3C12A

Crystal structure of flgd from xanthomonas campestris: insights into the hook capping essential for flagellar assembly
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
138
structure length
138
Chain Sequence
DQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAATSAGFVNFEITDANGTFVKQLSVPASAAGEVSFAWDGTDANGNRMAAGKYGITATQTDTAGAKSKLATYVDAPVDSVTIGSDGLYLNLTGLGTSPLANVLRVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein
publication title Crystal structure of the C-terminal domain of a flagellar hook-capping protein from Xanthomonas campestris
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Biosynthetic protein
total genus 24
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
A PF13861 FLgD_tudor FlgD Tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.910 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3c12A01
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3c12A02
4ZZKA 5K5YA 3OSVA 4ZZFA 3C12A
chains in the Genus database with same CATH superfamily
1Q94A 3LDBB 3UOAB 4X6EB 1G7HB 3OB9A 3NIGF 4H0GA 1WJSA 2GEEA 3FL7A 1FVEB 4PLJD 4QXVA 4V1DD 4ZFGH 1CXEA 4CUCA 2FEEI 3QJFB 1QVOA 5C0CE 1T0PB 1OTTD 2OMVB 2AZVA 1ZWIA 3FTWA 4NSKA 4R3SB 4OB0B 1EGJA 4S0HA 1FPTL 2JMAA 4I7ZC 4ZDHA 4F2ME 3WTTA 2ZOKA 4PJFE 2Y5QA 4EMHA 1RKRA 2SRCA 1TXKA 3GMQB 3WDJA 3DI3B 3KR3H 4TNEA 1JPEA 1CT8B 3ULUD 2JF1A 2D2OA 3WAJA 3IJYB 2X3CA 3BE3A 4RBPH 2QGDA 3MBEA 3JV6B 4L3FA 2Z8VC 2XIIA 3GIBA 3BWZA 4LLYB 4JFSA 1ZA1B 4AL8C 4N3UA 5LNGA 3ZHKA 2MQ0A 5FAAA 1KJVA 3GHEL 1TKWB 5LBVA 3GLEA 2P8PA 2PCXA 3QFJD 3WN5A 3T08A 1SEQL 4OLZL 3AAZB 3QDFA 1RV6X 1CCZA 3GHBL 1HK6A 2OYLA 3MKDA 1I8KA 1RLPC 2CHXA 3OX8B 4NNXA 3VI4A 4BFIA 4C0ZA 1W72L 2Z92B 3OWRA 1IAOA 3HFMH 2UY6A 3GC3A 3BUBA 2BFGA 5DEJA 3RTQB 1F8TL 1TG8A 1TS9A 1GKEA 2PWGA 2Q76B 2Y25A 5I6PA 3NTHA 2WXOA 2YQ2A 2LU4A 5GANh 1IC5H 4YEEA 1XCQB 4P2OC 1I8AA 2QLVB 1KACB 5IJVB 3R0NA 4G8EB 4G8IB 1AQ8A 4TLUA 1KLGB 3EUDA 1LL1A 4HU8A 1YNLH 3Q0HA 1NOLA 4P46D 2Z35B 4IRSA 2W81C 4LNVA 2P8MA 3T77A 4HKZA 1UCTA 4UMSA 4DW2H 5A6LA 5B3SB 3RBGA 4ZZKA 3JSCA 5AALA 2EABA 4PTTA 2QVFB 2K2VA 3OY9A 1V76A 1RSYA 3P77A 4G2AA 1OGAB 1VFBB 4NP9A 4J2XA 2JOYA 1VQ6Q 1A0NB 2CJUH 3AG2B 3QZNA 4PJ9C 1RZKH 3TC9A 4D8OA 1XGYH 3QUMB 5F3FA 1PD0A 4LL1A 4XVJH 3G5XA 3GMLB 1A22B 4JY4A 4MQ7B 4UAOC 4HUUB 3INOA 1KDIA 3P30H 3IE9A 5BRZE 1TQTA 3CCSQ 2CO6B 4A7VA 4DZ8B 3N44F 1OEBA 3ZE2F 3DA0A 4M6OH 1I7TB 2CUIA 3PNWA 3VXTA 2YHGA 1A1MA 4OQTL 5IJKC 3R7QA 1H0DB 4GUCA 4Z7OF 2EJFA 1H3UA 3SDCA 2GQHA 1VGKB 1FORL 5LG6A 2NUPB 3V8KA 3D48R 2JB5L 1DUZB 2B14A 1W6XA 2WXHA 3IAPA 3QUKA 4OFDA 3TO4A 1AR1B 1JRIA 4YFDB 3ENEA 5EG2A 3FTSA 4W9KC 4YXLH 3UCQA 4PBXA 3L2QA 2DICA 2KEAA 1XB6A 3GRBA 3PAVA 5AB0A 2LABA 2DWEB 5EUOA 5LJ3j 4W9LC 4WW2A 2C9AA 3WFCH 1U06A 4LP5A 4YX2H 2QTVA 4N9GB 1BW8A 1QPPA 2QVKA 3I85A 2XDHA 3VXMB 1M27C 1L9TA 2KK4A 4C92A 3K4AA 3QDGA 5I0WA 3RA7L 3GTTA 3OZ9L 4LK4A 2BSTB 3RLSA 3T0BA 1RZ8A 2EIBA 2GBAA 4RG8A 4LASL 1CFTB 4WF2A 4N2BA 5FV1L 3KPQB 1IBGH 4OJEH 3JV4B 4JRQA 4G6AC 5T5NG 3HR5B 5KG9B 2ZUSA 4DVBA 4GUQA 1WAEA 5LN4A 5FM4A 2K7AA 1D6EB 1NGWA 1N9SA 2YSSB 4APQB 2FWUA 1YMMB 3ATEA 1ZHLA 1RHFA 3IE4A 1UA7A 5B39B 4N0UE 3HUJE 1YQVL 4QTFA 5DJZA 4HF5H 4HMDA 4JCWA 4GQPH 4KXAA 4NM4H 1QP3A 3G6JF 1WHHA 3JZYA 4KKAD 1JF1B 4ZFFB 3G7TA 2FB7A 4ZW7A 1S7WB 3NSYA 4YHNA 2YFNA 3CCUQ 1OCZB 2VLMD 4L2LA 3QIWA 3ULAB 3C6LA 1MG3C 3PIQA 3MA9H 2Y07H 3CBKB 2X70A 2HT2D 1F0LA 2EEDA 3IS0X 2ZG2A 1NMAH 4OZGA 3CCET 3WE6B 4J9EA 3PGFH 2WKLA 4WKZA 2EPDA 1AYRA 3RTQD 1O9SA 4W6YB 2N59A 3BVXA 2E4HA 3JWDC 4FLQA 1WFOA 1WUZA 5JA9A 2R0KL 2HLFD 4JDTH 1Q82C 4K7FA 4KHTL 1PY9A 2C0OA 5T1KD 3UTSB 5H2BA 4DEPC 5EEVA 4UQ2A 5I8CB 5HI5D 3HN5A 3AS0A 4JFDA 4JRLA 3LQAH 3D39B 1R19A 3KWWA 4HJ1A 4HH8A 1VA7A 4Z8FH 1LO4H 3GMRA 3K6IA 5GRVK 2PVDB 5E2WL 5HVHC 3K0WA 4C8QA 5HDRA 2A9AA 1BYNA 3C12A 4YEFA 2PTKA 5ANME 1C8QA 3X13A 1QBLL 3UYPB 5CU5A 4BDVB 4UCFA 2E75C 3VGGA 4HBQA 1JVLA 1MFBH 3GPEA 3HFOA 1OGAD 1YEIH 4FNUA 4AGOA 1CC3A 4HSCX 4UANA 5BXFA 2IIJA 3HFML 2P80A 3VFTB 3O3EA 5I74B 2Z31B 2EJGA 5KZCD 2KRSA 2DQFA 3WOVA 3PE9A 3D0AA 4N2KA 5FM8A 3VRJA 3M57A 1KNOB 2YPLE 2ZUQB 1ZT7B 5GSRB 1P6FA 1ZRUA 1UC6A 4PREB 5KOMC 1VGEL 1VQ4Q 3EG2A 4EDXA 1IC5L 4EIZC 4L1HA 4W1TA 2RQWA 4QGYA 2BSSA 1WE5A 4AG4H 1QSEB 4OFYD 5BZDA 3PFQA 4GXVH 2CCWA 2KLTA 1Y71A 1AR1D 4EI5B 2XNAA 4QRTB 5G5DB 4U6YB 3LRLA 3X12A 4CVZB 5ENWB 2OMXA 3HMXH 4DW2L 2NNFA 4YJZL 2QHLA 2GABA 3ZQWA 2FIKB 4ICWA 5JW5A 2VLKA 4D9RD 1KGCE 1GZQA 1WPYA 4YHPA 2RJDA 3VXRE 3ZDXF 3HAEG 4BI3A 2CJUL 3RIKA 3L4UA 3P9LA 4XU2A 5T5NF 2FJUB 3QUGA 4NJAH 4KK6C 3VXMD 4Q8BA 1OVZA 1XGYL 1MCDA 1FQ9C 2P52A 2O6FA 3HVNA 2OJEB 1U1SA 4PD4K 5D9SA 3V6FA 4XVJL 4KXDA 5B22A 5TGBB 4ZMTA 2GGRA 1ZTMA 3NACH 2WP3O 2MK5A 2JCCB 3RB5A 2XV6B 5EU6B 2EJ1A 3HFFA 1D2PA 5DD6A 4N4HA 3UJJH 2YD6A 4JFQB 1RY7B 2WBXA 1QFWL 2E46A 4ZMPA 4N4GA 1UT9A 2F19H 4QHMB 3V5HB 1P5VB 4WGWB 5IG7B 1JHTA 4AGNA 3KW7A 3IFOA 3IMSA 5C0CA 4QCIB 2D3LA 3VE0B 2VQ1A 4L8SA 2EUWA 2X4TB 1MCQA 3KPMA 3KG5A 4F2MA 1BXVA 5DGQA 5I71B 4PJFA 3QDJB 3EUUA 3MI6A 4AYID 4X9YA 3WXWL 2F7RA 1KC5L 3AGWA 2P4TA 2WQXA 1IRXA 1MKFA 3S4SA 3AJ7A 4HK3N 4WEMB 5D70H 4FG6D 1MUJB 1A6TB 1KLFB 2GSGB 5I5IA 3WLWC 2KVQG 1H3XA 4JJNK 4ZUWA 4LXFA 4FLSA 5C9JB 2DMKA 4DGUA 3H0HA 4JFYA 4NRXA 4NAMA 2BVUA 1E4XL 1JFQL 2BIHA 2OXHA 1W72B 4NWUH 3G6DH 5HHME 3DTDA 5DYFA 4AM0Q 4B60A 5CSBA 2ZD0A 3LHPL 3BZ4B 4XMLH 3ZL4L 1EZLA 5KVEL 4ATWA 3CDGB 4PCSA 5IEKA 3ME0A 3RPIB 1T03H 2GG1A 2AK4B 4GKLA 3UTSD 3UC2A 5GPRA 3CFJA 4UM8A 2Y36L 2X1WL 5F7HA 2AI0H 3LXBA 4N8CL 2O61A 3D39D 5GRUH 2E27H 3GBQA 2WXLA 5I73B 5KSBB 1MFVA 1AZEA 5IJKA 1XAKA 3QDRB 3IVKA 3QGVA 4M3KB 3KHOA 4K8RH 2W38A 4LO9A 1OT4A 3W2DH 4BZ2A 2I9TA 1U8KA 2CDEA 4ZW5A 4Y9GA 3SKNB 3DVGB 4XTWA 1HI6A 3K80A 4JHUA 3ZTNH 4YSUA 5IFJB 2X88A 3BJLA 3BZ5A 2YEZA 3FMGH 3IEAA 3EJSA 5GIRB 1LE5A 3IS1X 2FX8L 2P0QA 1B3JA 3JB9H 2Y07L 3MA9L 4E9XA 3OMGA 1G0XA 5EOCL 1NMAL 1P1ZA 1CFMA 4HUMB 3ZDZF 5FHBL 4PEEA 1JRHI 4U3HA 5LBGA 4BKLB 3PGFL 5K9JH 3TURA 4DOVA 2EH7H 1MW0A 5IR1A 4FT4A 4DP0X 4ZD3H 2DLGA 1A6ZA 2G5BA 3KPLA 1G6RA 3QO0B 4MBOA 1SMOA 4YDJB 3K74B 4OFPA 4XZ4A 4ATOA 4JDTL 1U8JA 4K2UH 2HQXA 1OOWA 3CCRQ 1Q1JH 5LBSL 3BZFA 3W0WE 2X35A 1K4DA 4FCHA 4G8GE 2M0OA 4J6XA 4MA8L 4QJ3B 1KZQA 3QPQC 5AYUH 4Q0XH 5BRZA 2WACA 3VRZA 2CPUA 3FO1A 2YAFA 5JIIA 1UGRB 4Z8FL 5HY9A 3TN0C 4JZ4A 3CQTA 1BLNB 3CBMA 1BI2A 1G9MH 1U8CA 1UGPB 2OKMA 4L8DB 3EG3A 1QPXA 43CAA 2VGLM 5EDXA 3TVMA 3VRLF 4OD1H 1M2VB 3MEWA 1JWSB 1R75A 1TEYA 2AERT 2FYYA 2X2UA 4PWEA 5IF0B 3U25A 2O2OA 3EYVB 3MJWA 1MFBL 2IDFA 1YEIL 3VI3F 4K5LA 3OSVA 3H7BB 4FLOA 4FYYB 4QOKE 4V2CB 2WSEE 2XV0A 2EYTB 2FO0A 2X44D 1FZJA 3D51A 5HYJB 4QHNA 1U3ZA 3UZVB 4XT1C 2YEQA 2VM9A 3LB6D 3KJ6L 4HAFA 4TQEL 3OYBA 4IKJA 5ID0A 5IT2H 3VCLB 1CJYA 5EU6D 2YRVA 4DP4X 3RL1A 4BWUA 4CW1A 1M1GA 4XVTH 3AWEA 3RKDC 5LB1A 5AVZB 3T3ME 2LX9A 5ESQB 2DL2A 4NKOA 1GCFA 5FECA 4AGMA 5JIPA 1DL7L 2ZQKA 1PQZB 3WHXA 2AQ1A 2FGWH 3OJDA 1JPTH 2QQRA 4QHUB 4YBQC 4AG4L 3N2JA 2GK0A 2PCFB 3E8VA 4W9IC 1ML0A 2KSSA 3P0VH 3BE1H 2ITEA 3QFDB 4IBUA 5C07E 2KY9A 2DQDH 3GB7B 4XP4H 4AIZB 1SUJA 3QDJD 4KTGA 1A25A 3BRFA 2ISDA 4O02L 4AK1A 2DQ6A 4N85A 4CAGA 1M9SA 2F6AA 3L4YA 4N0UA 3RGBA 3HUJA 3D7PA 2YAOA 5D7JC 1R5IB 1A4BA 4JRWA 3WJMA 1LO2H 5FDWA 3DO7A 3JCMg 2DTOA 2J1WA 1SMAA 5F0JB 5KYXA 1NH6A 2ITCA 3KYKL 1GCPA 4GRMB 4MAYD 4WV1B 1URZA 3FU5A 1I4FA 1MMAA 5HVGB 3QEQE 1N3NB 1O6VA 3BWUF 1S7QA 5LHDA 4N6RB 1YJDC 5LGJB 5IB2B 4OVAA 4AXWA 3I6GB 4UTAH 1FMVA 1V3MA 3N5BB 1NQBA 3A6BL 1A1NA 1IC7H 1MUZA 2C3GA 3UJJL 4PGCA 2AK4D 5A2QE 3OKKA 5FWCA 3U9UA 4RRPG 4B27A 3BAYA 1YHPA 3UTTD 4AKOA 2F19L 5AZEH 1N0XH 1XF5B 1MHCB 3LZLA 4HGMA 4RMSA 1KC8C 2ESWA 4UZGA 5I1IH 5JPNC 2QDWA 5GS0C 2HRPH 5C71A 1Z5HA 2SEMA 4HFUH 4KZEH 4DO4A 1N0LA 1HEZB 4Y2OB 3AQXA 5IJDC 5KJ4A 2AC0A 4HW6A 1S6NA 5D70L 4AGPA 1DSFH 4L1TA 4BK8A 4C54A 4YHIA 5BOJA 5SWZB 2AK1H 4Y4KA 1E4HA 3OMNB 4GXFA 4XCFH 5ANMA 1X6LA 3TEWA 3K6FA 3GIVA 3L2LA 4OJFL 3P40A 5DI8B 5CP3A 2DLTA 2HN7A 4WTZA 4IHOB 5CEXA 4NWUL 1WYJA 4M7AB 2CRIA 2JSFA 3G6DL 3BN9D 5BVJA 3QZBA 5E1GA 1BZ7A 4E7HA 3O11B 1UWEH 4PVNA 5D7KD 5F7YC 4XMLL 1HSBB 4I9XA 4JS7A 2YUXA 1CURA 1T03L 4KVCH 1QWHA 2X40A 4HXJA 1USZA 1WZ1L 4BWWA 2YD9A 2HQEA 4BGDA 3MC0A 5CEZE 2Q86A 4HPYH 4F7UB 4KKRA 4NQUA 2QR0B 3STBA 2WXIA 4R26H 2OTUB 2ENQA 1CGWA 2YPLA 3C9NA 4W93A 5GZOD 4NDMA 5JXEA 3K4ZA 5KBMA 3OXRB 3MR9B 2NW3B 2P7TB 3CXCA 4ZT1A 2VVKA 3FTXA 2I5YL 4Y5YA 2NYYD 3UPAA 1A6UH 5HHQB 4QVDA 1A47A 2YJLA 4N8VA 5JDJA 1EHNA 3BP7A 5K33A 5J06A 3ZTNL 4ABWA 1E27B 3A8OB 1PW3A 3ULVF 4KRMB 3SYPA 4LOUD 3RY6C 4TTDD 1SLUA 2AV7B 5HXMA 3T0AA 4G7RB 4X9DA 4IRJC 1H6UA 5K9JL 3MLWH 5C0EB 4HC1A 2P24A 3HPJB 3VXRA 1IX2A 4MCZA 1XXDC 2JM9A 5I1KH 4HAGA 1U36A 3D8MA 2IWGA 4J8QA 1AVZC 1MFNA 4UWQB 3RWDA 3L9EA 4TLSA 5EN2B 5DJCB 5A6MA 4MD5A 2RACA 2OSYA 3EJRA 4UTBL 4XBGA 5KVGE 3NFPB 4QKTA 5E99L 3B4NA 5AYUL 4BELD 1TG0A 3S98A 1DQTA 2O5XH 5I9QC 1IE5A 3IDUA 3H9NA 1JXOA 3GS4A 2A73A 1NBCA 4GAGH 1LE9B 5KYYA 1TJIH 4APXB 4F7TA 3BDLA 2J2ZB 3U30B 1G9ML 5LJ3e 1O9VA 5J1AB 1GBQA 1FI8C 1C7SA 1P4IL 4K7PX 4D0BB 3NMEA 3W9EA 3HI1A 1S9XA 4WUKL 2D0FA 5F2FA 1FA4A 3VXUB 2VLRE 3EYUH 1ASPA 3G5ZB 1YPZE 3M5AA 3QZ5B 3IN2A 4TSCH 2Q6WA 4DIXA 3LEVH 5I1DA 2J44A 3FU8A 2A4EA 2H2PD 2YXWA 3DVNA 1VKXB 4JRIA 4RMVA 1E67A 4DOHE 4X4KA 1A0QH 4MBRA 1AQDA 2N7AA 3VMPA 4W9ZA 5GGSA 4QRQA 3VFMA 2Y2YA 4RMRA 1PZDA 3QZWG 5F9JA 3U7YL 3JTSA 4C47A 4X9CA 3IM1A 2KLRA 5ETUB 3KWXA 1I5LA 3VYGA 3OWEA 1BYOA 1EZSA 4FXGB 2RD1A 1P7QA 2RNAA 2Z0BA 4W9CC 2VC2L 2FGWL 1JPTL 4J3UA 1W2KT 2D4FA 2LNVA 2JFCA 2CP7A 3QH3B 4MTMA 3JTTB 4L3CB 3QXAB 5EEWA 1S7TA 1QX1A 2B4CL 5MERA 1S9YB 1EHXA 3HI5H 4ZGJB 2YXYA 3SKUD 2ATPA 2RB8A 2WOYA 3VD5A 3R4DA 3KXTA 1NDGB 2X3XD 3QVAA 3KPTA 2ALWA 4LL9A 3IKKA 5CJOL 3BAIA 2XPZA 3OTTA 1IAIH 3KBPA 5GAN6 2MWPA 1LO2L 1Y1DA 2WWNA 3AS1A 3BVUA 5I16B 2WLIB 4IUTA 3IYLW 4Q14A 3DHJA 4GFTB 4FTDA 5E5RB 2CSQA 2FZ3A 2H26B 1QFPA 7PCYA 3MV11 3OKNA 4JG9A 2EAYA 2OXGB 3ABMB 3RURA 4AQ8A 4F57H 1YNTA 2L7QA 1HXMA 3L54A 4L0ZA 3HRTA 3WNOA 5D1XB 2EO9A 4KVNH 3M54A 3SE8H 2A77L 3ZY7A 1RLBA 5SWSD 1K9AA 4DCQA 3FT2A 2OQJA 1SPKA 4GP5B 4PJ7B 3VGBA 5AZEL 2CNZA 1N0XL 3MRQB 4JFEE 4BRVA 4NC2B 4DP9X 5I1IL 2WK2A 1S46A 2K3BA 1SM3H 1SXBA 4H5SA 4P4KB 4XE0A 3DARA 2VM3A 1JYNA 2Y1ZA 3B8SA 3VM5A 4DO6A 5H35A 5DDHB 1W0WB 1K8IA 4HXAL 2IXQA 3EGUA 4G8GA 2NY6B 3L9YA 5DURB 1YYLH 5IESH 4O00A 2OV0A 3L1OH 3O45B 1SF9A 1TQBB 3BPOB 4OLYH 5JNYB 3MJ9L 5CIPA 1KPVB 3OLDA 5HDQL 1SVCP 2GK2A 1LDPH 2WKGA 4RKUE 4J23A 4ODWB 4OD3H 1I1FA 2FEDD 1QSVA 4WJKB 5BNXD 3VG0L 2FR4B 4OVUA 4M7LT 5KWYC 4IBTA 4IS6A 3NFCA 2J6EA 2K6WA 5C09B 4PRNB 5AW2B 5D7JA 2FYVA 3TH4T 5CWSB 4K3HA 1ACYH 1UWEL 3N3EA 2FHBA 3IJHA 3DECA 2MHAA 2AQSA 4QOKA 1RZFH 2Y4SA 2QZQA 4KVCL 1P53A 4PY7B 1ETZA 1I31A 3RWEB 5FYKH 5E4OA 2CBPA 4I48B 4MJIB 1GY1A 1NBZB 4H25A 2QEXA 1ED3B 4OFKA 1OSEA 2CUHA 2ODIA 2W0FA 4R26L 4JFPA 4FG2A 4XU0A 3RRQA 4HFWA 1AC0A 1K8DA 3CPWP 1DQJA 5F9WB 1JV2B 4CC4A 2ZAGA 1QLFA 3FQTA 2AEPH 3NOIA 5DUBA 1YY9D 3QNYA 3HBZA 1G7LA 4HHWA 4MSWB 3MJ7A 4G1EA 3NPZB 5A2FA 4ZN1A 2YWZA 5J11C 3OAYH 2DIQA 4Q9CA 4JPKH 1SJXA 3O0LA 4O02B 3VXUD 4BXVA 2YLBA 1YNZA 5BZZA 5KYUB 4FQHB 5C07A 1MAMH 1KIQB 1QRNB 2W91A 4FLRA 3F65A 1KCSH 3PWVB 1CGUA 4E9QA 2CH4A 1I8UA 4XHJD 3ABKB 3MLWL 3QJHB 1SOSA 2DEWX 5B21A 3OYAA 3WDHA 1IO6A 2K7QA 4I1NB 3ZE0E 1HOEA 2PPFA 4FT2A 1V3LA 4DEXA 3PFSA 5DEGB 1NCAL 2HBWA 3QEQA 2A4CA 3ZBDA 2VDQL 4K23H 3Q8BA 3CC5A 4H7VA 5HDWA 2DWDB 4EMKA 2BXYA 3H0TA 1WIPA 4UQ3A 1HHHA 4GAGL 4TQPA 1XTMA 3M0QA 3QRGH 4J6RL 1AVAA 1TJIL 2CM5A 1QLYA 3IDJA 1BGXH 4BGLA 1EO7A 3ILEA 2N0KA 2L0AA 3N91A 3DUUB 2XTSA 2FATH 3C60D 4GG6B 3O4OC 3LN4A 1R3IL 1QI5A 4QQDA 3EYUL 5AW3B 3T6ZA 5DS2A 5JHLH 2F8VA 2RM4A 5E6ZA 3FFDA 3IMWA 2HFGH 1BWWA 1RL2A 3ARBC 4Y19E 2LT1A 3QO1B 4RMTA 2HJKA 4P4RA 2DKGA 2VH5H 1I8MB 5KH6A 1T4KB 2CBMA 1TZ8A 3QEHA 4HS3B 3RY6A 1N7MH 4AITA 5I21A 3CFKB 2ZF9A 4K5OA 4MQTB 4C4KO 1RUMH 4L29A 4IRJA 5D1XD 5L6YL 4UOQA 4BSVB 1IO4C 2YA0A 3HS8A 2VXSL 4U6TA 2OTLA 2A9NL 2RFXA 3C75A 1ROWA 3CK0L 4YK4B 1FGNL 5IHWA 1UFGA 2OM5A 5KS9B 5LQBH 3EO0A 4NN6C 2R29L 3BAXA 1YITT 3S3SA 4P4KD 5E8PB 4HK3J 1OARH 3NRQA 2RQEA 5L0QB 3CLEL 2NY6D 3HI5L 1N12A 1Q0EA 1B0RB 3GSOB 2G3XA 1MFMA 4CN4A 4EUPA 3TTSA 4GAYA 4RTVA 1YYMH 4DFHA 1TTHB 3KPPB 4LCUB 4NKDA 5E8EA 1EXUA 2OR9H 3IAGC 5AAPA 2I0NA 4C0FA 4RQQA 2A6KB 2OTJT 1G1KA 1OV3A 5FFGA 43C9A 1Y7XA 4XOBA 5LXGH 2OFQA 3BAEH 3MNVA 1YMME 3DOIA 4GBXC 4NQTA 3X1FA 1DLHB 3GBMH 5I30H 3JWOC 5C09D 3ATFA 4C92G 4ZQKB 4FQ1H 2X9ZA 3WNLA 2ZWNA 3L5WB 3MO1A 2J12B 2H6PB 1RI9A 4F04B 1GSMA 4KVNL 2VR4A 2AQNA 4MB4A 4IK7A 3T3PB 4OH2A 3GPLA 5JORB 3GNFB 4C0GA 3CH1A 4OT1L 1XGZA 2CGZA 2FLBT 2N7SA 2PPCA 2Y22A 3DROB 3KWVA 3VGEA 3LKOB 3MRFB 4JL1A 3WNJA 5EORH 12E8H 3QC6X 2CWRA 5HHVH 5I28A 1F4WH 4DH2A 4Y5VC 1DVFB 4K9EC 3VI4F 4XBEH 4DF9A 2G2NA 1YYLL 5IESL 1DLFH 2BZYA 4MXQD 1M9WA 2DI7A 3D12B 3VFSB 2B7DT 3SQRA 4OLYL 4AC4A 2XI9A 4OMLA 3PL6C 3UTSE 2QKIA 4WQOA 1RAIB 2W9EH 3APFA 3ETBJ 1VIEA 1JVKA 2CRYA 2QDVA 2K6DA 1LDPL 5A2BA 1CICC 5H94B 1YFNA 4FNRA 4P2CG 3EJJX 1QRND 5FOBA 5K59F 1A1OA 1FZMB 1MCEA 1P84K 2YBGA 4APQC 4F37K 5HGHB 5IFAH 3CZNA 3TX4A 3V2AR 1YPZA 1CF1A 1PSEA 2LOEA 2MRYA 2DL7A 5ESAA 5GZND 5C0IB 2KQMA 1RJLA 3VACA 2WKOA 4EZKA 1JGEA 1FE8H 3CWGA 1VF5C 4WTXA 4X5WA 1Q9WB 2H8PA 3TIDA 3W5NA 4PRBA 4JQIL 3E6HB 3CCEA 4PJAB 3HE7A 4NQCE 3CE1A 2VC2B 4NQXA 3E19A 2APVA 2GAZA 3NPSB 5IQ7H 3QORB 4ZO6A 4J6YA 1AZVA 4LPXA 1E65A 3OW2A 2ZPFB 3M45A 4M1DH 2HJFB 1OGTA 2AEPL 3ZKSD 4HJTA 5E8NB 3TESA 4FZ8H 2VAAA 4C8QG 1EH9A 1OCOB 4Z7VE 1WLPB 2LTQC 3MODH 3WTUA 3VS2A 2PP8A 4MMXC 4Y91A 4NQVA 1TCMA 3BH9A 2COVD 4N2OA 3ZT7A 4HKJB 1I7RB 1QCFA 3Q05A 4F7CB 4FADA 5DVMA 3PWNB 1UZ6E 1QSEE 2B77A 2C1PB 4HKBB 5GGQH 4HUWB 4KGJA 4S10A 4UV4L 3BIBX 3ARFB 3KL5A 5HI4D 1QBML 1ZBXA 5I26A 3BIKB 3UZQA 2X3AA 4JUTA 4U1KA 4XZUB 1QW1A 4AZ8A 3GZOA 2MTPA 2O4XA 4LCVA 1K9MC 5FUOH 4KUIA 3C4SA 1BD2B 3BUPA 1YZZA 2GTJA 3O9WA 1YEKH 4IBLT 5GAN2 5GAMg 2ICEB 5GQBA 4XCCH 4ZX3A 2FZCB 1ZT1A 4L5FE 2BDNL 2ZPKH 4P3DA 4Z8AA 4F9LA 2Q3XA 1YHQT 2HXAA 3CFNA 5EUOF 4WW2F 1T0MB 2F9BT 3CBRA 5ANHA 1E5YA 1JJ2S 2XFXA 3RDTA 5L8KB 3EO1B 1A7BA 2DBLH 4QF1B 1WD9A 2JCCE 4JFEA 3RP1A 2ZX9A 2ROTA 1MF2H 2FATL 2N4IA 4A2HA 3BEWB 4K8RD 1G7HA 4XNYH 1YCYA 5GMKh 3VFGH 4FNPA 5MENB 4KZCA 5JHLL 3LSOA 5K93A 3FKUS 2HFGL 2EE9A 2V5YA 2XLLA 5E2TH 3IGLA 2DKUA 2Y1YA 1QI3A 3MSPA 3QJFA 3NCCB 4UNVA 2VH5L 1MW3A 3JB9D 4TLTA 2YR3A 4X6CE 1J9QA 2XUWA 4R3SA 2DWTA 1QEWA 5HD8D 1AHJB 1FWXA 3UMTA 3GXDA 1AS7A 3HHMA 1H3HA 3GMQA 4LSSH 3MLXH 1N7ML 3RMQA 4MNQE 2X10A 1CT8A 2E6QA 3IJYA 4JY5H 3SPIA 3GMMB 4MJ5B 4XAKE 4KKZA 4GSUA 1KJ2L 3EJUA 4OZHB 5HCKA 2EEBA 5ABDE 2OS7A 2JIXA 5DZLA 1UDLA 3CCHA 4TULH 4OF5A 5LGHH 4PJ6A 4OFVA 4DPCX 3CCQQ 5HYSB 1ZLDA 3HN8A 3CBOA 4J3WA 4Z77A 1S78C 1J8HB 1OARL 3LH2H 4OZGF 3ALXA 4LEOB 1D5XA 2OMYB 2Q7NA 2Z65C 4QRPE 1IJNA 5IB5B 1UFFA 3A24A 2Z91B 3CPLB 2Z92A 1AG0A 5CNHA 1VQKA 4AQAB 4GS7B 2CDGB 1R0CB 2G9KA 1VSCA 3FUHA 2OR9L 2PPAA 3S4SG 1K76A 3WELA 4AQOA 1L9PA 1TOXA 3BAEL 3FXIC 5CJXA 5I30L 3GBML 3V6OE 4U6VH 4FQCH 1JUFB 5GANe 4GG8B 4EIUA 4XNXH 1RK7A 3CDFA 3ARBA 4E41E 3T0EE 3JWNE 1GS6X 3CC4A 3AHUA 2AV1A 4C8QF 2QVMA 5EUKA 2YT6A 1WZMA 3S34H 2BX5A 1OPGL 5JIKA 3GMNA 1X5XA 4JEGB 5DHDA 4ONHA 2KROA 3NPFA 4GLRH 2WIMA 4MDRA 3SWNC 3CGTA 2QGBA 4U3SA 2E74C 5EORL 2YPVL 5HHVL 1F4WL 3ECWA 5JPMC 2QG9B 4WWKB 1MNDA 2WZPD 4XP1L 1B4LA 4NKMA 1WFMA 4AYFB 1ZLMA 4WNJA 1DLFL 3OVUB 4XPAL 3N40P 2Z4TA 5CJXC 1NJIR 3D0LA 3SGKA 3GMLA 2WSCE 3KLAA 4K94H 4QHLB 2BIOA 1M7XA 5CZXC 4YL4A 1SXNA 1HZHH 2BERA 3P0GB 4AQ1C 2AABH 4DZ8A 1JWMB 4K5PA 2E6PA 4UDUB 5LG1A 5IFAL 3M86A 4JJ5A 4ACPA 3V6OC 4YVNA 4AY0A 2QBWA 1H0DA 3MLTB 1D3BB 3R6OA 3ARFD 2ZOUA 2MTAA 4Y19A 2IQ9H 3SKMB 3GXIA 3T0EC 3U6RA 4KKCC 4AV0A 4PBVC 3JWNC 2NUPA 1DUZA 2VNCA 4JN2B 1BD2D 3JVGC 4XXCA 2B15A 4M8RA 3ZGIA 3CCMQ 5L7XH 4IBYA 4A4GA 4D7PA 1SYVB 3RHWF 1ZLVH 4C56E 2WQRA 4JS4A 4OLVH 5HYJE 5IQ7L 2DWEA 5GAN3 1M4ZA 2DVEA 1IV8A 1CF8H 3WFDH 4FMVA 1LEIA 2W0ZA 2H5UA 5IB4A 4XCNB 1SJMA 1UM6L 4TF4A 2D7OA 2X87A 3JYBA 1VQ8T 3DETC 1RVFH 4NUQA 3STZB 3MODL 4EOWH 2O93L 2WTRB 4NO5A 3VFUA 3OYDA 5MEND 1SOQA 5FYLH 2X89D 5INDB 4AIXA 1PM3A 4L4TB 1KHCA 5IMMB 2BSTA 3AS3A 3EJZD 2XU8A 3PHOA 3MRPA 3BVNB 5F96H 1CFTA 1J5OH 5KYWB 4FI7A 3KPQA 4DKAA 1HHGB 4NPKA 1UASA 3VG9C 3KYOA 3HR5A 4DKDC 1CICA 4CU8A 3WMPA 5JMRA 4XTZA 5FYKU 4KKQA 2ICWJ 4ADJA 4LSUH 5C08E 4APQA 5FUOL 2FT6A 1YMMA 1EZVX 2CP6A 1TOVA 3D18B 1NJIU 1HE8A 4PJFF 4FGMA 1YEKL 2PUKB 2GKIA 1QABA 1IGJB 2ZKWA 4QYOA 5GS2H 5JHDD 5BOZG 2VXQA 3EBGA 4ZFFA 5JIHA 2J56A 3F6IA 3GI8H 3ZHFA 3OR7A 4KRTA 1S7WA 5FA3B 2AEIT 2R5AA 2L8AA 4CBPA 1SEBB 2Q3AA 4PHZA 4KK8C 2EUZA 4I0PC 3Q2LA 2DBLL 1KCUL 3LNFA 4TQHA 3VD7A 2YUOA 1VENA 2NZ1A 4GQRA 3T6XA 4AJ0A 1TSRA 3WE6A 1QWFA 1HL9A 1MF2L 1U8MB 4FA7B 1LO0H 4AG2C 4XNYL 3VFGL 5I0DA 3I56Q 1PX4A 2ZUTA 4AE0A 4XNUL 2CKNA 3WHE1 5E2TL 2R69A 4FHBD 4DT2A 3LLRA 2AK5A 4WFED 4J3OG 4PP2B 1BCOA 2JKXA 3B43A 4MMXA 3UTSA 1ZA2B 1XZWA 3BSZH 3FNKA 4XCYA 4W6WB 4CA4A 3HS0B 5I8CA 1WA0X 4OKVB 3KWTA 4D3CH 2HWZH 2ODHA 3MLXL 3I5RA 2ZUVA 3HCVA 4KUCD 3T2NH 4F1ZA 3CCVQ 3QEUA 1IGYB 4JY5L 1Y7VA 1TZOA 5SWZE 2DD8L 4UOW1 2ZCKH 1RAGB 2D7NA 4CJ1A 5LGHL 3GSXA 1JYXA 3OXSA 3ARVA 1P69B 2VXVH 3RIRA 4M7AE 1DDTA 3D85D 4WWKD 4NL2A 2DQGH 2PYEE 1AWJA 2Z34A 3ILQD 5HYEA 5EPMB 3GWJA 2A9DA 5HGGS 2Q87A 4NQCA 1PNJA 1BMWA 1D5BB 3MCKB 3II3A 4M02A 3VFTA 4HPHA 1IGTB 4P2AA 2JTDA 1I53A 2Z31A 1QSZA 2V2TB 1QLRA 4F7UE 1LK2B 1X7TA 2NXZD 2PLTA 1UG1A 4PJLA 1KNOA 5I6LA 4Z7VA 1ZT7A 3AQDA 2TRYA 1G5AA 3D9AL 2GJ6B 3FAXA 3Q9PA 3LQZB 2RR3A 4EKXA 4U6VL 5ILTH 1J0JA 1X5GA 2Z8RA 4XNXL 2O1AA 4WTZG 1YEDB 3BCFA 2G4GA 4H0IA 5IV2B 1QSEA 5LJ5g 3H42H 3REBB 3P02A 3QR0A 4LAQH 4K9JA 2L3PA 4PJJA 4Y4FC 4EI5A 3ES6A 3MJGX 4AV4A 4U6YA 1F3JB 1PD6A 4FFVD 5EBMA 4DN3H 3MV7B 4FHJA 4HCFA 2JJ9A 2C7UA 4R7DB 3L1FA 4DQ2A 4V11A 3FC3A 3CMOH 3HN3A 2K0RA 5DC0A 2AGJH 3ZHDA 2WJ7A 2BPBA 2H1XA 5DK0B 3QRLA 4B0MM 2QFRA 3AT1B 5AVSB 1U2CA 2FJHA 1QRKA 4GKZA 3FOLA 3FQXB 2NUTB 1FNGB 4N8VG 3ARDC 4K94L 3QCUL 4RSYA 5FC9A 1AD0A 5IREA 4L4TD 1ZPUA 2JCCA 4B9KC 1HZHL 3FB7B 1PLGH 1CG9B 3CX5K 3K2KA 1A3LL 4E9TA 4JFQA 1JWUB 3MGTA 1U91A 5KN5A 3L42A 3L9BA 3IJ8A 1KT2A 3PWLA 4QHMA 1JNNL 2IQ9L 2WIIB 3FUDA 3E1F1 5DJ0B 3WV0A 4F80A 1I82A 2CIIB 2C9UA 3B5HA 4X6CA 3VXUE 2X4TA 4HAKA 2BZDA 3QNFA 5JXAH 2CA4A 1HHKA 3BD3A 5L7XL 1IB5A 4LDWA 3HBGA 4NL3A 1NJ9A 4MNQA 3N41F 3E1SA 3EFDH 3TGXA 1LP9F 3HUJF 4ENED 4OGCA 4P05A 1MY5A 3D3VB 4OLVL 3VD9A 1NUNB 1CF8L 2GI7A 4XMKL 2EP6A 2X12A 2XN9E 2YD4A 2ZP9A 1MY7A 3IK2A 2K6YA 1P7HL 2J1XA 4P5TC 2YRDA 2UVFA 4P5KB 2AQTA 1F45A 5BZWB 5LNEA 4E9VA 4IDJH 5JPMA 5IW1B 5KVEE 1W72A 2GTZA 3QISA 3MLRH 4MJ4A 2C1OB 4ORGB 5FYLL 2HZHA 5D55A 3MP8A 4QRPA 2F58H 3DJ9A 1VEMA 3P4MB 4WFGE 5TDNA 3ZIYA 5F96L 4A54A 4XHQA 3RPIA 4Y28E 2DLIA 2FJFB 1A9EB 2ZX8A 2FQEA 4ONFH 4PR5B 4TQ8A 5IMOA 1FVDA 3OBAA 2AMUA 5CLWA 5DA0B 1TUDA 1Q86R 1RU9L 2FJSA 2BZXA 3OKMA 4LSUL 3ROOB 2ZYHA 32C2A 2QQSA 1FG2B 2NWMA 3BFQG 1JV5A 3V6OA 4ZMNA 1MCCA 3S36L 2W60A 5LJ3f 3PRZA 3CVHL 4QT5A 1EAJA 4E41A 4F15C 4RNRB 3T0EA 1S3KL 1VQ5T 2K5LA 4RTXA 5FYKD 3IDIB 1B4RA 2A7BA 5KJRH 2BHZA 4HIXH 5DEFB 2KNBB 2FVNA 2DQUH 1RAAB 3CVIH 4X4XB 5IFJA 4M7KL 5GIRA 3KLLA 3NIGB 1MRFH 3SE9H 2IBZY 3BO8B 3MXVH 2J21A 1F41A 4BKLA 3GZQA 3OMIB 5K9KB 2EFIA 3ZL2A 4L4JA 2NDGA 4HBCL 2CP2A 2EQMA 1F6FB 1G7MB 1MI5B 3FQUB 3QO0A 4YDJA 4Y9CA 2MOVA 1R0AH 2APSA 2VOTA 4JFHE 5H4ZA 4HCZA 5ECAA 5T3ZE 3AY4A 1EEYA 1KV3A 2WW8A 2GJ6D 3BSZL 1TITA 3A23A 4N8UA 4NJ9L 1I9RH 3RFZB 1R17A 4H2CA 4D3CL 4OQTA 4JW3A 3T2NL 4X0KB 3VXPA 3RDVA 3REWB 1TQCC 5L2JB 4XCEA 1XFPA 3EYQD 4D9QE 2XCMC 2WQVA 2ZCKL 4B3EA 5KEZA 5KYNA 1EXGA 2OBGA 1JNLL 3KCPB 5CLTA 3CD4A 1M2VA 3VRIB 1JWSA 1C16B 2IPKB 5IF0A 5FLVA 2VXVL 3D2UD 3MRBA 1T20A 4BH7B 2DQGL 3FQNA 2Y1VA 1N8ZB 1Q86U 5CBEB 3H7BA 4IUQA 4PVLA 1I8LC 4ZFOL 2EYTA 4C56A 5E5MA 5HYJA 1WBYB 3DUHA 2XY1A 5J5EA 4I0PA 1SY6H 3LKRB 4MJIE 5FW7A 2D8JA 1ERNA 3PHAA 4UM9B 5HHPA 5CINH 5EBLB 3II2A 4LVOC 5F1OB 1FG9C 5F7LB 1J8KA 1I1YB 1S4IA 4PRIB 4G72B 2D0GA 1MHEB 4ZPTB 5D4IA 5BUGA 5FGSA 4KK9C 4P23D 3SGEH 3BOVA 3LKPB 3F5WB 2ADIA 2F7OA 1PQZA 2A9MH 3CUPA 1PRMC 2MPVA 4P9MH 4CVWA 2DZCA 4KITB 1LD9B 3H42L 1G7IB 4QVCA 2C3VB 2FL7A 2CUDA 1AGCA 3KS0J 3VWKC 3ULVH 1HQ4A 3GB7A 5L88L 4YSQA 1QRNE 4L0PB 2NX5D 1NFIB 1PEZA 1Z66A 5C08A 4DN3L 2VWEE 1DDHB 2IALB 3O2DA 5HSFA 4ZMAT 3P73B 1CD0A 4WI0A 3CMOL 1R5IA 2AGJL 3DOHA 4ZSOB 1UZGA 2Y23A 5E2JA 3GKWH 2BCKB 1T21B 4U1HA 5CLZA 4WI7A 4BFNA 5E6YA 2BMKA 1WHGA 3N44B 4ODUB 3ZE2B 3KLSA 1G0DA 5F1KC 1KJMA 2JN0A 4FQ2H 4Q89A 4IUUA 3HIZA 3L3IA 5CKAA 3I6GA 3JZ7A 2LX7A 1R24B 2P5PA 3FRUB 4QMEA 1Y0LB 1T2QL 3MJ8B 1EAQA 4QPEA 4CC3A 4M7JH 5AKSA 1KJ3H 4QWWD 3DJRA 3N06B 3DDFA 1DQLH 3QARA 2OYMA 4GG6E 1I3RA 2Z9TA 1AC6A 1K4US 5TFSH 3SQBA 4DGVL 3GTNA 4IEFB 1HEZA 5D7EA 2UZXB 1LEGB 4N8PA 2HKHH 1J1OH 3EFDL 4XPHL 4HZLA 1L7TH 2BVYA 1C12B 2VWEC 3FCTB 4OR1A 1GTFA 3NQKA 1WCBB 2XZZA 4KUDK 5SWZA 3OYLA 1ECZA 4XP9L 4MDXA 1VFMA 3BAJA 1X7SA 3AB0C 3WYRA 1EHAA 1JK9A 3FN9A 3PDDA 1FYTE 4BCZA 5HHOB 5GMKj 1U33A 3FU7B 3QHFH 5GGRY 3CFBB 4F7MB 3D09A 1YNTF 1HILB 5DRNA 4DGYH 4M7AA 1K3ZA 1RSFA 1MI5D 3G7ZA 4KULA 1CYXA 3EBIA 1E5UI 3MLRL 2PYEA 3LNGA 4LOFA 1NUFA 2F58L 3F64A 5CJ5A 2WXMA 1A5FH 4G80B 3IXTA 5CLYA 4KKBC 3Q48A 4KY2A 4X7SL 4ONFL 4M6MH 1QYGL 1KTLB 3TCXA 2HKNA 3ARDA 2Z93B 3AU1A 1SYSB 4JL2A 1LILA 2J43A 2IVWA 4F7UA 3B9AA 4JGNA 1BM7A 1DVXA 3G6JB 4JJHA 3OXRA 1YDPB 2X4RB 1ZA3B 4YTLA 2P7TA 4RGNB 5EO9B 2NW3A 3RKPA 5M94B 2YXFA 1OAZH 3BCDA 3L3KA 5GJTL 3WIFB 2WYZA 1I1AC 1F90H 2JJSA 1PZUB 1J0KA 2DN7A 4UQCA 3HB3C 2JLLA 4J3XA 1ZS2A 1KV7A 2DQUL 4MFHA 5EDSA 4WI8A 1BVKB 1OGSA 5SWQA 1DBMH 2PNDA 3WY3A 3BW9A 5KW9H 3MXVL 4HUVB 1QNZH 1KC8R 1GJIA 1SXZA 4EUPG 2IOIA 4PRPB 2DYPA 5LGYA 1R3HB 1DQQA 2ITDB 3C95A 4UM9D 2Y24A 4P5TA 1UZ8B 2BP5M 1MNUL 2HFEB 2V7HB 4PRID 1YITA 3C08H 3R8BB 5DJCA 4LD6A 1HZKA 2ZXGA 1I9RL 2ENYA 3QUXC 3A1PA 1KZYA 1H3PH 2E0PA 4BRJA 3H55A 3M07A 4ZO7A 1RUQH 3LN9A 1UADC 2VR8A 3RU8H 3T3MF 2ZPHB 5DT1H 1ZLSL 4IMLA 3WN6A 5EEYA 5F1IA 3Q5YA 4C8XA 2OTJA 1TVBB 2WVTA 3V7AE 5A3IC 4JO4H 3FFOA 4OGEA 2V8JA 2EECA 4GUPB 1JXMA 3NJNA 3CSYA 1V05A 5DVLA 4IOFC 1S8DB 3CSBA 4U1IA 3VXUA 1WIEA 3G5ZA 4Y4HB 4X7TB 3CFDA 4HX1A 1R5VB 2R1YB 5FRNA 2X6MA 3QQXA 4KVPA 1PYWB 2DDQH 2CH8A 2BVQA 4GKNA 1UWXK 1IAKB 1OULA 2ESVE 1V10A 3NDZE 2X4NB 4FI8A 4ERSH 2XN9A 1SY6L 1AWXA 3FU3A 1F00I 1MXDA 5CINL 4TVUA 4PRHD 3H6ZA 3U7AA 2Z3FA 4AEIL 2RA2A 3RPBA 3C5SB 4FFWD 1X6BA 5IBLD 1T0HA 3VS1A 1V3KA 3NCJH 3VUZA 2DH3A 3TVTA 5AL0A 4KKLD 4LOVA 4DP8X 4GUOA 4HCCA 3QH3A 2GCYA 1WP6A 1AGBB 1L5GB 4L3CA 5C6SA 3NEXA 3VQMA 3C2AL 2FTAA 2CP5A 1CU4H 3DPBB 4R7VA 2DH2A 5E7BA 5JDSB 4AH2B 3ULVL 5E6ID 2E3HA 1RIVH 2VMEA 5IQMA 1FGVH 3CVHB 3QXTA 4X9BA 1MFDH 2AITA 3UTOA 5E2UL 2HX8A 4Z3EA 2WBJC 2F2WA 3B3IA 4H4NA 1LE5B 1PZAA 2F74A 3VFOB 3ATDA 2WLIA 3MRJB 4P49A 5HHOD 3GXMA 5EOQH 2X4XA 2XDBA 1SGKA 4PJXB 3US1A 5D8JH 2YQBA 4WFFE 3UL4A 1CI3M 1F1GA 5DJAB 3V0HA 3EH2A 1EDHA 1GW6A 5LNDA 1NUGA 2YRLA 1UQSB 1AHWC 1QUPA 2A3LA 2GT9A 4U6XA 2NY2B 4OLXH 3NFNB 1QKZH 5DC9B 4UB0L 1UCBL 3MRQA 1DCEA 1B34B 5LBSA 1DQLL 2WZ6A 2XZCL 5DMJB 1UA3A 3TJEH 4F33B 2WQUA 5TFSL 2NR6C 3BMVA 3QYMA 3MUGB 3RIFF 1N19A 4RGND 3GSRB 4ZUVA 5AD0A 2R2CA 4NN5B 2WTPA 1QFWI 3MLYL 2HKHL 5E8OB 2BOCA 3GJEB 3O45A 1EJFA 5SX5K 2RHYA 4E0RB 1L7TL 1QVPA 2FSEA 1CB4A 5B4MC 4H40A 1U58B 1U8HA 4E6RA 3VWKA 2WXFA 1ODUA 3QO3A 3LH5A 4R5TA 3TZVB 5LUMA 2NXYB 5LDSA 1BOGB 4GRWF 3PWJA 4YMPA 3QHFL 1OD7A 3CDZB 4PRNA 2XYBA 1UYWL 3OSKA 3PLYA 4PRPD 4ZFOB 4DGYL 4I0CC 1VCAA 4OZHE 1UEYA 1G7QB 4FQXC 3AXLA 1QATA 3FTYA 4M9OA 2B39A 3WFBL 5FYJU 2XX0A 4LIQH 3MLVL 4NAJA 1MCPL 4POUB 3OZKA 4M6ML 5C9KA 1J8HE 1A4KB 5F7BA 3R06B 4MJIA 1NBZA 3WTXA 1ED3A 3FZUC 3UWNA 2YJQA 3BVDB 4MXVE 3WFHB 2VUBA 1WWWX 1U93B 1J0HA 4JDZA 4OM0H 1JCKA 5HDBE 3TU4K 4PJIE 2NYKA 4MSWA 2E65A 2IDSA 4G43B 4IKIA 3HS9A 2QZ5A 3DX6B 1VQLT 4HT9A 1AKJB 4O02A 3UP1A 2X0WA 1YUHB 3ATBA 3GDCA 4FQHA 3QDAA 4DK5A 1KIQA 3MNWA 4Y4HD 1QRNA 2ZF8A 2AZUA 3PWVA 1HSAB 3QQDB 1OAYH 4BSJA 3HI6L 3QI9D 5IHIA 2F7PA 4KUZL 1YPZF 4M8QB 6PCYA 4M1GL 4UBDD 1HHIA 4B50A 3JCMd 4JZJB 3DSFH 2WKOF 4LEBA 4OFIA 1PG7H 9PCYA 4LLUB 3EXLA 3DKMA 4CSZA 3P3YA 5FYLD 4AEHL 2IIMA 1PNDA 4D9LL 2CO2A 2BM3A 3KZ8A 3DURB 1IUZA 5DEGA 1CLYH 3L4TA 2BIMA 4N2CA 5F8RC 2HAZA 3HNSL 1JD7A 2A2QT 5FKPB 3S96B 1REIA 4KU1A 4MRCA 2DWDA 1T1YB 4ZXBC 2OZ4L 1ZMYA 4DP7X 4WEEA 4N90D 1OO2A 1S9KC 4PUBH 3FCBA 1AZUA 2GHWB 4G6KL 5DT1L 5JO5B 2VDMH 3MV8B 4DJMA 1UWGH 1LCKA 3A4AA 4LPUA 4PLLA 1TQWA 3RUXA 2CALA 2CXKA 2P5EB 4JO4L 4GG6A 2VW7A 3DV4B 2WXGA 2SEBB 4WU5A 5GS2D 1OX8A 4NB7A 4POYA 4S1DC 4JUVA 3QJZA 1BEYH 4H44C 3M46A 2CO4A 1BPLB 4LKCB 3V0VB 4ETQB 4XTVA 1ZVSA 2DQCL 4PQXA 2G2RB 1KY7A 1FCGA 2V17L 4Z7AA 4XP5L 4PGEB 2APFA 1IKNC 2NZ9C 25C8H 4ETYA 1RLWA 3ESMA 4NZTH 1RLQC 4JLRA 4L8CB 5CK9A 4HS3A 4NHUB 2LQNA 1Z1WA 1KLUB 5F7NC 4N0CC 3D7SB 2HL3A 3G6EA 1FYTA 5J6GA 4PJ8B 3N0AA 4PV9A 1ZV9A 3F7RA 3G9VA 3SDAC 4BSVA 3UYRH 3WNMA 1HCZA 3TF7C 2HT3D 3NCJL 2A28A 5I23A 2NY2D 2FEEL 1N2RA 2VJ0A 2EKSB 2H0PA 3TBWA 4UINH 5LCVL 1CFSB 5E7FA 1HH9B 1T3FA 4Z5RB 3O2VL 1A9BB 2Z0UA 3TIEA 5E8PA 4WTWA 2XETA 1KK7A 3QUXA 3TXAA 2ZYRA 3UADA 1X5ZA 3H2QA 4IYKA 1BG1A 4IURA 5EU3B 2G0LA 5DVPA 3PFUA 3W39B 2CLZA 1RIVL 5DRWB 5FUCE 1FGVL 3IMUA 5C8JA 3JV3A 1MFDL 4UNIA 1V3JA 4TL5A 1QA9A 3GS7A 2A6KA 3OB0H 3TZVD 1PX8A 1TTGA 2NXYD 3DRQB 1JI2A 1MMNA 3A5VA 2P9RA 5EOQL 1FNEB 4HOZA 2NY5H 1ZTXL 1NCCL 4AUYA 2H45A 2GCXA 3L5WA 1BZDA 1MCWW 1X5FA 2FT8A 4E9RA 3VX1A 2Y06H 3W81A 2WVVB 2NSMA 4JHAH 4H2AA 3QUIA 1IQDB 5ITFA 2VKWA 2DQIH 2CZ1B 4IIZA 5DRXA 4TSAH 3V5KB 5JORA 5ISZD 3PWPD 1GAFH 35C8H 4NZDA 3AREB 4OLXL 1K5WA 3CXHJ 5F6HI 4UTBA 4R56A 3P2BA 2H3JA 1IVLA 1F3DH 3LKOA 3LPOA 3MRFA 4NZ8A 3QXDB 1D0ZA 3TJEL 2DJQA 1G3WA 1VQ8A 5E9DD 3AROA 2AJSL 1U9KA 1TXQA 1E5BA 2DJMA 1DVFA 4OLWH 3FO9A 4GSDH 2AXGB 3RIAF 2AANA 4BFGA 2QADB 5JZ7D 2QYZA 5B3JE 2C9XA 2EYRA 3URGA 2P8LB 1NINA 3L8QA 2E6NA 3NA9H 4FCAA 4K3GA 1QP1A 3QJXA 4OI9A 1AKJD 2X9WA 3B2VH 2DD5A 3DX7B 2YK1H 3MFFB 2D9TA 1XH3B 5IM7A 3E8UL 5BRPA 4Y1SA 5IFHL 1Y96A 1XZ0A 2WY3B 1ZE3C 2LLGA 3VH8B 4AFZC 1FZMA 3CZFB 5EZOH 3HW7A 5HGHA 3FRPA 2JB6B 3WL9B 3VS4A 3B9DA 1E4KC 3IETB 1A6AA 2NY1C 1WHLA 3QSKB 1M1KC 1E7UA 1G1YA 3O3UN 4IMKA 4RAUA 3RWFA 1CFBA 3FOMA 3H4FA 1GGTA 2WN2A 3CZGA 3DX9B 4OSUH 5C7ZA 5C0IA 3EG1A 4LIQL 2FK9A 1OF0A 4ABVA 3BISA 2ESVA 2ED9A 2RA1A 2ZXBA 3NEEA 3ZE0F 2KE9A 4MJ2A 5AVTB 3RVWD 3JCMW 4QHKI 2HJLA 4WHTB 5FOJA 2FO8A 3NVQA 4X7EC 5FYJD 4KDVA 3HRZC 2I69A 3QORA 5IQOA 1N59B 2EXTA 4H1LA 1PDKB 3MV8D 2HJFA 2DIAA 2YSTA 3K8MA 5KVMC 4KI5E 4FABL 3LH8A 4ESRA 4PW9A 3IJ9A 4RIRA 2FAUA 1AYOA 2C3HA 3WKNA 4B5EA 4OAWA 3ORJA 4FFYA 3DYPA 2EDYA 1FNSH 4HKJA 1I7RA 4NNYB 2VW6A 5D4HA 3V0AC 4F7CA 5C0JB 4C4UA 3DO4A 1Q7YR 3Q2CA 4WSKA 1NM7A 1GMIA 4MA1B 2QEXQ 4HUWA 3B9KB 3T0XA 1MJ8L 1WUNT 4HWBL 2FD6L 4ODSL 4PD4J 3ZGHA 3NAAH 1CFQB 2H1PL 4C59B 4AKQA 1VACA 3RVTC 1P5UC 4YAQA 3MV7E 1Y1UA 3AGVA 4W81A 3CN4A 4AW4A 3HZMA 3MJ6A 3PU7A 2ICEA 3EJCA 4FQXA 3ASOB 2EVGA 5D1ZC 1T2JA 2EYQA 1KCLA 2MNJB 5CZVH 1T1XB 1BFSA 4Y1TA 3TFKC 2P5WD 3O3BB 4H26B 3WCYA 1UWGL 4QF1A 2BTTA 2YGQA 4KI5C 2G3RA 1UTIA 2LZ6B 3K6DA 3U4BH 3UTQB 4HV8B 2GVYA 2MOGA 1ONQB 4DK3A 5GMKe 5H37A 3FDWA 4B97A 3MJ9A 3P8HA 4M77E 4KJQC 3NBNA 4BB7A 4IIQC 4X99B 1FIEA 5EFIB 2VN5A 4Y16D 2LNHB 1JXJA 1U8IB 3R19A 4KJWD 1EAPB 1T0NB 4NQDB 25C8L 3BPLC 2D73A 4NZTL 1GS8A 1OE2A 3GJFA 5JR1H 1JRHH 1NSNH 4MCYA 1VIFA 4FDWA 1ZGLP 1FLRH 3RKYA 4AL8H 3D3VE 3UYRL 5MP6H 3EHQA 1H641 3MNZB 4RCAA 3ARED 4OZHA 3Q6FB 4WJ5B 2N1KA 3MV9B 2ZSVA 3PAZA 4UINL 3GUFA 1TU0B 1Q7YU 1H9VA 3GDBA 3PQYB 5HGBB 1SG5A 1J8HA 2D03H 3L7FA 2BIQA 3FN0H 4DKEH 3GLXA 4LEOA 3WO4B 1NGXA 1NC4B 2QADD 2JW4A 4XMZA 5IB5A 2KPWA 1SJVA 3KLHD 3M0TA 1NCTA 4HIHA 5I1AB 4AEEA 2CDGA 2JI2A 3JCMf 1K9MR 1FO0A 2B1AL 5L23A 2F0CA 3CC1A 3MBWB 1GMEA 4JJBA 3ZZLA 2VUOA 4R83A 5L2KD 3M1BA 4G9FB 1S5IL 4M77C 1MFCH 4PJIA 3UJTH 4BYHA 3O6FB 3LYIA 2OTLQ 2FHFA 5D6CA 3CMET 2EIDA 4MD0B 1WAPA 2AJZB 2VIRB 2LV4A 3NCMA 2NY5L 4HJGA 1TZHA 2ATCB 4QXTA 4WHYH 2QJDA 3VSQA 5BW7C 2Y4YA 1ZHNB 4K71B 3ZKMD 2WO4A 2DEQA 2Y06L 2ZNXA 2FBOJ 4JHAL 1E4WH 4KDWA 1IKNA 4UZSA 3T6WA 1YN6B 1GAFL 35C8L 2YGPA 2BC4B 4PGBA 2ZOLB 2DRUA 1YI2T 4MYWB 4E42B 1BQHB 1HNFA 3P2DA 1S7SA 4F5CE 2JS0A 2AXJA 3SDAA 3PXHA 1Q1PA 2RMNA 2ABLA 2L04A 5FW6A 4CL7A 2FRYA 3L3OB 2PCYA 4FKKA 4G6ML 4WWKA 4PBWD 1G7PA 4QO1B 4BZ1L 3AMLA 3SEMA 1B4JL 3HZYA 3QUZC 4X98B 1XTDA 5DUPL 3ULVD 1Z0MA 2ZAHA 4Y9FA 3EG9A 1E6OL 2K6ZA 3IDMA 3JWNG 4KPHH 3VFPB 4QHLA 2Q8BH 2YK1L 4PS3A 3NK4A 4Z7VF 1YJ9T 3WXVL 4WCYH 1JWMA 4JS5A 1IGQA 2FWOB 5BVPL 5EZOL 4XNQB 2RMOA 3JVFC 4QRRE 3B9KD 1L4IA 1OU9A 2BP0B 5IROD 1XCXA 3MLTA 4BZ2H 2A0LC 1D3BA 1L0PA 3NABH 4DVRH 1NAMA 1UZ6F 3MO8A 4XI5D 1RJYA 5MI0C 2V4LA 2QMJA 5JLZA 3AG1B 3QQNA 1ZHKA 4RX4A 3GNMH 3MFGB 4KBPA 4OW6A 2J6OA 4M78B 2F68X 1GZHC 2FH6A 3FSVA 1INEH 5IXFA 2FQFA 1BX2B 4ZAKB 4CMHC 2P0PA 2R29A 3OQ5A 1G6RH 4HS6B 4P9HC 2EZ0C 1OXYA 4I3RL 3ARPA 3QZWB 1F11A 4ZUTB 4XCNA 4U1SA 5E6UB 3STZA 4BFKA 1DN0B 4ANXA 1SOKA 2WTRA 2PO6B 2WWMC 2JCCF 3CN2A 2VMDA 3K71A 1FNSL 5AZ2H 5IMMA 3BEVB 5E6SB 2PVGB 4U31A 2EXWC 2R0LL 5LLIC 3ESVF 4X1VA 1HHGA 2AQPA 4W9DC 2WLKA 3CCEQ 3SPVA 3H9YA 4PJGE 1AQKH 4OVVA 4X6CF 4H8WL 2VISB 1ZXKA 5FDYA 2ARJB 4HEME 3UACA 4Y2LA 3H85A 5IVXE 2V6HA 3G3LA 2GY7B 2X28A 1Z5LB 4J4PD 1BFVH 3TLRA 4JFTA 3C6EA 4I77L 4PS8A 2PQWA 3BN3B 3MV9D 1GCQA 1A7QH 5TDOB 5D71H 3FSAA 3PQYD 4YE4L 2VKNA 2DLFH 2VDLH 1Y18B 1AE6H 4ZS6D 1EHKB 4I18C 4C83B 4KRPB 1SEBA 3QCVL 3AVEA 3CCLT 3I55A 1X6OA 1MDTA 1UJ3C 4JAMB 3MRCB 4LCCC 4LHQB 1NEZB 3MEVA 3OAZK 4YSRA 4ZBJA 4AVHA 1NC4D 2YD8A 5L8JB 2H6UA 2Y5EA 3HZVA 1TJGL 1BFOA 3IDGB 3U4BL 3MLUH 1ND0B 4QJ4B 2MCG1 3G4ST 2P47B 3HNTH 4F37F 3ZL7C 3WKYA 3DX0A 4G9FD 3O6FD 3POHA 5F1NA 4FQLH 1MHHB 3P0YH 3CCJA 1HH6B 3VVWA 5I6XC 2P1YA 4LDEB 2YRZA 5TQ0H 1TVHA 3AUVA 3BQUC 2GBUA 4OKVA 3CPWA 5JR1L 2LJ0A 1JRHL 4MAUL 5E0QA 5TDPA 1NSNL 1ITCA 3FO2B 4K15A 4PL6A 2ROYA 4ZTOL 4ZUUB 2DZEA 1FLRL 4E5XB 4AL8L 4J3OH 5I1LB 4YDIH 3WVDB 2IDUA 5FUZL 1BECA 2ZZUT 3SYQA 3EHBB 1HU8A 4X8CA 1WA7A 2QASA 2DAQA 1P5UA 2PXYC 3JTBA 4BY6B 1MRDH 4JQIA 2ZKHH 3NCWA 4F58L 5DD5H 3EDJA 4DKEL 5CP7A 2CYZB 3SGDI 5D1ZA 3ZO9A 1QVOB 4NHCH 4RZCA 2HT4D 2JKJA 3SGJC 4XN8A 4BACA 1FVCB 1BMGA 5AOZA 4FAAB 2CT4A 1D5BA 1ZWIB 3EF4A 4OGAD 4XO3A 4ZDHB 5C6TH 3U9PH 2ZOKB 5L4JA 1OZUA 3FC8A 1JNHB 4ODHH 1MFCL 4FKHA 4LLQA 3UJTL 3KLQA 3OGCA 1H8LA 2EDHA 3CMAT 1TU2B 3FIFA 3LQZA 2X1XR 4LPTA 3MBEB 1Z6JT 2KBTA 1O9WA 1KIPA 3HSBA 1XD0A 4EDWH 4IIQA 3RKWA 4M7AG 4IM8A 5FU6C 1UGNA 3BH4A 3WN5B 1BF2A 1QR4A 1E4WL 3S9DB 3F6JA 2QSQA 4JQXA 5I0XA 1A9VA 4MRBA 1VQKQ 1PF3A 1KIRB 1F3JA 3H7LA 5CP3H 1N18A 3VI4B 5ECJE 1PNCA 1WFWA 3MV7A 4BFIB 1BVNP 4X9FA 4F7UG 4ZAKD 2DTSA 1IAOB 5GAMd 5CN2A 3QUHA 4W9JC 4HIPA 2BW5A 3K6NA 3IAQA 2NNXA 2ZKXA 4OGXH 2MNUA 3BDYH 1U4EA 5AYQA 1GC1C 5TE6H 4MA7H 2QGGA 4GI8A 2FWLB 2IV9A 1C8PA 3VDBA 2DXUA 5I2IA 1YNKL 3CC4Q 1P7BA 2PO6D 3FQXA 3GF8A 1I07A 5I8KH 3MCLH 4ONOA 3O8XC 1VZIA 2DERA 1AD9B 1HCYA 4ECNA 1U3OA 2M8XA 2WUCL 3TCTA 4FERA 4M77A 1AI1H 1JWUA 3NABL 4PWHA 2MWCA 3T77B 5I19H 3ARSA 1YEHL 3MA7A 1PIGA 5CD3B 2CIIA 2QSCH 2R56H 2LVMA 4NXKA 4PTTB 3P77B 1E6HA 2BS71 4ZZFA 5BW7A 2JUFA 1INEL 2XKUA 4UI2A 3TEXA 4YWGL 1KJ2A 4KK5D 4HC1H 4LB8A 5C3TA 4XE5B 5T1LA 4AT6A 1NFKA 4E7KA 3D3VA 2A37A 2APTA 2ZPGB 4UQAA 1HEJC 4KRPD 3G5XB 4JY4B 4OIBA 5EBWA 5BS0E 4X80H 4P5KA 2JVUA 3FB5B 3QG1A 1A1MB 1ZCRA 1Q81R 2R0WL 5D93B 2OX5A 4ORGA 2UZIH 1CMOA 2J5LC 5AZ2L 5D1ZI 3QUZA 3SDCB 2KT6A 4TNWK 4YL9A 5F9OL 3NIFF 2GPZA 4JHWL 4KKNA 5ICXA 4X8GA 1T0OA 1K5NA 3QUKB 1NC2B 3TO4B 1TH7A 4PH8A 3KPSB 4MAYC 1AQKL 5I2MA 5EZIH 2HKAA 2MPAH 4LSVL 1F4XL 3QZPA 2M02A 2YMTA 3FFCE 3KH4A 4NM8H 3B3BA 4P2YA 5EUOB 5IY5B 1LWRA 2FT7A 4DVRL 1G84A 4WW2B 2KS0A 1B9ZA 1BFVL 1YA5A 3EHBD 2HVBA 1WHJA 1MGQA 3L5XH 4JRYE 4RNRA 4RH4A 2KXDA 2PP9A 1O5PA 1T89A 1A7QL 5D71L 3QDGB 2VDLL 3VFVB 4PJXE 1TMQA 3BP6A 4X4XA 2YPVA 1TTFA 1XVSA 1U8OA 1AR2A 2BP3A 1UWFA 1RUKH 4U0RB 2ZG3A 4EE2A 3ZKXB 1WICA 3BO8A 3V9EA 4ZTJA 15C8L 1JMXA 5IT9E 4K5NA 4Z7UE 4F5CA 3DJTA 5HP5A 1IBZA 3JWDL 4KX7A 4H8UA 3HNTL 4ZRGA 1G7MA 2FRWA 3FUFA 4FCYA 4CVXA 4M6AA 5A16A 2KI6A 1MFEL 4DVBB 3OKEA 4X4ME 2A1WH 3FT0A 3T4AC 7PAZA 1ZHLB 5IJVA 3UAJD 4NLAA 1GCYA 1GFCA 2RB6A 4F7UF 2HLEB 4QQ6A 3MBED 3PS6A 4U1LA 2X4YA 3LCYA 1KGIA 3OAUL 1E2VA 1PKOA 2JJWA 1A64A 2TRHA 3REWA 3U6XA 1V7NL 2DKMA 4VUBA 4FULA 5D1QE 4QRRA 4YHNB 5L2JA 5DMIH 2WNXA 3FW6A 3QIWB 2G4EA 1CDHA 2KYIA 3C6LB 5A2JH 5C70A 3PIQB 1Q95G 3FTVA 1EEQA 2X70B 5ES4B 4OZGB 3KCPA 4NQSA 3VRIA 5C2UB 1C16A 2IEPA 2IPKA 1VQOT 1MRDL 4WKZB 2ZKHL 2X6AA 3BDXA 1XIWC 3B37A 5D4JA 3I75A 5DD5L 2CR0A 5FO2A 5GGUA 4BH7A 3L3DA 4MD4A 4IJ3C 4E7SA 1A7NH 1OPOA 4NHCL 4R2GD 4XNZB 1D5MB 3VU3C 1AMXA 4I18A 1WBYA 5H2BB 2NYYC 1UJ3A 4G3YL 4UQ2B 1IGMH 3U9PL 3LKRA 4ODHL 1M7UA 2VABA 4JFDB 1M1FA 2FBJH 1MLCA 3BMWA 3N1PC 5D96B 2W1NA 2H41A 2Z0WA 2R1XA 3M0PA 2WXNA 1QLEH 5E94B 4ZPTA 4BDYA 4C5EA 4KX9A 4C8QB 4YPGA 4IRSD 3LKPA 3A8LB 3F5WA 2JK5A 5D7SH 4MS8C 1SJHB 3C5ZC 1ZX6A 3WKQA 5EO1A 2VLJB 4XWOD 4DERA 5D1QC 3ETTA 3QQ3B 1FZOA 3BQUA 3HBQA 3MUHL 4PJGA 2F53E 3M8OH 1FDLH 5GRWA 2J6EH 4FW2A 2V7NB 5KBKA 5BXFB 3QWRA 4HEMA 5IVXA 2XHCA 3O3EB 4P57B 4I2XE 2DQFB 3BDYL 1W1FA 3RAJL 2BCKA 2PXYA 3MPCA 5TE6L 4MA7L 1CXHA 4RGMC 4KBMB 3TH2T 3VRJB 1YJDH 1KTDB 1W2BS 1F2XK 2DM4A 4EDXB 1ZGLB 3JCMc 4MLSA 2BSSB 5DS1A 3SDCD 3SGJA 3E9FA 5IOPB 1CIDA 1OSYA 1R24A 2X4PB 4HEPA 3ZTDC 1Y0LA 3MJ8A 5IVNA 2AJYH 2ROXA 4BBWA 1KIKA 3TO4D 3MV8E 3OJ2C 3S3OA 4PY8J 2XNAB 3H1ZA 3VW3L 3SQOH 2EQKA 5GS0H 2VASA 4N4IA 1RP9A 2OMXB 2P5EE 3B2PA 3D87B 1VQ7T 2QSCL 4FXKC 4BUHA 1XTLA 5JW5B 1VQLA 2F18A 4YHPB 4JZ3A 5DK2A 5B8CC 5FK9B 1QQJA 1LEGA 5GGSY 5JTWA 2OL3L 2WSDA 3CMGA 4ONGH 2VKXA 3V10A 3QDGD 3V6FB 3OC8A 2UY7A 4Z95L 5IZ7A 3UGXA 2XWRA 2IO5A 3F3HA 2XQ0A 2K7PA 4TUJB 4XAWH 1QW9A 2B3IA 3FU7A 3Q2NA 5HGAA 5DD6B 3QWOA 4RESB 4JX0A 2NCEA 4F7MA 3FUKA 5CR2A 1HILA 3THMH 1I3UA 1XMWA 2UZIL 3B2XA 4N0AC 3FCGA 5EZJB 3K46A 3IFOB 2JE8A 1RHHA 1U4FA 2AJ3A 3Q43A 3TEUA 4A53A 2F7IA 1KTLA 3KPMB 2XA8H 4F2MB 4P2OB 4PJFB 3O8XA 2WLMA 4LOEA 5I1HH 5EZIL 2E5EA 2MPAL 3MRRB 5GAMf 4DQOH 5FO7A 5BZXA 4Z3FA 1EJ6A 3B2DC 1E7OA 4WJG3 1YDPA 2X4RA 4LFHG 2L3SA 4P06A 1GGCL 1RFDH 3QIWD 3C6LD 5JIQA 1NPRA 3L5XL 4ZUWB 4ZNCD 5LJ5d 1I9EA 3WIFA 4JFYB 4NRXB 1MVFA 5HGDB 1OHQA 4NKIL 2D8HA 3BSGA 4J5VA 1U3NA 1ILUA 2OXHB 1E2WA 2ITFA 4PJ9B 2C9RA 1L9RA 4RA0C 1QW8A 3R4RA 2A7YA 5IEKB 4HUVA 3CDYA 1IB8A 3SB3A 4U1NA 3ASWA 4LVNC 3CFJB 5GRVL 1GY2A 4UAOB 4UM8B 2ADFH 2ITDA 2XX1A 3MX0B 9CGTA 4JFDD 4JN1L 1G43A 1UZ8A 2V7HA 4OCRH 2OMUB 5E2VH 1HDMA 1KFGA 1CUOA 4GY4A 2B1HL 4KOBA 3S48A 5CEZH 1BZEA 4WFHD 5K1NA 1JGUH 1A4CA 2FEDC 1OL0A 2K9UA 1G4MA 2WYIA 4LVHC 4C8QD 4B7LA 4DEUA 3IVKB 4TL4A 4EUPH 4P5RA 2YXVA 1CS6A 2CDEB 2BVEA 1Q38A 2VLJD 5C0FA 2D0HA 1IGIH 1RJCA 1HI6B 1IVTA 2XIBA 1EV2E 5DMIL 1N4XH 1DSYA 1TEGA 2YEZB 3PXJA 3TV3H 2VDPH 3QAZC 3NTKA 4KDTC 2DX1A 4FQIH 5B38A 1TVBA 4GRWH 3VD3A 2TSBA 1T04A 5DGRA 1KCVH 2HTKD 5K5YA 2EVIA 2IAMC 4JMNA 4AKPA 1E9PA 1S8DA 3FQ4A 3D4GA 2K2MA 2K57A 2P80D 1WH0A 5IR1B 4PGJA 1S2EA 3B5TA 3T09A 1G6RB 4Y4HA 4QGTA 1QFUL 1Q82U 4N2NA 1PYWA 1JGLL 4N28A 1V54B 1P2CB 1T22B 1U8JB 1XF4A 4Z88A 2QTEA 3N5AA 2EKHA 1QACA 2K3XA 1EA9C 1II4E 5TQ2H 3SJVE 3N9GH 3ZTCC 5A2CA 2X4NA 5JOEA 3G71A 3A4FA 1IGML 1K4DB 3BP4A 3E9TA 2VXUL 5DD3H 3NRPA 3V52H 5BS0A 3HNVH 3CCST 3FO1B 1ASQA 2YWWA 4XAXB 5KVGH 3V7AG 1BAFH 1GL4B 3C5SA 2AKRA 4KAQH 5HY9B 2HSEB 4HIEA 4OUOA 5CU9A 1NIFA 3FRPG 3QA3B 2YEVB 1D1CA 4BQBA 4XOEA 2ERJC 3ULVE 4HA8A 3O0RL 2W92A 2FYYB 4GRLC 1L5GA 4IRZH 1K9TA 1X75C 1TJHH 5ICUA 4JRXB 3RWGA 1IC1A 3DPBA 2WOBA 1JIBA 2WO2B 3SYCA 4AH2A 4CU7A 3X24B 2O5NA 2MQGA 2V3FA 3EH3B 4S2SB 1IBDA 3MOAL 3CVHA 4BH8B 3FFCA 1OF2A 4MJ6B 4QHNB 2VR3A 3LPFA 1KXTB 3ISRA 1X5JA 2VDLB 1X6NA 1XDTT 4JRYA 3D06A 5JQ6H 3KL3A 1I3GH 5E24E 1JNJA 2YUQA 4H1LG 4PW3A 2W59A 2RHZA 1F4HA 3GK8L 1UUNA 3RE0A 3ECQA 4N2HA 2RAMA 1YJDL 3H2PA 3RL1B 4FU6A 1XIWA 2NTSP 2X4QB 2Y7MA 1IT9H 1WK0A 1JSYA 4PJXA 3C60C 2CP3A 2CP0A 2YSQA 5DK3A 4NKOB 3QNXA 3WHXB 1GHFH 3OJDB 1B2WL 1UWYA 4E2OA 5C0CD 4Z7UA 2KH2B 4EZJA 4YXHH 2YARA 3IFNL 1QVFP 4R8WH 4MNGB 3E9GA 1UQSA 2XJLA 4DEPB 1HWGB 2X3WD 4M5ZH 3S35H 5I0ZA 1L9NA 4P2OD 2L7JA 3NFNA 4RFOH 4J9DA 3BUTA 2LGNA 4IJTA 5GS0L 2BSRB 4RTUA 3ZTJG 4X4MA 2FCBA 4ZNXA 3K6OA 5LAPA 3N41B 4RCCA 5HVHB 3MUGA 4N0UB 4ODBD 1LP9B 3HUJB 4DN4H 5DA4A 4WAFA 3WJMB 5FDWB 4L37B 1GOHA 3C5ZA 2RI5A 5E8OA 1R9FA 3GJEA 5FM5O 3R6NA 5KYXB 1KPUA 4ONGL 4W9EC 2ITCB 3AXHA 1D1AA 3D52A 1PAZA 4E0RA 4MA1C 5D1QA 1I4FB 1P7KA 1U58A 2WVSA 4NQDE 4BFJA 3CX2A 4ELMB 1JD9A 2HCKA 4FW1A 1S7QB 4L18A 3ZBMA 3IMRA 3TO2A 3WEXA 4PFZA 4PB9H 3E3QE 1M2OA 1EX0A 4G5ZH 4AXWB 3QR2A 2BO0A 3TA3C 2KQWA 3CDZA 3LIZL 3NJLA 1BJ1H 3UJIH 5KTEH 2ZONA 4MB1A 3THML 4X5XB 3UP6A 2C3XA 1PSKL 1WHOA 1UATA 3S8FB 5H37G 3V6ZB 3MACH 1QOKA 1CKBA 3DGGA 1D09B 3MRGB 2KERA 3WBDA 1R8OB 3WAKA 3FT9A 3QYHB 4WUUB 3CHXA 2IPUK 5DHYA 1N0LB 1PAMA 1NBVH 2HFTA 4OCWL 4WO4C 1MMDA 1BI1A 3DVFA 4LNRA 3U2JA 4DQOL 2Q3ZA 1RK0A 5IEHB 5CUSH 3MRLA 2CUMA 2A5UA 3OV6A 1FH2A 4YHIB 2EC9T 2GBVA 1RFDL 1PVHA 3CXCS 1F5WA 4NZUL 4QR7A 4G43A 4WY7L 3GIVB 2BNQB 1JXDA 2DJSA 4JPIA 4FXKA 3SKOA 2OSLB 2WB7A 5B8CA 4JHBA 5CEXB 3CVDA 1YUHA 3U0WH 4YBHA 2WXRA 2XXGA 3POCA 1UTDA 5J12C 3A3YB 5GAN7 3MCAB 1BXUA 1YJWA 1HSAA 3E3QC 3PG2A 1ZSZC 3HPLA 2EYZA 1HOCA 1V29B 2HP4A 2BSCA 4OU3A 5DJXA 1F3RB 2DLEA 2ADFL 1CL7I 1H8KA 3EOTH 1AOJA 1WVZA 1KTKE 2JMCA 2JV6A 4I2XA 5BRZD 2Q86B 3T2OA 5FKAA 4AIEA 2YPLB 3C9NB 1SF3A 4JFZL 5BQ7A 1EHLH 4LF3A 1AOZA 1VQ4T 1JGUL 4G6AD 3QNZA 4N0AA 1EMTH 3LZNA 5IIEB 3TVMD 2E9IA 4OJCA 4O9HH 3EG0A 1IGIL 2N56A 3BP7B 3QAQA 3VQ2C 1XH0A 3CFEA 3MV8A 3TV3L 2VDPL 3SDDC 2QA4T 4G7YH 5LDUA 4FQIL 2EAEA 2LU5A 2P5EA 5I1EH 1KCVL 3AG4B 5B1CA 2SEBA 4PGZA 2OL3B 5KUMA 3PGGA 2P24B 2XN1A 2E3IA 3CSFA 1FIGH 3FSWA 4Q9QH 1FJ1A 3LV3A 4ETQA 2UZYB 2QVIA 1WXUA 1BMZA 4M6NH 4R4FH 4HH9A 4MD5B 4XBGB 4PGEA 3N9GL 5AVWB 3TSZA 2YOAA 3J07A 4M78E 4L8CA 3CC7T 3SZKC 5AKTA 1AOHA 3HNVL 1YI2A 4AWJC 2WCSA 3PJLA 2YUZA 3ZE1F 3D34A 4PJ8A 5KVGL 2A73B 2OTJQ 3KDMB 2AJXH 5JQHC 5LJ3h 5LJ5f 3F7QA 2EKSA 5D72H 1KBGH 3QEGH 3UTPE 2EKOA 5EF2A 1PLCA 4Z5RA 5J4MA 3T8XA 2HMID 1S9XB 4IRZL 5CO1A 1TJHL 2BVPA 1MJ7H 3S0PA 5EU3A 4ZOBA 3VNYA 2ZSWA 1CDGA 4J3OD 2WLHA 4PK4A 4TSBL 1YJ9A 2DF3A 3NK3A 3W39A 4JFWA 2HA1A 1S7UA 1PFOA 2J55A 3TBYB 4OF6A 3NT0A 4XN9A 3UDCA 1KQ2A 1AQDB 1N9PA 1KCRH 4KDTA 5GGSB 2HEQA 1ZTXE 3VFMB 3JWOH 1C5BH 5HJGA 5F9JB 2QQ9A 4PB0H 3D05A 4DO5A 2IAMA 5H8DA 3GGWA 3NSJA 4FL4C 2CRZA 4O51A 1FNEA 1E5AA 4PN6A 4P5NA 2ED6A 4XTRC 5C7XH 1R34A 1IT9L 5GAOq 2J1KA 1IRAY 2GYSA 4MMZC 1JZ3A 4D8KA 4A7UA 5TF0A 4K8RC 1P7QB 4HKXA 4NQQA 3FHAA 3TTYA 1GHFL 4MDIA 2DTMH 4M61A 3AMKA 5GGRA 1QVGP 1ADQL 1TQSA 4YXHL 4R8WL 4AK2A 5J0BA 3CD6T 1OZTG 1RUAH 4OZHF 3N04A 5FCUH 1RPUA 2EGAA 3S35L 3GRWA 5DFWH 4ZO8A 3LRKA 2ATPB 1EO8H 1HCFX 3QXDA 4G8FA 4CNIA 3WTYA 4K9EH 4LSQH 2JKRM 2HH0H 4W9FC 3TN0B 1D1BA 1Z9NA 2LFEA 1PHTA 2AXGA 1MHPL 4UT9H 4LCYB 4MXVF 1MELA 3JCMV 4Y4KD 2AEQH 1ZSDB 2AVGA 2P8LA 2IWKA 1MCOH 2BNQD 4EZMA 5HDBF 3VDCA 3LRHA 1HIMH 2FZ3B 4PJIF 1MH5A 2J4WH 3KPRE 1CZ8H 3GSWB 3OKNB 4KHXH 4XP6H 3IJ7A 3MFFA 2EYWA 2X1PA 1YNTB 3F04A 4F93B 5AOMA 4PB9L 2AHIA 3B7RL 3VH8A 1UD2A 4FTVB 4KK6D 1E3XA 3CZFA 2WBWB 5KTEL 3UJIL 4DCQB 3FT2B 3IETA 2OQJB 3S8GB 2VXQH 3OZLA 4ZFZB 3H9SE 1PGRB 4M4PA 1JZFA 1ECYA 4JJCA 3ZFJA 1SY6A 4H5SB 4PSRA 1MIEH 1YEGH 2VMJA 4GBQA 2YPLD 3PHSA 4CSTA 3BVVA 3SJVA 4KRLB 1PRLC 1K8IB 1QLEB 4WVRA 2A99A 2PW2B 5IVOA 3W0WB 4FZEH 4G8GB 3PTAA 5GMKi 4HJJH 1NBVL 4HMCA 4NENA 2C4FU 1YJNA 2LU7A 1NAKH 3OJVC 2H3NA 4PJHB 2XIDA 3BD5A 2R69H 2NRDA 3QPXL 5CILH 3G4SA 1N59A 3QJYA 1PDKA 2QGFB 4B5ZA 3P11H 1B07A 3A4DA 1YECH 2GF7A 4DPAX 1MHNA 4OZFA 1HYSC 3BLBA 4IS6B 3PABB 4JDEB 1XBRA 5D7JB 1KGCD 1FFRA 1MCWM 3U0WL 3VXRD 3WLWD 1X9RA 4TLKA 4YLQT 3ARQA 4Z23A 3VJPA 1JDAA 3K2UH 2MHAB 1NTDA 1J88A 1NKGA 1T1WB 2CUAA 2O5YH 3P3SA 3P9MB 3QE5A 4HPOH 4N0YH 4UQ9A 5KSVA 1NCNA 4UT6A 3WEOA 2G9HA 1NZRA 3TH3T 2RTTA 4FA6A 1BQ5A 4GMTH 3TA3A 4HFWB 1U92A 4PWIA 5F9AC 3ML9A 1K8DB 1G4RA 1DQJB 1N8RU 4YUEH 3T3MB 5DUBB 1QLFB 3FQTB 3RNKA 2QGCA 1IZKA 3QNYB 1G7LB 3RJOA 5ICYB 1F13A 3MJ7B 4G1EB 3CHOA 2LR4A 5JPNB 4NFCA 3DHUA 2A6DA 4O9HL 1T1XA 3RY5A 4P5MB 3O3BA 4H26A 4XMTA 1JTOA 4YC2C 2CA3A 5C07B 1UT1A 4G7YL 5L4FA 4OF8A 4WO4A 1M1KR 1OW0A 5DLLA 4XWGL 5SV3A 3Q8AA 3CMAA 3UIZA 5I1EL 2PWDA 2LP5A 3HKFA 1XF1A 2C0TA 1XNIA 4I89A 3MUZ1 3S37X 1FIGL 4Q9QL 1NLOC 4X8XA 3GSVA 5EFIA 5DZJA 2O72A 4KQ3L 3OD3A 1XMEB 1EAPA 1T0NA 4M6NL 1ZS8A 4NQDA 4R4FL 3QEQB 4ORZC 1E9QB 1P1VA 5HHMD 1LPLA 3ARYA 1P7QD 1AGDA 3LWIA 2DQHH 4J83A 2PR9A 3JXAA 2LVEA 4UQ3B 1HHHB 1IREB 1NPPA 1WJQA 3ZR5A 4L5FH 3EJZC 2AJXL 2ZUXA 1INQA 4AFSC 5DTFA 2J20A 2AXHA 3Q6FA 3QPQD 3D50A 2X53A 3QEGL 4M77G 2EO1A 4UU9A 2JQMA 2A74C 3LN4B 1X4YA 5MEOB 1GL5A 2ADGB 3OKDA 4DHLA 1GGYA 4ZQTA 5CEYB 2R51A 5CQXA 4RSVA 1MJ7L 3FFDB 3GM0A 4YGAB 3NA4A 5GHWL 1A3RH 5J6HA 1OTSD 1UJ0A 2HJKB 1KJWA 2WYTA 2F5BL 3ARGC 3LD8C 4P4RB 2X4WA 1UGKA 3VYPA 3O2WL 1CGSL 5I18L 1FC2D 3OYJA 1JBMA 1MFAL 4JO1L 5B3JF 3G6EQ 3GIZL 3SDDA 3KPSE 2VYTA 2PR4L 1TJMA 4YSEA 3JWOL 5LKNA 4Y8DC 3B7UX 3F58H 4PB0L 5I11A 2AJZA 4L29B 4IRJB 2VIRA 3TBVB 2DQJH 1VDGA 2RFXB 2QELA 4KGXB 1DJHA 3EO0B 1KBKA 1ZHNA 1DJGA 1NGZA 1SDYA 3GHEH 2DTML 5A40E 1QASA 1DZBA 3IMVA 1Z0NA 4OB5H 1RMFH 5BO1H 5G55A 2KI7A 2VC8A 3W0WD 5IB3B 1VQNA 4G8GD 1M6OA