2DRMA

Acanthamoeba myosin i sh3 domain bound to acan125
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
GPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acanthamoeba Myosin IB
publication title The crystal structure of the SH3 domain of Acanthamoeba myosin IB bound to Acan125
rcsb
source organism Acanthamoeba
molecule tags Contractile protein
total genus 11
structure length 58
sequence length 58
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2drmA00
2EYXA 4ESRA 2D8JA 2A36A 2EGAA 1ABOA 2J06A 4RTWA 1ZUKA 4J9IA 2ROTA 4HVUA 3EG3A 1JQQA 1MV3A 4Z89A 4JJCA 3VS6A 1WLPB 3TVTA 2EYWA 1NEGA 1UTIA 1MUZA 1Y57A 4LE9A 2RPNA 2A28A 2K3BA 2ENMA 2JXBA 1VYVA 1E7OA 2DNUA 4AFUC 2X3XD 1AWOA 2K79A 1JXOA 2LP5A 4J9CA 4J9GA 1WA7A 2MOXA 1CKAA 1LCKA 1PKTA 2KRNA 1AWWA 3CQTA 4LNPA 5IHKA 1OPKA 3VS1A 2BZ8A 3REBB 2M51A 1SSHA 2KT8A 2DL5A 1H3HA 2OAWA 2LX7A 1JO8A 2G6FX 2JT4A 4CC2A 2FRYA 1AWXA 4OMMA 1Z9QA 1VYTA 2HCKA 2O88A 1YWPA 3PE0A 2VWFA 2KEAA 1YNZA 4IIOA 1KJWA 2FEIA 3QWYA 3NHNA 1UJYA 1N5ZA 4IIMA 1GBRA 1ZUUA 2K6DA 2JS0A 2A08A 3O5ZA 2L3SA 1WXBA 1AZGB 4GBQA 1K4US 2FG0A 2RMOA 2RF0A 2EVRA 2EYZA 3M0QA 2QDLA 2LZ6B 5ECAA 2J05A 4RUGA 1RUWA 1X2KA 2VVKA 5FW9A 4DEXA 1IO6A 1PHTA 3H0FA 4QT7A 1SEMA 3EG2A 2RN8A 5IXBA 1GBQA 1GCQA 2BTTA 4AG2C 1X69A 2EYYA 2J6KA 2YUNA 1GRIA 2H8HA 4Z88A 1QWEA 1WX6A 4Z8AA 1TG0A 2KXCA 4J9DA 2HBWA 5I11A 5GJWB 2NWMA 3I35A 2M0YA 2NUZA 3PVLA 3I5SA 1W6XA 2CH4A 2EKHA 1M3BA 1RLQC 2DLPA 4OMNA 3VS5A 4CC4B 1AD5A 3PVQA 5EC7A 2DYBA 1X43A 2FRWA 4F14A 3EHQA 1CKBA 2FPDA 2ABLA 4LUDA 1JU5C 2KRMA 5IXFA 2FO0A 3UA7A 3THKA 2ED0A 2KE9A 1K0SA 1E6GA 2SEMA 2DVJA 1YP5A 1M3CA 1NLOC 3I5RA 2L3PA 4RTZA 4OMOA 1BBZA 2ED1A 2KT1A 2XMFA 5IHNA 5GJVB 2EQIA 3VRYA 1YWOA 5IH2A 1SHGA 1X6GA 2PNIA 2DRKA 1UHCA 2W0ZA 4OMPA 1WI7A 3M0RA 2P4RA 4HVWA 3R6NA 2EGCA 1H8KA 1NM7A 3TSZA 1UGVA 1I07A 1B07A 2YUQA 2K9GA 1MV0B 3M0SA 2MCNA 1T3SA 3EG1A 1QWFA 1NG2A 4D8KA 4HVVA 1VA7A 3C0CA 1UECA 1SRMA 1X6BA 2J6OA 4RTVA 2KYBA 1U06A 3ULRB 1ARKA 1VYUA 1Y0MA 4HXJA 2YUPA 2FPEA 1T3LA 5FWCA 1K76A 4JJDA 2CSIA 2LQWA 2BZXA 2C0TA 3RBBB 2V1RA 1SHFA 2CREA 1G2BA 4ORZA 3H41A 5I22A 1V1CA 1U3OA 1W1FA 5IHIA 2CUBA 1AEYA 2AK5A 3VS4A 1QCFA 2SRCA 2CSQA 2KYMA 2D1XA 2CT4A 1JEGA 4LUEA 2F2XA 1HD3A 3IQLA 2V1QA 1OOTA 3UF4A 1HJDA 2OJ2A 5L23A 4CC7A 1I0CA 2O9SA 2W10A 4LN2A 3JV3A 2C0OA 4OMQA 2GTJA 3FJ5A 3I9QA 1YN8A 2LMJA 1I1JA 2LCSA 1H92A 2JM9A 5FWBA 1RLPC 1UJ0A 1GCPA 2MIOA 1OPLA 1UE9A 2O9VA 1UDLA 2O31A 2YDLA 1WIEA 3A98A 1KIKA 1PKSA 3SHWA 4X1VA 1EFNA 2L3QA 2RQUA 4HCKA 1ZBJA 2DRMA 1UFFA 1WXUA 3H0IA 4KRTA 4E6RA 1RI9A 2LJ0A 3U23A 2JTEA 1E6HA 1NEBA 2EPDA 2DL3A 3UATA 4AG1C 4A63B 3RNJA 4AFSC 1ABQA 3M0UA 1OV3A 1FMKA 3QWXX 2GGRA 4J9BA 2YUOA 4F16A 2DE0X 3ZL7C 1SPKA 1M8MA 4AFZC 2B86A 1NYFA 2GBQA 2D8HA 1JXMA 2F2WA 3GBQA 2DL7A 1K1ZA 1KFZA 1B3QA 3REAB 2KROA 2LJ1A 1UG1A 2D0NA 1PRMC 1Z9ZA 4RTXA 1K0XA 1PNJA 2BZYA 2LQNA 2DBKA 2LNHB 1AVZC 5HCKA 4OMLA 1BK2A 4CC3A 1HSQA 1J3TA 1TUCA 3VS2A 2DMOA 3KFVA 2ESWA 2K7AA 2LJ3A 1AZEA 2JW4A 2AKKA 4Y92A 1WXTA 3UA6A 1SRLA 3H0HA 1M3AA 2HDAA 1K9AA 2DILA 1GL5A 2KRSA 2X3WD 2DM1A 2J6FA 1TUDA 1GFDA 2YSQA 2RQWA 1PRLC 2EBPA 2HSPA 1U5SA 1QKWA 2E5KA 2KBTA 2C0IA 1X2QA 3EHRA 2JS2A 1AWJA 1NLPC 2GNCA 1GCQC 2YT6A 2JMAA 4FSSA 3NMZC 2KNBB 2DL4A 2IIMA 3VRZA 2RQRA 1AOJA 2F2VA 1ZSGA 2RQTA 1FYNA 4K11A 3VS3A 1ZLMA 4GLMA 2GQIA 2L2PA 2DL8A 2OI3A 1W70A 4M4ZA 2CDTA 1WYXA 2CT3A 2RNAA 1BB9A 3TSWA 2VKNA 4WCIA 4RTUA 1ZX6A 4F17A 4DEYA 1CSKA 3NPFA 2EW3A 4R0KA 2DBMA 2AZVA 2J7IA 2A37A 2JM8A 1S1NA 2L0AA 1YCSB 2K2MA 1WDXA 2EGEA 2JMCA 3VS0A 2HEQA 1UHFA 4JJBA 2KGTA 2CH4W 2GTOA 4J9HA 1T0HA 1WFWA 2CUDA 4JPBW 4EIKA 1X27A 2I0NA 3M0PA 3LH5A 2KXDA 4RTTA 4D8DA 3NGPA 1T0JA 4AFQC 2RQVA 1NYGA 1M27C 3SEMA 2PTKA 1M30A 1G83A 2KR3A 3EG0A 4JZ3A 2AKLA 4JZ4A 1QKXA 3M0TA 4J9EA 1GFCA 2DA9A 1QLYA 2DF6A 2ROLA 3EGUA 1ZUYA 2PZ1A 2ECZA 2DJQA 1A0NB 1UUEA 3VS7A 1XOVA 1PWTA 2DX1A 1BU1A 2FPFA 4RTYA 2AZSA 2O2OA 4J9FA 1KSWA 4ZNXA 1OEBA
chains in the Genus database with same CATH superfamily
1Q86C 2L89A 5GMKj 3A8GB 4ESRA 4OF1A 5DLQE 1Q82R 3OYBA 5GAMg 2J06A 4RTWA 2OTJQ 4J9IA 2ROTA 3EG3A 1M2VA 2L3RA 3VS6A 1WLPB 1Y71A 1C6VX 1NEGA 4IUUA 2Y90A 5D6XA 4BB7A 1RL2A 2RPNA 2ENMA 1VYVA 1VQ5T 2QA4Q 1WQWA 2E70A 4AFUC 2X3XD 3JCMP 1AWOA 2WSCE 2K79A 3CCUT 1YI2T 5GAOp 2VGMA 3UDCA 5CKDA 1I5LA 2MWPA 3CQTA 3ZEHA 1KQSP 4M77C 2DXBA 2E1HA 2E6ZA 2M51A 1SSHA 2HQXA 3I55A 4QKUA 1H3HA 3OYNA 1WHHA 3L1AA 2G6FX 2FRYA 4ZTJA 1M4ZA 2HCKA 2O88A 1RACB 3PE0A 3HRTA 2VWFA 2KEAA 4C5EA 3OS5A 3QWYA 1M1KU 3NHNA 1N5ZA 5CO7A 4IIMA 2A0FB 1WJQA 3MP1A 2EAYA 2QQSA 4CRIA 4M75B 2L3SA 3AT1B 1YBYA 1AZGB 1K4US 3PIPA 3OQ5A 1QP2A 2EYZA 3M0QA 1WZOA 1BIAA 1QCOA 1KD1R 2J05A 2EJFA 5FW9A 4DEXA 3CD6A 3AHUA 1M1KC 4C5HA 4XTYA 3BW1A 3EG2A 2A7YA 4TVRA 1G5VA 1GBQA 1PD1A 1WPYA 4J8OA 2J6KA 1GRIA 5GAN8 1WX6A 1YIJT 4PJLA 1U8RA 2FL7A 2KXCA 1BI2A 3MP6A 5I11A 5GJWB 2YHTA 3TQ7P 2M0YA 4PJJA 4NL2A 3I5SA 2MMPA 2NUPB 3CC4T 3OSSC 3I55Q 4OMNA 3LYIA 1LOJA 4A54A 4C0FA 3EH2A 3OBYA 5EC7A 5GAOl 3RMQA 3LGLA 1CKBA 4OMFB 4E7IA 2C06A 4LUDA 1UB4A 4F7UA 4JS5A 5KE2A 2ZPIB 5IXFA 2FO0A 3NTHA 3MCAB 2ED0A 2KE9A 4RCCA 4F7UE 2CP6A 1UGQB 1R0CB 4MDXA 3LGFA 3OYHA 3JCMd 1IB8A 4C8QF 2KT1A 4HCCA 1G3YA 5GJVB 4M7AF 1S72A 1PC0A 1X6GA 3EAEA 2PNIA 2W0ZA 1UHCA 2HNIA 3RMSA 1N6AA 2EQUA 1WI7A 1QVFA 3E9FA 3CD6Q 4M7DB 2VASA 4F7UG 1NM7A 4FYXB 2QEXT 4WF2A 1D3BB 4YTLA 1MV0B 4XU2A 5LJ3h 3G71A 3MEVA 5A2QE 1M1GA 1UGPB 3EFSA 4E7JA 2J6OA 4RTVA 3LLRA 4O6JA 1JBMA 4M78A 2P4TA 1Y7XA 1Q81R 4OB1B 3N5BB 4E47A 3M53A 4A4FA 5KYNA 1G2BA 5LJ3e 4Y28E 1U3OA 1W1FA 2KDSA 2OTJT 4KH1B 2KYMA 4LUEA 5GMKi 1IRXA 1HD3A 4JJNK 3IQLA 1HJDA 4C8QE 4M7DC 2W10A 3QHSA 4LN2A 2OTLA 1S72Q 4M7AE 2GTJA 3JB9F 3I9QA 5HY6A 4ANJA 2LMJA 1KQSA 5LJ3g 2LCSA 5KCOA 1BCMA 1TSFA 1VQPT 3PGGA 3R6OA 3OMCA 1WIEA 1K9MU 1M9SA 3A98A 1I4K1 1EFNA 3OYLA 3G71Q 4C8QG 1ZBJA 4M7AG 1WHLA 4XTWA 3M59A 4E6RA 3CCQA 1BI1A 2CZ1B 2DL3A 3EFOA 5CQXA 5EG2A 4DBRA 2DD4A 1NJIU 3EGDA 2YUOA 1K9MC 3V8JA 4AFZC 2GBQA 1JXMA 4EMGA 3GBQA 2YLCA 1KFZA 4M77F 2O4XB 1LJOA 1X01A 1R77A 1Y96A 3QYGB 3P8DA 5C0MA 4KGZB 3RESA 4DBFA 5GMKh 1NJIC 1PRMC 3META 2DXUA 2QGGA 3CCEA 2MWOA 1K0XA 4FYVB 2OTLQ 2LQNA 4HCBA 2DBKA 1AVZC 5HCKA 2LVMA 4OMLA 4MDWA 1OX8A 1BK2A 2MI6A 5CAIA 4PJOD 4OGCA 1TUCA 3VS2A 3WXMB 3C95A 4F7UB 2KAFA 4IUTA 3GOXA 5KE3A 2LJ3A 1WXTA 1SRLA 3CMAA 3H0HA 2GFUA 4PLIA 2HKQB 2ZPEB 3SWNC 4N4HA 3I55T 2KRSA 2D9TA 3JCMe 4JLGA 3JB9G 4IUVA 3ASKA 3CCQQ 1GFDA 2RQWA 1WHKA 2HSPA 3QPHA 2RJDA 2X51A 5M9OA 3EHRA 5CKEA 3NMZC 1Q86R 2KNBB 2DL4A 2IIMA 4R56A 1U1TA 3MHXA 1AOJA 2RQTA 1ZSGA 3C12A 3JCMX 4K11A 1WJSA 3UT1A 2M0OA 3JCMg 2L2PA 5GAOn 1RAEB 4M77E 1G3SA 3OYAA 2DIGA 1RAHB 1OZ3A 3CPWP 4F17A 3JAME 3HKSA 4M78B 4PKCC 3CCEQ 4HT9A 3Q1JA 2EW3A 4R0KA 1VQ8T 4BI3A 3DLLA 4Z02A 1FX7A 2K3YA 2JMCA 3VS0A 1NPRA 3CC2A 2M02A 1Q81U 2CH4W 1WHMA 4JPBW 4M75F 3M0PA 4M77G 3LH5A 2DZCA 4ELYC 3L2ZA 4WTOB 5GAN4 3NGPA 3CCVT 2XICA 2QYZA 4AFQC 1RAAB 3CMAQ 4L5GA 3SEMA 2DAQA 3G4SA 4C8QB 3H6ZA 4JZ3A 3E19A 1QKXA 3M0TA 2ZPGB 1QLYA 2PZ1A 2XIDA 2HL5C 1K8AU 4X9DA 1Q81C 1O75A 1XOVA 2ZZDA 2DX1A 1QVGP 3FJPA 2ZAEA 2FPFA 4RTYA 4J9FA 1YHQA 4E7HA 2Z0WA 4E2FB 1HXDA 3L2WA 2QK0A 1G8XA 1ABOA 5FLXE 4M75D 5GAN2 4HVUA 1MV3A 4M78C 2VGNA 1WHJA 3TVTA 4OB2B 1M1KR 1P92A 3QG1A 2QAZA 2RK1A 3DKMA 1E7OA 1N9RA 2EJGA 4VUBA 1MNEA 3OBWA 2RHIA 2DFUA 1WA7A 2R5MA 2R58A 3EGDB 1CKAA 1VQ9A 5C6SA 2RA2A 3CC2Q 2CP5A 2K5LA 3VS1A 1VIEA 2DERA 4FT4A 2M1HA 1LVKA 2KT8A 2Y4XA 3QZ9B 2DL5A 3G4SQ 1Y96B 4M7DF 1R8OB 2E5QA 4XQ3A 2OX7A 3CBOA 4XAXB 1AWXA 4OMMA 2H3JA 4J6XA 1KG1A 4ZN3A 4ZGJB 1VQOT 4XK8E 3RIRA 1YHQQ 1KQSS 2K6DA 8ATCB 1KC8U 2JS0A 3O5ZA 1TOVA 1PM3A 5FRMA 3CC7A 4C5IA 1XJWB 2LZ6B 4RUGA 3J80E 2OTLT 4V2SA 3H0FA 1BI0A 3CXCP 3G1JA 5J26A 3CCMA 5A0LA 2YWWA 1GCQA 2BTTA 2CZ6B 4C92A 2IPOB 4AG2C 1KC8C 1VQ9Q 1QWEA 5LJ5f 1NZ9A 2HAXA 1X6OA 3OYYA 2NWMA 5KYXA 1TU0B 5GAN7 9ATCB 2FVUA 4FCYA 2EKOA 4PK4A 1AD5A 2COZA 1X43A 1YJNA 4M7DE 2FRWA 1OX9A 4MMLA 4ZGEB 3ME9A 3CBPA 4KGXB 3QBYA 3CEYA 3MO8A 3J7AF 3CPWA 3CCLA 3EFRA 1G3WA 2CGHA 2VXFA 4ZTFA 1WQ7A 2XK0A 3I5RA 4RTZA 4XU0A 1GXIE 3FEOA 4M7DG 2XMFA 2AIRB 3S3MA 1YWOA 5IH2A 3CCET 2DRKA 3CC7Q 2XKOC 3M0RA 2MF2A 3MEWA 2P4RA 5LJ5j 2JTMA 2EGCA 1VQLA 1H8KA 2DTHA 2QG9B 3C94A 3CCMQ 3TSZA 4IKFA 3H8ZA 1IXDA 2QTVA 4PJOC 4A53A 1PG5B 3M0SA 2X4WA 3VYHB 1QWFA 4D8KA 4HVVA 1VA7A 4EDUA 2V26A 3DLMA 1IHWA 3S3OA 1X6BA 2KYBA 3VU3C 2HSEB 2HQEA 2LTOA 5KYWA 1WHGA 1H641 2H3EB 2YUPA 2VXEA 3OYGA 2MYSA 2FPEA 4BDZA 1T3LA 1OYXA 5FWCA 1K76A 2HMAA 1Q95G 2E3HA 1K9MR 2LQWA 1YJNQ 2BZXA 1QP3A 2C0TA 4IUPA 4F7UF 1SHFA 5D7UA 2CREA 1VUBA 3SB2A 4ORZA 5I22A 5KYYA 1V1CA 5IHIA 3G6ET 3CCLQ 4LXCA 3CMET 2AK5A 3VS4A 3SWNA 2ATCB 3GP8A 1NJIR 2CT4A 1JEGA 2F2XA 2MAMA 3HTRA 3OS2A 2V1QA 1RAFB 3RKWA 1PSEA 2C0OA 4OMQA 4OP0A 2NLUA 1F1BB 3CCJA 2DZ9A 5J3BA 1VQLQ 2PVOB 4PLLA 4DQ2A 5GANf 2K2VA 1VQMA 1W4SA 2LDMA 3SHWA 2L3QA 2XI9A 4FW2A 3H0IA 3CCSA 3JCMJ 4M78F 1RI9A 3U23A 2RHXA 2JTEA 2L5QA 1OI1A 3UATA 4RCBA 3PNWC 4QQGA 4AG1C 1I5OB 1U1SA 2V8JA 1MMAA 4JLIA 4J9BA 5I2MA 2DE0X 1VQ7T 5FU7C 1SPKA 2B86A 2D8HA 2F2WA 2DL7A 2E41A 3REAB 2KROA 2E4HA 2D6FA 2WSEE 1K73U 1MHNA 3HRUA 2ZPHB 5D6YA 5KYXB 2D0NA 1Z9ZA 4RTXA 3MEAA 2DIQA 2DTOA 4N0AC 1VQ6T 2LNHB 2MK5A 5GANj 2DTIA 5GAMf 1OU8A 4CC3A 2F5TX 5LJ5d 1RABB 3CCJQ 3X26B 3TREA 2GCXA 2K7AA 3T9NA 4EPCA 1K73C 2AKKA 3UA6A 1VQMQ 2RD1A 1M3AA 1M2VB 4OGEA 1GL5A 1W2BP 4C8QD 4KUDK 1N9SA 2DM1A 3CCSQ 1WJRA 4M78E 4M7AD 1VQKT 1PRLC 2EBPA 4J6WA 3HP9A 2DJZA 2C0IA 1X2QA 1AWJA 1NLPC 1PSFA 1GCQC 2YT6A 2JMAA 4C92C 2YXYA 3VRZA 1D09B 4PL6A 2PUKB 5CCAA 3VS3A 3QDFA 3NTKA 1K8AR 1ZLMA 2GQIA 1C1AA 4M78G 4JS4A 2DL8A 3RR6A 1ZQ1A 2IVWA 2OI3A 1O9SA 4M4ZA 2QA4T 1X75C 3F70A 5DY9A 1WYXA 3L42A 1BB9A 3JB9H 4RTUA 4BE2A 3HSBA 2J7IA 3CCMT 1SSFA 1WDXA 1V29B 2QI2A 1EIFA 4EIKA 4J9HA 1T0HA 2CUDA 3PIOA 1VIFA 4FYWB 1X27A 2PQWA 4DA4A 4ZN1A 2KXDA 3M54A 5KYYB 4RTTA 3D7SB 1T0JA 2RQVA 3BDUA 5A0DA 1NYGA 4BE0A 1M27C 3SWNB 2X35A 1M30A 2KR3A 3CPWS 1YITA 1GFCA 4ELZC 4R55A 2ECZA 3JB9D 1ZA1B 4JRKA 1AT1B 4L6V5 4Q5WA 3RUXA 3G7ZA 3JCMQ 2A36A 2EGAA 1ZUKA 5A0GA 4QQ6A 2B8AA 3JCMh 4Z89A 4JJCA 4E7KA 4KT0E 3EGXA 1XQHA 2E65A 2DYIA 1MUZA 2E12A 1D1CA 2EFIA 2DNUA 3BY7A 4B9XA 2WACA 1KC8R 5LL6S 4J9CA 4J9GA 5GANd 1VQ5A 5FRNA 2FYKA 1ZSZC 4BACA 5GMKl 1PKTA 1YI2A 2KRNA 4P5NA 1AWWA 4LNPA 1JB0E 5IHKA 5LJ5h 1OPKA 1QVPA 2BIVA 2GF7A 4M77D 3REBB 3TU4K 2I2LA 5CR2A 3BE3A 3RERA 3L2VA 2LRQA 4PFZA 2LX7A 1JO8A 1YCYA 5GAOm 3V8LA 3TCJA 3BFMA 2JT4A 4CC2A 5CIUA 1YITQ 1YJ9A 1M1FA 1LNXA 1YWPA 2XHCA 1RAGB 4IIOA 4PJOA 1ZBXA 3QJYA 1UJYA 1RI0A 5LJ5e 3RKYA 3JB9I 1JJ2P 4JUVA 5HKCA 4EMKC 2XD0A 2A08A 4BI4A 4RMOA 5DLOA 1WXBA 3DB4A 3CD6T 2RMOA 2RF0A 7AT1B 2EVRA 2HL3A 2QDLA 5GAOq 3JRZA 5ECAA 5GAMd 1RUWA 5J39A 2E64A 1PHTA 4QT7A 4JDSA 2LCLA 5LJ5g 2RN8A 5IXBA 3OYIA 2LX9A 4N4GA 1D1AA 1W2BA 1VQ5Q 3MEUA 1X69A 2EYYA 1IGQA 4GY5A 4MZMA 2H8HA 4Z88A 4QVDA 2YRDA 1YI2Q 3MKDA 5LJ3f 1YIJA 3BDLA 1BYMA 1RLQC 2DLPA 4CC4B 3OSVA 1IZ6A 3MP8A 3CC4A 2DYBA 3SDZA 1EX4A 4F14A 2PUOB 4FSXA 3CXCS 1YJ9Q 4ME7A 2FPDA 4NS5A 2RB6A 2KRMA 1B7TA 3THKA 3L2UA 4J83A 2RI2A 2SEMA 4HT8A 2LQ8A 5IT9E 1YP5A 1K8AC 1FMVA 2YRCA 4QVZA 1M8VA 1S72T 1TS9A 3KXTA 1BBZA 2ZPBB 1TH7A 5IHNA 3UPUA 3M58A 2QQBA 3EFOB 4XU3A 2BUDA 4JRQA 2QASA 3UWNA 5FU6B 3X20B 1WNLA 5KCHA 2RO0A 3CPFA 4C92F 4O5VA 1D1BA 3G71T 2NYSA 1B07A 1TTHB 2YUQA 4AT1B 2F1LA 1T3SA 5GANh 2JJ9A 2QEXA 1NG2A 2R57A 1D0ZA 1SRMA 1HYOA 3ULRB 1ARKA 4F04B 4CI0C 1YIJQ 5I2SA 1VYUA 1Y0MA 2EIFA 4ZGDB 1FWZA 4GLKA 4N0AA 4X34A 4PJMA 3EGXB 3OS1A 4E7SA 3CC4Q 2CSIA 3RBBB 1VQNA 2CP7A 2HZYA 1M90U 2DXCA 3A8HB 2EYQA 5GANe 5L8RE 1TUGB 1N8RU 2AHJB 2CP0A 2SRCA 2CYZB 2CSQA 1AHJB 2FZGB 1UGRB 4A4HA 1OOTA 3UF4A 1MGQA 1I0CA 5FU6C 2O9SA 4M7DD 3EG9A 4BE1A 1YN8A 1I1JA 3OB9A 4J6YA 5GANg 4KUIA 2V8IA 4LDWA 3X28B 1H92A 2JM9A 5FWBA 1UJ0A 1N8RC 2MIOA 1XTDA 1K73R 1OPLA 4L59A 4C92E 5KYUA 4PJOB 4BDYA 4HA8A 1VQPA 3I56A 5GMKm 2CS7A 1KIKA 4X1VA 3A5ZB 3GNFB 2RQUA 2QEXQ 3CCQT 1D0YA 2P0KA 2RHYA 5GAOr 1VQ4A 3E2UA 1QVFP 3QXEB 4PFPA 2LJ0A 2DVEA 3J81E 2DPPB 1E6HA 1KHCA 3RNJA 2E3IA 4AFSC 4C92G 5GAMe 1ABQA 3M0UA 1VOMA 3A8MB 1YJWA 1FMKA 3QWXX 2GGRA 4HKEA 1VQNQ 3OYEA 3QKJA 3ZL7C 1M8MA 2YLBA 1M2OA 1NYFA 3M55A 2GQVA 2RHUA 1K1ZA 4J7FA 1B3QA 1MNDA 1OQKA 4OB0B 1UG1A 2BE9B 4IURA 1YFNA 2ZPFB 1N27A 3KFVA 3CMAT 2ESWA 3ZFJA 5LJ3d 3WVEB 1AZEA 2JW4A 1QVGA 1VQPQ 4Y92A 3I56Q 1KHIA 2CP3A 2KVQG 3X25B 1K9AA 2DILA 1VQ4Q 2X3WD 2J6FA 2K5IA 4JRPA 1QCNA 3P8HA 1YJ9T 1QKWA 2E5KA 2KBTA 2JS2A 1YJWQ 2X4YA 4FSSA 1ZSZA 4FU6A 5FU7B 1JRIA 4XU1A 2RQRA 2F2VA 5DM7R 3HHTB 1M5Q1 2XDDA 4LD9K 3OW2P 2XDPA 2RI5A 2DK3A 2VUBA 2RJEA 2DD5A 2FZKB 4GLMA 2R5AA 2KSSA 1FXXA 1B34A 5KH6A 3HFNA 3OYFA 1W70A 1W2BS 4A4EA 3QUIA 3KBGA 1DJ7B 2JTFA 4D6WA 4DEYA 3LX7A 1CSKA 3NPFA 4FIBA 2DBMA 3CC2T 1EZZB 2A37A 2JM8A 1ZA2B 4J5YA 2L0AA 4OVAA 2EGEA 2HEQA 1VQ8A 2RI3A 2GTOA 1UEBA 4EMKA 2I0NA 1MMNA 2LC4A 3PTAA 3G4ST 2ZGWA 3GPLA 1PD0A 1LPLA 3OYCA 3EH1A 2PTKA 2O4XA 2RM4A 3CCVA 2M16A 2DA9A 2QTXA 3RKXA 3VKIA 2DJQA 3DB3A 1UUEA 1YHQT 3EG9B 4AMCA 1PWTA 3JCMb 4C92B 2AZSA 2O2OA 2G3RA 4DOVA 2PVDB 3OYMA 2LT1A 4ZNXA 4UC4A 2F5KA 3HFOA 3CXCA 1OEBA 1ACMB 5KYUB 2EYXA 2D8JA 1RADB 3M4GA 4M75C 1Q7YU 1JQQA 3PMTA 3NFCA 4M78D 2EYWA 1UTIA 1Y57A 4LE9A 2A28A 2K3BA 2EQMA 2JXBA 1TWBA 2COWA 2P0QA 5CK9A 3OA6A 3A8LB 1VQ9T 1JXOA 2LP5A 4ATOA 1SF9A 2MOXA 3OS0A 1LCKA 2IG0A 1Q7YC 3O8VA 2QGFB 3A1PA 1VQ8Q 2X4XA 2RHZA 2NUTA 3S3NA 3OYKA 3X24B 2V8KA 2BZ8A 3PMIA 4RG8A 2OAWA 3CCVQ 1UGSB 3JCMV 2PU9B 1Q82U 2CP2A 4LDXA 2QQ9A 1Z9QA 1RAIB 1VYTA 3JCMc 3URGA 1VQNT 3QZ5B 4C0DB 1YNZA 2HBPA 1KJWA 2FEIA 4IUQA 4B9WA 3VUBA 1SKUB 2EWNA 3NTIA 4RG2A 1GBRA 2KI7A 3JB9J 1VQOA 2DKGA 1ZUUA 2F69A 5GAMj 3QSUA 1V76A 3CC7T 4GBQA 2YRVA 5KYWB 1Q82C 2FG0A 4C8QA 3LH0A 1MMGA 2QQRA 4M7AA 1X2KA 2VVKA 4KH0B 2DO3A 4DOWA 1IO6A 4DBQA 2XDBA 4QW2A 2VC8A 3L2RA 2K3XA 3S6WA 1SEMA 4FT2A 3L2QA 2QDYB 4A4KA 2YUNA 1ZSZB 3CCRA 1MMDA 4FYYB 1JJ2S 4JRIA 4MZTA 3I56T 4Z8AA 1TG0A 4J9DA 2HBWA 4LD6A 3I35A 3OYJA 2NUZA 3PVLA 1VQ4T 1W6XA 2CH4A 2ZCFB 4A4GA 2EKHA 1YJNT 1B34B 4KULA 3V7CA 1M3BA 4C5GA 3VS5A 4LDVA 1H3ZA 3QYHB 2BE7D 5GAN5 4LDUA 3PVQA 4C0DC 3OW2A 3EHQA 4OB3B 3PT9A 3SD4A 1YJWT 2ABLA 3CCLT 4PJOF 1BCOA 1JU5C 5CVIA 1ZHIA 3UA7A 1KD1U 2JVVA 2FB7A 2EQKA 1PCXA 1K0SA 2K4YA 1E6GA 1HK9A 4EMKB 2DVJA 1M3CA 3FLGA 3VYGA 1VQOQ 1NLOC 3RDVA 2L3PA 1IREB 4OMOA 3TEEA 1BKBA 4NL3A 2ED1A 2EQIA 4LDYA 3VRYA 2D0QB 3LW5E 1SHGA 3SFMA 1M90R 1QVGS 1XNIA 2CZ0B 2HQHA 3VUZA 2OAUA 1VQLT 4OMPA 1N8RR 1KD1C 4E7ZA 2RH2A 4HVWA 3R6NA 3M56A 3CCUA 1QMCA 2DXTA 1UGVA 1I07A 1NPPA 2K9GA 3PFSA 4KGVB 1QW1A 2MCNA 3EG1A 3CCRQ 3JSCA 2JOYA 4J7IA 3C0CA 1UECA 5HK3A 3E9GA 4BUGA 1U06A 1Y07A 2RJFA 4Y91A 3MPUB 4HXJA 2QXFA 5GMKe 2FZCB 3MJXA 4X9CA 5AYFA 4BI8B 4JJDA 3A8OB 3JCMW 2V1RA 5CKHA 3C4SA 4N4IA 4XTUA 4PJOE 3H41A 2L8DA 1FMWA 2CUBA 2LNVA 3OMGA 3LWHA 1AEYA 2O01E 3QO3A 1QCFA 4MZPA 4KBMB 2D1XA 2NUTB 4M77A 3G6EA 2A3LA 3M4YA 5AT1B 4BY6B 3CMEA 2LT4A 2Y4YA 2JZ2A 4PJNA 2OJ2A 5L23A 4CC7A 1G3TA 2XU8A 3JV3A 2EJ9A 3HRSA 3FJ5A 4PJOG 3HPWA 3CCJT 4B6MA 1BIBA 1IHVA 2XG8D 1OZ2A 1RLPC 3ZBDA 1GCPA 1VQMT 3CCUQ 1UE9A 2O9VA 1UDLA 2O31A 1D0XA 2DEUA 1C0MA 2YDLA 1PKSA 4E7LA 3CCST 1I8FA 4HCKA 4QQDA 3QIIA 2DRMA 3QJ6A 1UFFA 1WXUA 4KRTA 2EQJA 1NEBA 4PNOA 2EPDA 4II1A 2JUFA 4DBHA 4A63B 4M7AB 1OV3A 5GAN6 5CKFA 1BI3A 2CZ7B 2X4JA 4F16A 2M9UA 3CBMA 4EMHA 1VQ7A 3ER0A 4BY6C 1QQJA 2KY9A 3HL8A 2DEQA 1OULA 2AT1B 5CKBA 1QVFS 3GF5A 6AT1B 3G6EQ 3CMEQ 4XTZA 2KQWA 2LJ1A 2WSFE 4NOYA 3M9QA 1PNJA 2BZYA 8AT1B 5LJ3j 5HK0A 2LQKA 5IN1A 3FB9A 2DETA 1VQ6A 3GIBA 1HSQA 2K57A 2MPXC 1J3TA 2DMOA 2K5FA 5I21A 2BKDN 3VV0A 4M75A 1R0BG 2HDAA 4PFOA 1KQ2A 2COYA 4M75E 4C8QC 3GLXA 3INZA 4QVCA 4M7AC 1TUDA 2YSQA 4RKUE 3VJPA 2JNGA 3P8BB 3KUFA 4HCZA 3WVDB 1U5SA 2JN0A 3OYDA 2FHDA 1SG5A 4FM4B 2GNCA 1VQKA 3QDRB 3LWIA 1NE8A 1OU9A 2VB6A 4C92D 3H9NA 1I81A 4FW1A 1FYNA 4M75G 2KK4A 2RJCA 2OTJA 1WGSA 1VQ7Q 4C0GA 5D6WA 2PVGB 1IGUA 3V8KA 2VV5A 2QQAA 2NUPA 3M5AA 5CQYA 1NBEB 3FIFA 2CDTA 2CT3A 1M90C 2RNAA 3JCMf 2VKNA 2X9HA 3FDRA 4WCIA 1ZX6A 3TSWA 2P0PA 2QA4A 5GAMh 3GNGA 4C0ZA 2HD0A 2AZVA 1Q7YR 1S1NA 1YCSB 2K2MA 3M57A 4JJBA 1UHFA 2KGTA 5GAN3 1VQ6Q 2E10A 3CCRT 1WFWA 3V7SA 4MMKA 3OW2S 2KMTA 3FC3A 4D8DA 2HKNA 1KK7A 4XTVA 1YITT 2E6NA 1Q86U 2CKKA 5FROA 1JJ2A 1G83A 4M77B 2GFAA 3EG0A 2AKLA 1TXQA 4JZ4A 3E1SA 4J9EA 2ROLA 2DF6A 3EGUA 1ZUYA 4M7DA 3V7RA 4BD3A 1A0NB 3VS7A 4FL6A 2RK2A 5IAYA 2VYTA 2LCCA 1BU1A 1D3BA 1VQKQ 4XTXA 3OY9A 3FRNA 1KSWA 1KQ1A 2P84A
chains in the Genus database with same CATH topology
2EYXA 4ESRA 2D8JA 2A36A 2EGAA 1ABOA 2J06A 4RTWA 1ZUKA 4J9IA 2ROTA 4HVUA 3EG3A 1JQQA 1MV3A 4Z89A 4JJCA 3VS6A 1WLPB 3TVTA 2EYWA 1NEGA 1UTIA 1MUZA 1Y57A 4LE9A 2RPNA 2A28A 2K3BA 2ENMA 2JXBA 1VYVA 1E7OA 2DNUA 4AFUC 2X3XD 1AWOA 2K79A 1JXOA 2LP5A 4J9CA 4J9GA 1WA7A 2MOXA 1CKAA 1LCKA 1PKTA 2KRNA 1AWWA 3CQTA 4LNPA 5IHKA 1OPKA 3VS1A 2BZ8A 3REBB 2M51A 1SSHA 2KT8A 2DL5A 1H3HA 2OAWA 2LX7A 1JO8A 2G6FX 2JT4A 4CC2A 2FRYA 1AWXA 4OMMA 1Z9QA 1VYTA 2HCKA 2O88A 1YWPA 3PE0A 2VWFA 2KEAA 1YNZA 4IIOA 1KJWA 2FEIA 3QWYA 3NHNA 1UJYA 1N5ZA 4IIMA 1GBRA 1ZUUA 2K6DA 2JS0A 2A08A 3O5ZA 2L3SA 1WXBA 1AZGB 4GBQA 1K4US 2FG0A 2RMOA 2RF0A 2EVRA 2EYZA 3M0QA 2QDLA 2LZ6B 5ECAA 2J05A 4RUGA 1RUWA 1X2KA 2VVKA 5FW9A 4DEXA 1IO6A 1PHTA 3H0FA 4QT7A 1SEMA 3EG2A 2RN8A 5IXBA 1GBQA 1GCQA 2BTTA 4AG2C 1X69A 2EYYA 2J6KA 2YUNA 1GRIA 2H8HA 4Z88A 1QWEA 1WX6A 4Z8AA 1TG0A 2KXCA 4J9DA 2HBWA 5I11A 5GJWB 2NWMA 3I35A 2M0YA 2NUZA 3PVLA 3I5SA 1W6XA 2CH4A 2EKHA 1M3BA 1RLQC 2DLPA 4OMNA 3VS5A 4CC4B 1AD5A 3PVQA 5EC7A 2DYBA 1X43A 2FRWA 4F14A 3EHQA 1CKBA 2FPDA 2ABLA 4LUDA 1JU5C 2KRMA 5IXFA 2FO0A 3UA7A 3THKA 2ED0A 2KE9A 1K0SA 1E6GA 2SEMA 2DVJA 1YP5A 1M3CA 1NLOC 3I5RA 2L3PA 4RTZA 4OMOA 1BBZA 2ED1A 2KT1A 2XMFA 5IHNA 5GJVB 2EQIA 3VRYA 1YWOA 5IH2A 1SHGA 1X6GA 2PNIA 2DRKA 1UHCA 2W0ZA 4OMPA 1WI7A 3M0RA 2P4RA 4HVWA 3R6NA 2EGCA 1H8KA 1NM7A 3TSZA 1UGVA 1I07A 1B07A 2YUQA 2K9GA 1MV0B 3M0SA 2MCNA 1T3SA 3EG1A 1QWFA 1NG2A 4D8KA 4HVVA 1VA7A 3C0CA 1UECA 1SRMA 1X6BA 2J6OA 4RTVA 2KYBA 1U06A 3ULRB 1ARKA 1VYUA 1Y0MA 4HXJA 2YUPA 2FPEA 1T3LA 5FWCA 1K76A 4JJDA 2CSIA 2LQWA 2BZXA 2C0TA 3RBBB 2V1RA 1SHFA 2CREA 1G2BA 4ORZA 3H41A 5I22A 1V1CA 1U3OA 1W1FA 5IHIA 2CUBA 1AEYA 2AK5A 3VS4A 1QCFA 2SRCA 2CSQA 2KYMA 2D1XA 2CT4A 1JEGA 4LUEA 2F2XA 1HD3A 3IQLA 2V1QA 1OOTA 3UF4A 1HJDA 2OJ2A 5L23A 4CC7A 1I0CA 2O9SA 2W10A 4LN2A 3JV3A 2C0OA 4OMQA 2GTJA 3FJ5A 3I9QA 1YN8A 2LMJA 1I1JA 2LCSA 1H92A 2JM9A 5FWBA 1RLPC 1UJ0A 1GCPA 2MIOA 1OPLA 1UE9A 2O9VA 1UDLA 2O31A 2YDLA 1WIEA 3A98A 1KIKA 1PKSA 3SHWA 4X1VA 1EFNA 2L3QA 2RQUA 4HCKA 1ZBJA 2DRMA 1UFFA 1WXUA 3H0IA 4KRTA 4E6RA 1RI9A 2LJ0A 3U23A 2JTEA 1E6HA 1NEBA 2EPDA 2DL3A 3UATA 4AG1C 4A63B 3RNJA 4AFSC 1ABQA 3M0UA 1OV3A 1FMKA 3QWXX 2GGRA 4J9BA 2YUOA 4F16A 2DE0X 3ZL7C 1SPKA 1M8MA 4AFZC 2B86A 1NYFA 2GBQA 2D8HA 1JXMA 2F2WA 3GBQA 2DL7A 1K1ZA 1KFZA 1B3QA 3REAB 2KROA 2LJ1A 1UG1A 2D0NA 1PRMC 1Z9ZA 4RTXA 1K0XA 1PNJA 2BZYA 2LQNA 2DBKA 2LNHB 1AVZC 5HCKA 4OMLA 1BK2A 4CC3A 1HSQA 1J3TA 1TUCA 3VS2A 2DMOA 3KFVA 2ESWA 2K7AA 2LJ3A 1AZEA 2JW4A 2AKKA 4Y92A 1WXTA 3UA6A 1SRLA 3H0HA 1M3AA 2HDAA 1K9AA 2DILA 1GL5A 2KRSA 2X3WD 2DM1A 2J6FA 1TUDA 1GFDA 2YSQA 2RQWA 1PRLC 2EBPA 2HSPA 1U5SA 1QKWA 2E5KA 2KBTA 2C0IA 1X2QA 3EHRA 2JS2A 1AWJA 1NLPC 2GNCA 1GCQC 2YT6A 2JMAA 4FSSA 3NMZC 2KNBB 2DL4A 2IIMA 3VRZA 2RQRA 1AOJA 2F2VA 1ZSGA 2RQTA 1FYNA 4K11A 3VS3A 1ZLMA 4GLMA 2GQIA 2L2PA 2DL8A 2OI3A 1W70A 4M4ZA 2CDTA 1WYXA 2CT3A 2RNAA 1BB9A 3TSWA 2VKNA 4WCIA 4RTUA 1ZX6A 4F17A 4DEYA 1CSKA 3NPFA 2EW3A 4R0KA 2DBMA 2AZVA 2J7IA 2A37A 2JM8A 1S1NA 2L0AA 1YCSB 2K2MA 1WDXA 2EGEA 2JMCA 3VS0A 2HEQA 1UHFA 4JJBA 2KGTA 2CH4W 2GTOA 4J9HA 1T0HA 1WFWA 2CUDA 4JPBW 4EIKA 1X27A 2I0NA 3M0PA 3LH5A 2KXDA 4RTTA 4D8DA 3NGPA 1T0JA 4AFQC 2RQVA 1NYGA 1M27C 3SEMA 2PTKA 1M30A 1G83A 2KR3A 3EG0A 4JZ3A 2AKLA 4JZ4A 1QKXA 3M0TA 4J9EA 1GFCA 2DA9A 1QLYA 2DF6A 2ROLA 3EGUA 1ZUYA 2PZ1A 2ECZA 2DJQA 1A0NB 1UUEA 3VS7A 1XOVA 1PWTA 2DX1A 1BU1A 2FPFA 4RTYA 2AZSA 2O2OA 4J9FA 1KSWA 4ZNXA 1OEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYX A;  4ESR A;  2D8J A;  2A36 A;  2EGA A;  1ABO A;  2J06 A;  4RTW A;  1ZUK A;  4J9I A;  2ROT A;  4HVU A;  3EG3 A;  1JQQ A;  1MV3 A;  4Z89 A;  4JJC A;  3VS6 A;  1WLP B;  3TVT A;  2EYW A;  1NEG A;  1UTI A;  1MUZ A;  1Y57 A;  4LE9 A;  2RPN A;  2A28 A;  2K3B A;  2ENM A;  2JXB A;  1VYV A;  1E7O A;  2DNU A;  4AFU C;  2X3X D;  1AWO A;  2K79 A;  1JXO A;  2LP5 A;  4J9C A;  4J9G A;  1WA7 A;  2MOX A;  1CKA A;  1LCK A;  1PKT A;  2KRN A;  1AWW A;  3CQT A;  4LNP A;  5IHK A;  1OPK A;  3VS1 A;  2BZ8 A;  3REB B;  2M51 A;  1SSH A;  2KT8 A;  2DL5 A;  1H3H A;  2OAW A;  2LX7 A;  1JO8 A;  2G6F X;  2JT4 A;  4CC2 A;  2FRY A;  1AWX A;  4OMM A;  1Z9Q A;  1VYT A;  2HCK A;  2O88 A;  1YWP A;  3PE0 A;  2VWF A;  2KEA A;  1YNZ A;  4IIO A;  1KJW A;  2FEI A;  3QWY A;  3NHN A;  1UJY A;  1N5Z A;  4IIM A;  1GBR A;  1ZUU A;  2K6D A;  2JS0 A;  2A08 A;  3O5Z A;  2L3S A;  1WXB A;  1AZG B;  4GBQ A;  1K4U S;  2FG0 A;  2RMO A;  2RF0 A;  2EVR A;  2EYZ A;  3M0Q A;  2QDL A;  2LZ6 B;  5ECA A;  2J05 A;  4RUG A;  1RUW A;  1X2K A;  2VVK A;  5FW9 A;  4DEX A;  1IO6 A;  1PHT A;  3H0F A;  4QT7 A;  1SEM A;  3EG2 A;  2RN8 A;  5IXB A;  1GBQ A;  1GCQ A;  2BTT A;  4AG2 C;  1X69 A;  2EYY A;  2J6K A;  2YUN A;  1GRI A;  2H8H A;  4Z88 A;  1QWE A;  1WX6 A;  4Z8A A;  1TG0 A;  2KXC A;  4J9D A;  2HBW A;  5I11 A;  5GJW B;  2NWM A;  3I35 A;  2M0Y A;  2NUZ A;  3PVL A;  3I5S A;  1W6X A;  2CH4 A;  2EKH A;  1M3B A;  1RLQ C;  2DLP A;  4OMN A;  3VS5 A;  4CC4 B;  1AD5 A;  3PVQ A;  5EC7 A;  2DYB A;  1X43 A;  2FRW A;  4F14 A;  3EHQ A;  1CKB A;  2FPD A;  2ABL A;  4LUD A;  1JU5 C;  2KRM A;  5IXF A;  2FO0 A;  3UA7 A;  3THK A;  2ED0 A;  2KE9 A;  1K0S A;  1E6G A;  2SEM A;  2DVJ A;  1YP5 A;  1M3C A;  1NLO C;  3I5R A;  2L3P A;  4RTZ A;  4OMO A;  1BBZ A;  2ED1 A;  2KT1 A;  2XMF A;  5IHN A;  5GJV B;  2EQI A;  3VRY A;  1YWO A;  5IH2 A;  1SHG A;  1X6G A;  2PNI A;  2DRK A;  1UHC A;  2W0Z A;  4OMP A;  1WI7 A;  3M0R A;  2P4R A;  4HVW A;  3R6N A;  2EGC A;  1H8K A;  1NM7 A;  3TSZ A;  1UGV A;  1I07 A;  1B07 A;  2YUQ A;  2K9G A;  1MV0 B;  3M0S A;  2MCN A;  1T3S A;  3EG1 A;  1QWF A;  1NG2 A;  4D8K A;  4HVV A;  1VA7 A;  3C0C A;  1UEC A;  1SRM A;  1X6B A;  2J6O A;  4RTV A;  2KYB A;  1U06 A;  3ULR B;  1ARK A;  1VYU A;  1Y0M A;  4HXJ A;  2YUP A;  2FPE A;  1T3L A;  5FWC A;  1K76 A;  4JJD A;  2CSI A;  2LQW A;  2BZX A;  2C0T A;  3RBB B;  2V1R A;  1SHF A;  2CRE A;  1G2B A;  4ORZ A;  3H41 A;  5I22 A;  1V1C A;  1U3O A;  1W1F A;  5IHI A;  2CUB A;  1AEY A;  2AK5 A;  3VS4 A;  1QCF A;  2SRC A;  2CSQ A;  2KYM A;  2D1X A;  2CT4 A;  1JEG A;  4LUE A;  2F2X A;  1HD3 A;  3IQL A;  2V1Q A;  1OOT A;  3UF4 A;  1HJD A;  2OJ2 A;  5L23 A;  4CC7 A;  1I0C A;  2O9S A;  2W10 A;  4LN2 A;  3JV3 A;  2C0O A;  4OMQ A;  2GTJ A;  3FJ5 A;  3I9Q A;  1YN8 A;  2LMJ A;  1I1J A;  2LCS A;  1H92 A;  2JM9 A;  5FWB A;  1RLP C;  1UJ0 A;  1GCP A;  2MIO A;  1OPL A;  1UE9 A;  2O9V A;  1UDL A;  2O31 A;  2YDL A;  1WIE A;  3A98 A;  1KIK A;  1PKS A;  3SHW A;  4X1V A;  1EFN A;  2L3Q A;  2RQU A;  4HCK A;  1ZBJ A;  2DRM A;  1UFF A;  1WXU A;  3H0I A;  4KRT A;  4E6R A;  1RI9 A;  2LJ0 A;  3U23 A;  2JTE A;  1E6H A;  1NEB A;  2EPD A;  2DL3 A;  3UAT A;  4AG1 C;  4A63 B;  3RNJ A;  4AFS C;  1ABQ A;  3M0U A;  1OV3 A;  1FMK A;  3QWX X;  2GGR A;  4J9B A;  2YUO A;  4F16 A;  2DE0 X;  3ZL7 C;  1SPK A;  1M8M A;  4AFZ C;  2B86 A;  1NYF A;  2GBQ A;  2D8H A;  1JXM A;  2F2W A;  3GBQ A;  2DL7 A;  1K1Z A;  1KFZ A;  1B3Q A;  3REA B;  2KRO A;  2LJ1 A;  1UG1 A;  2D0N A;  1PRM C;  1Z9Z A;  4RTX A;  1K0X A;  1PNJ A;  2BZY A;  2LQN A;  2DBK A;  2LNH B;  1AVZ C;  5HCK A;  4OML A;  1BK2 A;  4CC3 A;  1HSQ A;  1J3T A;  1TUC A;  3VS2 A;  2DMO A;  3KFV A;  2ESW A;  2K7A A;  2LJ3 A;  1AZE A;  2JW4 A;  2AKK A;  4Y92 A;  1WXT A;  3UA6 A;  1SRL A;  3H0H A;  1M3A A;  2HDA A;  1K9A A;  2DIL A;  1GL5 A;  2KRS A;  2X3W D;  2DM1 A;  2J6F A;  1TUD A;  1GFD A;  2YSQ A;  2RQW A;  1PRL C;  2EBP A;  2HSP A;  1U5S A;  1QKW A;  2E5K A;  2KBT A;  2C0I A;  1X2Q A;  3EHR A;  2JS2 A;  1AWJ A;  1NLP C;  2GNC A;  1GCQ C;  2YT6 A;  2JMA A;  4FSS A;  3NMZ C;  2KNB B;  2DL4 A;  2IIM A;  3VRZ A;  2RQR A;  1AOJ A;  2F2V A;  1ZSG A;  2RQT A;  1FYN A;  4K11 A;  3VS3 A;  1ZLM A;  4GLM A;  2GQI A;  2L2P A;  2DL8 A;  2OI3 A;  1W70 A;  4M4Z A;  2CDT A;  1WYX A;  2CT3 A;  2RNA A;  1BB9 A;  3TSW A;  2VKN A;  4WCI A;  4RTU A;  1ZX6 A;  4F17 A;  4DEY A;  1CSK A;  3NPF A;  2EW3 A;  4R0K A;  2DBM A;  2AZV A;  2J7I A;  2A37 A;  2JM8 A;  1S1N A;  2L0A A;  1YCS B;  2K2M A;  1WDX A;  2EGE A;  2JMC A;  3VS0 A;  2HEQ A;  1UHF A;  4JJB A;  2KGT A;  2CH4 W;  2GTO A;  4J9H A;  1T0H A;  1WFW A;  2CUD A;  4JPB W;  4EIK A;  1X27 A;  2I0N A;  3M0P A;  3LH5 A;  2KXD A;  4RTT A;  4D8D A;  3NGP A;  1T0J A;  4AFQ C;  2RQV A;  1NYG A;  1M27 C;  3SEM A;  2PTK A;  1M30 A;  1G83 A;  2KR3 A;  3EG0 A;  4JZ3 A;  2AKL A;  4JZ4 A;  1QKX A;  3M0T A;  4J9E A;  1GFC A;  2DA9 A;  1QLY A;  2DF6 A;  2ROL A;  3EGU A;  1ZUY A;  2PZ1 A;  2ECZ A;  2DJQ A;  1A0N B;  1UUE A;  3VS7 A;  1XOV A;  1PWT A;  2DX1 A;  1BU1 A;  2FPF A;  4RTY A;  2AZS A;  2O2O A;  4J9F A;  1KSW A;  4ZNX A;  1OEB A; 
#chains in the Genus database with same CATH topology
 1Q86 C;  2L89 A;  5GMK j;  3A8G B;  4ESR A;  4OF1 A;  5DLQ E;  1Q82 R;  3OYB A;  5GAM g;  2J06 A;  4RTW A;  2OTJ Q;  4J9I A;  2ROT A;  3EG3 A;  1M2V A;  2L3R A;  3VS6 A;  1WLP B;  1Y71 A;  1C6V X;  1NEG A;  4IUU A;  2Y90 A;  5D6X A;  4BB7 A;  1RL2 A;  2RPN A;  2ENM A;  1VYV A;  1VQ5 T;  2QA4 Q;  1WQW A;  2E70 A;  4AFU C;  2X3X D;  3JCM P;  1AWO A;  2WSC E;  2K79 A;  3CCU T;  1YI2 T;  5GAO p;  2VGM A;  3UDC A;  5CKD A;  1I5L A;  2MWP A;  3CQT A;  3ZEH A;  1KQS P;  4M77 C;  2DXB A;  2E1H A;  2E6Z A;  2M51 A;  1SSH A;  2HQX A;  3I55 A;  4QKU A;  1H3H A;  3OYN A;  1WHH A;  3L1A A;  2G6F X;  2FRY A;  4ZTJ A;  1M4Z A;  2HCK A;  2O88 A;  1RAC B;  3PE0 A;  3HRT A;  2VWF A;  2KEA A;  4C5E A;  3OS5 A;  3QWY A;  1M1K U;  3NHN A;  1N5Z A;  5CO7 A;  4IIM A;  2A0F B;  1WJQ A;  3MP1 A;  2EAY A;  2QQS A;  4CRI A;  4M75 B;  2L3S A;  3AT1 B;  1YBY A;  1AZG B;  1K4U S;  3PIP A;  3OQ5 A;  1QP2 A;  2EYZ A;  3M0Q A;  1WZO A;  1BIA A;  1QCO A;  1KD1 R;  2J05 A;  2EJF A;  5FW9 A;  4DEX A;  3CD6 A;  3AHU A;  1M1K C;  4C5H A;  4XTY A;  3BW1 A;  3EG2 A;  2A7Y A;  4TVR A;  1G5V A;  1GBQ A;  1PD1 A;  1WPY A;  4J8O A;  2J6K A;  1GRI A;  5GAN 8;  1WX6 A;  1YIJ T;  4PJL A;  1U8R A;  2FL7 A;  2KXC A;  1BI2 A;  3MP6 A;  5I11 A;  5GJW B;  2YHT A;  3TQ7 P;  2M0Y A;  4PJJ A;  4NL2 A;  3I5S A;  2MMP A;  2NUP B;  3CC4 T;  3OSS C;  3I55 Q;  4OMN A;  3LYI A;  1LOJ A;  4A54 A;  4C0F A;  3EH2 A;  3OBY A;  5EC7 A;  5GAO l;  3RMQ A;  3LGL A;  1CKB A;  4OMF B;  4E7I A;  2C06 A;  4LUD A;  1UB4 A;  4F7U A;  4JS5 A;  5KE2 A;  2ZPI B;  5IXF A;  2FO0 A;  3NTH A;  3MCA B;  2ED0 A;  2KE9 A;  4RCC A;  4F7U E;  2CP6 A;  1UGQ B;  1R0C B;  4MDX A;  3LGF A;  3OYH A;  3JCM d;  1IB8 A;  4C8Q F;  2KT1 A;  4HCC A;  1G3Y A;  5GJV B;  4M7A F;  1S72 A;  1PC0 A;  1X6G A;  3EAE A;  2PNI A;  2W0Z A;  1UHC A;  2HNI A;  3RMS A;  1N6A A;  2EQU A;  1WI7 A;  1QVF A;  3E9F A;  3CD6 Q;  4M7D B;  2VAS A;  4F7U G;  1NM7 A;  4FYX B;  2QEX T;  4WF2 A;  1D3B B;  4YTL A;  1MV0 B;  4XU2 A;  5LJ3 h;  3G71 A;  3MEV A;  5A2Q E;  1M1G A;  1UGP B;  3EFS A;  4E7J A;  2J6O A;  4RTV A;  3LLR A;  4O6J A;  1JBM A;  4M78 A;  2P4T A;  1Y7X A;  1Q81 R;  4OB1 B;  3N5B B;  4E47 A;  3M53 A;  4A4F A;  5KYN A;  1G2B A;  5LJ3 e;  4Y28 E;  1U3O A;  1W1F A;  2KDS A;  2OTJ T;  4KH1 B;  2KYM A;  4LUE A;  5GMK i;  1IRX A;  1HD3 A;  4JJN K;  3IQL A;  1HJD A;  4C8Q E;  4M7D C;  2W10 A;  3QHS A;  4LN2 A;  2OTL A;  1S72 Q;  4M7A E;  2GTJ A;  3JB9 F;  3I9Q A;  5HY6 A;  4ANJ A;  2LMJ A;  1KQS A;  5LJ3 g;  2LCS A;  5KCO A;  1BCM A;  1TSF A;  1VQP T;  3PGG A;  3R6O A;  3OMC A;  1WIE A;  1K9M U;  1M9S A;  3A98 A;  1I4K 1;  1EFN A;  3OYL A;  3G71 Q;  4C8Q G;  1ZBJ A;  4M7A G;  1WHL A;  4XTW A;  3M59 A;  4E6R A;  3CCQ A;  1BI1 A;  2CZ1 B;  2DL3 A;  3EFO A;  5CQX A;  5EG2 A;  4DBR A;  2DD4 A;  1NJI U;  3EGD A;  2YUO A;  1K9M C;  3V8J A;  4AFZ C;  2GBQ A;  1JXM A;  4EMG A;  3GBQ A;  2YLC A;  1KFZ A;  4M77 F;  2O4X B;  1LJO A;  1X01 A;  1R77 A;  1Y96 A;  3QYG B;  3P8D A;  5C0M A;  4KGZ B;  3RES A;  4DBF A;  5GMK h;  1NJI C;  1PRM C;  3MET A;  2DXU A;  2QGG A;  3CCE A;  2MWO A;  1K0X A;  4FYV B;  2OTL Q;  2LQN A;  4HCB A;  2DBK A;  1AVZ C;  5HCK A;  2LVM A;  4OML A;  4MDW A;  1OX8 A;  1BK2 A;  2MI6 A;  5CAI A;  4PJO D;  4OGC A;  1TUC A;  3VS2 A;  3WXM B;  3C95 A;  4F7U B;  2KAF A;  4IUT A;  3GOX A;  5KE3 A;  2LJ3 A;  1WXT A;  1SRL A;  3CMA A;  3H0H A;  2GFU A;  4PLI A;  2HKQ B;  2ZPE B;  3SWN C;  4N4H A;  3I55 T;  2KRS A;  2D9T A;  3JCM e;  4JLG A;  3JB9 G;  4IUV A;  3ASK A;  3CCQ Q;  1GFD A;  2RQW A;  1WHK A;  2HSP A;  3QPH A;  2RJD A;  2X51 A;  5M9O A;  3EHR A;  5CKE A;  3NMZ C;  1Q86 R;  2KNB B;  2DL4 A;  2IIM A;  4R56 A;  1U1T A;  3MHX A;  1AOJ A;  2RQT A;  1ZSG A;  3C12 A;  3JCM X;  4K11 A;  1WJS A;  3UT1 A;  2M0O A;  3JCM g;  2L2P A;  5GAO n;  1RAE B;  4M77 E;  1G3S A;  3OYA A;  2DIG A;  1RAH B;  1OZ3 A;  3CPW P;  4F17 A;  3JAM E;  3HKS A;  4M78 B;  4PKC C;  3CCE Q;  4HT9 A;  3Q1J A;  2EW3 A;  4R0K A;  1VQ8 T;  4BI3 A;  3DLL A;  4Z02 A;  1FX7 A;  2K3Y A;  2JMC A;  3VS0 A;  1NPR A;  3CC2 A;  2M02 A;  1Q81 U;  2CH4 W;  1WHM A;  4JPB W;  4M75 F;  3M0P A;  4M77 G;  3LH5 A;  2DZC A;  4ELY C;  3L2Z A;  4WTO B;  5GAN 4;  3NGP A;  3CCV T;  2XIC A;  2QYZ A;  4AFQ C;  1RAA B;  3CMA Q;  4L5G A;  3SEM A;  2DAQ A;  3G4S A;  4C8Q B;  3H6Z A;  4JZ3 A;  3E19 A;  1QKX A;  3M0T A;  2ZPG B;  1QLY A;  2PZ1 A;  2XID A;  2HL5 C;  1K8A U;  4X9D A;  1Q81 C;  1O75 A;  1XOV A;  2ZZD A;  2DX1 A;  1QVG P;  3FJP A;  2ZAE A;  2FPF A;  4RTY A;  4J9F A;  1YHQ A;  4E7H A;  2Z0W A;  4E2F B;  1HXD A;  3L2W A;  2QK0 A;  1G8X A;  1ABO A;  5FLX E;  4M75 D;  5GAN 2;  4HVU A;  1MV3 A;  4M78 C;  2VGN A;  1WHJ A;  3TVT A;  4OB2 B;  1M1K R;  1P92 A;  3QG1 A;  2QAZ A;  2RK1 A;  3DKM A;  1E7O A;  1N9R A;  2EJG A;  4VUB A;  1MNE A;  3OBW A;  2RHI A;  2DFU A;  1WA7 A;  2R5M A;  2R58 A;  3EGD B;  1CKA A;  1VQ9 A;  5C6S A;  2RA2 A;  3CC2 Q;  2CP5 A;  2K5L A;  3VS1 A;  1VIE A;  2DER A;  4FT4 A;  2M1H A;  1LVK A;  2KT8 A;  2Y4X A;  3QZ9 B;  2DL5 A;  3G4S Q;  1Y96 B;  4M7D F;  1R8O B;  2E5Q A;  4XQ3 A;  2OX7 A;  3CBO A;  4XAX B;  1AWX A;  4OMM A;  2H3J A;  4J6X A;  1KG1 A;  4ZN3 A;  4ZGJ B;  1VQO T;  4XK8 E;  3RIR A;  1YHQ Q;  1KQS S;  2K6D A;  8ATC B;  1KC8 U;  2JS0 A;  3O5Z A;  1TOV A;  1PM3 A;  5FRM A;  3CC7 A;  4C5I A;  1XJW B;  2LZ6 B;  4RUG A;  3J80 E;  2OTL T;  4V2S A;  3H0F A;  1BI0 A;  3CXC P;  3G1J A;  5J26 A;  3CCM A;  5A0L A;  2YWW A;  1GCQ A;  2BTT A;  2CZ6 B;  4C92 A;  2IPO B;  4AG2 C;  1KC8 C;  1VQ9 Q;  1QWE A;  5LJ5 f;  1NZ9 A;  2HAX A;  1X6O A;  3OYY A;  2NWM A;  5KYX A;  1TU0 B;  5GAN 7;  9ATC B;  2FVU A;  4FCY A;  2EKO A;  4PK4 A;  1AD5 A;  2COZ A;  1X43 A;  1YJN A;  4M7D E;  2FRW A;  1OX9 A;  4MML A;  4ZGE B;  3ME9 A;  3CBP A;  4KGX B;  3QBY A;  3CEY A;  3MO8 A;  3J7A F;  3CPW A;  3CCL A;  3EFR A;  1G3W A;  2CGH A;  2VXF A;  4ZTF A;  1WQ7 A;  2XK0 A;  3I5R A;  4RTZ A;  4XU0 A;  1GXI E;  3FEO A;  4M7D G;  2XMF A;  2AIR B;  3S3M A;  1YWO A;  5IH2 A;  3CCE T;  2DRK A;  3CC7 Q;  2XKO C;  3M0R A;  2MF2 A;  3MEW A;  2P4R A;  5LJ5 j;  2JTM A;  2EGC A;  1VQL A;  1H8K A;  2DTH A;  2QG9 B;  3C94 A;  3CCM Q;  3TSZ A;  4IKF A;  3H8Z A;  1IXD A;  2QTV A;  4PJO C;  4A53 A;  1PG5 B;  3M0S A;  2X4W A;  3VYH B;  1QWF A;  4D8K A;  4HVV A;  1VA7 A;  4EDU A;  2V26 A;  3DLM A;  1IHW A;  3S3O A;  1X6B A;  2KYB A;  3VU3 C;  2HSE B;  2HQE A;  2LTO A;  5KYW A;  1WHG A;  1H64 1;  2H3E B;  2YUP A;  2VXE A;  3OYG A;  2MYS A;  2FPE A;  4BDZ A;  1T3L A;  1OYX A;  5FWC A;  1K76 A;  2HMA A;  1Q95 G;  2E3H A;  1K9M R;  2LQW A;  1YJN Q;  2BZX A;  1QP3 A;  2C0T A;  4IUP A;  4F7U F;  1SHF A;  5D7U A;  2CRE A;  1VUB A;  3SB2 A;  4ORZ A;  5I22 A;  5KYY A;  1V1C A;  5IHI A;  3G6E T;  3CCL Q;  4LXC A;  3CME T;  2AK5 A;  3VS4 A;  3SWN A;  2ATC B;  3GP8 A;  1NJI R;  2CT4 A;  1JEG A;  2F2X A;  2MAM A;  3HTR A;  3OS2 A;  2V1Q A;  1RAF B;  3RKW A;  1PSE A;  2C0O A;  4OMQ A;  4OP0 A;  2NLU A;  1F1B B;  3CCJ A;  2DZ9 A;  5J3B A;  1VQL Q;  2PVO B;  4PLL A;  4DQ2 A;  5GAN f;  2K2V A;  1VQM A;  1W4S A;  2LDM A;  3SHW A;  2L3Q A;  2XI9 A;  4FW2 A;  3H0I A;  3CCS A;  3JCM J;  4M78 F;  1RI9 A;  3U23 A;  2RHX A;  2JTE A;  2L5Q A;  1OI1 A;  3UAT A;  4RCB A;  3PNW C;  4QQG A;  4AG1 C;  1I5O B;  1U1S A;  2V8J A;  1MMA A;  4JLI A;  4J9B A;  5I2M A;  2DE0 X;  1VQ7 T;  5FU7 C;  1SPK A;  2B86 A;  2D8H A;  2F2W A;  2DL7 A;  2E41 A;  3REA B;  2KRO A;  2E4H A;  2D6F A;  2WSE E;  1K73 U;  1MHN A;  3HRU A;  2ZPH B;  5D6Y A;  5KYX B;  2D0N A;  1Z9Z A;  4RTX A;  3MEA A;  2DIQ A;  2DTO A;  4N0A C;  1VQ6 T;  2LNH B;  2MK5 A;  5GAN j;  2DTI A;  5GAM f;  1OU8 A;  4CC3 A;  2F5T X;  5LJ5 d;  1RAB B;  3CCJ Q;  3X26 B;  3TRE A;  2GCX A;  2K7A A;  3T9N A;  4EPC A;  1K73 C;  2AKK A;  3UA6 A;  1VQM Q;  2RD1 A;  1M3A A;  1M2V B;  4OGE A;  1GL5 A;  1W2B P;  4C8Q D;  4KUD K;  1N9S A;  2DM1 A;  3CCS Q;  1WJR A;  4M78 E;  4M7A D;  1VQK T;  1PRL C;  2EBP A;  4J6W A;  3HP9 A;  2DJZ A;  2C0I A;  1X2Q A;  1AWJ A;  1NLP C;  1PSF A;  1GCQ C;  2YT6 A;  2JMA A;  4C92 C;  2YXY A;  3VRZ A;  1D09 B;  4PL6 A;  2PUK B;  5CCA A;  3VS3 A;  3QDF A;  3NTK A;  1K8A R;  1ZLM A;  2GQI A;  1C1A A;  4M78 G;  4JS4 A;  2DL8 A;  3RR6 A;  1ZQ1 A;  2IVW A;  2OI3 A;  1O9S A;  4M4Z A;  2QA4 T;  1X75 C;  3F70 A;  5DY9 A;  1WYX A;  3L42 A;  1BB9 A;  3JB9 H;  4RTU A;  4BE2 A;  3HSB A;  2J7I A;  3CCM T;  1SSF A;  1WDX A;  1V29 B;  2QI2 A;  1EIF A;  4EIK A;  4J9H A;  1T0H A;  2CUD A;  3PIO A;  1VIF A;  4FYW B;  1X27 A;  2PQW A;  4DA4 A;  4ZN1 A;  2KXD A;  3M54 A;  5KYY B;  4RTT A;  3D7S B;  1T0J A;  2RQV A;  3BDU A;  5A0D A;  1NYG A;  4BE0 A;  1M27 C;  3SWN B;  2X35 A;  1M30 A;  2KR3 A;  3CPW S;  1YIT A;  1GFC A;  4ELZ C;  4R55 A;  2ECZ A;  3JB9 D;  1ZA1 B;  4JRK A;  1AT1 B;  4L6V 5;  4Q5W A;  3RUX A;  3G7Z A;  3JCM Q;  2A36 A;  2EGA A;  1ZUK A;  5A0G A;  4QQ6 A;  2B8A A;  3JCM h;  4Z89 A;  4JJC A;  4E7K A;  4KT0 E;  3EGX A;  1XQH A;  2E65 A;  2DYI A;  1MUZ A;  2E12 A;  1D1C A;  2EFI A;  2DNU A;  3BY7 A;  4B9X A;  2WAC A;  1KC8 R;  5LL6 S;  4J9C A;  4J9G A;  5GAN d;  1VQ5 A;  5FRN A;  2FYK A;  1ZSZ C;  4BAC A;  5GMK l;  1PKT A;  1YI2 A;  2KRN A;  4P5N A;  1AWW A;  4LNP A;  1JB0 E;  5IHK A;  5LJ5 h;  1OPK A;  1QVP A;  2BIV A;  2GF7 A;  4M77 D;  3REB B;  3TU4 K;  2I2L A;  5CR2 A;  3BE3 A;  3RER A;  3L2V A;  2LRQ A;  4PFZ A;  2LX7 A;  1JO8 A;  1YCY A;  5GAO m;  3V8L A;  3TCJ A;  3BFM A;  2JT4 A;  4CC2 A;  5CIU A;  1YIT Q;  1YJ9 A;  1M1F A;  1LNX A;  1YWP A;  2XHC A;  1RAG B;  4IIO A;  4PJO A;  1ZBX A;  3QJY A;  1UJY A;  1RI0 A;  5LJ5 e;  3RKY A;  3JB9 I;  1JJ2 P;  4JUV A;  5HKC A;  4EMK C;  2XD0 A;  2A08 A;  4BI4 A;  4RMO A;  5DLO A;  1WXB A;  3DB4 A;  3CD6 T;  2RMO A;  2RF0 A;  7AT1 B;  2EVR A;  2HL3 A;  2QDL A;  5GAO q;  3JRZ A;  5ECA A;  5GAM d;  1RUW A;  5J39 A;  2E64 A;  1PHT A;  4QT7 A;  4JDS A;  2LCL A;  5LJ5 g;  2RN8 A;  5IXB A;  3OYI A;  2LX9 A;  4N4G A;  1D1A A;  1W2B A;  1VQ5 Q;  3MEU A;  1X69 A;  2EYY A;  1IGQ A;  4GY5 A;  4MZM A;  2H8H A;  4Z88 A;  4QVD A;  2YRD A;  1YI2 Q;  3MKD A;  5LJ3 f;  1YIJ A;  3BDL A;  1BYM A;  1RLQ C;  2DLP A;  4CC4 B;  3OSV A;  1IZ6 A;  3MP8 A;  3CC4 A;  2DYB A;  3SDZ A;  1EX4 A;  4F14 A;  2PUO B;  4FSX A;  3CXC S;  1YJ9 Q;  4ME7 A;  2FPD A;  4NS5 A;  2RB6 A;  2KRM A;  1B7T A;  3THK A;  3L2U A;  4J83 A;  2RI2 A;  2SEM A;  4HT8 A;  2LQ8 A;  5IT9 E;  1YP5 A;  1K8A C;  1FMV A;  2YRC A;  4QVZ A;  1M8V A;  1S72 T;  1TS9 A;  3KXT A;  1BBZ A;  2ZPB B;  1TH7 A;  5IHN A;  3UPU A;  3M58 A;  2QQB A;  3EFO B;  4XU3 A;  2BUD A;  4JRQ A;  2QAS A;  3UWN A;  5FU6 B;  3X20 B;  1WNL A;  5KCH A;  2RO0 A;  3CPF A;  4C92 F;  4O5V A;  1D1B A;  3G71 T;  2NYS A;  1B07 A;  1TTH B;  2YUQ A;  4AT1 B;  2F1L A;  1T3S A;  5GAN h;  2JJ9 A;  2QEX A;  1NG2 A;  2R57 A;  1D0Z A;  1SRM A;  1HYO A;  3ULR B;  1ARK A;  4F04 B;  4CI0 C;  1YIJ Q;  5I2S A;  1VYU A;  1Y0M A;  2EIF A;  4ZGD B;  1FWZ A;  4GLK A;  4N0A A;  4X34 A;  4PJM A;  3EGX B;  3OS1 A;  4E7S A;  3CC4 Q;  2CSI A;  3RBB B;  1VQN A;  2CP7 A;  2HZY A;  1M90 U;  2DXC A;  3A8H B;  2EYQ A;  5GAN e;  5L8R E;  1TUG B;  1N8R U;  2AHJ B;  2CP0 A;  2SRC A;  2CYZ B;  2CSQ A;  1AHJ B;  2FZG B;  1UGR B;  4A4H A;  1OOT A;  3UF4 A;  1MGQ A;  1I0C A;  5FU6 C;  2O9S A;  4M7D D;  3EG9 A;  4BE1 A;  1YN8 A;  1I1J A;  3OB9 A;  4J6Y A;  5GAN g;  4KUI A;  2V8I A;  4LDW A;  3X28 B;  1H92 A;  2JM9 A;  5FWB A;  1UJ0 A;  1N8R C;  2MIO A;  1XTD A;  1K73 R;  1OPL A;  4L59 A;  4C92 E;  5KYU A;  4PJO B;  4BDY A;  4HA8 A;  1VQP A;  3I56 A;  5GMK m;  2CS7 A;  1KIK A;  4X1V A;  3A5Z B;  3GNF B;  2RQU A;  2QEX Q;  3CCQ T;  1D0Y A;  2P0K A;  2RHY A;  5GAO r;  1VQ4 A;  3E2U A;  1QVF P;  3QXE B;  4PFP A;  2LJ0 A;  2DVE A;  3J81 E;  2DPP B;  1E6H A;  1KHC A;  3RNJ A;  2E3I A;  4AFS C;  4C92 G;  5GAM e;  1ABQ A;  3M0U A;  1VOM A;  3A8M B;  1YJW A;  1FMK A;  3QWX X;  2GGR A;  4HKE A;  1VQN Q;  3OYE A;  3QKJ A;  3ZL7 C;  1M8M A;  2YLB A;  1M2O A;  1NYF A;  3M55 A;  2GQV A;  2RHU A;  1K1Z A;  4J7F A;  1B3Q A;  1MND A;  1OQK A;  4OB0 B;  1UG1 A;  2BE9 B;  4IUR A;  1YFN A;  2ZPF B;  1N27 A;  3KFV A;  3CMA T;  2ESW A;  3ZFJ A;  5LJ3 d;  3WVE B;  1AZE A;  2JW4 A;  1QVG A;  1VQP Q;  4Y92 A;  3I56 Q;  1KHI A;  2CP3 A;  2KVQ G;  3X25 B;  1K9A A;  2DIL A;  1VQ4 Q;  2X3W D;  2J6F A;  2K5I A;  4JRP A;  1QCN A;  3P8H A;  1YJ9 T;  1QKW A;  2E5K A;  2KBT A;  2JS2 A;  1YJW Q;  2X4Y A;  4FSS A;  1ZSZ A;  4FU6 A;  5FU7 B;  1JRI A;  4XU1 A;  2RQR A;  2F2V A;  5DM7 R;  3HHT B;  1M5Q 1;  2XDD A;  4LD9 K;  3OW2 P;  2XDP A;  2RI5 A;  2DK3 A;  2VUB A;  2RJE A;  2DD5 A;  2FZK B;  4GLM A;  2R5A A;  2KSS A;  1FXX A;  1B34 A;  5KH6 A;  3HFN A;  3OYF A;  1W70 A;  1W2B S;  4A4E A;  3QUI A;  3KBG A;  1DJ7 B;  2JTF A;  4D6W A;  4DEY A;  3LX7 A;  1CSK A;  3NPF A;  4FIB A;  2DBM A;  3CC2 T;  1EZZ B;  2A37 A;  2JM8 A;  1ZA2 B;  4J5Y A;  2L0A A;  4OVA A;  2EGE A;  2HEQ A;  1VQ8 A;  2RI3 A;  2GTO A;  1UEB A;  4EMK A;  2I0N A;  1MMN A;  2LC4 A;  3PTA A;  3G4S T;  2ZGW A;  3GPL A;  1PD0 A;  1LPL A;  3OYC A;  3EH1 A;  2PTK A;  2O4X A;  2RM4 A;  3CCV A;  2M16 A;  2DA9 A;  2QTX A;  3RKX A;  3VKI A;  2DJQ A;  3DB3 A;  1UUE A;  1YHQ T;  3EG9 B;  4AMC A;  1PWT A;  3JCM b;  4C92 B;  2AZS A;  2O2O A;  2G3R A;  4DOV A;  2PVD B;  3OYM A;  2LT1 A;  4ZNX A;  4UC4 A;  2F5K A;  3HFO A;  3CXC A;  1OEB A;  1ACM B;  5KYU B;  2EYX A;  2D8J A;  1RAD B;  3M4G A;  4M75 C;  1Q7Y U;  1JQQ A;  3PMT A;  3NFC A;  4M78 D;  2EYW A;  1UTI A;  1Y57 A;  4LE9 A;  2A28 A;  2K3B A;  2EQM A;  2JXB A;  1TWB A;  2COW A;  2P0Q A;  5CK9 A;  3OA6 A;  3A8L B;  1VQ9 T;  1JXO A;  2LP5 A;  4ATO A;  1SF9 A;  2MOX A;  3OS0 A;  1LCK A;  2IG0 A;  1Q7Y C;  3O8V A;  2QGF B;  3A1P A;  1VQ8 Q;  2X4X A;  2RHZ A;  2NUT A;  3S3N A;  3OYK A;  3X24 B;  2V8K A;  2BZ8 A;  3PMI A;  4RG8 A;  2OAW A;  3CCV Q;  1UGS B;  3JCM V;  2PU9 B;  1Q82 U;  2CP2 A;  4LDX A;  2QQ9 A;  1Z9Q A;  1RAI B;  1VYT A;  3JCM c;  3URG A;  1VQN T;  3QZ5 B;  4C0D B;  1YNZ A;  2HBP A;  1KJW A;  2FEI A;  4IUQ A;  4B9W A;  3VUB A;  1SKU B;  2EWN A;  3NTI A;  4RG2 A;  1GBR A;  2KI7 A;  3JB9 J;  1VQO A;  2DKG A;  1ZUU A;  2F69 A;  5GAM j;  3QSU A;  1V76 A;  3CC7 T;  4GBQ A;  2YRV A;  5KYW B;  1Q82 C;  2FG0 A;  4C8Q A;  3LH0 A;  1MMG A;  2QQR A;  4M7A A;  1X2K A;  2VVK A;  4KH0 B;  2DO3 A;  4DOW A;  1IO6 A;  4DBQ A;  2XDB A;  4QW2 A;  2VC8 A;  3L2R A;  2K3X A;  3S6W A;  1SEM A;  4FT2 A;  3L2Q A;  2QDY B;  4A4K A;  2YUN A;  1ZSZ B;  3CCR A;  1MMD A;  4FYY B;  1JJ2 S;  4JRI A;  4MZT A;  3I56 T;  4Z8A A;  1TG0 A;  4J9D A;  2HBW A;  4LD6 A;  3I35 A;  3OYJ A;  2NUZ A;  3PVL A;  1VQ4 T;  1W6X A;  2CH4 A;  2ZCF B;  4A4G A;  2EKH A;  1YJN T;  1B34 B;  4KUL A;  3V7C A;  1M3B A;  4C5G A;  3VS5 A;  4LDV A;  1H3Z A;  3QYH B;  2BE7 D;  5GAN 5;  4LDU A;  3PVQ A;  4C0D C;  3OW2 A;  3EHQ A;  4OB3 B;  3PT9 A;  3SD4 A;  1YJW T;  2ABL A;  3CCL T;  4PJO F;  1BCO A;  1JU5 C;  5CVI A;  1ZHI A;  3UA7 A;  1KD1 U;  2JVV A;  2FB7 A;  2EQK A;  1PCX A;  1K0S A;  2K4Y A;  1E6G A;  1HK9 A;  4EMK B;  2DVJ A;  1M3C A;  3FLG A;  3VYG A;  1VQO Q;  1NLO C;  3RDV A;  2L3P A;  1IRE B;  4OMO A;  3TEE A;  1BKB A;  4NL3 A;  2ED1 A;  2EQI A;  4LDY A;  3VRY A;  2D0Q B;  3LW5 E;  1SHG A;  3SFM A;  1M90 R;  1QVG S;  1XNI A;  2CZ0 B;  2HQH A;  3VUZ A;  2OAU A;  1VQL T;  4OMP A;  1N8R R;  1KD1 C;  4E7Z A;  2RH2 A;  4HVW A;  3R6N A;  3M56 A;  3CCU A;  1QMC A;  2DXT A;  1UGV A;  1I07 A;  1NPP A;  2K9G A;  3PFS A;  4KGV B;  1QW1 A;  2MCN A;  3EG1 A;  3CCR Q;  3JSC A;  2JOY A;  4J7I A;  3C0C A;  1UEC A;  5HK3 A;  3E9G A;  4BUG A;  1U06 A;  1Y07 A;  2RJF A;  4Y91 A;  3MPU B;  4HXJ A;  2QXF A;  5GMK e;  2FZC B;  3MJX A;  4X9C A;  5AYF A;  4BI8 B;  4JJD A;  3A8O B;  3JCM W;  2V1R A;  5CKH A;  3C4S A;  4N4I A;  4XTU A;  4PJO E;  3H41 A;  2L8D A;  1FMW A;  2CUB A;  2LNV A;  3OMG A;  3LWH A;  1AEY A;  2O01 E;  3QO3 A;  1QCF A;  4MZP A;  4KBM B;  2D1X A;  2NUT B;  4M77 A;  3G6E A;  2A3L A;  3M4Y A;  5AT1 B;  4BY6 B;  3CME A;  2LT4 A;  2Y4Y A;  2JZ2 A;  4PJN A;  2OJ2 A;  5L23 A;  4CC7 A;  1G3T A;  2XU8 A;  3JV3 A;  2EJ9 A;  3HRS A;  3FJ5 A;  4PJO G;  3HPW A;  3CCJ T;  4B6M A;  1BIB A;  1IHV A;  2XG8 D;  1OZ2 A;  1RLP C;  3ZBD A;  1GCP A;  1VQM T;  3CCU Q;  1UE9 A;  2O9V A;  1UDL A;  2O31 A;  1D0X A;  2DEU A;  1C0M A;  2YDL A;  1PKS A;  4E7L A;  3CCS T;  1I8F A;  4HCK A;  4QQD A;  3QII A;  2DRM A;  3QJ6 A;  1UFF A;  1WXU A;  4KRT A;  2EQJ A;  1NEB A;  4PNO A;  2EPD A;  4II1 A;  2JUF A;  4DBH A;  4A63 B;  4M7A B;  1OV3 A;  5GAN 6;  5CKF A;  1BI3 A;  2CZ7 B;  2X4J A;  4F16 A;  2M9U A;  3CBM A;  4EMH A;  1VQ7 A;  3ER0 A;  4BY6 C;  1QQJ A;  2KY9 A;  3HL8 A;  2DEQ A;  1OUL A;  2AT1 B;  5CKB A;  1QVF S;  3GF5 A;  6AT1 B;  3G6E Q;  3CME Q;  4XTZ A;  2KQW A;  2LJ1 A;  2WSF E;  4NOY A;  3M9Q A;  1PNJ A;  2BZY A;  8AT1 B;  5LJ3 j;  5HK0 A;  2LQK A;  5IN1 A;  3FB9 A;  2DET A;  1VQ6 A;  3GIB A;  1HSQ A;  2K57 A;  2MPX C;  1J3T A;  2DMO A;  2K5F A;  5I21 A;  2BKD N;  3VV0 A;  4M75 A;  1R0B G;  2HDA A;  4PFO A;  1KQ2 A;  2COY A;  4M75 E;  4C8Q C;  3GLX A;  3INZ A;  4QVC A;  4M7A C;  1TUD A;  2YSQ A;  4RKU E;  3VJP A;  2JNG A;  3P8B B;  3KUF A;  4HCZ A;  3WVD B;  1U5S A;  2JN0 A;  3OYD A;  2FHD A;  1SG5 A;  4FM4 B;  2GNC A;  1VQK A;  3QDR B;  3LWI A;  1NE8 A;  1OU9 A;  2VB6 A;  4C92 D;  3H9N A;  1I81 A;  4FW1 A;  1FYN A;  4M75 G;  2KK4 A;  2RJC A;  2OTJ A;  1WGS A;  1VQ7 Q;  4C0G A;  5D6W A;  2PVG B;  1IGU A;  3V8K A;  2VV5 A;  2QQA A;  2NUP A;  3M5A A;  5CQY A;  1NBE B;  3FIF A;  2CDT A;  2CT3 A;  1M90 C;  2RNA A;  3JCM f;  2VKN A;  2X9H A;  3FDR A;  4WCI A;  1ZX6 A;  3TSW A;  2P0P A;  2QA4 A;  5GAM h;  3GNG A;  4C0Z A;  2HD0 A;  2AZV A;  1Q7Y R;  1S1N A;  1YCS B;  2K2M A;  3M57 A;  4JJB A;  1UHF A;  2KGT A;  5GAN 3;  1VQ6 Q;  2E10 A;  3CCR T;  1WFW A;  3V7S A;  4MMK A;  3OW2 S;  2KMT A;  3FC3 A;  4D8D A;  2HKN A;  1KK7 A;  4XTV A;  1YIT T;  2E6N A;  1Q86 U;  2CKK A;  5FRO A;  1JJ2 A;  1G83 A;  4M77 B;  2GFA A;  3EG0 A;  2AKL A;  1TXQ A;  4JZ4 A;  3E1S A;  4J9E A;  2ROL A;  2DF6 A;  3EGU A;  1ZUY A;  4M7D A;  3V7R A;  4BD3 A;  1A0N B;  3VS7 A;  4FL6 A;  2RK2 A;  5IAY A;  2VYT A;  2LCC A;  1BU1 A;  1D3B A;  1VQK Q;  4XTX A;  3OY9 A;  3FRN A;  1KSW A;  1KQ1 A;  2P84 A; 
#chains in the Genus database with same CATH homology
 2EYX A;  4ESR A;  2D8J A;  2A36 A;  2EGA A;  1ABO A;  2J06 A;  4RTW A;  1ZUK A;  4J9I A;  2ROT A;  4HVU A;  3EG3 A;  1JQQ A;  1MV3 A;  4Z89 A;  4JJC A;  3VS6 A;  1WLP B;  3TVT A;  2EYW A;  1NEG A;  1UTI A;  1MUZ A;  1Y57 A;  4LE9 A;  2RPN A;  2A28 A;  2K3B A;  2ENM A;  2JXB A;  1VYV A;  1E7O A;  2DNU A;  4AFU C;  2X3X D;  1AWO A;  2K79 A;  1JXO A;  2LP5 A;  4J9C A;  4J9G A;  1WA7 A;  2MOX A;  1CKA A;  1LCK A;  1PKT A;  2KRN A;  1AWW A;  3CQT A;  4LNP A;  5IHK A;  1OPK A;  3VS1 A;  2BZ8 A;  3REB B;  2M51 A;  1SSH A;  2KT8 A;  2DL5 A;  1H3H A;  2OAW A;  2LX7 A;  1JO8 A;  2G6F X;  2JT4 A;  4CC2 A;  2FRY A;  1AWX A;  4OMM A;  1Z9Q A;  1VYT A;  2HCK A;  2O88 A;  1YWP A;  3PE0 A;  2VWF A;  2KEA A;  1YNZ A;  4IIO A;  1KJW A;  2FEI A;  3QWY A;  3NHN A;  1UJY A;  1N5Z A;  4IIM A;  1GBR A;  1ZUU A;  2K6D A;  2JS0 A;  2A08 A;  3O5Z A;  2L3S A;  1WXB A;  1AZG B;  4GBQ A;  1K4U S;  2FG0 A;  2RMO A;  2RF0 A;  2EVR A;  2EYZ A;  3M0Q A;  2QDL A;  2LZ6 B;  5ECA A;  2J05 A;  4RUG A;  1RUW A;  1X2K A;  2VVK A;  5FW9 A;  4DEX A;  1IO6 A;  1PHT A;  3H0F A;  4QT7 A;  1SEM A;  3EG2 A;  2RN8 A;  5IXB A;  1GBQ A;  1GCQ A;  2BTT A;  4AG2 C;  1X69 A;  2EYY A;  2J6K A;  2YUN A;  1GRI A;  2H8H A;  4Z88 A;  1QWE A;  1WX6 A;  4Z8A A;  1TG0 A;  2KXC A;  4J9D A;  2HBW A;  5I11 A;  5GJW B;  2NWM A;  3I35 A;  2M0Y A;  2NUZ A;  3PVL A;  3I5S A;  1W6X A;  2CH4 A;  2EKH A;  1M3B A;  1RLQ C;  2DLP A;  4OMN A;  3VS5 A;  4CC4 B;  1AD5 A;  3PVQ A;  5EC7 A;  2DYB A;  1X43 A;  2FRW A;  4F14 A;  3EHQ A;  1CKB A;  2FPD A;  2ABL A;  4LUD A;  1JU5 C;  2KRM A;  5IXF A;  2FO0 A;  3UA7 A;  3THK A;  2ED0 A;  2KE9 A;  1K0S A;  1E6G A;  2SEM A;  2DVJ A;  1YP5 A;  1M3C A;  1NLO C;  3I5R A;  2L3P A;  4RTZ A;  4OMO A;  1BBZ A;  2ED1 A;  2KT1 A;  2XMF A;  5IHN A;  5GJV B;  2EQI A;  3VRY A;  1YWO A;  5IH2 A;  1SHG A;  1X6G A;  2PNI A;  2DRK A;  1UHC A;  2W0Z A;  4OMP A;  1WI7 A;  3M0R A;  2P4R A;  4HVW A;  3R6N A;  2EGC A;  1H8K A;  1NM7 A;  3TSZ A;  1UGV A;  1I07 A;  1B07 A;  2YUQ A;  2K9G A;  1MV0 B;  3M0S A;  2MCN A;  1T3S A;  3EG1 A;  1QWF A;  1NG2 A;  4D8K A;  4HVV A;  1VA7 A;  3C0C A;  1UEC A;  1SRM A;  1X6B A;  2J6O A;  4RTV A;  2KYB A;  1U06 A;  3ULR B;  1ARK A;  1VYU A;  1Y0M A;  4HXJ A;  2YUP A;  2FPE A;  1T3L A;  5FWC A;  1K76 A;  4JJD A;  2CSI A;  2LQW A;  2BZX A;  2C0T A;  3RBB B;  2V1R A;  1SHF A;  2CRE A;  1G2B A;  4ORZ A;  3H41 A;  5I22 A;  1V1C A;  1U3O A;  1W1F A;  5IHI A;  2CUB A;  1AEY A;  2AK5 A;  3VS4 A;  1QCF A;  2SRC A;  2CSQ A;  2KYM A;  2D1X A;  2CT4 A;  1JEG A;  4LUE A;  2F2X A;  1HD3 A;  3IQL A;  2V1Q A;  1OOT A;  3UF4 A;  1HJD A;  2OJ2 A;  5L23 A;  4CC7 A;  1I0C A;  2O9S A;  2W10 A;  4LN2 A;  3JV3 A;  2C0O A;  4OMQ A;  2GTJ A;  3FJ5 A;  3I9Q A;  1YN8 A;  2LMJ A;  1I1J A;  2LCS A;  1H92 A;  2JM9 A;  5FWB A;  1RLP C;  1UJ0 A;  1GCP A;  2MIO A;  1OPL A;  1UE9 A;  2O9V A;  1UDL A;  2O31 A;  2YDL A;  1WIE A;  3A98 A;  1KIK A;  1PKS A;  3SHW A;  4X1V A;  1EFN A;  2L3Q A;  2RQU A;  4HCK A;  1ZBJ A;  2DRM A;  1UFF A;  1WXU A;  3H0I A;  4KRT A;  4E6R A;  1RI9 A;  2LJ0 A;  3U23 A;  2JTE A;  1E6H A;  1NEB A;  2EPD A;  2DL3 A;  3UAT A;  4AG1 C;  4A63 B;  3RNJ A;  4AFS C;  1ABQ A;  3M0U A;  1OV3 A;  1FMK A;  3QWX X;  2GGR A;  4J9B A;  2YUO A;  4F16 A;  2DE0 X;  3ZL7 C;  1SPK A;  1M8M A;  4AFZ C;  2B86 A;  1NYF A;  2GBQ A;  2D8H A;  1JXM A;  2F2W A;  3GBQ A;  2DL7 A;  1K1Z A;  1KFZ A;  1B3Q A;  3REA B;  2KRO A;  2LJ1 A;  1UG1 A;  2D0N A;  1PRM C;  1Z9Z A;  4RTX A;  1K0X A;  1PNJ A;  2BZY A;  2LQN A;  2DBK A;  2LNH B;  1AVZ C;  5HCK A;  4OML A;  1BK2 A;  4CC3 A;  1HSQ A;  1J3T A;  1TUC A;  3VS2 A;  2DMO A;  3KFV A;  2ESW A;  2K7A A;  2LJ3 A;  1AZE A;  2JW4 A;  2AKK A;  4Y92 A;  1WXT A;  3UA6 A;  1SRL A;  3H0H A;  1M3A A;  2HDA A;  1K9A A;  2DIL A;  1GL5 A;  2KRS A;  2X3W D;  2DM1 A;  2J6F A;  1TUD A;  1GFD A;  2YSQ A;  2RQW A;  1PRL C;  2EBP A;  2HSP A;  1U5S A;  1QKW A;  2E5K A;  2KBT A;  2C0I A;  1X2Q A;  3EHR A;  2JS2 A;  1AWJ A;  1NLP C;  2GNC A;  1GCQ C;  2YT6 A;  2JMA A;  4FSS A;  3NMZ C;  2KNB B;  2DL4 A;  2IIM A;  3VRZ A;  2RQR A;  1AOJ A;  2F2V A;  1ZSG A;  2RQT A;  1FYN A;  4K11 A;  3VS3 A;  1ZLM A;  4GLM A;  2GQI A;  2L2P A;  2DL8 A;  2OI3 A;  1W70 A;  4M4Z A;  2CDT A;  1WYX A;  2CT3 A;  2RNA A;  1BB9 A;  3TSW A;  2VKN A;  4WCI A;  4RTU A;  1ZX6 A;  4F17 A;  4DEY A;  1CSK A;  3NPF A;  2EW3 A;  4R0K A;  2DBM A;  2AZV A;  2J7I A;  2A37 A;  2JM8 A;  1S1N A;  2L0A A;  1YCS B;  2K2M A;  1WDX A;  2EGE A;  2JMC A;  3VS0 A;  2HEQ A;  1UHF A;  4JJB A;  2KGT A;  2CH4 W;  2GTO A;  4J9H A;  1T0H A;  1WFW A;  2CUD A;  4JPB W;  4EIK A;  1X27 A;  2I0N A;  3M0P A;  3LH5 A;  2KXD A;  4RTT A;  4D8D A;  3NGP A;  1T0J A;  4AFQ C;  2RQV A;  1NYG A;  1M27 C;  3SEM A;  2PTK A;  1M30 A;  1G83 A;  2KR3 A;  3EG0 A;  4JZ3 A;  2AKL A;  4JZ4 A;  1QKX A;  3M0T A;  4J9E A;  1GFC A;  2DA9 A;  1QLY A;  2DF6 A;  2ROL A;  3EGU A;  1ZUY A;  2PZ1 A;  2ECZ A;  2DJQ A;  1A0N B;  1UUE A;  3VS7 A;  1XOV A;  1PWT A;  2DX1 A;  1BU1 A;  2FPF A;  4RTY A;  2AZS A;  2O2O A;  4J9F A;  1KSW A;  4ZNX A;  1OEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...