5GAN6

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan600
4PJOE 4F7UF 4PJOG 3BY7A 4C92B 4M75A 3JCMg 5GAN3 2YLBA 1BIAA 3VU3C 1D3BB 3RIRA 2HNIA 5GMKm 1M8VA 1I81A 4HA8A 4XU1A 3FJPA 5GAN8 4M7AF 4F7UG 5GANj 5GMKl 4M75E 3M4GA 3RKXA 4M7AC 1Y96A 4XU2A 5LJ3d 1WNLA 2JN0A 5GANe 5GAMh 1I4K1 4M7DE 4PJOA 4V2SA 4WF2A 2DJZA 5GAMg 3HFNA 5GAOp 3JCMd 3BDUA 3BW1A 3EFRA 5LJ3e 4C8QB 5GANd 4C8QD 2K57A 2YLCA 4NOYA 2RM4A 3EFSA 2CGHA 3RESA 3JCMV 4F7UA 1I5LA 3JCMe 2DZCA 5GAN5 3V7SA 3AHUA 1HXDA 2E64A 3FB9A 4XTVA 3V8JA 3JCMh 4PJOC 4EMKA 4M7AE 2E65A 5GAOq 4QVDA 1N9SA 2FB7A 1WQ7A 4M7DA 4M78D 4C92A 2FYKA 4MMLA 3JCMc 5GAMd 4MMKA 5LJ5e 1WQWA 4N0AA 2DXUA 2DEQA 4XU3A 4HT8A 1B34A 5CAIA 1BIBA 3JB9D 5GAMe 5GMKi 4M78A 4C92D 2EJGA 4C8QG 5LJ5d 5GAOn 1M5Q1 1TH7A 2YHTA 3INZA 4M78G 5GAOr 4EMKC 1U1TA 4M7DF 5GAMj 4M7DC 3V7CA 4M75F 2E1HA 1N9RA 2DTIA 4M77C 4C92G 5GAN2 2EWNA 3JCMP 3RERA 4XTYA 4M7AB 2VXFA 2RD1A 4J5YA 5DY9A 1X01A 3JB9F 2E10A 4NL2A 4M7AD 4C92F 1JRIA 3JCMW 4A54A 4XTWA 3QUIA 4PJOF 3V7RA 4OP0A 3SB2A 5GAN4 1KQ1A 3SWNA 5LJ3g 4M77G 4M75B 4X9DA 4M75D 3RUXA 3JCMf 3V8KA 5I21A 4DQ2A 4M77B 3JCMQ 5LJ3j 3JB9J 1D3BA 2VXEA 2DTHA 4C8QC 3JCMb 3JB9G 5GANh 5GANg 4J6XA 4JLIA 1H641 3JCMJ 1KQ2A 2DXTA 1LNXA 5GMKh 1Y96B 4EMGA 4J6YA 4PJOD 4C8QA 4XTZA 4M77E 5GAMf 2RB6A 3PGGA 5GAOl 3RKWA 4XTUA 3RKYA 5GAOm 4XU0A 1U1SA 1HK9A 2QTXA 4J6WA 4M78E 4XTXA 4JUVA 5LJ5f 4EMHA 1LJOA 2E41A 2EJFA 3BFMA 4A53A 1I8FA 4JRIA 1JBMA 2DZ9A 4M7DD 2I2LA 4Y91A 3JB9H 4C92E 1MGQA 4M77A 4PNOA 5LJ3f 4C8QE 1LOJA 1B34B 5GMKe 4X9CA 4PJOB 4C8QF 2RA2A 3HFOA 5GMKj 5GANf 4M77D 4RCBA 3SWNB 3L2ZA 5GAN7 3JCMX 3QO3A 4N0AC 3JB9I 4F7UB 3QSUA 3SWNC 5GAN6 2ZGWA 4C92C 4M78F 3GIBA 4M7DG 2EJ9A 4QVCA 4XQ3A 2DKGA 2EAYA 1YCYA 4M78C 4EMKB 1WPYA 4M75G 4M7DB 4F7UE 4NL3A 5LJ5j 5LJ5h 2VC8A 3QHSA 4RCCA 3V8LA 4JRKA 4M75C 4M77F 5LJ5g 5LJ3h 2DVEA 2DTOA 3HSBA 3FIFA 3L1AA 4M7AA 2Y90A 4HT9A 4M78B 4M7AG
chains in the Genus database with same CATH superfamily
1MUZA 3SEMA 3S3MA 4IUQA 1UGVA 4JS4A 4DOVA 3E9FA 4HA8A 2EBPA 1M1FA 4M75E 3OW2P 3G71Q 2JN0A 3RBBB 2CSQA 3LX7A 1LVKA 4HVVA 4M4ZA 1QCNA 3G7ZA 1K73U 2DXBA 2YUNA 5CKEA 1N27A 2A36A 1IHVA 3C4SA 2YRDA 2E64A 3ZFJA 4KULA 4YTLA 4M7DA 3N5BB 1BCOA 1UJYA 3CCVQ 4N4HA 1AOJA 4N0AA 3E9GA 2KBTA 1AWJA 4X1VA 3URGA 3DLLA 2H3JA 1WZOA 5GMKi 2QGGA 3G71T 1Q82R 2RJFA 3OBYA 2EWNA 2EYQA 2A37A 2CP6A 2NUPA 2RPNA 3M56A 4ZGEB 3P8HA 3SB2A 2XIDA 3M58A 3SWNA 3QG1A 2DA9A 1M3AA 4RUGA 2RF0A 2VXEA 3JB9G 3I55Q 3MO8A 3G6EA 1AWWA 3GBQA 4C8QA 3CD6A 1Q81R 5AYFA 3RKYA 4LDUA 2FZGB 3CCRT 4ZGDB 3FJ5A 3QDFA 1YJWA 1TWBA 1WA7A 2A08A 2ED1A 4OMOA 3RDVA 1BBZA 3QYHB 1PHTA 5I22A 1K73C 4OMNA 2EQJA 1KK7A 2ROTA 3HFOA 1PSFA 3G4SA 3CCJT 3CPWP 2NUPB 2R5MA 4IURA 4M7DG 4AMCA 2RMOA 1WPYA 1RAEB 2J7IA 4BD3A 1VQ5T 3EFOB 1VQOQ 4LDVA 3H6ZA 3L1AA 2EGCA 1WDXA 1YJ9Q 2P4TA 4JZ3A 3EAEA 3I5RA 1KHCA 3IQLA 1BCMA 1X6OA 3GLXA 4MDXA 3BDUA 2K2VA 5IHKA 1C1AA 2OAUA 4DBRA 4ATOA 4F7UA 1BI2A 1JXMA 1RAFB 2DZCA 2DFUA 4R56A 5KE3A 4J83A 3CCRA 2E65A 2J06A 5GAMd 3CPWA 2K5FA 2M51A 1WHLA 3O5ZA 1K8AR 5IHNA 3GNFB 3M9QA 1Q7YU 4M7DF 1TUCA 2K79A 3RERA 2HQXA 1JO8A 3CCVA 2WSEE 2FVUA 2P0QA 1M1KU 4RTWA 1QVPA 2E10A 4PFZA 1EX4A 4FCYA 3GF5A 2L3SA 4M75B 1YJWT 3TQ7P 2RH2A 1KC8U 4KUIA 5KCHA 3SD4A 1WLPB 1AWXA 1YI2T 2DL3A 2K9GA 2LQ8A 3C0CA 4RTVA 2KVQG 2K3BA 2EYZA 5LJ5f 4TVRA 3OS5A 1NLPC 2KEAA 2XDPA 4PJJA 3MP6A 4GY5A 2HL5C 2A7YA 3J80E 1NEBA 4C8QE 1D1CA 1QW1A 2E6ZA 5GJVB 1OX8A 3O8VA 3JCMX 3QO3A 3MEAA 5KE2A 1YI2A 3MP1A 4M78F 3UATA 3CC4Q 2F2XA 3QJYA 2DLPA 2KR3A 1NJIU 1EIFA 5ECAA 5J26A 3UA7A 1GCQC 3HP9A 1V76A 1S72A 4C92B 2COYA 1LCKA 3EH1A 3CCVT 2MWOA 3FJPA 2V1RA 1Y7XA 1ZX6A 3UDCA 2FRWA 2X4YA 3M0PA 4QVZA 4DEXA 2CZ7B 3ZBDA 1OULA 4C8QB 2L2PA 3JCMe 3V8JA 2RHUA 1TUDA 1SF9A 4ESRA 2GFAA 4JRQA 1QVGS 2XICA 3PTAA 2D6FA 2F1LA 1YIJT 7AT1B 3G4ST 4JJDA 1TH7A 1WIEA 2YHTA 3L2VA 1MNEA 3ASKA 4C92G 2JMAA 2DL7A 3J7AF 1PWTA 3HTRA 4EDUA 2XMFA 3C95A 1T3SA 2MK5A 1N6AA 4OP0A 3OY9A 1ZSZB 2AKKA 4OMLA 4X9DA 1K8AU 2QI2A 2E3IA 2MYSA 3CD6T 3CCMA 4P5NA 1SEMA 3OYCA 3NTHA 2LT4A 2L8DA 3HPWA 2NUZA 2QQ9A 3D7SB 3CCJA 4M77E 1X75C 3PGGA 1RI0A 1G3YA 1GBQA 3A5ZB 2NWMA 3OW2A 1K4US 4M78E 2KK4A 4EMHA 2B86A 1X27A 3S3NA 1QWEA 1TOVA 1VQPQ 1ZBXA 1YNZA 1VQOT 4J8OA 2LVMA 3L2QA 2HQHA 2NUTA 2RJCA 3G71A 1Q86C 2E6NA 5A0LA 3VJPA 5GMKj 4LDYA 2O31A 3L2ZA 3CCSA 2COZA 2JT4A 3QSUA 4C5HA 4QVCA 3HKSA 3LH0A 3VS6A 5LJ5j 1P92A 1I07A 3QHSA 1M3CA 2DTOA 3HSBA 4M7AA 4F17A 1FXXA 3OYGA 3EG9A 3OYAA 1PD1A 3CCUA 4PLIA 3CCRQ 2CZ1B 2NYSA 2E5KA 4OB0B 1G3TA 1I4K1 2YRCA 4WF2A 1M1GA 3OB9A 1EFNA 4II1A 4ZTFA 2BIVA 3C12A 1Q7YR 2KDSA 4E7SA 1NE8A 1MV3A 1MMAA 3AHUA 2M0YA 4Z8AA 3JRZA 2M9UA 3S3OA 1UUEA 3JCMc 3I35A 4AT1B 3OYIA 1QCOA 5C0MA 2P84A 1DJ7B 2L0AA 3L2WA 3JCMP 1N9RA 2DTIA 4WTOB 4M7AB 1KIKA 2VXFA 4C5GA 2COWA 3OSVA 2AIRB 1YP5A 5D6YA 1KHIA 4MZPA 4J7IA 2DYIA 3LYIA 4C8QC 2CREA 2EYYA 2K3YA 1IREB 1SHGA 2JTMA 5GMKh 4EMGA 4HVWA 1Z9ZA 2GTJA 2DERA 2MAMA 3OYEA 4LUDA 4XU0A 2AK5A 2QTXA 2WSCE 4BACA 3CC7A 5CR2A 2CT3A 1Q95G 5KYYB 2EFIA 3MKDA 2KXDA 4IUVA 2OI3A 2FPFA 4E7HA 1QKWA 2IG0A 5GAN7 3NTKA 4RTTA 2JM8A 4F7UB 4KRTA 1HD3A 2K5IA 2HSEB 1VQ8T 2DE0X 1K1ZA 3G4SQ 3PE0A 5FWCA 1BI1A 3G6ET 1WYXA 2QQBA 2Y90A 1KFZA 4PK4A 4B6MA 3E2UA 3JCMg 1OV3A 4Y28E 2HEQA 2RHYA 3M4YA 1I81A 2QTVA 4JJNK 4M7AF 2YUOA 2LJ1A 5I11A 4C0ZA 4FSXA 1NG2A 2DEUA 5FU6C 1VQLA 2LX7A 4C8QD 2YLCA 2RM4A 2MF2A 3M5AA 3RESA 1YJ9T 2JOYA 4IKFA 4J9EA 4QVDA 2PVOB 2VASA 1NM7A 1YJNT 5LJ5e 2DXUA 4E7JA 3CMAT 2DVJA 2O4XA 4D8KA 4FYWB 1M5Q1 3CPFA 4ZNXA 1M27C 3KUFA 2E1HA 3TVTA 2RQVA 2GQVA 1NYFA 1NBEB 4BDYA 1TTHB 2JW4A 1JRIA 1KQ1A 3X28B 4EPCA 5HK3A 5CKFA 1D1BA 3JB9J 1UHCA 2NLUA 4KGZB 1VQOA 2LNHB 4FT2A 3CPWS 1M9SA 3CQTA 4R55A 1WHMA 4QKUA 1RAHB 4XTZA 5GAMf 1UDLA 1QWFA 3LH5A 3EGXB 1VQNT 3EG9B 4A53A 2V8JA 1VQ7Q 2EQKA 3CC2A 2JXBA 4E7ZA 3CC2T 3A8LB 3M0TA 2RO0A 3CEYA 3CCLQ 3PT9A 1M1KR 1QVFP 3VS3A 3CCUQ 3VUZA 3MP8A 3X20B 1T0JA 2CP0A 2LP5A 2PNIA 5GANf 2JJ9A 1YHQQ 4M77D 2ENMA 2AZVA 1GFCA 2QAZA 4RTUA 3QWYA 3LW5E 4C92C 1YJWQ 1GRIA 3OYLA 2OTJT 3X25B 1OPKA 2W0ZA 1ZHIA 5LJ5h 3V8LA 2AZSA 1K9MR 4JRKA 4M77F 3CC2Q 2JTEA 4OVAA 1MHNA 2L3PA 4F7UF 1RUWA 4PJOG 5IXFA 2YLBA 2GTOA 2LMJA 1IB8A 2MWPA 1FWZA 4M7DE 2PUOB 1IZ6A 2DJZA 3CMET 3CMAA 2DIGA 4DA4A 2HBPA 1ZSGA 1I5LA 1RAGB 3TSZA 3FB9A 4XTVA 4A63B 3JCMh 1RAIB 1N9SA 2HKQB 4MMLA 2DNUA 5KYUB 1VQLT 1VYVA 3HHTB 1UHFA 4CC4B 5GAOr 1TXQA 1WHGA 5IHIA 2RQTA 1FYNA 5GAN2 2MI6A 2LCCA 1ABOA 2BZXA 5J39A 1D0YA 1Y07A 3CBMA 4XAXB 5I2MA 3FC3A 1TUGB 3QZ5B 3V8KA 4DQ2A 4E7IA 1Q7YC 1KC8R 3M59A 4J6XA 3OYKA 4MDWA 2FZCB 2VV5A 1KQ2A 3META 1OI1A 2WACA 2DETA 4PJOD 4DBFA 5CCAA 4XTUA 2O9SA 2EYWA 4BE2A 1AWOA 1JU5C 1RAAB 1LJOA 1WHHA 3X24B 1OOTA 2I2LA 1YIJA 4E6RA 2EKHA 4PNOA 2YRVA 4X9CA 1WXUA 1D09B 4PLLA 4JLGA 2RN8A 4RMOA 3T9NA 3SWNC 1PSEA 3A1PA 3U23A 2XU8A 3I56Q 3H41A 5A0DA 2QQSA 3CBPA 5HKCA 4DBQA 4FT4A 4M75A 2VKNA 1ZLMA 2FRYA 1GXIE 2YUQA 3CBOA 4L59A 4OB1B 4NS5A 1KG1A 2OJ2A 3QPHA 1GCPA 1WNLA 2LZ6B 2YXYA 3EGXA 3JCMd 1VQ4A 4A4FA 1Q86R 2L89A 4PJOC 2DO3A 1NJIR 5HK0A 3VV0A 1X6GA 1KJWA 2EQIA 2QQRA 4M78D 1WI7A 1PCXA 5CQXA 1UECA 2RQUA 2EGAA 1GL5A 1M2VA 2LX9A 1U1TA 5GAMj 1OU8A 2JS0A 1RLPC 2CSIA 3PMIA 1G3WA 1G5VA 1QLYA 4PL6A 3CCUT 1IGQA 4J5YA 4LN2A 2AHJB 4NL2A 4XTWA 1VQKA 3QDRB 2DYBA 1H641 2DXTA 1KD1C 1UB4A 4WCIA 4F14A 3AT1B 1D1AA 1B3QA 3UT1A 2OAWA 5KYXB 1M4ZA 3E1SA 1WHJA 3LGFA 1VYTA 4F04B 1AZEA 1N5ZA 4Y91A 4LD6A 2EVRA 1IO6A 1O9SA 4LNPA 1UGRB 1Q82U 2K2MA 4AFSC 3UF4A 2I0NA 2RI3A 5GAN6 1TS9A 1U3OA 4B9XA 6AT1B 4R0KA 5D6XA 3G1JA 2EJ9A 4HCCA 4M78C 1G83A 3FDRA 4Y92A 1HSQA 1JXOA 4AG2C 1VQMT 2KAFA 1C6VX 1M8MA 3FIFA 2O4XB 2KE9A 4LDWA 2CKKA 2W10A 3BY7A 2X3WD 4ZN1A 1U8RA 3ZL7C 4J9HA 1BIAA 2QASA 3RMQA 2IVWA 4XU1A 1KC8C 1RADB 1AT1B 5GAMh 1VQ4T 1VYUA 4J7FA 2RHXA 3SFMA 1S72T 2E3HA 4B9WA 1I5OB 2DPPB 1AD5A 1BI0A 2V1QA 2O9VA 4FYXB 4E47A 3MEWA 3WVDB 1G2BA 1WFWA 1WQWA 3FRNA 3FEOA 4BI3A 1VQ8Q 2FPDA 2EJGA 3OYBA 4C0DC 3INZA 2PVDB 2C0TA 1QMCA 2RJEA 2XG8D 1YITQ 1KQSS 1NJIC 1Y0MA 1K9MC 2F69A 2EKOA 2ECZA 2MOXA 3OMGA 2DAQA 1X01A 3VUBA 3V7RA 3VS7A 4CC2A 1D3BA 2EPDA 1JJ2S 4K11A 3PIPA 1IGUA 2ABLA 2ZPIB 4GLKA 1CSKA 1QQJA 1YITT 2LCLA 3OYNA 5GAOl 3RKWA 3HRUA 2HCKA 4LD9K 1YJ9A 2E41A 1E7OA 1ZBJA 3MHXA 4JRIA 3ME9A 3JB9H 4BI4A 1OZ2A 2D8HA 2BE7D 4ZGJB 4CC3A 2QEXQ 1JJ2A 3OYFA 1PD0A 3CCET 4QQ6A 2XI9A 1F1BB 4DOWA 4AFQC 3H0HA 1X6BA 2R58A 3OS0A 2CP2A 3P8DA 2GBQA 1WHKA 4XQ3A 3HRSA 2B8AA 1PM3A 2C0OA 2VC8A 1YHQA 1WJSA 1A0NB 1MMDA 1RABB 1KD1U 3QXEB 2X9HA 2J6OA 2KNBB 2ZPHB 2DIQA 4QQDA 5IH2A 3M4GA 3DLMA 5GANe 4IIOA 2ED0A 4AG1C 3CMEA 5KYXA 4UC4A 2M02A 4RG2A 1VQMQ 4J9FA 3V7SA 4Z88A 1VQ6Q 2L3RA 4HT8A 4C0DB 3VS5A 1U06A 1XJWB 5LJ5d 4M78G 2LDMA 9ATCB 2WSFE 4HKEA 4EMKC 4IUUA 2KMTA 3NHNA 3CMEQ 2K5LA 3ULRB 3EG1A 4J9DA 2QDYB 3GOXA 2LNVA 1VIEA 1SRMA 5HCKA 2ZZDA 4DEYA 4PJOF 1BK2A 2PTKA 3JCMQ 1QKXA 4PJMA 1ZQ1A 2VUBA 2LQNA 1W2BA 3OS2A 3DB3A 3I55A 2K6DA 1PC0A 4DBHA 3GPLA 2ATCB 4J6WA 1OYXA 1I8FA 2KSSA 5KH6A 4M7DD 1NLOC 4MZMA 3VRYA 4QW2A 1NZ9A 2LRQA 2XKOC 2JMCA 1B34B 1FMVA 4OF1A 2K7AA 3UPUA 1V1CA 4J9IA 2J6KA 3I56A 3CCJQ 1M1KC 3I5SA 2LQWA 2RJDA 1N8RC 5D7UA 1V29B 4OMPA 1JQQA 4M75C 5LJ5g 2LCSA 1K9MU 2HMAA 1YFNA 2IIMA 4BY6B 8ATCB 2MCNA 2R5AA 3RIRA 2DBKA 4F7UG 3EHQA 1Y96A 2JVVA 2YSQA 3QZ9B 1OPLA 2DL5A 1KSWA 2K57A 2RK1A 2CGHA 2KGTA 3OMCA 4ANJA 2D0NA 1ABQA 3CCQT 3QBYA 1BU1A 4Z02A 1ZA1B 4ZN3A 2BKDN 5CAIA 1BIBA 4BE0A 4PKCC 2X4XA 2XHCA 1N8RU 3R6NA 2HZYA 3CCST 2R57A 4M7DC 3V7CA 2JM9A 2QA4A 1IRXA 2LTOA 2FG0A 1VQ6A 2MMPA 4IIMA 1W2BS 5DY9A 1WJQA 1QVGA 3JB9F 1VQNQ 5FRMA 4C92F 2X4JA 4M7AG 5AT1B 2VWFA 3JCMf 5FW9A 3H8ZA 1S1NA 1ZSZC 4RG8A 3LWHA 3JCMJ 2DJQA 1FX7A 4FM4B 1M2VB 1MMGA 2RB6A 5D6WA 2X51A 3CC4A 2CUDA 2KT1A 3H0FA 1U1SA 1HK9A 1E6HA 3CCMQ 2KROA 2PQWA 4IUPA 3WXMB 1FMKA 4HCBA 1O75A 5FWBA 5GMKe 4PJOB 3NFCA 2VB6A 4A4KA 1Y57A 4RCBA 3OYYA 4C0GA 1VQ9T 1Z9QA 1PRLC 2HBWA 1VQLQ 2EAYA 4M7DB 4F7UE 3TREA 4NL3A 2BZ8A 1M2OA 5CKDA 1UTIA 3TEEA 1B07A 5KCOA 1SPKA 3EH2A 4JS5A 3QWXX 4E2FB 1WXTA 3MEUA 5GJWB 1VQ6T 2QYZA 3VU3C 2YWWA 2QA4T 1M90U 5GMKm 5KYYA 2J6FA 4AFUC 2LJ3A 5LJ3d 4PFPA 3BW1A 2PU9B 3EFRA 2P4RA 4E7LA 3CCQA 4C5EA 4AFZC 2L3QA 3OYMA 4C92A 3TSWA 2Z0WA 2L5QA 3FLGA 4D6WA 1NYGA 1UGPB 1VQ4Q 2E70A 1BI3A 4M77C 2KYMA 4L5GA 4OMMA 1JB0E 1JEGA 1U5SA 4KBMB 2YDLA 2OX7A 2QG9B 2KRSA 4HCKA 4LE9A 1XTDA 2FHDA 2ZCFB 2QQAA 1RACB 1SRLA 2M1HA 1CKBA 1PG5B 2OTLT 3CCLA 2K3XA 2YT6A 3CCSQ 2O2OA 1R0BG 3CCQQ 4BY6C 1KQSA 1XNIA 1Y71A 3VS0A 4Z89A 2BE9B 3MCAB 4JUVA 1RI9A 1YCSB 2P0KA 3A8MB 1MGQA 3OA6A 4J9GA 2DXCA 2EGEA 3Q1JA 3PIOA 1Q81U 3CC7Q 2JS2A 2RNAA 4FYYB 2ZAEA 1H3ZA 3GIBA 4J9BA 2MIOA 2RHIA 1EZZB 2G6FX 4RCCA 1QVFS 2F5TX 1VQPT 4FW2A 1UGQB 2QDLA 3G6EQ 4HT9A 3M0SA 4RTYA 1WJRA 1D3BB 2HNIA 2CH4W 2EQMA 4OGCA 3HFNA 2HL3A 1VOMA 2DF6A 2DILA 2FO0A 5KYNA 1ACMB 2DM1A 1WGSA 1JJ2P 1GBRA 2FYKA 4KT0E 1C0MA 2F5KA 4XU3A 2QA4Q 2ZPBB 1YIJQ 1FMWA 2CP7A 4M78A 2X35A 1K0SA 1HYOA 2YUPA 2RQRA 1M30A 3BE3A 1X69A 2GFUA 4M7AD 1UE9A 1LPLA 3OW2S 4HCZA 1J3TA 4M77G 2G3RA 3RUXA 2E5QA 5CKHA 1VUBA 1H8KA 1YITA 1M3BA 3JAME 1E6GA 1I1JA 1ZA2B 1NEGA 1K76A 4A4HA 2V8KA 2CZ6B 2FZKB 3BFMA 1JBMA 3EFOA 2RI5A 4C92E 1I0CA 1XOVA 3UA6A 3OQ5A 4F16A 2HSPA 3SWNB 2RK2A 3EGUA 4BUGA 4O6JA 4CI0C 4N0AC 5HY6A 3DKMA 3X26B 1K73R 2HAXA 4OMFB 1H3HA 3PFSA 4EMKB 2KXCA 3HRTA 1TU0B 2D0QB 3I55T 3EG0A 2SEMA 2CYZB 3RMSA 1Q82C 1W1FA 4OB2B 5CQYA 1RL2A 4OMQA 5KYWB 1M8VA 1G8XA 4M7AC 4JDSA 1VQNA 2O88A 1X2QA 1QCFA 2RI2A 4BDZA 4MZTA 2HKNA 1W2BP 5LJ3e 2KY9A 4GBQA 5CIUA 3CXCA 1QP2A 4ORZA 2EQUA 2EIFA 5DM7R 3NTIA 2BZYA 2KRNA 3JB9D 4N4GA 4FSSA 1VIFA 4C8QG 4RTZA 3SHWA 2NUTB 1ZUKA 2DMOA 2FL7A 4BB7A 3VYHB 1VQ7A 1QVFA 5EC7A 4A54A 1VQMA 3QUIA 4FU6A 3NGPA 3TU4K 1R77A 1AEYA 4JZ4A 2OTJQ 5DLOA 2KQWA 3QIIA 2CP3A 3PMTA 4JLIA 3GNGA 3GP8A 2F2VA 2SRCA 1LNXA 2ZPEB 1YHQT 1GCQA 3M57A 2DL4A 3REAB 5FU7B 2D8JA 5GAOm 4PJNA 2Y4XA 1VQ7T 3EGDA 4OGEA 3CCLT 2OTLA 1K0XA 1TG0A 2HDAA 1LOJA 4J9CA 2X3XD 2ZPFB 1M90R 3H0IA 2QK0A 5IXBA 3A8OB 5FROA 1W6XA 1VA7A 3MEVA 1VQKT 2ROLA 3OS1A 2K4YA 1Q81C 1ZUUA 1W70A 1OX9A 5GAN3 2LT1A 2GQIA 4FW1A 3VS4A 5GANj 3RKXA 1VQPA 3J81E 4XU2A 4KGVB 4PJOA 4V2SA 2KI7A 4ELZC 5GAOp 2OTLQ 2VVKA 4NOYA 3HL8A 3MJXA 1KQSP 4HVUA 2H3EB 3MPUB 2ZPGB 2QXFA 3CXCS 3PVQA 2FB7A 1WQ7A 2BTTA 2CUBA 3A8GB 2O01E 5IT9E 2EYXA 4C0FA 3M54A 4JJCA 5GAMe 3EG2A 2C06A 5IAYA 1ZUYA 5FLXE 2CS7A 2DL8A 4O5VA 2MPXC 5I21A 2AKLA 2JZ2A 4M77B 2P0PA 5LJ3j 1KD1R 1AHJB 5GANh 5GANg 3S6WA 5A0GA 1OU9A 3OBWA 1VQ5A 5KYWA 4J6YA 2QEXA 5KYUA 3SDZA 2E4HA 2H8HA 2X4WA 1MNDA 4XTXA 5M9OA 1MMNA 1IHWA 2XK0A 2DZ9A 3KBGA 3C94A 1R8OB 4A4EA 5J3BA 2DBMA 1UJ0A 5FU7C 2DRMA 5I2SA 5CVIA 3P8BB 4A4GA 2VYTA 3OYDA 3KFVA 2DKGA 4OB3B 1YCYA 3CXCP 4M75G 1YJNA 1SG5A 3CD6Q 1SHFA 3R6OA 4PFOA 1BYMA 2FEIA 1ZSZA 1VQ5Q 3QYGB 3WVEB 3I56T 1PKSA 4JRPA 1YWOA 4PJOE 3A98A 5C6SA 2JUFA 1BB9A 3A8HB 3PNWC 2XDDA 4JJBA 2CZ0B 1T3LA 1H92A 1MV0B 2ESWA 3JV3A 3PVLA 4FYVB 4XK8E 4QT7A 2VGMA 5GANd 2F2WA 1SSHA 2FPEA 4KGXB 3UWNA 2RHZA 1VQKQ 1WX6A 5GAN5 1VQ9A 3M55A 2PZ1A 1Q86U 5EG2A 5GAOq 3VYGA 4FIBA 4KH1B 5L23A 1ARKA 3CCMT 4MMKA 2LC4A 1OZ3A 3OSSC 4LDXA 2C0IA 1CKAA 3H9NA 4M75F 4LXCA 1XQHA 4GLMA 4XTYA 2KYBA 2RD1A 1PKTA 2A0FB 1TSFA 2JTFA 5GAN4 2KT8A 1NPPA 2A28A 4ELYC 5A2QE 4M75D 1QVGP 1YWPA 2DTHA 2DRKA 2E12A 3VS1A 1UFFA 3DB4A 1YI2Q 2QEXT 3KXTA 2PVGB 3CCEQ 4PJLA 1X2KA 2V8IA 1PNJA 1OEBA 3F70A 4JPBW 4EIKA 2LQKA 1YN8A 4E7KA 1WXBA 3REBB 5LJ3f 4CC7A 1RLQC 2DD4A 1QP3A 3QJ6A 2LJ0A 3M0RA 2Y4YA 3L2RA 3OYJA 1N8RR 1D0ZA 2XDBA 3I9QA 1B7TA 2CT4A 1T0HA 2D9TA 2XD0A 4RTXA 1R0CB 3EHRA 4X34A 3NMZC 2GNCA 3BDLA 4KUDK 3CCEA 3LWIA 2D1XA 5IN1A 1K9AA 2J05A 4LUEA 4HXJA 4C5IA 2CDTA 4CRIA 5GAN8 2JNGA 5CKBA 5GMKl 2A3LA 5FU6B 5CO7A 3ZEHA 2HD0A 1S72Q 3VS2A 5GAMg 2GCXA 3EFSA 4L6V5 3JCMV 2GGRA 4FL6A 2VGNA 4BI8B 1HXDA 2GF7A 1VQ8A 1GFDA 4EMKA 4M7AE 5FRNA 3RR6A 5CK9A 1D0XA 2DEQA 3JSCA 1B34A 2DK3A 1W4SA 4C92D 5GAOn 2PUKB 5LL6S 3CC7T 1YBYA 1UG1A 5L8RE 8AT1B 5LJ3g 1G3SA 3JCMW 1SSFA 4RKUE 1M90C 3CC4T 3EG3A 5DLQE 3CMAQ 3LGLA 3JCMb 4IUTA 2AT1B 2DD5A 4ME7A 1Y96B 1PRMC 2V26A 1OQKA 4BE1A 3VKIA 4KH0B 1NPRA 2OTJA 3LLRA 1YJNQ 1UGSB 4ZTJA 3L42A 2EJFA 3VRZA 2M16A 3M0QA 3RNJA 1UEBA 1BKBA 3L2UA 4M77A 1HJDA 3M53A 3E19A 2IPOB 2DX1A 4C8QF 2RA2A 3NPFA 4VUBA 3TCJA 1IXDA 2CH4A 2KRMA 1X43A 1VQ9Q 2QGFB 4D8DA 3OYHA 3ER0A 3JB9I 2ZGWA 2BUDA 3M0UA 4QQGA 3QKJA 1AVZC 2RQWA 1K8AC 1SKUB 4Q5WA 2EW3A 2CP5A 1AZGB 2M0OA 5LJ3h 2DVEA 3EGDB 2HQEA 3THKA 4M78B 4N4IA
chains in the Genus database with same CATH topology
1KD1U 3QXEB 4OB2B 3S3MA 5CQYA 3JCMg 1RL2A 4IUQA 4Y28E 2ZPHB 4JS4A 2RHYA 2DIQA 3M4YA 4DOVA 1M8VA 1I81A 3E9FA 4HA8A 4JJNK 4M7AF 1M1FA 4QQDA 4M7AC 4JDSA 3M4GA 4M75E 3DLMA 5GANe 2JN0A 1VQNA 4C0ZA 3LX7A 4FSXA 3CMEA 4BDZA 2RI2A 4MZTA 5FU6C 4UC4A 1VQLA 5LJ3e 4C8QD 2YLCA 4RG2A 1K73U 3G7ZA 2RM4A 2MF2A 2KY9A 2DXBA 5CKEA 3M5AA 5CIUA 3RESA 1N27A 3CXCA 3C4SA 3V7SA 1QP2A 2E64A 3ZFJA 2JOYA 1YJ9T 2EQUA 4KULA 4YTLA 4IKFA 4M7DA 2EIFA 4QVDA 2PVOB 3N5BB 1YJNT 4N4HA 5LJ5e 5DM7R 4N0AA 2DXUA 2L3RA 3E9GA 4E7JA 3CMAT 3NTIA 3URGA 4C0DB 4HT8A 3JB9D 4N4GA 3DLLA 2H3JA 1VIFA 5GMKi 2O4XA 4C8QG 5LJ5d 1M5Q1 2LDMA 3CPFA 4M78G 3G71T 2WSFE 4HKEA 4EMKC 3KUFA 4IUUA 2RJFA 2KMTA 3OBYA 2FL7A 2E1HA 2EWNA 2EYQA 2K5LA 4BB7A 3VYHB 2GQVA 2QDYB 3GOXA 2LNVA 1VIEA 2ZZDA 1VQ7A 4BDYA 3M56A 1QVFA 1JRIA 4A54A 4ZGEB 1VQMA 3QUIA 4FU6A 4PJOF 3P8HA 3SB2A 3TU4K 2XIDA 1KQ1A 3M58A 3SWNA 3X28B 4EPCA 3JCMQ 3QG1A 5HK3A 5CKFA 5DLOA 2KQWA 2VXEA 3QIIA 3JB9J 3JB9G 2NLUA 3PMTA 4JLIA 3GNGA 1VQOA 4FT2A 3GP8A 3MO8A 3CPWS 3G6EA 1M9SA 1ZQ1A 2VUBA 1LNXA 1W2BA 2ZPEB 3OS2A 1YHQT 4C8QA 4R55A 3DB3A 3M57A 4XTZA 5GAMf 3I55A 3CD6A 5AYFA 5FU7B 3RKYA 5GAOm 4LDUA 3GPLA 3CCRT 4J6WA 4ZGDB 1OYXA 1VQNT 4A53A 2V8JA 1YJWA 2Y4XA 1I8FA 1VQ7T 2KSSA 2EQKA 5KH6A 3CC2A 3CC2T 4M7DD 3A8LB 4OGEA 2RO0A 4MZMA 3CCLT 3QYHB 3CEYA 2OTLA 4QW2A 1K73C 1NZ9A 2LRQA 2XKOC 3PT9A 1LOJA 1B34B 2EQJA 4OF1A 3VUZA 2ZPFB 3MP8A 3X20B 3UPUA 3HFOA 1PSFA 5GANf 3G4SA 4M77D 3CCJT 3I56A 1M1KC 2R5MA 3A8OB 2RJDA 4IURA 3LW5E 4C92C 4M7DG 1N8RC 3OYLA 2OTJT 1WPYA 3X25B 1V29B 5FROA 5LJ5h 1ZHIA 3V8LA 4BD3A 4JRKA 4M75C 4M77F 5LJ5g 1K9MU 1VQ5T 3MEVA 4LDVA 3H6ZA 1VQKT 3L1AA 4OVAA 3OS1A 2K4YA 1MHNA 1Q81C 2P4TA 4BY6B 4F7UF 4PJOG 2R5AA 3EAEA 5GAN3 2LT1A 2YLBA 3RIRA 1KHCA 2MWPA 4F7UG 5GANj 3RKXA 1VQPA 1X6OA 1FWZA 1Y96A 4XU2A 3J81E 2JVVA 3GLXA 4PJOA 3QZ9B 4M7DE 4V2SA 4MDXA 2PUOB 1IZ6A 4ELZC 2DJZA 3CMET 3CMAA 5GAOp 3BDUA 2DIGA 2K2VA 4DA4A 2OAUA 2K57A 2HBPA 4NOYA 4ATOA 2RK1A 3HL8A 2CGHA 3OMCA 4F7UA 1I5LA 1BI2A 2DZCA 4R56A 2ZPGB 3FB9A 2QXFA 4XTVA 5KE3A 3JCMh 4J83A 3CXCS 2E65A 3CCQT 3QBYA 1N9SA 2FB7A 1WQ7A 3CCRA 4MMLA 5GAMd 3A8GB 2K5FA 2O01E 4Z02A 3CPWA 5IT9E 1VQLT 4C0FA 3HHTB 3RMSA 4ZN3A 2BKDN 5CAIA 1BIBA 4BE0A 4PKCC 2X4XA 3M54A 2XHCA 5GAMe 1N8RU 3GNFB 3M9QA 1Q7YU 2C06A 3CCST 4M7DF 5GAOr 2R57A 4M7DC 3V7CA 2QA4A 5IAYA 5GAN2 2LTOA 2MI6A 3RERA 2LCCA 2HQXA 3CCVA 1VQ6A 2MMPA 2WSEE 2FVUA 2P0QA 5FLXE 5J39A 1W2BS 2CS7A 1M1KU 5DY9A 1QVPA 1WJQA 1QVGA 3JB9F 2E10A 3CBMA 1Y07A 5FRMA 4C92F 4XAXB 2X4JA 3GF5A 5I2MA 3FC3A 4M7AG 3QZ5B 4O5VA 4M75B 3V8KA 3JCMf 1YJWT 5I21A 2JZ2A 4DQ2A 4M77B 4E7IA 2RH2A 2P0PA 3H8ZA 5LJ3j 1Q7YC 1KC8U 4KUIA 5KCHA 3SD4A 1AHJB 5GANh 3M59A 4J6XA 5GANg 4RG8A 3OYKA 4MDWA 3S6WA 3LWHA 3JCMJ 1YI2T 2VV5A 5A0GA 1KQ2A 1FX7A 3META 1OI1A 3OBWA 4FM4B 4J6YA 1VQ5A 2WACA 4PJOD 2LQ8A 2RB6A 2QEXA 3SDZA 5CCAA 5D6WA 4XTUA 2KVQG 3CC4A 2X4WA 4BE2A 1U1SA 1HK9A 4XTXA 2PQWA 5LJ5f 1LJOA 4IUPA 5M9OA 4TVRA 3OS5A 3WXMB 2XK0A 2DZ9A 3X24B 2XDPA 2I2LA 3MP6A 4GY5A 1YIJA 4HCBA 3KBGA 2A7YA 1O75A 4PNOA 3J80E 4C8QE 3C94A 5GMKe 1QW1A 1R8OB 2YRVA 2E6ZA 4X9CA 4A4EA 5J3BA 4PJOB 3NFCA 4PLLA 4A4KA 5FU7C 4JLGA 4RCBA 5I2SA 3OYYA 5CVIA 3O8VA 3P8BB 4A4GA 4C0GA 3JCMX 1VQ9T 3QO3A 4RMOA 3MEAA 3T9NA 3SWNC 2VYTA 5KE2A 3OYDA 1YI2A 3MP1A 4M78F 2DKGA 2EAYA 1YCYA 4OB3B 4M7DB 1PSEA 3QJYA 4M75G 4F7UE 3TREA 4NL3A 1YJNA 3R6OA 5CKDA 1NJIU 1EIFA 1BYMA 2XU8A 5J26A 3TEEA 3QYGB 3WVEB 3I56T 5KCOA 5A0DA 2QQSA 3CBPA 4JS5A 5HKCA 4JRPA 4PJOE 3HP9A 4FT4A 1S72A 4C92B 5C6SA 2JUFA 4M75A 3A8HB 1GXIE 3MEUA 3PNWC 2XDDA 3CCVT 3VU3C 1VQ6T 3CBOA 4L59A 4OB1B 2MWOA 2QA4T 2CZ0B 1M90U 5GMKm 4NS5A 3FJPA 1KG1A 1Y7XA 3UDCA 3QPHA 2X4YA 5LJ3d 1WNLA 4QVZA 4XK8E 2CZ7B 3ZBDA 3JCMd 3BW1A 2PU9B 2VGMA 3EFRA 5GANd 4C8QB 1VQ4A 4E7LA 3UWNA 4A4FA 2RHZA 3CCQA 3JCMe 5GAN5 1VQ9A 3M55A 3V8JA 4C5EA 2L89A 2RHUA 3OYMA 1Q86U 4PJOC 2DO3A 5EG2A 5HK0A 3VV0A 4FIBA 3VYGA 5GAOq 2QQRA 4M78D 2GFAA 4C92A 3CCMT 4JRQA 1QVGS 4MMKA 5CQXA 2LC4A 1OZ3A 2XICA 3OSSC 3PTAA 2D6FA 1YIJT 2L5QA 3FLGA 3G4ST 2YHTA 1TH7A 1UGPB 2LX9A 4D6WA 4LDXA 1U1TA 2E70A 5GAMj 3L2VA 4C92G 1BI3A 3ASKA 4M75F 1XQHA 4L5GA 4M77C 3PMIA 1G3WA 1G5VA 4PL6A 3CCUT 1JB0E 4XTYA 3J7AF 2RD1A 4KBMB 4J5YA 4EDUA 2AHJB 3C95A 4NL2A 2JTFA 4XTWA 1N6AA 1VQKA 5GAN4 4OP0A 3QDRB 3OY9A 1XTDA 1NPPA 2FHDA 2ZCFB 2QQAA 4X9DA 4M75D 4ELYC 5A2QE 1K8AU 2QI2A 2DTHA 3CD6T 3CCMA 4P5NA 2M1HA 2OTLT 3OYCA 3CCLA 2E12A 1H641 3NTHA 2LT4A 2K3XA 2L8DA 2DXTA 3DB4A 3HPWA 3KXTA 2QEXT 1KD1C 2PVGB 1UB4A 2QQ9A 3CCJA 4M77E 1X75C 3PGGA 1RI0A 1G3YA 4BY6C 1KQSA 3A5ZB 1XNIA 3OW2A 3UT1A 1Y71A 4M78E 2KK4A 4JUVA 1M4ZA 2V8IA 3MCAB 4EMHA 3E1SA 3LGFA 3S3NA 3F70A 2P0KA 1ZBXA 3A8MB 4Y91A 2LQKA 1MGQA 3OA6A 4E7KA 1VQOT 4J8OA 4LD6A 2DXCA 2LVMA 5LJ3f 1O9SA 3Q1JA 3L2QA 2DD4A 1QP3A 3QJ6A 3PIOA 1UGRB 2RJCA 3G71A 1Q86C 2E6NA 5A0LA 2Y4YA 1Q82U 3L2RA 3VJPA 5GMKj 1Q81U 3OYJA 4LDYA 3L2ZA 3CCSA 2XDBA 3QSUA 2RI3A 5GAN6 4C5HA 4B9XA 1H3ZA 5D6XA 3GIBA 2D9TA 2EJ9A 4QVCA 3HKSA 2XD0A 3LH0A 4M78C 4HCCA 3FDRA 4X34A 2RHIA 5LJ3g 1P92A 5LJ5j 3QHSA 4RCCA 1QVFS 2F5TX 3BDLA 1VQPT 4KUDK 2DTOA 2KAFA 3CCEA 1UGQB 3FIFA 1VQMT 3HSBA 4M7AA 3LWIA 2O4XB 4HT9A 4LDWA 1FXXA 2CKKA 5IN1A 3BY7A 3OYGA 4ZN1A 3OYAA 1U8RA 3CCUA 1BIAA 1WJRA 4PLIA 1D3BB 2HNIA 4C5IA 3RMQA 2CZ1B 2IVWA 4CRIA 4XU1A 5GAN8 2EQMA 2JNGA 1KC8C 5CKBA 5GMKl 4OB0B 4OGCA 2A3LA 5FU6B 1G3TA 5GAMh 1I4K1 5CO7A 3ZEHA 1VQ4T 2HD0A 4J7FA 2RHXA 4WF2A 3SFMA 5GAMg 1S72T 3HFNA 2GCXA 1M1GA 3OB9A 4II1A 4B9WA 4ZTFA 2BIVA 3C12A 3EFSA 2DPPB 2KDSA 4L6V5 1NE8A 1BI0A 3JCMV 2VGNA 4FL6A 3AHUA 4BI8B 1HXDA 1WGSA 2GF7A 3JRZA 1VQ8A 4EMKA 4M7AE 4E47A 2M9UA 5FRNA 3S3OA 2FYKA 3JCMc 3MEWA 3WVDB 5CK9A 1WQWA 4KT0E 3FRNA 2DEQA 2F5KA 3JSCA 4XU3A 3OYIA 3FEOA 1B34A 2ZPBB 4BI3A 2DK3A 1W4SA 5C0MA 4M78A 4C92D 2EJGA 2PUKB 5GAOn 3OYBA 4C0DC 3INZA 2PVDB 1KQSS 1DJ7B 2XG8D 2RJEA 2X35A 3L2WA 3JCMP 1NJIC 1N9RA 2DTIA 5LL6S 1K9MC 2F69A 2EKOA 4M7AB 2VXFA 4C5GA 3OMGA 2DAQA 1X01A 3CC7T 2GFUA 1YBYA 3OSVA 4M7AD 3VUBA 3V7RA 5D6YA 5L8RE 3OW2S 1KHIA 4HCZA 1G3SA 4M77G 2G3RA 4J7IA 1SSFA 4MZPA 3RUXA 4RKUE 2E5QA 5CKHA 3JCMW 3CC4T 1M90C 5DLQE 1D3BA 1JJ2S 3LYIA 1VUBA 3LGLA 4C8QC 3JCMb 4IUTA 3PIPA 2K3YA 1IREB 2ZPIB 1YITA 2DD5A 3JAME 2JTMA 4ME7A 5GMKh 4GLKA 1Y96B 4EMGA 1YITT 2LCLA 3OYNA 4A4HA 5GAOl 2MAMA 3VKIA 3OYEA 4BE1A 1NPRA 3RKWA 2OTJA 2V8KA 3HRUA 4XU0A 3LLRA 1UGSB 2QTXA 2WSCE 2CZ6B 4BACA 4LD9K 4ZTJA 1YJ9A 2E41A 2EJFA 3BFMA 3L42A 2M16A 3MHXA 4JRIA 3CC7A 1JBMA 3ME9A 5CR2A 1UEBA 2RI5A 3JB9H 4C92E 4BI4A 1BKBA 3L2UA 1OZ2A 1XOVA 4M77A 2EFIA 3OQ5A 3M53A 3E19A 4IUVA 4ZGJB 4C8QF 2RA2A 1JJ2A 4VUBA 3TCJA 3OYFA 4E7HA 3SWNB 2IG0A 2RK2A 3CCET 4QQ6A 2XI9A 4DOWA 5GAN7 4BUGA 3NTKA 4O6JA 3OYHA 4CI0C 2R58A 3ER0A 4N0AC 4F7UB 5HY6A 3P8DA 3DKMA 3X26B 3JB9I 3OS0A 2ZGWA 2BUDA 2HAXA 4QQGA 4OMFB 3QKJA 3HRSA 3PFSA 4XQ3A 4EMKB 3HRTA 2K5IA 2B8AA 1VQ8T 2D0QB 3I55T 1K8AC 2VC8A 4Q5WA 2M0OA 1YHQA 1WJSA 5LJ3h 2DVEA 1BI1A 2HQEA 3G6ET 2CYZB 2QQBA 2Y90A 1Q82C 4M78B 4N4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO E;  4F7U F;  4PJO G;  3BY7 A;  4C92 B;  4M75 A;  3JCM g;  5GAN 3;  2YLB A;  1BIA A;  3VU3 C;  1D3B B;  3RIR A;  2HNI A;  5GMK m;  1M8V A;  1I81 A;  4HA8 A;  4XU1 A;  3FJP A;  5GAN 8;  4M7A F;  4F7U G;  5GAN j;  5GMK l;  4M75 E;  3M4G A;  3RKX A;  4M7A C;  1Y96 A;  4XU2 A;  5LJ3 d;  1WNL A;  2JN0 A;  5GAN e;  5GAM h;  1I4K 1;  4M7D E;  4PJO A;  4V2S A;  4WF2 A;  2DJZ A;  5GAM g;  3HFN A;  5GAO p;  3JCM d;  3BDU A;  3BW1 A;  3EFR A;  5LJ3 e;  4C8Q B;  5GAN d;  4C8Q D;  2K57 A;  2YLC A;  4NOY A;  2RM4 A;  3EFS A;  2CGH A;  3RES A;  3JCM V;  4F7U A;  1I5L A;  3JCM e;  2DZC A;  5GAN 5;  3V7S A;  3AHU A;  1HXD A;  2E64 A;  3FB9 A;  4XTV A;  3V8J A;  3JCM h;  4PJO C;  4EMK A;  4M7A E;  2E65 A;  5GAO q;  4QVD A;  1N9S A;  2FB7 A;  1WQ7 A;  4M7D A;  4M78 D;  4C92 A;  2FYK A;  4MML A;  3JCM c;  5GAM d;  4MMK A;  5LJ5 e;  1WQW A;  4N0A A;  2DXU A;  2DEQ A;  4XU3 A;  4HT8 A;  1B34 A;  5CAI A;  1BIB A;  3JB9 D;  5GAM e;  5GMK i;  4M78 A;  4C92 D;  2EJG A;  4C8Q G;  5LJ5 d;  5GAO n;  1M5Q 1;  1TH7 A;  2YHT A;  3INZ A;  4M78 G;  5GAO r;  4EMK C;  1U1T A;  4M7D F;  5GAM j;  4M7D C;  3V7C A;  4M75 F;  2E1H A;  1N9R A;  2DTI A;  4M77 C;  4C92 G;  5GAN 2;  2EWN A;  3JCM P;  3RER A;  4XTY A;  4M7A B;  2VXF A;  2RD1 A;  4J5Y A;  5DY9 A;  1X01 A;  3JB9 F;  2E10 A;  4NL2 A;  4M7A D;  4C92 F;  1JRI A;  3JCM W;  4A54 A;  4XTW A;  3QUI A;  4PJO F;  3V7R A;  4OP0 A;  3SB2 A;  5GAN 4;  1KQ1 A;  3SWN A;  5LJ3 g;  4M77 G;  4M75 B;  4X9D A;  4M75 D;  3RUX A;  3JCM f;  3V8K A;  5I21 A;  4DQ2 A;  4M77 B;  3JCM Q;  5LJ3 j;  3JB9 J;  1D3B A;  2VXE A;  2DTH A;  4C8Q C;  3JCM b;  3JB9 G;  5GAN h;  5GAN g;  4J6X A;  4JLI A;  1H64 1;  3JCM J;  1KQ2 A;  2DXT A;  1LNX A;  5GMK h;  1Y96 B;  4EMG A;  4J6Y A;  4PJO D;  4C8Q A;  4XTZ A;  4M77 E;  5GAM f;  2RB6 A;  3PGG A;  5GAO l;  3RKW A;  4XTU A;  3RKY A;  5GAO m;  4XU0 A;  1U1S A;  1HK9 A;  2QTX A;  4J6W A;  4M78 E;  4XTX A;  4JUV A;  5LJ5 f;  4EMH A;  1LJO A;  2E41 A;  2EJF A;  3BFM A;  4A53 A;  1I8F A;  4JRI A;  1JBM A;  2DZ9 A;  4M7D D;  2I2L A;  4Y91 A;  3JB9 H;  4C92 E;  1MGQ A;  4M77 A;  4PNO A;  5LJ3 f;  4C8Q E;  1LOJ A;  1B34 B;  5GMK e;  4X9C A;  4PJO B;  4C8Q F;  2RA2 A;  3HFO A;  5GMK j;  5GAN f;  4M77 D;  4RCB A;  3SWN B;  3L2Z A;  5GAN 7;  3JCM X;  3QO3 A;  4N0A C;  3JB9 I;  4F7U B;  3QSU A;  3SWN C;  5GAN 6;  2ZGW A;  4C92 C;  4M78 F;  3GIB A;  4M7D G;  2EJ9 A;  4QVC A;  4XQ3 A;  2DKG A;  2EAY A;  1YCY A;  4M78 C;  4EMK B;  1WPY A;  4M75 G;  4M7D B;  4F7U E;  4NL3 A;  5LJ5 j;  5LJ5 h;  2VC8 A;  3QHS A;  4RCC A;  3V8L A;  4JRK A;  4M75 C;  4M77 F;  5LJ5 g;  5LJ3 h;  2DVE A;  2DTO A;  3HSB A;  3FIF A;  3L1A A;  4M7A A;  2Y90 A;  4HT9 A;  4M78 B;  4M7A G; 
#chains in the Genus database with same CATH topology
 1MUZ A;  3SEM A;  3S3M A;  4IUQ A;  1UGV A;  4JS4 A;  4DOV A;  3E9F A;  4HA8 A;  2EBP A;  1M1F A;  4M75 E;  3OW2 P;  3G71 Q;  2JN0 A;  3RBB B;  2CSQ A;  3LX7 A;  1LVK A;  4HVV A;  4M4Z A;  1QCN A;  3G7Z A;  1K73 U;  2DXB A;  2YUN A;  5CKE A;  1N27 A;  2A36 A;  1IHV A;  3C4S A;  2YRD A;  2E64 A;  3ZFJ A;  4KUL A;  4YTL A;  4M7D A;  3N5B B;  1BCO A;  1UJY A;  3CCV Q;  4N4H A;  1AOJ A;  4N0A A;  3E9G A;  2KBT A;  1AWJ A;  4X1V A;  3URG A;  3DLL A;  2H3J A;  1WZO A;  5GMK i;  2QGG A;  3G71 T;  1Q82 R;  2RJF A;  3OBY A;  2EWN A;  2EYQ A;  2A37 A;  2CP6 A;  2NUP A;  2RPN A;  3M56 A;  4ZGE B;  3P8H A;  3SB2 A;  2XID A;  3M58 A;  3SWN A;  3QG1 A;  2DA9 A;  1M3A A;  4RUG A;  2RF0 A;  2VXE A;  3JB9 G;  3I55 Q;  3MO8 A;  3G6E A;  1AWW A;  3GBQ A;  4C8Q A;  3CD6 A;  1Q81 R;  5AYF A;  3RKY A;  4LDU A;  2FZG B;  3CCR T;  4ZGD B;  3FJ5 A;  3QDF A;  1YJW A;  1TWB A;  1WA7 A;  2A08 A;  2ED1 A;  4OMO A;  3RDV A;  1BBZ A;  3QYH B;  1PHT A;  5I22 A;  1K73 C;  4OMN A;  2EQJ A;  1KK7 A;  2ROT A;  3HFO A;  1PSF A;  3G4S A;  3CCJ T;  3CPW P;  2NUP B;  2R5M A;  4IUR A;  4M7D G;  4AMC A;  2RMO A;  1WPY A;  1RAE B;  2J7I A;  4BD3 A;  1VQ5 T;  3EFO B;  1VQO Q;  4LDV A;  3H6Z A;  3L1A A;  2EGC A;  1WDX A;  1YJ9 Q;  2P4T A;  4JZ3 A;  3EAE A;  3I5R A;  1KHC A;  3IQL A;  1BCM A;  1X6O A;  3GLX A;  4MDX A;  3BDU A;  2K2V A;  5IHK A;  1C1A A;  2OAU A;  4DBR A;  4ATO A;  4F7U A;  1BI2 A;  1JXM A;  1RAF B;  2DZC A;  2DFU A;  4R56 A;  5KE3 A;  4J83 A;  3CCR A;  2E65 A;  2J06 A;  5GAM d;  3CPW A;  2K5F A;  2M51 A;  1WHL A;  3O5Z A;  1K8A R;  5IHN A;  3GNF B;  3M9Q A;  1Q7Y U;  4M7D F;  1TUC A;  2K79 A;  3RER A;  2HQX A;  1JO8 A;  3CCV A;  2WSE E;  2FVU A;  2P0Q A;  1M1K U;  4RTW A;  1QVP A;  2E10 A;  4PFZ A;  1EX4 A;  4FCY A;  3GF5 A;  2L3S A;  4M75 B;  1YJW T;  3TQ7 P;  2RH2 A;  1KC8 U;  4KUI A;  5KCH A;  3SD4 A;  1WLP B;  1AWX A;  1YI2 T;  2DL3 A;  2K9G A;  2LQ8 A;  3C0C A;  4RTV A;  2KVQ G;  2K3B A;  2EYZ A;  5LJ5 f;  4TVR A;  3OS5 A;  1NLP C;  2KEA A;  2XDP A;  4PJJ A;  3MP6 A;  4GY5 A;  2HL5 C;  2A7Y A;  3J80 E;  1NEB A;  4C8Q E;  1D1C A;  1QW1 A;  2E6Z A;  5GJV B;  1OX8 A;  3O8V A;  3JCM X;  3QO3 A;  3MEA A;  5KE2 A;  1YI2 A;  3MP1 A;  4M78 F;  3UAT A;  3CC4 Q;  2F2X A;  3QJY A;  2DLP A;  2KR3 A;  1NJI U;  1EIF A;  5ECA A;  5J26 A;  3UA7 A;  1GCQ C;  3HP9 A;  1V76 A;  1S72 A;  4C92 B;  2COY A;  1LCK A;  3EH1 A;  3CCV T;  2MWO A;  3FJP A;  2V1R A;  1Y7X A;  1ZX6 A;  3UDC A;  2FRW A;  2X4Y A;  3M0P A;  4QVZ A;  4DEX A;  2CZ7 B;  3ZBD A;  1OUL A;  4C8Q B;  2L2P A;  3JCM e;  3V8J A;  2RHU A;  1TUD A;  1SF9 A;  4ESR A;  2GFA A;  4JRQ A;  1QVG S;  2XIC A;  3PTA A;  2D6F A;  2F1L A;  1YIJ T;  7AT1 B;  3G4S T;  4JJD A;  1TH7 A;  1WIE A;  2YHT A;  3L2V A;  1MNE A;  3ASK A;  4C92 G;  2JMA A;  2DL7 A;  3J7A F;  1PWT A;  3HTR A;  4EDU A;  2XMF A;  3C95 A;  1T3S A;  2MK5 A;  1N6A A;  4OP0 A;  3OY9 A;  1ZSZ B;  2AKK A;  4OML A;  4X9D A;  1K8A U;  2QI2 A;  2E3I A;  2MYS A;  3CD6 T;  3CCM A;  4P5N A;  1SEM A;  3OYC A;  3NTH A;  2LT4 A;  2L8D A;  3HPW A;  2NUZ A;  2QQ9 A;  3D7S B;  3CCJ A;  4M77 E;  1X75 C;  3PGG A;  1RI0 A;  1G3Y A;  1GBQ A;  3A5Z B;  2NWM A;  3OW2 A;  1K4U S;  4M78 E;  2KK4 A;  4EMH A;  2B86 A;  1X27 A;  3S3N A;  1QWE A;  1TOV A;  1VQP Q;  1ZBX A;  1YNZ A;  1VQO T;  4J8O A;  2LVM A;  3L2Q A;  2HQH A;  2NUT A;  2RJC A;  3G71 A;  1Q86 C;  2E6N A;  5A0L A;  3VJP A;  5GMK j;  4LDY A;  2O31 A;  3L2Z A;  3CCS A;  2COZ A;  2JT4 A;  3QSU A;  4C5H A;  4QVC A;  3HKS A;  3LH0 A;  3VS6 A;  5LJ5 j;  1P92 A;  1I07 A;  3QHS A;  1M3C A;  2DTO A;  3HSB A;  4M7A A;  4F17 A;  1FXX A;  3OYG A;  3EG9 A;  3OYA A;  1PD1 A;  3CCU A;  4PLI A;  3CCR Q;  2CZ1 B;  2NYS A;  2E5K A;  4OB0 B;  1G3T A;  1I4K 1;  2YRC A;  4WF2 A;  1M1G A;  3OB9 A;  1EFN A;  4II1 A;  4ZTF A;  2BIV A;  3C12 A;  1Q7Y R;  2KDS A;  4E7S A;  1NE8 A;  1MV3 A;  1MMA A;  3AHU A;  2M0Y A;  4Z8A A;  3JRZ A;  2M9U A;  3S3O A;  1UUE A;  3JCM c;  3I35 A;  4AT1 B;  3OYI A;  1QCO A;  5C0M A;  2P84 A;  1DJ7 B;  2L0A A;  3L2W A;  3JCM P;  1N9R A;  2DTI A;  4WTO B;  4M7A B;  1KIK A;  2VXF A;  4C5G A;  2COW A;  3OSV A;  2AIR B;  1YP5 A;  5D6Y A;  1KHI A;  4MZP A;  4J7I A;  2DYI A;  3LYI A;  4C8Q C;  2CRE A;  2EYY A;  2K3Y A;  1IRE B;  1SHG A;  2JTM A;  5GMK h;  4EMG A;  4HVW A;  1Z9Z A;  2GTJ A;  2DER A;  2MAM A;  3OYE A;  4LUD A;  4XU0 A;  2AK5 A;  2QTX A;  2WSC E;  4BAC A;  3CC7 A;  5CR2 A;  2CT3 A;  1Q95 G;  5KYY B;  2EFI A;  3MKD A;  2KXD A;  4IUV A;  2OI3 A;  2FPF A;  4E7H A;  1QKW A;  2IG0 A;  5GAN 7;  3NTK A;  4RTT A;  2JM8 A;  4F7U B;  4KRT A;  1HD3 A;  2K5I A;  2HSE B;  1VQ8 T;  2DE0 X;  1K1Z A;  3G4S Q;  3PE0 A;  5FWC A;  1BI1 A;  3G6E T;  1WYX A;  2QQB A;  2Y90 A;  1KFZ A;  4PK4 A;  4B6M A;  3E2U A;  3JCM g;  1OV3 A;  4Y28 E;  2HEQ A;  2RHY A;  3M4Y A;  1I81 A;  2QTV A;  4JJN K;  4M7A F;  2YUO A;  2LJ1 A;  5I11 A;  4C0Z A;  4FSX A;  1NG2 A;  2DEU A;  5FU6 C;  1VQL A;  2LX7 A;  4C8Q D;  2YLC A;  2RM4 A;  2MF2 A;  3M5A A;  3RES A;  1YJ9 T;  2JOY A;  4IKF A;  4J9E A;  4QVD A;  2PVO B;  2VAS A;  1NM7 A;  1YJN T;  5LJ5 e;  2DXU A;  4E7J A;  3CMA T;  2DVJ A;  2O4X A;  4D8K A;  4FYW B;  1M5Q 1;  3CPF A;  4ZNX A;  1M27 C;  3KUF A;  2E1H A;  3TVT A;  2RQV A;  2GQV A;  1NYF A;  1NBE B;  4BDY A;  1TTH B;  2JW4 A;  1JRI A;  1KQ1 A;  3X28 B;  4EPC A;  5HK3 A;  5CKF A;  1D1B A;  3JB9 J;  1UHC A;  2NLU A;  4KGZ B;  1VQO A;  2LNH B;  4FT2 A;  3CPW S;  1M9S A;  3CQT A;  4R55 A;  1WHM A;  4QKU A;  1RAH B;  4XTZ A;  5GAM f;  1UDL A;  1QWF A;  3LH5 A;  3EGX B;  1VQN T;  3EG9 B;  4A53 A;  2V8J A;  1VQ7 Q;  2EQK A;  3CC2 A;  2JXB A;  4E7Z A;  3CC2 T;  3A8L B;  3M0T A;  2RO0 A;  3CEY A;  3CCL Q;  3PT9 A;  1M1K R;  1QVF P;  3VS3 A;  3CCU Q;  3VUZ A;  3MP8 A;  3X20 B;  1T0J A;  2CP0 A;  2LP5 A;  2PNI A;  5GAN f;  2JJ9 A;  1YHQ Q;  4M77 D;  2ENM A;  2AZV A;  1GFC A;  2QAZ A;  4RTU A;  3QWY A;  3LW5 E;  4C92 C;  1YJW Q;  1GRI A;  3OYL A;  2OTJ T;  3X25 B;  1OPK A;  2W0Z A;  1ZHI A;  5LJ5 h;  3V8L A;  2AZS A;  1K9M R;  4JRK A;  4M77 F;  3CC2 Q;  2JTE A;  4OVA A;  1MHN A;  2L3P A;  4F7U F;  1RUW A;  4PJO G;  5IXF A;  2YLB A;  2GTO A;  2LMJ A;  1IB8 A;  2MWP A;  1FWZ A;  4M7D E;  2PUO B;  1IZ6 A;  2DJZ A;  3CME T;  3CMA A;  2DIG A;  4DA4 A;  2HBP A;  1ZSG A;  1I5L A;  1RAG B;  3TSZ A;  3FB9 A;  4XTV A;  4A63 B;  3JCM h;  1RAI B;  1N9S A;  2HKQ B;  4MML A;  2DNU A;  5KYU B;  1VQL T;  1VYV A;  3HHT B;  1UHF A;  4CC4 B;  5GAO r;  1TXQ A;  1WHG A;  5IHI A;  2RQT A;  1FYN A;  5GAN 2;  2MI6 A;  2LCC A;  1ABO A;  2BZX A;  5J39 A;  1D0Y A;  1Y07 A;  3CBM A;  4XAX B;  5I2M A;  3FC3 A;  1TUG B;  3QZ5 B;  3V8K A;  4DQ2 A;  4E7I A;  1Q7Y C;  1KC8 R;  3M59 A;  4J6X A;  3OYK A;  4MDW A;  2FZC B;  2VV5 A;  1KQ2 A;  3MET A;  1OI1 A;  2WAC A;  2DET A;  4PJO D;  4DBF A;  5CCA A;  4XTU A;  2O9S A;  2EYW A;  4BE2 A;  1AWO A;  1JU5 C;  1RAA B;  1LJO A;  1WHH A;  3X24 B;  1OOT A;  2I2L A;  1YIJ A;  4E6R A;  2EKH A;  4PNO A;  2YRV A;  4X9C A;  1WXU A;  1D09 B;  4PLL A;  4JLG A;  2RN8 A;  4RMO A;  3T9N A;  3SWN C;  1PSE A;  3A1P A;  3U23 A;  2XU8 A;  3I56 Q;  3H41 A;  5A0D A;  2QQS A;  3CBP A;  5HKC A;  4DBQ A;  4FT4 A;  4M75 A;  2VKN A;  1ZLM A;  2FRY A;  1GXI E;  2YUQ A;  3CBO A;  4L59 A;  4OB1 B;  4NS5 A;  1KG1 A;  2OJ2 A;  3QPH A;  1GCP A;  1WNL A;  2LZ6 B;  2YXY A;  3EGX A;  3JCM d;  1VQ4 A;  4A4F A;  1Q86 R;  2L89 A;  4PJO C;  2DO3 A;  1NJI R;  5HK0 A;  3VV0 A;  1X6G A;  1KJW A;  2EQI A;  2QQR A;  4M78 D;  1WI7 A;  1PCX A;  5CQX A;  1UEC A;  2RQU A;  2EGA A;  1GL5 A;  1M2V A;  2LX9 A;  1U1T A;  5GAM j;  1OU8 A;  2JS0 A;  1RLP C;  2CSI A;  3PMI A;  1G3W A;  1G5V A;  1QLY A;  4PL6 A;  3CCU T;  1IGQ A;  4J5Y A;  4LN2 A;  2AHJ B;  4NL2 A;  4XTW A;  1VQK A;  3QDR B;  2DYB A;  1H64 1;  2DXT A;  1KD1 C;  1UB4 A;  4WCI A;  4F14 A;  3AT1 B;  1D1A A;  1B3Q A;  3UT1 A;  2OAW A;  5KYX B;  1M4Z A;  3E1S A;  1WHJ A;  3LGF A;  1VYT A;  4F04 B;  1AZE A;  1N5Z A;  4Y91 A;  4LD6 A;  2EVR A;  1IO6 A;  1O9S A;  4LNP A;  1UGR B;  1Q82 U;  2K2M A;  4AFS C;  3UF4 A;  2I0N A;  2RI3 A;  5GAN 6;  1TS9 A;  1U3O A;  4B9X A;  6AT1 B;  4R0K A;  5D6X A;  3G1J A;  2EJ9 A;  4HCC A;  4M78 C;  1G83 A;  3FDR A;  4Y92 A;  1HSQ A;  1JXO A;  4AG2 C;  1VQM T;  2KAF A;  1C6V X;  1M8M A;  3FIF A;  2O4X B;  2KE9 A;  4LDW A;  2CKK A;  2W10 A;  3BY7 A;  2X3W D;  4ZN1 A;  1U8R A;  3ZL7 C;  4J9H A;  1BIA A;  2QAS A;  3RMQ A;  2IVW A;  4XU1 A;  1KC8 C;  1RAD B;  1AT1 B;  5GAM h;  1VQ4 T;  1VYU A;  4J7F A;  2RHX A;  3SFM A;  1S72 T;  2E3H A;  4B9W A;  1I5O B;  2DPP B;  1AD5 A;  1BI0 A;  2V1Q A;  2O9V A;  4FYX B;  4E47 A;  3MEW A;  3WVD B;  1G2B A;  1WFW A;  1WQW A;  3FRN A;  3FEO A;  4BI3 A;  1VQ8 Q;  2FPD A;  2EJG A;  3OYB A;  4C0D C;  3INZ A;  2PVD B;  2C0T A;  1QMC A;  2RJE A;  2XG8 D;  1YIT Q;  1KQS S;  1NJI C;  1Y0M A;  1K9M C;  2F69 A;  2EKO A;  2ECZ A;  2MOX A;  3OMG A;  2DAQ A;  1X01 A;  3VUB A;  3V7R A;  3VS7 A;  4CC2 A;  1D3B A;  2EPD A;  1JJ2 S;  4K11 A;  3PIP A;  1IGU A;  2ABL A;  2ZPI B;  4GLK A;  1CSK A;  1QQJ A;  1YIT T;  2LCL A;  3OYN A;  5GAO l;  3RKW A;  3HRU A;  2HCK A;  4LD9 K;  1YJ9 A;  2E41 A;  1E7O A;  1ZBJ A;  3MHX A;  4JRI A;  3ME9 A;  3JB9 H;  4BI4 A;  1OZ2 A;  2D8H A;  2BE7 D;  4ZGJ B;  4CC3 A;  2QEX Q;  1JJ2 A;  3OYF A;  1PD0 A;  3CCE T;  4QQ6 A;  2XI9 A;  1F1B B;  4DOW A;  4AFQ C;  3H0H A;  1X6B A;  2R58 A;  3OS0 A;  2CP2 A;  3P8D A;  2GBQ A;  1WHK A;  4XQ3 A;  3HRS A;  2B8A A;  1PM3 A;  2C0O A;  2VC8 A;  1YHQ A;  1WJS A;  1A0N B;  1MMD A;  1RAB B;  1KD1 U;  3QXE B;  2X9H A;  2J6O A;  2KNB B;  2ZPH B;  2DIQ A;  4QQD A;  5IH2 A;  3M4G A;  3DLM A;  5GAN e;  4IIO A;  2ED0 A;  4AG1 C;  3CME A;  5KYX A;  4UC4 A;  2M02 A;  4RG2 A;  1VQM Q;  4J9F A;  3V7S A;  4Z88 A;  1VQ6 Q;  2L3R A;  4HT8 A;  4C0D B;  3VS5 A;  1U06 A;  1XJW B;  5LJ5 d;  4M78 G;  2LDM A;  9ATC B;  2WSF E;  4HKE A;  4EMK C;  4IUU A;  2KMT A;  3NHN A;  3CME Q;  2K5L A;  3ULR B;  3EG1 A;  4J9D A;  2QDY B;  3GOX A;  2LNV A;  1VIE A;  1SRM A;  5HCK A;  2ZZD A;  4DEY A;  4PJO F;  1BK2 A;  2PTK A;  3JCM Q;  1QKX A;  4PJM A;  1ZQ1 A;  2VUB A;  2LQN A;  1W2B A;  3OS2 A;  3DB3 A;  3I55 A;  2K6D A;  1PC0 A;  4DBH A;  3GPL A;  2ATC B;  4J6W A;  1OYX A;  1I8F A;  2KSS A;  5KH6 A;  4M7D D;  1NLO C;  4MZM A;  3VRY A;  4QW2 A;  1NZ9 A;  2LRQ A;  2XKO C;  2JMC A;  1B34 B;  1FMV A;  4OF1 A;  2K7A A;  3UPU A;  1V1C A;  4J9I A;  2J6K A;  3I56 A;  3CCJ Q;  1M1K C;  3I5S A;  2LQW A;  2RJD A;  1N8R C;  5D7U A;  1V29 B;  4OMP A;  1JQQ A;  4M75 C;  5LJ5 g;  2LCS A;  1K9M U;  2HMA A;  1YFN A;  2IIM A;  4BY6 B;  8ATC B;  2MCN A;  2R5A A;  3RIR A;  2DBK A;  4F7U G;  3EHQ A;  1Y96 A;  2JVV A;  2YSQ A;  3QZ9 B;  1OPL A;  2DL5 A;  1KSW A;  2K57 A;  2RK1 A;  2CGH A;  2KGT A;  3OMC A;  4ANJ A;  2D0N A;  1ABQ A;  3CCQ T;  3QBY A;  1BU1 A;  4Z02 A;  1ZA1 B;  4ZN3 A;  2BKD N;  5CAI A;  1BIB A;  4BE0 A;  4PKC C;  2X4X A;  2XHC A;  1N8R U;  3R6N A;  2HZY A;  3CCS T;  2R57 A;  4M7D C;  3V7C A;  2JM9 A;  2QA4 A;  1IRX A;  2LTO A;  2FG0 A;  1VQ6 A;  2MMP A;  4IIM A;  1W2B S;  5DY9 A;  1WJQ A;  1QVG A;  3JB9 F;  1VQN Q;  5FRM A;  4C92 F;  2X4J A;  4M7A G;  5AT1 B;  2VWF A;  3JCM f;  5FW9 A;  3H8Z A;  1S1N A;  1ZSZ C;  4RG8 A;  3LWH A;  3JCM J;  2DJQ A;  1FX7 A;  4FM4 B;  1M2V B;  1MMG A;  2RB6 A;  5D6W A;  2X51 A;  3CC4 A;  2CUD A;  2KT1 A;  3H0F A;  1U1S A;  1HK9 A;  1E6H A;  3CCM Q;  2KRO A;  2PQW A;  4IUP A;  3WXM B;  1FMK A;  4HCB A;  1O75 A;  5FWB A;  5GMK e;  4PJO B;  3NFC A;  2VB6 A;  4A4K A;  1Y57 A;  4RCB A;  3OYY A;  4C0G A;  1VQ9 T;  1Z9Q A;  1PRL C;  2HBW A;  1VQL Q;  2EAY A;  4M7D B;  4F7U E;  3TRE A;  4NL3 A;  2BZ8 A;  1M2O A;  5CKD A;  1UTI A;  3TEE A;  1B07 A;  5KCO A;  1SPK A;  3EH2 A;  4JS5 A;  3QWX X;  4E2F B;  1WXT A;  3MEU A;  5GJW B;  1VQ6 T;  2QYZ A;  3VU3 C;  2YWW A;  2QA4 T;  1M90 U;  5GMK m;  5KYY A;  2J6F A;  4AFU C;  2LJ3 A;  5LJ3 d;  4PFP A;  3BW1 A;  2PU9 B;  3EFR A;  2P4R A;  4E7L A;  3CCQ A;  4C5E A;  4AFZ C;  2L3Q A;  3OYM A;  4C92 A;  3TSW A;  2Z0W A;  2L5Q A;  3FLG A;  4D6W A;  1NYG A;  1UGP B;  1VQ4 Q;  2E70 A;  1BI3 A;  4M77 C;  2KYM A;  4L5G A;  4OMM A;  1JB0 E;  1JEG A;  1U5S A;  4KBM B;  2YDL A;  2OX7 A;  2QG9 B;  2KRS A;  4HCK A;  4LE9 A;  1XTD A;  2FHD A;  2ZCF B;  2QQA A;  1RAC B;  1SRL A;  2M1H A;  1CKB A;  1PG5 B;  2OTL T;  3CCL A;  2K3X A;  2YT6 A;  3CCS Q;  2O2O A;  1R0B G;  3CCQ Q;  4BY6 C;  1KQS A;  1XNI A;  1Y71 A;  3VS0 A;  4Z89 A;  2BE9 B;  3MCA B;  4JUV A;  1RI9 A;  1YCS B;  2P0K A;  3A8M B;  1MGQ A;  3OA6 A;  4J9G A;  2DXC A;  2EGE A;  3Q1J A;  3PIO A;  1Q81 U;  3CC7 Q;  2JS2 A;  2RNA A;  4FYY B;  2ZAE A;  1H3Z A;  3GIB A;  4J9B A;  2MIO A;  2RHI A;  1EZZ B;  2G6F X;  4RCC A;  1QVF S;  2F5T X;  1VQP T;  4FW2 A;  1UGQ B;  2QDL A;  3G6E Q;  4HT9 A;  3M0S A;  4RTY A;  1WJR A;  1D3B B;  2HNI A;  2CH4 W;  2EQM A;  4OGC A;  3HFN A;  2HL3 A;  1VOM A;  2DF6 A;  2DIL A;  2FO0 A;  5KYN A;  1ACM B;  2DM1 A;  1WGS A;  1JJ2 P;  1GBR A;  2FYK A;  4KT0 E;  1C0M A;  2F5K A;  4XU3 A;  2QA4 Q;  2ZPB B;  1YIJ Q;  1FMW A;  2CP7 A;  4M78 A;  2X35 A;  1K0S A;  1HYO A;  2YUP A;  2RQR A;  1M30 A;  3BE3 A;  1X69 A;  2GFU A;  4M7A D;  1UE9 A;  1LPL A;  3OW2 S;  4HCZ A;  1J3T A;  4M77 G;  2G3R A;  3RUX A;  2E5Q A;  5CKH A;  1VUB A;  1H8K A;  1YIT A;  1M3B A;  3JAM E;  1E6G A;  1I1J A;  1ZA2 B;  1NEG A;  1K76 A;  4A4H A;  2V8K A;  2CZ6 B;  2FZK B;  3BFM A;  1JBM A;  3EFO A;  2RI5 A;  4C92 E;  1I0C A;  1XOV A;  3UA6 A;  3OQ5 A;  4F16 A;  2HSP A;  3SWN B;  2RK2 A;  3EGU A;  4BUG A;  4O6J A;  4CI0 C;  4N0A C;  5HY6 A;  3DKM A;  3X26 B;  1K73 R;  2HAX A;  4OMF B;  1H3H A;  3PFS A;  4EMK B;  2KXC A;  3HRT A;  1TU0 B;  2D0Q B;  3I55 T;  3EG0 A;  2SEM A;  2CYZ B;  3RMS A;  1Q82 C;  1W1F A;  4OB2 B;  5CQY A;  1RL2 A;  4OMQ A;  5KYW B;  1M8V A;  1G8X A;  4M7A C;  4JDS A;  1VQN A;  2O88 A;  1X2Q A;  1QCF A;  2RI2 A;  4BDZ A;  4MZT A;  2HKN A;  1W2B P;  5LJ3 e;  2KY9 A;  4GBQ A;  5CIU A;  3CXC A;  1QP2 A;  4ORZ A;  2EQU A;  2EIF A;  5DM7 R;  3NTI A;  2BZY A;  2KRN A;  3JB9 D;  4N4G A;  4FSS A;  1VIF A;  4C8Q G;  4RTZ A;  3SHW A;  2NUT B;  1ZUK A;  2DMO A;  2FL7 A;  4BB7 A;  3VYH B;  1VQ7 A;  1QVF A;  5EC7 A;  4A54 A;  1VQM A;  3QUI A;  4FU6 A;  3NGP A;  3TU4 K;  1R77 A;  1AEY A;  4JZ4 A;  2OTJ Q;  5DLO A;  2KQW A;  3QII A;  2CP3 A;  3PMT A;  4JLI A;  3GNG A;  3GP8 A;  2F2V A;  2SRC A;  1LNX A;  2ZPE B;  1YHQ T;  1GCQ A;  3M57 A;  2DL4 A;  3REA B;  5FU7 B;  2D8J A;  5GAO m;  4PJN A;  2Y4X A;  1VQ7 T;  3EGD A;  4OGE A;  3CCL T;  2OTL A;  1K0X A;  1TG0 A;  2HDA A;  1LOJ A;  4J9C A;  2X3X D;  2ZPF B;  1M90 R;  3H0I A;  2QK0 A;  5IXB A;  3A8O B;  5FRO A;  1W6X A;  1VA7 A;  3MEV A;  1VQK T;  2ROL A;  3OS1 A;  2K4Y A;  1Q81 C;  1ZUU A;  1W70 A;  1OX9 A;  5GAN 3;  2LT1 A;  2GQI A;  4FW1 A;  3VS4 A;  5GAN j;  3RKX A;  1VQP A;  3J81 E;  4XU2 A;  4KGV B;  4PJO A;  4V2S A;  2KI7 A;  4ELZ C;  5GAO p;  2OTL Q;  2VVK A;  4NOY A;  3HL8 A;  3MJX A;  1KQS P;  4HVU A;  2H3E B;  3MPU B;  2ZPG B;  2QXF A;  3CXC S;  3PVQ A;  2FB7 A;  1WQ7 A;  2BTT A;  2CUB A;  3A8G B;  2O01 E;  5IT9 E;  2EYX A;  4C0F A;  3M54 A;  4JJC A;  5GAM e;  3EG2 A;  2C06 A;  5IAY A;  1ZUY A;  5FLX E;  2CS7 A;  2DL8 A;  4O5V A;  2MPX C;  5I21 A;  2AKL A;  2JZ2 A;  4M77 B;  2P0P A;  5LJ3 j;  1KD1 R;  1AHJ B;  5GAN h;  5GAN g;  3S6W A;  5A0G A;  1OU9 A;  3OBW A;  1VQ5 A;  5KYW A;  4J6Y A;  2QEX A;  5KYU A;  3SDZ A;  2E4H A;  2H8H A;  2X4W A;  1MND A;  4XTX A;  5M9O A;  1MMN A;  1IHW A;  2XK0 A;  2DZ9 A;  3KBG A;  3C94 A;  1R8O B;  4A4E A;  5J3B A;  2DBM A;  1UJ0 A;  5FU7 C;  2DRM A;  5I2S A;  5CVI A;  3P8B B;  4A4G A;  2VYT A;  3OYD A;  3KFV A;  2DKG A;  4OB3 B;  1YCY A;  3CXC P;  4M75 G;  1YJN A;  1SG5 A;  3CD6 Q;  1SHF A;  3R6O A;  4PFO A;  1BYM A;  2FEI A;  1ZSZ A;  1VQ5 Q;  3QYG B;  3WVE B;  3I56 T;  1PKS A;  4JRP A;  1YWO A;  4PJO E;  3A98 A;  5C6S A;  2JUF A;  1BB9 A;  3A8H B;  3PNW C;  2XDD A;  4JJB A;  2CZ0 B;  1T3L A;  1H92 A;  1MV0 B;  2ESW A;  3JV3 A;  3PVL A;  4FYV B;  4XK8 E;  4QT7 A;  2VGM A;  5GAN d;  2F2W A;  1SSH A;  2FPE A;  4KGX B;  3UWN A;  2RHZ A;  1VQK Q;  1WX6 A;  5GAN 5;  1VQ9 A;  3M55 A;  2PZ1 A;  1Q86 U;  5EG2 A;  5GAO q;  3VYG A;  4FIB A;  4KH1 B;  5L23 A;  1ARK A;  3CCM T;  4MMK A;  2LC4 A;  1OZ3 A;  3OSS C;  4LDX A;  2C0I A;  1CKA A;  3H9N A;  4M75 F;  4LXC A;  1XQH A;  4GLM A;  4XTY A;  2KYB A;  2RD1 A;  1PKT A;  2A0F B;  1TSF A;  2JTF A;  5GAN 4;  2KT8 A;  1NPP A;  2A28 A;  4ELY C;  5A2Q E;  4M75 D;  1QVG P;  1YWP A;  2DTH A;  2DRK A;  2E12 A;  3VS1 A;  1UFF A;  3DB4 A;  1YI2 Q;  2QEX T;  3KXT A;  2PVG B;  3CCE Q;  4PJL A;  1X2K A;  2V8I A;  1PNJ A;  1OEB A;  3F70 A;  4JPB W;  4EIK A;  2LQK A;  1YN8 A;  4E7K A;  1WXB A;  3REB B;  5LJ3 f;  4CC7 A;  1RLQ C;  2DD4 A;  1QP3 A;  3QJ6 A;  2LJ0 A;  3M0R A;  2Y4Y A;  3L2R A;  3OYJ A;  1N8R R;  1D0Z A;  2XDB A;  3I9Q A;  1B7T A;  2CT4 A;  1T0H A;  2D9T A;  2XD0 A;  4RTX A;  1R0C B;  3EHR A;  4X34 A;  3NMZ C;  2GNC A;  3BDL A;  4KUD K;  3CCE A;  3LWI A;  2D1X A;  5IN1 A;  1K9A A;  2J05 A;  4LUE A;  4HXJ A;  4C5I A;  2CDT A;  4CRI A;  5GAN 8;  2JNG A;  5CKB A;  5GMK l;  2A3L A;  5FU6 B;  5CO7 A;  3ZEH A;  2HD0 A;  1S72 Q;  3VS2 A;  5GAM g;  2GCX A;  3EFS A;  4L6V 5;  3JCM V;  2GGR A;  4FL6 A;  2VGN A;  4BI8 B;  1HXD A;  2GF7 A;  1VQ8 A;  1GFD A;  4EMK A;  4M7A E;  5FRN A;  3RR6 A;  5CK9 A;  1D0X A;  2DEQ A;  3JSC A;  1B34 A;  2DK3 A;  1W4S A;  4C92 D;  5GAO n;  2PUK B;  5LL6 S;  3CC7 T;  1YBY A;  1UG1 A;  5L8R E;  8AT1 B;  5LJ3 g;  1G3S A;  3JCM W;  1SSF A;  4RKU E;  1M90 C;  3CC4 T;  3EG3 A;  5DLQ E;  3CMA Q;  3LGL A;  3JCM b;  4IUT A;  2AT1 B;  2DD5 A;  4ME7 A;  1Y96 B;  1PRM C;  2V26 A;  1OQK A;  4BE1 A;  3VKI A;  4KH0 B;  1NPR A;  2OTJ A;  3LLR A;  1YJN Q;  1UGS B;  4ZTJ A;  3L42 A;  2EJF A;  3VRZ A;  2M16 A;  3M0Q A;  3RNJ A;  1UEB A;  1BKB A;  3L2U A;  4M77 A;  1HJD A;  3M53 A;  3E19 A;  2IPO B;  2DX1 A;  4C8Q F;  2RA2 A;  3NPF A;  4VUB A;  3TCJ A;  1IXD A;  2CH4 A;  2KRM A;  1X43 A;  1VQ9 Q;  2QGF B;  4D8D A;  3OYH A;  3ER0 A;  3JB9 I;  2ZGW A;  2BUD A;  3M0U A;  4QQG A;  3QKJ A;  1AVZ C;  2RQW A;  1K8A C;  1SKU B;  4Q5W A;  2EW3 A;  2CP5 A;  1AZG B;  2M0O A;  5LJ3 h;  2DVE A;  3EGD B;  2HQE A;  3THK A;  4M78 B;  4N4I A; 
#chains in the Genus database with same CATH homology
 1KD1 U;  3QXE B;  4OB2 B;  3S3M A;  5CQY A;  3JCM g;  1RL2 A;  4IUQ A;  4Y28 E;  2ZPH B;  4JS4 A;  2RHY A;  2DIQ A;  3M4Y A;  4DOV A;  1M8V A;  1I81 A;  3E9F A;  4HA8 A;  4JJN K;  4M7A F;  1M1F A;  4QQD A;  4M7A C;  4JDS A;  3M4G A;  4M75 E;  3DLM A;  5GAN e;  2JN0 A;  1VQN A;  4C0Z A;  3LX7 A;  4FSX A;  3CME A;  4BDZ A;  2RI2 A;  4MZT A;  5FU6 C;  4UC4 A;  1VQL A;  5LJ3 e;  4C8Q D;  2YLC A;  4RG2 A;  1K73 U;  3G7Z A;  2RM4 A;  2MF2 A;  2KY9 A;  2DXB A;  5CKE A;  3M5A A;  5CIU A;  3RES A;  1N27 A;  3CXC A;  3C4S A;  3V7S A;  1QP2 A;  2E64 A;  3ZFJ A;  2JOY A;  1YJ9 T;  2EQU A;  4KUL A;  4YTL A;  4IKF A;  4M7D A;  2EIF A;  4QVD A;  2PVO B;  3N5B B;  1YJN T;  4N4H A;  5LJ5 e;  5DM7 R;  4N0A A;  2DXU A;  2L3R A;  3E9G A;  4E7J A;  3CMA T;  3NTI A;  3URG A;  4C0D B;  4HT8 A;  3JB9 D;  4N4G A;  3DLL A;  2H3J A;  1VIF A;  5GMK i;  2O4X A;  4C8Q G;  5LJ5 d;  1M5Q 1;  2LDM A;  3CPF A;  4M78 G;  3G71 T;  2WSF E;  4HKE A;  4EMK C;  3KUF A;  4IUU A;  2RJF A;  2KMT A;  3OBY A;  2FL7 A;  2E1H A;  2EWN A;  2EYQ A;  2K5L A;  4BB7 A;  3VYH B;  2GQV A;  2QDY B;  3GOX A;  2LNV A;  1VIE A;  2ZZD A;  1VQ7 A;  4BDY A;  3M56 A;  1QVF A;  1JRI A;  4A54 A;  4ZGE B;  1VQM A;  3QUI A;  4FU6 A;  4PJO F;  3P8H A;  3SB2 A;  3TU4 K;  2XID A;  1KQ1 A;  3M58 A;  3SWN A;  3X28 B;  4EPC A;  3JCM Q;  3QG1 A;  5HK3 A;  5CKF A;  5DLO A;  2KQW A;  2VXE A;  3QII A;  3JB9 J;  3JB9 G;  2NLU A;  3PMT A;  4JLI A;  3GNG A;  1VQO A;  4FT2 A;  3GP8 A;  3MO8 A;  3CPW S;  3G6E A;  1M9S A;  1ZQ1 A;  2VUB A;  1LNX A;  1W2B A;  2ZPE B;  3OS2 A;  1YHQ T;  4C8Q A;  4R55 A;  3DB3 A;  3M57 A;  4XTZ A;  5GAM f;  3I55 A;  3CD6 A;  5AYF A;  5FU7 B;  3RKY A;  5GAO m;  4LDU A;  3GPL A;  3CCR T;  4J6W A;  4ZGD B;  1OYX A;  1VQN T;  4A53 A;  2V8J A;  1YJW A;  2Y4X A;  1I8F A;  1VQ7 T;  2KSS A;  2EQK A;  5KH6 A;  3CC2 A;  3CC2 T;  4M7D D;  3A8L B;  4OGE A;  2RO0 A;  4MZM A;  3CCL T;  3QYH B;  3CEY A;  2OTL A;  4QW2 A;  1K73 C;  1NZ9 A;  2LRQ A;  2XKO C;  3PT9 A;  1LOJ A;  1B34 B;  2EQJ A;  4OF1 A;  3VUZ A;  2ZPF B;  3MP8 A;  3X20 B;  3UPU A;  3HFO A;  1PSF A;  5GAN f;  3G4S A;  4M77 D;  3CCJ T;  3I56 A;  1M1K C;  2R5M A;  3A8O B;  2RJD A;  4IUR A;  3LW5 E;  4C92 C;  4M7D G;  1N8R C;  3OYL A;  2OTJ T;  1WPY A;  3X25 B;  1V29 B;  5FRO A;  5LJ5 h;  1ZHI A;  3V8L A;  4BD3 A;  4JRK A;  4M75 C;  4M77 F;  5LJ5 g;  1K9M U;  1VQ5 T;  3MEV A;  4LDV A;  3H6Z A;  1VQK T;  3L1A A;  4OVA A;  3OS1 A;  2K4Y A;  1MHN A;  1Q81 C;  2P4T A;  4BY6 B;  4F7U F;  4PJO G;  2R5A A;  3EAE A;  5GAN 3;  2LT1 A;  2YLB A;  3RIR A;  1KHC A;  2MWP A;  4F7U G;  5GAN j;  3RKX A;  1VQP A;  1X6O A;  1FWZ A;  1Y96 A;  4XU2 A;  3J81 E;  2JVV A;  3GLX A;  4PJO A;  3QZ9 B;  4M7D E;  4V2S A;  4MDX A;  2PUO B;  1IZ6 A;  4ELZ C;  2DJZ A;  3CME T;  3CMA A;  5GAO p;  3BDU A;  2DIG A;  2K2V A;  4DA4 A;  2OAU A;  2K57 A;  2HBP A;  4NOY A;  4ATO A;  2RK1 A;  3HL8 A;  2CGH A;  3OMC A;  4F7U A;  1I5L A;  1BI2 A;  2DZC A;  4R56 A;  2ZPG B;  3FB9 A;  2QXF A;  4XTV A;  5KE3 A;  3JCM h;  4J83 A;  3CXC S;  2E65 A;  3CCQ T;  3QBY A;  1N9S A;  2FB7 A;  1WQ7 A;  3CCR A;  4MML A;  5GAM d;  3A8G B;  2K5F A;  2O01 E;  4Z02 A;  3CPW A;  5IT9 E;  1VQL T;  4C0F A;  3HHT B;  3RMS A;  4ZN3 A;  2BKD N;  5CAI A;  1BIB A;  4BE0 A;  4PKC C;  2X4X A;  3M54 A;  2XHC A;  5GAM e;  1N8R U;  3GNF B;  3M9Q A;  1Q7Y U;  2C06 A;  3CCS T;  4M7D F;  5GAO r;  2R57 A;  4M7D C;  3V7C A;  2QA4 A;  5IAY A;  5GAN 2;  2LTO A;  2MI6 A;  3RER A;  2LCC A;  2HQX A;  3CCV A;  1VQ6 A;  2MMP A;  2WSE E;  2FVU A;  2P0Q A;  5FLX E;  5J39 A;  1W2B S;  2CS7 A;  1M1K U;  5DY9 A;  1QVP A;  1WJQ A;  1QVG A;  3JB9 F;  2E10 A;  3CBM A;  1Y07 A;  5FRM A;  4C92 F;  4XAX B;  2X4J A;  3GF5 A;  5I2M A;  3FC3 A;  4M7A G;  3QZ5 B;  4O5V A;  4M75 B;  3V8K A;  3JCM f;  1YJW T;  5I21 A;  2JZ2 A;  4DQ2 A;  4M77 B;  4E7I A;  2RH2 A;  2P0P A;  3H8Z A;  5LJ3 j;  1Q7Y C;  1KC8 U;  4KUI A;  5KCH A;  3SD4 A;  1AHJ B;  5GAN h;  3M59 A;  4J6X A;  5GAN g;  4RG8 A;  3OYK A;  4MDW A;  3S6W A;  3LWH A;  3JCM J;  1YI2 T;  2VV5 A;  5A0G A;  1KQ2 A;  1FX7 A;  3MET A;  1OI1 A;  3OBW A;  4FM4 B;  4J6Y A;  1VQ5 A;  2WAC A;  4PJO D;  2LQ8 A;  2RB6 A;  2QEX A;  3SDZ A;  5CCA A;  5D6W A;  4XTU A;  2KVQ G;  3CC4 A;  2X4W A;  4BE2 A;  1U1S A;  1HK9 A;  4XTX A;  2PQW A;  5LJ5 f;  1LJO A;  4IUP A;  5M9O A;  4TVR A;  3OS5 A;  3WXM B;  2XK0 A;  2DZ9 A;  3X24 B;  2XDP A;  2I2L A;  3MP6 A;  4GY5 A;  1YIJ A;  4HCB A;  3KBG A;  2A7Y A;  1O75 A;  4PNO A;  3J80 E;  4C8Q E;  3C94 A;  5GMK e;  1QW1 A;  1R8O B;  2YRV A;  2E6Z A;  4X9C A;  4A4E A;  5J3B A;  4PJO B;  3NFC A;  4PLL A;  4A4K A;  5FU7 C;  4JLG A;  4RCB A;  5I2S A;  3OYY A;  5CVI A;  3O8V A;  3P8B B;  4A4G A;  4C0G A;  3JCM X;  1VQ9 T;  3QO3 A;  4RMO A;  3MEA A;  3T9N A;  3SWN C;  2VYT A;  5KE2 A;  3OYD A;  1YI2 A;  3MP1 A;  4M78 F;  2DKG A;  2EAY A;  1YCY A;  4OB3 B;  4M7D B;  1PSE A;  3QJY A;  4M75 G;  4F7U E;  3TRE A;  4NL3 A;  1YJN A;  3R6O A;  5CKD A;  1NJI U;  1EIF A;  1BYM A;  2XU8 A;  5J26 A;  3TEE A;  3QYG B;  3WVE B;  3I56 T;  5KCO A;  5A0D A;  2QQS A;  3CBP A;  4JS5 A;  5HKC A;  4JRP A;  4PJO E;  3HP9 A;  4FT4 A;  1S72 A;  4C92 B;  5C6S A;  2JUF A;  4M75 A;  3A8H B;  1GXI E;  3MEU A;  3PNW C;  2XDD A;  3CCV T;  3VU3 C;  1VQ6 T;  3CBO A;  4L59 A;  4OB1 B;  2MWO A;  2QA4 T;  2CZ0 B;  1M90 U;  5GMK m;  4NS5 A;  3FJP A;  1KG1 A;  1Y7X A;  3UDC A;  3QPH A;  2X4Y A;  5LJ3 d;  1WNL A;  4QVZ A;  4XK8 E;  2CZ7 B;  3ZBD A;  3JCM d;  3BW1 A;  2PU9 B;  2VGM A;  3EFR A;  5GAN d;  4C8Q B;  1VQ4 A;  4E7L A;  3UWN A;  4A4F A;  2RHZ A;  3CCQ A;  3JCM e;  5GAN 5;  1VQ9 A;  3M55 A;  3V8J A;  4C5E A;  2L89 A;  2RHU A;  3OYM A;  1Q86 U;  4PJO C;  2DO3 A;  5EG2 A;  5HK0 A;  3VV0 A;  4FIB A;  3VYG A;  5GAO q;  2QQR A;  4M78 D;  2GFA A;  4C92 A;  3CCM T;  4JRQ A;  1QVG S;  4MMK A;  5CQX A;  2LC4 A;  1OZ3 A;  2XIC A;  3OSS C;  3PTA A;  2D6F A;  1YIJ T;  2L5Q A;  3FLG A;  3G4S T;  2YHT A;  1TH7 A;  1UGP B;  2LX9 A;  4D6W A;  4LDX A;  1U1T A;  2E70 A;  5GAM j;  3L2V A;  4C92 G;  1BI3 A;  3ASK A;  4M75 F;  1XQH A;  4L5G A;  4M77 C;  3PMI A;  1G3W A;  1G5V A;  4PL6 A;  3CCU T;  1JB0 E;  4XTY A;  3J7A F;  2RD1 A;  4KBM B;  4J5Y A;  4EDU A;  2AHJ B;  3C95 A;  4NL2 A;  2JTF A;  4XTW A;  1N6A A;  1VQK A;  5GAN 4;  4OP0 A;  3QDR B;  3OY9 A;  1XTD A;  1NPP A;  2FHD A;  2ZCF B;  2QQA A;  4X9D A;  4M75 D;  4ELY C;  5A2Q E;  1K8A U;  2QI2 A;  2DTH A;  3CD6 T;  3CCM A;  4P5N A;  2M1H A;  2OTL T;  3OYC A;  3CCL A;  2E12 A;  1H64 1;  3NTH A;  2LT4 A;  2K3X A;  2L8D A;  2DXT A;  3DB4 A;  3HPW A;  3KXT A;  2QEX T;  1KD1 C;  2PVG B;  1UB4 A;  2QQ9 A;  3CCJ A;  4M77 E;  1X75 C;  3PGG A;  1RI0 A;  1G3Y A;  4BY6 C;  1KQS A;  3A5Z B;  1XNI A;  3OW2 A;  3UT1 A;  1Y71 A;  4M78 E;  2KK4 A;  4JUV A;  1M4Z A;  2V8I A;  3MCA B;  4EMH A;  3E1S A;  3LGF A;  3S3N A;  3F70 A;  2P0K A;  1ZBX A;  3A8M B;  4Y91 A;  2LQK A;  1MGQ A;  3OA6 A;  4E7K A;  1VQO T;  4J8O A;  4LD6 A;  2DXC A;  2LVM A;  5LJ3 f;  1O9S A;  3Q1J A;  3L2Q A;  2DD4 A;  1QP3 A;  3QJ6 A;  3PIO A;  1UGR B;  2RJC A;  3G71 A;  1Q86 C;  2E6N A;  5A0L A;  2Y4Y A;  1Q82 U;  3L2R A;  3VJP A;  5GMK j;  1Q81 U;  3OYJ A;  4LDY A;  3L2Z A;  3CCS A;  2XDB A;  3QSU A;  2RI3 A;  5GAN 6;  4C5H A;  4B9X A;  1H3Z A;  5D6X A;  3GIB A;  2D9T A;  2EJ9 A;  4QVC A;  3HKS A;  2XD0 A;  3LH0 A;  4M78 C;  4HCC A;  3FDR A;  4X34 A;  2RHI A;  5LJ3 g;  1P92 A;  5LJ5 j;  3QHS A;  4RCC A;  1QVF S;  2F5T X;  3BDL A;  1VQP T;  4KUD K;  2DTO A;  2KAF A;  3CCE A;  1UGQ B;  3FIF A;  1VQM T;  3HSB A;  4M7A A;  3LWI A;  2O4X B;  4HT9 A;  4LDW A;  1FXX A;  2CKK A;  5IN1 A;  3BY7 A;  3OYG A;  4ZN1 A;  3OYA A;  1U8R A;  3CCU A;  1BIA A;  1WJR A;  4PLI A;  1D3B B;  2HNI A;  4C5I A;  3RMQ A;  2CZ1 B;  2IVW A;  4CRI A;  4XU1 A;  5GAN 8;  2EQM A;  2JNG A;  1KC8 C;  5CKB A;  5GMK l;  4OB0 B;  4OGC A;  2A3L A;  5FU6 B;  1G3T A;  5GAM h;  1I4K 1;  5CO7 A;  3ZEH A;  1VQ4 T;  2HD0 A;  4J7F A;  2RHX A;  4WF2 A;  3SFM A;  5GAM g;  1S72 T;  3HFN A;  2GCX A;  1M1G A;  3OB9 A;  4II1 A;  4B9W A;  4ZTF A;  2BIV A;  3C12 A;  3EFS A;  2DPP B;  2KDS A;  4L6V 5;  1NE8 A;  1BI0 A;  3JCM V;  2VGN A;  4FL6 A;  3AHU A;  4BI8 B;  1HXD A;  1WGS A;  2GF7 A;  3JRZ A;  1VQ8 A;  4EMK A;  4M7A E;  4E47 A;  2M9U A;  5FRN A;  3S3O A;  2FYK A;  3JCM c;  3MEW A;  3WVD B;  5CK9 A;  1WQW A;  4KT0 E;  3FRN A;  2DEQ A;  2F5K A;  3JSC A;  4XU3 A;  3OYI A;  3FEO A;  1B34 A;  2ZPB B;  4BI3 A;  2DK3 A;  1W4S A;  5C0M A;  4M78 A;  4C92 D;  2EJG A;  2PUK B;  5GAO n;  3OYB A;  4C0D C;  3INZ A;  2PVD B;  1KQS S;  1DJ7 B;  2XG8 D;  2RJE A;  2X35 A;  3L2W A;  3JCM P;  1NJI C;  1N9R A;  2DTI A;  5LL6 S;  1K9M C;  2F69 A;  2EKO A;  4M7A B;  2VXF A;  4C5G A;  3OMG A;  2DAQ A;  1X01 A;  3CC7 T;  2GFU A;  1YBY A;  3OSV A;  4M7A D;  3VUB A;  3V7R A;  5D6Y A;  5L8R E;  3OW2 S;  1KHI A;  4HCZ A;  1G3S A;  4M77 G;  2G3R A;  4J7I A;  1SSF A;  4MZP A;  3RUX A;  4RKU E;  2E5Q A;  5CKH A;  3JCM W;  3CC4 T;  1M90 C;  5DLQ E;  1D3B A;  1JJ2 S;  3LYI A;  1VUB A;  3LGL A;  4C8Q C;  3JCM b;  4IUT A;  3PIP A;  2K3Y A;  1IRE B;  2ZPI B;  1YIT A;  2DD5 A;  3JAM E;  2JTM A;  4ME7 A;  5GMK h;  4GLK A;  1Y96 B;  4EMG A;  1YIT T;  2LCL A;  3OYN A;  4A4H A;  5GAO l;  2MAM A;  3VKI A;  3OYE A;  4BE1 A;  1NPR A;  3RKW A;  2OTJ A;  2V8K A;  3HRU A;  4XU0 A;  3LLR A;  1UGS B;  2QTX A;  2WSC E;  2CZ6 B;  4BAC A;  4LD9 K;  4ZTJ A;  1YJ9 A;  2E41 A;  2EJF A;  3BFM A;  3L42 A;  2M16 A;  3MHX A;  4JRI A;  3CC7 A;  1JBM A;  3ME9 A;  5CR2 A;  1UEB A;  2RI5 A;  3JB9 H;  4C92 E;  4BI4 A;  1BKB A;  3L2U A;  1OZ2 A;  1XOV A;  4M77 A;  2EFI A;  3OQ5 A;  3M53 A;  3E19 A;  4IUV A;  4ZGJ B;  4C8Q F;  2RA2 A;  1JJ2 A;  4VUB A;  3TCJ A;  3OYF A;  4E7H A;  3SWN B;  2IG0 A;  2RK2 A;  3CCE T;  4QQ6 A;  2XI9 A;  4DOW A;  5GAN 7;  4BUG A;  3NTK A;  4O6J A;  3OYH A;  4CI0 C;  2R58 A;  3ER0 A;  4N0A C;  4F7U B;  5HY6 A;  3P8D A;  3DKM A;  3X26 B;  3JB9 I;  3OS0 A;  2ZGW A;  2BUD A;  2HAX A;  4QQG A;  4OMF B;  3QKJ A;  3HRS A;  3PFS A;  4XQ3 A;  4EMK B;  3HRT A;  2K5I A;  2B8A A;  1VQ8 T;  2D0Q B;  3I55 T;  1K8A C;  2VC8 A;  4Q5W A;  2M0O A;  1YHQ A;  1WJS A;  5LJ3 h;  2DVE A;  1BI1 A;  2HQE A;  3G6E T;  2CYZ B;  2QQB A;  2Y90 A;  1Q82 C;  4M78 B;  4N4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...