3C12A

Crystal structure of flgd from xanthomonas campestris: insights into the hook capping essential for flagellar assembly
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
138
structure length
138
Chain Sequence
DQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAATSAGFVNFEITDANGTFVKQLSVPASAAGEVSFAWDGTDANGNRMAAGKYGITATQTDTAGAKSKLATYVDAPVDSVTIGSDGLYLNLTGLGTSPLANVLRVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C-terminal domain of a flagellar hook-capping protein from Xanthomonas campestris
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Biosynthetic protein
molecule keywords Flagellar protein
total genus 24
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
A PF13861 FLgD_tudor FlgD Tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.910 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3c12A01
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3c12A02
4ZZFA 3C12A 5K5YA 3OSVA 4ZZKA
chains in the Genus database with same CATH superfamily
3G5YB 4PJ6A 4N0FB 2KSSA 4K71C 1IBZA 1ZT4A 1F0LA 2VQ4A 3DVFA 1K9MR 2JKSA 5LGKA 1BOGA 5F44A 1LDPH 1ZTXL 2WNKA 3CDFA 4KX9A 1QPXA 4BE1A 3S48A 4APQB 2EDQA 2V0AA 2EDMA 1F4AA 4Y5YB 1ONQB 2PUOB 1TXKA 5KVFL 2PPAA 1R6VA 1QR1B 1UTDA 1BKBA 1KZQA 2VDOH 1IAMA 3G5XB 3LWIA 3T2NH 2J73A 4K3DH 2FCBA 1HCYA 3MXWL 3ZVVA 4M93C 3GMMB 1TUGB 2EQJA 3MO1B 4F04B 1T22B 1WFUA 1AG6A 2XA8L 1EZSA 2X88A 4KNQA 2HSEB 3BD3A 5DI8B 4NBZB 3QPQD 4WTZA 1IARB 4TQIA 1S7RB 5DRZA 5DVMA 5GQBA 1NBZB 3QJVB 4N24A 3U48A 2QQAA 1DO6A 1MWAB 2D7MA 4FNPA 2VLJE 1A3RH 1CICD 1JCKA 2XVLA 4E42A 3G3LA 1H6UA 4OB2B 1M05B 2P49B 1E6JH 4L1DA 1RZJC 1TITA 1T0JA 1I4FB 1IFHH 2NY0B 5CHNA 2Z31D 4B6ZA 3N9GH 1KTDB 5I1CH 1IGJA 5I8KL 2C7FA 1Q4NX 3A6BH 1XSOA 4G83A 1OYXA 1PKQE 4KQ4H 1KENH 3GRGA 3E1F1 3PL6C 4E5XB 3BH8A 1AZNA 4YUEH 3WE6A 2X87A 3CBOA 4RA3A 4BH8B 4L9LC 2GW5A 1VYUA 1KXTB 4PJEF 4R7NB 3E8VA 3OR6A 4YZWA 3QUYB 3S97C 1H19A 3VFPB 5F3BA 4CL7A 1C6VX 4MJ5B 3GUTA 4LOVA 3UERA 4P23B 3RGVC 2BY2A 2W8CA 1T1WB 4LSQL 4H1LH 1IB5A 4O5VA 4XWOC 4GG6F 5F0JB 4ELMA 1FZMB 1H8SA 3QCVL 1UCTA 1ZK5A 2YIHA 4QRAA 1WZKA 3HN3A 4H20L 4YSDA 3Q8BA 3UBGA 2XOTA 4JRIA 5CKBA 4I4WA 4PQXA 4Z7WB 1U8JA 4O4YH 2WLYA 3UYOD 4KVNL 1FVDB 4JRQA 5CJOL 2BWIA 1NUDA 1AIFA 3KPSB 2V8LA 3C9NB 3Q43A 4NWUH 4AEEA 5IJBC 3FCTA 4MNHA 1U36A 5KYUA 1SYSA 2XRAH 1R0AL 2QQNH 4L8CB 2I5YH 1BXAA 1U8MB 1UKQA 2IC2A 3NDZE 1YUHB 3WNKA 5DDHA 2VMFA 3FSAA 1R4XA 1AD0B 2E12A 2GAZB 2OMUA 2W38A 1N26A 1JGDB 3I6KA 4R83A 5ESVA 3OJVC 3U9PL 5MEOA 3QG6A 1R3KA 2DWDB 5IT2L 3VVWA 5E00A 4OF6A 3CMOH 3LYIA 2WXKA 1GVIA 1IB8A 2HH0L 1IEHA 3HE6C 3OAYK 2COQA 1DBMH 4N0UA 3Q8FA 1BW8A 2HFGL 3PDOB 4UQ2B 1WZ1H 2CRYA 5EF1A 1YDPB 1RSYA 3OG6B 3HFOA 5DDHB 1KBWA 1IHWA 4NAMA 1U06A 2ADIB 5GRJH 3SDDB 3I9GH 5KYUB 1CXHA 1BLNA 1SMDA 2Z7ZA 3QI9A 5D1ZI 3HKFA 3J8F7 5ACZB 2NY1B 1AIFB 5KE2A 4ZJ9A 4JJBA 1WCBA 4K94C 3GM8A 4DEPB 2DX1A 1BPLB 3FCUB 4U6XA 2Z4QB 4J3OG 1ZUUA 4RNRA 2DQ6A 4N6RB 1M1SA 3ML8A 3N85L 5GSVA 1I53A 1WHGA 4HUWA 2IBGA 1W0YT 3FFCB 2L5QA 3HFFA 2QFPA 3LRSB 4HJ1A 5GAN4 4WVRA 2HCZX 2CJSA 1INEH 3MP8A 4PD4K 4ZUVB 2QDVA 4KFZC 3NZUA 4IUQA 1KOAA 5T3ZL 2E3IA 4P23A 4XR8C 4YHYB 1VPOL 2R1XB 3DARA 1KXTA 5I6OA 4J3UA 1RFDH 2CSPA 4EUPA 3MCYA 2YPVA 3MROB 3BH8B 1FIGL 2ZCLH 3LQZA 5CQYA 1DDHB 4AT6B 5IUCA 2O26U 5CU9A 3RVTD 2W0KA 3O2DL 4KKQA 1UACH 3RZCD 3LHPH 3GLZA 3VUZA 3IFNL 1DFBH 3OW2S 4TLKA 5FYJD 1WDXA 1JN6A 3K6SB 2LU5A 3D12B 2DJ4A 2DQCL 1NBZA 4YE4H 5D7KE 5ICUA 2A73B 1SEQL 1FVDA 2P45B 4WFGE 4OKDA 3MODL 1M42A 3CMAA 2A4ZA 4G8GB 4U1HA 5I0ZA 1BDYA 1RKRA 1XF3B 1H15B 1NWOA 2EDEA 3H6AA 3VSTA 4LHQB 2QGDA 1XCXA 3ASWA 4ZFZA 1YN6B 1KCWA 4XNUL 2E8YA 4ELMB 3AM8C 5DURD 1RJLB 3T9WA 2AZUA 3WNPA 2BDNH 4KO9A 4BZ2A 2H1XA 1GCQA 2YEVB 4PJ7B 1WJ3A 4TS6A 2VDPB 1NJ9A 2I0NA 3UBXG 2J2ZA 4RCCA 2RD1A 1PDKA 5KVDE 5EORH 5K5YA 5DD5H 1IZ6A 3OD3A 4LT7A 5HGBB 5IB4A 2Y7QB 1CXEA 4HCRL 1JFQL 2WLZA 3B2VL 2A99A 5IW3A 4D94A 3OLDA 5C0BB 5D4IA 2YGQA 5JXEC 4GMSL 1UA6L 2WLNA 6FABH 1V8HA 4V1DE 2FX7H 1GR7A 2X3WD 2A6KB 4YAQB 4UQCA 1WO2A 5ISZB 1OAQL 2EWNA 5KYWA 4HJGA 3UMNA 1NBCA 2VXUL 5CN1A 4MZ3A 1MCOH 1G7MB 1ACXA 2F54D 4L8SC 2FQDA 5K93A 4BCYA 3S3NA 1OP4A 2ITFA 4L4TE 4YHPB 1AQKL 4WDIA 4W4OC 3KWVA 2ADGB 3F7QA 1AHWB 1A21A 2CK0L 3K71B 5FU6B 4LEXL 4P2QA 4L3EE 3KBFA 4IJ3C 5JXED 1HH6A 4OCSL 2SRCA 4ZO8A 1XVSA 2ZCFB 1UEMA 1NAMB 4GAGL 3UYPA 4JLRB 3RBSA 2X3CA 2DKUA 5HK3A 2VN6A 3QUXB 4DZBA 5E2VL 2CK2A 1SHGA 1RK1B 4HJ0D 2GUOB 5F6HJ 4Z7NB 2FZ3B 4JO5A 3BPLC 1S3RA 1IAOB 2ODHA 2DE0X 3V8LA 1ID2A 3ZE2F 3W37A 2VLME 4LE9A 1Q0YH 5BRZD 3D39E 2DEUA 2K2MA 1DLHB 1KTLA 2IMNA 2QZQA 3OYGA 3D0VB 4QTHA 4HBQA 1OB1B 1U30A 1UD4A 2ZG1A 3TEUA 1XWVA 1EZUA 1DR9A 3OYKA 3LPGA 4LLVB 4QRTB 5KJ4A 3JTSA 2BXYA 2C4XA 1KIUB 3GBDA 1I82A 1GMIA 4J6RL 4PTTA 2BIHA 2AXGB 3BE1L 5CS7A 2K4AA 2A9CA 1HX0A 1ZPUA 2A28A 5DLQE 1AYRA 2OTWB 3DHJA 3MDJA 3NIDE 4JEGB 5DJYB 1R3HB 4Y4FB 1CDUA 1BG1A 2A9BA 1AP2A 1E27B 1SLWA 2BVQB 4O58H 4RQQA 4ZO9A 5KJRL 2O6EA 5EO1B 1OANA 3E2HC 2FRGP 3LKSB 1ITCA 3VTMA 1N5YH 1U8NB 4JVPA 4AQAB 2FGZA 4HH9A 1BK2A 3D52A 4DGVL 2P8LA 4WENB 3EH4B 5JUEL 4OCRL 4XRCB 1NDMB 2BIQA 3ZR5A 3TASA 3T4AA 3OYFA 1QKXA 3OYCA 5DU7A 1QRKA 4MNQA 3QWQB 4YDIH 1P5UB 5IXFA 3C8DA 2QFRA 5D7IB 1I75A 1ZCRA 4J3XA 4ZG1A 3DC0A 2JK5B 3HMXH 3Q2LA 1UTIA 2K4WA 3NOIA 4NRXA 4PRIA 2EKOA 3NTCH 3QPHA 2D0GA 3AB0B 5DD0H 5DQDH 3ZDXF 3GGWB 4EIKA 2BNQA 4G43B 3VXRE 1T21B 2ZF9A 3ESMA 4BI3A 5KH6A 3QGVA 4OVUA 2WWKO 1QFUH 1D5XB 1ZAGA 3T6VA 4LO9A 3F5WA 1VQMQ 4NQEA 5KVMC 3VD5A 2WN2A 5I6NA 1P4UA 3SZ6A 2W65B 3VSVA 3MJXA 4WEUD 1F02I 1T1XA 2AKRA 4G8EB 2NT0A 1CU4L 2QVTA 2XWJA 1AXTH 1BU1A 5GHWL 3UBHA 4WI0B 4XXCC 2UWEE 5ITFB 2OJ1A 3IJHB 3BAEH 5DMKB 3ULUH 4GFTB 3E9FA 3HVNA 1TCMA 2JB5L 3GJFH 2G2NA 4LHUD 5CEZE 2EDYA 2K7QA 4IKKA 1EX4A 2QPFA 3FT2A 3EBIA 3S2CA 1ETZA 3M0TA 4PWIA 1XCQB 3ZYZA 1KIQA 4Y7OC 3WXVH 5A2KH 3G08A 3POHA 2LNVA 2V5SA 4JFDD 3VFGL 2BIIA 3MV8E 3NRPA 2FEDC 4G7QB 1BB9A 1Y0MA 3LPOA 4ZSOE 4NEHB 2BOLA 3DX8B 5HJ3A 2R27A 2YMTA 3JWDH 1BBJB 1NIEA 4IGBD 3J7HA 5DS1A 4XZ4A 4KUIA 4WV1A 1VGKA 3GIVB 3GMNA 3KPOB 2R7EA 1TVBB 3R06A 4VUBA 4X4XB 1Z6JT 5DA4A 4CC1A 5J13B 3TF4A 2D0QB 5DQ9A 4YDVB 3WTXA 1BIBA 3NG5A 3F70A 1U8OA 3X14A 3N5BB 2FB4L 2AHJB 2JCCE 1DFXA 3V4VA 4D8DA 2OXGA 2XMFA 1V3KA 1YC8A 2FX9L 1LO2L 4HJIA 4BUGA 5IHUL 2EEAA 1XSIA 3V0IA 2CP7A 3CSGA 5FW8A 2PCFB 3X13B 3CCQQ 4NNPL 4NRZB 3CU1A 2DQTH 4TVPH 5T3ZH 1NPNA 1OPGH 5L2KA 1EH9A 4PG2C 3VM5A 3FHQA 2X70B 2UUDK 1I7UB 5D7LE 2BJML 3UPRB 1IAIL 2MTAA 4G6ML 2X1WL 2AEIT 1M6OA 2ZOLB 1TZAA 3O9WD 3O4OB 4L4TA 5DFAA 5IBLC 3FU8A 4YHYC 3CCMT 5BRZB 4C0FA 4M7AC 4JFQB 5E0QA 2GQHA 4NENA 4I48B 1JYNA 1IC4H 2YPLD 1RAMA 1MNDA 4QRRD 3IGLA 3PWPB 2VYTA 1KBVA 4Y2NA 2NTFA 1ZOXA 5DRXB 2VRAA 2W60A 2C3XA 2E6QA 2WN3A 3BISA 1JJ2A 4F5CE 1VQ7A 3FOLA 3OKOB 5DK3A 1DCLA 3WTSA 2R1WB 2XBDA 2WYHA 4XXWA 1H3PL 5E2TH 5I1CL 1FFQA 4AH2A 1UKTA 3C09C 4HUXB 4OZFH 1XEDA 1JU5C 5IY5B 4XO9A 4M7AD 3MV9E 4XMXA 4U6HA 2KLSA 4C8QG 2Y1ZA 4AMKL 3OYLA 1E90A 5GANj 3QQXA 2COYA 5LBSH 2BHUA 1BQHA 3A98A 3IU3A 3IVKB 2ZUXA 4LDWA 2XWZA 3GXTA 3U7YH 4ZI8A 43CAB 1FNGB 2WQSA 1NJIU 4ZMLA 2I60L 2YUOA 5M94B 3P4OA 2WXQA 2GITA 3T1WA 4GW5A 3B2DC 4HK0B 4N9GA 3FL7A 2ZP8A 4W68A 4E9LA 3M88A 3EGSB 3TJEH 1OE1A 1VHPA 3N9GL 1Z5HA 3QEGL 3V7AG 4OIIH 2P8PB 5F0PB 2OMZA 3WENA 4LPTA 4AM0A 1UQSA 2GF7A 4XPHH 3WKML 2GBQA 1QLFB 3TIDB 5I1JL 2CP2A 4AGLA 9ATCB 3KAAA 2X4PA 1VKXB 4B96A 1DZ0A 1JXOA 2IVFC 1Z0MA 4L2YA 3VXNB 2X2HA 5FUCE 2P52A 1E4KC 3EH5B 3FNKA 4CU7A 1JNHA 3RNKA 3U36A 3ZDZB 4IRZH 4ICXA 5EOCL 1J9SA 1VJSA 1S9YA 3CFNA 3FZUD 4MNQE 5DEJA 3ZKMD 5JHLH 4RTYA 1GA2A 1L5GB 2FO8A 2QKIA 2DILA 5GMKh 2E6JA 2FYVA 5C70A 1BPVA 4HS8L 3QJFB 2YFNA 1P84J 2F53A 3SJVA 1QFWL 3F58H 4G1EA 2YUXA 4KVNH 5EO0B 4OJDH 3CX5J 4P5SA 3VXOB 1D0YA 4J6IA 2BNQE 2BW5A 5I15L 3WFEH 1DQQB 3MPUB 5GANg 1CD0A 1Y18A 2B77A 4MTMA 3VYHB 3HE7D 3IXTB 3P11H 4YDZA 2CUIA 2IXQB 1JRHI 3VQ2C 3NIFF 3FEOA 5FYKH 3WY2A 5BQ7A 3RY4A 3SPGA 1UHCA 2JLLA 4C4UA 4JHAL 4N86A 4G9DA 3FU3A 4LMQE 1RAAB 3TPKA 3RFRA 1XGYL 3RL1A 1CFTB 5GZNC 4G11A 4XP4L 3HR5B 5DVNA 5EA0H 4FN0A 1I3RA 1QTSA 3VI4F 4I0PA 4JKPH 1QSEA 4X4ME 4Y2OA 4Z7QE 4QMEA 4J9EA 1IBHA 1YPZF 1H0DB 2E4TA 3IF1B 3OHXA 4P2OA 3RAJH 1R0AH 4MMYA 4EN3D 3KBPA 1QCFA 1G9NL 4OGYL 1SRLA 1GS6X 2RB6A 3UP6A 1A1NB 2XYBA 1FFTB 3FS9A 3QO0A 4GKLA 2YQ2A 1PNDA 2XN9B 3WEXA 3OXSB 5L0QB 2J88L 2FLBT 1TLMA 3FRUB 3QIBC 2H4EA 4ZXBA 4JFFE 3VB8A 2YAFA 4NZ8A 5T5NG 3KFVA 4OVVA 1PZ2A 2ZXAA 4YBLC 1A0NB 2HT4D 2YRDA 2QPSA 3GPSA 3HS0A 1Z9SB 5CUSL 2IAND 3TSZA 1RU9H 3SDAA 4UNUA 4KBPA 4KDWA 2UZIH 2YN3A 2AERT 5HI5C 2F2WA 3AY4A 2RJCA 3LN5B 5ANMB 4Q5WA 1IAKB 1MJJB 4TV3A 1TETL 1NC2B 2BSCA 5DJXB 5T5FL 1W8OA 3D1MC 1KK7A 5ACMA 5IFAH 1KIKA 4MJIB 2AQ1A 3A4FA 2C9VA 4LD9K 1M1KC 4K55A 3H9SA 4N4IA 1N8RR 4HPOH 4XC3H 4ZW5A 4F7UA 3Q9PA 7CGTA 3LZLA 1HI6A 5KS9B 1NEGA 1URZA 4KMQA 1NAKL 2L3RA 1J5HA 1GY2A 2AMGA 5I1DA 4AIZA 2Y5EA 1U8KA 1IEAA 3ESOA 3I3BA 3HRZB 2Y7SA 3MRMB 5IB1A 4CI0C 3A23A 4V33A 1PU0A 4LKXA 1J5DA 3EDFA 4J5YA 4YC2B 4W9FC 1A3LL 3HKZA 4XN2A 1WZOA 1F13A 1TG8A 2FYYB 2I07B 5CAYB 2HAXA 4ZPTA 3PV6B 2A74A 3UF4A 1KTRL 2IPKB 1C5CH 2DDQH 4H25B 4JCLA 2Q7YA 1RI9A 4MD4B 3D39A 3OKMB 5ABZA 5DJAA 2VLKA 1BAFH 1QD0A 3NQKA 1EPFA 3SGKC 1R0BG 4AGOA 1V7NL 4LRNL 1CTMA 3ARGD 4H1LB 2W59A 3BT2L 3NIGB 2LVMA 2G0KA 2OJZH 3JWDC 4QRPD 3LX9A 2Z34A 2CKKA 4LCWD 3QULA 4LBEB 2COVD 2XDBA 5SWZA 2YLBA 1PD0A 2VZUA 3X12A 1JNNL 3EG2A 3FAWA 1OLZA 1Z9NA 4P2RA 2E10A 2OZ4A 1NUNB 1HZLA 4L5FE 2KZWA 1RD6A 2LOEA 1S3KL 1UGNA 3VKIA 3BWAA 4KDTA 3TO4C 2DM3A 3DXAE 3LKQB 1N5AA 1MV0B 2ARJB 3L6FB 3BUYB 4YHML 2HD0A 3SY0A 4EXPX 5F3HB 2H2PD 2B1AL 3L5IA 1OGAD 1MWAH 1OZUA 2X1PA 3SQOL 3VXMD 4D0DB 1WIPA 5HGHA 3PIQB 5CIUA 1GYVA 2PTKA 4WUUB 1HINL 1GJWA 2ADJB 2OW7A 4UF7C 3V5KA 2Q3ZA 4QXTA 1QWNA 5DRNA 2J1WA 2DIBA 1E4XI 1MCIA 4KDTC 4OLUL 3M4YA 2ZXCA 2G9HB 3FUKA 1TU2B 1KIPB 4G5ZH 4MCZA 3L4WA 3ZKMC 4YMPA 2Y1YA 3OS5A 5KVDH 3WS3B 2F58L 5BUGA 3CCSA 1CGVA 5A6MA 1TZOA 1A6WL 1DVQA 4IRJB 1R1CA 1N3NA 3TBWB 3VD7A 4M77A 1S9WA 2FO0A 2XKNA 4YL9A 4KK5D 2J5LC 2CJUH 3DSNA 3UGUA 2EO1A 1OSEA 3SDAD 3CCUQ 2WIIB 3CCJQ 4J3WA 2DQFB 3MV7A 5GGSB 5EBMA 2IOMA 1CSKA 5K1JA 4IKIA 3AGVA 3EO9H 4LQ1A 1YNKL 5TQ0L 4EUPG 4KKAC 2VJXA 2F6AA 3E7JA 2H3NA 3T3PB 5IROD 3BAYA 2CKNA 4I1NB 4Y4HC 3NFSL 3ZUCA 1W8EA 3L2ZA 5GAMg 2FEJA 2FHDA 2ENYA 2FLRT 3C6SB 4EPCA 4QWWC 1SXZA 2SEBB 3UAEA 3QEUA 1DUZB 1N70A 2A6IB 3WJJC 1CQKA 5IM7A 1ES0A 2JJTA 2FB4H 3MOAH 3NT0A 1MFEH 3QQNA 1HQ4A 5AZUA 2YMOA 4JO2H 4UM8A 5IM7B 5KANI 2WLKA 4LAJH 4OF3A 4Y19A 2F61A 1A9EA 3VFWB 4Q6IB 2VB5A 2CBOA 4AMKH 1SDAB 4JG0L 4NKIH 4J3SA 1LJMA 3WELA 1FH5H 1UA3A 3PAUA 4PW4A 4RGND 3LZPA 4AITA 2YD3A 2COWA 1JD7A 3ZDZF 1BVKA 4PFOA 1ZE3C 1U3HA 4R0KA 2BP3A 2C1PB 3EOAB 4ZTOL 3EJSA 2DTSA 5MP6H 2EUZA 5FKPA 3QFGA 5E4EC 3CVIH 3VW3L 1KJVA 4FFZL 3M8OL 5JHDE 3ILPA 3RNQA 2DEXX 4R2GD 4GSRA 1QBML 3UTTD 1GBQA 2A1WL 3EOAA 1DN0A 4PJDA 4W6YB 3TBWA 1KB5A 4EZJA 3T0WA 4QTIH 2WSKA 5D1ZD 1XZWA 1PFOA 1QMUA 2QVKA 2Y22A 1WRFA 4PWFA 4YQXL 2NYKA 1TU2A 5AOLA 5IB3A 3HG1A 4GSQA 5EC7A 4JFFA 5GAOq 1J9QA 1SN5A 3BP4A 1G3YA 3NCYP 2FEEI 2VZSA 3BSHA 3CC2A 3RVVC 4N3TA 3VFVA 2O4EA 1SXBA 2O5YH 4P0DA 2ADJA 3DPDA 4PMEA 1AR1C 5IVXE 2A6IA 3LCYA 5HGHB 4BFRA 5JIHA 1Z9QA 4AYDC 1YAIA 1RLQC 4WSGA 3FAXA 3KWUA 2Z8VC 4RISH 1U8IB 3G6AA 1MJUH 3MFFA 3TCXA 3CCJT 1N6UA 1Y71A 5I71C 1TSHA 2MQCA 4FTVB 3GNML 5DZJA 1MHHB 4YSCA 2CZ6B 2FHBA 2BK8A 2PO6C 2PPCA 1MUZA 5E70A 4I88A 4QYOB 1NEZB 5E8NB 3T65B 4X7SL 4BDYA 3KXFE 5LDSA 1A1MB 4DKTA 3A6OA 1K6QL 5EBMB 4FZ8H 1MW0A 2LQ8A 4CRPA 5D71L 5JHDD 2FT8A 3D5OF 4GIPD 1F4WH 4U3HA 5AKSA 5DYOB 2I2LA 4FQIL 4GRWB 3HBQA 2JN0A 2MPXC 4NRYB 2QHLA 3LIZL 5JQHC 1QFHA 3F7RA 4FXGC 4FLHA 2W80C 5F9OL 2A9MH 1VACB 3QW9A 3EJPA 3RPIA 4Q9CA 1RI8A 2MPAL 2AJYH 1ETB1 2EC9T 4FNLL 5KSAD 3RB5A 2QYZA 3FBQA 4KNTA 3STZA 3MBEA 4WTZG 4DKEH 5EZJB 4B3EA 3AZUA 4PG9B 3N44F 4S2SB 4QRPB 2LCCA 4WUUA 3ZDYF 2JCWA 2R15A 1Q9WB 3UTSD 4FQPA 5D6WA 4HWEH 4Z5RB 2MSPA 4G7RB 1FL3A 1BZ9B 4ZZFA 5KVEL 2XACC 1P84K 2V5RA 3IU4L 1Z5LA 4LUDA 4NZDA 3V4UH 3DJZA 3SKNA 3BPLB 2PTUA 2YHGA 2A08A 4WW2C 3V55A 1S9XB 1D3CA 3V7RA 4OZIB 4WWNA 2DMHA 3F85A 1QBLH 5C08E 3HHMA 2DW5A 5DJZA 1RUQL 2IADA 1XGPA 2YSQA 5DZPA 5AW5B 5K9KA 2OMYB 1HZHH 2Q20A 4JRYA 3RB7A 3T8XA 3JWNC 1NEZG 4UZSA 3ME0A 2YAHA 5E8PA 1QASA 4P4KB 4Y0GA 4BFGA 1AWOA 2AK4B 1TQSA 2ZCZA 3CXDL 2B86A 2WAHA 3HPJA 2E7CA 2EYSB 4HXAH 4UB0L 1GIGH 1AGFB 4AQ1C 4YJZL 1V3MA 4KJWC 5B38A 1Y1UA 1HSBB 2ZYIA 3P9MB 1ZBXA 1RLWA 2X4OA 1A7BA 4BZ1A 1K4CB 4ZTOH 2ZCKL 4DP4X 4XNXH 1A14H 4K4KA 1NM9A 3T08A 2OLDA 1YIJQ 2NR6A 5EG2A 5HDQH 3WIHL 3FOMB 4GXFA 3NRFA 1KC8U 3FRPG 3TCLB 3BE3A 1GL4B 3MRMA 2H3EB 4E7KA 3B5GA 1EBPA 1N8ZB 1IRXA 3S36L 3UTSE 2O61A 3NZSA 2GBAA 3T8VA 1V1CA 1FL5B 4Y2OB 4K23L 4I0PB 1P2CB 3BUQA 4F7UB 3V8OA 3MFGB 4HPYL 4J3OD 1I7TA 3PL6B 3GMRB 4XO3A 4LLDA 3WUZA 2X6VA 1UECA 2JS0A 1E9QB 4K7PY 4ZUTB 3OTTA 4JFDA 3AREA 2EVIA 3NSXA 4E9VA 1G7HB 2EYRA 1KWGA 5ICXB 2XX0A 2JI2A 1WDAA 1JZ4A 1WZ1L 3CQQA 2HB0A 1E4XL 5CKEA 1F3JA 1YLBB 3QVAA 4LL1A 1K9MC 4OCYL 5IHNA 2X1OA 1N8OE 3IXTA 4HHWA 1T04A 2HQHA 1SYVA 2NY2D 5I23A 3JBG7 3HZMB 5FF6B 1KIRB 3NCEB 4PFEA 1AE6L 3DIVA 3MRIA 3DPBA 4KJPC 4LVNC 2OSWA 3BN3B 2QAZA 1ZDSA 2VDQB 3ECVA 3L3IB 3LZFL 4RESB 5KUKA 3U0PA 4P5NA 4YWGH 3VG0H 5F1OB 2EGEA 3RMSA 3JCMd 5AZ2L 5D1ZB 2QKIB 4MAYD 4JL1A 4P57A 4HU8A 3WJMB 1DCEA 3LKRA 5TK4A 3TNNB 1HSQA 5LDUA 5HHXH 5E1IA 1NGYA 4WLCA 1BOYA 2K9UA 4XNUH 3G6JE 3GC3A 3QJHB 3QUZD 4HEME 1CB4A 2CHXA 2VUYA 4Y92A 1ZIAA 4PTUA 2CM6A 4UDTB 1AZUA 3KPMA 4YVNA 2R4SH 3R4DA 1WEJL 3S96B 1KJ2A 4DESA 1NMAL 3KBGA 5FK9B 2ZCLL 3ZMRA 4GSDH 2AP2A 3RZCA 1LO0H 1SBBA 1FORL 2M83A 3TA4D 4TUJA 2KI6A 4GFXA 1RZPA 5GAOr 5SWSB 1KLGB 4N9GB 3EOBB 5J39A 4L4VD 3S36X 3V6FB 1CBJA 1YVLA 4Y9FA 1HSAB 3FONA 2AK1H 4NQED 3WXMB 2I85A 1IL1B 3VI3E 8PAZA 3LD8B 3P4MA 2EYWA 5CILH 1KB3A 3RWIB 5I8KH 3CFMA 1MELA 1YY9C 2YPKB 4POUB 5JHDB 3IS1X 4WQOA 1CDGA 4PW9A 2IFFL 1WZLA 1MH5A 4Y9BA 5CJOH 1TSFA 5EBWB 3W39B 2DQEH 5G2NA 1R5IB 1GC1L 1KCKA 4L5GA 1YYMH 2A7BA 1LO3L 1L5GA 4TQEH 5HYJA 1L7TL 4AH2B 3WO4B 2HTKD 2CMRH 3IE4A 4QO1A 1S9YB 3KJ4B 4ODSL 1IEBA 1UZGA 1UYWH 2H45A 5DWUL 4CC4B 2W81C 4PJ9A 2BZDA 3ZL4H 1HL8A 2NTFB 1SG5A 1NDGB 3KXFA 1HILB 3QIWA 3PWPA 4MZ2A 4G8FA 3S3BB 2RN8A 1BM3H 1N64H 3Q5TA 1VQKA 5GSRB 3U4KA 4KKBC 7FABL 2V17L 4PRPB 2AV7B 5J89A 3B37A 4OV6F 1ZHLB 2AEWA 3V7MA 4C54A 1SDDA 1P53A 1HILA 3V0GA 5LAXB 4GQZA 2RJEA 1EVTC 4HPOL 4XC3L 3LS4H 2MPVA 4A2EA 1G87A 3CH1B 4J5VA 2GC7C 2ICES 3E0GA 3MZGB 1ZJAA 2PCFA 4AGQA 4XVSL 4KJQD 3KPNB 3V0WL 4NC0B 4OSUL 1WWWX 5HYJB 3CMOL 4LHUG 5DC4B 1NFDF 1R5IA 1J3TA 3KYOA 2EQMA 1RP8A 2XQBH 5ERWA 4E9RA 1II4E 2ZUQC 3DTUB 1JJUA 4JO1H 2OI9B 3KYNA 5T1DH 3V4VB 5FYJE 2VDMH 2YRZA 4UTCA 1OARH 3QCTL 4PBVC 5AVQB 3M0UA 1Y7VA 3WKQA 3EG9B 2ENJA 3WHXB 4NOBA 4HK3N 2WPGA 3DJSA 1IFHL 4C0DC 2DN7A 4ZAKD 4DH2A 1TVBA 3GBEA 3L1OH 3L1FA 3LH9A 1KNOA 3PAVA 1JHKL 2KT1A 3QWOB 4N90E 2ESVA 3RU8L 2GJ6E 4MQXD 3MV7E 3UMTA 5IMLA 4WV1B 3D8MA 4LAQH 4YPJA 1HAUA 4J8OA 5BVJB 4RVBA 1NLBH 2B08A 43C9A 5T3XE 5B1BB 3IMSA 2BHZA 1BD2A 2I7SA 2XWCA 3H1ZA 2EE0A 3QIBD 1A6VL 4FTVE 4JQXC 4MAZA 4OCXL 3S96A 5PAZA 4LK4A 4EJ1C 2EW3A 2HN7B 5DS2A 4PTUB 1MG3C 3P4NB 1MZYA 4XGZA 2QBWA 5JIMA 4Y1AB 2APSA 2ZAHA 3RL2B 3TT3H 3T71A 1UATA 5CSBA 4KKRA 1AJ7H 3FPYA 4P07A 3H2QA 2CUHA 4H26A 1TTRA 1UZ6E 4O4YL 5E94B 2LT4A 3TCTA 2GI7A 4OFVA 4B7IA 4L59A 1VEMA 3GSRA 4EE2A 1RZKL 2GCXA 3NIGE 5IP4A 1JYXA 1AS7A 1OP9A 4JCMA 4V1DD 1I8LC 2FUQA 1JVLA 1W2BA 4BK5A 1WA1X 2YBRA 3TT1L 2WUBL 3B2UC 4MA1B 5D6CB 5D1XB 3FB9A 2BRRL 2E86A 3N50A 4M6NH 2W0ZA 2KKQA 3DYMA 1XR9A 2DZEA 5E6IC 1G3SA 1A7OH 1OGSA 1D1CA 5I1LA 3H8NA 3OGOE 5CGYC 3AREB 3J7AF 1D5XA 4X9GA 1ZA6A 3EOTL 5E1AB 2WBJB 4LLDB 5ESVB 1WK0A 1ETA1 3CIAA 2ZXDA 4H8UA 4YFDB 1S72Q 1TOVA 4NWUL 1HE8A 1RIVL 1ZVSB 4M1DH 1JI2A 2XICA 3FO9A 4KY1L 3B2UD 5TDPA 4IHBA 1ADQL 5ACLA 4KKAD 1WYJA 2AI0H 3MRLA 4E68A 3TJPA 1SUJA 3PGFL 1E5ZA 2WKLA 2XWRA 3MGAA 4JPKL 3C8HA 4G6FB 1S7SB 3EOTH 3C2SA 4Y8AA 2CH8A 3ULUC 1T0MB 2VXSL 3DWTA 4Q8BA 2IGFL 4HEMA 4KGZB 2VLJB 2ITEA 2VISA 1XMWA 3CDGA 3DVGB 4MB4A 3PT9A 1FDLL 3IJHA 4AUJA 5AB0A 2K3XA 3BSZA 2AI0L 3MPCA 5D1QC 1SMOA 4ESKA 2PLTA 3VX1A 2OMYA 1AP2B 4RQQB 4FJYA 4WW1B 1FYHB 3IXAB 4DTGH 2EJ1A 1XF5A 2DD8L 4IW4C 4PR5A 3GSNB 3VFUA 5MP6L 3GJFA 1H6EA 2UV3A 3I55A 1JZ8A 3BKCL 1QZ1A 4JKKA 2KDSA 1I3GL 3PHSA 4WNSA 2FWUA 5TQ2L 1PKOA 3E9TA 2GY5A 5FOBA 2OR9H 1TZIB 2HWZH 3NZHL 3SKNB 5I18H 3TM6A 2DMGA 4MGXA 3D0VA 2LLLA 2RJFA 3IWVA 4OBSA 4PRIB 5GS0H 3NVQA 3ZTEA 2EINB 3S37L 5HDRA 4NLHA 3DBSA 4ALAL 4JMNA 3D06A 2WLLB 3BZDA 2Q86B 4D8PA 1T7XA 1CZ8H 1ZHKA 2D9QB 4PG9A 1IAOA 2RMOA 1BFVH 4PBDA 5B21A 5LL6S 4PJBA 5CEXA 2H3JA 4J9FA 4G42B 3CCET 4K5MA 2JVVA 5E5MA 2MNWA 3MRCA 1XGRA 3LZQA 1UJ3A 2Z91A 4H0HB 3HE6D 4JFXB 1U2CA 2BNUB 1ZHBB 3Q2CA 1NAMA 3UYPB 4AVKA 4NDMB 3F7PC 1IVLA 2FRWA 2CS7A 2HFFB 4DKFL 2P44B 3KCPB 4QXUH 5F0LB 5FGRA 3QR2A 2F7IA 4Y9CA 2EP6A 3BP6A 2E4FA 5IMOB 3ULVH 4KH0B 3GKZA 1CXFA 4M56A 2VDKB 5C6SA 3M56A 3MC0A 4YPGA 5C2BH 4Y1AE 1KYOK 2NW3B 2FT7A 2DL4A 5DJYA 1QR4A 4A39A 2CUBA 2F2XA 2ZPIB 3AJ7A 3HTRA 3H55A 5KSAB 2LTQB 4OY9A 1H8LA 2EILB 4KQ3L 1IAII 3DHUA 3DROB 2HBWA 5C7XL 1KBKA 1NLDH 5I2SA 2JTMA 1JWSA 3OGCA 3Q2NA 3VI4A 2GYSA 2KGTA 4BY6C 2BO0A 3I9IA 4OLZH 5CILL 4FAAB 1FMWA 3U2JA 3JYBA 5MERA 1V3LA 1B07A 3WIHA 4HUVB 4AEFA 3PXLA 1FNHA 5T1DL 5LNDA 1H3HA 1WIUA 5IW6B 2DQUH 3GDBA 1KN4L 1R24A 3QUXA 2HQEA 3DKMA 5I11A 3HMWH 4ZQKB 3VXRA 3CLEL 5F7EL 2IBZY 2Z1PA 2IDTA 3CHQA 2XXMB 2ESVE 7PCYA 4W70A 1KC5L 4AG4H 1L6ZA 1PG7H 4D9RE 3VYOA 3FO1B 4Z78B 1NEUA 4DQ2A 1HU8A 2JTDA 1H15A 2G5UA 2R9HD 2ROXA 3FTZA 3O81A 5E9AA 4JR9L 1K8IA 5IOKA 1CDYA 1T83A 2FIKA 4L1HA 4Y1AD 5EFIB 2VDQL 4LLQB 1OAKL 1IV8A 2Z6FA 2RQVA 2C9SA 2FG0A 1LO0L 2DQGH 3IFPB 4MHHG 1LO2H 1M9SA 2KBGA 1TS9A 3G6JB 4R3SA 3K6SA 4YDLB 1JXFA 3CCRQ 1PG7L 2AVGA 3KLSA 4CGTA 3L7FA 3CBMA 1FLTX 5FYLD 4FA7B 1TVHB 1YAZA 4M02A 1HCVA 1TJHH 5E95B 5IESH 3M46A 4Y19B 5KSBF 3EZ8A 3FQUA 5H8DA 1HDMA 1A2YA 1Z66A 5D1XD 3D3VD 2DWEB 5F88B 2PNIA 4MA1C 3VXUB 2D7PA 1PY9A 4ZOAA 1IO4C 3EYOB 3PV7A 5J3HC 4HGMA 1T1YB 4PB9H 4HP5A 2ZF8A 3A67H 1MCJA 5IQ9B 1G7IA 5ABAA 3IFLL 3SQRA 1N5YL 1ZA2B 4OMOA 1Q94A 2A83B 1S78D 3HC0A 3RY6A 2WXHA 5E08H 5GGRY 2G75B 3CNKA 3QNZB 2V7HB 1UCBH 3ISRA 3MEAA 2BFVH 4GXVL 4QOKB 1CK0L 1R3LB 2OP4L 1WUNT 4XN7A 3ZTNH 1MHNA 1XGQA 5CEZL 4TKWA 1YYLH 1PD1A 2JKWA 2VT0A 3FO0L 5D4QA 5HGGS 2MHAA 5MEPB 4Z7AA 1CVSC 1NCIA 1NCWH 1KXVA 4IRJA 2ATCB 1A6VH 1JDDA 2XSKA 5LJ3h 1TYRA 3HMXL 4F20A 1KLFB 1DQML 3L5WA 4QXUL 2MOVA 3PGFH 1UEBA 4X80H 3T8MA 3ZSSA 4DP1X 4HUUB 1CLOL 4ANVA 3BIKB 5IV2A 2EH7L 1ZHIA 1A4AA 2G4GA 3C60C 3ZL2A 5C0FB 5JUEH 5BV7H 2RFXB 1OX9A 4LFHD 4R4BA 3AY2A 4WI9A 3FTSA 4O02B 4D0DA 5MEOB 5A0GA 4QRUA 5E9DB 4ELDA 4KOCA 2D0HA 2M8XA 3L54A 2ZXQA 1NGPL 2VVKA 1B4JH 1S7QB 3CX2A 1PJWA 1OT2A 1FF5A 2VR7A 1KGUA 2ZTBA 2WKOF 3VX0A 4F8QA 4J28A 1OIOA 4A4FA 2F54E 4P2RB 3DB3A 2E59A 4X4ZA 1A65A 1CXIA 1E7VA 4QYAA 2DK3A 3EG0A 1XGQB 1F6AA 2E5QA 2LRQA 2BNRA 2V33A 3L3KA 4UOJA 5KVGE 3D9AL 5I9QC 2F7OA 2XDPA 2G3MA 4PG2A 4GY5A 2DV6A 3MX0B 4I9WD 4ODTL 1XEUA 2QXFA 3L95B 4UAOC 4OQ1A 3SDDA 4M5TA 4BKTC 3N3EA 2MH4A 3ILDA 5IQ9A 4OCRH 3SGDH 3D39B 3OKMA 4N87A 4UQ2A 1KD1R 4IOIB 2A74B 3VFPA 2AJSL 3QS2A 1JI1A 3SQBA 2DWEA 4NC1C 5F88A 3WN6A 4F7EA 4Z23A 3CD6T 4LDCA 32C2B 2B1OA 4E7ZA 2HZHA 3G5ZA 4NAQA 3ZHFA 5BUPA 2AXWA 5D71H 1V5JA 5IB1B 5E6YA 2G2PA 5IVZB 2A36A 5F7MC 1B3JA 3I74A 1AVZC 1CF8L 4FQCL 2C34A 3DUHA 4J4PD 4CMHC 2XTSA 1QFWI 2OM5A 2BSDA 4F14A 2PUKB 2W0FB 5AFAA 3FQWB 4L8BB 4M6MH 1AOHA 1E4WH 2ILLA 3LQAC 4PGBA 2OSLA 1WXTA 3AMLA 4FFYA 4HUMB 5H37H 2JNGA 1CXKA 5L2JA 5SX5H 2Y24A 3IFPA 4JJCA 2OI3A 1J0JA 4NQXA 3SGEH 3KPSA 1M5Q1 4MXVE 3WE1A 4X34A 1A4KB 3M1CA 5DJXA 4QRQA 4RFNB 1VYTA 4OZFB 3CCQT 3QE5A 1I4K1 3SE9L 2MQ0A 3O3DA 4Q9RH 5AW7B 3SDXF 1A6TB 1ED3B 5C08B 4XNYL 2WLIA 4WWOA 3UO1L 5JR1H 2YN5A 1FI8C 1T4KB 3HG3A 4Y5YA 3TLRA 3HB3D 1MY5A 1V05A 3QRBA 2MKWA 2XD0A 4MJ5A 3WFCL 1U3HD 4QWWD 3UABA 2GI0A 2VR3A 3BPNB 4OKVB 1P4IL 1PQZB 2XN9A 3OSVA 2QADB 4P2OD 3MZTA 2OMWA 5T5FA 4A2DA 3C2AH 4FG6D 1PLGL 4E5XA 3PQYE 4G8AC 3MBXH 2Y5QA 1G1CA 2BRQA 1IGJB 1AKJA 3OHXB 2DTHA 4AYEC 3OGCB 4XP5L 2QA4Q 1QSEB 2QKIC 2PUQT 3ARBD 3DROA 3H6ZA 3GI8H 3QYMA 3IMWA 2WBKA 3F7YB 2G5BB 3EAEA 3L9EA 4DK5A 1XQ4A 4BCZA 1BYMA 1WFWA 3P1VA 1ZEAH 5LWYL 3EHRA 1JRIA 1IAIH 4G6MH 2WCPA 4AUUA 1BCMA 3TN0B 4PRAA 3TNMB 3GRWL 3IGAA 3C95A 2DRKA 2GHWB 1S78C 3LEYH 1S72T 4MMZC 5D6DA 1D5MB 2NW3A 3O0RH 5BQ7B 2F0CA 3K6OA 1WXUA 1INEL 2YD4A 3RILA 4NNXB 3GK8L 1QEXA 1FFOB 4QOKD 5H4ZA 5DY9A 1QAWA 2FLMA 1ZQ1A 5GAN8 1M1XB 2XXFA 3BGFB 3ARBC 3BQVA 1NFKA 3ESPA 3NA9H 2VC2H 3RGVA 3TJHC 2NMSA 2N7BA 4GO9A 3MNVB 1YMHB 4NGHH 2Y2YA 2P0PA 3KLHD 4YE4L 4XOAA 2XQBL 4PJBB 2ICEB 5MEQB 4APXB 1PPIA 2FBJH 2C3WA 3MTRA 3A67L 2PWHA 4X5PA 4WTOB 2VH5L 4POZC 5DJCA 3SYQA 3U36B 5C7XH 3GYRA 2WB7A 3CCVQ 3MRRA 3RWFA 4JM2D 5GAOl 4X6DB 4YHKH 3MEUA 1NC2D 4S1DD 4Z95H 2V8MA 4RSYA 4EI5A 3GMPA 2I9LB 5EEWA 2IWGA 5A0DA 2XTLA 3MLSH 5HHQB 2H8HA 2K8QA 4N4YB 4X1VA 2VN7A 4FABH 5INCA 3FB7A 4C47A 1O9WA 1PNCA 2E75C 2DXCA 4H88H 2BVOB 3OYEA 2EUXA 5GRVK 1G9EA 3WFBH 3GJFB 1A7RH 4BFEA 1GHFH 2VR5A 4DF9A 2CZ0B 1AZGB 3ZYOA 4WW1A 1EX0A 1LK3H 3AY4C 3Q05A 3QQ4A 3RKDD 4QOKE 2WZAA 1H6FA 4JPSA 1W72A 2J71A 2FVUA 3BVVA 1BA9A 4LCIL 3FB6A 4G8GE 5DTFB 3W1ZA 3H0TB 2JIXA 2D9CA 2DQIL 3PS6A 4NX0A 3D85B 2CYZB 4LB8A 4PS4H 5CMAB 1AO7A 3KYAA 1T0MA 3QI9C 1PEZA 2OMXA 4JM2A 4NZUH 4YDNA 4IMLA 5K39B 2QGGA 1C5CL 1S1NA 1YECL 2DDQL 4C92C 3TEEA 2K78A 4LSRH 2VLKD 2H2SC 4BUHA 1DVFC 2FZCB 3CLEH 5IFJA 1Z3GH 5TH2A 1YEFL 4Q0XH 3MLUH 4G9FA 4ZNEE 4Q97A 3FOLB 3B2PA 4XWGL 2B16A 3FO9B 1Y96A 4OM0L 2PQWA 5HD8C 4ORZC 1TQBB 2FPDA 4FNLH 2X0WA 1EEYA 2BNRE 5F6IB 2A6JB 2Z8SA 1B2WL 4P46D 1XMEB 4JM2C 4OUOA 1FORH 2YXWA 2G3NA 4OT1L 4PB0H 5ECJE 5ESQA 2ZD0A 3T0EC 1E5UI 3CFBB 2O5XH 1MXDA 1YFNA 1ZTXE 3KJ4C 5D7SH 2CR3A 5E2VH 2NY3B 4KUCD 3VWJC 5HY6A 2VMEA 1WD9A 5SV4A 3II1A 1ZA1B 1UFGA 3HPLA 5JW4N 3UPRA 1QCOA 1UVQA 4MRBA 3NQIA 3UYRL 4MCYA 3AXHA 3SE3A 3BSZH 1TTGA 3O6FD 2Y3NA 3FTWA 3QWYA 1A6AB 1S7VB 4Y28E 5TDOA 4BY6B 4NNYB 5BV7C 1UGKA 3CVBA 2RQTA 4JN1H 4YBQD 1ZTMA 2CP5A 3CDZB 3VXPA 4DP5X 1R17A 5JORA 1TYJA 1OAZH 1VGEH 3ZZLA 1RZKC 4ONFH 4UDUA 1QVOB 2JVUA 3LRKA 3CXCA 3UTQA 2BVPB 4X7TB 3D07A 4YH6A 1WF5A 4UOW0 4NCC2 2IG2L 3PXHA 5F6HI 3EYFB 3VYNA 1FO0L 1Q9KA 2OMVB 3WSQH 5JIDA 1JIBA 3A8OB 2IPTH 4PYHA 4HYTB 1OSYA 2ZPBB 3MQIA 4L3AA 5E2UL 1T0OA 2H2SD 1UOWA 3QIUB 4YFLI 5IT2H 4TM9A 1OTTC 4OLVL 3ZE0B 4XCEA 4MAYC 5B1AB 4E0RB 4Z7UF 5GMKm 4PLLA 4JS5A 5TPWL 2WANA 4EI6B 2DBKA 1EAJA 3V0AC 3OJDA 2CG9X 1FAIH 1QSED 5I1KH 1M2VB 1OALA 2A6JA 2OK0L 5DHXB 2XN2A 1NAMH 1Y96B 2Q2LA 1QRNE 1GGIH 4QW2A 1G0YR 2J8OA 3MV7D 2EQDA 3AUVA 4UNTA 3I9GL 3GSOA 3DJRA 5I16B 3BT2H 1EGJA 1KB9J 4TXVB 4WAFA 3V9CA 3VFRA 1FN4A 4Z3EA 2LLNA 4JY4A 3NGBC 4QRSB 4PJFA 2OMXB 4W9CC 4M4PA 3STLA 3K72A 4X83A 3APDA 4QPEA 5AB9A 1YJNQ 5AALA 2P42B 5C3LD 2RI3A 1BF8A 2WB1A 3P73B 4WHYH 3VXPB 4RTUA 5ECAA 4HCCA 3FB6B 4NKQB 4GB9A 1SPDA 1QQDA 2VN3A 5TDOB 4L8SA 3ROOB 2X9XA 2OJ2A 1CFMA 1GIGL 1WD8A 1L0YA 4ME7A 1M3IA 4YNYA 3B7UX 5HYQA 3QDJE 4QF1A 4KQ4L 2C06A 3DNKA 4K3DL 4KGXB 2O30A 4KTYA 4LLAA 2WQUA 2ZAEA 1F1GA 5SWQA 2J1XA 1E9OA 4M7DD 3FU6A 3ERXA 5EIIG 5FO8B 3NTKA 2O4XA 4LFHG 3PRZA 4LEBA 5AW9B 1BFOB 3WKMH 1XB6A 4N2CA 1EAQA 1TQWA 2CIIB 3HG1E 4G8FB 1YNLH 2XZAH 3TL5A 4DP8X 2ZSVA 1IBGL 3L7EA 4PJ9B 1TU0B 1B3QA 4U4BA 5EEYA 1XF4A 5C7ZA 1PVHA 4U1GC 4WFEE 4X99A 5EHFA 5TH2B 5KVGL 3VQMA 5E5LA 4M78D 4V2CB 3EDJA 4KOBA 5ICYB 4HBCH 4RTXA 4ES8A 3SBWA 2W91A 3QHFH 3M59A 4F17A 1GSMA 1XIWA 2VWEC 3CGTA 4W6WB 5C6TH 2DQUL 4BFJA 2CDFB 2IV9A 3WS6C 4NI6A 4JBSA 5D7HA 1MZZA 1SHWA 4PJ8D 3QEQA 1YI2A 4RZKA 2VRKA 1I9RH 4PJCF 2DA9A 1W72B 2EEFA 2VQ1B 4JS7A 2ECZA 1IQWL 3ZYJA 2FHCA 2Q2EB 4GKOA 5I15H 5DLMH 1RSFA 1X9UA 4DA4A 1OCCB 4OGAD 2HX8A 1OPLA 3QUMB 5DJDB 3VG9C 3MV01 3V6FA 4EDXB 3VJPA 4L48A 3NEOA 4HOWA 1SVZA 4PJEA 1SSHA 4S1RL 1OAYL 3SBWC 4DERA 1HQRA 1D5RA 2AXGA 3QRFM 4WGKA 5CGYD 1UGVA 4ZFOL 4PJOA 5DVOA 1T0NA 5EH1A 2YPVL 4Y9EA 3MCKB 2F9BT 2KVQG 1EJ8A 1RPKA 5DWUH 3HC3L 5H94B 3LKOA 1QWUA 1I1YB 1T7WA 3IT8D 1LD9A 1YSOA 4N20A 5B7FA 3FQYA 4F9PC 5KSAC 1AQMA 3QB7C 2IALB 1RAFB 1C12A 3HAEA 3JB9F 4P9HH 4M75E 3LEVL 3NMZC 3SGJA 1AD9A 5BZZA 2ICEA 3TU4K 2HJKA 2ZPEB 2JF1A 1NCHA 2R59A 3ZK0A 5D1ZA 4E7SA 4J9DA 5FYLL 3HOGA 1IGFH 5IHUH 5IROC 1YMHA 4G9FE 4U1KA 3DXAB 4Q9QH 3URGA 2HP4A 3HUJB 3RGVB 5E4EB 2GC4C 1T4KA 1GW6A 3A24A 1TWBA 1XB8A 1TFPA 3FU9A 3TFKC 1AIZA 1CLZH 3R6OA 5EIIB 2J8UB 1IX2A 4WSJA 1INQA 2BJMH 4APQD 3GM0A 2F5BH 1G7JA 1L0XA 1OW0C 3O3DB 4P5TC 4R0LB 5F89A 3ZJAA 1J18A 5D1ZC 4B5ZA 5TFSL 3NJJA 5AYUL 2OR9L 1N27A 1M8VA 5LO7A 4MRCA 1QP2A 4FFTA 2WVVA 1RI0A 1X6GA 3E3QC 3L1EA 3OMAB 4JDEB 1ESOA 3BKML 1G83A 4AQ1B 3KWWA 3D18A 1UWFA 2W5PA 4JPIA 4HVBA 3F7YA 2MNJB 4M1GH 1O9SA 3FQWA 2DPKA 2HTLC 4L8BA 3QJTB 5DSCA 4ZTPH 2LJ1A 4ZN1A 3ML9A 3Q13A 1TTHB 2BWQA 2I7OA 5E1QA 3SO3C 5D7UA 3WFHB 3QBTB 1OT4A 4QT7A 4HJ0C 1WHJA 4BQ9A 1XNIA 3TA3D 5F7KC 1RUKH 3FTXA 1RQ5A 1U3YA 4QVCA 1BQ5A 4Y4KD 4V2BA 1UD3A 2YWZA 2JFCA 4M75D 1JVKA 2B9BA 2JKIS 4UMSA 4F7EB 3ULVE 1MCSA 4ELKB 5EOTA 4JPBW 4L5FH 4NZUL 1NJ9B 2DQDH 1HSBA 1FPTH 1UJYA 2JS2A 3MUUA 2PWDA 1NPRA 2EE3A 3ZX1A 3OJ2C 1IBGH 1I8MA 1NCOA 1RJLA 4M62L 4M7DF 3FRPB 4Q14A 3EFSA 1FGVL 1IBYA 3HB3C 4OM0H 1XF3A 2P0QA 2ALAA 4UQAA 2EDHA 5BMFH 4KTGA 4F24A 2IADB 2ZWNA 2XY1A 4ZOBA 2QJDA 3I85A 3ZKND 4PJ5D 3KLLA 1ZXQA 4FQXC 3L42A 3TQ7P 2J7IA 1OGTA 3S35H 2I25N 1NCGA 1VQ5Q 1SXCA 2FNBA 5I5MA 3KYMB 4HMCA 1YJDH 1CLVA 3K8LA 4NUMA 1BG9A 4BGLA 1MGQA 1ITBB 2BRRH 1E4HA 1VQ8Q 1HIMH 3GEWB 8AT1B 1QKZL 2ENQA 3JV4B 3U46A 3MRGB 3S5LA 1ZKAA 1C08A 3OM3B 3G5ZB 5GRYA 4S2SA 5AZ2H 4YS4A 2GJRA 4ZSOA 1CE1L 2EKJA 2NUZA 2R2HA 3B9DA 4X6FB 1YEEH 2PYED 5GAMe 3STZB 1YJNT 3ZFJA 4MVBD 4EDWL 4BKLA 3J27A 3FFOA 4GH7B 4M7AA 3CHSA 4JY6A 1LEKB 2C9UA 1VACA 5GAN7 4ZUSB 2PXYA 3V5DB 3ES6B 3BCDA 1KJ3H 3BAEL 4NRYA 5KOVC 3X17A 3KG5A 4AYFA 4NUJB 4WEMB 1VCBC 1F1BB 2WYZA 4P9MH 5FUOL 4ODWB 4ABVA 1HK9A 1QZNA 1MI5D 3CFTA 4F3FA 1E3ZA 4G71B 4HMEA 1FXXA 2CNYA 3FQ4A 1SJMA 1RJZB 4F2MA 2FL7A 4AV4A 1U8CB 3BW9B 1ZWIA 4AYFB 4LOUD 4Y5VB 1P7KA 3QNZA 3QCUL 3CBPA 4OD1H 1IGQA 1Q94B 4JE4B 1E3FA 5C2UB 5I1EL 1VAHA 1T1YA 3KW8A 1MRFL 1G9NH 3RR6A 2RMNA 4LF3A 4WO4B 5KN5B 1W16A 4ZW7A 3HFML 4FF9A 4OFKA 5E9DA 3VXUA 5DJ6A 4N2NA 4U1IB 5C0ND 1EUUA 2RFXA 3QNYB 1PY0A 5AAPA 4YXHH 4OF5A 4ZUWA 3U46B 5F7NC 4JFFB 3LVTA 5EU4A 2EDOA 2PVDB 5C71A 3EFRA 4XVSH 5AZEL 3V0WH 1KEGL 4WU7A 1QVPA 2DI7A 2WOYA 1FV1A 1MN4A 4NP4L 1SYSB 4YHOH 5FV2A 3C60B 4AMWA 3S35X 1B4LA 3KL3A 4JPKH 5EC2B 3UDWC 2Y0SA 1F41A 4PJOE 1PFCA 2HL3A 5BNXD 1DBJH 1VQLA 3BFMA 1DP0A 5D7JB 3IPBA 3E6FB 3KPQA 2J55A 4OZHF 1HHJB 1SNRA 3TFKD 1F1DA 2NY5C 1XCWA 2BY3A 1X3DA 2KERA 2WXNA 2UWEB 1VERA 2H9GB 3FO1A 3JWNH 3OC8A 4Z78A 2KBTA 1O9VA 3QZWG 1TTBA 1PZAA 2NNRA 1MMNA 1B34B 4J3VA 5DQDL 2ESWA 3A0OA 4NQCD 2DMBA 4OAWB 2X42A 5C3IA 4H8WL 4KPHL 1IIIA 3P77A 1ID5I 2JCCB 4YZFE 1R24B 2E7BA 4FXTA 4R7NA 1IM9B 2UVFA 3OSSC 3MUJA 1UWXK 1WPYA 3MO8A 4WEBL 1JZ2A 3P3UA 3SCMD 4FTDA 3TONA 2VE6A 3NPFA 2WD0A 4KKCD 4HH8A 4JO4H 2HLAB 5IHZB 3MGOA 2APXA 4RMQA 4ZYKA 1PSFA 5F1NA 1X5HA 1LO5B 5DSCB 1U1SA 3HZYA 5JOEA 1MCPL 2X9WA 4XO5A 2G0LA 5GZNA 5SWSD 4MDRA 3APFA 3VU2A 3AC0A 3ASOB 3ILQC 4JUSA 5DD1H 4XMTA 4I0PC 1SF3A 5GS2H 2FIRT 1I81A 5DR5H 2V9UA 3F7VA 1EEZA 3OHXC 4G6KL 4XVTL 5C08D 3QDRB 4HA8A 2AQPA 5DI8A 2EDJA 4Q6KA 5GANd 2GFUA 1JSYA 3UTZB 3BZ5A 1EIFA 4KUDK 2DBLH 2MMXA 3PAYA 4GIAA 4OU3A 4Z7UA 5ES4B 4CBPA 4GQQA 4IURA 1FCCA 1B2YA 3QIBA 1FAKT 2KK4A 4ZXBC 2BSEA 1RMFL 2RR3A 3R0NA 2CRMA 1PRLC 4WJ5A 4XNQB 5DLML 1OI1A 4JM4L 4KVCL 2WSCE 2OQJA 3NABL 4UOQA 3BUDA 2Z91B 4KI5E 4KXAA 3MJ9H 2H3XC 4U1KB 1BOGB 4G2AA 5DO8A 5I6LA 3H0IA 1T6BX 3NA4A 3UO8B 1XO8A 2GG1A 2QQ9A 1OP5H 4C92D 3B4NA 5EB9A 2WM0A 1AGDA 4AENA 4RRPM 4X6EB 4B9CA 1K8AU 3BRDA 2Y3AA 4HUVA 3OYBA 3BMVA 5BRQA 2OJEB 4ADGA 2M16A 4RIRA 3WBDA 4AVJA 3PIQA 5KVEE 3IDIB 1HK6A 5CCGE 2EGAA 4BD3A 1E4WL 3V6ZA 1JWSB 1L9TA 4LXCA 1F3RB 8FABB 1DDTA 3L5HA 3NH7L 4OB5H 2QQQA 3RIAK 1TT6A 3RKDC 4MB1A 5F9WC 4ACPA 4EOWL 3NAAH 4PJOB 3NMEA 5JDSB 1TPXB 4UUJB 4EBQH 2RJDA 3LS5H 1ET5A 2NY4C 1L9QA 4YHNB 4L37A 5SWZB 3KL0A 2CRIA 1XF5B 1UKSA 1R75A 2PO6D 2PMZA 1X5LA 1KQ2A 4GT0A 3R1GH 5LXGL 1BXXA 1IHVA 4KI1A 3SKOA 2PNDA 3RDVA 3ZL1A 2EDRA 1HJCA 1E5BA 2KL6A 4KRTA 3L4YA 4LPUA 4OZ4A 5AKVA 5I66A 2DVEA 4TUOB 5JQ6H 4B9KC 1A9VA 3S8WA 1HESA 1ZX6A 2EQUA 4OMFB 1XSJA 3JV3A 4N2OA 4LGRB 4P2YA 1H3WM 2NDGA 3ZU8A 4BDVB 5A2JH 1NUFA 3MRCB 1HZKA 1MWOA 1B6DA 1QLRA 3D4YA 2ROLA 2FJSA 2EJ9A 1VQ9Q 2HFGH 4IRJD 5F7DB 3GKWL 2DI9A 3BWZA 1X9QA 3QEQE 3OPZH 3IDYB 4X7FC 2AJZA 1FIGH 3ARDC 2IPUG 4HF5H 1DTUA 4X4YB 3L3JB 4F7UE 3SN6N 1CC3A 3GJEB 1XHHA 1EGJH 4IRSC 5KS9A 2CIIA 4X9HA 3WY3A 2CO6A 1JGUH 1HWWA 4WHTB 4LNRB 4GUCA 4QY8B 1J1OL 2YMXH 4JJNK 5GANe 1VQ4A 3C5SB 3GSWA 4WO4D 3O2DA 3DGGA 3NZ8A 4KH1B 2QLYA 4JGNA 4ELME 3VWKD 4LHUB 3D85D 1ZHNA 4HALA 1M3JA 3OWRA 4IRSA 4L8SB 4PIRF 4LUEA 1FG2A 4N26A 5BW7A 1UG1A 2DLIA 3NCWA 5C8JA 3UIYA 5JW4M 2EUWA 3V4PA 3N1QC 4AGMA 3K2KA 4XU3A 4ZPVB 3TZVA 1LEIB 2ED6A 4NPYB 2M0OA 3K1KC 3OXSA 1DBAH 2L8AA 1FVEB 3NSFA 4JY4B 4QRSA 4RG8A 2WK2A 3GFUA 4BKSC 5EEVA 1OAKH 4ZO7A 3U25A 4LQFH 5JOFA 3QJRB 1QG3A 1ZV5A 2B8AA 3KGTA 5E4OA 5KBKA 4Y1AA 3RL2A 3TO4A 3MLVL 3QWRA 1ORSA 1WICA 4PJFF 4KVCH 3BW1A 5F9OH 2HT2D 3JWOL 2A6DA 1M2VA 1GJUA 3ARWA 3P0YL 1M1FA 2H32B 4Z02A 1AXIB 1G4MA 4NAJA 1AGEA 3JV6B 2WXPA 4YIQB 2JZ2A 4EI6A 4XP1L 3ECBB 4FZ8L 3FN0L 1MCDA 5IVNA 4FX5A 1N59B 3HA0A 4R4FH 5IEHB 1CICA 1MHPL 4NYLA 3G04A 4IOSD 5GISH 4G6FD 2YC1B 1EFNA 3SOBL 3ZTJG 4S0TD 1MF2H 4PRNB 3TZVD 4OJFH 2GHZA 3VFSB 4Q2ZB 5I17B 4XTYA 1BZDA 4XX1E 3EYFA 3UZEA 4KRNA 3T2OA 1DVUA 1HHGA 3GF8A 3L2LA 4G1EB 2X0UA 4M77E 2AW2A 4WWKB 1MQKH 2X7LB 5HHMB 2LABA 1V27A 1IGUA 1U3HC 2PZ1A 3EGDA 4PBXA 1J11A 3SE4C 3GMOA 1J9TA 2ZPHB 4WI5A 5B39A 4FLRA 4TNWF 1WFTA 4PV8B 2CHWA 5D9SB 4U2YA 2X4QA 4O6JA 1KG1A 2GTQA 3GB7A 4A7GA 5KVEH 1NCWL 3M86A 1KPVA 4NO2B 1OCWH 3P4NA 1WG3A 1N6AA 3A6BL 3LH2L 3OC5A 1B4RA 3CHPA 3GTVA 4ODVH 1CKBA 1PZ5B 4P23D 5D70H 4HSAC 4F16A 4LGPB 1N8RC 5GAOm 3FT4B 1ZSZC 4BE2A 5JHLA 1NPJA 4LSVL 1VQOT 4C8QD 3Q5YA 1M7XA 4XHQA 2DJZA 5CZVL 1BZQK 1SBSH 3KD4A 5A16B 4AFZC 1JPTL 3QQDB 2LDMA 4HKJA 3QWOA 1JUFB 3GIZL 5B1CA 5D2LF 2XTJE 1NMCC 1VOMA 3BGMA 5IBLD 5MI0B 3C0CA 1Q1JL 2NSXA 3ETBJ 3MRNA 4G80B 5MENE 2GQIA 4FFYH 4QQGA 1NGQL 3S37H 3N1PC 4IMLB 5K39A 5I8OL 3QO1B 3B7SA 5DC2A 2GABA 2F5BL 3X3FH 1GPOH 3D7PA 4E9QA 1CURA 5AAWA 3CBKB 2V9RA 1K9AA 1E5YA 3RWHA 3BVDB 2FD6L 3CMAT 2W9EH 4GO6B 2YPKA 4UV4L 3G6EQ 4PV9B 1I3VA 3KPNA 1I85C 3CSYB 1F4YH 2V2XA 3QPXH 5ECGA 3MA9H 2XPYA 3MBED 3MP1A 1WQ7A 3DOSB 3OPUA 4NO0A 1FGVH 3CCRT 4ODUA 4EBQL 4IIQA 4TUJB 4RCBA 3ETSA 3LQMA 3TV8A 5MHSD 4QXVA 4JZOA 4K8RL 3FQXA 3CLFH 5CD3A 4CADA 4DN4H 1F86A 1X2QA 1VFAB 3PU7A 2I69A 3B6SA 4C58B 4FQXD 1RURH 3KNBA 2O93L 4PV8A 1RUKL 1FA4A 3CC7T 4QR7A 2F1EA 4QO1B 4XP6L 3WNNA 4F37F 1SPKA 1NOFA 2GBTA 3GMOB 4BYHA 2IIMA 4FFZH 2Q6WB 3TYGL 2W92A 1JCVA 1MFCH 1HCFX 2Y7MA 1CDHA 2BSSB 1MH5B 3CWGA 1J7VR 1P4BH 3H3PL 4Z7VB 3U0PB 2W88A 3BRGC 1VQNT 3L3IA 5AOJA 4WHCA 2VGMA 2IAMA 1U8OB 3QRGH 4WI3A 1ZSGA 4P8QA 4LSUH 2E9GA 1M1XA 2F54A 4QHLB 5CNHA 3VFSA 5L4JA 4I89A 3W0WD 3DDGA 4EIGB 3QC5X 2B1AH 2FO4A 5DQ9B 1ZVNA 2FSEA 3UA6A 1J0KA 2ISDA 1CPUA 2KNBB 5I1IH 4JJHA 3G04B 2E65A 5J11B 2H47C 3KPRA 3EBHA 5GGSY 3VFTB 1MHCA 3QG7H 3MBEC 1DO5A 3JWNG 3N41B 4RTVA 3VTAA 1UXMA 4IQHA 3JV6A 3F65A 5MHSE 1B0IA 3ZE1B 2DJUA 4K3EL 5KYXA 1YN7B 2XRAL 2G5BA 4M7JL 3VFOB 1OP3H 2LTQC 3FU7B 3MRPA 5D72H 5DZLA 5IMKB 5GRUH 4UDTA 1FYNA 2G60L 5AWNL 5ENWB 2P84A 3C5ZD 4NM8L 1KEMH 1Q9LB 4RFEB 3G08B 2MOQA 1RUAH 2QEXT 2X4YA 1IO6A 1BJ1H 1PKQB 1S7XA 2PN5A 2VGNA 3H56A 1T2XA 4OCNC 2OMWB 3O6MH 4PSPA 1FVEA 4OMMA 3WUWG 2NNAA 3SPVA 4Q4EA 4PGDB 3ZGHA 3RUGB 1EZVY 3A6CH 3AQDA 1MCNA 3TZVB 2PPDA 4NBYB 5FO9B 3JXAA 2VOTA 1EFXD 1KYUA 5B38B 3AG4B 3KM1A 4UIKL 1PX4A 2Z0WA 3SE6A 5KSUA 2JXBA 4AV0A 5JDJA 3JZYA 3L3DA 4X5RA 3IJSA 4C8QF 2CBPA 3FSOA 4H4NA 4QRBA 5E8PB 2J6KA 3CC7Q 4ELMF 3ENEA 4DEUA 4MYPA 3TBVA 3QT2A 3QZBA 3HG2A 3CG8A 1P7QA 1DVTA 2MWCA 3D30A 4JAMB 1WTGT 2W65A 4MJ4A 2YQBA 2IG0A 4OD2A 3RFZB 1VQLQ 3GOXA 5JPNC 4M4ZA 2Y6SD 1LYQA 3S98A 1JXKA 1AR1B 1MCFA 1I7TB 2OSLB 4PRIE 4IS6B 5CGMA 1UM6L 4G6AC 4JY5L 1YC7A 1QLEB 1JV2B 5CKAA 3VS4A 1W0WA 4ZUUB 1RIUH 4OSUH 4NI3A 5EG6C 4MFHA 1AXSA 2D7QA 4UC4A 2FECL 1OZ2A 1O7DC 3EG1A 1VQNQ 1CXLA 4C59B 2CQVA 3HI5H 4OIBA 4OGAC 3QQ9D 5GIRB 2C4FU 4FYSA 5J1AB 2E4HA 1JFHA 4GBXD 2FEEL 3CN0A 2XZCH 5DUMH 2M02A 3FLGA 1LDPL 4X4KA 1OTUD 2AJUH 4AQAA 3SDYL 4J23A 4O9HL 3RDTD 3MVSA 2R0WH 4Y89A 5EO1A 2H8PB 5DYOA 1Q7YC 3D05A 4FZEL 3P0VH 2PVOB 1YHQA 4M5ZL 1IGIH 1F6AB 2BNRB 2NY5H 4HCFA 4UZUA 1QFUL 4K7PL 3OLGA 3FT9A 1DQJA 3DURB 3JUZA 3TV3H 3FN0H 1M90R 2DTML 3QISA 4YHKL 3RWGA 2WQAA 1U42A 3QH3B 2O9SA 3MFFB 4KFMA 4LSUL 2KYBA 2QEJA 1KELL 4Z5RA 2VUOA 4UT6H 4PJ5E 3O8XD 4JZJA 5E6IB 3UACA 5IHHA 2WXIA 2PKDA 3HRPA 1YIJT 1ROWA 4QRPA 1X27A 3W9EB 3WI9A 1GW0A 3BH9A 5LQBL 1DJXA 3U82B 2DJQA 3DUUB 1OGAB 2HUEA 5KSBE 5FWCA 3I9AA 2RQRA 2VR9A 4KKCC 3BIKA 5IV2B 5JLZB 4O2FA 4RTTA 1V3JA 2NTSP 5B4MD 2KC0A 2X09A 5IB3B 1FZKA 5GMKj 2VDLL 4J9GA 1D9KD 4UT6L 5EU3B 2ABLA 1KLFA 4TNEA 2VLLA 4WWPA 3C94A 1NMAH 2E9JA 1KGWA 4GBXC 3BP5B 4IU2B 5EBLB 2OI9C 4EZMA 1DN0B 1FHNA 4HD5A 4PJDB 4Q6YA 3VXSB 2MCAA 2ZUTA 2QTXA 2DVJA 1OEBA 1X5ZA 2EIMB 3A22A 4IGBC 4KUZH 4QOKA 1X5GA 3G4SQ 2C3GA 3C5JB 2NY2C 4PJXB 5GGVL 5FM4A 5JYLA 4HJGB 4H8QA 3MLWL 1U3HB 3MLPA 4OF7A 4PJOG 4RWYH 1PZDA 5DFTA 2WYTA 3EO1B 1WQWA 2GQVA 1MF2L 3VQLA 2VL5B 4UINH 3E8UH 3UAJD 5KCOA 4YDKL 4J3OC 4A6YA 4RGOL 1A6ZA 2CZNA 3JVGC 4JVWA 2GPZA 5DK0A 4LXFA 3ZE2E 3ZSTA 3ARPA 3WFCH 1VFOA 4YBHA 4PHZA 4Y16D 3VFVB 4C8XA 2SEBA 1QBAA 4PJIF 2L3QA 4M48L 3M54A 3TU6A 4AV5A 5I22A 35C8L 5EC1A 3TVMA 4R8WH 4U3SA 4N2EA 1X4XA 2FWOA 4FEIA 4P46B 3EYUL 1IE5A 4B3VA 3B9KA 4J4PC 2IVWA 3TVTA 2NY3D 3NGBB 3FTGB 4Z3GA 4LLQA 5GMKi 4L4JA 4Z3HA 2EIJB 1A1OB 1IBFA 2X6CA 1QFWM 4AJYV 5C6TL 2VV5A 2WACA 2UXTA 3RIAF 5I6PA 3QEHA 2ZUSA 2BPBA 4N4HA 2KYIA 4MAUH 2KQMA 1NIDA 2BINA 4IEFA 4IU2A 1OGPA 1BVKB 2NR6D 3CLFL 4PHXA 2L0DA 3PUUA 4HUCA 2FWOB 5GS1B 4IUPA 4UZGA 1HH9A 1NCAL 2ZQKA 4U3SB 1E2VA 3CFIC 3SKJH 4YE0A 4ZQKA 3VXRB 1WI7A 4RG2A 4DAGL 3US1A 1TNMA 4UIMB 5C3TA 1C8QA 3IYLW 3LQZB 1F6LL 3DUUA 3EFFA 2P5WB 2YBGA 5CBEA 1IU1A 1BQKA 2Z7UA 2B1HH 2DIJA 3H9NA 2YAEA 5EN3A 4JRYD 2YMXL 4U1IA 1UASA 1IKNC 12E8L 1GHFL 4JZJB 5E6IA 2KPNA 2M1KA 2R1XA 3HC3H 5AL0A 2EDXA 3VI4B 1DVFD 2QGCA 3O9WB 4P05A 3BUYA 3K2MC 5AVVB 5GGRB 2AGJL 1GRIA 2M9UA 2WXLA 4QLRA 2DQHL 2YD2A 2X10A 4Y5VA 3WNJA 1C5BL 1FWXA 2BIPA 3RDJA 3C5JA 3J80E 2P1YA 4X6BA 3WIHH 5HDQL 2LX7A 2F5AH 2AK5A 4RAHA 3R7RA 2EVFA 2P4TA 4XTUA 5GAOn 4X0KB 1KPRA 2GJ6D 3C87A 3E38A 3KHOA 1LNUB 1M7DB 1EJ6A 1ZVHA 1VQ5A 2OL3L 4HU2A 1DLFH 3OB8A 3GXFA 4KX7A 3QI9B 5FGBA 5IHWA 3ES6A 3EBGA 3ARDD 4Y9GA 3TT1H 3QXEB 3PMTA 3CCLT 2R69H 2XPGB 2VLKB 1LEKA 5FW9A 4M7AB 2WSEE 4JY6B 3X1GA 5ESAA 3MBWB 1KIPA 3VFGH 1UJ3B 4JFXA 4WTWA 5MENA 5KBDA 1GGCH 2D03H 2WO3B 4NFCA 4EIBA 1PNJA 4YWGL 1XR8A 3C75A 3VG0L 4CVZA 3CFCL 5L9DL 3V5KB 2VWFA 4GRMB 1H3ZA 1G7PA 3IAQA 3MRGA 4HZLA 3S5LB 2EECA 3Q3GA 3GZKA 2DJSA 1XGZA 2BZ7A 3JV4A 4D7BA 5CZKA 3R19A 4MXWH 2CK0H 4JW3A 3UFIA 4KY1H 1KCVH 5IQNA 2DKGA 4PWEA 2B3RA 4ZMYA 2CP6A 2ZAGA 2IFFH 1EZLA 1QNIA 2W10A 3E6HB 5F72S 1P92A 1GYAA 4UCFA 3PHOB 4Q4IA 4LP8A 3NJMA 1YHQQ 3MV9D 4HT1L 1UG9A 2KXCA 2VSCA 4M1CD 4Y5XA 3TBVB 3LD8C 4I9WE 4PJ5A 1LL1A 2HKAA 2CZ7B 2A9ML 1MCBA 1OXYA 5CKHA 1WAAF 3OZ9L 4DPAX 5C07D 1WWBX 5JYMA 2C1OB 3DO4A 1ZANL 3VYPA 2VASA 1MIMH 4FE9A 1FLRH 3JT2A 5E8EA 5H4YA 4HOZA 2YLKA 5KSBA 2LFEA 5E23A 3A5VA 3NJHA 3T0ED 3VNYA 2IPKA 3QXWA 3APMA 1P7HL 4ELKA 5FYJH 1QI4A 3VI3B 2F74B 5CZXC 2FWSA 3FHEA 3O3EA 1PLAA 2ADFH 2D4DA 5TTRA 4HS6B 1EHKB 1Q8MA 2EKSB 2P8MA 2WOBA 3P3YA 3AU1A 3KLDA 1BECA 3MRPB 1XH2A 2GCYB 1XIWC 2W0LA 3LB6C 4QXWA 1O5PA 3S5LG 2NY7H 3KWWB 3KPRE 4X8GA 3F04A 2WBJA 1MCCA 3FC8A 3FH7A 4JDEA 4AENB 4DAGH 4E9YA 4R7LA 5F9AC 4MJIA 2P26A 3QORA 5I1LB 2KUTA 4FABL 4URTB 1YITQ 3PWJB 2D7NA 2EJGA 3GRWH 3LEYL 5FHAL 3PJSB 5LBSA 3SZKC 3B1UA 2JV6A 4W81A 3OPZL 3BZEA 1T2QH 3EW3B 2FO4B 1PSKL 4PWKA 1LK2A 2X4JA 4TSAL 3NHNA 3RUXA 4PRHA 4G8GD 5KSUB 5BOPA 5SWZE 2J8HA 4P48A 3DLLA 2YRPA 1RZIA 4M7LL 1BI1A 1NFDE 5LN4A 1RADB 2E46A 2Q10A 3T0EE 4UQDA 4NGHL 5D6XA 5EOCJ 5HHNA 3B9KD 2Q6WA 3FRUA 3WLWC 1P1VA 2EO7A 3FCSA 4A67A 1YQ2A 3MA7B 1BCIA 3NDYE 4H1LG 2JB6B 2KH2B 3L81A 4S1DC 2NNFA 4ORGB 4KJPD 1K73R 4UMGA 4MSWB 1K76A 1MCWW 2RIKA 2ZAIA 1RHFA 4H8WC 3H54A 3O4OC 1CTOA 2YGPA 1VFAA 4ZODA 1BMZA 1R77A 3SPCA 2X4PB 4CVXB 3TX4A 5CD3B 3KVQA 2VLRA 3QZ5B 4XP9L 1PHTA 1SVCP 3VGDA 3VRIB 2CJTA 1T0NB 4LP5A 4GXUM 4HWBH 4X42A 1L9PA 1KXQE 3I6SA 4FQ2H 3GBMH 4G9DB 4YXHL 4Z76B 5C0GB 3VFTA 1CL7I 1FNAA 3CFEB 4AVHA 5DM7R 4F8TA 3OMGA 3DOSA 4W4NA 4QUOA 5HBBA 4L8DB 1EHXA 2HFEA 1RAGB 1F90L 1G3WA 5LCVL 4JRLA 3WXVL 3O41B 1EO8L 2EE9A 4W9GC 4NXKA 4R97C 3HTLX 4O2CB 1A6UL 4PGEB 4DZ8A 4YSSA 5I76B 2F54B 1KCVL 2CE6A 4OCWH 5DXWA 4XNZB 1H92A 5IHIA 3ULSA 4TULL 2QASA 1KLUA 2FH6A 2D3JA 4RFNC 1DBAL 4HIIA 4UV7H 4Z7VA 3M4GA 4RAVA 4TNWK 1TJGL 2YZ1A 2BUDA 3IKKA 4HCIA 3DUSA 4NN6C 3BO8A 3FCBA 1F6FB 4LSQH 3MUGA 4YO0A 2WLMA 1NQBA 4OBRA 3OYYA 3HS9A 3CH1A 4GAYA 4PLKC 4CRIA 3DHPA 4DNLA 3B6SB 4HUKB 5DC9B 3X3GH 1HAWA 2F58H 4WGVB 3P54A 1T0HA 3CK0H 2ZSVB 3QZOA 1FFNA 2ZYHA 1RUMH 1FNSL 4OQTA 1AHMA 1BQRA 3FQXB 1BFOA 4NO0D 4WNQA 3GDCA 1DHKA 4JZOB 5DEGB 5HHPB 5KS9F 4HDIA 1JZ3A 1JRHH 4JN2B 1S7UB 4K15A 1RK0A 3BEWA 5GSRA 2B15A 3VMNA 2ZKWA 2YO3A 2HCKA 5CLTA 2D8JA 1IZKA 1DVYA 1Z32X 2E9BA 2WQVA 2CDGB 4NB7A 1CI5A 4YNYB 2VC8A 4U0RC 1XF1A 2AZAA 4WK2B 2ERJB 3ROOA 1CL7L 2K9FB 2OL3B 4HISA 1J10A 3CMEA 2NSQA 1AVAA 3U9PH 2OTJQ 2Q8BH 1W6LA 2AMUA 4JQIA 5J26A 4M8VA 4QRPE 2DYRB 4YUEL 2IQ9L 4QNPE 1XQHA 4M7AE 3PGCB 4Z89A 2BS71 3HG5A 1DJ7B 2RALA 5D93B 4PFPA 4EDUA 3NTIA 2YOAA 3ZDXB 4B0MM 1HHGB 2DQGL 4ZAKB 4J6XA 3DTXB 3LDBC 4XXCA 1FN4B 2QTEA 3DSFL 2FO1A 2LU3A 5DUML 5I17A 2DLHA 4K3GA 1Y1DA 5D5ME 1QO3B 2NXZB 4PRNA 1O5DT 2CHNA 4L3EB 1Q90A 3FQTA 4X4XA 1AWWA 4WW2F 4DWHA 3GMNB 3KPOA 3MLZL 4NFBA 4WCYL 3F83A 1ET7A 3NFNB 4YDMA 5LWYH 2ZWSA 3JB9G 3SDDC 1JZ6A 4RCAA 1FNFA 4JFWA 5C07B 3N85H 2RM4A 4TVPE 1PLCA 4WO4C 2NYSA 5DZ9A 2DMOA 2ZG2A 3KPMB 2EIFA 4MDXA 3MYZA 4K71B 4Y4KC 5KVDL 5JOPD 3QFJD 2CRZA 2QG9B 3JAME 5D1QE 1QVFS 1LWRA 3DX7A 3QZ9B 3B3BA 1CFNA 4NM4L 3MMEB 1NGYB 2EXTA 4JRWA 2IWFA 1NCDL 1MLCB 2YFOA 4UQEA 4FIBA 3SYAA 1MPAH 3QIIA 1ZSDB 2G3XA 4P57B 2R9HC 4XH2A 3VXTA 1QVOA 4ZDHB 1XSKA 1CT8A 3BAWA 4FYYB 3REBB 3THKA 1TETH 2X7LA 2QHRL 2EGCA 4QHMB 3V4PB 2LU4A 5E99H 2EIZA 2RCSL 2Y4SA 3C60D 1UWGL 4C0GA 4QJ5B 3GP8A 4AK1A 1J87A 1OD7A 1S7VA 2E9WA 4HWZB 4LHUA 1J9RA 4G6AD 3O6KH 4FHKA 1N2RA 2ED7A 3FHAA 3ULVL 5IEHA 4IYKA 5J57B 2C7UA 3OKLB 4N5UA 1KGXA 4WUUE 3AW5A 1M57B 1MLBA 4IU3B 4NQDB 4RZCA 5BMFL 4HCRA 2A4EA 3SBRA 2ZJSH 3WYRA 1BI2A 4I18A 2Q87A 4BSVB 3CSBA 2NWMA 3U4AA 2Q3AA 4F7KA 2H0EA 2IDCA 3KBEA 2NYZA 3EUDA 3VXQB 4LPWA 1LEGA 1MVYA 1R19A 5GS1C 1ORSB 1AS8A 1KELH 4PIBA 4BZYA 4X98A 2MJWA 1WLHA 5DEZA 5TE6H 5HI4C 3FOMA 1A5FH 3FUMA 4YTLA 5EF3A 3KVPA 4AOFA 4JDSA 1MUJB 2HKNA 4G9FD 5AKRA 2H6PA 1Y6KR 3KPSE 4OZHE 4WHDA 5CMAA 3S34H 3CCVA 1B3IA 3EJRA 2JIXB 3ZBDA 3MJ8A 3O2DH 2EDFA 4HCKA 2OTJA 4E7LA 2ED1A 5DMKA 2EYSA 2UZPA 3NACH 2M1HA 1VQ9T 1E4KA 3AT8A 3DK0A 5AW3B 4IMKA 3LKSA 1I8AA 1UZ8A 1X6NA 5C0IA 4HHAB 2FATH 1COBA 3QFDA 4KROB 2C9AA 1LE9B 2ZPFB 4L18A 2JTYA 2HRPL 2OTWA 3UX9B 4JR9H 3C5SA 5JDSA 4PTTB 4R97B 4QY8A 1BVOA 3DIFA 4CSTA 3CVHL 2ITCB 3NCBB 4QRTA 3D69B 3ZTDC 3L5XL 1QTPA 2APFA 4GLRH 5L88H 3K2UL 4FC3E 3QJOA 4OLWH 4JG0H 4GLMA 4NKIL 4W9ZA 4F58H 5CM1A 2KR3A 1BXVA 2HLFC 3OAYH 2OJEA 3PWPD 4RGOH 4GP5B 4FYVB 1XTDA 2PCXA 1FO0B 4M78E 1VESA 3QZPA 4GOSA 3JRZA 4OLXL 4F8LA 3Q6FB 3AABA 2J1KA 1MFDL 4BQ6A 2QA4A 3T4AB 1SMAA 3LGLA 4FI8A 1VB9A 5J9PB 1NDMA 1YNKH 4AQZA 1W0VB 3QR1A 35C8H 3FCGA 3BJ91 1KB5H 5HHOE 5AAMA 2Z64C 1I8KA 4TNGA 5L88L 4JKPL 4MJJA 4P2OC 5F9WB 5LKNA 4U6TA 5HKCA 1HHIA 2A4CA 3UCQA 3T6QC 1N7ML 4U31A 5KZCB 3PMIA 2WP3T 2KLTA 3HCVA 3UPCA 1A66A 5BCAA 1WFNA 1E27A 2BVQA 5BRZE 1A8ZA 3MAWA 5KSVB 1R3HA 4Y4FA 4TOYL 5L2KD 5HHOB 1I8FA 3WEAA 5BXFB 2HX9A 1BEYH 4QYOA 4MJ6B 4AUYA 3ARUA 1N19A 3CBJB 1KIUA 3IDJA 2BOBB 3RBBB 4EO5A 4FD0A 4Y16C 1JZIA 2XETA 3BN9C 2YD6A 2J57A 1OAJA 3HNSL 1J1PL 1R5VB 4N2HA 4JUTA 5F97E 4OI7A 3FIFA 2DKMA 5F1NB 1AOJA 1NH6A 3CCUA 2E47A 2GSIB 4XO8A 1SJXA 3SSGA 4E41E 1BBDH 1X7TA 3LKNB 1NFIB 5HHME 5CGBA 1MCHA 2V1RA 4AC2A 4A54A 5J5EA 2E7MA 5L23A 1NJIR 3TT3L 4BELD 4DETA 4L29B 5F7AA 1IC4L 2BCMA 5AYTA 4AIXA 2ENSA 3ARFB 3L4TA 1U58B 1NCNA 2HA1A 3A4AA 2R5MA 1QVGP 3HNVH 1VIWA 5EZPA 4IBSA 1BJ1J 2GT9A 4HC1A 4R7XA 4UQ3A 4AT1B 5FGSA 4JJDA 4LASL 3LZNA 2V26A 1LTXA 2ZXWB 4ANWA 1SLUA 1L7IL 5DZAA 4W1TA 1WHMA 4HFWA 4JRXB 5AQ0A 2AT1B 3IJEA 4MMLA 1PCXA 3GO1L 3CAFA 2ZZDA 4XN1A 5JPMC 2CM5A 3P8DA 3ZQWA 3KPQB 3TO4D 2JI1A 5L2KE 3QA3A 4ESRA 4GW1B 1EEZB 3HS0C 3MV8B 5L7XL 4NQXB 5A40E 3LMJL 5ISZA 3VVVA 4WJKB 5DVPA 2DWYA 5DLLA 2VAAA 2EDDA 3SGKA 3B1TA 3IM1A 2V8JA 1D6EA 3BHBA 3RUGE 4DBQA 2QPEB 4F2EA 5I5JA 5FU7B 3PPEA 1AKPA 2JNZA 4HCGA 1QMCA 4F5CA 2ZKYA 4LVOB 3HG0A 5DFVC 3GS7A 3N5AA 5HGBA 4XTRD 4K8RH 5IB4B 3VQ1C 1HOEA 3MLTB 2D31A 1NJIC 3DYPA 3T77B 3TC9A 2KMWA 2C9PA 1QFOA 3IGUA 1JF6A 3OLEA 3UXFA 5DZVA 3T1FB 3VWJA 4LQFL 1SBSL 2AZVA 3P9LB 2RHZA 5FDWA