2RQUA

Solution structure of the complex between the ddef1 sh3 domain and the apc samp1 motif
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
VRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DDEF1_SH3
publication title Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 12
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rquA00
5GJWB 2BZYA 3EG3A 4X1VA 1ZUUA 2JW4A 4AFSC 4HXJA 1JQQA 2M0YA 2CREA 1NG2A 2JMCA 3VS4A 1ZUYA 5IHNA 1JO8A 1S1NA 2KYBA 2F2WA 2M51A 2J06A 1X43A 2LJ3A 4JJBA 3M0UA 3VRZA 2JS0A 2A08A 1YN8A 2KRNA 2EGEA 2EYWA 1QKWA 1G2BA 2GTOA 2K9GA 3GBQA 1B07A 3NGPA 2J6KA 1WIEA 2DVJA 2EW3A 2B86A 2XMFA 1ARKA 2J05A 3H0IA 4LUEA 2O31A 5FWCA 4JPBW 4ZNXA 2DL7A 1GRIA 3REAB 4AFQC 3NMZC 5ECAA 2LNHB 2EBPA 4F14A 1RI9A 2DBMA 1JU5C 1FMKA 2QDLA 4LN2A 2C0IA 1CSKA 2EGCA 2L0AA 2SRCA 2A37A 4Y92A 1ABQA 1PKSA 1YP5A 4JZ4A 3TSZA 1QKXA 1NYGA 2EGAA 2L3QA 2GBQA 1E6HA 2DJQA 4J9DA 4K11A 1B3QA 3M0RA 2DX1A 1GFCA 3EGUA 3H0HA 2YUNA 2MCNA 3I5RA 1PRMC 2KYMA 5L23A 1TUDA 1SHFA 2E5KA 2KEAA 3M0SA 1GCPA 1NLOC 4JZ3A 4HCKA 1PNJA 1CKBA 2K2MA 2RQRA 2YSQA 1ZX6A 2LZ6B 1WXTA 2DF6A 2L3PA 3A98A 2LMJA 3IQLA 4AG2C 2O88A 1ABOA 3ZL7C 4Z8AA 2CH4W 4WCIA 4DEXA 1SPKA 1WFWA 4D8DA 1X69A 1X2KA 2PZ1A 4RTXA 1JXOA 1TUCA 2J6FA 3VS7A 3EHQA 1GBQA 1SSHA 1BU1A 1RUWA 2FPEA 1AD5A 1WYXA 5HCKA 4CC4B 1UE9A 1UECA 4J9HA 1UUEA 1MUZA 2LCSA 4OMLA 1I07A 1BB9A 3RBBB 1N5ZA 1UTIA 2OI3A 1K4US 2VKNA 2GQIA 2EVRA 2ENMA 2EYXA 2LX7A 2D1XA 3EG1A 2D0NA 1QLYA 3H0FA 1W1FA 2ED0A 3VRYA 1NM7A 1QWEA 2CH4A 2HBWA 2KXCA 1X6BA 2JM9A 2C0OA 1TG0A 2CUDA 5IXFA 2DE0X 2JMAA 3R6NA 2JT4A 4DEYA 2NUZA 2AZSA 2EPDA 2ECZA 2JTEA 2CT3A 3UF4A 3VS5A 1LCKA 3FJ5A 1VA7A 1WXBA 3SHWA 4KRTA 2YUOA 4CC7A 1J3TA 1I1JA 2DRKA 1SRLA 2RQWA 1UHCA 2FG0A 2DNUA 3PVLA 1OV3A 1VYVA 1X27A 1AZEA 1CKAA 1U3OA 4J9FA 4AFUC 2K6DA 2PNIA 2HEQA 2RQVA 2W10A 2PTKA 1T3SA 1KIKA 4A63B 1GFDA 3M0PA 1ZSGA 5FW9A 4CC3A 3UA7A 2KNBB 1E6GA 2KROA 2VVKA 2AK5A 2HSPA 1MV3A 2DL5A 3VS0A 5FWBA 1GL5A 1AOJA 4LUDA 3M0QA 4HVWA 3VS6A 4AFZC 1IO6A 2EYZA 3VS3A 4CC2A 2DA9A 3QWYA 1GCQA 1H8KA 1M30A 2DMOA 2CUBA 1PWTA 4J9CA 1M3CA 1AWWA 2RF0A 2OAWA 1ZUKA 3NPFA 4HVUA 2EYYA 1WI7A 1Z9QA 1V1CA 1W70A 2MOXA 3I9QA 2JM8A 3SEMA 1FYNA 2FRWA 4J9EA 1QCFA 4F17A 2YUPA 1Y57A 1SRMA 1G83A 1T0JA 4JJCA 1E7OA 1HJDA 1NEBA 2LP5A 2AKKA 5EC7A 1OOTA 1UDLA 1PRLC 4OMNA 2FEIA 3TSWA 2KT1A 3O5ZA 1JEGA 4R0KA 2DBKA 1VYTA 1BK2A 1M3AA 3PE0A 2FRYA 2VWFA 5I22A 1BBZA 1UJ0A 2CSQA 2DL4A 1YCSB 5IXBA 2O9VA 1KSWA 1K9AA 1WXUA 2G6FX 4EIKA 5IHIA 3VS2A 1Z9ZA 2BZXA 2D8HA 2KT8A 2O9SA 3QWXX 4ESRA 2I0NA 2LQWA 1GCQC 2K3BA 3C0CA 2DRMA 4RTVA 1AEYA 1OPKA 2KRSA 1SHGA 4ORZA 3U23A 2KBTA 1WDXA 2RNAA 2X3WD 4HVVA 3I5SA 3ULRB 4OMQA 2J6OA 2K7AA 2LJ1A 1EFNA 2X3XD 2GGRA 2BZ8A 1AVZC 2DILA 2AZVA 4GBQA 3UATA 4J9BA 5IHKA 1UFFA 2A28A 2YT6A 2CT4A 2FPDA 2L2PA 2J7IA 2V1RA 2EQIA 2OJ2A 4E6RA 1NYFA 1AZGB 2YDLA 2RN8A 3EG0A 2KRMA 1M3BA 4LNPA 2ROLA 1A0NB 2F2XA 2MIOA 4RTWA 3REBB 5IH2A 2BTTA 1YWPA 3NHNA 2CDTA 1NEGA 1WLPB 1X2QA 2RQTA 4JJDA 4OMMA 1GBRA 2KE9A 4RUGA 4AG1C 2KXDA 2V1QA 4OMPA 5GJVB 1AWOA 2DL8A 4J9IA 1NLPC 1U06A 1SEMA 1YNZA 2KR3A 2GNCA 1M27C 4RTYA 1AWXA 2DM1A 1WA7A 1K0XA 2ABLA 1T0HA 4GLMA 1Y0MA 4RTZA 1VYUA 2FPFA 2FO0A 1RLPC 3THKA 3RNJA 1WX6A 1AWJA 3EHRA 1K1ZA 2HCKA 3CQTA 2D8JA 3TVTA 1ZLMA 3EG2A 2AKLA 1RLQC 3LH5A 4D8KA 2L3SA 1X6GA 2NWMA 4RTUA 1MV0B 3KFVA 2ROTA 3UA6A 2A36A 2F2VA 3H41A 2ESWA 4OMOA 1T3LA 1PHTA 1UJYA 1H92A 2KGTA 2EKHA 4RTTA 1OEBA 2O2OA 2JXBA 3I35A 1W6XA 1QWFA 2GTJA 1KJWA 4LE9A 1H3HA 1JXMA 1PKTA 1UHFA 2P4RA 2IIMA 1UGVA 2LQNA 1K76A 1XOVA 2LJ0A 1I0CA 4QT7A 1U5SA 2ED1A 2JS2A 3VS1A 2DYBA 2RMOA 4J9GA 2W0ZA 4Z88A 2HDAA 4F16A 1KFZA 4M4ZA 2H8HA 2SEMA 1HSQA 3M0TA 4IIOA 2YUQA 2RPNA 2DLPA 2CSIA 4FSSA 1M8MA 1UG1A 1HD3A 3JV3A 2RQUA 1YWOA 4IIMA 4Z89A 2DL3A 3PVQA 5I11A 1K0SA 1ZBJA 2K79A 2C0TA 1OPLA
chains in the Genus database with same CATH superfamily
1VIFA 2RI5A 5GJWB 4X1VA 1YJNQ 3MP6A 1K9MR 2M0YA 1WHHA 2JMCA 4IUPA 4C92G 3VS4A 5KH6A 3HRUA 2DEUA 3DB4A 1JO8A 4M7AG 2DFUA 3CC7Q 1X43A 2LJ3A 2ZPBB 2E70A 4J83A 3OYDA 4ZTJA 1WZOA 2QEXQ 1YN8A 1K73C 2KRNA 4KUIA 4C8QF 1QKWA 2RHUA 2BKDN 4C8QB 2V26A 2OTLQ 2O4XA 5GANd 1ARKA 3OYKA 2DXUA 2HZYA 5FWCA 3EGDB 2LDMA 3CC4A 2DL7A 1YJWQ 4EMKB 4VUBA 2CP7A 1K73U 4LDVA 4OF1A 3A8OB 5LJ3f 5GMKj 3CCRA 1RI9A 2EWNA 4BB7A 4F7UF 4IKFA 3CCLT 2C0IA 1CSKA 3OSSC 3M57A 5HKCA 1ABQA 4PFPA 5GAN6 1TOVA 3A8GB 1QKXA 2XU8A 1E6HA 1K8AC 4ANJA 1B3QA 3G4SA 2DX1A 1GFCA 2YUNA 3EGXA 2FHDA 1PRMC 2KYMA 1V29B 1FWZA 3AHUA 3JCMh 4C8QA 4XTWA 3JCMf 4XQ3A 1CKBA 3OYLA 1VQKA 3V7SA 2DYIA 1ZX6A 1WHJA 2L3PA 3GP8A 1N8RR 3EGDA 4KT0E 3A98A 1VQ8A 3IQLA 1ABOA 3QO3A 4EMKA 3CC4T 2JOYA 4RMOA 4DEXA 1SPKA 1WFWA 2YRCA 2PZ1A 1I8FA 4FYWB 2LX9A 2BUDA 3VS7A 3CMAA 3CEYA 3M54A 2DTOA 1UECA 2CP5A 2GFUA 1WQWA 2Y4YA 4OMLA 4E7ZA 2JTFA 2VKNA 3HTRA 3MP1A 1M90U 2ENMA 2EYXA 2DTIA 1YITA 5GAN2 3G71Q 1VQ4T 1W1FA 3NTHA 2ED0A 4IUQA 3VRYA 1NM7A 4FYYB 3RMQA 2ZGWA 5LJ5g 3CCVA 4BI8B 2K5LA 1TG0A 2RJDA 2CUDA 4LDUA 3R6NA 3X20B 2AZSA 1X01A 2A3LA 2JTEA 3A8HB 1QQJA 2RA2A 4ZGJB 4R56A 3PIPA 3RESA 3CMEQ 1I1JA 1MMGA 2DRKA 3OYYA 3OW2P 5CKBA 1R77A 4OMFB 3MEVA 2HBPA 1OV3A 1AZEA 2EYQA 1CKAA 5GAN4 4E7HA 4J9FA 4JDSA 3KXTA 3CMAT 3L1AA 3CCET 2D0QB 2PTKA 1T3SA 4A63B 5KYUB 4HCBA 4J6XA 1E6GA 2KROA 2VVKA 3FJPA 2HSPA 3UPUA 1MV3A 3JCMJ 2WSEE 2CP2A 1YITT 1VQMA 3VS6A 5CIUA 4AFZC 2EYZA 1WJQA 3OSVA 2R5MA 5CCAA 2Y4XA 1LPLA 3I55Q 3R6OA 2VGMA 5GANh 5GANf 3UWNA 4ELZC 4E7IA 1VQ6A 4MMKA 5GAMd 1O9SA 4HVUA 5I2SA 3OYGA 5GAOl 4ATOA 1BYMA 5LJ5e 2QG9B 1PD1A 4KH0B 4J9EA 2E41A 2CZ0B 3OYFA 1VQ7A 1F1BB 1NEBA 1G3YA 3OYHA 5EC7A 3QZ9B 1UDLA 1W2BA 2CGHA 4PJNA 3TSWA 2QQRA 1JEGA 3OMGA 3CPWA 2QK0A 4ZN1A 5IT9E 2PQWA 4GLKA 2CS7A 3JB9J 1MMDA 1ZSZC 2DJZA 2FRYA 1D1BA 4QQDA 3PTAA 1UJ0A 1VQMT 2CSQA 3I56Q 1H641 2O9VA 1WXUA 2BIVA 4EIKA 4M7DC 2HNIA 1QVGS 5IHIA 3VS2A 3OA6A 3CXCP 1NBEB 2O9SA 2E5QA 4CI0C 3QXEB 3S3NA 4RKUE 3P8DA 1VQ6T 1LNXA 2RJCA 5CQXA 1JB0E 2AIRB 2KRSA 1UEBA 1UGRB 1WDXA 2RNAA 4NL2A 1VQOA 3ULRB 4PJOE 4M7DD 4MZMA 2O01E 2X3XD 2M16A 1S72Q 2RHZA 5FROA 2GF7A 2AZVA 4GBQA 3UATA 1C6VX 1UFFA 1YFNA 2QGFB 2VYTA 2L2PA 2DIQA 2KDSA 3G4SQ 3OYCA 2CZ1B 3EG0A 3TCJA 2PU9B 2X4JA 3REBB 2F69A 2BTTA 1YWPA 2CDTA 2QQAA 5FU6B 1XNIA 2DVEA 4OMMA 3ZFJA 2XDDA 1VQKQ 5D7UA 4PJOG 3F70A 2EKOA 4N0AA 4OMPA 1AWOA 3CC7A 1SG5A 1VQ8Q 4J9IA 1U06A 3CBOA 4M78B 3CXCA 2QEXA 4B9WA 3P8BB 1AWXA 1K0XA 2ABLA 1VQOT 2OTLA 1HYOA 3ZBDA 2EJGA 4P5NA 3RNJA 4QQ6A 2LT4A 5GAOm 2HCKA 1YJWA 4II1A 1IXDA 1WJSA 1M90R 2E6ZA 2NWMA 3CCSA 2PVGB 2ROTA 2MWOA 3JB9G 4ME7A 3VV0A 2QQBA 3QG1A 3LLRA 1H3ZA 1YIJT 3H9NA 1IRXA 1N9SA 2O2OA 2JXBA 2FZCB 1RAIB 5KYNA 4R55A 1KD1R 1Y07A 1IGQA 1PKTA 1UHFA 2P4RA 2IIMA 1YJNT 3GIBA 5GAMh 2LQNA 4RG8A 2JS2A 1WHLA 2RMOA 2RO0A 1B34B 3CC7T 4BI4A 4M78A 4M4ZA 3URGA 1OU8A 4C0GA 3BW1A 1Q86U 2QEXT 2DLPA 2CSIA 1UG1A 2QDYB 1N6AA 2OTLT 2NYSA 2FZKB 4B9XA 1K0SA 3QIIA 4M7DF 2K79A 1OPLA 1YJWT 3EG3A 1QVFP 4HXJA 1UGSB 2CREA 1NG2A 1ZUYA 3QZ5B 1PSFA 2J06A 1O75A 5GMKe 2EJ9A 2LQ8A 5GAMj 1OQKA 2EGEA 2EYWA 1G2BA 3BDUA 1FMVA 2GTOA 3G71A 1B34A 2J6KA 1M9SA 1YI2Q 1WIEA 4XTUA 2XMFA 3HRSA 1WGSA 3LGFA 2O31A 3OB9A 2HD0A 2ZPFB 4AFQC 1WHKA 3OBYA 2X4XA 3S3MA 1VQ7Q 2FZGB 3FIFA 2IPOB 5J39A 2QDLA 1TS9A 2CZ7B 4V2SA 2DETA 2EGCA 2SRCA 5AYFA 4Y92A 4M7DA 1KG1A 5FLXE 1PKSA 4C92C 1SKUB 4HKEA 3UT1A 3CCMQ 1D3BB 1NYGA 3M56A 4M7AC 2EGAA 2L3QA 2X4YA 1BIBA 2M02A 3QYGB 2GBQA 4K11A 3M0RA 5HK3A 3E9GA 3EGUA 3EH1A 2K2VA 3SD4A 2MCNA 1M1FA 4PL6A 4L59A 3OYNA 2YWWA 2KEAA 5HK0A 1GCPA 1NLOC 3PNWC 4WTOB 4C92D 4M7AD 2K2MA 2YSQA 1Q82C 5D6YA 2QGGA 2XIDA 1WXTA 2DF6A 4IUUA 1WJRA 2COZA 1QW1A 3I55A 5FU7C 4WCIA 2LC4A 2M0OA 1X69A 1X2KA 2MAMA 5A0DA 4BDZA 2E12A 1TUCA 2J6FA 4DOWA 3EHQA 1GBQA 1BU1A 1YJ9T 1AD5A 1WYXA 2F1LA 3HFNA 5GAN7 2XDBA 5GAOr 3G1JA 1D3BA 1UE9A 3CMET 4J9HA 3WVEB 3N5BB 3M58A 1I07A 1BB9A 3RBBB 2YLBA 3JCMb 2AHJB 1N5ZA 1UTIA 5J26A 1K4US 5KCHA 3OQ5A 4C5GA 4FT2A 3WVDB 2FVUA 3L2UA 2EVRA 2LX7A 1I4K1 4KGVB 2KAFA 2KI7A 4C0DC 2H3JA 2DXTA 2C0OA 2XKOC 5IXFA 2JMAA 4JJNK 4FW2A 2NUZA 3EGXB 3HRTA 1W2BS 5A0LA 2CT3A 2DK3A 3ME9A 3VS5A 3CPWS 4LD6A 3I56A 4JS4A 4CC7A 3I55T 1KC8C 2RQWA 3QKJA 1AHJB 3G7ZA 1UHCA 2FG0A 3V8JA 3PVLA 1X27A 1TTHB 1OYXA 2K6DA 5KE2A 2HEQA 4MDWA 1WHMA 1IHWA 5LJ3h 3MPUB 3CCSQ 4CC3A 1KC8U 4M77E 2H3EB 4F7UB 2F5KA 4PJJA 1I81A 1S72A 2GCXA 1JJ2A 2AK5A 2V8IA 5FWBA 1GL5A 1AOJA 5GAN5 4HCCA 3M0QA 4J7IA 1G5VA 3VS3A 2DA9A 1X6OA 1M30A 2OX7A 1PWTA 2ZAEA 1M3CA 1AWWA 4BD3A 2PUKB 4C92F 1Q86R 1IREB 3I56T 4M7AF 1K8AU 1YHQQ 2EYYA 2DPPB 1V1CA 1W70A 8AT1B 1KQSP 4M77G 3SEMA 1FYNA 5CO7A 2FRWA 4F17A 1QCFA 4L5GA 5GANe 2E65A 1E7OA 5LJ3j 4BY6B 2AKKA 1M2OA 5CKFA 4OMNA 2FEIA 3QBYA 4F7UA 3CCRT 3SFMA 4FW1A 3PIOA 1BK2A 4PFOA 1RABB 2WSCE 3QPHA 2VWFA 4XAXB 4A4FA 5I22A 1VQ5A 2DL4A 5FU7B 5IXBA 2G6FX 4JS5A 1P92A 3A8LB 3G4ST 1Z9ZA 1U1SA 1LOJA 2BZXA 2D8HA 3CC2Q 3G6EQ 4XU1A 1GCQC 1UGPB 1WPYA 4NS5A 3RMSA 2K3BA 2DRMA 3BE3A 1AEYA 1OPKA 1M4ZA 3CPFA 2KBTA 1MNEA 1VQKT 3I5SA 3OYMA 3MEUA 1PSEA 2HQEA 2YRDA 2GGRA 1VQ8T 2RHIA 5CKDA 4C0DB 5IHKA 2XI9A 4DBRA 2FPDA 2EQIA 3M4YA 1RADB 2JZ2A 2YDLA 2RN8A 4OP0A 9ATCB 2XD0A 1EZZB 2E3HA 5LJ5d 2KRMA 3SWNC 3CCJQ 2ROLA 2F2XA 5KYYB 2DD5A 5IH2A 2HAXA 5EG2A 5FRMA 1NEGA 2HMAA 3MJXA 1TUGB 4JJDA 3QUIA 3EG9B 1GBRA 3LX7A 3CD6Q 2QYZA 4AG1C 5GAMg 2V1QA 5GJVB 5GMKm 3QDRB 5IAYA 3CCVT 2RHYA 2GNCA 3OYEA 2BE7D 5J3BA 1BI1A 1T0HA 1RAHB 4QKUA 2GFAA 1Y0MA 2FPFA 1RLPC 4X9CA 1YI2A 1WX6A 5C0MA 1AWJA 5I21A 3TEEA 5GAOp 1K1ZA 4ZGDB 3CQTA 5CK9A 2LCLA 3TVTA 1ZLMA 1MMAA 2XICA 1X6GA 2P0PA 2ZPIB 3OW2A 4A4KA 3M59A 1RAGB 4ELYC 4JLIA 4D6WA 1IHVA 2F2VA 3H41A 4OB0B 4DBFA 3RUXA 4PLIA 4ZGEB 1UJYA 2EKHA 4RTTA 1OEBA 4A4HA 5KYYA 4BE2A 2WSFE 4PJOC 3CCMA 4M78E 3SB2A 3EG9A 4DQ2A 4N4IA 4QW2A 3ER0A 1XOVA 2CZ6B 1Q7YC 4QT7A 1U5SA 2EQMA 3VS1A 2DYBA 3QSUA 3OS0A 2W0ZA 5GANj 2HDAA 1NJIC 3ZEHA 4PFZA 1KFZA 3V8LA 5DY9A 1Q81C 1M1KC 1HSQA 2EJFA 2K5IA 4PJOD 2RPNA 1IZ6A 1M8MA 4BUGA 4E47A 1HD3A 3OMCA 4KUDK 1Q7YU 1K73R 1WHGA 2K4YA 5C6SA 1YI2T 5GAMe 5I11A 2E3IA 4DBHA 1M1KU 4BE0A 4XU3A 4M78G 3EFRA 2M9UA 3V7CA 2BZYA 3KUFA 5IN1A 1ZUUA 2JW4A 2QA4Q 1VQ7T 1BIAA 3PT9A 3T9NA 5IHNA 1VQNQ 2KYBA 1G3TA 2F2WA 3H8ZA 1TU0B 4EDUA 2MMPA 4C5EA 3VRZA 2A0FB 2E4HA 2VV5A 3JB9D 2HKQB 2Y90A 1NPRA 3LYIA 3X25B 2M1HA 2K9GA 3A5ZB 3GBQA 1K8AR 2DVJA 4LUEA 2QTVA 4M75C 4JPBW 4ZNXA 1VQ4Q 3HKSA 2KK4A 1K9MC 3REAB 3M5AA 5ECAA 2CP6A 2LNHB 5CKHA 3GPLA 4F14A 2DBMA 1XJWB 2L3RA 4LN2A 2L0AA 4Q5WA 3TSZA 4M75D 3J81E 1K9MU 2R5AA 3OS2A 5LJ5f 2PUOB 1VQ5Q 3I5RA 5L23A 1TUDA 2MK5A 2E5KA 4J8OA 3NFCA 4LDXA 4PKCC 1G3SA 1TSFA 4MMLA 3JCMP 3CCEQ 1RAEB 2G3RA 3VU3C 2P0KA 3M9QA 3C94A 1ACMB 2LZ6B 3OYAA 1JJ2S 2MF2A 4AG2C 2Z0WA 3ZL7C 4Z8AA 2DZCA 2JTMA 6AT1B 2XDPA 3J80E 2CYZB 2QQ9A 4RTXA 4OVAA 4UC4A 2P84A 1SSHA 4PJOF 3E2UA 4AMCA 1OX8A 4PJOB 3OYJA 4QVZA 5L8RE 5HCKA 4CC4B 1YHQA 5CAIA 1PM3A 3C95A 1ZSZB 5LJ3g 3CCUQ 1UUEA 2LCSA 2OI3A 1WQ7A 2GQIA 1N8RC 4C5HA 4M7DB 2D0NA 1QLYA 1V76A 1VIEA 3H0FA 4PK4A 1QWEA 2HBWA 2KXCA 3DLLA 3CCST 1RAAB 1X6BA 2JM9A 2JT4A 4DEYA 1N8RU 2ECZA 1QVGP 3JB9F 1XQHA 2P4TA 3FJ5A 1VA7A 1WXBA 4N4HA 2HKNA 1VQLA 4IURA 2LRQA 4KRTA 2KVQG 5KCOA 3JCMg 3JCMV 1SRLA 1KQ1A 1OI1A 3CC2A 1Y7XA 5GAOq 2OAUA 4C0ZA 3G6EA 3M53A 4PJOA 4FCYA 2PNIA 2R57A 1D0YA 1TXQA 1D09B 2QAZA 2W10A 5A2QE 1ZSZA 1YHQT 1IB8A 1GFDA 1KIKA 3RIRA 1ZSGA 5FW9A 2KNBB 3A8MB 3HFOA 2DL5A 4HA8A 4M75F 3MEWA 4M75B 4LUDA 1NPPA 5DLOA 1IO6A 4OB3B 4C8QE 4CC2A 1OU9A 3QWYA 3CBPA 5LJ3e 4RG2A 2DMOA 2CP3A 2CUBA 3JB9I 1SSFA 1AT1B 2RF0A 1W4SA 2OAWA 2OTJA 1QVFA 1ZUKA 3NPFA 3H6ZA 1M1GA 3EFSA 3CCJA 1VUBA 4NL3A 8ATCB 2VGNA 3PMTA 1X75C 2VC8A 3VYGA 1QVGA 1WI7A 1Z9QA 3LGLA 3O8VA 3EH2A 3I9QA 2X4WA 4F7UE 3G71T 3CD6A 1EIFA 2JM8A 3JCMX 3MHXA 3CC2T 3ASKA 1G8XA 1VQ9Q 1Y57A 4JJCA 2VASA 4X34A 2YHTA 1HJDA 2DD4A 1OOTA 1PRLC 4C8QG 3JCMe 1Q82U 2KT1A 2XG8D 1M3AA 4M75A 5KE3A 4PJLA 5CR2A 1TWBA 3E1SA 4JLGA 5GAN8 4JRIA 4EMHA 1PCXA 1GXIE 4F7UG 4KGXB 4NOYA 4FSXA 3QWXX 4MDXA 1YBYA 2I0NA 4ESRA 1ZA1B 4M77C 4DBQA 2NUPB 3C0CA 4RTVA 3OW2S 4OB1B 3MO8A 4FYVB 1SHGA 1QCOA 3L42A 4ORZA 3U23A 5GANg 4QQGA 1R8OB 4HVVA 5I2MA 2JJ9A 3CD6T 2LJ1A 3RKYA 3HSBA 1QP3A 2DKGA 2EQKA 2YRVA 4PJMA 1XTDA 3QJ6A 4J9BA 2XHCA 4M77D 2LQKA 2YT6A 4LDYA 2CT4A 2J7IA 1MMNA 2V1RA 1VQPQ 2OJ2A 4E6RA 1NYFA 2FYKA 1AZGB 3QJYA 3VJPA 4N4GA 2WACA 3LWIA 2RJFA 3M55A 2HL5C 4RTWA 1ZBXA 2DXBA 3OYIA 1WLPB 2RD1A 2QA4A 5GMKl 2DAQA 4OGCA 2KXDA 2K3YA 4J6WA 1VQNA 2DL8A 2NUPA 1RL2A 5GAN3 5DM7R 5FRNA 2A7YA 1SEMA 2ZPHB 4OB2B 4X9DA 2X51A 2JNGA 1OZ3A 1M27C 4RTYA 1OX9A 1WA7A 3FRNA 4GLMA 3FEOA 4Y28E 2FO0A 3THKA 4C92B 3E19A 1I5OB 1M8VA 3EHRA 4M7AB 4QVDA 2D8JA 2NUTB 1VQ4A 1IGUA 3VUBA 2AKLA 4D8KA 4BI3A 1MV0B 3KFVA 3V7RA 4LD9K 3UA6A 3MCAB 3V8KA 1KHCA 4JRPA 1T3LA 1H92A 3L2RA 2KGTA 3LW5E 3A1PA 3I35A 3J7AF 1QWFA 2ATCB 2RK2A 3GLXA 2GTJA 1KJWA 4LE9A 1S72T 1JXMA 2V8KA 3LWHA 4JRKA 2LCCA 3CXCS 2QA4T 2RB6A 3CCQQ 1UGVA 2F5TX 3OS5A 4O6JA 2YLCA 1I0CA 1PD0A 3JCMQ 1VQLQ 1VQNT 4Z88A 4L6V5 4F16A 1M90C 2H8HA 4LXCA 3CCEA 3X28B 2KSSA 4N0AC 2K57A 1MGQA 3JV3A 4C92A 2EFIA 3PFSA 2RK1A 2VXFA 4M7AA 1YWOA 4FT4A 4Z89A 2DL3A 1KD1C 2NUTA 1RACB 2MWPA 2LVMA 1DJ7B 1VOMA 1EX4A 3L2ZA 3JAME 2I2LA 2KQWA 2E6NA 4AFSC 2JN0A 1JQQA 2D9TA 2LT1A 4M77F 3BDLA 1KQSA 3MEAA 3DB3A 4M77B 1KD1U 1S1NA 2M51A 4JJBA 3M0UA 2MI6A 2EQUA 2YXYA 3CCUA 2JS0A 1NE8A 1YJ9Q 2A08A 1BKBA 2QI2A 2OTJQ 2FL7A 1B07A 1BCMA 1VQ5T 3VKIA 3NGPA 5FU6C 2NLUA 3FDRA 2EAYA 2ZPEB 4MZTA 2EW3A 2B86A 1W2BP 2J05A 3H0IA 2EQJA 2RJEA 3CPWP 2HL3A 2QTXA 4WF2A 1GRIA 1Y71A 3NMZC 4A4EA 2HQHA 2EBPA 4XTXA 1HXDA 4M78C 1JU5C 2B8AA 1FMKA 2GQVA 3M4GA 2A37A 4ZN3A 1Q82R 1D1AA 1YP5A 4JZ4A 2DIGA 4DOVA 4JRQA 5A0GA 1QMCA 3RKWA 2X35A 2K3XA 2DJQA 4J9DA 7AT1B 4M77A 2L89A 4KGZB 2RM4A 3H0HA 1OZ2A 2JVVA 2X9HA 4M78D 4PNOA 5DLQE 2DEQA 1MHNA 2K5FA 1R0BG 2D6FA 1SHFA 3M0SA 4JZ3A 4HCKA 3CCUT 3RR6A 4YTLA 1PNJA 4KBMB 2RQRA 3VYHB 5CQYA 4EMGA 4B6MA 4A53A 3CCLQ 1KQ2A 2COYA 3EFOB 2LMJA 2O88A 3FC3A 2CH4W 5D6WA 1RI0A 4D8DA 5KYUA 3NTKA 4E7SA 2ZZDA 1JBMA 1JXOA 2R58A 1M5Q1 1RUWA 2FPEA 2EIFA 4DA4A 4XU2A 3L2QA 4QVCA 1QVFS 1QVPA 4EPCA 4OGEA 3TQ7P 1MUZA 1NJIU 1VQ9A 1KC8R 2AT1B 4JUVA 1Q81U 3EAEA 2D1XA 3EG1A 2QXFA 1YCYA 2CP0A 1FXXA 2CH4A 1SF9A 1C0MA 3CC4Q 4AT1B 2DE0X 2EPDA 3UF4A 3CCRQ 3JRZA 3QHSA 3CCMT 3EFOA 3WXMB 1LCKA 3OY9A 1ZA2B 3SHWA 2V8JA 3GF5A 2YUOA 1J3TA 3S3OA 2ZPGB 1PC0A 3MP8A 2DNUA 1VYVA 1U3OA 5AT1B 4AFUC 3D7SB 4M7DE 4F04B 1BI0A 3GOXA 2RQVA 1YIJA 4KH1B 4BACA 1NZ9A 3M0PA 2VUBA 4FU6A 3UA7A 4E2FB 3SWNB 3INZA 1RAFB 5D6XA 1WNLA 3VS0A 1YJNA 1VQ9T 5CKEA 4XTVA 4HVWA 4IUVA 5LJ5h 1PG5B 3KBGA 2L8DA 1MNDA 1D1CA 2LNVA 3L2WA 1GCQA 1U1TA 3TREA 1H8KA 1R0CB 1VQPA 2C06A 3HL8A 4M78F 2IG0A 3QYHB 5GMKi 4J9CA 3BY7A 3C4SA 1KK7A 2RH2A 3E9FA 4M7DG 4J6YA 4FM4B 3Q1JA 3CMAQ 3X24B 1HK9A 1BI2A 2E1HA 2MOXA 4FIBA 4ZTFA 2ZCFB 1C1AA 1ZHIA 4A54A 1JRIA 2YUPA 1OULA 1SRMA 1G83A 1T0JA 2E10A 2L5QA 4M75E 2PVDB 2DTHA 1YITQ 2LP5A 2PVOB 4XK8E 1U8RA 3JB9H 3UDCA 2HQXA 2DXCA 2VXEA 3O5ZA 3SWNA 4J7FA 5KYWB 4R0KA 3CCVQ 2DBKA 1VYTA 4Z02A 1Q86C 4XU0A 3JCMW 3PE0A 4RCCA 2VB6A 5LJ5j 5GAMf 1BBZA 5KYXB 2LTOA 1YCSB 1KSWA 1K9AA 4C0FA 1M2VB 1UGQB 2MYSA 1N27A 1VQPT 2KT8A 2BE9B 4CRIA 2HSEB 2LQWA 3BFMA 4RCBA 4M75G 3OYBA 4PLLA 3HHTB 2X3WD 3CCQA 4OMQA 2J6OA 2K7AA 4Y91A 5GAOn 2DZ9A 3NTIA 2DO3A 1EFNA 3FB9A 2P0QA 4C8QC 2BZ8A 1AVZC 2DILA 2KY9A 3META 2DERA 5LJ3d 4HT8A 4O5VA 1VQMQ 4LDWA 5HY6A 2A28A 5KYWA 1N9RA 1BI3A 4TVRA 3TU4K 4EMKC 2FB7A 3S6WA 3JSCA 4E7KA 4XTZA 4C8QD 5KYXA 4FYXB 1M3BA 4E7LA 4LNPA 1VQ6Q 3GNFB 1A0NB 2MIOA 1M2VA 3VUZA 3NHNA 5M9OA 1B7TA 1QP2A 1X2QA 2RQTA 4HT9A 2KE9A 4FL6A 1LJOA 4RUGA 1Y96B 1FX7A 3JCMd 3C12A 1NLPC 4KULA 3FLGA 1YNZA 2KR3A 1YJ9A 1KQSS 2COWA 2DM1A 3CMEA 3CCQT 4RTZA 1VYUA 2E64A 4GY5A 3OBWA 4A4GA 1VQLT 2RI3A 3LH0A 1TH7A 3GNGA 1Q7YR 1LVKA 2QQSA 4MZPA 1BCOA 3DKMA 1NJIR 3EG2A 2JUFA 1RLQC 2XK0A 3L2VA 3LH5A 2L3SA 1Q81R 1M1KR 3G6ET 2QASA 4RTUA 4BY6C 3PMIA 1I5LA 4J5YA 3HPWA 2A36A 2ESWA 4OMOA 1D0ZA 1PHTA 3OS1A 3P8HA 4E7JA 1W6XA 4BE1A 3QDFA 2RI2A 1FMWA 1H3HA 3HP9A 3MKDA 1VQOQ 1Y96A 1K76A 4C92E 3SDZA 2LJ0A 4C5IA 2ED1A 4M7AE 4XTYA 4J9GA 2O4XB 1Q95G 1UB4A 3RDVA 3PGGA 3RERA 1D0XA 2SEMA 3M0TA 4IIOA 1ZQ1A 2YUQA 2MPXC 3DLMA 1JJ2P 1KHIA 4FSSA 3CBMA 2OTJT 1G3WA 2RHXA 2KMTA 3CCJT 2IVWA 4HCZA 2RQUA 5LL6S 3JCMc 3CCLA 4IUTA 4BDYA 4IIMA 3RKXA 1YIJQ 3PVQA 3X26B 5GMKh 1ZBJA 3AT1B 1QCNA 5CVIA 2CKKA 2C0TA
chains in the Genus database with same CATH topology
5GJWB 2BZYA 3EG3A 4X1VA 1ZUUA 2JW4A 4AFSC 4HXJA 1JQQA 2M0YA 2CREA 1NG2A 2JMCA 3VS4A 1ZUYA 5IHNA 1JO8A 1S1NA 2KYBA 2F2WA 2M51A 2J06A 1X43A 2LJ3A 4JJBA 3M0UA 3VRZA 2JS0A 2A08A 1YN8A 2KRNA 2EGEA 2EYWA 1QKWA 1G2BA 2GTOA 2K9GA 3GBQA 1B07A 3NGPA 2J6KA 1WIEA 2DVJA 2EW3A 2B86A 2XMFA 1ARKA 2J05A 3H0IA 4LUEA 2O31A 5FWCA 4JPBW 4ZNXA 2DL7A 1GRIA 3REAB 4AFQC 3NMZC 5ECAA 2LNHB 2EBPA 4F14A 1RI9A 2DBMA 1JU5C 1FMKA 2QDLA 4LN2A 2C0IA 1CSKA 2EGCA 2L0AA 2SRCA 2A37A 4Y92A 1ABQA 1PKSA 1YP5A 4JZ4A 3TSZA 1QKXA 1NYGA 2EGAA 2L3QA 2GBQA 1E6HA 2DJQA 4J9DA 4K11A 1B3QA 3M0RA 2DX1A 1GFCA 3EGUA 3H0HA 2YUNA 2MCNA 3I5RA 1PRMC 2KYMA 5L23A 1TUDA 1SHFA 2E5KA 2KEAA 3M0SA 1GCPA 1NLOC 4JZ3A 4HCKA 1PNJA 1CKBA 2K2MA 2RQRA 2YSQA 1ZX6A 2LZ6B 1WXTA 2DF6A 2L3PA 3A98A 2LMJA 3IQLA 4AG2C 2O88A 1ABOA 3ZL7C 4Z8AA 2CH4W 4WCIA 4DEXA 1SPKA 1WFWA 4D8DA 1X69A 1X2KA 2PZ1A 4RTXA 1JXOA 1TUCA 2J6FA 3VS7A 3EHQA 1GBQA 1SSHA 1BU1A 1RUWA 2FPEA 1AD5A 1WYXA 5HCKA 4CC4B 1UE9A 1UECA 4J9HA 1UUEA 1MUZA 2LCSA 4OMLA 1I07A 1BB9A 3RBBB 1N5ZA 1UTIA 2OI3A 1K4US 2VKNA 2GQIA 2EVRA 2ENMA 2EYXA 2LX7A 2D1XA 3EG1A 2D0NA 1QLYA 3H0FA 1W1FA 2ED0A 3VRYA 1NM7A 1QWEA 2CH4A 2HBWA 2KXCA 1X6BA 2JM9A 2C0OA 1TG0A 2CUDA 5IXFA 2DE0X 2JMAA 3R6NA 2JT4A 4DEYA 2NUZA 2AZSA 2EPDA 2ECZA 2JTEA 2CT3A 3UF4A 3VS5A 1LCKA 3FJ5A 1VA7A 1WXBA 3SHWA 4KRTA 2YUOA 4CC7A 1J3TA 1I1JA 2DRKA 1SRLA 2RQWA 1UHCA 2FG0A 2DNUA 3PVLA 1OV3A 1VYVA 1X27A 1AZEA 1CKAA 1U3OA 4J9FA 4AFUC 2K6DA 2PNIA 2HEQA 2RQVA 2W10A 2PTKA 1T3SA 1KIKA 4A63B 1GFDA 3M0PA 1ZSGA 5FW9A 4CC3A 3UA7A 2KNBB 1E6GA 2KROA 2VVKA 2AK5A 2HSPA 1MV3A 2DL5A 3VS0A 5FWBA 1GL5A 1AOJA 4LUDA 3M0QA 4HVWA 3VS6A 4AFZC 1IO6A 2EYZA 3VS3A 4CC2A 2DA9A 3QWYA 1GCQA 1H8KA 1M30A 2DMOA 2CUBA 1PWTA 4J9CA 1M3CA 1AWWA 2RF0A 2OAWA 1ZUKA 3NPFA 4HVUA 2EYYA 1WI7A 1Z9QA 1V1CA 1W70A 2MOXA 3I9QA 2JM8A 3SEMA 1FYNA 2FRWA 4J9EA 1QCFA 4F17A 2YUPA 1Y57A 1SRMA 1G83A 1T0JA 4JJCA 1E7OA 1HJDA 1NEBA 2LP5A 2AKKA 5EC7A 1OOTA 1UDLA 1PRLC 4OMNA 2FEIA 3TSWA 2KT1A 3O5ZA 1JEGA 4R0KA 2DBKA 1VYTA 1BK2A 1M3AA 3PE0A 2FRYA 2VWFA 5I22A 1BBZA 1UJ0A 2CSQA 2DL4A 1YCSB 5IXBA 2O9VA 1KSWA 1K9AA 1WXUA 2G6FX 4EIKA 5IHIA 3VS2A 1Z9ZA 2BZXA 2D8HA 2KT8A 2O9SA 3QWXX 4ESRA 2I0NA 2LQWA 1GCQC 2K3BA 3C0CA 2DRMA 4RTVA 1AEYA 1OPKA 2KRSA 1SHGA 4ORZA 3U23A 2KBTA 1WDXA 2RNAA 2X3WD 4HVVA 3I5SA 3ULRB 4OMQA 2J6OA 2K7AA 2LJ1A 1EFNA 2X3XD 2GGRA 2BZ8A 1AVZC 2DILA 2AZVA 4GBQA 3UATA 4J9BA 5IHKA 1UFFA 2A28A 2YT6A 2CT4A 2FPDA 2L2PA 2J7IA 2V1RA 2EQIA 2OJ2A 4E6RA 1NYFA 1AZGB 2YDLA 2RN8A 3EG0A 2KRMA 1M3BA 4LNPA 2ROLA 1A0NB 2F2XA 2MIOA 4RTWA 3REBB 5IH2A 2BTTA 1YWPA 3NHNA 2CDTA 1NEGA 1WLPB 1X2QA 2RQTA 4JJDA 4OMMA 1GBRA 2KE9A 4RUGA 4AG1C 2KXDA 2V1QA 4OMPA 5GJVB 1AWOA 2DL8A 4J9IA 1NLPC 1U06A 1SEMA 1YNZA 2KR3A 2GNCA 1M27C 4RTYA 1AWXA 2DM1A 1WA7A 1K0XA 2ABLA 1T0HA 4GLMA 1Y0MA 4RTZA 1VYUA 2FPFA 2FO0A 1RLPC 3THKA 3RNJA 1WX6A 1AWJA 3EHRA 1K1ZA 2HCKA 3CQTA 2D8JA 3TVTA 1ZLMA 3EG2A 2AKLA 1RLQC 3LH5A 4D8KA 2L3SA 1X6GA 2NWMA 4RTUA 1MV0B 3KFVA 2ROTA 3UA6A 2A36A 2F2VA 3H41A 2ESWA 4OMOA 1T3LA 1PHTA 1UJYA 1H92A 2KGTA 2EKHA 4RTTA 1OEBA 2O2OA 2JXBA 3I35A 1W6XA 1QWFA 2GTJA 1KJWA 4LE9A 1H3HA 1JXMA 1PKTA 1UHFA 2P4RA 2IIMA 1UGVA 2LQNA 1K76A 1XOVA 2LJ0A 1I0CA 4QT7A 1U5SA 2ED1A 2JS2A 3VS1A 2DYBA 2RMOA 4J9GA 2W0ZA 4Z88A 2HDAA 4F16A 1KFZA 4M4ZA 2H8HA 2SEMA 1HSQA 3M0TA 4IIOA 2YUQA 2RPNA 2DLPA 2CSIA 4FSSA 1M8MA 1UG1A 1HD3A 3JV3A 2RQUA 1YWOA 4IIMA 4Z89A 2DL3A 3PVQA 5I11A 1K0SA 1ZBJA 2K79A 2C0TA 1OPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJW B;  2BZY A;  3EG3 A;  4X1V A;  1ZUU A;  2JW4 A;  4AFS C;  4HXJ A;  1JQQ A;  2M0Y A;  2CRE A;  1NG2 A;  2JMC A;  3VS4 A;  1ZUY A;  5IHN A;  1JO8 A;  1S1N A;  2KYB A;  2F2W A;  2M51 A;  2J06 A;  1X43 A;  2LJ3 A;  4JJB A;  3M0U A;  3VRZ A;  2JS0 A;  2A08 A;  1YN8 A;  2KRN A;  2EGE A;  2EYW A;  1QKW A;  1G2B A;  2GTO A;  2K9G A;  3GBQ A;  1B07 A;  3NGP A;  2J6K A;  1WIE A;  2DVJ A;  2EW3 A;  2B86 A;  2XMF A;  1ARK A;  2J05 A;  3H0I A;  4LUE A;  2O31 A;  5FWC A;  4JPB W;  4ZNX A;  2DL7 A;  1GRI A;  3REA B;  4AFQ C;  3NMZ C;  5ECA A;  2LNH B;  2EBP A;  4F14 A;  1RI9 A;  2DBM A;  1JU5 C;  1FMK A;  2QDL A;  4LN2 A;  2C0I A;  1CSK A;  2EGC A;  2L0A A;  2SRC A;  2A37 A;  4Y92 A;  1ABQ A;  1PKS A;  1YP5 A;  4JZ4 A;  3TSZ A;  1QKX A;  1NYG A;  2EGA A;  2L3Q A;  2GBQ A;  1E6H A;  2DJQ A;  4J9D A;  4K11 A;  1B3Q A;  3M0R A;  2DX1 A;  1GFC A;  3EGU A;  3H0H A;  2YUN A;  2MCN A;  3I5R A;  1PRM C;  2KYM A;  5L23 A;  1TUD A;  1SHF A;  2E5K A;  2KEA A;  3M0S A;  1GCP A;  1NLO C;  4JZ3 A;  4HCK A;  1PNJ A;  1CKB A;  2K2M A;  2RQR A;  2YSQ A;  1ZX6 A;  2LZ6 B;  1WXT A;  2DF6 A;  2L3P A;  3A98 A;  2LMJ A;  3IQL A;  4AG2 C;  2O88 A;  1ABO A;  3ZL7 C;  4Z8A A;  2CH4 W;  4WCI A;  4DEX A;  1SPK A;  1WFW A;  4D8D A;  1X69 A;  1X2K A;  2PZ1 A;  4RTX A;  1JXO A;  1TUC A;  2J6F A;  3VS7 A;  3EHQ A;  1GBQ A;  1SSH A;  1BU1 A;  1RUW A;  2FPE A;  1AD5 A;  1WYX A;  5HCK A;  4CC4 B;  1UE9 A;  1UEC A;  4J9H A;  1UUE A;  1MUZ A;  2LCS A;  4OML A;  1I07 A;  1BB9 A;  3RBB B;  1N5Z A;  1UTI A;  2OI3 A;  1K4U S;  2VKN A;  2GQI A;  2EVR A;  2ENM A;  2EYX A;  2LX7 A;  2D1X A;  3EG1 A;  2D0N A;  1QLY A;  3H0F A;  1W1F A;  2ED0 A;  3VRY A;  1NM7 A;  1QWE A;  2CH4 A;  2HBW A;  2KXC A;  1X6B A;  2JM9 A;  2C0O A;  1TG0 A;  2CUD A;  5IXF A;  2DE0 X;  2JMA A;  3R6N A;  2JT4 A;  4DEY A;  2NUZ A;  2AZS A;  2EPD A;  2ECZ A;  2JTE A;  2CT3 A;  3UF4 A;  3VS5 A;  1LCK A;  3FJ5 A;  1VA7 A;  1WXB A;  3SHW A;  4KRT A;  2YUO A;  4CC7 A;  1J3T A;  1I1J A;  2DRK A;  1SRL A;  2RQW A;  1UHC A;  2FG0 A;  2DNU A;  3PVL A;  1OV3 A;  1VYV A;  1X27 A;  1AZE A;  1CKA A;  1U3O A;  4J9F A;  4AFU C;  2K6D A;  2PNI A;  2HEQ A;  2RQV A;  2W10 A;  2PTK A;  1T3S A;  1KIK A;  4A63 B;  1GFD A;  3M0P A;  1ZSG A;  5FW9 A;  4CC3 A;  3UA7 A;  2KNB B;  1E6G A;  2KRO A;  2VVK A;  2AK5 A;  2HSP A;  1MV3 A;  2DL5 A;  3VS0 A;  5FWB A;  1GL5 A;  1AOJ A;  4LUD A;  3M0Q A;  4HVW A;  3VS6 A;  4AFZ C;  1IO6 A;  2EYZ A;  3VS3 A;  4CC2 A;  2DA9 A;  3QWY A;  1GCQ A;  1H8K A;  1M30 A;  2DMO A;  2CUB A;  1PWT A;  4J9C A;  1M3C A;  1AWW A;  2RF0 A;  2OAW A;  1ZUK A;  3NPF A;  4HVU A;  2EYY A;  1WI7 A;  1Z9Q A;  1V1C A;  1W70 A;  2MOX A;  3I9Q A;  2JM8 A;  3SEM A;  1FYN A;  2FRW A;  4J9E A;  1QCF A;  4F17 A;  2YUP A;  1Y57 A;  1SRM A;  1G83 A;  1T0J A;  4JJC A;  1E7O A;  1HJD A;  1NEB A;  2LP5 A;  2AKK A;  5EC7 A;  1OOT A;  1UDL A;  1PRL C;  4OMN A;  2FEI A;  3TSW A;  2KT1 A;  3O5Z A;  1JEG A;  4R0K A;  2DBK A;  1VYT A;  1BK2 A;  1M3A A;  3PE0 A;  2FRY A;  2VWF A;  5I22 A;  1BBZ A;  1UJ0 A;  2CSQ A;  2DL4 A;  1YCS B;  5IXB A;  2O9V A;  1KSW A;  1K9A A;  1WXU A;  2G6F X;  4EIK A;  5IHI A;  3VS2 A;  1Z9Z A;  2BZX A;  2D8H A;  2KT8 A;  2O9S A;  3QWX X;  4ESR A;  2I0N A;  2LQW A;  1GCQ C;  2K3B A;  3C0C A;  2DRM A;  4RTV A;  1AEY A;  1OPK A;  2KRS A;  1SHG A;  4ORZ A;  3U23 A;  2KBT A;  1WDX A;  2RNA A;  2X3W D;  4HVV A;  3I5S A;  3ULR B;  4OMQ A;  2J6O A;  2K7A A;  2LJ1 A;  1EFN A;  2X3X D;  2GGR A;  2BZ8 A;  1AVZ C;  2DIL A;  2AZV A;  4GBQ A;  3UAT A;  4J9B A;  5IHK A;  1UFF A;  2A28 A;  2YT6 A;  2CT4 A;  2FPD A;  2L2P A;  2J7I A;  2V1R A;  2EQI A;  2OJ2 A;  4E6R A;  1NYF A;  1AZG B;  2YDL A;  2RN8 A;  3EG0 A;  2KRM A;  1M3B A;  4LNP A;  2ROL A;  1A0N B;  2F2X A;  2MIO A;  4RTW A;  3REB B;  5IH2 A;  2BTT A;  1YWP A;  3NHN A;  2CDT A;  1NEG A;  1WLP B;  1X2Q A;  2RQT A;  4JJD A;  4OMM A;  1GBR A;  2KE9 A;  4RUG A;  4AG1 C;  2KXD A;  2V1Q A;  4OMP A;  5GJV B;  1AWO A;  2DL8 A;  4J9I A;  1NLP C;  1U06 A;  1SEM A;  1YNZ A;  2KR3 A;  2GNC A;  1M27 C;  4RTY A;  1AWX A;  2DM1 A;  1WA7 A;  1K0X A;  2ABL A;  1T0H A;  4GLM A;  1Y0M A;  4RTZ A;  1VYU A;  2FPF A;  2FO0 A;  1RLP C;  3THK A;  3RNJ A;  1WX6 A;  1AWJ A;  3EHR A;  1K1Z A;  2HCK A;  3CQT A;  2D8J A;  3TVT A;  1ZLM A;  3EG2 A;  2AKL A;  1RLQ C;  3LH5 A;  4D8K A;  2L3S A;  1X6G A;  2NWM A;  4RTU A;  1MV0 B;  3KFV A;  2ROT A;  3UA6 A;  2A36 A;  2F2V A;  3H41 A;  2ESW A;  4OMO A;  1T3L A;  1PHT A;  1UJY A;  1H92 A;  2KGT A;  2EKH A;  4RTT A;  1OEB A;  2O2O A;  2JXB A;  3I35 A;  1W6X A;  1QWF A;  2GTJ A;  1KJW A;  4LE9 A;  1H3H A;  1JXM A;  1PKT A;  1UHF A;  2P4R A;  2IIM A;  1UGV A;  2LQN A;  1K76 A;  1XOV A;  2LJ0 A;  1I0C A;  4QT7 A;  1U5S A;  2ED1 A;  2JS2 A;  3VS1 A;  2DYB A;  2RMO A;  4J9G A;  2W0Z A;  4Z88 A;  2HDA A;  4F16 A;  1KFZ A;  4M4Z A;  2H8H A;  2SEM A;  1HSQ A;  3M0T A;  4IIO A;  2YUQ A;  2RPN A;  2DLP A;  2CSI A;  4FSS A;  1M8M A;  1UG1 A;  1HD3 A;  3JV3 A;  2RQU A;  1YWO A;  4IIM A;  4Z89 A;  2DL3 A;  3PVQ A;  5I11 A;  1K0S A;  1ZBJ A;  2K79 A;  2C0T A;  1OPL A; 
#chains in the Genus database with same CATH topology
 1VIF A;  2RI5 A;  5GJW B;  4X1V A;  1YJN Q;  3MP6 A;  1K9M R;  2M0Y A;  1WHH A;  2JMC A;  4IUP A;  4C92 G;  3VS4 A;  5KH6 A;  3HRU A;  2DEU A;  3DB4 A;  1JO8 A;  4M7A G;  2DFU A;  3CC7 Q;  1X43 A;  2LJ3 A;  2ZPB B;  2E70 A;  4J83 A;  3OYD A;  4ZTJ A;  1WZO A;  2QEX Q;  1YN8 A;  1K73 C;  2KRN A;  4KUI A;  4C8Q F;  1QKW A;  2RHU A;  2BKD N;  4C8Q B;  2V26 A;  2OTL Q;  2O4X A;  5GAN d;  1ARK A;  3OYK A;  2DXU A;  2HZY A;  5FWC A;  3EGD B;  2LDM A;  3CC4 A;  2DL7 A;  1YJW Q;  4EMK B;  4VUB A;  2CP7 A;  1K73 U;  4LDV A;  4OF1 A;  3A8O B;  5LJ3 f;  5GMK j;  3CCR A;  1RI9 A;  2EWN A;  4BB7 A;  4F7U F;  4IKF A;  3CCL T;  2C0I A;  1CSK A;  3OSS C;  3M57 A;  5HKC A;  1ABQ A;  4PFP A;  5GAN 6;  1TOV A;  3A8G B;  1QKX A;  2XU8 A;  1E6H A;  1K8A C;  4ANJ A;  1B3Q A;  3G4S A;  2DX1 A;  1GFC A;  2YUN A;  3EGX A;  2FHD A;  1PRM C;  2KYM A;  1V29 B;  1FWZ A;  3AHU A;  3JCM h;  4C8Q A;  4XTW A;  3JCM f;  4XQ3 A;  1CKB A;  3OYL A;  1VQK A;  3V7S A;  2DYI A;  1ZX6 A;  1WHJ A;  2L3P A;  3GP8 A;  1N8R R;  3EGD A;  4KT0 E;  3A98 A;  1VQ8 A;  3IQL A;  1ABO A;  3QO3 A;  4EMK A;  3CC4 T;  2JOY A;  4RMO A;  4DEX A;  1SPK A;  1WFW A;  2YRC A;  2PZ1 A;  1I8F A;  4FYW B;  2LX9 A;  2BUD A;  3VS7 A;  3CMA A;  3CEY A;  3M54 A;  2DTO A;  1UEC A;  2CP5 A;  2GFU A;  1WQW A;  2Y4Y A;  4OML A;  4E7Z A;  2JTF A;  2VKN A;  3HTR A;  3MP1 A;  1M90 U;  2ENM A;  2EYX A;  2DTI A;  1YIT A;  5GAN 2;  3G71 Q;  1VQ4 T;  1W1F A;  3NTH A;  2ED0 A;  4IUQ A;  3VRY A;  1NM7 A;  4FYY B;  3RMQ A;  2ZGW A;  5LJ5 g;  3CCV A;  4BI8 B;  2K5L A;  1TG0 A;  2RJD A;  2CUD A;  4LDU A;  3R6N A;  3X20 B;  2AZS A;  1X01 A;  2A3L A;  2JTE A;  3A8H B;  1QQJ A;  2RA2 A;  4ZGJ B;  4R56 A;  3PIP A;  3RES A;  3CME Q;  1I1J A;  1MMG A;  2DRK A;  3OYY A;  3OW2 P;  5CKB A;  1R77 A;  4OMF B;  3MEV A;  2HBP A;  1OV3 A;  1AZE A;  2EYQ A;  1CKA A;  5GAN 4;  4E7H A;  4J9F A;  4JDS A;  3KXT A;  3CMA T;  3L1A A;  3CCE T;  2D0Q B;  2PTK A;  1T3S A;  4A63 B;  5KYU B;  4HCB A;  4J6X A;  1E6G A;  2KRO A;  2VVK A;  3FJP A;  2HSP A;  3UPU A;  1MV3 A;  3JCM J;  2WSE E;  2CP2 A;  1YIT T;  1VQM A;  3VS6 A;  5CIU A;  4AFZ C;  2EYZ A;  1WJQ A;  3OSV A;  2R5M A;  5CCA A;  2Y4X A;  1LPL A;  3I55 Q;  3R6O A;  2VGM A;  5GAN h;  5GAN f;  3UWN A;  4ELZ C;  4E7I A;  1VQ6 A;  4MMK A;  5GAM d;  1O9S A;  4HVU A;  5I2S A;  3OYG A;  5GAO l;  4ATO A;  1BYM A;  5LJ5 e;  2QG9 B;  1PD1 A;  4KH0 B;  4J9E A;  2E41 A;  2CZ0 B;  3OYF A;  1VQ7 A;  1F1B B;  1NEB A;  1G3Y A;  3OYH A;  5EC7 A;  3QZ9 B;  1UDL A;  1W2B A;  2CGH A;  4PJN A;  3TSW A;  2QQR A;  1JEG A;  3OMG A;  3CPW A;  2QK0 A;  4ZN1 A;  5IT9 E;  2PQW A;  4GLK A;  2CS7 A;  3JB9 J;  1MMD A;  1ZSZ C;  2DJZ A;  2FRY A;  1D1B A;  4QQD A;  3PTA A;  1UJ0 A;  1VQM T;  2CSQ A;  3I56 Q;  1H64 1;  2O9V A;  1WXU A;  2BIV A;  4EIK A;  4M7D C;  2HNI A;  1QVG S;  5IHI A;  3VS2 A;  3OA6 A;  3CXC P;  1NBE B;  2O9S A;  2E5Q A;  4CI0 C;  3QXE B;  3S3N A;  4RKU E;  3P8D A;  1VQ6 T;  1LNX A;  2RJC A;  5CQX A;  1JB0 E;  2AIR B;  2KRS A;  1UEB A;  1UGR B;  1WDX A;  2RNA A;  4NL2 A;  1VQO A;  3ULR B;  4PJO E;  4M7D D;  4MZM A;  2O01 E;  2X3X D;  2M16 A;  1S72 Q;  2RHZ A;  5FRO A;  2GF7 A;  2AZV A;  4GBQ A;  3UAT A;  1C6V X;  1UFF A;  1YFN A;  2QGF B;  2VYT A;  2L2P A;  2DIQ A;  2KDS A;  3G4S Q;  3OYC A;  2CZ1 B;  3EG0 A;  3TCJ A;  2PU9 B;  2X4J A;  3REB B;  2F69 A;  2BTT A;  1YWP A;  2CDT A;  2QQA A;  5FU6 B;  1XNI A;  2DVE A;  4OMM A;  3ZFJ A;  2XDD A;  1VQK Q;  5D7U A;  4PJO G;  3F70 A;  2EKO A;  4N0A A;  4OMP A;  1AWO A;  3CC7 A;  1SG5 A;  1VQ8 Q;  4J9I A;  1U06 A;  3CBO A;  4M78 B;  3CXC A;  2QEX A;  4B9W A;  3P8B B;  1AWX A;  1K0X A;  2ABL A;  1VQO T;  2OTL A;  1HYO A;  3ZBD A;  2EJG A;  4P5N A;  3RNJ A;  4QQ6 A;  2LT4 A;  5GAO m;  2HCK A;  1YJW A;  4II1 A;  1IXD A;  1WJS A;  1M90 R;  2E6Z A;  2NWM A;  3CCS A;  2PVG B;  2ROT A;  2MWO A;  3JB9 G;  4ME7 A;  3VV0 A;  2QQB A;  3QG1 A;  3LLR A;  1H3Z A;  1YIJ T;  3H9N A;  1IRX A;  1N9S A;  2O2O A;  2JXB A;  2FZC B;  1RAI B;  5KYN A;  4R55 A;  1KD1 R;  1Y07 A;  1IGQ A;  1PKT A;  1UHF A;  2P4R A;  2IIM A;  1YJN T;  3GIB A;  5GAM h;  2LQN A;  4RG8 A;  2JS2 A;  1WHL A;  2RMO A;  2RO0 A;  1B34 B;  3CC7 T;  4BI4 A;  4M78 A;  4M4Z A;  3URG A;  1OU8 A;  4C0G A;  3BW1 A;  1Q86 U;  2QEX T;  2DLP A;  2CSI A;  1UG1 A;  2QDY B;  1N6A A;  2OTL T;  2NYS A;  2FZK B;  4B9X A;  1K0S A;  3QII A;  4M7D F;  2K79 A;  1OPL A;  1YJW T;  3EG3 A;  1QVF P;  4HXJ A;  1UGS B;  2CRE A;  1NG2 A;  1ZUY A;  3QZ5 B;  1PSF A;  2J06 A;  1O75 A;  5GMK e;  2EJ9 A;  2LQ8 A;  5GAM j;  1OQK A;  2EGE A;  2EYW A;  1G2B A;  3BDU A;  1FMV A;  2GTO A;  3G71 A;  1B34 A;  2J6K A;  1M9S A;  1YI2 Q;  1WIE A;  4XTU A;  2XMF A;  3HRS A;  1WGS A;  3LGF A;  2O31 A;  3OB9 A;  2HD0 A;  2ZPF B;  4AFQ C;  1WHK A;  3OBY A;  2X4X A;  3S3M A;  1VQ7 Q;  2FZG B;  3FIF A;  2IPO B;  5J39 A;  2QDL A;  1TS9 A;  2CZ7 B;  4V2S A;  2DET A;  2EGC A;  2SRC A;  5AYF A;  4Y92 A;  4M7D A;  1KG1 A;  5FLX E;  1PKS A;  4C92 C;  1SKU B;  4HKE A;  3UT1 A;  3CCM Q;  1D3B B;  1NYG A;  3M56 A;  4M7A C;  2EGA A;  2L3Q A;  2X4Y A;  1BIB A;  2M02 A;  3QYG B;  2GBQ A;  4K11 A;  3M0R A;  5HK3 A;  3E9G A;  3EGU A;  3EH1 A;  2K2V A;  3SD4 A;  2MCN A;  1M1F A;  4PL6 A;  4L59 A;  3OYN A;  2YWW A;  2KEA A;  5HK0 A;  1GCP A;  1NLO C;  3PNW C;  4WTO B;  4C92 D;  4M7A D;  2K2M A;  2YSQ A;  1Q82 C;  5D6Y A;  2QGG A;  2XID A;  1WXT A;  2DF6 A;  4IUU A;  1WJR A;  2COZ A;  1QW1 A;  3I55 A;  5FU7 C;  4WCI A;  2LC4 A;  2M0O A;  1X69 A;  1X2K A;  2MAM A;  5A0D A;  4BDZ A;  2E12 A;  1TUC A;  2J6F A;  4DOW A;  3EHQ A;  1GBQ A;  1BU1 A;  1YJ9 T;  1AD5 A;  1WYX A;  2F1L A;  3HFN A;  5GAN 7;  2XDB A;  5GAO r;  3G1J A;  1D3B A;  1UE9 A;  3CME T;  4J9H A;  3WVE B;  3N5B B;  3M58 A;  1I07 A;  1BB9 A;  3RBB B;  2YLB A;  3JCM b;  2AHJ B;  1N5Z A;  1UTI A;  5J26 A;  1K4U S;  5KCH A;  3OQ5 A;  4C5G A;  4FT2 A;  3WVD B;  2FVU A;  3L2U A;  2EVR A;  2LX7 A;  1I4K 1;  4KGV B;  2KAF A;  2KI7 A;  4C0D C;  2H3J A;  2DXT A;  2C0O A;  2XKO C;  5IXF A;  2JMA A;  4JJN K;  4FW2 A;  2NUZ A;  3EGX B;  3HRT A;  1W2B S;  5A0L A;  2CT3 A;  2DK3 A;  3ME9 A;  3VS5 A;  3CPW S;  4LD6 A;  3I56 A;  4JS4 A;  4CC7 A;  3I55 T;  1KC8 C;  2RQW A;  3QKJ A;  1AHJ B;  3G7Z A;  1UHC A;  2FG0 A;  3V8J A;  3PVL A;  1X27 A;  1TTH B;  1OYX A;  2K6D A;  5KE2 A;  2HEQ A;  4MDW A;  1WHM A;  1IHW A;  5LJ3 h;  3MPU B;  3CCS Q;  4CC3 A;  1KC8 U;  4M77 E;  2H3E B;  4F7U B;  2F5K A;  4PJJ A;  1I81 A;  1S72 A;  2GCX A;  1JJ2 A;  2AK5 A;  2V8I A;  5FWB A;  1GL5 A;  1AOJ A;  5GAN 5;  4HCC A;  3M0Q A;  4J7I A;  1G5V A;  3VS3 A;  2DA9 A;  1X6O A;  1M30 A;  2OX7 A;  1PWT A;  2ZAE A;  1M3C A;  1AWW A;  4BD3 A;  2PUK B;  4C92 F;  1Q86 R;  1IRE B;  3I56 T;  4M7A F;  1K8A U;  1YHQ Q;  2EYY A;  2DPP B;  1V1C A;  1W70 A;  8AT1 B;  1KQS P;  4M77 G;  3SEM A;  1FYN A;  5CO7 A;  2FRW A;  4F17 A;  1QCF A;  4L5G A;  5GAN e;  2E65 A;  1E7O A;  5LJ3 j;  4BY6 B;  2AKK A;  1M2O A;  5CKF A;  4OMN A;  2FEI A;  3QBY A;  4F7U A;  3CCR T;  3SFM A;  4FW1 A;  3PIO A;  1BK2 A;  4PFO A;  1RAB B;  2WSC E;  3QPH A;  2VWF A;  4XAX B;  4A4F A;  5I22 A;  1VQ5 A;  2DL4 A;  5FU7 B;  5IXB A;  2G6F X;  4JS5 A;  1P92 A;  3A8L B;  3G4S T;  1Z9Z A;  1U1S A;  1LOJ A;  2BZX A;  2D8H A;  3CC2 Q;  3G6E Q;  4XU1 A;  1GCQ C;  1UGP B;  1WPY A;  4NS5 A;  3RMS A;  2K3B A;  2DRM A;  3BE3 A;  1AEY A;  1OPK A;  1M4Z A;  3CPF A;  2KBT A;  1MNE A;  1VQK T;  3I5S A;  3OYM A;  3MEU A;  1PSE A;  2HQE A;  2YRD A;  2GGR A;  1VQ8 T;  2RHI A;  5CKD A;  4C0D B;  5IHK A;  2XI9 A;  4DBR A;  2FPD A;  2EQI A;  3M4Y A;  1RAD B;  2JZ2 A;  2YDL A;  2RN8 A;  4OP0 A;  9ATC B;  2XD0 A;  1EZZ B;  2E3H A;  5LJ5 d;  2KRM A;  3SWN C;  3CCJ Q;  2ROL A;  2F2X A;  5KYY B;  2DD5 A;  5IH2 A;  2HAX A;  5EG2 A;  5FRM A;  1NEG A;  2HMA A;  3MJX A;  1TUG B;  4JJD A;  3QUI A;  3EG9 B;  1GBR A;  3LX7 A;  3CD6 Q;  2QYZ A;  4AG1 C;  5GAM g;  2V1Q A;  5GJV B;  5GMK m;  3QDR B;  5IAY A;  3CCV T;  2RHY A;  2GNC A;  3OYE A;  2BE7 D;  5J3B A;  1BI1 A;  1T0H A;  1RAH B;  4QKU A;  2GFA A;  1Y0M A;  2FPF A;  1RLP C;  4X9C A;  1YI2 A;  1WX6 A;  5C0M A;  1AWJ A;  5I21 A;  3TEE A;  5GAO p;  1K1Z A;  4ZGD B;  3CQT A;  5CK9 A;  2LCL A;  3TVT A;  1ZLM A;  1MMA A;  2XIC A;  1X6G A;  2P0P A;  2ZPI B;  3OW2 A;  4A4K A;  3M59 A;  1RAG B;  4ELY C;  4JLI A;  4D6W A;  1IHV A;  2F2V A;  3H41 A;  4OB0 B;  4DBF A;  3RUX A;  4PLI A;  4ZGE B;  1UJY A;  2EKH A;  4RTT A;  1OEB A;  4A4H A;  5KYY A;  4BE2 A;  2WSF E;  4PJO C;  3CCM A;  4M78 E;  3SB2 A;  3EG9 A;  4DQ2 A;  4N4I A;  4QW2 A;  3ER0 A;  1XOV A;  2CZ6 B;  1Q7Y C;  4QT7 A;  1U5S A;  2EQM A;  3VS1 A;  2DYB A;  3QSU A;  3OS0 A;  2W0Z A;  5GAN j;  2HDA A;  1NJI C;  3ZEH A;  4PFZ A;  1KFZ A;  3V8L A;  5DY9 A;  1Q81 C;  1M1K C;  1HSQ A;  2EJF A;  2K5I A;  4PJO D;  2RPN A;  1IZ6 A;  1M8M A;  4BUG A;  4E47 A;  1HD3 A;  3OMC A;  4KUD K;  1Q7Y U;  1K73 R;  1WHG A;  2K4Y A;  5C6S A;  1YI2 T;  5GAM e;  5I11 A;  2E3I A;  4DBH A;  1M1K U;  4BE0 A;  4XU3 A;  4M78 G;  3EFR A;  2M9U A;  3V7C A;  2BZY A;  3KUF A;  5IN1 A;  1ZUU A;  2JW4 A;  2QA4 Q;  1VQ7 T;  1BIA A;  3PT9 A;  3T9N A;  5IHN A;  1VQN Q;  2KYB A;  1G3T A;  2F2W A;  3H8Z A;  1TU0 B;  4EDU A;  2MMP A;  4C5E A;  3VRZ A;  2A0F B;  2E4H A;  2VV5 A;  3JB9 D;  2HKQ B;  2Y90 A;  1NPR A;  3LYI A;  3X25 B;  2M1H A;  2K9G A;  3A5Z B;  3GBQ A;  1K8A R;  2DVJ A;  4LUE A;  2QTV A;  4M75 C;  4JPB W;  4ZNX A;  1VQ4 Q;  3HKS A;  2KK4 A;  1K9M C;  3REA B;  3M5A A;  5ECA A;  2CP6 A;  2LNH B;  5CKH A;  3GPL A;  4F14 A;  2DBM A;  1XJW B;  2L3R A;  4LN2 A;  2L0A A;  4Q5W A;  3TSZ A;  4M75 D;  3J81 E;  1K9M U;  2R5A A;  3OS2 A;  5LJ5 f;  2PUO B;  1VQ5 Q;  3I5R A;  5L23 A;  1TUD A;  2MK5 A;  2E5K A;  4J8O A;  3NFC A;  4LDX A;  4PKC C;  1G3S A;  1TSF A;  4MML A;  3JCM P;  3CCE Q;  1RAE B;  2G3R A;  3VU3 C;  2P0K A;  3M9Q A;  3C94 A;  1ACM B;  2LZ6 B;  3OYA A;  1JJ2 S;  2MF2 A;  4AG2 C;  2Z0W A;  3ZL7 C;  4Z8A A;  2DZC A;  2JTM A;  6AT1 B;  2XDP A;  3J80 E;  2CYZ B;  2QQ9 A;  4RTX A;  4OVA A;  4UC4 A;  2P84 A;  1SSH A;  4PJO F;  3E2U A;  4AMC A;  1OX8 A;  4PJO B;  3OYJ A;  4QVZ A;  5L8R E;  5HCK A;  4CC4 B;  1YHQ A;  5CAI A;  1PM3 A;  3C95 A;  1ZSZ B;  5LJ3 g;  3CCU Q;  1UUE A;  2LCS A;  2OI3 A;  1WQ7 A;  2GQI A;  1N8R C;  4C5H A;  4M7D B;  2D0N A;  1QLY A;  1V76 A;  1VIE A;  3H0F A;  4PK4 A;  1QWE A;  2HBW A;  2KXC A;  3DLL A;  3CCS T;  1RAA B;  1X6B A;  2JM9 A;  2JT4 A;  4DEY A;  1N8R U;  2ECZ A;  1QVG P;  3JB9 F;  1XQH A;  2P4T A;  3FJ5 A;  1VA7 A;  1WXB A;  4N4H A;  2HKN A;  1VQL A;  4IUR A;  2LRQ A;  4KRT A;  2KVQ G;  5KCO A;  3JCM g;  3JCM V;  1SRL A;  1KQ1 A;  1OI1 A;  3CC2 A;  1Y7X A;  5GAO q;  2OAU A;  4C0Z A;  3G6E A;  3M53 A;  4PJO A;  4FCY A;  2PNI A;  2R57 A;  1D0Y A;  1TXQ A;  1D09 B;  2QAZ A;  2W10 A;  5A2Q E;  1ZSZ A;  1YHQ T;  1IB8 A;  1GFD A;  1KIK A;  3RIR A;  1ZSG A;  5FW9 A;  2KNB B;  3A8M B;  3HFO A;  2DL5 A;  4HA8 A;  4M75 F;  3MEW A;  4M75 B;  4LUD A;  1NPP A;  5DLO A;  1IO6 A;  4OB3 B;  4C8Q E;  4CC2 A;  1OU9 A;  3QWY A;  3CBP A;  5LJ3 e;  4RG2 A;  2DMO A;  2CP3 A;  2CUB A;  3JB9 I;  1SSF A;  1AT1 B;  2RF0 A;  1W4S A;  2OAW A;  2OTJ A;  1QVF A;  1ZUK A;  3NPF A;  3H6Z A;  1M1G A;  3EFS A;  3CCJ A;  1VUB A;  4NL3 A;  8ATC B;  2VGN A;  3PMT A;  1X75 C;  2VC8 A;  3VYG A;  1QVG A;  1WI7 A;  1Z9Q A;  3LGL A;  3O8V A;  3EH2 A;  3I9Q A;  2X4W A;  4F7U E;  3G71 T;  3CD6 A;  1EIF A;  2JM8 A;  3JCM X;  3MHX A;  3CC2 T;  3ASK A;  1G8X A;  1VQ9 Q;  1Y57 A;  4JJC A;  2VAS A;  4X34 A;  2YHT A;  1HJD A;  2DD4 A;  1OOT A;  1PRL C;  4C8Q G;  3JCM e;  1Q82 U;  2KT1 A;  2XG8 D;  1M3A A;  4M75 A;  5KE3 A;  4PJL A;  5CR2 A;  1TWB A;  3E1S A;  4JLG A;  5GAN 8;  4JRI A;  4EMH A;  1PCX A;  1GXI E;  4F7U G;  4KGX B;  4NOY A;  4FSX A;  3QWX X;  4MDX A;  1YBY A;  2I0N A;  4ESR A;  1ZA1 B;  4M77 C;  4DBQ A;  2NUP B;  3C0C A;  4RTV A;  3OW2 S;  4OB1 B;  3MO8 A;  4FYV B;  1SHG A;  1QCO A;  3L42 A;  4ORZ A;  3U23 A;  5GAN g;  4QQG A;  1R8O B;  4HVV A;  5I2M A;  2JJ9 A;  3CD6 T;  2LJ1 A;  3RKY A;  3HSB A;  1QP3 A;  2DKG A;  2EQK A;  2YRV A;  4PJM A;  1XTD A;  3QJ6 A;  4J9B A;  2XHC A;  4M77 D;  2LQK A;  2YT6 A;  4LDY A;  2CT4 A;  2J7I A;  1MMN A;  2V1R A;  1VQP Q;  2OJ2 A;  4E6R A;  1NYF A;  2FYK A;  1AZG B;  3QJY A;  3VJP A;  4N4G A;  2WAC A;  3LWI A;  2RJF A;  3M55 A;  2HL5 C;  4RTW A;  1ZBX A;  2DXB A;  3OYI A;  1WLP B;  2RD1 A;  2QA4 A;  5GMK l;  2DAQ A;  4OGC A;  2KXD A;  2K3Y A;  4J6W A;  1VQN A;  2DL8 A;  2NUP A;  1RL2 A;  5GAN 3;  5DM7 R;  5FRN A;  2A7Y A;  1SEM A;  2ZPH B;  4OB2 B;  4X9D A;  2X51 A;  2JNG A;  1OZ3 A;  1M27 C;  4RTY A;  1OX9 A;  1WA7 A;  3FRN A;  4GLM A;  3FEO A;  4Y28 E;  2FO0 A;  3THK A;  4C92 B;  3E19 A;  1I5O B;  1M8V A;  3EHR A;  4M7A B;  4QVD A;  2D8J A;  2NUT B;  1VQ4 A;  1IGU A;  3VUB A;  2AKL A;  4D8K A;  4BI3 A;  1MV0 B;  3KFV A;  3V7R A;  4LD9 K;  3UA6 A;  3MCA B;  3V8K A;  1KHC A;  4JRP A;  1T3L A;  1H92 A;  3L2R A;  2KGT A;  3LW5 E;  3A1P A;  3I35 A;  3J7A F;  1QWF A;  2ATC B;  2RK2 A;  3GLX A;  2GTJ A;  1KJW A;  4LE9 A;  1S72 T;  1JXM A;  2V8K A;  3LWH A;  4JRK A;  2LCC A;  3CXC S;  2QA4 T;  2RB6 A;  3CCQ Q;  1UGV A;  2F5T X;  3OS5 A;  4O6J A;  2YLC A;  1I0C A;  1PD0 A;  3JCM Q;  1VQL Q;  1VQN T;  4Z88 A;  4L6V 5;  4F16 A;  1M90 C;  2H8H A;  4LXC A;  3CCE A;  3X28 B;  2KSS A;  4N0A C;  2K57 A;  1MGQ A;  3JV3 A;  4C92 A;  2EFI A;  3PFS A;  2RK1 A;  2VXF A;  4M7A A;  1YWO A;  4FT4 A;  4Z89 A;  2DL3 A;  1KD1 C;  2NUT A;  1RAC B;  2MWP A;  2LVM A;  1DJ7 B;  1VOM A;  1EX4 A;  3L2Z A;  3JAM E;  2I2L A;  2KQW A;  2E6N A;  4AFS C;  2JN0 A;  1JQQ A;  2D9T A;  2LT1 A;  4M77 F;  3BDL A;  1KQS A;  3MEA A;  3DB3 A;  4M77 B;  1KD1 U;  1S1N A;  2M51 A;  4JJB A;  3M0U A;  2MI6 A;  2EQU A;  2YXY A;  3CCU A;  2JS0 A;  1NE8 A;  1YJ9 Q;  2A08 A;  1BKB A;  2QI2 A;  2OTJ Q;  2FL7 A;  1B07 A;  1BCM A;  1VQ5 T;  3VKI A;  3NGP A;  5FU6 C;  2NLU A;  3FDR A;  2EAY A;  2ZPE B;  4MZT A;  2EW3 A;  2B86 A;  1W2B P;  2J05 A;  3H0I A;  2EQJ A;  2RJE A;  3CPW P;  2HL3 A;  2QTX A;  4WF2 A;  1GRI A;  1Y71 A;  3NMZ C;  4A4E A;  2HQH A;  2EBP A;  4XTX A;  1HXD A;  4M78 C;  1JU5 C;  2B8A A;  1FMK A;  2GQV A;  3M4G A;  2A37 A;  4ZN3 A;  1Q82 R;  1D1A A;  1YP5 A;  4JZ4 A;  2DIG A;  4DOV A;  4JRQ A;  5A0G A;  1QMC A;  3RKW A;  2X35 A;  2K3X A;  2DJQ A;  4J9D A;  7AT1 B;  4M77 A;  2L89 A;  4KGZ B;  2RM4 A;  3H0H A;  1OZ2 A;  2JVV A;  2X9H A;  4M78 D;  4PNO A;  5DLQ E;  2DEQ A;  1MHN A;  2K5F A;  1R0B G;  2D6F A;  1SHF A;  3M0S A;  4JZ3 A;  4HCK A;  3CCU T;  3RR6 A;  4YTL A;  1PNJ A;  4KBM B;  2RQR A;  3VYH B;  5CQY A;  4EMG A;  4B6M A;  4A53 A;  3CCL Q;  1KQ2 A;  2COY A;  3EFO B;  2LMJ A;  2O88 A;  3FC3 A;  2CH4 W;  5D6W A;  1RI0 A;  4D8D A;  5KYU A;  3NTK A;  4E7S A;  2ZZD A;  1JBM A;  1JXO A;  2R58 A;  1M5Q 1;  1RUW A;  2FPE A;  2EIF A;  4DA4 A;  4XU2 A;  3L2Q A;  4QVC A;  1QVF S;  1QVP A;  4EPC A;  4OGE A;  3TQ7 P;  1MUZ A;  1NJI U;  1VQ9 A;  1KC8 R;  2AT1 B;  4JUV A;  1Q81 U;  3EAE A;  2D1X A;  3EG1 A;  2QXF A;  1YCY A;  2CP0 A;  1FXX A;  2CH4 A;  1SF9 A;  1C0M A;  3CC4 Q;  4AT1 B;  2DE0 X;  2EPD A;  3UF4 A;  3CCR Q;  3JRZ A;  3QHS A;  3CCM T;  3EFO A;  3WXM B;  1LCK A;  3OY9 A;  1ZA2 B;  3SHW A;  2V8J A;  3GF5 A;  2YUO A;  1J3T A;  3S3O A;  2ZPG B;  1PC0 A;  3MP8 A;  2DNU A;  1VYV A;  1U3O A;  5AT1 B;  4AFU C;  3D7S B;  4M7D E;  4F04 B;  1BI0 A;  3GOX A;  2RQV A;  1YIJ A;  4KH1 B;  4BAC A;  1NZ9 A;  3M0P A;  2VUB A;  4FU6 A;  3UA7 A;  4E2F B;  3SWN B;  3INZ A;  1RAF B;  5D6X A;  1WNL A;  3VS0 A;  1YJN A;  1VQ9 T;  5CKE A;  4XTV A;  4HVW A;  4IUV A;  5LJ5 h;  1PG5 B;  3KBG A;  2L8D A;  1MND A;  1D1C A;  2LNV A;  3L2W A;  1GCQ A;  1U1T A;  3TRE A;  1H8K A;  1R0C B;  1VQP A;  2C06 A;  3HL8 A;  4M78 F;  2IG0 A;  3QYH B;  5GMK i;  4J9C A;  3BY7 A;  3C4S A;  1KK7 A;  2RH2 A;  3E9F A;  4M7D G;  4J6Y A;  4FM4 B;  3Q1J A;  3CMA Q;  3X24 B;  1HK9 A;  1BI2 A;  2E1H A;  2MOX A;  4FIB A;  4ZTF A;  2ZCF B;  1C1A A;  1ZHI A;  4A54 A;  1JRI A;  2YUP A;  1OUL A;  1SRM A;  1G83 A;  1T0J A;  2E10 A;  2L5Q A;  4M75 E;  2PVD B;  2DTH A;  1YIT Q;  2LP5 A;  2PVO B;  4XK8 E;  1U8R A;  3JB9 H;  3UDC A;  2HQX A;  2DXC A;  2VXE A;  3O5Z A;  3SWN A;  4J7F A;  5KYW B;  4R0K A;  3CCV Q;  2DBK A;  1VYT A;  4Z02 A;  1Q86 C;  4XU0 A;  3JCM W;  3PE0 A;  4RCC A;  2VB6 A;  5LJ5 j;  5GAM f;  1BBZ A;  5KYX B;  2LTO A;  1YCS B;  1KSW A;  1K9A A;  4C0F A;  1M2V B;  1UGQ B;  2MYS A;  1N27 A;  1VQP T;  2KT8 A;  2BE9 B;  4CRI A;  2HSE B;  2LQW A;  3BFM A;  4RCB A;  4M75 G;  3OYB A;  4PLL A;  3HHT B;  2X3W D;  3CCQ A;  4OMQ A;  2J6O A;  2K7A A;  4Y91 A;  5GAO n;  2DZ9 A;  3NTI A;  2DO3 A;  1EFN A;  3FB9 A;  2P0Q A;  4C8Q C;  2BZ8 A;  1AVZ C;  2DIL A;  2KY9 A;  3MET A;  2DER A;  5LJ3 d;  4HT8 A;  4O5V A;  1VQM Q;  4LDW A;  5HY6 A;  2A28 A;  5KYW A;  1N9R A;  1BI3 A;  4TVR A;  3TU4 K;  4EMK C;  2FB7 A;  3S6W A;  3JSC A;  4E7K A;  4XTZ A;  4C8Q D;  5KYX A;  4FYX B;  1M3B A;  4E7L A;  4LNP A;  1VQ6 Q;  3GNF B;  1A0N B;  2MIO A;  1M2V A;  3VUZ A;  3NHN A;  5M9O A;  1B7T A;  1QP2 A;  1X2Q A;  2RQT A;  4HT9 A;  2KE9 A;  4FL6 A;  1LJO A;  4RUG A;  1Y96 B;  1FX7 A;  3JCM d;  3C12 A;  1NLP C;  4KUL A;  3FLG A;  1YNZ A;  2KR3 A;  1YJ9 A;  1KQS S;  2COW A;  2DM1 A;  3CME A;  3CCQ T;  4RTZ A;  1VYU A;  2E64 A;  4GY5 A;  3OBW A;  4A4G A;  1VQL T;  2RI3 A;  3LH0 A;  1TH7 A;  3GNG A;  1Q7Y R;  1LVK A;  2QQS A;  4MZP A;  1BCO A;  3DKM A;  1NJI R;  3EG2 A;  2JUF A;  1RLQ C;  2XK0 A;  3L2V A;  3LH5 A;  2L3S A;  1Q81 R;  1M1K R;  3G6E T;  2QAS A;  4RTU A;  4BY6 C;  3PMI A;  1I5L A;  4J5Y A;  3HPW A;  2A36 A;  2ESW A;  4OMO A;  1D0Z A;  1PHT A;  3OS1 A;  3P8H A;  4E7J A;  1W6X A;  4BE1 A;  3QDF A;  2RI2 A;  1FMW A;  1H3H A;  3HP9 A;  3MKD A;  1VQO Q;  1Y96 A;  1K76 A;  4C92 E;  3SDZ A;  2LJ0 A;  4C5I A;  2ED1 A;  4M7A E;  4XTY A;  4J9G A;  2O4X B;  1Q95 G;  1UB4 A;  3RDV A;  3PGG A;  3RER A;  1D0X A;  2SEM A;  3M0T A;  4IIO A;  1ZQ1 A;  2YUQ A;  2MPX C;  3DLM A;  1JJ2 P;  1KHI A;  4FSS A;  3CBM A;  2OTJ T;  1G3W A;  2RHX A;  2KMT A;  3CCJ T;  2IVW A;  4HCZ A;  2RQU A;  5LL6 S;  3JCM c;  3CCL A;  4IUT A;  4BDY A;  4IIM A;  3RKX A;  1YIJ Q;  3PVQ A;  3X26 B;  5GMK h;  1ZBJ A;  3AT1 B;  1QCN A;  5CVI A;  2CKK A;  2C0T A; 
#chains in the Genus database with same CATH homology
 5GJW B;  2BZY A;  3EG3 A;  4X1V A;  1ZUU A;  2JW4 A;  4AFS C;  4HXJ A;  1JQQ A;  2M0Y A;  2CRE A;  1NG2 A;  2JMC A;  3VS4 A;  1ZUY A;  5IHN A;  1JO8 A;  1S1N A;  2KYB A;  2F2W A;  2M51 A;  2J06 A;  1X43 A;  2LJ3 A;  4JJB A;  3M0U A;  3VRZ A;  2JS0 A;  2A08 A;  1YN8 A;  2KRN A;  2EGE A;  2EYW A;  1QKW A;  1G2B A;  2GTO A;  2K9G A;  3GBQ A;  1B07 A;  3NGP A;  2J6K A;  1WIE A;  2DVJ A;  2EW3 A;  2B86 A;  2XMF A;  1ARK A;  2J05 A;  3H0I A;  4LUE A;  2O31 A;  5FWC A;  4JPB W;  4ZNX A;  2DL7 A;  1GRI A;  3REA B;  4AFQ C;  3NMZ C;  5ECA A;  2LNH B;  2EBP A;  4F14 A;  1RI9 A;  2DBM A;  1JU5 C;  1FMK A;  2QDL A;  4LN2 A;  2C0I A;  1CSK A;  2EGC A;  2L0A A;  2SRC A;  2A37 A;  4Y92 A;  1ABQ A;  1PKS A;  1YP5 A;  4JZ4 A;  3TSZ A;  1QKX A;  1NYG A;  2EGA A;  2L3Q A;  2GBQ A;  1E6H A;  2DJQ A;  4J9D A;  4K11 A;  1B3Q A;  3M0R A;  2DX1 A;  1GFC A;  3EGU A;  3H0H A;  2YUN A;  2MCN A;  3I5R A;  1PRM C;  2KYM A;  5L23 A;  1TUD A;  1SHF A;  2E5K A;  2KEA A;  3M0S A;  1GCP A;  1NLO C;  4JZ3 A;  4HCK A;  1PNJ A;  1CKB A;  2K2M A;  2RQR A;  2YSQ A;  1ZX6 A;  2LZ6 B;  1WXT A;  2DF6 A;  2L3P A;  3A98 A;  2LMJ A;  3IQL A;  4AG2 C;  2O88 A;  1ABO A;  3ZL7 C;  4Z8A A;  2CH4 W;  4WCI A;  4DEX A;  1SPK A;  1WFW A;  4D8D A;  1X69 A;  1X2K A;  2PZ1 A;  4RTX A;  1JXO A;  1TUC A;  2J6F A;  3VS7 A;  3EHQ A;  1GBQ A;  1SSH A;  1BU1 A;  1RUW A;  2FPE A;  1AD5 A;  1WYX A;  5HCK A;  4CC4 B;  1UE9 A;  1UEC A;  4J9H A;  1UUE A;  1MUZ A;  2LCS A;  4OML A;  1I07 A;  1BB9 A;  3RBB B;  1N5Z A;  1UTI A;  2OI3 A;  1K4U S;  2VKN A;  2GQI A;  2EVR A;  2ENM A;  2EYX A;  2LX7 A;  2D1X A;  3EG1 A;  2D0N A;  1QLY A;  3H0F A;  1W1F A;  2ED0 A;  3VRY A;  1NM7 A;  1QWE A;  2CH4 A;  2HBW A;  2KXC A;  1X6B A;  2JM9 A;  2C0O A;  1TG0 A;  2CUD A;  5IXF A;  2DE0 X;  2JMA A;  3R6N A;  2JT4 A;  4DEY A;  2NUZ A;  2AZS A;  2EPD A;  2ECZ A;  2JTE A;  2CT3 A;  3UF4 A;  3VS5 A;  1LCK A;  3FJ5 A;  1VA7 A;  1WXB A;  3SHW A;  4KRT A;  2YUO A;  4CC7 A;  1J3T A;  1I1J A;  2DRK A;  1SRL A;  2RQW A;  1UHC A;  2FG0 A;  2DNU A;  3PVL A;  1OV3 A;  1VYV A;  1X27 A;  1AZE A;  1CKA A;  1U3O A;  4J9F A;  4AFU C;  2K6D A;  2PNI A;  2HEQ A;  2RQV A;  2W10 A;  2PTK A;  1T3S A;  1KIK A;  4A63 B;  1GFD A;  3M0P A;  1ZSG A;  5FW9 A;  4CC3 A;  3UA7 A;  2KNB B;  1E6G A;  2KRO A;  2VVK A;  2AK5 A;  2HSP A;  1MV3 A;  2DL5 A;  3VS0 A;  5FWB A;  1GL5 A;  1AOJ A;  4LUD A;  3M0Q A;  4HVW A;  3VS6 A;  4AFZ C;  1IO6 A;  2EYZ A;  3VS3 A;  4CC2 A;  2DA9 A;  3QWY A;  1GCQ A;  1H8K A;  1M30 A;  2DMO A;  2CUB A;  1PWT A;  4J9C A;  1M3C A;  1AWW A;  2RF0 A;  2OAW A;  1ZUK A;  3NPF A;  4HVU A;  2EYY A;  1WI7 A;  1Z9Q A;  1V1C A;  1W70 A;  2MOX A;  3I9Q A;  2JM8 A;  3SEM A;  1FYN A;  2FRW A;  4J9E A;  1QCF A;  4F17 A;  2YUP A;  1Y57 A;  1SRM A;  1G83 A;  1T0J A;  4JJC A;  1E7O A;  1HJD A;  1NEB A;  2LP5 A;  2AKK A;  5EC7 A;  1OOT A;  1UDL A;  1PRL C;  4OMN A;  2FEI A;  3TSW A;  2KT1 A;  3O5Z A;  1JEG A;  4R0K A;  2DBK A;  1VYT A;  1BK2 A;  1M3A A;  3PE0 A;  2FRY A;  2VWF A;  5I22 A;  1BBZ A;  1UJ0 A;  2CSQ A;  2DL4 A;  1YCS B;  5IXB A;  2O9V A;  1KSW A;  1K9A A;  1WXU A;  2G6F X;  4EIK A;  5IHI A;  3VS2 A;  1Z9Z A;  2BZX A;  2D8H A;  2KT8 A;  2O9S A;  3QWX X;  4ESR A;  2I0N A;  2LQW A;  1GCQ C;  2K3B A;  3C0C A;  2DRM A;  4RTV A;  1AEY A;  1OPK A;  2KRS A;  1SHG A;  4ORZ A;  3U23 A;  2KBT A;  1WDX A;  2RNA A;  2X3W D;  4HVV A;  3I5S A;  3ULR B;  4OMQ A;  2J6O A;  2K7A A;  2LJ1 A;  1EFN A;  2X3X D;  2GGR A;  2BZ8 A;  1AVZ C;  2DIL A;  2AZV A;  4GBQ A;  3UAT A;  4J9B A;  5IHK A;  1UFF A;  2A28 A;  2YT6 A;  2CT4 A;  2FPD A;  2L2P A;  2J7I A;  2V1R A;  2EQI A;  2OJ2 A;  4E6R A;  1NYF A;  1AZG B;  2YDL A;  2RN8 A;  3EG0 A;  2KRM A;  1M3B A;  4LNP A;  2ROL A;  1A0N B;  2F2X A;  2MIO A;  4RTW A;  3REB B;  5IH2 A;  2BTT A;  1YWP A;  3NHN A;  2CDT A;  1NEG A;  1WLP B;  1X2Q A;  2RQT A;  4JJD A;  4OMM A;  1GBR A;  2KE9 A;  4RUG A;  4AG1 C;  2KXD A;  2V1Q A;  4OMP A;  5GJV B;  1AWO A;  2DL8 A;  4J9I A;  1NLP C;  1U06 A;  1SEM A;  1YNZ A;  2KR3 A;  2GNC A;  1M27 C;  4RTY A;  1AWX A;  2DM1 A;  1WA7 A;  1K0X A;  2ABL A;  1T0H A;  4GLM A;  1Y0M A;  4RTZ A;  1VYU A;  2FPF A;  2FO0 A;  1RLP C;  3THK A;  3RNJ A;  1WX6 A;  1AWJ A;  3EHR A;  1K1Z A;  2HCK A;  3CQT A;  2D8J A;  3TVT A;  1ZLM A;  3EG2 A;  2AKL A;  1RLQ C;  3LH5 A;  4D8K A;  2L3S A;  1X6G A;  2NWM A;  4RTU A;  1MV0 B;  3KFV A;  2ROT A;  3UA6 A;  2A36 A;  2F2V A;  3H41 A;  2ESW A;  4OMO A;  1T3L A;  1PHT A;  1UJY A;  1H92 A;  2KGT A;  2EKH A;  4RTT A;  1OEB A;  2O2O A;  2JXB A;  3I35 A;  1W6X A;  1QWF A;  2GTJ A;  1KJW A;  4LE9 A;  1H3H A;  1JXM A;  1PKT A;  1UHF A;  2P4R A;  2IIM A;  1UGV A;  2LQN A;  1K76 A;  1XOV A;  2LJ0 A;  1I0C A;  4QT7 A;  1U5S A;  2ED1 A;  2JS2 A;  3VS1 A;  2DYB A;  2RMO A;  4J9G A;  2W0Z A;  4Z88 A;  2HDA A;  4F16 A;  1KFZ A;  4M4Z A;  2H8H A;  2SEM A;  1HSQ A;  3M0T A;  4IIO A;  2YUQ A;  2RPN A;  2DLP A;  2CSI A;  4FSS A;  1M8M A;  1UG1 A;  1HD3 A;  3JV3 A;  2RQU A;  1YWO A;  4IIM A;  4Z89 A;  2DL3 A;  3PVQ A;  5I11 A;  1K0S A;  1ZBJ A;  2K79 A;  2C0T A;  1OPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...