3C12A

Crystal structure of flgd from xanthomonas campestris: insights into the hook capping essential for flagellar assembly
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
138
structure length
138
Chain Sequence
DQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAATSAGFVNFEITDANGTFVKQLSVPASAAGEVSFAWDGTDANGNRMAAGKYGITATQTDTAGAKSKLATYVDAPVDSVTIGSDGLYLNLTGLGTSPLANVLRVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein
publication title Crystal structure of the C-terminal domain of a flagellar hook-capping protein from Xanthomonas campestris
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Biosynthetic protein
total genus 24
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
A PF13861 FLgD_tudor FlgD Tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.910 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3c12A01
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3c12A02
5K5YA 3OSVA 4ZZKA 3C12A 4ZZFA
chains in the Genus database with same CATH superfamily
3BVNA 1A3QA 2GAZA 2BMKB 4MZRA 2R8SH 4WK2B 2DK3A 5CR1A 1WH0A 2IJ0C 4WI8A 2F19L 4KNTA 3IETA 2CKBL 5KOVC 5IFAL 4JFED 5ITBH 2OK0L 2KQNA 5CFHA 1VSCA 2D2CC 3WKMH 2HFTA 1DZ0A 1NMCC 3N91A 5D1QA 4PP2B 4YGVA 9CGTA 3AQXA 1AS7A 3ILQD 3U46B 4XMPH 4NKOA 1QVOB 3K2UL 2B20A 3LKPB 1V5JA 4Z7QF 1TZ8A 4OLZL 1LEGB 2O61A 2JB6A 5EN2B 5CCGE 3ETBJ 3OAYK 1ZSDB 1K4CB 2O6PA 3C08L 2I69A 4HKXA 3CFEA 5A3IC 2VZVA 2KI6A 2KSSA 1LP9B 3CX5J 4XCFL 1TQBC 4Z6AT 3IJHB 2AV1B 4KGZB 4AKPA 1E8XA 3TP4A 1V3MA 5AAWA 1MJJB 2FGWH 2ECZA 2RHEA 3HNSL 3HA0A 2NLJA 1TTBA 2F5AL 3A3YB 2DTIA 1W2BP 1KJ2B 5MENA 1JGLH 4NHUA 1Y71A 2FAUA 3SGEI 1LILA 5GS0L 1ED3A 4Z88A 4K2UL 4JZOA 3KDMA 4IRSC 5CO1A 2YD3A 5IEKA 4AITA 1DDHA 1XNIA 3BAEH 1YNLH 5E0FA 5E24E 1AD0A 2NQCA 1B0GA 3CG8A 2ARWA 5HI3D 2G2RA 1N64L 3I5SA 4I5BB 4ZXBB 1K85A 4JY5H 2YHGA 4KKQA 1OARH 2ZSWB 3UZVA 5IW3A 2E9WA 2K0RA 5J6GB 3HCVA 1BI0A 4AYFB 5TQ2H 2MWCA 3E6HA 4HLZG 1D0ZA 4RA0C 2ICEB 5KSVB 4NX0A 2IEPA 1AI1L 1P1ZB 2MEJB 4WEBL 7FABH 2TSAA 3KBHE 1N0XL 4G5ZH 1XCWA 4UDTB 1URLA 1R0AH 3T4AB 2BDNL 3WO4C 4FQXD 2TAAA 4GAGH 4KHTH 1ZDQA 1X01A 4KOBA 3ZXAC 1PDKA 3SYAA 2PF6A 2OX7A 4NJ9L 2VWFA 1R9FA 4CU6A 5C07E 3CC2A 3Q3GB 2DTOA 2O1AA 5C08E 3M88A 3ES6B 4RSYA 3QDMD 3TJEL 2K5LA 4X6EA 4X6DF 2BIHA 2N1TE 3ATAA 3SWNB 2DBLL 3JCMP 3KWTA 3LNHA 2IH1B 3T0AA 4ANXA 1IIIA 3P30H 2VZTA 4PFPA 1FFOB 3MRRA 3FQ4A 3CC2Q 3MCKA 1X9UA 3L3GB 4WUKH 4EN3C 1WHHA 4FTVB 1RIHL 1VQ4Q 4MB1A 4N8CH 1SPDA 1X75C 3ECWA 4RIRB 3OYAA 3K74B 4YOKA 1FLRH 5FU6B 1WITA 1NGPH 2E47A 3WN5C 4S0SD 1X27A 2R51A 4KNQA 3F3HA 4MA1C 1ZJAA 1PSKL 4ZMYA 4RA3A 3CE1A 4FL4B 2MHAA 4PJ5A 5E5MA 5MEOB 1JPFB 3BRFA 3V79C 3MACH 3UTSA 1HHJB 1WFIA 1NJIU 1S7TB 3VG9B 3QVAA 4PG9B 2RK1A 5ID0B 4KI5D 2XV6B 4ONGH 5AW2B 4AKOA 5ACZA 3FFDA 3MRPA 4L4VD 4JPVL 3NFCA 5JR1L 3NJXA 3IXTB 4YHIA 2IADB 1A21A 2L7UA 3T0EA 4J5VA 1LO2L 2JIXB 1LEIB 1KHIA 5J11B 1EJOH 1XD0A 3UMNA 1Z9PA 3LVTA 2XTJE 4ODUA 4TSAL 2B39A 4M7JH 5LO7A 1IO6A 4OSUL 3HMWL 3F04A 4GO9A 1R3HB 3F84A 1IGIH 3IU3B 4U6YA 4S11A 4YHNA 2AI0L 2K3YA 5TGBA 4M6OH 2B77A 4P99A 2BNQB 4WEUD 3AGVA 4HCIA 2GJZB 4M7AC 3L1EA 2ATKA 2DBJA 4KX7A 4OAWB 2GG1A 1HQRA 2N59A 4HHWA 5E9DB 3BUYA 4XPHH 5CZRA 4J28A 1OE1A 2HB0A 1P7KA 4BQCA 4BDYA 3HN5A 4A6YH 2DL2A 1M7IA 3IDXH 3UTZA 1JVLA 2XQYK 4JCMA 3GBQA 4KMTL 4A4FA 1OM9A 4Z7VB 1J0HA 4FQIH 1CDBA 2F2XA 3CC5B 4XXDA 5KVGH 2HVKA 4M1DH 1HINH 5D1ZB 2FEDC 2H6PB 2A4CA 4MMZA 1FX7A 3DROA 4L3EA 4MX7B 2Q7YA 4QI3A 1BQLH 4F9LA 2XV3A 4HH8A 4PJOG 1R4XA 2FG0A 2DAQA 4XU1A 4C92C 1BAGA 2ICWB 3VXME 1A9VA 2A38A 3OSKA 3WFEH 3X3FL 5FOJA 4FOMA 1R19A 4AW7A 4NQXA 4P2QE 4PJ8D 3W82A 4U6XA 3TYFA 1A2YB 1U8NA 4DSYA 2BNRD 5IMLA 3GXPA 3G6JE 5ABAA 3BAIA 4FXKB 5ANME 5ILTH 4OLXL 2J55A 2MTPA 3R18A 3FKUS 2GF7A 3UDCA 4WI3A 4J3WA 4WW2B 1JZ7A 2ICEC 2RB8A 2VQUA 4YO0B 1KXQA 5LGHH 1EIFA 1JK8B 4W9ZA 2WSFE 2ZPIB 1HAWA 1QYGH 3GBNL 2AFNA 4WWNA 4D3CL 5JHLL 3VVVA 2CH4W 4E7IA 3NIGE 5EU5B 3AB0B 3IRCA 4MXQD 5CINH 4C5HA 4OCSH 1NM9A 2IAMA 3HSBA 2ZX9A 4K8RH 4OD3L 4OT1L 4UV7H 2ZOTA 5EBLA 5HSFA 2OMTA 3M1BB 1KV3A 1BIBA 4YMPA 3D2UA 2WSCE 4MAZA 3B2UD 2F7OA 3IDNA 4Z7WA 5GRXG 5H94B 5I24A 4ISVB 5DEGB 1DVFD 1D1AA 2QDWA 2ZZUT 3FL7A 5D7EA 4I2XE 2IWFA 3UPUA 3QG1A 3WJLA 1EDYA 3BFMA 4O2EB 3GSWA 3A6CL 4HT1H 2X6BA 3ZL2A 1NC4A 4DO6A 2E6PA 2WYTA 4PJ9A 3V7CA 4FQ2L 4NN5B 1AMYA 1FJ1A 3MYJA 4QRQA 3VI3F 1U92B 5KTEH 3V4PL 2JKRM 3RI5K 4F57H 2CDGB 4EPCA 4GB9A 5FO8B 3AMLA 4KTEL 1N9SA 2Y1VA 2PETA 2BY0A 5D7IA 5L7XL 5FU6C 4NWTL 2HWZL 5I0XA 4BFIA 5B1JA 1S9XA 3PWVB 4ZOCA 4KMQA 2WXKA 2PW2B 1Y7XA 1JZ4A 2R56L 5KG9B 3HZVA 2XWTB 4XPGL 1T4KA 1JXJA 1BD2A 2CKBB 2J7LA 1FL3B 1FVCB 2IGTA 2QGEA 4FE9A 2XPYA 2DMHA 5IN1A 2DQGH 2IG2L 1KYOK 3C8HA 4GAAA 1HJCA 1IAOA 2A83B 5TFSL 3PAUA 3OSSC 5CEYB 4PFEA 3ZY7A 4AQ8C 2M16A 2MOVA 2NY2B 4YC2C 2A5UA 2JTDA 1M4ZA 5E8NB 1YN7B 4F80A 1H8NA 2R4RL 3MNWA 3CD6T 4N2GA 3KBEA 2DF6A 2BFVL 2FT7A 5B7EA 4GQ9H 1OQOA 2F6AA 2LRQA 2MQ3A 2JUFA 2KT6A 2DWTA 4P9HL 3SBWA 4Z8AA 4AI7A 1GOHA 4HGWB 1HEZA 4K0OA 1BW8A 1PX3A 4J3TA 1Q1JH 3FO0L 3I3DA 5I6KA 1YMMD 4I1NB 4LE8A 4F1ZA 1WA0X 2O6EA 2CM6A 4FQLH 3RWIA 4F7KA 5JMOC 1NEZA 1EJ6A 3LHPH 4HEPG 2GTWA 3CMOH 4M93C 1JNLH 2YFOA 1RURH 1NFDF 2BIQA 1MFEL 2DLPA 1LO5B 1JWMB 3BWUC 5A43C 1UASA 3CFCL 2FBJH 5A6MA 2I85A 5FU7B 5JTWA 3QJOA 1YUHA 5JZ7C 3GMMB 4LLYB 1MRCL 2OCJA 3BP7A 1NL0H 1F90H 3CX5K 4HJ0D 4DZBB 1XVSA 5K9QI 1HCZA 3L45A 3O4LA 5I18H 5DHXB 2HJKB 4TL5A 3V6BR 1PZCA 3I75B 5DU7A 4EOWH 3CSYA 1KENH 4TNEA 1MNUL 2PN5A 1SSFA 4JFYB 3CVHH 4M7DD 4PD4K 5F1IA 5DMIH 4W9GC 5GXBB 4DETA 2VDPH 5DQDH 4P3WA 1MOEA 5DJZB 1PAMA 1I1AD 3TLRA 4OMPA 2ZKHH 4WJ5A 4URKA 4LCWE 5FKAA 4BCYA 3G6AB 2YXVA 2HKFH 2VR8A 2VJ8A 3NGBC 3HHMA 4LARL 3F6IA 4RMVA 4WW2C 1YEWA 2R7EB 2C3WA 4M4ZA 5C0AE 1N7MH 4HV8A 4PJXF 3W0WB 3CLFH 5BS0A 4AJ0A 3B2VL 1IVTA 1GYVA 2A6IA 2WYZA 2F9BT 3NP4A 4XVSH 5E70A 4U31A 1AD5A 1FWZA 2NLUA 4EI0A 4HJUA 4RX4A 2F54D 5I1IH 4KO9A 1M1GA 3I50L 4Y19B 3LKRA 4H0LC 1R75A 2CALA 4NRYB 5ICZA 4L0YA 2GUOA 2CJ3A 3QZLA 4P5NA 4PJDA 4YL9A 3KFVA 5F71A 3RIAK 3WIFA 1B07A 5DJAB 3U0TA 4NQEB 3GHBL 1T22B 2YUZA 2FJUB 4IIOA 4MNGB 1T83C 3LCYA 2OTJA 3AT0A 3R7RA 3JCMJ 2DWDB 2VDLL 2X9YA 2WINB 5DC9B 2ZNXA 3IPBA 4ZFZA 1ACZA 3QHFH 1A6AA 3AXLA 1XJWB 4UBDC 4NT6B 1ZJBA 1NCOA 5IEHA 2ENYA 3ROOB 3B9DA 5LJ5j 2Y7QB 4FNRA 4YHOL 2ROTA 1YWOA 2ORBL 4IHBA 2YGQA 4XBEH 5FIEA 2CCVA 1F3DH 4JZJB 4J6RL 1IZ6A 2P8PA 4MNQE 3GZOA 1I9RH 3VXOA 1OGPA 3DSNB 3G5VB 3OYYA 3DX0A 3DO7B 5GZOC 3LRLA 4OCWH 4LDUA 2VLLB 2W80C 1M71B 1KWKA 1GZQB 3NJVA 5CHNB 4DEWA 4TUUA 2BHZA 4OFKA 3WXVH 1J0ZA 4RGMC 2OR7A 1B34B 3OZ9H 1IGFL 2FZ3A 1ID2A 3L3JB 1MFDH 3ARFD 4FS0A 4EAEA 2WMPB 4UQ9A 1G7JA 4P2QB 2XU8A 5KJRH 2DL8A 4J9CA 4KQ4L 3RKPA 4XTWA 1WS8A 2OPCA 3TO4C 4NQCB 4ZTPL 2YUVA 2Q2LA 3RWJA 5IZ7A 2FX7H 1F42A 1ITBB 3NZSA 3TCTA 1N6QH 1R5IA 3MOBL 3CHOA 5AW7B 4K71B 4XNUL 5KSAB 3H8ZA 3QWRA 4HXBH 4U1GC 5IR1A 5IHIA 1YEGL 1MJUH 1U6AH 2XWJB 1KCWA 1NBYB 3GD1C 4KAQH 2MIZA 1Y18A 3L1FA 2VQ4A 1J9SA 3I56T 5GS0C 3OB8A 3TYGL 4YDIH 5KUKA 4NSKB 4YDJB 3CPLB 1GA2A 4WTXA 4R56A 1GKOA 4L8SC 5HVHB 2X6MA 5LVEA 3BZEB 5TE4H 3CPWS 4OZHE 1BAWA 5ERWB 5FYLH 5K39B 2BP0A 4AX3A 3QRLA 2L3QA 2BVOB 3UO1H 5D7JC 15C8L 3CD4A 4OKVB 4XB3A 4Y5YC 3HG1D 1LXMA 3IMTA 1BZ9A 2MFNA 4DUWA 3BZEA 1PG7W 2ARJB 5IB4B 3W5MA 4PWJA 3WEBA 2N7SA 1NGZA 4OTXH 1D5ZA 4NNYA 4R4FL 3K6DA 3ULSA 4Y9GA 4RMBA 4Q4EA 2B59A 3V9FA 1KGCD 1MHNA 2I7SA 5J6SA 4Y4KB 3D85D 1WYJA 4UQ3A 3CDCA 4DQAA 5EU4B 5GAN6 3B6SA 3GHEH 3RVTD 4MYPA 5E1HB 2R9HD 2F15A 1JF5A 2E7HA 4EZMA 1LTXA 5JUEL 1FNFA 5L9DL 3LKOB 3MQIA 3O2WH 1WP6A 4JM2F 3SCMA 3SYOA 4ZMOA 2AP2A 5IESH 4AJWA 4TVPH 3OG4B 4KITB 3IS0X 4I48B 5DJ2B 2RHUA 4M7AA 4K8RD 3FTVA 5JPNB 3S37X 4F14A 3TX4A 1SQ2N 3EO9H 2UUDK 3UERA 3ARDB 4C83A 1JN6B 1N10A 3C5ZD 1NJIC 4E41A 4QRSB 3RVVC 3V4PB 4IW4C 5IJKA 3TO2B 2FATL 3L4XA 4HJJL 1CVRA 4DZ8A 5ACLA 2KHAA 1Q94B 1E9PA 2PR4H 3GRBA 1NAMH 2UZIH 2AK4D 2C3VA 5ECAA 1FPTH 4M4RB 5KVDH 3DVFA 3VKIA 4OGZA 1CLZH 2X4RA 5JYMA 3JSSA 3U2SA 2EVGA 1YQVH 4OIIL 4I89A 5MEQB 4C92A 3MRHA 3QDHA 4FFWD 1Z5YD 3VM5A 2H2SC 3DOIA 3VFSA 4A2EA 3K2KA 1T20A 2X1WL 1BGXH 1DP0A 3KPSD 3RG1C 4J9DA 3UAEA 1Q82R 4K5PA 4QR7A 4BH7B 5LJ5f 3LYIA 2HH0H 2MYSA 3GSNL 3PJLA 5IFHL 5FUCC 2MPXC 3CZLA 3MR9B 4W9IC 2A9AA 3Q8BA 1UZGA 2HG5B 1B88A 2K70A 1BDYA 3ZU8A 3MLWL 1F56A 1BVLA 1JQQA 1U2HA 3S3PA 2K6YA 4QXUL 5D5MA 3NH7H 1E9QA 5IB2A 1BIHA 2AQ3A 3DSFH 2J20A 1AYOA 3O2VH 4U6HA 3V0WL 4TN9A 3M4YA 1MY7A 2EW3A 3L5WA 4X9IA 4XX1G 1PKQE 4XMWA 3FQXB 1UTIA 2BVQA 3PWLB 5DVMA 1KJ2H 2OTLT 5G5DA 2YUPA 1S72T 3WAKA 1F11A 2EABA 2GKIA 1I5LA 4JG0L 1LK2A 4JFXB 4APQD 1RUQL 3NVQA 2DMKA 4OZGA 3TBVB 3OAUL 3VUZA 1VQOT 4U2YA 2MOQA 4Y1AA 1GYCA 2WLHA 3QDJA 5H37A 5DYOB 3HC2A 5KSAC 3JCMg 4AENB 2LGNA 2QDLA 4JR9L 4LNVA 5FA4B 1QVFS 3CPUA 1SMOA 4J3UA 1J9QA 2PPCA 1E5BA 2YMXL 4ZUSB 1UZ6F 2FUTA 3MBXH 43C9A 4NBZB 4C8QF 2X3AA 1G7QB 1H6FA 4U1MB 1WDAA 2JQMA 5KS9A 2RNAA 3KCPB 2JQZA 4HJ1A 2ADGB 2BWQA 3DXAE 2ZXBA 1ZT4A 5C0BA 2YOCA 1ZGLP 2LLLA 5D8JL 4BZ2L 3L08A 5HHPB 1S3RA 1A6PA 1I8IB 12E8H 2Y2TA 4JN1H 4XMKH 1QSVA 2R1YB 5BJTA 4BELD 3V55A 5FYJU 1KBBA 2B3IA 1R77A 1PCSA 3O3BB 2X4SA 4NZFA 3ZDXE 4M5YH 3CVCA 1UB5B 3H4FA 3SHSA 5B7FA 3J7HA 2BM3A 2QA4A 3QNXB 1DSYA 2ED7A 3QUYB 4FYQA 5C07B 3SKOA 1YNTB 1QW1A 4Y4KC 1F1BB 5C08B 3NFSH 4AQ8A 4AYGA 3JWDH 4EDWH 5EORH 3HAEA 3BN9D 1A65A 1J5OH 2JFCA 2J43A 1DJ7B 5T3ZH 5GIRA 2JLLA 4TF4A 2KRNA 3J8F7 2QLVB 5I6XC 3R0NA 1JEGA 5HDWA 2QA4Q 4F7CB 3LV3B 2UY6B 2SEBB 3NIFE 3VD0A 3JCMf 3D3VE 1OCRB 1PGRB 1TMQA 4F8QA 4FCHA 4UUJA 2PQWA 3LSOB 2YEZA 4MNHA 1D9KD 2ZPEB 5ESQB 2CO7B 2X44D 5E94A 1YAIA 5FHBH 5E8EB 5I82A 5F89A 5SX4H 3ZL4L 5JPNC 2EDLA 3ARDC 1OF0A 1VZIA 1JZHA 1X5MA 4MVBC 1XGQA 3KWWA 4RETB 1QSZA 2CZNA 2Q2EB 2DYPA 3O3AA 1H6EA 2BCKB 2H26B 2I5YL 2V9UA 2QAZA 4PJBE 2EDNA 1S7SB 2FLRT 5J3BA 2YAPA 3KYKH 4AE0A 3ZUNC 3LRSB 3T3PF 4I9XA 5DUMH 2GJ6A 4GUQA 4TULL 3B37A 4ODXB 3QZOA 3ZIYA 3IDIB 4FIBA 2OV0A 2X4OB 2J8UA 3HAEH 3PP4H 4Q14A 3HNVH 3EFSA 4AWJC 5KSBE 3VJ6A 4XODA 1VKXA 3F6LA 4X98B 4N9GB 2XTJB 4G9FD 2B0SL 3D69B 3MMEA 3VQ2C 2HQXA 1NPUA 4C57C 2DPPB 2RMOA 3ARRA 4NRZA 4PGEA 1JXMA 1WFWA 1JHKL 1MV0B 5C0MA 2W60A 3SE4C 2B2XH 4XBGB 4XN8A 1N67A 3WV0A 2VXVL 1GYAA 5A2QE 2HAZA 3KVQA 2NY0B 4LEOA 2YSTA 4Q74A 2FGZA 3N04A 1EGJL 3UO8B 4P9HC 3EXLA 3NABL 1LDPL 2CHNA 3EBAA 2B1HL 2V2WA 4PR5A 1XH0A 4D9RD 4D0BA 3DIVA 3SDAC 1BBJA 3UJJL 4JDZA 3LXCA 3T2QA 1ODAA 4X50A 3OX8A 4M78F 5JXAH 1QPPA 4G8IA 5LQBH 3TF7C 4KJYB 1FA4A 2ESWA 3L3HA 3SDYL 1UXSB 4A39A 3W9DA 2OJEB 2FRYA 3VXMB 4WDIB 1IGYA 2JWYA 5FYKD 3ME0B 3E0GA 5EZIH 2NW2A 5AW0B 3FNKA 4HF5H 3ZYZA 3KL3A 1H3ZA 4M75G 1Z6JT 3BEVA 3FQ1A 4GRMB 4LXFA 5EFIB 3SDDB 2VLKD 3US0A 3G6JB 5FB8A 2DQUH 3L5XL 5ANMB 3T04D 3GI8H 3CBOA 4IRJA 2DIGA 3WE1A 4M9PA 3HBZA 4X5RA 4JB9H 3DYPA 5FYLD 3M0RA 1IAKA 1GZHC 1MREL 4WI6A 1JSYA 4P5TB 1CSKA 2COZA 1XCTA 4MBRA 5AKSA 1MCJA 4EO5A 4MJ4A 5FW6A 3VWKB 3NIGB 5JW4R 1KQ1A 1L7TH 5GZOA 5DJCB 1RJCA 4OVUA 4TNWF 5F9OH 5GANj 2M1HA 2A6DB 5AYTA 1SF3A 3KPOB 4JS7A 4AQ1A 4OI8A 4GO8A 3WTVA 1RMFL 3A6BL 3D34A 3SY0B 3TZVB 2E64A 1P9MC 4LCCB 3QHTC 4RRPG 2ZXGA 2X4PB 1RUAH 2NNAA 3ZW3A 3ARPA 1FE8L 3CQFA 4I2XB 1KGJA 5CWSA 5CEZE 1J3TA 1IAIH 1IM9B 3ZQ9A 1U8KB 2D8HA 1ZA6A 3PMIA 2D7OA 4R5TA 1TZOA 1TZGH 4PRBA 2LU7A 5SX5H 4PW9A 3TO4A 3HLAA 3U7YL 4BCZA 3CMAT 4GRLB 3VD7A 5DLML 1J86A 3FF7A 5KW9H 4K5MA 4UT7H 3QDGD 1MHPH 3MV01 3LB6C 3QEQD 4MCZA 1QCFA 4P3CL 1M90R 3MXWH 5D7LA 3HG0A 4L8DA 2ZOOA 2WWKO 5MEPA 3I55A 2P80A 1HD3A 5I71B 5IG7B 5F88B 4YFEA 1A6WL 3GNFB 2YA1A 5ENWB 3WNNA 1IGJB 2F19H 4R4ND 1UWYA 1ZLDA 2CKBH 3MA7A 1MUJB 5IFAH 1ZVHA 3ZLQC 3ARQA 3ARBB 4L8SA 5EO0B 2QADC 1IGTB 3AG2B 2MJWA 4MCNA 2YSSB 4HHAB 3SKMB 3BDXA 5D7JA 3I55Q 4Y5YA 1K3ZA 3K5RA 3K2UH 3QJRB 4AVIA 1VF5C 3QHSA 3KHQA 3ULVL 3GSNB 1FZOB 4OLZH 2VN6A 1VFBA 3WUZA 1CFNB 1XCXA 1G87A 4BM7A 5B4MC 4PGCB 1SDDB 3O3EB 3HE7A 2VLJE 3C08H 3LEYL 2DVEA 4GMTL 3FZUC 2XTJC 4RZCA 5CLTA 1FMWA 3QXAA 2TRHA 1VB9A 4XCFH 1VQPQ 3DVGA 1PZSA 4B27A 2IQAB 4V2SA 2HT2D 5AT1B 2NOYA 5HHQB 3HNSH 2GCYA 2K79A 2F5AH 1G3YA 1YZZA 3F6JA 3IKKA 3TBTA 4GRWF 3RL1A 1IGML 1UEMA 3B9KA 1ADWA 1XMEB 5GS0H 4YZFF 4K2UH 3ISRA 3FB8A 1TLKA 5ICYA 5GSVB 3RGHA 1K0XA 3RPKA 2YSQA 4IKIA 2MIOA 5G4NA 2V8IA 2P0PA 5JIMA 3EOAB 1Q9LA 5CGTA 4J23A 1N64H 1M4KA 1TZIA 3LN4A 3UZQB 2Q1EA 3BSHA 3VDAA 3WUWB 3N06B 2EIBA 4FNPA 3GSOB 2NR6D 3S3JA 1XT5A 2VL4A 1TYEB 3VUAA 4GBQA 5CSZA 1BA9A 1BLNB 2QTEA 1I9JL 4MA3B 4ZXBD 1XDTT 3EO0A 2XVBA 1KIRB 4P4KA 1CXKA 5EIIG 3CBRA 1AI1H 1RADB 2F1EA 1QRNE 3APNA 4WEBH 3QYMA 1EHAA 1N0XH 2F53E 4LAQL 4MXWL 2RQEA 1OP3K 3V5DB 2VSCA 3BYYA 4QKTA 4LCWB 2BDNH 4GO6B 2WGNB 3OL2A 1G5VA 1RLBA 4F37F 5F7MC 4PSRA 4X6DA 2OYLA 2ENMA 4EIBA 3KXFA 2ESVE 1K9MR 4DPRA 1WV7T 3T65A 4NJ9H 4P5TC 5HGAA 1I8UA 1F41A 3V52L 4F9PC 4F7EB 3H9SD 5DFVD 2E6NA 3KBGA 2PUKB 3NZHL 3QO1A 5BW7C 3VWKC 3TJEH 3CDFA 2FZGB 3EH2A 3SYPA 3EH4B 2DBLH 2NT0A 5GRYA 3CCLT 3PQYE 4IIMA 3KGTA 3SYCA 5L8JB 1F4AA 5EEYA 3KW7A 2X38A 1OZTG 2BSTB 4QYAA 3OGCB 1RIHH 3G5XA 2NUZA 4LCCC 2XHCA 3CXCP 5L2KE 4QLWA 4PJOC 5FUOL 1ZHIA 1G7PA 3O6ML 1IEBB 4KRNA 3RWDA 1R5VA 1SYSA 3CCJT 5DJ6A 5C0DB 5FDWA 4M3HA 5T3ZD 5JOPD 3RIRA 4Z89A 2EDQA 3KJ4C 1QSEA 5F1NB 1PSKH 3TH4T 4FTVD 3FRNA 5J56B 4X5QA 4JG5A 1QVPA 2CGYA 2FLMA 4N9OB 3SY6A 1H3UA 1ZWIA 3MX0A 4QKUA 3MRJB 4O2CA 2A1WL 3LIUA 5LJ3d 4X7TB 5IHNA 1A1OA 4AG4L 1FORL 3T0EB 1BIAA 2LT9A 2KXCA 5E4IA 2IXQA 3LH2L 4JPVH 1XF5B 5JR1H 2F2VA 2WN3A 3U9WA 1I3RB 4AKQA 2KROA 5IMKA 1G9EA 4R7NB 2QGDA 4MNQB 1LO2H 5H35A 1RZ8B 4MD5B 5D1ZI 1I8LC 4KK9C 4TSAH 3WYRA 3KZ8A 1JJ2S 2V5TA 4Y92A 4ZSOA 4N2NA 4OSUH 1P6FA 5IK3A 1BIIA 3HTRA 3HMWH 4J4PD 1KG1A 4LL1A 2QSVA 1HJBC 1BCMA 3PHQA 4OB1B 1IL1B 2AI0H 4N4YB 2WQ8A 5DZOA 2ZXCA 4XGZA 5CCJA 5IXBA 3VH8G 4JRIA 2JIXD 1QUPA 3V6OE 2Z4TA 3VGBA 3VRYA 2HVJB 2ZPFB 4ZMQA 5FW9A 1GRIA 1OU9A 2KPWA 3S3BB 2VNCA 1XGUB 2GITB 3N43F 2KI7A 4J3OD 1RCYA 1MY5A 1RIUL 3B2MA 1QQDA 3NJKA 1COBA 4FNTA 4E7SA 4Y5XC 2OM5A 4KMTH 3ELAT 3LN5B 1RULL 3U4BL 2LAGB 3VS0A 3X14B 4KK6C 4YBLB 2A6JB 1ZHLB 1UM6L 3ZHNA 1BXVA 3UIYA 1Z9SB 2H9GA 4LP8A 3EJZC 5BO0D 5JIIA 5E4AA 5J1AB 4F7UE 4F91B 4JRQA 1KT2A 3CFJB 3OJDB 3X3FH 1E43A 4OCNC 3S2AA 1E8ZA 1PPIA 4JRYA 4OZHB 4FXGB 5D1ZD 3T2LA 1M7UA 3SZKC 1KTJA 1M3CA 2EVRA 5I73C 1F1GA 4OLXH 4Y4FC 1KD1U 5CEXA 2C9RA 1E4KC 2NY3C 5FK9B 1UGPB 5C0EB 4UAHA 4N87A 4Z78B 1JPEA 2EDFA 2LE9A 5GGRA 3UEZA 3WE6A 3I6KA 4D3CH 3GBNH 1JZ5A 4L3FA 5CKGA 5JHLH 3C2SA 1A4BA 3PAZA 4ADIA 4JFDE 1YQ2A 1ZTMA 3S4SG 5CM1A 1DQQA 4OD3H 1S7WA 5E7BA 4FLRA 4GP4B 2J2ZB 4U1NB 4MMKA 3WKNA 3FCSB 4AZ8B 2BOCA 2W1NA 1TYRA 3QIUA 2A28A 4BWTA 1KV7A 3HG3A 2KVQG 1R47A 2OXGB 4OBRA 5D6DC 1JYWA 4BI8B 3FW6A 1Y1UA 3SE4A 2B4CL 3FQ2A 3A6CH 3EADA 4CC2A 3A4AA 3HG4A 4FLSA 3QIWB 1JRIA 1K4US 1P5UB 4E7JA 4X7CC 6PCYA 2ZZDA 2J6KA 3EFRA 3OF6A 4FQ2H 4Q6IA 4AQEB 4CDHA 2D7PA 2K9UA 3V4PH 3F85A 2LAAA 4VUBA 4KTEH 5I21A 1FYTE 5L7XH 3SDAA 1I1YA 4HUMB 32C2A 4NWTH 1FCGA 4IU2A 2A36A 4LCIL 3UG5A 3DARA 3KL5A 4GXFA 2YAEA 2ZUVA 1PY9A 4E9VA 2EEAA 4OF5A 4FFTA 5ESAA 2R56H 4EI5C 5D6CA 4XPGH 3ZTJH 3HC0A 3VTMA 5CN3A 3QH3B 1JB0E 3OMGA 2YPKB 3QISA 2XHNA 3R4DA 4HFWA 4J3BA 3RDTC 2IG2H 3FH8A 3GPEA 2E5EA 4RTTA 3V8JA 1DBKL 5TFSH 1IRXA 1HE8A 2DTML 3BCDA 4NLHA 3S36L 4ELKB 3NCWA 1WA7A 4HWBL 3KWUA 2RJEA 3JB9H 1CLOL 2NXYC 5EDXA 4XP6L 4XMZA 2R4RH 4UZGA 4F04B 3NESA 2BFVH 5KCOA 2FJGA 3FYEB 2NTSP 1GZHA 3MODL 4P9HH 2VM3A 1FLTX 3TEUA 1VA7A 4KKRA 3PVQA 1Y0LB 4ZTFA 3FO0H 4UNVA 2JXMA 2NY2D 1KIPB 3B7UX 2YUWA 1V7ML 4LVHC 4U4BA 1RVFL 5D6YA 4NO3B 4JUSA 1PKQB 1KF9B 1YY9C 2ATPA 4YSPA 4EXPX 3MGAA 5LN4A 1AC0A 2KQWA 4TRPL 5KYXA 5AOJA 1HVXA 9PCYA 3K6SA 2Z0WA 1MFEH 1WAAA 4HFUL 3MFFA 5AYUL 5PAZA 3CCRA 3CFCH 3V7RA 5DZLA 1IZKA 3JVGC 4WHCA 3RFZC 4KUCD 1AXTL 1O7VA 2YZ1A 1CGTA 1MRCH 4OV5A 3GUFA 1WHOA 4YPGB 5F0LB 8AT1B 3A23A 3U9PL 3BI9X 5DWUL 4EDXA 4QRPA 4U3XA 1MNUH 2WVTA 3C60C 4DW2L 3IPEA 4QD2E 1AO7A 1VFAA 4FXGC 4PJXA 3GLEA 4I0PD 1L3NA 3DXAB 2KT8A 3OYEA 2V37A 4HS6B 3O3DA 2EIZB 1ASPA 4OM0L 2I9LB 5BS0B 2C9QA 1VQ6A 4YSCA 1G4RA 1OQKA 4LARH 3VRIA 2LW3A 1PLGL 4UZUA 1F4HA 5C0CE 3AACA 3UTQA 3B2VH 1A25A 4R3SA 5DRXB 5J0BA 1YYCA 2J21A 3F12B 1KYDA 3ZDXB 4IUQA 4WWPA 4J6IA 1DQJA 4ETQB 3U7WL 2VIRB 3DKHA 3WTYA 1QFHA 1SJMA 3QPHA 1CICC 3JVFC 1J5IA 3I50H 2OTUA 5T1LA 3W0WD 5AW1B 2VDNB 3JV3A 1H5BB 2FO4A 1BQKA 3DLQR 4ZGDB 5DA0B 2OXHA 3GHBH 2P24B 1ECZA 4QJ3B 3REVB 4PJCE 4HLZH 3NIFB 4DN4L 4C4KT 5B39G 2VDLH 3D3VB 1SEMA 1S4IA 2DQIL 4Y19D 2CU9A 2VZ1A 3OS1A 1AGFA 1UD5A 1KGXA 2Z35B 4MSWB 1P5UC 2Y0SA 1ACMB 3QXDA 1AQDB 1HH9B 4NQED 2ZGWA 2EGAA 2NYYD 4NB7A 3C6LC 2DO3A 1PY4A 4N5ED 5I0VA 2J25A 4Y1TA 4YHOH 5DEZA 2GUYA 4WSKA 2ORBH 3GB7A 1EZLA 5A0GA 4LF3A 3TTYA 4J6RH 3QULB 4UT9L 3HR5A 4QJ4B 2CBOA 1U5SA 3T4YB 4YHZL 4JY4B 1FFPB 3VA6A 2EZ0C 1NWOA 1UM4L 2HA1A 3EW3B 1TTAA 1GBRA 3M17A 3OXSB 4QT5B 3IMSA 4RMTA 5FM5O 5AB1A 3CCQT 3VD1A 4MJIA 2ZE0A 3OS2A 3LZFL 4RLDA 5EO9B 1X4ZA 3KXTA 1G7JB 4FYXB 4IHOB 2BC4A 3QORB 4ZDHA 4JS4A 1MVUA 1WGSA 1A6VL 1IGFH 1P2CB 4PM1A 3DMMC 3EO1B 2APXA 1HCFX 5BPPA 4X8CA 3VWJC 3ULVC 1SBBA 2ENPA 5TQ0L 4KQ4H 2C9UA 3GSUA 1FGNL 1PX4A 3MCLL 4PWHA 4PYHA 4QDGA 3TBWB 4ZTPH 4F9PA 2C4FT 3MRCA 5DGRA 3MOBH 2CO6A 4K11A 2VXQL 1O9SA 5BW7A 4GUCA 4XNUH 3I02B 3A8MB 5IB1B 2BZ8A 5LXVA 1YEGH 3V95A 1M1SA 5FX3A 4LLWA 1KTDB 2R29A 1LOJA 1QA9A 5A2JH 2I32A 4BH8A 5CZXC 4GKSA 4MJ5B 4NQCD 5DJXB 3TYGH 5C9JB 2KYMA 2B9AA 2UXFA 3I6LE 4LFHG 5I1EL 4BJLA 3P9LB 3FRPG 5KSAD 4PJOA 1ONQB 4Y9EA 4JNXA 1WHMA 1U8QB 2WD0A 1BWMA 4U1HB 1U8RA 1KEGL 3NA9L 4MFHA 2PYED 1RZGA 15C8H 3K8KA 3HHSA 4I4WB 2F74B 5A0LA 4BYHA 7AT1B 5L4IA 5K1JA 2COQA 2BP3A 2DM1A 4GY5A 2VR9A 2DNUA 3DX4A 5J3HD 3K1KC 1JF1A 4LPCA 3VD9A 3OLGA 1PJWA 1NG2A 1IFHL 1KFAL 2CH8A 2Y5TB 4R4FH 2UUDH 4WEEA 3ECQA 2H45A 1AANA 3G71T 1WFNA 1OTUC 4MGXA 1QEWB 2NZ9C 1TSFA 2Z65C 1WS7A 2CQVA 4TTGA 1U91A 3EDEA 1XIWB 5EG6C 1MCLA 4GSUA 1P5VA 1O7DE 3VI3E 1I8LA 4ZNEE 3LXAA 5JIDA 2UZXA 1ZLVK 2P8LA 4LDOB 5JUEH 5L9DH 4WNJA 1SPKA 2QPFA 5EPMA 1DLFL 3V0VB 1E30A 2DWYA 3BKML 4Y4KD 5FO9A 1S78D 3FAWA 4S1QL 2X2YA 4P06A 4JJNK 5T1KA 1UTDA 2XDPA 2IAND 4XNMA 3AWGA 2J5LC 4D8PB 2C0IA 4NQTA 1W0WB 3SE9L 1BV8A 2MTAA 3MJ9L 1H3GA 1NCDL 2LV4A 2GQIA 3GPSA 4NM4L 1AG0A 3ATFA 2CLVB 3PJSA 2Y25A 4MQXC 2CDFB 4ENED 3CCSA 1PEZA 5I11A 2FATH 4Y5XA 5IF0A 3TNMA 1FQ9C 4M56A 4HJJH 2EADA 2HCKA 2XFXA 2DS4A 4AM0A 3A8LB 2YWZA 4D8KA 3HFOA 2H1XA 3FQYA 2Y3AA 1OZ2A 5KYNA 4Z18A 2CRIA 5FECB 1PIFA 3CCSQ 4OIIH 2HJLA 2DM4A 1G7IB 1OP5K 1K5NB 1W2BA 2FSDA 2Y3NA 3LQAL 4EIGB 2FIKA 2V2TB 4JREC 4M8QA 2RHYA 1ZGLM 2M26A 2XG4B 2NY5L 1QFWM 3DK0A 2DH2A 3H3PL 4M7ZC 4P3DB 2WO3B 2E5QA 3GSNH 5IFHH 3FOLA 4NZ8A 3DJRA 5FO7B 3M9QA 3MBWB 4Y4FA 3RNKB 3ZMEA 2FECL 1E4KA 4KK8C 5B1AB 1T03L 5FPIA 2DWXA 1NFDE 4B53A 3MLWH 1DBML 2VLJB 3HG2A 1JV2A 4XVUC 1VQ7A 4QXUH 4TVRA 3L7EA 3LZOA 4PP1D 4KBPA 4ZG1A 3JB9D 1E67A 2PCPB 3PDOA 4LPUA 3RZCB 5IREA 5HI4C 2HG0A 4DH2A 4JG0H 3QG6B 5DSCA 4NXSA 5LBVA 5BCAA 1EXUA 1VQ7Q 2BKDN 3DV4A 2BK8A 1RUQH 5C0AA 1T6BX 5CIUA 2VXEA 2CE6A 1VADB 1P0SE 3OAUH 2VO5A 3K72A 4CSPA 4N6QA 1TSHA 3MV7A 1ADQL 3VGFA 3F64A 3ZDZF 2H7WA 4RGNE 5CLWA 1CLCA 4JR9H 1A8JH 4G6JL 4RFOL 2WAHA 4P2OA 1KD1C 3L2LA 2A0LC 3WIHL 2JMAA 2YMXH 4JQIL 4A7GF 3WENA 4UTAL 3ABLB 5CGYD 2Q76A 3D4YA 1CT8A 3D0AA 3CQQA 3C12A 4RG2A 1RAAB 2ISDA 3UBFA 1OTSC 1GJIA 4KK5D 1D3CA 3Q1JA 3FJTA 1UHCA 2EDJA 3B9EA 1CPUA 1ZD6A 2BVPB 3P02A 4WWID 4ZS6C 4FKEA 1QRNB 5D8JH 4BZ2H 4EI5A 2VN4A 2F53B 3OKKA 1LEKA 3S3DB 3JCMQ 1GVIA 1X7QA 4ZAKB 2EDWA 4JY6B 3RDTA 1HH6A 5DFTA 4Q2ZB 1ES0A 2QKIB 2ESVB 2XWRA 3Q6FA 3CGTA 3QUMB 5HGBA 1I4FA 2K2VA 1NANH 1V3JA 2EDXA 1YN8A 3MRGA 1GGCL 1HEHC 3FB7B 3NFNB 3QEGL 3FMGL 1G3WA 4HX1A 1KPRB 1J0IA 2ZCHL 3PQYB 2YPLA 1MW3A 4ZW3A 1KIQA 3GSRA 3TBYB 5C0JB 2A73B 4IIZA 2YEZB 3QUYD 3IMUA 4IU3B 5HI5C 3MYZA 5C08D 4C56E 5A16A 4PRHA 5L2KB 1NDMA 3VXTA 3U4EB 5DMGD 3ZT6A 1FAIL 2BNUB 2B4CC 3U9UB 3ZL4H 2ITFA 1A6TB 4HC1L 1EMTL 4PGZA 5DMYA 4JHVA 5JHDE 1C8PA 2F68X 4M75C 5F3BA 4XZUA 5KOMC 1NOLA 2I5YH 1ZEAL 5C0GA 5B38B 2H3JA 2RD0A 3DLMA 2O30A 3JVGA 4CADB 2DKMA 3RFZA 2WZPA 1YY8B 1PG7X 3Q2VA 2DH3A 1AVAA 1HNGA 4KY2A 4TULH 3CC7A 2OJ1A 3II2A 4N2IA 3LH5A 3TA3B 1MLCA 1B3IA 1OW0C 4FW2A 3C60A 1ZSZB 2A74B 2YUXA 4POYA 2B0SH 3HE6A 4GAFB 2AXJA 3NFPA 2VGMA 2Q7NA 2OMZA 1YMHA 2YOAA 4QHMA 5IV2B 4RKUE 1P7QA 2FJHB 2Z1KA 3IBEA 1CFQA 5AOIA 1JE6A 1JHKH 4QY8B 3PAYA 2JZ2A 2YBGA 3AQZA 2VXVH 4R84A 5D55A 5GGSA 2K3BA 3HBQA 3PE9A 5D70L 3LKNB 3AU1B 4IIQA 4BI3A 4JLRA 4RBPK 2D0QB 1EGJH 4ZUWA 2KNBB 3WNKA 1LVEA 5LG1A 4M78A 5JIQA 3NABH 5DRNB 5AVRB 1LDPH 2B1HH 2VM4A 4DBHA 2IH3B 4YHPB 1BWWA 1CICA 1BZ8A 3BPNB 4KKCD 5ICUA 1TJGL 3RZCC 3UJJH 2NY0D 3M54A 3GS4A 1Q7YC 1K2DB 4QOKA 5A0DA 1FNEA 3WJJC 3ESVF 3RBGA 3CH1B 2FWOB 4AVHA 4PWEA 2C5DC 4J9HA 1G7LB 2DDQL 2YMTA 3GHPA 3GSQA 4MZIA 4Z7UF 3SDYH 5EOCJ 3ROLB 1VQ8T 4F7UB 2XN1A 4IS6B 1XV8A 3VFMB 2DJQA 3MC0A 4K4KA 5DUPL 1P4IL 3SQOL 4NPYA 3L5XH 2RO0A 3C6LA 3AM8A 3PAVA 1SYVB 4PJAF 4Z3GA 3DIDA 1BXAA 3VXMD 2NXZB 1N2RB 1MREH 4YSEA 1JERA 1MDTA 4GS7C 2AV7B 2XG5A 2GI0A 3MZGB 1F00I 5F7EL 2NY1B 5HYJE 2X09A 3SFMA 3P1VA 4ZQTA 4DOVA 4XOEA 3SDDD 2C1PB 3UZEA 4JFDB 3O6LL 3SBRA 2DWEB 4DP2X 1USZA 2IOMA 5DRWB 1OB0A 4K3EL 1A3ZA 2QKIC 1RMFH 3A6BH 3OYNA 4Q9RL 4N0UA 5J26A 5BV7C 2QK0A 2HTKC 3DMMA 3OLDA 3GMRB 2FHFA 3VWJA 1FE8H 5GAN7 1CKAA 2UVEA 3S5ZA 2JJWA 3L4UA 5KSUA 3V5HA 3CDGA 2FB4L 3PGFL 2Y5QA 5EU7C 4X4XA 3U7YH 3TZVD 5DLMH 4PWKA 4EIUA 4TNVF 3DUSB 4MTMA 3ZTNL 3OHMB 4BFGA 4PV8A 3QPQD 4Z5RB 3M55A 1ZBJA 5JA8B 4LLDB 4XXWC 2D8KA 4P3CH 1IM9D 1TEFA 1AYRA 2RM4A 1FYTB 2YMOA 3HZKB 1WJQA 1U58B 5L0QB 3JYCA 1JJ2P 4QRUB 1ZHKA 4LDWA 4GRLD 1AD9B 1A6WH 1RQ5A 4NQQA 4KRPB 2JS2A 4O02A 5AD0B 4M6NL 1F45A 2VERN 2G6FX 2VERA 4RAUA 4BSWA 2GQHA 4MD0B 3Q8AA 3TV8A 5IMMA 5DHVA 5CBEB 4LLQB 3FIFA 3CBJB 3JV6B 4NO0A 4FQPA 3AY2A 4G82A 1KYAA 1UD4A 3QQ3B 1BHGA 2P3YA 3BVVA 2DAVA 3ULVH 3QR0A 4CSSA 2IDFA 5I26A 1AKJB 3ARBD 2L4OA 3D9AL 5I1LA 4GMTH 3LEYH 5CIPB 2RA1A 5GAN8 3LNGA 5CP7A 3I35A 3OKNB 1XTMA 2V5SA 5IJDC 1OX9A 3G5ZB 4KO5A 3MA9L 4HPHA 4JMXA 4NZRL 3FJPA 5JORA 3QZ5B 3N5BB 4HH9B 1KDJA 4PY8I 1UZ6E 4AGOA 1IGMH 4C8QE 1UOVA 4TUJA 5E8OA 1K73R 3IGLA 2E0PA 3LEVL 1X6OA 2WP3T 1C5DA 2BVTA 3ZHKA 4LNRB 4DN3L 3DPBA 5B8CB 2KLRA 2FIRT 1R46A 2A9DA 3X1EA 1UB6A 2WIIB 3MRFA 1TFHA 2GK0A 5F3HB 1KPUB 5JPMC 1TZHA 3BGFC 2EYTB 1S7QA 4JRXE 1JMXA 1FG9C 5A7BA 3QQNA 2ZYIA 5T8IA 1I9JH 3MRDB 1YITQ 1XXDC 4OUOA 2ZCKL 3IJEA 3LIZL 4PV9A 3TH3T 2C7FA 2E6QA 3C8KA 4B60A 2RTTA 1EH9A 3MOQA 3GUTA 4ELMF 1AXSA 1E2VA 1M1XA 4LAQH 1HT6A 4MXWH 4NQVB 4RWYL 4ICXA 1IMHC 2CHXA 3NMZC 4GG8A 1RK1A 4B9ZA 5HGAB 3MKDA 5C0NC 2WVVA 2NXZC 1FZKA 2VQ1A 4U1KA 5JDSA 3EYQC 5C0CB 3VRJA 4PJBA 3V52H 5E1AB 2J4WL 3RHWF 4CW1B 3FONA 1XXFC 4UIKL 2LNVA 3NZHH 3WLBA 1KCRL 2VB6A 1XR8A 5BVJB 4LCWD 1KJMB 5ELIA 3B34A 4X2UA 4MZTA 2HT4C 4W9HC 5EZPA 4D9QE 3VXUE 5KBMA 3NSFA 4Q8BA 5AZUA 5EUKB 1UJ0A 5I17A 2EINB 4BKLA 5K69A 1TDQA 3QUKA 1JWUB 4XCYA 4F7TA 4KXZH 1UGQB 1Z7JA 1ETZB 1N5ZA 1UFUA 2HX7A 4TSBL 2BSRA 4ZPVB 5FUOH 1IIKA 3T3PE 1ZVSB 4PJCB 4Z95L 3O6MH 1Y0MA 3AG1B 5DVLA 1DVTA 1X2KA 4FYSA 1GOFA 1PNCA 1UGKA 3KLLA 3GJEA 4JDVB 3BRDA 3FO1B 1U1SA 4YGAB 1SRDA 4F27A 1S7XB 4D8DA 5JW4M 1NM7A 3EG3A 4XOAA 4EIZC 1UD6A 3PNWB 5E8PA 2A1WH 1BB9A 2MOGA 3GRWA 4PJ5D 4QXWA 3LTVA 4DGVL 4Q9CA 4AG4H 5IMKB 1FORH 3FOMA 5AAMC 3RB5A 3LH2H 2DD8L 2EDMA 5L0QC 5IBLD 4MS8D 1MEXL 2PLTA 1C1EL 2DF3A 3JUYA 4KRPC 1YI2T 4JM4L 3EF4A 4PIBA 2FK9A 1BX2B 2QELA 2EXTA 3L2MA 3LQAC 3JSCA 2QQQA 3T0ED 4XOBA 3WTUA 2NY5C 3B7YA 2A6KA 2NX5E 3AS0A 3HN8A 4QAWA 3A47A 4JEGB 3QPXL 5CD3A 4NYLB 4MNQD 1U1TA 1ASQA 3SQRA 8FABB 3MRIB 1RAEB 3J07A 4FM4B 3EYOB 4TVSa 3OYLA 3H0IA 3KH4A 4PLJD 1GAFL 2JKTM 4NOFA 4FHBD 4QO1A 4AG2C 4HIEA 3V10A 3B8SA 3PXLA 5ITFB 5JXEA 2ERJB 4DVBA 2HPOA 1RIUH 3O8VA 1A4JA 2X4UA 3D7PA 2CLZB 2E9GA 5KZCB 2IMMA 1RULH 3R06B 4G9DA 3U4BH 3I6GA 4KKNA 1BVNP 1UM6H 3WKPA 5BQDA 3ZMNA 3QXUA 4W9CC 2FEEI 3PWUB 5KJ7E 1VIWA 5IUCA 3C9NA 4EUPG 1NCCL 2WSKA 5J6HB 2BY1A 4UYPA 4M77G 5DQJB 3BZ4B 4X6FA 4YBQC 3GTTA 1HWHB 5CEXB 2I2LA 1I8MA 1T0JA 2Z34A 3KPRE 1WUNT 1OAQL 4M75A 3TN0C 5KE3A 5IKCB 3FULA 2L0DA 1VQ5T 5HYSA 4XQ3A 1NLOC 3LWIA 4G11A 4WHTB 1NCBL 5IMOA 1ML0A 4J6WA 1FZMB 3KEDA 4KOCA 2D7NA 1KZYA 1NFAA 1OW0A 3T2NL 5FW7A 1RPKA 3VI3B 2YLCA 2GY7B 3GMQB 3FO9B 3GYRA 4EJ1C 3BO8B 2PXYB 1SXAA 1MCWM 1NUDA 1FFNB 1R0CB 2ZF8A 1LHZA 4JFFE 3GJFK 2B4CH 2EDYA 5TDOA 4M77E 1E4HA 1W80A 5IP4A 4IOIB 1TPXC 1YEKL 3X13B 3ECBB 1MLBB 4IUVA 5I1CL 4GNKB 5I30L 5C3TA 4MHHI 2ALAA 2HKHL 2P5EA 3PGDB 1NC4D 3KH3A 4XAKE 1U8CB 3BWAA 3TTSA 4FSXA 1TTGA 1ZVNA 4LCIH 2LT4A 4HCZA 4BXSV 5GRZA 4FJ6A 3QIWD 1SZNA 5IY5B 5F0PB 1ZHNA 5IHZA 2AJUL 4HIJB 5SV4A 4LESA 1UZ8A 3VD4A 4DBRA 5DLOA 3OYFA 5AVVB 5LBSL 4Z77B 2F7QA 2X4QB 1DANT 2V8KA 4MDIB 4OFYA 4XPFL 1DBKH 2AXFB 4MASA 2XYBA 2DTMH 3Q9QA 5LB1A 1L5GB 1P92A 1SBSH 2YJQA 3S36H 3WNJA 1QABA 4HWBH 4OJDH 1CLOH 3D39E 4L1SA 5DJ0B 1QLFA 1UA3A 4HS3A 5IAYA 2K7PA 4XP6H 4YZFE 4X9DA 3RESA 2Q9OA 3STLA 1KJWA 1NFDB 3MODH 4IM8A 5FGSA 3P2BA 5DD1L 4GT7A 5LGKA 2P44B 5DJDA 2MCG1 5AKRA 5KAQG 3IN2A 3CBMA 5SV3A 3EFDL 1PNJA 3VGHA 5EIQA 4K7FA 4AIOA 5I76B 4RTXA 1V7MH 5KYUB 3EG9A 3ARGC 1X6LA 1S8DB 1RVFH 2AS5M 4FN0A 4JFEE 4PBDA 4JHAL 1U93A 5KBPA 5H2BA 2H0PA 5SWZE 2VOTA 3WFBL 2EO9A 4TRPH 3IB4A 3VFWA 4B9PA 4KRLB 4C4BA 2F69A 3BGMB 1UD8A 2ERJC 4HKJB 4HFUH 4ZUTB 2DMBA 5AYUH 1FV1A 3BAKA 5ADOL 2VITB 3VXPB 4GEJA 4X9YA 1EHXA 1UYWL 1HQ4B 3OA6A 1PLBA 1AXTH 1ZK5A 4RGNB 2FHDA 1I8KB 2EVFA 1FDLL 2OBGA 2UY7B 4OLWL 1QCNA 1G9NL 1DTUA 5K59F 3OJ2C 3U9PH 1X5FA 2YAOA 5DWUH 4FT4A 1YHQA 4J3VA 2XVGA 4JQVC 3IDGA 4JFOB 3VS7A 4CKVX 4DW2H 5CD5D 4XXWA 1MFAL 2VDQL 3MBEC 2NW3A 4FQQA 2YPVL 4UTBL 5EIIA 1HZKA 3ER0A 3TBSB 3PJNA 2ILLA 4NKDA 4OM0H 3EFFA 1G1KA 5IQ9B 1C12A 2R27A 1PLGH 3H7BA 4GAYA 1KGIA 3DBSA 1EBPA 3FO2A 3HRPA 3QWOB 4OQTA 2B5IC 2B7DT 1YEHL 5B3JF 2KKQA 3U7WH 2WP3O 5BS0D 3INZA 3VFVA 4WTQA 4X6CA 4ESKA 3LD8C 2CP2A 3BQUB 2COVD 3CXHJ 3F7KA 5J12B 3TT3L 5KH6A 3HI1B 1ILSA 3PGCB 2COYA 1RSFA 3CN2A 2PXYC 3TCLA 4GKLA 3Q06A 2COWA 4LNPA 2JM8A 4RCBA 2XN0A 4LSVL 4WUUA 2BY3A 3I85A 3EGXA 2KBGA 3SPHA 2X3XD 5EU6A 4MJ2A 4DN4H 4YSOA 2WQSA 4JFWA 4POZC 1IE5A 4C56B 4P2RA 4UOQA 2DQIH 3GXNA 4LGSB 3GT6A 1QNZL 2WWMD 3IFOB 3RGVB 1ZA3A 2Y72A 3OKEB 5HYQA 1YP5A 3CFBB 5JHDB 2GFBA 1EX0A 1R3IL 4JGNA 5GAOn 1E8WA 1F6LL 2FX9L 2RFXA 4GUPB 1E9OA 2CKNA 1M1KU 4E9LA 2XN9A 3GF5A 1V10A 5JPMA 4JJ5A 5ECJE 4UT9H 4JFPB 2NNRA 5DR5L 1PIGA 3MRMB 4YHZH 3M45A 1O5PA 4XCEA 1MQKL 1UM4H 2H1PL 3GSVA 3NCCB 2NNCA 3O8XB 1JZ6A 1M7XA 5E5UB 4LLMA 4OGCA 5GRVL 4FXTA 3H6AA 3H42L 3LZFH 2RQRA 5AAPA 3WXMB 4GQZA 2R2BB 5DHYA 1IFRA 1OHZA 4A7UA 3RFRA 3IQLA 1A6VH 1R3JB 1WG3A 2K4YA 3B1UA 5DTFA 2H2PD 2XIBA 3FBQA 1MWAL 3RQ3A 2EJFA 1RAGB 3AREA 5TQ0H 3VH8A 4D7BA 3MUZ1 1L9MA 2JKIS 1FGNH 1CXFA 1JV5A 4MA8L 4QHNA 1AAJA 1IX2A 3MCLH 5HJ3A 1NPJA 2CREA 4KI5E 1A6ZB 3QORD 4F5CE 1JTOA 2FVUA 4MMYA 1UJ3B 2JTYA 2LTQB 2P7TB 2VXQH 3VFNB 3AUVA 3OWEA 5DK2B 4OZ4A 2FDBP 5D4JA 4GKZA 2D0FA 5I1AA 5GRVK 4DT2A 3MLXL 1U2CA 2HT3D 1AIZA 4PJFF 2J1KA 1QO3A 3FQRA 2L7EA 3CFNA 1CFMA 2EEDA 3QWRD 3SE3C 5I1EH 2H8PA 4QRTA 4UAOB 1USQA 1RUPL 1VYUA 4POUB 2EAYA 2ADIB 2E4FA 4OVVA 1Q1PA 2PCYA 1ZLVH 4R8WL 4DHLA 1MIEL 1MKFA 1NPNA 1R3KB 3O41A 1KEGH 3NA9H 4RFEA 3CN1A 4PVNA 4PY7A 4RGNC 3TPKA 5I66A 2FSEA 1NIEA 3W9EB 1HEJC 1HX0A 2NTFB 4KGVB 2JH2A 3FDRA 1PL3A 3GLDA 1SMAA 2HSIA 3S37L 3DLLA 2G4GA 2EGEA 1WIEA 3TVTA 1PEWA 1IFHH 1KFAH 4OR1A 2P1YA 2RK2A 2YD7A 4JM2B 4YSUA 2G3NA 2DJ4A 2JELL 3PPSA 1P5VB 3BPLB 5E95B 2GSIB 5AAMA 2XG8D 4NENA 1DDTA 4N0FA 3H56A 2WWOA 4PEEA 3S88L 1K8IB 1BZOA 1NJ9A 1T2JA 1BLIA 3S4SA 2NYZA 1MN4A 1U41A 3GSXA 5GAOr 1N5AA 3M07A 4S2SB 3IJ7A 2JVUA 1UT2A 1LE5A 3LDBC 4CMMA 4KNSA 1DLFH 5CLYA 2JE8A 3L54A 3LKSA 3BKMH 4K5OA 4AIZB 3TIDB 2ZWSA 4AVJA 1AHWC 1XIWD 4A7VA 1OP5H 4NHCL 4S1QH 4JZNB 4Y9CA 4CN4A 1OULA 4LZKA 3DX8B 1KBKA 2QI2A 4FFVD 4R5VA 4HUWB 4APXB 3SCMD 5BXFA 4LSQL 3T1FB 3IGAB 3SE9H 3MJ9H 4N2OA 3JV5A 1EZZB 4NM4H 1NCDH 4XTYA 4KX9A 2B14A 4PRAB 5TDNA 3TNMB 3SDCA 4FRWA 2HFEA 5GGSY 2KY9A 2AEQL 2ZKXA 4J1UB 4JPIB 4TPRL 1MZZA 1OZUA 2CZ7B 1CTNA 3PIOA 2AQRA 2VLRE 2WOBA 4JJOA 2AC0A 2IIMA 2WC7A 3VXSB 5CEZD 2WKLA 1U4EA 1WIOA 2GT9A 3W11C 1MRFL 2Y2WA 2YWYA 1CK0L 4BQ9A 2WNXA 5F1OB 2ADJA 3VE0A 1HOCB 4BA0A 1ADQA 1IRAY 3LQAH 1KQ2A 4UQ2B 1L9NA 3GZQA 5FKPA 1C5BL 1YCSA 5HHNA 2NY5H 2WN2A 1X5ZA 3H3PH 2CA4A 1NCTA 3NUKA 3CCRT 3WIHA 1UGSB 1ND0A 1KCSL 4UTAA 4D0DB 1AQHA 5AVYB 1AGBB 3TN0A 5JW5A 1YN6A 3OQ3B 3LKQA 1T03H 1CE6A 1LWRA 2EEBA 2X6AA 4FKHA 5CIPH 1YVLA 3BP5A 5T1LB 4PAZA 2CHZA 1EQWA 1DBMH 2BIPA 3QFDB 3WTSA 1A3RL 4Z3TA 2CD0A 1KG0A 1SXNA 3IDYB 3AAZA 5DMKA 3AU0A 4Y16C 1FH2A 1N8OE 5CXPA 4HU2A 4P04A 2IFFL 4EBQL 2AJYL 5IQ7L 2VLJD 2WUCL 4PREA 1XSJA 3QNYA 4C8QB 2I27N 2V2XA 1UJ3C 1VQ6T 2LTQC 5E0QA 2Y2YA 2WXHA 1ADQH 2Q0ZX 3RY5A 3FCTA 1HWGB 4R9HA 3JCMd 2IALA 2BOLA 2H0JA 5PCYA 3IDJB 3CK0L 3H0TA 3CCHB 4G6JH 4RFOH 3WTXA 2V3DA 2WXRA 2D4DA 2H3NB 3F7YB 2HL5C 4M7DG 1VGEL 3WIHH 4JQIH 1JPTL 2BW5A 3GM0A 3S6WA 2V3FA 4UTAH 5KUMA 3V8OA 5DEFB 2ZX7A 3G6ET 1CD9B 2PO6B 4ONHA 4HMEA 4UAOC 5KYWA 2XV2A 3AWFA 4JRXB 5HY9B 4FFZL 1JVKA 3FJ5A 1MXDA 4NKIL 2XJLA 3HUJA 2Z8SA 5EBMB 2C26A 1A7QL 1M3IA 2GBTA 2VDQB 3IN0A 3L4WA 4PLKC 4HMDA 1N9RA 2O5YL 4DWHA 3ULVD 1UOLA 4P5MA 3CXCA 1YC8A 1QVGS 2Y7SA 3NN8B 3CC4T 3OKOA 5GS3A 2ID5A 4RMUA 2O4XB 5E5RB 3FTGB 3PWPA 4P23B 1XB3A 4PRIA 4HCRL 4NOBA 4HCKA 1HSAB 5C0BD 3WBDA 1VGKA 3BW9B 3QWNA 1D5MB 1OGAE 4OBSA 1EDHA 1IEAA 4P8QA 1BVKB 3WFHA 3KPMA 3BPLC 3SGDH 3T6WA 2HMIC 2ZOUA 1R5WB 5GGUB 1GGCH 1E5ZA 2F53D 1L6XA 3TVMA 2YD9A 3QEGH 3ARYA 4KJPC 3FMGH 1XGPB 4ZAKD 4A04A 4FKKA 3ZQWA 2ZWKA 4OFVA 3VXUB 2ZCHH 1A4KB 3GM8A 5K9QG 3H53A 5F0JB 3CCET 3L3OC 4QF1A 4PRHB 1VHPA 1UH2A 5G2NA 4EDUA 1Q9KB 4YAQB 1CDYA 1CD0A 1NDGA 4FLQA 4HK0B 1W91A 3ARGA 4G8FA 1K9TA 1FAIH 3T3PB 2YD4A 2CH4A 4WK4B 1F8TL 3HB3B 1HL8A 1Y7VA 4BK5C 3O6KL 3LPFA 3PQYD 2CR6A 5B39A 2OMWA 4NN7B 1SXZA 3H8NA 2DILA 1EMTH 2Y4SA 3HL8A 4HC1H 3AROA 1PYWB 2WTRA 3TBBA 1EZUA 4PJGA 3DV6A 1J0YA 2Q86B 1ZEAH 3O9WC 3OSVA 4KH2A 5EO1A 5GZNC 3QUIA 4RBPH 4WK0B 4C5EA 2PTUA 2X2HA 2DYPD 1E42A 3T08A 1CFTA 2R1XB 1M6OA 3HZMB 4S0HA 1FMVA 3CLEL 1U8LB 2CZ1B 4DESA 3VV0A 5JIHA 1CWVA 4ZJ9A 4YJZL 2VDRL 2OTWB 4F3FA 4G71B 5EF2A 4HUVA 2G5BB 4JQVA 2WZAA 3D12B 3CSFA 4HYTB 4R96B 3QSUA 1FUNA 2DBKA 4PTTA 3IMBA 3ECVA 3MBEA 4QHUB 2YO3A 2HVBA 2BJML 4LRIA 4ZT1A 4X83A 1EAOA 5K9KB 5JLZA 4HDIB 1TENA 3TA3D 2NX5B 5C9KA 4KFMA 3META 4WY7L 3IS1X 1MWAB 5BZDB 5FA3A 5D70H 1YEDA 5TH2B 5JW4N 2Q10A 3ZE0F 4I9WD 4PGDA 4ANKA 1HSBB 1YLBB 3ZSTA 2VWEE 3FEOA 1WWCA 2DVJA 4JFQB 4K3JL 3TJHC 3G4ST 4FERA 4IOSD 4LKXA 4GKOA 2DQMA 2CK2A 4N6RB 3BCFA 4ESRA 2WBWB 3FU8A 3L5JA 3VFRA 3MU3A 3CUPA 3KE0A 2YHTA 1OEZW 3NPFA 1TJGH 4IUTA 1WVZA 1WTGT 4YDLB 2WQVA 1OWRM 3BH4A 4JKLA 2QDYB 2BZDA 1JGEB 3L3IB 2DDQH 1OCOB 2VLMD 3CMEA 1LNUB 2APTA 3QI9B 1KZQA 4O51B 2FR4A 4MLSA 2O31A 4CA4A 3G1JA 4F58L 25C8L 3FRPA 4AQOA 3UMTA 3NK3A 3BIKB 3K4AA 1YJWQ 4L2LA 5AVQB 3VGEA 43CAA 4NKQB 2LQKA 4XO4A 1K8DB 5DUPH 4L59A 5EU3B 1P4IH 2CWRA 3IDUA 4G6KL 4GW5B 4TLSA 3O45B 3JYBA 5I1HH 5I0WA 3CMEQ 1G6RL 3KPRB 2PO6C 3MRQA 3WIIL 2EPDA 5DLQE 4Y4HC 3IAQA 3ZE1E 1GSKA 4N2LA 3D4ZA 2WTOA 1TU0B 2J8OA 2LFEA 1J0KA 3EG1A 4K9EC 1QUNA 4NQSB 1B7TA 4D0CA 2PWHA 1P4BL 4AFSC 3IMWA 1VFMA 4X34A 5F7EH 1EVUA 1D5RA 4IRJD 4GI8A 4PBXA 1AHJB 2BSCA 2JOYA 4HSQA 2AQPA 3O6LH 3NJGA 2DZCA 1S6NA 4P23C 5L88L 2DXBA 1U8HB 3NK4A 2XPGB 1KNOB 3MGOB 4K3EH 3B2DC 1J9RA 1B9ZA 3RNQA 3FDWA 4NKMA 1T7ZA 2NY1D 2QR0A 2Z9TA 3IKCA 1UWEL 4Q9RH 3HG1E 3WAJA 3C4SA 4LDVA 2PKDA 4R4BB 1YHPA 4JFDD 4JFFB 3QAZB 3DHPA 3VXRA 3ET9F 1MI5E 4XBPB 1Q81U 4WWOA 1Q9OA 2FB4H 3PGFH 4PJIE 5AUMA 3S97C 3UFIA 4M77B 5FGBA 4NUJA 1FL5B 3EBHA 4IOFD 3MHZA 3NG5A 1J8SA 1JYNA 1M1KC 4JJCA 1KGCE 4KKBD 3RY6C 2XBZA 4AIXA 2V1QA 2NY6B 3ZTNH 2CO4A 4ALAL 5SWSA 2GTJA 4DUVA 2PABA 3EUUA 3F62A 3HB3C 3PPEA 2XQ0A 2YRLA 1JZGA 4NN7C 4JHUA 4PCYA 4PHXA 2OSLB 2P5WA 4XPBL 3SE3A 3T09A 4P2AA 4AT6A 3P40A 5F6IC 4M6NH 2YDLA 1YIJT 3KCWA 3ZJAA 4AYDC 1INQB 4P49A 3QNZB 3VFUB 2Y6SD 2CNYA 5FCUL 1FYTD 3FT2A 4DCQA 4AK1A 3MNZB 3K71A 2AHJB 3IF1A 3CPWA 2OMUA 2E86A 3A4FA 1A1MA 5DUBB 1U33A 3C94A 3BKJL 4RCAA 3MLUL 3UYRL 5INDA 3K2MC 3D9AH 2X7LA 3D39B 4WI0B 5HHME 3RUGF 5IOPB 1N3NA 1N19A 3BE3A 2WZ6A 2DETA 5IVXA 2AK4E 4IGBC 4NAQA 3ZVVA 3A0OA 5IM7B 3LN9A 3CCMA 3EG0A 2LHAA 3KYOA 1HHGA 3MA9H 4TUOB 3HE7D 1DO6A 4NZRH 2WQWA 4TYUA 3K6NA 4PRPE 4YLQT 5I2IB 3QR1A 1DE4A 4M1CD 1AKJD 4WHYG 3VRZA 1XTLA 4TLTA 4QT7A 1BFOA 4ZX3A 3VFTB 5HGGS 3II1A 3NZ8A 4JFEB 4QKXB 3T0BA 1ORSA 3FSZA 2VQTA 4UILL 3VVWA 3KPSE 3W1ZA 5IHKA 5SWZB 3DGGA 3LEVH 5KBNC 2CP6A 4BK4A 4MA7L 3TESA 3BPOC 3AXHA 3KYMB 1MCIA 3OYMA 1AHWA 3B9KD 2YQ2A 4DN3H 1H9VA 2WCPA 1PSEA 1YRKA 1FVEA 1WQVT 2RIKA 3NSXA 4P5SA 5I8OL 2X89D 1I07A 2GB2A 2OSYA 4PFZA 2CBQA 1NGYB 2ED8A 1H19A 4NZJA 1VESA 5AVTB 4CNIB 4H8QA 4QWWC 1FZJB 2DQTL 3US9A 4AXWA 1WBYA 4TQEL 4JFHE 1J9TA 3UTOA 4F2MA 3MEUA 4OMQA 2ZCKH 3LIZH 5IJCC 3QC6X 2G5RA 4N2HA 4OQ1A 4XMTA 5IVNA 4G80A 4A53A 1KGWA 2GVYA 3CC4Q 4OFQA 2FEIA 4Y2DC 4N24A 3RWFB 4RWYH 2XCMC 2D3JA 4JO8A 3APFA 3MV9A 1V29B 4PRDA 3FU9A 1NBZB 1BBDL 1J05B 3BD5A 4W9DC 3V6OC 3WEXB 1BYNA 3OKLB 4M4PA 1OOAA 4H2CA 3QJHB 1KQSS 5C7ZA 2G75A 3A5VA 4H0IA 4NQDE 4BDVB 3A8HB 3STZB 3KYNA 4QRRA 4ZW5A 2J4WH 3IAPA 3S3OA 5DHDA 4UIKH 3ZKNC 4YEEA 1N6UA 1KCRH 2NZ1A 1G7MB 2QPDB 4N86A 5LJ3j 1T1ZB 2GGRA 1T5XA 4N2DA 2RQTA 1T5KA 2DQFB 2VL5B 3KVPA 2CO2A 2DQ6A 1FYHB 4KV5E 3CC7T 3D6GA 1F13A 5D7KD 2WOYA 2XKNA 3JWOC 5GAN5 3VRLF 3VSVA 3DYMA 3LQZB 5F6HI 1TEGA 3CZUB 4TSBH 1MH5A 4AC2A 4Y16A 4Z95H 5EH1A 3WEOA 1MAJA 1TUDA 1GGUA 3L8QA 4P46B 3ESUF 2NCMA 3P3TA 1EFXA 4M77C 4OMOA 3VDCA 4R7DA 3VXQB 4LOUC 2X9XA 2WXIA 5IHUL 3RKXA 2XQBL 2FYYB 3QO3A 2NY6C 3GMLB 2VABA 3HLKA 2CUDA 2K8QA 4DGVH 3GGWB 3V5KA 1S7RB 4MDJB 2OQJA 2BVEA 4HUCA 4IUPA 2DD8H 3STBA 4D7PA 1XF3A 2DLEA 2Z31C 1QVFA 3MJ8A 1MEXH 3RTQC 1C1EH 1AIFA 1JIBA 4F1SA 4JDEB 4AFQC 3Q01A 4JM4H 2VDRB 2C06A 3D87B 4F33B 4PCTA 2L3PA 4U1SB 5T1DL 4A4GA 4YH6A 1MG3C 4LLVB 5MHSD 2CGRL 4LQ1A 4N90D 4X9BA 3MP6A 1OKEA 2A2QT 3KPQA 4G8GE 3MRKB 1ACCA 3QPXH 4MMXC 1BQ5A 1I7RA 4ODHL 1HI6A 3GJFA 1XH3B 2PTTB 8CGTA 1NEBA 2J6OA 1Z3RA 4WV1B 2HLAB 1GAFH 4Z7UE 3NRQA 4B0MM 5EBWA 4HSAC 2EXWD 4JGUA 4Y5VB 2A9CA 3IJYA 4P5KA 1BQHG 3VFOB 3NDYE 4WSGA 3QFJA 5AB2A 5DD6B 2QMJA 4ZFQA 4ZUUB 5ISZA 2K78A 4U1KB 5DC4B 4RTYA 4GSXA 5DZAA 3BAXA 4DUXA 3P77B 2V7HA 3TC9A 3H6JA 4N8VG 4HOZA 3L3OA 1HNFA 1DEDA 1ID5I 2BUDA 5LJ5h 1U36A 1JWSB 4UU9A 4Z7NF 3HC3L 5F7NC 1MCEA 5ESVB 1XF4B 5IW6A 1BXUA 1KXTB 5HHOA 3ILQC 5FRNA 1F3DJ 1NCCH 3QS3A 4E7LA 1VQKA 2CUHA 3RJQB 2DQEL 4O2FB 4E2OA 3L7FB 1OPLA 3DUUA 5CN1A 3GZKA 4N2CA 1PNDA 1F18A 5KBKA 1EXGA 4UMGA 3MROB 1V55B 1I8AA 1OAQH 3GXTA 2O93L 4JRYD 2OMVA 4G43A 1DQML 4YR6A 3C5JA 3G04A 3LH9A 4LRNL 4EKJA 1VQKQ 2CPCA 3O9WA 4J8RB 5T5NG 1ZLUK 1NCBH 4D9RE 4J8QA 2NUPB 1MCPL 1ZOXA 3SGKC 2IQ9L 3GKZA 4G6AD 1REIA 5KYYB 1X5IA 4KKPA 1Z0NA 3X20B 1XO8A 4F16A 3RVWD 4DFIA 2LLGA 2IBGA 2XWDA 1D0YA 1S9VA 3Q7JA 3T2NH 3N1FC 5LBSA 5FYKE 1WPCA 1HXDA 4K5LA 3PUUA 3UCRA 1QTSA 1VA9A 2WVUA 5HI3C 5CJ5A 4OJFL 1A1NB 5C09A 3CC1A 3DRTB 2D9TA 4DEUA 4L29B 1O6SA 4M1DL 2ETWA 3QIUD 2VLKE 2HFFA 5SWQA 4NXKA 2ZP0T 4L37B 1IM3A 4X5XA 1T1XA 2VSDA 2X70B 1YEKH 5LJ3f 2F1LA 5I1CH 2OMYB 4KROB 1OP4A 1RK0B 5GGTA 5I30H 3OW2S 3T6QC 2ZOLA 3ESPA 4G6FD 5D2LF 2HKHH 3RL2A 3WJMA 3N5AA 2HKAA 3OF6D 3CZNA 5DJ8B 3RWHA 4B9WA 2FE0A 5M7QA 5TJWK 3MRNB 3PY9A 3WIAA 2WLLB 4HW6A 2VLRB 4FQXC 3VS6A 3UBHA 3VI4E 4KXAA 4ZMAT 5GMKh 2AJUH 1S1NA 1HXMA 3FUDA 4IBSA 5EC2B 3ZKXB 1AZBA 2ODIA 1BPVA 5LJ5e 1FL6B 4N2BA 1E6HA 4BY6B 1UVQB 5LBSH 3G5YB 2QEXA 1DVFB 2J88L 3O6FB 1LVKA 4D2NA 4XRCB 1UA6L 3OAWA 1T89C 3DBXA 1WQ7A 3JCMh 4PGBA 1MHEB 4Y4HA 1DCLA 2CUBA 2CJUL 1YEIL 2EIDA 4YDMA 1FO0L 2FL5B 1AMXA 5DD1H 3CFDB 2DI7A 2YPVA 4HT9A 2OCFD 3WS6C 3EFDH 4XBMA 2ZSVB 2DMCA 3QUXB 4XMVA 2AXGB 1KCVL 2DLGA 3WFZA 5EZOL 2EDRA 1Q86U 4GH7B 2CAKA 2CSQA 3RX5A 1AE6L 4JHAH 1ZGLB 4F2EA 1KB5L 4B5ZA 3WFBH 35C8L 1AFVL 1TEYA 1EZVY 3CCVT 4JPKL 1L0PA 1QR1A 5FWBA 1P69B 2O5NA 4KI5C 1OV3A 4KNUA 3V6FB 5ADOH 3OPZL 3U36B 1PQZB 1UYWH 4X8GA 2A3TA 4LKCA 4ELME 1JNHA 4LCUA 3D50A 2D7TL 2DY2A 2CIIA 4M8VA 1FDLH 3JV4B 2KDYA 3DX7A 4E7ZA 2BCMA 4OLWH 3IDGB 1G9NH 3VMOA 3RY6A 1K4DA 5T1JA 1JHLL 3MJ6A 4ABVA 4GAJL 2J6EA 1RZ7L 4MZ3A 5HTSA 1MFAH 2VDQH 5CGMA 1DN2A 5CKFA 2YPVH 4UTBH 4HCFA 3ELQA 4PW4A 1FG2A 2D9CA 3AGWA 3DURB 4BWWA 4EI6A 1AO7D 3BH8B 3EAEA 3VCLA 4GKNA 3HP9A 1EEYB 3QJFA 4BZ1L 3BVTA 2FX8L 3ATBA 4NZTL 3P9WB 2V9RA 3TT1L 3WGVB 3BSZL 2QGGA 1OGAB 1YEHH 4LEEA 5ICXA 3TXAA 1Q81C 3FQWA 4ADJA 4DAGL 5E9NA 5EWIL 2AVFA 3MLVL 1J8HE 5DS1A 1E4XI 1V1CA 3JCMe 2VC2L 5F9JA 1WHLA 2CYZB 1M2VB 3SB2A 4YIQA 3TT3H 5B1BB 2YFNA 2PPFA 3A6OA 3P0YL 3CH8A 4IMKC 4IGBA 2VE6B 4Y0GA 1QWFA 3SHWA 4ZPTA 3UABA 4LSVH 4Q52A 1BM3L 3WHXA 4PJ8C 4LSUL 4XN9A 3MGTB 5T1LD 3IVKB 1TCRA 2WAQA 1VRSA 4FMVA 3CU1A 2V7NB 1JPGB 2OL3L 3BQUD 5EMYA 5I18L 5D2NC 4PCKA 4X4YB 1YG9A 5LCVA 1QNZH 1SJHA 1AR1B 3TH2T 3RRQA 2C9PA 4KKAD 4KROC 4AQAA 4PQXA 3H9SE 1CB4A 1OIOA 3GMPA 2D31B 4MWFB 4YQXL 1E65A 2BZYA 2HXAA 1R3IH 5CS7A 4C56D 1EFQA 2FX9H 4GXUM 3AFLA 4MXQC 3RVXD 3OQRA 2IPKB 1BJ1H 4GLRH 3WLWD 1Q9WA 4E9WA 3ARTA 4J3XA 3RGVD 4XMUA 1ZVYA 4MAYA 5DR5H 1U95A 2AQQA 3JUZA 4LDCA 5D9SB 3B2UC 1MQKH 2H1PH 5JHDD 1SN5A 3UTTA 4BY6C 4QGYA 4FEMA 1M27C 1DVFC 3H42H 3BXNA 4QMEA 2JVVA 1YDPA 2W95A 1WXUA 2Y07H 1A9EA 4XH2B 4BE2A 4Y2DA 4R6UA 1DLHA 3BH9B 3FC3A 2CIKA 4RMQA 4J3OG 1MWAH 3UTPD 1J11A 3O8XD 3KLDA 1HYSD 4GQPH 2PYFB 3AUWB 3MKKA 4MA8H 3PHSA 3ILPA 4NP9A 2BTTA 4PJFA 3VD2A 1PSFA 1ZHBB 2VN7A 1BZ7A 3GO1L 3HOGA 3L5HA 3MLRL 3S5LG 3RWDB 5E2UL 3QJQB 3V7AG 5J13B 3PWJB 5DRZB 2FJSA 4W93A 1BMGA 1NCGA 3MLXH 5CLXA 3HIZA 3MNVB 5A2CA 2M02A 4LCYA 2E6ZA 2IGFL 5L2JB 3JBG7 2EXYD 3RX7A 2PVGB 1SEBB 1RUPH 2V6HA 4MJJA 5CMAB 4G7YL 2PUQT 1XF2A 4R8WH 1MIEH 4BSVA 5AG9A 3PXJA 4EUPA 4UM9B 2ZYHA 3HS9A 5FOBB 3PMTA 5TD4A 4BZYA 1VQMQ 5HDBF 1NEGA 3P4MB 1KFZA 3D7SB 4IBUA 2UV3A 4L2YA 4RAVB 4V11A 2AK5A 5FC9A 4ES9A 3S37H 4GIPD 3K80A 4BFJA 4X6BB 5I0DA 4LUDA 2OX5B 2BHYA 5F44A 1WT5C 2QQRA 3UATA 1M30A 2H8HA 3ZE1B 2CRMA 2W5PA 5F7DB 5DK0B 1RJLB 2JELH 3MV8A 2GBQA 2WLIA 1ETA1 4RTVA 2H3KA 4HKZB 2QQNL 4IUUA 2Z31A 4XWGL 3S88H 3E1F1 1E7UA 4WFFE 2DV6A 4R7LA 3RTQA 3V7AE 3DX6A 2E5KA 2NDFA 1JK9B 4Z3JA 1SJEA 4AV0A 3L95A 1UGRB 5C0FB 1GTNA 3ZHLA 3JTSB 4JM2D 3BJLA 1BKBA 1W8EA 5FYKL 1JJ2A 1Z5HA 1U21A 3U0PB 1XZ0B 1UXMA 3KR3L 4MMXA 1OY3B 3HG1B 4NHCH 1VIEA 2E76C 2CXKA 4HJ0C 4Q89A 4YHYC 3DX2A 3QEUB 3IXAB 1F1DA 3L6FB 3MJ7A 4LSQH 1MI5B 3U6XS 2ICWJ 4PJIB 2W65A 2DFUA 1HHIB 4DF9A 4HCCA 4M7DC 3D2TA 3KPNA 1UUEA 1KTCA 3HMXA 2J12B 4YNYA 3O11A 4U1IA 2BWIA 2AEQH 4TPRH 2R2EB 3SJVE 1OGTA 2X4NA 1IQDB 4OJAA 1I1AC 4WCIA 3L9RA 4Y89A 2W88A 1OB1B 4AOFA 1IBHA 5FF6A 4BINA 3DRQA 4FULA 3CFQA 1KXHA 3IM1A 3MLTB 4B96A 1J10A 2JCCE 1MRFH 4L8BA 1GYUA 1CK0H 5BUAA 3UPAA 2J3SA 1Q90A 3GBLA 4CVZA 1ZXKA 1DUYA 2AJ3B 1WWWX 1F3JB 4LVEA 2MWOA 1HOEA 2KL6A 1LMIA 5CBAA 1SY6A 3H54A 1C5BH 3U25A 1FFRA 3VXSD 4Q97A 2OCCB 1QFPA 2RJMA 1AGDA 1R3LB 1J0JA 4OVAA 3BGAA 3WKYA 1B3QA 1KCSH 2YBRA 3V9CA 1LD9B 1G0XA 3C5ZB 1F4WL 3OMNB 3QEHA 4MJ6A 1OPGL 1F6AA 4ELDA 5DS8A 5E7FA 3E7JA 1EZVX 2J6WA 4LBEB 5HHMB 5A2LH 1FO0B 2GIMA 2XZQL 1A3RH 3MLYL 5LNGA 4KQ0A 4YWGL 1SFHA 4KFZC 1T4WA 2AK4B 1YHQT 1XGZA 4GBXB 4N2EA 4P9ML 2C8NA 1GJWA 3O3UN 3ZYJA 1A7RL 4PRPB 4ZMZA 4KDWA 1D3BB 5K59E 3ABMB 2IFFH 1NCNA 1KB5B 2AJYH 4GW4B 4EBQH 3C6SA 5IQ7H 2WUCH 1D7FA 4ZO8A 2EYRA 3APMA 4UM8A 3ULAB 2IALB 1T6WA 3CN3A 3KPSB 2VWEC 4U3CA 1LP9F 2JI1A 5GGRY 1QI5A 2WSPA 5I16A 5J13C 1N0LB 4UANA 3TNNA 3WY4A 4GI6A 3WMSA 3CK0H 5CF3A 1R1CA 4EMZA 2RJDA 1GZPA 7CGTA 1ZIAA 1VGEH 3MV7D 3OKMA 1JPTH 1EAPA 1JL8A 4QHKJ 4C8QD 4H26A 5DI8B 3QDRB 4ZMPA 4P2OD 2VJ0A 4FFZH 2FQGA 4C92F 4DA4A 4NKIH 4XU3A 3MFGB 5FV1L 3X1GA 4HU8A 5B3JE 2GEEA 3ARFC 1I9EA 1A7QH 4NL3A 1KPVB 4FQXA 2O5YH 2OI9B 3M7FB 4I1RA 4PHZA 5GS1A 1T3FA 4ZO7A 1NFIA 1IC5L 2GHZA 1MV3A 1GL4B 3QJVB 4JRXD 5K9JL 2OP4L 1UCBL 4HCRH 4PRNA 1CG9A 4X0KB 5F9WB 3NAAL 4GI9A 3QDMA 3T8MA 4P59L 1T89A 1FC2D 2UYLB 4NQDB 3TURA 3HS0C 1FN4A 4YZWA 3VXNA 1FFTB 3LPPA 4F7PB 4FJYA 3EAKA 3P4OB 2YXMA 2LX7A 5I8EA 2VC2B 1TOXA 3VYOA 2CLRA 5HYIA 4M8UA 4LSRL 2Z7WA 5KEZA 4F2FA 2B86A 1CL7I 1DJHA 4K9JA 2I9TA 2V1RA 5EEVA 4WO4A 3EOBA 3VFPB 4X4MA 3U7AA 3L3KB 1YJ9Q 3MUGB 5AENA 2C7UB 3K91A 1W72A 1EXHA 2D3LA 2D4FA 1N8ZA 2OL3B 2VASA 1F8TH 2CCWA 4D9QD 3O6KH 3VXUD 1YA5A 1TQTA 3EYFB 1OSZA 4PRHD 1LPLA 5DZ9A 3QZWA 4A63B 4E5XB 1JBJA 3Q0HA 3PV6B 1UATA 3E19A 1EO8L 1F4XL 4HKBA 4L4VA 3SGEH 1IVLA 3HZYB 3QB7C 4BFKA 5DMJB 3EHBD 2VAAA 3RVTC 5HPMA 5J1SC 3CLEH 2JKLA 2R9HC 5I28A 4NN6B 5ECGA 2OK0H 2ITCA 4L8CB 2VDRH 5E6UB 2EDBA 2MPVA 5J9PA 2K4WA 3V4VB 4IBQA 3LEXB 2W0FB 2HPTA 1J8KA 2OA9A 3BOVA 2BJMH 4K8RC 4L4TE 1FYNA 4NI3A 1Q86C 2XD0A 1ET7A 3US1A 5B7MA 1TTUA 2DE0X 4G8GB 3C5ZC 3HE6D 3OBAA 1G6RA 4WY7H 3NRPA 4MNGE 3IPFA 2C1OB 3X2QB 2A08A 5HGDA 2ED9A 3CVBA 3CQTA 3ABZA 4Z7UB 2PW1B 4K3JH 1XX9C 3UDWC 4DVRL 1I5OB 1FNGB 4GBXC 2EIMB 2FL7A 1KIKA 3FU6A 4PVLA 5F7UA 4DKFL 1VQ9Q 4M78D 4XN2A 4K3HA 4C47A 4LIQE 4OD2B 4FFWC 3CDZA 4AUYA 3JZYA 2IMNA 1SMDA 4NZDA 1UWGL 4PJAB 2MCAA 4PJ8A 2ZWYA 4E0RB 2FBOJ 2BNRA 3BWUF 3K4DA 4PTUA 25C8H 3RNJA 5D2NA 3PU7A 1DUZA 1PZBA 5D4IA 4CJ0A 1UD3A 4G6KH 4Y8DC 4C58B 2CDEB 1HDMA 1KQSP 3SDXA 1G6RH 5FHAL 3WIIH 4U7SA 4EVNA 1E7VA 3KM2A 1P84J 3QI9D 2YN3A 2WQXA 3CFMA 4P4RA 5A2KH 4HJTA 3JT2A 4D8OA 1X6BA 5ETUA 1P4BH 1I0CA 1TU2A 4ZFFB 3VYGA 1OPOA 4CRIA 1ARKA