1WLPB

Solution structure of the p22phox-p47phox complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
138
structure length
138
Chain Sequence
GSDITGPIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/signaling protein
molecule keywords Cytochrome b-245 light chain
publication title NMR solution structure of the tandem Src homology 3 domains of p47phox complexed with a p22phox-derived proline-rich peptide
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wlpB01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wlpB02
1XOVA 4EIKA 2YDLA 2DX1A 2DE0X 4JJCA 4J9DA 4DEYA 1I1JA 4RTXA 2FG0A 1ABQA 4F16A 1HSQA 2O88A 4JZ3A 2PNIA 1W1FA 1QWEA 4AFSC 4CC4B 1FMKA 4Z89A 1QCFA 1M3BA 5L23A 1AWWA 5IH2A 2EQIA 1Z9ZA 1AVZC 2DNUA 3H41A 1GL5A 4JZ4A 3EHQA 3M0PA 1E6GA 1T0JA 4RTYA 2FPDA 1JO8A 4CC2A 2X3XD 4CC3A 1M3CA 2PTKA 3UA6A 2OAWA 2B86A 2EPDA 1UGVA 2LZ6B 3IQLA 2DJQA 2YUOA 2RMOA 2ROLA 1CSKA 1OEBA 1TG0A 2EGAA 5FWBA 1KJWA 1ZUYA 3VS4A 1PKSA 2HEQA 4OMQA 4RTWA 4F14A 1U3OA 2DBMA 4QT7A 2HDAA 2KRNA 2CT4A 2YUPA 1M30A 2G6FX 2PZ1A 1UTIA 2FO0A 2GTJA 4Z88A 3REAB 2J06A 5FWCA 1UJYA 2CDTA 1AWOA 4J9GA 2M51A 3I5SA 2DF6A 2KYBA 2CH4W 1WXTA 1IO6A 2ESWA 1X2QA 2KYMA 1PNJA 2K3BA 2KROA 3M0SA 2LJ0A 2L3SA 1UG1A 1BK2A 1WDXA 1K0SA 2EGCA 3M0QA 1NLPC 4CC7A 1KIKA 3VS5A 2D8HA 2ENMA 2SRCA 4RTUA 3GBQA 1KFZA 3VS0A 1ZBJA 2RQWA 4D8KA 2A36A 2KNBB 2O9SA 1OPLA 1B07A 3PE0A 2VWFA 2K7AA 3R6NA 2C0OA 5GJWB 1X6BA 2HCKA 2BZXA 2EYZA 4LE9A 1ARKA 2VKNA 5IHNA 4OMMA 2KRSA 1WX6A 1X2KA 1SRMA 2LCSA 2GBQA 3M0RA 4HCKA 1NYGA 4ORZA 2LQNA 3EG0A 1GBRA 1GFCA 1FYNA 1UFFA 1CKAA 2MIOA 2AZSA 4GBQA 1K4US 4OMLA 4F17A 2O9VA 2RNAA 4AFUC 1QLYA 2EKHA 1SHGA 1I07A 1RI9A 2FEIA 1NEGA 1AWJA 4GLMA 1GRIA 4OMPA 1NM7A 4LUEA 2ED1A 2AKKA 2GNCA 2RN8A 2I0NA 2DRMA 1NG2A 4RTZA 4J9EA 2JW4A 2L2PA 2BTTA 3VRZA 1YN8A 2D8JA 1BBZA 2SEMA 4R0KA 3UA7A 1LCKA 1UDLA 2IIMA 3I9QA 2DL4A 4ESRA 4J9HA 2FPFA 2O31A 3ULRB 1UECA 2LJ1A 2HBWA 1K0XA 1SSHA 1ZX6A 2ABLA 2JT4A 3FJ5A 3VS2A 5IHKA 3NGPA 2ECZA 4Z8AA 2W10A 1G83A 1JQQA 3A98A 4D8DA 1JEGA 4A63B 2LJ3A 4ZNXA 2ROTA 2NUZA 2BZYA 4HVVA 4J9IA 4AG1C 1PWTA 4JPBW 1NEBA 1KSWA 1M8MA 1YWPA 2JS0A 3NMZC 4AFZC 3RNJA 5GJVB 1G2BA 2D1XA 1OPKA 2NWMA 2GTOA 3O5ZA 1M3AA 4DEXA 1X27A 4AG2C 3EGUA 2LP5A 1UE9A 1TUCA 2KE9A 3U23A 2KRMA 2QDLA 5EC7A 2EGEA 2VVKA 2KXCA 1W70A 1GFDA 2OI3A 4E6RA 2DL8A 4RTTA 1U5SA 2RQTA 4HVWA 1JXMA 1UUEA 3PVQA 1X43A 1ZSGA 2D0NA 1A0NB 1E6HA 2KBTA 2KT1A 1CKBA 1TUDA 2CREA 4RUGA 2F2XA 2W0ZA 3NHNA 1SEMA 2DLPA 1M27C 2K79A 2KR3A 2JM9A 2V1QA 5IXFA 3H0FA 3C0CA 1WXUA 2GQIA 3VRYA 4IIMA 5ECAA 1AZGB 2JS2A 4LN2A 2A08A 1U06A 2CUDA 3SEMA 3VS6A 2F2WA 2F2VA 2AK5A 1HJDA 4AFQC 1B3QA 2L3QA 3H0IA 4JJDA 2MCNA 2FPEA 2RQUA 1JXOA 2DBKA 3VS7A 2AKLA 3NPFA 1PHTA 1RUWA 2L3PA 4J9FA 1X6GA 2YUQA 4WCIA 1GCQC 1PKTA 4J9BA 2K9GA 4HXJA 1K76A 2DILA 1AZEA 2L0AA 1ZUUA 2A37A 3JV3A 1WYXA 2HSPA 2JXBA 3QWYA 2RQVA 4OMNA 1J3TA 1NYFA 2JTEA 1Y57A 2EBPA 3RBBB 4M4ZA 2P4RA 2ED0A 4RTVA 1H8KA 2KGTA 2X3WD 2K6DA 1UJ0A 2EVRA 3H0HA 2K2MA 1SPKA 1RLQC 3EHRA 1W6XA 1WLPB 2DVJA 1AOJA 1WFWA 2JM8A 2M0YA 1YP5A 4JJBA 2MOXA 5I11A 1SRLA 3I35A 2RF0A 1T0HA 3EG2A 1K9AA 2DM1A 2RQRA 1PRLC 1GCPA 2LX7A 5I22A 3VS1A 2DMOA 1S1NA 1MV0B 3TVTA 1AEYA 1JU5C 1YCSB 2J7IA 4HVUA 3ZL7C 2KEAA 3PVLA 1VYTA 1QKXA 3UATA 2JMCA 1MUZA 2DRKA 4K11A 1BU1A 2AZVA 2BZ8A 2EW3A 3CQTA 1ZLMA 2CSQA 2DL3A 1WIEA 5HCKA 2DA9A 2C0TA 1K1ZA 2KXDA 1YNZA 1BB9A 2EYYA 2LNHB 1VA7A 3I5RA 1NLOC 3VS3A 2CH4A 4KRTA 2EYWA 1ABOA 3KFVA 3TSZA 2GGRA 2V1RA 1T3LA 1AWXA 5FW9A 2EYXA 1H92A 4J9CA 2E5KA 1ZUKA 3EG1A 4LNPA 2JMAA 1QWFA 3M0TA 1V1CA 2KT8A 1VYUA 2FRYA 1N5ZA 1OV3A 2OJ2A 3SHWA 1UHCA 1WXBA 2LMJA 3EG3A 1WI7A 4X1VA 2RPNA 1YWOA 3M0UA 4FSSA 5IHIA 1GCQA 1I0CA 5IXBA 2A28A 3QWXX 2J05A 4OMOA 1HD3A 2H8HA 2YUNA 4LUDA 1OOTA 2CT3A 4IIOA 3LH5A 2CSIA 1UHFA 2FRWA 1AD5A 2CUBA 2DL5A 3REBB 2YT6A 2DYBA 1X69A 2C0IA 1T3SA 1MV3A 1WA7A 2DL7A 1VYVA 1EFNA 1SHFA 1Y0MA 3THKA 1H3HA 3TSWA 1E7OA 1QKWA 2O2OA 2XMFA 3UF4A 1Z9QA 1RLPC 2LQWA 1GBQA 2J6KA 2YSQA 2J6OA 1PRMC 2J6FA 4Y92A
chains in the Genus database with same CATH superfamily
4EIKA 1OULA 1I1JA 4C92C 2C06A 4M75G 4HT8A 1UGPB 4AFSC 2RO0A 1FMKA 1QCFA 2CZ6B 4TVRA 5L23A 2XICA 2EQIA 4X9DA 5GAOr 1AVZC 2JZ2A 5L8RE 4DBRA 3M0PA 2KMTA 4E7KA 3SWNC 4PJOG 2XD0A 2FPDA 1JO8A 4CC3A 1M3CA 4HA8A 2KQWA 2LRQA 3JCMe 2RH2A 2E4HA 1M9SA 5A0GA 3JCMV 3OYNA 2B86A 4XAXB 2LZ6B 4QVCA 1WQWA 3OYHA 2X51A 1C6VX 4M7AG 3LGLA 5FWBA 4JRIA 4ME7A 1U8RA 3EAEA 1R0CB 3CPWA 3CCEA 1QVGA 2QK0A 3CCSA 3CXCP 3JCMg 5FROA 3GP8A 4OMFB 3JCMQ 1M30A 2G6FX 4ELYC 4A4EA 1IRXA 4DA4A 2GTJA 1HYOA 3QXEB 2M1HA 1VQOA 1AWOA 4IUTA 2K5IA 2JN0A 4KGVB 1VQ4T 1YIJT 1K9MR 5CCAA 1X2QA 1PD0A 3A8GB 1VQ4Q 2LQKA 3M0SA 4C0GA 4IUUA 5GAMf 1C1AA 2HBPA 3FRNA 1I5LA 4KH1B 3RERA 2KSSA 1BK2A 3M0QA 4OP0A 3CMEA 1KIKA 2EJFA 2K4YA 1R0BG 5GAN3 4J5YA 5GANd 3M57A 4QW2A 4FW2A 3GBQA 3HFNA 1KFZA 1C0MA 4DQ2A 2HKNA 1KQSA 2RQWA 2DTOA 4PJNA 2O9SA 1B07A 4OGCA 3PE0A 5GJWB 3BE3A 3M59A 2EYZA 4MDWA 3CPWS 4ZTJA 1OX9A 4QVDA 1Q86R 2L89A 5IHNA 1QVGS 1MNDA 3PNWC 4IKFA 2KRSA 4C5IA 2QA4A 3RKXA 4JRQA 4NL3A 2QEXA 1VQ6T 1MMGA 2LCSA 1FWZA 1BKBA 5KH6A 1RAFB 4XU1A 3F70A 4M7DB 4N0AA 1VQ6Q 1NYGA 2LQNA 2M0OA 1YCYA 2LDMA 1GBRA 2EYQA 4Y91A 1UFFA 1Q86U 2HKQB 4GY5A 3DLLA 5FLXE 1W2BA 1UGQB 3H8ZA 3MP6A 2RNAA 3FLGA 4EDUA 4A4KA 2MWPA 4AFUC 5HK3A 3M9QA 1QLYA 2YLCA 4M77G 1QQJA 1TH7A 2EKHA 2GCXA 1JB0E 1I07A 2DJZA 2QDYB 3JCMJ 4GLMA 3QZ5B 4EMGA 1NM7A 1KQSS 1NG2A 1K73R 5CKDA 1KQ1A 3L2RA 2JW4A 4L6V5 3CCRT 2L2PA 4FYXB 1VQPQ 3CC7T 1Q82R 2RB6A 3MPUB 3OYGA 2DETA 3CC7Q 1OQKA 3I55T 1K73U 2DL4A 2GFAA 4J9HA 3ULRB 1UECA 3I55Q 1YJNT 1NJIR 1K0XA 1KHIA 1Q82U 3VS2A 3JCMW 1NZ9A 4Z8AA 4D8DA 1JQQA 4NOYA 3UWNA 1JEGA 1YJNQ 3OS5A 4DBFA 1OI1A 4MZPA 2EAYA 4FU6A 1W2BS 1M8MA 1LPLA 1G2BA 4C92G 1NJIU 2O4XB 4F7UE 2JTFA 3ME9A 1B34B 3OYFA 3MJXA 1BIBA 2NWMA 1QVGP 4AG2C 3EGUA 1R8OB 3CBOA 3GNFB 1D1BA 2YRDA 2PUOB 3V7CA 2KRMA 5EC7A 2V8KA 1W70A 4E6RA 2MWOA 3TU4K 1Q81C 1Y96B 4FW1A 4QKUA 1BIAA 1Y7XA 1X43A 4AMCA 3O8VA 1ZSGA 3X24B 5CIUA 2KT1A 2EJ9A 5FU7B 1CKBA 1LJOA 1TUDA 2CREA 3QHSA 4RUGA 2X9HA 1VQKA 2F2XA 1YJWA 2K79A 3RKYA 2R57A 5IXFA 3OYBA 3H0FA 3C0CA 2DFUA 2VGNA 2ZAEA 2JS2A 3NTHA 3A8OB 1U06A 1TOVA 4C8QE 3L2ZA 2L3QA 3H0IA 2MCNA 1R77A 3VS7A 1S72T 1KQSP 1KD1C 3NPFA 2BIVA 2E64A 3G6EA 4J9FA 2BUDA 1X6GA 2KY9A 1S72Q 4M75E 1PKTA 2K57A 4J9BA 1Y96A 4LD9K 4M78G 4N4GA 3JCMf 2A37A 2DK3A 5GANe 1EZZB 1WYXA 2JXBA 2CGHA 2FVUA 4BD3A 3TQ7P 2DEUA 3N5BB 1VQMA 4RKUE 4RTVA 2DTHA 1D0XA 2E3IA 3L2UA 3A8HB 1RLQC 1W2BP 1I81A 5GANg 2KI7A 4JJBA 4JLGA 3I35A 4DBHA 4J6WA 3LW5E 3URGA 2RF0A 4M7AE 4RG2A 3EG2A 2BE7D 1NBEB 2K3XA 1PRLC 1GCPA 3OMGA 4JDSA 4V2SA 4HVUA 2KEAA 3PVLA 4OGEA 3LH0A 2DRKA 4K11A 3VKIA 4J7FA 2QAZA 1VQNA 2HZYA 3CQTA 2RHZA 2V26A 2ZPEB 1YNZA 3MEAA 2DIQA 1IB8A 2H3JA 3VS3A 4IUPA 2CH4A 3E9GA 3EFRA 4KRTA 3CCET 2EYWA 3KFVA 3CCST 2GGRA 9ATCB 1AWXA 4XQ3A 3I56A 3CCEQ 5GAOn 4M75C 3V8JA 1FX7A 1TTHB 3OYCA 5FU6C 2YWWA 4BACA 1VYUA 4ZN1A 1H3ZA 1G3YA 3CCLA 3SWNB 2OJ2A 3FC3A 3CC2T 1G3TA 1UHCA 2KDSA 2DVEA 3CCUA 1WXBA 3EG3A 1WI7A 2XIDA 3M0UA 1RABB 3L2WA 3PIOA 1GCQA 3CC2Q 3QDFA 3PFSA 1YI2T 2V8JA 3CMET 4FCYA 3GIBA 1N6AA 1OX8A 3QO3A 2JVVA 2E6NA 4IIOA 1YI2Q 3CMEQ 5CK9A 1UHFA 2HAXA 4M7AC 3OYMA 3M55A 1WQ7A 3EGDA 1D3BB 2X4XA 1MV3A 3M4GA 1UGRB 1EFNA 3FIFA 2VUBA 5AT1B 2KAFA 2LT4A 4X9CA 1E7OA 4ZTFA 1QKWA 2O2OA 1N9RA 1YITA 4N4IA 3UF4A 5KYYA 1RLPC 4Z02A 1SF9A 2QA4T 1TS9A 4M77E 2QEXT 2J6OA 1XNIA 1IGUA 1XOVA 4O5VA 2YDLA 2QA4Q 2ZCFB 4JJCA 4RMOA 3OS0A 4DEYA 5LL6S 4PJLA 3LWHA 2FG0A 2HMAA 1WHMA 1M1GA 2DIGA 4F16A 5IAYA 2FL7A 2O88A 2PNIA 2DEQA 1IHVA 1QWEA 2WACA 3JSCA 2YRVA 3OYIA 1AWWA 1M1FA 5IH2A 1QCOA 4IURA 3CXCA 2DNUA 2A3LA 4JZ4A 1D3BA 1E6GA 1TXQA 3LX7A 3TCJA 2RHXA 2PTKA 3ZFJA 2EPDA 3G1JA 1RAGB 2K5LA 4OB3B 4KUIA 3VU3C 1KC8C 2X4YA 1PKSA 1G3SA 4F14A 3CC4T 3RMQA 1IREB 1M2VA 2QGGA 2MAMA 5FRNA 3CC4Q 4BE1A 2FO0A 3REAB 2J06A 5A0LA 1SKUB 2LNVA 4J9GA 2M51A 2QQAA 4M77C 2KYMA 2P84A 1PNJA 1Q7YC 2LJ0A 1RI0A 1UG1A 2FHDA 2EGCA 4M7DF 4CC7A 5DM7R 4FYVB 3D7SB 2F5TX 5CKHA 3EGXB 4RTUA 4BI3A 3VS0A 2CZ7B 3META 2A36A 2KNBB 5FRMA 2K7AA 2RI2A 2C0OA 1X6BA 1VQKT 1YJWT 4JJNK 3QYGB 3TEEA 4RCCA 4A54A 4C5GA 2L5QA 4D6WA 4BE0A 4OMMA 1VQKQ 4PNOA 1YJWQ 3HSBA 1WX6A 5KE3A 4PJOF 5CQYA 1VQ8A 4M78E 3EH1A 2GBQA 3VYGA 2P0KA 1VQ7A 2AT1B 4QQDA 1GFCA 4J6XA 3A8LB 3C12A 2MIOA 4GBQA 3ZBDA 1DJ7B 3G6ET 2O9VA 4XTZA 3S3NA 2O01E 3G6EQ 3C94A 1SHGA 2MPXC 3QBYA 2VV5A 2FEIA 2Y4XA 2XDPA 4R55A 3LGFA 1VQMT 4HT9A 2ED1A 2GNCA 1YBYA 2I0NA 4LXCA 1VQMQ 3ER0A 3VYHB 2BTTA 5GMKi 2SEMA 2R5AA 1JBMA 4BE2A 3RDVA 3CBPA 1WHJA 2L8DA 1BI3A 4J6YA 2RJDA 4E7HA 2E3HA 4LDXA 4JS5A 3L2VA 2LJ1A 4MMKA 3SB2A 1PC0A 2ZPHB 1N9SA 2KK4A 5D6XA 5IHKA 3OY9A 2ECZA 3INZA 2K2VA 2ROTA 2RI5A 4J9IA 3PIPA 1YWPA 1KQ2A 3EG9B 2P4TA 4AFZC 3RNJA 1VQNT 4M78C 1RAAB 2EJGA 5GJVB 4A53A 1V29B 1YIJQ 4F7UB 1VQNQ 2D1XA 2R5MA 4HCCA 3A8MB 2ZPBB 1XTDA 1I8FA 3LYIA 2LP5A 1PM3A 3I56T 1K9MU 3U23A 2QDLA 1GFDA 2RI3A 2OI3A 3E2UA 5LJ3e 1WJRA 2MMPA 4RTTA 3I56Q 3CCVA 5GAOp 2ZPIB 3PVQA 1VQLA 2QQBA 2D0NA 1SG5A 2KBTA 3CCLT 3TREA 3CCQA 3CCUT 2NUPB 3NHNA 1SEMA 2KR3A 3CCLQ 5A0DA 3GLXA 2V1QA 3P8DA 4Y28E 1WXUA 1PSFA 2GQIA 2YRCA 5LJ3g 3CCUQ 3QDRB 2DZ9A 3EG9A 3EFOB 5KYXB 4KT0E 3BW1A 1FMWA 2HSEB 2F2VA 2OAUA 3CD6T 3OW2A 1HJDA 1B3QA 2GFUA 1SSFA 5DY9A 4C8QB 4YTLA 2CZ0B 4XK8E 1IGQA 3CD6Q 2MI6A 4KULA 2AKLA 3OYAA 1VIEA 4J8OA 5LJ5e 4WCIA 2QQSA 4PK4A 2CZ1B 4M75B 2K9GA 4HXJA 1K76A 3NTKA 4L59A 3MHXA 1NPPA 1YITT 5CR2A 1J3TA 1Y57A 1YITQ 2ED0A 1TUGB 2D9TA 4RCBA 5LJ5g 4PJOB 1M90C 2E41A 3C95A 2D6FA 1Y07A 2EVRA 1EX4A 2NYSA 3HTRA 4BUGA 2LQ8A 4EMKC 1WLPB 4II1A 4LDYA 4C92F 1WFWA 4L5GA 4M7DA 4P5NA 5I11A 2RD1A 3CCRQ 4M7AB 1T0HA 4E7IA 4B6MA 5GAMh 4F04B 3JB9I 4BI4A 1HK9A 3VS1A 2DMOA 3H6ZA 3TVTA 3HRUA 2OTJA 3OW2S 3OS2A 1JU5C 3EH2A 3M53A 1VYTA 2XHCA 2JMCA 1TU0B 5GAMj 5I21A 2JJ9A 3QUIA 3RKWA 1GXIE 1WIEA 5HCKA 2DA9A 1F1BB 2KXDA 2EYYA 1D0ZA 1VA7A 3I5RA 3JB9F 3MP1A 3QYHB 3QG1A 4PJOA 2GF7A 2K3YA 4QVZA 2CS7A 2V1RA 1T3LA 4M7DD 1M1KR 4J9CA 1ZUKA 5GAMd 1K8AC 1ZSZB 2VB6A 3EG1A 3H9NA 1QWFA 4AT1B 1M8VA 1V1CA 3KBGA 2DO3A 3WXMB 3M54A 1M1KU 4X34A 4A4HA 5DLOA 1MMNA 4B9XA 1QP3A 4JLIA 2PQWA 2QI2A 1I0CA 5IXBA 2A28A 3DKMA 2J05A 5GAN8 2H8HA 4C0DB 2ZPGB 2DERA 4PJOD 2CT3A 1OU8A 3J81E 4OVAA 2CSIA 3HHTB 3ZEHA 3SFMA 2FRWA 2O4XA 1B34A 2YT6A 1X69A 1BCOA 2C0IA 3DLMA 3RMSA 3THKA 2YXYA 4EMHA 3TSWA 2IPOB 4ZGEB 2XMFA 3LWIA 1VQ9A 2J6KA 2YSQA 4M77B 1PRMC 2J6FA 1VQ8T 5I2MA 3M5AA 1WHGA 3OW2P 3QZ9B 3FDRA 1VUBA 1U1TA 1VQ8Q 1VQ7T 4RTXA 2E5QA 1YJ9A 1ABQA 2EQUA 2WSFE 2VXEA 1N8RC 2YLBA 2NUTB 5KYWB 1M3BA 1Z9ZA 3AT1B 3VV0A 1D0YA 3FB9A 1O9SA 4N0AC 1Q95G 3QPHA 2QYZA 3UA6A 1M2OA 2OAWA 1YHQA 3IQLA 3GF5A 2DJQA 5I2SA 2RMOA 1X6OA 2ROLA 2RHUA 3BDUA 5D6YA 1TG0A 3KUFA 3HL8A 1ZUYA 2AHJB 4RTWA 2VXFA 5LJ3f 1U3OA 4QT7A 2HDAA 2CP5A 2KRNA 4C92B 2M9UA 5GMKh 1UTIA 4Z88A 2MYSA 3E9FA 3CCSQ 2JNGA 1UJYA 2CDTA 2Z0WA 2DF6A 4CRIA 1VQOT 3CCJA 5CQXA 1M4ZA 4ZGJB 1IO6A 5GMKj 1VQOQ 3VJPA 4B9WA 2A0FB 5GAN7 1RAHB 2V8IA 1K0SA 2MK5A 3UT1A 1D1CA 1NLPC 1P92A 2DD5A 2EIFA 3HRTA 3VS5A 2D8HA 1TSFA 2ENMA 3JCMh 2FZGB 1XJWB 3OYKA 2X35A 5LJ5f 1RAIB 2QQRA 1ZBJA 4D8KA 4C92A 3CCVT 4LDWA 1OPLA 2CKKA 3SD4A 3R6NA 1MHNA 3RR6A 3JCMb 2KVQG 4ZN3A 3CCVQ 2BZXA 4PFPA 4LE9A 2VKNA 3OYDA 1VQ6A 5GAOl 3OBYA 5GAMe 5GAN2 3ASKA 3T9NA 4M78B 4HCBA 3SWNA 3P8BB 4HCKA 2QEXQ 1FYNA 3JCMd 1CKAA 2RA2A 1N27A 3PT9A 2MF2A 4DBQA 2RHIA 4OMLA 4F17A 2HQEA 4NS5A 4C92D 4KGXB 4C0ZA 1RI9A 4DOWA 6AT1B 4LDVA 2D0QB 2QXFA 1LOJA 1NEGA 1AWJA 3G4SA 3JAME 1VQPA 2AKKA 1QVFA 3X25B 2DRMA 1K8AR 4J9EA 1UB4A 3CCMA 5J26A 1Q81R 3M56A 2ZPFB 1QP2A 5GAN4 4F7UF 1Q86C 1YN8A 3CMAA 1WJQA 4E7SA 4R0KA 1OZ3A 3UA7A 1LCKA 2IIMA 3JB9D 3I9QA 3GOXA 2PVOB 4PL6A 2IVWA 1ZQ1A 1Q81U 2FPFA 2O31A 3X20B 1SSHA 2OTJT 3NGPA 1WNLA 2W10A 2EQKA 5GAOm 4R56A 4A63B 2ZGWA 4ZNXA 5CO7A 1ZBXA 4JPBW 1NEBA 2JS0A 2QASA 1RAEB 1KD1R 3JCMP 4XTVA 2EWNA 2GTOA 3O5ZA 1M3AA 1X27A 2HQXA 3OBWA 4ELZC 4C8QF 2KE9A 3V8LA 4EMKB 2CP3A 1K73C 2EGEA 2VVKA 2KXCA 1KD1U 1EIFA 5KYUB 1QVFS 1QMCA 1JXMA 1X75C 3HPWA 1RADB 4FL6A 4PFZA 1Q82C 2RHYA 1RACB 4M75F 3J7AF 2ATCB 2DXTA 3DB3A 1E6HA 5GANf 1PSEA 1YFNA 4O6JA 1IZ6A 4KBMB 2ZZDA 5KE2A 1NJIC 3VRYA 1AZGB 2QTVA 4LN2A 1G3WA 2A08A 4E7LA 2CUDA 3OSVA 3VS6A 2F2WA 5D7UA 3OYEA 2AK5A 5J3BA 3P8HA 3SDZA 4KH0B 3OA6A 2RQUA 3FJPA 2L3PA 2X4JA 4VUBA 4M7AF 1GCQC 3GNGA 3EGXA 4MZTA 3S3OA 8ATCB 2HQHA 1OYXA 4M7DG 2RK1A 3JV3A 2HSPA 1HXDA 3QWYA 5GMKe 1PCXA 1VQ9T 2QGFB 2JTEA 1KHCA 4M4ZA 1VQ9Q 1IHWA 1H8KA 2KGTA 2K6DA 1YJ9T 2K2MA 1W6XA 2DVJA 2M0YA 1YJ9Q 1YP5A 2QQ9A 3A5ZB 2MOXA 1UGSB 3BFMA 2YHTA 3G71A 5D6WA 1K9AA 2DM1A 4BY6C 2RQRA 2VASA 1MV0B 4EPCA 4KUDK 1AEYA 1UEBA 1YCSB 3ZL7C 3MEWA 1QKXA 3MO8A 3UATA 1MUZA 1YHQT 1BU1A 4PJMA 1QVFP 1BYMA 4E2FB 4XTUA 5EG2A 1WGSA 2EW3A 1ZLMA 2CSQA 3WVEB 1YHQQ 3E19A 1K1ZA 1IXDA 2LNHB 3OYJA 1NLOC 1W4SA 4A4FA 3CPFA 3VUZA 5GANh 1OU9A 2EQMA 4XTYA 2XDDA 2A7YA 3M58A 1AHJB 4MDXA 1H92A 2E5KA 4WTOB 2LVMA 3JB9H 5GANj 4FT2A 2DYIA 1BI0A 3M0TA 2AIRB 3CCJT 3EFSA 3CC2A 2XU8A 2LT1A 2E10A 3CCJQ 2LMJA 4X1VA 1YWOA 1YI2A 2DD4A 5IHIA 3RIRA 4E7JA 4M77F 3QWXX 1B7TA 4IUVA 4LUDA 1OOTA 3A1PA 2DPPB 2LCLA 2XK0A 2CP6A 4ATOA 2CUBA 2DL5A 4F7UA 3REBB 3HP9A 2RM4A 2DYBA 1WJSA 4WF2A 2DL7A 1QCNA 4J7IA 1SHFA 4OB1B 1H3HA 4ANJA 1KC8R 4KGZB 3V7SA 3X26B 1Z9QA 2LQWA 3BY7A 1GBQA 2CP2A 2WSEE 1X01A 5FU6B 4JRKA 2GQVA 2CP7A 4UC4A 4LD6A 4Y92A 3L1AA 4E47A 2PU9B 2DX1A 2DE0X 2I2LA 4J9DA 2NUPA 3OS1A 2COYA 1MMAA 1KC8U 3QJYA 1VOMA 1HSQA 4JZ3A 3EFOA 1W1FA 5KYXA 3PMIA 4BI8B 2NLUA 4CC4B 3JCMX 5HKCA 4Z89A 1ZHIA 1Q7YR 4C8QA 4MZMA 3QSUA 3H41A 2QTXA 1GL5A 3EHQA 1T0JA 4RTYA 4QQ6A 4C0FA 4CC2A 2X3XD 3UPUA 1VQ5A 3G4ST 5J39A 1VQPT 1D1AA 4M75A 1TWBA 1UGVA 1Q7YU 3BDLA 3VUBA 2YUOA 3OQ5A 3G4SQ 3CCMT 2BKDN 1CSKA 1OEBA 4JUVA 3CMAT 3CC4A 2DXUA 2EGAA 1KJWA 3HFOA 3VS4A 3CCMQ 2HEQA 4OMQA 2XI9A 3CMAQ 2DBMA 2CT4A 2RJEA 2YUPA 3PMTA 1QW1A 2PZ1A 1FMVA 3M4YA 4C8QD 3V7RA 1I4K1 5FWCA 4PKCC 2JTMA 2OTLA 5KCHA 3I5SA 2KYBA 2E6ZA 2CH4W 3OMCA 3NTIA 4M7AA 1WXTA 1MMDA 2ESWA 3UDCA 2K3BA 1NE8A 4M75D 2KROA 1G5VA 2L3SA 2FYKA 3CPWP 1WDXA 2DAQA 4M78F 2CP0A 4E7ZA 4QQGA 5CKEA 5IT9E 2EQJA 2FZCB 2SRCA 3JRZA 3WVDB 4FSXA 2DTIA 5DLQE 2VWFA 3G7ZA 5CKFA 8AT1B 2HCKA 3JB9G 3MKDA 4M7AD 5GAN5 1ARKA 1ZSZA 3JB9J 2FB7A 3S3MA 5CVIA 1NPRA 1X2KA 1SRMA 3KXTA 4M7DE 2F69A 5C6SA 1LNXA 2L3RA 3M0RA 1V76A 2PVGB 4ORZA 3EG0A 2JUFA 4NL2A 2AZSA 1JJ2A 1K4US 3L2QA 2DZCA 1VQ7Q 5GAOq 1BI2A 3DB4A 4PLIA 3OSSC 1WHHA 3C4SA 4C5EA 5A2QE 1GRIA 4OMPA 4PJOE 3S6WA 4LUEA 1WPYA 4FIBA 2RN8A 4RTZA 2IG0A 2F1LA 1BCMA 2RK2A 3VRZA 3LLRA 2D8JA 1BBZA 3PGGA 4M77A 2HL3A 1UDLA 1G8XA 2HNIA 1WHKA 3L42A 3G71T 2E1HA 2XKOC 4ESRA 1XQHA 3X28B 5GMKl 3G71Q 3HRSA 2M02A 2HBWA 5M9OA 1ZX6A 2ABLA 2JT4A 3FJ5A 2NUTA 3A98A 1G83A 5KYWA 1OZ2A 1VQ4A 2FZKB 3J80E 2LJ3A 1YIJA 2NUZA 2BZYA 4HVVA 4AG1C 1I5OB 1PWTA 2LX9A 1KSWA 2VYTA 1JJ2S 3NMZC 2P0PA 7AT1B 1RL2A 4M7DC 4C8QC 4N4HA 3MCAB 1OPKA 3EGDB 1WZOA 4M77D 4DEXA 1WHLA 4A4GA 2RJFA 2M16A 1UE9A 4XU0A 1TUCA 5HK0A 3CBMA 2EKOA 4OB0B 3MEVA 2DL8A 1U5SA 2RQTA 4HVWA 4XTWA 1UUEA 4HKEA 5CAIA 5KYYB 4ZGDB 5KYNA 3MEUA 2XG8D 4BY6B 1A0NB 3Q1JA 1M90R 1VQLT 4PJOC 2W0ZA 3JCMc 2DLPA 1M27C 4XTXA 3CCQT 2JM9A 1VQLQ 4OF1A 4Q5WA 3V8KA 4FM4B 2COWA 1PD1A 4IIMA 5ECAA 3CD6A 3CCQQ 1BI1A 4FYWB 3SEMA 1M90U 1ACMB 3RUXA 2BE9B 4AFQC 4JJDA 3QIIA 1KG1A 2FPEA 1PG5B 4CI0C 1K9MC 1JXOA 2DBKA 5GMKm 2VGMA 1PHTA 1RUWA 4FT4A 2YUQA 4BDZA 5GAMg 3AHUA 2DILA 1AZEA 2L0AA 3OB9A 1ZUUA 4C5HA 2XDBA 2P0QA 4PLLA 2RQVA 4OMNA 1MGQA 1NYFA 5KCOA 2E12A 4J83A 2EBPA 5HY6A 3RBBB 5LJ3h 5C0MA 2DXCA 4LDUA 4PFOA 2P4RA 4XU2A 3HKSA 1M2VB 2LTOA 4OB2B 2X3WD 1UJ0A 3CCRA 3H0HA 1SPKA 1ZSZC 3EHRA 3MP8A 5LJ3j 3CC7A 1JJ2P 1AOJA 2JM8A 2PUKB 5GAN6 4M78A 1SRLA 2VC8A 3I55A 2K5FA 2JOYA 1AT1B 3FEOA 1K8AU 2R58A 4GLKA 1LVKA 2LX7A 5I22A 5FU7C 1YJNA 1S1NA 2Y4YA 3RESA 4JS4A 2HL5C 3GPLA 4FYYB 2J7IA 2CYZB 1VQ5T 4RG8A 4C0DC 2DXBA 5LJ3d 1Y71A 2Y90A 2AZVA 1VQ5Q 2BZ8A 2E65A 3R6OA 2OTJQ 5LJ5h 2DL3A 2C0TA 1BB9A 1ZA1B 4C92E 2WSCE 1ABOA 5IN1A 3TSZA 4M78D 2DKGA 5LJ5j 5FW9A 3OYLA 2OX7A 2EYXA 2COZA 1VIFA 4PJJA 1O75A 1QVPA 3QJ6A 4LNPA 3E1SA 2OTLT 4HCZA 2JMAA 2F5KA 1JRIA 2KT8A 4F7UG 2OTLQ 2FRYA 2LC4A 1M5Q1 1H641 1N5ZA 1OV3A 5CKBA 3SHWA 4IUQA 2QG9B 2B8AA 2RPNA 3NFCA 5LJ5d 2H3EB 4FSSA 1N8RR 3CXCS 1D09B 2G3RA 4OMOA 3QKJA 1HD3A 2YUNA 4BDYA 4JRPA 2PVDB 4BB7A 3LH5A 3CEYA 1AD5A 1ZA2B 1N8RU 1S72A 2RJCA 1FXXA 1KK7A 3PTAA 1T3SA 3OYYA 1WA7A 1VYVA 4XU3A 1Y0MA 4EMKA 1U1SA 4MMLA 2E70A 2X4WA 2LCCA 1M1KC 5KYUA 1MNEA 4C8QG 4DOVA 5AYFA 2HD0A 2EFIA
chains in the Genus database with same CATH topology
1XOVA 4EIKA 2YDLA 2DX1A 2DE0X 4JJCA 4J9DA 4DEYA 1I1JA 4RTXA 2FG0A 1ABQA 4F16A 1HSQA 2O88A 4JZ3A 2PNIA 1W1FA 1QWEA 4AFSC 4CC4B 1FMKA 4Z89A 1QCFA 1M3BA 5L23A 1AWWA 5IH2A 2EQIA 1Z9ZA 1AVZC 2DNUA 3H41A 1GL5A 4JZ4A 3EHQA 3M0PA 1E6GA 1T0JA 4RTYA 2FPDA 1JO8A 4CC2A 2X3XD 4CC3A 1M3CA 2PTKA 3UA6A 2OAWA 2B86A 2EPDA 1UGVA 2LZ6B 3IQLA 2DJQA 2YUOA 2RMOA 2ROLA 1CSKA 1OEBA 1TG0A 2EGAA 5FWBA 1KJWA 1ZUYA 3VS4A 1PKSA 2HEQA 4OMQA 4RTWA 4F14A 1U3OA 2DBMA 4QT7A 2HDAA 2KRNA 2CT4A 2YUPA 1M30A 2G6FX 2PZ1A 1UTIA 2FO0A 2GTJA 4Z88A 3REAB 2J06A 5FWCA 1UJYA 2CDTA 1AWOA 4J9GA 2M51A 3I5SA 2DF6A 2KYBA 2CH4W 1WXTA 1IO6A 2ESWA 1X2QA 2KYMA 1PNJA 2K3BA 2KROA 3M0SA 2LJ0A 2L3SA 1UG1A 1BK2A 1WDXA 1K0SA 2EGCA 3M0QA 1NLPC 4CC7A 1KIKA 3VS5A 2D8HA 2ENMA 2SRCA 4RTUA 3GBQA 1KFZA 3VS0A 1ZBJA 2RQWA 4D8KA 2A36A 2KNBB 2O9SA 1OPLA 1B07A 3PE0A 2VWFA 2K7AA 3R6NA 2C0OA 5GJWB 1X6BA 2HCKA 2BZXA 2EYZA 4LE9A 1ARKA 2VKNA 5IHNA 4OMMA 2KRSA 1WX6A 1X2KA 1SRMA 2LCSA 2GBQA 3M0RA 4HCKA 1NYGA 4ORZA 2LQNA 3EG0A 1GBRA 1GFCA 1FYNA 1UFFA 1CKAA 2MIOA 2AZSA 4GBQA 1K4US 4OMLA 4F17A 2O9VA 2RNAA 4AFUC 1QLYA 2EKHA 1SHGA 1I07A 1RI9A 2FEIA 1NEGA 1AWJA 4GLMA 1GRIA 4OMPA 1NM7A 4LUEA 2ED1A 2AKKA 2GNCA 2RN8A 2I0NA 2DRMA 1NG2A 4RTZA 4J9EA 2JW4A 2L2PA 2BTTA 3VRZA 1YN8A 2D8JA 1BBZA 2SEMA 4R0KA 3UA7A 1LCKA 1UDLA 2IIMA 3I9QA 2DL4A 4ESRA 4J9HA 2FPFA 2O31A 3ULRB 1UECA 2LJ1A 2HBWA 1K0XA 1SSHA 1ZX6A 2ABLA 2JT4A 3FJ5A 3VS2A 5IHKA 3NGPA 2ECZA 4Z8AA 2W10A 1G83A 1JQQA 3A98A 4D8DA 1JEGA 4A63B 2LJ3A 4ZNXA 2ROTA 2NUZA 2BZYA 4HVVA 4J9IA 4AG1C 1PWTA 4JPBW 1NEBA 1KSWA 1M8MA 1YWPA 2JS0A 3NMZC 4AFZC 3RNJA 5GJVB 1G2BA 2D1XA 1OPKA 2NWMA 2GTOA 3O5ZA 1M3AA 4DEXA 1X27A 4AG2C 3EGUA 2LP5A 1UE9A 1TUCA 2KE9A 3U23A 2KRMA 2QDLA 5EC7A 2EGEA 2VVKA 2KXCA 1W70A 1GFDA 2OI3A 4E6RA 2DL8A 4RTTA 1U5SA 2RQTA 4HVWA 1JXMA 1UUEA 3PVQA 1X43A 1ZSGA 2D0NA 1A0NB 1E6HA 2KBTA 2KT1A 1CKBA 1TUDA 2CREA 4RUGA 2F2XA 2W0ZA 3NHNA 1SEMA 2DLPA 1M27C 2K79A 2KR3A 2JM9A 2V1QA 5IXFA 3H0FA 3C0CA 1WXUA 2GQIA 3VRYA 4IIMA 5ECAA 1AZGB 2JS2A 4LN2A 2A08A 1U06A 2CUDA 3SEMA 3VS6A 2F2WA 2F2VA 2AK5A 1HJDA 4AFQC 1B3QA 2L3QA 3H0IA 4JJDA 2MCNA 2FPEA 2RQUA 1JXOA 2DBKA 3VS7A 2AKLA 3NPFA 1PHTA 1RUWA 2L3PA 4J9FA 1X6GA 2YUQA 4WCIA 1GCQC 1PKTA 4J9BA 2K9GA 4HXJA 1K76A 2DILA 1AZEA 2L0AA 1ZUUA 2A37A 3JV3A 1WYXA 2HSPA 2JXBA 3QWYA 2RQVA 4OMNA 1J3TA 1NYFA 2JTEA 1Y57A 2EBPA 3RBBB 4M4ZA 2P4RA 2ED0A 4RTVA 1H8KA 2KGTA 2X3WD 2K6DA 1UJ0A 2EVRA 3H0HA 2K2MA 1SPKA 1RLQC 3EHRA 1W6XA 1WLPB 2DVJA 1AOJA 1WFWA 2JM8A 2M0YA 1YP5A 4JJBA 2MOXA 5I11A 1SRLA 3I35A 2RF0A 1T0HA 3EG2A 1K9AA 2DM1A 2RQRA 1PRLC 1GCPA 2LX7A 5I22A 3VS1A 2DMOA 1S1NA 1MV0B 3TVTA 1AEYA 1JU5C 1YCSB 2J7IA 4HVUA 3ZL7C 2KEAA 3PVLA 1VYTA 1QKXA 3UATA 2JMCA 1MUZA 2DRKA 4K11A 1BU1A 2AZVA 2BZ8A 2EW3A 3CQTA 1ZLMA 2CSQA 2DL3A 1WIEA 5HCKA 2DA9A 2C0TA 1K1ZA 2KXDA 1YNZA 1BB9A 2EYYA 2LNHB 1VA7A 3I5RA 1NLOC 3VS3A 2CH4A 4KRTA 2EYWA 1ABOA 3KFVA 3TSZA 2GGRA 2V1RA 1T3LA 1AWXA 5FW9A 2EYXA 1H92A 4J9CA 2E5KA 1ZUKA 3EG1A 4LNPA 2JMAA 1QWFA 3M0TA 1V1CA 2KT8A 1VYUA 2FRYA 1N5ZA 1OV3A 2OJ2A 3SHWA 1UHCA 1WXBA 2LMJA 3EG3A 1WI7A 4X1VA 2RPNA 1YWOA 3M0UA 4FSSA 5IHIA 1GCQA 1I0CA 5IXBA 2A28A 3QWXX 2J05A 4OMOA 1HD3A 2H8HA 2YUNA 4LUDA 1OOTA 2CT3A 4IIOA 3LH5A 2CSIA 1UHFA 2FRWA 1AD5A 2CUBA 2DL5A 3REBB 2YT6A 2DYBA 1X69A 2C0IA 1T3SA 1MV3A 1WA7A 2DL7A 1VYVA 1EFNA 1SHFA 1Y0MA 3THKA 1H3HA 3TSWA 1E7OA 1QKWA 2O2OA 2XMFA 3UF4A 1Z9QA 1RLPC 2LQWA 1GBQA 2J6KA 2YSQA 2J6OA 1PRMC 2J6FA 4Y92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOV A;  4EIK A;  2YDL A;  2DX1 A;  2DE0 X;  4JJC A;  4J9D A;  4DEY A;  1I1J A;  4RTX A;  2FG0 A;  1ABQ A;  4F16 A;  1HSQ A;  2O88 A;  4JZ3 A;  2PNI A;  1W1F A;  1QWE A;  4AFS C;  4CC4 B;  1FMK A;  4Z89 A;  1QCF A;  1M3B A;  5L23 A;  1AWW A;  5IH2 A;  2EQI A;  1Z9Z A;  1AVZ C;  2DNU A;  3H41 A;  1GL5 A;  4JZ4 A;  3EHQ A;  3M0P A;  1E6G A;  1T0J A;  4RTY A;  2FPD A;  1JO8 A;  4CC2 A;  2X3X D;  4CC3 A;  1M3C A;  2PTK A;  3UA6 A;  2OAW A;  2B86 A;  2EPD A;  1UGV A;  2LZ6 B;  3IQL A;  2DJQ A;  2YUO A;  2RMO A;  2ROL A;  1CSK A;  1OEB A;  1TG0 A;  2EGA A;  5FWB A;  1KJW A;  1ZUY A;  3VS4 A;  1PKS A;  2HEQ A;  4OMQ A;  4RTW A;  4F14 A;  1U3O A;  2DBM A;  4QT7 A;  2HDA A;  2KRN A;  2CT4 A;  2YUP A;  1M30 A;  2G6F X;  2PZ1 A;  1UTI A;  2FO0 A;  2GTJ A;  4Z88 A;  3REA B;  2J06 A;  5FWC A;  1UJY A;  2CDT A;  1AWO A;  4J9G A;  2M51 A;  3I5S A;  2DF6 A;  2KYB A;  2CH4 W;  1WXT A;  1IO6 A;  2ESW A;  1X2Q A;  2KYM A;  1PNJ A;  2K3B A;  2KRO A;  3M0S A;  2LJ0 A;  2L3S A;  1UG1 A;  1BK2 A;  1WDX A;  1K0S A;  2EGC A;  3M0Q A;  1NLP C;  4CC7 A;  1KIK A;  3VS5 A;  2D8H A;  2ENM A;  2SRC A;  4RTU A;  3GBQ A;  1KFZ A;  3VS0 A;  1ZBJ A;  2RQW A;  4D8K A;  2A36 A;  2KNB B;  2O9S A;  1OPL A;  1B07 A;  3PE0 A;  2VWF A;  2K7A A;  3R6N A;  2C0O A;  5GJW B;  1X6B A;  2HCK A;  2BZX A;  2EYZ A;  4LE9 A;  1ARK A;  2VKN A;  5IHN A;  4OMM A;  2KRS A;  1WX6 A;  1X2K A;  1SRM A;  2LCS A;  2GBQ A;  3M0R A;  4HCK A;  1NYG A;  4ORZ A;  2LQN A;  3EG0 A;  1GBR A;  1GFC A;  1FYN A;  1UFF A;  1CKA A;  2MIO A;  2AZS A;  4GBQ A;  1K4U S;  4OML A;  4F17 A;  2O9V A;  2RNA A;  4AFU C;  1QLY A;  2EKH A;  1SHG A;  1I07 A;  1RI9 A;  2FEI A;  1NEG A;  1AWJ A;  4GLM A;  1GRI A;  4OMP A;  1NM7 A;  4LUE A;  2ED1 A;  2AKK A;  2GNC A;  2RN8 A;  2I0N A;  2DRM A;  1NG2 A;  4RTZ A;  4J9E A;  2JW4 A;  2L2P A;  2BTT A;  3VRZ A;  1YN8 A;  2D8J A;  1BBZ A;  2SEM A;  4R0K A;  3UA7 A;  1LCK A;  1UDL A;  2IIM A;  3I9Q A;  2DL4 A;  4ESR A;  4J9H A;  2FPF A;  2O31 A;  3ULR B;  1UEC A;  2LJ1 A;  2HBW A;  1K0X A;  1SSH A;  1ZX6 A;  2ABL A;  2JT4 A;  3FJ5 A;  3VS2 A;  5IHK A;  3NGP A;  2ECZ A;  4Z8A A;  2W10 A;  1G83 A;  1JQQ A;  3A98 A;  4D8D A;  1JEG A;  4A63 B;  2LJ3 A;  4ZNX A;  2ROT A;  2NUZ A;  2BZY A;  4HVV A;  4J9I A;  4AG1 C;  1PWT A;  4JPB W;  1NEB A;  1KSW A;  1M8M A;  1YWP A;  2JS0 A;  3NMZ C;  4AFZ C;  3RNJ A;  5GJV B;  1G2B A;  2D1X A;  1OPK A;  2NWM A;  2GTO A;  3O5Z A;  1M3A A;  4DEX A;  1X27 A;  4AG2 C;  3EGU A;  2LP5 A;  1UE9 A;  1TUC A;  2KE9 A;  3U23 A;  2KRM A;  2QDL A;  5EC7 A;  2EGE A;  2VVK A;  2KXC A;  1W70 A;  1GFD A;  2OI3 A;  4E6R A;  2DL8 A;  4RTT A;  1U5S A;  2RQT A;  4HVW A;  1JXM A;  1UUE A;  3PVQ A;  1X43 A;  1ZSG A;  2D0N A;  1A0N B;  1E6H A;  2KBT A;  2KT1 A;  1CKB A;  1TUD A;  2CRE A;  4RUG A;  2F2X A;  2W0Z A;  3NHN A;  1SEM A;  2DLP A;  1M27 C;  2K79 A;  2KR3 A;  2JM9 A;  2V1Q A;  5IXF A;  3H0F A;  3C0C A;  1WXU A;  2GQI A;  3VRY A;  4IIM A;  5ECA A;  1AZG B;  2JS2 A;  4LN2 A;  2A08 A;  1U06 A;  2CUD A;  3SEM A;  3VS6 A;  2F2W A;  2F2V A;  2AK5 A;  1HJD A;  4AFQ C;  1B3Q A;  2L3Q A;  3H0I A;  4JJD A;  2MCN A;  2FPE A;  2RQU A;  1JXO A;  2DBK A;  3VS7 A;  2AKL A;  3NPF A;  1PHT A;  1RUW A;  2L3P A;  4J9F A;  1X6G A;  2YUQ A;  4WCI A;  1GCQ C;  1PKT A;  4J9B A;  2K9G A;  4HXJ A;  1K76 A;  2DIL A;  1AZE A;  2L0A A;  1ZUU A;  2A37 A;  3JV3 A;  1WYX A;  2HSP A;  2JXB A;  3QWY A;  2RQV A;  4OMN A;  1J3T A;  1NYF A;  2JTE A;  1Y57 A;  2EBP A;  3RBB B;  4M4Z A;  2P4R A;  2ED0 A;  4RTV A;  1H8K A;  2KGT A;  2X3W D;  2K6D A;  1UJ0 A;  2EVR A;  3H0H A;  2K2M A;  1SPK A;  1RLQ C;  3EHR A;  1W6X A;  1WLP B;  2DVJ A;  1AOJ A;  1WFW A;  2JM8 A;  2M0Y A;  1YP5 A;  4JJB A;  2MOX A;  5I11 A;  1SRL A;  3I35 A;  2RF0 A;  1T0H A;  3EG2 A;  1K9A A;  2DM1 A;  2RQR A;  1PRL C;  1GCP A;  2LX7 A;  5I22 A;  3VS1 A;  2DMO A;  1S1N A;  1MV0 B;  3TVT A;  1AEY A;  1JU5 C;  1YCS B;  2J7I A;  4HVU A;  3ZL7 C;  2KEA A;  3PVL A;  1VYT A;  1QKX A;  3UAT A;  2JMC A;  1MUZ A;  2DRK A;  4K11 A;  1BU1 A;  2AZV A;  2BZ8 A;  2EW3 A;  3CQT A;  1ZLM A;  2CSQ A;  2DL3 A;  1WIE A;  5HCK A;  2DA9 A;  2C0T A;  1K1Z A;  2KXD A;  1YNZ A;  1BB9 A;  2EYY A;  2LNH B;  1VA7 A;  3I5R A;  1NLO C;  3VS3 A;  2CH4 A;  4KRT A;  2EYW A;  1ABO A;  3KFV A;  3TSZ A;  2GGR A;  2V1R A;  1T3L A;  1AWX A;  5FW9 A;  2EYX A;  1H92 A;  4J9C A;  2E5K A;  1ZUK A;  3EG1 A;  4LNP A;  2JMA A;  1QWF A;  3M0T A;  1V1C A;  2KT8 A;  1VYU A;  2FRY A;  1N5Z A;  1OV3 A;  2OJ2 A;  3SHW A;  1UHC A;  1WXB A;  2LMJ A;  3EG3 A;  1WI7 A;  4X1V A;  2RPN A;  1YWO A;  3M0U A;  4FSS A;  5IHI A;  1GCQ A;  1I0C A;  5IXB A;  2A28 A;  3QWX X;  2J05 A;  4OMO A;  1HD3 A;  2H8H A;  2YUN A;  4LUD A;  1OOT A;  2CT3 A;  4IIO A;  3LH5 A;  2CSI A;  1UHF A;  2FRW A;  1AD5 A;  2CUB A;  2DL5 A;  3REB B;  2YT6 A;  2DYB A;  1X69 A;  2C0I A;  1T3S A;  1MV3 A;  1WA7 A;  2DL7 A;  1VYV A;  1EFN A;  1SHF A;  1Y0M A;  3THK A;  1H3H A;  3TSW A;  1E7O A;  1QKW A;  2O2O A;  2XMF A;  3UF4 A;  1Z9Q A;  1RLP C;  2LQW A;  1GBQ A;  2J6K A;  2YSQ A;  2J6O A;  1PRM C;  2J6F A;  4Y92 A; 
#chains in the Genus database with same CATH topology
 4EIK A;  1OUL A;  1I1J A;  4C92 C;  2C06 A;  4M75 G;  4HT8 A;  1UGP B;  4AFS C;  2RO0 A;  1FMK A;  1QCF A;  2CZ6 B;  4TVR A;  5L23 A;  2XIC A;  2EQI A;  4X9D A;  5GAO r;  1AVZ C;  2JZ2 A;  5L8R E;  4DBR A;  3M0P A;  2KMT A;  4E7K A;  3SWN C;  4PJO G;  2XD0 A;  2FPD A;  1JO8 A;  4CC3 A;  1M3C A;  4HA8 A;  2KQW A;  2LRQ A;  3JCM e;  2RH2 A;  2E4H A;  1M9S A;  5A0G A;  3JCM V;  3OYN A;  2B86 A;  4XAX B;  2LZ6 B;  4QVC A;  1WQW A;  3OYH A;  2X51 A;  1C6V X;  4M7A G;  3LGL A;  5FWB A;  4JRI A;  4ME7 A;  1U8R A;  3EAE A;  1R0C B;  3CPW A;  3CCE A;  1QVG A;  2QK0 A;  3CCS A;  3CXC P;  3JCM g;  5FRO A;  3GP8 A;  4OMF B;  3JCM Q;  1M30 A;  2G6F X;  4ELY C;  4A4E A;  1IRX A;  4DA4 A;  2GTJ A;  1HYO A;  3QXE B;  2M1H A;  1VQO A;  1AWO A;  4IUT A;  2K5I A;  2JN0 A;  4KGV B;  1VQ4 T;  1YIJ T;  1K9M R;  5CCA A;  1X2Q A;  1PD0 A;  3A8G B;  1VQ4 Q;  2LQK A;  3M0S A;  4C0G A;  4IUU A;  5GAM f;  1C1A A;  2HBP A;  3FRN A;  1I5L A;  4KH1 B;  3RER A;  2KSS A;  1BK2 A;  3M0Q A;  4OP0 A;  3CME A;  1KIK A;  2EJF A;  2K4Y A;  1R0B G;  5GAN 3;  4J5Y A;  5GAN d;  3M57 A;  4QW2 A;  4FW2 A;  3GBQ A;  3HFN A;  1KFZ A;  1C0M A;  4DQ2 A;  2HKN A;  1KQS A;  2RQW A;  2DTO A;  4PJN A;  2O9S A;  1B07 A;  4OGC A;  3PE0 A;  5GJW B;  3BE3 A;  3M59 A;  2EYZ A;  4MDW A;  3CPW S;  4ZTJ A;  1OX9 A;  4QVD A;  1Q86 R;  2L89 A;  5IHN A;  1QVG S;  1MND A;  3PNW C;  4IKF A;  2KRS A;  4C5I A;  2QA4 A;  3RKX A;  4JRQ A;  4NL3 A;  2QEX A;  1VQ6 T;  1MMG A;  2LCS A;  1FWZ A;  1BKB A;  5KH6 A;  1RAF B;  4XU1 A;  3F70 A;  4M7D B;  4N0A A;  1VQ6 Q;  1NYG A;  2LQN A;  2M0O A;  1YCY A;  2LDM A;  1GBR A;  2EYQ A;  4Y91 A;  1UFF A;  1Q86 U;  2HKQ B;  4GY5 A;  3DLL A;  5FLX E;  1W2B A;  1UGQ B;  3H8Z A;  3MP6 A;  2RNA A;  3FLG A;  4EDU A;  4A4K A;  2MWP A;  4AFU C;  5HK3 A;  3M9Q A;  1QLY A;  2YLC A;  4M77 G;  1QQJ A;  1TH7 A;  2EKH A;  2GCX A;  1JB0 E;  1I07 A;  2DJZ A;  2QDY B;  3JCM J;  4GLM A;  3QZ5 B;  4EMG A;  1NM7 A;  1KQS S;  1NG2 A;  1K73 R;  5CKD A;  1KQ1 A;  3L2R A;  2JW4 A;  4L6V 5;  3CCR T;  2L2P A;  4FYX B;  1VQP Q;  3CC7 T;  1Q82 R;  2RB6 A;  3MPU B;  3OYG A;  2DET A;  3CC7 Q;  1OQK A;  3I55 T;  1K73 U;  2DL4 A;  2GFA A;  4J9H A;  3ULR B;  1UEC A;  3I55 Q;  1YJN T;  1NJI R;  1K0X A;  1KHI A;  1Q82 U;  3VS2 A;  3JCM W;  1NZ9 A;  4Z8A A;  4D8D A;  1JQQ A;  4NOY A;  3UWN A;  1JEG A;  1YJN Q;  3OS5 A;  4DBF A;  1OI1 A;  4MZP A;  2EAY A;  4FU6 A;  1W2B S;  1M8M A;  1LPL A;  1G2B A;  4C92 G;  1NJI U;  2O4X B;  4F7U E;  2JTF A;  3ME9 A;  1B34 B;  3OYF A;  3MJX A;  1BIB A;  2NWM A;  1QVG P;  4AG2 C;  3EGU A;  1R8O B;  3CBO A;  3GNF B;  1D1B A;  2YRD A;  2PUO B;  3V7C A;  2KRM A;  5EC7 A;  2V8K A;  1W70 A;  4E6R A;  2MWO A;  3TU4 K;  1Q81 C;  1Y96 B;  4FW1 A;  4QKU A;  1BIA A;  1Y7X A;  1X43 A;  4AMC A;  3O8V A;  1ZSG A;  3X24 B;  5CIU A;  2KT1 A;  2EJ9 A;  5FU7 B;  1CKB A;  1LJO A;  1TUD A;  2CRE A;  3QHS A;  4RUG A;  2X9H A;  1VQK A;  2F2X A;  1YJW A;  2K79 A;  3RKY A;  2R57 A;  5IXF A;  3OYB A;  3H0F A;  3C0C A;  2DFU A;  2VGN A;  2ZAE A;  2JS2 A;  3NTH A;  3A8O B;  1U06 A;  1TOV A;  4C8Q E;  3L2Z A;  2L3Q A;  3H0I A;  2MCN A;  1R77 A;  3VS7 A;  1S72 T;  1KQS P;  1KD1 C;  3NPF A;  2BIV A;  2E64 A;  3G6E A;  4J9F A;  2BUD A;  1X6G A;  2KY9 A;  1S72 Q;  4M75 E;  1PKT A;  2K57 A;  4J9B A;  1Y96 A;  4LD9 K;  4M78 G;  4N4G A;  3JCM f;  2A37 A;  2DK3 A;  5GAN e;  1EZZ B;  1WYX A;  2JXB A;  2CGH A;  2FVU A;  4BD3 A;  3TQ7 P;  2DEU A;  3N5B B;  1VQM A;  4RKU E;  4RTV A;  2DTH A;  1D0X A;  2E3I A;  3L2U A;  3A8H B;  1RLQ C;  1W2B P;  1I81 A;  5GAN g;  2KI7 A;  4JJB A;  4JLG A;  3I35 A;  4DBH A;  4J6W A;  3LW5 E;  3URG A;  2RF0 A;  4M7A E;  4RG2 A;  3EG2 A;  2BE7 D;  1NBE B;  2K3X A;  1PRL C;  1GCP A;  3OMG A;  4JDS A;  4V2S A;  4HVU A;  2KEA A;  3PVL A;  4OGE A;  3LH0 A;  2DRK A;  4K11 A;  3VKI A;  4J7F A;  2QAZ A;  1VQN A;  2HZY A;  3CQT A;  2RHZ A;  2V26 A;  2ZPE B;  1YNZ A;  3MEA A;  2DIQ A;  1IB8 A;  2H3J A;  3VS3 A;  4IUP A;  2CH4 A;  3E9G A;  3EFR A;  4KRT A;  3CCE T;  2EYW A;  3KFV A;  3CCS T;  2GGR A;  9ATC B;  1AWX A;  4XQ3 A;  3I56 A;  3CCE Q;  5GAO n;  4M75 C;  3V8J A;  1FX7 A;  1TTH B;  3OYC A;  5FU6 C;  2YWW A;  4BAC A;  1VYU A;  4ZN1 A;  1H3Z A;  1G3Y A;  3CCL A;  3SWN B;  2OJ2 A;  3FC3 A;  3CC2 T;  1G3T A;  1UHC A;  2KDS A;  2DVE A;  3CCU A;  1WXB A;  3EG3 A;  1WI7 A;  2XID A;  3M0U A;  1RAB B;  3L2W A;  3PIO A;  1GCQ A;  3CC2 Q;  3QDF A;  3PFS A;  1YI2 T;  2V8J A;  3CME T;  4FCY A;  3GIB A;  1N6A A;  1OX8 A;  3QO3 A;  2JVV A;  2E6N A;  4IIO A;  1YI2 Q;  3CME Q;  5CK9 A;  1UHF A;  2HAX A;  4M7A C;  3OYM A;  3M55 A;  1WQ7 A;  3EGD A;  1D3B B;  2X4X A;  1MV3 A;  3M4G A;  1UGR B;  1EFN A;  3FIF A;  2VUB A;  5AT1 B;  2KAF A;  2LT4 A;  4X9C A;  1E7O A;  4ZTF A;  1QKW A;  2O2O A;  1N9R A;  1YIT A;  4N4I A;  3UF4 A;  5KYY A;  1RLP C;  4Z02 A;  1SF9 A;  2QA4 T;  1TS9 A;  4M77 E;  2QEX T;  2J6O A;  1XNI A;  1IGU A;  1XOV A;  4O5V A;  2YDL A;  2QA4 Q;  2ZCF B;  4JJC A;  4RMO A;  3OS0 A;  4DEY A;  5LL6 S;  4PJL A;  3LWH A;  2FG0 A;  2HMA A;  1WHM A;  1M1G A;  2DIG A;  4F16 A;  5IAY A;  2FL7 A;  2O88 A;  2PNI A;  2DEQ A;  1IHV A;  1QWE A;  2WAC A;  3JSC A;  2YRV A;  3OYI A;  1AWW A;  1M1F A;  5IH2 A;  1QCO A;  4IUR A;  3CXC A;  2DNU A;  2A3L A;  4JZ4 A;  1D3B A;  1E6G A;  1TXQ A;  3LX7 A;  3TCJ A;  2RHX A;  2PTK A;  3ZFJ A;  2EPD A;  3G1J A;  1RAG B;  2K5L A;  4OB3 B;  4KUI A;  3VU3 C;  1KC8 C;  2X4Y A;  1PKS A;  1G3S A;  4F14 A;  3CC4 T;  3RMQ A;  1IRE B;  1M2V A;  2QGG A;  2MAM A;  5FRN A;  3CC4 Q;  4BE1 A;  2FO0 A;  3REA B;  2J06 A;  5A0L A;  1SKU B;  2LNV A;  4J9G A;  2M51 A;  2QQA A;  4M77 C;  2KYM A;  2P84 A;  1PNJ A;  1Q7Y C;  2LJ0 A;  1RI0 A;  1UG1 A;  2FHD A;  2EGC A;  4M7D F;  4CC7 A;  5DM7 R;  4FYV B;  3D7S B;  2F5T X;  5CKH A;  3EGX B;  4RTU A;  4BI3 A;  3VS0 A;  2CZ7 B;  3MET A;  2A36 A;  2KNB B;  5FRM A;  2K7A A;  2RI2 A;  2C0O A;  1X6B A;  1VQK T;  1YJW T;  4JJN K;  3QYG B;  3TEE A;  4RCC A;  4A54 A;  4C5G A;  2L5Q A;  4D6W A;  4BE0 A;  4OMM A;  1VQK Q;  4PNO A;  1YJW Q;  3HSB A;  1WX6 A;  5KE3 A;  4PJO F;  5CQY A;  1VQ8 A;  4M78 E;  3EH1 A;  2GBQ A;  3VYG A;  2P0K A;  1VQ7 A;  2AT1 B;  4QQD A;  1GFC A;  4J6X A;  3A8L B;  3C12 A;  2MIO A;  4GBQ A;  3ZBD A;  1DJ7 B;  3G6E T;  2O9V A;  4XTZ A;  3S3N A;  2O01 E;  3G6E Q;  3C94 A;  1SHG A;  2MPX C;  3QBY A;  2VV5 A;  2FEI A;  2Y4X A;  2XDP A;  4R55 A;  3LGF A;  1VQM T;  4HT9 A;  2ED1 A;  2GNC A;  1YBY A;  2I0N A;  4LXC A;  1VQM Q;  3ER0 A;  3VYH B;  2BTT A;  5GMK i;  2SEM A;  2R5A A;  1JBM A;  4BE2 A;  3RDV A;  3CBP A;  1WHJ A;  2L8D A;  1BI3 A;  4J6Y A;  2RJD A;  4E7H A;  2E3H A;  4LDX A;  4JS5 A;  3L2V A;  2LJ1 A;  4MMK A;  3SB2 A;  1PC0 A;  2ZPH B;  1N9S A;  2KK4 A;  5D6X A;  5IHK A;  3OY9 A;  2ECZ A;  3INZ A;  2K2V A;  2ROT A;  2RI5 A;  4J9I A;  3PIP A;  1YWP A;  1KQ2 A;  3EG9 B;  2P4T A;  4AFZ C;  3RNJ A;  1VQN T;  4M78 C;  1RAA B;  2EJG A;  5GJV B;  4A53 A;  1V29 B;  1YIJ Q;  4F7U B;  1VQN Q;  2D1X A;  2R5M A;  4HCC A;  3A8M B;  2ZPB B;  1XTD A;  1I8F A;  3LYI A;  2LP5 A;  1PM3 A;  3I56 T;  1K9M U;  3U23 A;  2QDL A;  1GFD A;  2RI3 A;  2OI3 A;  3E2U A;  5LJ3 e;  1WJR A;  2MMP A;  4RTT A;  3I56 Q;  3CCV A;  5GAO p;  2ZPI B;  3PVQ A;  1VQL A;  2QQB A;  2D0N A;  1SG5 A;  2KBT A;  3CCL T;  3TRE A;  3CCQ A;  3CCU T;  2NUP B;  3NHN A;  1SEM A;  2KR3 A;  3CCL Q;  5A0D A;  3GLX A;  2V1Q A;  3P8D A;  4Y28 E;  1WXU A;  1PSF A;  2GQI A;  2YRC A;  5LJ3 g;  3CCU Q;  3QDR B;  2DZ9 A;  3EG9 A;  3EFO B;  5KYX B;  4KT0 E;  3BW1 A;  1FMW A;  2HSE B;  2F2V A;  2OAU A;  3CD6 T;  3OW2 A;  1HJD A;  1B3Q A;  2GFU A;  1SSF A;  5DY9 A;  4C8Q B;  4YTL A;  2CZ0 B;  4XK8 E;  1IGQ A;  3CD6 Q;  2MI6 A;  4KUL A;  2AKL A;  3OYA A;  1VIE A;  4J8O A;  5LJ5 e;  4WCI A;  2QQS A;  4PK4 A;  2CZ1 B;  4M75 B;  2K9G A;  4HXJ A;  1K76 A;  3NTK A;  4L59 A;  3MHX A;  1NPP A;  1YIT T;  5CR2 A;  1J3T A;  1Y57 A;  1YIT Q;  2ED0 A;  1TUG B;  2D9T A;  4RCB A;  5LJ5 g;  4PJO B;  1M90 C;  2E41 A;  3C95 A;  2D6F A;  1Y07 A;  2EVR A;  1EX4 A;  2NYS A;  3HTR A;  4BUG A;  2LQ8 A;  4EMK C;  1WLP B;  4II1 A;  4LDY A;  4C92 F;  1WFW A;  4L5G A;  4M7D A;  4P5N A;  5I11 A;  2RD1 A;  3CCR Q;  4M7A B;  1T0H A;  4E7I A;  4B6M A;  5GAM h;  4F04 B;  3JB9 I;  4BI4 A;  1HK9 A;  3VS1 A;  2DMO A;  3H6Z A;  3TVT A;  3HRU A;  2OTJ A;  3OW2 S;  3OS2 A;  1JU5 C;  3EH2 A;  3M53 A;  1VYT A;  2XHC A;  2JMC A;  1TU0 B;  5GAM j;  5I21 A;  2JJ9 A;  3QUI A;  3RKW A;  1GXI E;  1WIE A;  5HCK A;  2DA9 A;  1F1B B;  2KXD A;  2EYY A;  1D0Z A;  1VA7 A;  3I5R A;  3JB9 F;  3MP1 A;  3QYH B;  3QG1 A;  4PJO A;  2GF7 A;  2K3Y A;  4QVZ A;  2CS7 A;  2V1R A;  1T3L A;  4M7D D;  1M1K R;  4J9C A;  1ZUK A;  5GAM d;  1K8A C;  1ZSZ B;  2VB6 A;  3EG1 A;  3H9N A;  1QWF A;  4AT1 B;  1M8V A;  1V1C A;  3KBG A;  2DO3 A;  3WXM B;  3M54 A;  1M1K U;  4X34 A;  4A4H A;  5DLO A;  1MMN A;  4B9X A;  1QP3 A;  4JLI A;  2PQW A;  2QI2 A;  1I0C A;  5IXB A;  2A28 A;  3DKM A;  2J05 A;  5GAN 8;  2H8H A;  4C0D B;  2ZPG B;  2DER A;  4PJO D;  2CT3 A;  1OU8 A;  3J81 E;  4OVA A;  2CSI A;  3HHT B;  3ZEH A;  3SFM A;  2FRW A;  2O4X A;  1B34 A;  2YT6 A;  1X69 A;  1BCO A;  2C0I A;  3DLM A;  3RMS A;  3THK A;  2YXY A;  4EMH A;  3TSW A;  2IPO B;  4ZGE B;  2XMF A;  3LWI A;  1VQ9 A;  2J6K A;  2YSQ A;  4M77 B;  1PRM C;  2J6F A;  1VQ8 T;  5I2M A;  3M5A A;  1WHG A;  3OW2 P;  3QZ9 B;  3FDR A;  1VUB A;  1U1T A;  1VQ8 Q;  1VQ7 T;  4RTX A;  2E5Q A;  1YJ9 A;  1ABQ A;  2EQU A;  2WSF E;  2VXE A;  1N8R C;  2YLB A;  2NUT B;  5KYW B;  1M3B A;  1Z9Z A;  3AT1 B;  3VV0 A;  1D0Y A;  3FB9 A;  1O9S A;  4N0A C;  1Q95 G;  3QPH A;  2QYZ A;  3UA6 A;  1M2O A;  2OAW A;  1YHQ A;  3IQL A;  3GF5 A;  2DJQ A;  5I2S A;  2RMO A;  1X6O A;  2ROL A;  2RHU A;  3BDU A;  5D6Y A;  1TG0 A;  3KUF A;  3HL8 A;  1ZUY A;  2AHJ B;  4RTW A;  2VXF A;  5LJ3 f;  1U3O A;  4QT7 A;  2HDA A;  2CP5 A;  2KRN A;  4C92 B;  2M9U A;  5GMK h;  1UTI A;  4Z88 A;  2MYS A;  3E9F A;  3CCS Q;  2JNG A;  1UJY A;  2CDT A;  2Z0W A;  2DF6 A;  4CRI A;  1VQO T;  3CCJ A;  5CQX A;  1M4Z A;  4ZGJ B;  1IO6 A;  5GMK j;  1VQO Q;  3VJP A;  4B9W A;  2A0F B;  5GAN 7;  1RAH B;  2V8I A;  1K0S A;  2MK5 A;  3UT1 A;  1D1C A;  1NLP C;  1P92 A;  2DD5 A;  2EIF A;  3HRT A;  3VS5 A;  2D8H A;  1TSF A;  2ENM A;  3JCM h;  2FZG B;  1XJW B;  3OYK A;  2X35 A;  5LJ5 f;  1RAI B;  2QQR A;  1ZBJ A;  4D8K A;  4C92 A;  3CCV T;  4LDW A;  1OPL A;  2CKK A;  3SD4 A;  3R6N A;  1MHN A;  3RR6 A;  3JCM b;  2KVQ G;  4ZN3 A;  3CCV Q;  2BZX A;  4PFP A;  4LE9 A;  2VKN A;  3OYD A;  1VQ6 A;  5GAO l;  3OBY A;  5GAM e;  5GAN 2;  3ASK A;  3T9N A;  4M78 B;  4HCB A;  3SWN A;  3P8B B;  4HCK A;  2QEX Q;  1FYN A;  3JCM d;  1CKA A;  2RA2 A;  1N27 A;  3PT9 A;  2MF2 A;  4DBQ A;  2RHI A;  4OML A;  4F17 A;  2HQE A;  4NS5 A;  4C92 D;  4KGX B;  4C0Z A;  1RI9 A;  4DOW A;  6AT1 B;  4LDV A;  2D0Q B;  2QXF A;  1LOJ A;  1NEG A;  1AWJ A;  3G4S A;  3JAM E;  1VQP A;  2AKK A;  1QVF A;  3X25 B;  2DRM A;  1K8A R;  4J9E A;  1UB4 A;  3CCM A;  5J26 A;  1Q81 R;  3M56 A;  2ZPF B;  1QP2 A;  5GAN 4;  4F7U F;  1Q86 C;  1YN8 A;  3CMA A;  1WJQ A;  4E7S A;  4R0K A;  1OZ3 A;  3UA7 A;  1LCK A;  2IIM A;  3JB9 D;  3I9Q A;  3GOX A;  2PVO B;  4PL6 A;  2IVW A;  1ZQ1 A;  1Q81 U;  2FPF A;  2O31 A;  3X20 B;  1SSH A;  2OTJ T;  3NGP A;  1WNL A;  2W10 A;  2EQK A;  5GAO m;  4R56 A;  4A63 B;  2ZGW A;  4ZNX A;  5CO7 A;  1ZBX A;  4JPB W;  1NEB A;  2JS0 A;  2QAS A;  1RAE B;  1KD1 R;  3JCM P;  4XTV A;  2EWN A;  2GTO A;  3O5Z A;  1M3A A;  1X27 A;  2HQX A;  3OBW A;  4ELZ C;  4C8Q F;  2KE9 A;  3V8L A;  4EMK B;  2CP3 A;  1K73 C;  2EGE A;  2VVK A;  2KXC A;  1KD1 U;  1EIF A;  5KYU B;  1QVF S;  1QMC A;  1JXM A;  1X75 C;  3HPW A;  1RAD B;  4FL6 A;  4PFZ A;  1Q82 C;  2RHY A;  1RAC B;  4M75 F;  3J7A F;  2ATC B;  2DXT A;  3DB3 A;  1E6H A;  5GAN f;  1PSE A;  1YFN A;  4O6J A;  1IZ6 A;  4KBM B;  2ZZD A;  5KE2 A;  1NJI C;  3VRY A;  1AZG B;  2QTV A;  4LN2 A;  1G3W A;  2A08 A;  4E7L A;  2CUD A;  3OSV A;  3VS6 A;  2F2W A;  5D7U A;  3OYE A;  2AK5 A;  5J3B A;  3P8H A;  3SDZ A;  4KH0 B;  3OA6 A;  2RQU A;  3FJP A;  2L3P A;  2X4J A;  4VUB A;  4M7A F;  1GCQ C;  3GNG A;  3EGX A;  4MZT A;  3S3O A;  8ATC B;  2HQH A;  1OYX A;  4M7D G;  2RK1 A;  3JV3 A;  2HSP A;  1HXD A;  3QWY A;  5GMK e;  1PCX A;  1VQ9 T;  2QGF B;  2JTE A;  1KHC A;  4M4Z A;  1VQ9 Q;  1IHW A;  1H8K A;  2KGT A;  2K6D A;  1YJ9 T;  2K2M A;  1W6X A;  2DVJ A;  2M0Y A;  1YJ9 Q;  1YP5 A;  2QQ9 A;  3A5Z B;  2MOX A;  1UGS B;  3BFM A;  2YHT A;  3G71 A;  5D6W A;  1K9A A;  2DM1 A;  4BY6 C;  2RQR A;  2VAS A;  1MV0 B;  4EPC A;  4KUD K;  1AEY A;  1UEB A;  1YCS B;  3ZL7 C;  3MEW A;  1QKX A;  3MO8 A;  3UAT A;  1MUZ A;  1YHQ T;  1BU1 A;  4PJM A;  1QVF P;  1BYM A;  4E2F B;  4XTU A;  5EG2 A;  1WGS A;  2EW3 A;  1ZLM A;  2CSQ A;  3WVE B;  1YHQ Q;  3E19 A;  1K1Z A;  1IXD A;  2LNH B;  3OYJ A;  1NLO C;  1W4S A;  4A4F A;  3CPF A;  3VUZ A;  5GAN h;  1OU9 A;  2EQM A;  4XTY A;  2XDD A;  2A7Y A;  3M58 A;  1AHJ B;  4MDX A;  1H92 A;  2E5K A;  4WTO B;  2LVM A;  3JB9 H;  5GAN j;  4FT2 A;  2DYI A;  1BI0 A;  3M0T A;  2AIR B;  3CCJ T;  3EFS A;  3CC2 A;  2XU8 A;  2LT1 A;  2E10 A;  3CCJ Q;  2LMJ A;  4X1V A;  1YWO A;  1YI2 A;  2DD4 A;  5IHI A;  3RIR A;  4E7J A;  4M77 F;  3QWX X;  1B7T A;  4IUV A;  4LUD A;  1OOT A;  3A1P A;  2DPP B;  2LCL A;  2XK0 A;  2CP6 A;  4ATO A;  2CUB A;  2DL5 A;  4F7U A;  3REB B;  3HP9 A;  2RM4 A;  2DYB A;  1WJS A;  4WF2 A;  2DL7 A;  1QCN A;  4J7I A;  1SHF A;  4OB1 B;  1H3H A;  4ANJ A;  1KC8 R;  4KGZ B;  3V7S A;  3X26 B;  1Z9Q A;  2LQW A;  3BY7 A;  1GBQ A;  2CP2 A;  2WSE E;  1X01 A;  5FU6 B;  4JRK A;  2GQV A;  2CP7 A;  4UC4 A;  4LD6 A;  4Y92 A;  3L1A A;  4E47 A;  2PU9 B;  2DX1 A;  2DE0 X;  2I2L A;  4J9D A;  2NUP A;  3OS1 A;  2COY A;  1MMA A;  1KC8 U;  3QJY A;  1VOM A;  1HSQ A;  4JZ3 A;  3EFO A;  1W1F A;  5KYX A;  3PMI A;  4BI8 B;  2NLU A;  4CC4 B;  3JCM X;  5HKC A;  4Z89 A;  1ZHI A;  1Q7Y R;  4C8Q A;  4MZM A;  3QSU A;  3H41 A;  2QTX A;  1GL5 A;  3EHQ A;  1T0J A;  4RTY A;  4QQ6 A;  4C0F A;  4CC2 A;  2X3X D;  3UPU A;  1VQ5 A;  3G4S T;  5J39 A;  1VQP T;  1D1A A;  4M75 A;  1TWB A;  1UGV A;  1Q7Y U;  3BDL A;  3VUB A;  2YUO A;  3OQ5 A;  3G4S Q;  3CCM T;  2BKD N;  1CSK A;  1OEB A;  4JUV A;  3CMA T;  3CC4 A;  2DXU A;  2EGA A;  1KJW A;  3HFO A;  3VS4 A;  3CCM Q;  2HEQ A;  4OMQ A;  2XI9 A;  3CMA Q;  2DBM A;  2CT4 A;  2RJE A;  2YUP A;  3PMT A;  1QW1 A;  2PZ1 A;  1FMV A;  3M4Y A;  4C8Q D;  3V7R A;  1I4K 1;  5FWC A;  4PKC C;  2JTM A;  2OTL A;  5KCH A;  3I5S A;  2KYB A;  2E6Z A;  2CH4 W;  3OMC A;  3NTI A;  4M7A A;  1WXT A;  1MMD A;  2ESW A;  3UDC A;  2K3B A;  1NE8 A;  4M75 D;  2KRO A;  1G5V A;  2L3S A;  2FYK A;  3CPW P;  1WDX A;  2DAQ A;  4M78 F;  2CP0 A;  4E7Z A;  4QQG A;  5CKE A;  5IT9 E;  2EQJ A;  2FZC B;  2SRC A;  3JRZ A;  3WVD B;  4FSX A;  2DTI A;  5DLQ E;  2VWF A;  3G7Z A;  5CKF A;  8AT1 B;  2HCK A;  3JB9 G;  3MKD A;  4M7A D;  5GAN 5;  1ARK A;  1ZSZ A;  3JB9 J;  2FB7 A;  3S3M A;  5CVI A;  1NPR A;  1X2K A;  1SRM A;  3KXT A;  4M7D E;  2F69 A;  5C6S A;  1LNX A;  2L3R A;  3M0R A;  1V76 A;  2PVG B;  4ORZ A;  3EG0 A;  2JUF A;  4NL2 A;  2AZS A;  1JJ2 A;  1K4U S;  3L2Q A;  2DZC A;  1VQ7 Q;  5GAO q;  1BI2 A;  3DB4 A;  4PLI A;  3OSS C;  1WHH A;  3C4S A;  4C5E A;  5A2Q E;  1GRI A;  4OMP A;  4PJO E;  3S6W A;  4LUE A;  1WPY A;  4FIB A;  2RN8 A;  4RTZ A;  2IG0 A;  2F1L A;  1BCM A;  2RK2 A;  3VRZ A;  3LLR A;  2D8J A;  1BBZ A;  3PGG A;  4M77 A;  2HL3 A;  1UDL A;  1G8X A;  2HNI A;  1WHK A;  3L42 A;  3G71 T;  2E1H A;  2XKO C;  4ESR A;  1XQH A;  3X28 B;  5GMK l;  3G71 Q;  3HRS A;  2M02 A;  2HBW A;  5M9O A;  1ZX6 A;  2ABL A;  2JT4 A;  3FJ5 A;  2NUT A;  3A98 A;  1G83 A;  5KYW A;  1OZ2 A;  1VQ4 A;  2FZK B;  3J80 E;  2LJ3 A;  1YIJ A;  2NUZ A;  2BZY A;  4HVV A;  4AG1 C;  1I5O B;  1PWT A;  2LX9 A;  1KSW A;  2VYT A;  1JJ2 S;  3NMZ C;  2P0P A;  7AT1 B;  1RL2 A;  4M7D C;  4C8Q C;  4N4H A;  3MCA B;  1OPK A;  3EGD B;  1WZO A;  4M77 D;  4DEX A;  1WHL A;  4A4G A;  2RJF A;  2M16 A;  1UE9 A;  4XU0 A;  1TUC A;  5HK0 A;  3CBM A;  2EKO A;  4OB0 B;  3MEV A;  2DL8 A;  1U5S A;  2RQT A;  4HVW A;  4XTW A;  1UUE A;  4HKE A;  5CAI A;  5KYY B;  4ZGD B;  5KYN A;  3MEU A;  2XG8 D;  4BY6 B;  1A0N B;  3Q1J A;  1M90 R;  1VQL T;  4PJO C;  2W0Z A;  3JCM c;  2DLP A;  1M27 C;  4XTX A;  3CCQ T;  2JM9 A;  1VQL Q;  4OF1 A;  4Q5W A;  3V8K A;  4FM4 B;  2COW A;  1PD1 A;  4IIM A;  5ECA A;  3CD6 A;  3CCQ Q;  1BI1 A;  4FYW B;  3SEM A;  1M90 U;  1ACM B;  3RUX A;  2BE9 B;  4AFQ C;  4JJD A;  3QII A;  1KG1 A;  2FPE A;  1PG5 B;  4CI0 C;  1K9M C;  1JXO A;  2DBK A;  5GMK m;  2VGM A;  1PHT A;  1RUW A;  4FT4 A;  2YUQ A;  4BDZ A;  5GAM g;  3AHU A;  2DIL A;  1AZE A;  2L0A A;  3OB9 A;  1ZUU A;  4C5H A;  2XDB A;  2P0Q A;  4PLL A;  2RQV A;  4OMN A;  1MGQ A;  1NYF A;  5KCO A;  2E12 A;  4J83 A;  2EBP A;  5HY6 A;  3RBB B;  5LJ3 h;  5C0M A;  2DXC A;  4LDU A;  4PFO A;  2P4R A;  4XU2 A;  3HKS A;  1M2V B;  2LTO A;  4OB2 B;  2X3W D;  1UJ0 A;  3CCR A;  3H0H A;  1SPK A;  1ZSZ C;  3EHR A;  3MP8 A;  5LJ3 j;  3CC7 A;  1JJ2 P;  1AOJ A;  2JM8 A;  2PUK B;  5GAN 6;  4M78 A;  1SRL A;  2VC8 A;  3I55 A;  2K5F A;  2JOY A;  1AT1 B;  3FEO A;  1K8A U;  2R58 A;  4GLK A;  1LVK A;  2LX7 A;  5I22 A;  5FU7 C;  1YJN A;  1S1N A;  2Y4Y A;  3RES A;  4JS4 A;  2HL5 C;  3GPL A;  4FYY B;  2J7I A;  2CYZ B;  1VQ5 T;  4RG8 A;  4C0D C;  2DXB A;  5LJ3 d;  1Y71 A;  2Y90 A;  2AZV A;  1VQ5 Q;  2BZ8 A;  2E65 A;  3R6O A;  2OTJ Q;  5LJ5 h;  2DL3 A;  2C0T A;  1BB9 A;  1ZA1 B;  4C92 E;  2WSC E;  1ABO A;  5IN1 A;  3TSZ A;  4M78 D;  2DKG A;  5LJ5 j;  5FW9 A;  3OYL A;  2OX7 A;  2EYX A;  2COZ A;  1VIF A;  4PJJ A;  1O75 A;  1QVP A;  3QJ6 A;  4LNP A;  3E1S A;  2OTL T;  4HCZ A;  2JMA A;  2F5K A;  1JRI A;  2KT8 A;  4F7U G;  2OTL Q;  2FRY A;  2LC4 A;  1M5Q 1;  1H64 1;  1N5Z A;  1OV3 A;  5CKB A;  3SHW A;  4IUQ A;  2QG9 B;  2B8A A;  2RPN A;  3NFC A;  5LJ5 d;  2H3E B;  4FSS A;  1N8R R;  3CXC S;  1D09 B;  2G3R A;  4OMO A;  3QKJ A;  1HD3 A;  2YUN A;  4BDY A;  4JRP A;  2PVD B;  4BB7 A;  3LH5 A;  3CEY A;  1AD5 A;  1ZA2 B;  1N8R U;  1S72 A;  2RJC A;  1FXX A;  1KK7 A;  3PTA A;  1T3S A;  3OYY A;  1WA7 A;  1VYV A;  4XU3 A;  1Y0M A;  4EMK A;  1U1S A;  4MML A;  2E70 A;  2X4W A;  2LCC A;  1M1K C;  5KYU A;  1MNE A;  4C8Q G;  4DOV A;  5AYF A;  2HD0 A;  2EFI A; 
#chains in the Genus database with same CATH homology
 1XOV A;  4EIK A;  2YDL A;  2DX1 A;  2DE0 X;  4JJC A;  4J9D A;  4DEY A;  1I1J A;  4RTX A;  2FG0 A;  1ABQ A;  4F16 A;  1HSQ A;  2O88 A;  4JZ3 A;  2PNI A;  1W1F A;  1QWE A;  4AFS C;  4CC4 B;  1FMK A;  4Z89 A;  1QCF A;  1M3B A;  5L23 A;  1AWW A;  5IH2 A;  2EQI A;  1Z9Z A;  1AVZ C;  2DNU A;  3H41 A;  1GL5 A;  4JZ4 A;  3EHQ A;  3M0P A;  1E6G A;  1T0J A;  4RTY A;  2FPD A;  1JO8 A;  4CC2 A;  2X3X D;  4CC3 A;  1M3C A;  2PTK A;  3UA6 A;  2OAW A;  2B86 A;  2EPD A;  1UGV A;  2LZ6 B;  3IQL A;  2DJQ A;  2YUO A;  2RMO A;  2ROL A;  1CSK A;  1OEB A;  1TG0 A;  2EGA A;  5FWB A;  1KJW A;  1ZUY A;  3VS4 A;  1PKS A;  2HEQ A;  4OMQ A;  4RTW A;  4F14 A;  1U3O A;  2DBM A;  4QT7 A;  2HDA A;  2KRN A;  2CT4 A;  2YUP A;  1M30 A;  2G6F X;  2PZ1 A;  1UTI A;  2FO0 A;  2GTJ A;  4Z88 A;  3REA B;  2J06 A;  5FWC A;  1UJY A;  2CDT A;  1AWO A;  4J9G A;  2M51 A;  3I5S A;  2DF6 A;  2KYB A;  2CH4 W;  1WXT A;  1IO6 A;  2ESW A;  1X2Q A;  2KYM A;  1PNJ A;  2K3B A;  2KRO A;  3M0S A;  2LJ0 A;  2L3S A;  1UG1 A;  1BK2 A;  1WDX A;  1K0S A;  2EGC A;  3M0Q A;  1NLP C;  4CC7 A;  1KIK A;  3VS5 A;  2D8H A;  2ENM A;  2SRC A;  4RTU A;  3GBQ A;  1KFZ A;  3VS0 A;  1ZBJ A;  2RQW A;  4D8K A;  2A36 A;  2KNB B;  2O9S A;  1OPL A;  1B07 A;  3PE0 A;  2VWF A;  2K7A A;  3R6N A;  2C0O A;  5GJW B;  1X6B A;  2HCK A;  2BZX A;  2EYZ A;  4LE9 A;  1ARK A;  2VKN A;  5IHN A;  4OMM A;  2KRS A;  1WX6 A;  1X2K A;  1SRM A;  2LCS A;  2GBQ A;  3M0R A;  4HCK A;  1NYG A;  4ORZ A;  2LQN A;  3EG0 A;  1GBR A;  1GFC A;  1FYN A;  1UFF A;  1CKA A;  2MIO A;  2AZS A;  4GBQ A;  1K4U S;  4OML A;  4F17 A;  2O9V A;  2RNA A;  4AFU C;  1QLY A;  2EKH A;  1SHG A;  1I07 A;  1RI9 A;  2FEI A;  1NEG A;  1AWJ A;  4GLM A;  1GRI A;  4OMP A;  1NM7 A;  4LUE A;  2ED1 A;  2AKK A;  2GNC A;  2RN8 A;  2I0N A;  2DRM A;  1NG2 A;  4RTZ A;  4J9E A;  2JW4 A;  2L2P A;  2BTT A;  3VRZ A;  1YN8 A;  2D8J A;  1BBZ A;  2SEM A;  4R0K A;  3UA7 A;  1LCK A;  1UDL A;  2IIM A;  3I9Q A;  2DL4 A;  4ESR A;  4J9H A;  2FPF A;  2O31 A;  3ULR B;  1UEC A;  2LJ1 A;  2HBW A;  1K0X A;  1SSH A;  1ZX6 A;  2ABL A;  2JT4 A;  3FJ5 A;  3VS2 A;  5IHK A;  3NGP A;  2ECZ A;  4Z8A A;  2W10 A;  1G83 A;  1JQQ A;  3A98 A;  4D8D A;  1JEG A;  4A63 B;  2LJ3 A;  4ZNX A;  2ROT A;  2NUZ A;  2BZY A;  4HVV A;  4J9I A;  4AG1 C;  1PWT A;  4JPB W;  1NEB A;  1KSW A;  1M8M A;  1YWP A;  2JS0 A;  3NMZ C;  4AFZ C;  3RNJ A;  5GJV B;  1G2B A;  2D1X A;  1OPK A;  2NWM A;  2GTO A;  3O5Z A;  1M3A A;  4DEX A;  1X27 A;  4AG2 C;  3EGU A;  2LP5 A;  1UE9 A;  1TUC A;  2KE9 A;  3U23 A;  2KRM A;  2QDL A;  5EC7 A;  2EGE A;  2VVK A;  2KXC A;  1W70 A;  1GFD A;  2OI3 A;  4E6R A;  2DL8 A;  4RTT A;  1U5S A;  2RQT A;  4HVW A;  1JXM A;  1UUE A;  3PVQ A;  1X43 A;  1ZSG A;  2D0N A;  1A0N B;  1E6H A;  2KBT A;  2KT1 A;  1CKB A;  1TUD A;  2CRE A;  4RUG A;  2F2X A;  2W0Z A;  3NHN A;  1SEM A;  2DLP A;  1M27 C;  2K79 A;  2KR3 A;  2JM9 A;  2V1Q A;  5IXF A;  3H0F A;  3C0C A;  1WXU A;  2GQI A;  3VRY A;  4IIM A;  5ECA A;  1AZG B;  2JS2 A;  4LN2 A;  2A08 A;  1U06 A;  2CUD A;  3SEM A;  3VS6 A;  2F2W A;  2F2V A;  2AK5 A;  1HJD A;  4AFQ C;  1B3Q A;  2L3Q A;  3H0I A;  4JJD A;  2MCN A;  2FPE A;  2RQU A;  1JXO A;  2DBK A;  3VS7 A;  2AKL A;  3NPF A;  1PHT A;  1RUW A;  2L3P A;  4J9F A;  1X6G A;  2YUQ A;  4WCI A;  1GCQ C;  1PKT A;  4J9B A;  2K9G A;  4HXJ A;  1K76 A;  2DIL A;  1AZE A;  2L0A A;  1ZUU A;  2A37 A;  3JV3 A;  1WYX A;  2HSP A;  2JXB A;  3QWY A;  2RQV A;  4OMN A;  1J3T A;  1NYF A;  2JTE A;  1Y57 A;  2EBP A;  3RBB B;  4M4Z A;  2P4R A;  2ED0 A;  4RTV A;  1H8K A;  2KGT A;  2X3W D;  2K6D A;  1UJ0 A;  2EVR A;  3H0H A;  2K2M A;  1SPK A;  1RLQ C;  3EHR A;  1W6X A;  1WLP B;  2DVJ A;  1AOJ A;  1WFW A;  2JM8 A;  2M0Y A;  1YP5 A;  4JJB A;  2MOX A;  5I11 A;  1SRL A;  3I35 A;  2RF0 A;  1T0H A;  3EG2 A;  1K9A A;  2DM1 A;  2RQR A;  1PRL C;  1GCP A;  2LX7 A;  5I22 A;  3VS1 A;  2DMO A;  1S1N A;  1MV0 B;  3TVT A;  1AEY A;  1JU5 C;  1YCS B;  2J7I A;  4HVU A;  3ZL7 C;  2KEA A;  3PVL A;  1VYT A;  1QKX A;  3UAT A;  2JMC A;  1MUZ A;  2DRK A;  4K11 A;  1BU1 A;  2AZV A;  2BZ8 A;  2EW3 A;  3CQT A;  1ZLM A;  2CSQ A;  2DL3 A;  1WIE A;  5HCK A;  2DA9 A;  2C0T A;  1K1Z A;  2KXD A;  1YNZ A;  1BB9 A;  2EYY A;  2LNH B;  1VA7 A;  3I5R A;  1NLO C;  3VS3 A;  2CH4 A;  4KRT A;  2EYW A;  1ABO A;  3KFV A;  3TSZ A;  2GGR A;  2V1R A;  1T3L A;  1AWX A;  5FW9 A;  2EYX A;  1H92 A;  4J9C A;  2E5K A;  1ZUK A;  3EG1 A;  4LNP A;  2JMA A;  1QWF A;  3M0T A;  1V1C A;  2KT8 A;  1VYU A;  2FRY A;  1N5Z A;  1OV3 A;  2OJ2 A;  3SHW A;  1UHC A;  1WXB A;  2LMJ A;  3EG3 A;  1WI7 A;  4X1V A;  2RPN A;  1YWO A;  3M0U A;  4FSS A;  5IHI A;  1GCQ A;  1I0C A;  5IXB A;  2A28 A;  3QWX X;  2J05 A;  4OMO A;  1HD3 A;  2H8H A;  2YUN A;  4LUD A;  1OOT A;  2CT3 A;  4IIO A;  3LH5 A;  2CSI A;  1UHF A;  2FRW A;  1AD5 A;  2CUB A;  2DL5 A;  3REB B;  2YT6 A;  2DYB A;  1X69 A;  2C0I A;  1T3S A;  1MV3 A;  1WA7 A;  2DL7 A;  1VYV A;  1EFN A;  1SHF A;  1Y0M A;  3THK A;  1H3H A;  3TSW A;  1E7O A;  1QKW A;  2O2O A;  2XMF A;  3UF4 A;  1Z9Q A;  1RLP C;  2LQW A;  1GBQ A;  2J6K A;  2YSQ A;  2J6O A;  1PRM C;  2J6F A;  4Y92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...