1M3BA

Solution structure of a circular form of the n-terminal sh3 domain (a134c, e135g, r191g mutant) from oncogene protein c-crk.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
58
structure length
58
Chain Sequence
CGYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Proto-oncogene C-crk
publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
total genus 5
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m3bA00
2GQIA 4LN2A 4IIOA 4D8KA 4RTXA 5IH2A 1NEBA 1NLOC 1YWPA 4KRTA 3JV3A 1WLPB 1OOTA 2LX7A 4GBQA 4LE9A 1EFNA 2C0TA 2EYZA 4HCKA 4E6RA 2DVJA 1WDXA 2L3PA 2VWFA 1U3OA 2DRKA 3FJ5A 2K79A 2CSQA 1MV0B 1I0CA 2DL7A 2FRYA 1JQQA 2YUPA 2F2XA 4DEYA 2RQVA 5FWCA 2KT1A 4IIMA 3H0IA 2LQNA 2RQWA 2KR3A 1GL5A 5EC7A 3EG2A 1PKTA 2EYYA 2EGEA 1QKWA 1I07A 2CSIA 2CUDA 2FPEA 4J9HA 3ZL7C 3I5SA 1AWWA 2DL4A 2IIMA 2X3WD 3IQLA 1WXTA 1YCSB 4AFUC 2OAWA 4JJBA 2HCKA 1SEMA 1K0XA 1JEGA 3REAB 2DILA 1QWFA 1VYUA 1X2KA 3M0PA 4EIKA 1SRLA 1PRMC 2AKLA 2F2VA 4J9IA 1E6HA 1WXBA 1NYFA 2JS2A 2KNBB 2DYBA 2I0NA 1G83A 1UUEA 4CC7A 1UJYA 1TUDA 3M0SA 2G6FX 1SRMA 3C0CA 2RNAA 1ZUKA 2MIOA 2A28A 2AZSA 2KRNA 3VS5A 1KIKA 1OV3A 3QWYA 1YWOA 3VS3A 3THKA 2JS0A 1ZX6A 2KEAA 2HDAA 2RMOA 1UDLA 1VA7A 2M51A 1AZEA 2L3SA 1JXMA 1ZLMA 4A63B 2DNUA 3H41A 4OMPA 4HXJA 1UECA 1CKBA 4J9FA 1UGVA 2B86A 4OMQA 2A37A 2GNCA 2V1QA 1T0HA 4LUEA 1BBZA 5IHIA 1U5SA 2YUNA 5HCKA 1KFZA 1WI7A 5IXFA 1HJDA 2DMOA 2JM9A 4X1VA 2ENMA 2JMCA 5GJVB 1K4US 4HVUA 2QDLA 3ULRB 3VS7A 2FEIA 1NLPC 2CREA 2HBWA 3UA6A 1W1FA 1MUZA 1UTIA 4D8DA 1AWOA 2K3BA 1PNJA 2FRWA 5I22A 2KYMA 2CH4A 4CC3A 2M0YA 2EQIA 1ABOA 3PVLA 4CC2A 2LMJA 2L3QA 2RN8A 4RTTA 2C0OA 1AZGB 1E7OA 2EW3A 1Z9ZA 4JJCA 2F2WA 2J6OA 1QCFA 1SHFA 4HVWA 1KSWA 1J3TA 1GBRA 2KGTA 1YP5A 1B3QA 2AKKA 3VS0A 2KYBA 1NYGA 3M0UA 2J6FA 1UJ0A 1M3CA 2LNHB 3LH5A 2KBTA 2J6KA 2K6DA 1XOVA 1Y0MA 4R0KA 1OPLA 1GBQA 1RUWA 3A98A 1FMKA 1PWTA 2LQWA 2ROTA 4J9DA 5ECAA 5IXBA 2VVKA 2DM1A 4RTYA 1PRLC 1PHTA 2RQRA 1QWEA 3EHQA 2D8JA 1BU1A 2D0NA 2V1RA 1X27A 2K7AA 4J9EA 2CT3A 2LP5A 1ZUUA 4J9GA 1UFFA 3RNJA 2K9GA 3KFVA 1Y57A 2GBQA 2YSQA 2CUBA 4DEXA 1T3SA 4LUDA 3REBB 2KE9A 2OI3A 2JMAA 1AWXA 2BZXA 2J05A 2DA9A 2D8HA 2BZYA 2ROLA 2P4RA 1M8MA 1X6BA 3M0TA 4RTVA 4K11A 1OEBA 4JZ4A 5GJWB 2DLPA 1M3AA 1CKAA 3CQTA 1U06A 5FWBA 3M0QA 2KXCA 1G2BA 3NHNA 2YT6A 2HSPA 1H8KA 2W0ZA 3O5ZA 1JO8A 4F14A 1JU5C 3TSZA 2D1XA 3GBQA 1WFWA 2DF6A 2FG0A 2K2MA 2W10A 1KJWA 2SRCA 2XMFA 4OMLA 3EG1A 2O88A 1WX6A 2RF0A 1SHGA 4J9CA 1K0SA 4JJDA 1T0JA 3EG0A 1ARKA 2ED0A 3H0HA 3VS2A 4ORZA 3I9QA 1GCPA 3VS4A 1Z9QA 1ZBJA 1V1CA 1X6GA 1YN8A 1QKXA 1RI9A 1K1ZA 3TSWA 4AG2C 2DL5A 1X2QA 1K9AA 4CC4B 2DJQA 3I35A 1NEGA 1NM7A 2BZ8A 2ECZA 3NPFA 4WCIA 1H92A 4Z89A 1AWJA 2CH4W 3VS6A 1RLPC 2PZ1A 1AEYA 1SPKA 4AFSC 1UHCA 1X69A 2PTKA 1HD3A 2EBPA 2EYXA 1OPKA 2KT8A 1FYNA 1M30A 1X43A 2RQUA 2JT4A 4RUGA 2ED1A 4Y92A 2KXDA 3SEMA 1PKSA 2J7IA 1YNZA 3EHRA 1GCQA 3TVTA 3UA7A 1W70A 4ZNXA 1BB9A 1ABQA 2GGRA 1WXUA 3QWXX 1TUCA 2ABLA 2GTJA 1W6XA 4ESRA 2YUOA 1B07A 3UF4A 2LZ6B 5IHKA 2C0IA 2X3XD 2DX1A 2SEMA 2GTOA 2JXBA 4JPBW 1H3HA 2DL8A 2EKHA 1HSQA 2KROA 1UG1A 3R6NA 1NG2A 2O2OA 1GRIA 5L23A 2YUQA 1QLYA 3NGPA 2AK5A 2YDLA 4AG1C 4F17A 2RQTA 1MV3A 1K76A 2BTTA 1AD5A 4RTWA 1GCQC 2EYWA 2O31A 2L2PA 2A36A 1T3LA 2CDTA 2J06A 2O9VA 3NMZC 1RLQC 3RBBB 1A0NB 1WA7A 2AZVA 4RTUA 2EPDA 2DE0X 1IO6A 3I5RA 2DL3A 1M3BA 3M0RA 2RPNA 3VS1A 2EGAA 2CT4A 4OMNA 4Z8AA 2ESWA 3U23A 3VRYA 4Z88A 2DBKA 2LJ1A 1M27C 2KRMA 2JW4A 2JTEA 4RTZA 2NUZA 2KRSA 4LNPA 3PE0A 3EG3A 2DRMA 5IHNA 1UHFA 2EVRA 1VYTA 3VRZA 2PNIA 1GFCA 4M4ZA 1E6GA 2MOXA 4QT7A 2FPFA 1GFDA 2A08A 3SHWA 1S1NA 1AVZC 4FSSA 1WIEA 1ZUYA 2NWMA 1N5ZA 1SSHA 2H8HA 2L0AA 1AOJA 1LCKA 4GLMA 4JZ3A 2MCNA 2OJ2A 1JXOA 4HVVA 1BK2A 2EGCA 5I11A 1CSKA 2E5KA 4F16A 1VYVA 4AFQC 2LCSA 4J9BA 4OMMA 2JM8A 1TG0A 2O9SA 4OMOA 3UATA 3H0FA 2LJ3A 5FW9A 2VKNA 1I1JA 2DBMA 1WYXA 4AFZC 1UE9A 3PVQA 2FPDA 2FO0A 2LJ0A 3EGUA 2HEQA 1ZSGA
chains in the Genus database with same CATH superfamily
4E7JA 3RKXA 1W2BS 3OA6A 5DLQE 2IPOB 4MZPA 1C6VX 3CCUQ 2MAMA 4WTOB 4NOYA 4KRTA 1WLPB 5KYNA 3A8GB 4BI3A 1OOTA 2CP6A 1QVFP 1TTHB 5GAOl 2KDSA 4OGCA 1WHHA 4HCKA 2DVJA 4M78F 1WDXA 1VQKT 2DTIA 5GAOp 3QHSA 1F1BB 2KY9A 1D3BB 1YIJA 3CC4T 2FZGB 4DEYA 5C0MA 1JJ2P 3OBWA 3JCMe 4N4IA 1ZA2B 1VQ8T 2K5IA 1YI2A 4AT1B 2DO3A 3JB9J 2QGFB 2QQ9A 1NJIR 1YJ9A 4J9HA 2X3WD 1N8RC 3M53A 2XDBA 3UWNA 2DEQA 3HRTA 1K0XA 3QIIA 2DILA 1VYUA 2AKLA 2E1HA 1VQ7T 2EAYA 1YJNQ 5CQYA 1WXBA 1QVFA 3MEUA 2DYBA 2RI5A 1QVPA 4CC7A 1UJYA 3M0SA 1UGRB 4XK8E 1IREB 5KYYA 1SRMA 3C0CA 3G6EA 2MIOA 4A54A 2VUBA 1JJ2A 2A28A 2DKGA 3A8MB 2V8IA 2MF2A 3VS5A 1KIKA 5GAMh 3CCLT 4ZTJA 3ME9A 3VS3A 1I5LA 3THKA 2KQWA 2QA4A 4ME7A 2FL7A 2HDAA 3CBMA 1UDLA 3X24B 3LWIA 5KYWA 1JXMA 1V76A 1YIJT 4IURA 2VYTA 1CKBA 1UGVA 3OW2P 3D7SB 4E47A 1SF9A 1YI2T 3RMQA 2CKKA 3RDVA 5HCKA 3FIFA 3QZ9B 2HKNA 3E9GA 4X1VA 4BB7A 4XTXA 4C92B 2JMCA 1S72A 2K2VA 4HVUA 3FJPA 2FEIA 2ZPEB 1MGQA 5GMKi 3G7ZA 2CP5A 3BFMA 1AWOA 2FRWA 2K3BA 4II1A 5LJ5h 2M0YA 2EQIA 2HNIA 1Q86C 1G3WA 5D6XA 1VQ9T 1QW1A 1Y71A 3CPWA 1AZGB 3CCVT 2EW3A 2F2WA 1M1KU 1QCFA 2P0QA 4HVWA 3G6ET 3LX7A 5J26A 2KGTA 1N8RR 3OW2A 1B3QA 1RI0A 5AYFA 1BCOA 1X75C 2QA4T 1M3CA 1R0CB 1Q82C 9ATCB 5GANd 4HT8A 1XOVA 4QKUA 3HP9A 1OPLA 2RA2A 3CC7Q 1O9SA 1KD1U 1QP2A 3RKYA 4JRKA 3L2ZA 3LGLA 4RTYA 4E7LA 4RCCA 1UGPB 3OYMA 3CMAA 1VQMA 4N0AA 2MPXC 2WSFE 3MP6A 1X27A 4JRPA 2CT3A 2LP5A 1VQ9Q 2LRQA 5A0DA 1UFFA 4BI4A 1X6OA 3OYBA 1WZOA 2RHYA 3V8KA 2GBQA 3JCMX 2DD4A 2CUBA 4DEXA 1YITQ 1S72T 4E7KA 3REBB 1JRIA 3JB9I 2LDMA 5CQXA 3LW5E 4PLLA 2J05A 3A1PA 1M8MA 2FB7A 3A8LB 3JCMP 3UT1A 2Y4YA 3OB9A 4A53A 3VV0A 3L42A 1OEBA 2MWPA 1VQ6A 4PJNA 5GMKe 3OMCA 4F04B 2DPPB 4FM4B 2D1XA 2MWOA 2E5QA 2DF6A 4PJJA 1Q81R 2X4YA 4N0AC 1NJIU 4M75A 1KJWA 3EGXA 5A2QE 5KE2A 1WX6A 2HQHA 2ED0A 1RADB 3JCMh 1GCPA 1PSEA 4J8OA 3OBYA 1Q86R 1V1CA 1QKXA 2PVDB 1K1ZA 3DB3A 1X2QA 4XQ3A 5KYUA 3JCMW 4C0DB 1VQMT 2DJQA 2V8JA 1PM3A 1K8AR 2RK1A 2BZ8A 4WCIA 1H92A 4Z89A 4PLIA 5CIUA 2CH4W 2PZ1A 1ZHIA 1AEYA 1SPKA 3CD6A 3HRSA 1C0MA 4XTWA 1Q82R 1AHJB 3CCMT 1HD3A 3I56A 5FRMA 3QO3A 1FYNA 7AT1B 1UEBA 4RUGA 2ED1A 5GAOq 4M75C 4O5VA 3CMEQ 2J7IA 1YNZA 2XICA 3RERA 1W70A 2V8KA 1M1GA 5KYYB 1VQPQ 2HQEA 4JJNK 3ASKA 2GGRA 4C5EA 4BE2A 3SB2A 1M4ZA 3QWXX 4B9WA 1ZSZB 3UF4A 2EQKA 2E10A 2LVMA 4FU6A 3G71A 4XAXB 3HKSA 2JVVA 4J7IA 1Y96B 2GTOA 2JXBA 4JPBW 3X26B 4A4GA 4HCZA 1H3HA 1IXDA 3P8BB 3CCMQ 1HSQA 1V29B 3L1AA 1UG1A 2CP2A 1Q95G 3R6NA 3C12A 2AK5A 1TS9A 2IVWA 2RQTA 1LOJA 1MV3A 2HBPA 4C0GA 2CS7A 1AD5A 5GMKj 2EYWA 2O31A 2A36A 1OI1A 2O9VA 3H9NA 3A8OB 5FU6C 2ZPFB 1U1SA 4RTUA 1N8RU 1VQNQ 3I5RA 3CC2T 5L8RE 1QVGS 3I56T 3PMTA 4P5NA 4IUTA 2LJ1A 1M5Q1 3G4SQ 2X4JA 4RTZA 3PT9A 1OQKA 1SSFA 3HSBA 4XTYA 2LCLA 3MPUB 4ANJA 5FLXE 2PNIA 1QQJA 1GFCA 2DXBA 2MOXA 2FPFA 1OYXA 5J3BA 3VUBA 4FSSA 4UC4A 3G71T 3EFOA 4M7DA 4HKEA 3TCJA 2NWMA 2K3YA 3ZBDA 2FHDA 1N5ZA 2H8HA 3PMIA 2A0FB 4GLMA 3QG1A 4JZ3A 2OTLQ 2OJ2A 4M75D 3CC2Q 4HVVA 5I11A 1M2VB 2E5KA 1TU0B 4OB1B 1WGSA 4AFQC 2GFAA 1TG0A 3QJ6A 2DAQA 2Y90A 3H0FA 4JDSA 2DD5A 4Y91A 2FPDA 2GQIA 1VQ5A 1Q81U 4OB2B 1BIAA 4D8KA 4L59A 1YWPA 3JV3A 4ZN3A 4M7DC 4OP0A 3VUZA 1Q86U 2D6FA 2HZYA 3L2UA 2VWFA 2RHZA 3FJ5A 2DIGA 2OTJQ 2YUPA 3NTIA 3DKMA 2RQVA 2KT1A 4LDYA 1ZA1B 3GPLA 4WF2A 3EGXB 3NTKA 2RQWA 4PJOA 2QASA 3OYGA 1TWBA 3JB9D 2EYYA 4BDZA 1Q82U 2CSIA 1AWWA 1M90C 2DL4A 2IIMA 4BE0A 4FSXA 2DFUA 5KE3A 2XHCA 1BYMA 8AT1B 5GAOr 3M0PA 1PRMC 1E6HA 4JLIA 1BI1A 1W2BP 2KI7A 3I55A 2JS2A 2KNBB 3CCJQ 4BY6C 1WQ7A 2E65A 2ZPHB 1FMWA 5CKDA 1NJIC 5LJ3g 1TUDA 5GAN3 2G6FX 1VQ5T 3EAEA 2AZSA 3GNGA 2O4XA 1OV3A 4PJOC 5GAOm 2JS0A 3TEEA 1U1TA 1Q7YR 5KYXA 4M75E 2KEAA 4DBRA 2OX7A 4M7AA 2M51A 1ZLMA 1YHQA 2MYSA 2WSCE 4OMPA 1UECA 3EGDB 4J9FA 3CXCS 2CP3A 5LJ3h 2GNCA 1U8RA 3CCRT 2A3LA 4LUEA 5IHIA 1W2BA 1U5SA 3CCSQ 2LQ8A 5GAMd 2DMOA 4TVRA 4NL2A 4OB0B 1VQOT 4M7DD 4L5GA 4OMFB 4XTUA 1NLPC 2HBWA 3JCMJ 1W1FA 2EQMA 2PQWA 3EH1A 1UTIA 1RABB 2X9HA 1PNJA 5I22A 4MDWA 3GF5A 3PVLA 4CC2A 4E7IA 5IT9E 1KC8R 2RN8A 4M7AC 1OU8A 2JOYA 4MMLA 5I2MA 4JJCA 2H3JA 2ZGWA 1J3TA 1M90R 1N6AA 3CCEA 1LJOA 2FVUA 2KYBA 1N27A 2LNHB 2COWA 1YJWA 2PU9B 1XJWB 2DYIA 2J6KA 2K6DA 4N4HA 1EZZB 1Y0MA 5LJ5j 5LJ5d 1GBQA 2ROTA 1VQ4T 4J9DA 2PVGB 1BI2A 5CO7A 2VVKA 2DM1A 1R77A 1M8VA 3H8ZA 1IGQA 3PFSA 3L2QA 2E3IA 2RQRA 3EHQA 2D8JA 1BU1A 2D0NA 2K7AA 4J9EA 2JUFA 1ZUUA 5CR2A 4PJOD 2YSQA 2P0PA 4M78A 1HYOA 1T3SA 2RH2A 3FRNA 3VKIA 1VQKQ 3CCQA 1AWXA 2BZXA 3CC4Q 2P4RA 1X6BA 4K11A 4PFZA 1VQ8Q 3KBGA 2HL3A 4X9CA 3META 1U06A 1OULA 4NL3A 1G2BA 3NHNA 4J6WA 3QJYA 2QQBA 5FU7B 3O5ZA 2E41A 4PNOA 5LJ3f 4F14A 1JU5C 1B34A 3OSVA 3TSZA 3CCET 2R57A 3G1JA 2FZKB 1LNXA 5CKEA 1YITA 4M77A 5GAN7 1N9RA 2NUPA 2VC8A 2SRCA 1VQ7Q 2JZ2A 1YJWT 2RF0A 4M7DE 3QYHB 1KHCA 4MMKA 1KHIA 1K0SA 4JJDA 1VIEA 1TSFA 1W4SA 3H0HA 3OS5A 2DZCA 1YJ9T 6AT1B 1YN8A 4M7AD 3TSWA 1IB8A 1Q81C 3I35A 1NEGA 1NM7A 3CCLQ 1XNIA 1AWJA 1PG5B 2JTMA 5HY6A 2PVOB 2M0OA 2PTKA 2DJZA 3OYYA 3EFRA 3CCQT 3QSUA 2RQUA 4M77C 1YIJQ 3MO8A 5CK9A 3JCMd 1I4K1 2RHIA 3R6OA 1K8AC 3TVTA 2D9TA 4AMCA 5GMKm 1NE8A 1YI2Q 4DBFA 3TQ7P 3SWNA 1N9SA 4C5IA 2B8AA 1YCYA 4RG2A 4EMKB 1R8OB 2LZ6B 1PD1A 1QP3A 3C4SA 3DLMA 4QVDA 5LL6S 3INZA 4PJOE 3V8JA 2F5KA 1VQLA 2DL8A 3CPWS 2KROA 1PSFA 5CKHA 4KGXB 1VQPA 2QTVA 3CCVQ 3QBYA 5L23A 2P4TA 1QLYA 3NGPA 2YDLA 3G6EQ 3CBOA 4FW1A 3OYNA 3EG9B 3URGA 3F70A 3SWNC 2CDTA 3NMZC 1RLQC 3RBBB 2QA4Q 1M90U 1C1AA 4M75F 2DL3A 3E19A 1M3BA 4OF1A 1MMNA 3OS1A 4ZGEB 4EDUA 4Z8AA 2EFIA 4QQ6A 4M78D 3U23A 3KXTA 2KRMA 1LPLA 3SD4A 2ZZDA 1OZ3A 3PE0A 2E70A 3EG3A 2DTHA 4ZGJB 4XU3A 2GF7A 5IHNA 4M7AE 4JS4A 2QQAA 1S72Q 1SKUB 1GFDA 1D1AA 2A08A 2ATCB 1TOVA 4C5GA 1AVZC 2LT4A 5GANg 3X28B 2RHXA 1WJSA 1SSHA 3V7CA 2L0AA 1LCKA 4M77D 3CMAT 1VQLT 1K73R 3OQ5A 3VYHB 1BK2A 2EGCA 1VYVA 2LX9A 2LCSA 2JM8A 4OMOA 2NUTA 3CPFA 2LJ3A 2HD0A 3JCMb 5FW9A 1OX9A 2VKNA 1I1JA 5C6SA 3JB9F 4BDYA 4EMHA 3PVQA 1WJQA 4QVCA 5HKCA 3WXMB 3EGUA 2EJ9A 5GANh 4LN2A 4IIOA 1TH7A 1VQ6T 4FW2A 2JTFA 2OTLA 2K4YA 1WHKA 1NLOC 5EG2A 2C0TA 3GIBA 2NYSA 4LDWA 2HMAA 1D0XA 4M75G 3JSCA 1VQMQ 2GQVA 4E6RA 2L3PA 4FL6A 2DRKA 2K5LA 2K79A 1R0BG 5LJ3e 1JQQA 3NTHA 5KYWB 2RM4A 1JBMA 3UPUA 4BI8B 2LQNA 3VJPA 5EC7A 3EG2A 3QYGB 1QKWA 2CUDA 3MEWA 3P8DA 3I5SA 3ZL7C 4JRQA 4C8QA 4KGVB 1WXTA 4E2FB 3MP1A 1SEMA 1JEGA 3REAB 4L6V5 4DBHA 2EJGA 3CD6T 1X2KA 3L2WA 4J9IA 3BE3A 4KH0B 1RAIB 4B9XA 1NYFA 4DOWA 2EJFA 2X51A 4ELYC 1UUEA 2RO0A 3L2RA 4MZMA 4M7DF 3OSSC 1ZUKA 5I2SA 4B6MA 4A4FA 2DK3A 1TXQA 3JB9G 2XU8A 2KVQG 1YWOA 1UB4A 1MMAA 4F7UA 1ZX6A 4M77E 2QXFA 3JCMQ 4C8QC 1D3BA 1VA7A 4R55A 2JN0A 5GAN5 3CCJA 4A63B 2DNUA 4O6JA 4RG8A 2A37A 3BDLA 4X34A 3I56Q 4C5HA 3MCAB 1Q7YC 3V8LA 5IXFA 3M4GA 3PGGA 5GANf 2MI6A 2VB6A 3RKWA 3VYGA 2QDLA 1PC0A 2VASA 3ULRB 3VS7A 2CREA 1FXXA 3QXEB 4LDUA 5HK0A 4D8DA 2IG0A 1LVKA 3DLLA 3TREA 2JNGA 5LJ3j 3QPHA 1TUGB 3G71Q 1RAFB 3RESA 4PJOF 5A0LA 1KQ1A 2QEXA 4ZN1A 1KSWA 3OYEA 3FLGA 1YP5A 4FT4A 1IHVA 2HSEB 1MMDA 4DOVA 2AKKA 1RAAB 1O75A 1P92A 3JCMc 1NYGA 1K73U 1UJ0A 2YLCA 1K8AU 1BCMA 1UGSB 1M9SA 4M7DG 3PIPA 3CXCP 3J81E 4M75B 2KBTA 1KC8C 5J39A 3J7AF 1RUWA 3CCUA 1PWTA 2LQWA 2L5QA 2CZ0B 5IXBA 3M57A 2RJFA 5D6WA 3RIRA 3LH0A 3TU4K 1QWEA 2V1RA 1RAEB 5KYUB 4C92A 4J9GA 2HKQB 3RNJA 1OU9A 1Y57A 2EQUA 1WNLA 3GLXA 1H3ZA 2OI3A 2JMAA 2RJDA 5CCAA 4C8QD 4M7AF 4KULA 1BI3A 2D8HA 2BZYA 3ZEHA 3O8VA 2ROLA 4RTVA 4KBMB 1ZQ1A 3M5AA 4JZ4A 5AT1B 2DLPA 3CXCA 1CKAA 1Y7XA 5FWBA 1I5OB 2QEXT 3MHXA 2XIDA 2W0ZA 2VGMA 2VGNA 1JO8A 1RAHB 2YWWA 1YJNA 5FU6B 2QAZA 3GBQA 3OYJA 4C0FA 2FG0A 1VQKA 2W10A 4YTLA 2XMFA 4C92C 4OMLA 4PJOG 4QQGA 2O88A 3CC4A 2E3HA 3KUFA 1T0JA 3EG0A 1D09B 3OYDA 4PJLA 3VS2A 1M1KR 1MHNA 3VS4A 1MNEA 1Z9QA 5KH6A 2F1LA 1X6GA 4IUQA 1VQ5Q 3OS2A 2KK4A 2DL5A 2CP7A 1K9AA 2R5MA 4PKCC 4FIBA 2RB6A 3NPFA 2ECZA 2CZ6B 2M1HA 3GOXA 3VS6A 1RLPC 4AFSC 4Y28E 2YXYA 3I55T 1UHCA 1X69A 1VQ7A 2FYKA 3EH2A 3OYFA 1KD1R 4ZTFA 1PD0A 2EBPA 2EYXA 1OPKA 2KT8A 2ZPBB 1X43A 4J5YA 3ZFJA 2WSEE 2M02A 4BE1A 3OYAA 1ZBXA 3CCRQ 3UA7A 4ZNXA 1SG5A 1ABQA 3V7RA 4M7AG 3CCLA 3M56A 1TUCA 2ABLA 2BUDA 1YJNT 3JB9H 1KQ2A 2QQSA 2YUOA 3MEVA 3S3MA 3JCMV 1VQOQ 1KQSS 3HHTB 1YHQT 2A7YA 4F7UB 4PK4A 4XU1A 1KG1A 1K9MR 2L89A 5IHKA 2C0IA 3VU3C 2DX1A 4HA8A 4JRIA 3AT1B 3EFOB 1KK7A 4M7DB 3I55Q 2EKHA 1ACMB 2R58A 4C8QE 2QGGA 3OYHA 2K57A 1NG2A 2L8DA 1IRXA 2O2OA 2GCXA 2YUQA 3FB9A 1WQWA 5GAMg 1K76A 2BTTA 4RTWA 2HL5C 3OMGA 2DVEA 5GANe 5HK3A 3C94A 1T3LA 5FROA 4M77F 3CC7A 1A0NB 3BDUA 4KUIA 2EPDA 1IO6A 4RCBA 2AT1B 3X20B 4C92D 3VS1A 2EGAA 4HCCA 1YHQQ 4OGEA 4DA4A 2ESWA 2K5FA 1VQ4Q 3RR6A 3VRYA 4Z88A 2DBKA 1VUBA 1M27C 1VQ9A 3OYKA 3CCVA 2BE9B 4F7UE 1IZ6A 2KRSA 3X25B 3V7SA 4J83A 2DRMA 3HPWA 5DM7R 4LD9K 4BY6B 1ZSZA 2EVRA 1QVFS 2LNVA 2AHJB 3VRZA 5DLOA 4C0DC 3CEYA 4ZGDB 1E6GA 4M78C 4RKUE 2E6NA 5GAN4 4C0ZA 3CPWP 1Y96A 4IKFA 3OYCA 4FCYA 2ZPIB 1JJ2S 5LJ5g 2CYZB 4PJOB 1RL2A 2KSSA 1AT1B 5IN1A 2MCNA 4J7FA 1XTDA 3H6ZA 4F16A 4M78G 4J9BA 4ELZC 2O9SA 3NFCA 3LWHA 1D1BA 4E7ZA 1QMCA 1WHLA 3A8HB 3PNWC 3CCEQ 4AFZC 1Q7YU 2EKOA 3HFOA 3CC7T 2FO0A 1YBYA 1K73C 1ZSZC 2KAFA 2M9UA 1ZSGA 1YJWQ 3GP8A 2RHUA 2RD1A 4ATOA 4CRIA 2BE7D 4RTXA 5IH2A 1NEBA 1QCNA 1WJRA 1YJ9Q 2LX7A 4GBQA 2HQXA 1EFNA 4LE9A 5FRNA 4FYYB 4KT0E 4M77G 3M9QA 4GLKA 4A4EA 5A0GA 2O4XB 2VXFA 1YITT 2X4XA 2EYZA 2YHTA 4OVAA 3QUIA 2EIFA 1U3OA 5KYXB 1D0ZA 4EPCA 2CSQA 1MV0B 1I0CA 2CZ1B 2DL7A 2FRYA 3OS0A 2F2XA 4M7AB 2CP0A 5FWCA 4IIMA 3CMEA 3H0IA 5GANj 3CCQQ 4PFPA 2KR3A 1GL5A 3N5BB 4E7SA 1PKTA 2EGEA 1M1FA 2PUOB 1I07A 1M2VA 4VUBA 2RI2A 2FPEA 3OW2S 5CVIA 1KC8U 4C92E 3IQLA 1YCSB 4J6YA 4AFUC 2MK5A 2OAWA 4JJBA 4D6WA 2HCKA 2LQKA 2DIQA 4FYWB 1NPRA 2P0KA 1WPYA 2QTXA 2X35A 3T9NA 1QWFA 4GY5A 4EIKA 1SRLA 3BY7A 2F2VA 2K3XA 2R5AA 2LTOA 4NS5A 1MMGA 2I0NA 3ER0A 3CCMA 1G83A 4BACA 5GAMf 3LYIA 1WHJA 2RNAA 3JCMg 1K9MU 2VXEA 3FC3A 2KRNA 2E4HA 1G3TA 1XQHA 2LT1A 3QWYA 5GMKl 2I2LA 2EYQA 2EQJA 3MJXA 4IUPA 2RK2A 1VQNA 2RMOA 1OZ2A 1EIFA 1YFNA 1AZEA 2L3SA 1WHMA 2QK0A 2YRVA 3SFMA 3M58A 3H41A 2QI2A 4HXJA 2XDDA 2F69A 3HL8A 4QW2A 3G4SA 2GFUA 2B86A 3FEOA 4OMQA 3CMET 2CZ7B 3GNFB 1M2OA 2V1QA 1NPPA 1I8FA 5CKFA 1T0HA 1BBZA 1VQPT 5I21A 2YUNA 3E9FA 1KFZA 4V2SA 1WI7A 1HJDA 1FX7A 4KGZB 2JM9A 2QQRA 2ENMA 1IHWA 1HK9A 4IUVA 3PTAA 3HTRA 5GJVB 1K4US 1QVGP 1FMVA 1VIFA 5LJ5f 4HCBA 1NBEB 3WVEB 4M78B 2XI9A 3UA6A 1HXDA 5DY9A 1MUZA 1OX8A 4RMOA 2E12A 2F5TX 4CI0C 4IUUA 2KYMA 2CH4A 4CC3A 2DTOA 1ABOA 4JUVA 3CC2A 3LGFA 2LMJA 4MDXA 3C95A 2XD0A 2L3QA 4RTTA 2C0OA 1E7OA 2G3RA 3QKJA 4E7HA 1IGUA 1Z9ZA 2J6OA 2RI3A 1SHFA 3CMAQ 1VQLQ 1GBRA 1RAGB 2L3RA 3UDCA 1G8XA 4C8QF 3VS0A 1EX4A 5KCHA 1X01A 3OY9A 1B34B 4XTVA 3M0UA 2ZAEA 2J6FA 4M77B 2DXCA 1VQNT 2MMPA 2XG8D 3AHUA 2COYA 3LH5A 2NUPB 1FWZA 5D7UA 4R0KA 3EGDA 3JRZA 3A98A 4HT9A 1FMKA 5ECAA 1QVGA 2P84A 3M55A 3G4ST 3WVDB 2DXTA 1BIBA 1PRLC 1PHTA 1VQ6Q 4M78E 4X9DA 1NZ9A 3E1SA 3L2VA 3P8HA 2OTJA 1D1CA 2H3EB 5GAOn 2K9GA 4A4KA 3KFVA 2YRDA 5CKBA 4F7UF 4LUDA 2KE9A 4KUDK 2KMTA 2QDYB 1Y07A 2DA9A 3E2UA 3JAME 3M0TA 3OYLA 2OTLT 5M9OA 2PUKB 4BD3A 2E64A 2OAUA 5GJWB 3CBPA 1M3AA 3CQTA 3M0QA 2KXCA 1QCOA 3SDZA 5CAIA 2YT6A 3SWNB 2HSPA 1H8KA 3QDRB 4FT2A 1WFWA 3S3OA 1UGQB 3MEAA 3HRUA 2K2MA 3JCMf 5GAN2 3CD6Q 3S6WA 3OYIA 3EG1A 1BKBA 2DXUA 1SHGA 4J9CA 1G3YA 4XU2A 1ARKA 4ORZA 4C8QG 3I9QA 3HFNA 1ZBJA 1RI9A 2DEUA 4OB3B 1I81A 2M16A 2EWNA 4LD6A 4AG2C 3PIOA 1VOMA 2COZA 4CC4B 1BI0A 8ATCB 3RUXA 3S3NA 2XDPA 4A4HA 2OTJT 5IAYA 3EFSA 1B7TA 3BW1A 4DQ2A 4XU0A 2AIRB 1M1KC 4LXCA 5LJ3d 4QQDA 4PFOA 4QVZA 2QYZA 4JS5A 1M30A 2WACA 2JJ9A 2JT4A 3CCSA 4Y92A 2KXDA 3SEMA 1PKSA 4R56A 4F7UG 3EHRA 1GCQA 5GAMe 2RJCA 2BKDN 1BB9A 2DETA 1WXUA 2YRCA 3QDFA 4C92F 1KD1C 2GTJA 5GMKh 5KCOA 1W6XA 4FYXB 4ESRA 4J6XA 1B07A 3M59A 3CCJT 3RMSA 3FDRA 5D6YA 2X3XD 2ZPGB 4BUGA 2SEMA 4LDVA 4Z02A 3M4YA 2ZCFB 1H641 3CCRA 4EMGA 2QG9B 3M54A 1G5VA 4DBQA 1GRIA 2LC4A 3A5ZB 4AG1C 4F17A 2Z0WA 1K9MC 4JLGA 2NUTB 2DZ9A 1GCQC 1VQOA 3QZ5B 5FU7C 2L2PA 1G3SA 2J06A 4XTZA 1WA7A 2AZVA 5LJ5e 4FYVB 2DE0X 3MP8A 3M0RA 2RPNA 1DJ7B 2LCCA 4LDXA 2CT4A 4OMNA 1JB0E 3CCST 4MZTA 4PJMA 2JW4A 1GXIE 2JTEA 2NUZA 1PCXA 4LNPA 1KQSP 2CGHA 2NLUA 2DERA 1MNDA 4EMKA 2D0QB 1UHFA 1VYTA 1WHGA 4Q5WA 4M4ZA 4QT7A 2C06A 2Y4XA 4KH1B 3J80E 1RACB 3SHWA 3CCUT 1S1NA 3Q1JA 1VQ8A 3DB4A 2XK0A 1WIEA 1ZUYA 1VQ4A 1AOJA 4C92G 5GAN8 2E6ZA 1JXOA 2FZCB 4N4GA 2VV5A 1CSKA 3MKDA 4C8QB 1D0YA 4OMMA 3UATA 2QEXQ 2O01E 5GAMj 3EG9A 2X4WA 2HAXA 5GAN6 2YLBA 2RJEA 2XKOC 2DBMA 1WYXA 2V26A 1UE9A 4PL6A 1KQSA 3LLRA 2BIVA 4EMKC 2LJ0A 2HEQA
chains in the Genus database with same CATH topology
2GQIA 4LN2A 4IIOA 4D8KA 4RTXA 5IH2A 1NEBA 1NLOC 1YWPA 4KRTA 3JV3A 1WLPB 1OOTA 2LX7A 4GBQA 4LE9A 1EFNA 2C0TA 2EYZA 4HCKA 4E6RA 2DVJA 1WDXA 2L3PA 2VWFA 1U3OA 2DRKA 3FJ5A 2K79A 2CSQA 1MV0B 1I0CA 2DL7A 2FRYA 1JQQA 2YUPA 2F2XA 4DEYA 2RQVA 5FWCA 2KT1A 4IIMA 3H0IA 2LQNA 2RQWA 2KR3A 1GL5A 5EC7A 3EG2A 1PKTA 2EYYA 2EGEA 1QKWA 1I07A 2CSIA 2CUDA 2FPEA 4J9HA 3ZL7C 3I5SA 1AWWA 2DL4A 2IIMA 2X3WD 3IQLA 1WXTA 1YCSB 4AFUC 2OAWA 4JJBA 2HCKA 1SEMA 1K0XA 1JEGA 3REAB 2DILA 1QWFA 1VYUA 1X2KA 3M0PA 4EIKA 1SRLA 1PRMC 2AKLA 2F2VA 4J9IA 1E6HA 1WXBA 1NYFA 2JS2A 2KNBB 2DYBA 2I0NA 1G83A 1UUEA 4CC7A 1UJYA 1TUDA 3M0SA 2G6FX 1SRMA 3C0CA 2RNAA 1ZUKA 2MIOA 2A28A 2AZSA 2KRNA 3VS5A 1KIKA 1OV3A 3QWYA 1YWOA 3VS3A 3THKA 2JS0A 1ZX6A 2KEAA 2HDAA 2RMOA 1UDLA 1VA7A 2M51A 1AZEA 2L3SA 1JXMA 1ZLMA 4A63B 2DNUA 3H41A 4OMPA 4HXJA 1UECA 1CKBA 4J9FA 1UGVA 2B86A 4OMQA 2A37A 2GNCA 2V1QA 1T0HA 4LUEA 1BBZA 5IHIA 1U5SA 2YUNA 5HCKA 1KFZA 1WI7A 5IXFA 1HJDA 2DMOA 2JM9A 4X1VA 2ENMA 2JMCA 5GJVB 1K4US 4HVUA 2QDLA 3ULRB 3VS7A 2FEIA 1NLPC 2CREA 2HBWA 3UA6A 1W1FA 1MUZA 1UTIA 4D8DA 1AWOA 2K3BA 1PNJA 2FRWA 5I22A 2KYMA 2CH4A 4CC3A 2M0YA 2EQIA 1ABOA 3PVLA 4CC2A 2LMJA 2L3QA 2RN8A 4RTTA 2C0OA 1AZGB 1E7OA 2EW3A 1Z9ZA 4JJCA 2F2WA 2J6OA 1QCFA 1SHFA 4HVWA 1KSWA 1J3TA 1GBRA 2KGTA 1YP5A 1B3QA 2AKKA 3VS0A 2KYBA 1NYGA 3M0UA 2J6FA 1UJ0A 1M3CA 2LNHB 3LH5A 2KBTA 2J6KA 2K6DA 1XOVA 1Y0MA 4R0KA 1OPLA 1GBQA 1RUWA 3A98A 1FMKA 1PWTA 2LQWA 2ROTA 4J9DA 5ECAA 5IXBA 2VVKA 2DM1A 4RTYA 1PRLC 1PHTA 2RQRA 1QWEA 3EHQA 2D8JA 1BU1A 2D0NA 2V1RA 1X27A 2K7AA 4J9EA 2CT3A 2LP5A 1ZUUA 4J9GA 1UFFA 3RNJA 2K9GA 3KFVA 1Y57A 2GBQA 2YSQA 2CUBA 4DEXA 1T3SA 4LUDA 3REBB 2KE9A 2OI3A 2JMAA 1AWXA 2BZXA 2J05A 2DA9A 2D8HA 2BZYA 2ROLA 2P4RA 1M8MA 1X6BA 3M0TA 4RTVA 4K11A 1OEBA 4JZ4A 5GJWB 2DLPA 1M3AA 1CKAA 3CQTA 1U06A 5FWBA 3M0QA 2KXCA 1G2BA 3NHNA 2YT6A 2HSPA 1H8KA 2W0ZA 3O5ZA 1JO8A 4F14A 1JU5C 3TSZA 2D1XA 3GBQA 1WFWA 2DF6A 2FG0A 2K2MA 2W10A 1KJWA 2SRCA 2XMFA 4OMLA 3EG1A 2O88A 1WX6A 2RF0A 1SHGA 4J9CA 1K0SA 4JJDA 1T0JA 3EG0A 1ARKA 2ED0A 3H0HA 3VS2A 4ORZA 3I9QA 1GCPA 3VS4A 1Z9QA 1ZBJA 1V1CA 1X6GA 1YN8A 1QKXA 1RI9A 1K1ZA 3TSWA 4AG2C 2DL5A 1X2QA 1K9AA 4CC4B 2DJQA 3I35A 1NEGA 1NM7A 2BZ8A 2ECZA 3NPFA 4WCIA 1H92A 4Z89A 1AWJA 2CH4W 3VS6A 1RLPC 2PZ1A 1AEYA 1SPKA 4AFSC 1UHCA 1X69A 2PTKA 1HD3A 2EBPA 2EYXA 1OPKA 2KT8A 1FYNA 1M30A 1X43A 2RQUA 2JT4A 4RUGA 2ED1A 4Y92A 2KXDA 3SEMA 1PKSA 2J7IA 1YNZA 3EHRA 1GCQA 3TVTA 3UA7A 1W70A 4ZNXA 1BB9A 1ABQA 2GGRA 1WXUA 3QWXX 1TUCA 2ABLA 2GTJA 1W6XA 4ESRA 2YUOA 1B07A 3UF4A 2LZ6B 5IHKA 2C0IA 2X3XD 2DX1A 2SEMA 2GTOA 2JXBA 4JPBW 1H3HA 2DL8A 2EKHA 1HSQA 2KROA 1UG1A 3R6NA 1NG2A 2O2OA 1GRIA 5L23A 2YUQA 1QLYA 3NGPA 2AK5A 2YDLA 4AG1C 4F17A 2RQTA 1MV3A 1K76A 2BTTA 1AD5A 4RTWA 1GCQC 2EYWA 2O31A 2L2PA 2A36A 1T3LA 2CDTA 2J06A 2O9VA 3NMZC 1RLQC 3RBBB 1A0NB 1WA7A 2AZVA 4RTUA 2EPDA 2DE0X 1IO6A 3I5RA 2DL3A 1M3BA 3M0RA 2RPNA 3VS1A 2EGAA 2CT4A 4OMNA 4Z8AA 2ESWA 3U23A 3VRYA 4Z88A 2DBKA 2LJ1A 1M27C 2KRMA 2JW4A 2JTEA 4RTZA 2NUZA 2KRSA 4LNPA 3PE0A 3EG3A 2DRMA 5IHNA 1UHFA 2EVRA 1VYTA 3VRZA 2PNIA 1GFCA 4M4ZA 1E6GA 2MOXA 4QT7A 2FPFA 1GFDA 2A08A 3SHWA 1S1NA 1AVZC 4FSSA 1WIEA 1ZUYA 2NWMA 1N5ZA 1SSHA 2H8HA 2L0AA 1AOJA 1LCKA 4GLMA 4JZ3A 2MCNA 2OJ2A 1JXOA 4HVVA 1BK2A 2EGCA 5I11A 1CSKA 2E5KA 4F16A 1VYVA 4AFQC 2LCSA 4J9BA 4OMMA 2JM8A 1TG0A 2O9SA 4OMOA 3UATA 3H0FA 2LJ3A 5FW9A 2VKNA 1I1JA 2DBMA 1WYXA 4AFZC 1UE9A 3PVQA 2FPDA 2FO0A 2LJ0A 3EGUA 2HEQA 1ZSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQI A;  4LN2 A;  4IIO A;  4D8K A;  4RTX A;  5IH2 A;  1NEB A;  1NLO C;  1YWP A;  4KRT A;  3JV3 A;  1WLP B;  1OOT A;  2LX7 A;  4GBQ A;  4LE9 A;  1EFN A;  2C0T A;  2EYZ A;  4HCK A;  4E6R A;  2DVJ A;  1WDX A;  2L3P A;  2VWF A;  1U3O A;  2DRK A;  3FJ5 A;  2K79 A;  2CSQ A;  1MV0 B;  1I0C A;  2DL7 A;  2FRY A;  1JQQ A;  2YUP A;  2F2X A;  4DEY A;  2RQV A;  5FWC A;  2KT1 A;  4IIM A;  3H0I A;  2LQN A;  2RQW A;  2KR3 A;  1GL5 A;  5EC7 A;  3EG2 A;  1PKT A;  2EYY A;  2EGE A;  1QKW A;  1I07 A;  2CSI A;  2CUD A;  2FPE A;  4J9H A;  3ZL7 C;  3I5S A;  1AWW A;  2DL4 A;  2IIM A;  2X3W D;  3IQL A;  1WXT A;  1YCS B;  4AFU C;  2OAW A;  4JJB A;  2HCK A;  1SEM A;  1K0X A;  1JEG A;  3REA B;  2DIL A;  1QWF A;  1VYU A;  1X2K A;  3M0P A;  4EIK A;  1SRL A;  1PRM C;  2AKL A;  2F2V A;  4J9I A;  1E6H A;  1WXB A;  1NYF A;  2JS2 A;  2KNB B;  2DYB A;  2I0N A;  1G83 A;  1UUE A;  4CC7 A;  1UJY A;  1TUD A;  3M0S A;  2G6F X;  1SRM A;  3C0C A;  2RNA A;  1ZUK A;  2MIO A;  2A28 A;  2AZS A;  2KRN A;  3VS5 A;  1KIK A;  1OV3 A;  3QWY A;  1YWO A;  3VS3 A;  3THK A;  2JS0 A;  1ZX6 A;  2KEA A;  2HDA A;  2RMO A;  1UDL A;  1VA7 A;  2M51 A;  1AZE A;  2L3S A;  1JXM A;  1ZLM A;  4A63 B;  2DNU A;  3H41 A;  4OMP A;  4HXJ A;  1UEC A;  1CKB A;  4J9F A;  1UGV A;  2B86 A;  4OMQ A;  2A37 A;  2GNC A;  2V1Q A;  1T0H A;  4LUE A;  1BBZ A;  5IHI A;  1U5S A;  2YUN A;  5HCK A;  1KFZ A;  1WI7 A;  5IXF A;  1HJD A;  2DMO A;  2JM9 A;  4X1V A;  2ENM A;  2JMC A;  5GJV B;  1K4U S;  4HVU A;  2QDL A;  3ULR B;  3VS7 A;  2FEI A;  1NLP C;  2CRE A;  2HBW A;  3UA6 A;  1W1F A;  1MUZ A;  1UTI A;  4D8D A;  1AWO A;  2K3B A;  1PNJ A;  2FRW A;  5I22 A;  2KYM A;  2CH4 A;  4CC3 A;  2M0Y A;  2EQI A;  1ABO A;  3PVL A;  4CC2 A;  2LMJ A;  2L3Q A;  2RN8 A;  4RTT A;  2C0O A;  1AZG B;  1E7O A;  2EW3 A;  1Z9Z A;  4JJC A;  2F2W A;  2J6O A;  1QCF A;  1SHF A;  4HVW A;  1KSW A;  1J3T A;  1GBR A;  2KGT A;  1YP5 A;  1B3Q A;  2AKK A;  3VS0 A;  2KYB A;  1NYG A;  3M0U A;  2J6F A;  1UJ0 A;  1M3C A;  2LNH B;  3LH5 A;  2KBT A;  2J6K A;  2K6D A;  1XOV A;  1Y0M A;  4R0K A;  1OPL A;  1GBQ A;  1RUW A;  3A98 A;  1FMK A;  1PWT A;  2LQW A;  2ROT A;  4J9D A;  5ECA A;  5IXB A;  2VVK A;  2DM1 A;  4RTY A;  1PRL C;  1PHT A;  2RQR A;  1QWE A;  3EHQ A;  2D8J A;  1BU1 A;  2D0N A;  2V1R A;  1X27 A;  2K7A A;  4J9E A;  2CT3 A;  2LP5 A;  1ZUU A;  4J9G A;  1UFF A;  3RNJ A;  2K9G A;  3KFV A;  1Y57 A;  2GBQ A;  2YSQ A;  2CUB A;  4DEX A;  1T3S A;  4LUD A;  3REB B;  2KE9 A;  2OI3 A;  2JMA A;  1AWX A;  2BZX A;  2J05 A;  2DA9 A;  2D8H A;  2BZY A;  2ROL A;  2P4R A;  1M8M A;  1X6B A;  3M0T A;  4RTV A;  4K11 A;  1OEB A;  4JZ4 A;  5GJW B;  2DLP A;  1M3A A;  1CKA A;  3CQT A;  1U06 A;  5FWB A;  3M0Q A;  2KXC A;  1G2B A;  3NHN A;  2YT6 A;  2HSP A;  1H8K A;  2W0Z A;  3O5Z A;  1JO8 A;  4F14 A;  1JU5 C;  3TSZ A;  2D1X A;  3GBQ A;  1WFW A;  2DF6 A;  2FG0 A;  2K2M A;  2W10 A;  1KJW A;  2SRC A;  2XMF A;  4OML A;  3EG1 A;  2O88 A;  1WX6 A;  2RF0 A;  1SHG A;  4J9C A;  1K0S A;  4JJD A;  1T0J A;  3EG0 A;  1ARK A;  2ED0 A;  3H0H A;  3VS2 A;  4ORZ A;  3I9Q A;  1GCP A;  3VS4 A;  1Z9Q A;  1ZBJ A;  1V1C A;  1X6G A;  1YN8 A;  1QKX A;  1RI9 A;  1K1Z A;  3TSW A;  4AG2 C;  2DL5 A;  1X2Q A;  1K9A A;  4CC4 B;  2DJQ A;  3I35 A;  1NEG A;  1NM7 A;  2BZ8 A;  2ECZ A;  3NPF A;  4WCI A;  1H92 A;  4Z89 A;  1AWJ A;  2CH4 W;  3VS6 A;  1RLP C;  2PZ1 A;  1AEY A;  1SPK A;  4AFS C;  1UHC A;  1X69 A;  2PTK A;  1HD3 A;  2EBP A;  2EYX A;  1OPK A;  2KT8 A;  1FYN A;  1M30 A;  1X43 A;  2RQU A;  2JT4 A;  4RUG A;  2ED1 A;  4Y92 A;  2KXD A;  3SEM A;  1PKS A;  2J7I A;  1YNZ A;  3EHR A;  1GCQ A;  3TVT A;  3UA7 A;  1W70 A;  4ZNX A;  1BB9 A;  1ABQ A;  2GGR A;  1WXU A;  3QWX X;  1TUC A;  2ABL A;  2GTJ A;  1W6X A;  4ESR A;  2YUO A;  1B07 A;  3UF4 A;  2LZ6 B;  5IHK A;  2C0I A;  2X3X D;  2DX1 A;  2SEM A;  2GTO A;  2JXB A;  4JPB W;  1H3H A;  2DL8 A;  2EKH A;  1HSQ A;  2KRO A;  1UG1 A;  3R6N A;  1NG2 A;  2O2O A;  1GRI A;  5L23 A;  2YUQ A;  1QLY A;  3NGP A;  2AK5 A;  2YDL A;  4AG1 C;  4F17 A;  2RQT A;  1MV3 A;  1K76 A;  2BTT A;  1AD5 A;  4RTW A;  1GCQ C;  2EYW A;  2O31 A;  2L2P A;  2A36 A;  1T3L A;  2CDT A;  2J06 A;  2O9V A;  3NMZ C;  1RLQ C;  3RBB B;  1A0N B;  1WA7 A;  2AZV A;  4RTU A;  2EPD A;  2DE0 X;  1IO6 A;  3I5R A;  2DL3 A;  1M3B A;  3M0R A;  2RPN A;  3VS1 A;  2EGA A;  2CT4 A;  4OMN A;  4Z8A A;  2ESW A;  3U23 A;  3VRY A;  4Z88 A;  2DBK A;  2LJ1 A;  1M27 C;  2KRM A;  2JW4 A;  2JTE A;  4RTZ A;  2NUZ A;  2KRS A;  4LNP A;  3PE0 A;  3EG3 A;  2DRM A;  5IHN A;  1UHF A;  2EVR A;  1VYT A;  3VRZ A;  2PNI A;  1GFC A;  4M4Z A;  1E6G A;  2MOX A;  4QT7 A;  2FPF A;  1GFD A;  2A08 A;  3SHW A;  1S1N A;  1AVZ C;  4FSS A;  1WIE A;  1ZUY A;  2NWM A;  1N5Z A;  1SSH A;  2H8H A;  2L0A A;  1AOJ A;  1LCK A;  4GLM A;  4JZ3 A;  2MCN A;  2OJ2 A;  1JXO A;  4HVV A;  1BK2 A;  2EGC A;  5I11 A;  1CSK A;  2E5K A;  4F16 A;  1VYV A;  4AFQ C;  2LCS A;  4J9B A;  4OMM A;  2JM8 A;  1TG0 A;  2O9S A;  4OMO A;  3UAT A;  3H0F A;  2LJ3 A;  5FW9 A;  2VKN A;  1I1J A;  2DBM A;  1WYX A;  4AFZ C;  1UE9 A;  3PVQ A;  2FPD A;  2FO0 A;  2LJ0 A;  3EGU A;  2HEQ A;  1ZSG A; 
#chains in the Genus database with same CATH topology
 4E7J A;  3RKX A;  1W2B S;  3OA6 A;  5DLQ E;  2IPO B;  4MZP A;  1C6V X;  3CCU Q;  2MAM A;  4WTO B;  4NOY A;  4KRT A;  1WLP B;  5KYN A;  3A8G B;  4BI3 A;  1OOT A;  2CP6 A;  1QVF P;  1TTH B;  5GAO l;  2KDS A;  4OGC A;  1WHH A;  4HCK A;  2DVJ A;  4M78 F;  1WDX A;  1VQK T;  2DTI A;  5GAO p;  3QHS A;  1F1B B;  2KY9 A;  1D3B B;  1YIJ A;  3CC4 T;  2FZG B;  4DEY A;  5C0M A;  1JJ2 P;  3OBW A;  3JCM e;  4N4I A;  1ZA2 B;  1VQ8 T;  2K5I A;  1YI2 A;  4AT1 B;  2DO3 A;  3JB9 J;  2QGF B;  2QQ9 A;  1NJI R;  1YJ9 A;  4J9H A;  2X3W D;  1N8R C;  3M53 A;  2XDB A;  3UWN A;  2DEQ A;  3HRT A;  1K0X A;  3QII A;  2DIL A;  1VYU A;  2AKL A;  2E1H A;  1VQ7 T;  2EAY A;  1YJN Q;  5CQY A;  1WXB A;  1QVF A;  3MEU A;  2DYB A;  2RI5 A;  1QVP A;  4CC7 A;  1UJY A;  3M0S A;  1UGR B;  4XK8 E;  1IRE B;  5KYY A;  1SRM A;  3C0C A;  3G6E A;  2MIO A;  4A54 A;  2VUB A;  1JJ2 A;  2A28 A;  2DKG A;  3A8M B;  2V8I A;  2MF2 A;  3VS5 A;  1KIK A;  5GAM h;  3CCL T;  4ZTJ A;  3ME9 A;  3VS3 A;  1I5L A;  3THK A;  2KQW A;  2QA4 A;  4ME7 A;  2FL7 A;  2HDA A;  3CBM A;  1UDL A;  3X24 B;  3LWI A;  5KYW A;  1JXM A;  1V76 A;  1YIJ T;  4IUR A;  2VYT A;  1CKB A;  1UGV A;  3OW2 P;  3D7S B;  4E47 A;  1SF9 A;  1YI2 T;  3RMQ A;  2CKK A;  3RDV A;  5HCK A;  3FIF A;  3QZ9 B;  2HKN A;  3E9G A;  4X1V A;  4BB7 A;  4XTX A;  4C92 B;  2JMC A;  1S72 A;  2K2V A;  4HVU A;  3FJP A;  2FEI A;  2ZPE B;  1MGQ A;  5GMK i;  3G7Z A;  2CP5 A;  3BFM A;  1AWO A;  2FRW A;  2K3B A;  4II1 A;  5LJ5 h;  2M0Y A;  2EQI A;  2HNI A;  1Q86 C;  1G3W A;  5D6X A;  1VQ9 T;  1QW1 A;  1Y71 A;  3CPW A;  1AZG B;  3CCV T;  2EW3 A;  2F2W A;  1M1K U;  1QCF A;  2P0Q A;  4HVW A;  3G6E T;  3LX7 A;  5J26 A;  2KGT A;  1N8R R;  3OW2 A;  1B3Q A;  1RI0 A;  5AYF A;  1BCO A;  1X75 C;  2QA4 T;  1M3C A;  1R0C B;  1Q82 C;  9ATC B;  5GAN d;  4HT8 A;  1XOV A;  4QKU A;  3HP9 A;  1OPL A;  2RA2 A;  3CC7 Q;  1O9S A;  1KD1 U;  1QP2 A;  3RKY A;  4JRK A;  3L2Z A;  3LGL A;  4RTY A;  4E7L A;  4RCC A;  1UGP B;  3OYM A;  3CMA A;  1VQM A;  4N0A A;  2MPX C;  2WSF E;  3MP6 A;  1X27 A;  4JRP A;  2CT3 A;  2LP5 A;  1VQ9 Q;  2LRQ A;  5A0D A;  1UFF A;  4BI4 A;  1X6O A;  3OYB A;  1WZO A;  2RHY A;  3V8K A;  2GBQ A;  3JCM X;  2DD4 A;  2CUB A;  4DEX A;  1YIT Q;  1S72 T;  4E7K A;  3REB B;  1JRI A;  3JB9 I;  2LDM A;  5CQX A;  3LW5 E;  4PLL A;  2J05 A;  3A1P A;  1M8M A;  2FB7 A;  3A8L B;  3JCM P;  3UT1 A;  2Y4Y A;  3OB9 A;  4A53 A;  3VV0 A;  3L42 A;  1OEB A;  2MWP A;  1VQ6 A;  4PJN A;  5GMK e;  3OMC A;  4F04 B;  2DPP B;  4FM4 B;  2D1X A;  2MWO A;  2E5Q A;  2DF6 A;  4PJJ A;  1Q81 R;  2X4Y A;  4N0A C;  1NJI U;  4M75 A;  1KJW A;  3EGX A;  5A2Q E;  5KE2 A;  1WX6 A;  2HQH A;  2ED0 A;  1RAD B;  3JCM h;  1GCP A;  1PSE A;  4J8O A;  3OBY A;  1Q86 R;  1V1C A;  1QKX A;  2PVD B;  1K1Z A;  3DB3 A;  1X2Q A;  4XQ3 A;  5KYU A;  3JCM W;  4C0D B;  1VQM T;  2DJQ A;  2V8J A;  1PM3 A;  1K8A R;  2RK1 A;  2BZ8 A;  4WCI A;  1H92 A;  4Z89 A;  4PLI A;  5CIU A;  2CH4 W;  2PZ1 A;  1ZHI A;  1AEY A;  1SPK A;  3CD6 A;  3HRS A;  1C0M A;  4XTW A;  1Q82 R;  1AHJ B;  3CCM T;  1HD3 A;  3I56 A;  5FRM A;  3QO3 A;  1FYN A;  7AT1 B;  1UEB A;  4RUG A;  2ED1 A;  5GAO q;  4M75 C;  4O5V A;  3CME Q;  2J7I A;  1YNZ A;  2XIC A;  3RER A;  1W70 A;  2V8K A;  1M1G A;  5KYY B;  1VQP Q;  2HQE A;  4JJN K;  3ASK A;  2GGR A;  4C5E A;  4BE2 A;  3SB2 A;  1M4Z A;  3QWX X;  4B9W A;  1ZSZ B;  3UF4 A;  2EQK A;  2E10 A;  2LVM A;  4FU6 A;  3G71 A;  4XAX B;  3HKS A;  2JVV A;  4J7I A;  1Y96 B;  2GTO A;  2JXB A;  4JPB W;  3X26 B;  4A4G A;  4HCZ A;  1H3H A;  1IXD A;  3P8B B;  3CCM Q;  1HSQ A;  1V29 B;  3L1A A;  1UG1 A;  2CP2 A;  1Q95 G;  3R6N A;  3C12 A;  2AK5 A;  1TS9 A;  2IVW A;  2RQT A;  1LOJ A;  1MV3 A;  2HBP A;  4C0G A;  2CS7 A;  1AD5 A;  5GMK j;  2EYW A;  2O31 A;  2A36 A;  1OI1 A;  2O9V A;  3H9N A;  3A8O B;  5FU6 C;  2ZPF B;  1U1S A;  4RTU A;  1N8R U;  1VQN Q;  3I5R A;  3CC2 T;  5L8R E;  1QVG S;  3I56 T;  3PMT A;  4P5N A;  4IUT A;  2LJ1 A;  1M5Q 1;  3G4S Q;  2X4J A;  4RTZ A;  3PT9 A;  1OQK A;  1SSF A;  3HSB A;  4XTY A;  2LCL A;  3MPU B;  4ANJ A;  5FLX E;  2PNI A;  1QQJ A;  1GFC A;  2DXB A;  2MOX A;  2FPF A;  1OYX A;  5J3B A;  3VUB A;  4FSS A;  4UC4 A;  3G71 T;  3EFO A;  4M7D A;  4HKE A;  3TCJ A;  2NWM A;  2K3Y A;  3ZBD A;  2FHD A;  1N5Z A;  2H8H A;  3PMI A;  2A0F B;  4GLM A;  3QG1 A;  4JZ3 A;  2OTL Q;  2OJ2 A;  4M75 D;  3CC2 Q;  4HVV A;  5I11 A;  1M2V B;  2E5K A;  1TU0 B;  4OB1 B;  1WGS A;  4AFQ C;  2GFA A;  1TG0 A;  3QJ6 A;  2DAQ A;  2Y90 A;  3H0F A;  4JDS A;  2DD5 A;  4Y91 A;  2FPD A;  2GQI A;  1VQ5 A;  1Q81 U;  4OB2 B;  1BIA A;  4D8K A;  4L59 A;  1YWP A;  3JV3 A;  4ZN3 A;  4M7D C;  4OP0 A;  3VUZ A;  1Q86 U;  2D6F A;  2HZY A;  3L2U A;  2VWF A;  2RHZ A;  3FJ5 A;  2DIG A;  2OTJ Q;  2YUP A;  3NTI A;  3DKM A;  2RQV A;  2KT1 A;  4LDY A;  1ZA1 B;  3GPL A;  4WF2 A;  3EGX B;  3NTK A;  2RQW A;  4PJO A;  2QAS A;  3OYG A;  1TWB A;  3JB9 D;  2EYY A;  4BDZ A;  1Q82 U;  2CSI A;  1AWW A;  1M90 C;  2DL4 A;  2IIM A;  4BE0 A;  4FSX A;  2DFU A;  5KE3 A;  2XHC A;  1BYM A;  8AT1 B;  5GAO r;  3M0P A;  1PRM C;  1E6H A;  4JLI A;  1BI1 A;  1W2B P;  2KI7 A;  3I55 A;  2JS2 A;  2KNB B;  3CCJ Q;  4BY6 C;  1WQ7 A;  2E65 A;  2ZPH B;  1FMW A;  5CKD A;  1NJI C;  5LJ3 g;  1TUD A;  5GAN 3;  2G6F X;  1VQ5 T;  3EAE A;  2AZS A;  3GNG A;  2O4X A;  1OV3 A;  4PJO C;  5GAO m;  2JS0 A;  3TEE A;  1U1T A;  1Q7Y R;  5KYX A;  4M75 E;  2KEA A;  4DBR A;  2OX7 A;  4M7A A;  2M51 A;  1ZLM A;  1YHQ A;  2MYS A;  2WSC E;  4OMP A;  1UEC A;  3EGD B;  4J9F A;  3CXC S;  2CP3 A;  5LJ3 h;  2GNC A;  1U8R A;  3CCR T;  2A3L A;  4LUE A;  5IHI A;  1W2B A;  1U5S A;  3CCS Q;  2LQ8 A;  5GAM d;  2DMO A;  4TVR A;  4NL2 A;  4OB0 B;  1VQO T;  4M7D D;  4L5G A;  4OMF B;  4XTU A;  1NLP C;  2HBW A;  3JCM J;  1W1F A;  2EQM A;  2PQW A;  3EH1 A;  1UTI A;  1RAB B;  2X9H A;  1PNJ A;  5I22 A;  4MDW A;  3GF5 A;  3PVL A;  4CC2 A;  4E7I A;  5IT9 E;  1KC8 R;  2RN8 A;  4M7A C;  1OU8 A;  2JOY A;  4MML A;  5I2M A;  4JJC A;  2H3J A;  2ZGW A;  1J3T A;  1M90 R;  1N6A A;  3CCE A;  1LJO A;  2FVU A;  2KYB A;  1N27 A;  2LNH B;  2COW A;  1YJW A;  2PU9 B;  1XJW B;  2DYI A;  2J6K A;  2K6D A;  4N4H A;  1EZZ B;  1Y0M A;  5LJ5 j;  5LJ5 d;  1GBQ A;  2ROT A;  1VQ4 T;  4J9D A;  2PVG B;  1BI2 A;  5CO7 A;  2VVK A;  2DM1 A;  1R77 A;  1M8V A;  3H8Z A;  1IGQ A;  3PFS A;  3L2Q A;  2E3I A;  2RQR A;  3EHQ A;  2D8J A;  1BU1 A;  2D0N A;  2K7A A;  4J9E A;  2JUF A;  1ZUU A;  5CR2 A;  4PJO D;  2YSQ A;  2P0P A;  4M78 A;  1HYO A;  1T3S A;  2RH2 A;  3FRN A;  3VKI A;  1VQK Q;  3CCQ A;  1AWX A;  2BZX A;  3CC4 Q;  2P4R A;  1X6B A;  4K11 A;  4PFZ A;  1VQ8 Q;  3KBG A;  2HL3 A;  4X9C A;  3MET A;  1U06 A;  1OUL A;  4NL3 A;  1G2B A;  3NHN A;  4J6W A;  3QJY A;  2QQB A;  5FU7 B;  3O5Z A;  2E41 A;  4PNO A;  5LJ3 f;  4F14 A;  1JU5 C;  1B34 A;  3OSV A;  3TSZ A;  3CCE T;  2R57 A;  3G1J A;  2FZK B;  1LNX A;  5CKE A;  1YIT A;  4M77 A;  5GAN 7;  1N9R A;  2NUP A;  2VC8 A;  2SRC A;  1VQ7 Q;  2JZ2 A;  1YJW T;  2RF0 A;  4M7D E;  3QYH B;  1KHC A;  4MMK A;  1KHI A;  1K0S A;  4JJD A;  1VIE A;  1TSF A;  1W4S A;  3H0H A;  3OS5 A;  2DZC A;  1YJ9 T;  6AT1 B;  1YN8 A;  4M7A D;  3TSW A;  1IB8 A;  1Q81 C;  3I35 A;  1NEG A;  1NM7 A;  3CCL Q;  1XNI A;  1AWJ A;  1PG5 B;  2JTM A;  5HY6 A;  2PVO B;  2M0O A;  2PTK A;  2DJZ A;  3OYY A;  3EFR A;  3CCQ T;  3QSU A;  2RQU A;  4M77 C;  1YIJ Q;  3MO8 A;  5CK9 A;  3JCM d;  1I4K 1;  2RHI A;  3R6O A;  1K8A C;  3TVT A;  2D9T A;  4AMC A;  5GMK m;  1NE8 A;  1YI2 Q;  4DBF A;  3TQ7 P;  3SWN A;  1N9S A;  4C5I A;  2B8A A;  1YCY A;  4RG2 A;  4EMK B;  1R8O B;  2LZ6 B;  1PD1 A;  1QP3 A;  3C4S A;  3DLM A;  4QVD A;  5LL6 S;  3INZ A;  4PJO E;  3V8J A;  2F5K A;  1VQL A;  2DL8 A;  3CPW S;  2KRO A;  1PSF A;  5CKH A;  4KGX B;  1VQP A;  2QTV A;  3CCV Q;  3QBY A;  5L23 A;  2P4T A;  1QLY A;  3NGP A;  2YDL A;  3G6E Q;  3CBO A;  4FW1 A;  3OYN A;  3EG9 B;  3URG A;  3F70 A;  3SWN C;  2CDT A;  3NMZ C;  1RLQ C;  3RBB B;  2QA4 Q;  1M90 U;  1C1A A;  4M75 F;  2DL3 A;  3E19 A;  1M3B A;  4OF1 A;  1MMN A;  3OS1 A;  4ZGE B;  4EDU A;  4Z8A A;  2EFI A;  4QQ6 A;  4M78 D;  3U23 A;  3KXT A;  2KRM A;  1LPL A;  3SD4 A;  2ZZD A;  1OZ3 A;  3PE0 A;  2E70 A;  3EG3 A;  2DTH A;  4ZGJ B;  4XU3 A;  2GF7 A;  5IHN A;  4M7A E;  4JS4 A;  2QQA A;  1S72 Q;  1SKU B;  1GFD A;  1D1A A;  2A08 A;  2ATC B;  1TOV A;  4C5G A;  1AVZ C;  2LT4 A;  5GAN g;  3X28 B;  2RHX A;  1WJS A;  1SSH A;  3V7C A;  2L0A A;  1LCK A;  4M77 D;  3CMA T;  1VQL T;  1K73 R;  3OQ5 A;  3VYH B;  1BK2 A;  2EGC A;  1VYV A;  2LX9 A;  2LCS A;  2JM8 A;  4OMO A;  2NUT A;  3CPF A;  2LJ3 A;  2HD0 A;  3JCM b;  5FW9 A;  1OX9 A;  2VKN A;  1I1J A;  5C6S A;  3JB9 F;  4BDY A;  4EMH A;  3PVQ A;  1WJQ A;  4QVC A;  5HKC A;  3WXM B;  3EGU A;  2EJ9 A;  5GAN h;  4LN2 A;  4IIO A;  1TH7 A;  1VQ6 T;  4FW2 A;  2JTF A;  2OTL A;  2K4Y A;  1WHK A;  1NLO C;  5EG2 A;  2C0T A;  3GIB A;  2NYS A;  4LDW A;  2HMA A;  1D0X A;  4M75 G;  3JSC A;  1VQM Q;  2GQV A;  4E6R A;  2L3P A;  4FL6 A;  2DRK A;  2K5L A;  2K79 A;  1R0B G;  5LJ3 e;  1JQQ A;  3NTH A;  5KYW B;  2RM4 A;  1JBM A;  3UPU A;  4BI8 B;  2LQN A;  3VJP A;  5EC7 A;  3EG2 A;  3QYG B;  1QKW A;  2CUD A;  3MEW A;  3P8D A;  3I5S A;  3ZL7 C;  4JRQ A;  4C8Q A;  4KGV B;  1WXT A;  4E2F B;  3MP1 A;  1SEM A;  1JEG A;  3REA B;  4L6V 5;  4DBH A;  2EJG A;  3CD6 T;  1X2K A;  3L2W A;  4J9I A;  3BE3 A;  4KH0 B;  1RAI B;  4B9X A;  1NYF A;  4DOW A;  2EJF A;  2X51 A;  4ELY C;  1UUE A;  2RO0 A;  3L2R A;  4MZM A;  4M7D F;  3OSS C;  1ZUK A;  5I2S A;  4B6M A;  4A4F A;  2DK3 A;  1TXQ A;  3JB9 G;  2XU8 A;  2KVQ G;  1YWO A;  1UB4 A;  1MMA A;  4F7U A;  1ZX6 A;  4M77 E;  2QXF A;  3JCM Q;  4C8Q C;  1D3B A;  1VA7 A;  4R55 A;  2JN0 A;  5GAN 5;  3CCJ A;  4A63 B;  2DNU A;  4O6J A;  4RG8 A;  2A37 A;  3BDL A;  4X34 A;  3I56 Q;  4C5H A;  3MCA B;  1Q7Y C;  3V8L A;  5IXF A;  3M4G A;  3PGG A;  5GAN f;  2MI6 A;  2VB6 A;  3RKW A;  3VYG A;  2QDL A;  1PC0 A;  2VAS A;  3ULR B;  3VS7 A;  2CRE A;  1FXX A;  3QXE B;  4LDU A;  5HK0 A;  4D8D A;  2IG0 A;  1LVK A;  3DLL A;  3TRE A;  2JNG A;  5LJ3 j;  3QPH A;  1TUG B;  3G71 Q;  1RAF B;  3RES A;  4PJO F;  5A0L A;  1KQ1 A;  2QEX A;  4ZN1 A;  1KSW A;  3OYE A;  3FLG A;  1YP5 A;  4FT4 A;  1IHV A;  2HSE B;  1MMD A;  4DOV A;  2AKK A;  1RAA B;  1O75 A;  1P92 A;  3JCM c;  1NYG A;  1K73 U;  1UJ0 A;  2YLC A;  1K8A U;  1BCM A;  1UGS B;  1M9S A;  4M7D G;  3PIP A;  3CXC P;  3J81 E;  4M75 B;  2KBT A;  1KC8 C;  5J39 A;  3J7A F;  1RUW A;  3CCU A;  1PWT A;  2LQW A;  2L5Q A;  2CZ0 B;  5IXB A;  3M57 A;  2RJF A;  5D6W A;  3RIR A;  3LH0 A;  3TU4 K;  1QWE A;  2V1R A;  1RAE B;  5KYU B;  4C92 A;  4J9G A;  2HKQ B;  3RNJ A;  1OU9 A;  1Y57 A;  2EQU A;  1WNL A;  3GLX A;  1H3Z A;  2OI3 A;  2JMA A;  2RJD A;  5CCA A;  4C8Q D;  4M7A F;  4KUL A;  1BI3 A;  2D8H A;  2BZY A;  3ZEH A;  3O8V A;  2ROL A;  4RTV A;  4KBM B;  1ZQ1 A;  3M5A A;  4JZ4 A;  5AT1 B;  2DLP A;  3CXC A;  1CKA A;  1Y7X A;  5FWB A;  1I5O B;  2QEX T;  3MHX A;  2XID A;  2W0Z A;  2VGM A;  2VGN A;  1JO8 A;  1RAH B;  2YWW A;  1YJN A;  5FU6 B;  2QAZ A;  3GBQ A;  3OYJ A;  4C0F A;  2FG0 A;  1VQK A;  2W10 A;  4YTL A;  2XMF A;  4C92 C;  4OML A;  4PJO G;  4QQG A;  2O88 A;  3CC4 A;  2E3H A;  3KUF A;  1T0J A;  3EG0 A;  1D09 B;  3OYD A;  4PJL A;  3VS2 A;  1M1K R;  1MHN A;  3VS4 A;  1MNE A;  1Z9Q A;  5KH6 A;  2F1L A;  1X6G A;  4IUQ A;  1VQ5 Q;  3OS2 A;  2KK4 A;  2DL5 A;  2CP7 A;  1K9A A;  2R5M A;  4PKC C;  4FIB A;  2RB6 A;  3NPF A;  2ECZ A;  2CZ6 B;  2M1H A;  3GOX A;  3VS6 A;  1RLP C;  4AFS C;  4Y28 E;  2YXY A;  3I55 T;  1UHC A;  1X69 A;  1VQ7 A;  2FYK A;  3EH2 A;  3OYF A;  1KD1 R;  4ZTF A;  1PD0 A;  2EBP A;  2EYX A;  1OPK A;  2KT8 A;  2ZPB B;  1X43 A;  4J5Y A;  3ZFJ A;  2WSE E;  2M02 A;  4BE1 A;  3OYA A;  1ZBX A;  3CCR Q;  3UA7 A;  4ZNX A;  1SG5 A;  1ABQ A;  3V7R A;  4M7A G;  3CCL A;  3M56 A;  1TUC A;  2ABL A;  2BUD A;  1YJN T;  3JB9 H;  1KQ2 A;  2QQS A;  2YUO A;  3MEV A;  3S3M A;  3JCM V;  1VQO Q;  1KQS S;  3HHT B;  1YHQ T;  2A7Y A;  4F7U B;  4PK4 A;  4XU1 A;  1KG1 A;  1K9M R;  2L89 A;  5IHK A;  2C0I A;  3VU3 C;  2DX1 A;  4HA8 A;  4JRI A;  3AT1 B;  3EFO B;  1KK7 A;  4M7D B;  3I55 Q;  2EKH A;  1ACM B;  2R58 A;  4C8Q E;  2QGG A;  3OYH A;  2K57 A;  1NG2 A;  2L8D A;  1IRX A;  2O2O A;  2GCX A;  2YUQ A;  3FB9 A;  1WQW A;  5GAM g;  1K76 A;  2BTT A;  4RTW A;  2HL5 C;  3OMG A;  2DVE A;  5GAN e;  5HK3 A;  3C94 A;  1T3L A;  5FRO A;  4M77 F;  3CC7 A;  1A0N B;  3BDU A;  4KUI A;  2EPD A;  1IO6 A;  4RCB A;  2AT1 B;  3X20 B;  4C92 D;  3VS1 A;  2EGA A;  4HCC A;  1YHQ Q;  4OGE A;  4DA4 A;  2ESW A;  2K5F A;  1VQ4 Q;  3RR6 A;  3VRY A;  4Z88 A;  2DBK A;  1VUB A;  1M27 C;  1VQ9 A;  3OYK A;  3CCV A;  2BE9 B;  4F7U E;  1IZ6 A;  2KRS A;  3X25 B;  3V7S A;  4J83 A;  2DRM A;  3HPW A;  5DM7 R;  4LD9 K;  4BY6 B;  1ZSZ A;  2EVR A;  1QVF S;  2LNV A;  2AHJ B;  3VRZ A;  5DLO A;  4C0D C;  3CEY A;  4ZGD B;  1E6G A;  4M78 C;  4RKU E;  2E6N A;  5GAN 4;  4C0Z A;  3CPW P;  1Y96 A;  4IKF A;  3OYC A;  4FCY A;  2ZPI B;  1JJ2 S;  5LJ5 g;  2CYZ B;  4PJO B;  1RL2 A;  2KSS A;  1AT1 B;  5IN1 A;  2MCN A;  4J7F A;  1XTD A;  3H6Z A;  4F16 A;  4M78 G;  4J9B A;  4ELZ C;  2O9S A;  3NFC A;  3LWH A;  1D1B A;  4E7Z A;  1QMC A;  1WHL A;  3A8H B;  3PNW C;  3CCE Q;  4AFZ C;  1Q7Y U;  2EKO A;  3HFO A;  3CC7 T;  2FO0 A;  1YBY A;  1K73 C;  1ZSZ C;  2KAF A;  2M9U A;  1ZSG A;  1YJW Q;  3GP8 A;  2RHU A;  2RD1 A;  4ATO A;  4CRI A;  2BE7 D;  4RTX A;  5IH2 A;  1NEB A;  1QCN A;  1WJR A;  1YJ9 Q;  2LX7 A;  4GBQ A;  2HQX A;  1EFN A;  4LE9 A;  5FRN A;  4FYY B;  4KT0 E;  4M77 G;  3M9Q A;  4GLK A;  4A4E A;  5A0G A;  2O4X B;  2VXF A;  1YIT T;  2X4X A;  2EYZ A;  2YHT A;  4OVA A;  3QUI A;  2EIF A;  1U3O A;  5KYX B;  1D0Z A;  4EPC A;  2CSQ A;  1MV0 B;  1I0C A;  2CZ1 B;  2DL7 A;  2FRY A;  3OS0 A;  2F2X A;  4M7A B;  2CP0 A;  5FWC A;  4IIM A;  3CME A;  3H0I A;  5GAN j;  3CCQ Q;  4PFP A;  2KR3 A;  1GL5 A;  3N5B B;  4E7S A;  1PKT A;  2EGE A;  1M1F A;  2PUO B;  1I07 A;  1M2V A;  4VUB A;  2RI2 A;  2FPE A;  3OW2 S;  5CVI A;  1KC8 U;  4C92 E;  3IQL A;  1YCS B;  4J6Y A;  4AFU C;  2MK5 A;  2OAW A;  4JJB A;  4D6W A;  2HCK A;  2LQK A;  2DIQ A;  4FYW B;  1NPR A;  2P0K A;  1WPY A;  2QTX A;  2X35 A;  3T9N A;  1QWF A;  4GY5 A;  4EIK A;  1SRL A;  3BY7 A;  2F2V A;  2K3X A;  2R5A A;  2LTO A;  4NS5 A;  1MMG A;  2I0N A;  3ER0 A;  3CCM A;  1G83 A;  4BAC A;  5GAM f;  3LYI A;  1WHJ A;  2RNA A;  3JCM g;  1K9M U;  2VXE A;  3FC3 A;  2KRN A;  2E4H A;  1G3T A;  1XQH A;  2LT1 A;  3QWY A;  5GMK l;  2I2L A;  2EYQ A;  2EQJ A;  3MJX A;  4IUP A;  2RK2 A;  1VQN A;  2RMO A;  1OZ2 A;  1EIF A;  1YFN A;  1AZE A;  2L3S A;  1WHM A;  2QK0 A;  2YRV A;  3SFM A;  3M58 A;  3H41 A;  2QI2 A;  4HXJ A;  2XDD A;  2F69 A;  3HL8 A;  4QW2 A;  3G4S A;  2GFU A;  2B86 A;  3FEO A;  4OMQ A;  3CME T;  2CZ7 B;  3GNF B;  1M2O A;  2V1Q A;  1NPP A;  1I8F A;  5CKF A;  1T0H A;  1BBZ A;  1VQP T;  5I21 A;  2YUN A;  3E9F A;  1KFZ A;  4V2S A;  1WI7 A;  1HJD A;  1FX7 A;  4KGZ B;  2JM9 A;  2QQR A;  2ENM A;  1IHW A;  1HK9 A;  4IUV A;  3PTA A;  3HTR A;  5GJV B;  1K4U S;  1QVG P;  1FMV A;  1VIF A;  5LJ5 f;  4HCB A;  1NBE B;  3WVE B;  4M78 B;  2XI9 A;  3UA6 A;  1HXD A;  5DY9 A;  1MUZ A;  1OX8 A;  4RMO A;  2E12 A;  2F5T X;  4CI0 C;  4IUU A;  2KYM A;  2CH4 A;  4CC3 A;  2DTO A;  1ABO A;  4JUV A;  3CC2 A;  3LGF A;  2LMJ A;  4MDX A;  3C95 A;  2XD0 A;  2L3Q A;  4RTT A;  2C0O A;  1E7O A;  2G3R A;  3QKJ A;  4E7H A;  1IGU A;  1Z9Z A;  2J6O A;  2RI3 A;  1SHF A;  3CMA Q;  1VQL Q;  1GBR A;  1RAG B;  2L3R A;  3UDC A;  1G8X A;  4C8Q F;  3VS0 A;  1EX4 A;  5KCH A;  1X01 A;  3OY9 A;  1B34 B;  4XTV A;  3M0U A;  2ZAE A;  2J6F A;  4M77 B;  2DXC A;  1VQN T;  2MMP A;  2XG8 D;  3AHU A;  2COY A;  3LH5 A;  2NUP B;  1FWZ A;  5D7U A;  4R0K A;  3EGD A;  3JRZ A;  3A98 A;  4HT9 A;  1FMK A;  5ECA A;  1QVG A;  2P84 A;  3M55 A;  3G4S T;  3WVD B;  2DXT A;  1BIB A;  1PRL C;  1PHT A;  1VQ6 Q;  4M78 E;  4X9D A;  1NZ9 A;  3E1S A;  3L2V A;  3P8H A;  2OTJ A;  1D1C A;  2H3E B;  5GAO n;  2K9G A;  4A4K A;  3KFV A;  2YRD A;  5CKB A;  4F7U F;  4LUD A;  2KE9 A;  4KUD K;  2KMT A;  2QDY B;  1Y07 A;  2DA9 A;  3E2U A;  3JAM E;  3M0T A;  3OYL A;  2OTL T;  5M9O A;  2PUK B;  4BD3 A;  2E64 A;  2OAU A;  5GJW B;  3CBP A;  1M3A A;  3CQT A;  3M0Q A;  2KXC A;  1QCO A;  3SDZ A;  5CAI A;  2YT6 A;  3SWN B;  2HSP A;  1H8K A;  3QDR B;  4FT2 A;  1WFW A;  3S3O A;  1UGQ B;  3MEA A;  3HRU A;  2K2M A;  3JCM f;  5GAN 2;  3CD6 Q;  3S6W A;  3OYI A;  3EG1 A;  1BKB A;  2DXU A;  1SHG A;  4J9C A;  1G3Y A;  4XU2 A;  1ARK A;  4ORZ A;  4C8Q G;  3I9Q A;  3HFN A;  1ZBJ A;  1RI9 A;  2DEU A;  4OB3 B;  1I81 A;  2M16 A;  2EWN A;  4LD6 A;  4AG2 C;  3PIO A;  1VOM A;  2COZ A;  4CC4 B;  1BI0 A;  8ATC B;  3RUX A;  3S3N A;  2XDP A;  4A4H A;  2OTJ T;  5IAY A;  3EFS A;  1B7T A;  3BW1 A;  4DQ2 A;  4XU0 A;  2AIR B;  1M1K C;  4LXC A;  5LJ3 d;  4QQD A;  4PFO A;  4QVZ A;  2QYZ A;  4JS5 A;  1M30 A;  2WAC A;  2JJ9 A;  2JT4 A;  3CCS A;  4Y92 A;  2KXD A;  3SEM A;  1PKS A;  4R56 A;  4F7U G;  3EHR A;  1GCQ A;  5GAM e;  2RJC A;  2BKD N;  1BB9 A;  2DET A;  1WXU A;  2YRC A;  3QDF A;  4C92 F;  1KD1 C;  2GTJ A;  5GMK h;  5KCO A;  1W6X A;  4FYX B;  4ESR A;  4J6X A;  1B07 A;  3M59 A;  3CCJ T;  3RMS A;  3FDR A;  5D6Y A;  2X3X D;  2ZPG B;  4BUG A;  2SEM A;  4LDV A;  4Z02 A;  3M4Y A;  2ZCF B;  1H64 1;  3CCR A;  4EMG A;  2QG9 B;  3M54 A;  1G5V A;  4DBQ A;  1GRI A;  2LC4 A;  3A5Z B;  4AG1 C;  4F17 A;  2Z0W A;  1K9M C;  4JLG A;  2NUT B;  2DZ9 A;  1GCQ C;  1VQO A;  3QZ5 B;  5FU7 C;  2L2P A;  1G3S A;  2J06 A;  4XTZ A;  1WA7 A;  2AZV A;  5LJ5 e;  4FYV B;  2DE0 X;  3MP8 A;  3M0R A;  2RPN A;  1DJ7 B;  2LCC A;  4LDX A;  2CT4 A;  4OMN A;  1JB0 E;  3CCS T;  4MZT A;  4PJM A;  2JW4 A;  1GXI E;  2JTE A;  2NUZ A;  1PCX A;  4LNP A;  1KQS P;  2CGH A;  2NLU A;  2DER A;  1MND A;  4EMK A;  2D0Q B;  1UHF A;  1VYT A;  1WHG A;  4Q5W A;  4M4Z A;  4QT7 A;  2C06 A;  2Y4X A;  4KH1 B;  3J80 E;  1RAC B;  3SHW A;  3CCU T;  1S1N A;  3Q1J A;  1VQ8 A;  3DB4 A;  2XK0 A;  1WIE A;  1ZUY A;  1VQ4 A;  1AOJ A;  4C92 G;  5GAN 8;  2E6Z A;  1JXO A;  2FZC B;  4N4G A;  2VV5 A;  1CSK A;  3MKD A;  4C8Q B;  1D0Y A;  4OMM A;  3UAT A;  2QEX Q;  2O01 E;  5GAM j;  3EG9 A;  2X4W A;  2HAX A;  5GAN 6;  2YLB A;  2RJE A;  2XKO C;  2DBM A;  1WYX A;  2V26 A;  1UE9 A;  4PL6 A;  1KQS A;  3LLR A;  2BIV A;  4EMK C;  2LJ0 A;  2HEQ A; 
#chains in the Genus database with same CATH homology
 2GQI A;  4LN2 A;  4IIO A;  4D8K A;  4RTX A;  5IH2 A;  1NEB A;  1NLO C;  1YWP A;  4KRT A;  3JV3 A;  1WLP B;  1OOT A;  2LX7 A;  4GBQ A;  4LE9 A;  1EFN A;  2C0T A;  2EYZ A;  4HCK A;  4E6R A;  2DVJ A;  1WDX A;  2L3P A;  2VWF A;  1U3O A;  2DRK A;  3FJ5 A;  2K79 A;  2CSQ A;  1MV0 B;  1I0C A;  2DL7 A;  2FRY A;  1JQQ A;  2YUP A;  2F2X A;  4DEY A;  2RQV A;  5FWC A;  2KT1 A;  4IIM A;  3H0I A;  2LQN A;  2RQW A;  2KR3 A;  1GL5 A;  5EC7 A;  3EG2 A;  1PKT A;  2EYY A;  2EGE A;  1QKW A;  1I07 A;  2CSI A;  2CUD A;  2FPE A;  4J9H A;  3ZL7 C;  3I5S A;  1AWW A;  2DL4 A;  2IIM A;  2X3W D;  3IQL A;  1WXT A;  1YCS B;  4AFU C;  2OAW A;  4JJB A;  2HCK A;  1SEM A;  1K0X A;  1JEG A;  3REA B;  2DIL A;  1QWF A;  1VYU A;  1X2K A;  3M0P A;  4EIK A;  1SRL A;  1PRM C;  2AKL A;  2F2V A;  4J9I A;  1E6H A;  1WXB A;  1NYF A;  2JS2 A;  2KNB B;  2DYB A;  2I0N A;  1G83 A;  1UUE A;  4CC7 A;  1UJY A;  1TUD A;  3M0S A;  2G6F X;  1SRM A;  3C0C A;  2RNA A;  1ZUK A;  2MIO A;  2A28 A;  2AZS A;  2KRN A;  3VS5 A;  1KIK A;  1OV3 A;  3QWY A;  1YWO A;  3VS3 A;  3THK A;  2JS0 A;  1ZX6 A;  2KEA A;  2HDA A;  2RMO A;  1UDL A;  1VA7 A;  2M51 A;  1AZE A;  2L3S A;  1JXM A;  1ZLM A;  4A63 B;  2DNU A;  3H41 A;  4OMP A;  4HXJ A;  1UEC A;  1CKB A;  4J9F A;  1UGV A;  2B86 A;  4OMQ A;  2A37 A;  2GNC A;  2V1Q A;  1T0H A;  4LUE A;  1BBZ A;  5IHI A;  1U5S A;  2YUN A;  5HCK A;  1KFZ A;  1WI7 A;  5IXF A;  1HJD A;  2DMO A;  2JM9 A;  4X1V A;  2ENM A;  2JMC A;  5GJV B;  1K4U S;  4HVU A;  2QDL A;  3ULR B;  3VS7 A;  2FEI A;  1NLP C;  2CRE A;  2HBW A;  3UA6 A;  1W1F A;  1MUZ A;  1UTI A;  4D8D A;  1AWO A;  2K3B A;  1PNJ A;  2FRW A;  5I22 A;  2KYM A;  2CH4 A;  4CC3 A;  2M0Y A;  2EQI A;  1ABO A;  3PVL A;  4CC2 A;  2LMJ A;  2L3Q A;  2RN8 A;  4RTT A;  2C0O A;  1AZG B;  1E7O A;  2EW3 A;  1Z9Z A;  4JJC A;  2F2W A;  2J6O A;  1QCF A;  1SHF A;  4HVW A;  1KSW A;  1J3T A;  1GBR A;  2KGT A;  1YP5 A;  1B3Q A;  2AKK A;  3VS0 A;  2KYB A;  1NYG A;  3M0U A;  2J6F A;  1UJ0 A;  1M3C A;  2LNH B;  3LH5 A;  2KBT A;  2J6K A;  2K6D A;  1XOV A;  1Y0M A;  4R0K A;  1OPL A;  1GBQ A;  1RUW A;  3A98 A;  1FMK A;  1PWT A;  2LQW A;  2ROT A;  4J9D A;  5ECA A;  5IXB A;  2VVK A;  2DM1 A;  4RTY A;  1PRL C;  1PHT A;  2RQR A;  1QWE A;  3EHQ A;  2D8J A;  1BU1 A;  2D0N A;  2V1R A;  1X27 A;  2K7A A;  4J9E A;  2CT3 A;  2LP5 A;  1ZUU A;  4J9G A;  1UFF A;  3RNJ A;  2K9G A;  3KFV A;  1Y57 A;  2GBQ A;  2YSQ A;  2CUB A;  4DEX A;  1T3S A;  4LUD A;  3REB B;  2KE9 A;  2OI3 A;  2JMA A;  1AWX A;  2BZX A;  2J05 A;  2DA9 A;  2D8H A;  2BZY A;  2ROL A;  2P4R A;  1M8M A;  1X6B A;  3M0T A;  4RTV A;  4K11 A;  1OEB A;  4JZ4 A;  5GJW B;  2DLP A;  1M3A A;  1CKA A;  3CQT A;  1U06 A;  5FWB A;  3M0Q A;  2KXC A;  1G2B A;  3NHN A;  2YT6 A;  2HSP A;  1H8K A;  2W0Z A;  3O5Z A;  1JO8 A;  4F14 A;  1JU5 C;  3TSZ A;  2D1X A;  3GBQ A;  1WFW A;  2DF6 A;  2FG0 A;  2K2M A;  2W10 A;  1KJW A;  2SRC A;  2XMF A;  4OML A;  3EG1 A;  2O88 A;  1WX6 A;  2RF0 A;  1SHG A;  4J9C A;  1K0S A;  4JJD A;  1T0J A;  3EG0 A;  1ARK A;  2ED0 A;  3H0H A;  3VS2 A;  4ORZ A;  3I9Q A;  1GCP A;  3VS4 A;  1Z9Q A;  1ZBJ A;  1V1C A;  1X6G A;  1YN8 A;  1QKX A;  1RI9 A;  1K1Z A;  3TSW A;  4AG2 C;  2DL5 A;  1X2Q A;  1K9A A;  4CC4 B;  2DJQ A;  3I35 A;  1NEG A;  1NM7 A;  2BZ8 A;  2ECZ A;  3NPF A;  4WCI A;  1H92 A;  4Z89 A;  1AWJ A;  2CH4 W;  3VS6 A;  1RLP C;  2PZ1 A;  1AEY A;  1SPK A;  4AFS C;  1UHC A;  1X69 A;  2PTK A;  1HD3 A;  2EBP A;  2EYX A;  1OPK A;  2KT8 A;  1FYN A;  1M30 A;  1X43 A;  2RQU A;  2JT4 A;  4RUG A;  2ED1 A;  4Y92 A;  2KXD A;  3SEM A;  1PKS A;  2J7I A;  1YNZ A;  3EHR A;  1GCQ A;  3TVT A;  3UA7 A;  1W70 A;  4ZNX A;  1BB9 A;  1ABQ A;  2GGR A;  1WXU A;  3QWX X;  1TUC A;  2ABL A;  2GTJ A;  1W6X A;  4ESR A;  2YUO A;  1B07 A;  3UF4 A;  2LZ6 B;  5IHK A;  2C0I A;  2X3X D;  2DX1 A;  2SEM A;  2GTO A;  2JXB A;  4JPB W;  1H3H A;  2DL8 A;  2EKH A;  1HSQ A;  2KRO A;  1UG1 A;  3R6N A;  1NG2 A;  2O2O A;  1GRI A;  5L23 A;  2YUQ A;  1QLY A;  3NGP A;  2AK5 A;  2YDL A;  4AG1 C;  4F17 A;  2RQT A;  1MV3 A;  1K76 A;  2BTT A;  1AD5 A;  4RTW A;  1GCQ C;  2EYW A;  2O31 A;  2L2P A;  2A36 A;  1T3L A;  2CDT A;  2J06 A;  2O9V A;  3NMZ C;  1RLQ C;  3RBB B;  1A0N B;  1WA7 A;  2AZV A;  4RTU A;  2EPD A;  2DE0 X;  1IO6 A;  3I5R A;  2DL3 A;  1M3B A;  3M0R A;  2RPN A;  3VS1 A;  2EGA A;  2CT4 A;  4OMN A;  4Z8A A;  2ESW A;  3U23 A;  3VRY A;  4Z88 A;  2DBK A;  2LJ1 A;  1M27 C;  2KRM A;  2JW4 A;  2JTE A;  4RTZ A;  2NUZ A;  2KRS A;  4LNP A;  3PE0 A;  3EG3 A;  2DRM A;  5IHN A;  1UHF A;  2EVR A;  1VYT A;  3VRZ A;  2PNI A;  1GFC A;  4M4Z A;  1E6G A;  2MOX A;  4QT7 A;  2FPF A;  1GFD A;  2A08 A;  3SHW A;  1S1N A;  1AVZ C;  4FSS A;  1WIE A;  1ZUY A;  2NWM A;  1N5Z A;  1SSH A;  2H8H A;  2L0A A;  1AOJ A;  1LCK A;  4GLM A;  4JZ3 A;  2MCN A;  2OJ2 A;  1JXO A;  4HVV A;  1BK2 A;  2EGC A;  5I11 A;  1CSK A;  2E5K A;  4F16 A;  1VYV A;  4AFQ C;  2LCS A;  4J9B A;  4OMM A;  2JM8 A;  1TG0 A;  2O9S A;  4OMO A;  3UAT A;  3H0F A;  2LJ3 A;  5FW9 A;  2VKN A;  1I1J A;  2DBM A;  1WYX A;  4AFZ C;  1UE9 A;  3PVQ A;  2FPD A;  2FO0 A;  2LJ0 A;  3EGU A;  2HEQ A;  1ZSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...