3C12A

Crystal structure of flgd from xanthomonas campestris: insights into the hook capping essential for flagellar assembly
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
138
structure length
138
Chain Sequence
DQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAATSAGFVNFEITDANGTFVKQLSVPASAAGEVSFAWDGTDANGNRMAAGKYGITATQTDTAGAKSKLATYVDAPVDSVTIGSDGLYLNLTGLGTSPLANVLRVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Flagellar protein
publication title Crystal structure of the C-terminal domain of a flagellar hook-capping protein from Xanthomonas campestris
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 24
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
A PF13861 FLgD_tudor FlgD Tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.910 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3c12A01
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3c12A02
3OSVA 4ZZFA 4ZZKA 5K5YA 3C12A
chains in the Genus database with same CATH superfamily
5H35B 3C6LD 1U3HC 2D0GA 1UA6H 3QUMB 1HSBB 2OW7A 3FB8B 4Y2NA 1KC5L 3MX0A 4LCCB 4PGCA 2A1WL 2JKSA 5FUCE 4BZ2A 2Q6WA 4AMXA 2D9TA 4B7IA 3SGKC 4N2BA 2EYZA 4NKOB 3ZL7C 4NIKB 3U9UA 1WFTA 2CU9A 2IH3B 2VASA 3K80A 3RIFF 1U8HB 2NQ3A 3WAJA 4J3XA 1PX3A 2NY5C 3BEWA 3MUGA 4L8BA 1M2OA 3B2VL 4OLVH 4R56A 4PSPA 3EOTL 1WIPA 1BREA 3ZTJG 4TMPA 4ZUSA 1HEHC 3SDYL 1KCVH 4F37K 3QUML 2Z8WC 4XBEH 3GSNH 3HC4L 5DT1H 1PLAA 2OL3L 2QADD 3Q9QA 3QI9D 2CUDA 5IQ9A 3MACH 2C4FU 4NC0B 1XIWC 5HYJE 5J11B 3X3FL 3BT2H 1NDMB 3IFPA 2CJTA 2YRBA 3WIFA 2DYSB 2VAAB 5H37G 3TT1H 4RX4A 2A9NH 1MRFL 4P59L 5ICXA 3V0HA 4DUVA 4JCLA 3H8NA 4HYTB 3AXLB 1RMFL 1P1ZA 2MKWA 3CFMA 4D2NA 4Q97A 2OTLA 1E4HA 1NDGA 3HUJA 3TBYB 4PFEA 4N28A 4ENEC 2RQEA 3LPPA 3KXFA 3G71Q 4J1UA 4P4RB 5E2VH 3UP6A 5D7LD 4G9DA 1XSOA 2DJZA 3S6CA 4XTVA 5C6TH 2GFBA 1CURA 2X4SB 3JB9F 4XTWA 3OYHA 3RMQA 3RWCA 2Q5BA 4KNQA 2FATH 1QO3A 4IS6A 1A5FL 2PWEA 1KC5H 3GHBL 1FL5A 1A0QL 4ZQKB 2A1WH 1XGUB 2EPDA 5M94B 1RVFL 4PMEA 4F2MA 5GGQH 4JDVB 4AKPA 1K8DB 4JJHA 4J3VA 4L8CB 5BRZD 3SPVA 2YAOA 3QP3A 1DUZB 2BK8A 3NCYS 4N4GA 4X9CA 1J05A 2XN9D 4QUOA 1DCLA 3IDIB 2FNBA 3AXHA 4A68A 1LQBC 1TVDA 3B2VH 1OWRM 3EOTH 5EU5B 3V7AG 1NAKL 3SDYH 3UTTA 3QUMH 3HC4H 3QH3A 2G9KA 2OL3H 2XHCA 5AVRB 3JV6B 1ZA3B 1JNHB 3X3FH 2JKWA 1SHWA 2PYFB 4HIHB 4YK4C 1AP2B 3EAKA 3KLQA 3STLB 4LSPL 3KDMB 2OBGA 4TRPL 4WNJA 4ZO8A 1MRFH 2VQ4A 4P59H 4NAMA 5DJ0B 3N91A 4B0MM 3QORD 2KRNA 5IV2A 1RMFH 2QDLA 3BUYA 5E0QA 1A1OB 1IGQA 2E64A 2JMCA 4B9JA 4N2GA 2M26A 1JGEB 1ND0A 2G4GA 4P23B 1LYQA 3FUMA 3KZ8A 2QGCA 1IGML 4K9EC 1XGRA 2XN0A 4K8RL 2JQAA 1E27A 3CIAA 1FL6A 1R24A 1EERB 3LKOB 3RWEB 1FZMB 2V7HB 2PW1A 1CDCA 3WUZA 4BE6A 1MI5A 2VR6A 1A5FH 1WZOA 3ILQD 3WXWL 2KT1A 1DBKL 5JIHA 5DEFA 3P9LB 4JZJA 1A0QH 3JAME 4ZFQA 1RVFH 3UTTD 1MIEL 3TZVB 1KC8C 3VFGL 1A02N 3ULUE 1AXSA 2AW2A 4YHIB 3D69B 1LWHA 3FQUB 1GTNA 2J3SA 4PJEF 2RK1A 3QIWA 1DQTA 4PJAF 4JDEB 4DCQA 1NAKH 5DJXA 2F5TX 3LLRA 1XNIA 2DM3A 5E2WL 2E9JA 1OB1A 3P54A 5E4AA 2OJ2A 1M7IA 2X4TB 2WXPA 5FS5A 5LCVL 3EHBB 4BFGA 2G0KA 4B6MA 4UDTB 4F7UG 2MRYA 5L7XH 4LSPH 3LGLA 4HGKC 4LSUH 1A6TA 2F1EA 4TRPH 4E41D 1TTUA 2Y9RT 2FX8L 4PP1D 3U2SA 3IVKA 1ET5A 3BP4A 2Z7WA 3B7TA 2Y4YA 4M7DF 3G5YA 3HZVB 2CZ0B 3ZEHA 2WMPB 1KD1U 2FHDA 1MHCB 3H9YA 2OJEB 2GTWB 3QXDB 1V3KA 1SXSA 1IGMH 2X4RB 3C9NB 4K8RH 4FG0A 3KNBA 3UAAA 5DJ8B 1ERNA 1UB6B 1B2WH 1AR2A 1QP2A 5FO7B 3UDWC 2WINA 4LDOB 1UM6L 2DYIA 2V5RA 2PTTB 5DLQE 4JRLA 4U1SB 3WXWH 1DBKH 2YRPA 3LRLA 4FP8L 1OEZW 1CDBA 4TQIA 1HESA 2L0DA 1MIEH 3VFGH 5E8NA 1JZ2A 1BK2A 4JL2A 1VUBA 5T3XE 3PPSA 4QOKD 1XF3A 1NE8A 4YSDA 2P5PA 1J5OL 4KNUA 1MCWM 4OF5A 1WHGA 2NNFA 5DJAB 3F62A 4PU2A 4JRXE 2L8DA 1OGAA 4EMKA 3BUQA 4QWWD 5DHYB 3QJFB 1U21A 3FQ2A 5E2WH 3WJLC 4WGWB 4Z76B 4ZTFA 4PJOG 3P8HA 2AABL 2A6KB 4ZQTA 5LCVH 3WFCL 2D4FA 4GMSL 4P4KC 3CBOA 1LDPL 1VQKA 2C8NA 3EF4A 5IK3B 4Z78A 3VSUA 5IB4A 2FX8H 5FWRA 1OLLA 1R3HA 2A99A 3H2WA 4FXKB 1WWCA 1YJWQ 2D9QB 4MKMA 3C8DA 2PTUA 2GCXA 1GMIA 4GUPA 2LCCA 4MLIA 3DK0A 4RMWA 2W1NA 4ZPVB 3PJNA 4LQ1A 4LCCC 1AVZC 1IIIA 3JRZA 5DLOA 3FB5B 3OR7A 4MMYB 2Y07L 4UQCA 3RJDA 3RERA 1UT1A 5BVPL 2ATCB 2QTXA 2K45A 3H2PA 2NX5A 4UTBL 3KPRD 1UM6H 3TTSA 1ZT1A 1R3KB 1B9KA 4NZTL 4KI5C 3CQTA 1I8UA 4FP8H 4F7EB 4FW1A 1PDKB 4JN2B 3BQVA 4MXVF 2B08A 5GMKm 1M1XB 2CLZB 4LL4A 4JDTL 3J8F7 4JFZH 3WLBB 4WF2A 2YRCA 5FAAA 4BCYA 3MRKB 1W2BA 3P69A 3EFDL 3VMPA 1QSED 1CKAA 1FVDB 1YECL 1HHJB 4MHHG 5C0JB 2B2XL 2YZ1A 3HPLA 4PQXA 4AGMA 3DO7A 5J11C 1OP4A 2WYTA 1NEUA 3SE8H 5IB2B 2YN5A 2HFFA 3LRKA 4MKTA 2UYLA 3JCMc 3QJQB 4LBEB 1RAEB 2VR8A 2EEFA 3L3HA 1KTCA 3MLVL 2AABH 2KERA 3SWNB 5A6MA 3WFCH 1S4IA 2EE0A 3MYJB 4GMSH 1FZKA 1LDPH 2EO7A 3W81A 4YS4A 3K71B 2FUTA 5DUPH 5CK9A 5CIPA 4PMFA 4AGPA 3EFSA 1KGWA 4UANA 2WQSA 5EF2A 4C8QE 5KCHA 4JRXB 1UGNA 4ZMWA 2P49B 3IJEA 4HCFA 2IQAA 2A0LC 4OGXL 2YWWA 1ANUA 2XNAA 5FOBB 3I6LE 1HXMB 5TGBB 4FYVB 2Y07H 3P3YA 5BVPH 3P0YL 1SN5A 2RJMA 1WBZA 4UTBH 2FZ3B 1MFBL 4WI0B 4ZTPL 3NDZE 3R8QA 2W9EH 4GW5A 4NZTH 1CVRA 3EG3A 1QW8A 3NACL 1F3DH 4LOUD 3GWJA 4R7XA 4WI4A 3MRBA 4TL4A 1GRIA 2ZAGA 4JQVA 2X3WD 1EIBA 3TF7C 4JDTH 3T2LA 1K8AU 1QVFS 4BE5A 3F7LA 2Z0WA 2J6OA 3OS0A 1ZD6A 3EFDH 5JXEC 1T0MA 4HHAA 2R2EA 1YECH 4OZFH 2B2XH 1NPJA 2VLJE 4J3SA 5FUCC 4ZFGL 1A4CA 1SOQA 3OJMB 3QQ4B 1DSYA 2BVPB 1ZHKB 3ROLA 3BVTA 3NGBB 3PWJB 1WICA 3OYGA 3QEQD 4PJXA 4YO0A 4PD4J 3CBPA 2N56A 1RPUA 4WFED 4WI9A 8PAZA 4X80L 1S3RA 3MLVH 4B3VA 3CCLT 2QHLA 1X69A 4FSSA 5T33L 4MNQA 2KYIA 1SZNA 3UYOD 3ZKXB 1PW3A 4LD9K 1HEZB 2YXYA 3LGFA 2OM5A 3F00A 4P23C 2FECL 3C95A 1OGTB 1RZPA 2DJUA 1K9MC 5ID1A 3F5WB 5BS0A 2I0NA 5FO8B 4V2CB 4AEHL 2MKLC 2PCPA 1YY9D 3QHTC 3B56A 3JCMf 1TQBB 2XZQL 3ULSA 1GXEA 3HE6B 4OGXH 2I32A 5A7BA 1UKQA 4PWGA 5L2KE 4UNUA 2MIZA 4IMLA 2DXUA 3QKJA 1C16A 2JKJA 2C9QA 1G4MA 4AC2A 3P0YH 1SM3L 3PAUA 4E9LA 1IBBA 1MFBH 2LQKA 4ZTPH 5CCHE 1M2VB 3NJJA 1K5NA 4PFZA 1JXJA 2KMWA 3NACH 2EVFA 2BWQA 4AIZB 2QA4T 3EDKA 3AUVA 4C8QB 3IDNB 3P40A 1MRCL 2BINA 2MQCA 5A0GA 3CC1A 4IOSD 2MWOA 4MJ6A 1J9TA 1F11A 3Q0HA 4FE9A 2OQJB 4L3EA 1NIFA 4M75A 3HZKB 4ZFGH 2EYSB 5EZLB 2EADA 3ERXA 3TCTA 2YEZA 2V5SA 5GZNC 3OJ2C 1U2CA 4JE0A 4APQD 3L4XA 4R7NA 4WV1A 3E1ZA 2R0LL 4AFUC 1PZ3A 3OKDA 3QEHA 1SF3A 4WQOA 4X80H 5C0CA 2KNBB 4M1CD 5T33H 2BZYA 1XAUA 2HVKA 5DHEA 1H8SA 3BX7C 5DJDA 1R0CB 5F7EL 2RHEA 3WFHA 5KN5B 2BX5A 3CBJB 1ADWA 5AOMA 3KPQA 2IOIA 3WCYA 3GJFH 2VLJB 25C8H 2XWJA 1GSKA 3TGXA 1U36A 3DSFL 3W11C 4JGUA 1TH7A 2WWKO 4NKIL 3T4AB 1QFHA 1OAUL 4AEHH 4NQCE 2XZQH 5G4NA 2C9UA 2L0AA 3FS9A 2Q1EA 2LABA 5D1XD 2XWBB 2EKSB 4R96B 5HVGB 4JPBW 4KK8D 1SM3H 3SD5A 3D7SB 3ARFD 2V17L 5JQIB 4P5TD 4NQVB 2ZCHL 5HHNA 2VVKA 1KB9J 3GUFA 2ZYSA 3VRJB 3NCWA 1G9HA 4YSQA 4AH2B 3T3PF 3H54A 1BMGA 2EC9U 1TXQA 3O2DL 1MRCH 2AEPL 2DQGL 1X7TA 3QJOA 5C0CD 1KYFA 1MCEA 5L2KB 5F6HI 4IIQB 2SRCA 2QGBA 1GZHA 2VB6A 3BPCB 1XZ0B 3W39A 2D7PA 4FL4B 2JLLA 2XPGB 3C8KB 4Q9CA 3ULUC 2ICEC 2DQCL 5ISZD 5IVNA 3VJ6B 4BH8A 1BA9A 2KVQG 3NQIA 1NJIR 4HZLA 1JJ2P 1AS6A 3ZPDA 1ZLDA 1TXKA 4FXKC 1BV8A 2N7AA 4RTXA 4JANA 4OCXH 4D0CB 4N85A 5F7EH 1XX9C 2Y7OA 4MFHA 1UCTA 4LNPA 3WDIA 4EN3A 3FAWA 1QKWA 4MJ4A 3A8LB 3D12B 5T3ZH 3DSFH 5SX4I 5D2LB 1RAIB 1I1AB 1OCWL 1UXWB 4YMPA 1T04A 1P2CA 3NCCB 1F3DJ 2LFGA 1G7HA 3BEVA 1OAUH 4NKIH 1NCBL 5IT2L 5JR1L 3W5MA 3NHNA 1NC2A 5LBSA 2SODB 2I07A 5KANG 1OZUA 2DXCA 2WNWA 4IGBB 4A2DA 3O3EA 3JCMV 2XG4A 2CDGB 2CPCA 1DVSA 5T1DL 4M7LT 4WWKA 2FJUB 2Q3AA 1VQ7Q 2D6FA 2ZCHH 1NL0L 2D8KA 5GIRA 1MCLA 5HYSB 4NKDB 2YBGA 4XTYA 4YDKL 1WEJL 4PCKA 1Z5LB 1ZE3H 4NQCB 4WHYG 3O2DH 2AEPH 2E7LA 3CC7Q 2DQGH 3N5BB 2X10A 2J21A 5HDRA 4RAHA 4WW2C 2IXQA 4N0RA 4JCMA 3CH1A 2D03H 5I0DA 3SWNC 4OBSA 1A4BA 4D7BA 1R9FA 1RZJL 2DQCH 2LC4A 4IKJA 4R4NC 5C0GB 1QSZA 2VQ1A 1FV1B 4N2DA 1J0JA 4ZOAA 3UBXG 3BWUF 4Q56A 2F5AL 5EU4B 1NYGA 5HY6A 5D70L 1B0GA 5JUEL 3OB0K 3RHWF 1HYSC 1RLQC 4DIXA 2VN3A 3MYZA 1LXMA 3IM1A 2LMJA 1OCWH 1FC2D 3ZUCA 3VWKB 5IT2H 3HRUA 3QUYD 1NCBH 5JR1H 2V5YA 4BFFA 3CCUQ 2HMID 3O0LA 1TYRA 4WKZA 5DO2D 2VISA 5ECJE 3FH5A 3PY9A 2BY1A 3K5RA 2YLCA 4LHUB 2GQHA 4P5KA 4LDLB 5T1DH 3IMBA 2RJEA 4G5AA 1M42A 3WG7B 4HT1L 1X5GA 3M55A 4OB5L 4R7DB 4TUUA 3TV3L 5I15L 3U82B 4OCYL 1WQ7A 3RB7A 15C8L 4BFRA 4L3CA 1NL0H 5B7FA 1H3XA 2JXMB 4YDKH 3TCLA 1WEJH 4UT9L 1M56B 4NRXB 4QQDA 3KL0A 5J12C 1UB5A 3ARBA 1FYTD 2VQTA 3KYMB 4N9OB 5FRNA 3KM1A 4YSSA 3BKML 1I07A 2DF6A 5DZOA 2IPTL 5TFSL 5D1ZB 3CU1A 3QFJE 3FCTB 2FGWL 3ZKXC 4OD3L 4GKNA 2C5DC 5JHLL 4PJGA 5JHDA 1RZJH 3DPDA 3F85A 2JVUA 3GGWB 2QEXQ 4YVNA 3CUPA 4BHUI 3Q8EA 2A9DA 3KWWB 3MLSL 4OZHE 1WDXA 3MJXA 4HPHA 5I6KA 1NMAL 3BQUB 3JCMJ 1Z66A 3TNNA 4Z3FA 32C2B 3BZFA 4I48B 4G7SB 2F5AH 3JYBA 4C0DB 5KVMC 1TQBC 5D70H 4Q89A 2BS71 3HE6C 4HHGA 5JUEH 3LV3A 5ECAA 4NPKA 1P7QB 5F6IB 2B9BA 4LU5L 1FNSL 5DMGC 5T1LB 3I55A 4XXCC 1Z3GL 4NWTL 3WTYA 1TSRA 1JWMA 1DJYA 3QFDA 4HKEA 2CBMA 3AS0A 5HHVH 1L9PA 1OTSD 4A55A 2H2PC 2R29L 2YD0A 3T0EE 4TV3A 2WB1A 4C8QC 1DR9A 4HT1H 1HWGB 4OB5H 4DGVL 5KYWB 3TV3H 4OCYH 4CU7A 3V10A 15C8H 1KQSP 4K55A 1EA9C 2NY6B 2P8PB 5FM5M 3SPCA 4UT9H 3V5DB 2BIMA 4OW6A 5IESL 3Q1SL 2CO6B 2KH2B 2VDMB 3CSBA 3RMSA 4R0KA 4UZUA 2VDKB 2DWDA 3BKMH 3LZLA 2D2OA 4PJBA 4DPBX 3I9QA 2IPTH 4Z0BH 5TFSH 5CU9A 3D3VE 4NLHA 4L48A 4QKUA 1VFOA 2R0WL 5FGBA 1U8CA 2J1ZA 2FGWH 1MLCB 4BI8B 3CFJB 4OD3H 3RX9A 5JHLH 1JZIA 3K8LA 3HI1B 1JEGA 1ZSHA 4B9XA 1KCKA 4R26H 4MMXA 3KMDA 2G5RA 4C57C 4N0CD 3MLSH 2LJ1A 4RKUE 1VFAA 4NO5A 1NMAH 1ZE3C 1HHIA 3UPUA 1WIEA 3T4AC 2FYVA 1LO0L 2WTRA 4JUSA 3UC0L 1F18A 4AUYA 4M4RB 4QO1A 1JHKL 1ADQL 3QFJB 3O3BA 5B38A 4LU5H 1FNSH 4PP2A 4HS6B 1S9XB 1BP3B 1Z3GH 3IAQA 4NWTH 4GRLB 4KBPA 4PJ9A 1F90H 2P47B 4EI0A 5CLWA 4LCVA 5E5MA 3V0JA 1BMWA 2RF0A 4ES9A 3CXCP 1A3RH 4OZHB 2NSXA 5E1GA 3CDZA 3KHOA 5IW1B 3BPOB 1K4US 3BP7A 2R29H 1T21A 2FL5A 3BWAA 2HD0A 3WN5C 2CBOA 3FRUB 3DBXB 3EHRA 3GUTB 3EG1A 2OLDA 3OJVC 4DGVH 4DBQA 1Q9WA 2VXEA 3D9AL 1SSHA 4IIQC 4X2UA 3TWCL 4B50A 2BCKB 4ABWA 4Y4FC 1X5JA 1QP1A 4FL4C 5K9KA 2HZHA 1ID2A 1JS4A 3Q1SH 5IESH 4IKNA 4QLWA 3ML9A 5DHXB 2OTLT 4F7CB 3IDXL 5J7CC 5A1AA 1KSWA 3T0EB 4CJ0A 5G55A 3LNFA 3VFPA 2R0WH 3OVUB 4G7YL 5HYEA 5AD0A 2DM7A 2ITFA 3US1A 3WNPA 1T7WA 5I30L 1CE6B 1JWSA 4G6FB 3PE0A 1KFZA 1EZZB 3BFWA 1I1AC 2GYSA 3ARYA 4FFWD 1ZLWH 2E65A 1O9WA 4X9IA 2GGRA 1EBPA 1LO0H 2VRQA 2CUMA 5IHLB 1ZIAA 4PJDA 3UC0H 1CFTB 4AL8C 1OEBA 4M8QB 3D3VB 3LPFA 2BRRL 2YAFA 4IGBC 1JHKH 1ADQH 2GVYA 1FMKA 1H92A 5EULV 1RJYA 1R3IL 4KVCL 1KCBA 1U8MA 4N26A 1NH6A 3ZRSA 3W2DL 2R15A 3IETB 2YQ2A 2OMTB 3DX6A 4GBXC 1MMNA 4J6YA 3U0TA 4Z6AT 3AY4A 2DDQL 3MXVL 3V8KA 1SPDA 3FTGB 4J4PC 4ZUVA 4KKZA 1KFGA 2QPEB 4MJHA 1PG5B 2DL4A 1H3UA 1SLXA 5D72L 2DQJL 5KVDH 2ADIA 3ECBA 3KEHA 3D9AH 1YN6B 3TWCH 2V3EA 2HKNA 1MDAA 1A1NA 3HG4A 4QY8B 5EUKA 4GG6E 3LPOA 4KKPA 1U5SA 4BK5C 1IBHA 1E40A 2XG5A 2PWFA 1IFRA 2HSEB 2R0KL 2C0IA 3DRQA 2FCBA 1CO1A 5DQ9A 2WGNB 4G7YH 4PI2A 1T89A 3KGTA 3ARSA 2AZSA 4MX7A 5CIUA 4Z02A 2RI2A 1JWUA 3RHWK 3VI3A 2WXFA 5KYUB 3E8VA 2P45B 5T5FH 4P5SA 2MPAL 4HJ0D 3NSFA 5I30H 5IQOA 1QVGA 1ORQA 2Z92B 3VWKC 3NDYE 4GINA 2EDTA 1F4AA 4OZFG 3DX3A 4MJID 1IM9B 4KDVA 4DUWA 5MEQA 2BRRH 3QA3A 4UM9A 4ZO7A 5DZAA 4X8XA 3ZMNA 1R3IH 3L54A 1OAXL 5DD0H 2EE9A 5CM1A 2WXLA 2HX9A 3GNML 2J44A 2YPLE 4XI5D 4OJDH 4RNRA 5F0PB 3FT2A 3HS9A 3MRFB 1GZPB 4E2OA 4NSKB 2NY2B 2DDQH 2BKDN 3B7SA 3MXVH 3MBED 1QR1B 1SYVB 3V6FA 1IGJB 1LM8V 4XTUA 1RJLB 4Z8FL 2GBQA 5D72H 4RMRA 3PQYA 2DQJH 4NUJB 2WWMC 4G1EB 2E70A 4BK8A 4U05A 3KFVA 3V8LA 1LO5A 5D1ZC 3TA3A 1UVQB 1XB3A 5HI3C 5KSUB 1XFPA 1Q94A 4LB8A 3TPUA 2YPVL 4YBQD 1OM9A 1TLKA 4PRPA 4FZ8L 4DAGH 3DARA 3VGAC 5I28A 2RCSL 2R0KH 1PKOA 5GS1C 3BQUC 3AFLA 1WK0A 3L5HA 4X50A 2YXMA 2APTA 4C0DC 4HF5L 1P4IH 3JWDL 5J6HB 5DUJA 3RU8L 2MPAH 3VFTA 3OB8A 4HMCA 2EKJA 3RBSA 1O6VA 1QASA 3BVWA 5D7JD 3F05A 4MZIA 5F6IC 4GG6B 5D9SB 1JGDA 2XV2A 2JB6A 3HCVA 5ITFB 4HWZB 5E8PA 1XSJA 2WNGA 5FGCE 5IFHL 3BLKA 1FMWA 3D85D 3AUWB 2FYYA 1EXUA 2ZOOA 1OAXH 1ZV5A 3NCBB 1CU4L 3BISA 3GNMH 4XRCB 1XF5B 4FT4A 2V7NB 2B8AA 1Z9LA 3TNMB 2NY6C 2EJ9A 3ATBA 4H8QA 5E6RB 1MCPL 1KFAL 4UQ3B 3SJVD 4Z8FH 1DN0B 3WGVB 3AC0A 1NZRA 3G5ZB 1XCXA 2C1PB 2D31B 3LN4A 4NBXB 1VQKT 4U0QB 4OZGA 4N0AA 2CBPA 3QDGA 4JY6B 3F64A 4AQZA 1RV6X 1YITA 1BBDL 1FJ1B 2D0HA 2YPVH 3I50L 3PJSA 3LQAC 4KXDA 5IBLD 2NXZB 3BSZL 2G0LA 4NNPL 3VH8B 3VQ2C 4YGVB 3QQ3A 4MMZC 1CLCA 4YIQA 4Z8AA 2RCSH 2BWIA 1NJ9A 5F3HA 2QXFA 3OLEA 2GBUA 3OJDB 4KZDL 4N3TA 4HIIA 1X6OA 1PMYA 1KELL 2QAZA 1W15A 1T7VA 1WZKA 3UTOA 3JWDH 3BP5A 3X25B 4M78A 1IE4A 3C60A 2IH1B 3RU8H 3KVPA 1HCFX 1MAJA 4PB9L 4X5RA 4YSOA 5HPMA 1OT1A 4J23A 5FKAA 1KK7A 4GRLC 1U95A 2W60B 2EECA 2CHWA 2VN4A 1R5WB 2QQKL 1T3FB 4GH7B 4HJSA 1Y0LA 3EYUL 5IFHH 3BFOA 1NC4D 1X4XA 1CFNA 2BNQD 3EO0B 1UFFA 4K9JA 3BPOC 1VA7A 4KUCF 4XCEA 1CU4H 3MBXL 2D7OA 3ELQA 3IMWA 2YPKA 3L9EA 5K9OA 2JM8A 1BOGB 4JFXB 2HQHA 4U1HA 3LNHA 1CGSL 1U3NA 1W0VA 1ZA6A 4J83A 5K93A 4XO8A 5KTEL 2X70A 1KFAH 3QARA 4ZODA 5J57B 4I85A 4C8QG 1T03L 3DV6B 1G3WA 2BVYA 4DFIA 1JZGA 3V5KB 3MLTA 3JT2A 5FGCB 4ZTJA 3DURB 5FYKU 5C0FA 1RHFA 5E23A 5HHQB 4BZ1L 5EDSA 4J9EA 1QABA 4PJHF 3AT1B 4GRWE 3G5VA 1BBDH 1NBYB 3I50H 5GAN7 3O3DA 3C60D 3MJ9L 2L7QA 4L1HA 3BSZH 4NNPH 4UNVA 3AG3B 2NYYC 4FCYA 1NJIC 4NPYB 3PNWB 5BQDA 1AD0A 1IGFL 3LTVA 1T5KA 4M7DC 4KZDH 2PQWA 2NZ1A 1J3TA 1KELH 2QGFB 1B4LA 1LEGB 2GKIA 1D2PA 4QGTA 4W9EC 3T5WA 1N26A 3KLHC 5A2IH 5F9WC 2KZWA 4JJ5A 1WBXA 4HC1H 3MRGB 1QRNA 1O7VA 2QDYB 5DJ2B 1EEQA 4N8VB 1TTBA 5C0BE 4ZPTB 3TSZA 1VQ8A 2CLRB 5MERB 4XCYB 1YEEL 3HAEA 1OF2A 4EIZC 5HSFA 2QQKH 3PWUB 4PJOD 3CPWS 2OTJA 3EYUH 4MYPA 3GP8A 2R9HD 4G8GA 3PFSA 1SOSA 3P2TA 4XTZA 2JCCA 2IPUK 3LRGA 2A83A 4PWKA 4XNMB 3H55A 2ID5A 2UZIL 3MBXH 4F7PA 2ZOTA 2VDRL 1RL2A 2F8IA 5BUPA 1VADA 2ZOUA 3PRZA 3CHQA 4GXVL 2WLIB 4KNSA 1HSAA 2LZ6B 4WWPA 1CGSH 1I85C 1VQ7A 1DVYA 1OIOA 3UJIL 5A2LH 1LK3L 5KTEH 2BZ8A 1NLPC 3HMWL 3NFPA 4WTZG 1T03H 2DMCA 2G60L 3QG6A 4MWFA 1HOEA 1FL3B 3K74B 4LDUA 2DERA 1ZLUH 4BZ1H 3CSYB 1MPAL 2RALA 3H7BA 1KTBA 2UY7A 3H6JA 2DL7A 4H26B 4OD1L 5EC1B 5FV1L 2DL9A 4FQPA 1BIHA 4JFVA 5F89A 1GHFL 1QRND 2I9LB 4FIBA 3D25A 2N01B 3A67L 3ZMRA 3EYSL 3L3DA 5M95B 2NNRA 5ANMA 4L8DA 3SDAB 3VXOB 3GMQA 1A6AA 4G9FE 4LOVA 1MOEA 1KB5B 4ATWA 1ILUA 2WW8A 3HI6L 3IDGA 3IS1X 3GMLB 4AGOA 3DV4B 2A37A 2CYZB 2E4HA 3JQOB 4GRWB 4HG4K 4FAAB 5FU7B 2ICWB 4LCUB 1YEEH 1VA9A 1WT5C 2YWYA 5EV7A 1NOAA 5HHXL 5DK0A 2NY2C 1CLVA 2FNWA 2IGTA 2WBWB 4JZNA 2C4FT 2UZIH 4NDMA 2VDRH 4WGKA 3T2PA 4J3OD 5J13B 4YXKL 2WWOA 4XGZA 4GXVH 3UJIH 2PXYB 5F1KC 2CQVA 1KB5L 3PWVB 1LK3H 2W92A 5HYSG 3HMWH 5IR1B 1JXGA 1YNZA 1MAML 5C0BB 3POCA 1WUNT 2Z91A 4IURA 2NW2A 3IRPX 2G60H 2UXFA 3MTXA 2DM2A 3OHXA 1WX6A 1RUKL 4JFEE 5AVTB 1QHPA 1K0SA 4LARL 4NZRL 1F1DA 1M71B 1MPAH 2DJSA 4M02A 4OD1H 1BI2A 4WWID 4F2EA 1E67A 1G7LB 4G1MB 3CMEQ 2OMZA 4L8SA 5FKPB 2IDCA 1GHFH 1I7UA 2B7DT 1X5ZA 2XTJE 3A67H 3GIBA 3EYSH 4FQLH 1C5DA 1GGBL 5B1CA 3MNVB 3RTLA 4X6DF 1Y1UA 3ALWA 4M61B 3IMSA 5FWQA 3ZN6A 1HHGA 2F1BA 1AMYA 4WO4C 2JM9A 2HRHA 1GCQC 2TAAA 1SHGA 1UWEL 2XKUA 2VNCA 2K70A 1OU9A 1VQ5T 1YUHB 2WXOA 3HJ0A 4ZTOL 4OCNC 1C1EL 3RAJL 5GGRA 1XIWD 1F4YL 3JUZA 5D2NE 2ARJA 1R3JB 4LHUG 5I82A 3JTTA 3REVA 5FU6C 4G9FB 4JFOA 4R3SB 5HVHB 4O5LL 4YXKH 2FBOJ 3DDGA 4C92F 3ZIMA 1KF9B 1QMUA 1KB5H 1EK3A 3MZTA 1KXHA 3W0WE 2UY6B 3O8XA 1MAMH 4I9WE 2NTSP 4AM0B 2BVOB 1KGIA 4FLHA 1FG2A 3SQBA 4ENED 1PKQE 3WNIA 5DHVB 2NXZC 4JFHE 4KH2A 1RUKH 1N5AB 1QBLL 2AJVL 1GGYA 1JF5A 4LARH 1Z5YD 4NZRH 5KOVC 3NTCL 2ZX6A 3BE1L 5DRWA 5AW3B 1J9RA 4JFYA 5C08E 5LNDA 4XR8C 3MP6A 1Z9SB 1XXDC 3SD4A 3T4YB 6CGTA 5IM7A 2PR9A 4PW9A 2J12B 5L2JB 2K4YA 4RRPM 4H8WL 4MD4A 1GGBH 3TLRA 1HINL 5C0IB 3U7WL 1FZOB 4AQEA 2LT1A 4DERA 1FCCA 3NG5A 4ANUA 3AS3A 1NTDA 3FUKA 4JFEB 1AOJA 1JZ5A 2XFXA 3SIKA 4TVRA 3I6KA 2LQNA 3PDGA 3HG3A 4PS3A 5FCSH 3RZCB 2GY7B 4G59C 3U1PA 4EIGB 4Y9FA 4EDWL 3GB7B 3ESMA 1HFUA 4PLOB 2HWZL 4ZTOH 4XU3A 3X1FA 3CZKA 2GTJA 4J7FA 1BI0A 1C1EH 3FU3A 2D7NA 2XTJB 3HC2A 3NZUA 5F7NC 4Y5YC 1F4YH 3PAZA 2WLLB 5ACZB 3CCVA 3AZUA 5D1QE 1QKXA 3UX9B 5F9JB 4M5TA 5BMFL 3MUY1 2RACA 3C12A 3OHMB 3KWUA 1T5XB 1ONQB 2Y5TB 1QATA 4O5LH 4PJ7B 1NCDL 1UA7A 2O6FA 3HN8A 4G8EA 4YHKL 4YSRA 4NOFA 4A63A 5C8JA 4XAWL 3BKCL 3CJJA 3Q8AA 3ESUF 2ZUUA 1I1YA 3B83A 1CFQA 1JPST 5DZPA 3GRBA 3ULVL 3FOMB 1VOMA 4X6CA 5K9JL 3D07A 4LUDA 4LDCA 4M7KL 2K9UA 1QBLH 2AJVH 3N41B 4JRYE 1RPKA 4M9OA 5D2NB 1F1BB 1USZA 2FO4A 5HBBA 4NENA 4RA3A 2BMKA 3KYKL 3NTCH 4FG6C 4IKFA 3BE1H 4G8IA 3WFBL 3TS8A 1CFBA 3QNZA 4QVCA 1BYMA 1IILE 3MV7A 4RG8A 1YPZA 2AXJA 1NEPA 2J8UF 3W0WB 2R69L 4H8WH 1HINH 4JFQA 3U7WH 1KB9K 5DYOA 1JJUA 3D48R 4ESKA 2CRIA 1LE9B 1PKQB 1MCHA 1QLEB 2ED9A 3CCMQ 4WNQB 5E1IA 3MRDB 5DHVH 1AGDB 3V4UL 2PP8A 1U0QA 3HRPA 1LK2B 4U6XA 5EDXA 5GMKj 5FA4A 4EQ3A 2EYTB 4K7FA 4Z0XB 1ZT4A 4B60A 4EDWH 5C08B 2HWZH 4C59B 2NYKA 2HT2C 1G6RA 3C5JA 5SWSA 2Q76A 4QRAA 1ZDQA 2KQMA 1S9YB 4N8CL 3GSQB 5B1JC 5G2NA 3B37A 3DVFA 5BMFH 1H19A 4OMQA 1MCOL 1AQMA 2JJUA 4NB7A 3ALXA 5D7HA 5I6LA 2QG9B 4XU1A 2VSCA 1YCSB 3RL2B 5ESAA 4YHKH 1NCDH 4E7JA 4ZK8A 3M0SA 3O2VL 1QLEL 3TVTA 3M0TA 1CLOL 4HKXB 2E74C 2VR3A 4JHAL 5FYLD 5JIKA 4ETQA 5AB0A 2R2CA 4XAWH 3BKCH 1NGPL 4WY7L 1M30A 3HJEA 2LAAA 3FKUS 3ULVH 4QCIA 2XA8H 4OQTL 4AZ8B 5K69A 5K9JH 3ATFA 5AAWC 2YXFA 1PEWA 3DJTA 3VI4A 1YC8A 4M7KH 4AQOA 4B9IA 2KBGA 2J43A 1DQQA 2SEBA 4R97B 4TLTA 4ZW5A 4NQDA 2PVDB 5D1QB 4D8KA 2KT6A 1P6FA 5I16A 3KYKH 4LMQI 2AHIA 3SE9L 4C4UA 1OU8A 3WFBH 1HILB 4YDJB 1T0PB 2OP4H 4KJQC 4XMXA 3I55T 1YJDC 4JGMA 1I3VA 3VRIB 4FQXB 1L0XA 2R69H 2P5EE 5BUAA 5IXBA 1KIKA 1WD8A 3N1QC 3D2UB 5FU7C 2BS9A 3E2HC 2KGTA 4FM4B 1AC0A 3SKOB 4BACA 4E36A 1B34A 5BW7A 4JRYB 3ZW3A 4FT2A 1G7PA 3V4UH 4HCIA 2GJ6D 5IZ7A 2NUTA 3VACA 4HAFA 2LGNA 5GMKi 4PV1C 3T08A 1L6ZA 2J2ZB 4B9GA 2EJ1A 4N8CH 2DYBA 4GAJL 3EYVA 4LASL 5DRNA 3MRIB 3MUUA 4AJWA 2PXYC 4HISA 4OTXL 1VQ9A 3DSNB 3F7YA 5CP3A 4Y9GA 1MCOH 4P4KD 2YA1A 2XXGA 1ARKA 3QZWB 4EZMA 1EQWA 1S7VA 4XBPA 4TL5A 3O2VH 1WRFA 1QLEH 1CLOH 3I2CL 4JHAH 4U3SA 5LJYH 2UWEA 1EGJA 3MPCA 4UT6A 1WFWA 3L2MA 4JAMB 4OAWA 1NGPH 4WY7H 3QO0B 3H9ZA 1UQSB 1ZANL 1UD2A 3OG4B 2CGHA 3DHMA 2VXVL 4L9LA 4H2AA 3IB4A 1GBQA 4AV4A 2DEXX 3T0XA 4QTHB 1KYAA 1N19A 1UXSB 1BECA 3CFNA 2FSEB 3DJ9A 1W2BP 1A47A 3SE9H 2C06A 5LDUA 3BWUC 5KAQF 5FGRA 4ZUTA 4KI5D 3FN3A 2DBLL 3FO2A 3L9RB 3WHXB 1S72Q 1J18A 4LPCA 1VIFA 4RTUA 4X34A 5I1AA 1RZ7L 2DXTA 1UZ8B 3DTXA 1A21A 2IADA 2EUZA 3D50A 3KLKA 4LPWA 4XPGL 2IAAC 4C83B 1ETZA 2OMWB 3JWOL 5CSBA 3M53A 4ZYKA 3GJFK 1CGXA 4YDVA 1J86A 3C6SA 2AQ1A 3WIHL 2KE9A 3UTZA 4GAJH 4LASH 4J3BA 1EJFA 4OTXH 2P5EB 5HHPA 2K3XA 3QDRB 5JLZB 4WI7A 1AS7A 4I4WB 5I5MA 3I2CH 4H13C 2LTQB 2X1OA 4Q14A 1ZWIA 3E6HB 1IEHA 4OQ1A 5FOJA 3BGAA 4QVDA 1ZANH 3EDFA 3NRPA 2O61B 4NYLB 2G3MA 2VXVH 4YN3A 3RKYA 5EU6A 2A0LD 3WS3B 2W0PA 3MV8A 2XKSA 1YJWT 1JRIA 2ZP8A 1IEBA 3W38A 4I13B 1FNAA 5DD1L 1CD1A 5FW8A 1DJWA 3TONA 4LCIL 3CHPA 2DBLH 1A6VL 1NEBA 4DKEL 1XH2A 1L9RA 3RZCC 1WS7A 1QQJA 3OMCA 2VT0A 3E6FB 1RZ7H 4EF3A 2VMJA 3CFTA 5JXED 4KTYA 5KSVA 3QUKA 5LQBL 4XPGH 1AQ8A 3EH5B 2N59A 3FXIC 4CRPA 1AGFB 2BSCA 2BERA 2XTJC 3JWOH 4U7KA 4UDUB 3ZE0F 2CP7A 4JE4B 1XGTB 2LLGA 2G9HB 4IIZA 4WNSA 4DVBA 1QFWI 3BCFA 1GA2A 2CJSA 4Y5XA 1G7JA 4PR5A 3WIHH 5DC4B 5DI8A 4QRPA 1JPSH 5CCAA 5EU6D 4LKCA 3ZIYA 3B5HA 3GTTA 4P23D 3Q01A 4J6RH 1XR8B 2QSVA 4W6YB 4O4YL 2HEQA 5TDPB 4DP7X 3BMWA 5HYJD 1PLBA 2QMJA 1OSZA 4QVZA 4HK3N 3CSGA 4DEWA 4GB9A 4MD0A 1TZ8A 2DQDH 5GRYA 1CYWA 4GEIA 4NC1E 5I1IL 5LJ5e 1N5YL 4U3HA 3TFKC 1AD9B 3V0EA 3VH8G 4DW2L 2H7WA 5IF0B 5FO9B 4HSQA 1XCTB 2CBQA 2NR6A 5C0DB 4HA1A 4P9HL 1SXCA 4MA1B 4P2RA 1S9VB 1QZ1A 4L5GA 1X5FA 5EO9B 2Q2LA 2CCVA 3I3DA 5DD1H 5IVZB 5DGQA 4LCIH 1K6QL 4HSCX 1A6VH 3KYAA 1OD9A 3ROOB 2HPOA 3FU8A 3EW3B 1NKGA 2CALA 4LRIA 3C2SA 3NOIA 1Z1WA 4J39A 5CKHA 3DMMB 4OF0A 1NCTA 4TNVF 1MCFA 2F53E 3T6ZA 5BXFA 1ZSZB 1KPRA 3DVNB 5AW8B 5CGYC 3SPHA 4G43A 2EC9T 3TURA 1MXGA 3AW5A 2F7RA 3D39A 5AVVB 2DKGA 1I82A 3G7TA 2J88L 1OSPL 2HAZA 4FI8A 4WUUE 5GZND 5D7SL 1DVFB 2XWDA 2PNDA 5A7EA 1V3LA 2C9RA 3UTQA 4D8OA 3H9SE 4DZBA 4MJ5A 5C0RL 2RAMA 1ZEAL 3NZHL 5JZ7C 3Q8FA 4BSWA 4ZW6A 2BDNL 3B34A 3GJEB 5GSRA 3S36X 5A3IC 4HBCL 4Z7WA 3FQTA 1BBJB 5EC2B 1RJZA 3DLMA 1OW0A 2ICEA 4L1BA 4O4YH 4YHPB 2SEMA 1QA9A 3ILPB 4KO9A 3W11D 4ORGA 3WEXA 5D1QC 4WJ5B 2E47A 1FE8L 1LL1A 4AIOA 4QXTB 1AO7A 2IAMA 3R1GL 1AIFA 1RXLA 4IBYA 1SHMA 3G08A 5A40E 5I1IH 2DX1A 3FB6B 1N5YH 1TUCA 1OO2A 4DW2H 5D4JA 3LEXB 1BGXL 3G4SA 2RMOA 1D5MA 1ACXA 2H32B 5B8CB 4FQXC 4FJZA 4P9HH 5E4OA 1CI5A 1RABB 1J9SA 4QKXB 1P4LB 1OK8A 3GSWB 4UMGA 5CEYB 2VIRB 3X2QB 3QXEB 2A73B 1Q9OA 3AWGA 1K6QH 3SDXE 4MXQC 3I56A 1BQHB 5ENWB 2Q86B 4IYKA 2E7HA 3CN1A 1BQSA 2A36A 1MREL 4N8VG 1XF4A 4E9VA 2NTFB 4QGYA 3QO1A 2DQFA 3IJSA 1PG7L 1FYNA 3OX8B 4WW1A 1TUPA 2J88H 1OSPH 3KCWA 4XCNB 3RWGA 4U4IA 1LO3L 2EABA 3HBPA 4XNQA 4BDYA 5D7SH 3ULUD 4X6BB 5TTRA 5AW0B 5LJ5d 1IKFL 4F9LC 3CBKB 5C0RH 2DB8A 1ZEAH 3NZHH 2VSMB 3AQDA 3MROA 4WW2A 2BP3A 2BDNH 1UA3A 4HBCH 5CBEB 1AO7D 1IIKA 2CUIA 2IAMD 1QRKA 5DJCA 1EHKB 3KD4A 3H42H 2F53B 1NZ9A 4N4HA 4M6AA 3L3GA 2B1OA 3S0PA 1E30A 2FVNA 2OV0A 4L29B 1T7YA 1Y07A 5CQYA 4AYID 4PFPA 1KIRB 4FMKA 3S5LB 3HPJA 2DW5A 3U0PB 1A6WL 4WUUB 4FI6A 4PW3A 5J3BA 1FE8H 1U6AL 4JZ4A 3R1GH 2Z4TA 1S3KL 3H9SB 5C0EA 2L89A 1M3BA 1QWEA 4X0KB 3SCMB 1BGXH 4H8VA 3PFQA 4PJCF 3ZHKA 4DEXA 3B5TA 1KBWA 1S7QB 3MEAA 1JAEA 3IEAA 4JM2F 1BFTA 2WKLA 2OA9A 1WP6A 5BZDA 1JRHL 2HLAB 5IMKB 1F42A 3BZEB 4WK0B 1MREH 3QNFA 4JL1A 4Z7VA 3ME9A 4AK1A 2FIKB 1PG7H 2K6WA 1R47A 4WVRA 5HDOA 4HUXB 1E6HA 1CLZL 1ILSA 1T0JA 1LO3H 1H6UA 3LMJL 4HALA 5EC7A 5J1AA 1URZA 3GS0A 3HC0B 4YHOL 5T3XD 4R4ND 4TVSa 5E6IB 2DY2A 3SDXB 1A6ZB 3SBWC 3CC4Q 2VITB 2J8OA 5CEZE 2YOCA 4CW1B 2LTQC 2HT4C 3CHSA 4K5LA 4N8PA 3MGTB 2QI2A 5L6YL 5AKTA 4JRXD 4XNXL 1YYML 4BFOA 2NCEA 2C3VA 5DZ9A 1KLFA 5BQ7B 1HYSD 1RCYA 4UQDA 4WSKA 2FHBA 2ZCLL 2K3HA 2YGPA 3GTNA 2NPLX 3ELAT 3ZOAA 1A6WH 3NEEA 1YBYA 3BIAX 4PM1A 1QBBA 1U9KA 3AM8C 1U6AH 3K8MA 5IG7B 1NGZB 1X2KA 1S3KH 1EHXA 2BSED 3G6EQ 1JB0E 1CS6A 4LK4A 4PG2C 4R83A 3A0OA 1VQ8T 1VESA 4GO8A 5C2BL 3V95A 4D9QE 3QJSB 2CAKA 3IGAB 2OX7A 2OTJT 1R46A 5GGVL 2AV1A 1YIJQ 3QWOB 1JRHH 1SJEB 3LDBB 3N50A 2NLJA 2JJSC 3VO0A 1W16A 1VQ7T 5FWBA 2WTOA 3MUZ1 2X88A 4P9HC 1ZLWK 1HOCA 2DWXA 3D08A 1CLZH 3N2JA 3KPSE 3LMJH 5IMLA 4HJGB 1ICTA 1QACA 2OXGA 4LLWB 4YHOH 4AT6A 1FAKT 4LVNB 1WYJA 2QQBA 3IMRA 1N27A 3TO2B 4D0BA 1I8MB 1WISA 1NCIA 3FT3A 3QNXA 2JVVA 1MJUL 2N1TE 2BP5M 3QZNA 1BZQK 3RNQB 5L6YH 4XNXH 4PJJA 1UFUA 3HRZC 1YYMH 3GHPA 1ZHIA 1BM3H 3HE6D 4PGEB 1SF9A 4XO3A 2NRDA 2ZCLH 1SYSA 4QHMB 3VKIA 4QHLB 1J48A 1SOKA 5DMGD 3EHQA 3VW3L 2DRKA 2E7BA 3K4DA 1E6OL 4MA1C 4F57L 4ZMXA 1MMAA 4BGLA 2I5YL 3KPNB 3QG7L 2M0OA 3BXNA 5FA3A 2O4EA 3V0IA 1OT4A 2CUAA 2H2PD 5C2BH 3M17B 4TNVK 1UACL 1Z9OA 2MPVA 4P3DA 2RH2A 4C8QD 1E9OA 2E56A 2WQVA 4Z7UE 3CCUT 5GGVH 3FQNA 4K3EL 3C08L 1FFPA 4P2OC 1ZSZC 3IT8D 2LJ3A 3I6LD 3O4OC 4PG9A 2EDHA 1XZWA 2F7OA 3SE3A 1KCUH 1IC7L 2Y7NA 1QCNA 1V3MA 1AGCB 3WN5A 1J0HA 2BVQB 1JZ4A 3JVGC 4B41A 1DVFC 4E0RA 2VYRE 1XTLA 4IBUA 1RD6A 5K39A 2ATAA 4PV8B 5CZXC 2QPSA 4Y4FA 4HS8L 4GIPD 2D7TL 5KEZA 4EXPX 1U91A 1DLHB 4OGAC 5I66B 2CMRL 1DUYB 2CLVA 1J5IA 3RB5A 2VLJD 3FQWB 2XTSA 5T1MB 1MJUH 3P3SA 2EIBA 5JW3L 2WIIA 2GEEA 2NDFA 5EO0B 3OR6A 3N85L 3CD4A 4CNIB 2JI1A 2QEXT 4ALAC 2XC8A 2ZYHA 4H1LB 4CADA 2J8HA 1WJSA 3CN2A 3EIFA 4DBFA 1E7VA 1NCJA 4O02B 5B8CC 5CD3B 3PDDA 1KJ2A 1JERA 1TTAA 3KPSB 3VW3H 3TEYA 1E6OH 4F57H 3RKDC 1KG1A 2GSIB 4KDTA 3GMMB 2BS8A 2I5YH 5F2FA 1VQLQ 3QG7H 4M56A 3ZX1A 1PM3A 5DFWH 1FSKB 2ZG3A 1UACH 2FWUA 1UM4L 3A22A 4L3AA 1R19A 1NBQA 1TZIA 2EVIA 1XH3A 3C08H 2DMOA 3GMNB 3HC3L 4K3EH 4NC1C 5L2KD 3P0GB 1HE8A 2XXCB 3MU3A 3GTVA 1GAFL 4GBXA 2ZXQA 1DCEA 4JY4B 4KTDL 4Y4FD 1IC7H 1JPGA 1VQ4Q 3IU3B 2CRZA 2P5WA 4HFWB 4J4PA 1BG9A 3AWEA 1H3HA 3PU7A 4O02L 3OYJA 4P46A 5KBNC 2V8KA 1MG3C 4OMOA 2QHRL 3D2TA 3HG1E 3TO4A 3PE9A 2R0ZL 4Z7UB 3V7SA 4HS8H 2D7TH 2OMUA 4RFEA 4Z77B 2CMRH 4S11A 3UPCA 1ZT7A 1T2QL 5I21A 1V27A 3MRJB 5HKCA 5CJ8A 5E0FA 5B3JE 1SN2A 1I1AD 1C8PA 3GEWB 3OKKA 2DEQA 5JW3H 1J1OL 5K33A 3LZNA 3GKZA 3N85H 3W9DB 2M8XA 3PIQB 2EIZA 2VERA 2NZ9C 3GBNL 3QUZA 3CCHA 1T1XA 4IGBD 2AK4A 4TVPE 3SCMC 5L0QB 2DQTL 1KQ1A 2P0KA 4FQQB 4XU0A 2WANA 3RY6C 1E2ZA 2MHAA 5EG2A 4TSCL 4XVSL 4GBXD 3VFUA 3VXRA 3HZYA 4ANWA 1JE6A 4GSXA 4YDMA 4E9WA 4J4PD 2FQDA 4HUUB 1LTXA 1UM4H 5TH2B 4NQCD 3EJQA 2VJ0A 3IFOB 3QDJE 4LQFL 3HC3H 2JN0A 3CCVT 1E4WL 1D3CA 2BPBA 4BB7A 3M1BB 3DGDA 1EAQA 4MDJA 5LAXB 2A6IB 1GAFH 4KTDH 3T65A 3QCVL 3VG9B 2DKUA 5BOZG 2VO8A 3EFOA 3NIFE 3P77A 1EO8L 1MHHB 4CSPA 3AU1A 5FK9A 4JM0A 5EUOB 4YLCA 4AG1C 3O45A 3CLEL 3MA7B 4ZXBB 1T1ZB 2WNKA 3DKMA 3P11L 3KS0H 3I35A 5CWSA 4A6YL 4O5VA 2R0ZH 5IB3B 3KH4A 5HY9A 3ZLQC 2CREA 5KYYA 4M7AF 2NDGA 3AMKA 4CSZA 5C7XL 4PS8A 3QZWG 1LDSA 3O11B 1T2QH 3VFMB 3TBVA 2YC1B 5I8CA 1K4CA 3QPXH 3VWKD 5GS1A 1J1OH 4I77L 3RESA 3VXRD 3T2QA 2XACC 4AW7A 3WVDB 2L3RA 4DSYA 4EI6A 3U30B 4MA3B 2LJ0A 3GBNH 3GBDA 4FHBD 4J7IA 1FLRH 3HG1B 3WJJA 4HU2A 4U2YA 4FTVA 1H3WM 4MZTA 4LHUD 4ELMF 3ZZSA 3LWIA 2HXAA 3HSBA 2P8MB 4UINL 1MXDA 3CN4A 4ERSL 4OV6F 4TSCH 2OK0L 4XVSH 2WBXA 5DK2B 4M77E 1RSYA 2VDPB 3DRTB 4JEGB 3LDBC 1O0VA 2NT1A 2L8AA 3L4UA 3RFRA 1EXHA 2ZWYA 1HQRB 2GF7A 4LVOC 4OM1L 2FH8A 4PBVC 4LQFH 1HQ4A 2DIGA 1L6XA 2YMTA 1E4WH 5GRZA 2Z4QA 5DA0B 3OM3B 4W70A 3QEUB 5KJ4A 3TBTB 3QCVH 5D1ZD 2AJ3B 5HI3D 1EO8H 4HUWA 5E95B 1MH5A 1AY1L 5I19L 4LLQB 3QUXB 4TLUA 3AG1B 1MUZA 2MCNA 2YLHA 3CLEH 3O3AB 4LVNC 3RIAK 3P11H 4QXUH 5F7UA 5JW4N 4B6ZA 2VDPL 2QR0B 4A6YH 3BQUD 2FWOA 2E4FA 3R7QA 3TV8A 2QT6A 4JG0L 3DJZA 3QDJB 3RPIA 4F9PC 4KK9C 3RGVB 3ARPA 5EEXA 4Y4HA 1W6LA 2VLME 5C7XH 3QHSA 3O9WB 5AFAA 4DA4A 3ZT6A 3AREB 1LWJA 4MMZA 1P7QD 3NIFB 2R39A 2XVBA 3W57A 3AT0A 3QXWA 3US0A 5T1LD 4I77H 2G3RA 2J57A 4LNRB 5C86A 1IJ9A 5L4MA 3F12A 4K94C 4PJXF 3SKJL 1N59A 3QDME 3VFWB 5SWQA 2AS5M 3CSFA 4XBGA 4UINH 4EDXA 5CKEA 2X3BA 4ERSH 5AOIA 3VNYA 2OK0H 1PJ9A 4JZ3A 4I1NB 1R5IB 1WC7B 3Q2CA 1ZLUK 3U1SL 5EOTB 4E7HA 2V9TA 5F44A 4KULA 2NY6D 3PLYA 4KK5C 4L0YA 2ATPA 3OYYA 2YEQA 4OM1H 1EDQA 4CI0C 3ULVF 1QMCA 1UOKA 4QW2A 2R1WB 1N2RA 2ATKA 1B7TA 2IDQA 2EXYC 3PL6B 3V8OA 2Y7QA 4MTMA 4ZNEE 4PJEA 3FUDA 4XAKE 4ZFZA 1D7CA 5DZNA 3NCYP 1JK9B 4L05A 1AY1H 3HTLX 5I19H 4CC1A 4PJAA 4PRAA 4M77B 3CEYA 2WQXA 3TVMB 2HTKC 4TSBL 4YSUA 4E9TA 5GMKh 3OZ9L 3RWIB 3RTQC 2VDPH 4FYRA 1TEYA 2EE6A 5ICZA 4KNTA 3BH9B 4NNYA 1G87A 2WKOF 1R8OB 2IDTA 2GTQA 4JG0H 4AYFA 1W0YT 3MLYL 4S0SD 1PYWB 4JLIA 5GANd 2X89D 5EEVA 3PWPA 1ACZA 4MZ3A 3QJHA 4HUKB 3OG6B 3QFJD 4Y2DA 1VJSA 3S3BB 3L8QA 5TDNB 4GRLD 4M7DA 4R55A 3EFFB 5T1KA 4N2AA 1FC1A 2JXBA 2B16A 3SKJH 4LOEA 5CMAB 1JJ2S 1QLRB 3CQQA 2OCCB 2NZIA 1FSKC 2X42A 5CP7B 1PEZA 1ETB1 5E8EB 4PTUA 2M2DA 3OS2A 4M3KB 4Y5VB 4QAMB 3U1SH 3A23A 4FNSA 1RZGA 3VU3C 5HHME 2WQRA 1E5BA 2CUBA 1ZTXE 3ARRA 1KY6A 3FH7A 2E41A 1S5HA 1YI2Q 4A4EA 2H3EB 4RDQF 5EIVA 2YFOA 2FVUA 4Y4KB 1AIZA 3QDMB 3DROB 2EEBA 1QFWM 5ALCL 2ZKYA 3HHRB 3ET9F 3S34L 1QHQA 2FO0A 3R06B 4AC4A 3PWPD 1ZHLA 3IKCA 4Z7AA 1N4XL 2Q3ZA 2NYYD 4TSBH 3WTVA 3OZ9H 4OMLA 2WAHA 2XYBA 3GF8A 4C4BA 5LLIC 4G6FD 4LLUB 3DOHA 3N40F 4DP1X 4EZJA 4M7DD 3MO1B 2X2YA 5KCOA 3NCJL 3MLYH 4PRIA 2MCMA 1PTZA 1WAAF 5IEHA 2Y4SA 4XP5L 3KLHD 1EAPA 1PSKL 3D3VD 2HLEB 4XK8E 1FGNL 2Y6TE 5L0QC 1ZTMA 2H26B 5DJYB 5C09A 1PZBA 5FLXE 1TVBA 2R2BA 2R7EB 3M0PA 4PJFE 3GSUA 5F6HJ 3KPOB 1U8OB 4NZFA 5GGSB 2V3FA 4LT7A 2O2OA 1GBRA 1S7WB 3OBAA 3PIPA 1RU9L 4AV5A 1VQMQ 2Y23A 5DO8A 4FG4A 3OSVA 1OX8A 1YJ9A 4GLRI 2AZAA 5BV7L 3L3JA 3PWNB 1YAIA 3US9A 5EN2B 3VG9C 4OGEA 1J10A 1BQHG 3D7PA 4UU9A 4EIUA 2PWDA 2RK2A 1WHHA 1PNDA 3GOXA 1FDLL 2FLRT 3KBGA 4X8JA 3J7AF 4UQIM 2H6PA 5IFAL 1GL5A 5B21A 3JUYA 5IOPB 3G6DH 1V7ML 5IGXL 3B2UC 4ICWA 4OI8A 1T4WA 1PZ5B 5ALCH 3LEVL 3C4SA 4LOFA 4FADA 3V6ZA 5E1AB 5CLXA 4N6RA 3S34H 4G42A 1VYUA 2EUXA 4XAXB 1N4XH 2GB2A 1GS6X 5HHMB 2JJTA 5AUMB 5L8RE 1WCBA 4QQGA 2CKBA 5GMKe 2E6PA 3NCJH 5BZWA 1CICA 1Q86C 1HL9A 1JPFB 4BE0A 2DEWX 4N0FA 4XP5H 3UGEA 3HUJE 1ED3A 2EDFA 1IM9D 1L6PA 4NERA 3U30C 4QJ4B 2O6PA 1PSKH 3DHPA 1MAKA 2DL8A 3S5LG 2Y24A 1FGNH 5DJZB 3KXFE 3G04B 3H2QA 3KGUA 1QW1A 1ZA1B 3T8XB 2HCZX 1QI4A 4ANKA 4AQ1B 6PCYA 2J55A 3F7PC 2NY2D 3G6EA 5GGTA 4HULB 1TQSA 1RU9H 1V76A 4X4MA 1KGCD 2X4UA 5TF0A 4BWTA 4E9RA 5C6WH 4BINA 1AYRA 4WO4A 3CD6Q 3PS6A 3NGPA 4GKSB 4KT0E 1MUJB 4P57B 3L48A 4YTLA 1BAGA 5F7DA 3REWA 4F2ME 5BV7H 2KBTA 1TJMA 4XMPL 2Y36L 5K1VA 3TN0A 5AVZB 3WFEL 2CCWA 2YLKA 1T2XA 4PJFB 1YHQQ 1FDLH 3P4MB 4WI5A 4Z95L 3UABA 3WL9A 5IFAH 2JWYA 3QUXC 4BE1A 1V7MH 3C5ZC 3EZ8A 6PAZA 1ZLVH 4KV5F 5IGXH 3AHUA 4JRIA 1KC8U 4K7PL 3LEVH 3UTTE 5KBDA 3MX0B 3RVTC 1FLTX 3O0RL 4PGCB 1QCOA 2YBRA 4FYWB 5GSVA 2Q6WB 3RGVC 4JFPA 4P5RA 2YPLA 4HVBA 1U2HA 3O9WC 5D7UA 5M9OA 3ZRFC 3EOBA 1KQSS 3AREC 1JIBA 2OPCA 1P1VA 1A7QL 3NEOA 4XMZA 3S5YA 3BEWB 1FVEA 2ED7A 3MUGB 4L8BB 4OGQC 4HOWA 5CQXA 4X9HA 1I8FA 4K15A 4ZUSB 1F2XK 2BJML 4I2XA 4WO4D 4AYDC 1MN4A 2ZUTA 2HFGL 5IQ9B 1ZMYA 3FONA 3IMTA 3WTXA 3I56T 2RO0A 3IFPB 3KDPB 1H9VA 1KBBA 2NY7L 5IMMA 3WIFB 2IPOB 4BZ2L 1XGYL 1ZX6A 2TSAA 4OIFA 3WFDL 4JVPA 5J06A 2BSRA 2Z93A 1MI5E 4Y9CA 5ICXB 3S8GB 4HCRA 3HBGA 4F20A 5CJOL 1BVKA 1P1ZB 1L7IL 3BDYL 3BWSA 3HUJB 1NDGB 2G2PA 3ECQA 1TFHA 1XWVA 2IF7A 4XMPH 4Y5YA 2Y36H 2VWEE 3KXFB 3WFEH 4J1UB 3PREA 4GS7B 1EHNA 1RZ8A 2YPLD 4G9DB 4Z95H 1G5GA 2NXZD 1E42A 2GFBB 3WNKA 3CXCS 3PUUA 3RWCB 5CKDA 5D6DC 1QVFP 1CZ8L 4NCC2 4K7PH 1QO3B 4IS6B 3BY7A 1VYTA 2ZYIA 3W5NA 4FNQA 3O0RH 1FL5B 2EQJA 1UT2A 2XT1B 4F2MB 5ADPL 1KCRL 3SPVB 4RMQA 5F88A 1A7QH 3JVFC 1FN4A 2X9ZA 1J05B 3CMET 2B9AA 3L16A 3MNZA 4U1KA 1HT6A 5AAMA 1RADB 2QJDA 2A9BA 3WIAA 4F17A 6AT1B 4UYQA 3UTTB 2BJMH 3ASOB 5CZRA 5KZCB 3QH3B 4PJBF 3ZKQD 2HFGH 5TJWK 3S3JA 4NX0A 2RGSA 3M88A 3X3GL 4PL6A 2FEEI 2UZPA 2NY7H 4Y5VC 3OLGA 1XGYH 2CS7A 1K2DA 2WXGA 4ZJ9A 3ZU8A 3LRSA 1VQOQ 5KG9A 5FFGA 1UGRB 8CGTA 3CE1A 1X9LA 3CHXA 3BUYB 1N6VA 5CJOH 5IV2B 1C12A 2DILA 1MJ8L 1L7IH 3BDYH 1N8RR 2FHCA 2AITA 3E0GA 2DJ4A 3G1JA 5JPNA 1ND0B 3SY6A 2Y90A 1SUHA 2W38A 3H7LA 5GHWL 1XGRB 5GAMd 4AQ8C 2V9QA 1E27B 1FL6B 1VQ4A 1UD4A 5DYFA 4C0FA 1R24B 1Z0MA 2HKHL 4AJYV 3NCMA 4QKTA 2PW1B 1DQDL 1N64L 4XZUA 3VRLE 1CZ8H 1OGAE 1MI5B 2GSGA 2KLRA 3SZ6A 3VCLA 5GGVY 1UUSA 4FG6D 2X0WA 1M1FA 1T1YA 1WA0X 5DEFB 4JZJB 3VTMA 4ZOCA 2J5WA 1AZRA 2EIEA 3FHEA 4S1SH 5AW1B 1JZ3A 5A2BA 5AAWA 5ADPH 4KJYA 1KCRH 1N3NA 1AXSB 2HN7A 4AK2A 3ZYIA 3FZUC 1EIFA 3QIWB 4BXVA 3L1FA 1UUNA 1ACMB 2F19L 5GGQL 2A6JA 4DCQB 3K6SA 2YA0A 4H1LG 5A0DA 1OZ2A 4M7JL 3UIYA 5JA9A 1OB1B 4GY4A 2EUVA 3ZYOA 5EIIA 3X3GH 5AYUL 1MW3A 1M7IB 2HT2D 1R5VA 3OTTA 4F27A 4Q6YA 1BX2A 1CE1L 5A6IA 1TQUA 1UD3A 2IMMA 1HVXA 1A6TB 2NX5E 1IJNA 3DX1A 2K2VA 2NUPA 3U2SB 1E4XI 1SVCP 4BM7A 3IVKB 3BP4B 4R7LA 3H0TA 1MJ8H 3G5YB 4M7AE 1DN2A 2IOMA 2FEIA 4U6YA 4Q5WA 2X9XA 1OANA 1UZ6E 4P0DA 4JJOA 5JW4M 3KNBB 1SJVA 4ONFL 2FE0A 1HC1A 3TWYA 2KXDA 1MEXL 2W10A 3I5SA 2BNRA 2HKHH 1A8JH 1DQDH 1K3ZA 1N64H 3FFOA 2WINB 2O1AA 2VWFA 1EZVY 1TJIH 1O6SA 3PDOA 2QTEA 4K07A 1MHEA 4XOAA 3L4ZA 3B8YA 4KJQD 3UEZA 2WCSA 4JRKA 3BPNB 4YL9A 3MV9A 3HZMA 3NJGA 4KTEL 5E8NB 4CGTA 1WA1X 1LO4L 4L0ZA 3R4DA 2EP6A 2R56L 3LQZA 1XF3B 3LW5E 5I23A 2K9GA 3N1GC 4WFEE 1L5GA 1FZJA 3T77A 4MDWA 4JQIA 1Y1DA 4ZUUA 5T5NF 3VXPA 4AQ1C 2YGVA 1WI7A 5GANg 1OGAB 4EMKB 2EIDA 2EXWC 2LRQA 4M7JH 2H3NA 4TTGA 3FT1A 3CCMT 4A54A 5AYUH 1E4KC 5KSBF 1NPNA 1M5Q1 1CE1H 1UD5A 5LHDA 5HDBE 1FFNA 2PXYD 4Z78B 3H56A 4ODWA 5IB4B 3DOSA 1RQ5A 1KIQA 4GSRA 1R3HB 4Z9KB 5DHMC 3FMGH 5EBWA 4JUVA 1SVZA 5DEGA 3HVDA 3BO8A 4GUPB 4A7GF 2KR3A 4LAJH 2V9RA 3V6OA 5JORA 3CSTA 1BD2A 4DN3L 2VC8A 3AADB 3OR7B 4ONFH 1Y18A 4LGPB 2Z31A 1TYEB 1MEXH 2TRHA 1GYVA 1XH1A 3JCMW 3DXAA 2NCMA 3WKNA 1E5AA 2NX5B 2O6DA 3RKPA 4GAYA 3VE0A 1CUOA 3REAB 2RHZA 1VQNQ 1SLUA 2P4RA 1ZT1B 4GW4A 4PJXE 1G3TA 4ZFFA 1OCOB 5HK0A 2J06A 4JFFA 4UT7L 4OGCA 2A4ZA 4MNQE 4KTEH 3SDCA 2E5KA 1UOWA 4H2CA 2GAZA 3QYMA 1LO4H 2JOYA 2R56H 1OQXA 4UMSA 3HPLB 5BS0E 1OGSA 3DO7B 2K5IA 2FJGA 2CR3A 2HFFB 2QVTA 3NJKA 4YEEA 2UYLB 2ZPIB 3NZSA 3PXJA 2O93L 1EUUA 1UHVA 3L3HB 4PBXA 1K73U 2QSQA 1UHFA 4G9FD 5E56A 3FRPA 4P2YA 5I8EA 2LHAA 1FZKB 2WZ6A 4OLEA 4RRPG 1SMOA 3BUIA 4CVXA 5CIPB 4BWWA 4GS7C 3O5ZA 1XGZA 1T80A 2COWA 3MP1A 1KZYA 2IDFA 3DVGA 1UENA 3LXAA 3V79C 1TDQA 3IJEB 3GSXA 3RP1A 4L5FE 2IQAB 1PVHA 2XNAB 4DN3H 2APBA 3ECWA 4L3EE 2L7UA 1SJMA 3M0QA 4M75E 4L3FA 4EPSA 4ZX3A 1V8HA 4FMVA 5HDBB 1SDYA 2YOAA 3INZA 3S3OA 3E9TA 1RULL 1WBZB 1OD7A 3EYOA 2DQMA 2OAAA 1HCYA 1R4XA 3QWRA 4GW5B 4JS4A 4U6HA 5C0CE 3MRBB 2ZUQB 5TE6L 4JFED 4HKZA 4OFQA 4UT7H 3CC2Q 3GSVA 1WIOA 2PABA 1RIHL 1YEFL 3R8BB 1M1KR 1D0YA 3RZCD 4E47A 1T0MB 3HR5A 2R2EB 4HHAB 3I9IA 3EADA 3I3EA 4I8DA 4YR6A 1BVNP 1V5JA 3ZL4L 3Q3GA 5E9NA 4AVJA 1S72T 2XTJD 3ROLB 4YO0B 4PJXB 4M9PA 1YNTA 2NY0B 4KGLA 1TNMA 4QT5A 4W9KC 2P7TA 1MV3A 4MNQB 3WOVA 1KWGA 1IZJA 4RMBA 4LO9A 4NAQA 1UG9A 2LNVA 4XVUC 4PW4A 4W9GC 5ID1B 5BS0B 3ZZQA 1E0OB 2IBZX 4X4XA 4GO9A 4LDYA 1NPUA 3X1EA 2PCPB 3QWRD 1MJJA 4OCLC 5D96B 3ULSB 4A7QA 1YQ2A 1ASPA 2EE3A 4AIXA 4IMLB 1MVUA 4PJ8A 1C16B 4C0ZA 4JZJC 1TTFA 1S9WA 1ABQA 3TFKD 3MRMA 2V2XA 4V1DA 4M77G 1F6AA 2A08A 3VXTA 4ANJA 1YEDA 3W0WD 1CIUA 5GAN2 1K5NB 2VWEC 4I9WD 2C9VA 1QFOA 1KGYE 2D1XA 5CIPH 2FX7L 3OYAA 3QIWC 2YS4A 3QIIA 3J81E 3KJ6H 4JFHD 3CX5J 5TE6H 3ZDZF 2VSKB 1RIHH 1YEFH 1WWBX 1NBZA 4MDIA 4OFVA 4OZ4A 5A2AA 4MJ6B 4BQBA 1F11B 4Z7NE 3GINA 2JTYA 4L3EB 5C08D 1FQ9C 1ZK9A 3FUEA 4M75B 3L4WA 4KX8A 4NBYB 5CGYD 4YNYA 3ZL4H 3GXIA 2YEZB 3PHOA 3JV4A 2ZCFB 3IJYA 5I8KH 1MSPA 3GSNA 3UMNA 2Y1VA 4R7NB 4WV1B 1WUZA 3OKDB 1TNNA 5C0CB 3QEHB 4BFBD 4DT2A 4HOXA 2FEJA 2Z7UA 4OFKA 3TXAA 2HVKB 3M7OA 1WHKA 2CHZA 5CO1A 5DJDB 5JZ7D 3APMA 4RSYA 3WFHB 2CH4W 2B1HL 2JFCA 1T20A 5E70A 1M1GA 5A3ID 5DUBA 1NQBA 2VC2B 3KPQB 3L95A 3MC0A 2M1HA 5EBLA 2XWJB 2GJRA 1AZEA 4X8GA 1HK9A 1LP9F 3PV6A 3LH2L 1IVTA 2F6AA 3QPKA 4DUXA 1DJIA 1F0LA 3ISRA 5D1QD 1AE6L 5ID0A 1ACCA 2JKNA 3I02A 3QQDA 3KWXA 4EKXA 4MB5A 4X7DC 4CBZA 2WLMA 1M90R 5IQ7L 1FNGA 2CHXA 4FQXD 5CKGA 4NUGL 4YVUA 2B39A 5HHNB 3GEFA 2CDEA 1RJCA 2R1XA 3N42F 3SDDA 3TBBA 3D2UD 2FX7H 2JS2A 1S2EA 2LCSA 2QQLL 2MCG1 3L4CA 2KRSA 2UZXA 4MXQD 4F7MA 5KBPA 3II1A 4EMKC 3ZE2E 2EQKA 4F58L 1IO4C 5J56B 3MKGA 1IV8A 3W39B 4KVPA 4HHWA 5EPMA 2Z65C 2Z9TA 3IPBA 4Y1SA 4NWUL 3V0WL 2IPKA 3ISWA 4KV5E 4N6QA 4XODA 5FM4A 4BH8B 2OL3A 1J12A 1EFXA 2VDOL 3VM5A 4HZLB 1I1RA 3LS5L 5F72S 4N5UA 4ISVA 1GCFA 2A28A 3EBAA 4JANB 4FW2A 3I6SA 3HNVL 3CTTA 3ZKSD 2DLIA 4F7EA 1NBCA 1IL1A 2B1HH 4M5ZH 2CJ3A 2DYPA 1JVOA 1PFOA 4B9CA 2F58L 1TENA 2O4XA 5D8JL 3S2CA 4Z7NB 1LGVA 5DMIL 4EN3B 3LH2H 4BA8A 1T04B 1P2CB 3D1MC 4AG2C 2E5EA 1G7HB 3BEVB 3EYQC 3JT0A 1NC2B 2CP3A 1AE6H 2Y3AA 4KX7A 1VACA 2I07B 4ZTEA 1AACA 3VFOA 3FOLA 4NIYE 5GAMg 1E3XA 3O3EB 2V4LA 1R77A 2XG4B 1NIDA 4M7AC 4Q9RL 4WWKB 4FQCL 1F86A 1SPKA 2V3DA 3HLAA 1U30A 3L08A 2XX0A 5IQ7H 3BZDA 4PJGE 2ZXBA 5JHDE 4NUGH 5H94A 2B4CC 3VS4A 5GIRB 3MA9L 5JYLA 4U49A 3OYLA 1AGEA 4MB4A 1H5BA 2J72A 2QQLH 4ZW8A 4ZMTA 1EEZA 3L7EA 2EW3A 3GIVA 5AALA 5C71A 1CT8A 4I0PA 4LDVA 1AWJA 2FYKA 3M54A 1J8SA 2IXQB 2BIOA 3ZQ9A 3CH1B 4R9HA 2YHGA 4F58H 4Z3IA 1LLAA 3SYCA 4XC3L 3CHRA 3L2NA 1KBKA 4OFYA 5J26A 1ZVHA 2L5QA 1IQDA 4J8RA 1ETA1 3IN2A 5IJDC 3OZLA 4NWUH 1I9IL 3V0WH 2P5ED 5LAPA 2VDOH 3BVDB 3LS5H 2VQ1B 5GS2D 5JTWA 5FUOL 2VGLM 2VN5A 1W72A 4WDIB 3JB9I 3NPSB 4FXGC 3HNVH 3A8OB 3NSDA 1A25A 1T6VN 2HT4D 3VV0A 1B0GB 3ZE2B 2X6BA 4ZOBA 5D8JH 4NO2A 5DMIH 2CGZA 3KBPA 2AJXL 4B97A 1G2BA 4YSAA 3NTHA 1U4EA 5BZXA 3L45A 4JHUA 2Z34A 4XNZB 1IRAY 1MHPL 4WKZB 2FO8A 2PP9A 4JPQA 4PJBE 1KEGL 1A7OL 3FQXB 3HRZA 2OI3A 1VQPQ 4Q9RH 4JQVC 4P5KB 5KYXA 2ZZDA 4FQCH 1E90A 1Y7VA 2YD4A 2AQNA 3GLZA 4R0LA 3BI9X 4L3CB 1GGCL 2K78A 3ABZA 3LRMA 2AERT 2E6QA 3TCLB 3FSWA 3I84A 3CFBA 5IT9E 1UB5B 5GGSY 4OFDA 3R7RA 1WHLA 1UWYA 3ARBB 1YJ9T 1DDTA 1UOVA 3GLEA 1WZMA 2NY0C 4DOWA 1AWXA 4XC3H 3VS6A 2EDNA 4P2OA 4Y2LA 5C6PB 3RWEA 4GKNB 4PJGB 5JHDB 1I9IH 3WO4B 3QPQC 1A8ZA 1Q7YR 3CUPB 4KMLB 4BJLA 5F9OL 5JHBA 5FUOH 1JF1A 5ITBL 3T3MF 3W3BA 1ZBXA 3JVGA 5CNHA 3TNNB 2HRPL 2LT9A 3BZFB 3T1FA 2EYQA 3C0CA 1UD6A 5E6ZA 5D96C 3L5WA 4PY7A 3E80A 3LV3B 2FQFA 4HCZA 1IAKA 2AJXH 2WLYA 4YSEA 3WY4A 2WSFE 3CC4T 2FX9L 1IB5A 1JV2A 4ES8A 1JWMB 2AQ2A 3L42A 3ER0A 3QFDB 1MHPH 3POHA 5LB1A 3APDA 1KEGH 5CN1A 4PJHA 4PGDA 2BIIA 1PZ2A 3GSOA 4X5XA 1Y6KR 1BXVA 3LKRA 1K76A 4TQHA 2Z35A 1FFOA 4QR7A 2QPUA 1WG3A 1XL4A 2OTWA 2WUCH 2DD4A 1GGCH 4P2OD 4YJZL 5J6GA 1QAWA 3G6ET 2ADGA 4M75C 1VSCA 1Q9LA 3VUBA 3BFQG 3ASWA 4K7PY 4BKTC 1U8JA 4IBVA 1QFWL 4J9BA 3QJXA 1E3ZA 5C7ZA 4DTGL 3P4LA 3OBYA 2DWDB 4PJDE 4JHWL 4PJBB 2BHFA 1DVFD 5K9QI 1EANA 5GS0C 2AV7A 1QPKA 4QYOA 2Q7AA 1VLXA 1U8CB 1KOAA 2FR4A 2X6VA 4WEBL 5CZXD 2B3RA 1N7ML 1YPZF 2W8CA 1SY6A 4MMXB 4WK2B 1ZJBA 2BE9B 1I9EA 5F9OH 4W9HC 3T71A 4OGAD 1VFAB 2HKAA 4NO5B 5ITBH 1EAOA 1HHIB 2HRPH 3FL7A 2G3XA 4OZIF 1RACB 2WTRB 5JW4R 4LXCA 1AEYA 2XWRA 5D6WA 3EGSA 1D3BA 3GDCA 3LNGA 4QO1B 5B38B 3GLAA 3O3BB 5EF1A 2MTPA 3H3PH 4PP2B 2FX9H 2YUNA 3LIZL 3QCTL 4X5WA 1FWXA 4ZDHA 5HGHA 4PJ9B 5JOFA 5DGRA 5LN8A 2GCYA 5FGSA 4X7FC 5E5MB 1XTMA 3OXSA 3VXSA 1E2VA 2F54A 3CDZB 4ADGA 4QRRA 3RKDD 2MNUA 4H5SA 3BP7B 1CQKA 1T21B 2FL5B 3BWAB 2ORBL 3NN8A 3WXVL 4U0RB 1H0DA 4KHTL 2BVTA 4TUOA 5I6OA 3VI3E 1Q9WB 1LEKA 2J20A 2Z0UA 5F7YC 1AQKL 2OW6A 1NKOA 1TLMA 1GZHC 3OKOA 1QVOA 1PY0A 1YJNA 5C07A 3QR0A 3VGHA 5K9KB 4DQ2A 4O9HL 1E7OA 2J7IA 3ZJAA 3S97C 3THML 1ZRUA 4HK3J 1QFWH 4OZFA 4DTGH 4Y2OA 4Z18A 3RX7A 1BIAA 4JHWH 1W2BS 2ZWZA 1WD9A 2CXGA 3QYNA 1MFAL 3VFPB 2WCPA 3UEQA 3WBDA 2ZPBB 1UKSA 2L3BA 5AD0B 2YZ8A 1IBZA 4WEBH 3N06B 4HJTA 4Y19A 4KQ4L 2F53D 1G0DA 4EN3C 3VGDA 1JWSB 4XB7A 2WJ7A 4JGNA 2BO0A 2YMOA 5SX5H 1AOZA 2CO2A 1B3QA 3BUBA 2EVHA 2F54D 3S8FB 3PQYE 4WUUD 4FKEA 4PJDB 5CEXA 5PAZA 3M56A 5DM7R 2XETA 1PC0A 2DXBA 3U4BL 3DUSA 4Q6KA 2NZ9D 1RJYB 1SNRA 1ZY9A 2APXA 3LIZH 3QCTH 1U8MB 4WWKC 3D09A 4MAYA 4RA0C 2XG8D 3SCMD 4GAFB 3OMIB 2UVFA 1J0YA 4PRPE 3DX6B 4LPXA 5C07D 3U0TB 2VMCA 3H8ZA 4XP1L 4ZUVB 1A1MA 3KHQA 1SXNA 4IKIA 2ORBH 3T9WA 3WXVH 2E7LC 2BIPA 4KHTH 2ADIB 3ECBB 3FB7A 4ZMZA 1AQKH 1YEGL 5HJBA 2RD1A 1VQLT 3QZ5B 1A1NB 5EUKB 2QSCL 4O9HH 4QT7A 3THMH 1EV2E 2JW4A 1JGIA 2L7EA 4X6DA 4H25A 2NSMA 2XG5B 3U9WA 1HXDA 1XJWB 1D9KA 1HXMA 3DRQB 1MFAH 3OQRA 2NNCA 4LDXA 2PKDA 2Y2TA 1NAMH 4HIJA 5DQ9B 2COYA 1UYWL 3NPSC 5IBUB 5JDJA 2J1KA 1E3FA 1VQ4T 1HAWA 4MX7B 3VI3B 1JWUB 2CKKA 2COVD 2KPWA 4KQ4H 2UX7A 3GQFA 4WGVB 5D5MF 4QRSA 3ATEA 3NRFA 4C0GA 4L18A 1N18A 4AE1A 3NPFA 2DYRB 3LXUX 5DY9A 3GLXA 2FPDA 1KZQA 1ORQB 3U7YL 3MLXL 1JPEA 3BLPX 3QIBA 3GJFA 2I85A 4XNZC 5C3TA 4C92A 4HX1A 2QZQA 3DB4A 5MEQB 5J39A 3QA3B 4UM9B 4FA6A 2PR4L 4P2QA 3U4BH 1UE9A 3U36A 3VVVA 4OZGE 4FSXA 2LE9A 3QDGE 1HDMA 5INCA 2NWMA 3OPZL 4Y1AA 4JPSA 4RLDA 2HQXA 1BYPA 1Q1JL 3DHJA 4C5GA 2GBTA 2CP5A 3FT2B 4RNRB 3VTTA 4CBPA 4HAGA 2GITA 4XP1H 5I0XA 1CBVL 4KZEL 4Q9BA 5D4QA 3V6FB 4FZEL 3OF6A 4Z3EA 1COBA 2K7QA 2TRYA 4NHCL 3PQYB 3ARBC 1Z0NA 3ESOA 4LSTL 4EI5A 5D7IF 1LMKA 1KHCA 4M78E 2YAEA 4JFUA 1YEGH 1LO5B 1NJIU 3B9KC 1HYOA 1BYOA 2RD0A 3TA3B 2QSCH 3LZPA 3TPUB 1Q94B 1N8ZA 2QL1A 4PRPB 1CYGA 3WO4C 1GMEA 2AVGA 2L04A 3ZTJH 2P48B 5LWYL 3ARZA 5GRJL 3OYNA 1JFQH 1PX4A 5CGBA 5A2QE 4A2EA 4JREB 2DIEA 4N2KA 1UYWH 3NH7L 4JS7A 2WCGA 1PZSA 3Q2WA 1NCCL 4P2QD 1OULA 2DL3A 4KK9D 1HKFA 3VFTB 4BRVA 2OI9B 1IHWA 2A0FB 1P4BL 3GD1C 2QGGA 1JGDB 3ZDZE 1PKTA 2JB6B 3HCVB 1GXIE 3U7YH 3WIIH 1Y71A 3MLXH 4PRHD 5E8PB 1MCWW 3RTQA 3BGMA 4IOFC 3GBML 2EDWA 4POUB 4W81A 5FXCH 4ANXA 2QVFB 5CJBA 3TH3T 3B2DC 4Q6IA 2FYYB 1EXUB 4MA7L 5EZLA 5CEZD 3BVVA 3X20B 1U58A 3FTVA 1Q1JH 1IAII 3SD2A 3X17A 2OAUA 2E9WA 1I7RA 3OYKA 3KLAA 4Z3JA 1CBVH 4KZEH 1FP5A 2IDSA 4XU2A 4FZEH 5E9DA 2VRAA 4KK5D 3WO3B 3N43B 1ID5I 5LJ3e 4NHCH 4MAUL 3I75A 4LSTH 5I18L 2DIJA 2J8UA 3LN4B 4XMUA 4JO4L 4KKAC 4OZGB 2LQWA 1QI3A 3QDGB 2EXYD 4KH0B 5CJ5A 3PJSB 5ICYB 2AMGA 4D9QD 3GI8H 3QQ3B 3QHFL 4YIQB 4MMXC 5LWYH 1YEJL 1NJ9B 3K2IA 4BUGA 3DETC 3QWNA 4G8GE 4ILDA 4YBLB 2HTKD 5F3HB 1BVZA 1U4FA 2JCCE 2JK5A 3RTQD 4KRTA 3NH7H 4HIIB 1ET8A 2NY3C 1RUAL 4KDWA 4ZFOL 3GBQA 4NQSA 2O31A 3BRFA 3BP5B 3E8UL 3C60B 4M78B 1NCCH 3B6SA 3MFFA 3S3NA 2JJWA 3O4LA 1HSQA 1ZVNA 4FTDA 3FULA 3VRJA 4AKOA 1P4BH 3OD3A 1WZAA 5HPMB 5FKAB 3ZTNL 4YAQA 1KC8R 4L4JA 1U95B 4PJ9C 3RDTA 1D5XA 3GBMH 4HQQL 1Y0LB 1CFNB 3FW6A 4I1RA 5E99L 2GFAA 3HPWA 1TKWA 1YDPA 4MA7H 4XCEB 3P30L 1TO5A 4ELKA 2YPKB 1M90C 4U0RC 3HEIB 4JVWA 4KX9A 1GW6A 3OKMA 4M29A 4RWHA 4U1HB 4Z7OF 1ZA6B 1W0VB 3GLDA 3C09B 2X70B 5TK4A 1ZLVK 3ZDZB 1J1PL 2W07A 3VFRB 1QTYT 5JQ6L 5ANME 3PGDA 2CRYA 1WNLA 4MAUH 2KI6A 2J6WA 3MLTB 4ZUWA 5I18H 1N6QL 2EEAA 5C0FB 3ZDYF 4JO4H 4ENZA 4M75G 5D2LA 4RMSA 3G5VB 3MEWA 5IH2A 1GC1L 3O3DB 3FUJA 3ZZLA 4N2NA 4HT9A 2YSSA 2RQ8A 1YEJH 3RVWC 2AXFA 1AD0B 3AABA 2P9RA 1RUAH 1Q0YL 4G6KL 3E8UH 4JM4L 4NFCA 4XWOC 1FIEA 4LLDA 4OJEH 4JJ5B 2CH4A 1WBXB 2AANA 1QRNB 2M83A 2PU9B 2MFNA 3RPBA 5BO0D 5IW3A 2J6FA 3URGA 3ZTNH 4HXAL 2X4OA 5I5RA 4LUEA 5LJ3d 1OF2B 1M7UA 3HAEB 3MMEA 4URTB 4FYXB 4HQQH 4G8GB 5DMKA 3UH8A 2VM9A 2Y1ZA 4JMXA 3AY4C 1TZOA 5E99H 2JCCB 4YPJA 2A83B 3JTSA 1JZDC 1TQCB 2V33A 3KG5A 4IKLA 3DGGA 1VADB 5IHZA 1J5DA 1HSAB 1F00I 3D06A 1CXKA 3EZJB 3B2XA 3O8VA 1VQ6Q 3NFPB 1ZLMA 1J1PH 1KN2L 2APWA 3E38A 3LCYA 3SO3C 4PWEA 3U4KA 5JQ6H 2W5PA 1E9PA 4TUJA 3CPWA 1ORSA 3QG6B 2CO7A 2HUEA 4MWFB 1N6QH 2MQ3A 4UT9A 3H7BB 4W93A 2UY7B 5ETUA 1OT2A 3B2UD 1P5VA 2EDMA 5IROA 1I5OB 2HL5C 1T89C 2QGEA 2EO9A 3KYNA 2PCFA 1NUFA 5F89B 1YI2T 3D25B 4OF7A 3MPUB 5IMOA 4NNXA 5FDWA 3L3DB 1EHAA 1DBML 5ANMB 4L8DB 1OM3L 4MS6A 3C5ZA 4I3RL 3AAZA 4MZPA 1Q0YH