4M78E

Crystal structure of lsm2-8 complex, space group p21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
73
Chain Sequence
ILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDNEKVMQHHGRMLLSGNNIAILVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 10
structure length 73
sequence length 79
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78E00
2HNIA 4M75D 5LJ5f 3HFOA 4M78F 2JN0A 2DXTA 1KQ2A 4M78B 4M7AD 2DTHA 5I21A 5LJ5j 3JCMe 1KQ1A 2Y90A 4QVCA 4M7DE 1I81A 5DY9A 4C8QE 5GAN2 3L2ZA 4F7UA 5GAN6 5GAN3 1U1SA 3EFRA 3INZA 1U1TA 2I2LA 5GAN7 3HSBA 1N9SA 5GMKh 1M5Q1 5GANd 4JRKA 4NOYA 4M77G 1Y96A 4J5YA 4X9CA 4M7DB 4J6WA 2RD1A 1Y96B 4M78D 3RIRA 4C8QB 4M7DA 4PJOC 2RM4A 3JB9D 1D3BB 4M77F 3RKXA 4Y91A 4XTXA 3QUIA 3JCMg 4EMKA 5CAIA 4J6XA 5GAN5 4M75C 4X9DA 5GAOl 4F7UG 5GAN4 5GANh 5LJ3g 5GAMd 4M7AC 2VXFA 3BY7A 4F7UF 2EJFA 5LJ5g 3FJPA 3AHUA 4C92A 1HK9A 4XQ3A 4F7UB 1N9RA 5LJ3j 1I5LA 4M77A 3JCMb 3RKWA 4M7DD 3QSUA 3QO3A 1JRIA 4XTZA 4C8QD 4WF2A 3SWNA 3V7SA 3SB2A 5LJ3e 5GAMh 4C92E 4M77E 5LJ5e 5GAOn 4PJOA 2DZ9A 2EWNA 4PNOA 1LOJA 1WNLA 4C92G 4MMLA 3JB9I 2YLCA 4XU2A 3JCMh 2YLBA 3RESA 4A54A 3EFSA 4XU0A 2VC8A 4N0AC 3V8JA 3BFMA 4C92F 2K57A 4F7UE 4M7AA 4C92B 5GAOq 4EMHA 2DEQA 4HT8A 4M77B 2E10A 5GAN8 5GANf 4JRIA 4PJOG 3FIFA 2EJGA 3SWNB 2QTXA 4A53A 4NL3A 3JB9J 3RERA 4M7DC 2DXUA 3V7RA 4C8QC 1BIAA 4QVDA 4PJOF 2DTOA 2RB6A 2E41A 3V8KA 1H641 2DZCA 4RCCA 5GMKl 3JCMd 4M7AG 1YCYA 2FB7A 4C92D 2YHTA 2RA2A 3L1AA 5GAOm 2EJ9A 5GAMf 4M77D 1WPYA 5LJ3d 4M7AF 2DTIA 4JLIA 4OP0A 3JCMV 4N0AA 4EMKB 5LJ5d 4V2SA 3PGGA 2ZGWA 4M78C 1I8FA 2DJZA 3JCMP 2CGHA 4NL2A 3JCMf 4M75A 5GMKj 3BDUA 2VXEA 4HA8A 2EAYA 1M8VA 3QHSA 4EMGA 5LJ3h 3JCMc 3JB9G 3JB9H 4C8QA 4PJOE 2E64A 1X01A 3FB9A 1D3BA 5LJ5h 4XTVA 1B34A 5GMKe 3JB9F 4M75E 4JUVA 4HT9A 5GANg 3JCMW 3RKYA 1MGQA 1I4K1 4M7AE 3V8LA 1JBMA 3V7CA 4XTWA 2FYKA 4M75G 3RUXA 4C92C 3JCMX 5GANj 2E1HA 4PJOB 4M77C 1LNXA 4M75F 5GAOp 4M7DG 1HXDA 3M4GA 4M78A 4M75B 4C8QG 3SWNC 5GMKi 1BIBA 5GANe 4XU3A 5GAOr 5GAMg 4M7DF 4XTUA 3VU3C 2E65A 4J6YA 4M7AB 4C8QF 1LJOA 5GAMj 4XTYA 3JCMJ 1B34B 4M78E 3JCMQ 4MMKA 5GMKm 3BW1A 1TH7A 2DVEA 4RCBA 1WQ7A 4DQ2A 4PJOD 4XU1A 4M78G 5LJ3f 5GAMe 3GIBA 3HFNA 1WQWA 2DKGA 4EMKC
chains in the Genus database with same CATH superfamily
2JJ9A 1D1AA 3CCLT 2DL7A 1NZ9A 4E7JA 3QYGB 1PKTA 1R0CB 4BACA 2PTKA 1I81A 3C0CA 2EKOA 3X28B 3ULRB 1VQKT 1MMNA 4DBFA 4D8DA 1TUGB 4M7DB 1VQOT 4C8QB 3S3NA 2KK4A 1TUCA 4B6MA 3C12A 3CCLQ 1OU9A 2DMOA 1D09B 5GAN4 1K73U 4N4HA 5IHKA 3AHUA 5LJ3j 4RUGA 5CK9A 1K73C 2NUTA 1JRIA 1Q86R 1VQMT 4WF2A 5A0GA 3CD6A 2MIOA 1VQKQ 3OSSC 2A36A 2LVMA 1VQOQ 5CO7A 4B9WA 2YUNA 4DOWA 2YLCA 1XOVA 4YTLA 5KCOA 2VGMA 3BFMA 4FSXA 2K57A 2WSCE 1AZEA 1TS9A 4JRIA 3SWNB 2DNUA 3MHXA 3L2UA 4PJOF 2RB6A 1EIFA 4JJBA 4PJJA 3GNGA 2Z0WA 2P84A 2RA2A 2LC4A 1HYOA 3A8LB 2LX7A 1W2BS 3X20B 1TUDA 2VXEA 4OMMA 1KD1U 2BUDA 4OB2B 1QCNA 1NPPA 2CP2A 3TU4K 2P4RA 3OBYA 1KD1C 2J05A 4II1A 3KUFA 1AT1B 2RI5A 1D1BA 4CC2A 1M1KU 5AYFA 2RO0A 1QP2A 5GAMg 1M2OA 4XTUA 4M7DF 4C8QF 1WXUA 2LT4A 3OY9A 2V1RA 1M1KC 1B34B 1UUEA 2V8JA 3TSWA 1W4SA 3BW1A 1E6HA 2J7IA 3C4SA 3SHWA 4LDYA 4EMKC 2A0FB 2DXTA 5CCAA 5I21A 1KIKA 1K9MR 1WJRA 1WHJA 3M56A 2C0OA 3ASKA 4Z88A 2F1LA 2AZSA 3VV0A 4AFUC 2RHUA 1QP3A 4PKCC 2FPFA 4M77G 3A8MB 1G3TA 3PE0A 4ZGDB 4A4HA 1B7TA 3CCQT 4J6XA 4D8KA 2E70A 5GANh 4M7AC 1PG5B 2AKLA 2DFUA 1N9RA 2EQKA 2CZ0B 1RI9A 4J9GA 3OYIA 2QQAA 9ATCB 3V7SA 3ZFJA 4ZGEB 2DD4A 1BBZA 3P8BB 1YJ9T 2FPDA 2RQVA 2ZPGB 3CCQQ 1UGRB 1YI2Q 3I5RA 2VC8A 5GAOq 1HJDA 5KYWB 2E5KA 3HTRA 4Y28E 5GAN8 1YJNA 1PC0A 1ZSGA 5IT9E 3REAB 2MOXA 2XK0A 4E2FB 4X34A 2CSIA 4IUQA 5A0DA 2BZXA 1VQ8A 3KFVA 1TSFA 1ZBXA 2JMAA 4L5GA 1T3SA 3BDUA 4HA8A 1KHCA 2RI3A 1SHFA 1D3BA 5CKFA 5J3BA 1AWOA 3O8VA 3KBGA 1M8MA 1MGQA 5DLOA 2FYKA 2KE9A 2CH4A 4LUDA 1SF9A 2RQTA 4OB0B 3VU3C 2PVOB 5HK0A 1RABB 2E65A 2EGCA 3EG3A 2KYBA 2QA4T 1YBYA 3VJPA 5CR2A 1N5ZA 2D8HA 4E6RA 3HFNA 1SHGA 1OZ2A 1U06A 3RBBB 4PFZA 4DEYA 2KNBB 5LJ5j 3EG9B 2CSQA 3WXMB 3J80E 1QVGA 4FCYA 5GAN3 2QA4Q 2I2LA 2JUFA 4FU6A 1S72A 1NJIU 4BI8B 1VIFA 1YITA 1SRLA 4C5GA 2CP6A 2FZKB 1Q7YU 1NJIC 1WXBA 4IIMA 4LDWA 2M9UA 2QXFA 2YWWA 4BE2A 1Q7YC 3CEYA 3FC3A 5AT1B 4ZN1A 1I5LA 1BI1A 3QO3A 2QQSA 1G8XA 1WJSA 3SB2A 4BE1A 2KDSA 2KRNA 4RKUE 2XHCA 4PJOA 5IHIA 2LNHB 1JQQA 1VQOA 2COYA 2EYYA 3JB9J 1BCMA 1OX8A 2O4XB 2DTOA 2QQ9A 1FXXA 2RHXA 4M77D 2DTIA 5D6WA 1M3AA 4C5HA 4M78C 1R0BG 4QQGA 2OTLT 2WACA 3HKSA 2R58A 4AT1B 3E1SA 3OYDA 1YN8A 3CCRT 1RL2A 1ABOA 4HXJA 4C8QA 3CCST 3ME9A 1QLYA 1Q95G 2COZA 1JBMA 5GANj 2G3RA 4M75G 4FT4A 4AFZC 2KR3A 1VIEA 2RK2A 2D9TA 1VQ5T 2DETA 5GJWB 2DF6A 1PM3A 2CT3A 3CCRQ 2RQRA 3VUZA 2HAXA 3URGA 3CCSQ 2KXCA 4AG1C 2J06A 2OAWA 2NUPB 2AIRB 5FROA 2CZ7B 3CCET 3JCMe 2ZPBB 1WDXA 1VQ5Q 4QVCA 2JM9A 3CCUT 3EHRA 4OMPA 4LDVA 1WGSA 1GFCA 3OYMA 3CCEQ 2F2WA 3EGXB 4Z8AA 2EBPA 2ROLA 5LJ5g 4E47A 3OYNA 1HK9A 3NHNA 2VKNA 4ZTFA 2X4XA 2FO0A 4ZNXA 1RUWA 4FYWB 1EX4A 3GP8A 3CD6T 1GFDA 3FDRA 2QQRA 3MCAB 3VS7A 2DK3A 4NS5A 3CCUQ 2XG8D 2P0QA 4RTWA 5GAMh 2DJQA 3LW5E 1M30A 1LOJA 3OS1A 1NYFA 3RR6A 1M90R 4ME7A 2GFAA 3GLXA 1WZOA 2K5IA 4M77B 2C0TA 4ATOA 4C5IA 3CCQA 2NWMA 4C0ZA 5FU6C 1BU1A 3CD6Q 1YI2A 4A4GA 3UATA 3V7RA 5KYYB 3NMZC 2DL5A 3GNFB 2P4TA 2YUOA 4E7LA 3OMCA 5KYNA 1OULA 1WPYA 1YNZA 1IO6A 4JLIA 3DLLA 4V2SA 3OW2P 1IHVA 3JCMf 1MV0B 4J9EA 2LT1A 1M3CA 3CMET 1ZBJA 2MCNA 3I5SA 1VQ9A 1PRMC 3V7CA 1Q81R 2HQEA 5GJVB 3MKDA 1ZLMA 1JO8A 2KMTA 4DEXA 3EG0A 2PVDB 1AOJA 3CMEQ 2HL5C 4OF1A 2HDAA 1V76A 2RQUA 2K3BA 4GBQA 1K4US 3NPFA 1GCQC 3VS5A 1MHNA 1LCKA 2OJ2A 3SDZA 2YDLA 3INZA 1Q82C 4WTOB 4O6JA 1PD0A 4J6WA 3I55Q 1KQSP 2RM4A 4M77F 3VS4A 3RKXA 4A4EA 4Y91A 3LWHA 4EIKA 5EC7A 5ECAA 3LYIA 2XMFA 3M0QA 1N6AA 2FVUA 2E5QA 4XQ3A 2X9HA 1NPRA 3RKWA 4QKUA 2LJ0A 2RJFA 4VUBA 2DZ9A 1D0XA 3EG1A 4EPCA 2EQMA 2KT1A 2LDMA 4A54A 3M0UA 1LVKA 2IG0A 2BZYA 3I56T 2DEQA 4FSSA 1YJNT 1RACB 3TSZA 4AMCA 2K5LA 1IGUA 5HY6A 4CC4B 2MMPA 2DYIA 1IHWA 2DXUA 2JTMA 2ZCFB 2DZCA 1VQ8T 2CH4W 2YHTA 4C92D 2GTOA 2OX7A 2MYSA 1SEMA 2M51A 4DOVA 3I56Q 1YJNQ 2VASA 1OU8A 1AZGB 2K7AA 1ABQA 4PJMA 4PJOE 2CUBA 3JB9G 1IXDA 2K79A 4IUVA 3M53A 1M4ZA 4M75E 3GPLA 1T3LA 3JCMW 3OYKA 2FRYA 2I0NA 3CPWA 2RNAA 4BY6B 1VQ8Q 3MPUB 3QBYA 3V8LA 1HXDA 3M4GA 1AWXA 2FEIA 1QVFA 2JM8A 1Y71A 5GAMj 2FL7A 4BE0A 2KGTA 1VQLQ 5GMKm 3TQ7P 1K76A 2DL4A 2HD0A 4IUUA 2RN8A 4LN2A 2V1QA 2D6FA 4Z89A 3E9GA 2KXDA 3CCSA 4M7DE 4C8QE 3J7AF 2O4XA 4OMOA 5D6XA 1S72T 4RTTA 2YSQA 1N9SA 1YITT 5GMKh 2WSEE 1SKUB 2GGRA 1UDLA 2YT6A 1IB8A 1RAIB 4M78D 2SRCA 3T9NA 3EFOB 1FMKA 4XTXA 2XIDA 4OMFB 1Y57A 3EHQA 4JJDA 1AHJB 2YRDA 3H0IA 2LQWA 1VQ4A 3BE3A 2LNVA 4F7UB 2HKQB 3P8HA 3CCEA 2CDTA 1S72Q 1RAFB 2YUPA 4M4ZA 5FU7C 3A8HB 1YITQ 2QG9B 2XU8A 4J9IA 5GAOn 3LWIA 3GOXA 3QYHB 5IAYA 2CP7A 1C1AA 2ED1A 2RQWA 3CCUA 3JSCA 2EW3A 1K0XA 4C92B 3H6ZA 4CRIA 3BDLA 4O5VA 1JJ2A 4C5EA 1NEBA 2EIFA 4LD9K 3QZ9B 2IIMA 1VQ6Q 4J7FA 5GMKl 1ZSZB 2M02A 2ZPEB 3QWYA 3L1AA 3THKA 5LJ3d 3FJ5A 2ZGWA 7AT1B 3G7ZA 4A4KA 1JEGA 1UGSB 1U5SA 2EAYA 2CZ1B 3JCMc 5FRNA 1MUZA 3LGLA 1TWBA 5LJ5h 4JJCA 2JXBA 2YRVA 4CC3A 4BUGA 3EGXA 2GBQA 4UC4A 5IHNA 1AVZC 2RJDA 3L2VA 4M75F 1ZHIA 1RADB 2HSPA 1OEBA 4WCIA 1QCFA 1WHLA 4IIOA 5KE2A 1Y96A 3I35A 2ZZDA 3CMEA 3SD4A 3QPHA 3PT9A 4M78B 2LCLA 4ORZA 1T0HA 2AZVA 5KYYA 3N5BB 3CXCA 3UDCA 1JXOA 1FMWA 1OI1A 2CP5A 3JB9D 2ZPFB 2NLUA 1VQ7Q 2KY9A 3HPWA 3PFSA 2O31A 3I55A 2EJFA 2KAFA 1W70A 1Q82R 1H3HA 4HCCA 2DPPB 4XTZA 4PJNA 1GL5A 2X35A 1NM7A 4J9CA 3QJ6A 2HBWA 3OA6A 3JB9I 2M1HA 3DKMA 4PLIA 2JT4A 1VQNA 2KI7A 2CYZB 1YI2T 3OYGA 3QJYA 1WHKA 1KC8U 5D6YA 3V8KA 5IXFA 3JCMd 3KXTA 1KC8C 4JS4A 1JB0E 1UJ0A 2AK5A 4N0AA 2GFUA 4PLLA 4C0DB 3JCMP 4GLKA 4LXCA 5GMKj 1I5OB 4OVAA 1VQ9T 4D6WA 1QVGP 1X01A 2K4YA 4DBHA 3L2QA 1H3ZA 3I56A 1TU0B 3RKYA 3DLMA 2A37A 1I4K1 1WXTA 3QKJA 3OBWA 1K9AA 2D8JA 5I22A 1K8AR 1FYNA 1IGQA 3H8ZA 2G6FX 2VYTA 5I2MA 1CKBA 1LJOA 2VUBA 2O2OA 1VQ9Q 4FL6A 4HVVA 4AFSC 4FYYB 4K11A 3OW2S 4E7ZA 4MDWA 1WQWA 1J3TA 2K3YA 3HFOA 4OB3B 2LJ1A 2JN0A 1VQLA 4BI3A 1KQ1A 3OYCA 3LH5A 1WFWA 2QQBA 2LQ8A 2LZ6B 3TREA 1VOMA 3VYHB 2RK1A 3VYGA 2QI2A 3EGDB 3TVTA 2HEQA 3S6WA 1R77A 4PJOC 2ESWA 1QKXA 4KBMB 3VKIA 4M75C 3A5ZB 4IKFA 2RMOA 1I0CA 5CVIA 1F1BB 4J9DA 5I11A 1G2BA 1UFFA 3PMIA 5LJ3e 1V1CA 2L3QA 1X6OA 3LGFA 4PNOA 1QVPA 3PIPA 3G6ET 1M1FA 5CQXA 2X3WD 3PNWC 1KQSS 3JB9H 5FWCA 1OV3A 4M7DC 1WHHA 4C8QC 5J26A 4RTYA 4M7AG 1NYGA 3O5ZA 4OGEA 3EGUA 3JCMV 2LRQA 1SRMA 3G6EQ 1VQ6A 2JTEA 3M58A 4M75A 4HCZA 3OYLA 4EMGA 4B9XA 3E19A 1K73R 4LDUA 3JRZA 3JB9F 2EYXA 2EKHA 1ZUYA 4F14A 1X69A 3MEUA 3NFCA 2D0QB 3SWNC 2EGEA 3A8OB 1ZUKA 2BKDN 2OTJA 1IREB 1M2VB 1MMAA 1PD1A 2DXBA 1VYVA 2V8IA 5LJ3f 4M7DA 2F69A 2MK5A 2L3SA 1RAHB 2XDPA 5A2QE 2C0IA 2Y90A 3MEWA 2BIVA 2R5AA 3FLGA 1UG1A 5GAN6 3EFRA 1D0ZA 1M5Q1 1ZSZA 5GANd 4JRKA 4NOYA 4FYXB 4J5YA 4HCKA 4BDYA 4MZMA 1U3OA 5CAIA 2XDDA 1KD1R 4A4FA 4X9DA 3VS3A 2K2MA 4F7UG 1VQ4T 1NEGA 3R6NA 3ZEHA 2F5TX 1JXMA 1R8OB 1VQ7A 1YHQQ 3SWNA 4DBQA 1D1CA 1UHFA 2LQKA 2X4JA 4PK4A 1M1KR 1UHCA 1N8RU 2MI6A 4M77E 4C92G 3CCJA 2CZ6B 2LMJA 1N8RC 1VQ4Q 3VS6A 4HT8A 3MO8A 1U8RA 3OB9A 1PHTA 4ZTJA 2E10A 2NUTB 1YIJA 1OX9A 5CQYA 2QTXA 3DB4A 1BIAA 1M27C 3MP1A 1C0MA 3IQLA 1I07A 4RCCA 2KBTA 1UGVA 1YCYA 2DRKA 4OP0A 2JOYA 5KYUB 2MWPA 3QIIA 2KVQG 4CC7A 4ZGJB 5M9OA 2CKKA 4DBRA 1W2BA 3WVDB 2O9VA 1B34A 2RJCA 1Q86U 1KK7A 2HMAA 2LTOA 5CKBA 1Q86C 2DX1A 4MZPA 4R55A 3L2RA 2GQIA 4XTYA 4QVZA 5IXBA 4AFQC 2COWA 3G71T 4LNPA 4OGCA 1UE9A 2HSEB 4GY5A 2IPOB 4M78G 2VVKA 3H9NA 4M7AD 2Y4YA 1EZZB 2HKNA 2RI2A 5CKHA 2QGFB 5GAN2 4C0GA 2PUOB 1PNJA 1U1SA 1MNDA 2L5QA 1VUBA 3EH1A 2ZPIB 3G71Q 1X2KA 1OYXA 2KSSA 2QGGA 2H3EB 3NTIA 3M9QA 3I55T 1G3YA 2JS2A 5KYWA 1AEYA 4RMOA 3S3OA 2RHYA 3L2WA 2E4HA 2L89A 4OMLA 4HCBA 2VGNA 4MMLA 5EG2A 4XU2A 3CPWP 1VQNT 4KH1B 5A0LA 4Q5WA 5L23A 3CCVT 2FZCB 2KRMA 2EYZA 3RERA 1QVFP 4PFPA 2EVRA 3CC2T 2PZ1A 2ROTA 1VQPA 1K9MU 3M57A 4FT2A 2K2VA 2KEAA 3M4YA 4EDUA 1NJIR 1K9MC 2LQNA 1VQNQ 4EMKB 4DA4A 3SFMA 4E7SA 3M0SA 3CCVQ 1KJWA 2MWOA 1IRXA 2WSFE 1Q7YR 1M8VA 3EGDA 5C6SA 3G6EA 4OMQA 3CC2Q 1UJYA 3PTAA 4HT9A 2VB6A 3MEAA 3LX7A 3LH0A 4J83A 4F17A 1GXIE 4J9FA 5GAOp 2Y4XA 2A7YA 3HRTA 2A28A 4CI0C 1BI2A 5GANe 1KSWA 3EG9A 5J39A 2DRMA 4M7AB 1RLQC 4MMKA 2DVEA 1X75C 4QW2A 1OPLA 2DEUA 1VQLT 2DYBA 3CQTA 2EGAA 3VRZA 2E6NA 3D7SB 5KH6A 1YJWQ 3RMQA 4FW2A 2IVWA 1QVGS 3H0HA 1LPLA 1GRIA 1O75A 1QWFA 4J9HA 3UA7A 4PJLA 1WYXA 1U1TA 1ZQ1A 5GAN7 1VYTA 4JZ3A 3X26B 2FRWA 1TXQA 1JJ2P 3HP9A 2V8KA 3ZBDA 3MP6A 2MAMA 1NG2A 3CMAT 2FHDA 5GAMd 2DD5A 2D0NA 3CCMQ 3EG2A 1GCPA 4LUEA 1X6GA 2DL8A 4C92E 1ACMB 3G1JA 4JRPA 1WNLA 2HZYA 1YHQA 3JCMh 3CMAQ 4QQ6A 2BZ8A 1M2VA 2EFIA 5GANf 2DM1A 1BK2A 2VWFA 1G3SA 3QDRB 2R5MA 5GAOm 4M7AF 1VQ6T 1VYUA 4J8OA 1AD5A 2SEMA 1NE8A 2QAZA 1FWZA 1YFNA 2O88A 3QHSA 4XAXB 4RG2A 1ARKA 3FB9A 3A98A 2K9GA 3CXCP 4JUVA 2R57A 2NUPA 3NGPA 4OB1B 4M77C 2L0AA 4J9BA 4KUDK 2V26A 5GAOr 2OTJT 2OAUA 2C06A 2J6OA 3JCMJ 4M78E 2CT4A 5KE3A 5IN1A 3Q1JA 2DKGA 5CKDA 2HNIA 2LX9A 1A0NB 3OS0A 3RNJA 3TEEA 1HD3A 1RAEB 2OTJQ 1KFZA 1G5VA 3CPFA 1AWJA 2LCCA 3CBMA 4P5NA 1Y0MA 2XKOC 1YP5A 5KYUA 5GAOl 3G71A 3DB3A 3G4ST 4F7UF 3HRSA 1VQMQ 1CKAA 1VQ7T 4M77A 4L59A 1NLPC 2KQWA 2DXCA 3UWNA 4E7HA 2AHJB 2DVJA 3CCJT 3VRYA 2DO3A 1JU5C 1PSEA 4HVWA 3EFSA 4XU0A 1G3WA 4C92F 4N0AC 3G4SQ 3UT1A 1YIJT 3M0TA 2DAQA 8ATCB 2BTTA 2GNCA 2EJGA 2K5FA 3LLRA 5KYXB 2H8HA 3HHTB 3VUBA 3CCJQ 2E12A 2L3RA 4ELYC 4BD3A 2ABLA 2CGHA 5D7UA 1YIJQ 5CKEA 1GBQA 1Z9QA 1OZ3A 3CCVA 1X6BA 4KUIA 1X43A 1W6XA 3FEOA 1C6VX 4XTWA 3RMSA 4LE9A 3CC2A 1QQJA 2CUDA 4ESRA 1H92A 4XU3A 2QEXT 4FIBA 1RAAB 1OQKA 2DILA 1M90U 2F5KA 1TOVA 3M5AA 5DM7R 4RCBA 3META 1M90C 5GAMe 4F04B 5HCKA 1FMVA 4M78F 3M54A 4IUPA 2A3LA 1UEBA 1WA7A 2GQVA 3EAEA 2YUQA 2QEXQ 1YJWA 4PFOA 1UTIA 2H3JA 3HSBA 2GCXA 1X27A 4BY6C 5FU6B 3RIRA 1VA7A 2DIQA 4EMKA 1RI0A 3QUIA 3X25B 5L8RE 2O9SA 5LJ3g 4X1VA 2K6DA 3VS2A 3BY7A 4FW1A 5C0MA 4BB7A 4OMNA 3JCMb 4RTXA 4N4IA 5FWBA 1Q81U 2BE9B 4JS5A 1UECA 1YJ9Q 1ZA2B 3ER0A 2O01E 5I2SA 2EYWA 5HKCA 2JZ2A 3CCMA 1Q81C 2EWNA 4KGVB 3L42A 3RDVA 2LP5A 1K0SA 1CSKA 4M7AA 1QWEA 4EMHA 1NBEB 4QT7A 3CC4A 1N27A 6AT1B 3CMAA 1B07A 1VQPT 4JJNK 1BI0A 3AT1B 1TTHB 2EQIA 1UB4A 2EYQA 2MPXC 5GAMf 1W1FA 2EQUA 3PVQA 3I9QA 5LJ5d 1SG5A 2DLPA 4E7KA 4NL2A 2PVGB 2RHZA 3CC7T 1PRLC 1UGQB 1MMGA 2EQJA 1VQPQ 2M0OA 3CPWS 2ECZA 1FX7A 1Z9ZA 2DIGA 1SSFA 2ZPHB 1YWOA 3C95A 3QWXX 3RUXA 4C92C 2ENMA 1QVFS 3OQ5A 3ZL7C 3OYHA 2RHIA 3CC7Q 1KHIA 3H41A 3REBB 3C94A 2DBMA 1ZSZC 1TH7A 2HQXA 3UA6A 5CIUA 2D1XA 2ED0A 3GIBA 3EFOA 3TCJA 3J81E 2QASA 1KQ2A 3CCLA 2DTHA 3PIOA 2M0YA 1WX6A 2X4WA 4F7UA 3U23A 3WVEB 1QMCA 1WI7A 1H8KA 2DA9A 1EFNA 2CP3A 1OPKA 1VQKA 1B3QA 1QCOA 3SEMA 4XK8E 2B8AA 3E9FA 3JCMg 2GF7A 1XTDA 4HKEA 2CP0A 4IURA 2VXFA 3M0RA 1SSHA 3H0FA 4C92A 3QZ5B 4E7IA 1ZX6A 3OYYA 4RTVA 2XDBA 1VQMA 4Z02A 1TG0A 1W2BP 2E6ZA 3NTHA 2JVVA 1YHQT 4Y92A 1ZA1B 2YLBA 4A63B 3RESA 3E2UA 3GBQA 2JNGA 4FM4B 1P92A 1JJ2S 4ELZC 4NL3A 4PJOG 1WHMA 5LL6S 3UPUA 2YXYA 3G4SA 2YRCA 2QTVA 2FB7A 2HBPA 2OTLQ 1SPKA 1I1JA 1Y07A 3A8GB 2PNIA 2RH2A 2P0KA 5KCHA 3EH2A 2GTJA 3VS1A 3X24B 2LCSA 4XTVA 5GMKe 1WJQA 1QKWA 2JW4A 4RTZA 3JCMX 4KT0E 3OS5A 3OYAA 2OI3A 1PCXA 4M7DG 4M78A 5GMKi 4C8QG 2HCKA 2PU9B 1PWTA 2NYSA 3CBPA 4DQ2A 5FU7B 4JPBW 1UGPB 2FPEA 4C0DC 1KC8R 4R56A 2J6FA 2HL3A 2XICA 1MMDA 3CXCS 2KT8A 5DY9A 1OOTA 5KYXA 1E7OA 4HVUA 2KYMA 2M16A 4X9CA 1Y96B 2QEXA 4FYVB 1BI3A 3MP8A 5GAN5 1NLOC 1D0YA 3GF5A 3MJXA 1M3BA 3FJPA 1YCSB 3PMTA 2CS7A 3QDFA 3QSUA 4TVRA 2DL3A 4ANJA 3M0PA 5LJ5e 1M1GA 1XQHA 2B86A 2JTFA 3JAME 1YJ9A 4KGZB 3V8JA 2K3XA 1BYMA 2X3XD 2KRSA 3OMGA 2RPNA 4A53A 1T0JA 2VV5A 4F16A 2QK0A 1WLPB 1YWPA 4LDXA 2DBKA 3F70A 1PSFA 2FZGB 4L6V5 3PGGA 2MF2A 1I8FA 4MDXA 1X2QA 2X4YA 3P8DA 3PVLA 2X51A 1K1ZA 5LJ3h 4KH0B 2JS0A 5GANg 2P0PA 1Q82U 5FRMA 4M7AE 2L3PA 4KULA 4RTUA 2ZAEA 3M59A 1BIBA 2RF0A 3JV3A 2QA4A 2F2VA 2DE0X 2J6KA 3HL8A 4J7IA 4R0KA 1WQ7A 4PJOD 3CC7A 3FRNA 1MV3A 4MZTA 3A1PA 3OSVA 3OYJA 2AKKA 4M75D 1DJ7B 5LJ5f 1KG1A 3OW2A 4JZ4A 2EPDA 4RG8A 5IH2A 1YJWT 1PKSA 1WHGA 5FLXE 2KROA 1IZ6A 3L2ZA 1BB9A 3QXEB 3HRUA 2RD1A 1D3BB 2E3IA 1GCQA 3OYFA 3M55A 2PQWA 1QW1A 4KGXB 1G83A 5FW9A 2L2PA 4M7DD 4C8QD 3NTKA 4JRQA 2FG0A 1K8AU 4ZN3A 3CCMT 8AT1B 3UF4A 4QQDA 3VS0A 2ATCB 2QDYB 1K8AC 1S1NA 2W0ZA 4F7UE 1M9SA 3QG1A 3CC4T 1O9SA 2AT1B 2E3HA 2QYZA 2CREA 1HSQA 3FIFA 1WIEA 1XNIA 2LJ3A 3OYBA 4JLGA 4BDZA 3R6OA 4QVDA 1RAGB 1KQSA 2E41A 2BE7D 1H641 1ZUUA 2DERA 2EJ9A 2NUZA 1RLPC 2L8DA 1Y7XA 4LD6A 1XJWB 2JMCA 2DJZA 3CC4Q 4BI4A 4N4GA 2OTLA 2XD0A 3CCRA 2E64A 1BCOA 3CBOA 2RJEA 2HQHA 3S3MA 4JDSA 2A08A 4IUTA 1V29B 2QDLA 5HK3A 2E1HA 4PJOB 1LNXA 3OS2A 4M75B 1N8RR 3MEVA 1E6GA 1VQ5A 4J6YA 4PL6A 2PUKB 1BKBA 1MNEA 5DLQE 3OYEA 4AG2C 2F2XA 3JCMQ 1GBRA 4XU1A 1AWWA 4C0FA 2W10A 2XI9A 4KRTA 4GLMA
chains in the Genus database with same CATH topology
2F69A 3CCLT 4M78F 3M54A 1NZ9A 2XDPA 4IUPA 5A2QE 4E7JA 2A3LA 1MHNA 2Y90A 3QYGB 4BACA 1UEBA 2GQVA 3EAEA 1I81A 3MEWA 2BIVA 2R5AA 3CCET 3FLGA 3SDZA 1YJWA 2EKOA 3X28B 5GAN6 3EFRA 3INZA 2H3JA 1Q82C 3HSBA 2GCXA 1VQKT 1M5Q1 5GANd 4JRKA 4NOYA 5FU6B 4BY6C 4O6JA 4J5YA 4M7DB 1VQOT 4J6WA 3RIRA 4C8QB 4BDYA 4MZMA 3S3NA 2KK4A 2RM4A 4M77F 2DIQA 3RKXA 4A4EA 4Y91A 1RI0A 3QUIA 4EMKA 3X25B 3C12A 5CAIA 2XDDA 4A4FA 3LWHA 4X9DA 5L8RE 4F7UG 3LYIA 1VQ4T 1K73U 5GAN4 5LJ3g 1N6AA 2FVUA 4N4HA 3BY7A 5C0MA 3AHUA 2E5QA 4XQ3A 3ZEHA 2F5TX 4BB7A 5LJ3j 3JCMb 1NPRA 1R8OB 4N4IA 3RKWA 1VQ7A 5CK9A 1Q81U 1K73C 1JRIA 1VQMT 4JS5A 4WF2A 5A0GA 3SWNA 3CD6A 3ER0A 2LQKA 2X4JA 3OSSC 2RJFA 2O01E 5I2SA 1N8RU 3CC7A 2LVMA 2MI6A 5HKCA 2JZ2A 4M77E 4VUBA 3CCMA 1Q81C 2DZ9A 5CO7A 2EWNA 4B9WA 4DOWA 4C92G 3L42A 4EPCA 2EQMA 3CCJA 2CZ6B 2YLCA 1XOVA 4A54A 2LDMA 4YTLA 1N8RC 5KCOA 2VGMA 3BFMA 4FSXA 2K57A 4M7AA 2IG0A 2WSCE 3I56T 4EMHA 2DEQA 4HT8A 3MO8A 1YJNT 1U8RA 3OB9A 3CC4A 4ZTJA 1KG1A 2E10A 2K5LA 1N27A 4JRIA 5HY6A 3SWNB 2MMPA 5CQYA 2QTXA 3CMAA 1YIJA 3DB4A 2DXUA 4JJNK 3MHXA 3L2UA 1VQPT 1BIAA 4PJOF 1BI0A 2RB6A 1EIFA 3MP1A 2JTMA 2ZCFB 2DZCA 3GNGA 4RCCA 1VQ8T 1YCYA 1UB4A 4C92D 2YHTA 2RA2A 2EYQA 5GAMf 2EQUA 4OP0A 2JOYA 2LC4A 5LJ5d 3A8LB 2MWPA 3QIIA 4DOVA 4E7KA 2KVQG 4ZGJB 4NL2A 2PVGB 1W2BS 2RHZA 3X20B 3CC7T 2VXEA 5M9OA 1UGQB 1KD1U 2CKKA 2BUDA 4PJOE 2EQJA 3JB9G 1W2BA 3WVDB 2M0OA 4OB2B 3CPWS 4IUVA 3M53A 1M4ZA 1B34A 4M75E 2RJCA 3GPLA 1FX7A 1NPPA 3OYKA 3JCMW 3TU4K 3OBYA 1KD1C 2DIGA 1SSFA 4BY6B 2ZPHB 3CPWA 3C95A 3QBYA 3V8LA 4II1A 3RUXA 3KUFA 4C92C 1Q86U 2RI5A 1QVFS 3OQ5A 2LTOA 1HXDA 3M4GA 1M1KU 5AYFA 3OYHA 2RHIA 2RO0A 5CKBA 1QP2A 5GAMg 1QVFA 4XTUA 1Q86C 4M7DF 4MZPA 4C8QF 1KHIA 2LT4A 4R55A 3OY9A 3L2RA 1Y71A 5GAMj 4XTYA 2FL7A 4QVZA 4BE0A 1M1KC 3C94A 1B34B 2V8JA 3G71T 4OGCA 5GMKm 1W4SA 1TH7A 2HQXA 3BW1A 3C4SA 4GY5A 5CIUA 2HD0A 4IUUA 4M78G 3GIBA 4LDYA 4EMKC 2D6FA 3E9GA 3TCJA 3J81E 2DXTA 3CCSA 1KQ2A 4M7AD 3CCLA 2Y4YA 2DTHA 5CCAA 5I21A 2RI2A 3PIOA 5CKHA 1WJRA 3M56A 4M7DE 4C8QE 5GAN2 2X4WA 3ASKA 3J7AF 2O4XA 4C0GA 5D6XA 1S72T 2PUOB 4F7UA 1U1SA 3VV0A 3WVEB 2L5QA 2RHUA 1N9SA 1YITT 1VUBA 5GMKh 2WSEE 2ZPIB 1QP3A 4PKCC 4M77G 3A8MB 1VQKA 1G3TA 1OYXA 2KSSA 4M78D 4ZGDB 4XK8E 2B8AA 3T9NA 4A4HA 3NTIA 3E9FA 4XTXA 3JCMg 3CCQT 2GF7A 4J6XA 1XTDA 2XIDA 4OMFB 3M9QA 3I55T 2E70A 4HKEA 1AHJB 5GANh 4M7AC 4IURA 2VXFA 1VQ4A 2LNVA 1G3YA 4C92A 4F7UB 1N9RA 2EQKA 3P8HA 3QZ5B 3CCEA 4E7IA 2CZ0B 4RMOA 3OYYA 3OYIA 5FU7C 2QQAA 3A8HB 3V7SA 3ZFJA 2XDBA 1VQMA 3S3OA 2XU8A 4Z02A 4ZGEB 2RHYA 2E6ZA 5GAOn 3NTHA 2JVVA 3QYHB 2DD4A 3LWIA 3L2WA 3P8BB 3GOXA 5IAYA 1YHQT 2L89A 1YJ9T 4HCBA 2ZPGB 2VGNA 4MMLA 5EG2A 1UGRB 4XU2A 2YLBA 3CCUA 3JSCA 3RESA 1VQNT 5A0LA 2VC8A 4Q5WA 3CCVT 4C92B 5GAOq 3H6ZA 2JNGA 4FM4B 1P92A 1JJ2S 4CRIA 4Y28E 4ELZC 5GAN8 3BDLA 4NL3A 4PJOG 5LL6S 1YJNA 4O5VA 5IT9E 3RERA 1JJ2A 4C5EA 3UPUA 2XK0A 3CC2T 2EIFA 4LD9K 4X34A 3QZ9B 3G4SA 1VQPA 1K9MU 3M57A 4FT2A 4J7FA 5GMKl 2ZPEB 2K2VA 2FB7A 4IUQA 2HBPA 3L1AA 5A0DA 3M4YA 5LJ3d 1VQ8A 4EDUA 1K9MC 1Y07A 1ZBXA 3A8GB 3SFMA 4EMKB 2ZGWA 4DA4A 3G7ZA 4A4KA 2RH2A 4L5GA 2MWOA 2P0KA 5KCHA 2WSFE 3BDUA 1UGSB 4HA8A 1KHCA 2EAYA 1M8VA 2CZ1B 3JCMc 5C6SA 3G6EA 2RI3A 3LGLA 5FRNA 1D3BA 3X24B 5LJ5h 4XTVA 3PTAA 5GMKe 5CKFA 4HT9A 5J3BA 1WJQA 2YRVA 3MEAA 3O8VA 3KBGA 3LH0A 3LX7A 4J83A 4BUGA 1MGQA 4UC4A 3JCMX 5DLOA 2FYKA 4KT0E 3OS5A 3OYAA 2RJDA 3L2VA 1GXIE 4M75F 5GAOp 2Y4XA 1ZHIA 2A7YA 3HRTA 4M78A 4C8QG 5GMKi 4M7DG 4CI0C 1BI2A 4OB0B 5GANe 5J39A 3VU3C 2PVOB 5HK0A 2E65A 4M7AB 2PU9B 2QA4T 1YBYA 3VJPA 5CR2A 4MMKA 2DVEA 1X75C 3CBPA 4DQ2A 5FU7B 4QW2A 1UGPB 5KE2A 3HFNA 1VQLT 1Y96A 2ZZDA 3CMEA 3SD4A 1OZ2A 2E6NA 5KH6A 4C0DC 3QPHA 3RMQA 3PT9A 4M78B 4R56A 2IVWA 5LJ5j 1QVGS 2XICA 2LCLA 3CXCS 3WXMB 5DY9A 1O75A 3J80E 1QVGA 3N5BB 5GAN3 3CXCA 1U1TA 1ZQ1A 2I2LA 2JUFA 4FU6A 5GAN7 3X26B 4BI8B 1S72A 2M16A 1NJIU 1VIFA 3UDCA 1YITA 4X9CA 1OI1A 1Y96B 3HP9A 2V8KA 2QEXA 4C5GA 3ZBDA 2ZPFB 3MP6A 2MAMA 1BI3A 2NLUA 3JB9D 3MP8A 1Q7YU 1NJIC 5GAN5 4LDWA 2M9UA 3CMAT 2QXFA 2FHDA 2KY9A 3HPWA 3GF5A 3PFSA 5GAMd 2DD5A 3I55A 4BE2A 1Q7YC 2EJFA 2KAFA 3CEYA 3FJPA 3FC3A 3PMTA 4ZN1A 1I5LA 4HCCA 2CS7A 2DPPB 3QSUA 1BI1A 3QO3A 4XTZA 2QQSA 1WJSA 2X35A 3SB2A 2KDSA 4BE1A 4TVRA 4RKUE 4C92E 2XHCA 5LJ5e 4JRPA 4PJOA 3QJ6A 1M1GA 1WNLA 1XQHA 2JTFA 3OA6A 1YHQA 3JAME 3JB9I 1YJ9A 3JCMh 3V8JA 2K3XA 4QQ6A 1BYMA 2M1HA 3DKMA 4PLIA 1VQOA 1VQNA 3OMGA 2CYZB 2EFIA 1YI2T 3OYGA 5GANf 3JB9J 3QJYA 4A53A 1KC8U 2O4XB 5D6YA 2VV5A 2DTOA 1G3SA 3QDRB 3V8KA 3JCMd 3KXTA 2QQ9A 1KC8C 3F70A 4LDXA 1FXXA 2RHXA 1PSFA 1JB0E 2R5MA 5GAOm 4JS4A 4M7AF 4M77D 1VQ6T 2DTIA 5D6WA 4L6V5 4N0AA 2GFUA 4C5HA 3PGGA 2MF2A 4M78C 4PLLA 4QQGA 1I8FA 4GLKA 4J8OA 4C0DB 3JCMP 2WACA 2OTLT 3HKSA 2X4YA 2R58A 3P8DA 4MDXA 3E1SA 5GMKj 3OYDA 1NE8A 3CCRT 4OVAA 1FWZA 1RL2A 3QHSA 4XAXB 5LJ3h 4D6WA 1VQ9T 4C8QA 4RG2A 3CCST 1X01A 2K4YA 3FB9A 3L2QA 3ME9A 1H3ZA 3I56A 4JUVA 5GANg 2P0PA 3RKYA 1Q82U 3DLMA 5FRMA 1I4K1 2R57A 3QKJA 3OBWA 4M7AE 1JBMA 5GANj 2G3RA 4M75G 4KULA 4OB1B 4M77C 4FT4A 1VIEA 2RK2A 2D9TA 3H8ZA 3M59A 1VQ5T 4KUDK 1BIBA 2OTJT 5GAOr 2OAUA 2C06A 2VYTA 5I2MA 1LJOA 2VUBA 3VUZA 3OYJA 3JCMJ 2HAXA 4M78E 2QA4A 3URGA 4FL6A 3HL8A 4J7IA 1WQ7A 5KE3A 3OW2S 4PJOD 4MDWA 5IN1A 3FRNA 5FROA 3Q1JA 4MZTA 2CZ7B 1WQWA 2DKGA 3OSVA 5CKDA 2HNIA 4M75D 1DJ7B 2K3YA 5LJ5f 2LX9A 3HFOA 4OB3B 3OW2A 2JN0A 3OS0A 1VQLA 4RG8A 4BI3A 3JCMe 1KQ1A 2ZPBB 3TEEA 4QVCA 1YJWT 3OYCA 5FLXE 1IZ6A 3L2ZA 1G5VA 3CPFA 3QXEB 2QQBA 2LCCA 3HRUA 2LQ8A 3CBMA 3TREA 4P5NA 3CCUT 3VYHB 2RK1A 3VYGA 2QI2A 4LDVA 1WGSA 2RD1A 3S6WA 4PJOC 2XKOC 1D3BB 4KBMB 3OYMA 3VKIA 4M75C 3A5ZB 5GAOl 3OYFA 3G71A 4IKFA 3DB3A 3M55A 3G4ST 4F7UF 3HRSA 2PQWA 5LJ5g 1VQ7T 5CVIA 4E47A 1HK9A 1QW1A 3OYNA 4ZTFA 2X4XA 4M77A 3GP8A 3CD6T 4M7DD 3FDRA 2QQRA 3MCAB 4C8QD 3NTKA 4JRQA 3PMIA 2DK3A 4L59A 1K8AU 4NS5A 2KQWA 2DXCA 4ZN3A 2XG8D 2P0QA 5LJ3e 3UWNA 5GAMh 3CCMT 4QQDA 4E7HA 2AHJB 3LW5E 3CCJT 1X6OA 2QDYB 3LGFA 1LOJA 2DO3A 4PNOA 3OS1A 1K8AC 1PSEA 4ME7A 1QVPA 2GFAA 3GLXA 3PIPA 3EFSA 4XU0A 1G3WA 1M1FA 4N0AC 4C92F 3G6ET 4F7UE 1M9SA 3QG1A 3CC4T 2K5IA 1O9SA 4M77B 3UT1A 1YIJT 5CQXA 2DAQA 4ATOA 4C5IA 3PNWC 3CCQA 1KQSS 3JB9H 4C0ZA 5FU6C 3FIFA 2EJGA 1XNIA 1YI2A 3OYBA 4JLGA 4A4GA 4BDZA 4M7DC 3V7RA 4C8QC 3R6OA 5J26A 2K5FA 3LLRA 4QVDA 1KQSA 2E41A 3GNFB 3HHTB 1H641 2P4TA 3VUBA 4M7AG 4E7LA 2E12A 2L3RA 3OMCA 2EJ9A 1WPYA 4ELYC 4BD3A 4JLIA 4OGEA 3JCMV 2L8DA 1Y7XA 2LRQA 3DLLA 4V2SA 4LD6A 1VQ6A 2DJZA 3M58A 4BI4A 2CGHA 3JCMf 4M75A 4N4GA 2OTLA 5CKEA 4HCZA 2LT1A 3OYLA 3CMET 4EMGA 2XD0A 3CCRA 2E64A 3E19A 1OZ3A 4B9XA 4LDUA 3CCVA 3JRZA 1VQ9A 3CBOA 3JB9F 2RJEA 3S3MA 4JDSA 4KUIA 3FEOA 4IUTA 1V29B 3V7CA 4XTWA 3RMSA 5HK3A 2E1HA 4PJOB 2HQEA 3CC2A 1LNXA 3MEUA 3NFCA 3OS2A 2D0QB 4M75B 3SWNC 2KMTA 3A8OB 3MEVA 4XU3A 1VQ5A 2QEXT 4FIBA 4J6YA 2BKDN 2PVDB 2PUKB 4PL6A 1BKBA 1M90U 2OTJA 1IREB 2F5KA 5DLQE 3OYEA 2DXBA 3JCMQ 3M5AA 4OF1A 5DM7R 4RCBA 3META 2V8IA 4XU1A 1M90C 5LJ3f 4C0FA 5GAMe 4M7DA 2XI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HNI A;  4M75 D;  5LJ5 f;  3HFO A;  4M78 F;  2JN0 A;  2DXT A;  1KQ2 A;  4M78 B;  4M7A D;  2DTH A;  5I21 A;  5LJ5 j;  3JCM e;  1KQ1 A;  2Y90 A;  4QVC A;  4M7D E;  1I81 A;  5DY9 A;  4C8Q E;  5GAN 2;  3L2Z A;  4F7U A;  5GAN 6;  5GAN 3;  1U1S A;  3EFR A;  3INZ A;  1U1T A;  2I2L A;  5GAN 7;  3HSB A;  1N9S A;  5GMK h;  1M5Q 1;  5GAN d;  4JRK A;  4NOY A;  4M77 G;  1Y96 A;  4J5Y A;  4X9C A;  4M7D B;  4J6W A;  2RD1 A;  1Y96 B;  4M78 D;  3RIR A;  4C8Q B;  4M7D A;  4PJO C;  2RM4 A;  3JB9 D;  1D3B B;  4M77 F;  3RKX A;  4Y91 A;  4XTX A;  3QUI A;  3JCM g;  4EMK A;  5CAI A;  4J6X A;  5GAN 5;  4M75 C;  4X9D A;  5GAO l;  4F7U G;  5GAN 4;  5GAN h;  5LJ3 g;  5GAM d;  4M7A C;  2VXF A;  3BY7 A;  4F7U F;  2EJF A;  5LJ5 g;  3FJP A;  3AHU A;  4C92 A;  1HK9 A;  4XQ3 A;  4F7U B;  1N9R A;  5LJ3 j;  1I5L A;  4M77 A;  3JCM b;  3RKW A;  4M7D D;  3QSU A;  3QO3 A;  1JRI A;  4XTZ A;  4C8Q D;  4WF2 A;  3SWN A;  3V7S A;  3SB2 A;  5LJ3 e;  5GAM h;  4C92 E;  4M77 E;  5LJ5 e;  5GAO n;  4PJO A;  2DZ9 A;  2EWN A;  4PNO A;  1LOJ A;  1WNL A;  4C92 G;  4MML A;  3JB9 I;  2YLC A;  4XU2 A;  3JCM h;  2YLB A;  3RES A;  4A54 A;  3EFS A;  4XU0 A;  2VC8 A;  4N0A C;  3V8J A;  3BFM A;  4C92 F;  2K57 A;  4F7U E;  4M7A A;  4C92 B;  5GAO q;  4EMH A;  2DEQ A;  4HT8 A;  4M77 B;  2E10 A;  5GAN 8;  5GAN f;  4JRI A;  4PJO G;  3FIF A;  2EJG A;  3SWN B;  2QTX A;  4A53 A;  4NL3 A;  3JB9 J;  3RER A;  4M7D C;  2DXU A;  3V7R A;  4C8Q C;  1BIA A;  4QVD A;  4PJO F;  2DTO A;  2RB6 A;  2E41 A;  3V8K A;  1H64 1;  2DZC A;  4RCC A;  5GMK l;  3JCM d;  4M7A G;  1YCY A;  2FB7 A;  4C92 D;  2YHT A;  2RA2 A;  3L1A A;  5GAO m;  2EJ9 A;  5GAM f;  4M77 D;  1WPY A;  5LJ3 d;  4M7A F;  2DTI A;  4JLI A;  4OP0 A;  3JCM V;  4N0A A;  4EMK B;  5LJ5 d;  4V2S A;  3PGG A;  2ZGW A;  4M78 C;  1I8F A;  2DJZ A;  3JCM P;  2CGH A;  4NL2 A;  3JCM f;  4M75 A;  5GMK j;  3BDU A;  2VXE A;  4HA8 A;  2EAY A;  1M8V A;  3QHS A;  4EMG A;  5LJ3 h;  3JCM c;  3JB9 G;  3JB9 H;  4C8Q A;  4PJO E;  2E64 A;  1X01 A;  3FB9 A;  1D3B A;  5LJ5 h;  4XTV A;  1B34 A;  5GMK e;  3JB9 F;  4M75 E;  4JUV A;  4HT9 A;  5GAN g;  3JCM W;  3RKY A;  1MGQ A;  1I4K 1;  4M7A E;  3V8L A;  1JBM A;  3V7C A;  4XTW A;  2FYK A;  4M75 G;  3RUX A;  4C92 C;  3JCM X;  5GAN j;  2E1H A;  4PJO B;  4M77 C;  1LNX A;  4M75 F;  5GAO p;  4M7D G;  1HXD A;  3M4G A;  4M78 A;  4M75 B;  4C8Q G;  3SWN C;  5GMK i;  1BIB A;  5GAN e;  4XU3 A;  5GAO r;  5GAM g;  4M7D F;  4XTU A;  3VU3 C;  2E65 A;  4J6Y A;  4M7A B;  4C8Q F;  1LJO A;  5GAM j;  4XTY A;  3JCM J;  1B34 B;  4M78 E;  3JCM Q;  4MMK A;  5GMK m;  3BW1 A;  1TH7 A;  2DVE A;  4RCB A;  1WQ7 A;  4DQ2 A;  4PJO D;  4XU1 A;  4M78 G;  5LJ3 f;  5GAM e;  3GIB A;  3HFN A;  1WQW A;  2DKG A;  4EMK C; 
#chains in the Genus database with same CATH topology
 2JJ9 A;  1D1A A;  3CCL T;  2DL7 A;  1NZ9 A;  4E7J A;  3QYG B;  1PKT A;  1R0C B;  4BAC A;  2PTK A;  1I81 A;  3C0C A;  2EKO A;  3X28 B;  3ULR B;  1VQK T;  1MMN A;  4DBF A;  4D8D A;  1TUG B;  4M7D B;  1VQO T;  4C8Q B;  3S3N A;  2KK4 A;  1TUC A;  4B6M A;  3C12 A;  3CCL Q;  1OU9 A;  2DMO A;  1D09 B;  5GAN 4;  1K73 U;  4N4H A;  5IHK A;  3AHU A;  5LJ3 j;  4RUG A;  5CK9 A;  1K73 C;  2NUT A;  1JRI A;  1Q86 R;  1VQM T;  4WF2 A;  5A0G A;  3CD6 A;  2MIO A;  1VQK Q;  3OSS C;  2A36 A;  2LVM A;  1VQO Q;  5CO7 A;  4B9W A;  2YUN A;  4DOW A;  2YLC A;  1XOV A;  4YTL A;  5KCO A;  2VGM A;  3BFM A;  4FSX A;  2K57 A;  2WSC E;  1AZE A;  1TS9 A;  4JRI A;  3SWN B;  2DNU A;  3MHX A;  3L2U A;  4PJO F;  2RB6 A;  1EIF A;  4JJB A;  4PJJ A;  3GNG A;  2Z0W A;  2P84 A;  2RA2 A;  2LC4 A;  1HYO A;  3A8L B;  2LX7 A;  1W2B S;  3X20 B;  1TUD A;  2VXE A;  4OMM A;  1KD1 U;  2BUD A;  4OB2 B;  1QCN A;  1NPP A;  2CP2 A;  3TU4 K;  2P4R A;  3OBY A;  1KD1 C;  2J05 A;  4II1 A;  3KUF A;  1AT1 B;  2RI5 A;  1D1B A;  4CC2 A;  1M1K U;  5AYF A;  2RO0 A;  1QP2 A;  5GAM g;  1M2O A;  4XTU A;  4M7D F;  4C8Q F;  1WXU A;  2LT4 A;  3OY9 A;  2V1R A;  1M1K C;  1B34 B;  1UUE A;  2V8J A;  3TSW A;  1W4S A;  3BW1 A;  1E6H A;  2J7I A;  3C4S A;  3SHW A;  4LDY A;  4EMK C;  2A0F B;  2DXT A;  5CCA A;  5I21 A;  1KIK A;  1K9M R;  1WJR A;  1WHJ A;  3M56 A;  2C0O A;  3ASK A;  4Z88 A;  2F1L A;  2AZS A;  3VV0 A;  4AFU C;  2RHU A;  1QP3 A;  4PKC C;  2FPF A;  4M77 G;  3A8M B;  1G3T A;  3PE0 A;  4ZGD B;  4A4H A;  1B7T A;  3CCQ T;  4J6X A;  4D8K A;  2E70 A;  5GAN h;  4M7A C;  1PG5 B;  2AKL A;  2DFU A;  1N9R A;  2EQK A;  2CZ0 B;  1RI9 A;  4J9G A;  3OYI A;  2QQA A;  9ATC B;  3V7S A;  3ZFJ A;  4ZGE B;  2DD4 A;  1BBZ A;  3P8B B;  1YJ9 T;  2FPD A;  2RQV A;  2ZPG B;  3CCQ Q;  1UGR B;  1YI2 Q;  3I5R A;  2VC8 A;  5GAO q;  1HJD A;  5KYW B;  2E5K A;  3HTR A;  4Y28 E;  5GAN 8;  1YJN A;  1PC0 A;  1ZSG A;  5IT9 E;  3REA B;  2MOX A;  2XK0 A;  4E2F B;  4X34 A;  2CSI A;  4IUQ A;  5A0D A;  2BZX A;  1VQ8 A;  3KFV A;  1TSF A;  1ZBX A;  2JMA A;  4L5G A;  1T3S A;  3BDU A;  4HA8 A;  1KHC A;  2RI3 A;  1SHF A;  1D3B A;  5CKF A;  5J3B A;  1AWO A;  3O8V A;  3KBG A;  1M8M A;  1MGQ A;  5DLO A;  2FYK A;  2KE9 A;  2CH4 A;  4LUD A;  1SF9 A;  2RQT A;  4OB0 B;  3VU3 C;  2PVO B;  5HK0 A;  1RAB B;  2E65 A;  2EGC A;  3EG3 A;  2KYB A;  2QA4 T;  1YBY A;  3VJP A;  5CR2 A;  1N5Z A;  2D8H A;  4E6R A;  3HFN A;  1SHG A;  1OZ2 A;  1U06 A;  3RBB B;  4PFZ A;  4DEY A;  2KNB B;  5LJ5 j;  3EG9 B;  2CSQ A;  3WXM B;  3J80 E;  1QVG A;  4FCY A;  5GAN 3;  2QA4 Q;  2I2L A;  2JUF A;  4FU6 A;  1S72 A;  1NJI U;  4BI8 B;  1VIF A;  1YIT A;  1SRL A;  4C5G A;  2CP6 A;  2FZK B;  1Q7Y U;  1NJI C;  1WXB A;  4IIM A;  4LDW A;  2M9U A;  2QXF A;  2YWW A;  4BE2 A;  1Q7Y C;  3CEY A;  3FC3 A;  5AT1 B;  4ZN1 A;  1I5L A;  1BI1 A;  3QO3 A;  2QQS A;  1G8X A;  1WJS A;  3SB2 A;  4BE1 A;  2KDS A;  2KRN A;  4RKU E;  2XHC A;  4PJO A;  5IHI A;  2LNH B;  1JQQ A;  1VQO A;  2COY A;  2EYY A;  3JB9 J;  1BCM A;  1OX8 A;  2O4X B;  2DTO A;  2QQ9 A;  1FXX A;  2RHX A;  4M77 D;  2DTI A;  5D6W A;  1M3A A;  4C5H A;  4M78 C;  1R0B G;  4QQG A;  2OTL T;  2WAC A;  3HKS A;  2R58 A;  4AT1 B;  3E1S A;  3OYD A;  1YN8 A;  3CCR T;  1RL2 A;  1ABO A;  4HXJ A;  4C8Q A;  3CCS T;  3ME9 A;  1QLY A;  1Q95 G;  2COZ A;  1JBM A;  5GAN j;  2G3R A;  4M75 G;  4FT4 A;  4AFZ C;  2KR3 A;  1VIE A;  2RK2 A;  2D9T A;  1VQ5 T;  2DET A;  5GJW B;  2DF6 A;  1PM3 A;  2CT3 A;  3CCR Q;  2RQR A;  3VUZ A;  2HAX A;  3URG A;  3CCS Q;  2KXC A;  4AG1 C;  2J06 A;  2OAW A;  2NUP B;  2AIR B;  5FRO A;  2CZ7 B;  3CCE T;  3JCM e;  2ZPB B;  1WDX A;  1VQ5 Q;  4QVC A;  2JM9 A;  3CCU T;  3EHR A;  4OMP A;  4LDV A;  1WGS A;  1GFC A;  3OYM A;  3CCE Q;  2F2W A;  3EGX B;  4Z8A A;  2EBP A;  2ROL A;  5LJ5 g;  4E47 A;  3OYN A;  1HK9 A;  3NHN A;  2VKN A;  4ZTF A;  2X4X A;  2FO0 A;  4ZNX A;  1RUW A;  4FYW B;  1EX4 A;  3GP8 A;  3CD6 T;  1GFD A;  3FDR A;  2QQR A;  3MCA B;  3VS7 A;  2DK3 A;  4NS5 A;  3CCU Q;  2XG8 D;  2P0Q A;  4RTW A;  5GAM h;  2DJQ A;  3LW5 E;  1M30 A;  1LOJ A;  3OS1 A;  1NYF A;  3RR6 A;  1M90 R;  4ME7 A;  2GFA A;  3GLX A;  1WZO A;  2K5I A;  4M77 B;  2C0T A;  4ATO A;  4C5I A;  3CCQ A;  2NWM A;  4C0Z A;  5FU6 C;  1BU1 A;  3CD6 Q;  1YI2 A;  4A4G A;  3UAT A;  3V7R A;  5KYY B;  3NMZ C;  2DL5 A;  3GNF B;  2P4T A;  2YUO A;  4E7L A;  3OMC A;  5KYN A;  1OUL A;  1WPY A;  1YNZ A;  1IO6 A;  4JLI A;  3DLL A;  4V2S A;  3OW2 P;  1IHV A;  3JCM f;  1MV0 B;  4J9E A;  2LT1 A;  1M3C A;  3CME T;  1ZBJ A;  2MCN A;  3I5S A;  1VQ9 A;  1PRM C;  3V7C A;  1Q81 R;  2HQE A;  5GJV B;  3MKD A;  1ZLM A;  1JO8 A;  2KMT A;  4DEX A;  3EG0 A;  2PVD B;  1AOJ A;  3CME Q;  2HL5 C;  4OF1 A;  2HDA A;  1V76 A;  2RQU A;  2K3B A;  4GBQ A;  1K4U S;  3NPF A;  1GCQ C;  3VS5 A;  1MHN A;  1LCK A;  2OJ2 A;  3SDZ A;  2YDL A;  3INZ A;  1Q82 C;  4WTO B;  4O6J A;  1PD0 A;  4J6W A;  3I55 Q;  1KQS P;  2RM4 A;  4M77 F;  3VS4 A;  3RKX A;  4A4E A;  4Y91 A;  3LWH A;  4EIK A;  5EC7 A;  5ECA A;  3LYI A;  2XMF A;  3M0Q A;  1N6A A;  2FVU A;  2E5Q A;  4XQ3 A;  2X9H A;  1NPR A;  3RKW A;  4QKU A;  2LJ0 A;  2RJF A;  4VUB A;  2DZ9 A;  1D0X A;  3EG1 A;  4EPC A;  2EQM A;  2KT1 A;  2LDM A;  4A54 A;  3M0U A;  1LVK A;  2IG0 A;  2BZY A;  3I56 T;  2DEQ A;  4FSS A;  1YJN T;  1RAC B;  3TSZ A;  4AMC A;  2K5L A;  1IGU A;  5HY6 A;  4CC4 B;  2MMP A;  2DYI A;  1IHW A;  2DXU A;  2JTM A;  2ZCF B;  2DZC A;  1VQ8 T;  2CH4 W;  2YHT A;  4C92 D;  2GTO A;  2OX7 A;  2MYS A;  1SEM A;  2M51 A;  4DOV A;  3I56 Q;  1YJN Q;  2VAS A;  1OU8 A;  1AZG B;  2K7A A;  1ABQ A;  4PJM A;  4PJO E;  2CUB A;  3JB9 G;  1IXD A;  2K79 A;  4IUV A;  3M53 A;  1M4Z A;  4M75 E;  3GPL A;  1T3L A;  3JCM W;  3OYK A;  2FRY A;  2I0N A;  3CPW A;  2RNA A;  4BY6 B;  1VQ8 Q;  3MPU B;  3QBY A;  3V8L A;  1HXD A;  3M4G A;  1AWX A;  2FEI A;  1QVF A;  2JM8 A;  1Y71 A;  5GAM j;  2FL7 A;  4BE0 A;  2KGT A;  1VQL Q;  5GMK m;  3TQ7 P;  1K76 A;  2DL4 A;  2HD0 A;  4IUU A;  2RN8 A;  4LN2 A;  2V1Q A;  2D6F A;  4Z89 A;  3E9G A;  2KXD A;  3CCS A;  4M7D E;  4C8Q E;  3J7A F;  2O4X A;  4OMO A;  5D6X A;  1S72 T;  4RTT A;  2YSQ A;  1N9S A;  1YIT T;  5GMK h;  2WSE E;  1SKU B;  2GGR A;  1UDL A;  2YT6 A;  1IB8 A;  1RAI B;  4M78 D;  2SRC A;  3T9N A;  3EFO B;  1FMK A;  4XTX A;  2XID A;  4OMF B;  1Y57 A;  3EHQ A;  4JJD A;  1AHJ B;  2YRD A;  3H0I A;  2LQW A;  1VQ4 A;  3BE3 A;  2LNV A;  4F7U B;  2HKQ B;  3P8H A;  3CCE A;  2CDT A;  1S72 Q;  1RAF B;  2YUP A;  4M4Z A;  5FU7 C;  3A8H B;  1YIT Q;  2QG9 B;  2XU8 A;  4J9I A;  5GAO n;  3LWI A;  3GOX A;  3QYH B;  5IAY A;  2CP7 A;  1C1A A;  2ED1 A;  2RQW A;  3CCU A;  3JSC A;  2EW3 A;  1K0X A;  4C92 B;  3H6Z A;  4CRI A;  3BDL A;  4O5V A;  1JJ2 A;  4C5E A;  1NEB A;  2EIF A;  4LD9 K;  3QZ9 B;  2IIM A;  1VQ6 Q;  4J7F A;  5GMK l;  1ZSZ B;  2M02 A;  2ZPE B;  3QWY A;  3L1A A;  3THK A;  5LJ3 d;  3FJ5 A;  2ZGW A;  7AT1 B;  3G7Z A;  4A4K A;  1JEG A;  1UGS B;  1U5S A;  2EAY A;  2CZ1 B;  3JCM c;  5FRN A;  1MUZ A;  3LGL A;  1TWB A;  5LJ5 h;  4JJC A;  2JXB A;  2YRV A;  4CC3 A;  4BUG A;  3EGX A;  2GBQ A;  4UC4 A;  5IHN A;  1AVZ C;  2RJD A;  3L2V A;  4M75 F;  1ZHI A;  1RAD B;  2HSP A;  1OEB A;  4WCI A;  1QCF A;  1WHL A;  4IIO A;  5KE2 A;  1Y96 A;  3I35 A;  2ZZD A;  3CME A;  3SD4 A;  3QPH A;  3PT9 A;  4M78 B;  2LCL A;  4ORZ A;  1T0H A;  2AZV A;  5KYY A;  3N5B B;  3CXC A;  3UDC A;  1JXO A;  1FMW A;  1OI1 A;  2CP5 A;  3JB9 D;  2ZPF B;  2NLU A;  1VQ7 Q;  2KY9 A;  3HPW A;  3PFS A;  2O31 A;  3I55 A;  2EJF A;  2KAF A;  1W70 A;  1Q82 R;  1H3H A;  4HCC A;  2DPP B;  4XTZ A;  4PJN A;  1GL5 A;  2X35 A;  1NM7 A;  4J9C A;  3QJ6 A;  2HBW A;  3OA6 A;  3JB9 I;  2M1H A;  3DKM A;  4PLI A;  2JT4 A;  1VQN A;  2KI7 A;  2CYZ B;  1YI2 T;  3OYG A;  3QJY A;  1WHK A;  1KC8 U;  5D6Y A;  3V8K A;  5IXF A;  3JCM d;  3KXT A;  1KC8 C;  4JS4 A;  1JB0 E;  1UJ0 A;  2AK5 A;  4N0A A;  2GFU A;  4PLL A;  4C0D B;  3JCM P;  4GLK A;  4LXC A;  5GMK j;  1I5O B;  4OVA A;  1VQ9 T;  4D6W A;  1QVG P;  1X01 A;  2K4Y A;  4DBH A;  3L2Q A;  1H3Z A;  3I56 A;  1TU0 B;  3RKY A;  3DLM A;  2A37 A;  1I4K 1;  1WXT A;  3QKJ A;  3OBW A;  1K9A A;  2D8J A;  5I22 A;  1K8A R;  1FYN A;  1IGQ A;  3H8Z A;  2G6F X;  2VYT A;  5I2M A;  1CKB A;  1LJO A;  2VUB A;  2O2O A;  1VQ9 Q;  4FL6 A;  4HVV A;  4AFS C;  4FYY B;  4K11 A;  3OW2 S;  4E7Z A;  4MDW A;  1WQW A;  1J3T A;  2K3Y A;  3HFO A;  4OB3 B;  2LJ1 A;  2JN0 A;  1VQL A;  4BI3 A;  1KQ1 A;  3OYC A;  3LH5 A;  1WFW A;  2QQB A;  2LQ8 A;  2LZ6 B;  3TRE A;  1VOM A;  3VYH B;  2RK1 A;  3VYG A;  2QI2 A;  3EGD B;  3TVT A;  2HEQ A;  3S6W A;  1R77 A;  4PJO C;  2ESW A;  1QKX A;  4KBM B;  3VKI A;  4M75 C;  3A5Z B;  4IKF A;  2RMO A;  1I0C A;  5CVI A;  1F1B B;  4J9D A;  5I11 A;  1G2B A;  1UFF A;  3PMI A;  5LJ3 e;  1V1C A;  2L3Q A;  1X6O A;  3LGF A;  4PNO A;  1QVP A;  3PIP A;  3G6E T;  1M1F A;  5CQX A;  2X3W D;  3PNW C;  1KQS S;  3JB9 H;  5FWC A;  1OV3 A;  4M7D C;  1WHH A;  4C8Q C;  5J26 A;  4RTY A;  4M7A G;  1NYG A;  3O5Z A;  4OGE A;  3EGU A;  3JCM V;  2LRQ A;  1SRM A;  3G6E Q;  1VQ6 A;  2JTE A;  3M58 A;  4M75 A;  4HCZ A;  3OYL A;  4EMG A;  4B9X A;  3E19 A;  1K73 R;  4LDU A;  3JRZ A;  3JB9 F;  2EYX A;  2EKH A;  1ZUY A;  4F14 A;  1X69 A;  3MEU A;  3NFC A;  2D0Q B;  3SWN C;  2EGE A;  3A8O B;  1ZUK A;  2BKD N;  2OTJ A;  1IRE B;  1M2V B;  1MMA A;  1PD1 A;  2DXB A;  1VYV A;  2V8I A;  5LJ3 f;  4M7D A;  2F69 A;  2MK5 A;  2L3S A;  1RAH B;  2XDP A;  5A2Q E;  2C0I A;  2Y90 A;  3MEW A;  2BIV A;  2R5A A;  3FLG A;  1UG1 A;  5GAN 6;  3EFR A;  1D0Z A;  1M5Q 1;  1ZSZ A;  5GAN d;  4JRK A;  4NOY A;  4FYX B;  4J5Y A;  4HCK A;  4BDY A;  4MZM A;  1U3O A;  5CAI A;  2XDD A;  1KD1 R;  4A4F A;  4X9D A;  3VS3 A;  2K2M A;  4F7U G;  1VQ4 T;  1NEG A;  3R6N A;  3ZEH A;  2F5T X;  1JXM A;  1R8O B;  1VQ7 A;  1YHQ Q;  3SWN A;  4DBQ A;  1D1C A;  1UHF A;  2LQK A;  2X4J A;  4PK4 A;  1M1K R;  1UHC A;  1N8R U;  2MI6 A;  4M77 E;  4C92 G;  3CCJ A;  2CZ6 B;  2LMJ A;  1N8R C;  1VQ4 Q;  3VS6 A;  4HT8 A;  3MO8 A;  1U8R A;  3OB9 A;  1PHT A;  4ZTJ A;  2E10 A;  2NUT B;  1YIJ A;  1OX9 A;  5CQY A;  2QTX A;  3DB4 A;  1BIA A;  1M27 C;  3MP1 A;  1C0M A;  3IQL A;  1I07 A;  4RCC A;  2KBT A;  1UGV A;  1YCY A;  2DRK A;  4OP0 A;  2JOY A;  5KYU B;  2MWP A;  3QII A;  2KVQ G;  4CC7 A;  4ZGJ B;  5M9O A;  2CKK A;  4DBR A;  1W2B A;  3WVD B;  2O9V A;  1B34 A;  2RJC A;  1Q86 U;  1KK7 A;  2HMA A;  2LTO A;  5CKB A;  1Q86 C;  2DX1 A;  4MZP A;  4R55 A;  3L2R A;  2GQI A;  4XTY A;  4QVZ A;  5IXB A;  4AFQ C;  2COW A;  3G71 T;  4LNP A;  4OGC A;  1UE9 A;  2HSE B;  4GY5 A;  2IPO B;  4M78 G;  2VVK A;  3H9N A;  4M7A D;  2Y4Y A;  1EZZ B;  2HKN A;  2RI2 A;  5CKH A;  2QGF B;  5GAN 2;  4C0G A;  2PUO B;  1PNJ A;  1U1S A;  1MND A;  2L5Q A;  1VUB A;  3EH1 A;  2ZPI B;  3G71 Q;  1X2K A;  1OYX A;  2KSS A;  2QGG A;  2H3E B;  3NTI A;  3M9Q A;  3I55 T;  1G3Y A;  2JS2 A;  5KYW A;  1AEY A;  4RMO A;  3S3O A;  2RHY A;  3L2W A;  2E4H A;  2L89 A;  4OML A;  4HCB A;  2VGN A;  4MML A;  5EG2 A;  4XU2 A;  3CPW P;  1VQN T;  4KH1 B;  5A0L A;  4Q5W A;  5L23 A;  3CCV T;  2FZC B;  2KRM A;  2EYZ A;  3RER A;  1QVF P;  4PFP A;  2EVR A;  3CC2 T;  2PZ1 A;  2ROT A;  1VQP A;  1K9M U;  3M57 A;  4FT2 A;  2K2V A;  2KEA A;  3M4Y A;  4EDU A;  1NJI R;  1K9M C;  2LQN A;  1VQN Q;  4EMK B;  4DA4 A;  3SFM A;  4E7S A;  3M0S A;  3CCV Q;  1KJW A;  2MWO A;  1IRX A;  2WSF E;  1Q7Y R;  1M8V A;  3EGD A;  5C6S A;  3G6E A;  4OMQ A;  3CC2 Q;  1UJY A;  3PTA A;  4HT9 A;  2VB6 A;  3MEA A;  3LX7 A;  3LH0 A;  4J83 A;  4F17 A;  1GXI E;  4J9F A;  5GAO p;  2Y4X A;  2A7Y A;  3HRT A;  2A28 A;  4CI0 C;  1BI2 A;  5GAN e;  1KSW A;  3EG9 A;  5J39 A;  2DRM A;  4M7A B;  1RLQ C;  4MMK A;  2DVE A;  1X75 C;  4QW2 A;  1OPL A;  2DEU A;  1VQL T;  2DYB A;  3CQT A;  2EGA A;  3VRZ A;  2E6N A;  3D7S B;  5KH6 A;  1YJW Q;  3RMQ A;  4FW2 A;  2IVW A;  1QVG S;  3H0H A;  1LPL A;  1GRI A;  1O75 A;  1QWF A;  4J9H A;  3UA7 A;  4PJL A;  1WYX A;  1U1T A;  1ZQ1 A;  5GAN 7;  1VYT A;  4JZ3 A;  3X26 B;  2FRW A;  1TXQ A;  1JJ2 P;  3HP9 A;  2V8K A;  3ZBD A;  3MP6 A;  2MAM A;  1NG2 A;  3CMA T;  2FHD A;  5GAM d;  2DD5 A;  2D0N A;  3CCM Q;  3EG2 A;  1GCP A;  4LUE A;  1X6G A;  2DL8 A;  4C92 E;  1ACM B;  3G1J A;  4JRP A;  1WNL A;  2HZY A;  1YHQ A;  3JCM h;  3CMA Q;  4QQ6 A;  2BZ8 A;  1M2V A;  2EFI A;  5GAN f;  2DM1 A;  1BK2 A;  2VWF A;  1G3S A;  3QDR B;  2R5M A;  5GAO m;  4M7A F;  1VQ6 T;  1VYU A;  4J8O A;  1AD5 A;  2SEM A;  1NE8 A;  2QAZ A;  1FWZ A;  1YFN A;  2O88 A;  3QHS A;  4XAX B;  4RG2 A;  1ARK A;  3FB9 A;  3A98 A;  2K9G A;  3CXC P;  4JUV A;  2R57 A;  2NUP A;  3NGP A;  4OB1 B;  4M77 C;  2L0A A;  4J9B A;  4KUD K;  2V26 A;  5GAO r;  2OTJ T;  2OAU A;  2C06 A;  2J6O A;  3JCM J;  4M78 E;  2CT4 A;  5KE3 A;  5IN1 A;  3Q1J A;  2DKG A;  5CKD A;  2HNI A;  2LX9 A;  1A0N B;  3OS0 A;  3RNJ A;  3TEE A;  1HD3 A;  1RAE B;  2OTJ Q;  1KFZ A;  1G5V A;  3CPF A;  1AWJ A;  2LCC A;  3CBM A;  4P5N A;  1Y0M A;  2XKO C;  1YP5 A;  5KYU A;  5GAO l;  3G71 A;  3DB3 A;  3G4S T;  4F7U F;  3HRS A;  1VQM Q;  1CKA A;  1VQ7 T;  4M77 A;  4L59 A;  1NLP C;  2KQW A;  2DXC A;  3UWN A;  4E7H A;  2AHJ B;  2DVJ A;  3CCJ T;  3VRY A;  2DO3 A;  1JU5 C;  1PSE A;  4HVW A;  3EFS A;  4XU0 A;  1G3W A;  4C92 F;  4N0A C;  3G4S Q;  3UT1 A;  1YIJ T;  3M0T A;  2DAQ A;  8ATC B;  2BTT A;  2GNC A;  2EJG A;  2K5F A;  3LLR A;  5KYX B;  2H8H A;  3HHT B;  3VUB A;  3CCJ Q;  2E12 A;  2L3R A;  4ELY C;  4BD3 A;  2ABL A;  2CGH A;  5D7U A;  1YIJ Q;  5CKE A;  1GBQ A;  1Z9Q A;  1OZ3 A;  3CCV A;  1X6B A;  4KUI A;  1X43 A;  1W6X A;  3FEO A;  1C6V X;  4XTW A;  3RMS A;  4LE9 A;  3CC2 A;  1QQJ A;  2CUD A;  4ESR A;  1H92 A;  4XU3 A;  2QEX T;  4FIB A;  1RAA B;  1OQK A;  2DIL A;  1M90 U;  2F5K A;  1TOV A;  3M5A A;  5DM7 R;  4RCB A;  3MET A;  1M90 C;  5GAM e;  4F04 B;  5HCK A;  1FMV A;  4M78 F;  3M54 A;  4IUP A;  2A3L A;  1UEB A;  1WA7 A;  2GQV A;  3EAE A;  2YUQ A;  2QEX Q;  1YJW A;  4PFO A;  1UTI A;  2H3J A;  3HSB A;  2GCX A;  1X27 A;  4BY6 C;  5FU6 B;  3RIR A;  1VA7 A;  2DIQ A;  4EMK A;  1RI0 A;  3QUI A;  3X25 B;  5L8R E;  2O9S A;  5LJ3 g;  4X1V A;  2K6D A;  3VS2 A;  3BY7 A;  4FW1 A;  5C0M A;  4BB7 A;  4OMN A;  3JCM b;  4RTX A;  4N4I A;  5FWB A;  1Q81 U;  2BE9 B;  4JS5 A;  1UEC A;  1YJ9 Q;  1ZA2 B;  3ER0 A;  2O01 E;  5I2S A;  2EYW A;  5HKC A;  2JZ2 A;  3CCM A;  1Q81 C;  2EWN A;  4KGV B;  3L42 A;  3RDV A;  2LP5 A;  1K0S A;  1CSK A;  4M7A A;  1QWE A;  4EMH A;  1NBE B;  4QT7 A;  3CC4 A;  1N27 A;  6AT1 B;  3CMA A;  1B07 A;  1VQP T;  4JJN K;  1BI0 A;  3AT1 B;  1TTH B;  2EQI A;  1UB4 A;  2EYQ A;  2MPX C;  5GAM f;  1W1F A;  2EQU A;  3PVQ A;  3I9Q A;  5LJ5 d;  1SG5 A;  2DLP A;  4E7K A;  4NL2 A;  2PVG B;  2RHZ A;  3CC7 T;  1PRL C;  1UGQ B;  1MMG A;  2EQJ A;  1VQP Q;  2M0O A;  3CPW S;  2ECZ A;  1FX7 A;  1Z9Z A;  2DIG A;  1SSF A;  2ZPH B;  1YWO A;  3C95 A;  3QWX X;  3RUX A;  4C92 C;  2ENM A;  1QVF S;  3OQ5 A;  3ZL7 C;  3OYH A;  2RHI A;  3CC7 Q;  1KHI A;  3H41 A;  3REB B;  3C94 A;  2DBM A;  1ZSZ C;  1TH7 A;  2HQX A;  3UA6 A;  5CIU A;  2D1X A;  2ED0 A;  3GIB A;  3EFO A;  3TCJ A;  3J81 E;  2QAS A;  1KQ2 A;  3CCL A;  2DTH A;  3PIO A;  2M0Y A;  1WX6 A;  2X4W A;  4F7U A;  3U23 A;  3WVE B;  1QMC A;  1WI7 A;  1H8K A;  2DA9 A;  1EFN A;  2CP3 A;  1OPK A;  1VQK A;  1B3Q A;  1QCO A;  3SEM A;  4XK8 E;  2B8A A;  3E9F A;  3JCM g;  2GF7 A;  1XTD A;  4HKE A;  2CP0 A;  4IUR A;  2VXF A;  3M0R A;  1SSH A;  3H0F A;  4C92 A;  3QZ5 B;  4E7I A;  1ZX6 A;  3OYY A;  4RTV A;  2XDB A;  1VQM A;  4Z02 A;  1TG0 A;  1W2B P;  2E6Z A;  3NTH A;  2JVV A;  1YHQ T;  4Y92 A;  1ZA1 B;  2YLB A;  4A63 B;  3RES A;  3E2U A;  3GBQ A;  2JNG A;  4FM4 B;  1P92 A;  1JJ2 S;  4ELZ C;  4NL3 A;  4PJO G;  1WHM A;  5LL6 S;  3UPU A;  2YXY A;  3G4S A;  2YRC A;  2QTV A;  2FB7 A;  2HBP A;  2OTL Q;  1SPK A;  1I1J A;  1Y07 A;  3A8G B;  2PNI A;  2RH2 A;  2P0K A;  5KCH A;  3EH2 A;  2GTJ A;  3VS1 A;  3X24 B;  2LCS A;  4XTV A;  5GMK e;  1WJQ A;  1QKW A;  2JW4 A;  4RTZ A;  3JCM X;  4KT0 E;  3OS5 A;  3OYA A;  2OI3 A;  1PCX A;  4M7D G;  4M78 A;  5GMK i;  4C8Q G;  2HCK A;  2PU9 B;  1PWT A;  2NYS A;  3CBP A;  4DQ2 A;  5FU7 B;  4JPB W;  1UGP B;  2FPE A;  4C0D C;  1KC8 R;  4R56 A;  2J6F A;  2HL3 A;  2XIC A;  1MMD A;  3CXC S;  2KT8 A;  5DY9 A;  1OOT A;  5KYX A;  1E7O A;  4HVU A;  2KYM A;  2M16 A;  4X9C A;  1Y96 B;  2QEX A;  4FYV B;  1BI3 A;  3MP8 A;  5GAN 5;  1NLO C;  1D0Y A;  3GF5 A;  3MJX A;  1M3B A;  3FJP A;  1YCS B;  3PMT A;  2CS7 A;  3QDF A;  3QSU A;  4TVR A;  2DL3 A;  4ANJ A;  3M0P A;  5LJ5 e;  1M1G A;  1XQH A;  2B86 A;  2JTF A;  3JAM E;  1YJ9 A;  4KGZ B;  3V8J A;  2K3X A;  1BYM A;  2X3X D;  2KRS A;  3OMG A;  2RPN A;  4A53 A;  1T0J A;  2VV5 A;  4F16 A;  2QK0 A;  1WLP B;  1YWP A;  4LDX A;  2DBK A;  3F70 A;  1PSF A;  2FZG B;  4L6V 5;  3PGG A;  2MF2 A;  1I8F A;  4MDX A;  1X2Q A;  2X4Y A;  3P8D A;  3PVL A;  2X51 A;  1K1Z A;  5LJ3 h;  4KH0 B;  2JS0 A;  5GAN g;  2P0P A;  1Q82 U;  5FRM A;  4M7A E;  2L3P A;  4KUL A;  4RTU A;  2ZAE A;  3M59 A;  1BIB A;  2RF0 A;  3JV3 A;  2QA4 A;  2F2V A;  2DE0 X;  2J6K A;  3HL8 A;  4J7I A;  4R0K A;  1WQ7 A;  4PJO D;  3CC7 A;  3FRN A;  1MV3 A;  4MZT A;  3A1P A;  3OSV A;  3OYJ A;  2AKK A;  4M75 D;  1DJ7 B;  5LJ5 f;  1KG1 A;  3OW2 A;  4JZ4 A;  2EPD A;  4RG8 A;  5IH2 A;  1YJW T;  1PKS A;  1WHG A;  5FLX E;  2KRO A;  1IZ6 A;  3L2Z A;  1BB9 A;  3QXE B;  3HRU A;  2RD1 A;  1D3B B;  2E3I A;  1GCQ A;  3OYF A;  3M55 A;  2PQW A;  1QW1 A;  4KGX B;  1G83 A;  5FW9 A;  2L2P A;  4M7D D;  4C8Q D;  3NTK A;  4JRQ A;  2FG0 A;  1K8A U;  4ZN3 A;  3CCM T;  8AT1 B;  3UF4 A;  4QQD A;  3VS0 A;  2ATC B;  2QDY B;  1K8A C;  1S1N A;  2W0Z A;  4F7U E;  1M9S A;  3QG1 A;  3CC4 T;  1O9S A;  2AT1 B;  2E3H A;  2QYZ A;  2CRE A;  1HSQ A;  3FIF A;  1WIE A;  1XNI A;  2LJ3 A;  3OYB A;  4JLG A;  4BDZ A;  3R6O A;  4QVD A;  1RAG B;  1KQS A;  2E41 A;  2BE7 D;  1H64 1;  1ZUU A;  2DER A;  2EJ9 A;  2NUZ A;  1RLP C;  2L8D A;  1Y7X A;  4LD6 A;  1XJW B;  2JMC A;  2DJZ A;  3CC4 Q;  4BI4 A;  4N4G A;  2OTL A;  2XD0 A;  3CCR A;  2E64 A;  1BCO A;  3CBO A;  2RJE A;  2HQH A;  3S3M A;  4JDS A;  2A08 A;  4IUT A;  1V29 B;  2QDL A;  5HK3 A;  2E1H A;  4PJO B;  1LNX A;  3OS2 A;  4M75 B;  1N8R R;  3MEV A;  1E6G A;  1VQ5 A;  4J6Y A;  4PL6 A;  2PUK B;  1BKB A;  1MNE A;  5DLQ E;  3OYE A;  4AG2 C;  2F2X A;  3JCM Q;  1GBR A;  4XU1 A;  1AWW A;  4C0F A;  2W10 A;  2XI9 A;  4KRT A;  4GLM A; 
#chains in the Genus database with same CATH homology
 2F69 A;  3CCL T;  4M78 F;  3M54 A;  1NZ9 A;  2XDP A;  4IUP A;  5A2Q E;  4E7J A;  2A3L A;  1MHN A;  2Y90 A;  3QYG B;  4BAC A;  1UEB A;  2GQV A;  3EAE A;  1I81 A;  3MEW A;  2BIV A;  2R5A A;  3CCE T;  3FLG A;  3SDZ A;  1YJW A;  2EKO A;  3X28 B;  5GAN 6;  3EFR A;  3INZ A;  2H3J A;  1Q82 C;  3HSB A;  2GCX A;  1VQK T;  1M5Q 1;  5GAN d;  4JRK A;  4NOY A;  5FU6 B;  4BY6 C;  4O6J A;  4J5Y A;  4M7D B;  1VQO T;  4J6W A;  3RIR A;  4C8Q B;  4BDY A;  4MZM A;  3S3N A;  2KK4 A;  2RM4 A;  4M77 F;  2DIQ A;  3RKX A;  4A4E A;  4Y91 A;  1RI0 A;  3QUI A;  4EMK A;  3X25 B;  3C12 A;  5CAI A;  2XDD A;  4A4F A;  3LWH A;  4X9D A;  5L8R E;  4F7U G;  3LYI A;  1VQ4 T;  1K73 U;  5GAN 4;  5LJ3 g;  1N6A A;  2FVU A;  4N4H A;  3BY7 A;  5C0M A;  3AHU A;  2E5Q A;  4XQ3 A;  3ZEH A;  2F5T X;  4BB7 A;  5LJ3 j;  3JCM b;  1NPR A;  1R8O B;  4N4I A;  3RKW A;  1VQ7 A;  5CK9 A;  1Q81 U;  1K73 C;  1JRI A;  1VQM T;  4JS5 A;  4WF2 A;  5A0G A;  3SWN A;  3CD6 A;  3ER0 A;  2LQK A;  2X4J A;  3OSS C;  2RJF A;  2O01 E;  5I2S A;  1N8R U;  3CC7 A;  2LVM A;  2MI6 A;  5HKC A;  2JZ2 A;  4M77 E;  4VUB A;  3CCM A;  1Q81 C;  2DZ9 A;  5CO7 A;  2EWN A;  4B9W A;  4DOW A;  4C92 G;  3L42 A;  4EPC A;  2EQM A;  3CCJ A;  2CZ6 B;  2YLC A;  1XOV A;  4A54 A;  2LDM A;  4YTL A;  1N8R C;  5KCO A;  2VGM A;  3BFM A;  4FSX A;  2K57 A;  4M7A A;  2IG0 A;  2WSC E;  3I56 T;  4EMH A;  2DEQ A;  4HT8 A;  3MO8 A;  1YJN T;  1U8R A;  3OB9 A;  3CC4 A;  4ZTJ A;  1KG1 A;  2E10 A;  2K5L A;  1N27 A;  4JRI A;  5HY6 A;  3SWN B;  2MMP A;  5CQY A;  2QTX A;  3CMA A;  1YIJ A;  3DB4 A;  2DXU A;  4JJN K;  3MHX A;  3L2U A;  1VQP T;  1BIA A;  4PJO F;  1BI0 A;  2RB6 A;  1EIF A;  3MP1 A;  2JTM A;  2ZCF B;  2DZC A;  3GNG A;  4RCC A;  1VQ8 T;  1YCY A;  1UB4 A;  4C92 D;  2YHT A;  2RA2 A;  2EYQ A;  5GAM f;  2EQU A;  4OP0 A;  2JOY A;  2LC4 A;  5LJ5 d;  3A8L B;  2MWP A;  3QII A;  4DOV A;  4E7K A;  2KVQ G;  4ZGJ B;  4NL2 A;  2PVG B;  1W2B S;  2RHZ A;  3X20 B;  3CC7 T;  2VXE A;  5M9O A;  1UGQ B;  1KD1 U;  2CKK A;  2BUD A;  4PJO E;  2EQJ A;  3JB9 G;  1W2B A;  3WVD B;  2M0O A;  4OB2 B;  3CPW S;  4IUV A;  3M53 A;  1M4Z A;  1B34 A;  4M75 E;  2RJC A;  3GPL A;  1FX7 A;  1NPP A;  3OYK A;  3JCM W;  3TU4 K;  3OBY A;  1KD1 C;  2DIG A;  1SSF A;  4BY6 B;  2ZPH B;  3CPW A;  3C95 A;  3QBY A;  3V8L A;  4II1 A;  3RUX A;  3KUF A;  4C92 C;  1Q86 U;  2RI5 A;  1QVF S;  3OQ5 A;  2LTO A;  1HXD A;  3M4G A;  1M1K U;  5AYF A;  3OYH A;  2RHI A;  2RO0 A;  5CKB A;  1QP2 A;  5GAM g;  1QVF A;  4XTU A;  1Q86 C;  4M7D F;  4MZP A;  4C8Q F;  1KHI A;  2LT4 A;  4R55 A;  3OY9 A;  3L2R A;  1Y71 A;  5GAM j;  4XTY A;  2FL7 A;  4QVZ A;  4BE0 A;  1M1K C;  3C94 A;  1B34 B;  2V8J A;  3G71 T;  4OGC A;  5GMK m;  1W4S A;  1TH7 A;  2HQX A;  3BW1 A;  3C4S A;  4GY5 A;  5CIU A;  2HD0 A;  4IUU A;  4M78 G;  3GIB A;  4LDY A;  4EMK C;  2D6F A;  3E9G A;  3TCJ A;  3J81 E;  2DXT A;  3CCS A;  1KQ2 A;  4M7A D;  3CCL A;  2Y4Y A;  2DTH A;  5CCA A;  5I21 A;  2RI2 A;  3PIO A;  5CKH A;  1WJR A;  3M56 A;  4M7D E;  4C8Q E;  5GAN 2;  2X4W A;  3ASK A;  3J7A F;  2O4X A;  4C0G A;  5D6X A;  1S72 T;  2PUO B;  4F7U A;  1U1S A;  3VV0 A;  3WVE B;  2L5Q A;  2RHU A;  1N9S A;  1YIT T;  1VUB A;  5GMK h;  2WSE E;  2ZPI B;  1QP3 A;  4PKC C;  4M77 G;  3A8M B;  1VQK A;  1G3T A;  1OYX A;  2KSS A;  4M78 D;  4ZGD B;  4XK8 E;  2B8A A;  3T9N A;  4A4H A;  3NTI A;  3E9F A;  4XTX A;  3JCM g;  3CCQ T;  2GF7 A;  4J6X A;  1XTD A;  2XID A;  4OMF B;  3M9Q A;  3I55 T;  2E70 A;  4HKE A;  1AHJ B;  5GAN h;  4M7A C;  4IUR A;  2VXF A;  1VQ4 A;  2LNV A;  1G3Y A;  4C92 A;  4F7U B;  1N9R A;  2EQK A;  3P8H A;  3QZ5 B;  3CCE A;  4E7I A;  2CZ0 B;  4RMO A;  3OYY A;  3OYI A;  5FU7 C;  2QQA A;  3A8H B;  3V7S A;  3ZFJ A;  2XDB A;  1VQM A;  3S3O A;  2XU8 A;  4Z02 A;  4ZGE B;  2RHY A;  2E6Z A;  5GAO n;  3NTH A;  2JVV A;  3QYH B;  2DD4 A;  3LWI A;  3L2W A;  3P8B B;  3GOX A;  5IAY A;  1YHQ T;  2L89 A;  1YJ9 T;  4HCB A;  2ZPG B;  2VGN A;  4MML A;  5EG2 A;  1UGR B;  4XU2 A;  2YLB A;  3CCU A;  3JSC A;  3RES A;  1VQN T;  5A0L A;  2VC8 A;  4Q5W A;  3CCV T;  4C92 B;  5GAO q;  3H6Z A;  2JNG A;  4FM4 B;  1P92 A;  1JJ2 S;  4CRI A;  4Y28 E;  4ELZ C;  5GAN 8;  3BDL A;  4NL3 A;  4PJO G;  5LL6 S;  1YJN A;  4O5V A;  5IT9 E;  3RER A;  1JJ2 A;  4C5E A;  3UPU A;  2XK0 A;  3CC2 T;  2EIF A;  4LD9 K;  4X34 A;  3QZ9 B;  3G4S A;  1VQP A;  1K9M U;  3M57 A;  4FT2 A;  4J7F A;  5GMK l;  2ZPE B;  2K2V A;  2FB7 A;  4IUQ A;  2HBP A;  3L1A A;  5A0D A;  3M4Y A;  5LJ3 d;  1VQ8 A;  4EDU A;  1K9M C;  1Y07 A;  1ZBX A;  3A8G B;  3SFM A;  4EMK B;  2ZGW A;  4DA4 A;  3G7Z A;  4A4K A;  2RH2 A;  4L5G A;  2MWO A;  2P0K A;  5KCH A;  2WSF E;  3BDU A;  1UGS B;  4HA8 A;  1KHC A;  2EAY A;  1M8V A;  2CZ1 B;  3JCM c;  5C6S A;  3G6E A;  2RI3 A;  3LGL A;  5FRN A;  1D3B A;  3X24 B;  5LJ5 h;  4XTV A;  3PTA A;  5GMK e;  5CKF A;  4HT9 A;  5J3B A;  1WJQ A;  2YRV A;  3MEA A;  3O8V A;  3KBG A;  3LH0 A;  3LX7 A;  4J83 A;  4BUG A;  1MGQ A;  4UC4 A;  3JCM X;  5DLO A;  2FYK A;  4KT0 E;  3OS5 A;  3OYA A;  2RJD A;  3L2V A;  1GXI E;  4M75 F;  5GAO p;  2Y4X A;  1ZHI A;  2A7Y A;  3HRT A;  4M78 A;  4C8Q G;  5GMK i;  4M7D G;  4CI0 C;  1BI2 A;  4OB0 B;  5GAN e;  5J39 A;  3VU3 C;  2PVO B;  5HK0 A;  2E65 A;  4M7A B;  2PU9 B;  2QA4 T;  1YBY A;  3VJP A;  5CR2 A;  4MMK A;  2DVE A;  1X75 C;  3CBP A;  4DQ2 A;  5FU7 B;  4QW2 A;  1UGP B;  5KE2 A;  3HFN A;  1VQL T;  1Y96 A;  2ZZD A;  3CME A;  3SD4 A;  1OZ2 A;  2E6N A;  5KH6 A;  4C0D C;  3QPH A;  3RMQ A;  3PT9 A;  4M78 B;  4R56 A;  2IVW A;  5LJ5 j;  1QVG S;  2XIC A;  2LCL A;  3CXC S;  3WXM B;  5DY9 A;  1O75 A;  3J80 E;  1QVG A;  3N5B B;  5GAN 3;  3CXC A;  1U1T A;  1ZQ1 A;  2I2L A;  2JUF A;  4FU6 A;  5GAN 7;  3X26 B;  4BI8 B;  1S72 A;  2M16 A;  1NJI U;  1VIF A;  3UDC A;  1YIT A;  4X9C A;  1OI1 A;  1Y96 B;  3HP9 A;  2V8K A;  2QEX A;  4C5G A;  3ZBD A;  2ZPF B;  3MP6 A;  2MAM A;  1BI3 A;  2NLU A;  3JB9 D;  3MP8 A;  1Q7Y U;  1NJI C;  5GAN 5;  4LDW A;  2M9U A;  3CMA T;  2QXF A;  2FHD A;  2KY9 A;  3HPW A;  3GF5 A;  3PFS A;  5GAM d;  2DD5 A;  3I55 A;  4BE2 A;  1Q7Y C;  2EJF A;  2KAF A;  3CEY A;  3FJP A;  3FC3 A;  3PMT A;  4ZN1 A;  1I5L A;  4HCC A;  2CS7 A;  2DPP B;  3QSU A;  1BI1 A;  3QO3 A;  4XTZ A;  2QQS A;  1WJS A;  2X35 A;  3SB2 A;  2KDS A;  4BE1 A;  4TVR A;  4RKU E;  4C92 E;  2XHC A;  5LJ5 e;  4JRP A;  4PJO A;  3QJ6 A;  1M1G A;  1WNL A;  1XQH A;  2JTF A;  3OA6 A;  1YHQ A;  3JAM E;  3JB9 I;  1YJ9 A;  3JCM h;  3V8J A;  2K3X A;  4QQ6 A;  1BYM A;  2M1H A;  3DKM A;  4PLI A;  1VQO A;  1VQN A;  3OMG A;  2CYZ B;  2EFI A;  1YI2 T;  3OYG A;  5GAN f;  3JB9 J;  3QJY A;  4A53 A;  1KC8 U;  2O4X B;  5D6Y A;  2VV5 A;  2DTO A;  1G3S A;  3QDR B;  3V8K A;  3JCM d;  3KXT A;  2QQ9 A;  1KC8 C;  3F70 A;  4LDX A;  1FXX A;  2RHX A;  1PSF A;  1JB0 E;  2R5M A;  5GAO m;  4JS4 A;  4M7A F;  4M77 D;  1VQ6 T;  2DTI A;  5D6W A;  4L6V 5;  4N0A A;  2GFU A;  4C5H A;  3PGG A;  2MF2 A;  4M78 C;  4PLL A;  4QQG A;  1I8F A;  4GLK A;  4J8O A;  4C0D B;  3JCM P;  2WAC A;  2OTL T;  3HKS A;  2X4Y A;  2R58 A;  3P8D A;  4MDX A;  3E1S A;  5GMK j;  3OYD A;  1NE8 A;  3CCR T;  4OVA A;  1FWZ A;  1RL2 A;  3QHS A;  4XAX B;  5LJ3 h;  4D6W A;  1VQ9 T;  4C8Q A;  4RG2 A;  3CCS T;  1X01 A;  2K4Y A;  3FB9 A;  3L2Q A;  3ME9 A;  1H3Z A;  3I56 A;  4JUV A;  5GAN g;  2P0P A;  3RKY A;  1Q82 U;  3DLM A;  5FRM A;  1I4K 1;  2R57 A;  3QKJ A;  3OBW A;  4M7A E;  1JBM A;  5GAN j;  2G3R A;  4M75 G;  4KUL A;  4OB1 B;  4M77 C;  4FT4 A;  1VIE A;  2RK2 A;  2D9T A;  3H8Z A;  3M59 A;  1VQ5 T;  4KUD K;  1BIB A;  2OTJ T;  5GAO r;  2OAU A;  2C06 A;  2VYT A;  5I2M A;  1LJO A;  2VUB A;  3VUZ A;  3OYJ A;  3JCM J;  2HAX A;  4M78 E;  2QA4 A;  3URG A;  4FL6 A;  3HL8 A;  4J7I A;  1WQ7 A;  5KE3 A;  3OW2 S;  4PJO D;  4MDW A;  5IN1 A;  3FRN A;  5FRO A;  3Q1J A;  4MZT A;  2CZ7 B;  1WQW A;  2DKG A;  3OSV A;  5CKD A;  2HNI A;  4M75 D;  1DJ7 B;  2K3Y A;  5LJ5 f;  2LX9 A;  3HFO A;  4OB3 B;  3OW2 A;  2JN0 A;  3OS0 A;  1VQL A;  4RG8 A;  4BI3 A;  3JCM e;  1KQ1 A;  2ZPB B;  3TEE A;  4QVC A;  1YJW T;  3OYC A;  5FLX E;  1IZ6 A;  3L2Z A;  1G5V A;  3CPF A;  3QXE B;  2QQB A;  2LCC A;  3HRU A;  2LQ8 A;  3CBM A;  3TRE A;  4P5N A;  3CCU T;  3VYH B;  2RK1 A;  3VYG A;  2QI2 A;  4LDV A;  1WGS A;  2RD1 A;  3S6W A;  4PJO C;  2XKO C;  1D3B B;  4KBM B;  3OYM A;  3VKI A;  4M75 C;  3A5Z B;  5GAO l;  3OYF A;  3G71 A;  4IKF A;  3DB3 A;  3M55 A;  3G4S T;  4F7U F;  3HRS A;  2PQW A;  5LJ5 g;  1VQ7 T;  5CVI A;  4E47 A;  1HK9 A;  1QW1 A;  3OYN A;  4ZTF A;  2X4X A;  4M77 A;  3GP8 A;  3CD6 T;  4M7D D;  3FDR A;  2QQR A;  3MCA B;  4C8Q D;  3NTK A;  4JRQ A;  3PMI A;  2DK3 A;  4L59 A;  1K8A U;  4NS5 A;  2KQW A;  2DXC A;  4ZN3 A;  2XG8 D;  2P0Q A;  5LJ3 e;  3UWN A;  5GAM h;  3CCM T;  4QQD A;  4E7H A;  2AHJ B;  3LW5 E;  3CCJ T;  1X6O A;  2QDY B;  3LGF A;  1LOJ A;  2DO3 A;  4PNO A;  3OS1 A;  1K8A C;  1PSE A;  4ME7 A;  1QVP A;  2GFA A;  3GLX A;  3PIP A;  3EFS A;  4XU0 A;  1G3W A;  1M1F A;  4N0A C;  4C92 F;  3G6E T;  4F7U E;  1M9S A;  3QG1 A;  3CC4 T;  2K5I A;  1O9S A;  4M77 B;  3UT1 A;  1YIJ T;  5CQX A;  2DAQ A;  4ATO A;  4C5I A;  3PNW C;  3CCQ A;  1KQS S;  3JB9 H;  4C0Z A;  5FU6 C;  3FIF A;  2EJG A;  1XNI A;  1YI2 A;  3OYB A;  4JLG A;  4A4G A;  4BDZ A;  4M7D C;  3V7R A;  4C8Q C;  3R6O A;  5J26 A;  2K5F A;  3LLR A;  4QVD A;  1KQS A;  2E41 A;  3GNF B;  3HHT B;  1H64 1;  2P4T A;  3VUB A;  4M7A G;  4E7L A;  2E12 A;  2L3R A;  3OMC A;  2EJ9 A;  1WPY A;  4ELY C;  4BD3 A;  4JLI A;  4OGE A;  3JCM V;  2L8D A;  1Y7X A;  2LRQ A;  3DLL A;  4V2S A;  4LD6 A;  1VQ6 A;  2DJZ A;  3M58 A;  4BI4 A;  2CGH A;  3JCM f;  4M75 A;  4N4G A;  2OTL A;  5CKE A;  4HCZ A;  2LT1 A;  3OYL A;  3CME T;  4EMG A;  2XD0 A;  3CCR A;  2E64 A;  3E19 A;  1OZ3 A;  4B9X A;  4LDU A;  3CCV A;  3JRZ A;  1VQ9 A;  3CBO A;  3JB9 F;  2RJE A;  3S3M A;  4JDS A;  4KUI A;  3FEO A;  4IUT A;  1V29 B;  3V7C A;  4XTW A;  3RMS A;  5HK3 A;  2E1H A;  4PJO B;  2HQE A;  3CC2 A;  1LNX A;  3MEU A;  3NFC A;  3OS2 A;  2D0Q B;  4M75 B;  3SWN C;  2KMT A;  3A8O B;  3MEV A;  4XU3 A;  1VQ5 A;  2QEX T;  4FIB A;  4J6Y A;  2BKD N;  2PVD B;  2PUK B;  4PL6 A;  1BKB A;  1M90 U;  2OTJ A;  1IRE B;  2F5K A;  5DLQ E;  3OYE A;  2DXB A;  3JCM Q;  3M5A A;  4OF1 A;  5DM7 R;  4RCB A;  3MET A;  2V8I A;  4XU1 A;  1M90 C;  5LJ3 f;  4C0F A;  5GAM e;  4M7D A;  2XI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...