4JJNK

Crystal structure of heterochromatin protein sir3 in complex with a silenced yeast nucleosome
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
213
structure length
205
Chain Sequence
AKDLDGWQVIITDDQVIDDNNRRRSRKENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSNEYLKRVSVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3
publication title Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 205
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4jjnK00
4KUDK 4FSXA 4DOVA 4DOWA 4JJNK 1ZHIA 3TU4K 1M4ZA 4KULA 4DA4A 1W4SA 3PTAA 1ZBXA 3PT9A 4BB7A 4LD9K 2FVUA 4FT2A 4FT4A 4KUIA 2FL7A
chains in the Genus database with same CATH superfamily
3T9NA 2QXFA 2KY9A 1KJWA 1YJWA 2ABLA 3GBQA 2C0TA 2QEXT 4A63B 3I5RA 4LDXA 5A0LA 2JW4A 5CKHA 5AT1B 1R8OB 3UA7A 1BYMA 3G4SQ 2YUQA 3QWYA 4EIKA 1BBZA 2EJ9A 1PRMC 3QDRB 4R56A 4KH0B 3TCJA 5HK3A 4J9CA 2C0IA 2XG8D 1QKWA 2V8IA 4ZGDB 1YHQT 4M75G 5D6WA 2KQWA 2CS7A 2YDLA 3FIFA 3TREA 2DL5A 1X2KA 1JRIA 1W4SA 2H8HA 1JXOA 2M16A 4LD9K 2GQVA 3CPFA 3HTRA 2F5TX 4KRTA 3H9NA 1X27A 2YLCA 3JSCA 1IRXA 2D1XA 3CCST 1OPLA 1M1KU 4DOWA 1YCSB 2EGCA 2E5QA 1D1AA 2BUDA 4KT0E 4IUVA 1BB9A 3J81E 4AG1C 3FLGA 1GXIE 2WSEE 4BE2A 5KYYA 3NTHA 1ZUKA 1PKSA 3G1JA 2K3BA 1RLPC 1NYGA 1IGUA 2GTOA 2DD5A 1Q82R 4NL3A 2HKQB 4E7SA 3OS5A 3RKWA 2HAXA 5KYWA 3H0IA 3L2WA 1G3TA 1WA7A 2QEXA 2R5MA 4A53A 3HSBA 2M0OA 4FW1A 1IXDA 3RR6A 1SF9A 2JTEA 4DBHA 3VYHB 1K73C 4FSXA 2CP5A 1M3BA 2WSFE 2HZYA 4IUQA 3RESA 4C0GA 4IIMA 2LT1A 4M7AB 1AWOA 1BI2A 4XK8E 1B34A 3CBMA 3JCMP 1OPKA 5GMKm 3LWIA 2LJ1A 1I81A 4PJOB 2BE7D 1XOVA 1NJIR 1WPYA 1KIKA 2DE0X 1H3HA 4EMKA 2EVRA 2MWPA 4LXCA 3MEVA 4AFSC 2QYZA 5LJ3j 3VRYA 3CC2Q 1VQ9T 5IXFA 3G4ST 4PJMA 1VQKT 1G2BA 3PIOA 2KBTA 1VQMQ 3MEUA 3URGA 2KYMA 1M4ZA 3OYEA 2AKLA 1BK2A 3SWNB 2C0OA 4E2FB 4C92B 1S1NA 3FB9A 2DFUA 3PMIA 3JCMf 1QCNA 2FL7A 5FU6B 1UJ0A 4Y91A 2D8JA 1W2BS 2CREA 2AHJB 1VQNQ 1RLQC 3M53A 4PJLA 4JRQA 2LCLA 1R0CB 1OQKA 1QLYA 1A0NB 3UPUA 5KYXB 1GCPA 4Y92A 5GAMj 3N5BB 4M78E 2O4XA 1YNZA 4AFQC 2LRQA 1EIFA 4BI4A 4PJJA 3A8HB 3FEOA 4DEXA 4LUEA 2RH2A 3P8DA 1ZSZB 2MCNA 3L1AA 3MP8A 3JCMg 2RI5A 3V8LA 1OOTA 3E2UA 2EPDA 4OMLA 2MF2A 5D7UA 2V8KA 2WACA 1SEMA 3JCMW 2FPDA 4HT8A 1PCXA 3HRTA 1HXDA 1MMGA 1VUBA 4LDVA 3OBWA 3VRZA 5GAOl 1WHJA 1ZUYA 2YRDA 2OTJT 3MEWA 1VQ9A 2VWFA 4FCYA 3G4SA 3OYFA 1VQKA 2DX1A 1MUZA 1WHMA 3M59A 2K4YA 2L3PA 5GANf 5KYWB 2WSCE 1VQ5Q 3QHSA 1MNEA 2QI2A 1WDXA 4F14A 5C6SA 4QKUA 1U1TA 1Y57A 1C1AA 1TUGB 2ZPHB 3UA6A 3DB3A 3BY7A 4XU3A 1QW1A 1RL2A 1MNDA 2VKNA 4OB0B 1VIFA 2L3RA 3CC2T 1ZA1B 3S3MA 5HCKA 3OYBA 2P4TA 2ZZDA 3A5ZB 2HKNA 1K9MR 5L8RE 3CMAT 4J7FA 5I22A 3GPLA 3OYJA 3JCMb 3NFCA 1YN8A 4EMKB 1E7OA 3HP9A 3M0SA 1AWJA 5GAOp 2X9HA 5CKEA 3TU4K 1TTHB 2A28A 2RA2A 1V1CA 4NOYA 5GANg 4FYYB 3WVEB 2CZ1B 2DXCA 3KFVA 1VQNT 2HBWA 4J5YA 4YTLA 2LQKA 4XTXA 2BIVA 1I5OB 2JMAA 3CMEQ 2CZ0B 1AWWA 3RKXA 4HVWA 4M7DB 5LJ3h 2FRYA 3JB9H 3V7RA 3I56Q 3VUBA 3EFOA 1VQPQ 2DIQA 4D8KA 2YT6A 3M0RA 1E6HA 3EG3A 2K79A 2FB7A 4X1VA 2A08A 4LD6A 1N8RC 2NUPA 1H92A 1MHNA 2KRMA 3MO8A 2J05A 4MZTA 2DTIA 3MP1A 4DEYA 5GAOq 3GNGA 3A98A 5LJ3g 1WGSA 4FM4B 2H3JA 4M78A 5GAN2 1CKAA 2ECZA 2IG0A 1QCOA 2DZCA 3C0CA 3UWNA 1K0XA 3RMSA 1M90C 1TXQA 2DVJA 2E6NA 4HKEA 3QIIA 2QTXA 5GAMh 4J83A 1I8FA 4O5VA 3J80E 3CC2A 5A0GA 1YJWQ 4MMKA 5IHNA 3OYHA 2COYA 2NUZA 2DXBA 3WVDB 1U3OA 2CT3A 4PK4A 3CMAA 4GLMA 2YSQA 3PVQA 2P4RA 3THKA 1M1KR 3UT1A 3VYGA 4BE0A 3TQ7P 2CH4A 2EYWA 3LWHA 1JBMA 1UFFA 1IZ6A 5GAMg 2NLUA 1XTDA 3VV0A 3JCMe 1VQNA 4D8DA 1RAIB 1UGQB 4M77B 2JS2A 3NPFA 4OGEA 2ROLA 4J9EA 4M75A 2K7AA 4J9FA 2RHUA 2K9GA 4EDUA 1KQSS 1B3QA 3LH0A 3HL8A 4M7AE 1KG1A 1RADB 3RDVA 2AZVA 1Y96A 2CSIA 5D6YA 2DL4A 1YFNA 4PJOE 1VQ6Q 2XMFA 2E4HA 3CMET 2HCKA 1RACB 2MPXC 2JZ2A 2O88A 2RJDA 2E41A 1I4K1 3S3OA 1AZEA 3EGDB 4MDWA 2ED1A 4A4GA 2CGHA 3QYGB 2DXTA 4XTYA 5IHKA 3C4SA 1Q95G 2EWNA 4QT7A 4C92E 2DJZA 1ZBJA 4KGXB 1M8VA 3OS1A 2VVKA 3QPHA 4M7AD 1VQ5A 3TSWA 1K1ZA 2MK5A 2GNCA 5GANe 1YJNT 5C0MA 3CD6Q 2NUPB 1E6GA 3RMQA 2RHZA 4B9WA 1G3WA 4PJOD 3X25B 3G6EQ 3L2UA 4PFZA 1N8RU 4E7ZA 3JB9D 3UDCA 3OYDA 1WXUA 2PNIA 2XICA 1KD1U 4RG2A 5CKBA 2F5KA 3KBGA 1YHQQ 2BZXA 4NL2A 2X4WA 1PHTA 3VKIA 5D6XA 3OYKA 4RCBA 4QQGA 3CC7Q 2DILA 3RIRA 1YBYA 3OMCA 1SSFA 5FU7C 4B6MA 1G83A 1MMNA 2CP0A 4C92D 2DL3A 2GGRA 4FW2A 1Y0MA 2HSPA 3CCQT 5FRMA 4BDZA 3CCSQ 4MMLA 1OU8A 1CSKA 1PKTA 3EFSA 3LGFA 5GAOr 3ASKA 3EG1A 2X3WD 3CMEA 5GAOm 2X4XA 3CC4Q 4OGCA 1IO6A 3H0HA 4PNOA 1FMWA 5KH6A 1K8AU 4M7AF 3S6WA 5CAIA 1JU5C 3M54A 1GCQC 4E7JA 2DPPB 2Y90A 2KVQG 3OS0A 2KMTA 2E3HA 2DJQA 1H641 4PJOF 4M78G 3OA6A 3I55T 1VQ6T 2I2LA 1JO8A 1WLPB 3RBBB 2EQMA 4CC2A 2IVWA 2K6DA 2QASA 3CXCS 1TH7A 1PC0A 1ZLMA 1M2VA 2F2VA 1Z9QA 1AHJB 3MPUB 3OB9A 1Q81C 5GAN4 1QVPA 2X51A 2DD4A 4A4EA 4Z89A 1W2BA 1KC8C 2IIMA 2A37A 4JZ3A 3DB4A 4QW2A 4C92F 2LQNA 2P0PA 2SEMA 2X35A 1VQ7T 3V8KA 4XQ3A 2J6FA 1QP2A 1SG5A 3X28B 1VQ9Q 1N5ZA 4J9GA 1VQKQ 1JQQA 1BIBA 3VS4A 3M0TA 3CD6T 2HL3A 2FEIA 3G6ET 4M7AC 1JJ2S 1WJQA 4M7DE 1YWOA 1TS9A 1S72T 4WTOB 3OYLA 2CZ6B 3H0FA 4C8QE 3TSZA 2RF0A 3EG9B 4PJOC 2HDAA 5I11A 2QK0A 3HRSA 3CC7T 4A4HA 2HBPA 4A4FA 3V7CA 1X6BA 3X20B 2MMPA 4IUUA 1KHIA 3BE3A 5GJVB 1PSEA 4TVRA 3H6ZA 3SWNC 2RQWA 2AKKA 1JB0E 4C92C 4PLIA 3I55A 1VQ6A 4O6JA 2LCCA 5FU6C 2RD1A 4M7DD 2JNGA 3QO3A 2ZCFB 3CC4T 5J26A 1M30A 2LCSA 4C8QD 2CUDA 4OMFB 2LJ3A 1PWTA 4J6YA 2HSEB 4KGVB 2LVMA 1B07A 1RI0A 4C0DB 5EG2A 1M2OA 2RI2A 2BE9B 1XJWB 2DRMA 4XTWA 2RHXA 2ENMA 3CCVT 1WHHA 1VQ7A 2P0QA 2XHCA 3JCMV 2OTJQ 1X75C 2FPFA 2KT8A 5CVIA 2CP2A 3GIBA 1YCYA 1ABOA 3GNFB 1ZSZC 2CT4A 1NM7A 5M9OA 3CD6A 4M77E 4WF2A 1W2BP 3FJ5A 4HA8A 3SHWA 2PUKB 1IB8A 3G6EA 2JM8A 2K3YA 2EFIA 1YHQA 3R6NA 2OTLT 5KYUB 1OYXA 1M2VB 3OYCA 4R55A 1LOJA 1FWZA 3HRUA 3CC7A 1RUWA 5KYNA 5IXBA 5IT9E 1QCFA 4JZ4A 5KCHA 1AD5A 1IHVA 2DYBA 3CMAQ 3VS5A 1OI1A 3VS3A 2MI6A 2RJFA 4K11A 4M7DF 1YITT 1Q86R 1UGVA 4PLLA 2HL5C 4C8QF 4ME7A 3CCSA 4BDYA 3REBB 1G5VA 1RAHB 4OMNA 1M27C 2RHIA 3E1SA 2F2WA 2QDYB 1X6GA 3E9FA 4M77D 3VU3C 4QQDA 2NYSA 2D6FA 4QVZA 2QG9B 2E6ZA 2Y4YA 3CC4A 2DMOA 3L42A 1WJSA 4RTXA 2YUPA 1U5SA 3JCMd 4QQ6A 2Z0WA 5IN1A 2KT1A 2DZ9A 1NZ9A 2KEAA 2KNBB 2CYZB 3L2RA 4J9HA 1KQ2A 4F7UE 1N6AA 4E6RA 4RTUA 2CDTA 3CCVA 2E64A 2OX7A 2ED0A 4HCCA 4OB1B 1I0CA 2LNVA 1WHKA 2GFAA 1KD1R 4FT2A 3EH2A 3C12A 2PZ1A 4M7DC 5DM7R 1UEBA 4IURA 5KYYB 1Q82C 1K0SA 4C8QC 4ZGEB 1AWXA 5KCOA 2OTLA 2XDPA 4LDWA 4HVUA 2LQWA 3SEMA 2V26A 7AT1B 1PG5B 2QA4T 4BUGA 3VS0A 1UE9A 3J7AF 5I21A 2FG0A 4M77F 4ORZA 1KQSA 2VXEA 2MOXA 4EMGA 5DLQE 2GQIA 3MCAB 2O9SA 3OW2A 2RN8A 1YITA 3CPWA 1XNIA 2K2MA 1Y71A 5LL6S 5DY9A 2DIGA 4HCBA 1VQLQ 3GF5A 2M9UA 3EGUA 2K57A 5GANd 1K73U 2LZ6B 1B34B 1K8AR 1NJIC 4KUIA 2DL8A 4RMOA 4ZTJA 4JS5A 3L2ZA 3M4YA 1YI2Q 2RPNA 4II1A 2E3IA 3QSUA 3QDFA 1BCOA 4R0KA 3CCUT 2EAYA 5LJ3f 3ZFJA 1U8RA 1IHWA 2FVUA 3BFMA 1Q7YR 1VYUA 2CSQA 3NGPA 5HK0A 1OX9A 2E5KA 4OMMA 3PGGA 2FPEA 2EKHA 3LGLA 1UHCA 3M57A 1VQ4Q 4M77C 4CC3A 2DL7A 3JAME 1JXMA 2OJ2A 4DBFA 3DLMA 4F7UF 2L2PA 1FXXA 4ESRA 2PUOB 3PIPA 2RO0A 1NEGA 2YRCA 2ATCB 2OTJA 2O4XB 5GAMf 1GFDA 1HK9A 2ZPFB 1VYVA 2YRVA 2HEQA 5GMKi 3A8GB 2DRKA 1TU0B 4E7IA 1DJ7B 1I1JA 3I9QA 1YJNQ 4OP0A 2L89A 2RQTA 3QG1A 2A0FB 5CR2A 3M9QA 4LDUA 1LVKA 1BI0A 1D3BA 1UGSB 2RB6A 3OMGA 4LNPA 3RUXA 1KQSP 1KQ1A 5LJ5j 3ZL7C 3OW2P 4RCCA 2HNIA 3OBYA 3CPWP 1Q82U 2QGFB 1WQWA 3C95A 3LH5A 2JXBA 4E7HA 1QWEA 2OAUA 2MAMA 1VQLT 4JPBW 2FZGB 4FL6A 2D9TA 3CCUA 3H8ZA 2QTVA 4BY6B 3G71T 1QVGA 2LC4A 1W6XA 1Y07A 1PD1A 4L59A 3CCQQ 1HD3A 3LLRA 4BI3A 5GAN8 3BDLA 3M0UA 1UECA 5CK9A 4M7DG 4MZMA 2OI3A 2KDSA 1TSFA 5CQYA 4KULA 4XU1A 2SRCA 1BI1A 4C8QG 4JRPA 1PNJA 3PTAA 5IHIA 1YI2T 3QZ5B 4HVVA 3CEYA 1AVZC 4AMCA 2X4YA 3A1PA 3UATA 1RABB 1K9MC 3RERA 2QDLA 4FYWB 1SKUB 4XTZA 4RG8A 2F2XA 8ATCB 1LJOA 1UGPB 2PVGB 1NJIU 3EGXA 1FMKA 2RNAA 2K5LA 1YIJT 3I55Q 1KFZA 1VQ4T 3UF4A 4ZTFA 4HXJA 3MP6A 5GMKj 1JJ2A 4FIBA 1LPLA 3CCET 2EYZA 3VS2A 3FC3A 4DBRA 3KUFA 3ME9A 3ER0A 1TUDA 5GAN6 1AOJA 4XTUA 5J39A 1G8XA 4EMHA 8AT1B 1EX4A 2P84A 1BIAA 2M02A 4C5GA 3PT9A 2JT4A 2PVDB 2M1HA 3HPWA 4N4HA 2OAWA 1VQ7Q 1MMAA 3EFOB 1P92A 2L5QA 5CO7A 2O31A 2RJEA 5FRNA 1EFNA 4BD3A 4BI8B 3E19A 4L5GA 2M51A 1VQLA 4M77G 1S72Q 4J9BA 1C6VX 3AHUA 1T0JA 3EHQA 2G6FX 4M78B 3V8JA 2ZPBB 3JCMc 3HFOA 4KUDK 1YI2A 3VS1A 4XU0A 1M90U 2DBKA 3SD4A 2VASA 3IQLA 4L6V5 3RNJA 2KAFA 1GCQA 1KHCA 1QVGP 2QQAA 1HJDA 4MZPA 3META 4Q5WA 4ZN3A 3MKDA 1WXTA 2O9VA 3F70A 3NTIA 5LJ3e 4CC7A 3PMTA 2LQ8A 3EH1A 4AG2C 4IKFA 1VQ4A 2L0AA 1GBQA 1ZHIA 2PU9B 3CCEA 1RAGB 4RTVA 1M8MA 4KGZB 1QVFS 2FO0A 2DA9A 5LJ5h 1QMCA 3NTKA 4PKCC 4KBMB 4M75B 3JB9F 1YP5A 1T3SA 2O2OA 4JRIA 3PE0A 2HQXA 1WI7A 3QBYA 1JJ2P 3CCVQ 1LNXA 3HFNA 4J9DA 2YUOA 2M0YA 4F7UG 1I07A 4AT1B 1UJYA 2RHYA 5GAMe 2X3XD 5FLXE 1Y96B 1YJNA 3M55A 1NLPC 2KXCA 2E65A 4LE9A 5LJ5g 4FT4A 1K73R 1X43A 4M7AA 4QVDA 1HYOA 2R58A 4C5HA 1XQHA 4RUGA 1WYXA 1ZX6A 1K9AA 4J8OA 2OTLQ 4PJOA 2D0QB 2JUFA 1FX7A 1N9SA 4Z8AA 1M3AA 5EC7A 4BACA 2A7YA 3LX7A 2E10A 3E9GA 4BB7A 1V29B 4JJDA 2CH4W 4EPCA 2AK5A 5GMKh 1NPPA 2EKOA 1MV0B 1YITQ 4HCKA 2COWA 2DM1A 3SWNA 3CCQA 1C0MA 2EIFA 5FU7B 4C92A 1UG1A 2DERA 3CQTA 3M0QA 3CCRQ 2GBQA 2EBPA 4ELZC 2E1HA 1PSFA 4C0ZA 4DA4A 1NBEB 2DAQA 2DO3A 3KXTA 3G7ZA 2F69A 5FWBA 1R0BG 1FMVA 2R5AA 2NWMA 5KYXA 2CUBA 4QVCA 3VS7A 3OYAA 1EZZB 1RAFB 3ZEHA 2W0ZA 3EHRA 5I2MA 3OYIA 2DXUA 3M5AA 2LNHB 1W70A 1ABQA 3L2QA 4J6WA 1FYNA 4VUBA 3VJPA 2VYTA 1IREB 3VS6A 5HKCA 1YJ9T 1ZSZA 3GP8A 4KH1B 1MV3A 2EW3A 2DEQA 2RMOA 2DETA 4OMOA 3A8LB 1GBRA 1V76A 1G3SA 2QA4Q 2J6OA 3RKYA 1UGRB 4RTWA 4XTVA 3P8HA 2EQJA 4A4KA 1X2QA 2BTTA 5GAN3 2QQBA 5GANj 2EQIA 4XAXB 4C0FA 2LT4A 4C5IA 3SB2A 3A8MB 4LUDA 1T0HA 4JLIA 1S72A 1UUEA 3LW5E 3O8VA 5FW9A 1NPRA 2DTOA 1Q81U 4CRIA 3OYGA 1KC8U 3P8BB 4FYVB 2VGNA 5A0DA 2ZPEB 1WQ7A 4UC4A 3HKSA 2DK3A 2YLBA 4IIOA 2FYKA 2FHDA 1OV3A 1WFWA 1NE8A 1F1BB 2BZ8A 1K4US 3CCUQ 2K5IA 2HQHA 1WXBA 2XK0A 3CCRT 2GTJA 4ATOA 2RQRA 4OVAA 2ZPGB 3A8OB 2FZCB 6AT1B 5LJ5e 2ZPIB 3TEEA 2VV5A 2VC8A 2PQWA 2NUTA 2VGMA 1YJ9A 4E47A 3CCJQ 1BI3A 4M7DA 1N27A 3S3NA 4EMKC 2V8JA 2JM9A 4C8QA 2J06A 1H8KA 1TWBA 2L3QA 2LTOA 2EGEA 1X69A 2B86A 1D1BA 2EJFA 2KSSA 3JCMh 4M7AG 4GY5A 2HQEA 2EGAA 2J6KA 2XI9A 2CP3A 1MGQA 1N8RR 4LDYA 2XIDA 1WHLA 5CCAA 3MJXA 4PJOG 3CBOA 3JB9G 2BZYA 2JTMA 2GFUA 1VIEA 2CKKA 3OYMA 5GAN5 2K5FA 4JJBA 4ANJA 2A3LA 3QJYA 4JDSA 2XDDA 1M90R 4B9XA 2KK4A 4OB3B 5GMKe 1R77A 4RTYA 3FRNA 3QJ6A 3JV3A 2DKGA 3O5ZA 2DEUA 4C92G 3I5SA 3PNWC 1WHGA 2HMAA 2LX9A 2B8AA 4OMQA 4F16A 2DLPA 1U06A 3DLLA 4JJNK 1VQ8Q 4M78D 3G71Q 4ELYC 3CCRA 3X24B 3BW1A 4F17A 2FRWA 4BE1A 4M75E 2L8DA 1GRIA 2LMJA 4E7LA 1O75A 2RK1A 4M77A 1TG0A 3V7SA 2EYXA 2EJGA 1ZSGA 2XD0A 1TUCA 5GANh 2DNUA 1M9SA 1D1CA 1I5LA 3L2VA 1ACMB 1SHGA 4ZGJB 4BY6C 1ZBXA 2ZAEA 1WZOA 1Q86C 1RAEB 4AFUC 1VQMT 2JMCA 4PFPA 4J6XA 1JEGA 3OQ5A 4V2SA 2L3SA 2RM4A 1U1SA 4DBQA 2YXYA 1PRLC 5CKDA 1YIJQ 1NLOC 3CCJT 1O9SA 1NG2A 3U23A 2G3RA 3GOXA 4E7KA 4PJNA 1Y7XA 2PTKA 3CBPA 2KI7A 3EFRA 5LJ3d 3OSVA 3CCEQ 5GAOn 1LCKA 2D0NA 2KROA 2VUBA 1QQJA 4NS5A 2Y4XA 3SDZA 2C06A 4MDXA 4M75D 3EGDA 2NUTB 1OULA 2PVOB 2KRSA 1X01A 3PFSA 3OSSC 2QA4A 5FWCA 1RI9A 4IUPA 1M1FA 4M78F 2KXDA 2E12A 5IAYA 4LN2A 2KYBA 4C8QB 1IGQA 1H3ZA 4JUVA 1VQOQ 4X9DA 2QAZA 1UTIA 2JN0A 3QWXX 2EQUA 3CCMQ 4Z02A 1RAAB 2XU8A 3WXMB 2JVVA 4X9CA 1BKBA 1T3LA 3JRZA 2JS0A 1KD1C 3SFMA 1ZUUA 4F7UA 5GAMd 3H41A 2CP6A 1ZA2B 3QKJA 1QVFA 2CZ7B 3CCLQ 1VOMA 3INZA 3JCMX 2BKDN 2DTHA 3AT1B 3REAB 1HSQA 1QP3A 3JCMQ 4J9IA 3TVTA 1VQ8T 1NYFA 1CKBA 1X6OA 3CXCA 2DYIA 3M0PA 5IH2A 2MIOA 4Y28E 1D0YA 1VQMA 4HT9A 1AEYA 4M75F 2V1RA 2EYQA 2RK2A 1VQ5T 1QKXA 4M78C 3CCJA 1MMDA 3QUIA 4OMPA 1BU1A 3JB9I 3BDUA 1TOVA 1OZ3A 1K8AC 4DOVA 3D7SB 4PL6A 1WIEA 2JJ9A 1M1GA 3MHXA 3ZBDA 2P0KA 2JTFA 2COZA 2YUNA 2EYYA 4J7IA 5GMKl 2KE9A 5DLOA 3R6OA 3NHNA 1GFCA 1SSHA 1Q7YC 1SRMA 3OYNA 4X34A 3DKMA 3MEAA 2O01E 2ROTA 4JRKA 3OW2S 3PVLA 2VXFA 1Q86U 3CPWS 4CI0C 2EQKA 1Q81R 4DQ2A 3OS2A 3EAEA 1KC8R 1UHFA 4PFOA 4OB2B 3LYIA 3EG0A 1Z9ZA 4M75C 3M4GA 3EG2A 2DVEA 5KE3A 3I56T 1J3TA 2RJCA 1VQOT 2AT1B 2KR3A 5HY6A 1VQPT 4AFZC 5CKFA 3CCMT 2DF6A 2RI3A 9ATCB 3QXEB 1SHFA 1D0ZA 1PM3A 1VQ8A 2YHTA 2H3EB 4P5NA 3X26B 3C94A 5J3BA 3G71A 3NMZC 3FDRA 2QEXQ 1B7TA 3OYYA 1M5Q1 1OZ2A 1SPKA 2X4JA 2GCXA 5CQXA 3I35A 1UDLA 1QVFP 3CCLT 3FJPA 1BCMA 3EG9A 2GF7A 1WX6A 4N0AA 3JB9J 1GL5A 4F7UB 2HD0A 2CP7A 4WCIA 4GLKA 2RQUA 3Q1JA 5A2QE 2LJ0A 1D0XA 2MYSA 1D3BB 4ZN1A 3JCMJ 1YJWT 4HCZA 5GAN7 3QYHB 4JS4A 3CXCP 1M1KC 2LP5A 2AIRB 1OX8A 1OEBA 5FROA 3M58A 1PD0A 1K76A 2VB6A 3QZ9B 4A54A 5CIUA 1YIJA 1NEBA 2K3XA 2QQRA 4FSSA 4OF1A 5I2SA 5LJ5f 2I0NA 2K2VA 2QQSA 1UB4A 1YWPA 4FYXB 4N0AC 5ECAA 2XKOC 2W10A 4C5EA 4CC4B 2ZGWA 1YJ9Q 1D09B 2QGGA 5LJ5d 4Z88A 4JJCA 2QQ9A 5KE2A 3M56A 4RTTA 2FZKB 2MWOA 1VYTA 4GBQA 2RQVA 5L23A 1VA7A 1ZQ1A 1AT1B 2E70A 2ESWA 4F04B 3I56A 2DBMA 1W1FA 4M4ZA 4RKUE 1VQOA 2YWWA 1N9RA 2LDMA 1KSWA 2AZSA 4ZNXA 1VQPA 2F1LA 1K9MU 3CCMA 3ULRB 1M3CA 3EGXB 1SRLA 2KRNA 4FU6A 3OY9A 1QWFA 4IUTA 2KGTA 1ARKA 1WNLA 1WJRA 5GJWB 1QVGS 2R57A 2IPOB 4C0DC 4N4IA 5KYUA 3CCLA 1Q7YU 1KK7A 1OU9A 2A36A 2JOYA 3HHTB 4D6WA 2LX7A 4JLGA 3GLXA 4RTZA 2D8HA 5AYFA 3VUZA 2XDBA 4N4GA 2J7IA 1G3YA 2V1QA 4XU2A 1AZGB
chains in the Genus database with same CATH topology
3T9NA 2QXFA 2K5IA 3S3OA 2KY9A 2XK0A 3LGLA 3M57A 4MDWA 3CCRT 1YJWA 4ATOA 4OVAA 4M77C 4A4GA 2CGHA 2ZPGB 2QEXT 3QYGB 2DXTA 3A8OB 3JAME 4XTYA 4LDXA 5LJ5e 5A0LA 2ZPIB 3TEEA 2VV5A 2VC8A 2PQWA 5CKHA 3C4SA 2EWNA 1R8OB 1BYMA 2VGMA 1YJ9A 4E47A 3DLMA 4F7UF 4C92E 1FXXA 2DJZA 2EJ9A 2PUOB 1M8VA 3OS1A 1BI3A 3QDRB 4R56A 3PIPA 4M7DA 1N27A 2RO0A 3QPHA 4EMKC 3S3NA 3TCJA 4M7AD 5HK3A 1VQ5A 2V8JA 2XG8D 2V8IA 2OTJA 4ZGDB 4C8QA 2O4XB 5GANe 1YHQT 1YJNT 4M75G 5D6WA 5C0MA 5GAMf 3RMQA 2KQWA 2RHZA 4B9WA 2LTOA 1G3WA 4PJOD 1HK9A 2ZPFB 2CS7A 3X25B 3L2UA 2YRVA 5GMKi 1N8RU 3FIFA 3JB9D 2EJFA 2KSSA 3TREA 3UDCA 3A8GB 3OYDA 3JCMh 4E7IA 4M7AG 4GY5A 1DJ7B 2XICA 1KD1U 4RG2A 2HQEA 5CKBA 2F5KA 1JRIA 3KBGA 1W4SA 2XI9A 1MGQA 2M16A 4LDYA 4NL2A 4OP0A 2X4WA 4LD9K 2XIDA 2GQVA 3CPFA 3VKIA 2L89A 3QG1A 5D6XA 5CCAA 4PJOG 2F5TX 3CBOA 5CR2A 3JB9G 3OYKA 4RCBA 4QQGA 3M9QA 2JTMA 2YLCA 4LDUA 2GFUA 1YBYA 1VIEA 3JSCA 3OMCA 3RIRA 1SSFA 2CKKA 5FU7C 3OYMA 1UGSB 1D3BA 1BI0A 2RB6A 3OMGA 3RUXA 5GAN5 2K5FA 3CCST 4DOWA 1M1KU 2E5QA 2A3LA 4C92D 3QJYA 1KQ1A 2BUDA 4JDSA 4KT0E 5LJ5j 2XDDA 4IUVA 3J81E 4B9XA 2KK4A 3FLGA 1GXIE 4OB3B 2WSEE 5GMKe 3CCQT 5FRMA 4BDZA 4RCCA 2HNIA 3OBYA 4BE2A 1Q82U 3FRNA 3NTHA 3QJ6A 1WQWA 3C95A 4MMLA 4E7HA 2DKGA 2OAUA 2MAMA 3EFSA 3LGFA 1VQLT 5GAOr 4FL6A 2D9TA 3CCUA 4C92G 3H8ZA 4BY6B 2DD5A 3G71T 3ASKA 3PNWC 4NL3A 1QVGA 2LX9A 2B8AA 2LC4A 3CMEA 1Y07A 5GAOm 4L59A 3LLRA 3OS5A 4BI3A 5GAN8 3BDLA 3DLLA 3RKWA 4JJNK 5CK9A 4M7DG 2X4XA 4MZMA 2HAXA 4OGCA 2KDSA 4PNOA 4M78D 5CQYA 4KULA 4XU1A 4ELYC 1BI1A 5KH6A 1K8AU 4C8QG 3CCRA 3X24B 4JRPA 4M7AF 3S6WA 5CAIA 3L2WA 3BW1A 1G3TA 3M54A 3PTAA 2QEXA 2R5MA 4E7JA 1YI2T 4A53A 3HSBA 2DPPB 2M0OA 2KVQG 2Y90A 3OS0A 3QZ5B 2KMTA 4BE1A 4M75E 3CEYA 2L8DA 1H641 2X4YA 4PJOF 3VYHB 4E7LA 1O75A 2RK1A 4FSXA 4M78G 3OA6A 3I55T 1K73C 1K9MC 2I2LA 4M77A 1VQ6T 4XTZA 3V7SA 4RG8A 2EQMA 2WSFE 4IUQA 2EJGA 1VQNT 3RESA 4C0GA 2IVWA 1LJOA 2LT1A 4M7AB 3CXCS 2XD0A 1TH7A 1UGPB 1BI2A 2PVGB 4XK8E 1B34A 3CBMA 5GANh 1NJIU 3JCMP 2K5LA 1M9SA 1YIJT 1I5LA 5GMKm 3L2VA 3LWIA 1AHJB 1I81A 3OB9A 1Q81C 5GAN4 4ZGJB 1QVPA 1VQ4T 4ZTFA 1XOVA 4PJOB 4BY6C 1WPYA 1ZBXA 3MP6A 2DD4A 4A4EA 1VQMT 5GMKj 1W2BA 1Q86C 4FIBA 1KC8C 1JJ2A 4J6XA 4EMKA 3OQ5A 4V2SA 2MWPA 3CCET 2RM4A 1U1SA 3MEVA 5CKDA 3DB4A 5LJ3j 4QW2A 3FC3A 4C92F 1VQ9T 3G4ST 1VQKT 3KUFA 3PIOA 3CCJT 1O9SA 3ME9A 3ER0A 5GAN6 2G3RA 2P0PA 3GOXA 3MEUA 4E7KA 1Y7XA 2X35A 3URGA 1VQ7T 3CBPA 4XTUA 3V8KA 5J39A 3EFRA 5LJ3d 3OSVA 4XQ3A 5GAOn 1QP2A 1M4ZA 2VUBA 4NS5A 3OYEA 3X28B 2Y4XA 4EMHA 3SWNB 3SDZA 2C06A 4MDXA 1BIAA 4M75D 1BIBA 4C5GA 3PT9A 3CD6T 4C92B 2PVDB 2M1HA 3FB9A 3HPWA 4N4HA 3PMIA 3JCMf 2PVOB 3G6ET 1P92A 1X01A 3PFSA 2FL7A 2L5QA 3OSSC 5FU6B 5CO7A 2QA4A 4Y91A 4IUPA 4M7AC 1W2BS 2RJEA 1JJ2S 1WJQA 5FRNA 4M7DE 1M1FA 4BD3A 4M78F 2AHJB 4BI8B 1S72T 3OYLA 2CZ6B 2E12A 3E19A 3M53A 4L5GA 5IAYA 2LCLA 4C8QE 4JRQA 1VQLA 4C8QB 4PJOC 1H3ZA 4JUVA 4X9DA 3UPUA 2JN0A 3HRSA 4M77G 3CC7T 2EQUA 4A4HA 5GAMj 4Z02A 2HBPA 4A4FA 3V7CA 3N5BB 4M78E 2XU8A 3X20B 2O4XA 3WXMB 3AHUA 2JVVA 2MMPA 4X9CA 1BKBA 3JRZA 4M78B 3V8JA 4IUUA 2ZPBB 1KD1C 3SFMA 3HFOA 2LRQA 3JCMc 4F7UA 4KUDK 1EIFA 1KHIA 1PSEA 5GAMd 4TVRA 4BI4A 3H6ZA 1YI2A 3RERA 4XU0A 1M90U 3A8HB 3FEOA 3SWNC 3QKJA 1QVFA 2RH2A 3SD4A 1JB0E 2CZ7B 3P8DA 4L6V5 4C92C 4PLIA 3I55A 1VQ6A 2KAFA 4O6JA 1KHCA 3L1AA 3INZA 2QQAA 2LCCA 3MP8A 2BKDN 3JCMg 3JCMX 2RI5A 5FU6C 3V8LA 2DTHA 2RD1A 1QP3A 4MZPA 2MF2A 3JCMQ 2V8KA 3META 4Q5WA 1VQ8T 4ZN3A 4M7DD 2JNGA 2WACA 3F70A 2ZCFB 3NTIA 3QO3A 5J26A 5LJ3e 3CC4T 3JCMW 4HT8A 3HRTA 3PMTA 1X6OA 3CXCA 2LQ8A 4C8QD 4IKFA 1HXDA 1VQ4A 4OMFB 1VUBA 4LDVA 4Y28E 4J6YA 3OBWA 1VQMA 4HT9A 4M75F 5GAOl 2EYQA 1ZHIA 2RK2A 2LVMA 2PU9B 3CCEA 1VQ5T 1RI0A 2OTJT 3MEWA 4C0DB 4M78C 1VQ9A 3G4SA 3OYFA 1QVFS 1VQKA 3CCJA 5EG2A 3M59A 3QUIA 5LJ5h 2K4YA 2RI2A 3NTKA 3JB9I 4PKCC 4XTWA 2RHXA 4KBMB 5GANf 3CCVT 3BDUA 1VQ7A 2WSCE 1OZ3A 2P0QA 2XHCA 3JCMV 3QHSA 1K8AC 4M75B 4DOVA 1X75C 5CVIA 3GIBA 2QI2A 3JB9F 1YCYA 4PL6A 3GNFB 3MHXA 1M1GA 4JRIA 3ZBDA 5C6SA 5M9OA 1U1TA 2P0KA 3CD6A 2JTFA 4M77E 2HQXA 3QBYA 2ZPHB 3DB3A 3BY7A 4WF2A 4XU3A 1LNXA 1QW1A 2PUKB 1RL2A 3HFNA 4HA8A 4F7UG 3G6EA 4OB0B 1VIFA 2RHYA 5GAMe 2L3RA 3CC2T 3S3MA 2K3YA 5FLXE 2EFIA 4J7IA 1YHQA 1Y96B 5GMKl 3M55A 1YJNA 3OYBA 2P4TA 2OTLT 2ZZDA 3A5ZB 2E65A 5LJ5g 1OYXA 5DLOA 4FT4A 5L8RE 3R6OA 4J7FA 3OYCA 3CMAT 4R55A 4M7AA 1Q7YC 3GPLA 1LOJA 3OYJA 3OYNA 4X34A 1FWZA 3DKMA 3HRUA 4QVDA 3JCMb 2R58A 3NFCA 3MEAA 4C5HA 3CC7A 4EMKB 1XQHA 2O01E 3HP9A 4JRKA 3OW2S 5IT9E 4J8OA 5KCHA 2VXFA 1Q86U 4PJOA 3CPWS 5GAOp 4CI0C 2D0QB 2JUFA 5CKEA 1FX7A 3TU4K 1N9SA 2EQKA 1OI1A 2MI6A 4DQ2A 2RJFA 2RA2A 3OS2A 4BACA 3EAEA 4M7DF 2A7YA 3LX7A 4NOYA 5GANg 1YITT 2E10A 3E9GA 4OB2B 3LYIA 3WVEB 4PLLA 2CZ1B 2DXCA 1V29B 4M75C 4BB7A 4C8QF 4J5YA 3M4GA 4ME7A 4YTLA 3CCSA 4BDYA 2DVEA 2LQKA 5KE3A 3I56T 4EPCA 1G5VA 4XTXA 2RJCA 5GMKh 3E1SA 2RHIA 2BIVA 1VQOT 1NPPA 2EKOA 5HY6A 2CZ0B 2QDYB 3E9FA 4M77D 5CKFA 3VU3C 1VQPT 4QQDA 3CCMT 3RKXA 2RI3A 3SWNA 5LJ3h 3CCQA 3QXEB 2D6FA 4M7DB 4QVZA 2EIFA 2E6ZA 2Y4YA 5FU7B 1VQ8A 3V7RA 4C92A 3JB9H 2YHTA 3CC4A 4P5NA 3X26B 3C94A 3L42A 5J3BA 3VUBA 1WJSA 3G71A 4ELZC 2E1HA 1PSFA 3FDRA 4C0ZA 2DIQA 4DA4A 3JCMd 3OYYA 4QQ6A 5IN1A 1M5Q1 2FB7A 1OZ2A 2DAQA 1NZ9A 2DZ9A 2GCXA 2X4JA 2DO3A 5CQXA 4LD6A 1N8RC 3KXTA 3G7ZA 2F69A 3CCLT 2CYZB 3FJPA 3L2RA 2GF7A 1MHNA 2R5AA 1KQ2A 4F7UE 4N0AA 3MO8A 1N6AA 3JB9J 4MZTA 2DTIA 2HD0A 4F7UB 3MP1A 4QVCA 5GAOq 3GNGA 3OYAA 5LJ3g 4GLKA 3CCVA 2E64A 4HCCA 3ZEHA 1WGSA 4FM4B 3Q1JA 2H3JA 4M78A 5I2MA 5A2QE 3OYIA 4OB1B 5GAN2 2DXUA 3M5AA 4ZN1A 1D3BB 3JCMJ 1YJWT 2IG0A 2LNVA 4HCZA 3L2QA 2DZCA 3QYHB 3UWNA 5GAN7 4JS4A 4J6WA 3RMSA 1M90C 1M1KC 2GFAA 4FT2A 3C12A 2E6NA 4HKEA 3QIIA 2QTXA 5GAMh 4J83A 5FROA 3M58A 1I8FA 4O5VA 4VUBA 3VJPA 3J80E 5DM7R 2VYTA 4M7DC 1UEBA 3QZ9B 1IREB 5HKCA 4IURA 4A54A 1YJ9T 5CIUA 1YIJA 3CC2A 2QQRA 2K3XA 4OF1A 5A0GA 4MMKA 5I2SA 5LJ5f 3OYHA 3GP8A 1Q82C 2K2VA 2QQSA 4C8QC 2DXBA 3WVDB 4ZGEB 5KCOA 1UB4A 2DEQA 2OTLA 2XDPA 4LDWA 4N0AC 2XKOC 3CMAA 2QA4T 4BUGA 3A8LB 4C5EA 3UT1A 2ZGWA 3VYGA 4BE0A 3J7AF 5I21A 1G3SA 4M77F 1KQSA 2VXEA 4EMGA 3LWHA 5DLQE 1JBMA 5LJ5d 1IZ6A 3MCAB 3RKYA 2QQ9A 5KE2A 5GAMg 2NLUA 3M56A 1UGRB 4XTVA 3OW2A 2MWOA 3P8HA 2EQJA 1YITA 4A4KA 1XTDA 3CPWA 1XNIA 3VV0A 5GAN3 2QQBA 1ZQ1A 5GANj 3JCMe 1Y71A 1VQNA 5LL6S 5DY9A 2DIGA 4XAXB 4HCBA 2E70A 4C0FA 2LT4A 4C5IA 1UGQB 3GF5A 3I56A 2M9UA 4M77B 3SB2A 3A8MB 4OGEA 4RKUE 1VQOA 1N9RA 2K57A 2LDMA 1K9MU 1VQPA 5GANd 1K73U 4JLIA 3CCMA 4M75A 1S72A 1B34B 3LW5E 3O8VA 1NJIC 2RHUA 4KUIA 4FU6A 4EDUA 3OY9A 4RMOA 1KQSS 4ZTJA 4IUTA 4JS5A 3LH0A 3HL8A 4M7AE 3L2ZA 3M4YA 1NPRA 1KG1A 1WNLA 2DTOA 1WJRA 1Q81U 1QVGS 4CRIA 3OYGA 2R57A 4II1A 4C0DC 1KC8U 3P8BB 1Y96A 3QSUA 5D6YA 2VGNA 4N4IA 3CCUT 5A0DA 3CCLA 1Q7YU 2ZPEB 4PJOE 1WQ7A 4UC4A 3HKSA 3CMET 2JOYA 2EAYA 2DK3A 3HHTB 2YLBA 5LJ3f 4D6WA 3ZFJA 2FYKA 3GLXA 4JLGA 2FHDA 1U8RA 5AYFA 1NE8A 2FVUA 3BFMA 3VUZA 2XDBA 2JZ2A 4N4GA 1G3YA 5HK0A 2RJDA 4XU2A 2E41A 3PGGA 1I4K1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUD K;  4FSX A;  4DOV A;  4DOW A;  4JJN K;  1ZHI A;  3TU4 K;  1M4Z A;  4KUL A;  4DA4 A;  1W4S A;  3PTA A;  1ZBX A;  3PT9 A;  4BB7 A;  4LD9 K;  2FVU A;  4FT2 A;  4FT4 A;  4KUI A;  2FL7 A; 
#chains in the Genus database with same CATH topology
 3T9N A;  2QXF A;  2KY9 A;  1KJW A;  1YJW A;  2ABL A;  3GBQ A;  2C0T A;  2QEX T;  4A63 B;  3I5R A;  4LDX A;  5A0L A;  2JW4 A;  5CKH A;  5AT1 B;  1R8O B;  3UA7 A;  1BYM A;  3G4S Q;  2YUQ A;  3QWY A;  4EIK A;  1BBZ A;  2EJ9 A;  1PRM C;  3QDR B;  4R56 A;  4KH0 B;  3TCJ A;  5HK3 A;  4J9C A;  2C0I A;  2XG8 D;  1QKW A;  2V8I A;  4ZGD B;  1YHQ T;  4M75 G;  5D6W A;  2KQW A;  2CS7 A;  2YDL A;  3FIF A;  3TRE A;  2DL5 A;  1X2K A;  1JRI A;  1W4S A;  2H8H A;  1JXO A;  2M16 A;  4LD9 K;  2GQV A;  3CPF A;  3HTR A;  2F5T X;  4KRT A;  3H9N A;  1X27 A;  2YLC A;  3JSC A;  1IRX A;  2D1X A;  3CCS T;  1OPL A;  1M1K U;  4DOW A;  1YCS B;  2EGC A;  2E5Q A;  1D1A A;  2BUD A;  4KT0 E;  4IUV A;  1BB9 A;  3J81 E;  4AG1 C;  3FLG A;  1GXI E;  2WSE E;  4BE2 A;  5KYY A;  3NTH A;  1ZUK A;  1PKS A;  3G1J A;  2K3B A;  1RLP C;  1NYG A;  1IGU A;  2GTO A;  2DD5 A;  1Q82 R;  4NL3 A;  2HKQ B;  4E7S A;  3OS5 A;  3RKW A;  2HAX A;  5KYW A;  3H0I A;  3L2W A;  1G3T A;  1WA7 A;  2QEX A;  2R5M A;  4A53 A;  3HSB A;  2M0O A;  4FW1 A;  1IXD A;  3RR6 A;  1SF9 A;  2JTE A;  4DBH A;  3VYH B;  1K73 C;  4FSX A;  2CP5 A;  1M3B A;  2WSF E;  2HZY A;  4IUQ A;  3RES A;  4C0G A;  4IIM A;  2LT1 A;  4M7A B;  1AWO A;  1BI2 A;  4XK8 E;  1B34 A;  3CBM A;  3JCM P;  1OPK A;  5GMK m;  3LWI A;  2LJ1 A;  1I81 A;  4PJO B;  2BE7 D;  1XOV A;  1NJI R;  1WPY A;  1KIK A;  2DE0 X;  1H3H A;  4EMK A;  2EVR A;  2MWP A;  4LXC A;  3MEV A;  4AFS C;  2QYZ A;  5LJ3 j;  3VRY A;  3CC2 Q;  1VQ9 T;  5IXF A;  3G4S T;  4PJM A;  1VQK T;  1G2B A;  3PIO A;  2KBT A;  1VQM Q;  3MEU A;  3URG A;  2KYM A;  1M4Z A;  3OYE A;  2AKL A;  1BK2 A;  3SWN B;  2C0O A;  4E2F B;  4C92 B;  1S1N A;  3FB9 A;  2DFU A;  3PMI A;  3JCM f;  1QCN A;  2FL7 A;  5FU6 B;  1UJ0 A;  4Y91 A;  2D8J A;  1W2B S;  2CRE A;  2AHJ B;  1VQN Q;  1RLQ C;  3M53 A;  4PJL A;  4JRQ A;  2LCL A;  1R0C B;  1OQK A;  1QLY A;  1A0N B;  3UPU A;  5KYX B;  1GCP A;  4Y92 A;  5GAM j;  3N5B B;  4M78 E;  2O4X A;  1YNZ A;  4AFQ C;  2LRQ A;  1EIF A;  4BI4 A;  4PJJ A;  3A8H B;  3FEO A;  4DEX A;  4LUE A;  2RH2 A;  3P8D A;  1ZSZ B;  2MCN A;  3L1A A;  3MP8 A;  3JCM g;  2RI5 A;  3V8L A;  1OOT A;  3E2U A;  2EPD A;  4OML A;  2MF2 A;  5D7U A;  2V8K A;  2WAC A;  1SEM A;  3JCM W;  2FPD A;  4HT8 A;  1PCX A;  3HRT A;  1HXD A;  1MMG A;  1VUB A;  4LDV A;  3OBW A;  3VRZ A;  5GAO l;  1WHJ A;  1ZUY A;  2YRD A;  2OTJ T;  3MEW A;  1VQ9 A;  2VWF A;  4FCY A;  3G4S A;  3OYF A;  1VQK A;  2DX1 A;  1MUZ A;  1WHM A;  3M59 A;  2K4Y A;  2L3P A;  5GAN f;  5KYW B;  2WSC E;  1VQ5 Q;  3QHS A;  1MNE A;  2QI2 A;  1WDX A;  4F14 A;  5C6S A;  4QKU A;  1U1T A;  1Y57 A;  1C1A A;  1TUG B;  2ZPH B;  3UA6 A;  3DB3 A;  3BY7 A;  4XU3 A;  1QW1 A;  1RL2 A;  1MND A;  2VKN A;  4OB0 B;  1VIF A;  2L3R A;  3CC2 T;  1ZA1 B;  3S3M A;  5HCK A;  3OYB A;  2P4T A;  2ZZD A;  3A5Z B;  2HKN A;  1K9M R;  5L8R E;  3CMA T;  4J7F A;  5I22 A;  3GPL A;  3OYJ A;  3JCM b;  3NFC A;  1YN8 A;  4EMK B;  1E7O A;  3HP9 A;  3M0S A;  1AWJ A;  5GAO p;  2X9H A;  5CKE A;  3TU4 K;  1TTH B;  2A28 A;  2RA2 A;  1V1C A;  4NOY A;  5GAN g;  4FYY B;  3WVE B;  2CZ1 B;  2DXC A;  3KFV A;  1VQN T;  2HBW A;  4J5Y A;  4YTL A;  2LQK A;  4XTX A;  2BIV A;  1I5O B;  2JMA A;  3CME Q;  2CZ0 B;  1AWW A;  3RKX A;  4HVW A;  4M7D B;  5LJ3 h;  2FRY A;  3JB9 H;  3V7R A;  3I56 Q;  3VUB A;  3EFO A;  1VQP Q;  2DIQ A;  4D8K A;  2YT6 A;  3M0R A;  1E6H A;  3EG3 A;  2K79 A;  2FB7 A;  4X1V A;  2A08 A;  4LD6 A;  1N8R C;  2NUP A;  1H92 A;  1MHN A;  2KRM A;  3MO8 A;  2J05 A;  4MZT A;  2DTI A;  3MP1 A;  4DEY A;  5GAO q;  3GNG A;  3A98 A;  5LJ3 g;  1WGS A;  4FM4 B;  2H3J A;  4M78 A;  5GAN 2;  1CKA A;  2ECZ A;  2IG0 A;  1QCO A;  2DZC A;  3C0C A;  3UWN A;  1K0X A;  3RMS A;  1M90 C;  1TXQ A;  2DVJ A;  2E6N A;  4HKE A;  3QII A;  2QTX A;  5GAM h;  4J83 A;  1I8F A;  4O5V A;  3J80 E;  3CC2 A;  5A0G A;  1YJW Q;  4MMK A;  5IHN A;  3OYH A;  2COY A;  2NUZ A;  2DXB A;  3WVD B;  1U3O A;  2CT3 A;  4PK4 A;  3CMA A;  4GLM A;  2YSQ A;  3PVQ A;  2P4R A;  3THK A;  1M1K R;  3UT1 A;  3VYG A;  4BE0 A;  3TQ7 P;  2CH4 A;  2EYW A;  3LWH A;  1JBM A;  1UFF A;  1IZ6 A;  5GAM g;  2NLU A;  1XTD A;  3VV0 A;  3JCM e;  1VQN A;  4D8D A;  1RAI B;  1UGQ B;  4M77 B;  2JS2 A;  3NPF A;  4OGE A;  2ROL A;  4J9E A;  4M75 A;  2K7A A;  4J9F A;  2RHU A;  2K9G A;  4EDU A;  1KQS S;  1B3Q A;  3LH0 A;  3HL8 A;  4M7A E;  1KG1 A;  1RAD B;  3RDV A;  2AZV A;  1Y96 A;  2CSI A;  5D6Y A;  2DL4 A;  1YFN A;  4PJO E;  1VQ6 Q;  2XMF A;  2E4H A;  3CME T;  2HCK A;  1RAC B;  2MPX C;  2JZ2 A;  2O88 A;  2RJD A;  2E41 A;  1I4K 1;  3S3O A;  1AZE A;  3EGD B;  4MDW A;  2ED1 A;  4A4G A;  2CGH A;  3QYG B;  2DXT A;  4XTY A;  5IHK A;  3C4S A;  1Q95 G;  2EWN A;  4QT7 A;  4C92 E;  2DJZ A;  1ZBJ A;  4KGX B;  1M8V A;  3OS1 A;  2VVK A;  3QPH A;  4M7A D;  1VQ5 A;  3TSW A;  1K1Z A;  2MK5 A;  2GNC A;  5GAN e;  1YJN T;  5C0M A;  3CD6 Q;  2NUP B;  1E6G A;  3RMQ A;  2RHZ A;  4B9W A;  1G3W A;  4PJO D;  3X25 B;  3G6E Q;  3L2U A;  4PFZ A;  1N8R U;  4E7Z A;  3JB9 D;  3UDC A;  3OYD A;  1WXU A;  2PNI A;  2XIC A;  1KD1 U;  4RG2 A;  5CKB A;  2F5K A;  3KBG A;  1YHQ Q;  2BZX A;  4NL2 A;  2X4W A;  1PHT A;  3VKI A;  5D6X A;  3OYK A;  4RCB A;  4QQG A;  3CC7 Q;  2DIL A;  3RIR A;  1YBY A;  3OMC A;  1SSF A;  5FU7 C;  4B6M A;  1G83 A;  1MMN A;  2CP0 A;  4C92 D;  2DL3 A;  2GGR A;  4FW2 A;  1Y0M A;  2HSP A;  3CCQ T;  5FRM A;  4BDZ A;  3CCS Q;  4MML A;  1OU8 A;  1CSK A;  1PKT A;  3EFS A;  3LGF A;  5GAO r;  3ASK A;  3EG1 A;  2X3W D;  3CME A;  5GAO m;  2X4X A;  3CC4 Q;  4OGC A;  1IO6 A;  3H0H A;  4PNO A;  1FMW A;  5KH6 A;  1K8A U;  4M7A F;  3S6W A;  5CAI A;  1JU5 C;  3M54 A;  1GCQ C;  4E7J A;  2DPP B;  2Y90 A;  2KVQ G;  3OS0 A;  2KMT A;  2E3H A;  2DJQ A;  1H64 1;  4PJO F;  4M78 G;  3OA6 A;  3I55 T;  1VQ6 T;  2I2L A;  1JO8 A;  1WLP B;  3RBB B;  2EQM A;  4CC2 A;  2IVW A;  2K6D A;  2QAS A;  3CXC S;  1TH7 A;  1PC0 A;  1ZLM A;  1M2V A;  2F2V A;  1Z9Q A;  1AHJ B;  3MPU B;  3OB9 A;  1Q81 C;  5GAN 4;  1QVP A;  2X51 A;  2DD4 A;  4A4E A;  4Z89 A;  1W2B A;  1KC8 C;  2IIM A;  2A37 A;  4JZ3 A;  3DB4 A;  4QW2 A;  4C92 F;  2LQN A;  2P0P A;  2SEM A;  2X35 A;  1VQ7 T;  3V8K A;  4XQ3 A;  2J6F A;  1QP2 A;  1SG5 A;  3X28 B;  1VQ9 Q;  1N5Z A;  4J9G A;  1VQK Q;  1JQQ A;  1BIB A;  3VS4 A;  3M0T A;  3CD6 T;  2HL3 A;  2FEI A;  3G6E T;  4M7A C;  1JJ2 S;  1WJQ A;  4M7D E;  1YWO A;  1TS9 A;  1S72 T;  4WTO B;  3OYL A;  2CZ6 B;  3H0F A;  4C8Q E;  3TSZ A;  2RF0 A;  3EG9 B;  4PJO C;  2HDA A;  5I11 A;  2QK0 A;  3HRS A;  3CC7 T;  4A4H A;  2HBP A;  4A4F A;  3V7C A;  1X6B A;  3X20 B;  2MMP A;  4IUU A;  1KHI A;  3BE3 A;  5GJV B;  1PSE A;  4TVR A;  3H6Z A;  3SWN C;  2RQW A;  2AKK A;  1JB0 E;  4C92 C;  4PLI A;  3I55 A;  1VQ6 A;  4O6J A;  2LCC A;  5FU6 C;  2RD1 A;  4M7D D;  2JNG A;  3QO3 A;  2ZCF B;  3CC4 T;  5J26 A;  1M30 A;  2LCS A;  4C8Q D;  2CUD A;  4OMF B;  2LJ3 A;  1PWT A;  4J6Y A;  2HSE B;  4KGV B;  2LVM A;  1B07 A;  1RI0 A;  4C0D B;  5EG2 A;  1M2O A;  2RI2 A;  2BE9 B;  1XJW B;  2DRM A;  4XTW A;  2RHX A;  2ENM A;  3CCV T;  1WHH A;  1VQ7 A;  2P0Q A;  2XHC A;  3JCM V;  2OTJ Q;  1X75 C;  2FPF A;  2KT8 A;  5CVI A;  2CP2 A;  3GIB A;  1YCY A;  1ABO A;  3GNF B;  1ZSZ C;  2CT4 A;  1NM7 A;  5M9O A;  3CD6 A;  4M77 E;  4WF2 A;  1W2B P;  3FJ5 A;  4HA8 A;  3SHW A;  2PUK B;  1IB8 A;  3G6E A;  2JM8 A;  2K3Y A;  2EFI A;  1YHQ A;  3R6N A;  2OTL T;  5KYU B;  1OYX A;  1M2V B;  3OYC A;  4R55 A;  1LOJ A;  1FWZ A;  3HRU A;  3CC7 A;  1RUW A;  5KYN A;  5IXB A;  5IT9 E;  1QCF A;  4JZ4 A;  5KCH A;  1AD5 A;  1IHV A;  2DYB A;  3CMA Q;  3VS5 A;  1OI1 A;  3VS3 A;  2MI6 A;  2RJF A;  4K11 A;  4M7D F;  1YIT T;  1Q86 R;  1UGV A;  4PLL A;  2HL5 C;  4C8Q F;  4ME7 A;  3CCS A;  4BDY A;  3REB B;  1G5V A;  1RAH B;  4OMN A;  1M27 C;  2RHI A;  3E1S A;  2F2W A;  2QDY B;  1X6G A;  3E9F A;  4M77 D;  3VU3 C;  4QQD A;  2NYS A;  2D6F A;  4QVZ A;  2QG9 B;  2E6Z A;  2Y4Y A;  3CC4 A;  2DMO A;  3L42 A;  1WJS A;  4RTX A;  2YUP A;  1U5S A;  3JCM d;  4QQ6 A;  2Z0W A;  5IN1 A;  2KT1 A;  2DZ9 A;  1NZ9 A;  2KEA A;  2KNB B;  2CYZ B;  3L2R A;  4J9H A;  1KQ2 A;  4F7U E;  1N6A A;  4E6R A;  4RTU A;  2CDT A;  3CCV A;  2E64 A;  2OX7 A;  2ED0 A;  4HCC A;  4OB1 B;  1I0C A;  2LNV A;  1WHK A;  2GFA A;  1KD1 R;  4FT2 A;  3EH2 A;  3C12 A;  2PZ1 A;  4M7D C;  5DM7 R;  1UEB A;  4IUR A;  5KYY B;  1Q82 C;  1K0S A;  4C8Q C;  4ZGE B;  1AWX A;  5KCO A;  2OTL A;  2XDP A;  4LDW A;  4HVU A;  2LQW A;  3SEM A;  2V26 A;  7AT1 B;  1PG5 B;  2QA4 T;  4BUG A;  3VS0 A;  1UE9 A;  3J7A F;  5I21 A;  2FG0 A;  4M77 F;  4ORZ A;  1KQS A;  2VXE A;  2MOX A;  4EMG A;  5DLQ E;  2GQI A;  3MCA B;  2O9S A;  3OW2 A;  2RN8 A;  1YIT A;  3CPW A;  1XNI A;  2K2M A;  1Y71 A;  5LL6 S;  5DY9 A;  2DIG A;  4HCB A;  1VQL Q;  3GF5 A;  2M9U A;  3EGU A;  2K57 A;  5GAN d;  1K73 U;  2LZ6 B;  1B34 B;  1K8A R;  1NJI C;  4KUI A;  2DL8 A;  4RMO A;  4ZTJ A;  4JS5 A;  3L2Z A;  3M4Y A;  1YI2 Q;  2RPN A;  4II1 A;  2E3I A;  3QSU A;  3QDF A;  1BCO A;  4R0K A;  3CCU T;  2EAY A;  5LJ3 f;  3ZFJ A;  1U8R A;  1IHW A;  2FVU A;  3BFM A;  1Q7Y R;  1VYU A;  2CSQ A;  3NGP A;  5HK0 A;  1OX9 A;  2E5K A;  4OMM A;  3PGG A;  2FPE A;  2EKH A;  3LGL A;  1UHC A;  3M57 A;  1VQ4 Q;  4M77 C;  4CC3 A;  2DL7 A;  3JAM E;  1JXM A;  2OJ2 A;  4DBF A;  3DLM A;  4F7U F;  2L2P A;  1FXX A;  4ESR A;  2PUO B;  3PIP A;  2RO0 A;  1NEG A;  2YRC A;  2ATC B;  2OTJ A;  2O4X B;  5GAM f;  1GFD A;  1HK9 A;  2ZPF B;  1VYV A;  2YRV A;  2HEQ A;  5GMK i;  3A8G B;  2DRK A;  1TU0 B;  4E7I A;  1DJ7 B;  1I1J A;  3I9Q A;  1YJN Q;  4OP0 A;  2L89 A;  2RQT A;  3QG1 A;  2A0F B;  5CR2 A;  3M9Q A;  4LDU A;  1LVK A;  1BI0 A;  1D3B A;  1UGS B;  2RB6 A;  3OMG A;  4LNP A;  3RUX A;  1KQS P;  1KQ1 A;  5LJ5 j;  3ZL7 C;  3OW2 P;  4RCC A;  2HNI A;  3OBY A;  3CPW P;  1Q82 U;  2QGF B;  1WQW A;  3C95 A;  3LH5 A;  2JXB A;  4E7H A;  1QWE A;  2OAU A;  2MAM A;  1VQL T;  4JPB W;  2FZG B;  4FL6 A;  2D9T A;  3CCU A;  3H8Z A;  2QTV A;  4BY6 B;  3G71 T;  1QVG A;  2LC4 A;  1W6X A;  1Y07 A;  1PD1 A;  4L59 A;  3CCQ Q;  1HD3 A;  3LLR A;  4BI3 A;  5GAN 8;  3BDL A;  3M0U A;  1UEC A;  5CK9 A;  4M7D G;  4MZM A;  2OI3 A;  2KDS A;  1TSF A;  5CQY A;  4KUL A;  4XU1 A;  2SRC A;  1BI1 A;  4C8Q G;  4JRP A;  1PNJ A;  3PTA A;  5IHI A;  1YI2 T;  3QZ5 B;  4HVV A;  3CEY A;  1AVZ C;  4AMC A;  2X4Y A;  3A1P A;  3UAT A;  1RAB B;  1K9M C;  3RER A;  2QDL A;  4FYW B;  1SKU B;  4XTZ A;  4RG8 A;  2F2X A;  8ATC B;  1LJO A;  1UGP B;  2PVG B;  1NJI U;  3EGX A;  1FMK A;  2RNA A;  2K5L A;  1YIJ T;  3I55 Q;  1KFZ A;  1VQ4 T;  3UF4 A;  4ZTF A;  4HXJ A;  3MP6 A;  5GMK j;  1JJ2 A;  4FIB A;  1LPL A;  3CCE T;  2EYZ A;  3VS2 A;  3FC3 A;  4DBR A;  3KUF A;  3ME9 A;  3ER0 A;  1TUD A;  5GAN 6;  1AOJ A;  4XTU A;  5J39 A;  1G8X A;  4EMH A;  8AT1 B;  1EX4 A;  2P84 A;  1BIA A;  2M02 A;  4C5G A;  3PT9 A;  2JT4 A;  2PVD B;  2M1H A;  3HPW A;  4N4H A;  2OAW A;  1VQ7 Q;  1MMA A;  3EFO B;  1P92 A;  2L5Q A;  5CO7 A;  2O31 A;  2RJE A;  5FRN A;  1EFN A;  4BD3 A;  4BI8 B;  3E19 A;  4L5G A;  2M51 A;  1VQL A;  4M77 G;  1S72 Q;  4J9B A;  1C6V X;  3AHU A;  1T0J A;  3EHQ A;  2G6F X;  4M78 B;  3V8J A;  2ZPB B;  3JCM c;  3HFO A;  4KUD K;  1YI2 A;  3VS1 A;  4XU0 A;  1M90 U;  2DBK A;  3SD4 A;  2VAS A;  3IQL A;  4L6V 5;  3RNJ A;  2KAF A;  1GCQ A;  1KHC A;  1QVG P;  2QQA A;  1HJD A;  4MZP A;  3MET A;  4Q5W A;  4ZN3 A;  3MKD A;  1WXT A;  2O9V A;  3F70 A;  3NTI A;  5LJ3 e;  4CC7 A;  3PMT A;  2LQ8 A;  3EH1 A;  4AG2 C;  4IKF A;  1VQ4 A;  2L0A A;  1GBQ A;  1ZHI A;  2PU9 B;  3CCE A;  1RAG B;  4RTV A;  1M8M A;  4KGZ B;  1QVF S;  2FO0 A;  2DA9 A;  5LJ5 h;  1QMC A;  3NTK A;  4PKC C;  4KBM B;  4M75 B;  3JB9 F;  1YP5 A;  1T3S A;  2O2O A;  4JRI A;  3PE0 A;  2HQX A;  1WI7 A;  3QBY A;  1JJ2 P;  3CCV Q;  1LNX A;  3HFN A;  4J9D A;  2YUO A;  2M0Y A;  4F7U G;  1I07 A;  4AT1 B;  1UJY A;  2RHY A;  5GAM e;  2X3X D;  5FLX E;  1Y96 B;  1YJN A;  3M55 A;  1NLP C;  2KXC A;  2E65 A;  4LE9 A;  5LJ5 g;  4FT4 A;  1K73 R;  1X43 A;  4M7A A;  4QVD A;  1HYO A;  2R58 A;  4C5H A;  1XQH A;  4RUG A;  1WYX A;  1ZX6 A;  1K9A A;  4J8O A;  2OTL Q;  4PJO A;  2D0Q B;  2JUF A;  1FX7 A;  1N9S A;  4Z8A A;  1M3A A;  5EC7 A;  4BAC A;  2A7Y A;  3LX7 A;  2E10 A;  3E9G A;  4BB7 A;  1V29 B;  4JJD A;  2CH4 W;  4EPC A;  2AK5 A;  5GMK h;  1NPP A;  2EKO A;  1MV0 B;  1YIT Q;  4HCK A;  2COW A;  2DM1 A;  3SWN A;  3CCQ A;  1C0M A;  2EIF A;  5FU7 B;  4C92 A;  1UG1 A;  2DER A;  3CQT A;  3M0Q A;  3CCR Q;  2GBQ A;  2EBP A;  4ELZ C;  2E1H A;  1PSF A;  4C0Z A;  4DA4 A;  1NBE B;  2DAQ A;  2DO3 A;  3KXT A;  3G7Z A;  2F69 A;  5FWB A;  1R0B G;  1FMV A;  2R5A A;  2NWM A;  5KYX A;  2CUB A;  4QVC A;  3VS7 A;  3OYA A;  1EZZ B;  1RAF B;  3ZEH A;  2W0Z A;  3EHR A;  5I2M A;  3OYI A;  2DXU A;  3M5A A;  2LNH B;  1W70 A;  1ABQ A;  3L2Q A;  4J6W A;  1FYN A;  4VUB A;  3VJP A;  2VYT A;  1IRE B;  3VS6 A;  5HKC A;  1YJ9 T;  1ZSZ A;  3GP8 A;  4KH1 B;  1MV3 A;  2EW3 A;  2DEQ A;  2RMO A;  2DET A;  4OMO A;  3A8L B;  1GBR A;  1V76 A;  1G3S A;  2QA4 Q;  2J6O A;  3RKY A;  1UGR B;  4RTW A;  4XTV A;  3P8H A;  2EQJ A;  4A4K A;  1X2Q A;  2BTT A;  5GAN 3;  2QQB A;  5GAN j;  2EQI A;  4XAX B;  4C0F A;  2LT4 A;  4C5I A;  3SB2 A;  3A8M B;  4LUD A;  1T0H A;  4JLI A;  1S72 A;  1UUE A;  3LW5 E;  3O8V A;  5FW9 A;  1NPR A;  2DTO A;  1Q81 U;  4CRI A;  3OYG A;  1KC8 U;  3P8B B;  4FYV B;  2VGN A;  5A0D A;  2ZPE B;  1WQ7 A;  4UC4 A;  3HKS A;  2DK3 A;  2YLB A;  4IIO A;  2FYK A;  2FHD A;  1OV3 A;  1WFW A;  1NE8 A;  1F1B B;  2BZ8 A;  1K4U S;  3CCU Q;  2K5I A;  2HQH A;  1WXB A;  2XK0 A;  3CCR T;  2GTJ A;  4ATO A;  2RQR A;  4OVA A;  2ZPG B;  3A8O B;  2FZC B;  6AT1 B;  5LJ5 e;  2ZPI B;  3TEE A;  2VV5 A;  2VC8 A;  2PQW A;  2NUT A;  2VGM A;  1YJ9 A;  4E47 A;  3CCJ Q;  1BI3 A;  4M7D A;  1N27 A;  3S3N A;  4EMK C;  2V8J A;  2JM9 A;  4C8Q A;  2J06 A;  1H8K A;  1TWB A;  2L3Q A;  2LTO A;  2EGE A;  1X69 A;  2B86 A;  1D1B A;  2EJF A;  2KSS A;  3JCM h;  4M7A G;  4GY5 A;  2HQE A;  2EGA A;  2J6K A;  2XI9 A;  2CP3 A;  1MGQ A;  1N8R R;  4LDY A;  2XID A;  1WHL A;  5CCA A;  3MJX A;  4PJO G;  3CBO A;  3JB9 G;  2BZY A;  2JTM A;  2GFU A;  1VIE A;  2CKK A;  3OYM A;  5GAN 5;  2K5F A;  4JJB A;  4ANJ A;  2A3L A;  3QJY A;  4JDS A;  2XDD A;  1M90 R;  4B9X A;  2KK4 A;  4OB3 B;  5GMK e;  1R77 A;  4RTY A;  3FRN A;  3QJ6 A;  3JV3 A;  2DKG A;  3O5Z A;  2DEU A;  4C92 G;  3I5S A;  3PNW C;  1WHG A;  2HMA A;  2LX9 A;  2B8A A;  4OMQ A;  4F16 A;  2DLP A;  1U06 A;  3DLL A;  4JJN K;  1VQ8 Q;  4M78 D;  3G71 Q;  4ELY C;  3CCR A;  3X24 B;  3BW1 A;  4F17 A;  2FRW A;  4BE1 A;  4M75 E;  2L8D A;  1GRI A;  2LMJ A;  4E7L A;  1O75 A;  2RK1 A;  4M77 A;  1TG0 A;  3V7S A;  2EYX A;  2EJG A;  1ZSG A;  2XD0 A;  1TUC A;  5GAN h;  2DNU A;  1M9S A;  1D1C A;  1I5L A;  3L2V A;  1ACM B;  1SHG A;  4ZGJ B;  4BY6 C;  1ZBX A;  2ZAE A;  1WZO A;  1Q86 C;  1RAE B;  4AFU C;  1VQM T;  2JMC A;  4PFP A;  4J6X A;  1JEG A;  3OQ5 A;  4V2S A;  2L3S A;  2RM4 A;  1U1S A;  4DBQ A;  2YXY A;  1PRL C;  5CKD A;  1YIJ Q;  1NLO C;  3CCJ T;  1O9S A;  1NG2 A;  3U23 A;  2G3R A;  3GOX A;  4E7K A;  4PJN A;  1Y7X A;  2PTK A;  3CBP A;  2KI7 A;  3EFR A;  5LJ3 d;  3OSV A;  3CCE Q;  5GAO n;  1LCK A;  2D0N A;  2KRO A;  2VUB A;  1QQJ A;  4NS5 A;  2Y4X A;  3SDZ A;  2C06 A;  4MDX A;  4M75 D;  3EGD A;  2NUT B;  1OUL A;  2PVO B;  2KRS A;  1X01 A;  3PFS A;  3OSS C;  2QA4 A;  5FWC A;  1RI9 A;  4IUP A;  1M1F A;  4M78 F;  2KXD A;  2E12 A;  5IAY A;  4LN2 A;  2KYB A;  4C8Q B;  1IGQ A;  1H3Z A;  4JUV A;  1VQO Q;  4X9D A;  2QAZ A;  1UTI A;  2JN0 A;  3QWX X;  2EQU A;  3CCM Q;  4Z02 A;  1RAA B;  2XU8 A;  3WXM B;  2JVV A;  4X9C A;  1BKB A;  1T3L A;  3JRZ A;  2JS0 A;  1KD1 C;  3SFM A;  1ZUU A;  4F7U A;  5GAM d;  3H41 A;  2CP6 A;  1ZA2 B;  3QKJ A;  1QVF A;  2CZ7 B;  3CCL Q;  1VOM A;  3INZ A;  3JCM X;  2BKD N;  2DTH A;  3AT1 B;  3REA B;  1HSQ A;  1QP3 A;  3JCM Q;  4J9I A;  3TVT A;  1VQ8 T;  1NYF A;  1CKB A;  1X6O A;  3CXC A;  2DYI A;  3M0P A;  5IH2 A;  2MIO A;  4Y28 E;  1D0Y A;  1VQM A;  4HT9 A;  1AEY A;  4M75 F;  2V1R A;  2EYQ A;  2RK2 A;  1VQ5 T;  1QKX A;  4M78 C;  3CCJ A;  1MMD A;  3QUI A;  4OMP A;  1BU1 A;  3JB9 I;  3BDU A;  1TOV A;  1OZ3 A;  1K8A C;  4DOV A;  3D7S B;  4PL6 A;  1WIE A;  2JJ9 A;  1M1G A;  3MHX A;  3ZBD A;  2P0K A;  2JTF A;  2COZ A;  2YUN A;  2EYY A;  4J7I A;  5GMK l;  2KE9 A;  5DLO A;  3R6O A;  3NHN A;  1GFC A;  1SSH A;  1Q7Y C;  1SRM A;  3OYN A;  4X34 A;  3DKM A;  3MEA A;  2O01 E;  2ROT A;  4JRK A;  3OW2 S;  3PVL A;  2VXF A;  1Q86 U;  3CPW S;  4CI0 C;  2EQK A;  1Q81 R;  4DQ2 A;  3OS2 A;  3EAE A;  1KC8 R;  1UHF A;  4PFO A;  4OB2 B;  3LYI A;  3EG0 A;  1Z9Z A;  4M75 C;  3M4G A;  3EG2 A;  2DVE A;  5KE3 A;  3I56 T;  1J3T A;  2RJC A;  1VQO T;  2AT1 B;  2KR3 A;  5HY6 A;  1VQP T;  4AFZ C;  5CKF A;  3CCM T;  2DF6 A;  2RI3 A;  9ATC B;  3QXE B;  1SHF A;  1D0Z A;  1PM3 A;  1VQ8 A;  2YHT A;  2H3E B;  4P5N A;  3X26 B;  3C94 A;  5J3B A;  3G71 A;  3NMZ C;  3FDR A;  2QEX Q;  1B7T A;  3OYY A;  1M5Q 1;  1OZ2 A;  1SPK A;  2X4J A;  2GCX A;  5CQX A;  3I35 A;  1UDL A;  1QVF P;  3CCL T;  3FJP A;  1BCM A;  3EG9 A;  2GF7 A;  1WX6 A;  4N0A A;  3JB9 J;  1GL5 A;  4F7U B;  2HD0 A;  2CP7 A;  4WCI A;  4GLK A;  2RQU A;  3Q1J A;  5A2Q E;  2LJ0 A;  1D0X A;  2MYS A;  1D3B B;  4ZN1 A;  3JCM J;  1YJW T;  4HCZ A;  5GAN 7;  3QYH B;  4JS4 A;  3CXC P;  1M1K C;  2LP5 A;  2AIR B;  1OX8 A;  1OEB A;  5FRO A;  3M58 A;  1PD0 A;  1K76 A;  2VB6 A;  3QZ9 B;  4A54 A;  5CIU A;  1YIJ A;  1NEB A;  2K3X A;  2QQR A;  4FSS A;  4OF1 A;  5I2S A;  5LJ5 f;  2I0N A;  2K2V A;  2QQS A;  1UB4 A;  1YWP A;  4FYX B;  4N0A C;  5ECA A;  2XKO C;  2W10 A;  4C5E A;  4CC4 B;  2ZGW A;  1YJ9 Q;  1D09 B;  2QGG A;  5LJ5 d;  4Z88 A;  4JJC A;  2QQ9 A;  5KE2 A;  3M56 A;  4RTT A;  2FZK B;  2MWO A;  1VYT A;  4GBQ A;  2RQV A;  5L23 A;  1VA7 A;  1ZQ1 A;  1AT1 B;  2E70 A;  2ESW A;  4F04 B;  3I56 A;  2DBM A;  1W1F A;  4M4Z A;  4RKU E;  1VQO A;  2YWW A;  1N9R A;  2LDM A;  1KSW A;  2AZS A;  4ZNX A;  1VQP A;  2F1L A;  1K9M U;  3CCM A;  3ULR B;  1M3C A;  3EGX B;  1SRL A;  2KRN A;  4FU6 A;  3OY9 A;  1QWF A;  4IUT A;  2KGT A;  1ARK A;  1WNL A;  1WJR A;  5GJW B;  1QVG S;  2R57 A;  2IPO B;  4C0D C;  4N4I A;  5KYU A;  3CCL A;  1Q7Y U;  1KK7 A;  1OU9 A;  2A36 A;  2JOY A;  3HHT B;  4D6W A;  2LX7 A;  4JLG A;  3GLX A;  4RTZ A;  2D8H A;  5AYF A;  3VUZ A;  2XDB A;  4N4G A;  2J7I A;  1G3Y A;  2V1Q A;  4XU2 A;  1AZG B; 
#chains in the Genus database with same CATH homology
 3T9N A;  2QXF A;  2K5I A;  3S3O A;  2KY9 A;  2XK0 A;  3LGL A;  3M57 A;  4MDW A;  3CCR T;  1YJW A;  4ATO A;  4OVA A;  4M77 C;  4A4G A;  2CGH A;  2ZPG B;  2QEX T;  3QYG B;  2DXT A;  3A8O B;  3JAM E;  4XTY A;  4LDX A;  5LJ5 e;  5A0L A;  2ZPI B;  3TEE A;  2VV5 A;  2VC8 A;  2PQW A;  5CKH A;  3C4S A;  2EWN A;  1R8O B;  1BYM A;  2VGM A;  1YJ9 A;  4E47 A;  3DLM A;  4F7U F;  4C92 E;  1FXX A;  2DJZ A;  2EJ9 A;  2PUO B;  1M8V A;  3OS1 A;  1BI3 A;  3QDR B;  4R56 A;  3PIP A;  4M7D A;  1N27 A;  2RO0 A;  3QPH A;  4EMK C;  3S3N A;  3TCJ A;  4M7A D;  5HK3 A;  1VQ5 A;  2V8J A;  2XG8 D;  2V8I A;  2OTJ A;  4ZGD B;  4C8Q A;  2O4X B;  5GAN e;  1YHQ T;  1YJN T;  4M75 G;  5D6W A;  5C0M A;  5GAM f;  3RMQ A;  2KQW A;  2RHZ A;  4B9W A;  2LTO A;  1G3W A;  4PJO D;  1HK9 A;  2ZPF B;  2CS7 A;  3X25 B;  3L2U A;  2YRV A;  5GMK i;  1N8R U;  3FIF A;  3JB9 D;  2EJF A;  2KSS A;  3TRE A;  3UDC A;  3A8G B;  3OYD A;  3JCM h;  4E7I A;  4M7A G;  4GY5 A;  1DJ7 B;  2XIC A;  1KD1 U;  4RG2 A;  2HQE A;  5CKB A;  2F5K A;  1JRI A;  3KBG A;  1W4S A;  2XI9 A;  1MGQ A;  2M16 A;  4LDY A;  4NL2 A;  4OP0 A;  2X4W A;  4LD9 K;  2XID A;  2GQV A;  3CPF A;  3VKI A;  2L89 A;  3QG1 A;  5D6X A;  5CCA A;  4PJO G;  2F5T X;  3CBO A;  5CR2 A;  3JB9 G;  3OYK A;  4RCB A;  4QQG A;  3M9Q A;  2JTM A;  2YLC A;  4LDU A;  2GFU A;  1YBY A;  1VIE A;  3JSC A;  3OMC A;  3RIR A;  1SSF A;  2CKK A;  5FU7 C;  3OYM A;  1UGS B;  1D3B A;  1BI0 A;  2RB6 A;  3OMG A;  3RUX A;  5GAN 5;  2K5F A;  3CCS T;  4DOW A;  1M1K U;  2E5Q A;  2A3L A;  4C92 D;  3QJY A;  1KQ1 A;  2BUD A;  4JDS A;  4KT0 E;  5LJ5 j;  2XDD A;  4IUV A;  3J81 E;  4B9X A;  2KK4 A;  3FLG A;  1GXI E;  4OB3 B;  2WSE E;  5GMK e;  3CCQ T;  5FRM A;  4BDZ A;  4RCC A;  2HNI A;  3OBY A;  4BE2 A;  1Q82 U;  3FRN A;  3NTH A;  3QJ6 A;  1WQW A;  3C95 A;  4MML A;  4E7H A;  2DKG A;  2OAU A;  2MAM A;  3EFS A;  3LGF A;  1VQL T;  5GAO r;  4FL6 A;  2D9T A;  3CCU A;  4C92 G;  3H8Z A;  4BY6 B;  2DD5 A;  3G71 T;  3ASK A;  3PNW C;  4NL3 A;  1QVG A;  2LX9 A;  2B8A A;  2LC4 A;  3CME A;  1Y07 A;  5GAO m;  4L59 A;  3LLR A;  3OS5 A;  4BI3 A;  5GAN 8;  3BDL A;  3DLL A;  3RKW A;  4JJN K;  5CK9 A;  4M7D G;  2X4X A;  4MZM A;  2HAX A;  4OGC A;  2KDS A;  4PNO A;  4M78 D;  5CQY A;  4KUL A;  4XU1 A;  4ELY C;  1BI1 A;  5KH6 A;  1K8A U;  4C8Q G;  3CCR A;  3X24 B;  4JRP A;  4M7A F;  3S6W A;  5CAI A;  3L2W A;  3BW1 A;  1G3T A;  3M54 A;  3PTA A;  2QEX A;  2R5M A;  4E7J A;  1YI2 T;  4A53 A;  3HSB A;  2DPP B;  2M0O A;  2KVQ G;  2Y90 A;  3OS0 A;  3QZ5 B;  2KMT A;  4BE1 A;  4M75 E;  3CEY A;  2L8D A;  1H64 1;  2X4Y A;  4PJO F;  3VYH B;  4E7L A;  1O75 A;  2RK1 A;  4FSX A;  4M78 G;  3OA6 A;  3I55 T;  1K73 C;  1K9M C;  2I2L A;  4M77 A;  1VQ6 T;  4XTZ A;  3V7S A;  4RG8 A;  2EQM A;  2WSF E;  4IUQ A;  2EJG A;  1VQN T;  3RES A;  4C0G A;  2IVW A;  1LJO A;  2LT1 A;  4M7A B;  3CXC S;  2XD0 A;  1TH7 A;  1UGP B;  1BI2 A;  2PVG B;  4XK8 E;  1B34 A;  3CBM A;  5GAN h;  1NJI U;  3JCM P;  2K5L A;  1M9S A;  1YIJ T;  1I5L A;  5GMK m;  3L2V A;  3LWI A;  1AHJ B;  1I81 A;  3OB9 A;  1Q81 C;  5GAN 4;  4ZGJ B;  1QVP A;  1VQ4 T;  4ZTF A;  1XOV A;  4PJO B;  4BY6 C;  1WPY A;  1ZBX A;  3MP6 A;  2DD4 A;  4A4E A;  1VQM T;  5GMK j;  1W2B A;  1Q86 C;  4FIB A;  1KC8 C;  1JJ2 A;  4J6X A;  4EMK A;  3OQ5 A;  4V2S A;  2MWP A;  3CCE T;  2RM4 A;  1U1S A;  3MEV A;  5CKD A;  3DB4 A;  5LJ3 j;  4QW2 A;  3FC3 A;  4C92 F;  1VQ9 T;  3G4S T;  1VQK T;  3KUF A;  3PIO A;  3CCJ T;  1O9S A;  3ME9 A;  3ER0 A;  5GAN 6;  2G3R A;  2P0P A;  3GOX A;  3MEU A;  4E7K A;  1Y7X A;  2X35 A;  3URG A;  1VQ7 T;  3CBP A;  4XTU A;  3V8K A;  5J39 A;  3EFR A;  5LJ3 d;  3OSV A;  4XQ3 A;  5GAO n;  1QP2 A;  1M4Z A;  2VUB A;  4NS5 A;  3OYE A;  3X28 B;  2Y4X A;  4EMH A;  3SWN B;  3SDZ A;  2C06 A;  4MDX A;  1BIA A;  4M75 D;  1BIB A;  4C5G A;  3PT9 A;  3CD6 T;  4C92 B;  2PVD B;  2M1H A;  3FB9 A;  3HPW A;  4N4H A;  3PMI A;  3JCM f;  2PVO B;  3G6E T;  1P92 A;  1X01 A;  3PFS A;  2FL7 A;  2L5Q A;  3OSS C;  5FU6 B;  5CO7 A;  2QA4 A;  4Y91 A;  4IUP A;  4M7A C;  1W2B S;  2RJE A;  1JJ2 S;  1WJQ A;  5FRN A;  4M7D E;  1M1F A;  4BD3 A;  4M78 F;  2AHJ B;  4BI8 B;  1S72 T;  3OYL A;  2CZ6 B;  2E12 A;  3E19 A;  3M53 A;  4L5G A;  5IAY A;  2LCL A;  4C8Q E;  4JRQ A;  1VQL A;  4C8Q B;  4PJO C;  1H3Z A;  4JUV A;  4X9D A;  3UPU A;  2JN0 A;  3HRS A;  4M77 G;  3CC7 T;  2EQU A;  4A4H A;  5GAM j;  4Z02 A;  2HBP A;  4A4F A;  3V7C A;  3N5B B;  4M78 E;  2XU8 A;  3X20 B;  2O4X A;  3WXM B;  3AHU A;  2JVV A;  2MMP A;  4X9C A;  1BKB A;  3JRZ A;  4M78 B;  3V8J A;  4IUU A;  2ZPB B;  1KD1 C;  3SFM A;  3HFO A;  2LRQ A;  3JCM c;  4F7U A;  4KUD K;  1EIF A;  1KHI A;  1PSE A;  5GAM d;  4TVR A;  4BI4 A;  3H6Z A;  1YI2 A;  3RER A;  4XU0 A;  1M90 U;  3A8H B;  3FEO A;  3SWN C;  3QKJ A;  1QVF A;  2RH2 A;  3SD4 A;  1JB0 E;  2CZ7 B;  3P8D A;  4L6V 5;  4C92 C;  4PLI A;  3I55 A;  1VQ6 A;  2KAF A;  4O6J A;  1KHC A;  3L1A A;  3INZ A;  2QQA A;  2LCC A;  3MP8 A;  2BKD N;  3JCM g;  3JCM X;  2RI5 A;  5FU6 C;  3V8L A;  2DTH A;  2RD1 A;  1QP3 A;  4MZP A;  2MF2 A;  3JCM Q;  2V8K A;  3MET A;  4Q5W A;  1VQ8 T;  4ZN3 A;  4M7D D;  2JNG A;  2WAC A;  3F70 A;  2ZCF B;  3NTI A;  3QO3 A;  5J26 A;  5LJ3 e;  3CC4 T;  3JCM W;  4HT8 A;  3HRT A;  3PMT A;  1X6O A;  3CXC A;  2LQ8 A;  4C8Q D;  4IKF A;  1HXD A;  1VQ4 A;  4OMF B;  1VUB A;  4LDV A;  4Y28 E;  4J6Y A;  3OBW A;  1VQM A;  4HT9 A;  4M75 F;  5GAO l;  2EYQ A;  1ZHI A;  2RK2 A;  2LVM A;  2PU9 B;  3CCE A;  1VQ5 T;  1RI0 A;  2OTJ T;  3MEW A;  4C0D B;  4M78 C;  1VQ9 A;  3G4S A;  3OYF A;  1QVF S;  1VQK A;  3CCJ A;  5EG2 A;  3M59 A;  3QUI A;  5LJ5 h;  2K4Y A;  2RI2 A;  3NTK A;  3JB9 I;  4PKC C;  4XTW A;  2RHX A;  4KBM B;  5GAN f;  3CCV T;  3BDU A;  1VQ7 A;  2WSC E;  1OZ3 A;  2P0Q A;  2XHC A;  3JCM V;  3QHS A;  1K8A C;  4M75 B;  4DOV A;  1X75 C;  5CVI A;  3GIB A;  2QI2 A;  3JB9 F;  1YCY A;  4PL6 A;  3GNF B;  3MHX A;  1M1G A;  4JRI A;  3ZBD A;  5C6S A;  5M9O A;  1U1T A;  2P0K A;  3CD6 A;  2JTF A;  4M77 E;  2HQX A;  3QBY A;  2ZPH B;  3DB3 A;  3BY7 A;  4WF2 A;  4XU3 A;  1LNX A;  1QW1 A;  2PUK B;  1RL2 A;  3HFN A;  4HA8 A;  4F7U G;  3G6E A;  4OB0 B;  1VIF A;  2RHY A;  5GAM e;  2L3R A;  3CC2 T;  3S3M A;  2K3Y A;  5FLX E;  2EFI A;  4J7I A;  1YHQ A;  1Y96 B;  5GMK l;  3M55 A;  1YJN A;  3OYB A;  2P4T A;  2OTL T;  2ZZD A;  3A5Z B;  2E65 A;  5LJ5 g;  1OYX A;  5DLO A;  4FT4 A;  5L8R E;  3R6O A;  4J7F A;  3OYC A;  3CMA T;  4R55 A;  4M7A A;  1Q7Y C;  3GPL A;  1LOJ A;  3OYJ A;  3OYN A;  4X34 A;  1FWZ A;  3DKM A;  3HRU A;  4QVD A;  3JCM b;  2R58 A;  3NFC A;  3MEA A;  4C5H A;  3CC7 A;  4EMK B;  1XQH A;  2O01 E;  3HP9 A;  4JRK A;  3OW2 S;  5IT9 E;  4J8O A;  5KCH A;  2VXF A;  1Q86 U;  4PJO A;  3CPW S;  5GAO p;  4CI0 C;  2D0Q B;  2JUF A;  5CKE A;  1FX7 A;  3TU4 K;  1N9S A;  2EQK A;  1OI1 A;  2MI6 A;  4DQ2 A;  2RJF A;  2RA2 A;  3OS2 A;  4BAC A;  3EAE A;  4M7D F;  2A7Y A;  3LX7 A;  4NOY A;  5GAN g;  1YIT T;  2E10 A;  3E9G A;  4OB2 B;  3LYI A;  3WVE B;  4PLL A;  2CZ1 B;  2DXC A;  1V29 B;  4M75 C;  4BB7 A;  4C8Q F;  4J5Y A;  3M4G A;  4ME7 A;  4YTL A;  3CCS A;  4BDY A;  2DVE A;  2LQK A;  5KE3 A;  3I56 T;  4EPC A;  1G5V A;  4XTX A;  2RJC A;  5GMK h;  3E1S A;  2RHI A;  2BIV A;  1VQO T;  1NPP A;  2EKO A;  5HY6 A;  2CZ0 B;  2QDY B;  3E9F A;  4M77 D;  5CKF A;  3VU3 C;  1VQP T;  4QQD A;  3CCM T;  3RKX A;  2RI3 A;  3SWN A;  5LJ3 h;  3CCQ A;  3QXE B;  2D6F A;  4M7D B;  4QVZ A;  2EIF A;  2E6Z A;  2Y4Y A;  5FU7 B;  1VQ8 A;  3V7R A;  4C92 A;  3JB9 H;  2YHT A;  3CC4 A;  4P5N A;  3X26 B;  3C94 A;  3L42 A;  5J3B A;  3VUB A;  1WJS A;  3G71 A;  4ELZ C;  2E1H A;  1PSF A;  3FDR A;  4C0Z A;  2DIQ A;  4DA4 A;  3JCM d;  3OYY A;  4QQ6 A;  5IN1 A;  1M5Q 1;  2FB7 A;  1OZ2 A;  2DAQ A;  1NZ9 A;  2DZ9 A;  2GCX A;  2X4J A;  2DO3 A;  5CQX A;  4LD6 A;  1N8R C;  3KXT A;  3G7Z A;  2F69 A;  3CCL T;  2CYZ B;  3FJP A;  3L2R A;  2GF7 A;  1MHN A;  2R5A A;  1KQ2 A;  4F7U E;  4N0A A;  3MO8 A;  1N6A A;  3JB9 J;  4MZT A;  2DTI A;  2HD0 A;  4F7U B;  3MP1 A;  4QVC A;  5GAO q;  3GNG A;  3OYA A;  5LJ3 g;  4GLK A;  3CCV A;  2E64 A;  4HCC A;  3ZEH A;  1WGS A;  4FM4 B;  3Q1J A;  2H3J A;  4M78 A;  5I2M A;  5A2Q E;  3OYI A;  4OB1 B;  5GAN 2;  2DXU A;  3M5A A;  4ZN1 A;  1D3B B;  3JCM J;  1YJW T;  2IG0 A;  2LNV A;  4HCZ A;  3L2Q A;  2DZC A;  3QYH B;  3UWN A;  5GAN 7;  4JS4 A;  4J6W A;  3RMS A;  1M90 C;  1M1K C;  2GFA A;  4FT2 A;  3C12 A;  2E6N A;  4HKE A;  3QII A;  2QTX A;  5GAM h;  4J83 A;  5FRO A;  3M58 A;  1I8F A;  4O5V A;  4VUB A;  3VJP A;  3J80 E;  5DM7 R;  2VYT A;  4M7D C;  1UEB A;  3QZ9 B;  1IRE B;  5HKC A;  4IUR A;  4A54 A;  1YJ9 T;  5CIU A;  1YIJ A;  3CC2 A;  2QQR A;  2K3X A;  4OF1 A;  5A0G A;  4MMK A;  5I2S A;  5LJ5 f;  3OYH A;  3GP8 A;  1Q82 C;  2K2V A;  2QQS A;  4C8Q C;  2DXB A;  3WVD B;  4ZGE B;  5KCO A;  1UB4 A;  2DEQ A;  2OTL A;  2XDP A;  4LDW A;  4N0A C;  2XKO C;  3CMA A;  2QA4 T;  4BUG A;  3A8L B;  4C5E A;  3UT1 A;  2ZGW A;  3VYG A;  4BE0 A;  3J7A F;  5I21 A;  1G3S A;  4M77 F;  1KQS A;  2VXE A;  4EMG A;  3LWH A;  5DLQ E;  1JBM A;  5LJ5 d;  1IZ6 A;  3MCA B;  3RKY A;  2QQ9 A;  5KE2 A;  5GAM g;  2NLU A;  3M56 A;  1UGR B;  4XTV A;  3OW2 A;  2MWO A;  3P8H A;  2EQJ A;  1YIT A;  4A4K A;  1XTD A;  3CPW A;  1XNI A;  3VV0 A;  5GAN 3;  2QQB A;  1ZQ1 A;  5GAN j;  3JCM e;  1Y71 A;  1VQN A;  5LL6 S;  5DY9 A;  2DIG A;  4XAX B;  4HCB A;  2E70 A;  4C0F A;  2LT4 A;  4C5I A;  1UGQ B;  3GF5 A;  3I56 A;  2M9U A;  4M77 B;  3SB2 A;  3A8M B;  4OGE A;  4RKU E;  1VQO A;  1N9R A;  2K57 A;  2LDM A;  1K9M U;  1VQP A;  5GAN d;  1K73 U;  4JLI A;  3CCM A;  4M75 A;  1S72 A;  1B34 B;  3LW5 E;  3O8V A;  1NJI C;  2RHU A;  4KUI A;  4FU6 A;  4EDU A;  3OY9 A;  4RMO A;  1KQS S;  4ZTJ A;  4IUT A;  4JS5 A;  3LH0 A;  3HL8 A;  4M7A E;  3L2Z A;  3M4Y A;  1NPR A;  1KG1 A;  1WNL A;  2DTO A;  1WJR A;  1Q81 U;  1QVG S;  4CRI A;  3OYG A;  2R57 A;  4II1 A;  4C0D C;  1KC8 U;  3P8B B;  1Y96 A;  3QSU A;  5D6Y A;  2VGN A;  4N4I A;  3CCU T;  5A0D A;  3CCL A;  1Q7Y U;  2ZPE B;  4PJO E;  1WQ7 A;  4UC4 A;  3HKS A;  3CME T;  2JOY A;  2EAY A;  2DK3 A;  3HHT B;  2YLB A;  5LJ3 f;  4D6W A;  3ZFJ A;  2FYK A;  3GLX A;  4JLG A;  2FHD A;  1U8R A;  5AYF A;  1NE8 A;  2FVU A;  3BFM A;  3VUZ A;  2XDB A;  2JZ2 A;  4N4G A;  1G3Y A;  5HK0 A;  2RJD A;  4XU2 A;  2E41 A;  3PGG A;  1I4K 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...