1M3BA

Solution structure of a circular form of the n-terminal sh3 domain (a134c, e135g, r191g mutant) from oncogene protein c-crk.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
58
structure length
58
Chain Sequence
b'CGYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene C-crk
publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 5
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m3bA00
2EYYA 1AVZC 2BTTA 1SEMA 1UHCA 1JXMA 2RQVA 4R0KA 2NUZA 2EW3A 4HVWA 4J9CA 2BZYA 4HCKA 1E6HA 1PHTA 1T0HA 2CH4A 3REAB 2OI3A 2JM8A 1BU1A 1VYVA 2J06A 2O88A 2LQNA 1GFCA 4JZ3A 1HJDA 4IIOA 2CT4A 2RQUA 4OMPA 2CREA 2KXCA 1UE9A 1N5ZA 4F17A 1HSQA 1GL5A 1TUDA 3PVLA 1JO8A 1Y0MA 3FJ5A 4OMOA 3VS1A 2F2WA 1EFNA 1NG2A 1VYTA 2GTOA 2L3PA 3TSWA 1Z9QA 1WXBA 4AFUC 3EG2A 1SSHA 4DEXA 2HCKA 1WA7A 1I1JA 2V1QA 4J9FA 4RUGA 1X27A 4CC3A 2JTEA 2PZ1A 1E6GA 2DBKA 4JJCA 2GGRA 2AZSA 1OOTA 1GFDA 3VS3A 1AWWA 2DBMA 4LUDA 2JS0A 4HXJA 3RNJA 4ESRA 2FO0A 2K9GA 2VWFA 3EG1A 4Z89A 1RLPC 2CDTA 2J6FA 1UG1A 2K3BA 2DYBA 3UA6A 1AZGB 2KRSA 1AOJA 1VA7A 3M0TA 1PNJA 2KEAA 4RTUA 4A63B 4E6RA 2YUQA 1PRMC 2L2PA 2FRYA 2DL4A 1G83A 3RBBB 4LNPA 2FG0A 2YT6A 2BZ8A 1X69A 2FPEA 2AZVA 2H8HA 4OMNA 1ZUKA 2ESWA 2J6OA 3LH5A 2HDAA 2M51A 3NGPA 1X2QA 3TVTA 2KBTA 2DRKA 1WXUA 1H92A 2EGAA 1FYNA 2RF0A 3I5SA 2CSQA 2I0NA 3EGUA 1UTIA 1AZEA 2DLPA 3UA7A 1A0NB 1PRLC 2A08A 4JPBW 1ZUYA 2F2XA 4LUEA 1Y57A 3EHQA 5EC7A 1YNZA 1JEGA 2AKKA 1OV3A 3QWXX 4GLMA 1NEBA 2DRMA 2NWMA 1AEYA 1NYGA 3ULRB 2MOXA 2X3XD 1MV0B 2RPNA 2A28A 4OMMA 4J9GA 1SRMA 3GBQA 3EG3A 4ZNXA 2JMAA 3THKA 4AFQC 3NPFA 2O9VA 2L3QA 5ECAA 2JM9A 4X1VA 4J9EA 4DEYA 2DNUA 3M0RA 2GNCA 1ABQA 4FSSA 5GJWB 2BZXA 3VRYA 1I07A 1T3SA 1AD5A 2J7IA 2A37A 3VS7A 1GCPA 2DF6A 1JQQA 4D8DA 1ZBJA 1BK2A 1LCKA 2DL8A 2KT8A 2RNAA 2YDLA 1U5SA 2QDLA 4QT7A 2JXBA 5I11A 4Z8AA 1E7OA 2C0IA 1K0XA 3H0IA 1UECA 3IQLA 2ROLA 2EPDA 3NHNA 3PVQA 4RTXA 3SEMA 2O31A 3M0QA 1WFWA 2KE9A 2KNBB 2GBQA 4JZ4A 3VS0A 3UF4A 2EYWA 3I5RA 1VYUA 3U23A 4J9HA 1AWJA 1K9AA 4Y92A 2L0AA 4AG2C 1AWOA 4RTWA 1JXOA 1WX6A 2E5KA 2RMOA 2MCNA 5IH2A 1M27C 5IHKA 2F2VA 3REBB 1XOVA 1YP5A 1GBQA 1GCQC 2YSQA 4HVVA 2DE0X 3I35A 2YUPA 4J9DA 4LE9A 2DL5A 1YN8A 2X3WD 4OMLA 3TSZA 1IO6A 3VS4A 2KYMA 2RQRA 2JS2A 4HVUA 4EIKA 2ROTA 2PTKA 2DX1A 2AKLA 1T3LA 3VS5A 3PE0A 2W10A 2C0TA 2K2MA 1OEBA 2K7AA 2HEQA 1AWXA 2YUNA 1PWTA 2EGEA 1JU5C 1WLPB 1FMKA 1UHFA 1KSWA 3UATA 4AG1C 2LQWA 2FPFA 1ABOA 1I0CA 1UJ0A 2CT3A 2LNHB 1UJYA 1NLPC 4CC2A 2KR3A 2KROA 2ECZA 1UUEA 1WXTA 5FWCA 1GBRA 1M30A 2LCSA 4RTVA 1NM7A 1RUWA 2DMOA 2JW4A 2HSPA 2DA9A 1QKXA 2YUOA 1PKSA 2J05A 2B86A 2GTJA 2FRWA 2FPDA 3KFVA 3C0CA 2KT1A 1QKWA 1J3TA 2EKHA 3M0SA 1H8KA 2DILA 1QWFA 1MUZA 1X43A 2DVJA 1K4US 4Z88A 1S1NA 5HCKA 1ARKA 3CQTA 1M3AA 3NMZC 2A36A 1HD3A 1H3HA 2KRMA 4OMQA 2EYZA 1BBZA 1M3CA 1X6BA 2FEIA 3VRZA 1CKBA 1ZX6A 4M4ZA 1WI7A 2C0OA 2VKNA 2DJQA 1B3QA 4AFZC 2SEMA 1K0SA 2EQIA 1NYFA 4GBQA 5IHNA 2LX7A 1YCSB 5GJVB 1TG0A 1G2BA 2D0NA 3EG0A 4CC4B 2EVRA 1UDLA 1UFFA 2AK5A 3M0PA 2ED0A 2OAWA 2K79A 3I9QA 2MIOA 2DL7A 1Z9ZA 4ORZA 1OPKA 1NLOC 3H0HA 4F16A 4JJDA 1B07A 1K76A 2L3SA 2M0YA 1X6GA 1YWPA 1V1CA 2EYXA 1QCFA 1SHFA 5IHIA 1SHGA 2O9SA 4D8KA 2G6FX 2EGCA 3VS6A 1M8MA 5I22A 1T0JA 1WIEA 1ZSGA 2RQTA 2CUDA 4WCIA 4AFSC 1W6XA 3M0UA 2OJ2A 2VVKA 3QWYA 1KJWA 3JV3A 2LP5A 2RQWA 1W70A 2K6DA 1QWEA 5FWBA 1X2KA 1PKTA 5IXFA 2EBPA 2ENMA 1OPLA 4KRTA 1CKAA 4LN2A 2IIMA 3H0FA 2JMCA 1UGVA 5FW9A 2LZ6B 4F14A 1RLQC 2LMJA 1KFZA 3VS2A 2HBWA 2KRNA 1ZUUA 1W1FA 3ZL7C 1RI9A 2KGTA 2CUBA 1GCQA 3A98A 2D8HA 2D1XA 2J6KA 2SRCA 2P4RA 3H41A 2XMFA 3O5ZA 1SRLA 4K11A 2PNIA 2DL3A 2KXDA 2KYBA 4J9BA 1QLYA 2V1RA 4JJBA 5IXBA 3EHRA 1GRIA 3R6NA 1U3OA 4RTZA 1BB9A 1U06A 4RTTA 3SHWA 1M3BA 1K1ZA 2CH4W 4J9IA 1WYXA 1CSKA 2CSIA 4IIMA 2W0ZA 2ED1A 2JT4A 1ZLMA 1SPKA 2O2OA 2DM1A 4CC7A 2LJ3A 4RTYA 2LJ1A 1YWOA 2D8JA 5L23A 2RN8A 1NEGA 1KIKA 1MV3A 2LJ0A 1WDXA 1TUCA 2GQIA 2ABLA
chains in the Genus database with same CATH superfamily
3V7SA 5GAN3 1UHCA 2DZCA 4V2SA 2EW3A 1Q81U 3CPWS 2QXFA 1PHTA 1T0HA 4MMLA 3REAB 2QA4A 4J7IA 5GAMh 2JM8A 3CC7A 1VYVA 1SF9A 3P8DA 5D7UA 5KYYB 1KHCA 1OULA 2KMTA 1Q7YC 2OTLT 2HL5C 2BIVA 1PD1A 2FYKA 3EGXB 2CT4A 2AHJB 2PQWA 2KXCA 2X4YA 1N5ZA 1IB8A 1VQ5T 1VQNQ 4ELYC 1Y0MA 3TEEA 1ACMB 1NG2A 1VYTA 3QKJA 4FU6A 4OB3B 1OZ2A 3OYNA 2CGHA 1WXBA 5KE2A 1UB4A 2DO3A 1SSHA 2HCKA 4PJOG 1WGSA 2V1QA 1X27A 3J80E 4OGCA 4IKFA 2B8AA 4JJCA 2GGRA 3SWNA 5GAMd 4PJOD 4ELZC 3RNJA 4ESRA 3OSSC 5KYXA 3UA6A 1AZGB 4M77B 2MYSA 2DETA 2R57A 3QYHB 1VQ7T 4RTUA 2YUQA 1PRMC 4XAXB 2FRYA 3TQ7P 2DL4A 2DVEA 2OTLQ 3C4SA 2AZVA 4M78D 2H8HA 4OMNA 2HDAA 3LLRA 2VYTA 3TVTA 1ZA1B 1VQ5Q 2DRKA 1WXUA 2RD1A 3E9GA 4C5GA 2FZKB 2QQRA 5CKBA 4FYVB 3EHQA 4BE1A 2K2VA 2AKKA 2ZPGB 2DRMA 1O9SA 5I21A 3ULRB 2MOXA 1MV0B 5EG2A 3QSUA 3HSBA 4FL6A 4ZNXA 4OGEA 2JMAA 2QQSA 2FL7A 2L3QA 4TVRA 4J9EA 4FSSA 5GJWB 1M1FA 1B7TA 2X9HA 5GAMe 4J83A 1VQ7Q 1JQQA 4FCYA 1LOJA 1G3YA 3FJPA 1BK2A 2CZ6B 3FIFA 5KYUA 2P0PA 2DL8A 3GNGA 2ZGWA 4PNOA 4F04B 5J26A 1O75A 4J6WA 1QVGS 1RAGB 1K0XA 3QO3A 4PJOE 4FM4B 1C0MA 1OU8A 2ROLA 5CKDA 1YFNA 3PVQA 4RTXA 5CK9A 3QYGB 3VS0A 4BI3A 3CD6A 2YLBA 1M4ZA 1VYUA 2K5IA 2FZCB 4ZN3A 3NTIA 2QTVA 4JS4A 1JXOA 2P4TA 2E5KA 4C0FA 1WPYA 4MZTA 1YCYA 4M78E 1Y7XA 3REBB 2EQUA 1GCQC 3LX7A 3JCMQ 3I35A 2I2LA 4PJOF 4X9CA 4M7AA 1YN8A 3CC2A 3LWIA 2EWNA 3JRZA 2KYMA 2JS2A 4HVUA 4D6WA 2ROTA 1G3TA 3OBWA 3L1AA 1OQKA 3E2UA 1VQKA 3OW2S 3VS5A 2W10A 4FYYB 2C0TA 3JCMc 1HYOA 2HEQA 4C0DC 1AWXA 2YUNA 2EGEA 2KQWA 1TH7A 1KSWA 4F7UG 2QEXT 4M78F 2R5AA 4C92C 2LNHB 1PD0A 1NLPC 1UJYA 2LT1A 3CCVT 1GXIE 1IGQA 4OVAA 5D6YA 1GBRA 4KGXB 3A8GB 1NM7A 1M9SA 1S72A 2DMOA 2EFIA 4P5NA 1D1BA 4IUQA 4J7FA 2J05A 1VQLT 2CP7A 2FRWA 4ATOA 3EGXA 1QKWA 2EKHA 2QASA 2GFUA 3OYLA 1MUZA 2ATCB 4Z88A 3VKIA 3CPWP 3X25B 4FW1A 4JRPA 4XTYA 3H6ZA 4OMQA 2EYZA 1M3CA 2A3LA 3OY9A 3LWHA 1ZX6A 1WHGA 3PFSA 5KCHA 1B3QA 2JOYA 2DPPB 4QQDA 1VQ8T 1NYFA 2L8DA 1YCSB 2LX7A 1BI3A 1G2BA 3EG0A 3OYHA 4CC4B 2OTJT 2RHUA 5GMKj 2QG9B 2ZPIB 1UFFA 3G71T 3A8OB 2QEXQ 2K79A 3I9QA 1YBYA 3CCQQ 2EJ9A 5CQXA 1WHLA 2DL7A 3FEOA 2E3IA 5LJ3f 4B9WA 4PJOC 1MMNA 3OYKA 2L3SA 1YWPA 1QP2A 2Y90A 5GAOl 1PSEA 2KK4A 5IN1A 2ZPFB 3MKDA 1SHGA 1K73R 1KQ2A 1VQLQ 4AFSC 4WCIA 2OJ2A 3JCMg 1KD1R 3QWYA 2JJ9A 2HQEA 1KJWA 1K9MR 3V8LA 2RQWA 4QQ6A 4M78C 1QWEA 1TOVA 2C06A 4L5GA 1R0BG 5IXFA 2EBPA 1OPLA 5CKFA 3CEYA 4LN2A 2NUPA 1TXQA 2EJFA 2L89A 5FW9A 4F7UE 4EMKB 4ANJA 2HBWA 1V76A 2HKQB 3ZL7C 1VQ8Q 1RI9A 1M1GA 1X01A 1GCQA 3A98A 2D1XA 1YHQT 2OTJQ 3S3OA 4M7AD 2NUTA 3G71Q 1ZSZB 1Q81C 3S3MA 2PNIA 4MMKA 1MMDA 1KQ1A 2DL3A 4XU1A 3EG9A 2P0QA 3GPLA 1Q82R 4Z02A 4A53A 2BKDN 2A0FB 3EHRA 3E1SA 1D1AA 1YJWT 3ZEHA 2E5QA 4GLKA 2JTFA 2E10A 5C6SA 3CCSQ 1YJNQ 1M8VA 3URGA 1IZ6A 5A0LA 4IIMA 2W0ZA 2K3XA 6AT1B 2DM1A 3WXMB 1YWOA 4KULA 1YITQ 2L5QA 3MP6A 1QCNA 4BDZA 2DTHA 4N4HA 2D9TA 3NTKA 3FLGA 3A8LB 2EYYA 1AVZC 3MO8A 1SEMA 1LNXA 5FU7B 3BE3A 3OMCA 4J9CA 2M0OA 4ZTFA 2BZYA 1QVGP 4HCKA 1R77A 1UGRB 1YHQQ 2K5FA 1G8XA 1NJIR 4C8QB 4A4EA 3CCET 3I55T 1RI0A 4HKEA 1KQSA 4DBQA 1QVPA 2J06A 2VASA 3CCRA 1NPPA 3OA6A 3EGDA 1RABB 3CCUA 4RCBA 2HKNA 1W2BS 4JZ3A 4PL6A 2DTOA 3HRSA 4M77G 2Z0WA 2CREA 1YJWQ 4F17A 4BY6C 4FIBA 3JAME 5CQYA 3CC7T 2KY9A 4OMOA 3BW1A 3VS1A 4M77D 2GTOA 4HCBA 3DB3A 4PJOA 4CI0C 1KG1A 4M7AE 4AFUC 2RH2A 1X75C 4C0GA 1G5VA 4DEXA 3M4GA 4M75B 3M9QA 2PZ1A 1VQPT 1FMVA 2DBKA 1U1TA 4O5VA 2HZYA 2DBMA 4EMHA 3OW2P 1JBMA 2FO0A 1B34A 1QVFP 4DBRA 3EG1A 5LJ5j 1RLPC 2J6FA 2DTIA 2V26A 5KYWA 1M1KR 2DYBA 2VXEA 1QQJA 2IG0A 4MZMA 4BE2A 3M0TA 3CCEQ 3I55Q 3CMEA 1Y96B 5GANg 4WTOB 1KC8R 3OQ5A 4M7AF 4LNPA 1OI1A 2FG0A 4Y91A 4C5HA 1BIBA 4HCZA 3LH5A 3CCLA 3NGPA 3EFOB 1TTHB 1VQNT 2KBTA 1H92A 2EGAA 3CC7Q 2PUOB 2CSQA 3EGUA 1AZEA 3UA7A 1NJIC 4LXCA 1I8FA 1Y57A 1JRIA 4JRIA 4E7IA 1YNZA 3GOXA 2M16A 4GLMA 2E12A 2NWMA 5LJ5g 2X3XD 3MEVA 4BD3A 3EFSA 4OMMA 5I2SA 1SRMA 2O9VA 3L42A 1BI1A 4DEYA 3OYDA 3CC4A 2DNUA 2CZ0B 1ABQA 1VQ4A 3MJXA 5M9OA 1WHHA 4MZPA 3G4ST 1IXDA 1N27A 1Y71A 3O8VA 1YIJT 4M77E 2PVGB 1I07A 2J7IA 2QGGA 3VS7A 1QP3A 1YJ9A 4D8DA 3ZBDA 1LCKA 5A2QE 2KT8A 2RNAA 3CBMA 3HFNA 3JSCA 4QT7A 3BDLA 2JXBA 1XTDA 4Z8AA 5KE3A 4PK4A 2E3HA 4EMKA 1XNIA 2LT4A 2C0IA 1OU9A 4QVCA 1MMGA 2JVVA 1UECA 3IQLA 3V8JA 3NHNA 2DD5A 4GY5A 4A4KA 4J5YA 2EQMA 2KE9A 2KNBB 3HPWA 2LVMA 3UF4A 4PJLA 3I5RA 5GAMf 1FMWA 3U23A 3S6WA 5GAOq 1QMCA 1BIAA 2VV5A 2GCXA 1AWJA 4M77F 1K9AA 4M7AC 2MK5A 5IHKA 4KH1B 3JCMh 1KD1U 1VQMT 3M4YA 1NE8A 5A0GA 4J6YA 1GBQA 3RUXA 2YSQA 4RG8A 3G4SQ 2YUPA 2EKOA 2DD4A 1IHVA 2QDYB 1YIJQ 2COYA 4PFOA 3TSZA 2DKGA 1IO6A 3A5ZB 3CXCS 3OB9A 3BFMA 2DXCA 2PTKA 1BI2A 1M2VA 2K3YA 2QYZA 4F7UA 3PE0A 3J7AF 2DFUA 5FU6B 2K7AA 2K4YA 4KBMB 2NYSA 1JU5C 1WLPB 3P8HA 1FMKA 5HY6A 3CC2T 1I0CA 1UJ0A 4CC2A 4ME7A 2CS7A 2ECZA 1WXTA 4C8QA 1Q82U 1M30A 3L2WA 1VQKT 4LDVA 4RTVA 1D1CA 2JW4A 3JCMd 4E7LA 3I56A 1QKXA 4QVDA 3RIRA 4XU3A 2GTJA 3C0CA 4LD6A 1J3TA 3M0SA 2QGFB 3EFRA 2DILA 3KXTA 1QWFA 1VQMQ 5CIUA 2AT1B 1K4US 3QBYA 3OMGA 4Y28E 1ARKA 2V8IA 3A8HB 3E9FA 7AT1B 4JUVA 1S72T 2GFAA 2RJEA 2PU9B 4OB0B 1OYXA 2A36A 1Y07A 2V8JA 2KRMA 1BBZA 3UDCA 3LYIA 4ZGJB 2C0OA 2VKNA 2DJQA 2OTLA 1VQOT 4HA8A 3L2VA 4AFZC 2SEMA 5AT1B 2X4XA 1K0SA 3JB9H 4GBQA 2D0NA 2CP2A 1MHNA 1NJIU 3UPUA 2ED0A 2RM4A 3PIOA 1PCXA 3CC2Q 2QQBA 2CKKA 5LL6S 3H0HA 4F16A 3M54A 1K76A 2M0YA 4C0DB 1X6GA 3CMAT 1VQKQ 1WQ7A 8ATCB 3HRUA 4C92B 2BE7D 3EH1A 3VS6A 4M7DB 1I81A 4NL3A 3MP1A 3QIIA 3L2ZA 1ZSGA 1W6XA 3JCMe 2VVKA 3EAEA 4BE0A 4JS5A 1M2OA 3RDVA 2CP0A 2COZA 1W70A 2RA2A 4OF1A 3CBOA 4EMGA 1S72Q 5FWBA 4RMOA 3ASKA 2MF2A 3R6OA 4KRTA 1JJ2S 1CKAA 2IIMA 4KGVB 2CZ7B 3V7CA 3M59A 2WSFE 1UGVA 2LZ6B 4HCCA 4F14A 1RLQC 4PJJA 5IAYA 2LMJA 4AMCA 1VQOQ 1ZUUA 4N0AC 2CUBA 2XDPA 1M1KU 2J6KA 2SRCA 4XK8E 4LDXA 1RL2A 3O5ZA 2LCCA 3VUZA 5GANh 3CCQT 1KC8U 1N8RR 4KT0E 1TWBA 3VJPA 5FLXE 1QLYA 3CMAQ 1YI2A 2V1RA 3JCMP 2JZ2A 4XTVA 3R6NA 1GRIA 5KYYA 1VQ9A 1BB9A 4C8QG 5GAMj 3SHWA 1K1ZA 2CH4W 1D3BB 1WZOA 4J9IA 2HSEB 2X4JA 1CSKA 4C8QD 3KUFA 4PFPA 2DXUA 1RAAB 5LJ5h 4RTYA 2LJ1A 2E6NA 3NFCA 5L23A 2GF7A 1WDXA 3X28B 2ABLA 4M78B 4KGZB 1RAFB 2FZGB 1JXMA 3H9NA 2RQVA 4R0KA 5GANd 3CPWA 4HVWA 3X26B 4EPCA 3SB2A 1I4K1 3QDRB 1E6HA 2E65A 2OI3A 2E64A 2HQXA 1BU1A 2HMAA 2LQ8A 4M77A 2LQNA 1GFCA 2DIQA 3TCJA 1DJ7B 2F1LA 1HJDA 3CCMT 2R58A 4OMPA 1K8AR 4OMFB 1D0YA 3CCST 1KHIA 1YJNT 1GL5A 2EIFA 2O4XB 3FJ5A 2M9UA 4E2FB 3CCRT 2F2WA 1WHJA 2L3PA 5KYNA 3TSWA 2ZZDA 3CCUT 1Z9QA 2H3EB 3OYIA 1I1JA 4IUPA 4J9FA 2CZ1B 1TSFA 4RUGA 4CC3A 1YITT 3OS0A 2F69A 1E6GA 5GAN8 4BI4A 3PTAA 3ME9A 2AZSA 1OOTA 2KDSA 3LH0A 4E7JA 4LUDA 4RKUE 4HXJA 2DEQA 2PVDB 2DK3A 3MEUA 1PC0A 4Z89A 2CDTA 1UG1A 2K3BA 2DERA 3JCMW 3M5AA 1AOJA 1VA7A 4JRQA 4C8QE 5GANe 2KEAA 4A63B 3LGFA 3CCVA 2HD0A 4N4IA 2RK1A 2QTXA 3V8KA 2YRVA 1X69A 2VGMA 4N0AA 2LX9A 3AT1B 3G6EA 3CCMQ 2J6OA 2Y4YA 2M51A 3SDZA 2YRDA 1VQLA 3QJYA 4F7UF 1PM3A 3CMET 2KSSA 2I0NA 1MNDA 4E47A 1UTIA 3CCRQ 1D0XA 1I5LA 1PRLC 2A08A 4JPBW 1A0NB 4II1A 5EC7A 3CCUQ 2EYQA 1JEGA 5LJ5e 1NEBA 3Q1JA 2LDMA 2DJZA 2WSEE 3CCLT 4C8QF 1G3SA 3SWNB 2RPNA 2PUKB 3FDRA 3RESA 1FX7A 1VIEA 4NL2A 4AFQC 5KYXB 2RO0A 1K8AC 2IVWA 3NPFA 1K73C 2JM9A 2WSCE 2OAUA 4BUGA 2GNCA 1VQ8A 3GIBA 4EMKC 3PMIA 2OTJA 1KD1C 1K9MC 3G71A 5FRMA 1SSFA 1AD5A 1T3SA 1GCPA 3ZFJA 4XTWA 3OYFA 2MI6A 2YDLA 1VQ4T 3OYGA 5GMKi 1H3ZA 1QVGA 2VXFA 1E7OA 3PMTA 4RG2A 2QA4T 3H0IA 5L8RE 3CMEQ 4X34A 1YJ9T 2RHXA 1G3WA 3SEMA 1M90R 2P0KA 5GAOm 1M5Q1 4JZ4A 2GBQA 5FROA 1Q95G 4A4GA 1VQ6A 2EYWA 3VV0A 2FB7A 4UC4A 1TS9A 3CCLQ 4Y92A 2L0AA 3M55A 3MPUB 1Q82C 4AG2C 1RACB 4RTWA 2JUFA 1WX6A 5GAOr 1FWZA 4A4FA 5IH2A 3HRTA 3DKMA 2F2VA 2RJFA 3H8ZA 1XOVA 3N5BB 1SG5A 3DLMA 1YP5A 3OS5A 5KH6A 4N4GA 5FU7C 4J9DA 5GAN5 1YHQA 2E6ZA 4YTLA 5KYUB 2DL5A 3A8MB 1Q7YR 2X3WD 4OMLA 4CRIA 4HT8A 3FB9A 2K5LA 3VS4A 2ZPBB 1OZ3A 4C8QC 4EDUA 3OW2A 4LDWA 1VQ4Q 2AKLA 2X35A 1QVFA 5LJ3j 2K2MA 1OEBA 5HK3A 1PWTA 2COWA 3SD4A 1UHFA 4AG1C 2QA4Q 4MDXA 5CKHA 5DM7R 1ZBXA 2FPFA 1ABOA 1YJ9Q 2CP3A 5GAOn 2X4WA 4LD9K 4QVZA 3VYHB 1N6AA 3CCJA 2KR3A 2KROA 1UUEA 4FYWB 5FWCA 3TREA 3GP8A 2LCSA 4OP0A 3L2QA 1NPRA 1RUWA 3C12A 2HSPA 2DA9A 3GLXA 3RKXA 2RK2A 3JCMb 2B86A 4E7KA 3KFVA 4ZTJA 1X6OA 1EZZB 3L2UA 1X43A 2DVJA 5C0MA 3QZ5B 4M7AB 5HCKA 2AIRB 3CQTA 4C92G 1AHJB 1M3AA 3T9NA 5LJ3g 3I56T 4M7DG 1HD3A 3META 4DQ2A 4BB7A 3CCEA 2DEUA 1SKUB 2BUDA 2FEIA 3VRZA 1CKBA 2ZAEA 1WI7A 4C92D 5I2MA 1WJQA 2RI2A 4IUVA 1P92A 3X24B 1QCOA 4M7DD 4DOWA 1OX9A 4QKUA 2OAWA 4QW2A 5GAN7 2PVOB 2MIOA 4RCCA 2RHZA 1Z9ZA 1M1KC 1UGQB 1UGSB 1NLOC 1OPKA 4FSXA 3BY7A 2QQ9A 4JJDA 1B07A 3MP8A 4ZGDB 2HAXA 1ZSZA 1V1CA 2EYXA 3G7ZA 3OYAA 1KC8C 1QCFA 3OS2A 4XTZA 1K8AU 2JNGA 1K73U 4D8KA 2O9SA 1VQPA 1V29B 2EGCA 1M8MA 5I22A 3QG1A 3WVEB 1WHMA 2XU8A 2CUDA 3M0UA 3ER0A 2E70A 4FT2A 2YWWA 3OYCA 3QHSA 3CD6T 1K9MU 1WQWA 2K6DA 3QZ9B 1X2KA 1PKTA 2MWPA 3I56Q 1WJRA 4DOVA 2DZ9A 5GMKh 2QQAA 9ATCB 1QW1A 2M02A 5HKCA 2JMCA 2YRCA 1IRXA 1BCOA 4VUBA 2M1HA 4R56A 4JJNK 2KRNA 1VIFA 1W1FA 3GNFB 3CPFA 2XHCA 2XICA 3X20B 2D8HA 2P4RA 3H41A 4E7SA 3JCMf 1MGQA 1VQNA 2XMFA 1SRLA 4M78G 2VGNA 3OYBA 1F1BB 3HHTB 3UT1A 2KXDA 4J9BA 4BACA 5IXBA 2DIGA 4RTZA 2D6FA 3OYYA 3MEAA 4OB1B 4C92E 1WNLA 2RJDA 1M3BA 4NS5A 1C1AA 4M7DE 3LW5E 2V8KA 1LVKA 1WYXA 4J6XA 3CD6Q 3INZA 3UWNA 2ED1A 2JT4A 4QQGA 2NUPB 3RR6A 1SPKA 1YI2T 2DXTA 1TU0B 4KH0B 5GMKm 3G4SA 4CC7A 2XG8D 4A54A 3HL8A 1VQ9T 3JCMV 3EH2A 3E19A 5GAN4 2D8JA 1NEGA 1YIJA 2OX7A 1KIKA 1AT1B 1MV3A 1TUCA 2HNIA 2R5MA 2BTTA 5CR2A 3MEWA 2F5TX 4M77C 4M75A 4C0ZA 1W2BP 3JCMJ 4J8OA 2NUZA 2NUTB 4C92F 2YLCA 3EG9B 4M7DF 2CH4A 2MAMA 2BE9B 1VQ5A 3D7SB 5FU6C 2ZCFB 4Q5WA 4HT9A 4OB2B 1KQSS 1W2BA 3FC3A 2O88A 2QI2A 4IUUA 1BKBA 1Y96A 1NBEB 3PIPA 1D0ZA 4IIOA 3JB9G 2RQUA 5CCAA 4BDYA 1UE9A 1HSQA 3RMQA 1TUDA 2DAQA 1EIFA 3PVLA 2LTOA 1JO8A 1M90U 1OX8A 3JB9D 3EFOA 1EFNA 1VQMA 3LGLA 1RAIB 3QXEB 1YI2Q 3EG2A 3P8BB 1WA7A 1VQ9Q 1UGPB 2O01E 5GMKe 2D0QB 3C94A 4B9XA 2JTEA 1ZHIA 3MCAB 1VQ7A 4LDUA 2EQJA 1GFDA 3VS3A 1AWWA 2JS0A 2K9GA 2E1HA 2XIDA 2VWFA 4PFZA 3WVDB 4XU0A 1I5OB 2KRSA 1Q7YU 3EGDB 5CVIA 2P84A 1PNJA 4E6RA 4PLIA 2L2PA 2A7YA 5J3BA 1G83A 1Q86R 1WJSA 3MHXA 3RBBB 3OYMA 2FVUA 2YT6A 2BZ8A 2X51A 2FPEA 2XD0A 1ZUKA 2ESWA 4L59A 2JN0A 1QVFS 1BYMA 3M53A 4NOYA 1X2QA 4PJOB 2DYIA 1FYNA 2RF0A 2XDBA 3I5SA 2QK0A 3NTHA 4PJMA 5FRNA 2EJGA 1VOMA 2DLPA 1ZUYA 2F2XA 2G3RA 4LUEA 4M7DC 1KK7A 3DB4A 3DLLA 1OV3A 3HFOA 2VUBA 2GQVA 3QWXX 5GANf 3G6ET 1AEYA 1MMAA 1NYGA 3QJ6A 3PGGA 4KUIA 4JLGA 2A28A 4J9GA 4C5IA 3OYEA 1B34B 3EG3A 3GBQA 1N9RA 2L3RA 1UEBA 3THKA 1IGUA 5KYWB 5ECAA 1VQOA 4X1VA 5GAN6 4XTUA 3M0RA 1XJWB 8AT1B 2RB6A 3VUBA 2DXBA 4M75G 5LJ3h 1Q81R 2BZXA 2YHTA 3VRYA 1ZQ1A 3M57A 5GAMg 2A37A 3RMSA 2DF6A 1ZBJA 3OS1A 4M75D 5LJ5f 2LNVA 2HBPA 2KVQG 1LPLA 1U5SA 2QDLA 3CMAA 5I11A 5J39A 2XK0A 3BDUA 2LQKA 5DLQE 1LJOA 2KAFA 2ZPEB 2YXYA 1N9SA 5LJ5d 2EPDA 3JB9I 5CO7A 1R0CB 3CCVQ 2O31A 2LRQA 3M0QA 1WFWA 1RAEB 5HK0A 3V7RA 3JCMX 2LCLA 1NZ9A 3RKWA 1N8RC 3HKSA 3G6EQ 4J9HA 2EAYA 3JB9F 1Q86C 2XDDA 3A1PA 1AWOA 4C5EA 2RMOA 2MCNA 4PKCC 2XI9A 5LJ3d 1PSFA 1WHKA 1M27C 4DA4A 3CXCP 3QDFA 1C6VX 1VQ6T 4HVVA 2XKOC 4R55A 3C95A 2DE0X 2HQHA 2VC8A 4ZN1A 3G1JA 1HXDA 2RI3A 4LE9A 5D6WA 2QEXA 3FRNA 3CCQA 3QPHA 3CXCA 2RQRA 4M7AG 4EIKA 2DX1A 3KBGA 1T3LA 4XTXA 4E7HA 3PT9A 4LDYA 2RHIA 5CAIA 3L2RA 3SFMA 3UATA 2LQWA 2K57A 5IT9E 2CT3A 5KCOA 4L6V5 2JTMA 1IREB 2FHDA 4BY6B 4XU2A 3OYJA 1H641 3AHUA 1MNEA 2YUOA 4M75E 1PKSA 1R8OB 2FPDA 2KT1A 5D6XA 1BCMA 1H8KA 2E41A 4C92A 3CCJT 1HK9A 3OSVA 3CBPA 4ZGEB 4M7DA 1S1NA 1VQ6Q 2LC4A 2KI7A 2CYZB 5LJ3e 1JB0E 3NMZC 4WF2A 2H3JA 3HP9A 1H3HA 1IHWA 2Y4XA 2IPOB 1M2VB 4PLLA 1KQSP 1EX4A 3S3NA 4F7UB 1X6BA 3PNWC 4M4ZA 3CC4T 4PJNA 1ZSZC 4BI8B 4DBFA 4JRKA 2EQIA 1FXXA 4MDWA 5IHNA 5GJVB 1TG0A 3CCMA 1VUBA 4M75F 2QAZA 2EVRA 1UDLA 2RI5A 2AK5A 3M0PA 3CCSA 1YJNA 3TU4K 4ORZA 5CKEA 2CP5A 1U8RA 1RAHB 3QUIA 5GAN2 4B6MA 1JJ2P 1SHFA 5IHIA 2MPXC 2RJCA 4O6JA 5GAOp 1YITA 4JDSA 1W4SA 2G6FX 2VB6A 3JB9J 1T0JA 1WIEA 5GANj 2HL3A 1U1SA 2RQTA 3SWNC 3CCJQ 4IURA 5AYFA 1BI0A 3VU3C 3JV3A 1PG5B 2LP5A 1D3BA 1JJ2A 3F70A 2ENMA 3HTRA 1XQHA 4FYXB 3H0FA 1D09B 1KFZA 3VS2A 5A0DA 2WACA 3CC4Q 2EQKA 2KGTA 4DBHA 4FT4A 4M78A 4AT1B 1YJWA 4JLIA 2E4HA 2MMPA 1ZA2B 4K11A 1N8RU 1Q86U 2ZPHB 2NLUA 2MWOA 4FW2A 3RKYA 3M58A 2KYBA 4JJBA 3M56A 3RERA 1U3OA 2RHYA 3VYGA 1RADB 1U06A 4RTTA 4X9DA 4M75C 2CP6A 4XQ3A 2CSIA 3GF5A 4KUDK 1ZLMA 5DY9A 2O2OA 4E7ZA 2O4XA 1M90C 2LJ3A 2F5KA 3J81E 2RN8A 4A4HA 1TUGB 3OBYA 5GMKl 1VQPQ 4IUTA 3I55A 2LJ0A 2GQIA 5DLOA
chains in the Genus database with same CATH topology
2EYYA 1AVZC 2BTTA 1SEMA 1UHCA 1JXMA 2RQVA 4R0KA 2NUZA 2EW3A 4HVWA 4J9CA 2BZYA 4HCKA 1E6HA 1PHTA 1T0HA 2CH4A 3REAB 2OI3A 2JM8A 1BU1A 1VYVA 2J06A 2O88A 2LQNA 1GFCA 4JZ3A 1HJDA 4IIOA 2CT4A 2RQUA 4OMPA 2CREA 2KXCA 1UE9A 1N5ZA 4F17A 1HSQA 1GL5A 1TUDA 3PVLA 1JO8A 1Y0MA 3FJ5A 4OMOA 3VS1A 2F2WA 1EFNA 1NG2A 1VYTA 2GTOA 2L3PA 3TSWA 1Z9QA 1WXBA 4AFUC 3EG2A 1SSHA 4DEXA 2HCKA 1WA7A 1I1JA 2V1QA 4J9FA 4RUGA 1X27A 4CC3A 2JTEA 2PZ1A 1E6GA 2DBKA 4JJCA 2GGRA 2AZSA 1OOTA 1GFDA 3VS3A 1AWWA 2DBMA 4LUDA 2JS0A 4HXJA 3RNJA 4ESRA 2FO0A 2K9GA 2VWFA 3EG1A 4Z89A 1RLPC 2CDTA 2J6FA 1UG1A 2K3BA 2DYBA 3UA6A 1AZGB 2KRSA 1AOJA 1VA7A 3M0TA 1PNJA 2KEAA 4RTUA 4A63B 4E6RA 2YUQA 1PRMC 2L2PA 2FRYA 2DL4A 1G83A 3RBBB 4LNPA 2FG0A 2YT6A 2BZ8A 1X69A 2FPEA 2AZVA 2H8HA 4OMNA 1ZUKA 2ESWA 2J6OA 3LH5A 2HDAA 2M51A 3NGPA 1X2QA 3TVTA 2KBTA 2DRKA 1WXUA 1H92A 2EGAA 1FYNA 2RF0A 3I5SA 2CSQA 2I0NA 3EGUA 1UTIA 1AZEA 2DLPA 3UA7A 1A0NB 1PRLC 2A08A 4JPBW 1ZUYA 2F2XA 4LUEA 1Y57A 3EHQA 5EC7A 1YNZA 1JEGA 2AKKA 1OV3A 3QWXX 4GLMA 1NEBA 2DRMA 2NWMA 1AEYA 1NYGA 3ULRB 2MOXA 2X3XD 1MV0B 2RPNA 2A28A 4OMMA 4J9GA 1SRMA 3GBQA 3EG3A 4ZNXA 2JMAA 3THKA 4AFQC 3NPFA 2O9VA 2L3QA 5ECAA 2JM9A 4X1VA 4J9EA 4DEYA 2DNUA 3M0RA 2GNCA 1ABQA 4FSSA 5GJWB 2BZXA 3VRYA 1I07A 1T3SA 1AD5A 2J7IA 2A37A 3VS7A 1GCPA 2DF6A 1JQQA 4D8DA 1ZBJA 1BK2A 1LCKA 2DL8A 2KT8A 2RNAA 2YDLA 1U5SA 2QDLA 4QT7A 2JXBA 5I11A 4Z8AA 1E7OA 2C0IA 1K0XA 3H0IA 1UECA 3IQLA 2ROLA 2EPDA 3NHNA 3PVQA 4RTXA 3SEMA 2O31A 3M0QA 1WFWA 2KE9A 2KNBB 2GBQA 4JZ4A 3VS0A 3UF4A 2EYWA 3I5RA 1VYUA 3U23A 4J9HA 1AWJA 1K9AA 4Y92A 2L0AA 4AG2C 1AWOA 4RTWA 1JXOA 1WX6A 2E5KA 2RMOA 2MCNA 5IH2A 1M27C 5IHKA 2F2VA 3REBB 1XOVA 1YP5A 1GBQA 1GCQC 2YSQA 4HVVA 2DE0X 3I35A 2YUPA 4J9DA 4LE9A 2DL5A 1YN8A 2X3WD 4OMLA 3TSZA 1IO6A 3VS4A 2KYMA 2RQRA 2JS2A 4HVUA 4EIKA 2ROTA 2PTKA 2DX1A 2AKLA 1T3LA 3VS5A 3PE0A 2W10A 2C0TA 2K2MA 1OEBA 2K7AA 2HEQA 1AWXA 2YUNA 1PWTA 2EGEA 1JU5C 1WLPB 1FMKA 1UHFA 1KSWA 3UATA 4AG1C 2LQWA 2FPFA 1ABOA 1I0CA 1UJ0A 2CT3A 2LNHB 1UJYA 1NLPC 4CC2A 2KR3A 2KROA 2ECZA 1UUEA 1WXTA 5FWCA 1GBRA 1M30A 2LCSA 4RTVA 1NM7A 1RUWA 2DMOA 2JW4A 2HSPA 2DA9A 1QKXA 2YUOA 1PKSA 2J05A 2B86A 2GTJA 2FRWA 2FPDA 3KFVA 3C0CA 2KT1A 1QKWA 1J3TA 2EKHA 3M0SA 1H8KA 2DILA 1QWFA 1MUZA 1X43A 2DVJA 1K4US 4Z88A 1S1NA 5HCKA 1ARKA 3CQTA 1M3AA 3NMZC 2A36A 1HD3A 1H3HA 2KRMA 4OMQA 2EYZA 1BBZA 1M3CA 1X6BA 2FEIA 3VRZA 1CKBA 1ZX6A 4M4ZA 1WI7A 2C0OA 2VKNA 2DJQA 1B3QA 4AFZC 2SEMA 1K0SA 2EQIA 1NYFA 4GBQA 5IHNA 2LX7A 1YCSB 5GJVB 1TG0A 1G2BA 2D0NA 3EG0A 4CC4B 2EVRA 1UDLA 1UFFA 2AK5A 3M0PA 2ED0A 2OAWA 2K79A 3I9QA 2MIOA 2DL7A 1Z9ZA 4ORZA 1OPKA 1NLOC 3H0HA 4F16A 4JJDA 1B07A 1K76A 2L3SA 2M0YA 1X6GA 1YWPA 1V1CA 2EYXA 1QCFA 1SHFA 5IHIA 1SHGA 2O9SA 4D8KA 2G6FX 2EGCA 3VS6A 1M8MA 5I22A 1T0JA 1WIEA 1ZSGA 2RQTA 2CUDA 4WCIA 4AFSC 1W6XA 3M0UA 2OJ2A 2VVKA 3QWYA 1KJWA 3JV3A 2LP5A 2RQWA 1W70A 2K6DA 1QWEA 5FWBA 1X2KA 1PKTA 5IXFA 2EBPA 2ENMA 1OPLA 4KRTA 1CKAA 4LN2A 2IIMA 3H0FA 2JMCA 1UGVA 5FW9A 2LZ6B 4F14A 1RLQC 2LMJA 1KFZA 3VS2A 2HBWA 2KRNA 1ZUUA 1W1FA 3ZL7C 1RI9A 2KGTA 2CUBA 1GCQA 3A98A 2D8HA 2D1XA 2J6KA 2SRCA 2P4RA 3H41A 2XMFA 3O5ZA 1SRLA 4K11A 2PNIA 2DL3A 2KXDA 2KYBA 4J9BA 1QLYA 2V1RA 4JJBA 5IXBA 3EHRA 1GRIA 3R6NA 1U3OA 4RTZA 1BB9A 1U06A 4RTTA 3SHWA 1M3BA 1K1ZA 2CH4W 4J9IA 1WYXA 1CSKA 2CSIA 4IIMA 2W0ZA 2ED1A 2JT4A 1ZLMA 1SPKA 2O2OA 2DM1A 4CC7A 2LJ3A 4RTYA 2LJ1A 1YWOA 2D8JA 5L23A 2RN8A 1NEGA 1KIKA 1MV3A 2LJ0A 1WDXA 1TUCA 2GQIA 2ABLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYY A;  1AVZ C;  2BTT A;  1SEM A;  1UHC A;  1JXM A;  2RQV A;  4R0K A;  2NUZ A;  2EW3 A;  4HVW A;  4J9C A;  2BZY A;  4HCK A;  1E6H A;  1PHT A;  1T0H A;  2CH4 A;  3REA B;  2OI3 A;  2JM8 A;  1BU1 A;  1VYV A;  2J06 A;  2O88 A;  2LQN A;  1GFC A;  4JZ3 A;  1HJD A;  4IIO A;  2CT4 A;  2RQU A;  4OMP A;  2CRE A;  2KXC A;  1UE9 A;  1N5Z A;  4F17 A;  1HSQ A;  1GL5 A;  1TUD A;  3PVL A;  1JO8 A;  1Y0M A;  3FJ5 A;  4OMO A;  3VS1 A;  2F2W A;  1EFN A;  1NG2 A;  1VYT A;  2GTO A;  2L3P A;  3TSW A;  1Z9Q A;  1WXB A;  4AFU C;  3EG2 A;  1SSH A;  4DEX A;  2HCK A;  1WA7 A;  1I1J A;  2V1Q A;  4J9F A;  4RUG A;  1X27 A;  4CC3 A;  2JTE A;  2PZ1 A;  1E6G A;  2DBK A;  4JJC A;  2GGR A;  2AZS A;  1OOT A;  1GFD A;  3VS3 A;  1AWW A;  2DBM A;  4LUD A;  2JS0 A;  4HXJ A;  3RNJ A;  4ESR A;  2FO0 A;  2K9G A;  2VWF A;  3EG1 A;  4Z89 A;  1RLP C;  2CDT A;  2J6F A;  1UG1 A;  2K3B A;  2DYB A;  3UA6 A;  1AZG B;  2KRS A;  1AOJ A;  1VA7 A;  3M0T A;  1PNJ A;  2KEA A;  4RTU A;  4A63 B;  4E6R A;  2YUQ A;  1PRM C;  2L2P A;  2FRY A;  2DL4 A;  1G83 A;  3RBB B;  4LNP A;  2FG0 A;  2YT6 A;  2BZ8 A;  1X69 A;  2FPE A;  2AZV A;  2H8H A;  4OMN A;  1ZUK A;  2ESW A;  2J6O A;  3LH5 A;  2HDA A;  2M51 A;  3NGP A;  1X2Q A;  3TVT A;  2KBT A;  2DRK A;  1WXU A;  1H92 A;  2EGA A;  1FYN A;  2RF0 A;  3I5S A;  2CSQ A;  2I0N A;  3EGU A;  1UTI A;  1AZE A;  2DLP A;  3UA7 A;  1A0N B;  1PRL C;  2A08 A;  4JPB W;  1ZUY A;  2F2X A;  4LUE A;  1Y57 A;  3EHQ A;  5EC7 A;  1YNZ A;  1JEG A;  2AKK A;  1OV3 A;  3QWX X;  4GLM A;  1NEB A;  2DRM A;  2NWM A;  1AEY A;  1NYG A;  3ULR B;  2MOX A;  2X3X D;  1MV0 B;  2RPN A;  2A28 A;  4OMM A;  4J9G A;  1SRM A;  3GBQ A;  3EG3 A;  4ZNX A;  2JMA A;  3THK A;  4AFQ C;  3NPF A;  2O9V A;  2L3Q A;  5ECA A;  2JM9 A;  4X1V A;  4J9E A;  4DEY A;  2DNU A;  3M0R A;  2GNC A;  1ABQ A;  4FSS A;  5GJW B;  2BZX A;  3VRY A;  1I07 A;  1T3S A;  1AD5 A;  2J7I A;  2A37 A;  3VS7 A;  1GCP A;  2DF6 A;  1JQQ A;  4D8D A;  1ZBJ A;  1BK2 A;  1LCK A;  2DL8 A;  2KT8 A;  2RNA A;  2YDL A;  1U5S A;  2QDL A;  4QT7 A;  2JXB A;  5I11 A;  4Z8A A;  1E7O A;  2C0I A;  1K0X A;  3H0I A;  1UEC A;  3IQL A;  2ROL A;  2EPD A;  3NHN A;  3PVQ A;  4RTX A;  3SEM A;  2O31 A;  3M0Q A;  1WFW A;  2KE9 A;  2KNB B;  2GBQ A;  4JZ4 A;  3VS0 A;  3UF4 A;  2EYW A;  3I5R A;  1VYU A;  3U23 A;  4J9H A;  1AWJ A;  1K9A A;  4Y92 A;  2L0A A;  4AG2 C;  1AWO A;  4RTW A;  1JXO A;  1WX6 A;  2E5K A;  2RMO A;  2MCN A;  5IH2 A;  1M27 C;  5IHK A;  2F2V A;  3REB B;  1XOV A;  1YP5 A;  1GBQ A;  1GCQ C;  2YSQ A;  4HVV A;  2DE0 X;  3I35 A;  2YUP A;  4J9D A;  4LE9 A;  2DL5 A;  1YN8 A;  2X3W D;  4OML A;  3TSZ A;  1IO6 A;  3VS4 A;  2KYM A;  2RQR A;  2JS2 A;  4HVU A;  4EIK A;  2ROT A;  2PTK A;  2DX1 A;  2AKL A;  1T3L A;  3VS5 A;  3PE0 A;  2W10 A;  2C0T A;  2K2M A;  1OEB A;  2K7A A;  2HEQ A;  1AWX A;  2YUN A;  1PWT A;  2EGE A;  1JU5 C;  1WLP B;  1FMK A;  1UHF A;  1KSW A;  3UAT A;  4AG1 C;  2LQW A;  2FPF A;  1ABO A;  1I0C A;  1UJ0 A;  2CT3 A;  2LNH B;  1UJY A;  1NLP C;  4CC2 A;  2KR3 A;  2KRO A;  2ECZ A;  1UUE A;  1WXT A;  5FWC A;  1GBR A;  1M30 A;  2LCS A;  4RTV A;  1NM7 A;  1RUW A;  2DMO A;  2JW4 A;  2HSP A;  2DA9 A;  1QKX A;  2YUO A;  1PKS A;  2J05 A;  2B86 A;  2GTJ A;  2FRW A;  2FPD A;  3KFV A;  3C0C A;  2KT1 A;  1QKW A;  1J3T A;  2EKH A;  3M0S A;  1H8K A;  2DIL A;  1QWF A;  1MUZ A;  1X43 A;  2DVJ A;  1K4U S;  4Z88 A;  1S1N A;  5HCK A;  1ARK A;  3CQT A;  1M3A A;  3NMZ C;  2A36 A;  1HD3 A;  1H3H A;  2KRM A;  4OMQ A;  2EYZ A;  1BBZ A;  1M3C A;  1X6B A;  2FEI A;  3VRZ A;  1CKB A;  1ZX6 A;  4M4Z A;  1WI7 A;  2C0O A;  2VKN A;  2DJQ A;  1B3Q A;  4AFZ C;  2SEM A;  1K0S A;  2EQI A;  1NYF A;  4GBQ A;  5IHN A;  2LX7 A;  1YCS B;  5GJV B;  1TG0 A;  1G2B A;  2D0N A;  3EG0 A;  4CC4 B;  2EVR A;  1UDL A;  1UFF A;  2AK5 A;  3M0P A;  2ED0 A;  2OAW A;  2K79 A;  3I9Q A;  2MIO A;  2DL7 A;  1Z9Z A;  4ORZ A;  1OPK A;  1NLO C;  3H0H A;  4F16 A;  4JJD A;  1B07 A;  1K76 A;  2L3S A;  2M0Y A;  1X6G A;  1YWP A;  1V1C A;  2EYX A;  1QCF A;  1SHF A;  5IHI A;  1SHG A;  2O9S A;  4D8K A;  2G6F X;  2EGC A;  3VS6 A;  1M8M A;  5I22 A;  1T0J A;  1WIE A;  1ZSG A;  2RQT A;  2CUD A;  4WCI A;  4AFS C;  1W6X A;  3M0U A;  2OJ2 A;  2VVK A;  3QWY A;  1KJW A;  3JV3 A;  2LP5 A;  2RQW A;  1W70 A;  2K6D A;  1QWE A;  5FWB A;  1X2K A;  1PKT A;  5IXF A;  2EBP A;  2ENM A;  1OPL A;  4KRT A;  1CKA A;  4LN2 A;  2IIM A;  3H0F A;  2JMC A;  1UGV A;  5FW9 A;  2LZ6 B;  4F14 A;  1RLQ C;  2LMJ A;  1KFZ A;  3VS2 A;  2HBW A;  2KRN A;  1ZUU A;  1W1F A;  3ZL7 C;  1RI9 A;  2KGT A;  2CUB A;  1GCQ A;  3A98 A;  2D8H A;  2D1X A;  2J6K A;  2SRC A;  2P4R A;  3H41 A;  2XMF A;  3O5Z A;  1SRL A;  4K11 A;  2PNI A;  2DL3 A;  2KXD A;  2KYB A;  4J9B A;  1QLY A;  2V1R A;  4JJB A;  5IXB A;  3EHR A;  1GRI A;  3R6N A;  1U3O A;  4RTZ A;  1BB9 A;  1U06 A;  4RTT A;  3SHW A;  1M3B A;  1K1Z A;  2CH4 W;  4J9I A;  1WYX A;  1CSK A;  2CSI A;  4IIM A;  2W0Z A;  2ED1 A;  2JT4 A;  1ZLM A;  1SPK A;  2O2O A;  2DM1 A;  4CC7 A;  2LJ3 A;  4RTY A;  2LJ1 A;  1YWO A;  2D8J A;  5L23 A;  2RN8 A;  1NEG A;  1KIK A;  1MV3 A;  2LJ0 A;  1WDX A;  1TUC A;  2GQI A;  2ABL A; 
#chains in the Genus database with same CATH topology
 3V7S A;  5GAN 3;  1UHC A;  2DZC A;  4V2S A;  2EW3 A;  1Q81 U;  3CPW S;  2QXF A;  1PHT A;  1T0H A;  4MML A;  3REA B;  2QA4 A;  4J7I A;  5GAM h;  2JM8 A;  3CC7 A;  1VYV A;  1SF9 A;  3P8D A;  5D7U A;  5KYY B;  1KHC A;  1OUL A;  2KMT A;  1Q7Y C;  2OTL T;  2HL5 C;  2BIV A;  1PD1 A;  2FYK A;  3EGX B;  2CT4 A;  2AHJ B;  2PQW A;  2KXC A;  2X4Y A;  1N5Z A;  1IB8 A;  1VQ5 T;  1VQN Q;  4ELY C;  1Y0M A;  3TEE A;  1ACM B;  1NG2 A;  1VYT A;  3QKJ A;  4FU6 A;  4OB3 B;  1OZ2 A;  3OYN A;  2CGH A;  1WXB A;  5KE2 A;  1UB4 A;  2DO3 A;  1SSH A;  2HCK A;  4PJO G;  1WGS A;  2V1Q A;  1X27 A;  3J80 E;  4OGC A;  4IKF A;  2B8A A;  4JJC A;  2GGR A;  3SWN A;  5GAM d;  4PJO D;  4ELZ C;  3RNJ A;  4ESR A;  3OSS C;  5KYX A;  3UA6 A;  1AZG B;  4M77 B;  2MYS A;  2DET A;  2R57 A;  3QYH B;  1VQ7 T;  4RTU A;  2YUQ A;  1PRM C;  4XAX B;  2FRY A;  3TQ7 P;  2DL4 A;  2DVE A;  2OTL Q;  3C4S A;  2AZV A;  4M78 D;  2H8H A;  4OMN A;  2HDA A;  3LLR A;  2VYT A;  3TVT A;  1ZA1 B;  1VQ5 Q;  2DRK A;  1WXU A;  2RD1 A;  3E9G A;  4C5G A;  2FZK B;  2QQR A;  5CKB A;  4FYV B;  3EHQ A;  4BE1 A;  2K2V A;  2AKK A;  2ZPG B;  2DRM A;  1O9S A;  5I21 A;  3ULR B;  2MOX A;  1MV0 B;  5EG2 A;  3QSU A;  3HSB A;  4FL6 A;  4ZNX A;  4OGE A;  2JMA A;  2QQS A;  2FL7 A;  2L3Q A;  4TVR A;  4J9E A;  4FSS A;  5GJW B;  1M1F A;  1B7T A;  2X9H A;  5GAM e;  4J83 A;  1VQ7 Q;  1JQQ A;  4FCY A;  1LOJ A;  1G3Y A;  3FJP A;  1BK2 A;  2CZ6 B;  3FIF A;  5KYU A;  2P0P A;  2DL8 A;  3GNG A;  2ZGW A;  4PNO A;  4F04 B;  5J26 A;  1O75 A;  4J6W A;  1QVG S;  1RAG B;  1K0X A;  3QO3 A;  4PJO E;  4FM4 B;  1C0M A;  1OU8 A;  2ROL A;  5CKD A;  1YFN A;  3PVQ A;  4RTX A;  5CK9 A;  3QYG B;  3VS0 A;  4BI3 A;  3CD6 A;  2YLB A;  1M4Z A;  1VYU A;  2K5I A;  2FZC B;  4ZN3 A;  3NTI A;  2QTV A;  4JS4 A;  1JXO A;  2P4T A;  2E5K A;  4C0F A;  1WPY A;  4MZT A;  1YCY A;  4M78 E;  1Y7X A;  3REB B;  2EQU A;  1GCQ C;  3LX7 A;  3JCM Q;  3I35 A;  2I2L A;  4PJO F;  4X9C A;  4M7A A;  1YN8 A;  3CC2 A;  3LWI A;  2EWN A;  3JRZ A;  2KYM A;  2JS2 A;  4HVU A;  4D6W A;  2ROT A;  1G3T A;  3OBW A;  3L1A A;  1OQK A;  3E2U A;  1VQK A;  3OW2 S;  3VS5 A;  2W10 A;  4FYY B;  2C0T A;  3JCM c;  1HYO A;  2HEQ A;  4C0D C;  1AWX A;  2YUN A;  2EGE A;  2KQW A;  1TH7 A;  1KSW A;  4F7U G;  2QEX T;  4M78 F;  2R5A A;  4C92 C;  2LNH B;  1PD0 A;  1NLP C;  1UJY A;  2LT1 A;  3CCV T;  1GXI E;  1IGQ A;  4OVA A;  5D6Y A;  1GBR A;  4KGX B;  3A8G B;  1NM7 A;  1M9S A;  1S72 A;  2DMO A;  2EFI A;  4P5N A;  1D1B A;  4IUQ A;  4J7F A;  2J05 A;  1VQL T;  2CP7 A;  2FRW A;  4ATO A;  3EGX A;  1QKW A;  2EKH A;  2QAS A;  2GFU A;  3OYL A;  1MUZ A;  2ATC B;  4Z88 A;  3VKI A;  3CPW P;  3X25 B;  4FW1 A;  4JRP A;  4XTY A;  3H6Z A;  4OMQ A;  2EYZ A;  1M3C A;  2A3L A;  3OY9 A;  3LWH A;  1ZX6 A;  1WHG A;  3PFS A;  5KCH A;  1B3Q A;  2JOY A;  2DPP B;  4QQD A;  1VQ8 T;  1NYF A;  2L8D A;  1YCS B;  2LX7 A;  1BI3 A;  1G2B A;  3EG0 A;  3OYH A;  4CC4 B;  2OTJ T;  2RHU A;  5GMK j;  2QG9 B;  2ZPI B;  1UFF A;  3G71 T;  3A8O B;  2QEX Q;  2K79 A;  3I9Q A;  1YBY A;  3CCQ Q;  2EJ9 A;  5CQX A;  1WHL A;  2DL7 A;  3FEO A;  2E3I A;  5LJ3 f;  4B9W A;  4PJO C;  1MMN A;  3OYK A;  2L3S A;  1YWP A;  1QP2 A;  2Y90 A;  5GAO l;  1PSE A;  2KK4 A;  5IN1 A;  2ZPF B;  3MKD A;  1SHG A;  1K73 R;  1KQ2 A;  1VQL Q;  4AFS C;  4WCI A;  2OJ2 A;  3JCM g;  1KD1 R;  3QWY A;  2JJ9 A;  2HQE A;  1KJW A;  1K9M R;  3V8L A;  2RQW A;  4QQ6 A;  4M78 C;  1QWE A;  1TOV A;  2C06 A;  4L5G A;  1R0B G;  5IXF A;  2EBP A;  1OPL A;  5CKF A;  3CEY A;  4LN2 A;  2NUP A;  1TXQ A;  2EJF A;  2L89 A;  5FW9 A;  4F7U E;  4EMK B;  4ANJ A;  2HBW A;  1V76 A;  2HKQ B;  3ZL7 C;  1VQ8 Q;  1RI9 A;  1M1G A;  1X01 A;  1GCQ A;  3A98 A;  2D1X A;  1YHQ T;  2OTJ Q;  3S3O A;  4M7A D;  2NUT A;  3G71 Q;  1ZSZ B;  1Q81 C;  3S3M A;  2PNI A;  4MMK A;  1MMD A;  1KQ1 A;  2DL3 A;  4XU1 A;  3EG9 A;  2P0Q A;  3GPL A;  1Q82 R;  4Z02 A;  4A53 A;  2BKD N;  2A0F B;  3EHR A;  3E1S A;  1D1A A;  1YJW T;  3ZEH A;  2E5Q A;  4GLK A;  2JTF A;  2E10 A;  5C6S A;  3CCS Q;  1YJN Q;  1M8V A;  3URG A;  1IZ6 A;  5A0L A;  4IIM A;  2W0Z A;  2K3X A;  6AT1 B;  2DM1 A;  3WXM B;  1YWO A;  4KUL A;  1YIT Q;  2L5Q A;  3MP6 A;  1QCN A;  4BDZ A;  2DTH A;  4N4H A;  2D9T A;  3NTK A;  3FLG A;  3A8L B;  2EYY A;  1AVZ C;  3MO8 A;  1SEM A;  1LNX A;  5FU7 B;  3BE3 A;  3OMC A;  4J9C A;  2M0O A;  4ZTF A;  2BZY A;  1QVG P;  4HCK A;  1R77 A;  1UGR B;  1YHQ Q;  2K5F A;  1G8X A;  1NJI R;  4C8Q B;  4A4E A;  3CCE T;  3I55 T;  1RI0 A;  4HKE A;  1KQS A;  4DBQ A;  1QVP A;  2J06 A;  2VAS A;  3CCR A;  1NPP A;  3OA6 A;  3EGD A;  1RAB B;  3CCU A;  4RCB A;  2HKN A;  1W2B S;  4JZ3 A;  4PL6 A;  2DTO A;  3HRS A;  4M77 G;  2Z0W A;  2CRE A;  1YJW Q;  4F17 A;  4BY6 C;  4FIB A;  3JAM E;  5CQY A;  3CC7 T;  2KY9 A;  4OMO A;  3BW1 A;  3VS1 A;  4M77 D;  2GTO A;  4HCB A;  3DB3 A;  4PJO A;  4CI0 C;  1KG1 A;  4M7A E;  4AFU C;  2RH2 A;  1X75 C;  4C0G A;  1G5V A;  4DEX A;  3M4G A;  4M75 B;  3M9Q A;  2PZ1 A;  1VQP T;  1FMV A;  2DBK A;  1U1T A;  4O5V A;  2HZY A;  2DBM A;  4EMH A;  3OW2 P;  1JBM A;  2FO0 A;  1B34 A;  1QVF P;  4DBR A;  3EG1 A;  5LJ5 j;  1RLP C;  2J6F A;  2DTI A;  2V26 A;  5KYW A;  1M1K R;  2DYB A;  2VXE A;  1QQJ A;  2IG0 A;  4MZM A;  4BE2 A;  3M0T A;  3CCE Q;  3I55 Q;  3CME A;  1Y96 B;  5GAN g;  4WTO B;  1KC8 R;  3OQ5 A;  4M7A F;  4LNP A;  1OI1 A;  2FG0 A;  4Y91 A;  4C5H A;  1BIB A;  4HCZ A;  3LH5 A;  3CCL A;  3NGP A;  3EFO B;  1TTH B;  1VQN T;  2KBT A;  1H92 A;  2EGA A;  3CC7 Q;  2PUO B;  2CSQ A;  3EGU A;  1AZE A;  3UA7 A;  1NJI C;  4LXC A;  1I8F A;  1Y57 A;  1JRI A;  4JRI A;  4E7I A;  1YNZ A;  3GOX A;  2M16 A;  4GLM A;  2E12 A;  2NWM A;  5LJ5 g;  2X3X D;  3MEV A;  4BD3 A;  3EFS A;  4OMM A;  5I2S A;  1SRM A;  2O9V A;  3L42 A;  1BI1 A;  4DEY A;  3OYD A;  3CC4 A;  2DNU A;  2CZ0 B;  1ABQ A;  1VQ4 A;  3MJX A;  5M9O A;  1WHH A;  4MZP A;  3G4S T;  1IXD A;  1N27 A;  1Y71 A;  3O8V A;  1YIJ T;  4M77 E;  2PVG B;  1I07 A;  2J7I A;  2QGG A;  3VS7 A;  1QP3 A;  1YJ9 A;  4D8D A;  3ZBD A;  1LCK A;  5A2Q E;  2KT8 A;  2RNA A;  3CBM A;  3HFN A;  3JSC A;  4QT7 A;  3BDL A;  2JXB A;  1XTD A;  4Z8A A;  5KE3 A;  4PK4 A;  2E3H A;  4EMK A;  1XNI A;  2LT4 A;  2C0I A;  1OU9 A;  4QVC A;  1MMG A;  2JVV A;  1UEC A;  3IQL A;  3V8J A;  3NHN A;  2DD5 A;  4GY5 A;  4A4K A;  4J5Y A;  2EQM A;  2KE9 A;  2KNB B;  3HPW A;  2LVM A;  3UF4 A;  4PJL A;  3I5R A;  5GAM f;  1FMW A;  3U23 A;  3S6W A;  5GAO q;  1QMC A;  1BIA A;  2VV5 A;  2GCX A;  1AWJ A;  4M77 F;  1K9A A;  4M7A C;  2MK5 A;  5IHK A;  4KH1 B;  3JCM h;  1KD1 U;  1VQM T;  3M4Y A;  1NE8 A;  5A0G A;  4J6Y A;  1GBQ A;  3RUX A;  2YSQ A;  4RG8 A;  3G4S Q;  2YUP A;  2EKO A;  2DD4 A;  1IHV A;  2QDY B;  1YIJ Q;  2COY A;  4PFO A;  3TSZ A;  2DKG A;  1IO6 A;  3A5Z B;  3CXC S;  3OB9 A;  3BFM A;  2DXC A;  2PTK A;  1BI2 A;  1M2V A;  2K3Y A;  2QYZ A;  4F7U A;  3PE0 A;  3J7A F;  2DFU A;  5FU6 B;  2K7A A;  2K4Y A;  4KBM B;  2NYS A;  1JU5 C;  1WLP B;  3P8H A;  1FMK A;  5HY6 A;  3CC2 T;  1I0C A;  1UJ0 A;  4CC2 A;  4ME7 A;  2CS7 A;  2ECZ A;  1WXT A;  4C8Q A;  1Q82 U;  1M30 A;  3L2W A;  1VQK T;  4LDV A;  4RTV A;  1D1C A;  2JW4 A;  3JCM d;  4E7L A;  3I56 A;  1QKX A;  4QVD A;  3RIR A;  4XU3 A;  2GTJ A;  3C0C A;  4LD6 A;  1J3T A;  3M0S A;  2QGF B;  3EFR A;  2DIL A;  3KXT A;  1QWF A;  1VQM Q;  5CIU A;  2AT1 B;  1K4U S;  3QBY A;  3OMG A;  4Y28 E;  1ARK A;  2V8I A;  3A8H B;  3E9F A;  7AT1 B;  4JUV A;  1S72 T;  2GFA A;  2RJE A;  2PU9 B;  4OB0 B;  1OYX A;  2A36 A;  1Y07 A;  2V8J A;  2KRM A;  1BBZ A;  3UDC A;  3LYI A;  4ZGJ B;  2C0O A;  2VKN A;  2DJQ A;  2OTL A;  1VQO T;  4HA8 A;  3L2V A;  4AFZ C;  2SEM A;  5AT1 B;  2X4X A;  1K0S A;  3JB9 H;  4GBQ A;  2D0N A;  2CP2 A;  1MHN A;  1NJI U;  3UPU A;  2ED0 A;  2RM4 A;  3PIO A;  1PCX A;  3CC2 Q;  2QQB A;  2CKK A;  5LL6 S;  3H0H A;  4F16 A;  3M54 A;  1K76 A;  2M0Y A;  4C0D B;  1X6G A;  3CMA T;  1VQK Q;  1WQ7 A;  8ATC B;  3HRU A;  4C92 B;  2BE7 D;  3EH1 A;  3VS6 A;  4M7D B;  1I81 A;  4NL3 A;  3MP1 A;  3QII A;  3L2Z A;  1ZSG A;  1W6X A;  3JCM e;  2VVK A;  3EAE A;  4BE0 A;  4JS5 A;  1M2O A;  3RDV A;  2CP0 A;  2COZ A;  1W70 A;  2RA2 A;  4OF1 A;  3CBO A;  4EMG A;  1S72 Q;  5FWB A;  4RMO A;  3ASK A;  2MF2 A;  3R6O A;  4KRT A;  1JJ2 S;  1CKA A;  2IIM A;  4KGV B;  2CZ7 B;  3V7C A;  3M59 A;  2WSF E;  1UGV A;  2LZ6 B;  4HCC A;  4F14 A;  1RLQ C;  4PJJ A;  5IAY A;  2LMJ A;  4AMC A;  1VQO Q;  1ZUU A;  4N0A C;  2CUB A;  2XDP A;  1M1K U;  2J6K A;  2SRC A;  4XK8 E;  4LDX A;  1RL2 A;  3O5Z A;  2LCC A;  3VUZ A;  5GAN h;  3CCQ T;  1KC8 U;  1N8R R;  4KT0 E;  1TWB A;  3VJP A;  5FLX E;  1QLY A;  3CMA Q;  1YI2 A;  2V1R A;  3JCM P;  2JZ2 A;  4XTV A;  3R6N A;  1GRI A;  5KYY A;  1VQ9 A;  1BB9 A;  4C8Q G;  5GAM j;  3SHW A;  1K1Z A;  2CH4 W;  1D3B B;  1WZO A;  4J9I A;  2HSE B;  2X4J A;  1CSK A;  4C8Q D;  3KUF A;  4PFP A;  2DXU A;  1RAA B;  5LJ5 h;  4RTY A;  2LJ1 A;  2E6N A;  3NFC A;  5L23 A;  2GF7 A;  1WDX A;  3X28 B;  2ABL A;  4M78 B;  4KGZ B;  1RAF B;  2FZG B;  1JXM A;  3H9N A;  2RQV A;  4R0K A;  5GAN d;  3CPW A;  4HVW A;  3X26 B;  4EPC A;  3SB2 A;  1I4K 1;  3QDR B;  1E6H A;  2E65 A;  2OI3 A;  2E64 A;  2HQX A;  1BU1 A;  2HMA A;  2LQ8 A;  4M77 A;  2LQN A;  1GFC A;  2DIQ A;  3TCJ A;  1DJ7 B;  2F1L A;  1HJD A;  3CCM T;  2R58 A;  4OMP A;  1K8A R;  4OMF B;  1D0Y A;  3CCS T;  1KHI A;  1YJN T;  1GL5 A;  2EIF A;  2O4X B;  3FJ5 A;  2M9U A;  4E2F B;  3CCR T;  2F2W A;  1WHJ A;  2L3P A;  5KYN A;  3TSW A;  2ZZD A;  3CCU T;  1Z9Q A;  2H3E B;  3OYI A;  1I1J A;  4IUP A;  4J9F A;  2CZ1 B;  1TSF A;  4RUG A;  4CC3 A;  1YIT T;  3OS0 A;  2F69 A;  1E6G A;  5GAN 8;  4BI4 A;  3PTA A;  3ME9 A;  2AZS A;  1OOT A;  2KDS A;  3LH0 A;  4E7J A;  4LUD A;  4RKU E;  4HXJ A;  2DEQ A;  2PVD B;  2DK3 A;  3MEU A;  1PC0 A;  4Z89 A;  2CDT A;  1UG1 A;  2K3B A;  2DER A;  3JCM W;  3M5A A;  1AOJ A;  1VA7 A;  4JRQ A;  4C8Q E;  5GAN e;  2KEA A;  4A63 B;  3LGF A;  3CCV A;  2HD0 A;  4N4I A;  2RK1 A;  2QTX A;  3V8K A;  2YRV A;  1X69 A;  2VGM A;  4N0A A;  2LX9 A;  3AT1 B;  3G6E A;  3CCM Q;  2J6O A;  2Y4Y A;  2M51 A;  3SDZ A;  2YRD A;  1VQL A;  3QJY A;  4F7U F;  1PM3 A;  3CME T;  2KSS A;  2I0N A;  1MND A;  4E47 A;  1UTI A;  3CCR Q;  1D0X A;  1I5L A;  1PRL C;  2A08 A;  4JPB W;  1A0N B;  4II1 A;  5EC7 A;  3CCU Q;  2EYQ A;  1JEG A;  5LJ5 e;  1NEB A;  3Q1J A;  2LDM A;  2DJZ A;  2WSE E;  3CCL T;  4C8Q F;  1G3S A;  3SWN B;  2RPN A;  2PUK B;  3FDR A;  3RES A;  1FX7 A;  1VIE A;  4NL2 A;  4AFQ C;  5KYX B;  2RO0 A;  1K8A C;  2IVW A;  3NPF A;  1K73 C;  2JM9 A;  2WSC E;  2OAU A;  4BUG A;  2GNC A;  1VQ8 A;  3GIB A;  4EMK C;  3PMI A;  2OTJ A;  1KD1 C;  1K9M C;  3G71 A;  5FRM A;  1SSF A;  1AD5 A;  1T3S A;  1GCP A;  3ZFJ A;  4XTW A;  3OYF A;  2MI6 A;  2YDL A;  1VQ4 T;  3OYG A;  5GMK i;  1H3Z A;  1QVG A;  2VXF A;  1E7O A;  3PMT A;  4RG2 A;  2QA4 T;  3H0I A;  5L8R E;  3CME Q;  4X34 A;  1YJ9 T;  2RHX A;  1G3W A;  3SEM A;  1M90 R;  2P0K A;  5GAO m;  1M5Q 1;  4JZ4 A;  2GBQ A;  5FRO A;  1Q95 G;  4A4G A;  1VQ6 A;  2EYW A;  3VV0 A;  2FB7 A;  4UC4 A;  1TS9 A;  3CCL Q;  4Y92 A;  2L0A A;  3M55 A;  3MPU B;  1Q82 C;  4AG2 C;  1RAC B;  4RTW A;  2JUF A;  1WX6 A;  5GAO r;  1FWZ A;  4A4F A;  5IH2 A;  3HRT A;  3DKM A;  2F2V A;  2RJF A;  3H8Z A;  1XOV A;  3N5B B;  1SG5 A;  3DLM A;  1YP5 A;  3OS5 A;  5KH6 A;  4N4G A;  5FU7 C;  4J9D A;  5GAN 5;  1YHQ A;  2E6Z A;  4YTL A;  5KYU B;  2DL5 A;  3A8M B;  1Q7Y R;  2X3W D;  4OML A;  4CRI A;  4HT8 A;  3FB9 A;  2K5L A;  3VS4 A;  2ZPB B;  1OZ3 A;  4C8Q C;  4EDU A;  3OW2 A;  4LDW A;  1VQ4 Q;  2AKL A;  2X35 A;  1QVF A;  5LJ3 j;  2K2M A;  1OEB A;  5HK3 A;  1PWT A;  2COW A;  3SD4 A;  1UHF A;  4AG1 C;  2QA4 Q;  4MDX A;  5CKH A;  5DM7 R;  1ZBX A;  2FPF A;  1ABO A;  1YJ9 Q;  2CP3 A;  5GAO n;  2X4W A;  4LD9 K;  4QVZ A;  3VYH B;  1N6A A;  3CCJ A;  2KR3 A;  2KRO A;  1UUE A;  4FYW B;  5FWC A;  3TRE A;  3GP8 A;  2LCS A;  4OP0 A;  3L2Q A;  1NPR A;  1RUW A;  3C12 A;  2HSP A;  2DA9 A;  3GLX A;  3RKX A;  2RK2 A;  3JCM b;  2B86 A;  4E7K A;  3KFV A;  4ZTJ A;  1X6O A;  1EZZ B;  3L2U A;  1X43 A;  2DVJ A;  5C0M A;  3QZ5 B;  4M7A B;  5HCK A;  2AIR B;  3CQT A;  4C92 G;  1AHJ B;  1M3A A;  3T9N A;  5LJ3 g;  3I56 T;  4M7D G;  1HD3 A;  3MET A;  4DQ2 A;  4BB7 A;  3CCE A;  2DEU A;  1SKU B;  2BUD A;  2FEI A;  3VRZ A;  1CKB A;  2ZAE A;  1WI7 A;  4C92 D;  5I2M A;  1WJQ A;  2RI2 A;  4IUV A;  1P92 A;  3X24 B;  1QCO A;  4M7D D;  4DOW A;  1OX9 A;  4QKU A;  2OAW A;  4QW2 A;  5GAN 7;  2PVO B;  2MIO A;  4RCC A;  2RHZ A;  1Z9Z A;  1M1K C;  1UGQ B;  1UGS B;  1NLO C;  1OPK A;  4FSX A;  3BY7 A;  2QQ9 A;  4JJD A;  1B07 A;  3MP8 A;  4ZGD B;  2HAX A;  1ZSZ A;  1V1C A;  2EYX A;  3G7Z A;  3OYA A;  1KC8 C;  1QCF A;  3OS2 A;  4XTZ A;  1K8A U;  2JNG A;  1K73 U;  4D8K A;  2O9S A;  1VQP A;  1V29 B;  2EGC A;  1M8M A;  5I22 A;  3QG1 A;  3WVE B;  1WHM A;  2XU8 A;  2CUD A;  3M0U A;  3ER0 A;  2E70 A;  4FT2 A;  2YWW A;  3OYC A;  3QHS A;  3CD6 T;  1K9M U;  1WQW A;  2K6D A;  3QZ9 B;  1X2K A;  1PKT A;  2MWP A;  3I56 Q;  1WJR A;  4DOV A;  2DZ9 A;  5GMK h;  2QQA A;  9ATC B;  1QW1 A;  2M02 A;  5HKC A;  2JMC A;  2YRC A;  1IRX A;  1BCO A;  4VUB A;  2M1H A;  4R56 A;  4JJN K;  2KRN A;  1VIF A;  1W1F A;  3GNF B;  3CPF A;  2XHC A;  2XIC A;  3X20 B;  2D8H A;  2P4R A;  3H41 A;  4E7S A;  3JCM f;  1MGQ A;  1VQN A;  2XMF A;  1SRL A;  4M78 G;  2VGN A;  3OYB A;  1F1B B;  3HHT B;  3UT1 A;  2KXD A;  4J9B A;  4BAC A;  5IXB A;  2DIG A;  4RTZ A;  2D6F A;  3OYY A;  3MEA A;  4OB1 B;  4C92 E;  1WNL A;  2RJD A;  1M3B A;  4NS5 A;  1C1A A;  4M7D E;  3LW5 E;  2V8K A;  1LVK A;  1WYX A;  4J6X A;  3CD6 Q;  3INZ A;  3UWN A;  2ED1 A;  2JT4 A;  4QQG A;  2NUP B;  3RR6 A;  1SPK A;  1YI2 T;  2DXT A;  1TU0 B;  4KH0 B;  5GMK m;  3G4S A;  4CC7 A;  2XG8 D;  4A54 A;  3HL8 A;  1VQ9 T;  3JCM V;  3EH2 A;  3E19 A;  5GAN 4;  2D8J A;  1NEG A;  1YIJ A;  2OX7 A;  1KIK A;  1AT1 B;  1MV3 A;  1TUC A;  2HNI A;  2R5M A;  2BTT A;  5CR2 A;  3MEW A;  2F5T X;  4M77 C;  4M75 A;  4C0Z A;  1W2B P;  3JCM J;  4J8O A;  2NUZ A;  2NUT B;  4C92 F;  2YLC A;  3EG9 B;  4M7D F;  2CH4 A;  2MAM A;  2BE9 B;  1VQ5 A;  3D7S B;  5FU6 C;  2ZCF B;  4Q5W A;  4HT9 A;  4OB2 B;  1KQS S;  1W2B A;  3FC3 A;  2O88 A;  2QI2 A;  4IUU A;  1BKB A;  1Y96 A;  1NBE B;  3PIP A;  1D0Z A;  4IIO A;  3JB9 G;  2RQU A;  5CCA A;  4BDY A;  1UE9 A;  1HSQ A;  3RMQ A;  1TUD A;  2DAQ A;  1EIF A;  3PVL A;  2LTO A;  1JO8 A;  1M90 U;  1OX8 A;  3JB9 D;  3EFO A;  1EFN A;  1VQM A;  3LGL A;  1RAI B;  3QXE B;  1YI2 Q;  3EG2 A;  3P8B B;  1WA7 A;  1VQ9 Q;  1UGP B;  2O01 E;  5GMK e;  2D0Q B;  3C94 A;  4B9X A;  2JTE A;  1ZHI A;  3MCA B;  1VQ7 A;  4LDU A;  2EQJ A;  1GFD A;  3VS3 A;  1AWW A;  2JS0 A;  2K9G A;  2E1H A;  2XID A;  2VWF A;  4PFZ A;  3WVD B;  4XU0 A;  1I5O B;  2KRS A;  1Q7Y U;  3EGD B;  5CVI A;  2P84 A;  1PNJ A;  4E6R A;  4PLI A;  2L2P A;  2A7Y A;  5J3B A;  1G83 A;  1Q86 R;  1WJS A;  3MHX A;  3RBB B;  3OYM A;  2FVU A;  2YT6 A;  2BZ8 A;  2X51 A;  2FPE A;  2XD0 A;  1ZUK A;  2ESW A;  4L59 A;  2JN0 A;  1QVF S;  1BYM A;  3M53 A;  4NOY A;  1X2Q A;  4PJO B;  2DYI A;  1FYN A;  2RF0 A;  2XDB A;  3I5S A;  2QK0 A;  3NTH A;  4PJM A;  5FRN A;  2EJG A;  1VOM A;  2DLP A;  1ZUY A;  2F2X A;  2G3R A;  4LUE A;  4M7D C;  1KK7 A;  3DB4 A;  3DLL A;  1OV3 A;  3HFO A;  2VUB A;  2GQV A;  3QWX X;  5GAN f;  3G6E T;  1AEY A;  1MMA A;  1NYG A;  3QJ6 A;  3PGG A;  4KUI A;  4JLG A;  2A28 A;  4J9G A;  4C5I A;  3OYE A;  1B34 B;  3EG3 A;  3GBQ A;  1N9R A;  2L3R A;  1UEB A;  3THK A;  1IGU A;  5KYW B;  5ECA A;  1VQO A;  4X1V A;  5GAN 6;  4XTU A;  3M0R A;  1XJW B;  8AT1 B;  2RB6 A;  3VUB A;  2DXB A;  4M75 G;  5LJ3 h;  1Q81 R;  2BZX A;  2YHT A;  3VRY A;  1ZQ1 A;  3M57 A;  5GAM g;  2A37 A;  3RMS A;  2DF6 A;  1ZBJ A;  3OS1 A;  4M75 D;  5LJ5 f;  2LNV A;  2HBP A;  2KVQ G;  1LPL A;  1U5S A;  2QDL A;  3CMA A;  5I11 A;  5J39 A;  2XK0 A;  3BDU A;  2LQK A;  5DLQ E;  1LJO A;  2KAF A;  2ZPE B;  2YXY A;  1N9S A;  5LJ5 d;  2EPD A;  3JB9 I;  5CO7 A;  1R0C B;  3CCV Q;  2O31 A;  2LRQ A;  3M0Q A;  1WFW A;  1RAE B;  5HK0 A;  3V7R A;  3JCM X;  2LCL A;  1NZ9 A;  3RKW A;  1N8R C;  3HKS A;  3G6E Q;  4J9H A;  2EAY A;  3JB9 F;  1Q86 C;  2XDD A;  3A1P A;  1AWO A;  4C5E A;  2RMO A;  2MCN A;  4PKC C;  2XI9 A;  5LJ3 d;  1PSF A;  1WHK A;  1M27 C;  4DA4 A;  3CXC P;  3QDF A;  1C6V X;  1VQ6 T;  4HVV A;  2XKO C;  4R55 A;  3C95 A;  2DE0 X;  2HQH A;  2VC8 A;  4ZN1 A;  3G1J A;  1HXD A;  2RI3 A;  4LE9 A;  5D6W A;  2QEX A;  3FRN A;  3CCQ A;  3QPH A;  3CXC A;  2RQR A;  4M7A G;  4EIK A;  2DX1 A;  3KBG A;  1T3L A;  4XTX A;  4E7H A;  3PT9 A;  4LDY A;  2RHI A;  5CAI A;  3L2R A;  3SFM A;  3UAT A;  2LQW A;  2K57 A;  5IT9 E;  2CT3 A;  5KCO A;  4L6V 5;  2JTM A;  1IRE B;  2FHD A;  4BY6 B;  4XU2 A;  3OYJ A;  1H64 1;  3AHU A;  1MNE A;  2YUO A;  4M75 E;  1PKS A;  1R8O B;  2FPD A;  2KT1 A;  5D6X A;  1BCM A;  1H8K A;  2E41 A;  4C92 A;  3CCJ T;  1HK9 A;  3OSV A;  3CBP A;  4ZGE B;  4M7D A;  1S1N A;  1VQ6 Q;  2LC4 A;  2KI7 A;  2CYZ B;  5LJ3 e;  1JB0 E;  3NMZ C;  4WF2 A;  2H3J A;  3HP9 A;  1H3H A;  1IHW A;  2Y4X A;  2IPO B;  1M2V B;  4PLL A;  1KQS P;  1EX4 A;  3S3N A;  4F7U B;  1X6B A;  3PNW C;  4M4Z A;  3CC4 T;  4PJN A;  1ZSZ C;  4BI8 B;  4DBF A;  4JRK A;  2EQI A;  1FXX A;  4MDW A;  5IHN A;  5GJV B;  1TG0 A;  3CCM A;  1VUB A;  4M75 F;  2QAZ A;  2EVR A;  1UDL A;  2RI5 A;  2AK5 A;  3M0P A;  3CCS A;  1YJN A;  3TU4 K;  4ORZ A;  5CKE A;  2CP5 A;  1U8R A;  1RAH B;  3QUI A;  5GAN 2;  4B6M A;  1JJ2 P;  1SHF A;  5IHI A;  2MPX C;  2RJC A;  4O6J A;  5GAO p;  1YIT A;  4JDS A;  1W4S A;  2G6F X;  2VB6 A;  3JB9 J;  1T0J A;  1WIE A;  5GAN j;  2HL3 A;  1U1S A;  2RQT A;  3SWN C;  3CCJ Q;  4IUR A;  5AYF A;  1BI0 A;  3VU3 C;  3JV3 A;  1PG5 B;  2LP5 A;  1D3B A;  1JJ2 A;  3F70 A;  2ENM A;  3HTR A;  1XQH A;  4FYX B;  3H0F A;  1D09 B;  1KFZ A;  3VS2 A;  5A0D A;  2WAC A;  3CC4 Q;  2EQK A;  2KGT A;  4DBH A;  4FT4 A;  4M78 A;  4AT1 B;  1YJW A;  4JLI A;  2E4H A;  2MMP A;  1ZA2 B;  4K11 A;  1N8R U;  1Q86 U;  2ZPH B;  2NLU A;  2MWO A;  4FW2 A;  3RKY A;  3M58 A;  2KYB A;  4JJB A;  3M56 A;  3RER A;  1U3O A;  2RHY A;  3VYG A;  1RAD B;  1U06 A;  4RTT A;  4X9D A;  4M75 C;  2CP6 A;  4XQ3 A;  2CSI A;  3GF5 A;  4KUD K;  1ZLM A;  5DY9 A;  2O2O A;  4E7Z A;  2O4X A;  1M90 C;  2LJ3 A;  2F5K A;  3J81 E;  2RN8 A;  4A4H A;  1TUG B;  3OBY A;  5GMK l;  1VQP Q;  4IUT A;  3I55 A;  2LJ0 A;  2GQI A;  5DLO A; 
#chains in the Genus database with same CATH homology
 2EYY A;  1AVZ C;  2BTT A;  1SEM A;  1UHC A;  1JXM A;  2RQV A;  4R0K A;  2NUZ A;  2EW3 A;  4HVW A;  4J9C A;  2BZY A;  4HCK A;  1E6H A;  1PHT A;  1T0H A;  2CH4 A;  3REA B;  2OI3 A;  2JM8 A;  1BU1 A;  1VYV A;  2J06 A;  2O88 A;  2LQN A;  1GFC A;  4JZ3 A;  1HJD A;  4IIO A;  2CT4 A;  2RQU A;  4OMP A;  2CRE A;  2KXC A;  1UE9 A;  1N5Z A;  4F17 A;  1HSQ A;  1GL5 A;  1TUD A;  3PVL A;  1JO8 A;  1Y0M A;  3FJ5 A;  4OMO A;  3VS1 A;  2F2W A;  1EFN A;  1NG2 A;  1VYT A;  2GTO A;  2L3P A;  3TSW A;  1Z9Q A;  1WXB A;  4AFU C;  3EG2 A;  1SSH A;  4DEX A;  2HCK A;  1WA7 A;  1I1J A;  2V1Q A;  4J9F A;  4RUG A;  1X27 A;  4CC3 A;  2JTE A;  2PZ1 A;  1E6G A;  2DBK A;  4JJC A;  2GGR A;  2AZS A;  1OOT A;  1GFD A;  3VS3 A;  1AWW A;  2DBM A;  4LUD A;  2JS0 A;  4HXJ A;  3RNJ A;  4ESR A;  2FO0 A;  2K9G A;  2VWF A;  3EG1 A;  4Z89 A;  1RLP C;  2CDT A;  2J6F A;  1UG1 A;  2K3B A;  2DYB A;  3UA6 A;  1AZG B;  2KRS A;  1AOJ A;  1VA7 A;  3M0T A;  1PNJ A;  2KEA A;  4RTU A;  4A63 B;  4E6R A;  2YUQ A;  1PRM C;  2L2P A;  2FRY A;  2DL4 A;  1G83 A;  3RBB B;  4LNP A;  2FG0 A;  2YT6 A;  2BZ8 A;  1X69 A;  2FPE A;  2AZV A;  2H8H A;  4OMN A;  1ZUK A;  2ESW A;  2J6O A;  3LH5 A;  2HDA A;  2M51 A;  3NGP A;  1X2Q A;  3TVT A;  2KBT A;  2DRK A;  1WXU A;  1H92 A;  2EGA A;  1FYN A;  2RF0 A;  3I5S A;  2CSQ A;  2I0N A;  3EGU A;  1UTI A;  1AZE A;  2DLP A;  3UA7 A;  1A0N B;  1PRL C;  2A08 A;  4JPB W;  1ZUY A;  2F2X A;  4LUE A;  1Y57 A;  3EHQ A;  5EC7 A;  1YNZ A;  1JEG A;  2AKK A;  1OV3 A;  3QWX X;  4GLM A;  1NEB A;  2DRM A;  2NWM A;  1AEY A;  1NYG A;  3ULR B;  2MOX A;  2X3X D;  1MV0 B;  2RPN A;  2A28 A;  4OMM A;  4J9G A;  1SRM A;  3GBQ A;  3EG3 A;  4ZNX A;  2JMA A;  3THK A;  4AFQ C;  3NPF A;  2O9V A;  2L3Q A;  5ECA A;  2JM9 A;  4X1V A;  4J9E A;  4DEY A;  2DNU A;  3M0R A;  2GNC A;  1ABQ A;  4FSS A;  5GJW B;  2BZX A;  3VRY A;  1I07 A;  1T3S A;  1AD5 A;  2J7I A;  2A37 A;  3VS7 A;  1GCP A;  2DF6 A;  1JQQ A;  4D8D A;  1ZBJ A;  1BK2 A;  1LCK A;  2DL8 A;  2KT8 A;  2RNA A;  2YDL A;  1U5S A;  2QDL A;  4QT7 A;  2JXB A;  5I11 A;  4Z8A A;  1E7O A;  2C0I A;  1K0X A;  3H0I A;  1UEC A;  3IQL A;  2ROL A;  2EPD A;  3NHN A;  3PVQ A;  4RTX A;  3SEM A;  2O31 A;  3M0Q A;  1WFW A;  2KE9 A;  2KNB B;  2GBQ A;  4JZ4 A;  3VS0 A;  3UF4 A;  2EYW A;  3I5R A;  1VYU A;  3U23 A;  4J9H A;  1AWJ A;  1K9A A;  4Y92 A;  2L0A A;  4AG2 C;  1AWO A;  4RTW A;  1JXO A;  1WX6 A;  2E5K A;  2RMO A;  2MCN A;  5IH2 A;  1M27 C;  5IHK A;  2F2V A;  3REB B;  1XOV A;  1YP5 A;  1GBQ A;  1GCQ C;  2YSQ A;  4HVV A;  2DE0 X;  3I35 A;  2YUP A;  4J9D A;  4LE9 A;  2DL5 A;  1YN8 A;  2X3W D;  4OML A;  3TSZ A;  1IO6 A;  3VS4 A;  2KYM A;  2RQR A;  2JS2 A;  4HVU A;  4EIK A;  2ROT A;  2PTK A;  2DX1 A;  2AKL A;  1T3L A;  3VS5 A;  3PE0 A;  2W10 A;  2C0T A;  2K2M A;  1OEB A;  2K7A A;  2HEQ A;  1AWX A;  2YUN A;  1PWT A;  2EGE A;  1JU5 C;  1WLP B;  1FMK A;  1UHF A;  1KSW A;  3UAT A;  4AG1 C;  2LQW A;  2FPF A;  1ABO A;  1I0C A;  1UJ0 A;  2CT3 A;  2LNH B;  1UJY A;  1NLP C;  4CC2 A;  2KR3 A;  2KRO A;  2ECZ A;  1UUE A;  1WXT A;  5FWC A;  1GBR A;  1M30 A;  2LCS A;  4RTV A;  1NM7 A;  1RUW A;  2DMO A;  2JW4 A;  2HSP A;  2DA9 A;  1QKX A;  2YUO A;  1PKS A;  2J05 A;  2B86 A;  2GTJ A;  2FRW A;  2FPD A;  3KFV A;  3C0C A;  2KT1 A;  1QKW A;  1J3T A;  2EKH A;  3M0S A;  1H8K A;  2DIL A;  1QWF A;  1MUZ A;  1X43 A;  2DVJ A;  1K4U S;  4Z88 A;  1S1N A;  5HCK A;  1ARK A;  3CQT A;  1M3A A;  3NMZ C;  2A36 A;  1HD3 A;  1H3H A;  2KRM A;  4OMQ A;  2EYZ A;  1BBZ A;  1M3C A;  1X6B A;  2FEI A;  3VRZ A;  1CKB A;  1ZX6 A;  4M4Z A;  1WI7 A;  2C0O A;  2VKN A;  2DJQ A;  1B3Q A;  4AFZ C;  2SEM A;  1K0S A;  2EQI A;  1NYF A;  4GBQ A;  5IHN A;  2LX7 A;  1YCS B;  5GJV B;  1TG0 A;  1G2B A;  2D0N A;  3EG0 A;  4CC4 B;  2EVR A;  1UDL A;  1UFF A;  2AK5 A;  3M0P A;  2ED0 A;  2OAW A;  2K79 A;  3I9Q A;  2MIO A;  2DL7 A;  1Z9Z A;  4ORZ A;  1OPK A;  1NLO C;  3H0H A;  4F16 A;  4JJD A;  1B07 A;  1K76 A;  2L3S A;  2M0Y A;  1X6G A;  1YWP A;  1V1C A;  2EYX A;  1QCF A;  1SHF A;  5IHI A;  1SHG A;  2O9S A;  4D8K A;  2G6F X;  2EGC A;  3VS6 A;  1M8M A;  5I22 A;  1T0J A;  1WIE A;  1ZSG A;  2RQT A;  2CUD A;  4WCI A;  4AFS C;  1W6X A;  3M0U A;  2OJ2 A;  2VVK A;  3QWY A;  1KJW A;  3JV3 A;  2LP5 A;  2RQW A;  1W70 A;  2K6D A;  1QWE A;  5FWB A;  1X2K A;  1PKT A;  5IXF A;  2EBP A;  2ENM A;  1OPL A;  4KRT A;  1CKA A;  4LN2 A;  2IIM A;  3H0F A;  2JMC A;  1UGV A;  5FW9 A;  2LZ6 B;  4F14 A;  1RLQ C;  2LMJ A;  1KFZ A;  3VS2 A;  2HBW A;  2KRN A;  1ZUU A;  1W1F A;  3ZL7 C;  1RI9 A;  2KGT A;  2CUB A;  1GCQ A;  3A98 A;  2D8H A;  2D1X A;  2J6K A;  2SRC A;  2P4R A;  3H41 A;  2XMF A;  3O5Z A;  1SRL A;  4K11 A;  2PNI A;  2DL3 A;  2KXD A;  2KYB A;  4J9B A;  1QLY A;  2V1R A;  4JJB A;  5IXB A;  3EHR A;  1GRI A;  3R6N A;  1U3O A;  4RTZ A;  1BB9 A;  1U06 A;  4RTT A;  3SHW A;  1M3B A;  1K1Z A;  2CH4 W;  4J9I A;  1WYX A;  1CSK A;  2CSI A;  4IIM A;  2W0Z A;  2ED1 A;  2JT4 A;  1ZLM A;  1SPK A;  2O2O A;  2DM1 A;  4CC7 A;  2LJ3 A;  4RTY A;  2LJ1 A;  1YWO A;  2D8J A;  5L23 A;  2RN8 A;  1NEG A;  1KIK A;  1MV3 A;  2LJ0 A;  1WDX A;  1TUC A;  2GQI A;  2ABL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...