1G2BA

Alpha-spectrin src homology 3 domain, circular permutant, cut at n47-d48
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
MDRQGFVPAAYVKKLDSGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN
publication title Atomic resolution structure of a mutant of the spectrin SH3 domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal binding protein
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2000-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1g2bA00
2DJQA 3I35A 2LQWA 2O9SA 1W70A 1JO8A 1BB9A 1NYGA 2VKNA 3UF4A 2K79A 1GBQA 4AFQC 1AZEA 1WXBA 2KYMA 2KRMA 5ECAA 2RPNA 1OPKA 1JXMA 2EGAA 1X2KA 2CH4A 2L0AA 4LUEA 1ABQA 2KT8A 1RUWA 1AWWA 1YWPA 4GLMA 2EYWA 2DBKA 2L3PA 2L3QA 2FG0A 2ROTA 3M0SA 2C0OA 5IHIA 1K0SA 2CUDA 2KXDA 2D1XA 3SEMA 5GJVB 1GCQC 1U5SA 2YDLA 3PVLA 1FMKA 4GBQA 2RQRA 3THKA 2J6OA 1QWFA 2MCNA 1KJWA 2YSQA 1HD3A 2B86A 1N5ZA 4ZNXA 1QCFA 1PKTA 1AZGB 2K6DA 2HSPA 1SHGA 5FWCA 1PRLC 2RMOA 2FPFA 3TSZA 3IQLA 1G2BA 1WXTA 1AEYA 3R6NA 4CC4B 2GBQA 1JXOA 2BZXA 2DLPA 3CQTA 2JM9A 2M0YA 1UG1A 1YNZA 1ZSGA 3ZL7C 1WA7A 2IIMA 2D8HA 4A63B 2DVJA 2LNHB 4J9EA 4OMQA 1PHTA 2KYBA 2RF0A 4F14A 2LP5A 1YN8A 1T3SA 4CC7A 2BZYA 2GTOA 1ZX6A 1YCSB 3PE0A 3FJ5A 1UDLA 1E6HA 1JQQA 2FPDA 1JU5C 4AG2C 1M3AA 1YP5A 1E6GA 2DILA 1ZUYA 1MV3A 4AFUC 4F17A 1AOJA 2AZVA 5IXBA 1CSKA 1W1FA 2AKLA 1GCPA 2JTEA 2FRWA 1EFNA 2V1RA 4FSSA 4HVVA 1FYNA 2EGCA 2YUQA 3H41A 2JW4A 2DNUA 2EYYA 2FPEA 4RTUA 1UECA 2X3XD 5L23A 3H0FA 1OEBA 1X27A 2JT4A 3JV3A 2K9GA 3M0RA 1WIEA 4HVWA 4RTTA 4ESRA 1PKSA 4LNPA 4CC2A 1I0CA 5FW9A 3SHWA 2DM1A 1K4US 1X69A 3I9QA 2W10A 2J06A 1NEBA 1SEMA 3KFVA 2ESWA 1H3HA 2YUPA 2EPDA 2DL5A 1AVZC 1Z9QA 2E5KA 2L2PA 1WDXA 5EC7A 1TUDA 3UA6A 2ENMA 1GL5A 1MUZA 1RI9A 2EKHA 4OMMA 3U23A 4D8KA 2JS2A 1RLPC 5GJWB 3M0TA 1WX6A 1SSHA 1LCKA 4OMNA 2DRMA 4RUGA 2DX1A 2DMOA 2K3BA 1KIKA 1VYVA 2YT6A 1UUEA 2HBWA 2ED0A 5I22A 4AFZC 2DBMA 2F2XA 2DL8A 2RQUA 4JZ4A 2RNAA 1X2QA 2GNCA 4DEXA 2OAWA 2KT1A 1Y0MA 5IXFA 3QWYA 3EHRA 3EG0A 1X6BA 3M0PA 2KRNA 1HJDA 1JEGA 4WCIA 1QLYA 2V1QA 2HCKA 2C0TA 1WLPB 2AK5A 2RQWA 2G6FX 1OOTA 4K11A 4LN2A 1T0JA 3LH5A 2CT4A 2LQNA 1HSQA 1J3TA 1UJYA 3NHNA 1X6GA 1NLOC 2KGTA 1AWOA 3EG3A 2JM8A 2RQVA 3A98A 1AWXA 1K1ZA 2VWFA 2KXCA 2NUZA 5IH2A 2LJ0A 3M0UA 4HVUA 2FO0A 4Z88A 1M3BA 1NG2A 1M8MA 1NM7A 1QWEA 1VA7A 4J9FA 5IHNA 2CH4W 1T0HA 2F2WA 1CKAA 4CC3A 2HEQA 4IIOA 4D8DA 3VS3A 1CKBA 1GRIA 3EG2A 1AWJA 2XMFA 3NMZC 2L3SA 4OMOA 2W0ZA 2CUBA 1WFWA 4HCKA 2EGEA 4J9HA 4LE9A 2ECZA 3RNJA 2K2MA 2M51A 4JZ3A 2CSQA 2O2OA 2AKKA 2CREA 4DEYA 2NWMA 2J05A 2OI3A 3NGPA 2GTJA 3PVQA 4KRTA 1U3OA 2JXBA 4F16A 3VS0A 2LMJA 5FWBA 4R0KA 1BU1A 2A28A 2YUNA 1WI7A 1NYFA 1A0NB 2P4RA 2J7IA 1VYUA 2D0NA 1Y57A 1W6XA 1X43A 1M3CA 1RLQC 4X1VA 4Z89A 1GFDA 2RQTA 1BBZA 1H8KA 2O9VA 2HDAA 1SHFA 1M30A 2YUOA 3VRZA 2KRSA 1ZUUA 1MV0B 1ZUKA 3I5SA 4Y92A 4J9GA 4Z8AA 2CDTA 2GQIA 4J9BA 1S1NA 1UJ0A 1SPKA 1Z9ZA 2A37A 2PNIA 2A36A 2AZSA 1B3QA 1QKWA 1TG0A 3C0CA 4RTWA 4HXJA 4RTXA 2RN8A 3QWXX 1K0XA 3VS1A 2PZ1A 2KEAA 2LJ1A 1QKXA 2EQIA 2DYBA 2EVRA 2JS0A 2LJ3A 1I1JA 4JJBA 1UE9A 3I5RA 4RTVA 2JMAA 2LZ6B 3VS2A 5IHKA 3H0IA 4J9DA 3UATA 1K9AA 4E6RA 2EBPA 1H92A 2A08A 2DE0X 2I0NA 2D8JA 2C0IA 2H8HA 2KNBB 2LCSA 2GGRA 4M4ZA 3VRYA 4RTYA 4ORZA 1WYXA 3M0QA 3VS7A 2DF6A 2DRKA 4OMPA 2J6KA 2DL7A 2EW3A 1WXUA 2X3WD 2ROLA 4EIKA 1OPLA 1T3LA 1PWTA 1UFFA 1OV3A 1UHCA 2LX7A 2SRCA 3NPFA 3RBBB 3TSWA 1PNJA 1U06A 1VYTA 2DL3A 2SEMA 4JPBW 3REAB 1YWOA 1PRMC 2JMCA 2KE9A 2KROA 4AFSC 2KBTA 1GBRA 3EHQA 1UTIA 1M27C 3EGUA 3TVTA 1KSWA 4AG1C 2QDLA 3VS5A 2FEIA 1IO6A 2BTTA 1KFZA 5I11A 1ABOA 1AD5A 1UGVA 2DL4A 2O88A 2CT3A 2OJ2A 1E7OA 4JJCA 3ULRB 2ED1A 4J9CA 2BZ8A 2VVKA 4RTZA 1K76A 3H0HA 2EYZA 1GCQA 2MOXA 1G83A 1NLPC 1TUCA 4LUDA 1ZLMA 2O31A 1NEGA 1BK2A 2ABLA 3REBB 3EG1A 4JJDA 2CSIA 1B07A 2MIOA 4IIMA 4QT7A 2DA9A 1SRMA 1XOVA 3O5ZA 2F2VA 3GBQA 2EYXA 1UHFA 2FRYA 2J6FA 2K7AA 4OMLA 2KR3A 3VS6A 3VS4A 1ZBJA 1GFCA 1SRLA 1ARKA 3UA7A 4J9IA 5HCKA 2PTKA 1I07A 1V1CA
chains in the Genus database with same CATH superfamily
3CC7Q 2E64A 3I35A 2CP6A 5GAN7 1JO8A 5GANg 4ZN1A 1QP2A 3BE3A 1B34A 4PKCC 3CEYA 3UF4A 2K79A 1QVFP 2RI2A 3A8GB 2XDDA 2EWNA 5D6WA 4E47A 2YRCA 3FB9A 2M0OA 3L42A 5GAMj 2OTJT 1G3TA 4LUEA 1IRXA 4A54A 1YHQT 1MMGA 1AWWA 2P4TA 4C92D 4JLIA 2L3PA 4M77D 3CC4Q 2HZYA 3JCMV 3M0SA 2C0OA 2DXTA 2DXUA 3CCSQ 2JUFA 5KYXB 4XU0A 3QZ9B 4C8QC 3P8DA 1Q82U 4OF1A 1VQOA 1VQNQ 3JCMQ 3A8OB 4HCCA 2QASA 4PJOC 1FMKA 2D6FA 2ZPEB 4GY5A 2A0FB 4LXCA 4X34A 3CBMA 3QHSA 1HD3A 1N5ZA 1IB8A 1WPYA 2X35A 2K6DA 2HSPA 5GAOr 4DBHA 2FPFA 4M7AB 3M55A 3M9QA 4Y28E 5LJ3j 4FT4A 2BZXA 3CMEQ 4C0FA 1I5OB 3BDUA 2XI9A 4ELZC 3ZL7C 3X20B 2D8HA 3CCEQ 1MMDA 2QEXA 2IPOB 2DIQA 4XAXB 4XTWA 2LNHB 1BYMA 1TS9A 2RF0A 4ZTFA 4V2SA 3QKJA 5CVIA 4BY6B 5I21A 1YN8A 1V76A 5DY9A 2GTOA 1YI2T 3PE0A 3FJ5A 1UDLA 4M77E 1OI1A 1JU5C 2FPDA 4LDXA 5GMKi 1E6GA 2KMTA 1MV3A 3HP9A 4NS5A 3MHXA 5CKFA 1YJWQ 2AZVA 3VKIA 5CCAA 1W1FA 2CZ1B 4NL2A 4M7AC 2OTLA 3HPWA 2EAYA 1K8AR 2O4XA 2RJCA 1N6AA 2YUQA 4NL3A 3H41A 4M75D 1UECA 2LT4A 2NUPB 3H0FA 4KULA 1OEBA 1X27A 3HFNA 2JT4A 3QUIA 4LDVA 4RTTA 4ESRA 3SD4A 3CC2T 2QQBA 5FW9A 5AYFA 2JVVA 3I55T 1VQ5A 1VQ9T 1X69A 1AHJB 4C0DB 4DBQA 4C8QE 3G71Q 3HFOA 2YUPA 2EPDA 4PJOE 3KXTA 3VU3C 2L2PA 1WDXA 1IGQA 1KD1R 2EQMA 1MUZA 1RI9A 2EKHA 1TTHB 4D8KA 1VQPT 2OAUA 2WSEE 5GJWB 1RADB 2QK0A 3CPFA 4WF2A 1M90C 1M2OA 2ZPFB 6AT1B 2ATCB 4A4KA 3S3NA 1UUEA 2XIDA 1BIAA 2DVEA 2YHTA 5GAOm 4L5GA 2QEXT 3QXEB 1OULA 1BIBA 3CC7T 3LH0A 1KC8R 4OB3B 1AT1B 1QCOA 3ER0A 3GPLA 3ME9A 4C0DC 4MZMA 2L3RA 1Y0MA 3EHRA 3GF5A 1QVGP 4WCIA 4B9XA 3OYKA 2BE9B 3UPUA 3CPWP 4KBMB 2DTOA 2RHXA 3CC4T 4BE1A 2HAXA 1IXDA 3CCST 1X6GA 2KGTA 4M7AE 1AWXA 3M5AA 2VWFA 2KXCA 1VQNT 3CCUA 3OA6A 2MAMA 2LX9A 2FO0A 2V8KA 1ZQ1A 1RAHB 2H3JA 5IHNA 2F2WA 2XD0A 1FWZA 1Q86R 3QZ5B 2IG0A 4M78G 4JRIA 1OZ2A 4OMOA 2DD4A 1SF9A 1FXXA 4JDSA 1RAGB 4J9HA 2PVOB 3CMET 2WSFE 1KK7A 2RJDA 1G5VA 2AKKA 2QQAA 4MMKA 4DEYA 2M02A 2NWMA 2F5TX 3CCET 2GTJA 4KRTA 2Y4XA 2P84A 2LMJA 4R0KA 1BU1A 4KGZB 2J7IA 1VYUA 4BDZA 1PD1A 1W6XA 2K4YA 3PT9A 5LJ5h 1GFDA 3UDCA 2Y90A 3I56Q 4EMKB 2O4XB 2O9VA 4MDWA 1IHVA 2HDAA 3VRZA 1PC0A 1ZUKA 1YJWT 4Z8AA 1S1NA 1UJ0A 2F5KA 1WHMA 2A36A 2L89A 2NUTA 2RD1A 1B3QA 4RTWA 4RTXA 4OB0B 2RN8A 3OYNA 1K0XA 1B7TA 3VS1A 2KEAA 5IN1A 3JB9H 1QKXA 2JS0A 1TH7A 2LJ3A 4E7LA 4JJBA 1K73U 3URGA 2JMAA 5IHKA 3UATA 3M56A 2QA4Q 3RESA 2D8JA 2C0IA 5CKEA 2R5AA 2O01E 3MP1A 2LCSA 1X75C 4PLIA 3VRYA 2LRQA 1IREB 2CZ6B 3M0QA 1JBMA 3HHTB 2DL7A 3G71T 3PIPA 1YJ9A 4ELYC 1OPLA 1T3LA 1UFFA 3G6EA 2SRCA 3P8HA 3S6WA 3RBBB 3TSWA 3CXCS 1U06A 2DL3A 1S72Q 2JTFA 5CQYA 2KE9A 3OYMA 5A0GA 2K5LA 4J83A 2XDBA 4QQGA 1EZZB 3F70A 3LGLA 4O6JA 1QMCA 4FIBA 4AMCA 3L2QA 3VS5A 1IO6A 1M2VB 1ABOA 4C5GA 1UGVA 5M9OA 2O88A 4AT1B 2FB7A 1YJNA 1M9SA 2BZ8A 2PUOB 4A4EA 2RO0A 4RTZA 3EFOB 5CKBA 3H0HA 2EYZA 4C8QA 3CCQQ 2AT1B 2D9TA 1NLPC 2YRVA 1LPLA 4LUDA 1ZLMA 4PJOA 1BK2A 1VQ4Q 3MKDA 3REBB 2DZ9A 4IUTA 3EG1A 3CMAA 2R5MA 3HSBA 4BE2A 2CYZB 1PD0A 5GAN3 1NZ9A 3ZBDA 2EYXA 1UHFA 4LD6A 5C6SA 1BCMA 2JZ2A 1RI0A 3VS4A 1GFCA 1YITA 1ARKA 3OYAA 3QSUA 1X01A 2G3RA 2PTKA 4KUDK 1V1CA 2DJQA 3MEWA 4C8QF 3MP6A 4XU1A 4F7UG 3PMTA 1NYGA 2VKNA 4PJOF 5KYXA 3BW1A 4AFQC 5GANj 2KYMA 4FCYA 2MF2A 5ECAA 1X6OA 4II1A 3CD6A 2RPNA 4J6YA 1OPKA 5D6XA 2ZGWA 2L0AA 2L5QA 1ABQA 1RUWA 1YWPA 4GLMA 2L3QA 2FG0A 3OW2P 3X28B 2VXFA 3FDRA 3FC3A 2EIFA 1TWBA 2DTIA 4J7IA 5J26A 3CXCA 3SDZA 1U5SA 4B6MA 4FT2A 3CCQA 2MK5A 3I56T 3V8LA 2A3LA 2RQRA 3THKA 2ZZDA 2J6OA 1QWFA 3CBOA 2MCNA 1MNEA 1KJWA 2YSQA 2C06A 2DYIA 4ZNXA 1QCFA 3P8BB 3FRNA 1SHGA 3HRSA 4O5VA 3X26B 1WZOA 2PVDB 3IQLA 1WXTA 1AEYA 1KHIA 2QI2A 3E9FA 4J8OA 1D0XA 2GBQA 2E10A 4FYYB 4DOWA 2JM9A 2M0YA 2JTMA 3JSCA 4M7AF 1ZSGA 1XQHA 2QA4T 4A63B 2F1LA 4A4FA 1VIFA 2HBPA 2KYBA 3CPWA 5CIUA 4X9CA 3RDVA 1VQOQ 1T3SA 1ZX6A 4EMHA 4AG2C 2NUPA 3V8KA 2PUKB 3V7CA 3GP8A 4WTOB 4ATOA 4QVZA 5LJ5d 1CSKA 1Y71A 1Q95G 4FW1A 1RAEB 1FX7A 3M4YA 1C0MA 4IUQA 1S72T 2ZPGB 2FRWA 2X4XA 4GLKA 4UC4A 2V1RA 1R0CB 2FPEA 5L23A 4QVCA 1I81A 2E6NA 1WIEA 4Y91A 5CR2A 1PKSA 4CC2A 5CAIA 3RKXA 1M8VA 2RK1A 4PJLA 4ZN3A 3OYYA 3CCQT 1SEMA 3H6ZA 1U1TA 3KFVA 1H3HA 1VQ4T 1M1FA 1AVZC 2E5KA 2QTVA 5EC7A 5CO7A 3UA6A 3U23A 2NLUA 5A2QE 4B9WA 4M7DG 3A8LB 8AT1B 2OTLQ 1Y96A 3EG9B 3CCJA 3JB9J 1RACB 1LNXA 3ASKA 2LTOA 1KIKA 4HCBA 4FL6A 2CZ0B 5GAOp 1NJIR 2EYQA 1KQ2A 4AFZC 1K73R 5GMKh 1C6VX 2F2XA 4JZ4A 4HKEA 4C5EA 2A7YA 2QXFA 2RNAA 1VQ5Q 1LJOA 2HD0A 4XTYA 3LYIA 4FYXB 2RI5A 2OAWA 3GIBA 4F04B 4HT9A 3M0PA 1JEGA 5CKDA 3VUBA 3MCAB 4JJNK 3CCLQ 2DK3A 2KQWA 2XDPA 4C8QD 1OOTA 4K11A 3V7SA 1VIEA 2HKQB 1D3BB 1T0JA 2RB6A 3UWNA 2CT4A 4PJOD 4YTLA 1WJQA 1NLOC 3A98A 1PM3A 1K1ZA 1VQ7A 1ACMB 2BIVA 2MMPA 5A0DA 3ZFJA 1Q81R 2LJ0A 4JRPA 2K3YA 1KHCA 2E3HA 3DB3A 4QQDA 3T9NA 3CCVA 1NM7A 1QWEA 2BUDA 4OVAA 1VA7A 3FEOA 3OYIA 1UGSB 4J9FA 2DO3A 4N4HA 4IIOA 2E5QA 3VS3A 1CKBA 1H3ZA 4CI0C 1GRIA 3OS2A 2QYZA 1ZA1B 4R56A 4N4GA 1H641 2L3SA 2W0ZA 2CUBA 4QVDA 1JRIA 1UGPB 8ATCB 1K9MC 2YRDA 4OGEA 1O9SA 3PGGA 4EMKA 2ECZA 2GFUA 3META 4JZ3A 2CSQA 1PCXA 3TCJA 2LT1A 3NGPA 1U3OA 2JXBA 5FWBA 2A28A 2ZPIB 4JLGA 3OSVA 4FW2A 4BY6C 1VQOT 1M3CA 1ZA2B 4X1VA 2E41A 3OMGA 3CCUQ 1BI3A 2CP0A 1N8RC 2RQTA 1H8KA 2DETA 4M7AD 1LVKA 1ZSZA 2QG9B 3QDRB 1M30A 2RA2A 3HRUA 1MV0B 4M7DB 5CQXA 1PSEA 3CCLA 4J9GA 3DB4A 3WVDB 3DLMA 3Q1JA 5LJ5f 1M1KC 2DIGA 2PZ1A 2DJZA 2EQIA 1BI1A 1TUGB 1NE8A 3I5RA 3GLXA 4PLLA 2LZ6B 3H0IA 2VGNA 2DE0X 2NYSA 2KNBB 4LDUA 4RG8A 1TU0B 2GCXA 1N8RU 1QVFS 2VYTA 3OW2A 1W2BA 1Y96B 4ORZA 1WYXA 1QW1A 2EJFA 1M4ZA 2X3WD 5LJ5e 4M78A 1M2VA 2EJGA 1PWTA 3OBWA 1UHCA 3EGDA 2QGGA 3KUFA 3NPFA 1PNJA 3REAB 2E12A 3HRTA 1M90U 1M1KU 2OTLT 3TU4K 3EFOA 2KROA 4OB2B 3QO3A 2KBTA 4HT8A 1ZBXA 1GBRA 3EHQA 2VASA 3JB9F 4FSXA 3OYBA 3EGUA 5LJ5g 5HKCA 3EGXA 1KQSP 2H3EB 3QYHB 3MEAA 5GAOn 4C0ZA 1Q7YR 2CT3A 2OJ2A 3EAEA 2ED1A 1VQ5T 4R55A 1K76A 1JJ2P 1VQMA 2MOXA 1YJ9Q 3QDFA 1TUCA 1G8XA 2KVQG 2XG8D 3MO8A 4LD9K 3LX7A 3CCLT 2CSIA 3G6EQ 2K2VA 2K3XA 3O8VA 2Y4YA 5LJ3h 1BCOA 2QQRA 3MJXA 2QGFB 2DA9A 1SRMA 1NBEB 3J81E 3GBQA 2FRYA 5KYYB 2M9UA 2K7AA 1WQ7A 4E7SA 5GAOq 2KR3A 3VS6A 1RAIB 4FM4B 3FJPA 1N9SA 1VUBA 2CZ7B 1JB0E 1MNDA 1TSFA 4JRKA 1G3SA 1YJNQ 2O9SA 1W70A 2JJ9A 3M53A 1SSFA 2DAQA 2EQKA 2FL7A 1VQLA 2F69A 2KRMA 2E4HA 5IAYA 2EGAA 2DXBA 4MZTA 3CMAQ 1QVFA 1D09B 1BKBA 2AHJB 2X9HA 4QW2A 1ZSZB 1IHWA 2LQKA 2ROTA 2DKGA 5IHIA 1K0SA 2PQWA 3QG1A 3CCUT 3OS5A 4XK8E 2GF7A 1QP3A 3H8ZA 4EMKC 1YITQ 4GBQA 4OB1B 1Q82R 2LDMA 4PNOA 5L8RE 3L2WA 3L2RA 3EH2A 4CRIA 2B86A 3G4SQ 1PKTA 4JUVA 2V26A 3RKYA 1PRLC 5DLQE 2ZPHB 3CD6Q 4FU6A 1MMNA 4J6WA 1NPRA 1K8AC 3RIRA 1JXOA 2QDYB 3CQTA 2E3IA 3OYJA 1SKUB 2I2LA 1ZSZC 1UG1A 1YNZA 4M78B 3S3MA 2IIMA 1XJWB 2DZCA 2RJEA 2L8DA 3EGDB 3L2ZA 4OMQA 4J5YA 4F14A 1YIJQ 3ZEHA 2HQEA 1VQ8A 1RL2A 1QVGS 1OZ3A 5I2SA 1JQQA 4IKFA 4C92G 4EMGA 1M3AA 2DILA 3CPWS 4M77G 1WJRA 1AOJA 3EGXB 4BI3A 1KD1C 5IXBA 4Z02A 2B8AA 3V8JA 3BFMA 2JTEA 1K8AU 5GAN2 3JCMP 1W4SA 3VJPA 3CCMA 3JCMf 1EFNA 4DQ2A 3EFRA 4FSSA 3X25B 3LLRA 4HVVA 2COYA 2EGCA 5KE2A 2LNVA 1RAAB 2JW4A 3OY9A 2DNUA 4RTUA 4M78C 5EG2A 1VQKQ 1R0BG 1N27A 3JV3A 5GAOl 2LQ8A 5LL6S 3G4SA 1KC8C 3EG9A 5GAN6 1OU8A 4DBFA 1O75A 3I9QA 3KBGA 2KK4A 2CP7A 2J06A 4DOVA 1NEBA 3JB9D 1YJ9T 2ESWA 3C95A 2E65A 1OX9A 2HMAA 5KCHA 3JCMe 4C8QG 4BD3A 2DL5A 1Z9QA 1KD1U 3G6ET 4PJOG 2P0KA 1TUDA 3J80E 2ZPBB 2ENMA 3A8HB 1GL5A 4LDWA 4OMMA 3G7ZA 3CCRQ 3HTRA 3M57A 3RMQA 1WX6A 2WSCE 5KYUA 1SSHA 1LCKA 1WNLA 2M16A 1YIJA 2DRMA 4RUGA 5GMKm 2DMOA 2YT6A 2HBWA 1UGQB 3JCMb 2ED0A 4L59A 4EDUA 1KC8U 1D3BA 3H9NA 1Q86C 1YJNT 4NOYA 5KYWB 3SWNB 2GNCA 4DEXA 4E7JA 2VUBA 3QJYA 3RUXA 2KT1A 4M75G 2LVMA 3EG0A 3CMAT 3G1JA 2OTJA 1TOVA 2V1QA 2HCKA 5FU6B 2AK5A 2FZGB 1VQKA 1QVGA 1HSQA 3CCJQ 1J3TA 3NHNA 4PK4A 3EG3A 2JM8A 1XNIA 2YLCA 2RQVA 1M90R 2E6ZA 2X51A 2COZA 3JCMh 4C92B 2NUZA 4M7AG 5IH2A 5LJ3d 4M77B 1YITT 4HVUA 1M3BA 1NG2A 1Q86U 1T0HA 4M78E 1CKAA 4CC3A 2HEQA 4D8DA 3G4ST 1MGQA 4PJNA 1QVPA 1AWJA 4E7HA 3C12A 5GMKe 1KQSA 3SWNC 3I55Q 3C94A 1HYOA 3CCRA 4IUVA 2XK0A 3OYHA 3CD6T 1WFWA 4HCKA 4PJMA 3EH1A 2EGEA 4LE9A 5DM7R 2DERA 3LWIA 2M51A 1JJ2A 1G3WA 4PFZA 5FU6C 4M7DA 2O2OA 5DLOA 5KCOA 4F7UB 2LCLA 1GXIE 1KQ1A 2DTHA 2OI3A 3OQ5A 2CP2A 3VS0A 3OS1A 2YUNA 3INZA 1WI7A 1NYFA 1YIJT 2ZCFB 2D0NA 1VQ7Q 4J6XA 1RLQC 3FLGA 4C92C 4Z89A 4ZTJA 2DFUA 1YI2A 1ZHIA 2COWA 3CCVQ 3E19A 4E7ZA 4L6V5 1SHFA 2V8JA 4XU2A 3HKSA 2RHIA 4J9BA 4XTZA 5AT1B 2DD5A 1WHJA 1N9RA 5GAN4 3RKWA 4EPCA 1QKWA 1TG0A 2FYKA 3C0CA 4HXJA 5GAN8 4M7DF 3M58A 3QBYA 3M54A 2EQUA 2RJFA 1I1JA 1UE9A 4RTVA 3OB9A 3VS2A 4J9DA 1VQKT 2MWPA 1H92A 2KAFA 2I0NA 2LC4A 7AT1B 3BY7A 3CC2A 2H8HA 3NFCA 4J7FA 2GGRA 2JNGA 4M75B 4D6WA 3I55A 5KYUB 2RHYA 1VQ9A 3QIIA 2DF6A 4OMPA 3JRZA 2EW3A 5D6YA 2IVWA 2EFIA 1G3YA 3RR6A 2ROLA 1TXQA 4EIKA 5GANh 2EKOA 3PMIA 1OV3A 4XTUA 3X24B 2LX7A 3OW2S 5IT9E 1W2BS 1UEBA 4X9DA 2SEMA 3BDLA 5FLXE 1WHLA 3CCRT 3AHUA 1PRMC 2JMCA 1VQPA 1UB4A 4ANJA 1OQKA 1D1AA 3MEUA 3JCMX 1UTIA 1M27C 3TVTA 2BKDN 2FVUA 1KSWA 2QDLA 2FEIA 3TEEA 1KFZA 2HSEB 1AD5A 5LJ5j 2DL4A 4N0AA 5GAMf 3CC7A 2FZKB 4JJCA 3ULRB 2XKOC 4KUIA 4M75C 5KYYA 2VXEA 1U8RA 3JB9I 2D0QB 1G83A 4C0GA 4C92E 3JCMc 1NEGA 4HA8A 1Y7XA 4KH1B 2ABLA 2RH2A 1OX8A 4P5NA 1IGUA 2X4YA 2DPPB 1D1CA 2QQSA 4IIMA 3CC4A 4QT7A 3CCJT 1XOVA 3O5ZA 1PG5B 2F2VA 3CCSA 5GAMe 1MHNA 2FHDA 2J6FA 1VQ6Q 1VQNA 2JOYA 5GMKl 1OYXA 1YFNA 2BE7D 1SRLA 3UA7A 5GAN5 2YLBA 4J9IA 2RI3A 4F7UE 2HL3A 5LJ3f 2LQWA 3OBYA 1K9MU 4QQ6A 1BB9A 1YCYA 1C1AA 1GBQA 1AZEA 1VQMQ 2K57A 1WXBA 2OX7A 5GAMg 4PFPA 3VV0A 1JXMA 2CKKA 1X2KA 2CH4A 3HL8A 3UT1A 1MMAA 3CMEA 2GFAA 2KT8A 1WHHA 2EYWA 2DBKA 2P0PA 4OP0A 5I2MA 3CCEA 3CXCP 2CUDA 4OGCA 1B34B 2KXDA 5LJ3e 1VQ7T 2D1XA 3SEMA 4RG2A 5GJVB 1GCQC 3GNFB 4JRQA 2YDLA 3PVLA 3CCVT 4KGVB 1FMWA 3M59A 4RCCA 3J7AF 1WQWA 1DJ7B 4M7DC 4XTXA 1EIFA 3NTHA 3JCMd 1YJWA 1WGSA 1AZGB 1OU9A 5GAMh 5FWCA 2KSSA 3PNWC 2RMOA 3TSZA 1VQLQ 2QTXA 1G2BA 4RCBA 5LJ3g 3OYFA 4M75E 3A1PA 3R6NA 4CC4B 5FRMA 2RM4A 2DLPA 2YWWA 1KG1A 2K5IA 1VQ6A 4PL6A 4XU3A 2X4JA 3OYLA 4VUBA 1QCNA 1WA7A 4PJJA 1M5Q1 2DXCA 2RK2A 2DVJA 4J9EA 1PHTA 1PSFA 4M7DD 3JB9G 3D7SB 2LP5A 4M78F 4CC7A 4ZGJB 2BZYA 3OMCA 1YCSB 2E1HA 1E6HA 3G71A 4A53A 2K5FA 2VB6A 3LWHA 4JS4A 2KDSA 1YP5A 1ZUYA 3E1SA 4AFUC 1YBYA 4F17A 2HQHA 3SB2A 2VC8A 3GNGA 4IUUA 4ZGEB 2AKLA 1GCPA 2QAZA 1QQJA 2XICA 1FYNA 3JAME 2P0QA 2DEQA 2EYYA 2MWOA 5KH6A 1NJIC 2X3XD 1K73C 5J39A 1RAFB 2K9GA 2KY9A 3M0RA 4HVWA 4LNPA 1I0CA 2R58A 3E2UA 3SHWA 1D0YA 2DM1A 1WHGA 1WHKA 4OMFB 3WXMB 4FYWB 1K4US 9ATCB 3MP8A 2W10A 1VQ8Q 5FRNA 4BI8B 3RMSA 2VGMA 5CK9A 4MMLA 2RHZA 4BDYA 2PVGB 4E7IA 4M7DE 4DA4A 3OYCA 5KYWA 2JS2A 4N0AC 3SWNA 1RLPC 3M0TA 3CCMQ 2VV5A 3S3OA 4OMNA 5GANd 3E9GA 3OS0A 2DX1A 1VQ6T 1Q81C 2K3BA 1NJIU 1VYVA 3DLLA 2CS7A 2YXYA 4KGXB 4IURA 5I22A 4DBRA 2DBMA 1EX4A 1IZ6A 2DL8A 2RQUA 3VYHB 1X2QA 3LGFA 4E7KA 1VQMT 2AIRB 3QPHA 4C92A 5CKHA 5IXFA 4M77A 4XTVA 3QWYA 1X6BA 4ME7A 2KRNA 1HJDA 3TQ7P 1QLYA 3N5BB 2C0TA 1WLPB 1SG5A 2RQWA 2G6FX 3JCMW 4LN2A 3LH5A 3R6OA 2LQNA 2DEUA 1UJYA 1AWOA 1Q81U 3L2VA 4KT0E 2KI7A 3M0UA 4QKUA 4Z88A 3MPUB 3I56A 3GOXA 1M8MA 3L2UA 3CBPA 4F7UA 2CH4W 2GQVA 3OSSC 4C92F 3EG2A 2XMFA 4M77F 3NMZC 1BI2A 5KE3A 1VQLT 4ZGDB 5FROA 1R77A 5D7UA 2ZAEA 3VYGA 3OYEA 4Q5WA 2RHUA 3RNJA 2OTJQ 2K2MA 3EFSA 1YHQQ 1KQSS 2CREA 2X4WA 1VOMA 3RERA 3NTKA 2J05A 3PVQA 3TREA 2CP5A 2QA4A 4F16A 2QQ9A 4LDYA 3A8MB 1A0NB 2P4RA 2LCCA 1JJ2S 1Y57A 2HKNA 1X43A 5GMKj 3PTAA 4F7UF 1FMVA 4MZPA 5A0LA 1BBZA 3FIFA 4C5IA 3L1AA 1I4K1 1XTDA 2YUOA 2KRSA 1ZUUA 1I5LA 4C5HA 3V7RA 3I5SA 4Y92A 3AT1B 3LW5E 2CDTA 2GQIA 1SPKA 5KYNA 1Z9ZA 2A37A 2PNIA 2HL5C 1K9MR 4M75A 4M78D 3OYGA 4A4HA 2AZSA 3QYGB 1S72A 3QWXX 1D0ZA 4MDXA 3M4GA 2LJ1A 2DYBA 1LOJA 2EVRA 4BE0A 5GAMd 3JCMg 2HQXA 4E6RA 1K9AA 5FU7B 2EBPA 2JN0A 3PIOA 2A08A 1W2BP 2MPXC 4E2FB 5J3BA 1U1SA 1Q7YC 4M7AA 3OYDA 2R57A 1NPPA 4M4ZA 2CGHA 1F1BB 4RTYA 1BI0A 2NUTB 4FYVB 1N8RR 3VS7A 1VQ8T 1YI2Q 2DRKA 2MI6A 2J6KA 1WXUA 2V8IA 1VQ4A 4N4IA 5HY6A 4HCZA 4M75F 2EJ9A 1YHQA 4BB7A 1R8OB 1VYTA 4KH0B 4JPBW 4BI4A 1YWOA 2E70A 3CCMT 3WVEB 3MEVA 2CP3A 4AFSC 3QJ6A 3SFMA 1M1KR 2FZCB 1HK9A 3VUZA 1Y07A 2HNIA 4AG1C 5GANf 1I8FA 2BTTA 3NTIA 2PU9B 5FU7C 3C4SA 4RKUE 4A4GA 5I11A 5HK0A 1Q7YU 3CC2Q 5HK3A 1HXDA 1E7OA 1D1BA 1WJSA 2EQJA 4J9CA 2VVKA 1M1GA 4TVRA 1VQ9Q 1GCQA 3DKMA 1P92A 2WACA 4PFOA 2Z0WA 2O31A 2XHCA 4JS5A 3PFSA 4JJDA 1B07A 1UGRB 2MIOA 3JCMJ 5GANe 1VQPQ 4XQ3A 1V29B 4C8QB 4OMLA 3A5ZB 4IUPA 2M1HA 5C0MA 4M77C 1ZBJA 2XU8A 1Q82C 4PJOB 4BUGA 4BACA 2MYSA 4RMOA 1RABB 5HCKA 1I07A 2QEXQ
chains in the Genus database with same CATH topology
2DJQA 3I35A 2LQWA 2O9SA 1W70A 1JO8A 1BB9A 1NYGA 2VKNA 3UF4A 2K79A 1GBQA 4AFQC 1AZEA 1WXBA 2KYMA 2KRMA 5ECAA 2RPNA 1OPKA 1JXMA 2EGAA 1X2KA 2CH4A 2L0AA 4LUEA 1ABQA 2KT8A 1RUWA 1AWWA 1YWPA 4GLMA 2EYWA 2DBKA 2L3PA 2L3QA 2FG0A 2ROTA 3M0SA 2C0OA 5IHIA 1K0SA 2CUDA 2KXDA 2D1XA 3SEMA 5GJVB 1GCQC 1U5SA 2YDLA 3PVLA 1FMKA 4GBQA 2RQRA 3THKA 2J6OA 1QWFA 2MCNA 1KJWA 2YSQA 1HD3A 2B86A 1N5ZA 4ZNXA 1QCFA 1PKTA 1AZGB 2K6DA 2HSPA 1SHGA 5FWCA 1PRLC 2RMOA 2FPFA 3TSZA 3IQLA 1G2BA 1WXTA 1AEYA 3R6NA 4CC4B 2GBQA 1JXOA 2BZXA 2DLPA 3CQTA 2JM9A 2M0YA 1UG1A 1YNZA 1ZSGA 3ZL7C 1WA7A 2IIMA 2D8HA 4A63B 2DVJA 2LNHB 4J9EA 4OMQA 1PHTA 2KYBA 2RF0A 4F14A 2LP5A 1YN8A 1T3SA 4CC7A 2BZYA 2GTOA 1ZX6A 1YCSB 3PE0A 3FJ5A 1UDLA 1E6HA 1JQQA 2FPDA 1JU5C 4AG2C 1M3AA 1YP5A 1E6GA 2DILA 1ZUYA 1MV3A 4AFUC 4F17A 1AOJA 2AZVA 5IXBA 1CSKA 1W1FA 2AKLA 1GCPA 2JTEA 2FRWA 1EFNA 2V1RA 4FSSA 4HVVA 1FYNA 2EGCA 2YUQA 3H41A 2JW4A 2DNUA 2EYYA 2FPEA 4RTUA 1UECA 2X3XD 5L23A 3H0FA 1OEBA 1X27A 2JT4A 3JV3A 2K9GA 3M0RA 1WIEA 4HVWA 4RTTA 4ESRA 1PKSA 4LNPA 4CC2A 1I0CA 5FW9A 3SHWA 2DM1A 1K4US 1X69A 3I9QA 2W10A 2J06A 1NEBA 1SEMA 3KFVA 2ESWA 1H3HA 2YUPA 2EPDA 2DL5A 1AVZC 1Z9QA 2E5KA 2L2PA 1WDXA 5EC7A 1TUDA 3UA6A 2ENMA 1GL5A 1MUZA 1RI9A 2EKHA 4OMMA 3U23A 4D8KA 2JS2A 1RLPC 5GJWB 3M0TA 1WX6A 1SSHA 1LCKA 4OMNA 2DRMA 4RUGA 2DX1A 2DMOA 2K3BA 1KIKA 1VYVA 2YT6A 1UUEA 2HBWA 2ED0A 5I22A 4AFZC 2DBMA 2F2XA 2DL8A 2RQUA 4JZ4A 2RNAA 1X2QA 2GNCA 4DEXA 2OAWA 2KT1A 1Y0MA 5IXFA 3QWYA 3EHRA 3EG0A 1X6BA 3M0PA 2KRNA 1HJDA 1JEGA 4WCIA 1QLYA 2V1QA 2HCKA 2C0TA 1WLPB 2AK5A 2RQWA 2G6FX 1OOTA 4K11A 4LN2A 1T0JA 3LH5A 2CT4A 2LQNA 1HSQA 1J3TA 1UJYA 3NHNA 1X6GA 1NLOC 2KGTA 1AWOA 3EG3A 2JM8A 2RQVA 3A98A 1AWXA 1K1ZA 2VWFA 2KXCA 2NUZA 5IH2A 2LJ0A 3M0UA 4HVUA 2FO0A 4Z88A 1M3BA 1NG2A 1M8MA 1NM7A 1QWEA 1VA7A 4J9FA 5IHNA 2CH4W 1T0HA 2F2WA 1CKAA 4CC3A 2HEQA 4IIOA 4D8DA 3VS3A 1CKBA 1GRIA 3EG2A 1AWJA 2XMFA 3NMZC 2L3SA 4OMOA 2W0ZA 2CUBA 1WFWA 4HCKA 2EGEA 4J9HA 4LE9A 2ECZA 3RNJA 2K2MA 2M51A 4JZ3A 2CSQA 2O2OA 2AKKA 2CREA 4DEYA 2NWMA 2J05A 2OI3A 3NGPA 2GTJA 3PVQA 4KRTA 1U3OA 2JXBA 4F16A 3VS0A 2LMJA 5FWBA 4R0KA 1BU1A 2A28A 2YUNA 1WI7A 1NYFA 1A0NB 2P4RA 2J7IA 1VYUA 2D0NA 1Y57A 1W6XA 1X43A 1M3CA 1RLQC 4X1VA 4Z89A 1GFDA 2RQTA 1BBZA 1H8KA 2O9VA 2HDAA 1SHFA 1M30A 2YUOA 3VRZA 2KRSA 1ZUUA 1MV0B 1ZUKA 3I5SA 4Y92A 4J9GA 4Z8AA 2CDTA 2GQIA 4J9BA 1S1NA 1UJ0A 1SPKA 1Z9ZA 2A37A 2PNIA 2A36A 2AZSA 1B3QA 1QKWA 1TG0A 3C0CA 4RTWA 4HXJA 4RTXA 2RN8A 3QWXX 1K0XA 3VS1A 2PZ1A 2KEAA 2LJ1A 1QKXA 2EQIA 2DYBA 2EVRA 2JS0A 2LJ3A 1I1JA 4JJBA 1UE9A 3I5RA 4RTVA 2JMAA 2LZ6B 3VS2A 5IHKA 3H0IA 4J9DA 3UATA 1K9AA 4E6RA 2EBPA 1H92A 2A08A 2DE0X 2I0NA 2D8JA 2C0IA 2H8HA 2KNBB 2LCSA 2GGRA 4M4ZA 3VRYA 4RTYA 4ORZA 1WYXA 3M0QA 3VS7A 2DF6A 2DRKA 4OMPA 2J6KA 2DL7A 2EW3A 1WXUA 2X3WD 2ROLA 4EIKA 1OPLA 1T3LA 1PWTA 1UFFA 1OV3A 1UHCA 2LX7A 2SRCA 3NPFA 3RBBB 3TSWA 1PNJA 1U06A 1VYTA 2DL3A 2SEMA 4JPBW 3REAB 1YWOA 1PRMC 2JMCA 2KE9A 2KROA 4AFSC 2KBTA 1GBRA 3EHQA 1UTIA 1M27C 3EGUA 3TVTA 1KSWA 4AG1C 2QDLA 3VS5A 2FEIA 1IO6A 2BTTA 1KFZA 5I11A 1ABOA 1AD5A 1UGVA 2DL4A 2O88A 2CT3A 2OJ2A 1E7OA 4JJCA 3ULRB 2ED1A 4J9CA 2BZ8A 2VVKA 4RTZA 1K76A 3H0HA 2EYZA 1GCQA 2MOXA 1G83A 1NLPC 1TUCA 4LUDA 1ZLMA 2O31A 1NEGA 1BK2A 2ABLA 3REBB 3EG1A 4JJDA 2CSIA 1B07A 2MIOA 4IIMA 4QT7A 2DA9A 1SRMA 1XOVA 3O5ZA 2F2VA 3GBQA 2EYXA 1UHFA 2FRYA 2J6FA 2K7AA 4OMLA 2KR3A 3VS6A 3VS4A 1ZBJA 1GFCA 1SRLA 1ARKA 3UA7A 4J9IA 5HCKA 2PTKA 1I07A 1V1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJQ A;  3I35 A;  2LQW A;  2O9S A;  1W70 A;  1JO8 A;  1BB9 A;  1NYG A;  2VKN A;  3UF4 A;  2K79 A;  1GBQ A;  4AFQ C;  1AZE A;  1WXB A;  2KYM A;  2KRM A;  5ECA A;  2RPN A;  1OPK A;  1JXM A;  2EGA A;  1X2K A;  2CH4 A;  2L0A A;  4LUE A;  1ABQ A;  2KT8 A;  1RUW A;  1AWW A;  1YWP A;  4GLM A;  2EYW A;  2DBK A;  2L3P A;  2L3Q A;  2FG0 A;  2ROT A;  3M0S A;  2C0O A;  5IHI A;  1K0S A;  2CUD A;  2KXD A;  2D1X A;  3SEM A;  5GJV B;  1GCQ C;  1U5S A;  2YDL A;  3PVL A;  1FMK A;  4GBQ A;  2RQR A;  3THK A;  2J6O A;  1QWF A;  2MCN A;  1KJW A;  2YSQ A;  1HD3 A;  2B86 A;  1N5Z A;  4ZNX A;  1QCF A;  1PKT A;  1AZG B;  2K6D A;  2HSP A;  1SHG A;  5FWC A;  1PRL C;  2RMO A;  2FPF A;  3TSZ A;  3IQL A;  1G2B A;  1WXT A;  1AEY A;  3R6N A;  4CC4 B;  2GBQ A;  1JXO A;  2BZX A;  2DLP A;  3CQT A;  2JM9 A;  2M0Y A;  1UG1 A;  1YNZ A;  1ZSG A;  3ZL7 C;  1WA7 A;  2IIM A;  2D8H A;  4A63 B;  2DVJ A;  2LNH B;  4J9E A;  4OMQ A;  1PHT A;  2KYB A;  2RF0 A;  4F14 A;  2LP5 A;  1YN8 A;  1T3S A;  4CC7 A;  2BZY A;  2GTO A;  1ZX6 A;  1YCS B;  3PE0 A;  3FJ5 A;  1UDL A;  1E6H A;  1JQQ A;  2FPD A;  1JU5 C;  4AG2 C;  1M3A A;  1YP5 A;  1E6G A;  2DIL A;  1ZUY A;  1MV3 A;  4AFU C;  4F17 A;  1AOJ A;  2AZV A;  5IXB A;  1CSK A;  1W1F A;  2AKL A;  1GCP A;  2JTE A;  2FRW A;  1EFN A;  2V1R A;  4FSS A;  4HVV A;  1FYN A;  2EGC A;  2YUQ A;  3H41 A;  2JW4 A;  2DNU A;  2EYY A;  2FPE A;  4RTU A;  1UEC A;  2X3X D;  5L23 A;  3H0F A;  1OEB A;  1X27 A;  2JT4 A;  3JV3 A;  2K9G A;  3M0R A;  1WIE A;  4HVW A;  4RTT A;  4ESR A;  1PKS A;  4LNP A;  4CC2 A;  1I0C A;  5FW9 A;  3SHW A;  2DM1 A;  1K4U S;  1X69 A;  3I9Q A;  2W10 A;  2J06 A;  1NEB A;  1SEM A;  3KFV A;  2ESW A;  1H3H A;  2YUP A;  2EPD A;  2DL5 A;  1AVZ C;  1Z9Q A;  2E5K A;  2L2P A;  1WDX A;  5EC7 A;  1TUD A;  3UA6 A;  2ENM A;  1GL5 A;  1MUZ A;  1RI9 A;  2EKH A;  4OMM A;  3U23 A;  4D8K A;  2JS2 A;  1RLP C;  5GJW B;  3M0T A;  1WX6 A;  1SSH A;  1LCK A;  4OMN A;  2DRM A;  4RUG A;  2DX1 A;  2DMO A;  2K3B A;  1KIK A;  1VYV A;  2YT6 A;  1UUE A;  2HBW A;  2ED0 A;  5I22 A;  4AFZ C;  2DBM A;  2F2X A;  2DL8 A;  2RQU A;  4JZ4 A;  2RNA A;  1X2Q A;  2GNC A;  4DEX A;  2OAW A;  2KT1 A;  1Y0M A;  5IXF A;  3QWY A;  3EHR A;  3EG0 A;  1X6B A;  3M0P A;  2KRN A;  1HJD A;  1JEG A;  4WCI A;  1QLY A;  2V1Q A;  2HCK A;  2C0T A;  1WLP B;  2AK5 A;  2RQW A;  2G6F X;  1OOT A;  4K11 A;  4LN2 A;  1T0J A;  3LH5 A;  2CT4 A;  2LQN A;  1HSQ A;  1J3T A;  1UJY A;  3NHN A;  1X6G A;  1NLO C;  2KGT A;  1AWO A;  3EG3 A;  2JM8 A;  2RQV A;  3A98 A;  1AWX A;  1K1Z A;  2VWF A;  2KXC A;  2NUZ A;  5IH2 A;  2LJ0 A;  3M0U A;  4HVU A;  2FO0 A;  4Z88 A;  1M3B A;  1NG2 A;  1M8M A;  1NM7 A;  1QWE A;  1VA7 A;  4J9F A;  5IHN A;  2CH4 W;  1T0H A;  2F2W A;  1CKA A;  4CC3 A;  2HEQ A;  4IIO A;  4D8D A;  3VS3 A;  1CKB A;  1GRI A;  3EG2 A;  1AWJ A;  2XMF A;  3NMZ C;  2L3S A;  4OMO A;  2W0Z A;  2CUB A;  1WFW A;  4HCK A;  2EGE A;  4J9H A;  4LE9 A;  2ECZ A;  3RNJ A;  2K2M A;  2M51 A;  4JZ3 A;  2CSQ A;  2O2O A;  2AKK A;  2CRE A;  4DEY A;  2NWM A;  2J05 A;  2OI3 A;  3NGP A;  2GTJ A;  3PVQ A;  4KRT A;  1U3O A;  2JXB A;  4F16 A;  3VS0 A;  2LMJ A;  5FWB A;  4R0K A;  1BU1 A;  2A28 A;  2YUN A;  1WI7 A;  1NYF A;  1A0N B;  2P4R A;  2J7I A;  1VYU A;  2D0N A;  1Y57 A;  1W6X A;  1X43 A;  1M3C A;  1RLQ C;  4X1V A;  4Z89 A;  1GFD A;  2RQT A;  1BBZ A;  1H8K A;  2O9V A;  2HDA A;  1SHF A;  1M30 A;  2YUO A;  3VRZ A;  2KRS A;  1ZUU A;  1MV0 B;  1ZUK A;  3I5S A;  4Y92 A;  4J9G A;  4Z8A A;  2CDT A;  2GQI A;  4J9B A;  1S1N A;  1UJ0 A;  1SPK A;  1Z9Z A;  2A37 A;  2PNI A;  2A36 A;  2AZS A;  1B3Q A;  1QKW A;  1TG0 A;  3C0C A;  4RTW A;  4HXJ A;  4RTX A;  2RN8 A;  3QWX X;  1K0X A;  3VS1 A;  2PZ1 A;  2KEA A;  2LJ1 A;  1QKX A;  2EQI A;  2DYB A;  2EVR A;  2JS0 A;  2LJ3 A;  1I1J A;  4JJB A;  1UE9 A;  3I5R A;  4RTV A;  2JMA A;  2LZ6 B;  3VS2 A;  5IHK A;  3H0I A;  4J9D A;  3UAT A;  1K9A A;  4E6R A;  2EBP A;  1H92 A;  2A08 A;  2DE0 X;  2I0N A;  2D8J A;  2C0I A;  2H8H A;  2KNB B;  2LCS A;  2GGR A;  4M4Z A;  3VRY A;  4RTY A;  4ORZ A;  1WYX A;  3M0Q A;  3VS7 A;  2DF6 A;  2DRK A;  4OMP A;  2J6K A;  2DL7 A;  2EW3 A;  1WXU A;  2X3W D;  2ROL A;  4EIK A;  1OPL A;  1T3L A;  1PWT A;  1UFF A;  1OV3 A;  1UHC A;  2LX7 A;  2SRC A;  3NPF A;  3RBB B;  3TSW A;  1PNJ A;  1U06 A;  1VYT A;  2DL3 A;  2SEM A;  4JPB W;  3REA B;  1YWO A;  1PRM C;  2JMC A;  2KE9 A;  2KRO A;  4AFS C;  2KBT A;  1GBR A;  3EHQ A;  1UTI A;  1M27 C;  3EGU A;  3TVT A;  1KSW A;  4AG1 C;  2QDL A;  3VS5 A;  2FEI A;  1IO6 A;  2BTT A;  1KFZ A;  5I11 A;  1ABO A;  1AD5 A;  1UGV A;  2DL4 A;  2O88 A;  2CT3 A;  2OJ2 A;  1E7O A;  4JJC A;  3ULR B;  2ED1 A;  4J9C A;  2BZ8 A;  2VVK A;  4RTZ A;  1K76 A;  3H0H A;  2EYZ A;  1GCQ A;  2MOX A;  1G83 A;  1NLP C;  1TUC A;  4LUD A;  1ZLM A;  2O31 A;  1NEG A;  1BK2 A;  2ABL A;  3REB B;  3EG1 A;  4JJD A;  2CSI A;  1B07 A;  2MIO A;  4IIM A;  4QT7 A;  2DA9 A;  1SRM A;  1XOV A;  3O5Z A;  2F2V A;  3GBQ A;  2EYX A;  1UHF A;  2FRY A;  2J6F A;  2K7A A;  4OML A;  2KR3 A;  3VS6 A;  3VS4 A;  1ZBJ A;  1GFC A;  1SRL A;  1ARK A;  3UA7 A;  4J9I A;  5HCK A;  2PTK A;  1I07 A;  1V1C A; 
#chains in the Genus database with same CATH topology
 3CC7 Q;  2E64 A;  3I35 A;  2CP6 A;  5GAN 7;  1JO8 A;  5GAN g;  4ZN1 A;  1QP2 A;  3BE3 A;  1B34 A;  4PKC C;  3CEY A;  3UF4 A;  2K79 A;  1QVF P;  2RI2 A;  3A8G B;  2XDD A;  2EWN A;  5D6W A;  4E47 A;  2YRC A;  3FB9 A;  2M0O A;  3L42 A;  5GAM j;  2OTJ T;  1G3T A;  4LUE A;  1IRX A;  4A54 A;  1YHQ T;  1MMG A;  1AWW A;  2P4T A;  4C92 D;  4JLI A;  2L3P A;  4M77 D;  3CC4 Q;  2HZY A;  3JCM V;  3M0S A;  2C0O A;  2DXT A;  2DXU A;  3CCS Q;  2JUF A;  5KYX B;  4XU0 A;  3QZ9 B;  4C8Q C;  3P8D A;  1Q82 U;  4OF1 A;  1VQO A;  1VQN Q;  3JCM Q;  3A8O B;  4HCC A;  2QAS A;  4PJO C;  1FMK A;  2D6F A;  2ZPE B;  4GY5 A;  2A0F B;  4LXC A;  4X34 A;  3CBM A;  3QHS A;  1HD3 A;  1N5Z A;  1IB8 A;  1WPY A;  2X35 A;  2K6D A;  2HSP A;  5GAO r;  4DBH A;  2FPF A;  4M7A B;  3M55 A;  3M9Q A;  4Y28 E;  5LJ3 j;  4FT4 A;  2BZX A;  3CME Q;  4C0F A;  1I5O B;  3BDU A;  2XI9 A;  4ELZ C;  3ZL7 C;  3X20 B;  2D8H A;  3CCE Q;  1MMD A;  2QEX A;  2IPO B;  2DIQ A;  4XAX B;  4XTW A;  2LNH B;  1BYM A;  1TS9 A;  2RF0 A;  4ZTF A;  4V2S A;  3QKJ A;  5CVI A;  4BY6 B;  5I21 A;  1YN8 A;  1V76 A;  5DY9 A;  2GTO A;  1YI2 T;  3PE0 A;  3FJ5 A;  1UDL A;  4M77 E;  1OI1 A;  1JU5 C;  2FPD A;  4LDX A;  5GMK i;  1E6G A;  2KMT A;  1MV3 A;  3HP9 A;  4NS5 A;  3MHX A;  5CKF A;  1YJW Q;  2AZV A;  3VKI A;  5CCA A;  1W1F A;  2CZ1 B;  4NL2 A;  4M7A C;  2OTL A;  3HPW A;  2EAY A;  1K8A R;  2O4X A;  2RJC A;  1N6A A;  2YUQ A;  4NL3 A;  3H41 A;  4M75 D;  1UEC A;  2LT4 A;  2NUP B;  3H0F A;  4KUL A;  1OEB A;  1X27 A;  3HFN A;  2JT4 A;  3QUI A;  4LDV A;  4RTT A;  4ESR A;  3SD4 A;  3CC2 T;  2QQB A;  5FW9 A;  5AYF A;  2JVV A;  3I55 T;  1VQ5 A;  1VQ9 T;  1X69 A;  1AHJ B;  4C0D B;  4DBQ A;  4C8Q E;  3G71 Q;  3HFO A;  2YUP A;  2EPD A;  4PJO E;  3KXT A;  3VU3 C;  2L2P A;  1WDX A;  1IGQ A;  1KD1 R;  2EQM A;  1MUZ A;  1RI9 A;  2EKH A;  1TTH B;  4D8K A;  1VQP T;  2OAU A;  2WSE E;  5GJW B;  1RAD B;  2QK0 A;  3CPF A;  4WF2 A;  1M90 C;  1M2O A;  2ZPF B;  6AT1 B;  2ATC B;  4A4K A;  3S3N A;  1UUE A;  2XID A;  1BIA A;  2DVE A;  2YHT A;  5GAO m;  4L5G A;  2QEX T;  3QXE B;  1OUL A;  1BIB A;  3CC7 T;  3LH0 A;  1KC8 R;  4OB3 B;  1AT1 B;  1QCO A;  3ER0 A;  3GPL A;  3ME9 A;  4C0D C;  4MZM A;  2L3R A;  1Y0M A;  3EHR A;  3GF5 A;  1QVG P;  4WCI A;  4B9X A;  3OYK A;  2BE9 B;  3UPU A;  3CPW P;  4KBM B;  2DTO A;  2RHX A;  3CC4 T;  4BE1 A;  2HAX A;  1IXD A;  3CCS T;  1X6G A;  2KGT A;  4M7A E;  1AWX A;  3M5A A;  2VWF A;  2KXC A;  1VQN T;  3CCU A;  3OA6 A;  2MAM A;  2LX9 A;  2FO0 A;  2V8K A;  1ZQ1 A;  1RAH B;  2H3J A;  5IHN A;  2F2W A;  2XD0 A;  1FWZ A;  1Q86 R;  3QZ5 B;  2IG0 A;  4M78 G;  4JRI A;  1OZ2 A;  4OMO A;  2DD4 A;  1SF9 A;  1FXX A;  4JDS A;  1RAG B;  4J9H A;  2PVO B;  3CME T;  2WSF E;  1KK7 A;  2RJD A;  1G5V A;  2AKK A;  2QQA A;  4MMK A;  4DEY A;  2M02 A;  2NWM A;  2F5T X;  3CCE T;  2GTJ A;  4KRT A;  2Y4X A;  2P84 A;  2LMJ A;  4R0K A;  1BU1 A;  4KGZ B;  2J7I A;  1VYU A;  4BDZ A;  1PD1 A;  1W6X A;  2K4Y A;  3PT9 A;  5LJ5 h;  1GFD A;  3UDC A;  2Y90 A;  3I56 Q;  4EMK B;  2O4X B;  2O9V A;  4MDW A;  1IHV A;  2HDA A;  3VRZ A;  1PC0 A;  1ZUK A;  1YJW T;  4Z8A A;  1S1N A;  1UJ0 A;  2F5K A;  1WHM A;  2A36 A;  2L89 A;  2NUT A;  2RD1 A;  1B3Q A;  4RTW A;  4RTX A;  4OB0 B;  2RN8 A;  3OYN A;  1K0X A;  1B7T A;  3VS1 A;  2KEA A;  5IN1 A;  3JB9 H;  1QKX A;  2JS0 A;  1TH7 A;  2LJ3 A;  4E7L A;  4JJB A;  1K73 U;  3URG A;  2JMA A;  5IHK A;  3UAT A;  3M56 A;  2QA4 Q;  3RES A;  2D8J A;  2C0I A;  5CKE A;  2R5A A;  2O01 E;  3MP1 A;  2LCS A;  1X75 C;  4PLI A;  3VRY A;  2LRQ A;  1IRE B;  2CZ6 B;  3M0Q A;  1JBM A;  3HHT B;  2DL7 A;  3G71 T;  3PIP A;  1YJ9 A;  4ELY C;  1OPL A;  1T3L A;  1UFF A;  3G6E A;  2SRC A;  3P8H A;  3S6W A;  3RBB B;  3TSW A;  3CXC S;  1U06 A;  2DL3 A;  1S72 Q;  2JTF A;  5CQY A;  2KE9 A;  3OYM A;  5A0G A;  2K5L A;  4J83 A;  2XDB A;  4QQG A;  1EZZ B;  3F70 A;  3LGL A;  4O6J A;  1QMC A;  4FIB A;  4AMC A;  3L2Q A;  3VS5 A;  1IO6 A;  1M2V B;  1ABO A;  4C5G A;  1UGV A;  5M9O A;  2O88 A;  4AT1 B;  2FB7 A;  1YJN A;  1M9S A;  2BZ8 A;  2PUO B;  4A4E A;  2RO0 A;  4RTZ A;  3EFO B;  5CKB A;  3H0H A;  2EYZ A;  4C8Q A;  3CCQ Q;  2AT1 B;  2D9T A;  1NLP C;  2YRV A;  1LPL A;  4LUD A;  1ZLM A;  4PJO A;  1BK2 A;  1VQ4 Q;  3MKD A;  3REB B;  2DZ9 A;  4IUT A;  3EG1 A;  3CMA A;  2R5M A;  3HSB A;  4BE2 A;  2CYZ B;  1PD0 A;  5GAN 3;  1NZ9 A;  3ZBD A;  2EYX A;  1UHF A;  4LD6 A;  5C6S A;  1BCM A;  2JZ2 A;  1RI0 A;  3VS4 A;  1GFC A;  1YIT A;  1ARK A;  3OYA A;  3QSU A;  1X01 A;  2G3R A;  2PTK A;  4KUD K;  1V1C A;  2DJQ A;  3MEW A;  4C8Q F;  3MP6 A;  4XU1 A;  4F7U G;  3PMT A;  1NYG A;  2VKN A;  4PJO F;  5KYX A;  3BW1 A;  4AFQ C;  5GAN j;  2KYM A;  4FCY A;  2MF2 A;  5ECA A;  1X6O A;  4II1 A;  3CD6 A;  2RPN A;  4J6Y A;  1OPK A;  5D6X A;  2ZGW A;  2L0A A;  2L5Q A;  1ABQ A;  1RUW A;  1YWP A;  4GLM A;  2L3Q A;  2FG0 A;  3OW2 P;  3X28 B;  2VXF A;  3FDR A;  3FC3 A;  2EIF A;  1TWB A;  2DTI A;  4J7I A;  5J26 A;  3CXC A;  3SDZ A;  1U5S A;  4B6M A;  4FT2 A;  3CCQ A;  2MK5 A;  3I56 T;  3V8L A;  2A3L A;  2RQR A;  3THK A;  2ZZD A;  2J6O A;  1QWF A;  3CBO A;  2MCN A;  1MNE A;  1KJW A;  2YSQ A;  2C06 A;  2DYI A;  4ZNX A;  1QCF A;  3P8B B;  3FRN A;  1SHG A;  3HRS A;  4O5V A;  3X26 B;  1WZO A;  2PVD B;  3IQL A;  1WXT A;  1AEY A;  1KHI A;  2QI2 A;  3E9F A;  4J8O A;  1D0X A;  2GBQ A;  2E10 A;  4FYY B;  4DOW A;  2JM9 A;  2M0Y A;  2JTM A;  3JSC A;  4M7A F;  1ZSG A;  1XQH A;  2QA4 T;  4A63 B;  2F1L A;  4A4F A;  1VIF A;  2HBP A;  2KYB A;  3CPW A;  5CIU A;  4X9C A;  3RDV A;  1VQO Q;  1T3S A;  1ZX6 A;  4EMH A;  4AG2 C;  2NUP A;  3V8K A;  2PUK B;  3V7C A;  3GP8 A;  4WTO B;  4ATO A;  4QVZ A;  5LJ5 d;  1CSK A;  1Y71 A;  1Q95 G;  4FW1 A;  1RAE B;  1FX7 A;  3M4Y A;  1C0M A;  4IUQ A;  1S72 T;  2ZPG B;  2FRW A;  2X4X A;  4GLK A;  4UC4 A;  2V1R A;  1R0C B;  2FPE A;  5L23 A;  4QVC A;  1I81 A;  2E6N A;  1WIE A;  4Y91 A;  5CR2 A;  1PKS A;  4CC2 A;  5CAI A;  3RKX A;  1M8V A;  2RK1 A;  4PJL A;  4ZN3 A;  3OYY A;  3CCQ T;  1SEM A;  3H6Z A;  1U1T A;  3KFV A;  1H3H A;  1VQ4 T;  1M1F A;  1AVZ C;  2E5K A;  2QTV A;  5EC7 A;  5CO7 A;  3UA6 A;  3U23 A;  2NLU A;  5A2Q E;  4B9W A;  4M7D G;  3A8L B;  8AT1 B;  2OTL Q;  1Y96 A;  3EG9 B;  3CCJ A;  3JB9 J;  1RAC B;  1LNX A;  3ASK A;  2LTO A;  1KIK A;  4HCB A;  4FL6 A;  2CZ0 B;  5GAO p;  1NJI R;  2EYQ A;  1KQ2 A;  4AFZ C;  1K73 R;  5GMK h;  1C6V X;  2F2X A;  4JZ4 A;  4HKE A;  4C5E A;  2A7Y A;  2QXF A;  2RNA A;  1VQ5 Q;  1LJO A;  2HD0 A;  4XTY A;  3LYI A;  4FYX B;  2RI5 A;  2OAW A;  3GIB A;  4F04 B;  4HT9 A;  3M0P A;  1JEG A;  5CKD A;  3VUB A;  3MCA B;  4JJN K;  3CCL Q;  2DK3 A;  2KQW A;  2XDP A;  4C8Q D;  1OOT A;  4K11 A;  3V7S A;  1VIE A;  2HKQ B;  1D3B B;  1T0J A;  2RB6 A;  3UWN A;  2CT4 A;  4PJO D;  4YTL A;  1WJQ A;  1NLO C;  3A98 A;  1PM3 A;  1K1Z A;  1VQ7 A;  1ACM B;  2BIV A;  2MMP A;  5A0D A;  3ZFJ A;  1Q81 R;  2LJ0 A;  4JRP A;  2K3Y A;  1KHC A;  2E3H A;  3DB3 A;  4QQD A;  3T9N A;  3CCV A;  1NM7 A;  1QWE A;  2BUD A;  4OVA A;  1VA7 A;  3FEO A;  3OYI A;  1UGS B;  4J9F A;  2DO3 A;  4N4H A;  4IIO A;  2E5Q A;  3VS3 A;  1CKB A;  1H3Z A;  4CI0 C;  1GRI A;  3OS2 A;  2QYZ A;  1ZA1 B;  4R56 A;  4N4G A;  1H64 1;  2L3S A;  2W0Z A;  2CUB A;  4QVD A;  1JRI A;  1UGP B;  8ATC B;  1K9M C;  2YRD A;  4OGE A;  1O9S A;  3PGG A;  4EMK A;  2ECZ A;  2GFU A;  3MET A;  4JZ3 A;  2CSQ A;  1PCX A;  3TCJ A;  2LT1 A;  3NGP A;  1U3O A;  2JXB A;  5FWB A;  2A28 A;  2ZPI B;  4JLG A;  3OSV A;  4FW2 A;  4BY6 C;  1VQO T;  1M3C A;  1ZA2 B;  4X1V A;  2E41 A;  3OMG A;  3CCU Q;  1BI3 A;  2CP0 A;  1N8R C;  2RQT A;  1H8K A;  2DET A;  4M7A D;  1LVK A;  1ZSZ A;  2QG9 B;  3QDR B;  1M30 A;  2RA2 A;  3HRU A;  1MV0 B;  4M7D B;  5CQX A;  1PSE A;  3CCL A;  4J9G A;  3DB4 A;  3WVD B;  3DLM A;  3Q1J A;  5LJ5 f;  1M1K C;  2DIG A;  2PZ1 A;  2DJZ A;  2EQI A;  1BI1 A;  1TUG B;  1NE8 A;  3I5R A;  3GLX A;  4PLL A;  2LZ6 B;  3H0I A;  2VGN A;  2DE0 X;  2NYS A;  2KNB B;  4LDU A;  4RG8 A;  1TU0 B;  2GCX A;  1N8R U;  1QVF S;  2VYT A;  3OW2 A;  1W2B A;  1Y96 B;  4ORZ A;  1WYX A;  1QW1 A;  2EJF A;  1M4Z A;  2X3W D;  5LJ5 e;  4M78 A;  1M2V A;  2EJG A;  1PWT A;  3OBW A;  1UHC A;  3EGD A;  2QGG A;  3KUF A;  3NPF A;  1PNJ A;  3REA B;  2E12 A;  3HRT A;  1M90 U;  1M1K U;  2OTL T;  3TU4 K;  3EFO A;  2KRO A;  4OB2 B;  3QO3 A;  2KBT A;  4HT8 A;  1ZBX A;  1GBR A;  3EHQ A;  2VAS A;  3JB9 F;  4FSX A;  3OYB A;  3EGU A;  5LJ5 g;  5HKC A;  3EGX A;  1KQS P;  2H3E B;  3QYH B;  3MEA A;  5GAO n;  4C0Z A;  1Q7Y R;  2CT3 A;  2OJ2 A;  3EAE A;  2ED1 A;  1VQ5 T;  4R55 A;  1K76 A;  1JJ2 P;  1VQM A;  2MOX A;  1YJ9 Q;  3QDF A;  1TUC A;  1G8X A;  2KVQ G;  2XG8 D;  3MO8 A;  4LD9 K;  3LX7 A;  3CCL T;  2CSI A;  3G6E Q;  2K2V A;  2K3X A;  3O8V A;  2Y4Y A;  5LJ3 h;  1BCO A;  2QQR A;  3MJX A;  2QGF B;  2DA9 A;  1SRM A;  1NBE B;  3J81 E;  3GBQ A;  2FRY A;  5KYY B;  2M9U A;  2K7A A;  1WQ7 A;  4E7S A;  5GAO q;  2KR3 A;  3VS6 A;  1RAI B;  4FM4 B;  3FJP A;  1N9S A;  1VUB A;  2CZ7 B;  1JB0 E;  1MND A;  1TSF A;  4JRK A;  1G3S A;  1YJN Q;  2O9S A;  1W70 A;  2JJ9 A;  3M53 A;  1SSF A;  2DAQ A;  2EQK A;  2FL7 A;  1VQL A;  2F69 A;  2KRM A;  2E4H A;  5IAY A;  2EGA A;  2DXB A;  4MZT A;  3CMA Q;  1QVF A;  1D09 B;  1BKB A;  2AHJ B;  2X9H A;  4QW2 A;  1ZSZ B;  1IHW A;  2LQK A;  2ROT A;  2DKG A;  5IHI A;  1K0S A;  2PQW A;  3QG1 A;  3CCU T;  3OS5 A;  4XK8 E;  2GF7 A;  1QP3 A;  3H8Z A;  4EMK C;  1YIT Q;  4GBQ A;  4OB1 B;  1Q82 R;  2LDM A;  4PNO A;  5L8R E;  3L2W A;  3L2R A;  3EH2 A;  4CRI A;  2B86 A;  3G4S Q;  1PKT A;  4JUV A;  2V26 A;  3RKY A;  1PRL C;  5DLQ E;  2ZPH B;  3CD6 Q;  4FU6 A;  1MMN A;  4J6W A;  1NPR A;  1K8A C;  3RIR A;  1JXO A;  2QDY B;  3CQT A;  2E3I A;  3OYJ A;  1SKU B;  2I2L A;  1ZSZ C;  1UG1 A;  1YNZ A;  4M78 B;  3S3M A;  2IIM A;  1XJW B;  2DZC A;  2RJE A;  2L8D A;  3EGD B;  3L2Z A;  4OMQ A;  4J5Y A;  4F14 A;  1YIJ Q;  3ZEH A;  2HQE A;  1VQ8 A;  1RL2 A;  1QVG S;  1OZ3 A;  5I2S A;  1JQQ A;  4IKF A;  4C92 G;  4EMG A;  1M3A A;  2DIL A;  3CPW S;  4M77 G;  1WJR A;  1AOJ A;  3EGX B;  4BI3 A;  1KD1 C;  5IXB A;  4Z02 A;  2B8A A;  3V8J A;  3BFM A;  2JTE A;  1K8A U;  5GAN 2;  3JCM P;  1W4S A;  3VJP A;  3CCM A;  3JCM f;  1EFN A;  4DQ2 A;  3EFR A;  4FSS A;  3X25 B;  3LLR A;  4HVV A;  2COY A;  2EGC A;  5KE2 A;  2LNV A;  1RAA B;  2JW4 A;  3OY9 A;  2DNU A;  4RTU A;  4M78 C;  5EG2 A;  1VQK Q;  1R0B G;  1N27 A;  3JV3 A;  5GAO l;  2LQ8 A;  5LL6 S;  3G4S A;  1KC8 C;  3EG9 A;  5GAN 6;  1OU8 A;  4DBF A;  1O75 A;  3I9Q A;  3KBG A;  2KK4 A;  2CP7 A;  2J06 A;  4DOV A;  1NEB A;  3JB9 D;  1YJ9 T;  2ESW A;  3C95 A;  2E65 A;  1OX9 A;  2HMA A;  5KCH A;  3JCM e;  4C8Q G;  4BD3 A;  2DL5 A;  1Z9Q A;  1KD1 U;  3G6E T;  4PJO G;  2P0K A;  1TUD A;  3J80 E;  2ZPB B;  2ENM A;  3A8H B;  1GL5 A;  4LDW A;  4OMM A;  3G7Z A;  3CCR Q;  3HTR A;  3M57 A;  3RMQ A;  1WX6 A;  2WSC E;  5KYU A;  1SSH A;  1LCK A;  1WNL A;  2M16 A;  1YIJ A;  2DRM A;  4RUG A;  5GMK m;  2DMO A;  2YT6 A;  2HBW A;  1UGQ B;  3JCM b;  2ED0 A;  4L59 A;  4EDU A;  1KC8 U;  1D3B A;  3H9N A;  1Q86 C;  1YJN T;  4NOY A;  5KYW B;  3SWN B;  2GNC A;  4DEX A;  4E7J A;  2VUB A;  3QJY A;  3RUX A;  2KT1 A;  4M75 G;  2LVM A;  3EG0 A;  3CMA T;  3G1J A;  2OTJ A;  1TOV A;  2V1Q A;  2HCK A;  5FU6 B;  2AK5 A;  2FZG B;  1VQK A;  1QVG A;  1HSQ A;  3CCJ Q;  1J3T A;  3NHN A;  4PK4 A;  3EG3 A;  2JM8 A;  1XNI A;  2YLC A;  2RQV A;  1M90 R;  2E6Z A;  2X51 A;  2COZ A;  3JCM h;  4C92 B;  2NUZ A;  4M7A G;  5IH2 A;  5LJ3 d;  4M77 B;  1YIT T;  4HVU A;  1M3B A;  1NG2 A;  1Q86 U;  1T0H A;  4M78 E;  1CKA A;  4CC3 A;  2HEQ A;  4D8D A;  3G4S T;  1MGQ A;  4PJN A;  1QVP A;  1AWJ A;  4E7H A;  3C12 A;  5GMK e;  1KQS A;  3SWN C;  3I55 Q;  3C94 A;  1HYO A;  3CCR A;  4IUV A;  2XK0 A;  3OYH A;  3CD6 T;  1WFW A;  4HCK A;  4PJM A;  3EH1 A;  2EGE A;  4LE9 A;  5DM7 R;  2DER A;  3LWI A;  2M51 A;  1JJ2 A;  1G3W A;  4PFZ A;  5FU6 C;  4M7D A;  2O2O A;  5DLO A;  5KCO A;  4F7U B;  2LCL A;  1GXI E;  1KQ1 A;  2DTH A;  2OI3 A;  3OQ5 A;  2CP2 A;  3VS0 A;  3OS1 A;  2YUN A;  3INZ A;  1WI7 A;  1NYF A;  1YIJ T;  2ZCF B;  2D0N A;  1VQ7 Q;  4J6X A;  1RLQ C;  3FLG A;  4C92 C;  4Z89 A;  4ZTJ A;  2DFU A;  1YI2 A;  1ZHI A;  2COW A;  3CCV Q;  3E19 A;  4E7Z A;  4L6V 5;  1SHF A;  2V8J A;  4XU2 A;  3HKS A;  2RHI A;  4J9B A;  4XTZ A;  5AT1 B;  2DD5 A;  1WHJ A;  1N9R A;  5GAN 4;  3RKW A;  4EPC A;  1QKW A;  1TG0 A;  2FYK A;  3C0C A;  4HXJ A;  5GAN 8;  4M7D F;  3M58 A;  3QBY A;  3M54 A;  2EQU A;  2RJF A;  1I1J A;  1UE9 A;  4RTV A;  3OB9 A;  3VS2 A;  4J9D A;  1VQK T;  2MWP A;  1H92 A;  2KAF A;  2I0N A;  2LC4 A;  7AT1 B;  3BY7 A;  3CC2 A;  2H8H A;  3NFC A;  4J7F A;  2GGR A;  2JNG A;  4M75 B;  4D6W A;  3I55 A;  5KYU B;  2RHY A;  1VQ9 A;  3QII A;  2DF6 A;  4OMP A;  3JRZ A;  2EW3 A;  5D6Y A;  2IVW A;  2EFI A;  1G3Y A;  3RR6 A;  2ROL A;  1TXQ A;  4EIK A;  5GAN h;  2EKO A;  3PMI A;  1OV3 A;  4XTU A;  3X24 B;  2LX7 A;  3OW2 S;  5IT9 E;  1W2B S;  1UEB A;  4X9D A;  2SEM A;  3BDL A;  5FLX E;  1WHL A;  3CCR T;  3AHU A;  1PRM C;  2JMC A;  1VQP A;  1UB4 A;  4ANJ A;  1OQK A;  1D1A A;  3MEU A;  3JCM X;  1UTI A;  1M27 C;  3TVT A;  2BKD N;  2FVU A;  1KSW A;  2QDL A;  2FEI A;  3TEE A;  1KFZ A;  2HSE B;  1AD5 A;  5LJ5 j;  2DL4 A;  4N0A A;  5GAM f;  3CC7 A;  2FZK B;  4JJC A;  3ULR B;  2XKO C;  4KUI A;  4M75 C;  5KYY A;  2VXE A;  1U8R A;  3JB9 I;  2D0Q B;  1G83 A;  4C0G A;  4C92 E;  3JCM c;  1NEG A;  4HA8 A;  1Y7X A;  4KH1 B;  2ABL A;  2RH2 A;  1OX8 A;  4P5N A;  1IGU A;  2X4Y A;  2DPP B;  1D1C A;  2QQS A;  4IIM A;  3CC4 A;  4QT7 A;  3CCJ T;  1XOV A;  3O5Z A;  1PG5 B;  2F2V A;  3CCS A;  5GAM e;  1MHN A;  2FHD A;  2J6F A;  1VQ6 Q;  1VQN A;  2JOY A;  5GMK l;  1OYX A;  1YFN A;  2BE7 D;  1SRL A;  3UA7 A;  5GAN 5;  2YLB A;  4J9I A;  2RI3 A;  4F7U E;  2HL3 A;  5LJ3 f;  2LQW A;  3OBY A;  1K9M U;  4QQ6 A;  1BB9 A;  1YCY A;  1C1A A;  1GBQ A;  1AZE A;  1VQM Q;  2K57 A;  1WXB A;  2OX7 A;  5GAM g;  4PFP A;  3VV0 A;  1JXM A;  2CKK A;  1X2K A;  2CH4 A;  3HL8 A;  3UT1 A;  1MMA A;  3CME A;  2GFA A;  2KT8 A;  1WHH A;  2EYW A;  2DBK A;  2P0P A;  4OP0 A;  5I2M A;  3CCE A;  3CXC P;  2CUD A;  4OGC A;  1B34 B;  2KXD A;  5LJ3 e;  1VQ7 T;  2D1X A;  3SEM A;  4RG2 A;  5GJV B;  1GCQ C;  3GNF B;  4JRQ A;  2YDL A;  3PVL A;  3CCV T;  4KGV B;  1FMW A;  3M59 A;  4RCC A;  3J7A F;  1WQW A;  1DJ7 B;  4M7D C;  4XTX A;  1EIF A;  3NTH A;  3JCM d;  1YJW A;  1WGS A;  1AZG B;  1OU9 A;  5GAM h;  5FWC A;  2KSS A;  3PNW C;  2RMO A;  3TSZ A;  1VQL Q;  2QTX A;  1G2B A;  4RCB A;  5LJ3 g;  3OYF A;  4M75 E;  3A1P A;  3R6N A;  4CC4 B;  5FRM A;  2RM4 A;  2DLP A;  2YWW A;  1KG1 A;  2K5I A;  1VQ6 A;  4PL6 A;  4XU3 A;  2X4J A;  3OYL A;  4VUB A;  1QCN A;  1WA7 A;  4PJJ A;  1M5Q 1;  2DXC A;  2RK2 A;  2DVJ A;  4J9E A;  1PHT A;  1PSF A;  4M7D D;  3JB9 G;  3D7S B;  2LP5 A;  4M78 F;  4CC7 A;  4ZGJ B;  2BZY A;  3OMC A;  1YCS B;  2E1H A;  1E6H A;  3G71 A;  4A53 A;  2K5F A;  2VB6 A;  3LWH A;  4JS4 A;  2KDS A;  1YP5 A;  1ZUY A;  3E1S A;  4AFU C;  1YBY A;  4F17 A;  2HQH A;  3SB2 A;  2VC8 A;  3GNG A;  4IUU A;  4ZGE B;  2AKL A;  1GCP A;  2QAZ A;  1QQJ A;  2XIC A;  1FYN A;  3JAM E;  2P0Q A;  2DEQ A;  2EYY A;  2MWO A;  5KH6 A;  1NJI C;  2X3X D;  1K73 C;  5J39 A;  1RAF B;  2K9G A;  2KY9 A;  3M0R A;  4HVW A;  4LNP A;  1I0C A;  2R58 A;  3E2U A;  3SHW A;  1D0Y A;  2DM1 A;  1WHG A;  1WHK A;  4OMF B;  3WXM B;  4FYW B;  1K4U S;  9ATC B;  3MP8 A;  2W10 A;  1VQ8 Q;  5FRN A;  4BI8 B;  3RMS A;  2VGM A;  5CK9 A;  4MML A;  2RHZ A;  4BDY A;  2PVG B;  4E7I A;  4M7D E;  4DA4 A;  3OYC A;  5KYW A;  2JS2 A;  4N0A C;  3SWN A;  1RLP C;  3M0T A;  3CCM Q;  2VV5 A;  3S3O A;  4OMN A;  5GAN d;  3E9G A;  3OS0 A;  2DX1 A;  1VQ6 T;  1Q81 C;  2K3B A;  1NJI U;  1VYV A;  3DLL A;  2CS7 A;  2YXY A;  4KGX B;  4IUR A;  5I22 A;  4DBR A;  2DBM A;  1EX4 A;  1IZ6 A;  2DL8 A;  2RQU A;  3VYH B;  1X2Q A;  3LGF A;  4E7K A;  1VQM T;  2AIR B;  3QPH A;  4C92 A;  5CKH A;  5IXF A;  4M77 A;  4XTV A;  3QWY A;  1X6B A;  4ME7 A;  2KRN A;  1HJD A;  3TQ7 P;  1QLY A;  3N5B B;  2C0T A;  1WLP B;  1SG5 A;  2RQW A;  2G6F X;  3JCM W;  4LN2 A;  3LH5 A;  3R6O A;  2LQN A;  2DEU A;  1UJY A;  1AWO A;  1Q81 U;  3L2V A;  4KT0 E;  2KI7 A;  3M0U A;  4QKU A;  4Z88 A;  3MPU B;  3I56 A;  3GOX A;  1M8M A;  3L2U A;  3CBP A;  4F7U A;  2CH4 W;  2GQV A;  3OSS C;  4C92 F;  3EG2 A;  2XMF A;  4M77 F;  3NMZ C;  1BI2 A;  5KE3 A;  1VQL T;  4ZGD B;  5FRO A;  1R77 A;  5D7U A;  2ZAE A;  3VYG A;  3OYE A;  4Q5W A;  2RHU A;  3RNJ A;  2OTJ Q;  2K2M A;  3EFS A;  1YHQ Q;  1KQS S;  2CRE A;  2X4W A;  1VOM A;  3RER A;  3NTK A;  2J05 A;  3PVQ A;  3TRE A;  2CP5 A;  2QA4 A;  4F16 A;  2QQ9 A;  4LDY A;  3A8M B;  1A0N B;  2P4R A;  2LCC A;  1JJ2 S;  1Y57 A;  2HKN A;  1X43 A;  5GMK j;  3PTA A;  4F7U F;  1FMV A;  4MZP A;  5A0L A;  1BBZ A;  3FIF A;  4C5I A;  3L1A A;  1I4K 1;  1XTD A;  2YUO A;  2KRS A;  1ZUU A;  1I5L A;  4C5H A;  3V7R A;  3I5S A;  4Y92 A;  3AT1 B;  3LW5 E;  2CDT A;  2GQI A;  1SPK A;  5KYN A;  1Z9Z A;  2A37 A;  2PNI A;  2HL5 C;  1K9M R;  4M75 A;  4M78 D;  3OYG A;  4A4H A;  2AZS A;  3QYG B;  1S72 A;  3QWX X;  1D0Z A;  4MDX A;  3M4G A;  2LJ1 A;  2DYB A;  1LOJ A;  2EVR A;  4BE0 A;  5GAM d;  3JCM g;  2HQX A;  4E6R A;  1K9A A;  5FU7 B;  2EBP A;  2JN0 A;  3PIO A;  2A08 A;  1W2B P;  2MPX C;  4E2F B;  5J3B A;  1U1S A;  1Q7Y C;  4M7A A;  3OYD A;  2R57 A;  1NPP A;  4M4Z A;  2CGH A;  1F1B B;  4RTY A;  1BI0 A;  2NUT B;  4FYV B;  1N8R R;  3VS7 A;  1VQ8 T;  1YI2 Q;  2DRK A;  2MI6 A;  2J6K A;  1WXU A;  2V8I A;  1VQ4 A;  4N4I A;  5HY6 A;  4HCZ A;  4M75 F;  2EJ9 A;  1YHQ A;  4BB7 A;  1R8O B;  1VYT A;  4KH0 B;  4JPB W;  4BI4 A;  1YWO A;  2E70 A;  3CCM T;  3WVE B;  3MEV A;  2CP3 A;  4AFS C;  3QJ6 A;  3SFM A;  1M1K R;  2FZC B;  1HK9 A;  3VUZ A;  1Y07 A;  2HNI A;  4AG1 C;  5GAN f;  1I8F A;  2BTT A;  3NTI A;  2PU9 B;  5FU7 C;  3C4S A;  4RKU E;  4A4G A;  5I11 A;  5HK0 A;  1Q7Y U;  3CC2 Q;  5HK3 A;  1HXD A;  1E7O A;  1D1B A;  1WJS A;  2EQJ A;  4J9C A;  2VVK A;  1M1G A;  4TVR A;  1VQ9 Q;  1GCQ A;  3DKM A;  1P92 A;  2WAC A;  4PFO A;  2Z0W A;  2O31 A;  2XHC A;  4JS5 A;  3PFS A;  4JJD A;  1B07 A;  1UGR B;  2MIO A;  3JCM J;  5GAN e;  1VQP Q;  4XQ3 A;  1V29 B;  4C8Q B;  4OML A;  3A5Z B;  4IUP A;  2M1H A;  5C0M A;  4M77 C;  1ZBJ A;  2XU8 A;  1Q82 C;  4PJO B;  4BUG A;  4BAC A;  2MYS A;  4RMO A;  1RAB B;  5HCK A;  1I07 A;  2QEX Q; 
#chains in the Genus database with same CATH homology
 2DJQ A;  3I35 A;  2LQW A;  2O9S A;  1W70 A;  1JO8 A;  1BB9 A;  1NYG A;  2VKN A;  3UF4 A;  2K79 A;  1GBQ A;  4AFQ C;  1AZE A;  1WXB A;  2KYM A;  2KRM A;  5ECA A;  2RPN A;  1OPK A;  1JXM A;  2EGA A;  1X2K A;  2CH4 A;  2L0A A;  4LUE A;  1ABQ A;  2KT8 A;  1RUW A;  1AWW A;  1YWP A;  4GLM A;  2EYW A;  2DBK A;  2L3P A;  2L3Q A;  2FG0 A;  2ROT A;  3M0S A;  2C0O A;  5IHI A;  1K0S A;  2CUD A;  2KXD A;  2D1X A;  3SEM A;  5GJV B;  1GCQ C;  1U5S A;  2YDL A;  3PVL A;  1FMK A;  4GBQ A;  2RQR A;  3THK A;  2J6O A;  1QWF A;  2MCN A;  1KJW A;  2YSQ A;  1HD3 A;  2B86 A;  1N5Z A;  4ZNX A;  1QCF A;  1PKT A;  1AZG B;  2K6D A;  2HSP A;  1SHG A;  5FWC A;  1PRL C;  2RMO A;  2FPF A;  3TSZ A;  3IQL A;  1G2B A;  1WXT A;  1AEY A;  3R6N A;  4CC4 B;  2GBQ A;  1JXO A;  2BZX A;  2DLP A;  3CQT A;  2JM9 A;  2M0Y A;  1UG1 A;  1YNZ A;  1ZSG A;  3ZL7 C;  1WA7 A;  2IIM A;  2D8H A;  4A63 B;  2DVJ A;  2LNH B;  4J9E A;  4OMQ A;  1PHT A;  2KYB A;  2RF0 A;  4F14 A;  2LP5 A;  1YN8 A;  1T3S A;  4CC7 A;  2BZY A;  2GTO A;  1ZX6 A;  1YCS B;  3PE0 A;  3FJ5 A;  1UDL A;  1E6H A;  1JQQ A;  2FPD A;  1JU5 C;  4AG2 C;  1M3A A;  1YP5 A;  1E6G A;  2DIL A;  1ZUY A;  1MV3 A;  4AFU C;  4F17 A;  1AOJ A;  2AZV A;  5IXB A;  1CSK A;  1W1F A;  2AKL A;  1GCP A;  2JTE A;  2FRW A;  1EFN A;  2V1R A;  4FSS A;  4HVV A;  1FYN A;  2EGC A;  2YUQ A;  3H41 A;  2JW4 A;  2DNU A;  2EYY A;  2FPE A;  4RTU A;  1UEC A;  2X3X D;  5L23 A;  3H0F A;  1OEB A;  1X27 A;  2JT4 A;  3JV3 A;  2K9G A;  3M0R A;  1WIE A;  4HVW A;  4RTT A;  4ESR A;  1PKS A;  4LNP A;  4CC2 A;  1I0C A;  5FW9 A;  3SHW A;  2DM1 A;  1K4U S;  1X69 A;  3I9Q A;  2W10 A;  2J06 A;  1NEB A;  1SEM A;  3KFV A;  2ESW A;  1H3H A;  2YUP A;  2EPD A;  2DL5 A;  1AVZ C;  1Z9Q A;  2E5K A;  2L2P A;  1WDX A;  5EC7 A;  1TUD A;  3UA6 A;  2ENM A;  1GL5 A;  1MUZ A;  1RI9 A;  2EKH A;  4OMM A;  3U23 A;  4D8K A;  2JS2 A;  1RLP C;  5GJW B;  3M0T A;  1WX6 A;  1SSH A;  1LCK A;  4OMN A;  2DRM A;  4RUG A;  2DX1 A;  2DMO A;  2K3B A;  1KIK A;  1VYV A;  2YT6 A;  1UUE A;  2HBW A;  2ED0 A;  5I22 A;  4AFZ C;  2DBM A;  2F2X A;  2DL8 A;  2RQU A;  4JZ4 A;  2RNA A;  1X2Q A;  2GNC A;  4DEX A;  2OAW A;  2KT1 A;  1Y0M A;  5IXF A;  3QWY A;  3EHR A;  3EG0 A;  1X6B A;  3M0P A;  2KRN A;  1HJD A;  1JEG A;  4WCI A;  1QLY A;  2V1Q A;  2HCK A;  2C0T A;  1WLP B;  2AK5 A;  2RQW A;  2G6F X;  1OOT A;  4K11 A;  4LN2 A;  1T0J A;  3LH5 A;  2CT4 A;  2LQN A;  1HSQ A;  1J3T A;  1UJY A;  3NHN A;  1X6G A;  1NLO C;  2KGT A;  1AWO A;  3EG3 A;  2JM8 A;  2RQV A;  3A98 A;  1AWX A;  1K1Z A;  2VWF A;  2KXC A;  2NUZ A;  5IH2 A;  2LJ0 A;  3M0U A;  4HVU A;  2FO0 A;  4Z88 A;  1M3B A;  1NG2 A;  1M8M A;  1NM7 A;  1QWE A;  1VA7 A;  4J9F A;  5IHN A;  2CH4 W;  1T0H A;  2F2W A;  1CKA A;  4CC3 A;  2HEQ A;  4IIO A;  4D8D A;  3VS3 A;  1CKB A;  1GRI A;  3EG2 A;  1AWJ A;  2XMF A;  3NMZ C;  2L3S A;  4OMO A;  2W0Z A;  2CUB A;  1WFW A;  4HCK A;  2EGE A;  4J9H A;  4LE9 A;  2ECZ A;  3RNJ A;  2K2M A;  2M51 A;  4JZ3 A;  2CSQ A;  2O2O A;  2AKK A;  2CRE A;  4DEY A;  2NWM A;  2J05 A;  2OI3 A;  3NGP A;  2GTJ A;  3PVQ A;  4KRT A;  1U3O A;  2JXB A;  4F16 A;  3VS0 A;  2LMJ A;  5FWB A;  4R0K A;  1BU1 A;  2A28 A;  2YUN A;  1WI7 A;  1NYF A;  1A0N B;  2P4R A;  2J7I A;  1VYU A;  2D0N A;  1Y57 A;  1W6X A;  1X43 A;  1M3C A;  1RLQ C;  4X1V A;  4Z89 A;  1GFD A;  2RQT A;  1BBZ A;  1H8K A;  2O9V A;  2HDA A;  1SHF A;  1M30 A;  2YUO A;  3VRZ A;  2KRS A;  1ZUU A;  1MV0 B;  1ZUK A;  3I5S A;  4Y92 A;  4J9G A;  4Z8A A;  2CDT A;  2GQI A;  4J9B A;  1S1N A;  1UJ0 A;  1SPK A;  1Z9Z A;  2A37 A;  2PNI A;  2A36 A;  2AZS A;  1B3Q A;  1QKW A;  1TG0 A;  3C0C A;  4RTW A;  4HXJ A;  4RTX A;  2RN8 A;  3QWX X;  1K0X A;  3VS1 A;  2PZ1 A;  2KEA A;  2LJ1 A;  1QKX A;  2EQI A;  2DYB A;  2EVR A;  2JS0 A;  2LJ3 A;  1I1J A;  4JJB A;  1UE9 A;  3I5R A;  4RTV A;  2JMA A;  2LZ6 B;  3VS2 A;  5IHK A;  3H0I A;  4J9D A;  3UAT A;  1K9A A;  4E6R A;  2EBP A;  1H92 A;  2A08 A;  2DE0 X;  2I0N A;  2D8J A;  2C0I A;  2H8H A;  2KNB B;  2LCS A;  2GGR A;  4M4Z A;  3VRY A;  4RTY A;  4ORZ A;  1WYX A;  3M0Q A;  3VS7 A;  2DF6 A;  2DRK A;  4OMP A;  2J6K A;  2DL7 A;  2EW3 A;  1WXU A;  2X3W D;  2ROL A;  4EIK A;  1OPL A;  1T3L A;  1PWT A;  1UFF A;  1OV3 A;  1UHC A;  2LX7 A;  2SRC A;  3NPF A;  3RBB B;  3TSW A;  1PNJ A;  1U06 A;  1VYT A;  2DL3 A;  2SEM A;  4JPB W;  3REA B;  1YWO A;  1PRM C;  2JMC A;  2KE9 A;  2KRO A;  4AFS C;  2KBT A;  1GBR A;  3EHQ A;  1UTI A;  1M27 C;  3EGU A;  3TVT A;  1KSW A;  4AG1 C;  2QDL A;  3VS5 A;  2FEI A;  1IO6 A;  2BTT A;  1KFZ A;  5I11 A;  1ABO A;  1AD5 A;  1UGV A;  2DL4 A;  2O88 A;  2CT3 A;  2OJ2 A;  1E7O A;  4JJC A;  3ULR B;  2ED1 A;  4J9C A;  2BZ8 A;  2VVK A;  4RTZ A;  1K76 A;  3H0H A;  2EYZ A;  1GCQ A;  2MOX A;  1G83 A;  1NLP C;  1TUC A;  4LUD A;  1ZLM A;  2O31 A;  1NEG A;  1BK2 A;  2ABL A;  3REB B;  3EG1 A;  4JJD A;  2CSI A;  1B07 A;  2MIO A;  4IIM A;  4QT7 A;  2DA9 A;  1SRM A;  1XOV A;  3O5Z A;  2F2V A;  3GBQ A;  2EYX A;  1UHF A;  2FRY A;  2J6F A;  2K7A A;  4OML A;  2KR3 A;  3VS6 A;  3VS4 A;  1ZBJ A;  1GFC A;  1SRL A;  1ARK A;  3UA7 A;  4J9I A;  5HCK A;  2PTK A;  1I07 A;  1V1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...