3C12A

Crystal structure of flgd from xanthomonas campestris: insights into the hook capping essential for flagellar assembly
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
138
structure length
138
Chain Sequence
DQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAATSAGFVNFEITDANGTFVKQLSVPASAAGEVSFAWDGTDANGNRMAAGKYGITATQTDTAGAKSKLATYVDAPVDSVTIGSDGLYLNLTGLGTSPLANVLRVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C-terminal domain of a flagellar hook-capping protein from Xanthomonas campestris
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Biosynthetic protein
molecule keywords Flagellar protein
total genus 24
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
A PF13861 FLgD_tudor FlgD Tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.910 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3c12A01
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3c12A02
5K5YA 4ZZFA 3OSVA 3C12A 4ZZKA
chains in the Genus database with same CATH superfamily
1XCTA 3ARBA 3JUYA 3WFEL 2HL5C 4IRJC 3HE7C 5IJBC 2CP5A 3CCEA 1CICB 2MOVA 1KPRB 5E9DA 2O5ZL 5D7LE 2DM3A 2J6WA 3A5VA 3VWJA 4AYFB 3G4SA 1DQML 2E9BA 4PG9B 3LKOA 3VB8A 5CBAA 4KJPD 4C57C 1E5BA 2YFNA 2CLZB 4M6OH 4FG6D 3CCRT 5IWLA 4LT7A 3CMET 4XX1E 3ALXA 1I3RA 3AU0A 3UYPB 3EGXA 2YARA 1ZT4A 1P84J 4GMSL 4IDJH 4KY2A 4A66A 3QRBA 1DCEA 1R5IB 4DF9A 2QQ9A 4G6FB 3NESA 5I75C 3LYIA 3DUHA 4JO4H 1ED3B 4A2MA 2WZ5A 4GKLA 1UASA 4ERSH 4G70B 4UOJA 1N8RC 5C0IA 1FV1A 2QKIA 2IDCA 1T1YA 2L7QA 3S2AA 3KPNA 1YEKL 1DEEA 4FG6C 3R06B 4XOBA 1JG9A 2O61A 1SBBA 4FI6A 5IVXA 4DBQA 3AY4C 4E41A 4D8KA 3KHOA 1ZLUH 4DGIL 3ULRB 2W0PA 3FCUB 1HD3A 4W93A 5DGQA 5C0CB 3VQMA 3L5JA 4DW2L 2FVUA 3CPFA 4FG0A 1PEZA 3ME0A 4OIAA 4TNFA 1UWXK 2WKGA 2XVKA 4CVWA 4EN3C 1VQ4Q 1UZ6E 2GB2A 4F17A 2WO3B 4GKZB 4FFWC 1LHZA 4JJOA 4GH7B 5BO1L 2O30A 1MNUL 2XFXA 1CZ8H 3DX9B 3SKMB 5EEWA 5I6LA 5IVNA 1MHNA 1L0YA 1IJNA 1JYWA 1XGQA 2J06A 1AHWB 1TLKA 4J9EA 4AEIH 3QO0B 3P4OA 3QCVH 2JMAA 1UD6A 2CR0A 3H3KA 4M7DC 3WU1A 4N2BA 1AG6A 1A3QA 2XG5B 4OZGB 4PBVC 3UAJD 1TTBA 2RH2A 1XCXA 1OAYH 1KN2H 4XP4L 2GT9B 4KGXB 3PNWC 2AEQL 2OJEA 1BGXH 1EUTA 3MMEA 4JLGA 1Q9KA 2YXWA 5IGXH 2YSSB 5I1KH 1UD2A 3VFSB 3OSSC 4LUEA 2CKBA 1FZOB 1GCQA 3JT2A 3QUMA 5IHBA 3B7UX 1DUYA 2LABA 2BC4B 5LJ3f 4RWHA 4DKDC 4HS8L 3L4UA 3QZMA 2CKBH 3LEXA 1HEZA 1YNKH 1E9OA 2PP8A 2BVQB 3QIWA 3RZCA 1JCKA 4H1LH 2MMXA 5CQYA 2ZCHL 4ANJA 3AUWB 2AGJH 5GMKe 2O6FA 1PFCA 4GYBA 3RWGA 2A6JA 4NPJA 3OAZK 1CFQB 2J6EH 4PRHD 4FNPA 5I28A 1OT1A 3EFDL 3TZVD 4OCXH 4RMUA 4OFVA 1JU5C 2VUBA 1E2ZA 1WE5A 4QYOA 1BM3L 1IFHL 2H2PD 3HJ0A 4MNGB 1FORL 1WIOA 3AB0B 4L4TE 5D1XA 1CXHA 1AZEA 1I1AC 1JGUH 5GRUL 5HY9B 1CR9H 3E2HB 1FSKB 3OYGA 1SEQH 1HH6A 2APWA 4GG6E 1S7SA 4ZFZA 1GGCH 5KVFL 4J5YA 1MGQA 1D5BA 2QELA 3KVQA 4Z6AT 3O2WH 5BRZD 2F1LA 4NT6B 5BQDA 4ES8A 5EFIA 3OQ5A 3ARFB 4XMZA 3WJJC 2FJUB 2MH4A 4KKQA 3QEHA 2JIXB 1P0SE 2X38A 5I1HL 4ZNEE 4HX1A 1P5UB 2ETWA 4Q9CA 4M7AD 3R18A 3II2A 3GB7A 4KJWD 4OIFA 2ZPEB 4KUIA 1IC4H 1TJGH 3FDWA 3ILEA 1YWOA 4E7LA 2RJMA 3EHBB 2R0LL 1GMIA 2HVJB 4OLZH 1Z66A 4QXGL 3WDIA 3BP4B 5H94B 2A74B 5KVDH 1N3NB 1RZPA 5EU3B 2YN5A 1NFDA 4B5ZA 1GW6A 1FMWA 4ZOCA 1MCWM 4N1CA 4GAJL 3JWDL 4OUUB 2V9RA 5C0AA 1ZLEA 4MWFB 3E7JA 1S7WB 3JTBA 1B34B 5EU6E 4HWEL 2JQAA 3DDFA 3SWNC 4GXVH 3BKYL 3DUUA 5J13B 4HEMA 2PYFA 4R3SA 3PQYA 2B4CC 3SDAD 2XWBA 2FEIA 1K4US 3TO4A 3WD5L 3WY3A 4RRPM 2WO2B 3VS7A 4TMPA 5J26A 1MUZA 1QMCA 3HZKB 4IRSC 5IQLA 4GBXA 4GINA 4OV5A 1QKXA 3SE9L 3MOAH 1KC5H 4U6XB 1LEKB 4OGQC 1WHPA 5G55A 5TK4A 1U93B 4U7SA 5BOPA 2AJXH 3EJUA 4BQCA 1SOXA 1WLHA 4ANVA 1T20A 4YSEA 1F8TH 4IBWA 3WNMA 1LO4H 3FB7B 4HPYL 2MCMA 1NIAA 5LCVA 4XBPA 3VXRA 4HAFA 4Z77B 5A6MA 2AXGA 5DQJA 4MD0B 3ECUA 4XPAH 3HUJA 4L8BB 4AL8H 1A3RL 3LGLA 1PBYA 3HMWL 1GZPA 2EDDA 4PLLA 2GBQA 3HR5A 1Y6KR 3W2DH 4XRCA 1D7BA 2VC2H 3H2QA 1EA9C 5EWIH 2BZCA 5AW5B 4MXWL 2QQKH 1ZA3B 2D4FA 1JERA 4F8NA 5FU6C 4LBEA 2ESVE 3U2IA 4NOYA 1NUNB 3SE8L 3QXUA 1CF1A 4FX5A 3CFBA 5DD0H 4PP2A 3V6OA 3UO1L 1KIUB 3VU1A 1KCBA 4AEHH 5JHLH 3M55A 2DQGH 4FT4A 2IVWA 2A9DA 4EMKB 5C6SA 4GQ9L 4FI7A 3N43B 2J88H 2W0FB 4ADIA 5IHUH 3DHUA 2DIJA 3CFTA 3K91A 2AERT 2BINA 2CUMA 3QI9B 3ZFJA 4U3CA 3O3UN 3UPRA 2L3QA 1U8OB 2MJWA 2A83A 3NA4A 1SLXA 2NSMA 2QR0A 3QJTB 3VU3C 1EXUA 1L9PA 2NYYC 2QADC 4PJEB 1E4WL 4K3EH 3NMEA 3SDXF 1FYHB 2BS9A 1VQ9Q 1U6AL 2YD1A 3CHPA 4WW1A 3SEMA 3QXVA 1T0MB 3HG3A 4IRJA 1F1BB 3KLDA 5AKVA 4F15B 1VUBA 3K6DA 1JO8A 5DVPA 3L13A 4X6CA 5L9DH 3DTXA 3NQIA 4JZOB 3ZRFC 4O58H 2K3TA 2P0PA 2Q0ZX 4M61A 3FULA 4ZI8A 4PJHF 1HVXA 4LMQE 5D7EA 2NNXA 3OZLA 3BUYA 1OU9A 5LJ5e 2IPTL 3NH7H 3SODB 4D0CB 1QSFD 4KGZB 5K9KA 1XSIA 4WEBH 5IVOA 2N1TE 2PCFB 1M1SA 1X5GA 3QFDB 2ZXEB 2Y1ZA 5CEYA 5KW9H 5HHVL 2SRCA 3HC4H 1VFUA 3GRWL 4HA8A 1YI2T 4PJIF 3TPKA 5IW6A 5JQ6L 1U3JA 3T2QA 2GYSA 2UXGA 3UBXG 3QH3B 4HT1L 4X42A 5DY9A 1D1BA 4QXUH 2WACA 1R5WB 1CLYL 4FYRA 4CSTA 1A4JB 2CE6A 3ULVF 4WENB 3KFVA 1OSYA 4LSUH 4PJBF 1OP3H 3C5SA 4AC4A 2RQTA 5DD5H 4J12A 2NUTA 3H54A 3SKJH 5GAMh 2VXVL 2ARJQ 2CAKA 3D3VD 4G3YL 3AITA 2DOCA 2D31B 5KCOA 1MW0A 3CVIH 4JZ4A 3QXAA 3QZPA 4HWBL 3TREA 2KLTA 1NLBL 1XGQB 2L5QA 2F58H 2NX5D 3BESR 3QJUB 1A1OA 3DURA 3GS0A 3DOHA 5JA8B 1VIWA 2ICWI 2IF7A 4M62L 4WWKC 2A9NH 4YHPB 2J8UF 3RIAF 4BZ2L 5E08L 5IB1B 1YYCA 1EEQA 2C7FA 2CHNA 4JFEA 1PM3A 1WZAA 3LKRA 5DMIL 2P1YA 3FRPA 4HJTA 4Y4HA 3ZE0B 3TX4A 2EXSA 5HJGA 5F0JB 1VYTA 4RDQF 3G6DL 2A99A 3NZHL 4LOUC 4F14A 2FJFA 3IF1B 1JGVH 4AZ8B 1YECH 3QIWB 2JCCB 1MJ8L 3S0PA 3UFIA 1ZHIA 2J55A 3OXRB 5CMAA 5H37A 4F5CA 1VIFA 1KYOK 4YO0A 3ZTNL 1OIOA 1TZGH 1L9QA 2Y1VA 3I2CH 1WPCA 4PYHA 4P23C 4UTBH 1J8SA 1OGPA 2VDOL 4K3JL 4F37K 3OYAA 3GPLA 4R8WH 5FO7B 1ZLWK 2ED1A 1PD0A 5LWYH 4OH2A 4M75G 2F54A 5IBLD 4J7FA 5FKAA 4UAOC 2R51A 4YJZL 1CICA 1GH7A 4AMXA 3MHZA 2CO6A 4G43B 2K9UA 4ENZA 5D6WA 3OTTA 4RRPG 1M30A 5L23A 3GNMH 2EPDA 1H8SA 1RZIB 5CLTA 2E46A 5F6IB 2C3XA 5DMGD 4OGYL 3BC9A 4I2XB 5JHDA 3LQMA 2EDFA 3ATDA 4QRRE 4L5FH 3KXFD 1KCRL 2OLDA 3DVGA 2CG9X 4YSTA 1NFKA 3ELQA 4NPYB 5DEGA 3GIBA 3A6OA 3DXAB 4A4GA 1DR9A 2FDBP 1P1ZB 2X9YA 4LCUA 3MLYH 2IADB 3PREA 4TLKA 5FW9A 1JRHH 3S3OA 5E7BA 3RWCA 4EEEA 1J1XH 1QKZL 2TAAA 3EH1A 1IE4A 3LPFA 5T3ZD 2V8KA 2E7MA 2HRPL 3U9PH 3WFZA 3Q3GB 1V55B 4LLYB 5I76A 2AKRB 5C07B 4U1LB 2R39A 5EEZA 1A7PL 2Z6FA 3WXWH 1DO6A 3BH9A 2W92A 2BVOB 5ACZB 3F7VA 5F9DC 5KTEL 4L1HA 1S7WA 5BRZA 4FULA 3QZBA 3GBML 2W9LA 4RMOA 1IBYA 3NCYP 5ITFA 2OZ4H 3RZWA 5BVPL 1INQA 4AQ8A 4JDVB 5HI4C 4WFHD 5EUKA 3DMMB 3QR2A 3ZJAA 1ZX6A 2QQSA 5E0FA 2JKIS 5I5RA 1NE8A 3OM3B 2E5KA 2NLJB 2TSAA 1YN6A 2FO4A 4JM2B 1F18A 3QQ3A 3QZWB 5DJ8B 5J1SC 1Q9OB 5DD6B 1RZFL 4YZFE 1M27C 3U4AA 5KOMC 2EH8L 4BY6C 3D0VB 3K46A 4YSQA 3QHFL 1AAJA 5HVHC 1J1PH 2DMGA 2HKFL 2E41A 4AQEB 2RACA 3BIBX 4FQPA 3CMEA 4N9GA 5ESAA 3U1SH 5C70A 2DLGA 1IILE 2WXJA 2FB4L 1HL8A 5ACMA 4KUCD 1FH5H 3HUJB 2FO1A 3G4ST 2AQNA 4OFIA 4TRPL 1BFSA 3H4FA 4LLMA 4XVTL 3DSNB 3RPIA 4EJ1C 3PP3H 1RPUA 3B5TA 5HVFB 2EE2A 4Y1SA 4NIKB 3UJTL 4KKAD 4PJCA 1LO2L 3T1FA 5IESH 5ANMA 4NZJA 5SWZE 3WHXB 1P6AB 4YLQT 3L5XL 5JUEL 5E03A 5CWSB 4G1MB 4A2HA 4KRNA 3QUXB 1E4XI 2OJZL 2XQBH 3LQAC 1YEFH 1CLOL 2YRVA 3FL7A 1RK0B 4XZUB 5AW1B 3V2AR 3VWJC 1J0JA 4Z7OB 2IIJA 3MRGB 1UWGL 4M75E 1G7IB 4FQ1L 5D1XB 5CD5D 4OIIL 3KEHA 2XDPA 3BI9X 4UIMA 1KIQB 1CBVH 1R3IH 3DB4A 3OA6A 3L8QA 1G7PB 3NTCH 1HX0A 5E8DH 1A5FL 1T4KB 4UTAH 2JQZA 3RIKA 2WJ5A 2RQEA 1RZJL 4Y2DB 3RA7H 4JY5L 3K2MC 2JKTM 2I9TB 2Z91A 3PWPB 2CH4W 1KPVB 4ELKA 1G7MA 2ZGWA 4C0DC 2P24B 5GGRY 2RK1A 1EXGA 2AC0A 4G71B 3QYGB 3MV8B 4HIHB 4ZS6D 3OQ3B 2FCBA 4JO8A 1I1RA 5CD3B 4N90E 4OAWA 1NUGA 4IUUA 1FFRA 1RPKA 2YKLH 12E8L 2HSEB 3JWNH 1TZHB 3C5JA 3T3PB 2VXUL 4ZMXA 2D9QB 2BNQD 1HXMB 3P8DA 1OZTG 1SXAA 2M2DA 2X4TB 3JWOH 5LGHH 5AAWA 5H2BB 1T83C 2EP6A 4Y0GA 3S37L 5HHXH 3LH0A 3D51A 5JXAH 3V8JA 3JV6B 2X6BA 4YGAB 4OB2B 2XKNA 5EO0A 3OYMA 2AMUA 1KF9B 4XPFL 1DLHA 5ALBH 3S97C 4FXTA 2J6EA 3RIRA 4LZKA 3NACH 1MKFA 4I9XA 3T77A 4DNLA 5FGCE 4UTBA 2LHAA 3AS1A 2EDJA 4JAMA 1QNIA 1A4JA 2BDNH 3VGGA 3APFA 4QVCA 4H8QA 2HDAA 4HFUL 3SCMD 5IFJA 2WKLA 3UXFA 1ZHBA 3KW8A 2PPFA 3MGTA 5E5RB 1JI2A 3IXAB 1X01A 2BOCA 3NIGE 4DEPC 4TULH 3GNGA 3T0ED 4BQ8A 3CMOH 4JY4A 2Z31D 4B97A 3D3VE 4XI5D 5HVGB 1S7QB 4UDUA 2K7PA 5EN2A 4NKMA 1R4XA 3TOPA 2FD6H 1RHFA 1S3KL 2H7WA 1FPTH 4O51B 2VMCA 4JHAH 3V0EA 4IKIA 1QTSA 3WL9B 1CFVL 3P3RA 4E9VA 5DD1L 3G08A 4XBPB 2OK0L 4DETA 4OZHF 3ZL4H 1FVEB 3D08A 2KY9A 2QKSA 5J89A 2L3RA 1WS7A 2ZCKH 3CLEH 3GO1L 1LJOA 3UTSE 4ZJ9A 5DHEA 4N25A 3TFBA 3QZ9B 1C12A 2R69A 1QOKA 4YS4A 2JB5L 4NRXA 4Z3JA 1BZ7A 3QDGE 4K7PX 3U46A 5C0CD 1PLGH 3IFOB 1AZNA 4HCRA 1UXWB 1WHLA 5SV3A 3QFJB 1HQ4A 3FHAA 3IF1A 4P57B 1EZSA 2CGZA 3STBA 2VMJA 2A36A 1CU4H 3FT2A 1KC8U 2DJSA 2V9QA 4EMKA 4JN2A 4FNTA 3HRSA 3FO0H 3RTQB 3SDXB 1GGYA 3NFNB 1SHGA 2E65A 1SRDA 4Z95H 4MZ2A 2Y1YA 2ZX9A 3MN8A 4QMEA 3VI3E 4K0OA 2WLJA 3CC4T 4YQXL 5I71C 2YRBA 3LEVH 1DBAH 1W6XA 2WBJD 1KXTA 4JO3L 2DMCA 2R29L 5IOPA 4U0RC 1GTFA 1T1ZB 2E4TA 2D8JA 2CHDA 2EJ1A 4NNYB 1NDGB 4M1DL 4MA8L 3FO9A 4HVWA 3VG9B 1BQHB 4XP5L 2LRQA 3OYNA 1CD0A 3IGKA 2KDSA 2W5PA 5JXEC 2FZ3B 3ESVF 4XVUC 4BFGA 1WHMA 2VW7A 2CQVA 4HEPA 4M61B 8ATCB 2VZUA 4Y5XA 5I8EA 1OAKL 3BSZH 1NL0H 1OWWA 1Y18B 5IHKA 1ET8A 3QORB 4Q97A 2R0ZL 1FVDA 4C8QA 3PDDA 2CYZB 3M9QA 1IUZA 5DHMC 3MYJB 1H9DA 1U3ZA 1XGZA 2NY0C 1T1XB 4RAVB 4KZEL 2O72A 4KX8A 5EU6A 4F9LA 1KFZA 1BW8A 3JCMe 2LMJA 3VE0B 1WA2X 4X83A 43C9B 4FL6A 1Q9LB 3CEYA 2EIJB 2H32B 4P2AA 5B1KA 1YMMB 5IB2B 2FX7L 4KH1B 3T0DA 1RAIB 2Y6TE 1M8MA 1YUKB 2BXZA 2EO7A 3AJ7A 5DJ6A 5GQBA 5SX5H 5I0YA 4PHXA 5E2UH 5BRZB 4ZMNA 2P0KA 3N0PB 2IH9A 1KLGB 3SJVD 4TQEL 2W94A 3OMIB 1U06A 3LKPA 2WSKA 3ZU8A 3HPJA 4JKLA 4P2RB 3MXVH 1NMBH 1U91A 1VADA 2TSBA 3LKSA 3ZZ1A 2P5EA 5E8NB 4FQLH 1WJSA 3BX7C 3HUJF 5GS3A 5I0DA 5KEZA 2YD5A 1EZLA 5KSAC 3QEGH 2ZWYA 2MKLC 5I8KH 1JTTA 2KZBA 3X12A 4C92A 2BM3A 5KE3A 4KVNL 4J6RL 5CN1A 2ED7A 3GSVA 1QBAA 5F3FA 5MP6L 1IQWH 2EDYA 1XGTB 3BZ4A 3H0TB 2OCJA 2WP3O 3OR6B 5F7NC 3H7BA 4M7AF 4JM2F 4CC3A 3HS8A 4JFEB 1VAHA 4Z0XA 5AYUH 1JB0E 4HK0A 1D0XA 2FBJL 4MNGE 3TCJA 3DIFB 4PG2C 1JNNH 3ULSA 3BAIA 4JCMA 5FGSA 5G2NA 3A6BL 3D7PA 5IJVB 2EILB 4R4BB 4AVKA 4QNPE 1SYSB 3AAZA 2OS7A 4MJHA 3V0VB 5EG2A 4Z3EA 5CR8A 5IH2A 2GW5A 2NY1D 1K76A 4MSWB 4HJUA 4Y4KD 3EJYC 4UMSA 1C5BH 4MNQA 2X41A 3VX1A 5GANd 3O6KL 4N2OA 1E9PA 1Q94B 2F5AL 3A8HB 2KGTA 1SPDA 1WBYB 5CJOL 1TQBC 1BVKA 3JQOB 4Y16A 4FXKC 5SWZD 3MUZ1 2E27H 1U4EA 3GIZL 4XPHH 3PV6B 1MUJB 1X69A 3NTIA 2R1WB 3CZJA 4ANKA 1AXIB 4NBZB 2WINA 2WBJB 1IXDA 2PXYC 3W0WE 2DZCA 3KM2A 3L3KA 1BXVA 3CSYA 5LXGL 3GI8L 4OZGF 5I5IA 3MJ7A 2E9GA 4DPRA 2I9TA 2CHWA 4L1TA 1DBKH 1G7MB 1QLEB 1EZVX 5L0QC 2GFAA 2YPVA 4M8RA 1RXLA 4DJMA 4YH6A 3VSTA 3CG8A 1AY1H 1RABB 1O5DT 3QS2A 4JFFD 2ZX7A 4UT6L 4XAWL 4F7TB 1CYXA 1X4XA 2BUDA 3Q6GH 4FTDA 2X3XD 4M1CC 4P2OC 1EEZA 1S2EA 1SXSA 4ZK8A 3U4KA 3T65B 1HCVA 1PAMA 2VYRE 3JVGA 4WI4A 3G5XB 5C86A 2VKXA 1YA5A 2Z92A 1EGJH 1THAA 2VERN 3EO1B 3ZYZA 3JCMd 3V52L 5G5DB 2RI5A 3MRCA 1MLCA 3QQXA 4JZJB 2MHAB 2AJSH 4K5MA 2IO5A 4HIQA 1RLWA 2QADD 4XOAA 5EIIA 5EF2A 3BH9B 3IAQA 2FIRT 1U8QA 3ZYOA 4QYOB 1IV8A 4PRIA 4JGJA 1XIWC 1LE9B 1UFGA 2ENSA 2ICWB 2KPWA 5DUML 1S5HA 1R5VB 2EH7H 4C56D 1SZNA 1OI1A 2XA8L 4PJOA 2F9BT 2VDPB 5ITFB 3TEUA 4QKUA 5J8OA 2B39A 1WTLA 2V3FA 1Z9PA 3DRTB 3G5VA 3UYOD 5CHNA 5EUKB 2MEJB 2NY6C 2UXVA 4J1UB 3TFKD 1PJ9A 2H3KA 4NZTL 5C0IB 1SYVB 2Y23A 4F2FA 5LQBH 5DXWA 4WTOB 3Q1SL 4G7YH 1I9JL 4M9OA 5CSGA 2RK2A 2Z65C 1DZBA 1X5LA 3L3HB 3NZ8B 1T5KA 3P73A 3WFDL 4NC1E 1DBBH 3GI9H 4FSSA 3VRJA 2XBDA 4GW5A 1M90U 2YAOA 4OP0A 4HAGA 3P8BB 4R5XA 1CF8H 3VRLE 5C0CA 4YDZA 2DIGA 1R75A 3OYLA 4YXHL 3UC0L 2ZD0A 4OLWH 1BBJB 3ARYA 3M07A 4NP4H 1J7VR 2O5NA 2Q7AA 1WEJH 5C0MA 3HBPA 3I55A 4HJEA 3P0VL 3AT1B 3H9SB 4NBXB 4PFOA 2P80D 1D6VL 3WE6B 4PWIA 1NYGA 4CMHC 4XCFH 4I18A 5DSCA 4L8DA 5TE7L 3V5KA 5CWSA 1QBMH 1KQSS 1HNFA 3N1MC 1ZT7B 3HE6A 4Z7VE 1QI4A 4EO5A 3H0IA 3FZUD 4X80L 4HKZB 2QHLA 2EINB 5FK9A 2R2BA 3AVEA 1N4XL 2FB7A 3LX9A 4HIPA 3SYQA 1A7NL 5FOBB 1EHLH 3UADA 2YGNA 4P9ML 3TCLA 4HLEA 5AQ0A 4M5ZH 4Z0BH 5AWNL 1Q9KB 2Q7NA 3JWNG 3ULVH 2NZ1A 1NMAH 1Q95G 1IVLA 1PYWB 1JNLH 2CRYA 1E4HA 3EDEA 1DJZA 1AFVL 1YJDH 3OGOE 5ICXA 1JGIA 5TJWK 3Q8AA 3RWEA 4PJHB 4AV5A 3LX7A 2FG0A 2IH3B 3BQUC 1A7RH 1NC2D 4CBPA 3OW2S 1RZKL 2XNAB 4JG0H 1RUPH 4L1BA 1B0GA 4HOZA 2GTOA 4FXGB 4X0KA 4OAWB 4NPKA 3A21A 4B6MA 5HVHB 4A63B 2C3VB 1AR1D 4KHXH 4ZOBA 3T3PF 4N2CA 5BS0D 3NCFB 3CCUA 3BDUA 3PWNA 1T03L 1Z5YD 4HIJA 1K3ZA 3HZ3A 4J6IA 5D1QE 4F7CA 4NO5A 4U2ZA 2JI1A 4HV8A 3ABZA 1KIUA 1E4KC 3HG5A 3T4AB 3L08A 4LXFA 4AMCA 2M26A 3BP6A 1OHQA 5GS1A 3F5WB 3L1GA 2DWDA 2CGRH 3ZHKA 1G4RA 1BD2D 4ICWA 2CDGB 2VGMA 2LU5A 3T4AC 1OGAB 3ZDZB 1S5IH 3VTMA 1FNSL 1J11A 5HYEA 3ZDYB 2OSXA 5ICYA 2W9EL 2MQCA 2QR0B 5DS8A 1Q9WA 1YEIL 4BB7A 5IMKB 4U05A 4TQIA 3IDJB 3S96A 5A1AA 5C08A 4G82A 5C92A 1RZGA 3IXAA 2M9UA 3TV8A 3U30C 1HSBB 1JZDC 1MI5A 4NM8H 2H3NB 2JKJA 4IUTA 3L6FA 4NUGL 3GGWB 3JWDC 4PYGA 4M43H 5GAMg 3DTXB 2VXTH 4N2LA 3FK3A 2QSTA 3QXEB 4H44C 2CT4A 4BCXA 4D0BB 4PJOD 4LPVA 1MCBA 3CCVQ 4EE2A 1HHHA 4FS0A 1FVEA 1CG9B 1N12A 4AIEA 1E7VA 2WPGA 3FW6A 4LRNL 4K9EL 1XV8A 4NHCL 3EYSH 2G3XA 3DUUB 4DPCX 3HNTL 4PJ9A 1XF5B 4G1EB 1E9QB 3O6LH 4HW6A 2UX7A 4A54A 2EC8A 3BJ91 4XPBL 3MO8A 5D8JL 3P8HA 2O01E 4ONFH 1FYNA 5KYYA 1RJLA 3DJTA 2OP4H 3D9AL 3FOLB 5DI8B 2JS0A 4HWZA 4P57A 1M3CA 1SVBA 3KWUA 4HJ0C 5LG1A 1D9KC 4HUVA 3SJVA 3QO1B 1MHEA 4FQJL 4HS6A 4LD6A 4I85A 2YXFA 5LGHL 4CMHB 1LWRA 4N4IA 5T1KA 3ZZLA 3O8VA 2WN3A 1GKOA 3S3NA 4KFMA 3RYMA 1S72A 3B83A 3R1GH 2EO1A 2J2ZB 1BM7A 1I1CA 1U3HD 4HF5H 1SEBB 2F61A 2VE6A 2HJFB 1KB5A 3DBXB 4OU3A 3QXAB 1NOLA 2R1WA 2HKHH 4FNLH 4MJIE 4UT7L 3RKYA 3OKOA 4JR9H 4I7ZC 1HE7A 2BNRD 2DMHA 3FT3B 2RHZA 1K8AU 2A9BA 1MFNA 1OPKA 4NLHA 3TYFB 5GAOm 2X2JA 4FERA 3VI3F 3KLHC 3ARSA 3AY4A 1TCMA 4I0CC 4Y91A 1KFAH 1YJWT 1NCCL 1MHHB 2R27A 3GHPA 4UTCA 3UJJL 3NN8B 4L1LA 2VLJE 4HVBA 5IB1A 1BVNP 1ETZB 5D2NA 1W2BA 1AZVA 1IBDA 1LP9F 3FCSB 1K9MC 1RFDL 5DJ2B 4O2CA 1MIEL 3V0HA 2X4OA 4WWKB 5ESQA 1PKQB 2WB7A 3SBWA 4CN4A 2ADGA 2WQUA 5FUOL 1OCZB 4JFZH 4KO7A 1LNUB 4M5SA 1MFBH 4RAUB 4PBWD 3REWB 2ZXCA 3ZQWA 4A7GF 3MR9B 4XNYH 5D93C 3R4DA 4XNQA 1DJ7B 3G71A 4HBCH 5SWSA 4DA4A 5IZ7A 2ODHA 3LZOA 1MAML 3VRIA 2X4RB 4NCC2 3T6WA 3EAKA 5D2LB 4OVVA 3WNKA 1OM3H 5F1OB 4C0FA 4JZJC 1N6AA 3CPWS 2F68X 3EUDA 3EGSA 2YRCA 3L7FA 4PJ6A 5FCSH 5ADOH 3RURA 3FUNA 1N18A 2PVOB 4NO3A 4OZFH 3LS5H 4XK8E 4U1JA 2OXGA 3PIPA 2B1HL 3GLDA 4PJAE 4CADA 4Z3GA 3RVWC 2X12A 3EOAB 1UD3A 5EBMB 2H4EA 3DRQB 4GI9A 2YC1B 2EYRB 3BWZA 4CNIB 1JFQH 4PWKA 1X5IA 3WFBH 4RMTA 4DOHE 4Z7WF 1JGLL 4HSAC 4EIUA 2YPVH 4H25B 2KL6A 3MNWB 4JRPA 1KC8C 4I48B 3AUVA 4XC1H 5DEFA 4CUCA 3MCKA 5L0QB 2X51A 5ENWA 1MLBA 3QDGA 2ZICA 3RWIB 5C7XH 2DQJL 3TBSA 3DHMA 4ODVL 5DA0B 2LLGA 1WTGT 3ABLB 5HDQH 1U8IA 1WZ1H 4AMKL 2YD3A 5JYLA 1J0HA 3G3LA 3EBAA 4KJQC 4W9HC 4OFPA 4ETYA 5JNYA 1ZHLA 4G5AA 1K5NB 3DUSA 4P49A 2YPLE 3NIFB 3CX5J 3U0TA 1O7SA 5ACLA 4MA7H 3CTTA 3CX5K 4NUPA 2XV0A 3RESA 1T7YA 3GMLB 4NC1C 2UVFA 2IGFL 4DP5X 4Y2OA 2HCKA 3RB5A 2X4XA 1YDPA 2XWCA 2MI6A 1I9EA 3L1FA 2YK1L 1TVHB 5ABZA 3ARRA 2E8YA 2G9HB 2GSGB 2J8UB 5SX4H 4PG9A 5CBAB 1QLYA 1TMQA 2OZNA 3QC6X 2R0KL 1B4LA 3CXHJ 5KS9B 2MWOA 3MLTA 1Q94A 4QNPF 4K9EC 3MRPA 4IIZA 4QHMA 4ZTPL 4N0UE 1JDCA 2DMOA 3H56A 3HC3H 1B3QA 4UQ2B 1YLBB 2GQHA 3D6GA 2ZYIA 4IIQA 2XFGB 4NKIH 3TCXA 5GZNA 3MCYA 4HQQL 3WFCH 1AH1A 2A9MH 2YD2A 3CFQA 4OGAC 3MO1A 1L9TA 3P4MA 1MCOL 4G5ZL 4PJCF 3P30H 2CUAA 2Y06H 1FDLH 4RAHA 4W9LC 5KBDA 4QT7A 1T22B 4L3CB 3FRPB 4ZGJB 5DD6A 2PNDA 3GM0A 4PJBB 1UGKA 4UQ3A 3A6CH 4M7DG 1YEHH 1I9RL 4XBGB 5K9QI 3F04A 4JM4H 4CKQA 1UD8A 3VXSE 5TH2A 1SUHA 4PTUA 1YY9D 3SN6N 3QJOA 4FHBD 3D48R 3L3IB 3TJEL 3NEXA 3O5ZA 3QPXH 1FFOA 3CSGA 3VI4A 3BPOC 2JIXD 5F3BB 1DUZB 4LSVH 4JGMA 1R9FA 5I1GH 1FL5B 1Z9QA 3TH3T 1HQRA 5K1VA 2HG5A 5E6IB 4G6FD 2OTLA 5I66B 4JRXE 1WHJA 5T3ZL 3IBEA 1QFWL 4TS6A 4QPEA 3ZBMA 3OB9A 4MMXA 2DQIH 4DP6X 2VDML 2RPNA 1KBGL 2BWIA 1K2DA 4OLEA 3CDGA 1YO4A 3KEDA 1G7LA 3UCQA 2FECL 1FZKB 2FWUA 1RVFL 2G3NA 3D85D 3NOIA 2A9AA 3TO2B 1KLUB 1E6OL 2AEWA 1HNGA 1NGQL 4PEEA 1YC7A 5E95B 2X2IA 4XR8C 2Y7QB 4K3HA 4KXDA 3F85A 2VXEA 3PUUA 4Y1AD 1VQ8T 1B90A 4H0HB 4B5EA 4LCUB 3QORC 1JHLH 3WDHA 4X9DA 4KRMB 5KSAD 5DHYB 4QY8B 3WSQL 1AO7E 3KVPA 5MHSD 4MCZB 3UX9B 5T1MB 4K7FA 3ZKND 4NQDE 2RNAA 3CC7A 4P5KB 4S0TD 2MCNA 2P24A 2X88A 3DB3A 4OD2B 4JFYB 2WKOA 3SGDI 1RUKL 2W07A 4RFOL 4TSBL 1FNGB 2FZGB 3RPBA 3T3ME 4K94H 3RWGB 4IBVA 4P07A 2WAQA 4OBRA 3IPFA 1CFQA 3L5IA 4NQVB 1JWUA 4GRLD 3UO8B 4FFTA 4GG8B 1Z9NA 2UY6A 3FQTB 2KLRA 4NNXB 4JKPL 1HXMA 1X5AA 3TBYA 3O2VL 5GMKl 3NDZE 1PZ3A 4NQDD 1JGDB 2FHFA 2JCCE 3D1MC 3MLWL 4I89A 3VFMA 4X6EA 3IMWA 4ELDA 3VRLF 4MAYA 3UA6A 1QKWA 4N3TA 1CGSH 1AXSB 1BJ1H 1NCIA 1DVFB 3ESOA 1DLHB 1CC3A 2ZYRA 1NLDL 2HBPA 4P04A 4LSPH 4WSJA 5D1ZC 1MNEA 2CBTA 4AVHA 4HEPG 4B3EA 2NLJA 4MZPA 5LBSL 3UERA 5EPMB 4HPOH 4QHUB 1Q90A 1MHEB 5A2LH 2EGCA 1XSKA 3CFEB 4PGDB 4TOYH 1MW3A 2F1AA 5AVXB 4M78B 4LVNC 3X1GA 4CC4C 4KGLA 1WFNA 1CDUA 3CC2A 4PJIA 1MELA 1UCTA 1U42A 3CCUQ 1W8NA 2V4LA 1BAFL 3RFZA 1ZGLP 4A4HA 3OLIA 3ES6B 4GP4B 2VLME 1F00I 3EZJB 4L3FA 4EN3D 4UQBA 3VNZA 3IMTA 4JLRB 1TQCB 3UOAB 4LB8A 3GHBH 2WCPA 1UM6H 3GMOA 1TPXC 1SFDA 1MFAL 3FU0A 3V4VL 3KR3H 4YHZH 3A4FA 4FLSA 2IFFH 3G08B 4NUQA 2XMFA 1UUNA 2ZXWB 2EUWA 3IMSA 2BS8A 4HALA 4AL8C 4J3XA 5GAN8 4RMRA 1T66C 2WWMC 2ICWJ 3WHE1 1B34A 2GK0B 3FSZA 2D03H 4LARL 3BN3B 5BOZG 3VMNA 1UFFA 4PM1A 4A63A 1RK0A 4URKA 1KLFA 1QFHA 2WLZA 4LHUD 4RAUA 3HC0B 2ZJSL 4XTZA 1UHCA 1KFGA 4JB9L 1KTRL 1JWSB 2CK0L 4PGCA 4HCBA 5ESVB 3C08L 1JZHA 4NUJB 2DDQL 3URGA 5F7LB 3MRNB 1N67A 3D2UA 3WAKA 1G43A 2VIRB 1DVYA 5KSBF 5J7CC 2JK5A 4XPGH 5FUZL 2YD9A 3IDNB 4XVUD 1NCWL 5F96H 4PW4A 4Z7UE 1T2XA 1YN8A 2YJLA 4LLWB 5L8LB 2DWSA 5GAN3 2XETA 2ZOKB 3O41A 3QXTA 4L8BA 1UGPB 1Q9WB 4MQXD 5IMKA 3RNKB 1G3SA 5F93C 3C6LD 3H8NA 4O5LL 1AQDA 4ZTOL 2E59A 1FHGA 2RFXA 5HCKA 1ZSZC 3TWCH 1DHKA 2V8IA 1S9VB 1BU1A 3JWOC 4L9LB 3VH8A 3FAXA 3HMXL 3QQ4B 4P59L 3B43A 3LNIA 2C8NA 4WUUA 3RJDA 4F8QA 3H9NA 1RACB 2P7TB 1IHVA 3M5AA 4R7DB 2G5RA 1FAIL 4Y5XB 5I8EB 5JQIB 1SHSA 5KN5A 1XVSA 4TXVB 1U8IB 1X2QA 3BAJA 5C8JB 2OMXB 1SN5A 2K3YA 4AYEC 3QORA 1UD5A 4KKBD 4L8SB 3QDJD 1EHKB 4JJCA 3W82A 4MNHA 3OAZH 1DE4B 1IZJA 1NBZA 2VDRH 4UT9H 4MQXC 4AUYA 4J6WA 3TXAA 2E6QA 1BZOA 1N64H 2EQMA 4RAVA 4H8WH 1J8HA 1CFSB 5T5NF 3GXTA 3L1OH 4U6HA 4HOXA 3NJLA 1NCJA 1XH0A 1WCBA 4OJFH 3SDAC 4XO4A 3LXCA 3QUXC 2G60L 4IRJB 4LGSB 1YYML 3VXOA 4HXAL 2CO4A 2ZWZA 2P5WA 25C8L 1MDAA 1TENA 1ZEAL 2GJ6A 1EMTL 4BE0A 1CKBA 3LXAA 2ROTA 3O8XA 1CMOA 4CSSA 1S8DB 2JCCF 4KJWC 4E5XA 2VZSA 4GQPH 1KB5B 4KXCA 4UOW0 4D0CA 1DQDH 1CLZL 3BMWA 1WYJA 2QTVA 5T1LA 43CAA 3V5DB 3FT3A 4MS8C 2B20A 4TPRH 5AZUA 3BAEH 3QNZB 1YNTA 3QEQB 3BYYA 1B4TA 4KK6D 4KROC 1ZVHA 2Q76B 5AVSB 4BD4A 4PI0A 2EC9T 3K2UL 3BH8A 5I8OL 1BG9A 1KENH 1MCHA 1B7TA 1MI5D 2HUHA 3OZKA 5CILH 5C09A 4IMLA 1DVUA 1ZHNA 2RD0A 2RMOA 2FL7A 1DUZA 1FL3B 1FC2D 5FWBA 1W0YT 3FBKA 1X5YA 3EYUL 4S1SH 4HXBH 5CP7A 4HXJA 2V3DA 3INOA 4PW9A 4AUJA 3D09A 2AQPA 3FN0L 3OMAB 2Z35A 3HCVA 4JGNA 1WD8A 1AHKA 1ZD6A 3EDJA 1X5XA 4U2YA 3U36B 2EVFA 2GY5A 4WTZA 3LSOB 1QUNA 4KRPC 1DN0B 3ZE0F 4B3VA 2JTDA 4AQZA 1KZYA 3KPOB 4POYA 4AIZA 3L1EA 3ARWA 1ZDQA 4J7IA 4WY7H 3S36X 4M75C 3L2QA 3U2JA 3ARXA 4Q58C 4WIQA 3EJCA 4NN5B 1QVGA 1XR8A 3QAZB 1GYVA 1AKPA 4FYXB 5D96B 2AJVH 3CBKB 3OJ2C 3IJYB 1L7TH 2EACA 3GSNA 4PJDE 3X3GH 4RNRA 1HK9A 2UV3A 4KKNA 4L4VD 5ICZB 3AT8A 4HCGA 1E3FA 2IAMA 2UZIH 3CD4A 3D18B 5I1LA 1FNAA 1SF3A 2FYVA 2X70A 1KCWA 3HRTA 3C60B 1H15A 1M6OA 2OSLB 5E2VH 3UTTB 4UM9D 4ZUUA 5L2KE 2IMMA 1A6TB 4JJDA 2PPEA 3FO2A 4XCCL 4UM9A 1GC1H 4IBYA 5DRZA 1TLMA 1URLA 1KT2B 2LQRA 4LSRH 4OY9A 3G9VA 5DR5L 2UWEF 4HMCA 2UVEA 2H0EA 2VKWA 5AOZA 1HXDA 1E2WA 3UZEC 5CU9A 2EQUA 3IFNH 4HKJB 4KI5E 4FCHA 4UAOB 4G9DB 2HJKB 5LJ5f 1UJ0A 4IRSD 4BSVA 3PWVB 3WEMA 1EJ6A 2AVGA 2J56A 1YY8B 1QWHA 1T3FA 3Q8CA 4UNIA 5LJ5g 1D2PA 5SX4I 2G9HA 3VI4E 5F7EH 2HD0A 2CIKA 4BE2A 3ML9A 1RMFH 2EXYD 2EO9A 4KRPB 1P4IH 3L3DA 3C95A 2NR6D 4NAQA 1WC7B 1M8VA 1VACB 2QMKA 3FSOA 1BOGA 1KN4L 2BW5A 1FZOA 4YX2L 1OGTB 3BVDB 3VYNA 1Q7YU 1JPEA 1MCPL 2XY1A 1B6DA 5CAIA 3FSWA 5GISH 3Q8EA 1GZHC 5BS0A 2NUPA 2RHUA 1NBCA 1U92A 4PP1C 1ZIBA 4ODSL 5AVYB 5EU6D 5EU7C 3POCA 5DQDH 1WO2A 2JKRM 5C0DA 5INCB 1A7QL 1QQJA 2H1PL 3QFJE 1DJXA 5DYOB 5D71L 3DHJA 1BZEA 4O2FA 4OLYH 4MJ6B 3I02B 3AAZB 1ND0B 5AOIA 2YPKA 2E9WA 5ACZA 4LDUA 2R7EA 3L17A 2R4SL 1VPOH 4X99B 3I9GL 1CDJA 4PRDB 1FL5A 1TQTA 1OW0A 3HS0A 1EFXD 3T6XA 2WAHA 4AQ8C 4BA0A 4G8EB 4JPSA 2F7RA 3JB9H 2GK2A 3LQAL 3VSUA 3VXQB 3PV6A 1MUJA 2C9VA 4AZUA 3K5RA 2B4CL 5KVGH 3BIKA 1QNZL 2FSEA 3HG2A 1XGPA 1UB6A 1T89C 4Z76B 2EYYA 4KY1L 1HYRC 3HE6D 1Q9OA 1X4YA 3FT4B 1K2DB 2FQGA 2JXMA 1N19A 3W5NA 3SOBL 2VV5A 2VDQH 4Y16C 5GAN2 1N8ZA 1ZBXA 1YMHA 1QUPA 4OM0H 3SWNA 1IEAA 3QWNA 4HZ1A 2EXYC 3O9WC 4AC2A 3CXHK 5DLMH 1U8KA 5BV7C 1MEXL 3PAUA 4FTVD 2J7LA 5AW9B 1JZ7A 4EDUA 3S98A 5F89B 4NKOA 4QIRA 3QG6B 1LXMA 2JI2A 3PL6C 4PY7A 4X5LA 3VGHA 3NJVA 5E4EB 4AVJA 1ES0A 1DL7H 3IGAB 5L8JB 1IFGA 2VISA 3PG2A 3PCYA 5ANMB 1OHZA 3EYFB 3UTZB 4BM7A 1P4UA 5AAWC 3I50H 2A7BA 4F15C 3IB4A 3O11A 3PF2A 4M00A 5B38A 4LF3B 3HNSH 1IQDB 4PLJC 2VDKL 4ONOA 4WKZB 4M7DE 1A6VH 1MLCB 4QT5B 3L95B 3CCQQ 3JB9I 3KWWB 3WV0A 2Y5TA 4PGZA 3TO4B 5K39A 3EFFA 3V4PA 2QADB 3OKYA 3EDFA 4KKLD 3RP1A 4XPTL 2DBLL 5BMFH 1HHGA 1VA7A 4KK5C 4OD3H 4KO9A 4GY5A 1KEML 1PSKH 2VQ1B 3BP5A 1TWBA 3ULUH 1RU9H 5IKCB 4YNYB 2N7BA 2UXFA 4XP1L 3ARTA 1QATA 4PMEA 4GXUN 4LDOB 4XMUA 3WNNA 3LRSA 4DT2A 3KLHD 1R46A 1XF4A 5LGKA 2BIPA 2QQNH 4UQDA 3P0YL 15C8H 1TQUA 4G9FB 1CE1L 3NJFA 1TFHA 3DLLA 3DTDA 2DH2A 2LC4A 3U0PB 1OZ2A 2XWZA 4NI3A 5DS1A 3F01A 2XWDA 4XWOD 4KOCA 2DKGA 5DMKA 4PJ5B 5D6CA 1GL4B 3VRJB 4XO5A 3ZO9A 4F57L 1M42A 2IDFA 5F7BA 2FR4A 2VR4A 2AQQA 4LL9A 5IMMB 5ADPH 2I7OA 3WVEB 4Y1AA 5CZVH 4C4KO 3PMTA 3WI9A 3DETC 1IGML 2ADFH 4E68A 3VXRD 4XVJL 4Y9FA 2CUDA 4M7LT 5SWSD 1AD9A 1CDIA 1R24A 3VFVA 1RURL 2PP9A 3V5DA 1GSMA 5B3NA 4N0YH 1IIIA 1N70A 1YITQ 3U6RB 1BCOA 3EYVB 2E12A 5DO2D 5I1AB 1J88A 2EE3A 3I56Q 2E7CA 1H19A 1JV2B 3ZKXC 1W0VA 2V5RA 2W81C 5GMKh 1A0NB 2AK1H 2H6OA 3KL5A 3QHZH 4KKAC 1XJWB 1GIGH 4GBQA 2M83A 2X4SB 4JQXA 4LHUB 1PZ2A 3BUBA 4P5MB 1VQOT 3DJRA 4IRSB 4LEOB 4LQFL 3D25A 3IU3B 4GPVA 4TL5A 1HL5A 4LKXA 2VGLM 2VW6A 4R26L 4CU6A 5IFAH 4AXWB 1D6EA 2YDLA 5DI8A 4M6MH 4AENA 4I0PB 3P2BA 4LCYB 1S7XA 2YOCA 4NM4H 1PRLC 5CVIA 2XY2A 3HCVB 1G7QA 4E0RA 1NGPL 2AEPH 4I18C 4YFEA 4P48A 3HPWA 1T0JA 1ZWIA 3CZGA 4NL3A 4N5EC 4UDUB 5EN2B 5BJTB 4BZ2H 1F5WA 4QKTA 1DVFC 4O2EA 4XC3H 3OXSA 1WQWA 4GO6B 3NJHA 1N5YL 1E2VA 1U58A 1W91A 2Z7WA 5G4MA 5BW7C 3ETTA 2JM9A 4JFDD 4BSWA 2EJ9A 1YG9A 3PDGA 3S9DB 1WBXA 2ADYA 3W9DB 3AG3B 3VD7A 2WSPA 3BQVA 1A9BA 1Y6NR 4IKNA 3NAAL 1MPAL 4U1NA 3IVKB 5FHAL 1R3LA 4UCFA 4OJEH 3RVVC 4B0MB 5LG6A 4P2RD 3WKPA 1OPGH 3THML 2WYZA 5I30L 1JXKA 3QFJA 3UATA 2E3VA 2X70B 3N04A 4RWYH 4F7KA 2ENYA 4N0CC 1HEHC 1XR9A 2BRRL 3HHSA 1TUCA 1B0IA 2VXQA 1OT2A 1ACXA 3PPSA 5KN5B 5DUJA 3STZB 1YP5A 2RHIA 3CBOA 4M7JL 4YSRA 2ADGB 4OCYH 3LPGA 3GBNL 3ISWA 4APQD 1OTTC 4I3RL 5ITBH 3MR9A 2FBRA 1TUGB 2QA4T 2ZSVB 3SE6A 5B7MA 4WK2B 4EDWH 2D31A 1KTLA 1ZDSA 3AB0C 5C0RL 1YFNA 1MFCL 1IBBA 5A7EA 4AIOA 2CNZA 2CIIA 2XZQL 2YD8A 4XN4A 1T3FB 2F74B 4JX0A 1M2VB 2DAVA 3CBPA 2BNUA 1GYCA 1TJIL 4YHLH 5CKDA 5BZDB 4PJ7E 1UT2A 1L7IH 2WVVA 3MSPA 1V05A 4IKKA 4MA3B 2GHZA 1NJIU 1ONQA 4PRAA 3TBTB 3K6IA 3H2PA 4NZRH 1AG0A 4Q4IA 5IHLB 2YC1A 2WQSA 1G94A 4G7VH 4OD1H 4XH2A 3Q6FB 2VRAA 1WZMA 1F3RB 2NSQA 3JYCA 4YGVA 1J8RA 3MUGB 4NN6B 1NMCB 4DKAA 9ATCB 2BP3A 3NCEB 4M1GL 4ZX5A 1O6TA 2BZYA 1YNTB 1LQBC 1NFAA 1WRFA 2NNRA 3AS2A 2LOEA 3NFSH 4KMTL 1E8YA 1M3IA 4Y4HD 3ULVD 2DM2A 3CU1A 4UDTB 3TN0B 2D9CA 4GLRI 1HILB 1U3HB 2VLRE 3LIZH 5J6HA 5T1LD 1T66D 2P44B 4U6VL 3IYLW 5IB2A 3GMNA 2KZ1B 2IQAB 1JHTA 1O7DE 4WI8A 2OMUB 4OI7A 2JTEA 4JLIA 4RTYA 4RETB 4BKLB 4BK5C 3GSRA 3BPLC 3SCMA 4U6YB 1ASQA 3PS6A 5I15H 2Y6SD 3LAFA 1SG5A 3R0NA 3N41B 5E94A 5IW1A 1AZRA 5JHAA 3C6EA 4N2DA 1H8OA 4E7JA 2J25A 2PCPA 3SKMA 3TL5A 2OAWA 4IGBD 3TNNB 4OCSL 3U36A 4K5PA 4NKDA 3A8MB 4RGOH 2MOQA 1HL9A 4YDLB 2YWWA 1LK3H 1YAZA 2VC8A 2V2WB 1PFOA 5AW2B 4D7PA 4XNUL 3LXBA 1RQ5A 4KK9C 4KI1A 3FQ2A 3L48A 1XH3A 3QYMA 1YHPA 2RALA 2K8QA 4RBPK 1P7QB 2GT9A 4WFGD 3IU4L 2Z31C 4WGVB 3OR6A 5D4IA 3HG1E 3X1NA 4DN3H 2P8LA 2AQ2A 1QBBA 1XSJA 1Q0YL 4X2UA 4DAGH 2ITFA 2BC4A 4H20L 4X5WA 5KVEL 2NYZA 2DM4A 2A38A 4PVMA 2FVNA 3O6FA 3AT0A 3FO1A 4AW4A 5I24A 3SDDC 5LKNA 2LX9A 5C0BD 5CM1A 3WTWA 5DD3L 4FFWD 4ZG1A 3D06A 1N27A 4RA3A 1IQDA 4NP9A 5JTWA 1BLNA 3V7SA 1I81A 2OL3A 3EZ8A 3CPLA 5HY6A 2FLBT 1TTHB 4AE0A 2AXWA 1QSEE 3ULUD 2DKSA 3FFCD 1YY9C 2GJ6E 2HRGA 3GK8H 3WCYA 4OZIB 2FJHB 1KJWA 2FECI 2BLFA 1V7ML 2CM6A 2YEZB 3AG1B 5L6YH 4APXA 1MFVA 2CDEA 3Q13A 3BKMH 2DL4A 4NERA 1F4XL 1IM3B 4KWUA 3ZR6A 4W9KC 2AK5A 2EYRA 1OLZA 4YFLI 3TFKC 1JJ2P 3LWIA 1HINH 1KCSL 4HUUB 5LO7A 4M02A 4R4FH 3GJFA 2K3BA 2ED0A 1OB0A 2GC4C 4RX4D 4C4KT 1DQKA 4DKFH 4KTEH 1SY6A 2ZZDA 4IYKA 2VW4A 2BZ7A 4PFPA 1HHIA 4NN6C 5D93B 3QR0A 3RWIA 2A6IA 2WUCH 4KAQL 1W2BS 1OAQH 3RNQB 4LNRB 2JLLA 1HJDA 3C5XA 4DZBA 3JVFC 3QC5X 3ERXA 2ENMA 3KPTA 5DT1H 3VS4A 1R33A 1U92B 1CDGA 5L88L 3DKHA 3INZA 4AY0A 1A21A 5I26A 4BFKA 4MB1A 4PB0H 2VL5B 2A77H 3G6JB 3UIZA 3OZ9L 1T4WA 1FGNL 4PGJA 3PWLB 4HWUA 2F19H 2OPCA 3VGEA 1PAZA 4PJLA 2BKDN 2KSSA 2P9RA 4YMPA 1UZ8B 2KT8A 1ND0A 3NRFA 3WVDB 5I1EH 4M48H 4WHTB 2YBRB 5IQMA 3BRDA 4FL4B 1XBDA 3FQTA 1FFNB 1EIBA 4L18A 1R3JA 5AD0B 4UIKL 1FG9C 2Y07H 1IARB 4WHYH 3QZNA 1TJHL 1HIMH 1RZ7H 3M8OL 5DRWA 1VQ7A 2R4RL 5LJ5j 5FLUA 4AJYV 4J9DA 1QCNA 4MJIB 2IPUK 4UV4L 4Z7UB 1U8PB 4IM8A 5EOCH 2BCMA 1UXSA 4P2YA 5GJTL 3WEBA 1GHFL 5EOCJ 2UUDK 3QUYA 2V9TA 1SJMA 4NQEE 4CKVX 1G7QB 2HVBA 32C2B 3KG5A 3EDKA 4FA8A 4M7ZB 5J9PA 1CIDA 2WXFA 5KS9E 1VQPA 1U8CB 3MRJA 1OT4A 1G6RL 1A66A 1OX9A 3H2WA 4MGXA 1WHKA 2WVTA 2VZOA 4YHMH 3PIOA 2APFA 3RVUD 5HGAB 1QBLH 4WFEE 5IHZA 5SV4A 2AXGB 2WTPA 3HI5H 5JPMA 4FJYA 4CVZB 5D72L 4IU3B 3NCBB 1XNIA 1BQLL 4L2YA 4JDZA 5EZIH 2AKLA 3KJ6H 5CSBA 1EV2E 4K3DL 2VITB 3MRFB 4JFDE 2Q7YB 1R3LB 1RZKC 3FU7A 3LNDA 3MOBH 3WE1A 1N6QH 3KYKL 3W81A 4QGTA 1OAXH 1UOKA 4QXTB 4CC0A 2H0FA 1F2XK 2X9HA 3QJHB 4I18B 4JPWH 5DSCB 3UACA 4JQIL 5IWLC 4WWPA 3MRQB 3SBPA 2NT1A 2WO4A 1I8FA 4RSVA 4E36A 5H35A 5K9OB 1JPTH 1FFPA 3EXJA 5JORB 1BYOA 3US9A 5TK2A 4PLIA 1BZ8A 4OSUL 1DDTA 1H3WM 1V27A 3VS0A 1TZ8A 2NW3B 2YD6A 4NGHH 4ZAKD 1S46A 4LASH 2JELL 5BRZE 3GNFB 4QO1B 3DECA 4V11A 4WHCA 2IBZY 1CDCA 2L7UA 1U1SA 4IGBB 3DX8A 1ZANH 3QWRD 4C58B 3RZCD 4B50A 1J1OL 1Q0XH 3QWRA 3ABKB 5GANj 4RLDA 1M90C 1G6VK 3AU1B 3CHOA 1VIEA 3Q2WA 1M4ZA 2GAZB 2VYTA 2QPDB 4DHLA 2F74A 5DFVC 4PRHA 1S7UA 4K71B 4NQXA 4HCKA 2DWTA 2XNAA 3U0PA 2Q87A 4K94C 4KK6C 4NJAL 1KNOB 4HUNB 3CPUA 1NYFA 4G6JL 4RGNC 4LP5A 5LHDA 1UACL 4YDKH 4N9OB 1YC8A 1SXZA 4A2DA 2BSRB 4ZGDB 2ESVA 4W68A 3BFWA 4PP1D 1G9EA 1AWWA 3VFUB 1UXWA 1ZTXH 5H4YA 1JK9B 4NNXA 5GRZA 3ARUA 2CRIA 4NO5B 2ZUQB 1AD9B 4XHQA 5FYJU 3WNOA 4E42B 2P7TA 1NCAH 3PTAA 3UGUA 4ZFGH 2X9ZA 1UB4A 3QFDA 4PJCE 5LDSA 3ZSSA 4JL1A 5HYFA 3M46A 5TFSH 1MJUH 1JVOA 1Q72L 4L4VE 4FFZH 2B8AA 5B8CC 4KBPA 5I6NA 4J8OA 4QJ4B 5IW6B 3MRIA 3CCLQ 5FFLA 3OJDB 1HWHB 2CJUL 2AXFB 3SYOA 4LHUA 2HNIA 2VDKB 4P5MA 1N2RB 4MLIA 3D69B 1HNYA 4DP2X 3CAFA 4PJIB 2BCKA 1AWJA 3E2UA 2QVTA 4FP8L 4I0PA 4LCYA 5IBLC 5IVXB 1UJ3A 2D7NA 3N6YA 2YEVB 4YC2B 4D7BA 3G4SQ 3A5ZB 3FTWA 3P11L 1ADWA 3LNFA 4S1RL 1IM9D 3MOQA 1GCPA 1Q81C 2ZZUT 4JPVL 1C5DA 4MHHG 4F5CE 5IY5B 1VYUA 3F7RA 1TT6A 2F5KA 2CRMA 4L23A 3D0LA 4H0LC 2C5DC 1M53A 4KNTA 4WV1B 1X4ZA 4GG6A 2WB1A 3G5YA 2QQLL 4XNXL 5IJKA 1HCFX 3C6SB 4C8QB 2YUXA 3QJRB 3AXHA 4FYQA 4G2AA 4CA4A 2ZNWA 3FQ4A 3N85H 5K5YA 2Y4SA 4S1DC 5JW4N 4LAQH 1YMME 2AHJB 1XF5A 4G1EA 2G5UA 4OQ1A 1RP9A 4NNPH 3QG7L 2DFUA 1DDHA 1S9WB 1HSAB 1KGUA 3FOLA 3IXTA 1HSQA 1TETL 2Q3AA 3FQUA 5EU5B 4I13B 1FBIL 5ERWB 2IPKB 2DB8A 1PD6A 2BFVL 2GBAA 3HHSB 4QLRA 4DSYA 3PIQB 5FWRA 1OQXA 4EIGB 4K8RL 1FL3A 1DVXA 3QDMA 5JHDE 2X2UA 1T6WA 4DO5A 5IG7A 5DF0A 4HGWA 2Y2TA 4MTMA 1NTDA 1KBWA 4IJTA 2YRPA 4PV9A 5HYQB 4ANWA 2D0FA 2ZSVA 2AIRB 3CIAA 1JNHB 1U3OA 3GD1C 1TFPA 3AM8C 2K79A 2VDPH 2EZ0D 1M1KU 4PR5A 3B2VL 3II3A 2CCLA 3DX7A 3RNKA 4OJDH 5TE4H 4PH8A 3PAZA 1J05B 2ZOUA 3GF8A 3O6ML 4O00A 3OF6A 1NGXA 3WIHH 3D39E 1UEYA 3LZLA 3FQXB 4N68A 4IMKA 4LOEA 3HE7A 3GSVB 2V8MA 4U1GB 2HRLA 1MOEA 3U6XA 5T3ZE 4J39A 3DVGB 4NFBA 4MVBD 1AJ7L 2UYLB 2CKBB 3DO7B 4P2OD 1MCRA 1CT8B 2ADJA 3ILDA 1VQ4A 4AE1A 3MLRL 3WTSA 3BCDA 1LO5B 4O02H 4FADA 1WFIA 1TZIA 1CXFA 1NBZB 1SQMA 4I5BB 1CL7L 4Y8AA 1XGYL 1XO8A 1IKFL 3EJQA 5GGTL 3REVA 4BA8A 4HD5A 4MNQB 3K80A 2DTOA 1VQOQ 4IOIB 1YEGH 4PN6A 5AVRB 5C0NC 3B9EA 1QSEB 3L2VA 1SJEA 4TNWK 3RJQB 2R1YB 1BVKB 5HI3D 4OB3B 1SRLA 4NQCD 4JFXB 4G8GE 2PW1B 2R59A 4MX7B 5ETUB 2FNBA 3QDFA 3KPRE 3NPSB 4G9DA 4LLQB 4LEXH 4FQ2H 1Q7YR 4FTVA 3MBWA 4AIXA 4UYQA 1A3LL 3NJNA 4Z7OE 3X13A 5AZ2L 1ZVYA 4MCYB 4D3CH 3IPBA 4UM8B 3L3KB 3RBBB 4QJ3B 3QDJB 2NTFB 5JQHC 4TQHA 4Z7VF 2A4ZA 1WF5A 4ICXA 1MF2L 1J5HA 4WZ9A 4GAAA 3OAUH 1BVOA 3QIIA 2WCGA 2WXIA 1I3RB 2J7IA 1GC1C 5ENWB 3QQ3B 3KPLA 1U8MA 1ZJAA 2IC2A 1LEGB 2C1OA 3QZWA 4FFYL 4GMTL 3RPKA 1SHWA 2X4QA 5I6XB 2I26N 1DVFD 4ODHL 3TEXA 2P5EE 3Q5TA 1UVQB 4PJFF 1FFTB 4OLXH 3NA9L 3RX5A 4JEGB 2JUFA 2E7BA 4N4HA 1JZIA 4M8QA 3WN6A 4CGUB 1VFMA 4YXLL 3MAWA 4ZW6A 1WBZB 4DH2A 3F58L 5DURB 5I19H 2EE9A 5IFHL 2JKWA 1YHQQ 3CCSA 1UWEL 1BI3A 2A74A 2DRUA 3FONA 5FO2A 4B6ZA 4X8JA 3T0EB 2B15A 5EB9A 3WJLA 3LH9A 3MODL 3T8VA 3I02A 3DARA 4Y5YB 2O9VA 4KQ0A 2F53D 2XPGA 4QRAA 1OZ3A 3CCQT 1FO0H 3CFDB 3EJRA 2FQFA 2FBOJ 1MCIA 2EVRA 2OMVB 3GTTA 5DJAB 1CDHA 1G5GA 5D7JB 3FQWB 3UCRA 1M4KA 3OKDA 1DSFL 5AG8A 3BFMA 2DIEA 3B1UA 1A1MA 2H0PA 4WUUD 6FABL 5AVUB 1X43A 1LE5B 3VS2A 4Z02A 3OYCA 1J5OL 4POUB 2VVKA 5GHWH 2NYKA 3UC2A 2D3VA 3T04D 3V0JA 3D2TA 3DHPA 4X7SL 1ID2A 3L3HA 4WW2A 5PAZA 3QCUL 4P3DA 4GAGL 1HKLL 1FIGH 2WSFE 3ARVA 2XUWA 5DUPH 1Y07A 2W8CA 4PRBA 4XOCA 1U8NA 2YFOA 2F69A 1INEH 1YN7B 5C71A 3NHNA 5E51A 3UYRH 4U1SB 2XPZA 3FO2B 2H3JA 5DRZB 1NGZB 3KZ8A 3HI6H 3Q7JA 2CRZA 4MMYA 4JFQB 1P9MC 3RDTC 1MZZA 3NCCB 3RZCB 4NO0B 4UILL 4HH9B 1JPSL 1VQ5A 3NQKA 3SY0B 4LCIL 3MP6A 1A6WH 1U3YA 2PWDA 4Z8FH 4QT5A 3VG9C 5ISZE 1FYTD 3HEIB 5AW6B 3OSKA 1YPZB 3CX2A 5ABAA 3AS3A 2HJLB 1FFNA 3K71B 4YHYB 5C97A 4R5VA 3S34H 4QGYA 1XIWA 4YWGL 4DK3A 4WU7B 3CHQA 1ZVSB 3FRUB 3V10A 2DYIA 2DTMH 3GXDA 4ZFZB 4ONGH 5JW3H 5CK9A 3QSUA 3L4WA 3J8F7 2J1KA 1TCRA 3BVWA 3HG4A 2VJ8A 3NFPA 5KYXA 1RY7B 3TH4T 2IH3A 1ZLVH 3ARBC 3HFML 1RL1A 2P5PA 1GRIA 1KTDA 1WAPA 5EU4A 2X0WA 2CBQA 2FX8H 2O61B 1P53A 1DN2A 2DEXX 5FA4A 1P4LA 3F64A 5D7KE 4TLUA 3T0WA 3WMQA 1BQUA 2K5FA 2HT4D 3T4YA 5HGAA 5KBLA 3BN9C 4R90L 1DFBH 1UZ6F 4PFZA 2BERA 3QDRB 1DQLL 3E8UL 1VQMA 3QUYC 2EUXA 4KRTA 3IJHA 3HS0B 3IKKA 5F9JA 3OS2A 2NRDA 3RL2B 3SKUD 1NC2A 1AXSA 2XKOC 5L2KA 5GS1B 2MQ0A 2EAYA 3E19A 2XA3A 5EC7A 3HB3B 3VGAC 2J72A 2BW4A 1AOJA 2CDFB 3HNVH 3MRDA 4HETA 4K5NA 1KHCA 3TTSA 2HFGH 3BKCH 4H8WC 3DVFA 4S2SA 4C92E 3UEZA 2QQAA 1LP9A 2ZUXA 4KGJA 4X5XA 2G2NA 3AQZA 5JW4M 2YXVA 4XMLH 3SE4C 1QP3A 3Q48A 2FQEA 4AQ1A 4NDMA 1G7JA 3MLVH 4PJAF 2GCYB 3ULVE 1CQYA 4K2UH 4HJGA 1L6PA 4Z7VA 1MFMA 2VASA 2I5YH 4E0RB 4ZYKB 2R8SL 3U82B 1LEKA 2GJ6D 3HZYB 5CZKA 4JLRA 2VUOA 4G7SB 4G11A 2VM4A 3T2PA 1CD8A 3LWHA 5LDUA 1CGVA 3DPBA 4TQ8A 2EFIA 1YHQT 3BAWA 4P5TA 4URTB 1FRGL 1KIRB 3WJLC 4N0UB 5CJQL 4BD3A 3IJEB 1BVLA 4Z88A 3NT0A 5DMYA 1WV7T 3MLXL 5IAYA 2F5BL 2PMZA 1R47A 1X6BA 4N90D 3LKRB 4UYPA 4LN2A 3OJVC 4Y4HB 3RIFF 4WI0A 4GSDH 1FCGA 1SY6L 1P7BA 3PP4H 2CLRA 2LJ0A 4GI6A 1K85A 3ML8A 2WOYA 2MQGA 3EO9H 4LKCA 2ZUWA 1ASOA 2VQ1A 3EBGA 4W9GC 2OTWB 2NW2B 4NO2B 5LBSA 2NY1B 3ZBDA 4LLUA 3S36L 3UIYA 4Y2DC 5TPWH 3VSVA 2BJML 2DYPB 2VM3A 3CE1A 3FH7A 3RX8A 4JFXA 4YUEL 4ORGA 5C2BH 1YMMA 1SEBA 2QG9B 3LIUA 4OZ4B 1BVNT 4FNRA 1JZ5A 3GPSA 4OLVL 1L4IA 1JQQA 5EZPA 2OMWB 5SWZA 3OKOB 4YHYC 3VNYA 3V7AE 3VWJD 4WW2F 3MA9H 3SDDA 3BDYL 5GRVL 2QASA 1TQSA 3PJSB 5GJSH 3VG0H 3WS6A 1K8IA 2MYSA 5CLXA 1H3PL 1VQKA 1GZQA 3QJQB 4GEJA 3V4UL 3HA0A 1A7OL 1BBZA 1I85A 4A7GA 2YUPA 4J83A 1ZGLA 3EJJX 4B41A 1MCJA 1BB9A 4I1NB 4MRBA 4M77F 1KTKE 1T0NB 2B2XL 3DXAA 1OTTD 4KOBA 1I7TA 3KPMA 4HGMA 3JV4B 3D0LB 4GRLA 2OCCB 2EXTA 1SPKA 3ORJA 2NOYA 1SDDB 4MXQC 4XH2B 5TQ0L 2X4JA 4RFEA 2NXYC 3R7QA 4BH7A 3BT2L 1W2BP 3SE3C 1I1YA 3CZEA 2W9DL 3N50A 4CC2A 4ZSOE 4KQ3L 1YI2Q 1QSFE 5F9OH 1FVCB 4AOFA 3LMJL 2CJSA 2D7TH 1S9XA 1XGRA 3PNWA 5E9NA 4ZD3H 5B7FA 3S8FB 5CIUA 3QXDA 3CN4A 2AEIT 3MV7A 3W0WA 4BY6B 4AENB 4IKLA 4ZBJA 1D7CA 4U1IA 1ZQ1A 1YJNQ 2VR9A 1WI7A 1QYGH 3F7VB 3TA3A 2I0NA 1LD9A 5DVMA 1DJHA 5TQ2H 5ILTH 1KJVB 2VAAA 2DWEA 3DMMC 4QF1A 3GSRB 3SCMB 1ECYA 4UTAA 4E47A 1XH1A 2NR6A 2NUTB 3I5RA 2XDBA 1DTUA 3SDCC 2YAHA 3N9GH 4CW1B 3MROA 1U58B 4ATTA 2K6DA 2F7OA 4H25A 2B1OA 1DQJB 1T04A 4XOEA 3K2KA 3FS9A 4ODXB 1B4JL 3NVQA 5CKFA 1VQ9T 1DQMH 1YEWA 2AMGA 2Q20A 2ISDA 1A9BB 1A1OB 3DURB 2WLIA 1SQ2N 4P3DB 2Y3NA 3B2DC 2I24N 3L9RB 3BE1L 5CNHA 2DF6A 3UZQA 4C92F 1GS6X 1RJZB 3IFPB 2ZAEA 3WEAA 3A67L 1N7MH 2KYBA 3GDCA 1B2WH 1OF2A 3EH2A 3KYAA 4IDJL 2O93L 4EI6B 2N01B 3FUEA 4EQ2A 3UEQA 1CD9B 1ZBJA 4M7AA 3QPKA 2VM9A 1NM4A 1C6VX 1I7ZB 1G0YR 1ACMB 3LH2H 4ERSL 4JUTA 4O4YH 2V2TB 1QI5A 2K6YA 5EORH 1Y0MA 1DBJL 3VA6A 2LT9A 2P4RA 4I5BA 3BVTA 2DN7A 1F13A 3Q1JA 4L4VA 1TU0B 3V8LA 1FQ9C 4F7UA 1T5WA 5SWQB 5CJ5A 1A8ZA 4YSUA 3TESA 5E1QA 2CIIB 1IC0A 2FJSA 2PO6C 5CGBA 3QI9D 2FPEA 3ZE2E 4DW2H 1VGEH 5IQ9B 1VFOA 1U4FA 5EO1A 2R29A 4QRPD 3ZSTA 4MX7A 5ETUA 1M1KC 1DJWA 3WIIL 3FJ5A 4JGUA 3WY2A 3M45A 1KELL 2BSEA 3GUFA 3BLBA 3GIVB 4OZFG 3B9KA 4UANA 3PWJB 5D1ZA 3ZKSD 3JV5A 1AEYA 1UH2A 2HRHA 1IGIH 2XWRA 3ARZA 3JT0A 3MRRB 1R0AL 4BKSC 2HUEA 1BMGA 1EBAA 3FF8A 3ZKQD 4GUQA 5AL0A 4Q0XL 1R1CA 4JJNK 4P23B 4Y2DA 3CSFA 5FV2A 5B3SB 1MJ7H 1UWFA 4ENED 4PJHE 2EKSA 4LLDA 1FJ1B 4KULA 1HHIB 2EWNA 4U1MA 3MYZA 1OAYL 4ZUUB 5FYJL 3QIWC 4XP4H 3KS0H 1BGXL 4U0QB 5I1KL 3CC4Q 3QFGA 4JFHD 3KGSA 3CMAA 2Y5QA 4YEEA 3B9AA 1S78C 4YVUA 4AQAA 4JL2A 3QISA 4HS8H 3WXMB 4ME7A 1WFWA 3GMNB 2YMXH 5EA0L 3MACH 2GEEA 4LLYA 2VL5A 2CKBL 2GJZB 3LTVA 1MW1A 4PI2A 4U1GC 5FYJD 1YNKL 2IEPA 5D1QB 4JN1H 4BSVB 5FV1L 2VRQA 2FNWA 4F58H 1NKGA 1H8NA 3JV6A 2YGOA 1N10A 1WHOA 1OV3A 2ZCHH 3FTZA 2IDSA 5E4OA 5E2TL 2EUZA 3DPDA 1SGKA 1XIWD 3M86A 1UXLA 4R6UA 3H6AA 1BD2B 4WHTA 5A2IH 1QQDA 4H8HA 1NEGA 1AD0A 5HSFA 1OE2A 2NZ9C 4PWFA 3Q05A 2N56A 4J3SA 1AZCA 2B1AL 3O9WD 1WIEA 3UYPA 4H0IA 4HCRL 4XWGH 4JVWA 4NC0B 5F1IB 1CVRA 1BM3H 2JFCA 2K7AA 4Q5WA 3WUWG 5JHDD 3PVQA 2IPUG 2D9TA 2MKWA 1CR9L 1BQKA 3T3MB 4PJAA 3MBXH 4NWTH 4Z7VB 2DQCL 4PLNC 1SKUB 4MMXC 5D70L 3GLXA 5KSBE 1I4K1 3LPPA 3N40P 3ARDC 3O2WL 3M58A 5C08D 3JCMg 3MLZL 2I2LA 5I1HH 5BVJB 2WLKA 2EDKA 1NCBH 1QVOB 1AQ8A 4G6KH 2OX5A 4XO3A 1S9YB 3PHOB 3R6NA 2BVUA 2MOGA 3NCMA 1I8MA 2B5IC 2QDVA 3IDIB 4RG2A 1YUHA 2PF6A 2R0LH 1JN6B 3WJJA 1KB3A 3LZFH 5HDRA 4DKEL 2GTWB 2QXFA 3VXNA 4QKXB 3X2QB 2BIMA 2F7PA 3WHXA 1WGSA 1HJCA 4HIJB 3JAME 4WCYL 3QA3A 2KMWA 3GTVA 4A7VA 5CEZE 4R97C 1JTOA 1JTPA 3CD6A 3P4OB 3QUXA 1BZ9A 4WEEA 3BEWA 2EAEA 5JORA 1I31A 2GFBA 4OCWH 3OMZA 4PS3A 5AB2A 1J3TA 2Y2WA 1NGYB 2ZOTA 3L9YA 4GT0A 1IC5L 4HWEH 1NKOA 4AJWA 3BKYH 2I60H 5JHDB 1IEAB 4ORGB 1YJ9A 5T1KD 5A6IA 1K9MU 4NSKA 2BE9B 4M75D 4YAQB 2V26A 3OKLB 5ALCL 3AU1A 3Q5YA 4IHBA 4AYMC 1T4KA 4PJGB 4POZC 4QTIL 4QRUB 3TPUB 3JCMW 3IKCA 5LB1A 1NAMA 1RI0A 3SHSA 3HP9A 4ELKB 1J0IA 1A65A 2E4FA 1U95B 3DI3B 3SGKC 1LO4L 5KVFE 2YN3A 5I76B 2OTJA 4U3SB 4X6DE 3FU3A 3EYOB 2I27N 3MNVA 5KVMC 3IJ7A 3KWWA 3TC9A 4WFFD 4XE5B 1NDMB 1ZA6B 1F97A 4ADJA 5E1IA 2VTFA 1F58L 1HHGB 4MRCA 1N8RR 2OYMA 2ECZA 4XTVA 3SDXE 3V0DA 5J12C 3VI3A 2KBGA 2QQKL 4FQIH 4PKCC 2ATCB 1ITBB 4DGYL 4MQ7B 2MMPA 3RI5F 3SDCB 4B0MM 3OAYH 4AYDC 4RBPH 7TAAA 1UM5H 3FAWA 4X8CA 1WITA 1GGBL 2IFGA 2XV3A 2BHFA 1AKJD 2W88A 1YQVH 2ZPKH 3LKNB 4MASA 2HAXA 4YE4H 4TTGA 1ODAA 3TCTA 5I0ZA 2DD8L 4I9WD 5IHUL 4AK1A 1ZLSL 4FZEH 2G5BB 4WJG3 5CINL 4OQTA 2BHUA 2HX8A 3S3SA 3MGTB 2J5WA 2FT8A 1TIUA 3HC2A 1H3VA 5D7LB 5AW8B 1U91B 4B9CA 1J10A 1QLRB 4DQOH 2FJGA 5J13C 4K3EL 3B7YA 2XDHA 3DXAD 3DGGA 4UB0L 2H3EB 2Q8BL 5FM5M 5EZLB 2MCPL 2HT3C 3KPQA 4ODXA 4P2QA 4AG4L 3L45A 1GL5A 3CVHB 3JZYA 35C8L 1C5DB 2CCWA 2XZCH 5I6OA 2JB6A 5TDPA 3GLEA 2C9RA 5C0GB 4JO2L 3QQ9C 1ZSDA 4H5SB 3FT0A 2QEXA 5HD8C 4PREA 3MRLB 1J8HE 2MRYA 3PFSA 4B60A 2IPOB 4TQPA 1AC0A 1HK6A 4DCQB 1RPQA 1ARKA 5DHVB 3OGCA 1WHHA 4E9XA 3L2LA 4XZUA 1KGCD 4HUCA 4PQXA 1HSAA 1B0RB 1T7XA 1WCBB 2X6UA 2E8ZA 3CFMA 3WIFB 3RVXC 1E27A 3VFRB 3PIQA 3QQ9D 3ROOB 2YAPA 5JQ6H 3ARFC 2NY4D 1L3WA 3MLUL 1ORSA 2XG4A 4FSXA 2H3XC 2PZ1A 4XCEA 1EX0A 4YDVA 1V7NH 1XTMA 2E7HA 3CD6T 3OXSB 3TYGL 5HTSA 4BK5A 1JV5B 1CGYA 3JWNE 2JE8A 1NH6A 3RY4A 4OTXH 1VQ7Q 4QRPE 1FMKA 1D9KA 3II1A 3QEQE 4Z8AA 5IOPB 2O6PA 1Q7YC 1YEJH 4FL4C 4HWNA 2K45A 4JQVC 1PZAA 3FCBA 4NAJA 1FHNA 1F1AA 1K8IB 1NLBH 2HFEA 3KGRA 4I8DA 2RCSL 1P4BH 5BCAA 1FG2A 3HHTB 2CA3A 4LRIA 1K6QL 2X5PA 3QO3A 5BPPA 5HYJD 3F6LA 3MCLL 3FF7A 4JFPB 3KGTA 4PSPA 2H26A 1T2JA 4EMHA 1CL7I 2IBZX 2WMPA 3IRPX 1OSPL 4QAMB 5E6ID 3ZTCC 1RAFB 2K9GA 3SKNB 3VA2C 1EDHA 3H4HA 3S3JA 3SDZA 3M56A 1E30A 2A1WL 1I9IL 5CJXC 3RU8L 3NZHH 5ID0A 3MYJA 1RJYA 3PNWB 3DV4A 3B2XA 5IBTH 1OK0A 4BZ1L 2IXQB 3O81A 1NICA 4PJ7B 3EFOA 1JF6A 2KERA 2OMZA 3DA0A 4M7DB 4BK8A 3LRKA 3C12A 3PRZA 1TZGL 2LTQB 4UTBL 1QQDB 2ALWA 4N0AA 2BVPA 3N1FC 4KX9A 4NC2B 5EZJB 1J5IA 3IRCA 4NKMB 3QCTH 1W72L 3V4VB 4RNRB 1PF3A 4MCYA 3ET9F 3BUPA 2B16A 3RUXA 2BP0B 4NRYB 4EI5A 3P77A 4DTGH 3BUYB 1VQLT 4PB9L 5E56A 3GLAA 4X9BA 3SDYH 3DLQR 1AO7B 4X6BB 4JFFE 2DJZA 2BOBA 5GRWA 4ZZKA 5IB3B 4OZHE 2HFFB 5DWUH 2E6JA 3O4LE 4NXSA 2O2OA 4OGYH 3OBYA 2DL9A 4ABVA 4ZS6C 4PJ7F 2ZXQA 3MFGB 5AZEH 1UTDA 2FYYB 5TH2B 2LQNA 1RJZA 3IFPA 5E6SB 5GZOD 2ZONA 3N44F 3PLYA 5GAMf 3MLYL 3LH8A 4PTTA 5DMGC 5IB5B 3QH3A 5C08E 3VI4B 5F3BA 1Z3GH 2QV2A 2RGSA 3PQYE 3ARBB 3MZGB 3BQUA 1D5ZB 3HTRA 4ALAL 1J1XL 1QKZH 2NDFA 4NUMA 1A3ZA 1MSPA 2J71A 1QFUL 5F7YC 1WFOA 2UZXB 4R4BA 3H55A 3QG1A 2GTWA 2K1MA 3F2LA 3QT2A 4H88L 4W9ZA 5DGRA 4ZUVB 3S35H 3TVMA 5L2JA 1NIFA 1VKXA 4YDLC 4UC4A 4KJQD 2C4XA 3PHSA 4HJ0D 2BSSA 4N8VG 1FYTE 1W80A 1OANA 4XMWA 4Y9CA 2XTJC 4M78D 5T5FA 3CCLA 3JCMh 2X4NA 3BEVA 5IQOA 4X4XA 5DK0A 1XH3B 5KTEH 3K6SA 4IU2B 2FAUA 1QR1A 2V9UA 2VDNL 3TCLB 3HE7B 1Z7JA 2BSTA 4JPKL 2XWTA 1XAKA 1R6VA 4B27A 2YEQA 4QW2A 2C1PA 4DZ8A 2YR3A 5C0DB 5I1IH 4OLUL 2LFEA 1KCUL 4XI5C 3MRRA 5JYMA 4OW6A 5F7HA 1U3HC 4Y9BA 2MIZA 2AJUL 2XLLA 4TL4A 3MJ7B 3E1ZA 1N5AA 4O9HH 1W6WA 2YUQA 3ZLQC 4H0GA 3SYCA 3OV6A 2GITA 3I55Q 2OR9H 5JPNA 4GW4A 3B7RL 3TT1L 4KU1A 3V0WH 1KB9J 5HDBE 4GO9A 3BWUC 1GYAA 4ZT1A 5GS0C 4JFWA 4D9QD 1I07A 1H6TA 1MCFA 1CTOA 1RIUL 4K7PL 4B9JA 1X7TA 4AV4A 1HHKB 3VXTA 2ZX5A 1FH5L 2R1XA 1KWKA 3B9VA 3ENEA 3VXQA 2K78A 4JCWA 5KYUA 1IM9A 3CVCA 5E5MA 3S4SB 4FTVB 2PTVA 4TVSa 3ALWA 3CDCA 4JG1L 5GAOr 3OX8A 4Z76A 5C9KA 3UJTH 4P3CH 1LO2H 3W9EB 5IESL 4RISL 3CZKA 2Y7SA 3PV7A 5E24E 5AB1A 4GI8A 1KXHA 5T1DH 1HS6A 5JUEH 1MJJA 2HN7A 2B0SH 2C9SA 4W70A 1N8ZB 4OJCA 3BSHA 5D7JC 3U7YL 4J9GA 2OJEB 3MMEB 1F3DH 2OJZH 2XQBL 1QW8A 4BE1A 3UJIH 2OI9B 4FABL 3KPLB 1U8KB 1Z32X 2LVMA 2DW5A 3KLSA 3RDTD 1KV3A 2ZG3A 2XC8A 3VWKD 2ZP8A 5HGDB 3VTAA 4Y5YC 4EIBA 1I8KB 5I0WA 4OMQA 3IDJA 3VFOB 5CGMA 4QRPA 4RZCA 3L5WB 3T0EC 1NG2A 3IGUA 3RWCB 2YIHA 4NKQB 3RLSA 1FYTB 2BIIA 3NTCL 5F97E 2DZEA 1R0CB 4J9FA 3MZTA 4D8PB 1F1GA 2AJYL 5D7HA 3VO0A 4UTAL 4LEBA 3SOTA 1I8IB 3RA7L 2NUZA 4BHUA 3KAAA 4TLTA 3E9TA 4KKCD 1FXXA 4W81A 4MJ2A 1VF5C 4WU5B 3U4BL 3U2SA 3U6XS 3EFFB 3FJTA 4F7UE 1WWBX 3V4PB 4E9QA 2QI2A 2XT1B 3V0GA 5I71B 2OMVA 1VQKT 4E9RA 5JOEA 1S4IA 5DJAA 2HSIA 3LOWA 1BIIA 1D5IH 2VXUH 2V5MA 2ZUVA 4OM1L 2F08A 3ZDYE 4OIBA 3SDCD 1SSHA 3TWYA 2OMYA 1ULVA 1NCNA 2CDFA 3GQFA 4L8DB 2XWEA 3V5KB 5FFGA 4ZZFA 1QR4A 3WIFA 4AUUA 1K8DB 3L4YA 2CR6A 3S88L 4HS6B 4R84A 5J9PB 3UBHA 3KYMA 1BVZA 2GFBB 2WV3A 5DFVD 5HBBA 3D2UB 3ULUC 4GIOA 1PVHA 1U8JB 2PR4L 1EEYA 2BDNL 2GTZA 3LN5B 2WSDA 4KVCL 2PTUA 4LDWA 4PJXB 2JW4A 1NCHA 5TGBA 2L7EA 3IJSA 5FR3A 4OBSA 3QDGD 1J0ZA 1GA2A 4DESA 3KWXA 3X3FH 1JDAA 4LLMB 4MXVE 4TULL 2V2XB 3DPBB 4YHOL 1ODUA 1TYJA 4PG2A 4WDIB 3DLMA 4WSKA 5DK2B 3UTPD 3FFDB 4JFED 1GJWA 3PDOB 4LK4A 4O02B 4NZ8A 2FD6L 2P3YA 3RG1C 1EK3A 1F11B 1FPTL 5IVXF 4JHAL 3H42H 1HEJC 1V8HA 2PVGB 1A6ZB 3MNZA 1MIMH 5DD1H 3UBXA 3IFLH 2ILLA 1ETZA 3GPEA 4L1DA 2OK0H 4Q9RH 1GW0A 1HKFA 3U9UB 1OCWH 3QW9A 3M1OA 1G8XA 2ZCKL 3CLEL 5I74B 3DV6B 3WOVA 4NZUH 3B34A 1WG3A 5TDNB 5BQ7A 1RAGB 2P8PA 3OS0A 4X9CA 2LX7A 1CYGA 1NCGA 2ICWA 1MRFH 1ML0A 3DX1A 4IGBA 1ZUYA 4MA1C 3B3BA 4JZNB 1AGFA 3VXSA 4C56A 1BPLB 5HHME 3K1KC 1GAFH 5F3HB 1ZVSA 3FRUA 3ZQ9A 4DP8X 3HS9A 5SWSB 1YVLA 2AITA 1I8UA 3AQDA 4MQ7A 4EPSA 2XTSA 2F54D 2R2HA 1T20B 2MNWA 4QRRA 4XN9A 5KSBA 1X2KA 1RAAB 5HYJB 3MGOA 5EUOB 5C3LD 1G6RA 4MYWB 3T71A 1NZRA 5GS0L 3C6LC 3FFCE 5JPMC 1WBXB 2GIMA 2Q6WB 4ZMLA 3JVGC 3JZ7A 2AHIA 2DYSB 1ADQL 2LU7A 5FA4B 4QCIA 4N4YB 1NEPA 3LEVL 1VQMT 2E86A 3U4EB 4ZFFB 2QVIA 3O6FD 4JHWL 4OT1H 3B8SA 1VZGA 1INDL 1JZ2A 2Z4QA 3MCG1 2XV6B 1EO5A 2EC9U 3KPQB 2HH0H 3IN2A 1IT9H 4C8QC 1PX3A 3VXRE 2BVTA 1HESA 4XP5H 4R96A 2GY7B 4L0PB 5F9WB 5CJBA 2MTPA 4JK0D 2XKNB 5L2KB 1H5BA 2MPVA 2QGEA 1B9ZA 3RWFB 4GRLB 5CFHA 4L9DA 1MMNA 4PRPD 1Y6MR 1BQRA 3OC5A 3KHQA 5K69A 2J12B 5DRXB 3MEWA 5JNYB 3BSZL 1NL0L 1AGDA 2IQ9H 3L3OC 2NX5A 3GKWH 4Q4EA 5CFAA 1KTLB 2Q86B 2A83B 1D5ZA 1PZDA 4FCAA 2KZWA 4JZ3A 3OWRA 2HTKD 4Z7WB 5D7IE 1OP5K 1VQ5Q 1RHHB 2K57A 3GSXB