5GAN6

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan600
5GMKm 5LJ5e 4OP0A 4EMKC 4M7AB 4MMKA 4M77A 4M75F 5LJ3g 5LJ5d 5GAN6 5GAOl 4M7AA 2DKGA 1WQ7A 2CGHA 2DEQA 2E64A 4C8QG 4F7UA 4PJOE 4C92D 2E1HA 4M77C 3V7RA 3INZA 1BIBA 3V7SA 3JCMQ 1N9SA 3V8LA 3JB9J 2ZGWA 3QO3A 4XTZA 1I8FA 2DXTA 2RA2A 5CAIA 4M7DG 3JCMd 2DJZA 3JCMf 5GANe 3GIBA 2DTOA 3HFNA 1U1TA 3HSBA 4M7DC 3AHUA 5GAOr 2K57A 4X9CA 4C92F 4HA8A 1I81A 4XTUA 2EJFA 5GAMd 4M7DB 3PGGA 5GAMh 4Y91A 3QHSA 4F7UB 1I5LA 1KQ2A 4PJOC 4M75A 3JCMV 2DXUA 2E65A 3HFOA 2HNIA 1B34A 3SB2A 3JCMX 3JCMb 3JCMP 1YCYA 4C8QE 4NOYA 1M5Q1 2EWNA 4M78D 2JN0A 3L1AA 5LJ3f 4J5YA 4N0AA 2YHTA 1LJOA 4WF2A 1LNXA 2E41A 4M77D 2VXEA 1M8VA 1KQ1A 4EMKA 5LJ5h 4C92B 1TH7A 4C92A 4HT9A 4X9DA 3M4GA 3FJPA 5GAMg 3EFRA 4M7DF 4F7UF 3RKWA 5GAOq 1BIAA 4F7UG 5GMKl 1MGQA 5DY9A 4V2SA 4C8QC 4M7AG 1X01A 5GAN7 2I2LA 4JRIA 3SWNB 4PJOD 5GANd 4M7AE 5GANg 3JCMe 4J6WA 2FB7A 3RERA 4M78G 4XU3A 5LJ5f 3RUXA 5LJ5j 4XU2A 3QUIA 5GAOm 3RESA 1B34B 4M75B 4M7AF 4XTVA 3L2ZA 5GAMe 1Y96A 2EAYA 4M78C 3JB9G 4EMHA 3RKYA 4PJOF 4EMGA 5GAN5 4M78B 1JBMA 2Y90A 5GMKj 4QVCA 2RB6A 3JB9H 2DTHA 5LJ3e 5GAN4 2RM4A 3RKXA 4PJOB 1H641 4XU1A 1WPYA 3JCMJ 3BY7A 3FB9A 5I21A 4NL2A 5GANh 4C92G 5GAN8 1HXDA 4PNOA 4M78A 4C8QD 2VC8A 4M78E 4NL3A 4M7DD 4QVDA 5LJ3j 3SWNC 4HT8A 3SWNA 2DZCA 2YLBA 4M77E 5LJ3d 4M77B 3V7CA 1JRIA 1LOJA 5LJ5g 4A54A 2RD1A 2DZ9A 5GANj 3JB9D 4F7UE 5GAN2 4PJOA 5LJ3h 3V8JA 2QTXA 2VXFA 4M78F 4JRKA 4C92E 2DTIA 3BW1A 3BDUA 4M75G 4XTWA 2E10A 3JB9F 3JCMg 5GAOn 5GMKh 4MMLA 4PJOG 1WQWA 3VU3C 2EJGA 4XTYA 4M7AD 1N9RA 4JLIA 2FYKA 1D3BA 4C8QF 5GANf 3RIRA 4M75C 3FIFA 4XTXA 3JB9I 4M75E 1Y96B 4J6YA 4M77F 4J6XA 3V8KA 5GMKi 4M7AC 3JCMc 4DQ2A 3QSUA 4JUVA 4XU0A 1D3BB 1U1SA 4C8QA 3BFMA 4M77G 3JCMh 5GAMj 5GAN3 4M75D 2DVEA 1HK9A 2EJ9A 4C92C 4M7DA 4M7DE 1I4K1 3EFSA 4XQ3A 5GMKe 5GAMf 4C8QB 4N0AC 4RCBA 5GAOp 1WNLA 4EMKB 2YLCA 4RCCA 3JCMW 4A53A
chains in the Genus database with same CATH superfamily
1MUZA 4M7AB 2W10A 2QQAA 3PT9A 4C92D 1YBYA 2QQ9A 1UFFA 1N8RR 2DXTA 1MMAA 1KD1U 2HMAA 1TOVA 4PJLA 2VWFA 2DTOA 5GAOr 2B8AA 3CCJQ 1H8KA 2DK3A 4PLIA 1TG0A 1OV3A 3CBPA 3PGGA 3QHSA 1I5LA 2RQTA 4EIKA 3CCEQ 3CCSQ 4Z89A 3JCMb 2L0AA 3G6ET 5L8RE 4HVVA 2DXCA 3VS1A 1N27A 2NUPB 1RL2A 4C5IA 1KHIA 5D7UA 2AT1B 4HT9A 2C0TA 1RLQC 4F7UF 3RKWA 5GMKl 2W0ZA 2YUNA 2XDPA 2I2LA 5LJ5j 4MZMA 4XTVA 2DXBA 4E47A 2YSQA 2LVMA 5GAN5 1GXIE 3CMAQ 1K9MU 4QVCA 2CP3A 1YFNA 3FB9A 4J9HA 5AT1B 5A2QE 5IT9E 1YIJA 2DA9A 3AT1B 3DB3A 5D6XA 1OI1A 3CD6Q 3GF5A 3A8OB 4PJOA 4F7UE 1GBQA 3KBGA 1M90R 1CSKA 3A8GB 4OB0B 3CCRA 2J6FA 2RMOA 2RHUA 2KVQG 1QVFA 4JLIA 1NG2A 2WSFE 4XTXA 4M7AC 2O4XB 3G4SQ 1ZA2B 1YJ9Q 1X6BA 3VRYA 1QVFP 2KXDA 1UHFA 1S72Q 1SSFA 3FDRA 4OGCA 5CQXA 3H9NA 2DLPA 2L8DA 3CCJA 3RNJA 3L2WA 2X4XA 2DL3A 2G3RA 1Q81R 1BYMA 2RF0A 3UATA 2LJ0A 3A8LB 3ZBDA 3JB9J 3M57A 2M0YA 5CAIA 2LQWA 3QWYA 3TEEA 1IZ6A 3VUZA 2JTMA 8ATCB 4M7DB 2KBTA 4F7UB 3PE0A 1R0BG 3MEWA 2ZPBB 5C6SA 1N5ZA 2A3LA 2SEMA 4CI0C 2VUBA 4ZGDB 3D7SB 4HVWA 3WVEB 1ABQA 4RG8A 1NPRA 1LPLA 4LD6A 4LXCA 1V1CA 4C0GA 1N8RU 2RQUA 5GANg 4AG2C 4JPBW 2FB7A 3OBYA 2DE0X 3FEOA 3NTKA 4KH0B 1MHNA 4IUVA 4ZN1A 1I0CA 2Y4XA 1VYTA 2A37A 3JB9G 1YJNT 3QDFA 2X3WD 3CC4Q 5GMKj 1X75C 3X20B 1G3TA 2JTEA 1WFWA 2HBWA 1VQNQ 3NPFA 1KG1A 1HXDA 1SHGA 2LQKA 1VQ8T 1FMWA 1U06A 3CCUA 1VQLQ 2F2VA 2ESWA 3CCST 1WHJA 3QKJA 5DLOA 2G6FX 2MF2A 3O5ZA 5LJ3h 2RH2A 4E7SA 5HCKA 3ZEHA 1S72A 2LNHB 2EYYA 1ZUYA 1YNZA 4J6XA 1M3CA 3EG9A 2FPFA 4E7IA 2OI3A 1PCXA 2OTLT 4K11A 2MPXC 1I4K1 3EFSA 1GRIA 3MPUB 4C8QB 3UA6A 4PJOF 3OYKA 1KJWA 4E7KA 2NLUA 1RAIB 1M90U 1WQ7A 4DA4A 3J81E 3OW2A 2DO3A 1YHQT 4PK4A 2DJZA 2XK0A 3HFNA 3VKIA 1D0XA 1FX7A 3JCMV 2ZPIB 3Q1JA 4OMQA 3CXCA 2J06A 2DBKA 1IRXA 2E6ZA 2IG0A 2EQMA 1U8RA 3LYIA 5CKEA 4BY6C 2CP7A 1LNXA 1VQ7T 2COZA 2GQVA 3M59A 3FRNA 5GAMg 4KT0E 3CC2A 1HD3A 3OYCA 3L2UA 1UB4A 1BIAA 2AHJB 1K9AA 4JRIA 2BZYA 5GANd 3PMIA 4RTTA 4E7ZA 3J80E 3L2ZA 2EAYA 5J39A 1IHVA 4EMGA 3EGDA 5C0MA 1E7OA 3QIIA 3EG0A 1UGVA 3PVQA 1KSWA 2ZCFB 4NL2A 2JNGA 4M7DD 2QXFA 1YJNQ 2RHXA 2DL8A 4NS5A 4E7JA 1VQ8Q 2E12A 1HJDA 2DTIA 3L2RA 2M02A 4DEYA 3EAEA 1RLPC 3OYMA 1E6HA 3G71A 4PJMA 1BB9A 3I56Q 3FIFA 1KC8U 4FYXB 1JB0E 1NBEB 5CO7A 4C0FA 3OYAA 3UDCA 5GAMj 3UF4A 1VQ5Q 1VQ4A 3LWHA 3ER0A 2DL5A 1YIJQ 4RCCA 2CZ0B 3VJPA 4OP0A 4O6JA 4EMKC 1I5OB 3CCRT 2FVUA 5IXBA 1RI9A 1YITT 2CGHA 3H41A 3A8HB 1VIFA 4OF1A 3QZ9B 1BIBA 2CSQA 4OMOA 1Z9ZA 4D6WA 1UE9A 1YIJT 2FRYA 1WA7A 3C0CA 1WGSA 1TS9A 3O8VA 2FHDA 3S3MA 1WJSA 1ZUUA 5FU7C 2V1QA 3LH5A 3E9FA 3F70A 1I07A 2I0NA 2DNUA 4N0AA 2CP0A 2F2WA 1BI0A 3C4SA 1M8MA 4X9DA 4ESRA 1KC8C 4M7DF 4FCYA 5GAOq 3OYNA 2VASA 5GAN7 3LWIA 5KYXB 4J6WA 2FZCB 5CKDA 1D1AA 5DLQE 4J8OA 4FW1A 4Q5WA 4J9CA 2K5IA 4XAXB 3QDRB 3CCVA 2RI5A 1KQSS 3CC2Q 2F69A 3H6ZA 1NPPA 5LJ3e 1H641 3CC2T 2B86A 3E1SA 1W4SA 4QQDA 1MMGA 3E19A 2HD0A 1K73U 3M0QA 4KGXB 1R0CB 1NLOC 5KE3A 2LMJA 2LT4A 5CKHA 1M30A 3JB9F 3BE3A 1T3SA 2LQ8A 1G3YA 2HBPA 2XMFA 5I2SA 2AZSA 1QCFA 3JB9I 2AKLA 2WSCE 2GTOA 2V8KA 4M77F 2CKKA 3EH1A 2ROTA 1U1SA 2KR3A 3CCET 2QEXQ 2JS2A 4PFOA 3M55A 4MZTA 4BE2A 1UGSB 4CC2A 3G71Q 4M7DA 5FU6C 5GAOp 3RDVA 3MKDA 4GLMA 1OZ2A 4IURA 4B6MA 1NLPC 2K6DA 2WACA 4C0DC 5FWBA 4DBRA 4IUPA 1OU8A 3MEUA 4M7DG 4RTWA 4AFZC 1U1TA 1TUDA 4HCKA 3X28B 1VQ7A 2O88A 1R77A 3OYYA 2DILA 5KYYA 4HXJA 2FEIA 1WXTA 2L3PA 4HCBA 1Q86C 1UTIA 3EGXB 4M77D 1YJWA 2OTLQ 1M1KU 3KFVA 3M0SA 3M4GA 9ATCB 1VYUA 4C8QC 1WYXA 4M7AE 1T0JA 5LJ5f 2VGNA 3G7ZA 4XU2A 2IVWA 4Z02A 1Y96A 4M78C 5GJVB 3DLLA 1S1NA 5DM7R 4AT1B 3HRUA 2QQRA 2Y90A 1N8RC 2H3EB 4KRTA 4BI3A 2ROLA 3ME9A 5EG2A 3JCMJ 1Q81U 1AD5A 3CBMA 1P92A 1WHKA 2X35A 4LDWA 2QGGA 2HKNA 5LJ3d 1ZLMA 4LDXA 4A54A 1VQKQ 1TWBA 3BDLA 3NTHA 4CRIA 2YUPA 2KSSA 1U3OA 1NYFA 1WHMA 1X2QA 2R57A 3JCMc 1UGPB 2YRDA 4FL6A 4AMCA 2PU9B 1VQ8A 4OVAA 4IUUA 3CQTA 2QYZA 1OZ3A 4M7DE 2H8HA 2CREA 5CQYA 3QZ5B 5LJ5e 2RHYA 2RI3A 3SEMA 1Y7XA 3H0FA 1X43A 1M3AA 4LE9A 4HCZA 2K5FA 3V8LA 1WJRA 1I8FA 4A4FA 4BDZA 2JMAA 2X3XD 2EQJA 2K57A 3CCVT 4HA8A 3DKMA 2RHZA 2XKOC 4C5EA 1T3LA 1BI1A 1YI2Q 3HHTB 1VQLT 3MP6A 5LJ3f 1AZGB 4C5GA 4L5GA 2BE9B 4FYVB 1UG1A 3OMGA 4HCCA 4F7UG 2HCKA 2YRVA 2EKOA 3CCMT 4QT7A 5KYXA 4P5NA 3CCLA 1RADB 1MMDA 2GFUA 4BD3A 1M4ZA 4C0ZA 3JB9H 5IHIA 3OYGA 2EYXA 4KGZB 2K2MA 4X34A 1Q82U 5GAN8 1YJ9T 1W2BS 2A0FB 2X51A 3THKA 2HEQA 3UA7A 2YUOA 3QBYA 4M78F 2CH4A 2RPNA 5KYUB 2K5LA 3QYGB 1QKXA 2M16A 2ZAEA 1WX6A 1WHGA 2K2VA 5GANf 4Y92A 2JTFA 2QI2A 5GMKi 1ABOA 3CMET 2RN8A 1QVGP 1K1ZA 4JUVA 4CC7A 5FWCA 3OMCA 1CKBA 2KDSA 2Y4YA 4ELZC 3P8BB 1UECA 1K0XA 2DYBA 1H3ZA 2PTKA 4OMNA 4R55A 4A53A 3MP1A 4C0DB 2GNCA 2RJEA 3CCEA 3GOXA 4C8QG 2DERA 4RTYA 4FT2A 2DPPB 3OSSC 2ZGWA 3CD6A 2L5QA 2RA2A 4WCIA 5GANe 1SRLA 3GIBA 4KH1B 1PNJA 3HSBA 2P4RA 4LD9K 2EGAA 1VUBA 3CEYA 2XU8A 1VQLA 2V8IA 4PJOC 4FYWB 4E6RA 4WTOB 3TCJA 3J7AF 5D6WA 4NOYA 2JT4A 5IHNA 2EWNA 2JN0A 2LRQA 3G6EA 5FLXE 1LJOA 2KNBB 2VXEA 1D0YA 1KQ1A 1G8XA 2RK1A 3CC4T 5FU6B 3QG1A 1FWZA 1JJ2P 1HYOA 2O9SA 2DMOA 4M78G 4J9EA 3VS3A 4M7AF 2XICA 5GAOm 3RESA 2LC4A 3HRTA 3CCRQ 2EFIA 3C12A 1WZOA 2GGRA 5KYNA 3FJ5A 1XQHA 1GFCA 2VGMA 1JJ2A 1RAGB 4JZ3A 1D09B 2X4YA 1Y71A 4JDSA 4NL3A 2F5KA 1PWTA 3HPWA 1MNEA 2YRCA 5LJ5g 1VQNT 2EIFA 2DZ9A 2PUKB 3I9QA 3M4YA 4O5VA 1NJIR 3VRZA 3A8MB 3EHRA 4M7AD 4C8QF 4M75C 4J7IA 2O4XA 2QTVA 2RNAA 3CMEA 1OU9A 4XU0A 3PFSA 3BFMA 2VYTA 2PVDB 1J3TA 3X25B 2OTJQ 1HK9A 3A98A 2D1XA 5I22A 1O9SA 2GCXA 2QQSA 5GAOl 1QQJA 3G1JA 3GLXA 3I56A 5KH6A 3OYLA 1VQPA 3QYHB 2LCCA 1VQ9T 2ATCB 3OQ5A 4ELYC 1TUCA 4MZPA 2ED0A 1JXMA 3LGLA 1K9MC 2LQNA 5KCOA 1M8VA 4OGEA 2WSEE 4J9BA 1KD1C 1VQMA 3EH2A 5DY9A 2NUPA 5KYUA 1X01A 1GCQC 2KRMA 1HSQA 1QKWA 1FMVA 1UEBA 3LH0A 3PVLA 1UUEA 4JS4A 2HZYA 1SPKA 5ECAA 2CS7A 1ZX6A 1KD1R 1EFNA 1VQPQ 2L2PA 2J05A 3M54A 3EGXA 5GAN4 1Q7YU 1XTDA 4JS5A 5FROA 1IXDA 4AG1C 2DM1A 2VC8A 1K8AC 2MI6A 2HDAA 3RMSA 4LDUA 2V8JA 4B9XA 3JCMg 2VKNA 2CH4W 1PC0A 1UGQB 5CR2A 1D3BA 2EKHA 3CMAA 3EG2A 1OPLA 2LZ6B 2CP6A 3V8KA 1IREB 1V29B 2QASA 4M77G 1VQ6T 3OS1A 1NYGA 1YN8A 4A63B 2OJ2A 4BB7A 5GAN3 4C5HA 3CC7A 3CMAT 2KE9A 2P0KA 4A4KA 3UT1A 4A4GA 4M75F 2EVRA 4F16A 4M77C 3V7RA 2QEXA 2A36A 1EZZB 1NM7A 3JCMd 1KIKA 3HL8A 2E5KA 1G3SA 2VV5A 1OULA 1FMKA 1KQ2A 1S72T 3NFCA 1WLPB 4M75A 3VS6A 4KUIA 1D0ZA 1VYVA 2EW3A 1YCYA 3KXTA 1IB8A 4IUQA 2AK5A 4J83A 1X6OA 1VQOT 4C92B 2FPDA 4RTXA 2J7IA 1VA7A 4BDYA 1MGQA 1YITA 5D6YA 3M53A 2HSEB 2F2XA 3SWNB 3JCMe 1YHQA 1AVZC 3RUXA 3QUIA 2A08A 3CCQT 3U23A 4E7HA 3OS5A 1QLYA 2EQKA 8AT1B 1XJWB 3CPWA 3WXMB 2LNVA 1ZSGA 2JW4A 3H0IA 3T9NA 1V76A 5I2MA 2C0IA 5CKFA 4PNOA 1QWEA 5KYWB 1G2BA 4M77B 1YI2T 1WI7A 1OEBA 3M56A 3V8JA 3CPWP 4JRKA 4C92E 3PTAA 4ZTJA 4RTVA 7AT1B 4MMLA 1VQNA 4XTYA 3LGFA 3M0UA 2EPDA 3I55A 1ZUKA 4ZGEB 1W1FA 2K3YA 3I55T 2ZZDA 4M4ZA 5EC7A 2DETA 2YT6A 4UC4A 3CCUT 5M9OA 4JJDA 4JRQA 2E6NA 4IIMA 4C92C 3OY9A 1AZEA 2QDYB 1YI2A 3CCJT 5GMKe 5HY6A 4RTUA 4PJJA 5GMKm 2KROA 2RHIA 1LVKA 2RJFA 4FIBA 4TVRA 4L6V5 2E1HA 3INZA 3V7SA 1K8AR 2CUDA 4JLGA 2CYZB 1SG5A 3E9GA 1UJYA 3L42A 2O31A 3CCLQ 1PRMC 4ATOA 3UWNA 1A0NB 2E65A 2QK0A 1WJQA 2GTJA 4XK8E 2O2OA 1Q82R 1KHCA 1BK2A 4LN2A 4WF2A 2DRMA 2LX9A 1PG5B 4A4EA 2ZPEB 3VS2A 3OW2S 4ORZA 1G83A 3OYDA 1M27C 3CMEQ 1M3BA 4KGVB 4JZ4A 2D0QB 3TU4K 2L3SA 2DIQA 2J6KA 1X2KA 4DBHA 1WXBA 3SFMA 3VS7A 4LDYA 1KQSA 1EX4A 3MHXA 2DBMA 1NJIC 2H3JA 2HKQB 2DX1A 3URGA 4CC3A 4J9DA 5GANh 4HT8A 3SWNA 1SRMA 2YLBA 3CPWS 4ZNXA 2FZKB 1JRIA 2KYMA 1W6XA 4QW2A 4QQ6A 4JJCA 2XHCA 1AWWA 2PVGB 1QMCA 1NE8A 2YWWA 3CCQQ 3GBQA 4BI4A 2KT1A 2O9VA 2PZ1A 4PJNA 1XOVA 3ZL7C 1Y96B 4BACA 4DQ2A 1WDXA 2DFUA 2CZ6B 1TU0B 1M2VA 2CZ1B 1VQ7Q 2PQWA 4OB2B 4XQ3A 1PRLC 4RCBA 5CVIA 5L23A 1IHWA 2EGEA 3QPHA 4M77A 4ZTFA 4M7AA 3MEVA 5KYWA 3EHQA 1RAFB 4LNPA 2P84A 1WXUA 2F1LA 2KRNA 1BCMA 1VQ4Q 1Q95G 3JRZA 4YTLA 1NZ9A 1K76A 2MYSA 2K3XA 2EJFA 1NEBA 3S3OA 2P4TA 3M0PA 2YXYA 3M5AA 3GNGA 3X24B 2JVVA 1ZQ1A 4FM4B 2XIDA 3CCLT 1Q7YC 4JJBA 4HKEA 3VYHB 4EMKA 3CCVQ 4C92A 3CC4A 3FJPA 1PM3A 1O75A 3HTRA 1MV3A 2F5TX 4M7AG 5A0DA 4AFQC 1IGUA 1BKBA 2RJCA 4F14A 3C95A 4XU3A 4OMMA 2P0QA 3CCMQ 3MCAB 4PL6A 1WHLA 1TXQA 4M78B 3EFOB 2O01E 4GLKA 3MEAA 5IN1A 1BBZA 4C92G 1R8OB 1TUGB 3WVDB 3CD6T 1AEYA 3QJYA 3EG9B 3CXCP 3M58A 4JRPA 1YCSB 1LOJA 1PSFA 5GANj 3CC7Q 1JU5C 2CZ7B 4Z8AA 1M9SA 1X27A 4EPCA 4XTWA 2M51A 3OS2A 3I5RA 2KQWA 4X1VA 1K0SA 1PKSA 2OAWA 3RIRA 5A0GA 3CXCS 4M75E 1GFDA 1JXOA 3QSUA 1D3BB 4PFPA 1BI3A 4D8KA 4J9FA 3OSVA 3RMQA 2MWPA 3REBB 1C1AA 2YLCA 1OX8A 2A28A 4QKUA 2IPOB 5FU7B 5LJ3g 2ECZA 1JQQA 4DOVA 3LX7A 2EBPA 1K73R 4PJOE 2ED1A 1RUWA 1NJIU 2E4HA 1N9SA 4XTZA 2L3QA 1YJWT 1W70A 4N4GA 1D1BA 1YJWQ 1Y57A 4XTUA 5GAMd 4R56A 1GL5A 3DLMA 3L2VA 1D1CA 1U5SA 4DBFA 1B07A 3SB2A 1B34A 1Q7YR 3LLRA 4B9WA 4J5YA 4L59A 3FC3A 1F1BB 2E41A 2HL5C 3CCMA 3NHNA 1IO6A 2R5AA 1QCNA 1OX9A 2LX7A 2X4JA 2V1RA 1CKAA 4V2SA 3HP9A 2BUDA 1KC8R 1VQOA 3I55Q 3OYBA 4EDUA 5GAMe 2MWOA 2QA4T 1QVPA 2HQXA 3OA6A 1H92A 2R5MA 3E2UA 1JBMA 2XDDA 2P0PA 3SHWA 5IXFA 2MOXA 2D6FA 4AFSC 1BCOA 1AHJB 1MNDA 4M78E 3ASKA 1AWJA 3A5ZB 1SKUB 2DD4A 2PNIA 3A1PA 4M77E 3V7CA 3JB9D 2OX7A 4BUGA 2VXFA 3R6NA 2CT3A 4A4HA 2E5QA 1M2VB 2ABLA 3VV0A 1N9RA 2A7YA 1VQOQ 3CC7T 3RR6A 1QVGA 4PFZA 1QP3A 5AYFA 2VB6A 2K7AA 2E3IA 1YITQ 1GBRA 2DIGA 5FRNA 2NWMA 3MP8A 4N4IA 4N4HA 4RMOA 1FXXA 2DL7A 4CC4B 1C6VX 2KXCA 4N0AC 4EMKB 2FG0A 3VS4A 3OYIA 1RACB 2LTOA 5CKBA 2R58A 2DEQA 3GPLA 3JCMQ 2GF7A 2C06A 1M2OA 3KUFA 3JCMf 4BE0A 2BZXA 1YHQQ 2LJ1A 4Y91A 2LDMA 5CIUA 5KCHA 1VQKT 4DOWA 3JCMP 1M5Q1 4M78D 2CDTA 4J9IA 4Y28E 4OB1B 5LJ5h 3M0TA 3CPFA 2LT1A 1SF9A 2ENMA 4F17A 2EGCA 2QDLA 2MMPA 3ULRB 1B34B 1ZBXA 2E3HA 2JM9A 2COYA 4EMHA 3RKYA 1QVGS 1LCKA 1OPKA 3EFOA 5HK3A 1M90C 1ZA1B 2RM4A 1VQ9A 4ME7A 4XU1A 2XDBA 3S6WA 1FYNA 1Y07A 5I21A 1B3QA 2SRCA 2QEXT 3G4SA 2PVOB 4C8QD 2QA4Q 1JJ2S 3MJXA 4QVDA 1K4US 3SWNC 4DEXA 1UJ0A 1MV0B 1ZBJA 3I56T 3I35A 4QQGA 4BY6B 2HL3A 2RQRA 5HKCA 3BDUA 4M75G 1UHCA 2JJ9A 5GMKh 5HK0A 3OBWA 1VQ6A 2X4WA 1Z9QA 4GY5A 1M1FA 2AKKA 4MDWA 2XG8D 4QVZA 3R6OA 2D8HA 3VS5A 4ZN3A 2KYBA 2DVEA 4DBQA 3PIOA 2MCNA 2OTJT 2LP5A 4HVUA 1KK7A 4OB3B 1NEGA 3X26B 3VUBA 3S3NA 5LJ5d 5GAN6 3I5SA 5IHKA 5I11A 2L89A 2FRWA 4RG2A 2CP5A 2M9UA 4D8DA 2GFAA 1GCPA 1RAHB 2HSPA 1I1JA 4C92F 1IGQA 4KUDK 1X6GA 3EGUA 1ACMB 3TREA 4C8QE 3L1AA 1UDLA 2HAXA 5CCAA 1VQ9Q 4E7LA 1YJNA 1KQSP 5LL6S 1VQ5A 2JM8A 1N6AA 2KY9A 1QWFA 1W2BP 2DEUA 2X9HA 4PJOD 2LCLA 3RERA 3TSZA 2FL7A 2Z0WA 3H8ZA 3NMZC 3QJ6A 2COWA 4M75B 4BE1A 2RJDA 2K79A 1ZSZA 3TVTA 4VUBA 1Y0MA 3IQLA 2KGTA 1VQPT 1W2BA 2BIVA 2FPEA 2DF6A 2KRSA 3OW2P 3VS0A 4M78A 3VYGA 3G6EQ 2EYQA 1BI2A 2V26A 5GAN2 2D0NA 5IAYA 1AT1B 4LUDA 3P8DA 3SDZA 1OQKA 2BKDN 2K9GA 1WQWA 4JJNK 3P8HA 3CCSA 5J26A 1VQ4T 1BU1A 3LW5E 3OYFA 4GBQA 1Q81C 2E70A 3JSCA 1DJ7B 5J3BA 3NTIA 2ZPHB 2KAFA 3G71T 4M75D 2XI9A 3FLGA 4IKFA 5GAMf 4OMLA 4J9GA 4IIOA 3JCMW 2VVKA 1QW1A 2JXBA 2EYZA 4J7FA 1RABB 2DKGA 1JEGA 1EIFA 1T0HA 2E64A 3CCQA 2RI2A 3PNWC 3QO3A 1SHFA 2HQEA 2XD0A 2BTTA 3M9QA 1YJ9A 1JO8A 2EYWA 1RAAB 5GAMh 6AT1B 3NGPA 5KE2A 3HFOA 2HNIA 3G4ST 4ANJA 3DB4A 1VIEA 3SD4A 2YHTA 4F04B 1AOJA 1TH7A 4BI8B 3EGDB 2DJQA 2KI7A 2EQIA 4LDVA 2MAMA 2JOYA 1WHHA 4Z88A 2QAZA 3N5BB 2JS0A 2OTJA 2PUOB 3UPUA 2YDLA 1VQMQ 1RI0A 3JV3A 2HQHA 1WIEA 4LUEA 1PSEA 3TQ7P 3RKXA 3HKSA 1VQMT 1X69A 3BY7A 2CT4A 2LCSA 2DVJA 5LJ3j 1UGRB 1TSFA 4FSSA 2RD1A 3EG3A 2IIMA 2DAQA 2QTXA 2QG9B 1RAEB 3BW1A 1Q82C 3REAB 4ZGJB 3H0HA 3VU3C 2EJGA 3TSWA 2OTLA 2NUTA 4RUGA 2DRKA 1M1KC 4RKUE 3GP8A 4C8QA 1ARKA 2K4YA 3JCMh 2KMTA 1GCQA 2NUZA 4MDXA 2BZ8A 4E2FB 4AFUC 3OS0A 1OYXA 3META 3OYHA 1ZHIA 2ZPGB 2NYSA 3CCUQ 2M0OA 1ZSZB 5GJWB 1QVFS 2DL4A 1TTHB 4MMKA 3PIPA 4F7UA 1YP5A 2D9TA 1C0MA 4II1A 2MIOA 3QWXX 5A0LA 4IUTA 2ZPFB 1MMNA 2GQIA 1SEMA 4M7DC 2OAUA 3AHUA 1E6GA 2AZVA 2LJ3A 4X9CA 1I81A 1Q86U 3HRSA 2JUFA 2KK4A 1SSHA 1VQ6Q 4FYYB 1K9MR 2DXUA 1VQKA 3JCMX 4KULA 1M1GA 2JMCA 1PKTA 2L3RA 3PMTA 2EQUA 1PD1A 2M1HA 2C0OA 4RTZA 3QXEB 4OMPA 4FW2A 1VQ5T 2QA4A 3EFRA 3C94A 3OYJA 2FO0A 1XNIA 3MO8A 1YWPA 2DD5A 4R0KA 2K3BA 4FT4A 1QCOA 1YWOA 2KT8A 2AIRB 5IH2A 4PLLA 4FU6A 1OOTA 1K73C 5FRMA 3GNFB 3CBOA 1G3WA 2RQWA 2NUTB 2D8JA 2QQBA 2RB6A 2DTHA 5CK9A 4PJOB 1WPYA 2FZGB 5KYYB 1G5VA 2RO0A 2MK5A 2DZCA 3OYEA 4OMFB 5FW9A 2YUQA 2RK2A 1PD0A 2QGFB 2RQVA 1H3HA 2CUBA 4FSXA 1QP2A 4PKCC 2CP2A 2E10A 4KBMB 5GAOn 1KFZA 1Q86R 4PJOG 3EG1A 1K8AU 3ZFJA 3L2QA 2FYKA 2BE7D 1B7TA 1VOMA 3RBBB 2GBQA 4J6YA 3M0RA 2CSIA 3OB9A 1AWOA 1PHTA 2KEAA 1M1KR 2DYIA 2EJ9A 1AWXA 3JAME 2J6OA 1WNLA 1ZSZC 2JZ2A
chains in the Genus database with same CATH topology
1OZ2A 4IURA 4M7AB 4A4KA 2LTOA 3UT1A 4A4GA 4M75F 5CKBA 2QQAA 2DEQA 2R58A 3PT9A 3GPLA 2WACA 4C92D 4M77C 1YBYA 2QQ9A 3V7RA 4C0DC 2QEXA 3JCMQ 4IUPA 2DXTA 2GF7A 1KD1U 3MEUA 3JCMd 2C06A 4M7DG 3HL8A 3KUFA 3JCMf 4BE0A 2DTOA 1U1TA 5GAOr 2B8AA 1G3SA 2DK3A 4PLIA 2VV5A 3CBPA 3PGGA 4Y91A 3QHSA 1I5LA 2LDMA 5CIUA 3X28B 5KCHA 1S72T 3NFCA 1VQ7A 1VQKT 4M75A 1KQ2A 4KUIA 3JCMb 3OYYA 4DOWA 3JCMP 3G6ET 5L8RE 1YCYA 3KXTA 1M5Q1 2DXCA 4M78D 1N27A 4HCBA 1Q86C 4IUQA 4J83A 4Y28E 1X6OA 4M77D 1RL2A 4C5IA 1KHIA 1VQOT 4OB1B 1YJWA 5LJ5h 4C92B 1M1KU 4HT9A 3M4GA 3CPFA 2LT1A 4BDYA 4F7UF 3RKWA 5GMKl 1MGQA 4C8QC 1YITA 2XDPA 3M53A 5D6YA 2I2LA 3SWNB 4M7AE 3JCMe 1YHQA 2MMPA 5LJ5f 5LJ5j 2VGNA 3RUXA 3G7ZA 3QUIA 4XU2A 4MZMA 1B34B 1ZBXA 2IVWA 4XTVA 4Z02A 3CCQT 1Y96A 4E7HA 2DXBA 4M78C 3OS5A 4E47A 2EQKA 4EMHA 3DLLA 3RKYA 5DM7R 1QVGS 2LVMA 5GAN5 1GXIE 3CPWA 3WXMB 3HRUA 2LNVA 2QQRA 2Y90A 1N8RC 1K9MU 4BI3A 3T9NA 4QVCA 5HK3A 1M90C 2RM4A 1VQ9A 4ME7A 4XU1A 2XDBA 3ME9A 5EG2A 3JCMJ 5I2MA 1Y07A 3S6WA 3FB9A 5CKFA 5I21A 2QEXT 3G4SA 2PVOB 1Q81U 4C8QD 4PNOA 5A2QE 5IT9E 1YIJA 3CBMA 4QVDA 1JJ2S 1P92A 3DB3A 5D6XA 3SWNC 1OI1A 2X35A 4LDWA 3GF5A 5LJ3d 4M77B 1YI2T 4LDXA 4A54A 3A8OB 3I56T 4PJOA 4F7UE 3M56A 3V8JA 4QQGA 4JRKA 4BY6B 4C92E 3KBGA 3PTAA 4ZTJA 3A8GB 3BDUA 4M75G 4OB0B 5HKCA 3BDLA 3CCRA 5GMKh 3NTHA 4MMLA 4CRIA 2RHUA 5HK0A 3OBWA 2KVQG 1VQ6A 1VQNA 4XTYA 1QVFA 2KSSA 2X4WA 4JLIA 3LGFA 3I55A 4ZGEB 2WSFE 2K3YA 4XTXA 3I55T 2ZZDA 2R57A 4GY5A 4M7AC 3JCMc 1UGPB 1M1FA 2O4XB 4MDWA 4UC4A 3CCUT 4FL6A 2XG8D 4QVZA 2PU9B 5M9OA 3R6OA 4OVAA 1VQ8A 1SSFA 4JRQA 4ZN3A 3FDRA 4IUUA 2E6NA 4OGCA 5CQXA 1OZ3A 2DVEA 4C92C 2QDYB 3OY9A 1YI2A 3PIOA 2OTJT 3CCJT 4M7DE 2L8DA 5GMKe 4OB3B 5HY6A 3CCJA 3X26B 3L2WA 2X4XA 2G3RA 5CQYA 3QZ5B 3VUBA 2RHYA 5GMKm 5LJ5e 3S3NA 1BYMA 5LJ5d 2RHIA 2RI3A 2RJFA 4FIBA 5GAN6 1Y7XA 4TVRA 3A8LB 4L6V5 2E1HA 3INZA 4HCZA 3V7SA 2K5FA 3ZBDA 3M57A 3V8LA 2L89A 3JB9J 1WJRA 4RG2A 1I8FA 4A4FA 4BDZA 5CAIA 2M9UA 2GFAA 3TEEA 4JLGA 1IZ6A 2CYZB 3VUZA 2JTMA 2EQJA 2K57A 3E9GA 4C92F 4HA8A 3CCVT 3DKMA 3L42A 4KUDK 2RHZA 4M7DB 4F7UB 2XKOC 4C5EA 4ATOA 3UWNA 1BI1A 3HHTB 1VQLT 2E65A 3MEWA 1WJQA 3MP6A 3TREA 4C8QE 5LJ3f 4XK8E 3L1AA 2ZPBB 4C5GA 5C6SA 2HAXA 2A3LA 4CI0C 4L5GA 1KHCA 5CCAA 2VUBA 4WF2A 4ZGDB 2LX9A 3OMGA 4E7LA 4HCCA 3WVEB 4A4EA 1YJNA 2ZPEB 5LL6S 1VQ5A 4RG8A 4F7UG 1N6AA 1NPRA 2KY9A 4LD6A 3OW2S 2YRVA 2EKOA 3OYDA 3CCMT 4PJOD 4C0GA 1N8RU 2LCLA 5GANg 2FB7A 2FL7A 2D0QB 3H8ZA 3OBYA 3FEOA 4P5NA 3NTKA 3TU4K 3CCLA 1MHNA 3QJ6A 4IUVA 4ZN1A 4M75B 4BE1A 2Y4XA 2RJDA 2DIQA 3JB9G 1YJNT 2GFUA 4BD3A 3SFMA 1M4ZA 4C0ZA 4LDYA 4VUBA 5GMKj 1X75C 3X20B 1G3TA 1KQSA 3JB9H 3MHXA 1VQPT 3OYGA 1W2BA 2BIVA 1NJIC 2H3JA 3URGA 5GANh 1KG1A 4X34A 1Q82U 5GAN8 1HXDA 4M78A 1YJ9T 3VYGA 1W2BS 2LQKA 1VQ8T 4HT8A 3SWNA 3CCUA 2YLBA 2EYQA 3CPWS 3CCST 1BI2A 1JRIA 3QKJA 5DLOA 2MF2A 5GAN2 5IAYA 2RH2A 4QW2A 3QBYA 4M78F 3P8DA 4QQ6A 3SDZA 2BKDN 5LJ3h 2XHCA 3ZEHA 2PVGB 1S72A 1WQWA 2K5LA 4JJNK 3P8HA 3QYGB 2M16A 1NE8A 5J26A 3CCSA 1VQ4T 3LW5E 2K2VA 5GANf 3OYFA 2JTFA 4BI4A 1XOVA 2QI2A 1Y96B 5GMKi 4BACA 4J6XA 3CMET 4DQ2A 1Q81C 2E70A 3JSCA 4JUVA 1DJ7B 5J3BA 4E7IA 3OMCA 2CZ6B 3NTIA 2ZPHB 2KDSA 2KAFA 3G71T 2Y4YA 4M75D 2OTLT 4ELZC 2CZ1B 2PQWA 2XI9A 4OB2B 3FLGA 1I4K1 3EFSA 3P8BB 4XQ3A 5GAMf 4C8QB 4RCBA 4IKFA 4M7AA 1H3ZA 4PJOF 5CVIA 4R55A 3JCMW 4A53A 3MP1A 3OYKA 4E7KA 1QW1A 2NLUA 3QPHA 4M77A 4C0DB 4ZTFA 4J7FA 3MEVA 2DKGA 2RJEA 1WQ7A 1EIFA 3GOXA 2E64A 4C8QG 3CCEA 4DA4A 4FT2A 2DPPB 3J81E 2RI2A 3OSSC 3G6EA 3CCQA 3OW2A 2DO3A 2ZGWA 3PNWC 3QO3A 1YHQT 3CD6A 2L5QA 2HQEA 2RA2A 2DJZA 5GANe 2XD0A 3JRZA 4YTLA 3GIBA 1NZ9A 2XK0A 3M9QA 1YJ9A 3HFNA 3HSBA 4LD9K 3VKIA 2K3XA 2EJFA 5GAMh 1VUBA 3CEYA 2XU8A 1VQLA 2V8IA 4PJOC 5KE2A 3S3OA 1FX7A 2P4TA 3JCMV 3HFOA 2HNIA 2ZPIB 3Q1JA 3TCJA 3CXCA 3G4ST 3J7AF 5D6WA 3M5AA 3GNGA 4NOYA 2EWNA 1M90U 2JN0A 3DB4A 1VIEA 2E6ZA 2IG0A 2JVVA 2LRQA 3SD4A 3X24B 2EQMA 5FLXE 1ZQ1A 4FM4B 2XIDA 3LYIA 5CKEA 2YHTA 1LJOA 4BY6C 3CCLT 1LNXA 1Q7YC 2VXEA 4HKEA 1VQ7T 2GQVA 1KQ1A 3VYHB 4EMKA 3M59A 2RK1A 3FRNA 1TH7A 4C92A 3CC4A 4BI8B 3FJPA 5GAMg 4KT0E 3CC2A 3OYCA 3L2UA 5FU6B 3CC4T 1UB4A 1O75A 1BIAA 4LDVA 3QG1A 1FWZA 2AHJB 2F5TX 4M7AG 5A0DA 2MAMA 4JRIA 5GANd 1BKBA 2RJCA 3C95A 3PMIA 4M78G 2JOYA 4XU3A 4M7AF 2XICA 5GAOm 3RESA 3J80E 3L2ZA 3N5BB 2P0QA 2EAYA 2LC4A 3HRTA 2OTJA 2EFIA 3C12A 2PUOB 5J39A 3MCAB 1U8RA 4PL6A 4EMGA 5C0MA 4M78B 3UPUA 1RI0A 2O01E 4GLKA 1XQHA 3MEAA 3QIIA 1PSEA 2VGMA 3RKXA 1JJ2A 3HKSA 1VQMT 3BY7A 5IN1A 2X4YA 2ZCFB 1Y71A 4NL2A 4C92G 2JNGA 4M7DD 2QXFA 4JDSA 4NL3A 2F5KA 1R8OB 2RHXA 4NS5A 3WVDB 5LJ3j 4E7JA 3CD6T 1UGRB 3QJYA 3HPWA 5LJ5g 3M58A 4JRPA 1VQNT 1LOJA 1PSFA 2DZ9A 2EIFA 2PUKB 2RD1A 2DAQA 5GANj 3M4YA 2CZ7B 2QTXA 2E12A 1M9SA 4EPCA 2DTIA 3BW1A 4XTWA 4O5VA 3L2RA 1Q82C 4ZGJB 3OS2A 3EAEA 2KQWA 3VU3C 3A8MB 2EJGA 4M7AD 3OYMA 2OTLA 3G71A 4C8QF 3RIRA 5A0GA 3CXCS 4M75C 3FIFA 4J7IA 2O4XA 4M75E 1KC8U 1M1KC 1JB0E 4RKUE 3QSUA 3CMEA 5CO7A 4C0FA 4XU0A 3PFSA 3GP8A 1D3BB 4C8QA 3OYAA 3BFMA 2VYTA 3UDCA 2K4YA 3JCMh 1BI3A 5GAMj 2PVDB 3X25B 3OSVA 1VQ4A 2KMTA 1HK9A 3RMQA 2MWPA 3ER0A 3LWHA 4MDXA 3OS0A 1OYXA 3META 3OYHA 1ZHIA 1O9SA 2YLCA 2ZPGB 4RCCA 2CZ0B 3VJPA 2M0OA 2GCXA 2QQSA 4O6JA 4OP0A 4EMKC 3CCRT 1QVFS 5FU7B 4MMKA 5LJ3g 2FVUA 5GAOl 1YITT 3PIPA 4DOVA 2CGHA 3LX7A 4F7UA 3A8HB 3GLXA 1VIFA 4OF1A 1NJIU 3QZ9B 4PJOE 1BIBA 2D9TA 3I56A 3RERA 1N9SA 5KH6A 3OYLA 4XTZA 4II1A 5A0LA 1VQPA 4IUTA 3QYHB 1YJWT 4D6WA 2ZPFB 1YIJT 4M7DC 4N4GA 2OAUA 3AHUA 4X9CA 2LCCA 1I81A 1Q86U 1WGSA 4XTUA 5GAMd 1VQ9T 3HRSA 4R56A 3DLMA 2JUFA 2KK4A 3O8VA 3L2VA 2FHDA 3OQ5A 3S3MA 1WJSA 4ELYC 2DXUA 3SB2A 1B34A 3JCMX 3LLRA 1VQKA 4KULA 1M1GA 5FU7C 2L3RA 3E9FA 4B9WA 4MZPA 3LGLA 3F70A 3PMTA 2EQUA 1K9MC 4J5YA 2M1HA 4L59A 4N0AA 5KCOA 3FC3A 3CCMA 2E41A 1M8VA 4OGEA 2R5AA 2WSEE 3QXEB 1BI0A 3C4SA 2X4JA 4X9DA 1KC8C 1VQ5T 2QA4A 3EFRA 3C94A 1VQMA 1KD1C 4M7DF 5GAOq 3OYJA 3OYNA 5DY9A 4V2SA 1XNIA 3MO8A 1X01A 2DD5A 3HP9A 5GAN7 3LWIA 2BUDA 4FT4A 1VQOA 4J6WA 5CKDA 3OYBA 1UEBA 3LH0A 5DLQE 4J8OA 4EDUA 4Q5WA 5GAMe 2K5IA 2MWOA 4PLLA 4XAXB 4JS4A 4FU6A 2QA4T 3QDRB 3CCVA 2RI5A 1K73C 1KQSS 5FRMA 1QVPA 2HQXA 3GNFB 3CBOA 1G3WA 2CS7A 2R5MA 3OA6A 1JBMA 2F69A 3H6ZA 2QQBA 2XDDA 2P0PA 3M54A 2RB6A 1NPPA 2DTHA 5CK9A 5LJ3e 5GAN4 1Q7YU 4PJOB 1H641 1XTDA 4JS5A 1WPYA 5FROA 3CC2T 3E1SA 2D6FA 1W4SA 1AHJB 4QQDA 3E19A 2VC8A 4M78E 3ASKA 1G5VA 2HD0A 2RO0A 1K73U 1K8AC 3A5ZB 2DD4A 2DZCA 5KE3A 4M77E 3V7CA 3JB9D 3OYEA 4BUGA 2MI6A 4OMFB 2VXFA 2RK2A 2LT4A 5CKHA 4LDUA 2V8JA 4FSXA 4PKCC 1QP2A 3RMSA 4KBMB 2E10A 4B9XA 3JCMg 5GAOn 3JB9F 4A4HA 4PJOG 1UGQB 2E5QA 2LQ8A 3VV0A 5CR2A 1N9RA 1G3YA 2A7YA 1K8AU 2HBPA 3ZFJA 2FYKA 3L2QA 1D3BA 3CMAA 3CC7T 1QVGA 5I2SA 1QP3A 5AYFA 3JB9I 2WSCE 2V8KA 4J6YA 3V8KA 4M77F 2CKKA 2DIGA 1IREB 5FRNA 1V29B 1U1SA 3OB9A 3CCET 4M77G 1VQ6T 3OS1A 3M55A 3MP8A 4N4IA 4N4HA 4MZTA 4BE2A 1UGSB 4BB7A 5GAN3 2EJ9A 4C5HA 4RMOA 1FXXA 3CC7A 4M7DA 3CMAT 5FU6C 3JAME 5GAOp 4N0AC 1WNLA 4EMKB 2P0KA 2JZ2A 3OYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK m;  5LJ5 e;  4OP0 A;  4EMK C;  4M7A B;  4MMK A;  4M77 A;  4M75 F;  5LJ3 g;  5LJ5 d;  5GAN 6;  5GAO l;  4M7A A;  2DKG A;  1WQ7 A;  2CGH A;  2DEQ A;  2E64 A;  4C8Q G;  4F7U A;  4PJO E;  4C92 D;  2E1H A;  4M77 C;  3V7R A;  3INZ A;  1BIB A;  3V7S A;  3JCM Q;  1N9S A;  3V8L A;  3JB9 J;  2ZGW A;  3QO3 A;  4XTZ A;  1I8F A;  2DXT A;  2RA2 A;  5CAI A;  4M7D G;  3JCM d;  2DJZ A;  3JCM f;  5GAN e;  3GIB A;  2DTO A;  3HFN A;  1U1T A;  3HSB A;  4M7D C;  3AHU A;  5GAO r;  2K57 A;  4X9C A;  4C92 F;  4HA8 A;  1I81 A;  4XTU A;  2EJF A;  5GAM d;  4M7D B;  3PGG A;  5GAM h;  4Y91 A;  3QHS A;  4F7U B;  1I5L A;  1KQ2 A;  4PJO C;  4M75 A;  3JCM V;  2DXU A;  2E65 A;  3HFO A;  2HNI A;  1B34 A;  3SB2 A;  3JCM X;  3JCM b;  3JCM P;  1YCY A;  4C8Q E;  4NOY A;  1M5Q 1;  2EWN A;  4M78 D;  2JN0 A;  3L1A A;  5LJ3 f;  4J5Y A;  4N0A A;  2YHT A;  1LJO A;  4WF2 A;  1LNX A;  2E41 A;  4M77 D;  2VXE A;  1M8V A;  1KQ1 A;  4EMK A;  5LJ5 h;  4C92 B;  1TH7 A;  4C92 A;  4HT9 A;  4X9D A;  3M4G A;  3FJP A;  5GAM g;  3EFR A;  4M7D F;  4F7U F;  3RKW A;  5GAO q;  1BIA A;  4F7U G;  5GMK l;  1MGQ A;  5DY9 A;  4V2S A;  4C8Q C;  4M7A G;  1X01 A;  5GAN 7;  2I2L A;  4JRI A;  3SWN B;  4PJO D;  5GAN d;  4M7A E;  5GAN g;  3JCM e;  4J6W A;  2FB7 A;  3RER A;  4M78 G;  4XU3 A;  5LJ5 f;  3RUX A;  5LJ5 j;  4XU2 A;  3QUI A;  5GAO m;  3RES A;  1B34 B;  4M75 B;  4M7A F;  4XTV A;  3L2Z A;  5GAM e;  1Y96 A;  2EAY A;  4M78 C;  3JB9 G;  4EMH A;  3RKY A;  4PJO F;  4EMG A;  5GAN 5;  4M78 B;  1JBM A;  2Y90 A;  5GMK j;  4QVC A;  2RB6 A;  3JB9 H;  2DTH A;  5LJ3 e;  5GAN 4;  2RM4 A;  3RKX A;  4PJO B;  1H64 1;  4XU1 A;  1WPY A;  3JCM J;  3BY7 A;  3FB9 A;  5I21 A;  4NL2 A;  5GAN h;  4C92 G;  5GAN 8;  1HXD A;  4PNO A;  4M78 A;  4C8Q D;  2VC8 A;  4M78 E;  4NL3 A;  4M7D D;  4QVD A;  5LJ3 j;  3SWN C;  4HT8 A;  3SWN A;  2DZC A;  2YLB A;  4M77 E;  5LJ3 d;  4M77 B;  3V7C A;  1JRI A;  1LOJ A;  5LJ5 g;  4A54 A;  2RD1 A;  2DZ9 A;  5GAN j;  3JB9 D;  4F7U E;  5GAN 2;  4PJO A;  5LJ3 h;  3V8J A;  2QTX A;  2VXF A;  4M78 F;  4JRK A;  4C92 E;  2DTI A;  3BW1 A;  3BDU A;  4M75 G;  4XTW A;  2E10 A;  3JB9 F;  3JCM g;  5GAO n;  5GMK h;  4MML A;  4PJO G;  1WQW A;  3VU3 C;  2EJG A;  4XTY A;  4M7A D;  1N9R A;  4JLI A;  2FYK A;  1D3B A;  4C8Q F;  5GAN f;  3RIR A;  4M75 C;  3FIF A;  4XTX A;  3JB9 I;  4M75 E;  1Y96 B;  4J6Y A;  4M77 F;  4J6X A;  3V8K A;  5GMK i;  4M7A C;  3JCM c;  4DQ2 A;  3QSU A;  4JUV A;  4XU0 A;  1D3B B;  1U1S A;  4C8Q A;  3BFM A;  4M77 G;  3JCM h;  5GAM j;  5GAN 3;  4M75 D;  2DVE A;  1HK9 A;  2EJ9 A;  4C92 C;  4M7D A;  4M7D E;  1I4K 1;  3EFS A;  4XQ3 A;  5GMK e;  5GAM f;  4C8Q B;  4N0A C;  4RCB A;  5GAO p;  1WNL A;  4EMK B;  2YLC A;  4RCC A;  3JCM W;  4A53 A; 
#chains in the Genus database with same CATH topology
 1MUZ A;  4M7A B;  2W10 A;  2QQA A;  3PT9 A;  4C92 D;  1YBY A;  2QQ9 A;  1UFF A;  1N8R R;  2DXT A;  1MMA A;  1KD1 U;  2HMA A;  1TOV A;  4PJL A;  2VWF A;  2DTO A;  5GAO r;  2B8A A;  3CCJ Q;  1H8K A;  2DK3 A;  4PLI A;  1TG0 A;  1OV3 A;  3CBP A;  3PGG A;  3QHS A;  1I5L A;  2RQT A;  4EIK A;  3CCE Q;  3CCS Q;  4Z89 A;  3JCM b;  2L0A A;  3G6E T;  5L8R E;  4HVV A;  2DXC A;  3VS1 A;  1N27 A;  2NUP B;  1RL2 A;  4C5I A;  1KHI A;  5D7U A;  2AT1 B;  4HT9 A;  2C0T A;  1RLQ C;  4F7U F;  3RKW A;  5GMK l;  2W0Z A;  2YUN A;  2XDP A;  2I2L A;  5LJ5 j;  4MZM A;  4XTV A;  2DXB A;  4E47 A;  2YSQ A;  2LVM A;  5GAN 5;  1GXI E;  3CMA Q;  1K9M U;  4QVC A;  2CP3 A;  1YFN A;  3FB9 A;  4J9H A;  5AT1 B;  5A2Q E;  5IT9 E;  1YIJ A;  2DA9 A;  3AT1 B;  3DB3 A;  5D6X A;  1OI1 A;  3CD6 Q;  3GF5 A;  3A8O B;  4PJO A;  4F7U E;  1GBQ A;  3KBG A;  1M90 R;  1CSK A;  3A8G B;  4OB0 B;  3CCR A;  2J6F A;  2RMO A;  2RHU A;  2KVQ G;  1QVF A;  4JLI A;  1NG2 A;  2WSF E;  4XTX A;  4M7A C;  2O4X B;  3G4S Q;  1ZA2 B;  1YJ9 Q;  1X6B A;  3VRY A;  1QVF P;  2KXD A;  1UHF A;  1S72 Q;  1SSF A;  3FDR A;  4OGC A;  5CQX A;  3H9N A;  2DLP A;  2L8D A;  3CCJ A;  3RNJ A;  3L2W A;  2X4X A;  2DL3 A;  2G3R A;  1Q81 R;  1BYM A;  2RF0 A;  3UAT A;  2LJ0 A;  3A8L B;  3ZBD A;  3JB9 J;  3M57 A;  2M0Y A;  5CAI A;  2LQW A;  3QWY A;  3TEE A;  1IZ6 A;  3VUZ A;  2JTM A;  8ATC B;  4M7D B;  2KBT A;  4F7U B;  3PE0 A;  1R0B G;  3MEW A;  2ZPB B;  5C6S A;  1N5Z A;  2A3L A;  2SEM A;  4CI0 C;  2VUB A;  4ZGD B;  3D7S B;  4HVW A;  3WVE B;  1ABQ A;  4RG8 A;  1NPR A;  1LPL A;  4LD6 A;  4LXC A;  1V1C A;  4C0G A;  1N8R U;  2RQU A;  5GAN g;  4AG2 C;  4JPB W;  2FB7 A;  3OBY A;  2DE0 X;  3FEO A;  3NTK A;  4KH0 B;  1MHN A;  4IUV A;  4ZN1 A;  1I0C A;  2Y4X A;  1VYT A;  2A37 A;  3JB9 G;  1YJN T;  3QDF A;  2X3W D;  3CC4 Q;  5GMK j;  1X75 C;  3X20 B;  1G3T A;  2JTE A;  1WFW A;  2HBW A;  1VQN Q;  3NPF A;  1KG1 A;  1HXD A;  1SHG A;  2LQK A;  1VQ8 T;  1FMW A;  1U06 A;  3CCU A;  1VQL Q;  2F2V A;  2ESW A;  3CCS T;  1WHJ A;  3QKJ A;  5DLO A;  2G6F X;  2MF2 A;  3O5Z A;  5LJ3 h;  2RH2 A;  4E7S A;  5HCK A;  3ZEH A;  1S72 A;  2LNH B;  2EYY A;  1ZUY A;  1YNZ A;  4J6X A;  1M3C A;  3EG9 A;  2FPF A;  4E7I A;  2OI3 A;  1PCX A;  2OTL T;  4K11 A;  2MPX C;  1I4K 1;  3EFS A;  1GRI A;  3MPU B;  4C8Q B;  3UA6 A;  4PJO F;  3OYK A;  1KJW A;  4E7K A;  2NLU A;  1RAI B;  1M90 U;  1WQ7 A;  4DA4 A;  3J81 E;  3OW2 A;  2DO3 A;  1YHQ T;  4PK4 A;  2DJZ A;  2XK0 A;  3HFN A;  3VKI A;  1D0X A;  1FX7 A;  3JCM V;  2ZPI B;  3Q1J A;  4OMQ A;  3CXC A;  2J06 A;  2DBK A;  1IRX A;  2E6Z A;  2IG0 A;  2EQM A;  1U8R A;  3LYI A;  5CKE A;  4BY6 C;  2CP7 A;  1LNX A;  1VQ7 T;  2COZ A;  2GQV A;  3M59 A;  3FRN A;  5GAM g;  4KT0 E;  3CC2 A;  1HD3 A;  3OYC A;  3L2U A;  1UB4 A;  1BIA A;  2AHJ B;  1K9A A;  4JRI A;  2BZY A;  5GAN d;  3PMI A;  4RTT A;  4E7Z A;  3J80 E;  3L2Z A;  2EAY A;  5J39 A;  1IHV A;  4EMG A;  3EGD A;  5C0M A;  1E7O A;  3QII A;  3EG0 A;  1UGV A;  3PVQ A;  1KSW A;  2ZCF B;  4NL2 A;  2JNG A;  4M7D D;  2QXF A;  1YJN Q;  2RHX A;  2DL8 A;  4NS5 A;  4E7J A;  1VQ8 Q;  2E12 A;  1HJD A;  2DTI A;  3L2R A;  2M02 A;  4DEY A;  3EAE A;  1RLP C;  3OYM A;  1E6H A;  3G71 A;  4PJM A;  1BB9 A;  3I56 Q;  3FIF A;  1KC8 U;  4FYX B;  1JB0 E;  1NBE B;  5CO7 A;  4C0F A;  3OYA A;  3UDC A;  5GAM j;  3UF4 A;  1VQ5 Q;  1VQ4 A;  3LWH A;  3ER0 A;  2DL5 A;  1YIJ Q;  4RCC A;  2CZ0 B;  3VJP A;  4OP0 A;  4O6J A;  4EMK C;  1I5O B;  3CCR T;  2FVU A;  5IXB A;  1RI9 A;  1YIT T;  2CGH A;  3H41 A;  3A8H B;  1VIF A;  4OF1 A;  3QZ9 B;  1BIB A;  2CSQ A;  4OMO A;  1Z9Z A;  4D6W A;  1UE9 A;  1YIJ T;  2FRY A;  1WA7 A;  3C0C A;  1WGS A;  1TS9 A;  3O8V A;  2FHD A;  3S3M A;  1WJS A;  1ZUU A;  5FU7 C;  2V1Q A;  3LH5 A;  3E9F A;  3F70 A;  1I07 A;  2I0N A;  2DNU A;  4N0A A;  2CP0 A;  2F2W A;  1BI0 A;  3C4S A;  1M8M A;  4X9D A;  4ESR A;  1KC8 C;  4M7D F;  4FCY A;  5GAO q;  3OYN A;  2VAS A;  5GAN 7;  3LWI A;  5KYX B;  4J6W A;  2FZC B;  5CKD A;  1D1A A;  5DLQ E;  4J8O A;  4FW1 A;  4Q5W A;  4J9C A;  2K5I A;  4XAX B;  3QDR B;  3CCV A;  2RI5 A;  1KQS S;  3CC2 Q;  2F69 A;  3H6Z A;  1NPP A;  5LJ3 e;  1H64 1;  3CC2 T;  2B86 A;  3E1S A;  1W4S A;  4QQD A;  1MMG A;  3E19 A;  2HD0 A;  1K73 U;  3M0Q A;  4KGX B;  1R0C B;  1NLO C;  5KE3 A;  2LMJ A;  2LT4 A;  5CKH A;  1M30 A;  3JB9 F;  3BE3 A;  1T3S A;  2LQ8 A;  1G3Y A;  2HBP A;  2XMF A;  5I2S A;  2AZS A;  1QCF A;  3JB9 I;  2AKL A;  2WSC E;  2GTO A;  2V8K A;  4M77 F;  2CKK A;  3EH1 A;  2ROT A;  1U1S A;  2KR3 A;  3CCE T;  2QEX Q;  2JS2 A;  4PFO A;  3M55 A;  4MZT A;  4BE2 A;  1UGS B;  4CC2 A;  3G71 Q;  4M7D A;  5FU6 C;  5GAO p;  3RDV A;  3MKD A;  4GLM A;  1OZ2 A;  4IUR A;  4B6M A;  1NLP C;  2K6D A;  2WAC A;  4C0D C;  5FWB A;  4DBR A;  4IUP A;  1OU8 A;  3MEU A;  4M7D G;  4RTW A;  4AFZ C;  1U1T A;  1TUD A;  4HCK A;  3X28 B;  1VQ7 A;  2O88 A;  1R77 A;  3OYY A;  2DIL A;  5KYY A;  4HXJ A;  2FEI A;  1WXT A;  2L3P A;  4HCB A;  1Q86 C;  1UTI A;  3EGX B;  4M77 D;  1YJW A;  2OTL Q;  1M1K U;  3KFV A;  3M0S A;  3M4G A;  9ATC B;  1VYU A;  4C8Q C;  1WYX A;  4M7A E;  1T0J A;  5LJ5 f;  2VGN A;  3G7Z A;  4XU2 A;  2IVW A;  4Z02 A;  1Y96 A;  4M78 C;  5GJV B;  3DLL A;  1S1N A;  5DM7 R;  4AT1 B;  3HRU A;  2QQR A;  2Y90 A;  1N8R C;  2H3E B;  4KRT A;  4BI3 A;  2ROL A;  3ME9 A;  5EG2 A;  3JCM J;  1Q81 U;  1AD5 A;  3CBM A;  1P92 A;  1WHK A;  2X35 A;  4LDW A;  2QGG A;  2HKN A;  5LJ3 d;  1ZLM A;  4LDX A;  4A54 A;  1VQK Q;  1TWB A;  3BDL A;  3NTH A;  4CRI A;  2YUP A;  2KSS A;  1U3O A;  1NYF A;  1WHM A;  1X2Q A;  2R57 A;  3JCM c;  1UGP B;  2YRD A;  4FL6 A;  4AMC A;  2PU9 B;  1VQ8 A;  4OVA A;  4IUU A;  3CQT A;  2QYZ A;  1OZ3 A;  4M7D E;  2H8H A;  2CRE A;  5CQY A;  3QZ5 B;  5LJ5 e;  2RHY A;  2RI3 A;  3SEM A;  1Y7X A;  3H0F A;  1X43 A;  1M3A A;  4LE9 A;  4HCZ A;  2K5F A;  3V8L A;  1WJR A;  1I8F A;  4A4F A;  4BDZ A;  2JMA A;  2X3X D;  2EQJ A;  2K57 A;  3CCV T;  4HA8 A;  3DKM A;  2RHZ A;  2XKO C;  4C5E A;  1T3L A;  1BI1 A;  1YI2 Q;  3HHT B;  1VQL T;  3MP6 A;  5LJ3 f;  1AZG B;  4C5G A;  4L5G A;  2BE9 B;  4FYV B;  1UG1 A;  3OMG A;  4HCC A;  4F7U G;  2HCK A;  2YRV A;  2EKO A;  3CCM T;  4QT7 A;  5KYX A;  4P5N A;  3CCL A;  1RAD B;  1MMD A;  2GFU A;  4BD3 A;  1M4Z A;  4C0Z A;  3JB9 H;  5IHI A;  3OYG A;  2EYX A;  4KGZ B;  2K2M A;  4X34 A;  1Q82 U;  5GAN 8;  1YJ9 T;  1W2B S;  2A0F B;  2X51 A;  3THK A;  2HEQ A;  3UA7 A;  2YUO A;  3QBY A;  4M78 F;  2CH4 A;  2RPN A;  5KYU B;  2K5L A;  3QYG B;  1QKX A;  2M16 A;  2ZAE A;  1WX6 A;  1WHG A;  2K2V A;  5GAN f;  4Y92 A;  2JTF A;  2QI2 A;  5GMK i;  1ABO A;  3CME T;  2RN8 A;  1QVG P;  1K1Z A;  4JUV A;  4CC7 A;  5FWC A;  3OMC A;  1CKB A;  2KDS A;  2Y4Y A;  4ELZ C;  3P8B B;  1UEC A;  1K0X A;  2DYB A;  1H3Z A;  2PTK A;  4OMN A;  4R55 A;  4A53 A;  3MP1 A;  4C0D B;  2GNC A;  2RJE A;  3CCE A;  3GOX A;  4C8Q G;  2DER A;  4RTY A;  4FT2 A;  2DPP B;  3OSS C;  2ZGW A;  3CD6 A;  2L5Q A;  2RA2 A;  4WCI A;  5GAN e;  1SRL A;  3GIB A;  4KH1 B;  1PNJ A;  3HSB A;  2P4R A;  4LD9 K;  2EGA A;  1VUB A;  3CEY A;  2XU8 A;  1VQL A;  2V8I A;  4PJO C;  4FYW B;  4E6R A;  4WTO B;  3TCJ A;  3J7A F;  5D6W A;  4NOY A;  2JT4 A;  5IHN A;  2EWN A;  2JN0 A;  2LRQ A;  3G6E A;  5FLX E;  1LJO A;  2KNB B;  2VXE A;  1D0Y A;  1KQ1 A;  1G8X A;  2RK1 A;  3CC4 T;  5FU6 B;  3QG1 A;  1FWZ A;  1JJ2 P;  1HYO A;  2O9S A;  2DMO A;  4M78 G;  4J9E A;  3VS3 A;  4M7A F;  2XIC A;  5GAO m;  3RES A;  2LC4 A;  3HRT A;  3CCR Q;  2EFI A;  3C12 A;  1WZO A;  2GGR A;  5KYN A;  3FJ5 A;  1XQH A;  1GFC A;  2VGM A;  1JJ2 A;  1RAG B;  4JZ3 A;  1D09 B;  2X4Y A;  1Y71 A;  4JDS A;  4NL3 A;  2F5K A;  1PWT A;  3HPW A;  1MNE A;  2YRC A;  5LJ5 g;  1VQN T;  2EIF A;  2DZ9 A;  2PUK B;  3I9Q A;  3M4Y A;  4O5V A;  1NJI R;  3VRZ A;  3A8M B;  3EHR A;  4M7A D;  4C8Q F;  4M75 C;  4J7I A;  2O4X A;  2QTV A;  2RNA A;  3CME A;  1OU9 A;  4XU0 A;  3PFS A;  3BFM A;  2VYT A;  2PVD B;  1J3T A;  3X25 B;  2OTJ Q;  1HK9 A;  3A98 A;  2D1X A;  5I22 A;  1O9S A;  2GCX A;  2QQS A;  5GAO l;  1QQJ A;  3G1J A;  3GLX A;  3I56 A;  5KH6 A;  3OYL A;  1VQP A;  3QYH B;  2LCC A;  1VQ9 T;  2ATC B;  3OQ5 A;  4ELY C;  1TUC A;  4MZP A;  2ED0 A;  1JXM A;  3LGL A;  1K9M C;  2LQN A;  5KCO A;  1M8V A;  4OGE A;  2WSE E;  4J9B A;  1KD1 C;  1VQM A;  3EH2 A;  5DY9 A;  2NUP A;  5KYU A;  1X01 A;  1GCQ C;  2KRM A;  1HSQ A;  1QKW A;  1FMV A;  1UEB A;  3LH0 A;  3PVL A;  1UUE A;  4JS4 A;  2HZY A;  1SPK A;  5ECA A;  2CS7 A;  1ZX6 A;  1KD1 R;  1EFN A;  1VQP Q;  2L2P A;  2J05 A;  3M54 A;  3EGX A;  5GAN 4;  1Q7Y U;  1XTD A;  4JS5 A;  5FRO A;  1IXD A;  4AG1 C;  2DM1 A;  2VC8 A;  1K8A C;  2MI6 A;  2HDA A;  3RMS A;  4LDU A;  2V8J A;  4B9X A;  3JCM g;  2VKN A;  2CH4 W;  1PC0 A;  1UGQ B;  5CR2 A;  1D3B A;  2EKH A;  3CMA A;  3EG2 A;  1OPL A;  2LZ6 B;  2CP6 A;  3V8K A;  1IRE B;  1V29 B;  2QAS A;  4M77 G;  1VQ6 T;  3OS1 A;  1NYG A;  1YN8 A;  4A63 B;  2OJ2 A;  4BB7 A;  5GAN 3;  4C5H A;  3CC7 A;  3CMA T;  2KE9 A;  2P0K A;  4A4K A;  3UT1 A;  4A4G A;  4M75 F;  2EVR A;  4F16 A;  4M77 C;  3V7R A;  2QEX A;  2A36 A;  1EZZ B;  1NM7 A;  3JCM d;  1KIK A;  3HL8 A;  2E5K A;  1G3S A;  2VV5 A;  1OUL A;  1FMK A;  1KQ2 A;  1S72 T;  3NFC A;  1WLP B;  4M75 A;  3VS6 A;  4KUI A;  1D0Z A;  1VYV A;  2EW3 A;  1YCY A;  3KXT A;  1IB8 A;  4IUQ A;  2AK5 A;  4J83 A;  1X6O A;  1VQO T;  4C92 B;  2FPD A;  4RTX A;  2J7I A;  1VA7 A;  4BDY A;  1MGQ A;  1YIT A;  5D6Y A;  3M53 A;  2HSE B;  2F2X A;  3SWN B;  3JCM e;  1YHQ A;  1AVZ C;  3RUX A;  3QUI A;  2A08 A;  3CCQ T;  3U23 A;  4E7H A;  3OS5 A;  1QLY A;  2EQK A;  8AT1 B;  1XJW B;  3CPW A;  3WXM B;  2LNV A;  1ZSG A;  2JW4 A;  3H0I A;  3T9N A;  1V76 A;  5I2M A;  2C0I A;  5CKF A;  4PNO A;  1QWE A;  5KYW B;  1G2B A;  4M77 B;  1YI2 T;  1WI7 A;  1OEB A;  3M56 A;  3V8J A;  3CPW P;  4JRK A;  4C92 E;  3PTA A;  4ZTJ A;  4RTV A;  7AT1 B;  4MML A;  1VQN A;  4XTY A;  3LGF A;  3M0U A;  2EPD A;  3I55 A;  1ZUK A;  4ZGE B;  1W1F A;  2K3Y A;  3I55 T;  2ZZD A;  4M4Z A;  5EC7 A;  2DET A;  2YT6 A;  4UC4 A;  3CCU T;  5M9O A;  4JJD A;  4JRQ A;  2E6N A;  4IIM A;  4C92 C;  3OY9 A;  1AZE A;  2QDY B;  1YI2 A;  3CCJ T;  5GMK e;  5HY6 A;  4RTU A;  4PJJ A;  5GMK m;  2KRO A;  2RHI A;  1LVK A;  2RJF A;  4FIB A;  4TVR A;  4L6V 5;  2E1H A;  3INZ A;  3V7S A;  1K8A R;  2CUD A;  4JLG A;  2CYZ B;  1SG5 A;  3E9G A;  1UJY A;  3L42 A;  2O31 A;  3CCL Q;  1PRM C;  4ATO A;  3UWN A;  1A0N B;  2E65 A;  2QK0 A;  1WJQ A;  2GTJ A;  4XK8 E;  2O2O A;  1Q82 R;  1KHC A;  1BK2 A;  4LN2 A;  4WF2 A;  2DRM A;  2LX9 A;  1PG5 B;  4A4E A;  2ZPE B;  3VS2 A;  3OW2 S;  4ORZ A;  1G83 A;  3OYD A;  1M27 C;  3CME Q;  1M3B A;  4KGV B;  4JZ4 A;  2D0Q B;  3TU4 K;  2L3S A;  2DIQ A;  2J6K A;  1X2K A;  4DBH A;  1WXB A;  3SFM A;  3VS7 A;  4LDY A;  1KQS A;  1EX4 A;  3MHX A;  2DBM A;  1NJI C;  2H3J A;  2HKQ B;  2DX1 A;  3URG A;  4CC3 A;  4J9D A;  5GAN h;  4HT8 A;  3SWN A;  1SRM A;  2YLB A;  3CPW S;  4ZNX A;  2FZK B;  1JRI A;  2KYM A;  1W6X A;  4QW2 A;  4QQ6 A;  4JJC A;  2XHC A;  1AWW A;  2PVG B;  1QMC A;  1NE8 A;  2YWW A;  3CCQ Q;  3GBQ A;  4BI4 A;  2KT1 A;  2O9V A;  2PZ1 A;  4PJN A;  1XOV A;  3ZL7 C;  1Y96 B;  4BAC A;  4DQ2 A;  1WDX A;  2DFU A;  2CZ6 B;  1TU0 B;  1M2V A;  2CZ1 B;  1VQ7 Q;  2PQW A;  4OB2 B;  4XQ3 A;  1PRL C;  4RCB A;  5CVI A;  5L23 A;  1IHW A;  2EGE A;  3QPH A;  4M77 A;  4ZTF A;  4M7A A;  3MEV A;  5KYW A;  3EHQ A;  1RAF B;  4LNP A;  2P84 A;  1WXU A;  2F1L A;  2KRN A;  1BCM A;  1VQ4 Q;  1Q95 G;  3JRZ A;  4YTL A;  1NZ9 A;  1K76 A;  2MYS A;  2K3X A;  2EJF A;  1NEB A;  3S3O A;  2P4T A;  3M0P A;  2YXY A;  3M5A A;  3GNG A;  3X24 B;  2JVV A;  1ZQ1 A;  4FM4 B;  2XID A;  3CCL T;  1Q7Y C;  4JJB A;  4HKE A;  3VYH B;  4EMK A;  3CCV Q;  4C92 A;  3CC4 A;  3FJP A;  1PM3 A;  1O75 A;  3HTR A;  1MV3 A;  2F5T X;  4M7A G;  5A0D A;  4AFQ C;  1IGU A;  1BKB A;  2RJC A;  4F14 A;  3C95 A;  4XU3 A;  4OMM A;  2P0Q A;  3CCM Q;  3MCA B;  4PL6 A;  1WHL A;  1TXQ A;  4M78 B;  3EFO B;  2O01 E;  4GLK A;  3MEA A;  5IN1 A;  1BBZ A;  4C92 G;  1R8O B;  1TUG B;  3WVD B;  3CD6 T;  1AEY A;  3QJY A;  3EG9 B;  3CXC P;  3M58 A;  4JRP A;  1YCS B;  1LOJ A;  1PSF A;  5GAN j;  3CC7 Q;  1JU5 C;  2CZ7 B;  4Z8A A;  1M9S A;  1X27 A;  4EPC A;  4XTW A;  2M51 A;  3OS2 A;  3I5R A;  2KQW A;  4X1V A;  1K0S A;  1PKS A;  2OAW A;  3RIR A;  5A0G A;  3CXC S;  4M75 E;  1GFD A;  1JXO A;  3QSU A;  1D3B B;  4PFP A;  1BI3 A;  4D8K A;  4J9F A;  3OSV A;  3RMQ A;  2MWP A;  3REB B;  1C1A A;  2YLC A;  1OX8 A;  2A28 A;  4QKU A;  2IPO B;  5FU7 B;  5LJ3 g;  2ECZ A;  1JQQ A;  4DOV A;  3LX7 A;  2EBP A;  1K73 R;  4PJO E;  2ED1 A;  1RUW A;  1NJI U;  2E4H A;  1N9S A;  4XTZ A;  2L3Q A;  1YJW T;  1W70 A;  4N4G A;  1D1B A;  1YJW Q;  1Y57 A;  4XTU A;  5GAM d;  4R56 A;  1GL5 A;  3DLM A;  3L2V A;  1D1C A;  1U5S A;  4DBF A;  1B07 A;  3SB2 A;  1B34 A;  1Q7Y R;  3LLR A;  4B9W A;  4J5Y A;  4L59 A;  3FC3 A;  1F1B B;  2E41 A;  2HL5 C;  3CCM A;  3NHN A;  1IO6 A;  2R5A A;  1QCN A;  1OX9 A;  2LX7 A;  2X4J A;  2V1R A;  1CKA A;  4V2S A;  3HP9 A;  2BUD A;  1KC8 R;  1VQO A;  3I55 Q;  3OYB A;  4EDU A;  5GAM e;  2MWO A;  2QA4 T;  1QVP A;  2HQX A;  3OA6 A;  1H92 A;  2R5M A;  3E2U A;  1JBM A;  2XDD A;  2P0P A;  3SHW A;  5IXF A;  2MOX A;  2D6F A;  4AFS C;  1BCO A;  1AHJ B;  1MND A;  4M78 E;  3ASK A;  1AWJ A;  3A5Z B;  1SKU B;  2DD4 A;  2PNI A;  3A1P A;  4M77 E;  3V7C A;  3JB9 D;  2OX7 A;  4BUG A;  2VXF A;  3R6N A;  2CT3 A;  4A4H A;  2E5Q A;  1M2V B;  2ABL A;  3VV0 A;  1N9R A;  2A7Y A;  1VQO Q;  3CC7 T;  3RR6 A;  1QVG A;  4PFZ A;  1QP3 A;  5AYF A;  2VB6 A;  2K7A A;  2E3I A;  1YIT Q;  1GBR A;  2DIG A;  5FRN A;  2NWM A;  3MP8 A;  4N4I A;  4N4H A;  4RMO A;  1FXX A;  2DL7 A;  4CC4 B;  1C6V X;  2KXC A;  4N0A C;  4EMK B;  2FG0 A;  3VS4 A;  3OYI A;  1RAC B;  2LTO A;  5CKB A;  2R58 A;  2DEQ A;  3GPL A;  3JCM Q;  2GF7 A;  2C06 A;  1M2O A;  3KUF A;  3JCM f;  4BE0 A;  2BZX A;  1YHQ Q;  2LJ1 A;  4Y91 A;  2LDM A;  5CIU A;  5KCH A;  1VQK T;  4DOW A;  3JCM P;  1M5Q 1;  4M78 D;  2CDT A;  4J9I A;  4Y28 E;  4OB1 B;  5LJ5 h;  3M0T A;  3CPF A;  2LT1 A;  1SF9 A;  2ENM A;  4F17 A;  2EGC A;  2QDL A;  2MMP A;  3ULR B;  1B34 B;  1ZBX A;  2E3H A;  2JM9 A;  2COY A;  4EMH A;  3RKY A;  1QVG S;  1LCK A;  1OPK A;  3EFO A;  5HK3 A;  1M90 C;  1ZA1 B;  2RM4 A;  1VQ9 A;  4ME7 A;  4XU1 A;  2XDB A;  3S6W A;  1FYN A;  1Y07 A;  5I21 A;  1B3Q A;  2SRC A;  2QEX T;  3G4S A;  2PVO B;  4C8Q D;  2QA4 Q;  1JJ2 S;  3MJX A;  4QVD A;  1K4U S;  3SWN C;  4DEX A;  1UJ0 A;  1MV0 B;  1ZBJ A;  3I56 T;  3I35 A;  4QQG A;  4BY6 B;  2HL3 A;  2RQR A;  5HKC A;  3BDU A;  4M75 G;  1UHC A;  2JJ9 A;  5GMK h;  5HK0 A;  3OBW A;  1VQ6 A;  2X4W A;  1Z9Q A;  4GY5 A;  1M1F A;  2AKK A;  4MDW A;  2XG8 D;  4QVZ A;  3R6O A;  2D8H A;  3VS5 A;  4ZN3 A;  2KYB A;  2DVE A;  4DBQ A;  3PIO A;  2MCN A;  2OTJ T;  2LP5 A;  4HVU A;  1KK7 A;  4OB3 B;  1NEG A;  3X26 B;  3VUB A;  3S3N A;  5LJ5 d;  5GAN 6;  3I5S A;  5IHK A;  5I11 A;  2L89 A;  2FRW A;  4RG2 A;  2CP5 A;  2M9U A;  4D8D A;  2GFA A;  1GCP A;  1RAH B;  2HSP A;  1I1J A;  4C92 F;  1IGQ A;  4KUD K;  1X6G A;  3EGU A;  1ACM B;  3TRE A;  4C8Q E;  3L1A A;  1UDL A;  2HAX A;  5CCA A;  1VQ9 Q;  4E7L A;  1YJN A;  1KQS P;  5LL6 S;  1VQ5 A;  2JM8 A;  1N6A A;  2KY9 A;  1QWF A;  1W2B P;  2DEU A;  2X9H A;  4PJO D;  2LCL A;  3RER A;  3TSZ A;  2FL7 A;  2Z0W A;  3H8Z A;  3NMZ C;  3QJ6 A;  2COW A;  4M75 B;  4BE1 A;  2RJD A;  2K79 A;  1ZSZ A;  3TVT A;  4VUB A;  1Y0M A;  3IQL A;  2KGT A;  1VQP T;  1W2B A;  2BIV A;  2FPE A;  2DF6 A;  2KRS A;  3OW2 P;  3VS0 A;  4M78 A;  3VYG A;  3G6E Q;  2EYQ A;  1BI2 A;  2V26 A;  5GAN 2;  2D0N A;  5IAY A;  1AT1 B;  4LUD A;  3P8D A;  3SDZ A;  1OQK A;  2BKD N;  2K9G A;  1WQW A;  4JJN K;  3P8H A;  3CCS A;  5J26 A;  1VQ4 T;  1BU1 A;  3LW5 E;  3OYF A;  4GBQ A;  1Q81 C;  2E70 A;  3JSC A;  1DJ7 B;  5J3B A;  3NTI A;  2ZPH B;  2KAF A;  3G71 T;  4M75 D;  2XI9 A;  3FLG A;  4IKF A;  5GAM f;  4OML A;  4J9G A;  4IIO A;  3JCM W;  2VVK A;  1QW1 A;  2JXB A;  2EYZ A;  4J7F A;  1RAB B;  2DKG A;  1JEG A;  1EIF A;  1T0H A;  2E64 A;  3CCQ A;  2RI2 A;  3PNW C;  3QO3 A;  1SHF A;  2HQE A;  2XD0 A;  2BTT A;  3M9Q A;  1YJ9 A;  1JO8 A;  2EYW A;  1RAA B;  5GAM h;  6AT1 B;  3NGP A;  5KE2 A;  3HFO A;  2HNI A;  3G4S T;  4ANJ A;  3DB4 A;  1VIE A;  3SD4 A;  2YHT A;  4F04 B;  1AOJ A;  1TH7 A;  4BI8 B;  3EGD B;  2DJQ A;  2KI7 A;  2EQI A;  4LDV A;  2MAM A;  2JOY A;  1WHH A;  4Z88 A;  2QAZ A;  3N5B B;  2JS0 A;  2OTJ A;  2PUO B;  3UPU A;  2YDL A;  1VQM Q;  1RI0 A;  3JV3 A;  2HQH A;  1WIE A;  4LUE A;  1PSE A;  3TQ7 P;  3RKX A;  3HKS A;  1VQM T;  1X69 A;  3BY7 A;  2CT4 A;  2LCS A;  2DVJ A;  5LJ3 j;  1UGR B;  1TSF A;  4FSS A;  2RD1 A;  3EG3 A;  2IIM A;  2DAQ A;  2QTX A;  2QG9 B;  1RAE B;  3BW1 A;  1Q82 C;  3REA B;  4ZGJ B;  3H0H A;  3VU3 C;  2EJG A;  3TSW A;  2OTL A;  2NUT A;  4RUG A;  2DRK A;  1M1K C;  4RKU E;  3GP8 A;  4C8Q A;  1ARK A;  2K4Y A;  3JCM h;  2KMT A;  1GCQ A;  2NUZ A;  4MDX A;  2BZ8 A;  4E2F B;  4AFU C;  3OS0 A;  1OYX A;  3MET A;  3OYH A;  1ZHI A;  2ZPG B;  2NYS A;  3CCU Q;  2M0O A;  1ZSZ B;  5GJW B;  1QVF S;  2DL4 A;  1TTH B;  4MMK A;  3PIP A;  4F7U A;  1YP5 A;  2D9T A;  1C0M A;  4II1 A;  2MIO A;  3QWX X;  5A0L A;  4IUT A;  2ZPF B;  1MMN A;  2GQI A;  1SEM A;  4M7D C;  2OAU A;  3AHU A;  1E6G A;  2AZV A;  2LJ3 A;  4X9C A;  1I81 A;  1Q86 U;  3HRS A;  2JUF A;  2KK4 A;  1SSH A;  1VQ6 Q;  4FYY B;  1K9M R;  2DXU A;  1VQK A;  3JCM X;  4KUL A;  1M1G A;  2JMC A;  1PKT A;  2L3R A;  3PMT A;  2EQU A;  1PD1 A;  2M1H A;  2C0O A;  4RTZ A;  3QXE B;  4OMP A;  4FW2 A;  1VQ5 T;  2QA4 A;  3EFR A;  3C94 A;  3OYJ A;  2FO0 A;  1XNI A;  3MO8 A;  1YWP A;  2DD5 A;  4R0K A;  2K3B A;  4FT4 A;  1QCO A;  1YWO A;  2KT8 A;  2AIR B;  5IH2 A;  4PLL A;  4FU6 A;  1OOT A;  1K73 C;  5FRM A;  3GNF B;  3CBO A;  1G3W A;  2RQW A;  2NUT B;  2D8J A;  2QQB A;  2RB6 A;  2DTH A;  5CK9 A;  4PJO B;  1WPY A;  2FZG B;  5KYY B;  1G5V A;  2RO0 A;  2MK5 A;  2DZC A;  3OYE A;  4OMF B;  5FW9 A;  2YUQ A;  2RK2 A;  1PD0 A;  2QGF B;  2RQV A;  1H3H A;  2CUB A;  4FSX A;  1QP2 A;  4PKC C;  2CP2 A;  2E10 A;  4KBM B;  5GAO n;  1KFZ A;  1Q86 R;  4PJO G;  3EG1 A;  1K8A U;  3ZFJ A;  3L2Q A;  2FYK A;  2BE7 D;  1B7T A;  1VOM A;  3RBB B;  2GBQ A;  4J6Y A;  3M0R A;  2CSI A;  3OB9 A;  1AWO A;  1PHT A;  2KEA A;  1M1K R;  2DYI A;  2EJ9 A;  1AWX A;  3JAM E;  2J6O A;  1WNL A;  1ZSZ C;  2JZ2 A; 
#chains in the Genus database with same CATH homology
 1OZ2 A;  4IUR A;  4M7A B;  4A4K A;  2LTO A;  3UT1 A;  4A4G A;  4M75 F;  5CKB A;  2QQA A;  2DEQ A;  2R58 A;  3PT9 A;  3GPL A;  2WAC A;  4C92 D;  4M77 C;  1YBY A;  2QQ9 A;  3V7R A;  4C0D C;  2QEX A;  3JCM Q;  4IUP A;  2DXT A;  2GF7 A;  1KD1 U;  3MEU A;  3JCM d;  2C06 A;  4M7D G;  3HL8 A;  3KUF A;  3JCM f;  4BE0 A;  2DTO A;  1U1T A;  5GAO r;  2B8A A;  1G3S A;  2DK3 A;  4PLI A;  2VV5 A;  3CBP A;  3PGG A;  4Y91 A;  3QHS A;  1I5L A;  2LDM A;  5CIU A;  3X28 B;  5KCH A;  1S72 T;  3NFC A;  1VQ7 A;  1VQK T;  4M75 A;  1KQ2 A;  4KUI A;  3JCM b;  3OYY A;  4DOW A;  3JCM P;  3G6E T;  5L8R E;  1YCY A;  3KXT A;  1M5Q 1;  2DXC A;  4M78 D;  1N27 A;  4HCB A;  1Q86 C;  4IUQ A;  4J83 A;  4Y28 E;  1X6O A;  4M77 D;  1RL2 A;  4C5I A;  1KHI A;  1VQO T;  4OB1 B;  1YJW A;  5LJ5 h;  4C92 B;  1M1K U;  4HT9 A;  3M4G A;  3CPF A;  2LT1 A;  4BDY A;  4F7U F;  3RKW A;  5GMK l;  1MGQ A;  4C8Q C;  1YIT A;  2XDP A;  3M53 A;  5D6Y A;  2I2L A;  3SWN B;  4M7A E;  3JCM e;  1YHQ A;  2MMP A;  5LJ5 f;  5LJ5 j;  2VGN A;  3RUX A;  3G7Z A;  3QUI A;  4XU2 A;  4MZM A;  1B34 B;  1ZBX A;  2IVW A;  4XTV A;  4Z02 A;  3CCQ T;  1Y96 A;  4E7H A;  2DXB A;  4M78 C;  3OS5 A;  4E47 A;  2EQK A;  4EMH A;  3DLL A;  3RKY A;  5DM7 R;  1QVG S;  2LVM A;  5GAN 5;  1GXI E;  3CPW A;  3WXM B;  3HRU A;  2LNV A;  2QQR A;  2Y90 A;  1N8R C;  1K9M U;  4BI3 A;  3T9N A;  4QVC A;  5HK3 A;  1M90 C;  2RM4 A;  1VQ9 A;  4ME7 A;  4XU1 A;  2XDB A;  3ME9 A;  5EG2 A;  3JCM J;  5I2M A;  1Y07 A;  3S6W A;  3FB9 A;  5CKF A;  5I21 A;  2QEX T;  3G4S A;  2PVO B;  1Q81 U;  4C8Q D;  4PNO A;  5A2Q E;  5IT9 E;  1YIJ A;  3CBM A;  4QVD A;  1JJ2 S;  1P92 A;  3DB3 A;  5D6X A;  3SWN C;  1OI1 A;  2X35 A;  4LDW A;  3GF5 A;  5LJ3 d;  4M77 B;  1YI2 T;  4LDX A;  4A54 A;  3A8O B;  3I56 T;  4PJO A;  4F7U E;  3M56 A;  3V8J A;  4QQG A;  4JRK A;  4BY6 B;  4C92 E;  3KBG A;  3PTA A;  4ZTJ A;  3A8G B;  3BDU A;  4M75 G;  4OB0 B;  5HKC A;  3BDL A;  3CCR A;  5GMK h;  3NTH A;  4MML A;  4CRI A;  2RHU A;  5HK0 A;  3OBW A;  2KVQ G;  1VQ6 A;  1VQN A;  4XTY A;  1QVF A;  2KSS A;  2X4W A;  4JLI A;  3LGF A;  3I55 A;  4ZGE B;  2WSF E;  2K3Y A;  4XTX A;  3I55 T;  2ZZD A;  2R57 A;  4GY5 A;  4M7A C;  3JCM c;  1UGP B;  1M1F A;  2O4X B;  4MDW A;  4UC4 A;  3CCU T;  4FL6 A;  2XG8 D;  4QVZ A;  2PU9 B;  5M9O A;  3R6O A;  4OVA A;  1VQ8 A;  1SSF A;  4JRQ A;  4ZN3 A;  3FDR A;  4IUU A;  2E6N A;  4OGC A;  5CQX A;  1OZ3 A;  2DVE A;  4C92 C;  2QDY B;  3OY9 A;  1YI2 A;  3PIO A;  2OTJ T;  3CCJ T;  4M7D E;  2L8D A;  5GMK e;  4OB3 B;  5HY6 A;  3CCJ A;  3X26 B;  3L2W A;  2X4X A;  2G3R A;  5CQY A;  3QZ5 B;  3VUB A;  2RHY A;  5GMK m;  5LJ5 e;  3S3N A;  1BYM A;  5LJ5 d;  2RHI A;  2RI3 A;  2RJF A;  4FIB A;  5GAN 6;  1Y7X A;  4TVR A;  3A8L B;  4L6V 5;  2E1H A;  3INZ A;  4HCZ A;  3V7S A;  2K5F A;  3ZBD A;  3M57 A;  3V8L A;  2L89 A;  3JB9 J;  1WJR A;  4RG2 A;  1I8F A;  4A4F A;  4BDZ A;  5CAI A;  2M9U A;  2GFA A;  3TEE A;  4JLG A;  1IZ6 A;  2CYZ B;  3VUZ A;  2JTM A;  2EQJ A;  2K57 A;  3E9G A;  4C92 F;  4HA8 A;  3CCV T;  3DKM A;  3L42 A;  4KUD K;  2RHZ A;  4M7D B;  4F7U B;  2XKO C;  4C5E A;  4ATO A;  3UWN A;  1BI1 A;  3HHT B;  1VQL T;  2E65 A;  3MEW A;  1WJQ A;  3MP6 A;  3TRE A;  4C8Q E;  5LJ3 f;  4XK8 E;  3L1A A;  2ZPB B;  4C5G A;  5C6S A;  2HAX A;  2A3L A;  4CI0 C;  4L5G A;  1KHC A;  5CCA A;  2VUB A;  4WF2 A;  4ZGD B;  2LX9 A;  3OMG A;  4E7L A;  4HCC A;  3WVE B;  4A4E A;  1YJN A;  2ZPE B;  5LL6 S;  1VQ5 A;  4RG8 A;  4F7U G;  1N6A A;  1NPR A;  2KY9 A;  4LD6 A;  3OW2 S;  2YRV A;  2EKO A;  3OYD A;  3CCM T;  4PJO D;  4C0G A;  1N8R U;  2LCL A;  5GAN g;  2FB7 A;  2FL7 A;  2D0Q B;  3H8Z A;  3OBY A;  3FEO A;  4P5N A;  3NTK A;  3TU4 K;  3CCL A;  1MHN A;  3QJ6 A;  4IUV A;  4ZN1 A;  4M75 B;  4BE1 A;  2Y4X A;  2RJD A;  2DIQ A;  3JB9 G;  1YJN T;  2GFU A;  4BD3 A;  3SFM A;  1M4Z A;  4C0Z A;  4LDY A;  4VUB A;  5GMK j;  1X75 C;  3X20 B;  1G3T A;  1KQS A;  3JB9 H;  3MHX A;  1VQP T;  3OYG A;  1W2B A;  2BIV A;  1NJI C;  2H3J A;  3URG A;  5GAN h;  1KG1 A;  4X34 A;  1Q82 U;  5GAN 8;  1HXD A;  4M78 A;  1YJ9 T;  3VYG A;  1W2B S;  2LQK A;  1VQ8 T;  4HT8 A;  3SWN A;  3CCU A;  2YLB A;  2EYQ A;  3CPW S;  3CCS T;  1BI2 A;  1JRI A;  3QKJ A;  5DLO A;  2MF2 A;  5GAN 2;  5IAY A;  2RH2 A;  4QW2 A;  3QBY A;  4M78 F;  3P8D A;  4QQ6 A;  3SDZ A;  2BKD N;  5LJ3 h;  2XHC A;  3ZEH A;  2PVG B;  1S72 A;  1WQW A;  2K5L A;  4JJN K;  3P8H A;  3QYG B;  2M16 A;  1NE8 A;  5J26 A;  3CCS A;  1VQ4 T;  3LW5 E;  2K2V A;  5GAN f;  3OYF A;  2JTF A;  4BI4 A;  1XOV A;  2QI2 A;  1Y96 B;  5GMK i;  4BAC A;  4J6X A;  3CME T;  4DQ2 A;  1Q81 C;  2E70 A;  3JSC A;  4JUV A;  1DJ7 B;  5J3B A;  4E7I A;  3OMC A;  2CZ6 B;  3NTI A;  2ZPH B;  2KDS A;  2KAF A;  3G71 T;  2Y4Y A;  4M75 D;  2OTL T;  4ELZ C;  2CZ1 B;  2PQW A;  2XI9 A;  4OB2 B;  3FLG A;  1I4K 1;  3EFS A;  3P8B B;  4XQ3 A;  5GAM f;  4C8Q B;  4RCB A;  4IKF A;  4M7A A;  1H3Z A;  4PJO F;  5CVI A;  4R55 A;  3JCM W;  4A53 A;  3MP1 A;  3OYK A;  4E7K A;  1QW1 A;  2NLU A;  3QPH A;  4M77 A;  4C0D B;  4ZTF A;  4J7F A;  3MEV A;  2DKG A;  2RJE A;  1WQ7 A;  1EIF A;  3GOX A;  2E64 A;  4C8Q G;  3CCE A;  4DA4 A;  4FT2 A;  2DPP B;  3J81 E;  2RI2 A;  3OSS C;  3G6E A;  3CCQ A;  3OW2 A;  2DO3 A;  2ZGW A;  3PNW C;  3QO3 A;  1YHQ T;  3CD6 A;  2L5Q A;  2HQE A;  2RA2 A;  2DJZ A;  5GAN e;  2XD0 A;  3JRZ A;  4YTL A;  3GIB A;  1NZ9 A;  2XK0 A;  3M9Q A;  1YJ9 A;  3HFN A;  3HSB A;  4LD9 K;  3VKI A;  2K3X A;  2EJF A;  5GAM h;  1VUB A;  3CEY A;  2XU8 A;  1VQL A;  2V8I A;  4PJO C;  5KE2 A;  3S3O A;  1FX7 A;  2P4T A;  3JCM V;  3HFO A;  2HNI A;  2ZPI B;  3Q1J A;  3TCJ A;  3CXC A;  3G4S T;  3J7A F;  5D6W A;  3M5A A;  3GNG A;  4NOY A;  2EWN A;  1M90 U;  2JN0 A;  3DB4 A;  1VIE A;  2E6Z A;  2IG0 A;  2JVV A;  2LRQ A;  3SD4 A;  3X24 B;  2EQM A;  5FLX E;  1ZQ1 A;  4FM4 B;  2XID A;  3LYI A;  5CKE A;  2YHT A;  1LJO A;  4BY6 C;  3CCL T;  1LNX A;  1Q7Y C;  2VXE A;  4HKE A;  1VQ7 T;  2GQV A;  1KQ1 A;  3VYH B;  4EMK A;  3M59 A;  2RK1 A;  3FRN A;  1TH7 A;  4C92 A;  3CC4 A;  4BI8 B;  3FJP A;  5GAM g;  4KT0 E;  3CC2 A;  3OYC A;  3L2U A;  5FU6 B;  3CC4 T;  1UB4 A;  1O75 A;  1BIA A;  4LDV A;  3QG1 A;  1FWZ A;  2AHJ B;  2F5T X;  4M7A G;  5A0D A;  2MAM A;  4JRI A;  5GAN d;  1BKB A;  2RJC A;  3C95 A;  3PMI A;  4M78 G;  2JOY A;  4XU3 A;  4M7A F;  2XIC A;  5GAO m;  3RES A;  3J80 E;  3L2Z A;  3N5B B;  2P0Q A;  2EAY A;  2LC4 A;  3HRT A;  2OTJ A;  2EFI A;  3C12 A;  2PUO B;  5J39 A;  3MCA B;  1U8R A;  4PL6 A;  4EMG A;  5C0M A;  4M78 B;  3UPU A;  1RI0 A;  2O01 E;  4GLK A;  1XQH A;  3MEA A;  3QII A;  1PSE A;  2VGM A;  3RKX A;  1JJ2 A;  3HKS A;  1VQM T;  3BY7 A;  5IN1 A;  2X4Y A;  2ZCF B;  1Y71 A;  4NL2 A;  4C92 G;  2JNG A;  4M7D D;  2QXF A;  4JDS A;  4NL3 A;  2F5K A;  1R8O B;  2RHX A;  4NS5 A;  3WVD B;  5LJ3 j;  4E7J A;  3CD6 T;  1UGR B;  3QJY A;  3HPW A;  5LJ5 g;  3M58 A;  4JRP A;  1VQN T;  1LOJ A;  1PSF A;  2DZ9 A;  2EIF A;  2PUK B;  2RD1 A;  2DAQ A;  5GAN j;  3M4Y A;  2CZ7 B;  2QTX A;  2E12 A;  1M9S A;  4EPC A;  2DTI A;  3BW1 A;  4XTW A;  4O5V A;  3L2R A;  1Q82 C;  4ZGJ B;  3OS2 A;  3EAE A;  2KQW A;  3VU3 C;  3A8M B;  2EJG A;  4M7A D;  3OYM A;  2OTL A;  3G71 A;  4C8Q F;  3RIR A;  5A0G A;  3CXC S;  4M75 C;  3FIF A;  4J7I A;  2O4X A;  4M75 E;  1KC8 U;  1M1K C;  1JB0 E;  4RKU E;  3QSU A;  3CME A;  5CO7 A;  4C0F A;  4XU0 A;  3PFS A;  3GP8 A;  1D3B B;  4C8Q A;  3OYA A;  3BFM A;  2VYT A;  3UDC A;  2K4Y A;  3JCM h;  1BI3 A;  5GAM j;  2PVD B;  3X25 B;  3OSV A;  1VQ4 A;  2KMT A;  1HK9 A;  3RMQ A;  2MWP A;  3ER0 A;  3LWH A;  4MDX A;  3OS0 A;  1OYX A;  3MET A;  3OYH A;  1ZHI A;  1O9S A;  2YLC A;  2ZPG B;  4RCC A;  2CZ0 B;  3VJP A;  2M0O A;  2GCX A;  2QQS A;  4O6J A;  4OP0 A;  4EMK C;  3CCR T;  1QVF S;  5FU7 B;  4MMK A;  5LJ3 g;  2FVU A;  5GAO l;  1YIT T;  3PIP A;  4DOV A;  2CGH A;  3LX7 A;  4F7U A;  3A8H B;  3GLX A;  1VIF A;  4OF1 A;  1NJI U;  3QZ9 B;  4PJO E;  1BIB A;  2D9T A;  3I56 A;  3RER A;  1N9S A;  5KH6 A;  3OYL A;  4XTZ A;  4II1 A;  5A0L A;  1VQP A;  4IUT A;  3QYH B;  1YJW T;  4D6W A;  2ZPF B;  1YIJ T;  4M7D C;  4N4G A;  2OAU A;  3AHU A;  4X9C A;  2LCC A;  1I81 A;  1Q86 U;  1WGS A;  4XTU A;  5GAM d;  1VQ9 T;  3HRS A;  4R56 A;  3DLM A;  2JUF A;  2KK4 A;  3O8V A;  3L2V A;  2FHD A;  3OQ5 A;  3S3M A;  1WJS A;  4ELY C;  2DXU A;  3SB2 A;  1B34 A;  3JCM X;  3LLR A;  1VQK A;  4KUL A;  1M1G A;  5FU7 C;  2L3R A;  3E9F A;  4B9W A;  4MZP A;  3LGL A;  3F70 A;  3PMT A;  2EQU A;  1K9M C;  4J5Y A;  2M1H A;  4L59 A;  4N0A A;  5KCO A;  3FC3 A;  3CCM A;  2E41 A;  1M8V A;  4OGE A;  2R5A A;  2WSE E;  3QXE B;  1BI0 A;  3C4S A;  2X4J A;  4X9D A;  1KC8 C;  1VQ5 T;  2QA4 A;  3EFR A;  3C94 A;  1VQM A;  1KD1 C;  4M7D F;  5GAO q;  3OYJ A;  3OYN A;  5DY9 A;  4V2S A;  1XNI A;  3MO8 A;  1X01 A;  2DD5 A;  3HP9 A;  5GAN 7;  3LWI A;  2BUD A;  4FT4 A;  1VQO A;  4J6W A;  5CKD A;  3OYB A;  1UEB A;  3LH0 A;  5DLQ E;  4J8O A;  4EDU A;  4Q5W A;  5GAM e;  2K5I A;  2MWO A;  4PLL A;  4XAX B;  4JS4 A;  4FU6 A;  2QA4 T;  3QDR B;  3CCV A;  2RI5 A;  1K73 C;  1KQS S;  5FRM A;  1QVP A;  2HQX A;  3GNF B;  3CBO A;  1G3W A;  2CS7 A;  2R5M A;  3OA6 A;  1JBM A;  2F69 A;  3H6Z A;  2QQB A;  2XDD A;  2P0P A;  3M54 A;  2RB6 A;  1NPP A;  2DTH A;  5CK9 A;  5LJ3 e;  5GAN 4;  1Q7Y U;  4PJO B;  1H64 1;  1XTD A;  4JS5 A;  1WPY A;  5FRO A;  3CC2 T;  3E1S A;  2D6F A;  1W4S A;  1AHJ B;  4QQD A;  3E19 A;  2VC8 A;  4M78 E;  3ASK A;  1G5V A;  2HD0 A;  2RO0 A;  1K73 U;  1K8A C;  3A5Z B;  2DD4 A;  2DZC A;  5KE3 A;  4M77 E;  3V7C A;  3JB9 D;  3OYE A;  4BUG A;  2MI6 A;  4OMF B;  2VXF A;  2RK2 A;  2LT4 A;  5CKH A;  4LDU A;  2V8J A;  4FSX A;  4PKC C;  1QP2 A;  3RMS A;  4KBM B;  2E10 A;  4B9X A;  3JCM g;  5GAO n;  3JB9 F;  4A4H A;  4PJO G;  1UGQ B;  2E5Q A;  2LQ8 A;  3VV0 A;  5CR2 A;  1N9R A;  1G3Y A;  2A7Y A;  1K8A U;  2HBP A;  3ZFJ A;  2FYK A;  3L2Q A;  1D3B A;  3CMA A;  3CC7 T;  1QVG A;  5I2S A;  1QP3 A;  5AYF A;  3JB9 I;  2WSC E;  2V8K A;  4J6Y A;  3V8K A;  4M77 F;  2CKK A;  2DIG A;  1IRE B;  5FRN A;  1V29 B;  1U1S A;  3OB9 A;  3CCE T;  4M77 G;  1VQ6 T;  3OS1 A;  3M55 A;  3MP8 A;  4N4I A;  4N4H A;  4MZT A;  4BE2 A;  1UGS B;  4BB7 A;  5GAN 3;  2EJ9 A;  4C5H A;  4RMO A;  1FXX A;  3CC7 A;  4M7D A;  3CMA T;  5FU6 C;  3JAM E;  5GAO p;  4N0A C;  1WNL A;  4EMK B;  2P0K A;  2JZ2 A;  3OYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...