1G2BA

Alpha-spectrin src homology 3 domain, circular permutant, cut at n47-d48
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
MDRQGFVPAAYVKKLDSGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords SPECTRIN ALPHA CHAIN
publication title Atomic resolution structure of a mutant of the spectrin SH3 domain.
pubmed doi rcsb
source organism Gallus gallus
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2000-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1g2bA00
1ZSGA 3H0IA 1RLQC 1B3QA 1HSQA 1JO8A 2K2MA 4JZ3A 2X3WD 1M8MA 3VRZA 1X6GA 1NLPC 1QWEA 2CT4A 3CQTA 2ECZA 4D8DA 1GL5A 2FPEA 2MCNA 3VRYA 2YT6A 2KRSA 2DL7A 4CC4B 1CKAA 2BZ8A 4RTTA 2DL8A 2GQIA 2EGAA 1M3AA 2KR3A 2OI3A 1H92A 5GJVB 2DNUA 1SEMA 1AWJA 2BZYA 4M4ZA 3GBQA 2JM9A 3M0UA 2K6DA 5I11A 1QCFA 1H3HA 1N5ZA 3I5RA 2OJ2A 1AOJA 4AFUC 3KFVA 3UA6A 2VWFA 2KT8A 4K11A 1HJDA 2RMOA 2DJQA 2DA9A 4QT7A 3QWYA 2A08A 2L0AA 1AZGB 1UHCA 2ROTA 1WFWA 1NG2A 3EGUA 2QDLA 2J7IA 1RLPC 2F2VA 2KNBB 3PE0A 4CC2A 2O9SA 2FRWA 2KROA 3H41A 1NLOC 2HEQA 4J9CA 3UATA 1XOVA 2L3SA 2OAWA 2LJ1A 1M30A 3I35A 2DF6A 2F2WA 4HVWA 1VYUA 2YDLA 1WI7A 2KGTA 2X3XD 3FJ5A 3IQLA 2PTKA 1QKWA 1WX6A 2KXDA 4HCKA 1KJWA 3NHNA 1FYNA 1GRIA 1PHTA 1WLPB 3PVLA 4J9DA 1K4US 2HBWA 2GTJA 3ZL7C 2C0IA 1JU5C 4OMQA 1NM7A 2RQUA 1GFDA 2A28A 1PKTA 2BZXA 3QWXX 1I1JA 3VS3A 1PNJA 1NYFA 1ZUKA 2DRKA 2EKHA 2L3QA 1BBZA 3EG1A 4D8KA 2HDAA 4OMLA 1PRMC 2EYZA 1Y0MA 2DBKA 2LQWA 1X2KA 2RQRA 2JXBA 1JXOA 4LUEA 2EGCA 2LZ6B 2JT4A 2JMCA 1TUCA 2EYXA 2CUDA 1RUWA 4RTXA 3C0CA 3THKA 2J05A 5IXFA 2V1QA 1X43A 1ZUYA 1AEYA 2HSPA 4IIOA 2FG0A 5FW9A 3UF4A 3H0FA 4LN2A 4J9FA 1UE9A 2D1XA 2RQTA 4R0KA 4WCIA 2CH4A 2DM1A 1M27C 2LJ3A 2A37A 1X6BA 2FO0A 5HCKA 1UG1A 4AG1C 5L23A 2KYBA 4JJBA 2DRMA 3TVTA 2EYYA 3H0HA 4Z89A 2JTEA 3TSZA 4J9EA 2GNCA 2MOXA 3VS6A 2KRNA 2DVJA 4FSSA 1E7OA 2YUNA 4OMPA 2K7AA 2ROLA 3EHRA 2JMAA 2FPDA 2M51A 2JS0A 3NMZC 3EG3A 1SHGA 2JS2A 1U5SA 1X2QA 1X27A 2J06A 3M0TA 2DILA 4RTVA 1GCQC 2ESWA 3SHWA 3I9QA 4EIKA 1SRMA 2CSQA 1RI9A 1HD3A 2AZVA 3REAB 1Y57A 1PWTA 1WXBA 2A36A 2V1RA 4J9IA 1E6HA 1KFZA 2AKLA 4RTWA 1B07A 1X69A 2BTTA 4JPBW 4AFSC 2EPDA 2H8HA 5IHKA 1GCPA 1MV0B 2RPNA 3U23A 1VYVA 1BB9A 2PNIA 2YUPA 2VVKA 1OV3A 1WXTA 2K79A 2O2OA 1MV3A 2I0NA 2KBTA 5EC7A 1VA7A 5ECAA 1FMKA 1YNZA 1IO6A 5IXBA 5GJWB 2D8HA 1AD5A 4AFQC 2GGRA 1NYGA 2RQVA 1E6GA 2CH4W 1QKXA 2O31A 2RF0A 2SEMA 1V1CA 2CT3A 1S1NA 2CSIA 1GFCA 4HVUA 2AKKA 1UJYA 3NGPA 2J6FA 2DL3A 1AWOA 1SPKA 3PVQA 4X1VA 5I22A 3EG0A 2G6FX 4GLMA 1OEBA 4GBQA 1QWFA 1AVZC 5IH2A 3M0RA 2DX1A 1ABOA 1SSHA 3M0SA 4ORZA 4ZNXA 1K76A 1K1ZA 5IHNA 4LNPA 3ULRB 4F16A 5FWBA 3TSWA 4KRTA 1U3OA 1Z9QA 1JXMA 1AZEA 1BU1A 1T0HA 1T0JA 2ED1A 1OOTA 1ZBJA 3M0QA 1M3BA 3VS7A 4RTYA 1GBQA 2LX7A 2DMOA 2PZ1A 1G2BA 3VS2A 4ESRA 1M3CA 2KRMA 2MIOA 1JQQA 1I07A 1WXUA 2YUOA 2K9GA 1G83A 2SRCA 2O9VA 4J9BA 2W10A 4DEYA 1WA7A 2VKNA 1YN8A 1TUDA 4OMOA 2LQNA 2XMFA 1I0CA 2RN8A 2KT1A 3M0PA 4A63B 2IIMA 2EVRA 2L2PA 4CC7A 4HVVA 4CC3A 3VS5A 1CSKA 1J3TA 2YSQA 1ZUUA 4DEXA 2E5KA 2K3BA 2F2XA 2DYBA 2RQWA 3REBB 1ZX6A 1UFFA 1EFNA 3UA7A 2FPFA 1KIKA 2L3PA 1YCSB 2RNAA 1AWXA 2ENMA 3I5SA 2GBQA 2EBPA 2C0OA 4JJCA 1KSWA 1UGVA 2YUQA 2LCSA 2AK5A 1K0SA 3RNJA 1WIEA 4RUGA 2LMJA 4LUDA 2LP5A 1QLYA 2NUZA 2KE9A 1U06A 3EG2A 2HCKA 2DL4A 1A0NB 2B86A 2JM8A 4IIMA 4F17A 4OMMA 3R6NA 1UECA 1NEBA 1WDXA 4LE9A 1PKSA 5IHIA 2D0NA 1OPLA 1Z9ZA 2EYWA 1UJ0A 1UHFA 3RBBB 2KXCA 2ED0A 1VYTA 1ZLMA 4OMNA 2CREA 2NWMA 1W70A 2ABLA 4JZ4A 4Y92A 3VS1A 1UDLA 1CKBA 1SRLA 1WYXA 3NPFA 1K9AA 2EGEA 2LJ0A 4HXJA 1JEGA 2JW4A 4E6RA 2D8JA 2AZSA 2O88A 4Z88A 1YWPA 1GBRA 2FEIA 1ABQA 2DLPA 2DBMA 1K0XA 2LNHB 3JV3A 1T3SA 2DE0X 1UTIA 2CDTA 1MUZA 2C0TA 2W0ZA 1W6XA 3SEMA 1YWOA 1SHFA 1TG0A 1NEGA 4Z8AA 2M0YA 5FWCA 2CUBA 2KEAA 1AWWA 1LCKA 2EQIA 1PRLC 1GCQA 3VS0A 1ARKA 4RTZA 3LH5A 4AFZC 1H8KA 2EW3A 2P4RA 1OPKA 3EHQA 1UUEA 3O5ZA 4J9HA 2J6KA 2GTOA 2J6OA 2KYMA 4JJDA 3VS4A 1YP5A 4F14A 4AG2C 2DL5A 4J9GA 3A98A 4RTUA 1BK2A 1W1FA 2FRYA 1T3LA
chains in the Genus database with same CATH superfamily
1ZSGA 3CCSA 1VQ7A 2DAQA 3JCMQ 3TEEA 4JZ3A 5CKEA 1M8MA 2EKOA 3VRZA 4OB1B 1TTHB 4E7IA 1NLPC 2XIDA 3LWHA 1N8RR 4X34A 2V8JA 3G71A 3PTAA 1TSFA 3VRYA 3G6EQ 2DXCA 4F7UA 3M4YA 3EH2A 3FEOA 2CP0A 2XDBA 2EGAA 2FZKB 3C12A 3CC2Q 5LJ3g 1UGSB 2DNUA 5GMKe 1QVFP 3HL8A 2BZYA 4DBFA 4OGCA 2JM9A 2L89A 5CCAA 4KGZB 2K6DA 5I11A 1M8VA 4QVZA 1H3HA 1D3BA 1WHJA 1WHMA 3UA6A 1Q82C 4K11A 1HJDA 2DA9A 1U1SA 5GAOn 1VIEA 2Z0WA 1MHNA 1UHCA 4C92A 2COWA 4IUTA 3CMAA 1NG2A 4EMKA 4RCCA 1WHLA 4M78B 7AT1B 2F2VA 3PE0A 1VQ4T 2O9SA 1UGQB 3PIOA 4HT9A 2NUTA 3OS0A 4M7AC 4IUPA 2JOYA 2DIQA 3RMSA 2OAWA 5LJ5j 2DF6A 2QAZA 4JRPA 4HVWA 3IQLA 2KXDA 2PUOB 1KJWA 3NHNA 2PVGB 1FYNA 1VQ5A 3I55A 1WLPB 2D9TA 1HYOA 2RQUA 4ELZC 4JDSA 3VS3A 1BI2A 4HCCA 2NYSA 4BY6C 2L3QA 1RAHB 1M5Q1 1BBZA 3FB9A 2EYZA 2O4XA 2JXBA 2XI9A 3CCRT 2HKNA 1M1KR 3META 2V8IA 4PJOG 2YRDA 4IUUA 2EYXA 1NJIC 8ATCB 4J6XA 5GAN4 3HPWA 1I4K1 1WNLA 3C0CA 2QQ9A 1X43A 2FG0A 5FW9A 3UF4A 1VQPA 1OULA 4J9FA 1R0CB 4PJOD 2CH4A 3P8HA 4OVAA 3CD6Q 1YJ9Q 2LJ3A 3DLMA 1Q81U 2IVWA 2A37A 2YWWA 2DETA 4KH0B 1UG1A 4X9DA 5L23A 1W2BS 3FLGA 1KD1U 1M90U 2CP2A 3TVTA 1LPLA 3CCJQ 1VQ9T 4DOVA 5CVIA 4Z89A 4C5GA 3TSZA 2Y90A 2EWNA 3SWNA 4EMHA 1VQ6T 2DVJA 2A3LA 3OYMA 4XU3A 4OMPA 2QEXQ 2ROLA 2CS7A 1K8AU 1K73R 3CCEQ 5GAN5 2M51A 3NMZC 1VQ8A 5D7UA 1VQOQ 4ME7A 2D6FA 4C8QD 1X2QA 3M0TA 2H3JA 4RTVA 4NS5A 2VV5A 1YIJT 2ZAEA 2DYIA 3QUIA 4M7DF 4QQDA 3QJ6A 4LDUA 1Y57A 1WXBA 1V29B 1VQ7Q 4LD9K 4RTWA 1X69A 4JPBW 4AFSC 4BACA 1MV0B 3OYNA 1BB9A 2PNIA 2RJDA 1W4SA 2VVKA 1OV3A 1G3WA 3OSVA 5D6XA 3G71Q 1TOVA 4WTOB 2KBTA 1VA7A 1IO6A 3HRSA 1EX4A 4J5YA 4PNOA 4A4GA 3H6ZA 3NTKA 1AD5A 4C92G 2MWOA 1N8RU 3VKIA 4RKUE 2SEMA 2CT3A 4AT1B 4BD3A 1G8XA 1UJYA 2E4HA 3CCVT 2IG0A 2PU9B 3MPUB 1H3ZA 1SPKA 3PVQA 4X1VA 2LVMA 3M4GA 4DBQA 1QWFA 5AYFA 1KC8C 4C92D 5GAOl 1SSHA 2K5LA 4M7DB 2X4YA 4M7DC 3ULRB 2FYKA 4F16A 1VQ6A 1U3OA 3JCMh 1D0ZA 3CMAQ 2E1HA 3CCUA 2O01E 3M0QA 3VS7A 4RTYA 2YRCA 2LX7A 3H8ZA 3JCMd 4A4KA 4M77F 1M3CA 1FMWA 2E65A 2KRMA 3HP9A 2CGHA 3PGGA 4UC4A 4FYXB 2K9GA 2SRCA 2ZPEB 1BYMA 1YIJA 2VKNA 4OMOA 2YLBA 1QVGP 2MF2A 4M7DE 3ZEHA 1JJ2P 5LJ3j 1VQ5Q 3I55Q 4CC3A 3QYGB 3VS5A 1J3TA 4J7IA 4RG8A 4XU2A 4DEXA 2QGGA 2E5KA 3BDUA 3REBB 2LT1A 1EFNA 3UA7A 5FU6C 1KIKA 2RNAA 3S3MA 2FHDA 2C0OA 1KSWA 2MPXC 2LCSA 3JCMP 5EG2A 2MK5A 3RNJA 2F1LA 3OYYA 2HD0A 2KE9A 1NJIR 3EG2A 2RJCA 1S72T 1I8FA 2RJEA 1UECA 1WDXA 2GF7A 4PK4A 2DEUA 4LDYA 1PKSA 1X75C 3CPWP 2E5QA 1Z9ZA 1N9RA 2EYWA 1UJ0A 3CEYA 4M77B 1TXQA 4M77C 4IUVA 4PLLA 3BW1A 1VYTA 2JTFA 3QDRB 4OGEA 2K5FA 4Y92A 1M1KU 1VQKA 1VQPQ 3OYIA 2OTLA 1CKBA 2C06A 3NPFA 2IPOB 2LJ0A 4HXJA 4JUVA 2O88A 1JRIA 1YWPA 3A8LB 2RHXA 4XU0A 2X4JA 3DLLA 2DBMA 3CPFA 2GFUA 1T3SA 1UTIA 3E19A 4ZGEB 4YTLA 2JUFA 1WPYA 2COZA 1YWOA 2KVQG 1TG0A 1UB4A 4DA4A 1NEGA 2M0YA 2DZCA 4M77E 1H641 2R5MA 6AT1B 5CQXA 2EQIA 3RR6A 2KK4A 1OU8A 3LW5E 2AT1B 3JCMg 4RTZA 4AFZC 2P4RA 5DM7R 1BKBA 2YHTA 3EHQA 1UUEA 3O5ZA 2J6KA 1VQ8Q 2GTOA 3E1SA 3VS4A 2E6NA 1KQ1A 3M58A 4AG2C 4WF2A 3A98A 2LCCA 3TU4K 1W1FA 2FRYA 2GQVA 3H0IA 4HCZA 4Y91A 1HSQA 2NUTB 1G5VA 3ER0A 2X3WD 3L1AA 1K73U 4XQ3A 2WSEE 2MMPA 2HQEA 2ECZA 1I5OB 3J81E 3CC4A 5FRNA 3ZFJA 2FPEA 4LDVA 2JZ2A 4PFOA 1I5LA 4RTTA 3SFMA 4E7ZA 4M78G 3X25B 3HSBA 5CKBA 1YBYA 4M75F 4C0GA 1SEMA 1RAFB 4M4ZA 1K9MC 3GBQA 5CKDA 4OB0B 1U8RA 4E7LA 1N5ZA 3I5RA 4KGVB 1AOJA 2KT8A 1KQSA 4M7DA 4M78D 2DJQA 5CR2A 4E7KA 2P84A 3G4ST 1I81A 2HNIA 1KC8R 1F1BB 3EGXB 3OW2A 5CQYA 1AZGB 2MYSA 4QQGA 2ROTA 3CCQQ 2E64A 3CBMA 3MP1A 2H3EB 3RESA 1UGRB 1VQ6Q 3H41A 3QYHB 4LD6A 1XOVA 3CCUQ 2LQKA 4A4EA 5GAOm 2VUBA 1NZ9A 1R77A 2X3XD 3FJ5A 1WX6A 2JTMA 1QVFS 3JRZA 4HCKA 2M9UA 1PHTA 4M75B 1K4US 4ZGDB 5GANf 1YIJQ 3Q1JA 2RK2A 4MZPA 4OMQA 2CP3A 1GFDA 3GOXA 2RM4A 2BZXA 2GFAA 4PLIA 1PSEA 1PNJA 1ZUKA 3CXCA 2HDAA 1FX7A 2DBKA 2LQWA 2RQRA 1JXOA 3QIIA 4D6WA 3JCMe 2HZYA 2JT4A 4ZGJB 1D1CA 1TUCA 2LX9A 1RAGB 4M77A 4LXCA 4RTXA 4M75E 5FU7B 3PNWC 2VXEA 5FU7C 3QHSA 1PD1A 3L2WA 3LWIA 4M7AF 4IIOA 5FRMA 4IUQA 5KCOA 1QP3A 1UEBA 2D1XA 2RQTA 4WCIA 4L6V5 5GAMh 3DB4A 3L2RA 1YHQT 4FU6A 3H9NA 2KY9A 1VQKQ 1NJIU 2OTLQ 1X6OA 2DTIA 4AG1C 1QCNA 2KYBA 2B8AA 4E7SA 3T9NA 4PFZA 3H0HA 3RIRA 2F5KA 4Z02A 2QQSA 3GF5A 3LGFA 2DXBA 2E3HA 2BE9B 5GAOp 1WZOA 1E7OA 2K7AA 2A0FB 2DPPB 4J7FA 4EMGA 3SB2A 2M0OA 2JS0A 3OYLA 1MNDA 3EG3A 3S6WA 3CC7T 2EQUA 1HXDA 5KCHA 1B7TA 1X27A 5CAIA 1NPPA 2KQWA 1XTDA 4XTXA 5LJ5f 4M7AB 5IAYA 3I56T 5GAOq 3SHWA 4EIKA 2RH2A 5GAN7 2K4YA 1HD3A 1RABB 1PWTA 1M1GA 4J9IA 2P0QA 1B07A 8AT1B 5IHKA 2H8HA 2X51A 1VYVA 2YUPA 1M2VB 2K79A 4MMLA 1VQNT 2I0NA 3CC4Q 4M7DG 4A4HA 1BI1A 1FMKA 4FYYB 5ECAA 4B6MA 3G7ZA 2L5QA 2BUDA 4M7AE 1YI2T 4BY6B 1O75A 2K2VA 2RD1A 3HTRA 1YJNT 1TWBA 3M9QA 4FT2A 3VUZA 3FIFA 1QVPA 1KHCA 1K9MR 5KYWB 2HL3A 2O31A 1Q86C 1V1CA 1GFCA 4HVUA 1BCMA 1N27A 3EGXA 3NGPA 2VB6A 4C0ZA 2DL3A 2VXFA 2DTOA 2G6FX 4GLMA 1OEBA 1AVZC 5IH2A 3M0RA 2DX1A 4ORZA 2DKGA 3VJPA 5FWBA 2HBPA 1OX9A 1ZHIA 5GAMg 4HT8A 1JXMA 1WHKA 1BU1A 3VU3C 1T0JA 3URGA 4IURA 4NL3A 2DMOA 4J6WA 3VS2A 4ZTJA 3OB9A 3F70A 3EFOB 1KC8U 5I2MA 4M75A 1VQ4A 1YITT 2BIVA 1G83A 2O9VA 4J9BA 2W10A 3I56A 3JCMW 1WA7A 2X9HA 4XU1A 4ELYC 1I0CA 4J6YA 2IIMA 4CC7A 5LJ3e 4ZTFA 4KUDK 3CCLT 1WJQA 1D09B 2DZ9A 2RA2A 4M77G 3V8KA 2RQWA 4BE2A 2D0QB 3J7AF 3LX7A 2OAUA 1ZX6A 2XG8D 2KI7A 2RJFA 1YCSB 2ENMA 2GBQA 1WHGA 2YUQA 4O6JA 2AK5A 3QG1A 3UDCA 1WIEA 4PJNA 4C0DC 1OX8A 4F7UG 2LP5A 1EIFA 1YFNA 2HCKA 1A0NB 4IIMA 3OYDA 4Y28E 1YJNA 1RAAB 3JB9I 2MI6A 3CCSQ 5IHIA 2D0NA 1OPLA 1YCYA 3CCRA 3RBBB 2KXCA 3MJXA 3CMET 1QVGS 4JZ4A 3QZ9B 4FW2A 1JJ2S 1QW1A 1UDLA 2QTVA 2EGEA 2XD0A 4E6RA 1JB0E 2AHJB 2E41A 2AZSA 2VYTA 3OYGA 3OYEA 1PC0A 2FEIA 1K0XA 9ATCB 2DE0X 1VQMT 2C0TA 2CP6A 3GLXA 5LJ5h 5J39A 1Q82R 3EG9A 5FWCA 4MMKA 2XDPA 3DKMA 2KEAA 1LCKA 3MHXA 3OS1A 1YITA 1PRLC 4FT4A 3QSUA 1VQ9A 5GAN6 1ARKA 3WVDB 3S3OA 4M7AA 3LH5A 1YJWT 3CPWS 1H8KA 3CCMT 1SKUB 1W2BA 1VOMA 2DJZA 4DBRA 3G6ET 5D6YA 1YP5A 2QQAA 4J9GA 5L8RE 4RTUA 2X35A 2ZPFB 3MP6A 3AT1B 4O5VA 3MKDA 1KD1C 3CC2T 1JO8A 2K2MA 3VUBA 4LDWA 1QWEA 1M2VA 4L59A 3RUXA 2P0PA 4DQ2A 4JS5A 2JNGA 3E9GA 2F69A 5LJ3f 4C8QF 1M9SA 2WSCE 2CZ1B 2KRSA 4CC4B 1CKAA 3RKYA 4NL2A 2E3IA 3JB9G 1XNIA 2QGFB 2DL8A 1WJRA 5KYWA 2KR3A 1B34A 2OI3A 2P0KA 1TU0B 3O8VA 4PJOC 2M02A 4E2FB 5FU6B 1V76A 3CMEA 2RI2A 3TQ7P 2LTOA 1WQWA 1Q86R 1OU9A 2R58A 1BIBA 1QCFA 4AFUC 2K57A 3JB9D 3NFCA 2RMOA 2EFIA 2XICA 5GMKh 4M75G 1VQMA 1WFWA 1ZA2B 1MMGA 2J7IA 2QDLA 1RLPC 4RMOA 3EFRA 4EPCA 2OTJT 3CCVA 1K9MU 2FRWA 2KROA 4E7JA 3EFOA 5KYUB 1RACB 3UATA 1G3SA 4C8QB 2LJ1A 4C8QC 3QZ5B 1YJWA 4OP0A 2XU8A 4XTWA 3AHUA 3CCMA 4M75D 4PJJA 1WQ7A 2KGTA 3A8HB 2KMTA 4PL6A 2PTKA 4BI4A 4N4HA 4GLKA 1VQ4Q 1D0YA 3PVLA 4J9DA 2GTJA 3ZL7C 1LJOA 2A28A 1BCOA 1UGPB 4BDZA 1HK9A 2HMAA 4MDXA 5KYXB 3KUFA 3V8JA 4FSXA 2ZGWA 4C8QE 3QJYA 5DY9A 4OMLA 1PRMC 1KQ2A 3OS5A 3E9FA 2VASA 4LUEA 4ZN3A 3JB9H 2LCLA 2FZGB 4OF1A 1TS9A 2AIRB 3CD6T 1YJ9T 4NOYA 5GAMj 3MP8A 1VUBA 1RUWA 1ACMB 1RI0A 5CIUA 4CI0C 1TUGB 2J05A 5IXFA 1M1FA 2COYA 3D7SB 3CCJT 1RAEB 1ZUYA 2HSPA 4R55A 1YJNQ 3M53A 4MZTA 3VV0A 2CZ6B 3H0FA 3CCRQ 4LDXA 4C92C 4R0KA 1IGQA 1OI1A 1S72A 4EMKC 2I2LA 3ZBDA 3M59A 4QVDA 4KT0E 4DOWA 2RHIA 1M27C 2QEXT 3OYCA 1P92A 1BI3A 2HQXA 2QK0A 5HCKA 2OTJA 1PSFA 4M7AG 2CKKA 3CBOA 2EYYA 4KGXB 4L5GA 1KQSP 2GNCA 3VS6A 2KRNA 2Y4YA 4FSSA 4B9WA 3OW2P 4A54A 2DEQA 4CRIA 5GMKi 3EHRA 2JMAA 2DO3A 1G3TA 1VQLT 5A0DA 3MO8A 2FZCB 1YITQ 3OYFA 3PFSA 2JS2A 1VQ9Q 5M9OA 1M1KC 2DILA 1GCQC 2QTXA 3I9QA 1SRMA 4J83A 4GY5A 4XTYA 3RDVA 5KYYB 5AT1B 3PMTA 4QKUA 1Q82U 2CSQA 1RI9A 1PD0A 4XK8E 2VGNA 2AZVA 3E2UA 3BFMA 3REAB 3OMGA 2V1RA 1KFZA 2AKLA 3PMIA 2CZ0B 2BTTA 2MWPA 1C1AA 2EQJA 1M2OA 3L42A 3OY9A 4XAXB 1BI0A 2O2OA 2HQHA 1MV3A 3JCMb 1Y71A 3KXTA 2ZPGB 1TH7A 5IN1A 3GP8A 3CXCP 5GJWB 2D8HA 5A0LA 1R8OB 2HSEB 2GGRA 2CH4W 2EYQA 3VYHB 4C5EA 2RI3A 3UPUA 1IGUA 2AKKA 3CMEQ 1RL2A 2J6FA 2OX7A 3MEVA 3LYIA 2WSFE 1AWOA 1D1AA 1M4ZA 2EJFA 5I22A 4JS4A 3ASKA 3C4SA 2LDMA 3SD4A 1MGQA 2R5AA 1ABOA 4ZNXA 1K76A 1K1ZA 5IHNA 4LNPA 1D1BA 5KYUA 4JLIA 4Q5WA 4KRTA 4C8QA 2P4TA 3R6OA 3HRTA 1AZEA 1VQMQ 5GMKl 1T0HA 2ED1A 1Q86U 1ZBJA 3G4SA 1VQ5T 3I55T 3CCVQ 1LOJA 3HRUA 2ZCFB 1VQLA 4MZMA 2JVVA 4M78F 4QQ6A 3MEAA 2PZ1A 5CKFA 4ESRA 4RG2A 2MIOA 1JQQA 1I07A 4FIBA 3SDZA 1WXUA 2DXUA 1YJWQ 1OYXA 2R57A 5GAMd 3CCMQ 5C6SA 2CYZB 3QKJA 5KYXA 2RN8A 2QQRA 4A63B 2EVRA 4FL6A 4HVVA 4FYWB 1ZUUA 4XTZA 2K3BA 1X01A 2F2XA 2DYBA 1U1TA 3M54A 1O9SA 3OYBA 3UWNA 3EG9B 3HFNA 5J3BA 3I5SA 2EBPA 1AHJB 1UGVA 4XTVA 2LC4A 2KAFA 2JN0A 1K0SA 1QVFA 1VQPT 2PUKB 3X20B 4C5HA 1OQKA 2WACA 2NUZA 2XK0A 2DL4A 3J80E 4OMMA 5HY6A 3A8OB 1OZ2A 4E7HA 3EAEA 1NPRA 4M78C 1Q7YC 4HCBA 2Y4XA 3INZA 1ZLMA 4OMNA 1D0XA 2CREA 1XQHA 2NWMA 3JCMc 2ABLA 3VS1A 1WYXA 2K3YA 4BB7A 4ANJA 2JW4A 4JRKA 4EDUA 1S72Q 4Z88A 1GBRA 1PG5B 3OQ5A 2QA4T 2KDSA 1LNXA 2DLPA 1R0BG 3JCMf 3QDFA 1WGSA 3BDLA 3JV3A 1VQ8T 2VGMA 1ZBXA 4QVCA 2OTJQ 5CO7A 1QMCA 1MUZA 1B34B 1YHQA 1W6XA 3V7RA 4M78E 1SHFA 4Z8AA 1PCXA 4M7DD 2CZ7B 1SSFA 1AWWA 1ZA1B 1SG5A 1GCQA 3S3NA 5KYYA 5J26A 3L2ZA 2DTHA 2LT4A 1ZSZB 2KYMA 4JJDA 1ZSZC 3EGDB 1C0MA 1BK2A 5GANh 1DJ7B 1T3LA 1FMVA 1RLQC 1MNEA 2DERA 1B3QA 2K5IA 3CC7A 4V2SA 3PT9A 1X6GA 5LL6S 2CT4A 3JCMJ 1RADB 3QPHA 4C5IA 5GANd 3CQTA 4BDYA 3FJPA 4D8DA 2GCXA 4OB2B 1GL5A 1EZZB 1KK7A 3GNGA 3RKXA 5HK0A 2MCNA 2G3RA 2YT6A 3UT1A 2DL7A 2BZ8A 2PQWA 4VUBA 5A2QE 1IXDA 1OZ3A 5CKHA 3L2UA 2GQIA 1M3AA 1H92A 5GJVB 3OBYA 4BE0A 3CCQT 3LH0A 3P8DA 5GMKj 3MEUA 2LNVA 1AWJA 4C8QG 4JLGA 4R56A 4PJLA 3FC3A 1VQNA 3M0UA 4A53A 2OJ2A 3KFVA 4C0DB 2VWFA 2EQKA 1YI2A 3CCUT 2QA4A 1FWZA 4QT7A 3QWYA 4M77D 2A08A 2X4XA 2L0AA 3GPLA 2YRVA 3JCMV 3EGUA 2KNBB 2MAMA 1N9SA 4FCYA 4AMCA 2XHCA 4CC2A 3X28B 1QCOA 2M16A 1NLOC 1IRXA 2HEQA 3M55A 4J9CA 2L3SA 1KG1A 3V8LA 4PJMA 1M30A 3I35A 2F2WA 4F04B 3G4SQ 1VYUA 5IT9E 2YDLA 1VQLQ 2V26A 1WI7A 3EH1A 1QKWA 4C0FA 1VIFA 2RHZA 3BY7A 1GRIA 5GMKm 1BIAA 2HBWA 4DBHA 2C0IA 1JU5C 2QG9B 2X4WA 4PJOF 4JJNK 1NM7A 2FB7A 1PKTA 4FYVB 3QWXX 2BE7D 1I1JA 3N5BB 1RAIB 1W2BP 1NYFA 2DRKA 2EKHA 3FDRA 5LJ5d 3EG1A 4D8KA 3ME9A 3JAME 1Y0MA 1LVKA 4JRQA 1X2KA 1IHVA 5GANg 1PM3A 2EGCA 3CCLA 2LZ6B 2JMCA 4M78A 1VQKT 1Q81C 2CUDA 3A1PA 2FL7A 3GNFB 5GAMe 3CCQA 2OTLT 3THKA 2QASA 3DB3A 3L2VA 1M90C 1MMDA 2CP5A 2LRQA 2V1QA 4BUGA 3OYKA 4FM4B 1AEYA 1Q7YR 5D6WA 2DD5A 4LN2A 4ZN1A 3TREA 1UE9A 4N0AC 3M57A 1IB8A 2DM1A 1WJSA 1K8AC 5FROA 1X6BA 5GAN2 5DLOA 2FO0A 4KH1B 4PJOB 3L2QA 3OS2A 4JJBA 2HAXA 2NUPB 2DRMA 1SF9A 2EJGA 3CBPA 3OBWA 2JTEA 2ATCB 4J9EA 2L8DA 2MOXA 3RERA 4TVRA 4RCBA 1Y96B 4F7UF 2EIFA 2M1HA 4B9XA 3RMQA 1NE8A 1QVGA 1YHQQ 2YUNA 3OYJA 1JJ2A 1ZSZA 2FPDA 3C94A 2E6ZA 3HFOA 1SHGA 2HKQB 3EGDA 3VYGA 4KUIA 1U5SA 2J06A 4PJOE 2CP7A 3V7CA 2ESWA 4JRIA 3RKWA 3CC4T 4E47A 3EFSA 3X24B 3OSSC 2A36A 1E6HA 1GXIE 4C92F 1Y07A 2EPDA 4N4IA 3CC7Q 2E70A 1N8RC 3G6EA 5LJ5g 1GCPA 5C0MA 2RPNA 3P8BB 1C6VX 3CPWA 3U23A 1KQSS 2E12A 5A0GA 2RO0A 4BI8B 1WXTA 4XTUA 3I56Q 4MDWA 3OW2S 5EC7A 3CC2A 1YNZA 4ATOA 2EJ9A 5IXBA 5HKCA 2DXTA 3QXEB 3WVEB 4F7UB 2DD4A 5FLXE 3NTHA 4AFQC 2E10A 1NYGA 2RQVA 2XDDA 1FXXA 5I21A 3TCJA 1E6GA 2ZZDA 2YXYA 2F5TX 1QKXA 2RF0A 1WHHA 2ZPIB 1S1NA 2CSIA 5GAMf 3A8MB 1AT1B 5GAN8 1VQNQ 4FW1A 3EG0A 5GANe 4N4GA 4GBQA 2PVOB 2PVDB 1D3BB 1YI2Q 2QA4Q 4PKCC 3M0SA 3LGLA 3TSWA 3OYAA 1Z9QA 4F7UE 2RB6A 1NBEB 4C92B 1OOTA 4BI3A 4EMKB 3HKSA 1M3BA 3JB9F 4P5NA 1GBQA 2QDYB 3OMCA 3CXCS 3CCET 1G2BA 2KSSA 4OB3B 2DIGA 3A5ZB 2YUOA 1VQOT 5I2SA 2RHUA 2DVEA 3MCAB 2K3XA 2QXFA 2QI2A 1QP2A 4DEYA 5HK3A 5KE2A 5GAOr 1YN8A 1TUDA 1KHIA 2LQNA 3JSCA 2XMFA 2KT1A 2ZPHB 3M0PA 2ZPBB 4A4FA 2L2PA 3FRNA 3OYHA 3KBGA 4QW2A 4IKFA 1CSKA 2YSQA 3V7SA 3JCMX 4C92E 2BKDN 3CCST 3X26B 3PIPA 2DFUA 1UFFA 1VQ7T 4M7AD 1ZQ1A 2FPFA 2L3PA 1IZ6A 1AWXA 4KULA 3QO3A 4JJCA 4HKEA 3BE3A 1IHWA 3HHTB 3M56A 5LJ3h 2RK1A 2QQBA 2XKOC 4RUGA 2LMJA 3LLRA 3G71T 5CK9A 4LUDA 2JJ9A 1Y7XA 1QLYA 1U06A 1Q81R 4J8OA 2O4XB 3CCLQ 1N6AA 2EAYA 3GIBA 2B86A 2JM8A 4F17A 3R6NA 1NEBA 5LJ3d 1KD1R 1M90R 4LE9A 4N0AA 1G3YA 2V8KA 4OMFB 3JB9J 1UHFA 5KH6A 3M5AA 2ED0A 3CD6A 3C95A 3MEWA 1YJ9A 1W70A 4HA8A 4II1A 4PFPA 4X9CA 2EQMA 4PJOA 2LQ8A 1SRLA 2DK3A 1K9AA 1Q95G 2NUPA 1QQJA 3G1JA 1JEGA 2D8JA 5LJ5e 3WXMB 1K8AR 3OA6A 2YLCA 2QYZA 2HL5C 3CCJA 1XJWB 4BE1A 1MMAA 1ABQA 1Y96A 5KE3A 5KYNA 2LNHB 3NTIA 1Q7YU 2VC8A 3CMAT 2CDTA 2W0ZA 4M75C 3SEMA 2QEXA 3CCEA 3QBYA 2CUBA 2NLUA 1JBMA 5DLQE 5GANj 1VQOA 3SWNB 2A7YA 1K73C 3SWNC 3VS0A 2RHYA 2FVUA 4KBMB 2EW3A 1OPKA 2L3RA 4J9HA 1MMNA 3A8GB 2J6OA 2RI5A 4F14A 2DL5A 5GAN3 1IREB
chains in the Genus database with same CATH topology
1ZSGA 3H0IA 1RLQC 1B3QA 1HSQA 1JO8A 2K2MA 4JZ3A 2X3WD 1M8MA 3VRZA 1X6GA 1NLPC 1QWEA 2CT4A 3CQTA 2ECZA 4D8DA 1GL5A 2FPEA 2MCNA 3VRYA 2YT6A 2KRSA 2DL7A 4CC4B 1CKAA 2BZ8A 4RTTA 2DL8A 2GQIA 2EGAA 1M3AA 2KR3A 2OI3A 1H92A 5GJVB 2DNUA 1SEMA 1AWJA 2BZYA 4M4ZA 3GBQA 2JM9A 3M0UA 2K6DA 5I11A 1QCFA 1H3HA 1N5ZA 3I5RA 2OJ2A 1AOJA 4AFUC 3KFVA 3UA6A 2VWFA 2KT8A 4K11A 1HJDA 2RMOA 2DJQA 2DA9A 4QT7A 3QWYA 2A08A 2L0AA 1AZGB 1UHCA 2ROTA 1WFWA 1NG2A 3EGUA 2QDLA 2J7IA 1RLPC 2F2VA 2KNBB 3PE0A 4CC2A 2O9SA 2FRWA 2KROA 3H41A 1NLOC 2HEQA 4J9CA 3UATA 1XOVA 2L3SA 2OAWA 2LJ1A 1M30A 3I35A 2DF6A 2F2WA 4HVWA 1VYUA 2YDLA 1WI7A 2KGTA 2X3XD 3FJ5A 3IQLA 2PTKA 1QKWA 1WX6A 2KXDA 4HCKA 1KJWA 3NHNA 1FYNA 1GRIA 1PHTA 1WLPB 3PVLA 4J9DA 1K4US 2HBWA 2GTJA 3ZL7C 2C0IA 1JU5C 4OMQA 1NM7A 2RQUA 1GFDA 2A28A 1PKTA 2BZXA 3QWXX 1I1JA 3VS3A 1PNJA 1NYFA 1ZUKA 2DRKA 2EKHA 2L3QA 1BBZA 3EG1A 4D8KA 2HDAA 4OMLA 1PRMC 2EYZA 1Y0MA 2DBKA 2LQWA 1X2KA 2RQRA 2JXBA 1JXOA 4LUEA 2EGCA 2LZ6B 2JT4A 2JMCA 1TUCA 2EYXA 2CUDA 1RUWA 4RTXA 3C0CA 3THKA 2J05A 5IXFA 2V1QA 1X43A 1ZUYA 1AEYA 2HSPA 4IIOA 2FG0A 5FW9A 3UF4A 3H0FA 4LN2A 4J9FA 1UE9A 2D1XA 2RQTA 4R0KA 4WCIA 2CH4A 2DM1A 1M27C 2LJ3A 2A37A 1X6BA 2FO0A 5HCKA 1UG1A 4AG1C 5L23A 2KYBA 4JJBA 2DRMA 3TVTA 2EYYA 3H0HA 4Z89A 2JTEA 3TSZA 4J9EA 2GNCA 2MOXA 3VS6A 2KRNA 2DVJA 4FSSA 1E7OA 2YUNA 4OMPA 2K7AA 2ROLA 3EHRA 2JMAA 2FPDA 2M51A 2JS0A 3NMZC 3EG3A 1SHGA 2JS2A 1U5SA 1X2QA 1X27A 2J06A 3M0TA 2DILA 4RTVA 1GCQC 2ESWA 3SHWA 3I9QA 4EIKA 1SRMA 2CSQA 1RI9A 1HD3A 2AZVA 3REAB 1Y57A 1PWTA 1WXBA 2A36A 2V1RA 4J9IA 1E6HA 1KFZA 2AKLA 4RTWA 1B07A 1X69A 2BTTA 4JPBW 4AFSC 2EPDA 2H8HA 5IHKA 1GCPA 1MV0B 2RPNA 3U23A 1VYVA 1BB9A 2PNIA 2YUPA 2VVKA 1OV3A 1WXTA 2K79A 2O2OA 1MV3A 2I0NA 2KBTA 5EC7A 1VA7A 5ECAA 1FMKA 1YNZA 1IO6A 5IXBA 5GJWB 2D8HA 1AD5A 4AFQC 2GGRA 1NYGA 2RQVA 1E6GA 2CH4W 1QKXA 2O31A 2RF0A 2SEMA 1V1CA 2CT3A 1S1NA 2CSIA 1GFCA 4HVUA 2AKKA 1UJYA 3NGPA 2J6FA 2DL3A 1AWOA 1SPKA 3PVQA 4X1VA 5I22A 3EG0A 2G6FX 4GLMA 1OEBA 4GBQA 1QWFA 1AVZC 5IH2A 3M0RA 2DX1A 1ABOA 1SSHA 3M0SA 4ORZA 4ZNXA 1K76A 1K1ZA 5IHNA 4LNPA 3ULRB 4F16A 5FWBA 3TSWA 4KRTA 1U3OA 1Z9QA 1JXMA 1AZEA 1BU1A 1T0HA 1T0JA 2ED1A 1OOTA 1ZBJA 3M0QA 1M3BA 3VS7A 4RTYA 1GBQA 2LX7A 2DMOA 2PZ1A 1G2BA 3VS2A 4ESRA 1M3CA 2KRMA 2MIOA 1JQQA 1I07A 1WXUA 2YUOA 2K9GA 1G83A 2SRCA 2O9VA 4J9BA 2W10A 4DEYA 1WA7A 2VKNA 1YN8A 1TUDA 4OMOA 2LQNA 2XMFA 1I0CA 2RN8A 2KT1A 3M0PA 4A63B 2IIMA 2EVRA 2L2PA 4CC7A 4HVVA 4CC3A 3VS5A 1CSKA 1J3TA 2YSQA 1ZUUA 4DEXA 2E5KA 2K3BA 2F2XA 2DYBA 2RQWA 3REBB 1ZX6A 1UFFA 1EFNA 3UA7A 2FPFA 1KIKA 2L3PA 1YCSB 2RNAA 1AWXA 2ENMA 3I5SA 2GBQA 2EBPA 2C0OA 4JJCA 1KSWA 1UGVA 2YUQA 2LCSA 2AK5A 1K0SA 3RNJA 1WIEA 4RUGA 2LMJA 4LUDA 2LP5A 1QLYA 2NUZA 2KE9A 1U06A 3EG2A 2HCKA 2DL4A 1A0NB 2B86A 2JM8A 4IIMA 4F17A 4OMMA 3R6NA 1UECA 1NEBA 1WDXA 4LE9A 1PKSA 5IHIA 2D0NA 1OPLA 1Z9ZA 2EYWA 1UJ0A 1UHFA 3RBBB 2KXCA 2ED0A 1VYTA 1ZLMA 4OMNA 2CREA 2NWMA 1W70A 2ABLA 4JZ4A 4Y92A 3VS1A 1UDLA 1CKBA 1SRLA 1WYXA 3NPFA 1K9AA 2EGEA 2LJ0A 4HXJA 1JEGA 2JW4A 4E6RA 2D8JA 2AZSA 2O88A 4Z88A 1YWPA 1GBRA 2FEIA 1ABQA 2DLPA 2DBMA 1K0XA 2LNHB 3JV3A 1T3SA 2DE0X 1UTIA 2CDTA 1MUZA 2C0TA 2W0ZA 1W6XA 3SEMA 1YWOA 1SHFA 1TG0A 1NEGA 4Z8AA 2M0YA 5FWCA 2CUBA 2KEAA 1AWWA 1LCKA 2EQIA 1PRLC 1GCQA 3VS0A 1ARKA 4RTZA 3LH5A 4AFZC 1H8KA 2EW3A 2P4RA 1OPKA 3EHQA 1UUEA 3O5ZA 4J9HA 2J6KA 2GTOA 2J6OA 2KYMA 4JJDA 3VS4A 1YP5A 4F14A 4AG2C 2DL5A 4J9GA 3A98A 4RTUA 1BK2A 1W1FA 2FRYA 1T3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSG A;  3H0I A;  1RLQ C;  1B3Q A;  1HSQ A;  1JO8 A;  2K2M A;  4JZ3 A;  2X3W D;  1M8M A;  3VRZ A;  1X6G A;  1NLP C;  1QWE A;  2CT4 A;  3CQT A;  2ECZ A;  4D8D A;  1GL5 A;  2FPE A;  2MCN A;  3VRY A;  2YT6 A;  2KRS A;  2DL7 A;  4CC4 B;  1CKA A;  2BZ8 A;  4RTT A;  2DL8 A;  2GQI A;  2EGA A;  1M3A A;  2KR3 A;  2OI3 A;  1H92 A;  5GJV B;  2DNU A;  1SEM A;  1AWJ A;  2BZY A;  4M4Z A;  3GBQ A;  2JM9 A;  3M0U A;  2K6D A;  5I11 A;  1QCF A;  1H3H A;  1N5Z A;  3I5R A;  2OJ2 A;  1AOJ A;  4AFU C;  3KFV A;  3UA6 A;  2VWF A;  2KT8 A;  4K11 A;  1HJD A;  2RMO A;  2DJQ A;  2DA9 A;  4QT7 A;  3QWY A;  2A08 A;  2L0A A;  1AZG B;  1UHC A;  2ROT A;  1WFW A;  1NG2 A;  3EGU A;  2QDL A;  2J7I A;  1RLP C;  2F2V A;  2KNB B;  3PE0 A;  4CC2 A;  2O9S A;  2FRW A;  2KRO A;  3H41 A;  1NLO C;  2HEQ A;  4J9C A;  3UAT A;  1XOV A;  2L3S A;  2OAW A;  2LJ1 A;  1M30 A;  3I35 A;  2DF6 A;  2F2W A;  4HVW A;  1VYU A;  2YDL A;  1WI7 A;  2KGT A;  2X3X D;  3FJ5 A;  3IQL A;  2PTK A;  1QKW A;  1WX6 A;  2KXD A;  4HCK A;  1KJW A;  3NHN A;  1FYN A;  1GRI A;  1PHT A;  1WLP B;  3PVL A;  4J9D A;  1K4U S;  2HBW A;  2GTJ A;  3ZL7 C;  2C0I A;  1JU5 C;  4OMQ A;  1NM7 A;  2RQU A;  1GFD A;  2A28 A;  1PKT A;  2BZX A;  3QWX X;  1I1J A;  3VS3 A;  1PNJ A;  1NYF A;  1ZUK A;  2DRK A;  2EKH A;  2L3Q A;  1BBZ A;  3EG1 A;  4D8K A;  2HDA A;  4OML A;  1PRM C;  2EYZ A;  1Y0M A;  2DBK A;  2LQW A;  1X2K A;  2RQR A;  2JXB A;  1JXO A;  4LUE A;  2EGC A;  2LZ6 B;  2JT4 A;  2JMC A;  1TUC A;  2EYX A;  2CUD A;  1RUW A;  4RTX A;  3C0C A;  3THK A;  2J05 A;  5IXF A;  2V1Q A;  1X43 A;  1ZUY A;  1AEY A;  2HSP A;  4IIO A;  2FG0 A;  5FW9 A;  3UF4 A;  3H0F A;  4LN2 A;  4J9F A;  1UE9 A;  2D1X A;  2RQT A;  4R0K A;  4WCI A;  2CH4 A;  2DM1 A;  1M27 C;  2LJ3 A;  2A37 A;  1X6B A;  2FO0 A;  5HCK A;  1UG1 A;  4AG1 C;  5L23 A;  2KYB A;  4JJB A;  2DRM A;  3TVT A;  2EYY A;  3H0H A;  4Z89 A;  2JTE A;  3TSZ A;  4J9E A;  2GNC A;  2MOX A;  3VS6 A;  2KRN A;  2DVJ A;  4FSS A;  1E7O A;  2YUN A;  4OMP A;  2K7A A;  2ROL A;  3EHR A;  2JMA A;  2FPD A;  2M51 A;  2JS0 A;  3NMZ C;  3EG3 A;  1SHG A;  2JS2 A;  1U5S A;  1X2Q A;  1X27 A;  2J06 A;  3M0T A;  2DIL A;  4RTV A;  1GCQ C;  2ESW A;  3SHW A;  3I9Q A;  4EIK A;  1SRM A;  2CSQ A;  1RI9 A;  1HD3 A;  2AZV A;  3REA B;  1Y57 A;  1PWT A;  1WXB A;  2A36 A;  2V1R A;  4J9I A;  1E6H A;  1KFZ A;  2AKL A;  4RTW A;  1B07 A;  1X69 A;  2BTT A;  4JPB W;  4AFS C;  2EPD A;  2H8H A;  5IHK A;  1GCP A;  1MV0 B;  2RPN A;  3U23 A;  1VYV A;  1BB9 A;  2PNI A;  2YUP A;  2VVK A;  1OV3 A;  1WXT A;  2K79 A;  2O2O A;  1MV3 A;  2I0N A;  2KBT A;  5EC7 A;  1VA7 A;  5ECA A;  1FMK A;  1YNZ A;  1IO6 A;  5IXB A;  5GJW B;  2D8H A;  1AD5 A;  4AFQ C;  2GGR A;  1NYG A;  2RQV A;  1E6G A;  2CH4 W;  1QKX A;  2O31 A;  2RF0 A;  2SEM A;  1V1C A;  2CT3 A;  1S1N A;  2CSI A;  1GFC A;  4HVU A;  2AKK A;  1UJY A;  3NGP A;  2J6F A;  2DL3 A;  1AWO A;  1SPK A;  3PVQ A;  4X1V A;  5I22 A;  3EG0 A;  2G6F X;  4GLM A;  1OEB A;  4GBQ A;  1QWF A;  1AVZ C;  5IH2 A;  3M0R A;  2DX1 A;  1ABO A;  1SSH A;  3M0S A;  4ORZ A;  4ZNX A;  1K76 A;  1K1Z A;  5IHN A;  4LNP A;  3ULR B;  4F16 A;  5FWB A;  3TSW A;  4KRT A;  1U3O A;  1Z9Q A;  1JXM A;  1AZE A;  1BU1 A;  1T0H A;  1T0J A;  2ED1 A;  1OOT A;  1ZBJ A;  3M0Q A;  1M3B A;  3VS7 A;  4RTY A;  1GBQ A;  2LX7 A;  2DMO A;  2PZ1 A;  1G2B A;  3VS2 A;  4ESR A;  1M3C A;  2KRM A;  2MIO A;  1JQQ A;  1I07 A;  1WXU A;  2YUO A;  2K9G A;  1G83 A;  2SRC A;  2O9V A;  4J9B A;  2W10 A;  4DEY A;  1WA7 A;  2VKN A;  1YN8 A;  1TUD A;  4OMO A;  2LQN A;  2XMF A;  1I0C A;  2RN8 A;  2KT1 A;  3M0P A;  4A63 B;  2IIM A;  2EVR A;  2L2P A;  4CC7 A;  4HVV A;  4CC3 A;  3VS5 A;  1CSK A;  1J3T A;  2YSQ A;  1ZUU A;  4DEX A;  2E5K A;  2K3B A;  2F2X A;  2DYB A;  2RQW A;  3REB B;  1ZX6 A;  1UFF A;  1EFN A;  3UA7 A;  2FPF A;  1KIK A;  2L3P A;  1YCS B;  2RNA A;  1AWX A;  2ENM A;  3I5S A;  2GBQ A;  2EBP A;  2C0O A;  4JJC A;  1KSW A;  1UGV A;  2YUQ A;  2LCS A;  2AK5 A;  1K0S A;  3RNJ A;  1WIE A;  4RUG A;  2LMJ A;  4LUD A;  2LP5 A;  1QLY A;  2NUZ A;  2KE9 A;  1U06 A;  3EG2 A;  2HCK A;  2DL4 A;  1A0N B;  2B86 A;  2JM8 A;  4IIM A;  4F17 A;  4OMM A;  3R6N A;  1UEC A;  1NEB A;  1WDX A;  4LE9 A;  1PKS A;  5IHI A;  2D0N A;  1OPL A;  1Z9Z A;  2EYW A;  1UJ0 A;  1UHF A;  3RBB B;  2KXC A;  2ED0 A;  1VYT A;  1ZLM A;  4OMN A;  2CRE A;  2NWM A;  1W70 A;  2ABL A;  4JZ4 A;  4Y92 A;  3VS1 A;  1UDL A;  1CKB A;  1SRL A;  1WYX A;  3NPF A;  1K9A A;  2EGE A;  2LJ0 A;  4HXJ A;  1JEG A;  2JW4 A;  4E6R A;  2D8J A;  2AZS A;  2O88 A;  4Z88 A;  1YWP A;  1GBR A;  2FEI A;  1ABQ A;  2DLP A;  2DBM A;  1K0X A;  2LNH B;  3JV3 A;  1T3S A;  2DE0 X;  1UTI A;  2CDT A;  1MUZ A;  2C0T A;  2W0Z A;  1W6X A;  3SEM A;  1YWO A;  1SHF A;  1TG0 A;  1NEG A;  4Z8A A;  2M0Y A;  5FWC A;  2CUB A;  2KEA A;  1AWW A;  1LCK A;  2EQI A;  1PRL C;  1GCQ A;  3VS0 A;  1ARK A;  4RTZ A;  3LH5 A;  4AFZ C;  1H8K A;  2EW3 A;  2P4R A;  1OPK A;  3EHQ A;  1UUE A;  3O5Z A;  4J9H A;  2J6K A;  2GTO A;  2J6O A;  2KYM A;  4JJD A;  3VS4 A;  1YP5 A;  4F14 A;  4AG2 C;  2DL5 A;  4J9G A;  3A98 A;  4RTU A;  1BK2 A;  1W1F A;  2FRY A;  1T3L A; 
#chains in the Genus database with same CATH topology
 1ZSG A;  3CCS A;  1VQ7 A;  2DAQ A;  3JCM Q;  3TEE A;  4JZ3 A;  5CKE A;  1M8M A;  2EKO A;  3VRZ A;  4OB1 B;  1TTH B;  4E7I A;  1NLP C;  2XID A;  3LWH A;  1N8R R;  4X34 A;  2V8J A;  3G71 A;  3PTA A;  1TSF A;  3VRY A;  3G6E Q;  2DXC A;  4F7U A;  3M4Y A;  3EH2 A;  3FEO A;  2CP0 A;  2XDB A;  2EGA A;  2FZK B;  3C12 A;  3CC2 Q;  5LJ3 g;  1UGS B;  2DNU A;  5GMK e;  1QVF P;  3HL8 A;  2BZY A;  4DBF A;  4OGC A;  2JM9 A;  2L89 A;  5CCA A;  4KGZ B;  2K6D A;  5I11 A;  1M8V A;  4QVZ A;  1H3H A;  1D3B A;  1WHJ A;  1WHM A;  3UA6 A;  1Q82 C;  4K11 A;  1HJD A;  2DA9 A;  1U1S A;  5GAO n;  1VIE A;  2Z0W A;  1MHN A;  1UHC A;  4C92 A;  2COW A;  4IUT A;  3CMA A;  1NG2 A;  4EMK A;  4RCC A;  1WHL A;  4M78 B;  7AT1 B;  2F2V A;  3PE0 A;  1VQ4 T;  2O9S A;  1UGQ B;  3PIO A;  4HT9 A;  2NUT A;  3OS0 A;  4M7A C;  4IUP A;  2JOY A;  2DIQ A;  3RMS A;  2OAW A;  5LJ5 j;  2DF6 A;  2QAZ A;  4JRP A;  4HVW A;  3IQL A;  2KXD A;  2PUO B;  1KJW A;  3NHN A;  2PVG B;  1FYN A;  1VQ5 A;  3I55 A;  1WLP B;  2D9T A;  1HYO A;  2RQU A;  4ELZ C;  4JDS A;  3VS3 A;  1BI2 A;  4HCC A;  2NYS A;  4BY6 C;  2L3Q A;  1RAH B;  1M5Q 1;  1BBZ A;  3FB9 A;  2EYZ A;  2O4X A;  2JXB A;  2XI9 A;  3CCR T;  2HKN A;  1M1K R;  3MET A;  2V8I A;  4PJO G;  2YRD A;  4IUU A;  2EYX A;  1NJI C;  8ATC B;  4J6X A;  5GAN 4;  3HPW A;  1I4K 1;  1WNL A;  3C0C A;  2QQ9 A;  1X43 A;  2FG0 A;  5FW9 A;  3UF4 A;  1VQP A;  1OUL A;  4J9F A;  1R0C B;  4PJO D;  2CH4 A;  3P8H A;  4OVA A;  3CD6 Q;  1YJ9 Q;  2LJ3 A;  3DLM A;  1Q81 U;  2IVW A;  2A37 A;  2YWW A;  2DET A;  4KH0 B;  1UG1 A;  4X9D A;  5L23 A;  1W2B S;  3FLG A;  1KD1 U;  1M90 U;  2CP2 A;  3TVT A;  1LPL A;  3CCJ Q;  1VQ9 T;  4DOV A;  5CVI A;  4Z89 A;  4C5G A;  3TSZ A;  2Y90 A;  2EWN A;  3SWN A;  4EMH A;  1VQ6 T;  2DVJ A;  2A3L A;  3OYM A;  4XU3 A;  4OMP A;  2QEX Q;  2ROL A;  2CS7 A;  1K8A U;  1K73 R;  3CCE Q;  5GAN 5;  2M51 A;  3NMZ C;  1VQ8 A;  5D7U A;  1VQO Q;  4ME7 A;  2D6F A;  4C8Q D;  1X2Q A;  3M0T A;  2H3J A;  4RTV A;  4NS5 A;  2VV5 A;  1YIJ T;  2ZAE A;  2DYI A;  3QUI A;  4M7D F;  4QQD A;  3QJ6 A;  4LDU A;  1Y57 A;  1WXB A;  1V29 B;  1VQ7 Q;  4LD9 K;  4RTW A;  1X69 A;  4JPB W;  4AFS C;  4BAC A;  1MV0 B;  3OYN A;  1BB9 A;  2PNI A;  2RJD A;  1W4S A;  2VVK A;  1OV3 A;  1G3W A;  3OSV A;  5D6X A;  3G71 Q;  1TOV A;  4WTO B;  2KBT A;  1VA7 A;  1IO6 A;  3HRS A;  1EX4 A;  4J5Y A;  4PNO A;  4A4G A;  3H6Z A;  3NTK A;  1AD5 A;  4C92 G;  2MWO A;  1N8R U;  3VKI A;  4RKU E;  2SEM A;  2CT3 A;  4AT1 B;  4BD3 A;  1G8X A;  1UJY A;  2E4H A;  3CCV T;  2IG0 A;  2PU9 B;  3MPU B;  1H3Z A;  1SPK A;  3PVQ A;  4X1V A;  2LVM A;  3M4G A;  4DBQ A;  1QWF A;  5AYF A;  1KC8 C;  4C92 D;  5GAO l;  1SSH A;  2K5L A;  4M7D B;  2X4Y A;  4M7D C;  3ULR B;  2FYK A;  4F16 A;  1VQ6 A;  1U3O A;  3JCM h;  1D0Z A;  3CMA Q;  2E1H A;  3CCU A;  2O01 E;  3M0Q A;  3VS7 A;  4RTY A;  2YRC A;  2LX7 A;  3H8Z A;  3JCM d;  4A4K A;  4M77 F;  1M3C A;  1FMW A;  2E65 A;  2KRM A;  3HP9 A;  2CGH A;  3PGG A;  4UC4 A;  4FYX B;  2K9G A;  2SRC A;  2ZPE B;  1BYM A;  1YIJ A;  2VKN A;  4OMO A;  2YLB A;  1QVG P;  2MF2 A;  4M7D E;  3ZEH A;  1JJ2 P;  5LJ3 j;  1VQ5 Q;  3I55 Q;  4CC3 A;  3QYG B;  3VS5 A;  1J3T A;  4J7I A;  4RG8 A;  4XU2 A;  4DEX A;  2QGG A;  2E5K A;  3BDU A;  3REB B;  2LT1 A;  1EFN A;  3UA7 A;  5FU6 C;  1KIK A;  2RNA A;  3S3M A;  2FHD A;  2C0O A;  1KSW A;  2MPX C;  2LCS A;  3JCM P;  5EG2 A;  2MK5 A;  3RNJ A;  2F1L A;  3OYY A;  2HD0 A;  2KE9 A;  1NJI R;  3EG2 A;  2RJC A;  1S72 T;  1I8F A;  2RJE A;  1UEC A;  1WDX A;  2GF7 A;  4PK4 A;  2DEU A;  4LDY A;  1PKS A;  1X75 C;  3CPW P;  2E5Q A;  1Z9Z A;  1N9R A;  2EYW A;  1UJ0 A;  3CEY A;  4M77 B;  1TXQ A;  4M77 C;  4IUV A;  4PLL A;  3BW1 A;  1VYT A;  2JTF A;  3QDR B;  4OGE A;  2K5F A;  4Y92 A;  1M1K U;  1VQK A;  1VQP Q;  3OYI A;  2OTL A;  1CKB A;  2C06 A;  3NPF A;  2IPO B;  2LJ0 A;  4HXJ A;  4JUV A;  2O88 A;  1JRI A;  1YWP A;  3A8L B;  2RHX A;  4XU0 A;  2X4J A;  3DLL A;  2DBM A;  3CPF A;  2GFU A;  1T3S A;  1UTI A;  3E19 A;  4ZGE B;  4YTL A;  2JUF A;  1WPY A;  2COZ A;  1YWO A;  2KVQ G;  1TG0 A;  1UB4 A;  4DA4 A;  1NEG A;  2M0Y A;  2DZC A;  4M77 E;  1H64 1;  2R5M A;  6AT1 B;  5CQX A;  2EQI A;  3RR6 A;  2KK4 A;  1OU8 A;  3LW5 E;  2AT1 B;  3JCM g;  4RTZ A;  4AFZ C;  2P4R A;  5DM7 R;  1BKB A;  2YHT A;  3EHQ A;  1UUE A;  3O5Z A;  2J6K A;  1VQ8 Q;  2GTO A;  3E1S A;  3VS4 A;  2E6N A;  1KQ1 A;  3M58 A;  4AG2 C;  4WF2 A;  3A98 A;  2LCC A;  3TU4 K;  1W1F A;  2FRY A;  2GQV A;  3H0I A;  4HCZ A;  4Y91 A;  1HSQ A;  2NUT B;  1G5V A;  3ER0 A;  2X3W D;  3L1A A;  1K73 U;  4XQ3 A;  2WSE E;  2MMP A;  2HQE A;  2ECZ A;  1I5O B;  3J81 E;  3CC4 A;  5FRN A;  3ZFJ A;  2FPE A;  4LDV A;  2JZ2 A;  4PFO A;  1I5L A;  4RTT A;  3SFM A;  4E7Z A;  4M78 G;  3X25 B;  3HSB A;  5CKB A;  1YBY A;  4M75 F;  4C0G A;  1SEM A;  1RAF B;  4M4Z A;  1K9M C;  3GBQ A;  5CKD A;  4OB0 B;  1U8R A;  4E7L A;  1N5Z A;  3I5R A;  4KGV B;  1AOJ A;  2KT8 A;  1KQS A;  4M7D A;  4M78 D;  2DJQ A;  5CR2 A;  4E7K A;  2P84 A;  3G4S T;  1I81 A;  2HNI A;  1KC8 R;  1F1B B;  3EGX B;  3OW2 A;  5CQY A;  1AZG B;  2MYS A;  4QQG A;  2ROT A;  3CCQ Q;  2E64 A;  3CBM A;  3MP1 A;  2H3E B;  3RES A;  1UGR B;  1VQ6 Q;  3H41 A;  3QYH B;  4LD6 A;  1XOV A;  3CCU Q;  2LQK A;  4A4E A;  5GAO m;  2VUB A;  1NZ9 A;  1R77 A;  2X3X D;  3FJ5 A;  1WX6 A;  2JTM A;  1QVF S;  3JRZ A;  4HCK A;  2M9U A;  1PHT A;  4M75 B;  1K4U S;  4ZGD B;  5GAN f;  1YIJ Q;  3Q1J A;  2RK2 A;  4MZP A;  4OMQ A;  2CP3 A;  1GFD A;  3GOX A;  2RM4 A;  2BZX A;  2GFA A;  4PLI A;  1PSE A;  1PNJ A;  1ZUK A;  3CXC A;  2HDA A;  1FX7 A;  2DBK A;  2LQW A;  2RQR A;  1JXO A;  3QII A;  4D6W A;  3JCM e;  2HZY A;  2JT4 A;  4ZGJ B;  1D1C A;  1TUC A;  2LX9 A;  1RAG B;  4M77 A;  4LXC A;  4RTX A;  4M75 E;  5FU7 B;  3PNW C;  2VXE A;  5FU7 C;  3QHS A;  1PD1 A;  3L2W A;  3LWI A;  4M7A F;  4IIO A;  5FRM A;  4IUQ A;  5KCO A;  1QP3 A;  1UEB A;  2D1X A;  2RQT A;  4WCI A;  4L6V 5;  5GAM h;  3DB4 A;  3L2R A;  1YHQ T;  4FU6 A;  3H9N A;  2KY9 A;  1VQK Q;  1NJI U;  2OTL Q;  1X6O A;  2DTI A;  4AG1 C;  1QCN A;  2KYB A;  2B8A A;  4E7S A;  3T9N A;  4PFZ A;  3H0H A;  3RIR A;  2F5K A;  4Z02 A;  2QQS A;  3GF5 A;  3LGF A;  2DXB A;  2E3H A;  2BE9 B;  5GAO p;  1WZO A;  1E7O A;  2K7A A;  2A0F B;  2DPP B;  4J7F A;  4EMG A;  3SB2 A;  2M0O A;  2JS0 A;  3OYL A;  1MND A;  3EG3 A;  3S6W A;  3CC7 T;  2EQU A;  1HXD A;  5KCH A;  1B7T A;  1X27 A;  5CAI A;  1NPP A;  2KQW A;  1XTD A;  4XTX A;  5LJ5 f;  4M7A B;  5IAY A;  3I56 T;  5GAO q;  3SHW A;  4EIK A;  2RH2 A;  5GAN 7;  2K4Y A;  1HD3 A;  1RAB B;  1PWT A;  1M1G A;  4J9I A;  2P0Q A;  1B07 A;  8AT1 B;  5IHK A;  2H8H A;  2X51 A;  1VYV A;  2YUP A;  1M2V B;  2K79 A;  4MML A;  1VQN T;  2I0N A;  3CC4 Q;  4M7D G;  4A4H A;  1BI1 A;  1FMK A;  4FYY B;  5ECA A;  4B6M A;  3G7Z A;  2L5Q A;  2BUD A;  4M7A E;  1YI2 T;  4BY6 B;  1O75 A;  2K2V A;  2RD1 A;  3HTR A;  1YJN T;  1TWB A;  3M9Q A;  4FT2 A;  3VUZ A;  3FIF A;  1QVP A;  1KHC A;  1K9M R;  5KYW B;  2HL3 A;  2O31 A;  1Q86 C;  1V1C A;  1GFC A;  4HVU A;  1BCM A;  1N27 A;  3EGX A;  3NGP A;  2VB6 A;  4C0Z A;  2DL3 A;  2VXF A;  2DTO A;  2G6F X;  4GLM A;  1OEB A;  1AVZ C;  5IH2 A;  3M0R A;  2DX1 A;  4ORZ A;  2DKG A;  3VJP A;  5FWB A;  2HBP A;  1OX9 A;  1ZHI A;  5GAM g;  4HT8 A;  1JXM A;  1WHK A;  1BU1 A;  3VU3 C;  1T0J A;  3URG A;  4IUR A;  4NL3 A;  2DMO A;  4J6W A;  3VS2 A;  4ZTJ A;  3OB9 A;  3F70 A;  3EFO B;  1KC8 U;  5I2M A;  4M75 A;  1VQ4 A;  1YIT T;  2BIV A;  1G83 A;  2O9V A;  4J9B A;  2W10 A;  3I56 A;  3JCM W;  1WA7 A;  2X9H A;  4XU1 A;  4ELY C;  1I0C A;  4J6Y A;  2IIM A;  4CC7 A;  5LJ3 e;  4ZTF A;  4KUD K;  3CCL T;  1WJQ A;  1D09 B;  2DZ9 A;  2RA2 A;  4M77 G;  3V8K A;  2RQW A;  4BE2 A;  2D0Q B;  3J7A F;  3LX7 A;  2OAU A;  1ZX6 A;  2XG8 D;  2KI7 A;  2RJF A;  1YCS B;  2ENM A;  2GBQ A;  1WHG A;  2YUQ A;  4O6J A;  2AK5 A;  3QG1 A;  3UDC A;  1WIE A;  4PJN A;  4C0D C;  1OX8 A;  4F7U G;  2LP5 A;  1EIF A;  1YFN A;  2HCK A;  1A0N B;  4IIM A;  3OYD A;  4Y28 E;  1YJN A;  1RAA B;  3JB9 I;  2MI6 A;  3CCS Q;  5IHI A;  2D0N A;  1OPL A;  1YCY A;  3CCR A;  3RBB B;  2KXC A;  3MJX A;  3CME T;  1QVG S;  4JZ4 A;  3QZ9 B;  4FW2 A;  1JJ2 S;  1QW1 A;  1UDL A;  2QTV A;  2EGE A;  2XD0 A;  4E6R A;  1JB0 E;  2AHJ B;  2E41 A;  2AZS A;  2VYT A;  3OYG A;  3OYE A;  1PC0 A;  2FEI A;  1K0X A;  9ATC B;  2DE0 X;  1VQM T;  2C0T A;  2CP6 A;  3GLX A;  5LJ5 h;  5J39 A;  1Q82 R;  3EG9 A;  5FWC A;  4MMK A;  2XDP A;  3DKM A;  2KEA A;  1LCK A;  3MHX A;  3OS1 A;  1YIT A;  1PRL C;  4FT4 A;  3QSU A;  1VQ9 A;  5GAN 6;  1ARK A;  3WVD B;  3S3O A;  4M7A A;  3LH5 A;  1YJW T;  3CPW S;  1H8K A;  3CCM T;  1SKU B;  1W2B A;  1VOM A;  2DJZ A;  4DBR A;  3G6E T;  5D6Y A;  1YP5 A;  2QQA A;  4J9G A;  5L8R E;  4RTU A;  2X35 A;  2ZPF B;  3MP6 A;  3AT1 B;  4O5V A;  3MKD A;  1KD1 C;  3CC2 T;  1JO8 A;  2K2M A;  3VUB A;  4LDW A;  1QWE A;  1M2V A;  4L59 A;  3RUX A;  2P0P A;  4DQ2 A;  4JS5 A;  2JNG A;  3E9G A;  2F69 A;  5LJ3 f;  4C8Q F;  1M9S A;  2WSC E;  2CZ1 B;  2KRS A;  4CC4 B;  1CKA A;  3RKY A;  4NL2 A;  2E3I A;  3JB9 G;  1XNI A;  2QGF B;  2DL8 A;  1WJR A;  5KYW A;  2KR3 A;  1B34 A;  2OI3 A;  2P0K A;  1TU0 B;  3O8V A;  4PJO C;  2M02 A;  4E2F B;  5FU6 B;  1V76 A;  3CME A;  2RI2 A;  3TQ7 P;  2LTO A;  1WQW A;  1Q86 R;  1OU9 A;  2R58 A;  1BIB A;  1QCF A;  4AFU C;  2K57 A;  3JB9 D;  3NFC A;  2RMO A;  2EFI A;  2XIC A;  5GMK h;  4M75 G;  1VQM A;  1WFW A;  1ZA2 B;  1MMG A;  2J7I A;  2QDL A;  1RLP C;  4RMO A;  3EFR A;  4EPC A;  2OTJ T;  3CCV A;  1K9M U;  2FRW A;  2KRO A;  4E7J A;  3EFO A;  5KYU B;  1RAC B;  3UAT A;  1G3S A;  4C8Q B;  2LJ1 A;  4C8Q C;  3QZ5 B;  1YJW A;  4OP0 A;  2XU8 A;  4XTW A;  3AHU A;  3CCM A;  4M75 D;  4PJJ A;  1WQ7 A;  2KGT A;  3A8H B;  2KMT A;  4PL6 A;  2PTK A;  4BI4 A;  4N4H A;  4GLK A;  1VQ4 Q;  1D0Y A;  3PVL A;  4J9D A;  2GTJ A;  3ZL7 C;  1LJO A;  2A28 A;  1BCO A;  1UGP B;  4BDZ A;  1HK9 A;  2HMA A;  4MDX A;  5KYX B;  3KUF A;  3V8J A;  4FSX A;  2ZGW A;  4C8Q E;  3QJY A;  5DY9 A;  4OML A;  1PRM C;  1KQ2 A;  3OS5 A;  3E9F A;  2VAS A;  4LUE A;  4ZN3 A;  3JB9 H;  2LCL A;  2FZG B;  4OF1 A;  1TS9 A;  2AIR B;  3CD6 T;  1YJ9 T;  4NOY A;  5GAM j;  3MP8 A;  1VUB A;  1RUW A;  1ACM B;  1RI0 A;  5CIU A;  4CI0 C;  1TUG B;  2J05 A;  5IXF A;  1M1F A;  2COY A;  3D7S B;  3CCJ T;  1RAE B;  1ZUY A;  2HSP A;  4R55 A;  1YJN Q;  3M53 A;  4MZT A;  3VV0 A;  2CZ6 B;  3H0F A;  3CCR Q;  4LDX A;  4C92 C;  4R0K A;  1IGQ A;  1OI1 A;  1S72 A;  4EMK C;  2I2L A;  3ZBD A;  3M59 A;  4QVD A;  4KT0 E;  4DOW A;  2RHI A;  1M27 C;  2QEX T;  3OYC A;  1P92 A;  1BI3 A;  2HQX A;  2QK0 A;  5HCK A;  2OTJ A;  1PSF A;  4M7A G;  2CKK A;  3CBO A;  2EYY A;  4KGX B;  4L5G A;  1KQS P;  2GNC A;  3VS6 A;  2KRN A;  2Y4Y A;  4FSS A;  4B9W A;  3OW2 P;  4A54 A;  2DEQ A;  4CRI A;  5GMK i;  3EHR A;  2JMA A;  2DO3 A;  1G3T A;  1VQL T;  5A0D A;  3MO8 A;  2FZC B;  1YIT Q;  3OYF A;  3PFS A;  2JS2 A;  1VQ9 Q;  5M9O A;  1M1K C;  2DIL A;  1GCQ C;  2QTX A;  3I9Q A;  1SRM A;  4J83 A;  4GY5 A;  4XTY A;  3RDV A;  5KYY B;  5AT1 B;  3PMT A;  4QKU A;  1Q82 U;  2CSQ A;  1RI9 A;  1PD0 A;  4XK8 E;  2VGN A;  2AZV A;  3E2U A;  3BFM A;  3REA B;  3OMG A;  2V1R A;  1KFZ A;  2AKL A;  3PMI A;  2CZ0 B;  2BTT A;  2MWP A;  1C1A A;  2EQJ A;  1M2O A;  3L42 A;  3OY9 A;  4XAX B;  1BI0 A;  2O2O A;  2HQH A;  1MV3 A;  3JCM b;  1Y71 A;  3KXT A;  2ZPG B;  1TH7 A;  5IN1 A;  3GP8 A;  3CXC P;  5GJW B;  2D8H A;  5A0L A;  1R8O B;  2HSE B;  2GGR A;  2CH4 W;  2EYQ A;  3VYH B;  4C5E A;  2RI3 A;  3UPU A;  1IGU A;  2AKK A;  3CME Q;  1RL2 A;  2J6F A;  2OX7 A;  3MEV A;  3LYI A;  2WSF E;  1AWO A;  1D1A A;  1M4Z A;  2EJF A;  5I22 A;  4JS4 A;  3ASK A;  3C4S A;  2LDM A;  3SD4 A;  1MGQ A;  2R5A A;  1ABO A;  4ZNX A;  1K76 A;  1K1Z A;  5IHN A;  4LNP A;  1D1B A;  5KYU A;  4JLI A;  4Q5W A;  4KRT A;  4C8Q A;  2P4T A;  3R6O A;  3HRT A;  1AZE A;  1VQM Q;  5GMK l;  1T0H A;  2ED1 A;  1Q86 U;  1ZBJ A;  3G4S A;  1VQ5 T;  3I55 T;  3CCV Q;  1LOJ A;  3HRU A;  2ZCF B;  1VQL A;  4MZM A;  2JVV A;  4M78 F;  4QQ6 A;  3MEA A;  2PZ1 A;  5CKF A;  4ESR A;  4RG2 A;  2MIO A;  1JQQ A;  1I07 A;  4FIB A;  3SDZ A;  1WXU A;  2DXU A;  1YJW Q;  1OYX A;  2R57 A;  5GAM d;  3CCM Q;  5C6S A;  2CYZ B;  3QKJ A;  5KYX A;  2RN8 A;  2QQR A;  4A63 B;  2EVR A;  4FL6 A;  4HVV A;  4FYW B;  1ZUU A;  4XTZ A;  2K3B A;  1X01 A;  2F2X A;  2DYB A;  1U1T A;  3M54 A;  1O9S A;  3OYB A;  3UWN A;  3EG9 B;  3HFN A;  5J3B A;  3I5S A;  2EBP A;  1AHJ B;  1UGV A;  4XTV A;  2LC4 A;  2KAF A;  2JN0 A;  1K0S A;  1QVF A;  1VQP T;  2PUK B;  3X20 B;  4C5H A;  1OQK A;  2WAC A;  2NUZ A;  2XK0 A;  2DL4 A;  3J80 E;  4OMM A;  5HY6 A;  3A8O B;  1OZ2 A;  4E7H A;  3EAE A;  1NPR A;  4M78 C;  1Q7Y C;  4HCB A;  2Y4X A;  3INZ A;  1ZLM A;  4OMN A;  1D0X A;  2CRE A;  1XQH A;  2NWM A;  3JCM c;  2ABL A;  3VS1 A;  1WYX A;  2K3Y A;  4BB7 A;  4ANJ A;  2JW4 A;  4JRK A;  4EDU A;  1S72 Q;  4Z88 A;  1GBR A;  1PG5 B;  3OQ5 A;  2QA4 T;  2KDS A;  1LNX A;  2DLP A;  1R0B G;  3JCM f;  3QDF A;  1WGS A;  3BDL A;  3JV3 A;  1VQ8 T;  2VGM A;  1ZBX A;  4QVC A;  2OTJ Q;  5CO7 A;  1QMC A;  1MUZ A;  1B34 B;  1YHQ A;  1W6X A;  3V7R A;  4M78 E;  1SHF A;  4Z8A A;  1PCX A;  4M7D D;  2CZ7 B;  1SSF A;  1AWW A;  1ZA1 B;  1SG5 A;  1GCQ A;  3S3N A;  5KYY A;  5J26 A;  3L2Z A;  2DTH A;  2LT4 A;  1ZSZ B;  2KYM A;  4JJD A;  1ZSZ C;  3EGD B;  1C0M A;  1BK2 A;  5GAN h;  1DJ7 B;  1T3L A;  1FMV A;  1RLQ C;  1MNE A;  2DER A;  1B3Q A;  2K5I A;  3CC7 A;  4V2S A;  3PT9 A;  1X6G A;  5LL6 S;  2CT4 A;  3JCM J;  1RAD B;  3QPH A;  4C5I A;  5GAN d;  3CQT A;  4BDY A;  3FJP A;  4D8D A;  2GCX A;  4OB2 B;  1GL5 A;  1EZZ B;  1KK7 A;  3GNG A;  3RKX A;  5HK0 A;  2MCN A;  2G3R A;  2YT6 A;  3UT1 A;  2DL7 A;  2BZ8 A;  2PQW A;  4VUB A;  5A2Q E;  1IXD A;  1OZ3 A;  5CKH A;  3L2U A;  2GQI A;  1M3A A;  1H92 A;  5GJV B;  3OBY A;  4BE0 A;  3CCQ T;  3LH0 A;  3P8D A;  5GMK j;  3MEU A;  2LNV A;  1AWJ A;  4C8Q G;  4JLG A;  4R56 A;  4PJL A;  3FC3 A;  1VQN A;  3M0U A;  4A53 A;  2OJ2 A;  3KFV A;  4C0D B;  2VWF A;  2EQK A;  1YI2 A;  3CCU T;  2QA4 A;  1FWZ A;  4QT7 A;  3QWY A;  4M77 D;  2A08 A;  2X4X A;  2L0A A;  3GPL A;  2YRV A;  3JCM V;  3EGU A;  2KNB B;  2MAM A;  1N9S A;  4FCY A;  4AMC A;  2XHC A;  4CC2 A;  3X28 B;  1QCO A;  2M16 A;  1NLO C;  1IRX A;  2HEQ A;  3M55 A;  4J9C A;  2L3S A;  1KG1 A;  3V8L A;  4PJM A;  1M30 A;  3I35 A;  2F2W A;  4F04 B;  3G4S Q;  1VYU A;  5IT9 E;  2YDL A;  1VQL Q;  2V26 A;  1WI7 A;  3EH1 A;  1QKW A;  4C0F A;  1VIF A;  2RHZ A;  3BY7 A;  1GRI A;  5GMK m;  1BIA A;  2HBW A;  4DBH A;  2C0I A;  1JU5 C;  2QG9 B;  2X4W A;  4PJO F;  4JJN K;  1NM7 A;  2FB7 A;  1PKT A;  4FYV B;  3QWX X;  2BE7 D;  1I1J A;  3N5B B;  1RAI B;  1W2B P;  1NYF A;  2DRK A;  2EKH A;  3FDR A;  5LJ5 d;  3EG1 A;  4D8K A;  3ME9 A;  3JAM E;  1Y0M A;  1LVK A;  4JRQ A;  1X2K A;  1IHV A;  5GAN g;  1PM3 A;  2EGC A;  3CCL A;  2LZ6 B;  2JMC A;  4M78 A;  1VQK T;  1Q81 C;  2CUD A;  3A1P A;  2FL7 A;  3GNF B;  5GAM e;  3CCQ A;  2OTL T;  3THK A;  2QAS A;  3DB3 A;  3L2V A;  1M90 C;  1MMD A;  2CP5 A;  2LRQ A;  2V1Q A;  4BUG A;  3OYK A;  4FM4 B;  1AEY A;  1Q7Y R;  5D6W A;  2DD5 A;  4LN2 A;  4ZN1 A;  3TRE A;  1UE9 A;  4N0A C;  3M57 A;  1IB8 A;  2DM1 A;  1WJS A;  1K8A C;  5FRO A;  1X6B A;  5GAN 2;  5DLO A;  2FO0 A;  4KH1 B;  4PJO B;  3L2Q A;  3OS2 A;  4JJB A;  2HAX A;  2NUP B;  2DRM A;  1SF9 A;  2EJG A;  3CBP A;  3OBW A;  2JTE A;  2ATC B;  4J9E A;  2L8D A;  2MOX A;  3RER A;  4TVR A;  4RCB A;  1Y96 B;  4F7U F;  2EIF A;  2M1H A;  4B9X A;  3RMQ A;  1NE8 A;  1QVG A;  1YHQ Q;  2YUN A;  3OYJ A;  1JJ2 A;  1ZSZ A;  2FPD A;  3C94 A;  2E6Z A;  3HFO A;  1SHG A;  2HKQ B;  3EGD A;  3VYG A;  4KUI A;  1U5S A;  2J06 A;  4PJO E;  2CP7 A;  3V7C A;  2ESW A;  4JRI A;  3RKW A;  3CC4 T;  4E47 A;  3EFS A;  3X24 B;  3OSS C;  2A36 A;  1E6H A;  1GXI E;  4C92 F;  1Y07 A;  2EPD A;  4N4I A;  3CC7 Q;  2E70 A;  1N8R C;  3G6E A;  5LJ5 g;  1GCP A;  5C0M A;  2RPN A;  3P8B B;  1C6V X;  3CPW A;  3U23 A;  1KQS S;  2E12 A;  5A0G A;  2RO0 A;  4BI8 B;  1WXT A;  4XTU A;  3I56 Q;  4MDW A;  3OW2 S;  5EC7 A;  3CC2 A;  1YNZ A;  4ATO A;  2EJ9 A;  5IXB A;  5HKC A;  2DXT A;  3QXE B;  3WVE B;  4F7U B;  2DD4 A;  5FLX E;  3NTH A;  4AFQ C;  2E10 A;  1NYG A;  2RQV A;  2XDD A;  1FXX A;  5I21 A;  3TCJ A;  1E6G A;  2ZZD A;  2YXY A;  2F5T X;  1QKX A;  2RF0 A;  1WHH A;  2ZPI B;  1S1N A;  2CSI A;  5GAM f;  3A8M B;  1AT1 B;  5GAN 8;  1VQN Q;  4FW1 A;  3EG0 A;  5GAN e;  4N4G A;  4GBQ A;  2PVO B;  2PVD B;  1D3B B;  1YI2 Q;  2QA4 Q;  4PKC C;  3M0S A;  3LGL A;  3TSW A;  3OYA A;  1Z9Q A;  4F7U E;  2RB6 A;  1NBE B;  4C92 B;  1OOT A;  4BI3 A;  4EMK B;  3HKS A;  1M3B A;  3JB9 F;  4P5N A;  1GBQ A;  2QDY B;  3OMC A;  3CXC S;  3CCE T;  1G2B A;  2KSS A;  4OB3 B;  2DIG A;  3A5Z B;  2YUO A;  1VQO T;  5I2S A;  2RHU A;  2DVE A;  3MCA B;  2K3X A;  2QXF A;  2QI2 A;  1QP2 A;  4DEY A;  5HK3 A;  5KE2 A;  5GAO r;  1YN8 A;  1TUD A;  1KHI A;  2LQN A;  3JSC A;  2XMF A;  2KT1 A;  2ZPH B;  3M0P A;  2ZPB B;  4A4F A;  2L2P A;  3FRN A;  3OYH A;  3KBG A;  4QW2 A;  4IKF A;  1CSK A;  2YSQ A;  3V7S A;  3JCM X;  4C92 E;  2BKD N;  3CCS T;  3X26 B;  3PIP A;  2DFU A;  1UFF A;  1VQ7 T;  4M7A D;  1ZQ1 A;  2FPF A;  2L3P A;  1IZ6 A;  1AWX A;  4KUL A;  3QO3 A;  4JJC A;  4HKE A;  3BE3 A;  1IHW A;  3HHT B;  3M56 A;  5LJ3 h;  2RK1 A;  2QQB A;  2XKO C;  4RUG A;  2LMJ A;  3LLR A;  3G71 T;  5CK9 A;  4LUD A;  2JJ9 A;  1Y7X A;  1QLY A;  1U06 A;  1Q81 R;  4J8O A;  2O4X B;  3CCL Q;  1N6A A;  2EAY A;  3GIB A;  2B86 A;  2JM8 A;  4F17 A;  3R6N A;  1NEB A;  5LJ3 d;  1KD1 R;  1M90 R;  4LE9 A;  4N0A A;  1G3Y A;  2V8K A;  4OMF B;  3JB9 J;  1UHF A;  5KH6 A;  3M5A A;  2ED0 A;  3CD6 A;  3C95 A;  3MEW A;  1YJ9 A;  1W70 A;  4HA8 A;  4II1 A;  4PFP A;  4X9C A;  2EQM A;  4PJO A;  2LQ8 A;  1SRL A;  2DK3 A;  1K9A A;  1Q95 G;  2NUP A;  1QQJ A;  3G1J A;  1JEG A;  2D8J A;  5LJ5 e;  3WXM B;  1K8A R;  3OA6 A;  2YLC A;  2QYZ A;  2HL5 C;  3CCJ A;  1XJW B;  4BE1 A;  1MMA A;  1ABQ A;  1Y96 A;  5KE3 A;  5KYN A;  2LNH B;  3NTI A;  1Q7Y U;  2VC8 A;  3CMA T;  2CDT A;  2W0Z A;  4M75 C;  3SEM A;  2QEX A;  3CCE A;  3QBY A;  2CUB A;  2NLU A;  1JBM A;  5DLQ E;  5GAN j;  1VQO A;  3SWN B;  2A7Y A;  1K73 C;  3SWN C;  3VS0 A;  2RHY A;  2FVU A;  4KBM B;  2EW3 A;  1OPK A;  2L3R A;  4J9H A;  1MMN A;  3A8G B;  2J6O A;  2RI5 A;  4F14 A;  2DL5 A;  5GAN 3;  1IRE B; 
#chains in the Genus database with same CATH homology
 1ZSG A;  3H0I A;  1RLQ C;  1B3Q A;  1HSQ A;  1JO8 A;  2K2M A;  4JZ3 A;  2X3W D;  1M8M A;  3VRZ A;  1X6G A;  1NLP C;  1QWE A;  2CT4 A;  3CQT A;  2ECZ A;  4D8D A;  1GL5 A;  2FPE A;  2MCN A;  3VRY A;  2YT6 A;  2KRS A;  2DL7 A;  4CC4 B;  1CKA A;  2BZ8 A;  4RTT A;  2DL8 A;  2GQI A;  2EGA A;  1M3A A;  2KR3 A;  2OI3 A;  1H92 A;  5GJV B;  2DNU A;  1SEM A;  1AWJ A;  2BZY A;  4M4Z A;  3GBQ A;  2JM9 A;  3M0U A;  2K6D A;  5I11 A;  1QCF A;  1H3H A;  1N5Z A;  3I5R A;  2OJ2 A;  1AOJ A;  4AFU C;  3KFV A;  3UA6 A;  2VWF A;  2KT8 A;  4K11 A;  1HJD A;  2RMO A;  2DJQ A;  2DA9 A;  4QT7 A;  3QWY A;  2A08 A;  2L0A A;  1AZG B;  1UHC A;  2ROT A;  1WFW A;  1NG2 A;  3EGU A;  2QDL A;  2J7I A;  1RLP C;  2F2V A;  2KNB B;  3PE0 A;  4CC2 A;  2O9S A;  2FRW A;  2KRO A;  3H41 A;  1NLO C;  2HEQ A;  4J9C A;  3UAT A;  1XOV A;  2L3S A;  2OAW A;  2LJ1 A;  1M30 A;  3I35 A;  2DF6 A;  2F2W A;  4HVW A;  1VYU A;  2YDL A;  1WI7 A;  2KGT A;  2X3X D;  3FJ5 A;  3IQL A;  2PTK A;  1QKW A;  1WX6 A;  2KXD A;  4HCK A;  1KJW A;  3NHN A;  1FYN A;  1GRI A;  1PHT A;  1WLP B;  3PVL A;  4J9D A;  1K4U S;  2HBW A;  2GTJ A;  3ZL7 C;  2C0I A;  1JU5 C;  4OMQ A;  1NM7 A;  2RQU A;  1GFD A;  2A28 A;  1PKT A;  2BZX A;  3QWX X;  1I1J A;  3VS3 A;  1PNJ A;  1NYF A;  1ZUK A;  2DRK A;  2EKH A;  2L3Q A;  1BBZ A;  3EG1 A;  4D8K A;  2HDA A;  4OML A;  1PRM C;  2EYZ A;  1Y0M A;  2DBK A;  2LQW A;  1X2K A;  2RQR A;  2JXB A;  1JXO A;  4LUE A;  2EGC A;  2LZ6 B;  2JT4 A;  2JMC A;  1TUC A;  2EYX A;  2CUD A;  1RUW A;  4RTX A;  3C0C A;  3THK A;  2J05 A;  5IXF A;  2V1Q A;  1X43 A;  1ZUY A;  1AEY A;  2HSP A;  4IIO A;  2FG0 A;  5FW9 A;  3UF4 A;  3H0F A;  4LN2 A;  4J9F A;  1UE9 A;  2D1X A;  2RQT A;  4R0K A;  4WCI A;  2CH4 A;  2DM1 A;  1M27 C;  2LJ3 A;  2A37 A;  1X6B A;  2FO0 A;  5HCK A;  1UG1 A;  4AG1 C;  5L23 A;  2KYB A;  4JJB A;  2DRM A;  3TVT A;  2EYY A;  3H0H A;  4Z89 A;  2JTE A;  3TSZ A;  4J9E A;  2GNC A;  2MOX A;  3VS6 A;  2KRN A;  2DVJ A;  4FSS A;  1E7O A;  2YUN A;  4OMP A;  2K7A A;  2ROL A;  3EHR A;  2JMA A;  2FPD A;  2M51 A;  2JS0 A;  3NMZ C;  3EG3 A;  1SHG A;  2JS2 A;  1U5S A;  1X2Q A;  1X27 A;  2J06 A;  3M0T A;  2DIL A;  4RTV A;  1GCQ C;  2ESW A;  3SHW A;  3I9Q A;  4EIK A;  1SRM A;  2CSQ A;  1RI9 A;  1HD3 A;  2AZV A;  3REA B;  1Y57 A;  1PWT A;  1WXB A;  2A36 A;  2V1R A;  4J9I A;  1E6H A;  1KFZ A;  2AKL A;  4RTW A;  1B07 A;  1X69 A;  2BTT A;  4JPB W;  4AFS C;  2EPD A;  2H8H A;  5IHK A;  1GCP A;  1MV0 B;  2RPN A;  3U23 A;  1VYV A;  1BB9 A;  2PNI A;  2YUP A;  2VVK A;  1OV3 A;  1WXT A;  2K79 A;  2O2O A;  1MV3 A;  2I0N A;  2KBT A;  5EC7 A;  1VA7 A;  5ECA A;  1FMK A;  1YNZ A;  1IO6 A;  5IXB A;  5GJW B;  2D8H A;  1AD5 A;  4AFQ C;  2GGR A;  1NYG A;  2RQV A;  1E6G A;  2CH4 W;  1QKX A;  2O31 A;  2RF0 A;  2SEM A;  1V1C A;  2CT3 A;  1S1N A;  2CSI A;  1GFC A;  4HVU A;  2AKK A;  1UJY A;  3NGP A;  2J6F A;  2DL3 A;  1AWO A;  1SPK A;  3PVQ A;  4X1V A;  5I22 A;  3EG0 A;  2G6F X;  4GLM A;  1OEB A;  4GBQ A;  1QWF A;  1AVZ C;  5IH2 A;  3M0R A;  2DX1 A;  1ABO A;  1SSH A;  3M0S A;  4ORZ A;  4ZNX A;  1K76 A;  1K1Z A;  5IHN A;  4LNP A;  3ULR B;  4F16 A;  5FWB A;  3TSW A;  4KRT A;  1U3O A;  1Z9Q A;  1JXM A;  1AZE A;  1BU1 A;  1T0H A;  1T0J A;  2ED1 A;  1OOT A;  1ZBJ A;  3M0Q A;  1M3B A;  3VS7 A;  4RTY A;  1GBQ A;  2LX7 A;  2DMO A;  2PZ1 A;  1G2B A;  3VS2 A;  4ESR A;  1M3C A;  2KRM A;  2MIO A;  1JQQ A;  1I07 A;  1WXU A;  2YUO A;  2K9G A;  1G83 A;  2SRC A;  2O9V A;  4J9B A;  2W10 A;  4DEY A;  1WA7 A;  2VKN A;  1YN8 A;  1TUD A;  4OMO A;  2LQN A;  2XMF A;  1I0C A;  2RN8 A;  2KT1 A;  3M0P A;  4A63 B;  2IIM A;  2EVR A;  2L2P A;  4CC7 A;  4HVV A;  4CC3 A;  3VS5 A;  1CSK A;  1J3T A;  2YSQ A;  1ZUU A;  4DEX A;  2E5K A;  2K3B A;  2F2X A;  2DYB A;  2RQW A;  3REB B;  1ZX6 A;  1UFF A;  1EFN A;  3UA7 A;  2FPF A;  1KIK A;  2L3P A;  1YCS B;  2RNA A;  1AWX A;  2ENM A;  3I5S A;  2GBQ A;  2EBP A;  2C0O A;  4JJC A;  1KSW A;  1UGV A;  2YUQ A;  2LCS A;  2AK5 A;  1K0S A;  3RNJ A;  1WIE A;  4RUG A;  2LMJ A;  4LUD A;  2LP5 A;  1QLY A;  2NUZ A;  2KE9 A;  1U06 A;  3EG2 A;  2HCK A;  2DL4 A;  1A0N B;  2B86 A;  2JM8 A;  4IIM A;  4F17 A;  4OMM A;  3R6N A;  1UEC A;  1NEB A;  1WDX A;  4LE9 A;  1PKS A;  5IHI A;  2D0N A;  1OPL A;  1Z9Z A;  2EYW A;  1UJ0 A;  1UHF A;  3RBB B;  2KXC A;  2ED0 A;  1VYT A;  1ZLM A;  4OMN A;  2CRE A;  2NWM A;  1W70 A;  2ABL A;  4JZ4 A;  4Y92 A;  3VS1 A;  1UDL A;  1CKB A;  1SRL A;  1WYX A;  3NPF A;  1K9A A;  2EGE A;  2LJ0 A;  4HXJ A;  1JEG A;  2JW4 A;  4E6R A;  2D8J A;  2AZS A;  2O88 A;  4Z88 A;  1YWP A;  1GBR A;  2FEI A;  1ABQ A;  2DLP A;  2DBM A;  1K0X A;  2LNH B;  3JV3 A;  1T3S A;  2DE0 X;  1UTI A;  2CDT A;  1MUZ A;  2C0T A;  2W0Z A;  1W6X A;  3SEM A;  1YWO A;  1SHF A;  1TG0 A;  1NEG A;  4Z8A A;  2M0Y A;  5FWC A;  2CUB A;  2KEA A;  1AWW A;  1LCK A;  2EQI A;  1PRL C;  1GCQ A;  3VS0 A;  1ARK A;  4RTZ A;  3LH5 A;  4AFZ C;  1H8K A;  2EW3 A;  2P4R A;  1OPK A;  3EHQ A;  1UUE A;  3O5Z A;  4J9H A;  2J6K A;  2GTO A;  2J6O A;  2KYM A;  4JJD A;  3VS4 A;  1YP5 A;  4F14 A;  4AG2 C;  2DL5 A;  4J9G A;  3A98 A;  4RTU A;  1BK2 A;  1W1F A;  2FRY A;  1T3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...