5GAN6

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan600
1LOJA 3JB9J 3BY7A 4EMKB 3QO3A 5GMKi 5LJ3f 1WQ7A 5GAN7 5I21A 3RIRA 3JB9G 2E41A 5GMKe 3BW1A 1MGQA 2DTIA 3EFRA 3INZA 4PJOF 4C92C 3HFOA 4M75A 4PJOE 4M77G 4M78D 5LJ5j 3RESA 2K57A 4F7UA 4M7AG 1YCYA 1WPYA 4XTXA 2RB6A 1N9SA 4C8QB 4NL2A 4MMKA 2DZ9A 2YHTA 4C92B 3JCMW 1B34A 4WF2A 3JB9I 3HFNA 4XTYA 5GAMe 2YLCA 5LJ3j 5GANd 3V8JA 5GANh 5GAN8 5GAOl 2YLBA 4PJOD 4M77C 4M7DD 1KQ2A 4F7UB 4EMKC 3L2ZA 4EMGA 4M7AC 2DKGA 4N0AA 4XU1A 4C8QG 3HSBA 1B34B 4M78F 4M78E 4XTUA 3VU3C 3SWNA 4X9DA 5LJ5g 5GAN2 2EAYA 4M7AB 5LJ5e 4EMHA 4M77E 3FIFA 2HNIA 4F7UG 2DVEA 4J6WA 5GAN6 4QVDA 3QHSA 1WNLA 1I5LA 3JCMV 4A53A 4XTVA 4J6XA 5GMKl 5GANf 4C8QC 1D3BB 1Y96A 5LJ3g 3JCMe 4A54A 5GAN4 4M7DF 4M7DE 5LJ3e 3JCMX 3RUXA 2JN0A 3FB9A 4XU3A 4M77D 1M8VA 3EFSA 5GAMg 1HXDA 5GAOp 5GAOm 1LNXA 1Y96B 4M75B 4C8QE 4PJOA 4C92F 3BDUA 4C92E 1I4K1 3RKYA 3FJPA 2Y90A 4QVCA 3JCMb 3JB9H 4NL3A 1WQWA 5GANj 3JB9F 2E64A 2QTXA 5LJ5d 4N0AC 4HA8A 3JCMc 4PJOB 2ZGWA 1X01A 4M75G 5GAOr 2EJ9A 4RCCA 3SWNC 4C8QD 5GMKh 4C92D 4HT8A 4M77F 4OP0A 4V2SA 2RA2A 2FYKA 3JCMd 4M7AF 4M7AE 2DZCA 5GMKm 5LJ3d 4NOYA 2E1HA 3L1AA 3JCMg 5GAN3 2RD1A 3JCMJ 3RERA 3JB9D 1TH7A 4M78A 3SWNB 4XQ3A 5DY9A 4PJOG 1H641 1HK9A 2DXTA 1JRIA 1BIAA 4M75C 4DQ2A 4M77A 2VXFA 3RKWA 5GAMd 4EMKA 2VC8A 4XTWA 5GAMh 2EJGA 5GAOq 1JBMA 5LJ5f 2I2LA 3V7RA 5GANe 4M7AD 4M7DC 4JRIA 4M78B 4C8QF 1KQ1A 4HT9A 4M7DA 4J5YA 4PJOC 4J6YA 3GIBA 4M75E 3V7CA 2DJZA 4XU0A 1N9RA 3JCMQ 1U1TA 4F7UF 4F7UE 2DTHA 2DTOA 5LJ5h 3V8LA 5GAN5 3M4GA 4M78G 2DXUA 4C8QA 4M7DB 4C92A 2RM4A 3RKXA 4XTZA 3AHUA 5GAMf 2E65A 4M75D 5CAIA 3JCMh 1LJOA 4JRKA 5GMKj 5LJ3h 4X9CA 3BFMA 2E10A 4XU2A 2VXEA 1I8FA 4JUVA 4M7DG 4M78C 3PGGA 1M5Q1 2CGHA 1I81A 3SB2A 4MMLA 5GANg 1U1SA 4JLIA 4M7AA 3V8KA 4Y91A 2EJFA 5GAOn 4PNOA 3QSUA 2EWNA 1BIBA 2DEQA 2FB7A 4RCBA 3JCMP 3V7SA 3QUIA 4C92G 5GAMj 1D3BA 4M75F 4M77B 3JCMf
chains in the Genus database with same CATH superfamily
2DERA 5GAN7 1MMAA 2JXBA 3CCVA 3RIRA 1EFNA 5HY6A 3M53A 2NUTB 4M7AG 2GNCA 3L2WA 4C8QB 3JCMW 3NPFA 1Y07A 5HK3A 2D8HA 4PLIA 1RLPC 1Z9ZA 2MPXC 4X1VA 4PK4A 5HKCA 2G3RA 2VB6A 2A37A 5IH2A 3I56Q 4X34A 4F04B 2HNIA 3P8BB 3G6EQ 3QHSA 1WNLA 1RI0A 1NJIC 3GPLA 4RTYA 2DXCA 2A0FB 4XU3A 1EZZB 3EFSA 1NE8A 4ME7A 1QCOA 2RN8A 2B8AA 4N0AC 5FRMA 5AT1B 2AKLA 5D6XA 1WFWA 4V2SA 3MEVA 2R5AA 2MCNA 1VQ4T 3C12A 5FW9A 1JRIA 2HKQB 2QA4T 7AT1B 3GLXA 2QG9B 2DILA 2J7IA 5IN1A 4BDZA 2P4RA 1MMDA 1YHQQ 2D9TA 4ZGDB 4JPBW 4C92A 2DNUA 2VASA 1IXDA 4WTOB 4L6V5 2XKOC 2QQAA 3TQ7P 5CQXA 1BCMA 3CC2T 2EKHA 1NJIR 3VS5A 3FDRA 2KAFA 2JMCA 2QAZA 4IUTA 2RHIA 1M3CA 1RL2A 3NFCA 5CQYA 2EYXA 4KGZB 4OB1B 1MUZA 4E47A 2DK3A 3CCRA 3RESA 2K7AA 4LE9A 1RI9A 3FLGA 3HP9A 2XIDA 4GY5A 4HCBA 5GAMe 3M0UA 3NTIA 4EMGA 2DIQA 4IKFA 3HSBA 2K3XA 4C8QG 1OULA 1ZHIA 4J9CA 4X9DA 1OPKA 2KRMA 4EMHA 3I5RA 1VYTA 4O5VA 3CCLQ 3X24B 1VQMQ 5CKEA 4XTVA 3MEUA 3CCSA 2DL8A 1VQKQ 2LX9A 1VQ7T 1PM3A 2EYYA 1VQ9T 2WSCE 2JNGA 1D1BA 1QCNA 2YRCA 4BDYA 1UTIA 3ULRB 1YJ9T 2ZAEA 1HJDA 1G83A 3CBMA 1NYGA 3EFOB 4M7AF 4M7AE 2DZCA 5GAN3 5LJ3d 1ZBXA 4RTZA 3H9NA 3CXCS 3J81E 3M0RA 1M2VA 2W10A 2HSEB 2V8KA 3MCAB 2QK0A 1PG5B 1KQSP 2EQJA 2DTOA 3I5SA 1QP2A 3REAB 2V8IA 2RM4A 4F17A 1K0XA 3CMAA 3G4SQ 1UEBA 4MMLA 3T9NA 3CCUQ 3OYJA 2CYZB 2F2XA 1V76A 2QGGA 4GLKA 2C0OA 5J3BA 2EYQA 2OAWA 3CMEQ 4FW2A 1I0CA 5IHIA 4C0GA 2KROA 3THKA 3JV3A 4OB2B 4BUGA 2PZ1A 2DD5A 1S1NA 4JRPA 3HTRA 3PT9A 3QKJA 2P84A 2JM9A 2RNAA 1K1ZA 2O9SA 2QDYB 2PUOB 5GJVB 1WXTA 2OAUA 2HKNA 2SEMA 4M78D 1FMWA 2J6FA 3VYHB 3GBQA 1I5OB 4A63B 3G6ET 1VA7A 2CSQA 5GANd 3O8VA 5LJ3j 4M7DD 3EHRA 3CCQA 2COZA 4IUVA 1VQOT 2FL7A 2E3HA 2GTOA 1VUBA 2CSIA 2DBMA 3OW2P 4IUPA 3JCMe 1OEBA 3JCMX 2ED0A 5GAMg 2W0ZA 1VQLA 2V26A 4R55A 2LJ0A 1KIKA 1UGQB 3VUBA 2RK2A 4WCIA 2DPPB 1TUDA 4C92D 1RAHB 4RTXA 4LN2A 3CQTA 1NYFA 2JS2A 3OYLA 2OI3A 4OB0B 1RAAB 2D8JA 4DEYA 3CCEQ 5GAMh 2QI2A 4EPCA 2I2LA 2QDLA 1PSFA 4C8QF 1G5VA 3EG9B 1H8KA 4M75E 1DJ7B 5C6SA 1QVPA 3QWYA 1M1FA 1M1KR 1IGUA 2QEXQ 2KMTA 1NPRA 2L3SA 3CC4T 4JRKA 4LUEA 4PFOA 4J9GA 1WHKA 2OTJA 1FMKA 1Q82U 2IIMA 2QQ9A 1M5Q1 2EGCA 3V8KA 4Y91A 2EWNA 1BIBA 1YCSB 3E2UA 3JCMP 1IO6A 2K5IA 5GJWB 1AD5A 3BY7A 4FT4A 2E70A 2ROTA 4FSSA 5GMKe 1X69A 1N5ZA 3BE3A 4C92C 1C1AA 3L42A 1Q7YR 2DBKA 6AT1B 1OQKA 3MP6A 2PVDB 1VQ8A 2C06A 1VQPA 4WF2A 1SHFA 4OF1A 3OYKA 2HCKA 3L2VA 2PNIA 4HCZA 2OX7A 1VQKT 1ACMB 3MEWA 4JJCA 1TOVA 5A0GA 5LJ5e 4M77E 3KBGA 3TVTA 4CRIA 4Z8AA 3UPUA 4BI8B 5GANf 1Y96A 1VQ6T 2KVQG 4J9BA 2DYBA 4E7HA 1B07A 1I4K1 3NTHA 3RKYA 5KCOA 3CPWP 2KEAA 2RHZA 3M55A 4C5EA 2DXBA 4KULA 4AT1B 3H41A 1BB9A 4QQGA 2A7YA 2MYSA 3VJPA 1VQ9A 2O4XB 5KYUA 3JCMg 3L1AA 1IGQA 1QVFS 1CKAA 4M75C 1GXIE 1RAEB 1Y0MA 1XQHA 1VYVA 3N5BB 4AG2C 4KUIA 1X6BA 2RHUA 3MJXA 2LVMA 4PJJA 1OI1A 2ED1A 1Y57A 2RI5A 2DTHA 2J6OA 3M4GA 3C95A 2F5TX 1W2BP 2JT4A 5CR2A 1NEBA 2AK5A 1PWTA 3LYIA 4J8OA 2KY9A 3JCMh 1LJOA 2L8DA 2R57A 3QG1A 3FC3A 5KYXA 4LUDA 2X3WD 1PRLC 3TEEA 1Q95G 3QUIA 1G3TA 1VQ4Q 5DM7R 3O5ZA 2ZPFB 1K9MR 2RI2A 2YWWA 2QA4Q 3WVEB 1K8AC 4OMPA 4CC7A 2P0KA 4BE0A 4QQDA 5L8RE 2K2VA 2K9GA 4J9FA 4NS5A 4M77C 5J26A 3TSWA 2RJDA 1WLPB 4L5GA 4ZN1A 2A08A 2E6NA 2A36A 1X2QA 3I56A 3G6EA 5KYYA 3CC2Q 4M7AB 2JUFA 4JJBA 2ECZA 1TG0A 1Q86C 2CZ6B 2IPOB 1YFNA 2DD4A 2M0YA 4DA4A 3EGXB 1QCFA 5HCKA 2RQTA 2HBWA 2MIOA 3JAME 5AYFA 3CD6Q 2QTXA 4J9DA 1QMCA 1PD0A 2ZGWA 5GAOr 5GMKh 2DLPA 1ABQA 2X4YA 4E7KA 1KC8R 2DMOA 2QXFA 1KSWA 2XDPA 5KYNA 3I55T 3UDCA 3JB9D 2O01E 4OMQA 2HQEA 3EGUA 1K8AR 4XTWA 4UC4A 4PLLA 2CH4A 3R6OA 1KQ1A 3VS0A 4OGCA 2XHCA 1D1AA 5FROA 4RUGA 4XU0A 1OZ3A 2HL3A 2F2VA 1YHQA 5LJ5h 2LTOA 1YJNT 2BZXA 1VQ7Q 1SPKA 3A5ZB 4MDXA 1T0HA 2CH4W 4KRTA 4JUVA 3H8ZA 5EC7A 1KFZA 3UF4A 1M3AA 1R77A 3VS7A 1QVFA 4ANJA 4ATOA 1M27C 1YJ9Q 4OGEA 1K8AU 1LOJA 5KE3A 2H3JA 1K73C 1OX9A 2E41A 2GQVA 3CEYA 3BW1A 2DTIA 2CZ7B 3EFRA 2EIFA 3OYYA 4BI4A 5CK9A 5KYWA 2ZCFB 1OX8A 3SDZA 3RNJA 4BD3A 1YCYA 2E5QA 2FZKB 4P5NA 2RB6A 3GF5A 2OTLT 1GBQA 2RHXA 3HFNA 2LQ8A 1NLPC 3A8MB 2NWMA 2LDMA 2R5MA 1N6AA 2K6DA 2QQBA 1QQJA 2EAYA 3CCLA 1Q86U 1VQMA 1HD3A 4BE1A 1KHCA 3I35A 1VQKA 3M5AA 1G2BA 3G71T 2YRDA 4D8KA 3A8OB 3M54A 4M75B 3LW5E 3Q1JA 1ZSGA 3OY9A 5DLOA 2CREA 3H0FA 2M02A 3QZ5B 4JS5A 1BI2A 4FM4B 2P0PA 3M9QA 1SSHA 2FYKA 1JQQA 3VS3A 1NLOC 3A1PA 4FYVB 2RD1A 4M78A 1HSQA 1H641 1K73R 2X3XD 1XJWB 4FSXA 1VQOQ 3RR6A 4M7DA 3X28B 2VGMA 4F14A 2LX7A 1M2VB 2Z0WA 4E7IA 2GFAA 3EG1A 4HCCA 2K3YA 2C0TA 1H3ZA 1WJSA 3G4SA 2D0NA 1MV3A 4DOVA 1I07A 1NBEB 2QASA 4XU2A 2L89A 4ORZA 3CCUA 1I81A 3CXCP 1K73U 5GAOn 3CMEA 4PNOA 1A0NB 3SEMA 4C92G 5GAMj 2KYBA 2RQWA 4M77B 2L2PA 1VQ5Q 1BI3A 4B6MA 1RABB 3M4YA 3VV0A 1C0MA 4KT0E 1R0CB 3CPFA 2JJ9A 4FYWB 2LT4A 4Z02A 2JTEA 2YRVA 3JB9I 3ZEHA 3V8JA 4QT7A 4EMKC 3L2ZA 1WDXA 4FW1A 2LCSA 3CC4Q 1JJ2P 3LWHA 2JM8A 1JXMA 2JZ2A 2KI7A 2DRKA 4E2FB 2CUDA 3IQLA 2KT8A 2MAMA 2EGAA 5GAN4 3CD6T 1X27A 4AMCA 4ZN3A 3EH2A 2DETA 1NG2A 4LDXA 2CS7A 4QKUA 2ZPEB 3PVLA 3EG3A 3JB9H 2VUBA 3C4SA 3EGDA 3JSCA 4M75G 2DFUA 1IREB 2RA2A 4J9EA 3JCMd 1UECA 3CC7T 3SWNB 3CCEA 4AFZC 4F16A 2E6ZA 1UGVA 3QIIA 4RTWA 2RPNA 2X51A 1LCKA 3JRZA 3JCMQ 1OU8A 5ECAA 4JJDA 3OYEA 1VQ6Q 2L3RA 2LJ1A 2LCCA 1MMNA 2QEXA 1LPLA 1BI0A 4HCKA 4C8QA 2KDSA 2KNBB 1SEMA 4XTZA 2KT1A 1M90C 4A4KA 2RQVA 2F69A 1BU1A 2ZPBB 4OMNA 1YJWQ 2EPDA 3OYMA 5KH6A 2DX1A 5CKDA 2HEQA 2EBPA 3OYDA 1UJYA 4LNPA 3S3OA 4RCBA 2DIGA 3JB9J 5GMKi 4CI0C 2HDAA 2MOXA 3CCMT 1VQNT 1AT1B 1BYMA 4M77G 4PFPA 2DJQA 4F7UA 2DYIA 4J9IA 2RO0A 2PTKA 1TXQA 4MMKA 5FWBA 1GFCA 4QW2A 4R56A 3HL8A 3TU4K 3X26B 3M0SA 2Y4YA 1M4ZA 3RMSA 5CIUA 1U06A 1Q82C 3OYIA 3QBYA 3VRZA 4OMMA 4RTUA 1SHGA 4II1A 2EVRA 1D3BB 2CP3A 3LLRA 2DRMA 2XU8A 2DL3A 2A3LA 4BE2A 3M0TA 3PIPA 1LNXA 1Y96B 2RMOA 4PJOA 1K0SA 4C92F 4C92E 3MO8A 2EQMA 4VUBA 5LJ5d 2FPEA 2X4XA 3JCMc 2CZ0B 1GCQA 1GRIA 3OBYA 5M9OA 1MNDA 1U8RA 2E1HA 3GNGA 1TUCA 2IVWA 4XAXB 1QVGP 4XQ3A 2XK0A 3G7ZA 4LXCA 1K4US 2V1QA 2JOYA 1IRXA 5KYUB 1JBMA 2LMJA 2FVUA 4J6YA 5FU7C 1M90U 2EW3A 2L5QA 2E3IA 2GF7A 4Q5WA 2V8JA 3I9QA 2DXUA 3AT1B 1Q82R 3CBOA 1RAIB 5GMKj 3RBBB 1CSKA 2DF6A 4M78C 1N27A 1VQ5T 1OU9A 1WHMA 2DO3A 1U1SA 1F1BB 1D0YA 4ELYC 1WJQA 3OYFA 1SF9A 4M75F 1VQ4A 4M7DC 4RG8A 1MV0B 4EMKB 5KYXB 5LJ3f 2VKNA 3I55Q 1G8XA 2QA4A 2RHYA 2FZCB 3JB9G 1YI2Q 4B9WA 1RACB 1UG1A 3HFOA 5LJ5j 2PVOB 4FT2A 2XICA 3G1JA 3OYNA 1N8RC 4PJNA 2DZ9A 1B34A 4J7FA 1WZOA 1BCOA 4XTYA 1KQSS 5GAN8 2V1RA 3FJ5A 2WACA 3M58A 1YJNQ 4HVWA 3S3NA 2D1XA 1KJWA 2PQWA 2JTFA 4A4FA 3CC2A 4DEXA 3CCJT 4J6WA 1M8MA 5GMKl 2L3PA 3PTAA 4LD6A 1SSFA 1WX6A 1ARKA 3OS1A 1UB4A 1FXXA 4MDWA 1PKSA 1H3HA 2KXDA 1TWBA 1FX7A 2YT6A 2MMPA 4FYYB 1S72T 5CCAA 3CD6A 4D6WA 4C0DC 4QVZA 3F70A 3A98A 2EKOA 4C8QD 4M77F 3E19A 2OTLQ 3OMCA 1TS9A 3ZBDA 1WXUA 2ZPHB 1ZUKA 4N4IA 4RG2A 2BE9B 3VKIA 5GAOq 2EJGA 1JO8A 5LJ5f 5GANe 4LDUA 1WHLA 4CC4B 4CC3A 2BKDN 1VIEA 1N8RR 4OB3B 2E4HA 2BTTA 1YJWT 3OW2S 3G71Q 2X4WA 1QLYA 2M1HA 4N4GA 1VQ7A 1PCXA 1KD1U 3UWNA 4KGVB 2L3QA 1AZGB 2QTVA 1OPLA 1PHTA 3BFMA 2MWPA 3PGGA 2H8HA 4ELZC 1BBZA 5IHNA 1YJ9A 3UATA 3UT1A 2PU9B 1K76A 2F2WA 4JZ3A 2NUPA 1VOMA 1N8RU 2CP0A 4A4HA 2VGNA 3INZA 1YWOA 2XMFA 1RUWA 1WPYA 3OYHA 3ZL7C 3QZ9B 3HRTA 1XNIA 3HRSA 5KYWB 1QWEA 5GAOl 4PJOD 2EFIA 3GOXA 2GCXA 2HMAA 1Q81C 5D7UA 1W70A 2RI3A 1GCPA 4J83A 2J6KA 1I5LA 1KK7A 5GAN6 3EHQA 2VWFA 5LJ3g 2NYSA 2LQKA 1WA7A 2K5LA 4JZ4A 2JN0A 3QPHA 1M8VA 1PKTA 4EIKA 2G6FX 1WHHA 5FRNA 2Y90A 1KQSA 4QVCA 3CBPA 4NL3A 3JB9F 4HA8A 3H0IA 1R8OB 5FU7B 5I22A 2ZZDA 4GLMA 3PE0A 5C0MA 2CUBA 2M0OA 2YUQA 3JCMJ 2MF2A 1VQOA 5IHKA 2OJ2A 3SD4A 2VC8A 1ZA1B 3OYGA 2X9HA 4M78B 4KBMB 3WXMB 3CCRT 4PJOC 3URGA 3PIOA 4FL6A 4M7DB 4BACA 2ENMA 1GCQC 3H0HA 3QDRB 2J06A 2BZ8A 4MZMA 1W1FA 1W4SA 3VUZA 3CPWS 1MMGA 1YI2T 3SB2A 1J3TA 5GANg 2KE9A 1AZEA 2RH2A 2EJFA 3CCST 2DEQA 2AKKA 3PFSA 5KE2A 4J9HA 5HK0A 5CKFA 1AEYA 2FG0A 3CC7Q 3A8GB 4ZGEB 1VQ5A 1Y7XA 1Z9QA 2E12A 3OW2A 1MGQA 2P0QA 2C0IA 4HKEA 1JB0E 4FU6A 3TSZA 2EYWA 2K3BA 3C0CA 1Q81U 1N9SA 4C92B 3DB3A 3MKDA 5GANh 1YIJQ 2O9VA 4KH0B 1W2BS 3BDLA 1Q86R 3CC4A 1ZX6A 3VU3C 2XDBA 2YUNA 3E1SA 3M59A 4QVDA 4C0DB 4J6XA 2O88A 3HPWA 1UUEA 2AIRB 1ZSZA 3MP1A 3J80E 1QKXA 5L23A 1V1CA 5CKHA 4LDYA 3CCMQ 3CMAT 2AZSA 2F1LA 3FJPA 1XOVA 3LWIA 1VQNQ 4PJLA 1FYNA 5CVIA 2DL5A 1FWZA 1X01A 4ZNXA 4RCCA 1E7OA 4HT8A 2CKKA 5FU6C 2PVGB 2MI6A 2RJCA 5GMKm 4NOYA 1M2OA 4HVVA 3OS0A 1T3SA 2CT4A 3RKWA 5GAMd 2KXCA 3QYHB 4J5YA 2CP2A 1PD1A 1VQ6A 3V7CA 9ATCB 5A2QE 1X75C 4AG1C 2A28A 1GL5A 1M3BA 4M78G 3CCQT 4L59A 2DEUA 4X9CA 1YJWA 2VXEA 1ZA2B 2RF0A 2JTMA 4M7DG 8ATCB 4M7AA 1WHGA 5IXBA 4OMOA 5KCHA 3P8DA 1QWFA 4IURA 4DBRA 2FB7A 4OMFB 3QO3A 1VQLT 3NTKA 2D0QB 2FO0A 3OBWA 2JW4A 3FRNA 2VVKA 2K57A 3EGXA 4XTXA 2DVJA 5I2MA 3SHWA 2FRYA 2MK5A 1VYUA 3CPWA 1KQ2A 2FZGB 3OQ5A 4F7UB 4KGXB 1RAFB 5GAN2 5IAYA 4PL6A 1IB8A 2RK1A 1C6VX 2M9UA 3ME9A 4C0FA 2ESWA 3FB9A 4JJNK 1SRMA 5GAOm 1R0BG 2YUOA 4JRQA 3META 3DLLA 2L0AA 2LT1A 1UFFA 1W6XA 3OB9A 2OTJT 4Y92A 2E64A 2FEIA 3A8LB 3OA6A 3HHTB 1AWOA 4PJOB 4LDWA 1W2BA 3WVDB 1SG5A 3DKMA 2K2MA 2K5FA 4BY6C 3TCJA 5DY9A 4HVUA 1HK9A 1AHJB 4Z88A 5EG2A 2O2OA 3CCJQ 1NEGA 1AWXA 4K11A 1M9SA 2FPFA 2AZVA 4PKCC 5A0LA 1AVZC 2KRNA 1VQ8T 3PNWC 1VQPT 2BZYA 3REBB 4HXJA 3VS6A 5GAMf 2E65A 1X6GA 1S72Q 3ZFJA 1I8FA 2P4TA 1G3SA 4JLIA 1U3OA 1B7TA 1NJIU 1YITQ 2ZPIB 4MZPA 3I55A 1WXBA 2XD0A 5I11A 2DAQA 1YI2A 2NUTA 5I21A 3CCVQ 1YIJT 4M75A 1K9AA 1O75A 2R58A 4NL2A 2YHTA 3S3MA 4BI3A 1YJNA 3E9FA 3L2RA 1UDLA 1WI7A 2IG0A 4FYXB 2KRSA 2PUKB 1B34B 2BE7D 1QW1A 4M78E 4M78F 3M56A 1PC0A 1YBYA 2LCLA 3DB4A 4F7UG 4RMOA 2F5KA 1ZLMA 1QP3A 4N4HA 4M7DF 4M7DE 4QQ6A 5FU6B 5I2SA 4FCYA 3LH5A 5GAOp 2B86A 2XDDA 3OSVA 1UGSB 3SFMA 2GQIA 3EH1A 2KBTA 3NMZC 2O31A 3FEOA 1OYXA 2FPDA 3S6WA 2OTLA 1H92A 3PMTA 4C5IA 4FIBA 3RERA 1GBRA 2QYZA 4OVAA 4PJOG 4IUUA 4M77A 2HL5C 2VXFA 1ZSZC 3EAEA 2EQIA 3MEAA 1M90R 3V7RA 4M7AD 3M57A 1JJ2S 1M30A 2SRCA 5LL6S 2M51A 2CP7A 3G71A 2XI9A 1N9RA 2JS0A 5D6YA 2LC4A 2VYTA 3LX7A 1VIFA 5FWCA 1UJ0A 1IZ6A 1HYOA 4KH1B 3I56T 2CT3A 1AWJA 2EGEA 2BUDA 2CGHA 2VV5A 3OYAA 1M1KC 4Z89A 3P8HA 4M4ZA 2EQUA 3MPUB 2HQXA 2EYZA 1WYXA 3JCMf 1O9SA 1T0JA 1OV3A 2EQKA 2NUPB 1OZ2A 2H3EB 2YXYA 1JEGA 3CCRQ 1KD1C 4XK8E 3DLMA 1SRLA 2YLCA 2YLBA 1P92A 3GNFB 2CP6A 1QVFP 1T3LA 4M7AC 2QGFB 4C0ZA 2RQRA 4JLGA 4XU1A 4XTUA 3SWNA 1Q7YC 3VRYA 2DVEA 4A4GA 3R6NA 3JCMV 3X20B 3GP8A 2AHJB 3RDVA 4IUQA 4A54A 5LJ3e 1YHQT 3X25B 4E6RA 1ZUYA 4GBQA 3CCSQ 1MNEA 1V29B 3OS2A 2HZYA 1YP5A 4BY6B 1HXDA 3QJ6A 4C8QE 1IHWA 3BDUA 2KYMA 2HBPA 1D09B 3EFOA 3JCMb 3TREA 5GANj 2LJ3A 2COWA 2YSQA 3NHNA 5CO7A 2ATCB 4OP0A 4E7JA 4DBHA 2DL7A 1YWPA 2LZ6B 2DXTA 4AFQC 5KYYB 1BIAA 3D7SB 2Y4XA 3CXCA 2KGTA 4A4EA 2WSFE 3OYBA 3QJYA 2K4YA 2DM1A 1PSEA 1M1GA 4TVRA 1KD1R 1U1TA 4F7UF 2HD0A 4F7UE 3QDFA 3KXTA 3A8HB 1X6OA 2E5KA 3RKXA 1YITT 3OSSC 3U23A 4M75D 1RAGB 5CAIA 1M1KU 3PMIA 4LDVA 4KUDK 2E10A 3CMAQ 2QQRA 4PFZA 3CCLT 5DLQE 3CCVT 4C5GA 1NM7A 1VQMT 4E7ZA 2J05A 2GFUA 5D6WA 3UA6A 3QWXX 1D3BA 3CC7A 1JJ2A 2ZPGB 1YN8A 3LGLA 1LVKA 1WQ7A 1RLQC 1E6HA 8AT1B 1QVGS 2CZ1B 4PJOF 4PJOE 2JMAA 3C94A 2GTJA 1D1CA 1AWWA 2M16A 1ZUUA 3RMQA 1Q7YU 1YIJA 1WIEA 1G3WA 1K9MC 4CC2A 3OMGA 5IT9E 2DKGA 4N0AA 1PRMC 5IXFA 2LRQA 3CCQQ 2FHDA 1UHCA 4ZTFA 3M0PA 3FIFA 3PVQA 4YTLA 3J7AF 3ASKA 2KK4A 4C8QC 1JXOA 1Y71A 1I1JA 3M0QA 1ZQ1A 2HSPA 1TTHB 4M77D 3MP8A 4ESRA 5J39A 1KHIA 3CCMA 1VQLQ 3NGPA 3G4ST 4J7IA 1VQNA 1ZSZB 1WGSA 4ZTJA 4ZGJB 4E7LA 4BB7A 1SKUB 2RQUA 2K79A 3VS2A 3CCUT 3LGFA 1EIFA 2EJ9A 3CMET 1CKBA 3EG0A 2ABLA 4R0KA 2NLUA 4PJMA 4RTVA 3EG9A 3UA7A 1D0ZA 2DL4A 4C5HA 4EMKA 1WJRA 3QXEB 2D6FA 2NUZA 4IIOA 4AFSC 1KC8C 2YUPA 1UHFA 2LNHB 1B3QA 3V8LA 4OMLA 2DA9A 3VS4A 5LJ3h 4AFUC 2WSEE 1U5SA 1JU5C 2OTJQ 3KUFA 4DOWA 2JVVA 4IIMA 4DBQA 2KQWA 1IHVA 3H6ZA 3EG2A 3QSUA 4EDUA 3MHXA 4JS4A 1UE9A 3VYGA 3E9GA 1XTDA 1Q81R 1GFDA 1K9MU 4JDSA 1NZ9A 1UGPB 1VQ8Q 4RTTA 4E7SA 3HKSA 1UGRB 2RJFA 1VQPQ 1OOTA 2CDTA 5A0DA 1FMVA 1RADB 1ZBJA 2CP5A 2DE0X 3CCET 5LJ5g 4MZTA 4O6JA 1G3YA 1X43A 5CKBA 2QQSA 3L2QA 3LH0A 2LQNA 1ABOA 2HQHA 4A53A 4DBFA 1QVGA 4RKUE 3RUXA 2XG8D 3OYCA 2KR3A 2QEXT 3OS5A 2HAXA 1YNZA 4Y28E 1QKWA 2AT1B 1X2KA 1BI1A 1E6GA 2BIVA 1TU0B 2O4XA 1WQWA 2X4JA 2KSSA 1TSFA 3SWNC 1MHNA 2GBQA 1BKBA 1VQ9Q 1TH7A 1KC8U 1EX4A 4DQ2A 2LQWA 1WHJA 3CCJA 4LD9K 3KFVA 4JRIA 4HT9A 1TUGB 3HRUA 2ROLA 3ER0A 1AOJA 2X35A 2MWOA 3GIBA 2DJZA 4D8DA 1NPPA 2FRWA 4B9XA 5FLXE 5GAN5 3AHUA 3QYGB 3VS1A 1D0XA 1KG1A 1S72A 2COYA 2YDLA 3EGDB 1PNJA 1BK2A 2LP5A 1YITA 2RJEA 2I0NA 2LNVA 3V7SA 2GGRA 3L2UA
chains in the Genus database with same CATH topology
1G3TA 2DAQA 4EMKB 5LJ3f 1YI2A 5DM7R 5GAN7 2QA4A 2RHYA 2ZPFB 3RIRA 5I21A 3CCVA 3JB9G 2RI2A 1YIJT 5HY6A 3WVEB 4B9WA 1K8AC 3HFOA 3M53A 4M75A 1O75A 2R58A 5LJ5j 2PVOB 4M7AG 4FT2A 2XICA 3L2WA 2P0KA 4C8QB 4NL2A 4QQDA 2DZ9A 2YHTA 5L8RE 3OYNA 4BE0A 3JCMW 1B34A 4J7FA 3S3MA 2K2VA 4XTYA 1KQSS 1Y07A 5HK3A 5GAN8 4BI3A 1VQ4A 1YJNA 3E9FA 4M77C 4NS5A 5J26A 3L2RA 2IG0A 4PLIA 2WACA 3M58A 2RJDA 4L5GA 3S3NA 4ZN1A 2PQWA 2E6NA 2PUKB 1B34B 2G3RA 1QW1A 2JTFA 4M78E 4M78F 4A4FA 5HKCA 3I56A 3M56A 3CCJT 3CC2A 3G6EA 4M7AB 1YBYA 2LCLA 2JUFA 3DB4A 4X34A 2HNIA 3P8BB 4J6WA 4F7UG 3QHSA 1WNLA 1RI0A 1NJIC 4RMOA 2F5KA 5GMKl 3GPLA 1QP3A 4N4HA 4M7DF 4M7DE 4QQ6A 4LD6A 1SSFA 2DXCA 3PTAA 5FU6B 3OS1A 5I2SA 1Q86C 1UB4A 4XU3A 1FXXA 4MDWA 2CZ6B 3EFSA 1NE8A 4ME7A 5GAOp 2XDDA 1FX7A 3OSVA 2MMPA 1UGSB 2DD4A 4DA4A 3SFMA 1S72T 5CCAA 3CD6A 4D6WA 3JAME 4C0DC 2B8AA 5AYFA 2QTXA 4N0AC 5FRMA 4QVZA 3F70A 2ZGWA 2EKOA 3FEOA 1OYXA 3S6WA 5D6XA 4C8QD 5GMKh 5GAOr 2OTLA 4V2SA 4M77F 3E19A 3MEVA 2R5AA 2X4YA 3PMTA 3OMCA 4C5IA 4E7KA 2QXFA 2XDPA 4FIBA 3ZBDA 3RERA 2ZPHB 3I55T 3UDCA 3JB9D 1VQ4T 3C12A 2O01E 4OVAA 4PJOG 4IUUA 1JRIA 2HQEA 4N4IA 2QA4T 4M77A 2VXFA 4RG2A 3GLXA 3VKIA 4XTWA 5GAOq 2EJGA 3EAEA 3MEAA 4UC4A 4PLLA 5LJ5f 3V7RA 5IN1A 4LDUA 3M57A 5GANe 1JJ2S 3HSBA 3R6OA 4M7AD 1KQ1A 4OGCA 5LL6S 2BKDN 1VIEA 2XHCA 5FROA 4OB3B 4BDZA 3G71A 2XI9A 4XU0A 1N9RA 1OZ3A 1YJWT 3OW2S 1YHQA 5D6YA 2LC4A 2VYTA 2D9TA 2M1HA 2X4WA 4N4GA 4ZGDB 3LX7A 3UWNA 5LJ5h 1KD1U 1VQ7A 2LTOA 4C92A 1YJNT 1VIFA 3A5ZB 4MDXA 4L6V5 2XKOC 1IZ6A 2QQAA 5CQXA 3BFMA 3I56T 2MWPA 3CC2T 4JUVA 3PGGA 3H8ZA 2BUDA 4ELZC 2CGHA 3FDRA 2VV5A 3OYAA 2KAFA 1YJ9A 4IUTA 1QVFA 3UT1A 4ATOA 1M1KC 2PU9B 2RHIA 4OGEA 3P8HA 2EQUA 1K8AU 1RL2A 3NFCA 2HQXA 3JCMf 1LOJA 1O9SA 5KE3A 5CQYA 2H3JA 1K73C 2E41A 1N8RU 2EQKA 2GQVA 3CEYA 4A4HA 3BW1A 4OB1B 2DTIA 2CZ7B 2VGNA 2DK3A 2EIFA 3EFRA 3INZA 3OYYA 4BI4A 4E47A 2ZCFB 5CK9A 1OZ2A 3CCRA 3RESA 3SDZA 4BD3A 1YCYA 1WPYA 2E5QA 4P5NA 3FLGA 3OYHA 2RB6A 3HP9A 2XIDA 4GY5A 3QZ9B 3GF5A 3HRTA 1KD1C 4XK8E 1XNIA 2RHXA 2OTLT 4HCBA 3DLMA 3HRSA 3HFNA 2LQ8A 5GAMe 2YLCA 5GAOl 4PJOD 2YLBA 1P92A 3A8MB 3GNFB 2EFIA 3GOXA 2GCXA 3NTIA 2DIQA 4EMGA 4M7AC 1Q81C 2LDMA 4JLGA 4XU1A 2K3XA 1N6AA 2R5MA 4C0ZA 4C8QG 4IKFA 2RI3A 1ZHIA 4XTUA 3SWNA 4X9DA 1Q7YC 2QQBA 4J83A 2EAYA 3CCLA 1Q86U 4EMHA 1VQMA 1I5LA 4BE1A 2DVEA 4O5VA 5GAN6 4A4GA 1KHCA 3X24B 3JCMV 3X20B 3GP8A 5CKEA 4XTVA 2AHJB 5LJ3g 1VQKA 4IUQA 3M5AA 3MEUA 4A54A 3CCSA 3G71T 2LQKA 5LJ3e 1YHQT 3X25B 2K5LA 2LX9A 2JN0A 1V29B 3OS2A 1VQ7T 3A8OB 3QPHA 4BY6B 1M8VA 1HXDA 3QJ6A 3M54A 4M75B 4C8QE 3LW5E 3BDUA 1VQ9T 2WSCE 2JNGA 3Q1JA 1N8RC 2HBPA 3OY9A 5FRNA 2Y90A 1KQSA 5DLOA 4QVCA 3JCMb 3CBPA 4NL3A 3TREA 5GANj 3JB9F 4BDYA 3QZ5B 4HA8A 5CO7A 1BI2A 4FM4B 2P0PA 4JS5A 1R8OB 5FU7B 3M9QA 2ZZDA 1YJ9T 5C0MA 4OP0A 3CBMA 2FYKA 2M0OA 4M7AF 4M7AE 2DZCA 5GAN3 5LJ3d 4E7JA 1ZBXA 2RD1A 2MF2A 3JCMJ 4M78A 3CXCS 1H641 2DXTA 3J81E 1VQOA 1BIAA 4FSXA 3SD4A 2Y4XA 2VC8A 3CXCA 3OYGA 4M7DC 4A4EA 2WSFE 4M78B 3OYBA 3QJYA 4KBMB 2K4YA 3WXMB 3CCRT 4M7DA 2V8KA 4PJOC 3MCAB 3X28B 2VGMA 1PSEA 1M1GA 4TVRA 3URGA 3PIOA 1U1TA 4F7UF 2HD0A 4F7UE 4E7IA 2EQJA 2DTOA 2GFAA 1QP2A 3A8HB 1X6OA 2V8IA 4FL6A 2K3YA 3KXTA 4HCCA 4M7DB 2RM4A 3RKXA 1H3ZA 4BACA 1WJSA 3OSSC 1YITT 4M75D 3G4SA 5CAIA 1M1KU 3PMIA 4DOVA 3QDRB 3CMAA 4LDVA 4KUDK 4MZMA 2E10A 4XU2A 1W4SA 2L89A 3VUZA 1UEBA 3CPWS 2QQRA 1YI2T 3CCLT 5DLQE 3CCUA 3CCVT 4C5GA 1VQMT 1I81A 3SB2A 4MMLA 5GANg 3T9NA 3OYJA 2CYZB 2RH2A 2EJFA 5GAOn 2GFUA 4PNOA 4GLKA 5D6WA 3CMEA 5J3BA 1K73U 3CCST 2EYQA 2DEQA 3PFSA 4C92G 5KE2A 5GAMj 1D3BA 4C0GA 5CKFA 5HK0A 3CC7A 4M77B 4OB2B 2ZPGB 4BUGA 1JJ2A 2DD5A 3A8GB 3LGLA 1WQ7A 4ZGEB 4JRPA 1VQ5A 1Y7XA 3PT9A 3QKJA 1QVGS 1BI3A 2E12A 3OW2A 2QDYB 2CZ1B 1MGQA 2P0QA 2PUOB 2OAUA 4PJOF 3M4YA 4PJOE 3C94A 4HKEA 4M78D 3VV0A 1JB0E 4FU6A 3VYHB 4KT0E 1Q81U 1N9SA 2M16A 3CPFA 4C92B 3G6ET 2LT4A 3DB3A 4Z02A 3RMQA 2YRVA 3JB9I 3ZEHA 5GANd 3O8VA 5LJ3j 1YIJA 3V8JA 5GANh 1G3WA 1K9MC 4M7DD 4EMKC 3CCQA 3L2ZA 3OMGA 5IT9E 1W2BS 4IUVA 3BDLA 2DKGA 4N0AA 3CC4A 2LRQA 2FHDA 1VQOT 2FL7A 3VU3C 3LWHA 4ZTFA 2XDBA 1VUBA 3E1SA 2JZ2A 3M59A 4QVDA 3FIFA 4C0DB 4YTLA 3J7AF 4J6XA 3ASKA 2KK4A 4C8QC 2MAMA 4IUPA 3HPWA 3JCMe 5GAN4 3CD6T 1Y71A 3JCMX 1ZQ1A 3MP1A 4M77D 3MP8A 5J39A 5GAMg 4ZN3A 3J80E 1VQLA 4R55A 1KHIA 4LDXA 2CS7A 3CCMA 5CKHA 2ZPEB 4LDYA 3G4ST 4J7IA 1VQNA 3CMAT 1WGSA 4ZTJA 4ZGJB 4E7LA 3FJPA 1XOVA 4BB7A 3LWIA 3JB9H 1UGQB 5CVIA 1FWZA 2VUBA 3C4SA 3VUBA 2RK2A 3LGFA 1X01A 3JSCA 1EIFA 2DPPB 2EJ9A 4M75G 4RCCA 4C92D 4HT8A 1IREB 2CKKA 3CMET 2RA2A 3JCMd 5FU6C 2PVGB 2MI6A 2RJCA 5GMKm 4NOYA 2NLUA 3CC7T 3SWNB 3OYLA 3OS0A 4OB0B 3CCEA 3RKWA 4C5HA 4EMKA 5GAMd 1WJRA 3QXEB 2QI2A 2E6ZA 3QIIA 4EPCA 5GAMh 2I2LA 2D6FA 1PSFA 3QYHB 4C8QF 1G5VA 4J5YA 1KC8C 1VQ6A 3JRZA 4M75E 3V7CA 5A2QE 1DJ7B 1X75C 1QVPA 5C6SA 3JCMQ 3OYEA 2L3RA 2LCCA 2QEXA 1M1FA 1BI0A 3V8LA 4M78G 4C8QA 2KMTA 2KDSA 1NPRA 4XTZA 3CCQT 1M90C 4L59A 4A4KA 3CC4T 4JRKA 5LJ3h 2WSEE 4X9CA 2F69A 1YJWA 2OTJA 2VXEA 2ZPBB 1Q82U 4M7DG 2JTMA 3OYMA 2QQ9A 1M5Q1 3KUFA 5KH6A 4DOWA 2JVVA 2KQWA 5CKDA 4M7AA 3H6ZA 4Y91A 3V8KA 4EDUA 5KCHA 3QSUA 3P8DA 4IURA 2EWNA 3OYDA 1BIBA 3S3OA 2FB7A 4RCBA 3JCMP 4OMFB 2K5IA 2DIGA 3MHXA 3JB9J 3BY7A 4FT4A 2E70A 3QO3A 5GMKi 4CI0C 1VQLT 5GMKe 4JS4A 3NTKA 3CCUT 3CCMT 3VYGA 3E9GA 1XTDA 2D0QB 3OBWA 1VQNT 4C92C 1BYMA 1K9MU 4M77G 4JDSA 3FRNA 3L42A 1NZ9A 2K57A 4F7UA 1UGPB 4XTXA 5I2MA 2RO0A 3MP6A 2PVDB 4MMKA 1VQ8A 2C06A 1VQPA 4WF2A 4OF1A 4R56A 4QW2A 3OYKA 3HKSA 1UGRB 2RJFA 3HL8A 3TU4K 3CPWA 3X26B 3L2VA 3OQ5A 4F7UB 2Y4YA 4HCZA 1KQ2A 5A0DA 1VQKT 1M4ZA 3RMSA 3MEWA 5CIUA 1Q82C 5GAN2 5IAYA 3CCET 3OYIA 3QBYA 4PL6A 5A0GA 4MZTA 5LJ5g 4O6JA 1G3YA 5LJ5e 5CKBA 2QQSA 4M77E 3KBGA 4CRIA 2RK1A 3L2QA 2M9UA 3UPUA 3LH0A 4A53A 4II1A 3ME9A 4BI8B 5GANf 1D3BB 1Y96A 3LLRA 4C0FA 1QVGA 2XU8A 1VQ6T 4RKUE 2A3LA 2KVQG 3RUXA 2XG8D 3OYCA 2QEXT 3FB9A 4BE2A 3OS5A 2HAXA 4JJNK 3PIPA 4Y28E 5GAOm 1LNXA 1Y96B 4PJOA 4E7HA 4C92F 3META 4C92E 4JRQA 1I4K1 1BI1A 3NTHA 3RKYA 5KCOA 3MO8A 3DLLA 2BIVA 2LT1A 2RHZA 3M55A 2O4XA 3OB9A 4C5EA 2DXBA 2EQMA 4KULA 1WQWA 2X4JA 3OA6A 2E64A 3A8LB 2OTJT 4VUBA 5LJ5d 3HHTB 2KSSA 2X4XA 3JCMc 4QQGA 2A7YA 4LDWA 1W2BA 1Q7YU 4PJOB 3SWNC 2CZ0B 3VJPA 3WVDB 1MHNA 3OBYA 5M9OA 3DKMA 2O4XB 1VQ9A 1BKBA 3JCMg 2E1HA 3L1AA 1U8RA 2K5FA 4BY6C 3GNGA 3TCJA 2IVWA 1TH7A 4XAXB 4XQ3A 5DY9A 2XK0A 1HK9A 1KC8U 1QVFS 3G7ZA 4M75C 1GXIE 1AHJB 4DQ2A 2JOYA 3CCJA 1XQHA 5EG2A 3N5BB 4LD9K 1JBMA 4JRIA 4HT9A 4KUIA 3HRUA 2RHUA 2FVUA 3ER0A 1M9SA 2LVMA 2X35A 2MWOA 4J6YA 5FU7C 1M90U 3GIBA 2DJZA 4PKCC 5A0LA 1OI1A 1NPPA 2L5QA 2GF7A 4Q5WA 4B9XA 2RI5A 2V8JA 2DTHA 1VQ8T 3PNWC 5FLXE 1VQPT 5GAN5 3M4GA 2DXUA 2F5TX 3C95A 5CR2A 3AHUA 5GAMf 2E65A 3QYGB 3CBOA 1KG1A 3LYIA 4J8OA 2KY9A 3JCMh 1LJOA 5GMKj 1S72A 2L8DA 2R57A 3ZFJA 1I8FA 3QG1A 2P4TA 4M78C 1N27A 1VQ5T 1G3SA 2DO3A 3FC3A 1U1SA 4JLIA 3L2UA 1YITA 4ELYC 1WJQA 1NJIU 2RJEA 3OYFA 3TEEA 2ZPIB 4MZPA 2LNVA 3QUIA 3V7SA 3I55A 4M75F 2XD0A 4RG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LOJ A;  3JB9 J;  3BY7 A;  4EMK B;  3QO3 A;  5GMK i;  5LJ3 f;  1WQ7 A;  5GAN 7;  5I21 A;  3RIR A;  3JB9 G;  2E41 A;  5GMK e;  3BW1 A;  1MGQ A;  2DTI A;  3EFR A;  3INZ A;  4PJO F;  4C92 C;  3HFO A;  4M75 A;  4PJO E;  4M77 G;  4M78 D;  5LJ5 j;  3RES A;  2K57 A;  4F7U A;  4M7A G;  1YCY A;  1WPY A;  4XTX A;  2RB6 A;  1N9S A;  4C8Q B;  4NL2 A;  4MMK A;  2DZ9 A;  2YHT A;  4C92 B;  3JCM W;  1B34 A;  4WF2 A;  3JB9 I;  3HFN A;  4XTY A;  5GAM e;  2YLC A;  5LJ3 j;  5GAN d;  3V8J A;  5GAN h;  5GAN 8;  5GAO l;  2YLB A;  4PJO D;  4M77 C;  4M7D D;  1KQ2 A;  4F7U B;  4EMK C;  3L2Z A;  4EMG A;  4M7A C;  2DKG A;  4N0A A;  4XU1 A;  4C8Q G;  3HSB A;  1B34 B;  4M78 F;  4M78 E;  4XTU A;  3VU3 C;  3SWN A;  4X9D A;  5LJ5 g;  5GAN 2;  2EAY A;  4M7A B;  5LJ5 e;  4EMH A;  4M77 E;  3FIF A;  2HNI A;  4F7U G;  2DVE A;  4J6W A;  5GAN 6;  4QVD A;  3QHS A;  1WNL A;  1I5L A;  3JCM V;  4A53 A;  4XTV A;  4J6X A;  5GMK l;  5GAN f;  4C8Q C;  1D3B B;  1Y96 A;  5LJ3 g;  3JCM e;  4A54 A;  5GAN 4;  4M7D F;  4M7D E;  5LJ3 e;  3JCM X;  3RUX A;  2JN0 A;  3FB9 A;  4XU3 A;  4M77 D;  1M8V A;  3EFS A;  5GAM g;  1HXD A;  5GAO p;  5GAO m;  1LNX A;  1Y96 B;  4M75 B;  4C8Q E;  4PJO A;  4C92 F;  3BDU A;  4C92 E;  1I4K 1;  3RKY A;  3FJP A;  2Y90 A;  4QVC A;  3JCM b;  3JB9 H;  4NL3 A;  1WQW A;  5GAN j;  3JB9 F;  2E64 A;  2QTX A;  5LJ5 d;  4N0A C;  4HA8 A;  3JCM c;  4PJO B;  2ZGW A;  1X01 A;  4M75 G;  5GAO r;  2EJ9 A;  4RCC A;  3SWN C;  4C8Q D;  5GMK h;  4C92 D;  4HT8 A;  4M77 F;  4OP0 A;  4V2S A;  2RA2 A;  2FYK A;  3JCM d;  4M7A F;  4M7A E;  2DZC A;  5GMK m;  5LJ3 d;  4NOY A;  2E1H A;  3L1A A;  3JCM g;  5GAN 3;  2RD1 A;  3JCM J;  3RER A;  3JB9 D;  1TH7 A;  4M78 A;  3SWN B;  4XQ3 A;  5DY9 A;  4PJO G;  1H64 1;  1HK9 A;  2DXT A;  1JRI A;  1BIA A;  4M75 C;  4DQ2 A;  4M77 A;  2VXF A;  3RKW A;  5GAM d;  4EMK A;  2VC8 A;  4XTW A;  5GAM h;  2EJG A;  5GAO q;  1JBM A;  5LJ5 f;  2I2L A;  3V7R A;  5GAN e;  4M7A D;  4M7D C;  4JRI A;  4M78 B;  4C8Q F;  1KQ1 A;  4HT9 A;  4M7D A;  4J5Y A;  4PJO C;  4J6Y A;  3GIB A;  4M75 E;  3V7C A;  2DJZ A;  4XU0 A;  1N9R A;  3JCM Q;  1U1T A;  4F7U F;  4F7U E;  2DTH A;  2DTO A;  5LJ5 h;  3V8L A;  5GAN 5;  3M4G A;  4M78 G;  2DXU A;  4C8Q A;  4M7D B;  4C92 A;  2RM4 A;  3RKX A;  4XTZ A;  3AHU A;  5GAM f;  2E65 A;  4M75 D;  5CAI A;  3JCM h;  1LJO A;  4JRK A;  5GMK j;  5LJ3 h;  4X9C A;  3BFM A;  2E10 A;  4XU2 A;  2VXE A;  1I8F A;  4JUV A;  4M7D G;  4M78 C;  3PGG A;  1M5Q 1;  2CGH A;  1I81 A;  3SB2 A;  4MML A;  5GAN g;  1U1S A;  4JLI A;  4M7A A;  3V8K A;  4Y91 A;  2EJF A;  5GAO n;  4PNO A;  3QSU A;  2EWN A;  1BIB A;  2DEQ A;  2FB7 A;  4RCB A;  3JCM P;  3V7S A;  3QUI A;  4C92 G;  5GAM j;  1D3B A;  4M75 F;  4M77 B;  3JCM f; 
#chains in the Genus database with same CATH topology
 2DER A;  5GAN 7;  1MMA A;  2JXB A;  3CCV A;  3RIR A;  1EFN A;  5HY6 A;  3M53 A;  2NUT B;  4M7A G;  2GNC A;  3L2W A;  4C8Q B;  3JCM W;  3NPF A;  1Y07 A;  5HK3 A;  2D8H A;  4PLI A;  1RLP C;  1Z9Z A;  2MPX C;  4X1V A;  4PK4 A;  5HKC A;  2G3R A;  2VB6 A;  2A37 A;  5IH2 A;  3I56 Q;  4X34 A;  4F04 B;  2HNI A;  3P8B B;  3G6E Q;  3QHS A;  1WNL A;  1RI0 A;  1NJI C;  3GPL A;  4RTY A;  2DXC A;  2A0F B;  4XU3 A;  1EZZ B;  3EFS A;  1NE8 A;  4ME7 A;  1QCO A;  2RN8 A;  2B8A A;  4N0A C;  5FRM A;  5AT1 B;  2AKL A;  5D6X A;  1WFW A;  4V2S A;  3MEV A;  2R5A A;  2MCN A;  1VQ4 T;  3C12 A;  5FW9 A;  1JRI A;  2HKQ B;  2QA4 T;  7AT1 B;  3GLX A;  2QG9 B;  2DIL A;  2J7I A;  5IN1 A;  4BDZ A;  2P4R A;  1MMD A;  1YHQ Q;  2D9T A;  4ZGD B;  4JPB W;  4C92 A;  2DNU A;  2VAS A;  1IXD A;  4WTO B;  4L6V 5;  2XKO C;  2QQA A;  3TQ7 P;  5CQX A;  1BCM A;  3CC2 T;  2EKH A;  1NJI R;  3VS5 A;  3FDR A;  2KAF A;  2JMC A;  2QAZ A;  4IUT A;  2RHI A;  1M3C A;  1RL2 A;  3NFC A;  5CQY A;  2EYX A;  4KGZ B;  4OB1 B;  1MUZ A;  4E47 A;  2DK3 A;  3CCR A;  3RES A;  2K7A A;  4LE9 A;  1RI9 A;  3FLG A;  3HP9 A;  2XID A;  4GY5 A;  4HCB A;  5GAM e;  3M0U A;  3NTI A;  4EMG A;  2DIQ A;  4IKF A;  3HSB A;  2K3X A;  4C8Q G;  1OUL A;  1ZHI A;  4J9C A;  4X9D A;  1OPK A;  2KRM A;  4EMH A;  3I5R A;  1VYT A;  4O5V A;  3CCL Q;  3X24 B;  1VQM Q;  5CKE A;  4XTV A;  3MEU A;  3CCS A;  2DL8 A;  1VQK Q;  2LX9 A;  1VQ7 T;  1PM3 A;  2EYY A;  1VQ9 T;  2WSC E;  2JNG A;  1D1B A;  1QCN A;  2YRC A;  4BDY A;  1UTI A;  3ULR B;  1YJ9 T;  2ZAE A;  1HJD A;  1G83 A;  3CBM A;  1NYG A;  3EFO B;  4M7A F;  4M7A E;  2DZC A;  5GAN 3;  5LJ3 d;  1ZBX A;  4RTZ A;  3H9N A;  3CXC S;  3J81 E;  3M0R A;  1M2V A;  2W10 A;  2HSE B;  2V8K A;  3MCA B;  2QK0 A;  1PG5 B;  1KQS P;  2EQJ A;  2DTO A;  3I5S A;  1QP2 A;  3REA B;  2V8I A;  2RM4 A;  4F17 A;  1K0X A;  3CMA A;  3G4S Q;  1UEB A;  4MML A;  3T9N A;  3CCU Q;  3OYJ A;  2CYZ B;  2F2X A;  1V76 A;  2QGG A;  4GLK A;  2C0O A;  5J3B A;  2EYQ A;  2OAW A;  3CME Q;  4FW2 A;  1I0C A;  5IHI A;  4C0G A;  2KRO A;  3THK A;  3JV3 A;  4OB2 B;  4BUG A;  2PZ1 A;  2DD5 A;  1S1N A;  4JRP A;  3HTR A;  3PT9 A;  3QKJ A;  2P84 A;  2JM9 A;  2RNA A;  1K1Z A;  2O9S A;  2QDY B;  2PUO B;  5GJV B;  1WXT A;  2OAU A;  2HKN A;  2SEM A;  4M78 D;  1FMW A;  2J6F A;  3VYH B;  3GBQ A;  1I5O B;  4A63 B;  3G6E T;  1VA7 A;  2CSQ A;  5GAN d;  3O8V A;  5LJ3 j;  4M7D D;  3EHR A;  3CCQ A;  2COZ A;  4IUV A;  1VQO T;  2FL7 A;  2E3H A;  2GTO A;  1VUB A;  2CSI A;  2DBM A;  3OW2 P;  4IUP A;  3JCM e;  1OEB A;  3JCM X;  2ED0 A;  5GAM g;  2W0Z A;  1VQL A;  2V26 A;  4R55 A;  2LJ0 A;  1KIK A;  1UGQ B;  3VUB A;  2RK2 A;  4WCI A;  2DPP B;  1TUD A;  4C92 D;  1RAH B;  4RTX A;  4LN2 A;  3CQT A;  1NYF A;  2JS2 A;  3OYL A;  2OI3 A;  4OB0 B;  1RAA B;  2D8J A;  4DEY A;  3CCE Q;  5GAM h;  2QI2 A;  4EPC A;  2I2L A;  2QDL A;  1PSF A;  4C8Q F;  1G5V A;  3EG9 B;  1H8K A;  4M75 E;  1DJ7 B;  5C6S A;  1QVP A;  3QWY A;  1M1F A;  1M1K R;  1IGU A;  2QEX Q;  2KMT A;  1NPR A;  2L3S A;  3CC4 T;  4JRK A;  4LUE A;  4PFO A;  4J9G A;  1WHK A;  2OTJ A;  1FMK A;  1Q82 U;  2IIM A;  2QQ9 A;  1M5Q 1;  2EGC A;  3V8K A;  4Y91 A;  2EWN A;  1BIB A;  1YCS B;  3E2U A;  3JCM P;  1IO6 A;  2K5I A;  5GJW B;  1AD5 A;  3BY7 A;  4FT4 A;  2E70 A;  2ROT A;  4FSS A;  5GMK e;  1X69 A;  1N5Z A;  3BE3 A;  4C92 C;  1C1A A;  3L42 A;  1Q7Y R;  2DBK A;  6AT1 B;  1OQK A;  3MP6 A;  2PVD B;  1VQ8 A;  2C06 A;  1VQP A;  4WF2 A;  1SHF A;  4OF1 A;  3OYK A;  2HCK A;  3L2V A;  2PNI A;  4HCZ A;  2OX7 A;  1VQK T;  1ACM B;  3MEW A;  4JJC A;  1TOV A;  5A0G A;  5LJ5 e;  4M77 E;  3KBG A;  3TVT A;  4CRI A;  4Z8A A;  3UPU A;  4BI8 B;  5GAN f;  1Y96 A;  1VQ6 T;  2KVQ G;  4J9B A;  2DYB A;  4E7H A;  1B07 A;  1I4K 1;  3NTH A;  3RKY A;  5KCO A;  3CPW P;  2KEA A;  2RHZ A;  3M55 A;  4C5E A;  2DXB A;  4KUL A;  4AT1 B;  3H41 A;  1BB9 A;  4QQG A;  2A7Y A;  2MYS A;  3VJP A;  1VQ9 A;  2O4X B;  5KYU A;  3JCM g;  3L1A A;  1IGQ A;  1QVF S;  1CKA A;  4M75 C;  1GXI E;  1RAE B;  1Y0M A;  1XQH A;  1VYV A;  3N5B B;  4AG2 C;  4KUI A;  1X6B A;  2RHU A;  3MJX A;  2LVM A;  4PJJ A;  1OI1 A;  2ED1 A;  1Y57 A;  2RI5 A;  2DTH A;  2J6O A;  3M4G A;  3C95 A;  2F5T X;  1W2B P;  2JT4 A;  5CR2 A;  1NEB A;  2AK5 A;  1PWT A;  3LYI A;  4J8O A;  2KY9 A;  3JCM h;  1LJO A;  2L8D A;  2R57 A;  3QG1 A;  3FC3 A;  5KYX A;  4LUD A;  2X3W D;  1PRL C;  3TEE A;  1Q95 G;  3QUI A;  1G3T A;  1VQ4 Q;  5DM7 R;  3O5Z A;  2ZPF B;  1K9M R;  2RI2 A;  2YWW A;  2QA4 Q;  3WVE B;  1K8A C;  4OMP A;  4CC7 A;  2P0K A;  4BE0 A;  4QQD A;  5L8R E;  2K2V A;  2K9G A;  4J9F A;  4NS5 A;  4M77 C;  5J26 A;  3TSW A;  2RJD A;  1WLP B;  4L5G A;  4ZN1 A;  2A08 A;  2E6N A;  2A36 A;  1X2Q A;  3I56 A;  3G6E A;  5KYY A;  3CC2 Q;  4M7A B;  2JUF A;  4JJB A;  2ECZ A;  1TG0 A;  1Q86 C;  2CZ6 B;  2IPO B;  1YFN A;  2DD4 A;  2M0Y A;  4DA4 A;  3EGX B;  1QCF A;  5HCK A;  2RQT A;  2HBW A;  2MIO A;  3JAM E;  5AYF A;  3CD6 Q;  2QTX A;  4J9D A;  1QMC A;  1PD0 A;  2ZGW A;  5GAO r;  5GMK h;  2DLP A;  1ABQ A;  2X4Y A;  4E7K A;  1KC8 R;  2DMO A;  2QXF A;  1KSW A;  2XDP A;  5KYN A;  3I55 T;  3UDC A;  3JB9 D;  2O01 E;  4OMQ A;  2HQE A;  3EGU A;  1K8A R;  4XTW A;  4UC4 A;  4PLL A;  2CH4 A;  3R6O A;  1KQ1 A;  3VS0 A;  4OGC A;  2XHC A;  1D1A A;  5FRO A;  4RUG A;  4XU0 A;  1OZ3 A;  2HL3 A;  2F2V A;  1YHQ A;  5LJ5 h;  2LTO A;  1YJN T;  2BZX A;  1VQ7 Q;  1SPK A;  3A5Z B;  4MDX A;  1T0H A;  2CH4 W;  4KRT A;  4JUV A;  3H8Z A;  5EC7 A;  1KFZ A;  3UF4 A;  1M3A A;  1R77 A;  3VS7 A;  1QVF A;  4ANJ A;  4ATO A;  1M27 C;  1YJ9 Q;  4OGE A;  1K8A U;  1LOJ A;  5KE3 A;  2H3J A;  1K73 C;  1OX9 A;  2E41 A;  2GQV A;  3CEY A;  3BW1 A;  2DTI A;  2CZ7 B;  3EFR A;  2EIF A;  3OYY A;  4BI4 A;  5CK9 A;  5KYW A;  2ZCF B;  1OX8 A;  3SDZ A;  3RNJ A;  4BD3 A;  1YCY A;  2E5Q A;  2FZK B;  4P5N A;  2RB6 A;  3GF5 A;  2OTL T;  1GBQ A;  2RHX A;  3HFN A;  2LQ8 A;  1NLP C;  3A8M B;  2NWM A;  2LDM A;  2R5M A;  1N6A A;  2K6D A;  2QQB A;  1QQJ A;  2EAY A;  3CCL A;  1Q86 U;  1VQM A;  1HD3 A;  4BE1 A;  1KHC A;  3I35 A;  1VQK A;  3M5A A;  1G2B A;  3G71 T;  2YRD A;  4D8K A;  3A8O B;  3M54 A;  4M75 B;  3LW5 E;  3Q1J A;  1ZSG A;  3OY9 A;  5DLO A;  2CRE A;  3H0F A;  2M02 A;  3QZ5 B;  4JS5 A;  1BI2 A;  4FM4 B;  2P0P A;  3M9Q A;  1SSH A;  2FYK A;  1JQQ A;  3VS3 A;  1NLO C;  3A1P A;  4FYV B;  2RD1 A;  4M78 A;  1HSQ A;  1H64 1;  1K73 R;  2X3X D;  1XJW B;  4FSX A;  1VQO Q;  3RR6 A;  4M7D A;  3X28 B;  2VGM A;  4F14 A;  2LX7 A;  1M2V B;  2Z0W A;  4E7I A;  2GFA A;  3EG1 A;  4HCC A;  2K3Y A;  2C0T A;  1H3Z A;  1WJS A;  3G4S A;  2D0N A;  1MV3 A;  4DOV A;  1I07 A;  1NBE B;  2QAS A;  4XU2 A;  2L89 A;  4ORZ A;  3CCU A;  1I81 A;  3CXC P;  1K73 U;  5GAO n;  3CME A;  4PNO A;  1A0N B;  3SEM A;  4C92 G;  5GAM j;  2KYB A;  2RQW A;  4M77 B;  2L2P A;  1VQ5 Q;  1BI3 A;  4B6M A;  1RAB B;  3M4Y A;  3VV0 A;  1C0M A;  4KT0 E;  1R0C B;  3CPF A;  2JJ9 A;  4FYW B;  2LT4 A;  4Z02 A;  2JTE A;  2YRV A;  3JB9 I;  3ZEH A;  3V8J A;  4QT7 A;  4EMK C;  3L2Z A;  1WDX A;  4FW1 A;  2LCS A;  3CC4 Q;  1JJ2 P;  3LWH A;  2JM8 A;  1JXM A;  2JZ2 A;  2KI7 A;  2DRK A;  4E2F B;  2CUD A;  3IQL A;  2KT8 A;  2MAM A;  2EGA A;  5GAN 4;  3CD6 T;  1X27 A;  4AMC A;  4ZN3 A;  3EH2 A;  2DET A;  1NG2 A;  4LDX A;  2CS7 A;  4QKU A;  2ZPE B;  3PVL A;  3EG3 A;  3JB9 H;  2VUB A;  3C4S A;  3EGD A;  3JSC A;  4M75 G;  2DFU A;  1IRE B;  2RA2 A;  4J9E A;  3JCM d;  1UEC A;  3CC7 T;  3SWN B;  3CCE A;  4AFZ C;  4F16 A;  2E6Z A;  1UGV A;  3QII A;  4RTW A;  2RPN A;  2X51 A;  1LCK A;  3JRZ A;  3JCM Q;  1OU8 A;  5ECA A;  4JJD A;  3OYE A;  1VQ6 Q;  2L3R A;  2LJ1 A;  2LCC A;  1MMN A;  2QEX A;  1LPL A;  1BI0 A;  4HCK A;  4C8Q A;  2KDS A;  2KNB B;  1SEM A;  4XTZ A;  2KT1 A;  1M90 C;  4A4K A;  2RQV A;  2F69 A;  1BU1 A;  2ZPB B;  4OMN A;  1YJW Q;  2EPD A;  3OYM A;  5KH6 A;  2DX1 A;  5CKD A;  2HEQ A;  2EBP A;  3OYD A;  1UJY A;  4LNP A;  3S3O A;  4RCB A;  2DIG A;  3JB9 J;  5GMK i;  4CI0 C;  2HDA A;  2MOX A;  3CCM T;  1VQN T;  1AT1 B;  1BYM A;  4M77 G;  4PFP A;  2DJQ A;  4F7U A;  2DYI A;  4J9I A;  2RO0 A;  2PTK A;  1TXQ A;  4MMK A;  5FWB A;  1GFC A;  4QW2 A;  4R56 A;  3HL8 A;  3TU4 K;  3X26 B;  3M0S A;  2Y4Y A;  1M4Z A;  3RMS A;  5CIU A;  1U06 A;  1Q82 C;  3OYI A;  3QBY A;  3VRZ A;  4OMM A;  4RTU A;  1SHG A;  4II1 A;  2EVR A;  1D3B B;  2CP3 A;  3LLR A;  2DRM A;  2XU8 A;  2DL3 A;  2A3L A;  4BE2 A;  3M0T A;  3PIP A;  1LNX A;  1Y96 B;  2RMO A;  4PJO A;  1K0S A;  4C92 F;  4C92 E;  3MO8 A;  2EQM A;  4VUB A;  5LJ5 d;  2FPE A;  2X4X A;  3JCM c;  2CZ0 B;  1GCQ A;  1GRI A;  3OBY A;  5M9O A;  1MND A;  1U8R A;  2E1H A;  3GNG A;  1TUC A;  2IVW A;  4XAX B;  1QVG P;  4XQ3 A;  2XK0 A;  3G7Z A;  4LXC A;  1K4U S;  2V1Q A;  2JOY A;  1IRX A;  5KYU B;  1JBM A;  2LMJ A;  2FVU A;  4J6Y A;  5FU7 C;  1M90 U;  2EW3 A;  2L5Q A;  2E3I A;  2GF7 A;  4Q5W A;  2V8J A;  3I9Q A;  2DXU A;  3AT1 B;  1Q82 R;  3CBO A;  1RAI B;  5GMK j;  3RBB B;  1CSK A;  2DF6 A;  4M78 C;  1N27 A;  1VQ5 T;  1OU9 A;  1WHM A;  2DO3 A;  1U1S A;  1F1B B;  1D0Y A;  4ELY C;  1WJQ A;  3OYF A;  1SF9 A;  4M75 F;  1VQ4 A;  4M7D C;  4RG8 A;  1MV0 B;  4EMK B;  5KYX B;  5LJ3 f;  2VKN A;  3I55 Q;  1G8X A;  2QA4 A;  2RHY A;  2FZC B;  3JB9 G;  1YI2 Q;  4B9W A;  1RAC B;  1UG1 A;  3HFO A;  5LJ5 j;  2PVO B;  4FT2 A;  2XIC A;  3G1J A;  3OYN A;  1N8R C;  4PJN A;  2DZ9 A;  1B34 A;  4J7F A;  1WZO A;  1BCO A;  4XTY A;  1KQS S;  5GAN 8;  2V1R A;  3FJ5 A;  2WAC A;  3M58 A;  1YJN Q;  4HVW A;  3S3N A;  2D1X A;  1KJW A;  2PQW A;  2JTF A;  4A4F A;  3CC2 A;  4DEX A;  3CCJ T;  4J6W A;  1M8M A;  5GMK l;  2L3P A;  3PTA A;  4LD6 A;  1SSF A;  1WX6 A;  1ARK A;  3OS1 A;  1UB4 A;  1FXX A;  4MDW A;  1PKS A;  1H3H A;  2KXD A;  1TWB A;  1FX7 A;  2YT6 A;  2MMP A;  4FYY B;  1S72 T;  5CCA A;  3CD6 A;  4D6W A;  4C0D C;  4QVZ A;  3F70 A;  3A98 A;  2EKO A;  4C8Q D;  4M77 F;  3E19 A;  2OTL Q;  3OMC A;  1TS9 A;  3ZBD A;  1WXU A;  2ZPH B;  1ZUK A;  4N4I A;  4RG2 A;  2BE9 B;  3VKI A;  5GAO q;  2EJG A;  1JO8 A;  5LJ5 f;  5GAN e;  4LDU A;  1WHL A;  4CC4 B;  4CC3 A;  2BKD N;  1VIE A;  1N8R R;  4OB3 B;  2E4H A;  2BTT A;  1YJW T;  3OW2 S;  3G71 Q;  2X4W A;  1QLY A;  2M1H A;  4N4G A;  1VQ7 A;  1PCX A;  1KD1 U;  3UWN A;  4KGV B;  2L3Q A;  1AZG B;  2QTV A;  1OPL A;  1PHT A;  3BFM A;  2MWP A;  3PGG A;  2H8H A;  4ELZ C;  1BBZ A;  5IHN A;  1YJ9 A;  3UAT A;  3UT1 A;  2PU9 B;  1K76 A;  2F2W A;  4JZ3 A;  2NUP A;  1VOM A;  1N8R U;  2CP0 A;  4A4H A;  2VGN A;  3INZ A;  1YWO A;  2XMF A;  1RUW A;  1WPY A;  3OYH A;  3ZL7 C;  3QZ9 B;  3HRT A;  1XNI A;  3HRS A;  5KYW B;  1QWE A;  5GAO l;  4PJO D;  2EFI A;  3GOX A;  2GCX A;  2HMA A;  1Q81 C;  5D7U A;  1W70 A;  2RI3 A;  1GCP A;  4J83 A;  2J6K A;  1I5L A;  1KK7 A;  5GAN 6;  3EHQ A;  2VWF A;  5LJ3 g;  2NYS A;  2LQK A;  1WA7 A;  2K5L A;  4JZ4 A;  2JN0 A;  3QPH A;  1M8V A;  1PKT A;  4EIK A;  2G6F X;  1WHH A;  5FRN A;  2Y90 A;  1KQS A;  4QVC A;  3CBP A;  4NL3 A;  3JB9 F;  4HA8 A;  3H0I A;  1R8O B;  5FU7 B;  5I22 A;  2ZZD A;  4GLM A;  3PE0 A;  5C0M A;  2CUB A;  2M0O A;  2YUQ A;  3JCM J;  2MF2 A;  1VQO A;  5IHK A;  2OJ2 A;  3SD4 A;  2VC8 A;  1ZA1 B;  3OYG A;  2X9H A;  4M78 B;  4KBM B;  3WXM B;  3CCR T;  4PJO C;  3URG A;  3PIO A;  4FL6 A;  4M7D B;  4BAC A;  2ENM A;  1GCQ C;  3H0H A;  3QDR B;  2J06 A;  2BZ8 A;  4MZM A;  1W1F A;  1W4S A;  3VUZ A;  3CPW S;  1MMG A;  1YI2 T;  3SB2 A;  1J3T A;  5GAN g;  2KE9 A;  1AZE A;  2RH2 A;  2EJF A;  3CCS T;  2DEQ A;  2AKK A;  3PFS A;  5KE2 A;  4J9H A;  5HK0 A;  5CKF A;  1AEY A;  2FG0 A;  3CC7 Q;  3A8G B;  4ZGE B;  1VQ5 A;  1Y7X A;  1Z9Q A;  2E12 A;  3OW2 A;  1MGQ A;  2P0Q A;  2C0I A;  4HKE A;  1JB0 E;  4FU6 A;  3TSZ A;  2EYW A;  2K3B A;  3C0C A;  1Q81 U;  1N9S A;  4C92 B;  3DB3 A;  3MKD A;  5GAN h;  1YIJ Q;  2O9V A;  4KH0 B;  1W2B S;  3BDL A;  1Q86 R;  3CC4 A;  1ZX6 A;  3VU3 C;  2XDB A;  2YUN A;  3E1S A;  3M59 A;  4QVD A;  4C0D B;  4J6X A;  2O88 A;  3HPW A;  1UUE A;  2AIR B;  1ZSZ A;  3MP1 A;  3J80 E;  1QKX A;  5L23 A;  1V1C A;  5CKH A;  4LDY A;  3CCM Q;  3CMA T;  2AZS A;  2F1L A;  3FJP A;  1XOV A;  3LWI A;  1VQN Q;  4PJL A;  1FYN A;  5CVI A;  2DL5 A;  1FWZ A;  1X01 A;  4ZNX A;  4RCC A;  1E7O A;  4HT8 A;  2CKK A;  5FU6 C;  2PVG B;  2MI6 A;  2RJC A;  5GMK m;  4NOY A;  1M2O A;  4HVV A;  3OS0 A;  1T3S A;  2CT4 A;  3RKW A;  5GAM d;  2KXC A;  3QYH B;  4J5Y A;  2CP2 A;  1PD1 A;  1VQ6 A;  3V7C A;  9ATC B;  5A2Q E;  1X75 C;  4AG1 C;  2A28 A;  1GL5 A;  1M3B A;  4M78 G;  3CCQ T;  4L59 A;  2DEU A;  4X9C A;  1YJW A;  2VXE A;  1ZA2 B;  2RF0 A;  2JTM A;  4M7D G;  8ATC B;  4M7A A;  1WHG A;  5IXB A;  4OMO A;  5KCH A;  3P8D A;  1QWF A;  4IUR A;  4DBR A;  2FB7 A;  4OMF B;  3QO3 A;  1VQL T;  3NTK A;  2D0Q B;  2FO0 A;  3OBW A;  2JW4 A;  3FRN A;  2VVK A;  2K57 A;  3EGX A;  4XTX A;  2DVJ A;  5I2M A;  3SHW A;  2FRY A;  2MK5 A;  1VYU A;  3CPW A;  1KQ2 A;  2FZG B;  3OQ5 A;  4F7U B;  4KGX B;  1RAF B;  5GAN 2;  5IAY A;  4PL6 A;  1IB8 A;  2RK1 A;  1C6V X;  2M9U A;  3ME9 A;  4C0F A;  2ESW A;  3FB9 A;  4JJN K;  1SRM A;  5GAO m;  1R0B G;  2YUO A;  4JRQ A;  3MET A;  3DLL A;  2L0A A;  2LT1 A;  1UFF A;  1W6X A;  3OB9 A;  2OTJ T;  4Y92 A;  2E64 A;  2FEI A;  3A8L B;  3OA6 A;  3HHT B;  1AWO A;  4PJO B;  4LDW A;  1W2B A;  3WVD B;  1SG5 A;  3DKM A;  2K2M A;  2K5F A;  4BY6 C;  3TCJ A;  5DY9 A;  4HVU A;  1HK9 A;  1AHJ B;  4Z88 A;  5EG2 A;  2O2O A;  3CCJ Q;  1NEG A;  1AWX A;  4K11 A;  1M9S A;  2FPF A;  2AZV A;  4PKC C;  5A0L A;  1AVZ C;  2KRN A;  1VQ8 T;  3PNW C;  1VQP T;  2BZY A;  3REB B;  4HXJ A;  3VS6 A;  5GAM f;  2E65 A;  1X6G A;  1S72 Q;  3ZFJ A;  1I8F A;  2P4T A;  1G3S A;  4JLI A;  1U3O A;  1B7T A;  1NJI U;  1YIT Q;  2ZPI B;  4MZP A;  3I55 A;  1WXB A;  2XD0 A;  5I11 A;  2DAQ A;  1YI2 A;  2NUT A;  5I21 A;  3CCV Q;  1YIJ T;  4M75 A;  1K9A A;  1O75 A;  2R58 A;  4NL2 A;  2YHT A;  3S3M A;  4BI3 A;  1YJN A;  3E9F A;  3L2R A;  1UDL A;  1WI7 A;  2IG0 A;  4FYX B;  2KRS A;  2PUK B;  1B34 B;  2BE7 D;  1QW1 A;  4M78 E;  4M78 F;  3M56 A;  1PC0 A;  1YBY A;  2LCL A;  3DB4 A;  4F7U G;  4RMO A;  2F5K A;  1ZLM A;  1QP3 A;  4N4H A;  4M7D F;  4M7D E;  4QQ6 A;  5FU6 B;  5I2S A;  4FCY A;  3LH5 A;  5GAO p;  2B86 A;  2XDD A;  3OSV A;  1UGS B;  3SFM A;  2GQI A;  3EH1 A;  2KBT A;  3NMZ C;  2O31 A;  3FEO A;  1OYX A;  2FPD A;  3S6W A;  2OTL A;  1H92 A;  3PMT A;  4C5I A;  4FIB A;  3RER A;  1GBR A;  2QYZ A;  4OVA A;  4PJO G;  4IUU A;  4M77 A;  2HL5 C;  2VXF A;  1ZSZ C;  3EAE A;  2EQI A;  3MEA A;  1M90 R;  3V7R A;  4M7A D;  3M57 A;  1JJ2 S;  1M30 A;  2SRC A;  5LL6 S;  2M51 A;  2CP7 A;  3G71 A;  2XI9 A;  1N9R A;  2JS0 A;  5D6Y A;  2LC4 A;  2VYT A;  3LX7 A;  1VIF A;  5FWC A;  1UJ0 A;  1IZ6 A;  1HYO A;  4KH1 B;  3I56 T;  2CT3 A;  1AWJ A;  2EGE A;  2BUD A;  2CGH A;  2VV5 A;  3OYA A;  1M1K C;  4Z89 A;  3P8H A;  4M4Z A;  2EQU A;  3MPU B;  2HQX A;  2EYZ A;  1WYX A;  3JCM f;  1O9S A;  1T0J A;  1OV3 A;  2EQK A;  2NUP B;  1OZ2 A;  2H3E B;  2YXY A;  1JEG A;  3CCR Q;  1KD1 C;  4XK8 E;  3DLM A;  1SRL A;  2YLC A;  2YLB A;  1P92 A;  3GNF B;  2CP6 A;  1QVF P;  1T3L A;  4M7A C;  2QGF B;  4C0Z A;  2RQR A;  4JLG A;  4XU1 A;  4XTU A;  3SWN A;  1Q7Y C;  3VRY A;  2DVE A;  4A4G A;  3R6N A;  3JCM V;  3X20 B;  3GP8 A;  2AHJ B;  3RDV A;  4IUQ A;  4A54 A;  5LJ3 e;  1YHQ T;  3X25 B;  4E6R A;  1ZUY A;  4GBQ A;  3CCS Q;  1MNE A;  1V29 B;  3OS2 A;  2HZY A;  1YP5 A;  4BY6 B;  1HXD A;  3QJ6 A;  4C8Q E;  1IHW A;  3BDU A;  2KYM A;  2HBP A;  1D09 B;  3EFO A;  3JCM b;  3TRE A;  5GAN j;  2LJ3 A;  2COW A;  2YSQ A;  3NHN A;  5CO7 A;  2ATC B;  4OP0 A;  4E7J A;  4DBH A;  2DL7 A;  1YWP A;  2LZ6 B;  2DXT A;  4AFQ C;  5KYY B;  1BIA A;  3D7S B;  2Y4X A;  3CXC A;  2KGT A;  4A4E A;  2WSF E;  3OYB A;  3QJY A;  2K4Y A;  2DM1 A;  1PSE A;  1M1G A;  4TVR A;  1KD1 R;  1U1T A;  4F7U F;  2HD0 A;  4F7U E;  3QDF A;  3KXT A;  3A8H B;  1X6O A;  2E5K A;  3RKX A;  1YIT T;  3OSS C;  3U23 A;  4M75 D;  1RAG B;  5CAI A;  1M1K U;  3PMI A;  4LDV A;  4KUD K;  2E10 A;  3CMA Q;  2QQR A;  4PFZ A;  3CCL T;  5DLQ E;  3CCV T;  4C5G A;  1NM7 A;  1VQM T;  4E7Z A;  2J05 A;  2GFU A;  5D6W A;  3UA6 A;  3QWX X;  1D3B A;  3CC7 A;  1JJ2 A;  2ZPG B;  1YN8 A;  3LGL A;  1LVK A;  1WQ7 A;  1RLQ C;  1E6H A;  8AT1 B;  1QVG S;  2CZ1 B;  4PJO F;  4PJO E;  2JMA A;  3C94 A;  2GTJ A;  1D1C A;  1AWW A;  2M16 A;  1ZUU A;  3RMQ A;  1Q7Y U;  1YIJ A;  1WIE A;  1G3W A;  1K9M C;  4CC2 A;  3OMG A;  5IT9 E;  2DKG A;  4N0A A;  1PRM C;  5IXF A;  2LRQ A;  3CCQ Q;  2FHD A;  1UHC A;  4ZTF A;  3M0P A;  3FIF A;  3PVQ A;  4YTL A;  3J7A F;  3ASK A;  2KK4 A;  4C8Q C;  1JXO A;  1Y71 A;  1I1J A;  3M0Q A;  1ZQ1 A;  2HSP A;  1TTH B;  4M77 D;  3MP8 A;  4ESR A;  5J39 A;  1KHI A;  3CCM A;  1VQL Q;  3NGP A;  3G4S T;  4J7I A;  1VQN A;  1ZSZ B;  1WGS A;  4ZTJ A;  4ZGJ B;  4E7L A;  4BB7 A;  1SKU B;  2RQU A;  2K79 A;  3VS2 A;  3CCU T;  3LGF A;  1EIF A;  2EJ9 A;  3CME T;  1CKB A;  3EG0 A;  2ABL A;  4R0K A;  2NLU A;  4PJM A;  4RTV A;  3EG9 A;  3UA7 A;  1D0Z A;  2DL4 A;  4C5H A;  4EMK A;  1WJR A;  3QXE B;  2D6F A;  2NUZ A;  4IIO A;  4AFS C;  1KC8 C;  2YUP A;  1UHF A;  2LNH B;  1B3Q A;  3V8L A;  4OML A;  2DA9 A;  3VS4 A;  5LJ3 h;  4AFU C;  2WSE E;  1U5S A;  1JU5 C;  2OTJ Q;  3KUF A;  4DOW A;  2JVV A;  4IIM A;  4DBQ A;  2KQW A;  1IHV A;  3H6Z A;  3EG2 A;  3QSU A;  4EDU A;  3MHX A;  4JS4 A;  1UE9 A;  3VYG A;  3E9G A;  1XTD A;  1Q81 R;  1GFD A;  1K9M U;  4JDS A;  1NZ9 A;  1UGP B;  1VQ8 Q;  4RTT A;  4E7S A;  3HKS A;  1UGR B;  2RJF A;  1VQP Q;  1OOT A;  2CDT A;  5A0D A;  1FMV A;  1RAD B;  1ZBJ A;  2CP5 A;  2DE0 X;  3CCE T;  5LJ5 g;  4MZT A;  4O6J A;  1G3Y A;  1X43 A;  5CKB A;  2QQS A;  3L2Q A;  3LH0 A;  2LQN A;  1ABO A;  2HQH A;  4A53 A;  4DBF A;  1QVG A;  4RKU E;  3RUX A;  2XG8 D;  3OYC A;  2KR3 A;  2QEX T;  3OS5 A;  2HAX A;  1YNZ A;  4Y28 E;  1QKW A;  2AT1 B;  1X2K A;  1BI1 A;  1E6G A;  2BIV A;  1TU0 B;  2O4X A;  1WQW A;  2X4J A;  2KSS A;  1TSF A;  3SWN C;  1MHN A;  2GBQ A;  1BKB A;  1VQ9 Q;  1TH7 A;  1KC8 U;  1EX4 A;  4DQ2 A;  2LQW A;  1WHJ A;  3CCJ A;  4LD9 K;  3KFV A;  4JRI A;  4HT9 A;  1TUG B;  3HRU A;  2ROL A;  3ER0 A;  1AOJ A;  2X35 A;  2MWO A;  3GIB A;  2DJZ A;  4D8D A;  1NPP A;  2FRW A;  4B9X A;  5FLX E;  5GAN 5;  3AHU A;  3QYG B;  3VS1 A;  1D0X A;  1KG1 A;  1S72 A;  2COY A;  2YDL A;  3EGD B;  1PNJ A;  1BK2 A;  2LP5 A;  1YIT A;  2RJE A;  2I0N A;  2LNV A;  3V7S A;  2GGR A;  3L2U A; 
#chains in the Genus database with same CATH homology
 1G3T A;  2DAQ A;  4EMK B;  5LJ3 f;  1YI2 A;  5DM7 R;  5GAN 7;  2QA4 A;  2RHY A;  2ZPF B;  3RIR A;  5I21 A;  3CCV A;  3JB9 G;  2RI2 A;  1YIJ T;  5HY6 A;  3WVE B;  4B9W A;  1K8A C;  3HFO A;  3M53 A;  4M75 A;  1O75 A;  2R58 A;  5LJ5 j;  2PVO B;  4M7A G;  4FT2 A;  2XIC A;  3L2W A;  2P0K A;  4C8Q B;  4NL2 A;  4QQD A;  2DZ9 A;  2YHT A;  5L8R E;  3OYN A;  4BE0 A;  3JCM W;  1B34 A;  4J7F A;  3S3M A;  2K2V A;  4XTY A;  1KQS S;  1Y07 A;  5HK3 A;  5GAN 8;  4BI3 A;  1VQ4 A;  1YJN A;  3E9F A;  4M77 C;  4NS5 A;  5J26 A;  3L2R A;  2IG0 A;  4PLI A;  2WAC A;  3M58 A;  2RJD A;  4L5G A;  3S3N A;  4ZN1 A;  2PQW A;  2E6N A;  2PUK B;  1B34 B;  2G3R A;  1QW1 A;  2JTF A;  4M78 E;  4M78 F;  4A4F A;  5HKC A;  3I56 A;  3M56 A;  3CCJ T;  3CC2 A;  3G6E A;  4M7A B;  1YBY A;  2LCL A;  2JUF A;  3DB4 A;  4X34 A;  2HNI A;  3P8B B;  4J6W A;  4F7U G;  3QHS A;  1WNL A;  1RI0 A;  1NJI C;  4RMO A;  2F5K A;  5GMK l;  3GPL A;  1QP3 A;  4N4H A;  4M7D F;  4M7D E;  4QQ6 A;  4LD6 A;  1SSF A;  2DXC A;  3PTA A;  5FU6 B;  3OS1 A;  5I2S A;  1Q86 C;  1UB4 A;  4XU3 A;  1FXX A;  4MDW A;  2CZ6 B;  3EFS A;  1NE8 A;  4ME7 A;  5GAO p;  2XDD A;  1FX7 A;  3OSV A;  2MMP A;  1UGS B;  2DD4 A;  4DA4 A;  3SFM A;  1S72 T;  5CCA A;  3CD6 A;  4D6W A;  3JAM E;  4C0D C;  2B8A A;  5AYF A;  2QTX A;  4N0A C;  5FRM A;  4QVZ A;  3F70 A;  2ZGW A;  2EKO A;  3FEO A;  1OYX A;  3S6W A;  5D6X A;  4C8Q D;  5GMK h;  5GAO r;  2OTL A;  4V2S A;  4M77 F;  3E19 A;  3MEV A;  2R5A A;  2X4Y A;  3PMT A;  3OMC A;  4C5I A;  4E7K A;  2QXF A;  2XDP A;  4FIB A;  3ZBD A;  3RER A;  2ZPH B;  3I55 T;  3UDC A;  3JB9 D;  1VQ4 T;  3C12 A;  2O01 E;  4OVA A;  4PJO G;  4IUU A;  1JRI A;  2HQE A;  4N4I A;  2QA4 T;  4M77 A;  2VXF A;  4RG2 A;  3GLX A;  3VKI A;  4XTW A;  5GAO q;  2EJG A;  3EAE A;  3MEA A;  4UC4 A;  4PLL A;  5LJ5 f;  3V7R A;  5IN1 A;  4LDU A;  3M57 A;  5GAN e;  1JJ2 S;  3HSB A;  3R6O A;  4M7A D;  1KQ1 A;  4OGC A;  5LL6 S;  2BKD N;  1VIE A;  2XHC A;  5FRO A;  4OB3 B;  4BDZ A;  3G71 A;  2XI9 A;  4XU0 A;  1N9R A;  1OZ3 A;  1YJW T;  3OW2 S;  1YHQ A;  5D6Y A;  2LC4 A;  2VYT A;  2D9T A;  2M1H A;  2X4W A;  4N4G A;  4ZGD B;  3LX7 A;  3UWN A;  5LJ5 h;  1KD1 U;  1VQ7 A;  2LTO A;  4C92 A;  1YJN T;  1VIF A;  3A5Z B;  4MDX A;  4L6V 5;  2XKO C;  1IZ6 A;  2QQA A;  5CQX A;  3BFM A;  3I56 T;  2MWP A;  3CC2 T;  4JUV A;  3PGG A;  3H8Z A;  2BUD A;  4ELZ C;  2CGH A;  3FDR A;  2VV5 A;  3OYA A;  2KAF A;  1YJ9 A;  4IUT A;  1QVF A;  3UT1 A;  4ATO A;  1M1K C;  2PU9 B;  2RHI A;  4OGE A;  3P8H A;  2EQU A;  1K8A U;  1RL2 A;  3NFC A;  2HQX A;  3JCM f;  1LOJ A;  1O9S A;  5KE3 A;  5CQY A;  2H3J A;  1K73 C;  2E41 A;  1N8R U;  2EQK A;  2GQV A;  3CEY A;  4A4H A;  3BW1 A;  4OB1 B;  2DTI A;  2CZ7 B;  2VGN A;  2DK3 A;  2EIF A;  3EFR A;  3INZ A;  3OYY A;  4BI4 A;  4E47 A;  2ZCF B;  5CK9 A;  1OZ2 A;  3CCR A;  3RES A;  3SDZ A;  4BD3 A;  1YCY A;  1WPY A;  2E5Q A;  4P5N A;  3FLG A;  3OYH A;  2RB6 A;  3HP9 A;  2XID A;  4GY5 A;  3QZ9 B;  3GF5 A;  3HRT A;  1KD1 C;  4XK8 E;  1XNI A;  2RHX A;  2OTL T;  4HCB A;  3DLM A;  3HRS A;  3HFN A;  2LQ8 A;  5GAM e;  2YLC A;  5GAO l;  4PJO D;  2YLB A;  1P92 A;  3A8M B;  3GNF B;  2EFI A;  3GOX A;  2GCX A;  3NTI A;  2DIQ A;  4EMG A;  4M7A C;  1Q81 C;  2LDM A;  4JLG A;  4XU1 A;  2K3X A;  1N6A A;  2R5M A;  4C0Z A;  4C8Q G;  4IKF A;  2RI3 A;  1ZHI A;  4XTU A;  3SWN A;  4X9D A;  1Q7Y C;  2QQB A;  4J83 A;  2EAY A;  3CCL A;  1Q86 U;  4EMH A;  1VQM A;  1I5L A;  4BE1 A;  2DVE A;  4O5V A;  5GAN 6;  4A4G A;  1KHC A;  3X24 B;  3JCM V;  3X20 B;  3GP8 A;  5CKE A;  4XTV A;  2AHJ B;  5LJ3 g;  1VQK A;  4IUQ A;  3M5A A;  3MEU A;  4A54 A;  3CCS A;  3G71 T;  2LQK A;  5LJ3 e;  1YHQ T;  3X25 B;  2K5L A;  2LX9 A;  2JN0 A;  1V29 B;  3OS2 A;  1VQ7 T;  3A8O B;  3QPH A;  4BY6 B;  1M8V A;  1HXD A;  3QJ6 A;  3M54 A;  4M75 B;  4C8Q E;  3LW5 E;  3BDU A;  1VQ9 T;  2WSC E;  2JNG A;  3Q1J A;  1N8R C;  2HBP A;  3OY9 A;  5FRN A;  2Y90 A;  1KQS A;  5DLO A;  4QVC A;  3JCM b;  3CBP A;  4NL3 A;  3TRE A;  5GAN j;  3JB9 F;  4BDY A;  3QZ5 B;  4HA8 A;  5CO7 A;  1BI2 A;  4FM4 B;  2P0P A;  4JS5 A;  1R8O B;  5FU7 B;  3M9Q A;  2ZZD A;  1YJ9 T;  5C0M A;  4OP0 A;  3CBM A;  2FYK A;  2M0O A;  4M7A F;  4M7A E;  2DZC A;  5GAN 3;  5LJ3 d;  4E7J A;  1ZBX A;  2RD1 A;  2MF2 A;  3JCM J;  4M78 A;  3CXC S;  1H64 1;  2DXT A;  3J81 E;  1VQO A;  1BIA A;  4FSX A;  3SD4 A;  2Y4X A;  2VC8 A;  3CXC A;  3OYG A;  4M7D C;  4A4E A;  2WSF E;  4M78 B;  3OYB A;  3QJY A;  4KBM B;  2K4Y A;  3WXM B;  3CCR T;  4M7D A;  2V8K A;  4PJO C;  3MCA B;  3X28 B;  2VGM A;  1PSE A;  1M1G A;  4TVR A;  3URG A;  3PIO A;  1U1T A;  4F7U F;  2HD0 A;  4F7U E;  4E7I A;  2EQJ A;  2DTO A;  2GFA A;  1QP2 A;  3A8H B;  1X6O A;  2V8I A;  4FL6 A;  2K3Y A;  3KXT A;  4HCC A;  4M7D B;  2RM4 A;  3RKX A;  1H3Z A;  4BAC A;  1WJS A;  3OSS C;  1YIT T;  4M75 D;  3G4S A;  5CAI A;  1M1K U;  3PMI A;  4DOV A;  3QDR B;  3CMA A;  4LDV A;  4KUD K;  4MZM A;  2E10 A;  4XU2 A;  1W4S A;  2L89 A;  3VUZ A;  1UEB A;  3CPW S;  2QQR A;  1YI2 T;  3CCL T;  5DLQ E;  3CCU A;  3CCV T;  4C5G A;  1VQM T;  1I81 A;  3SB2 A;  4MML A;  5GAN g;  3T9N A;  3OYJ A;  2CYZ B;  2RH2 A;  2EJF A;  5GAO n;  2GFU A;  4PNO A;  4GLK A;  5D6W A;  3CME A;  5J3B A;  1K73 U;  3CCS T;  2EYQ A;  2DEQ A;  3PFS A;  4C92 G;  5KE2 A;  5GAM j;  1D3B A;  4C0G A;  5CKF A;  5HK0 A;  3CC7 A;  4M77 B;  4OB2 B;  2ZPG B;  4BUG A;  1JJ2 A;  2DD5 A;  3A8G B;  3LGL A;  1WQ7 A;  4ZGE B;  4JRP A;  1VQ5 A;  1Y7X A;  3PT9 A;  3QKJ A;  1QVG S;  1BI3 A;  2E12 A;  3OW2 A;  2QDY B;  2CZ1 B;  1MGQ A;  2P0Q A;  2PUO B;  2OAU A;  4PJO F;  3M4Y A;  4PJO E;  3C94 A;  4HKE A;  4M78 D;  3VV0 A;  1JB0 E;  4FU6 A;  3VYH B;  4KT0 E;  1Q81 U;  1N9S A;  2M16 A;  3CPF A;  4C92 B;  3G6E T;  2LT4 A;  3DB3 A;  4Z02 A;  3RMQ A;  2YRV A;  3JB9 I;  3ZEH A;  5GAN d;  3O8V A;  5LJ3 j;  1YIJ A;  3V8J A;  5GAN h;  1G3W A;  1K9M C;  4M7D D;  4EMK C;  3CCQ A;  3L2Z A;  3OMG A;  5IT9 E;  1W2B S;  4IUV A;  3BDL A;  2DKG A;  4N0A A;  3CC4 A;  2LRQ A;  2FHD A;  1VQO T;  2FL7 A;  3VU3 C;  3LWH A;  4ZTF A;  2XDB A;  1VUB A;  3E1S A;  2JZ2 A;  3M59 A;  4QVD A;  3FIF A;  4C0D B;  4YTL A;  3J7A F;  4J6X A;  3ASK A;  2KK4 A;  4C8Q C;  2MAM A;  4IUP A;  3HPW A;  3JCM e;  5GAN 4;  3CD6 T;  1Y71 A;  3JCM X;  1ZQ1 A;  3MP1 A;  4M77 D;  3MP8 A;  5J39 A;  5GAM g;  4ZN3 A;  3J80 E;  1VQL A;  4R55 A;  1KHI A;  4LDX A;  2CS7 A;  3CCM A;  5CKH A;  2ZPE B;  4LDY A;  3G4S T;  4J7I A;  1VQN A;  3CMA T;  1WGS A;  4ZTJ A;  4ZGJ B;  4E7L A;  3FJP A;  1XOV A;  4BB7 A;  3LWI A;  3JB9 H;  1UGQ B;  5CVI A;  1FWZ A;  2VUB A;  3C4S A;  3VUB A;  2RK2 A;  3LGF A;  1X01 A;  3JSC A;  1EIF A;  2DPP B;  2EJ9 A;  4M75 G;  4RCC A;  4C92 D;  4HT8 A;  1IRE B;  2CKK A;  3CME T;  2RA2 A;  3JCM d;  5FU6 C;  2PVG B;  2MI6 A;  2RJC A;  5GMK m;  4NOY A;  2NLU A;  3CC7 T;  3SWN B;  3OYL A;  3OS0 A;  4OB0 B;  3CCE A;  3RKW A;  4C5H A;  4EMK A;  5GAM d;  1WJR A;  3QXE B;  2QI2 A;  2E6Z A;  3QII A;  4EPC A;  5GAM h;  2I2L A;  2D6F A;  1PSF A;  3QYH B;  4C8Q F;  1G5V A;  4J5Y A;  1KC8 C;  1VQ6 A;  3JRZ A;  4M75 E;  3V7C A;  5A2Q E;  1DJ7 B;  1X75 C;  1QVP A;  5C6S A;  3JCM Q;  3OYE A;  2L3R A;  2LCC A;  2QEX A;  1M1F A;  1BI0 A;  3V8L A;  4M78 G;  4C8Q A;  2KMT A;  2KDS A;  1NPR A;  4XTZ A;  3CCQ T;  1M90 C;  4L59 A;  4A4K A;  3CC4 T;  4JRK A;  5LJ3 h;  2WSE E;  4X9C A;  2F69 A;  1YJW A;  2OTJ A;  2VXE A;  2ZPB B;  1Q82 U;  4M7D G;  2JTM A;  3OYM A;  2QQ9 A;  1M5Q 1;  3KUF A;  5KH6 A;  4DOW A;  2JVV A;  2KQW A;  5CKD A;  4M7A A;  3H6Z A;  4Y91 A;  3V8K A;  4EDU A;  5KCH A;  3QSU A;  3P8D A;  4IUR A;  2EWN A;  3OYD A;  1BIB A;  3S3O A;  2FB7 A;  4RCB A;  3JCM P;  4OMF B;  2K5I A;  2DIG A;  3MHX A;  3JB9 J;  3BY7 A;  4FT4 A;  2E70 A;  3QO3 A;  5GMK i;  4CI0 C;  1VQL T;  5GMK e;  4JS4 A;  3NTK A;  3CCU T;  3CCM T;  3VYG A;  3E9G A;  1XTD A;  2D0Q B;  3OBW A;  1VQN T;  4C92 C;  1BYM A;  1K9M U;  4M77 G;  4JDS A;  3FRN A;  3L42 A;  1NZ9 A;  2K57 A;  4F7U A;  1UGP B;  4XTX A;  5I2M A;  2RO0 A;  3MP6 A;  2PVD B;  4MMK A;  1VQ8 A;  2C06 A;  1VQP A;  4WF2 A;  4OF1 A;  4R56 A;  4QW2 A;  3OYK A;  3HKS A;  1UGR B;  2RJF A;  3HL8 A;  3TU4 K;  3CPW A;  3X26 B;  3L2V A;  3OQ5 A;  4F7U B;  2Y4Y A;  4HCZ A;  1KQ2 A;  5A0D A;  1VQK T;  1M4Z A;  3RMS A;  3MEW A;  5CIU A;  1Q82 C;  5GAN 2;  5IAY A;  3CCE T;  3OYI A;  3QBY A;  4PL6 A;  5A0G A;  4MZT A;  5LJ5 g;  4O6J A;  1G3Y A;  5LJ5 e;  5CKB A;  2QQS A;  4M77 E;  3KBG A;  4CRI A;  2RK1 A;  3L2Q A;  2M9U A;  3UPU A;  3LH0 A;  4A53 A;  4II1 A;  3ME9 A;  4BI8 B;  5GAN f;  1D3B B;  1Y96 A;  3LLR A;  4C0F A;  1QVG A;  2XU8 A;  1VQ6 T;  4RKU E;  2A3L A;  2KVQ G;  3RUX A;  2XG8 D;  3OYC A;  2QEX T;  3FB9 A;  4BE2 A;  3OS5 A;  2HAX A;  4JJN K;  3PIP A;  4Y28 E;  5GAO m;  1LNX A;  1Y96 B;  4PJO A;  4E7H A;  4C92 F;  3MET A;  4C92 E;  4JRQ A;  1I4K 1;  1BI1 A;  3NTH A;  3RKY A;  5KCO A;  3MO8 A;  3DLL A;  2BIV A;  2LT1 A;  2RHZ A;  3M55 A;  2O4X A;  3OB9 A;  4C5E A;  2DXB A;  2EQM A;  4KUL A;  1WQW A;  2X4J A;  3OA6 A;  2E64 A;  3A8L B;  2OTJ T;  4VUB A;  5LJ5 d;  3HHT B;  2KSS A;  2X4X A;  3JCM c;  4QQG A;  2A7Y A;  4LDW A;  1W2B A;  1Q7Y U;  4PJO B;  3SWN C;  2CZ0 B;  3VJP A;  3WVD B;  1MHN A;  3OBY A;  5M9O A;  3DKM A;  2O4X B;  1VQ9 A;  1BKB A;  3JCM g;  2E1H A;  3L1A A;  1U8R A;  2K5F A;  4BY6 C;  3GNG A;  3TCJ A;  2IVW A;  1TH7 A;  4XAX B;  4XQ3 A;  5DY9 A;  2XK0 A;  1HK9 A;  1KC8 U;  1QVF S;  3G7Z A;  4M75 C;  1GXI E;  1AHJ B;  4DQ2 A;  2JOY A;  3CCJ A;  1XQH A;  5EG2 A;  3N5B B;  4LD9 K;  1JBM A;  4JRI A;  4HT9 A;  4KUI A;  3HRU A;  2RHU A;  2FVU A;  3ER0 A;  1M9S A;  2LVM A;  2X35 A;  2MWO A;  4J6Y A;  5FU7 C;  1M90 U;  3GIB A;  2DJZ A;  4PKC C;  5A0L A;  1OI1 A;  1NPP A;  2L5Q A;  2GF7 A;  4Q5W A;  4B9X A;  2RI5 A;  2V8J A;  2DTH A;  1VQ8 T;  3PNW C;  5FLX E;  1VQP T;  5GAN 5;  3M4G A;  2DXU A;  2F5T X;  3C95 A;  5CR2 A;  3AHU A;  5GAM f;  2E65 A;  3QYG B;  3CBO A;  1KG1 A;  3LYI A;  4J8O A;  2KY9 A;  3JCM h;  1LJO A;  5GMK j;  1S72 A;  2L8D A;  2R57 A;  3ZFJ A;  1I8F A;  3QG1 A;  2P4T A;  4M78 C;  1N27 A;  1VQ5 T;  1G3S A;  2DO3 A;  3FC3 A;  1U1S A;  4JLI A;  3L2U A;  1YIT A;  4ELY C;  1WJQ A;  1NJI U;  2RJE A;  3OYF A;  3TEE A;  2ZPI B;  4MZP A;  2LNV A;  3QUI A;  3V7S A;  3I55 A;  4M75 F;  2XD0 A;  4RG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...