4PJOA

Minimal u1 snrnp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 19
structure length 84
sequence length 84
chains with identical sequence O, a, o
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoA00
2YHTA 3FB9A 3RKWA 3JCMf 4RCCA 4M77C 5GMKm 5LJ5g 5GAMh 2E65A 3JCMW 5GAMj 4M7AA 4EMKC 4HT8A 3V7CA 5GANg 1M8VA 1D3BB 3JB9D 1B34B 2DXTA 1B34A 4XTZA 5LJ5h 5GAN2 2VC8A 4A54A 1LOJA 1N9SA 5LJ3g 5LJ5j 3JCMP 4QVCA 3GIBA 4WF2A 3JB9G 5GANh 1BIAA 3SWNB 4F7UG 4M7DF 3M4GA 4X9DA 3RESA 2DTIA 3SWNA 4XU3A 5GANj 4C92F 4M75C 3JCMc 1JRIA 2E10A 4C8QB 3JCMg 3V7RA 4N0AA 4C8QA 2FYKA 3PGGA 4C8QE 3HSBA 5GAN6 2EJGA 4PJOC 5LJ3d 1WNLA 1N9RA 4M77F 4M78B 3V8JA 3SB2A 2EWNA 4M78A 3RKYA 4QVDA 1MGQA 2EAYA 3INZA 4M78E 4PJOG 3JCMh 4C8QD 5GMKh 3JB9J 4M7DB 4MMLA 1Y96B 4M7AB 3VU3C 4M7DA 4C92B 1Y96A 4M7DE 4C92A 4M7AE 3EFRA 4MMKA 4XU2A 3HFNA 5GAMd 5GMKl 2JN0A 3V8LA 4M78D 1I4K1 2YLCA 4JUVA 2K57A 4M77B 4M7DD 1BIBA 4M7AD 4M77A 4M75F 4M78G 1U1SA 1LNXA 4EMGA 3BFMA 5LJ5d 2DVEA 2RB6A 1KQ1A 2DEQA 5GAN3 2FB7A 4M7AG 4XTUA 2E1HA 5GANd 4HA8A 2E41A 2Y90A 4PJOF 1X01A 2DZCA 4M77D 1YCYA 2QTXA 1JBMA 5I21A 5GAN5 4XTVA 3SWNC 5GAN4 4NL3A 2DZ9A 2EJ9A 4M75B 1WQWA 5GMKi 4M75A 5GMKj 4M75E 4N0AC 2I2LA 4C8QC 3HFOA 5LJ3e 5GAN8 3JB9F 5CAIA 3RKXA 4C92E 4XTXA 4C8QG 4DQ2A 4F7UF 3JCMd 3QSUA 3FIFA 4Y91A 5GANf 4M78C 2CGHA 4M75D 3JB9H 3JCMb 2VXFA 5GAOn 1WPYA 3BDUA 5GAOp 5GAOm 3JCMJ 5LJ3f 4M77E 3JCMV 3V7SA 4C92D 2RA2A 4EMKB 5GAMe 4M7DC 4M7AC 3EFSA 4EMKA 4NOYA 2DJZA 3JCMQ 4J5YA 4M7DG 4J6YA 3BW1A 4C92G 2HNIA 1HXDA 1LJOA 4F7UB 2EJFA 4PNOA 5LJ5e 1I8FA 4F7UA 4F7UE 3QHSA 5GAMf 2DTHA 5GAOq 4V2SA 4C8QF 2RD1A 5GANe 1H641 3RUXA 1U1TA 2YLBA 4M77G 3QO3A 4NL2A 4EMHA 1WQ7A 4XU0A 1D3BA 4JRIA 4RCBA 2VXEA 5LJ5f 4M78F 3FJPA 4JRKA 4JLIA 4PJOB 2DTOA 3QUIA 4X9CA 3RIRA 4XQ3A 3JB9I 1TH7A 2ZGWA 3V8KA 1I5LA 1KQ2A 2DXUA 4XTWA 4PJOA 4XU1A 4M7AF 3L1AA 3AHUA 4PJOE 3JCMX 4OP0A 4XTYA 3RERA 5LJ3h 3JCMe 5GAN7 5GMKe 4HT9A 2RM4A 5LJ3j 5GAMg 5DY9A 4C92C 2DKGA 2E64A 3BY7A 4M75G 1I81A 3L2ZA 4PJOD 4J6XA 1M5Q1 4A53A 5GAOr 5GAOl 1HK9A 4J6WA
chains in the Genus database with same CATH superfamily
2JS2A 4BACA 1E6HA 2ZZDA 1YIJQ 1R8OB 4ELZC 1D1BA 2QAZA 2E3IA 1Z9ZA 3EH2A 2ROLA 2XDDA 2CKKA 2K7AA 4QVCA 1W2BS 2JMAA 5CKDA 1ZA1B 3MEUA 4LDWA 3CMEA 2LX9A 2HDAA 1VQNQ 5I11A 1ZSZB 2FG0A 1ZSZA 3CC4T 3J7AF 3INZA 1M90U 4M7AB 2QQ9A 4C92B 1JJ2S 3PMIA 2RK1A 1OV3A 4C92A 3EFRA 1K76A 3EGXB 2PVDB 1G83A 3EGXA 1N5ZA 1PHTA 2DIGA 4PJLA 3M0TA 5KH6A 1QVFS 1HYOA 5DM7R 2E1HA 2JM9A 1YN8A 5GAN5 1UGVA 4FSXA 2J7IA 1ZHIA 5CIUA 2EJ9A 5I2SA 2NUTB 3HFOA 2L2PA 2NUTA 1QVGS 3S3NA 3EFOB 1WPYA 1JEGA 3EFOA 2CP0A 4FYYB 1O75A 4BDYA 4C92G 2B86A 2H8HA 2X35A 5FU7C 5KCHA 1VQOA 4QQGA 2BIVA 3I56A 5J39A 3QXEB 3A5ZB 1J3TA 4RCBA 3C95A 2QASA 2W0ZA 4PJOE 1H92A 1PRLC 1UTIA 3F70A 1B7TA 1PSFA 3U23A 5GMKe 4E7LA 2OAUA 2HSEB 4D8DA 3I56T 4BI8B 4IUUA 3LGLA 4OMPA 1UHFA 4RCCA 3EAEA 5HK3A 1M8MA 1Q81C 1SKUB 2K2MA 2LNVA 4J9DA 1B34B 2HBPA 1B34A 2HKQB 1K9MC 2DVJA 3H8ZA 1QKXA 1BIAA 2FVUA 4M7DF 1QVFP 1WHJA 1WX6A 1K9MR 3HSBA 2PUKB 1K73C 4GBQA 3O8VA 4E47A 2HQXA 2PZ1A 2JNGA 4Y28E 1K73R 5CQXA 3NMZC 1WJQA 2DETA 2E12A 2ZPGB 3CCLQ 4LDVA 1VA7A 4M7AD 1KQ1A 3H9NA 5KYYB 1V29B 3VRZA 4XTUA 5KYYA 1FX7A 1X01A 2FZCB 3M58A 1M27C 1BCMA 1H8KA 4KUDK 5HCKA 2RJDA 4CC3A 4LNPA 4KGVB 3TQ7P 4F7UF 4QKUA 1IHWA 3G6EQ 3UT1A 3ASKA 4RMOA 2P4TA 3UPUA 4TVRA 1K1ZA 2X4XA 3SDZA 2COZA 2CUDA 4J9FA 4OB2B 3RUXA 1U1TA 3OW2P 2DJQA 1VOMA 3CBMA 1M4ZA 1PG5B 1W2BA 2H3JA 2PVOB 3L1AA 3QYHB 3RERA 1QCNA 1SG5A 3UDCA 3M59A 2X4JA 3VJPA 3CCEQ 4QT7A 2YHTA 4HKEA 1JJ2A 2O88A 4LDXA 1TS9A 4HT8A 1FMVA 4EPCA 2KSSA 2XKOC 3CCUA 4RG2A 4MDWA 1QVFA 2JXBA 2DFUA 1VYTA 3JCMc 2CREA 1AWXA 1XOVA 4RTWA 4FYVB 3V8JA 4BE0A 1VQPA 4M7DB 3OYYA 3IQLA 2MI6A 3VU3C 4KGXB 5AYFA 3CCUT 4M7DA 1QVGA 1I07A 2VUBA 4LN2A 4ZGEB 2K5IA 4KULA 2DAQA 2WSEE 2RB6A 1X43A 1VQPT 3QZ5B 4A63B 1YJWQ 4B6MA 4N4IA 3M5AA 1TWBA 3CCSQ 4E7JA 5L8RE 1SSHA 2MMPA 1AWJA 4KBMB 5GAN8 4JJCA 2DIQA 4KUIA 3LLRA 2KE9A 5FRMA 1HJDA 3JB9H 4J5YA 4M7DG 2FRYA 1KC8U 4F7UB 3CC2A 2CP3A 4F7UA 2MF2A 2PQWA 1G3SA 2DTHA 2RQWA 3S3MA 5GANe 3L42A 3VUBA 2BE9B 2RHIA 3L2VA 4BB7A 1ABOA 2FL7A 1TG0A 4A4HA 1I5LA 1EX4A 4LD6A 1WXTA 1SHFA 2LNHB 3VV0A 1WJSA 4JPBW 2ZAEA 4FIBA 2KRMA 5GAOl 2RJCA 2L3PA 4E7SA 1KQSP 3FJ5A 3NTKA 2M16A 2CP6A 5AT1B 5GANg 1VYUA 3HRTA 4R0KA 4E7IA 3I35A 2KRSA 5LJ3g 1YHQA 3QDFA 3I9QA 2V8IA 4F7UG 5GANj 2D8HA 2JTFA 2L5QA 1AOJA 2E10A 2EYXA 5FWCA 5A0GA 4RTXA 1P92A 5DLQE 3URGA 1B3QA 1K8AU 1ZUUA 1W1FA 2D8JA 3LW5E 4ZGJB 4M7AE 4MMKA 4OGEA 4N4GA 4Z88A 2K57A 4HCKA 4M7DD 2GTJA 1LNXA 2HMAA 2P4RA 3FRNA 2DEQA 1YIJA 2EQMA 2HSPA 5HK0A 3CD6Q 3PT9A 4L59A 1VQ6A 1IO6A 3M0UA 2QA4Q 1NZ9A 1W70A 3JB9F 4IUVA 3N5BB 1KIKA 1FYNA 2RI5A 3MEAA 1BI0A 5GAOn 1U06A 2CZ0B 1VQ6T 4LDUA 3EG9B 2ROTA 2EJFA 3FC3A 3EG9A 1SHGA 1Q86C 2K2VA 3C12A 4IURA 2KEAA 3G4SA 2AKKA 1NE8A 1NLOC 4R56A 5CKBA 2LCSA 4XU0A 1D3BA 1Q86R 2VXEA 3GNGA 3JSCA 3EGUA 3RIRA 3JB9I 1N8RR 1MNDA 2V26A 4XU1A 1OYXA 2QDLA 2C0TA 2PTKA 2DKGA 3G4ST 4J6XA 2LQWA 2ENMA 2QYZA 1PC0A 1H3ZA 4AFQC 1U3OA 4B9WA 3M0QA 2E65A 1PKSA 4IIMA 2Y4XA 3M0RA 4AG2C 1Q7YC 2RNAA 1NJIU 2E4HA 1BK2A 2RJFA 1JQQA 4X9DA 4XU3A 1VQMT 1WXBA 5L23A 3OYIA 4FL6A 1IHVA 3KFVA 2DERA 9ATCB 5LJ3d 3OS0A 3CEYA 3C4SA 1T3LA 1XTDA 4OVAA 3JB9J 1NLPC 1B07A 4JRQA 1GCQC 1BBZA 1M1FA 4ZNXA 2B8AA 2X4YA 4JUVA 1D1CA 3KUFA 1U1SA 1RLPC 3BFMA 3M57A 4CC4B 2DM1A 2XHCA 4J9EA 2L3QA 1ACMB 2K5LA 2LCLA 1RI0A 1AWOA 1QWFA 2C0OA 2EPDA 1M3AA 5FU6C 4RTZA 1N6AA 3SWNC 4IIOA 1ZLMA 2K3BA 3RR6A 5I2MA 1D0YA 3A8OB 1YJNT 2R5AA 1LPLA 2KGTA 3NPFA 4MDXA 4HVVA 1UJYA 3EHRA 2JOYA 2QEXQ 2VXFA 3RBBB 3NGPA 3CCVA 5IXFA 5GAMe 4M77E 3DKMA 4EMKB 3SEMA 3VRYA 4EMKA 4J6YA 2ED1A 5FROA 3BW1A 1IZ6A 3GLXA 5CKEA 2RH2A 1S1NA 3QG1A 2JT4A 4Q5WA 1I1JA 2GTOA 4NL2A 3OYEA 2Z0WA 3RNJA 3CCVT 3J81E 3CBPA 3E1SA 3R6NA 4ESRA 2DTOA 3QUIA 2AZVA 2ZGWA 4XTWA 3MP1A 4HT9A 3GOXA 5GAMg 2LJ0A 3LH0A 4A53A 2M9UA 4J6WA 3G6EA 3X20B 5GAMj 1M9SA 2KROA 2LRQA 2BUDA 2DXTA 2ZPHB 1M2OA 1KG1A 1LOJA 5IN1A 2KY9A 3JB9G 1UFFA 1U5SA 4FW1A 3CC7A 4C8QB 3V7RA 4C8QA 1JB0E 2FYKA 1X27A 3OYCA 1QLYA 1YI2Q 1N9RA 3CCRT 4L5GA 3SB2A 2MWPA 3TSZA 1KJWA 4M7DE 1WZOA 3OSSC 3WVDB 5GMKl 3CC7T 3EG3A 2JTEA 2QDYB 2EYWA 3CCEA 2LCCA 5LJ5d 4MZPA 2V1QA 3M56A 1FWZA 2YUQA 4ZGDB 1VQKQ 3QJ6A 1ZBJA 3G71A 3PNWC 4C8QG 3P8HA 3QPHA 5I22A 4M78C 3KBGA 3CMET 1KSWA 4C5EA 3JCMb 3CXCS 2CP5A 3FLGA 4JZ3A 1WDXA 2XK0A 2EBPA 1AD5A 2CSIA 4F04B 1V1CA 4F7UE 3G71T 3X24B 5IHIA 3CMAQ 2RD1A 3VS2A 1NBEB 1YNZA 3L2WA 1RAGB 2K9GA 4M78F 1VQ7Q 4X9CA 2CZ6B 4RG8A 1KQ2A 1NYFA 2QQSA 3V8KA 4DBHA 1YJWA 2VV5A 4XTYA 5LJ3h 3JCMe 1VQ9A 4HXJA 5IHKA 3HTRA 1T0HA 1VQ4A 3CCJQ 1BKBA 2V8JA 2GQVA 2VGMA 4A54A 1VQ9T 4Z8AA 4BE2A 5C0MA 3ZEHA 4HCCA 3QYGB 1S72A 3OBYA 2EGAA 1VQOT 1AWWA 3A8GB 3L2QA 3JCMg 1G3YA 1VQ4T 3I55A 2DPPB 3CCQA 1MNEA 2RO0A 1TTHB 1IREB 1UGRB 2KT8A 4FM4B 2AIRB 3CCMA 2OX7A 4C8QD 3GP8A 4FU6A 4E7ZA 5C6SA 5EC7A 1VQLQ 5KYWB 3HFNA 3OW2S 1AEYA 5KYWA 1S72T 1QMCA 3CXCP 2EYYA 5IAYA 3I55T 3CCQT 4YTLA 5D6XA 5KYNA 2OTJA 3CCMT 1T0JA 1QCOA 4CRIA 4ZN3A 1GRIA 1YWOA 2HQEA 2CH4A 4X34A 2MYSA 4OGCA 5GMKj 4N0AC 4DEYA 1VQ8Q 3VS0A 1JXMA 3WXMB 2KMTA 1M2VB 1JXOA 4WCIA 3VYGA 1M2VA 4XK8E 5GANf 2OTJT 3X26B 2J6FA 3VS7A 5LJ3f 4C92D 4NOYA 2HL5C 2O9SA 1VQ5A 2DK3A 3E19A 4OB0B 4E6RA 4PNOA 1HD3A 1NPRA 2HAXA 2D0NA 4V2SA 1IGUA 2RJEA 1R0CB 2X3XD 5CK9A 1TOVA 4JLIA 1LCKA 2VYTA 3MEWA 3H41A 1TH7A 1OQKA 2DXUA 1VQ5T 1WIEA 4OMFB 3ME9A 1VYVA 3PE0A 5EG2A 3OYLA 2FPEA 1Q82C 5GAOr 2J6OA 4RTTA 2BE7D 4BDZA 3FB9A 4KH0B 4JRPA 3KXTA 2KYMA 1ZX6A 1Q82R 2FO0A 3UA6A 1WI7A 3M53A 2GNCA 5LJ5h 4LUDA 1I0CA 3PFSA 4P5NA 1Q81U 2RI2A 1M1KC 4A4GA 1X69A 4M75C 3TVTA 3VS5A 1X6OA 1M1KR 1RUWA 2ED0A 1WYXA 2XDPA 4PJOC 1PD0A 2EAYA 1K73U 5D7UA 1YITA 1TUGB 3OS5A 5FU7B 3CXCA 2D0QB 1EFNA 1WHLA 1PD1A 2A7YA 1WXUA 2Y4YA 4M75F 4M78G 1UDLA 3CC4Q 1KC8C 1UUEA 4J9HA 3QDRB 2P84A 4PJOF 1YITT 1KHCA 3PIPA 2QTXA 2KXDA 2EKHA 1KC8R 4PL6A 1UGQB 3DB3A 5KYXB 4NL3A 2MOXA 3PVLA 5KYXA 2D1XA 7AT1B 1KQSS 3M9QA 1NEBA 3HHTB 5CAIA 2EW3A 2OI3A 2DBKA 3QSUA 1PM3A 2NUZA 2GBQA 5GAOp 1YJ9A 2BZ8A 2LT4A 4J9CA 1QQJA 2YWWA 4GY5A 1D1AA 2G3RA 1AHJB 2E5KA 1PCXA 2HNIA 4JJBA 3HP9A 5CKFA 1AT1B 3GF5A 2E6NA 1YJ9T 5LJ5f 4ZTFA 1OI1A 2NYSA 4C0DC 2JTMA 4PJJA 3AT1B 1X2KA 2VWFA 1PWTA 4D6WA 1Q95G 1UB4A 2HQHA 3PMTA 2DBMA 2LJ3A 3RKWA 3WVEB 1W6XA 1MMGA 2QEXA 3OW2A 1C6VX 2M0OA 3I56Q 1M3BA 2VKNA 3META 2ZPIB 3CC2T 4RUGA 1IB8A 4C8QE 2YT6A 1OPLA 3Q1JA 4MMLA 4E2FB 4XU2A 2K3YA 1GCPA 3V8LA 1E7OA 2P0KA 1RI9A 1BYMA 1KD1U 2CSQA 4OMQA 1N27A 3MHXA 2A3LA 1TUCA 2EVRA 3THKA 3G7ZA 1NEGA 2E41A 2DD5A 2EQKA 3PTAA 2AT1B 2J05A 4LUEA 2IG0A 3DLLA 1QP2A 4M75B 1SSFA 3NHNA 4M75A 2E3HA 3VS4A 1XQHA 1V76A 2YRVA 1YHQT 1RAHB 4C92E 3DB4A 3HPWA 2DD4A 1OZ2A 1SF9A 1NG2A 3C0CA 3HRSA 3A98A 1YI2A 5FLXE 4K11A 1FMWA 2CP2A 1YP5A 2EYZA 2DL5A 4FT4A 2EQJA 3M0PA 5CR2A 1H641 3QO3A 2KBTA 4IUQA 3OY9A 2EYQA 1JO8A 1YIJT 3ER0A 2O9VA 1VQNA 4J9BA 3MO8A 1VQKA 3BY7A 4M75G 2YUOA 1LVKA 2IPOB 1IRXA 2CDTA 3G1JA 2LQNA 3JCMW 1X6BA 1N8RC 1NM7A 1D3BB 1VQNT 3A8LB 2W10A 4CC7A 3OYJA 4OB1B 4N4HA 2A37A 5LL6S 2K3XA 3CMAA 3ZL7C 2VB6A 3PGGA 3M55A 2ESWA 1UECA 3VS6A 2X51A 1WNLA 2R57A 1AZGB 4JZ4A 3MKDA 2EWNA 1KQSA 5GMKh 2ATCB 3LGFA 4RTUA 2JMCA 4KT0E 4UC4A 3VKIA 4EMGA 1XNIA 2FB7A 2GFAA 3CCUQ 5GANd 1OU9A 4RKUE 2DZCA 4J9GA 4JDSA 4PJMA 2LZ6B 1Z9QA 3RDVA 1RLQC 2QXFA 5GMKi 2HCKA 3OYAA 2I2LA 2XIDA 4ZTJA 4EIKA 1VQPQ 2D9TA 3VS1A 4CC2A 1ZSZC 4M75D 4ANJA 1TU0B 2ABLA 3ZFJA 4M7AC 4XAXB 2WSFE 1M30A 2OJ2A 4LE9A 2CT3A 2RHXA 3UWNA 1VQLA 1HXDA 1MV3A 4M4ZA 8AT1B 2O01E 1I8FA 3CPFA 2JVVA 6AT1B 5GAOq 4JJNK 2RI3A 1Q86U 4PKCC 2YLBA 1WQ7A 2R58A 3PVQA 4IKFA 4JRKA 1RACB 3RMSA 1PNJA 4M7AF 3H6ZA 2F1LA 3JCMX 4OMOA 4DOWA 2P0QA 2RN8A 3R6OA 2RM4A 1XJWB 4OMLA 5DY9A 3VUZA 2JW4A 2X9HA 2EIFA 1VQ8A 3LH5A 2XU8A 3REBB 2COWA 2RHUA 3OYKA 3CPWS 2F2VA 1KFZA 4J83A 2F5TX 3CCLA 2RMOA 2ZPEB 1N9SA 2OTLQ 2A0FB 3CQTA 1Q7YU 3A8MB 1ARKA 3TCJA 2CH4W 1JRIA 2JS0A 2GCXA 1G3WA 1M90C 3QBYA 2L3SA 3C94A 3CCLT 3GNFB 5CKHA 3RKYA 1OZ3A 1VIFA 1W4SA 1Y96B 2A36A 2DRMA 2COYA 4GLMA 1Y96A 3OYFA 1M90R 4PLIA 2DYIA 2QTVA 1TUDA 2F2WA 1ZSGA 3JV3A 3OYHA 4A4KA 1BCOA 5CQYA 3EG1A 4A4FA 3G6ET 3PIOA 1R0BG 2JUFA 3OS2A 2XICA 4XTVA 3A1PA 1NPPA 1WQWA 3QZ9B 3VS3A 3E2UA 4JS5A 5IXBA 4OMMA 2H3EB 2DEUA 4AFUC 3NTHA 5J26A 2CGHA 2FZGB 2KRNA 2QK0A 3X25B 3JCMV 1QWEA 1QP3A 1FXXA 3HRUA 2MWOA 2QQRA 4BE1A 2FHDA 2XI9A 3MP8A 2RPNA 3MCAB 2KDSA 2ECZA 3UA7A 3CPWP 4Z89A 3OB9A 3QHSA 2HZYA 2V8KA 2J6KA 3VYHB 3CC4A 4LDYA 1VQ6Q 1C0MA 2J06A 3CCET 5CVIA 1GBRA 2QQBA 2XG8D 3E9FA 2DL3A 1KHIA 2DO3A 1OPKA 2LC4A 1GCQA 1M5Q1 4A4EA 2OAWA 2E6ZA 1UGPB 2V1RA 3H0FA 4M77C 5A0DA 1OX8A 2PVGB 2LVMA 4M7AA 3JB9D 2VVKA 4DEXA 3L2RA 3G4SQ 3MPUB 5FU6B 1F1BB 1MMNA 4WF2A 4F14A 2PU9B 5GANh 3SWNB 3SWNA 2KR3A 5D6YA 4O6JA 1E6GA 4KGZB 3CCSA 4WTOB 5KCOA 4L6V5 5D6WA 4M77F 2CUBA 1AZEA 1G2BA 2KK4A 1RADB 1VQMQ 1YJWT 5GAMd 3A8HB 1Y7XA 2EFIA 2AK5A 1BIBA 3CCST 3QIIA 1WHKA 2I0NA 1MMDA 3REAB 4M7AG 2C06A 1YCYA 2O2OA 2HBWA 3T9NA 2WSCE 4DBFA 3L2UA 4M75E 1T3SA 2DF6A 3RKXA 2EGEA 1W2BP 3LWIA 3FIFA 1YWPA 2LTOA 2LMJA 3E9GA 2DMOA 1GXIE 5GAOm 4M7DC 4OB3B 3GPLA 1K0SA 1QVPA 2JJ9A 1YJNQ 3CPWA 4BI3A 2LQKA 3OMCA 1JJ2P 3QWYA 2GQIA 2M0YA 1OX9A 4BI4A 4XQ3A 1Q81R 1X6GA 1SEMA 4OP0A 1GBQA 4J8OA 2RK2A 3OYNA 5ECAA 1EIFA 3HKSA 4HCZA 1UG1A 3CCVQ 3J80E 5IHNA 4R55A 2ZPFB 5A2QE 2AZSA 4J9IA 1QVGP 1AVZC 2RF0A 4C5HA 1YFNA 2GF7A 1VUBA 3CD6A 2IVWA 3M4GA 1D0ZA 2DTIA 1QCFA 5GJWB 2F69A 4FT2A 2K6DA 2QA4A 4DBQA 3LX7A 3NTIA 4M78B 4O5VA 1WFWA 4M78A 4QVDA 3M0SA 3LYIA 1D09B 2QGGA 1WA7A 1UEBA 3CD6T 2LT1A 2F5KA 2JN0A 3OYGA 2CYZB 2YLCA 1MMAA 2QA4T 4M77B 1IGQA 4M77A 3CCRQ 1K9MU 1EZZB 2FRWA 2KXCA 4FYXB 2IIMA 2Y90A 2M1HA 1K9AA 3CC7Q 3GBQA 1TSFA 1MV0B 3ZBDA 1HSQA 2GFUA 3S6WA 2ZPBB 4AMCA 4C5IA 1Y07A 4QW2A 3JCMd 5HY6A 4DQ2A 4LXCA 1UE9A 4Y91A 1DJ7B 2A28A 1KK7A 3O5ZA 4FYWB 1D0XA 1OOTA 2HD0A 3BDUA 1M8VA 4IUTA 3M4YA 2F2XA 4JS4A 3JAME 3JCMQ 1X75C 1G3TA 2O31A 2PUOB 1NYGA 2YUPA 2YSQA 3CMEQ 4J7FA 4M77G 4EMHA 5FRNA 4JRIA 5HKCA 1RL2A 2KQWA 2QG9B 4X1VA 2YXYA 2QGFB 3G71Q 4DA4A 2CZ1B 1QW1A 3OYMA 2L8DA 1I81A 3L2ZA 4D8KA 3EH1A 1RAIB 4RTYA 5GAMh 5A0LA 3OYBA 1Q82U 2DILA 1A0NB 2CT4A 2AKLA 1KD1C 1UHCA 4F17A 1G8XA 1YCSB 4II1A 5GAN2 5CO7A 2MIOA 3GIBA 1WHHA 2QQAA 1KD1R 1CSKA 3RESA 1BU1A 1M1KU 1ZUKA 2MAMA 2DL8A 1ZA2B 2ZCFB 3D7SB 4N0AA 1U8RA 1GL5A 5KE3A 1K8AC 5GAN6 2AHJB 2FEIA 3QKJA 1VQ9Q 4F16A 1MGQA 3TSWA 1K8AR 3OYDA 2HEQA 1VQOQ 1WLPB 3EG2A 4M78D 1VQ4Q 1M1GA 4ZN1A 2BKDN 4GLKA 4PFOA 3ULRB 2QI2A 2M02A 4JJDA 4RTVA 5GAN3 4KH1B 4HA8A 2DA9A 2KT1A 1WHGA 4M77D 2JM8A 2QEXT 1JBMA 1S72Q 1RAFB 5GAN4 2OTLA 1ZQ1A 3I55Q 3CCQQ 1G5VA 2DXBA 2DXCA 5IH2A 5LJ3e 4XTXA 3CCMQ 3MEVA 4FCYA 2VGNA 4VUBA 1PSEA 2K4YA 1OULA 2RA2A 4DOVA 2HL3A 2DJZA 1TXQA 2OTLT 2A08A 3UATA 5J3BA 2PNIA 5GAMf 4AG1C 2OTJQ 5GJVB 4QQDA 1WJRA 2O4XB 2DNUA 3OBWA 2O4XA 3EGDB 1WHMA 1BI3A 3EGDA 4PK4A 4PJOB 4AT1B 4PJOA 2YRDA 1BB9A 2XMFA 4ATOA 2MPXC 5LJ3j 2K5FA 4Y92A 3JRZA 2YDLA 2XD0A 1HK9A 2SEMA 1PKTA 3P8BB 5GMKm 2MK5A 1Y57A 4BD3A 1VQ5Q 4HCBA 3FEOA 4EMKC 2LJ1A 2BTTA 1C1AA 1NJIC 4XTZA 1YI2T 4C0ZA 4C0GA 2RQRA 2DYBA 4HVUA 1NJIR 5CCAA 5IT9E 4FW2A 4C5GA 3I5RA 2R5MA 2EJGA 4IUPA 2E70A 1RAAB 1UJ0A 3JCMh 4PJOG 3DLMA 1R77A 5KYUB 5KYUA 2JZ2A 3UF4A 3X28B 2KYBA 1VQKT 1GFDA 5KE2A 1ZUYA 2DVEA 4EDUA 2SRCA 4E7KA 3NFCA 1BI1A 1WGSA 4FSSA 4C0DB 1VQ7A 2DZ9A 1JU5C 1O9SA 3BDLA 3LWHA 4J7IA 4C8QC 2L89A 1QKWA 2FPFA 2KI7A 1ABQA 1YITQ 3CMAT 4BY6C 2YUNA 1CKAA 4DBRA 4BUGA 4C0FA 2C0IA 2EQIA 4PJNA 3V7SA 3FDRA 4OMNA 3CCJA 1VQ7T 3I5SA 3OMGA 2RHZA 1SPKA 1LJOA 1VQMA 2K79A 2X4WA 2EGCA 3BE3A 5LJ5e 2DLPA 2LX7A 4C8QF 3OA6A 4NS5A 3MJXA 3MP6A 4HVWA 2DL7A 1CKBA 5M9OA 3FJPA 1IXDA 1X2QA 1H3HA 3CCJT 3M54A 3SD4A 1MUZA 1Q7YR 4BY6B 2NUPB 2X3WD 2E64A 4C92C 3OSVA 3SHWA 4PJOD 2NUPA 2M51A 4KRTA 1YJ9Q 2BZYA 4ORZA 5LJ5g 1GFCA 2E5QA 3JCMf 2KAFA 2KNBB 4PLLA 4B9XA 2G6FX 3V7CA 2L3RA 1RAEB 2NLUA 2CS7A 2VC8A 1N8RU 3CBOA 2LQ8A 5LJ5j 3JCMP 1YJNA 2P0PA 1M3CA 4AFZC 1Y71A 4C92F 1VQLT 1FMKA 1SRLA 4CI0C 5FW9A 2NWMA 3QJYA 2GGRA 3OQ5A 3EHQA 4QVZA 2D6FA 1BI2A 4AFSC 4M78E 4MZMA 4OF1A 4ELYC 2LDMA 3CC2Q 3RMQA 1I4K1 1VIEA 3HL8A 3P8DA 3TU4K 1SRMA 3TEEA 2XDBA 2EQUA 1VQ8T 1PRMC 1MHNA 2YRCA 4MZTA 5I21A 2CP7A 2CZ7B 1RABB 2RQUA 2FZKB 1OU8A 2DRKA 4JLGA 1ZBXA 2DE0X 2HKNA 2VASA 4Z02A 3OS1A 1K4US 2MCNA 2KVQG 1Y0MA 4QQ6A 3JCMJ 4PFZA 2DX1A 4PFPA 3EFSA 2RQVA 4LD9K 4E7HA 3S3OA 1YBYA 1YHQQ 1I5OB 5FWBA 2DL4A 2RQTA 1UGSB 3H0IA 3CCRA 2EKOA 3EG0A 1OEBA 8ATCB 2WACA 3SFMA 3TREA 3QWXX 2L0AA 3AHUA 4ME7A 3H0HA 5GAN7 2LP5A 5DLOA 2RHYA 1K0XA 2BZXA 2FPDA
chains in the Genus database with same CATH topology
4B9WA 3RKWA 3WVEB 4BACA 2ZZDA 2E65A 2ZPFB 1R8OB 4ELZC 5A2QE 2QEXA 3OW2A 2Y4XA 2M0OA 1Q7YC 2XDDA 2CKKA 1NJIU 4QVCA 4C5HA 3META 1W2BS 2GF7A 2RJFA 1VUBA 3CD6A 2IVWA 3M4GA 4X9DA 2DTIA 4XU3A 2ZPIB 5CKDA 2F69A 3MEUA 4FT2A 1VQMT 3CC2T 4LDWA 3CMEA 3OYIA 2QA4A 2LX9A 4C8QE 4FL6A 1Q81U 3LX7A 3NTIA 5LJ3d 3OS0A 3CEYA 4M78B 4O5VA 3C4SA 3CC4T 4M78A 4QVDA 3J7AF 1XTDA 3INZA 4OVAA 1M90U 3LYIA 3Q1JA 3JB9J 4MMLA 4M7AB 2QQ9A 4C92B 1JJ2S 3PMIA 4JRQA 2RK1A 4C92A 1UEBA 3CD6T 3EFRA 2K3YA 2LT1A 4XU2A 1M1FA 2B8AA 2F5KA 2JN0A 2CYZB 3V8LA 3OYGA 2P0KA 2YLCA 2PVDB 1BYMA 2X4YA 1KD1U 2QA4T 4JUVA 4M77B 1N27A 3MHXA 4M77A 3KUFA 1U1SA 3BFMA 1K9MU 2A3LA 2DIGA 3M57A 5KH6A 2XHCA 1QVFS 5DM7R 2E1HA 3G7ZA 2E41A 2K5LA 2DD5A 2EQKA 2Y90A 3PTAA 2LCLA 1RI0A 2M1HA 5FU6C 5GAN5 2IG0A 4FSXA 1N6AA 3ZBDA 1ZHIA 5CIUA 3SWNC 3DLLA 1QP2A 2EJ9A 1SSFA 2GFUA 4M75B 5I2MA 3S6WA 2ZPBB 4M75A 5I2SA 4C5IA 1XQHA 3A8OB 3HFOA 1YJNT 2R5AA 2YRVA 1YHQT 1Y07A 4QW2A 4C92E 3JCMd 5HY6A 4DQ2A 3DB4A 3HPWA 2DD4A 4MDXA 1OZ2A 1QVGS 4Y91A 1DJ7B 3S3NA 2JOYA 3HRSA 2VXFA 1YI2A 1WPYA 3BDUA 2HD0A 5FLXE 3CCVA 1M8VA 5GAMe 4IUTA 3DKMA 3M4YA 4M77E 4EMKB 4JS4A 4EMKA 3JAME 1O75A 3JCMQ 1X75C 1G3TA 4J6YA 5FROA 4BDYA 3BW1A 1IZ6A 4C92G 2X35A 4FT4A 5KCHA 5FU7C 2EQJA 3GLXA 5CKEA 1VQOA 4QQGA 2RH2A 2PUOB 2BIVA 3I56A 5J39A 5CR2A 1H641 3QXEB 4J7FA 4M77G 3A5ZB 3QG1A 3QO3A 4Q5WA 4NL2A 4EMHA 3OYEA 3OY9A 4IUQA 4JRIA 4RCBA 5HKCA 5FRNA 2EYQA 3CCVT 3J81E 3CBPA 1RL2A 2KQWA 3E1SA 2DTOA 3C95A 3QUIA 2ZGWA 1YIJT 4PJOE 3ER0A 4XTWA 1VQNA 3MP1A 3F70A 1PSFA 4DA4A 4HT9A 5GMKe 4E7LA 2CZ1B 3MO8A 1QW1A 3GOXA 2OAUA 5GAMg 3OYMA 1VQKA 3BY7A 2L8DA 4M75G 1I81A 3I56T 3L2ZA 3LH0A 4BI8B 4A53A 4IUUA 3LGLA 2M9UA 4J6WA 5GAMh 5A0LA 3OYBA 4RCCA 3G6EA 3JCMW 3EAEA 3X20B 1Q82U 5HK3A 5GAMj 1N8RC 1Q81C 1KD1C 1M9SA 2LNVA 1D3BB 2LRQA 1B34B 2BUDA 1VQNT 2DXTA 2HBPA 2ZPHB 3A8LB 4II1A 1B34A 1KG1A 5GAN2 1K9MC 3OYJA 1LOJA 5CO7A 5IN1A 4OB1B 3H8ZA 3GIBA 2KY9A 3JB9G 4N4HA 1BIAA 2QQAA 5LL6S 2FVUA 4M7DF 3RESA 2K3XA 3CC7A 1M1KU 4C8QB 3CMAA 2MAMA 2ZCFB 3V7RA 4C8QA 4N0AA 1JB0E 2FYKA 3PGGA 1U8RA 3M55A 3HSBA 5KE3A 3OYCA 2PUKB 1K8AC 5GAN6 1K73C 2AHJB 3O8VA 4E47A 3QKJA 1WNLA 1N9RA 2HQXA 2R57A 3CCRT 4L5GA 3SB2A 2EWNA 1MGQA 2MWPA 2JNGA 5GMKh 1KQSA 3OYDA 3LGFA 4Y28E 4M7DE 3OSSC 3WVDB 5CQXA 5GMKl 4M78D 4KT0E 3CC7T 1M1GA 1WJQA 4ZN1A 2BKDN 4UC4A 4GLKA 2E12A 2QDYB 2ZPGB 3VKIA 2QI2A 4LDVA 4M7AD 3CCEA 2LCCA 4EMGA 5LJ5d 1KQ1A 1XNIA 5GAN3 1V29B 2FB7A 2GFAA 4MZPA 4XTUA 5GANd 4HA8A 1FX7A 1X01A 3M56A 4RKUE 2DZCA 3M58A 4M77D 4JDSA 2QEXT 1FWZA 1JBMA 4KUDK 4ZGDB 5GAN4 2OTLA 1ZQ1A 2RJDA 3QJ6A 1G5VA 5GMKi 2DXBA 2DXCA 2QXFA 3OYAA 2I2LA 2XIDA 5LJ3e 3G71A 4ZTJA 3PNWC 4F7UF 4XTXA 4C8QG 3P8HA 3MEVA 2D9TA 3QPHA 2VGNA 4VUBA 3UT1A 4M78C 3KBGA 3CMET 3ASKA 4M75D 4C5EA 1PSEA 2K4YA 3JCMb 4RMOA 3CXCS 2P4TA 3FLGA 3ZFJA 4M7AC 2RA2A 4XAXB 2WSFE 4DOVA 4TVRA 3UPUA 2X4XA 2DJZA 2XK0A 3SDZA 2OTLT 2RHXA 3UWNA 1VQLA 1HXDA 2O01E 5J3BA 1I8FA 3CPFA 2JVVA 4F7UE 3G71T 3X24B 5GAMf 5GAOq 4JJNK 4OB2B 2RD1A 2RI3A 4QQDA 1Q86U 4PKCC 1U1TA 1WJRA 2O4XB 2YLBA 3RUXA 3L2WA 3OBWA 2O4XA 1WQ7A 3CBMA 1M4ZA 2R58A 1W2BA 4IKFA 1BI3A 4M78F 2H3JA 4JRKA 4PJOB 4X9CA 2CZ6B 4RG8A 1KQ2A 4PJOA 2QQSA 3V8KA 3RMSA 1YJWA 2PVOB 2VV5A 3L1AA 4M7AF 3H6ZA 3JCMX 3QYHB 4XTYA 4DOWA 2P0QA 5LJ3h 3JCMe 3RERA 4ATOA 3R6OA 1VQ9A 2RM4A 3UDCA 5LJ3j 5DY9A 3M59A 2X4JA 3VUZA 2EIFA 2K5FA 3JRZA 1VQ8A 3VJPA 2XU8A 2XD0A 2RHUA 1HK9A 2YHTA 3P8BB 4HKEA 3OYKA 5GMKm 1JJ2A 3CPWS 1VQ4A 4BD3A 4LDXA 4J83A 1BKBA 2F5TX 3FEOA 4EMKC 4HT8A 4HCBA 1NJIC 3CCLA 2V8JA 2ZPEB 2GQVA 2VGMA 4XTZA 1YI2T 4C0ZA 4EPCA 4A54A 2KSSA 1N9SA 4C0GA 1VQ9T 2XKOC 5C0MA 4BE2A 3CCUA 4RG2A 4MDWA 3ZEHA 1Q7YU 4HCCA 1QVFA 3A8MB 5CCAA 3QYGB 5IT9E 3TCJA 1S72A 3OBYA 1JRIA 3JCMc 1VQOT 3A8GB 4C5GA 3L2QA 3JCMg 1G3YA 2GCXA 1VQ4T 3I55A 1G3WA 2DPPB 3CCQA 2R5MA 1XOVA 1M90C 2RO0A 2EJGA 3QBYA 2E70A 1IREB 4IUPA 3C94A 3CCLT 3GNFB 4BE0A 3V8JA 1UGRB 5CKHA 4FM4B 1VQPA 3RKYA 1OZ3A 3JCMh 1VIFA 4PJOG 3CCMA 4C8QD 1W4SA 4M7DB 3GP8A 1Y96B 3OYYA 3VU3C 2MI6A 3CCUT 4FU6A 5AYFA 3DLMA 1Y96A 5C6SA 3OYFA 4M7DA 4PLIA 1QVGA 3HFNA 3OW2S 2JZ2A 1S72T 3OYHA 3X28B 2VUBA 5IAYA 3I55T 4ZGEB 1VQKT 2K5IA 4KULA 3CCQT 5KE2A 4A4KA 2DAQA 4YTLA 2WSEE 5D6XA 2DVEA 2RB6A 5CQYA 4EDUA 1VQPT 2OTJA 3QZ5B 3CCMT 4A4FA 3G6ET 4E7KA 3NFCA 3PIOA 4CRIA 1BI1A 4N4IA 4ZN3A 3M5AA 1WGSA 2JUFA 4C0DB 3OS2A 2HQEA 2XICA 4XTVA 1VQ7A 4X34A 1NPPA 2DZ9A 1WQWA 1O9SA 3BDLA 3QZ9B 5L8RE 4OGCA 4JS5A 3LWHA 4E7JA 4J7IA 2MMPA 4N0AC 4C8QC 5GMKj 4KBMB 5GAN8 2L89A 3WXMB 2KMTA 2DIQA 4KUIA 3LLRA 3NTHA 3VYGA 4XK8E 5GANf 5FRMA 3CMAT 5J26A 2OTJT 2CGHA 3JB9H 4BY6C 3X26B 4BUGA 4C0FA 1KC8U 3X25B 5LJ3f 3JCMV 1QP3A 3V7SA 4C92D 3FDRA 1FXXA 3HRUA 4NOYA 2MWOA 2QQRA 4J5YA 3CCJA 1VQ7T 1VQ5A 4M7DG 4BE1A 2FHDA 2RHZA 3OMGA 2XI9A 3MP8A 1LJOA 2DK3A 3E19A 3MCAB 2KDSA 4OB0B 2X4WA 4F7UB 4PNOA 1VQMA 5LJ5e 4F7UA 3CC2A 2MF2A 1NPRA 2PQWA 2HAXA 3OB9A 3QHSA 1G3SA 2DTHA 4V2SA 2RJEA 2V8KA 4C8QF 3S3MA 5GANe 3OA6A 3L42A 3VYHB 4NS5A 3VUBA 3MP6A 3CC4A 4LDYA 2RHIA 5CK9A 3L2VA 5M9OA 3FJPA 3CCET 4JLIA 5CVIA 4BB7A 2QQBA 2FL7A 2VYTA 2XG8D 3MEWA 1TH7A 4A4HA 3CCJT 1I5LA 3E9FA 2DXUA 1VQ5T 4LD6A 4OMFB 3M54A 3SD4A 1KHIA 3ME9A 2DO3A 3VV0A 2LC4A 4C92C 1WJSA 2E64A 3OSVA 4PJOD 5EG2A 3OYLA 4FIBA 1Q82C 1M5Q1 4A4EA 5GAOr 5GAOl 2RJCA 2E6ZA 1UGPB 4BDZA 3FB9A 2E5QA 3JCMf 5LJ5g 4M77C 4JRPA 5A0DA 2PVGB 3NTKA 2KAFA 2M16A 3KXTA 4PLLA 2LVMA 4B9XA 4M7AA 3V7CA 5GANg 3JB9D 3M53A 2L3RA 3HRTA 3L2RA 5LJ5h 4E7IA 2NLUA 2CS7A 2VC8A 1N8RU 3PFSA 3CBOA 2LQ8A 4P5NA 2RI2A 5FU6B 5LJ3g 5LJ5j 3JCMP 4A4GA 4WF2A 1YJNA 1M1KC 2PU9B 2P0PA 5GANh 1YHQA 3SWNB 2V8IA 4F7UG 5GANj 3SWNA 5D6YA 1Y71A 4C92F 4O6JA 1VQLT 2JTFA 2L5QA 4M75C 2E10A 4CI0C 1X6OA 3CCSA 5A0GA 1P92A 5DLQE 3QJYA 5KCOA 4L6V5 2XDPA 3OQ5A 5D6WA 4M77F 3URGA 4PJOC 4QVZA 2D6FA 1BI2A 1K8AU 2EAYA 4M78E 1K73U 4MZMA 1YITA 3LW5E 2KK4A 4OF1A 4ELYC 2LDMA 4ZGJB 4M7AE 1YJWT 4MMKA 5GAMd 3OS5A 3A8HB 1Y7XA 4OGEA 1I4K1 2D0QB 1VIEA 3HL8A 5FU7B 4N4GA 3RMQA 3CXCA 2A7YA 2EFIA 2K57A 4M7DD 1BIBA 3P8DA 2Y4YA 3QIIA 3CCST 4M75F 4M78G 1LNXA 3TU4K 1KC8C 3TEEA 2XDBA 2EQUA 3FRNA 1VQ8T 2DEQA 1YIJA 3QDRB 4M7AG 2EQMA 4PJOF 1YITT 5HK0A 1KHCA 1MHNA 3PT9A 2C06A 1YCYA 3PIPA 2QTXA 4MZTA 4L59A 5I21A 4PL6A 1UGQB 3T9NA 2WSCE 1VQ6A 3DB3A 4NL3A 3L2UA 2CZ7B 1NZ9A 4M75E 1KQSS 3M9QA 3HHTB 3JB9F 4IUVA 5CAIA 3N5BB 3RKXA 4JLGA 1ZBXA 3LWIA 3QSUA 3FIFA 2RI5A 3MEAA 3OS1A 4Z02A 2LTOA 1BI0A 3E9GA 5GAOn 2KVQG 5GAOp 1YJ9A 1GXIE 2LT4A 4QQ6A 5GAOm 3JCMJ 4M7DC 4OB3B 2CZ0B 3GPLA 4GY5A 3EFSA 1VQ6T 1QVPA 2G3RA 1AHJB 4LDUA 4LD9K 4E7HA 3S3OA 1YBYA 2HNIA 2EJFA 3FC3A 1Q86C 3CPWA 4BI3A 2K2VA 2LQKA 3C12A 4IURA 3OMCA 3G4SA 1UGSB 3HP9A 5CKFA 1NE8A 4R56A 3GF5A 2E6NA 5CKBA 2EKOA 3CCRA 4XU0A 1D3BA 1YJ9T 2VXEA 5LJ5f 2WACA 3GNGA 1OI1A 4ZTFA 3JSCA 3SFMA 3TREA 4BI4A 3RIRA 4XQ3A 3JB9I 4C0DC 2JTMA 4XU1A 3AHUA 1OYXA 4ME7A 4OP0A 5GAN7 4D6WA 4J8OA 5DLOA 2DKGA 3G4ST 2RK2A 3OYNA 2RHYA 1EIFA 3HKSA 4HCZA 4J6XA 1UB4A 3PMTA 3J80E 1H3ZA 4BY6B 4R55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHT A;  3FB9 A;  3RKW A;  3JCM f;  4RCC A;  4M77 C;  5GMK m;  5LJ5 g;  5GAM h;  2E65 A;  3JCM W;  5GAM j;  4M7A A;  4EMK C;  4HT8 A;  3V7C A;  5GAN g;  1M8V A;  1D3B B;  3JB9 D;  1B34 B;  2DXT A;  1B34 A;  4XTZ A;  5LJ5 h;  5GAN 2;  2VC8 A;  4A54 A;  1LOJ A;  1N9S A;  5LJ3 g;  5LJ5 j;  3JCM P;  4QVC A;  3GIB A;  4WF2 A;  3JB9 G;  5GAN h;  1BIA A;  3SWN B;  4F7U G;  4M7D F;  3M4G A;  4X9D A;  3RES A;  2DTI A;  3SWN A;  4XU3 A;  5GAN j;  4C92 F;  4M75 C;  3JCM c;  1JRI A;  2E10 A;  4C8Q B;  3JCM g;  3V7R A;  4N0A A;  4C8Q A;  2FYK A;  3PGG A;  4C8Q E;  3HSB A;  5GAN 6;  2EJG A;  4PJO C;  5LJ3 d;  1WNL A;  1N9R A;  4M77 F;  4M78 B;  3V8J A;  3SB2 A;  2EWN A;  4M78 A;  3RKY A;  4QVD A;  1MGQ A;  2EAY A;  3INZ A;  4M78 E;  4PJO G;  3JCM h;  4C8Q D;  5GMK h;  3JB9 J;  4M7D B;  4MML A;  1Y96 B;  4M7A B;  3VU3 C;  4M7D A;  4C92 B;  1Y96 A;  4M7D E;  4C92 A;  4M7A E;  3EFR A;  4MMK A;  4XU2 A;  3HFN A;  5GAM d;  5GMK l;  2JN0 A;  3V8L A;  4M78 D;  1I4K 1;  2YLC A;  4JUV A;  2K57 A;  4M77 B;  4M7D D;  1BIB A;  4M7A D;  4M77 A;  4M75 F;  4M78 G;  1U1S A;  1LNX A;  4EMG A;  3BFM A;  5LJ5 d;  2DVE A;  2RB6 A;  1KQ1 A;  2DEQ A;  5GAN 3;  2FB7 A;  4M7A G;  4XTU A;  2E1H A;  5GAN d;  4HA8 A;  2E41 A;  2Y90 A;  4PJO F;  1X01 A;  2DZC A;  4M77 D;  1YCY A;  2QTX A;  1JBM A;  5I21 A;  5GAN 5;  4XTV A;  3SWN C;  5GAN 4;  4NL3 A;  2DZ9 A;  2EJ9 A;  4M75 B;  1WQW A;  5GMK i;  4M75 A;  5GMK j;  4M75 E;  4N0A C;  2I2L A;  4C8Q C;  3HFO A;  5LJ3 e;  5GAN 8;  3JB9 F;  5CAI A;  3RKX A;  4C92 E;  4XTX A;  4C8Q G;  4DQ2 A;  4F7U F;  3JCM d;  3QSU A;  3FIF A;  4Y91 A;  5GAN f;  4M78 C;  2CGH A;  4M75 D;  3JB9 H;  3JCM b;  2VXF A;  5GAO n;  1WPY A;  3BDU A;  5GAO p;  5GAO m;  3JCM J;  5LJ3 f;  4M77 E;  3JCM V;  3V7S A;  4C92 D;  2RA2 A;  4EMK B;  5GAM e;  4M7D C;  4M7A C;  3EFS A;  4EMK A;  4NOY A;  2DJZ A;  3JCM Q;  4J5Y A;  4M7D G;  4J6Y A;  3BW1 A;  4C92 G;  2HNI A;  1HXD A;  1LJO A;  4F7U B;  2EJF A;  4PNO A;  5LJ5 e;  1I8F A;  4F7U A;  4F7U E;  3QHS A;  5GAM f;  2DTH A;  5GAO q;  4V2S A;  4C8Q F;  2RD1 A;  5GAN e;  1H64 1;  3RUX A;  1U1T A;  2YLB A;  4M77 G;  3QO3 A;  4NL2 A;  4EMH A;  1WQ7 A;  4XU0 A;  1D3B A;  4JRI A;  4RCB A;  2VXE A;  5LJ5 f;  4M78 F;  3FJP A;  4JRK A;  4JLI A;  4PJO B;  2DTO A;  3QUI A;  4X9C A;  3RIR A;  4XQ3 A;  3JB9 I;  1TH7 A;  2ZGW A;  3V8K A;  1I5L A;  1KQ2 A;  2DXU A;  4XTW A;  4PJO A;  4XU1 A;  4M7A F;  3L1A A;  3AHU A;  4PJO E;  3JCM X;  4OP0 A;  4XTY A;  3RER A;  5LJ3 h;  3JCM e;  5GAN 7;  5GMK e;  4HT9 A;  2RM4 A;  5LJ3 j;  5GAM g;  5DY9 A;  4C92 C;  2DKG A;  2E64 A;  3BY7 A;  4M75 G;  1I81 A;  3L2Z A;  4PJO D;  4J6X A;  1M5Q 1;  4A53 A;  5GAO r;  5GAO l;  1HK9 A;  4J6W A; 
#chains in the Genus database with same CATH topology
 2JS2 A;  4BAC A;  1E6H A;  2ZZD A;  1YIJ Q;  1R8O B;  4ELZ C;  1D1B A;  2QAZ A;  2E3I A;  1Z9Z A;  3EH2 A;  2ROL A;  2XDD A;  2CKK A;  2K7A A;  4QVC A;  1W2B S;  2JMA A;  5CKD A;  1ZA1 B;  3MEU A;  4LDW A;  3CME A;  2LX9 A;  2HDA A;  1VQN Q;  5I11 A;  1ZSZ B;  2FG0 A;  1ZSZ A;  3CC4 T;  3J7A F;  3INZ A;  1M90 U;  4M7A B;  2QQ9 A;  4C92 B;  1JJ2 S;  3PMI A;  2RK1 A;  1OV3 A;  4C92 A;  3EFR A;  1K76 A;  3EGX B;  2PVD B;  1G83 A;  3EGX A;  1N5Z A;  1PHT A;  2DIG A;  4PJL A;  3M0T A;  5KH6 A;  1QVF S;  1HYO A;  5DM7 R;  2E1H A;  2JM9 A;  1YN8 A;  5GAN 5;  1UGV A;  4FSX A;  2J7I A;  1ZHI A;  5CIU A;  2EJ9 A;  5I2S A;  2NUT B;  3HFO A;  2L2P A;  2NUT A;  1QVG S;  3S3N A;  3EFO B;  1WPY A;  1JEG A;  3EFO A;  2CP0 A;  4FYY B;  1O75 A;  4BDY A;  4C92 G;  2B86 A;  2H8H A;  2X35 A;  5FU7 C;  5KCH A;  1VQO A;  4QQG A;  2BIV A;  3I56 A;  5J39 A;  3QXE B;  3A5Z B;  1J3T A;  4RCB A;  3C95 A;  2QAS A;  2W0Z A;  4PJO E;  1H92 A;  1PRL C;  1UTI A;  3F70 A;  1B7T A;  1PSF A;  3U23 A;  5GMK e;  4E7L A;  2OAU A;  2HSE B;  4D8D A;  3I56 T;  4BI8 B;  4IUU A;  3LGL A;  4OMP A;  1UHF A;  4RCC A;  3EAE A;  5HK3 A;  1M8M A;  1Q81 C;  1SKU B;  2K2M A;  2LNV A;  4J9D A;  1B34 B;  2HBP A;  1B34 A;  2HKQ B;  1K9M C;  2DVJ A;  3H8Z A;  1QKX A;  1BIA A;  2FVU A;  4M7D F;  1QVF P;  1WHJ A;  1WX6 A;  1K9M R;  3HSB A;  2PUK B;  1K73 C;  4GBQ A;  3O8V A;  4E47 A;  2HQX A;  2PZ1 A;  2JNG A;  4Y28 E;  1K73 R;  5CQX A;  3NMZ C;  1WJQ A;  2DET A;  2E12 A;  2ZPG B;  3CCL Q;  4LDV A;  1VA7 A;  4M7A D;  1KQ1 A;  3H9N A;  5KYY B;  1V29 B;  3VRZ A;  4XTU A;  5KYY A;  1FX7 A;  1X01 A;  2FZC B;  3M58 A;  1M27 C;  1BCM A;  1H8K A;  4KUD K;  5HCK A;  2RJD A;  4CC3 A;  4LNP A;  4KGV B;  3TQ7 P;  4F7U F;  4QKU A;  1IHW A;  3G6E Q;  3UT1 A;  3ASK A;  4RMO A;  2P4T A;  3UPU A;  4TVR A;  1K1Z A;  2X4X A;  3SDZ A;  2COZ A;  2CUD A;  4J9F A;  4OB2 B;  3RUX A;  1U1T A;  3OW2 P;  2DJQ A;  1VOM A;  3CBM A;  1M4Z A;  1PG5 B;  1W2B A;  2H3J A;  2PVO B;  3L1A A;  3QYH B;  3RER A;  1QCN A;  1SG5 A;  3UDC A;  3M59 A;  2X4J A;  3VJP A;  3CCE Q;  4QT7 A;  2YHT A;  4HKE A;  1JJ2 A;  2O88 A;  4LDX A;  1TS9 A;  4HT8 A;  1FMV A;  4EPC A;  2KSS A;  2XKO C;  3CCU A;  4RG2 A;  4MDW A;  1QVF A;  2JXB A;  2DFU A;  1VYT A;  3JCM c;  2CRE A;  1AWX A;  1XOV A;  4RTW A;  4FYV B;  3V8J A;  4BE0 A;  1VQP A;  4M7D B;  3OYY A;  3IQL A;  2MI6 A;  3VU3 C;  4KGX B;  5AYF A;  3CCU T;  4M7D A;  1QVG A;  1I07 A;  2VUB A;  4LN2 A;  4ZGE B;  2K5I A;  4KUL A;  2DAQ A;  2WSE E;  2RB6 A;  1X43 A;  1VQP T;  3QZ5 B;  4A63 B;  1YJW Q;  4B6M A;  4N4I A;  3M5A A;  1TWB A;  3CCS Q;  4E7J A;  5L8R E;  1SSH A;  2MMP A;  1AWJ A;  4KBM B;  5GAN 8;  4JJC A;  2DIQ A;  4KUI A;  3LLR A;  2KE9 A;  5FRM A;  1HJD A;  3JB9 H;  4J5Y A;  4M7D G;  2FRY A;  1KC8 U;  4F7U B;  3CC2 A;  2CP3 A;  4F7U A;  2MF2 A;  2PQW A;  1G3S A;  2DTH A;  2RQW A;  3S3M A;  5GAN e;  3L42 A;  3VUB A;  2BE9 B;  2RHI A;  3L2V A;  4BB7 A;  1ABO A;  2FL7 A;  1TG0 A;  4A4H A;  1I5L A;  1EX4 A;  4LD6 A;  1WXT A;  1SHF A;  2LNH B;  3VV0 A;  1WJS A;  4JPB W;  2ZAE A;  4FIB A;  2KRM A;  5GAO l;  2RJC A;  2L3P A;  4E7S A;  1KQS P;  3FJ5 A;  3NTK A;  2M16 A;  2CP6 A;  5AT1 B;  5GAN g;  1VYU A;  3HRT A;  4R0K A;  4E7I A;  3I35 A;  2KRS A;  5LJ3 g;  1YHQ A;  3QDF A;  3I9Q A;  2V8I A;  4F7U G;  5GAN j;  2D8H A;  2JTF A;  2L5Q A;  1AOJ A;  2E10 A;  2EYX A;  5FWC A;  5A0G A;  4RTX A;  1P92 A;  5DLQ E;  3URG A;  1B3Q A;  1K8A U;  1ZUU A;  1W1F A;  2D8J A;  3LW5 E;  4ZGJ B;  4M7A E;  4MMK A;  4OGE A;  4N4G A;  4Z88 A;  2K57 A;  4HCK A;  4M7D D;  2GTJ A;  1LNX A;  2HMA A;  2P4R A;  3FRN A;  2DEQ A;  1YIJ A;  2EQM A;  2HSP A;  5HK0 A;  3CD6 Q;  3PT9 A;  4L59 A;  1VQ6 A;  1IO6 A;  3M0U A;  2QA4 Q;  1NZ9 A;  1W70 A;  3JB9 F;  4IUV A;  3N5B B;  1KIK A;  1FYN A;  2RI5 A;  3MEA A;  1BI0 A;  5GAO n;  1U06 A;  2CZ0 B;  1VQ6 T;  4LDU A;  3EG9 B;  2ROT A;  2EJF A;  3FC3 A;  3EG9 A;  1SHG A;  1Q86 C;  2K2V A;  3C12 A;  4IUR A;  2KEA A;  3G4S A;  2AKK A;  1NE8 A;  1NLO C;  4R56 A;  5CKB A;  2LCS A;  4XU0 A;  1D3B A;  1Q86 R;  2VXE A;  3GNG A;  3JSC A;  3EGU A;  3RIR A;  3JB9 I;  1N8R R;  1MND A;  2V26 A;  4XU1 A;  1OYX A;  2QDL A;  2C0T A;  2PTK A;  2DKG A;  3G4S T;  4J6X A;  2LQW A;  2ENM A;  2QYZ A;  1PC0 A;  1H3Z A;  4AFQ C;  1U3O A;  4B9W A;  3M0Q A;  2E65 A;  1PKS A;  4IIM A;  2Y4X A;  3M0R A;  4AG2 C;  1Q7Y C;  2RNA A;  1NJI U;  2E4H A;  1BK2 A;  2RJF A;  1JQQ A;  4X9D A;  4XU3 A;  1VQM T;  1WXB A;  5L23 A;  3OYI A;  4FL6 A;  1IHV A;  3KFV A;  2DER A;  9ATC B;  5LJ3 d;  3OS0 A;  3CEY A;  3C4S A;  1T3L A;  1XTD A;  4OVA A;  3JB9 J;  1NLP C;  1B07 A;  4JRQ A;  1GCQ C;  1BBZ A;  1M1F A;  4ZNX A;  2B8A A;  2X4Y A;  4JUV A;  1D1C A;  3KUF A;  1U1S A;  1RLP C;  3BFM A;  3M57 A;  4CC4 B;  2DM1 A;  2XHC A;  4J9E A;  2L3Q A;  1ACM B;  2K5L A;  2LCL A;  1RI0 A;  1AWO A;  1QWF A;  2C0O A;  2EPD A;  1M3A A;  5FU6 C;  4RTZ A;  1N6A A;  3SWN C;  4IIO A;  1ZLM A;  2K3B A;  3RR6 A;  5I2M A;  1D0Y A;  3A8O B;  1YJN T;  2R5A A;  1LPL A;  2KGT A;  3NPF A;  4MDX A;  4HVV A;  1UJY A;  3EHR A;  2JOY A;  2QEX Q;  2VXF A;  3RBB B;  3NGP A;  3CCV A;  5IXF A;  5GAM e;  4M77 E;  3DKM A;  4EMK B;  3SEM A;  3VRY A;  4EMK A;  4J6Y A;  2ED1 A;  5FRO A;  3BW1 A;  1IZ6 A;  3GLX A;  5CKE A;  2RH2 A;  1S1N A;  3QG1 A;  2JT4 A;  4Q5W A;  1I1J A;  2GTO A;  4NL2 A;  3OYE A;  2Z0W A;  3RNJ A;  3CCV T;  3J81 E;  3CBP A;  3E1S A;  3R6N A;  4ESR A;  2DTO A;  3QUI A;  2AZV A;  2ZGW A;  4XTW A;  3MP1 A;  4HT9 A;  3GOX A;  5GAM g;  2LJ0 A;  3LH0 A;  4A53 A;  2M9U A;  4J6W A;  3G6E A;  3X20 B;  5GAM j;  1M9S A;  2KRO A;  2LRQ A;  2BUD A;  2DXT A;  2ZPH B;  1M2O A;  1KG1 A;  1LOJ A;  5IN1 A;  2KY9 A;  3JB9 G;  1UFF A;  1U5S A;  4FW1 A;  3CC7 A;  4C8Q B;  3V7R A;  4C8Q A;  1JB0 E;  2FYK A;  1X27 A;  3OYC A;  1QLY A;  1YI2 Q;  1N9R A;  3CCR T;  4L5G A;  3SB2 A;  2MWP A;  3TSZ A;  1KJW A;  4M7D E;  1WZO A;  3OSS C;  3WVD B;  5GMK l;  3CC7 T;  3EG3 A;  2JTE A;  2QDY B;  2EYW A;  3CCE A;  2LCC A;  5LJ5 d;  4MZP A;  2V1Q A;  3M56 A;  1FWZ A;  2YUQ A;  4ZGD B;  1VQK Q;  3QJ6 A;  1ZBJ A;  3G71 A;  3PNW C;  4C8Q G;  3P8H A;  3QPH A;  5I22 A;  4M78 C;  3KBG A;  3CME T;  1KSW A;  4C5E A;  3JCM b;  3CXC S;  2CP5 A;  3FLG A;  4JZ3 A;  1WDX A;  2XK0 A;  2EBP A;  1AD5 A;  2CSI A;  4F04 B;  1V1C A;  4F7U E;  3G71 T;  3X24 B;  5IHI A;  3CMA Q;  2RD1 A;  3VS2 A;  1NBE B;  1YNZ A;  3L2W A;  1RAG B;  2K9G A;  4M78 F;  1VQ7 Q;  4X9C A;  2CZ6 B;  4RG8 A;  1KQ2 A;  1NYF A;  2QQS A;  3V8K A;  4DBH A;  1YJW A;  2VV5 A;  4XTY A;  5LJ3 h;  3JCM e;  1VQ9 A;  4HXJ A;  5IHK A;  3HTR A;  1T0H A;  1VQ4 A;  3CCJ Q;  1BKB A;  2V8J A;  2GQV A;  2VGM A;  4A54 A;  1VQ9 T;  4Z8A A;  4BE2 A;  5C0M A;  3ZEH A;  4HCC A;  3QYG B;  1S72 A;  3OBY A;  2EGA A;  1VQO T;  1AWW A;  3A8G B;  3L2Q A;  3JCM g;  1G3Y A;  1VQ4 T;  3I55 A;  2DPP B;  3CCQ A;  1MNE A;  2RO0 A;  1TTH B;  1IRE B;  1UGR B;  2KT8 A;  4FM4 B;  2AIR B;  3CCM A;  2OX7 A;  4C8Q D;  3GP8 A;  4FU6 A;  4E7Z A;  5C6S A;  5EC7 A;  1VQL Q;  5KYW B;  3HFN A;  3OW2 S;  1AEY A;  5KYW A;  1S72 T;  1QMC A;  3CXC P;  2EYY A;  5IAY A;  3I55 T;  3CCQ T;  4YTL A;  5D6X A;  5KYN A;  2OTJ A;  3CCM T;  1T0J A;  1QCO A;  4CRI A;  4ZN3 A;  1GRI A;  1YWO A;  2HQE A;  2CH4 A;  4X34 A;  2MYS A;  4OGC A;  5GMK j;  4N0A C;  4DEY A;  1VQ8 Q;  3VS0 A;  1JXM A;  3WXM B;  2KMT A;  1M2V B;  1JXO A;  4WCI A;  3VYG A;  1M2V A;  4XK8 E;  5GAN f;  2OTJ T;  3X26 B;  2J6F A;  3VS7 A;  5LJ3 f;  4C92 D;  4NOY A;  2HL5 C;  2O9S A;  1VQ5 A;  2DK3 A;  3E19 A;  4OB0 B;  4E6R A;  4PNO A;  1HD3 A;  1NPR A;  2HAX A;  2D0N A;  4V2S A;  1IGU A;  2RJE A;  1R0C B;  2X3X D;  5CK9 A;  1TOV A;  4JLI A;  1LCK A;  2VYT A;  3MEW A;  3H41 A;  1TH7 A;  1OQK A;  2DXU A;  1VQ5 T;  1WIE A;  4OMF B;  3ME9 A;  1VYV A;  3PE0 A;  5EG2 A;  3OYL A;  2FPE A;  1Q82 C;  5GAO r;  2J6O A;  4RTT A;  2BE7 D;  4BDZ A;  3FB9 A;  4KH0 B;  4JRP A;  3KXT A;  2KYM A;  1ZX6 A;  1Q82 R;  2FO0 A;  3UA6 A;  1WI7 A;  3M53 A;  2GNC A;  5LJ5 h;  4LUD A;  1I0C A;  3PFS A;  4P5N A;  1Q81 U;  2RI2 A;  1M1K C;  4A4G A;  1X69 A;  4M75 C;  3TVT A;  3VS5 A;  1X6O A;  1M1K R;  1RUW A;  2ED0 A;  1WYX A;  2XDP A;  4PJO C;  1PD0 A;  2EAY A;  1K73 U;  5D7U A;  1YIT A;  1TUG B;  3OS5 A;  5FU7 B;  3CXC A;  2D0Q B;  1EFN A;  1WHL A;  1PD1 A;  2A7Y A;  1WXU A;  2Y4Y A;  4M75 F;  4M78 G;  1UDL A;  3CC4 Q;  1KC8 C;  1UUE A;  4J9H A;  3QDR B;  2P84 A;  4PJO F;  1YIT T;  1KHC A;  3PIP A;  2QTX A;  2KXD A;  2EKH A;  1KC8 R;  4PL6 A;  1UGQ B;  3DB3 A;  5KYX B;  4NL3 A;  2MOX A;  3PVL A;  5KYX A;  2D1X A;  7AT1 B;  1KQS S;  3M9Q A;  1NEB A;  3HHT B;  5CAI A;  2EW3 A;  2OI3 A;  2DBK A;  3QSU A;  1PM3 A;  2NUZ A;  2GBQ A;  5GAO p;  1YJ9 A;  2BZ8 A;  2LT4 A;  4J9C A;  1QQJ A;  2YWW A;  4GY5 A;  1D1A A;  2G3R A;  1AHJ B;  2E5K A;  1PCX A;  2HNI A;  4JJB A;  3HP9 A;  5CKF A;  1AT1 B;  3GF5 A;  2E6N A;  1YJ9 T;  5LJ5 f;  4ZTF A;  1OI1 A;  2NYS A;  4C0D C;  2JTM A;  4PJJ A;  3AT1 B;  1X2K A;  2VWF A;  1PWT A;  4D6W A;  1Q95 G;  1UB4 A;  2HQH A;  3PMT A;  2DBM A;  2LJ3 A;  3RKW A;  3WVE B;  1W6X A;  1MMG A;  2QEX A;  3OW2 A;  1C6V X;  2M0O A;  3I56 Q;  1M3B A;  2VKN A;  3MET A;  2ZPI B;  3CC2 T;  4RUG A;  1IB8 A;  4C8Q E;  2YT6 A;  1OPL A;  3Q1J A;  4MML A;  4E2F B;  4XU2 A;  2K3Y A;  1GCP A;  3V8L A;  1E7O A;  2P0K A;  1RI9 A;  1BYM A;  1KD1 U;  2CSQ A;  4OMQ A;  1N27 A;  3MHX A;  2A3L A;  1TUC A;  2EVR A;  3THK A;  3G7Z A;  1NEG A;  2E41 A;  2DD5 A;  2EQK A;  3PTA A;  2AT1 B;  2J05 A;  4LUE A;  2IG0 A;  3DLL A;  1QP2 A;  4M75 B;  1SSF A;  3NHN A;  4M75 A;  2E3H A;  3VS4 A;  1XQH A;  1V76 A;  2YRV A;  1YHQ T;  1RAH B;  4C92 E;  3DB4 A;  3HPW A;  2DD4 A;  1OZ2 A;  1SF9 A;  1NG2 A;  3C0C A;  3HRS A;  3A98 A;  1YI2 A;  5FLX E;  4K11 A;  1FMW A;  2CP2 A;  1YP5 A;  2EYZ A;  2DL5 A;  4FT4 A;  2EQJ A;  3M0P A;  5CR2 A;  1H64 1;  3QO3 A;  2KBT A;  4IUQ A;  3OY9 A;  2EYQ A;  1JO8 A;  1YIJ T;  3ER0 A;  2O9V A;  1VQN A;  4J9B A;  3MO8 A;  1VQK A;  3BY7 A;  4M75 G;  2YUO A;  1LVK A;  2IPO B;  1IRX A;  2CDT A;  3G1J A;  2LQN A;  3JCM W;  1X6B A;  1N8R C;  1NM7 A;  1D3B B;  1VQN T;  3A8L B;  2W10 A;  4CC7 A;  3OYJ A;  4OB1 B;  4N4H A;  2A37 A;  5LL6 S;  2K3X A;  3CMA A;  3ZL7 C;  2VB6 A;  3PGG A;  3M55 A;  2ESW A;  1UEC A;  3VS6 A;  2X51 A;  1WNL A;  2R57 A;  1AZG B;  4JZ4 A;  3MKD A;  2EWN A;  1KQS A;  5GMK h;  2ATC B;  3LGF A;  4RTU A;  2JMC A;  4KT0 E;  4UC4 A;  3VKI A;  4EMG A;  1XNI A;  2FB7 A;  2GFA A;  3CCU Q;  5GAN d;  1OU9 A;  4RKU E;  2DZC A;  4J9G A;  4JDS A;  4PJM A;  2LZ6 B;  1Z9Q A;  3RDV A;  1RLQ C;  2QXF A;  5GMK i;  2HCK A;  3OYA A;  2I2L A;  2XID A;  4ZTJ A;  4EIK A;  1VQP Q;  2D9T A;  3VS1 A;  4CC2 A;  1ZSZ C;  4M75 D;  4ANJ A;  1TU0 B;  2ABL A;  3ZFJ A;  4M7A C;  4XAX B;  2WSF E;  1M30 A;  2OJ2 A;  4LE9 A;  2CT3 A;  2RHX A;  3UWN A;  1VQL A;  1HXD A;  1MV3 A;  4M4Z A;  8AT1 B;  2O01 E;  1I8F A;  3CPF A;  2JVV A;  6AT1 B;  5GAO q;  4JJN K;  2RI3 A;  1Q86 U;  4PKC C;  2YLB A;  1WQ7 A;  2R58 A;  3PVQ A;  4IKF A;  4JRK A;  1RAC B;  3RMS A;  1PNJ A;  4M7A F;  3H6Z A;  2F1L A;  3JCM X;  4OMO A;  4DOW A;  2P0Q A;  2RN8 A;  3R6O A;  2RM4 A;  1XJW B;  4OML A;  5DY9 A;  3VUZ A;  2JW4 A;  2X9H A;  2EIF A;  1VQ8 A;  3LH5 A;  2XU8 A;  3REB B;  2COW A;  2RHU A;  3OYK A;  3CPW S;  2F2V A;  1KFZ A;  4J83 A;  2F5T X;  3CCL A;  2RMO A;  2ZPE B;  1N9S A;  2OTL Q;  2A0F B;  3CQT A;  1Q7Y U;  3A8M B;  1ARK A;  3TCJ A;  2CH4 W;  1JRI A;  2JS0 A;  2GCX A;  1G3W A;  1M90 C;  3QBY A;  2L3S A;  3C94 A;  3CCL T;  3GNF B;  5CKH A;  3RKY A;  1OZ3 A;  1VIF A;  1W4S A;  1Y96 B;  2A36 A;  2DRM A;  2COY A;  4GLM A;  1Y96 A;  3OYF A;  1M90 R;  4PLI A;  2DYI A;  2QTV A;  1TUD A;  2F2W A;  1ZSG A;  3JV3 A;  3OYH A;  4A4K A;  1BCO A;  5CQY A;  3EG1 A;  4A4F A;  3G6E T;  3PIO A;  1R0B G;  2JUF A;  3OS2 A;  2XIC A;  4XTV A;  3A1P A;  1NPP A;  1WQW A;  3QZ9 B;  3VS3 A;  3E2U A;  4JS5 A;  5IXB A;  4OMM A;  2H3E B;  2DEU A;  4AFU C;  3NTH A;  5J26 A;  2CGH A;  2FZG B;  2KRN A;  2QK0 A;  3X25 B;  3JCM V;  1QWE A;  1QP3 A;  1FXX A;  3HRU A;  2MWO A;  2QQR A;  4BE1 A;  2FHD A;  2XI9 A;  3MP8 A;  2RPN A;  3MCA B;  2KDS A;  2ECZ A;  3UA7 A;  3CPW P;  4Z89 A;  3OB9 A;  3QHS A;  2HZY A;  2V8K A;  2J6K A;  3VYH B;  3CC4 A;  4LDY A;  1VQ6 Q;  1C0M A;  2J06 A;  3CCE T;  5CVI A;  1GBR A;  2QQB A;  2XG8 D;  3E9F A;  2DL3 A;  1KHI A;  2DO3 A;  1OPK A;  2LC4 A;  1GCQ A;  1M5Q 1;  4A4E A;  2OAW A;  2E6Z A;  1UGP B;  2V1R A;  3H0F A;  4M77 C;  5A0D A;  1OX8 A;  2PVG B;  2LVM A;  4M7A A;  3JB9 D;  2VVK A;  4DEX A;  3L2R A;  3G4S Q;  3MPU B;  5FU6 B;  1F1B B;  1MMN A;  4WF2 A;  4F14 A;  2PU9 B;  5GAN h;  3SWN B;  3SWN A;  2KR3 A;  5D6Y A;  4O6J A;  1E6G A;  4KGZ B;  3CCS A;  4WTO B;  5KCO A;  4L6V 5;  5D6W A;  4M77 F;  2CUB A;  1AZE A;  1G2B A;  2KK4 A;  1RAD B;  1VQM Q;  1YJW T;  5GAM d;  3A8H B;  1Y7X A;  2EFI A;  2AK5 A;  1BIB A;  3CCS T;  3QII A;  1WHK A;  2I0N A;  1MMD A;  3REA B;  4M7A G;  2C06 A;  1YCY A;  2O2O A;  2HBW A;  3T9N A;  2WSC E;  4DBF A;  3L2U A;  4M75 E;  1T3S A;  2DF6 A;  3RKX A;  2EGE A;  1W2B P;  3LWI A;  3FIF A;  1YWP A;  2LTO A;  2LMJ A;  3E9G A;  2DMO A;  1GXI E;  5GAO m;  4M7D C;  4OB3 B;  3GPL A;  1K0S A;  1QVP A;  2JJ9 A;  1YJN Q;  3CPW A;  4BI3 A;  2LQK A;  3OMC A;  1JJ2 P;  3QWY A;  2GQI A;  2M0Y A;  1OX9 A;  4BI4 A;  4XQ3 A;  1Q81 R;  1X6G A;  1SEM A;  4OP0 A;  1GBQ A;  4J8O A;  2RK2 A;  3OYN A;  5ECA A;  1EIF A;  3HKS A;  4HCZ A;  1UG1 A;  3CCV Q;  3J80 E;  5IHN A;  4R55 A;  2ZPF B;  5A2Q E;  2AZS A;  4J9I A;  1QVG P;  1AVZ C;  2RF0 A;  4C5H A;  1YFN A;  2GF7 A;  1VUB A;  3CD6 A;  2IVW A;  3M4G A;  1D0Z A;  2DTI A;  1QCF A;  5GJW B;  2F69 A;  4FT2 A;  2K6D A;  2QA4 A;  4DBQ A;  3LX7 A;  3NTI A;  4M78 B;  4O5V A;  1WFW A;  4M78 A;  4QVD A;  3M0S A;  3LYI A;  1D09 B;  2QGG A;  1WA7 A;  1UEB A;  3CD6 T;  2LT1 A;  2F5K A;  2JN0 A;  3OYG A;  2CYZ B;  2YLC A;  1MMA A;  2QA4 T;  4M77 B;  1IGQ A;  4M77 A;  3CCR Q;  1K9M U;  1EZZ B;  2FRW A;  2KXC A;  4FYX B;  2IIM A;  2Y90 A;  2M1H A;  1K9A A;  3CC7 Q;  3GBQ A;  1TSF A;  1MV0 B;  3ZBD A;  1HSQ A;  2GFU A;  3S6W A;  2ZPB B;  4AMC A;  4C5I A;  1Y07 A;  4QW2 A;  3JCM d;  5HY6 A;  4DQ2 A;  4LXC A;  1UE9 A;  4Y91 A;  1DJ7 B;  2A28 A;  1KK7 A;  3O5Z A;  4FYW B;  1D0X A;  1OOT A;  2HD0 A;  3BDU A;  1M8V A;  4IUT A;  3M4Y A;  2F2X A;  4JS4 A;  3JAM E;  3JCM Q;  1X75 C;  1G3T A;  2O31 A;  2PUO B;  1NYG A;  2YUP A;  2YSQ A;  3CME Q;  4J7F A;  4M77 G;  4EMH A;  5FRN A;  4JRI A;  5HKC A;  1RL2 A;  2KQW A;  2QG9 B;  4X1V A;  2YXY A;  2QGF B;  3G71 Q;  4DA4 A;  2CZ1 B;  1QW1 A;  3OYM A;  2L8D A;  1I81 A;  3L2Z A;  4D8K A;  3EH1 A;  1RAI B;  4RTY A;  5GAM h;  5A0L A;  3OYB A;  1Q82 U;  2DIL A;  1A0N B;  2CT4 A;  2AKL A;  1KD1 C;  1UHC A;  4F17 A;  1G8X A;  1YCS B;  4II1 A;  5GAN 2;  5CO7 A;  2MIO A;  3GIB A;  1WHH A;  2QQA A;  1KD1 R;  1CSK A;  3RES A;  1BU1 A;  1M1K U;  1ZUK A;  2MAM A;  2DL8 A;  1ZA2 B;  2ZCF B;  3D7S B;  4N0A A;  1U8R A;  1GL5 A;  5KE3 A;  1K8A C;  5GAN 6;  2AHJ B;  2FEI A;  3QKJ A;  1VQ9 Q;  4F16 A;  1MGQ A;  3TSW A;  1K8A R;  3OYD A;  2HEQ A;  1VQO Q;  1WLP B;  3EG2 A;  4M78 D;  1VQ4 Q;  1M1G A;  4ZN1 A;  2BKD N;  4GLK A;  4PFO A;  3ULR B;  2QI2 A;  2M02 A;  4JJD A;  4RTV A;  5GAN 3;  4KH1 B;  4HA8 A;  2DA9 A;  2KT1 A;  1WHG A;  4M77 D;  2JM8 A;  2QEX T;  1JBM A;  1S72 Q;  1RAF B;  5GAN 4;  2OTL A;  1ZQ1 A;  3I55 Q;  3CCQ Q;  1G5V A;  2DXB A;  2DXC A;  5IH2 A;  5LJ3 e;  4XTX A;  3CCM Q;  3MEV A;  4FCY A;  2VGN A;  4VUB A;  1PSE A;  2K4Y A;  1OUL A;  2RA2 A;  4DOV A;  2HL3 A;  2DJZ A;  1TXQ A;  2OTL T;  2A08 A;  3UAT A;  5J3B A;  2PNI A;  5GAM f;  4AG1 C;  2OTJ Q;  5GJV B;  4QQD A;  1WJR A;  2O4X B;  2DNU A;  3OBW A;  2O4X A;  3EGD B;  1WHM A;  1BI3 A;  3EGD A;  4PK4 A;  4PJO B;  4AT1 B;  4PJO A;  2YRD A;  1BB9 A;  2XMF A;  4ATO A;  2MPX C;  5LJ3 j;  2K5F A;  4Y92 A;  3JRZ A;  2YDL A;  2XD0 A;  1HK9 A;  2SEM A;  1PKT A;  3P8B B;  5GMK m;  2MK5 A;  1Y57 A;  4BD3 A;  1VQ5 Q;  4HCB A;  3FEO A;  4EMK C;  2LJ1 A;  2BTT A;  1C1A A;  1NJI C;  4XTZ A;  1YI2 T;  4C0Z A;  4C0G A;  2RQR A;  2DYB A;  4HVU A;  1NJI R;  5CCA A;  5IT9 E;  4FW2 A;  4C5G A;  3I5R A;  2R5M A;  2EJG A;  4IUP A;  2E70 A;  1RAA B;  1UJ0 A;  3JCM h;  4PJO G;  3DLM A;  1R77 A;  5KYU B;  5KYU A;  2JZ2 A;  3UF4 A;  3X28 B;  2KYB A;  1VQK T;  1GFD A;  5KE2 A;  1ZUY A;  2DVE A;  4EDU A;  2SRC A;  4E7K A;  3NFC A;  1BI1 A;  1WGS A;  4FSS A;  4C0D B;  1VQ7 A;  2DZ9 A;  1JU5 C;  1O9S A;  3BDL A;  3LWH A;  4J7I A;  4C8Q C;  2L89 A;  1QKW A;  2FPF A;  2KI7 A;  1ABQ A;  1YIT Q;  3CMA T;  4BY6 C;  2YUN A;  1CKA A;  4DBR A;  4BUG A;  4C0F A;  2C0I A;  2EQI A;  4PJN A;  3V7S A;  3FDR A;  4OMN A;  3CCJ A;  1VQ7 T;  3I5S A;  3OMG A;  2RHZ A;  1SPK A;  1LJO A;  1VQM A;  2K79 A;  2X4W A;  2EGC A;  3BE3 A;  5LJ5 e;  2DLP A;  2LX7 A;  4C8Q F;  3OA6 A;  4NS5 A;  3MJX A;  3MP6 A;  4HVW A;  2DL7 A;  1CKB A;  5M9O A;  3FJP A;  1IXD A;  1X2Q A;  1H3H A;  3CCJ T;  3M54 A;  3SD4 A;  1MUZ A;  1Q7Y R;  4BY6 B;  2NUP B;  2X3W D;  2E64 A;  4C92 C;  3OSV A;  3SHW A;  4PJO D;  2NUP A;  2M51 A;  4KRT A;  1YJ9 Q;  2BZY A;  4ORZ A;  5LJ5 g;  1GFC A;  2E5Q A;  3JCM f;  2KAF A;  2KNB B;  4PLL A;  4B9X A;  2G6F X;  3V7C A;  2L3R A;  1RAE B;  2NLU A;  2CS7 A;  2VC8 A;  1N8R U;  3CBO A;  2LQ8 A;  5LJ5 j;  3JCM P;  1YJN A;  2P0P A;  1M3C A;  4AFZ C;  1Y71 A;  4C92 F;  1VQL T;  1FMK A;  1SRL A;  4CI0 C;  5FW9 A;  2NWM A;  3QJY A;  2GGR A;  3OQ5 A;  3EHQ A;  4QVZ A;  2D6F A;  1BI2 A;  4AFS C;  4M78 E;  4MZM A;  4OF1 A;  4ELY C;  2LDM A;  3CC2 Q;  3RMQ A;  1I4K 1;  1VIE A;  3HL8 A;  3P8D A;  3TU4 K;  1SRM A;  3TEE A;  2XDB A;  2EQU A;  1VQ8 T;  1PRM C;  1MHN A;  2YRC A;  4MZT A;  5I21 A;  2CP7 A;  2CZ7 B;  1RAB B;  2RQU A;  2FZK B;  1OU8 A;  2DRK A;  4JLG A;  1ZBX A;  2DE0 X;  2HKN A;  2VAS A;  4Z02 A;  3OS1 A;  1K4U S;  2MCN A;  2KVQ G;  1Y0M A;  4QQ6 A;  3JCM J;  4PFZ A;  2DX1 A;  4PFP A;  3EFS A;  2RQV A;  4LD9 K;  4E7H A;  3S3O A;  1YBY A;  1YHQ Q;  1I5O B;  5FWB A;  2DL4 A;  2RQT A;  1UGS B;  3H0I A;  3CCR A;  2EKO A;  3EG0 A;  1OEB A;  8ATC B;  2WAC A;  3SFM A;  3TRE A;  3QWX X;  2L0A A;  3AHU A;  4ME7 A;  3H0H A;  5GAN 7;  2LP5 A;  5DLO A;  2RHY A;  1K0X A;  2BZX A;  2FPD A; 
#chains in the Genus database with same CATH homology
 4B9W A;  3RKW A;  3WVE B;  4BAC A;  2ZZD A;  2E65 A;  2ZPF B;  1R8O B;  4ELZ C;  5A2Q E;  2QEX A;  3OW2 A;  2Y4X A;  2M0O A;  1Q7Y C;  2XDD A;  2CKK A;  1NJI U;  4QVC A;  4C5H A;  3MET A;  1W2B S;  2GF7 A;  2RJF A;  1VUB A;  3CD6 A;  2IVW A;  3M4G A;  4X9D A;  2DTI A;  4XU3 A;  2ZPI B;  5CKD A;  2F69 A;  3MEU A;  4FT2 A;  1VQM T;  3CC2 T;  4LDW A;  3CME A;  3OYI A;  2QA4 A;  2LX9 A;  4C8Q E;  4FL6 A;  1Q81 U;  3LX7 A;  3NTI A;  5LJ3 d;  3OS0 A;  3CEY A;  4M78 B;  4O5V A;  3C4S A;  3CC4 T;  4M78 A;  4QVD A;  3J7A F;  1XTD A;  3INZ A;  4OVA A;  1M90 U;  3LYI A;  3Q1J A;  3JB9 J;  4MML A;  4M7A B;  2QQ9 A;  4C92 B;  1JJ2 S;  3PMI A;  4JRQ A;  2RK1 A;  4C92 A;  1UEB A;  3CD6 T;  3EFR A;  2K3Y A;  2LT1 A;  4XU2 A;  1M1F A;  2B8A A;  2F5K A;  2JN0 A;  2CYZ B;  3V8L A;  3OYG A;  2P0K A;  2YLC A;  2PVD B;  1BYM A;  2X4Y A;  1KD1 U;  2QA4 T;  4JUV A;  4M77 B;  1N27 A;  3MHX A;  4M77 A;  3KUF A;  1U1S A;  3BFM A;  1K9M U;  2A3L A;  2DIG A;  3M57 A;  5KH6 A;  2XHC A;  1QVF S;  5DM7 R;  2E1H A;  3G7Z A;  2E41 A;  2K5L A;  2DD5 A;  2EQK A;  2Y90 A;  3PTA A;  2LCL A;  1RI0 A;  2M1H A;  5FU6 C;  5GAN 5;  2IG0 A;  4FSX A;  1N6A A;  3ZBD A;  1ZHI A;  5CIU A;  3SWN C;  3DLL A;  1QP2 A;  2EJ9 A;  1SSF A;  2GFU A;  4M75 B;  5I2M A;  3S6W A;  2ZPB B;  4M75 A;  5I2S A;  4C5I A;  1XQH A;  3A8O B;  3HFO A;  1YJN T;  2R5A A;  2YRV A;  1YHQ T;  1Y07 A;  4QW2 A;  4C92 E;  3JCM d;  5HY6 A;  4DQ2 A;  3DB4 A;  3HPW A;  2DD4 A;  4MDX A;  1OZ2 A;  1QVG S;  4Y91 A;  1DJ7 B;  3S3N A;  2JOY A;  3HRS A;  2VXF A;  1YI2 A;  1WPY A;  3BDU A;  2HD0 A;  5FLX E;  3CCV A;  1M8V A;  5GAM e;  4IUT A;  3DKM A;  3M4Y A;  4M77 E;  4EMK B;  4JS4 A;  4EMK A;  3JAM E;  1O75 A;  3JCM Q;  1X75 C;  1G3T A;  4J6Y A;  5FRO A;  4BDY A;  3BW1 A;  1IZ6 A;  4C92 G;  2X35 A;  4FT4 A;  5KCH A;  5FU7 C;  2EQJ A;  3GLX A;  5CKE A;  1VQO A;  4QQG A;  2RH2 A;  2PUO B;  2BIV A;  3I56 A;  5J39 A;  5CR2 A;  1H64 1;  3QXE B;  4J7F A;  4M77 G;  3A5Z B;  3QG1 A;  3QO3 A;  4Q5W A;  4NL2 A;  4EMH A;  3OYE A;  3OY9 A;  4IUQ A;  4JRI A;  4RCB A;  5HKC A;  5FRN A;  2EYQ A;  3CCV T;  3J81 E;  3CBP A;  1RL2 A;  2KQW A;  3E1S A;  2DTO A;  3C95 A;  3QUI A;  2ZGW A;  1YIJ T;  4PJO E;  3ER0 A;  4XTW A;  1VQN A;  3MP1 A;  3F70 A;  1PSF A;  4DA4 A;  4HT9 A;  5GMK e;  4E7L A;  2CZ1 B;  3MO8 A;  1QW1 A;  3GOX A;  2OAU A;  5GAM g;  3OYM A;  1VQK A;  3BY7 A;  2L8D A;  4M75 G;  1I81 A;  3I56 T;  3L2Z A;  3LH0 A;  4BI8 B;  4A53 A;  4IUU A;  3LGL A;  2M9U A;  4J6W A;  5GAM h;  5A0L A;  3OYB A;  4RCC A;  3G6E A;  3JCM W;  3EAE A;  3X20 B;  1Q82 U;  5HK3 A;  5GAM j;  1N8R C;  1Q81 C;  1KD1 C;  1M9S A;  2LNV A;  1D3B B;  2LRQ A;  1B34 B;  2BUD A;  1VQN T;  2DXT A;  2HBP A;  2ZPH B;  3A8L B;  4II1 A;  1B34 A;  1KG1 A;  5GAN 2;  1K9M C;  3OYJ A;  1LOJ A;  5CO7 A;  5IN1 A;  4OB1 B;  3H8Z A;  3GIB A;  2KY9 A;  3JB9 G;  4N4H A;  1BIA A;  2QQA A;  5LL6 S;  2FVU A;  4M7D F;  3RES A;  2K3X A;  3CC7 A;  1M1K U;  4C8Q B;  3CMA A;  2MAM A;  2ZCF B;  3V7R A;  4C8Q A;  4N0A A;  1JB0 E;  2FYK A;  3PGG A;  1U8R A;  3M55 A;  3HSB A;  5KE3 A;  3OYC A;  2PUK B;  1K8A C;  5GAN 6;  1K73 C;  2AHJ B;  3O8V A;  4E47 A;  3QKJ A;  1WNL A;  1N9R A;  2HQX A;  2R57 A;  3CCR T;  4L5G A;  3SB2 A;  2EWN A;  1MGQ A;  2MWP A;  2JNG A;  5GMK h;  1KQS A;  3OYD A;  3LGF A;  4Y28 E;  4M7D E;  3OSS C;  3WVD B;  5CQX A;  5GMK l;  4M78 D;  4KT0 E;  3CC7 T;  1M1G A;  1WJQ A;  4ZN1 A;  2BKD N;  4UC4 A;  4GLK A;  2E12 A;  2QDY B;  2ZPG B;  3VKI A;  2QI2 A;  4LDV A;  4M7A D;  3CCE A;  2LCC A;  4EMG A;  5LJ5 d;  1KQ1 A;  1XNI A;  5GAN 3;  1V29 B;  2FB7 A;  2GFA A;  4MZP A;  4XTU A;  5GAN d;  4HA8 A;  1FX7 A;  1X01 A;  3M56 A;  4RKU E;  2DZC A;  3M58 A;  4M77 D;  4JDS A;  2QEX T;  1FWZ A;  1JBM A;  4KUD K;  4ZGD B;  5GAN 4;  2OTL A;  1ZQ1 A;  2RJD A;  3QJ6 A;  1G5V A;  5GMK i;  2DXB A;  2DXC A;  2QXF A;  3OYA A;  2I2L A;  2XID A;  5LJ3 e;  3G71 A;  4ZTJ A;  3PNW C;  4F7U F;  4XTX A;  4C8Q G;  3P8H A;  3MEV A;  2D9T A;  3QPH A;  2VGN A;  4VUB A;  3UT1 A;  4M78 C;  3KBG A;  3CME T;  3ASK A;  4M75 D;  4C5E A;  1PSE A;  2K4Y A;  3JCM b;  4RMO A;  3CXC S;  2P4T A;  3FLG A;  3ZFJ A;  4M7A C;  2RA2 A;  4XAX B;  2WSF E;  4DOV A;  4TVR A;  3UPU A;  2X4X A;  2DJZ A;  2XK0 A;  3SDZ A;  2OTL T;  2RHX A;  3UWN A;  1VQL A;  1HXD A;  2O01 E;  5J3B A;  1I8F A;  3CPF A;  2JVV A;  4F7U E;  3G71 T;  3X24 B;  5GAM f;  5GAO q;  4JJN K;  4OB2 B;  2RD1 A;  2RI3 A;  4QQD A;  1Q86 U;  4PKC C;  1U1T A;  1WJR A;  2O4X B;  2YLB A;  3RUX A;  3L2W A;  3OBW A;  2O4X A;  1WQ7 A;  3CBM A;  1M4Z A;  2R58 A;  1W2B A;  4IKF A;  1BI3 A;  4M78 F;  2H3J A;  4JRK A;  4PJO B;  4X9C A;  2CZ6 B;  4RG8 A;  1KQ2 A;  4PJO A;  2QQS A;  3V8K A;  3RMS A;  1YJW A;  2PVO B;  2VV5 A;  3L1A A;  4M7A F;  3H6Z A;  3JCM X;  3QYH B;  4XTY A;  4DOW A;  2P0Q A;  5LJ3 h;  3JCM e;  3RER A;  4ATO A;  3R6O A;  1VQ9 A;  2RM4 A;  3UDC A;  5LJ3 j;  5DY9 A;  3M59 A;  2X4J A;  3VUZ A;  2EIF A;  2K5F A;  3JRZ A;  1VQ8 A;  3VJP A;  2XU8 A;  2XD0 A;  2RHU A;  1HK9 A;  2YHT A;  3P8B B;  4HKE A;  3OYK A;  5GMK m;  1JJ2 A;  3CPW S;  1VQ4 A;  4BD3 A;  4LDX A;  4J83 A;  1BKB A;  2F5T X;  3FEO A;  4EMK C;  4HT8 A;  4HCB A;  1NJI C;  3CCL A;  2V8J A;  2ZPE B;  2GQV A;  2VGM A;  4XTZ A;  1YI2 T;  4C0Z A;  4EPC A;  4A54 A;  2KSS A;  1N9S A;  4C0G A;  1VQ9 T;  2XKO C;  5C0M A;  4BE2 A;  3CCU A;  4RG2 A;  4MDW A;  3ZEH A;  1Q7Y U;  4HCC A;  1QVF A;  3A8M B;  5CCA A;  3QYG B;  5IT9 E;  3TCJ A;  1S72 A;  3OBY A;  1JRI A;  3JCM c;  1VQO T;  3A8G B;  4C5G A;  3L2Q A;  3JCM g;  1G3Y A;  2GCX A;  1VQ4 T;  3I55 A;  1G3W A;  2DPP B;  3CCQ A;  2R5M A;  1XOV A;  1M90 C;  2RO0 A;  2EJG A;  3QBY A;  2E70 A;  1IRE B;  4IUP A;  3C94 A;  3CCL T;  3GNF B;  4BE0 A;  3V8J A;  1UGR B;  5CKH A;  4FM4 B;  1VQP A;  3RKY A;  1OZ3 A;  3JCM h;  1VIF A;  4PJO G;  3CCM A;  4C8Q D;  1W4S A;  4M7D B;  3GP8 A;  1Y96 B;  3OYY A;  3VU3 C;  2MI6 A;  3CCU T;  4FU6 A;  5AYF A;  3DLM A;  1Y96 A;  5C6S A;  3OYF A;  4M7D A;  4PLI A;  1QVG A;  3HFN A;  3OW2 S;  2JZ2 A;  1S72 T;  3OYH A;  3X28 B;  2VUB A;  5IAY A;  3I55 T;  4ZGE B;  1VQK T;  2K5I A;  4KUL A;  3CCQ T;  5KE2 A;  4A4K A;  2DAQ A;  4YTL A;  2WSE E;  5D6X A;  2DVE A;  2RB6 A;  5CQY A;  4EDU A;  1VQP T;  2OTJ A;  3QZ5 B;  3CCM T;  4A4F A;  3G6E T;  4E7K A;  3NFC A;  3PIO A;  4CRI A;  1BI1 A;  4N4I A;  4ZN3 A;  3M5A A;  1WGS A;  2JUF A;  4C0D B;  3OS2 A;  2HQE A;  2XIC A;  4XTV A;  1VQ7 A;  4X34 A;  1NPP A;  2DZ9 A;  1WQW A;  1O9S A;  3BDL A;  3QZ9 B;  5L8R E;  4OGC A;  4JS5 A;  3LWH A;  4E7J A;  4J7I A;  2MMP A;  4N0A C;  4C8Q C;  5GMK j;  4KBM B;  5GAN 8;  2L89 A;  3WXM B;  2KMT A;  2DIQ A;  4KUI A;  3LLR A;  3NTH A;  3VYG A;  4XK8 E;  5GAN f;  5FRM A;  3CMA T;  5J26 A;  2OTJ T;  2CGH A;  3JB9 H;  4BY6 C;  3X26 B;  4BUG A;  4C0F A;  1KC8 U;  3X25 B;  5LJ3 f;  3JCM V;  1QP3 A;  3V7S A;  4C92 D;  3FDR A;  1FXX A;  3HRU A;  4NOY A;  2MWO A;  2QQR A;  4J5Y A;  3CCJ A;  1VQ7 T;  1VQ5 A;  4M7D G;  4BE1 A;  2FHD A;  2RHZ A;  3OMG A;  2XI9 A;  3MP8 A;  1LJO A;  2DK3 A;  3E19 A;  3MCA B;  2KDS A;  4OB0 B;  2X4W A;  4F7U B;  4PNO A;  1VQM A;  5LJ5 e;  4F7U A;  3CC2 A;  2MF2 A;  1NPR A;  2PQW A;  2HAX A;  3OB9 A;  3QHS A;  1G3S A;  2DTH A;  4V2S A;  2RJE A;  2V8K A;  4C8Q F;  3S3M A;  5GAN e;  3OA6 A;  3L42 A;  3VYH B;  4NS5 A;  3VUB A;  3MP6 A;  3CC4 A;  4LDY A;  2RHI A;  5CK9 A;  3L2V A;  5M9O A;  3FJP A;  3CCE T;  4JLI A;  5CVI A;  4BB7 A;  2QQB A;  2FL7 A;  2VYT A;  2XG8 D;  3MEW A;  1TH7 A;  4A4H A;  3CCJ T;  1I5L A;  3E9F A;  2DXU A;  1VQ5 T;  4LD6 A;  4OMF B;  3M54 A;  3SD4 A;  1KHI A;  3ME9 A;  2DO3 A;  3VV0 A;  2LC4 A;  4C92 C;  1WJS A;  2E64 A;  3OSV A;  4PJO D;  5EG2 A;  3OYL A;  4FIB A;  1Q82 C;  1M5Q 1;  4A4E A;  5GAO r;  5GAO l;  2RJC A;  2E6Z A;  1UGP B;  4BDZ A;  3FB9 A;  2E5Q A;  3JCM f;  5LJ5 g;  4M77 C;  4JRP A;  5A0D A;  2PVG B;  3NTK A;  2KAF A;  2M16 A;  3KXT A;  4PLL A;  2LVM A;  4B9X A;  4M7A A;  3V7C A;  5GAN g;  3JB9 D;  3M53 A;  2L3R A;  3HRT A;  3L2R A;  5LJ5 h;  4E7I A;  2NLU A;  2CS7 A;  2VC8 A;  1N8R U;  3PFS A;  3CBO A;  2LQ8 A;  4P5N A;  2RI2 A;  5FU6 B;  5LJ3 g;  5LJ5 j;  3JCM P;  4A4G A;  4WF2 A;  1YJN A;  1M1K C;  2PU9 B;  2P0P A;  5GAN h;  1YHQ A;  3SWN B;  2V8I A;  4F7U G;  5GAN j;  3SWN A;  5D6Y A;  1Y71 A;  4C92 F;  4O6J A;  1VQL T;  2JTF A;  2L5Q A;  4M75 C;  2E10 A;  4CI0 C;  1X6O A;  3CCS A;  5A0G A;  1P92 A;  5DLQ E;  3QJY A;  5KCO A;  4L6V 5;  2XDP A;  3OQ5 A;  5D6W A;  4M77 F;  3URG A;  4PJO C;  4QVZ A;  2D6F A;  1BI2 A;  1K8A U;  2EAY A;  4M78 E;  1K73 U;  4MZM A;  1YIT A;  3LW5 E;  2KK4 A;  4OF1 A;  4ELY C;  2LDM A;  4ZGJ B;  4M7A E;  1YJW T;  4MMK A;  5GAM d;  3OS5 A;  3A8H B;  1Y7X A;  4OGE A;  1I4K 1;  2D0Q B;  1VIE A;  3HL8 A;  5FU7 B;  4N4G A;  3RMQ A;  3CXC A;  2A7Y A;  2EFI A;  2K57 A;  4M7D D;  1BIB A;  3P8D A;  2Y4Y A;  3QII A;  3CCS T;  4M75 F;  4M78 G;  1LNX A;  3TU4 K;  1KC8 C;  3TEE A;  2XDB A;  2EQU A;  3FRN A;  1VQ8 T;  2DEQ A;  1YIJ A;  3QDR B;  4M7A G;  2EQM A;  4PJO F;  1YIT T;  5HK0 A;  1KHC A;  1MHN A;  3PT9 A;  2C06 A;  1YCY A;  3PIP A;  2QTX A;  4MZT A;  4L59 A;  5I21 A;  4PL6 A;  1UGQ B;  3T9N A;  2WSC E;  1VQ6 A;  3DB3 A;  4NL3 A;  3L2U A;  2CZ7 B;  1NZ9 A;  4M75 E;  1KQS S;  3M9Q A;  3HHT B;  3JB9 F;  4IUV A;  5CAI A;  3N5B B;  3RKX A;  4JLG A;  1ZBX A;  3LWI A;  3QSU A;  3FIF A;  2RI5 A;  3MEA A;  3OS1 A;  4Z02 A;  2LTO A;  1BI0 A;  3E9G A;  5GAO n;  2KVQ G;  5GAO p;  1YJ9 A;  1GXI E;  2LT4 A;  4QQ6 A;  5GAO m;  3JCM J;  4M7D C;  4OB3 B;  2CZ0 B;  3GPL A;  4GY5 A;  3EFS A;  1VQ6 T;  1QVP A;  2G3R A;  1AHJ B;  4LDU A;  4LD9 K;  4E7H A;  3S3O A;  1YBY A;  2HNI A;  2EJF A;  3FC3 A;  1Q86 C;  3CPW A;  4BI3 A;  2K2V A;  2LQK A;  3C12 A;  4IUR A;  3OMC A;  3G4S A;  1UGS B;  3HP9 A;  5CKF A;  1NE8 A;  4R56 A;  3GF5 A;  2E6N A;  5CKB A;  2EKO A;  3CCR A;  4XU0 A;  1D3B A;  1YJ9 T;  2VXE A;  5LJ5 f;  2WAC A;  3GNG A;  1OI1 A;  4ZTF A;  3JSC A;  3SFM A;  3TRE A;  4BI4 A;  3RIR A;  4XQ3 A;  3JB9 I;  4C0D C;  2JTM A;  4XU1 A;  3AHU A;  1OYX A;  4ME7 A;  4OP0 A;  5GAN 7;  4D6W A;  4J8O A;  5DLO A;  2DKG A;  3G4S T;  2RK2 A;  3OYN A;  2RHY A;  1EIF A;  3HKS A;  4HCZ A;  4J6X A;  1UB4 A;  3PMT A;  3J80 E;  1H3Z A;  4BY6 B;  4R55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...