4JJNK

Crystal structure of heterochromatin protein sir3 in complex with a silenced yeast nucleosome
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
213
structure length
205
Chain Sequence
AKDLDGWQVIITDDQVIDDNNRRRSRKENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSNEYLKRVSVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3
publication title Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 36
structure length 205
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4jjnK00
4FSXA 4KUIA 4FT2A 1M4ZA 4KULA 2FL7A 2FVUA 4JJNK 4KUDK 4DA4A 4FT4A 3PT9A 3PTAA 1ZBXA 4DOVA 4DOWA 4LD9K 4BB7A 3TU4K 1ZHIA 1W4SA
chains in the Genus database with same CATH superfamily
3TVTA 2E41A 2DFUA 1QP2A 2KXCA 4FW2A 4FYWB 4M75A 3SWNC 1VQPT 2J6OA 4HT9A 2ZCFB 2DETA 2DTHA 4XAXB 4PJJA 2CH4W 4IUPA 2HL5C 1PHTA 1IRXA 1WFWA 2YXYA 1ZHIA 4RMOA 5LJ5h 2GQIA 4Z02A 5IHNA 2EGAA 1ZA2B 4ELZC 2XDBA 4M7AB 5HKCA 2ZPFB 4J7FA 1BI2A 1D3BB 4D8KA 1NJIU 2DBMA 2HQEA 1K76A 1K9MU 1R0BG 1VQNA 3PGGA 3CCLA 4D6WA 2FRYA 3WVEB 3M0QA 1PM3A 3G4ST 2HEQA 1EIFA 2LQ8A 3HP9A 4B6MA 3G71A 1MV3A 2LJ0A 1SKUB 1VQPQ 3SEMA 4JJBA 3CCMT 3CPWS 1Q95G 4R56A 2EGCA 5KYNA 1LPLA 4M7AE 1KQSS 4M7AF 1QMCA 3HSBA 2QG9B 1PC0A 2GFUA 3ZFJA 3OMGA 4OMQA 4M77C 2FB7A 1M1GA 3EFOA 2V26A 3KBGA 4J5YA 3QPHA 1ZSZA 2DXBA 3L2QA 1P92A 3NFCA 2FPDA 2XHCA 4LDUA 4RTWA 2O31A 4J9IA 2E5QA 5LJ3d 1M2VA 3OA6A 2KI7A 1OZ2A 3G4SQ 2K57A 1BIBA 1X6BA 3P8DA 1MUZA 1JO8A 1UGPB 3CCMQ 3JCMd 4RUGA 4HXJA 3UPUA 1LNXA 2PUOB 4BY6C 2F1LA 4E47A 2EJ9A 2V1RA 5KYXB 3CCUT 1K0XA 2DKGA 2JZ2A 4PK4A 4OGEA 4OVAA 2X4JA 2L0AA 1YP5A 4LDVA 3CXCP 1IGUA 1JEGA 4A53A 2Y90A 3HHTB 3R6NA 2CUBA 1VQ8T 8ATCB 1HJDA 2M1HA 2M9UA 3OSVA 1G3TA 1MNEA 3BFMA 2BKDN 5GANe 2L3PA 3MEWA 1YFNA 1AD5A 1Q81C 2V8KA 2H3EB 4JUVA 3C4SA 1I0CA 4N4HA 5GMKe 4DEYA 2EYXA 1KQSP 1T0JA 2PQWA 1QVFA 2CUDA 2DILA 2D0QB 4QT7A 2ROLA 1UGQB 1IB8A 3TSZA 1OPKA 1D09B 3CCUQ 1KD1C 3CCVT 1H92A 1X75C 4QVCA 1QWEA 5J39A 4DOWA 2NUTA 4BB7A 4F7UB 2R57A 4BE1A 2IG0A 1M90C 1HYOA 1IGQA 3OYLA 1VQ8Q 1YHQT 3OYCA 1WXBA 4M7DB 4KUIA 3OS2A 4OMPA 4KGZB 2VGMA 2MIOA 2E6ZA 2NUPB 2R5AA 1TXQA 1W2BA 3FC3A 1J3TA 3CQTA 2EQUA 1VIFA 1G3YA 1WQWA 2DL4A 1VQ7T 2DTIA 2EKHA 1NG2A 2DAQA 2LQNA 3FEOA 4M75C 3V7RA 1FXXA 1D1BA 4RKUE 3SB2A 4F7UE 3EGDB 1PCXA 3PVLA 2KNBB 4F7UF 3MP1A 2LNHB 2JM8A 2QASA 5KYYB 3HKSA 1RL2A 3CCVQ 3VRZA 4RG8A 4RTUA 4PFZA 2O2OA 3PNWC 4XU1A 3L1AA 4M78D 2KRNA 2R58A 2DL8A 4M78G 4FIBA 1YHQQ 5CKBA 2CREA 1BI3A 3JCMf 1YNZA 4J9DA 4M78A 1Q81R 1WA7A 1VQ9T 2O01E 1VQ7Q 1K8AC 1M3CA 2ED1A 3REAB 4C8QD 3ASKA 2VXFA 1VQ4T 4C8QG 4LE9A 5GJWB 2AHJB 4ZNXA 5FROA 2QI2A 2HBWA 1BB9A 1PRMC 1KD1R 1Q7YC 4N4IA 3L2WA 5I11A 1W1FA 4C8QA 1YI2T 2GBQA 2K6DA 2QTVA 3RKWA 3J80E 2DL7A 2HQXA 4XTXA 3M59A 2WSFE 4UC4A 4PJNA 3LW5E 1M90R 1YJNT 2RJDA 2RMOA 3L2UA 2RK1A 1U5SA 3TSWA 5AYFA 3RR6A 1X2QA 4ESRA 3VYHB 1FX7A 4PJOD 4ELYC 1LCKA 1V29B 4PJOG 2RF0A 3QBYA 3OW2S 4C0DB 1W4SA 1YJWQ 1C6VX 2CH4A 2VYTA 4FL6A 4PJOA 1VQ9Q 5LJ3g 2A28A 2DXUA 1X6GA 2BIVA 4CRIA 3VU3C 4EMGA 3S3MA 1Q81U 3JCMg 3BY7A 1JJ2P 3QZ9B 3H0FA 1VQ4Q 4C0ZA 2VASA 1YBYA 2OI3A 2L89A 4WTOB 2F5KA 5D6XA 3A8MB 3EG9A 5CQXA 2VVKA 1U1SA 4P5NA 1B34A 2YDLA 2JMAA 1X69A 3EG2A 3PIPA 3JCMW 1KD1U 1YJNQ 2VC8A 3QWXX 1NZ9A 1GBQA 2DVEA 5KYWA 3META 4KT0E 1NE8A 1RABB 1UG1A 1VQOT 2RI5A 3RMQA 4CI0C 1M90U 2WACA 1G8XA 1SRMA 3QZ5B 4L6V5 3CCVA 2K3YA 1K8AR 3CD6A 2C0IA 1BI0A 2Z0WA 1N27A 1YITA 1RUWA 3PMTA 2VWFA 4LD6A 1QVFP 4XTWA 4C5HA 1JQQA 1Q7YR 1I5OB 1E6HA 4B9WA 2CP7A 4ORZA 2PVDB 2MAMA 2PVOB 3E9FA 3ZBDA 4LD9K 3CC4T 3DKMA 3CMAT 1SSFA 4N0AC 2K9GA 4CC3A 4M7DC 4C5IA 5GANf 4LDWA 3BW1A 1XJWB 5DLOA 3I5SA 1VQ7A 2EYQA 1OZ3A 4OB0B 4KGVB 3SWNB 4XU2A 2XK0A 1YJ9T 1WJQA 2J6FA 3NMZC 3VS6A 4R55A 4JZ4A 1UHCA 3E9GA 4E7IA 2DRMA 1W2BP 2P4RA 1KSWA 1OU9A 2CP2A 1PKSA 4II1A 1V76A 3MPUB 3VV0A 1FMKA 2LDMA 1BCOA 3DB4A 1M3BA 4X1VA 2X35A 2O9SA 1VQLT 3OS5A 3OBYA 1QVGA 2JXBA 2MWPA 2P84A 2QDLA 4DOVA 5I2SA 3CC4Q 1BIAA 3CMAQ 2ABLA 3OYKA 1UUEA 1PG5B 2JVVA 4J9GA 3TU4K 1Q7YU 2LMJA 4FYYB 4QW2A 2CP3A 1WI7A 5FRMA 1VQ5T 4DBHA 2QA4T 2X51A 5LJ3h 1YJ9Q 4PFPA 1RADB 4FT4A 3CBMA 4ZN1A 3OS1A 1M8MA 3AHUA 3JCMh 5GANg 4HA8A 2V1QA 1YI2A 3JB9H 4EMKA 1OX9A 2ENMA 3JB9I 2XDPA 4M78C 3I9QA 4GLKA 4JS5A 1YJNA 3JRZA 4M77B 4WF2A 4MZMA 2AZSA 2DYIA 2CP6A 3EHRA 1F1BB 3VYGA 1VQLQ 4OB3B 2IPOB 4AT1B 3RDVA 1VA7A 2KMTA 2MCNA 1SG5A 1RAFB 2A37A 3A98A 1VYUA 1QLYA 2KYBA 2LTOA 1SSHA 2YWWA 4C0DC 2MOXA 4J9BA 2NLUA 1VQ5Q 3I56T 4ANJA 5FRNA 2LVMA 2CS7A 5FU6B 4M77E 3JCMQ 3U23A 1VQ6A 4MDXA 4M77F 3TQ7P 3X28B 3JCMb 2ESWA 2KK4A 3M9QA 3OYAA 1O9SA 3V8LA 4A4HA 3OYYA 1T3SA 2VB6A 3CXCA 3X20B 2RJCA 2YLBA 4Y91A 2F2XA 3L2ZA 2LRQA 4KRTA 1KHCA 2OJ2A 3OQ5A 3DLLA 2DD5A 2F2VA 4BE0A 2E65A 1VQOA 3V8KA 4E2FB 1QWFA 2X3WD 1JRIA 3QIIA 4BUGA 1AWXA 3CPWA 2DJQA 1WX6A 3L2RA 4C92D 5I22A 3EHQA 4C92G 1KQSA 1XOVA 2RD1A 2JS2A 3M0TA 2OTLT 1RLQC 3X24B 2HKNA 3I56Q 3S6WA 2O4XB 1AT1B 5GANj 2ZPHB 1ZLMA 1DJ7B 1HD3A 1M9SA 4C92A 4XQ3A 2JMCA 1IXDA 2E3IA 1JU5C 1OU8A 2XG8D 4HCCA 4LXCA 1TH7A 4DBQA 2C0TA 5GMKj 2KYMA 2BUDA 2E4HA 2L5QA 4J6YA 2QK0A 5CQYA 3MCAB 2D8HA 2MYSA 2ZPEB 1WHLA 5KE3A 5D6YA 3JB9F 3VS0A 1D1AA 3ER0A 2DK3A 1WHMA 4KH1B 4OMMA 2RQTA 4LN2A 3FRNA 5GANh 3EG0A 2CSIA 1YCYA 2OTLQ 1WHJA 2KAFA 3GOXA 3I55A 3P8BB 2A0FB 2V8JA 4M75B 5GMKh 1UJYA 1ZBJA 5GAMj 2E1HA 2QQSA 2DERA 1YCSB 4FM4B 1VQKT 1ZX6A 2A3LA 3OSSC 1D3BA 3UA7A 2EJGA 3QUIA 1MHNA 3TREA 3HPWA 4OMLA 4MMLA 2K5LA 3JV3A 2QA4A 3RMSA 3NHNA 2L8DA 1QVGP 3OYMA 1ABQA 1E7OA 3LGFA 1N8RC 2P0QA 3G6EA 3WVDB 2XI9A 1XTDA 5GMKm 1A0NB 4M75E 1I8FA 3CC2A 1Z9QA 4X9CA 2KE9A 4M75F 2IVWA 1UEBA 2FHDA 5KE2A 4BE2A 4K11A 1N5ZA 1UFFA 2DZCA 3QSUA 1GCPA 5KYUA 2DL3A 4E7JA 1NLPC 2RJEA 5GAN7 3JCMX 4PNOA 1VQKQ 3VKIA 1R0CB 4RCCA 3X26B 4Z8AA 2CZ6B 2FO0A 4J8OA 2QQRA 2P4TA 1QCFA 2YUPA 1G3WA 1S1NA 2RQWA 3X25B 1RI9A 1ZSZB 1D0XA 2Y4XA 2YRVA 1KJWA 2RK2A 5FU6C 1NYFA 2J6KA 5D6WA 4PLLA 2RN8A 4MMKA 2GFAA 4HVWA 4ZTFA 1JJ2A 2H8HA 3CMEA 2X4XA 4EMHA 2FG0A 1M2VB 1Y96A 1KK7A 1MV0B 5FWBA 1MGQA 4IIOA 4JS4A 2V8IA 2AKKA 4QQGA 2LP5A 4E7SA 5CAIA 3CCQQ 4EIKA 2NYSA 2QEXT 1PSFA 4XTYA 4RTVA 4FYVB 1NPRA 3PTAA 1N8RR 4JJDA 3M4YA 2DNUA 3OYBA 5GAOn 2HD0A 1CSKA 2CT3A 1ABOA 1M2OA 3MEUA 5CIUA 1Y71A 2LNVA 4FYXB 3CPWP 2JJ9A 1AZEA 2M02A 1XNIA 3SD4A 2RH2A 4NS5A 2E5KA 5FWCA 1I5LA 3CEYA 1SHFA 4E6RA 4IKFA 3CCJT 1MNDA 4FCYA 2E3HA 4F7UG 2SEMA 2RI2A 1S72T 1D0ZA 3C12A 3OBWA 4E7ZA 1UGRB 2EBPA 5LJ5e 3QKJA 2W10A 2LT4A 4JRPA 4C92C 5L23A 5GAOr 1VQPA 4WCIA 1GXIE 2DBKA 4F7UA 3GIBA 3OMCA 2QEXQ 1JXOA 1CKAA 1VOMA 2EWNA 3C95A 3CCRT 2YRDA 2NUTB 4JJCA 5GAMe 1FMVA 1N8RU 1OEBA 2DZ9A 5CVIA 2KGTA 3V7SA 1B07A 1ZQ1A 2DD4A 3CCJQ 3EGDA 1MMGA 1OQKA 4M7DE 4IURA 3JSCA 3UATA 1Y57A 3RKXA 4M7DF 3M0SA 3G4SA 3M4GA 1S72Q 3FJ5A 4GY5A 1LVKA 3BE3A 4BDZA 3CCMA 1G3SA 1SRLA 3FDRA 1VIEA 1HK9A 1ARKA 2GCXA 4ZGEB 3RIRA 1PWTA 4J9CA 1YJWT 5GANd 3JCMP 1EZZB 2PVGB 3CCRQ 3OYGA 1RAAB 2HQHA 2RO0A 2DPPB 1UJ0A 4JLGA 4AG2C 2G3RA 2QYZA 2LJ3A 2X9HA 2DO3A 3PIOA 1I07A 3RERA 3FJPA 2JNGA 4FU6A 4M78B 1WIEA 4L5GA 5A0LA 2FEIA 2A7YA 4DA4A 1K0SA 3ULRB 1VUBA 4R0KA 1W70A 4MZPA 1O75A 4QVDA 1SF9A 3HRUA 2QQ9A 1H641 4C8QB 4J7IA 1ZSZC 3CCUA 2E6NA 3FB9A 2FZCB 2F69A 3RNJA 4M78E 2DJZA 3GBQA 4JPBW 3ME9A 2KRSA 4M78F 5ECAA 2RQRA 1NM7A 2XU8A 1GFDA 2HCKA 4JRKA 4PFOA 1PKTA 2K4YA 4BI8B 1FWZA 3CC7T 4XTZA 1VQ8A 5IHKA 2DM1A 3G7ZA 3BDLA 2JOYA 1WJRA 4PLIA 3JCMJ 3I5RA 4J6WA 3RESA 4PJOB 5GAOl 4BD3A 1V1CA 1RLPC 4LDYA 1MMDA 3H41A 4C8QE 1ZUYA 4PJMA 2RM4A 1WPYA 2K2MA 4C0GA 1KIKA 2EIFA 1WHGA 5CK9A 3CCST 3EGXA 1H8KA 2BZYA 1ZSGA 4LUEA 3A5ZB 4NL2A 1PSEA 5CKHA 2KBTA 3EG9B 3OYHA 5GAN5 1B34B 1ACMB 2EQJA 2AIRB 2FVUA 4KUDK 2CZ0B 3HRSA 2COZA 2DYBA 2CGHA 5KYWB 3LWHA 3CC7Q 1YHQA 3EH1A 1MMNA 2KDSA 2RJFA 2RHUA 3QDRB 4Z88A 2DIGA 3LH5A 3IQLA 3EAEA 3MEAA 4FSSA 4QQDA 1N9SA 8AT1B 2AT1B 3QYHB 2WSCE 4DBRA 2DA9A 1TOVA 1UHFA 2GTOA 5CR2A 3CCSQ 2LQKA 3URGA 3OW2P 2M16A 1T3LA 1BBZA 4J6XA 2HNIA 1GCQA 3EG3A 3VJPA 5GAOm 4AFUC 1KQ1A 2OAWA 2KVQG 2LQWA 2JUFA 4FSXA 2RQUA 4E7HA 3HFOA 5LJ5f 4C5GA 4AG1C 2YHTA 1K8AU 1Q82C 5I2MA 1YJWA 3UF4A 1IREB 3M58A 1VQMT 5GAN4 1VQ9A 1QQJA 2C06A 4XU0A 4PJLA 4FT2A 4B9XA 1WQ7A 5GAMf 3N5BB 5EG2A 2LCSA 1D0YA 2K79A 2BE9B 2JTEA 5C6SA 2NWMA 1X27A 3OYDA 2KT1A 1Y07A 3MO8A 1AZGB 1VQ4A 4BDYA 4RTXA 5GJVB 3MP6A 3QXEB 4J9FA 1NEBA 2EYZA 2F2WA 1QKWA 1VQNT 3CCLT 3HRTA 4XTVA 1RACB 4CC2A 2KT8A 2VV5A 1WGSA 2KEAA 3QJ6A 2JT4A 1U1TA 1M27C 4XTUA 5FLXE 4EMKB 2DE0X 1VQMQ 2JW4A 1EX4A 4IUQA 2PUKB 4C8QC 2RHIA 1NLOC 1H3HA 3CC7A 4ZN3A 3HL8A 1PD1A 1N9RA 2ZZDA 2RHZA 4RTYA 3KUFA 4X9DA 2AK5A 3V7CA 1TUGB 5GAMg 5D7UA 2ZPIB 1QVPA 2KR3A 4MZTA 3VS7A 1M1KC 3H0HA 2CZ1B 1VQNQ 4J9EA 3CCLQ 4PJOC 1RAHB 1C1AA 1Q82R 9ATCB 3PMIA 1OPLA 4LUDA 4LDXA 3LLRA 3ZEHA 2CDTA 3KFVA 2QTXA 2XDDA 5A0DA 2RHXA 2HMAA 4N4GA 2YUQA 1WJSA 2CZ7B 2EQKA 1KHIA 5HCKA 2K2VA 3NPFA 3M54A 3M55A 4C5EA 2YUOA 3S3NA 1U8RA 3M57A 3CC4A 3CMAA 2ED0A 1OOTA 1BYMA 5GMKl 3EH2A 3OYNA 3EFRA 4F14A 2OAUA 3EGUA 2ZGWA 2P0KA 3QHSA 2H3JA 3UA6A 4C92B 5FU7B 1YJ9A 2LCCA 2X4YA 4TVRA 1BU1A 3F70A 1ZUUA 1EFNA 4BI4A 2RB6A 2FZGB 5LJ5j 2YLCA 2QGGA 1WHKA 1Q82U 1I81A 4Z89A 2HSEB 5IXFA 2EKOA 3C0CA 4ME7A 3EG1A 3RKYA 2ECZA 1X2KA 2QQBA 1VYVA 3H8ZA 1VQLA 4PKCC 4JDSA 4M7AD 2FZKB 1M4ZA 4M7AG 2ZAEA 5CKDA 4C92E 5LJ3e 4C92F 4Q5WA 1VQMA 1M1KR 1GCQC 4XU3A 4DQ2A 4IUVA 3MEVA 1CKBA 2CSQA 1VYTA 4M7AA 2BTTA 3JCMe 2E10A 3OYJA 2JTMA 1YIJT 2GQVA 1E6GA 3OB9A 1VQ5A 5I21A 4ZTJA 2D9TA 2HBPA 3GF5A 1KG1A 3GNGA 2M0YA 4J9HA 2JTFA 2M51A 2VKNA 2RA2A 3L42A 3M53A 3E19A 3SHWA 3CXCS 1JB0E 3SFMA 2HSPA 5GAMh 3MKDA 1NEGA 2A36A 3QJYA 1I1JA 3A8GB 2DXTA 3NTHA 1OYXA 5GMKi 3UT1A 2LT1A 3DLMA 2L3SA 1NYGA 3PVQA 3CCQT 3EFSA 2XIDA 1K73C 1YIJQ 3TEEA 5KYUB 1Q86C 4EMKC 5CKEA 3I56A 1N6AA 3H9NA 4AFQC 1M1KU 2EJFA 2BZXA 2RI3A 1M3AA 2JS0A 3T9NA 3ZL7C 1GBRA 3EFOB 4XK8E 1Z9ZA 4A63B 5GAOp 4QKUA 4JJNK 2EW3A 1KQ2A 2DTOA 3NGPA 1AWJA 5GAN3 5HK3A 7AT1B 1FYNA 2EFIA 2GGRA 5KYXA 5GAN2 3E2UA 1UGVA 1X43A 2VXEA 1TG0A 4HT8A 4ATOA 2F5TX 3CBOA 1AVZC 1RAEB 2I2LA 1GFCA 2EGEA 1Y96B 2FRWA 3VUBA 4F04B 2OTLA 2L3QA 2AKLA 3M56A 2G6FX 2L2PA 4YTLA 5CKFA 4DEXA 2QDYB 1QW1A 1AHJB 1BCMA 4OB1B 1UECA 4EDUA 3VS5A 2PNIA 2DEQA 1WYXA 2XKOC 4RG2A 4PL6A 1D1CA 4M7DD 2DMOA 1AWOA 2MI6A 4M7DG 1MMAA 2EYYA 1TSFA 3L2VA 5DY9A 5FU7C 3O8VA 1K73R 3OW2A 2CYZB 4N0AA 1Q86R 2MK5A 4M7DA 4AFZC 3NTKA 3GPLA 1YN8A 2NUPA 3CBPA 1NPPA 3CD6T 1U3OA 4HKEA 1YITT 4AFSC 1LJOA 2E70A 3PE0A 3MHXA 4E7LA 4HVUA 1LOJA 2IIMA 5A2QE 3J7AF 2BZ8A 1VQKA 1TWBA 1YIJA 2HKQB 1HXDA 3FIFA 3P8HA 1WDXA 1WXTA 2FPFA 2MWOA 5KYYA 1ZBXA 1AWWA 1TS9A 2Y4YA 1G2BA 1R77A 2LX9A 2YSQA 3M0RA 3D7SB 1ZUKA 2LCLA 4OB2B 1X6OA 1UDLA 4GBQA 3UDCA 3VS2A 4BACA 5EC7A 4RCBA 1IO6A 5CCAA 4JLIA 3CPFA 3JB9J 5GAN8 4FW1A 1JJ2S 1KC8C 4M7AC 4IUTA 1G83A 2NUZA 4KGXB 2YRCA 1K73U 2JM9A 4CC4B 3CD6Q 2RNAA 2DVJA 1Q86U 1WXUA 1YITQ 3QG1A 5LJ3f 3LYIA 2O88A 1AEYA 1BKBA 3CCQA 1OULA 1PRLC 4IIMA 4A4GA 1KFZA 1WLPB 3OYIA 2LC4A 2D1XA 1JBMA 2DLPA 2PZ1A 2CKKA 1RAGB 3LGLA 3WXMB 5LJ5d 1B3QA 3JAME 3KXTA 1IZ6A 3SDZA 2LJ1A 3E1SA 4F16A 2E64A 2XMFA 2X3XD 1QVFS 1TUDA 2K5FA 5HK0A 2DIQA 2XD0A 4JRIA 5GAMd 2RHYA 2R5MA 2LX7A 5GAN6 1R8OB 3LH0A 1JXMA 3PT9A 4OGCA 3MP8A 2QGFB 1W6XA 4BI3A 4GLMA 2QQAA 2M0OA 3JCMV 2QEXA 3OYFA 1OV3A 2EVRA 2CP0A 4CC7A 4KULA 1W2BS 1UB4A 4F17A 2K7AA 2DXCA 1IHVA 2VUBA 4C8QF 1RI0A 4A4EA 2C0OA 2HAXA 2KY9A 3M5AA 3TCJA 2KXDA 3RBBB 5KH6A 1K4US 5IHIA 1BK2A 4QQ6A 1WHHA 3A8HB 1KC8R 2BE7D 1M8VA 4M4ZA 1VQ6T 2OTJT 4Y28E 3CCJA 3GNFB 2PTKA 2DEUA 1YI2Q 4ZGDB 2EPDA 4PJOE 3EGXB 2EQIA 1S72A 1AOJA 1SEMA 4OP0A 4PJOF 5IH2A 3A8OB 3I35A 1OI1A 3VS1A 3HFNA 2VGNA 4OMFB 1QKXA 4HCKA 2FPEA 1PNJA 3S3OA 2J7IA 2KROA 2RPNA 2B8AA 2HL3A 1FMWA 3CCRA 3CCET 1QCNA 2DRKA 5L8RE 3JCMc 1TU0B 3VUZA 1YWOA 2B86A 5IAYA 4RTTA 5LL6S 3SWNA 2CT4A 1T0HA 4A54A 1VQ6Q 2OTJQ 4NOYA 1X01A 2DX1A 2WSEE 1U06A 6AT1B 4KBMB 1XQHA 1KC8U 1GRIA 4OMNA 1ZA1B 1HSQA 2ATCB 2DF6A 4D8DA 2QXFA 1VQOQ 3GLXA 4J83A 1TTHB 5LJ3j 2EQMA 3QDFA 2LZ6B 2P0PA 1WZOA 3LWIA 5CO7A 2E12A 2MMPA 3H0IA 5GAOq 4E7KA 3A8LB 3CCEQ 2GF7A 1K9AA 2PU9B 5J3BA 4OMOA 2CP5A 4HCBA 2FL7A 2EYWA 3REBB 3I55T 4MDWA 1SPKA 4A4FA 3R6OA 5IN1A 2QAZA 4ZGJB 5KCOA 3HTRA 1GL5A 3QYGB 4M77D 3RUXA 5J26A 4M77G 2KSSA 4RTZA 5C0MA 5KCHA 1M1FA 5M9OA 1QCOA 1UTIA 2A08A 2ZPBB 3VS3A 4JZ3A 4M77A 1TUCA 2J06A 2KQWA 4O6JA 3G6ET 3THKA 1NJIC 4VUBA 3G1JA 3G71T 2YT6A 1K9MC 1PD0A 3CC2T 1UGSB 3GP8A 2JN0A 1YWPA 4QVZA 1I4K1 2MPXC 5LJ5g 3MJXA 2D0NA 4HCZA 3O5ZA 1BI1A 4Y92A 1B7TA 2EAYA 3VRYA 3VS4A 4KH0B 3BDUA 2K5IA 3I55Q 3AT1B 2K3XA 3LX7A 3OS0A 4EPCA 4OF1A 3UWNA 2X4WA 4JRQA 1K1ZA 5AT1B 3QO3A 5HY6A 1IHWA 3PFSA 3OY9A 5IXBA 3QWYA 3CCSA 2QA4Q 2J05A 2MF2A 1H3ZA 2COYA 2OTJA 3G6EQ 4BY6B 2L3RA 5DM7R 3G71Q 2COWA 2ROTA 3CC2Q 3H6ZA 3Q1JA 3JB9D 3C94A 4V2SA 1M30A 4IUUA 2FYKA 3JB9G 2YUNA 2GTJA 4X34A 1UE9A 3CMET 3OYEA 2D8JA 2O9VA 2HZYA 3M0PA 5A0GA 1G5VA 1Y0MA 4DBFA 2O4XA 5IT9E 4AMCA 1Y7XA 1QVGS 2I0NA 3M0UA 2ZPGB 4C0FA 2XICA 4LNPA 4O5VA 2AZVA 3CCEA 1QP3A 1M5Q1 3J81E 2SRCA 4NL3A 1RAIB 1WNLA 1C0MA 1NJIR 3NTIA 3INZA 1SHGA 3V8JA 1K9MR 5FW9A 2W0ZA 2GNCA 2K3BA 2KRMA 2HDAA 3DB3A 2RQVA 5DLQE 4M75D 1OX8A 4A4KA 4HVVA 4M75G 3CMEQ 4L59A 2DL5A 2D6FA 2OX7A 1NBEB 3FLGA 3A1PA
chains in the Genus database with same CATH topology
4C8QB 4QW2A 2E41A 4J7IA 5FRMA 3CCUA 1QP2A 2E6NA 4OB1B 1VQ5T 4M75A 3FB9A 4EDUA 2QA4T 3SWNC 1VQPT 2F69A 5LJ3h 4M78E 2DEQA 2DJZA 4FT4A 4HT9A 3CBMA 3ME9A 2ZCFB 4M78F 2DTHA 4XAXB 2XKOC 4ZN1A 3OS1A 3AHUA 2XU8A 4JRKA 4IUPA 2K4YA 4RG2A 4BI8B 1FWZA 4PL6A 4XTZA 3JCMh 5GANg 1VQ8A 3CC7T 4HA8A 1YI2A 4M7DD 1ZHIA 3G7ZA 3BDLA 4RMOA 2MI6A 2JOYA 3JB9H 1WJRA 4EMKA 5LJ5h 4PLIA 3L2VA 5DY9A 5FU7C 3JB9I 3JCMJ 2XDPA 4J6WA 4M78C 3RESA 3O8VA 4GLKA 4JS5A 1YJNA 3JRZA 4M77B 4WF2A 4MZMA 5GAOl 4Z02A 4BD3A 3OW2A 4ELZC 2CYZB 4N0AA 3VYGA 2XDBA 4LDYA 4C8QE 4M7DA 4M7AB 5HKCA 2ZPFB 4J7FA 1BI2A 1D3BB 1WPYA 2RM4A 4OB3B 1NJIU 4C0GA 2EIFA 2KMTA 3NTKA 5CK9A 3GPLA 3CBPA 3CCST 2HQEA 1NPPA 3CD6T 1K9MU 1VQNA 3PGGA 3CCLA 3A5ZB 4NL2A 1PSEA 2LTOA 4HKEA 3FLGA 5CKHA 4D6WA 1YITT 1LJOA 2E70A 3MHXA 4E7LA 3WVEB 3OYHA 5GAN5 1LOJA 5A2QE 3J7AF 1VQKA 4C0DC 3G4ST 1B34B 1EIFA 2LQ8A 3HP9A 3G71A 2NLUA 3I56T 2EQJA 5FRNA 2LVMA 1YIJA 2CS7A 2FVUA 5FU6B 3CCMT 4M77E 2CZ0B 3JCMQ 4KUDK 3HRSA 1HXDA 3CPWS 1VQ6A 2CGHA 3FIFA 3P8HA 4M77F 3X28B 4MDXA 4R56A 3JCMb 2MWOA 3LWHA 4M7AE 2KK4A 1ZBXA 3M9QA 3OYAA 1KQSS 1O9SA 3V8LA 1YHQA 4M7AF 4A4HA 3OYYA 3HSBA 3CXCA 2GFUA 2KDSA 3X20B 2RJCA 2YLBA 2Y4YA 3ZFJA 2LX9A 3OMGA 4Y91A 3L2ZA 2RJFA 2LRQA 1KHCA 2RHUA 3OQ5A 2LCLA 3QDRB 1X6OA 4OB2B 4M77C 3UDCA 3DLLA 4BACA 2DD5A 2DIGA 4RCBA 4BE0A 2FB7A 5CCAA 1M1GA 4JLIA 3CPFA 2E65A 3EAEA 3JB9J 5GAN8 3MEAA 1VQOA 3KBGA 4QQDA 1KC8C 1JJ2S 1N9SA 4IUTA 3V8KA 4M7AC 3QYHB 4J5YA 2WSCE 3QPHA 2DXBA 3L2QA 1P92A 1JRIA 3NFCA 5CR2A 1K73U 2LQKA 3URGA 2XHCA 3QIIA 4BUGA 2M16A 4LDUA 3CPWA 1Q86U 3L2RA 1Q86C 3QG1A 4J6XA 2HNIA 4C92D 5LJ3f 3VJPA 5GAOm 3LYIA 4C92G 2E5QA 1KQSA 5LJ3d 1XOVA 3OA6A 2RD1A 4PJOB 1OZ2A 1BKBA 3CCQA 2K57A 1BIBA 1KQ1A 2OTLT 3P8DA 4A4GA 2KVQG 3X24B 3OYIA 2JUFA 3S6WA 4FSXA 2LC4A 2O4XB 1UGPB 5GANj 2ZPHB 1DJ7B 1M9SA 4C92A 4E7HA 3JCMd 3CC2T 3HFOA 1JBMA 4XQ3A 1LNXA 2PUOB 5LJ5f 3UPUA 2CKKA 4BY6C 4C5GA 3LGLA 3WXMB 4E47A 5LJ5d 2XG8D 2EJ9A 4HCCA 1TH7A 2YHTA 5GMKj 3CCUT 1K8AU 1Q82C 3JAME 2BUDA 2DKGA 2JZ2A 5I2MA 3KXTA 1IZ6A 1YJWA 1IREB 3M58A 3SDZA 4OGEA 3E1SA 2L5QA 1VQMT 2E64A 2X4JA 4J6YA 4OVAA 5GAN4 1VQ9A 5CQYA 3MCAB 2C06A 4XU0A 1QVFS 4LDVA 2K5FA 5HK0A 4A53A 2Y90A 3HHTB 4FT2A 4B9XA 1WQ7A 1VQ8T 2DIQA 2ZPEB 5GAMf 3N5BB 5EG2A 5KE3A 2XD0A 4JRIA 5D6YA 5C6SA 5GAMd 3JB9F 2RHYA 2R5MA 5GAN6 2M1HA 2M9UA 3ER0A 3OSVA 3OYDA 1G3TA 1R8OB 1Y07A 3MO8A 3LH0A 2DK3A 3BFMA 1VQ4A 3PT9A 4BDYA 2BKDN 4OGCA 3MP6A 3MP8A 5GANe 3QXEB 3FRNA 5GANh 3MEWA 4BI3A 1Q81C 1YCYA 2V8KA 4M7DG 2QQAA 2KAFA 2M0OA 3GOXA 3JCMV 2QEXA 4JUVA 3I55A 3P8BB 2V8JA 3C4SA 3OYFA 4M75B 4N4HA 5GMKe 1VQNT 3CCLT 5GMKh 2PQWA 4KULA 5GAMj 1QVFA 3HRTA 1W2BS 4XTVA 2D0QB 1UB4A 2E1HA 2VV5A 1UGQB 1WGSA 2QQSA 4FM4B 3QJ6A 1VQKT 2DXCA 2VUBA 2A3LA 4C8QF 1RI0A 3OSSC 4A4EA 1KD1C 1D3BA 2HAXA 2KY9A 3CCVT 2EJGA 3QUIA 1MHNA 1U1TA 3M5AA 3HPWA 3TCJA 4XTUA 1X75C 3TREA 4QVCA 4MMLA 2K5LA 5FLXE 5KH6A 4EMKB 4QQ6A 5J39A 3A8HB 4DOWA 2QA4A 1M8VA 1VQ6T 3RMSA 4BB7A 4F7UB 2OTJT 4Y28E 2L8DA 2R57A 4BE1A 4IUQA 3OYMA 3CCJA 2IG0A 3GNFB 3LGFA 1N8RC 1M90C 2PUKB 2P0QA 3OYLA 4C8QC 3G6EA 3WVDB 2RHIA 3OYCA 1YHQT 4M7DB 4KUIA 2XI9A 3OS2A 1XTDA 4ZGDB 2VGMA 5GMKm 3CC7A 4M75E 1I8FA 2E6ZA 2R5AA 4ZN3A 3CC2A 4PJOE 4X9CA 1W2BA 1S72A 3HL8A 4M75F 2IVWA 3FC3A 4OP0A 4PJOF 1UEBA 1N9RA 2ZZDA 2RHZA 3A8OB 2EQUA 3KUFA 2FHDA 1VIFA 4X9DA 5KE2A 1OI1A 4BE2A 3HFNA 2VGNA 1G3YA 4OMFB 1WQWA 3V7CA 1VQ7T 5GAMg 2DTIA 2DZCA 2ZPIB 1QVPA 3QSUA 3S3OA 1M1KC 4MZTA 2DAQA 2CZ1B 3FEOA 4M75C 3V7RA 4E7JA 1FXXA 4RKUE 2B8AA 4PJOC 3SB2A 4F7UE 2RJEA 3CCRA 5GAN7 3CCET 4F7UF 3MP1A 5L8RE 3JCMX 4V2SA 3PMIA 4PNOA 4LDXA 3VKIA 3HKSA 3LLRA 3JCMc 4RCCA 1RL2A 3ZEHA 3X26B 2QTXA 3VUZA 2CZ6B 4ZTJA 5IAYA 4RG8A 5LL6S 3SWNA 2XDDA 4J8OA 4A54A 2QQRA 2RHXA 5A0DA 2P4TA 4N4GA 3PNWC 4XU1A 1WJSA 2CZ7B 3L1AA 4M78D 4NOYA 1X01A 2R58A 1G3WA 2EQKA 4M78G 1KHIA 2WSEE 4FIBA 2K2VA 5CKBA 3X25B 4KBMB 3M54A 1XQHA 1BI3A 3M55A 2Y4XA 3JCMf 4C5EA 1KC8U 2YRVA 3S3NA 1U8RA 2RK2A 5FU6C 4M78A 5D6WA 4PLLA 3M57A 4MMKA 1VQ9T 3CC4A 2GFAA 3CMAA 4ZTFA 1JJ2A 2QXFA 3CMEA 2O01E 2X4XA 4EMHA 1BYMA 5GMKl 1Y96A 1K8AC 3GLXA 4J83A 1MGQA 3OYNA 5LJ3j 2EQMA 3EFRA 4C8QD 3ASKA 2VXFA 2OAUA 2P0PA 1VQ4T 4C8QG 4JS4A 2ZGWA 2P0KA 3QHSA 2H3JA 2V8IA 2AHJB 5CO7A 4C92B 3LWIA 2E12A 2MMPA 5FU7B 2QI2A 4QQGA 5FROA 5GAOq 3A8LB 4E7KA 1YJ9A 2LCCA 1Q7YC 2X4YA 2GF7A 4N4IA 3L2WA 2PU9B 4TVRA 5J3BA 5CAIA 3F70A 4HCBA 4BI4A 2FL7A 2RB6A 4C8QA 1YI2T 5LJ5j 2YLCA 3RKWA 1PSFA 3I55T 4XTYA 3J80E 2QEXT 2HQXA 4MDWA 3M59A 2WSFE 4UC4A 4XTXA 1Q82U 1NPRA 1I81A 3LW5E 3PTAA 1YJNT 2RJDA 4A4FA 3M4YA 2RK1A 3OYBA 5GAOn 3R6OA 2HD0A 3L2UA 5IN1A 2EKOA 5AYFA 4ZGJB 4ME7A 5KCOA 3MEUA 5CIUA 1Y71A 3VYHB 3RKYA 1FX7A 4PJOD 2QQBA 3QYGB 4M77D 5J26A 1V29B 4PJOG 3RUXA 2LNVA 4ELYC 3H8ZA 4M77G 1VQLA 3QBYA 3OW2S 2KSSA 4C0DB 4PKCC 4JDSA 1XNIA 5C0MA 1W4SA 4M7AD 5KCHA 1M1FA 3SD4A 5M9OA 1M4ZA 2RH2A 4M7AG 4NS5A 2VYTA 5CKDA 4C92E 5LJ3e 4FL6A 1I5LA 4PJOA 2ZPBB 3CEYA 4IKFA 4M77A 4C92F 2KQWA 5LJ3g 4Q5WA 3CCJT 2DXUA 1VQMA 2BIVA 4O6JA 4XU3A 4CRIA 4DQ2A 4IUVA 3MEVA 3G6ET 1NJIC 4M7AA 3VU3C 4VUBA 3JCMe 3G71T 4F7UG 2E10A 3OYJA 4EMGA 3S3MA 1Q81U 3JCMg 2JTMA 2RI2A 3BY7A 3QZ9B 1YIJT 1S72T 1K9MC 2GQVA 3C12A 3OBWA 1UGSB 3OB9A 1UGRB 3GP8A 5LJ5e 1VQ5A 4C0ZA 5I21A 3QKJA 2D9TA 2JN0A 2LT4A 4C92C 4QVZA 4JRPA 1YBYA 5GAOr 1I4K1 2HBPA 5LJ5g 2L89A 1GXIE 2F5KA 5D6XA 4F7UA 3A8MB 4HCZA 5CQXA 3GIBA 1BI1A 2EAYA 3GF5A 1U1SA 4P5NA 1KG1A 1B34A 3GNGA 3BDUA 3OMCA 2K5IA 2JTFA 2K3XA 3PIPA 3LX7A 3OS0A 4EPCA 2RA2A 3JCMW 1KD1U 2EWNA 3L42A 3C95A 3M53A 2VC8A 3E19A 4OF1A 3UWNA 2X4WA 3CXCS 3CCRT 1NZ9A 4JRQA 1JB0E 2DVEA 3SFMA 3META 3QO3A 1NE8A 4KT0E 5HY6A 5GAMe 1VQOT 5GAMh 2RI5A 3PFSA 3RMQA 4CI0C 3OY9A 1M90U 1N8RU 2WACA 3QJYA 3A8GB 2DZ9A 2DXTA 5CVIA 3NTHA 3QZ5B 4L6V5 3CCSA 3CCVA 2K3YA 3V7SA 1OYXA 5GMKi 3UT1A 1ZQ1A 3CD6A 2LT1A 1BI0A 3DLMA 2DD4A 2MF2A 1N27A 1H3ZA 1YITA 2OTJA 3CCQT 3PMTA 4BY6B 4IURA 3EFSA 2L3RA 3JSCA 4M7DE 4LD6A 5DM7R 2XIDA 3RKXA 4XTWA 4M7DF 1K73C 4C5HA 3G4SA 3M4GA 4B9WA 3H6ZA 3Q1JA 3JB9D 3TEEA 2PVDB 2MAMA 2PVOB 3C94A 3E9FA 2FYKA 4IUUA 5CKEA 4EMKC 3I56A 1N6AA 3ZBDA 4GY5A 3JB9G 1M1KU 2EJFA 3DKMA 3CC4T 4BDZA 3CMAT 4LD9K 2RI3A 1G3SA 3CCMA 4X34A 3FDRA 1VIEA 3CMET 1SSFA 3T9NA 1HK9A 4N0AC 3OYEA 2GCXA 4ZGEB 4M7DC 4C5IA 5GANf 5A0GA 4LDWA 4XK8E 3RIRA 3BW1A 5DLOA 1G5VA 5GAOp 1YJWT 1VQ7A 5GANd 2EYQA 3JCMP 1OZ3A 4JJNK 4OB0B 2O4XA 5IT9E 3SWNB 1KQ2A 4XU2A 2DTOA 1Y7XA 2XK0A 1QVGS 1YJ9T 1WJQA 2PVGB 3OYGA 2ZPGB 4R55A 5GAN3 4C0FA 5HK3A 2XICA 2RO0A 3E9GA 4E7IA 4O5VA 2DPPB 4JLGA 3CCEA 1QP3A 2G3RA 1M5Q1 2EFIA 5GAN2 3J81E 4NL3A 2VXEA 4II1A 2DO3A 1WNLA 3PIOA 3RERA 3FJPA 2JNGA 4FU6A 4HT8A 3VV0A 4ATOA 3NTIA 2LDMA 3INZA 2F5TX 3CBOA 4M78B 4L5GA 3DB4A 3V8JA 5A0LA 2X35A 2A7YA 4DA4A 2I2LA 1VQLT 1VUBA 1Y96B 3OS5A 3VUBA 4MZPA 3OBYA 1QVGA 3DB3A 2OTLA 2MWPA 3M56A 4DOVA 5I2SA 4YTLA 5DLQE 1BIAA 4M75D 4A4KA 5CKFA 3OYKA 4M75G 1O75A 2JVVA 3TU4K 4QVDA 4L59A 2D6FA 3HRUA 2QDYB 1VQPA 1QW1A 2QQ9A 1Q7YU 1H641 1AHJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FSX A;  4KUI A;  4FT2 A;  1M4Z A;  4KUL A;  2FL7 A;  2FVU A;  4JJN K;  4KUD K;  4DA4 A;  4FT4 A;  3PT9 A;  3PTA A;  1ZBX A;  4DOV A;  4DOW A;  4LD9 K;  4BB7 A;  3TU4 K;  1ZHI A;  1W4S A; 
#chains in the Genus database with same CATH topology
 3TVT A;  2E41 A;  2DFU A;  1QP2 A;  2KXC A;  4FW2 A;  4FYW B;  4M75 A;  3SWN C;  1VQP T;  2J6O A;  4HT9 A;  2ZCF B;  2DET A;  2DTH A;  4XAX B;  4PJJ A;  2CH4 W;  4IUP A;  2HL5 C;  1PHT A;  1IRX A;  1WFW A;  2YXY A;  1ZHI A;  4RMO A;  5LJ5 h;  2GQI A;  4Z02 A;  5IHN A;  2EGA A;  1ZA2 B;  4ELZ C;  2XDB A;  4M7A B;  5HKC A;  2ZPF B;  4J7F A;  1BI2 A;  1D3B B;  4D8K A;  1NJI U;  2DBM A;  2HQE A;  1K76 A;  1K9M U;  1R0B G;  1VQN A;  3PGG A;  3CCL A;  4D6W A;  2FRY A;  3WVE B;  3M0Q A;  1PM3 A;  3G4S T;  2HEQ A;  1EIF A;  2LQ8 A;  3HP9 A;  4B6M A;  3G71 A;  1MV3 A;  2LJ0 A;  1SKU B;  1VQP Q;  3SEM A;  4JJB A;  3CCM T;  3CPW S;  1Q95 G;  4R56 A;  2EGC A;  5KYN A;  1LPL A;  4M7A E;  1KQS S;  4M7A F;  1QMC A;  3HSB A;  2QG9 B;  1PC0 A;  2GFU A;  3ZFJ A;  3OMG A;  4OMQ A;  4M77 C;  2FB7 A;  1M1G A;  3EFO A;  2V26 A;  3KBG A;  4J5Y A;  3QPH A;  1ZSZ A;  2DXB A;  3L2Q A;  1P92 A;  3NFC A;  2FPD A;  2XHC A;  4LDU A;  4RTW A;  2O31 A;  4J9I A;  2E5Q A;  5LJ3 d;  1M2V A;  3OA6 A;  2KI7 A;  1OZ2 A;  3G4S Q;  2K57 A;  1BIB A;  1X6B A;  3P8D A;  1MUZ A;  1JO8 A;  1UGP B;  3CCM Q;  3JCM d;  4RUG A;  4HXJ A;  3UPU A;  1LNX A;  2PUO B;  4BY6 C;  2F1L A;  4E47 A;  2EJ9 A;  2V1R A;  5KYX B;  3CCU T;  1K0X A;  2DKG A;  2JZ2 A;  4PK4 A;  4OGE A;  4OVA A;  2X4J A;  2L0A A;  1YP5 A;  4LDV A;  3CXC P;  1IGU A;  1JEG A;  4A53 A;  2Y90 A;  3HHT B;  3R6N A;  2CUB A;  1VQ8 T;  8ATC B;  1HJD A;  2M1H A;  2M9U A;  3OSV A;  1G3T A;  1MNE A;  3BFM A;  2BKD N;  5GAN e;  2L3P A;  3MEW A;  1YFN A;  1AD5 A;  1Q81 C;  2V8K A;  2H3E B;  4JUV A;  3C4S A;  1I0C A;  4N4H A;  5GMK e;  4DEY A;  2EYX A;  1KQS P;  1T0J A;  2PQW A;  1QVF A;  2CUD A;  2DIL A;  2D0Q B;  4QT7 A;  2ROL A;  1UGQ B;  1IB8 A;  3TSZ A;  1OPK A;  1D09 B;  3CCU Q;  1KD1 C;  3CCV T;  1H92 A;  1X75 C;  4QVC A;  1QWE A;  5J39 A;  4DOW A;  2NUT A;  4BB7 A;  4F7U B;  2R57 A;  4BE1 A;  2IG0 A;  1M90 C;  1HYO A;  1IGQ A;  3OYL A;  1VQ8 Q;  1YHQ T;  3OYC A;  1WXB A;  4M7D B;  4KUI A;  3OS2 A;  4OMP A;  4KGZ B;  2VGM A;  2MIO A;  2E6Z A;  2NUP B;  2R5A A;  1TXQ A;  1W2B A;  3FC3 A;  1J3T A;  3CQT A;  2EQU A;  1VIF A;  1G3Y A;  1WQW A;  2DL4 A;  1VQ7 T;  2DTI A;  2EKH A;  1NG2 A;  2DAQ A;  2LQN A;  3FEO A;  4M75 C;  3V7R A;  1FXX A;  1D1B A;  4RKU E;  3SB2 A;  4F7U E;  3EGD B;  1PCX A;  3PVL A;  2KNB B;  4F7U F;  3MP1 A;  2LNH B;  2JM8 A;  2QAS A;  5KYY B;  3HKS A;  1RL2 A;  3CCV Q;  3VRZ A;  4RG8 A;  4RTU A;  4PFZ A;  2O2O A;  3PNW C;  4XU1 A;  3L1A A;  4M78 D;  2KRN A;  2R58 A;  2DL8 A;  4M78 G;  4FIB A;  1YHQ Q;  5CKB A;  2CRE A;  1BI3 A;  3JCM f;  1YNZ A;  4J9D A;  4M78 A;  1Q81 R;  1WA7 A;  1VQ9 T;  2O01 E;  1VQ7 Q;  1K8A C;  1M3C A;  2ED1 A;  3REA B;  4C8Q D;  3ASK A;  2VXF A;  1VQ4 T;  4C8Q G;  4LE9 A;  5GJW B;  2AHJ B;  4ZNX A;  5FRO A;  2QI2 A;  2HBW A;  1BB9 A;  1PRM C;  1KD1 R;  1Q7Y C;  4N4I A;  3L2W A;  5I11 A;  1W1F A;  4C8Q A;  1YI2 T;  2GBQ A;  2K6D A;  2QTV A;  3RKW A;  3J80 E;  2DL7 A;  2HQX A;  4XTX A;  3M59 A;  2WSF E;  4UC4 A;  4PJN A;  3LW5 E;  1M90 R;  1YJN T;  2RJD A;  2RMO A;  3L2U A;  2RK1 A;  1U5S A;  3TSW A;  5AYF A;  3RR6 A;  1X2Q A;  4ESR A;  3VYH B;  1FX7 A;  4PJO D;  4ELY C;  1LCK A;  1V29 B;  4PJO G;  2RF0 A;  3QBY A;  3OW2 S;  4C0D B;  1W4S A;  1YJW Q;  1C6V X;  2CH4 A;  2VYT A;  4FL6 A;  4PJO A;  1VQ9 Q;  5LJ3 g;  2A28 A;  2DXU A;  1X6G A;  2BIV A;  4CRI A;  3VU3 C;  4EMG A;  3S3M A;  1Q81 U;  3JCM g;  3BY7 A;  1JJ2 P;  3QZ9 B;  3H0F A;  1VQ4 Q;  4C0Z A;  2VAS A;  1YBY A;  2OI3 A;  2L89 A;  4WTO B;  2F5K A;  5D6X A;  3A8M B;  3EG9 A;  5CQX A;  2VVK A;  1U1S A;  4P5N A;  1B34 A;  2YDL A;  2JMA A;  1X69 A;  3EG2 A;  3PIP A;  3JCM W;  1KD1 U;  1YJN Q;  2VC8 A;  3QWX X;  1NZ9 A;  1GBQ A;  2DVE A;  5KYW A;  3MET A;  4KT0 E;  1NE8 A;  1RAB B;  1UG1 A;  1VQO T;  2RI5 A;  3RMQ A;  4CI0 C;  1M90 U;  2WAC A;  1G8X A;  1SRM A;  3QZ5 B;  4L6V 5;  3CCV A;  2K3Y A;  1K8A R;  3CD6 A;  2C0I A;  1BI0 A;  2Z0W A;  1N27 A;  1YIT A;  1RUW A;  3PMT A;  2VWF A;  4LD6 A;  1QVF P;  4XTW A;  4C5H A;  1JQQ A;  1Q7Y R;  1I5O B;  1E6H A;  4B9W A;  2CP7 A;  4ORZ A;  2PVD B;  2MAM A;  2PVO B;  3E9F A;  3ZBD A;  4LD9 K;  3CC4 T;  3DKM A;  3CMA T;  1SSF A;  4N0A C;  2K9G A;  4CC3 A;  4M7D C;  4C5I A;  5GAN f;  4LDW A;  3BW1 A;  1XJW B;  5DLO A;  3I5S A;  1VQ7 A;  2EYQ A;  1OZ3 A;  4OB0 B;  4KGV B;  3SWN B;  4XU2 A;  2XK0 A;  1YJ9 T;  1WJQ A;  2J6F A;  3NMZ C;  3VS6 A;  4R55 A;  4JZ4 A;  1UHC A;  3E9G A;  4E7I A;  2DRM A;  1W2B P;  2P4R A;  1KSW A;  1OU9 A;  2CP2 A;  1PKS A;  4II1 A;  1V76 A;  3MPU B;  3VV0 A;  1FMK A;  2LDM A;  1BCO A;  3DB4 A;  1M3B A;  4X1V A;  2X35 A;  2O9S A;  1VQL T;  3OS5 A;  3OBY A;  1QVG A;  2JXB A;  2MWP A;  2P84 A;  2QDL A;  4DOV A;  5I2S A;  3CC4 Q;  1BIA A;  3CMA Q;  2ABL A;  3OYK A;  1UUE A;  1PG5 B;  2JVV A;  4J9G A;  3TU4 K;  1Q7Y U;  2LMJ A;  4FYY B;  4QW2 A;  2CP3 A;  1WI7 A;  5FRM A;  1VQ5 T;  4DBH A;  2QA4 T;  2X51 A;  5LJ3 h;  1YJ9 Q;  4PFP A;  1RAD B;  4FT4 A;  3CBM A;  4ZN1 A;  3OS1 A;  1M8M A;  3AHU A;  3JCM h;  5GAN g;  4HA8 A;  2V1Q A;  1YI2 A;  3JB9 H;  4EMK A;  1OX9 A;  2ENM A;  3JB9 I;  2XDP A;  4M78 C;  3I9Q A;  4GLK A;  4JS5 A;  1YJN A;  3JRZ A;  4M77 B;  4WF2 A;  4MZM A;  2AZS A;  2DYI A;  2CP6 A;  3EHR A;  1F1B B;  3VYG A;  1VQL Q;  4OB3 B;  2IPO B;  4AT1 B;  3RDV A;  1VA7 A;  2KMT A;  2MCN A;  1SG5 A;  1RAF B;  2A37 A;  3A98 A;  1VYU A;  1QLY A;  2KYB A;  2LTO A;  1SSH A;  2YWW A;  4C0D C;  2MOX A;  4J9B A;  2NLU A;  1VQ5 Q;  3I56 T;  4ANJ A;  5FRN A;  2LVM A;  2CS7 A;  5FU6 B;  4M77 E;  3JCM Q;  3U23 A;  1VQ6 A;  4MDX A;  4M77 F;  3TQ7 P;  3X28 B;  3JCM b;  2ESW A;  2KK4 A;  3M9Q A;  3OYA A;  1O9S A;  3V8L A;  4A4H A;  3OYY A;  1T3S A;  2VB6 A;  3CXC A;  3X20 B;  2RJC A;  2YLB A;  4Y91 A;  2F2X A;  3L2Z A;  2LRQ A;  4KRT A;  1KHC A;  2OJ2 A;  3OQ5 A;  3DLL A;  2DD5 A;  2F2V A;  4BE0 A;  2E65 A;  1VQO A;  3V8K A;  4E2F B;  1QWF A;  2X3W D;  1JRI A;  3QII A;  4BUG A;  1AWX A;  3CPW A;  2DJQ A;  1WX6 A;  3L2R A;  4C92 D;  5I22 A;  3EHQ A;  4C92 G;  1KQS A;  1XOV A;  2RD1 A;  2JS2 A;  3M0T A;  2OTL T;  1RLQ C;  3X24 B;  2HKN A;  3I56 Q;  3S6W A;  2O4X B;  1AT1 B;  5GAN j;  2ZPH B;  1ZLM A;  1DJ7 B;  1HD3 A;  1M9S A;  4C92 A;  4XQ3 A;  2JMC A;  1IXD A;  2E3I A;  1JU5 C;  1OU8 A;  2XG8 D;  4HCC A;  4LXC A;  1TH7 A;  4DBQ A;  2C0T A;  5GMK j;  2KYM A;  2BUD A;  2E4H A;  2L5Q A;  4J6Y A;  2QK0 A;  5CQY A;  3MCA B;  2D8H A;  2MYS A;  2ZPE B;  1WHL A;  5KE3 A;  5D6Y A;  3JB9 F;  3VS0 A;  1D1A A;  3ER0 A;  2DK3 A;  1WHM A;  4KH1 B;  4OMM A;  2RQT A;  4LN2 A;  3FRN A;  5GAN h;  3EG0 A;  2CSI A;  1YCY A;  2OTL Q;  1WHJ A;  2KAF A;  3GOX A;  3I55 A;  3P8B B;  2A0F B;  2V8J A;  4M75 B;  5GMK h;  1UJY A;  1ZBJ A;  5GAM j;  2E1H A;  2QQS A;  2DER A;  1YCS B;  4FM4 B;  1VQK T;  1ZX6 A;  2A3L A;  3OSS C;  1D3B A;  3UA7 A;  2EJG A;  3QUI A;  1MHN A;  3TRE A;  3HPW A;  4OML A;  4MML A;  2K5L A;  3JV3 A;  2QA4 A;  3RMS A;  3NHN A;  2L8D A;  1QVG P;  3OYM A;  1ABQ A;  1E7O A;  3LGF A;  1N8R C;  2P0Q A;  3G6E A;  3WVD B;  2XI9 A;  1XTD A;  5GMK m;  1A0N B;  4M75 E;  1I8F A;  3CC2 A;  1Z9Q A;  4X9C A;  2KE9 A;  4M75 F;  2IVW A;  1UEB A;  2FHD A;  5KE2 A;  4BE2 A;  4K11 A;  1N5Z A;  1UFF A;  2DZC A;  3QSU A;  1GCP A;  5KYU A;  2DL3 A;  4E7J A;  1NLP C;  2RJE A;  5GAN 7;  3JCM X;  4PNO A;  1VQK Q;  3VKI A;  1R0C B;  4RCC A;  3X26 B;  4Z8A A;  2CZ6 B;  2FO0 A;  4J8O A;  2QQR A;  2P4T A;  1QCF A;  2YUP A;  1G3W A;  1S1N A;  2RQW A;  3X25 B;  1RI9 A;  1ZSZ B;  1D0X A;  2Y4X A;  2YRV A;  1KJW A;  2RK2 A;  5FU6 C;  1NYF A;  2J6K A;  5D6W A;  4PLL A;  2RN8 A;  4MMK A;  2GFA A;  4HVW A;  4ZTF A;  1JJ2 A;  2H8H A;  3CME A;  2X4X A;  4EMH A;  2FG0 A;  1M2V B;  1Y96 A;  1KK7 A;  1MV0 B;  5FWB A;  1MGQ A;  4IIO A;  4JS4 A;  2V8I A;  2AKK A;  4QQG A;  2LP5 A;  4E7S A;  5CAI A;  3CCQ Q;  4EIK A;  2NYS A;  2QEX T;  1PSF A;  4XTY A;  4RTV A;  4FYV B;  1NPR A;  3PTA A;  1N8R R;  4JJD A;  3M4Y A;  2DNU A;  3OYB A;  5GAO n;  2HD0 A;  1CSK A;  2CT3 A;  1ABO A;  1M2O A;  3MEU A;  5CIU A;  1Y71 A;  2LNV A;  4FYX B;  3CPW P;  2JJ9 A;  1AZE A;  2M02 A;  1XNI A;  3SD4 A;  2RH2 A;  4NS5 A;  2E5K A;  5FWC A;  1I5L A;  3CEY A;  1SHF A;  4E6R A;  4IKF A;  3CCJ T;  1MND A;  4FCY A;  2E3H A;  4F7U G;  2SEM A;  2RI2 A;  1S72 T;  1D0Z A;  3C12 A;  3OBW A;  4E7Z A;  1UGR B;  2EBP A;  5LJ5 e;  3QKJ A;  2W10 A;  2LT4 A;  4JRP A;  4C92 C;  5L23 A;  5GAO r;  1VQP A;  4WCI A;  1GXI E;  2DBK A;  4F7U A;  3GIB A;  3OMC A;  2QEX Q;  1JXO A;  1CKA A;  1VOM A;  2EWN A;  3C95 A;  3CCR T;  2YRD A;  2NUT B;  4JJC A;  5GAM e;  1FMV A;  1N8R U;  1OEB A;  2DZ9 A;  5CVI A;  2KGT A;  3V7S A;  1B07 A;  1ZQ1 A;  2DD4 A;  3CCJ Q;  3EGD A;  1MMG A;  1OQK A;  4M7D E;  4IUR A;  3JSC A;  3UAT A;  1Y57 A;  3RKX A;  4M7D F;  3M0S A;  3G4S A;  3M4G A;  1S72 Q;  3FJ5 A;  4GY5 A;  1LVK A;  3BE3 A;  4BDZ A;  3CCM A;  1G3S A;  1SRL A;  3FDR A;  1VIE A;  1HK9 A;  1ARK A;  2GCX A;  4ZGE B;  3RIR A;  1PWT A;  4J9C A;  1YJW T;  5GAN d;  3JCM P;  1EZZ B;  2PVG B;  3CCR Q;  3OYG A;  1RAA B;  2HQH A;  2RO0 A;  2DPP B;  1UJ0 A;  4JLG A;  4AG2 C;  2G3R A;  2QYZ A;  2LJ3 A;  2X9H A;  2DO3 A;  3PIO A;  1I07 A;  3RER A;  3FJP A;  2JNG A;  4FU6 A;  4M78 B;  1WIE A;  4L5G A;  5A0L A;  2FEI A;  2A7Y A;  4DA4 A;  1K0S A;  3ULR B;  1VUB A;  4R0K A;  1W70 A;  4MZP A;  1O75 A;  4QVD A;  1SF9 A;  3HRU A;  2QQ9 A;  1H64 1;  4C8Q B;  4J7I A;  1ZSZ C;  3CCU A;  2E6N A;  3FB9 A;  2FZC B;  2F69 A;  3RNJ A;  4M78 E;  2DJZ A;  3GBQ A;  4JPB W;  3ME9 A;  2KRS A;  4M78 F;  5ECA A;  2RQR A;  1NM7 A;  2XU8 A;  1GFD A;  2HCK A;  4JRK A;  4PFO A;  1PKT A;  2K4Y A;  4BI8 B;  1FWZ A;  3CC7 T;  4XTZ A;  1VQ8 A;  5IHK A;  2DM1 A;  3G7Z A;  3BDL A;  2JOY A;  1WJR A;  4PLI A;  3JCM J;  3I5R A;  4J6W A;  3RES A;  4PJO B;  5GAO l;  4BD3 A;  1V1C A;  1RLP C;  4LDY A;  1MMD A;  3H41 A;  4C8Q E;  1ZUY A;  4PJM A;  2RM4 A;  1WPY A;  2K2M A;  4C0G A;  1KIK A;  2EIF A;  1WHG A;  5CK9 A;  3CCS T;  3EGX A;  1H8K A;  2BZY A;  1ZSG A;  4LUE A;  3A5Z B;  4NL2 A;  1PSE A;  5CKH A;  2KBT A;  3EG9 B;  3OYH A;  5GAN 5;  1B34 B;  1ACM B;  2EQJ A;  2AIR B;  2FVU A;  4KUD K;  2CZ0 B;  3HRS A;  2COZ A;  2DYB A;  2CGH A;  5KYW B;  3LWH A;  3CC7 Q;  1YHQ A;  3EH1 A;  1MMN A;  2KDS A;  2RJF A;  2RHU A;  3QDR B;  4Z88 A;  2DIG A;  3LH5 A;  3IQL A;  3EAE A;  3MEA A;  4FSS A;  4QQD A;  1N9S A;  8AT1 B;  2AT1 B;  3QYH B;  2WSC E;  4DBR A;  2DA9 A;  1TOV A;  1UHF A;  2GTO A;  5CR2 A;  3CCS Q;  2LQK A;  3URG A;  3OW2 P;  2M16 A;  1T3L A;  1BBZ A;  4J6X A;  2HNI A;  1GCQ A;  3EG3 A;  3VJP A;  5GAO m;  4AFU C;  1KQ1 A;  2OAW A;  2KVQ G;  2LQW A;  2JUF A;  4FSX A;  2RQU A;  4E7H A;  3HFO A;  5LJ5 f;  4C5G A;  4AG1 C;  2YHT A;  1K8A U;  1Q82 C;  5I2M A;  1YJW A;  3UF4 A;  1IRE B;  3M58 A;  1VQM T;  5GAN 4;  1VQ9 A;  1QQJ A;  2C06 A;  4XU0 A;  4PJL A;  4FT2 A;  4B9X A;  1WQ7 A;  5GAM f;  3N5B B;  5EG2 A;  2LCS A;  1D0Y A;  2K79 A;  2BE9 B;  2JTE A;  5C6S A;  2NWM A;  1X27 A;  3OYD A;  2KT1 A;  1Y07 A;  3MO8 A;  1AZG B;  1VQ4 A;  4BDY A;  4RTX A;  5GJV B;  3MP6 A;  3QXE B;  4J9F A;  1NEB A;  2EYZ A;  2F2W A;  1QKW A;  1VQN T;  3CCL T;  3HRT A;  4XTV A;  1RAC B;  4CC2 A;  2KT8 A;  2VV5 A;  1WGS A;  2KEA A;  3QJ6 A;  2JT4 A;  1U1T A;  1M27 C;  4XTU A;  5FLX E;  4EMK B;  2DE0 X;  1VQM Q;  2JW4 A;  1EX4 A;  4IUQ A;  2PUK B;  4C8Q C;  2RHI A;  1NLO C;  1H3H A;  3CC7 A;  4ZN3 A;  3HL8 A;  1PD1 A;  1N9R A;  2ZZD A;  2RHZ A;  4RTY A;  3KUF A;  4X9D A;  2AK5 A;  3V7C A;  1TUG B;  5GAM g;  5D7U A;  2ZPI B;  1QVP A;  2KR3 A;  4MZT A;  3VS7 A;  1M1K C;  3H0H A;  2CZ1 B;  1VQN Q;  4J9E A;  3CCL Q;  4PJO C;  1RAH B;  1C1A A;  1Q82 R;  9ATC B;  3PMI A;  1OPL A;  4LUD A;  4LDX A;  3LLR A;  3ZEH A;  2CDT A;  3KFV A;  2QTX A;  2XDD A;  5A0D A;  2RHX A;  2HMA A;  4N4G A;  2YUQ A;  1WJS A;  2CZ7 B;  2EQK A;  1KHI A;  5HCK A;  2K2V A;  3NPF A;  3M54 A;  3M55 A;  4C5E A;  2YUO A;  3S3N A;  1U8R A;  3M57 A;  3CC4 A;  3CMA A;  2ED0 A;  1OOT A;  1BYM A;  5GMK l;  3EH2 A;  3OYN A;  3EFR A;  4F14 A;  2OAU A;  3EGU A;  2ZGW A;  2P0K A;  3QHS A;  2H3J A;  3UA6 A;  4C92 B;  5FU7 B;  1YJ9 A;  2LCC A;  2X4Y A;  4TVR A;  1BU1 A;  3F70 A;  1ZUU A;  1EFN A;  4BI4 A;  2RB6 A;  2FZG B;  5LJ5 j;  2YLC A;  2QGG A;  1WHK A;  1Q82 U;  1I81 A;  4Z89 A;  2HSE B;  5IXF A;  2EKO A;  3C0C A;  4ME7 A;  3EG1 A;  3RKY A;  2ECZ A;  1X2K A;  2QQB A;  1VYV A;  3H8Z A;  1VQL A;  4PKC C;  4JDS A;  4M7A D;  2FZK B;  1M4Z A;  4M7A G;  2ZAE A;  5CKD A;  4C92 E;  5LJ3 e;  4C92 F;  4Q5W A;  1VQM A;  1M1K R;  1GCQ C;  4XU3 A;  4DQ2 A;  4IUV A;  3MEV A;  1CKB A;  2CSQ A;  1VYT A;  4M7A A;  2BTT A;  3JCM e;  2E10 A;  3OYJ A;  2JTM A;  1YIJ T;  2GQV A;  1E6G A;  3OB9 A;  1VQ5 A;  5I21 A;  4ZTJ A;  2D9T A;  2HBP A;  3GF5 A;  1KG1 A;  3GNG A;  2M0Y A;  4J9H A;  2JTF A;  2M51 A;  2VKN A;  2RA2 A;  3L42 A;  3M53 A;  3E19 A;  3SHW A;  3CXC S;  1JB0 E;  3SFM A;  2HSP A;  5GAM h;  3MKD A;  1NEG A;  2A36 A;  3QJY A;  1I1J A;  3A8G B;  2DXT A;  3NTH A;  1OYX A;  5GMK i;  3UT1 A;  2LT1 A;  3DLM A;  2L3S A;  1NYG A;  3PVQ A;  3CCQ T;  3EFS A;  2XID A;  1K73 C;  1YIJ Q;  3TEE A;  5KYU B;  1Q86 C;  4EMK C;  5CKE A;  3I56 A;  1N6A A;  3H9N A;  4AFQ C;  1M1K U;  2EJF A;  2BZX A;  2RI3 A;  1M3A A;  2JS0 A;  3T9N A;  3ZL7 C;  1GBR A;  3EFO B;  4XK8 E;  1Z9Z A;  4A63 B;  5GAO p;  4QKU A;  4JJN K;  2EW3 A;  1KQ2 A;  2DTO A;  3NGP A;  1AWJ A;  5GAN 3;  5HK3 A;  7AT1 B;  1FYN A;  2EFI A;  2GGR A;  5KYX A;  5GAN 2;  3E2U A;  1UGV A;  1X43 A;  2VXE A;  1TG0 A;  4HT8 A;  4ATO A;  2F5T X;  3CBO A;  1AVZ C;  1RAE B;  2I2L A;  1GFC A;  2EGE A;  1Y96 B;  2FRW A;  3VUB A;  4F04 B;  2OTL A;  2L3Q A;  2AKL A;  3M56 A;  2G6F X;  2L2P A;  4YTL A;  5CKF A;  4DEX A;  2QDY B;  1QW1 A;  1AHJ B;  1BCM A;  4OB1 B;  1UEC A;  4EDU A;  3VS5 A;  2PNI A;  2DEQ A;  1WYX A;  2XKO C;  4RG2 A;  4PL6 A;  1D1C A;  4M7D D;  2DMO A;  1AWO A;  2MI6 A;  4M7D G;  1MMA A;  2EYY A;  1TSF A;  3L2V A;  5DY9 A;  5FU7 C;  3O8V A;  1K73 R;  3OW2 A;  2CYZ B;  4N0A A;  1Q86 R;  2MK5 A;  4M7D A;  4AFZ C;  3NTK A;  3GPL A;  1YN8 A;  2NUP A;  3CBP A;  1NPP A;  3CD6 T;  1U3O A;  4HKE A;  1YIT T;  4AFS C;  1LJO A;  2E70 A;  3PE0 A;  3MHX A;  4E7L A;  4HVU A;  1LOJ A;  2IIM A;  5A2Q E;  3J7A F;  2BZ8 A;  1VQK A;  1TWB A;  1YIJ A;  2HKQ B;  1HXD A;  3FIF A;  3P8H A;  1WDX A;  1WXT A;  2FPF A;  2MWO A;  5KYY A;  1ZBX A;  1AWW A;  1TS9 A;  2Y4Y A;  1G2B A;  1R77 A;  2LX9 A;  2YSQ A;  3M0R A;  3D7S B;  1ZUK A;  2LCL A;  4OB2 B;  1X6O A;  1UDL A;  4GBQ A;  3UDC A;  3VS2 A;  4BAC A;  5EC7 A;  4RCB A;  1IO6 A;  5CCA A;  4JLI A;  3CPF A;  3JB9 J;  5GAN 8;  4FW1 A;  1JJ2 S;  1KC8 C;  4M7A C;  4IUT A;  1G83 A;  2NUZ A;  4KGX B;  2YRC A;  1K73 U;  2JM9 A;  4CC4 B;  3CD6 Q;  2RNA A;  2DVJ A;  1Q86 U;  1WXU A;  1YIT Q;  3QG1 A;  5LJ3 f;  3LYI A;  2O88 A;  1AEY A;  1BKB A;  3CCQ A;  1OUL A;  1PRL C;  4IIM A;  4A4G A;  1KFZ A;  1WLP B;  3OYI A;  2LC4 A;  2D1X A;  1JBM A;  2DLP A;  2PZ1 A;  2CKK A;  1RAG B;  3LGL A;  3WXM B;  5LJ5 d;  1B3Q A;  3JAM E;  3KXT A;  1IZ6 A;  3SDZ A;  2LJ1 A;  3E1S A;  4F16 A;  2E64 A;  2XMF A;  2X3X D;  1QVF S;  1TUD A;  2K5F A;  5HK0 A;  2DIQ A;  2XD0 A;  4JRI A;  5GAM d;  2RHY A;  2R5M A;  2LX7 A;  5GAN 6;  1R8O B;  3LH0 A;  1JXM A;  3PT9 A;  4OGC A;  3MP8 A;  2QGF B;  1W6X A;  4BI3 A;  4GLM A;  2QQA A;  2M0O A;  3JCM V;  2QEX A;  3OYF A;  1OV3 A;  2EVR A;  2CP0 A;  4CC7 A;  4KUL A;  1W2B S;  1UB4 A;  4F17 A;  2K7A A;  2DXC A;  1IHV A;  2VUB A;  4C8Q F;  1RI0 A;  4A4E A;  2C0O A;  2HAX A;  2KY9 A;  3M5A A;  3TCJ A;  2KXD A;  3RBB B;  5KH6 A;  1K4U S;  5IHI A;  1BK2 A;  4QQ6 A;  1WHH A;  3A8H B;  1KC8 R;  2BE7 D;  1M8V A;  4M4Z A;  1VQ6 T;  2OTJ T;  4Y28 E;  3CCJ A;  3GNF B;  2PTK A;  2DEU A;  1YI2 Q;  4ZGD B;  2EPD A;  4PJO E;  3EGX B;  2EQI A;  1S72 A;  1AOJ A;  1SEM A;  4OP0 A;  4PJO F;  5IH2 A;  3A8O B;  3I35 A;  1OI1 A;  3VS1 A;  3HFN A;  2VGN A;  4OMF B;  1QKX A;  4HCK A;  2FPE A;  1PNJ A;  3S3O A;  2J7I A;  2KRO A;  2RPN A;  2B8A A;  2HL3 A;  1FMW A;  3CCR A;  3CCE T;  1QCN A;  2DRK A;  5L8R E;  3JCM c;  1TU0 B;  3VUZ A;  1YWO A;  2B86 A;  5IAY A;  4RTT A;  5LL6 S;  3SWN A;  2CT4 A;  1T0H A;  4A54 A;  1VQ6 Q;  2OTJ Q;  4NOY A;  1X01 A;  2DX1 A;  2WSE E;  1U06 A;  6AT1 B;  4KBM B;  1XQH A;  1KC8 U;  1GRI A;  4OMN A;  1ZA1 B;  1HSQ A;  2ATC B;  2DF6 A;  4D8D A;  2QXF A;  1VQO Q;  3GLX A;  4J83 A;  1TTH B;  5LJ3 j;  2EQM A;  3QDF A;  2LZ6 B;  2P0P A;  1WZO A;  3LWI A;  5CO7 A;  2E12 A;  2MMP A;  3H0I A;  5GAO q;  4E7K A;  3A8L B;  3CCE Q;  2GF7 A;  1K9A A;  2PU9 B;  5J3B A;  4OMO A;  2CP5 A;  4HCB A;  2FL7 A;  2EYW A;  3REB B;  3I55 T;  4MDW A;  1SPK A;  4A4F A;  3R6O A;  5IN1 A;  2QAZ A;  4ZGJ B;  5KCO A;  3HTR A;  1GL5 A;  3QYG B;  4M77 D;  3RUX A;  5J26 A;  4M77 G;  2KSS A;  4RTZ A;  5C0M A;  5KCH A;  1M1F A;  5M9O A;  1QCO A;  1UTI A;  2A08 A;  2ZPB B;  3VS3 A;  4JZ3 A;  4M77 A;  1TUC A;  2J06 A;  2KQW A;  4O6J A;  3G6E T;  3THK A;  1NJI C;  4VUB A;  3G1J A;  3G71 T;  2YT6 A;  1K9M C;  1PD0 A;  3CC2 T;  1UGS B;  3GP8 A;  2JN0 A;  1YWP A;  4QVZ A;  1I4K 1;  2MPX C;  5LJ5 g;  3MJX A;  2D0N A;  4HCZ A;  3O5Z A;  1BI1 A;  4Y92 A;  1B7T A;  2EAY A;  3VRY A;  3VS4 A;  4KH0 B;  3BDU A;  2K5I A;  3I55 Q;  3AT1 B;  2K3X A;  3LX7 A;  3OS0 A;  4EPC A;  4OF1 A;  3UWN A;  2X4W A;  4JRQ A;  1K1Z A;  5AT1 B;  3QO3 A;  5HY6 A;  1IHW A;  3PFS A;  3OY9 A;  5IXB A;  3QWY A;  3CCS A;  2QA4 Q;  2J05 A;  2MF2 A;  1H3Z A;  2COY A;  2OTJ A;  3G6E Q;  4BY6 B;  2L3R A;  5DM7 R;  3G71 Q;  2COW A;  2ROT A;  3CC2 Q;  3H6Z A;  3Q1J A;  3JB9 D;  3C94 A;  4V2S A;  1M30 A;  4IUU A;  2FYK A;  3JB9 G;  2YUN A;  2GTJ A;  4X34 A;  1UE9 A;  3CME T;  3OYE A;  2D8J A;  2O9V A;  2HZY A;  3M0P A;  5A0G A;  1G5V A;  1Y0M A;  4DBF A;  2O4X A;  5IT9 E;  4AMC A;  1Y7X A;  1QVG S;  2I0N A;  3M0U A;  2ZPG B;  4C0F A;  2XIC A;  4LNP A;  4O5V A;  2AZV A;  3CCE A;  1QP3 A;  1M5Q 1;  3J81 E;  2SRC A;  4NL3 A;  1RAI B;  1WNL A;  1C0M A;  1NJI R;  3NTI A;  3INZ A;  1SHG A;  3V8J A;  1K9M R;  5FW9 A;  2W0Z A;  2GNC A;  2K3B A;  2KRM A;  2HDA A;  3DB3 A;  2RQV A;  5DLQ E;  4M75 D;  1OX8 A;  4A4K A;  4HVV A;  4M75 G;  3CME Q;  4L59 A;  2DL5 A;  2D6F A;  2OX7 A;  1NBE B;  3FLG A;  3A1P A; 
#chains in the Genus database with same CATH homology
 4C8Q B;  4QW2 A;  2E41 A;  4J7I A;  5FRM A;  3CCU A;  1QP2 A;  2E6N A;  4OB1 B;  1VQ5 T;  4M75 A;  3FB9 A;  4EDU A;  2QA4 T;  3SWN C;  1VQP T;  2F69 A;  5LJ3 h;  4M78 E;  2DEQ A;  2DJZ A;  4FT4 A;  4HT9 A;  3CBM A;  3ME9 A;  2ZCF B;  4M78 F;  2DTH A;  4XAX B;  2XKO C;  4ZN1 A;  3OS1 A;  3AHU A;  2XU8 A;  4JRK A;  4IUP A;  2K4Y A;  4RG2 A;  4BI8 B;  1FWZ A;  4PL6 A;  4XTZ A;  3JCM h;  5GAN g;  1VQ8 A;  3CC7 T;  4HA8 A;  1YI2 A;  4M7D D;  1ZHI A;  3G7Z A;  3BDL A;  4RMO A;  2MI6 A;  2JOY A;  3JB9 H;  1WJR A;  4EMK A;  5LJ5 h;  4PLI A;  3L2V A;  5DY9 A;  5FU7 C;  3JB9 I;  3JCM J;  2XDP A;  4J6W A;  4M78 C;  3RES A;  3O8V A;  4GLK A;  4JS5 A;  1YJN A;  3JRZ A;  4M77 B;  4WF2 A;  4MZM A;  5GAO l;  4Z02 A;  4BD3 A;  3OW2 A;  4ELZ C;  2CYZ B;  4N0A A;  3VYG A;  2XDB A;  4LDY A;  4C8Q E;  4M7D A;  4M7A B;  5HKC A;  2ZPF B;  4J7F A;  1BI2 A;  1D3B B;  1WPY A;  2RM4 A;  4OB3 B;  1NJI U;  4C0G A;  2EIF A;  2KMT A;  3NTK A;  5CK9 A;  3GPL A;  3CBP A;  3CCS T;  2HQE A;  1NPP A;  3CD6 T;  1K9M U;  1VQN A;  3PGG A;  3CCL A;  3A5Z B;  4NL2 A;  1PSE A;  2LTO A;  4HKE A;  3FLG A;  5CKH A;  4D6W A;  1YIT T;  1LJO A;  2E70 A;  3MHX A;  4E7L A;  3WVE B;  3OYH A;  5GAN 5;  1LOJ A;  5A2Q E;  3J7A F;  1VQK A;  4C0D C;  3G4S T;  1B34 B;  1EIF A;  2LQ8 A;  3HP9 A;  3G71 A;  2NLU A;  3I56 T;  2EQJ A;  5FRN A;  2LVM A;  1YIJ A;  2CS7 A;  2FVU A;  5FU6 B;  3CCM T;  4M77 E;  2CZ0 B;  3JCM Q;  4KUD K;  3HRS A;  1HXD A;  3CPW S;  1VQ6 A;  2CGH A;  3FIF A;  3P8H A;  4M77 F;  3X28 B;  4MDX A;  4R56 A;  3JCM b;  2MWO A;  3LWH A;  4M7A E;  2KK4 A;  1ZBX A;  3M9Q A;  3OYA A;  1KQS S;  1O9S A;  3V8L A;  1YHQ A;  4M7A F;  4A4H A;  3OYY A;  3HSB A;  3CXC A;  2GFU A;  2KDS A;  3X20 B;  2RJC A;  2YLB A;  2Y4Y A;  3ZFJ A;  2LX9 A;  3OMG A;  4Y91 A;  3L2Z A;  2RJF A;  2LRQ A;  1KHC A;  2RHU A;  3OQ5 A;  2LCL A;  3QDR B;  1X6O A;  4OB2 B;  4M77 C;  3UDC A;  3DLL A;  4BAC A;  2DD5 A;  2DIG A;  4RCB A;  4BE0 A;  2FB7 A;  5CCA A;  1M1G A;  4JLI A;  3CPF A;  2E65 A;  3EAE A;  3JB9 J;  5GAN 8;  3MEA A;  1VQO A;  3KBG A;  4QQD A;  1KC8 C;  1JJ2 S;  1N9S A;  4IUT A;  3V8K A;  4M7A C;  3QYH B;  4J5Y A;  2WSC E;  3QPH A;  2DXB A;  3L2Q A;  1P92 A;  1JRI A;  3NFC A;  5CR2 A;  1K73 U;  2LQK A;  3URG A;  2XHC A;  3QII A;  4BUG A;  2M16 A;  4LDU A;  3CPW A;  1Q86 U;  3L2R A;  1Q86 C;  3QG1 A;  4J6X A;  2HNI A;  4C92 D;  5LJ3 f;  3VJP A;  5GAO m;  3LYI A;  4C92 G;  2E5Q A;  1KQS A;  5LJ3 d;  1XOV A;  3OA6 A;  2RD1 A;  4PJO B;  1OZ2 A;  1BKB A;  3CCQ A;  2K57 A;  1BIB A;  1KQ1 A;  2OTL T;  3P8D A;  4A4G A;  2KVQ G;  3X24 B;  3OYI A;  2JUF A;  3S6W A;  4FSX A;  2LC4 A;  2O4X B;  1UGP B;  5GAN j;  2ZPH B;  1DJ7 B;  1M9S A;  4C92 A;  4E7H A;  3JCM d;  3CC2 T;  3HFO A;  1JBM A;  4XQ3 A;  1LNX A;  2PUO B;  5LJ5 f;  3UPU A;  2CKK A;  4BY6 C;  4C5G A;  3LGL A;  3WXM B;  4E47 A;  5LJ5 d;  2XG8 D;  2EJ9 A;  4HCC A;  1TH7 A;  2YHT A;  5GMK j;  3CCU T;  1K8A U;  1Q82 C;  3JAM E;  2BUD A;  2DKG A;  2JZ2 A;  5I2M A;  3KXT A;  1IZ6 A;  1YJW A;  1IRE B;  3M58 A;  3SDZ A;  4OGE A;  3E1S A;  2L5Q A;  1VQM T;  2E64 A;  2X4J A;  4J6Y A;  4OVA A;  5GAN 4;  1VQ9 A;  5CQY A;  3MCA B;  2C06 A;  4XU0 A;  1QVF S;  4LDV A;  2K5F A;  5HK0 A;  4A53 A;  2Y90 A;  3HHT B;  4FT2 A;  4B9X A;  1WQ7 A;  1VQ8 T;  2DIQ A;  2ZPE B;  5GAM f;  3N5B B;  5EG2 A;  5KE3 A;  2XD0 A;  4JRI A;  5D6Y A;  5C6S A;  5GAM d;  3JB9 F;  2RHY A;  2R5M A;  5GAN 6;  2M1H A;  2M9U A;  3ER0 A;  3OSV A;  3OYD A;  1G3T A;  1R8O B;  1Y07 A;  3MO8 A;  3LH0 A;  2DK3 A;  3BFM A;  1VQ4 A;  3PT9 A;  4BDY A;  2BKD N;  4OGC A;  3MP6 A;  3MP8 A;  5GAN e;  3QXE B;  3FRN A;  5GAN h;  3MEW A;  4BI3 A;  1Q81 C;  1YCY A;  2V8K A;  4M7D G;  2QQA A;  2KAF A;  2M0O A;  3GOX A;  3JCM V;  2QEX A;  4JUV A;  3I55 A;  3P8B B;  2V8J A;  3C4S A;  3OYF A;  4M75 B;  4N4H A;  5GMK e;  1VQN T;  3CCL T;  5GMK h;  2PQW A;  4KUL A;  5GAM j;  1QVF A;  3HRT A;  1W2B S;  4XTV A;  2D0Q B;  1UB4 A;  2E1H A;  2VV5 A;  1UGQ B;  1WGS A;  2QQS A;  4FM4 B;  3QJ6 A;  1VQK T;  2DXC A;  2VUB A;  2A3L A;  4C8Q F;  1RI0 A;  3OSS C;  4A4E A;  1KD1 C;  1D3B A;  2HAX A;  2KY9 A;  3CCV T;  2EJG A;  3QUI A;  1MHN A;  1U1T A;  3M5A A;  3HPW A;  3TCJ A;  4XTU A;  1X75 C;  3TRE A;  4QVC A;  4MML A;  2K5L A;  5FLX E;  5KH6 A;  4EMK B;  4QQ6 A;  5J39 A;  3A8H B;  4DOW A;  2QA4 A;  1M8V A;  1VQ6 T;  3RMS A;  4BB7 A;  4F7U B;  2OTJ T;  4Y28 E;  2L8D A;  2R57 A;  4BE1 A;  4IUQ A;  3OYM A;  3CCJ A;  2IG0 A;  3GNF B;  3LGF A;  1N8R C;  1M90 C;  2PUK B;  2P0Q A;  3OYL A;  4C8Q C;  3G6E A;  3WVD B;  2RHI A;  3OYC A;  1YHQ T;  4M7D B;  4KUI A;  2XI9 A;  3OS2 A;  1XTD A;  4ZGD B;  2VGM A;  5GMK m;  3CC7 A;  4M75 E;  1I8F A;  2E6Z A;  2R5A A;  4ZN3 A;  3CC2 A;  4PJO E;  4X9C A;  1W2B A;  1S72 A;  3HL8 A;  4M75 F;  2IVW A;  3FC3 A;  4OP0 A;  4PJO F;  1UEB A;  1N9R A;  2ZZD A;  2RHZ A;  3A8O B;  2EQU A;  3KUF A;  2FHD A;  1VIF A;  4X9D A;  5KE2 A;  1OI1 A;  4BE2 A;  3HFN A;  2VGN A;  1G3Y A;  4OMF B;  1WQW A;  3V7C A;  1VQ7 T;  5GAM g;  2DTI A;  2DZC A;  2ZPI B;  1QVP A;  3QSU A;  3S3O A;  1M1K C;  4MZT A;  2DAQ A;  2CZ1 B;  3FEO A;  4M75 C;  3V7R A;  4E7J A;  1FXX A;  4RKU E;  2B8A A;  4PJO C;  3SB2 A;  4F7U E;  2RJE A;  3CCR A;  5GAN 7;  3CCE T;  4F7U F;  3MP1 A;  5L8R E;  3JCM X;  4V2S A;  3PMI A;  4PNO A;  4LDX A;  3VKI A;  3HKS A;  3LLR A;  3JCM c;  4RCC A;  1RL2 A;  3ZEH A;  3X26 B;  2QTX A;  3VUZ A;  2CZ6 B;  4ZTJ A;  5IAY A;  4RG8 A;  5LL6 S;  3SWN A;  2XDD A;  4J8O A;  4A54 A;  2QQR A;  2RHX A;  5A0D A;  2P4T A;  4N4G A;  3PNW C;  4XU1 A;  1WJS A;  2CZ7 B;  3L1A A;  4M78 D;  4NOY A;  1X01 A;  2R58 A;  1G3W A;  2EQK A;  4M78 G;  1KHI A;  2WSE E;  4FIB A;  2K2V A;  5CKB A;  3X25 B;  4KBM B;  3M54 A;  1XQH A;  1BI3 A;  3M55 A;  2Y4X A;  3JCM f;  4C5E A;  1KC8 U;  2YRV A;  3S3N A;  1U8R A;  2RK2 A;  5FU6 C;  4M78 A;  5D6W A;  4PLL A;  3M57 A;  4MMK A;  1VQ9 T;  3CC4 A;  2GFA A;  3CMA A;  4ZTF A;  1JJ2 A;  2QXF A;  3CME A;  2O01 E;  2X4X A;  4EMH A;  1BYM A;  5GMK l;  1Y96 A;  1K8A C;  3GLX A;  4J83 A;  1MGQ A;  3OYN A;  5LJ3 j;  2EQM A;  3EFR A;  4C8Q D;  3ASK A;  2VXF A;  2OAU A;  2P0P A;  1VQ4 T;  4C8Q G;  4JS4 A;  2ZGW A;  2P0K A;  3QHS A;  2H3J A;  2V8I A;  2AHJ B;  5CO7 A;  4C92 B;  3LWI A;  2E12 A;  2MMP A;  5FU7 B;  2QI2 A;  4QQG A;  5FRO A;  5GAO q;  3A8L B;  4E7K A;  1YJ9 A;  2LCC A;  1Q7Y C;  2X4Y A;  2GF7 A;  4N4I A;  3L2W A;  2PU9 B;  4TVR A;  5J3B A;  5CAI A;  3F70 A;  4HCB A;  4BI4 A;  2FL7 A;  2RB6 A;  4C8Q A;  1YI2 T;  5LJ5 j;  2YLC A;  3RKW A;  1PSF A;  3I55 T;  4XTY A;  3J80 E;  2QEX T;  2HQX A;  4MDW A;  3M59 A;  2WSF E;  4UC4 A;  4XTX A;  1Q82 U;  1NPR A;  1I81 A;  3LW5 E;  3PTA A;  1YJN T;  2RJD A;  4A4F A;  3M4Y A;  2RK1 A;  3OYB A;  5GAO n;  3R6O A;  2HD0 A;  3L2U A;  5IN1 A;  2EKO A;  5AYF A;  4ZGJ B;  4ME7 A;  5KCO A;  3MEU A;  5CIU A;  1Y71 A;  3VYH B;  3RKY A;  1FX7 A;  4PJO D;  2QQB A;  3QYG B;  4M77 D;  5J26 A;  1V29 B;  4PJO G;  3RUX A;  2LNV A;  4ELY C;  3H8Z A;  4M77 G;  1VQL A;  3QBY A;  3OW2 S;  2KSS A;  4C0D B;  4PKC C;  4JDS A;  1XNI A;  5C0M A;  1W4S A;  4M7A D;  5KCH A;  1M1F A;  3SD4 A;  5M9O A;  1M4Z A;  2RH2 A;  4M7A G;  4NS5 A;  2VYT A;  5CKD A;  4C92 E;  5LJ3 e;  4FL6 A;  1I5L A;  4PJO A;  2ZPB B;  3CEY A;  4IKF A;  4M77 A;  4C92 F;  2KQW A;  5LJ3 g;  4Q5W A;  3CCJ T;  2DXU A;  1VQM A;  2BIV A;  4O6J A;  4XU3 A;  4CRI A;  4DQ2 A;  4IUV A;  3MEV A;  3G6E T;  1NJI C;  4M7A A;  3VU3 C;  4VUB A;  3JCM e;  3G71 T;  4F7U G;  2E10 A;  3OYJ A;  4EMG A;  3S3M A;  1Q81 U;  3JCM g;  2JTM A;  2RI2 A;  3BY7 A;  3QZ9 B;  1YIJ T;  1S72 T;  1K9M C;  2GQV A;  3C12 A;  3OBW A;  1UGS B;  3OB9 A;  1UGR B;  3GP8 A;  5LJ5 e;  1VQ5 A;  4C0Z A;  5I21 A;  3QKJ A;  2D9T A;  2JN0 A;  2LT4 A;  4C92 C;  4QVZ A;  4JRP A;  1YBY A;  5GAO r;  1I4K 1;  2HBP A;  5LJ5 g;  2L89 A;  1GXI E;  2F5K A;  5D6X A;  4F7U A;  3A8M B;  4HCZ A;  5CQX A;  3GIB A;  1BI1 A;  2EAY A;  3GF5 A;  1U1S A;  4P5N A;  1KG1 A;  1B34 A;  3GNG A;  3BDU A;  3OMC A;  2K5I A;  2JTF A;  2K3X A;  3PIP A;  3LX7 A;  3OS0 A;  4EPC A;  2RA2 A;  3JCM W;  1KD1 U;  2EWN A;  3L42 A;  3C95 A;  3M53 A;  2VC8 A;  3E19 A;  4OF1 A;  3UWN A;  2X4W A;  3CXC S;  3CCR T;  1NZ9 A;  4JRQ A;  1JB0 E;  2DVE A;  3SFM A;  3MET A;  3QO3 A;  1NE8 A;  4KT0 E;  5HY6 A;  5GAM e;  1VQO T;  5GAM h;  2RI5 A;  3PFS A;  3RMQ A;  4CI0 C;  3OY9 A;  1M90 U;  1N8R U;  2WAC A;  3QJY A;  3A8G B;  2DZ9 A;  2DXT A;  5CVI A;  3NTH A;  3QZ5 B;  4L6V 5;  3CCS A;  3CCV A;  2K3Y A;  3V7S A;  1OYX A;  5GMK i;  3UT1 A;  1ZQ1 A;  3CD6 A;  2LT1 A;  1BI0 A;  3DLM A;  2DD4 A;  2MF2 A;  1N27 A;  1H3Z A;  1YIT A;  2OTJ A;  3CCQ T;  3PMT A;  4BY6 B;  4IUR A;  3EFS A;  2L3R A;  3JSC A;  4M7D E;  4LD6 A;  5DM7 R;  2XID A;  3RKX A;  4XTW A;  4M7D F;  1K73 C;  4C5H A;  3G4S A;  3M4G A;  4B9W A;  3H6Z A;  3Q1J A;  3JB9 D;  3TEE A;  2PVD B;  2MAM A;  2PVO B;  3C94 A;  3E9F A;  2FYK A;  4IUU A;  5CKE A;  4EMK C;  3I56 A;  1N6A A;  3ZBD A;  4GY5 A;  3JB9 G;  1M1K U;  2EJF A;  3DKM A;  3CC4 T;  4BDZ A;  3CMA T;  4LD9 K;  2RI3 A;  1G3S A;  3CCM A;  4X34 A;  3FDR A;  1VIE A;  3CME T;  1SSF A;  3T9N A;  1HK9 A;  4N0A C;  3OYE A;  2GCX A;  4ZGE B;  4M7D C;  4C5I A;  5GAN f;  5A0G A;  4LDW A;  4XK8 E;  3RIR A;  3BW1 A;  5DLO A;  1G5V A;  5GAO p;  1YJW T;  1VQ7 A;  5GAN d;  2EYQ A;  3JCM P;  1OZ3 A;  4JJN K;  4OB0 B;  2O4X A;  5IT9 E;  3SWN B;  1KQ2 A;  4XU2 A;  2DTO A;  1Y7X A;  2XK0 A;  1QVG S;  1YJ9 T;  1WJQ A;  2PVG B;  3OYG A;  2ZPG B;  4R55 A;  5GAN 3;  4C0F A;  5HK3 A;  2XIC A;  2RO0 A;  3E9G A;  4E7I A;  4O5V A;  2DPP B;  4JLG A;  3CCE A;  1QP3 A;  2G3R A;  1M5Q 1;  2EFI A;  5GAN 2;  3J81 E;  4NL3 A;  2VXE A;  4II1 A;  2DO3 A;  1WNL A;  3PIO A;  3RER A;  3FJP A;  2JNG A;  4FU6 A;  4HT8 A;  3VV0 A;  4ATO A;  3NTI A;  2LDM A;  3INZ A;  2F5T X;  3CBO A;  4M78 B;  4L5G A;  3DB4 A;  3V8J A;  5A0L A;  2X35 A;  2A7Y A;  4DA4 A;  2I2L A;  1VQL T;  1VUB A;  1Y96 B;  3OS5 A;  3VUB A;  4MZP A;  3OBY A;  1QVG A;  3DB3 A;  2OTL A;  2MWP A;  3M56 A;  4DOV A;  5I2S A;  4YTL A;  5DLQ E;  1BIA A;  4M75 D;  4A4K A;  5CKF A;  3OYK A;  4M75 G;  1O75 A;  2JVV A;  3TU4 K;  4QVD A;  4L59 A;  2D6F A;  3HRU A;  2QDY B;  1VQP A;  1QW1 A;  2QQ9 A;  1Q7Y U;  1H64 1;  1AHJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...