2LX9A

Solution structure of escherichia coli ferrous iron transport protein a (feoa)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
83
structure length
83
Chain Sequence
MQYTPDTAWKITGFSREISPAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIETRRVSLVLRKKDLALLEVEAVSSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ferrous iron transport protein A
publication title Solution Structure of Escherichia coli FeoA and Its Potential Role in Bacterial Ferrous Iron Transport.
pubmed doi rcsb
source organism Escherichia coli
total genus 10
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lx9A00
2K4YA 1BI2A 2K5LA 1G3YA 2K5IA 3HRTA 3MHXA 4O6JA 1BI0A 4O5VA 1G3SA 3HRSA 1G3WA 2QQBA 1QW1A 2QQ9A 1FWZA 2H3JA 1QVPA 2GCXA 1BI1A 2LX9A 5CVIA 1G3TA 2QQAA 1U8RA 1P92A 1BYMA 2K5FA 1BI3A 1FX7A 3E19A 3GLXA 3HRUA
chains in the Genus database with same CATH superfamily
1H641 1X01A 1QCOA 2KROA 3KBGA 1WA7A 2YRCA 3CPWP 2VC8A 4PL6A 4F7UG 3OYLA 4L5GA 1ZSZA 3MCAB 1YJ9Q 1M3CA 2VB6A 4C0FA 3REAB 1Q86U 1O9SA 3LGFA 4N0AC 4L6V5 3L2ZA 4MZMA 4OMPA 5KYWB 1GRIA 2HDAA 3H8ZA 2A28A 2ZPIB 5KE3A 2CT4A 4J9BA 4QW2A 2VGNA 1YHQA 1Q95G 1PNJA 3OYFA 1YHQT 1TTHB 3H0FA 2K3XA 4OMOA 2J6OA 1UECA 4LUEA 2AK5A 2L3SA 2EQUA 1SRMA 2RM4A 4ORZA 3KFVA 3OYBA 1QLYA 2MAMA 3PGGA 2KR3A 1T3SA 2QQRA 2J05A 2VASA 4IUTA 1M8VA 3M0UA 3RNJA 2P84A 3REBB 3V7RA 4N4IA 3A98A 4XU0A 2I0NA 3H0HA 5KCOA 4F14A 2DIGA 3P8BB 4Y92A 2LZ6B 2DEUA 2VXFA 1MNEA 2BIVA 2DERA 2D8JA 2K5LA 4JJBA 4DEYA 3M0RA 4FT2A 2CP7A 4C8QC 4J9EA 4HVWA 3LH0A 2QDYB 2XMFA 1SHGA 2VUBA 3EGDA 1G8XA 3CEYA 5GMKe 1LVKA 3HFOA 1TS9A 1BI3A 2MIOA 2E5QA 4M77F 4E7SA 5GMKl 3CCEQ 3V8KA 1JJ2P 2YRVA 3NFCA 4WF2A 3UPUA 1S72Q 4O6JA 2CSIA 2OI3A 2CZ6B 2SEMA 3JCMW 3JV3A 3CXCP 1TOVA 1NJIU 1NEBA 2AKKA 1HJDA 3BDUA 3OYKA 3OS0A 3SHWA 5CQYA 1RLQC 5GAMe 3VS7A 1K8AR 1YJNQ 2EKOA 2DK3A 1AOJA 1ACMB 1G3SA 1NYFA 1N8RR 4EMKC 2R5MA 4D8DA 2ROTA 4GY5A 1BI1A 4NOYA 5FROA 2LQWA 4KUDK 1Y96B 1K73R 4KH1B 2X4WA 4M78F 4FU6A 1UGPB 1Q7YU 2HSPA 4HT9A 1RAGB 3LWHA 3M0QA 1B34A 4QQGA 5GAN7 2J06A 1WXUA 2LNHB 4UC4A 2JN0A 2K6DA 3I55A 2K79A 2V8JA 2FRWA 2CH4A 3I55T 3EAEA 1PRMC 1HSQA 4OF1A 3RKXA 4PFZA 1D3BA 2LT1A 1GCPA 4F17A 2DL4A 2E6ZA 3CCJA 1VQLA 2DXBA 3LX7A 3CCJT 3QYGB 1VQLT 1GCQA 3L2UA 4HCBA 3QDFA 1GBRA 3QBYA 1C1AA 4A4HA 4E7HA 2KGTA 2JMCA 3PNWC 3L2QA 2BZYA 2VYTA 1UGVA 2RJDA 3TVTA 4CRIA 3OW2S 4MDXA 3P8DA 2DXTA 2PU9B 4EMHA 1WXBA 2F1LA 1R77A 1SG5A 2HD0A 4JRPA 2FG0A 2DL5A 5EC7A 2E3HA 5KE2A 5LJ3e 4M77D 1YHQQ 4FL6A 1MV3A 2DL3A 4O5VA 4IURA 4XU2A 1Q86R 4A54A 4C8QE 2EYWA 1MV0B 2CGHA 2EPDA 4RTWA 5I2MA 2DF6A 3L1AA 4N4HA 3RKYA 4OB0B 4OMQA 4E47A 4XU3A 1KQSP 3MP6A 2LX7A 3OW2A 2HKNA 1UJYA 2FVUA 3FC3A 4JLIA 1BCOA 3JCMe 4L59A 8ATCB 1LOJA 2GQIA 2J6KA 2FRYA 1AWOA 2RN8A 3A5ZB 4RTXA 1QWFA 2CSQA 4M78D 1YBYA 2E3IA 3CBPA 1VQ8A 3EG3A 3JB9H 1VQ8T 3ZFJA 2D9TA 1CSKA 3EG9B 3X26B 4FSXA 1MMAA 3H41A 1OI1A 4PJMA 3MEWA 2K3BA 4M7DF 3PTAA 1VQKA 1I07A 3INZA 1N6AA 5ECAA 2RK1A 3H9NA 3LW5E 1UHFA 4ELYC 3RBBB 2DRMA 5HCKA 4CC2A 5CO7A 1AT1B 2DD5A 3M55A 3PFSA 1VA7A 1K73C 3MEUA 1AHJB 3CBMA 5A0DA 1IXDA 3A8OB 1WIEA 5CKEA 2LQKA 1VQ9Q 3VV0A 4MDWA 4J7IA 4C92C 4AFZC 2JNGA 2C0OA 2PZ1A 3CCQA 2LQ8A 2EGCA 3UATA 3CCQT 2CZ7B 2QXFA 4K11A 2RA2A 4RCCA 1SHFA 5FLXE 3AHUA 4C92D 3BDLA 2FB7A 4AG2C 1YIJA 2X51A 2GTJA 4JS5A 1YIJT 1NJIR 3JCMb 5C6SA 4MMKA 2O9SA 2PNIA 2K5FA 1VYTA 5GAOp 1OU8A 5KYNA 2RPNA 4J7FA 2QA4A 4ZGEB 1JQQA 1ZX6A 5GANh 5LJ3f 2O31A 2P0KA 4C0ZA 1FMWA 2CZ0B 3A1PA 4JJCA 2DAQA 4LDVA 5LJ5e 4KULA 1Q7YR 1TU0B 2ECZA 2QI2A 3I55Q 4BY6C 4LNPA 4EPCA 2E6NA 4C8QB 2YDLA 2P4RA 4FW2A 3HRUA 4J6WA 2EAYA 3OS1A 5HKCA 1BIBA 4AMCA 4FW1A 4J6XA 2ATCB 2KXDA 3M57A 2O4XB 3CCJQ 2COWA 1VQLQ 1E6GA 2DTHA 1M5Q1 1M2VA 3DLLA 2DIQA 1UFFA 4CC3A 2YWWA 1M9SA 3I56A 4HA8A 1NBEB 5KYUB 1QVGS 2GNCA 2KRNA 3I56T 2L3QA 4J6YA 4DBHA 1AWJA 2RQTA 2XKOC 1WHJA 2LTOA 1ZA2B 2MYSA 1GFDA 3R6OA 4C0GA 3RKWA 4M7DD 3OYDA 1Q81R 2XICA 2JS0A 3S6WA 2YUPA 4EMKB 3HHTB 2MI6A 1VIFA 3F70A 2DRKA 4M77G 5CKHA 1QVGA 3TREA 1S72T 2PVGB 4QQDA 2DBKA 3META 1W2BP 1PKSA 1UB4A 2QQAA 4HT8A 2PTKA 2EJFA 4Z8AA 1M8MA 3OMCA 4N4GA 5CKDA 3QWXX 3A8LB 1UUEA 3ASKA 3OYYA 3CC2A 4XTWA 1AZGB 4DBRA 1T3LA 3UDCA 2PUOB 4XK8E 4IKFA 4FYYB 4F7UE 4JZ3A 2DZCA 2YT6A 1MUZA 3PMIA 4M7AF 4JLGA 3DB3A 1V1CA 1WJSA 5I11A 4C92E 3UT1A 1X2QA 1VQ8Q 5IT9E 3G6EA 3PIOA 2RQVA 2O88A 3GNGA 2A7YA 2COZA 1D1BA 3G6ET 5GMKj 2G3RA 3UF4A 4M78G 2XDDA 1VIEA 5GAN3 3VKIA 3JCMQ 3T9NA 1QVFP 2EQMA 3OQ5A 1VQKQ 2J6FA 8AT1B 1PKTA 2YUNA 5LJ5f 3EG9A 5LJ3d 1M90U 4OMLA 2FL7A 2LC4A 4NL2A 2DL8A 4J9FA 5FWCA 3VRYA 2ZZDA 2QYZA 4Z89A 3JCMX 4RKUE 2LJ3A 3ULRB 3L2RA 3V8JA 2K57A 1D09B 1KG1A 5GAMg 4D8KA 3CMAA 1K0XA 2RHUA 1UJ0A 2JJ9A 3WVDB 5GMKm 4N0AA 1XOVA 1QMCA 3CMAT 4XTXA 4KRTA 2RI3A 4LXCA 1K4US 5GAMj 1WGSA 4XTYA 2DXCA 4BDZA 1Z9ZA 3CCQQ 4DA4A 1UDLA 2LRQA 3JCMd 3P8HA 4PJOF 2DFUA 1JO8A 4EMGA 3LLRA 2E5KA 5FU7C 3CD6A 4OMFB 1Q7YC 1VYUA 2X3WD 3CD6T 1YIJQ 1IRXA 4M7AA 5FRMA 5KYXB 1UE9A 4CI0C 4PKCC 2FEIA 2CUDA 1RLPC 4C92G 1D1AA 1U8RA 2O9VA 4HKEA 1W1FA 2M9UA 1KJWA 2QA4Q 3GIBA 3E2UA 1JXMA 4ANJA 3FRNA 4C5IA 2ED1A 4JDSA 4XU1A 4X9CA 3M4YA 3A8GB 5L23A 2D1XA 1QP2A 1KFZA 4JPBW 4JS4A 2KSSA 2NUPB 1MMNA 1C6VX 2MK5A 2GCXA 2EJGA 1KK7A 4RCBA 2E1HA 2NYSA 3TQ7P 1RAHB 3MP1A 3M56A 3NHNA 3LWIA 4ZTJA 2GQVA 3QWYA 3I9QA 1YWOA 3O5ZA 1B7TA 2XIDA 2HSEB 1PM3A 1ZSZC 2BUDA 1Q81C 1N9SA 1PSFA 1OX9A 2L3PA 4II1A 4PJOA 1M4ZA 3I56Q 3NMZC 1KQ1A 2C0IA 4M7AD 2JTEA 1SSHA 1PCXA 1VYVA 4F7UB 2LJ1A 3VJPA 1RAAB 5KYUA 1WHLA 3AT1B 3A8MB 4WTOB 5LJ3g 4C92B 2FZGB 1IHVA 3OS5A 4FIBA 1B07A 4XTVA 1FWZA 2BKDN 1OOTA 5LJ3j 5D6YA 4OGCA 1ZQ1A 5GAOq 2RHIA 1OU9A 1VQOA 3BE3A 5AYFA 2OJ2A 4LN2A 1VQOT 5LJ5d 4M7DG 4LD9K 1J3TA 2RF0A 1OYXA 3ER0A 1WHHA 2HQXA 1WQ7A 1I4K1 4EMKA 4PFPA 2LCSA 3NPFA 4RTZA 4LD6A 1QW1A 4YTLA 2A0FB 1WHMA 3C95A 4LUDA 2H3JA 2PQWA 4AFSC 4OMMA 1VQ4A 1PC0A 3JCMg 3R6NA 1VQ4T 1VQ9A 2YUQA 1HYOA 3GNFB 2EFIA 1VQ9T 3PIPA 2QTXA 2EGAA 2B86A 4J83A 3CC2Q 4OVAA 3BW1A 2VWFA 4HXJA 4BY6B 3HRSA 2NWMA 1MGQA 2V1RA 1FYNA 3OBWA 4M75F 2YXYA 2KE9A 3SFMA 2YRDA 3G6EQ 1WI7A 4HCZA 3JB9F 2CYZB 3QUIA 3RDVA 1Y71A 2FPDA 4QQ6A 3GP8A 5HY6A 1BI0A 2X4YA 1OEBA 2KRMA 5D7UA 4E7LA 1JRIA 4QKUA 2L8DA 2M1HA 2CUBA 2Z0WA 1KQ2A 3FJ5A 4A53A 4QVCA 1NG2A 5HK3A 3G71A 1VQ5A 3I35A 4DQ2A 2KEAA 2AZSA 4E7IA 1K76A 1O75A 2W0ZA 3G71T 1VQ5T 1CKBA 1PD0A 3M0SA 4BACA 4DEXA 2LP5A 1M90R 2FPEA 3CMAQ 2JOYA 2GBQA 4BB7A 2L5QA 4BI3A 3RR6A 4ZTFA 2HQHA 2NUTA 4BI4A 2CP2A 5D6WA 3VYHB 3QIIA 3CD6Q 5M9OA 2RH2A 3JSCA 1X75C 1PD1A 1TUGB 1ZBXA 3PMTA 2R58A 1Q81U 2M16A 4M75A 2BZXA 2AIRB 2X9HA 4QT7A 1OULA 3MJXA 2DA9A 1G83A 1JBMA 3OSSC 3QPHA 1G3TA 2DO3A 2E4HA 4M77C 3EG1A 1NLPC 1BYMA 5LJ5g 2CT3A 1W6XA 4C5HA 4XTUA 1H3ZA 5LJ5j 5KCHA 2K7AA 2F2XA 3OW2P 1IREB 5GAOl 4GBQA 1MMGA 1X43A 5KYWA 3IQLA 5GAN8 5CKBA 2BE9B 4OGEA 1FMKA 1Q82R 4IUUA 4ELZC 1VQ6A 2DL7A 2NUPA 2M51A 4PJNA 3HPWA 1GFCA 1VQ6T 1H8KA 2MWOA 1VOMA 1QQJA 3CMEA 2RQUA 3CMET 2D0NA 2QDLA 5GAMf 1D0XA 1PHTA 3TSWA 4M78C 4A4GA 2KT8A 3JCMP 2JW4A 2XHCA 2QK0A 5GMKi 9ATCB 4LDWA 2KNBB 1NEGA 3VYGA 4R55A 1OZ2A 2JMAA 1WLPB 1UHCA 3V7SA 3OYNA 3ZBDA 4EIKA 4M7AG 2COYA 3JB9I 3CCUA 1WJQA 3CC4Q 3CCUT 4NS5A 3HTRA 2LT4A 4F7UA 2W10A 3QG1A 2DVEA 3CCSA 3CQTA 3OBYA 1VQOQ 5FU7B 3G4SA 2AZVA 3CCST 1VQKT 1R0BG 3TEEA 3G4ST 3QZ5B 1TUDA 1MHNA 3VU3C 3M9QA 3OYHA 1SF9A 2OTLA 3S3NA 3L42A 5GAN6 3MKDA 2OTLT 2LCCA 1N9RA 1WYXA 3OYJA 1BIAA 2ZPBB 2EYXA 2XG8D 1ZHIA 2RB6A 4C5EA 1T0HA 1KHIA 2MPXC 3SWNB 1VQ4Q 3RMQA 4E2FB 3EFSA 2KYMA 3PVLA 1FX7A 2E65A 1BBZA 4V2SA 3FDRA 2RJFA 3LYIA 2EJ9A 1KD1U 4FM4B 5IN1A 1V76A 3JCMc 1X6BA 1X2KA 3RUXA 2E12A 3X20B 2L2PA 4J9GA 4X34A 1U06A 2KY9A 1M90C 4LDUA 1ZSZB 2LMJA 1Y96A 1BI2A 2DXUA 2JUFA 2QA4T 1OQKA 3JAME 3HKSA 2KAFA 3OA6A 4KGVB 2X3XD 4Z02A 3OS2A 4RG8A 5GAN2 2X4XA 4PK4A 4EDUA 3PT9A 1MMDA 3C0CA 4R56A 4IUVA 4M77E 3C12A 3G71Q 1VQ5Q 2QEXA 1ZUUA 5CQXA 1UEBA 2QEXT 1VQMA 4FT4A 4RTYA 1YWPA 2AT1B 1VQMT 3L2VA 2IVWA 2E70A 5CCAA 1ZBJA 3UWNA 3JCMf 2RHZA 3ME9A 3O8VA 1IHWA 2XDBA 5GAMd 2MMPA 2Y90A 2JM9A 3A8HB 2AHJB 4ATOA 2D0QB 4OMNA 1Q82C 1AWXA 4M7DC 2JS2A 4DBFA 1WDXA 4JJDA 4OP0A 5KYYB 2KT1A 2LNVA 3E9FA 2V1QA 1QVGP 1WPYA 4M78E 4HVVA 2CP6A 2ZAEA 1OX8A 3V7CA 1ZA1B 2CZ1B 3H0IA 3GLXA 3E19A 1LJOA 1ZLMA 3VS4A 2P4TA 4QVZA 2EVRA 2R5AA 2RO0A 5CKFA 4BUGA 1X6OA 4ZGJB 1PRLC 2AKLA 2DTOA 2PVDB 2XU8A 5FRNA 1VQ6Q 3NTKA 1RAEB 3CMEQ 2IG0A 2EQJA 1ABQA 3QHSA 1R0CB 1A0NB 3NTIA 4PLIA 3NGPA 2YLCA 4J9DA 5GJWB 2DTIA 2C0TA 1VQNA 1G3WA 2IPOB 4ZGDB 3CC2T 1VQNT 4HVUA 3I5RA 3G7ZA 1F1BB 3GPLA 1WJRA 3HFNA 4FYXB 2IIMA 4OB1B 4E7ZA 4ZN1A 2HL3A 5AT1B 4J9HA 2RQRA 2BTTA 3CCUQ 1TG0A 2K5IA 2RI2A 1EIFA 2DJQA 2L0AA 3VS2A 4F04B 1K9MU 4RTTA 4BE0A 3QXEB 2ABLA 1WXTA 4RTVA 5LJ3h 3CCSQ 1YITA 3OYGA 3G4SQ 4IUQA 2NUZA 1YITT 1NZ9A 1QCNA 2RHYA 2ZPFB 2OTLQ 4E7KA 5IAYA 3OYCA 2YUOA 3DLMA 4XTZA 4KUIA 5DLOA 1JXOA 1B34B 1IZ6A 2Y4XA 3JCMJ 5GANj 1EX4A 3RERA 1YP5A 2KBTA 4J8OA 4M77B 2CP5A 2LCLA 1D0ZA 4KGZB 5IHKA 2CDTA 3EGXB 3RIRA 3M54A 2I2LA 1HD3A 4MZPA 1BK2A 1FXXA 3THKA 3SD4A 4C8QF 4TVRA 1NM7A 3JCMh 1XJWB 2MF2A 1YI2A 4B6MA 2R57A 1D3BB 2WSEE 1TUCA 1YI2T 1LCKA 4BD3A 2HAXA 2VV5A 1QP3A 3EFOB 3E9GA 3KUFA 1SEMA 1QKWA 1QVPA 1G2BA 3VS5A 2O2OA 3CPWS 1YFNA 2DNUA 3MO8A 1KHCA 1KD1R 1I5LA 1Q82U 3SWNC 1RADB 2E41A 2YLBA 4M78B 2V26A 3FLGA 1KC8U 2ZGWA 3QYHB 1VQ7A 4M7DE 3FB9A 1BCMA 1VQ7T 4MZTA 1WX6A 7AT1B 2DKGA 2NLUA 1MNDA 2RHXA 1PG5B 1S1NA 4B9WA 4CC7A 2DE0X 1IO6A 3ZL7C 2DPPB 2QEXQ 4A4KA 2OAWA 1VQMQ 5FU6C 4WCIA 2D8HA 3FIFA 5IHNA 2SRCA 2HBPA 3SDZA 1I0CA 1YJWA 1RAFB 5A2QE 4C8QA 3CPWA 2DYIA 2K2MA 1YJWT 2FZCB 4M7AC 3D7SB 2QTVA 4DOWA 3CCRA 1U1SA 4AFUC 1P92A 2DVJA 1NPRA 2E64A 4AG1C 3CCMA 3CC7A 1M3BA 1XQHA 4Z88A 3CCRT 2O4XA 1D0YA 3CCMT 1GL5A 3CC7T 1PWTA 1RI9A 2K4YA 2EGEA 3CCVA 1X69A 4DOVA 1M30A 4PJLA 3JCMV 3CCVT 2EYYA 3SEMA 5D6XA 4RTUA 3CC4A 3CC4T 5KYYA 1OZ3A 5IXBA 4IIMA 1BU1A 4Y91A 4HCCA 5LJ5h 3QDRB 2KK4A 4X9DA 4ESRA 3OYEA 3M53A 2ZPGB 1G3YA 3MPUB 3J81E 4Y28E 1T0JA 1JJ2S 2K9GA 1ABOA 1HXDA 2K3YA 5EG2A 3I5SA 3S3MA 4CC4B 4LDYA 2V8KA 4PJOC 2LQNA 5GANe 5GAOm 2RNAA 2DBMA 2EYQA 4C8QD 1GBQA 1SRLA 2WACA 1N27A 1PSEA 4KT0E 4ME7A 3OYIA 3FJPA 1M2OA 2M02A 1OPLA 4PJOD 3OB9A 3MHXA 1VQNQ 2DEQA 3CXCS 4D6WA 1R8OB 1XTDA 1X27A 1VQPA 4GLKA 2VKNA 1AD5A 5IH2A 1VQPT 1LNXA 2A3LA 2DILA 4KBMB 2FPFA 2KQWA 2X4JA 1JJ2A 4JZ4A 2A37A 1EZZB 1E7OA 4OB2B 1AVZC 1YITQ 1LPLA 4A4FA 1EFNA 2VGMA 4BE2A 3VUZA 2KI7A 2KRSA 4M7DB 1H3HA 3CXCA 3RESA 1K9MR 3EH2A 2ED0A 1I8FA 3PVQA 2JZ2A 2DLPA 2RI5A 3FEOA 2RQWA 3BY7A 1KD1C 4B9XA 4FYVB 1M1KC 4M77A 2Y4YA 3EGXA 1ARKA 1YI2Q 4JJNK 3VRZA 3M58A 2JTMA 4P5NA 2DYBA 3M0PA 2ENMA 6AT1B 3OMGA 2RJEA 4E6RA 1M2VB 2FYKA 2QG9B 2ZPHB 4KH0B 4M7AE 1Y07A 2F2VA 2ZPEB 2HL5C 3EFOA 4RMOA 1NPPA 3QJYA 1RL2A 5KYXA 4F7UF 1N5ZA 1QKXA 2X35A 1I81A 1D1CA 2D6FA 1KSWA 2L89A 4LDXA 4PJJA 4C5GA 1RI0A 1VQ7Q 4C92F 3MEAA 5GAN5 2H8HA 1SKUB 1WNLA 1FMVA 4M78A 2HCKA 2RJCA 2DD4A 2WSCE 2KVQG 3VS6A 1IB8A 4ZNXA 3X28B 2O01E 1AZEA 3QKJA 4M4ZA 2KXCA 4C0DC 3CCLA 5GANf 1KC8R 1JU5C 3CCLT 2EW3A 1IGUA 1GCQC 2CREA 1XNIA 1YJWQ 2JXBA 5GAOn 2KMTA 4E7JA 2HQEA 4GLMA 1W4SA 5CIUA 2RK2A 4PNOA 4M75C 1KQSS 3M4GA 3U23A 1SSFA 3CCRQ 2LX9A 2QGFB 3CCMQ 2EWNA 3CC7Q 5FWBA 2EQIA 3DKMA 4IIOA 4PJOE 1YNZA 2PVOB 3OYMA 4M75D 3C94A 1H92A 1DJ7B 3CCVQ 2F5TX 1TXQA 5L8RE 3EG0A 1YCYA 4J9CA 2JVVA 5CAIA 3JB9D 1U5SA 2RD1A 3DB4A 5DM7R 1I5OB 5DLQE 3UA7A 1K0SA 4JUVA 1M1KR 4C92A 5DY9A 5I2SA 2JM8A 1OPKA 4JRQA 2FHDA 2QGGA 1KQSA 1AWWA 2QAZA 1W70A 2QASA 4XQ3A 3URGA 3KXTA 1RAIB 3UA6A 4BDYA 2QQ9A 3LH5A 4J9IA 1WHKA 3QJ6A 1WZOA 2DX1A 5CVIA 4BI8B 2F5KA 5C0MA 1M3AA 1VUBA 2GFAA 1RACB 2HZYA 1K8AC 2LDMA 2JTFA 2GGRA 1N8RC 2A36A 3SB2A 3G1JA 2KYBA 4C8QG 3J7AF 1M1KU 1ZUKA 2OTJA 1VQPQ 2OTJT 4PJOG 3WVEB 5FU6B 1UGQB 2E10A 5KH6A 1TH7A 1K9MC 4AFQC 5GJVB 1QCFA 3QSUA 4X1VA 2DZ9A 3H6ZA 3BFMA 5IXFA 4DBQA 2EQKA 3GF5A 2OAUA 4M7AB 2XI9A 5GMKh 2G6FX 2L3RA 4LE9A 1C0MA 3N5BB 1GXIE 3EGUA 2P0QA 3MEVA 1NYGA 2QQBA 5I22A 5A0GA 3EG2A 4RG2A 1YJ9A 2C06A 1YJ9T 4RUGA 2F69A 3OYAA 5J3BA 4QVDA 1UG1A 3TSZA 2LJ0A 3ZEHA 2HBWA 4M7DA 2YSQA 5GANd 1I1JA 2EIFA 1TSFA 2DMOA 2EKHA 2K2VA 4FCYA 5GAMh 1RUWA 3HL8A 1X6GA 2P0PA 1Y7XA 1G5VA 2BE7D 2CP0A 3S3OA 1JEGA 3MP8A 1Z9QA 3C4SA 2CS7A 5J26A 1M1GA 1M1FA 3GOXA 4PJOB 1B3QA 3JRZA 4PFOA 1K9AA 4M75E 1KC8C 4AT1B 3E1SA 3M5AA 2VXEA 1YCSB 5CK9A 4Q5WA 5A0LA 4BE1A 1U1TA 1K1ZA 2M0YA 2XK0A 4JRIA 3VS3A 2V8IA 4ZN3A 1Q86C 3HSBA 3L2WA 3Q1JA 3RMSA 2MCNA 3JB9J 3EGDB 3TU4K 4FSSA 2GF7A 1Y57A 3EH1A 1U3OA 2ROLA 3CCLQ 1IGQA 3NTHA 3LGLA 2HMAA 2HEQA 1W2BS 3CCEA 4XAXB 1RABB 5LL6S 3EHRA 3CCET 5IHIA 3OY9A 2HNIA 1S72A 3VS0A 1WHGA 4NL3A 3VS1A 4OB3B 1K8AU 1Y0MA 4A4EA 5GAN4 1N8RU 1NE8A 2A08A 4R0KA 4KGXB 3V8LA 5I21A 3EHQA 1K73U 3EFRA 3QZ9B 1E6HA 2HKQB 5CR2A 4M75G 1UGSB 3VUBA 1TWBA 3M59A 1YJNA 1BKBA 2BZ8A 2ESWA 4A63B 1CKAA 2EYZA 1YJNT 2XDPA 2ZCFB 3JB9G 1M27C 2QQSA 2J7IA 2GTOA 4J5YA 1W2BA 2FZKB 1QWEA 1QVFS 3OSVA 1V29B 2RMOA 1YN8A 5GANg 1SPKA 3X24B 1AEYA 3TCJA 3GBQA 2FO0A 2XD0A 2CP3A 3J80E 4F16A 2OX7A 3CPFA 2MOXA 2F2WA 2PUKB 3HP9A 4HCKA 2LVMA 3M0TA 3SWNA 2DJZA 2H3EB 2WSFE 5FW9A 2GFUA 2EBPA 2YHTA 4PLLA 1ZUYA 1BB9A 1ZSGA 2DM1A 3HRTA 5GAOr 1NJIC 2OTJQ 5HK0A 2M0OA 4FYWB 4JRKA 3QO3A 2NUTB 4IUPA 1OV3A 4MMLA 4C0DB 2DETA 2MWPA 2JT4A 1QVFA 1WQWA 5J39A 3PE0A 3WXMB 2B8AA 1WFWA 3X25B 2CKKA 1UTIA 1JB0E 1NLOC 1KIKA 2KDSA 1HK9A 4VUBA 1UGRB 2VVKA 4M75B 3CBOA 2CH4W
chains in the Genus database with same CATH topology
3I56T 1H641 2KQWA 1X01A 3KBGA 3OYNA 2X4JA 1JJ2A 4J6YA 3ZBDA 4M7AG 3JB9I 3CCUA 2XKOC 1WJQA 2LTOA 2VC8A 4PL6A 4F7UG 3OYLA 4L5GA 3CCUT 3MCAB 4OB2B 4NS5A 4F7UA 2LT4A 4A4FA 3R6OA 3QG1A 2VGMA 4BE2A 2DVEA 3CCSA 4C0GA 4C0FA 1Q86U 3OBYA 1O9SA 3LGFA 4N0AC 5FU7B 3RKWA 3VUZA 3OYDA 4L6V5 3L2ZA 3G4SA 3CCST 1VQKT 4MZMA 3TEEA 3G4ST 4M7DB 2XICA 3QZ5B 3CXCA 1MHNA 3RESA 3M9QA 3VU3C 3S6WA 3OYHA 2OTLA 3S3NA 3H8ZA 3L42A 5GAN6 2OTLT 4EMKB 2LCCA 3HHTB 1N9RA 2ZPIB 5KE3A 3OYJA 1BIAA 1I8FA 2ZPBB 2MI6A 1VIFA 2XG8D 1ZHIA 2JZ2A 3F70A 2RB6A 2RI5A 3FEOA 4QW2A 4C5EA 2VGNA 1YHQA 1KHIA 3BY7A 4M77G 5CKHA 3SWNB 1KD1C 4B9XA 3OYFA 1YHQT 1QVGA 1M1KC 4M77A 3RMQA 2PVGB 2Y4YA 3TREA 3EFSA 4QQDA 1S72T 2K3XA 3META 1UB4A 2QQAA 4HT8A 4JJNK 2EQUA 2EJFA 1FX7A 2E65A 3M58A 4V2SA 2RM4A 2JTMA 4P5NA 3OMCA 3FDRA 4N4GA 5CKDA 3OYBA 2RJFA 3A8LB 3LYIA 2EJ9A 1KD1U 3ASKA 3OMGA 2MAMA 3OYYA 3PGGA 3CC2A 2RJEA 4FM4B 4XTWA 5IN1A 3JCMc 2QQRA 2FYKA 3UDCA 2PUOB 2ZPHB 3RUXA 4XK8E 4IUTA 4M7AE 2E12A 1Y07A 4IKFA 1M8VA 4F7UE 2ZPEB 3X20B 4RMOA 2DZCA 1NPPA 3V7RA 4N4IA 4XU0A 3PMIA 3QJYA 1RL2A 4M7AF 4JLGA 4X34A 3DB3A 1WJSA 4F7UF 5KCOA 2DIGA 2X35A 4C92E 3P8BB 2KY9A 3UT1A 1I81A 2VXFA 1M90C 4LDUA 5IT9E 2BIVA 2D6FA 2L89A 4LDXA 3G6EA 3PIOA 1Y96A 1BI2A 2DXUA 2A7YA 1RI0A 2K5LA 3GNGA 3MEAA 4C5GA 2JUFA 4C92F 5GAN5 3G6ET 2QA4T 5GMKj 2G3RA 2XDDA 4M78G 3JAME 4FT2A 1VIEA 1WNLA 3HKSA 5GAN3 4M78A 4C8QC 2KAFA 2RJCA 3VKIA 3OA6A 2DD4A 3JCMQ 3LH0A 2QDYB 2EQMA 4Z02A 2WSCE 3OQ5A 3T9NA 3OS2A 4RG8A 5GAN2 2KVQG 2VUBA 2X4XA 4EDUA 3PT9A 5LJ5f 5LJ3d 1M90U 3CEYA 3X28B 2O01E 5GMKe 3HFOA 3QKJA 4IUVA 4R56A 4M77E 4C0DC 2FL7A 2LC4A 1BI3A 3C12A 4NL2A 5GANf 3CCLA 2QEXA 3CCLT 2E5QA 4M77F 5GMKl 5CQXA 1UEBA 1XNIA 2ZZDA 2QEXT 3V8KA 1VQMA 4FT4A 5GAOn 2KMTA 4E7JA 2YRVA 3NFCA 4WF2A 3JCMX 4RKUE 3UPUA 2HQEA 1VQMT 1W4SA 3L2RA 3L2VA 5CIUA 4O6JA 2RK2A 4PNOA 4M75C 1KQSS 2IVWA 3M4GA 2CZ6B 2E70A 2K57A 3V8JA 5CCAA 1KG1A 5GAMg 3CMAA 2RHUA 1SSFA 3UWNA 3JCMf 3WVDB 5GMKm 3JCMW 2LX9A 4N0AA 2RHZA 1XOVA 2EWNA 3CMAT 4XTXA 3ME9A 3O8VA 3DKMA 2RI3A 5GAMj 4PJOE 1WGSA 2XDBA 4XTYA 5GAMd 2DXCA 4BDZA 2PVOB 3OYMA 4DA4A 4M75D 2LRQA 2MMPA 2Y90A 3C94A 1NJIU 1DJ7B 3JCMd 3P8HA 3BDUA 2F5TX 4PJOF 5L8RE 3A8HB 3OYKA 2AHJB 3OS0A 4ATOA 4EMGA 1YCYA 3LLRA 5CQYA 5FU7C 3CD6A 2D0QB 2JVVA 4OMFB 1Q82C 5GAMe 5CAIA 1Q7YC 3JB9D 2RD1A 3DB4A 5DM7R 3CD6T 4M7DC 2EKOA 2DK3A 4M7AA 1G3SA 4OP0A 2LNVA 5FRMA 5DLQE 3E9FA 4EMKC 4CI0C 2R5MA 1WPYA 4M78E 4PKCC 4JUVA 4GY5A 1BI1A 3V7CA 4NOYA 4C92G 5FROA 1U8RA 4KUDK 1Y96B 4HKEA 4C92A 2X4WA 2CZ1B 2M9UA 4FU6A 4M78F 5DY9A 5I2SA 4JRQA 3GLXA 3E19A 1LJOA 1UGPB 2FHDA 1Q7YU 3GIBA 1KQSA 4M7DD 3FRNA 2P4TA 4QVZA 5CKFA 2R5AA 2RO0A 4JDSA 4BUGA 4C5IA 4HT9A 4XU1A 4X9CA 3M4YA 3A8GB 1X6OA 4ZGJB 4XQ3A 3URGA 3KXTA 2DTOA 1QP2A 3LWHA 4JS4A 2KSSA 1B34A 2PVDB 4QQGA 4BDYA 2QQ9A 2XU8A 5GAN7 3QJ6A 5FRNA 2GCXA 5CVIA 2EJGA 4BI8B 4RCBA 2F5KA 5C0MA 1VUBA 2E1HA 2GFAA 4UC4A 2JN0A 1K8AC 3NTKA 3I55A 2LDMA 2V8JA 2JTFA 1N8RC 3MP1A 3I55T 2IG0A 2EQJA 3M56A 3EAEA 3SB2A 3LWIA 4ZTJA 3QHSA 4C8QG 2GQVA 4OF1A 3RKXA 3NTIA 4PLIA 3J7AF 1M1KU 2YLCA 1D3BA 2OTJA 2DTIA 2LT1A 2XIDA 1VQNA 2BUDA 1G3WA 4ZGDB 3CC2T 2OTJT 1Q81C 1N9SA 4PJOG 3WVEB 1PSFA 2E6ZA 1UGQB 2E10A 5FU6B 5KH6A 1VQNT 1TH7A 4II1A 1K9MC 4PJOA 3G7ZA 3CCJA 3GPLA 1WJRA 3HFNA 1VQLA 3QSUA 1M4ZA 2DXBA 3LX7A 2DZ9A 1KQ1A 3CCJT 3QYGB 4OB1B 1VQLT 4ZN1A 3H6ZA 4M7AD 3L2UA 4HCBA 3BFMA 3QBYA 2EQKA 3GF5A 2OAUA 4M7AB 4A4HA 4E7HA 2XI9A 3PNWC 4F7UB 2K5IA 5GMKh 3VJPA 2RI2A 3L2QA 1EIFA 2VYTA 2L3RA 3N5BB 1K9MU 1GXIE 2P0QA 2RJDA 3MEVA 3A8MB 3QXEB 4BE0A 5LJ3g 4C92B 4CRIA 2QQBA 3OS5A 5LJ3h 5A0GA 4FIBA 4RG2A 4XTVA 3OW2S 1YITA 4MDXA 1FWZA 2BKDN 3OYGA 1YJ9A 3P8DA 2DXTA 2PU9B 5LJ3j 4EMHA 4IUQA 1YITT 2C06A 5D6YA 4OGCA 1YJ9T 1NZ9A 1ZQ1A 5GAOq 2RHYA 2RHIA 2F69A 2ZPFB 4E7KA 2HD0A 5IAYA 4JRPA 1VQOA 3OYCA 5AYFA 3DLMA 3OYAA 4XTZA 4KUIA 5J3BA 1VQOT 5DLOA 5LJ5d 5KE2A 4M7DG 4QVDA 4LD9K 5LJ3e 1B34B 1IZ6A 1OYXA 2Y4XA 4M77D 3ZEHA 3JCMJ 3ER0A 5GANj 4M7DA 5GANd 3RERA 2HQXA 4FL6A 2EIFA 4J8OA 4M77B 1WQ7A 1I4K1 4EMKA 4O5VA 4IURA 2LCLA 4XU2A 4A54A 4C8QE 2K2VA 4LD6A 3RIRA 3M54A 1QW1A 2I2LA 4MZPA 4YTLA 3C95A 2H3JA 1FXXA 2PQWA 2CGHA 1VQ4A 3SD4A 4C8QF 5I2MA 5GAMh 3HL8A 4TVRA 3JCMg 3L1AA 4N4HA 3RKYA 2P0PA 1Y7XA 1VQ4T 4OB0B 3JCMh 1VQ9A 1G5VA 2MF2A 4E47A 1YI2A 3S3OA 4XU3A 3GNFB 3MP8A 2EFIA 2R57A 1VQ9T 1D3BB 2WSEE 3PIPA 3C4SA 3MP6A 2QTXA 1YI2T 4BD3A 2CS7A 4J83A 3OW2A 2HAXA 2VV5A 5J26A 1M1GA 1QP3A 4OVAA 1M1FA 3BW1A 3GOXA 4PJOB 3FC3A 2FVUA 3JRZA 4BY6B 3HRSA 4JLIA 1MGQA 3JCMe 4M75E 4L59A 1KC8C 3E1SA 1LOJA 3M5AA 3E9GA 3KUFA 2VXEA 1QVPA 5CK9A 3OBWA 4M75F 4Q5WA 3CPWS 5A0LA 4BE1A 1U1TA 3A5ZB 3MO8A 1KHCA 3SFMA 1I5LA 2XK0A 4JRIA 1YBYA 4M78D 3SWNC 1Q82U 2V8IA 4ZN3A 1Q86C 4HCZA 2E41A 3HSBA 3L2WA 3JB9F 2CYZB 2YLBA 3CBPA 4M78B 3FLGA 3QUIA 1KC8U 3Q1JA 1VQ8A 3RMSA 1Y71A 4QQ6A 2ZGWA 3JB9H 3GP8A 1VQ8T 5HY6A 2D9TA 3ZFJA 3QYHB 1VQ7A 3JB9J 1BI0A 2X4YA 3TU4K 4E7LA 4M7DE 3FB9A 3X26B 1VQ7T 2GF7A 4MZTA 4FSXA 2DKGA 1JRIA 1OI1A 2NLUA 3MEWA 2L8DA 2M1HA 2RHXA 3PTAA 4B9WA 1VQKA 4M7DF 1KQ2A 2DPPB 3INZA 1N6AA 4A4KA 2RK1A 3NTHA 3LW5E 3LGLA 4A53A 4ELYC 5FU6C 4QVCA 5HK3A 3FIFA 3G71A 1VQ5A 4DQ2A 4E7IA 2HBPA 3SDZA 1W2BS 1O75A 3G71T 1VQ5T 3CCEA 4XAXB 1YJWA 5CO7A 4BACA 5A2QE 2DD5A 5LL6S 4C8QA 3CPWA 3CCET 3OY9A 1YJWT 3M55A 2HNIA 3PFSA 1S72A 3MEUA 1K73C 2JOYA 1AHJB 4BB7A 4M7AC 3CBMA 2L5QA 4BI3A 5A0DA 4NL3A 3A8OB 4OB3B 4DOWA 4ZTFA 1K8AU 5CKEA 2LQKA 4A4EA 5GAN4 4BI4A 3CCRA 1U1SA 1NE8A 1N8RU 1P92A 2E64A 1NPRA 3VV0A 3CCMA 3CC7A 4MDWA 4J7IA 1XQHA 5D6WA 3V8LA 2O4XA 4C92C 3CCRT 3VYHB 3CCMT 2JNGA 3CC7T 3QIIA 3CCQA 5I21A 2LQ8A 1K73U 5M9OA 2K4YA 3EFRA 2RH2A 3QZ9B 1X75C 3JSCA 2CZ7B 4DOVA 2QXFA 5CR2A 3CCQT 2RA2A 4RCCA 3CCVA 4M75G 1ZBXA 5FLXE 3PMTA 2R58A 3JCMV 2M16A 3CCVT 1Q81U 1UGSB 3VUBA 3AHUA 4M75A 4C92D 3BDLA 5D6XA 3M59A 1YJNA 1BKBA 2FB7A 1YIJA 3CC4A 1YJNT 2XDPA 2ZCFB 3JB9G 4JS5A 2QQSA 1JBMA 4J5YA 3CC4T 1YIJT 3OSSC 3QPHA 1G3TA 3JCMb 2DO3A 4MMKA 5C6SA 1W2BA 1OZ3A 4M77C 1BYMA 2K5FA 4Y91A 5LJ5g 1QVFS 4HCCA 5GAOp 3OSVA 5LJ5h 3QDRB 2KK4A 1V29B 4X9DA 4C5HA 3M53A 4XTUA 3OYEA 4J7FA 5GANg 2QA4A 4ZGEB 1H3ZA 5LJ5j 5KCHA 2ZPGB 5GANh 1G3YA 1IREB 5GAOl 3X24B 5LJ3f 2P0KA 4C0ZA 5GAN8 5CKBA 2CZ0B 3TCJA 3J81E 2XD0A 2DAQA 4Y28E 4OGEA 4LDVA 5LJ5e 4KULA 3J80E 1JJ2S 1HXDA 2K3YA 3CPFA 5EG2A 3S3MA 4IUUA 4LDYA 2QI2A 2PUKB 3HP9A 2V8KA 4ELZC 4PJOC 1VQ6A 5GANe 5GAOm 2LVMA 4BY6C 2EYQA 3HPWA 4C8QD 2WACA 3SWNA 1N27A 1PSEA 2DJZA 2WSFE 4EPCA 4KT0E 4ME7A 1VQ6T 2E6NA 2GFUA 4C8QB 2YHTA 3HRUA 2MWOA 4PLLA 4J6WA 3OYIA 3CMEA 3FJPA 2EAYA 3OS1A 3HRTA 3CMET 5GAOr 1NJIC 5HKCA 4PJOD 1BIBA 3MHXA 3OB9A 2M0OA 5HK0A 4JRKA 2DEQA 3QO3A 3CXCS 4IUPA 4J6XA 4MMLA 4C0DB 4D6WA 1R8OB 5GAMf 2MWPA 3M57A 1QVFA 1XTDA 1WQWA 4M78C 5J39A 2O4XB 4A4GA 1VQPA 4GLKA 3JCMP 2XHCA 3WXMB 2B8AA 2DTHA 5GMKi 3X25B 4LDWA 1LNXA 2CKKA 1VQPT 1M5Q1 3DLLA 3VYGA 4R55A 1JB0E 1OZ2A 2DIQA 2KDSA 2A3LA 1HK9A 4VUBA 1UGRB 1M9SA 3I56A 4KBMB 4HA8A 1QVGS 4M75B 3CBOA 3V7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4Y A;  1BI2 A;  2K5L A;  1G3Y A;  2K5I A;  3HRT A;  3MHX A;  4O6J A;  1BI0 A;  4O5V A;  1G3S A;  3HRS A;  1G3W A;  2QQB A;  1QW1 A;  2QQ9 A;  1FWZ A;  2H3J A;  1QVP A;  2GCX A;  1BI1 A;  2LX9 A;  5CVI A;  1G3T A;  2QQA A;  1U8R A;  1P92 A;  1BYM A;  2K5F A;  1BI3 A;  1FX7 A;  3E19 A;  3GLX A;  3HRU A; 
#chains in the Genus database with same CATH topology
 1H64 1;  1X01 A;  1QCO A;  2KRO A;  3KBG A;  1WA7 A;  2YRC A;  3CPW P;  2VC8 A;  4PL6 A;  4F7U G;  3OYL A;  4L5G A;  1ZSZ A;  3MCA B;  1YJ9 Q;  1M3C A;  2VB6 A;  4C0F A;  3REA B;  1Q86 U;  1O9S A;  3LGF A;  4N0A C;  4L6V 5;  3L2Z A;  4MZM A;  4OMP A;  5KYW B;  1GRI A;  2HDA A;  3H8Z A;  2A28 A;  2ZPI B;  5KE3 A;  2CT4 A;  4J9B A;  4QW2 A;  2VGN A;  1YHQ A;  1Q95 G;  1PNJ A;  3OYF A;  1YHQ T;  1TTH B;  3H0F A;  2K3X A;  4OMO A;  2J6O A;  1UEC A;  4LUE A;  2AK5 A;  2L3S A;  2EQU A;  1SRM A;  2RM4 A;  4ORZ A;  3KFV A;  3OYB A;  1QLY A;  2MAM A;  3PGG A;  2KR3 A;  1T3S A;  2QQR A;  2J05 A;  2VAS A;  4IUT A;  1M8V A;  3M0U A;  3RNJ A;  2P84 A;  3REB B;  3V7R A;  4N4I A;  3A98 A;  4XU0 A;  2I0N A;  3H0H A;  5KCO A;  4F14 A;  2DIG A;  3P8B B;  4Y92 A;  2LZ6 B;  2DEU A;  2VXF A;  1MNE A;  2BIV A;  2DER A;  2D8J A;  2K5L A;  4JJB A;  4DEY A;  3M0R A;  4FT2 A;  2CP7 A;  4C8Q C;  4J9E A;  4HVW A;  3LH0 A;  2QDY B;  2XMF A;  1SHG A;  2VUB A;  3EGD A;  1G8X A;  3CEY A;  5GMK e;  1LVK A;  3HFO A;  1TS9 A;  1BI3 A;  2MIO A;  2E5Q A;  4M77 F;  4E7S A;  5GMK l;  3CCE Q;  3V8K A;  1JJ2 P;  2YRV A;  3NFC A;  4WF2 A;  3UPU A;  1S72 Q;  4O6J A;  2CSI A;  2OI3 A;  2CZ6 B;  2SEM A;  3JCM W;  3JV3 A;  3CXC P;  1TOV A;  1NJI U;  1NEB A;  2AKK A;  1HJD A;  3BDU A;  3OYK A;  3OS0 A;  3SHW A;  5CQY A;  1RLQ C;  5GAM e;  3VS7 A;  1K8A R;  1YJN Q;  2EKO A;  2DK3 A;  1AOJ A;  1ACM B;  1G3S A;  1NYF A;  1N8R R;  4EMK C;  2R5M A;  4D8D A;  2ROT A;  4GY5 A;  1BI1 A;  4NOY A;  5FRO A;  2LQW A;  4KUD K;  1Y96 B;  1K73 R;  4KH1 B;  2X4W A;  4M78 F;  4FU6 A;  1UGP B;  1Q7Y U;  2HSP A;  4HT9 A;  1RAG B;  3LWH A;  3M0Q A;  1B34 A;  4QQG A;  5GAN 7;  2J06 A;  1WXU A;  2LNH B;  4UC4 A;  2JN0 A;  2K6D A;  3I55 A;  2K79 A;  2V8J A;  2FRW A;  2CH4 A;  3I55 T;  3EAE A;  1PRM C;  1HSQ A;  4OF1 A;  3RKX A;  4PFZ A;  1D3B A;  2LT1 A;  1GCP A;  4F17 A;  2DL4 A;  2E6Z A;  3CCJ A;  1VQL A;  2DXB A;  3LX7 A;  3CCJ T;  3QYG B;  1VQL T;  1GCQ A;  3L2U A;  4HCB A;  3QDF A;  1GBR A;  3QBY A;  1C1A A;  4A4H A;  4E7H A;  2KGT A;  2JMC A;  3PNW C;  3L2Q A;  2BZY A;  2VYT A;  1UGV A;  2RJD A;  3TVT A;  4CRI A;  3OW2 S;  4MDX A;  3P8D A;  2DXT A;  2PU9 B;  4EMH A;  1WXB A;  2F1L A;  1R77 A;  1SG5 A;  2HD0 A;  4JRP A;  2FG0 A;  2DL5 A;  5EC7 A;  2E3H A;  5KE2 A;  5LJ3 e;  4M77 D;  1YHQ Q;  4FL6 A;  1MV3 A;  2DL3 A;  4O5V A;  4IUR A;  4XU2 A;  1Q86 R;  4A54 A;  4C8Q E;  2EYW A;  1MV0 B;  2CGH A;  2EPD A;  4RTW A;  5I2M A;  2DF6 A;  3L1A A;  4N4H A;  3RKY A;  4OB0 B;  4OMQ A;  4E47 A;  4XU3 A;  1KQS P;  3MP6 A;  2LX7 A;  3OW2 A;  2HKN A;  1UJY A;  2FVU A;  3FC3 A;  4JLI A;  1BCO A;  3JCM e;  4L59 A;  8ATC B;  1LOJ A;  2GQI A;  2J6K A;  2FRY A;  1AWO A;  2RN8 A;  3A5Z B;  4RTX A;  1QWF A;  2CSQ A;  4M78 D;  1YBY A;  2E3I A;  3CBP A;  1VQ8 A;  3EG3 A;  3JB9 H;  1VQ8 T;  3ZFJ A;  2D9T A;  1CSK A;  3EG9 B;  3X26 B;  4FSX A;  1MMA A;  3H41 A;  1OI1 A;  4PJM A;  3MEW A;  2K3B A;  4M7D F;  3PTA A;  1VQK A;  1I07 A;  3INZ A;  1N6A A;  5ECA A;  2RK1 A;  3H9N A;  3LW5 E;  1UHF A;  4ELY C;  3RBB B;  2DRM A;  5HCK A;  4CC2 A;  5CO7 A;  1AT1 B;  2DD5 A;  3M55 A;  3PFS A;  1VA7 A;  1K73 C;  3MEU A;  1AHJ B;  3CBM A;  5A0D A;  1IXD A;  3A8O B;  1WIE A;  5CKE A;  2LQK A;  1VQ9 Q;  3VV0 A;  4MDW A;  4J7I A;  4C92 C;  4AFZ C;  2JNG A;  2C0O A;  2PZ1 A;  3CCQ A;  2LQ8 A;  2EGC A;  3UAT A;  3CCQ T;  2CZ7 B;  2QXF A;  4K11 A;  2RA2 A;  4RCC A;  1SHF A;  5FLX E;  3AHU A;  4C92 D;  3BDL A;  2FB7 A;  4AG2 C;  1YIJ A;  2X51 A;  2GTJ A;  4JS5 A;  1YIJ T;  1NJI R;  3JCM b;  5C6S A;  4MMK A;  2O9S A;  2PNI A;  2K5F A;  1VYT A;  5GAO p;  1OU8 A;  5KYN A;  2RPN A;  4J7F A;  2QA4 A;  4ZGE B;  1JQQ A;  1ZX6 A;  5GAN h;  5LJ3 f;  2O31 A;  2P0K A;  4C0Z A;  1FMW A;  2CZ0 B;  3A1P A;  4JJC A;  2DAQ A;  4LDV A;  5LJ5 e;  4KUL A;  1Q7Y R;  1TU0 B;  2ECZ A;  2QI2 A;  3I55 Q;  4BY6 C;  4LNP A;  4EPC A;  2E6N A;  4C8Q B;  2YDL A;  2P4R A;  4FW2 A;  3HRU A;  4J6W A;  2EAY A;  3OS1 A;  5HKC A;  1BIB A;  4AMC A;  4FW1 A;  4J6X A;  2ATC B;  2KXD A;  3M57 A;  2O4X B;  3CCJ Q;  2COW A;  1VQL Q;  1E6G A;  2DTH A;  1M5Q 1;  1M2V A;  3DLL A;  2DIQ A;  1UFF A;  4CC3 A;  2YWW A;  1M9S A;  3I56 A;  4HA8 A;  1NBE B;  5KYU B;  1QVG S;  2GNC A;  2KRN A;  3I56 T;  2L3Q A;  4J6Y A;  4DBH A;  1AWJ A;  2RQT A;  2XKO C;  1WHJ A;  2LTO A;  1ZA2 B;  2MYS A;  1GFD A;  3R6O A;  4C0G A;  3RKW A;  4M7D D;  3OYD A;  1Q81 R;  2XIC A;  2JS0 A;  3S6W A;  2YUP A;  4EMK B;  3HHT B;  2MI6 A;  1VIF A;  3F70 A;  2DRK A;  4M77 G;  5CKH A;  1QVG A;  3TRE A;  1S72 T;  2PVG B;  4QQD A;  2DBK A;  3MET A;  1W2B P;  1PKS A;  1UB4 A;  2QQA A;  4HT8 A;  2PTK A;  2EJF A;  4Z8A A;  1M8M A;  3OMC A;  4N4G A;  5CKD A;  3QWX X;  3A8L B;  1UUE A;  3ASK A;  3OYY A;  3CC2 A;  4XTW A;  1AZG B;  4DBR A;  1T3L A;  3UDC A;  2PUO B;  4XK8 E;  4IKF A;  4FYY B;  4F7U E;  4JZ3 A;  2DZC A;  2YT6 A;  1MUZ A;  3PMI A;  4M7A F;  4JLG A;  3DB3 A;  1V1C A;  1WJS A;  5I11 A;  4C92 E;  3UT1 A;  1X2Q A;  1VQ8 Q;  5IT9 E;  3G6E A;  3PIO A;  2RQV A;  2O88 A;  3GNG A;  2A7Y A;  2COZ A;  1D1B A;  3G6E T;  5GMK j;  2G3R A;  3UF4 A;  4M78 G;  2XDD A;  1VIE A;  5GAN 3;  3VKI A;  3JCM Q;  3T9N A;  1QVF P;  2EQM A;  3OQ5 A;  1VQK Q;  2J6F A;  8AT1 B;  1PKT A;  2YUN A;  5LJ5 f;  3EG9 A;  5LJ3 d;  1M90 U;  4OML A;  2FL7 A;  2LC4 A;  4NL2 A;  2DL8 A;  4J9F A;  5FWC A;  3VRY A;  2ZZD A;  2QYZ A;  4Z89 A;  3JCM X;  4RKU E;  2LJ3 A;  3ULR B;  3L2R A;  3V8J A;  2K57 A;  1D09 B;  1KG1 A;  5GAM g;  4D8K A;  3CMA A;  1K0X A;  2RHU A;  1UJ0 A;  2JJ9 A;  3WVD B;  5GMK m;  4N0A A;  1XOV A;  1QMC A;  3CMA T;  4XTX A;  4KRT A;  2RI3 A;  4LXC A;  1K4U S;  5GAM j;  1WGS A;  4XTY A;  2DXC A;  4BDZ A;  1Z9Z A;  3CCQ Q;  4DA4 A;  1UDL A;  2LRQ A;  3JCM d;  3P8H A;  4PJO F;  2DFU A;  1JO8 A;  4EMG A;  3LLR A;  2E5K A;  5FU7 C;  3CD6 A;  4OMF B;  1Q7Y C;  1VYU A;  2X3W D;  3CD6 T;  1YIJ Q;  1IRX A;  4M7A A;  5FRM A;  5KYX B;  1UE9 A;  4CI0 C;  4PKC C;  2FEI A;  2CUD A;  1RLP C;  4C92 G;  1D1A A;  1U8R A;  2O9V A;  4HKE A;  1W1F A;  2M9U A;  1KJW A;  2QA4 Q;  3GIB A;  3E2U A;  1JXM A;  4ANJ A;  3FRN A;  4C5I A;  2ED1 A;  4JDS A;  4XU1 A;  4X9C A;  3M4Y A;  3A8G B;  5L23 A;  2D1X A;  1QP2 A;  1KFZ A;  4JPB W;  4JS4 A;  2KSS A;  2NUP B;  1MMN A;  1C6V X;  2MK5 A;  2GCX A;  2EJG A;  1KK7 A;  4RCB A;  2E1H A;  2NYS A;  3TQ7 P;  1RAH B;  3MP1 A;  3M56 A;  3NHN A;  3LWI A;  4ZTJ A;  2GQV A;  3QWY A;  3I9Q A;  1YWO A;  3O5Z A;  1B7T A;  2XID A;  2HSE B;  1PM3 A;  1ZSZ C;  2BUD A;  1Q81 C;  1N9S A;  1PSF A;  1OX9 A;  2L3P A;  4II1 A;  4PJO A;  1M4Z A;  3I56 Q;  3NMZ C;  1KQ1 A;  2C0I A;  4M7A D;  2JTE A;  1SSH A;  1PCX A;  1VYV A;  4F7U B;  2LJ1 A;  3VJP A;  1RAA B;  5KYU A;  1WHL A;  3AT1 B;  3A8M B;  4WTO B;  5LJ3 g;  4C92 B;  2FZG B;  1IHV A;  3OS5 A;  4FIB A;  1B07 A;  4XTV A;  1FWZ A;  2BKD N;  1OOT A;  5LJ3 j;  5D6Y A;  4OGC A;  1ZQ1 A;  5GAO q;  2RHI A;  1OU9 A;  1VQO A;  3BE3 A;  5AYF A;  2OJ2 A;  4LN2 A;  1VQO T;  5LJ5 d;  4M7D G;  4LD9 K;  1J3T A;  2RF0 A;  1OYX A;  3ER0 A;  1WHH A;  2HQX A;  1WQ7 A;  1I4K 1;  4EMK A;  4PFP A;  2LCS A;  3NPF A;  4RTZ A;  4LD6 A;  1QW1 A;  4YTL A;  2A0F B;  1WHM A;  3C95 A;  4LUD A;  2H3J A;  2PQW A;  4AFS C;  4OMM A;  1VQ4 A;  1PC0 A;  3JCM g;  3R6N A;  1VQ4 T;  1VQ9 A;  2YUQ A;  1HYO A;  3GNF B;  2EFI A;  1VQ9 T;  3PIP A;  2QTX A;  2EGA A;  2B86 A;  4J83 A;  3CC2 Q;  4OVA A;  3BW1 A;  2VWF A;  4HXJ A;  4BY6 B;  3HRS A;  2NWM A;  1MGQ A;  2V1R A;  1FYN A;  3OBW A;  4M75 F;  2YXY A;  2KE9 A;  3SFM A;  2YRD A;  3G6E Q;  1WI7 A;  4HCZ A;  3JB9 F;  2CYZ B;  3QUI A;  3RDV A;  1Y71 A;  2FPD A;  4QQ6 A;  3GP8 A;  5HY6 A;  1BI0 A;  2X4Y A;  1OEB A;  2KRM A;  5D7U A;  4E7L A;  1JRI A;  4QKU A;  2L8D A;  2M1H A;  2CUB A;  2Z0W A;  1KQ2 A;  3FJ5 A;  4A53 A;  4QVC A;  1NG2 A;  5HK3 A;  3G71 A;  1VQ5 A;  3I35 A;  4DQ2 A;  2KEA A;  2AZS A;  4E7I A;  1K76 A;  1O75 A;  2W0Z A;  3G71 T;  1VQ5 T;  1CKB A;  1PD0 A;  3M0S A;  4BAC A;  4DEX A;  2LP5 A;  1M90 R;  2FPE A;  3CMA Q;  2JOY A;  2GBQ A;  4BB7 A;  2L5Q A;  4BI3 A;  3RR6 A;  4ZTF A;  2HQH A;  2NUT A;  4BI4 A;  2CP2 A;  5D6W A;  3VYH B;  3QII A;  3CD6 Q;  5M9O A;  2RH2 A;  3JSC A;  1X75 C;  1PD1 A;  1TUG B;  1ZBX A;  3PMT A;  2R58 A;  1Q81 U;  2M16 A;  4M75 A;  2BZX A;  2AIR B;  2X9H A;  4QT7 A;  1OUL A;  3MJX A;  2DA9 A;  1G83 A;  1JBM A;  3OSS C;  3QPH A;  1G3T A;  2DO3 A;  2E4H A;  4M77 C;  3EG1 A;  1NLP C;  1BYM A;  5LJ5 g;  2CT3 A;  1W6X A;  4C5H A;  4XTU A;  1H3Z A;  5LJ5 j;  5KCH A;  2K7A A;  2F2X A;  3OW2 P;  1IRE B;  5GAO l;  4GBQ A;  1MMG A;  1X43 A;  5KYW A;  3IQL A;  5GAN 8;  5CKB A;  2BE9 B;  4OGE A;  1FMK A;  1Q82 R;  4IUU A;  4ELZ C;  1VQ6 A;  2DL7 A;  2NUP A;  2M51 A;  4PJN A;  3HPW A;  1GFC A;  1VQ6 T;  1H8K A;  2MWO A;  1VOM A;  1QQJ A;  3CME A;  2RQU A;  3CME T;  2D0N A;  2QDL A;  5GAM f;  1D0X A;  1PHT A;  3TSW A;  4M78 C;  4A4G A;  2KT8 A;  3JCM P;  2JW4 A;  2XHC A;  2QK0 A;  5GMK i;  9ATC B;  4LDW A;  2KNB B;  1NEG A;  3VYG A;  4R55 A;  1OZ2 A;  2JMA A;  1WLP B;  1UHC A;  3V7S A;  3OYN A;  3ZBD A;  4EIK A;  4M7A G;  2COY A;  3JB9 I;  3CCU A;  1WJQ A;  3CC4 Q;  3CCU T;  4NS5 A;  3HTR A;  2LT4 A;  4F7U A;  2W10 A;  3QG1 A;  2DVE A;  3CCS A;  3CQT A;  3OBY A;  1VQO Q;  5FU7 B;  3G4S A;  2AZV A;  3CCS T;  1VQK T;  1R0B G;  3TEE A;  3G4S T;  3QZ5 B;  1TUD A;  1MHN A;  3VU3 C;  3M9Q A;  3OYH A;  1SF9 A;  2OTL A;  3S3N A;  3L42 A;  5GAN 6;  3MKD A;  2OTL T;  2LCC A;  1N9R A;  1WYX A;  3OYJ A;  1BIA A;  2ZPB B;  2EYX A;  2XG8 D;  1ZHI A;  2RB6 A;  4C5E A;  1T0H A;  1KHI A;  2MPX C;  3SWN B;  1VQ4 Q;  3RMQ A;  4E2F B;  3EFS A;  2KYM A;  3PVL A;  1FX7 A;  2E65 A;  1BBZ A;  4V2S A;  3FDR A;  2RJF A;  3LYI A;  2EJ9 A;  1KD1 U;  4FM4 B;  5IN1 A;  1V76 A;  3JCM c;  1X6B A;  1X2K A;  3RUX A;  2E12 A;  3X20 B;  2L2P A;  4J9G A;  4X34 A;  1U06 A;  2KY9 A;  1M90 C;  4LDU A;  1ZSZ B;  2LMJ A;  1Y96 A;  1BI2 A;  2DXU A;  2JUF A;  2QA4 T;  1OQK A;  3JAM E;  3HKS A;  2KAF A;  3OA6 A;  4KGV B;  2X3X D;  4Z02 A;  3OS2 A;  4RG8 A;  5GAN 2;  2X4X A;  4PK4 A;  4EDU A;  3PT9 A;  1MMD A;  3C0C A;  4R56 A;  4IUV A;  4M77 E;  3C12 A;  3G71 Q;  1VQ5 Q;  2QEX A;  1ZUU A;  5CQX A;  1UEB A;  2QEX T;  1VQM A;  4FT4 A;  4RTY A;  1YWP A;  2AT1 B;  1VQM T;  3L2V A;  2IVW A;  2E70 A;  5CCA A;  1ZBJ A;  3UWN A;  3JCM f;  2RHZ A;  3ME9 A;  3O8V A;  1IHW A;  2XDB A;  5GAM d;  2MMP A;  2Y90 A;  2JM9 A;  3A8H B;  2AHJ B;  4ATO A;  2D0Q B;  4OMN A;  1Q82 C;  1AWX A;  4M7D C;  2JS2 A;  4DBF A;  1WDX A;  4JJD A;  4OP0 A;  5KYY B;  2KT1 A;  2LNV A;  3E9F A;  2V1Q A;  1QVG P;  1WPY A;  4M78 E;  4HVV A;  2CP6 A;  2ZAE A;  1OX8 A;  3V7C A;  1ZA1 B;  2CZ1 B;  3H0I A;  3GLX A;  3E19 A;  1LJO A;  1ZLM A;  3VS4 A;  2P4T A;  4QVZ A;  2EVR A;  2R5A A;  2RO0 A;  5CKF A;  4BUG A;  1X6O A;  4ZGJ B;  1PRL C;  2AKL A;  2DTO A;  2PVD B;  2XU8 A;  5FRN A;  1VQ6 Q;  3NTK A;  1RAE B;  3CME Q;  2IG0 A;  2EQJ A;  1ABQ A;  3QHS A;  1R0C B;  1A0N B;  3NTI A;  4PLI A;  3NGP A;  2YLC A;  4J9D A;  5GJW B;  2DTI A;  2C0T A;  1VQN A;  1G3W A;  2IPO B;  4ZGD B;  3CC2 T;  1VQN T;  4HVU A;  3I5R A;  3G7Z A;  1F1B B;  3GPL A;  1WJR A;  3HFN A;  4FYX B;  2IIM A;  4OB1 B;  4E7Z A;  4ZN1 A;  2HL3 A;  5AT1 B;  4J9H A;  2RQR A;  2BTT A;  3CCU Q;  1TG0 A;  2K5I A;  2RI2 A;  1EIF A;  2DJQ A;  2L0A A;  3VS2 A;  4F04 B;  1K9M U;  4RTT A;  4BE0 A;  3QXE B;  2ABL A;  1WXT A;  4RTV A;  5LJ3 h;  3CCS Q;  1YIT A;  3OYG A;  3G4S Q;  4IUQ A;  2NUZ A;  1YIT T;  1NZ9 A;  1QCN A;  2RHY A;  2ZPF B;  2OTL Q;  4E7K A;  5IAY A;  3OYC A;  2YUO A;  3DLM A;  4XTZ A;  4KUI A;  5DLO A;  1JXO A;  1B34 B;  1IZ6 A;  2Y4X A;  3JCM J;  5GAN j;  1EX4 A;  3RER A;  1YP5 A;  2KBT A;  4J8O A;  4M77 B;  2CP5 A;  2LCL A;  1D0Z A;  4KGZ B;  5IHK A;  2CDT A;  3EGX B;  3RIR A;  3M54 A;  2I2L A;  1HD3 A;  4MZP A;  1BK2 A;  1FXX A;  3THK A;  3SD4 A;  4C8Q F;  4TVR A;  1NM7 A;  3JCM h;  1XJW B;  2MF2 A;  1YI2 A;  4B6M A;  2R57 A;  1D3B B;  2WSE E;  1TUC A;  1YI2 T;  1LCK A;  4BD3 A;  2HAX A;  2VV5 A;  1QP3 A;  3EFO B;  3E9G A;  3KUF A;  1SEM A;  1QKW A;  1QVP A;  1G2B A;  3VS5 A;  2O2O A;  3CPW S;  1YFN A;  2DNU A;  3MO8 A;  1KHC A;  1KD1 R;  1I5L A;  1Q82 U;  3SWN C;  1RAD B;  2E41 A;  2YLB A;  4M78 B;  2V26 A;  3FLG A;  1KC8 U;  2ZGW A;  3QYH B;  1VQ7 A;  4M7D E;  3FB9 A;  1BCM A;  1VQ7 T;  4MZT A;  1WX6 A;  7AT1 B;  2DKG A;  2NLU A;  1MND A;  2RHX A;  1PG5 B;  1S1N A;  4B9W A;  4CC7 A;  2DE0 X;  1IO6 A;  3ZL7 C;  2DPP B;  2QEX Q;  4A4K A;  2OAW A;  1VQM Q;  5FU6 C;  4WCI A;  2D8H A;  3FIF A;  5IHN A;  2SRC A;  2HBP A;  3SDZ A;  1I0C A;  1YJW A;  1RAF B;  5A2Q E;  4C8Q A;  3CPW A;  2DYI A;  2K2M A;  1YJW T;  2FZC B;  4M7A C;  3D7S B;  2QTV A;  4DOW A;  3CCR A;  1U1S A;  4AFU C;  1P92 A;  2DVJ A;  1NPR A;  2E64 A;  4AG1 C;  3CCM A;  3CC7 A;  1M3B A;  1XQH A;  4Z88 A;  3CCR T;  2O4X A;  1D0Y A;  3CCM T;  1GL5 A;  3CC7 T;  1PWT A;  1RI9 A;  2K4Y A;  2EGE A;  3CCV A;  1X69 A;  4DOV A;  1M30 A;  4PJL A;  3JCM V;  3CCV T;  2EYY A;  3SEM A;  5D6X A;  4RTU A;  3CC4 A;  3CC4 T;  5KYY A;  1OZ3 A;  5IXB A;  4IIM A;  1BU1 A;  4Y91 A;  4HCC A;  5LJ5 h;  3QDR B;  2KK4 A;  4X9D A;  4ESR A;  3OYE A;  3M53 A;  2ZPG B;  1G3Y A;  3MPU B;  3J81 E;  4Y28 E;  1T0J A;  1JJ2 S;  2K9G A;  1ABO A;  1HXD A;  2K3Y A;  5EG2 A;  3I5S A;  3S3M A;  4CC4 B;  4LDY A;  2V8K A;  4PJO C;  2LQN A;  5GAN e;  5GAO m;  2RNA A;  2DBM A;  2EYQ A;  4C8Q D;  1GBQ A;  1SRL A;  2WAC A;  1N27 A;  1PSE A;  4KT0 E;  4ME7 A;  3OYI A;  3FJP A;  1M2O A;  2M02 A;  1OPL A;  4PJO D;  3OB9 A;  3MHX A;  1VQN Q;  2DEQ A;  3CXC S;  4D6W A;  1R8O B;  1XTD A;  1X27 A;  1VQP A;  4GLK A;  2VKN A;  1AD5 A;  5IH2 A;  1VQP T;  1LNX A;  2A3L A;  2DIL A;  4KBM B;  2FPF A;  2KQW A;  2X4J A;  1JJ2 A;  4JZ4 A;  2A37 A;  1EZZ B;  1E7O A;  4OB2 B;  1AVZ C;  1YIT Q;  1LPL A;  4A4F A;  1EFN A;  2VGM A;  4BE2 A;  3VUZ A;  2KI7 A;  2KRS A;  4M7D B;  1H3H A;  3CXC A;  3RES A;  1K9M R;  3EH2 A;  2ED0 A;  1I8F A;  3PVQ A;  2JZ2 A;  2DLP A;  2RI5 A;  3FEO A;  2RQW A;  3BY7 A;  1KD1 C;  4B9X A;  4FYV B;  1M1K C;  4M77 A;  2Y4Y A;  3EGX A;  1ARK A;  1YI2 Q;  4JJN K;  3VRZ A;  3M58 A;  2JTM A;  4P5N A;  2DYB A;  3M0P A;  2ENM A;  6AT1 B;  3OMG A;  2RJE A;  4E6R A;  1M2V B;  2FYK A;  2QG9 B;  2ZPH B;  4KH0 B;  4M7A E;  1Y07 A;  2F2V A;  2ZPE B;  2HL5 C;  3EFO A;  4RMO A;  1NPP A;  3QJY A;  1RL2 A;  5KYX A;  4F7U F;  1N5Z A;  1QKX A;  2X35 A;  1I81 A;  1D1C A;  2D6F A;  1KSW A;  2L89 A;  4LDX A;  4PJJ A;  4C5G A;  1RI0 A;  1VQ7 Q;  4C92 F;  3MEA A;  5GAN 5;  2H8H A;  1SKU B;  1WNL A;  1FMV A;  4M78 A;  2HCK A;  2RJC A;  2DD4 A;  2WSC E;  2KVQ G;  3VS6 A;  1IB8 A;  4ZNX A;  3X28 B;  2O01 E;  1AZE A;  3QKJ A;  4M4Z A;  2KXC A;  4C0D C;  3CCL A;  5GAN f;  1KC8 R;  1JU5 C;  3CCL T;  2EW3 A;  1IGU A;  1GCQ C;  2CRE A;  1XNI A;  1YJW Q;  2JXB A;  5GAO n;  2KMT A;  4E7J A;  2HQE A;  4GLM A;  1W4S A;  5CIU A;  2RK2 A;  4PNO A;  4M75 C;  1KQS S;  3M4G A;  3U23 A;  1SSF A;  3CCR Q;  2LX9 A;  2QGF B;  3CCM Q;  2EWN A;  3CC7 Q;  5FWB A;  2EQI A;  3DKM A;  4IIO A;  4PJO E;  1YNZ A;  2PVO B;  3OYM A;  4M75 D;  3C94 A;  1H92 A;  1DJ7 B;  3CCV Q;  2F5T X;  1TXQ A;  5L8R E;  3EG0 A;  1YCY A;  4J9C A;  2JVV A;  5CAI A;  3JB9 D;  1U5S A;  2RD1 A;  3DB4 A;  5DM7 R;  1I5O B;  5DLQ E;  3UA7 A;  1K0S A;  4JUV A;  1M1K R;  4C92 A;  5DY9 A;  5I2S A;  2JM8 A;  1OPK A;  4JRQ A;  2FHD A;  2QGG A;  1KQS A;  1AWW A;  2QAZ A;  1W70 A;  2QAS A;  4XQ3 A;  3URG A;  3KXT A;  1RAI B;  3UA6 A;  4BDY A;  2QQ9 A;  3LH5 A;  4J9I A;  1WHK A;  3QJ6 A;  1WZO A;  2DX1 A;  5CVI A;  4BI8 B;  2F5K A;  5C0M A;  1M3A A;  1VUB A;  2GFA A;  1RAC B;  2HZY A;  1K8A C;  2LDM A;  2JTF A;  2GGR A;  1N8R C;  2A36 A;  3SB2 A;  3G1J A;  2KYB A;  4C8Q G;  3J7A F;  1M1K U;  1ZUK A;  2OTJ A;  1VQP Q;  2OTJ T;  4PJO G;  3WVE B;  5FU6 B;  1UGQ B;  2E10 A;  5KH6 A;  1TH7 A;  1K9M C;  4AFQ C;  5GJV B;  1QCF A;  3QSU A;  4X1V A;  2DZ9 A;  3H6Z A;  3BFM A;  5IXF A;  4DBQ A;  2EQK A;  3GF5 A;  2OAU A;  4M7A B;  2XI9 A;  5GMK h;  2G6F X;  2L3R A;  4LE9 A;  1C0M A;  3N5B B;  1GXI E;  3EGU A;  2P0Q A;  3MEV A;  1NYG A;  2QQB A;  5I22 A;  5A0G A;  3EG2 A;  4RG2 A;  1YJ9 A;  2C06 A;  1YJ9 T;  4RUG A;  2F69 A;  3OYA A;  5J3B A;  4QVD A;  1UG1 A;  3TSZ A;  2LJ0 A;  3ZEH A;  2HBW A;  4M7D A;  2YSQ A;  5GAN d;  1I1J A;  2EIF A;  1TSF A;  2DMO A;  2EKH A;  2K2V A;  4FCY A;  5GAM h;  1RUW A;  3HL8 A;  1X6G A;  2P0P A;  1Y7X A;  1G5V A;  2BE7 D;  2CP0 A;  3S3O A;  1JEG A;  3MP8 A;  1Z9Q A;  3C4S A;  2CS7 A;  5J26 A;  1M1G A;  1M1F A;  3GOX A;  4PJO B;  1B3Q A;  3JRZ A;  4PFO A;  1K9A A;  4M75 E;  1KC8 C;  4AT1 B;  3E1S A;  3M5A A;  2VXE A;  1YCS B;  5CK9 A;  4Q5W A;  5A0L A;  4BE1 A;  1U1T A;  1K1Z A;  2M0Y A;  2XK0 A;  4JRI A;  3VS3 A;  2V8I A;  4ZN3 A;  1Q86 C;  3HSB A;  3L2W A;  3Q1J A;  3RMS A;  2MCN A;  3JB9 J;  3EGD B;  3TU4 K;  4FSS A;  2GF7 A;  1Y57 A;  3EH1 A;  1U3O A;  2ROL A;  3CCL Q;  1IGQ A;  3NTH A;  3LGL A;  2HMA A;  2HEQ A;  1W2B S;  3CCE A;  4XAX B;  1RAB B;  5LL6 S;  3EHR A;  3CCE T;  5IHI A;  3OY9 A;  2HNI A;  1S72 A;  3VS0 A;  1WHG A;  4NL3 A;  3VS1 A;  4OB3 B;  1K8A U;  1Y0M A;  4A4E A;  5GAN 4;  1N8R U;  1NE8 A;  2A08 A;  4R0K A;  4KGX B;  3V8L A;  5I21 A;  3EHQ A;  1K73 U;  3EFR A;  3QZ9 B;  1E6H A;  2HKQ B;  5CR2 A;  4M75 G;  1UGS B;  3VUB A;  1TWB A;  3M59 A;  1YJN A;  1BKB A;  2BZ8 A;  2ESW A;  4A63 B;  1CKA A;  2EYZ A;  1YJN T;  2XDP A;  2ZCF B;  3JB9 G;  1M27 C;  2QQS A;  2J7I A;  2GTO A;  4J5Y A;  1W2B A;  2FZK B;  1QWE A;  1QVF S;  3OSV A;  1V29 B;  2RMO A;  1YN8 A;  5GAN g;  1SPK A;  3X24 B;  1AEY A;  3TCJ A;  3GBQ A;  2FO0 A;  2XD0 A;  2CP3 A;  3J80 E;  4F16 A;  2OX7 A;  3CPF A;  2MOX A;  2F2W A;  2PUK B;  3HP9 A;  4HCK A;  2LVM A;  3M0T A;  3SWN A;  2DJZ A;  2H3E B;  2WSF E;  5FW9 A;  2GFU A;  2EBP A;  2YHT A;  4PLL A;  1ZUY A;  1BB9 A;  1ZSG A;  2DM1 A;  3HRT A;  5GAO r;  1NJI C;  2OTJ Q;  5HK0 A;  2M0O A;  4FYW B;  4JRK A;  3QO3 A;  2NUT B;  4IUP A;  1OV3 A;  4MML A;  4C0D B;  2DET A;  2MWP A;  2JT4 A;  1QVF A;  1WQW A;  5J39 A;  3PE0 A;  3WXM B;  2B8A A;  1WFW A;  3X25 B;  2CKK A;  1UTI A;  1JB0 E;  1NLO C;  1KIK A;  2KDS A;  1HK9 A;  4VUB A;  1UGR B;  2VVK A;  4M75 B;  3CBO A;  2CH4 W; 
#chains in the Genus database with same CATH homology
 3I56 T;  1H64 1;  2KQW A;  1X01 A;  3KBG A;  3OYN A;  2X4J A;  1JJ2 A;  4J6Y A;  3ZBD A;  4M7A G;  3JB9 I;  3CCU A;  2XKO C;  1WJQ A;  2LTO A;  2VC8 A;  4PL6 A;  4F7U G;  3OYL A;  4L5G A;  3CCU T;  3MCA B;  4OB2 B;  4NS5 A;  4F7U A;  2LT4 A;  4A4F A;  3R6O A;  3QG1 A;  2VGM A;  4BE2 A;  2DVE A;  3CCS A;  4C0G A;  4C0F A;  1Q86 U;  3OBY A;  1O9S A;  3LGF A;  4N0A C;  5FU7 B;  3RKW A;  3VUZ A;  3OYD A;  4L6V 5;  3L2Z A;  3G4S A;  3CCS T;  1VQK T;  4MZM A;  3TEE A;  3G4S T;  4M7D B;  2XIC A;  3QZ5 B;  3CXC A;  1MHN A;  3RES A;  3M9Q A;  3VU3 C;  3S6W A;  3OYH A;  2OTL A;  3S3N A;  3H8Z A;  3L42 A;  5GAN 6;  2OTL T;  4EMK B;  2LCC A;  3HHT B;  1N9R A;  2ZPI B;  5KE3 A;  3OYJ A;  1BIA A;  1I8F A;  2ZPB B;  2MI6 A;  1VIF A;  2XG8 D;  1ZHI A;  2JZ2 A;  3F70 A;  2RB6 A;  2RI5 A;  3FEO A;  4QW2 A;  4C5E A;  2VGN A;  1YHQ A;  1KHI A;  3BY7 A;  4M77 G;  5CKH A;  3SWN B;  1KD1 C;  4B9X A;  3OYF A;  1YHQ T;  1QVG A;  1M1K C;  4M77 A;  3RMQ A;  2PVG B;  2Y4Y A;  3TRE A;  3EFS A;  4QQD A;  1S72 T;  2K3X A;  3MET A;  1UB4 A;  2QQA A;  4HT8 A;  4JJN K;  2EQU A;  2EJF A;  1FX7 A;  2E65 A;  3M58 A;  4V2S A;  2RM4 A;  2JTM A;  4P5N A;  3OMC A;  3FDR A;  4N4G A;  5CKD A;  3OYB A;  2RJF A;  3A8L B;  3LYI A;  2EJ9 A;  1KD1 U;  3ASK A;  3OMG A;  2MAM A;  3OYY A;  3PGG A;  3CC2 A;  2RJE A;  4FM4 B;  4XTW A;  5IN1 A;  3JCM c;  2QQR A;  2FYK A;  3UDC A;  2PUO B;  2ZPH B;  3RUX A;  4XK8 E;  4IUT A;  4M7A E;  2E12 A;  1Y07 A;  4IKF A;  1M8V A;  4F7U E;  2ZPE B;  3X20 B;  4RMO A;  2DZC A;  1NPP A;  3V7R A;  4N4I A;  4XU0 A;  3PMI A;  3QJY A;  1RL2 A;  4M7A F;  4JLG A;  4X34 A;  3DB3 A;  1WJS A;  4F7U F;  5KCO A;  2DIG A;  2X35 A;  4C92 E;  3P8B B;  2KY9 A;  3UT1 A;  1I81 A;  2VXF A;  1M90 C;  4LDU A;  5IT9 E;  2BIV A;  2D6F A;  2L89 A;  4LDX A;  3G6E A;  3PIO A;  1Y96 A;  1BI2 A;  2DXU A;  2A7Y A;  1RI0 A;  2K5L A;  3GNG A;  3MEA A;  4C5G A;  2JUF A;  4C92 F;  5GAN 5;  3G6E T;  2QA4 T;  5GMK j;  2G3R A;  2XDD A;  4M78 G;  3JAM E;  4FT2 A;  1VIE A;  1WNL A;  3HKS A;  5GAN 3;  4M78 A;  4C8Q C;  2KAF A;  2RJC A;  3VKI A;  3OA6 A;  2DD4 A;  3JCM Q;  3LH0 A;  2QDY B;  2EQM A;  4Z02 A;  2WSC E;  3OQ5 A;  3T9N A;  3OS2 A;  4RG8 A;  5GAN 2;  2KVQ G;  2VUB A;  2X4X A;  4EDU A;  3PT9 A;  5LJ5 f;  5LJ3 d;  1M90 U;  3CEY A;  3X28 B;  2O01 E;  5GMK e;  3HFO A;  3QKJ A;  4IUV A;  4R56 A;  4M77 E;  4C0D C;  2FL7 A;  2LC4 A;  1BI3 A;  3C12 A;  4NL2 A;  5GAN f;  3CCL A;  2QEX A;  3CCL T;  2E5Q A;  4M77 F;  5GMK l;  5CQX A;  1UEB A;  1XNI A;  2ZZD A;  2QEX T;  3V8K A;  1VQM A;  4FT4 A;  5GAO n;  2KMT A;  4E7J A;  2YRV A;  3NFC A;  4WF2 A;  3JCM X;  4RKU E;  3UPU A;  2HQE A;  1VQM T;  1W4S A;  3L2R A;  3L2V A;  5CIU A;  4O6J A;  2RK2 A;  4PNO A;  4M75 C;  1KQS S;  2IVW A;  3M4G A;  2CZ6 B;  2E70 A;  2K57 A;  3V8J A;  5CCA A;  1KG1 A;  5GAM g;  3CMA A;  2RHU A;  1SSF A;  3UWN A;  3JCM f;  3WVD B;  5GMK m;  3JCM W;  2LX9 A;  4N0A A;  2RHZ A;  1XOV A;  2EWN A;  3CMA T;  4XTX A;  3ME9 A;  3O8V A;  3DKM A;  2RI3 A;  5GAM j;  4PJO E;  1WGS A;  2XDB A;  4XTY A;  5GAM d;  2DXC A;  4BDZ A;  2PVO B;  3OYM A;  4DA4 A;  4M75 D;  2LRQ A;  2MMP A;  2Y90 A;  3C94 A;  1NJI U;  1DJ7 B;  3JCM d;  3P8H A;  3BDU A;  2F5T X;  4PJO F;  5L8R E;  3A8H B;  3OYK A;  2AHJ B;  3OS0 A;  4ATO A;  4EMG A;  1YCY A;  3LLR A;  5CQY A;  5FU7 C;  3CD6 A;  2D0Q B;  2JVV A;  4OMF B;  1Q82 C;  5GAM e;  5CAI A;  1Q7Y C;  3JB9 D;  2RD1 A;  3DB4 A;  5DM7 R;  3CD6 T;  4M7D C;  2EKO A;  2DK3 A;  4M7A A;  1G3S A;  4OP0 A;  2LNV A;  5FRM A;  5DLQ E;  3E9F A;  4EMK C;  4CI0 C;  2R5M A;  1WPY A;  4M78 E;  4PKC C;  4JUV A;  4GY5 A;  1BI1 A;  3V7C A;  4NOY A;  4C92 G;  5FRO A;  1U8R A;  4KUD K;  1Y96 B;  4HKE A;  4C92 A;  2X4W A;  2CZ1 B;  2M9U A;  4FU6 A;  4M78 F;  5DY9 A;  5I2S A;  4JRQ A;  3GLX A;  3E19 A;  1LJO A;  1UGP B;  2FHD A;  1Q7Y U;  3GIB A;  1KQS A;  4M7D D;  3FRN A;  2P4T A;  4QVZ A;  5CKF A;  2R5A A;  2RO0 A;  4JDS A;  4BUG A;  4C5I A;  4HT9 A;  4XU1 A;  4X9C A;  3M4Y A;  3A8G B;  1X6O A;  4ZGJ B;  4XQ3 A;  3URG A;  3KXT A;  2DTO A;  1QP2 A;  3LWH A;  4JS4 A;  2KSS A;  1B34 A;  2PVD B;  4QQG A;  4BDY A;  2QQ9 A;  2XU8 A;  5GAN 7;  3QJ6 A;  5FRN A;  2GCX A;  5CVI A;  2EJG A;  4BI8 B;  4RCB A;  2F5K A;  5C0M A;  1VUB A;  2E1H A;  2GFA A;  4UC4 A;  2JN0 A;  1K8A C;  3NTK A;  3I55 A;  2LDM A;  2V8J A;  2JTF A;  1N8R C;  3MP1 A;  3I55 T;  2IG0 A;  2EQJ A;  3M56 A;  3EAE A;  3SB2 A;  3LWI A;  4ZTJ A;  3QHS A;  4C8Q G;  2GQV A;  4OF1 A;  3RKX A;  3NTI A;  4PLI A;  3J7A F;  1M1K U;  2YLC A;  1D3B A;  2OTJ A;  2DTI A;  2LT1 A;  2XID A;  1VQN A;  2BUD A;  1G3W A;  4ZGD B;  3CC2 T;  2OTJ T;  1Q81 C;  1N9S A;  4PJO G;  3WVE B;  1PSF A;  2E6Z A;  1UGQ B;  2E10 A;  5FU6 B;  5KH6 A;  1VQN T;  1TH7 A;  4II1 A;  1K9M C;  4PJO A;  3G7Z A;  3CCJ A;  3GPL A;  1WJR A;  3HFN A;  1VQL A;  3QSU A;  1M4Z A;  2DXB A;  3LX7 A;  2DZ9 A;  1KQ1 A;  3CCJ T;  3QYG B;  4OB1 B;  1VQL T;  4ZN1 A;  3H6Z A;  4M7A D;  3L2U A;  4HCB A;  3BFM A;  3QBY A;  2EQK A;  3GF5 A;  2OAU A;  4M7A B;  4A4H A;  4E7H A;  2XI9 A;  3PNW C;  4F7U B;  2K5I A;  5GMK h;  3VJP A;  2RI2 A;  3L2Q A;  1EIF A;  2VYT A;  2L3R A;  3N5B B;  1K9M U;  1GXI E;  2P0Q A;  2RJD A;  3MEV A;  3A8M B;  3QXE B;  4BE0 A;  5LJ3 g;  4C92 B;  4CRI A;  2QQB A;  3OS5 A;  5LJ3 h;  5A0G A;  4FIB A;  4RG2 A;  4XTV A;  3OW2 S;  1YIT A;  4MDX A;  1FWZ A;  2BKD N;  3OYG A;  1YJ9 A;  3P8D A;  2DXT A;  2PU9 B;  5LJ3 j;  4EMH A;  4IUQ A;  1YIT T;  2C06 A;  5D6Y A;  4OGC A;  1YJ9 T;  1NZ9 A;  1ZQ1 A;  5GAO q;  2RHY A;  2RHI A;  2F69 A;  2ZPF B;  4E7K A;  2HD0 A;  5IAY A;  4JRP A;  1VQO A;  3OYC A;  5AYF A;  3DLM A;  3OYA A;  4XTZ A;  4KUI A;  5J3B A;  1VQO T;  5DLO A;  5LJ5 d;  5KE2 A;  4M7D G;  4QVD A;  4LD9 K;  5LJ3 e;  1B34 B;  1IZ6 A;  1OYX A;  2Y4X A;  4M77 D;  3ZEH A;  3JCM J;  3ER0 A;  5GAN j;  4M7D A;  5GAN d;  3RER A;  2HQX A;  4FL6 A;  2EIF A;  4J8O A;  4M77 B;  1WQ7 A;  1I4K 1;  4EMK A;  4O5V A;  4IUR A;  2LCL A;  4XU2 A;  4A54 A;  4C8Q E;  2K2V A;  4LD6 A;  3RIR A;  3M54 A;  1QW1 A;  2I2L A;  4MZP A;  4YTL A;  3C95 A;  2H3J A;  1FXX A;  2PQW A;  2CGH A;  1VQ4 A;  3SD4 A;  4C8Q F;  5I2M A;  5GAM h;  3HL8 A;  4TVR A;  3JCM g;  3L1A A;  4N4H A;  3RKY A;  2P0P A;  1Y7X A;  1VQ4 T;  4OB0 B;  3JCM h;  1VQ9 A;  1G5V A;  2MF2 A;  4E47 A;  1YI2 A;  3S3O A;  4XU3 A;  3GNF B;  3MP8 A;  2EFI A;  2R57 A;  1VQ9 T;  1D3B B;  2WSE E;  3PIP A;  3C4S A;  3MP6 A;  2QTX A;  1YI2 T;  4BD3 A;  2CS7 A;  4J83 A;  3OW2 A;  2HAX A;  2VV5 A;  5J26 A;  1M1G A;  1QP3 A;  4OVA A;  1M1F A;  3BW1 A;  3GOX A;  4PJO B;  3FC3 A;  2FVU A;  3JRZ A;  4BY6 B;  3HRS A;  4JLI A;  1MGQ A;  3JCM e;  4M75 E;  4L59 A;  1KC8 C;  3E1S A;  1LOJ A;  3M5A A;  3E9G A;  3KUF A;  2VXE A;  1QVP A;  5CK9 A;  3OBW A;  4M75 F;  4Q5W A;  3CPW S;  5A0L A;  4BE1 A;  1U1T A;  3A5Z B;  3MO8 A;  1KHC A;  3SFM A;  1I5L A;  2XK0 A;  4JRI A;  1YBY A;  4M78 D;  3SWN C;  1Q82 U;  2V8I A;  4ZN3 A;  1Q86 C;  4HCZ A;  2E41 A;  3HSB A;  3L2W A;  3JB9 F;  2CYZ B;  2YLB A;  3CBP A;  4M78 B;  3FLG A;  3QUI A;  1KC8 U;  3Q1J A;  1VQ8 A;  3RMS A;  1Y71 A;  4QQ6 A;  2ZGW A;  3JB9 H;  3GP8 A;  1VQ8 T;  5HY6 A;  2D9T A;  3ZFJ A;  3QYH B;  1VQ7 A;  3JB9 J;  1BI0 A;  2X4Y A;  3TU4 K;  4E7L A;  4M7D E;  3FB9 A;  3X26 B;  1VQ7 T;  2GF7 A;  4MZT A;  4FSX A;  2DKG A;  1JRI A;  1OI1 A;  2NLU A;  3MEW A;  2L8D A;  2M1H A;  2RHX A;  3PTA A;  4B9W A;  1VQK A;  4M7D F;  1KQ2 A;  2DPP B;  3INZ A;  1N6A A;  4A4K A;  2RK1 A;  3NTH A;  3LW5 E;  3LGL A;  4A53 A;  4ELY C;  5FU6 C;  4QVC A;  5HK3 A;  3FIF A;  3G71 A;  1VQ5 A;  4DQ2 A;  4E7I A;  2HBP A;  3SDZ A;  1W2B S;  1O75 A;  3G71 T;  1VQ5 T;  3CCE A;  4XAX B;  1YJW A;  5CO7 A;  4BAC A;  5A2Q E;  2DD5 A;  5LL6 S;  4C8Q A;  3CPW A;  3CCE T;  3OY9 A;  1YJW T;  3M55 A;  2HNI A;  3PFS A;  1S72 A;  3MEU A;  1K73 C;  2JOY A;  1AHJ B;  4BB7 A;  4M7A C;  3CBM A;  2L5Q A;  4BI3 A;  5A0D A;  4NL3 A;  3A8O B;  4OB3 B;  4DOW A;  4ZTF A;  1K8A U;  5CKE A;  2LQK A;  4A4E A;  5GAN 4;  4BI4 A;  3CCR A;  1U1S A;  1NE8 A;  1N8R U;  1P92 A;  2E64 A;  1NPR A;  3VV0 A;  3CCM A;  3CC7 A;  4MDW A;  4J7I A;  1XQH A;  5D6W A;  3V8L A;  2O4X A;  4C92 C;  3CCR T;  3VYH B;  3CCM T;  2JNG A;  3CC7 T;  3QII A;  3CCQ A;  5I21 A;  2LQ8 A;  1K73 U;  5M9O A;  2K4Y A;  3EFR A;  2RH2 A;  3QZ9 B;  1X75 C;  3JSC A;  2CZ7 B;  4DOV A;  2QXF A;  5CR2 A;  3CCQ T;  2RA2 A;  4RCC A;  3CCV A;  4M75 G;  1ZBX A;  5FLX E;  3PMT A;  2R58 A;  3JCM V;  2M16 A;  3CCV T;  1Q81 U;  1UGS B;  3VUB A;  3AHU A;  4M75 A;  4C92 D;  3BDL A;  5D6X A;  3M59 A;  1YJN A;  1BKB A;  2FB7 A;  1YIJ A;  3CC4 A;  1YJN T;  2XDP A;  2ZCF B;  3JB9 G;  4JS5 A;  2QQS A;  1JBM A;  4J5Y A;  3CC4 T;  1YIJ T;  3OSS C;  3QPH A;  1G3T A;  3JCM b;  2DO3 A;  4MMK A;  5C6S A;  1W2B A;  1OZ3 A;  4M77 C;  1BYM A;  2K5F A;  4Y91 A;  5LJ5 g;  1QVF S;  4HCC A;  5GAO p;  3OSV A;  5LJ5 h;  3QDR B;  2KK4 A;  1V29 B;  4X9D A;  4C5H A;  3M53 A;  4XTU A;  3OYE A;  4J7F A;  5GAN g;  2QA4 A;  4ZGE B;  1H3Z A;  5LJ5 j;  5KCH A;  2ZPG B;  5GAN h;  1G3Y A;  1IRE B;  5GAO l;  3X24 B;  5LJ3 f;  2P0K A;  4C0Z A;  5GAN 8;  5CKB A;  2CZ0 B;  3TCJ A;  3J81 E;  2XD0 A;  2DAQ A;  4Y28 E;  4OGE A;  4LDV A;  5LJ5 e;  4KUL A;  3J80 E;  1JJ2 S;  1HXD A;  2K3Y A;  3CPF A;  5EG2 A;  3S3M A;  4IUU A;  4LDY A;  2QI2 A;  2PUK B;  3HP9 A;  2V8K A;  4ELZ C;  4PJO C;  1VQ6 A;  5GAN e;  5GAO m;  2LVM A;  4BY6 C;  2EYQ A;  3HPW A;  4C8Q D;  2WAC A;  3SWN A;  1N27 A;  1PSE A;  2DJZ A;  2WSF E;  4EPC A;  4KT0 E;  4ME7 A;  1VQ6 T;  2E6N A;  2GFU A;  4C8Q B;  2YHT A;  3HRU A;  2MWO A;  4PLL A;  4J6W A;  3OYI A;  3CME A;  3FJP A;  2EAY A;  3OS1 A;  3HRT A;  3CME T;  5GAO r;  1NJI C;  5HKC A;  4PJO D;  1BIB A;  3MHX A;  3OB9 A;  2M0O A;  5HK0 A;  4JRK A;  2DEQ A;  3QO3 A;  3CXC S;  4IUP A;  4J6X A;  4MML A;  4C0D B;  4D6W A;  1R8O B;  5GAM f;  2MWP A;  3M57 A;  1QVF A;  1XTD A;  1WQW A;  4M78 C;  5J39 A;  2O4X B;  4A4G A;  1VQP A;  4GLK A;  3JCM P;  2XHC A;  3WXM B;  2B8A A;  2DTH A;  5GMK i;  3X25 B;  4LDW A;  1LNX A;  2CKK A;  1VQP T;  1M5Q 1;  3DLL A;  3VYG A;  4R55 A;  1JB0 E;  1OZ2 A;  2DIQ A;  2KDS A;  2A3L A;  1HK9 A;  4VUB A;  1UGR B;  1M9S A;  3I56 A;  4KBM B;  4HA8 A;  1QVG S;  4M75 B;  3CBO A;  3V7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...