2DRMA

Acanthamoeba myosin i sh3 domain bound to acan125
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
GPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the SH3 domain of Acanthamoeba myosin IB bound to Acan125
rcsb
source organism Acanthamoeba
molecule tags Contractile protein
molecule keywords Acanthamoeba Myosin IB
total genus 11
structure length 58
sequence length 58
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2drmA00
1VYUA 3M0SA 4AFZC 2M51A 2LJ1A 2MOXA 2J6OA 1GFDA 5HCKA 1M30A 2HEQA 1ZBJA 4J9GA 1E7OA 2NWMA 1UECA 2DF6A 2E5KA 5L23A 2X3XD 2YDLA 2V1QA 3EG2A 2HDAA 4AFQC 1U5SA 2HSPA 1LCKA 3H0HA 2D1XA 3JV3A 2KE9A 2CH4W 4HCKA 3VS7A 1WFWA 3QWXX 2RQWA 1Z9QA 2AZSA 2A08A 1EFNA 2ABLA 1B3QA 4WCIA 2EYYA 5IXFA 5ECAA 4F14A 1JO8A 2RQUA 1A0NB 1WXUA 4EIKA 1RLPC 4CC4B 4CC7A 4LN2A 2O2OA 2MCNA 2DYBA 1AWXA 2DLPA 2DNUA 4JZ4A 1SHGA 3ULRB 3EHRA 2YUOA 3KFVA 4K11A 5FWBA 1K9AA 2ED0A 2ESWA 1PKSA 1I07A 3UATA 2A37A 1ZX6A 1Z9ZA 1UG1A 2F2WA 1PRMC 4GLMA 2KNBB 2OJ2A 1GRIA 2YUQA 3R6NA 3M0QA 1WXBA 2LJ0A 1AEYA 2K3BA 1H92A 4J9EA 2LQNA 4J9CA 2YT6A 1QKXA 3I5SA 2DMOA 1PWTA 2KRNA 1AOJA 3TSWA 1NG2A 1U3OA 1VYTA 2L3SA 2QDLA 2FPFA 2GTOA 1WX6A 1NLOC 2D8HA 1UFFA 5FWCA 2EYXA 1PKTA 2KRSA 1PNJA 4OMLA 3NMZC 1E6GA 2ECZA 2DJQA 3VS2A 2NUZA 3ZL7C 2DRMA 4ORZA 2DRKA 2BZ8A 2LNHB 2BZYA 3UA6A 1AWJA 1I0CA 3UA7A 2CREA 1NEGA 2JT4A 3H41A 4IIOA 2CT4A 3EHQA 4RTZA 2K2MA 1ABOA 4AFUC 1B07A 2KT8A 1YP5A 2VVKA 2EPDA 2LJ3A 2W10A 3QWYA 1M3AA 4D8KA 1RI9A 1OPKA 1BK2A 2J7IA 2K79A 2KBTA 3REAB 1ARKA 2VKNA 2RF0A 1UHFA 2O88A 3NPFA 4HXJA 1W1FA 2BTTA 2LCSA 2L2PA 4DEXA 2KEAA 4LNPA 1X2KA 2DL8A 4Y92A 3I35A 1OPLA 1X43A 2DBMA 1NM7A 4Z89A 1WI7A 4RUGA 2HBWA 2PNIA 2DVJA 2V1RA 1NLPC 2K9GA 2JW4A 5IHNA 4LUDA 2AZVA 2FG0A 3A98A 2O9VA 1CKAA 4CC2A 4F16A 1SSHA 1SRMA 1WLPB 2DBKA 3U23A 2C0OA 4GBQA 5FW9A 1X27A 1TUCA 3EG1A 2DA9A 2RQVA 3EG3A 1U06A 1YWPA 2RMOA 1PRLC 2SRCA 4IIMA 4RTYA 2FO0A 1ZSGA 1RLQC 2PTKA 4J9FA 1X2QA 4A63B 1M3BA 3VS4A 2JMAA 3IQLA 2EYZA 1GBQA 4LE9A 2KXCA 1MUZA 2ENMA 5IHKA 2J05A 2IIMA 1KSWA 1GCQC 1H3HA 1N5ZA 1JEGA 2YUNA 5IXBA 3PVLA 1AZGB 1QLYA 1YNZA 1T3LA 3M0RA 1BU1A 4D8DA 2EGCA 2JS2A 2FRWA 2KGTA 2LMJA 2CDTA 1OOTA 2G6FX 3VRZA 1UUEA 1CSKA 2DL5A 2LZ6B 5EC7A 4LUEA 2GGRA 2MIOA 1S1NA 2KXDA 2AKKA 2K7AA 2CSIA 4R0KA 1HD3A 2JXBA 1K0SA 1KFZA 4AG2C 1Y0MA 1M8MA 1WXTA 1W6XA 3SHWA 5IHIA 2L0AA 2DE0X 2P4RA 4Z8AA 1Y57A 1QWEA 1UHCA 1BB9A 3SEMA 3M0TA 1AD5A 1GCPA 1IO6A 3REBB 1JXMA 2OAWA 1G2BA 2K6DA 1RUWA 2YUPA 1ZUUA 4KRTA 1YCSB 2C0TA 1UGVA 2AK5A 2LQWA 1OEBA 2L3QA 2BZXA 1SEMA 4CC3A 1T0JA 1TUDA 4FSSA 4ZNXA 4X1VA 4J9BA 1ZUKA 2OI3A 4Z88A 1I1JA 2YSQA 3VS3A 1SPKA 1UE9A 1G83A 4JJDA 1JQQA 4RTWA 1ZLMA 1AZEA 2W0ZA 4OMNA 1QWFA 2I0NA 1JXOA 2A28A 1GBRA 1GCQA 2DL3A 1V1CA 2DL7A 3H0FA 2EGAA 1VYVA 1WIEA 2O9SA 2O31A 1FMKA 4AG1C 2A36A 1UJYA 1SRLA 2CT3A 1AWOA 4E6RA 1AVZC 5I11A 1CKBA 2LP5A 1ABQA 2DL4A 3O5ZA 4ESRA 1NYGA 3NGPA 2J06A 5GJVB 4HVVA 1X6GA 1SHFA 2AKLA 1NYFA 2KROA 4OMMA 4HVUA 1J3TA 1HSQA 2ROTA 4HVWA 1QKWA 1GFCA 3FJ5A 1KJWA 1TG0A 3M0PA 2JM8A 2KYBA 1AWWA 2GBQA 4OMOA 4JZ3A 3I5RA 4JJBA 2DM1A 2SEMA 3EG0A 1FYNA 2EQIA 2HCKA 1W70A 2GTJA 2J6KA 2XMFA 5GJWB 2B86A 2M0YA 2CSQA 4J9HA 2VWFA 2KT1A 2EVRA 3LH5A 1YN8A 1WA7A 2J6FA 1K1ZA 1YWOA 2RQTA 4RTTA 3VS5A 1H8KA 1WYXA 3RBBB 1K4US 2KYMA 4J9DA 3NHNA 1MV3A 4QT7A 2FEIA 2RN8A 1NEBA 2F2VA 2EBPA 1M27C 2EW3A 2C0IA 1X6BA 1M3CA 3C0CA 3H0IA 2DILA 1PHTA 2D8JA 1BBZA 1JU5C 2L3PA 2KRMA 5IH2A 4JPBW 2CH4A 3I9QA 2EKHA 1UTIA 5I22A 2X3WD 4J9IA 1X69A 3RNJA 2RNAA 2EYWA 1OV3A 2H8HA 2KR3A 4M4ZA 4RTVA 4AFSC 2JM9A 2RQRA 3GBQA 3VRYA 1HJDA 2JMCA 2JTEA 3VS6A 1XOVA 2GNCA 2CUDA 1UDLA 2EGEA 2GQIA 1MV0B 4RTUA 4JJCA 3VS1A 3TSZA 4OMQA 1E6HA 2F2XA 3EGUA 3TVTA 1QCFA 3CQTA 3M0UA 3VS0A 1WDXA 3UF4A 2FPEA 2LX7A 1K0XA 2D0NA 2DX1A 4RTXA 2RPNA 3THKA 2PZ1A 4OMPA 4DEYA 1T0HA 3PE0A 4F17A 3PVQA 2FRYA 2CUBA 1K76A 1T3SA 1UJ0A 1GL5A 2ED1A 1VA7A 2JS0A 1ZUYA 2ROLA 1KIKA 2FPDA
chains in the Genus database with same CATH superfamily
4JRQA 2BKDN 2K3YA 4C92G 2DEUA 2M51A 3A8MB 5HCKA 4EMKC 3CMAA 1M30A 1NBEB 3SWNC 3ASKA 1Q7YU 1E7OA 2NWMA 2YRDA 2QASA 2K4YA 1YJWQ 3C94A 2YDLA 3QUIA 3G4SQ 4HKEA 2HSPA 3H0HA 4BE0A 4D6WA 3VS7A 2HZYA 1OU8A 2XK0A 1RAIB 3QWXX 4RG2A 1WQWA 2AZSA 3MO8A 2ABLA 2MAMA 4M78C 4WCIA 5CR2A 1RL2A 1VQ5T 3OBYA 4CC4B 4CC7A 3META 1K9MU 3FB9A 1Y07A 5D7UA 2DYBA 1PM3A 4E7LA 2DNUA 3ULRB 3EHRA 2YUOA 2WSFE 1KD1U 1K9AA 2A37A 4AT1B 1Z9ZA 1UG1A 4OB3B 1PRMC 2OJ2A 3R6NA 3SWNB 2D6FA 4A54A 1BI2A 1WHLA 3PT9A 3JCMd 4OVAA 4BY6C 1YJNT 4XQ3A 2P0QA 5KYYA 2QQAA 2RHIA 4J9CA 4BE1A 3QYHB 5M9OA 3I5SA 3RESA 4J83A 3OYFA 1VQ8A 4B9WA 2O01E 3OW2P 1NG2A 1YITT 2FPFA 1WX6A 2YXYA 2DXCA 4A4FA 5LJ5j 5GAOp 1KC8U 3OS5A 4FYWB 2JN0A 1PNJA 4OMLA 2EQKA 1TWBA 2ECZA 4Q5WA 2NUZA 2JVVA 3M9QA 4ORZA 5KYNA 1I5OB 2ATCB 3UA6A 4N4GA 3CD6Q 4EMGA 2QEXA 1NEGA 4XU0A 4IIOA 2CT4A 4BB7A 3MP6A 2COYA 4PLIA 2OTLA 2R5MA 3RMQA 3EGDA 4BY6B 1LOJA 5J39A 4Z02A 1BK2A 1TH7A 4FYVB 1VQ9A 4RCBA 3PMIA 4ZGEB 2GCXA 4FL6A 3REAB 3CCLQ 1AHJB 2RF0A 4FU6A 4HCCA 2EJGA 2BUDA 4HXJA 2BTTA 4DEXA 4PJOD 2KEAA 1TTHB 1PD1A 1OPLA 4E7SA 1WJQA 1I8FA 4M77G 5DY9A 3CCMA 3MEAA 4C92B 2HBWA 2QYZA 4DOWA 2QXFA 3H8ZA 1C0MA 2K9GA 2JW4A 1K8AU 2COWA 2EAYA 4LD9K 2NYSA 1KK7A 4C5GA 1N27A 2LVMA 1I81A 2E64A 1WLPB 3PFSA 2C0OA 5FLXE 5FRNA 1KQ1A 4M7AD 3JCMb 1TUCA 2FHDA 4FYYB 2Y4XA 4PJJA 1SF9A 1RLQC 2CP3A 3RKYA 3EH1A 1MMAA 1X2QA 3PIOA 5IAYA 5LJ3j 4NOYA 4X34A 1RACB 3UDCA 1D1CA 2VB6A 4J6XA 5FU7B 3IQLA 1QP3A 3JCMP 4LE9A 1B34B 2ENMA 1M4ZA 1TOVA 5LJ3f 3QZ5B 2CZ1B 1GCQC 1QVGS 1RABB 3QJ6A 2YUNA 1AZGB 1QLYA 1FMVA 3JCMV 1BU1A 2YLBA 4D8DA 2VYTA 2CDTA 3FLGA 3CC2Q 1FWZA 3VYGA 3O8VA 2MIOA 3TQ7P 1KHCA 4KGXB 2AKKA 1GXIE 3OSVA 5AT1B 2JXBA 4AG2C 1M8MA 5IHIA 3MP8A 1IXDA 1EIFA 5C6SA 5KYUB 3SEMA 1QVFP 4J7IA 4FT4A 1U1TA 1IO6A 1K9MR 5GAOm 1JXMA 2OAWA 4II1A 3V8KA 1VQ8Q 4C0ZA 1ZUUA 4DBRA 2LC4A 3G71Q 3V7CA 2LCCA 2V8IA 5HKCA 2BZXA 1YIJT 1JJ2P 3VU3C 4CRIA 2K3XA 2JUFA 1QVGP 4ZNXA 1ZUKA 1WJRA 3JB9J 2YSQA 3VS3A 2XU8A 2R57A 2CZ6B 4BD3A 4EMKB 2QEXQ 2XDBA 1YFNA 4LDYA 2I0NA 4BE2A 3V7RA 3OYHA 1VIEA 1GCQA 2OTJA 1W2BP 2I2LA 1Q81R 3H0FA 2EGAA 3CCJT 1VYVA 1WIEA 5KYXB 4AG1C 1FMKA 2A36A 1S72A 5GMKj 5GMKe 3V8JA 2RM4A 3PNWC 1AVZC 3X28B 3HP9A 1M8VA 3UT1A 3GPLA 3MHXA 3NGPA 1KG1A 3OW2A 4IUTA 4MZTA 3G71T 3E1SA 4OMMA 3J80E 1HSQA 2M0OA 1GFCA 1TG0A 2DK3A 2JM8A 1TXQA 2PVGB 4JZ3A 4JJBA 2SEMA 1YJWA 1K73R 4C8QC 2HCKA 2GTJA 4PJOE 1QCNA 2XMFA 4JRPA 3CCQA 5GANj 2B86A 3I56Q 5CKEA 1VQ8T 2CSQA 3HSBA 4A4GA 1VQKT 3E19A 2VWFA 1YN8A 1WA7A 2RA2A 3PMTA 3OYKA 1BKBA 1QW1A 1V29B 1WYXA 3RBBB 2KYMA 1IZ6A 4V2SA 4EPCA 1S72Q 4QT7A 2FEIA 2AT1B 2RN8A 2DIGA 1WHGA 1M27C 3GP8A 3M58A 3JB9H 1X6BA 2RJDA 1M3CA 1Q81U 1M1KR 1N9SA 3C0CA 1M2OA 3H0IA 2DILA 3D7SB 2LDMA 5GMKi 4FCYA 1D1BA 4FW1A 3CXCS 1AT1B 1KD1C 5IH2A 4LDXA 4IUQA 3JB9I 1UTIA 1Y96A 3HRUA 4J9IA 3OMCA 4PJOF 2FL7A 2DERA 2Y4YA 4RTVA 3JCMX 3UWNA 3GBQA 1HK9A 1HJDA 1M5Q1 2DXBA 2FZGB 2XDPA 3OB9A 2BE9B 4HT9A 3VS6A 1XOVA 3CPWP 2JNGA 3WXMB 4KBMB 2VGNA 1ZSZB 4PJOC 4RTUA 3MKDA 3VS1A 4C8QG 9ATCB 3M4YA 5LJ5d 3CQTA 3UF4A 3OYLA 1OU9A 1OYXA 2LX7A 1Q7YR 1K0XA 2D0NA 3I55T 4DEYA 1MGQA 1T0HA 2X51A 1M1FA 3E2UA 3EFRA 2CUBA 2ZCFB 3BFMA 4BUGA 1VA7A 2F5KA 2FPDA 2NLUA 4AFZC 4M7AB 3DB4A 2DJZA 2LJ1A 2DFUA 4M75D 3JCMh 1Q86U 3LWHA 1ZBJA 4FT2A 3VUBA 4A4KA 2CP0A 2DF6A 5GMKm 3CMAQ 2E5KA 1M1KU 5L23A 2CP5A 2M9UA 3JCMQ 2HDAA 4AFQC 4LDWA 1U5SA 1QP2A 3JV3A 2CH4W 2R5AA 4HCKA 1IB8A 4M75B 1Z9QA 2QQBA 3OYNA 3CMEA 5IXFA 3X24B 3G1JA 5ECAA 4JS5A 3GNGA 1UB4A 2DIQA 1WXUA 1RLPC 1ZQ1A 3OYGA 2OTJQ 3OYBA 5CKFA 4X9DA 3QBYA 2WSCE 5KYUA 4JZ4A 4C8QA 4K11A 5FWBA 2ZAEA 1I07A 1PG5B 3M59A 3FIFA 2KNBB 2YUQA 1YJNA 2ZPEB 4M78D 3M0QA 1G3YA 3E9GA 2DZ9A 2V8KA 2LJ0A 1VQPQ 2DTHA 2K3BA 3CCMQ 2E5QA 1UGSB 3G4ST 3DKMA 2LQNA 2PVDB 4C92C 5A0DA 1OI1A 3FDRA 2DMOA 5CKDA 3TSWA 3LH0A 1KC8R 3DLLA 1U3OA 2KVQG 2ZGWA 2QDLA 4M78F 1Y96B 2EKOA 1NLOC 4F7UB 2D8HA 1UFFA 5FWCA 4KH0B 3CCET 2KRSA 3HL8A 3HTRA 3NMZC 1VQ4A 3WVEB 2DRMA 5LJ3h 1WQ7A 1OX9A 2BZ8A 2QGGA 2LNHB 1AWJA 3BE3A 2JZ2A 1I0CA 3KXTA 2CREA 5D6YA 3RKWA 3EHQA 1YITQ 1ABOA 4MDWA 3CCRQ 1B07A 2KT8A 1YP5A 3G6EQ 2LJ3A 4M75E 1K73U 1JBMA 1M3AA 3QWYA 2LCLA 4D8KA 2E12A 3CEYA 1KQ2A 2OTJT 2K79A 3TREA 3RERA 3JCMW 3LGLA 5GAMh 1UHFA 1YI2Q 2O88A 4PFOA 2LCSA 3JB9D 4PJOG 2CS7A 4GLKA 1EX4A 3I35A 4F04B 2DBMA 3ER0A 2NUPA 4L5GA 1TSFA 4DBHA 1WI7A 2RI3A 4RUGA 2FZCB 2V1RA 1NLPC 2RHUA 4M75F 1CKAA 2LQ8A 2LT4A 4OB2B 4KUIA 4PK4A 4F16A 1IREB 4MZMA 2QAZA 2OAUA 1BIBA 5AYFA 3CCUA 2RK1A 2WSEE 5FW9A 2VC8A 1X27A 2DA9A 3EG3A 1YWPA 1PRLC 1HXDA 5CKBA 3JB9F 3NTHA 3G6ET 4J9FA 4PJOA 1X01A 2EJFA 1OZ2A 2DZCA 1IGQA 4L59A 5IHKA 4QQDA 2IIMA 1G5VA 1N5ZA 1G3WA 3SFMA 3JCMf 1R8OB 5IXBA 3PVLA 3OYMA 1T3LA 4C8QE 1D0YA 3M0RA 4RKUE 2EGCA 3HPWA 4A4EA 4E7HA 2G6FX 3M55A 3VRZA 4ZN3A 1CSKA 4MZPA 2LZ6B 4PL6A 4OGCA 1TS9A 3X20B 1XJWB 3OYCA 4N4IA 4R0KA 4NS5A 1KFZA 1Y0MA 1N8RU 2Z0WA 3KUFA 2A3LA 2YRVA 4M7AF 2H3JA 1QWEA 3A8GB 2CZ0B 1BB9A 4Y91A 1W2BS 2X4WA 1YJ9T 3REBB 4JRKA 5GANh 5GANe 2F5TX 3CCSQ 2YUPA 2E3HA 1I4K1 3CC7Q 2LQWA 2XD0A 1H3ZA 1OEBA 4M7DA 1IRXA 1JB0E 5A0GA 1T0JA 3M4GA 5GAMe 2L8DA 2V8JA 5CKHA 1VQ4Q 2IPOB 2FVUA 3JRZA 1SPKA 1G83A 2ZPBB 4JJDA 1NJIU 3AT1B 4RTWA 3DB3A 3S3OA 5GAN6 1BI1A 1YJ9A 1JXOA 2HQHA 4ANJA 3EAEA 2G3RA 1KHIA 4FSXA 3G6EA 1YIJQ 3RIRA 2LRQA 3BDUA 2DKGA 1V1CA 2DL7A 1UEBA 3M56A 1B34A 2KK4A 1UJYA 2B8AA 1KQSP 1VUBA 2HQEA 4ELZC 3OYIA 1AWOA 2A0FB 1QMCA 3I55Q 5LJ5h 2XKOC 1Q7YC 1ABQA 3TU4K 2DL4A 3NTIA 1BI3A 1VQKA 3VUZA 4HVVA 3WVDB 5CIUA 3HFNA 3CCLT 3CCST 4EMHA 2ROTA 4C5IA 5HK0A 4C92E 2KYBA 3CMAT 2NUTB 3MP1A 2DM1A 5I2MA 3TCJA 1FYNA 2EQIA 1R77A 1W70A 2J6KA 3ZFJA 1NJIC 4XAXB 5CQYA 1VQ7T 1PCXA 3QKJA 2KAFA 2EVRA 3LH5A 2J6FA 2QI2A 3CMEQ 1K1ZA 1XQHA 2VV5A 2HKQB 4RTTA 4M7DG 1H8KA 1K4US 4J9DA 1Q86R 3E9FA 1VQ6Q 2E65A 3INZA 2F2VA 4BI4A 5CK9A 3QDRB 2EBPA 1KQSS 1K8AR 4QKUA 1D0ZA 1PHTA 2L3PA 2LT1A 5HY6A 1BCMA 1KQSA 3I9QA 2PUOB 1D09B 4FW2A 5KE3A 3L2WA 2YLCA 4JRIA 3A8LB 3QG1A 3OS0A 3T9NA 2H8HA 4AFSC 2FB7A 5LJ3g 2RQRA 1RAAB 4XTWA 2WACA 2MWOA 2DPPB 2JMCA 4M75A 1PC0A 2JTEA 3S6WA 2GNCA 1M2VA 4IKFA 4ME7A 2DXTA 2QA4A 1IGUA 2GQIA 2MPXC 4P5NA 3OQ5A 1YBYA 3TSZA 3L2ZA 2CP2A 4WF2A 3EGUA 3TVTA 3M0UA 5GAMd 1WDXA 2RHYA 2FPEA 4BI3A 5A2QE 2DX1A 4RTXA 2A7YA 3PE0A 1VQ6A 3CMET 3X25B 3TEEA 5GANd 1K76A 1T3SA 4B6MA 2ED1A 1G3SA 2JS0A 4KULA 2RI2A 1KIKA 1VYUA 3M0SA 1VQLA 1YJWT 5CAIA 2J6OA 4XTYA 3VYHB 2P0KA 5LJ5g 4LDUA 2AIRB 1PD0A 1R0CB 2P84A 3OYDA 2X3XD 3QYGB 2IVWA 1N8RR 3GIBA 1LCKA 2KE9A 1WFWA 3P8HA 2RQWA 1W2BA 2A08A 1EFNA 1B3QA 1JO8A 2KQWA 4E7KA 2E41A 1D0XA 4EIKA 3V8LA 1P92A 4LN2A 2MCNA 4J6YA 2OTLT 1AWXA 1SHGA 3EFOB 4AMCA 2ED0A 1PKSA 5GANf 3UATA 4M77E 3L42A 1LNXA 2F69A 4GLMA 4ZTJA 1GRIA 2K5IA 2QK0A 1ZSZC 3M54A 2LX9A 3OW2S 3CCEA 2LTOA 1Q82C 4WTOB 4J6WA 4XU2A 1AEYA 2L89A 2M1HA 1VQNT 4XTXA 4M77D 2E6ZA 1Q95G 2QDYB 5HK3A 2CP7A 3RDVA 2VXEA 2YT6A 2MF2A 4F7UE 5J3BA 1PWTA 1QQJA 3C95A 4N0AA 4BDYA 3G7ZA 2ZZDA 1SKUB 3MJXA 5GAOq 4M7DC 2L3SA 3AHUA 3J81E 1OX8A 2GTOA 1C6VX 2NUPB 2EYXA 4C8QB 3EFOA 1QVPA 2OX7A 2DJQA 3VS2A 4C92F 2D0QB 2BZYA 4YTLA 4FM4B 3EGXB 2JT4A 3H41A 3M5AA 2RO0A 2X4YA 2K2MA 3FEOA 3CC4Q 2RD1A 4O6JA 2X35A 4PJLA 4JLIA 4M78B 2W10A 1N6AA 3CCEQ 2EYQA 4QVZA 2K57A 3JCMJ 1W4SA 5GAMj 4JLGA 2J7IA 3L2RA 2HL5C 4JS4A 3OA6A 2KBTA 1M1GA 5GMKh 4JJNK 1XTDA 3S3NA 2OTLQ 1ARKA 3BY7A 2FYKA 4C0DB 1I5LA 2XI9A 3CCVQ 2MWPA 4M77A 3NPFA 4MMLA 2EWNA 5EG2A 5LJ3d 3A8HB 2QA4Q 4LNPA 1X2KA 2DL8A 3NTKA 4Y92A 4DOVA 3RUXA 1VQ9Q 1X43A 3CCJQ 1NM7A 1XNIA 1HYOA 2DVJA 3EH2A 1PSFA 3KBGA 2JTMA 4LUDA 3A98A 2FG0A 2RJEA 2O9VA 5LJ5e 5DLQE 4CC2A 4N0AC 3SB2A 4RG8A 3C4SA 1YHQQ 1M2VB 3U23A 2HD0A 4GBQA 1VQMT 3P8BB 1M90C 2SRCA 3F70A 4CI0C 4IIMA 4RTYA 4M7AC 1ZSGA 2QG9B 4C0DC 1RI0A 2VUBA 4GY5A 1QVGA 4A63B 1KC8C 2HMAA 2M02A 3VS4A 1WJSA 2JMAA 2D9TA 2HAXA 3CC2A 3UPUA 2KXCA 1MUZA 4L6V5 3CC4T 1VQ5A 2JTFA 4ZGDB 1JEGA 2DO3A 1BYMA 1YNZA 1EZZB 5CO7A 2VASA 4QQ6A 3HHTB 3CPWA 2JS2A 3QXEB 2FRWA 2KGTA 2LMJA 3GNFB 3QHSA 4ATOA 1OOTA 2ZPGB 1V76A 2DL5A 3OY9A 5EC7A 4LUEA 3ZBDA 4JDSA 1S1NA 3CCVT 2E1HA 4XK8E 2QA4T 1YHQT 2E4HA 1WXTA 3SHWA 3OYYA 2L0AA 5I21A 2DE0X 3OYEA 5FROA 1Y57A 1VQOA 2DD5A 4BDZA 8ATCB 1MMDA 3M0TA 1AD5A 1GCPA 1Q86C 2K6DA 1RUWA 3A1PA 4QVCA 1VQPT 1YCSB 2C0TA 1K9MC 1UGVA 1MNDA 2QTXA 3OBWA 3CCSA 2L3QA 5CCAA 1SEMA 1ZBXA 3OYJA 2NUTA 1VIFA 1TUDA 1QVFS 4X1VA 4J9BA 1U1SA 3URGA 1WHKA 2HQXA 4Z88A 1LVKA 2QGFB 4M7AE 3G4SA 1PSEA 5GAMf 1OQKA 1UE9A 4OP0A 1Y7XA 4ELYC 1ZLMA 4HT8A 1AZEA 2W0ZA 4OMNA 3MCAB 2HKNA 1YITA 2A28A 1TUGB 1GBRA 4BACA 2COZA 2X4XA 3M57A 1O75A 1QCOA 2PVOB 3EGDB 2XDDA 2DL3A 4ZGJB 2MI6A 5I2SA 1G8XA 1YIJA 4FIBA 2IG0A 2C06A 4J8OA 3CCUT 2Y90A 1FXXA 1RADB 3MEWA 2CT3A 3HRSA 3LYIA 4QQGA 1FX7A 1RAHB 4PLLA 1CKBA 4XTVA 5KYYB 4ESRA 3BDLA 4KGVB 2J06A 4VUBA 1D3BB 1X6GA 3I56A 2AKLA 5LJ5f 4C0FA 1J3TA 1QKWA 4C92A 3FJ5A 4E7ZA 5GMKl 1AWWA 2GBQA 3I5RA 3EG0A 1N8RC 1WZOA 4IURA 2M0YA 2RHXA 3CD6A 1NE8A 4KT0E 4M77B 4LD6A 2KT1A 2EQJA 4M77C 3HKSA 3OS1A 4OMFB 2O4XB 2RQTA 4E47A 4XU3A 1JJ2A 3VS5A 3FRNA 2MMPA 3EFSA 1MV3A 2PU9B 1NEBA 2KSSA 1IHVA 4OB0B 3NFCA 2EW3A 2C0IA 4J7FA 1ZA2B 4M77F 2KDSA 1BBZA 1JU5C 1WHJA 5GAN8 4JPBW 1ACMB 4PJOB 1Q82R 3OMGA 4B9XA 3CPWS 2BE7D 2X3WD 5FU7C 5L8RE 5GAN2 3RNJA 4EDUA 3MPUB 3QJYA 1OZ3A 1OV3A 5J26A 4JUVA 4C0GA 3VRYA 2XG8D 2DETA 3VJPA 3CXCP 4O5VA 1K8AC 5GAN5 2RJCA 2L5QA 2CUDA 3LW5E 2GQVA 1MNEA 1JRIA 2EGEA 4IUPA 5C0MA 4JJCA 2CZ7B 1NZ9A 1E6HA 2F2XA 3N5BB 2X4JA 1QCFA 3VKIA 4XU1A 3VS0A 4F7UA 4N4HA 3LGFA 2DEQA 2RPNA 2PZ1A 4OMPA 4F17A 3PVQA 2FRYA 1BCOA 4M78E 1UJ0A 5FU6B 2E6NA 2QEXT 2X9HA 6AT1B 3QO3A 5CQXA 3RKXA 2EIFA 2MOXA 3CC4A 1GFDA 4M7AA 2HEQA 4J9GA 2M16A 4EMKA 1UECA 4IUVA 3CC7A 1D1AA 2V1QA 1ZHIA 3EG2A 2RH2A 1SSFA 2YRCA 2D1XA 1OULA 4M7DF 4QVDA 4IUUA 1VQ4T 2EYYA 4F14A 2RQUA 1A0NB 1WGSA 1VOMA 4E7JA 2E3IA 3PIPA 4Y28E 1YJNQ 5KH6A 3JCMg 4MDXA 2O2OA 4DQ2A 3J7AF 3QZ9B 2DLPA 2P4TA 2DTIA 3KFVA 2ESWA 2LNVA 4M75C 1ZX6A 2F2WA 3CCMT 4PKCC 3I55A 2QQSA 2CP6A 5GAMg 1VQNA 4HA8A 1WXBA 1VQMQ 1BIAA 3PGGA 2DYIA 4FYXB 1H92A 4J9EA 4M7AG 2V26A 2K5FA 1QKXA 2KRNA 1AOJA 3JB9G 1B7TA 1VYTA 1IHWA 1YCYA 3L2VA 1VQPA 2VXFA 1C1AA 4PJMA 3R6OA 2XICA 1PKTA 3P8DA 1E6GA 3ZL7C 3CCRT 3ZEHA 2DRKA 2KI7A 5CVIA 3UA7A 5IT9E 3CCQT 3HFOA 4RTZA 4AFUC 2PUKB 4NL3A 3QDFA 5GANg 2VVKA 3V7SA 2RHZA 2EPDA 4RCCA 3MEUA 2VGMA 1VQNQ 1RAFB 1RI9A 1UGPB 1OPKA 3LLRA 3CCLA 2MYSA 3GF5A 3SD4A 4HCZA 5FRMA 2E70A 3CCRA 2VKNA 3L2UA 1JJ2S 3LX7A 3M53A 5KYXA 1VQOQ 3MEVA 1H641 1WNLA 1W1FA 3RR6A 4XTZA 2L2PA 1ZSZA 3CBPA 2RB6A 5KE2A 4RMOA 1R0BG 4DBQA 1NPRA 2QTVA 3EGXA 4C92D 3I56T 3VV0A 4Z89A 3OS2A 2PNIA 4OGEA 3JCMc 5IHNA 1YI2A 3JSCA 5DLOA 2AZVA 2ZPIB 2ZPHB 3CC2T 1SSHA 1SRMA 2HL3A 3A5ZB 2DBKA 1QVFA 1S72T 1X75C 3DLMA 2F1LA 4OF1A 3EG1A 3QSUA 1ZA1B 2RQVA 3S3MA 1U06A 4QW2A 2RMOA 5GAOr 4C5HA 1TU0B 1D3BA 4KUDK 2FO0A 1VQ7A 2CKKA 4TVRA 2PTKA 4XTUA 1M9SA 1VQLQ 3CCUQ 1M3BA 3OSSC 2EYZA 1GBQA 3SDZA 1LPLA 2J05A 5DM7R 4LXCA 1KSWA 1UGRB 1H3HA 1VQOT 1Q81C 2GF7A 5LJ3e 1M90U 3X26B 3CD6T 3GOXA 1NJIR 4M75G 5D6WA 2EFIA 4F7UF 1U8RA 1UUEA 5A0LA 2L3RA 2RI5A 2GGRA 2YWWA 4A4HA 1RAGB 4M78G 1LJOA 2HSEB 2JJ9A 2KXDA 4PFZA 2JOYA 2E10A 2CYZB 4MMKA 2K7AA 2CSIA 3QIIA 1HD3A 1K0SA 3PTAA 1NPPA 1DJ7B 3L2QA 1W6XA 5GAN7 4Z8AA 2P4RA 1X6OA 1UHCA 4LDVA 2PQWA 4PFPA 4PNOA 1G2BA 4KRTA 4M7DE 1F1BB 5KYWA 1VQLT 2AK5A 3A8OB 3SWNA 2GFAA 4PJNA 3CBOA 1MHNA 1YJ9Q 4CC3A 2KY9A 2H3EB 4FSSA 2MK5A 2EQMA 1KD1R 2OI3A 1I1JA 2FZKB 2QQ9A 4E7IA 3GLXA 1JQQA 5GAOl 1SG5A 2DXUA 4C8QF 1M90R 1QWFA 1YI2T 4J5YA 2AHJB 3ME9A 1VQKQ 5GAN3 4KGZB 4DA4A 2O9SA 2O31A 4E2FB 3L1AA 3C12A 1SRLA 5LL6S 2XHCA 2XIDA 4C8QD 4E6RA 1K73C 5I11A 3RMSA 5FU6C 2LP5A 3H6ZA 2RJFA 3O5ZA 3QPHA 2ZPFB 3CBMA 1NYGA 5GJVB 5GAOn 1SHFA 2KMTA 4M78A 1NYFA 1Y71A 1Q82U 2KROA 2QQRA 3CCVA 4HVUA 3FJPA 3FC3A 4HVWA 1WHMA 1KJWA 3M0PA 4OMOA 1RAEB 3OYAA 3BW1A 3HRTA 3CCJA 2LQKA 4ZTFA 1FMWA 5GJWB 2CGHA 2P0PA 5IN1A 3EG9A 7AT1B 1YHQA 4J9HA 4R56A 3H9NA 1VQ6T 1MMGA 1YWOA 4C5EA 2DVEA 4KH1B 2DAQA 1VQ7Q 2RK2A 3NHNA 4DBFA 3G71A 4UC4A 3JCMe 5D6XA 2EQUA 3EG9B 1WHHA 5GAN4 4R55A 1N9RA 2D8JA 4X9CA 2KRMA 2R58A 2CH4A 1WPYA 2O4XA 2GFUA 4NL2A 2EKHA 5I22A 5KCHA 3LWIA 1X69A 2RNAA 5KCOA 2EYWA 2KR3A 1UGQB 4M4ZA 2JM9A 1VQ5Q 5KYWB 3JAME 4BI8B 2DD4A 2EJ9A 3Q1JA 4A53A 1M1KC 2HNIA 2DTOA 2HBPA 1BI0A 1UDLA 4M7DD 3CXCA 4F7UG 1MV0B 3CC7T 1VQMA 4OB1B 8AT1B 2K5LA 4OMQA 2YHTA 4ZN1A 3THKA 1G3TA 1O9SA 1MMNA 2BIVA 3CPFA 2K2VA 1GL5A 4M7DB 1ZUYA 4HCBA 2ROLA 3CCQQ 1VQ9T
chains in the Genus database with same CATH topology
1VYUA 3M0SA 4AFZC 2M51A 2LJ1A 2MOXA 2J6OA 1GFDA 5HCKA 1M30A 2HEQA 1ZBJA 4J9GA 1E7OA 2NWMA 1UECA 2DF6A 2E5KA 5L23A 2X3XD 2YDLA 2V1QA 3EG2A 2HDAA 4AFQC 1U5SA 2HSPA 1LCKA 3H0HA 2D1XA 3JV3A 2KE9A 2CH4W 4HCKA 3VS7A 1WFWA 3QWXX 2RQWA 1Z9QA 2AZSA 2A08A 1EFNA 2ABLA 1B3QA 4WCIA 2EYYA 5IXFA 5ECAA 4F14A 1JO8A 2RQUA 1A0NB 1WXUA 4EIKA 1RLPC 4CC4B 4CC7A 4LN2A 2O2OA 2MCNA 2DYBA 1AWXA 2DLPA 2DNUA 4JZ4A 1SHGA 3ULRB 3EHRA 2YUOA 3KFVA 4K11A 5FWBA 1K9AA 2ED0A 2ESWA 1PKSA 1I07A 3UATA 2A37A 1ZX6A 1Z9ZA 1UG1A 2F2WA 1PRMC 4GLMA 2KNBB 2OJ2A 1GRIA 2YUQA 3R6NA 3M0QA 1WXBA 2LJ0A 1AEYA 2K3BA 1H92A 4J9EA 2LQNA 4J9CA 2YT6A 1QKXA 3I5SA 2DMOA 1PWTA 2KRNA 1AOJA 3TSWA 1NG2A 1U3OA 1VYTA 2L3SA 2QDLA 2FPFA 2GTOA 1WX6A 1NLOC 2D8HA 1UFFA 5FWCA 2EYXA 1PKTA 2KRSA 1PNJA 4OMLA 3NMZC 1E6GA 2ECZA 2DJQA 3VS2A 2NUZA 3ZL7C 2DRMA 4ORZA 2DRKA 2BZ8A 2LNHB 2BZYA 3UA6A 1AWJA 1I0CA 3UA7A 2CREA 1NEGA 2JT4A 3H41A 4IIOA 2CT4A 3EHQA 4RTZA 2K2MA 1ABOA 4AFUC 1B07A 2KT8A 1YP5A 2VVKA 2EPDA 2LJ3A 2W10A 3QWYA 1M3AA 4D8KA 1RI9A 1OPKA 1BK2A 2J7IA 2K79A 2KBTA 3REAB 1ARKA 2VKNA 2RF0A 1UHFA 2O88A 3NPFA 4HXJA 1W1FA 2BTTA 2LCSA 2L2PA 4DEXA 2KEAA 4LNPA 1X2KA 2DL8A 4Y92A 3I35A 1OPLA 1X43A 2DBMA 1NM7A 4Z89A 1WI7A 4RUGA 2HBWA 2PNIA 2DVJA 2V1RA 1NLPC 2K9GA 2JW4A 5IHNA 4LUDA 2AZVA 2FG0A 3A98A 2O9VA 1CKAA 4CC2A 4F16A 1SSHA 1SRMA 1WLPB 2DBKA 3U23A 2C0OA 4GBQA 5FW9A 1X27A 1TUCA 3EG1A 2DA9A 2RQVA 3EG3A 1U06A 1YWPA 2RMOA 1PRLC 2SRCA 4IIMA 4RTYA 2FO0A 1ZSGA 1RLQC 2PTKA 4J9FA 1X2QA 4A63B 1M3BA 3VS4A 2JMAA 3IQLA 2EYZA 1GBQA 4LE9A 2KXCA 1MUZA 2ENMA 5IHKA 2J05A 2IIMA 1KSWA 1GCQC 1H3HA 1N5ZA 1JEGA 2YUNA 5IXBA 3PVLA 1AZGB 1QLYA 1YNZA 1T3LA 3M0RA 1BU1A 4D8DA 2EGCA 2JS2A 2FRWA 2KGTA 2LMJA 2CDTA 1OOTA 2G6FX 3VRZA 1UUEA 1CSKA 2DL5A 2LZ6B 5EC7A 4LUEA 2GGRA 2MIOA 1S1NA 2KXDA 2AKKA 2K7AA 2CSIA 4R0KA 1HD3A 2JXBA 1K0SA 1KFZA 4AG2C 1Y0MA 1M8MA 1WXTA 1W6XA 3SHWA 5IHIA 2L0AA 2DE0X 2P4RA 4Z8AA 1Y57A 1QWEA 1UHCA 1BB9A 3SEMA 3M0TA 1AD5A 1GCPA 1IO6A 3REBB 1JXMA 2OAWA 1G2BA 2K6DA 1RUWA 2YUPA 1ZUUA 4KRTA 1YCSB 2C0TA 1UGVA 2AK5A 2LQWA 1OEBA 2L3QA 2BZXA 1SEMA 4CC3A 1T0JA 1TUDA 4FSSA 4ZNXA 4X1VA 4J9BA 1ZUKA 2OI3A 4Z88A 1I1JA 2YSQA 3VS3A 1SPKA 1UE9A 1G83A 4JJDA 1JQQA 4RTWA 1ZLMA 1AZEA 2W0ZA 4OMNA 1QWFA 2I0NA 1JXOA 2A28A 1GBRA 1GCQA 2DL3A 1V1CA 2DL7A 3H0FA 2EGAA 1VYVA 1WIEA 2O9SA 2O31A 1FMKA 4AG1C 2A36A 1UJYA 1SRLA 2CT3A 1AWOA 4E6RA 1AVZC 5I11A 1CKBA 2LP5A 1ABQA 2DL4A 3O5ZA 4ESRA 1NYGA 3NGPA 2J06A 5GJVB 4HVVA 1X6GA 1SHFA 2AKLA 1NYFA 2KROA 4OMMA 4HVUA 1J3TA 1HSQA 2ROTA 4HVWA 1QKWA 1GFCA 3FJ5A 1KJWA 1TG0A 3M0PA 2JM8A 2KYBA 1AWWA 2GBQA 4OMOA 4JZ3A 3I5RA 4JJBA 2DM1A 2SEMA 3EG0A 1FYNA 2EQIA 2HCKA 1W70A 2GTJA 2J6KA 2XMFA 5GJWB 2B86A 2M0YA 2CSQA 4J9HA 2VWFA 2KT1A 2EVRA 3LH5A 1YN8A 1WA7A 2J6FA 1K1ZA 1YWOA 2RQTA 4RTTA 3VS5A 1H8KA 1WYXA 3RBBB 1K4US 2KYMA 4J9DA 3NHNA 1MV3A 4QT7A 2FEIA 2RN8A 1NEBA 2F2VA 2EBPA 1M27C 2EW3A 2C0IA 1X6BA 1M3CA 3C0CA 3H0IA 2DILA 1PHTA 2D8JA 1BBZA 1JU5C 2L3PA 2KRMA 5IH2A 4JPBW 2CH4A 3I9QA 2EKHA 1UTIA 5I22A 2X3WD 4J9IA 1X69A 3RNJA 2RNAA 2EYWA 1OV3A 2H8HA 2KR3A 4M4ZA 4RTVA 4AFSC 2JM9A 2RQRA 3GBQA 3VRYA 1HJDA 2JMCA 2JTEA 3VS6A 1XOVA 2GNCA 2CUDA 1UDLA 2EGEA 2GQIA 1MV0B 4RTUA 4JJCA 3VS1A 3TSZA 4OMQA 1E6HA 2F2XA 3EGUA 3TVTA 1QCFA 3CQTA 3M0UA 3VS0A 1WDXA 3UF4A 2FPEA 2LX7A 1K0XA 2D0NA 2DX1A 4RTXA 2RPNA 3THKA 2PZ1A 4OMPA 4DEYA 1T0HA 3PE0A 4F17A 3PVQA 2FRYA 2CUBA 1K76A 1T3SA 1UJ0A 1GL5A 2ED1A 1VA7A 2JS0A 1ZUYA 2ROLA 1KIKA 2FPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYU A;  3M0S A;  4AFZ C;  2M51 A;  2LJ1 A;  2MOX A;  2J6O A;  1GFD A;  5HCK A;  1M30 A;  2HEQ A;  1ZBJ A;  4J9G A;  1E7O A;  2NWM A;  1UEC A;  2DF6 A;  2E5K A;  5L23 A;  2X3X D;  2YDL A;  2V1Q A;  3EG2 A;  2HDA A;  4AFQ C;  1U5S A;  2HSP A;  1LCK A;  3H0H A;  2D1X A;  3JV3 A;  2KE9 A;  2CH4 W;  4HCK A;  3VS7 A;  1WFW A;  3QWX X;  2RQW A;  1Z9Q A;  2AZS A;  2A08 A;  1EFN A;  2ABL A;  1B3Q A;  4WCI A;  2EYY A;  5IXF A;  5ECA A;  4F14 A;  1JO8 A;  2RQU A;  1A0N B;  1WXU A;  4EIK A;  1RLP C;  4CC4 B;  4CC7 A;  4LN2 A;  2O2O A;  2MCN A;  2DYB A;  1AWX A;  2DLP A;  2DNU A;  4JZ4 A;  1SHG A;  3ULR B;  3EHR A;  2YUO A;  3KFV A;  4K11 A;  5FWB A;  1K9A A;  2ED0 A;  2ESW A;  1PKS A;  1I07 A;  3UAT A;  2A37 A;  1ZX6 A;  1Z9Z A;  1UG1 A;  2F2W A;  1PRM C;  4GLM A;  2KNB B;  2OJ2 A;  1GRI A;  2YUQ A;  3R6N A;  3M0Q A;  1WXB A;  2LJ0 A;  1AEY A;  2K3B A;  1H92 A;  4J9E A;  2LQN A;  4J9C A;  2YT6 A;  1QKX A;  3I5S A;  2DMO A;  1PWT A;  2KRN A;  1AOJ A;  3TSW A;  1NG2 A;  1U3O A;  1VYT A;  2L3S A;  2QDL A;  2FPF A;  2GTO A;  1WX6 A;  1NLO C;  2D8H A;  1UFF A;  5FWC A;  2EYX A;  1PKT A;  2KRS A;  1PNJ A;  4OML A;  3NMZ C;  1E6G A;  2ECZ A;  2DJQ A;  3VS2 A;  2NUZ A;  3ZL7 C;  2DRM A;  4ORZ A;  2DRK A;  2BZ8 A;  2LNH B;  2BZY A;  3UA6 A;  1AWJ A;  1I0C A;  3UA7 A;  2CRE A;  1NEG A;  2JT4 A;  3H41 A;  4IIO A;  2CT4 A;  3EHQ A;  4RTZ A;  2K2M A;  1ABO A;  4AFU C;  1B07 A;  2KT8 A;  1YP5 A;  2VVK A;  2EPD A;  2LJ3 A;  2W10 A;  3QWY A;  1M3A A;  4D8K A;  1RI9 A;  1OPK A;  1BK2 A;  2J7I A;  2K79 A;  2KBT A;  3REA B;  1ARK A;  2VKN A;  2RF0 A;  1UHF A;  2O88 A;  3NPF A;  4HXJ A;  1W1F A;  2BTT A;  2LCS A;  2L2P A;  4DEX A;  2KEA A;  4LNP A;  1X2K A;  2DL8 A;  4Y92 A;  3I35 A;  1OPL A;  1X43 A;  2DBM A;  1NM7 A;  4Z89 A;  1WI7 A;  4RUG A;  2HBW A;  2PNI A;  2DVJ A;  2V1R A;  1NLP C;  2K9G A;  2JW4 A;  5IHN A;  4LUD A;  2AZV A;  2FG0 A;  3A98 A;  2O9V A;  1CKA A;  4CC2 A;  4F16 A;  1SSH A;  1SRM A;  1WLP B;  2DBK A;  3U23 A;  2C0O A;  4GBQ A;  5FW9 A;  1X27 A;  1TUC A;  3EG1 A;  2DA9 A;  2RQV A;  3EG3 A;  1U06 A;  1YWP A;  2RMO A;  1PRL C;  2SRC A;  4IIM A;  4RTY A;  2FO0 A;  1ZSG A;  1RLQ C;  2PTK A;  4J9F A;  1X2Q A;  4A63 B;  1M3B A;  3VS4 A;  2JMA A;  3IQL A;  2EYZ A;  1GBQ A;  4LE9 A;  2KXC A;  1MUZ A;  2ENM A;  5IHK A;  2J05 A;  2IIM A;  1KSW A;  1GCQ C;  1H3H A;  1N5Z A;  1JEG A;  2YUN A;  5IXB A;  3PVL A;  1AZG B;  1QLY A;  1YNZ A;  1T3L A;  3M0R A;  1BU1 A;  4D8D A;  2EGC A;  2JS2 A;  2FRW A;  2KGT A;  2LMJ A;  2CDT A;  1OOT A;  2G6F X;  3VRZ A;  1UUE A;  1CSK A;  2DL5 A;  2LZ6 B;  5EC7 A;  4LUE A;  2GGR A;  2MIO A;  1S1N A;  2KXD A;  2AKK A;  2K7A A;  2CSI A;  4R0K A;  1HD3 A;  2JXB A;  1K0S A;  1KFZ A;  4AG2 C;  1Y0M A;  1M8M A;  1WXT A;  1W6X A;  3SHW A;  5IHI A;  2L0A A;  2DE0 X;  2P4R A;  4Z8A A;  1Y57 A;  1QWE A;  1UHC A;  1BB9 A;  3SEM A;  3M0T A;  1AD5 A;  1GCP A;  1IO6 A;  3REB B;  1JXM A;  2OAW A;  1G2B A;  2K6D A;  1RUW A;  2YUP A;  1ZUU A;  4KRT A;  1YCS B;  2C0T A;  1UGV A;  2AK5 A;  2LQW A;  1OEB A;  2L3Q A;  2BZX A;  1SEM A;  4CC3 A;  1T0J A;  1TUD A;  4FSS A;  4ZNX A;  4X1V A;  4J9B A;  1ZUK A;  2OI3 A;  4Z88 A;  1I1J A;  2YSQ A;  3VS3 A;  1SPK A;  1UE9 A;  1G83 A;  4JJD A;  1JQQ A;  4RTW A;  1ZLM A;  1AZE A;  2W0Z A;  4OMN A;  1QWF A;  2I0N A;  1JXO A;  2A28 A;  1GBR A;  1GCQ A;  2DL3 A;  1V1C A;  2DL7 A;  3H0F A;  2EGA A;  1VYV A;  1WIE A;  2O9S A;  2O31 A;  1FMK A;  4AG1 C;  2A36 A;  1UJY A;  1SRL A;  2CT3 A;  1AWO A;  4E6R A;  1AVZ C;  5I11 A;  1CKB A;  2LP5 A;  1ABQ A;  2DL4 A;  3O5Z A;  4ESR A;  1NYG A;  3NGP A;  2J06 A;  5GJV B;  4HVV A;  1X6G A;  1SHF A;  2AKL A;  1NYF A;  2KRO A;  4OMM A;  4HVU A;  1J3T A;  1HSQ A;  2ROT A;  4HVW A;  1QKW A;  1GFC A;  3FJ5 A;  1KJW A;  1TG0 A;  3M0P A;  2JM8 A;  2KYB A;  1AWW A;  2GBQ A;  4OMO A;  4JZ3 A;  3I5R A;  4JJB A;  2DM1 A;  2SEM A;  3EG0 A;  1FYN A;  2EQI A;  2HCK A;  1W70 A;  2GTJ A;  2J6K A;  2XMF A;  5GJW B;  2B86 A;  2M0Y A;  2CSQ A;  4J9H A;  2VWF A;  2KT1 A;  2EVR A;  3LH5 A;  1YN8 A;  1WA7 A;  2J6F A;  1K1Z A;  1YWO A;  2RQT A;  4RTT A;  3VS5 A;  1H8K A;  1WYX A;  3RBB B;  1K4U S;  2KYM A;  4J9D A;  3NHN A;  1MV3 A;  4QT7 A;  2FEI A;  2RN8 A;  1NEB A;  2F2V A;  2EBP A;  1M27 C;  2EW3 A;  2C0I A;  1X6B A;  1M3C A;  3C0C A;  3H0I A;  2DIL A;  1PHT A;  2D8J A;  1BBZ A;  1JU5 C;  2L3P A;  2KRM A;  5IH2 A;  4JPB W;  2CH4 A;  3I9Q A;  2EKH A;  1UTI A;  5I22 A;  2X3W D;  4J9I A;  1X69 A;  3RNJ A;  2RNA A;  2EYW A;  1OV3 A;  2H8H A;  2KR3 A;  4M4Z A;  4RTV A;  4AFS C;  2JM9 A;  2RQR A;  3GBQ A;  3VRY A;  1HJD A;  2JMC A;  2JTE A;  3VS6 A;  1XOV A;  2GNC A;  2CUD A;  1UDL A;  2EGE A;  2GQI A;  1MV0 B;  4RTU A;  4JJC A;  3VS1 A;  3TSZ A;  4OMQ A;  1E6H A;  2F2X A;  3EGU A;  3TVT A;  1QCF A;  3CQT A;  3M0U A;  3VS0 A;  1WDX A;  3UF4 A;  2FPE A;  2LX7 A;  1K0X A;  2D0N A;  2DX1 A;  4RTX A;  2RPN A;  3THK A;  2PZ1 A;  4OMP A;  4DEY A;  1T0H A;  3PE0 A;  4F17 A;  3PVQ A;  2FRY A;  2CUB A;  1K76 A;  1T3S A;  1UJ0 A;  1GL5 A;  2ED1 A;  1VA7 A;  2JS0 A;  1ZUY A;  2ROL A;  1KIK A;  2FPD A; 
#chains in the Genus database with same CATH topology
 4JRQ A;  2BKD N;  2K3Y A;  4C92 G;  2DEU A;  2M51 A;  3A8M B;  5HCK A;  4EMK C;  3CMA A;  1M30 A;  1NBE B;  3SWN C;  3ASK A;  1Q7Y U;  1E7O A;  2NWM A;  2YRD A;  2QAS A;  2K4Y A;  1YJW Q;  3C94 A;  2YDL A;  3QUI A;  3G4S Q;  4HKE A;  2HSP A;  3H0H A;  4BE0 A;  4D6W A;  3VS7 A;  2HZY A;  1OU8 A;  2XK0 A;  1RAI B;  3QWX X;  4RG2 A;  1WQW A;  2AZS A;  3MO8 A;  2ABL A;  2MAM A;  4M78 C;  4WCI A;  5CR2 A;  1RL2 A;  1VQ5 T;  3OBY A;  4CC4 B;  4CC7 A;  3MET A;  1K9M U;  3FB9 A;  1Y07 A;  5D7U A;  2DYB A;  1PM3 A;  4E7L A;  2DNU A;  3ULR B;  3EHR A;  2YUO A;  2WSF E;  1KD1 U;  1K9A A;  2A37 A;  4AT1 B;  1Z9Z A;  1UG1 A;  4OB3 B;  1PRM C;  2OJ2 A;  3R6N A;  3SWN B;  2D6F A;  4A54 A;  1BI2 A;  1WHL A;  3PT9 A;  3JCM d;  4OVA A;  4BY6 C;  1YJN T;  4XQ3 A;  2P0Q A;  5KYY A;  2QQA A;  2RHI A;  4J9C A;  4BE1 A;  3QYH B;  5M9O A;  3I5S A;  3RES A;  4J83 A;  3OYF A;  1VQ8 A;  4B9W A;  2O01 E;  3OW2 P;  1NG2 A;  1YIT T;  2FPF A;  1WX6 A;  2YXY A;  2DXC A;  4A4F A;  5LJ5 j;  5GAO p;  1KC8 U;  3OS5 A;  4FYW B;  2JN0 A;  1PNJ A;  4OML A;  2EQK A;  1TWB A;  2ECZ A;  4Q5W A;  2NUZ A;  2JVV A;  3M9Q A;  4ORZ A;  5KYN A;  1I5O B;  2ATC B;  3UA6 A;  4N4G A;  3CD6 Q;  4EMG A;  2QEX A;  1NEG A;  4XU0 A;  4IIO A;  2CT4 A;  4BB7 A;  3MP6 A;  2COY A;  4PLI A;  2OTL A;  2R5M A;  3RMQ A;  3EGD A;  4BY6 B;  1LOJ A;  5J39 A;  4Z02 A;  1BK2 A;  1TH7 A;  4FYV B;  1VQ9 A;  4RCB A;  3PMI A;  4ZGE B;  2GCX A;  4FL6 A;  3REA B;  3CCL Q;  1AHJ B;  2RF0 A;  4FU6 A;  4HCC A;  2EJG A;  2BUD A;  4HXJ A;  2BTT A;  4DEX A;  4PJO D;  2KEA A;  1TTH B;  1PD1 A;  1OPL A;  4E7S A;  1WJQ A;  1I8F A;  4M77 G;  5DY9 A;  3CCM A;  3MEA A;  4C92 B;  2HBW A;  2QYZ A;  4DOW A;  2QXF A;  3H8Z A;  1C0M A;  2K9G A;  2JW4 A;  1K8A U;  2COW A;  2EAY A;  4LD9 K;  2NYS A;  1KK7 A;  4C5G A;  1N27 A;  2LVM A;  1I81 A;  2E64 A;  1WLP B;  3PFS A;  2C0O A;  5FLX E;  5FRN A;  1KQ1 A;  4M7A D;  3JCM b;  1TUC A;  2FHD A;  4FYY B;  2Y4X A;  4PJJ A;  1SF9 A;  1RLQ C;  2CP3 A;  3RKY A;  3EH1 A;  1MMA A;  1X2Q A;  3PIO A;  5IAY A;  5LJ3 j;  4NOY A;  4X34 A;  1RAC B;  3UDC A;  1D1C A;  2VB6 A;  4J6X A;  5FU7 B;  3IQL A;  1QP3 A;  3JCM P;  4LE9 A;  1B34 B;  2ENM A;  1M4Z A;  1TOV A;  5LJ3 f;  3QZ5 B;  2CZ1 B;  1GCQ C;  1QVG S;  1RAB B;  3QJ6 A;  2YUN A;  1AZG B;  1QLY A;  1FMV A;  3JCM V;  1BU1 A;  2YLB A;  4D8D A;  2VYT A;  2CDT A;  3FLG A;  3CC2 Q;  1FWZ A;  3VYG A;  3O8V A;  2MIO A;  3TQ7 P;  1KHC A;  4KGX B;  2AKK A;  1GXI E;  3OSV A;  5AT1 B;  2JXB A;  4AG2 C;  1M8M A;  5IHI A;  3MP8 A;  1IXD A;  1EIF A;  5C6S A;  5KYU B;  3SEM A;  1QVF P;  4J7I A;  4FT4 A;  1U1T A;  1IO6 A;  1K9M R;  5GAO m;  1JXM A;  2OAW A;  4II1 A;  3V8K A;  1VQ8 Q;  4C0Z A;  1ZUU A;  4DBR A;  2LC4 A;  3G71 Q;  3V7C A;  2LCC A;  2V8I A;  5HKC A;  2BZX A;  1YIJ T;  1JJ2 P;  3VU3 C;  4CRI A;  2K3X A;  2JUF A;  1QVG P;  4ZNX A;  1ZUK A;  1WJR A;  3JB9 J;  2YSQ A;  3VS3 A;  2XU8 A;  2R57 A;  2CZ6 B;  4BD3 A;  4EMK B;  2QEX Q;  2XDB A;  1YFN A;  4LDY A;  2I0N A;  4BE2 A;  3V7R A;  3OYH A;  1VIE A;  1GCQ A;  2OTJ A;  1W2B P;  2I2L A;  1Q81 R;  3H0F A;  2EGA A;  3CCJ T;  1VYV A;  1WIE A;  5KYX B;  4AG1 C;  1FMK A;  2A36 A;  1S72 A;  5GMK j;  5GMK e;  3V8J A;  2RM4 A;  3PNW C;  1AVZ C;  3X28 B;  3HP9 A;  1M8V A;  3UT1 A;  3GPL A;  3MHX A;  3NGP A;  1KG1 A;  3OW2 A;  4IUT A;  4MZT A;  3G71 T;  3E1S A;  4OMM A;  3J80 E;  1HSQ A;  2M0O A;  1GFC A;  1TG0 A;  2DK3 A;  2JM8 A;  1TXQ A;  2PVG B;  4JZ3 A;  4JJB A;  2SEM A;  1YJW A;  1K73 R;  4C8Q C;  2HCK A;  2GTJ A;  4PJO E;  1QCN A;  2XMF A;  4JRP A;  3CCQ A;  5GAN j;  2B86 A;  3I56 Q;  5CKE A;  1VQ8 T;  2CSQ A;  3HSB A;  4A4G A;  1VQK T;  3E19 A;  2VWF A;  1YN8 A;  1WA7 A;  2RA2 A;  3PMT A;  3OYK A;  1BKB A;  1QW1 A;  1V29 B;  1WYX A;  3RBB B;  2KYM A;  1IZ6 A;  4V2S A;  4EPC A;  1S72 Q;  4QT7 A;  2FEI A;  2AT1 B;  2RN8 A;  2DIG A;  1WHG A;  1M27 C;  3GP8 A;  3M58 A;  3JB9 H;  1X6B A;  2RJD A;  1M3C A;  1Q81 U;  1M1K R;  1N9S A;  3C0C A;  1M2O A;  3H0I A;  2DIL A;  3D7S B;  2LDM A;  5GMK i;  4FCY A;  1D1B A;  4FW1 A;  3CXC S;  1AT1 B;  1KD1 C;  5IH2 A;  4LDX A;  4IUQ A;  3JB9 I;  1UTI A;  1Y96 A;  3HRU A;  4J9I A;  3OMC A;  4PJO F;  2FL7 A;  2DER A;  2Y4Y A;  4RTV A;  3JCM X;  3UWN A;  3GBQ A;  1HK9 A;  1HJD A;  1M5Q 1;  2DXB A;  2FZG B;  2XDP A;  3OB9 A;  2BE9 B;  4HT9 A;  3VS6 A;  1XOV A;  3CPW P;  2JNG A;  3WXM B;  4KBM B;  2VGN A;  1ZSZ B;  4PJO C;  4RTU A;  3MKD A;  3VS1 A;  4C8Q G;  9ATC B;  3M4Y A;  5LJ5 d;  3CQT A;  3UF4 A;  3OYL A;  1OU9 A;  1OYX A;  2LX7 A;  1Q7Y R;  1K0X A;  2D0N A;  3I55 T;  4DEY A;  1MGQ A;  1T0H A;  2X51 A;  1M1F A;  3E2U A;  3EFR A;  2CUB A;  2ZCF B;  3BFM A;  4BUG A;  1VA7 A;  2F5K A;  2FPD A;  2NLU A;  4AFZ C;  4M7A B;  3DB4 A;  2DJZ A;  2LJ1 A;  2DFU A;  4M75 D;  3JCM h;  1Q86 U;  3LWH A;  1ZBJ A;  4FT2 A;  3VUB A;  4A4K A;  2CP0 A;  2DF6 A;  5GMK m;  3CMA Q;  2E5K A;  1M1K U;  5L23 A;  2CP5 A;  2M9U A;  3JCM Q;  2HDA A;  4AFQ C;  4LDW A;  1U5S A;  1QP2 A;  3JV3 A;  2CH4 W;  2R5A A;  4HCK A;  1IB8 A;  4M75 B;  1Z9Q A;  2QQB A;  3OYN A;  3CME A;  5IXF A;  3X24 B;  3G1J A;  5ECA A;  4JS5 A;  3GNG A;  1UB4 A;  2DIQ A;  1WXU A;  1RLP C;  1ZQ1 A;  3OYG A;  2OTJ Q;  3OYB A;  5CKF A;  4X9D A;  3QBY A;  2WSC E;  5KYU A;  4JZ4 A;  4C8Q A;  4K11 A;  5FWB A;  2ZAE A;  1I07 A;  1PG5 B;  3M59 A;  3FIF A;  2KNB B;  2YUQ A;  1YJN A;  2ZPE B;  4M78 D;  3M0Q A;  1G3Y A;  3E9G A;  2DZ9 A;  2V8K A;  2LJ0 A;  1VQP Q;  2DTH A;  2K3B A;  3CCM Q;  2E5Q A;  1UGS B;  3G4S T;  3DKM A;  2LQN A;  2PVD B;  4C92 C;  5A0D A;  1OI1 A;  3FDR A;  2DMO A;  5CKD A;  3TSW A;  3LH0 A;  1KC8 R;  3DLL A;  1U3O A;  2KVQ G;  2ZGW A;  2QDL A;  4M78 F;  1Y96 B;  2EKO A;  1NLO C;  4F7U B;  2D8H A;  1UFF A;  5FWC A;  4KH0 B;  3CCE T;  2KRS A;  3HL8 A;  3HTR A;  3NMZ C;  1VQ4 A;  3WVE B;  2DRM A;  5LJ3 h;  1WQ7 A;  1OX9 A;  2BZ8 A;  2QGG A;  2LNH B;  1AWJ A;  3BE3 A;  2JZ2 A;  1I0C A;  3KXT A;  2CRE A;  5D6Y A;  3RKW A;  3EHQ A;  1YIT Q;  1ABO A;  4MDW A;  3CCR Q;  1B07 A;  2KT8 A;  1YP5 A;  3G6E Q;  2LJ3 A;  4M75 E;  1K73 U;  1JBM A;  1M3A A;  3QWY A;  2LCL A;  4D8K A;  2E12 A;  3CEY A;  1KQ2 A;  2OTJ T;  2K79 A;  3TRE A;  3RER A;  3JCM W;  3LGL A;  5GAM h;  1UHF A;  1YI2 Q;  2O88 A;  4PFO A;  2LCS A;  3JB9 D;  4PJO G;  2CS7 A;  4GLK A;  1EX4 A;  3I35 A;  4F04 B;  2DBM A;  3ER0 A;  2NUP A;  4L5G A;  1TSF A;  4DBH A;  1WI7 A;  2RI3 A;  4RUG A;  2FZC B;  2V1R A;  1NLP C;  2RHU A;  4M75 F;  1CKA A;  2LQ8 A;  2LT4 A;  4OB2 B;  4KUI A;  4PK4 A;  4F16 A;  1IRE B;  4MZM A;  2QAZ A;  2OAU A;  1BIB A;  5AYF A;  3CCU A;  2RK1 A;  2WSE E;  5FW9 A;  2VC8 A;  1X27 A;  2DA9 A;  3EG3 A;  1YWP A;  1PRL C;  1HXD A;  5CKB A;  3JB9 F;  3NTH A;  3G6E T;  4J9F A;  4PJO A;  1X01 A;  2EJF A;  1OZ2 A;  2DZC A;  1IGQ A;  4L59 A;  5IHK A;  4QQD A;  2IIM A;  1G5V A;  1N5Z A;  1G3W A;  3SFM A;  3JCM f;  1R8O B;  5IXB A;  3PVL A;  3OYM A;  1T3L A;  4C8Q E;  1D0Y A;  3M0R A;  4RKU E;  2EGC A;  3HPW A;  4A4E A;  4E7H A;  2G6F X;  3M55 A;  3VRZ A;  4ZN3 A;  1CSK A;  4MZP A;  2LZ6 B;  4PL6 A;  4OGC A;  1TS9 A;  3X20 B;  1XJW B;  3OYC A;  4N4I A;  4R0K A;  4NS5 A;  1KFZ A;  1Y0M A;  1N8R U;  2Z0W A;  3KUF A;  2A3L A;  2YRV A;  4M7A F;  2H3J A;  1QWE A;  3A8G B;  2CZ0 B;  1BB9 A;  4Y91 A;  1W2B S;  2X4W A;  1YJ9 T;  3REB B;  4JRK A;  5GAN h;  5GAN e;  2F5T X;  3CCS Q;  2YUP A;  2E3H A;  1I4K 1;  3CC7 Q;  2LQW A;  2XD0 A;  1H3Z A;  1OEB A;  4M7D A;  1IRX A;  1JB0 E;  5A0G A;  1T0J A;  3M4G A;  5GAM e;  2L8D A;  2V8J A;  5CKH A;  1VQ4 Q;  2IPO B;  2FVU A;  3JRZ A;  1SPK A;  1G83 A;  2ZPB B;  4JJD A;  1NJI U;  3AT1 B;  4RTW A;  3DB3 A;  3S3O A;  5GAN 6;  1BI1 A;  1YJ9 A;  1JXO A;  2HQH A;  4ANJ A;  3EAE A;  2G3R A;  1KHI A;  4FSX A;  3G6E A;  1YIJ Q;  3RIR A;  2LRQ A;  3BDU A;  2DKG A;  1V1C A;  2DL7 A;  1UEB A;  3M56 A;  1B34 A;  2KK4 A;  1UJY A;  2B8A A;  1KQS P;  1VUB A;  2HQE A;  4ELZ C;  3OYI A;  1AWO A;  2A0F B;  1QMC A;  3I55 Q;  5LJ5 h;  2XKO C;  1Q7Y C;  1ABQ A;  3TU4 K;  2DL4 A;  3NTI A;  1BI3 A;  1VQK A;  3VUZ A;  4HVV A;  3WVD B;  5CIU A;  3HFN A;  3CCL T;  3CCS T;  4EMH A;  2ROT A;  4C5I A;  5HK0 A;  4C92 E;  2KYB A;  3CMA T;  2NUT B;  3MP1 A;  2DM1 A;  5I2M A;  3TCJ A;  1FYN A;  2EQI A;  1R77 A;  1W70 A;  2J6K A;  3ZFJ A;  1NJI C;  4XAX B;  5CQY A;  1VQ7 T;  1PCX A;  3QKJ A;  2KAF A;  2EVR A;  3LH5 A;  2J6F A;  2QI2 A;  3CME Q;  1K1Z A;  1XQH A;  2VV5 A;  2HKQ B;  4RTT A;  4M7D G;  1H8K A;  1K4U S;  4J9D A;  1Q86 R;  3E9F A;  1VQ6 Q;  2E65 A;  3INZ A;  2F2V A;  4BI4 A;  5CK9 A;  3QDR B;  2EBP A;  1KQS S;  1K8A R;  4QKU A;  1D0Z A;  1PHT A;  2L3P A;  2LT1 A;  5HY6 A;  1BCM A;  1KQS A;  3I9Q A;  2PUO B;  1D09 B;  4FW2 A;  5KE3 A;  3L2W A;  2YLC A;  4JRI A;  3A8L B;  3QG1 A;  3OS0 A;  3T9N A;  2H8H A;  4AFS C;  2FB7 A;  5LJ3 g;  2RQR A;  1RAA B;  4XTW A;  2WAC A;  2MWO A;  2DPP B;  2JMC A;  4M75 A;  1PC0 A;  2JTE A;  3S6W A;  2GNC A;  1M2V A;  4IKF A;  4ME7 A;  2DXT A;  2QA4 A;  1IGU A;  2GQI A;  2MPX C;  4P5N A;  3OQ5 A;  1YBY A;  3TSZ A;  3L2Z A;  2CP2 A;  4WF2 A;  3EGU A;  3TVT A;  3M0U A;  5GAM d;  1WDX A;  2RHY A;  2FPE A;  4BI3 A;  5A2Q E;  2DX1 A;  4RTX A;  2A7Y A;  3PE0 A;  1VQ6 A;  3CME T;  3X25 B;  3TEE A;  5GAN d;  1K76 A;  1T3S A;  4B6M A;  2ED1 A;  1G3S A;  2JS0 A;  4KUL A;  2RI2 A;  1KIK A;  1VYU A;  3M0S A;  1VQL A;  1YJW T;  5CAI A;  2J6O A;  4XTY A;  3VYH B;  2P0K A;  5LJ5 g;  4LDU A;  2AIR B;  1PD0 A;  1R0C B;  2P84 A;  3OYD A;  2X3X D;  3QYG B;  2IVW A;  1N8R R;  3GIB A;  1LCK A;  2KE9 A;  1WFW A;  3P8H A;  2RQW A;  1W2B A;  2A08 A;  1EFN A;  1B3Q A;  1JO8 A;  2KQW A;  4E7K A;  2E41 A;  1D0X A;  4EIK A;  3V8L A;  1P92 A;  4LN2 A;  2MCN A;  4J6Y A;  2OTL T;  1AWX A;  1SHG A;  3EFO B;  4AMC A;  2ED0 A;  1PKS A;  5GAN f;  3UAT A;  4M77 E;  3L42 A;  1LNX A;  2F69 A;  4GLM A;  4ZTJ A;  1GRI A;  2K5I A;  2QK0 A;  1ZSZ C;  3M54 A;  2LX9 A;  3OW2 S;  3CCE A;  2LTO A;  1Q82 C;  4WTO B;  4J6W A;  4XU2 A;  1AEY A;  2L89 A;  2M1H A;  1VQN T;  4XTX A;  4M77 D;  2E6Z A;  1Q95 G;  2QDY B;  5HK3 A;  2CP7 A;  3RDV A;  2VXE A;  2YT6 A;  2MF2 A;  4F7U E;  5J3B A;  1PWT A;  1QQJ A;  3C95 A;  4N0A A;  4BDY A;  3G7Z A;  2ZZD A;  1SKU B;  3MJX A;  5GAO q;  4M7D C;  2L3S A;  3AHU A;  3J81 E;  1OX8 A;  2GTO A;  1C6V X;  2NUP B;  2EYX A;  4C8Q B;  3EFO A;  1QVP A;  2OX7 A;  2DJQ A;  3VS2 A;  4C92 F;  2D0Q B;  2BZY A;  4YTL A;  4FM4 B;  3EGX B;  2JT4 A;  3H41 A;  3M5A A;  2RO0 A;  2X4Y A;  2K2M A;  3FEO A;  3CC4 Q;  2RD1 A;  4O6J A;  2X35 A;  4PJL A;  4JLI A;  4M78 B;  2W10 A;  1N6A A;  3CCE Q;  2EYQ A;  4QVZ A;  2K57 A;  3JCM J;  1W4S A;  5GAM j;  4JLG A;  2J7I A;  3L2R A;  2HL5 C;  4JS4 A;  3OA6 A;  2KBT A;  1M1G A;  5GMK h;  4JJN K;  1XTD A;  3S3N A;  2OTL Q;  1ARK A;  3BY7 A;  2FYK A;  4C0D B;  1I5L A;  2XI9 A;  3CCV Q;  2MWP A;  4M77 A;  3NPF A;  4MML A;  2EWN A;  5EG2 A;  5LJ3 d;  3A8H B;  2QA4 Q;  4LNP A;  1X2K A;  2DL8 A;  3NTK A;  4Y92 A;  4DOV A;  3RUX A;  1VQ9 Q;  1X43 A;  3CCJ Q;  1NM7 A;  1XNI A;  1HYO A;  2DVJ A;  3EH2 A;  1PSF A;  3KBG A;  2JTM A;  4LUD A;  3A98 A;  2FG0 A;  2RJE A;  2O9V A;  5LJ5 e;  5DLQ E;  4CC2 A;  4N0A C;  3SB2 A;  4RG8 A;  3C4S A;  1YHQ Q;  1M2V B;  3U23 A;  2HD0 A;  4GBQ A;  1VQM T;  3P8B B;  1M90 C;  2SRC A;  3F70 A;  4CI0 C;  4IIM A;  4RTY A;  4M7A C;  1ZSG A;  2QG9 B;  4C0D C;  1RI0 A;  2VUB A;  4GY5 A;  1QVG A;  4A63 B;  1KC8 C;  2HMA A;  2M02 A;  3VS4 A;  1WJS A;  2JMA A;  2D9T A;  2HAX A;  3CC2 A;  3UPU A;  2KXC A;  1MUZ A;  4L6V 5;  3CC4 T;  1VQ5 A;  2JTF A;  4ZGD B;  1JEG A;  2DO3 A;  1BYM A;  1YNZ A;  1EZZ B;  5CO7 A;  2VAS A;  4QQ6 A;  3HHT B;  3CPW A;  2JS2 A;  3QXE B;  2FRW A;  2KGT A;  2LMJ A;  3GNF B;  3QHS A;  4ATO A;  1OOT A;  2ZPG B;  1V76 A;  2DL5 A;  3OY9 A;  5EC7 A;  4LUE A;  3ZBD A;  4JDS A;  1S1N A;  3CCV T;  2E1H A;  4XK8 E;  2QA4 T;  1YHQ T;  2E4H A;  1WXT A;  3SHW A;  3OYY A;  2L0A A;  5I21 A;  2DE0 X;  3OYE A;  5FRO A;  1Y57 A;  1VQO A;  2DD5 A;  4BDZ A;  8ATC B;  1MMD A;  3M0T A;  1AD5 A;  1GCP A;  1Q86 C;  2K6D A;  1RUW A;  3A1P A;  4QVC A;  1VQP T;  1YCS B;  2C0T A;  1K9M C;  1UGV A;  1MND A;  2QTX A;  3OBW A;  3CCS A;  2L3Q A;  5CCA A;  1SEM A;  1ZBX A;  3OYJ A;  2NUT A;  1VIF A;  1TUD A;  1QVF S;  4X1V A;  4J9B A;  1U1S A;  3URG A;  1WHK A;  2HQX A;  4Z88 A;  1LVK A;  2QGF B;  4M7A E;  3G4S A;  1PSE A;  5GAM f;  1OQK A;  1UE9 A;  4OP0 A;  1Y7X A;  4ELY C;  1ZLM A;  4HT8 A;  1AZE A;  2W0Z A;  4OMN A;  3MCA B;  2HKN A;  1YIT A;  2A28 A;  1TUG B;  1GBR A;  4BAC A;  2COZ A;  2X4X A;  3M57 A;  1O75 A;  1QCO A;  2PVO B;  3EGD B;  2XDD A;  2DL3 A;  4ZGJ B;  2MI6 A;  5I2S A;  1G8X A;  1YIJ A;  4FIB A;  2IG0 A;  2C06 A;  4J8O A;  3CCU T;  2Y90 A;  1FXX A;  1RAD B;  3MEW A;  2CT3 A;  3HRS A;  3LYI A;  4QQG A;  1FX7 A;  1RAH B;  4PLL A;  1CKB A;  4XTV A;  5KYY B;  4ESR A;  3BDL A;  4KGV B;  2J06 A;  4VUB A;  1D3B B;  1X6G A;  3I56 A;  2AKL A;  5LJ5 f;  4C0F A;  1J3T A;  1QKW A;  4C92 A;  3FJ5 A;  4E7Z A;  5GMK l;  1AWW A;  2GBQ A;  3I5R A;  3EG0 A;  1N8R C;  1WZO A;  4IUR A;  2M0Y A;  2RHX A;  3CD6 A;  1NE8 A;  4KT0 E;  4M77 B;  4LD6 A;  2KT1 A;  2EQJ A;  4M77 C;  3HKS A;  3OS1 A;  4OMF B;  2O4X B;  2RQT A;  4E47 A;  4XU3 A;  1JJ2 A;  3VS5 A;  3FRN A;  2MMP A;  3EFS A;  1MV3 A;  2PU9 B;  1NEB A;  2KSS A;  1IHV A;  4OB0 B;  3NFC A;  2EW3 A;  2C0I A;  4J7F A;  1ZA2 B;  4M77 F;  2KDS A;  1BBZ A;  1JU5 C;  1WHJ A;  5GAN 8;  4JPB W;  1ACM B;  4PJO B;  1Q82 R;  3OMG A;  4B9X A;  3CPW S;  2BE7 D;  2X3W D;  5FU7 C;  5L8R E;  5GAN 2;  3RNJ A;  4EDU A;  3MPU B;  3QJY A;  1OZ3 A;  1OV3 A;  5J26 A;  4JUV A;  4C0G A;  3VRY A;  2XG8 D;  2DET A;  3VJP A;  3CXC P;  4O5V A;  1K8A C;  5GAN 5;  2RJC A;  2L5Q A;  2CUD A;  3LW5 E;  2GQV A;  1MNE A;  1JRI A;  2EGE A;  4IUP A;  5C0M A;  4JJC A;  2CZ7 B;  1NZ9 A;  1E6H A;  2F2X A;  3N5B B;  2X4J A;  1QCF A;  3VKI A;  4XU1 A;  3VS0 A;  4F7U A;  4N4H A;  3LGF A;  2DEQ A;  2RPN A;  2PZ1 A;  4OMP A;  4F17 A;  3PVQ A;  2FRY A;  1BCO A;  4M78 E;  1UJ0 A;  5FU6 B;  2E6N A;  2QEX T;  2X9H A;  6AT1 B;  3QO3 A;  5CQX A;  3RKX A;  2EIF A;  2MOX A;  3CC4 A;  1GFD A;  4M7A A;  2HEQ A;  4J9G A;  2M16 A;  4EMK A;  1UEC A;  4IUV A;  3CC7 A;  1D1A A;  2V1Q A;  1ZHI A;  3EG2 A;  2RH2 A;  1SSF A;  2YRC A;  2D1X A;  1OUL A;  4M7D F;  4QVD A;  4IUU A;  1VQ4 T;  2EYY A;  4F14 A;  2RQU A;  1A0N B;  1WGS A;  1VOM A;  4E7J A;  2E3I A;  3PIP A;  4Y28 E;  1YJN Q;  5KH6 A;  3JCM g;  4MDX A;  2O2O A;  4DQ2 A;  3J7A F;  3QZ9 B;  2DLP A;  2P4T A;  2DTI A;  3KFV A;  2ESW A;  2LNV A;  4M75 C;  1ZX6 A;  2F2W A;  3CCM T;  4PKC C;  3I55 A;  2QQS A;  2CP6 A;  5GAM g;  1VQN A;  4HA8 A;  1WXB A;  1VQM Q;  1BIA A;  3PGG A;  2DYI A;  4FYX B;  1H92 A;  4J9E A;  4M7A G;  2V26 A;  2K5F A;  1QKX A;  2KRN A;  1AOJ A;  3JB9 G;  1B7T A;  1VYT A;  1IHW A;  1YCY A;  3L2V A;  1VQP A;  2VXF A;  1C1A A;  4PJM A;  3R6O A;  2XIC A;  1PKT A;  3P8D A;  1E6G A;  3ZL7 C;  3CCR T;  3ZEH A;  2DRK A;  2KI7 A;  5CVI A;  3UA7 A;  5IT9 E;  3CCQ T;  3HFO A;  4RTZ A;  4AFU C;  2PUK B;  4NL3 A;  3QDF A;  5GAN g;  2VVK A;  3V7S A;  2RHZ A;  2EPD A;  4RCC A;  3MEU A;  2VGM A;  1VQN Q;  1RAF B;  1RI9 A;  1UGP B;  1OPK A;  3LLR A;  3CCL A;  2MYS A;  3GF5 A;  3SD4 A;  4HCZ A;  5FRM A;  2E70 A;  3CCR A;  2VKN A;  3L2U A;  1JJ2 S;  3LX7 A;  3M53 A;  5KYX A;  1VQO Q;  3MEV A;  1H64 1;  1WNL A;  1W1F A;  3RR6 A;  4XTZ A;  2L2P A;  1ZSZ A;  3CBP A;  2RB6 A;  5KE2 A;  4RMO A;  1R0B G;  4DBQ A;  1NPR A;  2QTV A;  3EGX A;  4C92 D;  3I56 T;  3VV0 A;  4Z89 A;  3OS2 A;  2PNI A;  4OGE A;  3JCM c;  5IHN A;  1YI2 A;  3JSC A;  5DLO A;  2AZV A;  2ZPI B;  2ZPH B;  3CC2 T;  1SSH A;  1SRM A;  2HL3 A;  3A5Z B;  2DBK A;  1QVF A;  1S72 T;  1X75 C;  3DLM A;  2F1L A;  4OF1 A;  3EG1 A;  3QSU A;  1ZA1 B;  2RQV A;  3S3M A;  1U06 A;  4QW2 A;  2RMO A;  5GAO r;  4C5H A;  1TU0 B;  1D3B A;  4KUD K;  2FO0 A;  1VQ7 A;  2CKK A;  4TVR A;  2PTK A;  4XTU A;  1M9S A;  1VQL Q;  3CCU Q;  1M3B A;  3OSS C;  2EYZ A;  1GBQ A;  3SDZ A;  1LPL A;  2J05 A;  5DM7 R;  4LXC A;  1KSW A;  1UGR B;  1H3H A;  1VQO T;  1Q81 C;  2GF7 A;  5LJ3 e;  1M90 U;  3X26 B;  3CD6 T;  3GOX A;  1NJI R;  4M75 G;  5D6W A;  2EFI A;  4F7U F;  1U8R A;  1UUE A;  5A0L A;  2L3R A;  2RI5 A;  2GGR A;  2YWW A;  4A4H A;  1RAG B;  4M78 G;  1LJO A;  2HSE B;  2JJ9 A;  2KXD A;  4PFZ A;  2JOY A;  2E10 A;  2CYZ B;  4MMK A;  2K7A A;  2CSI A;  3QII A;  1HD3 A;  1K0S A;  3PTA A;  1NPP A;  1DJ7 B;  3L2Q A;  1W6X A;  5GAN 7;  4Z8A A;  2P4R A;  1X6O A;  1UHC A;  4LDV A;  2PQW A;  4PFP A;  4PNO A;  1G2B A;  4KRT A;  4M7D E;  1F1B B;  5KYW A;  1VQL T;  2AK5 A;  3A8O B;  3SWN A;  2GFA A;  4PJN A;  3CBO A;  1MHN A;  1YJ9 Q;  4CC3 A;  2KY9 A;  2H3E B;  4FSS A;  2MK5 A;  2EQM A;  1KD1 R;  2OI3 A;  1I1J A;  2FZK B;  2QQ9 A;  4E7I A;  3GLX A;  1JQQ A;  5GAO l;  1SG5 A;  2DXU A;  4C8Q F;  1M90 R;  1QWF A;  1YI2 T;  4J5Y A;  2AHJ B;  3ME9 A;  1VQK Q;  5GAN 3;  4KGZ B;  4DA4 A;  2O9S A;  2O31 A;  4E2F B;  3L1A A;  3C12 A;  1SRL A;  5LL6 S;  2XHC A;  2XID A;  4C8Q D;  4E6R A;  1K73 C;  5I11 A;  3RMS A;  5FU6 C;  2LP5 A;  3H6Z A;  2RJF A;  3O5Z A;  3QPH A;  2ZPF B;  3CBM A;  1NYG A;  5GJV B;  5GAO n;  1SHF A;  2KMT A;  4M78 A;  1NYF A;  1Y71 A;  1Q82 U;  2KRO A;  2QQR A;  3CCV A;  4HVU A;  3FJP A;  3FC3 A;  4HVW A;  1WHM A;  1KJW A;  3M0P A;  4OMO A;  1RAE B;  3OYA A;  3BW1 A;  3HRT A;  3CCJ A;  2LQK A;  4ZTF A;  1FMW A;  5GJW B;  2CGH A;  2P0P A;  5IN1 A;  3EG9 A;  7AT1 B;  1YHQ A;  4J9H A;  4R56 A;  3H9N A;  1VQ6 T;  1MMG A;  1YWO A;  4C5E A;  2DVE A;  4KH1 B;  2DAQ A;  1VQ7 Q;  2RK2 A;  3NHN A;  4DBF A;  3G71 A;  4UC4 A;  3JCM e;  5D6X A;  2EQU A;  3EG9 B;  1WHH A;  5GAN 4;  4R55 A;  1N9R A;  2D8J A;  4X9C A;  2KRM A;  2R58 A;  2CH4 A;  1WPY A;  2O4X A;  2GFU A;  4NL2 A;  2EKH A;  5I22 A;  5KCH A;  3LWI A;  1X69 A;  2RNA A;  5KCO A;  2EYW A;  2KR3 A;  1UGQ B;  4M4Z A;  2JM9 A;  1VQ5 Q;  5KYW B;  3JAM E;  4BI8 B;  2DD4 A;  2EJ9 A;  3Q1J A;  4A53 A;  1M1K C;  2HNI A;  2DTO A;  2HBP A;  1BI0 A;  1UDL A;  4M7D D;  3CXC A;  4F7U G;  1MV0 B;  3CC7 T;  1VQM A;  4OB1 B;  8AT1 B;  2K5L A;  4OMQ A;  2YHT A;  4ZN1 A;  3THK A;  1G3T A;  1O9S A;  1MMN A;  2BIV A;  3CPF A;  2K2V A;  1GL5 A;  4M7D B;  1ZUY A;  4HCB A;  2ROL A;  3CCQ Q;  1VQ9 T; 
#chains in the Genus database with same CATH homology
 1VYU A;  3M0S A;  4AFZ C;  2M51 A;  2LJ1 A;  2MOX A;  2J6O A;  1GFD A;  5HCK A;  1M30 A;  2HEQ A;  1ZBJ A;  4J9G A;  1E7O A;  2NWM A;  1UEC A;  2DF6 A;  2E5K A;  5L23 A;  2X3X D;  2YDL A;  2V1Q A;  3EG2 A;  2HDA A;  4AFQ C;  1U5S A;  2HSP A;  1LCK A;  3H0H A;  2D1X A;  3JV3 A;  2KE9 A;  2CH4 W;  4HCK A;  3VS7 A;  1WFW A;  3QWX X;  2RQW A;  1Z9Q A;  2AZS A;  2A08 A;  1EFN A;  2ABL A;  1B3Q A;  4WCI A;  2EYY A;  5IXF A;  5ECA A;  4F14 A;  1JO8 A;  2RQU A;  1A0N B;  1WXU A;  4EIK A;  1RLP C;  4CC4 B;  4CC7 A;  4LN2 A;  2O2O A;  2MCN A;  2DYB A;  1AWX A;  2DLP A;  2DNU A;  4JZ4 A;  1SHG A;  3ULR B;  3EHR A;  2YUO A;  3KFV A;  4K11 A;  5FWB A;  1K9A A;  2ED0 A;  2ESW A;  1PKS A;  1I07 A;  3UAT A;  2A37 A;  1ZX6 A;  1Z9Z A;  1UG1 A;  2F2W A;  1PRM C;  4GLM A;  2KNB B;  2OJ2 A;  1GRI A;  2YUQ A;  3R6N A;  3M0Q A;  1WXB A;  2LJ0 A;  1AEY A;  2K3B A;  1H92 A;  4J9E A;  2LQN A;  4J9C A;  2YT6 A;  1QKX A;  3I5S A;  2DMO A;  1PWT A;  2KRN A;  1AOJ A;  3TSW A;  1NG2 A;  1U3O A;  1VYT A;  2L3S A;  2QDL A;  2FPF A;  2GTO A;  1WX6 A;  1NLO C;  2D8H A;  1UFF A;  5FWC A;  2EYX A;  1PKT A;  2KRS A;  1PNJ A;  4OML A;  3NMZ C;  1E6G A;  2ECZ A;  2DJQ A;  3VS2 A;  2NUZ A;  3ZL7 C;  2DRM A;  4ORZ A;  2DRK A;  2BZ8 A;  2LNH B;  2BZY A;  3UA6 A;  1AWJ A;  1I0C A;  3UA7 A;  2CRE A;  1NEG A;  2JT4 A;  3H41 A;  4IIO A;  2CT4 A;  3EHQ A;  4RTZ A;  2K2M A;  1ABO A;  4AFU C;  1B07 A;  2KT8 A;  1YP5 A;  2VVK A;  2EPD A;  2LJ3 A;  2W10 A;  3QWY A;  1M3A A;  4D8K A;  1RI9 A;  1OPK A;  1BK2 A;  2J7I A;  2K79 A;  2KBT A;  3REA B;  1ARK A;  2VKN A;  2RF0 A;  1UHF A;  2O88 A;  3NPF A;  4HXJ A;  1W1F A;  2BTT A;  2LCS A;  2L2P A;  4DEX A;  2KEA A;  4LNP A;  1X2K A;  2DL8 A;  4Y92 A;  3I35 A;  1OPL A;  1X43 A;  2DBM A;  1NM7 A;  4Z89 A;  1WI7 A;  4RUG A;  2HBW A;  2PNI A;  2DVJ A;  2V1R A;  1NLP C;  2K9G A;  2JW4 A;  5IHN A;  4LUD A;  2AZV A;  2FG0 A;  3A98 A;  2O9V A;  1CKA A;  4CC2 A;  4F16 A;  1SSH A;  1SRM A;  1WLP B;  2DBK A;  3U23 A;  2C0O A;  4GBQ A;  5FW9 A;  1X27 A;  1TUC A;  3EG1 A;  2DA9 A;  2RQV A;  3EG3 A;  1U06 A;  1YWP A;  2RMO A;  1PRL C;  2SRC A;  4IIM A;  4RTY A;  2FO0 A;  1ZSG A;  1RLQ C;  2PTK A;  4J9F A;  1X2Q A;  4A63 B;  1M3B A;  3VS4 A;  2JMA A;  3IQL A;  2EYZ A;  1GBQ A;  4LE9 A;  2KXC A;  1MUZ A;  2ENM A;  5IHK A;  2J05 A;  2IIM A;  1KSW A;  1GCQ C;  1H3H A;  1N5Z A;  1JEG A;  2YUN A;  5IXB A;  3PVL A;  1AZG B;  1QLY A;  1YNZ A;  1T3L A;  3M0R A;  1BU1 A;  4D8D A;  2EGC A;  2JS2 A;  2FRW A;  2KGT A;  2LMJ A;  2CDT A;  1OOT A;  2G6F X;  3VRZ A;  1UUE A;  1CSK A;  2DL5 A;  2LZ6 B;  5EC7 A;  4LUE A;  2GGR A;  2MIO A;  1S1N A;  2KXD A;  2AKK A;  2K7A A;  2CSI A;  4R0K A;  1HD3 A;  2JXB A;  1K0S A;  1KFZ A;  4AG2 C;  1Y0M A;  1M8M A;  1WXT A;  1W6X A;  3SHW A;  5IHI A;  2L0A A;  2DE0 X;  2P4R A;  4Z8A A;  1Y57 A;  1QWE A;  1UHC A;  1BB9 A;  3SEM A;  3M0T A;  1AD5 A;  1GCP A;  1IO6 A;  3REB B;  1JXM A;  2OAW A;  1G2B A;  2K6D A;  1RUW A;  2YUP A;  1ZUU A;  4KRT A;  1YCS B;  2C0T A;  1UGV A;  2AK5 A;  2LQW A;  1OEB A;  2L3Q A;  2BZX A;  1SEM A;  4CC3 A;  1T0J A;  1TUD A;  4FSS A;  4ZNX A;  4X1V A;  4J9B A;  1ZUK A;  2OI3 A;  4Z88 A;  1I1J A;  2YSQ A;  3VS3 A;  1SPK A;  1UE9 A;  1G83 A;  4JJD A;  1JQQ A;  4RTW A;  1ZLM A;  1AZE A;  2W0Z A;  4OMN A;  1QWF A;  2I0N A;  1JXO A;  2A28 A;  1GBR A;  1GCQ A;  2DL3 A;  1V1C A;  2DL7 A;  3H0F A;  2EGA A;  1VYV A;  1WIE A;  2O9S A;  2O31 A;  1FMK A;  4AG1 C;  2A36 A;  1UJY A;  1SRL A;  2CT3 A;  1AWO A;  4E6R A;  1AVZ C;  5I11 A;  1CKB A;  2LP5 A;  1ABQ A;  2DL4 A;  3O5Z A;  4ESR A;  1NYG A;  3NGP A;  2J06 A;  5GJV B;  4HVV A;  1X6G A;  1SHF A;  2AKL A;  1NYF A;  2KRO A;  4OMM A;  4HVU A;  1J3T A;  1HSQ A;  2ROT A;  4HVW A;  1QKW A;  1GFC A;  3FJ5 A;  1KJW A;  1TG0 A;  3M0P A;  2JM8 A;  2KYB A;  1AWW A;  2GBQ A;  4OMO A;  4JZ3 A;  3I5R A;  4JJB A;  2DM1 A;  2SEM A;  3EG0 A;  1FYN A;  2EQI A;  2HCK A;  1W70 A;  2GTJ A;  2J6K A;  2XMF A;  5GJW B;  2B86 A;  2M0Y A;  2CSQ A;  4J9H A;  2VWF A;  2KT1 A;  2EVR A;  3LH5 A;  1YN8 A;  1WA7 A;  2J6F A;  1K1Z A;  1YWO A;  2RQT A;  4RTT A;  3VS5 A;  1H8K A;  1WYX A;  3RBB B;  1K4U S;  2KYM A;  4J9D A;  3NHN A;  1MV3 A;  4QT7 A;  2FEI A;  2RN8 A;  1NEB A;  2F2V A;  2EBP A;  1M27 C;  2EW3 A;  2C0I A;  1X6B A;  1M3C A;  3C0C A;  3H0I A;  2DIL A;  1PHT A;  2D8J A;  1BBZ A;  1JU5 C;  2L3P A;  2KRM A;  5IH2 A;  4JPB W;  2CH4 A;  3I9Q A;  2EKH A;  1UTI A;  5I22 A;  2X3W D;  4J9I A;  1X69 A;  3RNJ A;  2RNA A;  2EYW A;  1OV3 A;  2H8H A;  2KR3 A;  4M4Z A;  4RTV A;  4AFS C;  2JM9 A;  2RQR A;  3GBQ A;  3VRY A;  1HJD A;  2JMC A;  2JTE A;  3VS6 A;  1XOV A;  2GNC A;  2CUD A;  1UDL A;  2EGE A;  2GQI A;  1MV0 B;  4RTU A;  4JJC A;  3VS1 A;  3TSZ A;  4OMQ A;  1E6H A;  2F2X A;  3EGU A;  3TVT A;  1QCF A;  3CQT A;  3M0U A;  3VS0 A;  1WDX A;  3UF4 A;  2FPE A;  2LX7 A;  1K0X A;  2D0N A;  2DX1 A;  4RTX A;  2RPN A;  3THK A;  2PZ1 A;  4OMP A;  4DEY A;  1T0H A;  3PE0 A;  4F17 A;  3PVQ A;  2FRY A;  2CUB A;  1K76 A;  1T3S A;  1UJ0 A;  1GL5 A;  2ED1 A;  1VA7 A;  2JS0 A;  1ZUY A;  2ROL A;  1KIK A;  2FPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...