1Y07A

Crystal structure of the superoxide reductase from treponema pallidum
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
126
structure length
121
Chain Sequence
RELSFFLQFFLGMDAPAGSSVACGSEVLRAVPVGTVDAAKEKHIPVVEVHGHEVKVKVGSVAHPMTPEHYIAWVCLKTRKGIQLKELPVDGAPEVTFALTADDQVLEAYEFCNLHGVWSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords desulfoferrodoxin (rbo)
publication title The first crystal structure of class III superoxide reductase from Treponema pallidum.
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum str. nichols
molecule tags Oxidoreductase
total genus 22
structure length 121
sequence length 126
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2004-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.510 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y07A01
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1y07A02
1DFXA 1VZHA 4BV1A 1DQIA 4BGLA 2JI2A 2JI3A 4D7PA 4BFKA 1VZGA 4BFJA 2HVBA 3QZBA 1Y07A 4BRVA 4C4BA 1DO6A 4C4UA 4BFFA 1VZIA 2AMUA 4BRJA 2JI1A 4BK8A 1DQKA
chains in the Genus database with same CATH superfamily
1X9LA 4NQSB 3VMPA 4NGHH 1O75A 2X4UB 2R0ZH 3M7FB 4OF5A 2YJLA 3ESMA 4FF9A 4R7NA 2PXYD 2BH0A 1K9MC 4ILDA 5MHSE 4A4FA 2VR4A 3G6EQ 1HX0A 3RKYA 4GBXB 5I1JH 1T0NA 2BHFA 4ZFOL 1WBZA 4KFZC 3Q13A 2ZJSL 1NFDB 1NKGA 4IM8A 5HVFB 2AJZA 2RACA 3K6FA 4X8GA 4X9YA 3QI9B 1UD4A 1E28A 1D5ZA 1Q72L 1F11B 3ZR6A 4FTVA 2OSLB 3X3FL 4RTZA 1QWHA 3WD5L 4LSRH 4O4YH 5GGUB 1NEBA 3L2WA 3RHWF 3QJSB 1D1AA 2AF2A 3HRZB 2F5BL 1YEJH 5EU7C 1VQ4Q 3OC8A 12E8H 4BH7A 3L5WB 4JFYA 3U46A 1IRXA 4NN5B 2M1HA 2EUXA 4PJFF 3KLAB 4UM8A 1FA4A 1K8DA 1U91A 1PM3A 2QFRA 5GZND 1I4FB 4PS7A 4PJGB 5GAN3 35C8L 5DFVC 1N8ZB 3SBQA 2WWNA 4EIUA 2Q8AL 4Z7OB 4RCBA 3PWVB 3REWA 2AJVL 2C1PB 3LXAA 4XMTA 5M9OA 3K0WA 1P6AB 1P4BH 2BHZA 1W6WA 5E2VH 4RG2A 2HKHH 1QFWL 2F1EA 4FP8L 3G6AA 3EOBB 4Y4HA 3SHSA 3QBYA 4NS0A 1AJ7H 3VH8B 2CU9A 3FO1B 1VFBB 4KVCH 4OIBA 1G7HA 2RF0A 1DBJH 4KTDL 2QZ5A 1JHKL 1YEHH 1ZS8A 4WUUE 4XP5L 4K5OA 1Y0MA 3D39D 4NKMA 1HXYA 4LNRB 3DJSA 4P5MB 2QQBA 4QEGA 3T2OA 2LU3A 4NQXA 1YVLA 2P49B 5EULV 3ZE1B 1OPLA 2ADIA 2NY2B 2WM0A 1Q81R 2JJSA 4WNJA 1KBGL 4RWYH 3QXTA 3G7TA 4FYWB 4J83A 3JB9D 2DAVA 2W94A 2GEQA 2XWXA 4XMLH 3MSPA 2GTWA 3C87A 4MMXC 2DTSA 4Y5XB 4OJFH 2DI7A 5DC4B 2NY3C 1BWWA 3QYGB 5E9DE 1HHHA 5E2UH 3V8KA 5HXMA 1QLEL 4YC2B 4AXWA 1I3RA 1ZHKB 2EQDA 2X70B 4O02H 3T9WA 2X4NA 2K3BA 1YP5A 1G4RA 2YGQA 1LO5A 2B9BA 4QXVA 3ROOA 1RZ8A 4UIKH 1ND0A 1ZHNA 3JWOC 1CK0H 4DTGL 4PJHB 4GSXA 3PGGA 3EH4B 5GRZA 3IU3B 3P9WB 5BQDA 1SXBA 4X4ZA 5AAMC 5EO0A 3EDFA 2CRZA 4TNWK 1FG9C 3HBQA 3U4BL 3BP6A 3FCTA 3TNNB 4DFIA 2IADA 2PYFB 4Z6AT 3FU8A 3UZEA 1G5AA 3QZWB 4GIPD 4DP8X 1TETH 1QWFA 1HHIB 2AXGA 1NCOA 1XH3A 3RY6C 3TT3H 3KUFA 3VS5A 2DWDB 1KLUB 2JCCE 3GC3A 4GP4B 4Y1AD 2Q0ZX 4FJ6A 4ZFOB 1ECYA 1A4BA 2AXWA 2ZCLH 4NI3A 4R5XA 3TBYA 5A6LA 3OKMA 1XBRA 5D1XD 3UBXA 4F9PA 1G87A 2IGFH 1JGVL 1IKFL 2OXHA 5HHNA 4Q89A 3V7CA 4D0CA 1J18A 1Z9PA 3DETC 2ZNWA 1E5YA 3DVNA 2ZG2A 3N0PB 4EBQL 3OW2S 1KCKA 3AAZB 1MCPH 4PJMA 4J4PA 3S0PA 4F8NA 1EFXA 4GI8A 2JM9A 1KFAH 3CCSQ 2V2XB 5EU3B 2H2PC 5DQDH 4OGEA 1MCSA 1QCNA 3EO1B 4N5EC 5FUZH 1R24B 4GW4B 1U8MB 1WQVT 1SYVB 5I0YA 4ORZC 3UH8A 3FCGA 2HG5A 1IGIH 2XN2A 1BYPA 1NMCB 3CVIL 1F00I 3NPSC 4UDTB 2Y7QA 1HJDA 3TJHC 1QVGS 1CBVL 1AS8A 2QHLA 5I1CL 4WWID 3WLBB 2I27N 1F4WH 2XXMB 4FZ8L 4G8EB 4P06A 3QWOA 4EPCA 1NGQL 5AZ2L 1IM3A 3WJMB 4ATTA 3C5ZC 3HKSA 5DLQE 2BSTA 1FL5B 1CG9B 1P7KA 2CQVA 3RWFA 5LL6S 3IFPB 2L2PA 4QRPB 2V26A 1MH5A 4F24A 2I07B 1ANUA 2ZF9A 2OTLT 1CD8A 2FIKA 2IBZX 4ETQB 1E27B 1F58H 1G0YR 1F4HA 1PEZA 3UG5A 3SZKC 5C0AB 3G9VA 3FQXA 2QVMA 4PJ8C 5KVFH 3CXDL 1A0QL 2WV3A 5GS2H 3CCHB 3FIFA 2ODHA 3I6SA 3WS6A 4XC3L 3AWGA 2K7QA 2WO4A 2LFGA 3BSGA 3ARGB 1EJ8A 3GSOA 3OR7B 2VLLB 2P80D 3QKJA 1IGYA 4JY5L 5FB8A 4KK8C 1WCQA 5BZWB 1UM5L 2VUYA 3VSTA 2FYKA 3QNFA 3PP3K 1QLEB 3V6BR 4P2RE 3S3PA 4BQ6A 5JO5A 1NM4A 1GOHA 2MCPH 2V3FA 4FQIL 2PNDA 3FRPB 3GF5A 1J8HB 1DP0A 3I2CH 2PP9A 4B7LA 2SRCA 4Y2DD 3S2CA 2IWEA 5GGTL 2R29H 5KN5A 2JJWA 1YYLH 4MNGA 4PV9B 4WIQA 2N0MA 1BXXA 4F2ME 4OGYL 4GT7A 5GAN7 1FGVH 4AGQA 3L7EB 2EDBA 4MXQD 4WEUD 1N64H 4P8QA 5E7BA 1ZEAL 4AYSA 3F12A 5EOCL 1JF5A 3HJEA 5HY9B 2ESWA 2CLVB 1GYAA 4KX8A 1D3CA 2BZYA 4L0PB 1EZVX 3D0AA 3D69B 4LU5L 4Z3HA 3MPCA 4OZIF 1CLOL 1OGTB 4CMHB 4M7AE 4N4GA 1QLFB 5EO9A 5IBTL 2EXYD 3SGKA 4GW1A 5DS8B 4C4KT 4PJFA 1E50A 4U6VL 2WQXA 2J1ZA 5D5MF 2WZPD 2PW2B 3A6OA 3JCMJ 4DN3L 1W2BS 1C12B 1JFQL 1RUQL 4W6XB 2DM2A 2Y22A 1U92A 3KYKH 2XQYG 2BIMA 4GG8A 3SDDA 3TPKA 4OGAC 1IC7H 5FM8A 5C0FB 3PHAA 4Z5RB 5AT1B 2Q7NA 4MJIA 4UDUB 2EYQA 8FABA 1M7XA 3FFCE 3OJMB 4Z7WE 4PY8J 1QLRA 4XE0A 5JW5B 4HXBL 1OCZB 3QJOA 4WTZG 5A40E 4NL2A 3GLXA 2YPLB 3AXIA 4ODUA 3D85D 2J2ZB 1AZUA 1T1WB 4TNFA 4C58B 5BUGA 4HWEL 3W39B 1RK1A 3HUJE 5D9SA 1LJOA 1FZJA 4B50A 5FW8A 3SBPA 1Q81C 4M7JH 4A2DA 4PRIB 2BPBA 2ZPBB 1IT9H 1EUTA 1LQSR 5JLZA 2FO1A 3DDFA 4JW3A 4MZRA 3H7LA 4ODSH 2ZWYA 1F13A 2WBJA 2X6MA 4UMSA 4XODA 5ERWB 4EIZC 4G9FE 4I0CC 4WTXA 1VEMA 3VUZA 5EDXA 2WJ5A 3DGDA 5IVXB 1G6RA 2IO5A 4WCYH 1M57B 3WGVB 3BN3B 2C1OA 1QA9B 1YEDA 4AL8H 4TTGA 1G6VK 1PSKH 2WSPA 1E6HA 1ZLWK 3O8XC 3TJEL 4AH2A 4HULB 3AITA 1SYSA 1H3XA 2BZ7A 4PJCE 3BE1H 2WVVB 4UQCA 3OYGA 3CCEA 1KCSH 2IAND 4JREB 3QORC 4IIOA 1JOIA 3LZFL 3PIQB 1ASQA 4GXFA 4JFDD 4N8VG 1JK8B 3RPIB 3U9WA 1AHWC 5TGBB 5E5MA 2HSPA 2HPOA 3HZYB 2FL5A 3ELQA 3OMZA 2P4AB 5CP7A 4A63A 2B9AA 5L9DH 3L3JA 2CZ1B 1VGEH 5LDSA 1TCMA 5I74B 4O6JA 3EG1A 4MS8D 2O61A 5F6HJ 1UGVA 1YPZA 2CMRL 3B3IB 2JJTC 4X80H 5SV4A 3U0PB 4YSEA 1OTSD 1VQOA 2DQJL 3VRJB 4RNRA 3QNZB 4PJXB 3BHBB 2YGNA 3PDOA 4GMSL 4KUZH 5A2LH 5I18L 4IOIA 4PCKA 2D9TA 1OAXH 3TFKC 4ELYC 2B3RA 1IAKA 1KPUB 2FECI 3F2LA 3L3HA 3NIDF 1X5XA 4XPAH 2RFXB 4WSKA 3OHMB 4LHJB 2YKLH 4P9HC 3ZRFC 5ICXB 1F02I 3CZSA 4ZUSA 4LDEB 5AOLA 4YIQB 2R5MA 2OZNA 5IHIA 3FFDA 5MENE 3MV9E 3LB6C 5IFJB 3U48A 4X6DE 1A6VL 1MJJB 3MV7B 2BIPA 4QYAA 4F33B 1H3PH 4UT9H 4Y2DA 4M7ZB 2VZSA 3QQ4B 1KZQA 3QUZD 2K6WA 2GSIA 2OJZL 3LH0A 1FNAA 1S2EA 3GMQA 1B34A 5IREA 3H9HA 4DOHE 4OGQC 3PWUB 4QLRA 5EA0H 5GGVL 3I55T 4DEXA 1EGJA 3MGTB 3WUWB 3JCMg 1SDAB 1VQ5Q 2OMWB 3GBNH 2IC2A 3NYKA 4TUKH 1OB1A 3E7JA 2DQIL 2ZXGA 3H1ZA 4KK6C 1D09B 4JS5A 1E5BA 2FBRA 3HHSB 1XF4A 3K2KA 4JCWA 2X10A 2GAZB 4C92E 2ILLA 1OAKL 3E0GA 3T3MB 4KKLC 3ATDA 2XYBA 1SF3A 5KSVA 3UTZB 4JFSA 3ZKND 3BPCB 1YY9D 4HC1H 1BQUA 5E99H 1UJYA 4AIZB 4FCHA 1CCZA 4M5TA 4MXVF 2KH2B 3DPBA 4F8TA 2AQSA 2R0LH 1E8WA 1MSPA 2BRRL 2C7FA 1MQKH 5AQ0A 4FXKB 3M86A 4DN4L 3CX5K 2EADA 1Y57A 3REAB 1YQ2A 2NX5B 2ZCHH 2HVBA 4UAOB 1MCJA 4J9HA 4P46C 3MROA 4UZUA 5TF0A 4IU2B 3LMJL 3QZNA 1HE8A 4FS0A 5K1JA 4N22A 5GZOD 3JV6A 2J1WA 3EYOA 3WE6B 2CDGA 3J8F7 1H6FA 4IIQB 2XTJD 3S3OA 3ULVH 5TH2B 3V8LA 1FH2A 2D1XA 3D4YA 3EH5B 3MZTA 1NKOA 4F7TA 2WZ0A 4H8QA 3HE7D 4OQTA 5LJ3f 3C08L 3JCMQ 1FZMA 1KENL 3C9NB 5T1KB 2KXCA 2GT9B 3NFNB 1XDTT 4ODVL 2E7DA 2ZUQB 2HJFB 3MUZ1 1GGCL 2YAHA 4K7PY 2AI0L 3ZE0B 5BS0B 1QEXA 2OR9L 4WW2A 4OMMA 1KLGA 3MRLA 2NY4D 4O2FA 2CJUH 5EWIL 1LYQA 2FJGA 1BF5A 2VXSL 1SEBB 3K80A 3B5GA 3P30L 1PZAA 1OP9A 1NLOC 1OE1A 3QO3A 4RKUE 1E5ZA 1TVHA 3LQZA 4AT1B 3G5YB 3VA2C 4JFDA 2AEQL 3TIDB 1ILUA 1PNCA 2XPGB 1HYSC 1GOGA 1OSPL 4B9IA 3O9WA 3C8KA 3VD4A 3ZKNC 2HRPH 3HB3C 5E94A 2F7PA 2JELH 3GSWA 2YK1L 3BZ4A 1ACYL 3FU9A 1NLBL 4FNLL 2DQUH 5A43C 2CRIA 4L4VD 1TTAA 5E7FA 4OZHB 3MU3A 3EDDA 1UFGA 3FT2A 3GJFB 3LZRA 3UACA 2J4WL 1D6EB 1DVFD 3EW3B 2Q8BL 3CC5B 5D5MA 5LJ3j 4K15A 2X4TB 4LKXB 4N0AC 3MEAA 5JXEC 5D2LE 3SDAD 4K0OA 2CGZA 2IALB 5JA9A 1DJXA 5L7XL 2RJEA 2H8PB 1FGNH 4DCQA 1D2PA 2FT8A 4JRQA 4WEMB 3QEHB 5IUSA 5FU7B 4M5SA 3ZDZF 4A6YL 2EVHA 2J88H 5I1GH 4Y5YA 4OB5H 4MQTB 4YDKL 2R23A 4R7NB 1J0ZA 2YUPA 4EIKA 1GGIL 5FA3A 3SWNA 3TNMA 4XNQA 1OTTC 5KW9L 4M4RA 2DJQA 1HEJC 3MJXA 1YZZA 4PNOA 3SD2A 1WBZB 4WWKC 1F97A 3O0RL 4OCYL 4Y16A 4X34A 2AJZB 3TO2A 1CE1L 5CIPA 4DEUA 1E28B 2QDVA 3JVFC 4Z0BL 2VV5A 4U0RC 1D5ZB 4UT6H 2N7SA 3UYOD 3M45A 4H20L 4MZMA 1RZJC 4FTVB 4FULA 1P7BA 1YHQQ 4QXUL 4M77F 1LEGA 1D5IH 3SCMB 3WU1A 2W9EH 2WCPA 4GI6A 1RU9L 2EDXA 1DO6A 1SLUA 5LXGL 4LGSB 4BH7B 2LQNA 3C4SA 4KUDK 4JFYB 3U46B 4EI0A 2NR6D 4NLHA 3AU1A 1EDQA 5J89A 1K8DB 1U91B 3P4MA 4HEPG 5C09D 4MB4A 3U0TA 3ZBMA 2WUCH 3LV3A 4G7YH 3CNKA 1XR9A 3REWB 1IC5H 4XX1G 4RTVA 3DDGA 4OGXH 5E4EC 5GS1A 4Z7NF 2L4OA 4PGBB 3QYMA 3G6AB 3BOVA 3TVMA 4PWHA 2CKBH 4Y4HB 1PRLC 2WQ8A 4KHTL 1N3NA 4P48A 3VFRA 1W6LA 3H3BC 2K5IA 5J11C 1TU2A 1O7DC 1DBKL 1TO4A 1G7HB 2K6ZA 4YSRA 4IBVA 2E56A 2AK1L 2NXZD 1AR1D 1ZS8B 4NP9A 1K1ZA 1DQDL 3LRMA 4FGMA 2BS9A 1HXYB 2DBLL 3DRQA 4NKMB 4F58L 3EOTH 4I85A 4YPGB 3LKQB 5GANj 1XIWD 4L9LA 4OH2A 5CGTA 5E6ID 5DJ0A 5CJXA 2YRCA 2YA1A 3HAEA 4NQXB 3WEOA 3G6JE 4GRLD 1HI6A 1SRLA 2I32A 4R3SA 3NZHH 1H8LA 4GG6F 2J1YA 3P0VH 2A08A 4LOEA 3FAWA 3CBKB 1E6GA 2GTWB 3SGEH 2QSCL 1CU4L 1R1CA 2KMTA 3HFNA 2R39A 4RLDA 4U05A 3RGVA 1N7MH 4GKSA 1HHHB 2HT4C 2G30A 3L5JA 4AXWB 1I3RB 2DH3A 3CDGA 3Q8AA 4L4VA 1IGUA 4PI2A 4X0NA 4E42A 2KHAA 2X4NB 1DUYA 4Z3IA 3HNSL 3RB5A 1DVFA 4HQQH 2ROXA 1ND0B 1ZHNB 4XPTH 4A6YB 1VDGA 4B9PA 1CVSC 2XVLA 3S7GA 4M77D 4HCRH 3W82A 1B0GA 5FHBH 1NH6A 3X26B 5EO0B 3SDAA 3L16A 2YMOA 3EOYG 3BP6B 3JCMV 1I85A 2IADB 5K9JH 4G7QB 1NCDL 5D71L 1MHNA 5AB0A 2DQEL 3FU0A 4ELMF 2AXGB 3A5ZB 4J3OH 1XH3B 5I2IA 1GCPA 2L3SA 4C5HA 2WCSA 3FO0L 4RGOH 3GK8L 2C3WA 1KB5A 4APXA 4G6ML 1X9RA 4KU1A 3FOLA 3N41B 3TBYB 3D50A 3MRKA 3OKMB 2X3CA 3L13A 1UGRB 1KZYA 3QARA 2XKNB 3BKYH 5HHNB 4Z78A 1XGZA 4D0CB 3H2WA 4FQ1L 4GLRH 4G7RB 4JM2F 4Q58C 2X12A 4TLTA 5A1AA 1R75A 4YBLB 3V2AR 4N0CD 3BVNA 4KPHL 2XHNA 2XUWA 4HKBA 3V7AE 1EFXB 2E5EA 5LJ5j 3SDCC 3WIFA 3BRFA 4EO5A 3DRTA 4FZEH 5FM4A 3U2SA 3GSNA 1B3JA 1VESA 4OCWH 3TZVA 3U1SH 3GHEL 3VG9B 3WTSA 1C16A 4ZS6D 5CLWA 1WIOA 3RFZC 2WLMA 3AREB 3TF7C 2MNUA 3BP7B 4PG2C 2P5WE 1RZPA 3NRPA 1LO4H 4L3EE 1FFPA 5GJSH 2HG5B 5TD4A 3T3PB 3WEXB 1D9KA 2BSSA 4R0LA 2OV0A 1LTXA 3AXLA 3N9GH 5T1LD 1PZUB 4GQQA 4JRLA 4UAHA 1TMCB 1JU5C 1KTKE 3O3AA 5JQ6L 5B8CC 4XWGL 3MODL 1AQHA 3MAWA 3QWYA 3D3VD 2ARWA 4LIQL 3QWOB 4OFPA 5C09A 1M1XA 1RIHL 1IM3B 1XH1A 1EHXA 1QUNA 3O41A 2BSTB 2GJZA 4B9YA 1KGCE 1P7KB 1W2KT 4TMPA 2JKWA 4WUKH 5KANG 3RWFB 4B9CA 1JP5A 1VQ6A 3OYIA 1MH5B 4LSUH 5D72H 1EX0A 1G6RL 4JG1L 1BIBA 1YY8A 2FIKB 3UTTA 3QJYA 1L3WA 4XNMB 3BWZA 2DWEA 3LNEA 3VWJD 4R4FL 2XA8H 4XCNB 4HUMB 3KL5A 4OI9A 1YJ9Q 4HCZA 4QHUA 2C5DC 3FQXB 4FQHA 4JFWA 3AC0A 2CR3A 5JIMA 2RD0A 1UUNA 4QT5B 3FW6A 2MWOA 2AQ3A 2NY7H 3LVEA 5GRYA 1I9JL 3F00A 4PJ7F 5CD5C 2B16A 3SO3B 5JPNB 3GSOB 1X2QA 2F7OA 5CKFA 2EO1A 1JRHI 4ZPVB 5EG6C 1QBMH 3FH8A 5A2JH 3VXRD 2VT0A 1OXYA 4OB0B 4AV4A 4GRLA 5JO5B 1QSEB 1TR7A 2VITA 2Z31A 3G4SA 3QQ9D 4PB9H 3P4NA 3O4LD 2CSQA 2FQDA 4XO8A 4H1LG 3DYMA 5BRQA 1EXUA 3LH8A 2RH2A 1JXMA 2AEPH 3AMLA 1VIFA 3LIUA 1XL4A 4UWQB 3UABA 4DT2A 4PY8I 5KN5B 2GI0A 3BMVA 2Y1ZA 4KRPC 4MNGB 5GGVY 3ZOAA 1WYXA 5KZCB 3E6FA 4KMQA 3T8MA 4ONOA 5EOQH 2CZNA 4XNXL 1U58A 1V5JA 3JSCA 1VOMA 3F12B 4N8CH 4J7RA 3FTZA 3UTQA 3D30A 1WIUA 5A0LA 3OMGA 1CE6A 1T1XB 4BK5C 2OJ2A 1J1PL 1Z6JT 2LTQB 3EJTA 4M77A 3DX9A 5D1ZA 1WNLA 1WZLA 2AGJH 5FGCE 4URKA 2BNRD 1U95A 5FYKD 3TN0D 3SE3C 1TFPA 5EO9B 1KCVH 1TT6A 3QRGH 1EGJL 2W10A 1X44A 4GW1B 5EUOE 4LASH 4PJFB 4KT0E 3CC2A 3Q1SH 4YSDA 3E3QE 4LLQA 5KYUA 1REIA 2VH5L 2BP3A 1J5DA 3UO1L 1LDPH 1ZMYA 5DT1H 4BDZA 4MDXA 4S1QH 3QRFM 5E70A 4N5UA 1PKQE 3CXFA 4NAQA 5ADPH 2X2IA 3HI6H 1BXVA 3L2ZA 3VI4F 5LCVA 1A65A 4GG8B 3SDDB 3G6DH 1SXSA 3FT0A 4FJZA 3OBAA 5GMKm 3KLHC 2H0JA 5JHMA 3ZEHA 4ZFGL 1CDJA 5I24A 5D7JA 5JOFA 3IXAA 3PXJA 1NGWA 4MJIB 2V8LA 1NCAH 1UYWL 4RETB 8FABB 2DM3A 1QLRB 5LVEA 2Y3NA 1G9MC 5F6HI 2MOXA 1FNGA 4CJ1A 4XPGH 1HOCA 4ODUB 3BKMH 4A38A 3QFDA 4DF9A 1OK8A 3BDLA 4ADGA 3WXMB 3PMIA 5CEZH 1FZJB 4BE6A 3H4FA 4BI3A 3BUTA 1RIUH 2VRAA 3P0YH 4IGBA 4TV3A 4YHOH 1JGUL 2FSDA 3ZKXB 3BPNC 2X6UA 2WBJB 3BWAA 5DUJA 3LD8C 4GG6A 1R46A 3W9DA 2P48B 1Z2KA 1G6RB 1H5BB 5T1LA 4ONGH 5I75B 1FPTL 5F6IC 1YEDB 4KGZB 1EO7A 4AH2B 2GUOA 3Q1JA 3CHSA 3NJGA 2B77A 3UAJD 1FN4A 3AQYA 3QG7L 3V4PA 3ZDXE 2E5QA 3VGEA 1TCRA 1IGTA 3LHPL 5E5UB 5LNGA 2KROA 4PRPA 5I6PA 1BJMA 5E5MB 4GW5A 1B3IA 2FL5B 3VXTA 1FX7A 1BFVH 5CP7B 5CGMA 4F17A 2NY0C 3L3JB 4RA3A 2GBTA 2BO0A 5FW7A 4PJBE 1O0VA 3QFGA 4EMZA 2R29A 4MMZA 2LJ3A 2A7YA 3L4UA 1YPZB 2O61B 1NBVH 5I15H 1PLBA 4K71C 5GAOp 4HPYH 2ZAGA 1DQLL 4OLVH 4RNRB 5DJZB 3GI8H 3ZKSD 3MCLH 2FATH 3PDOB 3R6NA 2NLUA 4IOIB 4XX5A 1S7XA 3QPXH 3RNKB 1IAKB 2K7AA 3L3HB 5IHWA 4X6CA 2ZXEB 3WY4A 4LKCA 2NYYD 4WFHD 2FB4L 3UYRH 4LHUA 4PMFA 4PLKC 5ID0A 3FO2A 3ZSTA 2G0KA 1IGQA 3FFDB 2DTML 1WCBA 1Z0NA 4JM2A 4Z18A 3H9SD 1WBYA 1X5GA 4K94C 4OLYL 2A9ML 2GSIB 4BK4A 5INDA 2Y07L 5DVKA 4WCIA 3H9HB 2X4QA 1UOVA 3CFKA 4KK9C 1A5FH 2V9UA 4MAYD 5F1IA 4NHCL 1XR8A 1ZLDA 5IN1A 4NKDA 5T5FL 1GGBL 1IKOP 3GNML 1OB1B 5K5YA 2YUNA 3K6OA 1PIGA 2D3LA 1BB9A 1XF4B 3O6FB 4L4TB 3ZDYB 2X2UA 5LJ5h 1RVFL 4ZO6A 2BNRA 3O0LA 4Z77A 2WLIB 2LCLA 3BUBA 4HUWA 5AG9A 1MFNA 2YLKA 2ZXQA 4YFLF 3CH8A 3N42B 2EVJA 2I26N 2MTAA 4LSPH 4G6AC 3VQLA 3VFWA 2B5IB 3TCJA 2PVOB 2FTAA 4M43H 1KC8U 2NXYB 1NFDE 4G7VH 4A2LA 1MJ8H 5BRZD 1ICTA 3MLPA 2EE3A 1J5HA 3DROA 2DJZA 2ESVA 1YNZA 2QG9B 4JHWL 5PAZA 2B4CC 1E67A 3MROB 2PCFA 3KDPB 5LWYL 2R0KL 2RB6A 4BCYA 2WXNA 2LLNA 3JCMX 2FX8H 3EYOB 3JV6B 3UJTH 2VR6A 4GSDL 4IOSD 3RY5A 2IAAC 4EKXA 4PJ9D 2RB8A 2CALA 4PRDA 4EXPX 4PJ7A 2OTLQ 4F2EA 3GKZA 4N2NA 3RA7L 3N3EA 4F7TB 5CUSL 2EH7H 1SRMA 3IBOA 4NN7B 4PJGE 5HYSG 4I18A 2LRQA 1FZMB 5E2JA 3CPWP 3RBBB 4P3WA 2ZUUA 4TQEL 1F90L 4XNUH 2BJML 1JN6B 1A7OL 4U33A 1HNGA 5IB5B 1N19A 2R1YB 3VJPA 2CSIA 3B3BA 2HX7A 2VWEE 4WW2B 3MLZL 3E2HB 1KLGB 5E4IA 4B9WA 3MRLB 4OF1A 1D7CA 2J5LB 4O2FB 3Q2NA 1BV8A 4MHHG 1ZA2B 2CCLA 3SQOL 5C71A 5IF0A 1DQIA 1H3VA 1N0LA 4W9CC 2OR8A 3GEWB 5FYJE 1CDYA 1TVHB 3LQZB 2WJ7A 1K73U 3VS6A 1FYTD 3RIKA 4RIRB 4CU8A 1A3ZA 1HL5A 1QSZA 3WTUA 3AWFA 1GMEA 1IIKA 3O9WB 2YQ2A 3C8KB 4FL4C 4ZOCA 5DMKA 4JGUA 2CHWA 5D8JH 5HHMD 2B3IA 1KDIA 3M46A 4BFNA 5C0DB 5E94B 2K6YA 3GSWB 3BZ4B 4JLRA 3ESVF 2VXEA 1XNIA 2VQUA 3H42L 1SQMA 4TM9A 3Q2WA 4LPXA 2LCSA 1UD3A 3UBXG 3FT2B 4TUUA 3RJOA 3SKNA 1Q90A 2X2HA 5C2BH 4OLUH 5D5MB 2MHAA 2QELA 1GCQA 3BCFA 3EJUA 3QJUB 4QHPA 1CZ8L 1KK7A 3PV7A 4KAQL 3FTGA 4XAXB 2AJXL 3VI4A 2EDFA 5GAN6 5ID1A 5C7XL 2EKSA 2CGYA 3SDXE 3G08A 2NYSA 1TYEB 2AEIT 4XNYL 5GRJL 4DBRA 3WHE0 1TTCA 2R0ZL 2N7BA 3IJ8A 1F4AA 1M3IA 5D7SH 3RR6A 1FF5A 2RQEA 3QG1A 1I8MA 1DEEA 4JFPB 2NSMA 2JTFA 3CMGA 1KFZA 3NH7H 4HC1A 5I1JL 1T2JA 4IRJC 2H9GB 1V29B 2MAMA 4BY6B 2VXQH 3MX0A 3HR6A 5LUMA 4CKVX 2KZ1B 2R23B 4YGVA 3WTVA 3S3DB 4E7KA 2LAAA 3VS1A 2DETA 1UENA 5FA3B 3PP4L 4PLIA 1KJVB 1MMNA 3M8OH 2EJFA 4M4RB 4XNQB 3MLUL 4DEPB 5LLIC 3FRUA 3T9NA 3DX6B 3TEXA 1KB5L 2YD9A 4Y16B 2UX7A 1HXMA 2AFNA 3KD4A 4J3OF 3TO2B 3DNKA 1ZVSA 1VA9A 2D7MA 4FQCH 4LSRL 4NJAL 4O4YL 5CIPB 5FLUA 2IWFA 2A28A 4EDXA 1M7UA 1J5CA 1PU0A 1YEJL 2HLFD 4IRZH 4M3KB 3ARFA 1BCMA 3LNFA 3VFTA 8AT1B 2CGRL 1FDLH 1LEGB 3EYFA 1X43A 3BY7A 4F9LC 3FAXA 1S1NA 3CCET 2NY5C 3K1KC 1I1AC 4HSCX 3BP4A 3GSNL 1MF2H 4POZD 5JMRA 1GZQA 1P4BL 2ITFA 3P4MB 1JZJA 1DO5A 5E2VL 2FRGP 2HKHL 2IH1A 3U0TB 5LNEA 3SO5A 3LV3B 4BE2A 4JZ4A 5IHUL 3RX5A 1XR9B 2VIRA 3C60C 2EKHA 4XP1H 4U2YA 1AJ7L 1GKOA 1UWGH 3WKNA 2WOYA 4ODXB 3JB9G 4KVCL 3HN5A 1VQOT 1JJ2S 3QQ3A 3JWNE 1DBJL 4J3UA 4NIKB 5LHDA 2I5YL 1YEHL 5CSGA 5IIEB 1YUKB 3U6XA 3VFRB 2OL3H 1J1XH 4HGWA 5GISH 5FLXE 3NIDB 4PW4A 4LLUB 3RNQA 5CD3A 4QR7A 3NCJH 4QRPE 4YOKA 3MR9A 3UROR 3QRLA 2P42B 1YJWT 3HCVA 4XTUA 2R7EA 1HH9A 3DRQB 4XP4L 1QD0A 1IKNC 1X5MA 4UCFA 5C0AE 4L9LB 3W9EA 1EANA 1DL7H 1N27A 1BF2A 1OAUL 3HAEB 2WYHA 3OKLA 4B9ZA 4XMLL 1VLXA 2BSED 3LRLA 1HI6B 1JZ7A 1IAOA 3LGLA 4EE2A 1TXKA 3BIBX 3CSGA 1I7UA 3P1VA 4JFOA 3PWPE 4K23L 5E2UL 5A3ID 4JMXA 1C5CL 3FNKA 4O02L 4BE1A 5F7MC 1UG9A 4I8DA 4B9FA 4ALAC 1UGSB 3RGVB 3RVWD 4HMEA 5MEPA 2HFFA 4UIKL 1OGAD 4GKSB 1AGEA 2VM3A 1ZUKA 3MUY1 5LBGA 4E42B 3I55Q 3CDGB 5GS0L 5L2JB 3S6WA 1PY0A 1DUYB 3AY4A 3DTDA 4KROB 5CN1A 1H3UA 3L4VA 3FUKA 4XZ4A 1TJXA 3C6LD 3DJRA 4FFWC 2VOTA 5CO7A 2YWWA 4ONHA 1LVEA 5GRUL 3T77A 4J3SA 4M7DB 4AQ8C 3II3A 2YIHA 1UVQB 2DF6A 2ITCA 2ICEC 3BUYB 3F04A 1P9MC 3VXMD 1UKQA 2DL9A 4JZOA 4NQUA 2ZCLL 2E47A 2DLFH 4NT6A 4P5TC 3D18A 3KDMB 1R19A 2YR3A 4M00A 3GRWH 3W11D 5I2IB 3GIBA 1KN2H 3QJHA 2DS4A 2VR8A 3Q2LA 2DWTA 4NPKA 4UT6A 3V6OE 4APXB 4PREA 5F89B 3SE8H 4HGMA 3MA9H 4UQEA 4JRFA 1S9WA 4OP0A 3IFLH 3MRKB 1L9TA 4OJEH 1G1KA 2KRMA 4GRMA 1U3HD 4QRFA 3NA9H 2A74C 4Z78B 2ZG1A 3ARBD 2MRYA 1CDBA 5IEKB 1CLZH 1AO7A 3QZ5B 2PPCA 4G8GB 4JL2A 4HOZA 5FUZL 2NUZA 2PCXA 1L4IA 3KMDA 3BVNB 4PG9A 1SXAA 5I6OA 4HKBB 5LCVL 4B41A 3WIFB 1UACH 1WPCA 2EQUA 3MYJA 3U2SB 3GSNB 5HTSA 1JERA 3TZVB 2D8JA 2C4FT 4TLKA 4XHJC 1ZLVK 3SE4A 1C16B 4MA1B 5IT9E 1T04A 2WSKA 1CFBA 3GLAA 3PREA 2NT1A 1JEGA 3RUGF 1B88A 1FFPB 4C8QD 1D9KB 4R0LB 1E8YA 1KV7A 5CZVL 1ID2A 3AXLB 3BZFA 4YWGH 1ZLWH 4AQ1A 1RJCA 3O3AB 4KMTH 1VQMA 1X5FA 2Y7SA 1LWHA 3SSGA 3G5WA 3BWUC 3RESA 4HBQA 4OCRH 3CMOL 4N2KA 1AXSA 1M1XB 1F58L 3TVMC 1QUNB 3O41B 1MRDH 1UWXH 4IRSC 2LMJA 5IVXE 2CP0A 1Z9SA 5KVFL 1P69B 4QHNA 1YY8B 3DGCR 2JFCA 2WBKA 2ZWSA 2K9FB 2LNHB 3UTTB 1OLZA 1JF1A 2DQHH 2DWEB 3ZTJG 3RZCA 3RKDD 4RWHA 4IJ3C 3LEYH 5HPOA 3PCYA 4QHUB 4FQHB 2QDLA 2VC2L 4XWOD 4ZSOB 1RZFH 2BNQA 4KUCF 3V4PL 4AC2A 4GAFB 1AS7A 3ZTCC 2R0WL 5GANd 3NJIA 4P4KD 4F7CB 4MWFA 2ZYHA 4O02B 4D9RE 4OU3A 3LN9A 2MCPL 4U6HA 1LM8V 3VO0A 4OR1A 2QKSA 3I2CL 1INEL 4ODWB 4PJOD 5E00A 2ZWLT 4S1RH 5E1IA 4XP9L 2R29L 4HCRA 1F6FB 2D7PA 2LU5A 2Z31B 1YYLL 4PJXE 1DSWA 2A9NH 3P4NB 4GAJL 2FAUA 5A6IA 1EK3A 3CH1A 4OB1B 1FGVL 4G80A 4RX4A 1EXUB 4HUKB 4TNEA 2R59A 3URGA 1N64L 1K6QH 4PQXA 3KZ8A 1HL4A 3OA6A 4OZGF 5CU9A 5EU4A 1PY4A 1EBAA 1CICA 1KY7A 1WZKA 5J12B 4RQQA 3RVXC 1TTFA 1Q82U 3CC4A 3II1A 4OY9A 4J6RH 4JRXD 4YSTA 4A04A 3DJ9A 3DBXA 4NBXB 1Q9OA 3RLSA 2WANA 3UTQB 1NCWL 5C9KA 4HH8A 1NAMH 3QXUA 4YBQD 4DBQA 3NTIA 5D1ZB 1Z7JA 1S6NA 1U95B 4LGRB 1B6UA 5B3JF 4FKEA 3JQOB 2IEPA 3WAJA 1HHJA 5H8DA 1UKSA 3VXMA 1CQYA 4KRTA 2XVGA 3KYKL 4J9CA 2V8MA 3SD4A 1TZ8A 2E74C 1DJSA 3QC6X 2H3NA 3K1DA 3UWNA 4PN6A 3B9VA 1AY1H 4AMXA 5IB2A 1UA6H 4R0KA 1VQ9A 1LK2A 4FN0A 4KRMB 2A0LD 4OM1H 4NSKA 3LSOA 2K9GA 4NQCD 1Q9KB 1BZEA 1S78D 1MVUA 2FT7A 3I9AA 4U7KA 4Z7NB 1BMWA 4HUVB 1KXVC 1RI0A 4W4OC 5JUEH 2D6FA 1TVBA 2EXTA 3WYRA 5D7JB 2NUTB 3IXAB 3R0MA 1NGWB 1AQDB 2BM3A 2LAGB 5JOFB 2E6JA 4HU8A 3J2PA 1ID5I 2A7BA 5LJ5d 3KH3A 4FCYA 2QVKA 3OF6A 4KUCD 3TYGH 1IT9L 4N2EA 1FNGB 4JKKA 2FRWA 2ICWA 3ZHLA 1HOCB 1AD0A 2ZSWA 3I84A 4ODSL 3QFDB 3MJWA 3Q7JA 2YXYA 3ZT5A 3WN6A 1TQBB 3HI5H 3CEYA 3WJLA 4P2YA 4M1CD 1TYJA 4J9DA 4AL8L 1NBQA 5CO1A 3Q8EA 2QL1A 1PSKL 3WAKA 4HJEA 4GG6B 3W9DB 2IH3A 2ZNXA 3BE1L 4XVUD 2AXJA 2VDOH 1KCSL 4FQXB 4LSDA 3BLPX 4TNGA 2NNCA 2LFEA 4WJG3 1DBMH 1OAZH 2UY7A 2Y72A 4Q9QH 3QB7C 2GUOB 4MAZA 4XB3A 1SG5A 2VC2B 3U7WL 4L1DA 1FN4B 3MBEB 3ZE0E 1PKOA 5L9DL 4JDSA 3ESNA 3V4PB 1AZGB 1TCRB 2A9DA 1IGTB 1OANA 3LOWA 5DHMC 5SWQA 1TOXA 3M6DA 1ESOA 1RURH 4GW5B 4X80L 3VXTB 1OD9A 1XAKA 1FZKA 2ZD0A 4P07A 4Y19A 2YA0A 4AV5A 1I8LC 4N2HA 5I6NA 2EEAA 4KUZL 2A3TA 1WWBX 4MMZB 4N2FA 3QI9C 2X4OA 1RAMA 2R1WA 4XPAL 4E36A 4OZFH 1PG7X 2YKLL 4HFWA 2XWDA 3OS1A 2E6PA 3CCUT 2VQ1A 1S7XB 1ZTXE 5KS9F 3HRZC 4X6CB 1RI9A 1H3PL 5DEJA 3FU6A 2H4EA 4LKCB 4P57B 3VTMA 4LHUB 3T2PA 2H3EB 1DUZA 3LPFA 2OYKA 5ID0B 1WHHA 3FO2B 4K8RH 4XP6H 3ES6A 1WCBB 2IFGA 3M17A 5EA0L 3CCLT 5AALA 2KMWA 5H37A 2CUDA 3JCMc 1GC1C 1WBYB 3ARQA 2BW4A 4LE8A 3NJFA 5INDB 2YD0A 1YDPA 3GBNL 4FC3E 4TUKL 4JFQA 4TNWF 2PPEA 2X4QB 4NUGL 3CFKB 5D70L 1OKEA 1K8AU 1IXDA 4PFEA 5F1IB 3DGGA 1KXHA 1XR8B 5C0JA 1QKZH 2EEDA 4NKDB 4MB3A 5C07D 2G75A 5AB1A 3B4NA 1UTDA 3OB0K 2WC7A 4QW2A 3A22A 3PV6A 3RUGA 1FORL 2VAAA 3C12A 1V05A 4HC1L 5E99L 2AJUH 1RKRA 1W16A 3HZVA 4ONFL 1EO8H 4Z77B 5CCHE 1MQKL 4HUWB 1SMOA 4HUUA 2WQWA 4LRNH 5CZXD 3LLRA 2NZ9C 3WJJC 2A38A 5GSRA 2KDYA 4RESB 2ZCHL 2UZIH 3MRDB 4BB7A 3PHQA 1WV7T 4LF3A 4RBPH 3RU8H 1INQA 2NY2C 4LLYA 1L7TL 5E0FA 2WSFE 4I0PD 4KH0B 3PHOB 2OTJA 4XCFL 2ESVB 3PPEA 4N85A 2XQBH 5C2UB 3MBWB 4H8PA 5DZJA 2PCFB 1VQ6T 4FXGC 2NY1C 4HIXH 3C94A 2V5RA 3OKOA 4YC2C 3CG8A 5EU6E 4ZTPH 1BVLA 2HCKA 1E2WA 2TSAA 2LZ6B 2NY3D 1M1FA 4WI4A 3ALXA 3VAEA 2RD1A 1MWAA 2GTJA 5GAMh 4ODTL 3ML9A 4PJ7B 4WAFA 4AYBA 5E1QA 4HS3A 4LP8A 1BD2D 3IQLA 4JZNA 4I18B 5FDWA 1S46A 3DV4A 4LNPA 3KBHE 2RR3A 4KNTA 5LGJB 2CJUL 4PJAF 1AYRA 4YGAB 1A4AA 3WHE1 4YHNB 3WUZA 1WTGT 3ZXAC 1GGYA 4K73A 2WXPA 1OIOA 4FAAB 1KJ2H 3QYNA 1GYUA 2QQLH 5DMGC 4OZGA 4EOWL 3T4AA 1RPQA 2EAEA 4N4IA 1N0LB 2A4CA 3CN1A 3OLGA 3G71A 2HRPL 3HC3H 1BQLH 1MDTA 2JELL 2DQUL 3QUIA 1Y96A 1PF3A 2QA4A 1PD1A 1DQJA 4X5XA 3D4CA 5BZDA 5DMKB 1MFEL 2M16A 1WC7B 3KLQA 4TVPD 2HRGA 4P04A 3MRRA 2DQCH 2PR9A 3JVGA 3DETD 4JLRB 1OAJA 4WFGD 2OZ4H 1QHPA 2AZAA 5ISZA 4X1VA 1O9WA 1JHTB 4HCCA 3OHXA 3SKNB 1T4KB 1BI1A 1OT4A 1FGNL 2H2PD 3FQ1A 3UAAA 3UTOA 3QCUL 4YDMA 1BVOA 4QKUA 1TITA 3AACA 2EKSB 4N8UA 3SPGA 3G08B 2L0AA 1BQKA 1CR9H 2AKRA 1X5AA 4NO0D 2J88L 5I1GL 5J57B 2WGNB 4K7FA 4JDVB 4OZFG 3NESA 4A2HA 1G0DA 3EJPA 4ZFZA 3TJHD 2XOTA 3QEQB 1CSKA 2WKOF 2XA3A 4CC4B 2CCWA 4RGNB 1I8MB 1IZJA 4ZRGA 4F8QA 3RWHA 3MDJA 1TJHH 5A2QE 1NMBH 7FABH 5CQXA 1BM3H 4R84A 3K8KA 4YGVB 3SPJA 1HN1A 4FDWA 3ETBJ 2CO4A 3Q8FA 3D2TA 4HU2A 4WEBH 5FGBC 5IXBA 2X3BA 2VDLL 3FRUB 5D7IF 1EH9A 2G2RB 2YO3A 4UT6L 4C4UA 3MJ8A 5JHDE 3UZVB 3OBWA 3WNPA 4U2ZA 2DICA 5DO8A 4HWBA 4PJ8D 5F8RC 4IUVA 3A8GB 4Y9EA 3RTQA 1D5IL 1AMXA 2W9EL 3RDVA 5D4IA 1IREB 1I8IA 1V3KA 2WYIA 4OKVA 3ARFB 4AEFA 4UINH 2QR0A 3P11H 4KK8D 2XDBA 3EYFB 5HCKA 4I0PA 1YA5A 4FLRA 1AGBA 3ZT7A 1CO1A 4CC3A 2YS4A 2GK2A 4QLWA 1GZQB 5LGHH 1T3FA 3T3PE 4NDMA 1KGUA 4ZZFA 1NGPH 2IH1B 2CKBL 1YBYA 5KVEH 2VIRB 4ZMXA 4DFHA 4G59C 4MJ5B 4Y4KB 3BD4A 3DK2A 2QXFA 4TQIA 3QQ3B 4HBCH 1XF2A 3HMXA 5KS9A 3X2QB 1T21A 2DL4A 2ZPKH 4NXSA 3MEUA 4AVIA 4CMHC 4ZMAT 3EOTL 4YNYA 3RNQB 2C4XA 3UMTA 5CD3B 3F84A 5E6UB 3MR9B 1D7FA 3VB8A 1IC1A 4PLNC 3VDBA 2E8YA 3APNA 5B1CA 3NMEA 3QUYB 3VXSE 1FL3A 5T3ZE 1RUMH 1HH9B 2R7EB 2WB7A 3NZHL 1OEZW 4NQEE 3V9EA 4M77G 3P0VL 5FRMA 3W9EB 3SKOA 1MAJA 3EUDA 4P23A 2WQAA 1OU9A 3IFNH 3CC7T 1IAOB 1WBXB 3QZ9B 4QOKD 3T4YA 1J9CT 1I7UB 1N7ML 1BX2A 2XJLA 4YQXH 3OKEB 1E3XA 3C6EA 3CN0A 4JK0D 4NPYA 1IE4A 4HS8H 2AK4A 2VKWA 5F9OH 4R56A 2LQRA 1H92A 3VXPA 1QSEE 5MEPB 2HFFB 4HQQL 4XPTL 3V95A 1AGEB 1DHKA 2OCCB 4I77L 4BH8A 2F5KA 3M55A 1QUPA 4HCRL 4PJ6A 5FHBL 1F3JB 4EDUA 2P8PA 2K9UA 2KZBA 1EDYA 2UZXA 2Y36L 1EEQA 2QFPA 1FI8C 5I5RA 1PJ9A 5GMKe 1KYDA 1G7QA 3HW7A 1YMMD 3ULUF 2OTUA 4J3BA 2WYTA 3HHRB 3NQKA 2E8ZA 1RAFB 2Y7NA 2XWJB 2JB5H 1EO5A 1UZ6E 1X4ZA 4N2CA 5IB4A 4JZOB 4DP7X 1CGYA 4NT6B 2EIBA 3D18B 1GHFH 4OFVA 4AW7A 1SLWA 3D2UA 4K7PX 2XN0A 2IDUA 5ICZA 3KPTA 3QJHB 3BKYL 5DWPA 4Y7OC 4IRZA 4PREB 1MFDH 2H32H 2W0LA 3MFFA 1S9WB 1CDHA 4RDQF 3GWJA 1JRHH 3WTYA 2EDRA 2FEDC 4CSTA 3FUNA 1U8HA 1Z0MA 1PLGH 3PABB 1V3LA 3S5ZA 4FZEL 4OI8A 3LNGA 1AO7B 2H5UA 1RUPH 2F8OA 1KTDA 4OCWL 3STBA 4PJAA 5FYKU 4HKXB 2J12B 3WXVH 3CZUB 3P54A 1AAJA 4PG9B 1E4KA 4Z3JA 3ME9A 2LQ8A 2YHGA 2OR7A 4KHXL 3LPWA 5GJSL 1LO4L 4Y9FA 4F15C 3O11B 3MYJB 3VNZA 1DLFH 5AW6B 2P52A 1X9QA 1FMVA 3N9GL 5M95B 1T04B 4Z7UE 3RVTD 2UWEB 2ID5A 4WHDA 3WN5A 1C8QA 2CKBB 3TFKD 5I73B 4A37A 2OL3A 5FYLE 1GCFA 1NL0H 3OZ9H 4K9EH 3BZFB 1C7SA 4K3DH 1U8CA 4AQ1B 4X99A 4WK2B 5I30H 4GO9A 4M7ZC 1JV5A 3Q3GA 1JJUA 3H6ZA 4GS7B 4LIQE 3HFMH 4WUKL 5JHLA 3LB6D 4LSUL 5D72L 4UTCA 1AXSB 2PQWA 4HIJA 4ZQKA 1BGXL 5DS1A 1FVEB 2HZHA 3RWCA 1ASPA 5G4NA 2E7CA 3V4VH 3C8HA 4HAFA 2PTVA 2NCEA 2HSEB 2FWOB 1IGCL 3LKNA 4FI6A 4QHNB 4E9WA 1HK6A 1WAEA 2RHYA 3RZCB 5C0EA 4M78B 3LH5A 3ULUD 2IAMC 5I6XC 4L8SB 5A7EA 1VGKA 3EGUA 3RNJA 2DEWX 5D7HA 3VGDA 2NSQA 1UEMA 2ZYIA 2J8OA 4U1KA 3H3PL 3NJHA 1VQNT 3H55A 2FR4A 5CN2A 2WKOA 5CQYA 4MWFB 3SKMA 4EN3B 2RJFA 4PB9L 4U6HB 4V11A 2HQHA 1AIFB 4WFEE 1SUHA 5IVOA 2XX0A 4F7PA 5LGYA 4FXKC 2W91A 4RA0C 4MYPA 1YPZE 4JZ3A 5E00B 2AEPL 1EMTH 1UCTA 3FSAA 4OF0A 4UAOC 4IIMA 1ULVA 4LUDA 4ABQA 2GCXA 4G80B 2CE6A 3CH1B 5MI0C 3AT9A 2YOCA 2VW6A 4P46D 3IDYB 3TWCH 5D7IA 1XGQA 1EAQA 1CGSH 2YAOA 3B1TA 3PAUA 4N8CL 3IDGA 3OSSC 5EU4B 1CICB 1J12A 3OX8B 4YXLL 3GS0A 4EZLA 1CI3M 2LJ0A 1LL1A 5DO2C 1OE3A 3DBXB 1KC8R 4JGJA 4MB1A 3ZL7C 1S7WA 3TU4K 1AWJA 1DN0B 1Q9OB 2PUKB 4XVTH 4CRPA 2ENQA 5I1EH 1KCVL 2V9QA 3QRGL 2ZUQC 2Z4TA 2AV7A 1DJYA 3WNNA 3MP6A 2YZ8A 5E2WL 2YGOA 5I23A 1ACXA 4BEIA 5DT1L 3HRTA 2VDPH 1NCNA 4S1QL 1J7VR 3QDGE 3RPBA 1HHJB 5ADPL 4IOFC 3HI6L 1SEQL 3ZHFA 3G6DL 4L5FE 1IBYA 2WXIA 5LJ5g 5BV7H 3HZ3A 4L4TE 3ZDYE 5IB2B 3T1FA 2DB8A 1WITA 5DJ8A 2GJ6A 3BIKA 3M4GA 1LK2B 1NCAL 2XNAA 2ZUWA 4NSKB 3LSOB 3APMA 3P3YA 1MVUB 2ZWZA 4KXDA 5AVRB 4A7VA 1AGCA 1TVBB 2YD4A 1VB9A 4L3CA 1A21A 3GJFK 4FRWA 4YDIL 4F1SA 3BKML 3FSOA 5JPMA 3B5TA 4HA8A 5CEZL 1NOFA 4WQOA 3UCQA 1D5XA 2X9HA 3HB3D 4KQ3H 3IRZA 7CGTA 2JKTM 2WMPB 5AZEL 2ICWB 4YHOL 5CN3A 1NTDA 1H641 4B9XA 1KT2A 5DA0B 1I5LA 3ISRA 1UQSA 4QTFA 2KLSA 1BYOA 2RCSH 4ELDA 3ZT6A 2DDQH 3GUFA 1VF5C 4CN1A 2OKMA 1JDDA 1B4RA 2BVEA 4ONGL 1QNZH 1K73R 4IKIA 4MD0B 3SYCA 3KLSA 5JORB 5JXED 1T3LA 3WIIH 2BOCA 1R3LA 2JCCF 1YJWQ 2I24N 2IH3B 4G8IA 2VM9A 2LT9A 4UB0H 5D6DC 3HG2A 5FU7C 5I21A 4PK4A 4JJNK 3ZK0A 4HIIA 4H8UA 5JXAH 2Y5TB 1O5PA 2NNAB 3L2RA 4HZ1A 3WY1A 5KE2A 2UY7B 3UC0H 2LQKA 3QUHA 3EJRA 2Z35B 5IQOA 2EH8H 3IGUA 1OCCB 2OI9C 4FQ2L 1FHNA 4PAZA 4C4BA 1FLTX 4K3GA 3G6EA 5SWQB 4EZMA 4OV5A 1PD0A 5BJTA 5IT2H 3PFQA 3DYOA 4MCYA 1FZKB 2W9LA 2FPFA 3PQYE 4UTAH 2Q76A 1E2VA 1U8OA 3V4LA 3MCLL 2FATL 1Z32X 2PR4H 2X4OB 4K3JH 4WWKD 2YQGA 5HJBA 5L8LB 5ILTL 1IO6A 3X1EA 1OWRM 3QULA 4Z02A 4HFWB 1L9RA 2QQAA 2CP5A 3KYMA 4U49A 4X5PA 3W0WE 1SVCP 3ZYJA 2VQ1B 3ARZA 2OCJA 4O2EA 3RWIA 1NAMA 3NZUA 2FGWH 4JFEA 1DUZB 1BI3A 5D6WA 1IBGL 3VRIB 1VQ4A 3BH9A 3SYPA 2FUTA 4M4PA 3M17B 1A5FL 5I8KH 5FC9A 3KBPA 4LLAA 1GY2A 5D55A 2J43A 2Y6SC 1R5VB 1BAWA 2HA1A 3V9FA 1VZHA 4BV1A 1WIPA 4YN3A 4HLZH 4JFQB 5DD3H 2ZOWA 1LMKA 5FO9A 3MLRH 3VGAB 2VLRA 5GGRY 4Z3EA 5SWZE 2ADGA 3DURA 4Y4HC 5E6RB 5JIHA 3FC3A 2G75B 1I1FA 1UUSA 1W72H 4HHGA 2VMEA 3PV6B 3RUGB 4NJ9L 4KO7A 4LSPL 2I7SA 1Q38A 1KBPA 4WWNA 3HZVB 4ZXBA 1WS8A 5HHOE 1IBHA 3A8HB 4HD5A 4PHZA 5HHXH 5L2KA 1WGSA 1RHFA 2JLLA 1K2DB 1NOLA 4HUUB 4QTHA 4QRRD 2P45B 1MJ8L 4L0ZA 5IR1B 1VFOA 5GSRB 4YAQA 3B56A 5EB9A 2KZKA 4ABWA 2F7QA 1HZHH 3WTTA 3KPMA 3OZLA 3PHQB 4LF3B 1G1OA 5B1AB 1INQB 2YWZA 4LLYB 3F6IA 2DTIA 4A68A 5HD8D 5GMKl 2BMKB 5BXFB 2I9LA 4R5TA 2FX8L 4HWBL 4OTXH 2DQTH 1CF8L 3RL1A 4TLUA 1GYVA 1M3JA 1HH6A 4JB9H 3REVA 1QBAA 2DPKA 3OKOB 1UGNA 2ED7A 1BVLB 1HL9A 2EH7L 2IQ9H 5KVGH 4IDJH 3B2DC 2D8HA 4JJ5A 4KRLB 1PKTA 2MNJB 5AOIA 4FA8A 2FBJH 1TTHB 4G5ZH 4JG0H 2B1HH 1CFSA 4XNUL 1T1YB 4Q7DA 5B1BB 4M7AF 1T7YA 2PXYB 3IMSA 4HS3B 4M5YL 3UBGA 2VZVA 2Q1EA 3CN2A 5I1KH 5FGSA 3EADA 4BBWA 4ODBD 3VFOA 4ANVA 2KPNA 3DV4B 2L7EA 3IDIA 3OY9A 3UZEC 2RK2A 3HEIB 4TS6A 1NMAH 2JZ2A 2G9KA 1SLVA 3K2MC 3FUDA 1NC4A 1KYUA 2MFNA 3HN8A 4PRNB 5IBLC 1AOZA 1Y6MR 3MXVL 1RXLA 1W70A 4Z8FH 2A73A 4P5SA 5GRWA 5EF2A 3SPHA 4R4NC 5TQ0H 3FQ4A 2JH2A 1OTUD 3GIVA 2Y9RT 2GFBA 4FQQA 5LXVA 5D8JL 3GIZL 1OPKA 4F9PC 1RUKH 1ABOA 3META 2EGCA 2HYMA 4Z7WF 1Y96B 4Y2LA 1G3YA 2H8HA 4X5XB 5BZDB 4PBVC 4WUUA 3RP1A 1AG0A 4HJ0C 3HC0A 1BQHA 3P3TA 4YBLC 4PWJA 4DGVH 5C2BL 5IGXH 1HCYA 4OLUL 3HUJF 3MRRB 3PRZA 3OMAB 1KQSA 2LLGA 2DIGA 4JM0A 2RJMA 4MQ7A 5E08H 1AHMA 4CUCA 1WPYA 4MAUL 4GBQA 4HX1A 1OP3K 2HTKD 3SDCD 1FSKB 4HH9A 3LEXA 4KULA 5ADOH 1KYOK 1C08B 5G4OA 3X13B 3TTYA 1ZWIA 5D7SL 3GMMA 2UXVA 4ME7A 1AWWA 3INZA 3NH7L 5E9DA 1VQ9T 5DRXA 4PJCF 2VXQL 3EYQD 1IEAA 3IB4A 3LRGA 2B39A 4HW6A 2XV0A 4JAMA 4ZFZB 1MCDA 2VZ3A 4R5VA 4M7DE 2DH2A 1MLCA 1G3SA 5DVPA 3MV8D 4HYTB 1D5MA 1VAHA 4P3CH 3H0IA 3M8OL 3RWHB 4NYLA 2Y3AA 2EJGA 2R8SH 4YSAA 1YN7A 2XFXA 2YRPA 3HS0A 3GPSA 1YJDH 4LCYA 4FYXB 1XF3A 3CFTA 3I9PA 4X50A 4B53A 4LQFH 3DVGA 3MJ8B 2JCCA 4IRZL 5DHXB 5INCA 4MQSB 5AAWA 4FL6A 1OW0A 4FE9A 4WV1B 1FDLL 3RTQB 1Z9QA 2AKLA 2VC8A 3ULRB 4RTUA 2XV6B 3BGMA 1I8IB 1M6OA 3FH5A 3MNVA 4M3HA 5AVSB 1VKXB 4G8GE 4AKQA 1Y07A 4P9MH 4DH2A 1BQ5A 1ZD6A 1M3AA 3CXCP 1MF2L 5D1QA 4IK7A 4X6DF 2QR0B 4BXVA 4Z7VE 2WXLA 2X0WA 2EQMA 1X9UA 1HSBA 2Y7OA 5B1JA 3JAME 4OJCA 1RD6A 1JPSH 1AGBB 1CN4A 4Q6IB 5TFSH 1QQDA 2YPKA 3D0VA 4XP1L 4D9QE 1DQQA 1XCTA 1IGMH 2N4IA 2R2BA 1UWGL 3AZUA 3CDZA 3P9LA 1ORSA 1T3FB 4GRWH 4NDMB 1JPFB 1QSFD 1KJ2A 2F54B 2Q3AA 4I48A 3K2IA 4YDNA 2GF7A 2FUQA 1JGDA 2BY2A 2WXHA 2OL3L 1DCEA 1H8KA 4PIRF 2EYWA 3H6JA 3NCJL 3FOMA 1OV3A 4L23A 4C92F 1YNTB 4WTWA 1XF2B 2V3EA 2GABA 5D1XB 2IVWA 1IQWH 1T21B 1GFCA 4PJJA 1RK0A 3N91A 1BXAA 5D7LD 4YNYB 2LVEA 1PG7H 3Q06A 3SGKC 4C4KO 1DL7L 4JN1H 4CU6A 3UTTE 3EYSH 4P3DA 2OZ4A 1FL3B 2N7AA 1XVSA 1BYMA 3JRZA 1Z3GL 3OXRB 3CCUQ 5I71C 4QO1A 4WI5A 1VQ8T 4KMLB 1Q82R 4N2DA 4P23B 4ZSOE 1ZXQA 4JUTA 3SDDC 2JI2A 3ARRA 5DRWA 3W1ZA 2QMJA 2X05A 5E5RB 3T4YB 3QDMD 1ET5A 1BX2B 2F19H 3LKPA 5GXBB 5ESQB 1IFHL 1D0XA 2EFIA 3CCLQ 2F53D 2L5QA 2X42A 4NPYB 4AGLA 3KLHD 1Z9ZA 1E4XH 1XV8A 2QGEA 3P3UA 4CW1A 1SY6A 4KKQA 2YRVA 2BC4A 2H1PH 3UXFA 1CBJA 3VXPB 4NZRL 3SPIA 1MAMH 5DK3A 3DO3A 3KCWA 4XTXA 2DEQA 3G1JA 3M58A 3D8MA 4BH8B 5L8KB 2NT0A 1CDGA 4HAGA 2P8PB 4P2RA 3TP4A 3KNBA 3WTWA 2I85A 2JQZA 2UZXB 3E80A 5MEND 1YEEH 1UE9A 4GH7B 4PRAB 5I5IA 2YXVA 3MV9D 2YN5A 2UVEA 3FPXA 3IMVA 2Z7UA 1G7QB 1I1CA 2OAWA 4XU3A 2OTUB 1KN2L 4F2MA 4NNPH 3A8LB 2W5PA 5E5LA 1YNKL 3ENEA 3SE8L 6TAAA 3MA9L 1YNLH 3CSTA 5DYOB 3IFLL 1F6AA 1RAHB 3D2UB 4LMQE 4TSCH 5CF3A 5ICZB 5AYFA 2MIOA 3NA9L 2YD1A 4JPIA 2Z91A 2AJYH 1RL2A 4XPBL 5C0GA 4OCLC 1CLZL 4QRTB 4MZ2A 1Y0LA 5A2IH 4PKCC 1OF0A 4M7AA 4DOWA 1U8HB 2AJSH 1UACL 1H8NA 4CBZA 3VRZA 3HZKA 3MRQA 1E9QA 1T7VA 2NY0D 4KGLA 1M7IA 4UNIA 2HNIA 2FDBP 3EH1A 3SKUD 1U8KA 2EO9A 2HBPA 5D2LF 1TTUA 4WDIA 1I75A 2ATPA 3A23A 3FB8A 3NGPA 2DY2A 4LVHC 4X0KA 3BYTA 2VERA 3ISWA 4KMTL 2ICCA 3P9MB 5EZOH 2IMNA 4E41B 5E2TH 5IESH 3WN5B 1VIWA 2QTXA 4JPKL 1XGRA 4LESA 4QRBA 3FFCA 4ZUUA 5EZIH 4A66A 2OL3B 3QBTB 1IUZA 4FG2A 4OCRL 2O93L 8PAZA 1FMKA 1YCYA 3CFQA 4RMSA 3EO0A 1U8CB 4KTEH 4X99B 4Y2DC 2NDGA 5FS5A 2OYLA 1JV5B 2IDTA 3Q3GB 5DJDA 1FXXA 4F80A 4DZ8A 3FC8A 2VO5A 2DMOA 1A47A 1Z9OA 2UVFA 2UZYB 3HUJA 4KOBA 4TSBH 2BVQA 2ORBH 1IAIM 1SDYA 4BZ1A 5C6PB 3BXNA 1QVOA 4A2GA 3LX9A 1HFUA 2Y2YA 3RWCB 3LEYL 3R1GL 1X75C 3CAFA 4G9FA 4KK9D 3LKNB 4HIPA 1NCCL 4KI5E 5H37G 4AK2A 3DA0A 2Q9OA 1CUOA 4NFCA 2VLKD 3EKCA 3OWRA 4DBHA 3NJKA 4LARL 4YDLB 1VGKB 5CLXA 4N2AA 1KG1A 2EXYC 4PJCA 4U1KB 5EUKB 1P5VA 4S1RL 3MA7A 2ZUXA 2FR4B 1V1CA 4URTB 1UJTA 4ZAKD 5C0IB 2B5IC 3RJDA 3SKMB 2A9NL 2KDGA 2NXYC 3TBVA 3VW3H 1NM9A 1XTMA 4DKEH 1YMHA 4F7PB 2MI6A 4G6AD 2IXQA 4WGVB 2GIMA 3TJPA 1QZ1A 1YAZA 1K6QL 2FJHA 1WFJA 3VE0A 3RVVD 4ADJA 1K9MU 2VN7A 4J5YA 4U6YB 4Y5VA 5IQ9A 1ZLMA 1XB6A 3T0AA 2ADYA 1KIRA 4HALA 2ENYA 3JTSA 2QGGA 1MNEA 5D7IB 4X6CE 3UPCA 1XGQB 3UTSD 3CD4A 2BTTA 3IDGB 3LH2L 4A4GA 3BKJH 5FYJH 1NAML 3IRCA 1HWWA 4U1GB 3LS5H 4M48H 1QVPA 4NN7C 2EW3A 2H32A 4ZS7H 3BRDA 3QFJE 1S7WB 3AT0A 3OYNA 4PJNA 5MENA 2DBKA 3KPRB 1MRFH 3J7HA 3KVPA 2OJEA 5LAXA 3JWOH 2V5YA 4X6DA 5AVTB 4BDVA 1F5WA 2AV7B 4BELD 3RL2A 2MCMA 4YZFE 3S3CB 3MMEA 4WI9A 4YLQT 1TG8A 2XN9E 1NEZA 3E2HC 1UA6L 3G6JF 4KH2A 5EN2A 1U93A 3I3EA 4MDJA 4RGMB 4MNQE 5F9WB 2W60A 3A8OB 3T1FB 2BFGA 2FECL 2O5XH 3GSUA 5DJ8B 3U30B 1T89A 2GJ6B 3BIKB 5CKAA 4U1SA 3OYHA 1I0CA 1UXWB 5ANHA 2ED1A 4C92A 1Q0XH 3O9WC 1AGCB 2F58H 2AXFA 3QJVB 3TYGL 4PW3A 3Q43A 5FV2A 5HHQA 2FX9H 3QRBA 5JPMB 3BX7C 4TVPH 2G4GA 1K76A 5ANME 1D5XB 2JN0A 5CILH 3U7YH 3ZDWA 2YD3A 4JFFE 4Q2ZA 1Q82C 2FK9A 1CTNA 4MQXD 2HAZA 1KT2B 1XGUA 2RHEA 3OYFA 1UQSB 3EDKA 4JQVA 4CU7A 3SE6A 3V4VA 1M05A 4L4JA 4PM1A 4EIGB 2VDOL 5GAMg 4HPOL 5GQBA 3NACH 1JV2B 1AZEA 5LN4A 5DLML 1DBML 1OAZL 1TNNA 4EI5D 2RJDA 2BOCB 1R3LB 1TFHA 2YFOA 5CHNA 4OF8A 5GGSB 1BF8A 1HILB 3OS2A 2IOMA 3Q6GL 3B2XA 3PFUA 3FZUC 5C0BA 5EO1A 4D8KA 4XB8A 4HIIB 4KH9A 3QUZC 3I5SA 2OP4H 4Y5YC 3G3LA 3LH9A 4BY6C 2BOLA 1F3DJ 2OLDA 5B1KA 3WSQH 1RURL 3CC7Q 1SMAA 1GR7A 1BCOA 2E5KA 5H2BA 5J0BA 1FLRL 4UT7H 5HGAB 2OMBA 5T3XD 5AVYB 2XTLA 5AOJA 1NGZA 3SWNC 3PXLA 3AUVA 1VYUA 4Y2OA 5I0VA 4OV5B 3IFOA 4DEPC 2E3HA 3ZQXA 5BJTB 2VGNA 4MCYB 1XF1A 4GAGH 4ABUA 4BFKA 3Q8CA 1YEFH 3RY4A 2D4DA 1U8OB 3MBXH 3O2DA 5T8IA 1EDHA 3G04A 1E6OH 2JWYA 4AZUA 3O3UN 1NINA 4W68A 4N4HA 5DGRA 5E51A 2JVUA 1YY9C 3FCSA 2DYPD 3QULB 4MRCA 4CA4A 4K8RL 3O3BB 3MRBA 1JQQA 3KYMB 3ATAA 4XP6L 5GRXG 2IGTA 4X6EA 1HNFA 2F1AA 3I75A 1YHQA 4O2EB 2VDNH 3MGOA 5GRVL 1NAMB 3RWIB 3BH8A 1VCAA 4JFEB 5LG6A 3BH9B 1MG3C 1CKBA 4XN7A 1WICA 2HXAA 2J73A 4GXVH 3LRKA 4F5CA 2JKIS 4L2YA 4OMQA 2CO6A 5DSCA 5GZOC 1JPTH 5E6ZA 1QKZL 5B38A 3WKPA 2D7NA 1MY7A 3MP8A 2NY4B 2XTJC 1WA1X 3P0GB 5GS1C 3ZN6A 5F21B 4NWTL 2VLRB 5D2LA 2D3NA 5LB1A 3C60D 4GY4A 1RABB 2P5EB 4CC7A 1TQTA 2AJUL 2ADGB 3DURB 3QEQE 4HKZB 4JO4H 4PJIE 4WI6A 1SJVA 4X9HA 4RGNE 1F4YH 1HZKA 2YSSA 3AG1B 3ILEA 1QVFA 3CDCA 4LRNL 2P43B 5JW4Q 4MXWH 2X4PA 1WD9A 2JKRM 5L8RE 5K9KA 2KXDA 1W4SA 2UZIL 3IE4A 3RAJH 4ZXBB 3E1F1 5L2KB 4PVBA 5C7ZA 4DK6A 3OJDA 4YAQB 5FW9A 1II4E 1U8PA 3B9DA 5CJXC 1RMFL 3FUMA 1MG2C 1QR1A 3R6OA 3KPMB 4CVZA 2XQBL 5E0QA 4HIXL 2DBJA 2BKDN 4LCWB 2FJUB 1KNOA 2I9LB 2XIDA 2OMYA 2PYEA 4WO4D 3ULVE 4JO2H 3RL1B 1ZVHA 3QXDB 4QYOB 3RGVC 4RMTA 3U6RA 3BRGC 3UG4A 1JYXA 2VDOB 4LPUA 3SDZA 3REVB 4DK3A 5IW6A 3KGTA 4ZX4A 4OGCA 4IKKA 1KGYE 1O9SA 3S37X 2DPPB 3MLYH 5DUPH 1TZAA 3HFFA 3KR3L 4JJ5B 3RDTA 1A9BA 1W80A 2RHZA 3IE9A 1DVFC 2Z4QA 4XCYA 1UM4H 1XT5A 2XRAL 4QHMB 3RI5K 1XGTB 4M75E 4OB2B 2B08A 4EVNB 2D8KA 1BZ7A 3D7SB 3FT9A 5IHBA 3G7ZA 2H47C 5C86A 4X9GA 3SDAC 5EUOF 1B4LA 1KJ2L 1I85C 1TXQA 2C9PA 2QQLL 4ZBJA 3L42A 4UTAA 4HOWA 3WMQA 3GDBA 4EI5A 1VQNQ 2KERA 3LQAC 1NC4B 3L4TA 3STLA 3VD0A 4MA3A 2WIMA 1ZT4A 3HC3L 1BQLL 3QHZL 4HLEA 2XZAH 2EVIA 4P5TD 3PDDA 2YN3A 5IROA 4BSJA 4FQQB 3GIVB 2GFBB 1RJLA 3WTXA 1NZ9A 3I9GH 4OD2A 3GSXA 4JZJC 5FCSH 2OZ4L 5H94A 4A7TA 4D6WA 1YJNQ 4WUUB 4HMCA 2Y4XA 1KGWA 3QCVH 1ITCA 2EEFA 3HC0B 1UG1A 3AS1A 4XCEA 5EG2A 1WFUA 4CADB 1HU8A 2AQPA 4J6XA 2HD0A 2L04A 2VLJD 4MQ7B 2CHDA 2N1TE 4JVUA 4QY8A 3G6JA 4NP4H 4JY4A 3TZVC 5EEVA 2Z9TA 3S88H 1E3FA 4HH9B 4LDLB 1CR9L 1WAPA 5MP6H 3NCYP 1AZBA 3S5LA 3H54A 3OZKA 4XHJD 1D9KC 4R0LC 1A14H 5EIQA 2I7OA 3GMMB 3L3IB 4KRNA 3QZBA 4LMQI 1GTNA 2BZDA 4JFUA 2D2OA 5JR1H 4HDIA 1KWGA 3IVKA 1MFAH 3CD6T 3I56Q 4N1EA 5DRXB 3VCLA 1FP5A 1ADQA 1IEAB 2NR6C 4P9HH 1TJHL 4JAMB 3RE0A 2PKDA 3ZDXF 1KXQE 1AHKA 1MLCB 1AT1B 4NX0A 4EDWH 3D0LA 3SOTA 3TFBA 3SJVA 1OAQH 2W80C 3ZYIA 4WEBL 4BKTC 4TNVK 1TTGA 5DQ9B 1JD7A 4ISVA 1YN7B 1UCBL 3HS0B 5I0DA 3WIAA 3IU4H 4XTYA 3GI9H 4PJBF 1V10A 4I9WE 1MJ7H 4NC0B 4LCYB 1BVKA 1XF3B 1Q81U 2GGRA 4RZCA 1PS3A 3VI3E 1R34A 1YJ9A 4OLZH 1TWBA 5T1DH 3F5WA 3DVGB 2H6UA 3FBKA 2NNXA 7AT1B 3IETA 2NXZC 3N85H 3OPUA 5CJOL 3UIZA 4AYID 1AR1C 3OWEA 4UINL 3S5YA 5ELIA 1DQMH 2YC1A 1AO7E 1GL4B 4ZDHA 5E6IC 2DM1A 5K9OA 2NTFA 2DXUA 4TQPA 1NICA 3O3EA 4KDTA 2ZE0A 4MX7B 3SIKA 4GRLC 1I7ZA 3MP1A 5AYTA 2Z31C 5D1QB 3VFSA 2FH6A 1X3DA 2VDMH 5KYXA 5IUCA 4RFOL 5FA4B 4QI3A 5FUCC 4XH2B 5EEXA 4U3CA 5KVEL 2P28B 1QQDB 4WO4A 4DP6X 1O6SA 2HMIC 2ZUTA 2YPKB 2UWEE 3OG4B 1DQQB 1FQ9C 1XCTB 2GSMB 2R2BB 3CDZB 3P9LB 3KHQA 3MN8A 1JFHA 1ORSB 4JO3H 5F7EH 5T5NF 2BFVH 4F91B 1KJ2B 1DTUA 2BSRA 3COOA 2W0FA 4HBCL 4I48B 5L2JA 5F7UA 1BEYL 2JS2A 4FYYB 5GGSY 4I87A 3FHEA 1JGDB 4UM9D 2P5WA 2ZPKL 3I9QA 1OQOA 2ALAA 3D08A 4L3EA 2DRKA 4XR8C 3RVXD 1BIAA 1C5BH 3FOMB 3VNYA 5F0LB 1B9ZA 1EHLH 4FI8A 4M77C 1FYNA 1QLYA 4AIOA 3Q9QA 2CRYA 5I1HH 1RK0B 2JOYA 1HHGB 2AVGA 4BZ1L 3BAEL 1LJMA 5F7DA 5F7NC 1V7MH 1NFDF 5F3BA 4P3DB 3IFNL 2NDFA 4M78E 3DUUA 4M7LH 4MZ3A 4MJ6A 4GQRA 4QO1B 4YQXL 1MI5E 1MKFA 2QV2A 4HS8L 5DRWB 4U6TA 4Z7AA 3C09B 3AMKA 4AEHH 3J07A 2D3VA 3UAFA 4JUVA 3LKPB 5D7JC 4AG4L 2B1AH 1H6TA 1R33A 1BOGB 3D25A 2CS7A 2DIQA 4CW1B 5AVVB 1EFNA 2BSBA 2BC4B 2D7TH 4TULH 4BDYA 3ZU8A 1WJRA 1F4XH 2JIXA 2YXWA 4PJGF 1A0NB 1RL1A 4LXFA 2HLAA 4P2QA 2GFUA 5EF0A 1VZGA 4B0MM 4BSWA 5F9JA 4P2RB 2EKOA 2DM7A 4ESKA 2XWTA 4IGBC 4FABH 1PCXA 4TYUA 3RWEA 4NRZA 2JB5L 5HK0A 4XMUA 5KJ7E 5EC2A 3L2UA 4Y4FD 2X9XA 2QBWA 1GHFL 1MEXH 3EF4A 4RDBA 2IG0A 5KE3A 1XBDA 5CCKL 1ETJA 3BAJA 4F2MB 3BFMA 3TU6A 3L3DA 3LHAA 2I9TA 3UT1A 3FQTA 5IQ7L 2ZZDA 1GBRA 3ARWA 3QYCA 4UV7L 2M8XA 1YN8A 5SWSD 5DY9A 2VMFA 3GMOA 1JRHL 3IKCB 4RISH 1PLGL 4JPIB 2H3KA 2Z91B 3SGJA 2ADJB 5C0GB 2CR6A 3K74B 1SF5A 3M9QA 3C5JA 1S7QA 1X5YA 1Y0LB 3OAYH 5AL0A 3WXVL 4BACA 2LLLA 3MRFA 1B07A 5BOPA 4Y89A 3VWJC 4DQOH 2RH0A 4KGJA 3EF7A 3V0IA 1XXDC 1J0HA 5KEZA 3HZKB 4JHUA 3MRQB 1VQKT 3X24B 5EUOA 2DXCA 4MMZC 1DLFL 2RMNA 1UKTA 1M7IB 1HXDA 4ES9A 2AT1B 4BFRA 3RGBA 2MQ3A 1U8KB 3CGTA 1MN4A 3HJ0A 4LOUC 2OXGA 3FB6A 3QI9D 5DZ9A 1MWOA 2ATPB 4WDIB 3SDXF 3FB8B 1NL0L 5EFIB 3OZ9L 3SGDH 2N56A 4K9EL 3P4OB 4X0KB 4K3DL 2DMKA 1F41A 1KC5H 1EZSA 4KK5D 2HSIA 1QPKA 1YG9A 1RZJH 3HFML 3WNMA 1XGRB 4IURA 4GXUN 1UH2A 3C6SA 3FFCB 3DX7A 2MIZA 1T20B 3QQ9C 4J3XA 4ZUUB 5IZ7A 2BINA 3VXUE 1UASA 4JM2C 3EO0B 3RUXA 1UJ3A 1GSKA 4JGNA 1MHCA 3E9TA 5DJDB 1PNDA 5TJWK 4BM7A 3QJFA 3V4VL 3HVNA 1EXHA 2MPAH 4FNTA 4DZ8B 1LQBC 2CXKA 3HUJB 1DSFH 1WJ3A 3UGUA 2BVQB 4WENB 1MCKA 5I17A 1ZSGA 1XH2A 3BXNB 1OCWH 2HQEA 1QVOB 2APTA 5SX4H 4NKIL 4ZW3A 1JBJA 3BEVA 2HEQA 1XSKA 4RUGA 4G9FB 4WI7A 5DZLA 2NMSA 1NUDA 2DYRB 3KPNA 3VJ6A 1NC2A 2C9RA 5AFAA 1JPEA 1UXLA 2W59A 5KYYB 5DEZA 2K2MA 3KLLA 4R2GB 3V0AC 4L8DA 2DXBA 1ZE3C 3NSJA 4LCCC 2D3JA 4AG1C 2KR3A 1P5VB 3B6SA 1EMTL 4DGYL 3MA7B 3OV6A 5GHWH 3KVQA 3BPLB 1KCBA 3MTXA 1NUFA 1T7ZA 2NZ9D 3TBVB 4CC0A 3QP3A 4QAMB 2EVRA 1XFPA 1YMHB 1WHLA 5PCYA 3ARDA 2FYVA 2NY2D 3TWCL 3X12B 1VQ9Q 4KBPA 3VE0B 4PJBA 2F18A 4KJYB 5SX5H 3GXDA 1GL5A 4HVVA 1DVUA 3V5HA 4Y5VB 5IQ9B 1PCSA 1KIRB 4ZW6A 4AL8C 4J9EA 3JTSB 3N06B 2F0CA 2NY1D 1WO2A 3GBMH 1D1BA 3ZL2A 5I1EL 3HE6A 1U21A 4G2AA 4XVTL 2NQCA 4LBEA 4TF4A 3V79C 2OTLA 2J8HA 2PPAA 2VQTA 3MO1A 4LPTA 4AUUA 5ACZA 1SLXA 2H32B 4FNPA 1UEYA 3BW9A 2A3LA 1I1YA 2BHYA 3JV0A 1NLDL 1BLIA 4MCMA 1HK9A 5FUOL 5LAXB 1TZHA 1BREA 1FBIH 4NOFA 4X6DB 4BDVB 4Y4FA 2PVDB 2ROYA 3RL2B 4K11A 2IPTH 3MMEB 3QWRA 4UTBH 1NEZB 1JNLH 1FO0A 1F1AA 4BGDA 4FIBA 3QO0A 5EN2B 2K5FA 1U93B 1MLBA 1TZIA 4Y1TA 4MDJB 4YR6B 2ZPHB 1KIQA 3V0EA 2W60B 4NCC1 2KI7A 1G7PA 3FFOA 5DMGD 2RNAA 3HG1B 5D7KE 5CZRA 4U1SB 5J3HC 3VXOB 2CCVA 1KCWA 1ZV5A 3CBRA 2C9QA 2KK4A 4C92B 4ZD3L 2AXFB 3TLRA 5HI3D 4GBXA 4H88H 3EHRA 5B3SB 5C0ND 2RCSL 2TAAA 3GRGA 3KE0A 3G5ZA 4DP4X 2H7WA 2YAFA 3HHTB 1QNZL 2FHDA 5AW3B 4UU9B 2JB6B 3H3KA 3FDRA 4JN2A 3FULA 2JVVA 1XGUB 2DEYX 2QQ9A 4MAYB 3WIIL 3KBFA 5AVUB 1BQHG 3V4VB 1M05B 4UB0L 1F11A 1XCXA 5IQLA 3DXAE 1FWZA 4H25B 3GO1L 2NYYC 3ZQ9A 4C0DB 3JB9J 1JNHA 2J6WA 3M1OA 5JXAL 2PUOB 4NS5A 1PIFA 3J7AF 2FEIA 3UC0L 2YAQA 2Z0UA 2B1OA 5CHNB 5AVQB 2JCWA 4X5WA 1KQ1A 2BIQA 5F1NA 3L5WA 5C0BB 3UA7A 4HVWA 3MUUA 3MLWH 5EO1B 4HCIA 1VQ8Q 1BFTA 3HLKA 3V0DA 3VFVA 3KLAA 4LL1A 3GBDA 4HAKA 1DZBA 5FFOA 2DM4A 4PJGA 2QPEB 3I6KA 5H2BB 4CJ0A 3ZMEA 4UTAL 2C1PA 2J1XA 2VM4A 1G8XA 4IKJA 1NGZB 2R4RH 1EA9C 3S35H 3NFCA 1MHHB 2QTVA 1OSYA 1VRSA 3BVDB 3C75A 1YI2Q 3IFOB 4JFTA 3TEUA 1N6QH 2EUWA 1JWMB 4CI0C 3VRYA 5LKNA 5C0AD 2E70A 2K78A 2Q6WB 4BFFA 1IM9B 3G04B 4JKPL 1QBLH 1QO3B 3ZW3A 3DUSB 3EFRA 5IQNA 4IBUA 2FGWL 3ARGD 3LWIA 4LNRA 3ARFC 3MRBB 4P5MA 2CH4A 2EDTA 1YC7A 5I8KL 3MGOB 2F5AL 3BH8B 1J0JA 3NZ8B 2GBAA 4XMPH 4C8XA 4L5GA 4X6FA 6PCYA 5JIQA 1J8HD 3ASNB 5T3ZH 4NENA 5IVXF 2GK0A 3DKHA 2CO6B 5DSCB 4RFNB 4LDVA 1G7MA 1NUGA 4ZMWA 4UOZA 4IMKC 4DQAA 5B38B 2YUWA 1GBQA 4MLIA 2OM5A 4F8PA 5BV7B 2XWZA 4KO6A 5D2LB 3SDXA 1I8AA 1ADQL 3PDGA 4KI1A 2X6VA 1QQJA 2PCYA 5KBLA 2YSSB 5HHXL 3ZKMC 3NK3A 4Z76B 4H8HA 1NDMA 2DFUA 5L23A 5MEQA 1UHFA 2ZKHH 4YK4B 5K9KB 1HZHL 2HUHA 3A6BH 3G5VA 4JE0A 3TNNA 3VFGH 2PYFA 4NQDA 1ZT1A 2YMXL 1MW0A 3OJDB 2EKJA 3FL7A 1CXLA 4EUPH 1HHIA 1U8PB 1TQCC 4OTXL 3DHMA 1KBWA 4JKLA 2DW5A 4JJOA 2D7OA 4H2CA 4PJXF 4CVZB 2JNZA 1U36A 5LG1A 1X69A 4AUJA 4JB9L 2VXUL 1TU0B 4F7EA 1BDYA 1KNOB 3LAFA 3L6FA 1B2WH 3P8HA 3AG3B 4KGVB 2IQ9L 1RERA 2PYEB 3QSUA 1Q0EA 5KVGL 4IDJL 3L4CA 4UMGA 5DVNA 5SWZD 5IMOB 1NLPC 2A6JA 1G7IA 2DMCA 3WKYA 2FBJL 3UDWA 5A2FA 1J5IA 4ZOBA 3PGFH 4G5ZL 2B1HL 5DI8A 5JW4N 5BUAA 5IW6B 4N9GA 2FB7A 1J5OH 4IS6A 2VLMD 1A6ZA 1OARL 3NZSA 3AY4C 5KCHA 3I55A 1G9MH 1MJUH 2YPLD 3ILPA 1N9PA 3RDTB 1A9BB 4XCYB 5EZJB 4NRXB 2Z4QB 2CSPA 2E4TA 3BE3A 1NMAL 4UQAA 1LPLA 3EO1A 4X7DC 2F54E 4PRID 5CJBA 3NEXA 2V8IA 1TJIH 3MRCB 4Y1AE 4Z8FL 5C8JA 3IDNA 3E8UL 1JZ3A 3CCRT 3WXWH 4LPWA 1V7NH 2IDQA 3FSZA 5FU6C 4N2OA 5TQ0L 4LDCA 5K9QG 3STLB 1CURA 2F8IA 4MA3B 5D1XE 4Z7IA 1ZT4B 1EJOH 1RUKL 4M8RA 1OPGH 3QQDA 4G8EA 4KVNH 4ZNEE 2WXGA 2A6KB 4I3GA 1RI8A 4RAVB 5FYLH 4DGVL 1SNRA 5IGXL 4OD2B 2DL8A 1KB9K 2WXRA 4KKCC 4LPYA 3IFPA 4BA0A 2WTOA 4CVXA 4ERSL 3WENA 4QRPA 1RZKL 1CLCA 4G71B 3CXHJ 2I07A 5H94B 4PBXA 5E08L 1JXJA 5T1MB 5HI5C 2NZ1A 1NCIA 4LL4A 4CN6A 4C0ZA 3II2A 2HX9A 4KQ4L 4ZODA 4XCEB 2C0TA 4QF1A 3ATEA 1ZK9A 4QY8B 4M7AG 3G6JB 3LY6A 4JY4B 5BUPA 1QRNB 1AZRA 3SE4C 3V5DB 1Q1JH 3R4RA 1EAJA 2HLFC 3UF4A 1L7IH 5FKAA 3PWPA 3S5LB 3N1PC 3OR7A 3P77A 2VLLA 5I73C 3CCQA 3RBSA 5BVPH 1ZA1B 3RIFF 1SHXA 4HSAC 4AQ1C 4MCZB 4GLRI 4HDIB 1QASA 5ETUA 1N8RU 3VCLB 1AGDA 3OYJA 1CL7H 3TURA 2W65B 3SY0B 2ROTA 1Y6KR 3ZE0F 2OW7A 3MV7D 2R8SL 4JRYA 1PAZA 4M8VA 1DZ0A 1T0OA 2LX9A 3D0LB 2ARJQ 2HJKA 1HJCA 3SJVB 1T5WA 4K94H 4PV9A 1S4IA 2YUVA 2FZGB 1CFMA 4OD3L 4LDXA 4IUQA 1JZHA 3L3KB 5G4MA 4I4WB 3U9PH 4F7UG 2QHRL 2G3XA 2UX6A 3RWGA 4M3JA 5HY9A 1IB5A 2CLVA 3CHPA 2MMXA 4RZCB 1QW9A 4ENZA 4FLSA 4DO6A 4XPHL 1CFQA 3FQYA 4AQAB 2PN5A 4GQ9H 4P9ML 3F58L 3QZOA 5HYJB 3HI1A