  2ECZ A;  2LX7 A;  2HEQ A;  1PKT A;  4HVU A;  1WLP B;  2CT4 A;  1JO8 A;  1ZX6 A;  4HXJ A;  3EG0 A;  1PWT A;  1S1N A;  2KXD A;  4RTT A;  5FWB A;  2ROL A;  2FRY A;  1FYN A;  2KNB B;  2J06 A;  4JZ3 A;  2ESW A;  4FSS A;  2M51 A;  2DL5 A;  2YT6 A;  4J9D A;  3GBQ A;  1WIE A;  2LCS A;  1WDX A;  2V1Q A;  3A98 A;  2PTK A;  2ED1 A;  1GFC A;  3H41 A;  3VS4 A;  4AFU C;  2RQV A;  2A28 A;  2EYZ A;  2J6F A;  3VRZ A;  2EQI A;  3VS7 A;  2FPF A;  2ENM A;  1JXM A;  1W70 A;  2E5K A;  1GBQ A;  2RMO A;  1UJ0 A;  1ZBJ A;  1CKA A;  2CH4 A;  5I11 A;  5IHK A;  2KRN A;  4J9G A;  3UA6 A;  4J9E A;  1H92 A;  1WXB A;  1TG0 A;  4RTX A;  1I0C A;  3EG2 A;  2LQN A;  1WFW A;  2HSP A;  2OAW A;  3NHN A;  1WX6 A;  2GNC A;  1K0X A;  1X6G A;  1PKS A;  5IXF A;  2PNI A;  1AWJ A;  1Z9Q A;  1K4U S;  2L3P A;  2XMF A;  2CUB A;  4Y92 A;  1JEG A;  4HVV A;  2LJ3 A;  2EGE A;  3NGP A;  2I0N A;  4LN2 A;  4Z8A A;  3M0Q A;  4WCI A;  4RUG A;  3VS2 A;  2K6D A;  2KRS A;  1T3S A;  1I07 A;  1K1Z A;  1AD5 A;  2JM8 A;  3NMZ C;  2YSQ A;  2KT1 A;  2SRC A;  3QWX X;  3THK A;  3PVQ A;  1VYU A;  3REB B;  1VYT A;  4F16 A;  2K3B A;  4F17 A;  1AWX A;  2V1R A;  1MV3 A;  2CDT A;  5GJV B;  1HD3 A;  1NLO C;  1UHC A;  1OPK A;  4IIO A;  1SRM A;  2GQI A;  2AKK A;  1N5Z A;  1RLQ C;  1BK2 A;  4DEX A;  1YWP A;  2JM9 A;  4CC4 B;  1M3B A;  1GRI A;  2RPN A;  1HSQ A;  2NWM A;  3FJ5 A;  2JMA A;  2JS0 A;  1OOT A;  2D8H A;  1FMK A;  1AVZ C;  4QT7 A;  4J9C A;  2LJ0 A;  2KYM A;  2FPD A;  2K79 A;  1YN8 A;  3SEM A;  1KIK A;  1SHF A;  3NPF A;  2CSQ A;  4DEY A;  1CKB A;  1AZE A;  1X69 A;  3REA B;  2FEI A;  1GBR A;  1A0N B;  4E6R A;  4LUD A;  2O31 A;  3I5R A;  4J9B A;  3R6N A;  2RQT A;  2LZ6 B;  1MUZ A;  2EKH A;  2CRE A;  1AWW A;  2JXB A;  1GCQ C;  1NG2 A;  4AFQ C;  2RQR A;  3H0H A;  4JZ4 A;  1E7O A;  1ZUU A;  1BB9 A;  2RF0 A;  2J05 A;  2J6O A;  1KFZ A;  1UDL A;  3VS6 A;  1J3T A;  1BBZ A;  2JTE A;  2DVJ A;  4OML A;  4OMN A;  1UTI A;  3VRY A;  2YUQ A;  1SRL A;  2K7A A;  1U06 A;  2X3W D;  4RTV A;  1CSK A;  2W10 A;  1WA7 A;  1YP5 A;  1H3H A;  1E6H A;  2ABL A;  2G6F X;  2MOX A;  4JJC A;  3ULR B;  2BTT A;  2C0O A;  4ESR A;  2EBP A;  1K0S A;  1K9A A;  1M3A A;  2DL3 A;  1WXT A;  2FO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...