2LX9A

Solution structure of escherichia coli ferrous iron transport protein a (feoa)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
83
structure length
83
Chain Sequence
MQYTPDTAWKITGFSREISPAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIETRRVSLVLRKKDLALLEVEAVSSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Escherichia coli FeoA and Its Potential Role in Bacterial Ferrous Iron Transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Ferrous iron transport protein A
total genus 10
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lx9A00
1FX7A 1G3YA 2GCXA 1QW1A 2K4YA 1BI3A 3MHXA 3HRUA 1U8RA 1P92A 1G3TA 1BI2A 3HRTA 1BYMA 5CVIA 1FWZA 2QQ9A 2H3JA 4O5VA 2LX9A 3HRSA 1G3SA 3GLXA 3E19A 1QVPA 1BI1A 2K5FA 2QQBA 4O6JA 2K5IA 2K5LA 1G3WA 2QQAA 1BI0A
chains in the Genus database with same CATH superfamily
3CBOA 1YITQ 1D3BB 1KHIA 4QVCA 2O2OA 4B9WA 2VASA 2PZ1A 1EZZB 1ZSZA 4BE0A 2DIGA 3CCUA 2YLCA 1AT1B 3OBYA 5EC7A 4OB3B 3JCMJ 5FWBA 3OW2A 1YJ9Q 4C0ZA 5GMKm 5GAOq 3QG1A 2CYZB 1VYTA 2GGRA 1LNXA 2O88A 2L3PA 2DVEA 1WPYA 4XTWA 2FRYA 3JB9D 4M77G 2FB7A 4F04B 1AWJA 2JZ2A 1IO6A 3THKA 1X75C 8ATCB 4PJOE 2NLUA 2OAWA 3MP8A 2COZA 2HD0A 1MGQA 1E6HA 5LJ3h 3OW2P 3M0UA 4M7AD 5GAN6 2F2WA 4F7UE 2NYSA 1FX7A 1IRXA 1VOMA 4E7JA 2K4YA 1K73R 3HKSA 2QQ9A 3NFCA 4O5VA 4RCCA 1R0BG 2YHTA 4M77B 2CP6A 1Y71A 2BKDN 3CCSQ 3HHTB 3CMET 2P4TA 2LVMA 2X3XD 1ZBXA 2DE0X 3CC7T 1G2BA 4E6RA 2HZYA 3S3NA 4LDUA 1QKXA 3S3MA 2A36A 2JS0A 1WGSA 1OULA 1QW1A 2DIQA 1SEMA 5D6WA 2C0IA 4XAXB 2PTKA 5LJ5f 1AEYA 1WLPB 4KULA 2DD4A 3M5AA 2A08A 2P4RA 3AT1B 4C92B 4C5EA 1I5LA 1SPKA 3JCMW 3TU4K 2C06A 4M75A 3VRYA 3UA6A 2QQAA 1ZX6A 4CC7A 1NBEB 3OYHA 1MMGA 2YRCA 1PRMC 2QXFA 1RAEB 3EHQA 1UDLA 3DKMA 4ATOA 1VQOT 4AFSC 4EPCA 1X2KA 4N0AC 3URGA 1UGVA 1N8RC 4LD9K 1EIFA 4K11A 1KC8C 1XQHA 3MEWA 3HSBA 3OYIA 2QEXA 2M51A 1CKBA 1VQ8Q 3CC2T 3I35A 3MEVA 4OB1B 3M0QA 3JB9I 2DF6A 2MYSA 2GCXA 2PQWA 2RJDA 4C92G 1I5OB 4DOWA 5GMKh 2OTJT 1JU5C 3ASKA 1WDXA 4RTXA 4JRPA 1YP5A 3FJ5A 4C0FA 4L6V5 1OX9A 3CXCS 1M90R 1X6OA 2AKKA 3EGDB 1V76A 1C6VX 2EGAA 5KYUA 2BE9B 4D6WA 3NTIA 1Q82U 1LJOA 4JZ3A 1K9MR 2DA9A 3AHUA 2DO3A 3LGLA 4C0DC 2JOYA 4L5GA 2X9HA 2KE9A 4KUIA 4JS4A 1G3SA 2X35A 1IHWA 1JB0E 1N6AA 4DQ2A 4GLKA 3GPLA 4BD3A 4B9XA 2ROLA 3VS1A 5FLXE 1X27A 3LGFA 3OSSC 2X51A 1M1KU 4HCBA 1Z9ZA 5CKBA 1YJNA 1VUBA 2GNCA 2EGCA 3SD4A 1AZGB 2M9UA 2K6DA 1M9SA 1YWOA 3G7ZA 1WFWA 3HRUA 1PRLC 1QWFA 2CSIA 2DLPA 3V7RA 4LE9A 3A8HB 1RAIB 4LNPA 2EKOA 2DZ9A 5GAMd 2K7AA 2FZCB 4LUDA 5EG2A 3OYBA 3M58A 2K5FA 2XI9A 1VQ8T 1WQ7A 3FC3A 2EFIA 4J9GA 3RNJA 2RJFA 3WVEB 2VWFA 4J6WA 3VKIA 4F16A 1FMKA 3CCUQ 4RMOA 5HK3A 3REAB 4IUTA 3X24B 1T0JA 4M7DE 4M7DD 3M0PA 1FMWA 2PU9B 5GAMj 1N27A 2COWA 3RUXA 1A0NB 1K1ZA 3NHNA 2BE7D 5A0GA 4FT2A 1MNEA 4Q5WA 3OB9A 1QCOA 4EIKA 2RI5A 1C1AA 1OEBA 1YCSB 4KRTA 3CQTA 1MHNA 2EYWA 5CVIA 1YJNQ 1H92A 4OGCA 2O4XA 2LJ0A 4RCBA 1K0SA 3BDLA 4F7UB 4NOYA 2PUOB 3CCQQ 1N9SA 1PCXA 1KIKA 2R5AA 2RQWA 1OZ3A 1G3YA 2O9VA 2MMPA 3EFOB 2YT6A 3EGUA 4QQGA 3SHWA 3QZ9B 3IQLA 1QKWA 3NGPA 5A0DA 5I2SA 2X4XA 5FU6B 4RKUE 3OQ5A 5FROA 3RERA 2KEAA 2DL5A 4HKEA 4RTWA 2XKOC 2R58A 2QQRA 3I9QA 1X69A 3X25B 2DKGA 3CMAQ 3PVLA 2RPNA 3L2WA 1WJSA 4VUBA 5GAOm 2AK5A 4FYWB 2Y90A 4C8QF 2QAZA 3C94A 1QP2A 1YCYA 2EW3A 2FRWA 1N9RA 2LTOA 1WJRA 4OVAA 3QYGB 4JUVA 1G3TA 1OI1A 3A1PA 2LT1A 4QT7A 5KE2A 3OYEA 3VS6A 2RB6A 1B34A 1YJ9T 1XOVA 2L3QA 1M2OA 4IIOA 1GCPA 3ZBDA 1GCQC 3EGXA 2VXFA 4PJNA 3EFSA 4J6YA 2RJEA 3D7SB 4ZGJB 2VVKA 2RHUA 4PJLA 2RQRA 3I56Q 4M78F 3PE0A 1M2VB 4BE1A 1TUCA 2FEIA 2CREA 1Q82R 1K9MU 4J9IA 2F69A 3GBQA 2P84A 1X6BA 4LDWA 3JCMd 3KUFA 2DJZA 2HSPA 5CIUA 3RIRA 1NG2A 3UPUA 3RMSA 3I56A 1RLQC 2EGEA 1CSKA 1M1KR 1UGRB 2X4WA 4IUVA 4HCCA 5CQXA 1Y07A 3OYDA 3LW5E 2J7IA 4BB7A 1TTHB 3L2UA 1NJIR 2KDSA 3F70A 1UHFA 4ESRA 4Z88A 1JXOA 4BI3A 2O9SA 3JB9J 5CR2A 2EVRA 4HA8A 4F7UG 1PKTA 5DY9A 4WTOB 1LPLA 2HSEB 2RMOA 1EFNA 4DEYA 2CH4A 1UJYA 2E3IA 3PMIA 5M9OA 3T9NA 2FHDA 1R77A 3VUBA 3TVTA 5CAIA 4M75D 2GTOA 3HFNA 1Q86C 1NPRA 1BCOA 1M4ZA 5GANg 4JJDA 2CZ1B 2D6FA 1WHGA 2LJ3A 3FEOA 3CD6T 2V26A 2H3EB 2AZVA 2LJ1A 1M3AA 2COYA 5A0LA 2OI3A 4M7DB 4AMCA 4BY6C 4XTVA 2ABLA 3KXTA 1O75A 3CMEA 2MOXA 4KH1B 1QWEA 4M78G 1Y0MA 3CC7A 2V1QA 3GIBA 3M0RA 1M5Q1 1RACB 4M75C 2KT1A 3EGXB 3G71T 4C8QE 2RM4A 1AHJB 1E6GA 1K8AR 1TUDA 3HRTA 1H8KA 2PVDB 1QVFP 1BB9A 2ZPEB 3CCEA 3CCRQ 2E70A 2YUQA 1M27C 1NLOC 2CZ7B 4JJCA 3QJ6A 3QPHA 1K9MC 1S1NA 1VQNQ 5KYNA 2ECZA 3H0HA 4ZN1A 3CCLT 2BZ8A 4J9EA 1P92A 3EAEA 1IGQA 2OTLQ 2KVQG 1MMNA 4GY5A 4DEXA 2YXYA 3INZA 2DXUA 4WF2A 3FB9A 3RKWA 6AT1B 2J6KA 2C0TA 2D0QB 1MNDA 3EH2A 3VU3C 5A2QE 2KXCA 3EH1A 1ZLMA 2C0OA 2QASA 5LJ5h 3QHSA 2YUNA 3EFOA 2MAMA 4X1VA 1H641 2HBWA 3VS5A 4RTUA 5GAOn 1RADB 2JMAA 2MI6A 2J6FA 1VQPQ 1PNJA 1MMDA 2DFUA 3E1SA 3SWNB 2X4JA 4OGEA 3LLRA 1U8RA 4F14A 2DM1A 2E6NA 2V8KA 4ELYC 3HL8A 1YJ9A 1KD1R 1H3ZA 2V8JA 4XU3A 3E19A 2KK4A 2PVGB 4M7AC 1WJQA 1F1BB 1YWPA 1VQKQ 4N4IA 1UGPB 2PVOB 2XD0A 4E7KA 4N0AA 3CCLQ 4E7HA 1VQ6Q 4M77A 5GMKj 2EQIA 3DB4A 4GLMA 1GFCA 2F2VA 5CKHA 1MMAA 2JTFA 4Z89A 5LJ3e 1NJIU 3VS4A 4E7ZA 4XU1A 4HT9A 3CC7Q 3QWYA 2EQJA 3OYCA 1I4K1 1NM7A 4MZTA 3MCAB 1VQ9Q 5KYXA 1GXIE 5HCKA 4JLGA 2DXBA 1YJWQ 3VS7A 5IHNA 1WHJA 2LZ6B 3OSVA 1Q81U 4ZNXA 3KFVA 1UFFA 4J7FA 3JCMQ 2RO0A 4XTZA 1JEGA 2DTOA 1C0MA 3JCMh 3J81E 3ER0A 4OMOA 1YFNA 2F2XA 4PKCC 3VS0A 3ZL7C 5GANf 3NMZC 2I2LA 2EAYA 4PFOA 4J9FA 5DLOA 4RUGA 2JM8A 5GAN4 2RI2A 3DLLA 4C5GA 1N8RR 2K5LA 4MZMA 3M0TA 4IUUA 3EG2A 1R0CB 3CCJA 1VIEA 4BDZA 2J6OA 4M7DF 2RK1A 2GFAA 2HL5C 4JJNK 5LJ5j 2DZCA 2WSCE 5GAMh 3A5ZB 1SF9A 4N4GA 3CBPA 4PLLA 1K8AU 1AWWA 1X6GA 2MIOA 3H41A 1PC0A 1PM3A 4R55A 2VGMA 4XU0A 1YIJT 1HSQA 4M77C 1VQ7A 3N5BB 4AFUC 4ZTJA 4M78E 2M1HA 1VQ9A 1K4US 3MP6A 3HP9A 1K0XA 3CPWP 4XK8E 3H0FA 1BCMA 2E5KA 1K73C 2ZPGB 1PG5B 1ZSGA 2Z0WA 1YJWT 4M78C 3M0SA 3I55A 1N5ZA 5HKCA 1LCKA 3BDUA 5HY6A 1XNIA 1OPKA 4LD6A 4QKUA 1H3HA 1RAFB 3E9GA 3JSCA 3CCLA 3CCQA 1NZ9A 3PNWC 4M77D 5GAOp 2PUKB 3CBMA 2E3HA 1E7OA 1U5SA 1W70A 4ZN3A 4DBQA 4IUQA 3HPWA 4JRKA 2SEMA 2ZAEA 3CD6A 3G4SQ 2BZYA 4BI8B 4C8QC 2RHXA 4FCYA 3OMGA 1M2VA 1QQJA 2DYIA 2L3RA 3RDVA 4D8KA 5IXBA 1WXBA 5AYFA 4JRIA 5IHKA 4C92F 3L2VA 3OS5A 1W2BP 3CC2A 2RHZA 1AZEA 1M8MA 4M78B 1J3TA 2DL7A 1IXDA 3CPFA 5FW9A 5KCHA 1LOJA 2YWWA 3G1JA 4HT8A 1X2QA 2L3SA 1KD1U 2IPOB 4DA4A 3CCET 4IKFA 1V29B 4PJOG 1FMVA 3NTHA 5CK9A 4J5YA 2GFUA 4A54A 2VV5A 2DMOA 1YI2Q 5GANj 1ZSZB 1YN8A 1VQLQ 3CCJT 3OYKA 1OU9A 3DB3A 1U1TA 1TOVA 2OTLA 4RG2A 4Y91A 2GBQA 1SSFA 4M7AE 5GJVB 3Q1JA 5GJWB 4MMLA 1GFDA 1YIJA 4XTYA 3JCMP 2E5QA 2CP3A 3LX7A 1Q86R 5LJ5g 3PIPA 1AWXA 2FL7A 3JAME 2D9TA 4HXJA 1IGUA 4DBFA 2W10A 4JS5A 2KGTA 4M78D 1Q7YC 1VQKT 1ZQ1A 1Q81R 2HCKA 1K76A 3H0IA 1KD1C 2B86A 1ZUUA 1W6XA 3FRNA 5LJ3g 2VC8A 4FW2A 1RABB 1KQSA 5LJ3d 5CO7A 2OTLT 3C4SA 2EQUA 1K9AA 4IUPA 2LCCA 1WZOA 4J9BA 4M77E 4M7DG 5GAN3 2NUTB 3E9FA 1W2BS 2OAUA 2QDLA 2R5MA 3UF4A 1WYXA 3CC4Q 5DLQE 3G6EA 5ECAA 5IH2A 2EJFA 3OS0A 4LDVA 2G6FX 5IXFA 1N8RU 2QTXA 3MJXA 2DD5A 1NYFA 1NLPC 1GBRA 5LJ3j 4KGVB 4E7LA 5GAOr 2ED0A 4BACA 3L1AA 5CCAA 3PFSA 2Y4XA 3HTRA 1UHCA 5I21A 1KJWA 3LH5A 4PJMA 1WA7A 2OJ2A 3G4SA 3CD6Q 1KQSS 1VQPT 3EG1A 4PJOA 1VQ4A 2PNIA 1BIAA 2IVWA 4ANJA 1KG1A 4M7DC 1OX8A 2EYYA 2QEXQ 2E10A 2QTVA 3HFOA 2XHCA 3NTKA 5KYXB 1PKSA 2CSQA 4JDSA 5I22A 2VUBA 1IREB 1OZ2A 2FG0A 2LNHB 4JJBA 5GANe 1SHFA 4FIBA 2E41A 3OS2A 3J80E 3P8HA 3BW1A 1NEBA 4IIMA 4C92C 2O4XB 2D0NA 3A98A 1HJDA 1WHHA 4CI0C 1JJ2S 2F1LA 3V8KA 5IHIA 1QVPA 2HMAA 1BI1A 2A37A 4MMKA 4AFZC 2RNAA 3GOXA 1VIFA 1NE8A 1TUGB 3MO8A 1W4SA 3QUIA 1UGQB 3CCMQ 4M75E 4JPBW 5HK0A 1M90C 4HVWA 2QQBA 2JVVA 3J7AF 1GL5A 2EWNA 2SRCA 4OMQA 1U06A 3OBWA 2DXCA 1VYUA 1YBYA 3M9QA 1TXQA 4OB0B 2J06A 5FWCA 4R56A 2RI3A 4F7UA 3LYIA 1RAGB 1FXXA 3VYGA 3PIOA 2FVUA 3M56A 4JLIA 1BK2A 2DXTA 2DK3A 5FU7B 1SSHA 2ATCB 2HNIA 3GNGA 3S3OA 2QG9B 2VKNA 4Y92A 3OW2S 4Y28E 2RD1A 4GBQA 2MK5A 2ZZDA 1ZUYA 4DBRA 3I56T 4E7IA 1Y96A 2BUDA 3NPFA 4Z8AA 1T3LA 1Q86U 1OPLA 3GLXA 5GANd 1PD0A 1WNLA 2QI2A 4LDYA 3CC4T 4OMNA 3PVQA 4PK4A 2LT4A 2ZPFB 3DLMA 1M30A 4B6MA 3L2QA 1YITA 2MWOA 3GF5A 2OX7A 4EMGA 2BIVA 1VQNT 1HK9A 1NPPA 2KAFA 4TVRA 4YTLA 3TCJA 4M7AG 2JUFA 5CKFA 1VQKA 3VV0A 3V7SA 5GAN7 4A4FA 3M55A 3JCMV 3BE3A 3UT1A 3LH0A 4NS5A 1ZUKA 3L42A 5FU7C 2HKQB 3E2UA 5GAN5 2QA4A 1YI2T 4II1A 2QA4Q 4KT0E 1B07A 3QIIA 3CMAA 3VJPA 2KT8A 2ESWA 1OYXA 1VQLA 5C6SA 3G6ET 2DL4A 4J9HA 2HKNA 3OYJA 4O6JA 5GAMf 1TU0B 1K8AC 3I5SA 2KNBB 4A4GA 2FPDA 5FRNA 2YUPA 3MHXA 2MCNA 1NYGA 1KSWA 3QWXX 4PJOB 2XG8D 3H9NA 5LJ5e 3A8GB 2K57A 1VQ4Q 1M3CA 2X4YA 3TREA 1B3QA 4C8QD 4AFQC 2HQEA 9ATCB 1KC8R 2M02A 2O01E 4NL3A 2LP5A 5CQYA 4QVDA 3C0CA 2A3LA 5CKDA 2EYXA 4R0KA 1JJ2P 1VQLT 5AT1B 2JXBA 4X9DA 1Q95G 4FU6A 1IB8A 3BY7A 4JRQA 2KMTA 1GBQA 2AZSA 2MPXC 2KRNA 2KXDA 4EDUA 2JT4A 5D7UA 4FYXB 1JXMA 4M75B 1TH7A 2DVJA 2MF2A 2JS2A 5J39A 1VQ6T 1SRLA 1O9SA 2V8IA 1VQ9T 2NUPA 2LC4A 3JCMf 2KSSA 1PSEA 3CCJQ 1PWTA 4LUEA 1NEGA 1YJWA 4M7AA 4OMMA 4HVVA 3OY9A 2RHYA 2LRQA 3QYHB 3R6OA 1I0CA 3SEMA 3SB2A 1WHKA 5IAYA 2FYKA 4MDWA 2P0KA 3P8BB 1VQ4T 3UA7A 1CKAA 2DRKA 2JTEA 3MKDA 3I5RA 5GAOl 1RAAB 2G3RA 1XTDA 1G3WA 1UG1A 1VQ6A 3EHRA 1YHQA 1BU1A 3FLGA 4FT4A 3TSWA 4QVZA 4C8QB 5KCOA 4A63B 2A28A 5I11A 5GMKl 3FJPA 1YIJQ 2ZPIB 2ENMA 1QVGS 4JZ4A 2DETA 1KQSP 2DEQA 1T3SA 2WACA 4C5IA 3OS1A 3PGGA 8AT1B 3JRZA 4FSXA 1IZ6A 1G8XA 4CRIA 1VQ7Q 4QQDA 1FWZA 1W1FA 1Y7XA 2XIDA 3MPUB 1U3OA 3CCSA 5GMKi 1OOTA 4A53A 5J26A 3L2RA 2KR3A 1VQMA 2DL8A 1GCQA 1I07A 4LXCA 1YHQT 1YITT 4QQ6A 2F5KA 2AKLA 3QKJA 4C92A 2JM9A 3UDCA 2JN0A 4Z02A 3JB9G 1BI3A 3U23A 1OV3A 4KGXB 1BYMA 4F7UF 1UGSB 2JNGA 2AHJB 2YDLA 1QLYA 3CCVA 3G4ST 3CCVQ 2CP5A 5D6YA 2KROA 3SWNC 1AWOA 3BFMA 1PD1A 2D1XA 2E6ZA 4PLIA 4AT1B 2HQHA 3VYHB 3EGDA 2CZ0B 1KK7A 1VQOA 5IN1A 4KGZB 2LQKA 1QVFS 1WXTA 4FL6A 2VGNA 1X43A 4C0DB 2EBPA 2GF7A 4A4KA 4OMLA 2CZ6B 1RUWA 2NUPB 2HBPA 3SFMA 3S6WA 3CCEQ 2E65A 2YLBA 5KYWB 2KYBA 2LX7A 2EKHA 3JCMe 1QVGA 4FYYB 2LQNA 2GQIA 1KC8U 3QZ5B 1GRIA 3KBGA 2DILA 1KQ1A 4C5HA 3OYNA 4J83A 5KYYB 3FDRA 4N4HA 2F5TX 2L2PA 2H3JA 2O31A 4C8QA 1VQNA 4V2SA 2HQXA 3R6NA 4M77F 2X3WD 1ARKA 2KRSA 1YNZA 3V8LA 3CCRA 4FM4B 2XICA 1QVGP 5CKEA 1DJ7B 1PSFA 3RKXA 2DNUA 2IG0A 3H8ZA 2LCLA 3VS3A 1M3BA 2EYZA 1EX4A 1AVZC 2HEQA 3RR6A 3OYFA 3OYMA 2BTTA 1X01A 4RTYA 2CUDA 2QK0A 2JTMA 4M78A 3JCMg 4RTVA 4OP0A 1AOJA 3FIFA 1VQ5A 1D0XA 1RAHB 3ZFJA 1KHCA 1VQMQ 1NJIC 2KRMA 2RJCA 4M7AF 1UECA 3QDFA 2LX9A 2JMCA 3VUZA 1VQ8A 1ZBJA 3CC2Q 2YUOA 3OYAA 1VA7A 2VYTA 1Y57A 1JO8A 1D1BA 4EMKA 3QO3A 4PNOA 1BKBA 2KBTA 1WHMA 1S72T 2FPFA 2QGGA 4KBMB 2QYZA 1BIBA 3X28B 3UATA 1UTIA 1MUZA 2K3XA 2CUBA 4E47A 1MV3A 1M1GA 4OMPA 2HDAA 2L5QA 1PHTA 1TWBA 5GMKe 1G83A 2Y4YA 5J3BA 3EFRA 1YHQQ 1D3BA 2DRMA 5IT9E 3LWIA 1MV0B 3PMTA 1HXDA 4KH0B 4C92E 3P8DA 1ZSZC 2DPPB 2L0AA 5GANh 1M8VA 3OYLA 3O8VA 1WX6A 2P0QA 1M1FA 2ZPBB 3TEEA 4EMHA 1WI7A 1WIEA 2EJGA 2K5IA 3X26B 4UC4A 3M4GA 3GNFB 2CGHA 3RESA 4PJJA 1WXUA 2E1HA 3CMAT 3JV3A 2DERA 1IHVA 2NUZA 2DYBA 2XDDA 2NWMA 1TG0A 2QEXT 3WXMB 1D0ZA 1VQOQ 1U1SA 3QBYA 2K3YA 2GTJA 2JW4A 4MDXA 3G71A 2EJ9A 1Q7YR 5GAMg 2YRVA 4E7SA 3CC4A 4OMFB 1VQ5T 2E4HA 2L8DA 1XJWB 1VQ7T 2NUTA 3M54A 4M7DA 2D8HA 3QJYA 5GAN2 2XMFA 1B7TA 4DOVA 5KYYA 4BE2A 4X9CA 4HVUA 3LWHA 1JJ2A 2YSQA 2WSEE 3A8MB 2CT4A 3META 5KYWA 2B8AA 4PL6A 3MEAA 3X20B 2XU8A 4A4EA 2DX1A 3M4YA 2CS7A 2WSFE 5LJ5d 1Q82C 1VQPA 4HCKA 4J6XA 1TSFA 4ZGEB 3EG9B 3MEUA 3OYYA 2EQKA 4DBHA 2QQSA 2EIFA 1I1JA 2QA4T 1YI2A 1SG5A 2DAQA 2K79A 1YJNT 3RMQA 3JB9F 5D6XA 3SDZA 1UB4A 2R57A 1QCFA 4XTXA 1D0YA 4OB2B 2JJ9A 2EYQA 4FYVB 2DBKA 4M7AB 2CP0A 1Y96B 4XTUA 2CP7A 1HD3A 4PJOF 5DM7R 2RH2A 1M1KC 2BZXA 1BI2A 2M0OA 3O5ZA 1Q81C 3JCMb 3WVDB 2M0YA 4AG2C 4BUGA 4XU2A 3UWNA 7AT1B 3MP1A 2I0NA 1T0HA 3RBBB 3CCVT 1S72Q 5FRMA 1D1AA 4MZPA 2D8JA 3V8JA 5L23A 2RK2A 2E64A 2DEUA 2K9GA 2LCSA 2ZCFB 2RHIA 1UEBA 3A8LB 2LQWA 3A8OB 2OTJQ 2KI7A 2V1RA 4ELZC 2LNVA 1ZA1B 4P5NA 4F17A 5LL6S 1V1CA 1RLPC 4EMKB 4IURA 4C92D 3ME9A 4EMKC 5FU6C 3JCMX 4AG1C 3TSZA 3PT9A 2DJQA 4C0GA 3REBB 2AIRB 4CC2A 1ACMB 2VB6A 2K2MA 2XDPA 2E12A 1SHGA 1S72A 1QMCA 4XQ3A 1SRMA 2CH4W 4NL2A 1OU8A 2GQVA 3M59A 4ZTFA 1R8OB 1B34B 1BI0A 1W2BA 4BI4A 4E2FB 3M53A 4LN2A 4KUDK 2LMJA 1QCNA 4M75F 3CPWA 3TQ7P 2QDYB 3I55Q 1KFZA 2HAXA 3OMCA 4M75G 3CPWS 1SKUB 1Z9QA 2J05A 2EPDA 1I8FA 5C0MA 2DTIA 4LDXA 2P0PA 1K73U 3CEYA 1ABQA 2RQVA 1D1CA 2KY9A 2ZGWA 1FYNA 1UJ0A 1HYOA 4PJOD 4L59A 4QW2A 2VXEA 5L8RE 3C12A 2CP2A 1LVKA 4RTTA 1TS9A 2FZKB 2A7YA 2FO0A 3QXEB 4BDYA 3EG0A 2RQUA 4CC4B 3QDRB 2CKKA 1I81A 4CC3A 2EQMA 4J9DA 1Q7YU 2RF0A 3CCUT 1WHLA 4FW1A 4J7IA 4ME7A 2AT1B 5KE3A 1RI9A 3G6EQ 4J8OA 2XDBA 2FPEA 4OF1A 4ZGDB 4RTZA 3CCST 4ORZA 1RI0A 3CXCA 2LDMA 4RG8A 4X34A 3C95A 4PFZA 1VQMT 1AD5A 2QGFB 1QP3A 4J9CA 2MWPA 2W0ZA 1G5VA 2YRDA 2CDTA 3I55T 2ROTA 2CT3A 4WCIA 3L2ZA 1OQKA 3EG9A 2RA2A 5LJ3f 3CCRT 2OTJA 2KYMA 2K3BA 2KQWA 3CCMA 5KYUB 3CCQT 2LQ8A 3VRZA 4M4ZA 3G71Q 5I2MA 3CXCP 3OA6A 2HL3A 3V7CA 1KQ2A 5KH6A 3EG3A 1UUEA 5GAN8 3M57A 2XK0A 3SWNA 4A4HA 2DBMA 2M16A 1M90U 3OYGA 3H6ZA 2RN8A 2DL3A 3JCMc 2H8HA 1VYVA 3ZEHA 3GP8A 1WQWA 4D8DA 5GAMe 3JB9H 4PFPA 3RKYA 2ED1A 1QVFA 1ABOA 4HCZA 4FSSA 1BBZA 1ZHIA 2RQTA 2FZGB 3VS2A 1ZA2B 2K2VA 2A0FB 1VQ5Q 4PJOC 3HRSA 1JQQA 4BY6B 1JBMA 3CCMT 2ZPHB 1D09B 1JRIA 2DTHA 2L89A 1RL2A 4C8QG 3CMEQ 3ULRB 3PTAA 1UE9A 3QSUA 2IIMA
chains in the Genus database with same CATH topology
3FEOA 3CBOA 1D3BB 3CD6T 5CKEA 1KHIA 4QVCA 4PJOA 1DJ7B 1VQ4A 4B9WA 1BIAA 2IVWA 5A0LA 4M7DB 1PSFA 3RKXA 2IG0A 3H8ZA 2LCLA 3OYFA 1KG1A 4BY6C 4M7DC 3OYMA 4XTVA 4BE0A 2DIGA 2E10A 3KXTA 1O75A 3CMEA 3HFOA 2XHCA 3CCUA 2YLCA 1X01A 3NTKA 3OBYA 4M78G 4OB3B 3JCMJ 3CC7A 4JDSA 2VUBA 3OW2A 1IREB 1OZ2A 3GIBA 4C0ZA 5GMKm 2JTMA 5GANe 4M78A 3JCMg 5GAOq 3QG1A 2CYZB 4OP0A 3FIFA 1VQ5A 4M75C 1M5Q1 1LNXA 4FIBA 1KHCA 3ZFJA 2E41A 3OS2A 2DVEA 1WPYA 4XTWA 3J80E 1NJIC 3G71T 3P8HA 2RM4A 4M77G 2FB7A 4C8QE 3JB9D 1AHJB 3BW1A 4C92C 2O4XB 3HRTA 2RJCA 4M7AF 2JZ2A 4CI0C 2LX9A 2PVDB 4PJOE 1X75C 3VUZA 1VQ8A 1JJ2S 2NLUA 2ZPEB 3MP8A 3V8KA 3CCEA 1QVPA 1BI1A 4MMKA 2HD0A 1MGQA 3OYAA 2E70A 2VYTA 5LJ3h 4EMKA 4M7AD 3QO3A 5GAN6 4PNOA 3GOXA 1BKBA 4F7UE 1VIFA 2CZ7B 1S72T 4KBMB 3QJ6A 3QPHA 1K9MC 1BIBA 1FX7A 3X28B 1NE8A 4E7JA 2K3XA 2K4YA 4ZN1A 3MO8A 3CCLT 1W4SA 4E47A 3CXCA 1P92A 3QUIA 3HKSA 3EAEA 2QQ9A 3NFCA 4O5VA 4RCCA 1M1GA 1UGQB 2YHTA 4M75E 4M77B 2KVQG 2L5QA 5HK0A 4GY5A 1M90C 1Y71A 2BKDN 2QQBA 3HHTB 2JVVA 3J7AF 3CMET 2EWNA 5GMKe 3INZA 2Y4YA 2P4TA 2LVMA 2DXUA 3EFRA 1D3BA 3OBWA 5J3BA 2DXCA 5IT9E 3LWIA 1ZBXA 4WF2A 3FB9A 3RKWA 3PMTA 3CC7T 1YBYA 3M9QA 1HXDA 3S3NA 4LDUA 4OB0B 3S3MA 2D0QB 1WGSA 1QW1A 4R56A 3VU3C 2RI3A 2DIQA 4F7UA 5A2QE 3LYIA 5D6WA 4C92E 3P8DA 4XAXB 2DPPB 1FXXA 3VYGA 5LJ5f 1M8VA 5GANh 4KULA 2DD4A 3PIOA 3M5AA 3OYLA 3O8VA 2FVUA 3M56A 5LJ5h 2P0QA 4JLIA 1M1FA 2ZPBB 2DXTA 3TEEA 4C5EA 4C92B 4EMHA 3QHSA 2DK3A 1I5LA 2MAMA 5FU7B 3JCMW 3TU4K 1H641 2C06A 2HNIA 3GNGA 2EJGA 2K5IA 3X26B 5GAOn 3S3OA 4M75A 4UC4A 2QQAA 3OW2S 3M4GA 4Y28E 2MI6A 3GNFB 2CGHA 3OYHA 3RESA 2RD1A 5GANd 3E1SA 3SWNB 2E1HA 3CMAT 2ZZDA 2QXFA 2X4JA 4OGEA 3LLRA 3I56T 1U8RA 3DKMA 4ATOA 1VQOT 4E7IA 1Y96A 2BUDA 2XDDA 2E6NA 4EPCA 2V8KA 4N0AC 3URGA 4ELYC 2QEXT 3HL8A 1YJ9A 1N8RC 1Q86U 3WXMB 4LD9K 1EIFA 1H3ZA 1KC8C 1XQHA 3GLXA 2V8JA 3MEWA 1U1SA 2KK4A 2PVGB 3E19A 3QBYA 4XU3A 1WJQA 3OYIA 3HSBA 2K3YA 4M7AC 2QEXA 1WNLA 2QI2A 4LDYA 4N4IA 1UGPB 3CC4T 3CC2T 4MDXA 3G71A 2PVOB 2EJ9A 3MEVA 2LT4A 2ZPFB 3DLMA 4OB1B 5GAMg 2XD0A 3JB9I 2YRVA 4E7KA 3CC4A 3L2QA 4OMFB 3OS1A 1YITA 2GCXA 2MWOA 3GF5A 4N0AA 2PQWA 2RJDA 2L8DA 1VQ5T 4C92G 4DOWA 4E7HA 1VQ7T 4M77A 2BIVA 4EMGA 1VQNT 4M7AE 1HK9A 5GMKj 1NPPA 2KAFA 4TVRA 3M54A 4YTLA 3QJYA 3TCJA 5GMKh 5GAN2 3DB4A 4M7AG 4M7DA 2JUFA 5CKFA 1VQKA 2OTJT 3ASKA 3VV0A 3V7SA 4DOVA 5CKHA 2JTFA 5LJ3e 1NJIU 4BE2A 4X9CA 4JRPA 5GAN7 4XU1A 4A4FA 3LWHA 1JJ2A 4HT9A 4C0FA 3M55A 3JCMV 2EQJA 2WSEE 4L6V5 3A8MB 3CXCS 3UT1A 3META 3OYCA 1X6OA 1I4K1 2B8AA 3LH0A 4NS5A 4PL6A 3MEAA 3X20B 2XU8A 3L42A 4MZTA 5FU7C 3MCAB 3NTIA 4A4EA 4D6WA 1Q82U 1LJOA 2CS7A 2WSFE 3M4YA 5LJ5d 1Q82C 1VQPA 4J6XA 4ZGEB 3AHUA 2DO3A 5GAN5 2QA4A 3MEUA 1YI2T 4II1A 3OYYA 4KT0E 3LGLA 2EQKA 3QIIA 2JOYA 4L5GA 3VJPA 4C0DC 3CMAA 1GXIE 4KUIA 4JS4A 2QQSA 1G3SA 1OYXA 2DXBA 2EIFA 1JB0E 1N6AA 2X35A 4JLGA 4DQ2A 1VQLA 4GLKA 5C6SA 2QA4T 1YI2A 3G6ET 2DAQA 4BD3A 3GPLA 3OSVA 1YJNT 4B9XA 1Q81U 3RMQA 3JB9F 5FLXE 5D6XA 3OSSC 3LGFA 1UB4A 3SDZA 2R57A 4O6JA 3OYJA 1M1KU 4XTXA 5GAMf 4HCBA 5CKBA 1YJNA 1K8AC 4J7FA 4OB2B 4HCCA 1VUBA 2EYQA 4A4GA 3JCMQ 2RO0A 3MHXA 4XTZA 4M7AB 3SD4A 5FRNA 2DTOA 1Y96B 1M9SA 2M9UA 4XTUA 3JCMh 3G7ZA 3HRUA 3J81E 4PJOF 3ER0A 2RH2A 5DM7R 1M1KC 4PKCC 1BI2A 2M0OA 4PJOB 1Q81C 2XG8D 5GANf 3V7RA 5LJ5e 3A8GB 3JCMb 2I2LA 2K57A 3WVDB 3A8HB 2X4YA 2EAYA 2EKOA 2DZ9A 3TREA 4C8QD 5GAMd 5DLOA 5EG2A 3OYBA 3M58A 2K5FA 2XI9A 4XU2A 2HQEA 3UWNA 4BUGA 3MP1A 1VQ8T 1WQ7A 2O01E 4NL3A 3FC3A 5GAN4 3CCVT 2RI2A 3DLLA 4C5GA 5CQYA 2K5LA 4QVDA 5FRMA 4MZMA 2A3LA 5CKDA 2EFIA 4IUUA 4MZPA 2RJFA 4BDZA 3CCJA 1VIEA 3WVEB 4J6WA 3V8JA 3VKIA 4M7DF 2RK2A 2E64A 1VQLT 2RK1A 2GFAA 4X9DA 4RMOA 5HK3A 4FU6A 3BY7A 4JRQA 2KMTA 2ZCFB 2RHIA 4JJNK 4IUTA 3X24B 5LJ5j 2DZCA 2WSCE 5GAMh 3A5ZB 1K8AU 4N4GA 3CBPA 4PLLA 4M7DD 4M7DE 1UEBA 3A8LB 5GAMj 2PU9B 3A8OB 1N27A 3RUXA 4EDUA 4ELZC 2LNVA 5A0GA 4P5NA 4R55A 4FT2A 5LL6S 2VGMA 4XU0A 1YIJT 4M77C 1VQ7A 4EMKB 3N5BB 3OB9A 4Q5WA 4IURA 4M78E 4C92D 4M75B 4ZTJA 1TH7A 2M1HA 3ME9A 3MP6A 4EMKC 2RI5A 5FU6C 3HP9A 3JCMX 1VQ9A 2MF2A 5J39A 3PT9A 4XK8E 4C0GA 1VQ6T 1MHNA 1O9SA 2V8IA 1VQ9T 5CVIA 1K73C 4OGCA 2O4XA 2LC4A 3JCMf 2ZPGB 4RCBA 1YJWT 2KSSA 3BDLA 1PSEA 4M78C 2XDPA 4F7UB 2E12A 4NOYA 3I55A 2PUOB 5HKCA 3BDUA 5HY6A 1S72A 1YJWA 1XNIA 4M7AA 4XQ3A 4LD6A 4NL2A 2GQVA 1N9SA 3OY9A 3E9GA 3M59A 2RHYA 3JSCA 2R5AA 1R8OB 2LRQA 4ZTFA 3CCLA 1OZ3A 1B34B 1BI0A 1G3YA 3QYHB 1W2BA 3R6OA 3CCQA 1NZ9A 3PNWC 4M77D 4BI4A 5GAOp 3SB2A 2PUKB 3CBMA 3M53A 5IAYA 2FYKA 4KUDK 4MDWA 4M75F 4ZN3A 3CPWA 2P0KA 2QDYB 4IUQA 3P8BB 2MMPA 3HPWA 4JRKA 2HAXA 3OMCA 3CD6A 4QQGA 4BI8B 4C8QC 3QZ9B 1VQ4T 2RHXA 4M75G 3OMGA 3CPWS 5A0DA 5I2SA 2X4XA 1I8FA 2L3RA 5FU6B 5C0MA 5GAOl 4RKUE 2G3RA 3OQ5A 5FROA 5AYFA 2DTIA 3RERA 4JRIA 4LDXA 2P0PA 1XTDA 4HKEA 1K73U 1G3WA 2R58A 2QQRA 2XKOC 3CEYA 4C92F 3L2VA 1VQ6A 2KY9A 3OS5A 1YHQA 3CC2A 2RHZA 2ZGWA 3FLGA 3X25B 4M78B 4FT4A 2DKGA 4QVZA 4C8QB 5KCOA 3L2WA 4PJOD 4L59A 3CPFA 1WJSA 4QW2A 5GMKl 2VXEA 5L8RE 5KCHA 3C12A 3FJPA 4VUBA 5GAOm 1LOJA 2Y90A 4C8QF 4HT8A 2ZPIB 1QVGS 2A7YA 1KD1U 3C94A 2DEQA 1QP2A 4DA4A 3QXEB 2WACA 3CCET 4IKFA 1YCYA 4C5IA 1V29B 4BDYA 4PJOG 3NTHA 1N9RA 2LTOA 3PGGA 3QDRB 5CK9A 2CKKA 2GFUA 3JRZA 1I81A 4J5YA 1WJRA 2VV5A 4A54A 4FSXA 1IZ6A 5GANj 2EQMA 1Q7YU 4OVAA 4CRIA 3QYGB 4JUVA 3CCUT 1G3TA 1OI1A 4J7IA 4ME7A 3CCJT 4QQDA 5KE3A 2LT1A 1FWZA 4J8OA 3OYKA 1Y7XA 2XIDA 2D6FA 2XDBA 3CCSA 5GMKi 3DB3A 4OF1A 4ZGDB 5KE2A 4A53A 3OYEA 1U1TA 5J26A 2RB6A 2OTLA 4RG2A 1B34A 3L2RA 3CCST 1YJ9T 4Y91A 1XOVA 1VQMA 1YHQT 1YITT 1RI0A 1SSFA 4QQ6A 2F5KA 2LDMA 2VXFA 3EFSA 3QKJA 4J6YA 3ZBDA 3Q1JA 4C92A 4RG8A 4MMLA 4X34A 3C95A 2RJEA 3UDCA 1VQMT 2JN0A 4Z02A 3JB9G 4ZGJB 1YIJA 4XTYA 3JCMP 2E5QA 1BI3A 3LX7A 1QP3A 2RHUA 4M78F 2MWPA 1G5VA 5LJ5g 3PIPA 3I55T 4BE1A 2FL7A 4F7UF 3JAME 1BYMA 1UGSB 2D9TA 2JNGA 2AHJB 1K9MU 3L2ZA 2F69A 2RA2A 3CCVA 5LJ3f 3G4ST 4JS5A 4LDWA 3CCRT 2OTJA 4M78D 5D6YA 3JCMd 1Q7YC 1VQKT 3SWNC 3BFMA 2KQWA 3CCMA 3KUFA 3CCQT 2DJZA 2LQ8A 2E6ZA 5CIUA 3RIRA 4PLIA 1ZQ1A 5I2MA 3UPUA 3VYHB 2CZ0B 3RMSA 3OA6A 3V7CA 3I56A 1KQ2A 5KH6A 1UGRB 2X4WA 4IUVA 1VQOA 5CQXA 1Y07A 5IN1A 3LW5E 3FRNA 2LQKA 4BB7A 3OYDA 1KD1C 1QVFS 5LJ3g 4FL6A 5GAN8 2VC8A 2VGNA 4C0DB 3L2UA 3M57A 1KQSA 5LJ3d 2GF7A 5CO7A 2KDSA 4A4KA 2XK0A 3SWNA 2OTLT 2CZ6B 4A4HA 3F70A 3C4SA 2M16A 1M90U 2EQUA 4IUPA 2HBPA 2LCCA 3H6ZA 3SFMA 4M77E 3OYGA 3S6WA 3JCMc 4M7DG 2E65A 3ZEHA 2YLBA 3E9FA 2OAUA 5GAN3 1WQWA 3GP8A 1W2BS 2R5MA 4BI3A 5GAMe 3JB9J 5DLQE 3G6EA 5CR2A 4HA8A 3JB9H 3JCMe 4F7UG 1QVGA 2EJFA 3RKYA 1QVFA 3OS0A 4LDVA 1KC8U 3QZ5B 5DY9A 4HCZA 1N8RU 2QTXA 3KBGA 1ZHIA 1KQ1A 4C5HA 3OYNA 4J83A 2DD5A 3FDRA 4N4HA 2F5TX 2K2VA 5LJ3j 2H3JA 4PJOC 3HRSA 4BY6B 4E7LA 4C8QA 5GAOr 1JBMA 3PMIA 1VQNA 3CCMT 4BACA 3L1AA 5CCAA 5M9OA 4V2SA 2ZPHB 3PFSA 2HQXA 2FHDA 4M77F 1JRIA 3T9NA 2DTHA 2L89A 1RL2A 2Y4XA 3VUBA 4C8QG 5I21A 5CAIA 4M75D 3PTAA 3HFNA 1Q86C 1NPRA 3G4SA 3V8LA 3QSUA 1M4ZA 3CCRA 4FM4B 5GANg 1KQSS 1VQPT 2CZ1B 2XICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FX7 A;  1G3Y A;  2GCX A;  1QW1 A;  2K4Y A;  1BI3 A;  3MHX A;  3HRU A;  1U8R A;  1P92 A;  1G3T A;  1BI2 A;  3HRT A;  1BYM A;  5CVI A;  1FWZ A;  2QQ9 A;  2H3J A;  4O5V A;  2LX9 A;  3HRS A;  1G3S A;  3GLX A;  3E19 A;  1QVP A;  1BI1 A;  2K5F A;  2QQB A;  4O6J A;  2K5I A;  2K5L A;  1G3W A;  2QQA A;  1BI0 A; 
#chains in the Genus database with same CATH topology
 3CBO A;  1YIT Q;  1D3B B;  1KHI A;  4QVC A;  2O2O A;  4B9W A;  2VAS A;  2PZ1 A;  1EZZ B;  1ZSZ A;  4BE0 A;  2DIG A;  3CCU A;  2YLC A;  1AT1 B;  3OBY A;  5EC7 A;  4OB3 B;  3JCM J;  5FWB A;  3OW2 A;  1YJ9 Q;  4C0Z A;  5GMK m;  5GAO q;  3QG1 A;  2CYZ B;  1VYT A;  2GGR A;  1LNX A;  2O88 A;  2L3P A;  2DVE A;  1WPY A;  4XTW A;  2FRY A;  3JB9 D;  4M77 G;  2FB7 A;  4F04 B;  1AWJ A;  2JZ2 A;  1IO6 A;  3THK A;  1X75 C;  8ATC B;  4PJO E;  2NLU A;  2OAW A;  3MP8 A;  2COZ A;  2HD0 A;  1MGQ A;  1E6H A;  5LJ3 h;  3OW2 P;  3M0U A;  4M7A D;  5GAN 6;  2F2W A;  4F7U E;  2NYS A;  1FX7 A;  1IRX A;  1VOM A;  4E7J A;  2K4Y A;  1K73 R;  3HKS A;  2QQ9 A;  3NFC A;  4O5V A;  4RCC A;  1R0B G;  2YHT A;  4M77 B;  2CP6 A;  1Y71 A;  2BKD N;  3CCS Q;  3HHT B;  3CME T;  2P4T A;  2LVM A;  2X3X D;  1ZBX A;  2DE0 X;  3CC7 T;  1G2B A;  4E6R A;  2HZY A;  3S3N A;  4LDU A;  1QKX A;  3S3M A;  2A36 A;  2JS0 A;  1WGS A;  1OUL A;  1QW1 A;  2DIQ A;  1SEM A;  5D6W A;  2C0I A;  4XAX B;  2PTK A;  5LJ5 f;  1AEY A;  1WLP B;  4KUL A;  2DD4 A;  3M5A A;  2A08 A;  2P4R A;  3AT1 B;  4C92 B;  4C5E A;  1I5L A;  1SPK A;  3JCM W;  3TU4 K;  2C06 A;  4M75 A;  3VRY A;  3UA6 A;  2QQA A;  1ZX6 A;  4CC7 A;  1NBE B;  3OYH A;  1MMG A;  2YRC A;  1PRM C;  2QXF A;  1RAE B;  3EHQ A;  1UDL A;  3DKM A;  4ATO A;  1VQO T;  4AFS C;  4EPC A;  1X2K A;  4N0A C;  3URG A;  1UGV A;  1N8R C;  4LD9 K;  1EIF A;  4K11 A;  1KC8 C;  1XQH A;  3MEW A;  3HSB A;  3OYI A;  2QEX A;  2M51 A;  1CKB A;  1VQ8 Q;  3CC2 T;  3I35 A;  3MEV A;  4OB1 B;  3M0Q A;  3JB9 I;  2DF6 A;  2MYS A;  2GCX A;  2PQW A;  2RJD A;  4C92 G;  1I5O B;  4DOW A;  5GMK h;  2OTJ T;  1JU5 C;  3ASK A;  1WDX A;  4RTX A;  4JRP A;  1YP5 A;  3FJ5 A;  4C0F A;  4L6V 5;  1OX9 A;  3CXC S;  1M90 R;  1X6O A;  2AKK A;  3EGD B;  1V76 A;  1C6V X;  2EGA A;  5KYU A;  2BE9 B;  4D6W A;  3NTI A;  1Q82 U;  1LJO A;  4JZ3 A;  1K9M R;  2DA9 A;  3AHU A;  2DO3 A;  3LGL A;  4C0D C;  2JOY A;  4L5G A;  2X9H A;  2KE9 A;  4KUI A;  4JS4 A;  1G3S A;  2X35 A;  1IHW A;  1JB0 E;  1N6A A;  4DQ2 A;  4GLK A;  3GPL A;  4BD3 A;  4B9X A;  2ROL A;  3VS1 A;  5FLX E;  1X27 A;  3LGF A;  3OSS C;  2X51 A;  1M1K U;  4HCB A;  1Z9Z A;  5CKB A;  1YJN A;  1VUB A;  2GNC A;  2EGC A;  3SD4 A;  1AZG B;  2M9U A;  2K6D A;  1M9S A;  1YWO A;  3G7Z A;  1WFW A;  3HRU A;  1PRL C;  1QWF A;  2CSI A;  2DLP A;  3V7R A;  4LE9 A;  3A8H B;  1RAI B;  4LNP A;  2EKO A;  2DZ9 A;  5GAM d;  2K7A A;  2FZC B;  4LUD A;  5EG2 A;  3OYB A;  3M58 A;  2K5F A;  2XI9 A;  1VQ8 T;  1WQ7 A;  3FC3 A;  2EFI A;  4J9G A;  3RNJ A;  2RJF A;  3WVE B;  2VWF A;  4J6W A;  3VKI A;  4F16 A;  1FMK A;  3CCU Q;  4RMO A;  5HK3 A;  3REA B;  4IUT A;  3X24 B;  1T0J A;  4M7D E;  4M7D D;  3M0P A;  1FMW A;  2PU9 B;  5GAM j;  1N27 A;  2COW A;  3RUX A;  1A0N B;  1K1Z A;  3NHN A;  2BE7 D;  5A0G A;  4FT2 A;  1MNE A;  4Q5W A;  3OB9 A;  1QCO A;  4EIK A;  2RI5 A;  1C1A A;  1OEB A;  1YCS B;  4KRT A;  3CQT A;  1MHN A;  2EYW A;  5CVI A;  1YJN Q;  1H92 A;  4OGC A;  2O4X A;  2LJ0 A;  4RCB A;  1K0S A;  3BDL A;  4F7U B;  4NOY A;  2PUO B;  3CCQ Q;  1N9S A;  1PCX A;  1KIK A;  2R5A A;  2RQW A;  1OZ3 A;  1G3Y A;  2O9V A;  2MMP A;  3EFO B;  2YT6 A;  3EGU A;  4QQG A;  3SHW A;  3QZ9 B;  3IQL A;  1QKW A;  3NGP A;  5A0D A;  5I2S A;  2X4X A;  5FU6 B;  4RKU E;  3OQ5 A;  5FRO A;  3RER A;  2KEA A;  2DL5 A;  4HKE A;  4RTW A;  2XKO C;  2R58 A;  2QQR A;  3I9Q A;  1X69 A;  3X25 B;  2DKG A;  3CMA Q;  3PVL A;  2RPN A;  3L2W A;  1WJS A;  4VUB A;  5GAO m;  2AK5 A;  4FYW B;  2Y90 A;  4C8Q F;  2QAZ A;  3C94 A;  1QP2 A;  1YCY A;  2EW3 A;  2FRW A;  1N9R A;  2LTO A;  1WJR A;  4OVA A;  3QYG B;  4JUV A;  1G3T A;  1OI1 A;  3A1P A;  2LT1 A;  4QT7 A;  5KE2 A;  3OYE A;  3VS6 A;  2RB6 A;  1B34 A;  1YJ9 T;  1XOV A;  2L3Q A;  1M2O A;  4IIO A;  1GCP A;  3ZBD A;  1GCQ C;  3EGX A;  2VXF A;  4PJN A;  3EFS A;  4J6Y A;  2RJE A;  3D7S B;  4ZGJ B;  2VVK A;  2RHU A;  4PJL A;  2RQR A;  3I56 Q;  4M78 F;  3PE0 A;  1M2V B;  4BE1 A;  1TUC A;  2FEI A;  2CRE A;  1Q82 R;  1K9M U;  4J9I A;  2F69 A;  3GBQ A;  2P84 A;  1X6B A;  4LDW A;  3JCM d;  3KUF A;  2DJZ A;  2HSP A;  5CIU A;  3RIR A;  1NG2 A;  3UPU A;  3RMS A;  3I56 A;  1RLQ C;  2EGE A;  1CSK A;  1M1K R;  1UGR B;  2X4W A;  4IUV A;  4HCC A;  5CQX A;  1Y07 A;  3OYD A;  3LW5 E;  2J7I A;  4BB7 A;  1TTH B;  3L2U A;  1NJI R;  2KDS A;  3F70 A;  1UHF A;  4ESR A;  4Z88 A;  1JXO A;  4BI3 A;  2O9S A;  3JB9 J;  5CR2 A;  2EVR A;  4HA8 A;  4F7U G;  1PKT A;  5DY9 A;  4WTO B;  1LPL A;  2HSE B;  2RMO A;  1EFN A;  4DEY A;  2CH4 A;  1UJY A;  2E3I A;  3PMI A;  5M9O A;  3T9N A;  2FHD A;  1R77 A;  3VUB A;  3TVT A;  5CAI A;  4M75 D;  2GTO A;  3HFN A;  1Q86 C;  1NPR A;  1BCO A;  1M4Z A;  5GAN g;  4JJD A;  2CZ1 B;  2D6F A;  1WHG A;  2LJ3 A;  3FEO A;  3CD6 T;  2V26 A;  2H3E B;  2AZV A;  2LJ1 A;  1M3A A;  2COY A;  5A0L A;  2OI3 A;  4M7D B;  4AMC A;  4BY6 C;  4XTV A;  2ABL A;  3KXT A;  1O75 A;  3CME A;  2MOX A;  4KH1 B;  1QWE A;  4M78 G;  1Y0M A;  3CC7 A;  2V1Q A;  3GIB A;  3M0R A;  1M5Q 1;  1RAC B;  4M75 C;  2KT1 A;  3EGX B;  3G71 T;  4C8Q E;  2RM4 A;  1AHJ B;  1E6G A;  1K8A R;  1TUD A;  3HRT A;  1H8K A;  2PVD B;  1QVF P;  1BB9 A;  2ZPE B;  3CCE A;  3CCR Q;  2E70 A;  2YUQ A;  1M27 C;  1NLO C;  2CZ7 B;  4JJC A;  3QJ6 A;  3QPH A;  1K9M C;  1S1N A;  1VQN Q;  5KYN A;  2ECZ A;  3H0H A;  4ZN1 A;  3CCL T;  2BZ8 A;  4J9E A;  1P92 A;  3EAE A;  1IGQ A;  2OTL Q;  2KVQ G;  1MMN A;  4GY5 A;  4DEX A;  2YXY A;  3INZ A;  2DXU A;  4WF2 A;  3FB9 A;  3RKW A;  6AT1 B;  2J6K A;  2C0T A;  2D0Q B;  1MND A;  3EH2 A;  3VU3 C;  5A2Q E;  2KXC A;  3EH1 A;  1ZLM A;  2C0O A;  2QAS A;  5LJ5 h;  3QHS A;  2YUN A;  3EFO A;  2MAM A;  4X1V A;  1H64 1;  2HBW A;  3VS5 A;  4RTU A;  5GAO n;  1RAD B;  2JMA A;  2MI6 A;  2J6F A;  1VQP Q;  1PNJ A;  1MMD A;  2DFU A;  3E1S A;  3SWN B;  2X4J A;  4OGE A;  3LLR A;  1U8R A;  4F14 A;  2DM1 A;  2E6N A;  2V8K A;  4ELY C;  3HL8 A;  1YJ9 A;  1KD1 R;  1H3Z A;  2V8J A;  4XU3 A;  3E19 A;  2KK4 A;  2PVG B;  4M7A C;  1WJQ A;  1F1B B;  1YWP A;  1VQK Q;  4N4I A;  1UGP B;  2PVO B;  2XD0 A;  4E7K A;  4N0A A;  3CCL Q;  4E7H A;  1VQ6 Q;  4M77 A;  5GMK j;  2EQI A;  3DB4 A;  4GLM A;  1GFC A;  2F2V A;  5CKH A;  1MMA A;  2JTF A;  4Z89 A;  5LJ3 e;  1NJI U;  3VS4 A;  4E7Z A;  4XU1 A;  4HT9 A;  3CC7 Q;  3QWY A;  2EQJ A;  3OYC A;  1I4K 1;  1NM7 A;  4MZT A;  3MCA B;  1VQ9 Q;  5KYX A;  1GXI E;  5HCK A;  4JLG A;  2DXB A;  1YJW Q;  3VS7 A;  5IHN A;  1WHJ A;  2LZ6 B;  3OSV A;  1Q81 U;  4ZNX A;  3KFV A;  1UFF A;  4J7F A;  3JCM Q;  2RO0 A;  4XTZ A;  1JEG A;  2DTO A;  1C0M A;  3JCM h;  3J81 E;  3ER0 A;  4OMO A;  1YFN A;  2F2X A;  4PKC C;  3VS0 A;  3ZL7 C;  5GAN f;  3NMZ C;  2I2L A;  2EAY A;  4PFO A;  4J9F A;  5DLO A;  4RUG A;  2JM8 A;  5GAN 4;  2RI2 A;  3DLL A;  4C5G A;  1N8R R;  2K5L A;  4MZM A;  3M0T A;  4IUU A;  3EG2 A;  1R0C B;  3CCJ A;  1VIE A;  4BDZ A;  2J6O A;  4M7D F;  2RK1 A;  2GFA A;  2HL5 C;  4JJN K;  5LJ5 j;  2DZC A;  2WSC E;  5GAM h;  3A5Z B;  1SF9 A;  4N4G A;  3CBP A;  4PLL A;  1K8A U;  1AWW A;  1X6G A;  2MIO A;  3H41 A;  1PC0 A;  1PM3 A;  4R55 A;  2VGM A;  4XU0 A;  1YIJ T;  1HSQ A;  4M77 C;  1VQ7 A;  3N5B B;  4AFU C;  4ZTJ A;  4M78 E;  2M1H A;  1VQ9 A;  1K4U S;  3MP6 A;  3HP9 A;  1K0X A;  3CPW P;  4XK8 E;  3H0F A;  1BCM A;  2E5K A;  1K73 C;  2ZPG B;  1PG5 B;  1ZSG A;  2Z0W A;  1YJW T;  4M78 C;  3M0S A;  3I55 A;  1N5Z A;  5HKC A;  1LCK A;  3BDU A;  5HY6 A;  1XNI A;  1OPK A;  4LD6 A;  4QKU A;  1H3H A;  1RAF B;  3E9G A;  3JSC A;  3CCL A;  3CCQ A;  1NZ9 A;  3PNW C;  4M77 D;  5GAO p;  2PUK B;  3CBM A;  2E3H A;  1E7O A;  1U5S A;  1W70 A;  4ZN3 A;  4DBQ A;  4IUQ A;  3HPW A;  4JRK A;  2SEM A;  2ZAE A;  3CD6 A;  3G4S Q;  2BZY A;  4BI8 B;  4C8Q C;  2RHX A;  4FCY A;  3OMG A;  1M2V A;  1QQJ A;  2DYI A;  2L3R A;  3RDV A;  4D8K A;  5IXB A;  1WXB A;  5AYF A;  4JRI A;  5IHK A;  4C92 F;  3L2V A;  3OS5 A;  1W2B P;  3CC2 A;  2RHZ A;  1AZE A;  1M8M A;  4M78 B;  1J3T A;  2DL7 A;  1IXD A;  3CPF A;  5FW9 A;  5KCH A;  1LOJ A;  2YWW A;  3G1J A;  4HT8 A;  1X2Q A;  2L3S A;  1KD1 U;  2IPO B;  4DA4 A;  3CCE T;  4IKF A;  1V29 B;  4PJO G;  1FMV A;  3NTH A;  5CK9 A;  4J5Y A;  2GFU A;  4A54 A;  2VV5 A;  2DMO A;  1YI2 Q;  5GAN j;  1ZSZ B;  1YN8 A;  1VQL Q;  3CCJ T;  3OYK A;  1OU9 A;  3DB3 A;  1U1T A;  1TOV A;  2OTL A;  4RG2 A;  4Y91 A;  2GBQ A;  1SSF A;  4M7A E;  5GJV B;  3Q1J A;  5GJW B;  4MML A;  1GFD A;  1YIJ A;  4XTY A;  3JCM P;  2E5Q A;  2CP3 A;  3LX7 A;  1Q86 R;  5LJ5 g;  3PIP A;  1AWX A;  2FL7 A;  3JAM E;  2D9T A;  4HXJ A;  1IGU A;  4DBF A;  2W10 A;  4JS5 A;  2KGT A;  4M78 D;  1Q7Y C;  1VQK T;  1ZQ1 A;  1Q81 R;  2HCK A;  1K76 A;  3H0I A;  1KD1 C;  2B86 A;  1ZUU A;  1W6X A;  3FRN A;  5LJ3 g;  2VC8 A;  4FW2 A;  1RAB B;  1KQS A;  5LJ3 d;  5CO7 A;  2OTL T;  3C4S A;  2EQU A;  1K9A A;  4IUP A;  2LCC A;  1WZO A;  4J9B A;  4M77 E;  4M7D G;  5GAN 3;  2NUT B;  3E9F A;  1W2B S;  2OAU A;  2QDL A;  2R5M A;  3UF4 A;  1WYX A;  3CC4 Q;  5DLQ E;  3G6E A;  5ECA A;  5IH2 A;  2EJF A;  3OS0 A;  4LDV A;  2G6F X;  5IXF A;  1N8R U;  2QTX A;  3MJX A;  2DD5 A;  1NYF A;  1NLP C;  1GBR A;  5LJ3 j;  4KGV B;  4E7L A;  5GAO r;  2ED0 A;  4BAC A;  3L1A A;  5CCA A;  3PFS A;  2Y4X A;  3HTR A;  1UHC A;  5I21 A;  1KJW A;  3LH5 A;  4PJM A;  1WA7 A;  2OJ2 A;  3G4S A;  3CD6 Q;  1KQS S;  1VQP T;  3EG1 A;  4PJO A;  1VQ4 A;  2PNI A;  1BIA A;  2IVW A;  4ANJ A;  1KG1 A;  4M7D C;  1OX8 A;  2EYY A;  2QEX Q;  2E10 A;  2QTV A;  3HFO A;  2XHC A;  3NTK A;  5KYX B;  1PKS A;  2CSQ A;  4JDS A;  5I22 A;  2VUB A;  1IRE B;  1OZ2 A;  2FG0 A;  2LNH B;  4JJB A;  5GAN e;  1SHF A;  4FIB A;  2E41 A;  3OS2 A;  3J80 E;  3P8H A;  3BW1 A;  1NEB A;  4IIM A;  4C92 C;  2O4X B;  2D0N A;  3A98 A;  1HJD A;  1WHH A;  4CI0 C;  1JJ2 S;  2F1L A;  3V8K A;  5IHI A;  1QVP A;  2HMA A;  1BI1 A;  2A37 A;  4MMK A;  4AFZ C;  2RNA A;  3GOX A;  1VIF A;  1NE8 A;  1TUG B;  3MO8 A;  1W4S A;  3QUI A;  1UGQ B;  3CCM Q;  4M75 E;  4JPB W;  5HK0 A;  1M90 C;  4HVW A;  2QQB A;  2JVV A;  3J7A F;  1GL5 A;  2EWN A;  2SRC A;  4OMQ A;  1U06 A;  3OBW A;  2DXC A;  1VYU A;  1YBY A;  3M9Q A;  1TXQ A;  4OB0 B;  2J06 A;  5FWC A;  4R56 A;  2RI3 A;  4F7U A;  3LYI A;  1RAG B;  1FXX A;  3VYG A;  3PIO A;  2FVU A;  3M56 A;  4JLI A;  1BK2 A;  2DXT A;  2DK3 A;  5FU7 B;  1SSH A;  2ATC B;  2HNI A;  3GNG A;  3S3O A;  2QG9 B;  2VKN A;  4Y92 A;  3OW2 S;  4Y28 E;  2RD1 A;  4GBQ A;  2MK5 A;  2ZZD A;  1ZUY A;  4DBR A;  3I56 T;  4E7I A;  1Y96 A;  2BUD A;  3NPF A;  4Z8A A;  1T3L A;  1Q86 U;  1OPL A;  3GLX A;  5GAN d;  1PD0 A;  1WNL A;  2QI2 A;  4LDY A;  3CC4 T;  4OMN A;  3PVQ A;  4PK4 A;  2LT4 A;  2ZPF B;  3DLM A;  1M30 A;  4B6M A;  3L2Q A;  1YIT A;  2MWO A;  3GF5 A;  2OX7 A;  4EMG A;  2BIV A;  1VQN T;  1HK9 A;  1NPP A;  2KAF A;  4TVR A;  4YTL A;  3TCJ A;  4M7A G;  2JUF A;  5CKF A;  1VQK A;  3VV0 A;  3V7S A;  5GAN 7;  4A4F A;  3M55 A;  3JCM V;  3BE3 A;  3UT1 A;  3LH0 A;  4NS5 A;  1ZUK A;  3L42 A;  5FU7 C;  2HKQ B;  3E2U A;  5GAN 5;  2QA4 A;  1YI2 T;  4II1 A;  2QA4 Q;  4KT0 E;  1B07 A;  3QII A;  3CMA A;  3VJP A;  2KT8 A;  2ESW A;  1OYX A;  1VQL A;  5C6S A;  3G6E T;  2DL4 A;  4J9H A;  2HKN A;  3OYJ A;  4O6J A;  5GAM f;  1TU0 B;  1K8A C;  3I5S A;  2KNB B;  4A4G A;  2FPD A;  5FRN A;  2YUP A;  3MHX A;  2MCN A;  1NYG A;  1KSW A;  3QWX X;  4PJO B;  2XG8 D;  3H9N A;  5LJ5 e;  3A8G B;  2K57 A;  1VQ4 Q;  1M3C A;  2X4Y A;  3TRE A;  1B3Q A;  4C8Q D;  4AFQ C;  2HQE A;  9ATC B;  1KC8 R;  2M02 A;  2O01 E;  4NL3 A;  2LP5 A;  5CQY A;  4QVD A;  3C0C A;  2A3L A;  5CKD A;  2EYX A;  4R0K A;  1JJ2 P;  1VQL T;  5AT1 B;  2JXB A;  4X9D A;  1Q95 G;  4FU6 A;  1IB8 A;  3BY7 A;  4JRQ A;  2KMT A;  1GBQ A;  2AZS A;  2MPX C;  2KRN A;  2KXD A;  4EDU A;  2JT4 A;  5D7U A;  4FYX B;  1JXM A;  4M75 B;  1TH7 A;  2DVJ A;  2MF2 A;  2JS2 A;  5J39 A;  1VQ6 T;  1SRL A;  1O9S A;  2V8I A;  1VQ9 T;  2NUP A;  2LC4 A;  3JCM f;  2KSS A;  1PSE A;  3CCJ Q;  1PWT A;  4LUE A;  1NEG A;  1YJW A;  4M7A A;  4OMM A;  4HVV A;  3OY9 A;  2RHY A;  2LRQ A;  3QYH B;  3R6O A;  1I0C A;  3SEM A;  3SB2 A;  1WHK A;  5IAY A;  2FYK A;  4MDW A;  2P0K A;  3P8B B;  1VQ4 T;  3UA7 A;  1CKA A;  2DRK A;  2JTE A;  3MKD A;  3I5R A;  5GAO l;  1RAA B;  2G3R A;  1XTD A;  1G3W A;  1UG1 A;  1VQ6 A;  3EHR A;  1YHQ A;  1BU1 A;  3FLG A;  4FT4 A;  3TSW A;  4QVZ A;  4C8Q B;  5KCO A;  4A63 B;  2A28 A;  5I11 A;  5GMK l;  3FJP A;  1YIJ Q;  2ZPI B;  2ENM A;  1QVG S;  4JZ4 A;  2DET A;  1KQS P;  2DEQ A;  1T3S A;  2WAC A;  4C5I A;  3OS1 A;  3PGG A;  8AT1 B;  3JRZ A;  4FSX A;  1IZ6 A;  1G8X A;  4CRI A;  1VQ7 Q;  4QQD A;  1FWZ A;  1W1F A;  1Y7X A;  2XID A;  3MPU B;  1U3O A;  3CCS A;  5GMK i;  1OOT A;  4A53 A;  5J26 A;  3L2R A;  2KR3 A;  1VQM A;  2DL8 A;  1GCQ A;  1I07 A;  4LXC A;  1YHQ T;  1YIT T;  4QQ6 A;  2F5K A;  2AKL A;  3QKJ A;  4C92 A;  2JM9 A;  3UDC A;  2JN0 A;  4Z02 A;  3JB9 G;  1BI3 A;  3U23 A;  1OV3 A;  4KGX B;  1BYM A;  4F7U F;  1UGS B;  2JNG A;  2AHJ B;  2YDL A;  1QLY A;  3CCV A;  3G4S T;  3CCV Q;  2CP5 A;  5D6Y A;  2KRO A;  3SWN C;  1AWO A;  3BFM A;  1PD1 A;  2D1X A;  2E6Z A;  4PLI A;  4AT1 B;  2HQH A;  3VYH B;  3EGD A;  2CZ0 B;  1KK7 A;  1VQO A;  5IN1 A;  4KGZ B;  2LQK A;  1QVF S;  1WXT A;  4FL6 A;  2VGN A;  1X43 A;  4C0D B;  2EBP A;  2GF7 A;  4A4K A;  4OML A;  2CZ6 B;  1RUW A;  2NUP B;  2HBP A;  3SFM A;  3S6W A;  3CCE Q;  2E65 A;  2YLB A;  5KYW B;  2KYB A;  2LX7 A;  2EKH A;  3JCM e;  1QVG A;  4FYY B;  2LQN A;  2GQI A;  1KC8 U;  3QZ5 B;  1GRI A;  3KBG A;  2DIL A;  1KQ1 A;  4C5H A;  3OYN A;  4J83 A;  5KYY B;  3FDR A;  4N4H A;  2F5T X;  2L2P A;  2H3J A;  2O31 A;  4C8Q A;  1VQN A;  4V2S A;  2HQX A;  3R6N A;  4M77 F;  2X3W D;  1ARK A;  2KRS A;  1YNZ A;  3V8L A;  3CCR A;  4FM4 B;  2XIC A;  1QVG P;  5CKE A;  1DJ7 B;  1PSF A;  3RKX A;  2DNU A;  2IG0 A;  3H8Z A;  2LCL A;  3VS3 A;  1M3B A;  2EYZ A;  1EX4 A;  1AVZ C;  2HEQ A;  3RR6 A;  3OYF A;  3OYM A;  2BTT A;  1X01 A;  4RTY A;  2CUD A;  2QK0 A;  2JTM A;  4M78 A;  3JCM g;  4RTV A;  4OP0 A;  1AOJ A;  3FIF A;  1VQ5 A;  1D0X A;  1RAH B;  3ZFJ A;  1KHC A;  1VQM Q;  1NJI C;  2KRM A;  2RJC A;  4M7A F;  1UEC A;  3QDF A;  2LX9 A;  2JMC A;  3VUZ A;  1VQ8 A;  1ZBJ A;  3CC2 Q;  2YUO A;  3OYA A;  1VA7 A;  2VYT A;  1Y57 A;  1JO8 A;  1D1B A;  4EMK A;  3QO3 A;  4PNO A;  1BKB A;  2KBT A;  1WHM A;  1S72 T;  2FPF A;  2QGG A;  4KBM B;  2QYZ A;  1BIB A;  3X28 B;  3UAT A;  1UTI A;  1MUZ A;  2K3X A;  2CUB A;  4E47 A;  1MV3 A;  1M1G A;  4OMP A;  2HDA A;  2L5Q A;  1PHT A;  1TWB A;  5GMK e;  1G83 A;  2Y4Y A;  5J3B A;  3EFR A;  1YHQ Q;  1D3B A;  2DRM A;  5IT9 E;  3LWI A;  1MV0 B;  3PMT A;  1HXD A;  4KH0 B;  4C92 E;  3P8D A;  1ZSZ C;  2DPP B;  2L0A A;  5GAN h;  1M8V A;  3OYL A;  3O8V A;  1WX6 A;  2P0Q A;  1M1F A;  2ZPB B;  3TEE A;  4EMH A;  1WI7 A;  1WIE A;  2EJG A;  2K5I A;  3X26 B;  4UC4 A;  3M4G A;  3GNF B;  2CGH A;  3RES A;  4PJJ A;  1WXU A;  2E1H A;  3CMA T;  3JV3 A;  2DER A;  1IHV A;  2NUZ A;  2DYB A;  2XDD A;  2NWM A;  1TG0 A;  2QEX T;  3WXM B;  1D0Z A;  1VQO Q;  1U1S A;  3QBY A;  2K3Y A;  2GTJ A;  2JW4 A;  4MDX A;  3G71 A;  2EJ9 A;  1Q7Y R;  5GAM g;  2YRV A;  4E7S A;  3CC4 A;  4OMF B;  1VQ5 T;  2E4H A;  2L8D A;  1XJW B;  1VQ7 T;  2NUT A;  3M54 A;  4M7D A;  2D8H A;  3QJY A;  5GAN 2;  2XMF A;  1B7T A;  4DOV A;  5KYY A;  4BE2 A;  4X9C A;  4HVU A;  3LWH A;  1JJ2 A;  2YSQ A;  2WSE E;  3A8M B;  2CT4 A;  3MET A;  5KYW A;  2B8A A;  4PL6 A;  3MEA A;  3X20 B;  2XU8 A;  4A4E A;  2DX1 A;  3M4Y A;  2CS7 A;  2WSF E;  5LJ5 d;  1Q82 C;  1VQP A;  4HCK A;  4J6X A;  1TSF A;  4ZGE B;  3EG9 B;  3MEU A;  3OYY A;  2EQK A;  4DBH A;  2QQS A;  2EIF A;  1I1J A;  2QA4 T;  1YI2 A;  1SG5 A;  2DAQ A;  2K79 A;  1YJN T;  3RMQ A;  3JB9 F;  5D6X A;  3SDZ A;  1UB4 A;  2R57 A;  1QCF A;  4XTX A;  1D0Y A;  4OB2 B;  2JJ9 A;  2EYQ A;  4FYV B;  2DBK A;  4M7A B;  2CP0 A;  1Y96 B;  4XTU A;  2CP7 A;  1HD3 A;  4PJO F;  5DM7 R;  2RH2 A;  1M1K C;  2BZX A;  1BI2 A;  2M0O A;  3O5Z A;  1Q81 C;  3JCM b;  3WVD B;  2M0Y A;  4AG2 C;  4BUG A;  4XU2 A;  3UWN A;  7AT1 B;  3MP1 A;  2I0N A;  1T0H A;  3RBB B;  3CCV T;  1S72 Q;  5FRM A;  1D1A A;  4MZP A;  2D8J A;  3V8J A;  5L23 A;  2RK2 A;  2E64 A;  2DEU A;  2K9G A;  2LCS A;  2ZCF B;  2RHI A;  1UEB A;  3A8L B;  2LQW A;  3A8O B;  2OTJ Q;  2KI7 A;  2V1R A;  4ELZ C;  2LNV A;  1ZA1 B;  4P5N A;  4F17 A;  5LL6 S;  1V1C A;  1RLP C;  4EMK B;  4IUR A;  4C92 D;  3ME9 A;  4EMK C;  5FU6 C;  3JCM X;  4AG1 C;  3TSZ A;  3PT9 A;  2DJQ A;  4C0G A;  3REB B;  2AIR B;  4CC2 A;  1ACM B;  2VB6 A;  2K2M A;  2XDP A;  2E12 A;  1SHG A;  1S72 A;  1QMC A;  4XQ3 A;  1SRM A;  2CH4 W;  4NL2 A;  1OU8 A;  2GQV A;  3M59 A;  4ZTF A;  1R8O B;  1B34 B;  1BI0 A;  1W2B A;  4BI4 A;  4E2F B;  3M53 A;  4LN2 A;  4KUD K;  2LMJ A;  1QCN A;  4M75 F;  3CPW A;  3TQ7 P;  2QDY B;  3I55 Q;  1KFZ A;  2HAX A;  3OMC A;  4M75 G;  3CPW S;  1SKU B;  1Z9Q A;  2J05 A;  2EPD A;  1I8F A;  5C0M A;  2DTI A;  4LDX A;  2P0P A;  1K73 U;  3CEY A;  1ABQ A;  2RQV A;  1D1C A;  2KY9 A;  2ZGW A;  1FYN A;  1UJ0 A;  1HYO A;  4PJO D;  4L59 A;  4QW2 A;  2VXE A;  5L8R E;  3C12 A;  2CP2 A;  1LVK A;  4RTT A;  1TS9 A;  2FZK B;  2A7Y A;  2FO0 A;  3QXE B;  4BDY A;  3EG0 A;  2RQU A;  4CC4 B;  3QDR B;  2CKK A;  1I81 A;  4CC3 A;  2EQM A;  4J9D A;  1Q7Y U;  2RF0 A;  3CCU T;  1WHL A;  4FW1 A;  4J7I A;  4ME7 A;  2AT1 B;  5KE3 A;  1RI9 A;  3G6E Q;  4J8O A;  2XDB A;  2FPE A;  4OF1 A;  4ZGD B;  4RTZ A;  3CCS T;  4ORZ A;  1RI0 A;  3CXC A;  2LDM A;  4RG8 A;  4X34 A;  3C95 A;  4PFZ A;  1VQM T;  1AD5 A;  2QGF B;  1QP3 A;  4J9C A;  2MWP A;  2W0Z A;  1G5V A;  2YRD A;  2CDT A;  3I55 T;  2ROT A;  2CT3 A;  4WCI A;  3L2Z A;  1OQK A;  3EG9 A;  2RA2 A;  5LJ3 f;  3CCR T;  2OTJ A;  2KYM A;  2K3B A;  2KQW A;  3CCM A;  5KYU B;  3CCQ T;  2LQ8 A;  3VRZ A;  4M4Z A;  3G71 Q;  5I2M A;  3CXC P;  3OA6 A;  2HL3 A;  3V7C A;  1KQ2 A;  5KH6 A;  3EG3 A;  1UUE A;  5GAN 8;  3M57 A;  2XK0 A;  3SWN A;  4A4H A;  2DBM A;  2M16 A;  1M90 U;  3OYG A;  3H6Z A;  2RN8 A;  2DL3 A;  3JCM c;  2H8H A;  1VYV A;  3ZEH A;  3GP8 A;  1WQW A;  4D8D A;  5GAM e;  3JB9 H;  4PFP A;  3RKY A;  2ED1 A;  1QVF A;  1ABO A;  4HCZ A;  4FSS A;  1BBZ A;  1ZHI A;  2RQT A;  2FZG B;  3VS2 A;  1ZA2 B;  2K2V A;  2A0F B;  1VQ5 Q;  4PJO C;  3HRS A;  1JQQ A;  4BY6 B;  1JBM A;  3CCM T;  2ZPH B;  1D09 B;  1JRI A;  2DTH A;  2L89 A;  1RL2 A;  4C8Q G;  3CME Q;  3ULR B;  3PTA A;  1UE9 A;  3QSU A;  2IIM A; 
#chains in the Genus database with same CATH homology
 3FEO A;  3CBO A;  1D3B B;  3CD6 T;  5CKE A;  1KHI A;  4QVC A;  4PJO A;  1DJ7 B;  1VQ4 A;  4B9W A;  1BIA A;  2IVW A;  5A0L A;  4M7D B;  1PSF A;  3RKX A;  2IG0 A;  3H8Z A;  2LCL A;  3OYF A;  1KG1 A;  4BY6 C;  4M7D C;  3OYM A;  4XTV A;  4BE0 A;  2DIG A;  2E10 A;  3KXT A;  1O75 A;  3CME A;  3HFO A;  2XHC A;  3CCU A;  2YLC A;  1X01 A;  3NTK A;  3OBY A;  4M78 G;  4OB3 B;  3JCM J;  3CC7 A;  4JDS A;  2VUB A;  3OW2 A;  1IRE B;  1OZ2 A;  3GIB A;  4C0Z A;  5GMK m;  2JTM A;  5GAN e;  4M78 A;  3JCM g;  5GAO q;  3QG1 A;  2CYZ B;  4OP0 A;  3FIF A;  1VQ5 A;  4M75 C;  1M5Q 1;  1LNX A;  4FIB A;  1KHC A;  3ZFJ A;  2E41 A;  3OS2 A;  2DVE A;  1WPY A;  4XTW A;  3J80 E;  1NJI C;  3G71 T;  3P8H A;  2RM4 A;  4M77 G;  2FB7 A;  4C8Q E;  3JB9 D;  1AHJ B;  3BW1 A;  4C92 C;  2O4X B;  3HRT A;  2RJC A;  4M7A F;  2JZ2 A;  4CI0 C;  2LX9 A;  2PVD B;  4PJO E;  1X75 C;  3VUZ A;  1VQ8 A;  1JJ2 S;  2NLU A;  2ZPE B;  3MP8 A;  3V8K A;  3CCE A;  1QVP A;  1BI1 A;  4MMK A;  2HD0 A;  1MGQ A;  3OYA A;  2E70 A;  2VYT A;  5LJ3 h;  4EMK A;  4M7A D;  3QO3 A;  5GAN 6;  4PNO A;  3GOX A;  1BKB A;  4F7U E;  1VIF A;  2CZ7 B;  1S72 T;  4KBM B;  3QJ6 A;  3QPH A;  1K9M C;  1BIB A;  1FX7 A;  3X28 B;  1NE8 A;  4E7J A;  2K3X A;  2K4Y A;  4ZN1 A;  3MO8 A;  3CCL T;  1W4S A;  4E47 A;  3CXC A;  1P92 A;  3QUI A;  3HKS A;  3EAE A;  2QQ9 A;  3NFC A;  4O5V A;  4RCC A;  1M1G A;  1UGQ B;  2YHT A;  4M75 E;  4M77 B;  2KVQ G;  2L5Q A;  5HK0 A;  4GY5 A;  1M90 C;  1Y71 A;  2BKD N;  2QQB A;  3HHT B;  2JVV A;  3J7A F;  3CME T;  2EWN A;  5GMK e;  3INZ A;  2Y4Y A;  2P4T A;  2LVM A;  2DXU A;  3EFR A;  1D3B A;  3OBW A;  5J3B A;  2DXC A;  5IT9 E;  3LWI A;  1ZBX A;  4WF2 A;  3FB9 A;  3RKW A;  3PMT A;  3CC7 T;  1YBY A;  3M9Q A;  1HXD A;  3S3N A;  4LDU A;  4OB0 B;  3S3M A;  2D0Q B;  1WGS A;  1QW1 A;  4R56 A;  3VU3 C;  2RI3 A;  2DIQ A;  4F7U A;  5A2Q E;  3LYI A;  5D6W A;  4C92 E;  3P8D A;  4XAX B;  2DPP B;  1FXX A;  3VYG A;  5LJ5 f;  1M8V A;  5GAN h;  4KUL A;  2DD4 A;  3PIO A;  3M5A A;  3OYL A;  3O8V A;  2FVU A;  3M56 A;  5LJ5 h;  2P0Q A;  4JLI A;  1M1F A;  2ZPB B;  2DXT A;  3TEE A;  4C5E A;  4C92 B;  4EMH A;  3QHS A;  2DK3 A;  1I5L A;  2MAM A;  5FU7 B;  3JCM W;  3TU4 K;  1H64 1;  2C06 A;  2HNI A;  3GNG A;  2EJG A;  2K5I A;  3X26 B;  5GAO n;  3S3O A;  4M75 A;  4UC4 A;  2QQA A;  3OW2 S;  3M4G A;  4Y28 E;  2MI6 A;  3GNF B;  2CGH A;  3OYH A;  3RES A;  2RD1 A;  5GAN d;  3E1S A;  3SWN B;  2E1H A;  3CMA T;  2ZZD A;  2QXF A;  2X4J A;  4OGE A;  3LLR A;  3I56 T;  1U8R A;  3DKM A;  4ATO A;  1VQO T;  4E7I A;  1Y96 A;  2BUD A;  2XDD A;  2E6N A;  4EPC A;  2V8K A;  4N0A C;  3URG A;  4ELY C;  2QEX T;  3HL8 A;  1YJ9 A;  1N8R C;  1Q86 U;  3WXM B;  4LD9 K;  1EIF A;  1H3Z A;  1KC8 C;  1XQH A;  3GLX A;  2V8J A;  3MEW A;  1U1S A;  2KK4 A;  2PVG B;  3E19 A;  3QBY A;  4XU3 A;  1WJQ A;  3OYI A;  3HSB A;  2K3Y A;  4M7A C;  2QEX A;  1WNL A;  2QI2 A;  4LDY A;  4N4I A;  1UGP B;  3CC4 T;  3CC2 T;  4MDX A;  3G71 A;  2PVO B;  2EJ9 A;  3MEV A;  2LT4 A;  2ZPF B;  3DLM A;  4OB1 B;  5GAM g;  2XD0 A;  3JB9 I;  2YRV A;  4E7K A;  3CC4 A;  3L2Q A;  4OMF B;  3OS1 A;  1YIT A;  2GCX A;  2MWO A;  3GF5 A;  4N0A A;  2PQW A;  2RJD A;  2L8D A;  1VQ5 T;  4C92 G;  4DOW A;  4E7H A;  1VQ7 T;  4M77 A;  2BIV A;  4EMG A;  1VQN T;  4M7A E;  1HK9 A;  5GMK j;  1NPP A;  2KAF A;  4TVR A;  3M54 A;  4YTL A;  3QJY A;  3TCJ A;  5GMK h;  5GAN 2;  3DB4 A;  4M7A G;  4M7D A;  2JUF A;  5CKF A;  1VQK A;  2OTJ T;  3ASK A;  3VV0 A;  3V7S A;  4DOV A;  5CKH A;  2JTF A;  5LJ3 e;  1NJI U;  4BE2 A;  4X9C A;  4JRP A;  5GAN 7;  4XU1 A;  4A4F A;  3LWH A;  1JJ2 A;  4HT9 A;  4C0F A;  3M55 A;  3JCM V;  2EQJ A;  2WSE E;  4L6V 5;  3A8M B;  3CXC S;  3UT1 A;  3MET A;  3OYC A;  1X6O A;  1I4K 1;  2B8A A;  3LH0 A;  4NS5 A;  4PL6 A;  3MEA A;  3X20 B;  2XU8 A;  3L42 A;  4MZT A;  5FU7 C;  3MCA B;  3NTI A;  4A4E A;  4D6W A;  1Q82 U;  1LJO A;  2CS7 A;  2WSF E;  3M4Y A;  5LJ5 d;  1Q82 C;  1VQP A;  4J6X A;  4ZGE B;  3AHU A;  2DO3 A;  5GAN 5;  2QA4 A;  3MEU A;  1YI2 T;  4II1 A;  3OYY A;  4KT0 E;  3LGL A;  2EQK A;  3QII A;  2JOY A;  4L5G A;  3VJP A;  4C0D C;  3CMA A;  1GXI E;  4KUI A;  4JS4 A;  2QQS A;  1G3S A;  1OYX A;  2DXB A;  2EIF A;  1JB0 E;  1N6A A;  2X35 A;  4JLG A;  4DQ2 A;  1VQL A;  4GLK A;  5C6S A;  2QA4 T;  1YI2 A;  3G6E T;  2DAQ A;  4BD3 A;  3GPL A;  3OSV A;  1YJN T;  4B9X A;  1Q81 U;  3RMQ A;  3JB9 F;  5FLX E;  5D6X A;  3OSS C;  3LGF A;  1UB4 A;  3SDZ A;  2R57 A;  4O6J A;  3OYJ A;  1M1K U;  4XTX A;  5GAM f;  4HCB A;  5CKB A;  1YJN A;  1K8A C;  4J7F A;  4OB2 B;  4HCC A;  1VUB A;  2EYQ A;  4A4G A;  3JCM Q;  2RO0 A;  3MHX A;  4XTZ A;  4M7A B;  3SD4 A;  5FRN A;  2DTO A;  1Y96 B;  1M9S A;  2M9U A;  4XTU A;  3JCM h;  3G7Z A;  3HRU A;  3J81 E;  4PJO F;  3ER0 A;  2RH2 A;  5DM7 R;  1M1K C;  4PKC C;  1BI2 A;  2M0O A;  4PJO B;  1Q81 C;  2XG8 D;  5GAN f;  3V7R A;  5LJ5 e;  3A8G B;  3JCM b;  2I2L A;  2K57 A;  3WVD B;  3A8H B;  2X4Y A;  2EAY A;  2EKO A;  2DZ9 A;  3TRE A;  4C8Q D;  5GAM d;  5DLO A;  5EG2 A;  3OYB A;  3M58 A;  2K5F A;  2XI9 A;  4XU2 A;  2HQE A;  3UWN A;  4BUG A;  3MP1 A;  1VQ8 T;  1WQ7 A;  2O01 E;  4NL3 A;  3FC3 A;  5GAN 4;  3CCV T;  2RI2 A;  3DLL A;  4C5G A;  5CQY A;  2K5L A;  4QVD A;  5FRM A;  4MZM A;  2A3L A;  5CKD A;  2EFI A;  4IUU A;  4MZP A;  2RJF A;  4BDZ A;  3CCJ A;  1VIE A;  3WVE B;  4J6W A;  3V8J A;  3VKI A;  4M7D F;  2RK2 A;  2E64 A;  1VQL T;  2RK1 A;  2GFA A;  4X9D A;  4RMO A;  5HK3 A;  4FU6 A;  3BY7 A;  4JRQ A;  2KMT A;  2ZCF B;  2RHI A;  4JJN K;  4IUT A;  3X24 B;  5LJ5 j;  2DZC A;  2WSC E;  5GAM h;  3A5Z B;  1K8A U;  4N4G A;  3CBP A;  4PLL A;  4M7D D;  4M7D E;  1UEB A;  3A8L B;  5GAM j;  2PU9 B;  3A8O B;  1N27 A;  3RUX A;  4EDU A;  4ELZ C;  2LNV A;  5A0G A;  4P5N A;  4R55 A;  4FT2 A;  5LL6 S;  2VGM A;  4XU0 A;  1YIJ T;  4M77 C;  1VQ7 A;  4EMK B;  3N5B B;  3OB9 A;  4Q5W A;  4IUR A;  4M78 E;  4C92 D;  4M75 B;  4ZTJ A;  1TH7 A;  2M1H A;  3ME9 A;  3MP6 A;  4EMK C;  2RI5 A;  5FU6 C;  3HP9 A;  3JCM X;  1VQ9 A;  2MF2 A;  5J39 A;  3PT9 A;  4XK8 E;  4C0G A;  1VQ6 T;  1MHN A;  1O9S A;  2V8I A;  1VQ9 T;  5CVI A;  1K73 C;  4OGC A;  2O4X A;  2LC4 A;  3JCM f;  2ZPG B;  4RCB A;  1YJW T;  2KSS A;  3BDL A;  1PSE A;  4M78 C;  2XDP A;  4F7U B;  2E12 A;  4NOY A;  3I55 A;  2PUO B;  5HKC A;  3BDU A;  5HY6 A;  1S72 A;  1YJW A;  1XNI A;  4M7A A;  4XQ3 A;  4LD6 A;  4NL2 A;  2GQV A;  1N9S A;  3OY9 A;  3E9G A;  3M59 A;  2RHY A;  3JSC A;  2R5A A;  1R8O B;  2LRQ A;  4ZTF A;  3CCL A;  1OZ3 A;  1B34 B;  1BI0 A;  1G3Y A;  3QYH B;  1W2B A;  3R6O A;  3CCQ A;  1NZ9 A;  3PNW C;  4M77 D;  4BI4 A;  5GAO p;  3SB2 A;  2PUK B;  3CBM A;  3M53 A;  5IAY A;  2FYK A;  4KUD K;  4MDW A;  4M75 F;  4ZN3 A;  3CPW A;  2P0K A;  2QDY B;  4IUQ A;  3P8B B;  2MMP A;  3HPW A;  4JRK A;  2HAX A;  3OMC A;  3CD6 A;  4QQG A;  4BI8 B;  4C8Q C;  3QZ9 B;  1VQ4 T;  2RHX A;  4M75 G;  3OMG A;  3CPW S;  5A0D A;  5I2S A;  2X4X A;  1I8F A;  2L3R A;  5FU6 B;  5C0M A;  5GAO l;  4RKU E;  2G3R A;  3OQ5 A;  5FRO A;  5AYF A;  2DTI A;  3RER A;  4JRI A;  4LDX A;  2P0P A;  1XTD A;  4HKE A;  1K73 U;  1G3W A;  2R58 A;  2QQR A;  2XKO C;  3CEY A;  4C92 F;  3L2V A;  1VQ6 A;  2KY9 A;  3OS5 A;  1YHQ A;  3CC2 A;  2RHZ A;  2ZGW A;  3FLG A;  3X25 B;  4M78 B;  4FT4 A;  2DKG A;  4QVZ A;  4C8Q B;  5KCO A;  3L2W A;  4PJO D;  4L59 A;  3CPF A;  1WJS A;  4QW2 A;  5GMK l;  2VXE A;  5L8R E;  5KCH A;  3C12 A;  3FJP A;  4VUB A;  5GAO m;  1LOJ A;  2Y90 A;  4C8Q F;  4HT8 A;  2ZPI B;  1QVG S;  2A7Y A;  1KD1 U;  3C94 A;  2DEQ A;  1QP2 A;  4DA4 A;  3QXE B;  2WAC A;  3CCE T;  4IKF A;  1YCY A;  4C5I A;  1V29 B;  4BDY A;  4PJO G;  3NTH A;  1N9R A;  2LTO A;  3PGG A;  3QDR B;  5CK9 A;  2CKK A;  2GFU A;  3JRZ A;  1I81 A;  4J5Y A;  1WJR A;  2VV5 A;  4A54 A;  4FSX A;  1IZ6 A;  5GAN j;  2EQM A;  1Q7Y U;  4OVA A;  4CRI A;  3QYG B;  4JUV A;  3CCU T;  1G3T A;  1OI1 A;  4J7I A;  4ME7 A;  3CCJ T;  4QQD A;  5KE3 A;  2LT1 A;  1FWZ A;  4J8O A;  3OYK A;  1Y7X A;  2XID A;  2D6F A;  2XDB A;  3CCS A;  5GMK i;  3DB3 A;  4OF1 A;  4ZGD B;  5KE2 A;  4A53 A;  3OYE A;  1U1T A;  5J26 A;  2RB6 A;  2OTL A;  4RG2 A;  1B34 A;  3L2R A;  3CCS T;  1YJ9 T;  4Y91 A;  1XOV A;  1VQM A;  1YHQ T;  1YIT T;  1RI0 A;  1SSF A;  4QQ6 A;  2F5K A;  2LDM A;  2VXF A;  3EFS A;  3QKJ A;  4J6Y A;  3ZBD A;  3Q1J A;  4C92 A;  4RG8 A;  4MML A;  4X34 A;  3C95 A;  2RJE A;  3UDC A;  1VQM T;  2JN0 A;  4Z02 A;  3JB9 G;  4ZGJ B;  1YIJ A;  4XTY A;  3JCM P;  2E5Q A;  1BI3 A;  3LX7 A;  1QP3 A;  2RHU A;  4M78 F;  2MWP A;  1G5V A;  5LJ5 g;  3PIP A;  3I55 T;  4BE1 A;  2FL7 A;  4F7U F;  3JAM E;  1BYM A;  1UGS B;  2D9T A;  2JNG A;  2AHJ B;  1K9M U;  3L2Z A;  2F69 A;  2RA2 A;  3CCV A;  5LJ3 f;  3G4S T;  4JS5 A;  4LDW A;  3CCR T;  2OTJ A;  4M78 D;  5D6Y A;  3JCM d;  1Q7Y C;  1VQK T;  3SWN C;  3BFM A;  2KQW A;  3CCM A;  3KUF A;  3CCQ T;  2DJZ A;  2LQ8 A;  2E6Z A;  5CIU A;  3RIR A;  4PLI A;  1ZQ1 A;  5I2M A;  3UPU A;  3VYH B;  2CZ0 B;  3RMS A;  3OA6 A;  3V7C A;  3I56 A;  1KQ2 A;  5KH6 A;  1UGR B;  2X4W A;  4IUV A;  1VQO A;  5CQX A;  1Y07 A;  5IN1 A;  3LW5 E;  3FRN A;  2LQK A;  4BB7 A;  3OYD A;  1KD1 C;  1QVF S;  5LJ3 g;  4FL6 A;  5GAN 8;  2VC8 A;  2VGN A;  4C0D B;  3L2U A;  3M57 A;  1KQS A;  5LJ3 d;  2GF7 A;  5CO7 A;  2KDS A;  4A4K A;  2XK0 A;  3SWN A;  2OTL T;  2CZ6 B;  4A4H A;  3F70 A;  3C4S A;  2M16 A;  1M90 U;  2EQU A;  4IUP A;  2HBP A;  2LCC A;  3H6Z A;  3SFM A;  4M77 E;  3OYG A;  3S6W A;  3JCM c;  4M7D G;  2E65 A;  3ZEH A;  2YLB A;  3E9F A;  2OAU A;  5GAN 3;  1WQW A;  3GP8 A;  1W2B S;  2R5M A;  4BI3 A;  5GAM e;  3JB9 J;  5DLQ E;  3G6E A;  5CR2 A;  4HA8 A;  3JB9 H;  3JCM e;  4F7U G;  1QVG A;  2EJF A;  3RKY A;  1QVF A;  3OS0 A;  4LDV A;  1KC8 U;  3QZ5 B;  5DY9 A;  4HCZ A;  1N8R U;  2QTX A;  3KBG A;  1ZHI A;  1KQ1 A;  4C5H A;  3OYN A;  4J83 A;  2DD5 A;  3FDR A;  4N4H A;  2F5T X;  2K2V A;  5LJ3 j;  2H3J A;  4PJO C;  3HRS A;  4BY6 B;  4E7L A;  4C8Q A;  5GAO r;  1JBM A;  3PMI A;  1VQN A;  3CCM T;  4BAC A;  3L1A A;  5CCA A;  5M9O A;  4V2S A;  2ZPH B;  3PFS A;  2HQX A;  2FHD A;  4M77 F;  1JRI A;  3T9N A;  2DTH A;  2L89 A;  1RL2 A;  2Y4X A;  3VUB A;  4C8Q G;  5I21 A;  5CAI A;  4M75 D;  3PTA A;  3HFN A;  1Q86 C;  1NPR A;  3G4S A;  3V8L A;  3QSU A;  1M4Z A;  3CCR A;  4FM4 B;  5GAN g;  1KQS S;  1VQP T;  2CZ1 B;  2XIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...