1Y07A

Crystal structure of the superoxide reductase from treponema pallidum
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
126
structure length
121
Chain Sequence
RELSFFLQFFLGMDAPAGSSVACGSEVLRAVPVGTVDAAKEKHIPVVEVHGHEVKVKVGSVAHPMTPEHYIAWVCLKTRKGIQLKELPVDGAPEVTFALTADDQVLEAYEFCNLHGVWSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords desulfoferrodoxin (rbo)
publication title The first crystal structure of class III superoxide reductase from Treponema pallidum.
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum str. nichols
total genus 22
structure length 121
sequence length 126
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.510 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y07A01
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1y07A02
2JI2A 4BRVA 3QZBA 4C4BA 2JI3A 1DFXA 1DQIA 4D7PA 4BGLA 1DQKA 4BRJA 1VZIA 2JI1A 4C4UA 1Y07A 1DO6A 4BK8A 4BV1A 1VZHA 4BFFA 4BFKA 2HVBA 4BFJA 1VZGA 2AMUA
chains in the Genus database with same CATH superfamily
1TETL 2PYFB 3P4OA 2A77L 2C1OB 3B4NA 4TNFA 3RTQC 3BOVA 1DN0A 3LXBA 4KBPA 4NP4L 1L7TH 3QQNA 3BMVA 2XVGA 4WF7A 3VB8A 2FWOA 5GGTL 3R0MA 1HL9A 3D87B 4WI7A 1SSHA 1UA7A 2V3EA 5H37G 4I48B 4QRTA 2MKLC 3T2PA 5K9KB 1UFFA 4K7PL 4WW2C 3KYNB 2OZ4L 3RVTC 5DZPA 1SVCP 1NAML 1GTNA 3BPNB 3UYRL 5GGRB 5FGRA 1T1YA 3N04A 3EBHA 4I2XA 1EUUA 3U30C 4P9HH 4G1EB 3JUYA 2XQBH 1BB9A 5D1ZD 1OCZB 4DUVA 4XK8E 3ZX1A 1HILB 5IB2B 5BRZE 3ATAA 3F8UB 3BIKA 1DQQA 1UM4L 3QO1B 1LM8V 3RAJL 1S3RA 1D6EB 1FYNA 2DQIL 2V4LA 2YD8A 4IJ3B 3OLGA 3DUUA 3QCTH 2N7SA 3MRJB 4D0CA 3AT8A 3JB9F 1EFXD 2OX5A 4NQEE 1J3TA 3WFDH 4LPTA 4EZMA 5TGBA 2ARJB 1AR2A 4FXGA 4P5RA 4RMBA 4X7SH 4G5ZL 5J12C 2IBZX 2HT3C 2H2SC 3LMJH 1FZOA 4ZXBB 1ZD6A 3CCRT 1FX7A 5C0IB 3TN0C 4XMVA 2IANA 4U1JA 1TEFA 4NZUL 1S1NA 4G2AA 2DWEA 1JPTH 1Q81C 1UJ3A 2CBOA 4JR9H 4J6YA 3EO1A 3S3DB 3WOVA 4XP5L 1NH6A 1YJWT 1DJWA 4HCIA 3HMWL 4B5ZA 1MIEH 3DO7A 4IIQB 4HWEH 2V9QA 1O7DC 4BD3A 1E5UI 1SRMA 3UCQA 3TBYA 2WUCH 1GYVA 2XWBA 2HA1A 4ZNEA 1GFCA 4UUJA 4WUUE 2B9AA 3O4LE 4M43L 5AB0A 4H0HB 1AS8A 4G3YL 2OXGB 5GAN3 4WUUB 4N2AA 2F08A 3L1OL 6FABH 5JYLA 2YLHA 3FCGA 3L45A 5GGVL 3T6XA 1JXMA 3LHAA 4DGYH 1B90A 2AXGA 1A64A 4M8QA 2AJ3B 3B8SA 2XZQL 2QPFA 5AYUH 1V10A 4JZ3A 4NC1C 3GBDA 4L9LB 3EGUA 5EMYA 4EJ1C 5ID0B 3GYRA 3STLA 5I75C 5LQBL 4NXSA 4HUKB 4P2QA 5D7JD 5GAN7 4FYYB 2M02A 3FRUB 1R5VB 1KSWA 1IM9B 4JJOA 4PGZA 4F7PB 3G5VB 2GITA 4HIIA 4PJCE 2LFEA 3AT1B 3GI9L 5ITFB 1VQ6Q 5C3IA 5JIQA 3OTTA 3VFMA 1WZAA 1FNFA 4XN8A 4JFPA 1AY1L 5LXGH 4IRSD 2DJQA 3FQNB 4RZKA 7CGTA 3ULVL 3IDUA 3P4OB 3HMXH 2X7LA 2A4ZA 1DN0B 3MV01 1CK0H 1OCCB 2EC9T 3ZHNA 1ADQH 4NNPH 3BRDA 4C0DC 2FWOB 1GHFL 2IJ0C 2EDBA 3MEAA 2ESVD 5A3IC 3CC2A 1DJXA 2LCCA 4QW2A 3LS5H 4M6AA 4QRTB 5AYTA 3ZZQA 2G6FX 1BQLH 3TIEA 1SJVA 4HUMB 1T1YB 4I2XB 4MB3A 2K8MA 1F1GA 2QQRA 2E56A 4EQ3A 1TCRA 2YD9A 1EVTC 3B2PA 1DTUA 4B96A 5C0BD 1E42A 3H54A 1ZE3H 4M7AA 1KB9J 5D7SH 3BIKB 5H37H 1DQQB 5E1QA 2J7LA 2EDDA 5AZ2H 4Y2DA 1DQML 1ZTXE 5EIQA 1VQOT 3DUUB 1E5YA 4D0CB 4P0DA 2YUQA 4J9BA 4L59A 2UXVA 3O6FD 2OX5B 2F7RA 5TE4H 4G6AD 5FWRA 2AK1H 1TQUA 3NFSL 4PLJD 4FFYA 2RQTA 5KUKA 5TGBB 5LGYA 1MCOH 4FXGB 2ZX8A 1JP5A 2G0KA 1FZOB 4LOEA 1D3CA 2AQRA 3QJHA 4DERA 2CDTA 2IANB 4U1JB 1ZLSL 2ZX7A 2DWEB 1UJ3B 5T33H 4ZAKA 1L6PA 4NO0D 1REIA 2MPXC 4KX9A 4PN6A 3CVCA 1L3WA 3BC9A 4KRPD 1VPOL 3DO7B 1CTMA 2QDLA 1N4XH 1ULVA 2QLVB 3D25A 3EFRA 3O3EA 1TZGL 3TBYB 1QVGP 2IV8A 2XWBB 3O2DL 2ENYA 1N18A 5TDNA 4UUJB 3D9AL 4GBXC 3WFBH 1KYFA 5EZJA 4O00A 4YHYB 2QQKH 3CC7T 5DMGD 2VXEA 2FPFA 3JUZA 1SPKA 2MMPA 2H6OA 3UAJA 1JIBA 1IRAY 2WNXA 1T7ZA 2ITCB 2D6FA 1T3FA 4QOKA 3RWDA 4LPVA 5T3ZL 1NZRA 4JKPL 1ARKA 2AXGB 4PVBA 1OAUH 5DU7A 3A0OA 4M8QB 3SOBL 5KH6A 4BWTA 2EZ0C 4MXVE 4HKEA 1MSPA 4DW2L 1WFTA 4A7UA 3STLB 4R90H 2PVDB 3W56A 1JB0E 1TWBA 1EHKB 3CVHA 3MUHL 4P2QB 3HC2A 4X42A 1H8LA 5GGVY 1CD1A 3QJTB 1A5FL 3G3LA 3Q2CA 1HHKA 4FYSA 1RULH 3QPKA 5KSVA 2GITB 1P84K 3QEQD 4HIIB 3ECWA 4LCUA 4M5ZH 5CLYA 4MD4A 1IGJA 4OJYA 5AL0A 3SE4A 3QA3A 3VFMB 3BE3A 1CFSA 4GH7B 1WWBX 4JFPB 5HHXH 1D0YA 4LCCA 5DS2A 2VXVH 5SWSA 3OF6D 2CT3A 2D0QB 4JO2H 2J4WH 1I9IL 4UB0H 3A98A 2X7LB 1OI1A 3HBZA 4LDUA 4U6VH 4AW4A 3QDGD 3BZ5A 1Q82R 2WO3B 1D5BA 2OKMA 2FB4L 1J9SA 4JHWH 4M00A 4PJBA 4YE0A 5D6DC 3OKLA 3OKOA 1SJEA 1Z5YD 3G1JA 2MPAL 4MGXA 3CE1A 1AE6L 1KTDB 2DAVA 1WQWA 2Z4TA 3D85A 4HWUA 1T1XA 3TIEB 5M94B 1TCRB 4M3JA 4ZX5A 2EUWA 5F9DC 1SMOA 4JZOA 4JFUA 4XU3A 5GAMj 5DCCA 4GKOA 5CSBA 1MH5A 1HT6A 4M48H 4J3VA 4FJYA 5AENA 4LXFA 1ZT1A 3F62A 3V6OC 1ZSZA 3ZU8A 4OJDH 4DPBX 5L4MA 2VDOB 1UZ6F 4YSAA 4Y2DB 2Z7WA 4XX5A 1NOLA 3RHWK 4KTDH 4E41E 5C09A 2EICA 2DO3A 4C92C 5I1CH 1SZNA 3TNNA 4PYGA 4ANVA 4AV5A 5FFGA 2H0PA 1MIML 1A4KA 3FNKA 3WD5H 2A74A 4XNYL 4FG2A 1A6WH 3QJHB 4DTGL 1JGLH 5CCAA 2QAZA 1F6AB 4UMSA 3VD0A 3CXCA 1CGWA 1KMGA 1JZIA 4OLUL 1YAZA 5I1HL 1RXLA 4ZAKB 5BVPH 1E6OH 5E2UL 1OANA 4JFYB 4AG2C 4PJ5D 3D39D 2A6KA 3S3CB 4P04A 3D25B 4N1EA 3L4WA 3O3EB 1YPZA 4DP7X 3SDDC 4RTXA 1BBJA 1KJ3H 1QFHA 3IJ7A 5TDNB 3U2JA 4RAUA 4NN6B 1W2BP 1Z2KA 2WY3B 2PO6D 3L3IA 5EZJB 4MJIE 1HWHB 4LKCA 1TEYA 1RHFA 1ZHLA 2QLYA 3CCHA 3US9A 5C07E 3ZMRA 1R0CB 5JO5A 3PMIA 2OSWA 3URGA 1QLEL 4RTZA 1T3FB 3C08L 1O6TA 4QOKB 4TSBL 4JO3L 3LDBC 3RWDB 1JL8A 4JKMA 5J9PA 1LNUA 4QTFA 2CJUH 2WXFA 2YMOA 1YSOA 4Z7UE 3DGDA 3TBBA 1INDL 5F7DA 4MNGE 5KANG 1GAFL 1NC4A 2DQUL 3WMSA 2GI7A 3EG1A 1DBML 2WLHA 1S7SA 3AW5A 3QHSA 1RUMH 4EUPH 1RUAL 3CVHB 1BJ1J 1YEFH 3KPRE 4JUTA 4YSCA 4OLVL 4HKJA 1XSIA 4H25A 1CD1B 1O7VA 3OPUA 4ZPTA 3X3FH 3F6JA 4E9QA 1HHKB 3L2MA 4XNXL 2DL5A 5KSAC 3P40A 2IBBA 4IEFA 5JHDA 1QNIA 5KSVB 4RFOH 3SY6A 2O4XA 4LCUB 4ZGDB 5KBDA 4MD4B 1IGJB 5SWSE 3RDTD 3AMLA 2PABA 3QA3B 1WAPA 3V0VA 1CFSB 1MCQA 3PP4H 4LCCB 1C5BL 2OCFD 3KFVA 3CN1A 5SWSB 4QRAA 3EH4B 3TA3C 3MNDA 2K9FB 3RIRA 4X4ZA 5I1IL 4YSPA 1EJFA 5KVDL 2DWSA 2BNRD 1D5BB 4PJBE 4BFJA 5FYKU 3O6LL 5C71A 1U6AL 2V5SA 4ZX4A 1W0WB 4PJBB 3H3KA 4JRYE 3OKOB 1EMTL 2J8UE 5IW6A 1YEIL 4DBQA 2J6EH 4U4IA 1OSPL 3D85B 1C9SA 1DANT 3IMUA 1T1XB 1C5CL 1WV7T 2P44B 1FDLL 3WTTA 3KLDA 5I9QC 1S78C 1MJUH 1SN0A 3MXVL 3GSNA 3DMMD 4G59C 5CINH 4JZOB 2DI7A 3V4VH 4DN4L 1A14H 4BV1A 1MH5B 1UWEH 5E0QA 4BDZA 2WXQA 3ARBB 1L9PA 5PAZA 3JYCA 2ZCHH 1ZT1B 1BG9A 1ZSZB 2EXSA 2R0LL 3PHAA 3LGFA 2FVNA 4A7QA 4O2EA 4Z3GA 5I23A 1W2BA 2LTOA 3VQ2C 5C09B 2E7MA 1NEZA 4PIBA 4U0RB 3GSWA 3GLXA 2YAMA 1URZA 2XPGA 3D05A 3TNNB 3FU7A 4J9DA 4L05A 3CFBA 3TS8A 1XR8A 4DVRL 4XPFL 4ZN1A 1A4KB 3PJLA 2FSDA 3WY1A 2A74B 3F85A 2VVKA 2C7UA 4JPKL 2ZKYA 4YZFE 2FQDA 3RHWF 1ZSDA 2R15A 3NESA 5JR1H 2FATH 2BZCA 1YI2T 4K9JA 5LJYH 4FHJA 3WS6A 5D5MA 2LCLA 3MP8A 3DURA 5ITBH 2Q76A 2BY2A 1UGSB 2A6KB 1SG5A 1IILE 3J27A 3N91A 2V9TA 2JJ9A 2KXCA 1YPZB 4B9FA 4Y19D 5DMYA 1X6BA 1EHXA 1BBJB 3ZYJA 4RAUB 1XTDA 3GM0A 5LNDA 3L3IB 3KGRA 4MFHA 5JQ6L 1RUQL 1QA9A 4PJJA 1JJ2S 3ULUD 4LKCB 3CCHB 1ZHLB 2LU3A 1SOQA 1TTBA 4OCWL 1SKUB 1MFAH 4PBWD 4Q9QL 2DQTL 4YPGA 1PZ2A 1LNUB 3LQZA 1G43A 1TU2A 5AB2A 5E7BA 1Y96A 1E5ZA 1MVUA 2F54D 3SWNA 4N2FA 2GI0A 5F7DB 3QORC 3WIAA 5CJ5A 1NC4B 2ALAA 4M7LT 1CDHA 5GISH 4EMKA 3P0VL 3VB9A 1ZK9A 1S7SB 1BMGA 1UXLA 3N9GH 4AV4A 4P3CH 4HKJB 5GRYA 1VUBA 4H25B 2FG0A 1U8LA 3UTZA 2IOIA 2CIIB 1D2PA 4ZPTB 3RNQA 4AENA 1YITT 3BP4A 4IEFB 5JHDB 3LJ3A 1PHTA 2GTZA 5I6OA 4M75D 2O4XB 3A24A 2BY0A 3CHSA 4S1RL 2NW3A 5EZLA 3MNZA 4DEPB 3PNWA 5MENA 2Y3AA 2UZIL 4UM9A 3E9UA 3V0VB 1G7MA 5LNGA 5GS1A 1MFNA 2W59A 3C6EA 5LBSA 3CD6A 4I13B 3QYGB 4S1QL 4XI5D 1YJ9A 3WIHL 3BFWA 3QZWG 1IV8A 1DLHA 3KLHC 1NANI 1EK3A 2QGDA 3JVFC 1S7VB 2R58A 3MLUL 1K5NA 3B2VL 2MPVA 1YUHA 1OE2A 1XCTA 3SJVA 4WTZG 2VL5A 4PUBH 4RLDA 3T0EE 4X9HA 3TP4A 5IW6B 4BZ1A 1VZIA 2R29H 3V7AE 1RIVH 2F1AA 1LWRA 2MCPH 3DOIA 4HK3N 4HV8A 2WO4A 3N2JA 3CCSA 2UZPA 5C7XL 2IH3A 4J6IA 3SB2A 3FL7A 1KPUA 3DX3A 3GSNB 4FQQA 1UE9A 2O6PA 1ZWIA 4AKQA 1B0WA 1DQLL 4BZ2L 3WFEL 1KEML 2FEDC 4KKRA 5AAPA 2GBTA 4TNVK 2P45B 3H9HA 1ACXA 2Y6SC 1T0OA 2HQEA 2KDYA 3OR7A 4TVUA 4J9CA 3MV8A 3LZRA 2GFAA 2OSYA 3EUDA 3MX0A 3CFMA 3RJOA 1B2YA 1SQMA 4KKLD 5AG8A 1YBYA 5IHZA 1NEZB 1PC0A 3GSWB 1NMBL 4Z7VA 1BECA 2XPGB 4DFHA 1G9NL 3MUY1 2NUPA 2EIJB 3EDDA 4AMWA 3FU7B 1T21A 2Y36H 5DT1L 2JKTM 3QHFL 3S6WA 3CFBB 3IN0A 1XR8B 4XE0A 3S98A 3IFNH 4L37A 5DGRA 1F18A 3FZUC 4MS8C 2C7UB 2DQ6A 4LPCA 2KL6A 4GG6F 2PXYA 4KXCA 3OYYA 3JCMX 1MQKH 1ET8A 5D5ME 1M7UA 2EADA 1ZSDB 3WNJA 3LX7A 3ULVF 3BFOA 4W9LC 5A2LH 3PXJA 5CBAA 4JGNA 1A8ZA 5D5MB 3DURB 4TVPD 3NZHL 2Q76B 1OLZA 2ZAGA 4GSDH 5KVGH 1KPRA 1FA4A 4PK4A 2I24N 3RX7A 3BWSA 3MJ6A 1P4UA 1F97A 5F2FA 5LKNA 1KN4L 1G3SA 1QA9B 2XVBA 3THML 4WV1A 2A36A 4YE4H 4B7LA 4LU5H 2D03L 3NPSC 3W5MA 4NRYA 4YDJA 3K8MA 1VFUA 4KVCL 3O8VA 1TYJA 4R0LA 4PJ7E 3K80A 1NKRA 4YPGB 2YGQA 1YC7A 3LQZB 4PP2A 1TU2B 2V8LA 3RBGA 1FP5A 1JSYA 1OEZW 3KCPA 1Y96B 1MVUB 1GY1A 3SWNB 1KN2H 3MODL 3DB3A 1RIUH 1YYCA 1FAIL 2H6PA 4EMKB 3STBA 2Z8WC 4HOMA 1RZJL 5C2UB 1TTFA 3QG7L 4NNXA 1OOWA 3FO0H 1MJ7H 3UFIA 1AFVH 3NAAH 1U8LB 3UTZB 4DP9X 3IE4A 3RNQB 4AENB 3N0PB 4RSYA 2X2IA 3BP4B 3MDJA 2GTZB 2NW3B 3VFTA 1AMXA 5EZLB 4BFIA 2JM9A 3MNZB 5EO1A 2GJ6D 3PNWB 5MENB 1WSST 3E1ZA 4UM9B 1G7MB 2QHRH 2LJ0A 1PKTA 3OV6A 3CHXA 3P0YL 3OLIA 2F1BA 4LDXA 3WMPA 1N0XH 3QRLA 2YK1H 4YHML 1MCPH 1OAXL 1DLHB 2RPNA 5J57B 1N2RB 5FGBA 1MY5A 3SJVE 2IF7A 1K5NB 4ADIA 1KB5A 1YUHB 1HINL 1XCTB 3SJVB 2VL5B 4LRNL 4NT6A 2XIBA 2W88A 2HKFH 4XOAA 4KKZA 2EO1A 5IWLA 1B0GA 3E1SA 2Z31A 4HV8B 1IHWA 2XQ0A 3UGUA 4KGXB 2IH3B 3K2KA 4KY1H 5F1IA 1HXYA 4AFZC 1KPUB 4FQQB 2WQSA 2H3NA 1L0PA 1ZWIB 5FLXE 1VA9A 3N5BB 1UCBH 3KDPB 5F97E 3MV8E 4QWWC 2VLJE 3H9HB 3V55A 4YSSA 1Q7YR 1A6TA 2V5RA 3OR7B 3FSZA 3QJUB 3QK0A 2DLFL 3MV8B 2YEZA 3GEWB 1UA6H 1EEYA 3FDRA 3MX0B 4F8NA 1RUWA 2X88A 4P07A 4O2FA 3VRZA 2DNUA 3PHQA 5IHWA 4GQZA 3KPMA 2EVRA 3DHMA 4Z7VB 1NEBA 4A55A 5I22A 2BNUA 2NUPB 5CKFA 5CFHA 3VD1A 4TNVF 1T21B 1O9ZA 3MLYH 4XAKE 5FR3A 3FQWA 1BZQK 1MKFA 4L37B 1JXFA 2W0ZA 1OPGL 1V3LA 2OA9A 4PAZA 4KI5E 1BU1A 4XODA 5D1XA 3W38A 2DJZA 2N01B 2PXYB 4UI2A 2QQAA 3VFGH 4NL2A 3QCVL 4M6OL 4XVTL 2OR7A 3QQXA 3TEWA 2PCYA 1YEEH 2QT6A 5CBAB 2R1YA 1F4YL 5DD1L 2VLMD 2RH2A 5C0RL 1B2WL 4C5HA 1KPRB 4UDTA 2ED0A 4XVSH 5IHLB 1PY9A 1KCVH 4B27A 5ABAA 2N3JA 2QG9B 3QXAA 4WRLA 4PW3A 2YXYA 1P7QD 3VMPA 4ZMPA 3H9NA 5B1JC 1I85C 2WB7A 3RY5A 4D0DA 3T3ME 1IU1A 4WV1B 3VS1A 3BRFA 3N50A 4NRYB 4F9LC 1OGPA 4YHOH 2MK5A 1XQ4A 1UXSA 4G80A 3DI2B 2DL8A 4YDJB 5GZNA 2W07A 3AQDA 3T1FA 4F15B 4CC2A 4R0LB 4ZFGH 2NYZA 4PP2B 5F9AC 4OCMC 1E0OB 5L0QB 1DVFD 2J6WA 2B8AA 3KCPB 5GGRY 3VU1A 4A2FA 2F8IA 2X9ZA 4OP0A 2CCLA 5I24A 1JI1A 1QYGL 3TBVA 2BPBA 2H6PB 3ROLA 3OYKA 1BGXH 5EU4A 3VA6A 1ZTXL 4LSDA 5JPMC 4M77D 4Z7IA 4O58L 3CHPA 2ADJA 4NNXB 5F7WC 3CU7A 3VSUA 3QXDA 1DJGA 5E24E 4FQLH 1J9TA 1MXGA 3B5HA 4X34A 3VWKC 4I3RL 1BQHA 3VFTB 4QD2E 2NR6A 4BFIB 5EO1B 1UKTA 3NSFA 1CFNA 3RZCD 2DEWX 5F9WB 4BQ8A 5A0GA 1EJOH 1GKEA 4FI6A 4IBTA 4P49A 1TZHA 1IHVA 4OD1H 1FBIL 2WQXA 4XNUH 3Q13A 5H35A 4C56D 4RCCA 1LLAA 4ENEC 1XTMA 4XHJC 1G7QB 2LNHB 4K94L 4WCYL 2GUOA 9CGTA 1ZHKA 1BZ9A 1KB5B 2FH8A 4XPGL 5J3HC 3UZEC 1C8QA 1Q82C 5IN1A 4NT6B 4LCWA 3LSOA 1W6XA 2W9LA 1PLGL 2VYTA 2E27L 1JMZA 1B0GB 1X9LA 2ALWA 2Z31B 1GBQA 4GAJL 3S97C 2PR4H 4II1A 5EORH 5GAMf 5EOQH 1HXYB 2YRZA 4RTTA 2H3NB 4XMPH 3GMOA 1FO0H 2VXSL 2IDFA 2DS4A 1T6VN 1S4IA 2JWYA 3MXWH 4FFVD 2X6BA 3GHBH 4HEMA 5CGBA 4L3ED 4LSUH 4Z3HA 4NSKA 1A6TB 4K55A 2VDPB 1WQVT 2E8YA 4JPWH 4KQ4H 3W0WA 4Z7NF 4TQIA 2ZYRA 3BY7A 1AZVA 2YEZB 3X13A 1U3OA 1EEYB 3B2MA 1GS7A 4O2FB 4ZFFA 1O75A 3CD4A 3PHQB 4I9WE 1Z0MA 3KPMB 3L5IA 1CF8L 1GW6A 1L0XA 2BNUB 3ZYOA 2EGAA 2I07A 3FQWB 3MRKA 1EAOA 4U3CA 1LMIA 4XWOC 4HMEA 3WKML 1PNCA 5D55A 2B59A 5D1XB 4F7CA 4BE2A 1VIFA 3Q5TA 4XVJH 4AGMA 4Q89A 1VQMT 1P53A 3BDYL 1OP5K 1QUPA 4OT1H 4FC3E 2WPGA 3E19A 4Z7OF 3GO1L 1L0QA 4NZFA 4LAJH 4AQZA 1TMCB 1E8YA 2R1YB 4GT0A 4LUDA 1KV3A 4NC2B 1IIKA 1NIAA 2D9CA 1UDLA 1KJMA 4LNPA 4UDTB 5HHOD 5I0YA 3CCEA 2BVPA 2DJMA 3ARGC 4KQ3H 3KLKA 3QXAB 4B9CA 3BP6A 3M4GA 3I3DA 2YZ1A 1PLBA 3N3EA 4F20A 4D0DB 4P5TC 4XXWA 3CFJA 4RAVA 1H8SA 4XMTA 1DFXA 3LZOA 3NSDA 5IFHH 3T1FB 1UXSB 4G80B 4N2IA 1NJ9A 2XQYA 5K1NA 2QMKA 3QG1A 3G71Q 3LNEA 3Q1SL 4EPSA 2XWDA 4Y9GA 4LLAA 2AGJH 3U48A 5I5MA 2K9GA 1IC5H 3POHA 4OFYD 3TBVB 1MJ8H 3ROLB 2ZWSA 4WFEE 5CJOH 5EU4B 1SHGA 5AW3B 2VH5H 4ZMOA 3B7TA 2ADJB 1Z1WA 3QUZC 3QXDB 4K07A 1HCFX 3L2RA 2ATCB 4RZCA 4BINA 5C0MA 1M3CA 1FLRL 3LD8C 1BQHB 1OT2A 4R26L 2ECZA 1E6GA 1MJJA 1CFNB 1OARL 2JELL 3L2LA 1PX3A 3V7MA 2F6AA 1N6QL 4E9LA 3ULSA 2Y25A 2OTJA 1TZHB 1TQTA 4RDQG 3ULAB 1IMHC 2DQCH 4CRIA 4NHCL 2X42A 3BE1L 5H35B 1J1XH 3NJIA 4HCZA 1U36A 3MJ7A 5DYFA 3S2CA 3VH8A 5JDJA 3NBNA 1XBRA 4IIOA 3NCWA 2GUOB 3CXHJ 1ZHKB 1BZ9B 2C7FA 3J2PA 1FCCA 2HFGH 1H5BC 4J3OG 4LCWB 2KQMA 3WYRA 5IZ7A 1PZSA 3LSOB 4PPTA 1JPST 3SD4A 1G9MH 1HFUA 4XAWH 4ZO7A 2UWEF 1JTOA 4B60A 1DEEA 1KELH 4TULH 4WJG3 5I0DA 2C34A 2LZ6B 3KL3A 1NEGA 3EYUH 4RVBA 1SJXA 5G2NA 1TNMA 4ACTA 2OMNA 4TLUA 4PMEA 3GMOB 2IAMC 3APMA 2QGFB 2OMVA 3D06A 2BZDA 3EDKA 4AE0A 4XR8C 4MBOA 2ENQA 4TOYL 5J13B 1QSFE 5HDQL 2K70A 1KXVC 5E8DL 2GHZA 1VYVA 3NCJL 3TESA 3X13B 3B43A 2Z4QA 3EO0A 5C2BL 4ZFFB 2AEWA 1XF5A 1KZYA 2BIOA 4OLXL 5BRQA 3ZE1B 4TPRL 3SCMA 2BW5A 4NCC2 5GS3A 4CC1A 2A38A 4Z7AA 4XNDA 1VQNQ 2YUNA 4G8IA 2I07B 2X0VA 3ZBMA 3MRKB 3QIBC 3QWOA 1A9BA 2DY2A 2B59B 1CWVA 4F7CB 5BCAA 2DV6A 4NPYA 4BSJA 5HGHA 2XZAL 4OCYL 4X6DE 5FYJU 2OX7A 3V0AC 4UT6H 4Q4IA 3ZYIA 3ESPA 5DO2D 2B4CL 1VZHA 3OLDA 3FTGA 2ARJQ 2J71A 4RMUA 4UT9A 2AABL 1OF0A 2IFFL 2WWMD 1KJVA 5ETUA 5HYJE 2F5AL 4XN4A 4XRCA 4CMHB 1KJMB 2M51A 3UGXA 3WVEB 3W37A 5IJBC 4I88A 2BVPB 1L7TL 4AV0A 2C9UA 1AZUA 3SIKA 3BP6B 5JPNA 5GXBB 1TOXA 4A37A 1LJOA 2VC2H 2LT9A 4FZEH 3CFJB 1C6VX 4RAVB 2ICEC 1M53A 4PJOD 1QHOA 4BQ6A 2AJXH 3K1KC 1ED3A 3FT3A 4PFOA 1B0IA 3T9NA 1A6VH 1NJ9B 2P5ED 5LUMA 4OJCA 5E1GA 1S9YA 1H3WM 1I8MA 4P9HL 3LPOA 1JJ2P 5D9SA 2ZPEB 4PRHA 2R8SH 3HRTA 2X2JA 5CWSA 1NGWA 2BSDA 2EIDA 3JWOH 5F7EL 2KERA 2H8HA 1MRCL 4E2FB 3PL6C 2FZCB 1BOGA 3L5JA 5GZOA 1UUEA 1BD2E 4ZDHA 2D31A 5C0AE 3LNIA 4KXZI 2OQJA 3ZKMC 4Y5VA 5B4MD 3OC5A 3QCTL 4RZCB 2H47C 3APFA 1YYMH 4OLWH 1LEGA 1N6UA 3IPFA 4R7NA 4QHKI 1MJJB 1UWXH 4E9YA 2HMAA 2Y1ZA 3HG5A 4X7SL 4YDVA 1BVOA 5D70H 3RKXA 2I7SA 4N2NA 4EPCA 3L2VA 3ULSB 1L5GB 1MFUA 1ZGLA 2NXYC 3RNJA 3WHXA 1CR9H 2J5WA 1PGRB 6AT1B 1JPTL 5JHLH 3RVWD 3MJ7B 3HFOA 3VH8B 4JR9L 1I8IA 2GK2A 2YAOA 2E8ZA 3QRBA 1M1KR 3BSGA 4MYPA 2LJ3A 4O4YH 4F93B 1MIEL 3RKYA 4JO4H 3K1DA 4HWEL 5IFJA 5GAN5 3K74B 1NSNH 1IBGH 2R9HD 3CX2A 3KM1A 2WUCL 4XTRD 3CFEA 1DEEB 1XO8A 2N7BA 4YHLH 2WCPA 2F61A 4NQDD 4C8QC 5E2VH 3P2TA 1EDQA 2PU9B 1K4DA 3K71A 2K3BA 2CO1A 2XA8L 2OMVB 4L4TA 2DM3A 2VR4A 5JLZA 3B9KD 4P3WA 5CP3H 1IT9L 2N1KA 3BDLA 3CAFA 4J3OH 4DGYL 4N6QA 1ZDQA 2WZ0A 1R47A 2K0RA 3RKDD 5D2NA 3G6EA 2Z4QB 4HT8A 1M2VA 3EO0B 3F7KA 2ERJB 4GEIA 1ACZA 4PWGA 1XF5B 4NS5A 1XXFC 2WKLA 3SCMB 4KOCA 5KTEL 4KJQC 1UD5A 4B95C 1GZHC 4DF9A 5FHBL 4G8IB 3WXVH 3ZZLA 2YD7A 4XX1E 5DA4A 3PP3H 4XN7A 4AQAA 2D1XA 3QH3A 3QWOB 1A9BB 3GK8H 1YY9D 2VR8A 4R55A 2N59A 1PYWA 4NPYB 4D3CL 2Y4YA 5HGHB 2FGWL 3SQOH 4EQ2A 3FTGB 3W2DH 3S3SA 3BAJA 1KJVB 4W9KC 5ETUB 2WLMA 2G30A 1T83C 2H32H 1CS6A 4XRCB 4HISA 1UD4A 3HMXL 2WXMA 4L2LA 1YWOA 1JYVA 1C16A 3GNGA 1SLUA 3BYTA 4W9GC 1CK0L 1CGVA 5DJ0A 4J3XA 2EDRA 1RADB 2CKNA 1OB0A 3OB0H 3JWNE 4KFMA 4NNPL 4YDLC 5JPNB 1M05A 3GSNL 3D34A 3BH9A 2MNUA 1O9WA 1D5ZA 3QT2A 4JJHA 4NIYE 2YA1A 4PGDA 4F8OA 1BQLL 1ED3B 3FT3B 3MKGA 4MJJA 3V6BR 4PRHE 3GS4A 5GANf 1TJGH 4KAQL 1TTAA 2NNRA 2EXWD 1L9RA 1S9YB 3ARPA 3ZDZB 1I8MB 1HDMA 1MV0B 5F6IB 4PRHB 4M29A 4F8LA 4MHHI 3A4AA 5CWSB 1NGWB 3CBMA 5D7HA 3VFRA 5TF1L 4JX0A 4TUOA 5D7SL 1BOGB 2QVKA 3QRGH 1Q1JH 1ZVYA 4ZDHB 3DYOA 2D31B 4MTMA 5E8NA 1IRXA 1I4K1 2OQJB 1ACYL 3GBLA 4Y5VB 5AZ2L 3WDHA 5E08H 5FKPA 3FB9A 3NGBC 1CICD 1DCEA 3ENEA 3ZUNC 5I8CA 3QWYA 1LEGB 2IDSA 4PJCF 5TE4L 4R7NB 2AK1L 4APQD 4V2SA 4JFEA 4UT7L 2P1YA 4MRBA 5LL6S 1MCOL 1GMEA 1U3NA 4G5AA 5DQDH 4YDVB 3V8JA 4ATOA 1OOTA 2Y6SD 4KH9A 4YSDA 5IP4A 1ZGLB 3FSWA 3OY9A 2CCWA 3WHXB 5L2KD 1X4ZA 3TYGH 5C9KA 2G9KA 5T33L 3BP7A 3H7LA 1I8IB 3JTTA 1EDHA 2FSEA 1R46A 5K9OA 4KOBA 5KYXA 4LMQE 5CD3B 5IFJB 3L3GA 1B9ZA 3DETD 4K3HA 4ZQKA 1TUPA 2EQUA 1N8ZA 1SBSH 5T3XH 3CFEB 2FT8A 5C3TA 1WISA 3FTZA 2EWNA 3FLGA 2XTJE 3IF1A 3CC2Q 3D0VA 4HQQL 1BVNP 1TTHB 1E90A 2BWDA 2QQKL 1K4DB 3GBEA 4L4TE 4M1GH 2XBDA 4FFYH 5I71B 2RJCA 1RMFL 2CNYA 2X9HA 4L4TB 5AVXB 1UACH 5JLZB 3NCMA 4X9IA 2FBJL 2L4OA 5AQ0A 3JCMd 5D2NE 2QKIA 3KEHA 4KDVA 4LGRB 5CZKA 5IIEA 1JNNH 4N0UA 1OAUL 1JD7A 5D2NB 3DJ9A 2MI6A 2FEEL 1M2VB 1I8LA 2NQCA 4LPYA 4P3DA 1CFQA 5LJ5j 1Q7YC 2VRQA 4DP2X 1P69B 4XN5A 4R90L 4H1LH 3I9GH 4OZGA 5AVZB 2J72A 2WAHA 2V9RA 3BRGC 4AQAB 5E4EB 5FW7A 3QH3B 3RIFK 1PW3A 3V5DA 4PLKD 5I30H 1TJXA 3D09A 5E6IC 1RULL 4KKCC 2B20A 1PYWB 2XY2A 4M5ZL 3HG4A 3CVBA 3S35H 1E6JH 1UADC 2G3NA 4PQXA 1F90H 1RZIA 5TQ0H 5D1ZA 3MOAL 2OMTA 1KIKA 2O6DA 3EYQC 1XL4A 3Q3GA 5J7CC 1IQDA 1OALA 2HT2D 2RHUA 2VXTH 4KC3B 4AOFA 5IJKC 4N1HB 1C16B 1BLIA 1AEYA 5DJ0B 5D71L 4JHWL 4QEGA 1HH9A 1OT4A 5AW1B 3CCVT 3OWRA 1MVFA 1EFXA 3BH9B 4FA6A 3BPOC 2ZWKA 1D5ZB 2BWIA 2CALA 3KW7A 2G5RA 2ZXCA 2CAKA 4PGDB 3BN3B 9PCYA 4GPVA 1NANH 3V7CA 4LIQH 3GQFA 3GMNA 2XACC 2ZUXA 5KSBE 3ARDC 3RFZC 4IKNA 1HDMB 1QFPA 3SYQA 4BH8A 1QP1A 3LZQA 3SGKC 4RFNB 4MXVF 1G94A 2V7NA 4GAYB 2EYQA 3AT9A 3D3VD 3LLRA 1XF4A 4WENB 3VFRB 4TUOB 2ZUWA 1KOAA 1BF5A 4MXWL 4WDIA 1HJCA 1VGEL 3ESNA 5E8NB 1KV7A 2AJVH 4QRBA 5FKPB 1KB3A 4QHLA 3NCYS 4JFEE 4XT1C 3T6WA 3OYAA 2WVSA 5I1CL 3WTSA 3MJ8A 5F1OB 3US0A 3C09C 4JFEB 1TXKA 4JG1L 3KWXA 3CPLA 3ZTNH 3IJSA 4N8UA 2G3XA 1JGLL 1U3ZA 4QO1A 1TFPA 1R3LA 4L18A 2F58H 4GJTB 1F56A 3BP7B 3P3YA 1E6OL 3QNXA 4KV5E 4XCCH 3UBFA 2XFXA 3JTTB 2Y0SA 4C5IA 5K9OB 2E64A 1ZBJA 3KPQA 5IQLA 5FECA 3CSPA 3L3GB 2PPEA 1YNKH 4XXCC 4ZQKB 4C4KT 1N8ZB 2D8JA 4LL4A 1RERA 1TQWA 1KJ3L 5D7JA 5SV3A 3RL1A 4AE1A 3SDCD 3WSQH 1G9NC 1EEZA 3IF1B 3JV4A 4PYHA 3WKNA 3D0VB 1WGVA 1N5YH 5JZ7D 4GI8A 5LG6A 4PLNC 3LH9A 1ZLDA 4N0UE 4NKIH 5IB5A 3QS3A 4W9IC 2QKIB 4IRSA 1UJYA 4AYDC 1OSEA 3S5LA 3AB0B 1LWJA 4WHDA 4N0UB 5IIEB 2WWKT 5DD6A 3KG5A 4KKPA 4P3DB 4OZGE 2KZBA 3MV7D 3NJMA 5I1EH 2ZKWA 2ZT9C 1NLPC 1OYXA 4HUCA 2GBVA 4OZGB 3D6GA 5G4OA 5AAWC 1RUML 2ESVA 3BPNC 2GTJA 3O2WH 1YEFL 3QZMA 4LSTH 3WEBA 5FHAH 5E23A 1J5IA 3ME0A 3V5DB 3NABL 4RQQA 3X3FL 1CIDA 2HTLD 3HG1D 4IIZA 3VXME 3FUDA 3NACH 3BQUD 1WFWA 2O2OA 1NBQA 3WE6A 4G6MH 4LSRH 3G7TA 1RZIB 3C5JB 5D1ZB 5C0BA 2NY7H 2OMTB 4E9SA 5E56A 4IJ3C 2G4GA 3Q3GB 3EZ8A 4UBDC 5B1BB 1IQDB 3RIFF 5IROD 3HZVA 4UTCA 3KXTA 1SYSA 2ZYHA 1CBVL 4DFIA 1RZJC 4I9XA 1HH9B 2OS7A 1RZKC 1M8VA 5KVEH 2AZVA 3O6FA 1EFXB 2VN4A 1IC7H 3ESVF 4ZXBC 4JQIA 2BP0A 4LCYA 3GMNB 2CH8A 4W9CC 2VDPL 1G4MA 4Z7UF 2BZXA 1RUKH 4WSJA 3SE3A 3T8MA 3FQYA 4BH8B 4BFOA 3MLZH 3V4VL 4N3UA 4KITB 3CVDA 2V7NB 1A14L 4IIQC 4PS3A 4RISH 1UWEL 4NO0A 1HIMH 5FO2A 4IRZA 1KD1R 2YGNA 4WDIB 5JW4M 4WTQA 3REAB 2XI9A 4ZPVA 4YDKL 3QJFA 3A6OA 1A66A 5DUPH 3F7QA 4UINH 4QHLB 2O5ZH 4WK2B 1XGUA 2CO4A 2YA0A 1MCJA 2PUQT 2XU9A 3ATFA 3MJ8B 2IPUG 2FX7H 2ED8A 2IV9A 2V26A 3CPLB 2K2VA 1ODAA 5JDSA 3IJSB 4QO1B 1YHQA 5JW4R 1OTSC 1R3LB 1LNXA 2ICWA 1FQ9C 1U42A 2G2PA 4PJBF 2M1HA 2J44A 4L9LC 4PRID 5HYSA 2FATL 4FNPA 3QNXB 4R8WH 5JR1L 3IDIA 1GFDA 3GZQA 4ZI8A 1VACA 2XFXB 2X3WD 1PZAA 5ITBL 2FJGA 3KPQB 1RVFH 1KC8R 2B3IA 5FECB 2J8UF 3ATDA 1KCUH 1YN7A 2K78A 3CN2A 3PE9A 4PJHE 4Y4KD 5DC4B 4E5XG 1FMVA 3GSOA 5D7JB 1KXQA 3RL1B 3FCBA 3L3KA 2QQLL 2HX9A 2AFNA 2ZF8A 1EEZB 3ECUA 1I8KA 4JJCA 3JV4B 2GBAA 2ZPIB 3EFOA 4MB4A 4HCRH 2EDHA 4CDGC 3QEQA 4Z7WE 3WEXA 1MW1A 3CZGA 3ZRCC 2MQ0A 5IB5B 3HAEH 4IRSB 4H2AA 4Q8BA 4KTGA 3O9WD 3EJZC 3OF6A 4Q9BA 1YY8A 3S5LB 2BM3A 4G43A 4P5NA 1PG5B 5DD6B 3QDGA 3QNZA 3INZA 4TQHA 3NFCA 2ESVE 1MWAA 3DXAD 4JUVA 1R24A 3E6FA 5GISL 2RR3A 3MFFA 3HC3H 1WO2A 3CC4T 4K9EC 5E6ZA 5B38G 2ESVB 5DD0H 4MJHA 4S2SA 4P3CL 2QGCA 2EIFA 1LO2L 3PWUA 4P2OD 3ME0B 5F3FA 1INQA 1SSFA 3KYAA 4RQQB 4WFHD 4ME7A 4HDIA 2JT4A 2H0JA 4HAGA 1NGPH 4YZFF 1KLFA 3KYKH 2EDXA 5C0BE 3WE6B 4KRNA 4XTYA 5JXED 3ULVD 3VD4A 1AGDA 3NTCL 4YHZH 5C0BB 4W9HC 1QRND 4K5PA 1B4JH 2GQIA 2DF6A 3HZVB 1QVFS 1R6VA 2Y06H 2YAHA 1SYSB 4UCFA 5HBBA 3NA9H 3SODB 1AXTH 2J2ZA 3EJRA 3VYGA 2P0KA 1JBJA 1BP3B 4FXGC 3O6FB 4PUBL 2YGOA 4RMOA 3AU0A 2MCPL 1MFDH 4JFXA 2BP0B 4LCYB 3WNOA 1Q0EA 3CHRA 1JNLH 4WKXA 1UJ3C 1AWWA 4OFVA 3B8YA 3VI4E 1U8HA 3AQXA 3WLBA 3ZY7A 3KH4A 1PFCA 4NO0B 1YN8A 1W0YT 2L3SA 5D96B 3MPCA 4PJ5A 4JB9H 1PG7X 3D39A 4KRPB 2V7HA 3FRNA 1N8RR 5D93B 1BI3A 4TXVB 1R0AH 1CFVH 2EYWA 5D7KE 3EG3A 4D9LL 4M77G 4ZPVB 3BGFB 3CZUB 2L7JA 3GBML 3QJFB 4YHYC 1BFVH 3MJ9A 3ZT5A 4UAOB 1XGUB 4CGUB 4LQFH 2AEQH 3M53A 1BSIA 2VDNH 2PO6A 3EYVA 4KTEH 2AEIT 2B2XH 4LNRA 4B3VA 5JW4Q 1J5OH 2Y36L 3N41B 4IURA 3QPQD 3LZNA 3N1QC 4JN1H 4KWUA 2DH3A 5K39A 5C6PB 3MGOA 1FFOA 3V4PA 4EOWH 2WOBA 1YQVL 2AQTA 2GSMB 1KYAA 2ICWB 3FYEB 5HYSB 3GHEH 3L5WA 1HKLH 3IDIB 2AKRA 1QNZL 1VACB 3TWYA 2M1KA 3CD6Q 1JZ4A 1GY2A 2FJGB 4Z23A 2BP3A 4GSDL 4N4HA 2A7YA 1YJ9Q 1KDJA 4S0HA 1SEMA 2LP5A 1WHPA 1WS8A 1YN7B 2XLLA 3HR5A 5KJRH 4N68A 1JZHA 1M1KC 3GSOB 2AXJA 1TZ8A 4BQBA 4IBSA 3L3KB 3ERXA 1NUDA 1I8KB 2WN3A 1KBKA 2DZ9A 3EFOB 1JRHI 3SE8H 3EOTH 4LPUA 4MVBC 3QEQB 4YE4L 3WEXB 1A7QL 3OKMA 5BZXA 3CZLA 1TG8A 3RDTA 3CCSQ 1U8NA 1EBPA 2QASA 1OTUC 3VXNA 4BDVA 3JCMb 3SKUD 1EAJA 2X6VA 1YY8B 3H0HA 1BCOA 1TUDA 3OAYH 3B5TA 4G43B 5FS5A 3WLWC 5D2LA 1KN2L 3QDGB 3QNZB 2FD6H 2BNRA 4HIHA 1U3YA 1MWAB 3E6FB 4KX7A 4WEUD 3MFFB 4C5GA 4P59H 4B0MB 2FYYA 4S2SB 1QFWL 1MJ7L 4JZJA 3PWUB 1AFVL 3FB6A 3NAAL 1INQB 4G6KH 3HNVH 4AQOA 4UIKH 4HDIB 4GLMA 4BFFA 2MOVA 1YJWA 4W9JC 3C8HA 5D5MF 1OD9A 1KLFB 4QXTA 3ABZA 4LEOA 1FMWA 4M7AC 3DMMA 4X83A 1AGDB 2FBOJ 5H94A 1FIGH 2QHRL 1ZANL 3K5SA 2ID5A 4B9JA 2X4QA 4AW7A 1IQWL 4Y2DC 3META 1N0XL 3UO1L 3QXVA 2YK1L 1MCPL 2XKOC 1AXSA 3PU7A 4O6JA 1UECA 3IDGA 1Q38A 1VQNT 1C7SA 3OSVA 3AROA 1IM3D 5EBMA 3J81E 1NC2D 4JLGA 4ANJA 2A9ML 4KJWC 2HKFL 2ZJSH 3KVDD 4JFXB 3VUBA 5AD0A 5I1JH 4PJ7F 4AGNA 1O9SA 2EAYA 1LYQA 3GSQA 1KBPA 4WK4B 2WVUA 5B3JE 4ZAKC 5KZCD 4LIQE 5J5EA 1U8HB 1UCBL 2WLLA 3WLBB 3WXWL 3QRFM 4NWUL 4PJ5E 1KIPA 3MRQB 3F7RA 4XTXA 3KDMA 4PJ5B 4OMOA 1ZUKA 1RI8A 2V7HB 3D39B 4FTDA 4YFDB 5EZOH 5HPOA 3IMVA 4NN6C 1M90R 1UA6L 2Z3FA 3RJDA 2BVUA 4RGNE 1DJZA 1Z9OA 4Y19A 1RLBA 5FROA 1CDYA 2VWFA 1BHGA 3S8FB 1K3ZA 1W91A 3UAJC 3Q8AA 2PO6B 4OZHE 3EYVB 2V3FA 4UT9L 4IKLA 4LNRB 1PAMA 5HJDA 4F8PA 2DVJA 3MLYL 1Y7VA 3CFQA 3QWRD 4MMLA 4F8TA 3MLXH 3FFCE 2WO2B 4G9FD 5K39B 3MGOB 4MZTA 5GMKe 1FFOB 3V4PB 4EKXA 4OF7A 3TF4A 3F7PC 3VSQA 2APWA 2BINA 2BNQE 1RAEB 4PJIA 2VDLH 3L5WB 1YEEL 3S37X 2AKRB 4KGJA 2X1QA 3D07A 2HMIC 4L6V5 5B3SB 4QHKJ 3ZE2E 4B9PA 1W6LA 3GHPA 4XVSL 2WXOA 2XVKA 4ES9A 3HR5B 4F8QA 1UKQA 1BQ5A 4QMEA 5D7LD 5CIUA 2P0PA 3WELA 4XE5B 4WFGE 4G42A 1A7RH 4YDZA 2R4RL 1M6OA 3TWCL 4HVUA 3RGVD 2BIMA 3SE4C 4IK6A 2W91A 2XFGB 4LCCC 4DQOL 4N2BA 4M75A 4YLCA 3Q1JA 3I6LE 3OKMB 4YHOL 1WITA 4MHHG 3ZSSA 3RDTB 1FUNA 1U8NB 3K4ZA 4P4KD 3VXNB 4ZFGL 1RV6X 5D2LE 4BDVB 2B4CC 2HLAA 3DJRA 5LJ5f 1J8HD 3BUBA 1YNLH 2BNRE 3GXUB 2OR9H 1IL1A 4OQTA 4AK1A 4KO6A 4LLWA 5D2LB 4N5UA 15C8H 2QA4T 1OWWA 2K5FA 1T6WA 2BNRB 2DMKA 2NCEA 2DXUA 4HIHB 4E6RA 1IAIM 4MCYA 5B7FA 1D5XA 2VDKB 2BSCA 3RIKA 2FYYB 2QXFA 4X6EA 4JZJB 4N85A 2IPOB 3FB6B 5FW6A 1IX2A 1CXKA 4FQLL 4QVDA 4KI5F 2ADFL 2YD3A 3BW9A 3QGVA 4AGLA 2BS8A 3W3BA 4QXTB 4DK3A 4LEOB 3ARBC 5CKEA 3DMMB 5I15H 4KXZH 2G5BA 1AVZC 1MHPH 2CCVA 2I69A 4I7ZC 2CZ6B 5H94B 3HHMA 1ZSZC 4RMWA 3CMOL 2HTKC 4MDIA 2X4QB 1TO5A 3SHSA 3GBQA 4HWBA 1HAUA 4OD1L 2EP6A 4DNLA 4BD4A 1PZCA 3ET9F 1AXSB 4U0RC 4Y89A 5FB8A 1N8OE 3KGUA 2AAVA 4U31A 3IDGB 1IGTA 1U0QA 2OMUA 5BOZG 5EBMB 3T3MF 3UP1A 3SBQA 1FORH 4I3SH 1ZLUH 4E9RA 2A74C 3EO9L 2IOOA 1Q95G 5CBEA 4TKWA 3ASNB 2AV7A 1KBWA 2PR4L 5AD0B 5EORL 5EOQL 1SNRA 3GSQB 1M3BA 1T0MA 5DUMH 5JIPA 2R0KH 2DI8A 4DEUA 1FNGA 1FO0L 4M7JH 5HYQA 2K79A 2WXLA 1G87A 3ZE0E 2YUOA 1KIPB 4XP9H 3MXWL 4G72B 4H0LC 3GHBL 4OD3H 4LSUL 3KDMB 4KQ4L 4JPWL 5FO8A 4Y19E 2A6JB 4PJFA 3GSXA 3UF4A 3LVTA 3DX7A 4JN2A 3GDBA 4Y19B 4Z8FH 1SDDA 2CLVA 4A2LA 3QJQB 4APXA 4HGWA 3V8CA 2AQ2A 5HHVL 3ULUE 1JXJA 2ZKHL 4NUPA 1FNHA 3UJIH 3AS1A 4YDIH 5JIMA 3IS0X 3QPXL 1HCZA 1OE1A 4EF3A 2C9QA 2X1OA 3ISRA 2ZP0T 3DX0A 3HVDA 4BELD 3FN3A 1ZLMA 2WXNA 4YK4B 4PJIE 3CNKA 5CCHE 1JGVH 1SF9A 4OT1L 1D0XA 4J3WA 4PJIB 3FW6A 1BG1A 1FZMA 3L1FA 4JHVA 4S10A 4WEBH 2P84A 3WXWH 4BI8B 4KQ3L 2HFTA 4G42B 1AZZC 1M6OB 3VVWA 4M75E 4CW1A 4DEPC 2K3TA 5F89A 1E7VA 3A67H 3DO3A 2RB6A 2CHWA 1IAIH 1ZHIA 4FQJH 1IBZA 4CC7A 4HJSA 2DEQA 4M75B 3VXPA 4LSPH 4YXHH 3TO4D 2GJ6A 2OAUA 1JGUH 4W6YB 2P8MB 4KJPC 5CIPH 3GOXA 1IL1B 4N2KA 3UZVA 3H4HA 1Q7YU 3IMSA 4LLWB 1IC5L 2CP2A 2DFUA 2NCMA 2R56H 1QBBA 2ITDA 4J1UA 4MCYB 5DLML 1N5ZA 2PWDA 4EKJA 5CJOL 1D5XB 2LE9A 1AQ8A 1MCIA 4AJVA 3T09A 1QOKA 4FI7A 2DRMA 4X6EB 3CC2T 3OW2A 3ZRSA 3JCMh 1HZHH 2H0EA 2YPVA 3MAWA 3JWDL 4PJEA 5TPWH 3VGAB 4DO5A 3WTYA 3BW9B 3N1MC 4Z7QE 3I9PA 5AG9A 2G5BB 1P92A 3N55A 2LV4A 3U4BH 5HGBA 4O02A 4Z7QB 1IGYA 5K93A 4MDIB 1ZHBA 3FCUB 2X4YA 3QE5A 2E3VA 4X6FA 4YEEA 2HSIA 3B2DC 1S3KL 1GCQA 3MRPA 4I0CC 2AZAA 4OF6A 4PS4H 1U8QA 1DBKL 3QZNA 5FB8B 3RGHA 4ONGL 1QLFA 4HOWA 3CQQA 1IGTB 2OMUB 3PWPE 3PYCA 3FOLA 1KY6A 1A1MA 2JKRM 3C8DA 3WN5A 1UGVA 2HFGL 3EADA 3CCEQ 4GI6A 4D6WA 1L9SA 1Q9OB 4J3UA 1G9ML 5CBEB 4PG2A 1EX4A 1YN6A 1ZMYA 1KELL 2AV7B 3IU4H 1X4YA 4NLHA 1T0MB 3EYUL 2X4OB 3PXLA 1XVSA 3KJ4B 3WS6C 1FNGB 1HEZA 2FIKA 5HYQB 4HSAC 5GS0H 4HCCA 2NNAB 4TVPE 2EJ9A 1ECYA 3BKMH 3BCFA 4N28A 4GNKB 4FCYA 1DVQA 1WF5A 5FO8B 2D2CC 4PJFB 3GSXB 4LVEA 4DVBA 2ZOKA 3NZSA 3BZDA 4LZKA 1ZLVH 3DX7B 4JN2B 3VUAA 4F7UA 2P7TA 5E03A 1KD1C 1SDDB 2CLVB 4APXB 1OWRM 4HGWB 1P7QA 1C1EH 2VO5A 1ETA1 4BE0A 4L1LA 5GPRA 2DQGH 2GUYA 2CG9X 4AG1C 2BFGA 2QSTA 1T04A 1VQ7T 3WY3A 3SWNC 2NY2D 1DZBA 4ZMXA 2PCXA 5GGUA 4MA8H 1A6UL 1VKXA 4UT6L 3LHPH 5FEBA 1DVFA 5DHEA 4MMKA 2XK0A 4EMKC 1ZKAA 1UTDA 5CLXA 5E94A 4WWOA 2CREA 1J0JA 1YUKB 2OTJQ 2FQEA 3UADA 4XBMA 1FZMB 2FZGB 2Y5TA 4M77A 1MFCH 2I60H 4ADGA 2F2HA 1IGML 4I8DA 5EA0L 4HXAL 4J7IA 2HH0L 3HI5H 1XAKA 4CW1B 1KC8C 5IB4A 4PRPE 3PNWC 5F89B 5KSBF 3VXPB 5GS1C 4KZCA 4JKLA 2E9GA 2AJXL 3R4DA 3UBXA 1CXIA 3T1WA 5BRZD 1WUZA 2GJ6B 1E27A 1PKQE 3RZCA 3P73A 1AGCA 2Z93A 3T2LA 3DIDA 3IJYA 3P3TA 2CJTA 2BVTA 3UZVB 3NJKA 1U93A 4GAFB 1GL4B 3RVVC 3LIZH 1UT9A 3JWOL 4Y28E 4L0PB 4C56A 4AYFA 2ITDB 4J1UB 3ZKND 4NQED 1ANUA 3LEXA 1LVKA 5INDA 2YHGA 1IKNA 2WJ7A 2IH8A 4MB1A 4A6YA 5I73B 3H53A 1VF5C 4XB8A 1YI2A 3ZDYE 1UA3A 1OAYH 3F3HA 3FSOA 1YYML 4HJIA 4PJEB 4H8QA 2Z1KA 5GRJH 4X6DF 4ZX6A 4DP8X 4JBSA 5FK9A 6TAAA 3NYKA 2IWKA 4PHZA 5HGBB 1LEKA 4FNLH 1NCTA 2CSIA 4O02B 4EIUA 1JZ5A 1IGYB 5D70L 3ABKB 2RQVA 1DBBH 1HNFA 1ZHBB 3F12A 4X6FB 2VISA 3FO9A 4L3EA 2GY7B 1XF2A 3EIFA 3MRPB 1CR9L 5AOZA 1U8QB 3WTVA 1TLMA 2FYVA 4NN7B 4GBQA 3LKRA 3GJFH 4QRRD 4R5XA 5JHLL 1QLFB 4O4YL 1E9PA 3O4LD 1XCWA 1K5WA 3FOLB 1K76A 1A1MB 3WN5B 4HJTA 2A2QT 1GGIL 4OIAA 1QVFP 1IBGL 3NRPA 4PBDA 4HGMA 3H4FA 5HVHB 1GZPA 4HLJA 2PXYC 3DA0A 1YN6B 2J55A 3JQOB 4XWGH 5FYLH 4HXBH 4LFHD 4PJ8D 3U2IA 4URKA 3DTXA 1CLYH 1HEZB 3F58L 2FIKB 3SBPA 1N7MH 1VDGA 2H5UA 3L17A 3H2WA 4LVOB 5B39G 2VLME 2NZ9C 2O61A 4WW1A 1FL5A 1YITA 2P28B 3DJSA 3TU6A 4OLYH 3OSSC 5HHOA 4DVBB 3L1EA 5HY6A 2ZOKB 2MIZA 1EZSA 3IJ9A 4N8VA 2P7TB 4WV1C 1AQHA 4HALA 4YVNA 1N8RC 4GXUM 4QGYA 1PPIA 4F15C 4Z0XA 4R0LC 5AOLA 3WXVL 1KTLA 3LRSA 2DLHA 5L0QC 1T04B 5IVZA 1KJ2A 2R2HA 1T7VA 3EDJA 4J6WA 4XPHH 5GGUB 5IY5B 1IEHA 3N06B 3OBAA 1VKXB 4G7YH 1DVFB 2J06A 2YXFA 2FJUB 4K3DL 4YSQA 3MRLA 1L4IA 1HNYA 3M7OA 2VR9A 4XO5A 5E94B 1VEPA 1ZY9A 3FTWA 4OFYA 4UOQA 3W2DL 4O5LH 1CTNA 2RHZA 4M77E 2YLBA 1GC1C 2Y5TB 2HD0A 4H8UA 4LASH 4NERA 4M77B 2X6MA 5A6MA 4BQ9A 5L9DH 4N90D 3EYSL 2HBPA 1OW0A 3OKYA 2HVKA 4IUVA 5IB4B 3BP5A 2YGVA 4ZD3H 3VTTA 4HFUH 4V2BA 5F9WC 5BZDA 5AUMA 1EIBA 3UBXB 3CIQA 2L7UA 4E36A 2F15A 5E0FA 3HE7D 3CMAT 1E27B 3RZCB 3UG5A 4IRZL 2ETWA 1TJGL 5FRNA 1AGCB 2H6UA 2Z93B 3DX8A 5EG6C 3IJYB 1KGXA 5AL8A 5FGBC 1OTTC 4AUUA 5J6GA 1U93B 4Y1AD 2YSQA 1NJIC 4C56B 2CBTA 4AYFB 1BMZA 4FNTA 3ZT7A 1OGSA 2AQQA 3D30A 1JGIA 2CM5A 3QRGL 3LEXB 1Q1JL 2RHXA 3UPCA 5INDB 5DQ9A 5IWLC 2Z31C 4XO4A 3V5HA 1OPOA 3G6EQ 3I3EA 4A6YB 5CD5D 5C3LD 1FHGA 1S46A 2XN1A 3HHRB 5E08L 3DKMA 5CP7A 2VL4A 4C0GA 5I8EA 5FK9B 3MOQA 2F7QA 2B9BA 4ODVL 1LEKB 1QVOA 4DEYA 3TJEL 4HPOL 3CN3A 4JFOA 3F12B 3J8F7 1T3SA 3PPEA 3CDZA 2WMPB 4N5EC 1E4WH 2VISB 3FO9B 1RURH 4L3EB 5HHME 1PLCA 4PHXA 1SRLA 4LEXH 2YSSA 3AXIA 2E6PA 1KHIA 4AC4A 3LKRB 5DUJA 1LXMA 1WFNA 2WSPA 2MAMA 4A7VA 2BE7D 1E9PB 5ABDE 5GMKl 3GT6A 4X7DC 3GXMA 2B3RA 1RPKA 1GOGA 2J88H 3S3PA 3LWIA 4DGIH 2ZXWB 1AQKL 2DI9A 3QHZH 3RIAK 5D1XC 2KROA 1GZPB 5F8QC 4Y8DC 3QUHA 2VGMA 5D8JH 3ZDZF 2EVGA 5CN2A 4MB5A 4FLOA 4NCC1 1WCBA 3MV9D 3DTXB 2FPDA 2JXMB 4G71B 3HS8A 4M1GL 4KNQA 3VCLA 4QVCA 1VFAA 3MBXH 5IHUL 4OF1A 5HHOE 2O61B 4K23H 4WW1B 1FL5B 1EVUA 2GT9A 1HQ4A 1MF2L 1RU9H 1JNNL 4NNYA 5HHOB 2CLZA 3QR0A 2KRSA 2ICES 4N8VB 1Q72H 1JGDA 2L3QA 1VQLA 1LD9A 3BH4A 5GMKh 4TNWK 5DVMA 1KCSH 5C6TL 2C06A 2ZCLL 4NPKA 3I9GL 1CURA 3AABA 5GZNC 1ZS2A 4Z0XB 4LOFA 3ISYA 1KTLB 4ZTOH 4PJOA 3LRSB 4UOW1 2G75A 1JHTA 5IVZB 1KJ2B 2R2HB 3BEVA 2XG5A 1KWGA 2P5EA 3BMWA 4EDUA 3S35L 3EZJB 5IT2H 3MRLB 3X12A 1NCDH 5TQ0L 4UV4H 5CJXA 1JGEA 1WP6A 1IBFA 3RMSA 3GMPA 3LH2H 4K0OA 5DMJB 3IVKB 1M1KU 2UY6A 3QG6A 5JIIA 3EFDL 4B97A 3N85H 1CB4A 4CVUA 4U6YA 5BV7H 2NR6C 3H0TA 3O8XD 1X5MA 3BP5B 4NN5B 1HSBA 5LBGA 4QYAA 5A43C 5BZDB 1A3LL 5HDBE 2XHNA 4IKFA 3ABGA 4UC4A 5AUMB 5ADPH 3MLPA 1CO1A 5TFSH 1G3YA 1MFBH 1V29B 4LIQL 5HDBB 2CA4A 3IN2A 5L4IA 2J6KA 3DX8B 2WIIA 2YFNA 1R5IA 1DQJA 4YHIA 1SDAB 1UM6H 2FRWA 1E30A 1DO5A 5J6GB 5IGXH 2DAQA 1XV8A 3CD6T 3AWGA 3R18A 1KY7A 4Q2ZA 4A66A 4E41D 2Q3ZA 1YJ9T 5I2MA 3WAKA 2RBLA 4CU6A 3SB3A 1BJ8A 3OS0A 4E7LA 5DQ9B 3V5HB 2AK4E 4JY4A 2UX6A 4L8SA 3VG9B 2YJLA 4UOJA 5CP7B 3AUWB 1U2YA 5JA9A 5I8EB 2EIKB 4S1SH 3FUJA 4HYTB 1MNNA 4ERSH 3M1BA 4NQDA 5F96H 3QUIA 5J13C 2HB0A 2MOGA 4Y9FA 2WBJD 1QVOB 1QSEE 2LTQB 1IAMA 3U46A 1NMAH 2QVMA 3KPLA 4JFOB 3RVXD 4AFQC 3CDZB 1W80A 3KBEA 3FONA 3ZTNL 3LB6C 2XCMC 3B9KA 1RAHB 3CCQA 1WC7A 2OBGA 2YSSB 3HG0A 4DN3H 3B6SA 3GLZA 2F58L 3E2HB 2PZ1A 1H641 1X6LA 4XCCL 3RU8L 1HXMA 1OXYA 4NAMA 4MJID 5GAOl 1HXDA 2IPTL 3HNSL 4OGAD 1INEH 1YNKL 5C07D 3CDGA 5JOEA 3KPPA 3BVWA 1WCBB 2JCCA 2A4EA 2AERT 2F19L 1BVKA 4U1SA 2A9NH 1EHLH 2MTPA 3K2MC 3VCLB 3HN8A 4ODWB 5DXWA 4CMHC 2ZX9A 3WL9A 1VFAB 1QKWA 3FC8A 2QVIA 3RIAF 3KPOA 2Z91A 5AZEL 2GT9B 1HQ4B 1JRHH 3KPRD 4J83A 4NNYB 4WI5A 2CLZB 4M4ZA 4LHUG 1UWXK 3LEVL 1FZJA 1Y18A 1JGDB 4XXWC 1LD9B 4YGAB 2GJZA 4ALAH 1S7QB 5EZIL 5I1EL 2UUDH 4PRNA 4Z1PA 3FXIC 4PJOE 3O4OB 6PCYA 3O2WL 2ZCFB 1ETB1 2MMXA 5FHAL 1HYOA 4PJOB 3BJLA 4NFBA 2G75B 1JHTB 3BEVB 1CLOH 2XG5B 3E0GA 3MCLH 2P5EB 1MCSA 3OWEA 1URLA 1EGJA 1KHCA 3QBYA 1MDAA 3PV7A 4TNWF 4LLQB 1J0KA 4XP1L 3OSKA 4G6ML 3FJ5A 4KV5F 4F9PC 1MXDA 4P57B 1RFDL 3X12B 4AVHA 1U4EA 1RABB 2NY7L 1JGEB 3PE0A 4K73A 3GMPB 4JRYD 5KWYC 3GTNA 2UY6B 2H8PA 3C60D 3K5RA 3DSNA 3PNRB 2A0LC 3QG6B 4BJLA 4Z3EA 1EO5A 3GFUA 2VQTA 2CD0A 4U6YB 1G7LA 3H0TB 2V2TA 4IOSD 1XWVA 4M6MH 5DS8A 5CEXA 1CICA 1HSBB 2PWFA 4GMSL 1NGYA 3ARBD 2DKMA 2YUPA 1TLKA 1UWGH 4APQA 3LRGA 4ZGJB 2DM7A 2J1XA 1ZTMA 1N64H 4LLDA 3BVNA 3VXOA 1R5IB 1DQJB 4YHIB 4TV3A 1RUKL 4JZ4A 1U1SA 3BUQA 4OCSL 1HX0A 2VRKA 2RHEA 3ARSA 4Q2ZB 4OZGF 2G60H 5L2KA 4RISL 3PP3K 1ASQA 1HIML 1X7QA 1YECL 4B0MM 3GZPA 2ICWJ 1DL7H 3WFZA 1PFOA 4JY4B 1J5DA 3ULUL 1X4XA 4LOUD 3QWNA 1AZGB 4L8SB 3ETBJ 3LTVA 4NWTH 5DUPL 4UINL 4NQDE 1LE9A 4FTVE 5HDOA 4OTXL 2ILLA 4H8VA 1RZFH 1ZV2A 3M1BB 4NQDB 2A73A 5I6KA 4NIKB 5T5FH 2G4EA 3NN8A 1BWMA 3CLEH 3U46B 3KPLB 1IXDA 2Z7UA 2IG0A 3FONB 4PJLA 1UEBA 3B9KB 4OCRH 5CEZH 3HTRA 2ERJC 4TS6A 5EU6E 1WC7B 1T7WA 1G0XA 3HI1A 1YLBB 1YCSA 3B1TA 3B6SB 5FKAA 3SPIA 3SCMC 1SM3H 3FRPA 3QUMH 4GRWH 1HXMB 2XWTA 3VRLE 2YMTA 1Q0XL 4ZGEB 2NYYD 2VR5A 4F17A 1JZEA 3PT9A 4UAHA 3CDGB 2JCCE 2Y23A 3PF2A 3KPPB 2L5QA 5DEJA 4PJDE 2EVIA 4B9XA 2V3DA 3WGUB 2JCCB 4OLZL 2AJSH 5DHDA 4EXKA 1ZXKA 3HBGA 3SE9H 1BVKB 1MFMA 2Z7ZA 4HCRL 4U1SB 1HH6A 3FQ1A 2XTSA 3PAYA 1GGCL 3GUTA 1XMEB 4XMKH 3WL9B 5FYLE 4FLRA 1NBZA 5AT1B 3KPOB 2Z91B 2RIKA 5F3HA 3JB9I 1V5JA 4WKZA 5JPNC 1CPUA 2EIMB 5C0ND 2E1HA 4M93B 5DFAA 4FQIL 1G1OA 1FZJB 1Y18B 3PMTA 1I8FA 1QW9A 2VZSA 3X1EA 2GJZB 3JWNC 2X1WL 1H6UA 4PRNB 2WSFE 3HC3L 1LTXA 4WJKB 5DD0L 1UOVA 1G7JA 1X69A 1UKSA 5IBLD 3CHOA 2A7BA 4PCYA 4YBHA 5F6IC 4W93A 3HFNA 5EC2A 3ECBB 2X2HA 3NCCB 2DKSA 1NPRA 3CXFA 5E1AA 5MEQA 2WBXA 2LMJA 2A5UA 2Y7LA 4JNXA 3V6FA 3BUYA 4PD4K 4U1MA 4IOIA 3L3OA 3RX5A 4DUXA 2EEBA 5GZOC 2P42B 4YHZL 1UQSA 5HYEA 3VRIA 3D3VA 4Y5VC 1YHQQ 3FPXA 3T0ED 3FHEA 2IQ9L 4RG8A 2H8PB 3DSNB 4PJHF 3T2OA 2AKKA 1WHOA 5HY9A 5J56B 3BH8A 3NA9L 4XNZB 3FTSA 1AXTL 1G7LB 3FULA 2V2TB 2Z0WA 5CEXB 1WHLA 5DS8B 4WAFA 3W11D 1CICB 1DSWA 1NGYB 1UHCA 4JG0H 4Z7WF 1S9XA 2XZCH 4LSVH 4RDQF 4APQB 1MFDL 4KHTH 1X3DA 4PTUA 4LLDB 3BVNB 4TVPL 3BKJH 4IBLT 2YPKA 1KENH 5SX5K 3VXOB 5L2KE 2FK9A 4IDLA 4WWKD 1NKGA 3NCEB 4MMYA 4UQ3A 1EZVY 4M7DG 4HEPG 3BPCA 2BOLA 5L2KB 2HAXA 4LRIA 4EN3D 1CFMA 2OM5A 2ZYSA 1CL7I 1X7QB 3EJPA 2J1KA 2YRVA 1RKRA 2J8HA 3PUUA 4I5BA 5CLWA 1R0AL 3KLSA 4FXLA 1CFVL 2GC7C 2F53D 2WXKA 1NCWL 1PS3A 5IMMA 1LE9B 3QFDA 1FGNL 4XN9A 3SDCA 4TVRA 4LQFL 2AEQL 5I71C 1I1FA 5CR2A 2BFVL 2B2XL 2A73B 3BGAA 5CR8A 4PSPA 5HPMA 1V3KA 1J5OL 1E5CA 3MJGX 2AXFB 3NN8B 4ZUWA 2OL3A 1FWXA 4OM1H 3EOBA 4HIPA 1DN2A 5D2NC 4EOWL 4M7KL 1D5RA 2HBWA 4XXDA 4A1RA 1H3GA 5I6MA 3TGXA 3HI1B 5FKAB 4M78G 1YCSB 1JUFA 4A2MA 3GHEL 1WRFA 4L9DA 3FRPB 5IREA 4K5MA 1JTPA 1DUYA 3E9TA 1GW0A 1AYRA 2XWTB 1RPQA 4FA7B 1XCXA 1SF3A 3MV7A 3Q8EA 2Y2WA 4YNYA 4GFXA 5EWIH 3UTPE 5E4EC 3VYOA 1NCCH 4ZMWA 1LCKA 2XN9E 1I7RA 3KCWA 4X7EC 4ABWA 1MNEA 2JIXD 2VE6A 4Y7OC 3MJ9H 3BWUF 3HG1A 2XTLA 3QI9D 1HH6B 3FH7A 2IWEA 3BQUA 4NOFA 3VI4F 5A16A 3GUTB 3MYJA 2XWCA 4P48A 1TT6A 4Q0XH 3CDYA 3VGGA 3PVQA 1NBZB 5CKGA 3UTQA 4N24A 5G4NA 3A22A 2VCOA 1HU8A 2ZCZA 2R57A 1K1ZA 2CUAA 4KK9D 4WKZB 5F3HB 3U7WH 3VD2A 5IROA 1KD1U 2KLSA 1LWHA 2RI3A 3L42A 3OYMA 2FD6L 2P8LA 4JM2D 3CCET 3QWXX 2YPVL 5IR1A 4K8RH 3N41F 4OI7A 2X3BA 2W0FA 4P59L 5FYKH 2OZ4A 5I0ZA 5I8OH 3RKWA 1NAMA 5DHVA 5LHDA 1G7JB 2CBQA 4G6KL 3RY6A 1K6QL 4PLIA 4WUKL 3HNVL 1QX1A 1NBVH 3OHMB 3IKCA 2EYSA 4UIKL 2HDAA 4MX7A 4NQTA 2XG8D 4RFNC 2X41A 5EC2B 1E3FA 5E1AB 1G84A 8PAZA 5E2WH 5HTSA 3V6FB 3BUYB 3ETBF 4HG4K 2ZUQB 2EUZA 4U1MB 4IOIB 3T0AA 1KGIA 1FIGL 1V3JA 3L3OB 4XZUA 1UQSB 3BPLB 1KGWA 4P23D 5I74B 3D3VB 3MUZ1 3O3BA 3IDJA 3VRIB 4FQ2H 1QP2A 1Q9LA 3WTXA 5HY9B 3DVNA 3PRZA 2XX0A 2EVJA 5KYUA 3P9LA 1N9PA 4WO0A 4LDWA 3C75A 1VQ4A 3R1GL 4MCZA 4IS6A 4AL8H 1S9XB 1X6NA 4F57L 2ZJSL 5HI4C 1NLDL 4KX8A 1KFAL 1NWPA 3JWDC 2VLJD 4PTUB 4X5LA 1W72A 1UURA 2JTMA 3D4YA 3BDBA 3QR2A 2YPKB 4BFRA 3SYAA 5D4QA 4XC3L 5ANMA 1JZDC 1N10A 4UQ3B 4MMYB 3BPCB 2OTJT 2BIQA 4K5NA 4PRIA 1QFUL 2WLNA 1AS6A 1UH3A 5GAOp 3HPLA 1Z3RA 4XQ3A 3THKA 4I5BB 4Y1SA 3H55A 1AR1D 3DX1A 2SEMA 1MG2C 2Z8SA 2ZOWA 4Y4KA 3RUGE 1G4RA 3TL5A 3PABA 3VYNA 3G6DH 4KI5D 5I5RA 5IMKA 3LN5A 3QFDB 3SDCB 3FS9A 1PQZA 4NUJA 1VFMA 4UANA 3ZGHA 4FNUA 4KK6C 1BFTA 1L9MA 5HPMB 2W92A 2QKIC 1C0MA 2B0SH 2R5MA 3MLXL 2OL3B 4ZUWB 3AB0C 4L8DA 2ISDA 3S34L 2UZXA 5IBTH 3EOBB 3HNTH 1NE8A 3U1QA 1YJWQ 3I2CL 5IUSA 3P69A 1I8LC 2EYYA 4XXDB 3FO2A 1BEYL 3O9WA 1JUFB 2JCWA 1CDGA 3OYHA 2OSXA 5J0BA 2VDLL 4JRLA 3TEXA 1DUYB 5DEGA 5JHMA 3E6HA 3GPSA 3MV7B 5C6SA 3DXAA 4YNYB 1U2CA 3L1GA 1F1BB 4ZUUA 3SPHA 4C4UA 3SBRA 1XJWB 3KBPA 4PCTA 2FPEA 3TPUA 2VE6B 4P2OA 1A3QA 5LJ3j 3SQBA 2OJZL 3HG1B 4WI3A 4DP0X 1PD6A 4UILL 4GG6A 3KNBA 5D1ZC 3BQUB 4JS7A 5AWNH 5A16B 3MYJB 3DYPA 4H8WH 5JXEA 4NQSA 1FNSH 1WBYA 3EGDA 1CGSH 4OV6F 3UTQB 1LP9A 3T6QC 3NCXA 1QRNA 2EBPA 1YNLL 2OR9L 3SYCA 5KVFH 3IFLH 3X26B 15C8L 1N8RU 2P8LB 3M86A 1R3IH 3V52L 5IR1B 1PNDA 3QVAA 3WEAA 3APCA 2DA9A 4AYMC 3RDVA 1B6DA 1NAMB 4I89A 5DHVB 1A0NB 3DPBA 5A2IH 2FX8L 4DKEH 1R17A 3IKCB 3MEVA 2EYSB 3VQMA 4MX7B 1EXGA 4LARL 2G3RA 5D7IA 3BZEA 3V0JA 3TOPA 1MHPL 3LY6A 1NPJA 1IC0A 3ML8A 2N56A 3ZE2F 3L3DA 3OAUL 1QW1A 3O3BB 3IDJB 4J4PD 5E5MA 1G6VK 1NIBA 2F5BH 3ARZA 4JFFE 2CRIA 1DVTA 1GA2A 1Q9LB 3CCJA 4I4WA 5C0CE 3F6IA 3DVNB 3SD5A 5KYUB 3TLRA 3P9LB 2CRYA 3U9PL 4ZS7H 3O41A 3Q43A 4ZTFA 4FQCL 3GRGA 1MCEA 4MCZB 3PLYA 3MLVH 5FUCE 4IS6B 4XP4H 4I3SL 4EIKA 7AT1B 2I9TA 4HS8H 3DV4A 4X8JA 1XF1A 2YQBA 1OPKA 5ANME 2V5MA 3OL2A 3PUCA 1W72B 1T03L 1VQ8T 5D2LF 3QZOA 2I25N 2IIJA 4S1DD 5ANMB 3T8VA 2R0KL 2XYCA 3VS2A 1NPNA 1LMKA 4Y7MA 3TU4K 1P6WA 4PRIB 4XP9L 3KZ8A 1U8CA 1I3UA 4OD3L 4EO5A 1ZT7A 1EFNA 2QQNH 3HPLB 3OAZH 3U82B 2K45A 5D7JC 4ORGA 4A4KA 4RGOH 3O2DA 4Y4KB 5IMLA 3L1AA 1X44A 4Z8FL 1KJ2L 2BWQA 3PABB 4NKMA 2QGEA 3S48A 5IMKB 3LOWA 3LN5B 3MCG1 2EDTA 4LGSB 1WI7A 4Z8AA 1PQZB 4NUJB 1WDXA 3FQUA 1IFHH 3UJIL 1MCHA 1WZKA 1A7PL 1NINA 1V3MA 3U7AA 4IRSC 3UMNA 3ML9A 2FAUA 2WZ6A 2UZXB 4F92B 4J12A 2EDLA 4LP8A 4AC2A 3MRHA 3LIUA 3DLMA 3CCVA 1JGVL 3FO2B 2D7PA 3O9WB 2EINB 3F84A 4PP1D 4JDVA 5TE6L 4PFZA 1XH1A 5DEGB 1NCBH 3E6HB 2WLZA 3EG0A 2V8IA 3G6ET 3DXAB 4ZUUB 1OOAA 2HQXA 4NAQA 1N12A 1B3QA 2E7DA 1Q81R 4HC1A 5E6UB 4GRWE 1KT2A 3FEOA 1ACCA 2EFIA 3EHBD 5DFVD 4WFHE 5F71A 3RY4A 3TPUB 2XDDA 5L4JA 4P2OB 4R7VA 4WWPA 4MA3A 1BZ8A 3WV0A 3LEYL 3SQBB 1UOKA 1JCVA 1QHPA 2FZKB 1ROWA 2BP8A 4GG6B 2YJQA 2F68X 2MCMA 1LP9E 3H42H 4LSPL 2Q3XA 4YXHL 3ZE0F 1QRNE 4NQSB 3WI9A 2VDRH 1WBYB 5CKAA 3EGDB 4WFED 1LP9B 5JUEH 1QRNB 1L9NA 3GNML 2LGNA 4GIAA 4DH2A 3L7EA 5DZOA 1UB5A 2WD0A 3D48R 3O6FC 4PV9A 4FRWA 1FXXA 1M90U 4FG6D 4I77L 3S7GA 3ULUF 2D9TA 4G6AC 1AKPA 4PLJC 5EU7C 4G7VH 4R7DA 1IM3A 1NC2A 2H2PD 4KO7A 4OCNC 3WTWA 3EJYD 4WHTA 4KRLB 2EQIA 3KYOA 1COBA 3DPBB 5D7IE 1FVCA 4P2RD 2L7EA 4PJIF 4BB7A 3BWUC 2WIMA 1OAJA 5D7IB 4LCIH 2ED6A 5BS0D 2IPUK 4TL4A 4YQXH 3BZEB 2X4XA 5D96C 4WO4D 3RQ3A 4AMKL 1KPVA 1OCWH 4KRPC 5D93C 3ZMEA 1HK9A 1JVLA 2AZUA 2B1AH 4M3HA 3MACH 35C8H 5I66A 5E5MB 4Z3FA 3BGFC 1EA9C 3AWEA 4I4WB 2HRHA 3ZKXB 4UAOC 4PS4L 2Y07H 3S5ZA 5I8KH 1NEUA 4JCWA 1X5LA 1WD9A 4J7RA 1YYLH 2MWCA 1YVLA 4M75F 3DYMA 3O41B 3BYYA 4Q52A 3LRMA 4LAQL 2VLKE 4FU6A 2JQAA 5DMGC 1G6RH 3CFKA 3IRZA 5IKCA 2I9TB 3DV4B 4X8JB 2VLKB 3MNVA 1XR9A 3QWRA 1QSFD 3LB6D 1K8AU 4G9FA 3PGGA 3V0DA 2YEVB 3OS5A 3H9YA 4AFSC 4PJ9D 3UC0H 2VZUA 3VXRD 1SLWA 2JMAA 2AAAA 4ELME 2N0KA 1WFUA 1VEOA 3VGFA 5KBLA 2NY3D 3BKML 1U8CB 2K9UA 4C0FA 2QZQA 4FNQA 1ZT7B 4RWHA 1UGNA 3CLFH 4ORGB 4OVUA 4NM8H 4ZTPL 3C12A 4XCYA 5IMLB 4XCEA 3T77A 2ADYA 1ETJA 1EZLA 5D7LA 4NKMB 1DSYA 4FFZL 5DSCA 1C1EL 4TLKA 3RGVA 4ZMAT 4Z7QF 1MEXL 1E4XL 3FQUB 5E8EA 2DQGL 2XETA 5EV7A 3F05A 3OYIA 4K2UH 2Z9TA 1FZKA 3CBOA 2UV3A 1HQRA 5HYJD 4ZN3A 4Z95H 3DVIA 3L9EA 2C3XA 4LT7A 3NFNB 4P4KA 3MRHB 1FFQA 3DOSA 2C4FT 4DP6X 1J8HA 2KI6A 4RRPG 3LHPL 2JB5H 2VWEE 4JDVB 4AZ8A 4TSAL 4K11A 2MKWA 5E99L 4YDMA 1Z9ZA 2DEXX 3NT0A 3RWJA 4QRUA 5E1IA 4I18B 3UAEA 1UZGA 2AMUA 1J7VR 1MCNA 1KT2B 2I60L 4E7SA 4D94A 2BOBA 1QPXA 4MA3B 1THCA 2IPKA 3MNMA 4OFQA 5E2JA 3X17A 3AXLA 2BP8B 1QVGS 4IHOA 2W38A 4J5YA 4KULA 2A28A 3WMQA 3IMTA 5H8DA 3JVGA 1D6VL 1UXWA 1XIWD 2EH7H 3GRBA 1BD2D 1EHNA 1W6WA 3FT0A 3HTLX 5IFAH 5C0AD 5D7EA 3TV3H 1MCKA 3L7EB 1HHIB 3UTSD 2O30A 1UT2A 2CGRL 3HW7A 1UB5B 2Y7NA 4YSUA 4JRWA 4XBEH 4Z6AT 2DLIA 4GINA 1IM3B 4R7DB 4A4HA 2M16A 1MREH 1NC2B 3QQ9D 4WHTB 4K5OA 1H92A 4J6XA 3D4ZA 3KYOB 3QEUA 1J05A 1CYXA 4UYQA 5J06A 1FVCB 1WYJA 2NNFA 2RJFA 1RAGB 4JFDD 2WQAA 1GYCA 1OAYL 5FYKE 2ZTBA 3QARA 4JHZA 2NYKA 1XD0A 5DFTA 5KZCB 4W6XB 1Y0LA 4ZZKA 4C92G 1N19A 1MI5E 1UFGA 1KPVB 2Q86A 1YG9A 4EE2A 5FW9A 3KHOA 5I66B 2KGTA 3ILEA 1CXHA 4EBQH 5J8OA 1LE5A 3VU2A 1MFVA 2J43A 3GF8A 2JQZA 1EAPA 4ODSH 2IBGA 1U92A 4OZFG 2PO6C 1R3HA 3OYBA 1RI9A 4J9FA 2I0NA 3BAXA 4HIEA 3QEGL 4C0ZA 3CFKB 4XPAL 4PVNA 5MP6H 5IKCB 4OSUH 3UBGA 2C5DC 3L4TA 4TQPA 3MNVB 4Z77A 2QI2A 4KXBA 1XR9B 1A9VA 3H56A 5CJBA 5IMOA 2WZPD 1T89A 4XWGL 3SHWA 4G9FB 5FYLL 4IOFD 1JXOA 1HL5A 3CC4A 1HI6A 3JB9G 1S9VA 1T2QH 1X5XA 5TQ2H 5EULV 1Y0MA 4YSEA 3MZTA 3TASA 2LC4A 4FQPA 1J5HA 4LPWA 4XBGA 3QXEB 3NA4A 4XCYB 4XCEB 3T77B 1H6FA 4LEBA 4Y4HD 3DHUA 1JZJA 5D7LB 3ZDYF 1U8OA 2UWEA 1J9QA 1CDBA 2WLYA 3G4ST 5DSCB 2FT6A 2DM4A 3RGVB 3RDTC 1TTUA 1PG7H 2WV3A 1AZCA 3SFMA 3EKCA 5EIIA 1KQ1A 3HFMH 1QLEB 1FZKB 2XKSA 1MPAH 4GKSA 1YI2Q 1HQRB 3TO4A 4AITA 1KGJA 1J8HE 1MCWM 1MUJA 4M7DE 4LF3A 3UZQA 4P4KB 1WCQA 3DOSB 3U1SH 4XPHL 4FQHA 3NZ8B 5KBNC 4Z7NB 1J8HB 5IVOA 1ZLUK 4AZ8B 2OMXA 3MOBH 1NGZA 2DWDA 3EAEA 1J8RA 4O5LL 3RWJB 4QRUB 5I6XC 4JZJC 3APNA 4HBCL 8ATCB 4HVVA 1M7DA 1U8IB 3MUGA 2E4TA 4LASL 1JK8A 7FABH 4HKXA 5L9DL 2B16A 2BOBB 4PSRA 3CSFA 1BXVA 5E8OA 4NOYA 4YDNA 4B50A 3DMMC 4HX1A 2IPKB 2APSA 4ZD3L 1SMAA 3AXLB 4BQCA 4IHOB 1JWUA 4HFUL 1G1CA 3G6JE 1YEGL 1W2BS 3DIFA 4BFEA 1FCGA 1Z9SA 1YEHH 1UXWB 4NLAA 4M78E 3EDEA 4JFSA 3PAZA 1MNDA 2H7WA 3K4AA 3EYOA 4HBQA 1JYXA 1ZEAH 2KZKA 2WQVA 4C58B 4R5VA 3EFSA 2CO2A 5KCOA 1Y1DA 2ZUVA 3T6VA 1YITQ 1NZ9A 32C2A 2JKWA 2E6QA 3QEUB 2F2XA 5B7MA 1J05B 1KTRL 3TH3T 3VAEA 1TFHA 4P2YA 4WEEA 2BHUA 3OYDA 1BLNA 3P4NA 2WKOF 2BSTB 1QR4A 1XSOA 5EDSA 4MQXC 3L08A 4BZ2A 2P8PA 1Y0LB 2Q86B 3OHXA 2DMHA 2JKSA 4KKBD 3M46A 4M77F 1LE5B 2KPWA 2FECI 2KEAA 5E6RB 2X4SA 4LEXL 1EAPB 2OPCA 5F1NB 5L7XH 4M02A 4JJNK 1U92B 3L5XH 3NRQA 2ZXGA 1WT5A 1R3HB 2XTJD 1GYUA 3UJTH 3ULUC 4XP6H 3QUYD 2RD0A 4HIEB 4YBQD 4XVUD 2J88L 4DGIL 5KJ4A 4UQCA 3QHZL 4ZYKA 4YK4C 4JKWA 1RL2A 4FIBA 2AV1A 5D8JL 4Z77B 1B3IA 1MMNA