1Y07A

Crystal structure of the superoxide reductase from treponema pallidum
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
126
structure length
121
Chain Sequence
b'RELSFFLQFFLGMDAPAGSSVACGSEVLRAVPVGTVDAAKEKHIPVVEVHGHEVKVKVGSVAHPMTPEHYIAWVCLKTRKGIQLKELPVDGAPEVTFALTADDQVLEAYEFCNLHGVWSGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords desulfoferrodoxin (rbo)
molecule tags Oxidoreductase
source organism Treponema pallidum subsp. pallidum str. nichols
publication title The first crystal structure of class III superoxide reductase from Treponema pallidum.
pubmed doi rcsb
total genus 22
structure length 121
sequence length 126
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.510 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y07A01
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1y07A02
4BRJA 2JI3A 4BFJA 4BFKA 1VZHA 1Y07A 1DQKA 1DFXA 4BV1A 4BFFA 4C4BA 3QZBA 4BRVA 4BGLA 4BK8A 4C4UA 2HVBA 2AMUA 1VZGA 1DO6A 1VZIA 1DQIA 2JI1A 4D7PA 2JI2A
chains in the Genus database with same CATH superfamily
4PVBA 1JYNA 3K81A 4N2KA 3CLFL 5DC9B 4Z9KB 4WTZG 5H37H 4C56D 2CP2A 4G2AA 1G6VK 2KE9A 2VW4A 3MBEA 5K9OB 4AE1A 2WUCL 1UASA 3G08B 3IGUA 4NI3A 3F12A 4E9QA 2Q86A 3D9AL 1E5UI 3BKYL 1NLBH 3PNRB 4AFQC 1A8JH 4OJCA 2FRWA 3E1ZA 3J07A 1T0NA 1D0XA 4N8PA 2ZOLA 2VASA 2F74A 3SEPA 1W9XA 2JWYA 3Q2CA 3BFWA 4GI9A 1MLCB 3NCBB 3MHXA 3LZFH 2EVGA 3OYAA 3FMGL 4YSEA 4OCWL 3VRIA 1I7UA 4BD3A 1EBAA 1TTCA 2K7PA 2NZ9C 2OULB 3FB5B 4IRJB 2DLFL 4XPBH 2MOGA 4YHPB 5C07E 1IAKA 3VFPB 3VO0A 2OTLA 3T65B 3PE0A 1EEUA 2F61A 3FU7A 3PWPB 4NFCA 4Q74A 1FDLH 3GJFB 3MUGA 3BIKA 3QDJE 4QAMB 3V0FA 3LRLA 2IGTA 3U4EA 1YQ2A 2BE7D 1MHEB 2CO7B 2O72A 4W6YB 5DVNA 1CTOA 4F16A 2WLHA 3G9AB 3LDBC 4R97B 5B1JC 3F70A 2B2XL 3VU3C 3M45A 1M7IA 1H3VA 4EIZC 4AEHL 4BEIA 4G7QB 3RHWF 3HI1A 3G9VA 4N1CA 4LLWA 4D9LL 1XH3A 5EDXA 2PUOB 2PXYC 3SO3B 2WMPA 3MV9B 4G1MB 1A7PH 5DJ8A 3SDAD 3KVPA 1MI5B 4JDEA 5D9SB 1IARB 2DIAA 2OP4L 1YYML 4AG4H 1X6GA 3S6CA 4Y4KB 1X9LA 4OF0A 3W39A 5I1GL 5IT9E 3HG0A 1B0IA 3FEOA 3L5IA 3N55A 2GJZB 4RFNC 4LCWB 3WFEH 3K71B 3UCRA 4RCAA 4BY6B 2RN8A 3VWKC 5IVNA 3SGDI 4L1TA 1EDYA 2G2NA 3TWCH 5E7FA 4GBXB 4NM8L 3ESUF 1UEBA 1KGUA 1W80A 3E9TA 5E6YA 5IQLA 4FL4B 3UMNA 1U2HA 3GK8H 1BP3B 1YN7B 3WTXA 4EN3A 1P1ZB 2E27L 2NCMA 4HS3B 3CXCS 5CXPA 1H3ZA 1OVZA 1S9YA 3BH8A 5LAPA 4S0HA 2X3XD 1RK1B 3K3QA 4RFOL 2YMXH 3OMZA 4JJ5A 1NEZG 4Y1AB 1RERA 4WI5A 4X80L 2KS0A 3D25A 1FFNB 1YEJL 4FIBA 2PU9B 2YARA 3CFCL 2JS2A 4NKDA 3WAJA 3LQZA 1X27A 4TN9A 3BVUA 4H4NA 3TO4B 1I1FA 2DF3A 2K78A 3OG6B 3P30L 4BQCA 5I73C 5IW6A 1Y6MR 3PWVA 3KLQA 2MKWA 2X4UA 3PRZA 1ZHNB 1VIWA 2RO0A 4M7AC 2W88A 5DT1L 3CU1A 5AW5B 2GQHA 4MJ6B 4NZTH 4MD5A 3FN3A 4NNPH 3P0GB 4PRNB 4WFHE 5AW7B 2APVA 3TPKA 4QLWA 1I7UB 3QJFA 2V9TA 4N68A 1A9EB 4QRUA 3V9EA 4KXZH 5ACLA 5E56A 2F1EA 4NERA 3P30H 1ZT1A 4HOZA 5JZ7C 5LJ5f 4U1NA 2R0ZH 1KBPA 3L3OA 4XU1A 3T2PA 3O0RL 1BVKB 3BD5A 3ZE2E 3R7RA 2DYIA 2CUIA 2R29A 1ZEAL 3GKWH 5LXGH 2GHZA 2LP5A 5CBEB 5J3BA 3CQPA 3LNEA 2CZ0B 5H4ZA 2VJ0A 5L9DL 1JV2B 3H53A 3VW3H 2E9GA 3C6LD 3WFCL 3S34H 4AMKH 1RAGB 1D5ZB 4LRNH 2CNYA 4YVUA 2X2UA 3C60C 3O8XB 2H41A 5A0GA 3AZUA 4PW4A 6CGTA 4G8IA 1HHIB 5DJ2A 5D7IE 4C8QD 4CL7A 5J3HC 4U1GB 3BHBB 3DJZA 1CXEA 4GLKA 1UM6H 2NNAB 2YUOA 1T66C 1UJTA 4L29A 5IOPB 3T6QC 4NQXB 1JHTB 1JD9A 3M4GA 4PV9A 4U3HA 2P80A 2VAAA 3P11H 2UX6A 2IAMD 4G82A 1UWXH 4OFIA 3WEBA 2QDVA 1U2YA 2WXGA 2XWJB 4HMEA 1G1YA 4KROC 4OVUA 2KEAA 3BQUB 5JDSB 2L89A 4Z23A 1NCDL 4BYHA 4N8VB 4PUBH 4KGVB 2BIVA 1OGPA 1FLRL 1HESA 1KYDA 5E6IC 4C8QB 1L9NA 4NM4H 1YMHA 3P11L 1X6OA 4I1PA 3JCMX 1UH2A 1P1VA 3VQLA 4J9IA 5BRPA 1NCTA 4Y1AE 3LXAA 4MAUL 3DSFL 4IDJH 3QZWB 1CS6A 3PP4H 3U83A 1Y6NR 1TXQA 3I74A 4OF5A 4KKZA 1BYNA 5BRZE 1PSFA 3D48R 2AZAA 3OYCA 2HH0H 4HU8A 3V2AR 1XB6A 1H0DA 5I66A 3WXWL 3P9WB 2OR7A 5DJCA 3DKMA 3K5SA 3K2IA 5IB3B 3FQNA 3TV3L 1IKOP 2F7PA 4ZW5A 2QQQA 4OI7A 3FC3A 3EH5B 3LQZB 3IMUA 4HGMA 2PW1B 1YCSB 3VFVA 3ILQC 1T20A 4JM4L 4GRLA 4MMXC 1UURA 3AS3A 2CIKA 1U93A 1SF3A 4JM0A 2YD9A 5IW1B 4HJGB 4R2GD 2Q76A 3SQBB 2ZXDA 4FEIA 2I5YL 5K1NA 1V7NL 3INOA 4D9LH 4G7VL 3DDFA 1F56A 2AK1L 5I1HH 1M3AA 5FLVA 2FECL 3QFDB 5CSZB 5FDWA 43C9B 2CAKA 3FUNA 2F15A 3ZE2B 5JO5B 3V0DA 1GBQA 1I1FB 2J43A 2OP4H 5AQ0A 4AG4L 2E9JA 4JM4H 4CVUA 1FFOA 1G94A 1UD6A 2DL3A 2BZ7A 4L8BB 4OLYH 1CKAA 1FIEA 4Y8AA 4ABQA 4L4VB 5IHZA 3DLLA 3I2CL 4AT1B 4KMTH 3KYNA 2JKSA 2ZCZA 1I5LA 5EBLB 2ESVB 3TNNA 2Y7SA 1VA7A 4NO0B 2B9BA 2IOMA 2ZXAA 4JHZA 2BSCA 5D6YA 2BIMA 2VLLB 3GT6A 4K3HA 3H7BA 2AJUL 2H0EA 1U8LA 4POZC 1X5JA 5A6IA 1WVZA 2F53E 4B97A 4L4VA 4OLWL 3I2CH 2G5UA 4TRPL 4JFDE 5DC2A 2EQJA 5DM7R 4QCIB 2Z92B 3HZVA 3NSCA 2H0FA 4N22A 4XBGB 3SE4A 3V6ZA 2IH3B 2WLYA 3CC5B 4WUUA 1K8DA 2C9UA 4LXFA 1MUZA 4IOIA 5KAQG 4XHQA 2RIKA 3VXMB 5KUKA 3DO3A 3U4EB 1CQYA 2FWUA 5GMKm 3TASA 5I76B 3S3OA 4UIKL 4N1HB 4PTUB 1VQ4T 1ITBB 4TVPD 3F7YB 2GFAA 4P9HL 3IMBA 2Z31A 4OCNC 1S9WB 4BE5A 2GBVA 4G6AD 3U46B 4AG2C 4U4BA 1QW8A 1YCSA 2K9GA 5G55A 1A6PA 4PU2A 1KT2A 2F74B 4Q89A 4MZIA 4U7MA 1I7RA 2DM7A 4R7XA 1QBLL 1MELA 3NJKA 3GXPA 1JZ5A 4ZMPA 1H15B 4P99A 1HDMA 4UYQA 5GS0D 1RUMH 4M7AD 4PJEE 3KWTA 4D0BB 5FEBA 2YBGA 2WZ5A 1S5HB 5DUBB 4DWHA 3RNKB 1P4IH 2XD0A 3SYAA 5B1BB 2KLSA 2X42A 5D7LD 1CFMA 5HY6A 3GYRA 2QPFA 4H8PA 3OWRA 5HKCA 2GB2A 3V8LA 1FNLA 1I3VA 2P5WB 3TBWB 3FQTA 1MLCA 2V2TB 4RA3A 1RURL 2FWSA 3PWNA 3ULVH 1A4AA 1VADB 3IJSB 2QVMA 1FGNL 3REWA 1KDJA 2H32H 3QZ9B 1DCLA 3N40P 3QULA 1KJMB 3A3YB 3NCJL 4OMNA 1PSKL 4NP4L 4BGDA 1NH6A 2VDQH 2GAZB 1XTLA 4FFYH 4K5OA 4PRAA 5KJRH 3RERA 1ACXA 3D2UB 5DFVD 3T4YB 4K11A 1NGXA 4E0RA 2HTKC 1FNGA 4S0TD 1SDDB 4JQIL 4X6FA 5I75C 4R7DB 5B7EA 1FLRH 2WLJA 1D5XA 4RGMB 4K7PL 5B38G 1SYVB 4AZ8B 4UTAH 2QZQA 2IGFH 1UUEA 3EOAB 3MNZA 2ZAEA 2FEJA 1QFWI 3MREA 3KLHD 4IK7A 4P2YA 2P48B 3IU3B 4YHKH 4OZFG 4U6VL 1G9HA 5LJ3d 1YEKH 1PPIA 5KN5B 1WPYA 4FMFA 3K46A 1WGOA 2KXCA 3I6LD 4QNPF 3JT0A 4K5PA 4QVDA 4ZOBA 2RHXA 1LXMA 2HKFL 3E1F1 3GXTA 4RISL 5E08H 4XVJL 3L5WA 2P8LA 5CR8A 1DVQA 4TNVF 1IGML 2ZUXA 1X7TA 3VQ1C 5MENE 2QSTA 3Q5TA 5FV1L 3FH8A 5H35A 1I1JA 3J81E 2A9MH 3CBRA 4G3YH 4H5SA 5DEGA 4CILA 1SF5A 2DN7A 4D94A 1HCVA 1TVHB 3EW3B 1TQTA 4PCYA 4PM1A 4AFSC 2Y9RT 2K0RA 3X3GH 3ARDD 4L3CA 4ICWA 4MA7L 3EJYC 1AP2B 2CDFB 4EI6A 4HFWA 2WUBL 1M90R 2L3BA 1M57B 3FCTB 4Z7UE 1SPDA 1K3IA 1A66A 3U9UB 1U6AL 2J72A 4G3YL 4AYSA 2I07B 4DVBB 2HX8A 5I82A 5E6UB 3SDCA 1RK1A 1RFDH 3II1A 3P8BB 1CMOA 3LEVH 2IQ9H 2GITA 4C0GA 2DMKA 2FUQA 2Z35B 3HFML 4TNWK 1KC8C 3H0FA 4NQEB 4DKEL 1LWHA 1KIPA 3MLWL 1SY6A 4L8SA 3O0RH 1NPPA 5I1DA 2N56A 4PJAB 3KBPA 5F93C 1FV1A 2WLNA 2QYZA 1NM9A 4Z3FA 2NX5E 1KUMA 1I9IL 1X9QA 2DICA 2KMTA 4AYFA 4MRBA 5EZJA 2WYHA 5GGSA 4IIZA 2WQ8A 4YDJB 3ME0A 1IKNA 4K8RL 5I9QC 4FNLL 4NKOB 4BFKA 4W4OA 1PKQE 5AUMA 5DMIH 2R4SL 4F7TA 4KUDK 1IAII 1JTOA 1VQ8Q 2GVYA 3FHQA 2PVGB 2X1QA 4UILL 3L4UA 1UUSA 5IJBC 2CBTA 1D5IL 1BI2A 4ZUVB 5BZDA 5C9KA 1WHMA 5D4QA 1YUHB 3HRSA 1F41A 2YAEA 3BUBA 4GO9A 4N24A 5AOMA 2E3IA 5CQXA 3BW1A 2XFXA 2WINA 3L3GB 3O2DL 4E9LA 3DRTB 3PABB 5IEHA 3I56A 3CCLQ 3E6FA 32C2B 3KPSB 3NIGE 5F21B 2BC4B 3CN0A 4N2CA 2QQRA 3RKYA 1NYFA 4U6HA 2DQUH 4FNRA 1YNTF 2VLJD 5I5JA 3VU1A 3EG1A 3HNVH 1DQLL 3BSZL 2J21A 3DSFH 4GRWE 4IDJL 2WZAA 4K4KA 2YXYA 3MRPB 4S1SL 3BDYH 2KGTA 3IBOA 3GDBA 4N0YH 5EIIA 4PHXA 3LIZL 2KI7A 4H20L 2B20A 1A4BA 1SUHA 3OKKA 3P4OA 3Q44A 2E8YA 4NQDE 1A0QH 3AAZB 5IMMB 2NLJB 5KS9B 3G5YA 1I8LA 3HNVL 1FNAA 3LZFL 4LPTA 1T0OA 3FMGH 5KYUA 3BPOB 2X9YA 3STBA 2AHJB 3TFKC 2J7IA 2FUTA 2X4NB 3LV3B 4ZMZA 2JKTM 4WTXA 3K6OA 1AQKL 4DNLA 1T03L 4N6RB 3U0WH 4PGEA 2BZCA 2R4RH 1PD6A 4QHLB 3QWNA 3UMTA 1R0AL 4W68A 4XOAA 4ORZC 3IETA 2B0SH 4QLRA 3NP3A 1KULA 2RBLA 5D1ZI 1H3GA 3IJ8A 3ULAB 5HK3A 2VMJA 4KPHL 4APXB 5AOJA 1WJSA 4WK4B 4OT1L 5FYLL 5T3XL 1AXSA 2QGCA 3BAEL 4NYLB 4AEHH 5B3NA 5JZ7D 3EOBA 3PGCB 5EN2A 1T7YA 4WY7L 3QJXA 1FHNA 4E7KA 2A7YA 1ETB1 5FYKD 5BCAA 4HIIB 5HHNB 5D6XA 1WHHA 3RL2B 4XTVA 2EW3A 4K23L 5D70L 3WO4B 1SJHB 2EIJB 3WAKA 4N0FA 1PNCA 5BQ7B 4L8DA 2VL4A 3N42F 1ET5A 2IDCA 4MJ4A 5EOQL 1FNHA 2NUTA 3LRSA 3ZO9A 3CAFA 4F20A 4PLJD 2BWQA 5JW4N 4LLQB 2EGAA 2YD7A 1MW1A 1DVFD 3FH5A 5I6LA 1IVLA 2OMYB 2AAVA 5FKPA 4OY9A 3MLZH 3RVXD 1AAJA 5CR1A 5H37G 3K1DA 2WNWA 1JFQL 1SZNA 4HFUL 1TTGA 2W38A 3PL6C 4AM0A 3FTXA 3UWNA 1RL2A 1IE4A 4UM9A 4YXHL 4DGVH 1RACB 1EDHA 5CZKA 2HUEA 1HE8A 1FZMB 4O51A 3DX3A 4FFWC 4YFLI 3REAB 1PZ3A 4X9CA 3RLSA 1J5CA 2ZAHA 3QFJB 1XCQB 2HRGA 1JS4A 4XNUL 3QRBA 1CICD 4R4ND 4A55A 2Z7ZA 1NFDF 1K4DA 2D7QA 4AZ8A 5KS9F 1P6FA 1XFPA 1HS6A 4X4ZA 5DO8A 4DEYA 3ZY7A 3BXNB 1KQSP 2KERA 3MLWH 1J1OH 2HVKB 4OZFA 1D3CA 4L4TD 1GHFH 3M88A 4O2CA 2KH2B 1LO0L 4ZTPL 1SJMA 1P4IL 1PG7X 1CGTA 1G2BA 3VMNA 3GBEA 3H41A 4PG9A 3RUGA 4F5CE 1WBXA 3HE7A 1CG9B 5HGBB 3DETC 2WLZA 1I31A 1DJIA 2YMTA 4ANVA 1AQMA 1SJVA 5DMIL 1H641 2P7TA 5DRWA 2LHAA 2QPEB 4L59A 3KPPA 4FZ8H 3SJVA 1ZEAH 2BSTA 1AIFA 1SDAB 1KTDB 2ZKYA 2WSPA 2VLKB 2YAPA 2HL3A 3G5YB 4P49A 3AAZA 1NMCB 2CR3A 4JG5A 5D4JA 3RY4A 1CD1A 3DV6A 3LHPL 4Z95L 5CBAA 2ALAA 3ZTEA 3O6ML 4GUQA 5IBTL 1MCJA 3URGA 3VXOA 3QISA 4BSWA 3QQ4A 5F88A 3GHBH 5K39B 8AT1B 1K9MC 1NANI 3NOIA 5AAMA 3T8MA 2K5LA 1AZRA 3HPLB 4E2FB 5JOEA 1TO5A 3N9GH 1HQ4A 1A7RH 3QIWD 4ZPVB 3ARPA 4KO5A 1UB5B 3OQ5A 1EZVX 2ZOWA 4G1EA 3RZWA 1WI7A 3G5WA 4JGUA 4XNAA 4EDXA 1S7RA 2HLAB 4JFDD 5AWNL 1YEHL 4P5TD 3MV9D 1BVNT 4WI6A 2IPKA 4PJAF 4B9FA 1CLZH 4YWGL 2DQGL 1VQPQ 2EDEA 3O2WL 4OFYA 3VRJA 3LIZH 3Q48A 1A1MA 3OB0H 1CICC 1YYCA 2XWDA 4N4YB 4EUPB 1GGCL 4C92D 2X7LA 3VFSA 2FHFA 1CF8L 2YJQA 1C7SA 4B7LA 3G5ZB 4YGVA 3PP4L 1O7DE 4HS8L 3U7AA 3H6JA 5I1IH 4HIHA 1D9KC 2IALA 3D06A 1MHHB 3KJ4C 2EFIA 3D39E 2EPDA 3ISWA 3MZGB 4Q2ZA 1E7OA 2KRSA 4NFBA 4QHNA 3WTWA 2DZEA 4HIJB 1T0JA 2DQHH 5EF2A 3RIRA 3TBTB 1R5VB 2VITA 4FU6A 2O5YL 4IU2B 1KQSA 4NIKB 1JF6A 1SLVA 4KUZH 5I1AA 2ROTA 1KCLA 4H0GA 1JWSA 4P23C 4ZMOA 4JMXA 1JD7A 1BQLH 4QYAA 5BUAA 1FZJA 4LK4A 5C0IA 1ND0A 3M9QA 1M1SA 2OPCA 1QI3A 1UT1A 5AB1A 5A2KH 1ZV2A 1KSRA 2CO4A 3VVWA 4PRBA 3DJTA 3DXAB 3BYTA 4QRRD 3F7RA 4IRZA 5EOQH 3GLXA 1ORQA 2PPCA 1C6VX 1DQQA 2CU9A 5GANf 3EBIA 3MACH 4O4YL 3I6SA 2BSED 1QLEL 1LVKA 3FUDA 5GRVL 5IMOB 3BCFA 4NT6A 3MRDB 3QIUB 1FVCB 4P2OC 4MDIB 4XP5L 1KCSH 1HEHC 3BZ4A 3M6DA 1G87A 1OP5H 5C0GA 3NJMA 1MPAH 4PJOF 3VXUB 1Y7VA 5GSRA 1URIA 4J3SA 2VERN 1WIOA 4KQ4L 4O4YH 1FO0L 4HXAL 4QRRB 1KPUB 3CCJA 5TDNB 3STLB 4K9EL 4QW2A 3PDGA 3P9MB 4ETQB 2Q6WA 3MGOA 4PY7A 3WN5C 2WIIB 5F7YC 2F5KA 5LKNA 1U91A 3HS0A 4PIBA 4YFDB 1KB9K 2Z4TA 3P0VL 5D7JD 1W0VA 4KJWD 1HINH 1XQ4A 5IHNA 2DD5A 4MJ5B 5T1DH 1O6SA 3VYGA 4M8QB 4U0RC 1OAZH 4TULH 3VXUD 5GGUA 1HTYA 3ABMB 1YCYA 4N0AA 1I1CA 2D03L 1TMCB 3WUWG 1WFIA 2AK4A 2L0DA 2J2ZA 4B9CA 2QR0B 1LNUB 2GG1A 2K4AA 3VXPB 3C6SB 4OB5L 2DWXA 3BT0A 5GMKe 3IPFA 5ESVA 3F64A 4MQ7A 1KIRB 4KO6A 4B9KC 4M77E 3RX8A 1VJSA 5IFJA 1JO8A 3QNZA 4JDVB 1E4WH 1A6WL 2BVOB 2Z8SA 4PJBA 3TBYB 5M7QA 3VI3B 4M77F 1N5AA 1K3ZA 1ZLVK 3ALPA 3V7CA 5T8IA 3UROR 3NFSL 5HYJE 2D7TL 2EECA 4BFJA 4JZNB 2DW5A 3AREB 4LOUD 2UXVA 1UA6L 1S6NA 2CP6A 5AW2B 5KYYB 3R1GH 5HYJD 3QJVB 2H1PH 1M9SA 3UABA 3VTMA 1UZ8A 5TK4A 2G0KA 3VGBA 1N6UA 3CVHB 4PP1C 4PIRF 2A1WL 1PG7W 1S9VA 3QJOA 3RIAK 1XF3B 1KGJA 4ZO6A 2E1HA 1I7ZA 4FYRA 2RFXB 5DRZA 1EAPA 1QSZA 2QVTA 4MD5B 4D0BA 2J8HA 1DJSA 1VB9A 1T3FA 2FWOB 4RMWA 5F44A 5L0QB 3K4DA 3VG9B 1FFPB 2JFCA 5JPNB 1ZHNA 1E2VA 3N41F 3E9FA 3VS4A 2B5IB 3QNFA 2DLEA 2BSRA 4XI5C 3TA3A 3T2QA 2EIEA 1RCYA 5HHOB 1HH9A 5PCYA 4GO6B 4JM2D 3QXVA 2JQZA 2YGNA 5CGTA 1MFBH 4LU5L 2AQ3A 3N04A 3N40F 2YQ3A 1AKJD 3OKOB 1RZKL 3HE6C 1MCHA 1DQQB 4LD9K 3H8NA 2V8KA 4TVPL 1OV8A 5E1AB 2OXHA 3BQUC 1AOZA 3BD4A 2R1XA 4B0MB 5KYWA 3RR6A 1PDKA 2FJFB 3L16A 4NQDA 2W59A 4QF1B 4OD3L 1P5VB 3CVIL 3GTVA 5AZ2L 2VLRB 1JGEA 4NQCD 5EG6C 3UBXA 4XCFH 4WKZA 1IZKA 1E27A 2HPTA 5JQIB 4G71B 1G9NL 2OR8A 4E7SA 1BDYA 2CO1A 3HHRB 4J6XA 1IGMH 4M7LL 3U4KA 2WO2B 2O5YH 4A39A 4GT7A 3F83A 3EXJA 2D8KA 3DBSA 4L9LB 3OG4B 1FYNA 5DZAA 5HGGS 2Y6SD 4IGBA 4J3XA 5LG1A 5I30H 4LEOA 4N0AC 4IKFA 4LQ1A 3WS6C 3OXRA 1E6JH 4GSDL 2WBJA 3H42H 2UWEE 5HJBA 1EEYB 2NR6A 3HAEH 1JTPA 4Z02A 4NQCB 1XH3B 2BINA 2CBMA 5ENWB 4OH2A 1U1SA 1BKBA 2BZYA 1NPUA 3ROOA 2R29H 3KYNB 4YDVB 2ZPGB 4Y9GA 1RZGB 3N0PB 3MLXH 4E9VA 3KXTA 1UJ3C 2C9VA 3Q9PA 2ZXEB 3D85D 3RNJA 3A24A 2JTFA 1LK3L 3HNTL 3MU3A 4EUPA 1GSKA 2J8UA 4IJ3C 2DM3A 4YUEH 5FDWB 2AJXH 2NY3C 3U23A 3EH3B 4DIXA 1CTNA 3HMWH 1MFAH 5FXCH 4GG8A 4M03A 3BUIA 1OPKA 4Y7OC 4ABVA 2F8VA 3SCMB 1IC4L 2ECZA 4LUEA 5F71A 3SDCC 2HZYA 4TUJA 2EIKB 2EDXA 2FRYA 1DQIA 1NEBA 1M90C 3FPXA 2EILB 2PW1A 3VFVB 3QEHA 2DO3A 4YBLB 2AV1A 5HDBE 4L0ZA 3RY5A 1UGVA 1G0XA 1ETZB 2VSMB 3FB6A 3GGWA 2JXMA 3IBEA 5CO1A 3FQNB 2H8PA 1HJCA 3P8DA 4BSWB 5DFTA 4N2EA 2OJEA 2XFGB 1XF2A 5KG9A 3BE1H 4PRPE 5EF1A 2DA9A 4NC1C 3VCLA 4DW2H 5INDB 4M7KL 1TYEB 3ORJA 5JPNA 2PW2B 4PG2A 2XY2A 5FB8A 1G7JB 2WTRA 3X14B 1KGWA 2VO8A 3IDYC 4IHOA 3C87A 2XWZA 3EFDH 5DURD 2Q8AL 3VFWA 5I18H 1EAPB 4NPJA 2RFXA 3C60D 2CHZA 5AL0A 1H3TA 3GSQB 1MZZA 5E9NA 1MCOL 1BBDL 5CMAB 3HZYA 3T6VA 3WEXB 2F2VA 1ZA3B 2QQSA 3P3TA 1NGYB 5DJZA 1FMVA 1LP9E 5JXED 2V1RA 1B90A 1XH2A 2GY7B 2JCWA 4TNWF 2D0GA 5L8KB 3QDFA 2ZKWA 3JCMP 3BAJA 4OCLC 2P42B 4RZKA 1VENA 4QQDA 1BQUA 3FF8A 4K5MA 3L6FB 3MJGX 3FQUB 3QNXA 3OYEA 3CMAT 5CHNA 5I0WA 1QO3A 3H0TA 4XNQA 1R17A 2QKIB 2QELA 4OMFB 5I1IL 1IBHA 2GC7C 1YHQT 1YDPA 3G6DL 3DI3B 2A1WH 1Z9QA 4KNSA 1OLZA 5D93C 4C92E 3MRBA 4JGJA 1G1KA 1V1CA 1IC5H 3I3BA 2N4IA 4UZUA 1DEDA 5GZOA 3FKUS 5SWZD 1NCHA 4J3OH 4QXTB 3EO0B 3K0YA 1YA5A 3RA7L 2AGJL 2HJKB 3G3LA 3L3OB 4KXAA 2QADC 4ZFOB 2Y36H 1QLFB 2UYLB 3VGHA 1F0LA 5KAQF 1PFCA 1R3KB 1U4EA 4G8GA 2AS5M 2DBJA 2EVHA 4JO4L 3HG2A 2VM4A 2XXGA 2UXTA 1NDMB 3QJFB 2Y25A 4AGQA 3PVQA 4NS0A 4WW2B 1TYJA 2K6ZA 3LKSA 2DRKA 4MJ6A 1OE3A 2AZSA 4LF3A 3WJLA 1IT9H 3A6CH 4TVPH 4X4YA 3CIAA 1HJBC 1QPXA 1HHKB 4WGWB 1DL7L 4HKXA 5E5UB 5IW6B 2ITDB 3BO8A 1CFBA 4K23H 4NBXB 4JREC 4N0FB 1HXMA 3Q2VA 3TJHD 4LGRB 3WVEB 1YHPA 3X13A 4GP4B 5C2UB 1YAIA 1T04B 5E4EC 4ZD3H 1ZANH 1ZTXE 4JFFB 5CCKL 1WFNA 1FVCA 1G7MB 1SOXA 3GBNL 1J12A 3H9SD 3J7HA 3REVA 3S3DB 5EZIL 1KIUA 1IT9L 3OYFA 3BDBA 3NFPA 2D9TA 1UJYA 3BAKA 4JRIA 3B2XA 5HYSA 4L48A 1VQNQ 3IKKA 4QD2E 3D07A 3NHNA 4FI7A 3BPOC 3KYOB 4FW2A 4ODUB 1C5DA 3RTLA 5AD0B 2UWEF 1JF1A 5D1XA 3FT1A 3TVTA 1OAZL 4TULL 4E9RA 1MDAA 3UACA 4X9HA 2DJZA 1CIUA 1FHGA 1HHHA 3QW9A 5CAIA 5DJAA 2AABL 3VU2A 2E5KA 1SRMA 4IMLA 5EOTA 4PCKA 1GGIH 4MCYB 1CDYA 5HGAA 1WBYB 2YFOA 3JCMJ 1VFAA 2R27A 2ZUWA 5CR2A 3HC4H 4KHTL 3NTHA 1ZLVH 3IJYA 4L5GA 1DUZB 1QWEA 4KDWA 1Q1JH 4QGTA 2NY6D 5EIQA 4E2OA 5K69A 2WSFE 1YJWT 3QORD 5F96H 1IFRA 5FLXE 3BH9A 3W38A 4N0CC 4XHJD 1INDL 1UH4A 3IDMA 4C5GA 5KTEL 4F7CA 3DX2A 5A7EA 1XGPA 3QJUB 7CGTA 4RMVA 3SDXE 2NY3D 1F86A 3V6FB 1ZHLB 4Q9QH 1OCCB 1T4KA 1DJYA 2QA4A 4UV7L 5F7WC 1B2WH 3T65A 1SJXA 2HJFA 4P48A 5HGHB 3KLAA 5HHXL 1YUHA 1MF2L 4FC3E 3VD2A 4PJOD 4PJBE 2ATCB 4EDWL 5BZDB 7FABL 5C0CB 3UBFA 1J1XH 4KNQA 3KVDD 3OBYA 1YPZA 3S36X 4OD1H 3DX4A 1FORL 1SMDA 3STZA 2O6FA 5DFWH 4RRPG 2AAAA 2XRAH 3EYSH 1L7TL 2ADGB 3JB9G 5DTFB 4HXJA 1MCSA 4DGIL 5HD8C 1Z9PA 1ACCA 4CMHB 4MXVF 2JIXD 3N1PC 1T89A 1MFBL 4LU5H 3D2UD 3I56T 5F3FA 3RVVC 1BX2A 2D0FA 2O5ZL 2XQ0A 3EJRA 5EA0L 5JLZA 2V3FA 1MJUL 4AVJA 2L5QA 3IE4A 3L1OH 3I5RA 2FJHB 4OD2B 2A6JB 3T4AA 1E5CA 2BCMA 1E43A 4PJ8D 5BS0A 2IADA 3KL5A 4ODUA 4FFWD 4RSYA 1N5ZA 3DARA 3IFLL 2M1HA 2DYSB 4HZAA 4PP2A 2J5LB 4HT1L 1NGPL 2GPZA 2I07A 3FDWA 2VWFA 3OL2A 3UAEA 1YN6A 1MCEA 1W8OA 3B9KD 1S72T 1OGAD 1N7MH 4BQ6A 4E36A 5IXFA 3OKLB 3QJHA 1M2OA 1BIHA 5IHBA 4HVWA 3IVKB 1KD1U 2IQAB 2CO2A 5GGVY 3H42L 1XR9B 1TH7A 3BKCH 4JZOA 4O6JA 1MIMH 1O6TA 3GRWA 5EU4B 3EH1A 5DHMC 1UACL 4D8DA 3ESOA 4OGXH 5T1MB 1WSST 4WI2A 2MI6A 3NMZC 4JVWA 4KUZL 2V5RA 5TK2A 1DQKA 1D09B 3KD4A 1JVKA 4P4RA 1SVBA 4A67A 4HA1A 2YXVA 5JPMC 5IZ7A 4XP9L 1R3LB 5DFVC 1DL7H 1JGUH 1YBYA 4U1KA 1F1AA 2DLIA 1X5IA 1ADQA 3QCVL 4HOXA 3IDXH 4L3EA 3GPSA 4ZD3L 4MA1C 5GGTA 3RDTC 2X2YA 4PP2B 4WFGD 1E5AA 5IOKA 4JO8A 4D9RD 4J7FA 2IIMA 3OZKA 4AKPA 3L9RB 5ERWB 3LQAC 4TLUA 4J9GA 2IPUK 1ASPA 2BSSA 4QHPA 2ERJC 3VFMB 1SYVA 3NJGA 4LLAA 3NRFA 4X0KB 1D5XB 2GEEA 2A6JA 2JB6A 2FX8L 1U36A 4BFGA 2A6DB 5HJDA 1OGAA 3EFSA 4HHAA 3UH8A 4IEFA 3B9KA 4M7KH 3NA4A 1JNLL 1CGUA 3LZPA 4G5ZH 3CDGB 1FO0H 4IBSA 5FCUL 4WUKL 4ZW6A 4N9OB 2EUVA 1YNLL 2PYFA 2NUPB 3IJHB 2Z65C 2VTFA 3GI8L 1SY6H 2EBPA 3CCSA 3MRFB 1Q86U 1IQWL 2OTLT 1EMTL 1F18A 1NIAA 2FX9H 1YJNQ 5HPMB 3JXAA 2D4FA 2XQBL 5FUCE 2K79A 3KLDA 3ZBMA 5CUSL 4AYDC 3LH5A 4ZSOE 2NW3A 4AEEA 3UF4A 2Y7NA 4OD2A 2OQJA 3RY6C 3CCUQ 4WEMB 4YXLH 2B8OT 3UPAA 1N9PA 4BKLA 1F11B 4DUXA 3QO1B 4JFXB 2LAAA 2YEQA 2DJSA 3RNKA 3VX1A 2GCYB 4ESRA 4ZPTB 2WLMA 2LNHB 2CBQA 3VSUA 3T8XB 2DXBA 4LSQH 2VT0A 1TQSA 4MGXA 1ICTA 2AQ1A 2O1AA 4MJIB 4U1HB 4AVHA 3B2MA 4JRLA 1T22B 3VXUE 3NSYA 4B9YA 3CK0L 4OZIA 4LDOB 3MDJA 4Q9RL 5F7EH 4J3UA 3N85L 5AVUB 5DMJB 1DBAH 1RV6X 2P0KA 1MVUB 2EDLA 3K72B 3CCMA 2XG5B 2KQWA 1XZWA 1VQ6A 3GSNA 5DVPA 5IHKA 1UGKA 1YNTA 1T83A 2IVFC 4WHYG 5D7LE 5JUEL 3SE9L 3IN2A 3QCUL 4RMQA 2N1KA 3UPUA 3IXTB 4OGYL 3VG9C 4Q7DA 2P4AB 1K4US 4YIQA 2YZ1A 1LDSA 1P6WA 1BFTA 4FKEA 3RBGA 3SB3A 2V7NB 4S1DC 2HG5A 3OYIA 3CD6A 2D7NA 3OVUB 2APTA 2Z4QB 1QR1B 5CN3A 3AROA 1CD0A 1JGDA 2BVQA 1M4KA 1SMAA 3FT9A 3V4VB 2WLIA 1RZGA 2OCCB 5FM8A 2QSVA 3VS0A 1VQ9Q 1I1RA 4GP5B 3O6FB 4Z7VF 2BUDA 4Z7IA 5AUMB 1UH3A 2FECI 1TKWA 5J57B 4PS3A 2VLKE 4CN4A 1I85C 3ME0B 3RIAF 2BIHA 5KWYC 1BYPA 1E67A 5EBLA 5KCHA 1UQSA 4PS4L 4D8OA 3N0AA 4XE5B 3WTYA 3CWGA 5T1LD 2QA4Q 2X4SA 1X5HA 4FQJL 1I0CA 1FFOB 4RTXA 2BP5M 1GZPA 3MV7A 1PC0A 1QBMH 4XCNA 5E4IA 4B27A 1TWBA 5JW5B 2P24B 4NPYA 1DQJA 2VLRA 3GSXB 3UBXB 5JHAA 1AJ7L 1PZAA 1P5VA 2Y07H 5IB5B 1QWUA 2G2RB 2XN1A 1H8SA 3PGFL 3FCUB 4OM0L 1E9QB 2WBWB 4WW2A 1UKTA 2QL1A 2DBLH 3H3PH 3JT2A 1KYOJ 5E2UH 3RZCA 1KIUB 3ZX1A 1JV5A 4NQSA 1IFHL 2CLVB 3HN8A 1N2RB 1Z9OA 1GJWA 2YPVH 4JFFA 1CFQA 5DMGC 2VJXA 3LH2H 1JXDA 2PPDA 2IEPA 4CJ0A 2CALA 3VA6A 2NY7L 2BSRB 1I8MB 3Q2LA 5DMYA 1YC8A 3AY2A 4JJBA 1BSIA 1OM3L 4OUOA 3TV8A 5BRZB 5ICYA 3PAZA 3OYLA 3OM3B 1FFRA 3IDXL 1HK9A 2P45B 4DGYH 5FECA 3JTBA 2X51A 2WWOA 4ZMNA 2WQSA 2D3NA 3OYDA 5HI5D 1HC1A 4XNZC 4WU7B 4PJ6A 1FAIH 2X89D 3KDPB 1FZKB 1WWAX 2MKLC 3MLVH 3QIUC 4LVHB 4YAQA 2RCSL 3VSVA 3JZ7A 3GF8A 3L6FA 4DERA 2VABA 2VB5A 1YJNT 2HVBA 4NBYB 4P4KA 5C0AA 1ZSHA 1MFAL 1J8SA 2P0PA 5SWZA 4F37K 3CBKB 2J88L 4OCYH 4N3TA 1IM3D 4Z7QE 5GRXG 1VEPA 1OAKH 4AIZB 1XSOA 2YHGA 3CCUT 4J3OC 3DI2B 3M0RA 5EV7A 4QOKB 1AFVL 1B3IA 1TCMA 3VTTA 4PJIB 3EOAA 4GAJL 3V0JA 4BSJA 4EPCA 2IF7A 1T7ZA 4O02A 2VRQA 2HBPA 3ARFB 3KEHA 4OF7A 1MMAA 1QZ1A 4KZEL 4CVZB 1HHIA 5DJ2B 1CR9H 4L9LC 3AC0A 1FNGB 4PWIA 3QXAB 4OFDA 2MQGA 2HA1A 3C6SA 4XNYL 2NZ9D 3V52H 4CC2A 3IT8D 1EO8L 3V4UH 2DVEA 1EHXA 2HKAA 4WKXA 4L4TE 4LP8A 4PJGF 5I1JL 4G6FB 2PPEA 1OP3K 3CN1A 4PJEA 5I0XA 3E0GA 1IJ9A 1DANT 5ID0B 2DYBA 1A9BB 3EJCA 5BV7L 3FB7B 1WEJH 3FJTA 4LPCA 2NY1B 4K5LA 5DGRA 2YBRA 2CJTA 2Q9OA 3FRPG 4KKBD 2J6KA 3K6NA 3QZBA 1AZVA 3HB3D 4TYUA 5AENA 5E5MA 1ZHLA 3LGFA 1SXCA 1TQUA 4IBQA 3I55T 4P5TB 3ZYZA 2LT1A 3IGAA 4XB7A 1XF2B 4GKZB 4IQHA 5SV4A 3RPIB 2WBKA 2AEPH 2F8IA 3T2NL 3BDXA 2HRLA 1V3KA 2LQNA 3WKMH 1NYGA 4AC2A 1DO5A 2WCGA 3NA9H 2OX7A 2V17H 2HFGH 1D5RA 2A5UA 4G9FD 4MA3A 1N3NB 3L81A 5JIKA 1VFMA 3TYGL 5H94B 3UEQA 2OMNA 1JNNH 4WWPA 1UXWA 3QSKB 1WAAA 1H6TA 3T9WA 1Q9LB 4ZW7A 5LAXB 4JAMA 3IDIA 4LHUD 2O5XH 3V5KA 3S8WA 1UFFA 3BUYB 1VQ8T 3BZDA 4PKCC 4XX5A 5CGBA 2P4TA 1CUOA 2K70A 3SYQA 3BN9D 3RDJA 4OKVA 3MRHA 2L4OA 4IDLA 4J3OF 3CC5A 1TIUA 4TXVB 5T1LB 3FAWA 4C0ZA 4XN1A 2E8ZA 1FVDB 4RFEB 5CGYC 1SEMA 3ABKB 5KVGE 2GJJA 2OKMA 1R5WB 2LU3A 2AZVA 3S5LB 4MA1B 4YDVA 3TCTA 1OX8A 3CVBA 4M8UA 3MZTA 4MDJB 4J2QA 1SBSH 4OLEA 5CK9A 1ASOA 1E40A 1MAML 4NQDB 1NCCH 5HI4D 4HUWA 4YE4H 3VS6A 2DYPD 2KZKA 2PXYD 3MJ7A 1WV7T 2ODHA 4IGBD 2Y07L 4NCC1 4PS7A 5IG7B 3O3EB 2WIMA 2E56A 3BPCA 1P4BH 3BEWA 4C8XA 5J1AB 2UZIL 3LOWA 4YSDA 1DTUA 3CMEQ 3OAUH 3I75B 4M7LT 5EZIH 5TH2B 1GSMA 3FQ4A 3P4NB 2WQXA 5IBLD 4Q6IB 4YBHA 1YITT 1MRFH 4KK9D 1SHFA 5IREA 5CSZA 12E8H 1OTTC 2VZTA 4ODVL 4NQDD 4PJDE 1EUTA 1IKFL 1NCNA 4IW4C 4L5FH 3FN9A 3A0OA 3U4BH 1Y07A 3W2DH 2ED1A 5CUSH 4Z7WF 2Y2YA 4KUCF 3RWFA 3HN5A 3FB5A 3LB6D 4XTZA 4YHPA 3S35X 2IANE 5D7UA 4N2AA 4KMQA 1HYOA 5C9JB 2YPLD 4FG2A 3IWVA 4H26A 4EIUA 4FM4B 1YIJQ 1C1AA 1S72A 2P84A 4KVCH 5HYQB 2B15A 4DP9X 4ZW8A 2KXDA 1LO3L 1F42A 4MHHG 5HHOA 1XGUB 5IQ9A 4EMZA 2XKSA 5E9DB 3KW7A 1X5FA 3LKPA 2RK2A 4IMKC 4W81A 5A2LH 2Q3ZA 1TLMA 4XPTH 1SEBB 4HLJA 2ZCLL 1H8OA 3WHXB 2P52A 4JQXC 3AQDA 3FTZA 3HPJA 1LE5B 2YR3A 4P07A 3BKYH 5F96L 2F54E 3HUJA 1ZGLM 3NCYP 2BM3A 4UU9A 2J6WA 2VDMH 5GS2D 5GAN2 2E46A 2W07B 3ASKA 4JKLA 4GEIA 1JGLL 2X6AA 2OAAA 2COZA 1WJ3A 3II2A 1ZXQA 1NC4A 3Q13A 3QDGB 4KJYB 2VW6A 2R69A 2EAYA 5TQ0H 1ZMYA 2AEWA 1AGEB 2MTPA 1B2WL 1I3GL 1FPTH 3U25A 2Z0WA 2XWJA 1J5OH 4XMWA 1QQDA 2R7EB 2YOAA 1RPKA 1KYUA 2EIZA 1F4YH 3Q5YA 2GTOA 2EH7H 3MPUB 4I7ZC 4PJOE 3TESA 1KTCA 2ZP9A 1PG7L 2ICEA 1BZOA 4XOBA 3B83A 3FZUD 4PW3A 4BV1A 1R3IH 3CIQA 4I5BA 4NWUL 3GUTB 2YPLA 3H56A 4FI8A 1ZHKA 1LEKB 1N27A 3JWDL 1J0HA 2LVCA 4YDIH 1BQ5A 3NTKA 1FYTE 4CMMA 3OS5A 5CKAA 3FUIA 3DX6B 4D0CA 3ARUA 4W70A 4JE4B 4N2GA 1FSKB 3GTTA 2DQIH 1UYWH 1EFXB 1Y0LB 3SPGA 4JJHA 4LLUB 3BE3A 3VXUA 1WIPA 2YWWA 1PG7H 2YEVB 2WGNB 2P8PA 4JGNA 3EGSA 5IJVA 1FC2D 2H8PB 4PJ9D 3KPRB 1C8PA 4I77L 5I1CH 3P77A 3ROLB 1QUNA 3H4FA 3KCPA 5D7JA 1WQ7A 2LCSA 3DYOA 2V3EA 5B3JF 1V8HA 2L3SA 1JV5B 3ZMNA 3M56A 1HKLL 4IJTA 3SHSA 4HC1L 4J6RH 3TVMD 3UYRL 1XWVA 5DQDL 1VYTA 4AQ8C 5IB5A 3MRQB 1FX7A 4YJZL 3AY4A 3KPQB 3MHZA 2DDQL 3ARDB 3I9GL 3I9AA 2JB5H 5FIEA 5AAMC 2RMNA 1RADB 3EOYG 4EBQL 5EZOL 2X4SB 4MAZA 4PP1D 2R2BB 5GGRA 4ZUSA 5JW4R 2XDHA 3FTGB 4HUUA 2OTJA 1G9MH 2VLMD 3H6AA 4FULA 4OIAA 2RQVA 3ZDYB 1M42A 3ZIYA 2X70B 2MPAH 1YEGH 2YD2A 3ZKSD 5HVWA 1J8HD 5DU7A 5JDJA 1YECL 4YDKH 1GBRA 1KZYA 1MEXH 4M3HA 2ENYA 4XP9H 4CC4B 2PQWA 4GFTB 1FFTB 4DP5X 3WS3A 1XR8B 2QKSA 2BCKB 4YNYA 1CPUA 2Q87A 2DKGA 5CF3A 3CD6T 5D8JL 3O45A 4XN4A 5E6RB 3M0SA 5MEPA 3VD3A 1UECA 1DSFH 4DKAA 5MERB 4GMTH 1OAXL 3SKMB 2OX5A 3T8VA 2EVFA 1JRHH 4BQ9A 1X7SA 5I2SA 3MJ9H 4HUVA 4L18A 3MRJB 4KX7A 4YE0A 2BDNH 2BFVH 4RKUE 5D9SA 1F3DH 2R51A 1AD5A 1FWZA 3MNWA 4J27A 3KCWA 4BFFA 3GI9L 4R3SA 2AJSL 3AG4B 2BE9B 4MMYB 1OAXH 1MVUA 1X5LA 3AITA 5C0CD 1DN2A 4NB7A 5AW9B 1LO2L 2DQTL 3L5HA 3FPYA 5FOBA 4C92A 3U48A 2BIPA 4GXUM 4WHYH 2Z91A 4RTWA 2JMCA 3UPCA 3X1GA 1A1MB 2DWDB 4ZO7A 4Z1PA 2ZNXA 2RK1A 3KPSA 4U1HA 4L2YA 3MUGB 3RB7A 2MEJB 3KWUA 2G9HB 5E5MB 4R56A 2GT9A 4NX0A 2GUYA 1S7RB 2HLAA 2XQBH 2H9GA 3MRRB 4MD4A 3N50A 2VNCA 1XIWC 3ZQWA 3CUPA 1KACB 4J8QA 1YMMA 4HK0B 3MGAA 2P4RA 5HYEA 2EQIA 1DJGA 2DQEH 4XMXA 4JCLA 2IAND 3RTQC 5K39A 3H9SE 4UIMB 2I69A 3EHBC 4NM8H 5FGCE 1QFUH 3C5ZD 4G70B 1FL3B 1KLFA 4WO0A 3KPNA 3QFJE 4QGYA 4OR1A 5D2LE 2B14A 2MNWA 1KLGB 2GABA 5TQ0L 3T0EB 3FSZA 2WCSA 1YN8A 2WBJC 2XNAB 1FPTL 3WKML 3DURB 3NA9L 2HSIA 4YGAB 1XIWD 4ONFH 4P4KD 2QPUA 1I8AA 3PQYB 4P2QB 1QOKA 4GRLC 5IB1A 4NO3B 3WXWH 1DLHA 5JUEH 1MMGA 4DKFL 3ZZQA 4MCMA 2JJSA 3H1ZA 1M56B 1CFVH 2WO4A 3DB4A 1QI4A 2B9AA 2L7EA 5EC2B 4KU1A 1WTLA 4JPQA 3AB0B 4KRPC 4F17A 1LOJA 4J5YA 2WK2A 1K5NA 1M6OA 4M02A 3UA6A 3TIEB 5DK3A 3C5XA 2HT4C 4J8OA 1FVEA 2O30A 4YXKL 2N01B 5L2KE 1JK8A 4KTDL 4ZGEB 1H9DA 2VGMA 4I85A 5B1KA 5IQ7L 2Q3AA 4NRXB 1NBQA 4G6JL 4P4RB 4N28A 5I23A 3HLAA 3ZKXB 3MGOB 1MLBA 3K7UA 3RZCD 1P69B 3DOSB 4ODHL 3QXUA 3JUZA 4AT6A 4DOHE 3OKMA 3ZHKA 5EBMA 3ULVC 2EE9A 4LNRA 1BPVA 1KN4H 4QI3A 2GTZB 3RWDA 2DIGA 3R8QA 5H2BB 4JFVA 2P8LB 4PLNC 5C0GB 2QKIC 3H54A 4ZRGA 2JTMA 2DH3A 3ARWA 2AQNA 2PPAA 2EC9U 3OD3A 2P5EB 4HUCA 4WSJA 4LSVL 3VNYA 2FO0A 1I9RH 5EN2B 5IMOA 25C8L 3KWXA 5HPOA 1FFQA 3ARVA 5KN5A 3A6OA 1KN4L 2D7MA 1U33A 4TSBL 5F7AA 5EUKB 4ZFGH 3IS1X 3PHOB 2PWGA 1DEEB 1J8HB 3MREB 4WJ5B 1KTKE 4MB4A 5AT1B 1WGVA 4XCNB 2FQEA 5JW5A 4L1DA 3SOTA 3RX9A 1JJ2P 2MMPA 1MFUA 1PLAA 2GJ6B 1SDDA 2HTKD 2VC2B 4HW6A 4K71B 3SKNA 4BUHA 1KBGL 1PMYA 4P8QA 3C12A 1KYAA 3QQDA 5CJ8A 5DY9A 5IMMA 2IAAC 3GMMA 1SFHA 1ITCA 4XTWA 2GAZA 4MDXA 5DD3L 3MEAA 3RKXA 1QBLH 1VF5C 4OJEH 1E3XA 4N2IA 1A6VH 5F1KC 1RAFB 2BLFA 1EZSA 5I1KH 4DUWA 1RKRA 2Z7WA 3BT2L 2EVRA 3UBGA 1H8NA 2O9SA 2X4RA 1CTMA 3LN5B 4YSTA 1KOAA 1X5ZA 1ZV9A 2NXZC 4GRMB 3DGGB 3ZYOA 2J57A 1E7UA 2ZCHH 1BFVL 2LLGA 2J88H 4N9GA 4OCYL 3VFTA 2MMXA 1I3GH 1XIWA 3OPZL 2VL5B 1LO2H 1WF5A 4MD4B 4N0UB 1FGNH 1HOCB 1OARL 2V2XB 4KKLD 2HFFA 3VB9A 1I8FA 3TPUB 1SOQA 2YK1H 5EBGA 4C8QG 5IVXE 5DSCB 1TUDA 2DWDA 2VXQL 1UXLA 4V1DE 4FD0A 3B2VH 1SQMA 1OZTG 2IANA 2YWZA 4KI5F 5ANMB 1NAMA 2J20A 4I2XE 2DLFH 3V6OA 3QE5A 5KSBB 3R06A 2VDRL 2VLJA 2E9BA 1HEZA 1OI1A 2WHVA 3BMWA 5IM7A 2PABA 3EXLA 1JPSL 1F6LL 4K9JA 3CCRQ 4NKOA 4TPRH 4XCEB 5D1XE 4YSSA 3S2AA 5BZWB 5ES4B 1WBYA 1RVFH 3UA7A 4YDJA 2DFUA 4PJXE 4ZPTA 1EHAA 1ZHBA 3SPVA 4K5NA 5I1CL 4J8RB 4YN3A 1AS6A 3WDIA 2XZQH 2RHZA 1HHHB 5MERA 4NQVB 3NSDA 2CSIA 1F6FB 1WLPB 2DWEB 4ONFL 2A36A 2WZ6A 3V8OA 4X5LA 4I2XB 3IRPX 5HHPA 2NX5A 1QA9A 3TONA 5L2JB 3ARBC 2AQQA 1G6RB 2CCVA 5HPMA 1AD9B 1N10A 1BVNP 5CJQH 1DBMH 3BPNC 4L4JA 4PJ7A 1OEBA 4POUB 5GGSB 3U9WA 5E5LA 3L3JB 2QFRA 2PYFB 4JG1H 1BWWA 4HISA 2BKDN 1BWMA 2K6DA 4L3ED 4ES9A 2GJ6A 2LJ3A 3I56Q 1A6UH 5FU6B 5KVEE 3I55Q 1QPPA 3MOBL 1GW0A 3VXQA 1KGIA 5I11A 2FO1A 1DEEA 1J8HA 4MQSB 4FFZH 3LTVA 1NBYA 3MBXL 3UZQB 2FSEB 1SKUB 1A5FL 3MJ6A 2X40A 3QAZC 5F7KC 4DO5A 3D69A 4RNRA 1RUAH 1X6LA 2N7AA 4WWOA 1HNYA 5KOMC 4XVSH 5SWQB 1LJMA 1ADQL 3WE6B 5I1HL 1QUNB 1VAHA 1EH9A 2RM4A 3T3PE 1U8KA 2P49B 2BFVL 2VXTH 2UZPA 4UT7L 1QACA 5HGDA 2AEIT 4CNIA 2WP3O 3QK0A 4DEWA 3ES6B 4PJ8C 3F7LA 3TVMA 4OZIE 4MNHA 4RDQF 4HOWA 3QA3A 4U2YA 1ADQH 1A7NL 2NNXA 1O5PA 2XU8A 4LL9A 1W70A 4ORZA 4HWNA 4PSPA 1U8IA 3TIDA 3MEWA 4PTTA 3M4YA 4AITA 3P4MB 4XE0A 2N1TE 5BQ7A 3HHMA 4AK1A 1KG1A 2RHEA 1X43A 1MFCH 3D1MC 3RPKA 2FPEA 3VS5A 2NXZD 2J5WA 3FO9B 5KVMC 5CGMA 3EZJB 4ZT1A 4PBVC 3QYNA 3JCMg 3H4HA 4KDTA 2Y3NA 4A6YA 3V7MA 3D2UA 3QT2A 3T4YA 5IFHH 1OAJA 4KNTA 3ARQA 4I18C 1S5IL 2XA3A 4MDRA 2E10A 1ZA3A 2WB7A 4JPWL 1DO6A 2JCCE 1XL4A 3C2SA 5J12C 2VXUH 2C4FU 1NC4B 2UY6B 4P23B 5CMAA 3ZHDA 5KVEH 2J73A 1WFJA 3QQ9D 1WUZA 2WVVB 2JCCF 1UVQB 4ELMF 4R7DA 2NXZB 2ZWZA 4FYYB 1OALA 3FO2B 2DAQA 5DLMH 2E7BA 3JYCA 2XETA 2FDBP 4PJOA 3VQMA 1G7HB 2CRIA 2Y23A 1TVBB 2YAMA 5ALCL 4HKJB 1RK0A 3T2OA 3JTTB 1B7TA 3UP6A 3QHTC 4LZKA 5CIPA 3NRPA 1CFNA 4MQTB 1ZVSA 3SE3C 1WWWX 1KT2B 2Y4SA 1BEYL 3BSHA 3APFA 3NCCB 2BX5A 4PBXA 5E00B 4ADJA 4K71C 4DPRA 2NQ3A 1NEZB 4RGOH 4E7LA 1N70A 2HTLD 4P2OB 4UBDD 1YMMB 1TSHA 2BPBA 4HK0A 1Q86R 1ZOXA 4MMXB 4R8WL 2FVUA 3JV3A 1C12A 1A4JA 4FQQA 1RUKL 4PJCF 3U1QA 4QTIH 1S9WA 3RKDD 1PG5B 2W10A 4LKCA 3FBKA 1F90L 2PCPB 1TZIB 4N25A 1G7IB 5I0DA 3MEVA 4WTQA 1NIEA 3GSRB 2XWXA 5HHOD 4NO5B 4FFYL 3V8KA 1OAYH 5L4IA 3ZDZE 2Z9TA 4HZ1A 4PWKA 4ZUVA 3PV6B 1TNMA 2EH8L 1Y7XA 1BFOB 1P7QA 4XCYB 3RWGB 3NZ8B 5DYOA 1V10A 1EGJL 1NCBL 1OTSD 4G9DB 3HMXL 3P4LA 4P05A 5D1XD 1WQWA 1N0LA 5ENWA 2X0WA 1UT9A 2Z31B 1CO1A 4DJMA 3M5AA 2NNCA 1RZFL 3TCJA 5IHWA 2YZ8A 2W9EL 1P1ZA 4GG6F 3OLIA 4JS5A 2CDEB 4MDJA 2AF2A 4YHKL 4PJDF 1DBML 3SZKC 3VXSE 3AWEA 2HWZL 3EDKA 1BQKA 2AJZA 4F2MA 4NJ9H 4PJAA 4UV4L 5CEYB 3TA3C 1JU5C 4RETB 4FLQA 4OGAD 3V9CA 2AV7B 3UERA 3QUML 3OMCA 2Z35A 2JQMA 3KYOA 3N42B 2PWFA 4J1UB 4QXUL 3F58H 1TZGH 4N20A 1XX9C 3JV4A 1CLCA 2OK0L 1FYTB 4WNSA 3BWAB 5I26A 3OLDA 5E6IB 2H3EB 3OKOA 5CEXB 5FUCC 2P1YA 5F89B 3FOLA 2R2BA 2Y06H 3C5SB 4HMCA 4ZUSB 5GGRB 3EH2A 3RWJB 5DEFB 5KVFL 2NPLX 4HDIA 3VD5A 4FADA 5ILTH 2AKRA 2Y4XA 2A28A 1G7QB 4FT2A 1T66D 1AI1H 4NKMA 2SODB 3O41B 3JV6B 1MMDA 5F7MC 2AANA 3VXNA 1YECH 6PCYA 3C8KB 4LHUA 3X3FL 4IKLA 5EORH 2UXGA 2PWDA 1VGEH 3RKDC 3SD5A 5AYQA 4OAWA 1AT1B 4R26H 2H6OA 3HRUA 1GZQA 4B9IA 1C12B 1U92B 5IWLC 1J5HA 4VUBA 3AUWB 4JPVL 2X35A 4KK8D 5ACZA 5A16A 3HG1B 1KPRB 5DVMA 1NEZA 1QFPA 1W8NA 1A14L 3SQOH 3VGFA 3T6WA 1T21A 5C7XH 3V0WH 3R18A 4BM7A 3PXJA 3LEYH 1B3QA 3KYAA 2Q2LA 1ZVSB 4FQHA 3CCQQ 2BS71 3KPRE 1CFNB 4BI3A 3GC3A 4PV1C 3O6LH 1OYXA 2V37A 2XICA 3NH7H 4OQTH 4NXKA 4DQAA 3GWJA 1S72Q 1OOTA 5KSVB 4ZFZB 3SKOA 5JPMB 1TNNA 2R0WH 2A73B 3OMIB 1Z66A 3F8UB 4X7SH 5DMKA 3ZKMD 3OC5A 1U0QA 1YY9D 3V4LA 3CSGA 4XO8A 4UINH 4ZS7H 2UY6A 4NKQB 2B1HH 4U6YA 4XPAL 1GY1A 3S3CB 5IVXA 4ZFZA 2HKNA 2G2PA 2OMTA 1JV2A 4YSPA 4MAUH 2VGNA 1CYWA 1P4LA 1T1XA 4HWZA 4GXVH 1BAFH 3RL1A 4R7NB 5GGUB 2XVBA 1NLBL 1HI6A 1T5KA 3TF4A 3REWB 1JP5A 1CE1L 1JHTA 4K7PH 4JB9L 4S0SD 3EKCA 3CDZA 4FJYA 1UJ0A 1BJ1H 2CH4W 3RJDA 2FZGB 1F1BB 5IJDC 2OTWB 3L1FA 2BXZA 3S36L 3TIDB 4M7JL 1OTUC 1EIBA 3BP4A 4KT0E 2WTRB 5AYUL 4DPCX 3TJEL 3LKQA 1IM3A 5KE2A 2IPUG 4KKQA 4M5TA 5BW7C 4LDYA 1HD3A 4YC2C 1QW9A 4H20H 3JCMe 4GIOA 4NM4L 4O5VA 5C0BB 1F90H 5MP6L 4U1NB 2HAXA 5FAAA 2GTQA 4L37A 4QKXB 3KPTA 1GS6X 3NESA 1CJYA 4J2XA 4XC3H 5I8CB 1EGJA 1M1GA 5C9JA 1U1TA 5J56B 4UQ3A 1KC8U 3C8HA 1A5FH 4FRWA 4WTOB 3BW9B 5EOCJ 3MLPA 1I8IA 4GO8A 1P53A 2C3XA 2ADJB 3U0WL 5HBBA 4Q9BA 1ODUA 2D9CA 3NSXA 3WFDL 4EQ2A 3GSOA 4YHMH 4HCKA 1NBYB 1Q9KB 5JXAL 1ZA1B 3TO2B 2ZYRA 3CPLA 3LNFA 3LRHA 4S1RL 4EVNB 1RZFH 1TEYA 4BHUI 1F3JB 5DI8A 3ZEHA 5E51A 1DCEA 2PZ1A 4R97C 3HFFA 1P0SE 4JFFD 1BJ1J 5T5NG 4XNXH 4F24A 3BGFB 3ECBB 1I81A 2Y3AA 3PFQA 3KM2A 4AWJC 1BVOA 2VITB 2G6FX 4XPHH 2ZP8A 4X6DE 5ICUA 2XOTA 4J3OG 1YVLA 4WGVB 3EF7A 2I7SA 1FNFA 1A21A 4S1QL 2WNGA 2WMPB 3WOVA 3JWNG 4D9RE 4EN3D 2JJWA 3JVGC 1KXTA 2AJVL 3CTTA 5FGCB 1BF8A 2E41A 3T0WA 5B39A 5GRUH 2WV3A 3MV7D 4K9EH 5JMOC 1AKJA 4XVUC 1INQB 2AK4E 2GIMA 3CCJQ 3DTXA 3PNWC 3DROB 4WUUE 3HBGA 1FVDA 4X80H 5ECAA 1P7QD 3L2NA 3QPQC 3ETSA 3QS3A 4RH4A 1LGVA 5BOJA 5FR3A 3GSUA 5T1LA 4NO5A 2WWKT 4JFZH 35C8H 4KGJA 4K07A 3W39B 4WF7A 1M71B 5E1IA 3SDAA 4WWKC 1Q9KA 5T3XD 3CSPA 3GJFA 1ZDQA 2J7LA 3MODL 2AJUH 5KYWB 2OTJT 2YUVA 4JAMB 5GRJH 2ADJA 4UILH 3ZIMA 2R69H 4M43H 2HRPH 3TJPA 4WEUD 4LLWB 4F27A 1N3NA 1SG5A 3EO1B 4NZTL 1QNIA 3PV7A 5KSBA 3ULVF 4MSWA 1AGCA 3OYKA 3KGSA 1JDCA 4JPVH 4JM2C 4C8QF 4LSTL 2FG0A 5DJDB 2G3ZA 3G6JA 3V4VH 3CLEL 4W6XB 1U30A 1ET8A 1RURH 5C0BE 3RURA 4HG4J 3ULVL 1D6VH 3B7RL 1VQKQ 3UGEA 3V0WL 5TGBB 1RK0B 3LZQA 2DRUA 2OZNA 1F4WL 3NCJH 4HH8A 4ZFQA 1RJYB 2GJPA 4F93B 1DLFH 2ID5A 2ITEA 3GZPA 5KJRL 1KJ3H 3FT0A 3RY6A 3V6OC 3TSZA 3GXUB 5CEZH 4N87A 1BJMA 5CM1A 2GGRA 2WVVA 4XHJC 4QRPB 3KPMB 3WO4C 4FYXB 1B0GB 4UUJA 4UINL 1C5BL 1MJ7L 4ADGA 2PTTB 2D0HA 3QJZA 4NHCL 5CIPB 2AK4D 3T0AA 4V2SA 1NL0L 3IJEB 4NOYA 2B2XH 4HPHA 4LRIA 4PPTA 2FR4A 1DQDL 1FCGA 3FBQA 5CEZL 2JJSC 5GAOq 1I7TB 4OZFB 2GSIA 4XN9A 5GGVL 2NNAA 4L29B 5B3JE 5DJ0A 3HNSH 4GH7B 2LQKA 2VXEA 4NP4H 1RVFL 2EDQA 5EU6E 1JEGA 2BVTA 3UGUA 3QXTA 2FNWA 5J89A 2AK4B 3V6BR 3OYYA 3AU0A 2EQKA 1NLOC 5IV2B 2YRLA 2UV3A 3MRMA 2VMFA 4KI5C 4ZUWA 1BBZA 3VUZA 3I6GB 1M9WA 3OB0K 4Z7NE 4F8LA 1J1PL 2CA4A 2HT4D 3NIDE 3D08A 4LEBA 5EOCL 5I2IA 3CCRT 1LO5A 1ZLSL 1O6SB 1F45A 2D0QB 1KCUL 5IGXL 1WZMA 1SQ2N 5CJXA 1UA3A 3RWIA 1OF0A 3RWCA 4RRPM 1WCBB 2JF1A 2FB4L 3ULUL 2OMYA 5I22A 1MH5B 1R4XA 2BSEA 3D69B 3CG8A 4MXWL 1XGTA 1R47A 5DRXA 3D7SB 2W0PA 3IWUA 4G6KH 5E2VL 5TFSL 4QRRA 2NW2B 5ECGA 4HCIA 4Z76A 5I6XC 5ICYB 5E8NB 3JV6A 1KCUH 3MRLB 4NKMB 2BIQA 1ZVYA 4LMQE 4WO4D 4K7PY 1ZBXA 4OUUA 3U36B 2BJMH 4XAKD 1CFQB 2J1KA 1IGTB 4KMLB 3GDCA 5DEFA 3S97C 2GJ6D 3GXFA 5T1KB 2AP2A 5LWYH 3GO1H 1ZX6A 4QT7A 2AXHA 1BQSA 3MV7E 4JFQA 4RNRB 4UTBH 5E6IA 5CEXA 4IRZL 3UEZA 2GQVA 1F1GA 3ZL4H 3SE6A 3TT3H 1DVTA 4D2NA 4X1VA 4KAQH 2MOQA 3FFCB 3G5XA 3HMWL 2QADB 4QTHA 4JFHD 4PREB 4WV1B 1E2ZA 2FEDC 3TU4K 1IV8A 2PUQT 2QHLA 5HHPB 2NX5D 3ZE0E 1ID2A 5ADPH 2O9VA 1YJ9Q 5CEYA 5LN4A 5GRYA 3DIDA 4IKIA 1N67A 2CZ7B 3JCMQ 3HE6B 3OX8A 5DDHA 2W5PA 4FN0A 4LCWE 3E2UA 3TBTA 4NQEE 5ADOL 4I3RL 1CURA 1V29B 4UANA 4RGNE 3OMNB 3LVEA 3MV9A 1F8TH 2BNQA 2ZPFB 3O3BA 4BUQA 5EIIB 1AZUA 4PJ8A 4M77G 3TYFA 2IBBA 3MODH 3GPLA 4AENA 4H1LA 5JIQA 3HI1B 3IU4H 2BNUA 3BEVB 4YHNB 5LDSA 2DI7A 3P3UA 3CCSQ 1JGDB 2BVQB 3L3OC 5FO2A 3T71A 3AY4C 1GAFL 2GBTA 3QHFL 3CC7A 2JIXA 3T1FB 4IIMA 3ZN6A 1TQVA 1F8TL 2KT6A 4HUMB 4CBZA 3B5HA 1MCOH 2HSPA 1HT6A 1CD8A 5KH6A 1GC1C 4LVOB 1SM3L 1IRAY 3HLKA 3CX5K 1YWOA 1KTJA 2ZWYA 5KBDA 1PD0A 3D18A 3UT1A 2D8HA 2Y5TB 1UENA 3RTQA 2NY6B 2VDLL 3CLFH 1R1CA 1YEFH 2O5NA 2XG5A 3L5XL 2XLLA 3MLTB 3CC4T 2X4RB 1JZ2A 3AM8A 2XHNA 2YAOA 5AWNH 1DUZA 5HYSG 1Q94A 1AD0B 3HHTB 2JJ9A 3ALWA 1YC7A 4R96A 3HE7D 3TEUA 1PZUB 5HDRA 2IBZY 3GLAA 3MRKA 3FJ5A 1D1CA 5HGAB 1R0AH 5FROA 4WENB 1GYVA 1CF8H 2M83A 2C8NA 2MQ0A 2CDTA 4L4TA 3H9NA 1YYLH 2DILA 4OCWH 1T83C 3RIFF 2OXGB 3V95A 4Y2DC 3QORA 2OQJB 1UCBH 3S35H 5A40E 2YLCA 1M3IA 2CRYA 3RKWA 5DGQA 2NYKA 5GGVH 3VX0A 5TDOB 3LRKA 5AD0A 4A7TA 3W0WE 1IL1B 4ZQKA 2VXVH 5KANG 3MROB 4WCIA 2B4CL 2H3NB 3HE7C 4KJPC 4HPYL 1ZGLP 4GW1B 1AYRA 1WCQA 3HZ3A 3LS5L 2GIXA 3UL4A 4AC4A 4JDTL 4J83A 5D7EA 2H1LM 1NDGB 4XXDA 3RGVD 2KSSA 1EJFA 3OLEA 2KDYA 1I9EA 4HBCL 4ZUUB 4LAJH 3IMRA 1T03H 2CDFA 4OI8A 3M0TA 1EO7A 1R34A 2A9NL 4ZG1A 1IEHA 1B34A 4KMTL 4XO4A 1WS7A 2DI8A 1J1PH 2K3TA 2XX0A 4X4KA 1TEFA 3NQKA 1P7KA 5I0VA 1SJEB 1XF4B 4QRTB 4GUPB 2MWOA 4ONOA 5E2TH 1DVFA 4M5YH 4NIYE 2OSXA 4NUJB 3L4ZA 3BJLA 2BO0A 5FHAH 5DWUH 5EUKA 1QLEH 1O9WA 3QGVA 4LVNC 3WFEL 4F57H 3TN0B 5HGDB 1DQML 2AKLA 4G6KL 4B9WA 3NYKA 3DVNB 5E2VH 3QDMB 5TFSH 3MV8E 2NSXA 4AQZA 1CSKA 4HCFA 5B8CB 4ZGJB 3DTUB 3S96B 3CVIH 2YD6A 3LZOA 1K76A 1C16A 4LFHG 2OMVA 3PQYE 1G4MA 5ICZB 3T1WA 1WXBA 5FKPB 1XNIA 1WRFA 1ZGLB 4OGZA 2OK0H 3GS7A 4I18B 5F9DC 4AQEB 2R69L 4M43L 1NKGA 1YJ9T 2EKHA 1Y6KR 3SQRA 1PQZB 1GGIL 1AC0A 1MLBB 3M53A 1RFDL 1BHGA 4AQAB 3V6OE 5INCA 3KGUA 1L0YA 3ECWA 4U1GC 2XQYG 2XHCA 4DGVL 3G6AB 3RGHA 1MRCL 4NO3A 3QJHB 4DKEH 2YD0A 3CBJB 2PNDA 1JGVH 1W72A 2QI2A 1OP9A 1QEXA 1TU2A 4XAWL 5DRNA 4DUVA 2NY1C 3SD4A 3DOHA 1I4K1 3N91A 2CJSA 4PJ7B 3VXTA 1B07A 3MYJB 5KTEH 2H26A 1D5BB 3CFBB 1AGEA 3ZE1B 3MXVH 4ZTOL 1B0GA 5GAOr 5BS0B 3C5ZA 2CKBA 4BY6C 5TDOA 3ZLQC 5CKFA 3QQXA 3G6JE 4RFNB 1PZSA 2HZHA 4FYTA 3VFNB 5D4HA 4X34A 2DMOA 3GKWL 2VXFA 1YMMD 3H7LA 3IU4L 1LO0H 1LO4H 4G8EB 3NH7L 4ZTPH 1GRIA 2L8AA 4U05A 5D7HA 1YI2Q 1ES0A 1MFDL 5JXEA 3KL0A 1RP9A 4JFDB 4XP1L 1QYGH 2F9BT 5EEWA 4NLHA 3RWEA 2JMRA 1IAIH 2E7CA 2ZX9A 4OJAA 4OZGE 2FPFA 4E5XA 3KFVA 3KPSD 2X1WL 2X3AA 4JHBA 4YHYC 1L9MA 3CCVA 1GGYA 1G3WA 2EJ9A 2HVJA 2FBRA 5I1LB 2DQFB 3U1SH 1LO4L 1NIDA 2WKGA 4U1MA 4PGZA 5C0CA 3ML8A 4CGTA 1MWAA 1S8DA 2VLKD 2CNZA 3CSTA 4LEEA 2PMZA 4TSAL 4W9JC 3UATA 3MO1B 4POYA 1B6DA 4ONGH 5IBTH 32C2A 4BB7A 3HSBA 4K7FB 5DHXB 2CSQA 2TRHA 2Y7LA 4OF8A 1XGPB 3VB8A 4Z7UA 5GAMd 4GW5A 4V2BA 2NTSP 2XVLA 3EYQD 4ODXB 3TTYA 2V6HA 1WZOA 2APSA 4FFZA 4DEUA 4WEEA 3S36H 2WGXA 5FOBB 4Y89A 3NACH 4IIQC 5CZVL 4RIRB 4BFEA 3E80A 1DVSA 2DPPB 2ZCFB 2HKHH 5CJXC 3CMOH 1X5XA 3ROOB 4CC4A 2X05A 4F7TB 3LZNA 2GFBB 1CLZL 3FNKA 4UNUA 3EZ8A 4Z7WB 1J8KA 2A4ZA 3FRUB 4QXGL 4LEOB 3SDCD 1UACH 5LCVA 5E03A 3H3KA 3ZQ9A 2VR4A 4L9LA 3EGDA 4MYPA 5CZVH 4XC3L 5IQNA 2CO3A 4Z7AA 3SKMA 1PYWA 4ZSOA 5HCKA 2DJMA 2XWBA 3BZ5A 3D85A 3DVIA 1Q9OA 1CLVA 1GYWA 2ZWSA 1U8CB 3GB7B 4HEPA 2EE2A 4WY7H 3ARDA 1XR8A 4YNYB 2I5YH 4WV1A 1OCRB 1V7NH 1DFXA 1OPLA 1JGEB 2XACC 3CPLB 3LEVL 2WBJD 2FT7A 3O4OC 2EKJA 3OYJA 4FKHA 3PXHA 1BGXH 3ULSB 4JPKH 1PAMA 4KK5C 2VRKA 1VGKA 2LZ6B 2D73A 3WUWB 2R58A 1GZHC 2CIIA 4HP5A 2O61A 1S1NA 1E28A 3QG6A 4FJ6A 1PLGH 3LQAH 2CLZB 2R2HA 2E47A 4MJ2A 2XT1B 4XMVA 5DUPL 3APMA 3U36A 3I02B 5ADOH 3BVWA 2EABA 3C9NA 3MLZL 5GGRY 4K8RH 4PJ9A 1M8MA 1BYOA 2C0OA 2WANA 3ARGC 1ZANL 4JFPB 4KRLB 1X2KA 4HFUH 3L2RA 2OYLA 1NCGA 3S37X 5CCKH 5IKCB 3ZKXC 2J3SA 1UEYA 1SOSA 4PCSA 4WJG3 5CP7B 5H35B 1KLUB 4ZNEE 1T5WA 1T6BX 1LMIA 4KKNA 4OM1H 2ZUSA 2I0NA 5GGQL 1X7QB 3D7PA 3HI6H 3MRGA 3PGDB 4GQ9H 2H7WA 35C8L 4JM2A 2N7BA 5D7SH 5F9OL 2LJ0A 3ZHLA 5GHWL 4KQ4H 2J25A 3O3AA 4JFYB 5DHYA 4AXWB 5DD6B 4CC0A 1KHCA 1XBRA 4U1LB 3QBYA 1DVXA 2E6ZA 5C0JB 2KBTA 4W9HC 1YWPA 3F00A 3V4PH 3FCGA 3WJLC 1R3HB 1YEFL 3DX7B 5D6CB 2PCXA 2K2VA 3HC2A 5EC2A 1YJWA 5D7SL 3KE0A 1NC4D 3GUTA 4QEGA 3J27A 5DJ0B 3VUBA 3VKIA 2LQRA 3PIQA 5HDBF 4PJIA 4OMLA 1SNRA 2ENPA 3BUPA 1S7WA 5HYJA 3O9WC 4WCYH 1QR4A 4CI0C 3CPWS 2HT3D 5IHUH 1LNUA 3UC0H 3VXPA 2VE6B 4M7AA 4ZZFA 2Y2WA 3IJEA 3L2ZA 3MX0B 3GSWA 3CMEA 2G3NA 2X2JA 1M2VB 4OZ4B 4QY8A 1IBBA 2CA3A 2NY2C 3U6RB 4PJCB 4BE1A 1WTGT 3V7RA 4OB0B 2F8XC 4QXVA 2IMMA 4JFFE 1T6VN 4QRPA 4Y1TA 1EJOH 4E7ZA 1BMZA 4X6BA 3ZTCC 4WCYL 1WHGA 1MF2H 4BKTC 5D7JC 4NRYA 1MJ7H 2P5WE 2Z1KA 4WU7A 1ZJBA 2VMDA 2WIIA 3LPGA 1A7RL 3EDFA 1KCVH 4N4HA 3D3VD 2LTQB 4CU6A 5K1JA 5T3XH 5CP7A 4R2GB 8CGTA 3N1QC 5F7HA 1QSFB 3C8KA 4Y16C 2PTVA 2WXRA 4OSUH 1KTRL 1AZGB 1GCQA 1K8IA 4FFVC 3MRNA 4PRPB 3ATAA 5EO1B 4WUUD 4Y5VA 1KGXA 2FE0A 5A0DA 5AZ2H 4H8WC 1BZDA 4AH2A 4ZMVA 1BVZA 2COQA 2I32A 2IH8A 3UO1H 1N2RA 3MSPA 5LUMA 5F7DA 4FA8A 4MVBD 2NY5H 4IOFD 1IB8A 5GIRA 4L4VD 5F89A 3U7WL 3D4ZA 1VGKB 1IGJA 4GSXA 5EC1A 4F57L 1BIIA 4FNUA 1I5OB 3RVUC 3DBXB 3OHMB 1MFNA 3I9IA 1C5CL 2DYPA 2PXYA 2O01E 4OZHA 4WNJA 2VXQA 1FJ1A 2XUWA 4OZHF 2R39A 2OMXA 3GMRA 4KJQD 4YX2H 2J5LC 3K6SB 5E95B 3TH2T 2YLHA 1A02N 1J9RA 1J11A 2OSYA 5D5ME 4ORGA 3S5LA 1IC7L 3GBNH 2COWA 5C08E 4RFEA 5SX4I 1DBKH 3B7TA 3WI9A 4A38A 4BA8A 1NCAL 2CGRL 5D2NC 1P7HL 5IVZB 4HJ0C 3EBHA 3GQFA 4X8JA 1BCOA 3O3EA 3C0CA 3T0EE 2KVQG 4JY4A 1TOVA 4C54A 1AVAA 2WBJB 5GRVK 4CA4A 4CADB 3FB8B 2Z1PA 4AV0A 1AQDA 43CAA 5DJYB 3X3GL 1U95A 4NZDA 2EIDA 5DHVA 4JFEE 8ATCB 2WSCE 3PP3H 4MA7H 4GBQA 2X2IA 1WGSA 5FWBA 3ARDC 5AYFA 3ECBA 4G9FA 4MNQD 3N5BB 4O2EA 2AQTA 2G60L 2CZNA 4DK6A 4RZCA 3ZYJA 4UM8B 1MDTA 4LUDA 2WQRA 3GXDA 2QVIA 3MR9B 5J39A 1CXIA 1JWUA 1Z9SA 1R24B 2N0MA 1TZIA 1HL9A 4TNEA 3PTAA 4Z7UB 4QF1A 1W0WA 1ZLWK 3HHSB 5LAXA 3V5KB 5HY9B 2H6PA 4M7DC 3GP8A 4XWOD 3V5HB 3W57A 4OCXL 3A6BL 2COVD 3FTVA 2CZ6B 3E6HB 1UZ6E 3GSNB 2W0ZA 4MMXA 1OT1A 3TBVB 3BPLB 5FW6A 1J48A 3CFDB 1EDQA 4ZMAT 5ISZE 5C6PB 2JQAA 5I6MA 1UZ6F 5GAOm 3DWTA 4HIEB 4IIQA 3US1A 5GAOn 1UEMA 2R1YB 5EZLB 4FCHA 1OGTA 1S7VB 4UB0H 1ZWIA 2XWCA 4OFYD 1WAAE 1T22A 4LLUA 3OYHA 2CK2A 3VXSA 1BZ7B 2NY3B 3DJSA 4P5TA 3REBB 2CT4A 3PWJA 3A6BH 5FCUH 1WAEA 1G1CA 1TENA 4JFDA 1J0KA 2HX9A 3MOAL 1IBDA 1L0PA 4QRQB 3MFFB 4X6CA 7FABH 5J4MA 4KRPB 3V4UL 2KDSA 2C1PB 1WXUA 2J6OA 4G8EA 1UJ3B 2P80D 1MREH 3BP7B 5FUZL 5EU3B 1O9SA 1QCNA 1EMTH 2EEFA 2CO6A 3QIWA 4DGWC 4UB0L 5GMKl 5IUSA 4RTVA 4GKNB 5GANj 4C8QA 4E9SA 4RAVB 3JWOC 3AT0A 5LQBH 1ED3A 2VDNH 1LP9F 1FMWA 1NDTA 3G6DH 4JRPA 3US0A 2JNGA 1F3DJ 3QDJB 2O5ZH 2X10A 4FXKC 3CCQT 1E9OB 2VDOH 5EA0H 5FYJD 4E41A 3SWNB 3CFEB 3MLSL 4TQIA 4ZFFB 5C2BL 4NL3A 4OLZL 4Y2LA 4OCSH 3U6XA 2XYBA 1RAAB 5IFAL 3VV0A 2FJGB 2PO6B 1NZ9A 1N5AB 1UA6H 1WYXA 4MLIA 4PJGB 2HKHL 3GMQB 4YLQT 5C0AD 1BV8A 5SWSD 4HS8H 3SJVD 4PRDA 1BI1A 4KQ3L 3L1EA 3MV11 1KIRA 4M56A 4O02B 1MKFA 2X89A 2EUZA 1LP9B 5DR5L 3DTDA 4TMPA 3HUJB 1ZY9A 4ZAKB 4HT1H 1VFBB 5C2BH 3BIBX 1RAEB 2MWPA 3S37H 3GJEB 3TF7C 3M58A 3Q2WA 3TZVA 4AQEA 2UZYA 1BLIA 5DHYB 3B9KC 1A22B 2QQLH 2FH8A 1DJXA 4OLXL 1T21B 4URKA 3KAAA 4NENA 4MJ5A 3AUVA 3PHQB 9CGTA 2J44A 1Z2KA 1N8RR 3AQYA 1MIML 4GUOA 1DN0A 2HUHA 3HS0B 3ZKQD 4OGXL 1I1YB 3AFLA 1UT2A 4OT1H 1UB4A 2JKJA 3T2LA 1ZIBA 4QHUA 4XNMB 3DKHA 1QLYA 1J10A 3HKFA 4PJ7E 2VLRD 2MWCA 4UM9D 1IGFH 3ZO0A 3ZDXB 3A8OB 1SJHA 3WKYA 1KQ2A 3S5ZA 2EDNA 3B6SB 1MPAL 3PHAA 4TUKL 3MCAB 1BAGA 2XPGB 5D5MF 4GG6A 1E28B 3QG6B 4FF9A 3OBAA 2YUXA 2OMUA 4PJHB 3S6WA 4BWUA 1J9SA 4IOFC 5CLZA 2GI7A 3LH9A 3TZVC 5AB2A 1W91A 2CUDA 2DQCH 4GI6A 3JRZA 3SCMC 1GR7A 3NQIA 1NMAL 4KO7A 2EIBA 3ZTJG 1UB6A 3QIIA 2ZOOA 4V33A 4FNTA 1R3JA 1AQHA 3W2DL 1AG0A 1BBJB 2DKSA 1JVOA 4XTUA 1HL5A 1PNDA 3GB7A 4MKMA 4A4GA 3JWNE 4KKCC 5FA3A 2JKXA 4MNQB 4ZXBB 3U7YL 4JZ3A 1L9TA 1L9PA 4JRYB 1CBVH 1PIFA 3D0AA 3VD0A 3FQXA 4XVTL 2G60H 2Y7QB 3BDUA 5CU9A 4R83A 3OW2S 4WI8A 1QI5A 4BK5C 3OKKB 3P4OB 2W92A 2QQNH 4EZKA 5BZWA 2DEQA 2PKDA 2VSDA 1UXWB 2VRAA 2ZCLH 4M6MH 1JZIA 2FYYB 5GGSY 4CRIA 2JKLA 1EHKB 4XP6H 4BFBD 1COBA 5EU7E 3LKNA 4DZ8B 1YPZB 2Z7YA 5AOZA 4HS6A 1N4XH 4XP4H 3NFSH 4ZMQA 2MPXC 1TQCB 4MCZB 4OJYA 1E30A 2WWNA 1M3JA 2YD5A 4MLSA 2ZUQC 3HC4L 1L5GA 3RVTD 3CK0H 4Q9RH 4C0FA 3BOVA 4PJBF 1DVUA 3S8FB 1NFIB 3LEXB 4N26A 2VQUA 1DHKA 3MBED 4OCRH 5ANHA 3T1FA 3LKOB 1LEIB 5L7XH 1MCFA 1N4XL 1FGVL 4NI6A 4XP4L 4G80B 1JQQA 5I75B 1YEWA 1OLLA 5KVDH 1EPFA 3CZJA 1WFOA 3LRGA 4LDEB 3CBPA 1KELL 1YEIH 3BKML 4KZCA 1NEGA 2EXWD 5GAN3 2X5PA 5D1ZC 1RLWA 4OZIB 3JB9J 4FYVB 2DLPA 4NZFA 4BXVA 3KEDA 4YZFE 2L04A 4YQXH 1JPGB 2V8JA 2X9HA 4CAGA 2ZP0T 3G08A 3G04A 3P3SA 2NUPA 3IJHA 2O31A 5GAMe 4UI2A 1DANU 5GISL 4BK8A 1J1XL 1TR7A 1ZTMA 4AJ0A 2DQJH 1NGPH 2D3VA 2WTOA 4OVVA 4TV3A 3FT2A 4X7TB 5SWSB 3DK2A 4AI7A 2ZXQA 1CBJA 1FL6A 1KD1R 3MLUH 3O8VA 1DSYA 3BC9A 4GRWB 3H6ZA 5E8OA 3NTIA 3JB9I 3LNDA 4R0KA 3FOMA 3R0NA 4KQ3H 5GS1C 2BW5A 1OP4A 3MRCB 4YR6A 5EFIB 1QVPA 3KJ4B 4A7SA 3U0PA 3CFBA 1BOGB 3B9AA 3I85A 4LP5A 4YWGH 2DIEA 1SFDA 5C0RH 2EDOA 1UHFA 4OMQA 3MJ8B 1QW1A 4GQZA 3W81A 2LVEA 3IM1A 3MLUL 1UOKA 4D9QE 1MW2A 1PBYA 3GPEA 1RJZB 3AXLA 4OZGB 4A37A 4L3CB 2NY5C 2E65A 2K1MA 3FUKA 2G3RA 5E8DH 4X0KA 1OZ2A 3HC0B 4W6WB 1JGUL 1WBZB 3V79C 4OM0H 4YSAA 4Z7OF 3UAAA 3WKPA 4YO0A 4TOYH 5L6YL 1EANA 1HSBB 1OXYA 1YEEH 2ZUYA 1AXTH 3S3BB 5DEGB 3OKMB 4BACA 1KB5L 3QEQA 3RVTC 1G9EA 4JZJC 1AO7D 2DOCA 5FWQA 5ITFB 3UTOA 2LLNA 1B4JH 4NP9A 4F7MA 4JZOB 1ZGLA 1NDMA 2ZD0A 5T3ZL 1GYUA 1SXZA 4UM9B 5K33A 2XDPA 1ZLWH 1VPOL 4G8GB 3L9YA 1K4CA 5DZJA 4U1KB 2X4TA 4EIKA 1NC2A 1CLYL 5ICXA 3CFJA 4JQVA 4QXTA 2GSGB 4F37F 4PS8A 3RZCB 2Y0SA 2BHZA 3JCMf 4J9DA 1TZHA 4EI0A 5ITFA 3MACL 3MJ8A 3ML9A 1NGWB 2QZ5A 4JKMA 2DS4A 5D2LB 4PD4K