2DRMA

Acanthamoeba myosin i sh3 domain bound to acan125
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
GPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Acanthamoeba Myosin IB
publication title The crystal structure of the SH3 domain of Acanthamoeba myosin IB bound to Acan125
rcsb
source organism Acanthamoeba
total genus 11
structure length 58
sequence length 58
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2drmA00
1UECA 4J9DA 2ESWA 4Z8AA 4F17A 1JEGA 2LX7A 3EGUA 2J06A 2ENMA 3UA6A 3VS5A 1AEYA 2BZYA 1BK2A 1HSQA 2RQWA 2CT4A 2KEAA 3REAB 1K1ZA 4CC7A 1FMKA 2P4RA 3EG0A 4HXJA 2HCKA 3I9QA 1BBZA 2A28A 2D0NA 4HVWA 2SEMA 1T3LA 2FRYA 1SHGA 1EFNA 5GJVB 1WLPB 1K0XA 2SRCA 1K4US 2CSIA 1OV3A 1AD5A 1YWOA 3NPFA 3O5ZA 3VS1A 1GRIA 2KT8A 3M0SA 4A63B 2YUQA 1ZSGA 2EYWA 2DMOA 2EKHA 1X2KA 2EBPA 1M27C 1PHTA 4GLMA 1VA7A 2G6FX 2JMCA 4F14A 4OMLA 2LNHB 1GL5A 2RN8A 2CUBA 5EC7A 1AWOA 3PE0A 2MOXA 1U3OA 1HD3A 1SHFA 2V1RA 2YT6A 3I5SA 1W70A 4Y92A 1KFZA 3M0PA 1WDXA 1WX6A 4FSSA 3TVTA 4J9CA 4RTWA 2M0YA 4CC2A 4JZ4A 1Y0MA 1PWTA 2KROA 2CUDA 1NLPC 2OAWA 2HBWA 4E6RA 2PNIA 4CC3A 1BU1A 1VYVA 1AZGB 1UHFA 2JT4A 4HVUA 2FEIA 2KRMA 1SPKA 2CREA 2RMOA 2PZ1A 3EG2A 2JXBA 1OEBA 1JU5C 1YP5A 2GBQA 3UF4A 2YUNA 4LUDA 4LE9A 1BB9A 1GCQA 3RBBB 1CSKA 1TUCA 2QDLA 1WIEA 2JM8A 4RTXA 2F2VA 4OMMA 1VYUA 4AFUC 3H0FA 2K79A 2DX1A 1WXBA 1X6BA 3VRZA 2CH4A 1QWEA 1KSWA 2EYYA 1UDLA 2O31A 3VS2A 1YCSB 1I07A 2DBMA 1OPKA 2DE0X 1UHCA 2RF0A 4ZNXA 3PVQA 2YDLA 2RPNA 3SEMA 3ULRB 1JXOA 5GJWB 3REBB 1NM7A 1UFFA 3EG1A 1UE9A 1K9AA 2L3PA 4J9HA 1K76A 2O9VA 1NEGA 3I5RA 3QWYA 2JM9A 1MV3A 3KFVA 2LCSA 4LUEA 4F16A 2L2PA 3FJ5A 5HCKA 3H0HA 1SEMA 2EW3A 2YUPA 4J9GA 2A08A 2PTKA 2D1XA 3H0IA 4J9BA 3SHWA 1OOTA 1SRMA 2KBTA 2XMFA 2H8HA 4X1VA 2J7IA 4KRTA 3NHNA 4Z89A 1M3AA 2J6OA 1ZUUA 1UJYA 1AWXA 4OMQA 1WXTA 1M3CA 2ED1A 1AZEA 2DILA 4RTZA 2FPDA 5FWBA 2KT1A 3M0UA 1Z9ZA 4D8DA 1VYTA 1PRLC 1QLYA 1KJWA 1XOVA 1MUZA 2A36A 5IHKA 1J3TA 1M30A 2J6FA 2L3QA 1MV0B 1N5ZA 1T0HA 2ECZA 3VS6A 2KXDA 3VS0A 4AG2C 2GTOA 4IIOA 4RUGA 2AKLA 1GFCA 2DF6A 2JS2A 1NEBA 1WYXA 1CKAA 2C0TA 4AFZC 2HEQA 2MCNA 1W1FA 2EYZA 2AKKA 4LNPA 2LQWA 4JZ3A 4RTYA 1FYNA 1PRMC 4LN2A 2LQNA 1YNZA 2F2XA 2KYMA 2FPEA 5IHNA 1HJDA 5IXFA 4JJBA 4HVVA 1A0NB 1LCKA 1AWJA 2KRNA 4AFSC 2RQUA 4D8KA 1QKXA 4R0KA 1Z9QA 2X3XD 2VVKA 2D8HA 3UA7A 3A98A 2CDTA 1AWWA 1SSHA 1UTIA 1G2BA 1ZBJA 1NG2A 2DLPA 1B3QA 2CSQA 4WCIA 1H3HA 1RI9A 2L0AA 2ABLA 2GTJA 2FO0A 3THKA 1TG0A 2KE9A 2DBKA 2I0NA 2AZVA 2FG0A 1JXMA 1JQQA 2BTTA 2YSQA 3U23A 2GQIA 2ROTA 2CH4W 3IQLA 1UJ0A 1X2QA 1WA7A 2A37A 4HCKA 2MIOA 4J9FA 1U5SA 1WXUA 2DM1A 2L3SA 3RNJA 2ED0A 1M8MA 5FW9A 4K11A 2DL8A 2RQRA 2CT3A 2O9SA 1NLOC 2O88A 5IH2A 2NWMA 3PVLA 1I1JA 4EIKA 2RNAA 4DEYA 1KIKA 2KRSA 2VKNA 1NYFA 3VS4A 2DNUA 2B86A 1GCPA 2LJ3A 2DL3A 1ZLMA 2NUZA 2HDAA 2DRKA 1I0CA 1OPLA 3ZL7C 3GBQA 1U06A 1X6GA 2AZSA 3UATA 3QWXX 1IO6A 1E6GA 2OI3A 1ABQA 2EPDA 2DYBA 1Y57A 3TSWA 1GBQA 2KYBA 1X69A 1E7OA 2EQIA 1H92A 2VWFA 1NYGA 4AG1C 3CQTA 4CC4B 4RTTA 2BZXA 4Z88A 1T0JA 1QKWA 1AVZC 3C0CA 5FWCA 1GBRA 2C0OA 2LJ0A 4QT7A 2JW4A 5I22A 5IHIA 3H41A 1RUWA 1S1NA 5L23A 1ZUKA 2M51A 4JJDA 2EVRA 2KXCA 1T3SA 2LJ1A 1JO8A 2JMAA 2GGRA 4ORZA 4GBQA 2OJ2A 2IIMA 2LZ6B 1CKBA 3I35A 1WI7A 1G83A 4J9EA 2DRMA 1GCQC 2K7AA 2D8JA 2KGTA 5IXBA 2K3BA 4M4ZA 3LH5A 3NGPA 4IIMA 1WFWA 1UG1A 3TSZA 1GFDA 1V1CA 2RQTA 2X3WD 4ESRA 1UGVA 1SRLA 3JV3A 1M3BA 4JPBW 1B07A 4RTVA 3VRYA 2EYXA 1YN8A 2DL5A 2JTEA 4DEXA 1K0SA 1ARKA 2BZ8A 1QWFA 2J6KA 2EGAA 1X43A 2F2WA 1ZX6A 3R6NA 1X27A 2JS0A 1ZUYA 2LP5A 4AFQC 1H8KA 2RQVA 4J9IA 4OMOA 2HSPA 2LMJA 2EGCA 4RTUA 1PKTA 1PNJA 2KR3A 1RLPC 1W6XA 2FRWA 2YUOA 2AK5A 1YWPA 2K2MA 1PKSA 3M0RA 2DL7A 3VS7A 3EG3A 2KNBB 5I11A 1AOJA 3M0QA 4OMNA 2DL4A 3NMZC 5ECAA 2ROLA 2W10A 1E6HA 2DA9A 3EHQA 3EHRA 2C0IA 2EGEA 2K9GA 3M0TA 2E5KA 2W0ZA 2DVJA 1TUDA 2V1QA 1ABOA 4JJCA 4OMPA 2GNCA 3VS3A 2FPFA 2K6DA 1RLQC 1UUEA 2DJQA 2J05A 1QCFA 2O2OA
chains in the Genus database with same CATH superfamily
4RCBA 2LX9A 1YBYA 4J9DA 2ESWA 3QJ6A 3NTKA 4ELZC 2KMTA 1ACMB 3QZ9B 4M7AD 3SFMA 2J06A 4A4FA 2ENMA 3I56Q 1BK2A 2QEXT 1FXXA 4N4GA 4F04B 3REAB 4CC7A 3VV0A 1MMDA 4PJOG 2P4RA 3EG0A 3M55A 4IUUA 3CCRA 2A28A 2D0NA 3MEUA 4HVWA 4DBHA 2SEMA 4F7UA 1T3LA 1R77A 4KBMB 1YJ9T 1WLPB 3LW5E 4MZTA 2SRCA 3CPWP 2CSIA 2DXTA 3NPFA 3FRNA 3VUZA 3VS1A 1GRIA 2EYWA 4FL6A 4PJOB 9ATCB 1M4ZA 1VQ9T 2X4WA 2QK0A 3G4SA 5GMKl 4XTWA 3E19A 4DA4A 3PE0A 2MOXA 1HD3A 2V1RA 3I5SA 3JCMh 4BI4A 1KFZA 2R57A 3RUXA 4MDWA 3KBGA 3I56A 2M0YA 2E41A 4CC2A 4J5YA 2QTXA 2KROA 1NLPC 2OAWA 3MCAB 2VUBA 1X01A 4PJMA 2LCCA 3X20B 1G3WA 4ZTFA 2FEIA 5GAN5 1Q86U 2JXBA 1OEBA 2QEXQ 2GBQA 4ME7A 2RI2A 4LDUA 1LVKA 1CSKA 3OYCA 3V8KA 1KQSA 2H3EB 3A5ZB 2ATCB 3FJPA 4M7AA 1KC8R 2F2VA 4OMMA 4JLIA 4X34A 2OTLT 3ME9A 4A4EA 4C5HA 2KVQG 2GFUA 5I2MA 1MHNA 5GANg 4J6XA 2DYIA 2RH2A 3QPHA 1KQ2A 3PVQA 4M75E 4PLLA 4FIBA 2RPNA 2X51A 3ULRB 1WJSA 1VQ9Q 2F5KA 3CC4Q 1NM7A 3EG1A 1UE9A 1H3ZA 1K9AA 4J9HA 5GMKh 3I5RA 2JJ9A 3KFVA 4KGVB 3OBYA 4F16A 1NBEB 3JSCA 3DLLA 1RAGB 4DBFA 3OS5A 1R0BG 1M2VB 3QJYA 4C0ZA 3RMQA 4HT8A 1VQKT 2D1XA 2QEXA 5GANj 1K9MU 2RM4A 5GMKm 2H8HA 1I5LA 3EH2A 3JB9I 1M3AA 2J6OA 1ZUUA 2COYA 1QP2A 1K9MC 1OU8A 1WXTA 3OA6A 5LJ5g 4A4KA 2DILA 3QZ5B 4XK8E 4PJOF 2KT1A 2P0QA 2DIQA 1TTHB 4N0AA 1KJWA 1J3TA 1AHJB 1VQMT 3HFOA 1WHGA 3VKIA 3OSSC 1VQPT 1Q95G 4C92D 2CZ0B 3UDCA 3VS0A 4AG2C 1D3BB 1NZ9A 1TSFA 3BE3A 1GFCA 1VQ9A 2OTLQ 1BYMA 1NEBA 2C0TA 2CYZB 3P8DA 1W1FA 4E7HA 2EYZA 2AKKA 3BFMA 2LQWA 4J7IA 1R8OB 1MMAA 2YWWA 1M2VA 4IUPA 4JZ3A 3OYEA 1VQ4T 1VQNT 5KYWB 1YNZA 5LJ5j 2R5MA 1HJDA 3O8VA 1KK7A 3CCLT 4HVVA 1RAAB 5GANd 4AFSC 2A3LA 4EPCA 2V8KA 1VQ6T 5KYNA 5GAOl 1OYXA 4JDSA 1SSHA 2BIVA 1G2BA 3C12A 2O4XB 2E70A 2DLPA 2DERA 2HKNA 1H3HA 2ABLA 5FU6C 3THKA 1VIFA 3OYKA 2I0NA 4OVAA 4CRIA 5CO7A 3RR6A 1N8RR 1JJ2A 2ROTA 2CH4W 3CPFA 3LX7A 4BB7A 3FDRA 2OTLA 4IUVA 2QGFB 1U8RA 2MIOA 3BDUA 3TQ7P 1Q82U 1VQMQ 3RNJA 5KCOA 3HHTB 5FW9A 2XDPA 4K11A 3VU3C 3V8LA 5LJ5d 3CEYA 2EJGA 1Q82C 4X9CA 5IH2A 2NWMA 5HKCA 3PVLA 3CCVT 4EIKA 1I8FA 1BI2A 1OZ3A 1TU0B 4M7DC 3NTIA 1HYOA 2LNVA 3M5AA 1VQ4Q 3VS4A 1VQNQ 3BW1A 1U1TA 1G3TA 4ZN1A 3QKJA 2HDAA 3FIFA 5GANf 1VQ8Q 2L3RA 3CC2T 4N4HA 4BE2A 1VQKA 2FZKB 1VQ6Q 3UATA 3QWXX 1IO6A 1E6GA 1KD1U 4MMLA 2KY9A 3QG1A 1KD1C 3R6OA 2DD5A 1ZSZC 3TSWA 2KAFA 1RAHB 3JCMQ 2XIDA 3G7ZA 4L59A 1E7OA 1VQMA 5GAOm 3OS1A 4AG1C 4C8QC 1VQPA 4Z02A 2BZXA 3M9QA 4Z88A 5HK3A 2RJCA 3BDLA 4KUDK 1GBRA 5KE2A 2F5TX 4QT7A 4ZN3A 3H41A 1RUWA 5L23A 5LJ5f 1G5VA 5GAN8 1GXIE 1MNDA 3SWNB 1VQ4A 1VQNA 2VB6A 2JMAA 2GGRA 3CCVQ 2OJ2A 2VV5A 3S3MA 1RI0A 2CS7A 1VQ6A 4M7DD 1VIEA 1Q86R 1WHJA 3P8BB 3G1JA 3M59A 4PJOE 3GOXA 2Y4XA 4J8OA 5FU6B 3NGPA 5DLQE 3TSZA 5LJ3g 1GFDA 1V1CA 4RKUE 2ZAEA 3JV3A 2QQ9A 3JB9H 4ZGJB 1QVFS 5IAYA 1D1BA 3C4SA 2JTEA 3V7CA 5GANe 5C6SA 4RG8A 1WPYA 2P0PA 1M1KR 4BI8B 3KXTA 3SWNA 4AFQC 1VQ5T 2RQVA 2RI3A 4J9IA 3I55T 2M02A 1OZ2A 2DXBA 4RTUA 1PNJA 4C8QD 2AIRB 2AK5A 4XU2A 3CCVA 1VQLT 1C0MA 2QDYB 4WF2A 3EG3A 3H6ZA 5I11A 7AT1B 4PLIA 2DL4A 3NMZC 4IUQA 3RKWA 2HSEB 4M77G 3EHQA 3CC2A 1WHHA 3VS3A 5LJ5e 2EFIA 4BD3A 3OY9A 4IKFA 5CKBA 2K6DA 3ZEHA 1UECA 1QVGA 4JRPA 1JEGA 2L89A 1YCYA 1AT1B 5A0GA 3PT9A 3JCMc 2BZYA 4Y91A 4M77B 2DZ9A 4C8QB 3M57A 3JCMg 1TOVA 4M7DA 1UGQB 1KQSP 2BE9B 4RMOA 5KYUB 2XG8D 1OQKA 3EH1A 2JTFA 5A0LA 2FVUA 3I9QA 1BBZA 4UC4A 1VQ5Q 3TREA 4EMKC 1LOJA 4E7ZA 1W2BA 3I55Q 1EFNA 5GJVB 4OB3B 1PCXA 1OX9A 1OV3A 3OQ5A 2EQJA 3O5ZA 3V8JA 2QQAA 2KT8A 4A63B 1R0CB 1VQLQ 3CMAT 3GLXA 2DMOA 2DK3A 4ZTJA 1D0XA 4M78G 1M27C 1VA7A 1ZSZA 2JMCA 2JTMA 4OMLA 2LNHB 1RAIB 1GL5A 1PD1A 2CUBA 4B9XA 1U3OA 1D1AA 1SHFA 4C8QA 1W70A 4Y92A 1WDXA 4FSSA 2VXEA 4OMFB 3TVTA 2K5FA 4JZ4A 1PWTA 5KYUA 2MAMA 5KYYB 2DXUA 1JB0E 3FLGA 2YLCA 4M78B 1BU1A 1M1GA 1VYVA 2QQRA 4HVUA 2JT4A 3DLMA 4PFOA 1WZOA 1BI1A 3V7SA 1QW1A 2RMOA 2K3XA 1VQ5A 3EFRA 1K8AU 4F7UG 5LJ3f 3I55A 2YUNA 4LUDA 4LDYA 4LE9A 3HTRA 1BB9A 2K2VA 1K8AC 2R5AA 2QDLA 3LYIA 1WIEA 5EG2A 4RTXA 4QQDA 2RK1A 1KQSS 1VQLA 3QDRB 2YXYA 3JCMd 4AFUC 3H0FA 3OYLA 2DTOA 2L5QA 4QQGA 1X6BA 3VRZA 5GAN4 1FX7A 1UGRB 1KSWA 2QGGA 1UDLA 1WGSA 3VS2A 4C0DC 4FYWB 3QIIA 1UHCA 4F7UB 3CCJT 2D9TA 4ZNXA 2AHJB 3CMAQ 5GMKj 4NL2A 4HCCA 1JXOA 3CXCA 1OX8A 3HSBA 3A8HB 4M77F 2L3PA 2E6ZA 3QWYA 1MV3A 1IHVA 2LCSA 2MK5A 4LUEA 4AMCA 2LCLA 2L2PA 3FJ5A 5FROA 1SEMA 2YUPA 1VQ7T 2A08A 1NJIU 3S3NA 1N6AA 4XU1A 1Q7YR 2ZCFB 4D6WA 3OYHA 1H641 1OOTA 2JN0A 2KBTA 2XDBA 4X1VA 4KRTA 3OW2A 3S3OA 1NJIC 2PUOB 4EMKB 1AWXA 4M7AG 2FPDA 4P5NA 3M0UA 1W4SA 1RACB 3RKYA 1XOVA 1N5ZA 3VS6A 5IN1A 3JCMf 3CMAA 4GY5A 2GTOA 2HAXA 5LJ3e 4AFZC 2P84A 4M7AB 3H8ZA 2CZ6B 3CCJQ 4RTYA 3CCET 4M78F 1PRMC 5CVIA 2LQNA 2KYMA 4E7JA 2FPEA 4PJNA 3GP8A 2LQ8A 2DPPB 4EMKA 1QKXA 2IPOB 1YFNA 3URGA 1KHCA 2DTIA 2EAYA 3UA7A 1AWWA 3CBPA 1UTIA 1NG2A 4QW2A 4KULA 2CSQA 1VQ7Q 2E10A 2L0AA 3CCMT 3JCMJ 1M90C 3L2VA 2KE9A 3HRTA 1Y96B 2AZVA 2GFAA 4MDXA 2K3YA 2MYSA 1TH7A 2YSQA 4A4GA 4C92C 4C0FA 4F7UF 2GQIA 3UT1A 5CKFA 2IVWA 1WQ7A 2COZA 2CP5A 3JB9G 3MP8A 1SF9A 4EDUA 4J9FA 1YJ9Q 4JRQA 4J6WA 2KQWA 3ASKA 1WXUA 2PUKB 3CCJA 2RQRA 3J7AF 2O9SA 2O88A 4DQ2A 3CPWS 2RK2A 1I1JA 3CCQT 4DEYA 1KIKA 2KRSA 4AT1B 2QA4T 2HBPA 1Q81R 3S6WA 5D7UA 3JCMe 3CCEQ 4E7KA 2DNUA 3GF5A 4LD6A 1OPLA 1Y96A 2FZCB 3V7RA 1VQ7A 3ZL7C 3JCMP 4XTUA 2WSFE 2ZPIB 1IB8A 3QSUA 2CP3A 1VUBA 2DKGA 1ABQA 3HFNA 1TXQA 5J39A 2GCXA 4XTVA 1NPRA 1UGPB 3CCMQ 5I2SA 2KYBA 3CBOA 1YJ9A 1EIFA 1Y7XA 2XK0A 2EQIA 4M7AF 1H92A 2VWFA 2LRQA 4QQ6A 4M77E 2E64A 4A4HA 2RD1A 4OB1B 4LDXA 2LJ0A 5I22A 2JW4A 5IHIA 4KGXB 6AT1B 2M9UA 1ZUKA 5FRNA 4LDWA 3CCEA 4V2SA 2COWA 4JJDA 5LL6S 3F70A 1JO8A 1P92A 3L42A 3CCQQ 2CZ7B 2LT4A 3LWHA 2LZ6B 5GMKe 2L8DA 2QA4Q 3I35A 2M1HA 3VJPA 4BACA 3JCMX 2K7AA 2G3RA 2KGTA 1RAFB 1K73U 3MJXA 4OB0B 2AT1B 2EJFA 5C0MA 1VQKQ 3CCMA 1K73C 2Z0WA 2DVEA 3J80E 3TU4K 4C92B 3LGFA 4RTVA 2EYXA 2RJFA 4IURA 1M1FA 2K57A 4JRKA 1TUGB 3M56A 3HKSA 1PSEA 3C94A 1IHWA 1X43A 2HL5C 1X27A 2JS0A 3NTHA 3A8OB 4OMOA 2HSPA 2LMJA 2EGCA 4Q5WA 3CD6T 3JB9F 5KH6A 1VQPQ 4FYXB 1W6XA 1YITT 1WHMA 2VYTA 3HPWA 3CCQA 2K2MA 3PIOA 3VS7A 1C6VX 2QA4A 1VQOT 4BDYA 4ZGDB 1SKUB 4DBRA 4OMNA 2HNIA 4M75C 2DZCA 5KE3A 2C0IA 3CCLQ 2KDSA 4C92A 3M0TA 2JNGA 2W0ZA 4N4IA 1TUDA 4OMPA 3HL8A 2ZPGB 2HQXA 1RLQC 2DJQA 1QCFA 4Z8AA 1BCMA 3GNFB 4ELYC 5KCHA 5HK0A 3UA6A 4JLGA 1HSQA 2CT4A 2KEAA 4JRIA 1K1ZA 2PVDB 2I2LA 4R56A 1FMKA 2PQWA 1QMCA 1B7TA 3LGLA 1N9RA 2DFUA 2HCKA 2FRYA 2ZGWA 2QTVA 3CD6Q 1K4US 2WSEE 1YWOA 1YITQ 2YUQA 3CXCP 3CCLA 4BE1A 2EKHA 2WSCE 3TCJA 2EBPA 1PHTA 4GLMA 4J6YA 1VQOQ 2EJ9A 2JVVA 1QQJA 4F14A 2F1LA 2QG9B 4M75D 1G8XA 2MF2A 5GAN2 3CC7T 2EQMA 5GAMh 1S72T 3CC2Q 3D7SB 3M0PA 3Q1JA 3JCMV 1YJNT 2EQKA 2YHTA 4M7AE 2DIGA 2FZGB 3SD4A 2E1HA 3OYYA 4E7LA 3OW2P 1ZHIA 2CUDA 3LLRA 5J26A 4M7DG 3ZFJA 1G3SA 5FU7C 4CC3A 1KQ1A 2KRMA 2DJZA 1RADB 1YI2T 1NPPA 2CREA 2VGNA 5GAN6 2PZ1A 3CMET 1JU5C 1YP5A 2OX7A 3L1AA 2YRVA 2DD4A 3UPUA 3CD6A 1OI1A 4QVCA 3EGXB 3RBBB 1XTDA 1TUCA 4MZMA 5LJ3j 1YITA 4M7DB 4C5IA 2JM8A 3GIBA 4KUIA 1VYUA 2K79A 4M75B 2VXFA 1VQOA 3DB3A 1QWEA 2MMPA 5GAOn 2O31A 2E65A 3RIRA 1YCSB 5GAN7 3EFSA 2XU8A 4HA8A 2DBMA 1OPKA 1U1SA 1WHLA 5CR2A 2Y4YA 5CQXA 4FT4A 2H3JA 4JS5A 1K9MR 4C8QG 2XICA 3REBB 2IG0A 1UFFA 3VYHB 2MWPA 3PMIA 3FC3A 1UGSB 4BDZA 1K76A 2O9VA 2JM9A 2E6NA 3MHXA 1ZSZB 1MMGA 3CC7Q 4BI3A 1S72Q 4OB2B 5HCKA 2RJEA 3H0HA 2CP0A 1YJNQ 1KC8C 3PIPA 2RO0A 3EGXA 2E3IA 3H0IA 4J9BA 5A0DA 3SHWA 4PK4A 1SRMA 2XMFA 4B9WA 4Z89A 5LJ3d 4M75A 3OW2S 2QQSA 4HKEA 1EX4A 1YI2Q 3OSVA 1AZEA 1XJWB 4ATOA 3CMEQ 4D8DA 1Z9ZA 1VYTA 3RDVA 2RHIA 3TEEA 5IHKA 1M30A 1DJ7B 2J6FA 1MV0B 2DAQA 4A54A 4JUVA 1T0HA 3JB9J 2KXDA 4RUGA 2XHCA 2QAZA 3WVEB 1M2OA 5GMKi 1CKAA 2BUDA 2ZPFB 2MCNA 3LH0A 4LNPA 2RHZA 1D0YA 3PFSA 1FYNA 3CC7A 4LN2A 1G3YA 1S72A 2F2XA 1X6OA 1PC0A 1YJNA 3OYBA 2MWOA 2E5QA 1HXDA 2RQUA 3OYGA 4R0KA 4PJOC 2X3XD 2CDTA 5GAOr 1ZBJA 2DTHA 3CBMA 1Q82R 1B3QA 1YI2A 4PFZA 5CQYA 1I81A 3HRUA 4M7DF 1RI9A 2V8JA 3CMEA 3M58A 3PGGA 3EAEA 1TG0A 1B34B 1QVFA 3ZBDA 2DBKA 2XDDA 2ZZDA 1ZA1B 3U23A 3X26B 2CP7A 3QYGB 3IQLA 1UJ0A 4A53A 1X2QA 2MI6A 4HCKA 1PD0A 3OMGA 2L3SA 2ED0A 1TS9A 2XKOC 1XQHA 2DL8A 3EGDB 4HT9A 2O01E 2RHXA 2GQVA 1NLOC 1HK9A 4ANJA 1KD1R 2CP6A 4C0GA 1RAEB 4ZGEB 2VKNA 4X9DA 4C8QF 1FMVA 2LJ3A 1N8RC 2C06A 2B8AA 2P4TA 2NUZA 1BIBA 2DRKA 1QP3A 1B34A 1I0CA 3QDFA 4LD9K 3GBQA 2BKDN 3MEVA 1X6GA 4NS5A 4PJOD 1JJ2P 2K5LA 2RHUA 5CIUA 4PJJA 4HCBA 2ZPEB 2QI2A 2OAUA 2DO3A 2HMAA 1Y57A 4OF1A 1IZ6A 2FHDA 2NUPB 3L2QA 2K5IA 3CCUT 3EGDA 4VUBA 5CCAA 2X35A 2FL7A 3MEWA 4CC4B 3T9NA 4RTTA 2E12A 2RHYA 1QKWA 3C0CA 2C0OA 2JZ2A 2BE7D 1XNIA 4QKUA 2DEQA 3QHSA 4R55A 2M51A 8AT1B 2HKQB 4C5GA 1T3SA 3EFOA 2LJ1A 2DXCA 2HL3A 3OMCA 1UB4A 4ORZA 4GBQA 1RL2A 1QCOA 2IIMA 1LNXA 4XTYA 1WI7A 3CC4T 2DRMA 1GCQC 1BI0A 5DLOA 4KT0E 2FYKA 4EMGA 5IXBA 2K3BA 2NUPA 2D0QB 2EWNA 4OGEA 4M4ZA 4PNOA 1M90U 4IIMA 2RB6A 3L2WA 2XI9A 1I4K1 1UGVA 1SRLA 1YN8A 1M5Q1 1ZBXA 4E7SA 1ARKA 3C95A 4JS4A 2BZ8A 3JB9D 1QWFA 2WACA 2EGAA 1JJ2S 2F2WA 3RKXA 4C0DB 2JUFA 4FT2A 3CCUQ 1D09B 3MEAA 1YHQT 1Q86C 2LVMA 1YJWT 4PJOA 1PKTA 1ZA2B 2QXFA 3GPLA 2KR3A 2FRWA 4J7FA 2KSSA 2RA2A 4FW2A 2M16A 4XU0A 3AT1B 1PKSA 3M0RA 2DL7A 3MKDA 2KNBB 2E4HA 1AOJA 3NFCA 1M1KU 4M7DE 4NL3A 4B6MA 5DM7R 2ROLA 2W10A 2DA9A 3EHRA 1M1KC 2K9GA 2DVJA 4XU3A 4JJCA 1IGUA 2GNCA 3OS0A 1MMNA 2KK4A 2J05A 2V8IA 4F17A 2LX7A 3EGUA 3DKMA 3SB2A 1AEYA 3VS5A 1Y71A 2QASA 2RQWA 3CCUA 2JOYA 5GAMg 4NOYA 3L2RA 2CGHA 3OYJA 3E2UA 3OYFA 4HXJA 3AHUA 4C8QE 1YHQQ 4J83A 4L6V5 2FB7A 1SHGA 1YJWQ 4KH0B 4QVDA 5CKDA 2EQUA 3G6ET 1K0XA 2X9HA 1AD5A 1PSFA 1BIAA 1I5OB 2P0KA 2RI5A 3M0SA 1ZSGA 5M9OA 1M8VA 4C92G 1X2KA 5GAMj 2G6FX 1QVGP 3CC4A 4XQ3A 3X28B 2RN8A 3N5BB 5EC7A 3RESA 3DB4A 1AWOA 1K8AR 3META 2YT6A 1WX6A 1VQ8T 3SWNC 4FSXA 3VYGA 1Y07A 1UEBA 4J9CA 4RTWA 1Y0MA 5D6XA 2X4JA 3PNWC 3GNGA 2HBWA 4E6RA 2PNIA 5AYFA 1AZGB 1UHFA 3HRSA 1W2BP 1SPKA 3A8LB 2ZPBB 3EG2A 3PTAA 4M78E 1MGQA 1YHQA 5L8RE 3PMTA 5CAIA 3UF4A 1YJWA 3QO3A 1D3BA 1GCQA 5I21A 4FCYA 2LT1A 1V76A 3M54A 5GAMd 3M4GA 4OP0A 4DOWA 2DX1A 1WXBA 2CH4A 5KYWA 2HQEA 2EYYA 3G6EQ 3G71T 1I07A 4HCZA 3KUFA 2DEUA 1NJIR 2DE0X 2RF0A 3JRZA 5A2QE 2YRDA 3CPWA 2YDLA 3OYIA 3UWNA 3SEMA 5GJWB 5HY6A 4FM4B 3RMSA 4F7UE 1QVPA 2F69A 2O4XA 1NEGA 1TWBA 3OB9A 2E3HA 5CKEA 4TVRA 1QVGS 2PU9B 3OBWA 1SG5A 2EW3A 2VC8A 2YLBA 2A0FB 4MMKA 4J9GA 8ATCB 4O6JA 1QVFP 2PTKA 1WHKA 1OU9A 2NYSA 3OYDA 2J7IA 3NHNA 5GAOp 1YIJT 4KH1B 4YTLA 1UJYA 2CKKA 5FRMA 4OMQA 3X25B 1M3CA 2ED1A 5GANh 4RTZA 4LDVA 3A8MB 5FWBA 4KGZB 1BKBA 1PRLC 3OS2A 1QLYA 2X4XA 1W2BS 3OYAA 3M53A 4XTZA 2GF7A 5AT1B 3G6EA 3MP6A 1C1AA 1MUZA 2A36A 1MNEA 4XTXA 2L3QA 4M77C 2ECZA 5GAMf 2OTJT 1Q7YU 1EZZB 2X4YA 4IIOA 1NE8A 2AKLA 4C5EA 2DF6A 2JS2A 2CZ1B 2YRCA 3WVDB 5D6WA 1WYXA 1M90R 3G71Q 1Q7YC 2HEQA 2VASA 4C92F 1BI3A 1IRXA 1WJRA 1M9SA 2Y90A 3L2UA 4PFPA 4BUGA 3M4YA 5IHNA 5IXFA 1OULA 1VQ8A 1N9SA 1JRIA 3JCMW 4JJBA 1BCOA 3HP9A 4RG2A 1A0NB 1LCKA 1AWJA 2KRNA 4D8KA 1Z9QA 4E47A 5LJ5h 2VVKA 2D8HA 4OGCA 3JAME 1LJOA 3H9NA 3A98A 2VGMA 4M75G 1D0ZA 3E9GA 3CCST 2R58A 3QUIA 4WCIA 2HD0A 3MPUB 4MZPA 1X75C 1QCNA 2GTJA 2FO0A 1YIJQ 2FG0A 1JXMA 1JQQA 2BTTA 2M0OA 3JCMb 4M78C 3J81E 1WA7A 2A37A 3G71A 1ZQ1A 1U5SA 2DM1A 4FW1A 1M8MA 4M77D 2CT3A 2OTJQ 2V26A 3E1SA 2ZPHB 3FEOA 1VOMA 4L5GA 2LC4A 3QBYA 1KG1A 2RNAA 5CKHA 4BY6C 4JJNK 3CXCS 1NYFA 3EG9B 2K4YA 4XAXB 1KC8U 1WNLA 5GAMe 3OYNA 5CK9A 2B86A 1GCPA 2DL3A 1ZLMA 2LTOA 2NLUA 3BY7A 3X24B 2PVOB 4E2FB 4E7IA 2QYZA 4II1A 1U06A 3INZA 2AZSA 2KI7A 2OI3A 1YIJA 3SDZA 1IGQA 3CCSQ 1WJQA 2EPDA 1Q81U 5KYXB 2DYBA 3VUBA 1GBQA 2RJDA 3A8GB 1Q81C 1X69A 2EIFA 1NYGA 3MO8A 3OYMA 3CQTA 2OTJA 1T0JA 1AVZC 5GAOq 3EG9A 4M78D 3CCRT 5FWCA 1K73R 2CP2A 1S1NA 4GLKA 3ER0A 1IREB 3WXMB 1SSFA 2EVRA 2KXCA 2EKOA 4RCCA 4DOVA 4DBQA 2QQBA 4FU6A 5DY9A 4PKCC 4FYYB 3MP1A 1LPLA 5FU7B 3A1PA 4QVZA 1CKBA 3G4ST 2D6FA 1G83A 1FMWA 4BE0A 1PG5B 4J9EA 2D8JA 5KYXA 3FB9A 1JBMA 5D6YA 3CCSA 4M77A 1RABB 3LH5A 4M7AC 2NUTB 1WFWA 1UG1A 1N27A 1KHIA 1D1CA 2RQTA 2X3WD 4FYVB 4ESRA 3I56T 1O75A 4M75F 1M3BA 4JPBW 4EMHA 1B07A 3VRYA 1V29B 2DL5A 4DEXA 1K0SA 3P8HA 1FWZA 2J6KA 3L2ZA 2EYQA 1ZX6A 3R6NA 5J3BA 4C92E 4LXCA 1ZUYA 2LQKA 1F1BB 2LP5A 1H8KA 1PM3A 2XD0A 2PVGB 4IUTA 1WQWA 1RLPC 3E9FA 2YUOA 4BY6B 3LWIA 5IT9E 3CCRQ 2MPXC 4Y28E 1YWPA 4PJLA 2DETA 2A7YA 1IXDA 1O9SA 1N8RU 5GAN3 2NUTA 3M0QA 5LJ3h 5FLXE 5ECAA 4PL6A 1E6HA 2EGEA 5KYYA 3RERA 2E5KA 2HZYA 2LDMA 4O5VA 2HQHA 2V1QA 4M78A 1ABOA 3EFOB 4N0AC 3G4SQ 2FPFA 3QXEB 1UUEA 4WTOB 3QYHB 4CI0C 2O2OA
chains in the Genus database with same CATH topology
1UECA 4J9DA 2ESWA 4Z8AA 4F17A 1JEGA 2LX7A 3EGUA 2J06A 2ENMA 3UA6A 3VS5A 1AEYA 2BZYA 1BK2A 1HSQA 2RQWA 2CT4A 2KEAA 3REAB 1K1ZA 4CC7A 1FMKA 2P4RA 3EG0A 4HXJA 2HCKA 3I9QA 1BBZA 2A28A 2D0NA 4HVWA 2SEMA 1T3LA 2FRYA 1SHGA 1EFNA 5GJVB 1WLPB 1K0XA 2SRCA 1K4US 2CSIA 1OV3A 1AD5A 1YWOA 3NPFA 3O5ZA 3VS1A 1GRIA 2KT8A 3M0SA 4A63B 2YUQA 1ZSGA 2EYWA 2DMOA 2EKHA 1X2KA 2EBPA 1M27C 1PHTA 4GLMA 1VA7A 2G6FX 2JMCA 4F14A 4OMLA 2LNHB 1GL5A 2RN8A 2CUBA 5EC7A 1AWOA 3PE0A 2MOXA 1U3OA 1HD3A 1SHFA 2V1RA 2YT6A 3I5SA 1W70A 4Y92A 1KFZA 3M0PA 1WDXA 1WX6A 4FSSA 3TVTA 4J9CA 4RTWA 2M0YA 4CC2A 4JZ4A 1Y0MA 1PWTA 2KROA 2CUDA 1NLPC 2OAWA 2HBWA 4E6RA 2PNIA 4CC3A 1BU1A 1VYVA 1AZGB 1UHFA 2JT4A 4HVUA 2FEIA 2KRMA 1SPKA 2CREA 2RMOA 2PZ1A 3EG2A 2JXBA 1OEBA 1JU5C 1YP5A 2GBQA 3UF4A 2YUNA 4LUDA 4LE9A 1BB9A 1GCQA 3RBBB 1CSKA 1TUCA 2QDLA 1WIEA 2JM8A 4RTXA 2F2VA 4OMMA 1VYUA 4AFUC 3H0FA 2K79A 2DX1A 1WXBA 1X6BA 3VRZA 2CH4A 1QWEA 1KSWA 2EYYA 1UDLA 2O31A 3VS2A 1YCSB 1I07A 2DBMA 1OPKA 2DE0X 1UHCA 2RF0A 4ZNXA 3PVQA 2YDLA 2RPNA 3SEMA 3ULRB 1JXOA 5GJWB 3REBB 1NM7A 1UFFA 3EG1A 1UE9A 1K9AA 2L3PA 4J9HA 1K76A 2O9VA 1NEGA 3I5RA 3QWYA 2JM9A 1MV3A 3KFVA 2LCSA 4LUEA 4F16A 2L2PA 3FJ5A 5HCKA 3H0HA 1SEMA 2EW3A 2YUPA 4J9GA 2A08A 2PTKA 2D1XA 3H0IA 4J9BA 3SHWA 1OOTA 1SRMA 2KBTA 2XMFA 2H8HA 4X1VA 2J7IA 4KRTA 3NHNA 4Z89A 1M3AA 2J6OA 1ZUUA 1UJYA 1AWXA 4OMQA 1WXTA 1M3CA 2ED1A 1AZEA 2DILA 4RTZA 2FPDA 5FWBA 2KT1A 3M0UA 1Z9ZA 4D8DA 1VYTA 1PRLC 1QLYA 1KJWA 1XOVA 1MUZA 2A36A 5IHKA 1J3TA 1M30A 2J6FA 2L3QA 1MV0B 1N5ZA 1T0HA 2ECZA 3VS6A 2KXDA 3VS0A 4AG2C 2GTOA 4IIOA 4RUGA 2AKLA 1GFCA 2DF6A 2JS2A 1NEBA 1WYXA 1CKAA 2C0TA 4AFZC 2HEQA 2MCNA 1W1FA 2EYZA 2AKKA 4LNPA 2LQWA 4JZ3A 4RTYA 1FYNA 1PRMC 4LN2A 2LQNA 1YNZA 2F2XA 2KYMA 2FPEA 5IHNA 1HJDA 5IXFA 4JJBA 4HVVA 1A0NB 1LCKA 1AWJA 2KRNA 4AFSC 2RQUA 4D8KA 1QKXA 4R0KA 1Z9QA 2X3XD 2VVKA 2D8HA 3UA7A 3A98A 2CDTA 1AWWA 1SSHA 1UTIA 1G2BA 1ZBJA 1NG2A 2DLPA 1B3QA 2CSQA 4WCIA 1H3HA 1RI9A 2L0AA 2ABLA 2GTJA 2FO0A 3THKA 1TG0A 2KE9A 2DBKA 2I0NA 2AZVA 2FG0A 1JXMA 1JQQA 2BTTA 2YSQA 3U23A 2GQIA 2ROTA 2CH4W 3IQLA 1UJ0A 1X2QA 1WA7A 2A37A 4HCKA 2MIOA 4J9FA 1U5SA 1WXUA 2DM1A 2L3SA 3RNJA 2ED0A 1M8MA 5FW9A 4K11A 2DL8A 2RQRA 2CT3A 2O9SA 1NLOC 2O88A 5IH2A 2NWMA 3PVLA 1I1JA 4EIKA 2RNAA 4DEYA 1KIKA 2KRSA 2VKNA 1NYFA 3VS4A 2DNUA 2B86A 1GCPA 2LJ3A 2DL3A 1ZLMA 2NUZA 2HDAA 2DRKA 1I0CA 1OPLA 3ZL7C 3GBQA 1U06A 1X6GA 2AZSA 3UATA 3QWXX 1IO6A 1E6GA 2OI3A 1ABQA 2EPDA 2DYBA 1Y57A 3TSWA 1GBQA 2KYBA 1X69A 1E7OA 2EQIA 1H92A 2VWFA 1NYGA 4AG1C 3CQTA 4CC4B 4RTTA 2BZXA 4Z88A 1T0JA 1QKWA 1AVZC 3C0CA 5FWCA 1GBRA 2C0OA 2LJ0A 4QT7A 2JW4A 5I22A 5IHIA 3H41A 1RUWA 1S1NA 5L23A 1ZUKA 2M51A 4JJDA 2EVRA 2KXCA 1T3SA 2LJ1A 1JO8A 2JMAA 2GGRA 4ORZA 4GBQA 2OJ2A 2IIMA 2LZ6B 1CKBA 3I35A 1WI7A 1G83A 4J9EA 2DRMA 1GCQC 2K7AA 2D8JA 2KGTA 5IXBA 2K3BA 4M4ZA 3LH5A 3NGPA 4IIMA 1WFWA 1UG1A 3TSZA 1GFDA 1V1CA 2RQTA 2X3WD 4ESRA 1UGVA 1SRLA 3JV3A 1M3BA 4JPBW 1B07A 4RTVA 3VRYA 2EYXA 1YN8A 2DL5A 2JTEA 4DEXA 1K0SA 1ARKA 2BZ8A 1QWFA 2J6KA 2EGAA 1X43A 2F2WA 1ZX6A 3R6NA 1X27A 2JS0A 1ZUYA 2LP5A 4AFQC 1H8KA 2RQVA 4J9IA 4OMOA 2HSPA 2LMJA 2EGCA 4RTUA 1PKTA 1PNJA 2KR3A 1RLPC 1W6XA 2FRWA 2YUOA 2AK5A 1YWPA 2K2MA 1PKSA 3M0RA 2DL7A 3VS7A 3EG3A 2KNBB 5I11A 1AOJA 3M0QA 4OMNA 2DL4A 3NMZC 5ECAA 2ROLA 2W10A 1E6HA 2DA9A 3EHQA 3EHRA 2C0IA 2EGEA 2K9GA 3M0TA 2E5KA 2W0ZA 2DVJA 1TUDA 2V1QA 1ABOA 4JJCA 4OMPA 2GNCA 3VS3A 2FPFA 2K6DA 1RLQC 1UUEA 2DJQA 2J05A 1QCFA 2O2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UEC A;  4J9D A;  2ESW A;  4Z8A A;  4F17 A;  1JEG A;  2LX7 A;  3EGU A;  2J06 A;  2ENM A;  3UA6 A;  3VS5 A;  1AEY A;  2BZY A;  1BK2 A;  1HSQ A;  2RQW A;  2CT4 A;  2KEA A;  3REA B;  1K1Z A;  4CC7 A;  1FMK A;  2P4R A;  3EG0 A;  4HXJ A;  2HCK A;  3I9Q A;  1BBZ A;  2A28 A;  2D0N A;  4HVW A;  2SEM A;  1T3L A;  2FRY A;  1SHG A;  1EFN A;  5GJV B;  1WLP B;  1K0X A;  2SRC A;  1K4U S;  2CSI A;  1OV3 A;  1AD5 A;  1YWO A;  3NPF A;  3O5Z A;  3VS1 A;  1GRI A;  2KT8 A;  3M0S A;  4A63 B;  2YUQ A;  1ZSG A;  2EYW A;  2DMO A;  2EKH A;  1X2K A;  2EBP A;  1M27 C;  1PHT A;  4GLM A;  1VA7 A;  2G6F X;  2JMC A;  4F14 A;  4OML A;  2LNH B;  1GL5 A;  2RN8 A;  2CUB A;  5EC7 A;  1AWO A;  3PE0 A;  2MOX A;  1U3O A;  1HD3 A;  1SHF A;  2V1R A;  2YT6 A;  3I5S A;  1W70 A;  4Y92 A;  1KFZ A;  3M0P A;  1WDX A;  1WX6 A;  4FSS A;  3TVT A;  4J9C A;  4RTW A;  2M0Y A;  4CC2 A;  4JZ4 A;  1Y0M A;  1PWT A;  2KRO A;  2CUD A;  1NLP C;  2OAW A;  2HBW A;  4E6R A;  2PNI A;  4CC3 A;  1BU1 A;  1VYV A;  1AZG B;  1UHF A;  2JT4 A;  4HVU A;  2FEI A;  2KRM A;  1SPK A;  2CRE A;  2RMO A;  2PZ1 A;  3EG2 A;  2JXB A;  1OEB A;  1JU5 C;  1YP5 A;  2GBQ A;  3UF4 A;  2YUN A;  4LUD A;  4LE9 A;  1BB9 A;  1GCQ A;  3RBB B;  1CSK A;  1TUC A;  2QDL A;  1WIE A;  2JM8 A;  4RTX A;  2F2V A;  4OMM A;  1VYU A;  4AFU C;  3H0F A;  2K79 A;  2DX1 A;  1WXB A;  1X6B A;  3VRZ A;  2CH4 A;  1QWE A;  1KSW A;  2EYY A;  1UDL A;  2O31 A;  3VS2 A;  1YCS B;  1I07 A;  2DBM A;  1OPK A;  2DE0 X;  1UHC A;  2RF0 A;  4ZNX A;  3PVQ A;  2YDL A;  2RPN A;  3SEM A;  3ULR B;  1JXO A;  5GJW B;  3REB B;  1NM7 A;  1UFF A;  3EG1 A;  1UE9 A;  1K9A A;  2L3P A;  4J9H A;  1K76 A;  2O9V A;  1NEG A;  3I5R A;  3QWY A;  2JM9 A;  1MV3 A;  3KFV A;  2LCS A;  4LUE A;  4F16 A;  2L2P A;  3FJ5 A;  5HCK A;  3H0H A;  1SEM A;  2EW3 A;  2YUP A;  4J9G A;  2A08 A;  2PTK A;  2D1X A;  3H0I A;  4J9B A;  3SHW A;  1OOT A;  1SRM A;  2KBT A;  2XMF A;  2H8H A;  4X1V A;  2J7I A;  4KRT A;  3NHN A;  4Z89 A;  1M3A A;  2J6O A;  1ZUU A;  1UJY A;  1AWX A;  4OMQ A;  1WXT A;  1M3C A;  2ED1 A;  1AZE A;  2DIL A;  4RTZ A;  2FPD A;  5FWB A;  2KT1 A;  3M0U A;  1Z9Z A;  4D8D A;  1VYT A;  1PRL C;  1QLY A;  1KJW A;  1XOV A;  1MUZ A;  2A36 A;  5IHK A;  1J3T A;  1M30 A;  2J6F A;  2L3Q A;  1MV0 B;  1N5Z A;  1T0H A;  2ECZ A;  3VS6 A;  2KXD A;  3VS0 A;  4AG2 C;  2GTO A;  4IIO A;  4RUG A;  2AKL A;  1GFC A;  2DF6 A;  2JS2 A;  1NEB A;  1WYX A;  1CKA A;  2C0T A;  4AFZ C;  2HEQ A;  2MCN A;  1W1F A;  2EYZ A;  2AKK A;  4LNP A;  2LQW A;  4JZ3 A;  4RTY A;  1FYN A;  1PRM C;  4LN2 A;  2LQN A;  1YNZ A;  2F2X A;  2KYM A;  2FPE A;  5IHN A;  1HJD A;  5IXF A;  4JJB A;  4HVV A;  1A0N B;  1LCK A;  1AWJ A;  2KRN A;  4AFS C;  2RQU A;  4D8K A;  1QKX A;  4R0K A;  1Z9Q A;  2X3X D;  2VVK A;  2D8H A;  3UA7 A;  3A98 A;  2CDT A;  1AWW A;  1SSH A;  1UTI A;  1G2B A;  1ZBJ A;  1NG2 A;  2DLP A;  1B3Q A;  2CSQ A;  4WCI A;  1H3H A;  1RI9 A;  2L0A A;  2ABL A;  2GTJ A;  2FO0 A;  3THK A;  1TG0 A;  2KE9 A;  2DBK A;  2I0N A;  2AZV A;  2FG0 A;  1JXM A;  1JQQ A;  2BTT A;  2YSQ A;  3U23 A;  2GQI A;  2ROT A;  2CH4 W;  3IQL A;  1UJ0 A;  1X2Q A;  1WA7 A;  2A37 A;  4HCK A;  2MIO A;  4J9F A;  1U5S A;  1WXU A;  2DM1 A;  2L3S A;  3RNJ A;  2ED0 A;  1M8M A;  5FW9 A;  4K11 A;  2DL8 A;  2RQR A;  2CT3 A;  2O9S A;  1NLO C;  2O88 A;  5IH2 A;  2NWM A;  3PVL A;  1I1J A;  4EIK A;  2RNA A;  4DEY A;  1KIK A;  2KRS A;  2VKN A;  1NYF A;  3VS4 A;  2DNU A;  2B86 A;  1GCP A;  2LJ3 A;  2DL3 A;  1ZLM A;  2NUZ A;  2HDA A;  2DRK A;  1I0C A;  1OPL A;  3ZL7 C;  3GBQ A;  1U06 A;  1X6G A;  2AZS A;  3UAT A;  3QWX X;  1IO6 A;  1E6G A;  2OI3 A;  1ABQ A;  2EPD A;  2DYB A;  1Y57 A;  3TSW A;  1GBQ A;  2KYB A;  1X69 A;  1E7O A;  2EQI A;  1H92 A;  2VWF A;  1NYG A;  4AG1 C;  3CQT A;  4CC4 B;  4RTT A;  2BZX A;  4Z88 A;  1T0J A;  1QKW A;  1AVZ C;  3C0C A;  5FWC A;  1GBR A;  2C0O A;  2LJ0 A;  4QT7 A;  2JW4 A;  5I22 A;  5IHI A;  3H41 A;  1RUW A;  1S1N A;  5L23 A;  1ZUK A;  2M51 A;  4JJD A;  2EVR A;  2KXC A;  1T3S A;  2LJ1 A;  1JO8 A;  2JMA A;  2GGR A;  4ORZ A;  4GBQ A;  2OJ2 A;  2IIM A;  2LZ6 B;  1CKB A;  3I35 A;  1WI7 A;  1G83 A;  4J9E A;  2DRM A;  1GCQ C;  2K7A A;  2D8J A;  2KGT A;  5IXB A;  2K3B A;  4M4Z A;  3LH5 A;  3NGP A;  4IIM A;  1WFW A;  1UG1 A;  3TSZ A;  1GFD A;  1V1C A;  2RQT A;  2X3W D;  4ESR A;  1UGV A;  1SRL A;  3JV3 A;  1M3B A;  4JPB W;  1B07 A;  4RTV A;  3VRY A;  2EYX A;  1YN8 A;  2DL5 A;  2JTE A;  4DEX A;  1K0S A;  1ARK A;  2BZ8 A;  1QWF A;  2J6K A;  2EGA A;  1X43 A;  2F2W A;  1ZX6 A;  3R6N A;  1X27 A;  2JS0 A;  1ZUY A;  2LP5 A;  4AFQ C;  1H8K A;  2RQV A;  4J9I A;  4OMO A;  2HSP A;  2LMJ A;  2EGC A;  4RTU A;  1PKT A;  1PNJ A;  2KR3 A;  1RLP C;  1W6X A;  2FRW A;  2YUO A;  2AK5 A;  1YWP A;  2K2M A;  1PKS A;  3M0R A;  2DL7 A;  3VS7 A;  3EG3 A;  2KNB B;  5I11 A;  1AOJ A;  3M0Q A;  4OMN A;  2DL4 A;  3NMZ C;  5ECA A;  2ROL A;  2W10 A;  1E6H A;  2DA9 A;  3EHQ A;  3EHR A;  2C0I A;  2EGE A;  2K9G A;  3M0T A;  2E5K A;  2W0Z A;  2DVJ A;  1TUD A;  2V1Q A;  1ABO A;  4JJC A;  4OMP A;  2GNC A;  3VS3 A;  2FPF A;  2K6D A;  1RLQ C;  1UUE A;  2DJQ A;  2J05 A;  1QCF A;  2O2O A; 
#chains in the Genus database with same CATH topology
 4RCB A;  2LX9 A;  1YBY A;  4J9D A;  2ESW A;  3QJ6 A;  3NTK A;  4ELZ C;  2KMT A;  1ACM B;  3QZ9 B;  4M7A D;  3SFM A;  2J06 A;  4A4F A;  2ENM A;  3I56 Q;  1BK2 A;  2QEX T;  1FXX A;  4N4G A;  4F04 B;  3REA B;  4CC7 A;  3VV0 A;  1MMD A;  4PJO G;  2P4R A;  3EG0 A;  3M55 A;  4IUU A;  3CCR A;  2A28 A;  2D0N A;  3MEU A;  4HVW A;  4DBH A;  2SEM A;  4F7U A;  1T3L A;  1R77 A;  4KBM B;  1YJ9 T;  1WLP B;  3LW5 E;  4MZT A;  2SRC A;  3CPW P;  2CSI A;  2DXT A;  3NPF A;  3FRN A;  3VUZ A;  3VS1 A;  1GRI A;  2EYW A;  4FL6 A;  4PJO B;  9ATC B;  1M4Z A;  1VQ9 T;  2X4W A;  2QK0 A;  3G4S A;  5GMK l;  4XTW A;  3E19 A;  4DA4 A;  3PE0 A;  2MOX A;  1HD3 A;  2V1R A;  3I5S A;  3JCM h;  4BI4 A;  1KFZ A;  2R57 A;  3RUX A;  4MDW A;  3KBG A;  3I56 A;  2M0Y A;  2E41 A;  4CC2 A;  4J5Y A;  2QTX A;  2KRO A;  1NLP C;  2OAW A;  3MCA B;  2VUB A;  1X01 A;  4PJM A;  2LCC A;  3X20 B;  1G3W A;  4ZTF A;  2FEI A;  5GAN 5;  1Q86 U;  2JXB A;  1OEB A;  2QEX Q;  2GBQ A;  4ME7 A;  2RI2 A;  4LDU A;  1LVK A;  1CSK A;  3OYC A;  3V8K A;  1KQS A;  2H3E B;  3A5Z B;  2ATC B;  3FJP A;  4M7A A;  1KC8 R;  2F2V A;  4OMM A;  4JLI A;  4X34 A;  2OTL T;  3ME9 A;  4A4E A;  4C5H A;  2KVQ G;  2GFU A;  5I2M A;  1MHN A;  5GAN g;  4J6X A;  2DYI A;  2RH2 A;  3QPH A;  1KQ2 A;  3PVQ A;  4M75 E;  4PLL A;  4FIB A;  2RPN A;  2X51 A;  3ULR B;  1WJS A;  1VQ9 Q;  2F5K A;  3CC4 Q;  1NM7 A;  3EG1 A;  1UE9 A;  1H3Z A;  1K9A A;  4J9H A;  5GMK h;  3I5R A;  2JJ9 A;  3KFV A;  4KGV B;  3OBY A;  4F16 A;  1NBE B;  3JSC A;  3DLL A;  1RAG B;  4DBF A;  3OS5 A;  1R0B G;  1M2V B;  3QJY A;  4C0Z A;  3RMQ A;  4HT8 A;  1VQK T;  2D1X A;  2QEX A;  5GAN j;  1K9M U;  2RM4 A;  5GMK m;  2H8H A;  1I5L A;  3EH2 A;  3JB9 I;  1M3A A;  2J6O A;  1ZUU A;  2COY A;  1QP2 A;  1K9M C;  1OU8 A;  1WXT A;  3OA6 A;  5LJ5 g;  4A4K A;  2DIL A;  3QZ5 B;  4XK8 E;  4PJO F;  2KT1 A;  2P0Q A;  2DIQ A;  1TTH B;  4N0A A;  1KJW A;  1J3T A;  1AHJ B;  1VQM T;  3HFO A;  1WHG A;  3VKI A;  3OSS C;  1VQP T;  1Q95 G;  4C92 D;  2CZ0 B;  3UDC A;  3VS0 A;  4AG2 C;  1D3B B;  1NZ9 A;  1TSF A;  3BE3 A;  1GFC A;  1VQ9 A;  2OTL Q;  1BYM A;  1NEB A;  2C0T A;  2CYZ B;  3P8D A;  1W1F A;  4E7H A;  2EYZ A;  2AKK A;  3BFM A;  2LQW A;  4J7I A;  1R8O B;  1MMA A;  2YWW A;  1M2V A;  4IUP A;  4JZ3 A;  3OYE A;  1VQ4 T;  1VQN T;  5KYW B;  1YNZ A;  5LJ5 j;  2R5M A;  1HJD A;  3O8V A;  1KK7 A;  3CCL T;  4HVV A;  1RAA B;  5GAN d;  4AFS C;  2A3L A;  4EPC A;  2V8K A;  1VQ6 T;  5KYN A;  5GAO l;  1OYX A;  4JDS A;  1SSH A;  2BIV A;  1G2B A;  3C12 A;  2O4X B;  2E70 A;  2DLP A;  2DER A;  2HKN A;  1H3H A;  2ABL A;  5FU6 C;  3THK A;  1VIF A;  3OYK A;  2I0N A;  4OVA A;  4CRI A;  5CO7 A;  3RR6 A;  1N8R R;  1JJ2 A;  2ROT A;  2CH4 W;  3CPF A;  3LX7 A;  4BB7 A;  3FDR A;  2OTL A;  4IUV A;  2QGF B;  1U8R A;  2MIO A;  3BDU A;  3TQ7 P;  1Q82 U;  1VQM Q;  3RNJ A;  5KCO A;  3HHT B;  5FW9 A;  2XDP A;  4K11 A;  3VU3 C;  3V8L A;  5LJ5 d;  3CEY A;  2EJG A;  1Q82 C;  4X9C A;  5IH2 A;  2NWM A;  5HKC A;  3PVL A;  3CCV T;  4EIK A;  1I8F A;  1BI2 A;  1OZ3 A;  1TU0 B;  4M7D C;  3NTI A;  1HYO A;  2LNV A;  3M5A A;  1VQ4 Q;  3VS4 A;  1VQN Q;  3BW1 A;  1U1T A;  1G3T A;  4ZN1 A;  3QKJ A;  2HDA A;  3FIF A;  5GAN f;  1VQ8 Q;  2L3R A;  3CC2 T;  4N4H A;  4BE2 A;  1VQK A;  2FZK B;  1VQ6 Q;  3UAT A;  3QWX X;  1IO6 A;  1E6G A;  1KD1 U;  4MML A;  2KY9 A;  3QG1 A;  1KD1 C;  3R6O A;  2DD5 A;  1ZSZ C;  3TSW A;  2KAF A;  1RAH B;  3JCM Q;  2XID A;  3G7Z A;  4L59 A;  1E7O A;  1VQM A;  5GAO m;  3OS1 A;  4AG1 C;  4C8Q C;  1VQP A;  4Z02 A;  2BZX A;  3M9Q A;  4Z88 A;  5HK3 A;  2RJC A;  3BDL A;  4KUD K;  1GBR A;  5KE2 A;  2F5T X;  4QT7 A;  4ZN3 A;  3H41 A;  1RUW A;  5L23 A;  5LJ5 f;  1G5V A;  5GAN 8;  1GXI E;  1MND A;  3SWN B;  1VQ4 A;  1VQN A;  2VB6 A;  2JMA A;  2GGR A;  3CCV Q;  2OJ2 A;  2VV5 A;  3S3M A;  1RI0 A;  2CS7 A;  1VQ6 A;  4M7D D;  1VIE A;  1Q86 R;  1WHJ A;  3P8B B;  3G1J A;  3M59 A;  4PJO E;  3GOX A;  2Y4X A;  4J8O A;  5FU6 B;  3NGP A;  5DLQ E;  3TSZ A;  5LJ3 g;  1GFD A;  1V1C A;  4RKU E;  2ZAE A;  3JV3 A;  2QQ9 A;  3JB9 H;  4ZGJ B;  1QVF S;  5IAY A;  1D1B A;  3C4S A;  2JTE A;  3V7C A;  5GAN e;  5C6S A;  4RG8 A;  1WPY A;  2P0P A;  1M1K R;  4BI8 B;  3KXT A;  3SWN A;  4AFQ C;  1VQ5 T;  2RQV A;  2RI3 A;  4J9I A;  3I55 T;  2M02 A;  1OZ2 A;  2DXB A;  4RTU A;  1PNJ A;  4C8Q D;  2AIR B;  2AK5 A;  4XU2 A;  3CCV A;  1VQL T;  1C0M A;  2QDY B;  4WF2 A;  3EG3 A;  3H6Z A;  5I11 A;  7AT1 B;  4PLI A;  2DL4 A;  3NMZ C;  4IUQ A;  3RKW A;  2HSE B;  4M77 G;  3EHQ A;  3CC2 A;  1WHH A;  3VS3 A;  5LJ5 e;  2EFI A;  4BD3 A;  3OY9 A;  4IKF A;  5CKB A;  2K6D A;  3ZEH A;  1UEC A;  1QVG A;  4JRP A;  1JEG A;  2L89 A;  1YCY A;  1AT1 B;  5A0G A;  3PT9 A;  3JCM c;  2BZY A;  4Y91 A;  4M77 B;  2DZ9 A;  4C8Q B;  3M57 A;  3JCM g;  1TOV A;  4M7D A;  1UGQ B;  1KQS P;  2BE9 B;  4RMO A;  5KYU B;  2XG8 D;  1OQK A;  3EH1 A;  2JTF A;  5A0L A;  2FVU A;  3I9Q A;  1BBZ A;  4UC4 A;  1VQ5 Q;  3TRE A;  4EMK C;  1LOJ A;  4E7Z A;  1W2B A;  3I55 Q;  1EFN A;  5GJV B;  4OB3 B;  1PCX A;  1OX9 A;  1OV3 A;  3OQ5 A;  2EQJ A;  3O5Z A;  3V8J A;  2QQA A;  2KT8 A;  4A63 B;  1R0C B;  1VQL Q;  3CMA T;  3GLX A;  2DMO A;  2DK3 A;  4ZTJ A;  1D0X A;  4M78 G;  1M27 C;  1VA7 A;  1ZSZ A;  2JMC A;  2JTM A;  4OML A;  2LNH B;  1RAI B;  1GL5 A;  1PD1 A;  2CUB A;  4B9X A;  1U3O A;  1D1A A;  1SHF A;  4C8Q A;  1W70 A;  4Y92 A;  1WDX A;  4FSS A;  2VXE A;  4OMF B;  3TVT A;  2K5F A;  4JZ4 A;  1PWT A;  5KYU A;  2MAM A;  5KYY B;  2DXU A;  1JB0 E;  3FLG A;  2YLC A;  4M78 B;  1BU1 A;  1M1G A;  1VYV A;  2QQR A;  4HVU A;  2JT4 A;  3DLM A;  4PFO A;  1WZO A;  1BI1 A;  3V7S A;  1QW1 A;  2RMO A;  2K3X A;  1VQ5 A;  3EFR A;  1K8A U;  4F7U G;  5LJ3 f;  3I55 A;  2YUN A;  4LUD A;  4LDY A;  4LE9 A;  3HTR A;  1BB9 A;  2K2V A;  1K8A C;  2R5A A;  2QDL A;  3LYI A;  1WIE A;  5EG2 A;  4RTX A;  4QQD A;  2RK1 A;  1KQS S;  1VQL A;  3QDR B;  2YXY A;  3JCM d;  4AFU C;  3H0F A;  3OYL A;  2DTO A;  2L5Q A;  4QQG A;  1X6B A;  3VRZ A;  5GAN 4;  1FX7 A;  1UGR B;  1KSW A;  2QGG A;  1UDL A;  1WGS A;  3VS2 A;  4C0D C;  4FYW B;  3QII A;  1UHC A;  4F7U B;  3CCJ T;  2D9T A;  4ZNX A;  2AHJ B;  3CMA Q;  5GMK j;  4NL2 A;  4HCC A;  1JXO A;  3CXC A;  1OX8 A;  3HSB A;  3A8H B;  4M77 F;  2L3P A;  2E6Z A;  3QWY A;  1MV3 A;  1IHV A;  2LCS A;  2MK5 A;  4LUE A;  4AMC A;  2LCL A;  2L2P A;  3FJ5 A;  5FRO A;  1SEM A;  2YUP A;  1VQ7 T;  2A08 A;  1NJI U;  3S3N A;  1N6A A;  4XU1 A;  1Q7Y R;  2ZCF B;  4D6W A;  3OYH A;  1H64 1;  1OOT A;  2JN0 A;  2KBT A;  2XDB A;  4X1V A;  4KRT A;  3OW2 A;  3S3O A;  1NJI C;  2PUO B;  4EMK B;  1AWX A;  4M7A G;  2FPD A;  4P5N A;  3M0U A;  1W4S A;  1RAC B;  3RKY A;  1XOV A;  1N5Z A;  3VS6 A;  5IN1 A;  3JCM f;  3CMA A;  4GY5 A;  2GTO A;  2HAX A;  5LJ3 e;  4AFZ C;  2P84 A;  4M7A B;  3H8Z A;  2CZ6 B;  3CCJ Q;  4RTY A;  3CCE T;  4M78 F;  1PRM C;  5CVI A;  2LQN A;  2KYM A;  4E7J A;  2FPE A;  4PJN A;  3GP8 A;  2LQ8 A;  2DPP B;  4EMK A;  1QKX A;  2IPO B;  1YFN A;  3URG A;  1KHC A;  2DTI A;  2EAY A;  3UA7 A;  1AWW A;  3CBP A;  1UTI A;  1NG2 A;  4QW2 A;  4KUL A;  2CSQ A;  1VQ7 Q;  2E10 A;  2L0A A;  3CCM T;  3JCM J;  1M90 C;  3L2V A;  2KE9 A;  3HRT A;  1Y96 B;  2AZV A;  2GFA A;  4MDX A;  2K3Y A;  2MYS A;  1TH7 A;  2YSQ A;  4A4G A;  4C92 C;  4C0F A;  4F7U F;  2GQI A;  3UT1 A;  5CKF A;  2IVW A;  1WQ7 A;  2COZ A;  2CP5 A;  3JB9 G;  3MP8 A;  1SF9 A;  4EDU A;  4J9F A;  1YJ9 Q;  4JRQ A;  4J6W A;  2KQW A;  3ASK A;  1WXU A;  2PUK B;  3CCJ A;  2RQR A;  3J7A F;  2O9S A;  2O88 A;  4DQ2 A;  3CPW S;  2RK2 A;  1I1J A;  3CCQ T;  4DEY A;  1KIK A;  2KRS A;  4AT1 B;  2QA4 T;  2HBP A;  1Q81 R;  3S6W A;  5D7U A;  3JCM e;  3CCE Q;  4E7K A;  2DNU A;  3GF5 A;  4LD6 A;  1OPL A;  1Y96 A;  2FZC B;  3V7R A;  1VQ7 A;  3ZL7 C;  3JCM P;  4XTU A;  2WSF E;  2ZPI B;  1IB8 A;  3QSU A;  2CP3 A;  1VUB A;  2DKG A;  1ABQ A;  3HFN A;  1TXQ A;  5J39 A;  2GCX A;  4XTV A;  1NPR A;  1UGP B;  3CCM Q;  5I2S A;  2KYB A;  3CBO A;  1YJ9 A;  1EIF A;  1Y7X A;  2XK0 A;  2EQI A;  4M7A F;  1H92 A;  2VWF A;  2LRQ A;  4QQ6 A;  4M77 E;  2E64 A;  4A4H A;  2RD1 A;  4OB1 B;  4LDX A;  2LJ0 A;  5I22 A;  2JW4 A;  5IHI A;  4KGX B;  6AT1 B;  2M9U A;  1ZUK A;  5FRN A;  4LDW A;  3CCE A;  4V2S A;  2COW A;  4JJD A;  5LL6 S;  3F70 A;  1JO8 A;  1P92 A;  3L42 A;  3CCQ Q;  2CZ7 B;  2LT4 A;  3LWH A;  2LZ6 B;  5GMK e;  2L8D A;  2QA4 Q;  3I35 A;  2M1H A;  3VJP A;  4BAC A;  3JCM X;  2K7A A;  2G3R A;  2KGT A;  1RAF B;  1K73 U;  3MJX A;  4OB0 B;  2AT1 B;  2EJF A;  5C0M A;  1VQK Q;  3CCM A;  1K73 C;  2Z0W A;  2DVE A;  3J80 E;  3TU4 K;  4C92 B;  3LGF A;  4RTV A;  2EYX A;  2RJF A;  4IUR A;  1M1F A;  2K57 A;  4JRK A;  1TUG B;  3M56 A;  3HKS A;  1PSE A;  3C94 A;  1IHW A;  1X43 A;  2HL5 C;  1X27 A;  2JS0 A;  3NTH A;  3A8O B;  4OMO A;  2HSP A;  2LMJ A;  2EGC A;  4Q5W A;  3CD6 T;  3JB9 F;  5KH6 A;  1VQP Q;  4FYX B;  1W6X A;  1YIT T;  1WHM A;  2VYT A;  3HPW A;  3CCQ A;  2K2M A;  3PIO A;  3VS7 A;  1C6V X;  2QA4 A;  1VQO T;  4BDY A;  4ZGD B;  1SKU B;  4DBR A;  4OMN A;  2HNI A;  4M75 C;  2DZC A;  5KE3 A;  2C0I A;  3CCL Q;  2KDS A;  4C92 A;  3M0T A;  2JNG A;  2W0Z A;  4N4I A;  1TUD A;  4OMP A;  3HL8 A;  2ZPG B;  2HQX A;  1RLQ C;  2DJQ A;  1QCF A;  4Z8A A;  1BCM A;  3GNF B;  4ELY C;  5KCH A;  5HK0 A;  3UA6 A;  4JLG A;  1HSQ A;  2CT4 A;  2KEA A;  4JRI A;  1K1Z A;  2PVD B;  2I2L A;  4R56 A;  1FMK A;  2PQW A;  1QMC A;  1B7T A;  3LGL A;  1N9R A;  2DFU A;  2HCK A;  2FRY A;  2ZGW A;  2QTV A;  3CD6 Q;  1K4U S;  2WSE E;  1YWO A;  1YIT Q;  2YUQ A;  3CXC P;  3CCL A;  4BE1 A;  2EKH A;  2WSC E;  3TCJ A;  2EBP A;  1PHT A;  4GLM A;  4J6Y A;  1VQO Q;  2EJ9 A;  2JVV A;  1QQJ A;  4F14 A;  2F1L A;  2QG9 B;  4M75 D;  1G8X A;  2MF2 A;  5GAN 2;  3CC7 T;  2EQM A;  5GAM h;  1S72 T;  3CC2 Q;  3D7S B;  3M0P A;  3Q1J A;  3JCM V;  1YJN T;  2EQK A;  2YHT A;  4M7A E;  2DIG A;  2FZG B;  3SD4 A;  2E1H A;  3OYY A;  4E7L A;  3OW2 P;  1ZHI A;  2CUD A;  3LLR A;  5J26 A;  4M7D G;  3ZFJ A;  1G3S A;  5FU7 C;  4CC3 A;  1KQ1 A;  2KRM A;  2DJZ A;  1RAD B;  1YI2 T;  1NPP A;  2CRE A;  2VGN A;  5GAN 6;  2PZ1 A;  3CME T;  1JU5 C;  1YP5 A;  2OX7 A;  3L1A A;  2YRV A;  2DD4 A;  3UPU A;  3CD6 A;  1OI1 A;  4QVC A;  3EGX B;  3RBB B;  1XTD A;  1TUC A;  4MZM A;  5LJ3 j;  1YIT A;  4M7D B;  4C5I A;  2JM8 A;  3GIB A;  4KUI A;  1VYU A;  2K79 A;  4M75 B;  2VXF A;  1VQO A;  3DB3 A;  1QWE A;  2MMP A;  5GAO n;  2O31 A;  2E65 A;  3RIR A;  1YCS B;  5GAN 7;  3EFS A;  2XU8 A;  4HA8 A;  2DBM A;  1OPK A;  1U1S A;  1WHL A;  5CR2 A;  2Y4Y A;  5CQX A;  4FT4 A;  2H3J A;  4JS5 A;  1K9M R;  4C8Q G;  2XIC A;  3REB B;  2IG0 A;  1UFF A;  3VYH B;  2MWP A;  3PMI A;  3FC3 A;  1UGS B;  4BDZ A;  1K76 A;  2O9V A;  2JM9 A;  2E6N A;  3MHX A;  1ZSZ B;  1MMG A;  3CC7 Q;  4BI3 A;  1S72 Q;  4OB2 B;  5HCK A;  2RJE A;  3H0H A;  2CP0 A;  1YJN Q;  1KC8 C;  3PIP A;  2RO0 A;  3EGX A;  2E3I A;  3H0I A;  4J9B A;  5A0D A;  3SHW A;  4PK4 A;  1SRM A;  2XMF A;  4B9W A;  4Z89 A;  5LJ3 d;  4M75 A;  3OW2 S;  2QQS A;  4HKE A;  1EX4 A;  1YI2 Q;  3OSV A;  1AZE A;  1XJW B;  4ATO A;  3CME Q;  4D8D A;  1Z9Z A;  1VYT A;  3RDV A;  2RHI A;  3TEE A;  5IHK A;  1M30 A;  1DJ7 B;  2J6F A;  1MV0 B;  2DAQ A;  4A54 A;  4JUV A;  1T0H A;  3JB9 J;  2KXD A;  4RUG A;  2XHC A;  2QAZ A;  3WVE B;  1M2O A;  5GMK i;  1CKA A;  2BUD A;  2ZPF B;  2MCN A;  3LH0 A;  4LNP A;  2RHZ A;  1D0Y A;  3PFS A;  1FYN A;  3CC7 A;  4LN2 A;  1G3Y A;  1S72 A;  2F2X A;  1X6O A;  1PC0 A;  1YJN A;  3OYB A;  2MWO A;  2E5Q A;  1HXD A;  2RQU A;  3OYG A;  4R0K A;  4PJO C;  2X3X D;  2CDT A;  5GAO r;  1ZBJ A;  2DTH A;  3CBM A;  1Q82 R;  1B3Q A;  1YI2 A;  4PFZ A;  5CQY A;  1I81 A;  3HRU A;  4M7D F;  1RI9 A;  2V8J A;  3CME A;  3M58 A;  3PGG A;  3EAE A;  1TG0 A;  1B34 B;  1QVF A;  3ZBD A;  2DBK A;  2XDD A;  2ZZD A;  1ZA1 B;  3U23 A;  3X26 B;  2CP7 A;  3QYG B;  3IQL A;  1UJ0 A;  4A53 A;  1X2Q A;  2MI6 A;  4HCK A;  1PD0 A;  3OMG A;  2L3S A;  2ED0 A;  1TS9 A;  2XKO C;  1XQH A;  2DL8 A;  3EGD B;  4HT9 A;  2O01 E;  2RHX A;  2GQV A;  1NLO C;  1HK9 A;  4ANJ A;  1KD1 R;  2CP6 A;  4C0G A;  1RAE B;  4ZGE B;  2VKN A;  4X9D A;  4C8Q F;  1FMV A;  2LJ3 A;  1N8R C;  2C06 A;  2B8A A;  2P4T A;  2NUZ A;  1BIB A;  2DRK A;  1QP3 A;  1B34 A;  1I0C A;  3QDF A;  4LD9 K;  3GBQ A;  2BKD N;  3MEV A;  1X6G A;  4NS5 A;  4PJO D;  1JJ2 P;  2K5L A;  2RHU A;  5CIU A;  4PJJ A;  4HCB A;  2ZPE B;  2QI2 A;  2OAU A;  2DO3 A;  2HMA A;  1Y57 A;  4OF1 A;  1IZ6 A;  2FHD A;  2NUP B;  3L2Q A;  2K5I A;  3CCU T;  3EGD A;  4VUB A;  5CCA A;  2X35 A;  2FL7 A;  3MEW A;  4CC4 B;  3T9N A;  4RTT A;  2E12 A;  2RHY A;  1QKW A;  3C0C A;  2C0O A;  2JZ2 A;  2BE7 D;  1XNI A;  4QKU A;  2DEQ A;  3QHS A;  4R55 A;  2M51 A;  8AT1 B;  2HKQ B;  4C5G A;  1T3S A;  3EFO A;  2LJ1 A;  2DXC A;  2HL3 A;  3OMC A;  1UB4 A;  4ORZ A;  4GBQ A;  1RL2 A;  1QCO A;  2IIM A;  1LNX A;  4XTY A;  1WI7 A;  3CC4 T;  2DRM A;  1GCQ C;  1BI0 A;  5DLO A;  4KT0 E;  2FYK A;  4EMG A;  5IXB A;  2K3B A;  2NUP A;  2D0Q B;  2EWN A;  4OGE A;  4M4Z A;  4PNO A;  1M90 U;  4IIM A;  2RB6 A;  3L2W A;  2XI9 A;  1I4K 1;  1UGV A;  1SRL A;  1YN8 A;  1M5Q 1;  1ZBX A;  4E7S A;  1ARK A;  3C95 A;  4JS4 A;  2BZ8 A;  3JB9 D;  1QWF A;  2WAC A;  2EGA A;  1JJ2 S;  2F2W A;  3RKX A;  4C0D B;  2JUF A;  4FT2 A;  3CCU Q;  1D09 B;  3MEA A;  1YHQ T;  1Q86 C;  2LVM A;  1YJW T;  4PJO A;  1PKT A;  1ZA2 B;  2QXF A;  3GPL A;  2KR3 A;  2FRW A;  4J7F A;  2KSS A;  2RA2 A;  4FW2 A;  2M16 A;  4XU0 A;  3AT1 B;  1PKS A;  3M0R A;  2DL7 A;  3MKD A;  2KNB B;  2E4H A;  1AOJ A;  3NFC A;  1M1K U;  4M7D E;  4NL3 A;  4B6M A;  5DM7 R;  2ROL A;  2W10 A;  2DA9 A;  3EHR A;  1M1K C;  2K9G A;  2DVJ A;  4XU3 A;  4JJC A;  1IGU A;  2GNC A;  3OS0 A;  1MMN A;  2KK4 A;  2J05 A;  2V8I A;  4F17 A;  2LX7 A;  3EGU A;  3DKM A;  3SB2 A;  1AEY A;  3VS5 A;  1Y71 A;  2QAS A;  2RQW A;  3CCU A;  2JOY A;  5GAM g;  4NOY A;  3L2R A;  2CGH A;  3OYJ A;  3E2U A;  3OYF A;  4HXJ A;  3AHU A;  4C8Q E;  1YHQ Q;  4J83 A;  4L6V 5;  2FB7 A;  1SHG A;  1YJW Q;  4KH0 B;  4QVD A;  5CKD A;  2EQU A;  3G6E T;  1K0X A;  2X9H A;  1AD5 A;  1PSF A;  1BIA A;  1I5O B;  2P0K A;  2RI5 A;  3M0S A;  1ZSG A;  5M9O A;  1M8V A;  4C92 G;  1X2K A;  5GAM j;  2G6F X;  1QVG P;  3CC4 A;  4XQ3 A;  3X28 B;  2RN8 A;  3N5B B;  5EC7 A;  3RES A;  3DB4 A;  1AWO A;  1K8A R;  3MET A;  2YT6 A;  1WX6 A;  1VQ8 T;  3SWN C;  4FSX A;  3VYG A;  1Y07 A;  1UEB A;  4J9C A;  4RTW A;  1Y0M A;  5D6X A;  2X4J A;  3PNW C;  3GNG A;  2HBW A;  4E6R A;  2PNI A;  5AYF A;  1AZG B;  1UHF A;  3HRS A;  1W2B P;  1SPK A;  3A8L B;  2ZPB B;  3EG2 A;  3PTA A;  4M78 E;  1MGQ A;  1YHQ A;  5L8R E;  3PMT A;  5CAI A;  3UF4 A;  1YJW A;  3QO3 A;  1D3B A;  1GCQ A;  5I21 A;  4FCY A;  2LT1 A;  1V76 A;  3M54 A;  5GAM d;  3M4G A;  4OP0 A;  4DOW A;  2DX1 A;  1WXB A;  2CH4 A;  5KYW A;  2HQE A;  2EYY A;  3G6E Q;  3G71 T;  1I07 A;  4HCZ A;  3KUF A;  2DEU A;  1NJI R;  2DE0 X;  2RF0 A;  3JRZ A;  5A2Q E;  2YRD A;  3CPW A;  2YDL A;  3OYI A;  3UWN A;  3SEM A;  5GJW B;  5HY6 A;  4FM4 B;  3RMS A;  4F7U E;  1QVP A;  2F69 A;  2O4X A;  1NEG A;  1TWB A;  3OB9 A;  2E3H A;  5CKE A;  4TVR A;  1QVG S;  2PU9 B;  3OBW A;  1SG5 A;  2EW3 A;  2VC8 A;  2YLB A;  2A0F B;  4MMK A;  4J9G A;  8ATC B;  4O6J A;  1QVF P;  2PTK A;  1WHK A;  1OU9 A;  2NYS A;  3OYD A;  2J7I A;  3NHN A;  5GAO p;  1YIJ T;  4KH1 B;  4YTL A;  1UJY A;  2CKK A;  5FRM A;  4OMQ A;  3X25 B;  1M3C A;  2ED1 A;  5GAN h;  4RTZ A;  4LDV A;  3A8M B;  5FWB A;  4KGZ B;  1BKB A;  1PRL C;  3OS2 A;  1QLY A;  2X4X A;  1W2B S;  3OYA A;  3M53 A;  4XTZ A;  2GF7 A;  5AT1 B;  3G6E A;  3MP6 A;  1C1A A;  1MUZ A;  2A36 A;  1MNE A;  4XTX A;  2L3Q A;  4M77 C;  2ECZ A;  5GAM f;  2OTJ T;  1Q7Y U;  1EZZ B;  2X4Y A;  4IIO A;  1NE8 A;  2AKL A;  4C5E A;  2DF6 A;  2JS2 A;  2CZ1 B;  2YRC A;  3WVD B;  5D6W A;  1WYX A;  1M90 R;  3G71 Q;  1Q7Y C;  2HEQ A;  2VAS A;  4C92 F;  1BI3 A;  1IRX A;  1WJR A;  1M9S A;  2Y90 A;  3L2U A;  4PFP A;  4BUG A;  3M4Y A;  5IHN A;  5IXF A;  1OUL A;  1VQ8 A;  1N9S A;  1JRI A;  3JCM W;  4JJB A;  1BCO A;  3HP9 A;  4RG2 A;  1A0N B;  1LCK A;  1AWJ A;  2KRN A;  4D8K A;  1Z9Q A;  4E47 A;  5LJ5 h;  2VVK A;  2D8H A;  4OGC A;  3JAM E;  1LJO A;  3H9N A;  3A98 A;  2VGM A;  4M75 G;  1D0Z A;  3E9G A;  3CCS T;  2R58 A;  3QUI A;  4WCI A;  2HD0 A;  3MPU B;  4MZP A;  1X75 C;  1QCN A;  2GTJ A;  2FO0 A;  1YIJ Q;  2FG0 A;  1JXM A;  1JQQ A;  2BTT A;  2M0O A;  3JCM b;  4M78 C;  3J81 E;  1WA7 A;  2A37 A;  3G71 A;  1ZQ1 A;  1U5S A;  2DM1 A;  4FW1 A;  1M8M A;  4M77 D;  2CT3 A;  2OTJ Q;  2V26 A;  3E1S A;  2ZPH B;  3FEO A;  1VOM A;  4L5G A;  2LC4 A;  3QBY A;  1KG1 A;  2RNA A;  5CKH A;  4BY6 C;  4JJN K;  3CXC S;  1NYF A;  3EG9 B;  2K4Y A;  4XAX B;  1KC8 U;  1WNL A;  5GAM e;  3OYN A;  5CK9 A;  2B86 A;  1GCP A;  2DL3 A;  1ZLM A;  2LTO A;  2NLU A;  3BY7 A;  3X24 B;  2PVO B;  4E2F B;  4E7I A;  2QYZ A;  4II1 A;  1U06 A;  3INZ A;  2AZS A;  2KI7 A;  2OI3 A;  1YIJ A;  3SDZ A;  1IGQ A;  3CCS Q;  1WJQ A;  2EPD A;  1Q81 U;  5KYX B;  2DYB A;  3VUB A;  1GBQ A;  2RJD A;  3A8G B;  1Q81 C;  1X69 A;  2EIF A;  1NYG A;  3MO8 A;  3OYM A;  3CQT A;  2OTJ A;  1T0J A;  1AVZ C;  5GAO q;  3EG9 A;  4M78 D;  3CCR T;  5FWC A;  1K73 R;  2CP2 A;  1S1N A;  4GLK A;  3ER0 A;  1IRE B;  3WXM B;  1SSF A;  2EVR A;  2KXC A;  2EKO A;  4RCC A;  4DOV A;  4DBQ A;  2QQB A;  4FU6 A;  5DY9 A;  4PKC C;  4FYY B;  3MP1 A;  1LPL A;  5FU7 B;  3A1P A;  4QVZ A;  1CKB A;  3G4S T;  2D6F A;  1G83 A;  1FMW A;  4BE0 A;  1PG5 B;  4J9E A;  2D8J A;  5KYX A;  3FB9 A;  1JBM A;  5D6Y A;  3CCS A;  4M77 A;  1RAB B;  3LH5 A;  4M7A C;  2NUT B;  1WFW A;  1UG1 A;  1N27 A;  1KHI A;  1D1C A;  2RQT A;  2X3W D;  4FYV B;  4ESR A;  3I56 T;  1O75 A;  4M75 F;  1M3B A;  4JPB W;  4EMH A;  1B07 A;  3VRY A;  1V29 B;  2DL5 A;  4DEX A;  1K0S A;  3P8H A;  1FWZ A;  2J6K A;  3L2Z A;  2EYQ A;  1ZX6 A;  3R6N A;  5J3B A;  4C92 E;  4LXC A;  1ZUY A;  2LQK A;  1F1B B;  2LP5 A;  1H8K A;  1PM3 A;  2XD0 A;  2PVG B;  4IUT A;  1WQW A;  1RLP C;  3E9F A;  2YUO A;  4BY6 B;  3LWI A;  5IT9 E;  3CCR Q;  2MPX C;  4Y28 E;  1YWP A;  4PJL A;  2DET A;  2A7Y A;  1IXD A;  1O9S A;  1N8R U;  5GAN 3;  2NUT A;  3M0Q A;  5LJ3 h;  5FLX E;  5ECA A;  4PL6 A;  1E6H A;  2EGE A;  5KYY A;  3RER A;  2E5K A;  2HZY A;  2LDM A;  4O5V A;  2HQH A;  2V1Q A;  4M78 A;  1ABO A;  3EFO B;  4N0A C;  3G4S Q;  2FPF A;  3QXE B;  1UUE A;  4WTO B;  3QYH B;  4CI0 C;  2O2O A; 
#chains in the Genus database with same CATH homology
 1UEC A;  4J9D A;  2ESW A;  4Z8A A;  4F17 A;  1JEG A;  2LX7 A;  3EGU A;  2J06 A;  2ENM A;  3UA6 A;  3VS5 A;  1AEY A;  2BZY A;  1BK2 A;  1HSQ A;  2RQW A;  2CT4 A;  2KEA A;  3REA B;  1K1Z A;  4CC7 A;  1FMK A;  2P4R A;  3EG0 A;  4HXJ A;  2HCK A;  3I9Q A;  1BBZ A;  2A28 A;  2D0N A;  4HVW A;  2SEM A;  1T3L A;  2FRY A;  1SHG A;  1EFN A;  5GJV B;  1WLP B;  1K0X A;  2SRC A;  1K4U S;  2CSI A;  1OV3 A;  1AD5 A;  1YWO A;  3NPF A;  3O5Z A;  3VS1 A;  1GRI A;  2KT8 A;  3M0S A;  4A63 B;  2YUQ A;  1ZSG A;  2EYW A;  2DMO A;  2EKH A;  1X2K A;  2EBP A;  1M27 C;  1PHT A;  4GLM A;  1VA7 A;  2G6F X;  2JMC A;  4F14 A;  4OML A;  2LNH B;  1GL5 A;  2RN8 A;  2CUB A;  5EC7 A;  1AWO A;  3PE0 A;  2MOX A;  1U3O A;  1HD3 A;  1SHF A;  2V1R A;  2YT6 A;  3I5S A;  1W70 A;  4Y92 A;  1KFZ A;  3M0P A;  1WDX A;  1WX6 A;  4FSS A;  3TVT A;  4J9C A;  4RTW A;  2M0Y A;  4CC2 A;  4JZ4 A;  1Y0M A;  1PWT A;  2KRO A;  2CUD A;  1NLP C;  2OAW A;  2HBW A;  4E6R A;  2PNI A;  4CC3 A;  1BU1 A;  1VYV A;  1AZG B;  1UHF A;  2JT4 A;  4HVU A;  2FEI A;  2KRM A;  1SPK A;  2CRE A;  2RMO A;  2PZ1 A;  3EG2 A;  2JXB A;  1OEB A;  1JU5 C;  1YP5 A;  2GBQ A;  3UF4 A;  2YUN A;  4LUD A;  4LE9 A;  1BB9 A;  1GCQ A;  3RBB B;  1CSK A;  1TUC A;  2QDL A;  1WIE A;  2JM8 A;  4RTX A;  2F2V A;  4OMM A;  1VYU A;  4AFU C;  3H0F A;  2K79 A;  2DX1 A;  1WXB A;  1X6B A;  3VRZ A;  2CH4 A;  1QWE A;  1KSW A;  2EYY A;  1UDL A;  2O31 A;  3VS2 A;  1YCS B;  1I07 A;  2DBM A;  1OPK A;  2DE0 X;  1UHC A;  2RF0 A;  4ZNX A;  3PVQ A;  2YDL A;  2RPN A;  3SEM A;  3ULR B;  1JXO A;  5GJW B;  3REB B;  1NM7 A;  1UFF A;  3EG1 A;  1UE9 A;  1K9A A;  2L3P A;  4J9H A;  1K76 A;  2O9V A;  1NEG A;  3I5R A;  3QWY A;  2JM9 A;  1MV3 A;  3KFV A;  2LCS A;  4LUE A;  4F16 A;  2L2P A;  3FJ5 A;  5HCK A;  3H0H A;  1SEM A;  2EW3 A;  2YUP A;  4J9G A;  2A08 A;  2PTK A;  2D1X A;  3H0I A;  4J9B A;  3SHW A;  1OOT A;  1SRM A;  2KBT A;  2XMF A;  2H8H A;  4X1V A;  2J7I A;  4KRT A;  3NHN A;  4Z89 A;  1M3A A;  2J6O A;  1ZUU A;  1UJY A;  1AWX A;  4OMQ A;  1WXT A;  1M3C A;  2ED1 A;  1AZE A;  2DIL A;  4RTZ A;  2FPD A;  5FWB A;  2KT1 A;  3M0U A;  1Z9Z A;  4D8D A;  1VYT A;  1PRL C;  1QLY A;  1KJW A;  1XOV A;  1MUZ A;  2A36 A;  5IHK A;  1J3T A;  1M30 A;  2J6F A;  2L3Q A;  1MV0 B;  1N5Z A;  1T0H A;  2ECZ A;  3VS6 A;  2KXD A;  3VS0 A;  4AG2 C;  2GTO A;  4IIO A;  4RUG A;  2AKL A;  1GFC A;  2DF6 A;  2JS2 A;  1NEB A;  1WYX A;  1CKA A;  2C0T A;  4AFZ C;  2HEQ A;  2MCN A;  1W1F A;  2EYZ A;  2AKK A;  4LNP A;  2LQW A;  4JZ3 A;  4RTY A;  1FYN A;  1PRM C;  4LN2 A;  2LQN A;  1YNZ A;  2F2X A;  2KYM A;  2FPE A;  5IHN A;  1HJD A;  5IXF A;  4JJB A;  4HVV A;  1A0N B;  1LCK A;  1AWJ A;  2KRN A;  4AFS C;  2RQU A;  4D8K A;  1QKX A;  4R0K A;  1Z9Q A;  2X3X D;  2VVK A;  2D8H A;  3UA7 A;  3A98 A;  2CDT A;  1AWW A;  1SSH A;  1UTI A;  1G2B A;  1ZBJ A;  1NG2 A;  2DLP A;  1B3Q A;  2CSQ A;  4WCI A;  1H3H A;  1RI9 A;  2L0A A;  2ABL A;  2GTJ A;  2FO0 A;  3THK A;  1TG0 A;  2KE9 A;  2DBK A;  2I0N A;  2AZV A;  2FG0 A;  1JXM A;  1JQQ A;  2BTT A;  2YSQ A;  3U23 A;  2GQI A;  2ROT A;  2CH4 W;  3IQL A;  1UJ0 A;  1X2Q A;  1WA7 A;  2A37 A;  4HCK A;  2MIO A;  4J9F A;  1U5S A;  1WXU A;  2DM1 A;  2L3S A;  3RNJ A;  2ED0 A;  1M8M A;  5FW9 A;  4K11 A;  2DL8 A;  2RQR A;  2CT3 A;  2O9S A;  1NLO C;  2O88 A;  5IH2 A;  2NWM A;  3PVL A;  1I1J A;  4EIK A;  2RNA A;  4DEY A;  1KIK A;  2KRS A;  2VKN A;  1NYF A;  3VS4 A;  2DNU A;  2B86 A;  1GCP A;  2LJ3 A;  2DL3 A;  1ZLM A;  2NUZ A;  2HDA A;  2DRK A;  1I0C A;  1OPL A;  3ZL7 C;  3GBQ A;  1U06 A;  1X6G A;  2AZS A;  3UAT A;  3QWX X;  1IO6 A;  1E6G A;  2OI3 A;  1ABQ A;  2EPD A;  2DYB A;  1Y57 A;  3TSW A;  1GBQ A;  2KYB A;  1X69 A;  1E7O A;  2EQI A;  1H92 A;  2VWF A;  1NYG A;  4AG1 C;  3CQT A;  4CC4 B;  4RTT A;  2BZX A;  4Z88 A;  1T0J A;  1QKW A;  1AVZ C;  3C0C A;  5FWC A;  1GBR A;  2C0O A;  2LJ0 A;  4QT7 A;  2JW4 A;  5I22 A;  5IHI A;  3H41 A;  1RUW A;  1S1N A;  5L23 A;  1ZUK A;  2M51 A;  4JJD A;  2EVR A;  2KXC A;  1T3S A;  2LJ1 A;  1JO8 A;  2JMA A;  2GGR A;  4ORZ A;  4GBQ A;  2OJ2 A;  2IIM A;  2LZ6 B;  1CKB A;  3I35 A;  1WI7 A;  1G83 A;  4J9E A;  2DRM A;  1GCQ C;  2K7A A;  2D8J A;  2KGT A;  5IXB A;  2K3B A;  4M4Z A;  3LH5 A;  3NGP A;  4IIM A;  1WFW A;  1UG1 A;  3TSZ A;  1GFD A;  1V1C A;  2RQT A;  2X3W D;  4ESR A;  1UGV A;  1SRL A;  3JV3 A;  1M3B A;  4JPB W;  1B07 A;  4RTV A;  3VRY A;  2EYX A;  1YN8 A;  2DL5 A;  2JTE A;  4DEX A;  1K0S A;  1ARK A;  2BZ8 A;  1QWF A;  2J6K A;  2EGA A;  1X43 A;  2F2W A;  1ZX6 A;  3R6N A;  1X27 A;  2JS0 A;  1ZUY A;  2LP5 A;  4AFQ C;  1H8K A;  2RQV A;  4J9I A;  4OMO A;  2HSP A;  2LMJ A;  2EGC A;  4RTU A;  1PKT A;  1PNJ A;  2KR3 A;  1RLP C;  1W6X A;  2FRW A;  2YUO A;  2AK5 A;  1YWP A;  2K2M A;  1PKS A;  3M0R A;  2DL7 A;  3VS7 A;  3EG3 A;  2KNB B;  5I11 A;  1AOJ A;  3M0Q A;  4OMN A;  2DL4 A;  3NMZ C;  5ECA A;  2ROL A;  2W10 A;  1E6H A;  2DA9 A;  3EHQ A;  3EHR A;  2C0I A;  2EGE A;  2K9G A;  3M0T A;  2E5K A;  2W0Z A;  2DVJ A;  1TUD A;  2V1Q A;  1ABO A;  4JJC A;  4OMP A;  2GNC A;  3VS3 A;  2FPF A;  2K6D A;  1RLQ C;  1UUE A;  2DJQ A;  2J05 A;  1QCF A;  2O2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...