1WLPB

Solution structure of the p22phox-p47phox complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
138
structure length
138
Chain Sequence
b'GSDITGPIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytochrome b-245 light chain
molecule tags Oxidoreductase/signaling protein
source organism Homo sapiens
publication title NMR solution structure of the tandem Src homology 3 domains of p47phox complexed with a p22phox-derived proline-rich peptide
pubmed doi rcsb
total genus 14
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wlpB01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wlpB02
2X3WD 2CT3A 1K1ZA 2KYBA 4AFZC 1QCFA 2C0OA 1X43A 4IIOA 1M8MA 3I9QA 1AOJA 1AWOA 4Z8AA 4WCIA 4RTZA 1QWEA 2M51A 2EPDA 1OPKA 4RTYA 1AEYA 2LX7A 4JJBA 2O2OA 2W0ZA 1NYGA 1WI7A 2RN8A 4LUEA 1RUWA 2PNIA 1AWWA 2KT1A 4LE9A 3EGUA 3SHWA 2DL7A 3R6NA 3GBQA 2EVRA 4ZNXA 4DEYA 2ENMA 1PWTA 1RLQC 2DBKA 2SRCA 2L3PA 4CC4B 2OAWA 1JXMA 1JU5C 2LQNA 1B3QA 2D8HA 1HD3A 1GCQA 2CDTA 3RNJA 3THKA 2V1RA 1MV0B 2V1QA 2DE0X 2RQUA 5HCKA 2P4RA 2JW4A 3REAB 2IIMA 1SSHA 2YSQA 3NPFA 3A98A 2C0IA 2FPDA 1PRLC 2DRMA 2D0NA 4JPBW 2J6OA 2AKKA 1WYXA 1Y0MA 4OMPA 2KRMA 2BZYA 2YUOA 4X1VA 2KNBB 1YN8A 2ED0A 4AFQC 4Z88A 1X2KA 1UHFA 2DNUA 1OV3A 2YUQA 3VRZA 2JT4A 4F16A 2A28A 3EG0A 4J9FA 2FPEA 4RTVA 3EG3A 2DILA 2M0YA 4HVUA 2RQTA 1NG2A 2L0AA 1KIKA 2D1XA 2KRSA 2MIOA 2ED1A 3ULRB 1PKTA 2MOXA 2AZSA 4CC2A 2DF6A 3U23A 2EYXA 3FJ5A 2ROTA 4CC3A 2JM8A 2XMFA 3PVQA 1WFWA 2JMCA 2K79A 3UF4A 4RTTA 1PNJA 5GJWB 4D8KA 1BB9A 4HVWA 2CH4A 2HBWA 5ECAA 1ABOA 3NHNA 1I07A 2KBTA 2DJQA 2QDLA 2LCSA 1M30A 3I5SA 2KR3A 1T3LA 1UG1A 2A08A 1YWPA 1A0NB 3JV3A 2RQRA 2VVKA 1UTIA 2CUBA 2DL5A 2F2XA 1PHTA 1SHGA 3VRYA 2GTJA 1G83A 2D8JA 4FSSA 3EG1A 1Z9ZA 2DLPA 1K0SA 1W70A 2CSIA 3VS0A 1TUCA 5EC7A 2JTEA 4A63B 1JXOA 1NM7A 1UJ0A 2C0TA 1RLPC 1GFDA 2KYMA 2ECZA 2DVJA 2O9VA 4JJDA 1WIEA 5IXFA 2KROA 2LJ0A 1OEBA 1VYUA 4ESRA 2RPNA 3EG2A 4LN2A 2B86A 2RQVA 3UA7A 3EHRA 2GGRA 3M0SA 1N5ZA 3LH5A 4Y92A 1J3TA 1K0XA 3QWYA 1BK2A 5FWCA 1M3AA 1W6XA 1WX6A 4AFSC 1ZUKA 1NLPC 2NUZA 1JEGA 1H92A 4AG1C 2J6FA 1HJDA 2LJ1A 2EGEA 1UJYA 4OMOA 3VS4A 2EBPA 1EFNA 2K9GA 3VS7A 1X6GA 1PKSA 4F17A 5IHNA 1AD5A 2GTOA 1M3BA 5IH2A 1MUZA 1ZLMA 2VKNA 1E6HA 1GRIA 2KXCA 1GFCA 3TVTA 4JZ4A 2FRWA 2RMOA 3SEMA 1W1FA 1E6GA 1QKWA 1B07A 1AWXA 2DMOA 1K9AA 2K7AA 4OMMA 2A36A 2CT4A 2DYBA 3C0CA 1CKBA 2VWFA 1K76A 3EHQA 4J9CA 1X69A 2JMAA 2LNHB 1WLPB 2I0NA 1WXUA 1NYFA 1KFZA 2L2PA 4J9GA 1UUEA 2O9SA 3M0RA 1BU1A 3PE0A 4OMNA 3VS1A 2DL4A 2PZ1A 2RF0A 4Z89A 1E7OA 3H0IA 4RTUA 2RQWA 5I22A 1SPKA 1G2BA 1NEGA 2HDAA 2X3XD 1Y57A 4LNPA 2CUDA 4GLMA 2O31A 2ROLA 1GBQA 2A37A 2BZXA 3QWXX 1SEMA 2O88A 1S1NA 3H41A 1SRLA 1IO6A 2DL3A 2LMJA 3I5RA 2EGAA 1KJWA 4HXJA 2KXDA 3KFVA 2J05A 1U5SA 2LQWA 1XOVA 5FWBA 1UGVA 2EYZA 4DEXA 2BTTA 1AZGB 1YCSB 1QWFA 3ZL7C 1KSWA 1YWOA 1UFFA 2GBQA 4OMQA 1X6BA 2GNCA 3VS5A 1TUDA 3TSWA 2AKLA 1GBRA 2ESWA 2KT8A 2FG0A 4LUDA 1H8KA 1H3HA 5I11A 2LZ6B 2G6FX 2F2VA 1T0JA 5GJVB 1LCKA 2HSPA 2CSQA 2K6DA 2DL8A 2H8HA 2DX1A 2KE9A 4J9IA 1Z9QA 2BZ8A 4J9EA 1OPLA 4RTXA 1ZUUA 2ABLA 2K2MA 3NGPA 2YT6A 2GQIA 3VS6A 1VA7A 2AK5A 2AZVA 1GL5A 2CH4W 2KEAA 2OI3A 1CKAA 3H0HA 4F14A 4KRTA 4E6RA 1VYTA 1PRMC 1I1JA 2DM1A 3I35A 2EW3A 2KGTA 2CREA 2J06A 2JS2A 4R0KA 3TSZA 2F2WA 5IHKA 3CQTA 3PVLA 1U3OA 2YDLA 1X2QA 1AVZC 3VS3A 1ZX6A 4AG2C 1UHCA 1SHFA 2J7IA 4CC7A 1WDXA 3UATA 2EGCA 5IXBA 1SRMA 4EIKA 1YP5A 1ZUYA 4OMLA 1VYVA 1OOTA 1RI9A 1MV3A 1X27A 1NEBA 1NLOC 1T3SA 1V1CA 1JQQA 4J9DA 2J6KA 3VS2A 1WXTA 5IHIA 2PTKA 2W10A 4GBQA 1WXBA 4HVVA 3UA6A 2E5KA 4QT7A 1U06A 2SEMA 1ARKA 2FRYA 1BBZA 2LP5A 1AWJA 1AZEA 4K11A 2L3QA 3REBB 1K4US 5L23A 2HCKA 1ABQA 3M0PA 2FEIA 4JZ3A 1WA7A 4HCKA 2YUNA 2DRKA 5FW9A 2DA9A 3O5ZA 2HEQA 2YUPA 2K3BA 1CSKA 1GCQC 4J9HA 3NMZC 4RUGA 1ZSGA 4RTWA 2KRNA 2DBMA 1UDLA 1QKXA 2JXBA 3RBBB 1T0HA 1JO8A 2JM9A 1FYNA 1QLYA 1GCPA 2RNAA 2OJ2A 3M0QA 3M0TA 2EKHA 1ZBJA 2FPFA 4IIMA 4M4ZA 1YNZA 4D8DA 2EYYA 2EYWA 1I0CA 2LJ3A 1TG0A 2JS0A 2EQIA 1M3CA 4J9BA 1UE9A 3H0FA 3IQLA 4AFUC 1FMKA 1HSQA 2MCNA 1UECA 4ORZA 3M0UA 2L3SA 1M27C 2FO0A 4JJCA 2NWMA
chains in the Genus database with same CATH superfamily
5GAN5 2EQUA 2X3WD 2CT3A 1X43A 1M8MA 3I9QA 1AOJA 3QJ6A 3H9NA 4Z8AA 2KVQG 3OYDA 5CKFA 2M51A 3S6WA 4M77F 1AEYA 4JJBA 2W0ZA 5KCHA 5LJ5d 1RUWA 1HYOA 1VQ4T 1SKUB 3GLXA 2PNIA 1AWWA 2MWOA 4LE9A 4XTVA 2NLUA 4C0DC 3EGUA 3FIFA 1Q82R 3GBQA 2L5QA 4J7IA 1I81A 4PJLA 1PWTA 1RLQC 3HFNA 2DBKA 2HQEA 2LQNA 2YXYA 2CDTA 3G6EQ 1VQ6A 3CC7T 4CI0C 5HCKA 3G71A 3OB9A 3REAB 2IIMA 3DKMA 4N4GA 3P8HA 1QW1A 2FPDA 4Z02A 1Q81U 3EFOA 3JSCA 1JB0E 4M7AA 2J6OA 1Y0MA 2K3XA 2DK3A 2E64A 1BKBA 1UB4A 3OYHA 1K9MU 2IPOB 3V8LA 1BI0A 1KC8R 4Z88A 1UHFA 4KGVB 1VQMA 4F16A 4JS4A 1VOMA 4J9FA 2FPEA 4OGEA 4HVUA 1VQ9Q 1M4ZA 4C8QF 5DLOA 2D1XA 2KRSA 2FL7A 4MZMA 1D1AA 2M02A 2VB6A 4X34A 5GAN7 3JB9I 1Q82U 5CKBA 3FJ5A 3JCMh 2QQBA 4KT0E 3PVQA 2K79A 1VQ4Q 1RAHB 3DLMA 1PNJA 2HAXA 4HVWA 3I55Q 1QP3A 5ECAA 2ZPFB 3A8GB 4XTYA 1ABOA 3V7CA 1Y7XA 5CVIA 3C4SA 2EQJA 2QG9B 3I5SA 4MZPA 4JRQA 1NZ9A 5DM7R 3JV3A 5KYYB 4A4KA 1UTIA 2CUBA 3DB3A 2NUTA 1SHGA 4NL2A 1G83A 2D8JA 3EG1A 4RKUE 4C5HA 2LNVA 2WSEE 2HL3A 2YRDA 2CSIA 4KGXB 1TUCA 4FW1A 1TXQA 2E10A 1QVGS 8ATCB 1GFDA 2L8DA 2RK2A 5IT9E 3SD4A 5FLXE 4IURA 2LJ0A 3RKYA 1OEBA 1RL2A 2B86A 2RQVA 4A53A 2A0FB 3P8BB 5KH6A 4ZGEB 5GANe 5KYUB 2NUZA 3CCEA 1JEGA 3CCRA 3CMEA 3OYIA 3ASKA 4C92G 5LJ3e 3BDLA 4EMGA 2JVVA 1UJYA 3CD6Q 3CCQT 3HPWA 1EFNA 2LX9A 3OMGA 2EJFA 1OI1A 3EH1A 1IRXA 3TQ7P 1MUZA 2VKNA 1Q7YC 4LDUA 4C5GA 4OB0B 1BYMA 1UGPB 3SEMA 2QQAA 3P8DA 1AWXA 2K7AA 2PUKB 4OMMA 1VQ5T 3A8OB 1VQLA 3JCMP 1XNIA 1MMAA 4PJMA 4KULA 1CKBA 1K76A 2X35A 2EIFA 3CCJT 4J9CA 1X69A 3GNGA 5A0GA 4ANJA 4TVRA 2I0NA 1NYFA 3KBGA 3OQ5A 4E7ZA 1PG5B 2L2PA 2KSSA 2M16A 2MK5A 4J9GA 1UUEA 1VQNT 2O9SA 4OMNA 3VS1A 2LDMA 2X4WA 4Z89A 1RACB 3BDUA 4DOWA 5GAOp 1B7TA 3META 2IG0A 2RQWA 1G2BA 3BE3A 4BY6B 4LNPA 3GNFB 4M7AF 1D0ZA 4KH1B 4ZTFA 2GFUA 5CKDA 3HRUA 2OX7A 4B9WA 3I56Q 3QWXX 3URGA 4X9DA 4N4HA 3UDCA 1S1NA 4Y91A 4JJNK 2OTLA 2EGAA 4HXJA 3KFVA 2J05A 3G4SA 1U5SA 1XOVA 5FWBA 2BTTA 2LVMA 3H6ZA 1OX9A 3LYIA 1MHNA 4M7DB 1ZHIA 5KYXA 1X6BA 2GNCA 3EGXB 2JJ9A 4GY5A 2DETA 4NL3A 2DO3A 1GBRA 3OYMA 4F7UB 2GFAA 3G71T 2LZ6B 4B6MA 2QA4Q 3VJPA 1YJNQ 3QG1A 5J39A 1OQKA 2HSPA 2DIGA 1YJWA 3V8KA 3DB4A 3M4YA 1YJWQ 1KQSS 4M75A 2BZ8A 5D7UA 4J9EA 2RI2A 1TUGB 1VIEA 3VUZA 2K2MA 3PFSA 1YITA 4M78E 4HCCA 1VQPA 4BI3A 2A7YA 4C92A 1VQMT 2AZVA 4A4HA 5HK0A 3OW2A 1MMGA 1CKAA 4F14A 2BIVA 4KBMB 2LQ8A 3A8LB 3E9GA 3SDZA 2HKNA 1VIFA 1G3SA 2E4HA 2DM1A 4MDWA 3QDFA 4XTXA 3CCMQ 3L2QA 1LNXA 3M59A 2DZCA 2F2WA 5KCOA 3FEOA 3TREA 1VQKQ 1QVFS 3EGDA 3I55A 3CBMA 2E12A 4RMOA 2DZ9A 1JJ2P 1BI2A 1G3TA 2EGCA 2DJZA 4QQDA 4F7UG 5GAOl 1QVFP 1QCNA 3S3OA 1QVGA 1U1SA 4J83A 3FRNA 4EIKA 4OMLA 1YJ9T 3CCLT 2DEQA 1RI9A 1K73C 1NEBA 2COYA 1NLOC 1WGSA 4X9CA 4J9DA 1YHQQ 1WXBA 4HVVA 2RJFA 2E5KA 3HTRA 4QT7A 4IUUA 2E3IA 5AT1B 1Q95G 2HD0A 3J7AF 3JB9G 4MMKA 1BBZA 3CC4A 4FYYB 4MMLA 4A54A 1S72T 5CO7A 2MI6A 4AT1B 2BUDA 2D9TA 3ZFJA 1K9MC 2K5IA 4BD3A 1KQ2A 4C92C 1KK7A 2FEIA 3L2WA 3EG9A 2DRKA 1C0MA 1IZ6A 5GANg 1IHVA 2EQKA 1YFNA 1GCQC 2D0QB 4C0GA 4M7AD 1VQOQ 2KQWA 1WHMA 1ZSGA 2JNGA 1QKXA 2JM9A 5DY9A 1FYNA 5LJ3h 3R6OA 1QVPA 2JOYA 4N0AA 1GCPA 3QIIA 2RNAA 3M0QA 2FPFA 1ZBJA 4CRIA 2QEXQ 4M4ZA 1Q7YR 2XG8D 5FRMA 1YNZA 4E7HA 1WJQA 1YITT 1D0YA 1I0CA 2LJ3A 3UT1A 1TG0A 3I56A 1SG5A 1M3CA 1UE9A 3H0FA 4M7AC 1G3YA 2CP7A 4LDVA 4ORZA 5I2SA 4JJCA 2JTFA 3RKWA 2NWMA 3QBYA 2FZGB 5GANj 1XJWB 3JCMd 1WJSA 2MWPA 4AFZC 1VUBA 1QCFA 1SF9A 4HT9A 3X20B 3AHUA 3J80E 2HQXA 5KYWA 2EPDA 2QTXA 5LJ5h 4BI4A 4RTYA 2XK0A 3PGGA 4M75C 1WI7A 1I4K1 2RN8A 4LUEA 4ZN3A 2KT1A 2Y90A 2DL7A 3OMCA 1R0CB 2BKDN 4ZNXA 4DEYA 4F7UE 2SRCA 1KQSA 4CC4B 5LJ3f 1JXMA 4C8QD 4C8QA 2D8HA 1VQ7Q 3THKA 2V1RA 4PJOG 1MV0B 4JRIA 2RQUA 1VQ6Q 1PD1A 3OYBA 1H3ZA 2HZYA 1SSHA 5AYFA 5GAOn 5FROA 3A98A 3E1SA 2VASA 1MNEA 2DRMA 4P5NA 3PIPA 5GMKe 5EG2A 2CZ1B 2MYSA 4M77G 1VQ7T 2DIQA 1VQKT 1BIBA 3CCVT 4X1VA 4M77A 2KNBB 3QXEB 3VU3C 3MEUA 4J7FA 2E41A 3H8ZA 3QYHB 3JB9H 1M9SA 2DNUA 3VRZA 3VUBA 3EG0A 3OW2P 1K8AR 4RTVA 1VQPT 2DILA 2CZ0B 2M0YA 3MEVA 1Y96B 2PVOB 2MIOA 2JZ2A 3ULRB 3X24B 1BCOA 2MOXA 3CC4Q 2M9UA 3U23A 5J26A 1KQSP 2ROTA 2XMFA 2E5QA 2JMCA 2LCCA 5D6YA 2CH4A 2HBWA 4FSXA 3NHNA 2E6NA 1I07A 3UWNA 1M30A 2FHDA 2ZPBB 1YITQ 4ZGJB 2A08A 1X6OA 2CP5A 2ZAEA 2GQVA 2XDBA 2KDSA 1A0NB 2DL5A 1QMCA 2KY9A 1YIJT 2GTJA 2VXEA 2DXBA 3X28B 5EC7A 1Q81R 2JTEA 4A63B 5GANd 2HBPA 6AT1B 2KYMA 4OP0A 2BE9B 3T9NA 4C8QG 1KHCA 1VYUA 2RPNA 3UA7A 1X75C 3LH5A 1UGQB 1LPLA 3JCMQ 1M3AA 3MO8A 2DAQA 2Y4YA 3HP9A 4M75D 2COWA 2EYQA 4NS5A 3SWNB 2LJ1A 3SWNC 3OYFA 2CZ6B 1JBMA 1N6AA 1FXXA 4F17A 4HCBA 4E2FB 5IHNA 1AD5A 5CIUA 2XI9A 5IH2A 1VQ5Q 1E6HA 2RM4A 1PC0A 1GRIA 1RABB 4XU2A 1OZ3A 2V8JA 3QSUA 2K2VA 1W1FA 1E6GA 1QKWA 3E9FA 3CCSQ 2DMOA 2DD4A 3EGXA 3HL8A 2YHTA 2P0KA 3C0CA 3KUFA 3CPWP 4IUTA 1VQLQ 1JJ2A 4PFPA 3PMIA 2JMAA 3JCMV 3M57A 3M53A 4PNOA 5CAIA 2XDDA 1QVGP 4BY6C 2DTOA 3MJXA 2RF0A 3OYYA 2NYSA 3CBOA 4C92F 4J6XA 5I22A 4ZN1A 4LD6A 4R56A 1NEGA 2HDAA 3LGFA 2RJEA 2CUDA 4M7DE 3BFMA 2BZXA 5GAMd 1TS9A 2HMAA 4E7SA 1AHJB 2P0QA 2O88A 3MP1A 3F70A 3I5RA 2KXDA 2HSEB 2LQWA 5FU7B 1UGVA 1EIFA 1AZGB 3I56T 1YCSB 2ZPIB 3G71Q 3A1PA 3ZL7C 1UFFA 1O75A 5KE2A 4BE1A 5HKCA 4DQ2A 2YLBA 2G6FX 1T0JA 5M9OA 4PFZA 1C1AA 2QYZA 4OB1B 2CSQA 1ZA2B 2VXFA 2PUOB 1VQLT 4MDXA 4J9IA 1Z9QA 1M1GA 1U8RA 1NPRA 3HKSA 1ZUUA 5GAMh 2GQIA 2DVEA 2PVDB 1KC8U 3PMTA 4M75G 3MPUB 1FX7A 3QJYA 3OYNA 5DLQE 1IXDA 3CPFA 4FCYA 3QZ5B 3QHSA 3RDVA 3LLRA 3M5AA 4E6RA 2F69A 1UEBA 1I1JA 4IUQA 5D6WA 2G3RA 2NUPB 2CREA 4J6YA 3CMAQ 2X4YA 4EMKA 4N0AC 2RB6A 3QDRB 1IREB 4VUBA 1I8FA 1AVZC 1SHFA 2J7IA 4JLIA 1IHWA 3EH2A 3UATA 1D09B 3CC2A 3KXTA 5IXBA 1SRMA 2CP3A 3L42A 3VV0A 1YP5A 2DXUA 3LW5E 4L6V5 4FYXB 1X27A 1T3SA 1R77A 3JRZA 2QGFB 3VS2A 1W2BS 1WXTA 5IHIA 3G6ET 3MEWA 4GBQA 4BI8B 3BW1A 2AIRB 1ARKA 5KYXB 2LP5A 2CYZB 4M78F 3WXMB 4PJOA 3REBB 1K4US 2DFUA 5LJ3g 3FDRA 2B8AA 1WA7A 4HCKA 2L89A 5FW9A 3M4GA 3O5ZA 4HA8A 3CMEQ 4M7DF 2HEQA 2RH2A 3NFCA 4J9HA 3GOXA 3CC4T 1D0XA 1N8RR 4RTWA 2DBMA 1KQ1A 3OYAA 3HRSA 1T0HA 3CCST 2OTJQ 4EPCA 5IAYA 5LL6S 2FB7A 4DBQA 1RAFB 5C0MA 4RCCA 3S3MA 4M7AB 3GPLA 4A4FA 3INZA 5LJ5e 1VQ9T 1Q86C 3M0TA 4IIMA 1B34A 1OX8A 4DBFA 2JS0A 1EX4A 1JRIA 2AHJB 2OTLQ 4JS5A 3M0UA 2QGGA 2OAUA 2LT1A 1I5OB 2QASA 1RAGB 4C0FA 1WJRA 5GAN3 2EAYA 2RK1A 1K1ZA 2C0OA 4IIOA 1AWOA 1PSFA 3FC3A 4E7KA 1K8AC 3PTAA 5GAOm 5GAOr 1NYGA 4EMKB 4KUIA 3L2ZA 4M77E 3SHWA 3R6NA 5I2MA 4BDZA 2EVRA 2ENMA 4LD9K 1ZA1B 1B3QA 3EFSA 4C0ZA 4OVAA 1ZSZA 3PIOA 1TOVA 1GCQA 1YIJQ 3G6EA 1M1KC 2V1QA 2DE0X 1U1TA 2P4RA 3UPUA 1G3WA 2LC4A 4PJOE 2NUTB 1K73U 2CP6A 4QVZA 4JRKA 2BE7D 3OS0A 4HT8A 2YSQA 2CGHA 3V7RA 3CCUT 2WSCE 3CCMA 4M78C 2C0IA 3CMAA 1FMWA 3E19A 4C8QE 4BACA 4JPBW 4PLLA 2ZPGB 1WYXA 4OMPA 2KRMA 1NE8A 1RAAB 2DKGA 2YUOA 2YWWA 3OBYA 3OA6A 3JCMe 2ED0A 2VUBA 3RESA 3ZEHA 7AT1B 1X2KA 1RADB 4GLKA 1QQJA 2YUQA 2JT4A 3JCMX 1N9RA 3OS5A 2M0OA 2DD5A 2RQTA 4M7DC 3VYHB 3CCVA 5CR2A 2PQWA 1JJ2S 4ATOA 1PKTA 5CK9A 1VQOT 3OS2A 2LCLA 1RAIB 1EZZB 3OW2S 4CC3A 2JM8A 2RI3A 4EMHA 4RG2A 1WFWA 2X4JA 4RTTA 4D8KA 4C8QB 4FYVB 3CC2Q 3CCLQ 4KH0B 5IN1A 2KBTA 2DJQA 2QDLA 2KR3A 1T3LA 2FZKB 4BE2A 1IGUA 1UG1A 4FYWB 3CCJA 2RQRA 2PU9B 1YHQA 1PHTA 3OSVA 3OYCA 4IKFA 4XTZA 4FSSA 5LJ3d 2DLPA 1K0SA 4QQ6A 3N5BB 3L2VA 1W70A 1WQ7A 3CBPA 5GMKh 1N9SA 2QQRA 1JXOA 3C12A 1O9SA 1UJ0A 2C0TA 1Y71A 3FJPA 2O9VA 2DVJA 4JJDA 5IXFA 2KROA 4ESRA 3CXCP 4J8OA 4QW2A 4LN2A 3EG2A 1QVFA 2OTJT 3EHRA 3M0SA 1N5ZA 4PLIA 4Y92A 1VQ8A 1J3TA 3QWYA 4OB2B 4OMFB 1TU0B 5FWCA 3C94A 1WX6A 1VQOA 3CCUA 4JLGA 1NLPC 1KD1R 1W2BP 1H92A 5GMKi 3A8HB 4M7DA 3VYGA 2EGEA 4ZTJA 4OMOA 3VS4A 2EBPA 2K9GA 3VS7A 2WACA 2CS7A 4ME7A 1SSFA 3V8JA 2E6ZA 2QEXA 2X51A 3EAEA 3C95A 1TH7A 1ZLMA 1Q86R 2DXTA 3RMQA 1GFCA 4XQ3A 3RERA 3TVTA 2FRWA 4J6WA 4M77B 4PK4A 4DA4A 3A5ZB 1B07A 2PVGB 1M90R 2A36A 3QKJA 1YIJA 1M90C 2H3EB 2DYBA 4M75E 2P0PA 3EHQA 4JUVA 3LH0A 1YJNT 2LNHB 4C92B 1WXUA 5CCAA 2K3YA 1YI2T 3L1AA 1D1CA 2CKKA 4M78D 1BU1A 3PE0A 2XICA 3GIBA 2OTJA 2F5TX 2ZZDA 4Y28E 4J5YA 3BY7A 4O6JA 1SPKA 1VQ5A 2VYTA 1M8VA 2E1HA 1Y57A 2CP2A 3G7ZA 2NUPA 4GLMA 2ROLA 1GBQA 2KAFA 1X01A 2A37A 4EMKC 2DPPB 1TWBA 1SEMA 4IUVA 1SRLA 1IO6A 2DL3A 1H641 1KHIA 2LT4A 5FU6C 1YJ9Q 2P84A 2LRQA 1KSWA 1YWOA 2GBQA 2XDPA 2EFIA 1TUDA 1K73R 4C92E 2RI5A 3TSWA 2VGNA 1VQNQ 1NBEB 5GAMg 2KT8A 1B34B 1AT1B 4KGZB 1H8KA 1Q86U 3EFRA 3GP8A 2F2VA 2XU8A 1LCKA 3CCQQ 3G1JA 3CD6T 3CCMT 2H8HA 1M5Q1 3G4ST 2KE9A 1WHKA 3M58A 2O4XA 2P4TA 4RTXA 2ABLA 1TSFA 3VS6A 1VA7A 1BIAA 5HY6A 3O8VA 1GL5A 3OYEA 2OI3A 1KD1U 3H0HA 4LXCA 1LJOA 4KRTA 1K8AU 5GANh 1PRMC 2YLCA 1LOJA 2EW3A 2JUFA 2KGTA 4ZGDB 3MP8A 1WZOA 4XTWA 2J06A 3NTHA 3JB9D 1XTDA 4R0KA 3TSZA 5IHKA 2QA4A 2ZCFB 3HHTB 4RCBA 2GCXA 4FW2A 4C5IA 2HL5C 2YDLA 1RI0A 1X2QA 4XAXB 3VS3A 1ZX6A 4AG2C 2EJ9A 9ATCB 1UHCA 2RHIA 1WDXA 2EQMA 5CKHA 2D6FA 5LJ3j 2KI7A 4PKCC 5GAMj 4WTOB 2K4YA 4FL6A 2K57A 3I55T 1VYVA 1OOTA 5A0DA 3JB9J 4MZTA 2MF2A 4FU6A 3E2UA 1OYXA 4DOVA 2PTKA 2EKOA 2Y4XA 3JCMb 4E7LA 1Q81C 1DJ7B 4UC4A 1AWJA 1OU9A 4XK8E 1AZEA 4K11A 4OF1A 3HRTA 1VQ4A 1YCYA 2AT1B 1R0BG 1NJIU 5L23A 2E70A 5A0LA 3CCLA 5L8RE 4DBHA 4AMCA 1ABQA 3M0PA 4Q5WA 4PJNA 2DA9A 2K3BA 4E47A 1CSKA 3CCJQ 3D7SB 4RUGA 2X4XA 2VV5A 3CCRQ 1NPPA 5LJ5j 1UDLA 2XKOC 3Q1JA 1XQHA 3JAME 1QLYA 3OS1A 3M55A 3RUXA 3OYGA 5KYUA 2OJ2A 2F5KA 1FMVA 1PM3A 3JCMc 3IQLA 1VQ7A 1FMKA 4HCZA 2MCNA 1UECA 4O5VA 3CCSA 3X25B 2L3SA 1M27C 2FZCB 4II1A 1OZ2A 2V26A 3LWHA 1KC8C 4M77C 2KYBA 3CCEQ 3CCRT 4XU3A 4WCIA 4RTZA 1QWEA 2IVWA 1M1FA 1OPKA 2DYIA 2CZ7B 3ER0A 4A4EA 8AT1B 2LX7A 2O2OA 3MP6A 3S3NA 5LJ5f 3CC7A 4BE0A 3L2RA 1S72A 3CC7Q 3RKXA 4B9XA 5KYYA 4M75F 1MMDA 2L3PA 2OAWA 1JU5C 2WSFE 3PNWC 4NOYA 1HD3A 3CEYA 2CP0A 3RNJA 1D1BA 1OULA 3NTIA 2MMPA 2JTMA 1YJ9A 2RJCA 2K5FA 2JW4A 2DXCA 2LQKA 3CMET 1ZBXA 1ZSZB 1VQ9A 2M1HA 1KG1A 3NPFA 4LDYA 1PRLC 4IUPA 4QVDA 1C6VX 3LGLA 2D0NA 4PJOB 4OGCA 1WQWA 1YBYA 2AKKA 2R5AA 1P92A 2BZYA 4N4IA 1D3BB 3OSSC 3M56A 3MHXA 2DTIA 3X26B 4FIBA 3MEAA 2R57A 3MKDA 1K9MR 1YN8A 4F04B 4M7AG 4AFQC 4PJOD 1VQ6T 1WNLA 4C0DB 1OV3A 2A28A 2QQ9A 1N8RU 3EG3A 3LWIA 4WF2A 1NG2A 2L0AA 3QPHA 4M78G 2RHYA 1KIKA 5FRNA 2XD0A 3CCET 2ED1A 1VQKA 2AZSA 4CC2A 4V2SA 3SFMA 2DF6A 2EYXA 5FU7C 2XIDA 1YJNA 1QCOA 3CCQA 1NJIR 2R58A 3UF4A 3OYLA 3ME9A 5GJWB 3V7SA 1BB9A 3OY9A 3CMAT 2GF7A 3NTKA 1W4SA 5GANf 2FYKA 3OYKA 2LCSA 5CQXA 1YWPA 2DERA 1MNDA 4E7IA 2VVKA 3JCMf 1M2VB 2F2XA 1N27A 1R8OB 4PL6A 3VRYA 2RHXA 2HKQB 5HK3A 2O01E 4F7UA 1Z9ZA 3VS0A 3TCJA 2QTVA 2Z0WA 4ELZC 3L2UA 1NM7A 4PJOF 1PD0A 1RLPC 2QEXT 2ECZA 2RA2A 1WIEA 3FB9A 2VGMA 2ATCB 1HXDA 4D6WA 5CKEA 5GAMf 2YRVA 2ZGWA 2V8IA 2GGRA 3QO3A 1K0XA 1BK2A 1M1KU 1W6XA 2HQHA 4AFSC 4OB3B 2E65A 1ZUKA 2RO0A 1KD1C 2L3RA 3LX7A 1VQ8T 4AG1C 1V76A 2J6FA 2QDYB 3CD6A 1HJDA 1ZQ1A 1YI2Q 4F7UF 4M78B 4FT2A 1M2OA 3OBWA 1X6GA 1BI1A 1IB8A 2E3HA 2LTOA 5KYWB 1PKSA 1TTHB 3M54A 2GTOA 1M3BA 3HFOA 1S72Q 2QXFA 2KXCA 3HSBA 5J3BA 1FWZA 4JZ4A 2RMOA 5KE3A 1K9AA 5A2QE 2CT4A 1YHQT 1PCXA 2VWFA 4FM4B 4XTUA 1WLPB 4A4GA 4M78A 1MGQA 1KFZA 1G8XA 3EFOB 2DTHA 3M0RA 2ZPEB 2DL4A 1UGRB 2PZ1A 3RIRA 2EJGA 2COZA 1E7OA 3H0IA 1Q82C 4RTUA 2MPXC 3QZ9B 3CXCS 5GAN2 2X3XD 2QQSA 4YTLA 1BCMA 5FU6B 1M2VA 3JCMJ 1UGSB 2O31A 1NJIC 2HNIA 4BUGA 1ACMB 2RD1A 1WHGA 3RMSA 3H41A 1F1BB 3G4SQ 1M1KR 2LMJA 5KYNA 1KJWA 2O4XB 3GF5A 2EYZA 3SWNA 4DEXA 2DEUA 1QWFA 1VQMQ 4LDXA 3JCMg 4E7JA 4OMQA 2KK4A 3VS5A 2RJDA 4KUDK 2QAZA 2AKLA 2ZPHB 2ESWA 2H3JA 2FG0A 4LUDA 1YJWT 5GAN6 4M7DG 1H3HA 5I11A 2FVUA 4BDYA 5GJVB 2QK0A 4L59A 2K6DA 1RAEB 2QA4T 2DL8A 5GAMe 2DX1A 2A3LA 1OU8A 5GAN8 2RHUA 3ZBDA 1OPLA 3AT1B 4PJOC 2RHZA 3NGPA 3J81E 2YT6A 3JCMW 4JRPA 2K5LA 2AK5A 2F1LA 4C92D 4C5EA 2MAMA 2CH4W 4PJJA 2KEAA 2QI2A 3TEEA 1ZSZC 4PFOA 3JB9F 2VC8A 4L5GA 1VYTA 3EG9B 3SB2A 1WHJA 1VQNA 3I35A 3QYGB 5LJ5g 3PT9A 4M7DD 1GXIE 2JS2A 1BI3A 1WPYA 3CQTA 3PVLA 4FT4A 5GAN4 4M75B 1U3OA 4R55A 4EDUA 1Q7YU 2C06A 2V8KA 4CC7A 3DLLA 1I5LA 3VKIA 1M90U 3CCUQ 1VQPQ 1ZUYA 1WHLA 2KMTA 4QVCA 2YRCA 1MV3A 4QQGA 5C6SA 1V1CA 1JQQA 3RR6A 2J6KA 4RG8A 1MMNA 4M7AE 2W10A 2XHCA 4QKUA 4LDWA 2X9HA 3UA6A 5CQYA 1U06A 2SEMA 3MCAB 3CCVQ 3QUIA 2FRYA 1D3BA 2JN0A 3EGDB 4HKEA 2L3QA 4ELYC 5GMKj 3A8MB 3WVEB 4BB7A 2EWNA 4XU0A 4M77D 2HCKA 1Y07A 1V29B 4JZ3A 5GMKm 2YUNA 4C8QC 4JDSA 3OYJA 2YUPA 5D6XA 1YI2A 3NMZC 5I21A 1WHHA 2R5MA 1W2BA 1N8RC 2KRNA 2JXBA 3RBBB 1QP2A 5GAOq 4XU1A 1IGQA 1JO8A 3TU4K 2I2LA 1G5VA 2OTLT 1PSEA 2EKHA 3WVDB 3CXCA 4D8DA 5GMKl 2EYYA 2EYWA 2EQIA 4DBRA 1HK9A 4J9BA 4AFUC 3CC2T 1HSQA 1LVKA 3CPWS 3CPWA 2FO0A 3M9QA 1VQ8Q 3FLGA 1Y96A
chains in the Genus database with same CATH topology
2X3WD 2CT3A 1K1ZA 2KYBA 4AFZC 1QCFA 2C0OA 1X43A 4IIOA 1M8MA 3I9QA 1AOJA 1AWOA 4Z8AA 4WCIA 4RTZA 1QWEA 2M51A 2EPDA 1OPKA 4RTYA 1AEYA 2LX7A 4JJBA 2O2OA 2W0ZA 1NYGA 1WI7A 2RN8A 4LUEA 1RUWA 2PNIA 1AWWA 2KT1A 4LE9A 3EGUA 3SHWA 2DL7A 3R6NA 3GBQA 2EVRA 4ZNXA 4DEYA 2ENMA 1PWTA 1RLQC 2DBKA 2SRCA 2L3PA 4CC4B 2OAWA 1JXMA 1JU5C 2LQNA 1B3QA 2D8HA 1HD3A 1GCQA 2CDTA 3RNJA 3THKA 2V1RA 1MV0B 2V1QA 2DE0X 2RQUA 5HCKA 2P4RA 2JW4A 3REAB 2IIMA 1SSHA 2YSQA 3NPFA 3A98A 2C0IA 2FPDA 1PRLC 2DRMA 2D0NA 4JPBW 2J6OA 2AKKA 1WYXA 1Y0MA 4OMPA 2KRMA 2BZYA 2YUOA 4X1VA 2KNBB 1YN8A 2ED0A 4AFQC 4Z88A 1X2KA 1UHFA 2DNUA 1OV3A 2YUQA 3VRZA 2JT4A 4F16A 2A28A 3EG0A 4J9FA 2FPEA 4RTVA 3EG3A 2DILA 2M0YA 4HVUA 2RQTA 1NG2A 2L0AA 1KIKA 2D1XA 2KRSA 2MIOA 2ED1A 3ULRB 1PKTA 2MOXA 2AZSA 4CC2A 2DF6A 3U23A 2EYXA 3FJ5A 2ROTA 4CC3A 2JM8A 2XMFA 3PVQA 1WFWA 2JMCA 2K79A 3UF4A 4RTTA 1PNJA 5GJWB 4D8KA 1BB9A 4HVWA 2CH4A 2HBWA 5ECAA 1ABOA 3NHNA 1I07A 2KBTA 2DJQA 2QDLA 2LCSA 1M30A 3I5SA 2KR3A 1T3LA 1UG1A 2A08A 1YWPA 1A0NB 3JV3A 2RQRA 2VVKA 1UTIA 2CUBA 2DL5A 2F2XA 1PHTA 1SHGA 3VRYA 2GTJA 1G83A 2D8JA 4FSSA 3EG1A 1Z9ZA 2DLPA 1K0SA 1W70A 2CSIA 3VS0A 1TUCA 5EC7A 2JTEA 4A63B 1JXOA 1NM7A 1UJ0A 2C0TA 1RLPC 1GFDA 2KYMA 2ECZA 2DVJA 2O9VA 4JJDA 1WIEA 5IXFA 2KROA 2LJ0A 1OEBA 1VYUA 4ESRA 2RPNA 3EG2A 4LN2A 2B86A 2RQVA 3UA7A 3EHRA 2GGRA 3M0SA 1N5ZA 3LH5A 4Y92A 1J3TA 1K0XA 3QWYA 1BK2A 5FWCA 1M3AA 1W6XA 1WX6A 4AFSC 1ZUKA 1NLPC 2NUZA 1JEGA 1H92A 4AG1C 2J6FA 1HJDA 2LJ1A 2EGEA 1UJYA 4OMOA 3VS4A 2EBPA 1EFNA 2K9GA 3VS7A 1X6GA 1PKSA 4F17A 5IHNA 1AD5A 2GTOA 1M3BA 5IH2A 1MUZA 1ZLMA 2VKNA 1E6HA 1GRIA 2KXCA 1GFCA 3TVTA 4JZ4A 2FRWA 2RMOA 3SEMA 1W1FA 1E6GA 1QKWA 1B07A 1AWXA 2DMOA 1K9AA 2K7AA 4OMMA 2A36A 2CT4A 2DYBA 3C0CA 1CKBA 2VWFA 1K76A 3EHQA 4J9CA 1X69A 2JMAA 2LNHB 1WLPB 2I0NA 1WXUA 1NYFA 1KFZA 2L2PA 4J9GA 1UUEA 2O9SA 3M0RA 1BU1A 3PE0A 4OMNA 3VS1A 2DL4A 2PZ1A 2RF0A 4Z89A 1E7OA 3H0IA 4RTUA 2RQWA 5I22A 1SPKA 1G2BA 1NEGA 2HDAA 2X3XD 1Y57A 4LNPA 2CUDA 4GLMA 2O31A 2ROLA 1GBQA 2A37A 2BZXA 3QWXX 1SEMA 2O88A 1S1NA 3H41A 1SRLA 1IO6A 2DL3A 2LMJA 3I5RA 2EGAA 1KJWA 4HXJA 2KXDA 3KFVA 2J05A 1U5SA 2LQWA 1XOVA 5FWBA 1UGVA 2EYZA 4DEXA 2BTTA 1AZGB 1YCSB 1QWFA 3ZL7C 1KSWA 1YWOA 1UFFA 2GBQA 4OMQA 1X6BA 2GNCA 3VS5A 1TUDA 3TSWA 2AKLA 1GBRA 2ESWA 2KT8A 2FG0A 4LUDA 1H8KA 1H3HA 5I11A 2LZ6B 2G6FX 2F2VA 1T0JA 5GJVB 1LCKA 2HSPA 2CSQA 2K6DA 2DL8A 2H8HA 2DX1A 2KE9A 4J9IA 1Z9QA 2BZ8A 4J9EA 1OPLA 4RTXA 1ZUUA 2ABLA 2K2MA 3NGPA 2YT6A 2GQIA 3VS6A 1VA7A 2AK5A 2AZVA 1GL5A 2CH4W 2KEAA 2OI3A 1CKAA 3H0HA 4F14A 4KRTA 4E6RA 1VYTA 1PRMC 1I1JA 2DM1A 3I35A 2EW3A 2KGTA 2CREA 2J06A 2JS2A 4R0KA 3TSZA 2F2WA 5IHKA 3CQTA 3PVLA 1U3OA 2YDLA 1X2QA 1AVZC 3VS3A 1ZX6A 4AG2C 1UHCA 1SHFA 2J7IA 4CC7A 1WDXA 3UATA 2EGCA 5IXBA 1SRMA 4EIKA 1YP5A 1ZUYA 4OMLA 1VYVA 1OOTA 1RI9A 1MV3A 1X27A 1NEBA 1NLOC 1T3SA 1V1CA 1JQQA 4J9DA 2J6KA 3VS2A 1WXTA 5IHIA 2PTKA 2W10A 4GBQA 1WXBA 4HVVA 3UA6A 2E5KA 4QT7A 1U06A 2SEMA 1ARKA 2FRYA 1BBZA 2LP5A 1AWJA 1AZEA 4K11A 2L3QA 3REBB 1K4US 5L23A 2HCKA 1ABQA 3M0PA 2FEIA 4JZ3A 1WA7A 4HCKA 2YUNA 2DRKA 5FW9A 2DA9A 3O5ZA 2HEQA 2YUPA 2K3BA 1CSKA 1GCQC 4J9HA 3NMZC 4RUGA 1ZSGA 4RTWA 2KRNA 2DBMA 1UDLA 1QKXA 2JXBA 3RBBB 1T0HA 1JO8A 2JM9A 1FYNA 1QLYA 1GCPA 2RNAA 2OJ2A 3M0QA 3M0TA 2EKHA 1ZBJA 2FPFA 4IIMA 4M4ZA 1YNZA 4D8DA 2EYYA 2EYWA 1I0CA 2LJ3A 1TG0A 2JS0A 2EQIA 1M3CA 4J9BA 1UE9A 3H0FA 3IQLA 4AFUC 1FMKA 1HSQA 2MCNA 1UECA 4ORZA 3M0UA 2L3SA 1M27C 2FO0A 4JJCA 2NWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3W D;  2CT3 A;  1K1Z A;  2KYB A;  4AFZ C;  1QCF A;  2C0O A;  1X43 A;  4IIO A;  1M8M A;  3I9Q A;  1AOJ A;  1AWO A;  4Z8A A;  4WCI A;  4RTZ A;  1QWE A;  2M51 A;  2EPD A;  1OPK A;  4RTY A;  1AEY A;  2LX7 A;  4JJB A;  2O2O A;  2W0Z A;  1NYG A;  1WI7 A;  2RN8 A;  4LUE A;  1RUW A;  2PNI A;  1AWW A;  2KT1 A;  4LE9 A;  3EGU A;  3SHW A;  2DL7 A;  3R6N A;  3GBQ A;  2EVR A;  4ZNX A;  4DEY A;  2ENM A;  1PWT A;  1RLQ C;  2DBK A;  2SRC A;  2L3P A;  4CC4 B;  2OAW A;  1JXM A;  1JU5 C;  2LQN A;  1B3Q A;  2D8H A;  1HD3 A;  1GCQ A;  2CDT A;  3RNJ A;  3THK A;  2V1R A;  1MV0 B;  2V1Q A;  2DE0 X;  2RQU A;  5HCK A;  2P4R A;  2JW4 A;  3REA B;  2IIM A;  1SSH A;  2YSQ A;  3NPF A;  3A98 A;  2C0I A;  2FPD A;  1PRL C;  2DRM A;  2D0N A;  4JPB W;  2J6O A;  2AKK A;  1WYX A;  1Y0M A;  4OMP A;  2KRM A;  2BZY A;  2YUO A;  4X1V A;  2KNB B;  1YN8 A;  2ED0 A;  4AFQ C;  4Z88 A;  1X2K A;  1UHF A;  2DNU A;  1OV3 A;  2YUQ A;  3VRZ A;  2JT4 A;  4F16 A;  2A28 A;  3EG0 A;  4J9F A;  2FPE A;  4RTV A;  3EG3 A;  2DIL A;  2M0Y A;  4HVU A;  2RQT A;  1NG2 A;  2L0A A;  1KIK A;  2D1X A;  2KRS A;  2MIO A;  2ED1 A;  3ULR B;  1PKT A;  2MOX A;  2AZS A;  4CC2 A;  2DF6 A;  3U23 A;  2EYX A;  3FJ5 A;  2ROT A;  4CC3 A;  2JM8 A;  2XMF A;  3PVQ A;  1WFW A;  2JMC A;  2K79 A;  3UF4 A;  4RTT A;  1PNJ A;  5GJW B;  4D8K A;  1BB9 A;  4HVW A;  2CH4 A;  2HBW A;  5ECA A;  1ABO A;  3NHN A;  1I07 A;  2KBT A;  2DJQ A;  2QDL A;  2LCS A;  1M30 A;  3I5S A;  2KR3 A;  1T3L A;  1UG1 A;  2A08 A;  1YWP A;  1A0N B;  3JV3 A;  2RQR A;  2VVK A;  1UTI A;  2CUB A;  2DL5 A;  2F2X A;  1PHT A;  1SHG A;  3VRY A;  2GTJ A;  1G83 A;  2D8J A;  4FSS A;  3EG1 A;  1Z9Z A;  2DLP A;  1K0S A;  1W70 A;  2CSI A;  3VS0 A;  1TUC A;  5EC7 A;  2JTE A;  4A63 B;  1JXO A;  1NM7 A;  1UJ0 A;  2C0T A;  1RLP C;  1GFD A;  2KYM A;  2ECZ A;  2DVJ A;  2O9V A;  4JJD A;  1WIE A;  5IXF A;  2KRO A;  2LJ0 A;  1OEB A;  1VYU A;  4ESR A;  2RPN A;  3EG2 A;  4LN2 A;  2B86 A;  2RQV A;  3UA7 A;  3EHR A;  2GGR A;  3M0S A;  1N5Z A;  3LH5 A;  4Y92 A;  1J3T A;  1K0X A;  3QWY A;  1BK2 A;  5FWC A;  1M3A A;  1W6X A;  1WX6 A;  4AFS C;  1ZUK A;  1NLP C;  2NUZ A;  1JEG A;  1H92 A;  4AG1 C;  2J6F A;  1HJD A;  2LJ1 A;  2EGE A;  1UJY A;  4OMO A;  3VS4 A;  2EBP A;  1EFN A;  2K9G A;  3VS7 A;  1X6G A;  1PKS A;  4F17 A;  5IHN A;  1AD5 A;  2GTO A;  1M3B A;  5IH2 A;  1MUZ A;  1ZLM A;  2VKN A;  1E6H A;  1GRI A;  2KXC A;  1GFC A;  3TVT A;  4JZ4 A;  2FRW A;  2RMO A;  3SEM A;  1W1F A;  1E6G A;  1QKW A;  1B07 A;  1AWX A;  2DMO A;  1K9A A;  2K7A A;  4OMM A;  2A36 A;  2CT4 A;  2DYB A;  3C0C A;  1CKB A;  2VWF A;  1K76 A;  3EHQ A;  4J9C A;  1X69 A;  2JMA A;  2LNH B;  1WLP B;  2I0N A;  1WXU A;  1NYF A;  1KFZ A;  2L2P A;  4J9G A;  1UUE A;  2O9S A;  3M0R A;  1BU1 A;  3PE0 A;  4OMN A;  3VS1 A;  2DL4 A;  2PZ1 A;  2RF0 A;  4Z89 A;  1E7O A;  3H0I A;  4RTU A;  2RQW A;  5I22 A;  1SPK A;  1G2B A;  1NEG A;  2HDA A;  2X3X D;  1Y57 A;  4LNP A;  2CUD A;  4GLM A;  2O31 A;  2ROL A;  1GBQ A;  2A37 A;  2BZX A;  3QWX X;  1SEM A;  2O88 A;  1S1N A;  3H41 A;  1SRL A;  1IO6 A;  2DL3 A;  2LMJ A;  3I5R A;  2EGA A;  1KJW A;  4HXJ A;  2KXD A;  3KFV A;  2J05 A;  1U5S A;  2LQW A;  1XOV A;  5FWB A;  1UGV A;  2EYZ A;  4DEX A;  2BTT A;  1AZG B;  1YCS B;  1QWF A;  3ZL7 C;  1KSW A;  1YWO A;  1UFF A;  2GBQ A;  4OMQ A;  1X6B A;  2GNC A;  3VS5 A;  1TUD A;  3TSW A;  2AKL A;  1GBR A;  2ESW A;  2KT8 A;  2FG0 A;  4LUD A;  1H8K A;  1H3H A;  5I11 A;  2LZ6 B;  2G6F X;  2F2V A;  1T0J A;  5GJV B;  1LCK A;  2HSP A;  2CSQ A;  2K6D A;  2DL8 A;  2H8H A;  2DX1 A;  2KE9 A;  4J9I A;  1Z9Q A;  2BZ8 A;  4J9E A;  1OPL A;  4RTX A;  1ZUU A;  2ABL A;  2K2M A;  3NGP A;  2YT6 A;  2GQI A;  3VS6 A;  1VA7 A;  2AK5 A;  2AZV A;  1GL5 A;  2CH4 W;  2KEA A;  2OI3 A;  1CKA A;  3H0H A;  4F14 A;  4KRT A;  4E6R A;  1VYT A;  1PRM C;  1I1J A;  2DM1 A;  3I35 A;  2EW3 A;  2KGT A;  2CRE A;  2J06 A;  2JS2 A;  4R0K A;  3TSZ A;  2F2W A;  5IHK A;  3CQT A;  3PVL A;  1U3O A;  2YDL A;  1X2Q A;  1AVZ C;  3VS3 A;  1ZX6 A;  4AG2 C;  1UHC A;  1SHF A;  2J7I A;  4CC7 A;  1WDX A;  3UAT A;  2EGC A;  5IXB A;  1SRM A;  4EIK A;  1YP5 A;  1ZUY A;  4OML A;  1VYV A;  1OOT A;  1RI9 A;  1MV3 A;  1X27 A;  1NEB A;  1NLO C;  1T3S A;  1V1C A;  1JQQ A;  4J9D A;  2J6K A;  3VS2 A;  1WXT A;  5IHI A;  2PTK A;  2W10 A;  4GBQ A;  1WXB A;  4HVV A;  3UA6 A;  2E5K A;  4QT7 A;  1U06 A;  2SEM A;  1ARK A;  2FRY A;  1BBZ A;  2LP5 A;  1AWJ A;  1AZE A;  4K11 A;  2L3Q A;  3REB B;  1K4U S;  5L23 A;  2HCK A;  1ABQ A;  3M0P A;  2FEI A;  4JZ3 A;  1WA7 A;  4HCK A;  2YUN A;  2DRK A;  5FW9 A;  2DA9 A;  3O5Z A;  2HEQ A;  2YUP A;  2K3B A;  1CSK A;  1GCQ C;  4J9H A;  3NMZ C;  4RUG A;  1ZSG A;  4RTW A;  2KRN A;  2DBM A;  1UDL A;  1QKX A;  2JXB A;  3RBB B;  1T0H A;  1JO8 A;  2JM9 A;  1FYN A;  1QLY A;  1GCP A;  2RNA A;  2OJ2 A;  3M0Q A;  3M0T A;  2EKH A;  1ZBJ A;  2FPF A;  4IIM A;  4M4Z A;  1YNZ A;  4D8D A;  2EYY A;  2EYW A;  1I0C A;  2LJ3 A;  1TG0 A;  2JS0 A;  2EQI A;  1M3C A;  4J9B A;  1UE9 A;  3H0F A;  3IQL A;  4AFU C;  1FMK A;  1HSQ A;  2MCN A;  1UEC A;  4ORZ A;  3M0U A;  2L3S A;  1M27 C;  2FO0 A;  4JJC A;  2NWM A; 
#chains in the Genus database with same CATH topology
 5GAN 5;  2EQU A;  2X3W D;  2CT3 A;  1X43 A;  1M8M A;  3I9Q A;  1AOJ A;  3QJ6 A;  3H9N A;  4Z8A A;  2KVQ G;  3OYD A;  5CKF A;  2M51 A;  3S6W A;  4M77 F;  1AEY A;  4JJB A;  2W0Z A;  5KCH A;  5LJ5 d;  1RUW A;  1HYO A;  1VQ4 T;  1SKU B;  3GLX A;  2PNI A;  1AWW A;  2MWO A;  4LE9 A;  4XTV A;  2NLU A;  4C0D C;  3EGU A;  3FIF A;  1Q82 R;  3GBQ A;  2L5Q A;  4J7I A;  1I81 A;  4PJL A;  1PWT A;  1RLQ C;  3HFN A;  2DBK A;  2HQE A;  2LQN A;  2YXY A;  2CDT A;  3G6E Q;  1VQ6 A;  3CC7 T;  4CI0 C;  5HCK A;  3G71 A;  3OB9 A;  3REA B;  2IIM A;  3DKM A;  4N4G A;  3P8H A;  1QW1 A;  2FPD A;  4Z02 A;  1Q81 U;  3EFO A;  3JSC A;  1JB0 E;  4M7A A;  2J6O A;  1Y0M A;  2K3X A;  2DK3 A;  2E64 A;  1BKB A;  1UB4 A;  3OYH A;  1K9M U;  2IPO B;  3V8L A;  1BI0 A;  1KC8 R;  4Z88 A;  1UHF A;  4KGV B;  1VQM A;  4F16 A;  4JS4 A;  1VOM A;  4J9F A;  2FPE A;  4OGE A;  4HVU A;  1VQ9 Q;  1M4Z A;  4C8Q F;  5DLO A;  2D1X A;  2KRS A;  2FL7 A;  4MZM A;  1D1A A;  2M02 A;  2VB6 A;  4X34 A;  5GAN 7;  3JB9 I;  1Q82 U;  5CKB A;  3FJ5 A;  3JCM h;  2QQB A;  4KT0 E;  3PVQ A;  2K79 A;  1VQ4 Q;  1RAH B;  3DLM A;  1PNJ A;  2HAX A;  4HVW A;  3I55 Q;  1QP3 A;  5ECA A;  2ZPF B;  3A8G B;  4XTY A;  1ABO A;  3V7C A;  1Y7X A;  5CVI A;  3C4S A;  2EQJ A;  2QG9 B;  3I5S A;  4MZP A;  4JRQ A;  1NZ9 A;  5DM7 R;  3JV3 A;  5KYY B;  4A4K A;  1UTI A;  2CUB A;  3DB3 A;  2NUT A;  1SHG A;  4NL2 A;  1G83 A;  2D8J A;  3EG1 A;  4RKU E;  4C5H A;  2LNV A;  2WSE E;  2HL3 A;  2YRD A;  2CSI A;  4KGX B;  1TUC A;  4FW1 A;  1TXQ A;  2E10 A;  1QVG S;  8ATC B;  1GFD A;  2L8D A;  2RK2 A;  5IT9 E;  3SD4 A;  5FLX E;  4IUR A;  2LJ0 A;  3RKY A;  1OEB A;  1RL2 A;  2B86 A;  2RQV A;  4A53 A;  2A0F B;  3P8B B;  5KH6 A;  4ZGE B;  5GAN e;  5KYU B;  2NUZ A;  3CCE A;  1JEG A;  3CCR A;  3CME A;  3OYI A;  3ASK A;  4C92 G;  5LJ3 e;  3BDL A;  4EMG A;  2JVV A;  1UJY A;  3CD6 Q;  3CCQ T;  3HPW A;  1EFN A;  2LX9 A;  3OMG A;  2EJF A;  1OI1 A;  3EH1 A;  1IRX A;  3TQ7 P;  1MUZ A;  2VKN A;  1Q7Y C;  4LDU A;  4C5G A;  4OB0 B;  1BYM A;  1UGP B;  3SEM A;  2QQA A;  3P8D A;  1AWX A;  2K7A A;  2PUK B;  4OMM A;  1VQ5 T;  3A8O B;  1VQL A;  3JCM P;  1XNI A;  1MMA A;  4PJM A;  4KUL A;  1CKB A;  1K76 A;  2X35 A;  2EIF A;  3CCJ T;  4J9C A;  1X69 A;  3GNG A;  5A0G A;  4ANJ A;  4TVR A;  2I0N A;  1NYF A;  3KBG A;  3OQ5 A;  4E7Z A;  1PG5 B;  2L2P A;  2KSS A;  2M16 A;  2MK5 A;  4J9G A;  1UUE A;  1VQN T;  2O9S A;  4OMN A;  3VS1 A;  2LDM A;  2X4W A;  4Z89 A;  1RAC B;  3BDU A;  4DOW A;  5GAO p;  1B7T A;  3MET A;  2IG0 A;  2RQW A;  1G2B A;  3BE3 A;  4BY6 B;  4LNP A;  3GNF B;  4M7A F;  1D0Z A;  4KH1 B;  4ZTF A;  2GFU A;  5CKD A;  3HRU A;  2OX7 A;  4B9W A;  3I56 Q;  3QWX X;  3URG A;  4X9D A;  4N4H A;  3UDC A;  1S1N A;  4Y91 A;  4JJN K;  2OTL A;  2EGA A;  4HXJ A;  3KFV A;  2J05 A;  3G4S A;  1U5S A;  1XOV A;  5FWB A;  2BTT A;  2LVM A;  3H6Z A;  1OX9 A;  3LYI A;  1MHN A;  4M7D B;  1ZHI A;  5KYX A;  1X6B A;  2GNC A;  3EGX B;  2JJ9 A;  4GY5 A;  2DET A;  4NL3 A;  2DO3 A;  1GBR A;  3OYM A;  4F7U B;  2GFA A;  3G71 T;  2LZ6 B;  4B6M A;  2QA4 Q;  3VJP A;  1YJN Q;  3QG1 A;  5J39 A;  1OQK A;  2HSP A;  2DIG A;  1YJW A;  3V8K A;  3DB4 A;  3M4Y A;  1YJW Q;  1KQS S;  4M75 A;  2BZ8 A;  5D7U A;  4J9E A;  2RI2 A;  1TUG B;  1VIE A;  3VUZ A;  2K2M A;  3PFS A;  1YIT A;  4M78 E;  4HCC A;  1VQP A;  4BI3 A;  2A7Y A;  4C92 A;  1VQM T;  2AZV A;  4A4H A;  5HK0 A;  3OW2 A;  1MMG A;  1CKA A;  4F14 A;  2BIV A;  4KBM B;  2LQ8 A;  3A8L B;  3E9G A;  3SDZ A;  2HKN A;  1VIF A;  1G3S A;  2E4H A;  2DM1 A;  4MDW A;  3QDF A;  4XTX A;  3CCM Q;  3L2Q A;  1LNX A;  3M59 A;  2DZC A;  2F2W A;  5KCO A;  3FEO A;  3TRE A;  1VQK Q;  1QVF S;  3EGD A;  3I55 A;  3CBM A;  2E12 A;  4RMO A;  2DZ9 A;  1JJ2 P;  1BI2 A;  1G3T A;  2EGC A;  2DJZ A;  4QQD A;  4F7U G;  5GAO l;  1QVF P;  1QCN A;  3S3O A;  1QVG A;  1U1S A;  4J83 A;  3FRN A;  4EIK A;  4OML A;  1YJ9 T;  3CCL T;  2DEQ A;  1RI9 A;  1K73 C;  1NEB A;  2COY A;  1NLO C;  1WGS A;  4X9C A;  4J9D A;  1YHQ Q;  1WXB A;  4HVV A;  2RJF A;  2E5K A;  3HTR A;  4QT7 A;  4IUU A;  2E3I A;  5AT1 B;  1Q95 G;  2HD0 A;  3J7A F;  3JB9 G;  4MMK A;  1BBZ A;  3CC4 A;  4FYY B;  4MML A;  4A54 A;  1S72 T;  5CO7 A;  2MI6 A;  4AT1 B;  2BUD A;  2D9T A;  3ZFJ A;  1K9M C;  2K5I A;  4BD3 A;  1KQ2 A;  4C92 C;  1KK7 A;  2FEI A;  3L2W A;  3EG9 A;  2DRK A;  1C0M A;  1IZ6 A;  5GAN g;  1IHV A;  2EQK A;  1YFN A;  1GCQ C;  2D0Q B;  4C0G A;  4M7A D;  1VQO Q;  2KQW A;  1WHM A;  1ZSG A;  2JNG A;  1QKX A;  2JM9 A;  5DY9 A;  1FYN A;  5LJ3 h;  3R6O A;  1QVP A;  2JOY A;  4N0A A;  1GCP A;  3QII A;  2RNA A;  3M0Q A;  2FPF A;  1ZBJ A;  4CRI A;  2QEX Q;  4M4Z A;  1Q7Y R;  2XG8 D;  5FRM A;  1YNZ A;  4E7H A;  1WJQ A;  1YIT T;  1D0Y A;  1I0C A;  2LJ3 A;  3UT1 A;  1TG0 A;  3I56 A;  1SG5 A;  1M3C A;  1UE9 A;  3H0F A;  4M7A C;  1G3Y A;  2CP7 A;  4LDV A;  4ORZ A;  5I2S A;  4JJC A;  2JTF A;  3RKW A;  2NWM A;  3QBY A;  2FZG B;  5GAN j;  1XJW B;  3JCM d;  1WJS A;  2MWP A;  4AFZ C;  1VUB A;  1QCF A;  1SF9 A;  4HT9 A;  3X20 B;  3AHU A;  3J80 E;  2HQX A;  5KYW A;  2EPD A;  2QTX A;  5LJ5 h;  4BI4 A;  4RTY A;  2XK0 A;  3PGG A;  4M75 C;  1WI7 A;  1I4K 1;  2RN8 A;  4LUE A;  4ZN3 A;  2KT1 A;  2Y90 A;  2DL7 A;  3OMC A;  1R0C B;  2BKD N;  4ZNX A;  4DEY A;  4F7U E;  2SRC A;  1KQS A;  4CC4 B;  5LJ3 f;  1JXM A;  4C8Q D;  4C8Q A;  2D8H A;  1VQ7 Q;  3THK A;  2V1R A;  4PJO G;  1MV0 B;  4JRI A;  2RQU A;  1VQ6 Q;  1PD1 A;  3OYB A;  1H3Z A;  2HZY A;  1SSH A;  5AYF A;  5GAO n;  5FRO A;  3A98 A;  3E1S A;  2VAS A;  1MNE A;  2DRM A;  4P5N A;  3PIP A;  5GMK e;  5EG2 A;  2CZ1 B;  2MYS A;  4M77 G;  1VQ7 T;  2DIQ A;  1VQK T;  1BIB A;  3CCV T;  4X1V A;  4M77 A;  2KNB B;  3QXE B;  3VU3 C;  3MEU A;  4J7F A;  2E41 A;  3H8Z A;  3QYH B;  3JB9 H;  1M9S A;  2DNU A;  3VRZ A;  3VUB A;  3EG0 A;  3OW2 P;  1K8A R;  4RTV A;  1VQP T;  2DIL A;  2CZ0 B;  2M0Y A;  3MEV A;  1Y96 B;  2PVO B;  2MIO A;  2JZ2 A;  3ULR B;  3X24 B;  1BCO A;  2MOX A;  3CC4 Q;  2M9U A;  3U23 A;  5J26 A;  1KQS P;  2ROT A;  2XMF A;  2E5Q A;  2JMC A;  2LCC A;  5D6Y A;  2CH4 A;  2HBW A;  4FSX A;  3NHN A;  2E6N A;  1I07 A;  3UWN A;  1M30 A;  2FHD A;  2ZPB B;  1YIT Q;  4ZGJ B;  2A08 A;  1X6O A;  2CP5 A;  2ZAE A;  2GQV A;  2XDB A;  2KDS A;  1A0N B;  2DL5 A;  1QMC A;  2KY9 A;  1YIJ T;  2GTJ A;  2VXE A;  2DXB A;  3X28 B;  5EC7 A;  1Q81 R;  2JTE A;  4A63 B;  5GAN d;  2HBP A;  6AT1 B;  2KYM A;  4OP0 A;  2BE9 B;  3T9N A;  4C8Q G;  1KHC A;  1VYU A;  2RPN A;  3UA7 A;  1X75 C;  3LH5 A;  1UGQ B;  1LPL A;  3JCM Q;  1M3A A;  3MO8 A;  2DAQ A;  2Y4Y A;  3HP9 A;  4M75 D;  2COW A;  2EYQ A;  4NS5 A;  3SWN B;  2LJ1 A;  3SWN C;  3OYF A;  2CZ6 B;  1JBM A;  1N6A A;  1FXX A;  4F17 A;  4HCB A;  4E2F B;  5IHN A;  1AD5 A;  5CIU A;  2XI9 A;  5IH2 A;  1VQ5 Q;  1E6H A;  2RM4 A;  1PC0 A;  1GRI A;  1RAB B;  4XU2 A;  1OZ3 A;  2V8J A;  3QSU A;  2K2V A;  1W1F A;  1E6G A;  1QKW A;  3E9F A;  3CCS Q;  2DMO A;  2DD4 A;  3EGX A;  3HL8 A;  2YHT A;  2P0K A;  3C0C A;  3KUF A;  3CPW P;  4IUT A;  1VQL Q;  1JJ2 A;  4PFP A;  3PMI A;  2JMA A;  3JCM V;  3M57 A;  3M53 A;  4PNO A;  5CAI A;  2XDD A;  1QVG P;  4BY6 C;  2DTO A;  3MJX A;  2RF0 A;  3OYY A;  2NYS A;  3CBO A;  4C92 F;  4J6X A;  5I22 A;  4ZN1 A;  4LD6 A;  4R56 A;  1NEG A;  2HDA A;  3LGF A;  2RJE A;  2CUD A;  4M7D E;  3BFM A;  2BZX A;  5GAM d;  1TS9 A;  2HMA A;  4E7S A;  1AHJ B;  2P0Q A;  2O88 A;  3MP1 A;  3F70 A;  3I5R A;  2KXD A;  2HSE B;  2LQW A;  5FU7 B;  1UGV A;  1EIF A;  1AZG B;  3I56 T;  1YCS B;  2ZPI B;  3G71 Q;  3A1P A;  3ZL7 C;  1UFF A;  1O75 A;  5KE2 A;  4BE1 A;  5HKC A;  4DQ2 A;  2YLB A;  2G6F X;  1T0J A;  5M9O A;  4PFZ A;  1C1A A;  2QYZ A;  4OB1 B;  2CSQ A;  1ZA2 B;  2VXF A;  2PUO B;  1VQL T;  4MDX A;  4J9I A;  1Z9Q A;  1M1G A;  1U8R A;  1NPR A;  3HKS A;  1ZUU A;  5GAM h;  2GQI A;  2DVE A;  2PVD B;  1KC8 U;  3PMT A;  4M75 G;  3MPU B;  1FX7 A;  3QJY A;  3OYN A;  5DLQ E;  1IXD A;  3CPF A;  4FCY A;  3QZ5 B;  3QHS A;  3RDV A;  3LLR A;  3M5A A;  4E6R A;  2F69 A;  1UEB A;  1I1J A;  4IUQ A;  5D6W A;  2G3R A;  2NUP B;  2CRE A;  4J6Y A;  3CMA Q;  2X4Y A;  4EMK A;  4N0A C;  2RB6 A;  3QDR B;  1IRE B;  4VUB A;  1I8F A;  1AVZ C;  1SHF A;  2J7I A;  4JLI A;  1IHW A;  3EH2 A;  3UAT A;  1D09 B;  3CC2 A;  3KXT A;  5IXB A;  1SRM A;  2CP3 A;  3L42 A;  3VV0 A;  1YP5 A;  2DXU A;  3LW5 E;  4L6V 5;  4FYX B;  1X27 A;  1T3S A;  1R77 A;  3JRZ A;  2QGF B;  3VS2 A;  1W2B S;  1WXT A;  5IHI A;  3G6E T;  3MEW A;  4GBQ A;  4BI8 B;  3BW1 A;  2AIR B;  1ARK A;  5KYX B;  2LP5 A;  2CYZ B;  4M78 F;  3WXM B;  4PJO A;  3REB B;  1K4U S;  2DFU A;  5LJ3 g;  3FDR A;  2B8A A;  1WA7 A;  4HCK A;  2L89 A;  5FW9 A;  3M4G A;  3O5Z A;  4HA8 A;  3CME Q;  4M7D F;  2HEQ A;  2RH2 A;  3NFC A;  4J9H A;  3GOX A;  3CC4 T;  1D0X A;  1N8R R;  4RTW A;  2DBM A;  1KQ1 A;  3OYA A;  3HRS A;  1T0H A;  3CCS T;  2OTJ Q;  4EPC A;  5IAY A;  5LL6 S;  2FB7 A;  4DBQ A;  1RAF B;  5C0M A;  4RCC A;  3S3M A;  4M7A B;  3GPL A;  4A4F A;  3INZ A;  5LJ5 e;  1VQ9 T;  1Q86 C;  3M0T A;  4IIM A;  1B34 A;  1OX8 A;  4DBF A;  2JS0 A;  1EX4 A;  1JRI A;  2AHJ B;  2OTL Q;  4JS5 A;  3M0U A;  2QGG A;  2OAU A;  2LT1 A;  1I5O B;  2QAS A;  1RAG B;  4C0F A;  1WJR A;  5GAN 3;  2EAY A;  2RK1 A;  1K1Z A;  2C0O A;  4IIO A;  1AWO A;  1PSF A;  3FC3 A;  4E7K A;  1K8A C;  3PTA A;  5GAO m;  5GAO r;  1NYG A;  4EMK B;  4KUI A;  3L2Z A;  4M77 E;  3SHW A;  3R6N A;  5I2M A;  4BDZ A;  2EVR A;  2ENM A;  4LD9 K;  1ZA1 B;  1B3Q A;  3EFS A;  4C0Z A;  4OVA A;  1ZSZ A;  3PIO A;  1TOV A;  1GCQ A;  1YIJ Q;  3G6E A;  1M1K C;  2V1Q A;  2DE0 X;  1U1T A;  2P4R A;  3UPU A;  1G3W A;  2LC4 A;  4PJO E;  2NUT B;  1K73 U;  2CP6 A;  4QVZ A;  4JRK A;  2BE7 D;  3OS0 A;  4HT8 A;  2YSQ A;  2CGH A;  3V7R A;  3CCU T;  2WSC E;  3CCM A;  4M78 C;  2C0I A;  3CMA A;  1FMW A;  3E19 A;  4C8Q E;  4BAC A;  4JPB W;  4PLL A;  2ZPG B;  1WYX A;  4OMP A;  2KRM A;  1NE8 A;  1RAA B;  2DKG A;  2YUO A;  2YWW A;  3OBY A;  3OA6 A;  3JCM e;  2ED0 A;  2VUB A;  3RES A;  3ZEH A;  7AT1 B;  1X2K A;  1RAD B;  4GLK A;  1QQJ A;  2YUQ A;  2JT4 A;  3JCM X;  1N9R A;  3OS5 A;  2M0O A;  2DD5 A;  2RQT A;  4M7D C;  3VYH B;  3CCV A;  5CR2 A;  2PQW A;  1JJ2 S;  4ATO A;  1PKT A;  5CK9 A;  1VQO T;  3OS2 A;  2LCL A;  1RAI B;  1EZZ B;  3OW2 S;  4CC3 A;  2JM8 A;  2RI3 A;  4EMH A;  4RG2 A;  1WFW A;  2X4J A;  4RTT A;  4D8K A;  4C8Q B;  4FYV B;  3CC2 Q;  3CCL Q;  4KH0 B;  5IN1 A;  2KBT A;  2DJQ A;  2QDL A;  2KR3 A;  1T3L A;  2FZK B;  4BE2 A;  1IGU A;  1UG1 A;  4FYW B;  3CCJ A;  2RQR A;  2PU9 B;  1YHQ A;  1PHT A;  3OSV A;  3OYC A;  4IKF A;  4XTZ A;  4FSS A;  5LJ3 d;  2DLP A;  1K0S A;  4QQ6 A;  3N5B B;  3L2V A;  1W70 A;  1WQ7 A;  3CBP A;  5GMK h;  1N9S A;  2QQR A;  1JXO A;  3C12 A;  1O9S A;  1UJ0 A;  2C0T A;  1Y71 A;  3FJP A;  2O9V A;  2DVJ A;  4JJD A;  5IXF A;  2KRO A;  4ESR A;  3CXC P;  4J8O A;  4QW2 A;  4LN2 A;  3EG2 A;  1QVF A;  2OTJ T;  3EHR A;  3M0S A;  1N5Z A;  4PLI A;  4Y92 A;  1VQ8 A;  1J3T A;  3QWY A;  4OB2 B;  4OMF B;  1TU0 B;  5FWC A;  3C94 A;  1WX6 A;  1VQO A;  3CCU A;  4JLG A;  1NLP C;  1KD1 R;  1W2B P;  1H92 A;  5GMK i;  3A8H B;  4M7D A;  3VYG A;  2EGE A;  4ZTJ A;  4OMO A;  3VS4 A;  2EBP A;  2K9G A;  3VS7 A;  2WAC A;  2CS7 A;  4ME7 A;  1SSF A;  3V8J A;  2E6Z A;  2QEX A;  2X51 A;  3EAE A;  3C95 A;  1TH7 A;  1ZLM A;  1Q86 R;  2DXT A;  3RMQ A;  1GFC A;  4XQ3 A;  3RER A;  3TVT A;  2FRW A;  4J6W A;  4M77 B;  4PK4 A;  4DA4 A;  3A5Z B;  1B07 A;  2PVG B;  1M90 R;  2A36 A;  3QKJ A;  1YIJ A;  1M90 C;  2H3E B;  2DYB A;  4M75 E;  2P0P A;  3EHQ A;  4JUV A;  3LH0 A;  1YJN T;  2LNH B;  4C92 B;  1WXU A;  5CCA A;  2K3Y A;  1YI2 T;  3L1A A;  1D1C A;  2CKK A;  4M78 D;  1BU1 A;  3PE0 A;  2XIC A;  3GIB A;  2OTJ A;  2F5T X;  2ZZD A;  4Y28 E;  4J5Y A;  3BY7 A;  4O6J A;  1SPK A;  1VQ5 A;  2VYT A;  1M8V A;  2E1H A;  1Y57 A;  2CP2 A;  3G7Z A;  2NUP A;  4GLM A;  2ROL A;  1GBQ A;  2KAF A;  1X01 A;  2A37 A;  4EMK C;  2DPP B;  1TWB A;  1SEM A;  4IUV A;  1SRL A;  1IO6 A;  2DL3 A;  1H64 1;  1KHI A;  2LT4 A;  5FU6 C;  1YJ9 Q;  2P84 A;  2LRQ A;  1KSW A;  1YWO A;  2GBQ A;  2XDP A;  2EFI A;  1TUD A;  1K73 R;  4C92 E;  2RI5 A;  3TSW A;  2VGN A;  1VQN Q;  1NBE B;  5GAM g;  2KT8 A;  1B34 B;  1AT1 B;  4KGZ B;  1H8K A;  1Q86 U;  3EFR A;  3GP8 A;  2F2V A;  2XU8 A;  1LCK A;  3CCQ Q;  3G1J A;  3CD6 T;  3CCM T;  2H8H A;  1M5Q 1;  3G4S T;  2KE9 A;  1WHK A;  3M58 A;  2O4X A;  2P4T A;  4RTX A;  2ABL A;  1TSF A;  3VS6 A;  1VA7 A;  1BIA A;  5HY6 A;  3O8V A;  1GL5 A;  3OYE A;  2OI3 A;  1KD1 U;  3H0H A;  4LXC A;  1LJO A;  4KRT A;  1K8A U;  5GAN h;  1PRM C;  2YLC A;  1LOJ A;  2EW3 A;  2JUF A;  2KGT A;  4ZGD B;  3MP8 A;  1WZO A;  4XTW A;  2J06 A;  3NTH A;  3JB9 D;  1XTD A;  4R0K A;  3TSZ A;  5IHK A;  2QA4 A;  2ZCF B;  3HHT B;  4RCB A;  2GCX A;  4FW2 A;  4C5I A;  2HL5 C;  2YDL A;  1RI0 A;  1X2Q A;  4XAX B;  3VS3 A;  1ZX6 A;  4AG2 C;  2EJ9 A;  9ATC B;  1UHC A;  2RHI A;  1WDX A;  2EQM A;  5CKH A;  2D6F A;  5LJ3 j;  2KI7 A;  4PKC C;  5GAM j;  4WTO B;  2K4Y A;  4FL6 A;  2K57 A;  3I55 T;  1VYV A;  1OOT A;  5A0D A;  3JB9 J;  4MZT A;  2MF2 A;  4FU6 A;  3E2U A;  1OYX A;  4DOV A;  2PTK A;  2EKO A;  2Y4X A;  3JCM b;  4E7L A;  1Q81 C;  1DJ7 B;  4UC4 A;  1AWJ A;  1OU9 A;  4XK8 E;  1AZE A;  4K11 A;  4OF1 A;  3HRT A;  1VQ4 A;  1YCY A;  2AT1 B;  1R0B G;  1NJI U;  5L23 A;  2E70 A;  5A0L A;  3CCL A;  5L8R E;  4DBH A;  4AMC A;  1ABQ A;  3M0P A;  4Q5W A;  4PJN A;  2DA9 A;  2K3B A;  4E47 A;  1CSK A;  3CCJ Q;  3D7S B;  4RUG A;  2X4X A;  2VV5 A;  3CCR Q;  1NPP A;  5LJ5 j;  1UDL A;  2XKO C;  3Q1J A;  1XQH A;  3JAM E;  1QLY A;  3OS1 A;  3M55 A;  3RUX A;  3OYG A;  5KYU A;  2OJ2 A;  2F5K A;  1FMV A;  1PM3 A;  3JCM c;  3IQL A;  1VQ7 A;  1FMK A;  4HCZ A;  2MCN A;  1UEC A;  4O5V A;  3CCS A;  3X25 B;  2L3S A;  1M27 C;  2FZC B;  4II1 A;  1OZ2 A;  2V26 A;  3LWH A;  1KC8 C;  4M77 C;  2KYB A;  3CCE Q;  3CCR T;  4XU3 A;  4WCI A;  4RTZ A;  1QWE A;  2IVW A;  1M1F A;  1OPK A;  2DYI A;  2CZ7 B;  3ER0 A;  4A4E A;  8AT1 B;  2LX7 A;  2O2O A;  3MP6 A;  3S3N A;  5LJ5 f;  3CC7 A;  4BE0 A;  3L2R A;  1S72 A;  3CC7 Q;  3RKX A;  4B9X A;  5KYY A;  4M75 F;  1MMD A;  2L3P A;  2OAW A;  1JU5 C;  2WSF E;  3PNW C;  4NOY A;  1HD3 A;  3CEY A;  2CP0 A;  3RNJ A;  1D1B A;  1OUL A;  3NTI A;  2MMP A;  2JTM A;  1YJ9 A;  2RJC A;  2K5F A;  2JW4 A;  2DXC A;  2LQK A;  3CME T;  1ZBX A;  1ZSZ B;  1VQ9 A;  2M1H A;  1KG1 A;  3NPF A;  4LDY A;  1PRL C;  4IUP A;  4QVD A;  1C6V X;  3LGL A;  2D0N A;  4PJO B;  4OGC A;  1WQW A;  1YBY A;  2AKK A;  2R5A A;  1P92 A;  2BZY A;  4N4I A;  1D3B B;  3OSS C;  3M56 A;  3MHX A;  2DTI A;  3X26 B;  4FIB A;  3MEA A;  2R57 A;  3MKD A;  1K9M R;  1YN8 A;  4F04 B;  4M7A G;  4AFQ C;  4PJO D;  1VQ6 T;  1WNL A;  4C0D B;  1OV3 A;  2A28 A;  2QQ9 A;  1N8R U;  3EG3 A;  3LWI A;  4WF2 A;  1NG2 A;  2L0A A;  3QPH A;  4M78 G;  2RHY A;  1KIK A;  5FRN A;  2XD0 A;  3CCE T;  2ED1 A;  1VQK A;  2AZS A;  4CC2 A;  4V2S A;  3SFM A;  2DF6 A;  2EYX A;  5FU7 C;  2XID A;  1YJN A;  1QCO A;  3CCQ A;  1NJI R;  2R58 A;  3UF4 A;  3OYL A;  3ME9 A;  5GJW B;  3V7S A;  1BB9 A;  3OY9 A;  3CMA T;  2GF7 A;  3NTK A;  1W4S A;  5GAN f;  2FYK A;  3OYK A;  2LCS A;  5CQX A;  1YWP A;  2DER A;  1MND A;  4E7I A;  2VVK A;  3JCM f;  1M2V B;  2F2X A;  1N27 A;  1R8O B;  4PL6 A;  3VRY A;  2RHX A;  2HKQ B;  5HK3 A;  2O01 E;  4F7U A;  1Z9Z A;  3VS0 A;  3TCJ A;  2QTV A;  2Z0W A;  4ELZ C;  3L2U A;  1NM7 A;  4PJO F;  1PD0 A;  1RLP C;  2QEX T;  2ECZ A;  2RA2 A;  1WIE A;  3FB9 A;  2VGM A;  2ATC B;  1HXD A;  4D6W A;  5CKE A;  5GAM f;  2YRV A;  2ZGW A;  2V8I A;  2GGR A;  3QO3 A;  1K0X A;  1BK2 A;  1M1K U;  1W6X A;  2HQH A;  4AFS C;  4OB3 B;  2E65 A;  1ZUK A;  2RO0 A;  1KD1 C;  2L3R A;  3LX7 A;  1VQ8 T;  4AG1 C;  1V76 A;  2J6F A;  2QDY B;  3CD6 A;  1HJD A;  1ZQ1 A;  1YI2 Q;  4F7U F;  4M78 B;  4FT2 A;  1M2O A;  3OBW A;  1X6G A;  1BI1 A;  1IB8 A;  2E3H A;  2LTO A;  5KYW B;  1PKS A;  1TTH B;  3M54 A;  2GTO A;  1M3B A;  3HFO A;  1S72 Q;  2QXF A;  2KXC A;  3HSB A;  5J3B A;  1FWZ A;  4JZ4 A;  2RMO A;  5KE3 A;  1K9A A;  5A2Q E;  2CT4 A;  1YHQ T;  1PCX A;  2VWF A;  4FM4 B;  4XTU A;  1WLP B;  4A4G A;  4M78 A;  1MGQ A;  1KFZ A;  1G8X A;  3EFO B;  2DTH A;  3M0R A;  2ZPE B;  2DL4 A;  1UGR B;  2PZ1 A;  3RIR A;  2EJG A;  2COZ A;  1E7O A;  3H0I A;  1Q82 C;  4RTU A;  2MPX C;  3QZ9 B;  3CXC S;  5GAN 2;  2X3X D;  2QQS A;  4YTL A;  1BCM A;  5FU6 B;  1M2V A;  3JCM J;  1UGS B;  2O31 A;  1NJI C;  2HNI A;  4BUG A;  1ACM B;  2RD1 A;  1WHG A;  3RMS A;  3H41 A;  1F1B B;  3G4S Q;  1M1K R;  2LMJ A;  5KYN A;  1KJW A;  2O4X B;  3GF5 A;  2EYZ A;  3SWN A;  4DEX A;  2DEU A;  1QWF A;  1VQM Q;  4LDX A;  3JCM g;  4E7J A;  4OMQ A;  2KK4 A;  3VS5 A;  2RJD A;  4KUD K;  2QAZ A;  2AKL A;  2ZPH B;  2ESW A;  2H3J A;  2FG0 A;  4LUD A;  1YJW T;  5GAN 6;  4M7D G;  1H3H A;  5I11 A;  2FVU A;  4BDY A;  5GJV B;  2QK0 A;  4L59 A;  2K6D A;  1RAE B;  2QA4 T;  2DL8 A;  5GAM e;  2DX1 A;  2A3L A;  1OU8 A;  5GAN 8;  2RHU A;  3ZBD A;  1OPL A;  3AT1 B;  4PJO C;  2RHZ A;  3NGP A;  3J81 E;  2YT6 A;  3JCM W;  4JRP A;  2K5L A;  2AK5 A;  2F1L A;  4C92 D;  4C5E A;  2MAM A;  2CH4 W;  4PJJ A;  2KEA A;  2QI2 A;  3TEE A;  1ZSZ C;  4PFO A;  3JB9 F;  2VC8 A;  4L5G A;  1VYT A;  3EG9 B;  3SB2 A;  1WHJ A;  1VQN A;  3I35 A;  3QYG B;  5LJ5 g;  3PT9 A;  4M7D D;  1GXI E;  2JS2 A;  1BI3 A;  1WPY A;  3CQT A;  3PVL A;  4FT4 A;  5GAN 4;  4M75 B;  1U3O A;  4R55 A;  4EDU A;  1Q7Y U;  2C06 A;  2V8K A;  4CC7 A;  3DLL A;  1I5L A;  3VKI A;  1M90 U;  3CCU Q;  1VQP Q;  1ZUY A;  1WHL A;  2KMT A;  4QVC A;  2YRC A;  1MV3 A;  4QQG A;  5C6S A;  1V1C A;  1JQQ A;  3RR6 A;  2J6K A;  4RG8 A;  1MMN A;  4M7A E;  2W10 A;  2XHC A;  4QKU A;  4LDW A;  2X9H A;  3UA6 A;  5CQY A;  1U06 A;  2SEM A;  3MCA B;  3CCV Q;  3QUI A;  2FRY A;  1D3B A;  2JN0 A;  3EGD B;  4HKE A;  2L3Q A;  4ELY C;  5GMK j;  3A8M B;  3WVE B;  4BB7 A;  2EWN A;  4XU0 A;  4M77 D;  2HCK A;  1Y07 A;  1V29 B;  4JZ3 A;  5GMK m;  2YUN A;  4C8Q C;  4JDS A;  3OYJ A;  2YUP A;  5D6X A;  1YI2 A;  3NMZ C;  5I21 A;  1WHH A;  2R5M A;  1W2B A;  1N8R C;  2KRN A;  2JXB A;  3RBB B;  1QP2 A;  5GAO q;  4XU1 A;  1IGQ A;  1JO8 A;  3TU4 K;  2I2L A;  1G5V A;  2OTL T;  1PSE A;  2EKH A;  3WVD B;  3CXC A;  4D8D A;  5GMK l;  2EYY A;  2EYW A;  2EQI A;  4DBR A;  1HK9 A;  4J9B A;  4AFU C;  3CC2 T;  1HSQ A;  1LVK A;  3CPW S;  3CPW A;  2FO0 A;  3M9Q A;  1VQ8 Q;  3FLG A;  1Y96 A; 
#chains in the Genus database with same CATH homology
 2X3W D;  2CT3 A;  1K1Z A;  2KYB A;  4AFZ C;  1QCF A;  2C0O A;  1X43 A;  4IIO A;  1M8M A;  3I9Q A;  1AOJ A;  1AWO A;  4Z8A A;  4WCI A;  4RTZ A;  1QWE A;  2M51 A;  2EPD A;  1OPK A;  4RTY A;  1AEY A;  2LX7 A;  4JJB A;  2O2O A;  2W0Z A;  1NYG A;  1WI7 A;  2RN8 A;  4LUE A;  1RUW A;  2PNI A;  1AWW A;  2KT1 A;  4LE9 A;  3EGU A;  3SHW A;  2DL7 A;  3R6N A;  3GBQ A;  2EVR A;  4ZNX A;  4DEY A;  2ENM A;  1PWT A;  1RLQ C;  2DBK A;  2SRC A;  2L3P A;  4CC4 B;  2OAW A;  1JXM A;  1JU5 C;  2LQN A;  1B3Q A;  2D8H A;  1HD3 A;  1GCQ A;  2CDT A;  3RNJ A;  3THK A;  2V1R A;  1MV0 B;  2V1Q A;  2DE0 X;  2RQU A;  5HCK A;  2P4R A;  2JW4 A;  3REA B;  2IIM A;  1SSH A;  2YSQ A;  3NPF A;  3A98 A;  2C0I A;  2FPD A;  1PRL C;  2DRM A;  2D0N A;  4JPB W;  2J6O A;  2AKK A;  1WYX A;  1Y0M A;  4OMP A;  2KRM A;  2BZY A;  2YUO A;  4X1V A;  2KNB B;  1YN8 A;  2ED0 A;  4AFQ C;  4Z88 A;  1X2K A;  1UHF A;  2DNU A;  1OV3 A;  2YUQ A;  3VRZ A;  2JT4 A;  4F16 A;  2A28 A;  3EG0 A;  4J9F A;  2FPE A;  4RTV A;  3EG3 A;  2DIL A;  2M0Y A;  4HVU A;  2RQT A;  1NG2 A;  2L0A A;  1KIK A;  2D1X A;  2KRS A;  2MIO A;  2ED1 A;  3ULR B;  1PKT A;  2MOX A;  2AZS A;  4CC2 A;  2DF6 A;  3U23 A;  2EYX A;  3FJ5 A;  2ROT A;  4CC3 A;  2JM8 A;  2XMF A;  3PVQ A;  1WFW A;  2JMC A;  2K79 A;  3UF4 A;  4RTT A;  1PNJ A;  5GJW B;  4D8K A;  1BB9 A;  4HVW A;  2CH4 A;  2HBW A;  5ECA A;  1ABO A;  3NHN A;  1I07 A;  2KBT A;  2DJQ A;  2QDL A;  2LCS A;  1M30 A;  3I5S A;  2KR3 A;  1T3L A;  1UG1 A;  2A08 A;  1YWP A;  1A0N B;  3JV3 A;  2RQR A;  2VVK A;  1UTI A;  2CUB A;  2DL5 A;  2F2X A;  1PHT A;  1SHG A;  3VRY A;  2GTJ A;  1G83 A;  2D8J A;  4FSS A;  3EG1 A;  1Z9Z A;  2DLP A;  1K0S A;  1W70 A;  2CSI A;  3VS0 A;  1TUC A;  5EC7 A;  2JTE A;  4A63 B;  1JXO A;  1NM7 A;  1UJ0 A;  2C0T A;  1RLP C;  1GFD A;  2KYM A;  2ECZ A;  2DVJ A;  2O9V A;  4JJD A;  1WIE A;  5IXF A;  2KRO A;  2LJ0 A;  1OEB A;  1VYU A;  4ESR A;  2RPN A;  3EG2 A;  4LN2 A;  2B86 A;  2RQV A;  3UA7 A;  3EHR A;  2GGR A;  3M0S A;  1N5Z A;  3LH5 A;  4Y92 A;  1J3T A;  1K0X A;  3QWY A;  1BK2 A;  5FWC A;  1M3A A;  1W6X A;  1WX6 A;  4AFS C;  1ZUK A;  1NLP C;  2NUZ A;  1JEG A;  1H92 A;  4AG1 C;  2J6F A;  1HJD A;  2LJ1 A;  2EGE A;  1UJY A;  4OMO A;  3VS4 A;  2EBP A;  1EFN A;  2K9G A;  3VS7 A;  1X6G A;  1PKS A;  4F17 A;  5IHN A;  1AD5 A;  2GTO A;  1M3B A;  5IH2 A;  1MUZ A;  1ZLM A;  2VKN A;  1E6H A;  1GRI A;  2KXC A;  1GFC A;  3TVT A;  4JZ4 A;  2FRW A;  2RMO A;  3SEM A;  1W1F A;  1E6G A;  1QKW A;  1B07 A;  1AWX A;  2DMO A;  1K9A A;  2K7A A;  4OMM A;  2A36 A;  2CT4 A;  2DYB A;  3C0C A;  1CKB A;  2VWF A;  1K76 A;  3EHQ A;  4J9C A;  1X69 A;  2JMA A;  2LNH B;  1WLP B;  2I0N A;  1WXU A;  1NYF A;  1KFZ A;  2L2P A;  4J9G A;  1UUE A;  2O9S A;  3M0R A;  1BU1 A;  3PE0 A;  4OMN A;  3VS1 A;  2DL4 A;  2PZ1 A;  2RF0 A;  4Z89 A;  1E7O A;  3H0I A;  4RTU A;  2RQW A;  5I22 A;  1SPK A;  1G2B A;  1NEG A;  2HDA A;  2X3X D;  1Y57 A;  4LNP A;  2CUD A;  4GLM A;  2O31 A;  2ROL A;  1GBQ A;  2A37 A;  2BZX A;  3QWX X;  1SEM A;  2O88 A;  1S1N A;  3H41 A;  1SRL A;  1IO6 A;  2DL3 A;  2LMJ A;  3I5R A;  2EGA A;  1KJW A;  4HXJ A;  2KXD A;  3KFV A;  2J05 A;  1U5S A;  2LQW A;  1XOV A;  5FWB A;  1UGV A;  2EYZ A;  4DEX A;  2BTT A;  1AZG B;  1YCS B;  1QWF A;  3ZL7 C;  1KSW A;  1YWO A;  1UFF A;  2GBQ A;  4OMQ A;  1X6B A;  2GNC A;  3VS5 A;  1TUD A;  3TSW A;  2AKL A;  1GBR A;  2ESW A;  2KT8 A;  2FG0 A;  4LUD A;  1H8K A;  1H3H A;  5I11 A;  2LZ6 B;  2G6F X;  2F2V A;  1T0J A;  5GJV B;  1LCK A;  2HSP A;  2CSQ A;  2K6D A;  2DL8 A;  2H8H A;  2DX1 A;  2KE9 A;  4J9I A;  1Z9Q A;  2BZ8 A;  4J9E A;  1OPL A;  4RTX A;  1ZUU A;  2ABL A;  2K2M A;  3NGP A;  2YT6 A;  2GQI A;  3VS6 A;  1VA7 A;  2AK5 A;  2AZV A;  1GL5 A;  2CH4 W;  2KEA A;  2OI3 A;  1CKA A;  3H0H A;  4F14 A;  4KRT A;  4E6R A;  1VYT A;  1PRM C;  1I1J A;  2DM1 A;  3I35 A;  2EW3 A;  2KGT A;  2CRE A;  2J06 A;  2JS2 A;  4R0K A;  3TSZ A;  2F2W A;  5IHK A;  3CQT A;  3PVL A;  1U3O A;  2YDL A;  1X2Q A;  1AVZ C;  3VS3 A;  1ZX6 A;  4AG2 C;  1UHC A;  1SHF A;  2J7I A;  4CC7 A;  1WDX A;  3UAT A;  2EGC A;  5IXB A;  1SRM A;  4EIK A;  1YP5 A;  1ZUY A;  4OML A;  1VYV A;  1OOT A;  1RI9 A;  1MV3 A;  1X27 A;  1NEB A;  1NLO C;  1T3S A;  1V1C A;  1JQQ A;  4J9D A;  2J6K A;  3VS2 A;  1WXT A;  5IHI A;  2PTK A;  2W10 A;  4GBQ A;  1WXB A;  4HVV A;  3UA6 A;  2E5K A;  4QT7 A;  1U06 A;  2SEM A;  1ARK A;  2FRY A;  1BBZ A;  2LP5 A;  1AWJ A;  1AZE A;  4K11 A;  2L3Q A;  3REB B;  1K4U S;  5L23 A;  2HCK A;  1ABQ A;  3M0P A;  2FEI A;  4JZ3 A;  1WA7 A;  4HCK A;  2YUN A;  2DRK A;  5FW9 A;  2DA9 A;  3O5Z A;  2HEQ A;  2YUP A;  2K3B A;  1CSK A;  1GCQ C;  4J9H A;  3NMZ C;  4RUG A;  1ZSG A;  4RTW A;  2KRN A;  2DBM A;  1UDL A;  1QKX A;  2JXB A;  3RBB B;  1T0H A;  1JO8 A;  2JM9 A;  1FYN A;  1QLY A;  1GCP A;  2RNA A;  2OJ2 A;  3M0Q A;  3M0T A;  2EKH A;  1ZBJ A;  2FPF A;  4IIM A;  4M4Z A;  1YNZ A;  4D8D A;  2EYY A;  2EYW A;  1I0C A;  2LJ3 A;  1TG0 A;  2JS0 A;  2EQI A;  1M3C A;  4J9B A;  1UE9 A;  3H0F A;  3IQL A;  4AFU C;  1FMK A;  1HSQ A;  2MCN A;  1UEC A;  4ORZ A;  3M0U A;  2L3S A;  1M27 C;  2FO0 A;  4JJC A;  2NWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...