2RQUA

Solution structure of the complex between the ddef1 sh3 domain and the apc samp1 motif
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
b'VRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DDEF1_SH3
molecule tags Signaling protein
source organism Homo sapiens
publication title Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain.
pubmed doi rcsb
total genus 12
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rquA00
2KGTA 1SRLA 3EHRA 2L3PA 2MCNA 2DX1A 2CH4W 1JU5C 3VS2A 5IHKA 1GBRA 3PVLA 3UF4A 1PKSA 4JJDA 2O88A 5FWBA 1M27C 1NM7A 1VYTA 1UJ0A 4CC4B 2EBPA 2RQVA 2CT4A 2EVRA 1NEGA 2OAWA 2CUBA 5FWCA 1ZX6A 2KEAA 1JEGA 1T0HA 3M0RA 2EYZA 2JM8A 3VS7A 2BZYA 2DL4A 3VS4A 1M3CA 2G6FX 1UUEA 2V1RA 2LCSA 2RQTA 1GCPA 3NGPA 1ARKA 4OMLA 1G2BA 1YNZA 1AVZC 1X2KA 1Y57A 1VA7A 2A28A 2MIOA 1KFZA 1K0SA 1U3OA 1WXTA 4J9EA 4J9HA 1ZSGA 1GCQA 1OV3A 3FJ5A 1H3HA 1WI7A 1V1CA 1X43A 4Z88A 2DRMA 2F2XA 2HBWA 2EGEA 4OMMA 2L0AA 1B3QA 1UFFA 2PTKA 1PKTA 2O2OA 1G83A 1SEMA 2J6FA 2HCKA 2AZVA 2DNUA 2JW4A 4M4ZA 5GJWB 4JZ4A 2L3SA 3EG2A 3TSZA 2KRSA 2DLPA 1NEBA 1WDXA 2DBMA 2KXCA 1GFCA 1WLPB 1B07A 2O9VA 4ZNXA 2VWFA 2QDLA 2PNIA 1TUCA 4ORZA 2LX7A 1MV0B 4J9GA 1I0CA 2I0NA 2K3BA 3REBB 1JQQA 1WA7A 2RF0A 1T3LA 1N5ZA 3CQTA 5I11A 4Z8AA 1W70A 2LJ3A 2EGCA 2JM9A 2IIMA 3M0UA 4WCIA 3VRYA 1UG1A 2D8HA 2JS2A 2ROTA 3I9QA 2A36A 2LQWA 1YN8A 1YCSB 2DL5A 2K79A 1OPKA 3C0CA 2A37A 1WXUA 2RNAA 2LQNA 2EYWA 4AFQC 2V1QA 2J05A 1LCKA 1FYNA 2ROLA 4RTZA 1M3BA 2JS0A 1ZUUA 4ESRA 2EW3A 5IHNA 2YUQA 1K0XA 2EQIA 2EYXA 4D8KA 1NYGA 2BZXA 3VS6A 1ABOA 3O5ZA 1Z9ZA 4HVVA 5IHIA 2J06A 2DRKA 3RBBB 1T3SA 4F14A 2JMCA 2A08A 2EYYA 2JXBA 1WIEA 3EGUA 3ULRB 3PE0A 3QWXX 4OMPA 5ECAA 2JTEA 2D8JA 3VS3A 3EG1A 1A0NB 2KROA 1ZUKA 2GTJA 1ZUYA 2X3XD 2CT3A 3EG3A 1AZGB 3EG0A 4LNPA 2DYBA 1NG2A 4AFZC 1UDLA 2YUOA 2EGAA 1WYXA 2B86A 3VS5A 1W1FA 1UJYA 1AWXA 2FG0A 1NYFA 3JV3A 2SEMA 1BBZA 1AOJA 2W10A 1ZBJA 4OMQA 3H0IA 1WFWA 2KT8A 2DL8A 3I5SA 1UTIA 2AKLA 2RPNA 1M8MA 4LN2A 1QLYA 4GBQA 4KRTA 5EC7A 1UGVA 3RNJA 1PHTA 2K2MA 3U23A 1RLPC 2DJQA 4RTUA 2AZSA 1SHFA 2FRYA 2ED1A 4R0KA 1SPKA 2F2VA 3NHNA 2KYBA 2KXDA 3UA7A 4CC7A 2YT6A 4HXJA 4DEYA 4F16A 5IXBA 2DMOA 2KRNA 4RTYA 1AWJA 1CKAA 1GL5A 1NLOC 2K6DA 2DBKA 1GFDA 3UA6A 1RLQC 1KJWA 2HDAA 2BTTA 1ZLMA 2DILA 5HCKA 3M0TA 2J6OA 1U5SA 4JJBA 1KSWA 2FPFA 5FW9A 2OI3A 2O31A 1X69A 2KBTA 2ED0A 2M0YA 1MV3A 1UHFA 2DA9A 2GQIA 1XOVA 2M51A 2GTOA 4CC2A 1YP5A 1X2QA 4J9FA 3SEMA 1T0JA 1X27A 2LP5A 1TG0A 4J9DA 4JJCA 4OMOA 2ECZA 4IIMA 5IXFA 3VRZA 1HD3A 5IH2A 2FRWA 2KNBB 2EKHA 2ESWA 1QKWA 4OMNA 2PZ1A 2ABLA 2FPEA 3M0QA 2OJ2A 1AZEA 1E6HA 2LJ0A 2GGRA 3M0SA 1I07A 1PWTA 2JT4A 3IQLA 3H0FA 3GBQA 2RQUA 4J9BA 1K9AA 1VYUA 1IO6A 1TUDA 2AK5A 1HSQA 1U06A 1PRLC 1QCFA 2P4RA 4GLMA 1JXMA 2FPDA 1KIKA 1SSHA 1GBQA 2YSQA 1SHGA 4RTTA 1E7OA 1YWPA 2BZ8A 2HSPA 2NUZA 2KR3A 1MUZA 4IIOA 4X1VA 1JO8A 2LMJA 2LZ6B 4E6RA 3KFVA 2RMOA 2E5KA 4HVWA 5L23A 2YUPA 1X6BA 2K9GA 2NWMA 3TVTA 2F2WA 2CSIA 3UATA 4HCKA 4JPBW 1RI9A 2CSQA 2J7IA 1AWOA 1JXOA 3H0HA 3SHWA 2RQWA 2JMAA 3NMZC 1BB9A 2YUNA 1PNJA 3R6NA 1QKXA 4RTWA 1BK2A 1RUWA 2SRCA 3A98A 4K11A 1UE9A 2VKNA 3LH5A 4HVUA 1WXBA 2LJ1A 4QT7A 1HJDA 1OEBA 3EHQA 1X6GA 2AKKA 4LUEA 2DL3A 3M0PA 2X3WD 2DE0X 1CSKA 1YWOA 4AFUC 1H8KA 4DEXA 4J9CA 1SRMA 1UECA 5I22A 1QWEA 2D0NA 4AFSC 3REAB 2CDTA 4CC3A 1WX6A 1OOTA 2RQRA 2RN8A 2XMFA 4RTVA 2LNHB 2W0ZA 2DVJA 1VYVA 5GJVB 1BU1A 2L2PA 3TSWA 2DF6A 1W6XA 2CREA 1Y0MA 2C0TA 2KYMA 4F17A 1EFNA 3I5RA 1GRIA 1M30A 1NLPC 2GBQA 2FEIA 2YDLA 4RTXA 2EPDA 3H41A 2L3QA 4LE9A 4EIKA 2DL7A 2C0IA 1CKBA 1K4US 1AD5A 4JZ3A 2J6KA 2DM1A 3ZL7C 3I35A 2KE9A 1S1NA 3NPFA 1FMKA 4AG1C 1M3AA 1OPLA 2K7AA 2C0OA 1UHCA 1K76A 2CH4A 1AWWA 4J9IA 2ENMA 2VVKA 2KT1A 4LUDA 3VS0A 2HEQA 2KRMA 2H8HA 4Y92A 2CUDA 2D1XA 4RUGA 4AG2C 1K1ZA 1I1JA 2FO0A 2MOXA 1ABQA 4FSSA 2GNCA 2O9SA 1AEYA 3THKA 4D8DA 1E6GA 1QWFA 4Z89A 3VS1A 3PVQA 1H92A 1J3TA 4A63B 1GCQC 1PRMC 3QWYA 1Z9QA
chains in the Genus database with same CATH superfamily
2QQBA 3EHRA 2CH4W 3VS2A 5IHKA 3ZEHA 4JJDA 1K73U 1JJ2P 1M27C 4JRQA 1UJ0A 2RQVA 4J6YA 4PFPA 1LOJA 2EVRA 2DTHA 1WJSA 5FWCA 2KEAA 1T0HA 1U1TA 2EYZA 5GANh 2QAZA 2FZGB 1M3CA 3X28B 5GAN5 5GAMf 1GCPA 2QASA 3JCMg 3I55A 1W2BP 1W2BA 4FYVB 2ZPEB 3HPWA 3RUXA 1K0SA 4LDUA 4J9EA 2C06A 2RI5A 4PJOE 4M77A 2HQEA 3CXCS 1PSFA 2XD0A 1OV3A 2A3LA 2R5MA 2K2VA 1V1CA 2VGMA 4PNOA 2F2XA 2E64A 2F5TX 2EGEA 1PG5B 3CCQT 4WF2A 4O6JA 1UEBA 4DA4A 2PTKA 4E2FB 5GANg 3FEOA 1SEMA 5IN1A 5HK3A 1IGUA 4FL6A 2JW4A 1YI2A 4M4ZA 5GJWB 3RIRA 3QSUA 3EG2A 1JB0E 2CP0A 2CGHA 2KRSA 3L2QA 4BE2A 2BE9B 4ME7A 1QQJA 1YIJQ 3VU3C 2YHTA 2RJCA 4ZNXA 2VWFA 3CCLT 5A0LA 4ORZA 1MV0B 4J9GA 2GFAA 4E7LA 2I0NA 1RI0A 2M0OA 3OYKA 2LRQA 1WHMA 3CQTA 2LJ3A 2O4XA 1K9MC 2D0QB 3JB9F 1YFNA 3MHXA 1UG1A 2X4WA 4C0DB 2D8HA 3I9QA 3CMAA 3FDRA 5KYNA 3LYIA 3CCST 2BUDA 4EMKB 3C0CA 2A37A 1WXUA 3CC2T 5DM7R 2QA4T 4FU6A 1YJNT 3CCJT 4AFQC 2V1QA 3HKSA 2QTVA 2GF7A 4HT8A 4KGXB 2ROLA 1NPPA 5C6SA 5IHNA 1RADB 2M1HA 4D6WA 3UT1A 4D8KA 1NYGA 3NTKA 5L8RE 1ABOA 1Z9ZA 3H8ZA 5IHIA 3E9FA 1T3SA 1M90R 2A08A 3M53A 3R6OA 1Q86C 4PJOD 4M77G 3OYLA 1ZUKA 5GMKl 5CR2A 3EG0A 3G6EQ 3CC4Q 2DYBA 2FHDA 4AFZC 1G3SA 2EGAA 1TTHB 2QEXA 1WYXA 1K8AC 2V8KA 2B86A 3VS5A 1BI3A 1UJYA 4EPCA 2RK1A 2SEMA 3I56A 2BIVA 3GPLA 3EAEA 4FYYB 1ZBJA 2PVOB 3H0IA 1C6VX 3X20B 3TEEA 1D0YA 3E2UA 1WHJA 2H3JA 1PHTA 3ME9A 4KT0E 4RTUA 3OYEA 3INZA 2XG8D 2HAXA 2FRYA 4C0DC 5LJ3f 5LJ5h 1YCYA 2F2VA 3MP6A 4RMOA 2RA2A 4C8QC 1D0ZA 3PIOA 3JCMh 2KXDA 2YT6A 4YTLA 4DEYA 4A4EA 5C0MA 2KRNA 4E7IA 1CKAA 3BW1A 1ZHIA 3UA6A 4PJOG 2HDAA 2DILA 2J6OA 3CC7Q 4M7AG 2OI3A 4PJJA 1X69A 2KBTA 4BE0A 2ED0A 1X6OA 2GQIA 1G3WA 3META 1I5OB 2M51A 5KE3A 1HYOA 3M56A 4DBRA 2A7YA 3V7RA 2L3RA 1VIEA 1T0JA 2LP5A 2D6FA 4JJCA 3M58A 1H641 5IXFA 3VRZA 2CP3A 3OSVA 4MDWA 4HCZA 2DIGA 4IUUA 4OMNA 2QEXQ 2ABLA 2FPEA 3FB9A 4KGZB 1E6HA 4C92D 5J26A 5DY9A 3M0SA 1QCOA 4RG8A 2JT4A 4WTOB 2FVUA 2RQUA 3M4GA 2K5IA 3I55Q 1R0BG 2XU8A 4QQGA 5I2SA 4GLMA 2YLBA 2DERA 1BIBA 2DK3A 1SSFA 3HL8A 1SHGA 4RTTA 3SWNC 1YWPA 2BZ8A 2HSPA 2NUZA 4QKUA 4X1VA 1KG1A 4LD6A 5KYXB 2OTLQ 2LZ6B 1VQ8A 3KFVA 2P4TA 4BY6B 1D1CA 1K73C 2NWMA 4MZMA 1VOMA 2F69A 3E1SA 3UATA 1XTDA 4JPBW 4C0FA 3JCMf 4E47A 2CSQA 2J7IA 3PT9A 3UWNA 9ATCB 2V8JA 5GAN8 5EG2A 1QKXA 4GLKA 1BK2A 2DKGA 1RUWA 1M9SA 1Y07A 3HSBA 1TSFA 1VUBA 1GXIE 1IB8A 4J6XA 2VKNA 3LH5A 4E7SA 3EHQA 2HKQB 2O01E 2VB6A 2VXEA 2DE0X 1VQ9T 1CSKA 2CP6A 4M7DE 5GAOr 2HZYA 1SRMA 1U8RA 1QWEA 3A5ZB 3REAB 2CDTA 1ZSZA 5KYWA 1WX6A 1OOTA 2PUKB 1BI1A 2F1LA 2QI2A 3KXTA 4RTVA 3CCUT 1BU1A 4L59A 3CD6A 3DLLA 4M75F 2QTXA 4C0ZA 1Y0MA 2HQHA 1QVFS 3QJYA 1KC8R 1GRIA 1R77A 1M30A 1NLPC 3SFMA 2YDLA 1UGRB 1EX4A 2XICA 4LE9A 1K4US 2K5LA 3QYGB 6AT1B 4M78B 3NPFA 1FMKA 3JRZA 2DJZA 1M3AA 1OPLA 1FX7A 2C0OA 1AWWA 2DPPB 1Q86U 4LUDA 1N6AA 2DZ9A 2FYKA 4RUGA 3X25B 1I1JA 2FO0A 2VASA 3F70A 3A1PA 4OB0B 1MMNA 1YJNQ 1N9RA 5KE2A 3T9NA 1YITQ 2JN0A 3THKA 1R0CB 4D8DA 4KGVB 5HK0A 1E6GA 4EMKC 1PCXA 1OX9A 2X9HA 1J3TA 1PRMC 3M57A 1Z9QA 4PLLA 1SRLA 3OYHA 2HKNA 5CK9A 1Q81R 2L3PA 3OYYA 1BKBA 3SWNA 3G71T 4C92E 5LJ5g 1GBRA 3PVLA 1NPRA 4GY5A 5FWBA 1NM7A 2H3EB 2EBPA 3GP8A 3P8BB 4E7KA 4IUPA 3M55A 1NEGA 5DLOA 2HL3A 3M0RA 3VS7A 4E7JA 2BZYA 5A2QE 1KQSA 2XDBA 2RI2A 2IG0A 2G6FX 2V1RA 2X51A 1D3BA 2LCSA 1WHGA 2RQTA 3NGPA 1AT1B 3CCSQ 4F7UF 1G2BA 4PJOC 1YNZA 1X2KA 2A28A 1Y57A 2OTJA 5AT1B 4HA8A 1WXTA 3BE3A 2RHXA 1DJ7B 2QA4A 2QDYB 3MEWA 2G3RA 5KYUB 4MMLA 2LX9A 2KAFA 1RAAB 2X4YA 4PL6A 3C12A 2MMPA 2RJFA 4NL3A 1YHQA 1UFFA 1PKTA 3RKXA 4M75A 1NBEB 2QK0A 4Y28E 1SF9A 4M75C 2AZVA 5D6YA 2K4YA 1WHKA 2DXCA 4PJMA 2XDDA 3ZBDA 4J83A 1ZBXA 1YJ9A 3NTIA 2P84A 2RH2A 3C94A 4N4IA 3EH2A 2E6ZA 2GFUA 2DLPA 3RMSA 3PTAA 2D9TA 1WLPB 2R5AA 1B07A 1TS9A 5CO7A 2NUPA 3UPUA 2KK4A 1XQHA 2QDLA 1VQ6Q 2QGFB 2DETA 2QG9B 3JB9I 4M77E 1VQKQ 1TOVA 2LVMA 3OBWA 3L1AA 1PM3A 2K3BA 4KH1B 2KMTA 5GAOq 1WA7A 1AHJB 2RF0A 1B34A 1N5ZA 5I11A 3HRUA 4PFOA 1WHHA 1WNLA 4WCIA 3VRYA 3BDLA 2MI6A 2CKKA 3OYFA 2EQJA 2JOYA 2ROTA 2X4JA 3LGFA 5GMKe 3HTRA 2A36A 1N8RU 4DOWA 1NJIR 2DL5A 4M77F 1D09B 4ELZC 2JUFA 2LDMA 3TREA 3OB9A 5KCOA 4F04B 1M2OA 1F1BB 3I55T 1LCKA 1FYNA 2QQRA 2EAYA 4RKUE 4RTZA 2FB7A 2BE7D 4OGEA 1ZUUA 1MMGA 2QEXT 1G3YA 1M1GA 5D6XA 2PUOB 2MWPA 3CMEQ 2QYZA 3OQ5A 1QP3A 3OS5A 2NUTA 2DRKA 1RAFB 1N8RC 3RBBB 2JMCA 1Q7YU 1VQ5A 1WIEA 3ULRB 1WZOA 3PE0A 5ECAA 4R56A 3OMGA 3VS3A 2HBPA 2WACA 4XU3A 3CCVT 1A0NB 2KROA 2GTJA 2EKOA 2X3XD 2CT3A 4C8QA 3GF5A 3MEVA 1WQ7A 1YJWQ 4LNPA 5A0DA 3O8VA 4N4GA 1Q86R 1UDLA 5CKHA 2R58A 3OS0A 2YRVA 3OSSC 4JDSA 3LGLA 4F7UB 2MK5A 2QXFA 1VQ7A 1AWXA 4PLIA 3AHUA 4PJOB 4NL2A 3JV3A 1BBZA 2P0KA 2KT8A 2DL8A 2HNIA 1B7TA 3I5SA 2AKLA 2MPXC 4LN2A 4OB3B 3HHTB 4GBQA 3J80E 3VJPA 5EC7A 1UGVA 2LTOA 1R8OB 3CCMQ 2ED1A 2X35A 3L2VA 1Q81U 3M9QA 3QZ5B 1SPKA 3MKDA 1Y7XA 5LJ3h 5LJ5f 3JCMP 3OW2S 2JNGA 4C5GA 1VQ9Q 1QVPA 4F16A 4HCCA 5IXBA 2ZCFB 2DMOA 4RTYA 1KHCA 3OS2A 1OQKA 1NLOC 2K6DA 5CCAA 4Z02A 5CQXA 1RLQC 1KJWA 4DQ2A 3HRTA 3MPUB 1RAGB 2FZKB 5HCKA 2P0PA 4JRIA 3UDCA 1VQKT 4JJBA 4J7FA 1KSWA 3G4ST 2FPFA 4EMGA 2DTOA 2HSEB 4X9CA 1VQNA 1D1BA 4C92B 3MP1A 1UHFA 4PJNA 2VGNA 2OTLA 1QVFA 2DYIA 4CC2A 1VQOQ 1YP5A 2NUTB 4BI4A 1VQMT 3KUFA 4J9FA 3CPWA 2YWWA 2DD5A 4XTUA 3OYCA 1HD3A 2FRWA 2EYQA 2EKHA 1QKWA 1KHIA 3CCVQ 1OZ2A 3M0QA 4FT2A 1AZEA 3OBYA 5GAMd 2RHZA 1WGSA 1I07A 1VQPT 3H0FA 3CCEQ 1K9AA 1VYUA 1RL2A 1TUDA 3LWHA 1HSQA 2JTMA 1U06A 5GAMj 1FXXA 4QW2A 1KIKA 3CCRQ 2YSQA 4BI3A 5GAN6 5CKEA 2KR3A 2ZZDA 4JLIA 1JO8A 3SDZA 1QVGP 1QVGA 5L23A 1X6BA 3CCJQ 2K9GA 2JZ2A 3MP8A 2LNVA 2KY9A 5GAOn 3EH1A 3CMAT 1IGQA 5GANf 2LQ8A 2RQWA 4ZGDB 3RERA 1ZQ1A 3R6NA 2ZPFB 4RCCA 2R57A 3CCMT 4K11A 3OYJA 3PGGA 4A4GA 2RHUA 3OYGA 1Y96B 2EQUA 2LJ1A 3CBMA 2ZPBB 2E12A 3C4SA 4LUEA 3M0PA 2Y4XA 1KQSP 1YITT 1M1FA 1WHLA 1H8KA 3ZFJA 1OU8A 4PFZA 4J9CA 4L5GA 5I22A 1JJ2S 4CC3A 5GANe 4HCBA 2RN8A 2XMFA 3WVEB 5HKCA 4V2SA 2ZAEA 1P92A 3OYMA 1VYVA 3QG1A 5D6WA 4C0GA 1W6XA 2CREA 2KQWA 2KYMA 3OA6A 4F17A 4C5EA 3I5RA 3LW5E 2GBQA 3QYHB 4EMKA 2MAMA 4M78G 2COZA 2DL7A 2C0IA 4M7DB 2EJGA 4JZ3A 3FRNA 3EFOB 2ZPHB 1S1NA 3AT1B 4QVZA 2QA4Q 2K7AA 1Q82R 3G71A 3M4YA 3JAME 4M78A 2PQWA 2KT1A 3VS0A 2HEQA 2KRMA 5KYYA 1N9SA 2H8HA 2WSFE 1JBMA 1NZ9A 4AG2C 4IUVA 1NJIC 4ANJA 2MOXA 3JB9H 4CI0C 2E10A 3QIIA 5KYXA 1OYXA 4ZN1A 2GNCA 3MCAB 2E4HA 4FYWB 4Z89A 3LLRA 3VS1A 2QQSA 4M77C 4DOVA 2JJ9A 3RDVA 2OX7A 1S72T 3D7SB 4XU0A 3CXCA 1O9SA 2MCNA 1M4ZA 2VV5A 2M02A 2XDPA 3UF4A 4M7AA 2XKOC 3OMCA 4IURA 1VYTA 2X4XA 3Q1JA 4CC4B 5I2MA 3CCQQ 2LCCA 3M5AA 4NS5A 2E41A 7AT1B 4FIBA 4TVRA 4FW1A 2CUBA 1ZSZC 4M78E 1H3ZA 3VS4A 2LCLA 3GLXA 1UUEA 2DZCA 4KULA 1TU0B 5LJ3d 1M5Q1 1QW1A 2OTLT 4FW2A 3BY7A 4OMLA 1RAEB 4L6V5 4X34A 1M1KC 1K8AR 3CCUA 2VYTA 2O4XB 1RABB 2MIOA 4LD9K 2CZ7B 4OB1B 4AMCA 3QHSA 4J9HA 1ZSGA 2LC4A 3VYGA 2Z0WA 4ZTFA 4BACA 1WI7A 3MEAA 4Z88A 2AT1B 3CC7A 3CCVA 2HBWA 4LXCA 3EGDB 4XTVA 1B3QA 2HD0A 1G83A 2RJEA 1I4K1 3VUZA 2HMAA 2HCKA 2RO0A 2XIDA 1N27A 1VIFA 1D0XA 4JZ4A 4PJLA 4C92C 4UC4A 1MMAA 3FIFA 3V7SA 3URGA 2O9VA 1VQ6T 4BD3A 2A0FB 1VQ8T 5A0GA 4XAXB 3JB9D 1YIJT 1TUCA 1VQ6A 2LX7A 5GAOm 2ATCB 1I0CA 3CPFA 5J3BA 1PSEA 5FU6C 4C92F 1IHVA 1QP2A 1JQQA 4VUBA 1T3LA 4Z8AA 1PD0A 1S72A 2EGCA 3FLGA 2JM9A 3GNGA 2L8DA 2IIMA 5HY6A 4X9DA 3BFMA 4MMKA 4HT9A 1TXQA 3TQ7P 1ZA2B 1U1SA 2EIFA 4M77B 3JCMQ 2PVGB 1YCSB 4XU1A 3A8GB 2RNAA 2BKDN 4NOYA 4F7UE 3JCMd 3JB9J 3EGDA 4C92A 4XQ3A 2PVDB 1LJOA 3JCMX 1NE8A 1D3BB 4IKFA 1M3BA 4ATOA 2JS0A 1C1AA 3G4SA 2EW3A 4F7UG 1K0XA 1Y96A 1VQOT 2BZXA 3O5ZA 1OU9A 4HVVA 1TWBA 1MNEA 3OYIA 2EJ9A 3P8DA 4M75G 4C8QE 1S72Q 2JXBA 1X75C 3QWXX 4OMPA 1LVKA 2DIQA 2JTEA 2D8JA 1MGQA 3QUIA 1XJWB 5CAIA 5KCHA 3SB2A 3P8HA 3OY9A 1ZUYA 3G4SQ 3EG3A 3HFOA 4C5IA 3H6ZA 5CKBA 2RI3A 1QMCA 1Q7YR 1NG2A 1KK7A 3DLMA 5GMKm 3OW2A 1KD1R 2MWOA 2KI7A 3ASKA 2MYSA 1UGPB 1VQMQ 5FRNA 1VQPQ 1VQLQ 4JRPA 1NYFA 2DO3A 2MF2A 3L2ZA 1V29B 2P0QA 1RAIB 2W10A 4OMQA 1B34B 3JSCA 1RAHB 4DBQA 2E3IA 2RPNA 4XTXA 1LPLA 1QLYA 5GAN3 1WPYA 2GCXA 4BDZA 2DJQA 1Q82U 2RK2A 3CCMA 2AZSA 4MZTA 1BCMA 1SHFA 5IT9E 4R0KA 3QJ6A 1KC8C 3FJPA 3L42A 4HKEA 1WJRA 5GMKh 3JB9G 3CCRT 2YLCA 3CCLA 3H9NA 1GFDA 3SD4A 1O75A 2BTTA 4MDXA 1VQMA 3QDRB 4M75B 1U5SA 3V8LA 4FM4B 3GNFB 5FW9A 5KH6A 2XK0A 3OYDA 1MV3A 2DA9A 3MO8A 3CCUQ 1KQ1A 2GTOA 5GAN7 1PD1A 3PMTA 1UGQB 3SEMA 3G6EA 3CCQA 1VQ4A 2DXBA 3A8OB 2NUPB 2ECZA 4IIMA 5CVIA 1VQPA 4M75E 3S3MA 2PZ1A 2OJ2A 1Q95G 4J8OA 2DTIA 1X01A 1Q81C 1OX8A 3MJXA 2V8IA 4J9BA 3EG9A 4EDUA 5IAYA 1ACMB 2ZPGB 2COYA 1IO6A 4Q5WA 1MHNA 1HXDA 1TUGB 2RB6A 4ZN3A 4BB7A 1JXMA 3CC7T 2FPDA 3CCET 1GBQA 1M2VB 3EFSA 4O5VA 4Y91A 4A53A 2NLUA 4JS5A 2RMOA 2E5KA 4HVWA 3L2WA 1VQ9A 3L2UA 3TVTA 2F2WA 1UGSB 4HCKA 1RI9A 4LDYA 1AWOA 1JXOA 3H0HA 5CKDA 1IHWA 3SHWA 2OAUA 2JMAA 1I5LA 1BB9A 3A98A 4KUDK 3OYNA 1UE9A 4RG2A 2B8AA 1EZZB 3VYHB 1WXBA 4QT7A 1HJDA 4XTYA 1OEBA 3G6ET 2OTJT 2DL3A 1YWOA 3G7ZA 1WJQA 2ZGWA 1YI2T 1UECA 4E7HA 2D0NA 2EQMA 4AFSC 1BYMA 3GIBA 2W0ZA 3S3NA 2DVJA 3A8HB 1YHQQ 3CCLQ 1G3TA 3TSWA 2L2PA 3OYBA 3PMIA 1EFNA 3JCMW 4C8QG 3CCRA 3H41A 2IPOB 2YRDA 5GAMh 2JVVA 1CKBA 3LX7A 4XU2A 4JJNK 3CPWS 1AD5A 2J6KA 2DM1A 2CS7A 3I35A 5LJ3e 1TH7A 1XNIA 1K76A 3E19A 4A4HA 4A54A 5KYUA 4A4KA 2CUDA 1VQLA 1FMVA 1K1ZA 4QQDA 3J81E 1FWZA 3G1JA 3CC4T 4N0AC 1YJ9T 1BCOA 4JS4A 3CPWP 1AEYA 4C5HA 1QWFA 1H92A 3PVQA 3CC2A 3L2RA 1GCQC 4FSXA 3QWYA 2KGTA 5CKFA 2HQXA 1QCNA 4M75D 5CIUA 2DX1A 1KD1U 5LL6S 1JU5C 3PFSA 1N8RR 4LDWA 4F7UA 1PKSA 2CP2A 2O88A 4M7AD 1G5VA 4OGCA 3NFCA 1ZSZB 4PJOF 5KYWB 4R55A 2CT4A 1OZ3A 3HFNA 1IZ6A 2Y90A 2OAWA 3QBYA 4BY6C 1ZX6A 1JEGA 3WXMB 2JM8A 2WSCE 2DL4A 2E1HA 4B6MA 2FL7A 3N5BB 1K73R 5GANd 3CCSA 1ARKA 3HP9A 1VQOA 3OW2P 4LDXA 1AVZC 5LJ3g 1VA7A 1KFZA 3X24B 2GQVA 2LQKA 1U3OA 2XHCA 2XI9A 5D7UA 2DEUA 1EIFA 2NYSA 1GCQA 4M7AC 4JLGA 2DFUA 1VQ5T 3FJ5A 1H3HA 1JRIA 1YHQT 5GMKj 1K8AU 1X43A 2DRMA 1MNDA 4M78C 4OMMA 4XK8E 5GAN4 5M9OA 4M7DC 2L0AA 3VV0A 4M7DA 2Y4YA 2O2OA 5GAN2 2J6FA 3J7AF 2DNUA 4KBMB 4OF1A 2COWA 2L3SA 4ZTJA 1Y71A 2CYZB 1HK9A 1Q82C 3TSZA 2M16A 1NEBA 1WDXA 2DBMA 3QXEB 2KXCA 1GFCA 2VC8A 3NTHA 2RHYA 3CBOA 4C8QB 1VQ8Q 3JCMb 1IREB 1YJWA 2PNIA 2AHJB 4M78D 5GAMe 1K9MR 1M1KU 2CZ6B 3G71Q 4M7AF 2HL5C 3REBB 3RMQA 1YI2Q 2RM4A 2E6NA 3CBPA 2KSSA 4J6WA 3M54A 2CZ0B 3EG9B 1VQ5Q 1W70A 3HRSA 3RR6A 3M0UA 4FT4A 2JS2A 3OS1A 4XTWA 3CMEA 5FU7C 2LQWA 5KYYB 1YN8A 1M8VA 3A8LB 1OULA 1VQ4Q 2K79A 1OPKA 2YXYA 2CP5A 1D1AA 2K57A 2LQNA 4M7AE 2EYWA 2J05A 4B9WA 4BDYA 2L89A 3EFRA 4ESRA 3E9GA 2E65A 3CCEA 2YUQA 2IVWA 3VKIA 4BE1A 1M90C 4RCBA 3DKMA 2EQIA 1YITA 2EYXA 2L5QA 5GANj 1YJNA 3TCJA 3VS6A 3X26B 4II1A 3QPHA 1ZA1B 2J06A 3EGXA 1YJ9Q 4F14A 2EYYA 3EGUA 3TU4K 3I56Q 3EG1A 3CD6T 5GAMg 1AZGB 1JJ2A 4AT1B 1NJIU 2DEQA 2F5KA 3KBGA 3CC4A 1WQWA 1VQ7T 2YUOA 5I21A 3QKJA 3VUBA 1KQSS 5GAOp 2AIRB 5GAOl 1VQLT 1W1FA 1LNXA 2FG0A 2QGGA 2RD1A 2E5QA 4PK4A 2EJFA 4C8QF 1SG5A 1PC0A 3QZ9B 4ZGJB 1AOJA 1Q7YC 4IUQA 4QVDA 2CZ1B 1V76A 4DBFA 1WFWA 4J7IA 1UTIA 1M8MA 3QDFA 3QO3A 3CMAQ 4KRTA 3RESA 4M7DG 3RNJA 4MZPA 2K2MA 3U23A 1RLPC 1BI2A 8ATCB 4A4FA 1YBYA 4KH0B 1VQNQ 3RKWA 2DAQA 2QQAA 1BI0A 4FYXB 3NHNA 2KYBA 5GMKi 2DD4A 5J39A 4OB2B 4J5YA 4CC7A 3UA7A 3V8JA 4HXJA 5CQYA 5FU6B 2DVEA 1AWJA 1GL5A 1IXDA 2DBKA 4KUIA 1FMWA 2V26A 3M59A 3CEYA 4B9XA 1ZLMA 3JCMc 2VXFA 3M0TA 3GOXA 4JUVA 4N4HA 2ZPIB 2O31A 2M0YA 4C92G 1XOVA 4P5NA 8AT1B 4M7DF 3JCMV 1VQNT 3CCJA 1X2QA 2RHIA 2DXUA 1X27A 5AYFA 2E3HA 4M7DD 1TG0A 4J9DA 4OMOA 1UB4A 1W4SA 3OYAA 2KVQG 5IH2A 2KNBB 2ESWA 2LJ0A 2GGRA 3DB3A 1PWTA 4XTZA 3IQLA 3GBQA 4IUTA 4C8QD 4M7AB 2AK5A 4CRIA 1MMDA 4BI8B 1BIAA 2KDSA 3C95A 1PRLC 1QCFA 2P4RA 1I81A 2CP7A 1SSHA 4DBHA 4OP0A 1E7OA 4PKCC 3EFOA 1RACB 4EMHA 3ER0A 1MUZA 4IIOA 1KD1C 2LMJA 3MEUA 3RKYA 4E6RA 3CMET 2YUPA 1YIJA 3A8MB 1OI1A 3LWIA 2CSIA 2EWNA 1M1KR 1K9MU 4ZGEB 3DB4A 2WSEE 1QVFP 3NMZC 5FU7B 2YUNA 1PNJA 3PIPA 3EGXB 4RTWA 2LT1A 2SRCA 1YJWT 3JCMJ 2LT4A 3CD6Q 3CC2Q 3S6WA 4ELYC 5FRMA 3BDUA 4HVUA 1IRXA 3I56T 5LJ3j 1X6GA 2AKKA 2EQKA 3V7CA 2X3WD 2PU9B 4AFUC 2DXTA 1KC8U 4M78F 4DEXA 2K3YA 4BUGA 2RQRA 2M9UA 1VQKA 1C0MA 4JRKA 3SWNB 2LNHB 5GJVB 5LJ5e 2K5FA 3LH0A 3WVDB 4LDVA 5DLQE 1I8FA 2DF6A 3S3OA 2C0TA 4QQ6A 4PJOA 4N0AA 2FZCB 2EFIA 3V8KA 2FEIA 2VUBA 1M90U 4RTXA 2EPDA 2L3QA 4EIKA 4E7ZA 2I2LA 3JCMe 1M2VA 5LJ5j 3ZL7C 1QVGS 2KE9A 2YRCA 4AG1C 2QQ9A 1UHCA 2CH4A 4J9IA 2ENMA 2VVKA 2E70A 2JTFA 4QVCA 5FLXE 5LJ5d 1G8XA 4OMFB 3PNWC 4Y92A 2D1XA 1VQ7Q 2RJDA 1KQ2A 4OVAA 1VQ4T 1SKUB 1ABQA 4M77D 5FROA 4FSSA 2O9SA 2OTJQ 1W2BS 3CXCP 3FC3A 2K3XA 4A63B 4FCYA
chains in the Genus database with same CATH topology
2KGTA 1SRLA 3EHRA 2L3PA 2MCNA 2DX1A 2CH4W 1JU5C 3VS2A 5IHKA 1GBRA 3PVLA 3UF4A 1PKSA 4JJDA 2O88A 5FWBA 1M27C 1NM7A 1VYTA 1UJ0A 4CC4B 2EBPA 2RQVA 2CT4A 2EVRA 1NEGA 2OAWA 2CUBA 5FWCA 1ZX6A 2KEAA 1JEGA 1T0HA 3M0RA 2EYZA 2JM8A 3VS7A 2BZYA 2DL4A 3VS4A 1M3CA 2G6FX 1UUEA 2V1RA 2LCSA 2RQTA 1GCPA 3NGPA 1ARKA 4OMLA 1G2BA 1YNZA 1AVZC 1X2KA 1Y57A 1VA7A 2A28A 2MIOA 1KFZA 1K0SA 1U3OA 1WXTA 4J9EA 4J9HA 1ZSGA 1GCQA 1OV3A 3FJ5A 1H3HA 1WI7A 1V1CA 1X43A 4Z88A 2DRMA 2F2XA 2HBWA 2EGEA 4OMMA 2L0AA 1B3QA 1UFFA 2PTKA 1PKTA 2O2OA 1G83A 1SEMA 2J6FA 2HCKA 2AZVA 2DNUA 2JW4A 4M4ZA 5GJWB 4JZ4A 2L3SA 3EG2A 3TSZA 2KRSA 2DLPA 1NEBA 1WDXA 2DBMA 2KXCA 1GFCA 1WLPB 1B07A 2O9VA 4ZNXA 2VWFA 2QDLA 2PNIA 1TUCA 4ORZA 2LX7A 1MV0B 4J9GA 1I0CA 2I0NA 2K3BA 3REBB 1JQQA 1WA7A 2RF0A 1T3LA 1N5ZA 3CQTA 5I11A 4Z8AA 1W70A 2LJ3A 2EGCA 2JM9A 2IIMA 3M0UA 4WCIA 3VRYA 1UG1A 2D8HA 2JS2A 2ROTA 3I9QA 2A36A 2LQWA 1YN8A 1YCSB 2DL5A 2K79A 1OPKA 3C0CA 2A37A 1WXUA 2RNAA 2LQNA 2EYWA 4AFQC 2V1QA 2J05A 1LCKA 1FYNA 2ROLA 4RTZA 1M3BA 2JS0A 1ZUUA 4ESRA 2EW3A 5IHNA 2YUQA 1K0XA 2EQIA 2EYXA 4D8KA 1NYGA 2BZXA 3VS6A 1ABOA 3O5ZA 1Z9ZA 4HVVA 5IHIA 2J06A 2DRKA 3RBBB 1T3SA 4F14A 2JMCA 2A08A 2EYYA 2JXBA 1WIEA 3EGUA 3ULRB 3PE0A 3QWXX 4OMPA 5ECAA 2JTEA 2D8JA 3VS3A 3EG1A 1A0NB 2KROA 1ZUKA 2GTJA 1ZUYA 2X3XD 2CT3A 3EG3A 1AZGB 3EG0A 4LNPA 2DYBA 1NG2A 4AFZC 1UDLA 2YUOA 2EGAA 1WYXA 2B86A 3VS5A 1W1FA 1UJYA 1AWXA 2FG0A 1NYFA 3JV3A 2SEMA 1BBZA 1AOJA 2W10A 1ZBJA 4OMQA 3H0IA 1WFWA 2KT8A 2DL8A 3I5SA 1UTIA 2AKLA 2RPNA 1M8MA 4LN2A 1QLYA 4GBQA 4KRTA 5EC7A 1UGVA 3RNJA 1PHTA 2K2MA 3U23A 1RLPC 2DJQA 4RTUA 2AZSA 1SHFA 2FRYA 2ED1A 4R0KA 1SPKA 2F2VA 3NHNA 2KYBA 2KXDA 3UA7A 4CC7A 2YT6A 4HXJA 4DEYA 4F16A 5IXBA 2DMOA 2KRNA 4RTYA 1AWJA 1CKAA 1GL5A 1NLOC 2K6DA 2DBKA 1GFDA 3UA6A 1RLQC 1KJWA 2HDAA 2BTTA 1ZLMA 2DILA 5HCKA 3M0TA 2J6OA 1U5SA 4JJBA 1KSWA 2FPFA 5FW9A 2OI3A 2O31A 1X69A 2KBTA 2ED0A 2M0YA 1MV3A 1UHFA 2DA9A 2GQIA 1XOVA 2M51A 2GTOA 4CC2A 1YP5A 1X2QA 4J9FA 3SEMA 1T0JA 1X27A 2LP5A 1TG0A 4J9DA 4JJCA 4OMOA 2ECZA 4IIMA 5IXFA 3VRZA 1HD3A 5IH2A 2FRWA 2KNBB 2EKHA 2ESWA 1QKWA 4OMNA 2PZ1A 2ABLA 2FPEA 3M0QA 2OJ2A 1AZEA 1E6HA 2LJ0A 2GGRA 3M0SA 1I07A 1PWTA 2JT4A 3IQLA 3H0FA 3GBQA 2RQUA 4J9BA 1K9AA 1VYUA 1IO6A 1TUDA 2AK5A 1HSQA 1U06A 1PRLC 1QCFA 2P4RA 4GLMA 1JXMA 2FPDA 1KIKA 1SSHA 1GBQA 2YSQA 1SHGA 4RTTA 1E7OA 1YWPA 2BZ8A 2HSPA 2NUZA 2KR3A 1MUZA 4IIOA 4X1VA 1JO8A 2LMJA 2LZ6B 4E6RA 3KFVA 2RMOA 2E5KA 4HVWA 5L23A 2YUPA 1X6BA 2K9GA 2NWMA 3TVTA 2F2WA 2CSIA 3UATA 4HCKA 4JPBW 1RI9A 2CSQA 2J7IA 1AWOA 1JXOA 3H0HA 3SHWA 2RQWA 2JMAA 3NMZC 1BB9A 2YUNA 1PNJA 3R6NA 1QKXA 4RTWA 1BK2A 1RUWA 2SRCA 3A98A 4K11A 1UE9A 2VKNA 3LH5A 4HVUA 1WXBA 2LJ1A 4QT7A 1HJDA 1OEBA 3EHQA 1X6GA 2AKKA 4LUEA 2DL3A 3M0PA 2X3WD 2DE0X 1CSKA 1YWOA 4AFUC 1H8KA 4DEXA 4J9CA 1SRMA 1UECA 5I22A 1QWEA 2D0NA 4AFSC 3REAB 2CDTA 4CC3A 1WX6A 1OOTA 2RQRA 2RN8A 2XMFA 4RTVA 2LNHB 2W0ZA 2DVJA 1VYVA 5GJVB 1BU1A 2L2PA 3TSWA 2DF6A 1W6XA 2CREA 1Y0MA 2C0TA 2KYMA 4F17A 1EFNA 3I5RA 1GRIA 1M30A 1NLPC 2GBQA 2FEIA 2YDLA 4RTXA 2EPDA 3H41A 2L3QA 4LE9A 4EIKA 2DL7A 2C0IA 1CKBA 1K4US 1AD5A 4JZ3A 2J6KA 2DM1A 3ZL7C 3I35A 2KE9A 1S1NA 3NPFA 1FMKA 4AG1C 1M3AA 1OPLA 2K7AA 2C0OA 1UHCA 1K76A 2CH4A 1AWWA 4J9IA 2ENMA 2VVKA 2KT1A 4LUDA 3VS0A 2HEQA 2KRMA 2H8HA 4Y92A 2CUDA 2D1XA 4RUGA 4AG2C 1K1ZA 1I1JA 2FO0A 2MOXA 1ABQA 4FSSA 2GNCA 2O9SA 1AEYA 3THKA 4D8DA 1E6GA 1QWFA 4Z89A 3VS1A 3PVQA 1H92A 1J3TA 4A63B 1GCQC 1PRMC 3QWYA 1Z9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGT A;  1SRL A;  3EHR A;  2L3P A;  2MCN A;  2DX1 A;  2CH4 W;  1JU5 C;  3VS2 A;  5IHK A;  1GBR A;  3PVL A;  3UF4 A;  1PKS A;  4JJD A;  2O88 A;  5FWB A;  1M27 C;  1NM7 A;  1VYT A;  1UJ0 A;  4CC4 B;  2EBP A;  2RQV A;  2CT4 A;  2EVR A;  1NEG A;  2OAW A;  2CUB A;  5FWC A;  1ZX6 A;  2KEA A;  1JEG A;  1T0H A;  3M0R A;  2EYZ A;  2JM8 A;  3VS7 A;  2BZY A;  2DL4 A;  3VS4 A;  1M3C A;  2G6F X;  1UUE A;  2V1R A;  2LCS A;  2RQT A;  1GCP A;  3NGP A;  1ARK A;  4OML A;  1G2B A;  1YNZ A;  1AVZ C;  1X2K A;  1Y57 A;  1VA7 A;  2A28 A;  2MIO A;  1KFZ A;  1K0S A;  1U3O A;  1WXT A;  4J9E A;  4J9H A;  1ZSG A;  1GCQ A;  1OV3 A;  3FJ5 A;  1H3H A;  1WI7 A;  1V1C A;  1X43 A;  4Z88 A;  2DRM A;  2F2X A;  2HBW A;  2EGE A;  4OMM A;  2L0A A;  1B3Q A;  1UFF A;  2PTK A;  1PKT A;  2O2O A;  1G83 A;  1SEM A;  2J6F A;  2HCK A;  2AZV A;  2DNU A;  2JW4 A;  4M4Z A;  5GJW B;  4JZ4 A;  2L3S A;  3EG2 A;  3TSZ A;  2KRS A;  2DLP A;  1NEB A;  1WDX A;  2DBM A;  2KXC A;  1GFC A;  1WLP B;  1B07 A;  2O9V A;  4ZNX A;  2VWF A;  2QDL A;  2PNI A;  1TUC A;  4ORZ A;  2LX7 A;  1MV0 B;  4J9G A;  1I0C A;  2I0N A;  2K3B A;  3REB B;  1JQQ A;  1WA7 A;  2RF0 A;  1T3L A;  1N5Z A;  3CQT A;  5I11 A;  4Z8A A;  1W70 A;  2LJ3 A;  2EGC A;  2JM9 A;  2IIM A;  3M0U A;  4WCI A;  3VRY A;  1UG1 A;  2D8H A;  2JS2 A;  2ROT A;  3I9Q A;  2A36 A;  2LQW A;  1YN8 A;  1YCS B;  2DL5 A;  2K79 A;  1OPK A;  3C0C A;  2A37 A;  1WXU A;  2RNA A;  2LQN A;  2EYW A;  4AFQ C;  2V1Q A;  2J05 A;  1LCK A;  1FYN A;  2ROL A;  4RTZ A;  1M3B A;  2JS0 A;  1ZUU A;  4ESR A;  2EW3 A;  5IHN A;  2YUQ A;  1K0X A;  2EQI A;  2EYX A;  4D8K A;  1NYG A;  2BZX A;  3VS6 A;  1ABO A;  3O5Z A;  1Z9Z A;  4HVV A;  5IHI A;  2J06 A;  2DRK A;  3RBB B;  1T3S A;  4F14 A;  2JMC A;  2A08 A;  2EYY A;  2JXB A;  1WIE A;  3EGU A;  3ULR B;  3PE0 A;  3QWX X;  4OMP A;  5ECA A;  2JTE A;  2D8J A;  3VS3 A;  3EG1 A;  1A0N B;  2KRO A;  1ZUK A;  2GTJ A;  1ZUY A;  2X3X D;  2CT3 A;  3EG3 A;  1AZG B;  3EG0 A;  4LNP A;  2DYB A;  1NG2 A;  4AFZ C;  1UDL A;  2YUO A;  2EGA A;  1WYX A;  2B86 A;  3VS5 A;  1W1F A;  1UJY A;  1AWX A;  2FG0 A;  1NYF A;  3JV3 A;  2SEM A;  1BBZ A;  1AOJ A;  2W10 A;  1ZBJ A;  4OMQ A;  3H0I A;  1WFW A;  2KT8 A;  2DL8 A;  3I5S A;  1UTI A;  2AKL A;  2RPN A;  1M8M A;  4LN2 A;  1QLY A;  4GBQ A;  4KRT A;  5EC7 A;  1UGV A;  3RNJ A;  1PHT A;  2K2M A;  3U23 A;  1RLP C;  2DJQ A;  4RTU A;  2AZS A;  1SHF A;  2FRY A;  2ED1 A;  4R0K A;  1SPK A;  2F2V A;  3NHN A;  2KYB A;  2KXD A;  3UA7 A;  4CC7 A;  2YT6 A;  4HXJ A;  4DEY A;  4F16 A;  5IXB A;  2DMO A;  2KRN A;  4RTY A;  1AWJ A;  1CKA A;  1GL5 A;  1NLO C;  2K6D A;  2DBK A;  1GFD A;  3UA6 A;  1RLQ C;  1KJW A;  2HDA A;  2BTT A;  1ZLM A;  2DIL A;  5HCK A;  3M0T A;  2J6O A;  1U5S A;  4JJB A;  1KSW A;  2FPF A;  5FW9 A;  2OI3 A;  2O31 A;  1X69 A;  2KBT A;  2ED0 A;  2M0Y A;  1MV3 A;  1UHF A;  2DA9 A;  2GQI A;  1XOV A;  2M51 A;  2GTO A;  4CC2 A;  1YP5 A;  1X2Q A;  4J9F A;  3SEM A;  1T0J A;  1X27 A;  2LP5 A;  1TG0 A;  4J9D A;  4JJC A;  4OMO A;  2ECZ A;  4IIM A;  5IXF A;  3VRZ A;  1HD3 A;  5IH2 A;  2FRW A;  2KNB B;  2EKH A;  2ESW A;  1QKW A;  4OMN A;  2PZ1 A;  2ABL A;  2FPE A;  3M0Q A;  2OJ2 A;  1AZE A;  1E6H A;  2LJ0 A;  2GGR A;  3M0S A;  1I07 A;  1PWT A;  2JT4 A;  3IQL A;  3H0F A;  3GBQ A;  2RQU A;  4J9B A;  1K9A A;  1VYU A;  1IO6 A;  1TUD A;  2AK5 A;  1HSQ A;  1U06 A;  1PRL C;  1QCF A;  2P4R A;  4GLM A;  1JXM A;  2FPD A;  1KIK A;  1SSH A;  1GBQ A;  2YSQ A;  1SHG A;  4RTT A;  1E7O A;  1YWP A;  2BZ8 A;  2HSP A;  2NUZ A;  2KR3 A;  1MUZ A;  4IIO A;  4X1V A;  1JO8 A;  2LMJ A;  2LZ6 B;  4E6R A;  3KFV A;  2RMO A;  2E5K A;  4HVW A;  5L23 A;  2YUP A;  1X6B A;  2K9G A;  2NWM A;  3TVT A;  2F2W A;  2CSI A;  3UAT A;  4HCK A;  4JPB W;  1RI9 A;  2CSQ A;  2J7I A;  1AWO A;  1JXO A;  3H0H A;  3SHW A;  2RQW A;  2JMA A;  3NMZ C;  1BB9 A;  2YUN A;  1PNJ A;  3R6N A;  1QKX A;  4RTW A;  1BK2 A;  1RUW A;  2SRC A;  3A98 A;  4K11 A;  1UE9 A;  2VKN A;  3LH5 A;  4HVU A;  1WXB A;  2LJ1 A;  4QT7 A;  1HJD A;  1OEB A;  3EHQ A;  1X6G A;  2AKK A;  4LUE A;  2DL3 A;  3M0P A;  2X3W D;  2DE0 X;  1CSK A;  1YWO A;  4AFU C;  1H8K A;  4DEX A;  4J9C A;  1SRM A;  1UEC A;  5I22 A;  1QWE A;  2D0N A;  4AFS C;  3REA B;  2CDT A;  4CC3 A;  1WX6 A;  1OOT A;  2RQR A;  2RN8 A;  2XMF A;  4RTV A;  2LNH B;  2W0Z A;  2DVJ A;  1VYV A;  5GJV B;  1BU1 A;  2L2P A;  3TSW A;  2DF6 A;  1W6X A;  2CRE A;  1Y0M A;  2C0T A;  2KYM A;  4F17 A;  1EFN A;  3I5R A;  1GRI A;  1M30 A;  1NLP C;  2GBQ A;  2FEI A;  2YDL A;  4RTX A;  2EPD A;  3H41 A;  2L3Q A;  4LE9 A;  4EIK A;  2DL7 A;  2C0I A;  1CKB A;  1K4U S;  1AD5 A;  4JZ3 A;  2J6K A;  2DM1 A;  3ZL7 C;  3I35 A;  2KE9 A;  1S1N A;  3NPF A;  1FMK A;  4AG1 C;  1M3A A;  1OPL A;  2K7A A;  2C0O A;  1UHC A;  1K76 A;  2CH4 A;  1AWW A;  4J9I A;  2ENM A;  2VVK A;  2KT1 A;  4LUD A;  3VS0 A;  2HEQ A;  2KRM A;  2H8H A;  4Y92 A;  2CUD A;  2D1X A;  4RUG A;  4AG2 C;  1K1Z A;  1I1J A;  2FO0 A;  2MOX A;  1ABQ A;  4FSS A;  2GNC A;  2O9S A;  1AEY A;  3THK A;  4D8D A;  1E6G A;  1QWF A;  4Z89 A;  3VS1 A;  3PVQ A;  1H92 A;  1J3T A;  4A63 B;  1GCQ C;  1PRM C;  3QWY A;  1Z9Q A; 
#chains in the Genus database with same CATH topology
 2QQB A;  3EHR A;  2CH4 W;  3VS2 A;  5IHK A;  3ZEH A;  4JJD A;  1K73 U;  1JJ2 P;  1M27 C;  4JRQ A;  1UJ0 A;  2RQV A;  4J6Y A;  4PFP A;  1LOJ A;  2EVR A;  2DTH A;  1WJS A;  5FWC A;  2KEA A;  1T0H A;  1U1T A;  2EYZ A;  5GAN h;  2QAZ A;  2FZG B;  1M3C A;  3X28 B;  5GAN 5;  5GAM f;  1GCP A;  2QAS A;  3JCM g;  3I55 A;  1W2B P;  1W2B A;  4FYV B;  2ZPE B;  3HPW A;  3RUX A;  1K0S A;  4LDU A;  4J9E A;  2C06 A;  2RI5 A;  4PJO E;  4M77 A;  2HQE A;  3CXC S;  1PSF A;  2XD0 A;  1OV3 A;  2A3L A;  2R5M A;  2K2V A;  1V1C A;  2VGM A;  4PNO A;  2F2X A;  2E64 A;  2F5T X;  2EGE A;  1PG5 B;  3CCQ T;  4WF2 A;  4O6J A;  1UEB A;  4DA4 A;  2PTK A;  4E2F B;  5GAN g;  3FEO A;  1SEM A;  5IN1 A;  5HK3 A;  1IGU A;  4FL6 A;  2JW4 A;  1YI2 A;  4M4Z A;  5GJW B;  3RIR A;  3QSU A;  3EG2 A;  1JB0 E;  2CP0 A;  2CGH A;  2KRS A;  3L2Q A;  4BE2 A;  2BE9 B;  4ME7 A;  1QQJ A;  1YIJ Q;  3VU3 C;  2YHT A;  2RJC A;  4ZNX A;  2VWF A;  3CCL T;  5A0L A;  4ORZ A;  1MV0 B;  4J9G A;  2GFA A;  4E7L A;  2I0N A;  1RI0 A;  2M0O A;  3OYK A;  2LRQ A;  1WHM A;  3CQT A;  2LJ3 A;  2O4X A;  1K9M C;  2D0Q B;  3JB9 F;  1YFN A;  3MHX A;  1UG1 A;  2X4W A;  4C0D B;  2D8H A;  3I9Q A;  3CMA A;  3FDR A;  5KYN A;  3LYI A;  3CCS T;  2BUD A;  4EMK B;  3C0C A;  2A37 A;  1WXU A;  3CC2 T;  5DM7 R;  2QA4 T;  4FU6 A;  1YJN T;  3CCJ T;  4AFQ C;  2V1Q A;  3HKS A;  2QTV A;  2GF7 A;  4HT8 A;  4KGX B;  2ROL A;  1NPP A;  5C6S A;  5IHN A;  1RAD B;  2M1H A;  4D6W A;  3UT1 A;  4D8K A;  1NYG A;  3NTK A;  5L8R E;  1ABO A;  1Z9Z A;  3H8Z A;  5IHI A;  3E9F A;  1T3S A;  1M90 R;  2A08 A;  3M53 A;  3R6O A;  1Q86 C;  4PJO D;  4M77 G;  3OYL A;  1ZUK A;  5GMK l;  5CR2 A;  3EG0 A;  3G6E Q;  3CC4 Q;  2DYB A;  2FHD A;  4AFZ C;  1G3S A;  2EGA A;  1TTH B;  2QEX A;  1WYX A;  1K8A C;  2V8K A;  2B86 A;  3VS5 A;  1BI3 A;  1UJY A;  4EPC A;  2RK1 A;  2SEM A;  3I56 A;  2BIV A;  3GPL A;  3EAE A;  4FYY B;  1ZBJ A;  2PVO B;  3H0I A;  1C6V X;  3X20 B;  3TEE A;  1D0Y A;  3E2U A;  1WHJ A;  2H3J A;  1PHT A;  3ME9 A;  4KT0 E;  4RTU A;  3OYE A;  3INZ A;  2XG8 D;  2HAX A;  2FRY A;  4C0D C;  5LJ3 f;  5LJ5 h;  1YCY A;  2F2V A;  3MP6 A;  4RMO A;  2RA2 A;  4C8Q C;  1D0Z A;  3PIO A;  3JCM h;  2KXD A;  2YT6 A;  4YTL A;  4DEY A;  4A4E A;  5C0M A;  2KRN A;  4E7I A;  1CKA A;  3BW1 A;  1ZHI A;  3UA6 A;  4PJO G;  2HDA A;  2DIL A;  2J6O A;  3CC7 Q;  4M7A G;  2OI3 A;  4PJJ A;  1X69 A;  2KBT A;  4BE0 A;  2ED0 A;  1X6O A;  2GQI A;  1G3W A;  3MET A;  1I5O B;  2M51 A;  5KE3 A;  1HYO A;  3M56 A;  4DBR A;  2A7Y A;  3V7R A;  2L3R A;  1VIE A;  1T0J A;  2LP5 A;  2D6F A;  4JJC A;  3M58 A;  1H64 1;  5IXF A;  3VRZ A;  2CP3 A;  3OSV A;  4MDW A;  4HCZ A;  2DIG A;  4IUU A;  4OMN A;  2QEX Q;  2ABL A;  2FPE A;  3FB9 A;  4KGZ B;  1E6H A;  4C92 D;  5J26 A;  5DY9 A;  3M0S A;  1QCO A;  4RG8 A;  2JT4 A;  4WTO B;  2FVU A;  2RQU A;  3M4G A;  2K5I A;  3I55 Q;  1R0B G;  2XU8 A;  4QQG A;  5I2S A;  4GLM A;  2YLB A;  2DER A;  1BIB A;  2DK3 A;  1SSF A;  3HL8 A;  1SHG A;  4RTT A;  3SWN C;  1YWP A;  2BZ8 A;  2HSP A;  2NUZ A;  4QKU A;  4X1V A;  1KG1 A;  4LD6 A;  5KYX B;  2OTL Q;  2LZ6 B;  1VQ8 A;  3KFV A;  2P4T A;  4BY6 B;  1D1C A;  1K73 C;  2NWM A;  4MZM A;  1VOM A;  2F69 A;  3E1S A;  3UAT A;  1XTD A;  4JPB W;  4C0F A;  3JCM f;  4E47 A;  2CSQ A;  2J7I A;  3PT9 A;  3UWN A;  9ATC B;  2V8J A;  5GAN 8;  5EG2 A;  1QKX A;  4GLK A;  1BK2 A;  2DKG A;  1RUW A;  1M9S A;  1Y07 A;  3HSB A;  1TSF A;  1VUB A;  1GXI E;  1IB8 A;  4J6X A;  2VKN A;  3LH5 A;  4E7S A;  3EHQ A;  2HKQ B;  2O01 E;  2VB6 A;  2VXE A;  2DE0 X;  1VQ9 T;  1CSK A;  2CP6 A;  4M7D E;  5GAO r;  2HZY A;  1SRM A;  1U8R A;  1QWE A;  3A5Z B;  3REA B;  2CDT A;  1ZSZ A;  5KYW A;  1WX6 A;  1OOT A;  2PUK B;  1BI1 A;  2F1L A;  2QI2 A;  3KXT A;  4RTV A;  3CCU T;  1BU1 A;  4L59 A;  3CD6 A;  3DLL A;  4M75 F;  2QTX A;  4C0Z A;  1Y0M A;  2HQH A;  1QVF S;  3QJY A;  1KC8 R;  1GRI A;  1R77 A;  1M30 A;  1NLP C;  3SFM A;  2YDL A;  1UGR B;  1EX4 A;  2XIC A;  4LE9 A;  1K4U S;  2K5L A;  3QYG B;  6AT1 B;  4M78 B;  3NPF A;  1FMK A;  3JRZ A;  2DJZ A;  1M3A A;  1OPL A;  1FX7 A;  2C0O A;  1AWW A;  2DPP B;  1Q86 U;  4LUD A;  1N6A A;  2DZ9 A;  2FYK A;  4RUG A;  3X25 B;  1I1J A;  2FO0 A;  2VAS A;  3F70 A;  3A1P A;  4OB0 B;  1MMN A;  1YJN Q;  1N9R A;  5KE2 A;  3T9N A;  1YIT Q;  2JN0 A;  3THK A;  1R0C B;  4D8D A;  4KGV B;  5HK0 A;  1E6G A;  4EMK C;  1PCX A;  1OX9 A;  2X9H A;  1J3T A;  1PRM C;  3M57 A;  1Z9Q A;  4PLL A;  1SRL A;  3OYH A;  2HKN A;  5CK9 A;  1Q81 R;  2L3P A;  3OYY A;  1BKB A;  3SWN A;  3G71 T;  4C92 E;  5LJ5 g;  1GBR A;  3PVL A;  1NPR A;  4GY5 A;  5FWB A;  1NM7 A;  2H3E B;  2EBP A;  3GP8 A;  3P8B B;  4E7K A;  4IUP A;  3M55 A;  1NEG A;  5DLO A;  2HL3 A;  3M0R A;  3VS7 A;  4E7J A;  2BZY A;  5A2Q E;  1KQS A;  2XDB A;  2RI2 A;  2IG0 A;  2G6F X;  2V1R A;  2X51 A;  1D3B A;  2LCS A;  1WHG A;  2RQT A;  3NGP A;  1AT1 B;  3CCS Q;  4F7U F;  1G2B A;  4PJO C;  1YNZ A;  1X2K A;  2A28 A;  1Y57 A;  2OTJ A;  5AT1 B;  4HA8 A;  1WXT A;  3BE3 A;  2RHX A;  1DJ7 B;  2QA4 A;  2QDY B;  3MEW A;  2G3R A;  5KYU B;  4MML A;  2LX9 A;  2KAF A;  1RAA B;  2X4Y A;  4PL6 A;  3C12 A;  2MMP A;  2RJF A;  4NL3 A;  1YHQ A;  1UFF A;  1PKT A;  3RKX A;  4M75 A;  1NBE B;  2QK0 A;  4Y28 E;  1SF9 A;  4M75 C;  2AZV A;  5D6Y A;  2K4Y A;  1WHK A;  2DXC A;  4PJM A;  2XDD A;  3ZBD A;  4J83 A;  1ZBX A;  1YJ9 A;  3NTI A;  2P84 A;  2RH2 A;  3C94 A;  4N4I A;  3EH2 A;  2E6Z A;  2GFU A;  2DLP A;  3RMS A;  3PTA A;  2D9T A;  1WLP B;  2R5A A;  1B07 A;  1TS9 A;  5CO7 A;  2NUP A;  3UPU A;  2KK4 A;  1XQH A;  2QDL A;  1VQ6 Q;  2QGF B;  2DET A;  2QG9 B;  3JB9 I;  4M77 E;  1VQK Q;  1TOV A;  2LVM A;  3OBW A;  3L1A A;  1PM3 A;  2K3B A;  4KH1 B;  2KMT A;  5GAO q;  1WA7 A;  1AHJ B;  2RF0 A;  1B34 A;  1N5Z A;  5I11 A;  3HRU A;  4PFO A;  1WHH A;  1WNL A;  4WCI A;  3VRY A;  3BDL A;  2MI6 A;  2CKK A;  3OYF A;  2EQJ A;  2JOY A;  2ROT A;  2X4J A;  3LGF A;  5GMK e;  3HTR A;  2A36 A;  1N8R U;  4DOW A;  1NJI R;  2DL5 A;  4M77 F;  1D09 B;  4ELZ C;  2JUF A;  2LDM A;  3TRE A;  3OB9 A;  5KCO A;  4F04 B;  1M2O A;  1F1B B;  3I55 T;  1LCK A;  1FYN A;  2QQR A;  2EAY A;  4RKU E;  4RTZ A;  2FB7 A;  2BE7 D;  4OGE A;  1ZUU A;  1MMG A;  2QEX T;  1G3Y A;  1M1G A;  5D6X A;  2PUO B;  2MWP A;  3CME Q;  2QYZ A;  3OQ5 A;  1QP3 A;  3OS5 A;  2NUT A;  2DRK A;  1RAF B;  1N8R C;  3RBB B;  2JMC A;  1Q7Y U;  1VQ5 A;  1WIE A;  3ULR B;  1WZO A;  3PE0 A;  5ECA A;  4R56 A;  3OMG A;  3VS3 A;  2HBP A;  2WAC A;  4XU3 A;  3CCV T;  1A0N B;  2KRO A;  2GTJ A;  2EKO A;  2X3X D;  2CT3 A;  4C8Q A;  3GF5 A;  3MEV A;  1WQ7 A;  1YJW Q;  4LNP A;  5A0D A;  3O8V A;  4N4G A;  1Q86 R;  1UDL A;  5CKH A;  2R58 A;  3OS0 A;  2YRV A;  3OSS C;  4JDS A;  3LGL A;  4F7U B;  2MK5 A;  2QXF A;  1VQ7 A;  1AWX A;  4PLI A;  3AHU A;  4PJO B;  4NL2 A;  3JV3 A;  1BBZ A;  2P0K A;  2KT8 A;  2DL8 A;  2HNI A;  1B7T A;  3I5S A;  2AKL A;  2MPX C;  4LN2 A;  4OB3 B;  3HHT B;  4GBQ A;  3J80 E;  3VJP A;  5EC7 A;  1UGV A;  2LTO A;  1R8O B;  3CCM Q;  2ED1 A;  2X35 A;  3L2V A;  1Q81 U;  3M9Q A;  3QZ5 B;  1SPK A;  3MKD A;  1Y7X A;  5LJ3 h;  5LJ5 f;  3JCM P;  3OW2 S;  2JNG A;  4C5G A;  1VQ9 Q;  1QVP A;  4F16 A;  4HCC A;  5IXB A;  2ZCF B;  2DMO A;  4RTY A;  1KHC A;  3OS2 A;  1OQK A;  1NLO C;  2K6D A;  5CCA A;  4Z02 A;  5CQX A;  1RLQ C;  1KJW A;  4DQ2 A;  3HRT A;  3MPU B;  1RAG B;  2FZK B;  5HCK A;  2P0P A;  4JRI A;  3UDC A;  1VQK T;  4JJB A;  4J7F A;  1KSW A;  3G4S T;  2FPF A;  4EMG A;  2DTO A;  2HSE B;  4X9C A;  1VQN A;  1D1B A;  4C92 B;  3MP1 A;  1UHF A;  4PJN A;  2VGN A;  2OTL A;  1QVF A;  2DYI A;  4CC2 A;  1VQO Q;  1YP5 A;  2NUT B;  4BI4 A;  1VQM T;  3KUF A;  4J9F A;  3CPW A;  2YWW A;  2DD5 A;  4XTU A;  3OYC A;  1HD3 A;  2FRW A;  2EYQ A;  2EKH A;  1QKW A;  1KHI A;  3CCV Q;  1OZ2 A;  3M0Q A;  4FT2 A;  1AZE A;  3OBY A;  5GAM d;  2RHZ A;  1WGS A;  1I07 A;  1VQP T;  3H0F A;  3CCE Q;  1K9A A;  1VYU A;  1RL2 A;  1TUD A;  3LWH A;  1HSQ A;  2JTM A;  1U06 A;  5GAM j;  1FXX A;  4QW2 A;  1KIK A;  3CCR Q;  2YSQ A;  4BI3 A;  5GAN 6;  5CKE A;  2KR3 A;  2ZZD A;  4JLI A;  1JO8 A;  3SDZ A;  1QVG P;  1QVG A;  5L23 A;  1X6B A;  3CCJ Q;  2K9G A;  2JZ2 A;  3MP8 A;  2LNV A;  2KY9 A;  5GAO n;  3EH1 A;  3CMA T;  1IGQ A;  5GAN f;  2LQ8 A;  2RQW A;  4ZGD B;  3RER A;  1ZQ1 A;  3R6N A;  2ZPF B;  4RCC A;  2R57 A;  3CCM T;  4K11 A;  3OYJ A;  3PGG A;  4A4G A;  2RHU A;  3OYG A;  1Y96 B;  2EQU A;  2LJ1 A;  3CBM A;  2ZPB B;  2E12 A;  3C4S A;  4LUE A;  3M0P A;  2Y4X A;  1KQS P;  1YIT T;  1M1F A;  1WHL A;  1H8K A;  3ZFJ A;  1OU8 A;  4PFZ A;  4J9C A;  4L5G A;  5I22 A;  1JJ2 S;  4CC3 A;  5GAN e;  4HCB A;  2RN8 A;  2XMF A;  3WVE B;  5HKC A;  4V2S A;  2ZAE A;  1P92 A;  3OYM A;  1VYV A;  3QG1 A;  5D6W A;  4C0G A;  1W6X A;  2CRE A;  2KQW A;  2KYM A;  3OA6 A;  4F17 A;  4C5E A;  3I5R A;  3LW5 E;  2GBQ A;  3QYH B;  4EMK A;  2MAM A;  4M78 G;  2COZ A;  2DL7 A;  2C0I A;  4M7D B;  2EJG A;  4JZ3 A;  3FRN A;  3EFO B;  2ZPH B;  1S1N A;  3AT1 B;  4QVZ A;  2QA4 Q;  2K7A A;  1Q82 R;  3G71 A;  3M4Y A;  3JAM E;  4M78 A;  2PQW A;  2KT1 A;  3VS0 A;  2HEQ A;  2KRM A;  5KYY A;  1N9S A;  2H8H A;  2WSF E;  1JBM A;  1NZ9 A;  4AG2 C;  4IUV A;  1NJI C;  4ANJ A;  2MOX A;  3JB9 H;  4CI0 C;  2E10 A;  3QII A;  5KYX A;  1OYX A;  4ZN1 A;  2GNC A;  3MCA B;  2E4H A;  4FYW B;  4Z89 A;  3LLR A;  3VS1 A;  2QQS A;  4M77 C;  4DOV A;  2JJ9 A;  3RDV A;  2OX7 A;  1S72 T;  3D7S B;  4XU0 A;  3CXC A;  1O9S A;  2MCN A;  1M4Z A;  2VV5 A;  2M02 A;  2XDP A;  3UF4 A;  4M7A A;  2XKO C;  3OMC A;  4IUR A;  1VYT A;  2X4X A;  3Q1J A;  4CC4 B;  5I2M A;  3CCQ Q;  2LCC A;  3M5A A;  4NS5 A;  2E41 A;  7AT1 B;  4FIB A;  4TVR A;  4FW1 A;  2CUB A;  1ZSZ C;  4M78 E;  1H3Z A;  3VS4 A;  2LCL A;  3GLX A;  1UUE A;  2DZC A;  4KUL A;  1TU0 B;  5LJ3 d;  1M5Q 1;  1QW1 A;  2OTL T;  4FW2 A;  3BY7 A;  4OML A;  1RAE B;  4L6V 5;  4X34 A;  1M1K C;  1K8A R;  3CCU A;  2VYT A;  2O4X B;  1RAB B;  2MIO A;  4LD9 K;  2CZ7 B;  4OB1 B;  4AMC A;  3QHS A;  4J9H A;  1ZSG A;  2LC4 A;  3VYG A;  2Z0W A;  4ZTF A;  4BAC A;  1WI7 A;  3MEA A;  4Z88 A;  2AT1 B;  3CC7 A;  3CCV A;  2HBW A;  4LXC A;  3EGD B;  4XTV A;  1B3Q A;  2HD0 A;  1G83 A;  2RJE A;  1I4K 1;  3VUZ A;  2HMA A;  2HCK A;  2RO0 A;  2XID A;  1N27 A;  1VIF A;  1D0X A;  4JZ4 A;  4PJL A;  4C92 C;  4UC4 A;  1MMA A;  3FIF A;  3V7S A;  3URG A;  2O9V A;  1VQ6 T;  4BD3 A;  2A0F B;  1VQ8 T;  5A0G A;  4XAX B;  3JB9 D;  1YIJ T;  1TUC A;  1VQ6 A;  2LX7 A;  5GAO m;  2ATC B;  1I0C A;  3CPF A;  5J3B A;  1PSE A;  5FU6 C;  4C92 F;  1IHV A;  1QP2 A;  1JQQ A;  4VUB A;  1T3L A;  4Z8A A;  1PD0 A;  1S72 A;  2EGC A;  3FLG A;  2JM9 A;  3GNG A;  2L8D A;  2IIM A;  5HY6 A;  4X9D A;  3BFM A;  4MMK A;  4HT9 A;  1TXQ A;  3TQ7 P;  1ZA2 B;  1U1S A;  2EIF A;  4M77 B;  3JCM Q;  2PVG B;  1YCS B;  4XU1 A;  3A8G B;  2RNA A;  2BKD N;  4NOY A;  4F7U E;  3JCM d;  3JB9 J;  3EGD A;  4C92 A;  4XQ3 A;  2PVD B;  1LJO A;  3JCM X;  1NE8 A;  1D3B B;  4IKF A;  1M3B A;  4ATO A;  2JS0 A;  1C1A A;  3G4S A;  2EW3 A;  4F7U G;  1K0X A;  1Y96 A;  1VQO T;  2BZX A;  3O5Z A;  1OU9 A;  4HVV A;  1TWB A;  1MNE A;  3OYI A;  2EJ9 A;  3P8D A;  4M75 G;  4C8Q E;  1S72 Q;  2JXB A;  1X75 C;  3QWX X;  4OMP A;  1LVK A;  2DIQ A;  2JTE A;  2D8J A;  1MGQ A;  3QUI A;  1XJW B;  5CAI A;  5KCH A;  3SB2 A;  3P8H A;  3OY9 A;  1ZUY A;  3G4S Q;  3EG3 A;  3HFO A;  4C5I A;  3H6Z A;  5CKB A;  2RI3 A;  1QMC A;  1Q7Y R;  1NG2 A;  1KK7 A;  3DLM A;  5GMK m;  3OW2 A;  1KD1 R;  2MWO A;  2KI7 A;  3ASK A;  2MYS A;  1UGP B;  1VQM Q;  5FRN A;  1VQP Q;  1VQL Q;  4JRP A;  1NYF A;  2DO3 A;  2MF2 A;  3L2Z A;  1V29 B;  2P0Q A;  1RAI B;  2W10 A;  4OMQ A;  1B34 B;  3JSC A;  1RAH B;  4DBQ A;  2E3I A;  2RPN A;  4XTX A;  1LPL A;  1QLY A;  5GAN 3;  1WPY A;  2GCX A;  4BDZ A;  2DJQ A;  1Q82 U;  2RK2 A;  3CCM A;  2AZS A;  4MZT A;  1BCM A;  1SHF A;  5IT9 E;  4R0K A;  3QJ6 A;  1KC8 C;  3FJP A;  3L42 A;  4HKE A;  1WJR A;  5GMK h;  3JB9 G;  3CCR T;  2YLC A;  3CCL A;  3H9N A;  1GFD A;  3SD4 A;  1O75 A;  2BTT A;  4MDX A;  1VQM A;  3QDR B;  4M75 B;  1U5S A;  3V8L A;  4FM4 B;  3GNF B;  5FW9 A;  5KH6 A;  2XK0 A;  3OYD A;  1MV3 A;  2DA9 A;  3MO8 A;  3CCU Q;  1KQ1 A;  2GTO A;  5GAN 7;  1PD1 A;  3PMT A;  1UGQ B;  3SEM A;  3G6E A;  3CCQ A;  1VQ4 A;  2DXB A;  3A8O B;  2NUP B;  2ECZ A;  4IIM A;  5CVI A;  1VQP A;  4M75 E;  3S3M A;  2PZ1 A;  2OJ2 A;  1Q95 G;  4J8O A;  2DTI A;  1X01 A;  1Q81 C;  1OX8 A;  3MJX A;  2V8I A;  4J9B A;  3EG9 A;  4EDU A;  5IAY A;  1ACM B;  2ZPG B;  2COY A;  1IO6 A;  4Q5W A;  1MHN A;  1HXD A;  1TUG B;  2RB6 A;  4ZN3 A;  4BB7 A;  1JXM A;  3CC7 T;  2FPD A;  3CCE T;  1GBQ A;  1M2V B;  3EFS A;  4O5V A;  4Y91 A;  4A53 A;  2NLU A;  4JS5 A;  2RMO A;  2E5K A;  4HVW A;  3L2W A;  1VQ9 A;  3L2U A;  3TVT A;  2F2W A;  1UGS B;  4HCK A;  1RI9 A;  4LDY A;  1AWO A;  1JXO A;  3H0H A;  5CKD A;  1IHW A;  3SHW A;  2OAU A;  2JMA A;  1I5L A;  1BB9 A;  3A98 A;  4KUD K;  3OYN A;  1UE9 A;  4RG2 A;  2B8A A;  1EZZ B;  3VYH B;  1WXB A;  4QT7 A;  1HJD A;  4XTY A;  1OEB A;  3G6E T;  2OTJ T;  2DL3 A;  1YWO A;  3G7Z A;  1WJQ A;  2ZGW A;  1YI2 T;  1UEC A;  4E7H A;  2D0N A;  2EQM A;  4AFS C;  1BYM A;  3GIB A;  2W0Z A;  3S3N A;  2DVJ A;  3A8H B;  1YHQ Q;  3CCL Q;  1G3T A;  3TSW A;  2L2P A;  3OYB A;  3PMI A;  1EFN A;  3JCM W;  4C8Q G;  3CCR A;  3H41 A;  2IPO B;  2YRD A;  5GAM h;  2JVV A;  1CKB A;  3LX7 A;  4XU2 A;  4JJN K;  3CPW S;  1AD5 A;  2J6K A;  2DM1 A;  2CS7 A;  3I35 A;  5LJ3 e;  1TH7 A;  1XNI A;  1K76 A;  3E19 A;  4A4H A;  4A54 A;  5KYU A;  4A4K A;  2CUD A;  1VQL A;  1FMV A;  1K1Z A;  4QQD A;  3J81 E;  1FWZ A;  3G1J A;  3CC4 T;  4N0A C;  1YJ9 T;  1BCO A;  4JS4 A;  3CPW P;  1AEY A;  4C5H A;  1QWF A;  1H92 A;  3PVQ A;  3CC2 A;  3L2R A;  1GCQ C;  4FSX A;  3QWY A;  2KGT A;  5CKF A;  2HQX A;  1QCN A;  4M75 D;  5CIU A;  2DX1 A;  1KD1 U;  5LL6 S;  1JU5 C;  3PFS A;  1N8R R;  4LDW A;  4F7U A;  1PKS A;  2CP2 A;  2O88 A;  4M7A D;  1G5V A;  4OGC A;  3NFC A;  1ZSZ B;  4PJO F;  5KYW B;  4R55 A;  2CT4 A;  1OZ3 A;  3HFN A;  1IZ6 A;  2Y90 A;  2OAW A;  3QBY A;  4BY6 C;  1ZX6 A;  1JEG A;  3WXM B;  2JM8 A;  2WSC E;  2DL4 A;  2E1H A;  4B6M A;  2FL7 A;  3N5B B;  1K73 R;  5GAN d;  3CCS A;  1ARK A;  3HP9 A;  1VQO A;  3OW2 P;  4LDX A;  1AVZ C;  5LJ3 g;  1VA7 A;  1KFZ A;  3X24 B;  2GQV A;  2LQK A;  1U3O A;  2XHC A;  2XI9 A;  5D7U A;  2DEU A;  1EIF A;  2NYS A;  1GCQ A;  4M7A C;  4JLG A;  2DFU A;  1VQ5 T;  3FJ5 A;  1H3H A;  1JRI A;  1YHQ T;  5GMK j;  1K8A U;  1X43 A;  2DRM A;  1MND A;  4M78 C;  4OMM A;  4XK8 E;  5GAN 4;  5M9O A;  4M7D C;  2L0A A;  3VV0 A;  4M7D A;  2Y4Y A;  2O2O A;  5GAN 2;  2J6F A;  3J7A F;  2DNU A;  4KBM B;  4OF1 A;  2COW A;  2L3S A;  4ZTJ A;  1Y71 A;  2CYZ B;  1HK9 A;  1Q82 C;  3TSZ A;  2M16 A;  1NEB A;  1WDX A;  2DBM A;  3QXE B;  2KXC A;  1GFC A;  2VC8 A;  3NTH A;  2RHY A;  3CBO A;  4C8Q B;  1VQ8 Q;  3JCM b;  1IRE B;  1YJW A;  2PNI A;  2AHJ B;  4M78 D;  5GAM e;  1K9M R;  1M1K U;  2CZ6 B;  3G71 Q;  4M7A F;  2HL5 C;  3REB B;  3RMQ A;  1YI2 Q;  2RM4 A;  2E6N A;  3CBP A;  2KSS A;  4J6W A;  3M54 A;  2CZ0 B;  3EG9 B;  1VQ5 Q;  1W70 A;  3HRS A;  3RR6 A;  3M0U A;  4FT4 A;  2JS2 A;  3OS1 A;  4XTW A;  3CME A;  5FU7 C;  2LQW A;  5KYY B;  1YN8 A;  1M8V A;  3A8L B;  1OUL A;  1VQ4 Q;  2K79 A;  1OPK A;  2YXY A;  2CP5 A;  1D1A A;  2K57 A;  2LQN A;  4M7A E;  2EYW A;  2J05 A;  4B9W A;  4BDY A;  2L89 A;  3EFR A;  4ESR A;  3E9G A;  2E65 A;  3CCE A;  2YUQ A;  2IVW A;  3VKI A;  4BE1 A;  1M90 C;  4RCB A;  3DKM A;  2EQI A;  1YIT A;  2EYX A;  2L5Q A;  5GAN j;  1YJN A;  3TCJ A;  3VS6 A;  3X26 B;  4II1 A;  3QPH A;  1ZA1 B;  2J06 A;  3EGX A;  1YJ9 Q;  4F14 A;  2EYY A;  3EGU A;  3TU4 K;  3I56 Q;  3EG1 A;  3CD6 T;  5GAM g;  1AZG B;  1JJ2 A;  4AT1 B;  1NJI U;  2DEQ A;  2F5K A;  3KBG A;  3CC4 A;  1WQW A;  1VQ7 T;  2YUO A;  5I21 A;  3QKJ A;  3VUB A;  1KQS S;  5GAO p;  2AIR B;  5GAO l;  1VQL T;  1W1F A;  1LNX A;  2FG0 A;  2QGG A;  2RD1 A;  2E5Q A;  4PK4 A;  2EJF A;  4C8Q F;  1SG5 A;  1PC0 A;  3QZ9 B;  4ZGJ B;  1AOJ A;  1Q7Y C;  4IUQ A;  4QVD A;  2CZ1 B;  1V76 A;  4DBF A;  1WFW A;  4J7I A;  1UTI A;  1M8M A;  3QDF A;  3QO3 A;  3CMA Q;  4KRT A;  3RES A;  4M7D G;  3RNJ A;  4MZP A;  2K2M A;  3U23 A;  1RLP C;  1BI2 A;  8ATC B;  4A4F A;  1YBY A;  4KH0 B;  1VQN Q;  3RKW A;  2DAQ A;  2QQA A;  1BI0 A;  4FYX B;  3NHN A;  2KYB A;  5GMK i;  2DD4 A;  5J39 A;  4OB2 B;  4J5Y A;  4CC7 A;  3UA7 A;  3V8J A;  4HXJ A;  5CQY A;  5FU6 B;  2DVE A;  1AWJ A;  1GL5 A;  1IXD A;  2DBK A;  4KUI A;  1FMW A;  2V26 A;  3M59 A;  3CEY A;  4B9X A;  1ZLM A;  3JCM c;  2VXF A;  3M0T A;  3GOX A;  4JUV A;  4N4H A;  2ZPI B;  2O31 A;  2M0Y A;  4C92 G;  1XOV A;  4P5N A;  8AT1 B;  4M7D F;  3JCM V;  1VQN T;  3CCJ A;  1X2Q A;  2RHI A;  2DXU A;  1X27 A;  5AYF A;  2E3H A;  4M7D D;  1TG0 A;  4J9D A;  4OMO A;  1UB4 A;  1W4S A;  3OYA A;  2KVQ G;  5IH2 A;  2KNB B;  2ESW A;  2LJ0 A;  2GGR A;  3DB3 A;  1PWT A;  4XTZ A;  3IQL A;  3GBQ A;  4IUT A;  4C8Q D;  4M7A B;  2AK5 A;  4CRI A;  1MMD A;  4BI8 B;  1BIA A;  2KDS A;  3C95 A;  1PRL C;  1QCF A;  2P4R A;  1I81 A;  2CP7 A;  1SSH A;  4DBH A;  4OP0 A;  1E7O A;  4PKC C;  3EFO A;  1RAC B;  4EMH A;  3ER0 A;  1MUZ A;  4IIO A;  1KD1 C;  2LMJ A;  3MEU A;  3RKY A;  4E6R A;  3CME T;  2YUP A;  1YIJ A;  3A8M B;  1OI1 A;  3LWI A;  2CSI A;  2EWN A;  1M1K R;  1K9M U;  4ZGE B;  3DB4 A;  2WSE E;  1QVF P;  3NMZ C;  5FU7 B;  2YUN A;  1PNJ A;  3PIP A;  3EGX B;  4RTW A;  2LT1 A;  2SRC A;  1YJW T;  3JCM J;  2LT4 A;  3CD6 Q;  3CC2 Q;  3S6W A;  4ELY C;  5FRM A;  3BDU A;  4HVU A;  1IRX A;  3I56 T;  5LJ3 j;  1X6G A;  2AKK A;  2EQK A;  3V7C A;  2X3W D;  2PU9 B;  4AFU C;  2DXT A;  1KC8 U;  4M78 F;  4DEX A;  2K3Y A;  4BUG A;  2RQR A;  2M9U A;  1VQK A;  1C0M A;  4JRK A;  3SWN B;  2LNH B;  5GJV B;  5LJ5 e;  2K5F A;  3LH0 A;  3WVD B;  4LDV A;  5DLQ E;  1I8F A;  2DF6 A;  3S3O A;  2C0T A;  4QQ6 A;  4PJO A;  4N0A A;  2FZC B;  2EFI A;  3V8K A;  2FEI A;  2VUB A;  1M90 U;  4RTX A;  2EPD A;  2L3Q A;  4EIK A;  4E7Z A;  2I2L A;  3JCM e;  1M2V A;  5LJ5 j;  3ZL7 C;  1QVG S;  2KE9 A;  2YRC A;  4AG1 C;  2QQ9 A;  1UHC A;  2CH4 A;  4J9I A;  2ENM A;  2VVK A;  2E70 A;  2JTF A;  4QVC A;  5FLX E;  5LJ5 d;  1G8X A;  4OMF B;  3PNW C;  4Y92 A;  2D1X A;  1VQ7 Q;  2RJD A;  1KQ2 A;  4OVA A;  1VQ4 T;  1SKU B;  1ABQ A;  4M77 D;  5FRO A;  4FSS A;  2O9S A;  2OTJ Q;  1W2B S;  3CXC P;  3FC3 A;  2K3X A;  4A63 B;  4FCY A; 
#chains in the Genus database with same CATH homology
 2KGT A;  1SRL A;  3EHR A;  2L3P A;  2MCN A;  2DX1 A;  2CH4 W;  1JU5 C;  3VS2 A;  5IHK A;  1GBR A;  3PVL A;  3UF4 A;  1PKS A;  4JJD A;  2O88 A;  5FWB A;  1M27 C;  1NM7 A;  1VYT A;  1UJ0 A;  4CC4 B;  2EBP A;  2RQV A;  2CT4 A;  2EVR A;  1NEG A;  2OAW A;  2CUB A;  5FWC A;  1ZX6 A;  2KEA A;  1JEG A;  1T0H A;  3M0R A;  2EYZ A;  2JM8 A;  3VS7 A;  2BZY A;  2DL4 A;  3VS4 A;  1M3C A;  2G6F X;  1UUE A;  2V1R A;  2LCS A;  2RQT A;  1GCP A;  3NGP A;  1ARK A;  4OML A;  1G2B A;  1YNZ A;  1AVZ C;  1X2K A;  1Y57 A;  1VA7 A;  2A28 A;  2MIO A;  1KFZ A;  1K0S A;  1U3O A;  1WXT A;  4J9E A;  4J9H A;  1ZSG A;  1GCQ A;  1OV3 A;  3FJ5 A;  1H3H A;  1WI7 A;  1V1C A;  1X43 A;  4Z88 A;  2DRM A;  2F2X A;  2HBW A;  2EGE A;  4OMM A;  2L0A A;  1B3Q A;  1UFF A;  2PTK A;  1PKT A;  2O2O A;  1G83 A;  1SEM A;  2J6F A;  2HCK A;  2AZV A;  2DNU A;  2JW4 A;  4M4Z A;  5GJW B;  4JZ4 A;  2L3S A;  3EG2 A;  3TSZ A;  2KRS A;  2DLP A;  1NEB A;  1WDX A;  2DBM A;  2KXC A;  1GFC A;  1WLP B;  1B07 A;  2O9V A;  4ZNX A;  2VWF A;  2QDL A;  2PNI A;  1TUC A;  4ORZ A;  2LX7 A;  1MV0 B;  4J9G A;  1I0C A;  2I0N A;  2K3B A;  3REB B;  1JQQ A;  1WA7 A;  2RF0 A;  1T3L A;  1N5Z A;  3CQT A;  5I11 A;  4Z8A A;  1W70 A;  2LJ3 A;  2EGC A;  2JM9 A;  2IIM A;  3M0U A;  4WCI A;  3VRY A;  1UG1 A;  2D8H A;  2JS2 A;  2ROT A;  3I9Q A;  2A36 A;  2LQW A;  1YN8 A;  1YCS B;  2DL5 A;  2K79 A;  1OPK A;  3C0C A;  2A37 A;  1WXU A;  2RNA A;  2LQN A;  2EYW A;  4AFQ C;  2V1Q A;  2J05 A;  1LCK A;  1FYN A;  2ROL A;  4RTZ A;  1M3B A;  2JS0 A;  1ZUU A;  4ESR A;  2EW3 A;  5IHN A;  2YUQ A;  1K0X A;  2EQI A;  2EYX A;  4D8K A;  1NYG A;  2BZX A;  3VS6 A;  1ABO A;  3O5Z A;  1Z9Z A;  4HVV A;  5IHI A;  2J06 A;  2DRK A;  3RBB B;  1T3S A;  4F14 A;  2JMC A;  2A08 A;  2EYY A;  2JXB A;  1WIE A;  3EGU A;  3ULR B;  3PE0 A;  3QWX X;  4OMP A;  5ECA A;  2JTE A;  2D8J A;  3VS3 A;  3EG1 A;  1A0N B;  2KRO A;  1ZUK A;  2GTJ A;  1ZUY A;  2X3X D;  2CT3 A;  3EG3 A;  1AZG B;  3EG0 A;  4LNP A;  2DYB A;  1NG2 A;  4AFZ C;  1UDL A;  2YUO A;  2EGA A;  1WYX A;  2B86 A;  3VS5 A;  1W1F A;  1UJY A;  1AWX A;  2FG0 A;  1NYF A;  3JV3 A;  2SEM A;  1BBZ A;  1AOJ A;  2W10 A;  1ZBJ A;  4OMQ A;  3H0I A;  1WFW A;  2KT8 A;  2DL8 A;  3I5S A;  1UTI A;  2AKL A;  2RPN A;  1M8M A;  4LN2 A;  1QLY A;  4GBQ A;  4KRT A;  5EC7 A;  1UGV A;  3RNJ A;  1PHT A;  2K2M A;  3U23 A;  1RLP C;  2DJQ A;  4RTU A;  2AZS A;  1SHF A;  2FRY A;  2ED1 A;  4R0K A;  1SPK A;  2F2V A;  3NHN A;  2KYB A;  2KXD A;  3UA7 A;  4CC7 A;  2YT6 A;  4HXJ A;  4DEY A;  4F16 A;  5IXB A;  2DMO A;  2KRN A;  4RTY A;  1AWJ A;  1CKA A;  1GL5 A;  1NLO C;  2K6D A;  2DBK A;  1GFD A;  3UA6 A;  1RLQ C;  1KJW A;  2HDA A;  2BTT A;  1ZLM A;  2DIL A;  5HCK A;  3M0T A;  2J6O A;  1U5S A;  4JJB A;  1KSW A;  2FPF A;  5FW9 A;  2OI3 A;  2O31 A;  1X69 A;  2KBT A;  2ED0 A;  2M0Y A;  1MV3 A;  1UHF A;  2DA9 A;  2GQI A;  1XOV A;  2M51 A;  2GTO A;  4CC2 A;  1YP5 A;  1X2Q A;  4J9F A;  3SEM A;  1T0J A;  1X27 A;  2LP5 A;  1TG0 A;  4J9D A;  4JJC A;  4OMO A;  2ECZ A;  4IIM A;  5IXF A;  3VRZ A;  1HD3 A;  5IH2 A;  2FRW A;  2KNB B;  2EKH A;  2ESW A;  1QKW A;  4OMN A;  2PZ1 A;  2ABL A;  2FPE A;  3M0Q A;  2OJ2 A;  1AZE A;  1E6H A;  2LJ0 A;  2GGR A;  3M0S A;  1I07 A;  1PWT A;  2JT4 A;  3IQL A;  3H0F A;  3GBQ A;  2RQU A;  4J9B A;  1K9A A;  1VYU A;  1IO6 A;  1TUD A;  2AK5 A;  1HSQ A;  1U06 A;  1PRL C;  1QCF A;  2P4R A;  4GLM A;  1JXM A;  2FPD A;  1KIK A;  1SSH A;  1GBQ A;  2YSQ A;  1SHG A;  4RTT A;  1E7O A;  1YWP A;  2BZ8 A;  2HSP A;  2NUZ A;  2KR3 A;  1MUZ A;  4IIO A;  4X1V A;  1JO8 A;  2LMJ A;  2LZ6 B;  4E6R A;  3KFV A;  2RMO A;  2E5K A;  4HVW A;  5L23 A;  2YUP A;  1X6B A;  2K9G A;  2NWM A;  3TVT A;  2F2W A;  2CSI A;  3UAT A;  4HCK A;  4JPB W;  1RI9 A;  2CSQ A;  2J7I A;  1AWO A;  1JXO A;  3H0H A;  3SHW A;  2RQW A;  2JMA A;  3NMZ C;  1BB9 A;  2YUN A;  1PNJ A;  3R6N A;  1QKX A;  4RTW A;  1BK2 A;  1RUW A;  2SRC A;  3A98 A;  4K11 A;  1UE9 A;  2VKN A;  3LH5 A;  4HVU A;  1WXB A;  2LJ1 A;  4QT7 A;  1HJD A;  1OEB A;  3EHQ A;  1X6G A;  2AKK A;  4LUE A;  2DL3 A;  3M0P A;  2X3W D;  2DE0 X;  1CSK A;  1YWO A;  4AFU C;  1H8K A;  4DEX A;  4J9C A;  1SRM A;  1UEC A;  5I22 A;  1QWE A;  2D0N A;  4AFS C;  3REA B;  2CDT A;  4CC3 A;  1WX6 A;  1OOT A;  2RQR A;  2RN8 A;  2XMF A;  4RTV A;  2LNH B;  2W0Z A;  2DVJ A;  1VYV A;  5GJV B;  1BU1 A;  2L2P A;  3TSW A;  2DF6 A;  1W6X A;  2CRE A;  1Y0M A;  2C0T A;  2KYM A;  4F17 A;  1EFN A;  3I5R A;  1GRI A;  1M30 A;  1NLP C;  2GBQ A;  2FEI A;  2YDL A;  4RTX A;  2EPD A;  3H41 A;  2L3Q A;  4LE9 A;  4EIK A;  2DL7 A;  2C0I A;  1CKB A;  1K4U S;  1AD5 A;  4JZ3 A;  2J6K A;  2DM1 A;  3ZL7 C;  3I35 A;  2KE9 A;  1S1N A;  3NPF A;  1FMK A;  4AG1 C;  1M3A A;  1OPL A;  2K7A A;  2C0O A;  1UHC A;  1K76 A;  2CH4 A;  1AWW A;  4J9I A;  2ENM A;  2VVK A;  2KT1 A;  4LUD A;  3VS0 A;  2HEQ A;  2KRM A;  2H8H A;  4Y92 A;  2CUD A;  2D1X A;  4RUG A;  4AG2 C;  1K1Z A;  1I1J A;  2FO0 A;  2MOX A;  1ABQ A;  4FSS A;  2GNC A;  2O9S A;  1AEY A;  3THK A;  4D8D A;  1E6G A;  1QWF A;  4Z89 A;  3VS1 A;  3PVQ A;  1H92 A;  1J3T A;  4A63 B;  1GCQ C;  1PRM C;  3QWY A;  1Z9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...