4JJNK

Crystal structure of heterochromatin protein sir3 in complex with a silenced yeast nucleosome
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
213
structure length
205
Chain Sequence
AKDLDGWQVIITDDQVIDDNNRRRSRKENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSNEYLKRVSVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
molecule keywords Histone H3
total genus 36
structure length 205
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4jjnK00
2FL7A 1M4ZA 4KULA 4DOVA 2FVUA 4BB7A 4LD9K 4DA4A 4JJNK 4FT2A 4DOWA 3PT9A 4KUIA 1ZHIA 4FT4A 4KUDK 1ZBXA 3PTAA 1W4SA 4FSXA 3TU4K
chains in the Genus database with same CATH superfamily
2KI7A 5GAN7 2ESWA 1OV3A 4J9GA 4Z88A 4PJOA 1UFFA 4EMKB 3GF5A 2NUPB 1S72A 2O9VA 1JQQA 1Q86C 5IXFA 1WI7A 4M75B 2CT4A 4L6V5 5CKEA 5GAMe 1K0XA 2BUDA 3VS1A 4J9BA 1YJ9A 2XK0A 3VRZA 3CMAQ 5I22A 2RMOA 4RCBA 1J3TA 2DBKA 1GCPA 4M7AG 4MDWA 2RD1A 2A7YA 1K73R 1G5VA 4M75F 1OZ2A 2YXYA 4HXJA 1EX4A 1NE8A 1UGVA 4N0AA 1VQ5T 3TSWA 1OU8A 3EGUA 2P0PA 2CZ7B 1ACMB 2MF2A 3HFOA 1RACB 1M90U 2QQSA 3CCLA 1MMDA 5FU7B 2QDYB 1NLOC 1MGQA 2FL7A 5GANg 3HFNA 3EHRA 1NZ9A 4D8KA 4NOYA 2LDMA 1PRMC 4C92B 5GAMf 1JXOA 3OYLA 4KH0B 1ZSZB 4FYXB 2HSPA 2DRMA 2HEQA 5GMKh 3HRTA 2RNAA 2SRCA 1RL2A 2LJ3A 1V76A 3OBWA 2X3XD 1OX8A 1Y07A 2E6NA 2EQJA 1UJYA 2XHCA 2AKLA 1D09B 2RA2A 2FG0A 1BU1A 1ZUKA 1B3QA 2ENMA 3CCLQ 1K9MC 3LGLA 2RM4A 2M51A 2RK1A 1QP3A 2DRKA 2DXUA 3M9QA 3CCUT 3BE3A 2YSQA 3LWHA 3MPUB 2L3RA 4ANJA 3S3NA 4ZN1A 3CCUA 4XAXB 2J06A 2RI2A 2DTIA 1VQ8T 4PJOG 1RLQC 5KCHA 2M02A 5HKCA 2VGMA 1CKBA 1M27C 1UUEA 1M90R 1FMVA 1TUCA 2JOYA 3CC2T 5HK3A 4JLIA 2X51A 1Y0MA 3RKXA 2CZ1B 1H8KA 2JZ2A 2RQUA 3OSVA 4BI8B 4N4GA 1M5Q1 3CD6A 3OYMA 2F69A 4GLKA 3HRUA 3SWNA 4DBHA 1X27A 2V8KA 4EMKC 1WHKA 2KDSA 3M0RA 4M7DB 2QEXT 4AMCA 1TTHB 3HHTB 1C0MA 2O9SA 1WHLA 1BBZA 2JS0A 2R58A 3KBGA 3V8JA 1FMWA 2HZYA 1KHIA 1XOVA 4E7SA 2FHDA 1M1KR 1KQSA 3MP1A 3ZL7C 2LQWA 4O5VA 4C0ZA 2DXBA 4M77D 4M75A 3U23A 3MHXA 4IUUA 2QQRA 3MO8A 4E7IA 2HQHA 3VU3C 5GANh 4M7AD 1K73C 3GNGA 4BDYA 1VQ6Q 4PJMA 5FU6C 3OYJA 2XD0A 1G3WA 1K76A 3CC2A 1LNXA 1VQ4Q 3G1JA 2QXFA 3TSZA 1JO8A 1PWTA 2VUBA 4M7AE 1VQKA 3JCMd 2XG8D 5GMKe 1WQWA 5GAOl 2VC8A 1IXDA 1Q7YC 3UA7A 3THKA 2EGAA 1TWBA 4OF1A 3M4GA 3L2QA 2M9UA 1YJWQ 3GIBA 4LE9A 2A08A 5IHNA 1ZSZC 1JRIA 3KUFA 4LUDA 3OS1A 4M78G 2NUZA 1IHWA 3QJYA 2C06A 1S1NA 2EYZA 3OYNA 3EH1A 4LDWA 1AEYA 1GXIE 1QWEA 1NYGA 4TVRA 3PMTA 1G3SA 1N8RU 4JZ4A 4C8QG 4M7AF 4OB0B 1Q82C 2HNIA 4OMLA 1EIFA 4PJLA 4KH1B 1G3TA 1SRMA 3JB9I 5LJ3f 1RLPC 4BE2A 1AZGB 2V1RA 2CP2A 2XDBA 1K4US 2LVMA 1OU9A 3OQ5A 1HXDA 3I5SA 4WCIA 4M78B 4C0DB 1TU0B 2L3SA 1TS9A 3FLGA 3OYHA 3HPWA 4K11A 1UHFA 2ZGWA 1OEBA 3PVQA 2X4JA 1KQ1A 1NEGA 3CCQT 4ME7A 2M0OA 4C8QD 1TG0A 2PVGB 2RJFA 2AKKA 3PT9A 3CCET 4JRIA 4BE0A 1YP5A 3CCRT 1BI2A 3UATA 2PTKA 3QZ9B 2LT4A 3T9NA 4AT1B 3H9NA 2DMOA 1W70A 1YJ9T 1H641 4ELZC 1KFZA 3NGPA 3MKDA 2OTLQ 2EYYA 2LQ8A 3JCMV 4E7JA 2JJ9A 2R5AA 4X9CA 1M1GA 1SSFA 1M3CA 5A0LA 1Q86R 5GAOn 1VQLT 4HKEA 4CC2A 3UWNA 3CD6Q 1X6OA 1U5SA 1GFDA 5CK9A 1YJWA 2KYBA 2V1QA 4C92C 1GCQA 1KQSS 2KR3A 4LD6A 1WIEA 1I1JA 3CPWA 2NUTB 2WACA 1QVGP 5DLQE 2IVWA 3OB9A 4DA4A 2VB6A 5LJ3g 3FJ5A 2XKOC 3DB3A 2YT6A 4CI0C 2CP0A 2PNIA 2QA4T 1M2OA 2F5KA 2CUDA 2FRYA 2RJDA 2FVUA 3J7AF 3VUZA 2RO0A 1PM3A 6AT1B 1C6VX 3NMZC 4HT8A 2YLCA 1YJNQ 4Y92A 3M57A 2DO3A 2JTEA 4BI4A 5LL6S 1UG1A 1GFCA 4HT9A 4C8QA 1KIKA 1VQ5Q 2CP3A 7AT1B 1I0CA 3A8GB 4HVUA 2DZCA 3WVEB 1N8RC 3NTHA 9ATCB 5KYXB 3OBYA 1LOJA 2WSFE 1Q82U 4J6WA 2HQXA 2L3QA 4J83A 4C92E 3VRYA 2DL7A 3EH2A 3V7SA 4B6MA 2DL3A 3VS7A 2EAYA 1KK7A 1ABQA 1RADB 2GQIA 1M2VA 3IQLA 4M7DG 3CCSQ 1MMAA 1MNEA 1Q81R 4PJOD 3QIIA 3QWXX 2JT4A 3CCEQ 3BDUA 2KRSA 3RDVA 4HCZA 3A8HB 1JEGA 4M77B 3URGA 5GMKm 1SG5A 2DJZA 1YI2A 1AD5A 4J9IA 1TSFA 1VQOT 4RTXA 3CC4A 2KXDA 5CKFA 3QDFA 1NG2A 2YHTA 5KYXA 4PJOB 3DLLA 4XTZA 3FRNA 1AVZC 1MUZA 1K9MU 2HKQB 2EWNA 4C92F 3CCJT 2X4XA 3A8LB 2LC4A 4M7DA 4DOWA 4PJOC 1LJOA 4EDUA 1MMGA 2ED1A 4QQ6A 3H0FA 4RTUA 5J3BA 3FB9A 4RCCA 3EAEA 3I5RA 4IUQA 3QSUA 3L2ZA 2JTFA 1LPLA 4CC3A 3GBQA 3SFMA 1RAEB 1IHVA 3LH5A 5LJ5f 4J6YA 3OSSC 4L59A 4Y91A 1VQ9Q 1X6GA 2O31A 1VA7A 4M75E 3LGFA 3MEAA 4FCYA 3PNWC 1VUBA 2F2WA 1XTDA 1Q81C 1UTIA 2NUTA 3G4ST 3AT1B 2RI5A 3VS2A 2YUPA 1U1TA 4OMOA 2K79A 1I81A 2MK5A 2L0AA 1G8XA 2K7AA 3E1SA 4Z89A 5DM7R 2BE9B 2XMFA 4OP0A 4AFQC 1ZHIA 1U8RA 2X3WD 2JUFA 4A4FA 2XDDA 1SSHA 2RN8A 4PFZA 4J9CA 4LXCA 1KC8C 3G6EA 2DTHA 2ZPGB 1WXTA 4MZTA 4J7IA 1JU5C 4C0FA 5EG2A 1VQMQ 1D0ZA 2G3RA 4FT2A 1KSWA 2A3LA 3PFSA 5D6XA 5CVIA 1M8VA 1NJIC 2MMPA 3JCMe 4A4GA 3CCRA 2D1XA 5I2MA 2EKHA 2C0IA 1SKUB 2JXBA 4IUVA 4M78F 1WA7A 3QG1A 1W1FA 2DEQA 2OAUA 4M75C 4II1A 1RAHB 2DD5A 4FM4B 1S72Q 5A2QE 4ZGDB 1N27A 2CH4A 1LVKA 5KYYB 1WNLA 4XTVA 3X24B 1JBMA 1KG1A 2K57A 1Y71A 3CMEA 2EBPA 2RK2A 2QA4Q 4M7DF 1B07A 3QKJA 1PHTA 4FSXA 3TU4K 3EG0A 4FYWB 1YHQA 5GANe 2E3IA 3CCJA 4EMKA 1IO6A 2GTJA 1VQ6T 3M0UA 5D6WA 4M7AA 3JB9H 2COYA 2F2VA 2FPFA 3OA6A 3A1PA 3CCMT 3JV3A 2K4YA 3H0HA 3KXTA 2AT1B 2XIDA 2ZPFB 4BB7A 3I55T 1VQPT 1NM7A 1BI1A 3DLMA 3I55Q 1VQPQ 1V1CA 3M5AA 3MEVA 2FYKA 3EG1A 4FIBA 2EYWA 4M7DE 4OMPA 1HYOA 2OTJA 4FL6A 3JCMP 1K1ZA 1Q95G 1VQ7T 4IKFA 5LJ5g 2FEIA 2KBTA 3JB9J 1WJQA 2QQAA 2EW3A 1K0SA 2Y90A 3EGDB 2K3BA 3CPWP 4IURA 1BI0A 5GAN3 4XU0A 1U3OA 2KYMA 1YJNT 4GLMA 2WSEE 3H0IA 1X6BA 2ZPHB 1B7TA 1UGQB 3JB9D 3C0CA 4BACA 2DIQA 3RKWA 1QP2A 2DERA 1NJIU 4RUGA 3L42A 1GL5A 4QVZA 5J39A 3O8VA 3OMCA 1D1BA 4F04B 2DZ9A 2PZ1A 1R0BG 2DL8A 2I0NA 2QA4A 2R57A 1R8OB 1YITT 3CCSA 2CREA 3VV0A 2LNHB 1Q86U 2K3XA 3CXCP 2O2OA 4FSSA 4QKUA 5GANj 1W2BS 4M7DC 3H8ZA 1EZZB 2HMAA 3M55A 3I35A 3RIRA 4V2SA 2KT8A 3CCMQ 4M77E 5IAYA 3EFSA 3FIFA 4HVVA 2LTOA 3V8KA 4XU3A 4DBQA 4PLIA 4LDXA 5DY9A 2Z0WA 3VUBA 3CBMA 1WHHA 1X75C 2HBWA 2ED0A 4B9XA 2RQRA 2GQVA 2YUNA 1M90C 3CPFA 1HK9A 1BI3A 1AWWA 3BFMA 1NJIR 4ZTFA 4NS5A 4QQDA 4C8QB 3I55A 1VQPA 3VS3A 3EFOB 3CXCS 4M7AB 1TOVA 2H3EB 2DYBA 3KFVA 2RQVA 3I56T 3FC3A 4FU6A 1T0JA 1AZEA 1ZA1B 2RQWA 2G6FX 1QKWA 1D1AA 2P0KA 4J9EA 2D8JA 3HTRA 1RAGB 4CC7A 2KY9A 3G71A 4PL6A 2DBMA 1VQOQ 1M8MA 1WFWA 1DJ7B 1QVFA 2ROTA 4M77F 5FRNA 4MMKA 1M1KU 4OGCA 1BK2A 5GMKj 4R56A 2DPPB 3OYAA 1PCXA 2ZAEA 4RTWA 2JN0A 3EG2A 1D0XA 3N5BB 3TEEA 5CKDA 3OYYA 3CCVT 2EGCA 3HSBA 3CQTA 1TUGB 1YN8A 2DFUA 2JMCA 3M54A 1AWJA 4J5YA 4ZGEB 2CZ6B 1KQSP 3J81E 2E3HA 1GBQA 2JM9A 4KGXB 2C0OA 2DE0X 5I11A 4LD9K 4LUEA 1VQ5A 1R0CB 4PK4A 4NL3A 3G7ZA 5GAOp 3M0QA 2JNGA 3V8LA 3UPUA 1Q7YU 1IZ6A 2AIRB 1K9MR 3VYHB 5KCOA 1JXMA 5ECAA 5GAMd 4JLGA 1ARKA 3OYEA 1X2KA 2GFUA 3L2RA 2MOXA 2DETA 1VQ9A 4KGZB 4OMQA 1KC8R 2AK5A 1N8RR 2EJ9A 4QVCA 4RMOA 3S3MA 3CCUQ 1VQ9T 1KD1U 3M56A 2PU9B 2CYZB 3G6ET 5LJ5h 3JCMJ 2JVVA 3UT1A 5KE3A 5AT1B 5IXBA 3M0PA 3A5ZB 1MMNA 1VQKT 3EGDA 3LLRA 3CCVQ 1KQ2A 2YWWA 5KE2A 4J9FA 1YITQ 3CCEA 1W2BP 4JRKA 1OYXA 4MDXA 4C5EA 1WLPB 3CC7T 2E41A 4HA8A 1NPRA 5CR2A 1M3AA 3CCQA 4KGVB 1YCSB 1D1CA 4DEYA 3O5ZA 4C92D 1D3BA 3OMGA 1SF9A 1K8AC 4DBFA 2EIFA 1OI1A 3BW1A 2EQIA 5AYFA 2FZCB 5GAN6 1ZUUA 1X69A 2K2VA 2XI9A 3LYIA 2O4XB 2CUBA 4RKUE 5KYWA 1I8FA 1B34B 5IT9E 1LCKA 2MAMA 2DIGA 2CKKA 2K5FA 2O01E 1UE9A 1D3BB 3OS0A 5GAMj 2V8JA 3RKYA 2JMAA 2HBPA 5I2SA 3PTAA 1FXXA 2M16A 3ME9A 2EGEA 3QBYA 1XQHA 2CSIA 2ZCFB 4KULA 4LDUA 3VKIA 4M75D 2LCSA 3I9QA 4M77A 3OYDA 2Y4XA 2QASA 2GGRA 1KC8U 4FW2A 4M78E 3GOXA 3FJPA 5C0MA 5KYUB 1IB8A 2L5QA 1OZ3A 2CGHA 1KJWA 2KRMA 3L2UA 4QQGA 1YIJQ 4R55A 4E7HA 3UDCA 3JCMb 1WJRA 3D7SB 2H3JA 3OW2A 3C94A 1NLPC 2BTTA 1G3YA 3LX7A 5GANf 2MWPA 2LMJA 4DBRA 1W4SA 1AWXA 3VYGA 1SEMA 4JRQA 3F70A 3OYCA 4DQ2A 4F16A 2AHJB 2KXCA 4WTOB 3EG9A 5FRMA 2DXCA 2CP6A 2DL5A 1HD3A 2BZ8A 2W0ZA 2HDAA 3JCMh 1VQ4A 2JW4A 5GANd 3R6NA 1C1AA 1U1SA 3CMEQ 2D9TA 2LCCA 3NTKA 2ZPBB 2LQNA 3RR6A 3S3OA 2X9HA 4X34A 1YWPA 3PGGA 1N9RA 2QEXA 1G83A 5LJ3j 4C92G 3X26B 3SD4A 2H8HA 1UDLA 3JSCA 3G4SQ 3CBOA 2J6OA 3OS5A 2E4HA 2DAQA 1YCYA 3SHWA 4M78D 1WYXA 2KQWA 2SEMA 3QXEB 5FW9A 5A0DA 2J05A 4OB1B 4KT0E 4HCBA 4RG8A 5CQYA 2EYXA 3OYBA 4OB2B 1BIAA 2PQWA 3TREA 1WJSA 2VYTA 5IN1A 5CAIA 4IIOA 2M1HA 2OTJT 4QW2A 4E7LA 1QLYA 3V7CA 1VQLA 2X4WA 8ATCB 3P8BB 1S72T 2LX7A 4A54A 2E5KA 2D8HA 4LDYA 1VQNT 4PJOF 2RPNA 2J6KA 5LJ3e 2F1LA 4MZMA 4J6XA 4D6WA 4HVWA 1YFNA 1VQ7Q 2FB7A 1T3SA 1N6AA 2E10A 2ROLA 3HKSA 4J7FA 2J6FA 5IHIA 2PUKB 3QYHB 1WDXA 3HL8A 3NPFA 3RMSA 5GAOm 1QQJA 3JAME 1JJ2S 4BY6C 1VQ6A 1PRLC 2P4TA 1YBYA 2RHZA 1U06A 5FLXE 4QT7A 1ZQ1A 2MYSA 1KD1R 1N5ZA 2P4RA 2BZXA 2W10A 1WHJA 1BCMA 1YHQT 2D0NA 1PC0A 1IGQA 2KK4A 1MV3A 3OYGA 3J80E 1QVPA 2VXEA 1VQLQ 5GMKi 5KYUA 2RJCA 3I56Q 3JCMf 1X43A 1WHMA 5CQXA 3OW2S 2JM8A 3GP8A 4M78A 4B9WA 1VYVA 4XTYA 1RUWA 3R6OA 1I5OB 3RBBB 4E7KA 2XDPA 2FRWA 2LJ1A 2NUPA 2J7IA 4OMFB 3MP6A 4PNOA 1HSQA 5D6YA 2RHYA 1M1KC 2RQTA 2K6DA 1M3BA 3INZA 1RI0A 4XQ3A 3DKMA 4FYVB 2HAXA 3G71T 2X4YA 2DTOA 1WGSA 3C4SA 1GRIA 3E9FA 5KYNA 2HL3A 3OW2P 3Q1JA 2LZ6B 2R5MA 1VYUA 1VQKQ 3A8MB 2DXTA 1Y7XA 2CS7A 3JCMc 4RTTA 3I56A 4IIMA 2OTLT 1VQNA 2VGNA 5LJ3d 2P84A 1HJDA 2VXFA 1TUDA 4ZNXA 2ZZDA 5EC7A 4JRPA 2DA9A 4Y28E 1D0YA 2EJFA 2CSQA 2D6FA 4Q5WA 3JRZA 4M77G 1W2BA 5LJ5j 2KGTA 4XK8E 2GTOA 4P5NA 2E1HA 2CP5A 2MPXC 4JJDA 4M7DD 3P8HA 2JTMA 3EGXB 1K8AR 3RERA 2EQKA 4CRIA 3CCST 1UHCA 2GBQA 2PVDB 2NYSA 3GNFB 2DVEA 2CP7A 2KROA 3JCMX 2RHIA 5GAOq 3CCVA 1H92A 2FO0A 1UGSB 1FX7A 3NHNA 3META 1M9SA 3HP9A 4MMLA 4LNPA 2K9GA 2VASA 3LW5E 4D8DA 2LNVA 3PE0A 3E19A 2LRQA 1YWOA 2GCXA 3REAB 4F14A 1WHGA 1VQ4T 1AHJB 1VYTA 5FU6B 4DOVA 1NPPA 3CD6T 2BKDN 1B34A 2DILA 3SWNB 2LP5A 3NTIA 4M78C 1N9SA 3ZFJA 1X01A 1ZX6A 4XU2A 1P92A 4F7UF 2CDTA 2ZPEB 2L3PA 5I21A 3QHSA 4X9DA 3RMQA 1VQOA 1ZLMA 2QQ9A 4HCCA 2VWFA 4N4IA 1VQ7A 4BE1A 4N0AC 3MJXA 3JCMg 4AFZC 2L89A 2FZKB 4R0KA 5HK0A 3EHQA 2HD0A 3LH0A 2PVOB 2WSCE 1VQ8A 2YRDA 1WPYA 2EYQA 3NFCA 4F7UB 3OYIA 1PKTA 2E70A 2QTXA 5L23A 2IPOB 3G71Q 4OMNA 3LWIA 3M4YA 5FU7C 2QAZA 3VS0A 4GY5A 4XTWA 2QK0A 3EG3A 2ZPIB 4XTUA 4PLLA 2CT3A 4PJNA 3CXCA 2ABLA 4KBMB 4OVAA 4PFPA 5FWCA 1WQ7A 2KMTA 3CCMA 4C8QF 1K8AU 4JPBW 3OY9A 2CH4W 1BKBA 3SB2A 5GAMh 4Z8AA 3SDZA 1MV0B 2OJ2A 2E65A 1PSFA 3L1AA 1TH7A 4C92A 2YRCA 4ATOA 1H3HA 2RI3A 3RESA 1AWOA 8AT1B 2RHUA 4M77C 1EFNA 4A4KA 1ABOA 2E12A 2COZA 2LX9A 3WXMB 2OAWA 1VQ8Q 1A0NB 2BIVA 2F2XA 4EMGA 1ZUYA 1SHGA 4E6RA 1PNJA 3RUXA 2DD4A 1RAIB 1E6GA 3QZ5B 1WXUA 5DLOA 1ZSZA 5CIUA 2LJ0A 4RTYA 4M7AC 3QO3A 1I4K1 1ZBXA 1RABB 2DYIA 4MZPA 4AFSC 1JB0E 5M9OA 3G6EQ 4ZGJB 2IG0A 2YLBA 4C0DC 4WF2A 3CEYA 1BCOA 2K5LA 1SRLA 1YJ9Q 2QDLA 4E7ZA 3E2UA 1Q82R 3BY7A 2M0YA 1FWZA 2K2MA 2FZGB 2XICA 5C6SA 3QPHA 2KT1A 1QVGS 2Y4YA 4ZN3A 1O75A 3QDRB 5GAN4 5LJ5e 1BYMA 3CCQQ 4QVDA 5HCKA 3MEWA 4IUPA 4EIKA 1T0HA 3RNJA 1SPKA 4BDZA 4FW1A 3QWYA 3QUIA 2F5TX 4OMMA 3TCJA 2BE7D 4FYYB 2HQEA 2XU8A 3EFRA 3JCMW 2COWA 3UF4A 2DX1A 3BDLA 2EJGA 2QGFB 3EFOA 3PIOA 1Z9QA 2VKNA 1PG5B 2ECZA 3CC2Q 3UA6A 2LCLA 3FEOA 2O88A 2DF6A 2MWOA 2C0TA 1MNDA 1IREB 1MHNA 3ER0A 1UB4A 5KYWB 1FYNA 2LQKA 1NEBA 1NYFA 2KVQG 2O4XA 1QVFS 1ZA2B 2LT1A 3C12A 4A63B 1T3LA 2DVJA 1NBEB 4EMHA 4M75G 3EG9B 3A98A 1YHQQ 1UJ0A 4NL2A 3DB4A 2DL4A 3CMET 5L8RE 3VS6A 5GMKl 1OQKA 2RH2A 1KHCA 1WX6A 3QYGB 3HRSA 3GPLA 5J26A 3CMAA 2KAFA 4F17A 1K9AA 3TQ7P 1ZBJA 3X20B 2FPEA 1YIJA 1OPLA 2QI2A 4A4EA 1M1FA 3X28B 4CC4B 3CCRQ 4JUVA 4RG2A 2E6ZA 2DNUA 3WVDB 2EVRA 3SEMA 3E9GA 2NLUA 3P8DA 3VS5A 2FPDA 2DLPA 5IHKA 4LN2A 1QWFA 1Q7YR 2EKOA 1I5LA 1QVGA 1JJ2A 1M2VB 2K5IA 2QG9B 2AZVA 3ASKA 3M53A 4X1VA 2AZSA 1E6HA 4JZ3A 4KRTA 2YDLA 3CC4T 2EQMA 4O6JA 1UGRB 2B8AA 2P0QA 1RAAB 2KRNA 1K73U 4AFUC 4JDSA 1OOTA 2OI3A 4JJCA 1YNZA 1BIBA 1E7OA 4RTZA 4HCKA 2D0QB 4J9HA 3TVTA 2EPDA 1PSEA 1UECA 5FROA 2K3YA 4VUBA 1QCFA 3VS4A 4JJNK 4ZTJA 5GAN8 4C8QC 3L2VA 1PD1A 4F7UG 1Q81U 3OS2A 2RB6A 1PKSA 2DEUA 4DEXA 5GJWB 4ESRA 3JB9F 2MI6A 3FDRA 1OPKA 4JS4A 1I07A 1CKAA 3C95A 4JJBA 1VQMT 2L8DA 2HKNA 1Y57A 4XTXA 1FMKA 2KNBB 1V29B 4M4ZA 1Y96A 2YUQA 2BZYA 2CZ0B 3G4SA 2DK3A 1VIEA 4ORZA 5GAN5 1OX9A 4GBQA 1QCOA 4PFOA 2MIOA 3ZEHA 4FT4A 4KUDK 3V7RA 4E47A 3H6ZA 2V26A 5GAOr 1YITA 2HCKA 4PKCC 2QEXQ 2KEAA 4C5IA 1XNIA 4PJJA 1JJ2P 3GLXA 2GF7A 4C0GA 3M0TA 3JCMQ 4PJOE 4BUGA 1O9SA 5A0GA 1Y96B 5CO7A 2E64A 5CCAA 4BI3A 3MP8A 3MCAB 1RI9A 3PMIA 5LJ3h 1KD1C 2I2LA 3REBB 4F7UA 1TXQA 2IIMA 4A53A 2HSEB 1YJNA 5KH6A 1IRXA 5KYYA 4XU1A 2JS2A 3CCJQ 2NWMA 4AG1C 1CSKA 1X2QA 1VQMA 3CC4Q 2RJEA 1RAFB 3H41A 5GAMg 2GNCA 5D7UA 2A0FB 2ATCB 4UC4A 1M30A 1YI2T 3S6WA 2DJQA 2L2PA 1XJWB 1H3ZA 1M4ZA 1QCNA 3SWNC 4BD3A 4Z02A 1UGPB 1PD0A 1ZSGA 1Z9ZA 2EQUA 2E5QA 1IGUA 2VVKA 2OTLA 4JS5A 1R77A 2GFAA 4KUIA 2YRVA 1GBRA 4OB3B 4E2FB 3CPWS 2OTJQ 3AHUA 1QMCA 2DKGA 3MEUA 3QJ6A 5CKBA 3PVLA 4C5HA 3CBPA 2A28A 1SHFA 4L5GA 3OYKA 3EGXA 4C5GA 3CC7Q 5CKHA 2HL5C 5IH2A 1QW1A 2A36A 2KE9A 4F7UE 2QTVA 2OX7A 2V8IA 3OYFA 1YIJT 1WZOA 4YTLA 1VIFA 2KSSA 3X25B 2QQBA 2X35A 2A37A 5GJVB 1QKXA 4A4HA 1YI2Q 1GCQC 3CMAT 1AOJA 2QGGA 2PUOB 2RF0A 1F1BB 4LDVA 4BY6B 4IUTA 3M58A 1UEBA 3ULRB 1VQNQ 3M59A 1W6XA 1AT1B 3CCLT 1VOMA 4AG2C 3A8OB 5FWBA 3L2WA 2MCNA 5LJ5d 1WXBA 2YUOA 4OGEA 3JB9G 2QYZA 4C8QE 2VV5A 4N4HA 2RHXA 3ZBDA 3CC7A 3PIPA 5HY6A 2EFIA 4EPCA 5GAN2 1OULA 2DM1A 3M0SA 1QVFP 4J9DA 4RTVA 1G2BA 4J8OA 4ELYC 1BB9A 3VJPA 2B86A 1YJWT
chains in the Genus database with same CATH topology
5GAN7 2GFUA 3L2RA 2L89A 2EAYA 5HK0A 2HD0A 3LH0A 2PVOB 2WSCE 1VQ8A 4PJOA 1WPYA 2EYQA 1VQ9A 4EMKB 3GF5A 4M7DG 3NFCA 4F7UB 1S72A 4PJOD 2EJ9A 4QVCA 4RMOA 3S3MA 3OYIA 1VQ9T 1KD1U 3M56A 3QIIA 1Q86C 2E70A 2QTXA 4M75B 2PU9B 4L6V5 2CYZB 5CKEA 5LJ5h 3LWIA 2JVVA 3UT1A 3M4YA 3BDUA 5FU7C 5GAMe 4HCZA 2BUDA 5KE3A 3A8HB 4M77B 1YJ9A 3A5ZB 3URGA 4GY5A 4XTWA 5GMKm 4XTUA 2XK0A 2ZPIB 2DJZA 1VQKT 4PLLA 1YI2A 3LLRA 4RCBA 3CXCA 1KQ2A 4KBMB 4OVAA 4M7AD 1VQOT 5KE2A 4M7AG 1WQ7A 2KMTA 4MDWA 2RD1A 4C8QF 2A7YA 3OY9A 3CCEA 3CCMA 1K8AU 3CC4A 1G5VA 4JRKA 1OYXA 4MDXA 5CKFA 4M75F 1OZ2A 2YHTA 4C5EA 4PJOB 1NE8A 3DLLA 4XTZA 3FRNA 4N0AA 2E41A 3CC7T 4HA8A 1NPRA 5CR2A 1VQ5T 1BKBA 1K9MU 2P0PA 2EWNA 2CZ7B 3SB2A 3SDZA 4C92F 5GAMh 3CCQA 3CCJT 2X4XA 1D3BA 2LC4A 3A8LB 4C92D 2MF2A 4M7DA 3OMGA 4DOWA 4PJOC 1LJOA 1K8AC 4EDUA 3HFOA 2EIFA 1OI1A 2E65A 1PSFA 3L1AA 1TH7A 3BW1A 4QQ6A 5AYFA 4C92A 1M90U 4ATOA 2RI3A 2QQSA 3RESA 3CCLA 2RHUA 3JCMJ 5J3BA 4M77C 3FB9A 5GAN6 4A4KA 4RCCA 2E12A 3EAEA 2K2VA 5FU7B 2QDYB 2XI9A 2LX9A 1MGQA 3LYIA 2FL7A 4IUQA 2O4XB 3WXMB 5GANg 4RKUE 3HFNA 3QSUA 1NZ9A 3L2ZA 2JTFA 4NOYA 2LDMA 1I8FA 1B34B 2BIVA 4C92B 4EMGA 5GAMf 5IT9E 3RUXA 2MAMA 3SFMA 3OYLA 2DIGA 2CKKA 2K5FA 2O01E 2DD4A 1D3BB 3OS0A 3QZ5B 5GAMj 5DLOA 5LJ5f 4J6YA 5CIUA 2V8JA 3RKYA 3OSSC 5GMKh 4M7AC 3HRTA 4L59A 3QO3A 2HBPA 5I2SA 1I4K1 1RL2A 1ZBXA 4MZPA 4Y91A 3PTAA 1FXXA 2M16A 3ME9A 1JB0E 3QBYA 5M9OA 4M75E 1XQHA 3LGFA 3MEAA 2ZCFB 3OBWA 4KULA 3PNWC 1VUBA 4LDUA 1XTDA 4ZGJB 2IG0A 2YLBA 1Q81C 3VKIA 4C0DC 3G4ST 4WF2A 3CEYA 2K5LA 2RI5A 1Y07A 4M75D 2E6NA 2EQJA 4M77A 3OYDA 1U1TA 2Y4XA 3BY7A 2XHCA 1I81A 1FWZA 1KC8U 2RA2A 3E1SA 4M78E 2XICA 5C6SA 3GOXA 5DM7R 4OP0A 3FJPA 5C0MA 3QPHA 1ZHIA 1U8RA 1QVGS 2Y4YA 2L5QA 1OZ3A 2JUFA 1O75A 4ZN3A 4A4FA 1K9MC 3QDRB 2XDDA 5GAN4 3LGLA 5LJ5e 2CGHA 2RM4A 2RK1A 3L2UA 1BYMA 4QVDA 1KC8C 1QP3A 4QQGA 3G6EA 3MEWA 2DTHA 2DXUA 2ZPGB 3M9QA 4IUPA 4R55A 3CCUT 4MZTA 4J7IA 3UDCA 3LWHA 4BDZA 4E7HA 4C0FA 3JCMb 2L3RA 1WJRA 5EG2A 2H3JA 3QUIA 2F5TX 3S3NA 4ZN1A 3OW2A 3CCUA 2G3RA 3C94A 4XAXB 2RI2A 4FT2A 2DTIA 1VQ8T 3TCJA 1G3YA 2A3LA 4PJOG 2HQEA 3LX7A 5KCHA 3PFSA 5D6XA 2VGMA 5CVIA 2XU8A 5HKCA 3EFRA 5GANf 1NJIC 2MMPA 3JCMW 2MWPA 1W4SA 3JCMe 4A4GA 3BDLA 2EJGA 3CCRA 3PIOA 3VYGA 2JOYA 5I2MA 4JRQA 3CC2T 3F70A 5HK3A 4JLIA 2LCLA 3FEOA 3OYCA 4DQ2A 2AHJB 3RKXA 4IUVA 2CZ1B 2MWOA 2JZ2A 4M78F 5FRMA 3QG1A 1IREB 2DEQA 2DXCA 1MHNA 2OAUA 1UB4A 3ER0A 3OSVA 4BI8B 4N4GA 1M5Q1 2KVQG 2LQKA 2O4XA 3OYMA 3CD6A 1QVFS 2LT1A 2F69A 3C12A 4M75C 3JCMh 4GLKA 1VQ4A 3HRUA 3SWNA 5GANd 4II1A 4EMHA 2V8KA 4M75G 2DD5A 4FM4B 4EMKC 2KDSA 5A2QE 1U1SA 4NL2A 4M7DB 4ZGDB 3DB4A 2D9TA 1N27A 3CMET 5L8RE 2QEXT 2LCCA 5GMKl 2RH2A 3NTKA 1WNLA 4XTVA 1KHCA 2ZPBB 3HHTB 3QYGB 1JBMA 3X24B 3HRSA 3GPLA 1KG1A 2K57A 3S3OA 5J26A 3CMAA 1Y71A 4X34A 2KAFA 3PGGA 2R58A 1N9RA 2QEXA 3CMEA 3KBGA 2RK2A 3V8JA 1KHIA 1XOVA 2FHDA 3X20B 5LJ3j 4M7DF 1YIJA 4C92G 3X26B 2QI2A 4A4EA 1KQSA 1M1FA 3X28B 3QKJA 3SD4A 3MP1A 4FSXA 4JUVA 4RG2A 3JSCA 3TU4K 2E6ZA 3CBOA 3WVDB 4O5VA 1YHQA 5GANe 3OS5A 4C0ZA 2DXBA 2DAQA 1YCYA 4M77D 3E9GA 2NLUA 3P8DA 4M78D 3MHXA 4IUUA 2QQRA 4M75A 3MO8A 3CCJA 2KQWA 3VU3C 4E7IA 5GANh 3QXEB 5A0DA 2EKOA 1K73C 1I5LA 4EMKA 1QVGA 3GNGA 1JJ2A 4BDYA 4OB1B 2K5IA 4KT0E 3ASKA 3M53A 5D6WA 5FU6C 4HCBA 3OYJA 1VQ6T 4RG8A 4M7AA 5CQYA 1YITA 3OYBA 2XD0A 4OB2B 1BIAA 3JB9H 2PQWA 1G3WA 3OA6A 3CC2A 1LNXA 3TREA 1WJSA 3CC4T 3CCMT 2EQMA 2QXFA 2VYTA 4O6JA 5IN1A 5CAIA 1UGRB 2B8AA 3G6ET 4M7AE 2P0QA 2VUBA 1K73U 1VQKA 3JCMd 4JDSA 2M1HA 2OTJT 2XG8D 2K4YA 4QW2A 5GMKe 3KXTA 1WQWA 4E7LA 5GAOl 2VC8A 1BIBA 3V7CA 2XIDA 1VQLA 2X4WA 2D0QB 1Q7YC 2ZPFB 4BB7A 3P8BB 3I55T 1VQPT 1BI1A 3DLMA 1PSEA 1S72T 5FROA 2K3YA 4VUBA 3M5AA 3MEVA 2FYKA 4A54A 4JJNK 4FIBA 4ZTJA 4LDYA 1VQNT 4M7DE 5GAN8 4C8QC 4PJOF 4OF1A 3L2VA 5LJ3e 3M4GA 3L2QA 4MZMA 2M9UA 4J6XA 4F7UG 1Q81U 4D6WA 3GIBA 2OTJA 3OS2A 4FL6A 2RB6A 3JCMP 2FB7A 1VQ7T 2E10A 1JRIA 1N6AA 3KUFA 5LJ5g 4IKFA 3HKSA 4J7FA 3OS1A 2PUKB 2MI6A 4M78G 3JB9F 3QYHB 3FDRA 3HL8A 3RMSA 3JB9J 4JS4A 3QJYA 5GAOm 1WJQA 2QQAA 2C06A 3OYNA 3C95A 3JAME 1JJ2S 4LDWA 1VQMT 2L8DA 4BY6C 2Y90A 1VQ6A 1GXIE 2P4TA 4XTXA 1YBYA 4IURA 2RHZA 4TVRA 1BI0A 1V29B 1G3SA 1Y96A 3PMTA 5FLXE 5GAN3 4XU0A 1ZQ1A 2CZ0B 3G4SA 1N8RU 2DK3A 1VIEA 5GAN5 1YJNT 4C8QG 4M7AF 4OB0B 1Q82C 2HNIA 1YHQT 2WSEE 1EIFA 4FT4A 3ZEHA 4KUDK 3V7RA 4E47A 3H6ZA 1G3TA 2KK4A 3JB9I 2ZPHB 5LJ3f 1UGQB 3OYGA 4PKCC 3J80E 4BE2A 5GAOr 4C5IA 1QVPA 3JB9D 4BACA 2VXEA 1M8VA 1XNIA 5GMKi 2XDBA 2DIQA 2LVMA 2RJCA 3RKWA 3GLXA 2GF7A 1QP2A 3OQ5A 3JCMf 4C0GA 5CQXA 1NJIU 1HXDA 3JCMQ 3OW2S 4PJOE 3L42A 4QVZA 5J39A 4BUGA 1O9SA 3O8VA 4M78B 5A0GA 1Y96B 4M78A 2E64A 5CO7A 4B9WA 4XTYA 4C0DB 5CCAA 4BI3A 3OMCA 3R6OA 3MP8A 2DZ9A 3MCAB 4E7KA 3PMIA 2R57A 1R8OB 2QA4A 1YITT 3CCSA 3FLGA 5LJ3h 2XDPA 1KD1C 3VV0A 2I2LA 1Q86U 4F7UA 2K3XA 3OYHA 3HPWA 4OMFB 4A53A 2ZGWA 3MP6A 4PNOA 5D6YA 1YJNA 2RHYA 5KH6A 5GANj 1M1KC 1W2BS 4XU1A 2X4JA 4M7DC 1KQ1A 3INZA 3H8ZA 3CCQT 3M55A 4ME7A 2M0OA 3RIRA 4V2SA 1RI0A 4C8QD 4XQ3A 1VQMA 2PVGB 2RJFA 3DKMA 2HAXA 4M77E 2RJEA 3EFSA 3FIFA 5IAYA 3G71T 5GAMg 2X4YA 2LTOA 3PT9A 2DTOA 1WGSA 3C4SA 4XU3A 3V8KA 3CCET 4PLIA 4UC4A 4JRIA 4BE0A 5DY9A 4LDXA 3E9FA 3CCRT 1BI2A 3VUBA 3QZ9B 3CBMA 2LT4A 3T9NA 3S6WA 3Q1JA 1YI2T 1X75C 2R5MA 3GP8A 1YJ9T 4B9XA 1H641 4ELZC 1H3ZA 1M4ZA 2GQVA 2DXTA 1Y7XA 3A8MB 3SWNC 2CS7A 3JCMc 4BD3A 3CPFA 3I56A 1M90C 1HK9A 2OTLT 1BI3A 4Z02A 1VQNA 1UGPB 2LQ8A 2VGNA 5LJ3d 3JCMV 3BFMA 4E7JA 4ZTFA 4NS5A 4QQDA 2EQUA 2E5QA 4C8QB 3I55A 1VQPA 2R5AA 2VXFA 4X9CA 3CXCS 1M1GA 4M7AB 1SSFA 5A0LA 2ZZDA 2OTLA 5GAOn 4JS5A 3I56T 2GFAA 3FC3A 1VQLT 4FU6A 4HKEA 3UWNA 1X6OA 4KUIA 4JRPA 2YRVA 5CK9A 1YJWA 4OB3B 3CPWS 2P0KA 3AHUA 4C92C 4Y28E 1KQSS 2DKGA 3MEUA 3QJ6A 4LD6A 5CKBA 2EJFA 2KY9A 4C5HA 3CBPA 3G71A 4PL6A 3CPWA 2D6FA 4Q5WA 2WACA 4L5GA 3JRZA 1DJ7B 4M77G 5DLQE 1W2BA 5LJ5j 1QVFA 3OYKA 2IVWA 4M77F 3OB9A 5FRNA 4C5GA 4DA4A 4XK8E 4P5NA 5CKHA 4MMKA 1M1KU 4OGCA 1QW1A 5GMKj 5LJ3g 2E1HA 4F7UE 4M7DD 2XKOC 3DB3A 3P8HA 4CI0C 2V8IA 2JTMA 4R56A 1YJWT 3RERA 2DPPB 2EQKA 3OYFA 4CRIA 3OYAA 3CCST 1YIJT 4YTLA 2QA4T 1VIFA 2KSSA 2F5KA 2JN0A 3X25B 2QQBA 2X35A 3N5BB 2RJDA 2PVDB 3GNFB 2FVUA 3TEEA 2DVEA 4A4HA 3J7AF 5CKDA 3VUZA 3JCMX 2RHIA 5GAOq 2RO0A 3OYYA 3CCVA 3CMAT 3CCVT 2PUOB 1UGSB 4LDVA 1FX7A 4IUTA 4BY6B 3META 3HSBA 1M9SA 3HP9A 4MMLA 4HT8A 2YLCA 3LW5E 2LNVA 3M57A 2DO3A 3M58A 4BI4A 1UEBA 3E19A 5LL6S 2LRQA 3M59A 2GCXA 4HT9A 4C8QA 3M54A 3CCLT 4J5YA 4ZGEB 2CZ6B 3A8OB 3L2WA 1VQ4T 1AHJB 5FU6B 3A8GB 3J81E 2DZCA 4DOVA 3WVEB 1NPPA 1N8RC 3NTHA 5LJ5d 2BKDN 3CD6T 1B34A 3OBYA 4OGEA 1LOJA 3JB9G 4C8QE 2WSFE 3SWNB 2VV5A 1Q82U 4J6WA 4N4HA 4LD9K 3NTIA 4M78C 1N9SA 2RHXA 3ZBDA 1VQ5A 3ZFJA 2HQXA 3CC7A 1X01A 4XU2A 4NL3A 3PIPA 1P92A 3G7ZA 5GAOp 2JNGA 4F7UF 5HY6A 4J83A 3V8LA 3UPUA 1Q7YU 2ZPEB 2EFIA 4C92E 4EPCA 3QHSA 1IZ6A 4X9DA 5I21A 5GAN2 3RMQA 3VYHB 1VQOA 2QQ9A 3V7SA 4HCCA 5KCOA 4N4IA 1VQ7A 4BE1A 4N0AC 4ELYC 4J8OA 3VJPA 3JCMg 5GAMd 4JLGA 3OYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FL7 A;  1M4Z A;  4KUL A;  4DOV A;  2FVU A;  4BB7 A;  4LD9 K;  4DA4 A;  4JJN K;  4FT2 A;  4DOW A;  3PT9 A;  4KUI A;  1ZHI A;  4FT4 A;  4KUD K;  1ZBX A;  3PTA A;  1W4S A;  4FSX A;  3TU4 K; 
#chains in the Genus database with same CATH topology
 2KI7 A;  5GAN 7;  2ESW A;  1OV3 A;  4J9G A;  4Z88 A;  4PJO A;  1UFF A;  4EMK B;  3GF5 A;  2NUP B;  1S72 A;  2O9V A;  1JQQ A;  1Q86 C;  5IXF A;  1WI7 A;  4M75 B;  2CT4 A;  4L6V 5;  5CKE A;  5GAM e;  1K0X A;  2BUD A;  3VS1 A;  4J9B A;  1YJ9 A;  2XK0 A;  3VRZ A;  3CMA Q;  5I22 A;  2RMO A;  4RCB A;  1J3T A;  2DBK A;  1GCP A;  4M7A G;  4MDW A;  2RD1 A;  2A7Y A;  1K73 R;  1G5V A;  4M75 F;  1OZ2 A;  2YXY A;  4HXJ A;  1EX4 A;  1NE8 A;  1UGV A;  4N0A A;  1VQ5 T;  3TSW A;  1OU8 A;  3EGU A;  2P0P A;  2CZ7 B;  1ACM B;  2MF2 A;  3HFO A;  1RAC B;  1M90 U;  2QQS A;  3CCL A;  1MMD A;  5FU7 B;  2QDY B;  1NLO C;  1MGQ A;  2FL7 A;  5GAN g;  3HFN A;  3EHR A;  1NZ9 A;  4D8K A;  4NOY A;  2LDM A;  1PRM C;  4C92 B;  5GAM f;  1JXO A;  3OYL A;  4KH0 B;  1ZSZ B;  4FYX B;  2HSP A;  2DRM A;  2HEQ A;  5GMK h;  3HRT A;  2RNA A;  2SRC A;  1RL2 A;  2LJ3 A;  1V76 A;  3OBW A;  2X3X D;  1OX8 A;  1Y07 A;  2E6N A;  2EQJ A;  1UJY A;  2XHC A;  2AKL A;  1D09 B;  2RA2 A;  2FG0 A;  1BU1 A;  1ZUK A;  1B3Q A;  2ENM A;  3CCL Q;  1K9M C;  3LGL A;  2RM4 A;  2M51 A;  2RK1 A;  1QP3 A;  2DRK A;  2DXU A;  3M9Q A;  3CCU T;  3BE3 A;  2YSQ A;  3LWH A;  3MPU B;  2L3R A;  4ANJ A;  3S3N A;  4ZN1 A;  3CCU A;  4XAX B;  2J06 A;  2RI2 A;  2DTI A;  1VQ8 T;  4PJO G;  1RLQ C;  5KCH A;  2M02 A;  5HKC A;  2VGM A;  1CKB A;  1M27 C;  1UUE A;  1M90 R;  1FMV A;  1TUC A;  2JOY A;  3CC2 T;  5HK3 A;  4JLI A;  2X51 A;  1Y0M A;  3RKX A;  2CZ1 B;  1H8K A;  2JZ2 A;  2RQU A;  3OSV A;  4BI8 B;  4N4G A;  1M5Q 1;  3CD6 A;  3OYM A;  2F69 A;  4GLK A;  3HRU A;  3SWN A;  4DBH A;  1X27 A;  2V8K A;  4EMK C;  1WHK A;  2KDS A;  3M0R A;  4M7D B;  2QEX T;  4AMC A;  1TTH B;  3HHT B;  1C0M A;  2O9S A;  1WHL A;  1BBZ A;  2JS0 A;  2R58 A;  3KBG A;  3V8J A;  1FMW A;  2HZY A;  1KHI A;  1XOV A;  4E7S A;  2FHD A;  1M1K R;  1KQS A;  3MP1 A;  3ZL7 C;  2LQW A;  4O5V A;  4C0Z A;  2DXB A;  4M77 D;  4M75 A;  3U23 A;  3MHX A;  4IUU A;  2QQR A;  3MO8 A;  4E7I A;  2HQH A;  3VU3 C;  5GAN h;  4M7A D;  1K73 C;  3GNG A;  4BDY A;  1VQ6 Q;  4PJM A;  5FU6 C;  3OYJ A;  2XD0 A;  1G3W A;  1K76 A;  3CC2 A;  1LNX A;  1VQ4 Q;  3G1J A;  2QXF A;  3TSZ A;  1JO8 A;  1PWT A;  2VUB A;  4M7A E;  1VQK A;  3JCM d;  2XG8 D;  5GMK e;  1WQW A;  5GAO l;  2VC8 A;  1IXD A;  1Q7Y C;  3UA7 A;  3THK A;  2EGA A;  1TWB A;  4OF1 A;  3M4G A;  3L2Q A;  2M9U A;  1YJW Q;  3GIB A;  4LE9 A;  2A08 A;  5IHN A;  1ZSZ C;  1JRI A;  3KUF A;  4LUD A;  3OS1 A;  4M78 G;  2NUZ A;  1IHW A;  3QJY A;  2C06 A;  1S1N A;  2EYZ A;  3OYN A;  3EH1 A;  4LDW A;  1AEY A;  1GXI E;  1QWE A;  1NYG A;  4TVR A;  3PMT A;  1G3S A;  1N8R U;  4JZ4 A;  4C8Q G;  4M7A F;  4OB0 B;  1Q82 C;  2HNI A;  4OML A;  1EIF A;  4PJL A;  4KH1 B;  1G3T A;  1SRM A;  3JB9 I;  5LJ3 f;  1RLP C;  4BE2 A;  1AZG B;  2V1R A;  2CP2 A;  2XDB A;  1K4U S;  2LVM A;  1OU9 A;  3OQ5 A;  1HXD A;  3I5S A;  4WCI A;  4M78 B;  4C0D B;  1TU0 B;  2L3S A;  1TS9 A;  3FLG A;  3OYH A;  3HPW A;  4K11 A;  1UHF A;  2ZGW A;  1OEB A;  3PVQ A;  2X4J A;  1KQ1 A;  1NEG A;  3CCQ T;  4ME7 A;  2M0O A;  4C8Q D;  1TG0 A;  2PVG B;  2RJF A;  2AKK A;  3PT9 A;  3CCE T;  4JRI A;  4BE0 A;  1YP5 A;  3CCR T;  1BI2 A;  3UAT A;  2PTK A;  3QZ9 B;  2LT4 A;  3T9N A;  4AT1 B;  3H9N A;  2DMO A;  1W70 A;  1YJ9 T;  1H64 1;  4ELZ C;  1KFZ A;  3NGP A;  3MKD A;  2OTL Q;  2EYY A;  2LQ8 A;  3JCM V;  4E7J A;  2JJ9 A;  2R5A A;  4X9C A;  1M1G A;  1SSF A;  1M3C A;  5A0L A;  1Q86 R;  5GAO n;  1VQL T;  4HKE A;  4CC2 A;  3UWN A;  3CD6 Q;  1X6O A;  1U5S A;  1GFD A;  5CK9 A;  1YJW A;  2KYB A;  2V1Q A;  4C92 C;  1GCQ A;  1KQS S;  2KR3 A;  4LD6 A;  1WIE A;  1I1J A;  3CPW A;  2NUT B;  2WAC A;  1QVG P;  5DLQ E;  2IVW A;  3OB9 A;  4DA4 A;  2VB6 A;  5LJ3 g;  3FJ5 A;  2XKO C;  3DB3 A;  2YT6 A;  4CI0 C;  2CP0 A;  2PNI A;  2QA4 T;  1M2O A;  2F5K A;  2CUD A;  2FRY A;  2RJD A;  2FVU A;  3J7A F;  3VUZ A;  2RO0 A;  1PM3 A;  6AT1 B;  1C6V X;  3NMZ C;  4HT8 A;  2YLC A;  1YJN Q;  4Y92 A;  3M57 A;  2DO3 A;  2JTE A;  4BI4 A;  5LL6 S;  1UG1 A;  1GFC A;  4HT9 A;  4C8Q A;  1KIK A;  1VQ5 Q;  2CP3 A;  7AT1 B;  1I0C A;  3A8G B;  4HVU A;  2DZC A;  3WVE B;  1N8R C;  3NTH A;  9ATC B;  5KYX B;  3OBY A;  1LOJ A;  2WSF E;  1Q82 U;  4J6W A;  2HQX A;  2L3Q A;  4J83 A;  4C92 E;  3VRY A;  2DL7 A;  3EH2 A;  3V7S A;  4B6M A;  2DL3 A;  3VS7 A;  2EAY A;  1KK7 A;  1ABQ A;  1RAD B;  2GQI A;  1M2V A;  3IQL A;  4M7D G;  3CCS Q;  1MMA A;  1MNE A;  1Q81 R;  4PJO D;  3QII A;  3QWX X;  2JT4 A;  3CCE Q;  3BDU A;  2KRS A;  3RDV A;  4HCZ A;  3A8H B;  1JEG A;  4M77 B;  3URG A;  5GMK m;  1SG5 A;  2DJZ A;  1YI2 A;  1AD5 A;  4J9I A;  1TSF A;  1VQO T;  4RTX A;  3CC4 A;  2KXD A;  5CKF A;  3QDF A;  1NG2 A;  2YHT A;  5KYX A;  4PJO B;  3DLL A;  4XTZ A;  3FRN A;  1AVZ C;  1MUZ A;  1K9M U;  2HKQ B;  2EWN A;  4C92 F;  3CCJ T;  2X4X A;  3A8L B;  2LC4 A;  4M7D A;  4DOW A;  4PJO C;  1LJO A;  4EDU A;  1MMG A;  2ED1 A;  4QQ6 A;  3H0F A;  4RTU A;  5J3B A;  3FB9 A;  4RCC A;  3EAE A;  3I5R A;  4IUQ A;  3QSU A;  3L2Z A;  2JTF A;  1LPL A;  4CC3 A;  3GBQ A;  3SFM A;  1RAE B;  1IHV A;  3LH5 A;  5LJ5 f;  4J6Y A;  3OSS C;  4L59 A;  4Y91 A;  1VQ9 Q;  1X6G A;  2O31 A;  1VA7 A;  4M75 E;  3LGF A;  3MEA A;  4FCY A;  3PNW C;  1VUB A;  2F2W A;  1XTD A;  1Q81 C;  1UTI A;  2NUT A;  3G4S T;  3AT1 B;  2RI5 A;  3VS2 A;  2YUP A;  1U1T A;  4OMO A;  2K79 A;  1I81 A;  2MK5 A;  2L0A A;  1G8X A;  2K7A A;  3E1S A;  4Z89 A;  5DM7 R;  2BE9 B;  2XMF A;  4OP0 A;  4AFQ C;  1ZHI A;  1U8R A;  2X3W D;  2JUF A;  4A4F A;  2XDD A;  1SSH A;  2RN8 A;  4PFZ A;  4J9C A;  4LXC A;  1KC8 C;  3G6E A;  2DTH A;  2ZPG B;  1WXT A;  4MZT A;  4J7I A;  1JU5 C;  4C0F A;  5EG2 A;  1VQM Q;  1D0Z A;  2G3R A;  4FT2 A;  1KSW A;  2A3L A;  3PFS A;  5D6X A;  5CVI A;  1M8V A;  1NJI C;  2MMP A;  3JCM e;  4A4G A;  3CCR A;  2D1X A;  5I2M A;  2EKH A;  2C0I A;  1SKU B;  2JXB A;  4IUV A;  4M78 F;  1WA7 A;  3QG1 A;  1W1F A;  2DEQ A;  2OAU A;  4M75 C;  4II1 A;  1RAH B;  2DD5 A;  4FM4 B;  1S72 Q;  5A2Q E;  4ZGD B;  1N27 A;  2CH4 A;  1LVK A;  5KYY B;  1WNL A;  4XTV A;  3X24 B;  1JBM A;  1KG1 A;  2K57 A;  1Y71 A;  3CME A;  2EBP A;  2RK2 A;  2QA4 Q;  4M7D F;  1B07 A;  3QKJ A;  1PHT A;  4FSX A;  3TU4 K;  3EG0 A;  4FYW B;  1YHQ A;  5GAN e;  2E3I A;  3CCJ A;  4EMK A;  1IO6 A;  2GTJ A;  1VQ6 T;  3M0U A;  5D6W A;  4M7A A;  3JB9 H;  2COY A;  2F2V A;  2FPF A;  3OA6 A;  3A1P A;  3CCM T;  3JV3 A;  2K4Y A;  3H0H A;  3KXT A;  2AT1 B;  2XID A;  2ZPF B;  4BB7 A;  3I55 T;  1VQP T;  1NM7 A;  1BI1 A;  3DLM A;  3I55 Q;  1VQP Q;  1V1C A;  3M5A A;  3MEV A;  2FYK A;  3EG1 A;  4FIB A;  2EYW A;  4M7D E;  4OMP A;  1HYO A;  2OTJ A;  4FL6 A;  3JCM P;  1K1Z A;  1Q95 G;  1VQ7 T;  4IKF A;  5LJ5 g;  2FEI A;  2KBT A;  3JB9 J;  1WJQ A;  2QQA A;  2EW3 A;  1K0S A;  2Y90 A;  3EGD B;  2K3B A;  3CPW P;  4IUR A;  1BI0 A;  5GAN 3;  4XU0 A;  1U3O A;  2KYM A;  1YJN T;  4GLM A;  2WSE E;  3H0I A;  1X6B A;  2ZPH B;  1B7T A;  1UGQ B;  3JB9 D;  3C0C A;  4BAC A;  2DIQ A;  3RKW A;  1QP2 A;  2DER A;  1NJI U;  4RUG A;  3L42 A;  1GL5 A;  4QVZ A;  5J39 A;  3O8V A;  3OMC A;  1D1B A;  4F04 B;  2DZ9 A;  2PZ1 A;  1R0B G;  2DL8 A;  2I0N A;  2QA4 A;  2R57 A;  1R8O B;  1YIT T;  3CCS A;  2CRE A;  3VV0 A;  2LNH B;  1Q86 U;  2K3X A;  3CXC P;  2O2O A;  4FSS A;  4QKU A;  5GAN j;  1W2B S;  4M7D C;  3H8Z A;  1EZZ B;  2HMA A;  3M55 A;  3I35 A;  3RIR A;  4V2S A;  2KT8 A;  3CCM Q;  4M77 E;  5IAY A;  3EFS A;  3FIF A;  4HVV A;  2LTO A;  3V8K A;  4XU3 A;  4DBQ A;  4PLI A;  4LDX A;  5DY9 A;  2Z0W A;  3VUB A;  3CBM A;  1WHH A;  1X75 C;  2HBW A;  2ED0 A;  4B9X A;  2RQR A;  2GQV A;  2YUN A;  1M90 C;  3CPF A;  1HK9 A;  1BI3 A;  1AWW A;  3BFM A;  1NJI R;  4ZTF A;  4NS5 A;  4QQD A;  4C8Q B;  3I55 A;  1VQP A;  3VS3 A;  3EFO B;  3CXC S;  4M7A B;  1TOV A;  2H3E B;  2DYB A;  3KFV A;  2RQV A;  3I56 T;  3FC3 A;  4FU6 A;  1T0J A;  1AZE A;  1ZA1 B;  2RQW A;  2G6F X;  1QKW A;  1D1A A;  2P0K A;  4J9E A;  2D8J A;  3HTR A;  1RAG B;  4CC7 A;  2KY9 A;  3G71 A;  4PL6 A;  2DBM A;  1VQO Q;  1M8M A;  1WFW A;  1DJ7 B;  1QVF A;  2ROT A;  4M77 F;  5FRN A;  4MMK A;  1M1K U;  4OGC A;  1BK2 A;  5GMK j;  4R56 A;  2DPP B;  3OYA A;  1PCX A;  2ZAE A;  4RTW A;  2JN0 A;  3EG2 A;  1D0X A;  3N5B B;  3TEE A;  5CKD A;  3OYY A;  3CCV T;  2EGC A;  3HSB A;  3CQT A;  1TUG B;  1YN8 A;  2DFU A;  2JMC A;  3M54 A;  1AWJ A;  4J5Y A;  4ZGE B;  2CZ6 B;  1KQS P;  3J81 E;  2E3H A;  1GBQ A;  2JM9 A;  4KGX B;  2C0O A;  2DE0 X;  5I11 A;  4LD9 K;  4LUE A;  1VQ5 A;  1R0C B;  4PK4 A;  4NL3 A;  3G7Z A;  5GAO p;  3M0Q A;  2JNG A;  3V8L A;  3UPU A;  1Q7Y U;  1IZ6 A;  2AIR B;  1K9M R;  3VYH B;  5KCO A;  1JXM A;  5ECA A;  5GAM d;  4JLG A;  1ARK A;  3OYE A;  1X2K A;  2GFU A;  3L2R A;  2MOX A;  2DET A;  1VQ9 A;  4KGZ B;  4OMQ A;  1KC8 R;  2AK5 A;  1N8R R;  2EJ9 A;  4QVC A;  4RMO A;  3S3M A;  3CCU Q;  1VQ9 T;  1KD1 U;  3M56 A;  2PU9 B;  2CYZ B;  3G6E T;  5LJ5 h;  3JCM J;  2JVV A;  3UT1 A;  5KE3 A;  5AT1 B;  5IXB A;  3M0P A;  3A5Z B;  1MMN A;  1VQK T;  3EGD A;  3LLR A;  3CCV Q;  1KQ2 A;  2YWW A;  5KE2 A;  4J9F A;  1YIT Q;  3CCE A;  1W2B P;  4JRK A;  1OYX A;  4MDX A;  4C5E A;  1WLP B;  3CC7 T;  2E41 A;  4HA8 A;  1NPR A;  5CR2 A;  1M3A A;  3CCQ A;  4KGV B;  1YCS B;  1D1C A;  4DEY A;  3O5Z A;  4C92 D;  1D3B A;  3OMG A;  1SF9 A;  1K8A C;  4DBF A;  2EIF A;  1OI1 A;  3BW1 A;  2EQI A;  5AYF A;  2FZC B;  5GAN 6;  1ZUU A;  1X69 A;  2K2V A;  2XI9 A;  3LYI A;  2O4X B;  2CUB A;  4RKU E;  5KYW A;  1I8F A;  1B34 B;  5IT9 E;  1LCK A;  2MAM A;  2DIG A;  2CKK A;  2K5F A;  2O01 E;  1UE9 A;  1D3B B;  3OS0 A;  5GAM j;  2V8J A;  3RKY A;  2JMA A;  2HBP A;  5I2S A;  3PTA A;  1FXX A;  2M16 A;  3ME9 A;  2EGE A;  3QBY A;  1XQH A;  2CSI A;  2ZCF B;  4KUL A;  4LDU A;  3VKI A;  4M75 D;  2LCS A;  3I9Q A;  4M77 A;  3OYD A;  2Y4X A;  2QAS A;  2GGR A;  1KC8 U;  4FW2 A;  4M78 E;  3GOX A;  3FJP A;  5C0M A;  5KYU B;  1IB8 A;  2L5Q A;  1OZ3 A;  2CGH A;  1KJW A;  2KRM A;  3L2U A;  4QQG A;  1YIJ Q;  4R55 A;  4E7H A;  3UDC A;  3JCM b;  1WJR A;  3D7S B;  2H3J A;  3OW2 A;  3C94 A;  1NLP C;  2BTT A;  1G3Y A;  3LX7 A;  5GAN f;  2MWP A;  2LMJ A;  4DBR A;  1W4S A;  1AWX A;  3VYG A;  1SEM A;  4JRQ A;  3F70 A;  3OYC A;  4DQ2 A;  4F16 A;  2AHJ B;  2KXC A;  4WTO B;  3EG9 A;  5FRM A;  2DXC A;  2CP6 A;  2DL5 A;  1HD3 A;  2BZ8 A;  2W0Z A;  2HDA A;  3JCM h;  1VQ4 A;  2JW4 A;  5GAN d;  3R6N A;  1C1A A;  1U1S A;  3CME Q;  2D9T A;  2LCC A;  3NTK A;  2ZPB B;  2LQN A;  3RR6 A;  3S3O A;  2X9H A;  4X34 A;  1YWP A;  3PGG A;  1N9R A;  2QEX A;  1G83 A;  5LJ3 j;  4C92 G;  3X26 B;  3SD4 A;  2H8H A;  1UDL A;  3JSC A;  3G4S Q;  3CBO A;  2J6O A;  3OS5 A;  2E4H A;  2DAQ A;  1YCY A;  3SHW A;  4M78 D;  1WYX A;  2KQW A;  2SEM A;  3QXE B;  5FW9 A;  5A0D A;  2J05 A;  4OB1 B;  4KT0 E;  4HCB A;  4RG8 A;  5CQY A;  2EYX A;  3OYB A;  4OB2 B;  1BIA A;  2PQW A;  3TRE A;  1WJS A;  2VYT A;  5IN1 A;  5CAI A;  4IIO A;  2M1H A;  2OTJ T;  4QW2 A;  4E7L A;  1QLY A;  3V7C A;  1VQL A;  2X4W A;  8ATC B;  3P8B B;  1S72 T;  2LX7 A;  4A54 A;  2E5K A;  2D8H A;  4LDY A;  1VQN T;  4PJO F;  2RPN A;  2J6K A;  5LJ3 e;  2F1L A;  4MZM A;  4J6X A;  4D6W A;  4HVW A;  1YFN A;  1VQ7 Q;  2FB7 A;  1T3S A;  1N6A A;  2E10 A;  2ROL A;  3HKS A;  4J7F A;  2J6F A;  5IHI A;  2PUK B;  3QYH B;  1WDX A;  3HL8 A;  3NPF A;  3RMS A;  5GAO m;  1QQJ A;  3JAM E;  1JJ2 S;  4BY6 C;  1VQ6 A;  1PRL C;  2P4T A;  1YBY A;  2RHZ A;  1U06 A;  5FLX E;  4QT7 A;  1ZQ1 A;  2MYS A;  1KD1 R;  1N5Z A;  2P4R A;  2BZX A;  2W10 A;  1WHJ A;  1BCM A;  1YHQ T;  2D0N A;  1PC0 A;  1IGQ A;  2KK4 A;  1MV3 A;  3OYG A;  3J80 E;  1QVP A;  2VXE A;  1VQL Q;  5GMK i;  5KYU A;  2RJC A;  3I56 Q;  3JCM f;  1X43 A;  1WHM A;  5CQX A;  3OW2 S;  2JM8 A;  3GP8 A;  4M78 A;  4B9W A;  1VYV A;  4XTY A;  1RUW A;  3R6O A;  1I5O B;  3RBB B;  4E7K A;  2XDP A;  2FRW A;  2LJ1 A;  2NUP A;  2J7I A;  4OMF B;  3MP6 A;  4PNO A;  1HSQ A;  5D6Y A;  2RHY A;  1M1K C;  2RQT A;  2K6D A;  1M3B A;  3INZ A;  1RI0 A;  4XQ3 A;  3DKM A;  4FYV B;  2HAX A;  3G71 T;  2X4Y A;  2DTO A;  1WGS A;  3C4S A;  1GRI A;  3E9F A;  5KYN A;  2HL3 A;  3OW2 P;  3Q1J A;  2LZ6 B;  2R5M A;  1VYU A;  1VQK Q;  3A8M B;  2DXT A;  1Y7X A;  2CS7 A;  3JCM c;  4RTT A;  3I56 A;  4IIM A;  2OTL T;  1VQN A;  2VGN A;  5LJ3 d;  2P84 A;  1HJD A;  2VXF A;  1TUD A;  4ZNX A;  2ZZD A;  5EC7 A;  4JRP A;  2DA9 A;  4Y28 E;  1D0Y A;  2EJF A;  2CSQ A;  2D6F A;  4Q5W A;  3JRZ A;  4M77 G;  1W2B A;  5LJ5 j;  2KGT A;  4XK8 E;  2GTO A;  4P5N A;  2E1H A;  2CP5 A;  2MPX C;  4JJD A;  4M7D D;  3P8H A;  2JTM A;  3EGX B;  1K8A R;  3RER A;  2EQK A;  4CRI A;  3CCS T;  1UHC A;  2GBQ A;  2PVD B;  2NYS A;  3GNF B;  2DVE A;  2CP7 A;  2KRO A;  3JCM X;  2RHI A;  5GAO q;  3CCV A;  1H92 A;  2FO0 A;  1UGS B;  1FX7 A;  3NHN A;  3MET A;  1M9S A;  3HP9 A;  4MML A;  4LNP A;  2K9G A;  2VAS A;  3LW5 E;  4D8D A;  2LNV A;  3PE0 A;  3E19 A;  2LRQ A;  1YWO A;  2GCX A;  3REA B;  4F14 A;  1WHG A;  1VQ4 T;  1AHJ B;  1VYT A;  5FU6 B;  4DOV A;  1NPP A;  3CD6 T;  2BKD N;  1B34 A;  2DIL A;  3SWN B;  2LP5 A;  3NTI A;  4M78 C;  1N9S A;  3ZFJ A;  1X01 A;  1ZX6 A;  4XU2 A;  1P92 A;  4F7U F;  2CDT A;  2ZPE B;  2L3P A;  5I21 A;  3QHS A;  4X9D A;  3RMQ A;  1VQO A;  1ZLM A;  2QQ9 A;  4HCC A;  2VWF A;  4N4I A;  1VQ7 A;  4BE1 A;  4N0A C;  3MJX A;  3JCM g;  4AFZ C;  2L89 A;  2FZK B;  4R0K A;  5HK0 A;  3EHQ A;  2HD0 A;  3LH0 A;  2PVO B;  2WSC E;  1VQ8 A;  2YRD A;  1WPY A;  2EYQ A;  3NFC A;  4F7U B;  3OYI A;  1PKT A;  2E70 A;  2QTX A;  5L23 A;  2IPO B;  3G71 Q;  4OMN A;  3LWI A;  3M4Y A;  5FU7 C;  2QAZ A;  3VS0 A;  4GY5 A;  4XTW A;  2QK0 A;  3EG3 A;  2ZPI B;  4XTU A;  4PLL A;  2CT3 A;  4PJN A;  3CXC A;  2ABL A;  4KBM B;  4OVA A;  4PFP A;  5FWC A;  1WQ7 A;  2KMT A;  3CCM A;  4C8Q F;  1K8A U;  4JPB W;  3OY9 A;  2CH4 W;  1BKB A;  3SB2 A;  5GAM h;  4Z8A A;  3SDZ A;  1MV0 B;  2OJ2 A;  2E65 A;  1PSF A;  3L1A A;  1TH7 A;  4C92 A;  2YRC A;  4ATO A;  1H3H A;  2RI3 A;  3RES A;  1AWO A;  8AT1 B;  2RHU A;  4M77 C;  1EFN A;  4A4K A;  1ABO A;  2E12 A;  2COZ A;  2LX9 A;  3WXM B;  2OAW A;  1VQ8 Q;  1A0N B;  2BIV A;  2F2X A;  4EMG A;  1ZUY A;  1SHG A;  4E6R A;  1PNJ A;  3RUX A;  2DD4 A;  1RAI B;  1E6G A;  3QZ5 B;  1WXU A;  5DLO A;  1ZSZ A;  5CIU A;  2LJ0 A;  4RTY A;  4M7A C;  3QO3 A;  1I4K 1;  1ZBX A;  1RAB B;  2DYI A;  4MZP A;  4AFS C;  1JB0 E;  5M9O A;  3G6E Q;  4ZGJ B;  2IG0 A;  2YLB A;  4C0D C;  4WF2 A;  3CEY A;  1BCO A;  2K5L A;  1SRL A;  1YJ9 Q;  2QDL A;  4E7Z A;  3E2U A;  1Q82 R;  3BY7 A;  2M0Y A;  1FWZ A;  2K2M A;  2FZG B;  2XIC A;  5C6S A;  3QPH A;  2KT1 A;  1QVG S;  2Y4Y A;  4ZN3 A;  1O75 A;  3QDR B;  5GAN 4;  5LJ5 e;  1BYM A;  3CCQ Q;  4QVD A;  5HCK A;  3MEW A;  4IUP A;  4EIK A;  1T0H A;  3RNJ A;  1SPK A;  4BDZ A;  4FW1 A;  3QWY A;  3QUI A;  2F5T X;  4OMM A;  3TCJ A;  2BE7 D;  4FYY B;  2HQE A;  2XU8 A;  3EFR A;  3JCM W;  2COW A;  3UF4 A;  2DX1 A;  3BDL A;  2EJG A;  2QGF B;  3EFO A;  3PIO A;  1Z9Q A;  2VKN A;  1PG5 B;  2ECZ A;  3CC2 Q;  3UA6 A;  2LCL A;  3FEO A;  2O88 A;  2DF6 A;  2MWO A;  2C0T A;  1MND A;  1IRE B;  1MHN A;  3ER0 A;  1UB4 A;  5KYW B;  1FYN A;  2LQK A;  1NEB A;  1NYF A;  2KVQ G;  2O4X A;  1QVF S;  1ZA2 B;  2LT1 A;  3C12 A;  4A63 B;  1T3L A;  2DVJ A;  1NBE B;  4EMH A;  4M75 G;  3EG9 B;  3A98 A;  1YHQ Q;  1UJ0 A;  4NL2 A;  3DB4 A;  2DL4 A;  3CME T;  5L8R E;  3VS6 A;  5GMK l;  1OQK A;  2RH2 A;  1KHC A;  1WX6 A;  3QYG B;  3HRS A;  3GPL A;  5J26 A;  3CMA A;  2KAF A;  4F17 A;  1K9A A;  3TQ7 P;  1ZBJ A;  3X20 B;  2FPE A;  1YIJ A;  1OPL A;  2QI2 A;  4A4E A;  1M1F A;  3X28 B;  4CC4 B;  3CCR Q;  4JUV A;  4RG2 A;  2E6Z A;  2DNU A;  3WVD B;  2EVR A;  3SEM A;  3E9G A;  2NLU A;  3P8D A;  3VS5 A;  2FPD A;  2DLP A;  5IHK A;  4LN2 A;  1QWF A;  1Q7Y R;  2EKO A;  1I5L A;  1QVG A;  1JJ2 A;  1M2V B;  2K5I A;  2QG9 B;  2AZV A;  3ASK A;  3M53 A;  4X1V A;  2AZS A;  1E6H A;  4JZ3 A;  4KRT A;  2YDL A;  3CC4 T;  2EQM A;  4O6J A;  1UGR B;  2B8A A;  2P0Q A;  1RAA B;  2KRN A;  1K73 U;  4AFU C;  4JDS A;  1OOT A;  2OI3 A;  4JJC A;  1YNZ A;  1BIB A;  1E7O A;  4RTZ A;  4HCK A;  2D0Q B;  4J9H A;  3TVT A;  2EPD A;  1PSE A;  1UEC A;  5FRO A;  2K3Y A;  4VUB A;  1QCF A;  3VS4 A;  4JJN K;  4ZTJ A;  5GAN 8;  4C8Q C;  3L2V A;  1PD1 A;  4F7U G;  1Q81 U;  3OS2 A;  2RB6 A;  1PKS A;  2DEU A;  4DEX A;  5GJW B;  4ESR A;  3JB9 F;  2MI6 A;  3FDR A;  1OPK A;  4JS4 A;  1I07 A;  1CKA A;  3C95 A;  4JJB A;  1VQM T;  2L8D A;  2HKN A;  1Y57 A;  4XTX A;  1FMK A;  2KNB B;  1V29 B;  4M4Z A;  1Y96 A;  2YUQ A;  2BZY A;  2CZ0 B;  3G4S A;  2DK3 A;  1VIE A;  4ORZ A;  5GAN 5;  1OX9 A;  4GBQ A;  1QCO A;  4PFO A;  2MIO A;  3ZEH A;  4FT4 A;  4KUD K;  3V7R A;  4E47 A;  3H6Z A;  2V26 A;  5GAO r;  1YIT A;  2HCK A;  4PKC C;  2QEX Q;  2KEA A;  4C5I A;  1XNI A;  4PJJ A;  1JJ2 P;  3GLX A;  2GF7 A;  4C0G A;  3M0T A;  3JCM Q;  4PJO E;  4BUG A;  1O9S A;  5A0G A;  1Y96 B;  5CO7 A;  2E64 A;  5CCA A;  4BI3 A;  3MP8 A;  3MCA B;  1RI9 A;  3PMI A;  5LJ3 h;  1KD1 C;  2I2L A;  3REB B;  4F7U A;  1TXQ A;  2IIM A;  4A53 A;  2HSE B;  1YJN A;  5KH6 A;  1IRX A;  5KYY A;  4XU1 A;  2JS2 A;  3CCJ Q;  2NWM A;  4AG1 C;  1CSK A;  1X2Q A;  1VQM A;  3CC4 Q;  2RJE A;  1RAF B;  3H41 A;  5GAM g;  2GNC A;  5D7U A;  2A0F B;  2ATC B;  4UC4 A;  1M30 A;  1YI2 T;  3S6W A;  2DJQ A;  2L2P A;  1XJW B;  1H3Z A;  1M4Z A;  1QCN A;  3SWN C;  4BD3 A;  4Z02 A;  1UGP B;  1PD0 A;  1ZSG A;  1Z9Z A;  2EQU A;  2E5Q A;  1IGU A;  2VVK A;  2OTL A;  4JS5 A;  1R77 A;  2GFA A;  4KUI A;  2YRV A;  1GBR A;  4OB3 B;  4E2F B;  3CPW S;  2OTJ Q;  3AHU A;  1QMC A;  2DKG A;  3MEU A;  3QJ6 A;  5CKB A;  3PVL A;  4C5H A;  3CBP A;  2A28 A;  1SHF A;  4L5G A;  3OYK A;  3EGX A;  4C5G A;  3CC7 Q;  5CKH A;  2HL5 C;  5IH2 A;  1QW1 A;  2A36 A;  2KE9 A;  4F7U E;  2QTV A;  2OX7 A;  2V8I A;  3OYF A;  1YIJ T;  1WZO A;  4YTL A;  1VIF A;  2KSS A;  3X25 B;  2QQB A;  2X35 A;  2A37 A;  5GJV B;  1QKX A;  4A4H A;  1YI2 Q;  1GCQ C;  3CMA T;  1AOJ A;  2QGG A;  2PUO B;  2RF0 A;  1F1B B;  4LDV A;  4BY6 B;  4IUT A;  3M58 A;  1UEB A;  3ULR B;  1VQN Q;  3M59 A;  1W6X A;  1AT1 B;  3CCL T;  1VOM A;  4AG2 C;  3A8O B;  5FWB A;  3L2W A;  2MCN A;  5LJ5 d;  1WXB A;  2YUO A;  4OGE A;  3JB9 G;  2QYZ A;  4C8Q E;  2VV5 A;  4N4H A;  2RHX A;  3ZBD A;  3CC7 A;  3PIP A;  5HY6 A;  2EFI A;  4EPC A;  5GAN 2;  1OUL A;  2DM1 A;  3M0S A;  1QVF P;  4J9D A;  4RTV A;  1G2B A;  4J8O A;  4ELY C;  1BB9 A;  3VJP A;  2B86 A;  1YJW T; 
#chains in the Genus database with same CATH homology
 5GAN 7;  2GFU A;  3L2R A;  2L89 A;  2EAY A;  5HK0 A;  2HD0 A;  3LH0 A;  2PVO B;  2WSC E;  1VQ8 A;  4PJO A;  1WPY A;  2EYQ A;  1VQ9 A;  4EMK B;  3GF5 A;  4M7D G;  3NFC A;  4F7U B;  1S72 A;  4PJO D;  2EJ9 A;  4QVC A;  4RMO A;  3S3M A;  3OYI A;  1VQ9 T;  1KD1 U;  3M56 A;  3QII A;  1Q86 C;  2E70 A;  2QTX A;  4M75 B;  2PU9 B;  4L6V 5;  2CYZ B;  5CKE A;  5LJ5 h;  3LWI A;  2JVV A;  3UT1 A;  3M4Y A;  3BDU A;  5FU7 C;  5GAM e;  4HCZ A;  2BUD A;  5KE3 A;  3A8H B;  4M77 B;  1YJ9 A;  3A5Z B;  3URG A;  4GY5 A;  4XTW A;  5GMK m;  4XTU A;  2XK0 A;  2ZPI B;  2DJZ A;  1VQK T;  4PLL A;  1YI2 A;  3LLR A;  4RCB A;  3CXC A;  1KQ2 A;  4KBM B;  4OVA A;  4M7A D;  1VQO T;  5KE2 A;  4M7A G;  1WQ7 A;  2KMT A;  4MDW A;  2RD1 A;  4C8Q F;  2A7Y A;  3OY9 A;  3CCE A;  3CCM A;  1K8A U;  3CC4 A;  1G5V A;  4JRK A;  1OYX A;  4MDX A;  5CKF A;  4M75 F;  1OZ2 A;  2YHT A;  4C5E A;  4PJO B;  1NE8 A;  3DLL A;  4XTZ A;  3FRN A;  4N0A A;  2E41 A;  3CC7 T;  4HA8 A;  1NPR A;  5CR2 A;  1VQ5 T;  1BKB A;  1K9M U;  2P0P A;  2EWN A;  2CZ7 B;  3SB2 A;  3SDZ A;  4C92 F;  5GAM h;  3CCQ A;  3CCJ T;  2X4X A;  1D3B A;  2LC4 A;  3A8L B;  4C92 D;  2MF2 A;  4M7D A;  3OMG A;  4DOW A;  4PJO C;  1LJO A;  1K8A C;  4EDU A;  3HFO A;  2EIF A;  1OI1 A;  2E65 A;  1PSF A;  3L1A A;  1TH7 A;  3BW1 A;  4QQ6 A;  5AYF A;  4C92 A;  1M90 U;  4ATO A;  2RI3 A;  2QQS A;  3RES A;  3CCL A;  2RHU A;  3JCM J;  5J3B A;  4M77 C;  3FB9 A;  5GAN 6;  4A4K A;  4RCC A;  2E12 A;  3EAE A;  2K2V A;  5FU7 B;  2QDY B;  2XI9 A;  2LX9 A;  1MGQ A;  3LYI A;  2FL7 A;  4IUQ A;  2O4X B;  3WXM B;  5GAN g;  4RKU E;  3HFN A;  3QSU A;  1NZ9 A;  3L2Z A;  2JTF A;  4NOY A;  2LDM A;  1I8F A;  1B34 B;  2BIV A;  4C92 B;  4EMG A;  5GAM f;  5IT9 E;  3RUX A;  2MAM A;  3SFM A;  3OYL A;  2DIG A;  2CKK A;  2K5F A;  2O01 E;  2DD4 A;  1D3B B;  3OS0 A;  3QZ5 B;  5GAM j;  5DLO A;  5LJ5 f;  4J6Y A;  5CIU A;  2V8J A;  3RKY A;  3OSS C;  5GMK h;  4M7A C;  3HRT A;  4L59 A;  3QO3 A;  2HBP A;  5I2S A;  1I4K 1;  1RL2 A;  1ZBX A;  4MZP A;  4Y91 A;  3PTA A;  1FXX A;  2M16 A;  3ME9 A;  1JB0 E;  3QBY A;  5M9O A;  4M75 E;  1XQH A;  3LGF A;  3MEA A;  2ZCF B;  3OBW A;  4KUL A;  3PNW C;  1VUB A;  4LDU A;  1XTD A;  4ZGJ B;  2IG0 A;  2YLB A;  1Q81 C;  3VKI A;  4C0D C;  3G4S T;  4WF2 A;  3CEY A;  2K5L A;  2RI5 A;  1Y07 A;  4M75 D;  2E6N A;  2EQJ A;  4M77 A;  3OYD A;  1U1T A;  2Y4X A;  3BY7 A;  2XHC A;  1I81 A;  1FWZ A;  1KC8 U;  2RA2 A;  3E1S A;  4M78 E;  2XIC A;  5C6S A;  3GOX A;  5DM7 R;  4OP0 A;  3FJP A;  5C0M A;  3QPH A;  1ZHI A;  1U8R A;  1QVG S;  2Y4Y A;  2L5Q A;  1OZ3 A;  2JUF A;  1O75 A;  4ZN3 A;  4A4F A;  1K9M C;  3QDR B;  2XDD A;  5GAN 4;  3LGL A;  5LJ5 e;  2CGH A;  2RM4 A;  2RK1 A;  3L2U A;  1BYM A;  4QVD A;  1KC8 C;  1QP3 A;  4QQG A;  3G6E A;  3MEW A;  2DTH A;  2DXU A;  2ZPG B;  3M9Q A;  4IUP A;  4R55 A;  3CCU T;  4MZT A;  4J7I A;  3UDC A;  3LWH A;  4BDZ A;  4E7H A;  4C0F A;  3JCM b;  2L3R A;  1WJR A;  5EG2 A;  2H3J A;  3QUI A;  2F5T X;  3S3N A;  4ZN1 A;  3OW2 A;  3CCU A;  2G3R A;  3C94 A;  4XAX B;  2RI2 A;  4FT2 A;  2DTI A;  1VQ8 T;  3TCJ A;  1G3Y A;  2A3L A;  4PJO G;  2HQE A;  3LX7 A;  5KCH A;  3PFS A;  5D6X A;  2VGM A;  5CVI A;  2XU8 A;  5HKC A;  3EFR A;  5GAN f;  1NJI C;  2MMP A;  3JCM W;  2MWP A;  1W4S A;  3JCM e;  4A4G A;  3BDL A;  2EJG A;  3CCR A;  3PIO A;  3VYG A;  2JOY A;  5I2M A;  4JRQ A;  3CC2 T;  3F70 A;  5HK3 A;  4JLI A;  2LCL A;  3FEO A;  3OYC A;  4DQ2 A;  2AHJ B;  3RKX A;  4IUV A;  2CZ1 B;  2MWO A;  2JZ2 A;  4M78 F;  5FRM A;  3QG1 A;  1IRE B;  2DEQ A;  2DXC A;  1MHN A;  2OAU A;  1UB4 A;  3ER0 A;  3OSV A;  4BI8 B;  4N4G A;  1M5Q 1;  2KVQ G;  2LQK A;  2O4X A;  3OYM A;  3CD6 A;  1QVF S;  2LT1 A;  2F69 A;  3C12 A;  4M75 C;  3JCM h;  4GLK A;  1VQ4 A;  3HRU A;  3SWN A;  5GAN d;  4II1 A;  4EMH A;  2V8K A;  4M75 G;  2DD5 A;  4FM4 B;  4EMK C;  2KDS A;  5A2Q E;  1U1S A;  4NL2 A;  4M7D B;  4ZGD B;  3DB4 A;  2D9T A;  1N27 A;  3CME T;  5L8R E;  2QEX T;  2LCC A;  5GMK l;  2RH2 A;  3NTK A;  1WNL A;  4XTV A;  1KHC A;  2ZPB B;  3HHT B;  3QYG B;  1JBM A;  3X24 B;  3HRS A;  3GPL A;  1KG1 A;  2K57 A;  3S3O A;  5J26 A;  3CMA A;  1Y71 A;  4X34 A;  2KAF A;  3PGG A;  2R58 A;  1N9R A;  2QEX A;  3CME A;  3KBG A;  2RK2 A;  3V8J A;  1KHI A;  1XOV A;  2FHD A;  3X20 B;  5LJ3 j;  4M7D F;  1YIJ A;  4C92 G;  3X26 B;  2QI2 A;  4A4E A;  1KQS A;  1M1F A;  3X28 B;  3QKJ A;  3SD4 A;  3MP1 A;  4FSX A;  4JUV A;  4RG2 A;  3JSC A;  3TU4 K;  2E6Z A;  3CBO A;  3WVD B;  4O5V A;  1YHQ A;  5GAN e;  3OS5 A;  4C0Z A;  2DXB A;  2DAQ A;  1YCY A;  4M77 D;  3E9G A;  2NLU A;  3P8D A;  4M78 D;  3MHX A;  4IUU A;  2QQR A;  4M75 A;  3MO8 A;  3CCJ A;  2KQW A;  3VU3 C;  4E7I A;  5GAN h;  3QXE B;  5A0D A;  2EKO A;  1K73 C;  1I5L A;  4EMK A;  1QVG A;  3GNG A;  1JJ2 A;  4BDY A;  4OB1 B;  2K5I A;  4KT0 E;  3ASK A;  3M53 A;  5D6W A;  5FU6 C;  4HCB A;  3OYJ A;  1VQ6 T;  4RG8 A;  4M7A A;  5CQY A;  1YIT A;  3OYB A;  2XD0 A;  4OB2 B;  1BIA A;  3JB9 H;  2PQW A;  1G3W A;  3OA6 A;  3CC2 A;  1LNX A;  3TRE A;  1WJS A;  3CC4 T;  3CCM T;  2EQM A;  2QXF A;  2VYT A;  4O6J A;  5IN1 A;  5CAI A;  1UGR B;  2B8A A;  3G6E T;  4M7A E;  2P0Q A;  2VUB A;  1K73 U;  1VQK A;  3JCM d;  4JDS A;  2M1H A;  2OTJ T;  2XG8 D;  2K4Y A;  4QW2 A;  5GMK e;  3KXT A;  1WQW A;  4E7L A;  5GAO l;  2VC8 A;  1BIB A;  3V7C A;  2XID A;  1VQL A;  2X4W A;  2D0Q B;  1Q7Y C;  2ZPF B;  4BB7 A;  3P8B B;  3I55 T;  1VQP T;  1BI1 A;  3DLM A;  1PSE A;  1S72 T;  5FRO A;  2K3Y A;  4VUB A;  3M5A A;  3MEV A;  2FYK A;  4A54 A;  4JJN K;  4FIB A;  4ZTJ A;  4LDY A;  1VQN T;  4M7D E;  5GAN 8;  4C8Q C;  4PJO F;  4OF1 A;  3L2V A;  5LJ3 e;  3M4G A;  3L2Q A;  4MZM A;  2M9U A;  4J6X A;  4F7U G;  1Q81 U;  4D6W A;  3GIB A;  2OTJ A;  3OS2 A;  4FL6 A;  2RB6 A;  3JCM P;  2FB7 A;  1VQ7 T;  2E10 A;  1JRI A;  1N6A A;  3KUF A;  5LJ5 g;  4IKF A;  3HKS A;  4J7F A;  3OS1 A;  2PUK B;  2MI6 A;  4M78 G;  3JB9 F;  3QYH B;  3FDR A;  3HL8 A;  3RMS A;  3JB9 J;  4JS4 A;  3QJY A;  5GAO m;  1WJQ A;  2QQA A;  2C06 A;  3OYN A;  3C95 A;  3JAM E;  1JJ2 S;  4LDW A;  1VQM T;  2L8D A;  4BY6 C;  2Y90 A;  1VQ6 A;  1GXI E;  2P4T A;  4XTX A;  1YBY A;  4IUR A;  2RHZ A;  4TVR A;  1BI0 A;  1V29 B;  1G3S A;  1Y96 A;  3PMT A;  5FLX E;  5GAN 3;  4XU0 A;  1ZQ1 A;  2CZ0 B;  3G4S A;  1N8R U;  2DK3 A;  1VIE A;  5GAN 5;  1YJN T;  4C8Q G;  4M7A F;  4OB0 B;  1Q82 C;  2HNI A;  1YHQ T;  2WSE E;  1EIF A;  4FT4 A;  3ZEH A;  4KUD K;  3V7R A;  4E47 A;  3H6Z A;  1G3T A;  2KK4 A;  3JB9 I;  2ZPH B;  5LJ3 f;  1UGQ B;  3OYG A;  4PKC C;  3J80 E;  4BE2 A;  5GAO r;  4C5I A;  1QVP A;  3JB9 D;  4BAC A;  2VXE A;  1M8V A;  1XNI A;  5GMK i;  2XDB A;  2DIQ A;  2LVM A;  2RJC A;  3RKW A;  3GLX A;  2GF7 A;  1QP2 A;  3OQ5 A;  3JCM f;  4C0G A;  5CQX A;  1NJI U;  1HXD A;  3JCM Q;  3OW2 S;  4PJO E;  3L42 A;  4QVZ A;  5J39 A;  4BUG A;  1O9S A;  3O8V A;  4M78 B;  5A0G A;  1Y96 B;  4M78 A;  2E64 A;  5CO7 A;  4B9W A;  4XTY A;  4C0D B;  5CCA A;  4BI3 A;  3OMC A;  3R6O A;  3MP8 A;  2DZ9 A;  3MCA B;  4E7K A;  3PMI A;  2R57 A;  1R8O B;  2QA4 A;  1YIT T;  3CCS A;  3FLG A;  5LJ3 h;  2XDP A;  1KD1 C;  3VV0 A;  2I2L A;  1Q86 U;  4F7U A;  2K3X A;  3OYH A;  3HPW A;  4OMF B;  4A53 A;  2ZGW A;  3MP6 A;  4PNO A;  5D6Y A;  1YJN A;  2RHY A;  5KH6 A;  5GAN j;  1M1K C;  1W2B S;  4XU1 A;  2X4J A;  4M7D C;  1KQ1 A;  3INZ A;  3H8Z A;  3CCQ T;  3M55 A;  4ME7 A;  2M0O A;  3RIR A;  4V2S A;  1RI0 A;  4C8Q D;  4XQ3 A;  1VQM A;  2PVG B;  2RJF A;  3DKM A;  2HAX A;  4M77 E;  2RJE A;  3EFS A;  3FIF A;  5IAY A;  3G71 T;  5GAM g;  2X4Y A;  2LTO A;  3PT9 A;  2DTO A;  1WGS A;  3C4S A;  4XU3 A;  3V8K A;  3CCE T;  4PLI A;  4UC4 A;  4JRI A;  4BE0 A;  5DY9 A;  4LDX A;  3E9F A;  3CCR T;  1BI2 A;  3VUB A;  3QZ9 B;  3CBM A;  2LT4 A;  3T9N A;  3S6W A;  3Q1J A;  1YI2 T;  1X75 C;  2R5M A;  3GP8 A;  1YJ9 T;  4B9X A;  1H64 1;  4ELZ C;  1H3Z A;  1M4Z A;  2GQV A;  2DXT A;  1Y7X A;  3A8M B;  3SWN C;  2CS7 A;  3JCM c;  4BD3 A;  3CPF A;  3I56 A;  1M90 C;  1HK9 A;  2OTL T;  1BI3 A;  4Z02 A;  1VQN A;  1UGP B;  2LQ8 A;  2VGN A;  5LJ3 d;  3JCM V;  3BFM A;  4E7J A;  4ZTF A;  4NS5 A;  4QQD A;  2EQU A;  2E5Q A;  4C8Q B;  3I55 A;  1VQP A;  2R5A A;  2VXF A;  4X9C A;  3CXC S;  1M1G A;  4M7A B;  1SSF A;  5A0L A;  2ZZD A;  2OTL A;  5GAO n;  4JS5 A;  3I56 T;  2GFA A;  3FC3 A;  1VQL T;  4FU6 A;  4HKE A;  3UWN A;  1X6O A;  4KUI A;  4JRP A;  2YRV A;  5CK9 A;  1YJW A;  4OB3 B;  3CPW S;  2P0K A;  3AHU A;  4C92 C;  4Y28 E;  1KQS S;  2DKG A;  3MEU A;  3QJ6 A;  4LD6 A;  5CKB A;  2EJF A;  2KY9 A;  4C5H A;  3CBP A;  3G71 A;  4PL6 A;  3CPW A;  2D6F A;  4Q5W A;  2WAC A;  4L5G A;  3JRZ A;  1DJ7 B;  4M77 G;  5DLQ E;  1W2B A;  5LJ5 j;  1QVF A;  3OYK A;  2IVW A;  4M77 F;  3OB9 A;  5FRN A;  4C5G A;  4DA4 A;  4XK8 E;  4P5N A;  5CKH A;  4MMK A;  1M1K U;  4OGC A;  1QW1 A;  5GMK j;  5LJ3 g;  2E1H A;  4F7U E;  4M7D D;  2XKO C;  3DB3 A;  3P8H A;  4CI0 C;  2V8I A;  2JTM A;  4R56 A;  1YJW T;  3RER A;  2DPP B;  2EQK A;  3OYF A;  4CRI A;  3OYA A;  3CCS T;  1YIJ T;  4YTL A;  2QA4 T;  1VIF A;  2KSS A;  2F5K A;  2JN0 A;  3X25 B;  2QQB A;  2X35 A;  3N5B B;  2RJD A;  2PVD B;  3GNF B;  2FVU A;  3TEE A;  2DVE A;  4A4H A;  3J7A F;  5CKD A;  3VUZ A;  3JCM X;  2RHI A;  5GAO q;  2RO0 A;  3OYY A;  3CCV A;  3CMA T;  3CCV T;  2PUO B;  1UGS B;  4LDV A;  1FX7 A;  4IUT A;  4BY6 B;  3MET A;  3HSB A;  1M9S A;  3HP9 A;  4MML A;  4HT8 A;  2YLC A;  3LW5 E;  2LNV A;  3M57 A;  2DO3 A;  3M58 A;  4BI4 A;  1UEB A;  3E19 A;  5LL6 S;  2LRQ A;  3M59 A;  2GCX A;  4HT9 A;  4C8Q A;  3M54 A;  3CCL T;  4J5Y A;  4ZGE B;  2CZ6 B;  3A8O B;  3L2W A;  1VQ4 T;  1AHJ B;  5FU6 B;  3A8G B;  3J81 E;  2DZC A;  4DOV A;  3WVE B;  1NPP A;  1N8R C;  3NTH A;  5LJ5 d;  2BKD N;  3CD6 T;  1B34 A;  3OBY A;  4OGE A;  1LOJ A;  3JB9 G;  4C8Q E;  2WSF E;  3SWN B;  2VV5 A;  1Q82 U;  4J6W A;  4N4H A;  4LD9 K;  3NTI A;  4M78 C;  1N9S A;  2RHX A;  3ZBD A;  1VQ5 A;  3ZFJ A;  2HQX A;  3CC7 A;  1X01 A;  4XU2 A;  4NL3 A;  3PIP A;  1P92 A;  3G7Z A;  5GAO p;  2JNG A;  4F7U F;  5HY6 A;  4J83 A;  3V8L A;  3UPU A;  1Q7Y U;  2ZPE B;  2EFI A;  4C92 E;  4EPC A;  3QHS A;  1IZ6 A;  4X9D A;  5I21 A;  5GAN 2;  3RMQ A;  3VYH B;  1VQO A;  2QQ9 A;  3V7S A;  4HCC A;  5KCO A;  4N4I A;  1VQ7 A;  4BE1 A;  4N0A C;  4ELY C;  4J8O A;  3VJP A;  3JCM g;  5GAM d;  4JLG A;  3OYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...