5GAN6

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan600
2I2LA 1MGQA 5GMKe 5LJ3h 5GAN8 2VXFA 5I21A 4F7UE 1I81A 1WNLA 2CGHA 4M75E 4C8QG 2FB7A 3V7RA 5LJ5g 3JCMb 2FYKA 4M7AC 2ZGWA 4XU1A 4M7AB 5GMKm 4XTVA 4N0AC 5LJ3d 3V8JA 2RA2A 4M77D 3RESA 1KQ1A 1LNXA 4C8QE 5GAN2 1BIAA 4M75C 2EJGA 2E65A 4M75B 4XU3A 4NL3A 4JRIA 5GANf 5GANe 5GAOl 1I4K1 1WQ7A 3SB2A 3EFRA 4JUVA 3INZA 3GIBA 4PNOA 5GAN6 2EJ9A 4EMGA 4M7AE 4V2SA 4J5YA 4M78F 4C8QC 4X9CA 3JB9F 3RERA 2EAYA 4EMKA 2K57A 4C92D 4C8QD 4JLIA 3JB9I 4M7DF 3BFMA 1WPYA 2HNIA 3AHUA 5GAMj 4J6XA 2DEQA 4PJOF 4XQ3A 2E1HA 3FB9A 3FIFA 2JN0A 2E64A 2EJFA 4HA8A 1LOJA 3RKYA 5LJ5h 4NOYA 3QHSA 1X01A 4NL2A 5GAOq 3JCMJ 1I5LA 4M7AD 3RKXA 4M78A 5DY9A 5GAOn 2DZCA 5GAOr 2DVEA 2DKGA 1I8FA 5GMKj 4M7DA 3V8KA 1N9SA 5GAMg 2DTHA 1JBMA 4PJOA 4XU0A 5LJ5d 3V8LA 4M78G 3QUIA 3JB9G 4M75D 4XTXA 1BIBA 1HXDA 5GAN4 2E10A 4M7DG 3EFSA 2RD1A 1HK9A 2YLCA 4M77F 1N9RA 5GAN5 4PJOG 3JB9H 1B34A 2RB6A 3L2ZA 1YCYA 3HFOA 3JCMg 1Y96A 3JCMV 5GMKi 4M78E 4A53A 4EMKC 2DJZA 4EMKB 3V7CA 3M4GA 4F7UF 3JCMX 5LJ3f 5GMKh 5LJ3e 5GANj 2QTXA 1WQWA 3SWNA 5LJ5f 2DXUA 5LJ5e 3L1AA 2Y90A 4M77A 2E41A 3JCMc 5GAOp 4C92F 4M78C 4M78B 4XTZA 4XU2A 3JB9D 3RIRA 3V7SA 4F7UA 4M7DC 4M7DB 2VXEA 4M77G 5GANg 4PJOC 4PJOB 4XTWA 4XTUA 4JRKA 5GANh 5GAMh 4F7UG 2VC8A 4M7AF 5GAN7 4QVCA 4J6WA 1LJOA 4C92B 5CAIA 4C92A 4XTYA 4C8QA 4MMKA 1B34B 3VU3C 4A54A 3JCMe 3BW1A 5GAOm 2DZ9A 4RCBA 4HT9A 1Y96B 5GANd 1D3BB 5GAMd 1U1TA 1D3BA 3JCMh 2YHTA 3JCMW 1KQ2A 4M75F 3RKWA 4C92G 4M7DE 3HFNA 3PGGA 5GMKl 4MMLA 2DXTA 3BDUA 3SWNC 3SWNB 4M7AA 4PJOE 5GAN3 2DTOA 4M77C 4M77B 1U1SA 3JB9J 1H641 3FJPA 3JCMd 3QSUA 1M5Q1 4N0AA 4Y91A 3JCMP 4C92E 4C8QF 3BY7A 4M7AG 4F7UB 5LJ3j 4M78D 3RUXA 1M8VA 4M75A 2DTIA 3JCMQ 4WF2A 5GAMf 4M7DD 5GAMe 3QO3A 4HT8A 5LJ5j 4RCCA 4PJOD 4DQ2A 4J6YA 3HSBA 4M75G 2EWNA 2YLBA 4C92C 4OP0A 1TH7A 4C8QB 4M77E 4X9DA 3JCMf 1JRIA 4QVDA 2RM4A 4EMHA 5LJ3g
chains in the Genus database with same CATH superfamily
1WIEA 2K5LA 5GJWB 3G4ST 1Q86R 5LJ3h 2VXFA 4RTYA 4C8QG 3JCMb 2CDTA 3MPUB 1IRXA 5GMKm 1IXDA 1PKSA 1JJ2A 1ZBXA 1QVGA 2KBTA 2XI9A 2X4XA 2HAXA 1IO6A 5GAOl 3EFRA 3CCSA 1NYGA 4KT0E 3EH2A 5J39A 2QGFB 2BIVA 4M78F 3CCSQ 4X9CA 1NEGA 2CS7A 4QVZA 4M7DF 3IQLA 1SSHA 5GAMj 4J6XA 3GLXA 2EQJA 3ER0A 5IXBA 2XDBA 2D0QB 1UGSB 2FHDA 2JT4A 1Z9QA 5GAOn 1U5SA 1K9MR 1WI7A 1N8RC 2HKQB 3MEAA 4KH0B 3UT1A 2YLCA 4OMNA 4DEXA 4LUEA 2XU8A 4CC2A 4HVWA 3EFOB 5CKHA 1Q82R 5LJ3e 4JRPA 2LRQA 4J9GA 4C0DC 3VS6A 4XAXB 3LGFA 3OYFA 1M1KC 4M77A 3TCJA 3MCAB 2A3LA 5HY6A 2BKDN 4ZGDB 5ECAA 2E5QA 1TUGB 4FSXA 1KHCA 4AG1C 1WHMA 4HT9A 4E6RA 1WYXA 4KUIA 3VRZA 1EFNA 2EKHA 4BB7A 1JB0E 1NYFA 1OULA 2MK5A 2DXTA 3SWNB 2DTOA 3JB9J 3QSUA 1GFCA 3JCMP 4KGZB 1ZLMA 5CK9A 1K1ZA 4E7ZA 1JJ2S 3QO3A 1QVGS 1XOVA 2O4XB 2EBPA 3HSBA 2V26A 7AT1B 3REBB 2CREA 3JCMf 5A2QE 1CKBA 2ZPGB 2RQRA 1R0BG 2JW4A 2J06A 2OTLT 1M4ZA 1ARKA 1ZQ1A 1GL5A 3REAB 1KQ1A 1QWEA 1SG5A 2D1XA 2E65A 2R57A 1I4K1 4ATOA 1WQ7A 1J3TA 2RI5A 2WSFE 4PJJA 5HKCA 2DRMA 1K73R 4M7AE 3JB9F 2K57A 4IUVA 1VQOT 4XQ3A 1VQ7A 2M9UA 2MOXA 1VQ7Q 1ZA1B 2X51A 2NUTA 3M0PA 1Q81U 4HVUA 3I9QA 4KH1B 2J7IA 1QW1A 4M78G 2M02A 4M75D 2E70A 2LX9A 4XTXA 2HL3A 4M7DG 2X4WA 5I11A 5CVIA 2A36A 2OI3A 5KE2A 1OI1A 1PRMC 3CC2T 3M53A 4CC7A 4JZ4A 5I22A 2QTXA 1VQKA 1WQWA 2DERA 1KG1A 4YTLA 1WHKA 1VQKQ 1RLQC 2W0ZA 3PMTA 3CXCS 4C92F 1RUWA 2LCCA 1YWOA 1C1AA 4F7UA 4RKUE 1SF9A 5KYWA 2IVWA 2M16A 2HBPA 2QQBA 5GAMh 1GCQC 3QDFA 4M7AF 2I0NA 1B34B 2DYIA 1MMNA 1Y96B 1FMWA 2LJ0A 2HZYA 3RKWA 1PCXA 2HDAA 3OYLA 4FYWB 1VUBA 1UJYA 1H641 1R77A 4A4KA 1NJIC 1Y7XA 2K6DA 2NUPB 4RTXA 4PFOA 4JRQA 2V8JA 1Y71A 5IXFA 3R6OA 4B9XA 1RACB 2KE9A 2LMJA 2EYZA 4M77E 4ZN1A 5FU7B 5I21A 1SHGA 1MNEA 3JSCA 3OSVA 3EG9A 4CC3A 2FPFA 2ZGWA 2M51A 4R0KA 2DL4A 2RK2A 3CD6T 4J9EA 4GBQA 2L89A 3TREA 3CCLT 1N6AA 1VQMA 1W2BP 1SSFA 4LXCA 3M0QA 2YRDA 2RK1A 4FM4B 1VQMQ 2BTTA 2YRCA 5KYXA 2CP0A 1YWPA 2Y4YA 2R5MA 2K7AA 2NLUA 1X6OA 2CP6A 1LOJA 1FMKA 4NL2A 5D7UA 4F16A 2DVEA 2AT1B 1I8FA 1ABOA 1BK2A 4E7KA 4PLLA 3JB9G 3M57A 5CO7A 1VQ6A 3EFSA 3BDLA 4M77F 3JB9H 1VQ6Q 2GQIA 5KYYB 1D09B 2Z0WA 2P0PA 3CCRT 2PUKB 1QCFA 2EVRA 4RG2A 4C0DB 4E7SA 3VS7A 5CQXA 3CMEA 1F1BB 3QXEB 1R8OB 1UG1A 2XK0A 1WX6A 2FRWA 2XD0A 2PVGB 4IURA 2IIMA 4ZGEB 2QASA 1UB4A 3RMQA 3X26B 4L59A 1VYVA 1WHGA 4A54A 5A0LA 4J9CA 2CSQA 3URGA 4C92G 4J9IA 3HFNA 2QQ9A 4JLGA 2HMAA 2LNVA 1OU8A 3SD4A 4Z88A 1OPLA 4P5NA 2JNGA 1C6VX 2DEUA 2VASA 2KQWA 3BY7A 4M7AG 2L5QA 5A0GA 4AT1B 1Q86C 1I5OB 3G7ZA 2EQIA 1HSQA 4C8QB 4GLKA 3CQTA 2PQWA 1XJWB 2I2LA 9ATCB 1RAFB 1NG2A 1WXTA 3RDVA 4F7UE 4ZNXA 4JPBW 1AWWA 4R56A 4N0AC 4OB2B 1YP5A 4FYXB 2F1LA 2O9VA 2V8IA 3PFSA 3META 1VQPQ 1AVZC 1PD0A 3Q1JA 1Q7YC 5GANf 3A8HB 3VJPA 1KQSA 3C94A 1D1AA 3GIBA 3OS2A 1M8MA 4EMGA 3A98A 1TSFA 4ZTFA 3NFCA 3EG2A 1YIJT 1Y07A 1K9MC 1OOTA 5AYFA 1SRLA 2GFAA 4A4EA 5HCKA 2RO0A 2DKGA 2NWMA 3EGDA 2JTMA 3V8LA 2HCKA 3QUIA 1Q82C 2ROTA 1YJ9A 5KYNA 3I55A 1YJ9Q 3JV3A 3I55Q 2RQWA 3HFOA 4FT2A 3FLGA 3PIOA 2KT1A 3C4SA 2HQHA 4F7UF 2EW3A 3HL8A 3E19A 2O2OA 1ZSZA 5LJ5e 3CPFA 4GY5A 2OX7A 2LNHB 1OYXA 4M77G 3X20B 1MMGA 3GP8A 4XTUA 4E47A 1YNZA 2D8HA 3A8GB 3S6WA 3GBQA 3A5ZB 3EAEA 4J8OA 1YJWA 4LDWA 3PTAA 1YJWQ 2FEIA 2RQTA 3OYYA 4AFZC 2FPEA 3P8HA 2OTJA 5LJ3j 4M78D 5FLXE 2DTIA 2OTJQ 4M7DD 1VQKT 3HRSA 2F5KA 1UE9A 1NEBA 3P8DA 4QKUA 3UWNA 2X4YA 2LDMA 3OYJA 2LQWA 1JJ2P 3AT1B 1K73C 1M1FA 4HXJA 3NPFA 1M30A 3EG1A 4HKEA 2VGMA 2OJ2A 2NUZA 2DD5A 5IHNA 3CMAT 1NJIR 2YSQA 1TU0B 2EFIA 1YI2T 3NMZC 4RMOA 1H92A 3QIIA 4MZPA 3QHSA 1X01A 3M58A 1YHQA 2DLPA 3HTRA 4Z89A 1WA7A 2KDSA 4LE9A 2RJCA 2CT3A 2GNCA 2QQAA 1YHQQ 1W70A 4PLIA 1GFDA 4PJOA 1TWBA 1MMAA 1BCOA 3QZ5B 2RHXA 3VRYA 3QBYA 3JCMg 1U06A 3DB4A 2DJZA 3V7CA 4OGCA 1M2VB 1VQMT 2KEAA 3EG0A 4R55A 1N27A 4C0GA 2ATCB 1Q81R 4XU2A 1JO8A 1BU1A 2DA9A 3ME9A 2FPDA 3L2UA 2JM8A 1KD1U 3G1JA 4F7UG 2EYYA 3OYCA 5DLQE 1M3BA 2ZPHB 2P4RA 4IUTA 1C0MA 1D3BA 4OMFB 1OU9A 4D6WA 1OX9A 5GAN3 1VQ6T 1WHHA 3RBBB 3VS0A 2QA4T 1QQJA 2G6FX 1AHJB 5GAMf 2VKNA 2MF2A 2C0IA 2X3XD 5FW9A 3UDCA 3CMET 4DA4A 1KC8U 1VYUA 4JJCA 2IPOB 2YT6A 1ZUUA 4JS5A 4PKCC 3OMGA 5J26A 2VYTA 3X28B 3OYAA 2JTEA 5CKDA 2L3PA 3L2VA 4MDXA 4LD9K 1D0ZA 1M3CA 4C5HA 4M75C 2GBQA 4HCCA 4BI8B 5CQYA 2O9SA 2L3QA 1PHTA 4RG8A 1WJQA 1UHFA 2DMOA 5FU7C 4C92D 4JLIA 4J9FA 1QLYA 3AHUA 4XK8E 4BDYA 3M56A 2L8DA 1ZUYA 2M0OA 3RMSA 2RN8A 4M7AD 1UDLA 2K2MA 1BI1A 1KJWA 4AFUC 5LJ5d 1R0CB 2K3XA 1G3WA 5IHIA 1K8AU 5FRMA 1GBRA 3C0CA 2X3WD 1Q7YR 1AZGB 2LP5A 4J9DA 4EIKA 2QK0A 1TUDA 3SWNA 1I0CA 3GF5A 3HPWA 1BB9A 2Y90A 3SHWA 1UJ0A 4F04B 2DXCA 2VB6A 4L5GA 2O4XA 4C5EA 5GAN7 1ZHIA 4C92B 1E7OA 3BW1A 4RTVA 1D1CA 2KRSA 3KFVA 5FWCA 1M27C 3LLRA 2QYZA 4MZMA 2M1HA 3G6ET 5GMKl 4PJOE 2RJEA 4A4HA 4QQDA 3VUZA 3CCJT 2HEQA 2ZPEB 3T9NA 2ROLA 3SEMA 1WLPB 2YLBA 1FYNA 4ZTJA 3CCQT 3FJ5A 4WTOB 4F17A 3CXCA 4JZ3A 3CCVA 2KYBA 1BI3A 3CCVQ 2AK5A 4XTVA 1RLPC 3CBPA 4M77D 3FEOA 1LNXA 2ZPBB 3O5ZA 1IB8A 1X27A 2SRCA 5DLOA 1YJWT 4C8QC 1QP3A 1ZA2B 2OTJT 4AG2C 2R58A 2A08A 2DEQA 4PJOF 3FB9A 2L2PA 5A0DA 3RKYA 1CSKA 4IKFA 2AKKA 5GAOr 4OB3B 2DZCA 2C0TA 3I56A 3CPWS 1YITQ 5IAYA 3M0SA 3I56Q 1BKBA 3D7SB 1BIBA 4LDYA 4LNPA 3TSZA 2K3YA 2CZ0B 2KI7A 1B34A 1Q95G 5L23A 1Y96A 2ED0A 2AIRB 5AT1B 2EPDA 3QG1A 2L3SA 1K9AA 3LH5A 3CC7A 3DLLA 2CH4W 3CC7Q 3TEEA 2K3BA 5GANg 4XTWA 2RNAA 4QT7A 2ENMA 2QTVA 2CH4A 4QVCA 2YRVA 2DM1A 2DZ9A 1WHJA 1UFFA 1TG0A 2XDPA 3UA6A 1B3QA 3OBWA 2E4HA 2HKNA 1BYMA 2LC4A 1HJDA 2ZPIB 2CZ6B 4GLMA 2RQUA 5LJ5j 3OYEA 3L2RA 1M90U 5IH2A 2H3JA 1KSWA 2RJDA 2LQKA 5GAN8 3RR6A 2VWFA 1W6XA 4A63B 2F2XA 3L2QA 3M59A 4CC4B 1PC0A 2C0OA 3CCMA 1OZ2A 3QDRB 4LDXA 2D0NA 3V8JA 3CCMQ 1W4SA 2KROA 4C0FA 2EJGA 4M75B 1YCSB 1JQQA 1WZOA 2LZ6B 1LVKA 1KQSP 3PIPA 1WXBA 1WDXA 5GAN6 2EJ9A 5KYYA 1VQ8T 4V2SA 4IIMA 3OW2P 2FO0A 1BI2A 1RL2A 3QJ6A 1VQNA 1WJRA 2CUDA 1B07A 1VQNQ 5DY9A 3P8BB 1PKTA 2O31A 3H6ZA 2DRKA 1YFNA 2KT8A 1JBMA 2QI2A 2MMPA 1M2OA 4J83A 2V8KA 3TU4K 2GF7A 3H0IA 3ZEHA 3DKMA 4PJOG 5C6SA 1QVFP 5D6XA 1GCPA 1Q86U 3M4GA 1Q81C 3CBOA 2Y4XA 1KK7A 2D8JA 2DO3A 1D0XA 1EX4A 2QDYB 4M78C 4M7DC 2LX7A 3CCEA 1QCOA 4X34A 3VKIA 3CCEQ 2DAQA 3EHQA 4Y28E 5M9OA 4XTYA 4C8QA 3PNWC 3ZFJA 3MP1A 5GANd 2DXBA 2F69A 2RHIA 1KFZA 4BE0A 3PGGA 2CZ7B 3HKSA 1K76A 3MP8A 3CCST 2P0KA 1K9MU 3RUXA 1NBEB 2LCSA 3PVLA 3GOXA 1KD1R 3G71A 2PTKA 5FWBA 1B7TA 1JEGA 2QXFA 3G71Q 1TH7A 4DOWA 4O5VA 1JRIA 1Q82U 3E9GA 2CP7A 2DVJA 3KBGA 4LUDA 4M75E 2CGHA 2RF0A 1LCKA 2QDLA 1G5VA 3M9QA 1AEYA 1X2QA 1QKWA 2LVMA 3JAME 4PK4A 4EDUA 1G3SA 1RAGB 1AD5A 2KXCA 2H3EB 4AFSC 3CC4Q 4KGVB 5KYXB 4TVRA 8AT1B 3VV0A 1VQ5A 1KC8R 1VOMA 4OMOA 1M1GA 1VQ5Q 3RERA 1IHWA 4PL6A 5CKEA 1H3HA 2E12A 6AT1B 2X4JA 4PJNA 2JXBA 1LPLA 3M0RA 3A1PA 4HA8A 2IG0A 5LJ5h 1K0XA 3SDZA 3NHNA 5CKBA 1VQPA 5GAMg 5D6YA 1FX7A 1GCQA 3THKA 1FWZA 1JU5C 2WSCE 2HD0A 1N9RA 3A8LB 3E2UA 3H0HA 1RI0A 2JMAA 4EMKC 2LTOA 3JRZA 2FZKB 5LJ3f 3WXMB 2J6OA 2FVUA 2E41A 1FXXA 4OMLA 4XTZA 4FW2A 3V7SA 2EGAA 2VXEA 2EQMA 3PT9A 1WXUA 2OAWA 3QYHB 2CSIA 1QVPA 2A37A 4RUGA 3I56T 1U1TA 2EGCA 1KQ2A 2KY9A 1TS9A 2CYZB 4JDSA 4BY6B 1U1SA 2VV5A 1YBYA 1VQ4A 1UGQB 2JJ9A 1W2BA 1T3SA 2EYQA 1VQ4Q 4E7JA 4RCCA 3FRNA 1VQ7T 1WJSA 1YN8A 3CC7T 4C92C 2LT4A 3J80E 3JCMe 3EGXB 1KHIA 1ZUKA 3V7RA 4M7AC 1D1BA 2MI6A 3UATA 4PFZA 4DOVA 4HCKA 3RESA 4C8QE 5GAN2 2K5IA 4NL3A 1EZZB 3FDRA 2E6NA 2PUOB 3BFMA 1M2VA 4OB0B 2FG0A 1RAAB 2KYMA 2EJFA 2PVDB 2BE7D 2XICA 4L6V5 3RKXA 5KCOA 2V1RA 1QVGP 3UF4A 4N4HA 5L8RE 1VA7A 1HXDA 2DBKA 3OBYA 3OS5A 2WACA 2QEXA 1K4US 3MP6A 3NGPA 4O6JA 4II1A 2QEXQ 4QW2A 3JCMV 4ELZC 5IN1A 4BACA 2P84A 3LW5E 3QJYA 2RJFA 4C5IA 3WVDB 1TOVA 4M78B 2BUDA 1W1FA 2CZ1B 4M7DB 3OQ5A 2KRMA 2QGGA 4JRKA 3R6NA 3WVEB 1VQOQ 2RMOA 1PWTA 1TXQA 3A8OB 4OMMA 1W2BS 1VQNT 2RH2A 1LJOA 5FRNA 3OS0A 3LWHA 4C0ZA 2JZ2A 4MMKA 2VGNA 3EGUA 4PFPA 2YHTA 3HHTB 3PMIA 1PM3A 4F14A 4OGEA 4ANJA 4PJLA 2MYSA 4M77C 1MV3A 3X24B 4LD6A 1RAIB 4N0AA 1SEMA 2CUBA 1ZBJA 3CC2A 2L0AA 1YJNA 2DIQA 3CC2Q 3M5AA 1YJNQ 4PJOD 1IREB 3N5BB 3NTHA 4QVDA 4EMHA 4D8KA 3CCET 2QAZA 3CXCP 1UEBA 4CI0C 3OYHA 1PRLC 2FYKA 4XU1A 4ME7A 2G3RA 1WFWA 2QQSA 1V76A 2F2VA 1SRMA 4IUQA 3CEYA 3S3NA 3OYKA 2D9TA 3SB2A 3INZA 1AWJA 4M4ZA 4J5YA 2K5FA 1N8RU 1X6GA 3CCUA 3DB3A 5KYUB 2ZPFB 1P92A 1RADB 3CCUQ 4QQ6A 5GAOq 1X69A 2YDLA 2C06A 1XQHA 5EC7A 1M1KU 1HK9A 1AZEA 1V29B 2OAUA 2VVKA 2HL5C 1AWOA 3CD6A 2RB6A 2ABLA 2DILA 3GNFB 3L2ZA 3ZBDA 4M78E 1UTIA 4A53A 4EMKB 3CCLA 3CD6Q 3EFOA 3LGLA 5GMKh 3VS2A 3CCLQ 4B9WA 3QWXX 4A4GA 5I2MA 1MMDA 2DXUA 2FZCB 5GAOp 4Y92A 1G8XA 4E7LA 1ZSGA 1DJ7B 3OYMA 4N4GA 2E3IA 5GANh 4EPCA 4VUBA 1S72A 5CR2A 4J6WA 1S72Q 4OMPA 2ESWA 1QMCA 1VQPT 1D3BB 3VS3A 1H3ZA 1UGPB 2DFUA 3M4YA 4RTUA 2MIOA 1KD1C 3CPWA 3JCMd 1UGRB 1M5Q1 1RI9A 1OV3A 3CCRA 4OMQA 3CCRQ 2FL7A 3PE0A 2SEMA 1OEBA 2RQVA 3OYBA 1K0SA 5GMKe 1RABB 1VIEA 3VS5A 3KUFA 2CP5A 2AZSA 4M7AB 5KCHA 1BBZA 1YJ9T 1A0NB 3I55T 2GQVA 2HQEA 3EG3A 1KC8C 1IGUA 2COZA 1VIFA 5GANe 4KULA 4FYVB 4C5GA 2QG9B 1PD1A 2BZ8A 1VQ4T 2XG8D 1KIKA 3L42A 1PG5B 3M0UA 1XTDA 2E1HA 3UPUA 3I35A 3A8MB 4NOYA 2PVOB 2BZXA 3F70A 1NM7A 4WCIA 3MKDA 2DTHA 4CRIA 4XU0A 4FIBA 3SFMA 3RNJA 5GAN5 1Y0MA 1RAEB 1YCYA 5LJ5f 4AFQC 2K79A 1ZX6A 4ORZA 1K8AC 2YUOA 4KBMB 3RIRA 1YITA 2DL8A 1YIJA 3J7AF 2F2WA 4K11A 5FROA 2PNIA 1YIJQ 4OF1A 1NJIU 1AOJA 3X25B 5CAIA 2MWOA 2YXYA 1IGQA 1X75C 1H8KA 1VQ9A 2GCXA 2J05A 2FRYA 2NYSA 5CCAA 2DBMA 1VQ9Q 2KK4A 2QQRA 2QEXT 4E2FB 4M77B 1AT1B 3FJPA 2A28A 4C92E 4QQGA 2NUPA 1M8VA 4M75A 2KXDA 3MEUA 4BD3A 4J6YA 3MEVA 1NPPA 3S3MA 4DBRA 2MCNA 3UA7A 1YHQT 1G3TA 2LT1A 3E1SA 2XHCA 2RM4A 5LJ3g 1I81A 1WNLA 2AZVA 2LQNA 3CBMA 3VS4A 1QKXA 1VQLA 3OSSC 4BY6C 2CKKA 2LQ8A 1VQLQ 2RA2A 2X9HA 2YUQA 2GFUA 3M54A 4FYYB 1U3OA 1JXOA 1NLOC 3J81E 3MEWA 5J3BA 2KSSA 4J7IA 4BI4A 3JB9I 1YJNT 3H0FA 1Z9ZA 2JN0A 2V1QA 2CP2A 4JJNK 1XNIA 2DE0X 4J7FA 3MHXA 1O9SA 4J9HA 4OVAA 3ULRB 4BI3A 1GBQA 5EG2A 2B86A 1NZ9A 2E10A 3O8VA 5GMKi 1UECA 2JS0A 1V1CA 3CMAA 1M9SA 2JM9A 4FU6A 3OA6A 3CMAQ 2NUTB 3ZL7C 1YI2A 1HYOA 3HRUA 1GXIE 2K2VA 1YI2Q 4BE2A 3CCUT 4KUDK 3VU3C 1WGSA 3OYNA 4AMCA 2A7YA 3JCMW 5IHKA 2JMCA 1CKAA 1ZSZC 3ASKA 2E6ZA 5LL6S 3H9NA 4B6MA 1OX8A 3E9FA 2R5AA 4F7UB 1NPRA 3I5SA 3JCMQ 2XMFA 4J9BA 4WF2A 5KYWB 2DF6A 4NS5A 5GAMe 2ZAEA 3H41A 4HT8A 2COYA 2HSEB 4DQ2A 4OP0A 1VYTA 3I5RA 3OYDA 3NTKA 4A4FA 1Q7YU 1ABQA 1QP2A 1MGQA 5I2SA 2FB7A 2JUFA 2DL3A 1OZ3A 1S72T 3C12A 1M90C 2DYBA 5LJ3d 2W10A 3GNGA 2JS2A 1BIAA 2H8HA 4HVVA 3DLMA 1HD3A 1UGVA 1S1NA 3VYHB 4KGXB 2QA4A 4PJMA 2EAYA 1MHNA 2DD4A 4C8QD 2QA4Q 3GPLA 3MJXA 5CIUA 3OY9A 3EG9B 2LJ1A 4E7HA 1G2BA 2KRNA 3CMEQ 2CP3A 1SKUB 1QWFA 3V8KA 3CC4A 4OB1B 5GAN4 2DNUA 3OS1A 2RD1A 2KVQG 2EQUA 1N8RR 2F5TX 2VUBA 2EKOA 4FW1A 2MPXC 5C0MA 3EH1A 4BUGA 2O88A 4FCYA 3M0TA 2RHUA 5IT9E 2HBWA 3G4SA 4PJOC 1MUZA 3S3OA 3G4SQ 1AWXA 1M1KR 4BDZA 2E3HA 4KRTA 3CCVT 4ESRA 3QPHA 2HSPA 2M0YA 1D0YA 1EIFA 2JVVA 3JCMh 3EGXA 4M75F 3BE3A 3BDUA 4FT4A 3LWIA 2GTOA 1GRIA 5FU6C 1T0JA 2XIDA 2JTFA 2EIFA 1PSEA 2RI3A 1MV0B 3TSWA 1E6HA 1ACMB 1I07A 2ZZDA 4D8DA 1K8AR 2EWNA 1K73U 4UC4A 3OW2A 2KNBB 2YUNA 3QWYA 1YITT 2GGRA 8ATCB 1Y57A 5GJVB 2P4TA 2J6FA 4FSSA 3NTIA 4FL6A 3G6EA 1I1JA 1VQ9T 1FMVA 2K9GA 3G6EQ 4JUVA 1QVFA 4Z02A 5HK0A 1TTHB 4JS4A 3CCJA 4MDWA 1WPYA 2HNIA 3CCJQ 5KH6A 4DBQA 2E64A 4LDUA 3L2WA 2YUPA 3CCQA 3JCMJ 1I5LA 2RI2A 2EYWA 4M78A 3CCQQ 2COWA 5GMKj 4M7DA 2KR3A 1N9SA 3LX7A 3H8ZA 5DM7R 1PSFA 2KGTA 1SPKA 1QCNA 1VQLT 1MNDA 2YWWA 3LH0A 4IUPA 4LN2A 2J6KA 1SHFA 1G83A 3JCMX 4ZN3A 4DEYA 4N4IA 5GANj 2A0FB 2LJ3A 4ELYC 3OB9A 2DL7A 3L1AA 1IHVA 3JCMc 4JJBA 5D6WA 4RTZA 2DJQA 1WHLA 4RTTA 2LCLA 1G3YA 3QZ9B 1RAHB 2PU9B 3EGDB 2E5KA 2VC8A 4RTWA 2OTLA 4Z8AA 4Q5WA 1KQSS 2HQXA 2OTLQ 3CCMT 3QKJA 4RCBA 5GAMd 2ED1A 2EGEA 2CT4A 2O01E 3OW2S 1ZSZB 4MMLA 3SWNC 2PZ1A 3CPWP 2RPNA 4Y91A 2XDDA 4C8QF 2WSEE 3HP9A 3MO8A 1VQOA 2DETA 2DIGA 2DPPB 3TQ7P 4M75G 4IUUA 2ECZA 4HCBA 4X9DA 1N5ZA 4ZGJB 3M55A 1QVFS 2AKLA 4JJDA 5KYUA 1X6BA 5LJ5g 1JXMA 1NLPC 4BE1A 1U8RA 2D6FA 2KAFA 3LYIA 2RHYA 3VS1A 1OQKA 2RHZA 2MAMA 5CKFA 4XU3A 1PNJA 1UHCA 4JRIA 2BE9B 4IIOA 1TUCA 4PNOA 1OPKA 3OYGA 2ZCFB 2MWPA 4EMKA 1T3LA 3PVQA 3VYGA 3FIFA 2KMTA 1UUEA 5HK3A 2DK3A 4X1VA 3C95A 2DL5A 3VUBA 2P0QA 2B8AA 4MZTA 5KE3A 3FC3A 1X2KA 2X35A 4E7IA 2XKOC 1M90R 2FZGB 1E6GA 1BI0A 3OMCA 4DBHA 3KXTA 3G71T 1O75A 1X43A 1VQ8A 1VQ8Q 3JB9D 4LDVA 3EHRA 4PJOB 3U23A 4HCZA 4C92A 4DBFA 5GAOm 3OYIA 2BZYA 3HRTA 2JOYA 3CC4T 4M7DE 4M7AA 1VQ5T 1IZ6A 5FU6B 3QYGB 2GTJA 1NE8A 1BCMA 2DX1A 1M3AA 2K4YA 2AHJB 2L3RA 2EQKA 1T0HA 3TVTA 2EYXA
chains in the Genus database with same CATH topology
3G4ST 2K5LA 5LJ3h 2VXFA 3KBGA 3P8DA 1I81A 1WNLA 2CGHA 4M75E 3UWNA 2X4YA 4C8QG 3CBMA 3JCMb 2LDMA 1G5VA 3M9QA 3OYJA 1VQLA 3OSSC 4BY6C 5GMKm 2CKKA 2LQ8A 2LVMA 2RA2A 1ZBXA 3JAME 1K73C 1JJ2A 1M1FA 4EDUA 1QVGA 1G3SA 2XI9A 2GFUA 2X4XA 3M54A 4HKEA 2HAXA 2VGMA 5GAOl 4TVRA 2DD5A 3VV0A 3EFRA 3CMAT 1VQ5A 3J81E 3CCSA 4KT0E 3MEWA 5J39A 1M1GA 2BIVA 4M78F 2EFIA 5J3BA 4X9CA 1YI2T 3RERA 4PL6A 4M7DF 2CS7A 2KSSA 4J7IA 4QVZA 5CKEA 4BI4A 3JB9I 1YHQA 1YJNT 2E12A 4J6XA 5GAMj 3GLXA 2EQJA 4RMOA 2X4JA 3ER0A 2XDBA 2JN0A 3QIIA 2D0QB 4HA8A 2IG0A 4MZPA 5LJ5h 1XNIA 3MHXA 1X01A 1UGSB 1O9SA 2FHDA 3M58A 3QHSA 4J7FA 2KDSA 4OVAA 3SDZA 4BI3A 5GAOn 2RJCA 2QQAA 5CKBA 1VQPA 1N8RC 5GAMg 4PLIA 5D6YA 5EG2A 4PJOA 3MEAA 3UT1A 1FX7A 1NZ9A 2E10A 3QZ5B 1FWZA 2RHXA 2YLCA 2WSCE 2HD0A 1N9RA 3A8LB 3QBYA 3O8VA 3JCMg 5GMKi 1RI0A 2XU8A 3DB4A 4EMKC 2DJZA 2LTOA 5CKHA 3V7CA 3JRZA 5LJ3f 4OGCA 3WXMB 5LJ3e 4JRPA 1VQMT 2LRQA 2FVUA 4C0DC 4XAXB 3CMAA 3LGFA 3OYFA 1M1KC 1M9SA 4M77A 4R55A 4FU6A 2E41A 1N27A 3OA6A 1FXXA 1YI2A 3TCJA 4C0GA 3HRUA 4XTZA 1GXIE 4XU2A 2K2VA 3V7SA 4BE2A 2VXEA 2EQMA 3CCUT 3MCAB 2A3LA 5HY6A 2BKDN 3ME9A 3PT9A 4ZGDB 2E5QA 3L2UA 4KUDK 1KD1U 4FSXA 1KHCA 4F7UG 3QYHB 3OYCA 5DLQE 2ZPHB 3VU3C 1QVPA 1WGSA 4HT9A 4IUTA 3OYNA 4KUIA 2A7YA 3I56T 1U1TA 1D3BA 1KQ2A 2KY9A 4OMFB 3JCMW 4BB7A 1JB0E 2CYZB 4JDSA 3ASKA 2E6ZA 2DXTA 5LL6S 3SWNB 4D6WA 5GAN3 1VQ6T 2DTOA 4BY6B 3JB9J 1U1SA 2VV5A 1YBYA 3E9FA 3QSUA 3JCMP 2QA4T 5CK9A 2D6FA 2R5AA 4F7UB 1NPRA 1VQ4A 1UGQB 1AHJB 3JCMQ 1W2BA 4WF2A 2EYQA 5GAMf 2MF2A 4NS5A 5GAMe 1JJ2S 3QO3A 4E7JA 4HT8A 1QVGS 4RCCA 3FRNA 1VQ7T 1XOVA 2O4XB 1WJSA 4DQ2A 3UDCA 3CMET 4DA4A 3HSBA 1KC8U 3CC7T 4C92C 4OP0A 4JS5A 2LT4A 3JCMf 5A2QE 3J80E 3NTKA 3OMGA 4PKCC 5J26A 4A4FA 2ZPGB 3JCMe 1QP2A 2VYTA 1Q7YU 1MGQA 1KHIA 5I2SA 3X28B 2FB7A 3V7RA 3OYAA 2JUFA 4M7AC 1OZ3A 5CKDA 1S72T 2MI6A 2OTLT 1M4ZA 3C12A 3L2VA 1M90C 4MDXA 1ZQ1A 4DOVA 5LJ3d 4LD9K 3RESA 1KQ1A 3GNGA 4C5HA 4C8QE 5GAN2 1BIAA 4M75C 2K5IA 2E65A 4NL3A 4HCCA 4BI8B 2R57A 3DLMA 5CQYA 1I4K1 4ATOA 1WQ7A 2RI5A 3VYHB 2WSFE 5HKCA 4RG8A 4M7AE 2QA4A 1WJQA 3JB9F 3FDRA 2E6NA 1MHNA 2EAYA 2K57A 2DD4A 5FU7C 4JLIA 4C8QD 4C92D 2PUOB 3BFMA 4OB0B 3GPLA 3AHUA 4XK8E 4IUVA 5CIUA 3OY9A 4BDYA 1VQOT 4XQ3A 3M56A 1VQ7A 2L8DA 2M9UA 2M0OA 2EJFA 4E7HA 2PVDB 3RMSA 2XICA 4M7AD 4L6V5 3RKXA 5KCOA 1Q81U 1BI1A 4N4HA 1QW1A 5L8RE 3V8KA 3CC4A 4OB1B 5LJ5d 2K3XA 4M78G 1G3WA 4M75D 2E70A 2LX9A 4XTXA 1HXDA 5GAN4 1K8AU 3OS1A 3OBYA 3OS5A 2WACA 2RD1A 2X4WA 2QEXA 5CVIA 3MP6A 4O6JA 2KVQG 3TU4K 5FRMA 4II1A 2EQUA 4QW2A 3JCMV 2F5TX 2VUBA 1OI1A 4ELZC 5IN1A 5KE2A 4BACA 3CC2T 3M53A 2EKOA 3LW5E 3QJYA 2RJFA 4C5IA 2QTXA 5C0MA 1VQKA 4BUGA 1WQWA 3SWNA 3HPWA 3GF5A 4YTLA 1KG1A 2Y90A 3WVDB 3PMTA 3CXCS 4C92F 4M78B 2BUDA 2LCCA 2RHUA 5IT9E 4F7UA 4RKUE 4M7DB 2CZ1B 3G4SA 4PJOC 2IVWA 3OQ5A 3S3OA 2M16A 4JRKA 2HBPA 2DXCA 2QQBA 3WVEB 5GAMh 3CCVT 4L5GA 4BDZA 2O4XA 4M7AF 3A8OB 4C5EA 5GAN7 1ZHIA 1W2BS 1VQNT 2RH2A 1LJOA 4C92B 5FRNA 3OS0A 3LWHA 4C0ZA 2JZ2A 1B34B 3QPHA 4MMKA 3BW1A 1Y96B 2VGNA 1EIFA 2JVVA 3JCMh 3LLRA 2YHTA 3HHTB 3PMIA 4M75F 3RKWA 4MZMA 4OGEA 3OYLA 2M1HA 3G6ET 5GMKl 1VUBA 3BDUA 4FT4A 3LWIA 4PJOE 2RJEA 4M77C 4A4HA 3X24B 1H641 4LD6A 5FU6C 4A4KA 1NJIC 1Y7XA 4N0AA 2XIDA 2JTFA 2EIFA 4QQDA 3CC2A 4JRQA 3VUZA 1PSEA 2RI3A 2V8JA 3CCJT 2DIQA 1Y71A 1YJNA 2ZPEB 3M5AA 3T9NA 2ZZDA 3R6OA 4B9XA 4PJOD 1IREB 3N5BB 2EWNA 2YLBA 4ZTJA 4UC4A 1K73U 3CCQT 3OW2A 3NTHA 4M77E 4ZN1A 5FU7B 4QVDA 4EMHA 1YITT 3CCET 5I21A 1UEBA 3CCVA 3CXCA 4CI0C 3OYHA 3JSCA 3OSVA 1BI3A 2FYKA 2ZGWA 4XU1A 4ME7A 2G3RA 2F5KA 2P4TA 4XTVA 3CBPA 4M77D 2RK2A 2QQSA 3FEOA 3CD6T 1LNXA 2ZPBB 3CEYA 4IUQA 3CCLT 2L89A 3NTIA 3TREA 1N6AA 4FL6A 3S3NA 3G6EA 1SSFA 1VQ9T 1VQMA 5DLOA 1YJWT 4FM4B 2RK1A 3OYKA 2D9TA 4M7DG 3SB2A 4JUVA 3INZA 1QVFA 4Z02A 5HK0A 4J5YA 4C8QC 2K5FA 4JS4A 1N8RU 1QP3A 3CCJA 2OTJT 4MDWA 3CCUA 1WPYA 2HNIA 2R58A 2Y4YA 3DB3A 2DEQA 2R5MA 4PJOF 5KH6A 2ZPFB 1P92A 3FB9A 2NLUA 4QQ6A 2E64A 1X6OA 4LDUA 3L2WA 5A0DA 1LOJA 3RKYA 5GAOq 3CCQA 4NL2A 3JCMJ 2RI2A 1I5LA 4IKFA 4M78A 5GAOr 4OB3B 2DZCA 2C06A 2DVEA 1XQHA 1I8FA 5GMKj 3I56A 3CPWS 4M7DA 1N9SA 4E7KA 3LX7A 5IAYA 4PLLA 3H8ZA 1BKBA 5DM7R 1M1KU 3JB9G 1PSFA 3M57A 1BIBA 5CO7A 1VQ6A 4LDYA 3EFSA 3BDLA 1HK9A 1VQLT 2K3YA 1V29B 2OAUA 2CZ0B 4M77F 3JB9H 1B34A 3CD6A 2RB6A 3GNFB 3LH0A 3L2ZA 4IUPA 1Y96A 3ZBDA 4M78E 4A53A 3CCLA 4EMKB 3JCMX 3LGLA 4ZN3A 5GMKh 2P0PA 4N4IA 4B9WA 4A4GA 4ELYC 3CCRT 3OB9A 2PUKB 5GANj 5I2MA 4RG2A 4C0DB 3QG1A 2DXUA 3L1AA 5CQXA 3CMEA 3QXEB 3JCMc 5GAOp 3CC7A 3DLLA 1R8OB 5D6WA 2XK0A 4E7LA 3TEEA 1DJ7B 3OYMA 2LCLA 1G3YA 3QZ9B 5GANg 2XD0A 2PVGB 4IURA 2PU9B 4N4GA 4XTWA 4ZGEB 5GANh 4EPCA 1UB4A 3RMQA 4VUBA 1S72A 2VC8A 5CR2A 2OTLA 4Q5WA 4QVCA 4J6WA 3X26B 4L59A 1KQSS 2HQXA 2YRVA 4A54A 3CCMT 3QKJA 2DZ9A 4RCBA 5A0LA 1VQPT 1D3BB 5GAMd 2XDPA 3URGA 4C92G 2O01E 3OW2S 1H3ZA 3HFNA 2QQ9A 4JLGA 4MMLA 2LNVA 3SD4A 1UGPB 3SWNC 3M4YA 1KD1C 3OBWA 2JNGA 4P5NA 3JCMd 1UGRB 1M5Q1 4Y91A 3CPWA 2XDDA 1BYMA 4C8QF 2KQWA 3BY7A 4M7AG 2L5QA 2LC4A 2WSEE 2ZPIB 3CCRA 3HP9A 2CZ6B 3MO8A 5A0GA 1VQOA 1Q86C 5LJ5j 2DIGA 3G7ZA 2DPPB 3OYEA 3L2RA 1M90U 2FL7A 2H3JA 4M75G 2RJDA 4IUUA 2LQKA 4C8QB 4GLKA 4HCBA 4X9DA 2PQWA 4ZGJB 2I2LA 3M55A 5GMKe 3OYBA 1QVFS 1VIEA 5GAN8 4F7UE 3KUFA 5LJ5g 4M7AB 5KCHA 3L2QA 4BE1A 3M59A 1YJ9T 1U8RA 3I55T 3CCMA 4R56A 1OZ2A 2GQVA 3QDRB 4N0AC 2KAFA 3LYIA 4OB2B 2HQEA 3V8JA 2V8IA 2RHYA 1KC8C 3PFSA 3META 1W4SA 4C0FA 2RHZA 2MAMA 5CKFA 4LDXA 2EJGA 4M75B 4XU3A 1VIFA 3Q1JA 4JRIA 5GANf 3A8HB 1Q7YC 5GANe 3VJPA 1KQSA 3C94A 3PIPA 3GIBA 3OS2A 4KULA 4C5GA 4PNOA 5GAN6 2EJ9A 4EMGA 1VQ8T 3OYGA 4V2SA 2ZCFB 2MWPA 4EMKA 1VQ4T 2XG8D 4ZTFA 3L42A 3NFCA 1BI2A 1YIJT 3VYGA 1Y07A 1K9MC 1XTDA 2E1HA 1RL2A 2KMTA 3FIFA 5AYFA 3OYDA 5HK3A 2DK3A 3UPUA 3QJ6A 2GFAA 1VQNA 1WJRA 3A8MB 4A4EA 3C95A 4NOYA 3VUBA 2P0QA 2PVOB 5DY9A 2RO0A 3P8BB 2DKGA 2B8AA 3F70A 3H6ZA 2DTHA 2QI2A 1JBMA 4MZTA 2MMPA 4XU0A 2JTMA 3V8LA 4CRIA 3QUIA 5KE3A 1Q82C 4J83A 4FIBA 3FC3A 2V8KA 1YJ9A 3I55A 2X35A 2GF7A 2XKOC 3SFMA 3ZEHA 5GAN5 3DKMA 4PJOG 5C6SA 4JJNK 4FT2A 1BI0A 1YCYA 3FLGA 3HFOA 5D6XA 3C4SA 3PIOA 1Q86U 4F7UF 3M4GA 1Q81C 3CBOA 2Y4XA 3OMCA 3HL8A 2DO3A 3E19A 3KXTA 5LJ5f 5LJ5e 3G71T 1O75A 1K8AC 1VQ8A 2QDYB 4M78C 3CPFA 4KBMB 4GY5A 3JB9D 3RIRA 4M7DC 4LDVA 1OYXA 1YITA 4M77G 3CCEA 3X20B 1YIJA 4X34A 3J7AF 3GP8A 4PJOB 4XTUA 5FROA 3VKIA 4E47A 4OF1A 1NJIU 2DAQA 4E7IA 3X25B 4Y28E 5M9OA 5CAIA 4HCZA 4C92A 2MWOA 4XTYA 4C8QA 3PNWC 3ZFJA 5GAOm 3MP1A 3A8GB 3S6WA 3OYIA 5GANd 1X75C 2DXBA 3HRTA 2F69A 2JOYA 2RHIA 3CC4T 1VQ9A 3A5ZB 2GCXA 4BE0A 4M7DE 5CCAA 3EAEA 4J8OA 3PGGA 1YJWA 2CZ7B 2KK4A 3HKSA 2QQRA 2QEXT 4LDWA 4M7AA 3PTAA 4M77B 3MP8A 3FJPA 1VQ5T 1IZ6A 3OYYA 3QYGB 5FU6B 3P8HA 2P0KA 3CCST 4C92E 4QQGA 1K9MU 2OTJA 1NE8A 4M78D 3RUXA 5FLXE 4M75A 2DTIA 5LJ3j 1M8VA 3MEUA 4M7DD 3GOXA 4BD3A 2K4YA 3HRSA 1VQKT 2AHJB 2L3RA 4J6YA 3G71A 2EQKA 1NPPA 3MEVA 3S3MA 2QXFA 1TH7A 4DOWA 1G3TA 2LT1A 3E1SA 4O5VA 1YHQT 2XHCA 1JRIA 1Q82U 2RM4A 5LJ3g 3E9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2L A;  1MGQ A;  5GMK e;  5LJ3 h;  5GAN 8;  2VXF A;  5I21 A;  4F7U E;  1I81 A;  1WNL A;  2CGH A;  4M75 E;  4C8Q G;  2FB7 A;  3V7R A;  5LJ5 g;  3JCM b;  2FYK A;  4M7A C;  2ZGW A;  4XU1 A;  4M7A B;  5GMK m;  4XTV A;  4N0A C;  5LJ3 d;  3V8J A;  2RA2 A;  4M77 D;  3RES A;  1KQ1 A;  1LNX A;  4C8Q E;  5GAN 2;  1BIA A;  4M75 C;  2EJG A;  2E65 A;  4M75 B;  4XU3 A;  4NL3 A;  4JRI A;  5GAN f;  5GAN e;  5GAO l;  1I4K 1;  1WQ7 A;  3SB2 A;  3EFR A;  4JUV A;  3INZ A;  3GIB A;  4PNO A;  5GAN 6;  2EJ9 A;  4EMG A;  4M7A E;  4V2S A;  4J5Y A;  4M78 F;  4C8Q C;  4X9C A;  3JB9 F;  3RER A;  2EAY A;  4EMK A;  2K57 A;  4C92 D;  4C8Q D;  4JLI A;  3JB9 I;  4M7D F;  3BFM A;  1WPY A;  2HNI A;  3AHU A;  5GAM j;  4J6X A;  2DEQ A;  4PJO F;  4XQ3 A;  2E1H A;  3FB9 A;  3FIF A;  2JN0 A;  2E64 A;  2EJF A;  4HA8 A;  1LOJ A;  3RKY A;  5LJ5 h;  4NOY A;  3QHS A;  1X01 A;  4NL2 A;  5GAO q;  3JCM J;  1I5L A;  4M7A D;  3RKX A;  4M78 A;  5DY9 A;  5GAO n;  2DZC A;  5GAO r;  2DVE A;  2DKG A;  1I8F A;  5GMK j;  4M7D A;  3V8K A;  1N9S A;  5GAM g;  2DTH A;  1JBM A;  4PJO A;  4XU0 A;  5LJ5 d;  3V8L A;  4M78 G;  3QUI A;  3JB9 G;  4M75 D;  4XTX A;  1BIB A;  1HXD A;  5GAN 4;  2E10 A;  4M7D G;  3EFS A;  2RD1 A;  1HK9 A;  2YLC A;  4M77 F;  1N9R A;  5GAN 5;  4PJO G;  3JB9 H;  1B34 A;  2RB6 A;  3L2Z A;  1YCY A;  3HFO A;  3JCM g;  1Y96 A;  3JCM V;  5GMK i;  4M78 E;  4A53 A;  4EMK C;  2DJZ A;  4EMK B;  3V7C A;  3M4G A;  4F7U F;  3JCM X;  5LJ3 f;  5GMK h;  5LJ3 e;  5GAN j;  2QTX A;  1WQW A;  3SWN A;  5LJ5 f;  2DXU A;  5LJ5 e;  3L1A A;  2Y90 A;  4M77 A;  2E41 A;  3JCM c;  5GAO p;  4C92 F;  4M78 C;  4M78 B;  4XTZ A;  4XU2 A;  3JB9 D;  3RIR A;  3V7S A;  4F7U A;  4M7D C;  4M7D B;  2VXE A;  4M77 G;  5GAN g;  4PJO C;  4PJO B;  4XTW A;  4XTU A;  4JRK A;  5GAN h;  5GAM h;  4F7U G;  2VC8 A;  4M7A F;  5GAN 7;  4QVC A;  4J6W A;  1LJO A;  4C92 B;  5CAI A;  4C92 A;  4XTY A;  4C8Q A;  4MMK A;  1B34 B;  3VU3 C;  4A54 A;  3JCM e;  3BW1 A;  5GAO m;  2DZ9 A;  4RCB A;  4HT9 A;  1Y96 B;  5GAN d;  1D3B B;  5GAM d;  1U1T A;  1D3B A;  3JCM h;  2YHT A;  3JCM W;  1KQ2 A;  4M75 F;  3RKW A;  4C92 G;  4M7D E;  3HFN A;  3PGG A;  5GMK l;  4MML A;  2DXT A;  3BDU A;  3SWN C;  3SWN B;  4M7A A;  4PJO E;  5GAN 3;  2DTO A;  4M77 C;  4M77 B;  1U1S A;  3JB9 J;  1H64 1;  3FJP A;  3JCM d;  3QSU A;  1M5Q 1;  4N0A A;  4Y91 A;  3JCM P;  4C92 E;  4C8Q F;  3BY7 A;  4M7A G;  4F7U B;  5LJ3 j;  4M78 D;  3RUX A;  1M8V A;  4M75 A;  2DTI A;  3JCM Q;  4WF2 A;  5GAM f;  4M7D D;  5GAM e;  3QO3 A;  4HT8 A;  5LJ5 j;  4RCC A;  4PJO D;  4DQ2 A;  4J6Y A;  3HSB A;  4M75 G;  2EWN A;  2YLB A;  4C92 C;  4OP0 A;  1TH7 A;  4C8Q B;  4M77 E;  4X9D A;  3JCM f;  1JRI A;  4QVD A;  2RM4 A;  4EMH A;  5LJ3 g; 
#chains in the Genus database with same CATH topology
 1WIE A;  2K5L A;  5GJW B;  3G4S T;  1Q86 R;  5LJ3 h;  2VXF A;  4RTY A;  4C8Q G;  3JCM b;  2CDT A;  3MPU B;  1IRX A;  5GMK m;  1IXD A;  1PKS A;  1JJ2 A;  1ZBX A;  1QVG A;  2KBT A;  2XI9 A;  2X4X A;  2HAX A;  1IO6 A;  5GAO l;  3EFR A;  3CCS A;  1NYG A;  4KT0 E;  3EH2 A;  5J39 A;  2QGF B;  2BIV A;  4M78 F;  3CCS Q;  4X9C A;  1NEG A;  2CS7 A;  4QVZ A;  4M7D F;  3IQL A;  1SSH A;  5GAM j;  4J6X A;  3GLX A;  2EQJ A;  3ER0 A;  5IXB A;  2XDB A;  2D0Q B;  1UGS B;  2FHD A;  2JT4 A;  1Z9Q A;  5GAO n;  1U5S A;  1K9M R;  1WI7 A;  1N8R C;  2HKQ B;  3MEA A;  4KH0 B;  3UT1 A;  2YLC A;  4OMN A;  4DEX A;  4LUE A;  2XU8 A;  4CC2 A;  4HVW A;  3EFO B;  5CKH A;  1Q82 R;  5LJ3 e;  4JRP A;  2LRQ A;  4J9G A;  4C0D C;  3VS6 A;  4XAX B;  3LGF A;  3OYF A;  1M1K C;  4M77 A;  3TCJ A;  3MCA B;  2A3L A;  5HY6 A;  2BKD N;  4ZGD B;  5ECA A;  2E5Q A;  1TUG B;  4FSX A;  1KHC A;  4AG1 C;  1WHM A;  4HT9 A;  4E6R A;  1WYX A;  4KUI A;  3VRZ A;  1EFN A;  2EKH A;  4BB7 A;  1JB0 E;  1NYF A;  1OUL A;  2MK5 A;  2DXT A;  3SWN B;  2DTO A;  3JB9 J;  3QSU A;  1GFC A;  3JCM P;  4KGZ B;  1ZLM A;  5CK9 A;  1K1Z A;  4E7Z A;  1JJ2 S;  3QO3 A;  1QVG S;  1XOV A;  2O4X B;  2EBP A;  3HSB A;  2V26 A;  7AT1 B;  3REB B;  2CRE A;  3JCM f;  5A2Q E;  1CKB A;  2ZPG B;  2RQR A;  1R0B G;  2JW4 A;  2J06 A;  2OTL T;  1M4Z A;  1ARK A;  1ZQ1 A;  1GL5 A;  3REA B;  1KQ1 A;  1QWE A;  1SG5 A;  2D1X A;  2E65 A;  2R57 A;  1I4K 1;  4ATO A;  1WQ7 A;  1J3T A;  2RI5 A;  2WSF E;  4PJJ A;  5HKC A;  2DRM A;  1K73 R;  4M7A E;  3JB9 F;  2K57 A;  4IUV A;  1VQO T;  4XQ3 A;  1VQ7 A;  2M9U A;  2MOX A;  1VQ7 Q;  1ZA1 B;  2X51 A;  2NUT A;  3M0P A;  1Q81 U;  4HVU A;  3I9Q A;  4KH1 B;  2J7I A;  1QW1 A;  4M78 G;  2M02 A;  4M75 D;  2E70 A;  2LX9 A;  4XTX A;  2HL3 A;  4M7D G;  2X4W A;  5I11 A;  5CVI A;  2A36 A;  2OI3 A;  5KE2 A;  1OI1 A;  1PRM C;  3CC2 T;  3M53 A;  4CC7 A;  4JZ4 A;  5I22 A;  2QTX A;  1VQK A;  1WQW A;  2DER A;  1KG1 A;  4YTL A;  1WHK A;  1VQK Q;  1RLQ C;  2W0Z A;  3PMT A;  3CXC S;  4C92 F;  1RUW A;  2LCC A;  1YWO A;  1C1A A;  4F7U A;  4RKU E;  1SF9 A;  5KYW A;  2IVW A;  2M16 A;  2HBP A;  2QQB A;  5GAM h;  1GCQ C;  3QDF A;  4M7A F;  2I0N A;  1B34 B;  2DYI A;  1MMN A;  1Y96 B;  1FMW A;  2LJ0 A;  2HZY A;  3RKW A;  1PCX A;  2HDA A;  3OYL A;  4FYW B;  1VUB A;  1UJY A;  1H64 1;  1R77 A;  4A4K A;  1NJI C;  1Y7X A;  2K6D A;  2NUP B;  4RTX A;  4PFO A;  4JRQ A;  2V8J A;  1Y71 A;  5IXF A;  3R6O A;  4B9X A;  1RAC B;  2KE9 A;  2LMJ A;  2EYZ A;  4M77 E;  4ZN1 A;  5FU7 B;  5I21 A;  1SHG A;  1MNE A;  3JSC A;  3OSV A;  3EG9 A;  4CC3 A;  2FPF A;  2ZGW A;  2M51 A;  4R0K A;  2DL4 A;  2RK2 A;  3CD6 T;  4J9E A;  4GBQ A;  2L89 A;  3TRE A;  3CCL T;  1N6A A;  1VQM A;  1W2B P;  1SSF A;  4LXC A;  3M0Q A;  2YRD A;  2RK1 A;  4FM4 B;  1VQM Q;  2BTT A;  2YRC A;  5KYX A;  2CP0 A;  1YWP A;  2Y4Y A;  2R5M A;  2K7A A;  2NLU A;  1X6O A;  2CP6 A;  1LOJ A;  1FMK A;  4NL2 A;  5D7U A;  4F16 A;  2DVE A;  2AT1 B;  1I8F A;  1ABO A;  1BK2 A;  4E7K A;  4PLL A;  3JB9 G;  3M57 A;  5CO7 A;  1VQ6 A;  3EFS A;  3BDL A;  4M77 F;  3JB9 H;  1VQ6 Q;  2GQI A;  5KYY B;  1D09 B;  2Z0W A;  2P0P A;  3CCR T;  2PUK B;  1QCF A;  2EVR A;  4RG2 A;  4C0D B;  4E7S A;  3VS7 A;  5CQX A;  3CME A;  1F1B B;  3QXE B;  1R8O B;  1UG1 A;  2XK0 A;  1WX6 A;  2FRW A;  2XD0 A;  2PVG B;  4IUR A;  2IIM A;  4ZGE B;  2QAS A;  1UB4 A;  3RMQ A;  3X26 B;  4L59 A;  1VYV A;  1WHG A;  4A54 A;  5A0L A;  4J9C A;  2CSQ A;  3URG A;  4C92 G;  4J9I A;  3HFN A;  2QQ9 A;  4JLG A;  2HMA A;  2LNV A;  1OU8 A;  3SD4 A;  4Z88 A;  1OPL A;  4P5N A;  2JNG A;  1C6V X;  2DEU A;  2VAS A;  2KQW A;  3BY7 A;  4M7A G;  2L5Q A;  5A0G A;  4AT1 B;  1Q86 C;  1I5O B;  3G7Z A;  2EQI A;  1HSQ A;  4C8Q B;  4GLK A;  3CQT A;  2PQW A;  1XJW B;  2I2L A;  9ATC B;  1RAF B;  1NG2 A;  1WXT A;  3RDV A;  4F7U E;  4ZNX A;  4JPB W;  1AWW A;  4R56 A;  4N0A C;  4OB2 B;  1YP5 A;  4FYX B;  2F1L A;  2O9V A;  2V8I A;  3PFS A;  3MET A;  1VQP Q;  1AVZ C;  1PD0 A;  3Q1J A;  1Q7Y C;  5GAN f;  3A8H B;  3VJP A;  1KQS A;  3C94 A;  1D1A A;  3GIB A;  3OS2 A;  1M8M A;  4EMG A;  3A98 A;  1TSF A;  4ZTF A;  3NFC A;  3EG2 A;  1YIJ T;  1Y07 A;  1K9M C;  1OOT A;  5AYF A;  1SRL A;  2GFA A;  4A4E A;  5HCK A;  2RO0 A;  2DKG A;  2NWM A;  3EGD A;  2JTM A;  3V8L A;  2HCK A;  3QUI A;  1Q82 C;  2ROT A;  1YJ9 A;  5KYN A;  3I55 A;  1YJ9 Q;  3JV3 A;  3I55 Q;  2RQW A;  3HFO A;  4FT2 A;  3FLG A;  3PIO A;  2KT1 A;  3C4S A;  2HQH A;  4F7U F;  2EW3 A;  3HL8 A;  3E19 A;  2O2O A;  1ZSZ A;  5LJ5 e;  3CPF A;  4GY5 A;  2OX7 A;  2LNH B;  1OYX A;  4M77 G;  3X20 B;  1MMG A;  3GP8 A;  4XTU A;  4E47 A;  1YNZ A;  2D8H A;  3A8G B;  3S6W A;  3GBQ A;  3A5Z B;  3EAE A;  4J8O A;  1YJW A;  4LDW A;  3PTA A;  1YJW Q;  2FEI A;  2RQT A;  3OYY A;  4AFZ C;  2FPE A;  3P8H A;  2OTJ A;  5LJ3 j;  4M78 D;  5FLX E;  2DTI A;  2OTJ Q;  4M7D D;  1VQK T;  3HRS A;  2F5K A;  1UE9 A;  1NEB A;  3P8D A;  4QKU A;  3UWN A;  2X4Y A;  2LDM A;  3OYJ A;  2LQW A;  1JJ2 P;  3AT1 B;  1K73 C;  1M1F A;  4HXJ A;  3NPF A;  1M30 A;  3EG1 A;  4HKE A;  2VGM A;  2OJ2 A;  2NUZ A;  2DD5 A;  5IHN A;  3CMA T;  1NJI R;  2YSQ A;  1TU0 B;  2EFI A;  1YI2 T;  3NMZ C;  4RMO A;  1H92 A;  3QII A;  4MZP A;  3QHS A;  1X01 A;  3M58 A;  1YHQ A;  2DLP A;  3HTR A;  4Z89 A;  1WA7 A;  2KDS A;  4LE9 A;  2RJC A;  2CT3 A;  2GNC A;  2QQA A;  1YHQ Q;  1W70 A;  4PLI A;  1GFD A;  4PJO A;  1TWB A;  1MMA A;  1BCO A;  3QZ5 B;  2RHX A;  3VRY A;  3QBY A;  3JCM g;  1U06 A;  3DB4 A;  2DJZ A;  3V7C A;  4OGC A;  1M2V B;  1VQM T;  2KEA A;  3EG0 A;  4R55 A;  1N27 A;  4C0G A;  2ATC B;  1Q81 R;  4XU2 A;  1JO8 A;  1BU1 A;  2DA9 A;  3ME9 A;  2FPD A;  3L2U A;  2JM8 A;  1KD1 U;  3G1J A;  4F7U G;  2EYY A;  3OYC A;  5DLQ E;  1M3B A;  2ZPH B;  2P4R A;  4IUT A;  1C0M A;  1D3B A;  4OMF B;  1OU9 A;  4D6W A;  1OX9 A;  5GAN 3;  1VQ6 T;  1WHH A;  3RBB B;  3VS0 A;  2QA4 T;  1QQJ A;  2G6F X;  1AHJ B;  5GAM f;  2VKN A;  2MF2 A;  2C0I A;  2X3X D;  5FW9 A;  3UDC A;  3CME T;  4DA4 A;  1KC8 U;  1VYU A;  4JJC A;  2IPO B;  2YT6 A;  1ZUU A;  4JS5 A;  4PKC C;  3OMG A;  5J26 A;  2VYT A;  3X28 B;  3OYA A;  2JTE A;  5CKD A;  2L3P A;  3L2V A;  4MDX A;  4LD9 K;  1D0Z A;  1M3C A;  4C5H A;  4M75 C;  2GBQ A;  4HCC A;  4BI8 B;  5CQY A;  2O9S A;  2L3Q A;  1PHT A;  4RG8 A;  1WJQ A;  1UHF A;  2DMO A;  5FU7 C;  4C92 D;  4JLI A;  4J9F A;  1QLY A;  3AHU A;  4XK8 E;  4BDY A;  3M56 A;  2L8D A;  1ZUY A;  2M0O A;  3RMS A;  2RN8 A;  4M7A D;  1UDL A;  2K2M A;  1BI1 A;  1KJW A;  4AFU C;  5LJ5 d;  1R0C B;  2K3X A;  1G3W A;  5IHI A;  1K8A U;  5FRM A;  1GBR A;  3C0C A;  2X3W D;  1Q7Y R;  1AZG B;  2LP5 A;  4J9D A;  4EIK A;  2QK0 A;  1TUD A;  3SWN A;  1I0C A;  3GF5 A;  3HPW A;  1BB9 A;  2Y90 A;  3SHW A;  1UJ0 A;  4F04 B;  2DXC A;  2VB6 A;  4L5G A;  2O4X A;  4C5E A;  5GAN 7;  1ZHI A;  4C92 B;  1E7O A;  3BW1 A;  4RTV A;  1D1C A;  2KRS A;  3KFV A;  5FWC A;  1M27 C;  3LLR A;  2QYZ A;  4MZM A;  2M1H A;  3G6E T;  5GMK l;  4PJO E;  2RJE A;  4A4H A;  4QQD A;  3VUZ A;  3CCJ T;  2HEQ A;  2ZPE B;  3T9N A;  2ROL A;  3SEM A;  1WLP B;  2YLB A;  1FYN A;  4ZTJ A;  3CCQ T;  3FJ5 A;  4WTO B;  4F17 A;  3CXC A;  4JZ3 A;  3CCV A;  2KYB A;  1BI3 A;  3CCV Q;  2AK5 A;  4XTV A;  1RLP C;  3CBP A;  4M77 D;  3FEO A;  1LNX A;  2ZPB B;  3O5Z A;  1IB8 A;  1X27 A;  2SRC A;  5DLO A;  1YJW T;  4C8Q C;  1QP3 A;  1ZA2 B;  2OTJ T;  4AG2 C;  2R58 A;  2A08 A;  2DEQ A;  4PJO F;  3FB9 A;  2L2P A;  5A0D A;  3RKY A;  1CSK A;  4IKF A;  2AKK A;  5GAO r;  4OB3 B;  2DZC A;  2C0T A;  3I56 A;  3CPW S;  1YIT Q;  5IAY A;  3M0S A;  3I56 Q;  1BKB A;  3D7S B;  1BIB A;  4LDY A;  4LNP A;  3TSZ A;  2K3Y A;  2CZ0 B;  2KI7 A;  1B34 A;  1Q95 G;  5L23 A;  1Y96 A;  2ED0 A;  2AIR B;  5AT1 B;  2EPD A;  3QG1 A;  2L3S A;  1K9A A;  3LH5 A;  3CC7 A;  3DLL A;  2CH4 W;  3CC7 Q;  3TEE A;  2K3B A;  5GAN g;  4XTW A;  2RNA A;  4QT7 A;  2ENM A;  2QTV A;  2CH4 A;  4QVC A;  2YRV A;  2DM1 A;  2DZ9 A;  1WHJ A;  1UFF A;  1TG0 A;  2XDP A;  3UA6 A;  1B3Q A;  3OBW A;  2E4H A;  2HKN A;  1BYM A;  2LC4 A;  1HJD A;  2ZPI B;  2CZ6 B;  4GLM A;  2RQU A;  5LJ5 j;  3OYE A;  3L2R A;  1M90 U;  5IH2 A;  2H3J A;  1KSW A;  2RJD A;  2LQK A;  5GAN 8;  3RR6 A;  2VWF A;  1W6X A;  4A63 B;  2F2X A;  3L2Q A;  3M59 A;  4CC4 B;  1PC0 A;  2C0O A;  3CCM A;  1OZ2 A;  3QDR B;  4LDX A;  2D0N A;  3V8J A;  3CCM Q;  1W4S A;  2KRO A;  4C0F A;  2EJG A;  4M75 B;  1YCS B;  1JQQ A;  1WZO A;  2LZ6 B;  1LVK A;  1KQS P;  3PIP A;  1WXB A;  1WDX A;  5GAN 6;  2EJ9 A;  5KYY A;  1VQ8 T;  4V2S A;  4IIM A;  3OW2 P;  2FO0 A;  1BI2 A;  1RL2 A;  3QJ6 A;  1VQN A;  1WJR A;  2CUD A;  1B07 A;  1VQN Q;  5DY9 A;  3P8B B;  1PKT A;  2O31 A;  3H6Z A;  2DRK A;  1YFN A;  2KT8 A;  1JBM A;  2QI2 A;  2MMP A;  1M2O A;  4J83 A;  2V8K A;  3TU4 K;  2GF7 A;  3H0I A;  3ZEH A;  3DKM A;  4PJO G;  5C6S A;  1QVF P;  5D6X A;  1GCP A;  1Q86 U;  3M4G A;  1Q81 C;  3CBO A;  2Y4X A;  1KK7 A;  2D8J A;  2DO3 A;  1D0X A;  1EX4 A;  2QDY B;  4M78 C;  4M7D C;  2LX7 A;  3CCE A;  1QCO A;  4X34 A;  3VKI A;  3CCE Q;  2DAQ A;  3EHQ A;  4Y28 E;  5M9O A;  4XTY A;  4C8Q A;  3PNW C;  3ZFJ A;  3MP1 A;  5GAN d;  2DXB A;  2F69 A;  2RHI A;  1KFZ A;  4BE0 A;  3PGG A;  2CZ7 B;  3HKS A;  1K76 A;  3MP8 A;  3CCS T;  2P0K A;  1K9M U;  3RUX A;  1NBE B;  2LCS A;  3PVL A;  3GOX A;  1KD1 R;  3G71 A;  2PTK A;  5FWB A;  1B7T A;  1JEG A;  2QXF A;  3G71 Q;  1TH7 A;  4DOW A;  4O5V A;  1JRI A;  1Q82 U;  3E9G A;  2CP7 A;  2DVJ A;  3KBG A;  4LUD A;  4M75 E;  2CGH A;  2RF0 A;  1LCK A;  2QDL A;  1G5V A;  3M9Q A;  1AEY A;  1X2Q A;  1QKW A;  2LVM A;  3JAM E;  4PK4 A;  4EDU A;  1G3S A;  1RAG B;  1AD5 A;  2KXC A;  2H3E B;  4AFS C;  3CC4 Q;  4KGV B;  5KYX B;  4TVR A;  8AT1 B;  3VV0 A;  1VQ5 A;  1KC8 R;  1VOM A;  4OMO A;  1M1G A;  1VQ5 Q;  3RER A;  1IHW A;  4PL6 A;  5CKE A;  1H3H A;  2E12 A;  6AT1 B;  2X4J A;  4PJN A;  2JXB A;  1LPL A;  3M0R A;  3A1P A;  4HA8 A;  2IG0 A;  5LJ5 h;  1K0X A;  3SDZ A;  3NHN A;  5CKB A;  1VQP A;  5GAM g;  5D6Y A;  1FX7 A;  1GCQ A;  3THK A;  1FWZ A;  1JU5 C;  2WSC E;  2HD0 A;  1N9R A;  3A8L B;  3E2U A;  3H0H A;  1RI0 A;  2JMA A;  4EMK C;  2LTO A;  3JRZ A;  2FZK B;  5LJ3 f;  3WXM B;  2J6O A;  2FVU A;  2E41 A;  1FXX A;  4OML A;  4XTZ A;  4FW2 A;  3V7S A;  2EGA A;  2VXE A;  2EQM A;  3PT9 A;  1WXU A;  2OAW A;  3QYH B;  2CSI A;  1QVP A;  2A37 A;  4RUG A;  3I56 T;  1U1T A;  2EGC A;  1KQ2 A;  2KY9 A;  1TS9 A;  2CYZ B;  4JDS A;  4BY6 B;  1U1S A;  2VV5 A;  1YBY A;  1VQ4 A;  1UGQ B;  2JJ9 A;  1W2B A;  1T3S A;  2EYQ A;  1VQ4 Q;  4E7J A;  4RCC A;  3FRN A;  1VQ7 T;  1WJS A;  1YN8 A;  3CC7 T;  4C92 C;  2LT4 A;  3J80 E;  3JCM e;  3EGX B;  1KHI A;  1ZUK A;  3V7R A;  4M7A C;  1D1B A;  2MI6 A;  3UAT A;  4PFZ A;  4DOV A;  4HCK A;  3RES A;  4C8Q E;  5GAN 2;  2K5I A;  4NL3 A;  1EZZ B;  3FDR A;  2E6N A;  2PUO B;  3BFM A;  1M2V A;  4OB0 B;  2FG0 A;  1RAA B;  2KYM A;  2EJF A;  2PVD B;  2BE7 D;  2XIC A;  4L6V 5;  3RKX A;  5KCO A;  2V1R A;  1QVG P;  3UF4 A;  4N4H A;  5L8R E;  1VA7 A;  1HXD A;  2DBK A;  3OBY A;  3OS5 A;  2WAC A;  2QEX A;  1K4U S;  3MP6 A;  3NGP A;  4O6J A;  4II1 A;  2QEX Q;  4QW2 A;  3JCM V;  4ELZ C;  5IN1 A;  4BAC A;  2P84 A;  3LW5 E;  3QJY A;  2RJF A;  4C5I A;  3WVD B;  1TOV A;  4M78 B;  2BUD A;  1W1F A;  2CZ1 B;  4M7D B;  3OQ5 A;  2KRM A;  2QGG A;  4JRK A;  3R6N A;  3WVE B;  1VQO Q;  2RMO A;  1PWT A;  1TXQ A;  3A8O B;  4OMM A;  1W2B S;  1VQN T;  2RH2 A;  1LJO A;  5FRN A;  3OS0 A;  3LWH A;  4C0Z A;  2JZ2 A;  4MMK A;  2VGN A;  3EGU A;  4PFP A;  2YHT A;  3HHT B;  3PMI A;  1PM3 A;  4F14 A;  4OGE A;  4ANJ A;  4PJL A;  2MYS A;  4M77 C;  1MV3 A;  3X24 B;  4LD6 A;  1RAI B;  4N0A A;  1SEM A;  2CUB A;  1ZBJ A;  3CC2 A;  2L0A A;  1YJN A;  2DIQ A;  3CC2 Q;  3M5A A;  1YJN Q;  4PJO D;  1IRE B;  3N5B B;  3NTH A;  4QVD A;  4EMH A;  4D8K A;  3CCE T;  2QAZ A;  3CXC P;  1UEB A;  4CI0 C;  3OYH A;  1PRL C;  2FYK A;  4XU1 A;  4ME7 A;  2G3R A;  1WFW A;  2QQS A;  1V76 A;  2F2V A;  1SRM A;  4IUQ A;  3CEY A;  3S3N A;  3OYK A;  2D9T A;  3SB2 A;  3INZ A;  1AWJ A;  4M4Z A;  4J5Y A;  2K5F A;  1N8R U;  1X6G A;  3CCU A;  3DB3 A;  5KYU B;  2ZPF B;  1P92 A;  1RAD B;  3CCU Q;  4QQ6 A;  5GAO q;  1X69 A;  2YDL A;  2C06 A;  1XQH A;  5EC7 A;  1M1K U;  1HK9 A;  1AZE A;  1V29 B;  2OAU A;  2VVK A;  2HL5 C;  1AWO A;  3CD6 A;  2RB6 A;  2ABL A;  2DIL A;  3GNF B;  3L2Z A;  3ZBD A;  4M78 E;  1UTI A;  4A53 A;  4EMK B;  3CCL A;  3CD6 Q;  3EFO A;  3LGL A;  5GMK h;  3VS2 A;  3CCL Q;  4B9W A;  3QWX X;  4A4G A;  5I2M A;  1MMD A;  2DXU A;  2FZC B;  5GAO p;  4Y92 A;  1G8X A;  4E7L A;  1ZSG A;  1DJ7 B;  3OYM A;  4N4G A;  2E3I A;  5GAN h;  4EPC A;  4VUB A;  1S72 A;  5CR2 A;  4J6W A;  1S72 Q;  4OMP A;  2ESW A;  1QMC A;  1VQP T;  1D3B B;  3VS3 A;  1H3Z A;  1UGP B;  2DFU A;  3M4Y A;  4RTU A;  2MIO A;  1KD1 C;  3CPW A;  3JCM d;  1UGR B;  1M5Q 1;  1RI9 A;  1OV3 A;  3CCR A;  4OMQ A;  3CCR Q;  2FL7 A;  3PE0 A;  2SEM A;  1OEB A;  2RQV A;  3OYB A;  1K0S A;  5GMK e;  1RAB B;  1VIE A;  3VS5 A;  3KUF A;  2CP5 A;  2AZS A;  4M7A B;  5KCH A;  1BBZ A;  1YJ9 T;  1A0N B;  3I55 T;  2GQV A;  2HQE A;  3EG3 A;  1KC8 C;  1IGU A;  2COZ A;  1VIF A;  5GAN e;  4KUL A;  4FYV B;  4C5G A;  2QG9 B;  1PD1 A;  2BZ8 A;  1VQ4 T;  2XG8 D;  1KIK A;  3L42 A;  1PG5 B;  3M0U A;  1XTD A;  2E1H A;  3UPU A;  3I35 A;  3A8M B;  4NOY A;  2PVO B;  2BZX A;  3F70 A;  1NM7 A;  4WCI A;  3MKD A;  2DTH A;  4CRI A;  4XU0 A;  4FIB A;  3SFM A;  3RNJ A;  5GAN 5;  1Y0M A;  1RAE B;  1YCY A;  5LJ5 f;  4AFQ C;  2K79 A;  1ZX6 A;  4ORZ A;  1K8A C;  2YUO A;  4KBM B;  3RIR A;  1YIT A;  2DL8 A;  1YIJ A;  3J7A F;  2F2W A;  4K11 A;  5FRO A;  2PNI A;  1YIJ Q;  4OF1 A;  1NJI U;  1AOJ A;  3X25 B;  5CAI A;  2MWO A;  2YXY A;  1IGQ A;  1X75 C;  1H8K A;  1VQ9 A;  2GCX A;  2J05 A;  2FRY A;  2NYS A;  5CCA A;  2DBM A;  1VQ9 Q;  2KK4 A;  2QQR A;  2QEX T;  4E2F B;  4M77 B;  1AT1 B;  3FJP A;  2A28 A;  4C92 E;  4QQG A;  2NUP A;  1M8V A;  4M75 A;  2KXD A;  3MEU A;  4BD3 A;  4J6Y A;  3MEV A;  1NPP A;  3S3M A;  4DBR A;  2MCN A;  3UA7 A;  1YHQ T;  1G3T A;  2LT1 A;  3E1S A;  2XHC A;  2RM4 A;  5LJ3 g;  1I81 A;  1WNL A;  2AZV A;  2LQN A;  3CBM A;  3VS4 A;  1QKX A;  1VQL A;  3OSS C;  4BY6 C;  2CKK A;  2LQ8 A;  1VQL Q;  2RA2 A;  2X9H A;  2YUQ A;  2GFU A;  3M54 A;  4FYY B;  1U3O A;  1JXO A;  1NLO C;  3J81 E;  3MEW A;  5J3B A;  2KSS A;  4J7I A;  4BI4 A;  3JB9 I;  1YJN T;  3H0F A;  1Z9Z A;  2JN0 A;  2V1Q A;  2CP2 A;  4JJN K;  1XNI A;  2DE0 X;  4J7F A;  3MHX A;  1O9S A;  4J9H A;  4OVA A;  3ULR B;  4BI3 A;  1GBQ A;  5EG2 A;  2B86 A;  1NZ9 A;  2E10 A;  3O8V A;  5GMK i;  1UEC A;  2JS0 A;  1V1C A;  3CMA A;  1M9S A;  2JM9 A;  4FU6 A;  3OA6 A;  3CMA Q;  2NUT B;  3ZL7 C;  1YI2 A;  1HYO A;  3HRU A;  1GXI E;  2K2V A;  1YI2 Q;  4BE2 A;  3CCU T;  4KUD K;  3VU3 C;  1WGS A;  3OYN A;  4AMC A;  2A7Y A;  3JCM W;  5IHK A;  2JMC A;  1CKA A;  1ZSZ C;  3ASK A;  2E6Z A;  5LL6 S;  3H9N A;  4B6M A;  1OX8 A;  3E9F A;  2R5A A;  4F7U B;  1NPR A;  3I5S A;  3JCM Q;  2XMF A;  4J9B A;  4WF2 A;  5KYW B;  2DF6 A;  4NS5 A;  5GAM e;  2ZAE A;  3H41 A;  4HT8 A;  2COY A;  2HSE B;  4DQ2 A;  4OP0 A;  1VYT A;  3I5R A;  3OYD A;  3NTK A;  4A4F A;  1Q7Y U;  1ABQ A;  1QP2 A;  1MGQ A;  5I2S A;  2FB7 A;  2JUF A;  2DL3 A;  1OZ3 A;  1S72 T;  3C12 A;  1M90 C;  2DYB A;  5LJ3 d;  2W10 A;  3GNG A;  2JS2 A;  1BIA A;  2H8H A;  4HVV A;  3DLM A;  1HD3 A;  1UGV A;  1S1N A;  3VYH B;  4KGX B;  2QA4 A;  4PJM A;  2EAY A;  1MHN A;  2DD4 A;  4C8Q D;  2QA4 Q;  3GPL A;  3MJX A;  5CIU A;  3OY9 A;  3EG9 B;  2LJ1 A;  4E7H A;  1G2B A;  2KRN A;  3CME Q;  2CP3 A;  1SKU B;  1QWF A;  3V8K A;  3CC4 A;  4OB1 B;  5GAN 4;  2DNU A;  3OS1 A;  2RD1 A;  2KVQ G;  2EQU A;  1N8R R;  2F5T X;  2VUB A;  2EKO A;  4FW1 A;  2MPX C;  5C0M A;  3EH1 A;  4BUG A;  2O88 A;  4FCY A;  3M0T A;  2RHU A;  5IT9 E;  2HBW A;  3G4S A;  4PJO C;  1MUZ A;  3S3O A;  3G4S Q;  1AWX A;  1M1K R;  4BDZ A;  2E3H A;  4KRT A;  3CCV T;  4ESR A;  3QPH A;  2HSP A;  2M0Y A;  1D0Y A;  1EIF A;  2JVV A;  3JCM h;  3EGX A;  4M75 F;  3BE3 A;  3BDU A;  4FT4 A;  3LWI A;  2GTO A;  1GRI A;  5FU6 C;  1T0J A;  2XID A;  2JTF A;  2EIF A;  1PSE A;  2RI3 A;  1MV0 B;  3TSW A;  1E6H A;  1ACM B;  1I07 A;  2ZZD A;  4D8D A;  1K8A R;  2EWN A;  1K73 U;  4UC4 A;  3OW2 A;  2KNB B;  2YUN A;  3QWY A;  1YIT T;  2GGR A;  8ATC B;  1Y57 A;  5GJV B;  2P4T A;  2J6F A;  4FSS A;  3NTI A;  4FL6 A;  3G6E A;  1I1J A;  1VQ9 T;  1FMV A;  2K9G A;  3G6E Q;  4JUV A;  1QVF A;  4Z02 A;  5HK0 A;  1TTH B;  4JS4 A;  3CCJ A;  4MDW A;  1WPY A;  2HNI A;  3CCJ Q;  5KH6 A;  4DBQ A;  2E64 A;  4LDU A;  3L2W A;  2YUP A;  3CCQ A;  3JCM J;  1I5L A;  2RI2 A;  2EYW A;  4M78 A;  3CCQ Q;  2COW A;  5GMK j;  4M7D A;  2KR3 A;  1N9S A;  3LX7 A;  3H8Z A;  5DM7 R;  1PSF A;  2KGT A;  1SPK A;  1QCN A;  1VQL T;  1MND A;  2YWW A;  3LH0 A;  4IUP A;  4LN2 A;  2J6K A;  1SHF A;  1G83 A;  3JCM X;  4ZN3 A;  4DEY A;  4N4I A;  5GAN j;  2A0F B;  2LJ3 A;  4ELY C;  3OB9 A;  2DL7 A;  3L1A A;  1IHV A;  3JCM c;  4JJB A;  5D6W A;  4RTZ A;  2DJQ A;  1WHL A;  4RTT A;  2LCL A;  1G3Y A;  3QZ9 B;  1RAH B;  2PU9 B;  3EGD B;  2E5K A;  2VC8 A;  4RTW A;  2OTL A;  4Z8A A;  4Q5W A;  1KQS S;  2HQX A;  2OTL Q;  3CCM T;  3QKJ A;  4RCB A;  5GAM d;  2ED1 A;  2EGE A;  2CT4 A;  2O01 E;  3OW2 S;  1ZSZ B;  4MML A;  3SWN C;  2PZ1 A;  3CPW P;  2RPN A;  4Y91 A;  2XDD A;  4C8Q F;  2WSE E;  3HP9 A;  3MO8 A;  1VQO A;  2DET A;  2DIG A;  2DPP B;  3TQ7 P;  4M75 G;  4IUU A;  2ECZ A;  4HCB A;  4X9D A;  1N5Z A;  4ZGJ B;  3M55 A;  1QVF S;  2AKL A;  4JJD A;  5KYU A;  1X6B A;  5LJ5 g;  1JXM A;  1NLP C;  4BE1 A;  1U8R A;  2D6F A;  2KAF A;  3LYI A;  2RHY A;  3VS1 A;  1OQK A;  2RHZ A;  2MAM A;  5CKF A;  4XU3 A;  1PNJ A;  1UHC A;  4JRI A;  2BE9 B;  4IIO A;  1TUC A;  4PNO A;  1OPK A;  3OYG A;  2ZCF B;  2MWP A;  4EMK A;  1T3L A;  3PVQ A;  3VYG A;  3FIF A;  2KMT A;  1UUE A;  5HK3 A;  2DK3 A;  4X1V A;  3C95 A;  2DL5 A;  3VUB A;  2P0Q A;  2B8A A;  4MZT A;  5KE3 A;  3FC3 A;  1X2K A;  2X35 A;  4E7I A;  2XKO C;  1M90 R;  2FZG B;  1E6G A;  1BI0 A;  3OMC A;  4DBH A;  3KXT A;  3G71 T;  1O75 A;  1X43 A;  1VQ8 A;  1VQ8 Q;  3JB9 D;  4LDV A;  3EHR A;  4PJO B;  3U23 A;  4HCZ A;  4C92 A;  4DBF A;  5GAO m;  3OYI A;  2BZY A;  3HRT A;  2JOY A;  3CC4 T;  4M7D E;  4M7A A;  1VQ5 T;  1IZ6 A;  5FU6 B;  3QYG B;  2GTJ A;  1NE8 A;  1BCM A;  2DX1 A;  1M3A A;  2K4Y A;  2AHJ B;  2L3R A;  2EQK A;  1T0H A;  3TVT A;  2EYX A; 
#chains in the Genus database with same CATH homology
 3G4S T;  2K5L A;  5LJ3 h;  2VXF A;  3KBG A;  3P8D A;  1I81 A;  1WNL A;  2CGH A;  4M75 E;  3UWN A;  2X4Y A;  4C8Q G;  3CBM A;  3JCM b;  2LDM A;  1G5V A;  3M9Q A;  3OYJ A;  1VQL A;  3OSS C;  4BY6 C;  5GMK m;  2CKK A;  2LQ8 A;  2LVM A;  2RA2 A;  1ZBX A;  3JAM E;  1K73 C;  1JJ2 A;  1M1F A;  4EDU A;  1QVG A;  1G3S A;  2XI9 A;  2GFU A;  2X4X A;  3M54 A;  4HKE A;  2HAX A;  2VGM A;  5GAO l;  4TVR A;  2DD5 A;  3VV0 A;  3EFR A;  3CMA T;  1VQ5 A;  3J81 E;  3CCS A;  4KT0 E;  3MEW A;  5J39 A;  1M1G A;  2BIV A;  4M78 F;  2EFI A;  5J3B A;  4X9C A;  1YI2 T;  3RER A;  4PL6 A;  4M7D F;  2CS7 A;  2KSS A;  4J7I A;  4QVZ A;  5CKE A;  4BI4 A;  3JB9 I;  1YHQ A;  1YJN T;  2E12 A;  4J6X A;  5GAM j;  3GLX A;  2EQJ A;  4RMO A;  2X4J A;  3ER0 A;  2XDB A;  2JN0 A;  3QII A;  2D0Q B;  4HA8 A;  2IG0 A;  4MZP A;  5LJ5 h;  1XNI A;  3MHX A;  1X01 A;  1UGS B;  1O9S A;  2FHD A;  3M58 A;  3QHS A;  4J7F A;  2KDS A;  4OVA A;  3SDZ A;  4BI3 A;  5GAO n;  2RJC A;  2QQA A;  5CKB A;  1VQP A;  1N8R C;  5GAM g;  4PLI A;  5D6Y A;  5EG2 A;  4PJO A;  3MEA A;  3UT1 A;  1FX7 A;  1NZ9 A;  2E10 A;  3QZ5 B;  1FWZ A;  2RHX A;  2YLC A;  2WSC E;  2HD0 A;  1N9R A;  3A8L B;  3QBY A;  3O8V A;  3JCM g;  5GMK i;  1RI0 A;  2XU8 A;  3DB4 A;  4EMK C;  2DJZ A;  2LTO A;  5CKH A;  3V7C A;  3JRZ A;  5LJ3 f;  4OGC A;  3WXM B;  5LJ3 e;  4JRP A;  1VQM T;  2LRQ A;  2FVU A;  4C0D C;  4XAX B;  3CMA A;  3LGF A;  3OYF A;  1M1K C;  1M9S A;  4M77 A;  4R55 A;  4FU6 A;  2E41 A;  1N27 A;  3OA6 A;  1FXX A;  1YI2 A;  3TCJ A;  4C0G A;  3HRU A;  4XTZ A;  1GXI E;  4XU2 A;  2K2V A;  3V7S A;  4BE2 A;  2VXE A;  2EQM A;  3CCU T;  3MCA B;  2A3L A;  5HY6 A;  2BKD N;  3ME9 A;  3PT9 A;  4ZGD B;  2E5Q A;  3L2U A;  4KUD K;  1KD1 U;  4FSX A;  1KHC A;  4F7U G;  3QYH B;  3OYC A;  5DLQ E;  2ZPH B;  3VU3 C;  1QVP A;  1WGS A;  4HT9 A;  4IUT A;  3OYN A;  4KUI A;  2A7Y A;  3I56 T;  1U1T A;  1D3B A;  1KQ2 A;  2KY9 A;  4OMF B;  3JCM W;  4BB7 A;  1JB0 E;  2CYZ B;  4JDS A;  3ASK A;  2E6Z A;  2DXT A;  5LL6 S;  3SWN B;  4D6W A;  5GAN 3;  1VQ6 T;  2DTO A;  4BY6 B;  3JB9 J;  1U1S A;  2VV5 A;  1YBY A;  3E9F A;  3QSU A;  3JCM P;  2QA4 T;  5CK9 A;  2D6F A;  2R5A A;  4F7U B;  1NPR A;  1VQ4 A;  1UGQ B;  1AHJ B;  3JCM Q;  1W2B A;  4WF2 A;  2EYQ A;  5GAM f;  2MF2 A;  4NS5 A;  5GAM e;  1JJ2 S;  3QO3 A;  4E7J A;  4HT8 A;  1QVG S;  4RCC A;  3FRN A;  1VQ7 T;  1XOV A;  2O4X B;  1WJS A;  4DQ2 A;  3UDC A;  3CME T;  4DA4 A;  3HSB A;  1KC8 U;  3CC7 T;  4C92 C;  4OP0 A;  4JS5 A;  2LT4 A;  3JCM f;  5A2Q E;  3J80 E;  3NTK A;  3OMG A;  4PKC C;  5J26 A;  4A4F A;  2ZPG B;  3JCM e;  1QP2 A;  2VYT A;  1Q7Y U;  1MGQ A;  1KHI A;  5I2S A;  3X28 B;  2FB7 A;  3V7R A;  3OYA A;  2JUF A;  4M7A C;  1OZ3 A;  5CKD A;  1S72 T;  2MI6 A;  2OTL T;  1M4Z A;  3C12 A;  3L2V A;  1M90 C;  4MDX A;  1ZQ1 A;  4DOV A;  5LJ3 d;  4LD9 K;  3RES A;  1KQ1 A;  3GNG A;  4C5H A;  4C8Q E;  5GAN 2;  1BIA A;  4M75 C;  2K5I A;  2E65 A;  4NL3 A;  4HCC A;  4BI8 B;  2R57 A;  3DLM A;  5CQY A;  1I4K 1;  4ATO A;  1WQ7 A;  2RI5 A;  3VYH B;  2WSF E;  5HKC A;  4RG8 A;  4M7A E;  2QA4 A;  1WJQ A;  3JB9 F;  3FDR A;  2E6N A;  1MHN A;  2EAY A;  2K57 A;  2DD4 A;  5FU7 C;  4JLI A;  4C8Q D;  4C92 D;  2PUO B;  3BFM A;  4OB0 B;  3GPL A;  3AHU A;  4XK8 E;  4IUV A;  5CIU A;  3OY9 A;  4BDY A;  1VQO T;  4XQ3 A;  3M56 A;  1VQ7 A;  2L8D A;  2M9U A;  2M0O A;  2EJF A;  4E7H A;  2PVD B;  3RMS A;  2XIC A;  4M7A D;  4L6V 5;  3RKX A;  5KCO A;  1Q81 U;  1BI1 A;  4N4H A;  1QW1 A;  5L8R E;  3V8K A;  3CC4 A;  4OB1 B;  5LJ5 d;  2K3X A;  4M78 G;  1G3W A;  4M75 D;  2E70 A;  2LX9 A;  4XTX A;  1HXD A;  5GAN 4;  1K8A U;  3OS1 A;  3OBY A;  3OS5 A;  2WAC A;  2RD1 A;  2X4W A;  2QEX A;  5CVI A;  3MP6 A;  4O6J A;  2KVQ G;  3TU4 K;  5FRM A;  4II1 A;  2EQU A;  4QW2 A;  3JCM V;  2F5T X;  2VUB A;  1OI1 A;  4ELZ C;  5IN1 A;  5KE2 A;  4BAC A;  3CC2 T;  3M53 A;  2EKO A;  3LW5 E;  3QJY A;  2RJF A;  4C5I A;  2QTX A;  5C0M A;  1VQK A;  4BUG A;  1WQW A;  3SWN A;  3HPW A;  3GF5 A;  4YTL A;  1KG1 A;  2Y90 A;  3WVD B;  3PMT A;  3CXC S;  4C92 F;  4M78 B;  2BUD A;  2LCC A;  2RHU A;  5IT9 E;  4F7U A;  4RKU E;  4M7D B;  2CZ1 B;  3G4S A;  4PJO C;  2IVW A;  3OQ5 A;  3S3O A;  2M16 A;  4JRK A;  2HBP A;  2DXC A;  2QQB A;  3WVE B;  5GAM h;  3CCV T;  4L5G A;  4BDZ A;  2O4X A;  4M7A F;  3A8O B;  4C5E A;  5GAN 7;  1ZHI A;  1W2B S;  1VQN T;  2RH2 A;  1LJO A;  4C92 B;  5FRN A;  3OS0 A;  3LWH A;  4C0Z A;  2JZ2 A;  1B34 B;  3QPH A;  4MMK A;  3BW1 A;  1Y96 B;  2VGN A;  1EIF A;  2JVV A;  3JCM h;  3LLR A;  2YHT A;  3HHT B;  3PMI A;  4M75 F;  3RKW A;  4MZM A;  4OGE A;  3OYL A;  2M1H A;  3G6E T;  5GMK l;  1VUB A;  3BDU A;  4FT4 A;  3LWI A;  4PJO E;  2RJE A;  4M77 C;  4A4H A;  3X24 B;  1H64 1;  4LD6 A;  5FU6 C;  4A4K A;  1NJI C;  1Y7X A;  4N0A A;  2XID A;  2JTF A;  2EIF A;  4QQD A;  3CC2 A;  4JRQ A;  3VUZ A;  1PSE A;  2RI3 A;  2V8J A;  3CCJ T;  2DIQ A;  1Y71 A;  1YJN A;  2ZPE B;  3M5A A;  3T9N A;  2ZZD A;  3R6O A;  4B9X A;  4PJO D;  1IRE B;  3N5B B;  2EWN A;  2YLB A;  4ZTJ A;  4UC4 A;  1K73 U;  3CCQ T;  3OW2 A;  3NTH A;  4M77 E;  4ZN1 A;  5FU7 B;  4QVD A;  4EMH A;  1YIT T;  3CCE T;  5I21 A;  1UEB A;  3CCV A;  3CXC A;  4CI0 C;  3OYH A;  3JSC A;  3OSV A;  1BI3 A;  2FYK A;  2ZGW A;  4XU1 A;  4ME7 A;  2G3R A;  2F5K A;  2P4T A;  4XTV A;  3CBP A;  4M77 D;  2RK2 A;  2QQS A;  3FEO A;  3CD6 T;  1LNX A;  2ZPB B;  3CEY A;  4IUQ A;  3CCL T;  2L89 A;  3NTI A;  3TRE A;  1N6A A;  4FL6 A;  3S3N A;  3G6E A;  1SSF A;  1VQ9 T;  1VQM A;  5DLO A;  1YJW T;  4FM4 B;  2RK1 A;  3OYK A;  2D9T A;  4M7D G;  3SB2 A;  4JUV A;  3INZ A;  1QVF A;  4Z02 A;  5HK0 A;  4J5Y A;  4C8Q C;  2K5F A;  4JS4 A;  1N8R U;  1QP3 A;  3CCJ A;  2OTJ T;  4MDW A;  3CCU A;  1WPY A;  2HNI A;  2R58 A;  2Y4Y A;  3DB3 A;  2DEQ A;  2R5M A;  4PJO F;  5KH6 A;  2ZPF B;  1P92 A;  3FB9 A;  2NLU A;  4QQ6 A;  2E64 A;  1X6O A;  4LDU A;  3L2W A;  5A0D A;  1LOJ A;  3RKY A;  5GAO q;  3CCQ A;  4NL2 A;  3JCM J;  2RI2 A;  1I5L A;  4IKF A;  4M78 A;  5GAO r;  4OB3 B;  2DZC A;  2C06 A;  2DVE A;  1XQH A;  1I8F A;  5GMK j;  3I56 A;  3CPW S;  4M7D A;  1N9S A;  4E7K A;  3LX7 A;  5IAY A;  4PLL A;  3H8Z A;  1BKB A;  5DM7 R;  1M1K U;  3JB9 G;  1PSF A;  3M57 A;  1BIB A;  5CO7 A;  1VQ6 A;  4LDY A;  3EFS A;  3BDL A;  1HK9 A;  1VQL T;  2K3Y A;  1V29 B;  2OAU A;  2CZ0 B;  4M77 F;  3JB9 H;  1B34 A;  3CD6 A;  2RB6 A;  3GNF B;  3LH0 A;  3L2Z A;  4IUP A;  1Y96 A;  3ZBD A;  4M78 E;  4A53 A;  3CCL A;  4EMK B;  3JCM X;  3LGL A;  4ZN3 A;  5GMK h;  2P0P A;  4N4I A;  4B9W A;  4A4G A;  4ELY C;  3CCR T;  3OB9 A;  2PUK B;  5GAN j;  5I2M A;  4RG2 A;  4C0D B;  3QG1 A;  2DXU A;  3L1A A;  5CQX A;  3CME A;  3QXE B;  3JCM c;  5GAO p;  3CC7 A;  3DLL A;  1R8O B;  5D6W A;  2XK0 A;  4E7L A;  3TEE A;  1DJ7 B;  3OYM A;  2LCL A;  1G3Y A;  3QZ9 B;  5GAN g;  2XD0 A;  2PVG B;  4IUR A;  2PU9 B;  4N4G A;  4XTW A;  4ZGE B;  5GAN h;  4EPC A;  1UB4 A;  3RMQ A;  4VUB A;  1S72 A;  2VC8 A;  5CR2 A;  2OTL A;  4Q5W A;  4QVC A;  4J6W A;  3X26 B;  4L59 A;  1KQS S;  2HQX A;  2YRV A;  4A54 A;  3CCM T;  3QKJ A;  2DZ9 A;  4RCB A;  5A0L A;  1VQP T;  1D3B B;  5GAM d;  2XDP A;  3URG A;  4C92 G;  2O01 E;  3OW2 S;  1H3Z A;  3HFN A;  2QQ9 A;  4JLG A;  4MML A;  2LNV A;  3SD4 A;  1UGP B;  3SWN C;  3M4Y A;  1KD1 C;  3OBW A;  2JNG A;  4P5N A;  3JCM d;  1UGR B;  1M5Q 1;  4Y91 A;  3CPW A;  2XDD A;  1BYM A;  4C8Q F;  2KQW A;  3BY7 A;  4M7A G;  2L5Q A;  2LC4 A;  2WSE E;  2ZPI B;  3CCR A;  3HP9 A;  2CZ6 B;  3MO8 A;  5A0G A;  1VQO A;  1Q86 C;  5LJ5 j;  2DIG A;  3G7Z A;  2DPP B;  3OYE A;  3L2R A;  1M90 U;  2FL7 A;  2H3J A;  4M75 G;  2RJD A;  4IUU A;  2LQK A;  4C8Q B;  4GLK A;  4HCB A;  4X9D A;  2PQW A;  4ZGJ B;  2I2L A;  3M55 A;  5GMK e;  3OYB A;  1QVF S;  1VIE A;  5GAN 8;  4F7U E;  3KUF A;  5LJ5 g;  4M7A B;  5KCH A;  3L2Q A;  4BE1 A;  3M59 A;  1YJ9 T;  1U8R A;  3I55 T;  3CCM A;  4R56 A;  1OZ2 A;  2GQV A;  3QDR B;  4N0A C;  2KAF A;  3LYI A;  4OB2 B;  2HQE A;  3V8J A;  2V8I A;  2RHY A;  1KC8 C;  3PFS A;  3MET A;  1W4S A;  4C0F A;  2RHZ A;  2MAM A;  5CKF A;  4LDX A;  2EJG A;  4M75 B;  4XU3 A;  1VIF A;  3Q1J A;  4JRI A;  5GAN f;  3A8H B;  1Q7Y C;  5GAN e;  3VJP A;  1KQS A;  3C94 A;  3PIP A;  3GIB A;  3OS2 A;  4KUL A;  4C5G A;  4PNO A;  5GAN 6;  2EJ9 A;  4EMG A;  1VQ8 T;  3OYG A;  4V2S A;  2ZCF B;  2MWP A;  4EMK A;  1VQ4 T;  2XG8 D;  4ZTF A;  3L42 A;  3NFC A;  1BI2 A;  1YIJ T;  3VYG A;  1Y07 A;  1K9M C;  1XTD A;  2E1H A;  1RL2 A;  2KMT A;  3FIF A;  5AYF A;  3OYD A;  5HK3 A;  2DK3 A;  3UPU A;  3QJ6 A;  2GFA A;  1VQN A;  1WJR A;  3A8M B;  4A4E A;  3C95 A;  4NOY A;  3VUB A;  2P0Q A;  2PVO B;  5DY9 A;  2RO0 A;  3P8B B;  2DKG A;  2B8A A;  3F70 A;  3H6Z A;  2DTH A;  2QI2 A;  1JBM A;  4MZT A;  2MMP A;  4XU0 A;  2JTM A;  3V8L A;  4CRI A;  3QUI A;  5KE3 A;  1Q82 C;  4J83 A;  4FIB A;  3FC3 A;  2V8K A;  1YJ9 A;  3I55 A;  2X35 A;  2GF7 A;  2XKO C;  3SFM A;  3ZEH A;  5GAN 5;  3DKM A;  4PJO G;  5C6S A;  4JJN K;  4FT2 A;  1BI0 A;  1YCY A;  3FLG A;  3HFO A;  5D6X A;  3C4S A;  3PIO A;  1Q86 U;  4F7U F;  3M4G A;  1Q81 C;  3CBO A;  2Y4X A;  3OMC A;  3HL8 A;  2DO3 A;  3E19 A;  3KXT A;  5LJ5 f;  5LJ5 e;  3G71 T;  1O75 A;  1K8A C;  1VQ8 A;  2QDY B;  4M78 C;  3CPF A;  4KBM B;  4GY5 A;  3JB9 D;  3RIR A;  4M7D C;  4LDV A;  1OYX A;  1YIT A;  4M77 G;  3CCE A;  3X20 B;  1YIJ A;  4X34 A;  3J7A F;  3GP8 A;  4PJO B;  4XTU A;  5FRO A;  3VKI A;  4E47 A;  4OF1 A;  1NJI U;  2DAQ A;  4E7I A;  3X25 B;  4Y28 E;  5M9O A;  5CAI A;  4HCZ A;  4C92 A;  2MWO A;  4XTY A;  4C8Q A;  3PNW C;  3ZFJ A;  5GAO m;  3MP1 A;  3A8G B;  3S6W A;  3OYI A;  5GAN d;  1X75 C;  2DXB A;  3HRT A;  2F69 A;  2JOY A;  2RHI A;  3CC4 T;  1VQ9 A;  3A5Z B;  2GCX A;  4BE0 A;  4M7D E;  5CCA A;  3EAE A;  4J8O A;  3PGG A;  1YJW A;  2CZ7 B;  2KK4 A;  3HKS A;  2QQR A;  2QEX T;  4LDW A;  4M7A A;  3PTA A;  4M77 B;  3MP8 A;  3FJP A;  1VQ5 T;  1IZ6 A;  3OYY A;  3QYG B;  5FU6 B;  3P8H A;  2P0K A;  3CCS T;  4C92 E;  4QQG A;  1K9M U;  2OTJ A;  1NE8 A;  4M78 D;  3RUX A;  5FLX E;  4M75 A;  2DTI A;  5LJ3 j;  1M8V A;  3MEU A;  4M7D D;  3GOX A;  4BD3 A;  2K4Y A;  3HRS A;  1VQK T;  2AHJ B;  2L3R A;  4J6Y A;  3G71 A;  2EQK A;  1NPP A;  3MEV A;  3S3M A;  2QXF A;  1TH7 A;  4DOW A;  1G3T A;  2LT1 A;  3E1S A;  4O5V A;  1YHQ T;  2XHC A;  1JRI A;  1Q82 U;  2RM4 A;  5LJ3 g;  3E9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...