4PJOA

Minimal u1 snrnp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 84
sequence length 84
chains with identical sequence O, a, o
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoA00
4C92C 2DXTA 4M75C 4M78B 3QUIA 4JRIA 5GAOr 1Y96B 4XU2A 3JB9D 1JBMA 5LJ5d 4M78A 4A53A 4M7AG 1Y96A 1LOJA 2DTOA 2RB6A 1X01A 4V2SA 1M8VA 3M4GA 3JB9I 2QTXA 5GANe 4XTWA 4C8QF 4PJOC 4M77B 4XQ3A 1WQ7A 4MMKA 2YLBA 2E65A 2E64A 2EWNA 4F7UB 1YCYA 3HSBA 1B34A 4M77A 5GAN7 4M7DB 5GAMh 2DJZA 2EJGA 1N9SA 4RCCA 4XTXA 4F7UA 5CAIA 3QO3A 1HXDA 4XU3A 4C92E 4JLIA 4M75E 2DZ9A 5LJ5j 2ZGWA 4M78D 3GIBA 4HT8A 4M7DA 4C92F 1N9RA 3FIFA 4M75F 3V7SA 3AHUA 4M7DG 4PNOA 3JCMg 3V8LA 2DEQA 5GAOn 2DXUA 4NL2A 5GAN3 1I5LA 5LJ5h 4EMKB 2E41A 3SWNC 5DY9A 3RKXA 3SB2A 4M7AA 5GAOq 3FJPA 4WF2A 4EMKA 4PJOE 4XTZA 4M77D 3RESA 1I8FA 4PJOF 5GMKj 1WQWA 4C8QG 5GAMg 3RERA 4XU0A 4C8QE 4M7DD 4A54A 2VXFA 4M7AC 1KQ1A 2EAYA 5GMKh 1KQ2A 1U1SA 1M5Q1 4Y91A 2RD1A 5LJ3f 1JRIA 1MGQA 2YLCA 5LJ5e 4M78C 4M7AD 3JCMf 2I2LA 3V8KA 4C92G 4M75G 3JCMJ 3JB9F 4X9CA 3RIRA 5LJ3d 5LJ3g 4XTYA 3PGGA 5GAMj 5GANg 3JCMd 3BY7A 4JRKA 4C8QB 5GAOm 5GAN6 4M77C 1I81A 4J5YA 4EMGA 1U1TA 2Y90A 5GAMf 3HFNA 5GMKe 4HA8A 4PJOG 4C8QA 4DQ2A 5I21A 1WPYA 3BDUA 4M7DC 2FYKA 3L1AA 2DKGA 3RKYA 4NL3A 3JCMe 4N0AA 4M78E 5GAMd 5LJ3j 2VXEA 4J6YA 4M75B 2EJFA 3L2ZA 3EFSA 4M78F 4C92B 3JCMQ 3JCMb 3RUXA 3JCMV 4HT9A 3EFRA 4C92A 4M75A 4NOYA 4EMKC 3V7CA 2FB7A 5LJ3h 5GANf 3JB9G 3JCMW 3JCMX 3JB9H 1LNXA 3VU3C 4QVDA 2EJ9A 4M77E 1TH7A 3JCMh 4C8QD 4PJOB 2DVEA 4M77F 4EMHA 4F7UE 5GMKi 2RM4A 3JB9J 4F7UF 3QSUA 5GANd 4QVCA 4M7DE 4PJOA 5GAOp 4M7DF 2VC8A 5GAN4 5GAN2 5LJ5g 3JCMc 3INZA 4C92D 4M75D 2E1HA 3HFOA 2YHTA 4X9DA 2HNIA 2CGHA 4XTUA 1LJOA 5GMKm 4XTVA 5LJ3e 1BIBA 4M7AE 2DZCA 4OP0A 1WNLA 4MMLA 5GAN8 4M7AF 1HK9A 4M78G 1B34B 5GAN5 4J6XA 3SWNB 3QHSA 3BW1A 2E10A 3V7RA 3RKWA 5GANj 3SWNA 4J6WA 4PJOD 4C8QC 1BIAA 4RCBA 5GAOl 3BFMA 4JUVA 4XU1A 2DTHA 4M77G 3JCMP 5GANh 1I4K1 1H641 4N0AC 5GAMe 1D3BB 3FB9A 2RA2A 2DTIA 4M7AB 4F7UG 5GMKl 2K57A 5LJ5f 3V8JA 2JN0A 1D3BA
chains in the Genus database with same CATH superfamily
3LW5E 2CP5A 2JVVA 5LJ5d 1S72A 1YI2A 1NLPC 1K8AU 3A5ZB 3MO8A 1WHGA 3G4SA 1X6BA 2K3XA 2X3XD 4B9WA 3CMEQ 2LJ3A 1Q82C 2L3SA 1G3YA 4IURA 2OTLQ 2QQRA 4HT8A 4IUPA 1PKSA 5CKDA 4DBQA 9ATCB 4EMKB 4M7AA 1QCFA 1YJWT 3E9GA 2DILA 4J7FA 4HCZA 3HKSA 3CMAQ 2QDYB 2MAMA 5GAMg 1SPKA 2EYQA 2HKQB 1X6OA 5GMKh 4RG2A 3KFVA 4JZ4A 1N27A 3R6OA 2QASA 5KCOA 3NGPA 5CKFA 4FCYA 3OYNA 3I56T 2LJ1A 4OB2B 1XTDA 1VYTA 2LQ8A 4XAXB 2LCSA 3RNJA 1NM7A 2RPNA 5IN1A 5DLQE 1QKXA 2LMJA 1YI2T 3I9QA 3GP8A 1S72T 2XU8A 5LJ3j 3CC7A 4M75B 3JCMQ 5AT1B 1YWPA 3RDVA 2GQVA 2M51A 2IVWA 1LNXA 2KNBB 4C8QD 1M8MA 4A63B 5GJWB 3G1JA 1UHFA 4HVVA 4Z88A 5FWBA 4P5NA 1IO6A 3TEEA 1X2QA 2HNIA 4XTUA 1LJOA 1W4SA 5CO7A 4CRIA 1VQ5Q 2DZCA 4M7AF 2YUNA 3M0RA 2DJQA 4ZNXA 3TREA 3E19A 2OAWA 1AWXA 4C5GA 2JOYA 4C8QC 4IIOA 2MPXC 4VUBA 1T0HA 4IUTA 4J9CA 4F7UG 1WDXA 1VQ8A 1HSQA 1A0NB 1FMKA 1ZA1B 2RO0A 3CBPA 1YIJA 1EZZB 1YJNA 3CCSA 3QBYA 3CC7T 2YLBA 5HY6A 2M1HA 5FU6C 1SF9A 2CSIA 1BI0A 4EDUA 2KEAA 4M75E 1PSFA 1QKWA 4NL2A 1JO8A 2LNVA 2LTOA 4WF2A 1NJIR 3RESA 5KYWA 2F1LA 3S3MA 1JXOA 3TVTA 1N8RC 4C8QE 1ARKA 4GY5A 4BI8B 2YLCA 4RTZA 3G6EQ 3MP8A 1Q7YU 2OTLT 2RK1A 1UGVA 1W1FA 4X9CA 5LJ3g 3EH2A 2Z0WA 5GAOm 3C4SA 4J5YA 3TU4K 4J9EA 1JXMA 5I22A 4NS5A 4FSSA 4C8QA 3CMAT 5I21A 1K76A 4QT7A 4KUIA 3RKYA 1YIJT 2FEIA 4MZPA 4PJMA 1M90U 1YJNT 2QQBA 3CCST 2DIGA 5KYXB 1GL5A 3CCJQ 5LJ3h 1SG5A 4DEXA 2CZ1B 3CCLA 1YJ9Q 4EMHA 4B9XA 4AFUC 2DETA 4FYWB 3CCEQ 3H0HA 1VUBA 2ZAEA 4KUDK 5KE3A 4KULA 1M2VA 1KIKA 3LGFA 2KR3A 4X34A 5GANj 3G71Q 3EFOA 3X26B 3EGDA 4N4GA 2KAFA 2J6FA 3EHQA 2DTIA 4A4FA 5LJ5f 1H8KA 2C0OA 4M78B 1VQ5T 2XDDA 3MEVA 3CCVA 4C8QF 3UA7A 2E65A 2F2XA 2KK4A 2DJZA 2LNHB 2AKKA 2VB6A 2COWA 1OI1A 2LX9A 2L3PA 1VQ4A 2E41A 2LC4A 3I55A 2CUBA 3FJPA 3HP9A 4E7ZA 1UEBA 2DAQA 3URGA 1KQ1A 3RR6A 3ER0A 3N5BB 1RAFB 1WJSA 2BIVA 1Y57A 1FMWA 2X51A 2EQMA 2Y90A 5FRNA 1IGUA 4LN2A 5FRMA 3LGLA 2JT4A 1AZEA 2CT3A 2XI9A 4M78E 3CCVT 1UGQB 1ABQA 1LPLA 3JCMb 3JCMV 1SHGA 3G6ET 3DLMA 2ZPBB 2JJ9A 2AIRB 2YRCA 4PK4A 3VUZA 1GCPA 3X28B 1QVFA 2EYYA 3CCRQ 4HCCA 1Q95G 1TS9A 1QQJA 2L89A 2CP3A 4OMLA 4TVRA 4OMNA 4PL6A 2QI2A 1VQNQ 3SWNB 4QKUA 4LUDA 3RKWA 3M5AA 3NFCA 2NUPB 4HKEA 3O8VA 3BFMA 1TU0B 5GANh 2HL3A 2HL5C 4Z8AA 3CC4A 3NTHA 2RJEA 2XD0A 3QUIA 3EHRA 4KH1B 5D6XA 1U5SA 3KBGA 3HPWA 2DL3A 4KGZB 3G71T 3SHWA 3HTRA 1D1CA 2ZGWA 1N9RA 2X4JA 3LH5A 3A8HB 3OYYA 5GAOn 1Q81R 1E7OA 1KHIA 2FZCB 1KC8C 2JZ2A 1ZUUA 4A4GA 2DD5A 1AHJB 4E47A 2AK5A 4QVZA 2FRYA 2NUZA 1UG1A 2QGGA 3OYHA 3ZFJA 1JRIA 2CKKA 2I2LA 3L2RA 4M75G 1K9MC 4A4EA 1Y0MA 2J7IA 3TSZA 3PGGA 4HVWA 2QEXQ 2RNAA 5GAN6 3J7AF 2XHCA 2H3JA 4HXJA 2J06A 3NMZC 1RI9A 3L1AA 3I5RA 4OF1A 2CP2A 2SEMA 4BY6C 5L8RE 5CCAA 1MV3A 1UTIA 3JCMh 2LQKA 4D6WA 5FW9A 2NUTB 1BYMA 4PLLA 2JXBA 4HCKA 1NPPA 1VQ6Q 3EGUA 4X9DA 2SRCA 2OI3A 5EC7A 3KXTA 1VQMQ 1OPLA 1M9SA 2VKNA 2W0ZA 3PIOA 1KD1R 2OTJA 3OYKA 2P84A 2V8JA 4XU1A 1HD3A 1K73C 1D1BA 7AT1B 2CP0A 1RLQC 3Q1JA 3CCRT 2RJCA 1VQOQ 2QK0A 4ANJA 3QKJA 2FZKB 4XU2A 4ELZC 4A53A 2E6NA 3M4GA 5J39A 2FPFA 3P8BB 3FDRA 4M77B 1OQKA 3IQLA 3G7ZA 2ZZDA 2BE9B 4ZGJB 2YXYA 3M55A 3QJYA 4F7UA 1VQPT 2QA4Q 1Q82R 3GPLA 2ENMA 4ZTFA 1Q86U 3V8LA 2LDMA 3RKXA 3SB2A 2J05A 4A4HA 2YUOA 4FW1A 2AHJB 3LX7A 2WSEE 1RUWA 2CS7A 4JJCA 4O6JA 4RTTA 3WVDB 3PMIA 3CD6Q 3M0TA 5KCHA 2J6OA 2OTJT 4L6V5 3LH0A 2BZ8A 3HL8A 1SEMA 4B6MA 5LJ3d 5KYNA 1PWTA 4O5VA 3CCQA 3WVEB 1K8AC 1TUCA 4AG1C 2JNGA 4ZN3A 2PUKB 1PNJA 1ZHIA 2FYKA 3VRZA 3VS2A 4C0DB 2DRMA 1Q7YR 2RK2A 3OS5A 4MDWA 1KG1A 2LJ0A 2DRKA 1XQHA 3OBYA 1M3BA 2RI3A 4LDXA 2RMOA 3JB9H 4M77E 1TH7A 5A0DA 2O88A 1CKBA 1BI3A 4OB0B 1SHFA 4F7UF 5ECAA 2QQ9A 1M90R 3CC2Q 1C0MA 2KVQG 2VGMA 2KE9A 2KROA 4M78G 1B07A 4RMOA 2GCXA 2DA9A 3BW1A 3OYJA 2EQKA 2LQWA 1BIAA 4HCBA 1PRLC 1JEGA 1H641 2DBMA 4M7AB 2V8IA 2O4XA 3PT9A 4RTWA 3UT1A 4F14A 2HBPA 3CCQT 4Z02A 3OYAA 1VQ6T 2V8KA 1YJWA 1M1GA 1SSFA 5C0MA 1VQMT 2FVUA 3L2VA 4J8OA 2D1XA 3OYDA 1K1ZA 1B34A 1NZ9A 2K5IA 2EJGA 2KT8A 4RTYA 3RBBB 4ZGDB 3V7SA 3EG9B 3MEWA 3I56A 1OZ3A 3X25B 3H9NA 4DEYA 4E7IA 4RTUA 2ZCFB 4CC7A 3P8HA 1YWOA 3X20B 1N8RR 4C5HA 2OAUA 4LDWA 4C5EA 4PFPA 2RD1A 1UGPB 2QA4T 3CEYA 2H3EB 3QYHB 4WCIA 1QVFS 1GCQC 3BY7A 3OYCA 1V76A 2RF0A 3UWNA 1M2OA 1JJ2A 2QTVA 3QWYA 3LYIA 3OSVA 3PVQA 4KRTA 4IUQA 4C92B 3CD6T 1RADB 3L2ZA 1CSKA 1G5VA 4DOWA 1TUGB 2O01E 3MKDA 2DYBA 2YUPA 4NOYA 4EMKC 1YBYA 1BU1A 3BE3A 3RMSA 4FYYB 3OMCA 2RJDA 5GANd 1M1FA 5GAN4 4J9FA 3INZA 4M75D 5GAMh 1ZUKA 2YHTA 2ED1A 4JRQA 1Z9ZA 4XTVA 2HSPA 3HRUA 5GAN8 1Q7YC 4XK8E 3I5SA 4R0KA 1WYXA 2QG9B 5EG2A 3EAEA 5GAOl 5IXBA 1YN8A 2CT4A 2EW3A 3OS0A 2C0TA 3SFMA 3JAME 1P92A 3CQTA 1W70A 4M75C 2DL7A 2JTFA 2PTKA 2AT1B 5GAOr 1M90C 4D8DA 1JQQA 2Y4XA 1BB9A 1XNIA 1IHVA 2DPPB 1QVFP 3SD4A 5IXFA 2D0QB 3CCMQ 1GCQA 2XDPA 4M7DB 2FL7A 1LCKA 2OTLA 4C92E 3REBB 3X24B 1GBQA 1X2KA 4E7HA 3THKA 1I0CA 2AZSA 3HRTA 2L3RA 2LT4A 2M0OA 4EMKA 3T9NA 2HAXA 3CMAA 2K4YA 2CP7A 1PKTA 3UDCA 2DL4A 2ZPGB 5KE2A 3QDRB 5LJ3f 2GFAA 3OMGA 5LJ5e 1O9SA 1WFWA 8AT1B 1GXIE 5J26A 3E1SA 4QQ6A 3TQ7P 1YHQQ 2K5LA 3MJXA 1WXBA 3JCMd 4OB1B 1IGQA 1YFNA 3OS1A 3CBOA 4J9HA 2GQIA 1WX6A 1M1KU 2DD4A 1X27A 3EFOB 2VXEA 2F5KA 3EFSA 4HT9A 3CMET 4BDZA 2MI6A 2VASA 2DIQA 1BI2A 4M75A 1X75C 3V7CA 4ZN1A 1BI1A 4CC4B 2RI5A 5KYYB 3LWIA 4M7DE 1SRMA 4KBMB 2K6DA 1VQ5A 4OGCA 2YRVA 1DJ7B 1BIBA 3OY9A 1HK9A 1KK7A 2QQAA 2ROLA 4J6WA 2JMAA 4M77G 3VS6A 2HDAA 2KT1A 2K79A 1VQ7Q 3VS3A 1KQSA 1MMDA 3JSCA 1X01A 3D7SB 5CQXA 3VRYA 1VQLQ 1H92A 4XTXA 1OU9A 1HXDA 2YWWA 4M78D 4M75F 1SSHA 4JRPA 1XOVA 5GAN3 1NPRA 1E6GA 1G8XA 2R5MA 1KC8R 2QQSA 2FO0A 2JM8A 2PNIA 2EGEA 5D6YA 4EPCA 3CCMT 5CIUA 3CBMA 1M27C 1TWBA 4Y91A 1GFDA 3G6EA 1CKAA 2GGRA 3EGXB 4M78C 1KHCA 3U23A 1C6VX 5HK3A 2V26A 2CZ0B 1ABOA 2ED0A 1K9MR 3OW2A 5FROA 2E12A 1K0SA 1U1TA 4FU6A 4Y28E 3QWXX 1M3CA 5I2MA 3JCMe 3OA6A 2RQWA 2YRDA 2R5AA 2HD0A 1NEBA 4J6YA 1OOTA 1J3TA 3KUFA 3CCJA 4OVAA 2XMFA 4F16A 5GANf 2E70A 5KYXA 3JCMW 4BE1A 1YHQT 1WXUA 4PJOB 5GMKi 1HJDA 2EKOA 3OYIA 1UJ0A 3CCEA 5LJ5g 3M0PA 2A3LA 1GBRA 5GAN5 1NEGA 2COYA 1NG2A 1GRIA 1N6AA 3G71A 3LLRA 2KYMA 3AT1B 2KQWA 2A36A 4QQDA 3NTKA 2EFIA 1K73R 1WGSA 2XG8D 1AOJA 3ZEHA 2CP6A 3ZBDA 2VUBA 2PQWA 4JRIA 1MMNA 1Y96B 3META 2ZPEB 4M78A 3P8DA 2X4YA 3M57A 1N5ZA 2VVKA 1LVKA 1BK2A 2E64A 3CCJT 3GNFB 5GAN7 3UATA 5CAIA 6AT1B 2E3HA 1I5OB 1YJ9T 3AHUA 4AFQC 3ASKA 2GNCA 4PJNA 4QW2A 3SWNC 5CK9A 2RQTA 4RUGA 3CCET 1SKUB 4PJOE 1JJ2S 4C0FA 3CPFA 5A0GA 5IAYA 2EQJA 3J80E 3RERA 1C1AA 1QWFA 1VQLT 4F04B 3GBQA 3JCMf 2RHYA 3V8KA 4C92G 3JCMJ 1PM3A 3EG1A 2B86A 5LL6S 2DE0X 4R55A 1YITQ 5GJVB 1K8AR 5C6SA 2E4HA 3HFNA 3BDUA 1VQKQ 2EGCA 1UJYA 2HQXA 5GAMd 4M78F 5M9OA 3QZ9B 1Q86C 2AZVA 3PFSA 2ZPHB 1FX7A 3M59A 3JCMX 2ATCB 1VIEA 1FYNA 1YNZA 2PZ1A 2DMOA 3CCRA 4E7KA 2YSQA 1UUEA 4ELYC 3FLGA 3QYGB 1ZLMA 3MEUA 3GF5A 3JCMc 1ZBJA 1Y07A 1I5LA 4KH0B 1VQNA 1F1BB 2VWFA 2D9TA 4DA4A 3FEOA 1NJIU 3QHSA 4MDXA 1JJ2P 3QG1A 2FRWA 3DB3A 2RHIA 3SWNA 3H41A 1IXDA 4JS5A 4RCBA 2M9UA 1VQPA 2NUPA 2DTHA 4N0AC 5FLXE 2RA2A 3ME9A 1QWEA 3S6WA 4M7DG 1OPKA 1WJQA 2ZPFB 3A98A 2PVOB 2HQEA 3MCAB 2QGFB 2RB6A 3A8OB 1M8VA 4PFOA 1IB8A 1W2BA 2GBQA 3MHXA 1UGSB 4MMKA 4WTOB 5I11A 4BI3A 1YCYA 5CVIA 3DLLA 4IUVA 2ZPIB 1RAAB 2F5TX 3MP6A 1RL2A 3GIBA 3CCUQ 2LZ6B 3FIFA 4BB7A 5AYFA 5DY9A 5IHIA 2L3QA 2DERA 3M0UA 1WJRA 4M77D 2X35A 1EX4A 3QDFA 4ZTJA 1VQNT 1ZSZB 4KGVB 3HRSA 2E6ZA 4YTLA 3L42A 2KRNA 3OYBA 3EH1A 5FU7B 2QEXA 1OX8A 1TOVA 3FRNA 1RLPC 4M77C 1I81A 3A8GB 3NHNA 2YUQA 5GMKe 1WIEA 2BZXA 2HQHA 2KMTA 3VYHB 1PG5B 4N0AA 2JMCA 2QYZA 2E3IA 3M56A 2O4XB 3JB9G 2A37A 3VU3C 1FWZA 4F17A 4KGXB 1VQ9Q 1YITT 3JRZA 3VYGA 4PFZA 2NUTA 5GAN2 4RTVA 1VQKT 1VQ6A 2HKNA 2E1HA 1KQSS 4AFSC 1OX9A 2WSFE 4MMLA 4JPBW 1X43A 1VQMA 1B34B 1NBEB 1ZQ1A 5KYUB 4DBRA 2RN8A 2ROTA 4OMFB 4DOVA 1H3HA 4OMQA 3JCMP 3CXCA 1D3BB 4C0DC 5GMKl 1VQOA 1OV3A 4FL6A 2QEXT 1FMVA 2O2OA 4FW2A 4MZMA 4PJJA 2OX7A 1S72Q 1YI2Q 4LDUA 1JB0E 2QAZA 4ESRA 4LDYA 1PCXA 4M77A 3G4SQ 2QA4A 3QO3A 1T3SA 1VYVA 4E7JA 2HEQA 1MNEA 4PNOA 1TSFA 2DEQA 3OW2S 2P0QA 1WZOA 3EG3A 4CC2A 5D7UA 1OEBA 5GAOq 2E5KA 2LP5A 3REAB 1I8FA 3VS4A 1WXTA 4A54A 4M7AC 3CD6A 1KQ2A 1WHHA 1M5Q1 2X3WD 2K2MA 2HBWA 1KQSP 4A4KA 1D1AA 3CCUT 2ECZA 3RIRA 1VQOT 4OB3B 2JTEA 2KBTA 4CI0C 4EMGA 1I1JA 5GAMf 1BBZA 2JM9A 4HA8A 4PJOG 2MYSA 2CSQA 3M54A 4UC4A 2RQVA 2L8DA 4FYVB 3OYGA 3M9QA 2F2WA 4JJDA 4FYXB 3CC7Q 1JU5C 2JS2A 1KSWA 2FB7A 2HCKA 4C0GA 1NYGA 1M30A 4M77F 3OSSC 1KJWA 2LCLA 3M0QA 3A8MB 4OMOA 3CC2A 2VC8A 2YT6A 1QVPA 4C92D 2XKOC 1Q81U 4M7AE 4JLGA 2CGHA 5GMKm 2P0PA 5LJ3e 1NLOC 3OW2P 2KSSA 2KRMA 3UF4A 2O9SA 2XDBA 1VYUA 2DXCA 4BE2A 5IH2A 1R8OB 1VQ9T 3C94A 5IHNA 1Z9QA 4JJNK 4Y92A 1M1KC 3ULRB 1IRXA 1VQ8Q 4C92C 4LE9A 1UE9A 2RHZA 2DO3A 1AEYA 2DNUA 4GBQA 5CKEA 4LD9K 4AG2C 2KDSA 1YIJQ 1YJNQ 3CPWA 3CCSQ 2R58A 1K4US 2KRSA 3OS2A 2X4WA 2CZ6B 3L2WA 3QPHA 2MCNA 1QW1A 2C0IA 3EG9A 3CC2T 2K3YA 4BDYA 4BE0A 2M16A 5KYWB 2LRQA 1QCOA 2EQIA 2O9VA 2GTJA 3OYEA 4M7DD 1OYXA 3G4ST 3CMEA 2HMAA 2NLUA 1OULA 3JV3A 4PJLA 1KD1U 2MMPA 1FXXA 1VA7A 4C8QB 1O75A 2IG0A 4M7DC 1U06A 3OYMA 2EPDA 2ABLA 2BKDN 2CH4W 2JUFA 3EFRA 1WLPB 4C92A 2KXCA 2ESWA 4N4HA 4E2FB 3GLXA 5DM7R 4QVDA 4PKCC 3CCLQ 2MWPA 2K5FA 1Q82U 5FU6B 4GLKA 3I35A 1RAGB 1M2VB 1UB4A 2MIOA 1W2BS 1UFFA 3EGDB 2D8HA 4JUVA 5HCKA 4J83A 2RJFA 3J81E 4PLIA 2EIFA 1QVGA 2DXTA 4Q5WA 2WSCE 2R57A 3JB9D 1G3SA 4FSXA 2DTOA 3JB9I 5I2SA 5GANe 4XTWA 3VJPA 3CCMA 3CCVQ 1WQ7A 2CDTA 3FJ5A 1YCSB 3A8LB 4ME7A 4FT4A 4RCCA 1UDLA 1IHWA 5HK0A 4XU3A 3OB9A 4JLIA 5LJ5j 4M7DA 2EKHA 1RAEB 2YDLA 1YP5A 4RG8A 4C92F 1Y7XA 4LDVA 4AMCA 1VQ8T 1R77A 2MWOA 2FPEA 3QXEB 1VQ4Q 3VS5A 4ATOA 3I55Q 2J6KA 4E6RA 5A2QE 2DEUA 4X1VA 2RQUA 1W6XA 4XU0A 2EVRA 2EAYA 2QXFA 1AZGB 1QP3A 2LT1A 1T0JA 2EBPA 1WHLA 2EYZA 1YHQA 1W2BP 1AWWA 1QCNA 2GF7A 4XTYA 2M02A 2IIMA 3FC3A 1UECA 2NYSA 3PVLA 2QDLA 3NTIA 4L5GA 4D8KA 1QP2A 2O31A 3M53A 1VOMA 5DLOA 1NE8A 3RUXA 1ACMB 1Q86R 1IREB 1EFNA 2XK0A 3CXCS 3GNGA 3QSUA 3M58A 5GAOp 4M7DF 5KYYA 3A1PA 2HZYA 2VV5A 1TG0A 1WHKA 1ZBXA 1WNLA 1XJWB 1G2BA 1H3ZA 2E10A 3V7RA 1WA7A 4PJOD 2LX7A 2JW4A 3DKMA 2DK3A 1N8RU 2BUDA 1B3QA 3CCLT 4E7SA 3S3NA 1YJ9A 3FB9A 2DLPA 2KYBA 3H6ZA 2K57A 4RTXA 3V8JA 3DB4A 1VQ7A 3F70A 1D0ZA 4DBHA 3CC4Q 4M7AG 2A28A 3L2UA 5CR2A 1ZSGA 2D8JA 4PJOC 1VQLA 4MZTA 2MF2A 1BKBA 2K7AA 2DF6A 3L2QA 2L2PA 4IKFA 3RMQA 1V29B 1D0YA 4BD3A 1AWJA 5LJ5h 2A7YA 2EYWA 3HHTB 1NJIC 3PIPA 1K9AA 3CXCP 2VYTA 3QIIA 1R0CB 1MMGA 2VXFA 3GOXA 5HKCA 4R56A 3VS7A 4C5IA 5IT9E 1ZA2B 3EGXA 1AD5A 2XICA 3JB9F 2P0KA 2COZA 5GANg 5KH6A 3VS0A 2H8HA 1VQ4T 1VQ7T 3I55T 4LD6A 2CYZB 2EYXA 4LNPA 4AFZC 3QZ5B 3EG2A 4DQ2A 3E2UA 3WXMB 2V1RA 3NPFA 4LXCA 1KFZA 2EJFA 5D6WA 3SEMA 1U3OA 3S3OA 1K0XA 1VQPQ 2E5QA 4RKUE 1B7TA 2DVEA 2RHXA 1AT1B 4JDSA 2X4XA 1T3LA 4PJOA 1WI7A 1PRMC 1PD1A 1VIFA 4HVUA 2G6FX 4FIBA 3HFOA 3QJ6A 4OMMA 2P4TA 1BCMA 3CPWS 3C0CA 2JS0A 2M0YA 2AKLA 3EG0A 4EIKA 2OTJQ 1X69A 4FT2A 2LCCA 1TUDA 2KGTA 4J9IA 1I07A 4OGEA 3H8ZA 2L5QA 2DL8A 3MP1A 1BCOA 1Y96A 2FPDA 5L23A 2FG0A 2BE7D 4XQ3A 5FWCA 5A0LA 2CZ7B 4F7UB 3HSBA 1MHNA 5CKHA 1N9SA 3H0FA 1IZ6A 2KXDA 2KY9A 1D0XA 4JZ3A 4BUGA 1D09B 1PC0A 2DL5A 2PVGB 2FHDA 4BY6B 3JCMg 1RABB 5CQYA 2DXUA 3CC4T 1GFCA 1M3AA 2DM1A 2RQRA 4XTZA 2HSEB 2W10A 4PJOF 1U8RA 2P4RA 4II1A 4C8QG 4CC3A 2CUDA 1X6GA 1U1SA 3LWHA 1ZX6A 1MGQA 1RACB 2K3BA 4IIMA 5CKBA 2F2VA 3CPWP 1YITA 4C0ZA 4JRKA 3CCQQ 2RHUA 1VQKA 2B8AA 1WPYA 1WHMA 2DYIA 2DVJA 4DBFA 2K9GA 1MV0B 3H0IA 2EGAA 2NWMA 2DX1A 2L0AA 1TXQA 2F69A 3M0SA 4JS4A 1PHTA 3TCJA 3C12A 2I0NA 2DXBA 4F7UE 2RM4A 3JB9J 3PNWC 1ZSZC 4QVCA 1QVGS 2RH2A 4N4IA 2GTOA 1AVZC 1OZ2A 4Z89A 3MEAA 1KC8U 2RI2A 2PUOB 4J6XA 4OMPA 5FU7C 3M4YA 1HYOA 3VUBA 5GAMe 4BI4A 1M1KR 3BDLA 3OYLA 4J9BA 2A0FB 2MOXA 3OQ5A 1JBMA 1K9MU 2IPOB 2PU9B 1YJWQ 8ATCB 1LOJA 4V2SA 5IHKA 2QTXA 2JTMA 3R6NA 2MK5A 2EWNA 3ZL7C 1Y71A 1RI0A 1RAHB 2K2VA 3CCUA 1MUZA 2DZ9A 4BACA 1UGRB 2KI7A 1NYFA 1PSEA 1Q81C 2VGNA 2PVDB 3OYFA 1G83A 3I56Q 3MPUB 3E9FA 1V1CA 5GMKj 3C95A 1QLYA 1WQWA 4J7IA 4L59A 2DBKA 4KT0E 1QVGP 1E6HA 1ZSZA 1M4ZA 1TTHB 3PTAA 2LQNA 3VS1A 4GLMA 3PE0A 4M7AD 2EQUA 2BZYA 1RAIB 3SDZA 1AWOA 3PMTA 4FM4B 2C06A 2CREA 1PD0A 4AT1B 1G3WA 5GAMj 4J9DA 2G3RA 2DFUA 1K73U 3VKIA 2A08A 4ZGEB 2DKGA 4NL3A 3UPUA 1G3TA 4QQGA 2LVMA 2WACA 2Y4YA 4M4ZA 2BTTA 2X9HA 1VQ9A 4E7LA 2EJ9A 4IUUA 4LUEA 2V1QA 2D6FA 4K11A 1MNDA 4ORZA 3TSWA 3UA6A 1SRLA 2XIDA 3O5ZA 1OU8A 2CH4A 4OP0A 1MMAA 1QMCA 1S1NA 2GFUA 1KD1C 2FZGB 1ZUYA 5KYUA 1UHCA 1EIFA 5J3BA 1R0BG 4J9GA 1I4K1 2OJ2A 4JJBA 2D0NA 3OBWA 2JN0A 3VV0A 1D3BA 1WHJA
chains in the Genus database with same CATH topology
3ZBDA 2DXTA 2VUBA 4Q5WA 2PQWA 2WSCE 3LW5E 1Y96B 3QKJA 2R57A 4JRIA 4XU2A 3JB9D 3META 4ELZC 2JVVA 2ZPEB 4M78A 4A53A 3P8DA 5LJ5d 1G3SA 2X4YA 3M57A 2DTOA 2E6NA 4FSXA 1YI2A 1S72A 1K8AU 3A5ZB 3M4GA 3JB9I 5I2SA 5J39A 3P8BB 5GANe 4XTWA 3VJPA 3FDRA 4M77B 3CCMA 3MO8A 1WQ7A 2E64A 3G7ZA 2ZZDA 3G4SA 2K3XA 4B9WA 3CCJT 3A8LB 4ZGJB 3GNFB 3M55A 3QJYA 4ME7A 5GAN7 4FT4A 4RCCA 5CAIA 1Q82C 4F7UA 1VQPT 1G3YA 5HK0A 4XU3A 3OB9A 4JLIA 4IURA 5LJ5j 3GPLA 2QQRA 1YJ9T 4M7DA 4HT8A 4IUPA 4RG8A 4C92F 4ZTFA 5CKDA 1Y7XA 4LDVA 3AHUA 3ASKA 1Q86U 3V8LA 1VQ8T 2LDMA 2MWOA 4QW2A 3QXEB 3SWNC 4EMKB 3RKXA 3SB2A 5CK9A 4A4HA 3CCET 1YJWT 4M7AA 2AHJB 3E9GA 4ATOA 3LX7A 4PJOE 2WSEE 1JJ2S 4C0FA 3CPFA 4J7FA 5A0GA 5IAYA 5A2QE 4HCZA 3HKSA 2QDYB 2MAMA 2CS7A 5GAMg 2EQJA 2EYQA 4O6JA 4XU0A 3J80E 3WVDB 3RERA 4M7AE 3PMIA 1VQLT 1X6OA 2EAYA 2QXFA 5GMKh 4RG2A 1QP3A 5KCHA 2LT1A 3JCMf 1N27A 2OTJT 2RHYA 4L6V5 3LH0A 3R6OA 3V8KA 4C92G 3HL8A 3JCMJ 1YHQA 2GF7A 5LL6S 5LJ3d 5KCOA 4XTYA 4R55A 5CKFA 4O5VA 3OYNA 3CCQA 3WVEB 3I56T 4OB2B 3FC3A 1K8AC 1XTDA 5C6SA 2JNGA 3HFNA 4ZN3A 2PUKB 3NTIA 4L5GA 3BDUA 1ZHIA 2LQ8A 4XAXB 2FYKA 4C0DB 5IN1A 1S72T 5DLQE 1QP2A 1YI2T 3GP8A 2RK2A 3OS5A 4MDWA 2HQXA 2XU8A 3M53A 5GAMd 1KG1A 5LJ3j 3CC7A 4M75B 4M78F 5DLOA 1NE8A 3JCMQ 1XQHA 3OBYA 3RUXA 5M9OA 2GQVA 3QZ9B 1Q86C 3PFSA 2ZPHB 2RI3A 1FX7A 1IREB 3M59A 3JCMX 2XK0A 1VIEA 1LNXA 2IVWA 4LDXA 4C8QD 4M77E 1TH7A 3JB9H 5A0DA 3CXCS 1BI3A 3CCRA 4E7KA 4OB0B 3GNGA 4F7UF 3QSUA 3M58A 4ELYC 3FLGA 5GAOp 4M7DF 2QQ9A 3QYGB 4P5NA 2VV5A 3GF5A 3MEUA 3JCMc 2KVQG 2VGMA 1Y07A 1I5LA 3TEEA 2HNIA 4XTUA 5CO7A 1LJOA 1W4SA 1ZBXA 4CRIA 2DZCA 1VQNA 1WNLA 4M7AF 4M78G 2D9TA 3TREA 4RMOA 4DA4A 2GCXA 3FEOA 1NJIU 3QHSA 1H3ZA 3BW1A 3E19A 2E10A 3V7RA 3OYJA 4MDXA 4C5GA 3QG1A 2JOYA 2EQKA 3DB3A 2RHIA 3SWNA 4C8QC 4PJOD 3DKMA 4JS5A 1BIAA 2DK3A 4RCBA 4HCBA 1N8RU 2BUDA 2M9UA 4VUBA 1VQPA 2DTHA 3CCLT 4IUTA 4N0AC 1H641 3S3NA 5FLXE 1YJ9A 3FB9A 4M7AB 2RA2A 3H6ZA 2V8IA 3ME9A 2O4XA 2K57A 4F7UG 3S6WA 3PT9A 1VQ8A 3UT1A 2HBPA 3V8JA 3DB4A 1VQ7A 4M7DG 3CCQT 3F70A 4Z02A 3OYAA 1WJQA 2V8KA 2ZPFB 1VQ6T 1YJWA 1M1GA 2PVOB 1SSFA 5C0MA 2HQEA 3MCAB 4M7AG 2RB6A 3L2UA 3A8OB 2RO0A 3CBPA 5CR2A 1M8VA 1YIJA 1VQMT 2FVUA 3L2VA 4J8OA 3CCSA 3MHXA 1UGSB 3QBYA 1YJNA 1W2BA 3OYDA 3CC7T 4MMKA 4PJOC 2YLBA 5HY6A 1VQLA 2M1HA 4MZTA 4BI3A 2MF2A 1BKBA 1YCYA 5CVIA 1B34A 4IUVA 1NZ9A 5FU6C 2ZPIB 3DLLA 2K5IA 2EJGA 3L2QA 2F5TX 1BI0A 3MP6A 4EDUA 4M75E 3RMQA 4IKFA 1V29B 1RL2A 3GIBA 4ZGDB 4BD3A 3FIFA 1PSFA 3V7SA 4BB7A 4NL2A 5AYFA 2LNVA 3MEWA 5LJ5h 3I56A 1OZ3A 5DY9A 2LTOA 2A7YA 3HHTB 3X25B 1NJIC 3PIPA 4E7IA 4WF2A 1WJRA 4M77D 3RESA 2VYTA 2ZCFB 3QIIA 2X35A 3P8HA 4ZTJA 1VQNT 3S3MA 1N8RC 3HRSA 2E6ZA 3X20B 4C8QE 4C5HA 2OAUA 2VXFA 4LDWA 4GY5A 4C5EA 4BI8B 3GOXA 5HKCA 4R56A 2RD1A 1UGPB 4YTLA 2YLCA 3L42A 2QA4T 3CEYA 1VQ7T 3MP8A 1Q7YU 3OYBA 2OTLT 4C5IA 5IT9E 2RK1A 2XICA 3JB9F 4X9CA 5FU7B 2P0KA 5LJ3g 2QEXA 3QYHB 5GANg 5KH6A 1QVFS 3OYCA 3BY7A 1VQ4T 3FRNA 5GAOm 4LD6A 4M77C 1I81A 3C4SA 4J5YA 3UWNA 3A8GB 3I55T 3TU4K 5GMKe 4NS5A 1JJ2A 2CYZB 4C8QA 3CMAT 4DQ2A 3QZ5B 5I21A 4KUIA 3WXMB 2KMTA 3LYIA 3RKYA 3VYHB 3OSVA 4N0AA 1YIJT 4MZPA 4IUQA 1M90U 4C92B 2QQBA 3CCST 2EJFA 3L2ZA 1YJNT 3CD6T 4DOWA 1G5VA 2DIGA 5D6WA 2O01E 4NOYA 3M56A 4EMKC 5LJ3h 1YBYA 2O4XB 3JB9G 3S3OA 3VU3C 2CZ1B 1FWZA 2E5QA 4RKUE 3RMSA 3CCLA 3ZEHA 2DVEA 2RHXA 4EMHA 1YITT 3JRZA 3OMCA 4B9XA 4JDSA 2X4XA 2RJDA 5GANd 4PJOA 1M1FA 3VYGA 5GAN4 5GAN2 1VQKT 1VQ6A 1VIFA 3INZA 4FIBA 4M75D 2E1HA 3HFOA 2YHTA 5GAMh 4JRQA 1KQSS 1VUBA 4XTVA 3QJ6A 3HRUA 2WSFE 4MMLA 5GAN8 2P4TA 4KUDK 1Q7YC 1VQMA 1B34B 4XK8E 5KE3A 4KULA 1ZQ1A 5EG2A 3CPWS 3EAEA 3LGFA 4X34A 5GANj 4OMFB 5GAOl 3X26B 4DOVA 4N4GA 2KAFA 3OS0A 3JCMP 3CXCA 4FT2A 2LCCA 1D3BB 4C0DC 5GMKl 2DTIA 3SFMA 4A4FA 1VQOA 5LJ5f 4FL6A 4OGEA 2QEXT 3H8ZA 1P92A 3JAME 4M75C 4M78B 2L5QA 2JTFA 5GAOr 1VQ5T 1M90C 3MP1A 2XDDA 4MZMA 2Y4XA 3MEVA 1Y96A 1XNIA 2DPPB 3SD4A 3CCVA 4LDUA 1JB0E 4C8QF 4XQ3A 4LDYA 2E65A 2D0QB 5A0LA 2CZ7B 4F7UB 2XDPA 3HSBA 4M77A 1MHNA 5CKHA 2QA4A 2KK4A 4M7DB 2DJZA 2FL7A 1N9SA 2OTLA 1IZ6A 2KY9A 3QO3A 4BUGA 4C92E 3X24B 4E7HA 2PVGB 1OI1A 2FHDA 4BY6B 4E7JA 4PNOA 2LX9A 3JCMg 5CQYA 2DEQA 3OW2S 2DXUA 2P0QA 3HRTA 3CC4T 1VQ4A 2E41A 2L3RA 2LC4A 3I55A 2LT4A 2M0OA 5GAOq 3FJPA 3HP9A 4EMKA 3T9NA 1UEBA 4XTZA 3CMAA 2HAXA 1I8FA 4PJOF 2K4YA 1U8RA 2DAQA 4II1A 4C8QG 3UDCA 4A54A 3URGA 4M7AC 3CD6A 1KQ1A 2ZPGB 1KQ2A 1U1SA 1M5Q1 5KE2A 3QDRB 3ER0A 5LJ3f 3N5BB 1MGQA 2GFAA 3OMGA 3LWHA 4A4KA 5LJ5e 1O9SA 1WJSA 3CCUT 1GXIE 2BIVA 5J26A 3E1SA 5CKBA 3RIRA 4QQ6A 1VQOT 2K5LA 4OB3B 1YITA 3JCMd 4C0ZA 4OB1B 4CI0C 4JRKA 3OS1A 3CBOA 4EMGA 2RHUA 2EQMA 2Y90A 5GAMf 1M1KU 1VQKA 2B8AA 5FRNA 4HA8A 3LGLA 4PJOG 5FRMA 1WPYA 2DD4A 3M54A 4UC4A 2L8DA 2XI9A 4M78E 3CCVT 3OYGA 1UGQB 3M9QA 2VXEA 2F5KA 3EFSA 4HT9A 3CMET 3JCMb 4BDZA 3JCMV 2MI6A 3G6ET 2DIQA 2F69A 1BI2A 4M75A 1X75C 4JS4A 3TCJA 3DLMA 3V7CA 2FB7A 4ZN1A 2ZPBB 3C12A 4C0GA 1BI1A 2DXBA 4M77F 3OSSC 3VUZA 4F7UE 2RI5A 2RM4A 3X28B 2LCLA 3JB9J 1QVFA 3PNWC 3LWIA 3A8MB 4M7DE 4QVCA 4HCCA 1QVGS 3CC2A 2VC8A 4KBMB 2L89A 2RH2A 1QVPA 1VQ5A 4N4IA 4C92D 2XKOC 1Q81U 4OGCA 2YRVA 2CGHA 4JLGA 2P0PA 1OZ2A 1DJ7B 4TVRA 1BIBA 3MEAA 5GMKm 5LJ3e 1QVGA 4PL6A 3OY9A 1HK9A 1KC8U 2KSSA 2QI2A 2RI2A 2PUOB 4J6XA 5FU7C 3SWNB 2XDBA 2QQAA 3M4YA 3M5AA 3RKWA 3NFCA 4J6WA 2DXCA 4HKEA 4BE2A 3O8VA 1R8OB 3BFMA 1VQ9T 3C94A 3VUBA 4M77G 5GANh 4JJNK 1M1KC 5GAMe 4BI4A 3BDLA 3CC4A 3OYLA 3NTHA 2RJEA 4C92C 2XD0A 3QUIA 2RHZA 1JBMA 3OQ5A 1K9MU 2DO3A 2PU9B 5D6XA 1KQSA 1LOJA 5CKEA 3JSCA 1X01A 3KBGA 4V2SA 3HPWA 4LD9K 2KDSA 2QTXA 5CQXA 2JTMA 3G71T 3CPWA 2EWNA 2R58A 1Y71A 1RI0A 4XTXA 3OS2A 1HXDA 2K2VA 2X4WA 3CCUA 2DZ9A 2CZ6B 2ZGWA 4M78D 3L2WA 1N9RA 2X4JA 1UGRB 4M75F 4BACA 3A8HB 3OYYA 1PSEA 1Q81C 5GAOn 4JRPA 1XOVA 3QPHA 2VGNA 5GAN3 2PVDB 1NPRA 1KHIA 1QW1A 3CC2T 2K3YA 2R5MA 3OYFA 4BDYA 4BE0A 2M16A 2QQSA 1KC8C 3E9FA 2LRQA 2JZ2A 4A4GA 2DD5A 1AHJB 4E47A 5GMKj 3C95A 4QVZA 1WQWA 4J7IA 4L59A 4EPCA 5D6YA 4KT0E 3OYEA 4M7DD 3CCMT 5CIUA 3CBMA 1OYXA 3OYHA 3G4ST 3CMEA 4Y91A 1M4ZA 3ZFJA 3G6EA 3PTAA 1JRIA 4M78C 4M7AD 2CKKA 1KHCA 2NLUA 2EQUA 2I2LA 3L2RA 3SDZA 5HK3A 3PMTA 4FM4B 2CZ0B 4M75G 2C06A 1K9MC 4A4EA 1KD1U 2MMPA 3PGGA 5GAMj 1G3WA 5FROA 2E12A 3OW2A 1FXXA 4C8QB 2G3RA 5GAN6 1O75A 1U1TA 1K73U 3J7AF 2XHCA 3VKIA 2H3JA 4ZGEB 4FU6A 2IG0A 4Y28E 4M7DC 3L1AA 3OYMA 5I2MA 2DKGA 4OF1A 3JCMe 4NL3A 3OA6A 2R5AA 2HD0A 4J6YA 3UPUA 2BKDN 4BY6C 1G3TA 5L8RE 2JUFA 3KUFA 3EFRA 3CCJA 4QQGA 4C92A 4OVAA 2LVMA 5CCAA 2WACA 2Y4YA 4N4HA 5GANf 2E70A 3JCMW 3GLXA 5DM7R 4BE1A 4QVDA 2EJ9A 3JCMh 4E7LA 1YHQT 2LQKA 4IUUA 4PKCC 1VQ9A 4PJOB 4D6WA 5GMKi 2EKOA 2MWPA 2D6FA 2K5FA 3OYIA 1Q82U 1BYMA 5FU6B 4PLLA 3CCEA 4GLKA 5LJ5g 1NPPA 2XIDA 2A3LA 4X9DA 4OP0A 1UB4A 5GAN5 3KXTA 1W2BS 1N6AA 2GFUA 1M9SA 3PIOA 3G71A 3LLRA 1KD1C 1EIFA 2KQWA 5J3BA 3OYKA 2OTJA 4JUVA 2V8JA 4XU1A 4QQDA 3NTKA 2EFIA 1I4K1 2RJFA 4J83A 3J81E 1K73C 4PLIA 3Q1JA 3CCRT 1WGSA 2RJCA 2EIFA 3OBWA 2XG8D 2JN0A 3VV0A 1D3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 C;  2DXT A;  4M75 C;  4M78 B;  3QUI A;  4JRI A;  5GAO r;  1Y96 B;  4XU2 A;  3JB9 D;  1JBM A;  5LJ5 d;  4M78 A;  4A53 A;  4M7A G;  1Y96 A;  1LOJ A;  2DTO A;  2RB6 A;  1X01 A;  4V2S A;  1M8V A;  3M4G A;  3JB9 I;  2QTX A;  5GAN e;  4XTW A;  4C8Q F;  4PJO C;  4M77 B;  4XQ3 A;  1WQ7 A;  4MMK A;  2YLB A;  2E65 A;  2E64 A;  2EWN A;  4F7U B;  1YCY A;  3HSB A;  1B34 A;  4M77 A;  5GAN 7;  4M7D B;  5GAM h;  2DJZ A;  2EJG A;  1N9S A;  4RCC A;  4XTX A;  4F7U A;  5CAI A;  3QO3 A;  1HXD A;  4XU3 A;  4C92 E;  4JLI A;  4M75 E;  2DZ9 A;  5LJ5 j;  2ZGW A;  4M78 D;  3GIB A;  4HT8 A;  4M7D A;  4C92 F;  1N9R A;  3FIF A;  4M75 F;  3V7S A;  3AHU A;  4M7D G;  4PNO A;  3JCM g;  3V8L A;  2DEQ A;  5GAO n;  2DXU A;  4NL2 A;  5GAN 3;  1I5L A;  5LJ5 h;  4EMK B;  2E41 A;  3SWN C;  5DY9 A;  3RKX A;  3SB2 A;  4M7A A;  5GAO q;  3FJP A;  4WF2 A;  4EMK A;  4PJO E;  4XTZ A;  4M77 D;  3RES A;  1I8F A;  4PJO F;  5GMK j;  1WQW A;  4C8Q G;  5GAM g;  3RER A;  4XU0 A;  4C8Q E;  4M7D D;  4A54 A;  2VXF A;  4M7A C;  1KQ1 A;  2EAY A;  5GMK h;  1KQ2 A;  1U1S A;  1M5Q 1;  4Y91 A;  2RD1 A;  5LJ3 f;  1JRI A;  1MGQ A;  2YLC A;  5LJ5 e;  4M78 C;  4M7A D;  3JCM f;  2I2L A;  3V8K A;  4C92 G;  4M75 G;  3JCM J;  3JB9 F;  4X9C A;  3RIR A;  5LJ3 d;  5LJ3 g;  4XTY A;  3PGG A;  5GAM j;  5GAN g;  3JCM d;  3BY7 A;  4JRK A;  4C8Q B;  5GAO m;  5GAN 6;  4M77 C;  1I81 A;  4J5Y A;  4EMG A;  1U1T A;  2Y90 A;  5GAM f;  3HFN A;  5GMK e;  4HA8 A;  4PJO G;  4C8Q A;  4DQ2 A;  5I21 A;  1WPY A;  3BDU A;  4M7D C;  2FYK A;  3L1A A;  2DKG A;  3RKY A;  4NL3 A;  3JCM e;  4N0A A;  4M78 E;  5GAM d;  5LJ3 j;  2VXE A;  4J6Y A;  4M75 B;  2EJF A;  3L2Z A;  3EFS A;  4M78 F;  4C92 B;  3JCM Q;  3JCM b;  3RUX A;  3JCM V;  4HT9 A;  3EFR A;  4C92 A;  4M75 A;  4NOY A;  4EMK C;  3V7C A;  2FB7 A;  5LJ3 h;  5GAN f;  3JB9 G;  3JCM W;  3JCM X;  3JB9 H;  1LNX A;  3VU3 C;  4QVD A;  2EJ9 A;  4M77 E;  1TH7 A;  3JCM h;  4C8Q D;  4PJO B;  2DVE A;  4M77 F;  4EMH A;  4F7U E;  5GMK i;  2RM4 A;  3JB9 J;  4F7U F;  3QSU A;  5GAN d;  4QVC A;  4M7D E;  4PJO A;  5GAO p;  4M7D F;  2VC8 A;  5GAN 4;  5GAN 2;  5LJ5 g;  3JCM c;  3INZ A;  4C92 D;  4M75 D;  2E1H A;  3HFO A;  2YHT A;  4X9D A;  2HNI A;  2CGH A;  4XTU A;  1LJO A;  5GMK m;  4XTV A;  5LJ3 e;  1BIB A;  4M7A E;  2DZC A;  4OP0 A;  1WNL A;  4MML A;  5GAN 8;  4M7A F;  1HK9 A;  4M78 G;  1B34 B;  5GAN 5;  4J6X A;  3SWN B;  3QHS A;  3BW1 A;  2E10 A;  3V7R A;  3RKW A;  5GAN j;  3SWN A;  4J6W A;  4PJO D;  4C8Q C;  1BIA A;  4RCB A;  5GAO l;  3BFM A;  4JUV A;  4XU1 A;  2DTH A;  4M77 G;  3JCM P;  5GAN h;  1I4K 1;  1H64 1;  4N0A C;  5GAM e;  1D3B B;  3FB9 A;  2RA2 A;  2DTI A;  4M7A B;  4F7U G;  5GMK l;  2K57 A;  5LJ5 f;  3V8J A;  2JN0 A;  1D3B A; 
#chains in the Genus database with same CATH topology
 3LW5 E;  2CP5 A;  2JVV A;  5LJ5 d;  1S72 A;  1YI2 A;  1NLP C;  1K8A U;  3A5Z B;  3MO8 A;  1WHG A;  3G4S A;  1X6B A;  2K3X A;  2X3X D;  4B9W A;  3CME Q;  2LJ3 A;  1Q82 C;  2L3S A;  1G3Y A;  4IUR A;  2OTL Q;  2QQR A;  4HT8 A;  4IUP A;  1PKS A;  5CKD A;  4DBQ A;  9ATC B;  4EMK B;  4M7A A;  1QCF A;  1YJW T;  3E9G A;  2DIL A;  4J7F A;  4HCZ A;  3HKS A;  3CMA Q;  2QDY B;  2MAM A;  5GAM g;  1SPK A;  2EYQ A;  2HKQ B;  1X6O A;  5GMK h;  4RG2 A;  3KFV A;  4JZ4 A;  1N27 A;  3R6O A;  2QAS A;  5KCO A;  3NGP A;  5CKF A;  4FCY A;  3OYN A;  3I56 T;  2LJ1 A;  4OB2 B;  1XTD A;  1VYT A;  2LQ8 A;  4XAX B;  2LCS A;  3RNJ A;  1NM7 A;  2RPN A;  5IN1 A;  5DLQ E;  1QKX A;  2LMJ A;  1YI2 T;  3I9Q A;  3GP8 A;  1S72 T;  2XU8 A;  5LJ3 j;  3CC7 A;  4M75 B;  3JCM Q;  5AT1 B;  1YWP A;  3RDV A;  2GQV A;  2M51 A;  2IVW A;  1LNX A;  2KNB B;  4C8Q D;  1M8M A;  4A63 B;  5GJW B;  3G1J A;  1UHF A;  4HVV A;  4Z88 A;  5FWB A;  4P5N A;  1IO6 A;  3TEE A;  1X2Q A;  2HNI A;  4XTU A;  1LJO A;  1W4S A;  5CO7 A;  4CRI A;  1VQ5 Q;  2DZC A;  4M7A F;  2YUN A;  3M0R A;  2DJQ A;  4ZNX A;  3TRE A;  3E19 A;  2OAW A;  1AWX A;  4C5G A;  2JOY A;  4C8Q C;  4IIO A;  2MPX C;  4VUB A;  1T0H A;  4IUT A;  4J9C A;  4F7U G;  1WDX A;  1VQ8 A;  1HSQ A;  1A0N B;  1FMK A;  1ZA1 B;  2RO0 A;  3CBP A;  1YIJ A;  1EZZ B;  1YJN A;  3CCS A;  3QBY A;  3CC7 T;  2YLB A;  5HY6 A;  2M1H A;  5FU6 C;  1SF9 A;  2CSI A;  1BI0 A;  4EDU A;  2KEA A;  4M75 E;  1PSF A;  1QKW A;  4NL2 A;  1JO8 A;  2LNV A;  2LTO A;  4WF2 A;  1NJI R;  3RES A;  5KYW A;  2F1L A;  3S3M A;  1JXO A;  3TVT A;  1N8R C;  4C8Q E;  1ARK A;  4GY5 A;  4BI8 B;  2YLC A;  4RTZ A;  3G6E Q;  3MP8 A;  1Q7Y U;  2OTL T;  2RK1 A;  1UGV A;  1W1F A;  4X9C A;  5LJ3 g;  3EH2 A;  2Z0W A;  5GAO m;  3C4S A;  4J5Y A;  3TU4 K;  4J9E A;  1JXM A;  5I22 A;  4NS5 A;  4FSS A;  4C8Q A;  3CMA T;  5I21 A;  1K76 A;  4QT7 A;  4KUI A;  3RKY A;  1YIJ T;  2FEI A;  4MZP A;  4PJM A;  1M90 U;  1YJN T;  2QQB A;  3CCS T;  2DIG A;  5KYX B;  1GL5 A;  3CCJ Q;  5LJ3 h;  1SG5 A;  4DEX A;  2CZ1 B;  3CCL A;  1YJ9 Q;  4EMH A;  4B9X A;  4AFU C;  2DET A;  4FYW B;  3CCE Q;  3H0H A;  1VUB A;  2ZAE A;  4KUD K;  5KE3 A;  4KUL A;  1M2V A;  1KIK A;  3LGF A;  2KR3 A;  4X34 A;  5GAN j;  3G71 Q;  3EFO A;  3X26 B;  3EGD A;  4N4G A;  2KAF A;  2J6F A;  3EHQ A;  2DTI A;  4A4F A;  5LJ5 f;  1H8K A;  2C0O A;  4M78 B;  1VQ5 T;  2XDD A;  3MEV A;  3CCV A;  4C8Q F;  3UA7 A;  2E65 A;  2F2X A;  2KK4 A;  2DJZ A;  2LNH B;  2AKK A;  2VB6 A;  2COW A;  1OI1 A;  2LX9 A;  2L3P A;  1VQ4 A;  2E41 A;  2LC4 A;  3I55 A;  2CUB A;  3FJP A;  3HP9 A;  4E7Z A;  1UEB A;  2DAQ A;  3URG A;  1KQ1 A;  3RR6 A;  3ER0 A;  3N5B B;  1RAF B;  1WJS A;  2BIV A;  1Y57 A;  1FMW A;  2X51 A;  2EQM A;  2Y90 A;  5FRN A;  1IGU A;  4LN2 A;  5FRM A;  3LGL A;  2JT4 A;  1AZE A;  2CT3 A;  2XI9 A;  4M78 E;  3CCV T;  1UGQ B;  1ABQ A;  1LPL A;  3JCM b;  3JCM V;  1SHG A;  3G6E T;  3DLM A;  2ZPB B;  2JJ9 A;  2AIR B;  2YRC A;  4PK4 A;  3VUZ A;  1GCP A;  3X28 B;  1QVF A;  2EYY A;  3CCR Q;  4HCC A;  1Q95 G;  1TS9 A;  1QQJ A;  2L89 A;  2CP3 A;  4OML A;  4TVR A;  4OMN A;  4PL6 A;  2QI2 A;  1VQN Q;  3SWN B;  4QKU A;  4LUD A;  3RKW A;  3M5A A;  3NFC A;  2NUP B;  4HKE A;  3O8V A;  3BFM A;  1TU0 B;  5GAN h;  2HL3 A;  2HL5 C;  4Z8A A;  3CC4 A;  3NTH A;  2RJE A;  2XD0 A;  3QUI A;  3EHR A;  4KH1 B;  5D6X A;  1U5S A;  3KBG A;  3HPW A;  2DL3 A;  4KGZ B;  3G71 T;  3SHW A;  3HTR A;  1D1C A;  2ZGW A;  1N9R A;  2X4J A;  3LH5 A;  3A8H B;  3OYY A;  5GAO n;  1Q81 R;  1E7O A;  1KHI A;  2FZC B;  1KC8 C;  2JZ2 A;  1ZUU A;  4A4G A;  2DD5 A;  1AHJ B;  4E47 A;  2AK5 A;  4QVZ A;  2FRY A;  2NUZ A;  1UG1 A;  2QGG A;  3OYH A;  3ZFJ A;  1JRI A;  2CKK A;  2I2L A;  3L2R A;  4M75 G;  1K9M C;  4A4E A;  1Y0M A;  2J7I A;  3TSZ A;  3PGG A;  4HVW A;  2QEX Q;  2RNA A;  5GAN 6;  3J7A F;  2XHC A;  2H3J A;  4HXJ A;  2J06 A;  3NMZ C;  1RI9 A;  3L1A A;  3I5R A;  4OF1 A;  2CP2 A;  2SEM A;  4BY6 C;  5L8R E;  5CCA A;  1MV3 A;  1UTI A;  3JCM h;  2LQK A;  4D6W A;  5FW9 A;  2NUT B;  1BYM A;  4PLL A;  2JXB A;  4HCK A;  1NPP A;  1VQ6 Q;  3EGU A;  4X9D A;  2SRC A;  2OI3 A;  5EC7 A;  3KXT A;  1VQM Q;  1OPL A;  1M9S A;  2VKN A;  2W0Z A;  3PIO A;  1KD1 R;  2OTJ A;  3OYK A;  2P84 A;  2V8J A;  4XU1 A;  1HD3 A;  1K73 C;  1D1B A;  7AT1 B;  2CP0 A;  1RLQ C;  3Q1J A;  3CCR T;  2RJC A;  1VQO Q;  2QK0 A;  4ANJ A;  3QKJ A;  2FZK B;  4XU2 A;  4ELZ C;  4A53 A;  2E6N A;  3M4G A;  5J39 A;  2FPF A;  3P8B B;  3FDR A;  4M77 B;  1OQK A;  3IQL A;  3G7Z A;  2ZZD A;  2BE9 B;  4ZGJ B;  2YXY A;  3M55 A;  3QJY A;  4F7U A;  1VQP T;  2QA4 Q;  1Q82 R;  3GPL A;  2ENM A;  4ZTF A;  1Q86 U;  3V8L A;  2LDM A;  3RKX A;  3SB2 A;  2J05 A;  4A4H A;  2YUO A;  4FW1 A;  2AHJ B;  3LX7 A;  2WSE E;  1RUW A;  2CS7 A;  4JJC A;  4O6J A;  4RTT A;  3WVD B;  3PMI A;  3CD6 Q;  3M0T A;  5KCH A;  2J6O A;  2OTJ T;  4L6V 5;  3LH0 A;  2BZ8 A;  3HL8 A;  1SEM A;  4B6M A;  5LJ3 d;  5KYN A;  1PWT A;  4O5V A;  3CCQ A;  3WVE B;  1K8A C;  1TUC A;  4AG1 C;  2JNG A;  4ZN3 A;  2PUK B;  1PNJ A;  1ZHI A;  2FYK A;  3VRZ A;  3VS2 A;  4C0D B;  2DRM A;  1Q7Y R;  2RK2 A;  3OS5 A;  4MDW A;  1KG1 A;  2LJ0 A;  2DRK A;  1XQH A;  3OBY A;  1M3B A;  2RI3 A;  4LDX A;  2RMO A;  3JB9 H;  4M77 E;  1TH7 A;  5A0D A;  2O88 A;  1CKB A;  1BI3 A;  4OB0 B;  1SHF A;  4F7U F;  5ECA A;  2QQ9 A;  1M90 R;  3CC2 Q;  1C0M A;  2KVQ G;  2VGM A;  2KE9 A;  2KRO A;  4M78 G;  1B07 A;  4RMO A;  2GCX A;  2DA9 A;  3BW1 A;  3OYJ A;  2EQK A;  2LQW A;  1BIA A;  4HCB A;  1PRL C;  1JEG A;  1H64 1;  2DBM A;  4M7A B;  2V8I A;  2O4X A;  3PT9 A;  4RTW A;  3UT1 A;  4F14 A;  2HBP A;  3CCQ T;  4Z02 A;  3OYA A;  1VQ6 T;  2V8K A;  1YJW A;  1M1G A;  1SSF A;  5C0M A;  1VQM T;  2FVU A;  3L2V A;  4J8O A;  2D1X A;  3OYD A;  1K1Z A;  1B34 A;  1NZ9 A;  2K5I A;  2EJG A;  2KT8 A;  4RTY A;  3RBB B;  4ZGD B;  3V7S A;  3EG9 B;  3MEW A;  3I56 A;  1OZ3 A;  3X25 B;  3H9N A;  4DEY A;  4E7I A;  4RTU A;  2ZCF B;  4CC7 A;  3P8H A;  1YWO A;  3X20 B;  1N8R R;  4C5H A;  2OAU A;  4LDW A;  4C5E A;  4PFP A;  2RD1 A;  1UGP B;  2QA4 T;  3CEY A;  2H3E B;  3QYH B;  4WCI A;  1QVF S;  1GCQ C;  3BY7 A;  3OYC A;  1V76 A;  2RF0 A;  3UWN A;  1M2O A;  1JJ2 A;  2QTV A;  3QWY A;  3LYI A;  3OSV A;  3PVQ A;  4KRT A;  4IUQ A;  4C92 B;  3CD6 T;  1RAD B;  3L2Z A;  1CSK A;  1G5V A;  4DOW A;  1TUG B;  2O01 E;  3MKD A;  2DYB A;  2YUP A;  4NOY A;  4EMK C;  1YBY A;  1BU1 A;  3BE3 A;  3RMS A;  4FYY B;  3OMC A;  2RJD A;  5GAN d;  1M1F A;  5GAN 4;  4J9F A;  3INZ A;  4M75 D;  5GAM h;  1ZUK A;  2YHT A;  2ED1 A;  4JRQ A;  1Z9Z A;  4XTV A;  2HSP A;  3HRU A;  5GAN 8;  1Q7Y C;  4XK8 E;  3I5S A;  4R0K A;  1WYX A;  2QG9 B;  5EG2 A;  3EAE A;  5GAO l;  5IXB A;  1YN8 A;  2CT4 A;  2EW3 A;  3OS0 A;  2C0T A;  3SFM A;  3JAM E;  1P92 A;  3CQT A;  1W70 A;  4M75 C;  2DL7 A;  2JTF A;  2PTK A;  2AT1 B;  5GAO r;  1M90 C;  4D8D A;  1JQQ A;  2Y4X A;  1BB9 A;  1XNI A;  1IHV A;  2DPP B;  1QVF P;  3SD4 A;  5IXF A;  2D0Q B;  3CCM Q;  1GCQ A;  2XDP A;  4M7D B;  2FL7 A;  1LCK A;  2OTL A;  4C92 E;  3REB B;  3X24 B;  1GBQ A;  1X2K A;  4E7H A;  3THK A;  1I0C A;  2AZS A;  3HRT A;  2L3R A;  2LT4 A;  2M0O A;  4EMK A;  3T9N A;  2HAX A;  3CMA A;  2K4Y A;  2CP7 A;  1PKT A;  3UDC A;  2DL4 A;  2ZPG B;  5KE2 A;  3QDR B;  5LJ3 f;  2GFA A;  3OMG A;  5LJ5 e;  1O9S A;  1WFW A;  8AT1 B;  1GXI E;  5J26 A;  3E1S A;  4QQ6 A;  3TQ7 P;  1YHQ Q;  2K5L A;  3MJX A;  1WXB A;  3JCM d;  4OB1 B;  1IGQ A;  1YFN A;  3OS1 A;  3CBO A;  4J9H A;  2GQI A;  1WX6 A;  1M1K U;  2DD4 A;  1X27 A;  3EFO B;  2VXE A;  2F5K A;  3EFS A;  4HT9 A;  3CME T;  4BDZ A;  2MI6 A;  2VAS A;  2DIQ A;  1BI2 A;  4M75 A;  1X75 C;  3V7C A;  4ZN1 A;  1BI1 A;  4CC4 B;  2RI5 A;  5KYY B;  3LWI A;  4M7D E;  1SRM A;  4KBM B;  2K6D A;  1VQ5 A;  4OGC A;  2YRV A;  1DJ7 B;  1BIB A;  3OY9 A;  1HK9 A;  1KK7 A;  2QQA A;  2ROL A;  4J6W A;  2JMA A;  4M77 G;  3VS6 A;  2HDA A;  2KT1 A;  2K79 A;  1VQ7 Q;  3VS3 A;  1KQS A;  1MMD A;  3JSC A;  1X01 A;  3D7S B;  5CQX A;  3VRY A;  1VQL Q;  1H92 A;  4XTX A;  1OU9 A;  1HXD A;  2YWW A;  4M78 D;  4M75 F;  1SSH A;  4JRP A;  1XOV A;  5GAN 3;  1NPR A;  1E6G A;  1G8X A;  2R5M A;  1KC8 R;  2QQS A;  2FO0 A;  2JM8 A;  2PNI A;  2EGE A;  5D6Y A;  4EPC A;  3CCM T;  5CIU A;  3CBM A;  1M27 C;  1TWB A;  4Y91 A;  1GFD A;  3G6E A;  1CKA A;  2GGR A;  3EGX B;  4M78 C;  1KHC A;  3U23 A;  1C6V X;  5HK3 A;  2V26 A;  2CZ0 B;  1ABO A;  2ED0 A;  1K9M R;  3OW2 A;  5FRO A;  2E12 A;  1K0S A;  1U1T A;  4FU6 A;  4Y28 E;  3QWX X;  1M3C A;  5I2M A;  3JCM e;  3OA6 A;  2RQW A;  2YRD A;  2R5A A;  2HD0 A;  1NEB A;  4J6Y A;  1OOT A;  1J3T A;  3KUF A;  3CCJ A;  4OVA A;  2XMF A;  4F16 A;  5GAN f;  2E70 A;  5KYX A;  3JCM W;  4BE1 A;  1YHQ T;  1WXU A;  4PJO B;  5GMK i;  1HJD A;  2EKO A;  3OYI A;  1UJ0 A;  3CCE A;  5LJ5 g;  3M0P A;  2A3L A;  1GBR A;  5GAN 5;  1NEG A;  2COY A;  1NG2 A;  1GRI A;  1N6A A;  3G71 A;  3LLR A;  2KYM A;  3AT1 B;  2KQW A;  2A36 A;  4QQD A;  3NTK A;  2EFI A;  1K73 R;  1WGS A;  2XG8 D;  1AOJ A;  3ZEH A;  2CP6 A;  3ZBD A;  2VUB A;  2PQW A;  4JRI A;  1MMN A;  1Y96 B;  3MET A;  2ZPE B;  4M78 A;  3P8D A;  2X4Y A;  3M57 A;  1N5Z A;  2VVK A;  1LVK A;  1BK2 A;  2E64 A;  3CCJ T;  3GNF B;  5GAN 7;  3UAT A;  5CAI A;  6AT1 B;  2E3H A;  1I5O B;  1YJ9 T;  3AHU A;  4AFQ C;  3ASK A;  2GNC A;  4PJN A;  4QW2 A;  3SWN C;  5CK9 A;  2RQT A;  4RUG A;  3CCE T;  1SKU B;  4PJO E;  1JJ2 S;  4C0F A;  3CPF A;  5A0G A;  5IAY A;  2EQJ A;  3J80 E;  3RER A;  1C1A A;  1QWF A;  1VQL T;  4F04 B;  3GBQ A;  3JCM f;  2RHY A;  3V8K A;  4C92 G;  3JCM J;  1PM3 A;  3EG1 A;  2B86 A;  5LL6 S;  2DE0 X;  4R55 A;  1YIT Q;  5GJV B;  1K8A R;  5C6S A;  2E4H A;  3HFN A;  3BDU A;  1VQK Q;  2EGC A;  1UJY A;  2HQX A;  5GAM d;  4M78 F;  5M9O A;  3QZ9 B;  1Q86 C;  2AZV A;  3PFS A;  2ZPH B;  1FX7 A;  3M59 A;  3JCM X;  2ATC B;  1VIE A;  1FYN A;  1YNZ A;  2PZ1 A;  2DMO A;  3CCR A;  4E7K A;  2YSQ A;  1UUE A;  4ELY C;  3FLG A;  3QYG B;  1ZLM A;  3MEU A;  3GF5 A;  3JCM c;  1ZBJ A;  1Y07 A;  1I5L A;  4KH0 B;  1VQN A;  1F1B B;  2VWF A;  2D9T A;  4DA4 A;  3FEO A;  1NJI U;  3QHS A;  4MDX A;  1JJ2 P;  3QG1 A;  2FRW A;  3DB3 A;  2RHI A;  3SWN A;  3H41 A;  1IXD A;  4JS5 A;  4RCB A;  2M9U A;  1VQP A;  2NUP A;  2DTH A;  4N0A C;  5FLX E;  2RA2 A;  3ME9 A;  1QWE A;  3S6W A;  4M7D G;  1OPK A;  1WJQ A;  2ZPF B;  3A98 A;  2PVO B;  2HQE A;  3MCA B;  2QGF B;  2RB6 A;  3A8O B;  1M8V A;  4PFO A;  1IB8 A;  1W2B A;  2GBQ A;  3MHX A;  1UGS B;  4MMK A;  4WTO B;  5I11 A;  4BI3 A;  1YCY A;  5CVI A;  3DLL A;  4IUV A;  2ZPI B;  1RAA B;  2F5T X;  3MP6 A;  1RL2 A;  3GIB A;  3CCU Q;  2LZ6 B;  3FIF A;  4BB7 A;  5AYF A;  5DY9 A;  5IHI A;  2L3Q A;  2DER A;  3M0U A;  1WJR A;  4M77 D;  2X35 A;  1EX4 A;  3QDF A;  4ZTJ A;  1VQN T;  1ZSZ B;  4KGV B;  3HRS A;  2E6Z A;  4YTL A;  3L42 A;  2KRN A;  3OYB A;  3EH1 A;  5FU7 B;  2QEX A;  1OX8 A;  1TOV A;  3FRN A;  1RLP C;  4M77 C;  1I81 A;  3A8G B;  3NHN A;  2YUQ A;  5GMK e;  1WIE A;  2BZX A;  2HQH A;  2KMT A;  3VYH B;  1PG5 B;  4N0A A;  2JMC A;  2QYZ A;  2E3I A;  3M56 A;  2O4X B;  3JB9 G;  2A37 A;  3VU3 C;  1FWZ A;  4F17 A;  4KGX B;  1VQ9 Q;  1YIT T;  3JRZ A;  3VYG A;  4PFZ A;  2NUT A;  5GAN 2;  4RTV A;  1VQK T;  1VQ6 A;  2HKN A;  2E1H A;  1KQS S;  4AFS C;  1OX9 A;  2WSF E;  4MML A;  4JPB W;  1X43 A;  1VQM A;  1B34 B;  1NBE B;  1ZQ1 A;  5KYU B;  4DBR A;  2RN8 A;  2ROT A;  4OMF B;  4DOV A;  1H3H A;  4OMQ A;  3JCM P;  3CXC A;  1D3B B;  4C0D C;  5GMK l;  1VQO A;  1OV3 A;  4FL6 A;  2QEX T;  1FMV A;  2O2O A;  4FW2 A;  4MZM A;  4PJJ A;  2OX7 A;  1S72 Q;  1YI2 Q;  4LDU A;  1JB0 E;  2QAZ A;  4ESR A;  4LDY A;  1PCX A;  4M77 A;  3G4S Q;  2QA4 A;  3QO3 A;  1T3S A;  1VYV A;  4E7J A;  2HEQ A;  1MNE A;  4PNO A;  1TSF A;  2DEQ A;  3OW2 S;  2P0Q A;  1WZO A;  3EG3 A;  4CC2 A;  5D7U A;  1OEB A;  5GAO q;  2E5K A;  2LP5 A;  3REA B;  1I8F A;  3VS4 A;  1WXT A;  4A54 A;  4M7A C;  3CD6 A;  1KQ2 A;  1WHH A;  1M5Q 1;  2X3W D;  2K2M A;  2HBW A;  1KQS P;  4A4K A;  1D1A A;  3CCU T;  2ECZ A;  3RIR A;  1VQO T;  4OB3 B;  2JTE A;  2KBT A;  4CI0 C;  4EMG A;  1I1J A;  5GAM f;  1BBZ A;  2JM9 A;  4HA8 A;  4PJO G;  2MYS A;  2CSQ A;  3M54 A;  4UC4 A;  2RQV A;  2L8D A;  4FYV B;  3OYG A;  3M9Q A;  2F2W A;  4JJD A;  4FYX B;  3CC7 Q;  1JU5 C;  2JS2 A;  1KSW A;  2FB7 A;  2HCK A;  4C0G A;  1NYG A;  1M30 A;  4M77 F;  3OSS C;  1KJW A;  2LCL A;  3M0Q A;  3A8M B;  4OMO A;  3CC2 A;  2VC8 A;  2YT6 A;  1QVP A;  4C92 D;  2XKO C;  1Q81 U;  4M7A E;  4JLG A;  2CGH A;  5GMK m;  2P0P A;  5LJ3 e;  1NLO C;  3OW2 P;  2KSS A;  2KRM A;  3UF4 A;  2O9S A;  2XDB A;  1VYU A;  2DXC A;  4BE2 A;  5IH2 A;  1R8O B;  1VQ9 T;  3C94 A;  5IHN A;  1Z9Q A;  4JJN K;  4Y92 A;  1M1K C;  3ULR B;  1IRX A;  1VQ8 Q;  4C92 C;  4LE9 A;  1UE9 A;  2RHZ A;  2DO3 A;  1AEY A;  2DNU A;  4GBQ A;  5CKE A;  4LD9 K;  4AG2 C;  2KDS A;  1YIJ Q;  1YJN Q;  3CPW A;  3CCS Q;  2R58 A;  1K4U S;  2KRS A;  3OS2 A;  2X4W A;  2CZ6 B;  3L2W A;  3QPH A;  2MCN A;  1QW1 A;  2C0I A;  3EG9 A;  3CC2 T;  2K3Y A;  4BDY A;  4BE0 A;  2M16 A;  5KYW B;  2LRQ A;  1QCO A;  2EQI A;  2O9V A;  2GTJ A;  3OYE A;  4M7D D;  1OYX A;  3G4S T;  3CME A;  2HMA A;  2NLU A;  1OUL A;  3JV3 A;  4PJL A;  1KD1 U;  2MMP A;  1FXX A;  1VA7 A;  4C8Q B;  1O75 A;  2IG0 A;  4M7D C;  1U06 A;  3OYM A;  2EPD A;  2ABL A;  2BKD N;  2CH4 W;  2JUF A;  3EFR A;  1WLP B;  4C92 A;  2KXC A;  2ESW A;  4N4H A;  4E2F B;  3GLX A;  5DM7 R;  4QVD A;  4PKC C;  3CCL Q;  2MWP A;  2K5F A;  1Q82 U;  5FU6 B;  4GLK A;  3I35 A;  1RAG B;  1M2V B;  1UB4 A;  2MIO A;  1W2B S;  1UFF A;  3EGD B;  2D8H A;  4JUV A;  5HCK A;  4J83 A;  2RJF A;  3J81 E;  4PLI A;  2EIF A;  1QVG A;  2DXT A;  4Q5W A;  2WSC E;  2R57 A;  3JB9 D;  1G3S A;  4FSX A;  2DTO A;  3JB9 I;  5I2S A;  5GAN e;  4XTW A;  3VJP A;  3CCM A;  3CCV Q;  1WQ7 A;  2CDT A;  3FJ5 A;  1YCS B;  3A8L B;  4ME7 A;  4FT4 A;  4RCC A;  1UDL A;  1IHW A;  5HK0 A;  4XU3 A;  3OB9 A;  4JLI A;  5LJ5 j;  4M7D A;  2EKH A;  1RAE B;  2YDL A;  1YP5 A;  4RG8 A;  4C92 F;  1Y7X A;  4LDV A;  4AMC A;  1VQ8 T;  1R77 A;  2MWO A;  2FPE A;  3QXE B;  1VQ4 Q;  3VS5 A;  4ATO A;  3I55 Q;  2J6K A;  4E6R A;  5A2Q E;  2DEU A;  4X1V A;  2RQU A;  1W6X A;  4XU0 A;  2EVR A;  2EAY A;  2QXF A;  1AZG B;  1QP3 A;  2LT1 A;  1T0J A;  2EBP A;  1WHL A;  2EYZ A;  1YHQ A;  1W2B P;  1AWW A;  1QCN A;  2GF7 A;  4XTY A;  2M02 A;  2IIM A;  3FC3 A;  1UEC A;  2NYS A;  3PVL A;  2QDL A;  3NTI A;  4L5G A;  4D8K A;  1QP2 A;  2O31 A;  3M53 A;  1VOM A;  5DLO A;  1NE8 A;  3RUX A;  1ACM B;  1Q86 R;  1IRE B;  1EFN A;  2XK0 A;  3CXC S;  3GNG A;  3QSU A;  3M58 A;  5GAO p;  4M7D F;  5KYY A;  3A1P A;  2HZY A;  2VV5 A;  1TG0 A;  1WHK A;  1ZBX A;  1WNL A;  1XJW B;  1G2B A;  1H3Z A;  2E10 A;  3V7R A;  1WA7 A;  4PJO D;  2LX7 A;  2JW4 A;  3DKM A;  2DK3 A;  1N8R U;  2BUD A;  1B3Q A;  3CCL T;  4E7S A;  3S3N A;  1YJ9 A;  3FB9 A;  2DLP A;  2KYB A;  3H6Z A;  2K57 A;  4RTX A;  3V8J A;  3DB4 A;  1VQ7 A;  3F70 A;  1D0Z A;  4DBH A;  3CC4 Q;  4M7A G;  2A28 A;  3L2U A;  5CR2 A;  1ZSG A;  2D8J A;  4PJO C;  1VQL A;  4MZT A;  2MF2 A;  1BKB A;  2K7A A;  2DF6 A;  3L2Q A;  2L2P A;  4IKF A;  3RMQ A;  1V29 B;  1D0Y A;  4BD3 A;  1AWJ A;  5LJ5 h;  2A7Y A;  2EYW A;  3HHT B;  1NJI C;  3PIP A;  1K9A A;  3CXC P;  2VYT A;  3QII A;  1R0C B;  1MMG A;  2VXF A;  3GOX A;  5HKC A;  4R56 A;  3VS7 A;  4C5I A;  5IT9 E;  1ZA2 B;  3EGX A;  1AD5 A;  2XIC A;  3JB9 F;  2P0K A;  2COZ A;  5GAN g;  5KH6 A;  3VS0 A;  2H8H A;  1VQ4 T;  1VQ7 T;  3I55 T;  4LD6 A;  2CYZ B;  2EYX A;  4LNP A;  4AFZ C;  3QZ5 B;  3EG2 A;  4DQ2 A;  3E2U A;  3WXM B;  2V1R A;  3NPF A;  4LXC A;  1KFZ A;  2EJF A;  5D6W A;  3SEM A;  1U3O A;  3S3O A;  1K0X A;  1VQP Q;  2E5Q A;  4RKU E;  1B7T A;  2DVE A;  2RHX A;  1AT1 B;  4JDS A;  2X4X A;  1T3L A;  4PJO A;  1WI7 A;  1PRM C;  1PD1 A;  1VIF A;  4HVU A;  2G6F X;  4FIB A;  3HFO A;  3QJ6 A;  4OMM A;  2P4T A;  1BCM A;  3CPW S;  3C0C A;  2JS0 A;  2M0Y A;  2AKL A;  3EG0 A;  4EIK A;  2OTJ Q;  1X69 A;  4FT2 A;  2LCC A;  1TUD A;  2KGT A;  4J9I A;  1I07 A;  4OGE A;  3H8Z A;  2L5Q A;  2DL8 A;  3MP1 A;  1BCO A;  1Y96 A;  2FPD A;  5L23 A;  2FG0 A;  2BE7 D;  4XQ3 A;  5FWC A;  5A0L A;  2CZ7 B;  4F7U B;  3HSB A;  1MHN A;  5CKH A;  1N9S A;  3H0F A;  1IZ6 A;  2KXD A;  2KY9 A;  1D0X A;  4JZ3 A;  4BUG A;  1D09 B;  1PC0 A;  2DL5 A;  2PVG B;  2FHD A;  4BY6 B;  3JCM g;  1RAB B;  5CQY A;  2DXU A;  3CC4 T;  1GFC A;  1M3A A;  2DM1 A;  2RQR A;  4XTZ A;  2HSE B;  2W10 A;  4PJO F;  1U8R A;  2P4R A;  4II1 A;  4C8Q G;  4CC3 A;  2CUD A;  1X6G A;  1U1S A;  3LWH A;  1ZX6 A;  1MGQ A;  1RAC B;  2K3B A;  4IIM A;  5CKB A;  2F2V A;  3CPW P;  1YIT A;  4C0Z A;  4JRK A;  3CCQ Q;  2RHU A;  1VQK A;  2B8A A;  1WPY A;  1WHM A;  2DYI A;  2DVJ A;  4DBF A;  2K9G A;  1MV0 B;  3H0I A;  2EGA A;  2NWM A;  2DX1 A;  2L0A A;  1TXQ A;  2F69 A;  3M0S A;  4JS4 A;  1PHT A;  3TCJ A;  3C12 A;  2I0N A;  2DXB A;  4F7U E;  2RM4 A;  3JB9 J;  3PNW C;  1ZSZ C;  4QVC A;  1QVG S;  2RH2 A;  4N4I A;  2GTO A;  1AVZ C;  1OZ2 A;  4Z89 A;  3MEA A;  1KC8 U;  2RI2 A;  2PUO B;  4J6X A;  4OMP A;  5FU7 C;  3M4Y A;  1HYO A;  3VUB A;  5GAM e;  4BI4 A;  1M1K R;  3BDL A;  3OYL A;  4J9B A;  2A0F B;  2MOX A;  3OQ5 A;  1JBM A;  1K9M U;  2IPO B;  2PU9 B;  1YJW Q;  8ATC B;  1LOJ A;  4V2S A;  5IHK A;  2QTX A;  2JTM A;  3R6N A;  2MK5 A;  2EWN A;  3ZL7 C;  1Y71 A;  1RI0 A;  1RAH B;  2K2V A;  3CCU A;  1MUZ A;  2DZ9 A;  4BAC A;  1UGR B;  2KI7 A;  1NYF A;  1PSE A;  1Q81 C;  2VGN A;  2PVD B;  3OYF A;  1G83 A;  3I56 Q;  3MPU B;  3E9F A;  1V1C A;  5GMK j;  3C95 A;  1QLY A;  1WQW A;  4J7I A;  4L59 A;  2DBK A;  4KT0 E;  1QVG P;  1E6H A;  1ZSZ A;  1M4Z A;  1TTH B;  3PTA A;  2LQN A;  3VS1 A;  4GLM A;  3PE0 A;  4M7A D;  2EQU A;  2BZY A;  1RAI B;  3SDZ A;  1AWO A;  3PMT A;  4FM4 B;  2C06 A;  2CRE A;  1PD0 A;  4AT1 B;  1G3W A;  5GAM j;  4J9D A;  2G3R A;  2DFU A;  1K73 U;  3VKI A;  2A08 A;  4ZGE B;  2DKG A;  4NL3 A;  3UPU A;  1G3T A;  4QQG A;  2LVM A;  2WAC A;  2Y4Y A;  4M4Z A;  2BTT A;  2X9H A;  1VQ9 A;  4E7L A;  2EJ9 A;  4IUU A;  4LUE A;  2V1Q A;  2D6F A;  4K11 A;  1MND A;  4ORZ A;  3TSW A;  3UA6 A;  1SRL A;  2XID A;  3O5Z A;  1OU8 A;  2CH4 A;  4OP0 A;  1MMA A;  1QMC A;  1S1N A;  2GFU A;  1KD1 C;  2FZG B;  1ZUY A;  5KYU A;  1UHC A;  1EIF A;  5J3B A;  1R0B G;  4J9G A;  1I4K 1;  2OJ2 A;  4JJB A;  2D0N A;  3OBW A;  2JN0 A;  3VV0 A;  1D3B A;  1WHJ A; 
#chains in the Genus database with same CATH homology
 3ZBD A;  2DXT A;  2VUB A;  4Q5W A;  2PQW A;  2WSC E;  3LW5 E;  1Y96 B;  3QKJ A;  2R57 A;  4JRI A;  4XU2 A;  3JB9 D;  3MET A;  4ELZ C;  2JVV A;  2ZPE B;  4M78 A;  4A53 A;  3P8D A;  5LJ5 d;  1G3S A;  2X4Y A;  3M57 A;  2DTO A;  2E6N A;  4FSX A;  1YI2 A;  1S72 A;  1K8A U;  3A5Z B;  3M4G A;  3JB9 I;  5I2S A;  5J39 A;  3P8B B;  5GAN e;  4XTW A;  3VJP A;  3FDR A;  4M77 B;  3CCM A;  3MO8 A;  1WQ7 A;  2E64 A;  3G7Z A;  2ZZD A;  3G4S A;  2K3X A;  4B9W A;  3CCJ T;  3A8L B;  4ZGJ B;  3GNF B;  3M55 A;  3QJY A;  4ME7 A;  5GAN 7;  4FT4 A;  4RCC A;  5CAI A;  1Q82 C;  4F7U A;  1VQP T;  1G3Y A;  5HK0 A;  4XU3 A;  3OB9 A;  4JLI A;  4IUR A;  5LJ5 j;  3GPL A;  2QQR A;  1YJ9 T;  4M7D A;  4HT8 A;  4IUP A;  4RG8 A;  4C92 F;  4ZTF A;  5CKD A;  1Y7X A;  4LDV A;  3AHU A;  3ASK A;  1Q86 U;  3V8L A;  1VQ8 T;  2LDM A;  2MWO A;  4QW2 A;  3QXE B;  3SWN C;  4EMK B;  3RKX A;  3SB2 A;  5CK9 A;  4A4H A;  3CCE T;  1YJW T;  4M7A A;  2AHJ B;  3E9G A;  4ATO A;  3LX7 A;  4PJO E;  2WSE E;  1JJ2 S;  4C0F A;  3CPF A;  4J7F A;  5A0G A;  5IAY A;  5A2Q E;  4HCZ A;  3HKS A;  2QDY B;  2MAM A;  2CS7 A;  5GAM g;  2EQJ A;  2EYQ A;  4O6J A;  4XU0 A;  3J80 E;  3WVD B;  3RER A;  4M7A E;  3PMI A;  1VQL T;  1X6O A;  2EAY A;  2QXF A;  5GMK h;  4RG2 A;  1QP3 A;  5KCH A;  2LT1 A;  3JCM f;  1N27 A;  2OTJ T;  2RHY A;  4L6V 5;  3LH0 A;  3R6O A;  3V8K A;  4C92 G;  3HL8 A;  3JCM J;  1YHQ A;  2GF7 A;  5LL6 S;  5LJ3 d;  5KCO A;  4XTY A;  4R55 A;  5CKF A;  4O5V A;  3OYN A;  3CCQ A;  3WVE B;  3I56 T;  4OB2 B;  3FC3 A;  1K8A C;  1XTD A;  5C6S A;  2JNG A;  3HFN A;  4ZN3 A;  2PUK B;  3NTI A;  4L5G A;  3BDU A;  1ZHI A;  2LQ8 A;  4XAX B;  2FYK A;  4C0D B;  5IN1 A;  1S72 T;  5DLQ E;  1QP2 A;  1YI2 T;  3GP8 A;  2RK2 A;  3OS5 A;  4MDW A;  2HQX A;  2XU8 A;  3M53 A;  5GAM d;  1KG1 A;  5LJ3 j;  3CC7 A;  4M75 B;  4M78 F;  5DLO A;  1NE8 A;  3JCM Q;  1XQH A;  3OBY A;  3RUX A;  5M9O A;  2GQV A;  3QZ9 B;  1Q86 C;  3PFS A;  2ZPH B;  2RI3 A;  1FX7 A;  1IRE B;  3M59 A;  3JCM X;  2XK0 A;  1VIE A;  1LNX A;  2IVW A;  4LDX A;  4C8Q D;  4M77 E;  1TH7 A;  3JB9 H;  5A0D A;  3CXC S;  1BI3 A;  3CCR A;  4E7K A;  4OB0 B;  3GNG A;  4F7U F;  3QSU A;  3M58 A;  4ELY C;  3FLG A;  5GAO p;  4M7D F;  2QQ9 A;  3QYG B;  4P5N A;  2VV5 A;  3GF5 A;  3MEU A;  3JCM c;  2KVQ G;  2VGM A;  1Y07 A;  1I5L A;  3TEE A;  2HNI A;  4XTU A;  5CO7 A;  1LJO A;  1W4S A;  1ZBX A;  4CRI A;  2DZC A;  1VQN A;  1WNL A;  4M7A F;  4M78 G;  2D9T A;  3TRE A;  4RMO A;  4DA4 A;  2GCX A;  3FEO A;  1NJI U;  3QHS A;  1H3Z A;  3BW1 A;  3E19 A;  2E10 A;  3V7R A;  3OYJ A;  4MDX A;  4C5G A;  3QG1 A;  2JOY A;  2EQK A;  3DB3 A;  2RHI A;  3SWN A;  4C8Q C;  4PJO D;  3DKM A;  4JS5 A;  1BIA A;  2DK3 A;  4RCB A;  4HCB A;  1N8R U;  2BUD A;  2M9U A;  4VUB A;  1VQP A;  2DTH A;  3CCL T;  4IUT A;  4N0A C;  1H64 1;  3S3N A;  5FLX E;  1YJ9 A;  3FB9 A;  4M7A B;  2RA2 A;  3H6Z A;  2V8I A;  3ME9 A;  2O4X A;  2K57 A;  4F7U G;  3S6W A;  3PT9 A;  1VQ8 A;  3UT1 A;  2HBP A;  3V8J A;  3DB4 A;  1VQ7 A;  4M7D G;  3CCQ T;  3F70 A;  4Z02 A;  3OYA A;  1WJQ A;  2V8K A;  2ZPF B;  1VQ6 T;  1YJW A;  1M1G A;  2PVO B;  1SSF A;  5C0M A;  2HQE A;  3MCA B;  4M7A G;  2RB6 A;  3L2U A;  3A8O B;  2RO0 A;  3CBP A;  5CR2 A;  1M8V A;  1YIJ A;  1VQM T;  2FVU A;  3L2V A;  4J8O A;  3CCS A;  3MHX A;  1UGS B;  3QBY A;  1YJN A;  1W2B A;  3OYD A;  3CC7 T;  4MMK A;  4PJO C;  2YLB A;  5HY6 A;  1VQL A;  2M1H A;  4MZT A;  4BI3 A;  2MF2 A;  1BKB A;  1YCY A;  5CVI A;  1B34 A;  4IUV A;  1NZ9 A;  5FU6 C;  2ZPI B;  3DLL A;  2K5I A;  2EJG A;  3L2Q A;  2F5T X;  1BI0 A;  3MP6 A;  4EDU A;  4M75 E;  3RMQ A;  4IKF A;  1V29 B;  1RL2 A;  3GIB A;  4ZGD B;  4BD3 A;  3FIF A;  1PSF A;  3V7S A;  4BB7 A;  4NL2 A;  5AYF A;  2LNV A;  3MEW A;  5LJ5 h;  3I56 A;  1OZ3 A;  5DY9 A;  2LTO A;  2A7Y A;  3HHT B;  3X25 B;  1NJI C;  3PIP A;  4E7I A;  4WF2 A;  1WJR A;  4M77 D;  3RES A;  2VYT A;  2ZCF B;  3QII A;  2X35 A;  3P8H A;  4ZTJ A;  1VQN T;  3S3M A;  1N8R C;  3HRS A;  2E6Z A;  3X20 B;  4C8Q E;  4C5H A;  2OAU A;  2VXF A;  4LDW A;  4GY5 A;  4C5E A;  4BI8 B;  3GOX A;  5HKC A;  4R56 A;  2RD1 A;  1UGP B;  4YTL A;  2YLC A;  3L42 A;  2QA4 T;  3CEY A;  1VQ7 T;  3MP8 A;  1Q7Y U;  3OYB A;  2OTL T;  4C5I A;  5IT9 E;  2RK1 A;  2XIC A;  3JB9 F;  4X9C A;  5FU7 B;  2P0K A;  5LJ3 g;  2QEX A;  3QYH B;  5GAN g;  5KH6 A;  1QVF S;  3OYC A;  3BY7 A;  1VQ4 T;  3FRN A;  5GAO m;  4LD6 A;  4M77 C;  1I81 A;  3C4S A;  4J5Y A;  3UWN A;  3A8G B;  3I55 T;  3TU4 K;  5GMK e;  4NS5 A;  1JJ2 A;  2CYZ B;  4C8Q A;  3CMA T;  4DQ2 A;  3QZ5 B;  5I21 A;  4KUI A;  3WXM B;  2KMT A;  3LYI A;  3RKY A;  3VYH B;  3OSV A;  4N0A A;  1YIJ T;  4MZP A;  4IUQ A;  1M90 U;  4C92 B;  2QQB A;  3CCS T;  2EJF A;  3L2Z A;  1YJN T;  3CD6 T;  4DOW A;  1G5V A;  2DIG A;  5D6W A;  2O01 E;  4NOY A;  3M56 A;  4EMK C;  5LJ3 h;  1YBY A;  2O4X B;  3JB9 G;  3S3O A;  3VU3 C;  2CZ1 B;  1FWZ A;  2E5Q A;  4RKU E;  3RMS A;  3CCL A;  3ZEH A;  2DVE A;  2RHX A;  4EMH A;  1YIT T;  3JRZ A;  3OMC A;  4B9X A;  4JDS A;  2X4X A;  2RJD A;  5GAN d;  4PJO A;  1M1F A;  3VYG A;  5GAN 4;  5GAN 2;  1VQK T;  1VQ6 A;  1VIF A;  3INZ A;  4FIB A;  4M75 D;  2E1H A;  3HFO A;  2YHT A;  5GAM h;  4JRQ A;  1KQS S;  1VUB A;  4XTV A;  3QJ6 A;  3HRU A;  2WSF E;  4MML A;  5GAN 8;  2P4T A;  4KUD K;  1Q7Y C;  1VQM A;  1B34 B;  4XK8 E;  5KE3 A;  4KUL A;  1ZQ1 A;  5EG2 A;  3CPW S;  3EAE A;  3LGF A;  4X34 A;  5GAN j;  4OMF B;  5GAO l;  3X26 B;  4DOV A;  4N4G A;  2KAF A;  3OS0 A;  3JCM P;  3CXC A;  4FT2 A;  2LCC A;  1D3B B;  4C0D C;  5GMK l;  2DTI A;  3SFM A;  4A4F A;  1VQO A;  5LJ5 f;  4FL6 A;  4OGE A;  2QEX T;  3H8Z A;  1P92 A;  3JAM E;  4M75 C;  4M78 B;  2L5Q A;  2JTF A;  5GAO r;  1VQ5 T;  1M90 C;  3MP1 A;  2XDD A;  4MZM A;  2Y4X A;  3MEV A;  1Y96 A;  1XNI A;  2DPP B;  3SD4 A;  3CCV A;  4LDU A;  1JB0 E;  4C8Q F;  4XQ3 A;  4LDY A;  2E65 A;  2D0Q B;  5A0L A;  2CZ7 B;  4F7U B;  2XDP A;  3HSB A;  4M77 A;  1MHN A;  5CKH A;  2QA4 A;  2KK4 A;  4M7D B;  2DJZ A;  2FL7 A;  1N9S A;  2OTL A;  1IZ6 A;  2KY9 A;  3QO3 A;  4BUG A;  4C92 E;  3X24 B;  4E7H A;  2PVG B;  1OI1 A;  2FHD A;  4BY6 B;  4E7J A;  4PNO A;  2LX9 A;  3JCM g;  5CQY A;  2DEQ A;  3OW2 S;  2DXU A;  2P0Q A;  3HRT A;  3CC4 T;  1VQ4 A;  2E41 A;  2L3R A;  2LC4 A;  3I55 A;  2LT4 A;  2M0O A;  5GAO q;  3FJP A;  3HP9 A;  4EMK A;  3T9N A;  1UEB A;  4XTZ A;  3CMA A;  2HAX A;  1I8F A;  4PJO F;  2K4Y A;  1U8R A;  2DAQ A;  4II1 A;  4C8Q G;  3UDC A;  4A54 A;  3URG A;  4M7A C;  3CD6 A;  1KQ1 A;  2ZPG B;  1KQ2 A;  1U1S A;  1M5Q 1;  5KE2 A;  3QDR B;  3ER0 A;  5LJ3 f;  3N5B B;  1MGQ A;  2GFA A;  3OMG A;  3LWH A;  4A4K A;  5LJ5 e;  1O9S A;  1WJS A;  3CCU T;  1GXI E;  2BIV A;  5J26 A;  3E1S A;  5CKB A;  3RIR A;  4QQ6 A;  1VQO T;  2K5L A;  4OB3 B;  1YIT A;  3JCM d;  4C0Z A;  4OB1 B;  4CI0 C;  4JRK A;  3OS1 A;  3CBO A;  4EMG A;  2RHU A;  2EQM A;  2Y90 A;  5GAM f;  1M1K U;  1VQK A;  2B8A A;  5FRN A;  4HA8 A;  3LGL A;  4PJO G;  5FRM A;  1WPY A;  2DD4 A;  3M54 A;  4UC4 A;  2L8D A;  2XI9 A;  4M78 E;  3CCV T;  3OYG A;  1UGQ B;  3M9Q A;  2VXE A;  2F5K A;  3EFS A;  4HT9 A;  3CME T;  3JCM b;  4BDZ A;  3JCM V;  2MI6 A;  3G6E T;  2DIQ A;  2F69 A;  1BI2 A;  4M75 A;  1X75 C;  4JS4 A;  3TCJ A;  3DLM A;  3V7C A;  2FB7 A;  4ZN1 A;  2ZPB B;  3C12 A;  4C0G A;  1BI1 A;  2DXB A;  4M77 F;  3OSS C;  3VUZ A;  4F7U E;  2RI5 A;  2RM4 A;  3X28 B;  2LCL A;  3JB9 J;  1QVF A;  3PNW C;  3LWI A;  3A8M B;  4M7D E;  4QVC A;  4HCC A;  1QVG S;  3CC2 A;  2VC8 A;  4KBM B;  2L89 A;  2RH2 A;  1QVP A;  1VQ5 A;  4N4I A;  4C92 D;  2XKO C;  1Q81 U;  4OGC A;  2YRV A;  2CGH A;  4JLG A;  2P0P A;  1OZ2 A;  1DJ7 B;  4TVR A;  1BIB A;  3MEA A;  5GMK m;  5LJ3 e;  1QVG A;  4PL6 A;  3OY9 A;  1HK9 A;  1KC8 U;  2KSS A;  2QI2 A;  2RI2 A;  2PUO B;  4J6X A;  5FU7 C;  3SWN B;  2XDB A;  2QQA A;  3M4Y A;  3M5A A;  3RKW A;  3NFC A;  4J6W A;  2DXC A;  4HKE A;  4BE2 A;  3O8V A;  1R8O B;  3BFM A;  1VQ9 T;  3C94 A;  3VUB A;  4M77 G;  5GAN h;  4JJN K;  1M1K C;  5GAM e;  4BI4 A;  3BDL A;  3CC4 A;  3OYL A;  3NTH A;  2RJE A;  4C92 C;  2XD0 A;  3QUI A;  2RHZ A;  1JBM A;  3OQ5 A;  1K9M U;  2DO3 A;  2PU9 B;  5D6X A;  1KQS A;  1LOJ A;  5CKE A;  3JSC A;  1X01 A;  3KBG A;  4V2S A;  3HPW A;  4LD9 K;  2KDS A;  2QTX A;  5CQX A;  2JTM A;  3G71 T;  3CPW A;  2EWN A;  2R58 A;  1Y71 A;  1RI0 A;  4XTX A;  3OS2 A;  1HXD A;  2K2V A;  2X4W A;  3CCU A;  2DZ9 A;  2CZ6 B;  2ZGW A;  4M78 D;  3L2W A;  1N9R A;  2X4J A;  1UGR B;  4M75 F;  4BAC A;  3A8H B;  3OYY A;  1PSE A;  1Q81 C;  5GAO n;  4JRP A;  1XOV A;  3QPH A;  2VGN A;  5GAN 3;  2PVD B;  1NPR A;  1KHI A;  1QW1 A;  3CC2 T;  2K3Y A;  2R5M A;  3OYF A;  4BDY A;  4BE0 A;  2M16 A;  2QQS A;  1KC8 C;  3E9F A;  2LRQ A;  2JZ2 A;  4A4G A;  2DD5 A;  1AHJ B;  4E47 A;  5GMK j;  3C95 A;  4QVZ A;  1WQW A;  4J7I A;  4L59 A;  4EPC A;  5D6Y A;  4KT0 E;  3OYE A;  4M7D D;  3CCM T;  5CIU A;  3CBM A;  1OYX A;  3OYH A;  3G4S T;  3CME A;  4Y91 A;  1M4Z A;  3ZFJ A;  3G6E A;  3PTA A;  1JRI A;  4M78 C;  4M7A D;  2CKK A;  1KHC A;  2NLU A;  2EQU A;  2I2L A;  3L2R A;  3SDZ A;  5HK3 A;  3PMT A;  4FM4 B;  2CZ0 B;  4M75 G;  2C06 A;  1K9M C;  4A4E A;  1KD1 U;  2MMP A;  3PGG A;  5GAM j;  1G3W A;  5FRO A;  2E12 A;  3OW2 A;  1FXX A;  4C8Q B;  2G3R A;  5GAN 6;  1O75 A;  1U1T A;  1K73 U;  3J7A F;  2XHC A;  3VKI A;  2H3J A;  4ZGE B;  4FU6 A;  2IG0 A;  4Y28 E;  4M7D C;  3L1A A;  3OYM A;  5I2M A;  2DKG A;  4OF1 A;  3JCM e;  4NL3 A;  3OA6 A;  2R5A A;  2HD0 A;  4J6Y A;  3UPU A;  2BKD N;  4BY6 C;  1G3T A;  5L8R E;  2JUF A;  3KUF A;  3EFR A;  3CCJ A;  4QQG A;  4C92 A;  4OVA A;  2LVM A;  5CCA A;  2WAC A;  2Y4Y A;  4N4H A;  5GAN f;  2E70 A;  3JCM W;  3GLX A;  5DM7 R;  4BE1 A;  4QVD A;  2EJ9 A;  3JCM h;  4E7L A;  1YHQ T;  2LQK A;  4IUU A;  4PKC C;  1VQ9 A;  4PJO B;  4D6W A;  5GMK i;  2EKO A;  2MWP A;  2D6F A;  2K5F A;  3OYI A;  1Q82 U;  1BYM A;  5FU6 B;  4PLL A;  3CCE A;  4GLK A;  5LJ5 g;  1NPP A;  2XID A;  2A3L A;  4X9D A;  4OP0 A;  1UB4 A;  5GAN 5;  3KXT A;  1W2B S;  1N6A A;  2GFU A;  1M9S A;  3PIO A;  3G71 A;  3LLR A;  1KD1 C;  1EIF A;  2KQW A;  5J3B A;  3OYK A;  2OTJ A;  4JUV A;  2V8J A;  4XU1 A;  4QQD A;  3NTK A;  2EFI A;  1I4K 1;  2RJF A;  4J83 A;  3J81 E;  1K73 C;  4PLI A;  3Q1J A;  3CCR T;  1WGS A;  2RJC A;  2EIF A;  3OBW A;  2XG8 D;  2JN0 A;  3VV0 A;  1D3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...