2RQUA

Solution structure of the complex between the ddef1 sh3 domain and the apc samp1 motif
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
VRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords DDEF1_SH3
publication title Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rquA00
4J9BA 1M8MA 2NUZA 1K1ZA 1GBQA 1X6GA 1X2QA 2KNBB 4AG1C 1KSWA 3UATA 2D1XA 1WI7A 2HCKA 2KGTA 1QKXA 2L2PA 5FWCA 4HVUA 2B86A 2KXCA 2ED1A 1M27C 4CC2A 1JXOA 3O5ZA 1ZUUA 2RQRA 2EBPA 3R6NA 4IIOA 1SHFA 2HDAA 4AFQC 2DL8A 1BU1A 5IHNA 2AZVA 3U23A 3REBB 3RNJA 3I9QA 5GJWB 2LQNA 2RMOA 2FPEA 4JJDA 1WLPB 2CREA 1SSHA 3VS0A 2YUNA 2BZYA 2GNCA 2K9GA 5IXBA 1SPKA 2J06A 1GFDA 2A08A 1M3BA 3PE0A 2CUDA 4FSSA 3FJ5A 2ESWA 1BB9A 2LCSA 1T3LA 4LNPA 2F2VA 2CT3A 2DL4A 1AD5A 4OMQA 2VWFA 1B3QA 5EC7A 4IIMA 3VS3A 2CH4W 2ROTA 2KR3A 2A37A 1J3TA 3VRZA 1YWOA 1X43A 3H0FA 3EG2A 2D0NA 2O2OA 1ABQA 4CC4B 1TUDA 4LUDA 1TG0A 3SHWA 1AOJA 2ABLA 3QWXX 2HBWA 1N5ZA 1GCQA 1W70A 3I5RA 1UHFA 3IQLA 3M0QA 4LE9A 4HVWA 1MV0B 3PVLA 1V1CA 1NEBA 4Z8AA 3NGPA 2KRMA 2LZ6B 4ZNXA 3VS4A 1OPKA 4RTTA 2VKNA 2H8HA 4JZ4A 1AVZC 1G83A 2EYXA 4K11A 1UTIA 1JO8A 1H8KA 2KE9A 3TSZA 3C0CA 1M3AA 4GLMA 1AWOA 4AFSC 1W6XA 1PWTA 2OI3A 2LX7A 3H0IA 1UFFA 1YP5A 2EYYA 4OMOA 1SRLA 3ZL7C 5IXFA 2O88A 2F2WA 3JV3A 1GBRA 4WCIA 2L3PA 2KYBA 1S1NA 1AWJA 2LJ3A 5HCKA 2M51A 1NYFA 2EPDA 2J7IA 5IHKA 2KEAA 2JXBA 1UDLA 2SRCA 2YUOA 2RQUA 3EG3A 1CKAA 2K6DA 2A36A 4F17A 2NWMA 1U3OA 3EG0A 1NYGA 4KRTA 3CQTA 1A0NB 2YSQA 2JS0A 1H92A 1UECA 3UA6A 1K0SA 1AZGB 1GCPA 5ECAA 3H41A 5IH2A 1KIKA 4AFZC 2OAWA 3THKA 2FPDA 2CT4A 4JJBA 2MCNA 2AZSA 2VVKA 2HEQA 1UUEA 3EHRA 1K0XA 2LP5A 2ED0A 1OV3A 2GBQA 4RTWA 2I0NA 1YNZA 2LJ1A 1HJDA 4X1VA 4HVVA 1AWWA 1LCKA 2O9VA 1I07A 4D8KA 2L3QA 4AG2C 4F14A 2BTTA 4EIKA 2F2XA 2EVRA 2J05A 2PTKA 2W0ZA 3EGUA 2FO0A 2RN8A 3NHNA 2J6FA 4QT7A 1YN8A 1UE9A 2IIMA 1VA7A 4DEXA 1M3CA 4LUEA 3LH5A 2DX1A 4ESRA 1UG1A 2D8JA 4OMLA 2YUQA 2EKHA 2RQTA 2YUPA 1WFWA 3EG1A 5IHIA 3UF4A 2DL5A 2C0TA 1ARKA 1AEYA 1SEMA 1RUWA 3I35A 1GFCA 4R0KA 2SEMA 2EYZA 1UJ0A 1WX6A 2G6FX 1YCSB 2X3WD 2BZXA 4J9CA 2DA9A 3VS5A 1FMKA 2EGCA 5I22A 2JMAA 1OEBA 1JQQA 2JTEA 2DRKA 4E6RA 2RPNA 2FRYA 2AK5A 2BZ8A 1QLYA 4RTVA 1ZUYA 3I5SA 1M30A 1W1FA 4DEYA 1WXUA 2FG0A 2LQWA 2DM1A 2DE0X 1OOTA 3A98A 3QWYA 2CSQA 3TSWA 4CC3A 3REAB 3VRYA 1RI9A 2LJ0A 2KROA 2JM9A 3NMZC 2V1QA 4HXJA 2DJQA 1I0CA 1ZUKA 1CSKA 1K9AA 1CKBA 2HSPA 5I11A 4Z88A 4D8DA 1K4US 4OMNA 2XMFA 1WXTA 2CUBA 2LMJA 1TUCA 2DVJA 3KFVA 4JZ3A 1E7OA 2FEIA 1AWXA 1UGVA 1RLQC 2GTJA 4OMPA 2QDLA 3VS6A 1T0HA 2M0YA 1NEGA 2MOXA 1X27A 2KT1A 2O9SA 2L0AA 1BK2A 2CSIA 2DF6A 2JS2A 3GBQA 3RBBB 4J9HA 3M0PA 1JEGA 1SRMA 2RF0A 1VYTA 3VS2A 3EHQA 1WA7A 5FWBA 1MUZA 2E5KA 1HD3A 2DYBA 4AFUC 1PKSA 2EGEA 1WDXA 1T0JA 1Z9ZA 2DMOA 2C0IA 2FPFA 2JMCA 2KRNA 2K2MA 2PNIA 2FRWA 4J9DA 1IO6A 2ROLA 1UJYA 2KRSA 1U06A 1MV3A 2GTOA 2KXDA 1T3SA 4M4ZA 4RTXA 1PRLC 2DL3A 4Y92A 1UHCA 1X6BA 3M0TA 1JXMA 1X2KA 1QCFA 1WXBA 2J6OA 2DL7A 2GGRA 1ABOA 4RTUA 2JT4A 3H0HA 1PKTA 3M0RA 2JM8A 2C0OA 2YT6A 1KJWA 3M0SA 1YWPA 2O31A 4RUGA 1Y0MA 1JU5C 2CH4A 3VS1A 2DBMA 1E6GA 1SHGA 1GCQC 4RTYA 1X69A 4JPBW 2KBTA 1E6HA 5L23A 1KFZA 2PZ1A 1BBZA 2DNUA 2P4RA 3SEMA 1PRMC 1ZBJA 2OJ2A 1Y57A 4J9FA 1ZSGA 3TVTA 1GRIA 2X3XD 1WIEA 2DBKA 1ZLMA 4LN2A 3UA7A 1QWEA 2KT8A 3M0UA 2L3SA 1QKWA 1NLPC 4ORZA 4RTZA 1QWFA 3VS7A 1PNJA 2D8HA 2DILA 2EGAA 1K76A 2EQIA 2RNAA 1H3HA 4F16A 1U5SA 2RQWA 4HCKA 4J9EA 1AZEA 2DRMA 4J9GA 2V1RA 2GQIA 2EYWA 2ECZA 4GBQA 1XOVA 1PHTA 4OMMA 1G2BA 2MIOA 1Z9QA 1NM7A 3NPFA 2DLPA 1OPLA 1I1JA 2W10A 3PVQA 4A63B 1FYNA 2JW4A 2EW3A 1GL5A 4J9IA 2AKKA 1B07A 1HSQA 1WYXA 2J6KA 1ZX6A 2RQVA 2A28A 1RLPC 5FW9A 2K7AA 4Z89A 1EFNA 1NLOC 1NG2A 5GJVB 2AKLA 2ENMA 2KYMA 4CC7A 1VYVA 3ULRB 2YDLA 2K79A 1VYUA 2CDTA 2LNHB 4JJCA 2K3BA
chains in the Genus database with same CATH superfamily
1R0BG 1M8MA 3JB9J 3QYGB 1K1ZA 2ZCFB 2RI5A 1KHCA 1X2QA 5GAOn 3NFCA 1KSWA 2YRCA 2E1HA 2KGTA 2L2PA 1JJ2A 2JTFA 2B86A 2DXUA 4F04B 3ER0A 1JXOA 2VV5A 1NPRA 4IUQA 3CCJA 2EBPA 3R6NA 2ZGWA 1SHFA 1G5VA 1QVFA 4O5VA 1BU1A 2PU9B 3REBB 1RADB 4BI8B 2DXTA 6AT1B 4A4HA 2QA4A 4HCCA 4L5GA 5CKEA 1WLPB 1SSHA 1VQ4T 1TU0B 1W2BA 2L8DA 3CCRT 3CCMT 2GNCA 2K9GA 3M4YA 4KGXB 2J06A 3GNFB 4XQ3A 1M3BA 3PE0A 2ESWA 1N8RU 4KH1B 3L2UA 4F7UG 1ZSZB 5HK3A 2DETA 5GAMe 3OYEA 1IGQA 3VS3A 2CH4W 1GXIE 4JRIA 4R55A 1VIFA 4RG8A 4M77B 3E9GA 2DO3A 3EG2A 1R0CB 4JLIA 3MEAA 1D1AA 2NLUA 1VQOQ 4JS5A 2KDSA 2HBWA 3S3NA 2X4JA 3I5RA 5IAYA 3LGLA 3M0QA 1MMAA 2XDPA 1MV0B 1V1CA 4PFZA 2RI3A 5CQXA 5A0LA 2LZ6B 3A8HB 2IPOB 1G3WA 2RHXA 4RTTA 2H8HA 4JZ4A 1AVZC 2HQHA 2XK0A 4MZMA 4K11A 3EG9B 1EIFA 2MF2A 2RHIA 1MMGA 3L2WA 2LX7A 1M1KC 2D0QB 3WVDB 4MZTA 1WHJA 1UFFA 2BIVA 2EYYA 2C06A 1SRLA 1VQ5T 5IXFA 4JJNK 1TUGB 3UDCA 2KAFA 2XU8A 1GBRA 5LJ5j 2L3PA 4A4FA 2CP6A 5HCKA 2M51A 1VUBA 1NYFA 1Q86R 2EPDA 2K57A 2KEAA 1UDLA 3KUFA 2GQVA 1RACB 3CC2T 1CKAA 2K6DA 3CXCP 3M59A 3I55Q 2DZ9A 1NYGA 2FB7A 3G4SA 1UECA 3UA6A 2RJEA 1AZGB 5GMKj 1KQSP 4AFZC 3SWNC 1FMWA 2ZZDA 2CT4A 2M1HA 2MCNA 2VVKA 4BI3A 1M2VA 2QK0A 4N4HA 3CC7T 3CC4A 2LJ1A 1QQJA 3P8BB 5KYWB 1UGQB 2FVUA 1VQPT 4F14A 4FYXB 4EMGA 3L2QA 2FZGB 4EIKA 4L59A 3MEVA 2V26A 3M56A 2CZ6B 3EGUA 3JRZA 1X01A 4QT7A 2HKNA 2EJFA 1K73C 1UE9A 1M3CA 1TSFA 4BE0A 3LH5A 3CCLQ 4ESRA 3HP9A 3JAME 5FU6B 2EKHA 1KD1R 4EMKA 1QMCA 3TCJA 3JCMJ 1BI3A 3JCMb 2M0OA 3JCMe 2XIDA 1GFCA 4R0KA 4KH0B 2EYZA 4M7AD 3MP6A 5L8RE 3CMEA 3L42A 2X3WD 5LJ3d 2MK5A 2JTMA 3A8MB 2JMAA 1JQQA 2CZ1B 2JTEA 2DRKA 1JJ2P 2RPNA 3GPLA 3R6OA 2AK5A 1QLYA 1NPPA 1ZUYA 3I5SA 1I4K1 2QEXT 2LQWA 3CCST 4JLGA 2DE0X 4M7DG 4A4KA 1KC8C 4IUTA 3QWYA 2PUOB 2HD0A 2COWA 4BB7A 3OYCA 4E7LA 3J7AF 4FT4A 2LJ0A 2LTOA 2JM9A 4C5HA 1ZUKA 1CSKA 5CKHA 4M77F 2DZCA 3QSUA 2P0PA 2WSFE 4LDWA 2A0FB 1CKBA 4PFPA 5GMKm 4QQ6A 4E7IA 5CVIA 4E47A 1EX4A 4C92E 3V8LA 3CMEQ 1UGVA 4HT8A 3RERA 3VS6A 1T0HA 1X27A 2DVEA 4E7ZA 3QDRB 2O9SA 4M77C 4NL2A 1BK2A 1S72A 4XAXB 3L2VA 3GBQA 4WTOB 3M0PA 3E1SA 5GANd 2E5KA 1HD3A 1W4SA 1PKSA 4J6WA 5KYUA 2EJ9A 2PUKB 2KRNA 3G71A 1IO6A 2ROLA 3QDFA 2D9TA 3JCMf 4C8QG 2X4XA 4M7DE 1MV3A 1M5Q1 3M0TA 3RR6A 2HL5C 3M53A 1YFNA 4N0AC 3MP8A 2JT4A 3CC2A 2EKOA 4QVCA 4PJOA 2YT6A 4MDWA 3M0SA 4FSXA 5CR2A 4P5NA 2XG8D 2HBPA 2RJDA 3QJ6A 2E10A 1E6GA 1GCQC 2K3YA 4Z02A 1YI2A 1X69A 4JPBW 4C0GA 2I2LA 1S72Q 1RI0A 2XD0A 1BBZA 5J39A 1OX8A 3HHTB 1LOJA 3OYJA 2X51A 3E9FA 1PRMC 3CCET 3CCQT 1NZ9A 2RHZA 3FDRA 4J9FA 3MP1A 1ZSGA 2DD5A 2X3XD 1WIEA 2DBKA 4C92D 4LN2A 5I21A 1G3SA 3M9QA 5DLQE 1OZ3A 2GFUA 4RTZA 1WHKA 5GAOq 4X34A 2D8HA 3VS7A 3G6ET 1K76A 2RNAA 3JCMQ 4F16A 4PJLA 4ZGEB 1TXQA 2JOYA 5M9OA 2CP7A 2DTHA 1D3BA 2E4HA 2EYWA 4C8QE 3DLMA 1MHNA 5C0MA 4OGCA 1Y07A 4RCCA 1HK9A 1M90R 3NPFA 1ZHIA 5D6WA 3A5ZB 2W10A 1RAIB 1YI2Q 1M1KU 2CZ7B 3FRNA 5HY6A 5GAMd 2CP5A 3C12A 5FU6C 5LL6S 1B07A 1U8RA 4M78E 3TREA 1YJWA 2RQVA 2QEXA 4E2FB 3CCSA 3ZBDA 1V29B 2RHYA 5FLXE 5LJ5e 3RESA 2RA2A 4FM4B 2KYMA 2EWNA 2AT1B 1VYUA 2L3RA 1PG5B 4PJOG 1QP3A 1QVFS 4N4GA 2KMTA 2KNBB 4AG1C 2FYKA 3CBMA 1WI7A 1QKXA 2ZPIB 3X20B 4HVUA 2KXCA 2K5LA 5GMKe 2Y4YA 3O5ZA 1ZUUA 4TVRA 1W2BS 1JBMA 1VQ8T 2R57A 2DL8A 5GANh 4M7DB 3RNJA 4BE2A 2EJGA 2RMOA 3CMAA 4JJDA 3VS0A 5CO7A 1K73U 1YJWQ 1Y96B 2BZYA 5IXBA 3VJPA 3EGXB 3HL8A 3JCMW 1GFDA 1VOMA 2RK1A 3A8LB 4GY5A 2LCSA 3OSSC 3RKXA 2EIFA 4LXCA 3JB9I 1B3QA 3DB4A 4D6WA 2WACA 2QQBA 2A37A 1YWOA 5GAN7 4M78D 2D0NA 3UT1A 4J83A 4XU3A 1IB8A 3EH2A 3CEYA 2OAUA 3SHWA 4C0DC 2ABLA 3QWXX 2K2VA 1N5ZA 4C0FA 1YJ9Q 3QKJA 4KULA 1KC8U 4EMKB 3JCMP 4M7AA 3CMAQ 4X9DA 3PVLA 1VQ6T 4ZNXA 4C8QB 1RAHB 2VKNA 2DD4A 1JO8A 1O75A 3C0CA 2YHTA 1HYOA 2E65A 1M3AA 4FW2A 4GLMA 3JCMd 4AFSC 2B8AA 3CCEA 3CCQA 2OI3A 4FYVB 3OYKA 1YP5A 2L89A 4AT1B 2F2WA 4J6YA 1FMVA 1M1FA 3HRUA 4WCIA 1YJNT 1S1NA 1AWJA 2LJ3A 3CD6T 3QBYA 2OTLA 4M78B 2ZPEB 4FW1A 3LWIA 4V2SA 2SRCA 1M9SA 2D6FA 2RH2A 3F70A 1M90C 4J8OA 3GF5A 2NWMA 3RDVA 2HQEA 2A7YA 1I5OB 3LYIA 1M8VA 2JS0A 4EPCA 1H92A 3QZ9B 1YBYA 3H41A 4PL6A 4XTVA 1VQ7Q 4M77D 5GAN5 3EFOB 3OS0A 4MMKA 1NJIR 3H9NA 2ED0A 4E7HA 4XTYA 2GBQA 2I0NA 4N4IA 1IZ6A 1HJDA 5GAN2 2CGHA 1AWWA 1LCKA 4C92F 2L3QA 1M2OA 1MMNA 4AG2C 3CCUA 7AT1B 3OS2A 3PIOA 3CBOA 4B6MA 4JS4A 1YN8A 1VQ9Q 1VA7A 3SD4A 3M5AA 4DEXA 2OTLQ 4DBFA 2DX1A 2D8JA 2CP2A 1WFWA 5IHIA 4C92C 2R5AA 2LVMA 3OBYA 3OYDA 2DL5A 4M7AG 3JB9F 4M75G 1Q82R 1JB0E 1VQKT 5A0DA 5KYXA 1UJ0A 2NUTA 4M7DF 1EZZB 1WX6A 4OP0A 5IT9E 5KYYB 2BZXA 2QQ9A 3CCJQ 3RKYA 2EGCA 5I22A 3OYIA 4DOVA 4E6RA 3V8JA 4PJOB 4FYWB 4RTVA 4FT2A 1M30A 1WHLA 2FG0A 1K9MR 2DM1A 2QA4Q 3CCUQ 1TWBA 3VU3C 4XTUA 3A98A 3ZFJA 9ATCB 4M7DC 1YIJA 3REAB 3VRYA 2AIRB 1YHQA 2MAMA 1H641 5AYFA 2K3XA 3BY7A 1VQNT 4LDYA 3TU4K 1K9AA 2DFUA 2ZPGB 1DJ7B 2LDMA 2H3EB 5I11A 4D8DA 1KG1A 2XMFA 5D6XA 8AT1B 4F7UE 3BW1A 3KFVA 1E7OA 1AWXA 1NBEB 1IRXA 4OMPA 4ZTFA 2MOXA 1JRIA 2NUPB 5LJ3g 3CCVT 2QGGA 3OYHA 1YITA 2WSEE 4C8QF 2JS2A 2Z0WA 4WF2A 5FRMA 1SRMA 1IGUA 2RF0A 4J6XA 3HFNA 1MUZA 2DYBA 2GFAA 2EGEA 3E19A 2LQKA 5AT1B 1YIJQ 1Z9ZA 2DMOA 2C0IA 2RJFA 3I56A 1YHQQ 5GMKl 2OTJT 1UJYA 5CIUA 4RTXA 3CPWA 4C8QC 1PRLC 4Y92A 4M78F 5C6SA 1QCFA 2MI6A 2LX9A 4KGZB 5FRNA 2GGRA 3M57A 3C4SA 2JM8A 2C0OA 2O4XA 5LJ5d 1Y0MA 2YWWA 2R5MA 1NJIC 2E12A 4IKFA 2XICA 3SWNA 3OMGA 1SHGA 3VYHB 4PJNA 1UGPB 2FL7A 4M78C 3G4SQ 1YITQ 5L23A 4BD3A 5D6YA 3OA6A 3RUXA 3SEMA 4XU2A 1ZBJA 3OSVA 4Y91A 1G8XA 3TVTA 3Q1JA 3OYNA 2PQWA 3CC4Q 1WHHA 5GANg 4PKCC 3OB9A 1QWEA 2YXYA 3I56Q 1VQ4A 2L3SA 3CCRA 2E5QA 1NLPC 4ORZA 1Y71A 1QWFA 3CCMA 4ZN1A 1ZA2B 1QVFP 5I2MA 3ASKA 2EQIA 1H3HA 1AT1B 1FX7A 4BACA 3QG1A 1R8OB 4HCKA 4J9GA 5DM7R 2X4YA 4XTZA 2M16A 2ECZA 4GBQA 3VKIA 5GANj 4OMMA 5GAOm 1W2BP 1G2BA 4NS5A 2MIOA 4PJJA 1BYMA 1NM7A 1OPLA 3JCMX 1KQ2A 4FL6A 2QTXA 4A53A 3A8GB 4A63B 2JNGA 4VUBA 1FYNA 1PM3A 3MPUB 2JW4A 3OYGA 4JRPA 2RB6A 1ZSZC 1GL5A 1PD0A 4J9IA 2AKKA 3EGDB 1HSQA 1WYXA 4JDSA 2COZA 1ZX6A 4OF1A 4F7UB 2A28A 2RD1A 2K7AA 4ZGDB 2E6ZA 1Q7YR 1TS9A 1M90U 2QQRA 1VQ4Q 2E6NA 2ENMA 3CCRQ 3NTHA 4M75B 4QVDA 3CCMQ 1VQMT 2YDLA 1WZOA 4JJCA 2LNHB 2K3BA 4J7FA 3O8VA 4JRKA 1YJ9T 5GMKi 2NUZA 1GBQA 1X6GA 1Q86C 1VQ5A 1QVGA 3UATA 5FWCA 2LNVA 2BUDA 4CC2A 1D0XA 4RG2A 5KH6A 2CP0A 1V76A 3EFSA 4LDVA 4DOWA 3OYFA 4IIOA 4AFQC 2AZVA 3U23A 1I8FA 3I9QA 3DLLA 5GJWB 2LQNA 1Q95G 5GAMg 4NOYA 1VQLT 1BCOA 4M77A 3CCVA 3OW2A 4HT9A 4A4GA 2CREA 2YUNA 5KE3A 1SPKA 2M9UA 3LWHA 4ANJA 2A08A 8ATCB 2CUDA 4FSSA 3M55A 3FJ5A 1PD1A 3CC7A 3X25B 4C5EA 1KK7A 4LNPA 3SB2A 2DL4A 3NTIA 4IUVA 1FXXA 4OMQA 4QQDA 2VWFA 3JB9H 3QZ5B 1VQPA 4IIMA 3CXCS 2OX7A 2ROTA 1ZQ1A 2KR3A 3G71Q 1VQ5Q 2JJ9A 3VRZA 4BY6B 2VGMA 3H0FA 1KD1C 4N0AA 2O2OA 1ABQA 4QKUA 2E3HA 1TUDA 5LJ3h 2QQSA 1TG0A 2CP3A 3MKDA 3BDUA 1BCMA 1HXDA 3CC2Q 1GCQA 1W70A 3X28B 2HQXA 3IQLA 4LE9A 4HVWA 2QAZA 1NEBA 3NGPA 3JB9D 3J80E 4DA4A 3VS4A 3SDZA 1OPKA 1Y7XA 2EYXA 3TSZA 2KE9A 4M7DD 5KYXB 1W6XA 1PWTA 1WNLA 3HKSA 4QW2A 2EQMA 1I81A 2HSEB 3CC7Q 3BE3A 1OYXA 1X6OA 4J5YA 4YTLA 1XQHA 1LPLA 4XU0A 1VQPQ 2DTOA 2A3LA 1ZBXA 1VQOT 1IXDA 2HMAA 2E3IA 2HZYA 5KYWA 2RQUA 3EG3A 4RMOA 4DBRA 2A36A 3HPWA 3EG0A 4IURA 4M77G 4KRTA 3CQTA 1A0NB 5ECAA 1KIKA 2OAWA 2EFIA 2FPDA 3UWNA 2FHDA 1RABB 3RKWA 1P92A 1UUEA 1K0XA 1OZ2A 4MMLA 5EG2A 2LP5A 1Q7YC 1OV3A 2YLBA 2EQJA 2MWPA 1PSFA 2COYA 2O9VA 4F7UF 4ELYC 2XHCA 4D8KA 4XU1A 2VXFA 2BTTA 4E7JA 1N27A 1QCNA 5GAOr 2WSCE 2AHJB 1ZA1B 3OY9A 2F2XA 3M54A 2J05A 2PTKA 4C8QD 2QEXQ 2PVDB 2W0ZA 3CCSQ 2FO0A 2RN8A 2J6FA 5D7UA 3I55T 1NJIU 3VV0A 2X35A 4FYYB 1IHWA 1M2VB 1UG1A 1SG5A 5CAIA 2RQTA 2YUPA 3EG1A 4ATOA 2P0KA 1ARKA 1AEYA 2HL3A 4ZTJA 3I35A 3QXEB 1WQ7A 2MWOA 2F5KA 4M75C 4QVZA 3TEEA 3PMTA 1X75C 1B7TA 2G6FX 4PJOE 2GCXA 3VS5A 1FMKA 3CXCA 2QDYB 2FRYA 2ZPHB 2O4XB 3BFMA 4XK8E 1WQWA 2K4YA 2MMPA 3SFMA 1W1FA 1BIAA 4Y28E 5GAN3 3SWNB 1M1KR 1OOTA 1M1GA 3PT9A 2CSQA 3TSWA 3WXMB 4CC3A 3CCLT 3HSBA 1RI9A 2DEQA 2KROA 1MNEA 4J7IA 2V1QA 4HXJA 2DJQA 4MDXA 1I0CA 5GANe 1WHGA 1RAEB 1FWZA 2XDDA 2DKGA 1D0ZA 2HSPA 3G6EA 4Z88A 3S6WA 4OMNA 5GAMh 4OB1B 5CKDA 3OBWA 2RM4A 2XI9A 2LC4A 4JZ3A 2LQ8A 1RLQC 5CCAA 1AHJB 2QDLA 2DERA 2M0YA 2MPXC 5LJ3f 2JUFA 4CI0C 4HA8A 2KT1A 1OX9A 2L0AA 2CSIA 4BY6C 2DF6A 3LX7A 4BDZA 3RBBB 2QASA 3J81E 3CPWS 3MO8A 2VC8A 1OU9A 1VYTA 2KI7A 1WJQA 1OQKA 1WGSA 1Q86U 1WA7A 4XTXA 4AFUC 3RIRA 1WDXA 1T0JA 3A8OB 2JMCA 2K2MA 2PNIA 4PNOA 2FRWA 3CCEQ 4PJOD 3CCQQ 3QHSA 1K73R 1OULA 2GTOA 2KXDA 3AHUA 1XTDA 1UHCA 2XKOC 1VQOA 1X2KA 2P0QA 1O9SA 2J6OA 3CMET 4B9XA 3VUZA 3G6EQ 3H0HA 3DKMA 3M0RA 1G3TA 1KJWA 2O01E 1UB4A 4RUGA 1JU5C 3GIBA 3CPFA 3FJPA 2DBMA 4PK4A 4FIBA 5KYUB 2LCLA 5HKCA 1QVPA 1BKBA 1SKUB 2DEUA 4B9WA 1KFZA 1C1AA 4OB2B 1VQ8A 2DNUA 2HNIA 4PFOA 5DY9A 2P4RA 3V7RA 3DB3A 1K8AR 1OU8A 1Y57A 3H8ZA 3OS5A 1KC8R 4C5IA 4BI4A 1ACMB 1GRIA 5GANf 1KD1U 3AT1B 3MCAB 2DTIA 1SF9A 4Q5WA 1RAGB 3M0UA 3N5BB 4OB0B 1QKWA 1QW1A 1D09B 5FU7B 3VYGA 3OYMA 4FCYA 3I55A 3EAEA 1U5SA 1Q81R 2RQWA 4DQ2A 1WHMA 4J9EA 2DRMA 4C92A 2RO0A 3JCMc 1PHTA 4ZN3A 1KQ1A 1S72T 1Z9QA 5LJ5g 3UPUA 3LGFA 3PVQA 5KCOA 4QQGA 1D0YA 2RJCA 3QO3A 1RAAB 1XJWB 4AMCA 5CQYA 3FC3A 3JCMh 1BI1A 1VQ8Q 2CKKA 3MEUA 1MMDA 5A0GA 3G71T 4M7AE 2J6KA 1M4ZA 1LVKA 1BI2A 2CZ0B 4LD6A 1D3BB 4M75E 2YRVA 4OGEA 1RLPC 1QVGS 1VQ6A 2VUBA 1BIBA 4M7DA 1RL2A 2YLCA 1NG2A 3CCLA 4RCBA 5GAOl 4CC7A 3ULRB 3GOXA 2JN0A 2K79A 2CDTA 3C94A 4J9BA 2P4TA 1C6VX 1WJRA 2D1XA 4EMKC 5LJ3j 1Y96A 2HCKA 2MYSA 2ED1A 1M27C 3EGXA 1QCOA 3OW2S 3CBPA 1YJNA 1YI2T 3E2UA 3CD6A 2RQRA 1Q7YU 3A1PA 4MZPA 2HDAA 5IHNA 3OYBA 1N8RR 3D7SB 2VYTA 3H6ZA 2E64A 3OQ5A 2F69A 5GAMf 4KUIA 1U1SA 2FPEA 1LJOA 1LNXA 2DIQA 2ZAEA 4FU6A 4EMHA 1UGSB 5HK0A 1VQ6Q 5GAN8 1IHVA 3URGA 1SSFA 3HRSA 1BB9A 2V8KA 1T3LA 2RI2A 2F2VA 3OYLA 2CT3A 1AD5A 4C92G 5KCHA 5EC7A 1B34A 4ZGJB 1BI0A 4C8QA 3HFOA 2K5FA 1OI1A 1J3TA 5FROA 3ZEHA 1X43A 4OVAA 2HAXA 2DXBA 4XTWA 1YJNQ 4M75D 3QPHA 3CD6Q 4CC4B 1VIEA 2LCCA 4LUDA 3META 1MNDA 3INZA 4JRQA 2CS7A 2QXFA 1Q82C 1AOJA 5J3BA 4R56A 3JB9G 2QYZA 1TOVA 1UHFA 2EQUA 2IVWA 1YJWT 1K8AC 2JZ2A 4M78A 4Z8AA 2KRMA 1VQKA 1G83A 3L1AA 3P8DA 2PVGB 4BUGA 1UTIA 1H8KA 2V8JA 2JVVA 2L5QA 1AWOA 1K9MC 4DBQA 3H0IA 4PJOF 4OMOA 4KBMB 1Q81C 3ZL7C 3EFOA 2O88A 3JV3A 4LD9K 1WPYA 2ZPBB 2G3RA 2KYBA 2E41A 3PMIA 4M7AB 1N9SA 2J7IA 5IHKA 2JXBA 2YUOA 2P84A 1XNIA 4F17A 1U3OA 3KBGA 2K5IA 3OYAA 2QI2A 3CMAT 4PJOC 4A54A 2YSQA 1VQNA 1K0SA 4CRIA 4L6V5 1GCPA 5IH2A 5KYNA 2KSSA 3EFRA 5FU7C 1N6AA 3THKA 2VB6A 4HCZA 2EYQA 2Y90A 2AZSA 3C95A 2HEQA 3EHRA 2BE9B 1VQKQ 2QQAA 2H3JA 1ZSZA 4RTWA 1YNZA 2DYIA 4C0DB 2V8IA 4LDXA 4X1VA 4HVVA 1I07A 3OMCA 3FB9A 4C0ZA 2EVRA 4OMFB 1NE8A 2RK2A 5KYYA 2R58A 3NHNA 3NTKA 3G7ZA 5DLOA 2IIMA 4LUEA 3ME9A 2DJZA 5GAN6 5CKFA 4OMLA 5LJ5h 2YUQA 1QP2A 5GAMj 2OTJA 1VQ7T 4EDUA 1F1BB 1N8RC 2XDBA 3UF4A 2CYZB 2C0TA 4M78G 1SEMA 5KE2A 3PFSA 1RUWA 4NL3A 1VQNQ 2SEMA 4RKUE 3LLRA 3EG9A 2M02A 1KQSS 1YCSB 2DIGA 4J9CA 1TTHB 2DAQA 2DA9A 5GMKh 3M58A 3VUBA 1OEBA 2E70A 2BZ8A 3CPWP 4DEYA 1WXUA 3PGGA 3CCVQ 3TQ7P 2VGNA 4ME7A 5IN1A 1VQ9T 1PSEA 2OTLT 4GLKA 3LW5E 4JUVA 4HKEA 3V7CA 2NUTB 3QIIA 4PLLA 2NUPA 2YRDA 3NMZC 1D1CA 3S3OA 2FZKB 1RAFB 3L2RA 4A4EA 3PTAA 4HCBA 2OTJQ 3QJYA 1G3YA 2QGFB 3RMQA 1K4US 3CCJT 1WXTA 2CUBA 2LMJA 2LT1A 3T9NA 5CK9A 1TUCA 2DVJA 2QG9B 3JSCA 2FEIA 2LRQA 3PNWC 1YCYA 2GTJA 1NEGA 2QA4T 5CKBA 3CCUT 3MEWA 4C92B 2DK3A 4PJMA 3GNGA 1TH7A 1JJ2S 4OB3B 2DXCA 4J9HA 2LT4A 2KY9A 4KUDK 2FZCB 1JEGA 3VS2A 3GLXA 3EHQA 5FWBA 4UC4A 3S3MA 2IG0A 2FPFA 3FIFA 3L2ZA 2X9HA 4J9DA 3V8KA 3GP8A 3V7SA 5LJ3e 2VXEA 3PIPA 4O6JA 2KRSA 1U06A 3JCMg 1T3SA 4M4ZA 4E7SA 2DL3A 4C5GA 4M7AF 2RHUA 3QUIA 1X6BA 1JXMA 4M75F 1WXBA 1KHIA 4ELZC 1VQMA 2DL7A 1ABOA 4RTUA 1WJSA 1PKTA 2DPPB 4II1A 4X9CA 1YJ9A 1YWPA 2O31A 2CH4A 3M4GA 1I5LA 3HRTA 3VS1A 3FEOA 4RTYA 1MGQA 2ZPFB 2GF7A 4M7AC 3WVEB 3EH1A 2KBTA 1E6HA 2KK4A 2PZ1A 2PVOB 1R77A 2NYSA 1C0MA 1UGRB 1YIJT 1YHQT 2F1LA 4IUPA 2OJ2A 4M77E 1QVGP 1VQLA 3G1JA 5J26A 3P8HA 4DBHA 3X24B 4KGVB 2X4WA 1ZLMA 3UA7A 2BE7D 3JCMV 2KT8A 3OS1A 3QYHB 3OYYA 3BDLA 1PNJA 1KQSA 3MHXA 1Q82U 2DILA 2EGAA 2QTVA 2VASA 3X26B 5I2SA 1U1TA 2EQKA 4BE1A 3EGDA 1N9RA 1UEBA 1AZEA 1VQMQ 1K8AU 3LH0A 2KVQG 2V1RA 2GQIA 4F7UA 3OW2P 1VQ7A 2Y4XA 2BKDN 1XOVA 5GAN4 3RMSA 3G4ST 4KT0E 1PC0A 5LJ5f 1B34B 1YITT 3KXTA 3HTRA 4M75A 2DLPA 1I1JA 2EAYA 1K9MU 4IUUA 1PCXA 2EW3A 1IREB 4LDUA 1Q81U 2HKQB 4PLIA 5GAOp 3CC4T 3I56T 2F5TX 1H3ZA 1VQLQ 2KQWA 2ATCB 3MJXA 5FW9A 1VQ9A 3FLGA 4Z89A 1EFNA 1NLOC 5GJVB 2AKLA 4BDYA 1D1BA 1VYVA 4E7KA 4JJBA 5A2QE
chains in the Genus database with same CATH topology
4J9BA 1M8MA 2NUZA 1K1ZA 1GBQA 1X6GA 1X2QA 2KNBB 4AG1C 1KSWA 3UATA 2D1XA 1WI7A 2HCKA 2KGTA 1QKXA 2L2PA 5FWCA 4HVUA 2B86A 2KXCA 2ED1A 1M27C 4CC2A 1JXOA 3O5ZA 1ZUUA 2RQRA 2EBPA 3R6NA 4IIOA 1SHFA 2HDAA 4AFQC 2DL8A 1BU1A 5IHNA 2AZVA 3U23A 3REBB 3RNJA 3I9QA 5GJWB 2LQNA 2RMOA 2FPEA 4JJDA 1WLPB 2CREA 1SSHA 3VS0A 2YUNA 2BZYA 2GNCA 2K9GA 5IXBA 1SPKA 2J06A 1GFDA 2A08A 1M3BA 3PE0A 2CUDA 4FSSA 3FJ5A 2ESWA 1BB9A 2LCSA 1T3LA 4LNPA 2F2VA 2CT3A 2DL4A 1AD5A 4OMQA 2VWFA 1B3QA 5EC7A 4IIMA 3VS3A 2CH4W 2ROTA 2KR3A 2A37A 1J3TA 3VRZA 1YWOA 1X43A 3H0FA 3EG2A 2D0NA 2O2OA 1ABQA 4CC4B 1TUDA 4LUDA 1TG0A 3SHWA 1AOJA 2ABLA 3QWXX 2HBWA 1N5ZA 1GCQA 1W70A 3I5RA 1UHFA 3IQLA 3M0QA 4LE9A 4HVWA 1MV0B 3PVLA 1V1CA 1NEBA 4Z8AA 3NGPA 2KRMA 2LZ6B 4ZNXA 3VS4A 1OPKA 4RTTA 2VKNA 2H8HA 4JZ4A 1AVZC 1G83A 2EYXA 4K11A 1UTIA 1JO8A 1H8KA 2KE9A 3TSZA 3C0CA 1M3AA 4GLMA 1AWOA 4AFSC 1W6XA 1PWTA 2OI3A 2LX7A 3H0IA 1UFFA 1YP5A 2EYYA 4OMOA 1SRLA 3ZL7C 5IXFA 2O88A 2F2WA 3JV3A 1GBRA 4WCIA 2L3PA 2KYBA 1S1NA 1AWJA 2LJ3A 5HCKA 2M51A 1NYFA 2EPDA 2J7IA 5IHKA 2KEAA 2JXBA 1UDLA 2SRCA 2YUOA 2RQUA 3EG3A 1CKAA 2K6DA 2A36A 4F17A 2NWMA 1U3OA 3EG0A 1NYGA 4KRTA 3CQTA 1A0NB 2YSQA 2JS0A 1H92A 1UECA 3UA6A 1K0SA 1AZGB 1GCPA 5ECAA 3H41A 5IH2A 1KIKA 4AFZC 2OAWA 3THKA 2FPDA 2CT4A 4JJBA 2MCNA 2AZSA 2VVKA 2HEQA 1UUEA 3EHRA 1K0XA 2LP5A 2ED0A 1OV3A 2GBQA 4RTWA 2I0NA 1YNZA 2LJ1A 1HJDA 4X1VA 4HVVA 1AWWA 1LCKA 2O9VA 1I07A 4D8KA 2L3QA 4AG2C 4F14A 2BTTA 4EIKA 2F2XA 2EVRA 2J05A 2PTKA 2W0ZA 3EGUA 2FO0A 2RN8A 3NHNA 2J6FA 4QT7A 1YN8A 1UE9A 2IIMA 1VA7A 4DEXA 1M3CA 4LUEA 3LH5A 2DX1A 4ESRA 1UG1A 2D8JA 4OMLA 2YUQA 2EKHA 2RQTA 2YUPA 1WFWA 3EG1A 5IHIA 3UF4A 2DL5A 2C0TA 1ARKA 1AEYA 1SEMA 1RUWA 3I35A 1GFCA 4R0KA 2SEMA 2EYZA 1UJ0A 1WX6A 2G6FX 1YCSB 2X3WD 2BZXA 4J9CA 2DA9A 3VS5A 1FMKA 2EGCA 5I22A 2JMAA 1OEBA 1JQQA 2JTEA 2DRKA 4E6RA 2RPNA 2FRYA 2AK5A 2BZ8A 1QLYA 4RTVA 1ZUYA 3I5SA 1M30A 1W1FA 4DEYA 1WXUA 2FG0A 2LQWA 2DM1A 2DE0X 1OOTA 3A98A 3QWYA 2CSQA 3TSWA 4CC3A 3REAB 3VRYA 1RI9A 2LJ0A 2KROA 2JM9A 3NMZC 2V1QA 4HXJA 2DJQA 1I0CA 1ZUKA 1CSKA 1K9AA 1CKBA 2HSPA 5I11A 4Z88A 4D8DA 1K4US 4OMNA 2XMFA 1WXTA 2CUBA 2LMJA 1TUCA 2DVJA 3KFVA 4JZ3A 1E7OA 2FEIA 1AWXA 1UGVA 1RLQC 2GTJA 4OMPA 2QDLA 3VS6A 1T0HA 2M0YA 1NEGA 2MOXA 1X27A 2KT1A 2O9SA 2L0AA 1BK2A 2CSIA 2DF6A 2JS2A 3GBQA 3RBBB 4J9HA 3M0PA 1JEGA 1SRMA 2RF0A 1VYTA 3VS2A 3EHQA 1WA7A 5FWBA 1MUZA 2E5KA 1HD3A 2DYBA 4AFUC 1PKSA 2EGEA 1WDXA 1T0JA 1Z9ZA 2DMOA 2C0IA 2FPFA 2JMCA 2KRNA 2K2MA 2PNIA 2FRWA 4J9DA 1IO6A 2ROLA 1UJYA 2KRSA 1U06A 1MV3A 2GTOA 2KXDA 1T3SA 4M4ZA 4RTXA 1PRLC 2DL3A 4Y92A 1UHCA 1X6BA 3M0TA 1JXMA 1X2KA 1QCFA 1WXBA 2J6OA 2DL7A 2GGRA 1ABOA 4RTUA 2JT4A 3H0HA 1PKTA 3M0RA 2JM8A 2C0OA 2YT6A 1KJWA 3M0SA 1YWPA 2O31A 4RUGA 1Y0MA 1JU5C 2CH4A 3VS1A 2DBMA 1E6GA 1SHGA 1GCQC 4RTYA 1X69A 4JPBW 2KBTA 1E6HA 5L23A 1KFZA 2PZ1A 1BBZA 2DNUA 2P4RA 3SEMA 1PRMC 1ZBJA 2OJ2A 1Y57A 4J9FA 1ZSGA 3TVTA 1GRIA 2X3XD 1WIEA 2DBKA 1ZLMA 4LN2A 3UA7A 1QWEA 2KT8A 3M0UA 2L3SA 1QKWA 1NLPC 4ORZA 4RTZA 1QWFA 3VS7A 1PNJA 2D8HA 2DILA 2EGAA 1K76A 2EQIA 2RNAA 1H3HA 4F16A 1U5SA 2RQWA 4HCKA 4J9EA 1AZEA 2DRMA 4J9GA 2V1RA 2GQIA 2EYWA 2ECZA 4GBQA 1XOVA 1PHTA 4OMMA 1G2BA 2MIOA 1Z9QA 1NM7A 3NPFA 2DLPA 1OPLA 1I1JA 2W10A 3PVQA 4A63B 1FYNA 2JW4A 2EW3A 1GL5A 4J9IA 2AKKA 1B07A 1HSQA 1WYXA 2J6KA 1ZX6A 2RQVA 2A28A 1RLPC 5FW9A 2K7AA 4Z89A 1EFNA 1NLOC 1NG2A 5GJVB 2AKLA 2ENMA 2KYMA 4CC7A 1VYVA 3ULRB 2YDLA 2K79A 1VYUA 2CDTA 2LNHB 4JJCA 2K3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9B A;  1M8M A;  2NUZ A;  1K1Z A;  1GBQ A;  1X6G A;  1X2Q A;  2KNB B;  4AG1 C;  1KSW A;  3UAT A;  2D1X A;  1WI7 A;  2HCK A;  2KGT A;  1QKX A;  2L2P A;  5FWC A;  4HVU A;  2B86 A;  2KXC A;  2ED1 A;  1M27 C;  4CC2 A;  1JXO A;  3O5Z A;  1ZUU A;  2RQR A;  2EBP A;  3R6N A;  4IIO A;  1SHF A;  2HDA A;  4AFQ C;  2DL8 A;  1BU1 A;  5IHN A;  2AZV A;  3U23 A;  3REB B;  3RNJ A;  3I9Q A;  5GJW B;  2LQN A;  2RMO A;  2FPE A;  4JJD A;  1WLP B;  2CRE A;  1SSH A;  3VS0 A;  2YUN A;  2BZY A;  2GNC A;  2K9G A;  5IXB A;  1SPK A;  2J06 A;  1GFD A;  2A08 A;  1M3B A;  3PE0 A;  2CUD A;  4FSS A;  3FJ5 A;  2ESW A;  1BB9 A;  2LCS A;  1T3L A;  4LNP A;  2F2V A;  2CT3 A;  2DL4 A;  1AD5 A;  4OMQ A;  2VWF A;  1B3Q A;  5EC7 A;  4IIM A;  3VS3 A;  2CH4 W;  2ROT A;  2KR3 A;  2A37 A;  1J3T A;  3VRZ A;  1YWO A;  1X43 A;  3H0F A;  3EG2 A;  2D0N A;  2O2O A;  1ABQ A;  4CC4 B;  1TUD A;  4LUD A;  1TG0 A;  3SHW A;  1AOJ A;  2ABL A;  3QWX X;  2HBW A;  1N5Z A;  1GCQ A;  1W70 A;  3I5R A;  1UHF A;  3IQL A;  3M0Q A;  4LE9 A;  4HVW A;  1MV0 B;  3PVL A;  1V1C A;  1NEB A;  4Z8A A;  3NGP A;  2KRM A;  2LZ6 B;  4ZNX A;  3VS4 A;  1OPK A;  4RTT A;  2VKN A;  2H8H A;  4JZ4 A;  1AVZ C;  1G83 A;  2EYX A;  4K11 A;  1UTI A;  1JO8 A;  1H8K A;  2KE9 A;  3TSZ A;  3C0C A;  1M3A A;  4GLM A;  1AWO A;  4AFS C;  1W6X A;  1PWT A;  2OI3 A;  2LX7 A;  3H0I A;  1UFF A;  1YP5 A;  2EYY A;  4OMO A;  1SRL A;  3ZL7 C;  5IXF A;  2O88 A;  2F2W A;  3JV3 A;  1GBR A;  4WCI A;  2L3P A;  2KYB A;  1S1N A;  1AWJ A;  2LJ3 A;  5HCK A;  2M51 A;  1NYF A;  2EPD A;  2J7I A;  5IHK A;  2KEA A;  2JXB A;  1UDL A;  2SRC A;  2YUO A;  2RQU A;  3EG3 A;  1CKA A;  2K6D A;  2A36 A;  4F17 A;  2NWM A;  1U3O A;  3EG0 A;  1NYG A;  4KRT A;  3CQT A;  1A0N B;  2YSQ A;  2JS0 A;  1H92 A;  1UEC A;  3UA6 A;  1K0S A;  1AZG B;  1GCP A;  5ECA A;  3H41 A;  5IH2 A;  1KIK A;  4AFZ C;  2OAW A;  3THK A;  2FPD A;  2CT4 A;  4JJB A;  2MCN A;  2AZS A;  2VVK A;  2HEQ A;  1UUE A;  3EHR A;  1K0X A;  2LP5 A;  2ED0 A;  1OV3 A;  2GBQ A;  4RTW A;  2I0N A;  1YNZ A;  2LJ1 A;  1HJD A;  4X1V A;  4HVV A;  1AWW A;  1LCK A;  2O9V A;  1I07 A;  4D8K A;  2L3Q A;  4AG2 C;  4F14 A;  2BTT A;  4EIK A;  2F2X A;  2EVR A;  2J05 A;  2PTK A;  2W0Z A;  3EGU A;  2FO0 A;  2RN8 A;  3NHN A;  2J6F A;  4QT7 A;  1YN8 A;  1UE9 A;  2IIM A;  1VA7 A;  4DEX A;  1M3C A;  4LUE A;  3LH5 A;  2DX1 A;  4ESR A;  1UG1 A;  2D8J A;  4OML A;  2YUQ A;  2EKH A;  2RQT A;  2YUP A;  1WFW A;  3EG1 A;  5IHI A;  3UF4 A;  2DL5 A;  2C0T A;  1ARK A;  1AEY A;  1SEM A;  1RUW A;  3I35 A;  1GFC A;  4R0K A;  2SEM A;  2EYZ A;  1UJ0 A;  1WX6 A;  2G6F X;  1YCS B;  2X3W D;  2BZX A;  4J9C A;  2DA9 A;  3VS5 A;  1FMK A;  2EGC A;  5I22 A;  2JMA A;  1OEB A;  1JQQ A;  2JTE A;  2DRK A;  4E6R A;  2RPN A;  2FRY A;  2AK5 A;  2BZ8 A;  1QLY A;  4RTV A;  1ZUY A;  3I5S A;  1M30 A;  1W1F A;  4DEY A;  1WXU A;  2FG0 A;  2LQW A;  2DM1 A;  2DE0 X;  1OOT A;  3A98 A;  3QWY A;  2CSQ A;  3TSW A;  4CC3 A;  3REA B;  3VRY A;  1RI9 A;  2LJ0 A;  2KRO A;  2JM9 A;  3NMZ C;  2V1Q A;  4HXJ A;  2DJQ A;  1I0C A;  1ZUK A;  1CSK A;  1K9A A;  1CKB A;  2HSP A;  5I11 A;  4Z88 A;  4D8D A;  1K4U S;  4OMN A;  2XMF A;  1WXT A;  2CUB A;  2LMJ A;  1TUC A;  2DVJ A;  3KFV A;  4JZ3 A;  1E7O A;  2FEI A;  1AWX A;  1UGV A;  1RLQ C;  2GTJ A;  4OMP A;  2QDL A;  3VS6 A;  1T0H A;  2M0Y A;  1NEG A;  2MOX A;  1X27 A;  2KT1 A;  2O9S A;  2L0A A;  1BK2 A;  2CSI A;  2DF6 A;  2JS2 A;  3GBQ A;  3RBB B;  4J9H A;  3M0P A;  1JEG A;  1SRM A;  2RF0 A;  1VYT A;  3VS2 A;  3EHQ A;  1WA7 A;  5FWB A;  1MUZ A;  2E5K A;  1HD3 A;  2DYB A;  4AFU C;  1PKS A;  2EGE A;  1WDX A;  1T0J A;  1Z9Z A;  2DMO A;  2C0I A;  2FPF A;  2JMC A;  2KRN A;  2K2M A;  2PNI A;  2FRW A;  4J9D A;  1IO6 A;  2ROL A;  1UJY A;  2KRS A;  1U06 A;  1MV3 A;  2GTO A;  2KXD A;  1T3S A;  4M4Z A;  4RTX A;  1PRL C;  2DL3 A;  4Y92 A;  1UHC A;  1X6B A;  3M0T A;  1JXM A;  1X2K A;  1QCF A;  1WXB A;  2J6O A;  2DL7 A;  2GGR A;  1ABO A;  4RTU A;  2JT4 A;  3H0H A;  1PKT A;  3M0R A;  2JM8 A;  2C0O A;  2YT6 A;  1KJW A;  3M0S A;  1YWP A;  2O31 A;  4RUG A;  1Y0M A;  1JU5 C;  2CH4 A;  3VS1 A;  2DBM A;  1E6G A;  1SHG A;  1GCQ C;  4RTY A;  1X69 A;  4JPB W;  2KBT A;  1E6H A;  5L23 A;  1KFZ A;  2PZ1 A;  1BBZ A;  2DNU A;  2P4R A;  3SEM A;  1PRM C;  1ZBJ A;  2OJ2 A;  1Y57 A;  4J9F A;  1ZSG A;  3TVT A;  1GRI A;  2X3X D;  1WIE A;  2DBK A;  1ZLM A;  4LN2 A;  3UA7 A;  1QWE A;  2KT8 A;  3M0U A;  2L3S A;  1QKW A;  1NLP C;  4ORZ A;  4RTZ A;  1QWF A;  3VS7 A;  1PNJ A;  2D8H A;  2DIL A;  2EGA A;  1K76 A;  2EQI A;  2RNA A;  1H3H A;  4F16 A;  1U5S A;  2RQW A;  4HCK A;  4J9E A;  1AZE A;  2DRM A;  4J9G A;  2V1R A;  2GQI A;  2EYW A;  2ECZ A;  4GBQ A;  1XOV A;  1PHT A;  4OMM A;  1G2B A;  2MIO A;  1Z9Q A;  1NM7 A;  3NPF A;  2DLP A;  1OPL A;  1I1J A;  2W10 A;  3PVQ A;  4A63 B;  1FYN A;  2JW4 A;  2EW3 A;  1GL5 A;  4J9I A;  2AKK A;  1B07 A;  1HSQ A;  1WYX A;  2J6K A;  1ZX6 A;  2RQV A;  2A28 A;  1RLP C;  5FW9 A;  2K7A A;  4Z89 A;  1EFN A;  1NLO C;  1NG2 A;  5GJV B;  2AKL A;  2ENM A;  2KYM A;  4CC7 A;  1VYV A;  3ULR B;  2YDL A;  2K79 A;  1VYU A;  2CDT A;  2LNH B;  4JJC A;  2K3B A; 
#chains in the Genus database with same CATH topology
 1R0B G;  1M8M A;  3JB9 J;  3QYG B;  1K1Z A;  2ZCF B;  2RI5 A;  1KHC A;  1X2Q A;  5GAO n;  3NFC A;  1KSW A;  2YRC A;  2E1H A;  2KGT A;  2L2P A;  1JJ2 A;  2JTF A;  2B86 A;  2DXU A;  4F04 B;  3ER0 A;  1JXO A;  2VV5 A;  1NPR A;  4IUQ A;  3CCJ A;  2EBP A;  3R6N A;  2ZGW A;  1SHF A;  1G5V A;  1QVF A;  4O5V A;  1BU1 A;  2PU9 B;  3REB B;  1RAD B;  4BI8 B;  2DXT A;  6AT1 B;  4A4H A;  2QA4 A;  4HCC A;  4L5G A;  5CKE A;  1WLP B;  1SSH A;  1VQ4 T;  1TU0 B;  1W2B A;  2L8D A;  3CCR T;  3CCM T;  2GNC A;  2K9G A;  3M4Y A;  4KGX B;  2J06 A;  3GNF B;  4XQ3 A;  1M3B A;  3PE0 A;  2ESW A;  1N8R U;  4KH1 B;  3L2U A;  4F7U G;  1ZSZ B;  5HK3 A;  2DET A;  5GAM e;  3OYE A;  1IGQ A;  3VS3 A;  2CH4 W;  1GXI E;  4JRI A;  4R55 A;  1VIF A;  4RG8 A;  4M77 B;  3E9G A;  2DO3 A;  3EG2 A;  1R0C B;  4JLI A;  3MEA A;  1D1A A;  2NLU A;  1VQO Q;  4JS5 A;  2KDS A;  2HBW A;  3S3N A;  2X4J A;  3I5R A;  5IAY A;  3LGL A;  3M0Q A;  1MMA A;  2XDP A;  1MV0 B;  1V1C A;  4PFZ A;  2RI3 A;  5CQX A;  5A0L A;  2LZ6 B;  3A8H B;  2IPO B;  1G3W A;  2RHX A;  4RTT A;  2H8H A;  4JZ4 A;  1AVZ C;  2HQH A;  2XK0 A;  4MZM A;  4K11 A;  3EG9 B;  1EIF A;  2MF2 A;  2RHI A;  1MMG A;  3L2W A;  2LX7 A;  1M1K C;  2D0Q B;  3WVD B;  4MZT A;  1WHJ A;  1UFF A;  2BIV A;  2EYY A;  2C06 A;  1SRL A;  1VQ5 T;  5IXF A;  4JJN K;  1TUG B;  3UDC A;  2KAF A;  2XU8 A;  1GBR A;  5LJ5 j;  2L3P A;  4A4F A;  2CP6 A;  5HCK A;  2M51 A;  1VUB A;  1NYF A;  1Q86 R;  2EPD A;  2K57 A;  2KEA A;  1UDL A;  3KUF A;  2GQV A;  1RAC B;  3CC2 T;  1CKA A;  2K6D A;  3CXC P;  3M59 A;  3I55 Q;  2DZ9 A;  1NYG A;  2FB7 A;  3G4S A;  1UEC A;  3UA6 A;  2RJE A;  1AZG B;  5GMK j;  1KQS P;  4AFZ C;  3SWN C;  1FMW A;  2ZZD A;  2CT4 A;  2M1H A;  2MCN A;  2VVK A;  4BI3 A;  1M2V A;  2QK0 A;  4N4H A;  3CC7 T;  3CC4 A;  2LJ1 A;  1QQJ A;  3P8B B;  5KYW B;  1UGQ B;  2FVU A;  1VQP T;  4F14 A;  4FYX B;  4EMG A;  3L2Q A;  2FZG B;  4EIK A;  4L59 A;  3MEV A;  2V26 A;  3M56 A;  2CZ6 B;  3EGU A;  3JRZ A;  1X01 A;  4QT7 A;  2HKN A;  2EJF A;  1K73 C;  1UE9 A;  1M3C A;  1TSF A;  4BE0 A;  3LH5 A;  3CCL Q;  4ESR A;  3HP9 A;  3JAM E;  5FU6 B;  2EKH A;  1KD1 R;  4EMK A;  1QMC A;  3TCJ A;  3JCM J;  1BI3 A;  3JCM b;  2M0O A;  3JCM e;  2XID A;  1GFC A;  4R0K A;  4KH0 B;  2EYZ A;  4M7A D;  3MP6 A;  5L8R E;  3CME A;  3L42 A;  2X3W D;  5LJ3 d;  2MK5 A;  2JTM A;  3A8M B;  2JMA A;  1JQQ A;  2CZ1 B;  2JTE A;  2DRK A;  1JJ2 P;  2RPN A;  3GPL A;  3R6O A;  2AK5 A;  1QLY A;  1NPP A;  1ZUY A;  3I5S A;  1I4K 1;  2QEX T;  2LQW A;  3CCS T;  4JLG A;  2DE0 X;  4M7D G;  4A4K A;  1KC8 C;  4IUT A;  3QWY A;  2PUO B;  2HD0 A;  2COW A;  4BB7 A;  3OYC A;  4E7L A;  3J7A F;  4FT4 A;  2LJ0 A;  2LTO A;  2JM9 A;  4C5H A;  1ZUK A;  1CSK A;  5CKH A;  4M77 F;  2DZC A;  3QSU A;  2P0P A;  2WSF E;  4LDW A;  2A0F B;  1CKB A;  4PFP A;  5GMK m;  4QQ6 A;  4E7I A;  5CVI A;  4E47 A;  1EX4 A;  4C92 E;  3V8L A;  3CME Q;  1UGV A;  4HT8 A;  3RER A;  3VS6 A;  1T0H A;  1X27 A;  2DVE A;  4E7Z A;  3QDR B;  2O9S A;  4M77 C;  4NL2 A;  1BK2 A;  1S72 A;  4XAX B;  3L2V A;  3GBQ A;  4WTO B;  3M0P A;  3E1S A;  5GAN d;  2E5K A;  1HD3 A;  1W4S A;  1PKS A;  4J6W A;  5KYU A;  2EJ9 A;  2PUK B;  2KRN A;  3G71 A;  1IO6 A;  2ROL A;  3QDF A;  2D9T A;  3JCM f;  4C8Q G;  2X4X A;  4M7D E;  1MV3 A;  1M5Q 1;  3M0T A;  3RR6 A;  2HL5 C;  3M53 A;  1YFN A;  4N0A C;  3MP8 A;  2JT4 A;  3CC2 A;  2EKO A;  4QVC A;  4PJO A;  2YT6 A;  4MDW A;  3M0S A;  4FSX A;  5CR2 A;  4P5N A;  2XG8 D;  2HBP A;  2RJD A;  3QJ6 A;  2E10 A;  1E6G A;  1GCQ C;  2K3Y A;  4Z02 A;  1YI2 A;  1X69 A;  4JPB W;  4C0G A;  2I2L A;  1S72 Q;  1RI0 A;  2XD0 A;  1BBZ A;  5J39 A;  1OX8 A;  3HHT B;  1LOJ A;  3OYJ A;  2X51 A;  3E9F A;  1PRM C;  3CCE T;  3CCQ T;  1NZ9 A;  2RHZ A;  3FDR A;  4J9F A;  3MP1 A;  1ZSG A;  2DD5 A;  2X3X D;  1WIE A;  2DBK A;  4C92 D;  4LN2 A;  5I21 A;  1G3S A;  3M9Q A;  5DLQ E;  1OZ3 A;  2GFU A;  4RTZ A;  1WHK A;  5GAO q;  4X34 A;  2D8H A;  3VS7 A;  3G6E T;  1K76 A;  2RNA A;  3JCM Q;  4F16 A;  4PJL A;  4ZGE B;  1TXQ A;  2JOY A;  5M9O A;  2CP7 A;  2DTH A;  1D3B A;  2E4H A;  2EYW A;  4C8Q E;  3DLM A;  1MHN A;  5C0M A;  4OGC A;  1Y07 A;  4RCC A;  1HK9 A;  1M90 R;  3NPF A;  1ZHI A;  5D6W A;  3A5Z B;  2W10 A;  1RAI B;  1YI2 Q;  1M1K U;  2CZ7 B;  3FRN A;  5HY6 A;  5GAM d;  2CP5 A;  3C12 A;  5FU6 C;  5LL6 S;  1B07 A;  1U8R A;  4M78 E;  3TRE A;  1YJW A;  2RQV A;  2QEX A;  4E2F B;  3CCS A;  3ZBD A;  1V29 B;  2RHY A;  5FLX E;  5LJ5 e;  3RES A;  2RA2 A;  4FM4 B;  2KYM A;  2EWN A;  2AT1 B;  1VYU A;  2L3R A;  1PG5 B;  4PJO G;  1QP3 A;  1QVF S;  4N4G A;  2KMT A;  2KNB B;  4AG1 C;  2FYK A;  3CBM A;  1WI7 A;  1QKX A;  2ZPI B;  3X20 B;  4HVU A;  2KXC A;  2K5L A;  5GMK e;  2Y4Y A;  3O5Z A;  1ZUU A;  4TVR A;  1W2B S;  1JBM A;  1VQ8 T;  2R57 A;  2DL8 A;  5GAN h;  4M7D B;  3RNJ A;  4BE2 A;  2EJG A;  2RMO A;  3CMA A;  4JJD A;  3VS0 A;  5CO7 A;  1K73 U;  1YJW Q;  1Y96 B;  2BZY A;  5IXB A;  3VJP A;  3EGX B;  3HL8 A;  3JCM W;  1GFD A;  1VOM A;  2RK1 A;  3A8L B;  4GY5 A;  2LCS A;  3OSS C;  3RKX A;  2EIF A;  4LXC A;  3JB9 I;  1B3Q A;  3DB4 A;  4D6W A;  2WAC A;  2QQB A;  2A37 A;  1YWO A;  5GAN 7;  4M78 D;  2D0N A;  3UT1 A;  4J83 A;  4XU3 A;  1IB8 A;  3EH2 A;  3CEY A;  2OAU A;  3SHW A;  4C0D C;  2ABL A;  3QWX X;  2K2V A;  1N5Z A;  4C0F A;  1YJ9 Q;  3QKJ A;  4KUL A;  1KC8 U;  4EMK B;  3JCM P;  4M7A A;  3CMA Q;  4X9D A;  3PVL A;  1VQ6 T;  4ZNX A;  4C8Q B;  1RAH B;  2VKN A;  2DD4 A;  1JO8 A;  1O75 A;  3C0C A;  2YHT A;  1HYO A;  2E65 A;  1M3A A;  4FW2 A;  4GLM A;  3JCM d;  4AFS C;  2B8A A;  3CCE A;  3CCQ A;  2OI3 A;  4FYV B;  3OYK A;  1YP5 A;  2L89 A;  4AT1 B;  2F2W A;  4J6Y A;  1FMV A;  1M1F A;  3HRU A;  4WCI A;  1YJN T;  1S1N A;  1AWJ A;  2LJ3 A;  3CD6 T;  3QBY A;  2OTL A;  4M78 B;  2ZPE B;  4FW1 A;  3LWI A;  4V2S A;  2SRC A;  1M9S A;  2D6F A;  2RH2 A;  3F70 A;  1M90 C;  4J8O A;  3GF5 A;  2NWM A;  3RDV A;  2HQE A;  2A7Y A;  1I5O B;  3LYI A;  1M8V A;  2JS0 A;  4EPC A;  1H92 A;  3QZ9 B;  1YBY A;  3H41 A;  4PL6 A;  4XTV A;  1VQ7 Q;  4M77 D;  5GAN 5;  3EFO B;  3OS0 A;  4MMK A;  1NJI R;  3H9N A;  2ED0 A;  4E7H A;  4XTY A;  2GBQ A;  2I0N A;  4N4I A;  1IZ6 A;  1HJD A;  5GAN 2;  2CGH A;  1AWW A;  1LCK A;  4C92 F;  2L3Q A;  1M2O A;  1MMN A;  4AG2 C;  3CCU A;  7AT1 B;  3OS2 A;  3PIO A;  3CBO A;  4B6M A;  4JS4 A;  1YN8 A;  1VQ9 Q;  1VA7 A;  3SD4 A;  3M5A A;  4DEX A;  2OTL Q;  4DBF A;  2DX1 A;  2D8J A;  2CP2 A;  1WFW A;  5IHI A;  4C92 C;  2R5A A;  2LVM A;  3OBY A;  3OYD A;  2DL5 A;  4M7A G;  3JB9 F;  4M75 G;  1Q82 R;  1JB0 E;  1VQK T;  5A0D A;  5KYX A;  1UJ0 A;  2NUT A;  4M7D F;  1EZZ B;  1WX6 A;  4OP0 A;  5IT9 E;  5KYY B;  2BZX A;  2QQ9 A;  3CCJ Q;  3RKY A;  2EGC A;  5I22 A;  3OYI A;  4DOV A;  4E6R A;  3V8J A;  4PJO B;  4FYW B;  4RTV A;  4FT2 A;  1M30 A;  1WHL A;  2FG0 A;  1K9M R;  2DM1 A;  2QA4 Q;  3CCU Q;  1TWB A;  3VU3 C;  4XTU A;  3A98 A;  3ZFJ A;  9ATC B;  4M7D C;  1YIJ A;  3REA B;  3VRY A;  2AIR B;  1YHQ A;  2MAM A;  1H64 1;  5AYF A;  2K3X A;  3BY7 A;  1VQN T;  4LDY A;  3TU4 K;  1K9A A;  2DFU A;  2ZPG B;  1DJ7 B;  2LDM A;  2H3E B;  5I11 A;  4D8D A;  1KG1 A;  2XMF A;  5D6X A;  8AT1 B;  4F7U E;  3BW1 A;  3KFV A;  1E7O A;  1AWX A;  1NBE B;  1IRX A;  4OMP A;  4ZTF A;  2MOX A;  1JRI A;  2NUP B;  5LJ3 g;  3CCV T;  2QGG A;  3OYH A;  1YIT A;  2WSE E;  4C8Q F;  2JS2 A;  2Z0W A;  4WF2 A;  5FRM A;  1SRM A;  1IGU A;  2RF0 A;  4J6X A;  3HFN A;  1MUZ A;  2DYB A;  2GFA A;  2EGE A;  3E19 A;  2LQK A;  5AT1 B;  1YIJ Q;  1Z9Z A;  2DMO A;  2C0I A;  2RJF A;  3I56 A;  1YHQ Q;  5GMK l;  2OTJ T;  1UJY A;  5CIU A;  4RTX A;  3CPW A;  4C8Q C;  1PRL C;  4Y92 A;  4M78 F;  5C6S A;  1QCF A;  2MI6 A;  2LX9 A;  4KGZ B;  5FRN A;  2GGR A;  3M57 A;  3C4S A;  2JM8 A;  2C0O A;  2O4X A;  5LJ5 d;  1Y0M A;  2YWW A;  2R5M A;  1NJI C;  2E12 A;  4IKF A;  2XIC A;  3SWN A;  3OMG A;  1SHG A;  3VYH B;  4PJN A;  1UGP B;  2FL7 A;  4M78 C;  3G4S Q;  1YIT Q;  5L23 A;  4BD3 A;  5D6Y A;  3OA6 A;  3RUX A;  3SEM A;  4XU2 A;  1ZBJ A;  3OSV A;  4Y91 A;  1G8X A;  3TVT A;  3Q1J A;  3OYN A;  2PQW A;  3CC4 Q;  1WHH A;  5GAN g;  4PKC C;  3OB9 A;  1QWE A;  2YXY A;  3I56 Q;  1VQ4 A;  2L3S A;  3CCR A;  2E5Q A;  1NLP C;  4ORZ A;  1Y71 A;  1QWF A;  3CCM A;  4ZN1 A;  1ZA2 B;  1QVF P;  5I2M A;  3ASK A;  2EQI A;  1H3H A;  1AT1 B;  1FX7 A;  4BAC A;  3QG1 A;  1R8O B;  4HCK A;  4J9G A;  5DM7 R;  2X4Y A;  4XTZ A;  2M16 A;  2ECZ A;  4GBQ A;  3VKI A;  5GAN j;  4OMM A;  5GAO m;  1W2B P;  1G2B A;  4NS5 A;  2MIO A;  4PJJ A;  1BYM A;  1NM7 A;  1OPL A;  3JCM X;  1KQ2 A;  4FL6 A;  2QTX A;  4A53 A;  3A8G B;  4A63 B;  2JNG A;  4VUB A;  1FYN A;  1PM3 A;  3MPU B;  2JW4 A;  3OYG A;  4JRP A;  2RB6 A;  1ZSZ C;  1GL5 A;  1PD0 A;  4J9I A;  2AKK A;  3EGD B;  1HSQ A;  1WYX A;  4JDS A;  2COZ A;  1ZX6 A;  4OF1 A;  4F7U B;  2A28 A;  2RD1 A;  2K7A A;  4ZGD B;  2E6Z A;  1Q7Y R;  1TS9 A;  1M90 U;  2QQR A;  1VQ4 Q;  2E6N A;  2ENM A;  3CCR Q;  3NTH A;  4M75 B;  4QVD A;  3CCM Q;  1VQM T;  2YDL A;  1WZO A;  4JJC A;  2LNH B;  2K3B A;  4J7F A;  3O8V A;  4JRK A;  1YJ9 T;  5GMK i;  2NUZ A;  1GBQ A;  1X6G A;  1Q86 C;  1VQ5 A;  1QVG A;  3UAT A;  5FWC A;  2LNV A;  2BUD A;  4CC2 A;  1D0X A;  4RG2 A;  5KH6 A;  2CP0 A;  1V76 A;  3EFS A;  4LDV A;  4DOW A;  3OYF A;  4IIO A;  4AFQ C;  2AZV A;  3U23 A;  1I8F A;  3I9Q A;  3DLL A;  5GJW B;  2LQN A;  1Q95 G;  5GAM g;  4NOY A;  1VQL T;  1BCO A;  4M77 A;  3CCV A;  3OW2 A;  4HT9 A;  4A4G A;  2CRE A;  2YUN A;  5KE3 A;  1SPK A;  2M9U A;  3LWH A;  4ANJ A;  2A08 A;  8ATC B;  2CUD A;  4FSS A;  3M55 A;  3FJ5 A;  1PD1 A;  3CC7 A;  3X25 B;  4C5E A;  1KK7 A;  4LNP A;  3SB2 A;  2DL4 A;  3NTI A;  4IUV A;  1FXX A;  4OMQ A;  4QQD A;  2VWF A;  3JB9 H;  3QZ5 B;  1VQP A;  4IIM A;  3CXC S;  2OX7 A;  2ROT A;  1ZQ1 A;  2KR3 A;  3G71 Q;  1VQ5 Q;  2JJ9 A;  3VRZ A;  4BY6 B;  2VGM A;  3H0F A;  1KD1 C;  4N0A A;  2O2O A;  1ABQ A;  4QKU A;  2E3H A;  1TUD A;  5LJ3 h;  2QQS A;  1TG0 A;  2CP3 A;  3MKD A;  3BDU A;  1BCM A;  1HXD A;  3CC2 Q;  1GCQ A;  1W70 A;  3X28 B;  2HQX A;  3IQL A;  4LE9 A;  4HVW A;  2QAZ A;  1NEB A;  3NGP A;  3JB9 D;  3J80 E;  4DA4 A;  3VS4 A;  3SDZ A;  1OPK A;  1Y7X A;  2EYX A;  3TSZ A;  2KE9 A;  4M7D D;  5KYX B;  1W6X A;  1PWT A;  1WNL A;  3HKS A;  4QW2 A;  2EQM A;  1I81 A;  2HSE B;  3CC7 Q;  3BE3 A;  1OYX A;  1X6O A;  4J5Y A;  4YTL A;  1XQH A;  1LPL A;  4XU0 A;  1VQP Q;  2DTO A;  2A3L A;  1ZBX A;  1VQO T;  1IXD A;  2HMA A;  2E3I A;  2HZY A;  5KYW A;  2RQU A;  3EG3 A;  4RMO A;  4DBR A;  2A36 A;  3HPW A;  3EG0 A;  4IUR A;  4M77 G;  4KRT A;  3CQT A;  1A0N B;  5ECA A;  1KIK A;  2OAW A;  2EFI A;  2FPD A;  3UWN A;  2FHD A;  1RAB B;  3RKW A;  1P92 A;  1UUE A;  1K0X A;  1OZ2 A;  4MML A;  5EG2 A;  2LP5 A;  1Q7Y C;  1OV3 A;  2YLB A;  2EQJ A;  2MWP A;  1PSF A;  2COY A;  2O9V A;  4F7U F;  4ELY C;  2XHC A;  4D8K A;  4XU1 A;  2VXF A;  2BTT A;  4E7J A;  1N27 A;  1QCN A;  5GAO r;  2WSC E;  2AHJ B;  1ZA1 B;  3OY9 A;  2F2X A;  3M54 A;  2J05 A;  2PTK A;  4C8Q D;  2QEX Q;  2PVD B;  2W0Z A;  3CCS Q;  2FO0 A;  2RN8 A;  2J6F A;  5D7U A;  3I55 T;  1NJI U;  3VV0 A;  2X35 A;  4FYY B;  1IHW A;  1M2V B;  1UG1 A;  1SG5 A;  5CAI A;  2RQT A;  2YUP A;  3EG1 A;  4ATO A;  2P0K A;  1ARK A;  1AEY A;  2HL3 A;  4ZTJ A;  3I35 A;  3QXE B;  1WQ7 A;  2MWO A;  2F5K A;  4M75 C;  4QVZ A;  3TEE A;  3PMT A;  1X75 C;  1B7T A;  2G6F X;  4PJO E;  2GCX A;  3VS5 A;  1FMK A;  3CXC A;  2QDY B;  2FRY A;  2ZPH B;  2O4X B;  3BFM A;  4XK8 E;  1WQW A;  2K4Y A;  2MMP A;  3SFM A;  1W1F A;  1BIA A;  4Y28 E;  5GAN 3;  3SWN B;  1M1K R;  1OOT A;  1M1G A;  3PT9 A;  2CSQ A;  3TSW A;  3WXM B;  4CC3 A;  3CCL T;  3HSB A;  1RI9 A;  2DEQ A;  2KRO A;  1MNE A;  4J7I A;  2V1Q A;  4HXJ A;  2DJQ A;  4MDX A;  1I0C A;  5GAN e;  1WHG A;  1RAE B;  1FWZ A;  2XDD A;  2DKG A;  1D0Z A;  2HSP A;  3G6E A;  4Z88 A;  3S6W A;  4OMN A;  5GAM h;  4OB1 B;  5CKD A;  3OBW A;  2RM4 A;  2XI9 A;  2LC4 A;  4JZ3 A;  2LQ8 A;  1RLQ C;  5CCA A;  1AHJ B;  2QDL A;  2DER A;  2M0Y A;  2MPX C;  5LJ3 f;  2JUF A;  4CI0 C;  4HA8 A;  2KT1 A;  1OX9 A;  2L0A A;  2CSI A;  4BY6 C;  2DF6 A;  3LX7 A;  4BDZ A;  3RBB B;  2QAS A;  3J81 E;  3CPW S;  3MO8 A;  2VC8 A;  1OU9 A;  1VYT A;  2KI7 A;  1WJQ A;  1OQK A;  1WGS A;  1Q86 U;  1WA7 A;  4XTX A;  4AFU C;  3RIR A;  1WDX A;  1T0J A;  3A8O B;  2JMC A;  2K2M A;  2PNI A;  4PNO A;  2FRW A;  3CCE Q;  4PJO D;  3CCQ Q;  3QHS A;  1K73 R;  1OUL A;  2GTO A;  2KXD A;  3AHU A;  1XTD A;  1UHC A;  2XKO C;  1VQO A;  1X2K A;  2P0Q A;  1O9S A;  2J6O A;  3CME T;  4B9X A;  3VUZ A;  3G6E Q;  3H0H A;  3DKM A;  3M0R A;  1G3T A;  1KJW A;  2O01 E;  1UB4 A;  4RUG A;  1JU5 C;  3GIB A;  3CPF A;  3FJP A;  2DBM A;  4PK4 A;  4FIB A;  5KYU B;  2LCL A;  5HKC A;  1QVP A;  1BKB A;  1SKU B;  2DEU A;  4B9W A;  1KFZ A;  1C1A A;  4OB2 B;  1VQ8 A;  2DNU A;  2HNI A;  4PFO A;  5DY9 A;  2P4R A;  3V7R A;  3DB3 A;  1K8A R;  1OU8 A;  1Y57 A;  3H8Z A;  3OS5 A;  1KC8 R;  4C5I A;  4BI4 A;  1ACM B;  1GRI A;  5GAN f;  1KD1 U;  3AT1 B;  3MCA B;  2DTI A;  1SF9 A;  4Q5W A;  1RAG B;  3M0U A;  3N5B B;  4OB0 B;  1QKW A;  1QW1 A;  1D09 B;  5FU7 B;  3VYG A;  3OYM A;  4FCY A;  3I55 A;  3EAE A;  1U5S A;  1Q81 R;  2RQW A;  4DQ2 A;  1WHM A;  4J9E A;  2DRM A;  4C92 A;  2RO0 A;  3JCM c;  1PHT A;  4ZN3 A;  1KQ1 A;  1S72 T;  1Z9Q A;  5LJ5 g;  3UPU A;  3LGF A;  3PVQ A;  5KCO A;  4QQG A;  1D0Y A;  2RJC A;  3QO3 A;  1RAA B;  1XJW B;  4AMC A;  5CQY A;  3FC3 A;  3JCM h;  1BI1 A;  1VQ8 Q;  2CKK A;  3MEU A;  1MMD A;  5A0G A;  3G71 T;  4M7A E;  2J6K A;  1M4Z A;  1LVK A;  1BI2 A;  2CZ0 B;  4LD6 A;  1D3B B;  4M75 E;  2YRV A;  4OGE A;  1RLP C;  1QVG S;  1VQ6 A;  2VUB A;  1BIB A;  4M7D A;  1RL2 A;  2YLC A;  1NG2 A;  3CCL A;  4RCB A;  5GAO l;  4CC7 A;  3ULR B;  3GOX A;  2JN0 A;  2K79 A;  2CDT A;  3C94 A;  4J9B A;  2P4T A;  1C6V X;  1WJR A;  2D1X A;  4EMK C;  5LJ3 j;  1Y96 A;  2HCK A;  2MYS A;  2ED1 A;  1M27 C;  3EGX A;  1QCO A;  3OW2 S;  3CBP A;  1YJN A;  1YI2 T;  3E2U A;  3CD6 A;  2RQR A;  1Q7Y U;  3A1P A;  4MZP A;  2HDA A;  5IHN A;  3OYB A;  1N8R R;  3D7S B;  2VYT A;  3H6Z A;  2E64 A;  3OQ5 A;  2F69 A;  5GAM f;  4KUI A;  1U1S A;  2FPE A;  1LJO A;  1LNX A;  2DIQ A;  2ZAE A;  4FU6 A;  4EMH A;  1UGS B;  5HK0 A;  1VQ6 Q;  5GAN 8;  1IHV A;  3URG A;  1SSF A;  3HRS A;  1BB9 A;  2V8K A;  1T3L A;  2RI2 A;  2F2V A;  3OYL A;  2CT3 A;  1AD5 A;  4C92 G;  5KCH A;  5EC7 A;  1B34 A;  4ZGJ B;  1BI0 A;  4C8Q A;  3HFO A;  2K5F A;  1OI1 A;  1J3T A;  5FRO A;  3ZEH A;  1X43 A;  4OVA A;  2HAX A;  2DXB A;  4XTW A;  1YJN Q;  4M75 D;  3QPH A;  3CD6 Q;  4CC4 B;  1VIE A;  2LCC A;  4LUD A;  3MET A;  1MND A;  3INZ A;  4JRQ A;  2CS7 A;  2QXF A;  1Q82 C;  1AOJ A;  5J3B A;  4R56 A;  3JB9 G;  2QYZ A;  1TOV A;  1UHF A;  2EQU A;  2IVW A;  1YJW T;  1K8A C;  2JZ2 A;  4M78 A;  4Z8A A;  2KRM A;  1VQK A;  1G83 A;  3L1A A;  3P8D A;  2PVG B;  4BUG A;  1UTI A;  1H8K A;  2V8J A;  2JVV A;  2L5Q A;  1AWO A;  1K9M C;  4DBQ A;  3H0I A;  4PJO F;  4OMO A;  4KBM B;  1Q81 C;  3ZL7 C;  3EFO A;  2O88 A;  3JV3 A;  4LD9 K;  1WPY A;  2ZPB B;  2G3R A;  2KYB A;  2E41 A;  3PMI A;  4M7A B;  1N9S A;  2J7I A;  5IHK A;  2JXB A;  2YUO A;  2P84 A;  1XNI A;  4F17 A;  1U3O A;  3KBG A;  2K5I A;  3OYA A;  2QI2 A;  3CMA T;  4PJO C;  4A54 A;  2YSQ A;  1VQN A;  1K0S A;  4CRI A;  4L6V 5;  1GCP A;  5IH2 A;  5KYN A;  2KSS A;  3EFR A;  5FU7 C;  1N6A A;  3THK A;  2VB6 A;  4HCZ A;  2EYQ A;  2Y90 A;  2AZS A;  3C95 A;  2HEQ A;  3EHR A;  2BE9 B;  1VQK Q;  2QQA A;  2H3J A;  1ZSZ A;  4RTW A;  1YNZ A;  2DYI A;  4C0D B;  2V8I A;  4LDX A;  4X1V A;  4HVV A;  1I07 A;  3OMC A;  3FB9 A;  4C0Z A;  2EVR A;  4OMF B;  1NE8 A;  2RK2 A;  5KYY A;  2R58 A;  3NHN A;  3NTK A;  3G7Z A;  5DLO A;  2IIM A;  4LUE A;  3ME9 A;  2DJZ A;  5GAN 6;  5CKF A;  4OML A;  5LJ5 h;  2YUQ A;  1QP2 A;  5GAM j;  2OTJ A;  1VQ7 T;  4EDU A;  1F1B B;  1N8R C;  2XDB A;  3UF4 A;  2CYZ B;  2C0T A;  4M78 G;  1SEM A;  5KE2 A;  3PFS A;  1RUW A;  4NL3 A;  1VQN Q;  2SEM A;  4RKU E;  3LLR A;  3EG9 A;  2M02 A;  1KQS S;  1YCS B;  2DIG A;  4J9C A;  1TTH B;  2DAQ A;  2DA9 A;  5GMK h;  3M58 A;  3VUB A;  1OEB A;  2E70 A;  2BZ8 A;  3CPW P;  4DEY A;  1WXU A;  3PGG A;  3CCV Q;  3TQ7 P;  2VGN A;  4ME7 A;  5IN1 A;  1VQ9 T;  1PSE A;  2OTL T;  4GLK A;  3LW5 E;  4JUV A;  4HKE A;  3V7C A;  2NUT B;  3QII A;  4PLL A;  2NUP A;  2YRD A;  3NMZ C;  1D1C A;  3S3O A;  2FZK B;  1RAF B;  3L2R A;  4A4E A;  3PTA A;  4HCB A;  2OTJ Q;  3QJY A;  1G3Y A;  2QGF B;  3RMQ A;  1K4U S;  3CCJ T;  1WXT A;  2CUB A;  2LMJ A;  2LT1 A;  3T9N A;  5CK9 A;  1TUC A;  2DVJ A;  2QG9 B;  3JSC A;  2FEI A;  2LRQ A;  3PNW C;  1YCY A;  2GTJ A;  1NEG A;  2QA4 T;  5CKB A;  3CCU T;  3MEW A;  4C92 B;  2DK3 A;  4PJM A;  3GNG A;  1TH7 A;  1JJ2 S;  4OB3 B;  2DXC A;  4J9H A;  2LT4 A;  2KY9 A;  4KUD K;  2FZC B;  1JEG A;  3VS2 A;  3GLX A;  3EHQ A;  5FWB A;  4UC4 A;  3S3M A;  2IG0 A;  2FPF A;  3FIF A;  3L2Z A;  2X9H A;  4J9D A;  3V8K A;  3GP8 A;  3V7S A;  5LJ3 e;  2VXE A;  3PIP A;  4O6J A;  2KRS A;  1U06 A;  3JCM g;  1T3S A;  4M4Z A;  4E7S A;  2DL3 A;  4C5G A;  4M7A F;  2RHU A;  3QUI A;  1X6B A;  1JXM A;  4M75 F;  1WXB A;  1KHI A;  4ELZ C;  1VQM A;  2DL7 A;  1ABO A;  4RTU A;  1WJS A;  1PKT A;  2DPP B;  4II1 A;  4X9C A;  1YJ9 A;  1YWP A;  2O31 A;  2CH4 A;  3M4G A;  1I5L A;  3HRT A;  3VS1 A;  3FEO A;  4RTY A;  1MGQ A;  2ZPF B;  2GF7 A;  4M7A C;  3WVE B;  3EH1 A;  2KBT A;  1E6H A;  2KK4 A;  2PZ1 A;  2PVO B;  1R77 A;  2NYS A;  1C0M A;  1UGR B;  1YIJ T;  1YHQ T;  2F1L A;  4IUP A;  2OJ2 A;  4M77 E;  1QVG P;  1VQL A;  3G1J A;  5J26 A;  3P8H A;  4DBH A;  3X24 B;  4KGV B;  2X4W A;  1ZLM A;  3UA7 A;  2BE7 D;  3JCM V;  2KT8 A;  3OS1 A;  3QYH B;  3OYY A;  3BDL A;  1PNJ A;  1KQS A;  3MHX A;  1Q82 U;  2DIL A;  2EGA A;  2QTV A;  2VAS A;  3X26 B;  5I2S A;  1U1T A;  2EQK A;  4BE1 A;  3EGD A;  1N9R A;  1UEB A;  1AZE A;  1VQM Q;  1K8A U;  3LH0 A;  2KVQ G;  2V1R A;  2GQI A;  4F7U A;  3OW2 P;  1VQ7 A;  2Y4X A;  2BKD N;  1XOV A;  5GAN 4;  3RMS A;  3G4S T;  4KT0 E;  1PC0 A;  5LJ5 f;  1B34 B;  1YIT T;  3KXT A;  3HTR A;  4M75 A;  2DLP A;  1I1J A;  2EAY A;  1K9M U;  4IUU A;  1PCX A;  2EW3 A;  1IRE B;  4LDU A;  1Q81 U;  2HKQ B;  4PLI A;  5GAO p;  3CC4 T;  3I56 T;  2F5T X;  1H3Z A;  1VQL Q;  2KQW A;  2ATC B;  3MJX A;  5FW9 A;  1VQ9 A;  3FLG A;  4Z89 A;  1EFN A;  1NLO C;  5GJV B;  2AKL A;  4BDY A;  1D1B A;  1VYV A;  4E7K A;  4JJB A;  5A2Q E; 
#chains in the Genus database with same CATH homology
 4J9B A;  1M8M A;  2NUZ A;  1K1Z A;  1GBQ A;  1X6G A;  1X2Q A;  2KNB B;  4AG1 C;  1KSW A;  3UAT A;  2D1X A;  1WI7 A;  2HCK A;  2KGT A;  1QKX A;  2L2P A;  5FWC A;  4HVU A;  2B86 A;  2KXC A;  2ED1 A;  1M27 C;  4CC2 A;  1JXO A;  3O5Z A;  1ZUU A;  2RQR A;  2EBP A;  3R6N A;  4IIO A;  1SHF A;  2HDA A;  4AFQ C;  2DL8 A;  1BU1 A;  5IHN A;  2AZV A;  3U23 A;  3REB B;  3RNJ A;  3I9Q A;  5GJW B;  2LQN A;  2RMO A;  2FPE A;  4JJD A;  1WLP B;  2CRE A;  1SSH A;  3VS0 A;  2YUN A;  2BZY A;  2GNC A;  2K9G A;  5IXB A;  1SPK A;  2J06 A;  1GFD A;  2A08 A;  1M3B A;  3PE0 A;  2CUD A;  4FSS A;  3FJ5 A;  2ESW A;  1BB9 A;  2LCS A;  1T3L A;  4LNP A;  2F2V A;  2CT3 A;  2DL4 A;  1AD5 A;  4OMQ A;  2VWF A;  1B3Q A;  5EC7 A;  4IIM A;  3VS3 A;  2CH4 W;  2ROT A;  2KR3 A;  2A37 A;  1J3T A;  3VRZ A;  1YWO A;  1X43 A;  3H0F A;  3EG2 A;  2D0N A;  2O2O A;  1ABQ A;  4CC4 B;  1TUD A;  4LUD A;  1TG0 A;  3SHW A;  1AOJ A;  2ABL A;  3QWX X;  2HBW A;  1N5Z A;  1GCQ A;  1W70 A;  3I5R A;  1UHF A;  3IQL A;  3M0Q A;  4LE9 A;  4HVW A;  1MV0 B;  3PVL A;  1V1C A;  1NEB A;  4Z8A A;  3NGP A;  2KRM A;  2LZ6 B;  4ZNX A;  3VS4 A;  1OPK A;  4RTT A;  2VKN A;  2H8H A;  4JZ4 A;  1AVZ C;  1G83 A;  2EYX A;  4K11 A;  1UTI A;  1JO8 A;  1H8K A;  2KE9 A;  3TSZ A;  3C0C A;  1M3A A;  4GLM A;  1AWO A;  4AFS C;  1W6X A;  1PWT A;  2OI3 A;  2LX7 A;  3H0I A;  1UFF A;  1YP5 A;  2EYY A;  4OMO A;  1SRL A;  3ZL7 C;  5IXF A;  2O88 A;  2F2W A;  3JV3 A;  1GBR A;  4WCI A;  2L3P A;  2KYB A;  1S1N A;  1AWJ A;  2LJ3 A;  5HCK A;  2M51 A;  1NYF A;  2EPD A;  2J7I A;  5IHK A;  2KEA A;  2JXB A;  1UDL A;  2SRC A;  2YUO A;  2RQU A;  3EG3 A;  1CKA A;  2K6D A;  2A36 A;  4F17 A;  2NWM A;  1U3O A;  3EG0 A;  1NYG A;  4KRT A;  3CQT A;  1A0N B;  2YSQ A;  2JS0 A;  1H92 A;  1UEC A;  3UA6 A;  1K0S A;  1AZG B;  1GCP A;  5ECA A;  3H41 A;  5IH2 A;  1KIK A;  4AFZ C;  2OAW A;  3THK A;  2FPD A;  2CT4 A;  4JJB A;  2MCN A;  2AZS A;  2VVK A;  2HEQ A;  1UUE A;  3EHR A;  1K0X A;  2LP5 A;  2ED0 A;  1OV3 A;  2GBQ A;  4RTW A;  2I0N A;  1YNZ A;  2LJ1 A;  1HJD A;  4X1V A;  4HVV A;  1AWW A;  1LCK A;  2O9V A;  1I07 A;  4D8K A;  2L3Q A;  4AG2 C;  4F14 A;  2BTT A;  4EIK A;  2F2X A;  2EVR A;  2J05 A;  2PTK A;  2W0Z A;  3EGU A;  2FO0 A;  2RN8 A;  3NHN A;  2J6F A;  4QT7 A;  1YN8 A;  1UE9 A;  2IIM A;  1VA7 A;  4DEX A;  1M3C A;  4LUE A;  3LH5 A;  2DX1 A;  4ESR A;  1UG1 A;  2D8J A;  4OML A;  2YUQ A;  2EKH A;  2RQT A;  2YUP A;  1WFW A;  3EG1 A;  5IHI A;  3UF4 A;  2DL5 A;  2C0T A;  1ARK A;  1AEY A;  1SEM A;  1RUW A;  3I35 A;  1GFC A;  4R0K A;  2SEM A;  2EYZ A;  1UJ0 A;  1WX6 A;  2G6F X;  1YCS B;  2X3W D;  2BZX A;  4J9C A;  2DA9 A;  3VS5 A;  1FMK A;  2EGC A;  5I22 A;  2JMA A;  1OEB A;  1JQQ A;  2JTE A;  2DRK A;  4E6R A;  2RPN A;  2FRY A;  2AK5 A;  2BZ8 A;  1QLY A;  4RTV A;  1ZUY A;  3I5S A;  1M30 A;  1W1F A;  4DEY A;  1WXU A;  2FG0 A;  2LQW A;  2DM1 A;  2DE0 X;  1OOT A;  3A98 A;  3QWY A;  2CSQ A;  3TSW A;  4CC3 A;  3REA B;  3VRY A;  1RI9 A;  2LJ0 A;  2KRO A;  2JM9 A;  3NMZ C;  2V1Q A;  4HXJ A;  2DJQ A;  1I0C A;  1ZUK A;  1CSK A;  1K9A A;  1CKB A;  2HSP A;  5I11 A;  4Z88 A;  4D8D A;  1K4U S;  4OMN A;  2XMF A;  1WXT A;  2CUB A;  2LMJ A;  1TUC A;  2DVJ A;  3KFV A;  4JZ3 A;  1E7O A;  2FEI A;  1AWX A;  1UGV A;  1RLQ C;  2GTJ A;  4OMP A;  2QDL A;  3VS6 A;  1T0H A;  2M0Y A;  1NEG A;  2MOX A;  1X27 A;  2KT1 A;  2O9S A;  2L0A A;  1BK2 A;  2CSI A;  2DF6 A;  2JS2 A;  3GBQ A;  3RBB B;  4J9H A;  3M0P A;  1JEG A;  1SRM A;  2RF0 A;  1VYT A;  3VS2 A;  3EHQ A;  1WA7 A;  5FWB A;  1MUZ A;  2E5K A;  1HD3 A;  2DYB A;  4AFU C;  1PKS A;  2EGE A;  1WDX A;  1T0J A;  1Z9Z A;  2DMO A;  2C0I A;  2FPF A;  2JMC A;  2KRN A;  2K2M A;  2PNI A;  2FRW A;  4J9D A;  1IO6 A;  2ROL A;  1UJY A;  2KRS A;  1U06 A;  1MV3 A;  2GTO A;  2KXD A;  1T3S A;  4M4Z A;  4RTX A;  1PRL C;  2DL3 A;  4Y92 A;  1UHC A;  1X6B A;  3M0T A;  1JXM A;  1X2K A;  1QCF A;  1WXB A;  2J6O A;  2DL7 A;  2GGR A;  1ABO A;  4RTU A;  2JT4 A;  3H0H A;  1PKT A;  3M0R A;  2JM8 A;  2C0O A;  2YT6 A;  1KJW A;  3M0S A;  1YWP A;  2O31 A;  4RUG A;  1Y0M A;  1JU5 C;  2CH4 A;  3VS1 A;  2DBM A;  1E6G A;  1SHG A;  1GCQ C;  4RTY A;  1X69 A;  4JPB W;  2KBT A;  1E6H A;  5L23 A;  1KFZ A;  2PZ1 A;  1BBZ A;  2DNU A;  2P4R A;  3SEM A;  1PRM C;  1ZBJ A;  2OJ2 A;  1Y57 A;  4J9F A;  1ZSG A;  3TVT A;  1GRI A;  2X3X D;  1WIE A;  2DBK A;  1ZLM A;  4LN2 A;  3UA7 A;  1QWE A;  2KT8 A;  3M0U A;  2L3S A;  1QKW A;  1NLP C;  4ORZ A;  4RTZ A;  1QWF A;  3VS7 A;  1PNJ A;  2D8H A;  2DIL A;  2EGA A;  1K76 A;  2EQI A;  2RNA A;  1H3H A;  4F16 A;  1U5S A;  2RQW A;  4HCK A;  4J9E A;  1AZE A;  2DRM A;  4J9G A;  2V1R A;  2GQI A;  2EYW A;  2ECZ A;  4GBQ A;  1XOV A;  1PHT A;  4OMM A;  1G2B A;  2MIO A;  1Z9Q A;  1NM7 A;  3NPF A;  2DLP A;  1OPL A;  1I1J A;  2W10 A;  3PVQ A;  4A63 B;  1FYN A;  2JW4 A;  2EW3 A;  1GL5 A;  4J9I A;  2AKK A;  1B07 A;  1HSQ A;  1WYX A;  2J6K A;  1ZX6 A;  2RQV A;  2A28 A;  1RLP C;  5FW9 A;  2K7A A;  4Z89 A;  1EFN A;  1NLO C;  1NG2 A;  5GJV B;  2AKL A;  2ENM A;  2KYM A;  4CC7 A;  1VYV A;  3ULR B;  2YDL A;  2K79 A;  1VYU A;  2CDT A;  2LNH B;  4JJC A;  2K3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...