5GAN6

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
b'VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan600
3JCMg 3JCMW 1M5Q1 4WF2A 4XTUA 1BIAA 1YCYA 4N0AA 1TH7A 2RA2A 3QSUA 2DEQA 3JB9J 1B34A 2EJFA 3JB9H 4DQ2A 2RM4A 2JN0A 4XU3A 5GAMh 3JCMh 4M7AG 1N9SA 5GAOm 1KQ2A 5GMKm 3HFOA 3JCMb 4M7DG 4C92B 1I5LA 3JB9F 4M78A 4OP0A 5GANg 3GIBA 4C8QE 4XU1A 4M75E 4M77C 4M78F 2HNIA 5GANj 4F7UG 4JRKA 4PJOD 4A54A 5GANh 4XTYA 3RIRA 1Y96A 4EMKB 4M7AE 4PJOF 1I81A 3JCMJ 1BIBA 2DTHA 5GAOn 4C8QB 2FYKA 2YLBA 4J6WA 4J6YA 1HK9A 4C8QG 1I4K1 4M78C 1U1SA 3FIFA 3AHUA 4M75G 4F7UE 2DJZA 3L1AA 4M7AB 4M7DA 3JB9I 2DTOA 2VC8A 5LJ3d 4RCBA 5GMKl 4PJOC 1D3BB 5GAMf 5LJ3e 3JB9D 3JCMf 4C92A 4V2SA 2DZ9A 1LOJA 4C92F 5LJ5d 4M78D 5GMKe 5LJ5e 4EMHA 2EAYA 1U1TA 5GAOp 4M77E 3RUXA 4F7UB 3JCMP 2RD1A 2DZCA 5GMKi 3V7CA 3RKWA 2E65A 4JLIA 1WPYA 5GAOr 5GAN5 4EMKA 1WQWA 5GANf 4EMGA 4J5YA 2RB6A 3M4GA 4N0AC 3SWNB 5GAN8 4MMKA 3JCMX 4M77B 3HSBA 4XU0A 4M75B 2DTIA 4XTWA 3HFNA 4M77G 5GAMd 2EWNA 3JCMd 5GAN2 5GAMe 4M7AA 4M7DB 2YLCA 3BY7A 3V7RA 3JCMe 1WQ7A 4M7DD 5LJ3g 1M8VA 4M7AF 3RKXA 3QO3A 3JCMc 4PJOE 1D3BA 3BFMA 5GAN3 3PGGA 4JUVA 3V8KA 3VU3C 4EMKC 4MMLA 4C92D 2FB7A 1H641 5GAN6 5LJ3j 5LJ5g 5GAMg 5GAN4 5GAOl 5LJ3h 3JB9G 1KQ1A 3L2ZA 1JBMA 2VXEA 4F7UA 5GMKj 5LJ5j 5GANd 4HT8A 4HA8A 5GANe 2Y90A 4F7UF 4M78G 3V8LA 1WNLA 3RERA 2CGHA 2I2LA 3RESA 4PJOB 2YHTA 4M7AC 2DKGA 3SWNA 4A53A 1LJOA 4PJOG 4QVDA 4NL3A 4M7DC 1JRIA 2EJGA 2DXTA 4M77A 3V8JA 4X9DA 4C8QA 2E1HA 5I21A 4PNOA 4XU2A 5CAIA 2EJ9A 2K57A 4M75A 3V7SA 4C92C 4C8QF 4NL2A 3EFSA 3JCMV 4M75F 1I8FA 4M78E 4M7AD 5GAMj 4X9CA 4J6XA 3QUIA 4RCCA 3BW1A 2E64A 3EFRA 2VXFA 1B34B 2QTXA 4XTZA 2E10A 3QHSA 5GAN7 4QVCA 2DVEA 3SWNC 5DY9A 5LJ3f 4C92G 5GAOq 3FJPA 4M78B 4JRIA 4C8QC 3FB9A 4M7DF 4NOYA 4M75C 2ZGWA 2E41A 3SB2A 4PJOA 5GMKh 5LJ5f 4Y91A 5LJ5h 2DXUA 4XTVA 3JCMQ 1X01A 1LNXA 4XQ3A 1N9RA 1Y96B 4XTXA 4M7DE 3RKYA 4HT9A 4M77D 3BDUA 4C8QD 1HXDA 3INZA 4M75D 4C92E 4M77F 1MGQA
chains in the Genus database with same CATH superfamily
3JCMW 4RTWA 4DBHA 1BI1A 6AT1B 2A08A 5KYUB 5GMKm 2OJ2A 3G4SQ 4C0FA 3GIBA 4C8QE 4XU1A 2A37A 1T0HA 2R57A 1ZSZC 1YJWT 3PTAA 2KRNA 4EMKB 3CPFA 3I55A 1BIBA 1UGQB 3GOXA 2CZ7B 2RQTA 2YXYA 1C6VX 5FLXE 2PNIA 1XOVA 2KMTA 3OYGA 1RI0A 4L59A 5KE2A 4ZN1A 3THKA 2J06A 3I55T 4OMFB 4FW2A 2LT1A 1QQJA 3GNFB 1X6BA 3M55A 1WQWA 2DETA 1K73U 2RB6A 2J05A 5CQXA 1KD1R 2LX7A 5GAN8 4FYYB 1TXQA 2M0YA 2XKOC 4JS4A 1KSWA 5LJ5g 1JB0E 1FMKA 1K8AC 2FPDA 2Y90A 1GCQC 2PTKA 4PJJA 4PJOG 4PJMA 2P0PA 2XIDA 3VYHB 1VA7A 4HKEA 1M2VA 2G3RA 2MMPA 5IN1A 2CP6A 5A0DA 4XTZA 2KNBB 5I2MA 3UA7A 4DEYA 2DA9A 3CBOA 1QMCA 3CCEQ 4OMOA 4FYWB 3OBWA 1YJWQ 4LDVA 2K5IA 3QWYA 3KBGA 1PG5B 2DL3A 4C8QD 1ARKA 3REAB 3NMZC 4PKCC 1U06A 3QSUA 2RI2A 4QKUA 1TWBA 2AKLA 4E7IA 1K8AR 1BKBA 4MZTA 2JMCA 2VB6A 1I5LA 4OP0A 2NUPB 1SSHA 2EFIA 2JNGA 2ZPGB 3I55Q 5GANh 4E7JA 2CT4A 1M3BA 3T9NA 1E6HA 3M54A 1AEYA 5CQYA 3CXCP 2DD5A 5FWBA 4M75G 4F7UE 2BZ8A 2GNCA 4N4GA 3JB9D 2C06A 4C92F 2CP2A 4KGVB 3DB3A 5GAOp 1RACB 2RD1A 3LGLA 1TSFA 2EYYA 3C94A 3RDVA 1KQSA 4Z02A 1PKSA 1JXMA 1WJQA 3VYGA 3M0PA 3TVTA 5I2SA 2F5TX 1E6GA 3OSSC 1LPLA 4M7AA 3P8DA 2J6FA 3OQ5A 1QP2A 1T3SA 1SHFA 1YFNA 2F2WA 1ZLMA 1JBMA 4R55A 2LX9A 2CGHA 4F17A 1VQ8A 4FW1A 4ZGEB 2DKGA 4IUPA 1TUGB 4C0DC 2QA4A 1D0XA 2EJ9A 2JT4A 4J9FA 1VQMA 3EFSA 1I8FA 5CKBA 2R58A 5KYYA 2RI3A 2ROLA 1QKWA 4CC4B 1VQ8T 2OTJT 5D6XA 2WSCE 3URGA 5DY9A 1TUDA 4MZPA 2QA4T 2V1QA 5LJ5h 1VQMT 2EKHA 3MO8A 2HZYA 4XTXA 1OYXA 2LCCA 2EQUA 1QWFA 1GBQA 3MEAA 2IPOB 2R5AA 2ZPHB 2LMJA 3I35A 4N0AA 4D8DA 2DEQA 2EJFA 3DKMA 2RHZA 1YITA 1O75A 2DNUA 5HY6A 2QEXQ 4JRKA 4JJBA 4DBRA 4PLIA 4HVVA 3EFOA 4LD6A 1YITT 3CD6Q 5KYYB 2EYQA 2V1RA 2SEMA 1U1TA 1JJ2A 4IUVA 5FU7C 1WXTA 3REBB 2H3EB 4M77B 3TREA 1T3LA 2JTEA 1M8MA 3MP1A 2MAMA 5LJ3g 1NYFA 3HRTA 3VUZA 3NTIA 4JUVA 1PRLC 3SFMA 3SD4A 1VQ8Q 2PVGB 4OMNA 2JW4A 1E7OA 3V8LA 1KK7A 2QA4Q 1D1AA 4RG2A 2GQVA 1VQMQ 1Q86U 3EFOB 1JRIA 3O5ZA 2YDLA 3UPUA 3TQ7P 2K5LA 3D7SB 4BI8B 3H0IA 4RCCA 3A8LB 2CP5A 5FRNA 1B34B 4F14A 3CC2A 2HL3A 2EYZA 5J26A 1VYUA 3LGFA 3I9QA 2ZGWA 1IREB 2WSFE 3HTRA 3CXCS 2L3RA 4KUIA 4M77D 3INZA 4ORZA 3CC2T 2DIQA 4MMLA 5GAMg 4FYXB 2ENMA 2MK5A 5M9OA 2M16A 5GAOm 3JCMb 2DF6A 1GFCA 1NJIR 4M78F 2HNIA 4A54A 2DRKA 4XTYA 3HL8A 1RAEB 2L5QA 3FJ5A 4R56A 1SSFA 2DTHA 2FHDA 2NUZA 4ZTJA 3NHNA 1K9MU 3AHUA 1Q7YC 1KC8R 4E7LA 2OI3A 5IHKA 2XD0A 4PJOC 5GMKl 4C92A 3X28B 2DPPB 3L2RA 4EMHA 1AOJA 3TEEA 2H8HA 4JLIA 4E7SA 5CIUA 2FPEA 1RAIB 4J9GA 3CBPA 2RNAA 4RUGA 4MMKA 2DL4A 2LVMA 5GAMe 1IB8A 4UC4A 3PFSA 4MDXA 4PJOE 3VS0A 3L2UA 2VXEA 1D09B 2YRCA 4Z8AA 3MEUA 2QDLA 1OZ2A 2XMFA 1V76A 1WLPB 3PMTA 3GP8A 1AWWA 3LYIA 1W70A 2K79A 3CCMA 1Q7YR 4LE9A 2WSEE 2M02A 3H9NA 2V8JA 3CC2Q 2E64A 2VXFA 2XG8D 3KUFA 4O6JA 3PIOA 1BI0A 4M75C 1QW1A 5GMKh 4XQ3A 2CH4W 4AG2C 2EQMA 2FZGB 5J39A 1WHMA 1I0CA 2P4TA 2CP0A 5A0GA 1FMWA 3OMCA 5KCOA 2DFUA 4KH0B 2A0FB 1SRLA 3S6WA 4M7AG 2PUKB 5CCAA 2LP5A 4RTTA 3ZFJA 4C5GA 4M75E 4AG1C 2X35A 1RL2A 3RIRA 1AZEA 3RBBB 1UGRB 1T0JA 2ZPIB 4E2FB 2KSSA 3L1AA 4ZGDB 4M7DA 1HYOA 4GLMA 3VS3A 4D6WA 3JRZA 4LDWA 4RMOA 3RUXA 2LNVA 3RKWA 3MHXA 1X27A 5KE3A 3OYAA 2LCSA 1UHCA 3EGXA 4CRIA 4M75B 3U23A 3QPHA 4M77G 1PSFA 3BY7A 5KYWA 5EC7A 4LDYA 3QO3A 3JCMc 4Y28E 5CK9A 3M0RA 3V8KA 3OS2A 4ELYC 1IGUA 2AT1B 2LJ3A 4BDYA 1BYMA 1KIKA 5D6YA 3LH0A 5AT1B 4F7UF 1K0SA 4M4ZA 3CCMQ 1MNDA 1YJ9A 2LRQA 1X2QA 2OAUA 2QXFA 5FU6B 4NL2A 4E7HA 1UECA 2HBPA 1B07A 2CZ1B 1BU1A 4PFOA 1OQKA 1YI2A 2DEUA 1WGSA 1YJ9T 1Y71A 3JSCA 3META 2GBQA 4J9HA 2EKOA 2LQWA 1UEBA 1PSEA 1N8RU 4PL6A 1YIJQ 1AWOA 3BDUA 3M0SA 1YI2T 4M75D 4AFUC 3GLXA 2QQRA 2LT4A 1C0MA 2O4XA 4KGXB 3JB9J 2E12A 1JXOA 2K7AA 2ZZDA 3GNGA 4OGEA 2CSIA 1W2BA 3R6NA 1VQ7A 1ZUKA 4M78A 4IUUA 5GANg 1PCXA 3EAEA 3L2QA 2V8KA 3DB4A 4J8OA 2E3HA 5IHNA 1IHVA 1QCOA 2RF0A 4VUBA 4LXCA 1ACMB 3OS5A 3PE0A 1W4SA 2R5MA 3RMQA 1BB9A 3M59A 1D3BB 3TSZA 3CCET 2KEAA 3EG9A 1UG1A 2X4WA 1ZHIA 2SRCA 1WPYA 2ZPBB 4CC3A 2KQWA 1GL5A 1G3TA 4II1A 1UGSB 4K11A 3LW5E 1UDLA 3A8HB 5CKDA 2MI6A 3HFNA 3JCMd 4OF1A 2JTFA 3VS5A 2KYMA 1VQLQ 3CCLA 1C1AA 2XDBA 3MJXA 2HSPA 2EGCA 2DBMA 4FSSA 4AFSC 2YRVA 4HA8A 5GANe 4HVUA 1VQ4A 1YJ9Q 4BB7A 1G3YA 2LCLA 2HDAA 1ZSZA 2O9SA 1IHWA 1NG2A 8AT1B 3MCAB 2GTJA 4PK4A 4EDUA 1YI2Q 1G83A 2MIOA 3EGDA 1VQ4T 4KH1B 3HKSA 1Z9QA 3CC7A 2QGFB 2QG9B 4C92G 1X2KA 1PNJA 1GXIE 1D0YA 2KGTA 3FB9A 4E7ZA 2L3QA 4OMPA 1D1BA 2BUDA 3OB9A 2WACA 2FPFA 4YTLA 1IRXA 1NBEB 3QYGB 2D0QB 3OYMA 1MGQA 4A53A 1WIEA 4RTUA 4A4FA 3UT1A 1VQ7Q 4B9XA 2KDSA 4LUDA 2DYIA 2BZXA 4OVAA 2MOXA 1UE9A 2LC4A 4L6V5 1W1FA 1GRIA 4IIMA 5GJVB 1KFZA 3PIPA 2FYKA 2CP3A 2EGAA 3PNWC 4J6WA 4JS5A 2DJZA 3FC3A 3EGDB 1M27C 1SF9A 3JCMf 2E6ZA 2XK0A 5LJ5e 2HAXA 2OTLQ 3V7CA 4GY5A 5GAOr 5CKFA 1MV3A 2K2VA 5I22A 4J5YA 1KHIA 2CUBA 2QEXA 4FL6A 2ZAEA 1RLQC 3CCLQ 1M2VB 1S1NA 1RAGB 3CD6A 1MUZA 1R8OB 1Q86C 3PGGA 2LJ0A 1VQ4Q 3LH5A 2QEXT 1TS9A 4F7UA 3TCJA 1FX7A 1FYNA 3I5RA 2JZ2A 3P8BB 4M7AC 4FM4B 2LDMA 2HCKA 1FMVA 3CD6T 4GBQA 2G6FX 2RQWA 3QXEB 3L2VA 3CC7Q 4HCCA 5GAMj 3CMAQ 1K4US 3QJ6A 3BE3A 4A4KA 1AZGB 2AK5A 3OYKA 3OYLA 5CO7A 1KD1U 1M1KU 9ATCB 2JXBA 5A0LA 3WVDB 3C12A 1M4ZA 4HT9A 1OZ3A 1H3ZA 1MMGA 1WHGA 3LLRA 4BD3A 2VGMA 2BE7D 1G5VA 1Q86R 2P0KA 5IT9E 1VQOA 2DXBA 3UF4A 3EH2A 3S3NA 2HKQB 1K9MC 3OW2P 4M77C 3MPUB 2BE9B 3O8VA 3SEMA 3UATA 1WX6A 2F2VA 1VQOT 2VYTA 5GAOn 5HCKA 1WDXA 1ABQA 1X6GA 3OY9A 3LWHA 4X1VA 1ZA2B 4M7AB 2DX1A 2ABLA 3JB9I 4BI4A 2MWPA 2NYSA 1WI7A 2FRYA 3QYHB 4AMCA 3S3MA 1LOJA 1D0ZA 4M77E 3HPWA 2KT8A 4BI3A 4OB0B 2QQSA 3M4GA 3S3OA 3UDCA 3QG1A 1OOTA 2P84A 3I56A 1UJYA 2M1HA 4IIOA 3HSBA 4M7DF 1K9MR 1VQ9A 4KULA 2E6NA 2L2PA 1I07A 2V26A 4M78G 2QYZA 4LD9K 3I56T 1BI3A 1XJWB 2FVUA 4OB2B 4DEXA 3RNJA 4FSXA 2LQ8A 2MPXC 3RR6A 1VQ9T 3OSVA 3V7SA 1RI9A 3M0QA 1H8KA 4M7AD 4XAXB 2FEIA 1TTHB 3TSWA 4HXJA 1JO8A 2E10A 2K5FA 2EQJA 1UB4A 2L3SA 3MKDA 1ZUYA 2JM8A 2PU9B 4NOYA 1VOMA 5LJ5f 2DXUA 2JM9A 1NJIC 2KRMA 3CC4Q 2AZVA 1VQOQ 1A0NB 3RMSA 1EZZB 1M5Q1 1YBYA 2NUTA 1KQ2A 1KC8C 1QCFA 2EYXA 2M51A 1K1ZA 2QASA 2D1XA 3PT9A 1M90U 1NEGA 3G6EA 3CPWP 1KHCA 1R77A 4QW2A 4J6YA 1HK9A 4JLGA 1IXDA 5L23A 3FLGA 4PJLA 4OMMA 2VGNA 3CMEA 2DTOA 5LJ3e 3X24B 4MZMA 3G6ET 5GMKe 3JCMP 2EAYA 2FL7A 3HRUA 2RI5A 2DZCA 3C4SA 2D9TA 1FWZA 2CSQA 3G71A 3PVLA 4Y92A 4LUEA 3QKJA 1JU5C 1X75C 4RTVA 3I56Q 3CMET 3VUBA 2X3WD 2X3XD 5IXFA 4PLLA 2V8IA 1PC0A 4RKUE 1VQ9Q 2JVVA 2GQIA 1CSKA 2NUTB 2RH2A 2HMAA 1AT1B 3G71T 1KQ1A 4P5NA 2HKNA 2RQUA 2DL5A 4PFPA 4JJDA 1UGVA 5HKCA 3F70A 2A7YA 2EJGA 1DJ7B 4KRTA 4X9DA 2J6OA 4C8QF 1K0XA 2GFAA 1SHGA 3QUIA 2VVKA 3BW1A 3EFRA 3P8HA 1G2BA 1B3QA 1WXBA 3OW2S 5GAN7 4OMLA 3OMGA 2CS7A 1VQNA 1NZ9A 4PJOA 3QDRB 2IIMA 2JS2A 1AVZC 2E3IA 3G1JA 4J9IA 2ESWA 3FRNA 1Q81U 1YNZA 1G3SA 1SEMA 3H8ZA 2XICA 1AHJB 1BCOA 1HD3A 3QWXX 4C92B 4ANJA 3CXCA 3JB9F 5DLQE 2RPNA 2L0AA 3EHRA 3G6EQ 3CCMT 4F7UG 3CQTA 2A3LA 3CBMA 2KR3A 1Y96A 2XHCA 1Q82U 4ELZC 3OYJA 1YIJA 1N8RR 3CMEQ 1NEBA 3M9QA 4PJNA 3LX7A 2MF2A 3QDFA 2YRDA 1SRMA 3HRSA 2JTMA 4O5VA 2RQVA 4EIKA 3G71Q 1YIJT 5FU6C 5GAN5 2COZA 1HJDA 1OULA 1U3OA 2L3PA 2EW3A 1WJRA 4J9BA 2ED0A 2B8AA 1G8XA 2DK3A 1XNIA 4XU0A 2P4RA 5GAMd 5GAN2 3UWNA 3MP6A 1WQ7A 3OS0A 1K73C 2VUBA 1M1FA 3BFMA 3A1PA 5GAN3 4C92D 4AT1B 1KQSP 1VYTA 2GCXA 3L2ZA 4QT7A 5LJ5j 3A8OB 2OAWA 2I0NA 4A4GA 3VS1A 4RTZA 1WYXA 3SWNA 2W10A 2EPDA 4PNOA 1OPLA 1RUWA 2M0OA 4XK8E 2W0ZA 4WTOB 2DERA 1PWTA 1I1JA 2BZYA 2AZSA 1MNEA 2QTXA 1JEGA 1VQNQ 2KI7A 1BK2A 3WXMB 1VQLA 5LJ3f 5GAOq 2HSEB 4JZ4A 2K9GA 2DJQA 3CPWS 4FCYA 1LNXA 2KK4A 4DOVA 2MYSA 2RJEA 3RKYA 5J3BA 3HP9A 2RJFA 1WXUA 4FIBA 1K73R 1VQLT 2BKDN 4M7DB 1UGPB 2RM4A 3VS4A 1FXXA 4A4EA 5FWCA 4HCKA 2A36A 3JCMJ 3LWIA 4PFZA 1BBZA 2HQXA 2ZCFB 3EGXB 2YUOA 4M78C 3FIFA 5KYNA 3E1SA 4J9CA 2DVJA 2X4JA 1D1CA 5KYWB 4RCBA 4D8KA 1WHLA 5GAMf 2E5QA 1OI1A 2DE0X 3EG0A 1N27A 1WFWA 1VQ5A 1HSQA 3I5SA 4EMKA 2XDPA 4LDXA 2DIGA 4CC2A 1N5ZA 3QIIA 5FRMA 2RQRA 2C0OA 1NLOC 2DTIA 4N4HA 4KGZB 2EIFA 3OS1A 1JJ2P 1IO6A 3EGUA 1VQ7T 4M7DD 3DLLA 4KUDK 5KCHA 3VRZA 3ME9A 1VQ5T 1SPKA 2EQKA 3E2UA 1QCNA 2VWFA 3PMIA 2CUDA 3C95A 1MHNA 2K2MA 2OTLA 2O9VA 2QQBA 3X26B 4NL3A 3A8GB 3M4YA 1NE8A 4C8QA 4XU2A 1M1KC 5CAIA 1VUBA 4RTYA 3JCMV 2DD4A 2O4XB 3CPWA 2LNHB 2YSQA 2O88A 5CKHA 2OTLT 3GBQA 3VJPA 4M78B 3CCVA 2QK0A 2ZPFB 1IZ6A 3CCLT 1QVGP 5CKEA 2J7IA 2K3YA 1ZX6A 2RN8A 4ZN3A 2IVWA 1BIAA 1YCYA 1NPRA 3CCVT 3JB9H 4DQ2A 4XU3A 3JCMh 1VQ6A 3CMAA 3EG9B 2LQKA 2D0NA 2HEQA 1RABB 1CKAA 3ZL7C 1AWJA 1M1KR 1CKBA 4Q5WA 4C8QB 2K4YA 1NLPC 3CC7T 1VQ6T 3CMAT 5GJWB 2X51A 4B9WA 3A98A 1KQSS 2D8JA 2VC8A 4BY6B 3ZBDA 3VS2A 3G7ZA 2AHJB 2RJDA 2NUPA 2QDYB 3E19A 4M78D 1VQ5Q 2DO3A 5GMKi 2E65A 2EBPA 1SKUB 4EMGA 2DBKA 5DLOA 2LQNA 1RLPC 3IQLA 1UFFA 3M57A 3CCRA 4HCBA 1ZSZB 2QI2A 1GCQA 3RKXA 1TG0A 3SDZA 1MV0B 5LJ3j 5GAOl 2FZKB 3CEYA 2DXCA 4MDWA 5EG2A 5GMKj 1VQPA 5GANd 4OGCA 4BDZA 4HT8A 3M5AA 5IH2A 1QWEA 3BDLA 3CCRT 1YCSB 2YHTA 2KAFA 1H92A 2EYWA 4QVDA 4BE0A 2KRSA 2DL7A 3J81E 2RHYA 4IUQA 1ABOA 1VQPT 2COWA 1K9AA 1PM3A 2KROA 3VRYA 2O31A 4GLKA 2FZCB 4C5EA 3OYBA 3CCVQ 2GGRA 3ER0A 2CDTA 1MMNA 4JRIA 1QLYA 3H0FA 1VYVA 4KT0E 3JCMQ 3GF5A 5DM7R 4JDSA 3ZEHA 2QQAA 2L8DA 1N6AA 4R0KA 2CKKA 1PD0A 4WF2A 1X43A 1M90C 1TH7A 2RA2A 5L8RE 1VQ6Q 4OMQA 3X20B 2YUNA 5IHIA 4M7DG 2KXCA 1VIEA 1G3WA 3OYFA 2YWWA 4L5GA 2DMOA 4CI0C 1I5OB 2VV5A 2DAQA 1YJNA 2OX7A 3OBYA 2VASA 2JS0A 4PJOF 4M7AE 3M0TA 1JJ2S 1RAAB 3OYCA 2HQEA 1OX9A 1H3HA 2QAZA 3CC4A 1WHHA 4DBQA 4CC7A 4DA4A 2EVRA 4V2SA 1YJNT 3OYDA 1Z9ZA 5LJ5d 4JZ3A 2O2OA 3A5ZB 2CREA 1EIFA 1M3CA 4A63B 4F7UB 2JJ9A 4JJNK 2OTJA 2NWMA 5GANf 3CC4T 2DRMA 3CCRQ 4N0AC 1PKTA 1M90R 3MP8A 1YP5A 1M8VA 1R0BG 3EG1A 3CCQA 2ECZA 4B6MA 1QP3A 1UJ0A 5GAN6 1VQPQ 3M58A 3NPFA 1H641 2XU8A 4BUGA 1X6OA 4HCZA 1OX8A 2KBTA 3R6OA 4FT4A 1P92A 2H3JA 1Y0MA 1M9SA 2GTOA 1AD5A 3AT1B 2VKNA 1QVGS 1UTIA 2XDDA 4J83A 1M2OA 3CCQT 2DXTA 1ZBXA 4M77A 5KYXA 1KG1A 2K57A 5C0MA 3OYYA 2MCNA 1ZA1B 1K8AU 4M75F 3M56A 7AT1B 2AIRB 1J3TA 4X9CA 2AKKA 2LTOA 2COYA 2F69A 3QJYA 3VKIA 1YWOA 2F2XA 1VIFA 2DVEA 5IXBA 1WZOA 1V29B 1Q81C 4FYVB 1GCPA 2FRWA 3NGPA 4LNPA 5A2QE 1N9RA 4Z88A 3NTKA 2YUQA 4C0ZA 2CZ6B 4ZGJB 1B34A 1Q82C 1Y07A 4C0DB 1N9SA 2GF7A 1WA7A 1QKXA 1SG5A 4C5HA 4IKFA 5AYFA 1YJNQ 2D6FA 1RADB 1WJSA 2CT3A 2DILA 1I81A 1OU9A 1ZQ1A 5KYXB 2EQIA 1W2BP 2YLBA 3E9FA 4C8QG 3CCJA 2F5KA 1U1SA 5D6WA 2HL5C 2CYZB 3M0UA 1WHJA 1Q81R 3WVEB 5D7UA 2OTJQ 3HHTB 1QVFP 2DLPA 1WHKA 5FW9A 4JRPA 3CCJT 2IG0A 1ZSGA 1QVPA 2PUOB 1TOVA 2RHIA 2PZ1A 3CCQQ 2E70A 1Q82R 4ATOA 2YLCA 4Z89A 2KXDA 2L89A 2P0QA 5KH6A 3C0CA 3VU3C 4C5IA 2D8HA 2FB7A 1QVGA 3ULRB 3KXTA 3JB9G 1TU0B 1NM7A 1ZBJA 1NPPA 2YT6A 2HQHA 3KFVA 4BE1A 4C0GA 1JQQA 3EG2A 5I21A 1GFDA 2BTTA 4C92C 1KJWA 1YITQ 1NYGA 2HBWA 5FU7B 2JUFA 2RK2A 3NFCA 3FJPA 2QTVA 4Y91A 1UHFA 1LCKA 1U8RA 1IGQA 2DL8A 2XI9A 3UA6A 2Y4XA 2LJ1A 4C92E 3A8MB 1OPKA 2FO0A 2RO0A 1N8RC 3FEOA 1LVKA 2FG0A 2PVOB 1TUCA 2JN0A 2KT1A 4OB1B 1F1BB 2BIVA 1XQHA 2JOYA 1PHTA 3CCSA 5GANj 3ASKA 4RTXA 1OV3A 2X4YA 1M30A 3CCJQ 4F04B 4QQ6A 4QQDA 5C6SA 1I4K1 3VS7A 1O9SA 4RG8A 2ZPEB 3CCST 1VQNT 3GPLA 2JMAA 5LJ3d 1K76A 5CVIA 3H6ZA 4J7FA 1BI2A 2RHXA 2K6DA 3PVQA 2X9HA 4ME7A 3L42A 1M1GA 4LN2A 3X25B 4DOWA 4ESRA 8ATCB 2RHUA 1EX4A 3CCUA 1X69A 2CZ0B 1YHQA 3QBYA 3JCMX 2KYBA 1VQKA 4XTWA 4WCIA 2B86A 2EWNA 3J7AF 3V7RA 3MEWA 4AFZC 1YN8A 1YWPA 5HK0A 1OU8A 1MMAA 5ECAA 5GAN4 2RJCA 5LJ3h 3CCUT 3JAME 5I11A 1YHQT 1WNLA 1VQKT 2I2LA 4PJOB 1PD1A 2ROTA 5CR2A 2RMOA 3EG3A 5LL6S 4M7DC 4HVWA 2E1HA 4E47A 3SHWA 4M75A 4J9DA 2EGEA 1U5SA 2Z0WA 3E9GA 2C0TA 3FDRA 3EH1A 3QZ9B 3OYHA 4J9EA 4KBMB 1NJIU 1UUEA 3QHSA 4QVCA 3SWNC 2O01E 3MEVA 5FROA 2CH4A 4QVZA 4XTVA 2A28A 1X01A 5IAYA 1S72A 1W2BS 1Y96B 4FU6A 4M7DE 5HK3A 2M9UA 2X4XA 1KC8U 2RK1A 4IURA 3OW2A 4J7IA 1Q95G 3JCMg 4XTUA 4E7KA 3VS6A 2J6KA 5GAMh 3CCSQ 1QVFS 2QQ9A 3HFOA 1S72T 4TVRA 4OB3B 1BCMA 2F1LA 3G4SA 2NLUA 4PJOD 1R0CB 4JJCA 1Y7XA 2ATCB 1AWXA 2YUPA 4IUTA 1W6XA 2MWOA 4X34A 2E5KA 4ZNXA 3VV0A 4ZTFA 3QZ5B 3L2WA 3N5BB 4BACA 3G4ST 3Q1JA 2DZ9A 1M3AA 1PRMC 1RAFB 1XTDA 1Y57A 1RAHB 3JV3A 1V1CA 4N4IA 4A4HA 3CCUQ 1GBRA 3OYNA 2ED1A 1YHQQ 1Q7YU 3SWNB 4LDUA 1VQKQ 4BE2A 1MMDA 1EFNA 4EPCA 2PQWA 3J80E 2KE9A 3NTHA 3DLMA 3JCMe 4M7AF 2LZ6B 1D3BA 4JPBW 5KYUA 4E6RA 3H0HA 4EMKC 2HD0A 4DBFA 1OEBA 4NS5A 2DYBA 3EHQA 2QGGA 3OYEA 2GFUA 3H41A 3RERA 3RESA 4AFQC 3M53A 1LJOA 4JRQA 3V8JA 4M78E 4J6XA 4F16A 2E4HA 3OYIA 3TU4K 2Y4YA 4C8QC 4FT2A 1S72Q 3SB2A 2KVQG 2E41A 3CCEA 2K3BA 1ZUUA 4QQGA 2K3XA 1B7TA 2DM1A 2KY9A 2CP7A 1QVFA 4BY6C 2C0IA 2PVDB 1HXDA 1YJWA 1KD1C 4M77F 3OA6A
chains in the Genus database with same CATH topology
5A0GA 3RMSA 1M5Q1 3OMCA 4WF2A 3JCMW 1M90C 1TH7A 1YBYA 2RA2A 5L8RE 5KCOA 3S6WA 1BI1A 3X20B 4M7AG 2PUKB 1KQ2A 5GMKm 1KC8C 4M7DG 1VIEA 1G3WA 4C0FA 5CCAA 3OYFA 3GIBA 3ZFJA 4C8QE 4C5GA 4XU1A 4M75E 4L5GA 2R57A 1YJWT 4CI0C 2VV5A 2X35A 2DAQA 3PT9A 1RL2A 3PTAA 1YJNA 1M90U 3RIRA 3OBYA 4EMKB 4M7AE 4PJOF 3G6EA 1UGRB 3CPFA 3I55A 1BIBA 1KHCA 1UGQB 2ZPIB 3GOXA 2CZ7B 4QW2A 5FLXE 1JJ2S 3OYCA 4J6YA 1HK9A 4JLGA 2HQEA 1XOVA 2KMTA 3FLGA 2KSSA 3L1AA 3OYGA 4ZGDB 1RI0A 3CC4A 4M7DA 4L59A 2VGNA 3CMEA 4DA4A 2DTOA 5KE2A 4ZN1A 5LJ3e 1YJNT 3X24B 4V2SA 4MZMA 4D6WA 3JRZA 3OYDA 3G6ET 5LJ5d 3I55T 4LDWA 5GMKe 3JCMP 2EAYA 4OMFB 4RMOA 2FL7A 3A5ZB 2LNVA 1EIFA 2DZCA 2LT1A 2RI5A 3HRUA 3RUXA 3RKWA 3GNFB 3MHXA 3C4SA 5KE3A 4JJNK 2OTJA 2D9TA 3M55A 3OYAA 1FWZA 1WQWA 5GANf 1K73U 3G71A 3CC4T 2RB6A 3QKJA 5CQXA 4N0AC 1X75C 3CMET 3VUBA 5GAN8 4CRIA 4M75B 4PLLA 2XKOC 3QPHA 3MP8A 1PSFA 4M77G 1M8VA 2V8IA 3BY7A 4RKUE 4JS4A 2JVVA 3CCQA 4LDYA 3QO3A 3JCMc 4Y28E 1QP3A 5CK9A 5GAN6 3V8KA 3M58A 2RH2A 4ELYC 3OS2A 1H641 5LJ5g 2XU8A 1JB0E 4BUGA 3G71T 1X6OA 4HCZA 4BDYA 1BYMA 1KQ1A 4P5NA 5D6YA 1K8AC 3LH0A 3R6OA 4FT4A 1P92A 2H3JA 2Y90A 4F7UF 1M9SA 1QVGS 2XDDA 4J83A 4PJOG 3F70A 5HKCA 2LRQA 3CCQT 1YJ9A 2A7YA 2P0PA 2EJGA 1DJ7B 2DXTA 1ZBXA 2XIDA 4M77A 4X9DA 3VYHB 1KG1A 2OAUA 2K57A 2QXFA 4HKEA 3OYYA 4C8QF 5FU6B 4NL2A 5C0MA 4E7HA 1K8AU 2GFAA 3M56A 4M75F 2HBPA 4X9CA 2CZ1B 2G3RA 2LTOA 2MMPA 3BW1A 3QUIA 3EFRA 5IN1A 3P8HA 5A0DA 2F69A 3QJYA 4XTZA 3VKIA 1YI2A 5I2MA 3OW2S 1VIFA 5GAN7 2DVEA 1WGSA 1YJ9T 3OMGA 1V29B 3CBOA 1Q81C 2CS7A 1VQNA 1Y71A 3JSCA 3META 1NZ9A 3OBWA 4PJOA 3QDRB 2EKOA 5A2QE 1UEBA 1PSEA 1N8RU 4PL6A 1N9RA 4LDVA 2K5IA 3BDUA 3KBGA 4C8QD 1YI2T 4M75D 3FRNA 3NTKA 3GLXA 1Q81U 2QQRA 2LT4A 1G3SA 4C0ZA 2O4XA 4PKCC 2CZ6B 3QSUA 3H8ZA 4ZGJB 1B34A 2RI2A 2XICA 2E12A 3JB9J 1Q82C 1Y07A 4C0DB 4E7IA 1N9SA 2GF7A 2ZZDA 1AHJB 3GNGA 1BKBA 4MZTA 4OGEA 1W2BA 4C92B 1I5LA 3CXCA 3JB9F 4C5HA 1VQ7A 4M78A 4OP0A 4IUUA 5AYFA 5DLQE 5GANg 4IKFA 3EAEA 2EFIA 2JNGA 2D6FA 2ZPGB 3CCMT 4F7UG 3L2QA 5GANh 4E7JA 2V8KA 2A3LA 3CBMA 3DB4A 4J8OA 1Y96A 2XHCA 1WJSA 1I81A 1Q82U 1ZQ1A 3T9NA 4ELZC 3M54A 3OYJA 2YLBA 1YIJA 4VUBA 5CQYA 3E9FA 2DD5A 4C8QG 3CCJA 2F5KA 1U1SA 3OS5A 4M75G 4F7UE 3M9QA 5D6WA 2CYZB 1W4SA 2R5MA 3RMQA 3LX7A 2MF2A 3M59A 4N4GA 1D3BB 3JB9D 3WVEB 2C06A 3CCET 4C92F 2X4WA 1ZHIA 3DB3A 3HHTB 5GAOp 2RD1A 3HRSA 2JTMA 3LGLA 4O5VA 1YIJT 1WPYA 5FU6C 2ZPBB 5GAN5 4JRPA 3CCJT 3C94A 2KQWA 2IG0A 1QVPA 2PUOB 1KQSA 4Z02A 1WJRA 1G3TA 4II1A 1WJQA 2B8AA 2RHIA 1UGSB 3VYGA 3LW5E 3A8HB 2F5TX 5I2SA 2DK3A 1XNIA 3OSSC 4XU0A 5CKDA 2E70A 2MI6A 3HFNA 5GAMd 3UWNA 3JCMd 4OF1A 5GAN2 4ATOA 3MP6A 2YLCA 2JTFA 3P8DA 2L89A 1WQ7A 2P0QA 5KH6A 4M7AA 3OS0A 3OQ5A 1K73C 1QP2A 2VUBA 1M1FA 3CCLA 3BFMA 5GAN3 3VU3C 2XDBA 4C5IA 4C92D 2FB7A 1QVGA 3KXTA 2GCXA 3JB9G 3L2ZA 1JBMA 5LJ5j 2YRVA 4R55A 4HA8A 5GANe 2LX9A 3A8OB 1VQ4A 1NPPA 2CGHA 4A4GA 1VQ8A 4ZGEB 4BE1A 2DKGA 4BB7A 1G3YA 3SWNA 4C0GA 4IUPA 2LCLA 4C0DC 2QA4A 5I21A 4PNOA 2EJ9A 4C92C 1VQMA 2M0OA 3EFSA 3MCAB 1I8FA 4XK8E 2R58A 5CKBA 4EDUA 2RI3A 5FU7B 1VQ4T 3HKSA 2QTXA 3CC7A 1VQ8T 2OTJT 2JUFA 2RK2A 3WXMB 5D6XA 2WSCE 3URGA 3NFCA 1VQLA 5DY9A 5LJ3f 4C92G 5GAOq 3FJPA 4MZPA 1GXIE 2QA4T 3FB9A 3CPWS 5LJ5h 4Y91A 1VQMT 2BUDA 3MO8A 2WACA 3OB9A 1LNXA 2KK4A 4DOVA 4XTXA 1U8RA 2RJEA 2XI9A 1OYXA 4YTLA 3RKYA 5J3BA 2Y4XA 3HP9A 2LCCA 3QYGB 2D0QB 3OYMA 2EQUA 2RJFA 4C92E 3A8MB 4FIBA 3MEAA 1MGQA 4A53A 1VQLT 2R5AA 2ZPHB 2RO0A 2BKDN 4N0AA 1N8RC 3FEOA 2DEQA 2PVOB 2EJFA 4M7DB 1UGPB 2RM4A 2JN0A 3DKMA 4A4FA 3UT1A 4OB1B 2RHZA 4B9XA 1YITA 2KDSA 2BIVA 1XQHA 2JOYA 1FXXA 3CCSA 1O75A 4OVAA 5HY6A 5GANj 4JRKA 4A4EA 2LC4A 4L6V5 4PLIA 3ASKA 2X4YA 3JCMJ 3PIPA 3LWIA 2HQXA 2ZCFB 2FYKA 4LD6A 1YITT 3PNWC 4J6WA 4QQ6A 4QQDA 5C6SA 1I4K1 1O9SA 4M78C 3FIFA 4RG8A 2ZPEB 3CCST 4JS5A 2DJZA 3E1SA 2EYQA 2X4JA 1VQNT 3FC3A 3GPLA 5LJ3d 4RCBA 5GAMf 3JCMf 2E5QA 2E6ZA 2XK0A 5CVIA 3H6ZA 4J7FA 1BI2A 5LJ5e 1U1TA 1OI1A 2HAXA 2RHXA 1JJ2A 3V7CA 4GY5A 4ME7A 1N27A 5GAOr 5CKFA 3L42A 1VQ5A 1M1GA 3X25B 4DOWA 4EMKA 2XDPA 4LDXA 2K2VA 4IUVA 2DIGA 4J5YA 2RHUA 1KHIA 3CCUA 2QEXA 5FU7C 2CZ0B 4FL6A 3QBYA 1YHQA 3JCMX 5FRMA 3QIIA 4M77B 3TREA 1VQKA 4N4HA 2DTIA 4XTWA 2EIFA 2EWNA 3MP1A 3OS1A 3J7AF 1VQ7T 3V7RA 4M7DD 2MAMA 3MEWA 5LJ3g 3DLLA 4KUDK 3CD6A 5KCHA 1R8OB 3HRTA 3ME9A 3VUZA 3NTIA 3PGGA 4JUVA 5HK0A 1Q86C 1VQ5T 5GAN4 3SFMA 2RJCA 5LJ3h 3CCUT 2QEXT 2EQKA 3JAME 4F7UA 3SD4A 3TCJA 1FX7A 1YHQT 2PVGB 3PMIA 3V8LA 1WNLA 2JZ2A 3P8BB 1VQKT 2I2LA 4PJOB 5CR2A 3C95A 1MHNA 2OTLA 4RG2A 4M7AC 4FM4B 2GQVA 2LDMA 2QQBA 5LL6S 3X26B 4NL3A 3CD6T 4M7DC 1Q86U 1JRIA 3A8GB 3M4YA 1NE8A 2E1HA 4C8QA 4E47A 4XU2A 3UPUA 5CAIA 4M75A 1VUBA 3QXEB 1M1KC 3L2VA 3E9GA 3JCMV 2K5LA 3FDRA 2DD4A 4HCCA 5GAMj 4BI8B 2O4XB 4RCCA 3CPWA 3A8LB 3QJ6A 3QZ9B 3OYHA 4KBMB 5FRNA 1B34B 1NJIU 5CKHA 4A4KA 3QHSA 2OTLT 3VJPA 3SWNC 4QVCA 3CC2A 5J26A 2O01E 3OYKA 3OYLA 3MEVA 5FROA 4M78B 5CO7A 1KD1U 1M1KU 3CCVA 3LGFA 2ZGWA 5A0LA 4QVZA 4XTVA 1IREB 1X01A 3WVDB 2ZPFB 3C12A 2WSFE 5IAYA 1S72A 1W2BS 1Y96B 4FU6A 3CXCS 1M4ZA 4M7DE 1IZ6A 2M9UA 5HK3A 2L3RA 4HT9A 4KUIA 2X4XA 4M77D 1KC8U 1OZ3A 2RK1A 3CCLT 4IURA 1H3ZA 3OW2A 4J7IA 3INZA 3LLRA 5CKEA 2K3YA 4BD3A 2DIQA 3CC2T 4MMLA 2VGMA 4ZN3A 3JCMg 2IVWA 5GAMg 1G5VA 4XTUA 1BIAA 5M9OA 1YCYA 1NPRA 2P0KA 5IT9E 3CCVT 4E7KA 3JB9H 1VQOA 4DQ2A 2M16A 2DXBA 4XU3A 3JCMh 5GAMh 5GAOm 1QVFS 1VQ6A 2QQ9A 3HFOA 3JCMb 3CMAA 1S72T 3S3NA 4TVRA 4OB3B 2LQKA 1K9MC 4M77C 4M78F 3G4SA 2HNIA 2NLUA 4PJOD 4A54A 1Y7XA 3O8VA 4XTYA 3HL8A 2L5QA 4R56A 4IUTA 1SSFA 4Q5WA 1VQOT 2DTHA 2VYTA 5GAOn 2FHDA 2MWOA 4X34A 2K4YA 4C8QB 4ZTJA 3CC7T 1VQ6T 3CMAT 3OY9A 3LWHA 3VV0A 4ZTFA 3QZ5B 1K9MU 3AHUA 3L2WA 1Q7YC 3N5BB 4B9WA 4M7AB 4E7LA 4BACA 1KQSS 3G4ST 3JB9I 4BI4A 2MWPA 2VC8A 2XD0A 5GMKl 4PJOC 4BY6B 3Q1JA 3ZBDA 4C92A 3X28B 3G7ZA 2DPPB 2AHJB 2DZ9A 2RJDA 3QYHB 3S3MA 2QDYB 1LOJA 3E19A 4M78D 3L2RA 4EMHA 1XTDA 4M77E 2DO3A 4N4IA 3TEEA 4A4HA 5GMKi 2E65A 3HPWA 4JLIA 4BI3A 3OYNA 5CIUA 1Q7YU 4OB0B 4EMGA 5DLOA 2QQSA 3M4GA 4LDUA 3SWNB 3S3OA 3UDCA 3CBPA 3QG1A 4MMKA 4BE2A 3M57A 4EPCA 2PQWA 3J80E 3CCRA 4HCBA 3I56A 2LVMA 2M1HA 3NTHA 2QI2A 5GAMe 3DLMA 3JCMe 4UC4A 4M7AF 3PFSA 3RKXA 4MDXA 4PJOE 1D3BA 3HSBA 3SDZA 4EMKC 5LJ3j 3CEYA 5GAOl 1VQ9A 2DXCA 4M7DF 2HD0A 4KULA 3L2UA 2E6NA 4MDWA 4NS5A 2VXEA 5EG2A 5GMKj 5GANd 4OGCA 4BDZA 1VQPA 4HT8A 3M5AA 3OYEA 2GFUA 4M78G 3BDLA 3CCRT 4LD9K 3I56T 3RESA 3RERA 1BI3A 2FVUA 2YHTA 3MEUA 1OZ2A 3M53A 2KAFA 4OB2B 1LJOA 3PMTA 4FSXA 4QVDA 3GP8A 4JRQA 4BE0A 2LQ8A 3LYIA 3V8JA 3CCMA 4F7UB 1VQ9T 3OSVA 3V7SA 3J81E 2RHYA 2WSEE 4IUQA 4M78E 1VQPT 4M7AD 4XAXB 2V8JA 4J6XA 2E64A 2VXFA 4GLKA 2E10A 2K5FA 2XG8D 4C5EA 3OYBA 3TU4K 3OYIA 2EQJA 3KUFA 1UB4A 2Y4YA 3ER0A 4O6JA 4JRIA 2PU9B 4C8QC 3PIOA 4FT2A 1BI0A 4NOYA 4M75C 2KVQG 2E41A 3SB2A 1QW1A 5GMKh 5LJ5f 2DXUA 4KT0E 3JCMQ 3CCEA 3GF5A 4QQGA 4XQ3A 2K3XA 5DM7R 1NJIC 2EQMA 2KY9A 4JDSA 3ZEHA 2QQAA 2L8DA 1QVFA 1N6AA 4BY6C 2PVDB 5J39A 1HXDA 2P4TA 1YJWA 1KD1C 2CKKA 4M77F 3OA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM g;  3JCM W;  1M5Q 1;  4WF2 A;  4XTU A;  1BIA A;  1YCY A;  4N0A A;  1TH7 A;  2RA2 A;  3QSU A;  2DEQ A;  3JB9 J;  1B34 A;  2EJF A;  3JB9 H;  4DQ2 A;  2RM4 A;  2JN0 A;  4XU3 A;  5GAM h;  3JCM h;  4M7A G;  1N9S A;  5GAO m;  1KQ2 A;  5GMK m;  3HFO A;  3JCM b;  4M7D G;  4C92 B;  1I5L A;  3JB9 F;  4M78 A;  4OP0 A;  5GAN g;  3GIB A;  4C8Q E;  4XU1 A;  4M75 E;  4M77 C;  4M78 F;  2HNI A;  5GAN j;  4F7U G;  4JRK A;  4PJO D;  4A54 A;  5GAN h;  4XTY A;  3RIR A;  1Y96 A;  4EMK B;  4M7A E;  4PJO F;  1I81 A;  3JCM J;  1BIB A;  2DTH A;  5GAO n;  4C8Q B;  2FYK A;  2YLB A;  4J6W A;  4J6Y A;  1HK9 A;  4C8Q G;  1I4K 1;  4M78 C;  1U1S A;  3FIF A;  3AHU A;  4M75 G;  4F7U E;  2DJZ A;  3L1A A;  4M7A B;  4M7D A;  3JB9 I;  2DTO A;  2VC8 A;  5LJ3 d;  4RCB A;  5GMK l;  4PJO C;  1D3B B;  5GAM f;  5LJ3 e;  3JB9 D;  3JCM f;  4C92 A;  4V2S A;  2DZ9 A;  1LOJ A;  4C92 F;  5LJ5 d;  4M78 D;  5GMK e;  5LJ5 e;  4EMH A;  2EAY A;  1U1T A;  5GAO p;  4M77 E;  3RUX A;  4F7U B;  3JCM P;  2RD1 A;  2DZC A;  5GMK i;  3V7C A;  3RKW A;  2E65 A;  4JLI A;  1WPY A;  5GAO r;  5GAN 5;  4EMK A;  1WQW A;  5GAN f;  4EMG A;  4J5Y A;  2RB6 A;  3M4G A;  4N0A C;  3SWN B;  5GAN 8;  4MMK A;  3JCM X;  4M77 B;  3HSB A;  4XU0 A;  4M75 B;  2DTI A;  4XTW A;  3HFN A;  4M77 G;  5GAM d;  2EWN A;  3JCM d;  5GAN 2;  5GAM e;  4M7A A;  4M7D B;  2YLC A;  3BY7 A;  3V7R A;  3JCM e;  1WQ7 A;  4M7D D;  5LJ3 g;  1M8V A;  4M7A F;  3RKX A;  3QO3 A;  3JCM c;  4PJO E;  1D3B A;  3BFM A;  5GAN 3;  3PGG A;  4JUV A;  3V8K A;  3VU3 C;  4EMK C;  4MML A;  4C92 D;  2FB7 A;  1H64 1;  5GAN 6;  5LJ3 j;  5LJ5 g;  5GAM g;  5GAN 4;  5GAO l;  5LJ3 h;  3JB9 G;  1KQ1 A;  3L2Z A;  1JBM A;  2VXE A;  4F7U A;  5GMK j;  5LJ5 j;  5GAN d;  4HT8 A;  4HA8 A;  5GAN e;  2Y90 A;  4F7U F;  4M78 G;  3V8L A;  1WNL A;  3RER A;  2CGH A;  2I2L A;  3RES A;  4PJO B;  2YHT A;  4M7A C;  2DKG A;  3SWN A;  4A53 A;  1LJO A;  4PJO G;  4QVD A;  4NL3 A;  4M7D C;  1JRI A;  2EJG A;  2DXT A;  4M77 A;  3V8J A;  4X9D A;  4C8Q A;  2E1H A;  5I21 A;  4PNO A;  4XU2 A;  5CAI A;  2EJ9 A;  2K57 A;  4M75 A;  3V7S A;  4C92 C;  4C8Q F;  4NL2 A;  3EFS A;  3JCM V;  4M75 F;  1I8F A;  4M78 E;  4M7A D;  5GAM j;  4X9C A;  4J6X A;  3QUI A;  4RCC A;  3BW1 A;  2E64 A;  3EFR A;  2VXF A;  1B34 B;  2QTX A;  4XTZ A;  2E10 A;  3QHS A;  5GAN 7;  4QVC A;  2DVE A;  3SWN C;  5DY9 A;  5LJ3 f;  4C92 G;  5GAO q;  3FJP A;  4M78 B;  4JRI A;  4C8Q C;  3FB9 A;  4M7D F;  4NOY A;  4M75 C;  2ZGW A;  2E41 A;  3SB2 A;  4PJO A;  5GMK h;  5LJ5 f;  4Y91 A;  5LJ5 h;  2DXU A;  4XTV A;  3JCM Q;  1X01 A;  1LNX A;  4XQ3 A;  1N9R A;  1Y96 B;  4XTX A;  4M7D E;  3RKY A;  4HT9 A;  4M77 D;  3BDU A;  4C8Q D;  1HXD A;  3INZ A;  4M75 D;  4C92 E;  4M77 F;  1MGQ A; 
#chains in the Genus database with same CATH topology
 3JCM W;  4RTW A;  4DBH A;  1BI1 A;  6AT1 B;  2A08 A;  5KYU B;  5GMK m;  2OJ2 A;  3G4S Q;  4C0F A;  3GIB A;  4C8Q E;  4XU1 A;  2A37 A;  1T0H A;  2R57 A;  1ZSZ C;  1YJW T;  3PTA A;  2KRN A;  4EMK B;  3CPF A;  3I55 A;  1BIB A;  1UGQ B;  3GOX A;  2CZ7 B;  2RQT A;  2YXY A;  1C6V X;  5FLX E;  2PNI A;  1XOV A;  2KMT A;  3OYG A;  1RI0 A;  4L59 A;  5KE2 A;  4ZN1 A;  3THK A;  2J06 A;  3I55 T;  4OMF B;  4FW2 A;  2LT1 A;  1QQJ A;  3GNF B;  1X6B A;  3M55 A;  1WQW A;  2DET A;  1K73 U;  2RB6 A;  2J05 A;  5CQX A;  1KD1 R;  2LX7 A;  5GAN 8;  4FYY B;  1TXQ A;  2M0Y A;  2XKO C;  4JS4 A;  1KSW A;  5LJ5 g;  1JB0 E;  1FMK A;  1K8A C;  2FPD A;  2Y90 A;  1GCQ C;  2PTK A;  4PJJ A;  4PJO G;  4PJM A;  2P0P A;  2XID A;  3VYH B;  1VA7 A;  4HKE A;  1M2V A;  2G3R A;  2MMP A;  5IN1 A;  2CP6 A;  5A0D A;  4XTZ A;  2KNB B;  5I2M A;  3UA7 A;  4DEY A;  2DA9 A;  3CBO A;  1QMC A;  3CCE Q;  4OMO A;  4FYW B;  3OBW A;  1YJW Q;  4LDV A;  2K5I A;  3QWY A;  3KBG A;  1PG5 B;  2DL3 A;  4C8Q D;  1ARK A;  3REA B;  3NMZ C;  4PKC C;  1U06 A;  3QSU A;  2RI2 A;  4QKU A;  1TWB A;  2AKL A;  4E7I A;  1K8A R;  1BKB A;  4MZT A;  2JMC A;  2VB6 A;  1I5L A;  4OP0 A;  2NUP B;  1SSH A;  2EFI A;  2JNG A;  2ZPG B;  3I55 Q;  5GAN h;  4E7J A;  2CT4 A;  1M3B A;  3T9N A;  1E6H A;  3M54 A;  1AEY A;  5CQY A;  3CXC P;  2DD5 A;  5FWB A;  4M75 G;  4F7U E;  2BZ8 A;  2GNC A;  4N4G A;  3JB9 D;  2C06 A;  4C92 F;  2CP2 A;  4KGV B;  3DB3 A;  5GAO p;  1RAC B;  2RD1 A;  3LGL A;  1TSF A;  2EYY A;  3C94 A;  3RDV A;  1KQS A;  4Z02 A;  1PKS A;  1JXM A;  1WJQ A;  3VYG A;  3M0P A;  3TVT A;  5I2S A;  2F5T X;  1E6G A;  3OSS C;  1LPL A;  4M7A A;  3P8D A;  2J6F A;  3OQ5 A;  1QP2 A;  1T3S A;  1SHF A;  1YFN A;  2F2W A;  1ZLM A;  1JBM A;  4R55 A;  2LX9 A;  2CGH A;  4F17 A;  1VQ8 A;  4FW1 A;  4ZGE B;  2DKG A;  4IUP A;  1TUG B;  4C0D C;  2QA4 A;  1D0X A;  2EJ9 A;  2JT4 A;  4J9F A;  1VQM A;  3EFS A;  1I8F A;  5CKB A;  2R58 A;  5KYY A;  2RI3 A;  2ROL A;  1QKW A;  4CC4 B;  1VQ8 T;  2OTJ T;  5D6X A;  2WSC E;  3URG A;  5DY9 A;  1TUD A;  4MZP A;  2QA4 T;  2V1Q A;  5LJ5 h;  1VQM T;  2EKH A;  3MO8 A;  2HZY A;  4XTX A;  1OYX A;  2LCC A;  2EQU A;  1QWF A;  1GBQ A;  3MEA A;  2IPO B;  2R5A A;  2ZPH B;  2LMJ A;  3I35 A;  4N0A A;  4D8D A;  2DEQ A;  2EJF A;  3DKM A;  2RHZ A;  1YIT A;  1O75 A;  2DNU A;  5HY6 A;  2QEX Q;  4JRK A;  4JJB A;  4DBR A;  4PLI A;  4HVV A;  3EFO A;  4LD6 A;  1YIT T;  3CD6 Q;  5KYY B;  2EYQ A;  2V1R A;  2SEM A;  1U1T A;  1JJ2 A;  4IUV A;  5FU7 C;  1WXT A;  3REB B;  2H3E B;  4M77 B;  3TRE A;  1T3L A;  2JTE A;  1M8M A;  3MP1 A;  2MAM A;  5LJ3 g;  1NYF A;  3HRT A;  3VUZ A;  3NTI A;  4JUV A;  1PRL C;  3SFM A;  3SD4 A;  1VQ8 Q;  2PVG B;  4OMN A;  2JW4 A;  1E7O A;  3V8L A;  1KK7 A;  2QA4 Q;  1D1A A;  4RG2 A;  2GQV A;  1VQM Q;  1Q86 U;  3EFO B;  1JRI A;  3O5Z A;  2YDL A;  3UPU A;  3TQ7 P;  2K5L A;  3D7S B;  4BI8 B;  3H0I A;  4RCC A;  3A8L B;  2CP5 A;  5FRN A;  1B34 B;  4F14 A;  3CC2 A;  2HL3 A;  2EYZ A;  5J26 A;  1VYU A;  3LGF A;  3I9Q A;  2ZGW A;  1IRE B;  2WSF E;  3HTR A;  3CXC S;  2L3R A;  4KUI A;  4M77 D;  3INZ A;  4ORZ A;  3CC2 T;  2DIQ A;  4MML A;  5GAM g;  4FYX B;  2ENM A;  2MK5 A;  5M9O A;  2M16 A;  5GAO m;  3JCM b;  2DF6 A;  1GFC A;  1NJI R;  4M78 F;  2HNI A;  4A54 A;  2DRK A;  4XTY A;  3HL8 A;  1RAE B;  2L5Q A;  3FJ5 A;  4R56 A;  1SSF A;  2DTH A;  2FHD A;  2NUZ A;  4ZTJ A;  3NHN A;  1K9M U;  3AHU A;  1Q7Y C;  1KC8 R;  4E7L A;  2OI3 A;  5IHK A;  2XD0 A;  4PJO C;  5GMK l;  4C92 A;  3X28 B;  2DPP B;  3L2R A;  4EMH A;  1AOJ A;  3TEE A;  2H8H A;  4JLI A;  4E7S A;  5CIU A;  2FPE A;  1RAI B;  4J9G A;  3CBP A;  2RNA A;  4RUG A;  4MMK A;  2DL4 A;  2LVM A;  5GAM e;  1IB8 A;  4UC4 A;  3PFS A;  4MDX A;  4PJO E;  3VS0 A;  3L2U A;  2VXE A;  1D09 B;  2YRC A;  4Z8A A;  3MEU A;  2QDL A;  1OZ2 A;  2XMF A;  1V76 A;  1WLP B;  3PMT A;  3GP8 A;  1AWW A;  3LYI A;  1W70 A;  2K79 A;  3CCM A;  1Q7Y R;  4LE9 A;  2WSE E;  2M02 A;  3H9N A;  2V8J A;  3CC2 Q;  2E64 A;  2VXF A;  2XG8 D;  3KUF A;  4O6J A;  3PIO A;  1BI0 A;  4M75 C;  1QW1 A;  5GMK h;  4XQ3 A;  2CH4 W;  4AG2 C;  2EQM A;  2FZG B;  5J39 A;  1WHM A;  1I0C A;  2P4T A;  2CP0 A;  5A0G A;  1FMW A;  3OMC A;  5KCO A;  2DFU A;  4KH0 B;  2A0F B;  1SRL A;  3S6W A;  4M7A G;  2PUK B;  5CCA A;  2LP5 A;  4RTT A;  3ZFJ A;  4C5G A;  4M75 E;  4AG1 C;  2X35 A;  1RL2 A;  3RIR A;  1AZE A;  3RBB B;  1UGR B;  1T0J A;  2ZPI B;  4E2F B;  2KSS A;  3L1A A;  4ZGD B;  4M7D A;  1HYO A;  4GLM A;  3VS3 A;  4D6W A;  3JRZ A;  4LDW A;  4RMO A;  3RUX A;  2LNV A;  3RKW A;  3MHX A;  1X27 A;  5KE3 A;  3OYA A;  2LCS A;  1UHC A;  3EGX A;  4CRI A;  4M75 B;  3U23 A;  3QPH A;  4M77 G;  1PSF A;  3BY7 A;  5KYW A;  5EC7 A;  4LDY A;  3QO3 A;  3JCM c;  4Y28 E;  5CK9 A;  3M0R A;  3V8K A;  3OS2 A;  4ELY C;  1IGU A;  2AT1 B;  2LJ3 A;  4BDY A;  1BYM A;  1KIK A;  5D6Y A;  3LH0 A;  5AT1 B;  4F7U F;  1K0S A;  4M4Z A;  3CCM Q;  1MND A;  1YJ9 A;  2LRQ A;  1X2Q A;  2OAU A;  2QXF A;  5FU6 B;  4NL2 A;  4E7H A;  1UEC A;  2HBP A;  1B07 A;  2CZ1 B;  1BU1 A;  4PFO A;  1OQK A;  1YI2 A;  2DEU A;  1WGS A;  1YJ9 T;  1Y71 A;  3JSC A;  3MET A;  2GBQ A;  4J9H A;  2EKO A;  2LQW A;  1UEB A;  1PSE A;  1N8R U;  4PL6 A;  1YIJ Q;  1AWO A;  3BDU A;  3M0S A;  1YI2 T;  4M75 D;  4AFU C;  3GLX A;  2QQR A;  2LT4 A;  1C0M A;  2O4X A;  4KGX B;  3JB9 J;  2E12 A;  1JXO A;  2K7A A;  2ZZD A;  3GNG A;  4OGE A;  2CSI A;  1W2B A;  3R6N A;  1VQ7 A;  1ZUK A;  4M78 A;  4IUU A;  5GAN g;  1PCX A;  3EAE A;  3L2Q A;  2V8K A;  3DB4 A;  4J8O A;  2E3H A;  5IHN A;  1IHV A;  1QCO A;  2RF0 A;  4VUB A;  4LXC A;  1ACM B;  3OS5 A;  3PE0 A;  1W4S A;  2R5M A;  3RMQ A;  1BB9 A;  3M59 A;  1D3B B;  3TSZ A;  3CCE T;  2KEA A;  3EG9 A;  1UG1 A;  2X4W A;  1ZHI A;  2SRC A;  1WPY A;  2ZPB B;  4CC3 A;  2KQW A;  1GL5 A;  1G3T A;  4II1 A;  1UGS B;  4K11 A;  3LW5 E;  1UDL A;  3A8H B;  5CKD A;  2MI6 A;  3HFN A;  3JCM d;  4OF1 A;  2JTF A;  3VS5 A;  2KYM A;  1VQL Q;  3CCL A;  1C1A A;  2XDB A;  3MJX A;  2HSP A;  2EGC A;  2DBM A;  4FSS A;  4AFS C;  2YRV A;  4HA8 A;  5GAN e;  4HVU A;  1VQ4 A;  1YJ9 Q;  4BB7 A;  1G3Y A;  2LCL A;  2HDA A;  1ZSZ A;  2O9S A;  1IHW A;  1NG2 A;  8AT1 B;  3MCA B;  2GTJ A;  4PK4 A;  4EDU A;  1YI2 Q;  1G83 A;  2MIO A;  3EGD A;  1VQ4 T;  4KH1 B;  3HKS A;  1Z9Q A;  3CC7 A;  2QGF B;  2QG9 B;  4C92 G;  1X2K A;  1PNJ A;  1GXI E;  1D0Y A;  2KGT A;  3FB9 A;  4E7Z A;  2L3Q A;  4OMP A;  1D1B A;  2BUD A;  3OB9 A;  2WAC A;  2FPF A;  4YTL A;  1IRX A;  1NBE B;  3QYG B;  2D0Q B;  3OYM A;  1MGQ A;  4A53 A;  1WIE A;  4RTU A;  4A4F A;  3UT1 A;  1VQ7 Q;  4B9X A;  2KDS A;  4LUD A;  2DYI A;  2BZX A;  4OVA A;  2MOX A;  1UE9 A;  2LC4 A;  4L6V 5;  1W1F A;  1GRI A;  4IIM A;  5GJV B;  1KFZ A;  3PIP A;  2FYK A;  2CP3 A;  2EGA A;  3PNW C;  4J6W A;  4JS5 A;  2DJZ A;  3FC3 A;  3EGD B;  1M27 C;  1SF9 A;  3JCM f;  2E6Z A;  2XK0 A;  5LJ5 e;  2HAX A;  2OTL Q;  3V7C A;  4GY5 A;  5GAO r;  5CKF A;  1MV3 A;  2K2V A;  5I22 A;  4J5Y A;  1KHI A;  2CUB A;  2QEX A;  4FL6 A;  2ZAE A;  1RLQ C;  3CCL Q;  1M2V B;  1S1N A;  1RAG B;  3CD6 A;  1MUZ A;  1R8O B;  1Q86 C;  3PGG A;  2LJ0 A;  1VQ4 Q;  3LH5 A;  2QEX T;  1TS9 A;  4F7U A;  3TCJ A;  1FX7 A;  1FYN A;  3I5R A;  2JZ2 A;  3P8B B;  4M7A C;  4FM4 B;  2LDM A;  2HCK A;  1FMV A;  3CD6 T;  4GBQ A;  2G6F X;  2RQW A;  3QXE B;  3L2V A;  3CC7 Q;  4HCC A;  5GAM j;  3CMA Q;  1K4U S;  3QJ6 A;  3BE3 A;  4A4K A;  1AZG B;  2AK5 A;  3OYK A;  3OYL A;  5CO7 A;  1KD1 U;  1M1K U;  9ATC B;  2JXB A;  5A0L A;  3WVD B;  3C12 A;  1M4Z A;  4HT9 A;  1OZ3 A;  1H3Z A;  1MMG A;  1WHG A;  3LLR A;  4BD3 A;  2VGM A;  2BE7 D;  1G5V A;  1Q86 R;  2P0K A;  5IT9 E;  1VQO A;  2DXB A;  3UF4 A;  3EH2 A;  3S3N A;  2HKQ B;  1K9M C;  3OW2 P;  4M77 C;  3MPU B;  2BE9 B;  3O8V A;  3SEM A;  3UAT A;  1WX6 A;  2F2V A;  1VQO T;  2VYT A;  5GAO n;  5HCK A;  1WDX A;  1ABQ A;  1X6G A;  3OY9 A;  3LWH A;  4X1V A;  1ZA2 B;  4M7A B;  2DX1 A;  2ABL A;  3JB9 I;  4BI4 A;  2MWP A;  2NYS A;  1WI7 A;  2FRY A;  3QYH B;  4AMC A;  3S3M A;  1LOJ A;  1D0Z A;  4M77 E;  3HPW A;  2KT8 A;  4BI3 A;  4OB0 B;  2QQS A;  3M4G A;  3S3O A;  3UDC A;  3QG1 A;  1OOT A;  2P84 A;  3I56 A;  1UJY A;  2M1H A;  4IIO A;  3HSB A;  4M7D F;  1K9M R;  1VQ9 A;  4KUL A;  2E6N A;  2L2P A;  1I07 A;  2V26 A;  4M78 G;  2QYZ A;  4LD9 K;  3I56 T;  1BI3 A;  1XJW B;  2FVU A;  4OB2 B;  4DEX A;  3RNJ A;  4FSX A;  2LQ8 A;  2MPX C;  3RR6 A;  1VQ9 T;  3OSV A;  3V7S A;  1RI9 A;  3M0Q A;  1H8K A;  4M7A D;  4XAX B;  2FEI A;  1TTH B;  3TSW A;  4HXJ A;  1JO8 A;  2E10 A;  2K5F A;  2EQJ A;  1UB4 A;  2L3S A;  3MKD A;  1ZUY A;  2JM8 A;  2PU9 B;  4NOY A;  1VOM A;  5LJ5 f;  2DXU A;  2JM9 A;  1NJI C;  2KRM A;  3CC4 Q;  2AZV A;  1VQO Q;  1A0N B;  3RMS A;  1EZZ B;  1M5Q 1;  1YBY A;  2NUT A;  1KQ2 A;  1KC8 C;  1QCF A;  2EYX A;  2M51 A;  1K1Z A;  2QAS A;  2D1X A;  3PT9 A;  1M90 U;  1NEG A;  3G6E A;  3CPW P;  1KHC A;  1R77 A;  4QW2 A;  4J6Y A;  1HK9 A;  4JLG A;  1IXD A;  5L23 A;  3FLG A;  4PJL A;  4OMM A;  2VGN A;  3CME A;  2DTO A;  5LJ3 e;  3X24 B;  4MZM A;  3G6E T;  5GMK e;  3JCM P;  2EAY A;  2FL7 A;  3HRU A;  2RI5 A;  2DZC A;  3C4S A;  2D9T A;  1FWZ A;  2CSQ A;  3G71 A;  3PVL A;  4Y92 A;  4LUE A;  3QKJ A;  1JU5 C;  1X75 C;  4RTV A;  3I56 Q;  3CME T;  3VUB A;  2X3W D;  2X3X D;  5IXF A;  4PLL A;  2V8I A;  1PC0 A;  4RKU E;  1VQ9 Q;  2JVV A;  2GQI A;  1CSK A;  2NUT B;  2RH2 A;  2HMA A;  1AT1 B;  3G71 T;  1KQ1 A;  4P5N A;  2HKN A;  2RQU A;  2DL5 A;  4PFP A;  4JJD A;  1UGV A;  5HKC A;  3F70 A;  2A7Y A;  2EJG A;  1DJ7 B;  4KRT A;  4X9D A;  2J6O A;  4C8Q F;  1K0X A;  2GFA A;  1SHG A;  3QUI A;  2VVK A;  3BW1 A;  3EFR A;  3P8H A;  1G2B A;  1B3Q A;  1WXB A;  3OW2 S;  5GAN 7;  4OML A;  3OMG A;  2CS7 A;  1VQN A;  1NZ9 A;  4PJO A;  3QDR B;  2IIM A;  2JS2 A;  1AVZ C;  2E3I A;  3G1J A;  4J9I A;  2ESW A;  3FRN A;  1Q81 U;  1YNZ A;  1G3S A;  1SEM A;  3H8Z A;  2XIC A;  1AHJ B;  1BCO A;  1HD3 A;  3QWX X;  4C92 B;  4ANJ A;  3CXC A;  3JB9 F;  5DLQ E;  2RPN A;  2L0A A;  3EHR A;  3G6E Q;  3CCM T;  4F7U G;  3CQT A;  2A3L A;  3CBM A;  2KR3 A;  1Y96 A;  2XHC A;  1Q82 U;  4ELZ C;  3OYJ A;  1YIJ A;  1N8R R;  3CME Q;  1NEB A;  3M9Q A;  4PJN A;  3LX7 A;  2MF2 A;  3QDF A;  2YRD A;  1SRM A;  3HRS A;  2JTM A;  4O5V A;  2RQV A;  4EIK A;  3G71 Q;  1YIJ T;  5FU6 C;  5GAN 5;  2COZ A;  1HJD A;  1OUL A;  1U3O A;  2L3P A;  2EW3 A;  1WJR A;  4J9B A;  2ED0 A;  2B8A A;  1G8X A;  2DK3 A;  1XNI A;  4XU0 A;  2P4R A;  5GAM d;  5GAN 2;  3UWN A;  3MP6 A;  1WQ7 A;  3OS0 A;  1K73 C;  2VUB A;  1M1F A;  3BFM A;  3A1P A;  5GAN 3;  4C92 D;  4AT1 B;  1KQS P;  1VYT A;  2GCX A;  3L2Z A;  4QT7 A;  5LJ5 j;  3A8O B;  2OAW A;  2I0N A;  4A4G A;  3VS1 A;  4RTZ A;  1WYX A;  3SWN A;  2W10 A;  2EPD A;  4PNO A;  1OPL A;  1RUW A;  2M0O A;  4XK8 E;  2W0Z A;  4WTO B;  2DER A;  1PWT A;  1I1J A;  2BZY A;  2AZS A;  1MNE A;  2QTX A;  1JEG A;  1VQN Q;  2KI7 A;  1BK2 A;  3WXM B;  1VQL A;  5LJ3 f;  5GAO q;  2HSE B;  4JZ4 A;  2K9G A;  2DJQ A;  3CPW S;  4FCY A;  1LNX A;  2KK4 A;  4DOV A;  2MYS A;  2RJE A;  3RKY A;  5J3B A;  3HP9 A;  2RJF A;  1WXU A;  4FIB A;  1K73 R;  1VQL T;  2BKD N;  4M7D B;  1UGP B;  2RM4 A;  3VS4 A;  1FXX A;  4A4E A;  5FWC A;  4HCK A;  2A36 A;  3JCM J;  3LWI A;  4PFZ A;  1BBZ A;  2HQX A;  2ZCF B;  3EGX B;  2YUO A;  4M78 C;  3FIF A;  5KYN A;  3E1S A;  4J9C A;  2DVJ A;  2X4J A;  1D1C A;  5KYW B;  4RCB A;  4D8K A;  1WHL A;  5GAM f;  2E5Q A;  1OI1 A;  2DE0 X;  3EG0 A;  1N27 A;  1WFW A;  1VQ5 A;  1HSQ A;  3I5S A;  4EMK A;  2XDP A;  4LDX A;  2DIG A;  4CC2 A;  1N5Z A;  3QII A;  5FRM A;  2RQR A;  2C0O A;  1NLO C;  2DTI A;  4N4H A;  4KGZ B;  2EIF A;  3OS1 A;  1JJ2 P;  1IO6 A;  3EGU A;  1VQ7 T;  4M7D D;  3DLL A;  4KUD K;  5KCH A;  3VRZ A;  3ME9 A;  1VQ5 T;  1SPK A;  2EQK A;  3E2U A;  1QCN A;  2VWF A;  3PMI A;  2CUD A;  3C95 A;  1MHN A;  2K2M A;  2OTL A;  2O9V A;  2QQB A;  3X26 B;  4NL3 A;  3A8G B;  3M4Y A;  1NE8 A;  4C8Q A;  4XU2 A;  1M1K C;  5CAI A;  1VUB A;  4RTY A;  3JCM V;  2DD4 A;  2O4X B;  3CPW A;  2LNH B;  2YSQ A;  2O88 A;  5CKH A;  2OTL T;  3GBQ A;  3VJP A;  4M78 B;  3CCV A;  2QK0 A;  2ZPF B;  1IZ6 A;  3CCL T;  1QVG P;  5CKE A;  2J7I A;  2K3Y A;  1ZX6 A;  2RN8 A;  4ZN3 A;  2IVW A;  1BIA A;  1YCY A;  1NPR A;  3CCV T;  3JB9 H;  4DQ2 A;  4XU3 A;  3JCM h;  1VQ6 A;  3CMA A;  3EG9 B;  2LQK A;  2D0N A;  2HEQ A;  1RAB B;  1CKA A;  3ZL7 C;  1AWJ A;  1M1K R;  1CKB A;  4Q5W A;  4C8Q B;  2K4Y A;  1NLP C;  3CC7 T;  1VQ6 T;  3CMA T;  5GJW B;  2X51 A;  4B9W A;  3A98 A;  1KQS S;  2D8J A;  2VC8 A;  4BY6 B;  3ZBD A;  3VS2 A;  3G7Z A;  2AHJ B;  2RJD A;  2NUP A;  2QDY B;  3E19 A;  4M78 D;  1VQ5 Q;  2DO3 A;  5GMK i;  2E65 A;  2EBP A;  1SKU B;  4EMG A;  2DBK A;  5DLO A;  2LQN A;  1RLP C;  3IQL A;  1UFF A;  3M57 A;  3CCR A;  4HCB A;  1ZSZ B;  2QI2 A;  1GCQ A;  3RKX A;  1TG0 A;  3SDZ A;  1MV0 B;  5LJ3 j;  5GAO l;  2FZK B;  3CEY A;  2DXC A;  4MDW A;  5EG2 A;  5GMK j;  1VQP A;  5GAN d;  4OGC A;  4BDZ A;  4HT8 A;  3M5A A;  5IH2 A;  1QWE A;  3BDL A;  3CCR T;  1YCS B;  2YHT A;  2KAF A;  1H92 A;  2EYW A;  4QVD A;  4BE0 A;  2KRS A;  2DL7 A;  3J81 E;  2RHY A;  4IUQ A;  1ABO A;  1VQP T;  2COW A;  1K9A A;  1PM3 A;  2KRO A;  3VRY A;  2O31 A;  4GLK A;  2FZC B;  4C5E A;  3OYB A;  3CCV Q;  2GGR A;  3ER0 A;  2CDT A;  1MMN A;  4JRI A;  1QLY A;  3H0F A;  1VYV A;  4KT0 E;  3JCM Q;  3GF5 A;  5DM7 R;  4JDS A;  3ZEH A;  2QQA A;  2L8D A;  1N6A A;  4R0K A;  2CKK A;  1PD0 A;  4WF2 A;  1X43 A;  1M90 C;  1TH7 A;  2RA2 A;  5L8R E;  1VQ6 Q;  4OMQ A;  3X20 B;  2YUN A;  5IHI A;  4M7D G;  2KXC A;  1VIE A;  1G3W A;  3OYF A;  2YWW A;  4L5G A;  2DMO A;  4CI0 C;  1I5O B;  2VV5 A;  2DAQ A;  1YJN A;  2OX7 A;  3OBY A;  2VAS A;  2JS0 A;  4PJO F;  4M7A E;  3M0T A;  1JJ2 S;  1RAA B;  3OYC A;  2HQE A;  1OX9 A;  1H3H A;  2QAZ A;  3CC4 A;  1WHH A;  4DBQ A;  4CC7 A;  4DA4 A;  2EVR A;  4V2S A;  1YJN T;  3OYD A;  1Z9Z A;  5LJ5 d;  4JZ3 A;  2O2O A;  3A5Z B;  2CRE A;  1EIF A;  1M3C A;  4A63 B;  4F7U B;  2JJ9 A;  4JJN K;  2OTJ A;  2NWM A;  5GAN f;  3CC4 T;  2DRM A;  3CCR Q;  4N0A C;  1PKT A;  1M90 R;  3MP8 A;  1YP5 A;  1M8V A;  1R0B G;  3EG1 A;  3CCQ A;  2ECZ A;  4B6M A;  1QP3 A;  1UJ0 A;  5GAN 6;  1VQP Q;  3M58 A;  3NPF A;  1H64 1;  2XU8 A;  4BUG A;  1X6O A;  4HCZ A;  1OX8 A;  2KBT A;  3R6O A;  4FT4 A;  1P92 A;  2H3J A;  1Y0M A;  1M9S A;  2GTO A;  1AD5 A;  3AT1 B;  2VKN A;  1QVG S;  1UTI A;  2XDD A;  4J83 A;  1M2O A;  3CCQ T;  2DXT A;  1ZBX A;  4M77 A;  5KYX A;  1KG1 A;  2K57 A;  5C0M A;  3OYY A;  2MCN A;  1ZA1 B;  1K8A U;  4M75 F;  3M56 A;  7AT1 B;  2AIR B;  1J3T A;  4X9C A;  2AKK A;  2LTO A;  2COY A;  2F69 A;  3QJY A;  3VKI A;  1YWO A;  2F2X A;  1VIF A;  2DVE A;  5IXB A;  1WZO A;  1V29 B;  1Q81 C;  4FYV B;  1GCP A;  2FRW A;  3NGP A;  4LNP A;  5A2Q E;  1N9R A;  4Z88 A;  3NTK A;  2YUQ A;  4C0Z A;  2CZ6 B;  4ZGJ B;  1B34 A;  1Q82 C;  1Y07 A;  4C0D B;  1N9S A;  2GF7 A;  1WA7 A;  1QKX A;  1SG5 A;  4C5H A;  4IKF A;  5AYF A;  1YJN Q;  2D6F A;  1RAD B;  1WJS A;  2CT3 A;  2DIL A;  1I81 A;  1OU9 A;  1ZQ1 A;  5KYX B;  2EQI A;  1W2B P;  2YLB A;  3E9F A;  4C8Q G;  3CCJ A;  2F5K A;  1U1S A;  5D6W A;  2HL5 C;  2CYZ B;  3M0U A;  1WHJ A;  1Q81 R;  3WVE B;  5D7U A;  2OTJ Q;  3HHT B;  1QVF P;  2DLP A;  1WHK A;  5FW9 A;  4JRP A;  3CCJ T;  2IG0 A;  1ZSG A;  1QVP A;  2PUO B;  1TOV A;  2RHI A;  2PZ1 A;  3CCQ Q;  2E70 A;  1Q82 R;  4ATO A;  2YLC A;  4Z89 A;  2KXD A;  2L89 A;  2P0Q A;  5KH6 A;  3C0C A;  3VU3 C;  4C5I A;  2D8H A;  2FB7 A;  1QVG A;  3ULR B;  3KXT A;  3JB9 G;  1TU0 B;  1NM7 A;  1ZBJ A;  1NPP A;  2YT6 A;  2HQH A;  3KFV A;  4BE1 A;  4C0G A;  1JQQ A;  3EG2 A;  5I21 A;  1GFD A;  2BTT A;  4C92 C;  1KJW A;  1YIT Q;  1NYG A;  2HBW A;  5FU7 B;  2JUF A;  2RK2 A;  3NFC A;  3FJP A;  2QTV A;  4Y91 A;  1UHF A;  1LCK A;  1U8R A;  1IGQ A;  2DL8 A;  2XI9 A;  3UA6 A;  2Y4X A;  2LJ1 A;  4C92 E;  3A8M B;  1OPK A;  2FO0 A;  2RO0 A;  1N8R C;  3FEO A;  1LVK A;  2FG0 A;  2PVO B;  1TUC A;  2JN0 A;  2KT1 A;  4OB1 B;  1F1B B;  2BIV A;  1XQH A;  2JOY A;  1PHT A;  3CCS A;  5GAN j;  3ASK A;  4RTX A;  1OV3 A;  2X4Y A;  1M30 A;  3CCJ Q;  4F04 B;  4QQ6 A;  4QQD A;  5C6S A;  1I4K 1;  3VS7 A;  1O9S A;  4RG8 A;  2ZPE B;  3CCS T;  1VQN T;  3GPL A;  2JMA A;  5LJ3 d;  1K76 A;  5CVI A;  3H6Z A;  4J7F A;  1BI2 A;  2RHX A;  2K6D A;  3PVQ A;  2X9H A;  4ME7 A;  3L42 A;  1M1G A;  4LN2 A;  3X25 B;  4DOW A;  4ESR A;  8ATC B;  2RHU A;  1EX4 A;  3CCU A;  1X69 A;  2CZ0 B;  1YHQ A;  3QBY A;  3JCM X;  2KYB A;  1VQK A;  4XTW A;  4WCI A;  2B86 A;  2EWN A;  3J7A F;  3V7R A;  3MEW A;  4AFZ C;  1YN8 A;  1YWP A;  5HK0 A;  1OU8 A;  1MMA A;  5ECA A;  5GAN 4;  2RJC A;  5LJ3 h;  3CCU T;  3JAM E;  5I11 A;  1YHQ T;  1WNL A;  1VQK T;  2I2L A;  4PJO B;  1PD1 A;  2ROT A;  5CR2 A;  2RMO A;  3EG3 A;  5LL6 S;  4M7D C;  4HVW A;  2E1H A;  4E47 A;  3SHW A;  4M75 A;  4J9D A;  2EGE A;  1U5S A;  2Z0W A;  3E9G A;  2C0T A;  3FDR A;  3EH1 A;  3QZ9 B;  3OYH A;  4J9E A;  4KBM B;  1NJI U;  1UUE A;  3QHS A;  4QVC A;  3SWN C;  2O01 E;  3MEV A;  5FRO A;  2CH4 A;  4QVZ A;  4XTV A;  2A28 A;  1X01 A;  5IAY A;  1S72 A;  1W2B S;  1Y96 B;  4FU6 A;  4M7D E;  5HK3 A;  2M9U A;  2X4X A;  1KC8 U;  2RK1 A;  4IUR A;  3OW2 A;  4J7I A;  1Q95 G;  3JCM g;  4XTU A;  4E7K A;  3VS6 A;  2J6K A;  5GAM h;  3CCS Q;  1QVF S;  2QQ9 A;  3HFO A;  1S72 T;  4TVR A;  4OB3 B;  1BCM A;  2F1L A;  3G4S A;  2NLU A;  4PJO D;  1R0C B;  4JJC A;  1Y7X A;  2ATC B;  1AWX A;  2YUP A;  4IUT A;  1W6X A;  2MWO A;  4X34 A;  2E5K A;  4ZNX A;  3VV0 A;  4ZTF A;  3QZ5 B;  3L2W A;  3N5B B;  4BAC A;  3G4S T;  3Q1J A;  2DZ9 A;  1M3A A;  1PRM C;  1RAF B;  1XTD A;  1Y57 A;  1RAH B;  3JV3 A;  1V1C A;  4N4I A;  4A4H A;  3CCU Q;  1GBR A;  3OYN A;  2ED1 A;  1YHQ Q;  1Q7Y U;  3SWN B;  4LDU A;  1VQK Q;  4BE2 A;  1MMD A;  1EFN A;  4EPC A;  2PQW A;  3J80 E;  2KE9 A;  3NTH A;  3DLM A;  3JCM e;  4M7A F;  2LZ6 B;  1D3B A;  4JPB W;  5KYU A;  4E6R A;  3H0H A;  4EMK C;  2HD0 A;  4DBF A;  1OEB A;  4NS5 A;  2DYB A;  3EHQ A;  2QGG A;  3OYE A;  2GFU A;  3H41 A;  3RER A;  3RES A;  4AFQ C;  3M53 A;  1LJO A;  4JRQ A;  3V8J A;  4M78 E;  4J6X A;  4F16 A;  2E4H A;  3OYI A;  3TU4 K;  2Y4Y A;  4C8Q C;  4FT2 A;  1S72 Q;  3SB2 A;  2KVQ G;  2E41 A;  3CCE A;  2K3B A;  1ZUU A;  4QQG A;  2K3X A;  1B7T A;  2DM1 A;  2KY9 A;  2CP7 A;  1QVF A;  4BY6 C;  2C0I A;  2PVD B;  1HXD A;  1YJW A;  1KD1 C;  4M77 F;  3OA6 A; 
#chains in the Genus database with same CATH homology
 5A0G A;  3RMS A;  1M5Q 1;  3OMC A;  4WF2 A;  3JCM W;  1M90 C;  1TH7 A;  1YBY A;  2RA2 A;  5L8R E;  5KCO A;  3S6W A;  1BI1 A;  3X20 B;  4M7A G;  2PUK B;  1KQ2 A;  5GMK m;  1KC8 C;  4M7D G;  1VIE A;  1G3W A;  4C0F A;  5CCA A;  3OYF A;  3GIB A;  3ZFJ A;  4C8Q E;  4C5G A;  4XU1 A;  4M75 E;  4L5G A;  2R57 A;  1YJW T;  4CI0 C;  2VV5 A;  2X35 A;  2DAQ A;  3PT9 A;  1RL2 A;  3PTA A;  1YJN A;  1M90 U;  3RIR A;  3OBY A;  4EMK B;  4M7A E;  4PJO F;  3G6E A;  1UGR B;  3CPF A;  3I55 A;  1BIB A;  1KHC A;  1UGQ B;  2ZPI B;  3GOX A;  2CZ7 B;  4QW2 A;  5FLX E;  1JJ2 S;  3OYC A;  4J6Y A;  1HK9 A;  4JLG A;  2HQE A;  1XOV A;  2KMT A;  3FLG A;  2KSS A;  3L1A A;  3OYG A;  4ZGD B;  1RI0 A;  3CC4 A;  4M7D A;  4L59 A;  2VGN A;  3CME A;  4DA4 A;  2DTO A;  5KE2 A;  4ZN1 A;  5LJ3 e;  1YJN T;  3X24 B;  4V2S A;  4MZM A;  4D6W A;  3JRZ A;  3OYD A;  3G6E T;  5LJ5 d;  3I55 T;  4LDW A;  5GMK e;  3JCM P;  2EAY A;  4OMF B;  4RMO A;  2FL7 A;  3A5Z B;  2LNV A;  1EIF A;  2DZC A;  2LT1 A;  2RI5 A;  3HRU A;  3RUX A;  3RKW A;  3GNF B;  3MHX A;  3C4S A;  5KE3 A;  4JJN K;  2OTJ A;  2D9T A;  3M55 A;  3OYA A;  1FWZ A;  1WQW A;  5GAN f;  1K73 U;  3G71 A;  3CC4 T;  2RB6 A;  3QKJ A;  5CQX A;  4N0A C;  1X75 C;  3CME T;  3VUB A;  5GAN 8;  4CRI A;  4M75 B;  4PLL A;  2XKO C;  3QPH A;  3MP8 A;  1PSF A;  4M77 G;  1M8V A;  2V8I A;  3BY7 A;  4RKU E;  4JS4 A;  2JVV A;  3CCQ A;  4LDY A;  3QO3 A;  3JCM c;  4Y28 E;  1QP3 A;  5CK9 A;  5GAN 6;  3V8K A;  3M58 A;  2RH2 A;  4ELY C;  3OS2 A;  1H64 1;  5LJ5 g;  2XU8 A;  1JB0 E;  4BUG A;  3G71 T;  1X6O A;  4HCZ A;  4BDY A;  1BYM A;  1KQ1 A;  4P5N A;  5D6Y A;  1K8A C;  3LH0 A;  3R6O A;  4FT4 A;  1P92 A;  2H3J A;  2Y90 A;  4F7U F;  1M9S A;  1QVG S;  2XDD A;  4J83 A;  4PJO G;  3F70 A;  5HKC A;  2LRQ A;  3CCQ T;  1YJ9 A;  2A7Y A;  2P0P A;  2EJG A;  1DJ7 B;  2DXT A;  1ZBX A;  2XID A;  4M77 A;  4X9D A;  3VYH B;  1KG1 A;  2OAU A;  2K57 A;  2QXF A;  4HKE A;  3OYY A;  4C8Q F;  5FU6 B;  4NL2 A;  5C0M A;  4E7H A;  1K8A U;  2GFA A;  3M56 A;  4M75 F;  2HBP A;  4X9C A;  2CZ1 B;  2G3R A;  2LTO A;  2MMP A;  3BW1 A;  3QUI A;  3EFR A;  5IN1 A;  3P8H A;  5A0D A;  2F69 A;  3QJY A;  4XTZ A;  3VKI A;  1YI2 A;  5I2M A;  3OW2 S;  1VIF A;  5GAN 7;  2DVE A;  1WGS A;  1YJ9 T;  3OMG A;  1V29 B;  3CBO A;  1Q81 C;  2CS7 A;  1VQN A;  1Y71 A;  3JSC A;  3MET A;  1NZ9 A;  3OBW A;  4PJO A;  3QDR B;  2EKO A;  5A2Q E;  1UEB A;  1PSE A;  1N8R U;  4PL6 A;  1N9R A;  4LDV A;  2K5I A;  3BDU A;  3KBG A;  4C8Q D;  1YI2 T;  4M75 D;  3FRN A;  3NTK A;  3GLX A;  1Q81 U;  2QQR A;  2LT4 A;  1G3S A;  4C0Z A;  2O4X A;  4PKC C;  2CZ6 B;  3QSU A;  3H8Z A;  4ZGJ B;  1B34 A;  2RI2 A;  2XIC A;  2E12 A;  3JB9 J;  1Q82 C;  1Y07 A;  4C0D B;  4E7I A;  1N9S A;  2GF7 A;  2ZZD A;  1AHJ B;  3GNG A;  1BKB A;  4MZT A;  4OGE A;  1W2B A;  4C92 B;  1I5L A;  3CXC A;  3JB9 F;  4C5H A;  1VQ7 A;  4M78 A;  4OP0 A;  4IUU A;  5AYF A;  5DLQ E;  5GAN g;  4IKF A;  3EAE A;  2EFI A;  2JNG A;  2D6F A;  2ZPG B;  3CCM T;  4F7U G;  3L2Q A;  5GAN h;  4E7J A;  2V8K A;  2A3L A;  3CBM A;  3DB4 A;  4J8O A;  1Y96 A;  2XHC A;  1WJS A;  1I81 A;  1Q82 U;  1ZQ1 A;  3T9N A;  4ELZ C;  3M54 A;  3OYJ A;  2YLB A;  1YIJ A;  4VUB A;  5CQY A;  3E9F A;  2DD5 A;  4C8Q G;  3CCJ A;  2F5K A;  1U1S A;  3OS5 A;  4M75 G;  4F7U E;  3M9Q A;  5D6W A;  2CYZ B;  1W4S A;  2R5M A;  3RMQ A;  3LX7 A;  2MF2 A;  3M59 A;  4N4G A;  1D3B B;  3JB9 D;  3WVE B;  2C06 A;  3CCE T;  4C92 F;  2X4W A;  1ZHI A;  3DB3 A;  3HHT B;  5GAO p;  2RD1 A;  3HRS A;  2JTM A;  3LGL A;  4O5V A;  1YIJ T;  1WPY A;  5FU6 C;  2ZPB B;  5GAN 5;  4JRP A;  3CCJ T;  3C94 A;  2KQW A;  2IG0 A;  1QVP A;  2PUO B;  1KQS A;  4Z02 A;  1WJR A;  1G3T A;  4II1 A;  1WJQ A;  2B8A A;  2RHI A;  1UGS B;  3VYG A;  3LW5 E;  3A8H B;  2F5T X;  5I2S A;  2DK3 A;  1XNI A;  3OSS C;  4XU0 A;  5CKD A;  2E70 A;  2MI6 A;  3HFN A;  5GAM d;  3UWN A;  3JCM d;  4OF1 A;  5GAN 2;  4ATO A;  3MP6 A;  2YLC A;  2JTF A;  3P8D A;  2L89 A;  1WQ7 A;  2P0Q A;  5KH6 A;  4M7A A;  3OS0 A;  3OQ5 A;  1K73 C;  1QP2 A;  2VUB A;  1M1F A;  3CCL A;  3BFM A;  5GAN 3;  3VU3 C;  2XDB A;  4C5I A;  4C92 D;  2FB7 A;  1QVG A;  3KXT A;  2GCX A;  3JB9 G;  3L2Z A;  1JBM A;  5LJ5 j;  2YRV A;  4R55 A;  4HA8 A;  5GAN e;  2LX9 A;  3A8O B;  1VQ4 A;  1NPP A;  2CGH A;  4A4G A;  1VQ8 A;  4ZGE B;  4BE1 A;  2DKG A;  4BB7 A;  1G3Y A;  3SWN A;  4C0G A;  4IUP A;  2LCL A;  4C0D C;  2QA4 A;  5I21 A;  4PNO A;  2EJ9 A;  4C92 C;  1VQM A;  2M0O A;  3EFS A;  3MCA B;  1I8F A;  4XK8 E;  2R58 A;  5CKB A;  4EDU A;  2RI3 A;  5FU7 B;  1VQ4 T;  3HKS A;  2QTX A;  3CC7 A;  1VQ8 T;  2OTJ T;  2JUF A;  2RK2 A;  3WXM B;  5D6X A;  2WSC E;  3URG A;  3NFC A;  1VQL A;  5DY9 A;  5LJ3 f;  4C92 G;  5GAO q;  3FJP A;  4MZP A;  1GXI E;  2QA4 T;  3FB9 A;  3CPW S;  5LJ5 h;  4Y91 A;  1VQM T;  2BUD A;  3MO8 A;  2WAC A;  3OB9 A;  1LNX A;  2KK4 A;  4DOV A;  4XTX A;  1U8R A;  2RJE A;  2XI9 A;  1OYX A;  4YTL A;  3RKY A;  5J3B A;  2Y4X A;  3HP9 A;  2LCC A;  3QYG B;  2D0Q B;  3OYM A;  2EQU A;  2RJF A;  4C92 E;  3A8M B;  4FIB A;  3MEA A;  1MGQ A;  4A53 A;  1VQL T;  2R5A A;  2ZPH B;  2RO0 A;  2BKD N;  4N0A A;  1N8R C;  3FEO A;  2DEQ A;  2PVO B;  2EJF A;  4M7D B;  1UGP B;  2RM4 A;  2JN0 A;  3DKM A;  4A4F A;  3UT1 A;  4OB1 B;  2RHZ A;  4B9X A;  1YIT A;  2KDS A;  2BIV A;  1XQH A;  2JOY A;  1FXX A;  3CCS A;  1O75 A;  4OVA A;  5HY6 A;  5GAN j;  4JRK A;  4A4E A;  2LC4 A;  4L6V 5;  4PLI A;  3ASK A;  2X4Y A;  3JCM J;  3PIP A;  3LWI A;  2HQX A;  2ZCF B;  2FYK A;  4LD6 A;  1YIT T;  3PNW C;  4J6W A;  4QQ6 A;  4QQD A;  5C6S A;  1I4K 1;  1O9S A;  4M78 C;  3FIF A;  4RG8 A;  2ZPE B;  3CCS T;  4JS5 A;  2DJZ A;  3E1S A;  2EYQ A;  2X4J A;  1VQN T;  3FC3 A;  3GPL A;  5LJ3 d;  4RCB A;  5GAM f;  3JCM f;  2E5Q A;  2E6Z A;  2XK0 A;  5CVI A;  3H6Z A;  4J7F A;  1BI2 A;  5LJ5 e;  1U1T A;  1OI1 A;  2HAX A;  2RHX A;  1JJ2 A;  3V7C A;  4GY5 A;  4ME7 A;  1N27 A;  5GAO r;  5CKF A;  3L42 A;  1VQ5 A;  1M1G A;  3X25 B;  4DOW A;  4EMK A;  2XDP A;  4LDX A;  2K2V A;  4IUV A;  2DIG A;  4J5Y A;  2RHU A;  1KHI A;  3CCU A;  2QEX A;  5FU7 C;  2CZ0 B;  4FL6 A;  3QBY A;  1YHQ A;  3JCM X;  5FRM A;  3QII A;  4M77 B;  3TRE A;  1VQK A;  4N4H A;  2DTI A;  4XTW A;  2EIF A;  2EWN A;  3MP1 A;  3OS1 A;  3J7A F;  1VQ7 T;  3V7R A;  4M7D D;  2MAM A;  3MEW A;  5LJ3 g;  3DLL A;  4KUD K;  3CD6 A;  5KCH A;  1R8O B;  3HRT A;  3ME9 A;  3VUZ A;  3NTI A;  3PGG A;  4JUV A;  5HK0 A;  1Q86 C;  1VQ5 T;  5GAN 4;  3SFM A;  2RJC A;  5LJ3 h;  3CCU T;  2QEX T;  2EQK A;  3JAM E;  4F7U A;  3SD4 A;  3TCJ A;  1FX7 A;  1YHQ T;  2PVG B;  3PMI A;  3V8L A;  1WNL A;  2JZ2 A;  3P8B B;  1VQK T;  2I2L A;  4PJO B;  5CR2 A;  3C95 A;  1MHN A;  2OTL A;  4RG2 A;  4M7A C;  4FM4 B;  2GQV A;  2LDM A;  2QQB A;  5LL6 S;  3X26 B;  4NL3 A;  3CD6 T;  4M7D C;  1Q86 U;  1JRI A;  3A8G B;  3M4Y A;  1NE8 A;  2E1H A;  4C8Q A;  4E47 A;  4XU2 A;  3UPU A;  5CAI A;  4M75 A;  1VUB A;  3QXE B;  1M1K C;  3L2V A;  3E9G A;  3JCM V;  2K5L A;  3FDR A;  2DD4 A;  4HCC A;  5GAM j;  4BI8 B;  2O4X B;  4RCC A;  3CPW A;  3A8L B;  3QJ6 A;  3QZ9 B;  3OYH A;  4KBM B;  5FRN A;  1B34 B;  1NJI U;  5CKH A;  4A4K A;  3QHS A;  2OTL T;  3VJP A;  3SWN C;  4QVC A;  3CC2 A;  5J26 A;  2O01 E;  3OYK A;  3OYL A;  3MEV A;  5FRO A;  4M78 B;  5CO7 A;  1KD1 U;  1M1K U;  3CCV A;  3LGF A;  2ZGW A;  5A0L A;  4QVZ A;  4XTV A;  1IRE B;  1X01 A;  3WVD B;  2ZPF B;  3C12 A;  2WSF E;  5IAY A;  1S72 A;  1W2B S;  1Y96 B;  4FU6 A;  3CXC S;  1M4Z A;  4M7D E;  1IZ6 A;  2M9U A;  5HK3 A;  2L3R A;  4HT9 A;  4KUI A;  2X4X A;  4M77 D;  1KC8 U;  1OZ3 A;  2RK1 A;  3CCL T;  4IUR A;  1H3Z A;  3OW2 A;  4J7I A;  3INZ A;  3LLR A;  5CKE A;  2K3Y A;  4BD3 A;  2DIQ A;  3CC2 T;  4MML A;  2VGM A;  4ZN3 A;  3JCM g;  2IVW A;  5GAM g;  1G5V A;  4XTU A;  1BIA A;  5M9O A;  1YCY A;  1NPR A;  2P0K A;  5IT9 E;  3CCV T;  4E7K A;  3JB9 H;  1VQO A;  4DQ2 A;  2M16 A;  2DXB A;  4XU3 A;  3JCM h;  5GAM h;  5GAO m;  1QVF S;  1VQ6 A;  2QQ9 A;  3HFO A;  3JCM b;  3CMA A;  1S72 T;  3S3N A;  4TVR A;  4OB3 B;  2LQK A;  1K9M C;  4M77 C;  4M78 F;  3G4S A;  2HNI A;  2NLU A;  4PJO D;  4A54 A;  1Y7X A;  3O8V A;  4XTY A;  3HL8 A;  2L5Q A;  4R56 A;  4IUT A;  1SSF A;  4Q5W A;  1VQO T;  2DTH A;  2VYT A;  5GAO n;  2FHD A;  2MWO A;  4X34 A;  2K4Y A;  4C8Q B;  4ZTJ A;  3CC7 T;  1VQ6 T;  3CMA T;  3OY9 A;  3LWH A;  3VV0 A;  4ZTF A;  3QZ5 B;  1K9M U;  3AHU A;  3L2W A;  1Q7Y C;  3N5B B;  4B9W A;  4M7A B;  4E7L A;  4BAC A;  1KQS S;  3G4S T;  3JB9 I;  4BI4 A;  2MWP A;  2VC8 A;  2XD0 A;  5GMK l;  4PJO C;  4BY6 B;  3Q1J A;  3ZBD A;  4C92 A;  3X28 B;  3G7Z A;  2DPP B;  2AHJ B;  2DZ9 A;  2RJD A;  3QYH B;  3S3M A;  2QDY B;  1LOJ A;  3E19 A;  4M78 D;  3L2R A;  4EMH A;  1XTD A;  4M77 E;  2DO3 A;  4N4I A;  3TEE A;  4A4H A;  5GMK i;  2E65 A;  3HPW A;  4JLI A;  4BI3 A;  3OYN A;  5CIU A;  1Q7Y U;  4OB0 B;  4EMG A;  5DLO A;  2QQS A;  3M4G A;  4LDU A;  3SWN B;  3S3O A;  3UDC A;  3CBP A;  3QG1 A;  4MMK A;  4BE2 A;  3M57 A;  4EPC A;  2PQW A;  3J80 E;  3CCR A;  4HCB A;  3I56 A;  2LVM A;  2M1H A;  3NTH A;  2QI2 A;  5GAM e;  3DLM A;  3JCM e;  4UC4 A;  4M7A F;  3PFS A;  3RKX A;  4MDX A;  4PJO E;  1D3B A;  3HSB A;  3SDZ A;  4EMK C;  5LJ3 j;  3CEY A;  5GAO l;  1VQ9 A;  2DXC A;  4M7D F;  2HD0 A;  4KUL A;  3L2U A;  2E6N A;  4MDW A;  4NS5 A;  2VXE A;  5EG2 A;  5GMK j;  5GAN d;  4OGC A;  4BDZ A;  1VQP A;  4HT8 A;  3M5A A;  3OYE A;  2GFU A;  4M78 G;  3BDL A;  3CCR T;  4LD9 K;  3I56 T;  3RES A;  3RER A;  1BI3 A;  2FVU A;  2YHT A;  3MEU A;  1OZ2 A;  3M53 A;  2KAF A;  4OB2 B;  1LJO A;  3PMT A;  4FSX A;  4QVD A;  3GP8 A;  4JRQ A;  4BE0 A;  2LQ8 A;  3LYI A;  3V8J A;  3CCM A;  4F7U B;  1VQ9 T;  3OSV A;  3V7S A;  3J81 E;  2RHY A;  2WSE E;  4IUQ A;  4M78 E;  1VQP T;  4M7A D;  4XAX B;  2V8J A;  4J6X A;  2E64 A;  2VXF A;  4GLK A;  2E10 A;  2K5F A;  2XG8 D;  4C5E A;  3OYB A;  3TU4 K;  3OYI A;  2EQJ A;  3KUF A;  1UB4 A;  2Y4Y A;  3ER0 A;  4O6J A;  4JRI A;  2PU9 B;  4C8Q C;  3PIO A;  4FT2 A;  1BI0 A;  4NOY A;  4M75 C;  2KVQ G;  2E41 A;  3SB2 A;  1QW1 A;  5GMK h;  5LJ5 f;  2DXU A;  4KT0 E;  3JCM Q;  3CCE A;  3GF5 A;  4QQG A;  4XQ3 A;  2K3X A;  5DM7 R;  1NJI C;  2EQM A;  2KY9 A;  4JDS A;  3ZEH A;  2QQA A;  2L8D A;  1QVF A;  1N6A A;  4BY6 C;  2PVD B;  5J39 A;  1HXD A;  2P4T A;  1YJW A;  1KD1 C;  2CKK A;  4M77 F;  3OA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...