2DRMA

Acanthamoeba myosin i sh3 domain bound to acan125
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
b'GPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acanthamoeba Myosin IB
publication title The crystal structure of the SH3 domain of Acanthamoeba myosin IB bound to Acan125
rcsb
source organism Acanthamoeba
molecule tags Contractile protein
total genus 11
structure length 58
sequence length 58
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2drmA00
1W1FA 3UF4A 2DF6A 1RLPC 2KEAA 2GBQA 1WI7A 2PZ1A 3O5ZA 4AFQC 2J6FA 1UECA 1X27A 2JTEA 2YUQA 3I5SA 3TSWA 3ULRB 5EC7A 1RLQC 1GFDA 2CH4A 1SPKA 1T0HA 2D8HA 1OPKA 4ZNXA 2CT3A 2X3XD 1NYFA 2ABLA 1AWJA 1QCFA 2FEIA 2VWFA 2BZYA 1YP5A 2J7IA 4HXJA 5I11A 4AG2C 4DEYA 1AWWA 2F2VA 2EGAA 2LQNA 2PTKA 2LJ1A 2PNIA 1ABQA 2ENMA 2DILA 4D8DA 2KGTA 1K4US 1UE9A 1NLOC 4LUDA 3PVQA 1G2BA 1NEBA 3VS4A 3NGPA 3SEMA 2C0IA 2OJ2A 1A0NB 2JW4A 3ZL7C 4HVUA 1MV3A 2YT6A 1X69A 2VKNA 2LMJA 2LP5A 4ESRA 4Y92A 3EHQA 4RTVA 4CC3A 1QWFA 1NEGA 1X6BA 2O88A 1M3AA 2JM9A 2YUNA 2KRNA 4OMQA 2CUDA 2KT8A 3NPFA 2DVJA 2YUOA 2YUPA 2ECZA 2KYBA 4FSSA 1GBQA 2X3WD 1JXOA 2JMCA 2O31A 1AWXA 1UJYA 3A98A 1JEGA 2AKLA 2C0TA 4J9EA 2P4RA 1CKBA 1QKWA 2NWMA 1RI9A 2JXBA 2RN8A 1ZUUA 2RQWA 3FJ5A 2DE0X 4RUGA 3VS1A 3EG3A 1QKXA 1GCQC 4JJDA 1AVZC 4RTZA 1KIKA 2DNUA 1BU1A 4EIKA 2CUBA 2KT1A 4JPBW 1SHFA 1W6XA 1SSHA 1HD3A 2J05A 1XOVA 2DL4A 2RPNA 1HJDA 1M3CA 1H92A 2BZ8A 3TVTA 1UGVA 2RNAA 5IXFA 1GFCA 1ZBJA 2G6FX 3TSZA 2DRKA 3QWYA 1PRLC 1J3TA 2HBWA 2J6KA 1YWOA 3H41A 4AFUC 2L3SA 2EKHA 3U23A 2A37A 1SRLA 2FPEA 1OOTA 2C0OA 2KRSA 1E7OA 1JQQA 2DRMA 2AK5A 2SEMA 4Z89A 2V1RA 1SHGA 2BTTA 3M0TA 3VS2A 4D8KA 5HCKA 2KNBB 1GCQA 2DBMA 1NLPC 1T0JA 2MOXA 4J9DA 1GBRA 2B86A 3M0PA 2CDTA 2DLPA 2EGCA 3EGUA 5FWCA 1I0CA 2CT4A 2KE9A 4OMPA 3EG1A 2KXCA 4CC4B 4Z8AA 1BBZA 4RTWA 4J9CA 1EFNA 3VRYA 4HVWA 4LNPA 1HSQA 3EG2A 2HEQA 1MV0B 4E6RA 1B07A 1UJ0A 2EYWA 2KXDA 1U3OA 4JJCA 1GL5A 1AEYA 1OPLA 2LQWA 1Y57A 2EYYA 2FPFA 1WLPB 3C0CA 4IIOA 2O2OA 1PNJA 5GJVB 1ABOA 4J9IA 2D1XA 2JS2A 1PWTA 4OMLA 3M0SA 5ECAA 1W70A 2OAWA 2H8HA 3SHWA 5IXBA 3I5RA 2DX1A 1I07A 2EGEA 3M0QA 2J06A 1SEMA 2J6OA 1ZUYA 4M4ZA 2FPDA 2GGRA 3UA7A 4IIMA 4J9FA 2CSQA 2YSQA 2M0YA 1JXMA 4F16A 2BZXA 3H0IA 2FRWA 4OMMA 1WX6A 2F2WA 2NUZA 2LJ0A 2AZVA 2ESWA 2L0AA 1TUCA 1Y0MA 3EG0A 2V1QA 4DEXA 3PVLA 1MUZA 2RQRA 4GLMA 1K0XA 2A08A 2AKKA 1U06A 4OMNA 3I35A 1WIEA 2ROTA 1YN8A 4RTTA 1ZX6A 3RBBB 1YWPA 3M0RA 2M51A 1WXBA 4X1VA 2RQTA 2O9SA 5GJWB 1OV3A 3VS6A 1M3BA 5FW9A 3EHRA 3VRZA 5L23A 2OI3A 1Z9ZA 1ZSGA 2FG0A 1IO6A 1V1CA 2KROA 4AG1C 1QWEA 1UTIA 1GCPA 4Z88A 1TUDA 1AWOA 2CH4W 2DJQA 2DL7A 3I9QA 3CQTA 2K2MA 3UA6A 1X2KA 1UDLA 2K6DA 1LCKA 1PRMC 2QDLA 1H3HA 4OMOA 4ORZA 4JZ4A 1X2QA 2DM1A 2DMOA 1PKTA 2KBTA 2L3QA 1CSKA 2FO0A 2GNCA 4HCKA 1RUWA 2FRYA 5I22A 1WXTA 1KFZA 1BK2A 2A28A 1AD5A 2IIMA 1NM7A 4HVVA 1NYGA 2I0NA 1UFFA 1CKAA 2LJ3A 1VYUA 5IH2A 2JS0A 2EW3A 3GBQA 2CSIA 3R6NA 1UG1A 1UHCA 1SRMA 2MIOA 2RQUA 2HSPA 3REBB 4CC7A 4K11A 1PHTA 1WFWA 3JV3A 1TG0A 4F17A 1Z9QA 2RQVA 5FWBA 1K9AA 1AZGB 2ROLA 1WDXA 2MCNA 2DL5A 1G83A 4R0KA 1I1JA 2LNHB 2L3PA 2XMFA 3IQLA 4QT7A 2EQIA 1K1ZA 1AOJA 2W10A 2KYMA 1M8MA 4J9HA 2K9GA 4CC2A 2D0NA 2KRMA 1VYVA 2JM8A 2DBKA 4J9GA 2CREA 4GBQA 2L2PA 2LX7A 4LN2A 3RNJA 1YNZA 2DA9A 4RTYA 1T3SA 3NMZC 1KSWA 1M30A 5IHNA 1FYNA 4RTXA 1X6GA 2RMOA 2GTOA 2VVKA 1E6GA 2SRCA 1JU5C 4A63B 2F2XA 4JZ3A 1QLYA 1AZEA 3LH5A 4RTUA 1VYTA 1UHFA 2EPDA 1T3LA 2LZ6B 2DL3A 3PE0A 2EVRA 1FMKA 2GTJA 1WXUA 1PKSA 3H0HA 4AFZC 2JT4A 2EBPA 2HDAA 3H0FA 2W0ZA 1VA7A 1WA7A 1X43A 1K76A 1K0SA 1GRIA 1S1NA 2EYZA 3VS3A 2D8JA 1M27C 2AZSA 1OEBA 2RF0A 1NG2A 1ZLMA 2A36A 3VS0A 1ZUKA 2HCKA 4KRTA 1BB9A 1JO8A 2LCSA 1KJWA 3M0UA 2GQIA 3NHNA 2K79A 1U5SA 3UATA 4F14A 1N5ZA 2O9VA 2DYBA 2K3BA 3QWXX 2KR3A 5IHKA 4JJBA 4LUEA 2ED1A 2JMAA 3THKA 3VS5A 2ED0A 3REAB 2K7AA 3VS7A 3KFVA 1B3QA 1YCSB 2EYXA 4AFSC 2DL8A 4WCIA 1E6HA 5IHIA 1WYXA 4LE9A 1ARKA 2YDLA 1UUEA 2E5KA 1H8KA 4J9BA
chains in the Genus database with same CATH superfamily
1SSFA 1W1FA 3CEYA 1Y7XA 2MPXC 2QASA 2DIQA 3O5ZA 3EFOA 4EPCA 2J6FA 1EIFA 4PJOC 1JBMA 1Q7YU 4PFOA 1BIBA 4M75F 1VQOT 4RCCA 4FSXA 3QUIA 5LJ3j 2H3JA 1G3TA 2ABLA 1QCFA 1RAEB 2BZYA 3MJXA 1YP5A 4ATOA 2NUTB 4XTZA 4HCCA 8ATCB 1KQSA 2LQNA 5CVIA 1ABQA 2DILA 2M0OA 1UE9A 5LJ3f 3KXTA 1A0NB 2NYSA 2QQAA 1YJNT 4JUVA 4IKFA 1C1AA 1N9SA 3L2RA 3OYMA 4JS4A 4E7LA 4E7SA 1S72A 1OX9A 2LMJA 5CQXA 4XK8E 3CCMT 1VQ6T 1QVGS 2LCCA 4RTVA 1VQNQ 4CC3A 1QWFA 4M77G 3E2UA 5CCAA 1M3AA 2YHTA 4XAXB 4R55A 4MZPA 2JM9A 1Q82C 4OMQA 2KT8A 2CP3A 3NPFA 4L6V5 4LDXA 2ECZA 1TS9A 2KYBA 4FSSA 1GBQA 4C8QF 2O31A 2RHZA 1JEGA 3RUXA 1VQMA 4C92E 2DEUA 2E1HA 3L1AA 2MWPA 1R0CB 4WTOB 4IUTA 1WZOA 2NWMA 3SFMA 4BACA 2JXBA 1I4K1 2K4YA 2RH2A 1GCQC 4JJDA 3JCMX 3CCUT 2QGGA 2RHUA 4DBQA 4QVDA 1YHQQ 4EIKA 1LVKA 4JLIA 4JPBW 1VQ9A 3LWIA 1SSHA 2J05A 2FHDA 1HJDA 1M3CA 1K9MU 4F7UB 2ZPBB 1ZBJA 3TSZA 1Q7YR 4J7IA 4FU6A 2J6KA 3HRSA 4C92F 1W2BS 1VQMT 1YWOA 2COYA 5GMKj 4AFUC 4PFZA 4RG2A 2L3SA 2QYZA 1YCYA 3JB9G 3RKYA 1JQQA 2P0PA 2AK5A 2IG0A 2EQMA 4Z89A 2BTTA 3VS2A 3MEVA 2KNBB 5D6YA 2GQVA 4HCBA 2DBMA 4N4HA 3G4ST 2EJGA 1T0JA 4MZMA 1GBRA 2B86A 1ZSZA 2F5TX 3M0PA 5KCOA 3EGUA 5FWCA 1I0CA 4RTWA 2HKQB 4J9CA 9ATCB 1EFNA 3H8ZA 3FEOA 4M7DF 3SDZA 4A53A 1HSQA 3QG1A 5CAIA 1JJ2A 1B07A 5J26A 1VQ5T 2CYZB 4EMGA 1GL5A 3P8BB 3V7CA 3V8LA 1XTDA 2O4XB 2FPFA 3M59A 2PQWA 2RJDA 3C0CA 3AT1B 2LDMA 4J9IA 2D1XA 2JS2A 5EG2A 3T9NA 1BI2A 4M78B 4UC4A 2H8HA 5GAMe 4EMKA 2QDYB 3I5RA 4IUPA 4PLIA 1NJIU 4KUDK 2NUPA 2EGEA 1X01A 3M0QA 1YJ9T 1G3YA 1PSEA 1SEMA 2J6OA 2XD0A 1ZUYA 4X34A 1N8RC 4J9FA 1K9MR 2M0YA 2Y4YA 3H0IA 4N0AA 2AZVA 2ESWA 3L2QA 1Y0MA 3CCLQ 2RI5A 1MUZA 1M1KU 2RQRA 2DFUA 4AT1B 3EFRA 1M90R 1V76A 5KE3A 3OW2A 5FU6B 1QVGP 1KC8C 3CCMQ 4ME7A 4OMNA 1Q86U 1YN8A 3DKMA 5LJ5h 3SWNA 3JCMf 3JCMP 1D09B 1UGSB 5GAN3 3SB2A 1SF9A 5GJWB 4PJOB 4A54A 3EHRA 4KULA 3RDVA 1Z9ZA 3OYJA 1IO6A 1D1CA 3OYLA 2DXUA 4PKCC 2DJQA 1KD1C 3I9QA 3E1SA 2M16A 3UA6A 2X35A 1UDLA 3CCUQ 4MZTA 2EQUA 2QDLA 3QKJA 4JZ4A 4ORZA 2DXTA 5LL6S 3TU4K 2MI6A 3ZBDA 1CSKA 2PUKB 2FRYA 2A28A 2IIMA 1PD1A 4V2SA 2XI9A 1UFFA 1N27A 2MWOA 2LJ3A 2RK1A 1NPPA 1W2BP 5KYUA 2CSIA 2QEXT 1RAAB 1UHCA 4ZTFA 2MIOA 1Q81C 1NJIR 2RD1A 4M7DC 1SKUB 3EG9A 3CC7Q 3CCSA 2RB6A 4OB3B 4Y91A 4ANJA 4F17A 1Z9QA 4LD9K 5FWBA 1K9AA 2ROLA 3FDRA 1WDXA 1TUGB 3L2UA 4DBFA 1VQLQ 2XMFA 1M1KR 3CMEQ 1K1ZA 1VQ4A 1G8XA 3G4SQ 4BUGA 3VYGA 2DBKA 4J9GA 1WHGA 1FX7A 1Q86R 2LX7A 3OYEA 1T3SA 5L8RE 4M77A 2O01E 2QG9B 1GXIE 4D6WA 2KDSA 1X6GA 3P8HA 4IUQA 3CXCS 2V8KA 4A63B 4YTLA 3MP8A 1O75A 5KYWB 1QLYA 4PJLA 1AZEA 2E65A 3LH5A 1TOVA 3I56T 2YLBA 4FIBA 1G3WA 3PE0A 2GTJA 2DAQA 2VXEA 2X4WA 1PKSA 2EBPA 1I81A 3JCMg 5CKDA 5AT1B 3A5ZB 3CD6Q 3DLMA 2LX9A 1YJ9Q 3OBYA 1M9SA 2D8JA 1B34A 4C5EA 3PGGA 5AYFA 4N4GA 2RF0A 4M75B 2A36A 5GAOq 1ZUKA 2DETA 2GQIA 1I8FA 1NPRA 2DYBA 3QWXX 2KAFA 4A4EA 4LDUA 4PJOE 1VQNA 3QPHA 1RABB 3C95A 4NL2A 1JB0E 4C0GA 4M77D 3M4GA 3MO8A 3MEAA 3NFCA 2ED0A 1IXDA 2P4TA 2JN0A 5HK3A 1YCSB 2E41A 2E12A 2QAZA 1E6HA 1H641 4Q5WA 5IHIA 2G3RA 1D3BB 2YDLA 1D1AA 3QXEB 3X20B 3OYGA 2VASA 2YRVA 2E5KA 4PK4A 3UF4A 2DF6A 4BY6C 3HTRA 1WI7A 2FZGB 2PZ1A 4OGCA 4AFQC 2JTEA 3I5SA 1YHQA 1VQNT 3LGLA 5EC7A 1Y96B 4J6YA 1RLQC 2BIVA 3A8MB 4C8QB 2D8HA 1XNIA 2OTJT 4ZNXA 2D6FA 1Q7YC 4DA4A 1VQKT 2X3XD 4OGEA 4JJNK 2FEIA 2VWFA 4HXJA 1K73U 2R58A 2BE7D 2DTIA 2C06A 2LJ1A 1VQ8Q 2CP7A 5GAN5 2WACA 4FYXB 4M7AA 4C5IA 1NLOC 4ELZC 4LUDA 2GFUA 3GNGA 5GANf 4JDSA 1PCXA 3SEMA 2QEXQ 4HVUA 1Y07A 3JB9D 2WSCE 2CZ6B 4C92B 3UDCA 2R5MA 1BYMA 2YUNA 3OYDA 5LJ3e 2BE9B 4X9CA 2DVJA 4BD3A 2YUOA 4KH0B 3G71T 1MGQA 2RI2A 3M4YA 4GLKA 2QXFA 1TWBA 2JMCA 3A98A 1AWXA 3CCRQ 4RG8A 1KQ2A 2C0TA 3JB9I 5CKFA 2DJZA 3P8DA 1ZA2B 3FJ5A 2QA4T 2DE0X 2M02A 5GAN4 4C0FA 3OY9A 2A0FB 4RTZA 1KIKA 2DNUA 3CXCP 2HQXA 5GAMh 1PG5B 2CUBA 1W6XA 4M7AD 4R56A 1HD3A 2LC4A 3DB3A 2DL4A 2RPNA 4M7DB 4FCYA 1UB4A 1H92A 2Z0WA 1VQPQ 2RHIA 2RNAA 4M75E 1GFCA 1LPLA 2DRKA 1PRLC 1K9MC 2CS7A 2HBWA 3OYIA 2DEQA 5KYXB 3RKWA 3H41A 1BI0A 4P5NA 1BI1A 1QVGA 4B9XA 3U23A 1SRLA 2FPEA 4LDVA 3CCLA 1OOTA 4EDUA 1K73R 2AHJB 3BDLA 3M58A 2KRSA 3GPLA 1LOJA 1YJNA 3M0TA 3QDFA 5HCKA 2X4XA 4EMKC 4A4KA 2RJFA 2NUTA 4EMHA 3JAME 3CCMA 1VQ6A 3S3MA 5CKBA 5GAMd 4RCBA 4M77F 2E6ZA 5KYYB 1IHWA 2CT4A 2KE9A 4OMPA 4C5HA 4X9DA 5LJ5j 2KXCA 5C0MA 4N0AC 3Q1JA 3META 4L59A 3G7ZA 5I21A 4HVWA 4LNPA 2XDBA 2HZYA 4PJMA 4C8QE 3R6OA 1MV0B 4E6RA 1UJ0A 2EYWA 1M5Q1 4JRKA 3CCLT 2KXDA 5GANg 4JJCA 1AEYA 5LJ5f 4B6MA 5A0LA 5I2MA 1D0ZA 2K3XA 2FZKB 5D6XA 2CZ1B 4LD6A 4QQ6A 4J6WA 4O6JA 3SWNC 3CCUA 4J8OA 2KQWA 1PWTA 1W2BA 4OMLA 2X51A 1NE8A 2OAWA 3QHSA 2OTJQ 3QSUA 4LXCA 2VXFA 1WHHA 4DBRA 3OYYA 1VQKQ 2ATCB 1NJIC 3UA7A 2MF2A 3FRNA 2HSEB 2D0QB 2FRWA 4OMMA 2L5QA 1WX6A 2F2WA 4E7HA 4Y28E 2JJ9A 2L0AA 3C94A 2RHXA 3C12A 1TUCA 3RMQA 3JRZA 3EG0A 4DEXA 1WJQA 3CC7A 3FB9A 3VKIA 3LH0A 4F7UA 4GLMA 1EX4A 2QTXA 2DK3A 3EH1A 1M1KC 3OYCA 3AHUA 1PD0A 3JB9F 1WQ7A 2GCXA 1R0BG 5A0DA 2ZPIB 3OMGA 3CMEA 3RKXA 3BW1A 1ZX6A 1YWPA 3M0RA 3G4SA 1Q86C 1U1SA 3CCEQ 2O9SA 1OV3A 2ZGWA 5FU7B 3VS6A 3G71Q 1M3BA 1H3ZA 3OYHA 5GMKl 4RKUE 4QKUA 4XTXA 5L23A 2FL7A 5C6SA 2OI3A 3GP8A 1IB8A 1V1CA 2DKGA 5KYNA 5GAOn 3HL8A 1M90U 4PJJA 4M7DE 4AG1C 1QWEA 3CC7T 1GCPA 1RI0A 4Z88A 2CH4W 1VQ5A 3JCMe 1IGQA 2QA4Q 3CQTA 2K2MA 3G6ET 2M9UA 3VUBA 1JRIA 2F1LA 1PRMC 3OB9A 1VQLT 3CBPA 3CMET 1X2QA 2DM1A 2ZPFB 1UGRB 2PVOB 2F69A 2FO0A 1R77A 1TU0B 4DOVA 1ACMB 1K8AU 4HVVA 4M77C 3SD4A 3CC4T 1X6OA 3M53A 5IH2A 3CD6A 2EW3A 1YJ9A 1FMVA 2GFAA 5HY6A 3R6NA 2RQUA 8AT1B 4PJNA 5CQYA 3REBB 2DPPB 2XU8A 2QQBA 4QVZA 1N6AA 4M78A 1M2OA 1TXQA 1PHTA 3HKSA 3OS0A 5LJ3g 3J7AF 5LJ5g 2RQVA 1RAHB 3QIIA 3EAEA 1AZGB 1LNXA 3HHTB 3CC2T 2QQSA 2XK0A 1G83A 2E6NA 5M9OA 2LNHB 3ME9A 4M7AG 4FL6A 4GY5A 2W10A 2KYMA 3I55T 4J9HA 2K9GA 4CC2A 2D0NA 3CMAQ 1ZSZB 2L2PA 5DM7R 3CD6T 5HKCA 5KE2A 2RI3A 4KUIA 5KCHA 3CCJT 4RTYA 3EGXB 2WSFE 1X75C 2GTOA 4ZGJB 4JZ3A 5GAOr 4CI0C 2E3HA 2GF7A 3WVDB 1WXUA 4KT0E 4A4GA 4C0DC 2JT4A 4M78D 3UWNA 2HDAA 3H0FA 2W0ZA 2DO3A 2HL5C 1K76A 1M1FA 1K0SA 1VQ8A 2EYZA 2NUPB 1IHVA 3GNFB 1NZ9A 4F04B 1ZHIA 4IURA 3OYKA 4BDYA 1NG2A 1K8AR 2X9HA 2QEXA 2LCSA 4KGXB 1U5SA 4JLGA 2K3BA 2KR3A 5IHKA 4BE2A 2ED1A 3OS2A 2VB6A 3THKA 3VS5A 3MCAB 3REAB 2EYQA 3KFVA 4NOYA 4M7AC 2HAXA 2JNGA 1B3QA 2EYXA 4IUUA 2LCLA 2X4YA 1WYXA 3CXCA 3CCRA 1ARKA 1VQ8T 3MKDA 2R57A 2LTOA 2RHYA 2HKNA 4IUVA 3H9NA 1RLPC 2KEAA 3VV0A 3G1JA 4J5YA 1QP2A 1D0XA 1KQ1A 2YUQA 3LLRA 3TSWA 1YI2Q 3ULRB 4Z02A 2YRCA 3G6EQ 2QK0A 5LJ3d 3CPWS 3JB9J 3I56A 2CT3A 1YITT 1NYFA 1AWJA 2EIFA 1UEBA 1QVFS 2J7IA 5I11A 4OVAA 4AG2C 4DEYA 3CCRT 1KK7A 2ENMA 3VYHB 1NBEB 4PLLA 5KYWA 3CC4Q 4PL6A 1K73C 1K4US 3PVQA 2DZCA 1NEBA 2K2VA 2C0IA 2OJ2A 2JW4A 3ZL7C 2E10A 1MV3A 3MP6A 5KYUB 5DLOA 1VQ9Q 4XTWA 2Y90A 3GOXA 1X69A 2VKNA 3TEEA 3L42A 1NEGA 1X6BA 2BKDN 2O88A 1YJWQ 3CC2Q 5GMKi 1BI3A 2KRNA 2KMTA 2CUDA 1WQWA 3E9GA 1VQPT 1QMCA 5GANe 4E7JA 4AMCA 4J83A 2HMAA 4JRQA 3OYAA 3OYFA 4F7UG 2X3WD 1JXOA 3EGDB 3I55Q 2AIRB 2IVWA 3OYBA 4J9EA 2P4RA 3GF5A 3UT1A 4DQ2A 2RN8A 4RUGA 4E47A 3CCJQ 3LW5E 3EG3A 5CKEA 1AVZC 3M56A 4M77B 3H6ZA 1SHFA 2VC8A 5GAOl 4HKEA 3DLLA 2DZ9A 1RAIB 1YIJT 1UGVA 2OTJA 4LDWA 5IXFA 2G6FX 1WNLA 3OSVA 1OU9A 4XTYA 1VQKA 1J3TA 2CP0A 2DD4A 1RL2A 1MMNA 2OX7A 4NS5A 1Y96A 1WJRA 3VUZA 3JCMV 2EKHA 2ZPEB 1C0MA 2DRMA 1RACB 4KGVB 1D0YA 3NTIA 2V1RA 1SHGA 4D8KA 3L2ZA 1MNDA 1YFNA 1M8VA 5CKHA 3FC3A 1NLPC 3A8OB 1VIEA 2EJFA 1IREB 2CDTA 1VQ7Q 1MNEA 2LQKA 2RA2A 2VYTA 4M78G 4XU0A 1M2VB 3EG1A 3CCEA 3EH2A 5FLXE 3G71A 3JCMh 3OMCA 4MMKA 4BE1A 2HEQA 4C92A 3M54A 4DOWA 3JCMJ 1IZ6A 1OPLA 2CZ7B 5D7UA 2CZ0B 2QA4A 2A7YA 2DXBA 3QO3A 2V8JA 1WHJA 2O2OA 1PNJA 1ABOA 3ZEHA 3MHXA 4A4FA 1QCOA 1PC0A 3CPWP 1W70A 5IXBA 2ZCFB 2MMPA 4JRPA 2VGNA 5GAN2 3CCET 2VUBA 3CBMA 4QW2A 1YITQ 5LJ5e 3S3NA 2GGRA 3HRTA 4C5GA 2CSQA 4TVRA 4KGZB 1JXMA 2BZXA 4PJOG 2LJ0A 3PIPA 2M1HA 5DLQE 2EKOA 3PVLA 3JCMd 3C4SA 1KD1R 3OQ5A 1FWZA 3LGFA 2AKKA 1QVPA 4C92D 1WHMA 3JSCA 4RTTA 3M5AA 1AT1B 2OTLT 2M51A 2EJ9A 2DVEA 4HA8A 2RQTA 1WPYA 4M77E 4NL3A 4M78C 3F70A 3ASKA 1Q81R 1XJWB 1ZA1B 3WVEB 1UTIA 3QJ6A 5KYYA 2P0KA 1M90C 2JOYA 4RMOA 3DB4A 1VQ4Q 1H3HA 4OMOA 1R8OB 3JB9H 1PKTA 1QCNA 4OB1B 3MPUB 4HCKA 1RUWA 5I22A 3CMAT 1KFZA 4KBMB 1BK2A 2XG8D 5FU6C 1NM7A 1YBYA 1VUBA 3PTAA 3TQ7P 3URGA 1F1BB 2I0NA 3CCVQ 1YIJQ 1V29B 3CCQQ 1CKAA 1K8AC 2LVMA 2XDPA 1UG1A 3RESA 1SRMA 2VV5A 1Y71A 5GMKe 5GAOm 1ZQ1A 1OI1A 2LRQA 1RAGB 1TTHB 3S6WA 4K11A 3JV3A 3MEUA 2YLCA 4FT2A 5FRNA 2FVUA 3EFSA 1VOMA 2MCNA 3L2WA 4C0ZA 3BY7A 3PMIA 3A8HB 1TSFA 2L3PA 4QT7A 3QBYA 2EQIA 3WXMB 1AOJA 2E4HA 1M8MA 3KBGA 5A2QE 3EFOB 5J39A 4ZGEB 5KH6A 3PT9A 2JM8A 2CREA 4GBQA 4LN2A 3V8JA 1YNZA 1KSWA 1Q95G 1M30A 4FW1A 2R5AA 4RTXA 2SRCA 4M75G 4WF2A 1SG5A 4RTUA 1YI2A 2A3LA 3GIBA 1MMGA 1UHFA 4XU1A 3G6EA 2DTHA 2E3IA 1U8RA 7AT1B 1FMKA 2HQHA 1VQLA 3S3OA 2HD0A 3M55A 3CPFA 4M7AE 1WA7A 4BY6B 3OS5A 1B7TA 1DJ7B 3HRUA 1S1NA 3CC4A 3OS1A 2AZSA 2XICA 1OEBA 3VS0A 1S72T 2E70A 3HSBA 2HCKA 4KRTA 2ZPGB 1BB9A 1KQSS 3UATA 2K5FA 1QQJA 2RJCA 2VGMA 3FLGA 5GANh 2JVVA 1YI2T 1OQKA 4JJBA 2RJEA 2YWWA 5GAOp 1YJWA 3CC2A 3FIFA 4C8QG 4ZN3A 3X24B 4M7AF 4QQDA 4AFSC 2DL8A 2OTLQ 3I55A 4J6XA 4LE9A 2P0QA 1C6VX 3BE3A 4KH1B 3CBOA 2O4XA 1H8KA 1I5OB 3NTHA 1UGQB 2DYIA 3CCJA 2GBQA 1VQ9T 2COZA 2KSSA 1UECA 1X27A 3VU3C 5GAN7 5CO7A 3MEWA 2CP2A 3JCMc 4FT4A 2DIGA 2PVGB 2L3RA 1GFDA 2CH4A 4M75C 1SPKA 1T0HA 1OPKA 1YJWT 4HT9A 2F5KA 3FJPA 2LT1A 5GANd 4C92G 3EGXA 2QQ9A 1LJOA 2COWA 2LT4A 2KK4A 4HT8A 1AWWA 1WHLA 2F2VA 2EGAA 3HFOA 4E7KA 3ER0A 3RIRA 2PTKA 2PNIA 5GAN8 4D8DA 2KGTA 1I5LA 3X25B 1G2BA 3VS4A 2ZAEA 3NGPA 3LWHA 1OYXA 2YT6A 4ESRA 1WHKA 2LP5A 4Y92A 3EHQA 3UPUA 2X4JA 1Q82U 2JUFA 2V26A 1N9RA 1VQOQ 1WGSA 4PJOA 2JTFA 2YUPA 1P92A 2JZ2A 2EAYA 4XQ3A 2AT1B 4M7DG 1VQ7A 3QJYA 4C8QC 1UJYA 4O5VA 3E19A 2AKLA 2QGFB 3A8GB 4HCZA 3OSSC 4ZN1A 1CKBA 4EMKB 1QKWA 3NTKA 1G5VA 6AT1B 1RI9A 3M57A 1ZUUA 2RQWA 3VS1A 1OX8A 1QP3A 1YJNQ 1BIAA 3CPWA 1QKXA 3JCMQ 4E7IA 3PFSA 1VIFA 1RADB 1VQ6Q 1BU1A 4MMLA 2KT1A 1JJ2S 2ZPHB 5LJ3h 2K5IA 2L8DA 1QVFA 3N5BB 1XOVA 3VJPA 2DD5A 5IN1A 4OB2B 3MP1A 2BZ8A 3TVTA 2DXCA 1VQ7T 3QWYA 1YITA 3BFMA 4BDZA 1PSFA 1BKBA 5J3BA 4C92C 4OF1A 4BI8B 3M9QA 2MYSA 4F7UE 3SWNB 3A8LB 2A37A 4PJOD 2Y4XA 2D9TA 2C0OA 2HNIA 1E7OA 1S72Q 1KQSP 2SEMA 1MMDA 2E64A 4LDYA 4VUBA 3QYGB 1GCQA 2XDDA 4MDWA 2MOXA 4J9DA 2MK5A 2LQ8A 3E9FA 3OYNA 5GAMj 2DLPA 2EGCA 2EQKA 5GMKm 4XU2A 5LJ5d 3OW2S 4A4HA 1Q82R 4CC4B 4Z8AA 1VQPA 1BBZA 2KI7A 1VQMQ 2E5QA 3VRYA 1OULA 1FXXA 2KVQG 1G3SA 4F7UF 4QVCA 3EG2A 5GAMf 4PNOA 1U3OA 2LNVA 3OA6A 2PU9B 3RERA 2LQWA 1Y57A 3LX7A 2EYYA 2HL3A 1WLPB 3EGDA 4IIOA 5GJVB 5A0GA 4QQGA 3EG9B 3M0SA 5ECAA 1KHCA 3KUFA 3SHWA 2DX1A 1I07A 1N8RU 5GMKh 1ZBXA 3JCMb 2J06A 3CCVA 1YIJA 4M4ZA 3CCQA 4M75A 2FPDA 4IIMA 2YSQA 4F16A 4M78E 3CCST 2NUZA 1D1BA 2OAUA 1VQ5Q 2V1QA 3LYIA 4BB7A 4II1A 5FRMA 2YXYA 1KC8U 1M1GA 1K0XA 2A08A 4ELYC 1VQ4T 1BCOA 1U06A 3I35A 1WIEA 2ROTA 3RBBB 3QYHB 1WXBA 5CR2A 1D3BA 3A1PA 4X1VA 1OZ3A 3RR6A 2DERA 3CCVT 3CCQT 5FW9A 1AHJB 3VRZA 3PMTA 4XTUA 4M78F 1HXDA 3PIOA 2XHCA 1ZSGA 1HK9A 1M4ZA 2FG0A 1KD1U 2KROA 1FMWA 2EFIA 3BDUA 4ZGDB 4E2FB 4C8QA 1TUDA 2HQEA 4L5GA 4JS5A 1AWOA 2DL7A 4OMFB 5CIUA 4JRIA 3GLXA 4M75D 3V7SA 1B34B 1M2VA 1X2KA 2K6DA 2RM4A 1LCKA 1JJ2P 1RAFB 2XKOC 2EQJA 1XQHA 2DMOA 1W4SA 3D7SB 4XU3A 2I2LA 4XTVA 2KBTA 2L3QA 2GNCA 1WXTA 3OBWA 1AD5A 4BI3A 5I2SA 1EZZB 1NYGA 2B8AA 1Q81U 1VYUA 3PNWC 1KHIA 2JS0A 5IT9E 3GBQA 2QI2A 2K57A 1PM3A 5DY9A 1U1TA 2HSPA 1IRXA 4PFPA 1N8RR 4MDXA 5GAMg 4CC7A 2RO0A 2FB7A 4PJOF 1BCMA 5FU7C 1WFWA 3X26B 1TG0A 4C0DB 1TH7A 1MHNA 5GAN6 2DL5A 4N4IA 4R0KA 1I1JA 2EWNA 3TCJA 5HK0A 3INZA 3ZFJA 1OZ2A 3IQLA 5GANj 1KC8R 2P84A 4BI4A 2RK2A 2XIDA 4C8QD 2HBPA 2ZZDA 2KRMA 3J81E 5D6WA 3OW2P 1VYVA 4E7ZA 2OTLA 2NLUA 4BE0A 2FZCB 3O8VA 1MMAA 3QZ9B 4ZTJA 3RNJA 2JTMA 2DA9A 3NMZC 1QVFP 2K5LA 1QW1A 1WJSA 1OU8A 5IHNA 2YRDA 2WSEE 2CGHA 1YHQT 3J80E 1FYNA 3RMSA 2RMOA 2VVKA 1E6GA 1JU5C 2V8IA 2F2XA 2CP5A 4M7DA 4M7AB 5FROA 1VYTA 2EPDA 1T3LA 2LZ6B 2DL3A 2KY9A 4FW2A 2K3YA 5CK9A 2EVRA 5KYXA 3H0HA 4AFZC 1O9SA 1KG1A 3X28B 1VA7A 4J7FA 1IGUA 1X43A 2L89A 1HYOA 4FYVB 3HP9A 2PUOB 4FYWB 3CMAA 4OB0B 1GRIA 3QZ5B 3VS3A 1M27C 4OP0A 3HPWA 1ZLMA 3JCMW 3CCSQ 3HFNA 1JO8A 1ZSZC 1KJWA 1UGPB 3M0UA 3NHNA 2K79A 3V7RA 4F14A 1N5ZA 2O9VA 4DBHA 3I56Q 3L2VA 4LUEA 5IAYA 2DTOA 2BUDA 2IPOB 1VQOA 2JMAA 3QDRB 2MAMA 4FYYB 2K7AA 2QTVA 3VS7A 4CRIA 2FYKA 4WCIA 4FM4B 4M7DD 2PVDB 3TREA 4B9WA 2QQRA 2H3EB 3V8KA 1UUEA 2CKKA 2CP6A 4J9BA
chains in the Genus database with same CATH topology
1W1FA 3UF4A 2DF6A 1RLPC 2KEAA 2GBQA 1WI7A 2PZ1A 3O5ZA 4AFQC 2J6FA 1UECA 1X27A 2JTEA 2YUQA 3I5SA 3TSWA 3ULRB 5EC7A 1RLQC 1GFDA 2CH4A 1SPKA 1T0HA 2D8HA 1OPKA 4ZNXA 2CT3A 2X3XD 1NYFA 2ABLA 1AWJA 1QCFA 2FEIA 2VWFA 2BZYA 1YP5A 2J7IA 4HXJA 5I11A 4AG2C 4DEYA 1AWWA 2F2VA 2EGAA 2LQNA 2PTKA 2LJ1A 2PNIA 1ABQA 2ENMA 2DILA 4D8DA 2KGTA 1K4US 1UE9A 1NLOC 4LUDA 3PVQA 1G2BA 1NEBA 3VS4A 3NGPA 3SEMA 2C0IA 2OJ2A 1A0NB 2JW4A 3ZL7C 4HVUA 1MV3A 2YT6A 1X69A 2VKNA 2LMJA 2LP5A 4ESRA 4Y92A 3EHQA 4RTVA 4CC3A 1QWFA 1NEGA 1X6BA 2O88A 1M3AA 2JM9A 2YUNA 2KRNA 4OMQA 2CUDA 2KT8A 3NPFA 2DVJA 2YUOA 2YUPA 2ECZA 2KYBA 4FSSA 1GBQA 2X3WD 1JXOA 2JMCA 2O31A 1AWXA 1UJYA 3A98A 1JEGA 2AKLA 2C0TA 4J9EA 2P4RA 1CKBA 1QKWA 2NWMA 1RI9A 2JXBA 2RN8A 1ZUUA 2RQWA 3FJ5A 2DE0X 4RUGA 3VS1A 3EG3A 1QKXA 1GCQC 4JJDA 1AVZC 4RTZA 1KIKA 2DNUA 1BU1A 4EIKA 2CUBA 2KT1A 4JPBW 1SHFA 1W6XA 1SSHA 1HD3A 2J05A 1XOVA 2DL4A 2RPNA 1HJDA 1M3CA 1H92A 2BZ8A 3TVTA 1UGVA 2RNAA 5IXFA 1GFCA 1ZBJA 2G6FX 3TSZA 2DRKA 3QWYA 1PRLC 1J3TA 2HBWA 2J6KA 1YWOA 3H41A 4AFUC 2L3SA 2EKHA 3U23A 2A37A 1SRLA 2FPEA 1OOTA 2C0OA 2KRSA 1E7OA 1JQQA 2DRMA 2AK5A 2SEMA 4Z89A 2V1RA 1SHGA 2BTTA 3M0TA 3VS2A 4D8KA 5HCKA 2KNBB 1GCQA 2DBMA 1NLPC 1T0JA 2MOXA 4J9DA 1GBRA 2B86A 3M0PA 2CDTA 2DLPA 2EGCA 3EGUA 5FWCA 1I0CA 2CT4A 2KE9A 4OMPA 3EG1A 2KXCA 4CC4B 4Z8AA 1BBZA 4RTWA 4J9CA 1EFNA 3VRYA 4HVWA 4LNPA 1HSQA 3EG2A 2HEQA 1MV0B 4E6RA 1B07A 1UJ0A 2EYWA 2KXDA 1U3OA 4JJCA 1GL5A 1AEYA 1OPLA 2LQWA 1Y57A 2EYYA 2FPFA 1WLPB 3C0CA 4IIOA 2O2OA 1PNJA 5GJVB 1ABOA 4J9IA 2D1XA 2JS2A 1PWTA 4OMLA 3M0SA 5ECAA 1W70A 2OAWA 2H8HA 3SHWA 5IXBA 3I5RA 2DX1A 1I07A 2EGEA 3M0QA 2J06A 1SEMA 2J6OA 1ZUYA 4M4ZA 2FPDA 2GGRA 3UA7A 4IIMA 4J9FA 2CSQA 2YSQA 2M0YA 1JXMA 4F16A 2BZXA 3H0IA 2FRWA 4OMMA 1WX6A 2F2WA 2NUZA 2LJ0A 2AZVA 2ESWA 2L0AA 1TUCA 1Y0MA 3EG0A 2V1QA 4DEXA 3PVLA 1MUZA 2RQRA 4GLMA 1K0XA 2A08A 2AKKA 1U06A 4OMNA 3I35A 1WIEA 2ROTA 1YN8A 4RTTA 1ZX6A 3RBBB 1YWPA 3M0RA 2M51A 1WXBA 4X1VA 2RQTA 2O9SA 5GJWB 1OV3A 3VS6A 1M3BA 5FW9A 3EHRA 3VRZA 5L23A 2OI3A 1Z9ZA 1ZSGA 2FG0A 1IO6A 1V1CA 2KROA 4AG1C 1QWEA 1UTIA 1GCPA 4Z88A 1TUDA 1AWOA 2CH4W 2DJQA 2DL7A 3I9QA 3CQTA 2K2MA 3UA6A 1X2KA 1UDLA 2K6DA 1LCKA 1PRMC 2QDLA 1H3HA 4OMOA 4ORZA 4JZ4A 1X2QA 2DM1A 2DMOA 1PKTA 2KBTA 2L3QA 1CSKA 2FO0A 2GNCA 4HCKA 1RUWA 2FRYA 5I22A 1WXTA 1KFZA 1BK2A 2A28A 1AD5A 2IIMA 1NM7A 4HVVA 1NYGA 2I0NA 1UFFA 1CKAA 2LJ3A 1VYUA 5IH2A 2JS0A 2EW3A 3GBQA 2CSIA 3R6NA 1UG1A 1UHCA 1SRMA 2MIOA 2RQUA 2HSPA 3REBB 4CC7A 4K11A 1PHTA 1WFWA 3JV3A 1TG0A 4F17A 1Z9QA 2RQVA 5FWBA 1K9AA 1AZGB 2ROLA 1WDXA 2MCNA 2DL5A 1G83A 4R0KA 1I1JA 2LNHB 2L3PA 2XMFA 3IQLA 4QT7A 2EQIA 1K1ZA 1AOJA 2W10A 2KYMA 1M8MA 4J9HA 2K9GA 4CC2A 2D0NA 2KRMA 1VYVA 2JM8A 2DBKA 4J9GA 2CREA 4GBQA 2L2PA 2LX7A 4LN2A 3RNJA 1YNZA 2DA9A 4RTYA 1T3SA 3NMZC 1KSWA 1M30A 5IHNA 1FYNA 4RTXA 1X6GA 2RMOA 2GTOA 2VVKA 1E6GA 2SRCA 1JU5C 4A63B 2F2XA 4JZ3A 1QLYA 1AZEA 3LH5A 4RTUA 1VYTA 1UHFA 2EPDA 1T3LA 2LZ6B 2DL3A 3PE0A 2EVRA 1FMKA 2GTJA 1WXUA 1PKSA 3H0HA 4AFZC 2JT4A 2EBPA 2HDAA 3H0FA 2W0ZA 1VA7A 1WA7A 1X43A 1K76A 1K0SA 1GRIA 1S1NA 2EYZA 3VS3A 2D8JA 1M27C 2AZSA 1OEBA 2RF0A 1NG2A 1ZLMA 2A36A 3VS0A 1ZUKA 2HCKA 4KRTA 1BB9A 1JO8A 2LCSA 1KJWA 3M0UA 2GQIA 3NHNA 2K79A 1U5SA 3UATA 4F14A 1N5ZA 2O9VA 2DYBA 2K3BA 3QWXX 2KR3A 5IHKA 4JJBA 4LUEA 2ED1A 2JMAA 3THKA 3VS5A 2ED0A 3REAB 2K7AA 3VS7A 3KFVA 1B3QA 1YCSB 2EYXA 4AFSC 2DL8A 4WCIA 1E6HA 5IHIA 1WYXA 4LE9A 1ARKA 2YDLA 1UUEA 2E5KA 1H8KA 4J9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1F A;  3UF4 A;  2DF6 A;  1RLP C;  2KEA A;  2GBQ A;  1WI7 A;  2PZ1 A;  3O5Z A;  4AFQ C;  2J6F A;  1UEC A;  1X27 A;  2JTE A;  2YUQ A;  3I5S A;  3TSW A;  3ULR B;  5EC7 A;  1RLQ C;  1GFD A;  2CH4 A;  1SPK A;  1T0H A;  2D8H A;  1OPK A;  4ZNX A;  2CT3 A;  2X3X D;  1NYF A;  2ABL A;  1AWJ A;  1QCF A;  2FEI A;  2VWF A;  2BZY A;  1YP5 A;  2J7I A;  4HXJ A;  5I11 A;  4AG2 C;  4DEY A;  1AWW A;  2F2V A;  2EGA A;  2LQN A;  2PTK A;  2LJ1 A;  2PNI A;  1ABQ A;  2ENM A;  2DIL A;  4D8D A;  2KGT A;  1K4U S;  1UE9 A;  1NLO C;  4LUD A;  3PVQ A;  1G2B A;  1NEB A;  3VS4 A;  3NGP A;  3SEM A;  2C0I A;  2OJ2 A;  1A0N B;  2JW4 A;  3ZL7 C;  4HVU A;  1MV3 A;  2YT6 A;  1X69 A;  2VKN A;  2LMJ A;  2LP5 A;  4ESR A;  4Y92 A;  3EHQ A;  4RTV A;  4CC3 A;  1QWF A;  1NEG A;  1X6B A;  2O88 A;  1M3A A;  2JM9 A;  2YUN A;  2KRN A;  4OMQ A;  2CUD A;  2KT8 A;  3NPF A;  2DVJ A;  2YUO A;  2YUP A;  2ECZ A;  2KYB A;  4FSS A;  1GBQ A;  2X3W D;  1JXO A;  2JMC A;  2O31 A;  1AWX A;  1UJY A;  3A98 A;  1JEG A;  2AKL A;  2C0T A;  4J9E A;  2P4R A;  1CKB A;  1QKW A;  2NWM A;  1RI9 A;  2JXB A;  2RN8 A;  1ZUU A;  2RQW A;  3FJ5 A;  2DE0 X;  4RUG A;  3VS1 A;  3EG3 A;  1QKX A;  1GCQ C;  4JJD A;  1AVZ C;  4RTZ A;  1KIK A;  2DNU A;  1BU1 A;  4EIK A;  2CUB A;  2KT1 A;  4JPB W;  1SHF A;  1W6X A;  1SSH A;  1HD3 A;  2J05 A;  1XOV A;  2DL4 A;  2RPN A;  1HJD A;  1M3C A;  1H92 A;  2BZ8 A;  3TVT A;  1UGV A;  2RNA A;  5IXF A;  1GFC A;  1ZBJ A;  2G6F X;  3TSZ A;  2DRK A;  3QWY A;  1PRL C;  1J3T A;  2HBW A;  2J6K A;  1YWO A;  3H41 A;  4AFU C;  2L3S A;  2EKH A;  3U23 A;  2A37 A;  1SRL A;  2FPE A;  1OOT A;  2C0O A;  2KRS A;  1E7O A;  1JQQ A;  2DRM A;  2AK5 A;  2SEM A;  4Z89 A;  2V1R A;  1SHG A;  2BTT A;  3M0T A;  3VS2 A;  4D8K A;  5HCK A;  2KNB B;  1GCQ A;  2DBM A;  1NLP C;  1T0J A;  2MOX A;  4J9D A;  1GBR A;  2B86 A;  3M0P A;  2CDT A;  2DLP A;  2EGC A;  3EGU A;  5FWC A;  1I0C A;  2CT4 A;  2KE9 A;  4OMP A;  3EG1 A;  2KXC A;  4CC4 B;  4Z8A A;  1BBZ A;  4RTW A;  4J9C A;  1EFN A;  3VRY A;  4HVW A;  4LNP A;  1HSQ A;  3EG2 A;  2HEQ A;  1MV0 B;  4E6R A;  1B07 A;  1UJ0 A;  2EYW A;  2KXD A;  1U3O A;  4JJC A;  1GL5 A;  1AEY A;  1OPL A;  2LQW A;  1Y57 A;  2EYY A;  2FPF A;  1WLP B;  3C0C A;  4IIO A;  2O2O A;  1PNJ A;  5GJV B;  1ABO A;  4J9I A;  2D1X A;  2JS2 A;  1PWT A;  4OML A;  3M0S A;  5ECA A;  1W70 A;  2OAW A;  2H8H A;  3SHW A;  5IXB A;  3I5R A;  2DX1 A;  1I07 A;  2EGE A;  3M0Q A;  2J06 A;  1SEM A;  2J6O A;  1ZUY A;  4M4Z A;  2FPD A;  2GGR A;  3UA7 A;  4IIM A;  4J9F A;  2CSQ A;  2YSQ A;  2M0Y A;  1JXM A;  4F16 A;  2BZX A;  3H0I A;  2FRW A;  4OMM A;  1WX6 A;  2F2W A;  2NUZ A;  2LJ0 A;  2AZV A;  2ESW A;  2L0A A;  1TUC A;  1Y0M A;  3EG0 A;  2V1Q A;  4DEX A;  3PVL A;  1MUZ A;  2RQR A;  4GLM A;  1K0X A;  2A08 A;  2AKK A;  1U06 A;  4OMN A;  3I35 A;  1WIE A;  2ROT A;  1YN8 A;  4RTT A;  1ZX6 A;  3RBB B;  1YWP A;  3M0R A;  2M51 A;  1WXB A;  4X1V A;  2RQT A;  2O9S A;  5GJW B;  1OV3 A;  3VS6 A;  1M3B A;  5FW9 A;  3EHR A;  3VRZ A;  5L23 A;  2OI3 A;  1Z9Z A;  1ZSG A;  2FG0 A;  1IO6 A;  1V1C A;  2KRO A;  4AG1 C;  1QWE A;  1UTI A;  1GCP A;  4Z88 A;  1TUD A;  1AWO A;  2CH4 W;  2DJQ A;  2DL7 A;  3I9Q A;  3CQT A;  2K2M A;  3UA6 A;  1X2K A;  1UDL A;  2K6D A;  1LCK A;  1PRM C;  2QDL A;  1H3H A;  4OMO A;  4ORZ A;  4JZ4 A;  1X2Q A;  2DM1 A;  2DMO A;  1PKT A;  2KBT A;  2L3Q A;  1CSK A;  2FO0 A;  2GNC A;  4HCK A;  1RUW A;  2FRY A;  5I22 A;  1WXT A;  1KFZ A;  1BK2 A;  2A28 A;  1AD5 A;  2IIM A;  1NM7 A;  4HVV A;  1NYG A;  2I0N A;  1UFF A;  1CKA A;  2LJ3 A;  1VYU A;  5IH2 A;  2JS0 A;  2EW3 A;  3GBQ A;  2CSI A;  3R6N A;  1UG1 A;  1UHC A;  1SRM A;  2MIO A;  2RQU A;  2HSP A;  3REB B;  4CC7 A;  4K11 A;  1PHT A;  1WFW A;  3JV3 A;  1TG0 A;  4F17 A;  1Z9Q A;  2RQV A;  5FWB A;  1K9A A;  1AZG B;  2ROL A;  1WDX A;  2MCN A;  2DL5 A;  1G83 A;  4R0K A;  1I1J A;  2LNH B;  2L3P A;  2XMF A;  3IQL A;  4QT7 A;  2EQI A;  1K1Z A;  1AOJ A;  2W10 A;  2KYM A;  1M8M A;  4J9H A;  2K9G A;  4CC2 A;  2D0N A;  2KRM A;  1VYV A;  2JM8 A;  2DBK A;  4J9G A;  2CRE A;  4GBQ A;  2L2P A;  2LX7 A;  4LN2 A;  3RNJ A;  1YNZ A;  2DA9 A;  4RTY A;  1T3S A;  3NMZ C;  1KSW A;  1M30 A;  5IHN A;  1FYN A;  4RTX A;  1X6G A;  2RMO A;  2GTO A;  2VVK A;  1E6G A;  2SRC A;  1JU5 C;  4A63 B;  2F2X A;  4JZ3 A;  1QLY A;  1AZE A;  3LH5 A;  4RTU A;  1VYT A;  1UHF A;  2EPD A;  1T3L A;  2LZ6 B;  2DL3 A;  3PE0 A;  2EVR A;  1FMK A;  2GTJ A;  1WXU A;  1PKS A;  3H0H A;  4AFZ C;  2JT4 A;  2EBP A;  2HDA A;  3H0F A;  2W0Z A;  1VA7 A;  1WA7 A;  1X43 A;  1K76 A;  1K0S A;  1GRI A;  1S1N A;  2EYZ A;  3VS3 A;  2D8J A;  1M27 C;  2AZS A;  1OEB A;  2RF0 A;  1NG2 A;  1ZLM A;  2A36 A;  3VS0 A;  1ZUK A;  2HCK A;  4KRT A;  1BB9 A;  1JO8 A;  2LCS A;  1KJW A;  3M0U A;  2GQI A;  3NHN A;  2K79 A;  1U5S A;  3UAT A;  4F14 A;  1N5Z A;  2O9V A;  2DYB A;  2K3B A;  3QWX X;  2KR3 A;  5IHK A;  4JJB A;  4LUE A;  2ED1 A;  2JMA A;  3THK A;  3VS5 A;  2ED0 A;  3REA B;  2K7A A;  3VS7 A;  3KFV A;  1B3Q A;  1YCS B;  2EYX A;  4AFS C;  2DL8 A;  4WCI A;  1E6H A;  5IHI A;  1WYX A;  4LE9 A;  1ARK A;  2YDL A;  1UUE A;  2E5K A;  1H8K A;  4J9B A; 
#chains in the Genus database with same CATH topology
 1SSF A;  1W1F A;  3CEY A;  1Y7X A;  2MPX C;  2QAS A;  2DIQ A;  3O5Z A;  3EFO A;  4EPC A;  2J6F A;  1EIF A;  4PJO C;  1JBM A;  1Q7Y U;  4PFO A;  1BIB A;  4M75 F;  1VQO T;  4RCC A;  4FSX A;  3QUI A;  5LJ3 j;  2H3J A;  1G3T A;  2ABL A;  1QCF A;  1RAE B;  2BZY A;  3MJX A;  1YP5 A;  4ATO A;  2NUT B;  4XTZ A;  4HCC A;  8ATC B;  1KQS A;  2LQN A;  5CVI A;  1ABQ A;  2DIL A;  2M0O A;  1UE9 A;  5LJ3 f;  3KXT A;  1A0N B;  2NYS A;  2QQA A;  1YJN T;  4JUV A;  4IKF A;  1C1A A;  1N9S A;  3L2R A;  3OYM A;  4JS4 A;  4E7L A;  4E7S A;  1S72 A;  1OX9 A;  2LMJ A;  5CQX A;  4XK8 E;  3CCM T;  1VQ6 T;  1QVG S;  2LCC A;  4RTV A;  1VQN Q;  4CC3 A;  1QWF A;  4M77 G;  3E2U A;  5CCA A;  1M3A A;  2YHT A;  4XAX B;  4R55 A;  4MZP A;  2JM9 A;  1Q82 C;  4OMQ A;  2KT8 A;  2CP3 A;  3NPF A;  4L6V 5;  4LDX A;  2ECZ A;  1TS9 A;  2KYB A;  4FSS A;  1GBQ A;  4C8Q F;  2O31 A;  2RHZ A;  1JEG A;  3RUX A;  1VQM A;  4C92 E;  2DEU A;  2E1H A;  3L1A A;  2MWP A;  1R0C B;  4WTO B;  4IUT A;  1WZO A;  2NWM A;  3SFM A;  4BAC A;  2JXB A;  1I4K 1;  2K4Y A;  2RH2 A;  1GCQ C;  4JJD A;  3JCM X;  3CCU T;  2QGG A;  2RHU A;  4DBQ A;  4QVD A;  1YHQ Q;  4EIK A;  1LVK A;  4JLI A;  4JPB W;  1VQ9 A;  3LWI A;  1SSH A;  2J05 A;  2FHD A;  1HJD A;  1M3C A;  1K9M U;  4F7U B;  2ZPB B;  1ZBJ A;  3TSZ A;  1Q7Y R;  4J7I A;  4FU6 A;  2J6K A;  3HRS A;  4C92 F;  1W2B S;  1VQM T;  1YWO A;  2COY A;  5GMK j;  4AFU C;  4PFZ A;  4RG2 A;  2L3S A;  2QYZ A;  1YCY A;  3JB9 G;  3RKY A;  1JQQ A;  2P0P A;  2AK5 A;  2IG0 A;  2EQM A;  4Z89 A;  2BTT A;  3VS2 A;  3MEV A;  2KNB B;  5D6Y A;  2GQV A;  4HCB A;  2DBM A;  4N4H A;  3G4S T;  2EJG A;  1T0J A;  4MZM A;  1GBR A;  2B86 A;  1ZSZ A;  2F5T X;  3M0P A;  5KCO A;  3EGU A;  5FWC A;  1I0C A;  4RTW A;  2HKQ B;  4J9C A;  9ATC B;  1EFN A;  3H8Z A;  3FEO A;  4M7D F;  3SDZ A;  4A53 A;  1HSQ A;  3QG1 A;  5CAI A;  1JJ2 A;  1B07 A;  5J26 A;  1VQ5 T;  2CYZ B;  4EMG A;  1GL5 A;  3P8B B;  3V7C A;  3V8L A;  1XTD A;  2O4X B;  2FPF A;  3M59 A;  2PQW A;  2RJD A;  3C0C A;  3AT1 B;  2LDM A;  4J9I A;  2D1X A;  2JS2 A;  5EG2 A;  3T9N A;  1BI2 A;  4M78 B;  4UC4 A;  2H8H A;  5GAM e;  4EMK A;  2QDY B;  3I5R A;  4IUP A;  4PLI A;  1NJI U;  4KUD K;  2NUP A;  2EGE A;  1X01 A;  3M0Q A;  1YJ9 T;  1G3Y A;  1PSE A;  1SEM A;  2J6O A;  2XD0 A;  1ZUY A;  4X34 A;  1N8R C;  4J9F A;  1K9M R;  2M0Y A;  2Y4Y A;  3H0I A;  4N0A A;  2AZV A;  2ESW A;  3L2Q A;  1Y0M A;  3CCL Q;  2RI5 A;  1MUZ A;  1M1K U;  2RQR A;  2DFU A;  4AT1 B;  3EFR A;  1M90 R;  1V76 A;  5KE3 A;  3OW2 A;  5FU6 B;  1QVG P;  1KC8 C;  3CCM Q;  4ME7 A;  4OMN A;  1Q86 U;  1YN8 A;  3DKM A;  5LJ5 h;  3SWN A;  3JCM f;  3JCM P;  1D09 B;  1UGS B;  5GAN 3;  3SB2 A;  1SF9 A;  5GJW B;  4PJO B;  4A54 A;  3EHR A;  4KUL A;  3RDV A;  1Z9Z A;  3OYJ A;  1IO6 A;  1D1C A;  3OYL A;  2DXU A;  4PKC C;  2DJQ A;  1KD1 C;  3I9Q A;  3E1S A;  2M16 A;  3UA6 A;  2X35 A;  1UDL A;  3CCU Q;  4MZT A;  2EQU A;  2QDL A;  3QKJ A;  4JZ4 A;  4ORZ A;  2DXT A;  5LL6 S;  3TU4 K;  2MI6 A;  3ZBD A;  1CSK A;  2PUK B;  2FRY A;  2A28 A;  2IIM A;  1PD1 A;  4V2S A;  2XI9 A;  1UFF A;  1N27 A;  2MWO A;  2LJ3 A;  2RK1 A;  1NPP A;  1W2B P;  5KYU A;  2CSI A;  2QEX T;  1RAA B;  1UHC A;  4ZTF A;  2MIO A;  1Q81 C;  1NJI R;  2RD1 A;  4M7D C;  1SKU B;  3EG9 A;  3CC7 Q;  3CCS A;  2RB6 A;  4OB3 B;  4Y91 A;  4ANJ A;  4F17 A;  1Z9Q A;  4LD9 K;  5FWB A;  1K9A A;  2ROL A;  3FDR A;  1WDX A;  1TUG B;  3L2U A;  4DBF A;  1VQL Q;  2XMF A;  1M1K R;  3CME Q;  1K1Z A;  1VQ4 A;  1G8X A;  3G4S Q;  4BUG A;  3VYG A;  2DBK A;  4J9G A;  1WHG A;  1FX7 A;  1Q86 R;  2LX7 A;  3OYE A;  1T3S A;  5L8R E;  4M77 A;  2O01 E;  2QG9 B;  1GXI E;  4D6W A;  2KDS A;  1X6G A;  3P8H A;  4IUQ A;  3CXC S;  2V8K A;  4A63 B;  4YTL A;  3MP8 A;  1O75 A;  5KYW B;  1QLY A;  4PJL A;  1AZE A;  2E65 A;  3LH5 A;  1TOV A;  3I56 T;  2YLB A;  4FIB A;  1G3W A;  3PE0 A;  2GTJ A;  2DAQ A;  2VXE A;  2X4W A;  1PKS A;  2EBP A;  1I81 A;  3JCM g;  5CKD A;  5AT1 B;  3A5Z B;  3CD6 Q;  3DLM A;  2LX9 A;  1YJ9 Q;  3OBY A;  1M9S A;  2D8J A;  1B34 A;  4C5E A;  3PGG A;  5AYF A;  4N4G A;  2RF0 A;  4M75 B;  2A36 A;  5GAO q;  1ZUK A;  2DET A;  2GQI A;  1I8F A;  1NPR A;  2DYB A;  3QWX X;  2KAF A;  4A4E A;  4LDU A;  4PJO E;  1VQN A;  3QPH A;  1RAB B;  3C95 A;  4NL2 A;  1JB0 E;  4C0G A;  4M77 D;  3M4G A;  3MO8 A;  3MEA A;  3NFC A;  2ED0 A;  1IXD A;  2P4T A;  2JN0 A;  5HK3 A;  1YCS B;  2E41 A;  2E12 A;  2QAZ A;  1E6H A;  1H64 1;  4Q5W A;  5IHI A;  2G3R A;  1D3B B;  2YDL A;  1D1A A;  3QXE B;  3X20 B;  3OYG A;  2VAS A;  2YRV A;  2E5K A;  4PK4 A;  3UF4 A;  2DF6 A;  4BY6 C;  3HTR A;  1WI7 A;  2FZG B;  2PZ1 A;  4OGC A;  4AFQ C;  2JTE A;  3I5S A;  1YHQ A;  1VQN T;  3LGL A;  5EC7 A;  1Y96 B;  4J6Y A;  1RLQ C;  2BIV A;  3A8M B;  4C8Q B;  2D8H A;  1XNI A;  2OTJ T;  4ZNX A;  2D6F A;  1Q7Y C;  4DA4 A;  1VQK T;  2X3X D;  4OGE A;  4JJN K;  2FEI A;  2VWF A;  4HXJ A;  1K73 U;  2R58 A;  2BE7 D;  2DTI A;  2C06 A;  2LJ1 A;  1VQ8 Q;  2CP7 A;  5GAN 5;  2WAC A;  4FYX B;  4M7A A;  4C5I A;  1NLO C;  4ELZ C;  4LUD A;  2GFU A;  3GNG A;  5GAN f;  4JDS A;  1PCX A;  3SEM A;  2QEX Q;  4HVU A;  1Y07 A;  3JB9 D;  2WSC E;  2CZ6 B;  4C92 B;  3UDC A;  2R5M A;  1BYM A;  2YUN A;  3OYD A;  5LJ3 e;  2BE9 B;  4X9C A;  2DVJ A;  4BD3 A;  2YUO A;  4KH0 B;  3G71 T;  1MGQ A;  2RI2 A;  3M4Y A;  4GLK A;  2QXF A;  1TWB A;  2JMC A;  3A98 A;  1AWX A;  3CCR Q;  4RG8 A;  1KQ2 A;  2C0T A;  3JB9 I;  5CKF A;  2DJZ A;  3P8D A;  1ZA2 B;  3FJ5 A;  2QA4 T;  2DE0 X;  2M02 A;  5GAN 4;  4C0F A;  3OY9 A;  2A0F B;  4RTZ A;  1KIK A;  2DNU A;  3CXC P;  2HQX A;  5GAM h;  1PG5 B;  2CUB A;  1W6X A;  4M7A D;  4R56 A;  1HD3 A;  2LC4 A;  3DB3 A;  2DL4 A;  2RPN A;  4M7D B;  4FCY A;  1UB4 A;  1H92 A;  2Z0W A;  1VQP Q;  2RHI A;  2RNA A;  4M75 E;  1GFC A;  1LPL A;  2DRK A;  1PRL C;  1K9M C;  2CS7 A;  2HBW A;  3OYI A;  2DEQ A;  5KYX B;  3RKW A;  3H41 A;  1BI0 A;  4P5N A;  1BI1 A;  1QVG A;  4B9X A;  3U23 A;  1SRL A;  2FPE A;  4LDV A;  3CCL A;  1OOT A;  4EDU A;  1K73 R;  2AHJ B;  3BDL A;  3M58 A;  2KRS A;  3GPL A;  1LOJ A;  1YJN A;  3M0T A;  3QDF A;  5HCK A;  2X4X A;  4EMK C;  4A4K A;  2RJF A;  2NUT A;  4EMH A;  3JAM E;  3CCM A;  1VQ6 A;  3S3M A;  5CKB A;  5GAM d;  4RCB A;  4M77 F;  2E6Z A;  5KYY B;  1IHW A;  2CT4 A;  2KE9 A;  4OMP A;  4C5H A;  4X9D A;  5LJ5 j;  2KXC A;  5C0M A;  4N0A C;  3Q1J A;  3MET A;  4L59 A;  3G7Z A;  5I21 A;  4HVW A;  4LNP A;  2XDB A;  2HZY A;  4PJM A;  4C8Q E;  3R6O A;  1MV0 B;  4E6R A;  1UJ0 A;  2EYW A;  1M5Q 1;  4JRK A;  3CCL T;  2KXD A;  5GAN g;  4JJC A;  1AEY A;  5LJ5 f;  4B6M A;  5A0L A;  5I2M A;  1D0Z A;  2K3X A;  2FZK B;  5D6X A;  2CZ1 B;  4LD6 A;  4QQ6 A;  4J6W A;  4O6J A;  3SWN C;  3CCU A;  4J8O A;  2KQW A;  1PWT A;  1W2B A;  4OML A;  2X51 A;  1NE8 A;  2OAW A;  3QHS A;  2OTJ Q;  3QSU A;  4LXC A;  2VXF A;  1WHH A;  4DBR A;  3OYY A;  1VQK Q;  2ATC B;  1NJI C;  3UA7 A;  2MF2 A;  3FRN A;  2HSE B;  2D0Q B;  2FRW A;  4OMM A;  2L5Q A;  1WX6 A;  2F2W A;  4E7H A;  4Y28 E;  2JJ9 A;  2L0A A;  3C94 A;  2RHX A;  3C12 A;  1TUC A;  3RMQ A;  3JRZ A;  3EG0 A;  4DEX A;  1WJQ A;  3CC7 A;  3FB9 A;  3VKI A;  3LH0 A;  4F7U A;  4GLM A;  1EX4 A;  2QTX A;  2DK3 A;  3EH1 A;  1M1K C;  3OYC A;  3AHU A;  1PD0 A;  3JB9 F;  1WQ7 A;  2GCX A;  1R0B G;  5A0D A;  2ZPI B;  3OMG A;  3CME A;  3RKX A;  3BW1 A;  1ZX6 A;  1YWP A;  3M0R A;  3G4S A;  1Q86 C;  1U1S A;  3CCE Q;  2O9S A;  1OV3 A;  2ZGW A;  5FU7 B;  3VS6 A;  3G71 Q;  1M3B A;  1H3Z A;  3OYH A;  5GMK l;  4RKU E;  4QKU A;  4XTX A;  5L23 A;  2FL7 A;  5C6S A;  2OI3 A;  3GP8 A;  1IB8 A;  1V1C A;  2DKG A;  5KYN A;  5GAO n;  3HL8 A;  1M90 U;  4PJJ A;  4M7D E;  4AG1 C;  1QWE A;  3CC7 T;  1GCP A;  1RI0 A;  4Z88 A;  2CH4 W;  1VQ5 A;  3JCM e;  1IGQ A;  2QA4 Q;  3CQT A;  2K2M A;  3G6E T;  2M9U A;  3VUB A;  1JRI A;  2F1L A;  1PRM C;  3OB9 A;  1VQL T;  3CBP A;  3CME T;  1X2Q A;  2DM1 A;  2ZPF B;  1UGR B;  2PVO B;  2F69 A;  2FO0 A;  1R77 A;  1TU0 B;  4DOV A;  1ACM B;  1K8A U;  4HVV A;  4M77 C;  3SD4 A;  3CC4 T;  1X6O A;  3M53 A;  5IH2 A;  3CD6 A;  2EW3 A;  1YJ9 A;  1FMV A;  2GFA A;  5HY6 A;  3R6N A;  2RQU A;  8AT1 B;  4PJN A;  5CQY A;  3REB B;  2DPP B;  2XU8 A;  2QQB A;  4QVZ A;  1N6A A;  4M78 A;  1M2O A;  1TXQ A;  1PHT A;  3HKS A;  3OS0 A;  5LJ3 g;  3J7A F;  5LJ5 g;  2RQV A;  1RAH B;  3QII A;  3EAE A;  1AZG B;  1LNX A;  3HHT B;  3CC2 T;  2QQS A;  2XK0 A;  1G83 A;  2E6N A;  5M9O A;  2LNH B;  3ME9 A;  4M7A G;  4FL6 A;  4GY5 A;  2W10 A;  2KYM A;  3I55 T;  4J9H A;  2K9G A;  4CC2 A;  2D0N A;  3CMA Q;  1ZSZ B;  2L2P A;  5DM7 R;  3CD6 T;  5HKC A;  5KE2 A;  2RI3 A;  4KUI A;  5KCH A;  3CCJ T;  4RTY A;  3EGX B;  2WSF E;  1X75 C;  2GTO A;  4ZGJ B;  4JZ3 A;  5GAO r;  4CI0 C;  2E3H A;  2GF7 A;  3WVD B;  1WXU A;  4KT0 E;  4A4G A;  4C0D C;  2JT4 A;  4M78 D;  3UWN A;  2HDA A;  3H0F A;  2W0Z A;  2DO3 A;  2HL5 C;  1K76 A;  1M1F A;  1K0S A;  1VQ8 A;  2EYZ A;  2NUP B;  1IHV A;  3GNF B;  1NZ9 A;  4F04 B;  1ZHI A;  4IUR A;  3OYK A;  4BDY A;  1NG2 A;  1K8A R;  2X9H A;  2QEX A;  2LCS A;  4KGX B;  1U5S A;  4JLG A;  2K3B A;  2KR3 A;  5IHK A;  4BE2 A;  2ED1 A;  3OS2 A;  2VB6 A;  3THK A;  3VS5 A;  3MCA B;  3REA B;  2EYQ A;  3KFV A;  4NOY A;  4M7A C;  2HAX A;  2JNG A;  1B3Q A;  2EYX A;  4IUU A;  2LCL A;  2X4Y A;  1WYX A;  3CXC A;  3CCR A;  1ARK A;  1VQ8 T;  3MKD A;  2R57 A;  2LTO A;  2RHY A;  2HKN A;  4IUV A;  3H9N A;  1RLP C;  2KEA A;  3VV0 A;  3G1J A;  4J5Y A;  1QP2 A;  1D0X A;  1KQ1 A;  2YUQ A;  3LLR A;  3TSW A;  1YI2 Q;  3ULR B;  4Z02 A;  2YRC A;  3G6E Q;  2QK0 A;  5LJ3 d;  3CPW S;  3JB9 J;  3I56 A;  2CT3 A;  1YIT T;  1NYF A;  1AWJ A;  2EIF A;  1UEB A;  1QVF S;  2J7I A;  5I11 A;  4OVA A;  4AG2 C;  4DEY A;  3CCR T;  1KK7 A;  2ENM A;  3VYH B;  1NBE B;  4PLL A;  5KYW A;  3CC4 Q;  4PL6 A;  1K73 C;  1K4U S;  3PVQ A;  2DZC A;  1NEB A;  2K2V A;  2C0I A;  2OJ2 A;  2JW4 A;  3ZL7 C;  2E10 A;  1MV3 A;  3MP6 A;  5KYU B;  5DLO A;  1VQ9 Q;  4XTW A;  2Y90 A;  3GOX A;  1X69 A;  2VKN A;  3TEE A;  3L42 A;  1NEG A;  1X6B A;  2BKD N;  2O88 A;  1YJW Q;  3CC2 Q;  5GMK i;  1BI3 A;  2KRN A;  2KMT A;  2CUD A;  1WQW A;  3E9G A;  1VQP T;  1QMC A;  5GAN e;  4E7J A;  4AMC A;  4J83 A;  2HMA A;  4JRQ A;  3OYA A;  3OYF A;  4F7U G;  2X3W D;  1JXO A;  3EGD B;  3I55 Q;  2AIR B;  2IVW A;  3OYB A;  4J9E A;  2P4R A;  3GF5 A;  3UT1 A;  4DQ2 A;  2RN8 A;  4RUG A;  4E47 A;  3CCJ Q;  3LW5 E;  3EG3 A;  5CKE A;  1AVZ C;  3M56 A;  4M77 B;  3H6Z A;  1SHF A;  2VC8 A;  5GAO l;  4HKE A;  3DLL A;  2DZ9 A;  1RAI B;  1YIJ T;  1UGV A;  2OTJ A;  4LDW A;  5IXF A;  2G6F X;  1WNL A;  3OSV A;  1OU9 A;  4XTY A;  1VQK A;  1J3T A;  2CP0 A;  2DD4 A;  1RL2 A;  1MMN A;  2OX7 A;  4NS5 A;  1Y96 A;  1WJR A;  3VUZ A;  3JCM V;  2EKH A;  2ZPE B;  1C0M A;  2DRM A;  1RAC B;  4KGV B;  1D0Y A;  3NTI A;  2V1R A;  1SHG A;  4D8K A;  3L2Z A;  1MND A;  1YFN A;  1M8V A;  5CKH A;  3FC3 A;  1NLP C;  3A8O B;  1VIE A;  2EJF A;  1IRE B;  2CDT A;  1VQ7 Q;  1MNE A;  2LQK A;  2RA2 A;  2VYT A;  4M78 G;  4XU0 A;  1M2V B;  3EG1 A;  3CCE A;  3EH2 A;  5FLX E;  3G71 A;  3JCM h;  3OMC A;  4MMK A;  4BE1 A;  2HEQ A;  4C92 A;  3M54 A;  4DOW A;  3JCM J;  1IZ6 A;  1OPL A;  2CZ7 B;  5D7U A;  2CZ0 B;  2QA4 A;  2A7Y A;  2DXB A;  3QO3 A;  2V8J A;  1WHJ A;  2O2O A;  1PNJ A;  1ABO A;  3ZEH A;  3MHX A;  4A4F A;  1QCO A;  1PC0 A;  3CPW P;  1W70 A;  5IXB A;  2ZCF B;  2MMP A;  4JRP A;  2VGN A;  5GAN 2;  3CCE T;  2VUB A;  3CBM A;  4QW2 A;  1YIT Q;  5LJ5 e;  3S3N A;  2GGR A;  3HRT A;  4C5G A;  2CSQ A;  4TVR A;  4KGZ B;  1JXM A;  2BZX A;  4PJO G;  2LJ0 A;  3PIP A;  2M1H A;  5DLQ E;  2EKO A;  3PVL A;  3JCM d;  3C4S A;  1KD1 R;  3OQ5 A;  1FWZ A;  3LGF A;  2AKK A;  1QVP A;  4C92 D;  1WHM A;  3JSC A;  4RTT A;  3M5A A;  1AT1 B;  2OTL T;  2M51 A;  2EJ9 A;  2DVE A;  4HA8 A;  2RQT A;  1WPY A;  4M77 E;  4NL3 A;  4M78 C;  3F70 A;  3ASK A;  1Q81 R;  1XJW B;  1ZA1 B;  3WVE B;  1UTI A;  3QJ6 A;  5KYY A;  2P0K A;  1M90 C;  2JOY A;  4RMO A;  3DB4 A;  1VQ4 Q;  1H3H A;  4OMO A;  1R8O B;  3JB9 H;  1PKT A;  1QCN A;  4OB1 B;  3MPU B;  4HCK A;  1RUW A;  5I22 A;  3CMA T;  1KFZ A;  4KBM B;  1BK2 A;  2XG8 D;  5FU6 C;  1NM7 A;  1YBY A;  1VUB A;  3PTA A;  3TQ7 P;  3URG A;  1F1B B;  2I0N A;  3CCV Q;  1YIJ Q;  1V29 B;  3CCQ Q;  1CKA A;  1K8A C;  2LVM A;  2XDP A;  1UG1 A;  3RES A;  1SRM A;  2VV5 A;  1Y71 A;  5GMK e;  5GAO m;  1ZQ1 A;  1OI1 A;  2LRQ A;  1RAG B;  1TTH B;  3S6W A;  4K11 A;  3JV3 A;  3MEU A;  2YLC A;  4FT2 A;  5FRN A;  2FVU A;  3EFS A;  1VOM A;  2MCN A;  3L2W A;  4C0Z A;  3BY7 A;  3PMI A;  3A8H B;  1TSF A;  2L3P A;  4QT7 A;  3QBY A;  2EQI A;  3WXM B;  1AOJ A;  2E4H A;  1M8M A;  3KBG A;  5A2Q E;  3EFO B;  5J39 A;  4ZGE B;  5KH6 A;  3PT9 A;  2JM8 A;  2CRE A;  4GBQ A;  4LN2 A;  3V8J A;  1YNZ A;  1KSW A;  1Q95 G;  1M30 A;  4FW1 A;  2R5A A;  4RTX A;  2SRC A;  4M75 G;  4WF2 A;  1SG5 A;  4RTU A;  1YI2 A;  2A3L A;  3GIB A;  1MMG A;  1UHF A;  4XU1 A;  3G6E A;  2DTH A;  2E3I A;  1U8R A;  7AT1 B;  1FMK A;  2HQH A;  1VQL A;  3S3O A;  2HD0 A;  3M55 A;  3CPF A;  4M7A E;  1WA7 A;  4BY6 B;  3OS5 A;  1B7T A;  1DJ7 B;  3HRU A;  1S1N A;  3CC4 A;  3OS1 A;  2AZS A;  2XIC A;  1OEB A;  3VS0 A;  1S72 T;  2E70 A;  3HSB A;  2HCK A;  4KRT A;  2ZPG B;  1BB9 A;  1KQS S;  3UAT A;  2K5F A;  1QQJ A;  2RJC A;  2VGM A;  3FLG A;  5GAN h;  2JVV A;  1YI2 T;  1OQK A;  4JJB A;  2RJE A;  2YWW A;  5GAO p;  1YJW A;  3CC2 A;  3FIF A;  4C8Q G;  4ZN3 A;  3X24 B;  4M7A F;  4QQD A;  4AFS C;  2DL8 A;  2OTL Q;  3I55 A;  4J6X A;  4LE9 A;  2P0Q A;  1C6V X;  3BE3 A;  4KH1 B;  3CBO A;  2O4X A;  1H8K A;  1I5O B;  3NTH A;  1UGQ B;  2DYI A;  3CCJ A;  2GBQ A;  1VQ9 T;  2COZ A;  2KSS A;  1UEC A;  1X27 A;  3VU3 C;  5GAN 7;  5CO7 A;  3MEW A;  2CP2 A;  3JCM c;  4FT4 A;  2DIG A;  2PVG B;  2L3R A;  1GFD A;  2CH4 A;  4M75 C;  1SPK A;  1T0H A;  1OPK A;  1YJW T;  4HT9 A;  2F5K A;  3FJP A;  2LT1 A;  5GAN d;  4C92 G;  3EGX A;  2QQ9 A;  1LJO A;  2COW A;  2LT4 A;  2KK4 A;  4HT8 A;  1AWW A;  1WHL A;  2F2V A;  2EGA A;  3HFO A;  4E7K A;  3ER0 A;  3RIR A;  2PTK A;  2PNI A;  5GAN 8;  4D8D A;  2KGT A;  1I5L A;  3X25 B;  1G2B A;  3VS4 A;  2ZAE A;  3NGP A;  3LWH A;  1OYX A;  2YT6 A;  4ESR A;  1WHK A;  2LP5 A;  4Y92 A;  3EHQ A;  3UPU A;  2X4J A;  1Q82 U;  2JUF A;  2V26 A;  1N9R A;  1VQO Q;  1WGS A;  4PJO A;  2JTF A;  2YUP A;  1P92 A;  2JZ2 A;  2EAY A;  4XQ3 A;  2AT1 B;  4M7D G;  1VQ7 A;  3QJY A;  4C8Q C;  1UJY A;  4O5V A;  3E19 A;  2AKL A;  2QGF B;  3A8G B;  4HCZ A;  3OSS C;  4ZN1 A;  1CKB A;  4EMK B;  1QKW A;  3NTK A;  1G5V A;  6AT1 B;  1RI9 A;  3M57 A;  1ZUU A;  2RQW A;  3VS1 A;  1OX8 A;  1QP3 A;  1YJN Q;  1BIA A;  3CPW A;  1QKX A;  3JCM Q;  4E7I A;  3PFS A;  1VIF A;  1RAD B;  1VQ6 Q;  1BU1 A;  4MML A;  2KT1 A;  1JJ2 S;  2ZPH B;  5LJ3 h;  2K5I A;  2L8D A;  1QVF A;  3N5B B;  1XOV A;  3VJP A;  2DD5 A;  5IN1 A;  4OB2 B;  3MP1 A;  2BZ8 A;  3TVT A;  2DXC A;  1VQ7 T;  3QWY A;  1YIT A;  3BFM A;  4BDZ A;  1PSF A;  1BKB A;  5J3B A;  4C92 C;  4OF1 A;  4BI8 B;  3M9Q A;  2MYS A;  4F7U E;  3SWN B;  3A8L B;  2A37 A;  4PJO D;  2Y4X A;  2D9T A;  2C0O A;  2HNI A;  1E7O A;  1S72 Q;  1KQS P;  2SEM A;  1MMD A;  2E64 A;  4LDY A;  4VUB A;  3QYG B;  1GCQ A;  2XDD A;  4MDW A;  2MOX A;  4J9D A;  2MK5 A;  2LQ8 A;  3E9F A;  3OYN A;  5GAM j;  2DLP A;  2EGC A;  2EQK A;  5GMK m;  4XU2 A;  5LJ5 d;  3OW2 S;  4A4H A;  1Q82 R;  4CC4 B;  4Z8A A;  1VQP A;  1BBZ A;  2KI7 A;  1VQM Q;  2E5Q A;  3VRY A;  1OUL A;  1FXX A;  2KVQ G;  1G3S A;  4F7U F;  4QVC A;  3EG2 A;  5GAM f;  4PNO A;  1U3O A;  2LNV A;  3OA6 A;  2PU9 B;  3RER A;  2LQW A;  1Y57 A;  3LX7 A;  2EYY A;  2HL3 A;  1WLP B;  3EGD A;  4IIO A;  5GJV B;  5A0G A;  4QQG A;  3EG9 B;  3M0S A;  5ECA A;  1KHC A;  3KUF A;  3SHW A;  2DX1 A;  1I07 A;  1N8R U;  5GMK h;  1ZBX A;  3JCM b;  2J06 A;  3CCV A;  1YIJ A;  4M4Z A;  3CCQ A;  4M75 A;  2FPD A;  4IIM A;  2YSQ A;  4F16 A;  4M78 E;  3CCS T;  2NUZ A;  1D1B A;  2OAU A;  1VQ5 Q;  2V1Q A;  3LYI A;  4BB7 A;  4II1 A;  5FRM A;  2YXY A;  1KC8 U;  1M1G A;  1K0X A;  2A08 A;  4ELY C;  1VQ4 T;  1BCO A;  1U06 A;  3I35 A;  1WIE A;  2ROT A;  3RBB B;  3QYH B;  1WXB A;  5CR2 A;  1D3B A;  3A1P A;  4X1V A;  1OZ3 A;  3RR6 A;  2DER A;  3CCV T;  3CCQ T;  5FW9 A;  1AHJ B;  3VRZ A;  3PMT A;  4XTU A;  4M78 F;  1HXD A;  3PIO A;  2XHC A;  1ZSG A;  1HK9 A;  1M4Z A;  2FG0 A;  1KD1 U;  2KRO A;  1FMW A;  2EFI A;  3BDU A;  4ZGD B;  4E2F B;  4C8Q A;  1TUD A;  2HQE A;  4L5G A;  4JS5 A;  1AWO A;  2DL7 A;  4OMF B;  5CIU A;  4JRI A;  3GLX A;  4M75 D;  3V7S A;  1B34 B;  1M2V A;  1X2K A;  2K6D A;  2RM4 A;  1LCK A;  1JJ2 P;  1RAF B;  2XKO C;  2EQJ A;  1XQH A;  2DMO A;  1W4S A;  3D7S B;  4XU3 A;  2I2L A;  4XTV A;  2KBT A;  2L3Q A;  2GNC A;  1WXT A;  3OBW A;  1AD5 A;  4BI3 A;  5I2S A;  1EZZ B;  1NYG A;  2B8A A;  1Q81 U;  1VYU A;  3PNW C;  1KHI A;  2JS0 A;  5IT9 E;  3GBQ A;  2QI2 A;  2K57 A;  1PM3 A;  5DY9 A;  1U1T A;  2HSP A;  1IRX A;  4PFP A;  1N8R R;  4MDX A;  5GAM g;  4CC7 A;  2RO0 A;  2FB7 A;  4PJO F;  1BCM A;  5FU7 C;  1WFW A;  3X26 B;  1TG0 A;  4C0D B;  1TH7 A;  1MHN A;  5GAN 6;  2DL5 A;  4N4I A;  4R0K A;  1I1J A;  2EWN A;  3TCJ A;  5HK0 A;  3INZ A;  3ZFJ A;  1OZ2 A;  3IQL A;  5GAN j;  1KC8 R;  2P84 A;  4BI4 A;  2RK2 A;  2XID A;  4C8Q D;  2HBP A;  2ZZD A;  2KRM A;  3J81 E;  5D6W A;  3OW2 P;  1VYV A;  4E7Z A;  2OTL A;  2NLU A;  4BE0 A;  2FZC B;  3O8V A;  1MMA A;  3QZ9 B;  4ZTJ A;  3RNJ A;  2JTM A;  2DA9 A;  3NMZ C;  1QVF P;  2K5L A;  1QW1 A;  1WJS A;  1OU8 A;  5IHN A;  2YRD A;  2WSE E;  2CGH A;  1YHQ T;  3J80 E;  1FYN A;  3RMS A;  2RMO A;  2VVK A;  1E6G A;  1JU5 C;  2V8I A;  2F2X A;  2CP5 A;  4M7D A;  4M7A B;  5FRO A;  1VYT A;  2EPD A;  1T3L A;  2LZ6 B;  2DL3 A;  2KY9 A;  4FW2 A;  2K3Y A;  5CK9 A;  2EVR A;  5KYX A;  3H0H A;  4AFZ C;  1O9S A;  1KG1 A;  3X28 B;  1VA7 A;  4J7F A;  1IGU A;  1X43 A;  2L89 A;  1HYO A;  4FYV B;  3HP9 A;  2PUO B;  4FYW B;  3CMA A;  4OB0 B;  1GRI A;  3QZ5 B;  3VS3 A;  1M27 C;  4OP0 A;  3HPW A;  1ZLM A;  3JCM W;  3CCS Q;  3HFN A;  1JO8 A;  1ZSZ C;  1KJW A;  1UGP B;  3M0U A;  3NHN A;  2K79 A;  3V7R A;  4F14 A;  1N5Z A;  2O9V A;  4DBH A;  3I56 Q;  3L2V A;  4LUE A;  5IAY A;  2DTO A;  2BUD A;  2IPO B;  1VQO A;  2JMA A;  3QDR B;  2MAM A;  4FYY B;  2K7A A;  2QTV A;  3VS7 A;  4CRI A;  2FYK A;  4WCI A;  4FM4 B;  4M7D D;  2PVD B;  3TRE A;  4B9W A;  2QQR A;  2H3E B;  3V8K A;  1UUE A;  2CKK A;  2CP6 A;  4J9B A; 
#chains in the Genus database with same CATH homology
 1W1F A;  3UF4 A;  2DF6 A;  1RLP C;  2KEA A;  2GBQ A;  1WI7 A;  2PZ1 A;  3O5Z A;  4AFQ C;  2J6F A;  1UEC A;  1X27 A;  2JTE A;  2YUQ A;  3I5S A;  3TSW A;  3ULR B;  5EC7 A;  1RLQ C;  1GFD A;  2CH4 A;  1SPK A;  1T0H A;  2D8H A;  1OPK A;  4ZNX A;  2CT3 A;  2X3X D;  1NYF A;  2ABL A;  1AWJ A;  1QCF A;  2FEI A;  2VWF A;  2BZY A;  1YP5 A;  2J7I A;  4HXJ A;  5I11 A;  4AG2 C;  4DEY A;  1AWW A;  2F2V A;  2EGA A;  2LQN A;  2PTK A;  2LJ1 A;  2PNI A;  1ABQ A;  2ENM A;  2DIL A;  4D8D A;  2KGT A;  1K4U S;  1UE9 A;  1NLO C;  4LUD A;  3PVQ A;  1G2B A;  1NEB A;  3VS4 A;  3NGP A;  3SEM A;  2C0I A;  2OJ2 A;  1A0N B;  2JW4 A;  3ZL7 C;  4HVU A;  1MV3 A;  2YT6 A;  1X69 A;  2VKN A;  2LMJ A;  2LP5 A;  4ESR A;  4Y92 A;  3EHQ A;  4RTV A;  4CC3 A;  1QWF A;  1NEG A;  1X6B A;  2O88 A;  1M3A A;  2JM9 A;  2YUN A;  2KRN A;  4OMQ A;  2CUD A;  2KT8 A;  3NPF A;  2DVJ A;  2YUO A;  2YUP A;  2ECZ A;  2KYB A;  4FSS A;  1GBQ A;  2X3W D;  1JXO A;  2JMC A;  2O31 A;  1AWX A;  1UJY A;  3A98 A;  1JEG A;  2AKL A;  2C0T A;  4J9E A;  2P4R A;  1CKB A;  1QKW A;  2NWM A;  1RI9 A;  2JXB A;  2RN8 A;  1ZUU A;  2RQW A;  3FJ5 A;  2DE0 X;  4RUG A;  3VS1 A;  3EG3 A;  1QKX A;  1GCQ C;  4JJD A;  1AVZ C;  4RTZ A;  1KIK A;  2DNU A;  1BU1 A;  4EIK A;  2CUB A;  2KT1 A;  4JPB W;  1SHF A;  1W6X A;  1SSH A;  1HD3 A;  2J05 A;  1XOV A;  2DL4 A;  2RPN A;  1HJD A;  1M3C A;  1H92 A;  2BZ8 A;  3TVT A;  1UGV A;  2RNA A;  5IXF A;  1GFC A;  1ZBJ A;  2G6F X;  3TSZ A;  2DRK A;  3QWY A;  1PRL C;  1J3T A;  2HBW A;  2J6K A;  1YWO A;  3H41 A;  4AFU C;  2L3S A;  2EKH A;  3U23 A;  2A37 A;  1SRL A;  2FPE A;  1OOT A;  2C0O A;  2KRS A;  1E7O A;  1JQQ A;  2DRM A;  2AK5 A;  2SEM A;  4Z89 A;  2V1R A;  1SHG A;  2BTT A;  3M0T A;  3VS2 A;  4D8K A;  5HCK A;  2KNB B;  1GCQ A;  2DBM A;  1NLP C;  1T0J A;  2MOX A;  4J9D A;  1GBR A;  2B86 A;  3M0P A;  2CDT A;  2DLP A;  2EGC A;  3EGU A;  5FWC A;  1I0C A;  2CT4 A;  2KE9 A;  4OMP A;  3EG1 A;  2KXC A;  4CC4 B;  4Z8A A;  1BBZ A;  4RTW A;  4J9C A;  1EFN A;  3VRY A;  4HVW A;  4LNP A;  1HSQ A;  3EG2 A;  2HEQ A;  1MV0 B;  4E6R A;  1B07 A;  1UJ0 A;  2EYW A;  2KXD A;  1U3O A;  4JJC A;  1GL5 A;  1AEY A;  1OPL A;  2LQW A;  1Y57 A;  2EYY A;  2FPF A;  1WLP B;  3C0C A;  4IIO A;  2O2O A;  1PNJ A;  5GJV B;  1ABO A;  4J9I A;  2D1X A;  2JS2 A;  1PWT A;  4OML A;  3M0S A;  5ECA A;  1W70 A;  2OAW A;  2H8H A;  3SHW A;  5IXB A;  3I5R A;  2DX1 A;  1I07 A;  2EGE A;  3M0Q A;  2J06 A;  1SEM A;  2J6O A;  1ZUY A;  4M4Z A;  2FPD A;  2GGR A;  3UA7 A;  4IIM A;  4J9F A;  2CSQ A;  2YSQ A;  2M0Y A;  1JXM A;  4F16 A;  2BZX A;  3H0I A;  2FRW A;  4OMM A;  1WX6 A;  2F2W A;  2NUZ A;  2LJ0 A;  2AZV A;  2ESW A;  2L0A A;  1TUC A;  1Y0M A;  3EG0 A;  2V1Q A;  4DEX A;  3PVL A;  1MUZ A;  2RQR A;  4GLM A;  1K0X A;  2A08 A;  2AKK A;  1U06 A;  4OMN A;  3I35 A;  1WIE A;  2ROT A;  1YN8 A;  4RTT A;  1ZX6 A;  3RBB B;  1YWP A;  3M0R A;  2M51 A;  1WXB A;  4X1V A;  2RQT A;  2O9S A;  5GJW B;  1OV3 A;  3VS6 A;  1M3B A;  5FW9 A;  3EHR A;  3VRZ A;  5L23 A;  2OI3 A;  1Z9Z A;  1ZSG A;  2FG0 A;  1IO6 A;  1V1C A;  2KRO A;  4AG1 C;  1QWE A;  1UTI A;  1GCP A;  4Z88 A;  1TUD A;  1AWO A;  2CH4 W;  2DJQ A;  2DL7 A;  3I9Q A;  3CQT A;  2K2M A;  3UA6 A;  1X2K A;  1UDL A;  2K6D A;  1LCK A;  1PRM C;  2QDL A;  1H3H A;  4OMO A;  4ORZ A;  4JZ4 A;  1X2Q A;  2DM1 A;  2DMO A;  1PKT A;  2KBT A;  2L3Q A;  1CSK A;  2FO0 A;  2GNC A;  4HCK A;  1RUW A;  2FRY A;  5I22 A;  1WXT A;  1KFZ A;  1BK2 A;  2A28 A;  1AD5 A;  2IIM A;  1NM7 A;  4HVV A;  1NYG A;  2I0N A;  1UFF A;  1CKA A;  2LJ3 A;  1VYU A;  5IH2 A;  2JS0 A;  2EW3 A;  3GBQ A;  2CSI A;  3R6N A;  1UG1 A;  1UHC A;  1SRM A;  2MIO A;  2RQU A;  2HSP A;  3REB B;  4CC7 A;  4K11 A;  1PHT A;  1WFW A;  3JV3 A;  1TG0 A;  4F17 A;  1Z9Q A;  2RQV A;  5FWB A;  1K9A A;  1AZG B;  2ROL A;  1WDX A;  2MCN A;  2DL5 A;  1G83 A;  4R0K A;  1I1J A;  2LNH B;  2L3P A;  2XMF A;  3IQL A;  4QT7 A;  2EQI A;  1K1Z A;  1AOJ A;  2W10 A;  2KYM A;  1M8M A;  4J9H A;  2K9G A;  4CC2 A;  2D0N A;  2KRM A;  1VYV A;  2JM8 A;  2DBK A;  4J9G A;  2CRE A;  4GBQ A;  2L2P A;  2LX7 A;  4LN2 A;  3RNJ A;  1YNZ A;  2DA9 A;  4RTY A;  1T3S A;  3NMZ C;  1KSW A;  1M30 A;  5IHN A;  1FYN A;  4RTX A;  1X6G A;  2RMO A;  2GTO A;  2VVK A;  1E6G A;  2SRC A;  1JU5 C;  4A63 B;  2F2X A;  4JZ3 A;  1QLY A;  1AZE A;  3LH5 A;  4RTU A;  1VYT A;  1UHF A;  2EPD A;  1T3L A;  2LZ6 B;  2DL3 A;  3PE0 A;  2EVR A;  1FMK A;  2GTJ A;  1WXU A;  1PKS A;  3H0H A;  4AFZ C;  2JT4 A;  2EBP A;  2HDA A;  3H0F A;  2W0Z A;  1VA7 A;  1WA7 A;  1X43 A;  1K76 A;  1K0S A;  1GRI A;  1S1N A;  2EYZ A;  3VS3 A;  2D8J A;  1M27 C;  2AZS A;  1OEB A;  2RF0 A;  1NG2 A;  1ZLM A;  2A36 A;  3VS0 A;  1ZUK A;  2HCK A;  4KRT A;  1BB9 A;  1JO8 A;  2LCS A;  1KJW A;  3M0U A;  2GQI A;  3NHN A;  2K79 A;  1U5S A;  3UAT A;  4F14 A;  1N5Z A;  2O9V A;  2DYB A;  2K3B A;  3QWX X;  2KR3 A;  5IHK A;  4JJB A;  4LUE A;  2ED1 A;  2JMA A;  3THK A;  3VS5 A;  2ED0 A;  3REA B;  2K7A A;  3VS7 A;  3KFV A;  1B3Q A;  1YCS B;  2EYX A;  4AFS C;  2DL8 A;  4WCI A;  1E6H A;  5IHI A;  1WYX A;  4LE9 A;  1ARK A;  2YDL A;  1UUE A;  2E5K A;  1H8K A;  4J9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...