3C12A

Crystal structure of flgd from xanthomonas campestris: insights into the hook capping essential for flagellar assembly
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
138
structure length
138
Chain Sequence
b'DQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAATSAGFVNFEITDANGTFVKQLSVPASAAGEVSFAWDGTDANGNRMAAGKYGITATQTDTAGAKSKLATYVDAPVDSVTIGSDGLYLNLTGLGTSPLANVLRVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein
publication title Crystal structure of the C-terminal domain of a flagellar hook-capping protein from Xanthomonas campestris
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Biosynthetic protein
total genus 24
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
A PF13861 FLgD_tudor FlgD Tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.910 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3c12A01
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3c12A02
4ZZKA 5K5YA 4ZZFA 3C12A 3OSVA
chains in the Genus database with same CATH superfamily
4M6OL 4TUKL 1T1YA 2NT1A 3FW6A 4OSUL 1K73R 2GITA 4OZHB 4ABVA 5E1IA 4XNYH 5JXAH 4NQCA 2DWYA 3BW9B 4AQ8A 5EZLA 2QGBA 3GSWA 2Y7OA 4XU0A 3I56A 3WIIH 1FWZA 5JR1L 2AV7B 1CICD 1R33A 3KDPB 4AVIA 2ZCZA 2JI2A 3PAUA 1S7QB 2NY1C 3B9KD 3BUTA 2I7OA 1I9JH 1LEIA 3C94A 3RWFA 2NYYD 1K9MR 2YA1A 1VQ7T 3QJQB 3OBAA 4ACTA 4O00A 3M1BB 2R8SL 3DXAD 2FPFA 4KI5E 32C2A 3WIHH 4PJHA 1TOVA 2Y36H 3JV0A 2CO6B 3U6RB 5FROA 1GCFA 3EJZC 1M9SA 2W91A 3PS6A 5IW1A 1HEZA 2DTHA 2DV6A 4EN2A 3CMEA 1DQTA 1Q9LA 1ROCA 4EZJA 3HR5B 5DSCB 4EI0A 2P5WE 5TQ0L 2FIKA 4G8IB 3U7WL 3V6ZA 4Y4HD 2Z65C 5DS2A 5B7EA 2ZWLT 1DJ7B 3B7YA 3IFNL 3EG9A 1OTSD 1IM3B 5GS0H 1H8NA 1I9RH 3C5ZD 2EH8L 3F7QA 1U0QA 3LEYL 3PAYA 5GANf 3ESNA 4OZGE 3WKYA 3FFCA 3TZVD 1VKXA 1IZKA 3NOIA 3VXRE 4JHVA 1EZZB 2MI6A 1VCBC 2Y4SA 3D18B 1DQIA 4YSTA 3UCQA 2EXYC 2VE6A 3HB3B 3L7EA 4K07A 5DRXA 5I0WA 1NEPA 5GGQH 1NUDA 1VQPT 1C16B 3EOYG 2X05A 4A7SA 2XDBA 3CC5A 3QJFA 2PCPB 4TULH 4WK0B 4NQTA 4JVUA 5CZXD 4PJOF 5ALBH 2W95A 2IOOA 3IN2A 4S10A 3Q8AA 4RGNE 2HVKB 2XKSA 3FU5A 5LGYA 1LE9B 2JIXD 1OI1A 3PWUA 5DMGD 1FNSH 3BVWA 4UAHA 4X4MA 1OANA 1D09B 1KXTB 1X44A 2AJZA 2E59A 4P2AA 1F86A 2V2TA 4PLLA 3JT0A 4LBEB 3TIDA 3UTSB 5KWYC 3FCTB 3RKYA 4NQVA 3S36L 3MLTA 2H5UA 3WIHA 1WFJA 1AY1H 1YDPB 2Q9OA 3BZEB 2EAYA 5B4MD 1A7BA 1PLGL 2WWKO 2VO8A 5F7YC 1EFXB 4ZSOE 1MCFA 4R7VA 2VDNH 1A7OH 5EZPA 3EFRA 1W16A 4KZCA 2E64A 3S2AA 4FT2A 1C1EL 3F85A 4HJEA 8ATCB 1FVDA 5T5FL 1UXWA 3MUUA 4KTDH 3JRZA 1JI2A 2BP8B 2CLRB 3DLQR 4R3SA 3VCLB 3FT4A 4WKZB 1EK3A 4Z7QE 3ARFC 5GSVA 5I8EB 1BSIA 1GGIL 3TBWB 1SMAA 2C8NA 5AOIA 4RMTA 4DPCX 1D7BA 2HRHA 4HS3B 1R5VA 2HBWA 4PRHA 1JZ8A 4N1HB 4YSDA 4ZS6D 3G5YA 5DJYA 3OB9A 5ACZA 1I8LA 2R23B 2OMBA 3PRZA 1I5OB 3QIUD 4PJXA 3L1GA 3EG1A 4PJ8D 2NT0A 5IHUH 1AGEB 3NCFB 3TEZA 1G5VA 5IREA 2OYKA 3QDJD 3K5SA 1ZHLA 2CALA 4LLQA 3MV8D 3FJPA 1U91A 4Y2OA 5MERB 3CSTA 3VFGL 5JYLA 3WY1A 4F33B 1FXXA 2F1AA 3K0YA 4X9DA 3F84A 2BM3A 3EFDL 4OM0L 5KUKA 4ZS7H 3TPKA 5TF0A 1X5XA 3MRQB 3T71A 2QELA 3TA3D 1JNHB 1AD5A 1VQOQ 1SY6H 3H42L 1N26A 5KUMA 3ME9A 2OK0H 1LO2H 4Y2DB 3LGFA 4YHLH 3P8DA 2XVLA 4PR5B 3IGAA 5C0GB 1D2OA 3NTCL 2VDRB 3BP6A 2XETA 4RWYH 4JPQA 1SOQA 1XF5B 4DTGH 4XTUA 3EFFB 3LEVH 4KPHH 1SJMA 3SWNA 2F1BA 4EE2A 5J6GB 5E00B 3FRPB 4L8CB 5E1AA 5CJ8A 4M4PA 4WENB 1OP5H 5B8CC 4D9LH 3SKOA 1T66C 3DBSA 4XXDA 1AG0A 4GYBA 4QHKI 2FJUB 2V5YA 2RHYA 4YH6A 2LTQB 4I9XA 2ZUQB 3TBBA 3G5XB 1LMIA 2YPKB 2OAWA 4R56A 3RVWC 1R3HA 3FTVA 3A98A 3ALWA 1EZVY 5BS0E 2K6WA 4UQEA 4X9IA 5I1KH 2EJ1A 1RUAL 3OYEA 3FCGA 4M7DA 3E6FA 1EWHA 3A6BH 4I3GA 2MIOA 5E4OA 3ZE2B 2GCYB 3ZTNL 5B39B 1OU9A 1BMZA 1CR9L 3TO2A 3QQXA 4NNYA 3KHOA 1SEQL 5AG8A 5F1IA 4F15B 5EOTA 4UM9A 4PLKD 5JW4N 1D1AA 3JVGA 3F7YB 4YHYB 4JRIA 4D8KA 1AYOA 1AVAA 1ZHBA 2NX5E 3MX0A 3P73B 4PJFF 4U0RC 4DKDC 1BIIB 1Q9WA 3W38A 2VLLA 2BOCA 5CHNB 4DP7X 1HSAB 4M62H 1E42A 2D7TL 5MEPB 1NFIA 1Z66A 4MNQB 4ELZC 4MA8H 1JZ5A 2EINB 3TBSA 3B9KA 2COZA 5D1QE 2WKOA 3V4PL 1FNLA 5GMKl 2CUAA 2F53B 1A7RH 3K71B 1B34A 2PPEA 2E70A 4QRBA 5JW3H 3D2UB 2ZCKH 2O4EA 3DXAA 1YA5A 2C7FA 4NQDE 2D3VA 2K3TA 4R2GD 3W11C 3QWRD 4UQBA 1CFQA 1RIUH 4IBLT 3RWCA 2ZPFB 5MI0B 1SVZA 5H4YA 5CFAA 1AD9B 3CPUA 3ZKXC 4JCLA 2V3EA 3D3VA 1BZ9A 1UJYA 3OB0K 1ZQ1A 1KOAA 5L6YL 3OA6A 4Y4HA 3BD3A 2Y7QA 1DCEA 3F83A 2CAKA 3QIWD 1N4XL 2QQBA 1SFHA 1GS6X 2XXGA 3VFUA 2H6OA 4RISL 1OAYH 3C5ZA 3T6XA 3ZTDC 3NG5A 4G6JL 4YDIH 2GC4C 1OVZA 5IW6A 1ACYH 4C8QE 4Q8BA 3AG3B 4K8RC 2CM5A 4ZZFA 1HJBC 1JBJA 5GIRA 5C0JA 1XGYL 3P9MB 1QCFA 3UYPA 3QYNA 5HGGS 2NNAB 1OARH 2B5IC 4Z7WA 1A3LL 3CZFA 1TJGH 3IMWA 4AEFA 1R3JB 1ZEAL 2B2XH 1P4LA 4CC7A 4L8SC 4ZODA 3KS0H 3VVVA 1KZYA 4G7VH 3HZKA 4KJPD 4VUBA 3KWWA 1F4XL 4PP1C 4GXUN 4JL1A 2C4XA 1R9FA 1P5UC 4OMOA 2JJWA 2WQVA 3P9LB 4FFYL 4ZUTA 1CSKA 1Z6JT 4K5OA 1INQA 1P6WA 3P3UA 5AZ2H 1BVKA 2QKIA 3META 2A77H 4MWFA 2YN5A 3IJSB 4XX5A 3SE6A 4HYTB 4XBPA 4JZJA 4LCYA 3T0EA 2DFUA 1VRSA 3EF7A 4FQXA 2CH4A 1PLBA 3VFTA 4XI5C 1M9WA 1A6PA 3FC3A 3VYOA 3NJGA 4HXBL 2EDTA 3MRPB 4YSAA 1DFBH 3NCYP 4OGZA 3WO4B 2EYTB 1BQHG 1JRHI 1PDKA 3RZCD 1Q94B 4OTXH 4MTMA 4W9IC 5FYKU 1CE6B 4BFEA 1TUGB 4H44C 5L2JB 1IGMH 4M7JH 2H45A 1XR8B 1PQZA 5GAMh 3FT1A 3FO0H 2LDMA 4M77C 2TSAA 4LCWE 3VQLA 2ICWB 5E0FA 3IETA 1KBVA 1ZV2A 4TRPH 4Y19A 3CD6T 5IOPB 2C3VA 1THCA 1WWWX 1UE9A 3BYTA 3GSOB 4EVNA 3MZGB 1LQBC 4RDQG 4QI3A 1KYOK 3K8KA 3WS6C 1L6XA 1EMTL 2Q76B 3QHTC 4MJHA 3MRNB 5C71A 3X25B 5LJ5g 2PCXA 3MV8A 2APFA 5KS9F 1TCMA 3L2UA 4NZFA 3WYRA 4FXKB 3REVA 3NCMA 5GAOn 3EAEA 1ORQB 3WUWA 3S3OA 2R1XA 2R5MA 2BVTA 4E7KA 4GLKA 3ATFA 5GQBA 3EYQD 3SHWA 2W0ZA 3LLRA 4HIIA 3EO0A 5E2VH 1YYLL 2WLZA 3MBEA 4JR9H 3Q3GB 4LHUG 3TA3A 1OSZA 3MROA 3V8OA 3ZHFA 4MMKA 1PZDA 2GJZB 1U3HD 3DJ9A 3MO8A 1O6SA 2HWZL 1P4BH 4WAFA 5D7LE 4PY7A 3CVCA 2VN7A 5FUOL 3D33A 3UC2A 2YPLE 2BSSA 3DX2A 4EDWL 2GT9B 1I7RA 5AW6B 5GRWA 2D6FA 1BECA 1Y57A 4XP1H 4OCMC 4AJYV 3RWGB 5F6HI 3LWHA 1EEZA 2Q1EA 2V2XA 1DL7L 3EFOB 1BV8A 1SJHB 4FCHA 1P6AB 1VQ8Q 1U95B 3AGWA 2K79A 1W8NA 3ZLQC 4L4TE 2BSBA 3KLQA 4NENA 4WU5B 4X8CA 4PGEB 5KBPA 2YMXH 3IDXL 1YIJQ 2X4QA 5AL0A 3HRUA 2GFUA 4AZUA 2ZKYA 3QISA 4MLSA 1YJNT 3DARA 4N87A 5DHYA 5H2BB 3EDEA 3TN0C 1F4YH 4JFQB 2K57A 1T20A 3MRFB 2YA2A 1L3NA 3MP6A 2DZ9A 5DQJA 5KVFL 2X3AA 2VRQA 1IGYA 1WZ1L 5TD4A 2FPDA 4ENED 4WW2B 3IJ7A 3WCYA 3AT8A 1BBJB 5GANj 4EDXB 4ORZA 1K4DB 3S96B 1I8MB 3IGLA 4OJYA 2RK2A 2CDGA 3VI3F 2ZGWA 3L4YA 4F7MA 1SYSB 3JSSA 3MA7B 4OFKA 3APFA 1KIPA 4JFTA 2NY4B 5ACLA 5MEQB 4KUDK 4II1A 1Q0EA 2A73A 1CUOA 3DURA 4J3TA 1D5IH 3LS4L 5DJZB 4U1JA 5CBAA 4H20L 2DL2A 2V9UA 1J5HA 1PGRB 5I8CB 4RQQA 4JRXA 1BJ8A 5DM7R 1IGQA 1PNCA 5E9DA 1ZLEA 5B3NA 2FZKB 5D5MA 3MREB 1JZEA 5I21A 3VWJA 2LGNA 2DYPA 3QNYA 4X5LA 3HC3L 1W15A 1RJZA 3MV9E 3F5WB 2DD8L 4HQQL 4Z7VF 3V4VH 1R47A 1FORL 4PMEA 2IDFA 5E9AA 4OP0A 1F6FB 1Q0XH 4PWGA 2GHZA 3OKEA 3TM6A 3V6BR 2JTYA 1CL7I 2PWGA 3FTZA 4I0PB 4P57A 5IF0B 4HOWA 2KK4A 1KIUA 3O8XB 4MZRA 2P5EB 2J8UB 1VGEL 3CFUA 3RHWK 4JN1L 1KIRB 4XBMA 1IEBA 3LRMA 1QSZA 4LIQH 4Q9QL 1K8DA 5TPWH 2XHCA 3QWRA 2WW8A 4P2OD 2WJ5A 4EMGA 5IVXB 2EXTA 4GKZA 4HF5L 3DK0A 3R06B 1AC0A 1MQ8A 3QYHB 1I1YB 1UENA 3CXHJ 4XZUB 3OKNA 2XA8H 2NUPA 1Q95G 3P2BA 1XH0A 4HDIA 1UT1A 3MCKA 4L8DA 2JS2A 5J8OA 3QXUA 1CJYA 1NBZB 3QIWA 2GBVA 1V10A 4BM7A 4F7PA 1SXNA 4QIRA 2NY0B 1YCYA 4CUCA 2Y23A 1LE5A 2FATH 1PZ5B 3E80A 2H3NB 4XPGH 3UBGA 4YFLI 4K8RL 1LPLA 2IAAC 2DQIL 3I55Q 3LZRA 1FDLH 4N2MA 1U33A 4MXVF 2AK4E 3V4VA 4TN9A 1A6WH 3D0VA 3MU3A 2NUTA 3BXNB 2P7TA 5CD3A 2DL9A 1TZHA 3WKML 3V0VB 2JCCE 3G6AB 1J1XL 1G7QA 1VQ4T 1PKQB 2JJTA 5C07D 2G3RA 4LKXA 1FYTE 2QLYA 4V1DB 3EHBC 3WS3B 4AYMC 2XQYA 3DETD 5T1DL 2X4NA 3TBYB 1QZ1A 4ZDHB 2HFFB 4HD5A 3ZHNA 3FAXA 3S4SA 1QOKA 3LYRA 3U2SA 3VGGA 2VZVA 3CC4A 5GANe 2MSPA 3DNKA 1G0YR 4XPTL 4KBMB 1YRKA 2ZCHL 1ECZA 3D6GA 3OAZH 4G9FA 4OFDA 2B1AL 3MLPA 1KPRA 2YLCA 2A1WH 1VQ7A 4B60A 1N67A 1A6TA 5B1KA 3RPIB 1CGSH 4QYOA 2V9RA 2WQ8A 4D0CA 2JM9A 1TVHA 2E47A 2YUQA 1BVLB 2DLTA 3IJEB 2LRQA 3FF7A 2X44D 4OD2B 1GC1H 4NRXB 5E8EA 3S5LA 2AZSA 2HBPA 2WIIB 5TE6L 1KQSA 1MW1A 1RABB 4KXDA 5EHFA 3CN2A 4BFKA 2FJFB 5ABZA 4N2GA 3EYSH 5T33H 4HZ1A 2P8LA 2W88A 4OLXL 1ORSB 3KHQA 4GSRA 1SM3H 1AP2B 1ZWIA 3HBQA 5IJVB 1XL4A 5J7CC 2DLEA 4LK4A 1YWPA 1TFPA 4L4VE 3WEXA 3PIOA 1NOFA 2I7SA 2UYLB 1FVCB 2F54E 4TOYL 4BB7A 5HGDB 5JLZB 2BCMA 2LCSA 3QJHB 1FFOA 3OZKA 4BK8A 3LKNA 1D5XB 4DP0X 1JFQL 2VYRE 4PJEB 5C08E 5IJCC 3HOGA 1DBMH 4OKVB 1VQPA 3MLYL 4NQED 4XX1G 3U9UB 4BXVA 1VEPA 4NZDA 1FZJA 2RALA 2IF7A 4PTUA 5J3HC 4M56A 2DQJL 2VW7A 3HC2A 4F2MA 2BVQB 4GEJA 1YEHL 2BX5A 3AU1B 4GQ9L 2WAQA 4ELME 4XMUA 4M75A 4O2FB 4MA1C 4G1EA 3CX5J 4HMDA 1U3HA 1U93B 3BKYL 5L4FA 5ECJE 3LZNA 3RWIB 4HUWA 3QEQB 2QFRA 4S1DC 1E4XL 2OSXA 3RR6A 4G9DA 3NIFE 5PCYA 3S3JA 1H6TA 5I1AB 1UD4A 4BSWB 1OLLA 2Y6SD 3LHAA 1D5BA 1RVFL 1MW2A 2KNBB 2IQ9L 3QI9A 1RMFL 3ISWA 4Y4KC 5EZOH 3PXLA 4ZX4A 3AREC 1JHKH 4GAJL 4NCC2 1DQLL 3WFCH 1FMWA 1YUKB 3GRWA 2V6HA 4JG1L 2HXAA 1ECYA 4FYWB 1HH6A 1Z3GL 2D9CA 2VC8A 2EDHA 2O5ZH 3EJUA 4Q2ZB 2AEQL 1MFAL 4JQXC 4AG1C 4OCSL 3CFEB 1NDGA 4ZI8A 1RZIB 2D03L 1U8MB 1V05A 1F3DH 1SNRA 4OB5H 1ZT7A 2EBPA 2QQKH 4QPEA 1M90R 1LK2B 4LLUB 3SDCB 2JKTM 4JVWA 4C83B 2J8HA 5DZJA 4YGVB 5LQBH 4E7ZA 3PWNB 1NAMH 4DP6X 3SDDD 5FEBA 4GAGL 4PM1A 5LG6A 35C8L 1UQSB 2BZ8A 5AYFA 3CCUT 1FAIL 1MFBH 1JV2B 4YPGB 3VXSB 3STZB 4HOZA 4HX1A 1O7SA 5E2JA 1VLXA 2E4FA 4HAFA 4PW3A 4E41E 3C8DA 3D85D 1MFDH 1X69A 1O9VA 5I6XB 1AGCA 4Y89A 2HKFH 5DRNB 2MQCA 2EJ9A 1JRHL 4KVCL 4JBSA 5F96H 1D0ZA 5E1QA 5IBTL 1KB9K 3NFSH 1YQVH 1RIVH 5AT1B 4I77L 3MCLL 3UATA 2X6BA 3PWPD 3UGXA 4PQXA 3PFUA 4B9KC 1S7WA 4GI6A 4EQ3A 3BH8B 3BIKA 4P8QA 1JNLL 1R3LA 5K59F 2QYZA 4IOIB 3VFMB 4U7MA 4PGDB 1R24A 3VXQA 3UL4A 4Y2DC 3AHUA 3CSYB 4P5KB 1VQNQ 4K7PX 1S3RA 2QQNL 4G7YH 3ZPDA 2G3ZA 3BWSA 3DMMC 4FNUA 1VDGA 2DJSA 4HH8A 4MQ7A 5FYJU 2VZSA 1OE2A 4FNQA 4FXLA 4OCWH 4AE1A 1OWRM 4NN7C 3QCUH 4CNIA 1F8TL 4WJG3 4P2OA 4DT2A 5DR5H 4N8CH 5KJRH 3QORD 3QG7L 1A8ZA 1CIUA 1C7SA 1L9RA 3O3AA 5FOBB 3MJWA 4GEIA 5FO7B 1I9IL 2I0NA 3DRQB 5KVFE 4ZN1A 4N4HA 1IAII 1D7DA 1ZHNA 1E6OH 1UEBA 4GMTH 1DVFD 1KCUL 2FRGP 2OLDA 3HIZA 1UHFA 3VO0A 2OMYB 3IDJA 4KX7A 4U31A 3A4DA 4QRPE 2WXMA 3RU8H 3A5VA 4O2CB 1K4CB 3TFKC 2AIRB 3UOAB 4KKZA 2J7IA 2O72A 4JO8A 4NNXB 4LU5H 2MCNA 4N2CA 4P23C 5EEWA 8AT1B 2GJ6E 1INEL 4XMLH 1VQLQ 1QSFD 2CH8A 2XWJB 3DX3A 1YC8A 5DD3L 4JN2A 4AL8H 1SFDA 1UJ0A 1X2KA 1PSFA 2G3XA 3OR6B 2VMJA 3BPNB 5KVGE 2R9HD 5H35B 2Q20A 1LCKA 1VIEA 1IQWL 4KH1B 1TCRB 1AHKA 1BYOA 2B8AA 5BZWB 1I9EA 1YMME 2LQ8A 2XPZA 3RI5K 5LBSA 3B9AA 3QAZB 2QGFB 4NHUA 4HCKA 4GSDL 4X6CF 3UG5A 1RZJH 1PYWB 4GY5A 1GJUA 1P92A 2FPEA 1Q82R 1F58H 2PPDA 1HSBB 2A4EA 2HJKB 3HRSA 4S0TD 5EZIH 1N59B 5J1TC 4M78C 2CR0A 1JL8A 2EH7L 3KBFA 4CC4A 2GITB 3ZDXF 4F24A 1JGVH 4FT4A 2NXYD 4NQCB 1BZEA 1MWAB 5DD1L 3GZQA 4EKXA 2EIDA 2YAFA 1ZTMA 4PJAE 5ENWB 3RAJL 3ZYOA 5HY9A 5I75C 5HVHB 1OZUA 2XZCL 4JO1H 1LDSA 1MMAA 5CO1A 3VJPA 2LJ1A 2D0FA 3VKIA 3QJ6A 4H0IA 1T1XB 3L3HB 4J3OC 5I18L 4ONOA 1UJ3C 1BAFH 5CGTA 5DO2C 1XCWA 3W9DA 3P3TA 4ADIA 3TCJA 1MI5A 3WHXA 1YWOA 5EFIA 2OX7A 2VH5H 3EGDB 4DFIA 4JFFD 1K76A 2A99A 4PHXA 1QMUA 1NDMA 2NLJB 4IHOB 3LSOB 3GTVA 5DI8A 4Z8FH 3A4EA 4XCFL 1VESA 2GI7A 1KCKA 3PCYA 3R7RA 3W2DL 2O9SA 3NCJL 4MXQD 5KG9B 1L7TL 2BVUA 1ZTXH 2Z31B 1UB6B 2O6EA 5KTEL 2KR3A 4M9OA 2Z7YA 2BKDN 3H8NA 1CVRA 3ECUA 3EG9B 3FB5B 1N9SA 3GIVA 2L3RA 3WXVH 3AMLA 2R0WH 2LJ0A 3FFCB 2YD8A 4IJ3C 4NQEA 4UIMB 2JUFA 4AK2A 3L2NA 4BI3A 3LN9A 2VE6B 4QQ6A 4K9EH 4KAQL 2PLTA 1NUGA 5DRXB 1QVGP 1E2VA 2B16A 2R29A 4FHJA 1ED3A 1UKQA 4Y16B 1MY5A 1PZSA 3NACL 1BM3H 4TPRL 3DBXA 3FPYA 4NJAL 4PJGE 3BKML 4TS6A 3FSVA 4DBFA 1NMBH 5FPIA 1EO8L 4DUWA 4ZMWA 2FB4H 5GMKi 3DLLA 2GHWB 3HCVB 2ENYA 1DHKA 3QJSB 1P9MC 4HCRH 4LSVH 4YSCA 5FYKD 5IHKA 2HT4C 3R6NA 3B56A 2HJFB 3QPKA 4NQVB 4XPFH 1UWGH 3GMOB 1VQ6T 4YIQB 2OJZH 1E50A 1G1YA 2E76C 3TVMD 5INDA 3WIFB 4BFOA 3ATDA 3NABL 4LSQL 1C12B 3H7BB 2C3XA 2JJSA 1PSEA 4R4ND 5JZ7C 2BP3A 5CJQH 2CU9A 1AXTH 1Q1JL 1PM3A 5AW4B 1YEJH 1MNNA 4JL2A 1IM9D 2Z0WA 3ALXA 3O45A 4C92D 2ITFA 1KCWA 1JN6A 3NMZC 1OCRB 3SDDA 3CD6A 3GRGA 3KPNA 1PVHA 4PRHB 1IAOA 1GBQA 3RUGA 5DRWB 4HT8A 2M26A 3ZKMD 3US9A 3WSQL 4HAGA 5AKSA 1H3TA 1QUPA 2PP7A 2EDNA 3D39B 3DGGA 1AOZA 1IFGA 5JOPE 3GSVA 1YI2A 2JI1A 4PJXB 5EBWA 2ODHA 1U06A 2FYKA 1JZFA 5DJXB 5GS2D 2EECA 1CQYA 3FKUS 1Q9OB 1BQHB 4NO3A 2OCJA 1TZGL 2R56H 1DJXA 4LPUA 3MLZH 4A4EA 4F7TA 4YBQD 3RWDA 5AVTB 3V95A 3PWPA 3VM7A 2LQRA 3I6GB 4HCRA 1JF5A 4WFHE 2DQDH 4Z6AT 2O93L 4XCCL 3VU2A 1F56A 3KNBA 3B2VL 4UBDD 1E4KA 1I8UA 3BN9C 3KH3A 1MAMH 3RMQA 1BZOA 3PUUA 1WI7A 2IAMD 5B1BB 1MCOL 1RZKH 4WW2F 2IWFA 1PZCA 4N8VB 3MACL 3CCEA 2VDNB 5EU7E 4WV1A 3MV7D 3MKGA 4CMMA 3MVSA 3NTHA 3CCRT 1A0NB 4UV7L 3UYRL 4IRSA 4Z7NE 4DSYA 4OGAC 3IGAB 2JS0A 3K4AA 2FHFA 3EDDA 4P2RD 1HQ4A 2LABA 3II2A 1RKRA 5LGHH 1B9KA 2CHWA 1R34A 2G9HA 4QXTA 1J0ZA 2O5XH 5T3XL 2QZQA 4HWZB 4JRYE 3SWNB 2VDMB 3QFJE 4BH8B 4OT1L 5AAMA 2P43B 3QORA 4ILDA 4EN3D 3L2ZA 3GZOA 2WINA 4K7PY 2X28A 4NERA 4PS8A 3N1GC 5CUSL 4APQB 5L2KB 4LLYA 1O5PA 3MPCA 3D4ZA 4H7VA 4I3RH 1VGKB 4XCNA 1K6QL 5D93C 4HVBA 1X5LA 1DZBA 4C0DB 1KB5B 1O75A 4OFVA 3AUWB 3ARBA 1J9CT 3PJLA 2KMTA 4G6MH 3PNRB 4RRPG 4PJ5D 5IJKA 1EX4A 4LF3B 2NWMA 1X27A 2H6PB 1R0AL 5DZNA 4PJIF 3JB9G 2N0KA 1G7LA 3N44B 2VLJE 3E6FB 4L2YA 1ZLVH 1QSFA 2BNQA 4UOQA 4FA6A 4J9CA 3E9TA 4F7UE 2FJHB 2E0PA 4LRNL 2B0SL 3JV5A 1ZCRA 2DM2A 2D31A 4NX0A 3TO2B 4NNYB 3U25A 2XWEA 4ZD3H 3H4FA 5EUKB 2WLNA 4XO4A 4XTWA 5AEAA 1SMDA 4PJCF 4JRKA 3QZBA 1C9SA 3I9QA 2CA4A 2BVEA 3H9SE 1DQML 3MLXH 4IDJL 2HLEB 4UT7H 2OX5A 5AW8B 2LR4A 2NZ9D 1ZHBB 5IQLA 9CGTA 3FQ4A 1WITA 1SJXA 2IJ0C 4JLIA 4X1VA 3G6EA 2BZCA 3DIFA 4ONHA 5MEND 3G9VA 5FUCC 2J06A 1E27B 3MKKA 1SKUB 1MMNA 2BOCB 1KFAL 1MPAH 4WZ9A 1FMVA 1L7IL 3QO1A 3MRRB 3VV0A 2DERA 1CICB 5DD6A 4LCIH 3VJ6B 2HKQB 2XI9A 4MX7B 1CLOL 1V1CA 3B9KB 3BAYA 3EO1B 1KV3A 2XPGB 3VI3E 4CMHC 3BRGC 4QMEA 2IADA 2YGQA 3OQ5A 5KW9H 2YPVA 5FYKH 5IG7B 2X35A 3S37L 4CADB 3LNHA 5I24A 3JWOH 4FFZH 2DBJA 3MNVB 4N8UA 5FO2A 5JHLH 1VQOT 1M57B 2OSLA 4JFFA 4W9ZA 1V3MA 5CMAB 4BZ1L 2DQFB 4HJ0D 4TLSA 4IUTA 3PGDA 1QWNA 1X5ZA 1WS7A 4NWUH 3RNQB 4LL9A 1ABOA 3QJVB 1KD1C 2Y7QB 4OGXH 3EYFB 2NY0C 3L3DB 4HOMA 4M7AF 1A9BB 3BVXA 1XAKA 1L9PA 3C5ZB 3JZ7A 1JGEB 1MJJB 1NFKA 5D4QA 3UWNA 3TZVB 4YX2H 1SMOA 5C3LD 3MLWL 2OR9H 1KULA 2BCKB 4L29B 4WWKA 4HBQA 1VZHA 5C0CE 5AAWA 5GSRA 5GZNC 5ADPL 2X9YA 4R26L 4OMPA 2YAQA 3V8KA 3IKCA 4Z76A 3CBPA 1VQ4A 2E65A 4LD9K 1P7QD 1U8JA 3PHQB 1P4LB 3PQYE 2J71A 2V9TA 5GS2H 4L48A 1Y6MR 3OMGA 2K3HA 3QEGL 1UC6A 4WCYH 3A6CL 5CAIA 3SYQA 2JIXB 4OZHE 3QNFA 4NNPL 4PU2A 3GFUA 3QEHB 5HYSG 1FA4A 3OLDA 1IGTA 3O3EB 1FGVH 1ID2A 5CBEA 3TH4T 5L4JA 1KNOA 2WOYA 3FT9A 4E9TA 2P8MA 4IKIA 3TVTA 4FFZA 4QHPA 1P7BA 4PJEF 5DJ0B 1AGFB 5GGSB 1BVKB 3TVMA 4ELKB 2CCWA 12E8L 4ES9A 4LCYB 4POZC 5CP7B 3BPCA 1A6UL 5HYQA 5GANg 1DLHB 2WVTA 3QHZH 2LAAA 3CAFA 1OALA 4DAGH 3QZNA 1QWHA 3OGCA 3TYGL 4EJ1C 1G3TA 4JRQA 5FDWA 2Q3AA 4PRPE 5IGXL 3VS6A 1ILSA 4JFZH 2VQUA 4PLJC 3A0OA 4OF5A 4N2HA 2EACA 1MCCA 4M00A 2UWEA 4KUCF 3MLUH 1GTFA 4OMLA 1IX2A 1KJMB 1FI8C 4LUEA 2X2YA 2X2JA 1N18A 4FZEH 1XMWA 4KGLA 5EUOF 4FE9A 1KLGB 2P47B 1F1BB 1A6AA 1DSFH 2CCVA 3JSCA 2IH3A 3QIUB 5E4EC 4N8PA 3H53A 4MS8D 2BDNL 2JTDA 5A2BA 4PJ8B 1FRGH 2OQJB 3GKWL 4K3JL 1TETL 3BDUA 2E46A 4NC1E 5D7IB 5E6IC 1WT5C 2BSEA 3QDJB 4FKEA 3MLVH 4KK8D 1Y6NR 3MV8B 3NYKA 3O3DA 5EC1A 3VS1A 3REVB 4F57H 4HT9A 5A0LA 1HZHL 1WRFA 3WUWB 2R1XB 3BN3B 2X41A 1NCGA 3KAAA 4E9LA 5L8RE 4N2IA 1EJ6A 4HIIB 3EO0B 1CTOA 1L5GA 3HMXL 4JFOB 3TV8A 5KYUA 2ARJA 4L9LC 3G04B 4XO5A 5IMMA 3SKMA 3TA3B 1IJ9A 3MROB 3RY5A 4QF1B 5ESAB 2P4TA 2ESVE 4GLRI 3BI9X 1OK0A 2CA3A 4XVJH 1O6SB 3MV7A 3UTSE 1K9AA 4GRLD 4PY7B 1H3PL 4ZMXA 2JLPA 1S7VA 2BSSB 3CCHA 2C1OA 3DHUA 4JDTL 4PJDF 2OTUB 5GAOq 4XWOD 2LNHB 3NUKA 4KROB 5GJTL 1G5AA 2JKWA 3NTKA 3OR7A 2V2XB 4A4HA 5E0QA 1MNUH 2N3JA 5KOMC 3BJLA 3E8VA 3QCTH 3UERA 2E7CA 3WDHA 2JQMA 2V37A 3BLKA 4EN3A 4GMSH 1GGBH 4FF9A 5EPMB 1THAA 2YOCA 1EJOL 1KCRH 4FL6A 1MJUL 3GS4A 3L1EA 1KC8C 4UIKL 3GMMB 4JKLA 3I50H 2FQGA 3P0VH 2PYFA 1T20B 2QEJA 3UEQA 3URGA 3ETBF 5DQJB 1ZK9A 3CCUA 3FB7A 4R83A 1M7IB 1I53A 1K9TA 1PSKL 1F4WL 1IGYB 1JZHA 1KPUB 5E8DL 3CQPA 3BY7A 1L6PA 2F5AH 1BQSA 1AKJD 1KTJA 5C3TA 4HGMA 4G6AD 1CIDA 3TXAA 5CU5A 1N6QH 1OW0C 1WGVA 2A0LD 3EO9H 3BDYL 3DTUB 2TRHA 5B3JF 1DQVA 3EYUH 1E6JL 3CLFL 5FYJD 5D1XC 2K5IA 1JGUL 2XDHA 4PY8J 5GGVH 1WGOA 2FO1A 1QPXA 1YFNA 3RESA 4F17A 5MENA 3QNYB 1K8AR 1U5SA 1RJZB 4K7FA 4WGWB 5ERWA 3ZQ9A 1QLRB 1XGTA 1YNZA 3EOBB 5IBUG 3CVHA 1C1AA 1AIFA 2FG0A 3IVKA 2A9BA 3CLWA 5ES4B 3QWOB 5J06A 2CNZA 3M6DA 2MWPA 4RTYA 3OKEB 1J11A 1HHGB 2XOTA 3WHE0 4P57B 3VFWA 5FGCB 3QQ9C 4Y0GA 1WXTA 2J2ZB 1UB4A 3HI6H 3FMGH 4UQ2A 4NKDB 3VYHB 1YHPA 4U0QB 5LKNA 3QUMA 3B2UD 4YWGL 5GXBB 1FMKA 5IR1A 2DA9A 1IEBB 4ZGJB 2ZXBA 3DROB 4ES8A 5A2LH 3N06B 3BLPX 5T3ZL 1W91A 2ZPKH 4UTBH 5EO9B 4GKZB 3GXMA 4JQIH 4A67A 1P4IH 3OKNB 3SGDI 1NJIC 1R17A 5FM5O 2O4XB 4TQ8A 3PIPA 3HG2A 3MCKB 4L8DB 4KNQA 4B5EA 4TNVK 2HVJA 1S3KL 5KBMA 3GHBL 3QIWB 3GLXA 4PBVC 4J7IA 2GSIA 4FFWD 1A8JH 3ZDZF 2ADFH 4WJ5A 5ABDE 1VQ8T 3E8UL 3JQOB 2EE9A 4WSKA 1UECA 3QXEB 3X12B 3IQLA 2DMBA 3ZE2E 3HNSH 5F7MC 1YYML 3C75A 1YIJT 1GZHC 1EZUA 3OYFA 5LXVA 1QFWI 1IZJA 1S5HA 4KI5D 3TJEH 3X11B 5ID0A 4FMVA 4L2LA 2X4YA 2J88H 1RUPL 1KLFB 5B22A 2WBWB 5ICZA 4HV8A 3V4VB 4XCYA 1DVUA 1P7QA 3D0VB 2NUTB 5ITBL 4XVUC 2D7MA 1S9KC 4CU6A 2XG8D 4E42A 4FZ8H 1MFCH 4TUOA 2RBLA 4S2SB 3WAKA 2WLIB 1G7QB 1GYUA 1QLEL 4LKXB 4M78E 3WKQA 1MJ7L 3UJTL 3K46A 4OLWH 4NWTH 5DJCB 1MMDA 3ARGA 3S4SB 4MNQE 1A4KA 3RDTC 4C92G 4AZ8A 3RY6C 2VR9A 4W6WB 1TLMA 2M9UA 4UTBA 3S3NA 1WQ7A 5DD5L 1KBKA 2F53E 2QEXQ 1XIWC 4IRZL 1M3BA 2KXDA 1USZA 3LDBB 5HHXH 3RVTC 2FRYA 1A6TB 4JQIA 4N0UE 3T4YB 5F3BB 2VR8A 4D0CB 2AQRA 4RFOH 1URLA 3TT3H 1BIAA 5IWLA 2ZUVA 3ZT6A 1Q0YH 5E8EB 1QLFA 1NGPH 4RGND 1M42A 2V1RA 4K3GA 3RZCB 3UJIH 4YLCA 1ZANL 3N1MC 5J1AA 3MLRH 2JXBA 1Z9LA 3ELAT 2HLAA 4WHTA 4YC2C 2BIOA 3P54A 4YSPA 4Q9CA 3VWKA 1HYSC 1QRNE 1L0QA 1GMEA 1UOKA 1NC4B 1ZWIB 3PGFL 5I71C 1A14L 1U3NA 3NGPA 3OS5A 4LP5A 4J3XA 3WEXB 3G7ZA 1BOYA 2EIZA 2J6WA 5A16B 4X6FA 2FLBT 2N56A 1KGYE 2JE8A 1AS8A 4JM2B 1PD1A 5IHWA 3UZVA 3ULUF 4IEFB 1EXHA 3O6ML 1QYGL 5FFOA 4J6RL 2NW2B 3TF7C 4M5YL 1FZJB 4PTUB 1W8OA 1JUFA 3DGCR 2KE9A 2F8VA 4O02A 5DWUL 4X99B 5F1NB 5KAQF 4Y16C 5EU3A 4PRNA 3E1SA 4F2MB 5DYOB 1YEFH 4WFEE 1BVNT 3RWJB 5DK2A 1AGDA 1AO7E 3GINA 4M5ZL 3WJMB 3KYNA 2JH2A 2ZYHA 4OCYL 5DD0H 4DO5A 1FZOA 1KYFA 3TFBA 4GKLA 3WNNA 2ZUTA 1MRDL 5FYJH 4NIKB 4H8PA 2HTLD 2R4RH 1FF5A 4ADGA 2OMVA 2LJ3A 4G9DB 2J6EH 4YE4L 2MQ3A 4BSJA 1OU8A 1OF0A 2OTJT 3CFDB 4PJXF 2PWFA 4NZTH 1OPGL 3BKJL 4XOAA 1D5BB 1D5RA 2R15A 1ARKA 4O9HL 2WSKA 4XB8A 2PO6C 4FI6A 5D1ZC 4DGYL 2UZIH 3QZOA 5EOQH 1JPTL 4FFVC 1E90A 3NJKA 4BZYA 1UM6H 4WO4D 3QR2A 1MQKH 5GMKh 1NDGB 3OTTA 2FJGB 2DQEL 2FZ3B 3QDGE 1M3CA 3BSZH 5I22A 3IXTB 3N5AA 2MNJB 1NPRA 3OXRB 4PJOC 2HP4A 4UDUA 5F1OB 5TDPB 3MNDA 1JYWA 4EMKB 2Z0BA 2XXMB 4AMKH 4DGVH 1T2XA 4DERA 4I48A 1MCPL 3PWJB 4U7KA 2PUOB 1RERA 3LQAC 3CPWS 4PBDA 4QHLB 4F8OA 3QO0B 4JO2L 1AKJA 2F58L 2L3BA 3J80E 3OW2P 2L0DA 3N5BB 1E5BA 1T21A 3HAEA 1TUDA 3SBRA 1T22A 2GY5A 2L3PA 3AQXA 4RAHA 3TEUA 1BEXA 2J56A 4RMRA 3Q2CA 2K3YA 3ARDB 2Y1AA 3HNTL 4IOFD 1G9NH 4OVVA 1NC2B 2OP4L 2EDBA 1FQ9C 4KTYA 2APXA 1M1FA 3SHSA 5BS0D 3R7QA 3RX8A 3TH3T 1MCRA 3M0QA 2ENQA 4Q56A 4OIAA 5DS1A 1R3LB 1AE6L 1Y7VA 3U1SL 3TX4A 1XB8A 1J9TA 2FH8A 2YSTA 2ATKA 3I02A 1EJ8A 5F9OH 1II4E 4M7DF 1KF9B 1TVBA 2W60B 2KDSA 3BO8A 4H8HA 2B15A 4KKLD 4LEOA 1INDL 4NFBA 4TSBL 3Q5TA 1K5WA 3KPRE 1YO4A 4RUGA 4JJ5B 2CDEB 2W0KA 4G11A 2H3XC 3FQ2A 4PIRF 3BSZA 4NZUH 3REWA 3F04A 4N5UA 2WNWA 4OLVH 1WBYA 4PS4L 4KZDL 1I5LA 2WTRA 4CNIB 2FRWA 4JPVL 2R58A 2VJXA 1NAMB 3SQOH 3QHFL 5DHXB 4XP6H 5EG2A 1G43A 3ABZA 4MRCA 2YUXA 5GS1B 1A66A 1X5KA 4KKBD 2CZNA 5KSVB 5TQ2L 1ZHNB 4AYDC 1VFOA 2HYMA 4HJSA 3H8ZA 4HUUA 1V7NH 2TAAA 4EI5C 2E1HA 3GSNB 4LP8A 4TSCL 3Q8BA 2DW5A 4L0PB 4C4KO 3QC6X 2GJJA 1CD9B 3VXUB 2WKOF 3KWUA 3DYOA 1HHKB 4HCZA 4K9JA 1S7XA 2XZQH 2N01B 4XNMB 1FN4A 4X0NA 5JW5A 4F92B 4CVZB 4YAQA 2CHDA 3HHRB 3PT9A 2R0KL 2A7BA 5DY9A 3TPUA 5IHLB 1TQUA 2FO8A 5LGJB 1J87A 5IVZB 5D70H 1OCOB 2ZPBB 1TZOA 3ETTA 1AZUA 3FO2B 2X4UA 4Z5RB 2YD9A 2P5WA 2NY3D 3BUYB 3C09C 5C07B 5ETUB 5I1JH 2LOEA 1FO0L 3DUUB 4JO4L 2HT3D 4QRRE 4F9LA 4S0HA 4LHJB 1NGYA 2KY9A 4D7PA 1JJUA 2B1OA 2QDVA 2YBGA 5E6ZA 2B39A 3B8YA 4KY1H 3D06A 4FCYA 1OEZW 1NUNB 2DKSA 4AEIH 4OZGA 4D3CL 5BNXD 1BZ7A 4BUGA 3VXRA 5FR3A 2WNXA 3UTOA 4U6HA 5I16A 3M59A 3OY9A 3AY4C 4PJMA 1LXMA 4PV9B 4XN4A 5HY9B 2BZYA 2NQCA 3CK0H 4B9YA 2J8UE 3U9WA 4CBZA 5JIDA 1U3OA 2F5BL 4FQCL 3PIQA 5AB1A 5C09D 2F8IA 2ZIDA 4HS8H 4AUYA 1TUCA 3KL0A 5F7NC 2UXVA 1VQOA 5KSBB 4Z3JA 2BIMA 4DOHB 4UILH 3GMRA 5IVXE 3O6LH 3D87B 1MHHB 3MJGX 3WL9A 3WHXB 2ZX5A 4YXLH 1TJMA 3DB3A 3ES6B 3NPSC 5FW6A 4P3CH 4G8AC 2I60L 4J6WA 1YZZA 2J57A 3LY6A 4GRMA 4I13B 4M8VA 3ZTJG 4QNPF 2A9MH 1HE7A 1YQ2A 5D7JB 1QSED 3LCYA 1W70A 5I1CH 2X2HA 1TTCA 4Q9RH 3PNWA 3UPCA 3HMWH 3EXLA 4R7XA 5H8DA 2K2MA 3EBGA 1C7TA 2A2QT 1H19A 1YJ9Q 4NO0B 3JCMe 2XTSA 2XWTA 4ZSOA 3FU0A 4D9RE 1IGJA 2A3LA 4KQ0A 3QG1A 5LAPA 1Q7YU 1TYJA 4NQEB 3MGTB 5I76B 1A0QL 1QBLH 2LU3A 5HDBF 3NGBC 3IB4A 2XQBH 2E9IA 2W65A 1ZE3C 4ODUB 4YHPB 1ZV5A 1ED3B 3BAXA 1SHFA 2UZYB 5LB1A 3M55A 2VW4A 1PKQE 3PLYA 3DPBB 2G3MA 4LLDB 2XG5B 1ZIAA 1GAFH 2K7PA 5F9JA 3LKSA 1AR2A 2ZYIA 4GBXC 3UBXB 4CDHA 2VW6A 3LB6D 2WPGA 4KKCD 1S1NA 1VQLT 1A2YA 3DYPA 5DDHA 1ZT4A 4RFNC 4TNWK 2MNWA 1BF5A 3QEUB 1J8SA 4IGBC 3V52L 3RKXA 3UTQA 4G43A 3OYMA 3AS1A 4LVOB 1DANU 1FYNA 3FQXA 4IIQA 4HS6A 2WYHA 1ZJBA 3AROA 2IPUG 2QVFB 4FJYA 4HPYH 1G9HA 2K1MA 1R5IA 3VW3L 3F7VA 4IOSD 4X7TA 1Z9ZA 1BU1A 5EC7A 5CSGA 3DJSA 4DVBA 1CLZH 3GNGA 1YNTA 2VDOL 3A67L 4WO4A 2VZOA 3HHTB 3TESA 4UU9B 2GEEA 1IC5L 5I2IB 5HYSB 4JY5L 3KPPB 1ACZA 4D9QE 3ZE1F 3F8UB 4WNQA 1AJ7L 3OYNA 3EZ8A 1Y96A 4E9SA 3UA7A 3P0YH 2WUBL 5D7LD 3RLSA 2YPLD 3O45B 5DUPH 3RTQC 1JZ6A 1JN6B 2Y1YA 4H8UA 3TSWA 4MCZA 2VR6A 1J9QA 4FQJL 1IAOB 4KTEL 1ZA1B 3KCWA 3JTTA 1M6OA 3UF4A 4KXZH 5KN5B 4FYXB 4K5LA 4UNUA 5SWSE 3DGGB 2NY6C 4LKCB 4Q5WA 3CVDA 2WN3A 1OB1A 5HI5C 2C7UA 3D85B 3GKZA 3VS7A 2A7YA 4JB9H 1H9VA 2OL3H 1VFBA 2P8PB 2XPYA 4L4TD 1V76A 1Q90A 2MF2A 1MG2C 2AK5A 1G7PB 1T3FA 2G5BA 2YWYA 5EG6C 3WLBA 5LG1A 2KYBA 3EG2A 4KWUA 2N1KA 4QRTA 3FQTA 1TQCC 1FCCA 3RWDB 1UWFA 1ZVYA 3HZ3A 4PFZA 1B2WL 2DILA 4RIRA 3SCMC 4JG0H 1BI2A 3ZE0E 4KKQA 5BS0A 1ETJA 2JWYA 5FHAH 5DS8A 4AEHH 3KNBB 2NPLX 3QPXL 2WMPB 4FYSA 3MHZA 4Z1PA 7FABL 2NNCA 3P2TA 1BYPA 1W2BP 3QNZA 4Y9FA 3Q6FB 2WBKA 3W82A 3GDBA 3HZVB 2EAEA 4KROC 5LNGA 3B4NA 3GSUB 1SHWA 2M02A 3KYMA 4MCNA 3K6SA 4HCBA 5EWIL 2EYXA 3PDOB 1AD0B 1HQ4B 1QQDA 1IAIM 2G75A 4JRLA 3UP1A 4DK5A 3QIBB 4Y28E 1TQTA 1HOCA 1PLCA 3GPSA 1XSOA 3P8BB 5BZXA 1WQVT 2NX5A 3EH3B 5F97E 3UXFA 4OV5B 3DSFH 5F6HJ 3HLAA 4FXGB 2VXUL 3MDJA 2RN8A 1HIMH 4X6DB 1WDAA 1K2DA 2A9NH 1ZBJA 3HE6D 2QDYB 4ZTPH 3I2CH 3QXAA 5D5MF 3MV9D 2EYSB 1XQ4A 3MNWB 4MDIB 1BJ1J 1QVOA 5F0LB 1DVFB 4DEPB 1C08A 3TJHD 4JNXA 1LNXA 1FC1A 2OZNA 3NP4A 5D1QA 4CW1A 5E6RB 3V9EA 5KVDL 1ZHIA 4XB7A 1LTXA 2VZ1A 2CG9X 3VXSE 2FX7L 5IMOB 3ULVC 2VZ3A 2RCSH 2H47C 4MDJB 5K9OB 1G7LB 2YN3A 4KO7A 2RB8A 4NQDA 1G7IB 4FLQA 1XZWA 4BHUI 3CHSA 2ZX7A 3IYLW 3QDAA 4M61A 3HKFA 3IWUA 5D72H 5IKCA 1CDBA 1DDHA 4QKUA 5HYFA 3EJJX 3OHXA 1KB9J 3AG4B 4ODTL 3LV3A 2ZKXA 1U58B 4LOFA 4AV4A 1JRIA 1Z9SB 1U2YA 3O9WD 3ZW3A 4W6XB 2OX5B 1WHGA 2PR4L 4KX8A 5GPRA 3FRNA 1RUQH 3X14A 1GS7A 4AX3A 4Z18A 1DO5A 1WC7A 2KZWA 2IMMA 3GI8L 3MOBL 4ONHB 1A9VA 2CSQA 2VDLL 5TQ0H 1YY8A 5DQ9B 2IAND 3U7WH 5FU6C 4NSKB 5BJTA 4C8QA 4MDWA 4DQOL 5JUEH 3DGDA 3IDNB 4ODXA 1OGAB 3IFNH 1HL9A 1YC7A 1LEKA 1ZVSA 4R84A 4A7UA 4MZ3A 4V11A 1MLCA 4M7LL 4MJJA 1QTPA 1ETZA 3LEYH 2AKKA 3LEXA 4P5SA 2VLRD 4R0LB 1Q4NX 2IADB 2J25A 4N2NA 5E8OA 3G6DL 2CGZA 1QHPA 2ZWSA 4Q4EA 1B0IA 2HJLA 4ODWA 2PPAA 3FSWA 2YSSB 2C9RA 4JFDD 5AVZB 4BSVA 1XGPB 1ZHKA 3S35H 4LSDA 1LNUA 3G3LA 1J10A 1K4US 3K8LA 5DUBA 1XCTA 4MRBA 4BZ2L 3EG3A 5IBUB 4A54A 3PGDB 3UDCA 5B1JA 2O26U 5L4MA 3KPLB 3IRPX 2L3QA 1OCCB 5CKHA 2GW5A 5BXFB 4PS7A 2NY1D 4X0KB 4JPIA 1BF2A 4LE9A 3CSPA 1FGNL 1YIJA 4X5PA 1PWTA 2PPFA 1JZJA 1URZA 3ARXA 5ALCH 2DH2A 3GBNL 3S36H 1U8KB 5J9PB 3D08A 4YL4A 3WJJC 1AS7A 1G7HB 1U21A 4IRJB 3SDAC 5I9QB 3R6OA 4IMLB 3O4OC 4KUZL 1DQQB 4AIXA 2XFXA 2ZXWB 4N68A 1HCYA 1N5AA 2C9AA 4G6FD 3S88H 1RJYB 2EIKB 1K73C 3DHPA 1WZKA 3FQ1A 2HMIC 4RA0C 3LPPA 5GSRB 1C1EH 3LZOA 3NFNA 1DANT 4LO9A 5T5FH 3IKCB 4XN1A 5JQIB 1U8JB 1YUHA 4XPHL 1ZLMA 3PJNA 4MNHB 1T03L 1HZKA 3WNLA 4LCWA 2HRPL 2DTSA 3FQNB 2BS71 2EYWA 4L4VD 3LW5E 4JEGB 1CBVH 3RFZA 2F54D 1ZUUA 1TQWA 3BOVA 4PRBA 2VITB 5FWCA 3K6IA 2ADIA 3BT0A 3GYRA 1KYUA 2ADJA 1QCNA 2QGDA 3NA9L 1B4RA 3Q8CA 2MIZA 4KHTL 3TLRA 1S9YA 3JCMV 4FEIA 1HKLL 2CRYA 3ZQWA 2EXYD 1BQRA 3ZJAA 3OSSC 5IK3A 3I9PA 4HSAC 3LRKA 2KXCA 3SFMA 1NJ9B 1H5BA 3K6NA 3BE1L 4G42A 4EI6B 7AT1B 5GAN5 4IOSA 1G9MC 3KEDA 3BPCB 1U8CA 4B95C 5HYQB 1NCAH 3RGVB 2A74B 3CPLA 2LVMA 2GTWB 4N2EA 1JGDB 5TGBA 3V4UH 2I07A 3VFGH 3MBWA 2WWMC 3HS0A 4M75F 2DI7A 5DFVC 5BOZG 2F74A 5FDWB 1CGWA 3CVIL 2CKBA 3IU3B 3EFDH 1I7UA 2OMUA 1IM9B 5D7LA 4F37K 2YPLA 4C92B 5AYUL 4M6AA 1I81A 4BDVA 2HQHA 4O5LL 3FH8A 1OM3H 2B4CC 3DJZA 4XP9H 3H42H 3DOHA 4YR6A 4LDVA 4KKPA 2IH3B 3N42B 4EBQL 1NEZA 4JM2C 4DUXA 3NTCH 4DPRA 4A6YL 2ATPB 2F2WA 4XU2A 4YZWA 4L4TA 1UHCA 4UOZA 4HUKB 2YD3A 5E2WH 2ZXCA 2LZ6B 3ARFD 4OW6A 1RUWA 2ZAGA 1J8KA 4WEBH 1CXLA 4G8EB 3A21A 3HG3A 1WO2A 3UPRA 4XP5L 1T83C 1T5WA 2FTAA 5IHZA 1L5GB 5K69A 2ARJB 2QBWA 3SKMB 1IBYA 2VAAB 2IAMB 3I55A 4GKOA 1JERA 3FHAA 4PI0A 5HGAB 3C2AL 2BP0B 2X5PA 1N8ZA 2QSTA 4E41D 5CJXA 4CC0A 5EOCH 3NZSA 1S7VB 1Y0LA 2C1OB 2XWBA 5JDSB 1MDTA 5GZOA 4P2RB 4PD4K 2ZAIA 1PTZA 2RHIA 1GZQB 3T2OA 1RXLA 3OR7B 1SBSH 1JPGA 3G5VA 2Q5BA 3W9EA 1KACB 3WN5C 3CH1A 2J1XA 4EN3B 4HIEA 2X0VA 2W81C 2ED1A 1CGVA 1MLBB 5C0DA 3MR9A 5D6YA 1RHFA 1RL1A 4KH2A 1NEGA 3HE6A 3P02A 2J4WH 1DLFL 1IGFL 2PW2B 2UUDK 5AKVA 3V7AG 3MV9A 4YDLB 4OF7A 2Z34A 3L3KB 4WI0B 4P05A 1YN8A 2VWFA 1V3JA 3QGVA 1IZ6A 2ZF8A 4LNRB 2R1YA 5C6WH 2Z64C 3OKDA 3RL1A 1JNJA 3HN5A 1I85A 4EMHA 2C1PB 4D2NA 1P5VA 2D7TH 2AANA 4PJ5B 3D39E 2EE2A 1UH4A 4HT1L 2OAUA 3P4OB 4XNUL 3ULVL 1KJ2H 3JB9I 1MCIA 25C8L 1IBGH 3V4PH 3BT2L 2HKNA 4A53A 1B0GB 4X5XB 1FV1A 1SG5A 1NBEB 1UVQA 2DBLH 4GO6B 4KHXH 1T66D 1TF4A 2FR4A 3CDYA 3ARDC 2ITDB 2XG4B 5IUCA 2XBZA 2X0UA 3RVWD 3Q9PA 2AT1B 3OM3B 1OYXA 1R6VA 4LVNB 2X4WA 2BOBB 5MENB 2JN0A 4QRPD 1BFTA 2KDGA 5GRUH 3GSQB 3L9YA 4S11A 2D3JA 5E9NA 5L6YH 1AHMA 4WFFD 1YN6A 2DEWX 4LXFA 2Q6WA 3QUXC 4LEXH 3V0DA 1JHLH 1W72B 4LCVA 2GJ6D 3KPQA 4YQXL 1ACXA 2Q2EB 1GFCA 3O3UN 4JGJA 4G6JH 3H0FA 2KVQG 3S3BB 2YXFA 3N9GH 3VFWB 2AK4A 4L1BA 4PREB 3SJVB 4DEXA 1UB5B 2PNDA 4UINL 5F0PB 5HHPA 3IDYB 5E8NB 3VB9A 2VXEA 1XGYH 3D4YA 2JCCA 2G2PA 1BWWA 1FYTA 4X7EC 4B9CA 3DO4A 3BAWA 2W38A 3UAEA 2ZOKA 2QPFA 5L2KE 4NUGL 4DEUA 3CXDL 5CKBA 4J1UB 4KBPA 3M0RA 3PAVA 1E3XA 4NUJA 5AENA 3S3PA 1KJ2A 2KLRA 3F62A 3ER0A 4KRTA 5EN2A 1JYNA 4X34A 2Q8BL 2DLFL 5DTFB 2I5YL 2GSIB 1BOGA 1SOKA 1NFAA 4FFYH 2VYTA 3PL6C 4PRAA 4WJ5B 3JCMh 5AW5B 3QNXA 4B96A 3IT8D 2GB2A 4TQEL 2EKSA 2GIXA 4IKJA 2V5TA 1D6VL 2N0MA 4PWKA 2R4SL 1IEAA 2KYIA 3C60C 1JJ2P 2WGNB 2AQPA 5ID0B 4MB5A 1EO5A 1SLVA 4ZYKB 4CRPA 1FUNA 1I1AC 3C4SA 2ZZDA 1NSNL 2BSTB 2WVUA 1DUZA 3D4CA 2EQDA 2DAQA 5HBBA 2EE3A 3RURA 1J88A 1UWEL 4E42B 5KCHA 4TUOB 4L4VA 4QT5A 3WTXA 2RHEA 4ALAC 1HINL 2PU9B 4PCTA 2F54A 1T7XA 4QJ3B 1ILUA 3MJ9L 1FHNA 4PIBA 4XOEA 4ZOEA 3S5LG 3CZJA 3FO1B 4RAUB 3RIFF 1T4KA 1U8LB 4K8RD 5C08A 5JNYA 2YHTA 3H0TA 1J5OL 2EVJA 4OF6A 3HFNA 3R19A 5F44A 1ZS8B 1PX4A 4ZX6A 2JSFA 5FU7C 1HU8A 2HUHA 4PJ9A 1RLBA 4C0ZA 2WBJB 5C0AE 4IU3A 1EMTH 4N5EC 3VE0B 3OB0H 3ZQXA 1TZIA 3PAZA 1G9ML 3KLHC 2KROA 4H25A 2LLNA 4ELMA 3ISRA 5E08H 4TVRA 3H4HA 5FWQA 1CFMA 2BOLA 3W39B 4HKEA 1QLFB 1U8QB 3GTTA 4JW3A 4X6EB 4QAMB 3JCMP 3L2LA 4PP1D 1VQNA 4FFYA 4ZFOL 4NPJA 5J1AB 2GSGA 2HG5A 4WHTB 2HLAB 4K7PL 1YYLH 3MA9L 2XHNA 5D7JC 2CUBA 1MVYA 2CBQA 1ZT1A 2DPKA 3O0RL 1CFBA 2AJVL 4XH2B 4FQQB 5CN2A 1EX0A 4Z0BH 1Q81U 1FNGA 1CURA 4HFUH 2HWZH 2XNAB 3POHA 3CDGA 2B4CL 3N1FC 4EDWH 3OPZL 4MA7L 2UZPA 4IJTA 1U8PB 5IROC 1OSYA 2NY2C 4X7SL 2Y90A 3CUPA 4M6NH 4XI5D 3OL2A 3HRZC 5IB2B 2MFNA 4HWBH 5GRJL 2AS5M 5JPNB 2XC8A 2X9WA 1DL7H 3BP5A 3OMCA 4IK6A 3UZVB 1MH5A 3Q6GH 1OWWA 1PJWA 3FNKA 4Z9KB 1Q1PA 1OD9A 5EF1A 2VL5B 3ARFA 3EJSA 4A2MA 1CF8L 1JUFB 4H8VA 1ZAGA 3IDXH 4YS4A 2WK2A 1OAKH 1KCLA 3PVQA 1VQLA 3QUZC 3BP7A 4TUJB 5LXGL 2YUWA 4K3EL 2X4TA 1FZOB 4LCCA 2XK0A 2CIKA 2X3BA 5KSAC 5KVFH 3V7CA 4Y9GA 2OYPA 3UIZA 3WE6A 4GRLB 4E41A 4Z7UB 5JOPD 1ZPLA 1HWGB 3E9UA 2C9SA 3CSGA 1NBVL 3OKYA 2WSCE 3KE0A 3NZ8A 5A3IC 2M16A 3AG2B 4LAJH 5LDSA 2IWKA 5KBKA 3O6FA 3R18A 1XXDC 2AABL 3SO3C 1QRKA 1UG9A 4B9IA 5AG9A 5I5IA 3FUEA 1G6RA 2YQBA 3LS4H 5HXMA 1ZX6A 3PMTA 4YEFA 5LHDA 3SEMA 4H20H 3AWEA 4DOVA 4HWNA 4WEUD 3ALPA 4G5ZL 3NJIA 2H3JA 4J3VA 2YR3A 1RK1A 4Z3TA 2IG0A 3GSRB 4QRAA 3KWVA 4HWBA 2DMHA 2QEXT 3IF1A 2ZQKA 2WQSA 3EOTH 4RVBA 4AYSA 2DD8H 4HQQH 1MHCA 2VABA 4JAMB 4S1RL 4ZX5A 1PFCA 1U92B 1NQBA 2BH0A 3DV6A 3SD2A 2GBAA 2E56A 3KFVA 3QZWG 4J3SA 4MMLA 1FAKT 4JZNA 1CS6A 1G7MA 4MMXC 3BWZA 2YQ3A 5D7IE 3RNKB 5CAYB 1IRXA 5I73C 3QDJE 3A8MB 4Y1SA 1WNLA 3FHEA 5EH1A 5B8CA 1VHPA 1T21B 4JN1H 4KUIA 5FAAA 1T0MB 5LCVL 1N6UA 1T22B 2VUBA 3TN0D 2EKHA 2IG2L 3PU7A 1LP9B 5ICXA 4HF5H 4HUXA 4QRSB 4PNOA 4YO0A 5J11B 1VEMA 1R0CB 1KYDA 3Q1EA 4QRPA 3V5HA 4W9JC 3VG0L 1OSPL 3GRBA 3GT6A 5C0MA 4XCEA 3ZUCA 1AHWA 1E3FA 4R90L 2GJ6A 1A6VL 2WLYA 3THKA 2D0HA 4NQXA 4XX1E 2LVCA 3P4LA 3AXLB 3H1ZA 5FGBC 2ZE0A 2ED0A 4XVTL 1QBML 1E7VA 2F2XA 1YMMA 3VXTB 1A9EA 2F2HA 2FT8A 3QIBC 1Y07A 5HI4C 4WI5A 3BH9A 2VXVL 4K8RH 2JXMA 2VDRL 4I18A 1HSQA 2DQIH 1S9VA 4KQ4L 5AZEL 3REWB 4XGZA 4NL3A 5GHWH 3ZOAA 5F88A 1KGWA 2IH9A 4G5AA 2DQTH 4E9VA 2VXTH 2QG9B 3PMIA 1J1XH 3DX7B 4CGUB 3ZR5A 1QFWM 1HHIB 5T1DH 1WDXA 3DWTA 4PJAA 4X8XA 3BVNA 1H8OA 3GJEB 4ZAKB 2KSSA 1CG9B 1FNEA 1XCQB 3LRLA 4TVPL 4F2FA 3GIZL 3GM8A 3SE3C 4IBSA 2P26A 2XFGB 4XPTH 2ZCHH 4NQSA 2J43A 4PB0L 4JPKH 2B1AH 2C26A 2EZ0D 4BQ8A 3LVTA 5DLML 5JO5A 2W07B 4XC1L 5GISH 2EADA 3U30B 3HN3A 5KVEE 1I3UA 1QPPA 1RZGA 2M0YA 5IHNA 4NFCA 4CKVX 5EC2B 2AMUA 4PVLA 1ZSZB 1GGUA 3UZQA 1RLWA 2NY5C 2X6MA 3X1EA 4UT6L 4D8OA 1U2HA 1QG3A 2KRMA 2ITCB 2GBTA 3IS1X 1WLPB 3KGRA 5IQOA 1AKPA 1CE1H 3CFCL 2FO4A 3NFCA 5CZRA 1QLYA 1DSWA 1XVSA 4JKPH 3JV6B 4OLXH 1ROWA 4ALAL 1KXVC 3WXWH 4XRCB 3UZEC 2X4SA 3MRMA 4AGQA 1GGTA 3EDJA 4A37A 3CCLQ 1BCIA 1EAPA 3M0SA 1H92A 1DVTA 1EFQA 5GGUA 3PG2A 3U79A 5J6HA 5FGCE 1HCFX 5KSUA 3LIZL 3VXNA 4BV1A 3LH2H 1SEBA 2DICA 3DX0A 2F8OA 1G84A 3VH8A 4UT9L 2WXLA 3Q44A 4AGLA 5C0CD 3TWCH 2VZUA 1JFQH 1IAMA 3D8MA 3G6JE 1RAGB 4XMZA 2BRRL 3U7YL 2IWGA 3CZNA 3LKRA 1EUTA 1XF4A 3MLYH 4KOCA 3ECBA 3PQYD 2UXGA 4PJGA 2Z92B 2R83A 3GMRB 4JZ3A 4TUUA 3EHBD 5CCGE 3WL9B 4EZMA 2AKRB 1D7CA 1F1AA 1P5UA 1QFOA 1YEHH 1FZMA 2HAZA 4OCNC 1NMAH 4GRMB 4AQ1C 1HH9A 5F7EL 3UTPE 5TK2A 3I6KB 3BKYH 1EUUA 5FRNA 4N0FB 4XO8A 3G4SQ 4HBCL 5IM7A 3TYFA 1TUPA 3NN8A 5ECAA 4K4KA 2H2SC 1E4XH 1E28A 1NZ9A 3OMAB 4C5HA 4HEPA 2IO5A 2EPDA 4M4RB 3NFPA 4HIHB 3VDAA 1IGJB 1ZV9A 4Q6IC 1RMFH 4DGUA 1VFAA 3QVAA 1NCHA 2DIGA 1TSRA 3L3IA 5E7BA 2O6PA 1KHCA 3VM5A 5EU6D 3BVDB 2BJML 1DQLH 2ZUSA 2QV2A 1VQMQ 3F12A 2JI3A 4PRPD 3ECVA 4GOSA 1M56B 4AENA 2OBGA 2OR7A 1EXUB 3HG5A 2AEQH 2AXFB 1MFAH 3LRGA 4PTTB 4XPAL 3BEVB 4OCSH 5CILL 5EORL 4Z78B 2D03H 2XXFA 3WNMA 4UI2A 4BKLA 4KK6C 2UWEF 3ARPA 4H5SA 3UGEA 5CSZB 3LKSB 1YLBB 2P24B 5I1IL 1HWHB 3ENEA 1IM3D 3MXVH 2GC7C 3FN0L 1ZLUK 1A2YB 1YEEH 1A7NH 2BFVL 2JKJA 4LLVA 1CBJA 2LT9A 4LIQE 1VADB 4P2QB 3QW9A 3N42F 1CLVA 3WS6A 5DVPA 1R3KB 5JORB 4G43B 4MAYB 4DBQA 1J3TA 3CPWA 1COBA 4HJJH 5A0DA 2R69H 4L59A 2R1WA 5J3HD 1OT4A 4M7AC 3E6HA 4AI7A 5BOJA 4P3DA 1TJHL 3MRBA 1QVPA 2MPAH 1DVYA 3WEAA 3F7VB 3AMKA 1EA9C 1JRHH 2WCSA 4KVCH 2BP5M 5DLQE 1B0RB 1Q8MA 1YNTB 5IBTH 43C9A 1XTDA 5HDQL 3OPUA 4JY4A 4I77H 2QPSA 3U1QA 4BE5A 5FLVA 3OYIA 3BHBA 4PGCA 3K2IA 5CSBA 1FG2A 2ESVD 2R59A 4KXCA 2K4AA 4RGMB 4S1DD 4E9WA 3CDZB 1Y96B 2I9LB 3P3SA 1MAJA 5F1KC 4X7DC 3ZIYA 4Y4KD 2B59A 2YRPA 1TITA 1PKTA 2COWA 2DIJA 4UTAA 3J7AF 3M53A 1EFXD 1HDMB 2NTFB 3ARED 1VACB 3FFDA 1OX9A 2N59A 4JRYA 2I69A 3QFJA 3MRIA 1YEDA 1PHTA 2DTIA 5D6WA 3VI4B 2X09A 2CP3A 3UFIA 1OB1B 4FLSA 2CKKA 4NO5A 1T04A 4ZXBB 4D0DB 5FKPA 1N0XL 2E5KA 1VFBB 2AFNA 2B20A 2FBJL 3BGMB 3CHOA 4U3SB 3TT1L 2HQEA 1F8TH 5F7AA 1MVFA 5SWQA 3TN0A 2B3IA 2LHAA 1UCBH 3QRGL 3WJLC 3FQRB 5I1EH 3UPAA 3QG7H 3NSDA 3FQTB 2XTLA 5ID1B 5L9DH 2E5EA 3DIDA 3OX8B 4N86A 1I9IH 4F91B 4RMOA 2AI0L 1W0WA 1NCCL 2R69A 2JZ2A 1LWHA 4HK3N 1IE4A 4KU1A 3V10A 1BPLB 4ZUVB 1U30A 4RZCA 1ZD6A 1LEGA 2VLJA 1OTTC 4LLWB 2F5KA 3QNZB 3CFJA 2J7LA 4G6KH 4OFYA 3O4LD 4F7UA 2ZNWA 5CCKH 2D2OA 2DN7A 4O4YL 2CSIA 3B6SA 3GXPA 5KYYB 2C0IA 5FGRA 5I5RA 5SV4A 5AOZA 3K6SB 3PV7A 2BIHA 4LLMA 1BJ1H 1QI4A 2AAAA 5CF3A 4G7QB 2LX9A 2BLFA 3H9SA 3QA3B 1M3AA 4FW1A 1M90C 2O88A 4C5EA 3LKPB 4L5FE 1IQWH 1A1NB 3H9YA 4MVBC 2IXQB 1WBZB 3PE0A 1DJWA 1BQ5A 2A6IA 4A4GA 3KJ6L 4K5MA 2IDQA 3QQDB 1HFUA 3QXAB 3P40A 3L3OA 2YARA 1RZ7H 2ZOOA 3M0PA 3DX6B 4Y2DD 3VFSA 4KMTL 1C08B 4CC3A 2ID5A 5GGRB 1BEYL 2E5QA 1NIAA 2ED6A 2OL3B 4GPVA 4L23A 3DMMD 3VI3A 5BW7C 3QUIA 1ASOA 3RAJH 3C12A 1P84K 1IQDA 5FLXE 1U4EA 4KKRA 1U8IB 2R2BB 2K7AA 2B08A 1HI6B 4L0ZA 5AW3B 4H2AA 1OEBA 1QQJA 2K78A 2J8OA 1V3LA 2D0QB 3BP4A 3RA7L 3WY3A 4ZFZB 3T9WA 4OZFH 3DTXA 4NYLB 4C56B 4ATWA 2DQCL 3LV3B 2ZXEB 4OJCA 2NY3B 1WTLA 1A22B 3ECWA 1IAKB 4G80B 2GJPA 1OP4A 4N3TA 1JGLL 3CX2A 3CVBA 4DP8X 1JF1A 4M3KB 1I8KA 3TFKD 4XCFH 5DHVH 4HZLB 2H41A 2EDQA 4C5IA 3LX7A 1CL7H 3PE9A 4TVSa 4HGWB 3NCJH 4P23D 4DVRL 4YSEA 1SDAB 3HKZA 1AQKL 4ZMOA 4JFXA 2HFGL 3HE7C 4ODXB 4U1SA 5IB3A 4HXAH 3L9RA 2X7LB 2EGAA 1X4ZA 4JS5A 3O3BB 4OAWB 5HD8C 4KNSA 4XODA 5C0CA 2X4JA 1NJIU 1ETZB 2NUZA 1YJWQ 4IS6A 3LEXB 5IBLC 5C09B 3H6AA 1KGXA 2YC1A 4L37A 3PQYA 5TE4L 5I28A 2V8KA 2VKXA 1U8RA 2AK1L 4GQZA 5E8OB 4H1LG 4GP4B 4KAQH 4AIZB 4BSVB 3FUDA 2L7JA 4OZHA 2DJZA 4BFJA 3BZDA 3R1GL 1JS4A 3BW9A 2NYSA 4M78D 1FSKC 4I4WA 2DF3A 4W93A 5D71L 5JMRA 2FO0A 1GS8A 1I4FB 4TPRH 1WHOA 1MHEB 4NJAH 1NKRA 4MA3B 1I1JA 3I9GL 2AV7A 5IB1A 1QSEB 1WAAE 4M77G 3WFZA 1OPLA 1EO8H 1S7QA 1H6UA 5TE7L 3DUHA 3IRZA 3OS0A 4RDBA 3VXUE 4ZTFA 3AY2A 1CZ8L 1OQXA 2FGWH 2FX9L 2QV4A 2J3SA 3M1BA 4YDJB 4BGLA 2Q10A 4J3OD 5IXFA 4UDTB 4AYID 3EKCA 5EZJA 4N1EA 5DO2D 3U9PL 1Q82C 1F45A 2A5UA 2CO6A 3ASWA 1AG6A 1TG8A 2WP3T 4JQVA 2XFXB 3NABH 4PRPA 3DC0A 3U7AA 3CDFA 4LHQB 4LSQH 5DT1H 2YMTA 1XJWB 3HR5A 5DSCA 3ZO9A 1KELH 3NFNB 1QRND 5C07E 2KT6A 1SVBA 1CDUA 5CJ5A 2XWCA 1Q1JH 1AZNA 4LOVA 3CHXA 4LP4A 2AQ2A 4ELYC 2HA1A 2ZP8A 4XXCA 5AVWB 1IM3A 1NLDL 4BGDA 4ODHL 4R97B 2XX0A 3CCVQ 4PRBB 1U1TA 2ESWA 5E4AA 3SYAA 4ONFH 3WO3B 2ADIB 3D18A 3SGJA 5BVPL 2BSRB 4BCXA 4TTGA 3JAME 4AQ8C 4ESRA 3WSQH 3Q48A 3H85A 1PG7X 5IK3B 3W5MA 1C16A 4MAUL 5FRMA 3MEUA 2BXZA 2WBJC 2GABA 2PCPA 1R75A 3WMPA 3FPXA 5KSBE 4DOHE 3ZSSA 1U8CB 2Z1KA 1LE9A 5CZVH 1KYAA 3RG1C 1AO7D 2I07B 5HGHB 1O9WA 2ESVA 3HS0B 3I3EA 5CXPA 3GDCA 2X0WA 4MDRA 1Y7XA 4LBEA 3UTSA 1I7UB 4ZNEE 1KQSP 5D7LB 3T8XB 3B2VH 2DLHA 2YPLB 1HNFA 4BDVB 4DO6A 2HT4D 5LJ5f 4WI4A 1WHMA 3BZEA 2E7LC 2XZAL 1MCOH 1T5XB 3VQMA 4QVDA 4ZFQA 1EFXA 4YR6B 3MACH 1NG2A 4O51B 4UOJA 5I6NA 4YSSA 1SDDB 4U3HA 1JZDC 3LPOA 2DL4A 3D05A 3FONA 4UV7H 1YEGH 2DRMA 3UYRH 2J5LB 1A5FH 1NEZB 3JWDC 2XX1A 4J3WA 2XJKA 2GK0B 2CLRA 2BP8A 2K8MA 3AXHA 4JM4H 4JQXA 2W0FB 5JZ7D 3VCLA 4WKZA 1NUFA 4QO1B 1NPPA 5I8EA 3PWVB 4ZMPA 2DYSB 2HEQA 1V7ML 3T4AA 2BHFA 5GAOm 3RB7A 4JHBA 3QDGD 5C2UB 2CLVA 4HS3A 2Q86A 2B9BA 4RSYA 5JIPA 1UATA 3GTNA 2Z0UA 2DLIA 5CUSH 1WK0A 1GMIA 5JHDB 3CCJQ 3KZ8A 3KUFA 1KC8R 1AEYA 3P2DA 3C08L 5ANMB 3QR1A 3WFHA 5I1GL 1IC7L 3UJJL 1DYZA 1AGEA 5HJ3B 1A1MB 5TF1L 1RY7B 4HLZH 1RLQC 4F80A 3OD3A 2BWIA 2XWBB 4WI6A 1GCQC 4KXBA 5MERA 3D0AA 3IS0X 5AL8A 3BMWA 1VYUA 4J9DA 4H40A 4X98B 4F33A 2ZKHH 3F70A 2B0SH 2J72A 4WIQA 3W9EB 3WFEL 1UFFA 4W9LC 4XK8E 2OMTB 3MRQA 4HIEB 4K2UH 3ULUC 4AVHA 2G60L 1WJRA 1JNHA 1TQBB 1C5CH 2VM9A 3MR9B 3BN9D 2X6VA 3SE4A 3MV9B 1WCQA 2QEXA 4YBLC 2AGJL 4Y2DA 2JMAA 4UNIA 2IC2A 1MELA 4PR5A 2G2NA 2GVYA 4OR1A 5C0GA 4ZPVB 2FEJA 1XF5A 2WUCH 4OGAD 3MTRA 3DMMA 2LFEA 2ZG3A 3KPRD 4X5RA 2E7HA 4PG2C 5LJ3d 1AQ8A 3FRPA 2WIMA 3AQDA 1CLOH 2HH0H 3OKKB 1MCLA 2WQXA 2F1LA 1I8LC 4P4RA 5DRZB 4GI9A 4KDTC 1AQDB 4KV5F 5CLZA 1UVQB 3LX9A 2ZOUA 3CXHK 5MHSE 2XN9B 4YUEL 3GPLA 1UXSA 2FR4B 3RGHA 3VTMA 4J3OH 4J27A 3QDRB 1LQSR 2OZ4A 3UG4A 2HNIA 2WZ6A 3A1PA 5GRVK 2I27N 3O9WB 4QXUL 5CWSA 4PBXA 3HJEA 2I24N 3BMVA 3QWXX 1RU9L 1J1OH 1WX6A 3M0TA 2OI9C 5DVMA 3N1QC 3BUPA 1BQUA 2EIJB 4NQUA 1MFVA 2FX8L 2IANB 4P23A 2Q8AL 2C3HA 2D73A 2GCYA 4AGOA 5AWNL 1UGPB 5B39A 4X9BA 2MHAB 2WXNA 3VTTA 1QBBA 2BWQA 2PVGB 3NJHA 3BPLC 2QFPA 3FT2B 1GPOL 2X1PA 3AM8A 4KI5F 1O7DC 2VLRB 3OBWA 1RJLB 2MWCA 3RRQA 3S2CA 3MLWH 4AW7A 3E9GA 1KJWA 3F7YA 4FI8A 5HHPB 1NGWA 4OZFG 1M4ZA 3FTWA 4X6DE 5A6MA 3CGTA 1BIIA 4JFDB 3ROLB 2FL5B 4M78A 2MYSA 4QRRD 5CHNA 1E5YA 5CKDA 1HSAA 3O41B 4ZOAA 2HN7B 3FDRA 5MEPA 4E2OA 4NUJB 3F58H 3QEGH 4MNQA 2WLMA 3A6CH 1AMYA 2Y5EA 4HC1L 4N6RA 1MHNA 4N0CC 1CXIA 4NNPH 3V4PB 4OZGF 4K3DH 2NY1B 1G87A 2F53A 2OYMA 5EN2B 4HKJB 2DRUA 1AXIB 1Z7JA 4N0UA 4TMPA 3IXAB 2P0KA 4HU8A 4PRAB 4J6YA 2X40A 1UJ3A 5LJYH 1AS6A 3VRJB 4BEIA 4NCDA 2EKSB 1MXDA 3C6EA 5DLLA 4M7DC 1R8OB 3FOLB 4G6FB 1M8VA 1AD9A 1ZSZC 1E43A 1WYXA 2FNBA 3HI1A 3OJVC 1CO1A 3TTYA 4ZW5A 3FB9A 4FTDA 1KQ1A 2PWEA 1QRNA 4QRUB 2ATCB 5F8QC 3T3PB 5LWYL 4GXVL 5IB4A 3RE0A 5FUZL 3TYGH 1AYRA 4JO3L 1NWPA 2G9KA 4L4VB 4LPTA 2NY0D 5F9AC 1N6VA 2AHJB 4R96B 4MXWL 1MJ8L 2RA1A 1GOHA 2PQWA 1QR1B 2EVGA 2WXIA 1S9WB 2XKNB 3PWLB 1TLKA 4QTIL 1SN0A 1OGAE 1CLCA 2GBUA 1PKOA 3P9MA 4D9RD 2NNAA 1P53A 3DX8B 1VFUA 3LZPA 5GRVL 3QZLA 1FIEA 2NZIA 4YHIA 3JWNG 1R3JA 2BDNH 5GZND 1KIQA 5D2LB 3TV3H 2X42A 5LJ3h 2FWSA 3IGUA 4AG2C 3GKWH 4K3JH 4LARL 1TETH 1DP0A 2JM8A 2CDFA 4IU3B 4KMLB 5CKGA 4X4YB 4ZZKA 3SB3A 3TONA 2YQ2A 4Z7QF 4QXGL 1EANA 1IBDA 1DEDA 1TZIB 3UCRA 4OMFB 3ZL1A 4H25B 3UPUA 1AO7A 3MGOB 3GBML 1HZHH 4MCYB 3L1OL 4QOKD 3MV01 2IPUK 5ABAA 4Y5XC 4BDYA 2HG5B 1P9MA 1ADQA 2E27L 3HMXH 4HIXL 4RCAA 3RVXC 1FCGA 3NIFB 1GCPA 1KCVH 2VAJA 3CBJB 4HG4J 1LDPL 1W0VB 3IJSA 1BYNA 4WY7L 2E86A 1SXCA 3K2KA 1IGCH 3IPFA 4W9FC 4Y4HC 1H3PH 1DCLA 3QQ4B 4JDTH 2XD0A 3AACA 4POZD 2OA9A 4FX5A 5IHBA 3L3GB 3JUYA 3MRPA 5GJTH 1A3RL 3V7MA 1T2QL 3JWDL 5AYTA 1R77A 1Q94A 1MH5B 3U6XA 3UP6A 4LEBA 3FO9B 2OJ1A 1YNTF 2GQHA 5D6CB 3WNJA 3ARFB 4ZMVA 3QDGA 5L2JA 4PLJD 1XR8A 1M5Q1 2BIIA 2DIBA 2NYKA 3UDWA 2LVEA 3SZKC 1EJOH 1MJUH 2PWDA 4JDZA 5BUPA 4HOXA 1X5IA 3V8JA 2GSMB 1PU0A 2YRCA 3HFOA 5JIIA 3BP7B 3UTZB 5IOPA 4FABL 1WFWA 3GSOA 5CINL 1FH5H 3U82B 2DLGA 3O2DH 2VVKA 2Q76A 5CFHA 5SWSD 4NKQB 1PSKH 6AT1B 1QSVA 3MRNA 3WE6B 3V7RA 3AT1B 1I9JL 4FLRA 5E6ID 3ZY7A 4LDYA 2EEFA 4GG6E 1VF5C 3NZ8B 1SLUA 5F7FA 4GT0A 5ILTL 1P0SE 1Z9NA 1WPYA 2QKIC 5B4MC 1E9OB 1Z9PA 1W2BA 3Q3GA 2Y36L 3BWAB 3T0EC 3DI3B 4FQXC 3PVLA 2O61A 1M2VB 4E9YA 5AZUA 2GJZA 3CMAA 1ERNA 3ULUL 1FLRH 3CLFH 2EGCA 4RRPM 5CCJA 1JGUH 2UY6A 1NM7A 4AYFA 2EW3A 2EDXA 1RAAB 4C92E 3A3YB 1BI0A 5HK3A 1J86A 2GT9A 5B38G 3CFTA 5KVMC 5HP5A 4BI4A 1P2CA 1D9KB 4JFVA 3RWGA 5KCOA 2FIRT 2GIMA 1WQWA 3MNMA 3R4RA 3KPRA 2XDDA 4N2KA 2KBTA 5GS0L 3EFOA 1SJHA 2F69A 1JXKA 1MHCB 4TQIA 2ENSA 1QI5A 1NCNA 4HIJA 2C06A 1U95A 2YK1L 2COQA 1WTGT 1G7MB 2X88A 4O58H 2AJ3B 3TGXA 4PGEA 3BVTA 4LSTL 2FWUA 1DJYA 2QSCH 3V0WH 4PJ7B 5B8CB 4B9PA 1X3DA 2K5LA 3FH7A 1WAEA 2LX7A 4RCBA 2H9GB 2IEPA 4M48L 4JFQA 5ALBL 3MRFA 3O2DA 3AFLA 4I85A 1IHVA 4DEYA 4MMZC 3CCMQ 1YJ9A 3CZSA 4QLRA 1LILA 1R46A 4U1LB 1L9QA 5E51A 5TTRA 1RH8A 3GZKA 3BUQA 4BWWA 3GLZA 1G0DA 4GRWH 2FECL 4PSRA 4C59B 4EDXA 1BBJA 4PCYA 1AWWA 1K4DA 3MBEC 4HPOH 3S96A 1I8MA 3VXSD 3HZYB 2VXQH 4XCEB 1HE8A 4R9HA 3O11A 5EEUA 1S3KH 1M8MA 3VYGA 1GFDA 1OPOA 1QAWA 1J05B 1AY1L 1SYSA 1RZQA 2GJ6B 3GHBH 3IJ8A 3MA7A 3P3RA 5MEQA 3P9WB 4P2RE 3E8UH 2MWOA 4L8BB 1WFNA 3OC8A 4NQXB 5D2NC 4U1HA 2DZEA 5DJZA 2BIVA 4Y2NA 2XDPA 4KJWC 1YYMH 5I8CA 1XF2B 4RWHA 4ZUUA 2I9TA 4KTDL 3BH9B 5AW2B 4TTDC 2ALAA 1RUPH 2X1OA 3OJMB 2WQUA 5C70A 4QRRA 2PVOB 3WE1A 3VXME 3F5WA 5A40E 2FH6A 1E2WA 3JCMb 3UABA 3CC1A 1AANA 4ZO7A 3UAFA 4AWJC 1MRCH 1QLEH 2VASA 2KMWA 3MJ7B 4I0PA 5LJ5j 5IF0A 1OAUH 3F65A 3UAJC 2Y2YA 1MJ7H 3UJTH 4ZUSB 1D6EB 3O8XA 4M7LT 3PF2A 4PJ5E 3RBBB 1FNEB 2J8UA 3QQ9D 4OU3A 1KTCA 3L2WA 3GUFA 3WGUB 2E10A 3TEWA 4E0RA 5JO5B 4ANKA 4J9FA 2AVGA 2RJEA 4IRZH 1X75C 4AXWB 5IVXA 4ORZC 2WLKA 2DKUA 2DPPB 4CRIA 1DN0A 3R06A 5DZ9A 4H0LC 1I1YA 2MOQA 4FADA 4XZUA 3PV6A 1FNHA 1K8AC 2IBZX 3FOMB 3ZKXB 2P84A 2VXQA 2WZ5A 3B2XA 5L88L 4ZS7L 4XNZC 3O2WH 5E94B 1NBZA 3F3HA 4ZQKB 3IM1A 2K2VA 5CQXA 2YZ1A 2PF6A 4KGXB 4UCFA 4YDNA 5BO0D 1REIA 1LO2L 1PZ5A 3WOVA 4YHLL 1LLAA 1A14H 1T1ZB 3VWJC 1S7SB 3F64A 5DEFB 1A4JA 4MNGB 4RA3A 1ZLSH 2AJSL 4RWYL 4XT1C 4DO4A 3VRZA 1RFDL 1KUMA 5KSUB 4F7EA 5GZNA 3CBKB 2B5IB 2ZPEB 3SJVE 1T4WA 4WU7B 1PNDA 4G2AA 4R4BB 1BBDH 2F68X 3V8CA 4X5WB 4TLKA 1T2JA 3O6MH 4L8SB 2G5RA 3GI9L 1XT5A 1BQLL 5CEZL 2XIDA 1QYGH 4XVUD 3NSYA 2FEIA 1PKQA 1XF4B 1CKBA 4J6RH 3WMQA 3WS3A 3RJOA 4D9LL 2ZKMX 4M5YH 4C47A 4DOWA 1ETA1 2ZOTA 3TBYA 4F5CE 5DWUH 3BRFA 4DPAX 1HXKA 4G7RB 2HFFA 3APCA 2Y06H 4L1HA 2OTLT 2QTXA 2HKAA 1ZDSA 2NQ3A 4NIYE 1P5UB 1OXYA 4FQLL 2VUOA 1XTLA 1RZFH 3SYCA 2YS4A 1HH9B 4OCYH 3A8GB 1YPZB 2ZOLA 1HN1A 1K73U 3ZT5A 1YYCA 4OJAA 2FE0A 1N27A 1MRDH 1XIWD 2