2RQUA

Solution structure of the complex between the ddef1 sh3 domain and the apc samp1 motif
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
VRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords DDEF1_SH3
total genus 12
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rquA00
1NYGA 1SRMA 4HVUA 1ABOA 2FEIA 2K6DA 2EVRA 3VS6A 2V1QA 2K3BA 2RNAA 1BB9A 4JJCA 2LJ1A 1U5SA 2ROTA 2L3PA 2O9SA 1X2QA 2BZYA 2YT6A 3A98A 3REBB 1WYXA 2ENMA 3VRZA 2M0YA 3RNJA 2HDAA 4OMMA 1K9AA 2DYBA 2KGTA 2VKNA 1UJ0A 2F2VA 2DRKA 2KR3A 1HJDA 4AFUC 2J7IA 3EG2A 4RTZA 1RLPC 1X6GA 3M0QA 2EYYA 2KNBB 1AVZC 4Z88A 4DEXA 3M0SA 4DEYA 1FYNA 2KT1A 3H0FA 1GBRA 3VS3A 4D8DA 4RTYA 2D1XA 1GBQA 1ZX6A 2JMCA 2CH4W 2LCSA 2MIOA 2DVJA 1QKWA 2DRMA 3SEMA 2RMOA 2DJQA 1M3AA 1HD3A 1SEMA 2X3XD 3QWXX 2D0NA 4F14A 3I35A 1ZLMA 2FG0A 4WCIA 2GNCA 3EG1A 5GJVB 1QWFA 2O88A 2GTJA 1SHFA 2DLPA 2LJ3A 1EFNA 3NMZC 1MV3A 1Z9ZA 2BZ8A 1YN8A 1OEBA 2EYWA 1ZUYA 2M51A 3UA6A 2CT4A 1VA7A 1NG2A 2RN8A 3EG0A 1ARKA 1T0JA 3UF4A 1K1ZA 1Z9QA 4JZ3A 3ULRB 1TG0A 1JXOA 4J9DA 3IQLA 1KFZA 1I0CA 5I11A 1AZGB 2NUZA 3M0PA 3PVLA 2HSPA 1MV0B 1UG1A 2FO0A 1T3SA 1B07A 1GFDA 3VS2A 3TSZA 2RQTA 1OPKA 5IHKA 1AOJA 1UECA 2YUNA 2LNHB 4ESRA 2K79A 4RTTA 2P4RA 4HXJA 2DMOA 2O9VA 1NLOC 2SRCA 2GGRA 2DNUA 1Y0MA 4J9GA 1RUWA 1GFCA 3PVQA 3RBBB 1RLQC 2KYMA 1WIEA 4X1VA 1PKSA 2YUOA 1BBZA 3QWYA 2EKHA 2FRWA 4RTWA 2AZVA 5I22A 2B86A 2SEMA 1WDXA 1PRMC 1WFWA 2EBPA 2L0AA 2OAWA 2DM1A 1YP5A 4OMPA 2VWFA 1W6XA 3CQTA 1NLPC 1E6GA 1G83A 5EC7A 4J9EA 4OMQA 1X43A 4ORZA 1GCPA 4EIKA 2JS0A 4J9IA 1K76A 1AEYA 1IO6A 4AFZC 2DX1A 1WX6A 2C0OA 1JEGA 1X69A 5IXFA 1K0SA 4RTVA 2CUBA 3TSWA 2KYBA 2EQIA 2H8HA 4GLMA 2KE9A 3R6NA 2HBWA 4HVVA 2YDLA 4K11A 2J6FA 2DL3A 4KRTA 5IH2A 3EG3A 1Y57A 2JS2A 3O5ZA 3KFVA 3TVTA 2CSIA 1W70A 4JJBA 2RQUA 1SHGA 2XMFA 1B3QA 2K7AA 1A0NB 2YUQA 2KBTA 2OI3A 2I0NA 2FPDA 2KXCA 4OMOA 1JO8A 2KT8A 5IXBA 1TUDA 2JTEA 1CSKA 2F2XA 1YWOA 2W10A 1BK2A 2IIMA 1QWEA 5HCKA 2CREA 1GL5A 3VRYA 3VS1A 3NPFA 1M3CA 4LN2A 1UHCA 2PNIA 2A36A 1AWWA 2RQRA 2J6KA 2C0TA 3NHNA 4GBQA 3THKA 1AD5A 4D8KA 3H0HA 1PKTA 1X2KA 2DL8A 3C0CA 2GQIA 2FPFA 2G6FX 1JQQA 1I07A 2CUDA 1QKXA 4J9BA 1WA7A 2D8HA 2JM8A 2LZ6B 1ZUUA 3I5SA 1WXTA 1ZSGA 2LQWA 1T0HA 2QDLA 4CC3A 1CKBA 1H3HA 1PWTA 2L2PA 5FWBA 2J06A 2DE0X 3H41A 3EHRA 4LUDA 2KEAA 1V1CA 2ECZA 4AFQC 1KIKA 1J3TA 4LNPA 1OPLA 1RI9A 2LJ0A 1UTIA 2DA9A 2EGAA 2MCNA 2YUPA 1BU1A 2EGEA 3M0RA 1VYVA 4IIOA 3UA7A 1NM7A 3VS0A 4M4ZA 3U23A 1ZUKA 4J9HA 1AWJA 4CC4B 4HVWA 4RTUA 1WXBA 1YCSB 2L3QA 1UDLA 3EHQA 1X6BA 4E6RA 2EYXA 1OV3A 4OMNA 1QLYA 1VYUA 2AK5A 2LMJA 5IHIA 2JW4A 1VYTA 2LP5A 1MUZA 2D8JA 2CH4A 1H92A 1UE9A 2DL7A 1G2BA 1M8MA 2ROLA 3M0TA 1QCFA 1PNJA 4LE9A 1M30A 1U3OA 2ED1A 1TUCA 2A37A 4A63B 1UFFA 1LCKA 2EW3A 2RQVA 4CC2A 2FRYA 1SPKA 2GBQA 2KRNA 2VVKA 4RUGA 1JXMA 1UJYA 2CDTA 2CSQA 1GCQC 3FJ5A 4HCKA 2EYZA 2ESWA 4F16A 1T3LA 2L3SA 1I1JA 3NGPA 3PE0A 1UGVA 1AWOA 2DL5A 1UUEA 2JMAA 1NEBA 5IHNA 1WXUA 2LQNA 4Z8AA 4J9CA 1X27A 2DILA 2F2WA 4JZ4A 1PHTA 2RF0A 2E5KA 1M3BA 3M0UA 1SRLA 5FWCA 1HSQA 2AZSA 3LH5A 2KXDA 4F17A 5ECAA 2C0IA 2ABLA 2CT3A 2A08A 2HEQA 4AG1C 4ZNXA 1H8KA 2EPDA 2X3WD 1OOTA 2J6OA 1N5ZA 2RPNA 1E6HA 1NYFA 5GJWB 2DBMA 1JU5C 4IIMA 4Y92A 2BZXA 2O31A 5L23A 2BTTA 3H0IA 4LUEA 4CC7A 2A28A 1WLPB 2DF6A 3JV3A 3UATA 2YSQA 2KROA 3REAB 1YNZA 2EGCA 1CKAA 3SHWA 1SSHA 4RTXA 3I9QA 1KSWA 1AWXA 1K0XA 2V1RA 2OJ2A 4Z89A 4FSSA 2GTOA 2FPEA 2AKKA 2O2OA 2JXBA 3VS7A 1M27C 2AKLA 2HCKA 2KRMA 2K2MA 2ED0A 2KRSA 2PZ1A 1W1FA 2DBKA 4JJDA 1XOVA 2DL4A 1YWPA 1KJWA 2NWMA 3ZL7C 2J05A 4J9FA 1S1NA 1E7OA 1ABQA 1FMKA 3VS4A 1PRLC 4R0KA 1AZEA 2LX7A 2JT4A 1U06A 1ZBJA 3GBQA 1GCQA 2K9GA 1K4US 4QT7A 3EGUA 4AFSC 2RQWA 1UHFA 2MOXA 2PTKA 1GRIA 3I5RA 4OMLA 3VS5A 4AG2C 2JM9A 1NEGA 2W0ZA 1WI7A 4JPBW 5FW9A
chains in the Genus database with same CATH superfamily
2FL7A 2AT1B 3META 4M77C 4XTUA 2QI2A 1NYGA 4A4HA 2A0FB 4N4GA 1MNDA 1OU9A 3SB2A 2EVRA 3VS6A 3RUXA 5KE2A 2RNAA 1PG5B 2Z0WA 2K3YA 1WJQA 2MK5A 1U8RA 1Q82R 2MMPA 4PJJA 2YT6A 4OGCA 4M75A 3JCMg 1H641 4PJOA 4OB3B 1D1BA 2HDAA 1K9AA 4HA8A 4M75D 3QYGB 3LYIA 1KG1A 4JRIA 2F2VA 3CCQT 1K73U 4OB0B 2KR3A 1HJDA 2LTOA 1QVGS 2VASA 2LCCA 5I21A 1X01A 1K9MU 2KNBB 2QQRA 1X6OA 7AT1B 4DEYA 5IT9E 2KT1A 5KYXB 5A0GA 4PJOB 1B34B 1VQ9T 3C94A 3VS3A 2QTXA 1V76A 1MGQA 1VQ8T 6AT1B 3ZEHA 4XTYA 4C92A 2DJQA 2PU9B 4QQDA 1HD3A 3RKXA 2QA4A 4C5GA 3I55Q 4IUTA 5KCOA 1ZLMA 2FG0A 2KMTA 3M55A 4A53A 5GJVB 5GANg 1XTDA 1Z9ZA 3ZBDA 1ZUYA 4IUUA 2M51A 2XDDA 1K73R 2CT4A 3VKIA 5KYWA 1ARKA 3ULRB 4J9DA 1KFZA 1K9MR 1I0CA 1VQPQ 4M7DC 2KVQG 5LJ3h 3H8ZA 3M0PA 1TTHB 3OBWA 1VQ4A 1MV0B 4LDVA 1B07A 4DOWA 1OULA 2RQTA 1G5VA 4C0DB 1I4K1 5CQXA 2BIVA 4A4FA 1RAFB 4KH1B 1H3ZA 3GIBA 4J6YA 4B6MA 5KYYA 4BI3A 2DMOA 1NLOC 3EFRA 2QYZA 3PVQA 1GFCA 1FWZA 2KYMA 3G1JA 4M77G 2LT4A 1W4SA 2WACA 4BY6B 5D6YA 3DLMA 1IHWA 2EKHA 4M7AF 2FRWA 2RJCA 3EFOA 5I22A 2YXYA 4BI8B 2B86A 2GQVA 2SEMA 3UT1A 1PRMC 2RI2A 2DYIA 2LDMA 1YP5A 4J7IA 2VWFA 1WQWA 3CQTA 5LJ5g 1NLPC 1M90C 1E6GA 4R55A 1G83A 5EC7A 2E1HA 2H3EB 3MEUA 1X43A 4QVDA 4ORZA 3OBYA 1SSFA 2K4YA 2JS0A 4EMKA 1VQMT 4KBMB 2X51A 4CI0C 3V7SA 4C0ZA 1WX6A 2JZ2A 1X69A 5A2QE 1K0SA 3SDZA 4F7UG 1KQSS 1V29B 3KXTA 2BUDA 4K11A 5LJ5h 5DM7R 2WSEE 1M9SA 1IB8A 3BE3A 3OYJA 4IURA 1YHQT 3CCUT 1YIJQ 1W70A 4ZTFA 1QW1A 1C1AA 1B3QA 5A0DA 1A0NB 2YUQA 1FXXA 3CCLT 3QG1A 3OS1A 2COWA 1QMCA 2OI3A 5HY6A 2FPDA 3E9FA 4OMFB 2E6NA 4OMOA 2XG8D 3PMTA 1M1KC 2JTEA 1CSKA 1BK2A 1OQKA 2IIMA 5HCKA 2K5IA 1EX4A 5I2MA 2V8KA 4DQ2A 4ANJA 3SD4A 5GANh 2DXBA 4M78G 1QP3A 4M7AC 2COYA 1UHCA 2PNIA 2A36A 3DB3A 1UGSB 1P92A 2LT1A 2RQRA 3L42A 3S3NA 2X4WA 2DTHA 4GBQA 2HD0A 4M75G 2HAXA 3M5AA 4PJOE 1PSEA 2E12A 2FPFA 4FYWB 1RABB 1QKXA 2D8HA 2VUBA 2F5TX 2P84A 1VQKT 2FYKA 4M7DF 4C8QE 5FWBA 3JRZA 3VUBA 2DE0X 4PJMA 3PFSA 4PK4A 2RD1A 5FLXE 1O75A 2HL5C 2DA9A 4M77F 3FJPA 1KHIA 4C0FA 1VYVA 3UA7A 3LLRA 4BB7A 1ZUKA 4J9HA 4CC4B 4KUIA 3L2RA 4HVWA 4M7AA 2DAQA 4DBFA 1JJ2A 3RERA 5KCHA 3EHQA 2O01E 3HRTA 3H6ZA 2AK5A 2LMJA 3ER0A 3P8DA 5IHIA 3A8LB 1KC8U 8ATCB 1JB0E 3CMAQ 4BE1A 3TU4K 3CC4Q 1WZOA 2M0OA 2RHIA 1I81A 2BE9B 3OYNA 1Q82U 3JAME 3E19A 1ZSZB 3CCLQ 2EYQA 2FRYA 3CPFA 5LJ3e 2X35A 1N27A 4XAXB 2KSSA 3PMIA 1UJYA 2CDTA 3CCRT 1D1AA 3FJ5A 4M77B 2DZCA 2KDSA 4C8QG 4XU1A 1BIAA 4C92E 1YITA 2Y4XA 5FU6C 1UGVA 4ZTJA 3GP8A 1AWOA 1ZA1B 3FLGA 1LJOA 2DL5A 3MEVA 3G4ST 2F2WA 3Q1JA 1GXIE 5CVIA 2E5KA 5KYUA 4J5YA 5CR2A 1SRLA 4MZMA 1VQ8A 2QDYB 4F17A 5CKBA 1QVGP 2CP6A 2CT3A 4C8QB 1VQ5A 4M7DE 5EG2A 2HEQA 4AG1C 1JJ2P 4FL6A 2COZA 3M54A 3HSBA 4J8OA 1H8KA 2EPDA 1NJIU 3R6OA 1JJ2S 3JCMc 2JN0A 2CYZB 1YJWQ 4LDUA 4Q5WA 5M9OA 1JU5C 4PJOF 1HYOA 2KAFA 5GAN8 2FZGB 1PD1A 1QVFA 2A28A 1WLPB 2DF6A 3RMSA 2NUPA 4FSXA 2GCXA 3OA6A 1QVFP 3SHWA 4RTXA 3CCMT 1XQHA 4WF2A 3I55T 1K0XA 1LOJA 1SF9A 2FPEA 2JTMA 5KYNA 1M27C 3PT9A 2DBKA 1D09B 2DL4A 3M58A 1QCNA 2LQKA 4M7AD 2J05A 1S1NA 3A8OB 4MZPA 4E7IA 4A54A 4QKUA 3UPUA 2K9GA 1K4US 5GAMh 3OYMA 2RQWA 2XU8A 4OMLA 2RHXA 4AG2C 2JM9A 2M16A 1YIJT 1WI7A 2QGGA 4BD3A 1SRMA 1ABOA 2FEIA 3OY9A 2K6DA 4JRKA 2K3BA 2IG0A 2K57A 2RM4A 1BB9A 2LVMA 4JJCA 2L3PA 1X2QA 4RG2A 2EWNA 1Q7YC 1DJ7B 2RH2A 5GAN5 1BCOA 2DPPB 3X20B 3CCJA 3JB9I 3OYHA 4M78C 1UJ0A 3FB9A 4NL2A 2BKDN 5GANd 4RTZA 1RLPC 1X6GA 1RACB 2M1HA 3M0QA 5GAMj 1YI2Q 4BE2A 2HNIA 1QVGA 4DEXA 1M1GA 1NZ9A 2CZ0B 2ZPFB 1K8AC 2ZPBB 1ACMB 2JVVA 5LJ3f 2MIOA 2YWWA 1QKWA 3SEMA 8AT1B 2LRQA 3QHSA 5LJ3g 3I35A 3UDCA 1D3BA 4WCIA 1QWFA 2O88A 4FW2A 2DLPA 2ZPIB 3NMZC 5LJ5j 3BDLA 1OEBA 2EYWA 3UA6A 3MEAA 1VQLQ 2RN8A 2K2VA 2IPOB 3HHTB 1AT1B 1T0JA 1K1ZA 5D6WA 2MWPA 4JZ3A 5J3BA 5GANj 3NFCA 1JXOA 3EFOB 1IZ6A 2HQHA 3NTHA 2QASA 2NUZA 1YBYA 1NE8A 2HSPA 1UG1A 1N8RU 1GFDA 1FX7A 5GAMe 2HBPA 3VS2A 4PL6A 1AOJA 3HRUA 1W2BA 2AHJB 4ESRA 4MMLA 2P4RA 4HXJA 4OB2B 1IHVA 2MPXC 3CCMA 5D7UA 2DNUA 4J9GA 2R5MA 3RBBB 1U1TA 3EAEA 4XK8E 4O5VA 2XD0A 1RLQC 4F04B 1BBZA 3QWYA 4DBQA 3G71T 1WHLA 4XU2A 3DLLA 4NL3A 1WFWA 2L0AA 4OMPA 1W6XA 4HCBA 2RB6A 4V2SA 3CMAT 2EQJA 3LGLA 4EMKB 4KGXB 3JCMb 3OW2A 1GCPA 2ZCFB 1K76A 1YJWA 4AFZC 3G4SA 1X75C 4JS4A 1N8RR 3CC7Q 5CCAA 3BW1A 2FB7A 4DBHA 1FMWA 1KD1U 1VQ7A 3TSWA 3NTKA 4M7AG 2HBWA 4N4IA 3CPWS 1VQNA 2YLCA 2YDLA 1BI0A 3LWIA 2DL3A 3EFSA 1SG5A 3CMEQ 1OZ2A 3TEEA 4R56A 1ZSZC 2JS2A 3M4YA 4EMGA 1Q7YR 1G8XA 3OMCA 3RKWA 2MF2A 4JJBA 3CCST 1BYMA 1SHGA 2K7AA 3CCEA 1M8VA 3HFNA 2KBTA 3BDUA 2K3XA 2V8JA 2PUKB 5IXBA 1TUDA 1YWOA 2EQUA 2CP0A 4JUVA 5GAOp 1QWEA 2DIQA 3X26B 2CREA 3X24B 3QZ5B 3CBOA 4D6WA 3I56T 4FIBA 1EIFA 2F1LA 3MP6A 3QXEB 1YCYA 4RMOA 1YJ9Q 1R77A 1R0CB 2LC4A 1AWWA 2J6KA 3NHNA 3THKA 1AD5A 1M1FA 3OYIA 1YJ9T 4D8KA 4KT0E 4PJOD 3H0HA 4N0AC 1X2KA 3A5ZB 2DL8A 5AT1B 1VQ8Q 1D0YA 2ZPEB 4DOVA 4JRPA 4J9BA 2RJFA 4MMKA 3V7RA 2QK0A 2LQWA 3WVDB 1M90U 2QDLA 4CC3A 1H3HA 5LJ5d 4BI4A 2L89A 2DXUA 3DB4A 1N8RC 1LNXA 4WTOB 4LUDA 1V1CA 2DERA 2ECZA 3CCVT 4RG8A 4LNPA 3CXCS 4C8QF 4OF1A 3OYAA 4GY5A 2MCNA 1WPYA 1TS9A 5LJ3j 2YUPA 1BU1A 4KUDK 4IIOA 3G4SQ 1R0BG 1AWJA 3CC4T 4RTUA 2QQSA 4FCYA 1WXBA 1YCSB 1B7TA 5KYYB 3C95A 1BI3A 3CCRQ 5CK9A 3OYKA 1B34A 4XTZA 3CMAA 2JW4A 3A1PA 1VYTA 3CC2A 5IAYA 2Y4YA 2LP5A 4PJLA 3BFMA 2CZ6B 2XKOC 2D8JA 2CH4A 3MPUB 4PFPA 3CCQA 2OTJT 4M7AE 1ZBXA 5LJ5f 1VQ7Q 1VQ5T 4X9CA 1TUCA 2A37A 2HL3A 2K5LA 1UFFA 2YRVA 1LCKA 1SPKA 1PSFA 2KRNA 1JXMA 4LDWA 2CSQA 1GCQC 4HCKA 3EG9B 4F7UB 2BE7D 4ZGJB 5GANe 2QEXA 1D0ZA 1T3LA 1I1JA 1OX8A 1VQLA 3MKDA 5HK3A 1G3TA 4AT1B 2O4XB 5IHNA 1WXUA 2LQNA 4C92F 1X27A 2DILA 3GF5A 2RF0A 1YIJA 3EG9A 4F7UA 2ZZDA 2DXCA 5KYXA 2L8DA 2OTLA 4N4HA 2G3RA 3LH5A 3PIOA 4M7DD 5AYFA 3JB9F 2ABLA 3G71A 2QA4T 3CD6T 2A7YA 2JJ9A 2RPNA 3LX7A 4B9WA 1KD1R 2LNVA 5GJWB 4C5IA 1WNLA 4Y92A 4ATOA 2BZXA 1YI2A 2O31A 4LDYA 5L23A 2MI6A 3H0IA 4CC7A 5C0MA 3UATA 3ZFJA 4FM4B 4Z02A 3CCUA 1UEBA 3CCJQ 1NPPA 2F5KA 4XU0A 5LJ5e 1JRIA 2V1RA 4Z89A 4BACA 4RCBA 4ELZC 4KH0B 2O2OA 4BDZA 3VS7A 2KRMA 2ED0A 4JJDA 1XOVA 3PTAA 3S3OA 4J9FA 3LH0A 2JT4A 1ZBJA 5GAOl 1GCQA 2FHDA 4FYXB 2D6FA 2DO3A 4M75E 3J81E 1UHFA 3JCMP 2MOXA 2PTKA 3JB9H 1GRIA 1RAGB 3V7CA 4B9XA 2EQKA 2RHZA 2FZKB 5GAOn 1XNIA 3RESA 2QQAA 4M7DG 2KK4A 4IUQA 3T9NA 1U5SA 5DLQE 2ROTA 4DA4A 3KBGA 2O9SA 1YJWT 2BZYA 3A98A 4KGZB 3AHUA 5KE3A 2M0YA 5CAIA 2CP5A 3RNJA 4OMMA 3CBMA 1VQ6A 1KQ2A 2NLUA 2VKNA 3M56A 4PKCC 2DRKA 5J26A 3RMQA 3MEWA 3QJYA 1ZA2B 1AVZC 2RJDA 4Z88A 4C8QD 3M0SA 2DETA 2DD4A 1KHCA 1Q82C 4KGVB 3H0FA 1TXQA 1WHMA 4IUPA 4M75B 3JCMV 4D8DA 3N5BB 2CKKA 1GBQA 1HXDA 1LVKA 2VGMA 3CPWP 2DRMA 2RMOA 3OSSC 1M3AA 4HCCA 1M2VB 2VXEA 4TVRA 5GAN6 1IGUA 3HL8A 4IKFA 1VQPT 3HFOA 2GTJA 1SHFA 1EFNA 2BZ8A 3SWNB 5GAN2 3OYDA 4CRIA 1VA7A 4KULA 1NG2A 3OSVA 3EG0A 4P5NA 1YITQ 4LDXA 4JLIA 1Z9QA 3WVEB 3QKJA 3IQLA 1TUGB 3ME9A 5GAMf 2EAYA 1BKBA 1YJNT 3AT1B 1FMVA 1VIFA 1T3SA 2FO0A 5GAOr 3TSZA 3CCLA 3LGFA 2YUNA 3HTRA 2Y90A 1BI1A 1QQJA 2ZGWA 5DLOA 1OZ3A 2GF7A 1Y0MA 2NUPB 1RUWA 2HMAA 3L1AA 2DEQA 4C92D 3QO3A 3CC4A 1WHHA 1PKSA 4J7FA 4RTWA 3LW5E 1K8AU 1WDXA 1D0XA 1EZZB 5GMKm 2OAWA 2DM1A 2KQWA 3HRSA 4L59A 2PVGB 4LD6A 3X25B 3CXCP 2P0KA 4M77A 4J9EA 4OMQA 4F7UE 2OTLT 4GLKA 2RHYA 1Y7XA 1MMDA 4XTVA 5IN1A 4YTLA 2X9HA 3OW2S 2CZ1B 4FYYB 4J9IA 3MO8A 2X4XA 2AIRB 4Y28E 4XQ3A 1RAAB 1UB4A 5IXFA 4RTVA 2KYBA 3S3MA 4GLMA 2H8HA 2DXTA 5LJ3d 4E7KA 3EGDA 2YRDA 3R6NA 2CP7A 1VUBA 4KRTA 3CPWA 3EG3A 1Y57A 3O5ZA 2CSIA 3OYBA 3GNGA 2V26A 1PCXA 1MMGA 4M78A 1VQ9Q 3C4SA 1WGSA 2KXCA 1JO8A 2CS7A 2X4JA 2KT8A 4JLGA 2ZAEA 4ZN3A 2F2XA 2CP2A 2EJFA 1N9SA 1Y07A 1MMAA 1IRXA 3M9QA 3VS1A 2ZPGB 3CCVQ 1KC8R 4M78F 1M3CA 4QQ6A 3CMET 2OAUA 2C0TA 2MYSA 1ZHIA 2P0PA 5LL6S 3JB9G 5FU7B 1PKTA 1S72A 2XDBA 2GQIA 2EKOA 3HP9A 1JQQA 1I07A 4A4EA 3QIIA 1WA7A 1YFNA 1JBMA 2LZ6B 1BIBA 1ZUUA 1D1CA 3I5SA 5GAOm 1WXTA 3MP1A 4J6WA 4EPCA 2RI5A 2CP3A 3G7ZA 3CCET 4EMHA 2J06A 1AHJB 2DIGA 3EHRA 3EH1A 3H41A 2H3JA 2KEAA 2LX9A 2DD5A 4AFQC 1NBEB 2V8IA 1YHQQ 4HT8A 3VU3C 1HK9A 1UTIA 1NPRA 3CXCA 1SKUB 3VYHB 2EIFA 3M0RA 1NM7A 4M4ZA 3U23A 4X9DA 4A4GA 1KQ1A 2YHTA 2RHUA 3G6ET 3H9NA 2L3QA 1VQNQ 1UDLA 4E6RA 2EYXA 1VOMA 2JNGA 4LD9K 1QLYA 4L5GA 2QAZA 3CD6Q 5KYUB 1Q95G 2YLBA 1OX9A 1NJIR 2ZPHB 3OMGA 1TSFA 2CGHA 2XHCA 5CKFA 3F70A 4E47A 1G2BA 4QVZA 2ROLA 3M0TA 1QCFA 1PNJA 3GOXA 1U3OA 4PJOG 2E10A 3CC2T 3L2WA 1VQ6Q 4IUVA 1QVPA 1K8AR 5CKHA 2RQVA 2PVOB 1VQ4Q 3TCJA 2GBQA 2VVKA 4PLLA 4C92C 2CZ7B 4RUGA 5GAOq 4HCZA 2B8AA 1VQPA 3RIRA 3TQ7P 5GMKi 4MZTA 5HKCA 1S72Q 1M4ZA 3FDRA 4F16A 1G3SA 4C5HA 1UUEA 1Q81U 2C06A 3A8GB 3OQ5A 4Z8AA 4J9CA 4C8QA 2DJZA 4JZ4A 4FYVB 1PHTA 1VQMQ 3OYCA 2OTJQ 4X34A 1RI0A 1YI2T 1HSQA 2XK0A 2QA4Q 3L2ZA 1I8FA 2D0QB 4QQGA 3CCQQ 1M90R 2JTFA 1WHKA 4NS5A 4ZNXA 4ZN1A 1TH7A 2X3WD 4HKEA 4XU3A 1OOTA 3CC2Q 4E7SA 2L3RA 3MJXA 4FW1A 5GANf 3QBYA 3FC3A 1M5Q1 1NYFA 2GFUA 2FZCB 4IIMA 4M75C 5I2SA 1Q81C 1ZQ1A 2BTTA 4M75F 4PJNA 1Q86C 3E9GA 1TOVA 3JV3A 2YSQA 3CCUQ 2EGCA 1SSHA 3V8KA 4FT2A 3I9QA 3NTIA 4BE0A 3LWHA 2AKKA 2JXBA 4M7AB 4JS5A 2WSCE 2PZ1A 1W1FA 2X4YA 2XDPA 4M77D 1YWPA 1K9MC 5FROA 1PD0A 1KJWA 3QYHB 3ZL7C 3G71Q 1E7OA 1FMKA 1VQKQ 1UGPB 1PRLC 2E41A 1AZEA 2LX7A 1RAEB 1K73C 5D6XA 4QT7A 3EGUA 2ATCB 1M1KU 3EGXA 3JB9J 3I5RA 4Y91A 3VS5A 4EMKC 1KC8C 1Q7YU 2W0ZA 2PQWA 5FW9A 3EH2A 2RI3A 3CCJT 4HVUA 3TREA 4C8QC 1VQOA 3D7SB 3S6WA 2V1QA 1I5LA 2LQ8A 2VV5A 5C6SA 2QEXQ 5GAN7 1O9SA 4L6V5 1WHJA 2D9TA 2DTOA 2LJ1A 1YJ9A 9ATCB 5J39A 3REBB 1WYXA 2ENMA 5GMKl 3VRZA 1Q86R 1C0MA 1OYXA 2DYBA 2KGTA 2P0QA 2HSEB 4AFUC 2J7IA 3V8LA 3EG2A 4M77E 2K5FA 2EYYA 4XTXA 3JSCA 2HKNA 4RKUE 1FYNA 3SWNA 4N0AA 1GBRA 2NUTB 2KI7A 3QDRB 4RTYA 2D1XA 4F7UF 1ZX6A 4M78D 2JMCA 2CH4W 3M4GA 2LCSA 4EDUA 2DVJA 1PM3A 3GLXA 2VB6A 1SEMA 2X3XD 3MP8A 2QXFA 3QWXX 2D0NA 4F14A 2A3LA 4C92B 3L2UA 2DZ9A 2GNCA 4OGEA 3EG1A 4O6JA 2RA2A 2GFAA 2LJ3A 1MV3A 1YN8A 5CO7A 2L5QA 3MCAB 4C5EA 1OI1A 2LCLA 3FEOA 3UF4A 2QG9B 1KQSP 3VV0A 1VQOQ 4DBRA 1TG0A 1N9RA 2HKQB 5CKDA 3JCMf 3QDFA 5I11A 1UGRB 1AZGB 3VJPA 2RK1A 3M59A 4A4KA 3PVLA 4M78B 5GMKe 5IHKA 1OPKA 3CCMQ 1UECA 1KQSA 2LNHB 1Y96A 3CCSA 3DKMA 2K79A 4RTTA 2E5QA 2O9VA 3JCMX 1Q81R 2SRCA 2GGRA 2QTVA 2EJGA 1W2BP 1WIEA 3RKYA 1KD1C 3GNFB 3JCMJ 4X1VA 4E7HA 2YUOA 1D3BB 3X28B 5KH6A 2AZVA 3J80E 2EBPA 2JUFA 5FU6B 3GPLA 5FU7C 1IREB 3A8MB 4FU6A 2E3HA 3OYEA 2E3IA 3OB9A 2MAMA 4MDXA 4XTWA 4EIKA 3QJ6A 1AEYA 4PFOA 1IO6A 2O4XA 2DX1A 4ME7A 4JJNK 3PGGA 1JEGA 2C0OA 4M7DA 5DY9A 3O8VA 4C92G 3SFMA 2QEXT 2CUBA 1R8OB 2R5AA 2EQIA 1VQKA 2KE9A 1M1KR 2E6ZA 1TU0B 4HVVA 2J6FA 5IH2A 4RCCA 4QW2A 5CKEA 4C0GA 3TVTA 3KFVA 3INZA 3CC7A 1QP2A 1VQMA 1ZSZA 2RQUA 2XMFA 2DEUA 3I56Q 4E2FB 3CEYA 3VUZA 3M53A 3G6EA 2I0NA 4MDWA 2W10A 2VXFA 2DTIA 1OU8A 1WQ7A 2OTLQ 1GL5A 3VRYA 2DFUA 3BY7A 2QQ9A 1XJWB 4OVAA 3E2UA 3NPFA 3QUIA 3CBPA 4LN2A 4ZGEB 2R57A 5FRNA 2QGFB 3ASKA 2E4HA 2FVUA 3FRNA 2KY9A 2QQBA 1YJNA 4QVCA 5GAN4 4M78E 3C0CA 5A0LA 2G6FX 2CUDA 3G6EQ 4E7LA 1C6VX 1G3YA 2JM8A 1M2VA 3OYFA 2OTJA 5CQYA 1VQ7T 1Q86U 4BY6C 1ZSGA 4BDYA 1S72T 2JOYA 1T0HA 1CKBA 1PWTA 3CD6A 1RL2A 3L2VA 2I2LA 2L2PA 2IVWA 1WJSA 3FIFA 1YJNQ 3EGXB 1KIKA 5FRMA 1J3TA 1OPLA 1RI9A 4PNOA 3UWNA 4BUGA 2LJ0A 5CIUA 1TWBA 4JRQA 4AMCA 4OP0A 2EGAA 1YITT 1BCMA 1VQLT 1Y71A 2EGEA 4ZGDB 4E7JA 3VS0A 4NOYA 3CCRA 2EQMA 3A8HB 3JCMe 2HZYA 3P8HA 5GAN3 2DVEA 1M2OA 2E70A 2NUTA 1X6BA 3QSUA 3URGA 1OV3A 4OMNA 2MWOA 5HK0A 1VYUA 4E7ZA 1VIEA 3I56A 4JDSA 1W2BS 1UGQB 5GAMg 1F1BB 1VQ4T 2DKGA 1IGQA 1RADB 2R58A 3EGDB 1VQ6T 1MUZA 1H92A 1UE9A 1VQ5Q 2DL7A 4J83A 1LPLA 1M8MA 4LE9A 1M30A 2VC8A 3HPWA 1RAHB 2EJ9A 5KYWB 2ED1A 4OB1B 4A63B 5GMKj 2EW3A 3JCMQ 4CC2A 2RK2A 2VGNA 2PUOB 3V8JA 3CCVA 1BI2A 2E65A 3JCMW 1Y96B 1G3WA 2XI9A 1QVFS 1YHQA 2EYZA 2ESWA 1MHNA 2L3SA 3C12A 3NGPA 3PE0A 2RO0A 1N6AA 1MMNA 3OYLA 2XIDA 2JMAA 1NEBA 2RJEA 3HKSA 3RDVA 2F69A 3PIPA 3QZ9B 4M7DB 3WXMB 1M3BA 3M0UA 1NJIC 3L2QA 5FWCA 3QPHA 2AZSA 2KXDA 5ECAA 2C0IA 2E64A 3VYGA 1RAIB 5L8RE 3CCSQ 2M02A 2A08A 2XICA 1QCOA 2WSFE 3CCEQ 2OX7A 2J6OA 1N5ZA 1E6HA 2EFIA 3KUFA 1MNEA 2VYTA 4HT9A 3JB9D 2DBMA 3CMEA 4PLIA 4J6XA 4C0DC 3I55A 4LUEA 3CC7T 3OW2P 3OS2A 2KROA 3REAB 1YNZA 3SWNC 1CKAA 5GMKh 2PVDB 3E1SA 4PFZA 1VQ9A 1KSWA 1AWXA 2NYSA 1IXDA 2OJ2A 3PNWC 4FSSA 2GTOA 4PJOC 1PC0A 1VQNT 4FT4A 2AKLA 2HCKA 2K2MA 2KRSA 4VUBA 3OS0A 1VQOT 3RR6A 2M9UA 2NWMA 3J7AF 2HQEA 3P8BB 4ELYC 4UC4A 2YRCA 1ABQA 3MHXA 1U1SA 1I5OB 3VS4A 4R0KA 3M57A 1U06A 3GBQA 1KK7A 3OYYA 1WJRA 5GAMd 2HQXA 3JCMd 4AFSC 3OYGA 3JCMh 4LXCA 3OS5A 4II1A 1WHGA 1NEGA 2P4TA 2DK3A 4JPBW
chains in the Genus database with same CATH topology
1NYGA 1SRMA 4HVUA 1ABOA 2FEIA 2K6DA 2EVRA 3VS6A 2V1QA 2K3BA 2RNAA 1BB9A 4JJCA 2LJ1A 1U5SA 2ROTA 2L3PA 2O9SA 1X2QA 2BZYA 2YT6A 3A98A 3REBB 1WYXA 2ENMA 3VRZA 2M0YA 3RNJA 2HDAA 4OMMA 1K9AA 2DYBA 2KGTA 2VKNA 1UJ0A 2F2VA 2DRKA 2KR3A 1HJDA 4AFUC 2J7IA 3EG2A 4RTZA 1RLPC 1X6GA 3M0QA 2EYYA 2KNBB 1AVZC 4Z88A 4DEXA 3M0SA 4DEYA 1FYNA 2KT1A 3H0FA 1GBRA 3VS3A 4D8DA 4RTYA 2D1XA 1GBQA 1ZX6A 2JMCA 2CH4W 2LCSA 2MIOA 2DVJA 1QKWA 2DRMA 3SEMA 2RMOA 2DJQA 1M3AA 1HD3A 1SEMA 2X3XD 3QWXX 2D0NA 4F14A 3I35A 1ZLMA 2FG0A 4WCIA 2GNCA 3EG1A 5GJVB 1QWFA 2O88A 2GTJA 1SHFA 2DLPA 2LJ3A 1EFNA 3NMZC 1MV3A 1Z9ZA 2BZ8A 1YN8A 1OEBA 2EYWA 1ZUYA 2M51A 3UA6A 2CT4A 1VA7A 1NG2A 2RN8A 3EG0A 1ARKA 1T0JA 3UF4A 1K1ZA 1Z9QA 4JZ3A 3ULRB 1TG0A 1JXOA 4J9DA 3IQLA 1KFZA 1I0CA 5I11A 1AZGB 2NUZA 3M0PA 3PVLA 2HSPA 1MV0B 1UG1A 2FO0A 1T3SA 1B07A 1GFDA 3VS2A 3TSZA 2RQTA 1OPKA 5IHKA 1AOJA 1UECA 2YUNA 2LNHB 4ESRA 2K79A 4RTTA 2P4RA 4HXJA 2DMOA 2O9VA 1NLOC 2SRCA 2GGRA 2DNUA 1Y0MA 4J9GA 1RUWA 1GFCA 3PVQA 3RBBB 1RLQC 2KYMA 1WIEA 4X1VA 1PKSA 2YUOA 1BBZA 3QWYA 2EKHA 2FRWA 4RTWA 2AZVA 5I22A 2B86A 2SEMA 1WDXA 1PRMC 1WFWA 2EBPA 2L0AA 2OAWA 2DM1A 1YP5A 4OMPA 2VWFA 1W6XA 3CQTA 1NLPC 1E6GA 1G83A 5EC7A 4J9EA 4OMQA 1X43A 4ORZA 1GCPA 4EIKA 2JS0A 4J9IA 1K76A 1AEYA 1IO6A 4AFZC 2DX1A 1WX6A 2C0OA 1JEGA 1X69A 5IXFA 1K0SA 4RTVA 2CUBA 3TSWA 2KYBA 2EQIA 2H8HA 4GLMA 2KE9A 3R6NA 2HBWA 4HVVA 2YDLA 4K11A 2J6FA 2DL3A 4KRTA 5IH2A 3EG3A 1Y57A 2JS2A 3O5ZA 3KFVA 3TVTA 2CSIA 1W70A 4JJBA 2RQUA 1SHGA 2XMFA 1B3QA 2K7AA 1A0NB 2YUQA 2KBTA 2OI3A 2I0NA 2FPDA 2KXCA 4OMOA 1JO8A 2KT8A 5IXBA 1TUDA 2JTEA 1CSKA 2F2XA 1YWOA 2W10A 1BK2A 2IIMA 1QWEA 5HCKA 2CREA 1GL5A 3VRYA 3VS1A 3NPFA 1M3CA 4LN2A 1UHCA 2PNIA 2A36A 1AWWA 2RQRA 2J6KA 2C0TA 3NHNA 4GBQA 3THKA 1AD5A 4D8KA 3H0HA 1PKTA 1X2KA 2DL8A 3C0CA 2GQIA 2FPFA 2G6FX 1JQQA 1I07A 2CUDA 1QKXA 4J9BA 1WA7A 2D8HA 2JM8A 2LZ6B 1ZUUA 3I5SA 1WXTA 1ZSGA 2LQWA 1T0HA 2QDLA 4CC3A 1CKBA 1H3HA 1PWTA 2L2PA 5FWBA 2J06A 2DE0X 3H41A 3EHRA 4LUDA 2KEAA 1V1CA 2ECZA 4AFQC 1KIKA 1J3TA 4LNPA 1OPLA 1RI9A 2LJ0A 1UTIA 2DA9A 2EGAA 2MCNA 2YUPA 1BU1A 2EGEA 3M0RA 1VYVA 4IIOA 3UA7A 1NM7A 3VS0A 4M4ZA 3U23A 1ZUKA 4J9HA 1AWJA 4CC4B 4HVWA 4RTUA 1WXBA 1YCSB 2L3QA 1UDLA 3EHQA 1X6BA 4E6RA 2EYXA 1OV3A 4OMNA 1QLYA 1VYUA 2AK5A 2LMJA 5IHIA 2JW4A 1VYTA 2LP5A 1MUZA 2D8JA 2CH4A 1H92A 1UE9A 2DL7A 1G2BA 1M8MA 2ROLA 3M0TA 1QCFA 1PNJA 4LE9A 1M30A 1U3OA 2ED1A 1TUCA 2A37A 4A63B 1UFFA 1LCKA 2EW3A 2RQVA 4CC2A 2FRYA 1SPKA 2GBQA 2KRNA 2VVKA 4RUGA 1JXMA 1UJYA 2CDTA 2CSQA 1GCQC 3FJ5A 4HCKA 2EYZA 2ESWA 4F16A 1T3LA 2L3SA 1I1JA 3NGPA 3PE0A 1UGVA 1AWOA 2DL5A 1UUEA 2JMAA 1NEBA 5IHNA 1WXUA 2LQNA 4Z8AA 4J9CA 1X27A 2DILA 2F2WA 4JZ4A 1PHTA 2RF0A 2E5KA 1M3BA 3M0UA 1SRLA 5FWCA 1HSQA 2AZSA 3LH5A 2KXDA 4F17A 5ECAA 2C0IA 2ABLA 2CT3A 2A08A 2HEQA 4AG1C 4ZNXA 1H8KA 2EPDA 2X3WD 1OOTA 2J6OA 1N5ZA 2RPNA 1E6HA 1NYFA 5GJWB 2DBMA 1JU5C 4IIMA 4Y92A 2BZXA 2O31A 5L23A 2BTTA 3H0IA 4LUEA 4CC7A 2A28A 1WLPB 2DF6A 3JV3A 3UATA 2YSQA 2KROA 3REAB 1YNZA 2EGCA 1CKAA 3SHWA 1SSHA 4RTXA 3I9QA 1KSWA 1AWXA 1K0XA 2V1RA 2OJ2A 4Z89A 4FSSA 2GTOA 2FPEA 2AKKA 2O2OA 2JXBA 3VS7A 1M27C 2AKLA 2HCKA 2KRMA 2K2MA 2ED0A 2KRSA 2PZ1A 1W1FA 2DBKA 4JJDA 1XOVA 2DL4A 1YWPA 1KJWA 2NWMA 3ZL7C 2J05A 4J9FA 1S1NA 1E7OA 1ABQA 1FMKA 3VS4A 1PRLC 4R0KA 1AZEA 2LX7A 2JT4A 1U06A 1ZBJA 3GBQA 1GCQA 2K9GA 1K4US 4QT7A 3EGUA 4AFSC 2RQWA 1UHFA 2MOXA 2PTKA 1GRIA 3I5RA 4OMLA 3VS5A 4AG2C 2JM9A 1NEGA 2W0ZA 1WI7A 4JPBW 5FW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYG A;  1SRM A;  4HVU A;  1ABO A;  2FEI A;  2K6D A;  2EVR A;  3VS6 A;  2V1Q A;  2K3B A;  2RNA A;  1BB9 A;  4JJC A;  2LJ1 A;  1U5S A;  2ROT A;  2L3P A;  2O9S A;  1X2Q A;  2BZY A;  2YT6 A;  3A98 A;  3REB B;  1WYX A;  2ENM A;  3VRZ A;  2M0Y A;  3RNJ A;  2HDA A;  4OMM A;  1K9A A;  2DYB A;  2KGT A;  2VKN A;  1UJ0 A;  2F2V A;  2DRK A;  2KR3 A;  1HJD A;  4AFU C;  2J7I A;  3EG2 A;  4RTZ A;  1RLP C;  1X6G A;  3M0Q A;  2EYY A;  2KNB B;  1AVZ C;  4Z88 A;  4DEX A;  3M0S A;  4DEY A;  1FYN A;  2KT1 A;  3H0F A;  1GBR A;  3VS3 A;  4D8D A;  4RTY A;  2D1X A;  1GBQ A;  1ZX6 A;  2JMC A;  2CH4 W;  2LCS A;  2MIO A;  2DVJ A;  1QKW A;  2DRM A;  3SEM A;  2RMO A;  2DJQ A;  1M3A A;  1HD3 A;  1SEM A;  2X3X D;  3QWX X;  2D0N A;  4F14 A;  3I35 A;  1ZLM A;  2FG0 A;  4WCI A;  2GNC A;  3EG1 A;  5GJV B;  1QWF A;  2O88 A;  2GTJ A;  1SHF A;  2DLP A;  2LJ3 A;  1EFN A;  3NMZ C;  1MV3 A;  1Z9Z A;  2BZ8 A;  1YN8 A;  1OEB A;  2EYW A;  1ZUY A;  2M51 A;  3UA6 A;  2CT4 A;  1VA7 A;  1NG2 A;  2RN8 A;  3EG0 A;  1ARK A;  1T0J A;  3UF4 A;  1K1Z A;  1Z9Q A;  4JZ3 A;  3ULR B;  1TG0 A;  1JXO A;  4J9D A;  3IQL A;  1KFZ A;  1I0C A;  5I11 A;  1AZG B;  2NUZ A;  3M0P A;  3PVL A;  2HSP A;  1MV0 B;  1UG1 A;  2FO0 A;  1T3S A;  1B07 A;  1GFD A;  3VS2 A;  3TSZ A;  2RQT A;  1OPK A;  5IHK A;  1AOJ A;  1UEC A;  2YUN A;  2LNH B;  4ESR A;  2K79 A;  4RTT A;  2P4R A;  4HXJ A;  2DMO A;  2O9V A;  1NLO C;  2SRC A;  2GGR A;  2DNU A;  1Y0M A;  4J9G A;  1RUW A;  1GFC A;  3PVQ A;  3RBB B;  1RLQ C;  2KYM A;  1WIE A;  4X1V A;  1PKS A;  2YUO A;  1BBZ A;  3QWY A;  2EKH A;  2FRW A;  4RTW A;  2AZV A;  5I22 A;  2B86 A;  2SEM A;  1WDX A;  1PRM C;  1WFW A;  2EBP A;  2L0A A;  2OAW A;  2DM1 A;  1YP5 A;  4OMP A;  2VWF A;  1W6X A;  3CQT A;  1NLP C;  1E6G A;  1G83 A;  5EC7 A;  4J9E A;  4OMQ A;  1X43 A;  4ORZ A;  1GCP A;  4EIK A;  2JS0 A;  4J9I A;  1K76 A;  1AEY A;  1IO6 A;  4AFZ C;  2DX1 A;  1WX6 A;  2C0O A;  1JEG A;  1X69 A;  5IXF A;  1K0S A;  4RTV A;  2CUB A;  3TSW A;  2KYB A;  2EQI A;  2H8H A;  4GLM A;  2KE9 A;  3R6N A;  2HBW A;  4HVV A;  2YDL A;  4K11 A;  2J6F A;  2DL3 A;  4KRT A;  5IH2 A;  3EG3 A;  1Y57 A;  2JS2 A;  3O5Z A;  3KFV A;  3TVT A;  2CSI A;  1W70 A;  4JJB A;  2RQU A;  1SHG A;  2XMF A;  1B3Q A;  2K7A A;  1A0N B;  2YUQ A;  2KBT A;  2OI3 A;  2I0N A;  2FPD A;  2KXC A;  4OMO A;  1JO8 A;  2KT8 A;  5IXB A;  1TUD A;  2JTE A;  1CSK A;  2F2X A;  1YWO A;  2W10 A;  1BK2 A;  2IIM A;  1QWE A;  5HCK A;  2CRE A;  1GL5 A;  3VRY A;  3VS1 A;  3NPF A;  1M3C A;  4LN2 A;  1UHC A;  2PNI A;  2A36 A;  1AWW A;  2RQR A;  2J6K A;  2C0T A;  3NHN A;  4GBQ A;  3THK A;  1AD5 A;  4D8K A;  3H0H A;  1PKT A;  1X2K A;  2DL8 A;  3C0C A;  2GQI A;  2FPF A;  2G6F X;  1JQQ A;  1I07 A;  2CUD A;  1QKX A;  4J9B A;  1WA7 A;  2D8H A;  2JM8 A;  2LZ6 B;  1ZUU A;  3I5S A;  1WXT A;  1ZSG A;  2LQW A;  1T0H A;  2QDL A;  4CC3 A;  1CKB A;  1H3H A;  1PWT A;  2L2P A;  5FWB A;  2J06 A;  2DE0 X;  3H41 A;  3EHR A;  4LUD A;  2KEA A;  1V1C A;  2ECZ A;  4AFQ C;  1KIK A;  1J3T A;  4LNP A;  1OPL A;  1RI9 A;  2LJ0 A;  1UTI A;  2DA9 A;  2EGA A;  2MCN A;  2YUP A;  1BU1 A;  2EGE A;  3M0R A;  1VYV A;  4IIO A;  3UA7 A;  1NM7 A;  3VS0 A;  4M4Z A;  3U23 A;  1ZUK A;  4J9H A;  1AWJ A;  4CC4 B;  4HVW A;  4RTU A;  1WXB A;  1YCS B;  2L3Q A;  1UDL A;  3EHQ A;  1X6B A;  4E6R A;  2EYX A;  1OV3 A;  4OMN A;  1QLY A;  1VYU A;  2AK5 A;  2LMJ A;  5IHI A;  2JW4 A;  1VYT A;  2LP5 A;  1MUZ A;  2D8J A;  2CH4 A;  1H92 A;  1UE9 A;  2DL7 A;  1G2B A;  1M8M A;  2ROL A;  3M0T A;  1QCF A;  1PNJ A;  4LE9 A;  1M30 A;  1U3O A;  2ED1 A;  1TUC A;  2A37 A;  4A63 B;  1UFF A;  1LCK A;  2EW3 A;  2RQV A;  4CC2 A;  2FRY A;  1SPK A;  2GBQ A;  2KRN A;  2VVK A;  4RUG A;  1JXM A;  1UJY A;  2CDT A;  2CSQ A;  1GCQ C;  3FJ5 A;  4HCK A;  2EYZ A;  2ESW A;  4F16 A;  1T3L A;  2L3S A;  1I1J A;  3NGP A;  3PE0 A;  1UGV A;  1AWO A;  2DL5 A;  1UUE A;  2JMA A;  1NEB A;  5IHN A;  1WXU A;  2LQN A;  4Z8A A;  4J9C A;  1X27 A;  2DIL A;  2F2W A;  4JZ4 A;  1PHT A;  2RF0 A;  2E5K A;  1M3B A;  3M0U A;  1SRL A;  5FWC A;  1HSQ A;  2AZS A;  3LH5 A;  2KXD A;  4F17 A;  5ECA A;  2C0I A;  2ABL A;  2CT3 A;  2A08 A;  2HEQ A;  4AG1 C;  4ZNX A;  1H8K A;  2EPD A;  2X3W D;  1OOT A;  2J6O A;  1N5Z A;  2RPN A;  1E6H A;  1NYF A;  5GJW B;  2DBM A;  1JU5 C;  4IIM A;  4Y92 A;  2BZX A;  2O31 A;  5L23 A;  2BTT A;  3H0I A;  4LUE A;  4CC7 A;  2A28 A;  1WLP B;  2DF6 A;  3JV3 A;  3UAT A;  2YSQ A;  2KRO A;  3REA B;  1YNZ A;  2EGC A;  1CKA A;  3SHW A;  1SSH A;  4RTX A;  3I9Q A;  1KSW A;  1AWX A;  1K0X A;  2V1R A;  2OJ2 A;  4Z89 A;  4FSS A;  2GTO A;  2FPE A;  2AKK A;  2O2O A;  2JXB A;  3VS7 A;  1M27 C;  2AKL A;  2HCK A;  2KRM A;  2K2M A;  2ED0 A;  2KRS A;  2PZ1 A;  1W1F A;  2DBK A;  4JJD A;  1XOV A;  2DL4 A;  1YWP A;  1KJW A;  2NWM A;  3ZL7 C;  2J05 A;  4J9F A;  1S1N A;  1E7O A;  1ABQ A;  1FMK A;  3VS4 A;  1PRL C;  4R0K A;  1AZE A;  2LX7 A;  2JT4 A;  1U06 A;  1ZBJ A;  3GBQ A;  1GCQ A;  2K9G A;  1K4U S;  4QT7 A;  3EGU A;  4AFS C;  2RQW A;  1UHF A;  2MOX A;  2PTK A;  1GRI A;  3I5R A;  4OML A;  3VS5 A;  4AG2 C;  2JM9 A;  1NEG A;  2W0Z A;  1WI7 A;  4JPB W;  5FW9 A; 
#chains in the Genus database with same CATH topology
 2FL7 A;  2AT1 B;  3MET A;  4M77 C;  4XTU A;  2QI2 A;  1NYG A;  4A4H A;  2A0F B;  4N4G A;  1MND A;  1OU9 A;  3SB2 A;  2EVR A;  3VS6 A;  3RUX A;  5KE2 A;  2RNA A;  1PG5 B;  2Z0W A;  2K3Y A;  1WJQ A;  2MK5 A;  1U8R A;  1Q82 R;  2MMP A;  4PJJ A;  2YT6 A;  4OGC A;  4M75 A;  3JCM g;  1H64 1;  4PJO A;  4OB3 B;  1D1B A;  2HDA A;  1K9A A;  4HA8 A;  4M75 D;  3QYG B;  3LYI A;  1KG1 A;  4JRI A;  2F2V A;  3CCQ T;  1K73 U;  4OB0 B;  2KR3 A;  1HJD A;  2LTO A;  1QVG S;  2VAS A;  2LCC A;  5I21 A;  1X01 A;  1K9M U;  2KNB B;  2QQR A;  1X6O A;  7AT1 B;  4DEY A;  5IT9 E;  2KT1 A;  5KYX B;  5A0G A;  4PJO B;  1B34 B;  1VQ9 T;  3C94 A;  3VS3 A;  2QTX A;  1V76 A;  1MGQ A;  1VQ8 T;  6AT1 B;  3ZEH A;  4XTY A;  4C92 A;  2DJQ A;  2PU9 B;  4QQD A;  1HD3 A;  3RKX A;  2QA4 A;  4C5G A;  3I55 Q;  4IUT A;  5KCO A;  1ZLM A;  2FG0 A;  2KMT A;  3M55 A;  4A53 A;  5GJV B;  5GAN g;  1XTD A;  1Z9Z A;  3ZBD A;  1ZUY A;  4IUU A;  2M51 A;  2XDD A;  1K73 R;  2CT4 A;  3VKI A;  5KYW A;  1ARK A;  3ULR B;  4J9D A;  1KFZ A;  1K9M R;  1I0C A;  1VQP Q;  4M7D C;  2KVQ G;  5LJ3 h;  3H8Z A;  3M0P A;  1TTH B;  3OBW A;  1VQ4 A;  1MV0 B;  4LDV A;  1B07 A;  4DOW A;  1OUL A;  2RQT A;  1G5V A;  4C0D B;  1I4K 1;  5CQX A;  2BIV A;  4A4F A;  1RAF B;  4KH1 B;  1H3Z A;  3GIB A;  4J6Y A;  4B6M A;  5KYY A;  4BI3 A;  2DMO A;  1NLO C;  3EFR A;  2QYZ A;  3PVQ A;  1GFC A;  1FWZ A;  2KYM A;  3G1J A;  4M77 G;  2LT4 A;  1W4S A;  2WAC A;  4BY6 B;  5D6Y A;  3DLM A;  1IHW A;  2EKH A;  4M7A F;  2FRW A;  2RJC A;  3EFO A;  5I22 A;  2YXY A;  4BI8 B;  2B86 A;  2GQV A;  2SEM A;  3UT1 A;  1PRM C;  2RI2 A;  2DYI A;  2LDM A;  1YP5 A;  4J7I A;  2VWF A;  1WQW A;  3CQT A;  5LJ5 g;  1NLP C;  1M90 C;  1E6G A;  4R55 A;  1G83 A;  5EC7 A;  2E1H A;  2H3E B;  3MEU A;  1X43 A;  4QVD A;  4ORZ A;  3OBY A;  1SSF A;  2K4Y A;  2JS0 A;  4EMK A;  1VQM T;  4KBM B;  2X51 A;  4CI0 C;  3V7S A;  4C0Z A;  1WX6 A;  2JZ2 A;  1X69 A;  5A2Q E;  1K0S A;  3SDZ A;  4F7U G;  1KQS S;  1V29 B;  3KXT A;  2BUD A;  4K11 A;  5LJ5 h;  5DM7 R;  2WSE E;  1M9S A;  1IB8 A;  3BE3 A;  3OYJ A;  4IUR A;  1YHQ T;  3CCU T;  1YIJ Q;  1W70 A;  4ZTF A;  1QW1 A;  1C1A A;  1B3Q A;  5A0D A;  1A0N B;  2YUQ A;  1FXX A;  3CCL T;  3QG1 A;  3OS1 A;  2COW A;  1QMC A;  2OI3 A;  5HY6 A;  2FPD A;  3E9F A;  4OMF B;  2E6N A;  4OMO A;  2XG8 D;  3PMT A;  1M1K C;  2JTE A;  1CSK A;  1BK2 A;  1OQK A;  2IIM A;  5HCK A;  2K5I A;  1EX4 A;  5I2M A;  2V8K A;  4DQ2 A;  4ANJ A;  3SD4 A;  5GAN h;  2DXB A;  4M78 G;  1QP3 A;  4M7A C;  2COY A;  1UHC A;  2PNI A;  2A36 A;  3DB3 A;  1UGS B;  1P92 A;  2LT1 A;  2RQR A;  3L42 A;  3S3N A;  2X4W A;  2DTH A;  4GBQ A;  2HD0 A;  4M75 G;  2HAX A;  3M5A A;  4PJO E;  1PSE A;  2E12 A;  2FPF A;  4FYW B;  1RAB B;  1QKX A;  2D8H A;  2VUB A;  2F5T X;  2P84 A;  1VQK T;  2FYK A;  4M7D F;  4C8Q E;  5FWB A;  3JRZ A;  3VUB A;  2DE0 X;  4PJM A;  3PFS A;  4PK4 A;  2RD1 A;  5FLX E;  1O75 A;  2HL5 C;  2DA9 A;  4M77 F;  3FJP A;  1KHI A;  4C0F A;  1VYV A;  3UA7 A;  3LLR A;  4BB7 A;  1ZUK A;  4J9H A;  4CC4 B;  4KUI A;  3L2R A;  4HVW A;  4M7A A;  2DAQ A;  4DBF A;  1JJ2 A;  3RER A;  5KCH A;  3EHQ A;  2O01 E;  3HRT A;  3H6Z A;  2AK5 A;  2LMJ A;  3ER0 A;  3P8D A;  5IHI A;  3A8L B;  1KC8 U;  8ATC B;  1JB0 E;  3CMA Q;  4BE1 A;  3TU4 K;  3CC4 Q;  1WZO A;  2M0O A;  2RHI A;  1I81 A;  2BE9 B;  3OYN A;  1Q82 U;  3JAM E;  3E19 A;  1ZSZ B;  3CCL Q;  2EYQ A;  2FRY A;  3CPF A;  5LJ3 e;  2X35 A;  1N27 A;  4XAX B;  2KSS A;  3PMI A;  1UJY A;  2CDT A;  3CCR T;  1D1A A;  3FJ5 A;  4M77 B;  2DZC A;  2KDS A;  4C8Q G;  4XU1 A;  1BIA A;  4C92 E;  1YIT A;  2Y4X A;  5FU6 C;  1UGV A;  4ZTJ A;  3GP8 A;  1AWO A;  1ZA1 B;  3FLG A;  1LJO A;  2DL5 A;  3MEV A;  3G4S T;  2F2W A;  3Q1J A;  1GXI E;  5CVI A;  2E5K A;  5KYU A;  4J5Y A;  5CR2 A;  1SRL A;  4MZM A;  1VQ8 A;  2QDY B;  4F17 A;  5CKB A;  1QVG P;  2CP6 A;  2CT3 A;  4C8Q B;  1VQ5 A;  4M7D E;  5EG2 A;  2HEQ A;  4AG1 C;  1JJ2 P;  4FL6 A;  2COZ A;  3M54 A;  3HSB A;  4J8O A;  1H8K A;  2EPD A;  1NJI U;  3R6O A;  1JJ2 S;  3JCM c;  2JN0 A;  2CYZ B;  1YJW Q;  4LDU A;  4Q5W A;  5M9O A;  1JU5 C;  4PJO F;  1HYO A;  2KAF A;  5GAN 8;  2FZG B;  1PD1 A;  1QVF A;  2A28 A;  1WLP B;  2DF6 A;  3RMS A;  2NUP A;  4FSX A;  2GCX A;  3OA6 A;  1QVF P;  3SHW A;  4RTX A;  3CCM T;  1XQH A;  4WF2 A;  3I55 T;  1K0X A;  1LOJ A;  1SF9 A;  2FPE A;  2JTM A;  5KYN A;  1M27 C;  3PT9 A;  2DBK A;  1D09 B;  2DL4 A;  3M58 A;  1QCN A;  2LQK A;  4M7A D;  2J05 A;  1S1N A;  3A8O B;  4MZP A;  4E7I A;  4A54 A;  4QKU A;  3UPU A;  2K9G A;  1K4U S;  5GAM h;  3OYM A;  2RQW A;  2XU8 A;  4OML A;  2RHX A;  4AG2 C;  2JM9 A;  2M16 A;  1YIJ T;  1WI7 A;  2QGG A;  4BD3 A;  1SRM A;  1ABO A;  2FEI A;  3OY9 A;  2K6D A;  4JRK A;  2K3B A;  2IG0 A;  2K57 A;  2RM4 A;  1BB9 A;  2LVM A;  4JJC A;  2L3P A;  1X2Q A;  4RG2 A;  2EWN A;  1Q7Y C;  1DJ7 B;  2RH2 A;  5GAN 5;  1BCO A;  2DPP B;  3X20 B;  3CCJ A;  3JB9 I;  3OYH A;  4M78 C;  1UJ0 A;  3FB9 A;  4NL2 A;  2BKD N;  5GAN d;  4RTZ A;  1RLP C;  1X6G A;  1RAC B;  2M1H A;  3M0Q A;  5GAM j;  1YI2 Q;  4BE2 A;  2HNI A;  1QVG A;  4DEX A;  1M1G A;  1NZ9 A;  2CZ0 B;  2ZPF B;  1K8A C;  2ZPB B;  1ACM B;  2JVV A;  5LJ3 f;  2MIO A;  2YWW A;  1QKW A;  3SEM A;  8AT1 B;  2LRQ A;  3QHS A;  5LJ3 g;  3I35 A;  3UDC A;  1D3B A;  4WCI A;  1QWF A;  2O88 A;  4FW2 A;  2DLP A;  2ZPI B;  3NMZ C;  5LJ5 j;  3BDL A;  1OEB A;  2EYW A;  3UA6 A;  3MEA A;  1VQL Q;  2RN8 A;  2K2V A;  2IPO B;  3HHT B;  1AT1 B;  1T0J A;  1K1Z A;  5D6W A;  2MWP A;  4JZ3 A;  5J3B A;  5GAN j;  3NFC A;  1JXO A;  3EFO B;  1IZ6 A;  2HQH A;  3NTH A;  2QAS A;  2NUZ A;  1YBY A;  1NE8 A;  2HSP A;  1UG1 A;  1N8R U;  1GFD A;  1FX7 A;  5GAM e;  2HBP A;  3VS2 A;  4PL6 A;  1AOJ A;  3HRU A;  1W2B A;  2AHJ B;  4ESR A;  4MML A;  2P4R A;  4HXJ A;  4OB2 B;  1IHV A;  2MPX C;  3CCM A;  5D7U A;  2DNU A;  4J9G A;  2R5M A;  3RBB B;  1U1T A;  3EAE A;  4XK8 E;  4O5V A;  2XD0 A;  1RLQ C;  4F04 B;  1BBZ A;  3QWY A;  4DBQ A;  3G71 T;  1WHL A;  4XU2 A;  3DLL A;  4NL3 A;  1WFW A;  2L0A A;  4OMP A;  1W6X A;  4HCB A;  2RB6 A;  4V2S A;  3CMA T;  2EQJ A;  3LGL A;  4EMK B;  4KGX B;  3JCM b;  3OW2 A;  1GCP A;  2ZCF B;  1K76 A;  1YJW A;  4AFZ C;  3G4S A;  1X75 C;  4JS4 A;  1N8R R;  3CC7 Q;  5CCA A;  3BW1 A;  2FB7 A;  4DBH A;  1FMW A;  1KD1 U;  1VQ7 A;  3TSW A;  3NTK A;  4M7A G;  2HBW A;  4N4I A;  3CPW S;  1VQN A;  2YLC A;  2YDL A;  1BI0 A;  3LWI A;  2DL3 A;  3EFS A;  1SG5 A;  3CME Q;  1OZ2 A;  3TEE A;  4R56 A;  1ZSZ C;  2JS2 A;  3M4Y A;  4EMG A;  1Q7Y R;  1G8X A;  3OMC A;  3RKW A;  2MF2 A;  4JJB A;  3CCS T;  1BYM A;  1SHG A;  2K7A A;  3CCE A;  1M8V A;  3HFN A;  2KBT A;  3BDU A;  2K3X A;  2V8J A;  2PUK B;  5IXB A;  1TUD A;  1YWO A;  2EQU A;  2CP0 A;  4JUV A;  5GAO p;  1QWE A;  2DIQ A;  3X26 B;  2CRE A;  3X24 B;  3QZ5 B;  3CBO A;  4D6W A;  3I56 T;  4FIB A;  1EIF A;  2F1L A;  3MP6 A;  3QXE B;  1YCY A;  4RMO A;  1YJ9 Q;  1R77 A;  1R0C B;  2LC4 A;  1AWW A;  2J6K A;  3NHN A;  3THK A;  1AD5 A;  1M1F A;  3OYI A;  1YJ9 T;  4D8K A;  4KT0 E;  4PJO D;  3H0H A;  4N0A C;  1X2K A;  3A5Z B;  2DL8 A;  5AT1 B;  1VQ8 Q;  1D0Y A;  2ZPE B;  4DOV A;  4JRP A;  4J9B A;  2RJF A;  4MMK A;  3V7R A;  2QK0 A;  2LQW A;  3WVD B;  1M90 U;  2QDL A;  4CC3 A;  1H3H A;  5LJ5 d;  4BI4 A;  2L89 A;  2DXU A;  3DB4 A;  1N8R C;  1LNX A;  4WTO B;  4LUD A;  1V1C A;  2DER A;  2ECZ A;  3CCV T;  4RG8 A;  4LNP A;  3CXC S;  4C8Q F;  4OF1 A;  3OYA A;  4GY5 A;  2MCN A;  1WPY A;  1TS9 A;  5LJ3 j;  2YUP A;  1BU1 A;  4KUD K;  4IIO A;  3G4S Q;  1R0B G;  1AWJ A;  3CC4 T;  4RTU A;  2QQS A;  4FCY A;  1WXB A;  1YCS B;  1B7T A;  5KYY B;  3C95 A;  1BI3 A;  3CCR Q;  5CK9 A;  3OYK A;  1B34 A;  4XTZ A;  3CMA A;  2JW4 A;  3A1P A;  1VYT A;  3CC2 A;  5IAY A;  2Y4Y A;  2LP5 A;  4PJL A;  3BFM A;  2CZ6 B;  2XKO C;  2D8J A;  2CH4 A;  3MPU B;  4PFP A;  3CCQ A;  2OTJ T;  4M7A E;  1ZBX A;  5LJ5 f;  1VQ7 Q;  1VQ5 T;  4X9C A;  1TUC A;  2A37 A;  2HL3 A;  2K5L A;  1UFF A;  2YRV A;  1LCK A;  1SPK A;  1PSF A;  2KRN A;  1JXM A;  4LDW A;  2CSQ A;  1GCQ C;  4HCK A;  3EG9 B;  4F7U B;  2BE7 D;  4ZGJ B;  5GAN e;  2QEX A;  1D0Z A;  1T3L A;  1I1J A;  1OX8 A;  1VQL A;  3MKD A;  5HK3 A;  1G3T A;  4AT1 B;  2O4X B;  5IHN A;  1WXU A;  2LQN A;  4C92 F;  1X27 A;  2DIL A;  3GF5 A;  2RF0 A;  1YIJ A;  3EG9 A;  4F7U A;  2ZZD A;  2DXC A;  5KYX A;  2L8D A;  2OTL A;  4N4H A;  2G3R A;  3LH5 A;  3PIO A;  4M7D D;  5AYF A;  3JB9 F;  2ABL A;  3G71 A;  2QA4 T;  3CD6 T;  2A7Y A;  2JJ9 A;  2RPN A;  3LX7 A;  4B9W A;  1KD1 R;  2LNV A;  5GJW B;  4C5I A;  1WNL A;  4Y92 A;  4ATO A;  2BZX A;  1YI2 A;  2O31 A;  4LDY A;  5L23 A;  2MI6 A;  3H0I A;  4CC7 A;  5C0M A;  3UAT A;  3ZFJ A;  4FM4 B;  4Z02 A;  3CCU A;  1UEB A;  3CCJ Q;  1NPP A;  2F5K A;  4XU0 A;  5LJ5 e;  1JRI A;  2V1R A;  4Z89 A;  4BAC A;  4RCB A;  4ELZ C;  4KH0 B;  2O2O A;  4BDZ A;  3VS7 A;  2KRM A;  2ED0 A;  4JJD A;  1XOV A;  3PTA A;  3S3O A;  4J9F A;  3LH0 A;  2JT4 A;  1ZBJ A;  5GAO l;  1GCQ A;  2FHD A;  4FYX B;  2D6F A;  2DO3 A;  4M75 E;  3J81 E;  1UHF A;  3JCM P;  2MOX A;  2PTK A;  3JB9 H;  1GRI A;  1RAG B;  3V7C A;  4B9X A;  2EQK A;  2RHZ A;  2FZK B;  5GAO n;  1XNI A;  3RES A;  2QQA A;  4M7D G;  2KK4 A;  4IUQ A;  3T9N A;  1U5S A;  5DLQ E;  2ROT A;  4DA4 A;  3KBG A;  2O9S A;  1YJW T;  2BZY A;  3A98 A;  4KGZ B;  3AHU A;  5KE3 A;  2M0Y A;  5CAI A;  2CP5 A;  3RNJ A;  4OMM A;  3CBM A;  1VQ6 A;  1KQ2 A;  2NLU A;  2VKN A;  3M56 A;  4PKC C;  2DRK A;  5J26 A;  3RMQ A;  3MEW A;  3QJY A;  1ZA2 B;  1AVZ C;  2RJD A;  4Z88 A;  4C8Q D;  3M0S A;  2DET A;  2DD4 A;  1KHC A;  1Q82 C;  4KGV B;  3H0F A;  1TXQ A;  1WHM A;  4IUP A;  4M75 B;  3JCM V;  4D8D A;  3N5B B;  2CKK A;  1GBQ A;  1HXD A;  1LVK A;  2VGM A;  3CPW P;  2DRM A;  2RMO A;  3OSS C;  1M3A A;  4HCC A;  1M2V B;  2VXE A;  4TVR A;  5GAN 6;  1IGU A;  3HL8 A;  4IKF A;  1VQP T;  3HFO A;  2GTJ A;  1SHF A;  1EFN A;  2BZ8 A;  3SWN B;  5GAN 2;  3OYD A;  4CRI A;  1VA7 A;  4KUL A;  1NG2 A;  3OSV A;  3EG0 A;  4P5N A;  1YIT Q;  4LDX A;  4JLI A;  1Z9Q A;  3WVE B;  3QKJ A;  3IQL A;  1TUG B;  3ME9 A;  5GAM f;  2EAY A;  1BKB A;  1YJN T;  3AT1 B;  1FMV A;  1VIF A;  1T3S A;  2FO0 A;  5GAO r;  3TSZ A;  3CCL A;  3LGF A;  2YUN A;  3HTR A;  2Y90 A;  1BI1 A;  1QQJ A;  2ZGW A;  5DLO A;  1OZ3 A;  2GF7 A;  1Y0M A;  2NUP B;  1RUW A;  2HMA A;  3L1A A;  2DEQ A;  4C92 D;  3QO3 A;  3CC4 A;  1WHH A;  1PKS A;  4J7F A;  4RTW A;  3LW5 E;  1K8A U;  1WDX A;  1D0X A;  1EZZ B;  5GMK m;  2OAW A;  2DM1 A;  2KQW A;  3HRS A;  4L59 A;  2PVG B;  4LD6 A;  3X25 B;  3CXC P;  2P0K A;  4M77 A;  4J9E A;  4OMQ A;  4F7U E;  2OTL T;  4GLK A;  2RHY A;  1Y7X A;  1MMD A;  4XTV A;  5IN1 A;  4YTL A;  2X9H A;  3OW2 S;  2CZ1 B;  4FYY B;  4J9I A;  3MO8 A;  2X4X A;  2AIR B;  4Y28 E;  4XQ3 A;  1RAA B;  1UB4 A;  5IXF A;  4RTV A;  2KYB A;  3S3M A;  4GLM A;  2H8H A;  2DXT A;  5LJ3 d;  4E7K A;  3EGD A;  2YRD A;  3R6N A;  2CP7 A;  1VUB A;  4KRT A;  3CPW A;  3EG3 A;  1Y57 A;  3O5Z A;  2CSI A;  3OYB A;  3GNG A;  2V26 A;  1PCX A;  1MMG A;  4M78 A;  1VQ9 Q;  3C4S A;  1WGS A;  2KXC A;  1JO8 A;  2CS7 A;  2X4J A;  2KT8 A;  4JLG A;  2ZAE A;  4ZN3 A;  2F2X A;  2CP2 A;  2EJF A;  1N9S A;  1Y07 A;  1MMA A;  1IRX A;  3M9Q A;  3VS1 A;  2ZPG B;  3CCV Q;  1KC8 R;  4M78 F;  1M3C A;  4QQ6 A;  3CME T;  2OAU A;  2C0T A;  2MYS A;  1ZHI A;  2P0P A;  5LL6 S;  3JB9 G;  5FU7 B;  1PKT A;  1S72 A;  2XDB A;  2GQI A;  2EKO A;  3HP9 A;  1JQQ A;  1I07 A;  4A4E A;  3QII A;  1WA7 A;  1YFN A;  1JBM A;  2LZ6 B;  1BIB A;  1ZUU A;  1D1C A;  3I5S A;  5GAO m;  1WXT A;  3MP1 A;  4J6W A;  4EPC A;  2RI5 A;  2CP3 A;  3G7Z A;  3CCE T;  4EMH A;  2J06 A;  1AHJ B;  2DIG A;  3EHR A;  3EH1 A;  3H41 A;  2H3J A;  2KEA A;  2LX9 A;  2DD5 A;  4AFQ C;  1NBE B;  2V8I A;  1YHQ Q;  4HT8 A;  3VU3 C;  1HK9 A;  1UTI A;  1NPR A;  3CXC A;  1SKU B;  3VYH B;  2EIF A;  3M0R A;  1NM7 A;  4M4Z A;  3U23 A;  4X9D A;  4A4G A;  1KQ1 A;  2YHT A;  2RHU A;  3G6E T;  3H9N A;  2L3Q A;  1VQN Q;  1UDL A;  4E6R A;  2EYX A;  1VOM A;  2JNG A;  4LD9 K;  1QLY A;  4L5G A;  2QAZ A;  3CD6 Q;  5KYU B;  1Q95 G;  2YLB A;  1OX9 A;  1NJI R;  2ZPH B;  3OMG A;  1TSF A;  2CGH A;  2XHC A;  5CKF A;  3F70 A;  4E47 A;  1G2B A;  4QVZ A;  2ROL A;  3M0T A;  1QCF A;  1PNJ A;  3GOX A;  1U3O A;  4PJO G;  2E10 A;  3CC2 T;  3L2W A;  1VQ6 Q;  4IUV A;  1QVP A;  1K8A R;  5CKH A;  2RQV A;  2PVO B;  1VQ4 Q;  3TCJ A;  2GBQ A;  2VVK A;  4PLL A;  4C92 C;  2CZ7 B;  4RUG A;  5GAO q;  4HCZ A;  2B8A A;  1VQP A;  3RIR A;  3TQ7 P;  5GMK i;  4MZT A;  5HKC A;  1S72 Q;  1M4Z A;  3FDR A;  4F16 A;  1G3S A;  4C5H A;  1UUE A;  1Q81 U;  2C06 A;  3A8G B;  3OQ5 A;  4Z8A A;  4J9C A;  4C8Q A;  2DJZ A;  4JZ4 A;  4FYV B;  1PHT A;  1VQM Q;  3OYC A;  2OTJ Q;  4X34 A;  1RI0 A;  1YI2 T;  1HSQ A;  2XK0 A;  2QA4 Q;  3L2Z A;  1I8F A;  2D0Q B;  4QQG A;  3CCQ Q;  1M90 R;  2JTF A;  1WHK A;  4NS5 A;  4ZNX A;  4ZN1 A;  1TH7 A;  2X3W D;  4HKE A;  4XU3 A;  1OOT A;  3CC2 Q;  4E7S A;  2L3R A;  3MJX A;  4FW1 A;  5GAN f;  3QBY A;  3FC3 A;  1M5Q 1;  1NYF A;  2GFU A;  2FZC B;  4IIM A;  4M75 C;  5I2S A;  1Q81 C;  1ZQ1 A;  2BTT A;  4M75 F;  4PJN A;  1Q86 C;  3E9G A;  1TOV A;  3JV3 A;  2YSQ A;  3CCU Q;  2EGC A;  1SSH A;  3V8K A;  4FT2 A;  3I9Q A;  3NTI A;  4BE0 A;  3LWH A;  2AKK A;  2JXB A;  4M7A B;  4JS5 A;  2WSC E;  2PZ1 A;  1W1F A;  2X4Y A;  2XDP A;  4M77 D;  1YWP A;  1K9M C;  5FRO A;  1PD0 A;  1KJW A;  3QYH B;  3ZL7 C;  3G71 Q;  1E7O A;  1FMK A;  1VQK Q;  1UGP B;  1PRL C;  2E41 A;  1AZE A;  2LX7 A;  1RAE B;  1K73 C;  5D6X A;  4QT7 A;  3EGU A;  2ATC B;  1M1K U;  3EGX A;  3JB9 J;  3I5R A;  4Y91 A;  3VS5 A;  4EMK C;  1KC8 C;  1Q7Y U;  2W0Z A;  2PQW A;  5FW9 A;  3EH2 A;  2RI3 A;  3CCJ T;  4HVU A;  3TRE A;  4C8Q C;  1VQO A;  3D7S B;  3S6W A;  2V1Q A;  1I5L A;  2LQ8 A;  2VV5 A;  5C6S A;  2QEX Q;  5GAN 7;  1O9S A;  4L6V 5;  1WHJ A;  2D9T A;  2DTO A;  2LJ1 A;  1YJ9 A;  9ATC B;  5J39 A;  3REB B;  1WYX A;  2ENM A;  5GMK l;  3VRZ A;  1Q86 R;  1C0M A;  1OYX A;  2DYB A;  2KGT A;  2P0Q A;  2HSE B;  4AFU C;  2J7I A;  3V8L A;  3EG2 A;  4M77 E;  2K5F A;  2EYY A;  4XTX A;  3JSC A;  2HKN A;  4RKU E;  1FYN A;  3SWN A;  4N0A A;  1GBR A;  2NUT B;  2KI7 A;  3QDR B;  4RTY A;  2D1X A;  4F7U F;  1ZX6 A;  4M78 D;  2JMC A;  2CH4 W;  3M4G A;  2LCS A;  4EDU A;  2DVJ A;  1PM3 A;  3GLX A;  2VB6 A;  1SEM A;  2X3X D;  3MP8 A;  2QXF A;  3QWX X;  2D0N A;  4F14 A;  2A3L A;  4C92 B;  3L2U A;  2DZ9 A;  2GNC A;  4OGE A;  3EG1 A;  4O6J A;  2RA2 A;  2GFA A;  2LJ3 A;  1MV3 A;  1YN8 A;  5CO7 A;  2L5Q A;  3MCA B;  4C5E A;  1OI1 A;  2LCL A;  3FEO A;  3UF4 A;  2QG9 B;  1KQS P;  3VV0 A;  1VQO Q;  4DBR A;  1TG0 A;  1N9R A;  2HKQ B;  5CKD A;  3JCM f;  3QDF A;  5I11 A;  1UGR B;  1AZG B;  3VJP A;  2RK1 A;  3M59 A;  4A4K A;  3PVL A;  4M78 B;  5GMK e;  5IHK A;  1OPK A;  3CCM Q;  1UEC A;  1KQS A;  2LNH B;  1Y96 A;  3CCS A;  3DKM A;  2K79 A;  4RTT A;  2E5Q A;  2O9V A;  3JCM X;  1Q81 R;  2SRC A;  2GGR A;  2QTV A;  2EJG A;  1W2B P;  1WIE A;  3RKY A;  1KD1 C;  3GNF B;  3JCM J;  4X1V A;  4E7H A;  2YUO A;  1D3B B;  3X28 B;  5KH6 A;  2AZV A;  3J80 E;  2EBP A;  2JUF A;  5FU6 B;  3GPL A;  5FU7 C;  1IRE B;  3A8M B;  4FU6 A;  2E3H A;  3OYE A;  2E3I A;  3OB9 A;  2MAM A;  4MDX A;  4XTW A;  4EIK A;  3QJ6 A;  1AEY A;  4PFO A;  1IO6 A;  2O4X A;  2DX1 A;  4ME7 A;  4JJN K;  3PGG A;  1JEG A;  2C0O A;  4M7D A;  5DY9 A;  3O8V A;  4C92 G;  3SFM A;  2QEX T;  2CUB A;  1R8O B;  2R5A A;  2EQI A;  1VQK A;  2KE9 A;  1M1K R;  2E6Z A;  1TU0 B;  4HVV A;  2J6F A;  5IH2 A;  4RCC A;  4QW2 A;  5CKE A;  4C0G A;  3TVT A;  3KFV A;  3INZ A;  3CC7 A;  1QP2 A;  1VQM A;  1ZSZ A;  2RQU A;  2XMF A;  2DEU A;  3I56 Q;  4E2F B;  3CEY A;  3VUZ A;  3M53 A;  3G6E A;  2I0N A;  4MDW A;  2W10 A;  2VXF A;  2DTI A;  1OU8 A;  1WQ7 A;  2OTL Q;  1GL5 A;  3VRY A;  2DFU A;  3BY7 A;  2QQ9 A;  1XJW B;  4OVA A;  3E2U A;  3NPF A;  3QUI A;  3CBP A;  4LN2 A;  4ZGE B;  2R57 A;  5FRN A;  2QGF B;  3ASK A;  2E4H A;  2FVU A;  3FRN A;  2KY9 A;  2QQB A;  1YJN A;  4QVC A;  5GAN 4;  4M78 E;  3C0C A;  5A0L A;  2G6F X;  2CUD A;  3G6E Q;  4E7L A;  1C6V X;  1G3Y A;  2JM8 A;  1M2V A;  3OYF A;  2OTJ A;  5CQY A;  1VQ7 T;  1Q86 U;  4BY6 C;  1ZSG A;  4BDY A;  1S72 T;  2JOY A;  1T0H A;  1CKB A;  1PWT A;  3CD6 A;  1RL2 A;  3L2V A;  2I2L A;  2L2P A;  2IVW A;  1WJS A;  3FIF A;  1YJN Q;  3EGX B;  1KIK A;  5FRM A;  1J3T A;  1OPL A;  1RI9 A;  4PNO A;  3UWN A;  4BUG A;  2LJ0 A;  5CIU A;  1TWB A;  4JRQ A;  4AMC A;  4OP0 A;  2EGA A;  1YIT T;  1BCM A;  1VQL T;  1Y71 A;  2EGE A;  4ZGD B;  4E7J A;  3VS0 A;  4NOY A;  3CCR A;  2EQM A;  3A8H B;  3JCM e;  2HZY A;  3P8H A;  5GAN 3;  2DVE A;  1M2O A;  2E70 A;  2NUT A;  1X6B A;  3QSU A;  3URG A;  1OV3 A;  4OMN A;  2MWO A;  5HK0 A;  1VYU A;  4E7Z A;  1VIE A;  3I56 A;  4JDS A;  1W2B S;  1UGQ B;  5GAM g;  1F1B B;  1VQ4 T;  2DKG A;  1IGQ A;  1RAD B;  2R58 A;  3EGD B;  1VQ6 T;  1MUZ A;  1H92 A;  1UE9 A;  1VQ5 Q;  2DL7 A;  4J83 A;  1LPL A;  1M8M A;  4LE9 A;  1M30 A;  2VC8 A;  3HPW A;  1RAH B;  2EJ9 A;  5KYW B;  2ED1 A;  4OB1 B;  4A63 B;  5GMK j;  2EW3 A;  3JCM Q;  4CC2 A;  2RK2 A;  2VGN A;  2PUO B;  3V8J A;  3CCV A;  1BI2 A;  2E65 A;  3JCM W;  1Y96 B;  1G3W A;  2XI9 A;  1QVF S;  1YHQ A;  2EYZ A;  2ESW A;  1MHN A;  2L3S A;  3C12 A;  3NGP A;  3PE0 A;  2RO0 A;  1N6A A;  1MMN A;  3OYL A;  2XID A;  2JMA A;  1NEB A;  2RJE A;  3HKS A;  3RDV A;  2F69 A;  3PIP A;  3QZ9 B;  4M7D B;  3WXM B;  1M3B A;  3M0U A;  1NJI C;  3L2Q A;  5FWC A;  3QPH A;  2AZS A;  2KXD A;  5ECA A;  2C0I A;  2E64 A;  3VYG A;  1RAI B;  5L8R E;  3CCS Q;  2M02 A;  2A08 A;  2XIC A;  1QCO A;  2WSF E;  3CCE Q;  2OX7 A;  2J6O A;  1N5Z A;  1E6H A;  2EFI A;  3KUF A;  1MNE A;  2VYT A;  4HT9 A;  3JB9 D;  2DBM A;  3CME A;  4PLI A;  4J6X A;  4C0D C;  3I55 A;  4LUE A;  3CC7 T;  3OW2 P;  3OS2 A;  2KRO A;  3REA B;  1YNZ A;  3SWN C;  1CKA A;  5GMK h;  2PVD B;  3E1S A;  4PFZ A;  1VQ9 A;  1KSW A;  1AWX A;  2NYS A;  1IXD A;  2OJ2 A;  3PNW C;  4FSS A;  2GTO A;  4PJO C;  1PC0 A;  1VQN T;  4FT4 A;  2AKL A;  2HCK A;  2K2M A;  2KRS A;  4VUB A;  3OS0 A;  1VQO T;  3RR6 A;  2M9U A;  2NWM A;  3J7A F;  2HQE A;  3P8B B;  4ELY C;  4UC4 A;  2YRC A;  1ABQ A;  3MHX A;  1U1S A;  1I5O B;  3VS4 A;  4R0K A;  3M57 A;  1U06 A;  3GBQ A;  1KK7 A;  3OYY A;  1WJR A;  5GAM d;  2HQX A;  3JCM d;  4AFS C;  3OYG A;  3JCM h;  4LXC A;  3OS5 A;  4II1 A;  1WHG A;  1NEG A;  2P4T A;  2DK3 A;  4JPB W; 
#chains in the Genus database with same CATH homology
 1NYG A;  1SRM A;  4HVU A;  1ABO A;  2FEI A;  2K6D A;  2EVR A;  3VS6 A;  2V1Q A;  2K3B A;  2RNA A;  1BB9 A;  4JJC A;  2LJ1 A;  1U5S A;  2ROT A;  2L3P A;  2O9S A;  1X2Q A;  2BZY A;  2YT6 A;  3A98 A;  3REB B;  1WYX A;  2ENM A;  3VRZ A;  2M0Y A;  3RNJ A;  2HDA A;  4OMM A;  1K9A A;  2DYB A;  2KGT A;  2VKN A;  1UJ0 A;  2F2V A;  2DRK A;  2KR3 A;  1HJD A;  4AFU C;  2J7I A;  3EG2 A;  4RTZ A;  1RLP C;  1X6G A;  3M0Q A;  2EYY A;  2KNB B;  1AVZ C;  4Z88 A;  4DEX A;  3M0S A;  4DEY A;  1FYN A;  2KT1 A;  3H0F A;  1GBR A;  3VS3 A;  4D8D A;  4RTY A;  2D1X A;  1GBQ A;  1ZX6 A;  2JMC A;  2CH4 W;  2LCS A;  2MIO A;  2DVJ A;  1QKW A;  2DRM A;  3SEM A;  2RMO A;  2DJQ A;  1M3A A;  1HD3 A;  1SEM A;  2X3X D;  3QWX X;  2D0N A;  4F14 A;  3I35 A;  1ZLM A;  2FG0 A;  4WCI A;  2GNC A;  3EG1 A;  5GJV B;  1QWF A;  2O88 A;  2GTJ A;  1SHF A;  2DLP A;  2LJ3 A;  1EFN A;  3NMZ C;  1MV3 A;  1Z9Z A;  2BZ8 A;  1YN8 A;  1OEB A;  2EYW A;  1ZUY A;  2M51 A;  3UA6 A;  2CT4 A;  1VA7 A;  1NG2 A;  2RN8 A;  3EG0 A;  1ARK A;  1T0J A;  3UF4 A;  1K1Z A;  1Z9Q A;  4JZ3 A;  3ULR B;  1TG0 A;  1JXO A;  4J9D A;  3IQL A;  1KFZ A;  1I0C A;  5I11 A;  1AZG B;  2NUZ A;  3M0P A;  3PVL A;  2HSP A;  1MV0 B;  1UG1 A;  2FO0 A;  1T3S A;  1B07 A;  1GFD A;  3VS2 A;  3TSZ A;  2RQT A;  1OPK A;  5IHK A;  1AOJ A;  1UEC A;  2YUN A;  2LNH B;  4ESR A;  2K79 A;  4RTT A;  2P4R A;  4HXJ A;  2DMO A;  2O9V A;  1NLO C;  2SRC A;  2GGR A;  2DNU A;  1Y0M A;  4J9G A;  1RUW A;  1GFC A;  3PVQ A;  3RBB B;  1RLQ C;  2KYM A;  1WIE A;  4X1V A;  1PKS A;  2YUO A;  1BBZ A;  3QWY A;  2EKH A;  2FRW A;  4RTW A;  2AZV A;  5I22 A;  2B86 A;  2SEM A;  1WDX A;  1PRM C;  1WFW A;  2EBP A;  2L0A A;  2OAW A;  2DM1 A;  1YP5 A;  4OMP A;  2VWF A;  1W6X A;  3CQT A;  1NLP C;  1E6G A;  1G83 A;  5EC7 A;  4J9E A;  4OMQ A;  1X43 A;  4ORZ A;  1GCP A;  4EIK A;  2JS0 A;  4J9I A;  1K76 A;  1AEY A;  1IO6 A;  4AFZ C;  2DX1 A;  1WX6 A;  2C0O A;  1JEG A;  1X69 A;  5IXF A;  1K0S A;  4RTV A;  2CUB A;  3TSW A;  2KYB A;  2EQI A;  2H8H A;  4GLM A;  2KE9 A;  3R6N A;  2HBW A;  4HVV A;  2YDL A;  4K11 A;  2J6F A;  2DL3 A;  4KRT A;  5IH2 A;  3EG3 A;  1Y57 A;  2JS2 A;  3O5Z A;  3KFV A;  3TVT A;  2CSI A;  1W70 A;  4JJB A;  2RQU A;  1SHG A;  2XMF A;  1B3Q A;  2K7A A;  1A0N B;  2YUQ A;  2KBT A;  2OI3 A;  2I0N A;  2FPD A;  2KXC A;  4OMO A;  1JO8 A;  2KT8 A;  5IXB A;  1TUD A;  2JTE A;  1CSK A;  2F2X A;  1YWO A;  2W10 A;  1BK2 A;  2IIM A;  1QWE A;  5HCK A;  2CRE A;  1GL5 A;  3VRY A;  3VS1 A;  3NPF A;  1M3C A;  4LN2 A;  1UHC A;  2PNI A;  2A36 A;  1AWW A;  2RQR A;  2J6K A;  2C0T A;  3NHN A;  4GBQ A;  3THK A;  1AD5 A;  4D8K A;  3H0H A;  1PKT A;  1X2K A;  2DL8 A;  3C0C A;  2GQI A;  2FPF A;  2G6F X;  1JQQ A;  1I07 A;  2CUD A;  1QKX A;  4J9B A;  1WA7 A;  2D8H A;  2JM8 A;  2LZ6 B;  1ZUU A;  3I5S A;  1WXT A;  1ZSG A;  2LQW A;  1T0H A;  2QDL A;  4CC3 A;  1CKB A;  1H3H A;  1PWT A;  2L2P A;  5FWB A;  2J06 A;  2DE0 X;  3H41 A;  3EHR A;  4LUD A;  2KEA A;  1V1C A;  2ECZ A;  4AFQ C;  1KIK A;  1J3T A;  4LNP A;  1OPL A;  1RI9 A;  2LJ0 A;  1UTI A;  2DA9 A;  2EGA A;  2MCN A;  2YUP A;  1BU1 A;  2EGE A;  3M0R A;  1VYV A;  4IIO A;  3UA7 A;  1NM7 A;  3VS0 A;  4M4Z A;  3U23 A;  1ZUK A;  4J9H A;  1AWJ A;  4CC4 B;  4HVW A;  4RTU A;  1WXB A;  1YCS B;  2L3Q A;  1UDL A;  3EHQ A;  1X6B A;  4E6R A;  2EYX A;  1OV3 A;  4OMN A;  1QLY A;  1VYU A;  2AK5 A;  2LMJ A;  5IHI A;  2JW4 A;  1VYT A;  2LP5 A;  1MUZ A;  2D8J A;  2CH4 A;  1H92 A;  1UE9 A;  2DL7 A;  1G2B A;  1M8M A;  2ROL A;  3M0T A;  1QCF A;  1PNJ A;  4LE9 A;  1M30 A;  1U3O A;  2ED1 A;  1TUC A;  2A37 A;  4A63 B;  1UFF A;  1LCK A;  2EW3 A;  2RQV A;  4CC2 A;  2FRY A;  1SPK A;  2GBQ A;  2KRN A;  2VVK A;  4RUG A;  1JXM A;  1UJY A;  2CDT A;  2CSQ A;  1GCQ C;  3FJ5 A;  4HCK A;  2EYZ A;  2ESW A;  4F16 A;  1T3L A;  2L3S A;  1I1J A;  3NGP A;  3PE0 A;  1UGV A;  1AWO A;  2DL5 A;  1UUE A;  2JMA A;  1NEB A;  5IHN A;  1WXU A;  2LQN A;  4Z8A A;  4J9C A;  1X27 A;  2DIL A;  2F2W A;  4JZ4 A;  1PHT A;  2RF0 A;  2E5K A;  1M3B A;  3M0U A;  1SRL A;  5FWC A;  1HSQ A;  2AZS A;  3LH5 A;  2KXD A;  4F17 A;  5ECA A;  2C0I A;  2ABL A;  2CT3 A;  2A08 A;  2HEQ A;  4AG1 C;  4ZNX A;  1H8K A;  2EPD A;  2X3W D;  1OOT A;  2J6O A;  1N5Z A;  2RPN A;  1E6H A;  1NYF A;  5GJW B;  2DBM A;  1JU5 C;  4IIM A;  4Y92 A;  2BZX A;  2O31 A;  5L23 A;  2BTT A;  3H0I A;  4LUE A;  4CC7 A;  2A28 A;  1WLP B;  2DF6 A;  3JV3 A;  3UAT A;  2YSQ A;  2KRO A;  3REA B;  1YNZ A;  2EGC A;  1CKA A;  3SHW A;  1SSH A;  4RTX A;  3I9Q A;  1KSW A;  1AWX A;  1K0X A;  2V1R A;  2OJ2 A;  4Z89 A;  4FSS A;  2GTO A;  2FPE A;  2AKK A;  2O2O A;  2JXB A;  3VS7 A;  1M27 C;  2AKL A;  2HCK A;  2KRM A;  2K2M A;  2ED0 A;  2KRS A;  2PZ1 A;  1W1F A;  2DBK A;  4JJD A;  1XOV A;  2DL4 A;  1YWP A;  1KJW A;  2NWM A;  3ZL7 C;  2J05 A;  4J9F A;  1S1N A;  1E7O A;  1ABQ A;  1FMK A;  3VS4 A;  1PRL C;  4R0K A;  1AZE A;  2LX7 A;  2JT4 A;  1U06 A;  1ZBJ A;  3GBQ A;  1GCQ A;  2K9G A;  1K4U S;  4QT7 A;  3EGU A;  4AFS C;  2RQW A;  1UHF A;  2MOX A;  2PTK A;  1GRI A;  3I5R A;  4OML A;  3VS5 A;  4AG2 C;  2JM9 A;  1NEG A;  2W0Z A;  1WI7 A;  4JPB W;  5FW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...