4M78E

Crystal structure of lsm2-8 complex, space group p21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
73
Chain Sequence
b'ILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDNEKVMQHHGRMLLSGNNIAILVPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 10
structure length 73
sequence length 79
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78E00
4C8QG 5CAIA 5LJ3g 3QSUA 4EMHA 4XTXA 3QUIA 3HFOA 3BFMA 2RD1A 2EJGA 4M7AE 4XTZA 4M77B 3L1AA 4NL3A 4C92F 4PJOB 4PNOA 1WNLA 1X01A 4C8QF 4M78C 3JB9D 5GMKh 1LOJA 5LJ5e 4M77E 3V8JA 4M7DE 4PJOE 4M75A 4QVDA 5LJ3j 3JCMh 3EFSA 4M78B 5GAOm 1B34A 2DVEA 1TH7A 1U1SA 4NOYA 4X9CA 4F7UB 3V8LA 1JBMA 4C92C 5GAOl 4V2SA 4C8QC 5GAN6 4J6WA 3RIRA 3JCMV 5GANj 5LJ5d 2Y90A 4F7UE 4M75B 2DTHA 2DJZA 2E10A 4NL2A 5LJ5g 4C8QB 3RKXA 1HK9A 4DQ2A 5GMKi 4M75E 3RERA 2DTOA 1MGQA 3V7RA 4C92G 5GMKe 4N0AA 2E41A 3JCMf 5DY9A 5GANh 4M7AD 3EFRA 3HFNA 5GMKm 3JCMe 5GAN7 4M78A 2VXEA 4XTVA 3L2ZA 1WQWA 4F7UA 3JCMP 3JB9G 4M77D 5GMKl 4M7DD 4J6XA 3BY7A 4Y91A 5GAMj 4EMGA 1BIBA 2DXUA 4XTYA 5GAOn 3HSBA 3JB9F 4C8QA 1I8FA 3JCMd 1YCYA 4RCBA 4MMKA 5GANf 1D3BB 2YHTA 5GAMh 3JCMJ 4JRIA 2FYKA 4M78E 3RKYA 4MMLA 3SWNC 5GANe 4C92B 5LJ3h 4XTUA 3AHUA 1M8VA 5I21A 2VXFA 3JCMX 1N9SA 4C92E 2YLBA 4JLIA 4OP0A 4C8QE 2VC8A 4XQ3A 3RESA 4M7AG 4J6YA 3QO3A 4J5YA 5GANd 5LJ5j 1WPYA 2DZ9A 3SB2A 5GAMf 2E1HA 2RA2A 4M77G 4M7AF 4M7DG 5GAN2 1N9RA 4PJOG 4PJOD 1D3BA 4XU3A 2DXTA 2HNIA 5LJ3f 5GAOq 4HT9A 4HA8A 4C92A 5LJ3e 2EWNA 4M77F 4M7DF 2E64A 5LJ5h 2E65A 3BDUA 4PJOF 2DZCA 2DEQA 4M78D 3JCMg 2DKGA 3V7CA 4M7AC 5GAN8 1BIAA 4QVCA 4A54A 5GAN3 4XU0A 1I4K1 1H641 1I81A 3BW1A 2EJ9A 2FB7A 3FIFA 4M75G 4M75D 4M77C 1WQ7A 3RKWA 2EAYA 5LJ3d 4C8QD 5GAOr 3SWNB 2ZGWA 3GIBA 1U1TA 3FB9A 4XTWA 4N0AC 4EMKC 5GAN5 4JRKA 5GAOp 4A53A 3JCMW 1I5LA 4M7DB 4M75F 5LJ5f 4X9DA 4EMKB 2I2LA 1KQ2A 1Y96B 2K57A 5GANg 3V7SA 4F7UF 1KQ1A 3JCMQ 2JN0A 3JB9H 3PGGA 5GAMe 2CGHA 5GMKj 4M75C 1HXDA 3M4GA 2YLCA 4HT8A 3JCMc 1M5Q1 1JRIA 3FJPA 4M7DC 4M7AA 4PJOC 3QHSA 3VU3C 3RUXA 4M78G 4WF2A 2EJFA 3JB9J 2RM4A 3SWNA 4XU1A 1B34B 3INZA 4F7UG 4XU2A 3JB9I 4RCCA 1LJOA 2QTXA 2DTIA 4M77A 3JCMb 5GAMd 4M7DA 2RB6A 5GAMg 4PJOA 1LNXA 4M78F 4M7AB 4JUVA 3V8KA 4EMKA 1Y96A 5GAN4 4C92D
chains in the Genus database with same CATH superfamily
3CMEA 3CCVT 2EJGA 4DOVA 1VQPQ 2EFIA 3I5SA 5KYUA 3HL8A 4M77E 3MCAB 5A0DA 1MMAA 2DF6A 4J6WA 5I22A 3S3NA 1VQOA 5KE2A 4JS4A 3G6EQ 1QVGA 5GANh 3OA6A 4GBQA 4RTVA 2DLPA 1VQ4T 1BIBA 2RN8A 2XDDA 3CCJT 3JSCA 1XQHA 4J9HA 3OW2P 4E6RA 2A7YA 1S72A 2QQRA 2HKQB 2WACA 2C0IA 4MDWA 2ROLA 4JLIA 3RESA 4IUPA 2D0NA 3CMAT 2P4TA 1ACMB 4HT9A 1OQKA 2AHJB 3CMEQ 3QG1A 2DEQA 5GAN8 4JRPA 2X35A 3M56A 4ZN3A 1VQ8T 1JB0E 3OYYA 3TVTA 1H641 5CVIA 3CD6T 4PFOA 3CC2T 1Q7YU 1KQSS 3LGLA 2BKDN 2F2WA 2C0TA 2VKNA 5J3BA 1NJIU 1VQOQ 1TXQA 2KRMA 4PJMA 2DX1A 2YXYA 3ZL7C 3QHSA 2LQ8A 2XIDA 2B86A 2DRKA 3INZA 4R56A 4XU2A 1IXDA 2DTIA 4M7DA 1HYOA 4QW2A 4D8DA 1Q86U 2QGFB 4EMKA 3AHUA 3MHXA 5GAN4 3H6ZA 3UWNA 2JS0A 2COYA 4M7AE 5CQYA 4XTZA 2WSFE 2RJFA 1IRXA 1QP3A 4RMOA 2CH4W 1AWJA 1LOJA 3QZ9B 2DXBA 1VQMA 5A0LA 3L2RA 4QVDA 5GAOm 1S72Q 1HSQA 2QA4T 2JT4A 3V8LA 4V2SA 4HCZA 2AZVA 2LJ1A 2Y90A 5KYWB 5LJ5g 2QQ9A 2R5MA 2LQNA 1TSFA 1PM3A 2EKHA 3FEOA 4N0AA 3DLMA 4OB1B 4J9FA 1RI0A 3O5ZA 2DD5A 3REBB 3JCMP 2D8HA 1VQNT 4C8QA 1JEGA 1ARKA 2DILA 2DYBA 4RCBA 3OYBA 4M78E 2KBTA 1K73C 3A98A 3M57A 4JRQA 1N9SA 2EQIA 2EYYA 4C92E 2HEQA 2VC8A 5FW9A 2PQWA 3M0RA 3QO3A 5GANd 3A8HB 5IXFA 4B6MA 1JXOA 2JTFA 2E4HA 4PJOD 5GAOq 1QVGS 2NLUA 4PLIA 2LT1A 3TQ7P 4PJOF 1K73R 1N8RC 3CC4T 4BD3A 4C5EA 2DKGA 1S1NA 1D09B 1YNZA 1YI2T 2DPPB 5CKFA 2QQAA 1OU9A 3H8ZA 3OY9A 3BW1A 1VQKT 3CCEA 4K11A 3CCLA 1UDLA 4E47A 3RMQA 1M27C 1X6GA 3EGDB 1YHQT 3ZFJA 5GJWB 1LVKA 4M75C 2XI9A 2YRCA 3CXCS 4PLLA 4B9XA 4LDWA 3JCMb 3VS1A 4A63B 1RLPC 3MJXA 3QWYA 1RAEB 3L1AA 4PJOB 2NYSA 4PNOA 4QVZA 1K76A 1W70A 2LCSA 2MOXA 5FU6B 2X3WD 3LLRA 1OOTA 2MF2A 3QDFA 3HKSA 1WI7A 2DVEA 1R8OB 4LDVA 4ZN1A 1BK2A 4X9CA 3EHQA 2COWA 4QQGA 4PFPA 3I55A 1JJ2P 3CCUT 4OMLA 2LDMA 2RF0A 1RUWA 3REAB 3G71T 2FEIA 3M5AA 1YJWA 3OYIA 2CUBA 5GAMj 2JMAA 5FU7C 2BIVA 1D1CA 1WXUA 5FROA 1LCKA 4JZ3A 1QVFP 4JRIA 3MP1A 3L42A 1ZQ1A 4CC7A 4HCBA 4X1VA 1PKTA 3GLXA 4XAXB 2X4YA 4OF1A 3PVQA 4OP0A 2YUQA 2KT8A 2NUZA 3UA6A 2OAUA 4B9WA 5GAMf 2X4JA 2KGTA 3NPFA 4XU3A 3QIIA 1IGUA 4CC2A 2E5KA 1M1KC 4F14A 4M7DF 2HL5C 3WVEB 4IKFA 5FRMA 2D0QB 2KNBB 2DL7A 2JXBA 4OB3B 2FB7A 2QEXQ 4MZTA 2OX7A 1VIFA 3J81E 3FB9A 4N0AC 1AWXA 2LRQA 2SRCA 5GANg 1YJNT 3I55Q 3CCRA 5LL6S 3ULRB 1I1JA 1M8VA 3M4GA 1NPRA 4OMQA 2X9HA 4MZMA 2DEUA 1WGSA 2KT1A 2GGRA 1UFFA 1WJQA 4R55A 2RD1A 3G7ZA 2OAWA 2RQUA 5IHNA 4C8QF 3JB9D 4KRTA 3M0PA 5C0MA 1GBQA 4ELZC 2RQTA 4C0ZA 1MUZA 2KY9A 4BUGA 4RTWA 2MCNA 3HRTA 2O9SA 2GBQA 3QBYA 2W10A 2FPEA 5KE3A 3OYJA 3M0QA 2KE9A 3LH5A 4OMNA 5DY9A 1V29B 1OPLA 5GAN7 4ZGDB 1RADB 4LUDA 2QDYB 3DB3A 4M77D 1NLOC 2JTMA 2O31A 4E7SA 5L23A 2BZYA 3G4SA 1OI1A 2GFUA 1AWOA 4HVVA 5GANe 1UHCA 4XTUA 3TREA 2GFAA 3CCRQ 4ZTJA 3CEYA 2PVOB 2EQKA 1GRIA 2EQUA 2R57A 1N5ZA 5LJ5j 1RL2A 5HKCA 1ZSZC 2K9GA 3EHRA 1FXXA 2A37A 2AZSA 3EG9A 1KC8C 1PD0A 1K9MC 3FIFA 1W2BA 1WQ7A 4BI8B 5GAN5 3VJPA 1I5LA 1TG0A 2EPDA 1NYGA 5LJ5f 5KH6A 5CK9A 2ZPHB 4C5HA 4OVAA 1Y96B 2J6OA 2AKLA 4RUGA 1NBEB 2KQWA 1KQ1A 2MWPA 4QQ6A 3VS5A 4LNPA 1QKXA 3NFCA 2RNAA 1D0YA 1H8KA 2FPDA 1UE9A 1K8AC 1ZA1B 5CKEA 4XU1A 5D6WA 5GAMd 4ATOA 2L2PA 2YUPA 1BCOA 1SF9A 1MV0B 4C0DB 3Q1JA 3QUIA 2DYIA 2EBPA 3SHWA 3OYMA 1Y7XA 3PFSA 3ASKA 2HAXA 2E70A 1MNEA 3CCQT 1UGRB 3V8JA 5LJ3j 2QYZA 2LQKA 3UA7A 2LJ0A 2F5TX 2JZ2A 2YDLA 3LWHA 3RKXA 2HBWA 1OULA 1EIFA 1HK9A 2GF7A 4M75E 4M7AD 4Y92A 3I56T 3JB9G 1PRMC 2QASA 1QKWA 1RABB 4RTTA 2VVKA 3HRSA 5KYWA 2J05A 3GF5A 3CCVA 1WX6A 2F2XA 1D3BB 4J8OA 1TWBA 3OS5A 2D6FA 4KH0B 5LJ3h 1JO8A 3CC7Q 2KYBA 2ZPFB 1Q86R 4RKUE 2RK1A 1KD1U 4ZTFA 3RBBB 2J06A 1Q81U 2M0YA 4LN2A 4M77G 1E6GA 4FSSA 2FL7A 3E1SA 3TEEA 3NTIA 3BE3A 4M78D 1RAHB 2NUPB 4RTZA 3EG3A 1I4K1 1VQ4A 2MI6A 2IG0A 2ZGWA 3CCJA 4XTWA 5GAOp 3UATA 5C6SA 4IURA 3H0FA 5L8RE 1VYUA 5HK3A 1NM7A 1PSEA 3H41A 3JCMc 2CP6A 3A1PA 4ANJA 4KULA 1NEBA 4HCKA 3CMAA 1VUBA 3QSUA 1IREB 3JAME 3ME9A 2PUOB 3LGFA 2QXFA 1VQ8A 4IIMA 1GCQA 2X4WA 4M78B 4GLMA 3QJYA 4NOYA 1U5SA 4O5VA 3CD6A 2FRWA 2FVUA 5GAOl 3RIRA 3CC2A 4BDZA 2HQHA 1UG1A 5GANj 5LJ5d 4A4GA 5A2QE 1VQ5T 1FX7A 3ZBDA 1K0XA 1WFWA 3L2WA 1KQSP 1ZSGA 3VYGA 1JQQA 2VXEA 3L2ZA 1WQWA 3S3OA 2FG0A 3PIOA 2V8JA 3CQTA 1Z9ZA 2ZPIB 2DFUA 4MMKA 3CCJQ 5KYYA 1AVZC 2B8AA 5GANf 2E6NA 3OMCA 3C4SA 2J6KA 3C0CA 4RTXA 3M0TA 2QA4A 1PRLC 4M7AG 3CCMT 3CPFA 2DMOA 1YN8A 1BKBA 3VRZA 3SB2A 3X28B 3OB9A 2A3LA 3TSWA 1MV3A 3H9NA 1TOVA 4HA8A 4AFZC 2DL8A 3V7CA 2CT3A 1QWFA 4IUVA 4KUIA 2OTLT 4QVCA 1H3HA 3CBMA 3QZ5B 1FYNA 2K4YA 2XMFA 1A0NB 2LX9A 1VQ8Q 5EC7A 4KBMB 5LJ3d 4F7UF 2D8JA 1VQPT 1VQNA 3EG9B 4E7JA 4BI3A 1V1CA 3N5BB 1E7OA 4J7IA 4J9BA 4RTUA 2KRNA 3E19A 4LXCA 5GAMe 1KC8U 2CKKA 1K9MU 1VQ6Q 2XDPA 4M78G 4BB7A 1YP5A 2RM4A 2D9TA 1UGPB 1LJOA 2QTXA 4FYWB 4KGVB 1TTHB 3LYIA 4E7ZA 2HSEB 2MMPA 2CZ6B 2GQVA 2JTEA 5I2SA 4Q5WA 3CPWS 3CC4A 3OYGA 1K8AU 2EIFA 2DO3A 2HSPA 2JOYA 1X43A 2YWWA 1YI2A 4J9IA 1QVGP 2K5LA 1VQKA 1Z9QA 4F7UB 4F04B 4NL2A 2CDTA 1YHQA 2QI2A 2BE9B 2DNUA 1MGQA 2GNCA 3PNWC 3DLLA 1I07A 2EGAA 2ZPBB 3SEMA 3BY7A 2LP5A 1KG1A 1CKBA 1UECA 1QVPA 2E5QA 3CCST 4E7IA 1K0SA 1VQNQ 5CKBA 3CXCP 4DBRA 4CI0C 3A5ZB 2ZPEB 2F5KA 1D0XA 1UTIA 2RHUA 2RA2A 3CCUA 2DXTA 4FYVB 1GCQC 3EAEA 2JVVA 4LDXA 2E64A 3BDUA 2PZ1A 2K3BA 3E9FA 3FC3A 3G71A 2MIOA 3M4YA 3CC4Q 1UEBA 4BE0A 1U8RA 1YI2Q 4PJOC 5GAOr 5FWBA 1VQKQ 5FU6C 4C5GA 4MZPA 3GNFB 1D1AA 1E6HA 1X2KA 4CC4B 3JCMQ 4AMCA 4OMPA 1Y71A 2RQWA 1M30A 1MMDA 1UGVA 3RUXA 2GTJA 1SRLA 4EDUA 4F7UG 3VS7A 3JB9I 4M77A 4P5NA 1Y57A 1Q82U 2RB6A 3OQ5A 1BYMA 2RJEA 1Y96A 1VQMQ 5CAIA 5LJ3g 3HFOA 2D1XA 1KHCA 3DB4A 4X34A 1JJ2A 5LJ5e 5DLOA 3JCMh 1M9SA 3IQLA 1TH7A 1M90R 2LVMA 5GAN6 3HRUA 3KXTA 4MDXA 1YWPA 2I0NA 1YJNA 3CCUQ 1KK7A 3V7RA 1G5VA 3EFRA 3TU4K 1SKUB 3QPHA 1QVFA 1PHTA 3G71Q 1G8XA 4RTYA 2VB6A 1OZ2A 4FYXB 2V8KA 3EG1A 2EQMA 2KR3A 2O9VA 4FSXA 4TVRA 1SG5A 2DL3A 2NWMA 2G6FX 2VXFA 2O88A 5KYYB 1X6BA 2RI2A 4M4ZA 2RHZA 4XQ3A 1M1GA 4OMFB 2LNHB 4IIOA 5IAYA 1VQ7T 1D3BA 1YWOA 3OBYA 2RQVA 3UDCA 5LJ3e 1DJ7B 2M02A 5CCAA 3CCEQ 1RAGB 4NS5A 2ENMA 3HPWA 3M58A 3CCLQ 1AWWA 1GL5A 4N4HA 2DIGA 2IIMA 4HKEA 5CKDA 3M0SA 5GMKj 2ED1A 4M7DC 1OZ3A 4EMKC 4BY6C 4JRKA 4C0GA 4A53A 3JCMW 3WXMB 1C1AA 1TS9A 3GP8A 1YJNQ 2NUPA 2MWOA 3PGGA 2VV5A 1F1BB 4M7AA 2EJFA 4D8KA 2DL4A 4OGCA 2A0FB 5CO7A 4LUEA 2RPNA 2CYZB 1KD1R 3QJ6A 1NG2A 1BCMA 1T3SA 2QTVA 1SEMA 1WNLA 5GMKh 1U3OA 1PC0A 3OMGA 4OGEA 3KUFA 1C0MA 3ZEHA 4C8QC 1IO6A 2M9UA 1PKSA 2DXCA 3T9NA 1YJWQ 2A28A 3EGXB 1T0JA 4HXJA 2VWFA 2V1RA 1NEGA 2E3HA 1WJSA 3E2UA 4M78A 4XTVA 2K5FA 2K3XA 4EMGA 2DD4A 3H0IA 3HHTB 1R0CB 3JB9F 3JCMd 1OEBA 2XG8D 2V26A 1YCYA 5IHKA 5FU7B 3C95A 2QEXT 2VGNA 1T3LA 2V1QA 5I21A 2RMOA 3CCQA 1OYXA 2KROA 2P0QA 2DK3A 2KEAA 3NGPA 4E7KA 3EH1A 2EQJA 4FIBA 1BI1A 2EW3A 2E1HA 2W0ZA 3VS0A 1N9RA 1RACB 1NLPC 1QQJA 2F1LA 2VUBA 3OS0A 1KIKA 4M77F 5HK0A 4N4IA 5I2MA 4C0DC 3M59A 2FZGB 1ZA2B 5GJVB 3I56A 3OBWA 2OTJT 4IUUA 1YITT 4M75G 3SWNB 2BZ8A 1IGQA 4PFZA 3VKIA 8ATCB 2ZPGB 3I9QA 2RH2A 2CGHA 1RAIB 1YJ9T 1UB4A 1K73U 1JRIA 3LH0A 2YSQA 4RG2A 4DOWA 2CUDA 4KH1B 3OS1A 4M77B 2FZCB 4YTLA 2LTOA 1BB9A 1N8RU 1TUCA 4C0FA 4EPCA 4PJOE 3CCQQ 2BE7D 1M8MA 1JBMA 1UGSB 2ECZA 3MKDA 1WHGA 4FT2A 2DTHA 2M51A 4FW1A 2OI3A 1QWEA 2HZYA 1MNDA 3VYHB 4DQ2A 2MPXC 1GFDA 2F69A 1VQ9T 1OV3A 2E41A 2DERA 1WHLA 4F7UA 3G4SQ 1M4ZA 3EG0A 3OYFA 3L2VA 2ATCB 3I56Q 2RJCA 2EKOA 3PT9A 1G83A 4OB2B 1R0BG 4XK8E 2XK0A 3QKJA 3SFMA 2JNGA 2C0OA 2E3IA 3JCMX 2VGMA 5HY6A 2RJDA 3R6OA 1EX4A 2DETA 2L5QA 3FJ5A 1Q7YR 1Q86C 2NUTB 1WPYA 3KBGA 4D6WA 4M7AF 1VQ5A 2DM1A 3WVDB 2HQEA 1W2BP 2CREA 5LJ3f 1NJIR 2RHIA 2J7IA 2FHDA 3JCMg 3QDRB 4ZGJB 2K3YA 1EFNA 2ED0A 1QCNA 2HQXA 1GFCA 3OSSC 4HVWA 4LE9A 2K57A 4OB0B 3X20B 4J9CA 2H3JA 1SHGA 1ZBJA 3LX7A 1HXDA 3A8GB 1BI0A 2LCCA 2CZ0B 1W1FA 5KYXB 3CCMA 2YRVA 1MMNA 3MP6A 4JPBW 4M78F 4JJBA 4M7AB 4JUVA 2FPFA 1OU8A 3V8KA 4C92D 2KMTA 4GY5A 5D6YA 4C92F 5J39A 1WHMA 2KVQG 1M1KU 2OTLA 4M7DE 2PNIA 2DJQA 2RI5A 2O01E 1YIJT 1VQPA 3CC7T 1X75C 2DJZA 3OS2A 1VQ5Q 1NPPA 4LD6A 4PKCC 1WZOA 1AT1B 3HFNA 3I35A 5GMKm 1VQLT 1MMGA 3JCMe 3CCVQ 1NE8A 3A8LB 2V8IA 3FDRA 2RQRA 1UJ0A 1QLYA 2A08A 3HSBA 1KFZA 1KHIA 3A8OB 4JS5A 2KYMA 1W2BS 2YHTA 1KJWA 4C92B 2R58A 2P0PA 1X27A 2L0AA 4C8QE 3CPWP 3OW2A 3CCMQ 4LDUA 5CQXA 4JJCA 3MEVA 3OYLA 2KDSA 4WCIA 2EYQA 3P8HA 3PE0A 4E7HA 1VQ4Q 1Y0MA 2E65A 4XU0A 1ZUUA 1M1FA 1XOVA 2GCXA 1ZX6A 2QQSA 3CCSA 3TCJA 5KCHA 2VASA 1I0CA 1TUGB 2XICA 2M1HA 4ZGEB 3V7SA 2YUOA 4FW2A 4C5IA 3AT1B 1W4SA 3RDVA 4DEYA 1B7TA 4F17A 3F70A 3CMAQ 8AT1B 2DE0X 1CKAA 2LJ3A 1B34B 1QW1A 4KGXB 3LWIA 2HMAA 2RI3A 2Z0WA 2KI7A 3CD6Q 4NL3A 1GBRA 1AEYA 3CC2Q 4M75A 2CT4A 5AYFA 2RK2A 2F2VA 2CS7A 1KSWA 2EVRA 3G6ET 1PWTA 1XNIA 1VYTA 2K6DA 2XD0A 2FZKB 9ATCB 4C92G 5GMKe 5IT9E 3CXCA 2L3PA 4L5GA 1VYVA 2YUNA 5I11A 1UGQB 1PG5B 3E9GA 3LW5E 2X3XD 1K1ZA 4ESRA 1ZHIA 4QT7A 1WJRA 3D7SB 3EGXA 3VRYA 3CCSQ 2QA4Q 1V76A 2FYKA 3PMTA 2BTTA 4R0KA 4OMMA 3VS3A 4QKUA 4ELYC 3URGA 4JDSA 4HCCA 3VUZA 1B07A 1M3AA 2EYXA 2DZ9A 1B3QA 5A0GA 4FM4B 1VQ6T 1NYFA 3CMET 3VV0A 2EWNA 5IHIA 1X2QA 1G3YA 4FU6A 2PVGB 1FMWA 3VS6A 4A54A 3JRZA 3VS2A 3P8DA 4JLGA 2LZ6B 4E7LA 4ORZA 2EJ9A 4OMOA 3RKWA 4LD9K 2JW4A 2P4RA 4UC4A 2LC4A 1IZ6A 1VQOT 4J9EA 4WTOB 2JN0A 1MHNA 3JB9H 1I5OB 1IHVA 2CSIA 2YLCA 2GTOA 3C12A 2J6FA 5J26A 1ZBXA 3SWNA 3OW2S 4RCCA 3R6NA 1VQ7A 3G1JA 2ZZDA 4BE1A 4EMHA 2CP2A 2O4XA 1R77A 1LPLA 1PNJA 5FRNA 2E6ZA 4FT4A 3HP9A 4AG1C 4JJDA 1S72T 1M2VB 3MO8A 3EFSA 1YHQQ 1QP2A 5EG2A 1UJYA 1U1SA 2ABLA 1K9AA 2QGGA 2E10A 2ESWA 3EFOA 1M90C 4N4GA 2DTOA 3OYAA 3JCMf 3RR6A 2DRMA 3RMSA 3C94A 2RHYA 1SRMA 4A4HA 1C6VX 2DXUA 4XTYA 2C06A 2QAZA 2XDBA 1G3WA 4JZ4A 4ZNXA 1WXBA 2L3QA 1WHJA 3MPUB 4IUTA 1FMKA 2AK5A 2P84A 3VUBA 2PTKA 3QYHB 4J6YA 5DM7R 5CR2A 3UT1A 2L3SA 2LCLA 1N8RR 4QQDA 1X6OA 1WXTA 5M9OA 2EYWA 1VQ7Q 2HNIA 3MEUA 2OJ2A 1WHKA 1AZGB 3KFVA 4AFQC 4BE2A 5GAN3 2HKNA 1VQMT 1M2OA 5CIUA 3UF4A 2NUTA 4M75D 2EAYA 3SDZA 1U1TA 2COZA 4M75F 2PVDB 4J7FA 1M3BA 1ZUKA 1ZSZA 2QEXA 2HL3A 1XTDA 1QMCA 1O75A 4HT8A 2H3EB 4PJLA 2CZ1B 5IXBA 5KYUB 3MEAA 4WF2A 1H92A 2PUKB 2MK5A 3OYEA 2M0OA 3P8BB 2JS2A 4L59A 4F16A 3EGUA 4KGZB 2MAMA 2QQBA 4J9DA 3OSVA 1W6XA 1X01A 1KD1C 2KSSA 2L8DA 4DBHA 4DBQA 2VYTA 5KYXA 2KK4A 2OTJA 1YITA 1Q81C 2L89A 2IPOB 4Z8AA 3PTAA 2IVWA 3NHNA 5DLQE 3PVLA 3JCMV 1M3CA 4F7UE 4M75B 2DA9A 1ZUYA 2AKKA 1SPKA 2MYSA 1YJ9A 1RLQC 3OYNA 3PMIA 1G2BA 1Q81R 3I5RA 1CSKA 3MEWA 1UUEA 4M7DD 1XJWB 2K7AA 4Y91A 1UHFA 3CCET 4DEXA 1U06A 5GAOn 3CCLT 3X24B 5GAMh 2QG9B 1WIEA 2LMJA 4RG8A 3SWNC 2DVJA 2FRYA 2LQWA 1WLPB 2ROTA 2HD0A 2PU9B 3M54A 4J5YA 1M1KR 3JV3A 5GAN2 4PJOG 1BBZA 2WSEE 2K2VA 1FMVA 2Y4XA 4C92A 1VQ9A 2XKOC 1T0HA 1D0ZA 4KT0E 1TUDA 1BIAA 1Y07A 4FCYA 4LDYA 4Z88A 1JJ2S 1I81A 4M77C 2ZAEA 1GCPA 2OTJQ 2JMCA 4C8QD 1YITQ 4M7DB 3I55T 4GLKA 3NTHA 4EMKB 4BY6B 2H8HA 2FO0A 3J7AF 4VUBA 1AD5A 2CP7A 1VOMA 4ME7A 5D7UA 5IH2A 2LX7A 1M5Q1 3FJPA 1YJ9Q 3THKA 1YJWT 1QVFS 3BDLA 2BUDA 5D6XA 1WDXA 1GXIE 2M16A 2CP0A 4XTXA 3BFMA 1N27A 1WYXA 2BZXA 2LNVA 2JJ9A 4E2FB 3NTKA 2O4XB 2CZ7B 2JM8A 1B34A 1P92A 1RI9A 4DA4A 1BU1A 3UPUA 1K4US 4C8QB 2CP3A 3DKMA 3M55A 4L6V5 3GOXA 1HJDA 4FYYB 3EFOB 1VQ9Q 4O6JA 2XHCA 3SD4A 2P0KA 2DBMA 2X4XA 1FWZA 5GMKl 3L2QA 3CBPA 3VS4A 1ZLMA 2AT1B 4A4FA 3M9QA 1M90U 1YFNA 3HTRA 2O2OA 1YCSB 1PSFA 3JCMJ 1VA7A 2RO0A 4Z02A 4MMLA 3CCRT 2K5IA 4AFSC 4BDYA 2KRSA 2CSQA 3M53A 1YIJA 3META 1IB8A 1OX9A 2DL5A 4IUQA 5AT1B 3CC7A 4EIKA 4M7DG 2GQIA 1G3TA 4AT1B 5KCOA 1Q7YC 3A8MB 1KC8R 5LJ5h 3X25B 1K9MR 3EG2A 3OYHA 4M7AC 3ER0A 1VQLA 1N6AA 2KXCA 1NJIC 4BACA 2EGCA 4KUDK 3GIBA 3OYDA 4CC3A 5CKHA 2E12A 2I2LA 1KQ2A 3QXEB 1K8AR 3S3MA 5FLXE 2Y4YA 3FLGA 1JXMA 3O8VA 4HVUA 4JJNK 4A4EA 1ZSZB 1BI3A 1ABQA 3JB9J 1X69A 2HCKA 2QK0A 1OPKA 1YBYA 4A4KA 3GPLA 4J9GA 1Q95G 2EGEA 3PIPA 1RAAB 1AHJB 2DAQA 4C8QG 3G4ST 4PK4A 4J83A 2LT4A 4M78C 1H3ZA 1SHFA 2RHXA 1JU5C 3X26B 4C92C 4CRIA 3OYKA 1YIJQ 1J3TA 3RNJA 3OYCA 1AZEA 2KAFA 3U23A 2EYZA 2JM9A 5HCKA 5KYNA 5ECAA 1AOJA 5GMKi 3RERA 3QYGB 2KXDA 2R5AA 1M2VA 3QWXX 4PJJA 2SEMA 1VQLQ 3CBOA 4J6XA 2QDLA 1QCFA 2YT6A 3GBQA 3TSZA 1IHWA 1I8FA 5IN1A 3EH2A 3CPWA 1KQSA 1EZZB 1VIEA 4II1A 7AT1B 2JUFA 1NZ9A 3RKYA 3NMZC 3GNGA 1SSHA 5FWCA 2DBKA 1HD3A 2CH4A 2K2MA 2DIQA 2YLBA 1ABOA 1Q82C 1TU0B 4Z89A 2CP5A 3FRNA 3G6EA 3J80E 2WSCE 4DBFA 2DZCA 4FL6A 2K79A 3MP8A 3M0UA 1SSFA 1BI2A 6AT1B 2HDAA 4AFUC 1Q82R 1G3SA 3EGDA 2A36A 1QCOA 1WA7A 2X51A 1WHHA 2XU8A 4BI4A 1D1BA 2ZCFB 1O9SA 4X9DA 4PJNA 2YRDA 2HBPA 2G3RA 1PCXA 2L3RA 4PL6A 3VU3C 4AG2C 3H0HA 1PD1A 1RAFB 4Y28E 4PJOA 3S6WA 5GAMg 1LNXA 2OTLQ 2AIRB 1VQ6A 1OX8A 3L2UA
chains in the Genus database with same CATH topology
3QJ6A 3CMEA 3CCVT 3Q1JA 4EMHA 2O4XA 3QUIA 5FRNA 2EJGA 4DOVA 2E6ZA 3OYMA 1Y7XA 3PFSA 4FT4A 1WNLA 3ASKA 2EFIA 3HP9A 2HAXA 1S72T 2E70A 5GMKh 3HL8A 3CCQT 1UGRB 4M77E 3V8JA 3MCAB 3OMGA 5LJ3j 3MO8A 3EFSA 1QP2A 4OGEA 3KUFA 2LQKA 1U1SA 5EG2A 5A0DA 3ZEHA 4C8QC 4J6WA 2F5TX 2JZ2A 2M9UA 2DXCA 3T9NA 2E10A 3S3NA 3LWHA 3RKXA 1VQOA 5KE2A 1M90C 1EIFA 1HK9A 4JS4A 4N4GA 2GF7A 4M75E 1QVGA 2DTOA 3OYAA 3JCMf 5GANh 4M7AD 3RMSA 3C94A 3OA6A 1WJSA 4M78A 2RHYA 4XTVA 3I56T 3JB9G 2K5FA 4A4HA 2K3XA 1VQ4T 4EMGA 2DD4A 1BIBA 2DXUA 4XTYA 2C06A 3HHTB 2XDDA 3HRSA 3CCJT 3JSCA 2XDBA 3JB9F 3GF5A 3JCMd 1G3WA 1XQHA 2XG8D 3CCVA 1YCYA 5FU7B 1D3BB 4J8OA 1KQ2A 3C95A 2QEXT 4IUTA 2VGNA 3OS5A 2D6FA 5LJ3h 2A7YA 1S72A 2ZPFB 5I21A 2QQRA 4RKUE 3CCQA 2WACA 1OYXA 2RK1A 1KD1U 2P0QA 4MDWA 2DK3A 3VUBA 4E7KA 4JLIA 3QYHB 3RESA 4J6YA 4ZTFA 5DM7R 4IUPA 5CR2A 1Q81U 2EQJA 4FIBA 3UT1A 1BI1A 2LCLA 2E1HA 4QQDA 1X6OA 4M77G 1N9RA 5M9OA 3CMAT 2P4TA 2HNIA 2FL7A 3MEUA 4HT9A 3E1SA 2VUBA 3TEEA 3OS0A 3NTIA 2AHJB 4M77F 5HK0A 3QG1A 2DEQA 4M78D 4N4IA 5I2MA 5GAN8 2X35A 4JRPA 4C0DC 3M56A 4ZN3A 3M59A 4BE2A 3I56A 1VQ8T 1JB0E 3OYYA 5GAN3 1VQMT 1I4K1 3OBWA 2OTJT 1H641 4IUUA 5CVIA 1YITT 4M75G 5CIUA 1VQ4A 2MI6A 4M75D 2IG0A 2EAYA 3CD6T 3SDZA 3SWNB 2ZGWA 3CCJA 1U1TA 4XTWA 5GAOp 3CC2T 1Q7YU 1KQSS 3LGLA 4M75F 2PVDB 5C6SA 4IURA 4J7FA 2BKDN 3VKIA 5L8RE 2QEXA 2ZPGB 5J3BA 1NJIU 1XTDA 2RH2A 2CGHA 5HK3A 1O75A 1PSEA 1YJ9T 1UB4A 4HT8A 3JCMc 1K73U 1JRIA 2CZ1B 3LH0A 3QHSA 2LQ8A 3MEAA 4WF2A 4RG2A 2XIDA 4KULA 2PUKB 3INZA 4R56A 4XU2A 4DOWA 3OYEA 2M0OA 2DTIA 4M7DA 3P8BB 4L59A 4QW2A 1Q86U 3CMAA 4EMKA 3AHUA 1VUBA 3MHXA 5GAN4 3H6ZA 2MAMA 1IREB 2QQBA 3OSVA 3UWNA 3QSUA 3JAME 3ME9A 3OS1A 4M7AE 2PUOB 5CQYA 4XTZA 3LGFA 2QXFA 4M77B 1X01A 2WSFE 2RJFA 2KSSA 2LTOA 1QP3A 4YTLA 4RMOA 1KD1C 1N8RU 1VQ8A 2L8DA 1LOJA 3QZ9B 2DXBA 4C0FA 4EPCA 2VYTA 5A0LA 3L2RA 2KK4A 1VQMA 4PJOE 2OTJA 4QVDA 5GAOm 1YITA 4M78B 2X4WA 1Q81C 2QA4T 2L89A 3QJYA 4NOYA 4O5VA 3PTAA 3CD6A 3V8LA 1JBMA 1UGSB 2IVWA 2FVUA 5GAOl 4V2SA 5DLQE 3RIRA 3JCMV 4HCZA 4BDZA 3CC2A 5GANj 5LJ5d 2Y90A 4F7UE 4FT2A 2DTHA 4M75B 4A4GA 2QQ9A 1FX7A 2R5MA 3ZBDA 5LJ5g 5A2QE 1VQ5T 3VYHB 4DQ2A 2F69A 3L2WA 1VQ9T 3FEOA 4N0AA 2E41A 3DLMA 4OB1B 1YJ9A 1RI0A 3OYNA 3VYGA 2DD5A 3PMIA 2VXEA 3L2ZA 1WQWA 4F7UA 3MEWA 3JCMP 1M4ZA 3S3OA 4M7DD 3OYFA 3L2VA 4Y91A 2RJCA 3CCET 3PIOA 2EKOA 2V8JA 5GAOn 1VQNT 3PT9A 3CCLT 3X24B 4OB2B 4C8QA 4XK8E 2XK0A 2ZPIB 3QKJA 4RCBA 4MMKA 3OYBA 2B8AA 5GANf 2E6NA 3SFMA 5GAMh 2JNGA 4M78E 4RG8A 3SWNC 3OMCA 1K73C 3C4SA 3M57A 4JRQA 3JCMX 2VGMA 1N9SA 5HY6A 2RJDA 4C92E 3R6OA 2QA4A 2VC8A 4M7AG 2HD0A 2PQWA 3CCMT 2L5QA 2PU9B 3CPFA 3M54A 3QO3A 3A8HB 4J5YA 5GANd 1BKBA 1Q86C 1WPYA 3KBGA 3SB2A 3X28B 4D6WA 4M7AF 1VQ5A 3OB9A 5GAN2 2JTFA 4PJOG 2A3LA 3WVDB 2HQEA 4PJOD 2WSEE 5LJ3f 2K2VA 5GAOq 2RHIA 2Y4XA 4HA8A 1QVGS 4C92A 2NLUA 4PLIA 2LT1A 2FHDA 2XKOC 1VQ9A 4PJOF 1N8RC 3CC4T 4BD3A 3JCMg 3QDRB 4KT0E 2DKGA 3V7CA 4C5EA 4ZGJB 4IUVA 4KUIA 1BIAA 1Y07A 4QVCA 2OTLT 2K3YA 3CBMA 3QZ5B 1YI2T 4LDYA 2K4YA 2DPPB 5CKFA 1JJ2S 2QQAA 1I81A 2HQXA 2LX9A 3BW1A 3H8ZA 4KBMB 4M77C 5LJ3d 4F7UF 3OY9A 3CCEA 1VQKT 1VQPT 4C8QD 1VQNA 3CCLA 3OSSC 4E47A 4E7JA 4BI3A 4M7DB 3RMQA 3N5BB 3I55T 4GLKA 3NTHA 4EMKB 4BY6B 2K57A 3J7AF 4J7IA 4OB0B 4VUBA 3X20B 1YHQT 3ZFJA 4ME7A 3E19A 2H3JA 5GAMe 1KC8U 2CKKA 3LX7A 4M75C 1HXDA 1K9MU 1M5Q1 3A8GB 3FJPA 2XI9A 1BI0A 2LCCA 2XDPA 2CZ0B 1YJWT 4M78G 3CCMA 4BB7A 2YRVA 2RM4A 3MP6A 3CXCS 2D9TA 4PLLA 1UGPB 4B9XA 1QVFS 1LJOA 2QTXA 3BDLA 4LDWA 3JCMb 2BUDA 3LYIA 3L2UA 4M78F 5D6XA 4M7AB 1GXIE 2M16A 4JUVA 3V8KA 2MMPA 4C92D 2CZ6B 2GQVA 4XTXA 3BFMA 2KMTA 4Q5WA 5I2SA 1N27A 4GY5A 3L1AA 3CPWS 5D6YA 4C92F 5J39A 3OYGA 3CC4A 4PNOA 2LNVA 2KVQG 2EIFA 4QVZA 1K8AU 2DO3A 2JOYA 1M1KU 2OTLA 1YI2A 3NTKA 4M7DE 2O4XB 5FU6B 2CZ7B 3LLRA 2K5LA 1VQKA 2MF2A 2RI5A 1B34A 2DVEA 2O01E 1R8OB 3HKSA 1P92A 4LDVA 4X9CA 4F7UB 4ZN1A 1VQPA 1YIJT 4QQGA 4DA4A 3CC7T 3I55A 1X75C 3UPUA 2DJZA 4NL2A 3OS2A 3CCUT 4C8QB 2LDMA 1YHQA 3DKMA 2QI2A 3M55A 1NPPA 1MGQA 4L6V5 4LD6A 3PNWC 4PKCC 3GOXA 3HFNA 4O6JA 3G71T 5GMKm 1VQLT 3JCMe 2XHCA 3DLLA 3SD4A 2P0KA 3M5AA 1YJWA 2X4XA 1NE8A 1FWZA 2ZPBB 3A8LB 3OYIA 5GMKl 2V8IA 3BY7A 3FDRA 5GAMj 3L2QA 1KG1A 3CBPA 4A4FA 3HSBA 5FU7C 1KHIA 3M9QA 1QVPA 2E5QA 3A8OB 3CCST 4JS5A 2BIVA 4E7IA 1W2BS 1M90U 5CKBA 5FROA 2YHTA 1PSFA 3JCMJ 4JRIA 3MP1A 2RO0A 4Z02A 3L42A 1ZQ1A 4MMLA 4C92B 3CCRT 4CI0C 4HCBA 2K5IA 2R58A 2P0PA 3A5ZB 4BDYA 2ZPEB 2F5KA 3GLXA 4XAXB 2X4YA 4OF1A 4OP0A 3M53A 4C8QE 1YIJA 3META 4IUQA 3CC7A 3OW2A 2OAUA 2RHUA 4LDUA 4B9WA 5GAMf 2RA2A 2X4JA 4M7DG 3CCUA 5CQXA 1G3TA 3MEVA 3QIIA 2DXTA 4XU3A 5KCOA 2KDSA 3OYLA 1Q7YC 3A8MB 3EAEA 2EYQA 2JVVA 3P8HA 4E7HA 1M1KC 4LDXA 2E64A 3X25B 2E65A 3BDUA 5LJ5h 4M7DF 3WVEB 3OYHA 3E9FA 4IKFA 4M7AC 3FC3A 3ER0A 3G71A 1N6AA 2D0QB 1VQLA 5FRMA 3M4YA 1NJIC 1UEBA 4BACA 4BE0A 4XU0A 4KUDK 1U8RA 4OB3B 1M1FA 2FB7A 1XOVA 2GCXA 4MZTA 3GIBA 4PJOC 1VIFA 3J81E 2QQSA 3OYDA 5GAOr 3FB9A 3TCJA 4N0AC 5KCHA 3CCSA 5FU6C 4C5GA 5CKHA 4MZPA 4PJOB 2XICA 2E12A 2I2LA 2LRQA 2M1HA 3GNFB 3QXEB 3V7SA 4ZGEB 5GANg 1YJNT 4C5IA 3JCMQ 3CCRA 3S3MA 5FLXE 2Y4YA 5LL6S 1W4SA 3FLGA 3O8VA 1M8VA 3M4GA 1NPRA 1Y71A 4JJNK 3F70A 4A4EA 4MZMA 3RUXA 1BI3A 4EDUA 3JB9J 4F7UG 1B34B 1WGSA 3JB9I 4M77A 1YBYA 1QW1A 4P5NA 2RB6A 3OQ5A 4A4KA 3GPLA 1Q82U 3PIPA 3LWIA 1BYMA 2RJEA 1Y96A 1AHJB 2DAQA 2RI3A 4C8QG 5CAIA 1WJQA 5LJ3g 3HFOA 4R55A 2RD1A 3G4ST 3G7ZA 4J83A 1KHCA 3DB4A 2LT4A 4NL3A 4X34A 4C8QF 1JJ2A 4M78C 3JB9D 5LJ5e 5C0MA 1H3ZA 2RHXA 4M75A 4ELZC 4C0ZA 3JCMh 5DLOA 1M9SA 5AYFA 1TH7A 2KY9A 2RK2A 3X26B 4BUGA 2LVMA 3HRTA 4C92C 4CRIA 5GAN6 3OYKA 3HRUA 3OYCA 3KXTA 2CS7A 3QBYA 2KAFA 4MDXA 3G6ET 1YJNA 1XNIA 2XD0A 5KE3A 5GMKi 3OYJA 3RERA 3QYGB 3V7RA 4C92G 5GMKe 5IT9E 5DY9A 1G5VA 3EFRA 3TU4K 3CXCA 1V29B 2R5AA 3QPHA 5GAN7 1QVFA 4L5GA 4ZGDB 2QDYB 1UGQB 3CBOA 3DB3A 4M77D 4J6XA 2JTMA 3E9GA 3LW5E 1ZHIA 1OZ2A 1I8FA 2V8KA 5IN1A 3CPWA 1KQSA 1VIEA 2EQMA 4FSXA 1WJRA 4TVRA 3G4SA 4II1A 1OI1A 2GFUA 2FYKA 3PMTA 2JUFA 1NZ9A 3RKYA 5GANe 3GNGA 4XTUA 3TREA 2GFAA 4ELYC 2VXFA 3URGA 4JDSA 4ZTJA 3CEYA 4HCCA 2PVOB 2DIQA 2RI2A 2YLBA 2EQKA 2RHZA 4XQ3A 3VUZA 1M1GA 4OMFB 1Q82C 2EQUA 2R57A 5IAYA 5LJ5j 1RL2A 2DZ9A 1VQ7T 5A0GA 5HKCA 3FRNA 4FM4B 3G6EA 1VQ6T 1D3BA 3CMET 3J80E 3OBYA 3UDCA 3VV0A 5LJ3e 1DJ7B 2EWNA 5CCAA 2WSCE 1FXXA 2DZCA 4NS5A 4FL6A 1G3YA 4FU6A 2PVGB 3HPWA 3M58A 4A54A 3JRZA 3MP8A 4N4HA 2DIGA 1SSFA 1BI2A 1KC8C 4HKEA 3P8DA 4JLGA 5CKDA 1K9MC 4E7LA 5GMKj 2EJ9A 3FIFA 1G3SA 3RKWA 1W2BA 4M7DC 1OZ3A 1WQ7A 4BI8B 4LD9K 4EMKC 4BI4A 4BY6C 5GAN5 2XU8A 2ZCFB 4JRKA 3VJPA 4A53A 4C0GA 3JCMW 4UC4A 1I5LA 2LC4A 3WXMB 5LJ5f 1IZ6A 1O9SA 4X9DA 5KH6A 5CK9A 2ZPHB 4C5HA 4OVAA 1Y96B 1VQOT 2KQWA 2HBPA 1KQ1A 2MWPA 3GP8A 4QQ6A 2G3RA 2JN0A 1MHNA 3JB9H 3NFCA 2MWOA 3PGGA 2YLCA 2VV5A 2L3RA 4PL6A 1K8AC 4M7AA 3C12A 3VU3C 2EJFA 5J26A 1ZBXA 5CKEA 3SWNA 4XU1A 3OW2S 4RCCA 4OGCA 5D6WA 4Y28E 5GAMd 1VQ7A 5CO7A 3S6WA 5GAMg 1LNXA 4ATOA 4PJOA 1VQ6A 2CYZB 2ZZDA 4C0DB 4BE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q G;  5CAI A;  5LJ3 g;  3QSU A;  4EMH A;  4XTX A;  3QUI A;  3HFO A;  3BFM A;  2RD1 A;  2EJG A;  4M7A E;  4XTZ A;  4M77 B;  3L1A A;  4NL3 A;  4C92 F;  4PJO B;  4PNO A;  1WNL A;  1X01 A;  4C8Q F;  4M78 C;  3JB9 D;  5GMK h;  1LOJ A;  5LJ5 e;  4M77 E;  3V8J A;  4M7D E;  4PJO E;  4M75 A;  4QVD A;  5LJ3 j;  3JCM h;  3EFS A;  4M78 B;  5GAO m;  1B34 A;  2DVE A;  1TH7 A;  1U1S A;  4NOY A;  4X9C A;  4F7U B;  3V8L A;  1JBM A;  4C92 C;  5GAO l;  4V2S A;  4C8Q C;  5GAN 6;  4J6W A;  3RIR A;  3JCM V;  5GAN j;  5LJ5 d;  2Y90 A;  4F7U E;  4M75 B;  2DTH A;  2DJZ A;  2E10 A;  4NL2 A;  5LJ5 g;  4C8Q B;  3RKX A;  1HK9 A;  4DQ2 A;  5GMK i;  4M75 E;  3RER A;  2DTO A;  1MGQ A;  3V7R A;  4C92 G;  5GMK e;  4N0A A;  2E41 A;  3JCM f;  5DY9 A;  5GAN h;  4M7A D;  3EFR A;  3HFN A;  5GMK m;  3JCM e;  5GAN 7;  4M78 A;  2VXE A;  4XTV A;  3L2Z A;  1WQW A;  4F7U A;  3JCM P;  3JB9 G;  4M77 D;  5GMK l;  4M7D D;  4J6X A;  3BY7 A;  4Y91 A;  5GAM j;  4EMG A;  1BIB A;  2DXU A;  4XTY A;  5GAO n;  3HSB A;  3JB9 F;  4C8Q A;  1I8F A;  3JCM d;  1YCY A;  4RCB A;  4MMK A;  5GAN f;  1D3B B;  2YHT A;  5GAM h;  3JCM J;  4JRI A;  2FYK A;  4M78 E;  3RKY A;  4MML A;  3SWN C;  5GAN e;  4C92 B;  5LJ3 h;  4XTU A;  3AHU A;  1M8V A;  5I21 A;  2VXF A;  3JCM X;  1N9S A;  4C92 E;  2YLB A;  4JLI A;  4OP0 A;  4C8Q E;  2VC8 A;  4XQ3 A;  3RES A;  4M7A G;  4J6Y A;  3QO3 A;  4J5Y A;  5GAN d;  5LJ5 j;  1WPY A;  2DZ9 A;  3SB2 A;  5GAM f;  2E1H A;  2RA2 A;  4M77 G;  4M7A F;  4M7D G;  5GAN 2;  1N9R A;  4PJO G;  4PJO D;  1D3B A;  4XU3 A;  2DXT A;  2HNI A;  5LJ3 f;  5GAO q;  4HT9 A;  4HA8 A;  4C92 A;  5LJ3 e;  2EWN A;  4M77 F;  4M7D F;  2E64 A;  5LJ5 h;  2E65 A;  3BDU A;  4PJO F;  2DZC A;  2DEQ A;  4M78 D;  3JCM g;  2DKG A;  3V7C A;  4M7A C;  5GAN 8;  1BIA A;  4QVC A;  4A54 A;  5GAN 3;  4XU0 A;  1I4K 1;  1H64 1;  1I81 A;  3BW1 A;  2EJ9 A;  2FB7 A;  3FIF A;  4M75 G;  4M75 D;  4M77 C;  1WQ7 A;  3RKW A;  2EAY A;  5LJ3 d;  4C8Q D;  5GAO r;  3SWN B;  2ZGW A;  3GIB A;  1U1T A;  3FB9 A;  4XTW A;  4N0A C;  4EMK C;  5GAN 5;  4JRK A;  5GAO p;  4A53 A;  3JCM W;  1I5L A;  4M7D B;  4M75 F;  5LJ5 f;  4X9D A;  4EMK B;  2I2L A;  1KQ2 A;  1Y96 B;  2K57 A;  5GAN g;  3V7S A;  4F7U F;  1KQ1 A;  3JCM Q;  2JN0 A;  3JB9 H;  3PGG A;  5GAM e;  2CGH A;  5GMK j;  4M75 C;  1HXD A;  3M4G A;  2YLC A;  4HT8 A;  3JCM c;  1M5Q 1;  1JRI A;  3FJP A;  4M7D C;  4M7A A;  4PJO C;  3QHS A;  3VU3 C;  3RUX A;  4M78 G;  4WF2 A;  2EJF A;  3JB9 J;  2RM4 A;  3SWN A;  4XU1 A;  1B34 B;  3INZ A;  4F7U G;  4XU2 A;  3JB9 I;  4RCC A;  1LJO A;  2QTX A;  2DTI A;  4M77 A;  3JCM b;  5GAM d;  4M7D A;  2RB6 A;  5GAM g;  4PJO A;  1LNX A;  4M78 F;  4M7A B;  4JUV A;  3V8K A;  4EMK A;  1Y96 A;  5GAN 4;  4C92 D; 
#chains in the Genus database with same CATH topology
 3CME A;  3CCV T;  2EJG A;  4DOV A;  1VQP Q;  2EFI A;  3I5S A;  5KYU A;  3HL8 A;  4M77 E;  3MCA B;  5A0D A;  1MMA A;  2DF6 A;  4J6W A;  5I22 A;  3S3N A;  1VQO A;  5KE2 A;  4JS4 A;  3G6E Q;  1QVG A;  5GAN h;  3OA6 A;  4GBQ A;  4RTV A;  2DLP A;  1VQ4 T;  1BIB A;  2RN8 A;  2XDD A;  3CCJ T;  3JSC A;  1XQH A;  4J9H A;  3OW2 P;  4E6R A;  2A7Y A;  1S72 A;  2QQR A;  2HKQ B;  2WAC A;  2C0I A;  4MDW A;  2ROL A;  4JLI A;  3RES A;  4IUP A;  2D0N A;  3CMA T;  2P4T A;  1ACM B;  4HT9 A;  1OQK A;  2AHJ B;  3CME Q;  3QG1 A;  2DEQ A;  5GAN 8;  4JRP A;  2X35 A;  3M56 A;  4ZN3 A;  1VQ8 T;  1JB0 E;  3OYY A;  3TVT A;  1H64 1;  5CVI A;  3CD6 T;  4PFO A;  3CC2 T;  1Q7Y U;  1KQS S;  3LGL A;  2BKD N;  2F2W A;  2C0T A;  2VKN A;  5J3B A;  1NJI U;  1VQO Q;  1TXQ A;  2KRM A;  4PJM A;  2DX1 A;  2YXY A;  3ZL7 C;  3QHS A;  2LQ8 A;  2XID A;  2B86 A;  2DRK A;  3INZ A;  4R56 A;  4XU2 A;  1IXD A;  2DTI A;  4M7D A;  1HYO A;  4QW2 A;  4D8D A;  1Q86 U;  2QGF B;  4EMK A;  3AHU A;  3MHX A;  5GAN 4;  3H6Z A;  3UWN A;  2JS0 A;  2COY A;  4M7A E;  5CQY A;  4XTZ A;  2WSF E;  2RJF A;  1IRX A;  1QP3 A;  4RMO A;  2CH4 W;  1AWJ A;  1LOJ A;  3QZ9 B;  2DXB A;  1VQM A;  5A0L A;  3L2R A;  4QVD A;  5GAO m;  1S72 Q;  1HSQ A;  2QA4 T;  2JT4 A;  3V8L A;  4V2S A;  4HCZ A;  2AZV A;  2LJ1 A;  2Y90 A;  5KYW B;  5LJ5 g;  2QQ9 A;  2R5M A;  2LQN A;  1TSF A;  1PM3 A;  2EKH A;  3FEO A;  4N0A A;  3DLM A;  4OB1 B;  4J9F A;  1RI0 A;  3O5Z A;  2DD5 A;  3REB B;  3JCM P;  2D8H A;  1VQN T;  4C8Q A;  1JEG A;  1ARK A;  2DIL A;  2DYB A;  4RCB A;  3OYB A;  4M78 E;  2KBT A;  1K73 C;  3A98 A;  3M57 A;  4JRQ A;  1N9S A;  2EQI A;  2EYY A;  4C92 E;  2HEQ A;  2VC8 A;  5FW9 A;  2PQW A;  3M0R A;  3QO3 A;  5GAN d;  3A8H B;  5IXF A;  4B6M A;  1JXO A;  2JTF A;  2E4H A;  4PJO D;  5GAO q;  1QVG S;  2NLU A;  4PLI A;  2LT1 A;  3TQ7 P;  4PJO F;  1K73 R;  1N8R C;  3CC4 T;  4BD3 A;  4C5E A;  2DKG A;  1S1N A;  1D09 B;  1YNZ A;  1YI2 T;  2DPP B;  5CKF A;  2QQA A;  1OU9 A;  3H8Z A;  3OY9 A;  3BW1 A;  1VQK T;  3CCE A;  4K11 A;  3CCL A;  1UDL A;  4E47 A;  3RMQ A;  1M27 C;  1X6G A;  3EGD B;  1YHQ T;  3ZFJ A;  5GJW B;  1LVK A;  4M75 C;  2XI9 A;  2YRC A;  3CXC S;  4PLL A;  4B9X A;  4LDW A;  3JCM b;  3VS1 A;  4A63 B;  1RLP C;  3MJX A;  3QWY A;  1RAE B;  3L1A A;  4PJO B;  2NYS A;  4PNO A;  4QVZ A;  1K76 A;  1W70 A;  2LCS A;  2MOX A;  5FU6 B;  2X3W D;  3LLR A;  1OOT A;  2MF2 A;  3QDF A;  3HKS A;  1WI7 A;  2DVE A;  1R8O B;  4LDV A;  4ZN1 A;  1BK2 A;  4X9C A;  3EHQ A;  2COW A;  4QQG A;  4PFP A;  3I55 A;  1JJ2 P;  3CCU T;  4OML A;  2LDM A;  2RF0 A;  1RUW A;  3REA B;  3G71 T;  2FEI A;  3M5A A;  1YJW A;  3OYI A;  2CUB A;  5GAM j;  2JMA A;  5FU7 C;  2BIV A;  1D1C A;  1WXU A;  5FRO A;  1LCK A;  4JZ3 A;  1QVF P;  4JRI A;  3MP1 A;  3L42 A;  1ZQ1 A;  4CC7 A;  4HCB A;  4X1V A;  1PKT A;  3GLX A;  4XAX B;  2X4Y A;  4OF1 A;  3PVQ A;  4OP0 A;  2YUQ A;  2KT8 A;  2NUZ A;  3UA6 A;  2OAU A;  4B9W A;  5GAM f;  2X4J A;  2KGT A;  3NPF A;  4XU3 A;  3QII A;  1IGU A;  4CC2 A;  2E5K A;  1M1K C;  4F14 A;  4M7D F;  2HL5 C;  3WVE B;  4IKF A;  5FRM A;  2D0Q B;  2KNB B;  2DL7 A;  2JXB A;  4OB3 B;  2FB7 A;  2QEX Q;  4MZT A;  2OX7 A;  1VIF A;  3J81 E;  3FB9 A;  4N0A C;  1AWX A;  2LRQ A;  2SRC A;  5GAN g;  1YJN T;  3I55 Q;  3CCR A;  5LL6 S;  3ULR B;  1I1J A;  1M8V A;  3M4G A;  1NPR A;  4OMQ A;  2X9H A;  4MZM A;  2DEU A;  1WGS A;  2KT1 A;  2GGR A;  1UFF A;  1WJQ A;  4R55 A;  2RD1 A;  3G7Z A;  2OAW A;  2RQU A;  5IHN A;  4C8Q F;  3JB9 D;  4KRT A;  3M0P A;  5C0M A;  1GBQ A;  4ELZ C;  2RQT A;  4C0Z A;  1MUZ A;  2KY9 A;  4BUG A;  4RTW A;  2MCN A;  3HRT A;  2O9S A;  2GBQ A;  3QBY A;  2W10 A;  2FPE A;  5KE3 A;  3OYJ A;  3M0Q A;  2KE9 A;  3LH5 A;  4OMN A;  5DY9 A;  1V29 B;  1OPL A;  5GAN 7;  4ZGD B;  1RAD B;  4LUD A;  2QDY B;  3DB3 A;  4M77 D;  1NLO C;  2JTM A;  2O31 A;  4E7S A;  5L23 A;  2BZY A;  3G4S A;  1OI1 A;  2GFU A;  1AWO A;  4HVV A;  5GAN e;  1UHC A;  4XTU A;  3TRE A;  2GFA A;  3CCR Q;  4ZTJ A;  3CEY A;  2PVO B;  2EQK A;  1GRI A;  2EQU A;  2R57 A;  1N5Z A;  5LJ5 j;  1RL2 A;  5HKC A;  1ZSZ C;  2K9G A;  3EHR A;  1FXX A;  2A37 A;  2AZS A;  3EG9 A;  1KC8 C;  1PD0 A;  1K9M C;  3FIF A;  1W2B A;  1WQ7 A;  4BI8 B;  5GAN 5;  3VJP A;  1I5L A;  1TG0 A;  2EPD A;  1NYG A;  5LJ5 f;  5KH6 A;  5CK9 A;  2ZPH B;  4C5H A;  4OVA A;  1Y96 B;  2J6O A;  2AKL A;  4RUG A;  1NBE B;  2KQW A;  1KQ1 A;  2MWP A;  4QQ6 A;  3VS5 A;  4LNP A;  1QKX A;  3NFC A;  2RNA A;  1D0Y A;  1H8K A;  2FPD A;  1UE9 A;  1K8A C;  1ZA1 B;  5CKE A;  4XU1 A;  5D6W A;  5GAM d;  4ATO A;  2L2P A;  2YUP A;  1BCO A;  1SF9 A;  1MV0 B;  4C0D B;  3Q1J A;  3QUI A;  2DYI A;  2EBP A;  3SHW A;  3OYM A;  1Y7X A;  3PFS A;  3ASK A;  2HAX A;  2E70 A;  1MNE A;  3CCQ T;  1UGR B;  3V8J A;  5LJ3 j;  2QYZ A;  2LQK A;  3UA7 A;  2LJ0 A;  2F5T X;  2JZ2 A;  2YDL A;  3LWH A;  3RKX A;  2HBW A;  1OUL A;  1EIF A;  1HK9 A;  2GF7 A;  4M75 E;  4M7A D;  4Y92 A;  3I56 T;  3JB9 G;  1PRM C;  2QAS A;  1QKW A;  1RAB B;  4RTT A;  2VVK A;  3HRS A;  5KYW A;  2J05 A;  3GF5 A;  3CCV A;  1WX6 A;  2F2X A;  1D3B B;  4J8O A;  1TWB A;  3OS5 A;  2D6F A;  4KH0 B;  5LJ3 h;  1JO8 A;  3CC7 Q;  2KYB A;  2ZPF B;  1Q86 R;  4RKU E;  2RK1 A;  1KD1 U;  4ZTF A;  3RBB B;  2J06 A;  1Q81 U;  2M0Y A;  4LN2 A;  4M77 G;  1E6G A;  4FSS A;  2FL7 A;  3E1S A;  3TEE A;  3NTI A;  3BE3 A;  4M78 D;  1RAH B;  2NUP B;  4RTZ A;  3EG3 A;  1I4K 1;  1VQ4 A;  2MI6 A;  2IG0 A;  2ZGW A;  3CCJ A;  4XTW A;  5GAO p;  3UAT A;  5C6S A;  4IUR A;  3H0F A;  5L8R E;  1VYU A;  5HK3 A;  1NM7 A;  1PSE A;  3H41 A;  3JCM c;  2CP6 A;  3A1P A;  4ANJ A;  4KUL A;  1NEB A;  4HCK A;  3CMA A;  1VUB A;  3QSU A;  1IRE B;  3JAM E;  3ME9 A;  2PUO B;  3LGF A;  2QXF A;  1VQ8 A;  4IIM A;  1GCQ A;  2X4W A;  4M78 B;  4GLM A;  3QJY A;  4NOY A;  1U5S A;  4O5V A;  3CD6 A;  2FRW A;  2FVU A;  5GAO l;  3RIR A;  3CC2 A;  4BDZ A;  2HQH A;  1UG1 A;  5GAN j;  5LJ5 d;  4A4G A;  5A2Q E;  1VQ5 T;  1FX7 A;  3ZBD A;  1K0X A;  1WFW A;  3L2W A;  1KQS P;  1ZSG A;  3VYG A;  1JQQ A;  2VXE A;  3L2Z A;  1WQW A;  3S3O A;  2FG0 A;  3PIO A;  2V8J A;  3CQT A;  1Z9Z A;  2ZPI B;  2DFU A;  4MMK A;  3CCJ Q;  5KYY A;  1AVZ C;  2B8A A;  5GAN f;  2E6N A;  3OMC A;  3C4S A;  2J6K A;  3C0C A;  4RTX A;  3M0T A;  2QA4 A;  1PRL C;  4M7A G;  3CCM T;  3CPF A;  2DMO A;  1YN8 A;  1BKB A;  3VRZ A;  3SB2 A;  3X28 B;  3OB9 A;  2A3L A;  3TSW A;  1MV3 A;  3H9N A;  1TOV A;  4HA8 A;  4AFZ C;  2DL8 A;  3V7C A;  2CT3 A;  1QWF A;  4IUV A;  4KUI A;  2OTL T;  4QVC A;  1H3H A;  3CBM A;  3QZ5 B;  1FYN A;  2K4Y A;  2XMF A;  1A0N B;  2LX9 A;  1VQ8 Q;  5EC7 A;  4KBM B;  5LJ3 d;  4F7U F;  2D8J A;  1VQP T;  1VQN A;  3EG9 B;  4E7J A;  4BI3 A;  1V1C A;  3N5B B;  1E7O A;  4J7I A;  4J9B A;  4RTU A;  2KRN A;  3E19 A;  4LXC A;  5GAM e;  1KC8 U;  2CKK A;  1K9M U;  1VQ6 Q;  2XDP A;  4M78 G;  4BB7 A;  1YP5 A;  2RM4 A;  2D9T A;  1UGP B;  1LJO A;  2QTX A;  4FYW B;  4KGV B;  1TTH B;  3LYI A;  4E7Z A;  2HSE B;  2MMP A;  2CZ6 B;  2GQV A;  2JTE A;  5I2S A;  4Q5W A;  3CPW S;  3CC4 A;  3OYG A;  1K8A U;  2EIF A;  2DO3 A;  2HSP A;  2JOY A;  1X43 A;  2YWW A;  1YI2 A;  4J9I A;  1QVG P;  2K5L A;  1VQK A;  1Z9Q A;  4F7U B;  4F04 B;  4NL2 A;  2CDT A;  1YHQ A;  2QI2 A;  2BE9 B;  2DNU A;  1MGQ A;  2GNC A;  3PNW C;  3DLL A;  1I07 A;  2EGA A;  2ZPB B;  3SEM A;  3BY7 A;  2LP5 A;  1KG1 A;  1CKB A;  1UEC A;  1QVP A;  2E5Q A;  3CCS T;  4E7I A;  1K0S A;  1VQN Q;  5CKB A;  3CXC P;  4DBR A;  4CI0 C;  3A5Z B;  2ZPE B;  2F5K A;  1D0X A;  1UTI A;  2RHU A;  2RA2 A;  3CCU A;  2DXT A;  4FYV B;  1GCQ C;  3EAE A;  2JVV A;  4LDX A;  2E64 A;  3BDU A;  2PZ1 A;  2K3B A;  3E9F A;  3FC3 A;  3G71 A;  2MIO A;  3M4Y A;  3CC4 Q;  1UEB A;  4BE0 A;  1U8R A;  1YI2 Q;  4PJO C;  5GAO r;  5FWB A;  1VQK Q;  5FU6 C;  4C5G A;  4MZP A;  3GNF B;  1D1A A;  1E6H A;  1X2K A;  4CC4 B;  3JCM Q;  4AMC A;  4OMP A;  1Y71 A;  2RQW A;  1M30 A;  1MMD A;  1UGV A;  3RUX A;  2GTJ A;  1SRL A;  4EDU A;  4F7U G;  3VS7 A;  3JB9 I;  4M77 A;  4P5N A;  1Y57 A;  1Q82 U;  2RB6 A;  3OQ5 A;  1BYM A;  2RJE A;  1Y96 A;  1VQM Q;  5CAI A;  5LJ3 g;  3HFO A;  2D1X A;  1KHC A;  3DB4 A;  4X34 A;  1JJ2 A;  5LJ5 e;  5DLO A;  3JCM h;  1M9S A;  3IQL A;  1TH7 A;  1M90 R;  2LVM A;  5GAN 6;  3HRU A;  3KXT A;  4MDX A;  1YWP A;  2I0N A;  1YJN A;  3CCU Q;  1KK7 A;  3V7R A;  1G5V A;  3EFR A;  3TU4 K;  1SKU B;  3QPH A;  1QVF A;  1PHT A;  3G71 Q;  1G8X A;  4RTY A;  2VB6 A;  1OZ2 A;  4FYX B;  2V8K A;  3EG1 A;  2EQM A;  2KR3 A;  2O9V A;  4FSX A;  4TVR A;  1SG5 A;  2DL3 A;  2NWM A;  2G6F X;  2VXF A;  2O88 A;  5KYY B;  1X6B A;  2RI2 A;  4M4Z A;  2RHZ A;  4XQ3 A;  1M1G A;  4OMF B;  2LNH B;  4IIO A;  5IAY A;  1VQ7 T;  1D3B A;  1YWO A;  3OBY A;  2RQV A;  3UDC A;  5LJ3 e;  1DJ7 B;  2M02 A;  5CCA A;  3CCE Q;  1RAG B;  4NS5 A;  2ENM A;  3HPW A;  3M58 A;  3CCL Q;  1AWW A;  1GL5 A;  4N4H A;  2DIG A;  2IIM A;  4HKE A;  5CKD A;  3M0S A;  5GMK j;  2ED1 A;  4M7D C;  1OZ3 A;  4EMK C;  4BY6 C;  4JRK A;  4C0G A;  4A53 A;  3JCM W;  3WXM B;  1C1A A;  1TS9 A;  3GP8 A;  1YJN Q;  2NUP A;  2MWO A;  3PGG A;  2VV5 A;  1F1B B;  4M7A A;  2EJF A;  4D8K A;  2DL4 A;  4OGC A;  2A0F B;  5CO7 A;  4LUE A;  2RPN A;  2CYZ B;  1KD1 R;  3QJ6 A;  1NG2 A;  1BCM A;  1T3S A;  2QTV A;  1SEM A;  1WNL A;  5GMK h;  1U3O A;  1PC0 A;  3OMG A;  4OGE A;  3KUF A;  1C0M A;  3ZEH A;  4C8Q C;  1IO6 A;  2M9U A;  1PKS A;  2DXC A;  3T9N A;  1YJW Q;  2A28 A;  3EGX B;  1T0J A;  4HXJ A;  2VWF A;  2V1R A;  1NEG A;  2E3H A;  1WJS A;  3E2U A;  4M78 A;  4XTV A;  2K5F A;  2K3X A;  4EMG A;  2DD4 A;  3H0I A;  3HHT B;  1R0C B;  3JB9 F;  3JCM d;  1OEB A;  2XG8 D;  2V26 A;  1YCY A;  5IHK A;  5FU7 B;  3C95 A;  2QEX T;  2VGN A;  1T3L A;  2V1Q A;  5I21 A;  2RMO A;  3CCQ A;  1OYX A;  2KRO A;  2P0Q A;  2DK3 A;  2KEA A;  3NGP A;  4E7K A;  3EH1 A;  2EQJ A;  4FIB A;  1BI1 A;  2EW3 A;  2E1H A;  2W0Z A;  3VS0 A;  1N9R A;  1RAC B;  1NLP C;  1QQJ A;  2F1L A;  2VUB A;  3OS0 A;  1KIK A;  4M77 F;  5HK0 A;  4N4I A;  5I2M A;  4C0D C;  3M59 A;  2FZG B;  1ZA2 B;  5GJV B;  3I56 A;  3OBW A;  2OTJ T;  4IUU A;  1YIT T;  4M75 G;  3SWN B;  2BZ8 A;  1IGQ A;  4PFZ A;  3VKI A;  8ATC B;  2ZPG B;  3I9Q A;  2RH2 A;  2CGH A;  1RAI B;  1YJ9 T;  1UB4 A;  1K73 U;  1JRI A;  3LH0 A;  2YSQ A;  4RG2 A;  4DOW A;  2CUD A;  4KH1 B;  3OS1 A;  4M77 B;  2FZC B;  4YTL A;  2LTO A;  1BB9 A;  1N8R U;  1TUC A;  4C0F A;  4EPC A;  4PJO E;  3CCQ Q;  2BE7 D;  1M8M A;  1JBM A;  1UGS B;  2ECZ A;  3MKD A;  1WHG A;  4FT2 A;  2DTH A;  2M51 A;  4FW1 A;  2OI3 A;  1QWE A;  2HZY A;  1MND A;  3VYH B;  4DQ2 A;  2MPX C;  1GFD A;  2F69 A;  1VQ9 T;  1OV3 A;  2E41 A;  2DER A;  1WHL A;  4F7U A;  3G4S Q;  1M4Z A;  3EG0 A;  3OYF A;  3L2V A;  2ATC B;  3I56 Q;  2RJC A;  2EKO A;  3PT9 A;  1G83 A;  4OB2 B;  1R0B G;  4XK8 E;  2XK0 A;  3QKJ A;  3SFM A;  2JNG A;  2C0O A;  2E3I A;  3JCM X;  2VGM A;  5HY6 A;  2RJD A;  3R6O A;  1EX4 A;  2DET A;  2L5Q A;  3FJ5 A;  1Q7Y R;  1Q86 C;  2NUT B;  1WPY A;  3KBG A;  4D6W A;  4M7A F;  1VQ5 A;  2DM1 A;  3WVD B;  2HQE A;  1W2B P;  2CRE A;  5LJ3 f;  1NJI R;  2RHI A;  2J7I A;  2FHD A;  3JCM g;  3QDR B;  4ZGJ B;  2K3Y A;  1EFN A;  2ED0 A;  1QCN A;  2HQX A;  1GFC A;  3OSS C;  4HVW A;  4LE9 A;  2K57 A;  4OB0 B;  3X20 B;  4J9C A;  2H3J A;  1SHG A;  1ZBJ A;  3LX7 A;  1HXD A;  3A8G B;  1BI0 A;  2LCC A;  2CZ0 B;  1W1F A;  5KYX B;  3CCM A;  2YRV A;  1MMN A;  3MP6 A;  4JPB W;  4M78 F;  4JJB A;  4M7A B;  4JUV A;  2FPF A;  1OU8 A;  3V8K A;  4C92 D;  2KMT A;  4GY5 A;  5D6Y A;  4C92 F;  5J39 A;  1WHM A;  2KVQ G;  1M1K U;  2OTL A;  4M7D E;  2PNI A;  2DJQ A;  2RI5 A;  2O01 E;  1YIJ T;  1VQP A;  3CC7 T;  1X75 C;  2DJZ A;  3OS2 A;  1VQ5 Q;  1NPP A;  4LD6 A;  4PKC C;  1WZO A;  1AT1 B;  3HFN A;  3I35 A;  5GMK m;  1VQL T;  1MMG A;  3JCM e;  3CCV Q;  1NE8 A;  3A8L B;  2V8I A;  3FDR A;  2RQR A;  1UJ0 A;  1QLY A;  2A08 A;  3HSB A;  1KFZ A;  1KHI A;  3A8O B;  4JS5 A;  2KYM A;  1W2B S;  2YHT A;  1KJW A;  4C92 B;  2R58 A;  2P0P A;  1X27 A;  2L0A A;  4C8Q E;  3CPW P;  3OW2 A;  3CCM Q;  4LDU A;  5CQX A;  4JJC A;  3MEV A;  3OYL A;  2KDS A;  4WCI A;  2EYQ A;  3P8H A;  3PE0 A;  4E7H A;  1VQ4 Q;  1Y0M A;  2E65 A;  4XU0 A;  1ZUU A;  1M1F A;  1XOV A;  2GCX A;  1ZX6 A;  2QQS A;  3CCS A;  3TCJ A;  5KCH A;  2VAS A;  1I0C A;  1TUG B;  2XIC A;  2M1H A;  4ZGE B;  3V7S A;  2YUO A;  4FW2 A;  4C5I A;  3AT1 B;  1W4S A;  3RDV A;  4DEY A;  1B7T A;  4F17 A;  3F70 A;  3CMA Q;  8AT1 B;  2DE0 X;  1CKA A;  2LJ3 A;  1B34 B;  1QW1 A;  4KGX B;  3LWI A;  2HMA A;  2RI3 A;  2Z0W A;  2KI7 A;  3CD6 Q;  4NL3 A;  1GBR A;  1AEY A;  3CC2 Q;  4M75 A;  2CT4 A;  5AYF A;  2RK2 A;  2F2V A;  2CS7 A;  1KSW A;  2EVR A;  3G6E T;  1PWT A;  1XNI A;  1VYT A;  2K6D A;  2XD0 A;  2FZK B;  9ATC B;  4C92 G;  5GMK e;  5IT9 E;  3CXC A;  2L3P A;  4L5G A;  1VYV A;  2YUN A;  5I11 A;  1UGQ B;  1PG5 B;  3E9G A;  3LW5 E;  2X3X D;  1K1Z A;  4ESR A;  1ZHI A;  4QT7 A;  1WJR A;  3D7S B;  3EGX A;  3VRY A;  3CCS Q;  2QA4 Q;  1V76 A;  2FYK A;  3PMT A;  2BTT A;  4R0K A;  4OMM A;  3VS3 A;  4QKU A;  4ELY C;  3URG A;  4JDS A;  4HCC A;  3VUZ A;  1B07 A;  1M3A A;  2EYX A;  2DZ9 A;  1B3Q A;  5A0G A;  4FM4 B;  1VQ6 T;  1NYF A;  3CME T;  3VV0 A;  2EWN A;  5IHI A;  1X2Q A;  1G3Y A;  4FU6 A;  2PVG B;  1FMW A;  3VS6 A;  4A54 A;  3JRZ A;  3VS2 A;  3P8D A;  4JLG A;  2LZ6 B;  4E7L A;  4ORZ A;  2EJ9 A;  4OMO A;  3RKW A;  4LD9 K;  2JW4 A;  2P4R A;  4UC4 A;  2LC4 A;  1IZ6 A;  1VQO T;  4J9E A;  4WTO B;  2JN0 A;  1MHN A;  3JB9 H;  1I5O B;  1IHV A;  2CSI A;  2YLC A;  2GTO A;  3C12 A;  2J6F A;  5J26 A;  1ZBX A;  3SWN A;  3OW2 S;  4RCC A;  3R6N A;  1VQ7 A;  3G1J A;  2ZZD A;  4BE1 A;  4EMH A;  2CP2 A;  2O4X A;  1R77 A;  1LPL A;  1PNJ A;  5FRN A;  2E6Z A;  4FT4 A;  3HP9 A;  4AG1 C;  4JJD A;  1S72 T;  1M2V B;  3MO8 A;  3EFS A;  1YHQ Q;  1QP2 A;  5EG2 A;  1UJY A;  1U1S A;  2ABL A;  1K9A A;  2QGG A;  2E10 A;  2ESW A;  3EFO A;  1M90 C;  4N4G A;  2DTO A;  3OYA A;  3JCM f;  3RR6 A;  2DRM A;  3RMS A;  3C94 A;  2RHY A;  1SRM A;  4A4H A;  1C6V X;  2DXU A;  4XTY A;  2C06 A;  2QAZ A;  2XDB A;  1G3W A;  4JZ4 A;  4ZNX A;  1WXB A;  2L3Q A;  1WHJ A;  3MPU B;  4IUT A;  1FMK A;  2AK5 A;  2P84 A;  3VUB A;  2PTK A;  3QYH B;  4J6Y A;  5DM7 R;  5CR2 A;  3UT1 A;  2L3S A;  2LCL A;  1N8R R;  4QQD A;  1X6O A;  1WXT A;  5M9O A;  2EYW A;  1VQ7 Q;  2HNI A;  3MEU A;  2OJ2 A;  1WHK A;  1AZG B;  3KFV A;  4AFQ C;  4BE2 A;  5GAN 3;  2HKN A;  1VQM T;  1M2O A;  5CIU A;  3UF4 A;  2NUT A;  4M75 D;  2EAY A;  3SDZ A;  1U1T A;  2COZ A;  4M75 F;  2PVD B;  4J7F A;  1M3B A;  1ZUK A;  1ZSZ A;  2QEX A;  2HL3 A;  1XTD A;  1QMC A;  1O75 A;  4HT8 A;  2H3E B;  4PJL A;  2CZ1 B;  5IXB A;  5KYU B;  3MEA A;  4WF2 A;  1H92 A;  2PUK B;  2MK5 A;  3OYE A;  2M0O A;  3P8B B;  2JS2 A;  4L59 A;  4F16 A;  3EGU A;  4KGZ B;  2MAM A;  2QQB A;  4J9D A;  3OSV A;  1W6X A;  1X01 A;  1KD1 C;  2KSS A;  2L8D A;  4DBH A;  4DBQ A;  2VYT A;  5KYX A;  2KK4 A;  2OTJ A;  1YIT A;  1Q81 C;  2L89 A;  2IPO B;  4Z8A A;  3PTA A;  2IVW A;  3NHN A;  5DLQ E;  3PVL A;  3JCM V;  1M3C A;  4F7U E;  4M75 B;  2DA9 A;  1ZUY A;  2AKK A;  1SPK A;  2MYS A;  1YJ9 A;  1RLQ C;  3OYN A;  3PMI A;  1G2B A;  1Q81 R;  3I5R A;  1CSK A;  3MEW A;  1UUE A;  4M7D D;  1XJW B;  2K7A A;  4Y91 A;  1UHF A;  3CCE T;  4DEX A;  1U06 A;  5GAO n;  3CCL T;  3X24 B;  5GAM h;  2QG9 B;  1WIE A;  2LMJ A;  4RG8 A;  3SWN C;  2DVJ A;  2FRY A;  2LQW A;  1WLP B;  2ROT A;  2HD0 A;  2PU9 B;  3M54 A;  4J5Y A;  1M1K R;  3JV3 A;  5GAN 2;  4PJO G;  1BBZ A;  2WSE E;  2K2V A;  1FMV A;  2Y4X A;  4C92 A;  1VQ9 A;  2XKO C;  1T0H A;  1D0Z A;  4KT0 E;  1TUD A;  1BIA A;  1Y07 A;  4FCY A;  4LDY A;  4Z88 A;  1JJ2 S;  1I81 A;  4M77 C;  2ZAE A;  1GCP A;  2OTJ Q;  2JMC A;  4C8Q D;  1YIT Q;  4M7D B;  3I55 T;  4GLK A;  3NTH A;  4EMK B;  4BY6 B;  2H8H A;  2FO0 A;  3J7A F;  4VUB A;  1AD5 A;  2CP7 A;  1VOM A;  4ME7 A;  5D7U A;  5IH2 A;  2LX7 A;  1M5Q 1;  3FJP A;  1YJ9 Q;  3THK A;  1YJW T;  1QVF S;  3BDL A;  2BUD A;  5D6X A;  1WDX A;  1GXI E;  2M16 A;  2CP0 A;  4XTX A;  3BFM A;  1N27 A;  1WYX A;  2BZX A;  2LNV A;  2JJ9 A;  4E2F B;  3NTK A;  2O4X B;  2CZ7 B;  2JM8 A;  1B34 A;  1P92 A;  1RI9 A;  4DA4 A;  1BU1 A;  3UPU A;  1K4U S;  4C8Q B;  2CP3 A;  3DKM A;  3M55 A;  4L6V 5;  3GOX A;  1HJD A;  4FYY B;  3EFO B;  1VQ9 Q;  4O6J A;  2XHC A;  3SD4 A;  2P0K A;  2DBM A;  2X4X A;  1FWZ A;  5GMK l;  3L2Q A;  3CBP A;  3VS4 A;  1ZLM A;  2AT1 B;  4A4F A;  3M9Q A;  1M90 U;  1YFN A;  3HTR A;  2O2O A;  1YCS B;  1PSF A;  3JCM J;  1VA7 A;  2RO0 A;  4Z02 A;  4MML A;  3CCR T;  2K5I A;  4AFS C;  4BDY A;  2KRS A;  2CSQ A;  3M53 A;  1YIJ A;  3MET A;  1IB8 A;  1OX9 A;  2DL5 A;  4IUQ A;  5AT1 B;  3CC7 A;  4EIK A;  4M7D G;  2GQI A;  1G3T A;  4AT1 B;  5KCO A;  1Q7Y C;  3A8M B;  1KC8 R;  5LJ5 h;  3X25 B;  1K9M R;  3EG2 A;  3OYH A;  4M7A C;  3ER0 A;  1VQL A;  1N6A A;  2KXC A;  1NJI C;  4BAC A;  2EGC A;  4KUD K;  3GIB A;  3OYD A;  4CC3 A;  5CKH A;  2E12 A;  2I2L A;  1KQ2 A;  3QXE B;  1K8A R;  3S3M A;  5FLX E;  2Y4Y A;  3FLG A;  1JXM A;  3O8V A;  4HVU A;  4JJN K;  4A4E A;  1ZSZ B;  1BI3 A;  1ABQ A;  3JB9 J;  1X69 A;  2HCK A;  2QK0 A;  1OPK A;  1YBY A;  4A4K A;  3GPL A;  4J9G A;  1Q95 G;  2EGE A;  3PIP A;  1RAA B;  1AHJ B;  2DAQ A;  4C8Q G;  3G4S T;  4PK4 A;  4J83 A;  2LT4 A;  4M78 C;  1H3Z A;  1SHF A;  2RHX A;  1JU5 C;  3X26 B;  4C92 C;  4CRI A;  3OYK A;  1YIJ Q;  1J3T A;  3RNJ A;  3OYC A;  1AZE A;  2KAF A;  3U23 A;  2EYZ A;  2JM9 A;  5HCK A;  5KYN A;  5ECA A;  1AOJ A;  5GMK i;  3RER A;  3QYG B;  2KXD A;  2R5A A;  1M2V A;  3QWX X;  4PJJ A;  2SEM A;  1VQL Q;  3CBO A;  4J6X A;  2QDL A;  1QCF A;  2YT6 A;  3GBQ A;  3TSZ A;  1IHW A;  1I8F A;  5IN1 A;  3EH2 A;  3CPW A;  1KQS A;  1EZZ B;  1VIE A;  4II1 A;  7AT1 B;  2JUF A;  1NZ9 A;  3RKY A;  3NMZ C;  3GNG A;  1SSH A;  5FWC A;  2DBK A;  1HD3 A;  2CH4 A;  2K2M A;  2DIQ A;  2YLB A;  1ABO A;  1Q82 C;  1TU0 B;  4Z89 A;  2CP5 A;  3FRN A;  3G6E A;  3J80 E;  2WSC E;  4DBF A;  2DZC A;  4FL6 A;  2K79 A;  3MP8 A;  3M0U A;  1SSF A;  1BI2 A;  6AT1 B;  2HDA A;  4AFU C;  1Q82 R;  1G3S A;  3EGD A;  2A36 A;  1QCO A;  1WA7 A;  2X51 A;  1WHH A;  2XU8 A;  4BI4 A;  1D1B A;  2ZCF B;  1O9S A;  4X9D A;  4PJN A;  2YRD A;  2HBP A;  2G3R A;  1PCX A;  2L3R A;  4PL6 A;  3VU3 C;  4AG2 C;  3H0H A;  1PD1 A;  1RAF B;  4Y28 E;  4PJO A;  3S6W A;  5GAM g;  1LNX A;  2OTL Q;  2AIR B;  1VQ6 A;  1OX8 A;  3L2U A; 
#chains in the Genus database with same CATH homology
 3QJ6 A;  3CME A;  3CCV T;  3Q1J A;  4EMH A;  2O4X A;  3QUI A;  5FRN A;  2EJG A;  4DOV A;  2E6Z A;  3OYM A;  1Y7X A;  3PFS A;  4FT4 A;  1WNL A;  3ASK A;  2EFI A;  3HP9 A;  2HAX A;  1S72 T;  2E70 A;  5GMK h;  3HL8 A;  3CCQ T;  1UGR B;  4M77 E;  3V8J A;  3MCA B;  3OMG A;  5LJ3 j;  3MO8 A;  3EFS A;  1QP2 A;  4OGE A;  3KUF A;  2LQK A;  1U1S A;  5EG2 A;  5A0D A;  3ZEH A;  4C8Q C;  4J6W A;  2F5T X;  2JZ2 A;  2M9U A;  2DXC A;  3T9N A;  2E10 A;  3S3N A;  3LWH A;  3RKX A;  1VQO A;  5KE2 A;  1M90 C;  1EIF A;  1HK9 A;  4JS4 A;  4N4G A;  2GF7 A;  4M75 E;  1QVG A;  2DTO A;  3OYA A;  3JCM f;  5GAN h;  4M7A D;  3RMS A;  3C94 A;  3OA6 A;  1WJS A;  4M78 A;  2RHY A;  4XTV A;  3I56 T;  3JB9 G;  2K5F A;  4A4H A;  2K3X A;  1VQ4 T;  4EMG A;  2DD4 A;  1BIB A;  2DXU A;  4XTY A;  2C06 A;  3HHT B;  2XDD A;  3HRS A;  3CCJ T;  3JSC A;  2XDB A;  3JB9 F;  3GF5 A;  3JCM d;  1G3W A;  1XQH A;  2XG8 D;  3CCV A;  1YCY A;  5FU7 B;  1D3B B;  4J8O A;  1KQ2 A;  3C95 A;  2QEX T;  4IUT A;  2VGN A;  3OS5 A;  2D6F A;  5LJ3 h;  2A7Y A;  1S72 A;  2ZPF B;  5I21 A;  2QQR A;  4RKU E;  3CCQ A;  2WAC A;  1OYX A;  2RK1 A;  1KD1 U;  2P0Q A;  4MDW A;  2DK3 A;  3VUB A;  4E7K A;  4JLI A;  3QYH B;  3RES A;  4J6Y A;  4ZTF A;  5DM7 R;  4IUP A;  5CR2 A;  1Q81 U;  2EQJ A;  4FIB A;  3UT1 A;  1BI1 A;  2LCL A;  2E1H A;  4QQD A;  1X6O A;  4M77 G;  1N9R A;  5M9O A;  3CMA T;  2P4T A;  2HNI A;  2FL7 A;  3MEU A;  4HT9 A;  3E1S A;  2VUB A;  3TEE A;  3OS0 A;  3NTI A;  2AHJ B;  4M77 F;  5HK0 A;  3QG1 A;  2DEQ A;  4M78 D;  4N4I A;  5I2M A;  5GAN 8;  2X35 A;  4JRP A;  4C0D C;  3M56 A;  4ZN3 A;  3M59 A;  4BE2 A;  3I56 A;  1VQ8 T;  1JB0 E;  3OYY A;  5GAN 3;  1VQM T;  1I4K 1;  3OBW A;  2OTJ T;  1H64 1;  4IUU A;  5CVI A;  1YIT T;  4M75 G;  5CIU A;  1VQ4 A;  2MI6 A;  4M75 D;  2IG0 A;  2EAY A;  3CD6 T;  3SDZ A;  3SWN B;  2ZGW A;  3CCJ A;  1U1T A;  4XTW A;  5GAO p;  3CC2 T;  1Q7Y U;  1KQS S;  3LGL A;  4M75 F;  2PVD B;  5C6S A;  4IUR A;  4J7F A;  2BKD N;  3VKI A;  5L8R E;  2QEX A;  2ZPG B;  5J3B A;  1NJI U;  1XTD A;  2RH2 A;  2CGH A;  5HK3 A;  1O75 A;  1PSE A;  1YJ9 T;  1UB4 A;  4HT8 A;  3JCM c;  1K73 U;  1JRI A;  2CZ1 B;  3LH0 A;  3QHS A;  2LQ8 A;  3MEA A;  4WF2 A;  4RG2 A;  2XID A;  4KUL A;  2PUK B;  3INZ A;  4R56 A;  4XU2 A;  4DOW A;  3OYE A;  2M0O A;  2DTI A;  4M7D A;  3P8B B;  4L59 A;  4QW2 A;  1Q86 U;  3CMA A;  4EMK A;  3AHU A;  1VUB A;  3MHX A;  5GAN 4;  3H6Z A;  2MAM A;  1IRE B;  2QQB A;  3OSV A;  3UWN A;  3QSU A;  3JAM E;  3ME9 A;  3OS1 A;  4M7A E;  2PUO B;  5CQY A;  4XTZ A;  3LGF A;  2QXF A;  4M77 B;  1X01 A;  2WSF E;  2RJF A;  2KSS A;  2LTO A;  1QP3 A;  4YTL A;  4RMO A;  1KD1 C;  1N8R U;  1VQ8 A;  2L8D A;  1LOJ A;  3QZ9 B;  2DXB A;  4C0F A;  4EPC A;  2VYT A;  5A0L A;  3L2R A;  2KK4 A;  1VQM A;  4PJO E;  2OTJ A;  4QVD A;  5GAO m;  1YIT A;  4M78 B;  2X4W A;  1Q81 C;  2QA4 T;  2L89 A;  3QJY A;  4NOY A;  4O5V A;  3PTA A;  3CD6 A;  3V8L A;  1JBM A;  1UGS B;  2IVW A;  2FVU A;  5GAO l;  4V2S A;  5DLQ E;  3RIR A;  3JCM V;  4HCZ A;  4BDZ A;  3CC2 A;  5GAN j;  5LJ5 d;  2Y90 A;  4F7U E;  4FT2 A;  2DTH A;  4M75 B;  4A4G A;  2QQ9 A;  1FX7 A;  2R5M A;  3ZBD A;  5LJ5 g;  5A2Q E;  1VQ5 T;  3VYH B;  4DQ2 A;  2F69 A;  3L2W A;  1VQ9 T;  3FEO A;  4N0A A;  2E41 A;  3DLM A;  4OB1 B;  1YJ9 A;  1RI0 A;  3OYN A;  3VYG A;  2DD5 A;  3PMI A;  2VXE A;  3L2Z A;  1WQW A;  4F7U A;  3MEW A;  3JCM P;  1M4Z A;  3S3O A;  4M7D D;  3OYF A;  3L2V A;  4Y91 A;  2RJC A;  3CCE T;  3PIO A;  2EKO A;  2V8J A;  5GAO n;  1VQN T;  3PT9 A;  3CCL T;  3X24 B;  4OB2 B;  4C8Q A;  4XK8 E;  2XK0 A;  2ZPI B;  3QKJ A;  4RCB A;  4MMK A;  3OYB A;  2B8A A;  5GAN f;  2E6N A;  3SFM A;  5GAM h;  2JNG A;  4M78 E;  4RG8 A;  3SWN C;  3OMC A;  1K73 C;  3C4S A;  3M57 A;  4JRQ A;  3JCM X;  2VGM A;  1N9S A;  5HY6 A;  2RJD A;  4C92 E;  3R6O A;  2QA4 A;  2VC8 A;  4M7A G;  2HD0 A;  2PQW A;  3CCM T;  2L5Q A;  2PU9 B;  3CPF A;  3M54 A;  3QO3 A;  3A8H B;  4J5Y A;  5GAN d;  1BKB A;  1Q86 C;  1WPY A;  3KBG A;  3SB2 A;  3X28 B;  4D6W A;  4M7A F;  1VQ5 A;  3OB9 A;  5GAN 2;  2JTF A;  4PJO G;  2A3L A;  3WVD B;  2HQE A;  4PJO D;  2WSE E;  5LJ3 f;  2K2V A;  5GAO q;  2RHI A;  2Y4X A;  4HA8 A;  1QVG S;  4C92 A;  2NLU A;  4PLI A;  2LT1 A;  2FHD A;  2XKO C;  1VQ9 A;  4PJO F;  1N8R C;  3CC4 T;  4BD3 A;  3JCM g;  3QDR B;  4KT0 E;  2DKG A;  3V7C A;  4C5E A;  4ZGJ B;  4IUV A;  4KUI A;  1BIA A;  1Y07 A;  4QVC A;  2OTL T;  2K3Y A;  3CBM A;  3QZ5 B;  1YI2 T;  4LDY A;  2K4Y A;  2DPP B;  5CKF A;  1JJ2 S;  2QQA A;  1I81 A;  2HQX A;  2LX9 A;  3BW1 A;  3H8Z A;  4KBM B;  4M77 C;  5LJ3 d;  4F7U F;  3OY9 A;  3CCE A;  1VQK T;  1VQP T;  4C8Q D;  1VQN A;  3CCL A;  3OSS C;  4E47 A;  4E7J A;  4BI3 A;  4M7D B;  3RMQ A;  3N5B B;  3I55 T;  4GLK A;  3NTH A;  4EMK B;  4BY6 B;  2K57 A;  3J7A F;  4J7I A;  4OB0 B;  4VUB A;  3X20 B;  1YHQ T;  3ZFJ A;  4ME7 A;  3E19 A;  2H3J A;  5GAM e;  1KC8 U;  2CKK A;  3LX7 A;  4M75 C;  1HXD A;  1K9M U;  1M5Q 1;  3A8G B;  3FJP A;  2XI9 A;  1BI0 A;  2LCC A;  2XDP A;  2CZ0 B;  1YJW T;  4M78 G;  3CCM A;  4BB7 A;  2YRV A;  2RM4 A;  3MP6 A;  3CXC S;  2D9T A;  4PLL A;  1UGP B;  4B9X A;  1QVF S;  1LJO A;  2QTX A;  3BDL A;  4LDW A;  3JCM b;  2BUD A;  3LYI A;  3L2U A;  4M78 F;  5D6X A;  4M7A B;  1GXI E;  2M16 A;  4JUV A;  3V8K A;  2MMP A;  4C92 D;  2CZ6 B;  2GQV A;  4XTX A;  3BFM A;  2KMT A;  4Q5W A;  5I2S A;  1N27 A;  4GY5 A;  3L1A A;  3CPW S;  5D6Y A;  4C92 F;  5J39 A;  3OYG A;  3CC4 A;  4PNO A;  2LNV A;  2KVQ G;  2EIF A;  4QVZ A;  1K8A U;  2DO3 A;  2JOY A;  1M1K U;  2OTL A;  1YI2 A;  3NTK A;  4M7D E;  2O4X B;  5FU6 B;  2CZ7 B;  3LLR A;  2K5L A;  1VQK A;  2MF2 A;  2RI5 A;  1B34 A;  2DVE A;  2O01 E;  1R8O B;  3HKS A;  1P92 A;  4LDV A;  4X9C A;  4F7U B;  4ZN1 A;  1VQP A;  1YIJ T;  4QQG A;  4DA4 A;  3CC7 T;  3I55 A;  1X75 C;  3UPU A;  2DJZ A;  4NL2 A;  3OS2 A;  3CCU T;  4C8Q B;  2LDM A;  1YHQ A;  3DKM A;  2QI2 A;  3M55 A;  1NPP A;  1MGQ A;  4L6V 5;  4LD6 A;  3PNW C;  4PKC C;  3GOX A;  3HFN A;  4O6J A;  3G71 T;  5GMK m;  1VQL T;  3JCM e;  2XHC A;  3DLL A;  3SD4 A;  2P0K A;  3M5A A;  1YJW A;  2X4X A;  1NE8 A;  1FWZ A;  2ZPB B;  3A8L B;  3OYI A;  5GMK l;  2V8I A;  3BY7 A;  3FDR A;  5GAM j;  3L2Q A;  1KG1 A;  3CBP A;  4A4F A;  3HSB A;  5FU7 C;  1KHI A;  3M9Q A;  1QVP A;  2E5Q A;  3A8O B;  3CCS T;  4JS5 A;  2BIV A;  4E7I A;  1W2B S;  1M90 U;  5CKB A;  5FRO A;  2YHT A;  1PSF A;  3JCM J;  4JRI A;  3MP1 A;  2RO0 A;  4Z02 A;  3L42 A;  1ZQ1 A;  4MML A;  4C92 B;  3CCR T;  4CI0 C;  4HCB A;  2K5I A;  2R58 A;  2P0P A;  3A5Z B;  4BDY A;  2ZPE B;  2F5K A;  3GLX A;  4XAX B;  2X4Y A;  4OF1 A;  4OP0 A;  3M53 A;  4C8Q E;  1YIJ A;  3MET A;  4IUQ A;  3CC7 A;  3OW2 A;  2OAU A;  2RHU A;  4LDU A;  4B9W A;  5GAM f;  2RA2 A;  2X4J A;  4M7D G;  3CCU A;  5CQX A;  1G3T A;  3MEV A;  3QII A;  2DXT A;  4XU3 A;  5KCO A;  2KDS A;  3OYL A;  1Q7Y C;  3A8M B;  3EAE A;  2EYQ A;  2JVV A;  3P8H A;  4E7H A;  1M1K C;  4LDX A;  2E64 A;  3X25 B;  2E65 A;  3BDU A;  5LJ5 h;  4M7D F;  3WVE B;  3OYH A;  3E9F A;  4IKF A;  4M7A C;  3FC3 A;  3ER0 A;  3G71 A;  1N6A A;  2D0Q B;  1VQL A;  5FRM A;  3M4Y A;  1NJI C;  1UEB A;  4BAC A;  4BE0 A;  4XU0 A;  4KUD K;  1U8R A;  4OB3 B;  1M1F A;  2FB7 A;  1XOV A;  2GCX A;  4MZT A;  3GIB A;  4PJO C;  1VIF A;  3J81 E;  2QQS A;  3OYD A;  5GAO r;  3FB9 A;  3TCJ A;  4N0A C;  5KCH A;  3CCS A;  5FU6 C;  4C5G A;  5CKH A;  4MZP A;  4PJO B;  2XIC A;  2E12 A;  2I2L A;  2LRQ A;  2M1H A;  3GNF B;  3QXE B;  3V7S A;  4ZGE B;  5GAN g;  1YJN T;  4C5I A;  3JCM Q;  3CCR A;  3S3M A;  5FLX E;  2Y4Y A;  5LL6 S;  1W4S A;  3FLG A;  3O8V A;  1M8V A;  3M4G A;  1NPR A;  1Y71 A;  4JJN K;  3F70 A;  4A4E A;  4MZM A;  3RUX A;  1BI3 A;  4EDU A;  3JB9 J;  4F7U G;  1B34 B;  1WGS A;  3JB9 I;  4M77 A;  1YBY A;  1QW1 A;  4P5N A;  2RB6 A;  3OQ5 A;  4A4K A;  3GPL A;  1Q82 U;  3PIP A;  3LWI A;  1BYM A;  2RJE A;  1Y96 A;  1AHJ B;  2DAQ A;  2RI3 A;  4C8Q G;  5CAI A;  1WJQ A;  5LJ3 g;  3HFO A;  4R55 A;  2RD1 A;  3G4S T;  3G7Z A;  4J83 A;  1KHC A;  3DB4 A;  2LT4 A;  4NL3 A;  4X34 A;  4C8Q F;  1JJ2 A;  4M78 C;  3JB9 D;  5LJ5 e;  5C0M A;  1H3Z A;  2RHX A;  4M75 A;  4ELZ C;  4C0Z A;  3JCM h;  5DLO A;  1M9S A;  5AYF A;  1TH7 A;  2KY9 A;  2RK2 A;  3X26 B;  4BUG A;  2LVM A;  3HRT A;  4C92 C;  4CRI A;  5GAN 6;  3OYK A;  3HRU A;  3OYC A;  3KXT A;  2CS7 A;  3QBY A;  2KAF A;  4MDX A;  3G6E T;  1YJN A;  1XNI A;  2XD0 A;  5KE3 A;  5GMK i;  3OYJ A;  3RER A;  3QYG B;  3V7R A;  4C92 G;  5GMK e;  5IT9 E;  5DY9 A;  1G5V A;  3EFR A;  3TU4 K;  3CXC A;  1V29 B;  2R5A A;  3QPH A;  5GAN 7;  1QVF A;  4L5G A;  4ZGD B;  2QDY B;  1UGQ B;  3CBO A;  3DB3 A;  4M77 D;  4J6X A;  2JTM A;  3E9G A;  3LW5 E;  1ZHI A;  1OZ2 A;  1I8F A;  2V8K A;  5IN1 A;  3CPW A;  1KQS A;  1VIE A;  2EQM A;  4FSX A;  1WJR A;  4TVR A;  3G4S A;  4II1 A;  1OI1 A;  2GFU A;  2FYK A;  3PMT A;  2JUF A;  1NZ9 A;  3RKY A;  5GAN e;  3GNG A;  4XTU A;  3TRE A;  2GFA A;  4ELY C;  2VXF A;  3URG A;  4JDS A;  4ZTJ A;  3CEY A;  4HCC A;  2PVO B;  2DIQ A;  2RI2 A;  2YLB A;  2EQK A;  2RHZ A;  4XQ3 A;  3VUZ A;  1M1G A;  4OMF B;  1Q82 C;  2EQU A;  2R57 A;  5IAY A;  5LJ5 j;  1RL2 A;  2DZ9 A;  1VQ7 T;  5A0G A;  5HKC A;  3FRN A;  4FM4 B;  3G6E A;  1VQ6 T;  1D3B A;  3CME T;  3J80 E;  3OBY A;  3UDC A;  3VV0 A;  5LJ3 e;  1DJ7 B;  2EWN A;  5CCA A;  2WSC E;  1FXX A;  2DZC A;  4NS5 A;  4FL6 A;  1G3Y A;  4FU6 A;  2PVG B;  3HPW A;  3M58 A;  4A54 A;  3JRZ A;  3MP8 A;  4N4H A;  2DIG A;  1SSF A;  1BI2 A;  1KC8 C;  4HKE A;  3P8D A;  4JLG A;  5CKD A;  1K9M C;  4E7L A;  5GMK j;  2EJ9 A;  3FIF A;  1G3S A;  3RKW A;  1W2B A;  4M7D C;  1OZ3 A;  1WQ7 A;  4BI8 B;  4LD9 K;  4EMK C;  4BI4 A;  4BY6 C;  5GAN 5;  2XU8 A;  2ZCF B;  4JRK A;  3VJP A;  4A53 A;  4C0G A;  3JCM W;  4UC4 A;  1I5L A;  2LC4 A;  3WXM B;  5LJ5 f;  1IZ6 A;  1O9S A;  4X9D A;  5KH6 A;  5CK9 A;  2ZPH B;  4C5H A;  4OVA A;  1Y96 B;  1VQO T;  2KQW A;  2HBP A;  1KQ1 A;  2MWP A;  3GP8 A;  4QQ6 A;  2G3R A;  2JN0 A;  1MHN A;  3JB9 H;  3NFC A;  2MWO A;  3PGG A;  2YLC A;  2VV5 A;  2L3R A;  4PL6 A;  1K8A C;  4M7A A;  3C12 A;  3VU3 C;  2EJF A;  5J26 A;  1ZBX A;  5CKE A;  3SWN A;  4XU1 A;  3OW2 S;  4RCC A;  4OGC A;  5D6W A;  4Y28 E;  5GAM d;  1VQ7 A;  5CO7 A;  3S6W A;  5GAM g;  1LNX A;  4ATO A;  4PJO A;  1VQ6 A;  2CYZ B;  2ZZD A;  4C0D B;  4BE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...