1Y07A

Crystal structure of the superoxide reductase from treponema pallidum
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
126
structure length
121
Chain Sequence
RELSFFLQFFLGMDAPAGSSVACGSEVLRAVPVGTVDAAKEKHIPVVEVHGHEVKVKVGSVAHPMTPEHYIAWVCLKTRKGIQLKELPVDGAPEVTFALTADDQVLEAYEFCNLHGVWSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords desulfoferrodoxin (rbo)
publication title The first crystal structure of class III superoxide reductase from Treponema pallidum.
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum str. nichols
molecule tags Oxidoreductase
total genus 22
structure length 121
sequence length 126
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.510 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y07A01
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1y07A02
4BGLA 4BFKA 4BV1A 2JI3A 1VZIA 3QZBA 1VZGA 2JI2A 1Y07A 4BFJA 2HVBA 4C4UA 4C4BA 1DFXA 2JI1A 4BRJA 4D7PA 4BRVA 1DQKA 1DQIA 2AMUA 4BK8A 4BFFA 1VZHA 1DO6A
chains in the Genus database with same CATH superfamily
1E4XH 4KOCA 3IRPX 1G83A 2AEPL 2XVKA 3V5KB 5JDSB 2BOBB 1P7HL 2H1PL 1I1FB 4CVZB 2XZAH 2VXUL 2ZCKL 4KI5C 1VQ9Q 4IBLT 3BWAB 3BFWA 3NP4A 4QVZA 2Z8VC 1GBQA 4NXKA 3V0WH 2Y23A 3KPQB 4M75D 2GEEA 2XN1A 3QQ3A 5EUOE 3WTSA 3HNTL 4LP8A 1DE4B 3HR6A 4B6MA 2R2EB 1Z1WA 3WFHB 1JPTH 3L45A 2WQVA 1S5HA 3VFUB 2HKQB 5JDJA 4NOYA 1YY8A 2OXHB 2YSSB 4C8QF 3VRIA 2D9TA 3OKDB 3BFQG 3HAEG 3UO1L 3SPVB 3Q6GH 3QUKB 4FG2A 3QZBA 2EP6A 1E3FA 3QUXB 4EUPA 1XF2A 3X24B 4LOVA 3T8XB 2XQBL 1SY6L 4ODSH 3QQ4A 5F8QC 1B0IA 2FB4L 1IGUA 4IIMA 1A4CA 3BQUB 4HMEA 4HX1A 1YEEL 3VNZA 3BP7A 1KD1C 5B3JE 2DN7A 1DJYA 4M1CC 4JLGA 1XSOA 2R9HC 3ABLB 2AKKA 5HHOE 1NDMA 3PS6A 4NCC2 3CCRT 4JW3A 3JZ7A 2VZVA 4S0SD 5KG9A 3K71A 3HFMH 3GBDA 2ADYA 3UBFA 1CFTB 4GH7B 3DOSB 4G6AD 5F2FA 2YUWA 3LIZL 4RBPH 1K9MR 3AM8A 3IPFA 5H8DA 4PJDE 2BFVL 4DEUA 3VJ6B 2ZP0T 4JS7A 3MRJA 5IVZB 1NCWL 1KIQA 5C0RH 5DJDA 2WKGA 1SYSA 4G43A 4Y16C 5AVYB 3SY6A 5E2UL 2CH8A 4IIZA 3EJYD 3UO8B 4W9HC 2V9TA 4LB8A 2J5WA 4GBQA 5GAMe 3CC7A 1IGCL 4YSOA 3CFDB 3MHZA 5BQ7B 4U1LB 3TTSA 4GAJL 4HFWA 1OGAE 3QEQE 3HNVH 3PDOB 4KY1L 4OZFH 5E6SB 3WNPA 5L2KA 3S8FB 2FBOJ 5DEFA 1JPGB 3GMRA 1IKFL 1H9VA 1HCFX 3SQOH 1C9SA 4K71B 2AJZA 5AYUL 4OZFB 1OE1A 3BLPX 4EF3A 1OGSA 3QSUA 2EZ0C 3HZ3A 4M7DA 3RKDC 4EIUA 3JCMc 3SCMB 2JKNA 2K5LA 4M7AG 2OBGA 1Q9WA 3MNVA 5GPRA 4G6ML 5EOTA 3T8MA 2LU4A 4JNXA 4IGBB 2GABA 4XNAA 2E59A 5TDNA 1EO5A 1NTDA 5CD5C 1J8KA 3AZUA 4MFHA 4Y28E 5D2LA 5DZLA 1VB9A 3JRZA 2ZXAA 1MQKH 3KPSE 1QATA 4R4BB 2FH6A 2I5YH 4RAUB 3UPCA 3WKNA 4J7FA 1QWFA 3HC4L 2GTWA 4JN1H 4NT6B 2BIOA 2F58L 3GZPA 1GA2A 2F19H 4HBCL 4ACPA 1UB5B 4X6BB 1LP9B 3CDFA 1D5IH 5IHIA 5J26A 5CZXC 2WCSA 4HMCA 4WWID 2ZIDA 3BW9B 5F7UA 3HUJE 2X4YA 3WSQH 2AQ2A 2XG5A 1VA7A 2Y4YA 2X3BA 2RD1A 2Y06H 2Y7QA 4HCRA 2NW3B 3A21A 3BGAA 3KFVA 1A3RH 4HALA 2F7QA 3V4UH 2ICWI 2HKHL 2J56A 5L4JA 3L3IA 4PUBL 2L3RA 5I0YA 2E75C 3I3EA 3GS0A 1G7HA 3RLSA 1S72Q 4ODVH 3KHQA 1U3HC 3MRLA 3MRBA 4W9GC 1HI6A 2VJ8A 4BSVA 3OF6A 3T3ME 1QQDA 2XWRA 2EBPA 4YGVB 1YLBB 1ADQH 3GUTA 2V33A 4R26L 4FFYA 3PWLB 2Z31C 2JZ2A 3QWXX 4EO5A 1EGJA 2GIMA 3ESPA 5E8PB 1EJ6A 1CWVA 1VUBA 1BFTA 2PPAA 1IEAA 5ID0A 1E0OB 1OT2A 3KVQA 1II4E 3DBXB 2JIXA 5IROC 1BBDL 4FS0A 4IQHA 3DHMA 5DK2A 5TPWH 4ZMOA 3NCYP 1NBYA 5IVXF 3IMRA 5C0BB 1WFMA 1L9NA 3X25B 2DLEA 5C09E 4UBDC 3OWEA 2BVYA 1EERB 3D85D 1X5LA 1B0WA 1QP2A 4Z7UA 1UURA 1PKOA 3JWNE 3FUKA 3LQZA 4PWGA 4QR7A 1TZHB 3UTSA 3C2SA 5F44A 3W38A 3MEVA 1VQLA 1NBVL 3QIBA 2AAVA 2YRBA 3FSVA 3RGHA 1GYVA 3OGCB 4Z3EA 1WIEA 1VQ9T 1OAZL 3SY0A 2EDYA 5E6ZA 4K3DH 3ZE1F 4M75G 4YE4H 3BSHA 1K8AU 2O30A 1W72B 2O6CA 3NAAL 2XUWA 2J4WL 3HFOA 1AGFB 5SWSB 3EUDA 3N44B 4HK3N 4Z7OB 3FB7A 1BJ1H 4GAAA 1RZIB 4PJBA 4IBSA 3CFEB 4X34A 3HN3A 1J1PL 2ZOLA 4N4GA 5BMFL 5JO5B 1BG9A 3O2DL 2X89D 1B34B 1DO6A 3PUCA 4IJ3B 2WNXA 4X6FB 3HL8A 5A7BA 1GYWA 1J1OH 1IBGH 2J12B 3INUL 3VXRA 3Q05A 1UE9A 4G80A 1NMAH 2H9GB 4FTVB 2Q86B 3WNJA 1JGDB 2R2BB 1LK2B 4J39A 2WGNB 1OOWA 4C56E 5KSAD 3PGGA 3P8DA 1NCAL 2CBOA 2N7AA 4FG6C 5TE6H 4JBSA 4GP8B 2BVEA 3FRUA 4F37K 4PRPB 4OJCA 3LZNA 3EOBA 2E27H 1MFAL 4YLQT 2BIPA 1ETJA 1NIBA 3QSKB 4X4XB 1JPST 2D2CC 4NOBA 1H3XA 1EUTA 1LTXA 2N7SA 3TVMA 3EG3A 3C5SB 4I18A 5JHLH 1CI3M 4N2AA 2C4XA 1M3CA 3DO7B 4WK2B 2FQEA 1XIWA 1YJNT 4OVVA 3OKKA 1Q0XH 1CUOA 1EAQA 2BC4B 4JG9A 2HN7B 4P4KC 1MI5B 5EUOF 3TN0D 1NFDB 1NEBA 4JFYA 3TO4D 4Y16B 3RI5F 4D0DA 5FCUL 5KBPA 3S9DB 1WF5A 2WLJA 3RUGB 4DP6X 5J13C 5TQ2H 5ICUA 3PWPE 1PKQE 1YHQA 4AYDC 1PKTA 1LWHA 2FL5A 3K6SB 2AMUA 1PYWA 2R0KH 4HIPA 1XGYH 2W81C 3K1DA 2DBMA 1JFHA 2JB6B 3OYIA 1C16B 4WV1C 3TCJA 3EYVB 3X1GA 2DRKA 2DO3A 3VYHB 1BVLA 3NMEA 3U9UB 4BQBA 4MD4A 1SXSA 4B9YA 5CR8A 3K8KA 3CMAT 4WI7A 5TDOB 3HIZA 5DM7R 4RMSA 1J9SA 2PNIA 5IHKA 1HKLH 2O26U 2GJJA 3FZUC 3JWOH 4GQZA 5F93C 4UDTA 1UA3A 3CZFA 2WZPA 4ISVB 2IAND 2Z64C 1SDDA 3B56A 1ZLDA 1XF3A 1JU5C 1LJMA 2BP3A 2DWDA 2DMHA 3DWTA 4MMYA 4TMPA 4C4KT 1X6LA 1ZPUA 4IOSD 3O6FD 3OKMB 5A0DA 4TQPA 1H15A 8FABA 3ROOA 4PJ5E 5SWZA 3SKNB 5I6OA 1IHWA 3D4CA 5MI0C 5FWCA 1KXQA 1ZX6A 2JTDA 3LAFA 4DAGL 4PJDF 4MMKA 5FYKD 1KLFB 2OM5A 2X4QB 3CPUA 3ZL4H 4CJ1A 1WPYA 2M1KA 3JXAA 4G7RB 3B1TA 4Y5VC 2VO5A 2GIYA 3FK3A 3HFML 3RPKA 4ZJ9A 2EDRA 2WXHA 3ISRA 2BIHA 2DAVA 2A38A 1G6VK 3PQYD 5D7JA 4P2QD 5I6XC 2P5WE 2A08A 1Z9SB 3VXMD 4WI2A 1S72T 4YHLL 3K72B 1WZLA 2VZSA 3WIAA 4WKZA 1MLBB 4MDXA 3C6LC 2BZXA 3GXMA 5C3IA 3FU5A 2RCSH 2X6BA 3B9KD 1U3HB 4FFZA 5ICYA 1M30A 5IEKB 1HS6A 2ZOUA 3NCXA 1BXVA 4NCC1 4E9VA 1A4JB 2Z31B 1QRNB 1OKEA 2CDFB 3SQOL 5I1EH 2K3XA 2XXCB 4K15A 4NAMA 5EPMA 1KC8C 3PMIA 1N8RR 4DSYA 3UTZB 1AIFB 3KH3A 4CVUA 2DJQA 3HZVB 4P5KB 4ZTPH 1S5IL 3POHA 3V0IA 4KZEH 5GAMh 3L5HA 5LAXA 3T2QA 3WKML 3BDLA 2AIRB 1B6DA 3WD5H 3H8ZA 1HSBB 5KCHA 1OOTA 1J0JA 4JN2A 4M1DL 2RALA 2ZXWB 4LK4A 4MD5A 2YK1H 1OM9A 3FQTA 3HG1E 3V8OA 1CF8H 4ETQA 3KNBA 1D5IL 4I88A 3RB7A 3AG1B 5GGRA 4EBQL 1U8LA 3QDJB 3WSQL 2EIEA 4KGLA 5J1SC 2D8KA 4NI6A 4DK5A 4HEPG 4WK0B 3C5JA 3L16A 5I1JH 1A7RL 3CC5A 4WW2C 5F6IC 3KE0A 3ULSA 2YAEA 1MCHA 4TSCL 3T3MF 4E9LA 5KBDA 1D7BA 4FQXC 1V3MA 1QCOA 3HHSA 2MQCA 4KH2A 3PPSA 4PQXA 1JG9A 2WTPA 1XDTT 2HAXA 4TVSa 1UD3A 3P2DA 2DXUA 1XWVA 4Y9CA 3IDMA 1F6LL 3H2QA 2G9KA 1G9MC 3E6FB 2PR4H 4L1LA 3MNZA 5D1ZC 5C2UB 1FNGA 3EFOA 3FO1A 3MREA 5IGXH 2DMOA 1P53A 1R47A 3AT9A 1EJ8A 3EH3B 4DWHA 5EOCL 5FGCE 1X5YA 4R90H 1YITQ 3RL1A 1CFQA 1JVLA 3DROA 4Y2DA 1VACA 5F7MC 5E9AA 5KOMC 3RWFB 3T2PA 2KROA 1CIDA 4K3EH 1PSEA 1U33A 4HV8B 4IOIB 2B16A 4DOHE 1IAIH 4AKPA 5LG6A 4DT2A 2C9PA 2OK0H 4PJ8A 2QSQA 3CUPA 2GAZB 2ZX8A 1WQWA 2EUZA 3SBWA 1IGYA 4X5XA 4ADJA 2H0FA 4GQQA 3AQXA 1N0XL 3WJLC 4BH7B 3TJEL 5MEQB 4E68A 2R4SH 1EEZB 1FIGH 1M71B 3FYIB 4E36A 1NSNH 2E3IA 3ARGD 5ANMB 5GGVH 4P4KB 2XKUA 1P0SE 1W72L 3M0SA 4KKBC 1RHHA 3L3KB 4ONFL 4C54A 3HFNA 4ZOEA 1OPLA 2VISB 5E08L 1ECYA 1TKWA 5J13B 5DA0B 4JO8A 1AHKA 1L6XA 4A55A 4M8QB 4JKLA 4LGSB 4X9FA 4R7DA 2EE2A 3OAZK 1P7QA 4J4PA 4MS8D 4RGOH 3MGTA 3B7TA 4JJOA 3VFNB 3GLDA 2YGOA 4KROB 3TXAA 2DRUA 2BFGA 5DY9A 5GMKe 3AG3B 1UH2A 2RQ8A 2C3GA 1OAJA 1XCQB 4UINH 4P46A 1JXMA 3HRZA 4MWFA 4Y2OB 3MUY1 1J1OL 1IBGL 1ET8A 3WS6C 4A7SA 4ZQTA 3JTBA 3T08A 2DK3A 2Y90A 2BVPB 1JHTB 1SPDA 1NMAL 3WN5A 4JQVA 5AWNH 1PZ2A 2QGEA 2A1WH 2WXGA 4M78F 2Z7UA 3PTAA 3GDBA 1OCZB 4IMKC 3II3A 5E6RB 3S5LG 1EVTC 5TE6L 1IILE 2CBPA 3TS8A 5EBMA 3CFJA 3IEAA 2KY9A 3QRLA 4JFWA 5MI0B 1BCMA 4G1MB 4YAQA 5F1KC 1M6UA 2HMID 1BD2B 5E1AB 1E6GA 5D7LE 3G3LA 1DANT 4X6CF 2PP8A 4DVBB 2XWDA 4KKZA 4Y7OC 1I9JL 2E9GA 1ZHKA 4LLAA 4Y5VB 4AQ8C 4F20A 2EUVA 3H9SA 2GFBB 2K45A 1BMZA 1J8HA 3LHPL 3V95A 1EO8L 2AK1H 3F00A 3PVQA 4Y92A 4ALAC 4UT7L 1ZJBA 5I6XB 4H5SB 2AJXH 2OSWA 3PGDA 3QJUB 2XWCA 1LMKA 2CJUL 4KQ3H 4RRPG 2TSAA 3U1QA 4J6XA 4TVRA 1D2PA 1G5VA 4TLUA 1K2DA 3RY4A 5BVPH 4I0PA 3C6LB 4U6XA 4U1IA 1U93A 5A1AA 2D0HA 1AXSB 1TIUA 3L9BA 1BKBA 4JFZH 3I02A 4AC4A 3X14A 4LZKA 1TLMA 3PAVA 2ZYSA 5E70A 1G9EA 3PAYA 1BIIA 3UX9B 2J1XA 1HEZA 2D31B 2ICES 2OQJB 2YD5A 3SDDD 1KJMA 2K3YA 2XZCL 1Y6MR 2IFFL 4JO2H 1YEKL 1I7ZA 1MJUH 1P1VA 3WNMA 1WT5C 1HKLL 5EZLA 1T3LA 5CZKA 1SEMA 3VUBA 2R1WB 4HS3A 2HAZA 2QQLL 1QR4A 2IPTH 2HSEB 4MNQE 4M6NH 1FO0B 2MWPA 5C6TH 1CURA 5D7IB 1ACMB 5IFAL 4E9SA 2Q76B 3ZL7C 4A4KA 1WZMA 1N5ZA 2AXGB 4N8VB 3X3GH 1ZEAH 4MA7L 3MTXA 4OMOA 1RZFH 4LP5A 4EVNB 5GS1B 2V8KA 1DVUA 1WAAA 4ONHB 3BUYA 1RJYB 3DVNB 3QULB 2FBJL 2FO1A 4MJID 2G3ZA 2ODHA 3WUZA 4MDIA 4HWNA 4QCIA 4YDLC 5DZ9A 2ZD0A 1I1AA 5T1KD 3SO5A 1G87A 1UJYA 3DYOA 2A77H 2Z4QA 1OM3L 1CE6A 2J8UA 3KWWA 4WW2B 3DGCR 5DLOA 5F1NB 3S37L 4DPBX 3J27A 4FQXB 3FFDA 3VU3C 1RAHB 1JZ7A 1IAMA 4E7KA 1ANUA 4FADA 1TU2A 2BHFA 5AOZA 4EI6A 4QEGA 2KDSA 1T1ZB 1ZDSA 4ZYKB 1FYTE 4RA0C 4J6IA 4PB9H 7FABL 2DQUH 5D1ZB 5GAN5 1IGJB 5C7XH 1YITT 4JFDA 3PDGA 5HJBA 1CG9B 1TYEB 4KULA 2P4AB 1PIFA 3AWGA 4EXPX 1MXGA 2IXQB 4N8CH 4HG4J 3LNIA 3GBQA 3TPUB 2JWYA 4AVIA 2IH9A 1FL5A 1JZGA 3SD5A 2ISDA 3RVUC 2WXOA 3AREC 5EU5B 4S1QL 3EFFB 3EBGA 4YDZA 5EF0A 2BNRE 4GLKA 4M8VA 5C8JA 1MDTA 3WNKA 3UYRH 4J5VA 3E0GA 2A0LD 3O3AA 3V7SA 2Q9OA 3H6AA 4AT1B 2NY2C 3CC4Q 4IU2B 3O6ML 3GJFB 3LEXB 4KOBA 1RIHL 2DMKA 3VXPA 8PAZA 4HJGB 4U1NA 5HGAB 3GS4A 3UH8A 2VLMD 4OF3A 5FFGA 1RQ5A 2PO6C 1R5VB 4O9HH 4WI0A 2QASA 2VE6B 1UA6H 3BZ5A 1EBAA 1KB5A 1ZD6A 4ELMA 1C8PA 3PWJA 5DO8A 2EJ9A 2HLFD 3TBCA 4Z5RB 4HISA 2R0WH 3QDME 3VRJB 1DVSA 1LK3L 1WLHA 3BAYA 3V5DA 4ZZFA 4HVWA 1MFNA 4WI6A 3I6LD 4LCWB 5B1BB 3K4ZA 1TXKA 2PWEA 4ODHH 3ALWA 1A2YB 4MYPA 4BZ1H 3F12A 1NGWB 1YY9C 5C3LD 4Z8FL 3CLEH 3L3DB 1SSHA 5GAOp 3BWUF 4KRTA 2OMZA 2I07B 1IGFL 1XGZA 4BK5A 1PD6A 2DTSA 3MA9H 1LD9A 2G60H 4BE5A 4NO3B 2J21A 4HEMA 1U8MB 1T5XA 4ZFOA 4HUUB 4O2EB 5TFSH 3PAUA 4WY7L 1DQDH 1HQRA 3RKYA 1LEKA 4NO5B 2AJYH 4O51B 1RJLB 4D0BA 4N22A 4QOKE 5JOEA 2PYFB 2V2XB 5DJ6B 3PL6C 3FLGA 4A68A 5CKAA 1U92A 4BA0A 1P2CA 2WZ6A 3QDGB 1WNLA 4HCZA 1C08B 1QNZH 4IGBA 4LHUA 4Q9BA 5I1GH 4K3EL 4N2BA 1GFDA 4NKDA 5D4QA 4QRRE 1KJVA 1E28A 5LXGL 1E3ZA 5ACMA 3FB9A 1FYHB 1CL7H 2CNZA 1Q0YL 4X8JB 1PG7X 2BM3A 3I50L 3AQZA 3ML8A 4TUJA 3C94A 4XB8A 4ZMYA 1FIGL 5FF6B 3TIDA 3WLBB 2VDKH 4PJOA 2YRDA 3HS0A 1QX1A 4BI3A 5D5MF 3UBHA 4W6XB 4NKIH 3T9WA 2VDKB 3MPCA 4TNGA 1F8TL 5KYYB 3EH2A 2EIBA 1YI2T 4N1EA 1U91B 1UG9A 3HNSH 4Y1AA 2BSSB 5CINL 5I1KH 2FEDC 3BC9A 3GBLA 4OIBA 3U4AA 4GAGL 1MHCA 2FWLB 1WGVA 3REWA 1NEGA 3EHBD 5K33A 1HJBC 3D9AH 3VD5A 5JPNC 3QKJA 3G5VA 2E9JA 1H19A 4PPTA 1A7PH 1FXXA 2R83A 4AVKA 3P0VL 5JLZB 2X5PA 1GIGL 4ZPVB 3DX9B 3VTAA 3EG9A 2A1WL 2DVJA 1X9QA 3ME0A 4D9RE 3UPRA 3N1FC 1I3UA 2WQUA 1EAJA 1RLPC 4P8QA 2VWFA 1NC2A 3Q2WA 1WRFA 1H641 4M77D 3WIFB 4BFEA 1U1TA 1CR9L 1WJ3A 4YPJA 4NQCA 2W8CA 2XKSA 5I26A 1YNTA 4LVNC 1JNJA 1O7SA 4FKEA 1SG5A 2RHYA 2BLFA 2O6PA 4YPGB 2YEZA 5IQ7L 4G8GA 2WVSA 4OB3B 4PS4L 1WGOA 4GG8B 5J8OA 2AQTA 4OZIA 2AK1L 1RH8A 3VXUD 3VFTB 3RWIB 2L7JA 4XWOC 2C0OA 1QLFB 2VVKA 2AJXL 2HBPA 2Y1VA 4NNXB 2L4OA 3GJEA 2OR9H 4KQ3L 2X4TB 1JV2B 3OB0K 1EHKB 2WWKT 3MACL 4PP1D 3STBA 4BK8A 3AMKA 3FOMB 4PJ7F 4W93A 1L7TL 5IQOA 4OKDA 4JHZA 3ZT6A 3GSNA 2WZPD 3WKYA 1YEGH 1VSCA 2N3JA 2XBZA 5CLZA 5ESQB 4GQRA 2VKXA 5ADOH 5J39A 4OMNA 5LHDA 3GMNB 3NJLA 2YUOA 1QYGH 4W6WB 4WGKA 1UGVA 1VQ4Q 1ZK5A 4UTBA 3F7YA 2OA9A 1VQ7T 5EIIB 3G9VA 4QGYA 3BPCB 4NFBA 3QBYA 5ETUB 4GQPH 3MRDB 5T5FA 1FO0L 1XF5B 4HDIB 5DD1H 2WXPA 1EX4A 3LH2L 2YA0A 4JKMA 3JCMd 4BYHA 4NHUB 2CP0A 4M75C 2OLDA 4HZLA 2DZ9A 2WLIB 2BY1A 2FGWH 4GG6E 1BFOA 5C6TL 2GCXA 1WCBB 1HOCB 2KGTA 3CC4T 5I76B 4K7PH 1AWXA 4AGNA 1A64A 4IDJL 3W39A 2X2UA 4LASH 5GIRA 3X3GL 3NBNA 3PNWC 4J3BA 2NY2B 3P9LB 1RJCA 1RZFL 2D73A 3EJRA 4CN6A 2F9BT 4WHDA 1ZLWH 2BNQE 4X4YA 5ESAB 4W9JC 5F9DC 4XGZB 2PO6B 4RLDA 1Y0LB 1M1SA 3WHXB 4PV1C 1N70A 3AACA 1RI8A 2NZ9D 5KBLA 4E7JA 3HAEB 1AKJD 5LJ5h 4FXKC 2IGTA 1LNXA 2A9DA 1INQA 5HHME 3GHBL 5KVFH 4AV5A 4HYTB 1AS6A 3RZCD 1G9ML 4I87A 3K6NA 4YHIA 5B7FA 3CPFA 3GI8H 4OAWA 2C7UA 2OZ4H 2X3XD 1WBZB 3H3BC 4RFOH 5E1IA 3UAAA 2CO6A 3O4LE 15C8H 3IETB 2ZONA 4PB9L 1KPVA 1UM4H 1UOKA 1Z9PA 5LG1A 4G6AC 4OY9A 4X6DA 1IGQA 2D3NA 3QO1A 4X50A 5GRUH 2AZVA 2O9SA 1W80A 2RA1A 3Q1EA 1YEWA 2HX8A 5CQYA 2KZBA 2OS7A 1G9NC 2KKQA 4GBXD 1PEZA 3PL6B 4QHMB 3UIZA 3SDXA 1ED3A 3SYQA 2AEOA 3T0BA 2MK5A 3GKZA 4F80A 2G3NA 3JSSA 1YDPA 1H92A 3VYNA 4DW2H 2ED7A 4CKVX 2GQHA 2GY5A 3DUSB 3L9EA 3PGFH 4HK0B 4AXWB 2X4RB 2ARJA 1OD9A 1USZA 4MNGE 1E50A 1O6SB 1Z9LA 4XX1G 4MB4A 3P4NB 2D3VA 4W81A 3A8OB 2JUFA 5KYUA 1CDBA 3HMXH 2WBXA 1QSEA 4O9HL 4M7AB 4YNYB 4XTRD 1I8FA 3THMH 1KXHA 1S9XA 5H94A 5FM8A 1KT2A 5D6YA 2WLKA 2E6ZA 3MP6A 1YSOA 3WTYA 1NANI 3CD4A 5DVOA 1XB8A 3BP5B 3N1PC 4UZGA 4IM8A 2VC8A 3EYUL 2HSPA 4Y2DD 3CLEL 3UJJL 2J3SA 2X88A 4F57H 2WWNA 5JPNB 1M42A 1P1ZB 4P57A 2AQ3A 2ZAHA 3FFCD 4JHWH 4B96A 3OMAB 1NLBL 2WJ7A 4HAKA 2EYWA 4F7UE 3U2SB 4M77G 2J8HA 4OGQC 2NY1B 1S3RA 3MEAA 1YMME 2AJYL 3OTTA 2GJZB 1ILSA 4XTXA 1ZWIB 3QDAA 3OR6B 1KIUA 3ZR5A 5FV2A 1M27C 4XVSL 3HHTB 2XWTA 3VFMB 3QNZB 4LVNB 1AIZA 5IQ9A 1L3NA 3PJSA 2P84A 4N2FA 1F18A 1H3GA 4IMLA 1IC5L 4ALAL 1Y7VA 3AWFA 2OXGB 1MRFL 2J1WA 4HWBH 1BYNA 4CVXA 4QY8B 1F56A 1UYWL 2IWGA 4NC0B 1YMHB 1JNLL 1UOWA 3W37A 1AWOA 1CYGA 1G7QA 1CU4H 1BQRA 2VDKL 2WM0A 3B7SA 3CIAA 3HBGA 1YN6B 3ZDYE 4CMHC 1E4KC 2Q8BL 2Q8AL 2WXFA 1KQ2A 2ZKHL 3WIHH 4NENA 3ER0A 1NCGA 1RAAB 1NGXA 2B1AH 1MNUH 4LEOA 1NC4A 1MSPA 1VQ4T 3HR5A 3KPOB 3L1GA 3ARFA 4G42A 4IBZA 4L8CB 1I8MA 1TOXA 5C71A 2VZ3A 5E9DE 5AALA 2IJ0C 3MV7A 4QUOA 5J4MA 3IKCB 4F7MB 4MAZA 3CCMQ 2DQHH 4X2UA 2HVJB 2HT2D 1YIJQ 4D7BA 4Z3GA 1M8MA 4BY6C 3HLAA 1NIDA 4LN2A 3O81A 3DK0A 2NCMA 1W8OA 3W2DL 1ONQA 4M75B 1NL0H 2XTJD 6PCYA 1BG1A 5JYMA 1PDKA 2R1XB 4JM0A 4CU8A 2H6UA 1FX7A 2PPCA 2WN2A 4KVCL 4LAJH 5DZOA 4Y4HA 1ITBB 3D25A 1QMUA 1MVFA 5LN8A 2IPKA 2WIIB 4PGBA 1IB5A 3WYRA 1EEYB 1MOEA 1SJXA 1XR8A 4B41A 3GTVA 1VZIA 4OUUA 4R5XA 1DBAL 1IGIL 1BF5A 3Q43A 4NO2B 3MRPB 1FNEB 4JDEB 3ILPB 1MVUB 1W4SA 2F5BL 5KSAC 1MUJA 3DDFA 4GI6A 4XNQB 3DURA 3H7BB 4IHOB 2VB5A 1WYJA 4FXKB 3QR2A 2V3FA 3LZFL 4OZHF 4CC1A 3BE1L 3VXNA 1NFIA 4DETA 5JHBA 1V05A 4XXCC 1SOKA 5DS1A 3MLVL 1GKOA 4QRQB 4DO5A 4JUTA 5FGBC 3S4SG 5C07B 2IH3B 1UQSA 1BM7A 5AKVA 1DVFA 1D1BA 4TSBL 1MWAB 2FT6A 5EIVA 2D2OA 5IW6B 3TN0C 1VQNA 2VR4A 4H1LA 1F3JA 3TO4C 3C5XA 4GG6F 2EYZA 3H2PA 5IHLB 2X51A 3FQWA 2J88H 4QIRA 5D6CA 1AGDA 2GI0A 4M7LL 4FRWA 1KBPA 4PHZA 1QD0A 4KNTA 5DD1L 3O45A 1AEYA 4PJCA 5SX5K 1KTLA 2OI3A 2FGWL 3NRFA 1PRMC 5GRJH 3WXVL 5BUGA 3GDCA 4BE2A 3F65A 4K7PL 5B38A 3EGSB 4MRCA 3JSCA 4LASL 5JR1H 3VFGL 1M1KU 4WGVB 5CK9A 3SPGA 5LQBH 1RPUA 4P2AA 3EO1B 3PABA 2O4EA 3AC0A 2AZSA 4DPRA 2JE8A 3ZKXC 3RIAF 3QQDB 3UAJA 4OFIA 3SQBB 4ATWA 1O7DC 5GZOD 1Z9ZA 3NCJL 3O6FC 1TVHB 1FHGA 2G2RA 5DC9B 2XIDA 2WYHA 4KITB 1A7NL 1N59A 4JLRA 32C2A 5KVFL 1PJWA 3MNDA 4WI3A 5FO7B 3F7KA 1H3TA 1T0HA 3HC0A 4WKXA 4KDTC 1AGCA 1WISA 4KXDA 4JQIA 4Y9GA 4AM0A 4ZPTA 5GAMj 2DQEH 4OLVL 3CU7A 1XH2A 4TTDD 2WLZA 15C8L 1NA8A 1UECA 2FLRT 1TDQA 3O8VA 3VMNA 2E1HA 3P69A 1UD5A 3BFMA 3DV6A 5DDHA 1DCEA 4J1UB 5DJXA 3ZHDA 1GJUA 2VASA 1UOVA 3II1A 4K5LA 5IOPB 1Q94B 1ZLUH 3O6KH 1G8XA 1E9OB 4V1DD 3B9KC 3IXTA 1T20B 4LU5H 3ZE0E 2ZICA 3MCG1 5DJYB 1O6TA 3FQRB 1KELL 3CIQA 4HKZB 2EVFA 4H40A 3FKUS 2FSEB 4H8QA 3UTPE 1DQJA 3PGFL 1AVAA 1KNOB 1LO0H 2ETWA 4QXWA 2WW8A 3S5LA 3B2UD 2DEQA 3UA6A 5I16B 2EQMA 1VFMA 4XT1C 4XVJL 4FA7B 3FT1A 4YLCA 4CMHB 3LQAH 2GBUA 2DEXX 2QQ9A 4EOWH 1OAXH 1T6BX 4UV7H 1BZ7A 4Z7VE 2C26A 3MLTB 4NUGH 3OKNB 2VLJE 3OYNA 4ODBD 3S34H 4M02A 3THML 3VA6A 3D85B 4NQXB 1FJ1A 1R17A 5HCKA 5I73C 3CDCA 3NRPA 2LC4A 4F7UF 1FL3A 3HJ0A 3I56Q 3CCMT 3T77A 5LJ5f 1G3TA 4HOZA 1DFBL 1XAKA 1G6RH 1OB1A 4YTLA 4F57L 4MSWB 4AYSA 1VAHA 4R8WH 5GGSA 4PHXA 2DYSB 1BYOA 4BY6B 3V7AG 5CQXA 1E2VA 1RLWA 4HH9B 4JHWL 3RGVA 3X3FL 1V1CA 1NPNA 3SWNA 2OTUB 4JUVA 4AX3A 4TQEH 1J5HA 2VLRB 3LEVL 5KVGE 2O9VA 3GSQA 5DS8B 2FT7A 4PREB 1T2QH 4HKBA 3OKLB 4LSTH 1LEGA 3VVWA 3M88A 1HVXA 4PJOD 5LLIC 1IC4L 4TOYL 1BHGA 1MNDA 2DKGA 2PYEE 2EYYA 1VFBB 4C5HA 2FAUA 4JY4B 3Q44A 1OX8A 3ZDYF 2WCPA 5I66B 3JCMV 5FKPB 5KW9L 3QH3B 4J9IA 3V4PB 1BLIA 3WTUA 3CVBA 1FC1A 1CDUA 1UWXK 5D9SA 3N40P 3QJOA 1JOIA 5FYLD 3E9TA 4A63B 3BN9D 4JRIA 4H26B 2F69A 1QASA 2UX7A 1ZTXL 3CVHH 3PV6B 1ML0A 1SLWA 1CSKA 2Z91A 1TCRA 1KYOK 3CBMA 3DPBA 1FFPA 1AMYA 1SOQA 1TQCC 3ARWA 5BRPA 2ZYRA 3CVHB 1WFJA 2APXA 1WZ1H 3C9NB 3F5WA 3QQ9D 3W56A 2Q3AA 1J8SA 3WIHL 4HPYH 2QGCA 4N4IA 4AKOA 4JGUA 4PRIA 1OPOA 3ARGC 3FQXA 4C92D 2FWSA 1IRAY 1SJEA 3UG5A 3MA7B 5B3SB 2R57A 1CPUA 3P73A 4TVPD 4O6JA 4HIHA 4S2SA 1N7MH 4NQCD 3OAWA 2YD8A 4XBMA 3SDYH 4R6UA 1QFUL 4IUUA 3BW1A 1NL0L 4LVOC 3BMVA 4MS8C 2JKIS 2QA4Q 2OTPA 2NXYD 2ZZUT 3P4OB 3OQ3B 3Q8BA 1PRLC 1YWOA 4C0ZA 5EIQA 1PLCA 3PWVA 1BEYH 3KS0H 5IVOA 4CSSA 4IRSA 4OZGA 4KGJA 5FGRA 3S48A 1UWEH 3N85H 4JFUA 1FG9C 2ARWA 3TV8A 2DQFA 5JHDD 2ZSVA 3ZKXB 5ICXB 4X5WA 4DGVL 2ZKXA 3I9PA 3B7YA 1XGQA 1GHFH 2EKSA 3O6FB 2HCKA 5KANG 1EZLA 3BP6B 1JZJA 4G72B 1S7QB 1AC0A 4WU5A 2A6KB 4LNRB 4Q9CA 1M3BA 1F4XL 1A5FL 5ILTL 2MMXA 4IW4C 4OM1H 4UT6L 2HMIC 1IKOP 4JG5A 1RIVL 3BN3B 1SXNA 1T22B 2X4NB 4EMKA 1BOGB 1DJGA 1LQBC 1UD8A 3BGMA 3MLYH 3GZOA 1MWAL 2PN5A 3I9GH 4L4JA 2YD2A 2KBGA 2JELH 2DM2A 4U4IA 5A6LA 1G9NL 1S7SA 1BYMA 3PQYB 2DJSA 4P2QB 5GSVA 3WNLA 1FZKB 4Q2ZA 5IB4B 3LKQA 4YX2H 3RVVD 2SEMA 2EDNA 2GBTA 4I2XA 1E9QA 3I6KA 1OP3K 5IT9E 5ECAA 4G2AA 5CSGA 2GQIA 3B9KB 5C0AA 4FYQA 1M6OA 4QXUL 1KGWA 5AKSA 1MRDH 4AEHH 3T1FB 5HDLA 2QGBA 3X13A 3SDDC 4JDZA 3I9AA 4OP0A 3VWKA 5JR1L 4PGCB 1FGNL 2X1WL 4AIZA 4AEFA 2R23A 3DVIA 5CJQH 5IB1A 4C83A 1VENA 4J9FA 3NH7H 5J57B 3ZYZA 3F7VB 3D5OF 1MPAH 3EYSL 3ULRB 1Q7YC 1ZJAA 2YD3A 4K5OA 5LBSH 5C9JA 2EDQA 4PCYA 4AJWA 3AM8C 3QGVA 1M9SA 1MY7A 2R27A 5I0DA 3CCQA 4OFQA 5T1JA 1YQVL 1K4DB 2AEWA 5DSCB 3ISWA 2Q7YB 1FVEA 3MUHL 4LIQL 3V5HA 1KTDB 3GB7A 5C0EB 2CQVA 5JQ6H 2XHNA 1QSVA 3LN4A 4HHAA 3DVGB 3B9EA 3HS8A 2ZYIA 4KGXB 1WH0A 2EYRA 2VM3A 3FB5B 2FX9L 4KX9A 3SHSA 3OXRA 2HRHA 5HTSA 3FQ1A 3S96A 5EF3A 2NTFB 3ZE0F 9PCYA 4ZX5A 4ODXB 2WVVB 2P8MA 1N9SA 1X9RA 5GISL 2HT3D 2X6VA 5D70H 1PX4A 1AJ7H 3C75A 1X27A 2B0SH 3N5BB 2H32A 5AW8B 4AUYA 2IEPA 4LU5L 5D4HA 4JY6A 4LPUA 4PJ9D 2KPWA 3VSVA 2EO9A 3Q6FB 1IB8A 3IMTA 3SGJC 1LO0L 1N8OE 5E94A 4Z7VF 1Q86U 1SEQL 1ZUUA 2CLRB 3OX8A 2BIMA 1KGIA 4FGMA 1P5UA 3W0WA 2CA3A 5FOBB 5AB2A 4X4MA 4YEEA 3MX0B 4FN0A 4HS8L 2PW1B 3RDJA 1R3IH 2EQKA 1NZ9A 3RWGA 4AUJA 1TQCB 4IBTA 5AW0B 1K5NB 3KEDA 1BPVA 4NUGL 4C92G 3S34L 2A0LC 5I9QC 1HIMH 2APTA 5G4NA 3V6OE 2H5UA 4BFGA 1D0ZA 1HEJC 4OMPA 3QJSB 1HILB 3MP1A 2AV7A 1IAKB 2HG5A 2DXBA 1LO3H 4FYVB 3ZXAC 3TNMA 1KN2L 4JZJB 1QBMH 4ZX3A 3CEYA 3CLFH 3DSNA 1BVNT 3ARDB 3ZTNH 4LCYB 4X7DC 4XP1H 2HLFC 3D69A 4KI5E 5KWYC 4OLZH 1YEHH 4CNIB 4RCBA 2E12A 3G6AA 4BQ6A 4ZW7A 2FHFA 2MNUA 5DMIH 1QSFA 4ZDHA 5CEYB 2V2TA 1T4WA 3PHOA 3PWUA 4GS7C 4Z7OE 4FNLH 3IFPB 5DJ8A 2AZAA 5BV7C 5KAQF 5F97E 4BE1A 4B60A 1YJWT 3T2LA 2ADGB 2WTRB 1GTFA 2WLLB 4OJDH 1M2OA 4X80L 3V4PL 3VCLA 4JQXA 1W0VA 1U06A 3MP8A 5FAAA 4ACTA 3QWOB 4ATTA 2A6JB 3GSXB 4FF9A 5E2TL 3WO3B 3GIVB 1HE7A 4WTZG 1ZANL 1KYUA 2X2JA 3JVGC 4KO9A 5JPMA 3QUIA 4L8DB 5KSUB 2BSEA 2X3CA 1NEZA 3EJZC 1MJJB 3RX9A 1JAEA 1YNKH 3QZNA 4M5SA 2BVOA 2X4PB 2DYPD 3NZ8B 5CSZA 5CMAB 2YUQA 1VQ8T 1AD0A 1CS6A 3LV3A 3RL2A 1KLUB 4XWGL 2Z7YA 3GPSA 4WWPA 5MHSD 1EEQA 4TM9A 4M7DE 1U8NA 5MEPB 1I9RL 1WZ1L 5HYSB 1BAFH 2UWEA 2CDGB 4JKKA 5F9WC 4HPYL 2YRPA 1I5OB 3QQ3B 5CBAB 3GF8A 2V8JA 5EOCJ 4APQA 1FZJB 2JM9A 1NPPA 5M9OA 4YDIH 4YH6A 4HCBA 2YUZA 3D39A 5D2LE 1ID2A 1B3JA 1MI5E 1NFDE 5GMKj 1R3LA 3ZZQA 5I0VA 4EUPH 2CLVB 3PGCA 3OHXC 1RD6A 3FULA 4JO3H 3SDYL 2Z7ZA 5B1KA 4EUPB 4JO4H 2DILA 1EBPA 1YJDC 2I9LA 1SMDA 2YQ2A 1XF2B 3T6XA 2Z8RA 4ORGB 3LH0A 4PWHA 3ARPA 3EHBC 4YDVA 3SDDB 4PRBA 1N4XL 1IGTB 4PRDB 1AR1D 1SHMA 1I8KB 5IBUG 2LU3A 3A5ZB 3RI5K 3G6JA 2QGGA 4GUPB 3FUJA 3CCSQ 2EIMB 3RBGA 2EABA 3FJ5A 3CN2A 4GPVA 3TOPA 1A9BA 2WO4A 1V3KA 1DQQA 4AEEA 1GGIL 2QSVA 3P77B 4KHTH 2FHBA 2EEAA 4FQQA 3UEQA 3K71B 4OB5H 1GHFL 1HAUA 3BVWA 1V3LA 4OJYA 1JK9B 1OV3A 1HD3A 3OMCA 1JZ5A 4JFHD 2UXTA 3HVDA 4M77C 2WYIA 5DUPH 1G3WA 5FYKL 1LLAA 2AJVL 2XN2A 1TQVA 3FCTB 1X5KA 5T5NF 5EC7A 3NFNB 1B3QA 1WIUA 1FV1B 3KWVA 3WFBH 5FA4A 2XXMB 3CH8A 2HFEA 4MJIB 3LH9A 1V7NH 3LNGA 5T1KB 3I9GL 4HFWB 3OSVA 3U7AA 1MV0B 1CQYA 1AHWC 4UV4H 2JELL 2VDQB 4NQEA 2DQDH 3T0EA 1D5BB 3GHEH 2RHEA 3BY7A 5IM7A 3VUAA 1W9XA 2ZPIB 4JFXB 5IEHA 1XGPA 2XG4A 2NUPA 4PP1C 1P7KA 3BH9B 3L4ZA 4HUWB 4K73A 4Y19D 5EOTB 3UTSE 4Z7QE 1AO7D 4Q52A 5LNEA 3TIEA 5D7SH 3MGAA 4U4BA 2AV1B 4R5TA 1TG0A 2YDLA 4DVRL 3KWTA 1QRNE 2WUCH 3WFDH 3GRGA 3VXSD 1UJTA 2HX9A 2WOYA 1L9OA 1PIGA 2HFTA 3MCLH 4IK6A 4NP4L 2FZKB 1KGYE 2WANA 1RIUH 2YC1B 4PV8A 4XN1A 1FWXA 3IDNB 2ZWZA 3F84A 4IOFD 3ZHKA 3HW7A 1ZV9A 3AT8A 4AC2A 3ATDA 3FUEA 4VUBA 1GC1C 2XPGA 2WINA 2HL3A 1MNNA 1LP9F 3HI1B 1MPAL 2F7IA 4A7GA 5I9QB 2Y7QB 5IW3A 5LBSL 2X70A 3AGVA 1U8KA 2IQAA 5K1VA 1OANA 3VI3A 3WY4A 1HCZA 1E4WH 3KHOA 4PTTA 4E9RA 4JPVL 4WFHD 1YP5A 2A4EA 2WMPB 1SXAA 2OTWA 3L4TA 5DCCA 1HH9B 2R5AA 1MCIA 1OZ3A 3D33A 2NYYD 4JZNA 3VO0A 2DQIL 2NX5B 3IMWA 4QDGA 4AVHA 4UQBA 3G08A 1YN8A 5GS3A 4DP2X 4FFYH 3KPPA 4AQOA 2VUBA 3MRBB 4IKLA 4CKQA 1KV7A 5KSBA 2J2ZA 1EGJH 4NPJA 2NZ9C 3DK2A 3DB4A 3MU3A 1M57B 5DUJA 5EEVA 4Q58C 3SDAA 3STZB 5BV7H 1UVQA 2C9XA 2MHAB 2RFXB 4P3CL 3E1F1 2WXQA 4NIKB 5K9OB 3RZCC 3ZRSA 1AQHA 1VQ9A 3O6LL 2DL5A 4QXVA 5BV7B 2VQTA 1AJ7L 1NWOA 2BNUB 4XMLL 2ED8A 3ZO0A 2A3TA 3EYFB 1M7UA 5JA9A 3VV0A 5KBKA 1N6QH 3M58A 2LQ8A 4F16A 4A6YH 4B97A 1AZEA 3LX9A 4IRZL 3BUTA 3GMOB 4WSJA 1KQSS 2P0QA 3U4BH 4ABVA 1ZHNA 5JOFA 3DC0A 3FQUA 3ZGIA 4A6YB 5HVGB 2BSRA 1HXYA 2OULB 1FZOA 4MD0A 4GBXC 3LQZB 4OFPA 5CHNB 1OOAA 1OE2A 3R1GH 3LRMA 4ODWA 2HQXA 1FRGL 2EE6A 5E2VH 3RAJH 4EDWH 1JYVA 1UEBA 1QEXA 1N0LA 4P48A 5LGHL 3WIIH 2DKMA 4WNQA 3VB8A 2VLKA 2VLLA 3R18A 2PVGB 4Z3HA 5MENA 4ICXA 3QHZH 1NANH 2QG9B 3QRFM 1HIML 4TV3A 3RGVD 4OZ4A 5F9WB 2IH1B 2GHZA 4G8EA 3V8JA 1IAOA 2GBQA 3I55Q 2NUZA 1I3VA 1R3JB 2AVGA 3H0TA 4KI5F 1F45A 4MS6A 1LO3L 3FB7B 2LCLA 1MH5A 1OK8A 1QBML 2B77A 4OCRH 3T6WA 4RKUE 4N0UB 5IUCA 4Z7OF 3N44F 1T1YB 1JNNH 2G0KA 2IV9A 5SWZE 4XTRC 3OHXB 3ZTNL 5GAMg 2DTML 2VR3A 1TVBB 3L5WB 4XP1L 4BCZA 4G80B 3KBGA 3MUJA 1X5HA 2A9NH 1OAUL 2ZCLH 1B90A 1FHNA 1ZT1B 4XX5A 2Z0UA 1CXKA 2CUIA 3EHBB 4OBRA 3ZT7A 4DEWA 4I48A 2D6FA 3FRUB 1RZ8B 4Y2DC 2JMRA 1DSFH 4NOFA 4MVBD 2ATPB 3KYNA 4LARH 5GANh 4FCAA 2D7TL 2XMFA 5E00A 3DRQA 1ZHLA 4JPSA 4Y8DC 1G1YA 1R24A 5EEWA 2DEUA 4RCCA 4A7VA 4WWKD 3S3JA 3UTTA 1JD7A 3QYMA 4UMSA 1TU0B 2G9HA 1RI0A 4M77B 2DIAA 4PRID 4XZ4A 3QZLA 1I9IH 3UC0H 1P9MA 5F7BA 3UDWA 1JS4A 4XRCA 2V1RA 1PVHA 4U1HB 5E8NB 3JWDH 4JFPB 5DD5L 2QEXT 1BD2E 3CMGA 4R7LA 3CC2A 1H3ZA 1NFDF 1QUNB 1CDJA 3EH1A 1BAFL 5BXFA 4G9DA 3VGDA 2R1YA 1F2QA 3DTXA 1AHWB 1PWTA 4WZ9A 1IZ6A 1M3IA 3RUGF 3FO0H 5IHUH 3VXUB 3BAEL 2PCYA 4YDIL 4GW5B 5H2BB 5IB3A 3U4EA 1OAYH 2EO1A 2UYLB 2I69A 4KXCA 1NLDH 1TF4A 2G5BA 3CLWA 2QR0A 5AD0B 4L4VA 1A21A 5CJ8A 5CGMA 5BVJB 1T1XA 3KXFA 2W9DH 4N2DA 3FH7A 3MOAL 4JR9L 4UDTB 1KJ3H 4XN2A 3RWHA 1UZ6E 1KJ2A 3LKNA 5IHWA 4C8QA 1WIOA 5M7QA 3WN5C 1KGCD 4LOEA 1WDXA 3DX6A 1XF3B 1KHIA 3QUGA 4JPKL 2I25N 1MEXH 2K6WA 3V8LA 3L54A 1U8JA 5CM1A 5EU7C 1CCZA 3HVNA 2NT1A 1NCDH 4XH2A 4B3EA 4NKMA 2LCSA 4WFFD 5IR1B 3JCMQ 1WXTA 2HT2C 3C2AH 3K7UA 3PNRB 1MFBH 3IXAA 4LNPA 1HSQA 3GSVB 4G5AA 2OSLB 3G6ET 3CCUT 2XTJC 2WVUA 3NUKA 2VDNB 4OIFA 5FW7A 2V17H 4GAYA 4C57C 4ADGA 4X8CA 4DTGH 4KH0B 2J6EL 3VU2A 1VF5C 5KJRH 2QKIC 4KGZB 3BKCL 5DUPL 4XBGA 1QTSA 3ALXA 3IN2A 2D7OA 2AKRB 3BDYL 5FKAB 1DLHB 3BAXA 3S35L 3DO3A 4NWUL 5IFJB 2E46A 4FFZH 1H8NA 3WFBL 3U9PH 2AF2A 2D7MA 4XTYA 1K76A 4K07A 3AXHA 2VDQL 2CM6A 2J1KA 2LE9A 3QPKA 4FQ1H 4OLUL 3EDDA 5C0AD 5AFAA 5DO2D 1XXFC 3U46A 1AKJB 4UU9B 1NMBH 25C8H 4JFOA 4Z7QF 4XR8C 3RNJA 4L1BA 3QZWA 5TQ0H 1ZGLM 2DQDL 3LX7A 5D1QC 2D0NA 4NM4L 4AFSC 5HGDA 3RZCB 3EO0B 2YPLA 4J3OG 4JB9H 4FQIH 4IK7A 2GEQA 2ADIA 1OE3A 2JB5L 4ERSL 4RMUA 1BPLB 4YSAA 3OW2A 3WN6A 1UWFA 2W0ZA 1E5ZA 3IU4L 3LSOA 3RMSA 3Q3GB 3S4SB 2K6YA 4LO9A 1FLTX 5F3FA 4QT5B 4OH2A 4AW4A 2WUCL 4EDXA 4LESA 1WXBA 4GBXB 5KSVB 5FCSH 4H0LC 4LEXH 4N0YH 5H37A 4ETQB 3SHWA 4BCXA 3ULVL 3S3MA 2R29A 4MJ6A 3KYOA 4U7MA 5I0ZA 1W1FA 1I3GH 3P1VA 3RWEB 1BVNP 1RXLA 3IAGC 4C5EA 3HZYA 1QCNA 5I22A 3I55T 1T7WA 2ESWA 1NCUA 1T7YA 3JV5A 4QF1B 3UPAA 1FPTH 4XC3H 1KLGB 2WLMA 4FD0A 3T2OA 5LJ3d 1GS6X 4PB0H 3ZMNA 2HX7A 4YQXH 2X4SA 5BOJA 2RGSA 4Z89A 3BUIA 4QPEA 1I7TA 5GZOC 4C0GA 2OW6A 2CRYA 2WJ5A 3HHRB 2V8LA 4WF7A 4OD2B 2KEAA 1WC7B 4GIAA 3MNZB 1AC6A 2EDHA 4AIEA 5IY5B 4HPHA 4QXGL 4XU2A 5BV7L 1PZSA 1WZOA 3MLWH 2MTPA 4RTZA 1HT6A 2JQZA 1UJ0A 4ZODA 3ZHNA 4DN3H 3SJVD 3POCA 5DJZB 4JREC 1A6ZB 1DUYB 1VQKQ 2CGRH 2BCKB 5EZJB 3S3DB 3A67H 5EZPA 1WBXB 2V6HA 2XWBA 4TTDC 3FFCB 4A6YL 3ZL1A 3DBSA 5J3BA 3NQKA 1WXUA 1HEHC 3BVXA 1Q1JH 3A24A 5IJDC 1KOAA 2Y5EA 3CUPB 1D5MA 3D1MC 5IVXA 3LWHA 3OKEB 3V4VB 5SV3A 1JJUA 4N1HB 4NO0A 4WI9A 3EJTA 2H3JA 2VDOB 2YRZA 2LTQC 4ONOA 4P5TA 4U6HB 3C6SB 3R1GL 4UQIM 3D4GA 1I4K1 4MA8L 4QTFA 1ACZA 1EMTL 3N3EA 3TWCH 1XSJA 1KXTB 4EI5A 1QNIA 3FOLB 4IUPA 2MTAA 1OHZA 1BLNA 2BP0B 1D9KD 3QHZL 5I1IH 1YQ2A 4J8QA 2CSQA 3B2UC 4U1SA 1H6EA 2XN9D 2NR6D 3IGAA 4L23A 3FJTA 3A8MB 4F9LA 3MGTB 2B3IA 1QSFD 5IESL 3P9WB 5J3HD 3NN8A 4FLRA 4JRYA 5AENA 4KU1A 4A53A 2CKNA 4ELZC 5CILH 4B9FA 5GAOm 4OCRL 4Z78A 1EV2E 2K9GA 3MRGA 2F15A 1JNNL 2ZX6A 4IDLA 4GT0A 1YJDL 1S7UA 4U7KA 1P4BH 1VQOQ 1XF4B 3FMGH 4Z77A 5EN2A 5HYQA 3IAQA 4LSQL 3TT3H 1ABQA 3WN5B 3IDJA 3M86A 7CGTA 5LDSA 1F1DA 4PBXA 1K9MU 4HOXA 2RK2A 2G4GA 2RJDA 2UXVA 2L7UA 3BEVB 3ZTJG 1QZ1A 5GRZA 2ZWNA 3CFJB 1HL8A 2F8OA 5AUMB 3BKYH 3JTSB 5AYQA 1TFHA 3RNKA 1UXSA 1ZS8B 1QVGS 4NCDA 2UXGA 3FU0A 4QTHB 1KACB 2Y72A 2EJGA 4GY4A 4F7TA 1ZHKB 2XTJB 4ANJA 1AZGB 1BFVH 4KT0E 2OMTA 3CCJA 3U4KA 1LE5A 5IBLD 1BW8A 4YMPA 1D5ZA 2E9WA 1DLFL 3UP6A 2QKIB 3WEMA 3V8CA 3MJ7A 3C0CA 4BWUA 4H0IA 3FB6A 4WFGD 3WUWG 4GRLD 5CGBA 4PJOC 3QXAA 1SRMA 3D39D 2CO3A 5EUOA 3WDJA 1RPKA 4D8OA 4H25A 4JFFD 4G3YL 3OMIB 3QZ9B 3HBPA 4G7QB 3SKMA 3RG1C 4NYLB 2L5QA 3FN0H 5BS0D 4K9EC 2ZSWB 2CZ1B 1N10A 1ZTMA 3GBML 3T2NH 1G43A 2ID5A 5ID1B 3BN9C 1UZ6F 5IHUL 4GXVH 2E6JA 1OV8A 5DRXB 3BZFB 5D1QB 4V2BA 1OAYL 1HEZB 4M3JA 2FVNA 4E41B 1OSZA 1X5JA 4PBWD 3BKMH 2EXWD 2VDPB 3DHJA 4GEJA 3UZVA 5DVNA 2YMXH 3KDPB 5FA3B 2W9DL 4U33A 4O02A 5L8LB 1J10A 4HS3B 3JBG7 1MCOH 2F1AA 4YDNA 5DUBB 5EH1A 5F3HB 4HG4K 2ITCA 2C0TA 2F7OA 3PIOA 2MKLC 4XP5L 4AENA 4C92C 2HB0A 4XP6H 5HHOA 3US9A 4ZMPA 3JUYA 5HPMB 5E8DL 3HC2A 1FVDA 3IGLA 4ELME 3I74A 5FECA 3KJ6L 2PLTA 2OMXA 3FUFA 3C2AL 1GC1L 2VDNL 3BUYB 3P0YL 1LE9B 4P2CG 4PJDA 2VUOA 2AKLA 2OJ1A 4K7PY 1ECZA 4OF7A 2N7BA 3AY4C 2IDFA 2NXYC 4DTGL 5GANf 2ZKWA 3UZEA 2X42A 4NQED 2Z92B 3MTRA 4M4ZA 1BMWA 3GLXA 1VA9A 1OGAA 3JV6B 3QEQA 5IB2B 5C0JB 2E6QA 1TQWA 2R69A 1PZ5A 4WW2F 2NNRA 2ROYA 1HCVA 2DBJA 3QO3A 3RERA 3ZRFC 1IE5A 5TGBB 1N2RB 2WB7A 5BZZA 5KS9B 5F72S 3OJVC 4Q5WA 1OZTG 4MZ3A 2ATAA 1UXLA 4MLIA 3WBDA 4HIIB 1NMBL 25C8L 3ZIMA 2GJ6D 3JB9J 3LIUA 2VAAA 2YQ3A 2FZGB 1VQKT 2GW5A 4WI5A 5FUZH 1UKSA 4ZTOH 2K78A 1J7VR 3OLIA 1OLZA 4XNYL 4FQIL 4XNDA 3G6DH 4JREB 4MQTB 1SBSH 5GS0L 3KPSA 1FZMB 4PRNB 1JPSL 3Q1JA 1LNUB 1AZBA 3CVIH 4QHKI 2V7NA 4DZBA 2NY3B 4P3DB 2XICA 2HJFA 4QHUB 4F7EA 1O75A 1IV8A 2B20A 3L2WA 4KUIA 1JZFA 2A74C 2AABL 1AACA 2DM7A 1X6BA 3FQNA 2WGXA 5EWIH 3SPIA 2F6AA 4J28A 3RVVC 3BCFA 5EU3A 3RKWA 2E47A 2LTQB 4LEXL 1K5WA 3VH8G 3E6HA 3UPUA 1RY7B 4V1DB 1KB5H 1DJHA 3HG4A 5DTFB 5EZIL 3LMJL 3OMGA 1I3GL 3OKOA 4BFNA 3MRMA 1YNZA 4GLRI 2YUPA 3FJPA 2ZNWA 3LTVA 2IQ9H 4O4YL 2P1YA 3I3DA 3PWJB 3WJMA 3X12B 4JJDA 2KZ1B 1JN6B 1SLVA 3ARBA 4XC3L 1ZLVK 2NY4D 3QHFH 4X5RA 1GY2A 1Q9KA 3VS3A 4J6RH 3RFRA 3WDIA 3G5ZA 4KFMA 1LO4L 2VIRB 1JB0E 1HE8A 1REIA 3EO9H 4PB0L 2J6OA 4O5LL 4U31A 4YHNA 4WCYH 1KG1A 4A1RA 5HHQA 3QHSA 4RMQA 4KPHH 3OW2P 4PJJA 3EBHA 3HBQA 3PFQA 1NAMA 1PNDA 3H3PL 2K79A 4M7AE 1LD9B 5T1MA 2HQHA 3GSRB 3S7GA 4AMWA 1UZ8A 2FR4B 3VD1A 3L4VA 1T89C 4EQ3A 2VXVH 2XV6B 3MLWL 1HQRB 1XV8A 3MV8D 4MJ5A 2CP7A 4L05A 3SOBL 1FAKT 4LSRH 4G8GE 4Q6IA 3M5AA 5B8CA 5F1IA 4GJTB 3NYKA 5C09A 2N0KA 5TD4A 3VDAA 3H1ZA 3GK8L 3U23A 1TG8A 4DF9A 1I85C 2XA8H 5CEXB 4LLQB 4NKDB 1VADB 4ZGEB 1WZKA 2JNGA 2CIKA 4YIQB 3FF7A 1DN0B 3V4VL 3BAWA 4HC1L 4UTAA 1OVZA 1XH3A 2VDOL 2VLKD 1QBAA 3V7RA 2ZJSL 5MEND 1UCTA 2A6DB 4OCLC 4U1MB 3ROLB 3U30C 5IREA 2HT3C 5LJ5g 3C60A 3MV9A 3HCVB 5HGBA 3LKPA 1E5CA 3S2CA 1EFQA 3VD2A 2UZIH 4ZFGL 43CAB 5DHVB 5ESVA 1KG0B 2JXBA 4K9EH 4RSVA 1C5CL 2EJ1A 4NPYA 2DQTH 4PJ9C 4ZQKB 3QHTC 5FYLH 3GM8A 4BQ9A 4KDVA 4AFQC 2IADA 3K8LA 2L3PA 3F2LA 4NSKB 3TBWB 3SPCA 5I1IL 5HYJA 4R96A 2WZAA 2MNJB 4OCWL 3OPZH 4MAYD 4A4FA 1GL4B 1R5WB 2FX8H 3GBNL 2YA1A 3L3JB 4KRPC 5DFAA 5C0CA 3NIDB 3R7RA 2DEYX 1XR9A 3RIRA 4XZUB 4JHVA 2Q2LA 2FIKB 5CILL 1SQMA 1SXBA 4C56A 3NA9H 5IV2A 2OCFD 5HGHA 1ZTXE 4NQUA 3ZK0A 1NAKH 1AI1H 2AXJA 4H20H 1OSEA 2F68X 4H8WH 5CKGA 4PGJA 3KPTA 3MRQA 4KH1B 3META 4TVPH 1MG3C 4IU3A 2ZQKA 4LDOB 4M78A 4C92B 3LQMA 2HMAA 3QG6A 3CBJB 2ZXEB 4FCHA 4L59A 2CPUA 1GOGA 2OJEA 1U2HA 3BKYL 2XZQL 1JRHI 5L8RE 1KBGL 2H6OA 4NQCB 4X98A 1KMGA 1BDYA 4ZUVA 3N9GH 2OTJQ 3ATAA 5TH2A 1K3ZA 4HQQH 2LMJA 1HSAA 1MCDA 4NZUL 4TPRH 3JB9F 4X6CA 5FYKU 2DNUA 2BH0A 1BFVL 4M75E 1UCBL 5T3XD 3RDTA 2NXYB 3CXHK 2YAOA 4S0TD 3TBVB 2KVQG 5D1XB 4KNQA 2PCFB 1C5DB 4OZIB 2A73B 4A37A 1QG3A 4TL5A 5ENWB 4L37A 2WLHA 3MCAB 3TBBA 3OAUH 1NMCC 1FFRA 5AYTA 3PWPA 1PKQA 1ZLSL 2NW2B 1T1WA 3GJEB 5JHDB 4UM9D 4PVBA 3GSNH 1JF5A 1Z9MA 5AVTB 5BRQA 5BRZD 4KV5E 4L4VD 3KXFD 4WFEE 3CC4A 3B37A 5IKCA 1KTCA 5JW5B 1K8DA 3SE4C 3T2NL 1M3JA 3L3GB 3T4AC 3JT2A 1WCQA 2Y6TE 3QC5X 1ZSHA 4DEYA 2DWYA 2VDPL 4BDVB 2ZAIA 5I1CH 1MW3A 1OPGH 3VXTB 3GXIA 4BCYA 1HINH 1U8QA 1ZAGA 5GRVK 4J9BA 4LPCA 1OI1A 3Q2VA 4PJ5A 5C07E 4GMTH 1DYZA 4IBVA 4H2CA 5KE3A 4ZTFA 2I9TA 2VDMH 4ZUSA 2GITB 5I1DB 4Y9FA 1GMEA 3DIDA 3J81E 2A74B 5T8IA 3IU3A 1QSEE 1YECH 4HLEA 5DVLA 4XC1H 4XVTH 1T0MA 2YN3A 4F8QA 5LGKA 1K73C 5GGQL 1CIUA 1FGVL 1TMQA 3TWYA 3WVDB 2AQNA 2PTTA 5CNHA 4M8RA 1H3UA 5HHNA 1S7TB 2K1MA 2NXZD 4AYFA 2NSMA 4MZ2A 1IAIM 2P5WA 5IB5B 4KHXH 1DVTA 2CK2A 4F2EA 4M7JH 1S9VA 1TWBA 3GIBA 3KGRA 1T0PB 3VWJB 4Y4KD 5I0XA 3ASKA 4II1A 1AR1C 4PJAE 3TQ7P 1E7UA 5T1DH 3IDGB 5J11C 4X9CA 4GT7A 4R3SB 4E7LA 2QMKA 2CKBB 1QVOA 5IBUB 2SEBA 5FWBA 2GSIB 3FU7A 4N2MA 3H54A 1CLZL 4N24A 3WFEL 1Q82R 1VQPA 2JJSC 2OL3A 2UZXA 1BZDA 2DIQA 3N42B 5C0GA 5AVQB 4NNYB 2O5NA 3O3BB 1ZS2A 2BY0A 5K59F 2QTEA 1JWSB 5GS2D 1FMKA 2H3NA 3KPRD 1E5UI 2QQNH 4YR6A 4BWTA 4OB2B 5FW9A 2H26B 2W65A 3ZUCA 1OIOA 4ZTOL 3T0XA 3H0IA 2D7PA 3HLKA 4LD6A 4Z88A 3LKOA 3VFWB 3G6DL 5FV1L 1UACL 1EFXD 3L3OB 1JXJA 1MFCH 2IG2H 2XRAH 4K94C 1UHVA 3RIAK 3CHPA 3CVIL 3KYKL 2AK4D 1J18A 1I75A 1OGTA 1YDPB 2DL2A 2R0ZL 2V2WA 2BSTA 2EE3A 4R7NB 3HG1A 4LIQE 5FYJD 3D30A 4RIRA 5ECGA 4LPXA 4AE0A 4LLMB 1M7DA 1A6AB 5AVXB 3MAWA 5AL0A 5G4MA 3U30B 2ARJB 1T7VA 5LWYH 4HJEA 5BO1H 1VGKB 1I1YA 3Q2LA 3NZHH 4D0CA 2GF7A 5AVVB 1P6AB 3EHRA 5DQJB 2XU8A 4OGAD 3CZJA 5BJTB 3A6BH 3S88H 3MGOB 4PJ9B 4JPWH 1BFSA 1Y96B 3GMQB 4JKNA 5JIIA 3TT1H 3Q2NA 1ES0A 3V9FA 4ZMNA 4JRLA 3RQ3A 4M7AF 5TJWK 4QO1A 1WK0A 5FLVA 2DLHA 2J71A 2ABLA 2MQ3A 4KRPB 4UQCA 5E23A 1F6FB 3WEXB 2OMYA 5JTWA 4IOFC 2VL5A 1AD9B 1HHGA 4KKAD 4PM1A 3BJLA 2X6MA 4L2LA 5TF1L 1TMCB 2XV0A 2UX6A 5GHWL 4P57B 1DCLA 2BPBA 3EOAB 1H3VA 2IAMD 5JQHC 1R5IA 4MRBA 1XO8A 3BEWA 1NFKA 4HGMA 3QFGA 3TYGL 4KRNA 1U8PA 1EXUB 1TQSA 3ZPDA 1S7VA 3PPEA 1PU0A 2DIGA 2O5ZH 1GCYA 3MROA 2NYYC 3HI5L 4TUOA 5JOPD 1U2YA 2P49B 3ENEA 3STLA 4EI0A 2AI0H 2ZOOA 3FT4B 1B2WH 2EGCA 2O4XB 3UA7A 1C5BH 4FSXA 2OTJT 1H6TA 2I27N 2Y6SD 2XA8L 3LRSA 1FA4A 1VEOA 4NJAH 5TTRA 1F1BB 1ORQB 1RSFA 1PG7W 4XBPB 4UT9A 1PL3A 1HHHA 4GKNB 3V6ZA 1U1SA 3MRIB 5DQDH 2VLRE 3U0TB 3WL9B 1JYNA 4Y5XA 1E65A 1NPUA 1DVZA 1QPPA 4L5FH 3UIYA 4YUEH 1NMCB 1OT1A 2BRRH 4RTVA 4KFZC 4JRYD 4Q9RH 2Z93A 4UMGA 5IG7B 3S6WA 4K9EL 5DD3H 5D5MA 2R2HA 2C06A 1H0DA 1TTGA 3QYGB 4YHZL 1KEML 1Y18A 2DQTL 4QHNA 5EN3A 5BO0D 3BUQA 4BHUA 2IPUG 3DO4A 1IM3D 2J06A 3TYFA 2NDGA 3RWDA 2IDUA 4G6KL 3HR5B 4G42B 3T4AB 5KH6A 5HY9B 1GYAA 4L3CA 1G1KA 2FX8L 4P59L 5JIQA 4DNLA 2OPCA 5IMKA 5CEZE 5HI3D 2DYPB 4GI9A 4HUKB 4NDMA 4OFYA 3U9WA 5IMMB 1GPOL 3BIKB 3RX8A 4YXKH 4E0RA 2OP4L 4HVVA 2GT9A 3BHBB 2VH5H 4WWNA 4K23H 1NAKL 1T5WA 3RGVC 1KFZA 4H20L 5AW1B 3SWNC 3QNXB 4XMKL 4FEMA 1NCTA 2VQ4A 2BZCA 3MJ9A 4D9QE 2BP5M 3QIWD 2X10A 5FM5M 2EQUA 2BIVA 1MCSA 4L5GA 3QNYB 5FWRA 3WI9A 1KK7A 4M75F 3D25B 4QRTB 4NQVA 2HG0A 5DJ2B 1BM3H 3DX8B 2Y7SA 2EIDA 4PGBB 5IF0B 2EGAA 4WHYG 6PAZA 1F86A 2NY5H 5E5MB 4XHQA 4LXCA 3WMQA 2VMEA 3QUZD 4P9ML 2EVGA 3ARTA 3EJQA 4ZMAT 1HXMB 5CXPA 2DIJA 1FVCA 4F2MB 4MHHG 3FDRA 3CFKA 3GRWA 4KV5F 3M54A 1BX2B 5DZVA 2RHIA 3NEEA 1AR1B 4RNRB 2J1YA 2RHXA 1X7SA 2BIIA 3B2PA 1S9WA 2QPFA 3OAUL 4X6EA 3TU4K 5J11B 3NFPA 4MVBC 3ECBA 4HUVA 4PI0A 3QEGL 1W6LA 1L9QA 5AZEH 1B4RA 3WGVB 5AW4B 1A7BA 1PKSA 3IN0A 1IM9D 4WWKC 1F11B 1I8UA 1OAKL 1CICD 2UY6B 4PJ7A 4UILH 4H1LH 5CN3A 3AS0A 1NGQH 4J12A 2QELA 4HOWA 1E7OA 2FK9A 5GMKm 2DTHA 2RIKA 4P5NA 2CDEB 1MDAA 1RZKH 2F0CA 1JPEA 4J9EA 2JKWA 4JUSA 5I1CL 1MFVA 5T3ZH 2KPNA 4QRUB 4N2IA 4N2HA 5T33H 1OPGL 1JF1B 2EH8L 5FYKE 1XGUA 4GKSB 1HINL 4NI3A 3ERXA 2P8LB 1L9SA 4GMTL 3MRFA 4ZAKC 4N2EA 3KLAB 4OT1H 5FDYA 4KDWA 4JHAH 3RZWA 4FSSA 1WD8A 3PP3K 1YEJL 3CSYA 1JUFB 3OZ9L 1E6OL 1RMFL 1BBJA 3PQYE 2G0LA 4HUXB 4OCXL 4NKOA 3D18B 5CFAA 3MUGA 4WDIB 2YPVL 4YWGH 5HDQH 3ZZLA 3OYKA 2KYMA 1CB4A 1OGAD 3QEQD 4Y19B 4B7LA 1X2KA 4PJAF 4XNMA 2OTLQ 2AEQL 4JL2A 1AO7B 1C12A 1QLRB 1WD9A 1N26A 3WDHA 3FBQA 5IHZB 4G9FB 3I35A 3PDDA 4M7JL 1I31A 1AQDA 4DKEH 3VXSB 1JD9A 1FYTA 4JQIH 2CKBL 3DX7B 1UJ3A 5T1DL 4HT1H 4D8DA 2BZYA 1QPXA 3BSZA 4BZ2L 1M2VA 4KJYA 4FZ8H 4CC0A 4JAMA 3KPSD 5J9PB 3NABH 5AAMA 3JAME 3MO1B 3VTMA 2CLZA 2VXSL 2AHIA 2A9BA 1S7RA 2ED1A 2GTZA 3X11A 1MCPH 3QEHA 5I74C 4ZUUA 4C4BA 5KZCD 1GKEA 3VA2C 5J6GA 2HWZH 1HH6A 2OYKA 3IMVA 4AQ1A 3ZTCC 4E2OA 3RJOA 4YVNA 5I5MA 1JGEA 5FFOA 4ZXBD 1NGYA 2XRAL 4P05A 5J6HB 4PL6A 4L3AA 3ESNA 5DO2C 2PETA 2W07A 4P2OD 4PGEB 3UDCA 2Q1EA 3H4HA 3PXJA 5FIEA 3CCLT 3JT0A 5KUMA 3KCPA 3OC8A 3IFOA 2V3DA 4NQQA 3M55A 4WIQA 5BCAA 5J6SA 3MJ6A 3CDGB 1YIJA 3ARBD 1JWUA 3GRBA 4FX5A 2COWA 3I9IA 2KRSA 2LVMA 1TJHH 1XTMA 4ZMQA 5KJ7E 1GTNA 4YHPA 4OGZA 4HIXL 3QJQB 3PVLA 3QDMA 3CCEQ 4K8RH 2ATKB 4PG9B 3QORA 4PRAA 1F90L 4JPWL 2VGMA 1BZ7B 2Y1YA 4L8BA 4KJWD 2CD0A 2FX7H 1GZQB 5LGYA 3CXCS 1FJ1B 5EO1A 4PWIA 4FIBA 5C6WH 3GSUB 5BPPA 3BPOC 1OCCB 4LL1A 4GO6B 1X75C 4J83A 4Y9BA 4L9LA 2VW4A 1LGVA 1GGBH 3DJTA 3GFUA 1OB1B 2ZPGB 3V0VB 2KMWA 2YWYA 1HHIB 3CD6T 5GGSB 4QOKA 2XJKA 3RWCA 2VERN 1CYXA 4OZFG 2PW2A 1KD1R 2P28B 1DQLH 1KQSA 3PUUA 5J89A 4IUTA 1BZ8A 3FO9A 4A2MA 3NTIA 5CO1A 4QRRA 5GRYA 3C60D 1XTDA 2DI7A 5I8KH 1OARH 4HKBB 4JO1L 2AI0L 1SF9A 3EBAA 3SB3A 2D7QA 3TSWA 2IALB 3NIGB 5JNYA 2YLCA 4TF4A 3G5XA 2FL7A 4YHKL 1DEDA 1FFQA 3AVEA 4U3HA 1KTJA 4PYGA 3U0WL 3EFRA 1FH5H 1CFVH 4HIJB 4O2CB 1MHPH 2XHCA 1CVSC 5TDPB 1JF6A 1PBYA 4N0FB 4Q9QH 3IMUA 4JANB 5DJAB 1ZA3B 4Q9RL 3HI6H 3P0GB 5A0LA 2Y5QA 1X4YA 4KTEH 2C1PA 4C56D 3GEWB 1IKNA 4TKWA 1VDGA 5I30H 4AMKL 4WWKB 4CADA 3DMMA 2QTXA 5DZAA 1OW0C 3M9QA 4PRIB 3R7QA 5J12C 5D2NA 3UBXG 3T6QC 4WK4B 1UGKA 4ZO9A 4LE9A 3M46A 3O2VH 1GBRA 3OB0H 1KEGL 1YJ9T 4D3CH 4YSPA 2DL3A 1UFUA 4H88L 2YBRA 1M1XA 1D9KC 5HJ3A 4ZAKB 4LRIA 4Y0GA 1GR7A 2GUOA 2KZWA 2NR6C 1GAFL 4XTVA 3B9AA 4I4WA 4DP0X 1DQTA 3RDTD 5J3HC 2B4CC 4M6ML 3AY2A 2OTLT 3Q06A 1Q90A 3K2UL 4KJQD 4B9JA 2P42B 3KPLA 1BM3L 1KGJA 2HJKB 2FRYA 5FLXE 1INEH 3PWPD 3QPXL 4FQHB 4AW7A 4EN3D 1CLOL 1HL5A 1LO5A 1I7RA 3GXNA 1RAGB 2TRYA 5LBGA 1J9QA 2DQFB 3MRCA 1ACXA 2R8SL 3I2CH 2YGPA 1NCBH 3VDCA 4N0AA 4HZ1A 4ODTL 4XP9H 3TH3T 3QJZA 3VFOB 4D7PA 1F6AA 4KAQL 3GIZH 2EDTA 1JWMB 1GRIA 1A4KA 2Z65C 4KKCD 4UQ3A 3TNNB 4OZHA 3IDIB 1CE1H 1JNHB 1AXTH 3J8F7 5AZEL 3ULUH 5JMRA 4F7PA 4L9DA 3RFZC 4PKCC 2F5AL 3GMLB 3QCUH 4GMSH 4Z95H 4YEFA 3VFRA 4MJ4A 3PHQA 4PJ5D 5IBLC 3E9GA 2E8ZA 4DP7X 1WHOA 3HE6A 2Q3ZA 1A0QL 2EQDA 3TFKD 4GRLC 3M59A 1X6OA 4HU2A 4EMGA 5GSVB 3OKYA 4K94L 5I74B 4TUUA 1WHKA 1A9EA 5EU6D 3WE6A 1HX0A 3VRZA 2V8MA 4F9PA 4GG6A 3WUWB 3LGFA 1ZT4A 4MJIE 4KX8A 4PD4J 4LSSL 4RGNE 5C0AB 1SM3L 3W0WE 2WP3O 3I56A 3V52L 4HD5A 3L7EA 2P5WD 4G1EA 4JHAL 1E42A 2VXTL 2EE0A 1M90C 2XX0A 2WSDA 4Z0XB 5E8EA 2BNQA 4OGEA 3QI9A 3BT2L 1V5JA 1TTAA 3NQIA 4C8XA 2F1EA 4JDZB 4UIMB 1BI2A 4LD9K 1LO2H 4AIZB 1AG6A 1BGXL 3CCET 1OP9A 2EXWC 4Y5YA 5HDQL 2EEXA 1VQMQ 5I5JA 1RVFH 4ENED 3W9DB 3JUZA 2ZXQA 5I18L 5IW1A 2A5UA 2SODB 2VAJA 2H3EB 1KSWA 2P0PA 4JRXA 2YGVA 2FYVA 3R8QA 3MLSH 1NM9A 5GGTL 5IWLA 4FQCH 3UTQB 4HCCA 4FNSA 4LLWA 2AXFB 4U1GC 4ZW5A 4KUZL 1DEEB 4YXLH 4XU1A 2JKXA 3O4LA 4FG0A 4J3UA 5K93A 3I3BA 2ICEC 3L81A 5DGRA 5LKNA 3QJTB 5BOPA 1ESOA 3BAIA 1AFVH 3Q5TA 1HDMA 3MR9B 1J0ZA 3ULVE 3HG1D 1N5YH 5C0ND 4IIOA 1O9VA 3UACA 4DH2A 4XPFL 4JRPA 5FOJA 2HVKB 2ZOKA 1NJIC 2H32H 5D93C 1NJ9B 1PGRB 4FQLH 4UQ2B 2MOVA 4MQ7A 1YCYA 4K55A 1UM5L 1U8IB 4MMXA 3EKCA 4IURA 2NX5E 2VLME 3MRHA 5B1JA 2H32B 1ROWA 1J9RA 1PSKH 4MNGA 1ZIBA 2DLFL 1A1NA 4Z9KB 1YA5A 2MCPH 4DKDC 5G2NA 3R8BB 2VUYA 1BZEA 3WKQA 1RAIB 3SJVB 5AVWB 1T4KA 5KVEL 3RPIB 3L5XH 1RKRA 1PQZB 1TJHL 3G71Q 1XZWA 2Z35B 4WEBL 3VTTA 2Y0SA 3DV4A 4GLRH 2FEEI 2L0DA 2QA4A 3RNQB 3SEMA 3U36B 2BUDA 3RB5A 3ZDWA 1SVCP 2TSBA 4GKZA 4E42A 1QO3A 3OMZA 5I21A 4IS6A 2QQAA 1C7SA 1I3RA 1TZAA 2IBGA 2O1AA 4PCSA 1FFNA 2DZCA 5A2FA 5J12B 3L3HB 5EOQH 5DHYB 1TVDA 1JQQA 3ARZA 3LZOA 1KBWA 3MXWL 3HC3L 4F7UA 1SVBA 4IKIA 3UP1A 1GGBL 3IMBA 2O61A 1OULA 5ANHA 4CRIA 4UUJB 4PRHA 1CGUA 4CSPA 1D0YA 4M00A 4CAGA 3R6OA 2WBJA 1NYFA 2QYZA 4ONGL 5EO0A 4NS5A 1D9KB 1ZSDB 2EIZA 2B4CH 3RGBA 1ZE3C 2NY4C 2XN9B 3G6AB 2GFAA 1T7XA 1WAEA 3DYMA 2V2TB 2CP5A 1A02N 3A0OA 2EFIA 4DGYL 1RERA 1OARL 2BSBA 2DE0X 4TNWF 4OIIH 4N0UE 4Q0XH 2LJ3A 5IMOB 4MBRA 1UB6A 2GG1A 5I17B 4KO5A 4XX1E 1VFAB 2EACA 3CN1A 4X9DA 3CCVT 4PK4A 3IJ7A 3QCVH 4Z0BL 5K9KA 2WQXA 2WNGA 3D0AA 2VRAA 3RHWF 3RVXD 1FH5L 2VKWA 4Q97A 1CF1A 4OCYH 4HJIA 1RAMA 1MHPL 3K80A 4U6YB 5HHXL 3P4MA 1CTMA 4Q9QL 1KCUH 3QS2A 3MZTA 1UXWA 2VTFA 3HI6L 1JI2A 4OFYD 3T0EE 3LV3B 1AD0B 1JCKA 3VI4B 3EFSA 1KIPA 4E9YA 1H3PH 3RFZB 1KC8R 2CT3A 5GZNA 5E9DA 1KQSP 2KLSA 5D7UA 2W5PA 4PJ6A 4XPAH 3BKJL 1Q9LB 3UG4A 1FFOA 4DEXA 5CGTA 4QWWC 1Z3GL 1GZHA 4FXGA 1KY7A 1YUHA 5F70A 4GRLB 5D7LD 1H5BB 2V7HB 5F0MB 5SWQA 3U0PA 4NUJA 3EG1A 3BAKA 4M5YH 2MQGA 3KEHA 3BZEB 4OVAA 4JFFB 4LCUA 5ITFB 2ZE0A 1QWHA 2R0LL 1CGVA 3LS5H 4LP4A 3VB9A 5BS0B 1I8IB 4ZO8A 2VSMB 4XPGL 3FTWA 4KZCA 2BMKA 4AVJA 3QJHA 1UT9A 1OQKA 4MAYC 1SJHB 4NZRH 5F71A 4HCKA 2FPEA 1DBBH 3MMEA 4N3UA 4M8UA 2EDWA 1MJ7L 3ARRA 3VXUE 5FB8B 4IEFA 1VQMT 1KENH 5EG2A 3MRRA 4X7TA 4Q6KA 3RYMA 1YEDB 1NUFA 4PJLA 1XGRA 3QUYB 4RCAA 2QQBA 4AKQA 1INEL 2VJ0A 1I1RA 4RETB 3QCTH 5JXED 1IEBA 5I8EA 1M7IB 5SX5H 1OSPL 3K2KA 3QFDB 5A2LH 2IWKA 2HJLA 3G4SQ 2VNCA 1YWPA 2RN8A 3P11L 4NN7C 5FK9B 3UROR 2ITEA 3TJHD 1W6XA 1SY6A 1C1EH 3OBWA 1XVSA 2GJPA 2MEJB 4WLCA 4U1GB 1DSYA 1W6WA 2CMRH 1MHHA 2B2XL 5J1TC 2FHDA 1NIEA 3DX0A 3UDWC 3O8XA 3VW3H 2ICEB 3T0WA 2FO4A 4ZNXA 2BWIA 2BP8A 2DQCL 2DBLL 4K3JH 4MNQD 2DEWX 3TCXA 2QSCH 2R56L 5BZWB 5DRZB 4A2EA 1UUEA 3NTCH 4Z95L 4JG0L 4XMTA 4M5ZL 4K3GA 5AW3B 1E67A 1HL4A 1WV7T 2MH4A 4DGIH 4AGLA 4OI8A 3LIZA 1TEYA 1S9YA 4QJ4B 2CBMA 4ICWA 3D51A 4QJ5B 3H9HB 2RH0A 2IDCA 1DANU 1MJ8H 4LDLB 4OUOA 2XWJA 4O2FB 5HY6A 2WQRA 4LKXA 1UXMA 1BIBA 1L0XA 2H1LM 5D93B 5EC1A 4ZW8A 2RQEA 1L5GA 2F74B 3QVAA 1FNSL 1AP2A 2JKJA 1CD1A 4PGDB 2H2PD 4L8SC 3DECA 5LL6S 1MLCA 3VM7A 4OLEA 1QA9A 4LE8A 1WI7A 5E6IA 2LW3A 3LB6C 2VDRB 1RHFA 5IJKA 2GJ6B 4FYRA 2YPKA 1PLGH 2JKLA 3G71T 3WEBA 4RFEA 1LO2L 1UEYA 1A6WL 4MJJA 4AG4L 1FYTD 1P4IH 2EDXA 3L95B 1A1OB 1MRCH 2RH2A 2X7LB 4ZUWA 1RVFL 1D0XA 4X7CC 2BZ8A 2QT6A 5EDXA 3ZOAA 3NCEB 2X0UA 3SGEI 4FNTA 4OD1L 2NY6C 2YAHA 3M1OA 4FC3E 3U25A 4ZFZA 3QWYA 3T0VA 1U3ZA 1ACYL 4XCNA 5ICZB 2BE9B 2OJZH 3APNA 3VI3B 2ZAEA 2ORBL 2X2IA 3ULVF 4EN2A 4CMMA 2QTVA 1DBKH 1BB9A 5ACZB 3FUDA 2LRQA 2BNRD 2YO3A 2OTWB 1DDHA 2NXZC 4RQQA 3N91A 4UYPA 1WPCA 3G08B 4LLVA 1ZE3H 2RNAA 2HLAA 2A28A 3MBXH 1UT1A 4QRSB 4HIEB 4Y4KC 1IC7H 4MCYA 4OGXH 5GJSH 4F33B 3FONB 3M17B 2NY4B 5K69A 1E27B 1MCEA 4D9LL 1W8NA 2D8HA 2O5XL 5ABZA 2XDDA 4N9GB 3UTTE 3QA3B 2EILB 4PR5B 4BKLB 3VS0A 1U6AL 3M53A 5CJOL 4TQIA 5DEGA 3TU6A 1T6WA 2CIIB 3QDMD 1EJFA 1PSKL 3HZKB 4QTIL 1U21A 3KL5A 4KZDH 3ECQA 3HZMA 3S36L 1R9FA 2MCPL 3IJEA 4ZN1A 2KC0A 3HE7D 3MV8B 1WS7A 2F54D 4DFIA 5AZ2L 1G4MA 4MD0B 3FO2A 1RFDH 4AGPA 1RUAH 5CP7B 4Z7VA 5C0IA 2COVD 3O3EA 1JSYA 1YN7B 1ZT7B 3L5XL 3OXSB 5T1LD 5ABDE 1R0BG 2PR9A 3DGGB 3D0LA 4KMLB 2B5IB 4P23A 3EAKA 1S8DB 1P4LA 4ZW6A 3TBTA 1E8XA 3GYRA 3FFCE 5LGJB 3D09A 3V6FB 3OM3B 2CO7B 2VLKB 3G04A 5AKTA 2ZAGA 4J5YA 3WJJA 4BHUI 4OFDA 4M43L 1SPKA 1WQ7A 2DA9A 3CCSA 1UWXH 3IF1B 3P4LA 5GJWB 1PY4A 4HIQA 2V37A 1SYVB 4CC4C 1IIKA 4QRRD 4JRKA 3ZX1A 3CXDH 2GGRA 1BQHG 1CK0H 4OGAC 1HTYA 1P84K 2VM4A 1ZRUA 2JM8A 4PJIB 4UOW1 2G30A 3LKRB 1A7OL 2W60A 4B9GA 1MW0A 1ZHBB 3OYFA 1BCOA 2A6IA 1KYOJ 3SBQA 4LDVA 1DVQA 3BZ4B 4BUQA 2E5KA 4OLYL 1G7IB 4P5MA 5DZJA 2WK2A 4MAYB 3T65B 3IQLA 4Q14A 2PYEA 4IYKA 4HVBA 2H6PA 1E90A 3FSZA 1QLYA 2YD0A 2LQWA 3LRHA 1NIFA 3KG5A 4KKAC 3O2DA 4P49A 3REVA 5GAN4 1TOVA 3FL7A 3WGUB 3L9RB 2RQWA 3ELQA 4PTUB 3RTQD 1WTLA 3CMEA 2IAMC 3MPUB 4Y4FA 1DJZA 1OCOB 1TETH 1BXAA 3QCVL 4I77H 5HJGA 2ZUWA 3LHAA 2EDMA 2Z9TA 5DMYA 5INDA 4YHOL 4NN7B 5KYNA 3VG0L 2ROXA 4OCYL 4FQPA 4AZ8B 2ED0A 3IVKA 3DXAB 4DQAA 2Y6SC 5F3BB 2JJWA 3TV3L 4MKTA 1F2XK 3IJYB 4XO5A 5TE7H 1U8HA 4BE6A 1BQLH 4M77F