1G2BA

Alpha-spectrin src homology 3 domain, circular permutant, cut at n47-d48
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
b'MDRQGFVPAAYVKKLDSGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
publication title Atomic resolution structure of a mutant of the spectrin SH3 domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal binding protein
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2000-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1g2bA00
1VYUA 1GFDA 3M0RA 4AG2C 4CC2A 2YSQA 1PRLC 1Z9ZA 2M0YA 4DEXA 2BZYA 2KNBB 4R0KA 2O9VA 1SPKA 4RTYA 4J9DA 2EYYA 2AK5A 2GBQA 4CC4B 3VS0A 2EYZA 2YDLA 3H41A 5FWCA 1GL5A 2DRMA 4J9CA 2K3BA 2K6DA 1HSQA 4RTTA 1M3BA 5IHIA 4IIMA 2M51A 2AZSA 1BB9A 2KE9A 4LUEA 1WDXA 2RQWA 1V1CA 2PZ1A 3TVTA 2K79A 2DL4A 2RPNA 1BK2A 4ESRA 2LJ1A 1QWFA 2LP5A 4JJBA 2FPDA 2ESWA 4AG1C 2CDTA 2KYMA 1YN8A 2AKLA 4LN2A 2BZXA 2JMAA 1RI9A 1E6HA 4AFUC 1UG1A 2HCKA 2FRWA 2FPEA 1CKBA 1A0NB 2ROTA 2A28A 2K2MA 2KYBA 1T3LA 1VYTA 2RQRA 3EHRA 2DVJA 2YUPA 3H0IA 2A37A 2H8HA 1OOTA 1VA7A 1UJ0A 3H0FA 3NMZC 3EG0A 2DL3A 1WI7A 2GQIA 1WA7A 1UGVA 2DM1A 5GJVB 1WFWA 2CUDA 3VS1A 3RNJA 3UATA 3SEMA 4HVUA 1I07A 1UHFA 2DL7A 2ECZA 1PWTA 3EG3A 3ULRB 1T3SA 5IHKA 1E7OA 2KR3A 2BTTA 4ORZA 1SHGA 2O31A 2EVRA 1AD5A 4RTUA 2JTEA 1PNJA 4Z8AA 4D8KA 4J9IA 3I35A 1S1NA 1HD3A 3UA7A 2L0AA 1PKSA 1CKAA 5GJWB 2CSQA 1NLPC 2L3PA 2YUOA 2V1RA 3VS2A 4AFSC 1SRLA 2X3XD 1OV3A 2ED1A 2GTJA 4AFQC 2JW4A 1I0CA 2KRMA 3VS7A 1KIKA 1GCQC 1UE9A 2MOXA 1B3QA 2XMFA 1NYFA 2DRKA 1FYNA 2ABLA 2RQTA 1PRMC 1QKWA 4F14A 2JM8A 3REBB 2W10A 3VS3A 2KEAA 3M0TA 4M4ZA 3I5RA 1IO6A 3QWYA 1AVZC 1WLPB 2KRSA 4OMQA 2CSIA 2LQWA 4KRTA 3R6NA 3KFVA 1M8MA 5ECAA 4J9HA 2IIMA 1ZX6A 2MCNA 2RNAA 3PE0A 5IXFA 1QLYA 1WIEA 1GFCA 4JZ4A 3LH5A 2OAWA 1XOVA 3CQTA 3UF4A 1WXTA 1YWOA 1ZUUA 2PNIA 2CT3A 2EYWA 4Y92A 2LX7A 2DMOA 1QCFA 2E5KA 3EGUA 3NGPA 2YUNA 2EKHA 2LNHB 1TUDA 1NEBA 2D8HA 4HXJA 1M30A 5FW9A 5IH2A 1X27A 2ENMA 2EGEA 2CH4W 1M3AA 4CC3A 1RUWA 3EG1A 4JPBW 3C0CA 1BBZA 2CH4A 2OI3A 1UECA 4OMPA 1Y0MA 5IXBA 3EHQA 2JS2A 3M0SA 2HDAA 4DEYA 1PHTA 2L3QA 1GBRA 1AWJA 1X2KA 2VWFA 2NUZA 4X1VA 1KSWA 1ARKA 3JV3A 1UDLA 2CUBA 2JM9A 2DLPA 4J9BA 5IHNA 2FEIA 1G2BA 1UJYA 4A63B 2LMJA 3I5SA 2JT4A 1NYGA 4RUGA 3ZL7C 2F2VA 1MV0B 1K4US 1YP5A 1AZEA 1ZUKA 2DA9A 4LUDA 3THKA 4E6RA 5EC7A 4JJDA 3UA6A 4J9EA 2HSPA 1SEMA 2RN8A 1YWPA 2RQUA 2HEQA 1T0JA 2HBWA 1U06A 2QDLA 1YCSB 2J6FA 2RQVA 1X69A 2CT4A 3TSZA 1K9AA 4ZNXA 2J6OA 1GCPA 4HVWA 2LZ6B 2K9GA 1OPKA 5I11A 1T0HA 1NLOC 2FO0A 2CREA 1X2QA 2EBPA 4OMNA 1UHCA 2DL5A 3EG2A 1MUZA 2KRNA 3VS5A 1N5ZA 4OMLA 1AOJA 2J6KA 1ABQA 1U5SA 2EGCA 2I0NA 2JS0A 3O5ZA 1K0SA 1EFNA 1J3TA 1M27C 1SHFA 1TG0A 4RTXA 2GNCA 1H3HA 1MV3A 2SEMA 1K1ZA 2FPFA 2EW3A 4LNPA 1X6BA 2D1XA 2KXCA 1G83A 2LQNA 1U3OA 1WXBA 2EYXA 1GRIA 2J7IA 1UFFA 2FG0A 2KBTA 2KT8A 1NM7A 1NG2A 2KT1A 4OMOA 1SRMA 2MIOA 4WCIA 1KFZA 2DL8A 2B86A 1JO8A 1I1JA 2RMOA 2AZVA 5L23A 4F16A 1VYVA 3I9QA 1WXUA 4RTVA 1K76A 1H92A 4LE9A 1GBQA 2L2PA 1RLQC 3NHNA 1BU1A 4IIOA 1WX6A 2OJ2A 1AZGB 4OMMA 3SHWA 2C0TA 2O88A 2GTOA 1JXMA 3A98A 3H0HA 1TUCA 2NWMA 2V1QA 2D8JA 2KGTA 4F17A 1Y57A 2DILA 2SRCA 3U23A 3TSWA 2C0OA 2LJ0A 1HJDA 3M0PA 2ED0A 1B07A 1X43A 4JZ3A 2G6FX 4Z89A 2DYBA 2L3SA 1PKTA 1UTIA 4J9GA 2PTKA 2EPDA 4EIKA 2J06A 3NPFA 2ROLA 3M0QA 1LCKA 2FRYA 4AFZC 1H8KA 2DBKA 2DX1A 2O2OA 3GBQA 1CSKA 1ZLMA 3VS4A 2DF6A 2EGAA 2YT6A 1ABOA 2JMCA 2X3WD 2RF0A 2YUQA 1QWEA 2A08A 4Z88A 5FWBA 3QWXX 4D8DA 4HCKA 2KROA 1ZSGA 2JXBA 1QKXA 1JXOA 3RBBB 1ZUYA 4JJCA 2BZ8A 1GCQA 2VKNA 4CC7A 2DNUA 2LCSA 1WYXA 3VRZA 2AKKA 1JQQA 2F2XA 4QT7A 1SSHA 4HVVA 2J05A 1W70A 2GGRA 2LJ3A 4RTWA 1ZBJA 1OEBA 2F2WA 5I22A 2P4RA 5HCKA 3VRYA 1FMKA 3FJ5A 2DBMA 4RTZA 1W6XA 1X6GA 2C0IA 4GBQA 2EQIA 2O9SA 1KJWA 3M0UA 2A36A 2KXDA 4J9FA 1W1FA 1AWOA 1JEGA 2DJQA 1AWXA 2W0ZA 1NEGA 1AWWA 3PVLA 1UUEA 3PVQA 4K11A 3VS6A 1Z9QA 3IQLA 1M3CA 1JU5C 2K7AA 2D0NA 2VVKA 1K0XA 1AEYA 3REAB 1E6GA 4GLMA 4FSSA 2DE0X 1OPLA 1YNZA 1RLPC
chains in the Genus database with same CATH superfamily
4CC2A 1U1TA 2LC4A 5GAN8 3SB2A 2M0YA 4DEXA 2KNBB 4C92G 3L1AA 3L2QA 3CC7A 1MMGA 2AK5A 1XTDA 2MWOA 5GAMh 3OS1A 3VS0A 2EYZA 1QMCA 3GNGA 1IRXA 4C8QA 4M77F 2DRMA 5HK0A 4BDZA 4L6V5 2RHYA 5IHIA 1KC8C 4FIBA 1WDXA 3OYBA 5CIUA 1V1CA 4PFOA 2MK5A 3X24B 3JCMJ 3CC2T 1BK2A 3V7RA 3JCMe 2EWNA 2JJ9A 1VQKA 2DETA 3CC2A 2GFAA 1NE8A 3QPHA 4XTZA 1Q86C 4C5GA 4NL2A 2BZXA 1YJWQ 1RI9A 4EPCA 2OTJT 3M55A 3PTAA 2FPEA 3QUIA 4C8QC 2A28A 2KYBA 3V8KA 3G4SA 4QVZA 2OTJA 4XU1A 3EHRA 2DVJA 2YUPA 3OYDA 2JNGA 1VA7A 2XKOC 3H0FA 3JCMX 2GQIA 4M77E 1WFWA 2CZ6B 3MEVA 1X6OA 2X9HA 4C5EA 5KCOA 2FVUA 1W4SA 1PWTA 2IG0A 1KQSS 2QQ9A 4C8QG 4TVRA 1VQ7Q 2BTTA 1D3BB 1AD5A 1PNJA 4L59A 4LXCA 4D8KA 1OU9A 4J9IA 2Y4XA 3UA7A 2B8AA 4IUTA 4OF1A 1CKAA 4V2SA 3MEAA 2RHIA 3CXCS 4M7AD 3VS2A 4AFSC 4MZPA 2EJGA 1SRLA 1TWBA 1OV3A 1Q81U 1M8VA 2DXUA 2KRMA 4YTLA 1B3QA 2KQWA 3LLRA 4QQGA 2ABLA 1BIAA 1VQPA 3UPUA 2BE9B 2W10A 3VV0A 3M56A 4M78A 2JTMA 1KD1C 1RL2A 3QO3A 2GFUA 1VQLQ 2DEQA 4JDSA 1IREB 3R6NA 1VQ8Q 4HKEA 4RCBA 5ECAA 5KYUA 4FW2A 2KMTA 1K73U 1VQ4T 4PLIA 3HRTA 1VQ9T 3PE0A 3MO8A 3JCMc 1LNXA 2EQUA 5IXFA 1VQ4A 5CKDA 3JAME 2HL3A 1VQ9A 3UF4A 1WXTA 3M57A 2CT3A 3O8VA 5M9OA 1S72Q 2EYWA 1OULA 4FL6A 4J5YA 1M1GA 2VC8A 4ZTFA 1M1KU 2COZA 1H3ZA 3NGPA 4KULA 2E70A 4ZGDB 3QHSA 3S6WA 2M9UA 1NEBA 2YXYA 4HXJA 4OGEA 5FW9A 5IH2A 1X27A 5LJ5j 1N6AA 1M3AA 1TSFA 3QJ6A 4RCCA 1RUWA 3X20B 2CS7A 1BBZA 1RAGB 4N4IA 5LJ3d 1HYOA 2PU9B 2JVVA 4C0FA 2MAMA 1Y0MA 4LD9K 3HP9A 4BE0A 3C95A 2XDPA 1Y7XA 3RESA 2VWFA 4X1VA 4M78G 1G5VA 3G6ET 1OYXA 1QVFP 2D6FA 2CUBA 3EGXA 2CZ1B 5IHNA 4DBFA 1G2BA 3QXEB 3WVDB 4A63B 4M7AF 4FYYB 4ELYC 4RUGA 3X25B 3TCJA 1YJ9T 5GAN3 4E7SA 3CMET 2E65A 1KK7A 4E6RA 2HZYA 4J9EA 3CCMQ 3ZBDA 3PNWC 2RN8A 1YWPA 1M90R 5A2QE 4C92D 1I81A 4DA4A 1TOVA 4BY6B 3UDCA 4IKFA 3A8GB 2P0QA 1YHQA 3OYAA 3OSSC 2QEXA 2CT4A 2J6OA 3LW5E 2QA4A 2K5IA 2CKKA 1RI0A 2V8JA 1X2QA 1K9MR 1M1FA 2EBPA 4OMNA 2LQ8A 1UHCA 1MUZA 1QVFA 4X34A 1QQJA 2LNVA 1KC8U 2X4WA 1ABQA 2EGCA 4R55A 1VQ5T 4CI0C 3JCMW 1SHFA 4C0GA 4M7AE 2RJFA 4A4HA 5FU6B 1H3HA 2K57A 1VQ5A 2FPFA 2R5MA 2D9TA 3A8LB 4LD6A 5J26A 2H3EB 1Q86U 2L3RA 1YJWT 2E1HA 3VJPA 2BE7D 1SRMA 2FZKB 2MIOA 4CRIA 1KFZA 2DL8A 2YLBA 1JJ2P 3KUFA 1TU0B 3CD6T 5GAOq 5L23A 4FSXA 1Q82C 2GQVA 5LJ5e 3I9QA 2NUPA 2XG8D 2ZGWA 3HHTB 2ZPEB 1K76A 4QKUA 3CD6A 3GIBA 1IGQA 3L2UA 3NHNA 4BI4A 5LJ3f 4KUIA 1WX6A 2OJ2A 4ZGJB 3NTIA 3GP8A 3GNFB 4C8QD 4X9CA 3H0HA 1O75A 3TEEA 4F17A 2XDBA 2SRCA 3M0PA 4ZGEB 1GXIE 2ZPGB 4HCBA 4J8OA 4Z89A 3DKMA 2DYBA 3QYGB 5LJ5g 1PKTA 2JN0A 2EAYA 2EPDA 4DBHA 4E7KA 3GBQA 1ZLMA 2X35A 3VS4A 2DF6A 1BI3A 1JJ2A 2X3WD 2RF0A 2X4YA 3I56Q 1N9SA 5I21A 3QWXX 2V8IA 2RJDA 3CCVT 5GAN2 1QKXA 2BZ8A 5KYWA 4BACA 3CMAT 1GCQA 4A4KA 2VUBA 4DOWA 1N8RC 3CCVA 2RI2A 3OA6A 3VRZA 1G3TA 3CMAA 1BCOA 2F2XA 2EQKA 5LJ5h 2J05A 2K5LA 1W70A 3DLMA 2LJ3A 3X26B 3CCJA 3OW2A 3LYIA 1OEBA 1V76A 1YFNA 2WACA 2DERA 1KD1U 3VRYA 3NFCA 4MDXA 3CC4Q 2DBMA 4C0ZA 2DD4A 1X6GA 1W1FA 1AWOA 1VQ8T 3NTHA 1X75C 1G3YA 2W0ZA 4M7DF 5IT9E 3PVQA 5GAOm 4K11A 4MDWA 3MEWA 1VQ8A 4C92E 2D0NA 4BE2A 2EJ9A 4C0DB 2GCXA 1Y07A 8ATCB 3REAB 1O9SA 2DE0X 3ZFJA 1MMDA 4BDYA 2HQXA 4RTYA 2GBQA 4N0AA 2X51A 1LPLA 1ACMB 3M4GA 1C6VX 2YDLA 3JCMb 5FWCA 1GL5A 3BDUA 4OP0A 4J9CA 4WTOB 2E4HA 4EMGA 2K3BA 1OZ2A 4DQ2A 3CXCP 4IIMA 2AZSA 4FYWB 1BB9A 4LUEA 3CCLA 1VQOQ 2PZ1A 2DL4A 1IHVA 3OYMA 4FT4A 3DB4A 4JJBA 3E9GA 4AG1C 2ESWA 3L2ZA 1VUBA 2A7YA 1EIFA 3MKDA 1QP2A 3RMSA 1YN8A 2JMAA 4E7HA 4N0AC 4BD3A 4KGVB 2FRWA 3N5BB 1TTHB 2ROTA 1B7TA 3CCUQ 2K2MA 1T3LA 4LDWA 3C12A 2RQRA 4MMLA 2LRQA 2A37A 3CCRQ 1Q7YC 3QZ9B 2P0KA 1UJ0A 3FC3A 5HKCA 2M16A 3OS2A 4M75C 2DL3A 4C8QE 3QKJA 6AT1B 5CKEA 3RNJA 2RO0A 1D1CA 1PCXA 5GMKl 4M7DB 3META 4II1A 1RAIB 4XU3A 2CP6A 1C1AA 2LT1A 1I07A 3X28B 1YIJA 1T3SA 2KR3A 4ORZA 1MNDA 3OSVA 4ELZC 4Q5WA 4MMKA 3VUBA 4E47A 3I35A 1S1NA 1RAEB 2EQJA 2L0AA 1PKSA 1RAHB 2EJFA 2CSQA 1NLPC 2ZPIB 3EGDA 2YUOA 4QVCA 2WSCE 2V1RA 2OTLQ 2X3XD 2ED1A 5D6XA 4AFQC 2JW4A 3MEUA 3CCSQ 5CQYA 1C0MA 2WSFE 3HPWA 1UE9A 2XMFA 1VQ6Q 4A4GA 4XTUA 2MMPA 4F14A 1IZ6A 1X01A 3A1PA 1Q82U 1KHIA 2XK0A 3BDLA 1ZSZB 2Z0WA 3M0TA 4M4ZA 2DK3A 1IO6A 3QWYA 1WZOA 3CBPA 4DOVA 1ZA1B 3HKSA 2LQWA 3KFVA 4HCZA 1K8AR 4IUVA 5CO7A 2VGNA 4XQ3A 1ZX6A 4N4HA 3ME9A 5D6YA 3OS5A 1EX4A 2HBPA 5DM7R 1R0CB 1OX9A 4NOYA 3ER0A 1WIEA 1GFCA 2D0QB 1XOVA 3CQTA 3QZ5B 5KYXB 3EFSA 4PJOB 4OGCA 2LX7A 3H9NA 2DMOA 3EGUA 3CCEQ 3EH1A 3NTKA 5DLQE 2EKHA 2RM4A 2F5KA 3RKYA 2LNHB 3CPWS 1TUDA 3M9QA 2H3JA 4BI3A 4E7LA 3I56T 3OYNA 2L5QA 5GANd 3HTRA 1HXDA 5FRNA 3EG1A 3SDZA 5DLOA 1U8RA 1N8RU 2EYQA 2OI3A 3Q1JA 4OMPA 3JCMg 4WF2A 1ZSZA 1R8OB 3MP8A 5IXBA 1SG5A 5FRMA 4DEYA 2P84A 2AT1B 1M5Q1 3LH0A 1YITQ 1KSWA 1M2VB 3JV3A 2FHDA 4J9BA 3CC4T 1NZ9A 1EZZB 1KHCA 2CP7A 2HNIA 2VGMA 1NYGA 2C06A 1UGPB 1ZUKA 3T9NA 1AZEA 4LUDA 2CP3A 1B34B 3THKA 3S3MA 4PJOA 4JJDA 1YJNQ 1YI2Q 2HSPA 1SEMA 3CCQQ 3PIPA 3JCMh 4J6WA 3TU4K 3HSBA 1TH7A 1WNLA 2HBWA 3J80E 5IN1A 4IUQA 2RQVA 1RAAB 3TSZA 4M77B 3VKIA 1I5LA 1FMWA 5FU7B 1SKUB 1OI1A 4OB2B 2FB7A 2DZ9A 2FO0A 2CREA 2RJEA 5CKFA 3EG2A 2KRNA 3VS5A 1VIEA 2QTVA 3H8ZA 4DBQA 2XU8A 1FMVA 5GAOr 1LVKA 2A0FB 2JS0A 4HT9A 3QJYA 5DY9A 1M27C 1VQOT 2E64A 5CR2A 2SEMA 1BI2A 3MJXA 1K1ZA 3F70A 1X6BA 2JUFA 2D1XA 3M59A 1ZQ1A 1D3BA 2LQNA 3OYYA 1WXBA 1W2BS 2CGHA 1IB8A 1PD0A 3BE3A 1NG2A 2KT1A 2DAQA 4DBRA 3HFOA 2ZPFB 4WCIA 4PJOG 4Z02A 1JO8A 3VYHB 1QCOA 1QW1A 3FJPA 4M77A 2RMOA 4M78C 2O4XB 4GLKA 1Q7YU 1VYVA 2DO3A 3C4SA 3CCRT 1WXUA 3E2UA 3M5AA 3VU3C 5LJ3j 5GANf 1RLQC 3I55Q 3CPFA 4VUBA 4RG8A 4IIOA 2HQEA 2NUTB 3SD4A 2O88A 2DIQA 3A98A 2HSEB 3TSWA 1HJDA 3AHUA 2ED0A 1B07A 4JZ3A 5CCAA 1MMNA 2G6FX 5A0LA 2L3SA 4M75D 3LX7A 3V8JA 1UTIA 4EIKA 4ANJA 3P8DA 2DZCA 3V8LA 4AFZC 1H8KA 3TREA 1R0BG 3UWNA 1CSKA 3JCMV 2YT6A 3G6EA 3JB9G 2YUQA 3AT1B 2ZZDA 2ZPBB 4E7ZA 4Z88A 2XI9A 1HK9A 4HCKA 1NBEB 3CCST 1ZA2B 4E7IA 1ZUYA 1Q81R 2DIGA 4PJLA 3OY9A 4QVDA 3JRZA 4CC7A 1YJ9A 4D6WA 3CMEA 1UEBA 1WYXA 1QVGP 1IHWA 1N27A 1KQ2A 1VQ6T 5CK9A 4JUVA 4J6XA 3TQ7P 1VQMT 2AKKA 4QT7A 1Y71A 4M77G 1SSHA 2GGRA 2DEUA 4QW2A 5I22A 3L2VA 1TUGB 1VQMA 3HFNA 3RR6A 3G71Q 2HMAA 2DXCA 2PQWA 3EFRA 2V8KA 2A36A 2KXDA 3MPUB 2ZCFB 2DJQA 2DJZA 2PVGB 1NEGA 1PD1A 2PUKB 1AWWA 1UUEA 1MHNA 1K73R 4JRPA 3IQLA 1JU5C 2R5AA 4BE1A 4N4GA 3DB3A 3EG9B 4GLMA 4JJNK 4PJNA 2VV5A 2R58A 1NJIR 1YNZA 1VQNQ 1VYUA 1NPPA 1DJ7B 1TS9A 2YSQA 1KG1A 2BZYA 1KQ1A 4R0KA 3CCET 2O9VA 2KSSA 1D0ZA 1SPKA 1WHMA 2LX9A 4J9DA 3C94A 2KVQG 4CC4B 1JB0E 4HA8A 1YJWA 2QYZA 5LJ3e 1M3BA 5CVIA 7AT1B 3OYGA 2K2VA 2RQWA 4M75F 3TVTA 2RPNA 1P92A 4M7AB 3SWNB 2RA2A 2QQRA 1RACB 4ESRA 3FIFA 5GAN6 2V26A 2LJ1A 1QWFA 2LP5A 2E6NA 2X4XA 1YITT 3CC7Q 2DTHA 4F7UF 4ZN1A 2KYMA 5LJ3g 2NYSA 3RKWA 5KCHA 1UG1A 4BY6C 5KYYB 1VQ7T 3A8OB 4MZMA 2AHJB 1VYTA 4LDVA 2QTXA 1VQ7A 4C5IA 2KI7A 3ASKA 3H0IA 3QIIA 3QG1A 4C92F 3CCQT 2LVMA 4EMKB 1OOTA 1VQKQ 3NMZC 3CC2Q 3EG0A 2IVWA 3J81E 1OU8A 4B9XA 1WA7A 1N9RA 2CUDA 2K4YA 3VS1A 3UATA 3EFOB 4HVUA 1R77A 4M75E 1UHFA 2DL7A 2ECZA 5LJ3h 2QI2A 3S3NA 3EG3A 5FU6C 3G4SQ 2EIFA 3SWNA 4M7AA 5IHKA 2OTJQ 1E7OA 1WJSA 1SHGA 2EVRA 3EAEA 2QGFB 3CPWP 2JTEA 4F7UE 3M54A 4Z8AA 4XU0A 1KC8R 1HD3A 4J83A 4OB1B 4F04B 1VQLT 4ME7A 2DVEA 2RK2A 2NLUA 3JSCA 5KYYA 4KGZB 4PL6A 1AT1B 2GTJA 5D7UA 1VQLA 1I0CA 4P5NA 5GAMd 1GCQC 1Q86R 4EMKA 3OYKA 3OYJA 1FYNA 3RERA 1WHGA 2RQTA 4M75B 5C6SA 1QKWA 3MP1A 1BI1A 1PC0A 1JRIA 2JM8A 1S72T 2FZCB 3VS3A 5GAN4 1KQSP 1WGSA 4F7UB 1S72A 3I5RA 3FRNA 3E1SA 1AVZC 1PSFA 1WLPB 3I55T 5HK3A 4PFZA 4IURA 4OMQA 4C8QF 2CSIA 4KUDK 4J9HA 4XTYA 2HD0A 2IIMA 4FT2A 2RHXA 4M78D 1UGSB 5GMKj 4ZTJA 3LGLA 3QDRB 1VQPQ 1M90C 4C92B 5HY6A 4M7AG 1QLYA 1QVFS 3JB9J 4JZ4A 3WXMB 1D1AA 2OAWA 2KK4A 9ATCB 4GY5A 2PNIA 2PUOB 2E5KA 4LDXA 2VXFA 1PM3A 4MZTA 4AMCA 3INZA 1K9MC 2CP0A 3CEYA 2LCLA 1WHHA 2ENMA 4OB0B 2CH4W 1KQSA 2COYA 5A0GA 4JPBW 3C0CA 4JLIA 2CH4A 1VQ4Q 3CCMT 4XK8E 1VQ9Q 2E41A 4FYVB 3CCMA 3M0SA 2HDAA 1W2BP 1BI0A 2I2LA 2L3QA 3CXCA 1NJIC 4HCCA 4JS5A 1X2KA 2NUZA 2YWWA 2JM9A 1KD1R 5D6WA 8AT1B 4C0DC 3I5SA 3BFMA 2JT4A 1UGQB 3ZL7C 3LWIA 2F2VA 2DTIA 1MV0B 1K4US 1YP5A 5GAMe 5EC7A 2RQUA 4O6JA 3HL8A 2HEQA 1Y96B 4JRQA 2QDLA 2MWPA 2ATCB 1X69A 5GAMf 1WHLA 4C8QB 3VYGA 4ZNXA 2A3LA 1GCPA 4E7JA 4HVWA 1JJ2S 4A4FA 2LZ6B 2K9GA 1OPKA 1SSFA 2F69A 3PMIA 4PKCC 3L42A 4EMHA 4OMLA 4XAXB 3RKXA 4M78F 4M7DA 1M4ZA 1U5SA 2I0NA 3GLXA 1XJWB 1YHQQ 2QEXQ 3D7SB 2GNCA 2COWA 2VB6A 1RADB 3CBOA 4PNOA 5GMKe 2QA4Q 3OW2S 2EW3A 1NPRA 1UB4A 2HKNA 4LNPA 2KXCA 3CC7T 1G83A 4BUGA 2E10A 3A8MB 5I2SA 3DLLA 1UFFA 2E3HA 1QCNA 4ATOA 1Q95G 1M2OA 1Y96A 2RJCA 4XU2A 3WVEB 3GF5A 2B86A 2VASA 2E3IA 1I1JA 2AZVA 5GANj 3S3OA 3JCMQ 3M53A 4M7DC 1VQ5Q 1YCYA 1H92A 1VQKT 1GBQA 2BIVA 1BU1A 4OMMA 2GTOA 1JXMA 2GF7A 4M78E 2NWMA 3RDVA 3I56A 2V1QA 1FWZA 2EKOA 1BKBA 2DILA 2LJ0A 1D0XA 5GAOn 1X43A 3G4ST 5CAIA 3JCMf 3JB9I 4J9GA 2PTKA 2J06A 3NPFA 4B6MA 3M0QA 2RI5A 3CD6Q 4M7DG 2FRYA 2RK1A 1FX7A 2QQBA 3L2WA 2O2OA 2RD1A 3EH2A 4JRIA 2M0OA 5GMKh 1ZHIA 1ABOA 2JMCA 3KBGA 4J6YA 1OX8A 3CC4A 2A08A 2P0PA 5KYXA 4D8DA 2KROA 5J3BA 2FYKA 1QP3A 4M78B 2XD0A 2DNUA 1ZSZC 2ZPHB 3G1JA 2RI3A 3MCAB 5GAOl 4HVVA 4X9DA 2RB6A 4RTWA 5KYUB 1ZBJA 2DPPB 5HCKA 3OB9A 1G8XA 1Q82R 5AT1B 2DTOA 3E9FA 2PVOB 4O5VA 4RTZA 1W6XA 2C0IA 5IAYA 1KJWA 1LOJA 1D09B 4J9FA 1AWXA 1V29B 3OMCA 4PJOC 3PVLA 3CCVQ 4FM4B 1M2VA 1OZ3A 1Z9QA 3BW1A 4A54A 3CMAQ 1M90U 1D0YA 2VVKA 1VQPT 1AEYA 1XNIA 3CCJQ 1E6GA 4FSSA 2XIDA 1OPLA 1VQOA 1RLPC 1GFDA 2XICA 1B34A 3M0RA 4L5GA 4QQ6A 4AG2C 1PRLC 3BY7A 1Z9ZA 2EFIA 2QG9B 2CZ7B 5CQXA 2RHUA 4Y28E 1K9MU 2CP2A 2EYYA 2VYTA 4XTXA 5GANe 4FW1A 4B9WA 3A8HB 1RAFB 3H41A 4IUUA 3CCUT 1MGQA 3E19A 3QSUA 2K6DA 1HSQA 3PFSA 4RTTA 4PLLA 2M51A 2QQSA 3EGXB 2KE9A 3CCUA 2MPXC 4KBMB 1N8RR 3FDRA 5KE3A 2YHTA 2K79A 2QXFA 1NJIU 3A5ZB 3CCRA 4QQDA 5L8RE 3MHXA 2FPDA 2K5FA 5GANg 2CDTA 1OQKA 2AKLA 4LN2A 2LTOA 1IXDA 1E6HA 4AFUC 5I2MA 1U1SA 2F1LA 2HCKA 2MF2A 1CKBA 1A0NB 2AIRB 4M77C 3CCLQ 2CP5A 5FU7C 1G3SA 5AYFA 4OVAA 2H8HA 5LJ5d 3UT1A 1WHKA 3G7ZA 2OTLT 1WI7A 1K8AC 1UGVA 2DM1A 5GJVB 3PIOA 4C5HA 1AHJB 3SEMA 2E5QA 2O4XA 2JZ2A 5GANh 2OTLA 3ZEHA 2QDYB 5LL6S 1I8FA 3CCSA 4IUPA 3OMGA 2DD5A 2L89A 2HQHA 3ULRB 2NUTA 2M02A 3GOXA 2Y90A 5GAN7 3JCMP 2O31A 1VQ6A 1TXQA 5FLXE 4RTUA 1MMAA 1YHQT 3L2RA 2QEXT 5GJWB 5GMKm 3H6ZA 2L3PA 2RHZA 3VUZA 2QA4T 5EG2A 1BYMA 3QYHB 3VS7A 1KIKA 2OX7A 2MOXA 2LQKA 1YIJQ 2NUPB 4XTVA 1NYFA 2DRKA 2KDSA 1PG5B 4NL3A 1PRMC 5J39A 2DYIA 3URGA 3OYLA 3JB9H 1ZBXA 3REBB 1QVGA 5KYNA 1VIFA 4EDUA 2KEAA 4PFPA 1M1KR 1Q7YR 2KRSA 3CCEA 3SFMA 4KRTA 2F5TX 3OBYA 2QASA 1M8MA 1WQ7A 3FB9A 1SF9A 2FZGB 2MCNA 3OBWA 2YRCA 2XHCA 2RNAA 4M7DD 4XTWA 4OB3B 3LH5A 3OYCA 5KH6A 1YWOA 1ZUUA 4BB7A 4FCYA 1PSEA 4Y92A 3OYIA 3KXTA 5KYWB 1QCFA 2YUNA 1YITA 2QQAA 1BCMA 2EQMA 2E6ZA 1IGUA 2D8HA 3EG9A 1M30A 1H641 2R57A 2EGEA 4CC3A 1YJNT 2L8DA 1YI2T 2BUDA 5LJ5f 1UECA 2Y4YA 3OW2P 1YJNA 3V7CA 2DXBA 1YI2A 3EHQA 2JS2A 1VOMA 1BIBA 2O01E 3CCQA 4FU6A 2RH2A 1PHTA 5GAN5 4KGXB 1GBRA 1AWJA 4HT8A 1UGRB 1ARKA 1UDLA 2M1HA 2DLPA 2K3YA 2FEIA 1G3WA 4LDYA 5C0MA 1UJYA 5FROA 3OYEA 2LMJA 4R56A 3V7SA 1WPYA 2DA9A 3QDFA 4AT1B 2QGGA 3UA6A 1I4K1 4PJJA 5GAMj 3CCJT 1T0JA 3RMQA 1U06A 2K3XA 2E12A 1YCSB 2J6FA 3FEOA 3P8BB 4E2FB 2CYZB 1K9AA 2VXEA 4JS4A 4PJOD 2LCCA 2HL5C 5I11A 1T0HA 1NLOC 5CKBA 4FYXB 2FL7A 4M7AC 3SWNC 2DL5A 4UC4A 4NS5A 1N5ZA 1FXXA 1AOJA 2J6KA 1F1BB 3J7AF 4J7FA 3EFOA 5GMKi 4KH0B 3O5ZA 1K0SA 1EFNA 1J3TA 3M4YA 1TG0A 4RMOA 4RTXA 1MV3A 2KAFA 3CPWA 2DKGA 1YBYA 4RKUE 3P8HA 3I55A 1Q81C 1U3OA 2XDDA 2EYXA 1GRIA 2J7IA 5KE2A 3RUXA 2WSEE 3OS0A 2FG0A 2KBTA 4EMKC 2OAUA 2KT8A 1NM7A 4OMOA 1XQHA 3JB9D 4KT0E 4PJMA 1WHJA 3CCLT 2HAXA 1LJOA 2ZAEA 4F16A 4RTVA 2QAZA 3LWHA 3PT9A 4LE9A 4PK4A 2L2PA 4M75A 4JLGA 1K8AU 1JBMA 1QVGS 2QK0A 1AZGB 2PVDB 3SHWA 2C0TA 2LDMA 4M7DE 3FLGA 1TUCA 4M77D 3OYFA 2D8JA 2KGTA 1K73C 4F7UA 1Y57A 3U23A 2C0OA 2JTFA 3R6OA 5A0DA 3GPLA 3EGDB 4JRKA 3OYHA 2P4TA 3MP6A 4OMFB 2CZ0B 3JCMd 2ROLA 1D1BA 1LCKA 3OQ5A 2DBKA 2DX1A 3G71T 1M1KC 2EGAA 4C92A 3RIRA 1MNEA 4A53A 1QWEA 1M9SA 4KH1B 3CBMA 3G71A 2DXTA 5FWBA 4PJOF 4RG2A 1ZSGA 2JXBA 4LDUA 1JXOA 3PGGA 3RBBB 4JJCA 5GAOp 2VKNA 1YIJT 2LCSA 4A4EA 1WJRA 2YRVA 4J7IA 2DFUA 3HRUA 1I5OB 1QVPA 1RABB 2BKDN 1JQQA 1VQNT 2YLCA 2MYSA 2F2WA 1WJQA 2P4RA 3G6EQ 1WQWA 1FMKA 3FJ5A 3PMTA 1VQNA 1W2BA 4M75G 4C92C 5GAMg 4GBQA 2EQIA 2O9SA 2X4JA 3M0UA 2KY9A 1JEGA 3QBYA 1YJ9Q 2JOYA 3CMEQ 4BI8B 2G3RA 4F7UG 4ZN3A 3VS6A 2LT4A 2MI6A 1M3CA 2K7AA 2IPOB 1K0XA 3LGFA 3JB9F 3HRSA 2YRDA 2HKQB 3M58A 1VQMQ 5CKHA 4PJOE 4Y91A
chains in the Genus database with same CATH topology
1VYUA 1GFDA 3M0RA 4AG2C 4CC2A 2YSQA 1PRLC 1Z9ZA 2M0YA 4DEXA 2BZYA 2KNBB 4R0KA 2O9VA 1SPKA 4RTYA 4J9DA 2EYYA 2AK5A 2GBQA 4CC4B 3VS0A 2EYZA 2YDLA 3H41A 5FWCA 1GL5A 2DRMA 4J9CA 2K3BA 2K6DA 1HSQA 4RTTA 1M3BA 5IHIA 4IIMA 2M51A 2AZSA 1BB9A 2KE9A 4LUEA 1WDXA 2RQWA 1V1CA 2PZ1A 3TVTA 2K79A 2DL4A 2RPNA 1BK2A 4ESRA 2LJ1A 1QWFA 2LP5A 4JJBA 2FPDA 2ESWA 4AG1C 2CDTA 2KYMA 1YN8A 2AKLA 4LN2A 2BZXA 2JMAA 1RI9A 1E6HA 4AFUC 1UG1A 2HCKA 2FRWA 2FPEA 1CKBA 1A0NB 2ROTA 2A28A 2K2MA 2KYBA 1T3LA 1VYTA 2RQRA 3EHRA 2DVJA 2YUPA 3H0IA 2A37A 2H8HA 1OOTA 1VA7A 1UJ0A 3H0FA 3NMZC 3EG0A 2DL3A 1WI7A 2GQIA 1WA7A 1UGVA 2DM1A 5GJVB 1WFWA 2CUDA 3VS1A 3RNJA 3UATA 3SEMA 4HVUA 1I07A 1UHFA 2DL7A 2ECZA 1PWTA 3EG3A 3ULRB 1T3SA 5IHKA 1E7OA 2KR3A 2BTTA 4ORZA 1SHGA 2O31A 2EVRA 1AD5A 4RTUA 2JTEA 1PNJA 4Z8AA 4D8KA 4J9IA 3I35A 1S1NA 1HD3A 3UA7A 2L0AA 1PKSA 1CKAA 5GJWB 2CSQA 1NLPC 2L3PA 2YUOA 2V1RA 3VS2A 4AFSC 1SRLA 2X3XD 1OV3A 2ED1A 2GTJA 4AFQC 2JW4A 1I0CA 2KRMA 3VS7A 1KIKA 1GCQC 1UE9A 2MOXA 1B3QA 2XMFA 1NYFA 2DRKA 1FYNA 2ABLA 2RQTA 1PRMC 1QKWA 4F14A 2JM8A 3REBB 2W10A 3VS3A 2KEAA 3M0TA 4M4ZA 3I5RA 1IO6A 3QWYA 1AVZC 1WLPB 2KRSA 4OMQA 2CSIA 2LQWA 4KRTA 3R6NA 3KFVA 1M8MA 5ECAA 4J9HA 2IIMA 1ZX6A 2MCNA 2RNAA 3PE0A 5IXFA 1QLYA 1WIEA 1GFCA 4JZ4A 3LH5A 2OAWA 1XOVA 3CQTA 3UF4A 1WXTA 1YWOA 1ZUUA 2PNIA 2CT3A 2EYWA 4Y92A 2LX7A 2DMOA 1QCFA 2E5KA 3EGUA 3NGPA 2YUNA 2EKHA 2LNHB 1TUDA 1NEBA 2D8HA 4HXJA 1M30A 5FW9A 5IH2A 1X27A 2ENMA 2EGEA 2CH4W 1M3AA 4CC3A 1RUWA 3EG1A 4JPBW 3C0CA 1BBZA 2CH4A 2OI3A 1UECA 4OMPA 1Y0MA 5IXBA 3EHQA 2JS2A 3M0SA 2HDAA 4DEYA 1PHTA 2L3QA 1GBRA 1AWJA 1X2KA 2VWFA 2NUZA 4X1VA 1KSWA 1ARKA 3JV3A 1UDLA 2CUBA 2JM9A 2DLPA 4J9BA 5IHNA 2FEIA 1G2BA 1UJYA 4A63B 2LMJA 3I5SA 2JT4A 1NYGA 4RUGA 3ZL7C 2F2VA 1MV0B 1K4US 1YP5A 1AZEA 1ZUKA 2DA9A 4LUDA 3THKA 4E6RA 5EC7A 4JJDA 3UA6A 4J9EA 2HSPA 1SEMA 2RN8A 1YWPA 2RQUA 2HEQA 1T0JA 2HBWA 1U06A 2QDLA 1YCSB 2J6FA 2RQVA 1X69A 2CT4A 3TSZA 1K9AA 4ZNXA 2J6OA 1GCPA 4HVWA 2LZ6B 2K9GA 1OPKA 5I11A 1T0HA 1NLOC 2FO0A 2CREA 1X2QA 2EBPA 4OMNA 1UHCA 2DL5A 3EG2A 1MUZA 2KRNA 3VS5A 1N5ZA 4OMLA 1AOJA 2J6KA 1ABQA 1U5SA 2EGCA 2I0NA 2JS0A 3O5ZA 1K0SA 1EFNA 1J3TA 1M27C 1SHFA 1TG0A 4RTXA 2GNCA 1H3HA 1MV3A 2SEMA 1K1ZA 2FPFA 2EW3A 4LNPA 1X6BA 2D1XA 2KXCA 1G83A 2LQNA 1U3OA 1WXBA 2EYXA 1GRIA 2J7IA 1UFFA 2FG0A 2KBTA 2KT8A 1NM7A 1NG2A 2KT1A 4OMOA 1SRMA 2MIOA 4WCIA 1KFZA 2DL8A 2B86A 1JO8A 1I1JA 2RMOA 2AZVA 5L23A 4F16A 1VYVA 3I9QA 1WXUA 4RTVA 1K76A 1H92A 4LE9A 1GBQA 2L2PA 1RLQC 3NHNA 1BU1A 4IIOA 1WX6A 2OJ2A 1AZGB 4OMMA 3SHWA 2C0TA 2O88A 2GTOA 1JXMA 3A98A 3H0HA 1TUCA 2NWMA 2V1QA 2D8JA 2KGTA 4F17A 1Y57A 2DILA 2SRCA 3U23A 3TSWA 2C0OA 2LJ0A 1HJDA 3M0PA 2ED0A 1B07A 1X43A 4JZ3A 2G6FX 4Z89A 2DYBA 2L3SA 1PKTA 1UTIA 4J9GA 2PTKA 2EPDA 4EIKA 2J06A 3NPFA 2ROLA 3M0QA 1LCKA 2FRYA 4AFZC 1H8KA 2DBKA 2DX1A 2O2OA 3GBQA 1CSKA 1ZLMA 3VS4A 2DF6A 2EGAA 2YT6A 1ABOA 2JMCA 2X3WD 2RF0A 2YUQA 1QWEA 2A08A 4Z88A 5FWBA 3QWXX 4D8DA 4HCKA 2KROA 1ZSGA 2JXBA 1QKXA 1JXOA 3RBBB 1ZUYA 4JJCA 2BZ8A 1GCQA 2VKNA 4CC7A 2DNUA 2LCSA 1WYXA 3VRZA 2AKKA 1JQQA 2F2XA 4QT7A 1SSHA 4HVVA 2J05A 1W70A 2GGRA 2LJ3A 4RTWA 1ZBJA 1OEBA 2F2WA 5I22A 2P4RA 5HCKA 3VRYA 1FMKA 3FJ5A 2DBMA 4RTZA 1W6XA 1X6GA 2C0IA 4GBQA 2EQIA 2O9SA 1KJWA 3M0UA 2A36A 2KXDA 4J9FA 1W1FA 1AWOA 1JEGA 2DJQA 1AWXA 2W0ZA 1NEGA 1AWWA 3PVLA 1UUEA 3PVQA 4K11A 3VS6A 1Z9QA 3IQLA 1M3CA 1JU5C 2K7AA 2D0NA 2VVKA 1K0XA 1AEYA 3REAB 1E6GA 4GLMA 4FSSA 2DE0X 1OPLA 1YNZA 1RLPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYU A;  1GFD A;  3M0R A;  4AG2 C;  4CC2 A;  2YSQ A;  1PRL C;  1Z9Z A;  2M0Y A;  4DEX A;  2BZY A;  2KNB B;  4R0K A;  2O9V A;  1SPK A;  4RTY A;  4J9D A;  2EYY A;  2AK5 A;  2GBQ A;  4CC4 B;  3VS0 A;  2EYZ A;  2YDL A;  3H41 A;  5FWC A;  1GL5 A;  2DRM A;  4J9C A;  2K3B A;  2K6D A;  1HSQ A;  4RTT A;  1M3B A;  5IHI A;  4IIM A;  2M51 A;  2AZS A;  1BB9 A;  2KE9 A;  4LUE A;  1WDX A;  2RQW A;  1V1C A;  2PZ1 A;  3TVT A;  2K79 A;  2DL4 A;  2RPN A;  1BK2 A;  4ESR A;  2LJ1 A;  1QWF A;  2LP5 A;  4JJB A;  2FPD A;  2ESW A;  4AG1 C;  2CDT A;  2KYM A;  1YN8 A;  2AKL A;  4LN2 A;  2BZX A;  2JMA A;  1RI9 A;  1E6H A;  4AFU C;  1UG1 A;  2HCK A;  2FRW A;  2FPE A;  1CKB A;  1A0N B;  2ROT A;  2A28 A;  2K2M A;  2KYB A;  1T3L A;  1VYT A;  2RQR A;  3EHR A;  2DVJ A;  2YUP A;  3H0I A;  2A37 A;  2H8H A;  1OOT A;  1VA7 A;  1UJ0 A;  3H0F A;  3NMZ C;  3EG0 A;  2DL3 A;  1WI7 A;  2GQI A;  1WA7 A;  1UGV A;  2DM1 A;  5GJV B;  1WFW A;  2CUD A;  3VS1 A;  3RNJ A;  3UAT A;  3SEM A;  4HVU A;  1I07 A;  1UHF A;  2DL7 A;  2ECZ A;  1PWT A;  3EG3 A;  3ULR B;  1T3S A;  5IHK A;  1E7O A;  2KR3 A;  2BTT A;  4ORZ A;  1SHG A;  2O31 A;  2EVR A;  1AD5 A;  4RTU A;  2JTE A;  1PNJ A;  4Z8A A;  4D8K A;  4J9I A;  3I35 A;  1S1N A;  1HD3 A;  3UA7 A;  2L0A A;  1PKS A;  1CKA A;  5GJW B;  2CSQ A;  1NLP C;  2L3P A;  2YUO A;  2V1R A;  3VS2 A;  4AFS C;  1SRL A;  2X3X D;  1OV3 A;  2ED1 A;  2GTJ A;  4AFQ C;  2JW4 A;  1I0C A;  2KRM A;  3VS7 A;  1KIK A;  1GCQ C;  1UE9 A;  2MOX A;  1B3Q A;  2XMF A;  1NYF A;  2DRK A;  1FYN A;  2ABL A;  2RQT A;  1PRM C;  1QKW A;  4F14 A;  2JM8 A;  3REB B;  2W10 A;  3VS3 A;  2KEA A;  3M0T A;  4M4Z A;  3I5R A;  1IO6 A;  3QWY A;  1AVZ C;  1WLP B;  2KRS A;  4OMQ A;  2CSI A;  2LQW A;  4KRT A;  3R6N A;  3KFV A;  1M8M A;  5ECA A;  4J9H A;  2IIM A;  1ZX6 A;  2MCN A;  2RNA A;  3PE0 A;  5IXF A;  1QLY A;  1WIE A;  1GFC A;  4JZ4 A;  3LH5 A;  2OAW A;  1XOV A;  3CQT A;  3UF4 A;  1WXT A;  1YWO A;  1ZUU A;  2PNI A;  2CT3 A;  2EYW A;  4Y92 A;  2LX7 A;  2DMO A;  1QCF A;  2E5K A;  3EGU A;  3NGP A;  2YUN A;  2EKH A;  2LNH B;  1TUD A;  1NEB A;  2D8H A;  4HXJ A;  1M30 A;  5FW9 A;  5IH2 A;  1X27 A;  2ENM A;  2EGE A;  2CH4 W;  1M3A A;  4CC3 A;  1RUW A;  3EG1 A;  4JPB W;  3C0C A;  1BBZ A;  2CH4 A;  2OI3 A;  1UEC A;  4OMP A;  1Y0M A;  5IXB A;  3EHQ A;  2JS2 A;  3M0S A;  2HDA A;  4DEY A;  1PHT A;  2L3Q A;  1GBR A;  1AWJ A;  1X2K A;  2VWF A;  2NUZ A;  4X1V A;  1KSW A;  1ARK A;  3JV3 A;  1UDL A;  2CUB A;  2JM9 A;  2DLP A;  4J9B A;  5IHN A;  2FEI A;  1G2B A;  1UJY A;  4A63 B;  2LMJ A;  3I5S A;  2JT4 A;  1NYG A;  4RUG A;  3ZL7 C;  2F2V A;  1MV0 B;  1K4U S;  1YP5 A;  1AZE A;  1ZUK A;  2DA9 A;  4LUD A;  3THK A;  4E6R A;  5EC7 A;  4JJD A;  3UA6 A;  4J9E A;  2HSP A;  1SEM A;  2RN8 A;  1YWP A;  2RQU A;  2HEQ A;  1T0J A;  2HBW A;  1U06 A;  2QDL A;  1YCS B;  2J6F A;  2RQV A;  1X69 A;  2CT4 A;  3TSZ A;  1K9A A;  4ZNX A;  2J6O A;  1GCP A;  4HVW A;  2LZ6 B;  2K9G A;  1OPK A;  5I11 A;  1T0H A;  1NLO C;  2FO0 A;  2CRE A;  1X2Q A;  2EBP A;  4OMN A;  1UHC A;  2DL5 A;  3EG2 A;  1MUZ A;  2KRN A;  3VS5 A;  1N5Z A;  4OML A;  1AOJ A;  2J6K A;  1ABQ A;  1U5S A;  2EGC A;  2I0N A;  2JS0 A;  3O5Z A;  1K0S A;  1EFN A;  1J3T A;  1M27 C;  1SHF A;  1TG0 A;  4RTX A;  2GNC A;  1H3H A;  1MV3 A;  2SEM A;  1K1Z A;  2FPF A;  2EW3 A;  4LNP A;  1X6B A;  2D1X A;  2KXC A;  1G83 A;  2LQN A;  1U3O A;  1WXB A;  2EYX A;  1GRI A;  2J7I A;  1UFF A;  2FG0 A;  2KBT A;  2KT8 A;  1NM7 A;  1NG2 A;  2KT1 A;  4OMO A;  1SRM A;  2MIO A;  4WCI A;  1KFZ A;  2DL8 A;  2B86 A;  1JO8 A;  1I1J A;  2RMO A;  2AZV A;  5L23 A;  4F16 A;  1VYV A;  3I9Q A;  1WXU A;  4RTV A;  1K76 A;  1H92 A;  4LE9 A;  1GBQ A;  2L2P A;  1RLQ C;  3NHN A;  1BU1 A;  4IIO A;  1WX6 A;  2OJ2 A;  1AZG B;  4OMM A;  3SHW A;  2C0T A;  2O88 A;  2GTO A;  1JXM A;  3A98 A;  3H0H A;  1TUC A;  2NWM A;  2V1Q A;  2D8J A;  2KGT A;  4F17 A;  1Y57 A;  2DIL A;  2SRC A;  3U23 A;  3TSW A;  2C0O A;  2LJ0 A;  1HJD A;  3M0P A;  2ED0 A;  1B07 A;  1X43 A;  4JZ3 A;  2G6F X;  4Z89 A;  2DYB A;  2L3S A;  1PKT A;  1UTI A;  4J9G A;  2PTK A;  2EPD A;  4EIK A;  2J06 A;  3NPF A;  2ROL A;  3M0Q A;  1LCK A;  2FRY A;  4AFZ C;  1H8K A;  2DBK A;  2DX1 A;  2O2O A;  3GBQ A;  1CSK A;  1ZLM A;  3VS4 A;  2DF6 A;  2EGA A;  2YT6 A;  1ABO A;  2JMC A;  2X3W D;  2RF0 A;  2YUQ A;  1QWE A;  2A08 A;  4Z88 A;  5FWB A;  3QWX X;  4D8D A;  4HCK A;  2KRO A;  1ZSG A;  2JXB A;  1QKX A;  1JXO A;  3RBB B;  1ZUY A;  4JJC A;  2BZ8 A;  1GCQ A;  2VKN A;  4CC7 A;  2DNU A;  2LCS A;  1WYX A;  3VRZ A;  2AKK A;  1JQQ A;  2F2X A;  4QT7 A;  1SSH A;  4HVV A;  2J05 A;  1W70 A;  2GGR A;  2LJ3 A;  4RTW A;  1ZBJ A;  1OEB A;  2F2W A;  5I22 A;  2P4R A;  5HCK A;  3VRY A;  1FMK A;  3FJ5 A;  2DBM A;  4RTZ A;  1W6X A;  1X6G A;  2C0I A;  4GBQ A;  2EQI A;  2O9S A;  1KJW A;  3M0U A;  2A36 A;  2KXD A;  4J9F A;  1W1F A;  1AWO A;  1JEG A;  2DJQ A;  1AWX A;  2W0Z A;  1NEG A;  1AWW A;  3PVL A;  1UUE A;  3PVQ A;  4K11 A;  3VS6 A;  1Z9Q A;  3IQL A;  1M3C A;  1JU5 C;  2K7A A;  2D0N A;  2VVK A;  1K0X A;  1AEY A;  3REA B;  1E6G A;  4GLM A;  4FSS A;  2DE0 X;  1OPL A;  1YNZ A;  1RLP C; 
#chains in the Genus database with same CATH topology
 4CC2 A;  1U1T A;  2LC4 A;  5GAN 8;  3SB2 A;  2M0Y A;  4DEX A;  2KNB B;  4C92 G;  3L1A A;  3L2Q A;  3CC7 A;  1MMG A;  2AK5 A;  1XTD A;  2MWO A;  5GAM h;  3OS1 A;  3VS0 A;  2EYZ A;  1QMC A;  3GNG A;  1IRX A;  4C8Q A;  4M77 F;  2DRM A;  5HK0 A;  4BDZ A;  4L6V 5;  2RHY A;  5IHI A;  1KC8 C;  4FIB A;  1WDX A;  3OYB A;  5CIU A;  1V1C A;  4PFO A;  2MK5 A;  3X24 B;  3JCM J;  3CC2 T;  1BK2 A;  3V7R A;  3JCM e;  2EWN A;  2JJ9 A;  1VQK A;  2DET A;  3CC2 A;  2GFA A;  1NE8 A;  3QPH A;  4XTZ A;  1Q86 C;  4C5G A;  4NL2 A;  2BZX A;  1YJW Q;  1RI9 A;  4EPC A;  2OTJ T;  3M55 A;  3PTA A;  2FPE A;  3QUI A;  4C8Q C;  2A28 A;  2KYB A;  3V8K A;  3G4S A;  4QVZ A;  2OTJ A;  4XU1 A;  3EHR A;  2DVJ A;  2YUP A;  3OYD A;  2JNG A;  1VA7 A;  2XKO C;  3H0F A;  3JCM X;  2GQI A;  4M77 E;  1WFW A;  2CZ6 B;  3MEV A;  1X6O A;  2X9H A;  4C5E A;  5KCO A;  2FVU A;  1W4S A;  1PWT A;  2IG0 A;  1KQS S;  2QQ9 A;  4C8Q G;  4TVR A;  1VQ7 Q;  2BTT A;  1D3B B;  1AD5 A;  1PNJ A;  4L59 A;  4LXC A;  4D8K A;  1OU9 A;  4J9I A;  2Y4X A;  3UA7 A;  2B8A A;  4IUT A;  4OF1 A;  1CKA A;  4V2S A;  3MEA A;  2RHI A;  3CXC S;  4M7A D;  3VS2 A;  4AFS C;  4MZP A;  2EJG A;  1SRL A;  1TWB A;  1OV3 A;  1Q81 U;  1M8V A;  2DXU A;  2KRM A;  4YTL A;  1B3Q A;  2KQW A;  3LLR A;  4QQG A;  2ABL A;  1BIA A;  1VQP A;  3UPU A;  2BE9 B;  2W10 A;  3VV0 A;  3M56 A;  4M78 A;  2JTM A;  1KD1 C;  1RL2 A;  3QO3 A;  2GFU A;  1VQL Q;  2DEQ A;  4JDS A;  1IRE B;  3R6N A;  1VQ8 Q;  4HKE A;  4RCB A;  5ECA A;  5KYU A;  4FW2 A;  2KMT A;  1K73 U;  1VQ4 T;  4PLI A;  3HRT A;  1VQ9 T;  3PE0 A;  3MO8 A;  3JCM c;  1LNX A;  2EQU A;  5IXF A;  1VQ4 A;  5CKD A;  3JAM E;  2HL3 A;  1VQ9 A;  3UF4 A;  1WXT A;  3M57 A;  2CT3 A;  3O8V A;  5M9O A;  1S72 Q;  2EYW A;  1OUL A;  4FL6 A;  4J5Y A;  1M1G A;  2VC8 A;  4ZTF A;  1M1K U;  2COZ A;  1H3Z A;  3NGP A;  4KUL A;  2E70 A;  4ZGD B;  3QHS A;  3S6W A;  2M9U A;  1NEB A;  2YXY A;  4HXJ A;  4OGE A;  5FW9 A;  5IH2 A;  1X27 A;  5LJ5 j;  1N6A A;  1M3A A;  1TSF A;  3QJ6 A;  4RCC A;  1RUW A;  3X20 B;  2CS7 A;  1BBZ A;  1RAG B;  4N4I A;  5LJ3 d;  1HYO A;  2PU9 B;  2JVV A;  4C0F A;  2MAM A;  1Y0M A;  4LD9 K;  3HP9 A;  4BE0 A;  3C95 A;  2XDP A;  1Y7X A;  3RES A;  2VWF A;  4X1V A;  4M78 G;  1G5V A;  3G6E T;  1OYX A;  1QVF P;  2D6F A;  2CUB A;  3EGX A;  2CZ1 B;  5IHN A;  4DBF A;  1G2B A;  3QXE B;  3WVD B;  4A63 B;  4M7A F;  4FYY B;  4ELY C;  4RUG A;  3X25 B;  3TCJ A;  1YJ9 T;  5GAN 3;  4E7S A;  3CME T;  2E65 A;  1KK7 A;  4E6R A;  2HZY A;  4J9E A;  3CCM Q;  3ZBD A;  3PNW C;  2RN8 A;  1YWP A;  1M90 R;  5A2Q E;  4C92 D;  1I81 A;  4DA4 A;  1TOV A;  4BY6 B;  3UDC A;  4IKF A;  3A8G B;  2P0Q A;  1YHQ A;  3OYA A;  3OSS C;  2QEX A;  2CT4 A;  2J6O A;  3LW5 E;  2QA4 A;  2K5I A;  2CKK A;  1RI0 A;  2V8J A;  1X2Q A;  1K9M R;  1M1F A;  2EBP A;  4OMN A;  2LQ8 A;  1UHC A;  1MUZ A;  1QVF A;  4X34 A;  1QQJ A;  2LNV A;  1KC8 U;  2X4W A;  1ABQ A;  2EGC A;  4R55 A;  1VQ5 T;  4CI0 C;  3JCM W;  1SHF A;  4C0G A;  4M7A E;  2RJF A;  4A4H A;  5FU6 B;  1H3H A;  2K57 A;  1VQ5 A;  2FPF A;  2R5M A;  2D9T A;  3A8L B;  4LD6 A;  5J26 A;  2H3E B;  1Q86 U;  2L3R A;  1YJW T;  2E1H A;  3VJP A;  2BE7 D;  1SRM A;  2FZK B;  2MIO A;  4CRI A;  1KFZ A;  2DL8 A;  2YLB A;  1JJ2 P;  3KUF A;  1TU0 B;  3CD6 T;  5GAO q;  5L23 A;  4FSX A;  1Q82 C;  2GQV A;  5LJ5 e;  3I9Q A;  2NUP A;  2XG8 D;  2ZGW A;  3HHT B;  2ZPE B;  1K76 A;  4QKU A;  3CD6 A;  3GIB A;  1IGQ A;  3L2U A;  3NHN A;  4BI4 A;  5LJ3 f;  4KUI A;  1WX6 A;  2OJ2 A;  4ZGJ B;  3NTI A;  3GP8 A;  3GNF B;  4C8Q D;  4X9C A;  3H0H A;  1O75 A;  3TEE A;  4F17 A;  2XDB A;  2SRC A;  3M0P A;  4ZGE B;  1GXI E;  2ZPG B;  4HCB A;  4J8O A;  4Z89 A;  3DKM A;  2DYB A;  3QYG B;  5LJ5 g;  1PKT A;  2JN0 A;  2EAY A;  2EPD A;  4DBH A;  4E7K A;  3GBQ A;  1ZLM A;  2X35 A;  3VS4 A;  2DF6 A;  1BI3 A;  1JJ2 A;  2X3W D;  2RF0 A;  2X4Y A;  3I56 Q;  1N9S A;  5I21 A;  3QWX X;  2V8I A;  2RJD A;  3CCV T;  5GAN 2;  1QKX A;  2BZ8 A;  5KYW A;  4BAC A;  3CMA T;  1GCQ A;  4A4K A;  2VUB A;  4DOW A;  1N8R C;  3CCV A;  2RI2 A;  3OA6 A;  3VRZ A;  1G3T A;  3CMA A;  1BCO A;  2F2X A;  2EQK A;  5LJ5 h;  2J05 A;  2K5L A;  1W70 A;  3DLM A;  2LJ3 A;  3X26 B;  3CCJ A;  3OW2 A;  3LYI A;  1OEB A;  1V76 A;  1YFN A;  2WAC A;  2DER A;  1KD1 U;  3VRY A;  3NFC A;  4MDX A;  3CC4 Q;  2DBM A;  4C0Z A;  2DD4 A;  1X6G A;  1W1F A;  1AWO A;  1VQ8 T;  3NTH A;  1X75 C;  1G3Y A;  2W0Z A;  4M7D F;  5IT9 E;  3PVQ A;  5GAO m;  4K11 A;  4MDW A;  3MEW A;  1VQ8 A;  4C92 E;  2D0N A;  4BE2 A;  2EJ9 A;  4C0D B;  2GCX A;  1Y07 A;  8ATC B;  3REA B;  1O9S A;  2DE0 X;  3ZFJ A;  1MMD A;  4BDY A;  2HQX A;  4RTY A;  2GBQ A;  4N0A A;  2X51 A;  1LPL A;  1ACM B;  3M4G A;  1C6V X;  2YDL A;  3JCM b;  5FWC A;  1GL5 A;  3BDU A;  4OP0 A;  4J9C A;  4WTO B;  2E4H A;  4EMG A;  2K3B A;  1OZ2 A;  4DQ2 A;  3CXC P;  4IIM A;  2AZS A;  4FYW B;  1BB9 A;  4LUE A;  3CCL A;  1VQO Q;  2PZ1 A;  2DL4 A;  1IHV A;  3OYM A;  4FT4 A;  3DB4 A;  4JJB A;  3E9G A;  4AG1 C;  2ESW A;  3L2Z A;  1VUB A;  2A7Y A;  1EIF A;  3MKD A;  1QP2 A;  3RMS A;  1YN8 A;  2JMA A;  4E7H A;  4N0A C;  4BD3 A;  4KGV B;  2FRW A;  3N5B B;  1TTH B;  2ROT A;  1B7T A;  3CCU Q;  2K2M A;  1T3L A;  4LDW A;  3C12 A;  2RQR A;  4MML A;  2LRQ A;  2A37 A;  3CCR Q;  1Q7Y C;  3QZ9 B;  2P0K A;  1UJ0 A;  3FC3 A;  5HKC A;  2M16 A;  3OS2 A;  4M75 C;  2DL3 A;  4C8Q E;  3QKJ A;  6AT1 B;  5CKE A;  3RNJ A;  2RO0 A;  1D1C A;  1PCX A;  5GMK l;  4M7D B;  3MET A;  4II1 A;  1RAI B;  4XU3 A;  2CP6 A;  1C1A A;  2LT1 A;  1I07 A;  3X28 B;  1YIJ A;  1T3S A;  2KR3 A;  4ORZ A;  1MND A;  3OSV A;  4ELZ C;  4Q5W A;  4MMK A;  3VUB A;  4E47 A;  3I35 A;  1S1N A;  1RAE B;  2EQJ A;  2L0A A;  1PKS A;  1RAH B;  2EJF A;  2CSQ A;  1NLP C;  2ZPI B;  3EGD A;  2YUO A;  4QVC A;  2WSC E;  2V1R A;  2OTL Q;  2X3X D;  2ED1 A;  5D6X A;  4AFQ C;  2JW4 A;  3MEU A;  3CCS Q;  5CQY A;  1C0M A;  2WSF E;  3HPW A;  1UE9 A;  2XMF A;  1VQ6 Q;  4A4G A;  4XTU A;  2MMP A;  4F14 A;  1IZ6 A;  1X01 A;  3A1P A;  1Q82 U;  1KHI A;  2XK0 A;  3BDL A;  1ZSZ B;  2Z0W A;  3M0T A;  4M4Z A;  2DK3 A;  1IO6 A;  3QWY A;  1WZO A;  3CBP A;  4DOV A;  1ZA1 B;  3HKS A;  2LQW A;  3KFV A;  4HCZ A;  1K8A R;  4IUV A;  5CO7 A;  2VGN A;  4XQ3 A;  1ZX6 A;  4N4H A;  3ME9 A;  5D6Y A;  3OS5 A;  1EX4 A;  2HBP A;  5DM7 R;  1R0C B;  1OX9 A;  4NOY A;  3ER0 A;  1WIE A;  1GFC A;  2D0Q B;  1XOV A;  3CQT A;  3QZ5 B;  5KYX B;  3EFS A;  4PJO B;  4OGC A;  2LX7 A;  3H9N A;  2DMO A;  3EGU A;  3CCE Q;  3EH1 A;  3NTK A;  5DLQ E;  2EKH A;  2RM4 A;  2F5K A;  3RKY A;  2LNH B;  3CPW S;  1TUD A;  3M9Q A;  2H3J A;  4BI3 A;  4E7L A;  3I56 T;  3OYN A;  2L5Q A;  5GAN d;  3HTR A;  1HXD A;  5FRN A;  3EG1 A;  3SDZ A;  5DLO A;  1U8R A;  1N8R U;  2EYQ A;  2OI3 A;  3Q1J A;  4OMP A;  3JCM g;  4WF2 A;  1ZSZ A;  1R8O B;  3MP8 A;  5IXB A;  1SG5 A;  5FRM A;  4DEY A;  2P84 A;  2AT1 B;  1M5Q 1;  3LH0 A;  1YIT Q;  1KSW A;  1M2V B;  3JV3 A;  2FHD A;  4J9B A;  3CC4 T;  1NZ9 A;  1EZZ B;  1KHC A;  2CP7 A;  2HNI A;  2VGM A;  1NYG A;  2C06 A;  1UGP B;  1ZUK A;  3T9N A;  1AZE A;  4LUD A;  2CP3 A;  1B34 B;  3THK A;  3S3M A;  4PJO A;  4JJD A;  1YJN Q;  1YI2 Q;  2HSP A;  1SEM A;  3CCQ Q;  3PIP A;  3JCM h;  4J6W A;  3TU4 K;  3HSB A;  1TH7 A;  1WNL A;  2HBW A;  3J80 E;  5IN1 A;  4IUQ A;  2RQV A;  1RAA B;  3TSZ A;  4M77 B;  3VKI A;  1I5L A;  1FMW A;  5FU7 B;  1SKU B;  1OI1 A;  4OB2 B;  2FB7 A;  2DZ9 A;  2FO0 A;  2CRE A;  2RJE A;  5CKF A;  3EG2 A;  2KRN A;  3VS5 A;  1VIE A;  2QTV A;  3H8Z A;  4DBQ A;  2XU8 A;  1FMV A;  5GAO r;  1LVK A;  2A0F B;  2JS0 A;  4HT9 A;  3QJY A;  5DY9 A;  1M27 C;  1VQO T;  2E64 A;  5CR2 A;  2SEM A;  1BI2 A;  3MJX A;  1K1Z A;  3F70 A;  1X6B A;  2JUF A;  2D1X A;  3M59 A;  1ZQ1 A;  1D3B A;  2LQN A;  3OYY A;  1WXB A;  1W2B S;  2CGH A;  1IB8 A;  1PD0 A;  3BE3 A;  1NG2 A;  2KT1 A;  2DAQ A;  4DBR A;  3HFO A;  2ZPF B;  4WCI A;  4PJO G;  4Z02 A;  1JO8 A;  3VYH B;  1QCO A;  1QW1 A;  3FJP A;  4M77 A;  2RMO A;  4M78 C;  2O4X B;  4GLK A;  1Q7Y U;  1VYV A;  2DO3 A;  3C4S A;  3CCR T;  1WXU A;  3E2U A;  3M5A A;  3VU3 C;  5LJ3 j;  5GAN f;  1RLQ C;  3I55 Q;  3CPF A;  4VUB A;  4RG8 A;  4IIO A;  2HQE A;  2NUT B;  3SD4 A;  2O88 A;  2DIQ A;  3A98 A;  2HSE B;  3TSW A;  1HJD A;  3AHU A;  2ED0 A;  1B07 A;  4JZ3 A;  5CCA A;  1MMN A;  2G6F X;  5A0L A;  2L3S A;  4M75 D;  3LX7 A;  3V8J A;  1UTI A;  4EIK A;  4ANJ A;  3P8D A;  2DZC A;  3V8L A;  4AFZ C;  1H8K A;  3TRE A;  1R0B G;  3UWN A;  1CSK A;  3JCM V;  2YT6 A;  3G6E A;  3JB9 G;  2YUQ A;  3AT1 B;  2ZZD A;  2ZPB B;  4E7Z A;  4Z88 A;  2XI9 A;  1HK9 A;  4HCK A;  1NBE B;  3CCS T;  1ZA2 B;  4E7I A;  1ZUY A;  1Q81 R;  2DIG A;  4PJL A;  3OY9 A;  4QVD A;  3JRZ A;  4CC7 A;  1YJ9 A;  4D6W A;  3CME A;  1UEB A;  1WYX A;  1QVG P;  1IHW A;  1N27 A;  1KQ2 A;  1VQ6 T;  5CK9 A;  4JUV A;  4J6X A;  3TQ7 P;  1VQM T;  2AKK A;  4QT7 A;  1Y71 A;  4M77 G;  1SSH A;  2GGR A;  2DEU A;  4QW2 A;  5I22 A;  3L2V A;  1TUG B;  1VQM A;  3HFN A;  3RR6 A;  3G71 Q;  2HMA A;  2DXC A;  2PQW A;  3EFR A;  2V8K A;  2A36 A;  2KXD A;  3MPU B;  2ZCF B;  2DJQ A;  2DJZ A;  2PVG B;  1NEG A;  1PD1 A;  2PUK B;  1AWW A;  1UUE A;  1MHN A;  1K73 R;  4JRP A;  3IQL A;  1JU5 C;  2R5A A;  4BE1 A;  4N4G A;  3DB3 A;  3EG9 B;  4GLM A;  4JJN K;  4PJN A;  2VV5 A;  2R58 A;  1NJI R;  1YNZ A;  1VQN Q;  1VYU A;  1NPP A;  1DJ7 B;  1TS9 A;  2YSQ A;  1KG1 A;  2BZY A;  1KQ1 A;  4R0K A;  3CCE T;  2O9V A;  2KSS A;  1D0Z A;  1SPK A;  1WHM A;  2LX9 A;  4J9D A;  3C94 A;  2KVQ G;  4CC4 B;  1JB0 E;  4HA8 A;  1YJW A;  2QYZ A;  5LJ3 e;  1M3B A;  5CVI A;  7AT1 B;  3OYG A;  2K2V A;  2RQW A;  4M75 F;  3TVT A;  2RPN A;  1P92 A;  4M7A B;  3SWN B;  2RA2 A;  2QQR A;  1RAC B;  4ESR A;  3FIF A;  5GAN 6;  2V26 A;  2LJ1 A;  1QWF A;  2LP5 A;  2E6N A;  2X4X A;  1YIT T;  3CC7 Q;  2DTH A;  4F7U F;  4ZN1 A;  2KYM A;  5LJ3 g;  2NYS A;  3RKW A;  5KCH A;  1UG1 A;  4BY6 C;  5KYY B;  1VQ7 T;  3A8O B;  4MZM A;  2AHJ B;  1VYT A;  4LDV A;  2QTX A;  1VQ7 A;  4C5I A;  2KI7 A;  3ASK A;  3H0I A;  3QII A;  3QG1 A;  4C92 F;  3CCQ T;  2LVM A;  4EMK B;  1OOT A;  1VQK Q;  3NMZ C;  3CC2 Q;  3EG0 A;  2IVW A;  3J81 E;  1OU8 A;  4B9X A;  1WA7 A;  1N9R A;  2CUD A;  2K4Y A;  3VS1 A;  3UAT A;  3EFO B;  4HVU A;  1R77 A;  4M75 E;  1UHF A;  2DL7 A;  2ECZ A;  5LJ3 h;  2QI2 A;  3S3N A;  3EG3 A;  5FU6 C;  3G4S Q;  2EIF A;  3SWN A;  4M7A A;  5IHK A;  2OTJ Q;  1E7O A;  1WJS A;  1SHG A;  2EVR A;  3EAE A;  2QGF B;  3CPW P;  2JTE A;  4F7U E;  3M54 A;  4Z8A A;  4XU0 A;  1KC8 R;  1HD3 A;  4J83 A;  4OB1 B;  4F04 B;  1VQL T;  4ME7 A;  2DVE A;  2RK2 A;  2NLU A;  3JSC A;  5KYY A;  4KGZ B;  4PL6 A;  1AT1 B;  2GTJ A;  5D7U A;  1VQL A;  1I0C A;  4P5N A;  5GAM d;  1GCQ C;  1Q86 R;  4EMK A;  3OYK A;  3OYJ A;  1FYN A;  3RER A;  1WHG A;  2RQT A;  4M75 B;  5C6S A;  1QKW A;  3MP1 A;  1BI1 A;  1PC0 A;  1JRI A;  2JM8 A;  1S72 T;  2FZC B;  3VS3 A;  5GAN 4;  1KQS P;  1WGS A;  4F7U B;  1S72 A;  3I5R A;  3FRN A;  3E1S A;  1AVZ C;  1PSF A;  1WLP B;  3I55 T;  5HK3 A;  4PFZ A;  4IUR A;  4OMQ A;  4C8Q F;  2CSI A;  4KUD K;  4J9H A;  4XTY A;  2HD0 A;  2IIM A;  4FT2 A;  2RHX A;  4M78 D;  1UGS B;  5GMK j;  4ZTJ A;  3LGL A;  3QDR B;  1VQP Q;  1M90 C;  4C92 B;  5HY6 A;  4M7A G;  1QLY A;  1QVF S;  3JB9 J;  4JZ4 A;  3WXM B;  1D1A A;  2OAW A;  2KK4 A;  9ATC B;  4GY5 A;  2PNI A;  2PUO B;  2E5K A;  4LDX A;  2VXF A;  1PM3 A;  4MZT A;  4AMC A;  3INZ A;  1K9M C;  2CP0 A;  3CEY A;  2LCL A;  1WHH A;  2ENM A;  4OB0 B;  2CH4 W;  1KQS A;  2COY A;  5A0G A;  4JPB W;  3C0C A;  4JLI A;  2CH4 A;  1VQ4 Q;  3CCM T;  4XK8 E;  1VQ9 Q;  2E41 A;  4FYV B;  3CCM A;  3M0S A;  2HDA A;  1W2B P;  1BI0 A;  2I2L A;  2L3Q A;  3CXC A;  1NJI C;  4HCC A;  4JS5 A;  1X2K A;  2NUZ A;  2YWW A;  2JM9 A;  1KD1 R;  5D6W A;  8AT1 B;  4C0D C;  3I5S A;  3BFM A;  2JT4 A;  1UGQ B;  3ZL7 C;  3LWI A;  2F2V A;  2DTI A;  1MV0 B;  1K4U S;  1YP5 A;  5GAM e;  5EC7 A;  2RQU A;  4O6J A;  3HL8 A;  2HEQ A;  1Y96 B;  4JRQ A;  2QDL A;  2MWP A;  2ATC B;  1X69 A;  5GAM f;  1WHL A;  4C8Q B;  3VYG A;  4ZNX A;  2A3L A;  1GCP A;  4E7J A;  4HVW A;  1JJ2 S;  4A4F A;  2LZ6 B;  2K9G A;  1OPK A;  1SSF A;  2F69 A;  3PMI A;  4PKC C;  3L42 A;  4EMH A;  4OML A;  4XAX B;  3RKX A;  4M78 F;  4M7D A;  1M4Z A;  1U5S A;  2I0N A;  3GLX A;  1XJW B;  1YHQ Q;  2QEX Q;  3D7S B;  2GNC A;  2COW A;  2VB6 A;  1RAD B;  3CBO A;  4PNO A;  5GMK e;  2QA4 Q;  3OW2 S;  2EW3 A;  1NPR A;  1UB4 A;  2HKN A;  4LNP A;  2KXC A;  3CC7 T;  1G83 A;  4BUG A;  2E10 A;  3A8M B;  5I2S A;  3DLL A;  1UFF A;  2E3H A;  1QCN A;  4ATO A;  1Q95 G;  1M2O A;  1Y96 A;  2RJC A;  4XU2 A;  3WVE B;  3GF5 A;  2B86 A;  2VAS A;  2E3I A;  1I1J A;  2AZV A;  5GAN j;  3S3O A;  3JCM Q;  3M53 A;  4M7D C;  1VQ5 Q;  1YCY A;  1H92 A;  1VQK T;  1GBQ A;  2BIV A;  1BU1 A;  4OMM A;  2GTO A;  1JXM A;  2GF7 A;  4M78 E;  2NWM A;  3RDV A;  3I56 A;  2V1Q A;  1FWZ A;  2EKO A;  1BKB A;  2DIL A;  2LJ0 A;  1D0X A;  5GAO n;  1X43 A;  3G4S T;  5CAI A;  3JCM f;  3JB9 I;  4J9G A;  2PTK A;  2J06 A;  3NPF A;  4B6M A;  3M0Q A;  2RI5 A;  3CD6 Q;  4M7D G;  2FRY A;  2RK1 A;  1FX7 A;  2QQB A;  3L2W A;  2O2O A;  2RD1 A;  3EH2 A;  4JRI A;  2M0O A;  5GMK h;  1ZHI A;  1ABO A;  2JMC A;  3KBG A;  4J6Y A;  1OX8 A;  3CC4 A;  2A08 A;  2P0P A;  5KYX A;  4D8D A;  2KRO A;  5J3B A;  2FYK A;  1QP3 A;  4M78 B;  2XD0 A;  2DNU A;  1ZSZ C;  2ZPH B;  3G1J A;  2RI3 A;  3MCA B;  5GAO l;  4HVV A;  4X9D A;  2RB6 A;  4RTW A;  5KYU B;  1ZBJ A;  2DPP B;  5HCK A;  3OB9 A;  1G8X A;  1Q82 R;  5AT1 B;  2DTO A;  3E9F A;  2PVO B;  4O5V A;  4RTZ A;  1W6X A;  2C0I A;  5IAY A;  1KJW A;  1LOJ A;  1D09 B;  4J9F A;  1AWX A;  1V29 B;  3OMC A;  4PJO C;  3PVL A;  3CCV Q;  4FM4 B;  1M2V A;  1OZ3 A;  1Z9Q A;  3BW1 A;  4A54 A;  3CMA Q;  1M90 U;  1D0Y A;  2VVK A;  1VQP T;  1AEY A;  1XNI A;  3CCJ Q;  1E6G A;  4FSS A;  2XID A;  1OPL A;  1VQO A;  1RLP C;  1GFD A;  2XIC A;  1B34 A;  3M0R A;  4L5G A;  4QQ6 A;  4AG2 C;  1PRL C;  3BY7 A;  1Z9Z A;  2EFI A;  2QG9 B;  2CZ7 B;  5CQX A;  2RHU A;  4Y28 E;  1K9M U;  2CP2 A;  2EYY A;  2VYT A;  4XTX A;  5GAN e;  4FW1 A;  4B9W A;  3A8H B;  1RAF B;  3H41 A;  4IUU A;  3CCU T;  1MGQ A;  3E19 A;  3QSU A;  2K6D A;  1HSQ A;  3PFS A;  4RTT A;  4PLL A;  2M51 A;  2QQS A;  3EGX B;  2KE9 A;  3CCU A;  2MPX C;  4KBM B;  1N8R R;  3FDR A;  5KE3 A;  2YHT A;  2K79 A;  2QXF A;  1NJI U;  3A5Z B;  3CCR A;  4QQD A;  5L8R E;  3MHX A;  2FPD A;  2K5F A;  5GAN g;  2CDT A;  1OQK A;  2AKL A;  4LN2 A;  2LTO A;  1IXD A;  1E6H A;  4AFU C;  5I2M A;  1U1S A;  2F1L A;  2HCK A;  2MF2 A;  1CKB A;  1A0N B;  2AIR B;  4M77 C;  3CCL Q;  2CP5 A;  5FU7 C;  1G3S A;  5AYF A;  4OVA A;  2H8H A;  5LJ5 d;  3UT1 A;  1WHK A;  3G7Z A;  2OTL T;  1WI7 A;  1K8A C;  1UGV A;  2DM1 A;  5GJV B;  3PIO A;  4C5H A;  1AHJ B;  3SEM A;  2E5Q A;  2O4X A;  2JZ2 A;  5GAN h;  2OTL A;  3ZEH A;  2QDY B;  5LL6 S;  1I8F A;  3CCS A;  4IUP A;  3OMG A;  2DD5 A;  2L89 A;  2HQH A;  3ULR B;  2NUT A;  2M02 A;  3GOX A;  2Y90 A;  5GAN 7;  3JCM P;  2O31 A;  1VQ6 A;  1TXQ A;  5FLX E;  4RTU A;  1MMA A;  1YHQ T;  3L2R A;  2QEX T;  5GJW B;  5GMK m;  3H6Z A;  2L3P A;  2RHZ A;  3VUZ A;  2QA4 T;  5EG2 A;  1BYM A;  3QYH B;  3VS7 A;  1KIK A;  2OX7 A;  2MOX A;  2LQK A;  1YIJ Q;  2NUP B;  4XTV A;  1NYF A;  2DRK A;  2KDS A;  1PG5 B;  4NL3 A;  1PRM C;  5J39 A;  2DYI A;  3URG A;  3OYL A;  3JB9 H;  1ZBX A;  3REB B;  1QVG A;  5KYN A;  1VIF A;  4EDU A;  2KEA A;  4PFP A;  1M1K R;  1Q7Y R;  2KRS A;  3CCE A;  3SFM A;  4KRT A;  2F5T X;  3OBY A;  2QAS A;  1M8M A;  1WQ7 A;  3FB9 A;  1SF9 A;  2FZG B;  2MCN A;  3OBW A;  2YRC A;  2XHC A;  2RNA A;  4M7D D;  4XTW A;  4OB3 B;  3LH5 A;  3OYC A;  5KH6 A;  1YWO A;  1ZUU A;  4BB7 A;  4FCY A;  1PSE A;  4Y92 A;  3OYI A;  3KXT A;  5KYW B;  1QCF A;  2YUN A;  1YIT A;  2QQA A;  1BCM A;  2EQM A;  2E6Z A;  1IGU A;  2D8H A;  3EG9 A;  1M30 A;  1H64 1;  2R57 A;  2EGE A;  4CC3 A;  1YJN T;  2L8D A;  1YI2 T;  2BUD A;  5LJ5 f;  1UEC A;  2Y4Y A;  3OW2 P;  1YJN A;  3V7C A;  2DXB A;  1YI2 A;  3EHQ A;  2JS2 A;  1VOM A;  1BIB A;  2O01 E;  3CCQ A;  4FU6 A;  2RH2 A;  1PHT A;  5GAN 5;  4KGX B;  1GBR A;  1AWJ A;  4HT8 A;  1UGR B;  1ARK A;  1UDL A;  2M1H A;  2DLP A;  2K3Y A;  2FEI A;  1G3W A;  4LDY A;  5C0M A;  1UJY A;  5FRO A;  3OYE A;  2LMJ A;  4R56 A;  3V7S A;  1WPY A;  2DA9 A;  3QDF A;  4AT1 B;  2QGG A;  3UA6 A;  1I4K 1;  4PJJ A;  5GAM j;  3CCJ T;  1T0J A;  3RMQ A;  1U06 A;  2K3X A;  2E12 A;  1YCS B;  2J6F A;  3FEO A;  3P8B B;  4E2F B;  2CYZ B;  1K9A A;  2VXE A;  4JS4 A;  4PJO D;  2LCC A;  2HL5 C;  5I11 A;  1T0H A;  1NLO C;  5CKB A;  4FYX B;  2FL7 A;  4M7A C;  3SWN C;  2DL5 A;  4UC4 A;  4NS5 A;  1N5Z A;  1FXX A;  1AOJ A;  2J6K A;  1F1B B;  3J7A F;  4J7F A;  3EFO A;  5GMK i;  4KH0 B;  3O5Z A;  1K0S A;  1EFN A;  1J3T A;  3M4Y A;  1TG0 A;  4RMO A;  4RTX A;  1MV3 A;  2KAF A;  3CPW A;  2DKG A;  1YBY A;  4RKU E;  3P8H A;  3I55 A;  1Q81 C;  1U3O A;  2XDD A;  2EYX A;  1GRI A;  2J7I A;  5KE2 A;  3RUX A;  2WSE E;  3OS0 A;  2FG0 A;  2KBT A;  4EMK C;  2OAU A;  2KT8 A;  1NM7 A;  4OMO A;  1XQH A;  3JB9 D;  4KT0 E;  4PJM A;  1WHJ A;  3CCL T;  2HAX A;  1LJO A;  2ZAE A;  4F16 A;  4RTV A;  2QAZ A;  3LWH A;  3PT9 A;  4LE9 A;  4PK4 A;  2L2P A;  4M75 A;  4JLG A;  1K8A U;  1JBM A;  1QVG S;  2QK0 A;  1AZG B;  2PVD B;  3SHW A;  2C0T A;  2LDM A;  4M7D E;  3FLG A;  1TUC A;  4M77 D;  3OYF A;  2D8J A;  2KGT A;  1K73 C;  4F7U A;  1Y57 A;  3U23 A;  2C0O A;  2JTF A;  3R6O A;  5A0D A;  3GPL A;  3EGD B;  4JRK A;  3OYH A;  2P4T A;  3MP6 A;  4OMF B;  2CZ0 B;  3JCM d;  2ROL A;  1D1B A;  1LCK A;  3OQ5 A;  2DBK A;  2DX1 A;  3G71 T;  1M1K C;  2EGA A;  4C92 A;  3RIR A;  1MNE A;  4A53 A;  1QWE A;  1M9S A;  4KH1 B;  3CBM A;  3G71 A;  2DXT A;  5FWB A;  4PJO F;  4RG2 A;  1ZSG A;  2JXB A;  4LDU A;  1JXO A;  3PGG A;  3RBB B;  4JJC A;  5GAO p;  2VKN A;  1YIJ T;  2LCS A;  4A4E A;  1WJR A;  2YRV A;  4J7I A;  2DFU A;  3HRU A;  1I5O B;  1QVP A;  1RAB B;  2BKD N;  1JQQ A;  1VQN T;  2YLC A;  2MYS A;  2F2W A;  1WJQ A;  2P4R A;  3G6E Q;  1WQW A;  1FMK A;  3FJ5 A;  3PMT A;  1VQN A;  1W2B A;  4M75 G;  4C92 C;  5GAM g;  4GBQ A;  2EQI A;  2O9S A;  2X4J A;  3M0U A;  2KY9 A;  1JEG A;  3QBY A;  1YJ9 Q;  2JOY A;  3CME Q;  4BI8 B;  2G3R A;  4F7U G;  4ZN3 A;  3VS6 A;  2LT4 A;  2MI6 A;  1M3C A;  2K7A A;  2IPO B;  1K0X A;  3LGF A;  3JB9 F;  3HRS A;  2YRD A;  2HKQ B;  3M58 A;  1VQM Q;  5CKH A;  4PJO E;  4Y91 A; 
#chains in the Genus database with same CATH homology
 1VYU A;  1GFD A;  3M0R A;  4AG2 C;  4CC2 A;  2YSQ A;  1PRL C;  1Z9Z A;  2M0Y A;  4DEX A;  2BZY A;  2KNB B;  4R0K A;  2O9V A;  1SPK A;  4RTY A;  4J9D A;  2EYY A;  2AK5 A;  2GBQ A;  4CC4 B;  3VS0 A;  2EYZ A;  2YDL A;  3H41 A;  5FWC A;  1GL5 A;  2DRM A;  4J9C A;  2K3B A;  2K6D A;  1HSQ A;  4RTT A;  1M3B A;  5IHI A;  4IIM A;  2M51 A;  2AZS A;  1BB9 A;  2KE9 A;  4LUE A;  1WDX A;  2RQW A;  1V1C A;  2PZ1 A;  3TVT A;  2K79 A;  2DL4 A;  2RPN A;  1BK2 A;  4ESR A;  2LJ1 A;  1QWF A;  2LP5 A;  4JJB A;  2FPD A;  2ESW A;  4AG1 C;  2CDT A;  2KYM A;  1YN8 A;  2AKL A;  4LN2 A;  2BZX A;  2JMA A;  1RI9 A;  1E6H A;  4AFU C;  1UG1 A;  2HCK A;  2FRW A;  2FPE A;  1CKB A;  1A0N B;  2ROT A;  2A28 A;  2K2M A;  2KYB A;  1T3L A;  1VYT A;  2RQR A;  3EHR A;  2DVJ A;  2YUP A;  3H0I A;  2A37 A;  2H8H A;  1OOT A;  1VA7 A;  1UJ0 A;  3H0F A;  3NMZ C;  3EG0 A;  2DL3 A;  1WI7 A;  2GQI A;  1WA7 A;  1UGV A;  2DM1 A;  5GJV B;  1WFW A;  2CUD A;  3VS1 A;  3RNJ A;  3UAT A;  3SEM A;  4HVU A;  1I07 A;  1UHF A;  2DL7 A;  2ECZ A;  1PWT A;  3EG3 A;  3ULR B;  1T3S A;  5IHK A;  1E7O A;  2KR3 A;  2BTT A;  4ORZ A;  1SHG A;  2O31 A;  2EVR A;  1AD5 A;  4RTU A;  2JTE A;  1PNJ A;  4Z8A A;  4D8K A;  4J9I A;  3I35 A;  1S1N A;  1HD3 A;  3UA7 A;  2L0A A;  1PKS A;  1CKA A;  5GJW B;  2CSQ A;  1NLP C;  2L3P A;  2YUO A;  2V1R A;  3VS2 A;  4AFS C;  1SRL A;  2X3X D;  1OV3 A;  2ED1 A;  2GTJ A;  4AFQ C;  2JW4 A;  1I0C A;  2KRM A;  3VS7 A;  1KIK A;  1GCQ C;  1UE9 A;  2MOX A;  1B3Q A;  2XMF A;  1NYF A;  2DRK A;  1FYN A;  2ABL A;  2RQT A;  1PRM C;  1QKW A;  4F14 A;  2JM8 A;  3REB B;  2W10 A;  3VS3 A;  2KEA A;  3M0T A;  4M4Z A;  3I5R A;  1IO6 A;  3QWY A;  1AVZ C;  1WLP B;  2KRS A;  4OMQ A;  2CSI A;  2LQW A;  4KRT A;  3R6N A;  3KFV A;  1M8M A;  5ECA A;  4J9H A;  2IIM A;  1ZX6 A;  2MCN A;  2RNA A;  3PE0 A;  5IXF A;  1QLY A;  1WIE A;  1GFC A;  4JZ4 A;  3LH5 A;  2OAW A;  1XOV A;  3CQT A;  3UF4 A;  1WXT A;  1YWO A;  1ZUU A;  2PNI A;  2CT3 A;  2EYW A;  4Y92 A;  2LX7 A;  2DMO A;  1QCF A;  2E5K A;  3EGU A;  3NGP A;  2YUN A;  2EKH A;  2LNH B;  1TUD A;  1NEB A;  2D8H A;  4HXJ A;  1M30 A;  5FW9 A;  5IH2 A;  1X27 A;  2ENM A;  2EGE A;  2CH4 W;  1M3A A;  4CC3 A;  1RUW A;  3EG1 A;  4JPB W;  3C0C A;  1BBZ A;  2CH4 A;  2OI3 A;  1UEC A;  4OMP A;  1Y0M A;  5IXB A;  3EHQ A;  2JS2 A;  3M0S A;  2HDA A;  4DEY A;  1PHT A;  2L3Q A;  1GBR A;  1AWJ A;  1X2K A;  2VWF A;  2NUZ A;  4X1V A;  1KSW A;  1ARK A;  3JV3 A;  1UDL A;  2CUB A;  2JM9 A;  2DLP A;  4J9B A;  5IHN A;  2FEI A;  1G2B A;  1UJY A;  4A63 B;  2LMJ A;  3I5S A;  2JT4 A;  1NYG A;  4RUG A;  3ZL7 C;  2F2V A;  1MV0 B;  1K4U S;  1YP5 A;  1AZE A;  1ZUK A;  2DA9 A;  4LUD A;  3THK A;  4E6R A;  5EC7 A;  4JJD A;  3UA6 A;  4J9E A;  2HSP A;  1SEM A;  2RN8 A;  1YWP A;  2RQU A;  2HEQ A;  1T0J A;  2HBW A;  1U06 A;  2QDL A;  1YCS B;  2J6F A;  2RQV A;  1X69 A;  2CT4 A;  3TSZ A;  1K9A A;  4ZNX A;  2J6O A;  1GCP A;  4HVW A;  2LZ6 B;  2K9G A;  1OPK A;  5I11 A;  1T0H A;  1NLO C;  2FO0 A;  2CRE A;  1X2Q A;  2EBP A;  4OMN A;  1UHC A;  2DL5 A;  3EG2 A;  1MUZ A;  2KRN A;  3VS5 A;  1N5Z A;  4OML A;  1AOJ A;  2J6K A;  1ABQ A;  1U5S A;  2EGC A;  2I0N A;  2JS0 A;  3O5Z A;  1K0S A;  1EFN A;  1J3T A;  1M27 C;  1SHF A;  1TG0 A;  4RTX A;  2GNC A;  1H3H A;  1MV3 A;  2SEM A;  1K1Z A;  2FPF A;  2EW3 A;  4LNP A;  1X6B A;  2D1X A;  2KXC A;  1G83 A;  2LQN A;  1U3O A;  1WXB A;  2EYX A;  1GRI A;  2J7I A;  1UFF A;  2FG0 A;  2KBT A;  2KT8 A;  1NM7 A;  1NG2 A;  2KT1 A;  4OMO A;  1SRM A;  2MIO A;  4WCI A;  1KFZ A;  2DL8 A;  2B86 A;  1JO8 A;  1I1J A;  2RMO A;  2AZV A;  5L23 A;  4F16 A;  1VYV A;  3I9Q A;  1WXU A;  4RTV A;  1K76 A;  1H92 A;  4LE9 A;  1GBQ A;  2L2P A;  1RLQ C;  3NHN A;  1BU1 A;  4IIO A;  1WX6 A;  2OJ2 A;  1AZG B;  4OMM A;  3SHW A;  2C0T A;  2O88 A;  2GTO A;  1JXM A;  3A98 A;  3H0H A;  1TUC A;  2NWM A;  2V1Q A;  2D8J A;  2KGT A;  4F17 A;  1Y57 A;  2DIL A;  2SRC A;  3U23 A;  3TSW A;  2C0O A;  2LJ0 A;  1HJD A;  3M0P A;  2ED0 A;  1B07 A;  1X43 A;  4JZ3 A;  2G6F X;  4Z89 A;  2DYB A;  2L3S A;  1PKT A;  1UTI A;  4J9G A;  2PTK A;  2EPD A;  4EIK A;  2J06 A;  3NPF A;  2ROL A;  3M0Q A;  1LCK A;  2FRY A;  4AFZ C;  1H8K A;  2DBK A;  2DX1 A;  2O2O A;  3GBQ A;  1CSK A;  1ZLM A;  3VS4 A;  2DF6 A;  2EGA A;  2YT6 A;  1ABO A;  2JMC A;  2X3W D;  2RF0 A;  2YUQ A;  1QWE A;  2A08 A;  4Z88 A;  5FWB A;  3QWX X;  4D8D A;  4HCK A;  2KRO A;  1ZSG A;  2JXB A;  1QKX A;  1JXO A;  3RBB B;  1ZUY A;  4JJC A;  2BZ8 A;  1GCQ A;  2VKN A;  4CC7 A;  2DNU A;  2LCS A;  1WYX A;  3VRZ A;  2AKK A;  1JQQ A;  2F2X A;  4QT7 A;  1SSH A;  4HVV A;  2J05 A;  1W70 A;  2GGR A;  2LJ3 A;  4RTW A;  1ZBJ A;  1OEB A;  2F2W A;  5I22 A;  2P4R A;  5HCK A;  3VRY A;  1FMK A;  3FJ5 A;  2DBM A;  4RTZ A;  1W6X A;  1X6G A;  2C0I A;  4GBQ A;  2EQI A;  2O9S A;  1KJW A;  3M0U A;  2A36 A;  2KXD A;  4J9F A;  1W1F A;  1AWO A;  1JEG A;  2DJQ A;  1AWX A;  2W0Z A;  1NEG A;  1AWW A;  3PVL A;  1UUE A;  3PVQ A;  4K11 A;  3VS6 A;  1Z9Q A;  3IQL A;  1M3C A;  1JU5 C;  2K7A A;  2D0N A;  2VVK A;  1K0X A;  1AEY A;  3REA B;  1E6G A;  4GLM A;  4FSS A;  2DE0 X;  1OPL A;  1YNZ A;  1RLP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...