1G2BA

Alpha-spectrin src homology 3 domain, circular permutant, cut at n47-d48
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
MDRQGFVPAAYVKKLDSGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structure of a mutant of the spectrin SH3 domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal binding protein
molecule keywords SPECTRIN ALPHA CHAIN
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2000-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1g2bA00
1W70A 1BBZA 2PNIA 4EIKA 2JM9A 2EPDA 2KEAA 2DX1A 4CC7A 2LMJA 1ABQA 2XMFA 2KE9A 1M3BA 2A28A 1FMKA 2J6OA 1W6XA 2DBMA 1ZX6A 2DLPA 1RUWA 1QKWA 2JTEA 2L0AA 2MCNA 2DYBA 1E6GA 3VRZA 3EG3A 4QT7A 2PZ1A 1PHTA 1ZUUA 2KR3A 2B86A 2RNAA 1ARKA 1T0JA 1U3OA 3UA6A 1VYUA 2CSIA 1HD3A 2CT3A 2YUPA 4GBQA 3QWYA 5IHIA 2K79A 1T3LA 2LNHB 2GNCA 1JU5C 3M0UA 4HVWA 3H0IA 1SSHA 2EQIA 2AKKA 3REBB 2JS2A 1UGVA 2C0TA 2AZVA 3TVTA 2K7AA 4A63B 1BB9A 2J6FA 1VA7A 2RQRA 1KJWA 3TSWA 2LP5A 1M30A 2L2PA 1A0NB 2LJ3A 2O2OA 3VS6A 3UA7A 2LJ1A 2DMOA 1UJ0A 4J9EA 4RTWA 4DEYA 2FRWA 5HCKA 1GBRA 1YCSB 3I35A 4Z88A 1K0SA 1ABOA 4CC3A 4AG1C 4RTYA 3SHWA 3KFVA 1SPKA 1K4US 1JO8A 4HVVA 1QLYA 1WXUA 2E5KA 2EKHA 1WDXA 2OAWA 1AWOA 3U23A 2HSPA 4D8KA 1RLQC 3JV3A 2CUBA 1U06A 3UATA 3I5SA 2JXBA 2CDTA 1N5ZA 3IQLA 5L23A 2CREA 3VRYA 1ZUYA 3VS7A 2DRKA 4J9DA 2FO0A 1PKSA 2KRNA 4LNPA 2KROA 1CKAA 4WCIA 1SHGA 3M0QA 3I9QA 4IIOA 4J9CA 3NGPA 4OMNA 1TUDA 2ESWA 4E6RA 2L3SA 4JZ3A 2FRYA 1AOJA 1UG1A 1WXTA 2JW4A 1M3CA 2H8HA 2RN8A 2V1RA 1CKBA 1JXOA 2A36A 2K3BA 2YT6A 1QKXA 2I0NA 2PTKA 5IXBA 1MV0B 2RQVA 1I07A 1ZSGA 3O5ZA 2FPFA 1BK2A 1MV3A 3VS4A 2VWFA 1E6HA 2AZSA 1PRLC 2DL3A 3EGUA 1SRMA 2J06A 2NUZA 2DE0X 4J9IA 1OEBA 1WXBA 2AKLA 1JEGA 5ECAA 2MOXA 4JPBW 2CT4A 3FJ5A 3I5RA 2L3PA 1WX6A 4OMPA 2QDLA 2W0ZA 4J9FA 4HVUA 1JQQA 1PWTA 2VKNA 3C0CA 2O9SA 2DF6A 2C0IA 3NHNA 3VS0A 1K0XA 2IIMA 2KT1A 4J9HA 1X69A 2O9VA 2EW3A 4X1VA 2D8HA 4ORZA 2D8JA 5I11A 3SEMA 2YDLA 5IH2A 2O88A 3UF4A 1UUEA 2EYYA 1AEYA 3EG2A 1AWJA 1M8MA 1M3AA 1WI7A 2LCSA 1I1JA 3PVQA 2C0OA 2MIOA 1V1CA 3EHQA 1U5SA 2EGEA 4J9BA 3VS5A 2KXCA 1ZBJA 1B3QA 2KNBB 2F2XA 2YUOA 3EG0A 4JJDA 1T3SA 1OV3A 2M0YA 1JXMA 4RTUA 5IHKA 1KFZA 1OOTA 2JMAA 1B07A 2EVRA 1QWFA 2KYMA 5FW9A 2EGAA 1K76A 1H92A 1NLPC 2OJ2A 2LZ6B 5GJWB 4JZ4A 2EYWA 2ENMA 4LN2A 5GJVB 1UFFA 2J7IA 2DNUA 2K9GA 1Z9QA 3ULRB 2CH4W 1S1NA 1UECA 3M0TA 2YSQA 3A98A 1GCQC 4AFSC 4CC2A 4OMOA 4J9GA 1FYNA 1M27C 1SRLA 4OMMA 4AFQC 3H0FA 2P4RA 1WYXA 1GRIA 2GTJA 2DL4A 2J6KA 3RBBB 3M0PA 1HJDA 1PRMC 2LQNA 4Z8AA 1MUZA 4RTVA 5FWBA 3REAB 2EBPA 2EGCA 2LQWA 2RQWA 1E7OA 1NM7A 2K6DA 2VVKA 1ZUKA 3QWXX 2KGTA 4HCKA 4JJCA 2F2WA 4LUEA 2D1XA 1ZLMA 3H0HA 2ECZA 3THKA 3TSZA 2FPEA 2DL7A 3PE0A 1K1ZA 2GQIA 1WIEA 2ED1A 2JS0A 4IIMA 1RI9A 2BZYA 4LUDA 2KRSA 1QWEA 2CH4A 2YUQA 4HXJA 5FWCA 3H41A 1X27A 4RTXA 3NMZC 2V1QA 2DBKA 2ROTA 4F14A 1GCPA 2HEQA 3RNJA 4GLMA 1K9AA 5I22A 1X6GA 1QCFA 2JMCA 1H3HA 2GBQA 4JJBA 2CUDA 2DJQA 2KYBA 1YP5A 2F2VA 2RMOA 1Y0MA 1NEBA 2K2MA 4FSSA 4RTTA 2DA9A 3M0RA 2HBWA 1GBQA 1X6BA 2G6FX 3PVLA 2NWMA 4RTZA 2BZXA 1UJYA 3EHRA 1G2BA 4OMQA 5EC7A 3EG1A 2RPNA 3VS3A 3R6NA 2RQUA 2EYXA 4LE9A 3M0SA 1YWPA 1X2KA 1CSKA 1AD5A 2A08A 2J05A 2GGRA 2CSQA 4D8DA 1NYGA 1WLPB 2O31A 1RLPC 2JM8A 2ED0A 2JT4A 4Y92A 1AVZC 3VS2A 4K11A 2RF0A 2X3WD 2HCKA 2A37A 1PKTA 1X2QA 4AFUC 1VYVA 1T0HA 5IHNA 3ZL7C 1UHCA 1WFWA 1G83A 1W1FA 1VYTA 1UDLA 1BU1A 1EFNA 2SEMA 2FEIA 2X3XD 1KSWA 2YUNA 1I0CA 1TG0A 3VS1A 1AWXA 1SHFA 1UTIA 1H8KA 4RUGA 4F16A 3LH5A 1KIKA 4AG2C 2OI3A 1J3TA 4Z89A 1TUCA 4M4ZA 1NYFA 1AWWA 1GCQA 2HDAA 4KRTA 1UHFA 2M51A 2BTTA 2GTOA 4F17A 2RQTA 2KXDA 2ROLA 4AFZC 2L3QA 4DEXA 1NG2A 1AZEA 1OPLA 2W10A 1PNJA 2FG0A 3GBQA 1YWOA 3CQTA 1Z9ZA 1WA7A 1YN8A 1HSQA 2KT8A 1IO6A 1LCKA 2DVJA 2SRCA 1GFDA 3NPFA 1YNZA 2D0NA 1XOVA 2KBTA 2DM1A 2BZ8A 4R0KA 4ZNXA 1UE9A 1Y57A 2ABLA 2KRMA 2FPDA 2LX7A 1GFCA 2AK5A 4OMLA 2DL5A 1SEMA 2DL8A 4CC4B 4ESRA 2DILA 1AZGB 1OPKA 1GL5A 2LJ0A 1NLOC 1X43A 1NEGA 2DRMA 2EYZA 5IXFA
chains in the Genus database with same CATH superfamily
4BACA 2JM9A 2KEAA 1ABQA 1M3BA 1FMKA 4LD6A 1WHHA 2BUDA 3DLMA 2GCXA 1VQ9T 2JTMA 2LC4A 1BI1A 3KXTA 2QTVA 4PJOC 4DOWA 2X4WA 4PJOB 1KQSS 2A3LA 1PHTA 2I2LA 4MDXA 2G3RA 3OYHA 9ATCB 2DERA 1U3OA 8ATCB 5LJ5h 4BI4A 5GAN4 1VYUA 2CSIA 2H3EB 1I5LA 1IXDA 2YUPA 2YRVA 4MZPA 4J6YA 1T3LA 3CBOA 4C0FA 1JB0E 5L8RE 1JU5C 1M90C 4MZMA 3M0UA 3QJ6A 1ZA1B 2AKKA 3CC2T 3REBB 1UGVA 1OZ2A 3M59A 4M77G 4C0GA 1LNXA 1KD1U 1MNDA 3L2RA 4A63B 3JB9D 2E6NA 1VA7A 2DTHA 1JJ2S 1MMAA 2RQRA 2HL3A 1F1BB 2L2PA 4D6WA 2VGMA 2LJ3A 1PD0A 1D0ZA 3VS6A 5LL6S 4HCCA 3CCSQ 2AIRB 4WF2A 4M75F 3D7SB 1WQWA 5GAOq 4RTWA 3CCUA 3BDUA 2NUPA 3I35A 1ABOA 3X26B 4XTVA 1TWBA 3SHWA 2FVUA 1BCMA 1WJRA 2ZPFB 3KFVA 2M9UA 2HKQB 1K4US 1R8OB 1QQJA 5GMKm 3V7SA 2BIVA 2DZCA 4PFZA 1O9SA 3G1JA 2HSPA 4XTZA 4E7ZA 3EFSA 1WHGA 4L5GA 5FROA 3PMIA 4BI8B 4JRKA 1N5ZA 1N8RR 2CREA 3VS7A 3X25B 2DRKA 3HFOA 1K9MR 2O01E 2DXCA 1KC8U 1KQSA 4LNPA 2KROA 2RI5A 1Q82C 2KMTA 1WJQA 4C8QE 3NGPA 4PLLA 1TS9A 3LGLA 4E6RA 2FRYA 1UG1A 2DEQA 2E3HA 3OY9A 3I55T 3ME9A 2RN8A 3C12A 3E1SA 2V1RA 2A36A 2QA4T 2EWNA 3QJYA 1QKXA 3BFMA 4M78E 1MV0B 1ZSGA 3O5ZA 3VUBA 1MV3A 3OYYA 3QO3A 1M1FA 2F69A 2VYTA 5GAOr 4FYYB 2BE7D 2X51A 2AZSA 5KYYA 2M16A 4R55A 1SRMA 4C92A 1D1AA 1OEBA 1W4SA 5J3BA 5ECAA 2LCCA 3FJ5A 3I5RA 5FU7B 4ANJA 1M2OA 2CZ0B 2QDLA 2QG9B 2W0ZA 4J9FA 1JQQA 2NLUA 5GAOm 1PWTA 5GAOn 4BD3A 3G6ET 3VYGA 3MEUA 4XU2A 2O9VA 2EW3A 3GOXA 2K4YA 3J7AF 2KVQG 3VU3C 4A54A 3QHSA 4CI0C 4Y91A 5C0MA 1AEYA 1AWJA 1WI7A 2DFUA 1HK9A 2MIOA 1V1CA 2EJ9A 1IREB 2KXCA 2E12A 2F2XA 1U1TA 3EG0A 4JJDA 4PJOF 2M0YA 4RTUA 3JB9H 1LPLA 3HRUA 1Y7XA 2JMAA 1WNLA 2XHCA 2RHIA 1BI3A 1K76A 2QGFB 1H92A 1M1GA 4M7AF 3SDZA 4JZ4A 2EYWA 3G6EA 2ENMA 4LN2A 3TCJA 4TVRA 4EMKA 3OYJA 3ULRB 2MAMA 4CC2A 1QMCA 4OMOA 4ZN3A 1OQKA 1QVFP 1M1KU 1WYXA 1GRIA 3G7ZA 4CRIA 2GTJA 4PJNA 5GAOl 5LJ3g 2DPPB 3GPLA 2QA4Q 3VUZA 2J6KA 3RBBB 3OYBA 2RJDA 2V26A 2DIQA 1PRMC 1FX7A 4KULA 3FB9A 4C5GA 1VQMT 1HXDA 2XD0A 1D3BA 3CCST 4E7IA 2LQWA 1I8FA 4DBRA 2QEXA 2VVKA 4M7DA 2KGTA 1VQNQ 1RI0A 3EGXA 3L1AA 4LUEA 2D1XA 2EQMA 4BB7A 3G71A 3H0HA 2RJFA 3PE0A 1WHLA 2WSCE 2GQIA 1WIEA 2ED1A 5GAMd 4E7JA 2EFIA 2XI9A 1VQKQ 4LUDA 2CH4A 2R5AA 3H41A 5J26A 2V1QA 3EGDA 4BDZA 4QVZA 5DY9A 3GNFB 2MMPA 5CKDA 2VASA 2ZPHB 4QKUA 2JMCA 2VGNA 2GBQA 4M75B 2KYBA 4WTOB 3CCSA 2F2VA 3UPUA 3X24B 4C8QB 1Y0MA 1K73U 1N8RC 4RTTA 4DBFA 1ZA2B 2HBWA 1GBQA 3CXCS 4P5NA 1VQ9Q 4JLIA 2FYKA 3EHRA 4DBHA 3RERA 4OMQA 1YIJA 1D1CA 3FC3A 1N27A 2HD0A 4XK8E 2RQUA 3C94A 4LE9A 2HQEA 3CCUQ 1NE8A 3KUFA 1D09B 2CSQA 4D8DA 3WVEB 1Q81U 5LJ3d 4Y92A 1AVZC 1FWZA 4K11A 3CXCA 1PKTA 4J7FA 5A2QE 4OB2B 1RAGB 1WFWA 3CCMQ 1W1FA 1VYTA 2X3XD 1UEBA 3PTAA 1AWXA 1SHFA 1UTIA 2FZGB 4HCZA 4RUGA 5GAMe 3G6EQ 2GFUA 3G4SQ 2OI3A 1J3TA 4OB0B 2DZ9A 1BYMA 4M4ZA 1GCQA 2HDAA 4C5HA 1Q86C 4N4GA 2GTOA 5IN1A 4ZTFA 4IUPA 1SF9A 3NTIA 2ROLA 1NG2A 1AZEA 4A4HA 2W10A 4YTLA 4EMHA 3CBPA 3R6OA 1HSQA 3A8HB 1KK7A 1K73C 4RMOA 1GFDA 2EKOA 1K8AR 1ACMB 2KBTA 3X28B 1Y57A 3RMSA 4IUTA 2FPDA 5GAMh 2WSFE 3ASKA 5GANg 3E2UA 2DILA 2LCLA 3VKIA 2L8DA 4BDYA 4EMKC 2BKDN 1X43A 3X20B 5CO7A 5GAN6 4N4IA 4M78F 5LJ3e 1ZQ1A 2KQWA 5CQYA 1NJIU 3OSVA 2EQKA 1W6XA 3SWNC 1ZX6A 5HK0A 2LQKA 5GAOp 4B6MA 3BDLA 1VIFA 4RG2A 2L0AA 2MCNA 4AT1B 2DYBA 1NPPA 1E6GA 4QT7A 2JOYA 1PCXA 1HYOA 2PVGB 2JZ2A 2X4XA 2YLCA 3JCMX 1ZUUA 3UWNA 4BI3A 5D6YA 2OTLT 2B86A 1VQMQ 3UA6A 2E70A 1Q95G 4XU0A 3OB9A 5KE2A 4GBQA 3JCMb 4RCBA 1M4ZA 4HVWA 2DTOA 1SSHA 3CC4Q 2X35A 2XDPA 2EAYA 2RJEA 3JRZA 1B7TA 3TVTA 4J6XA 1BB9A 2J6FA 3CPFA 3UA7A 4XQ3A 4JS4A 2DMOA 5KYYB 4PJOE 3CPWS 2FRWA 1VQ5T 3QSUA 2DTIA 4X9CA 3E9FA 4CC3A 3CC2Q 2QQBA 4MZTA 3G71T 4RTYA 5FU7C 5CCAA 1SPKA 4C8QD 1WQ7A 2A0FB 3M54A 8AT1B 1WXUA 4PFOA 4M7DG 2E5KA 3HFNA 3J81E 3UATA 3WXMB 3EH1A 4OF1A 1IHVA 3CCMA 3P8BB 2K2VA 2FO0A 1AHJB 2KRNA 4RCCA 5EG2A 3CCQT 4F04B 3CCLA 4WCIA 1SHGA 4XU1A 2GFAA 1JBMA 2RJCA 3AHUA 4IIOA 3HRTA 3H8ZA 4J9CA 1VQOT 3M58A 4OMNA 3EFOB 3URGA 3PGGA 1YJWT 4VUBA 1M3CA 3VJPA 5CAIA 2FZKB 2YLBA 4C8QF 4JRQA 3CCRA 1CKBA 2E3IA 5KYWB 2PTKA 3HP9A 1YIJQ 2D9TA 1LJOA 1NJIR 1BCOA 3C95A 3MP6A 4NL2A 1VQPT 2VUBA 1VQ9A 4KUDK 3I55Q 4JUVA 2RA2A 4RKUE 2ZPEB 1JJ2A 4FIBA 4O6JA 4AMCA 3UT1A 3CC2A 2DD4A 1I81A 1UGRB 2DE0X 1WHKA 1W2BS 4M7DB 4OP0A 3A8MB 4J9IA 2MOXA 4JPBW 4X9DA 2LT4A 1K8AU 2MYSA 2K5IA 3EGXB 2LQ8A 1MMGA 4HVUA 2COZA 4Y28E 5DLOA 1BIAA 2VKNA 3C0CA 2RD1A 2C0IA 1RAIB 3MPUB 2DXUA 4J9HA 7AT1B 4M78C 5I11A 5KH6A 3SEMA 1B34A 2YDLA 4IUVA 3RIRA 2O88A 2EYYA 2XU8A 1I1JA 4NOYA 2EGEA 3V7CA 3VS5A 1IHWA 1OYXA 2EQJA 4DBQA 4M77B 3PNWC 1T3SA 1VQ4T 3QDRB 2VC8A 5CQXA 1KQ1A 2MWOA 2MPXC 5D7UA 1KFZA 1X75C 4LDWA 1QWFA 5FW9A 2EGAA 2XK0A 4PL6A 2IPOB 4M77E 2QQAA 2ZPBB 2OJ2A 2LZ6B 4KH1B 2R57A 2LTOA 4FU6A 5GJVB 4L59A 1RAFB 5CIUA 3PFSA 3CBMA 3LH0A 4J8OA 1Z9QA 5IT9E 3L2UA 1IRXA 3A98A 1Y07A 2FHDA 4J9GA 1FYNA 1M27C 3EG9B 4AFQC 4R56A 3JB9J 4MMLA 2HL5C 5M9OA 2DXBA 4C8QG 1XTDA 1KQSP 1YCYA 2DL4A 3JB9G 1VQLA 2LQNA 5FWBA 3REAB 1W2BA 4ELYC 3CMAT 2EGCA 1E7OA 2K6DA 1KHCA 2LDMA 2P84A 3JB9I 3I56A 1ZUKA 1G3WA 2F2WA 4KBMB 1M90R 4BE2A 3TQ7P 4B9WA 2CP5A 2KRSA 3TEEA 5FWCA 1GXIE 1QCNA 4LDVA 5CVIA 4A53A 3FEOA 3M4GA 1S72T 2C06A 3EFOA 1VQOA 2HEQA 3RNJA 3V7RA 5I22A 3OS0A 1X6GA 4EMGA 2NUTA 2QEXT 3BW1A 4DOVA 4JJBA 3CCQA 2CUDA 1IB8A 1YP5A 2OTJA 2RMOA 4E7SA 5LJ3h 3EG9A 4N0AA 2DA9A 2DKGA 4M77C 4PJOA 1X6BA 2DEUA 2CZ6B 2QDYB 2BZXA 3HKSA 2QTXA 1QVGS 1G2BA 3KBGA 3EG1A 3CMAA 4C92G 3V8JA 3R6NA 2E41A 4ZGDB 2K3XA 1VQLT 4A4FA 1YWPA 4M7AA 1M2VB 1X2KA 3SFMA 1FXXA 5KYXB 1RLPC 1Q86R 2PVOB 1W2BP 2E64A 3ZBDA 2QGGA 2ATCB 1UGPB 3P8DA 4O5VA 4AFUC 4GY5A 1VYVA 1VQ4A 4BE1A 2HNIA 3ZL7C 2QXFA 1UHCA 2Y90A 2DAQA 1UDLA 1BU1A 3QYGB 3L2VA 5GMKj 2CZ1B 2YUNA 1I0CA 1YJ9Q 1TG0A 5AT1B 3V8LA 4F16A 1KIKA 1WJSA 3LH5A 3QUIA 4Q5WA 2F5KA 2AT1B 1YJ9A 5DM7R 1AWWA 4KRTA 1UHFA 1JRIA 2M51A 2RQTA 3CD6A 1WZOA 6AT1B 2JN0A 4M7AC 1RL2A 2L3QA 5GAMj 3P8HA 1QVFA 3JCMQ 2CP3A 3DKMA 2L89A 4PNOA 2RB6A 2E1HA 4KUIA 3CD6Q 2FG0A 1UB4A 4IUQA 4FYVB 3N5BB 1YN8A 5GMKh 3LX7A 2KT8A 4QQ6A 4EPCA 3WVDB 1KQ2A 1VQNA 4C0DB 1YNZA 2QEXQ 1BI2A 4E7KA 4LXCA 2DM1A 3RDVA 1BKBA 4R0KA 4ZNXA 1UE9A 1RACB 2AK5A 2QASA 5FRMA 4OMLA 1N9SA 2PUOB 1SG5A 4ESRA 1AZGB 2RM4A 1QVFS 4EDUA 2LJ0A 4M7AD 1NLOC 3MP8A 2EYZA 1M9SA 1XQHA 5IXFA 5KYUB 1W70A 1BBZA 2PNIA 1YI2Q 2OTJQ 2EPDA 2LMJA 3M56A 2XMFA 3JCMP 1C0MA 1EIFA 2A28A 2J6OA 1OULA 2RHUA 5GANh 3JB9F 3VV0A 1QKWA 4FW1A 5A0LA 2KI7A 2O4XA 2PUKB 3CMAQ 2JTEA 2RK2A 3OYCA 5LJ3j 5CKHA 2IG0A 3VRZA 2XICA 3M57A 4FW2A 3RKWA 4MMKA 2JUFA 1SKUB 3JCMW 3OYKA 1TU0B 3MEVA 4XAXB 4QVCA 2JVVA 2CT3A 4J83A 3QYHB 1MMDA 2K79A 3CCVT 2GNCA 3QZ9B 3LGFA 1VQ7Q 3CD6T 3H0IA 3M4YA 3MEAA 3CCEQ 4C92E 2C0TA 5GANe 2AZVA 3RKXA 4M75C 1R0CB 3JSCA 3OYIA 1Q86U 1RAAB 2K7AA 3CXCP 2H3JA 3S3OA 1KJWA 4ATOA 1YJNQ 1IGUA 2ZAEA 4LDXA 1VQPA 2Z0WA 2PQWA 1R0BG 1YITQ 2QA4A 1ZSZA 3CCRT 1N6AA 5HCKA 1GBRA 4F7UF 5HKCA 2YHTA 3HHTB 4PFPA 5HK3A 1K0SA 4HCBA 2AHJB 4AG1C 3A8GB 3RUXA 4V2SA 2HKNA 4M77F 2M1HA 3CCJA 1JO8A 4HVVA 3OW2S 4BY6B 1M90U 1QLYA 1YITA 1QP2A 1YHQT 3M53A 2EKHA 4HT9A 2OAWA 3HL8A 3U23A 1M8VA 2YWWA 1PC0A 4D8KA 1RLQC 3BE3A 4M7DF 1OU9A 5KYNA 1U06A 4FT2A 3I5SA 1K73R 5DLQE 4EMKB 2CDTA 3IQLA 2LVMA 3VRYA 2RK1A 1YBYA 2FL7A 4J5YA 2M02A 4PJOG 3ZEHA 2K57A 1PKSA 2M0OA 1CKAA 2DJZA 2CYZB 2QYZA 3FRNA 3TREA 3M0QA 3I9QA 3OS5A 4N4HA 2RHZA 1PSFA 1VQPQ 3QDFA 3T9NA 1TSFA 2JTFA 1WXTA 1KHIA 5GANd 4M78G 1YHQQ 2YT6A 2I0NA 3CCEA 1TH7A 2RQVA 1I07A 2VXFA 2KSSA 3L2WA 2F1LA 2VB6A 2VWFA 4XTXA 4M75D 1G3YA 1OI1A 1E6HA 4FT4A 3Q1JA 1PRLC 3EGUA 1M1KR 3NTKA 3CCRQ 1WXBA 5LJ5j 2D6FA 2EYQA 2ZCFB 4II1A 4XTYA 2CT4A 2L3PA 1WX6A 1KC8C 4OMPA 5GAN8 2E4HA 1XNIA 1VUBA 1QCOA 2DF6A 4IUUA 3NHNA 3VS0A 5LJ3f 3JCMg 1K0XA 3HPWA 5CKBA 4ZGEB 2KT1A 2YRDA 4DQ2A 4FM4B 4C0ZA 4X1VA 4ORZA 2LX9A 2V8KA 2D8JA 4C92D 5C6SA 4C5EA 3UF4A 1UUEA 3VYHB 1M8MA 2WSEE 3PVQA 3EHQA 4B9XA 2CGHA 4UC4A 2MF2A 5I2SA 5KCHA 1R77A 3OQ5A 4QQGA 1PD1A 1ZBJA 4E7HA 1AT1B 5GAN2 1OV3A 3HRSA 2DD5A 1ZSZC 5CKFA 5KYUA 1VQ8T 1JXMA 1QVGP 1YJWA 1QVGA 2A7YA 1Q82U 2KYMA 3RKYA 3QKJA 3MHXA 2XDDA 2L5QA 1NLPC 3OYLA 4A4GA 4M75A 1IGQA 1K8AC 1C1AA 1UFFA 1VQKA 2J7IA 2DNUA 3C4SA 4C8QA 2DK3A 1UECA 4AFSC 1GCQC 4RG8A 1Q7YC 1SRLA 3F70A 1ZHIA 3H0FA 2COWA 2P4RA 4JLGA 4X34A 4FYWB 5HY6A 3JCMJ 4F7UG 3A8LB 1HJDA 1G3SA 4OMFB 4Z8AA 4RTVA 2EBPA 2QQ9A 3DB3A 4F7UB 4LD9K 3CCLQ 4C92C 3CCJT 4HCKA 4FYXB 2OX7A 4KGXB 1ZLMA 2O4XB 1H641 1LOJA 3TSZA 3GLXA 4BY6C 1K1ZA 2HZYA 2LNVA 3CCET 2P0PA 1FMVA 1RADB 1RI9A 1G3TA 3QG1A 3DB4A 4HXJA 5GANf 3CCJQ 3CCVQ 2EJFA 3NMZC 1D0XA 1G8XA 3CC4A 2DBKA 5I2MA 1YIJT 2ROTA 1O75A 4GLKA 1DJ7B 1K9AA 3GIBA 4M7DC 2X4JA 4M78D 1QCFA 1H3HA 4ZTJA 1D0YA 1KG1A 1UGQB 5IAYA 1U1SA 2DYIA 1NEBA 1QW1A 2XG8D 5FU6C 1NPRA 4BE0A 1MHNA 4FSSA 3RMQA 1M5Q1 3CCQQ 2G6FX 4RTZA 2Y4XA 1Q81C 2KDSA 3CMET 3A5ZB 3VS3A 2OTLA 3UDCA 1YITT 2OTJT 1YI2T 1VQLQ 3M0SA 4C92F 3NTHA 1Q7YU 3G4ST 1VQ8Q 1PM3A 4KGZB 5GAN7 2GGRA 2E10A 1NYGA 4XTWA 1YJNA 3O8VA 2JM8A 2ZZDA 2HCKA 2A37A 3L2QA 1X2QA 3EAEA 5LJ5e 1EZZB 2K3YA 2EJGA 4J6WA 5IHNA 2GQVA 3META 4F7UE 3PIPA 1EFNA 2LT1A 2RHYA 2QK0A 2FEIA 2WACA 3OS2A 4HT8A 1H8KA 2Y4YA 5CK9A 4Z89A 1TUCA 2KY9A 2PU9B 1KD1C 4F17A 2KXDA 2YXYA 3OMGA 3PMTA 2V8IA 5GANj 1Q82R 2K5LA 5FRNA 4M7DE 4KGVB 1OPLA 2DIGA 3SB2A 4A4KA 3JCMc 3OYGA 3GBQA 2E5QA 1YWOA 3CQTA 3CMEQ 2HSEB 3E9GA 3V8KA 1IO6A 4C5IA 2DVJA 2SRCA 4JRPA 4OGEA 4DA4A 2HQXA 1V29B 3NPFA 1XOVA 4M7AB 1OX9A 3JAME 2EQUA 5CKEA 2DETA 3M5AA 5GAN5 2ABLA 2KK4A 2LX7A 2XIDA 3FJPA 2OAUA 3S3MA 3H9NA 1PG5B 2LRQA 1OPKA 1RAHB 5FU6B 3M9QA 4NS5A 1NEGA 4M75G 1VQ6A 2R58A 2K5FA 4EIKA 4M78B 2DX1A 4CC7A 5GMKl 4A4EA 2KE9A 4J7IA 1VQNT 3I55A 1D1BA 2DBMA 2DLPA 3OYMA 1RUWA 3MCAB 5KE3A 3CC7A 4MDWA 2GF7A 2JNGA 2DVEA 2E6ZA 1VQ4Q 3EG3A 3G4SA 3CCLT 4M77D 4XU3A 2PZ1A 3OS1A 2KR3A 3JCMf 2RNAA 1ARKA 1T0JA 2DO3A 1V76A 4IKFA 3ER0A 1YJ9T 1TOVA 4ZGJB 1HD3A 4C92B 3LLRA 1YJWQ 3CEYA 3QWYA 1H3ZA 5IHIA 2LNHB 1QP3A 2NYSA 2EQIA 5FLXE 2JS2A 4FCYA 1TUGB 4M75E 2VXEA 3OMCA 3OYAA 3OW2A 3INZA 3TSWA 2LP5A 1M30A 1S72A 1A0NB 2O2OA 2LJ1A 3QZ5B 4QVDA 1VQ5A 1UJ0A 4J9EA 5GMKi 3M55A 4DEYA 2P4TA 1YCSB 2CP0A 2L3RA 4Z88A 3MKDA 1P92A 2VV5A 3CMEA 3CCMT 1X6OA 1MGQA 1IZ6A 2KAFA 3QPHA 3TU4K 3GNGA 2QQSA 3JCMe 1WDXA 1AWOA 4FL6A 4LDYA 3E19A 3JV3A 2CUBA 2JJ9A 1G5VA 2JXBA 3MP1A 1VQOQ 5D6XA 5L23A 1Q7YR 1PSEA 1ZUYA 4FSXA 3GF5A 4J9DA 1I4K1 3FLGA 1BI0A 3PIOA 2XKOC 2CP2A 4C0DC 1TUDA 2ESWA 4HKEA 4KH0B 2ZPIB 2RH2A 2L3SA 1D3BB 4JZ3A 4JS5A 1AOJA 3FDRA 3J80E 3OW2P 2JW4A 5I21A 4OVAA 2H8HA 3SWNA 2B8AA 1JXOA 2K3BA 2OTLQ 2IVWA 1WHMA 3L42A 5IXBA 2FZCB 2FPFA 1BK2A 2XDBA 3VS4A 3OYFA 3L2ZA 4C8QC 3GP8A 1JJ2P 4M7AG 4ME7A 2DL3A 2J06A 2NUZA 1FMWA 4M7DD 2RI2A 4JRIA 2AKLA 1NBEB 2FB7A 2ZGWA 1JEGA 4IURA 2P0KA 4F7UA 4OB1B 1VQ7A 5GMKe 3JCMd 2O9SA 2V8JA 2COYA 4QQDA 2IIMA 1NZ9A 3EFRA 1M1KC 1X69A 5GAN3 2D8HA 4PJMA 3SWNB 3ZFJA 5IH2A 2R5MA 3EG2A 1RAEB 1M3AA 2PVDB 2LCSA 3SD4A 2C0OA 1U5SA 4J9BA 5KYXA 3LWIA 3QXEB 1X01A 1B3QA 2KNBB 4PK4A 4LDUA 3JCMh 2YUOA 2MK5A 4M7AE 2EIFA 5IHKA 3FIFA 2MI6A 2MWPA 1OOTA 2RHXA 1B07A 2EVRA 4JJNK 1YJNT 1Y96A 2DXTA 1WGSA 4OGCA 2QI2A 3MEWA 3QIIA 1TXQA 2CKKA 5GJWB 5KYWA 1EX4A 1WHJA 2HBPA 2K9GA 4HA8A 3S6WA 2CH4W 2CP6A 1S1NA 1VQ7T 3LW5E 5J39A 3M0TA 4PJOD 2YSQA 1KC8R 5A0DA 3H6ZA 4OMMA 3HSBA 4PJJA 1N8RU 5AYFA 3OA6A 1VQ5Q 3M0PA 1RABB 1YI2A 5KCOA 1MUZA 1S72Q 2RQWA 3LWHA 1K9MU 1NM7A 1B34B 3QWXX 4JJCA 2ECZA 3THKA 2FPEA 2DL7A 4PKCC 2RO0A 2NUPB 3OSSC 3JCMV 2JS0A 4IIMA 2BZYA 1QWEA 2YUQA 2CS7A 4OB3B 2CZ7B 1X27A 1I5OB 4RTXA 4E7LA 5GAMf 2E65A 1Y96B 1U8RA 4E47A 3MJXA 3A8OB 2BE9B 4F14A 1GCPA 4GLMA 5A0GA 3AT1B 2HMAA 3OYEA 2DJQA 3OYDA 1WPYA 3CC7Q 2K2MA 1UGSB 5CR2A 3M0RA 3G71Q 3HTRA 3OBYA 3CPWP 3PVLA 2NWMA 1UJYA 1ZBXA 2F5TX 5EC7A 4M78A 4PJLA 3NFCA 1VQ6Q 2RPNA 3S3NA 1YHQA 2NUTB 5LJ5d 1MMNA 2EYXA 4Z02A 3CCUT 2YRCA 3I56Q 1OZ3A 1CSKA 1AD5A 2A08A 2J05A 4KT0E 1WLPB 2O31A 1YFNA 1KD1R 3MO8A 1NJIC 2ED0A 2JT4A 4M77A 3VS2A 4PLIA 2HQHA 3DLLA 3RESA 2RF0A 2X3WD 3CC4T 4QW2A 1MNEA 1T0HA 5GAMg 1Y71A 4BUGA 4E2FB 1G83A 3RR6A 1OX8A 1SSFA 2SEMA 2QQRA 1KSWA 1M2VA 3VS1A 4JDSA 4AG2C 1VIEA 3BY7A 3I56T 3QBYA 1NYFA 4XTUA 2BTTA 1VQMA 1VOMA 2RI3A 4NL3A 1VQ6T 2X4YA 1VQKT 4AFZC 3CCVA 3OBWA 4DEXA 1OU8A 2HAXA 3LYIA 2QAZA 3PT9A 3EH2A 2D0QB 1PNJA 3A1PA 1Z9ZA 2X9HA 1LVKA 3CC7T 1QVPA 1WA7A 3EGDB 1LCKA 4ELZC 3CPWA 2D0NA 2BZ8A 1ZSZB 1N9RA 2KRMA 5D6WA 1GFCA 2CP7A 2DL5A 2ZPGB 1K9MC 1SEMA 2DL8A 4N0AC 1C6VX 4CC4B 5LJ5f 3OYNA 2P0QA 1VQ8A 5LJ5g 1TTHB 1BIBA 1GL5A 4ZN1A 4L6V5 1XJWB 2DRMA 1Q81R
chains in the Genus database with same CATH topology
1W70A 1BBZA 2PNIA 4EIKA 2JM9A 2EPDA 2KEAA 2DX1A 4CC7A 2LMJA 1ABQA 2XMFA 2KE9A 1M3BA 2A28A 1FMKA 2J6OA 1W6XA 2DBMA 1ZX6A 2DLPA 1RUWA 1QKWA 2JTEA 2L0AA 2MCNA 2DYBA 1E6GA 3VRZA 3EG3A 4QT7A 2PZ1A 1PHTA 1ZUUA 2KR3A 2B86A 2RNAA 1ARKA 1T0JA 1U3OA 3UA6A 1VYUA 2CSIA 1HD3A 2CT3A 2YUPA 4GBQA 3QWYA 5IHIA 2K79A 1T3LA 2LNHB 2GNCA 1JU5C 3M0UA 4HVWA 3H0IA 1SSHA 2EQIA 2AKKA 3REBB 2JS2A 1UGVA 2C0TA 2AZVA 3TVTA 2K7AA 4A63B 1BB9A 2J6FA 1VA7A 2RQRA 1KJWA 3TSWA 2LP5A 1M30A 2L2PA 1A0NB 2LJ3A 2O2OA 3VS6A 3UA7A 2LJ1A 2DMOA 1UJ0A 4J9EA 4RTWA 4DEYA 2FRWA 5HCKA 1GBRA 1YCSB 3I35A 4Z88A 1K0SA 1ABOA 4CC3A 4AG1C 4RTYA 3SHWA 3KFVA 1SPKA 1K4US 1JO8A 4HVVA 1QLYA 1WXUA 2E5KA 2EKHA 1WDXA 2OAWA 1AWOA 3U23A 2HSPA 4D8KA 1RLQC 3JV3A 2CUBA 1U06A 3UATA 3I5SA 2JXBA 2CDTA 1N5ZA 3IQLA 5L23A 2CREA 3VRYA 1ZUYA 3VS7A 2DRKA 4J9DA 2FO0A 1PKSA 2KRNA 4LNPA 2KROA 1CKAA 4WCIA 1SHGA 3M0QA 3I9QA 4IIOA 4J9CA 3NGPA 4OMNA 1TUDA 2ESWA 4E6RA 2L3SA 4JZ3A 2FRYA 1AOJA 1UG1A 1WXTA 2JW4A 1M3CA 2H8HA 2RN8A 2V1RA 1CKBA 1JXOA 2A36A 2K3BA 2YT6A 1QKXA 2I0NA 2PTKA 5IXBA 1MV0B 2RQVA 1I07A 1ZSGA 3O5ZA 2FPFA 1BK2A 1MV3A 3VS4A 2VWFA 1E6HA 2AZSA 1PRLC 2DL3A 3EGUA 1SRMA 2J06A 2NUZA 2DE0X 4J9IA 1OEBA 1WXBA 2AKLA 1JEGA 5ECAA 2MOXA 4JPBW 2CT4A 3FJ5A 3I5RA 2L3PA 1WX6A 4OMPA 2QDLA 2W0ZA 4J9FA 4HVUA 1JQQA 1PWTA 2VKNA 3C0CA 2O9SA 2DF6A 2C0IA 3NHNA 3VS0A 1K0XA 2IIMA 2KT1A 4J9HA 1X69A 2O9VA 2EW3A 4X1VA 2D8HA 4ORZA 2D8JA 5I11A 3SEMA 2YDLA 5IH2A 2O88A 3UF4A 1UUEA 2EYYA 1AEYA 3EG2A 1AWJA 1M8MA 1M3AA 1WI7A 2LCSA 1I1JA 3PVQA 2C0OA 2MIOA 1V1CA 3EHQA 1U5SA 2EGEA 4J9BA 3VS5A 2KXCA 1ZBJA 1B3QA 2KNBB 2F2XA 2YUOA 3EG0A 4JJDA 1T3SA 1OV3A 2M0YA 1JXMA 4RTUA 5IHKA 1KFZA 1OOTA 2JMAA 1B07A 2EVRA 1QWFA 2KYMA 5FW9A 2EGAA 1K76A 1H92A 1NLPC 2OJ2A 2LZ6B 5GJWB 4JZ4A 2EYWA 2ENMA 4LN2A 5GJVB 1UFFA 2J7IA 2DNUA 2K9GA 1Z9QA 3ULRB 2CH4W 1S1NA 1UECA 3M0TA 2YSQA 3A98A 1GCQC 4AFSC 4CC2A 4OMOA 4J9GA 1FYNA 1M27C 1SRLA 4OMMA 4AFQC 3H0FA 2P4RA 1WYXA 1GRIA 2GTJA 2DL4A 2J6KA 3RBBB 3M0PA 1HJDA 1PRMC 2LQNA 4Z8AA 1MUZA 4RTVA 5FWBA 3REAB 2EBPA 2EGCA 2LQWA 2RQWA 1E7OA 1NM7A 2K6DA 2VVKA 1ZUKA 3QWXX 2KGTA 4HCKA 4JJCA 2F2WA 4LUEA 2D1XA 1ZLMA 3H0HA 2ECZA 3THKA 3TSZA 2FPEA 2DL7A 3PE0A 1K1ZA 2GQIA 1WIEA 2ED1A 2JS0A 4IIMA 1RI9A 2BZYA 4LUDA 2KRSA 1QWEA 2CH4A 2YUQA 4HXJA 5FWCA 3H41A 1X27A 4RTXA 3NMZC 2V1QA 2DBKA 2ROTA 4F14A 1GCPA 2HEQA 3RNJA 4GLMA 1K9AA 5I22A 1X6GA 1QCFA 2JMCA 1H3HA 2GBQA 4JJBA 2CUDA 2DJQA 2KYBA 1YP5A 2F2VA 2RMOA 1Y0MA 1NEBA 2K2MA 4FSSA 4RTTA 2DA9A 3M0RA 2HBWA 1GBQA 1X6BA 2G6FX 3PVLA 2NWMA 4RTZA 2BZXA 1UJYA 3EHRA 1G2BA 4OMQA 5EC7A 3EG1A 2RPNA 3VS3A 3R6NA 2RQUA 2EYXA 4LE9A 3M0SA 1YWPA 1X2KA 1CSKA 1AD5A 2A08A 2J05A 2GGRA 2CSQA 4D8DA 1NYGA 1WLPB 2O31A 1RLPC 2JM8A 2ED0A 2JT4A 4Y92A 1AVZC 3VS2A 4K11A 2RF0A 2X3WD 2HCKA 2A37A 1PKTA 1X2QA 4AFUC 1VYVA 1T0HA 5IHNA 3ZL7C 1UHCA 1WFWA 1G83A 1W1FA 1VYTA 1UDLA 1BU1A 1EFNA 2SEMA 2FEIA 2X3XD 1KSWA 2YUNA 1I0CA 1TG0A 3VS1A 1AWXA 1SHFA 1UTIA 1H8KA 4RUGA 4F16A 3LH5A 1KIKA 4AG2C 2OI3A 1J3TA 4Z89A 1TUCA 4M4ZA 1NYFA 1AWWA 1GCQA 2HDAA 4KRTA 1UHFA 2M51A 2BTTA 2GTOA 4F17A 2RQTA 2KXDA 2ROLA 4AFZC 2L3QA 4DEXA 1NG2A 1AZEA 1OPLA 2W10A 1PNJA 2FG0A 3GBQA 1YWOA 3CQTA 1Z9ZA 1WA7A 1YN8A 1HSQA 2KT8A 1IO6A 1LCKA 2DVJA 2SRCA 1GFDA 3NPFA 1YNZA 2D0NA 1XOVA 2KBTA 2DM1A 2BZ8A 4R0KA 4ZNXA 1UE9A 1Y57A 2ABLA 2KRMA 2FPDA 2LX7A 1GFCA 2AK5A 4OMLA 2DL5A 1SEMA 2DL8A 4CC4B 4ESRA 2DILA 1AZGB 1OPKA 1GL5A 2LJ0A 1NLOC 1X43A 1NEGA 2DRMA 2EYZA 5IXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W70 A;  1BBZ A;  2PNI A;  4EIK A;  2JM9 A;  2EPD A;  2KEA A;  2DX1 A;  4CC7 A;  2LMJ A;  1ABQ A;  2XMF A;  2KE9 A;  1M3B A;  2A28 A;  1FMK A;  2J6O A;  1W6X A;  2DBM A;  1ZX6 A;  2DLP A;  1RUW A;  1QKW A;  2JTE A;  2L0A A;  2MCN A;  2DYB A;  1E6G A;  3VRZ A;  3EG3 A;  4QT7 A;  2PZ1 A;  1PHT A;  1ZUU A;  2KR3 A;  2B86 A;  2RNA A;  1ARK A;  1T0J A;  1U3O A;  3UA6 A;  1VYU A;  2CSI A;  1HD3 A;  2CT3 A;  2YUP A;  4GBQ A;  3QWY A;  5IHI A;  2K79 A;  1T3L A;  2LNH B;  2GNC A;  1JU5 C;  3M0U A;  4HVW A;  3H0I A;  1SSH A;  2EQI A;  2AKK A;  3REB B;  2JS2 A;  1UGV A;  2C0T A;  2AZV A;  3TVT A;  2K7A A;  4A63 B;  1BB9 A;  2J6F A;  1VA7 A;  2RQR A;  1KJW A;  3TSW A;  2LP5 A;  1M30 A;  2L2P A;  1A0N B;  2LJ3 A;  2O2O A;  3VS6 A;  3UA7 A;  2LJ1 A;  2DMO A;  1UJ0 A;  4J9E A;  4RTW A;  4DEY A;  2FRW A;  5HCK A;  1GBR A;  1YCS B;  3I35 A;  4Z88 A;  1K0S A;  1ABO A;  4CC3 A;  4AG1 C;  4RTY A;  3SHW A;  3KFV A;  1SPK A;  1K4U S;  1JO8 A;  4HVV A;  1QLY A;  1WXU A;  2E5K A;  2EKH A;  1WDX A;  2OAW A;  1AWO A;  3U23 A;  2HSP A;  4D8K A;  1RLQ C;  3JV3 A;  2CUB A;  1U06 A;  3UAT A;  3I5S A;  2JXB A;  2CDT A;  1N5Z A;  3IQL A;  5L23 A;  2CRE A;  3VRY A;  1ZUY A;  3VS7 A;  2DRK A;  4J9D A;  2FO0 A;  1PKS A;  2KRN A;  4LNP A;  2KRO A;  1CKA A;  4WCI A;  1SHG A;  3M0Q A;  3I9Q A;  4IIO A;  4J9C A;  3NGP A;  4OMN A;  1TUD A;  2ESW A;  4E6R A;  2L3S A;  4JZ3 A;  2FRY A;  1AOJ A;  1UG1 A;  1WXT A;  2JW4 A;  1M3C A;  2H8H A;  2RN8 A;  2V1R A;  1CKB A;  1JXO A;  2A36 A;  2K3B A;  2YT6 A;  1QKX A;  2I0N A;  2PTK A;  5IXB A;  1MV0 B;  2RQV A;  1I07 A;  1ZSG A;  3O5Z A;  2FPF A;  1BK2 A;  1MV3 A;  3VS4 A;  2VWF A;  1E6H A;  2AZS A;  1PRL C;  2DL3 A;  3EGU A;  1SRM A;  2J06 A;  2NUZ A;  2DE0 X;  4J9I A;  1OEB A;  1WXB A;  2AKL A;  1JEG A;  5ECA A;  2MOX A;  4JPB W;  2CT4 A;  3FJ5 A;  3I5R A;  2L3P A;  1WX6 A;  4OMP A;  2QDL A;  2W0Z A;  4J9F A;  4HVU A;  1JQQ A;  1PWT A;  2VKN A;  3C0C A;  2O9S A;  2DF6 A;  2C0I A;  3NHN A;  3VS0 A;  1K0X A;  2IIM A;  2KT1 A;  4J9H A;  1X69 A;  2O9V A;  2EW3 A;  4X1V A;  2D8H A;  4ORZ A;  2D8J A;  5I11 A;  3SEM A;  2YDL A;  5IH2 A;  2O88 A;  3UF4 A;  1UUE A;  2EYY A;  1AEY A;  3EG2 A;  1AWJ A;  1M8M A;  1M3A A;  1WI7 A;  2LCS A;  1I1J A;  3PVQ A;  2C0O A;  2MIO A;  1V1C A;  3EHQ A;  1U5S A;  2EGE A;  4J9B A;  3VS5 A;  2KXC A;  1ZBJ A;  1B3Q A;  2KNB B;  2F2X A;  2YUO A;  3EG0 A;  4JJD A;  1T3S A;  1OV3 A;  2M0Y A;  1JXM A;  4RTU A;  5IHK A;  1KFZ A;  1OOT A;  2JMA A;  1B07 A;  2EVR A;  1QWF A;  2KYM A;  5FW9 A;  2EGA A;  1K76 A;  1H92 A;  1NLP C;  2OJ2 A;  2LZ6 B;  5GJW B;  4JZ4 A;  2EYW A;  2ENM A;  4LN2 A;  5GJV B;  1UFF A;  2J7I A;  2DNU A;  2K9G A;  1Z9Q A;  3ULR B;  2CH4 W;  1S1N A;  1UEC A;  3M0T A;  2YSQ A;  3A98 A;  1GCQ C;  4AFS C;  4CC2 A;  4OMO A;  4J9G A;  1FYN A;  1M27 C;  1SRL A;  4OMM A;  4AFQ C;  3H0F A;  2P4R A;  1WYX A;  1GRI A;  2GTJ A;  2DL4 A;  2J6K A;  3RBB B;  3M0P A;  1HJD A;  1PRM C;  2LQN A;  4Z8A A;  1MUZ A;  4RTV A;  5FWB A;  3REA B;  2EBP A;  2EGC A;  2LQW A;  2RQW A;  1E7O A;  1NM7 A;  2K6D A;  2VVK A;  1ZUK A;  3QWX X;  2KGT A;  4HCK A;  4JJC A;  2F2W A;  4LUE A;  2D1X A;  1ZLM A;  3H0H A;  2ECZ A;  3THK A;  3TSZ A;  2FPE A;  2DL7 A;  3PE0 A;  1K1Z A;  2GQI A;  1WIE A;  2ED1 A;  2JS0 A;  4IIM A;  1RI9 A;  2BZY A;  4LUD A;  2KRS A;  1QWE A;  2CH4 A;  2YUQ A;  4HXJ A;  5FWC A;  3H41 A;  1X27 A;  4RTX A;  3NMZ C;  2V1Q A;  2DBK A;  2ROT A;  4F14 A;  1GCP A;  2HEQ A;  3RNJ A;  4GLM A;  1K9A A;  5I22 A;  1X6G A;  1QCF A;  2JMC A;  1H3H A;  2GBQ A;  4JJB A;  2CUD A;  2DJQ A;  2KYB A;  1YP5 A;  2F2V A;  2RMO A;  1Y0M A;  1NEB A;  2K2M A;  4FSS A;  4RTT A;  2DA9 A;  3M0R A;  2HBW A;  1GBQ A;  1X6B A;  2G6F X;  3PVL A;  2NWM A;  4RTZ A;  2BZX A;  1UJY A;  3EHR A;  1G2B A;  4OMQ A;  5EC7 A;  3EG1 A;  2RPN A;  3VS3 A;  3R6N A;  2RQU A;  2EYX A;  4LE9 A;  3M0S A;  1YWP A;  1X2K A;  1CSK A;  1AD5 A;  2A08 A;  2J05 A;  2GGR A;  2CSQ A;  4D8D A;  1NYG A;  1WLP B;  2O31 A;  1RLP C;  2JM8 A;  2ED0 A;  2JT4 A;  4Y92 A;  1AVZ C;  3VS2 A;  4K11 A;  2RF0 A;  2X3W D;  2HCK A;  2A37 A;  1PKT A;  1X2Q A;  4AFU C;  1VYV A;  1T0H A;  5IHN A;  3ZL7 C;  1UHC A;  1WFW A;  1G83 A;  1W1F A;  1VYT A;  1UDL A;  1BU1 A;  1EFN A;  2SEM A;  2FEI A;  2X3X D;  1KSW A;  2YUN A;  1I0C A;  1TG0 A;  3VS1 A;  1AWX A;  1SHF A;  1UTI A;  1H8K A;  4RUG A;  4F16 A;  3LH5 A;  1KIK A;  4AG2 C;  2OI3 A;  1J3T A;  4Z89 A;  1TUC A;  4M4Z A;  1NYF A;  1AWW A;  1GCQ A;  2HDA A;  4KRT A;  1UHF A;  2M51 A;  2BTT A;  2GTO A;  4F17 A;  2RQT A;  2KXD A;  2ROL A;  4AFZ C;  2L3Q A;  4DEX A;  1NG2 A;  1AZE A;  1OPL A;  2W10 A;  1PNJ A;  2FG0 A;  3GBQ A;  1YWO A;  3CQT A;  1Z9Z A;  1WA7 A;  1YN8 A;  1HSQ A;  2KT8 A;  1IO6 A;  1LCK A;  2DVJ A;  2SRC A;  1GFD A;  3NPF A;  1YNZ A;  2D0N A;  1XOV A;  2KBT A;  2DM1 A;  2BZ8 A;  4R0K A;  4ZNX A;  1UE9 A;  1Y57 A;  2ABL A;  2KRM A;  2FPD A;  2LX7 A;  1GFC A;  2AK5 A;  4OML A;  2DL5 A;  1SEM A;  2DL8 A;  4CC4 B;  4ESR A;  2DIL A;  1AZG B;  1OPK A;  1GL5 A;  2LJ0 A;  1NLO C;  1X43 A;  1NEG A;  2DRM A;  2EYZ A;  5IXF A; 
#chains in the Genus database with same CATH topology
 4BAC A;  2JM9 A;  2KEA A;  1ABQ A;  1M3B A;  1FMK A;  4LD6 A;  1WHH A;  2BUD A;  3DLM A;  2GCX A;  1VQ9 T;  2JTM A;  2LC4 A;  1BI1 A;  3KXT A;  2QTV A;  4PJO C;  4DOW A;  2X4W A;  4PJO B;  1KQS S;  2A3L A;  1PHT A;  2I2L A;  4MDX A;  2G3R A;  3OYH A;  9ATC B;  2DER A;  1U3O A;  8ATC B;  5LJ5 h;  4BI4 A;  5GAN 4;  1VYU A;  2CSI A;  2H3E B;  1I5L A;  1IXD A;  2YUP A;  2YRV A;  4MZP A;  4J6Y A;  1T3L A;  3CBO A;  4C0F A;  1JB0 E;  5L8R E;  1JU5 C;  1M90 C;  4MZM A;  3M0U A;  3QJ6 A;  1ZA1 B;  2AKK A;  3CC2 T;  3REB B;  1UGV A;  1OZ2 A;  3M59 A;  4M77 G;  4C0G A;  1LNX A;  1KD1 U;  1MND A;  3L2R A;  4A63 B;  3JB9 D;  2E6N A;  1VA7 A;  2DTH A;  1JJ2 S;  1MMA A;  2RQR A;  2HL3 A;  1F1B B;  2L2P A;  4D6W A;  2VGM A;  2LJ3 A;  1PD0 A;  1D0Z A;  3VS6 A;  5LL6 S;  4HCC A;  3CCS Q;  2AIR B;  4WF2 A;  4M75 F;  3D7S B;  1WQW A;  5GAO q;  4RTW A;  3CCU A;  3BDU A;  2NUP A;  3I35 A;  1ABO A;  3X26 B;  4XTV A;  1TWB A;  3SHW A;  2FVU A;  1BCM A;  1WJR A;  2ZPF B;  3KFV A;  2M9U A;  2HKQ B;  1K4U S;  1R8O B;  1QQJ A;  5GMK m;  3V7S A;  2BIV A;  2DZC A;  4PFZ A;  1O9S A;  3G1J A;  2HSP A;  4XTZ A;  4E7Z A;  3EFS A;  1WHG A;  4L5G A;  5FRO A;  3PMI A;  4BI8 B;  4JRK A;  1N5Z A;  1N8R R;  2CRE A;  3VS7 A;  3X25 B;  2DRK A;  3HFO A;  1K9M R;  2O01 E;  2DXC A;  1KC8 U;  1KQS A;  4LNP A;  2KRO A;  2RI5 A;  1Q82 C;  2KMT A;  1WJQ A;  4C8Q E;  3NGP A;  4PLL A;  1TS9 A;  3LGL A;  4E6R A;  2FRY A;  1UG1 A;  2DEQ A;  2E3H A;  3OY9 A;  3I55 T;  3ME9 A;  2RN8 A;  3C12 A;  3E1S A;  2V1R A;  2A36 A;  2QA4 T;  2EWN A;  3QJY A;  1QKX A;  3BFM A;  4M78 E;  1MV0 B;  1ZSG A;  3O5Z A;  3VUB A;  1MV3 A;  3OYY A;  3QO3 A;  1M1F A;  2F69 A;  2VYT A;  5GAO r;  4FYY B;  2BE7 D;  2X51 A;  2AZS A;  5KYY A;  2M16 A;  4R55 A;  1SRM A;  4C92 A;  1D1A A;  1OEB A;  1W4S A;  5J3B A;  5ECA A;  2LCC A;  3FJ5 A;  3I5R A;  5FU7 B;  4ANJ A;  1M2O A;  2CZ0 B;  2QDL A;  2QG9 B;  2W0Z A;  4J9F A;  1JQQ A;  2NLU A;  5GAO m;  1PWT A;  5GAO n;  4BD3 A;  3G6E T;  3VYG A;  3MEU A;  4XU2 A;  2O9V A;  2EW3 A;  3GOX A;  2K4Y A;  3J7A F;  2KVQ G;  3VU3 C;  4A54 A;  3QHS A;  4CI0 C;  4Y91 A;  5C0M A;  1AEY A;  1AWJ A;  1WI7 A;  2DFU A;  1HK9 A;  2MIO A;  1V1C A;  2EJ9 A;  1IRE B;  2KXC A;  2E12 A;  2F2X A;  1U1T A;  3EG0 A;  4JJD A;  4PJO F;  2M0Y A;  4RTU A;  3JB9 H;  1LPL A;  3HRU A;  1Y7X A;  2JMA A;  1WNL A;  2XHC A;  2RHI A;  1BI3 A;  1K76 A;  2QGF B;  1H92 A;  1M1G A;  4M7A F;  3SDZ A;  4JZ4 A;  2EYW A;  3G6E A;  2ENM A;  4LN2 A;  3TCJ A;  4TVR A;  4EMK A;  3OYJ A;  3ULR B;  2MAM A;  4CC2 A;  1QMC A;  4OMO A;  4ZN3 A;  1OQK A;  1QVF P;  1M1K U;  1WYX A;  1GRI A;  3G7Z A;  4CRI A;  2GTJ A;  4PJN A;  5GAO l;  5LJ3 g;  2DPP B;  3GPL A;  2QA4 Q;  3VUZ A;  2J6K A;  3RBB B;  3OYB A;  2RJD A;  2V26 A;  2DIQ A;  1PRM C;  1FX7 A;  4KUL A;  3FB9 A;  4C5G A;  1VQM T;  1HXD A;  2XD0 A;  1D3B A;  3CCS T;  4E7I A;  2LQW A;  1I8F A;  4DBR A;  2QEX A;  2VVK A;  4M7D A;  2KGT A;  1VQN Q;  1RI0 A;  3EGX A;  3L1A A;  4LUE A;  2D1X A;  2EQM A;  4BB7 A;  3G71 A;  3H0H A;  2RJF A;  3PE0 A;  1WHL A;  2WSC E;  2GQI A;  1WIE A;  2ED1 A;  5GAM d;  4E7J A;  2EFI A;  2XI9 A;  1VQK Q;  4LUD A;  2CH4 A;  2R5A A;  3H41 A;  5J26 A;  2V1Q A;  3EGD A;  4BDZ A;  4QVZ A;  5DY9 A;  3GNF B;  2MMP A;  5CKD A;  2VAS A;  2ZPH B;  4QKU A;  2JMC A;  2VGN A;  2GBQ A;  4M75 B;  2KYB A;  4WTO B;  3CCS A;  2F2V A;  3UPU A;  3X24 B;  4C8Q B;  1Y0M A;  1K73 U;  1N8R C;  4RTT A;  4DBF A;  1ZA2 B;  2HBW A;  1GBQ A;  3CXC S;  4P5N A;  1VQ9 Q;  4JLI A;  2FYK A;  3EHR A;  4DBH A;  3RER A;  4OMQ A;  1YIJ A;  1D1C A;  3FC3 A;  1N27 A;  2HD0 A;  4XK8 E;  2RQU A;  3C94 A;  4LE9 A;  2HQE A;  3CCU Q;  1NE8 A;  3KUF A;  1D09 B;  2CSQ A;  4D8D A;  3WVE B;  1Q81 U;  5LJ3 d;  4Y92 A;  1AVZ C;  1FWZ A;  4K11 A;  3CXC A;  1PKT A;  4J7F A;  5A2Q E;  4OB2 B;  1RAG B;  1WFW A;  3CCM Q;  1W1F A;  1VYT A;  2X3X D;  1UEB A;  3PTA A;  1AWX A;  1SHF A;  1UTI A;  2FZG B;  4HCZ A;  4RUG A;  5GAM e;  3G6E Q;  2GFU A;  3G4S Q;  2OI3 A;  1J3T A;  4OB0 B;  2DZ9 A;  1BYM A;  4M4Z A;  1GCQ A;  2HDA A;  4C5H A;  1Q86 C;  4N4G A;  2GTO A;  5IN1 A;  4ZTF A;  4IUP A;  1SF9 A;  3NTI A;  2ROL A;  1NG2 A;  1AZE A;  4A4H A;  2W10 A;  4YTL A;  4EMH A;  3CBP A;  3R6O A;  1HSQ A;  3A8H B;  1KK7 A;  1K73 C;  4RMO A;  1GFD A;  2EKO A;  1K8A R;  1ACM B;  2KBT A;  3X28 B;  1Y57 A;  3RMS A;  4IUT A;  2FPD A;  5GAM h;  2WSF E;  3ASK A;  5GAN g;  3E2U A;  2DIL A;  2LCL A;  3VKI A;  2L8D A;  4BDY A;  4EMK C;  2BKD N;  1X43 A;  3X20 B;  5CO7 A;  5GAN 6;  4N4I A;  4M78 F;  5LJ3 e;  1ZQ1 A;  2KQW A;  5CQY A;  1NJI U;  3OSV A;  2EQK A;  1W6X A;  3SWN C;  1ZX6 A;  5HK0 A;  2LQK A;  5GAO p;  4B6M A;  3BDL A;  1VIF A;  4RG2 A;  2L0A A;  2MCN A;  4AT1 B;  2DYB A;  1NPP A;  1E6G A;  4QT7 A;  2JOY A;  1PCX A;  1HYO A;  2PVG B;  2JZ2 A;  2X4X A;  2YLC A;  3JCM X;  1ZUU A;  3UWN A;  4BI3 A;  5D6Y A;  2OTL T;  2B86 A;  1VQM Q;  3UA6 A;  2E70 A;  1Q95 G;  4XU0 A;  3OB9 A;  5KE2 A;  4GBQ A;  3JCM b;  4RCB A;  1M4Z A;  4HVW A;  2DTO A;  1SSH A;  3CC4 Q;  2X35 A;  2XDP A;  2EAY A;  2RJE A;  3JRZ A;  1B7T A;  3TVT A;  4J6X A;  1BB9 A;  2J6F A;  3CPF A;  3UA7 A;  4XQ3 A;  4JS4 A;  2DMO A;  5KYY B;  4PJO E;  3CPW S;  2FRW A;  1VQ5 T;  3QSU A;  2DTI A;  4X9C A;  3E9F A;  4CC3 A;  3CC2 Q;  2QQB A;  4MZT A;  3G71 T;  4RTY A;  5FU7 C;  5CCA A;  1SPK A;  4C8Q D;  1WQ7 A;  2A0F B;  3M54 A;  8AT1 B;  1WXU A;  4PFO A;  4M7D G;  2E5K A;  3HFN A;  3J81 E;  3UAT A;  3WXM B;  3EH1 A;  4OF1 A;  1IHV A;  3CCM A;  3P8B B;  2K2V A;  2FO0 A;  1AHJ B;  2KRN A;  4RCC A;  5EG2 A;  3CCQ T;  4F04 B;  3CCL A;  4WCI A;  1SHG A;  4XU1 A;  2GFA A;  1JBM A;  2RJC A;  3AHU A;  4IIO A;  3HRT A;  3H8Z A;  4J9C A;  1VQO T;  3M58 A;  4OMN A;  3EFO B;  3URG A;  3PGG A;  1YJW T;  4VUB A;  1M3C A;  3VJP A;  5CAI A;  2FZK B;  2YLB A;  4C8Q F;  4JRQ A;  3CCR A;  1CKB A;  2E3I A;  5KYW B;  2PTK A;  3HP9 A;  1YIJ Q;  2D9T A;  1LJO A;  1NJI R;  1BCO A;  3C95 A;  3MP6 A;  4NL2 A;  1VQP T;  2VUB A;  1VQ9 A;  4KUD K;  3I55 Q;  4JUV A;  2RA2 A;  4RKU E;  2ZPE B;  1JJ2 A;  4FIB A;  4O6J A;  4AMC A;  3UT1 A;  3CC2 A;  2DD4 A;  1I81 A;  1UGR B;  2DE0 X;  1WHK A;  1W2B S;  4M7D B;  4OP0 A;  3A8M B;  4J9I A;  2MOX A;  4JPB W;  4X9D A;  2LT4 A;  1K8A U;  2MYS A;  2K5I A;  3EGX B;  2LQ8 A;  1MMG A;  4HVU A;  2COZ A;  4Y28 E;  5DLO A;  1BIA A;  2VKN A;  3C0C A;  2RD1 A;  2C0I A;  1RAI B;  3MPU B;  2DXU A;  4J9H A;  7AT1 B;  4M78 C;  5I11 A;  5KH6 A;  3SEM A;  1B34 A;  2YDL A;  4IUV A;  3RIR A;  2O88 A;  2EYY A;  2XU8 A;  1I1J A;  4NOY A;  2EGE A;  3V7C A;  3VS5 A;  1IHW A;  1OYX A;  2EQJ A;  4DBQ A;  4M77 B;  3PNW C;  1T3S A;  1VQ4 T;  3QDR B;  2VC8 A;  5CQX A;  1KQ1 A;  2MWO A;  2MPX C;  5D7U A;  1KFZ A;  1X75 C;  4LDW A;  1QWF A;  5FW9 A;  2EGA A;  2XK0 A;  4PL6 A;  2IPO B;  4M77 E;  2QQA A;  2ZPB B;  2OJ2 A;  2LZ6 B;  4KH1 B;  2R57 A;  2LTO A;  4FU6 A;  5GJV B;  4L59 A;  1RAF B;  5CIU A;  3PFS A;  3CBM A;  3LH0 A;  4J8O A;  1Z9Q A;  5IT9 E;  3L2U A;  1IRX A;  3A98 A;  1Y07 A;  2FHD A;  4J9G A;  1FYN A;  1M27 C;  3EG9 B;  4AFQ C;  4R56 A;  3JB9 J;  4MML A;  2HL5 C;  5M9O A;  2DXB A;  4C8Q G;  1XTD A;  1KQS P;  1YCY A;  2DL4 A;  3JB9 G;  1VQL A;  2LQN A;  5FWB A;  3REA B;  1W2B A;  4ELY C;  3CMA T;  2EGC A;  1E7O A;  2K6D A;  1KHC A;  2LDM A;  2P84 A;  3JB9 I;  3I56 A;  1ZUK A;  1G3W A;  2F2W A;  4KBM B;  1M90 R;  4BE2 A;  3TQ7 P;  4B9W A;  2CP5 A;  2KRS A;  3TEE A;  5FWC A;  1GXI E;  1QCN A;  4LDV A;  5CVI A;  4A53 A;  3FEO A;  3M4G A;  1S72 T;  2C06 A;  3EFO A;  1VQO A;  2HEQ A;  3RNJ A;  3V7R A;  5I22 A;  3OS0 A;  1X6G A;  4EMG A;  2NUT A;  2QEX T;  3BW1 A;  4DOV A;  4JJB A;  3CCQ A;  2CUD A;  1IB8 A;  1YP5 A;  2OTJ A;  2RMO A;  4E7S A;  5LJ3 h;  3EG9 A;  4N0A A;  2DA9 A;  2DKG A;  4M77 C;  4PJO A;  1X6B A;  2DEU A;  2CZ6 B;  2QDY B;  2BZX A;  3HKS A;  2QTX A;  1QVG S;  1G2B A;  3KBG A;  3EG1 A;  3CMA A;  4C92 G;  3V8J A;  3R6N A;  2E41 A;  4ZGD B;  2K3X A;  1VQL T;  4A4F A;  1YWP A;  4M7A A;  1M2V B;  1X2K A;  3SFM A;  1FXX A;  5KYX B;  1RLP C;  1Q86 R;  2PVO B;  1W2B P;  2E64 A;  3ZBD A;  2QGG A;  2ATC B;  1UGP B;  3P8D A;  4O5V A;  4AFU C;  4GY5 A;  1VYV A;  1VQ4 A;  4BE1 A;  2HNI A;  3ZL7 C;  2QXF A;  1UHC A;  2Y90 A;  2DAQ A;  1UDL A;  1BU1 A;  3QYG B;  3L2V A;  5GMK j;  2CZ1 B;  2YUN A;  1I0C A;  1YJ9 Q;  1TG0 A;  5AT1 B;  3V8L A;  4F16 A;  1KIK A;  1WJS A;  3LH5 A;  3QUI A;  4Q5W A;  2F5K A;  2AT1 B;  1YJ9 A;  5DM7 R;  1AWW A;  4KRT A;  1UHF A;  1JRI A;  2M51 A;  2RQT A;  3CD6 A;  1WZO A;  6AT1 B;  2JN0 A;  4M7A C;  1RL2 A;  2L3Q A;  5GAM j;  3P8H A;  1QVF A;  3JCM Q;  2CP3 A;  3DKM A;  2L89 A;  4PNO A;  2RB6 A;  2E1H A;  4KUI A;  3CD6 Q;  2FG0 A;  1UB4 A;  4IUQ A;  4FYV B;  3N5B B;  1YN8 A;  5GMK h;  3LX7 A;  2KT8 A;  4QQ6 A;  4EPC A;  3WVD B;  1KQ2 A;  1VQN A;  4C0D B;  1YNZ A;  2QEX Q;  1BI2 A;  4E7K A;  4LXC A;  2DM1 A;  3RDV A;  1BKB A;  4R0K A;  4ZNX A;  1UE9 A;  1RAC B;  2AK5 A;  2QAS A;  5FRM A;  4OML A;  1N9S A;  2PUO B;  1SG5 A;  4ESR A;  1AZG B;  2RM4 A;  1QVF S;  4EDU A;  2LJ0 A;  4M7A D;  1NLO C;  3MP8 A;  2EYZ A;  1M9S A;  1XQH A;  5IXF A;  5KYU B;  1W70 A;  1BBZ A;  2PNI A;  1YI2 Q;  2OTJ Q;  2EPD A;  2LMJ A;  3M56 A;  2XMF A;  3JCM P;  1C0M A;  1EIF A;  2A28 A;  2J6O A;  1OUL A;  2RHU A;  5GAN h;  3JB9 F;  3VV0 A;  1QKW A;  4FW1 A;  5A0L A;  2KI7 A;  2O4X A;  2PUK B;  3CMA Q;  2JTE A;  2RK2 A;  3OYC A;  5LJ3 j;  5CKH A;  2IG0 A;  3VRZ A;  2XIC A;  3M57 A;  4FW2 A;  3RKW A;  4MMK A;  2JUF A;  1SKU B;  3JCM W;  3OYK A;  1TU0 B;  3MEV A;  4XAX B;  4QVC A;  2JVV A;  2CT3 A;  4J83 A;  3QYH B;  1MMD A;  2K79 A;  3CCV T;  2GNC A;  3QZ9 B;  3LGF A;  1VQ7 Q;  3CD6 T;  3H0I A;  3M4Y A;  3MEA A;  3CCE Q;  4C92 E;  2C0T A;  5GAN e;  2AZV A;  3RKX A;  4M75 C;  1R0C B;  3JSC A;  3OYI A;  1Q86 U;  1RAA B;  2K7A A;  3CXC P;  2H3J A;  3S3O A;  1KJW A;  4ATO A;  1YJN Q;  1IGU A;  2ZAE A;  4LDX A;  1VQP A;  2Z0W A;  2PQW A;  1R0B G;  1YIT Q;  2QA4 A;  1ZSZ A;  3CCR T;  1N6A A;  5HCK A;  1GBR A;  4F7U F;  5HKC A;  2YHT A;  3HHT B;  4PFP A;  5HK3 A;  1K0S A;  4HCB A;  2AHJ B;  4AG1 C;  3A8G B;  3RUX A;  4V2S A;  2HKN A;  4M77 F;  2M1H A;  3CCJ A;  1JO8 A;  4HVV A;  3OW2 S;  4BY6 B;  1M90 U;  1QLY A;  1YIT A;  1QP2 A;  1YHQ T;  3M53 A;  2EKH A;  4HT9 A;  2OAW A;  3HL8 A;  3U23 A;  1M8V A;  2YWW A;  1PC0 A;  4D8K A;  1RLQ C;  3BE3 A;  4M7D F;  1OU9 A;  5KYN A;  1U06 A;  4FT2 A;  3I5S A;  1K73 R;  5DLQ E;  4EMK B;  2CDT A;  3IQL A;  2LVM A;  3VRY A;  2RK1 A;  1YBY A;  2FL7 A;  4J5Y A;  2M02 A;  4PJO G;  3ZEH A;  2K57 A;  1PKS A;  2M0O A;  1CKA A;  2DJZ A;  2CYZ B;  2QYZ A;  3FRN A;  3TRE A;  3M0Q A;  3I9Q A;  3OS5 A;  4N4H A;  2RHZ A;  1PSF A;  1VQP Q;  3QDF A;  3T9N A;  1TSF A;  2JTF A;  1WXT A;  1KHI A;  5GAN d;  4M78 G;  1YHQ Q;  2YT6 A;  2I0N A;  3CCE A;  1TH7 A;  2RQV A;  1I07 A;  2VXF A;  2KSS A;  3L2W A;  2F1L A;  2VB6 A;  2VWF A;  4XTX A;  4M75 D;  1G3Y A;  1OI1 A;  1E6H A;  4FT4 A;  3Q1J A;  1PRL C;  3EGU A;  1M1K R;  3NTK A;  3CCR Q;  1WXB A;  5LJ5 j;  2D6F A;  2EYQ A;  2ZCF B;  4II1 A;  4XTY A;  2CT4 A;  2L3P A;  1WX6 A;  1KC8 C;  4OMP A;  5GAN 8;  2E4H A;  1XNI A;  1VUB A;  1QCO A;  2DF6 A;  4IUU A;  3NHN A;  3VS0 A;  5LJ3 f;  3JCM g;  1K0X A;  3HPW A;  5CKB A;  4ZGE B;  2KT1 A;  2YRD A;  4DQ2 A;  4FM4 B;  4C0Z A;  4X1V A;  4ORZ A;  2LX9 A;  2V8K A;  2D8J A;  4C92 D;  5C6S A;  4C5E A;  3UF4 A;  1UUE A;  3VYH B;  1M8M A;  2WSE E;  3PVQ A;  3EHQ A;  4B9X A;  2CGH A;  4UC4 A;  2MF2 A;  5I2S A;  5KCH A;  1R77 A;  3OQ5 A;  4QQG A;  1PD1 A;  1ZBJ A;  4E7H A;  1AT1 B;  5GAN 2;  1OV3 A;  3HRS A;  2DD5 A;  1ZSZ C;  5CKF A;  5KYU A;  1VQ8 T;  1JXM A;  1QVG P;  1YJW A;  1QVG A;  2A7Y A;  1Q82 U;  2KYM A;  3RKY A;  3QKJ A;  3MHX A;  2XDD A;  2L5Q A;  1NLP C;  3OYL A;  4A4G A;  4M75 A;  1IGQ A;  1K8A C;  1C1A A;  1UFF A;  1VQK A;  2J7I A;  2DNU A;  3C4S A;  4C8Q A;  2DK3 A;  1UEC A;  4AFS C;  1GCQ C;  4RG8 A;  1Q7Y C;  1SRL A;  3F70 A;  1ZHI A;  3H0F A;  2COW A;  2P4R A;  4JLG A;  4X34 A;  4FYW B;  5HY6 A;  3JCM J;  4F7U G;  3A8L B;  1HJD A;  1G3S A;  4OMF B;  4Z8A A;  4RTV A;  2EBP A;  2QQ9 A;  3DB3 A;  4F7U B;  4LD9 K;  3CCL Q;  4C92 C;  3CCJ T;  4HCK A;  4FYX B;  2OX7 A;  4KGX B;  1ZLM A;  2O4X B;  1H64 1;  1LOJ A;  3TSZ A;  3GLX A;  4BY6 C;  1K1Z A;  2HZY A;  2LNV A;  3CCE T;  2P0P A;  1FMV A;  1RAD B;  1RI9 A;  1G3T A;  3QG1 A;  3DB4 A;  4HXJ A;  5GAN f;  3CCJ Q;  3CCV Q;  2EJF A;  3NMZ C;  1D0X A;  1G8X A;  3CC4 A;  2DBK A;  5I2M A;  1YIJ T;  2ROT A;  1O75 A;  4GLK A;  1DJ7 B;  1K9A A;  3GIB A;  4M7D C;  2X4J A;  4M78 D;  1QCF A;  1H3H A;  4ZTJ A;  1D0Y A;  1KG1 A;  1UGQ B;  5IAY A;  1U1S A;  2DYI A;  1NEB A;  1QW1 A;  2XG8 D;  5FU6 C;  1NPR A;  4BE0 A;  1MHN A;  4FSS A;  3RMQ A;  1M5Q 1;  3CCQ Q;  2G6F X;  4RTZ A;  2Y4X A;  1Q81 C;  2KDS A;  3CME T;  3A5Z B;  3VS3 A;  2OTL A;  3UDC A;  1YIT T;  2OTJ T;  1YI2 T;  1VQL Q;  3M0S A;  4C92 F;  3NTH A;  1Q7Y U;  3G4S T;  1VQ8 Q;  1PM3 A;  4KGZ B;  5GAN 7;  2GGR A;  2E10 A;  1NYG A;  4XTW A;  1YJN A;  3O8V A;  2JM8 A;  2ZZD A;  2HCK A;  2A37 A;  3L2Q A;  1X2Q A;  3EAE A;  5LJ5 e;  1EZZ B;  2K3Y A;  2EJG A;  4J6W A;  5IHN A;  2GQV A;  3MET A;  4F7U E;  3PIP A;  1EFN A;  2LT1 A;  2RHY A;  2QK0 A;  2FEI A;  2WAC A;  3OS2 A;  4HT8 A;  1H8K A;  2Y4Y A;  5CK9 A;  4Z89 A;  1TUC A;  2KY9 A;  2PU9 B;  1KD1 C;  4F17 A;  2KXD A;  2YXY A;  3OMG A;  3PMT A;  2V8I A;  5GAN j;  1Q82 R;  2K5L A;  5FRN A;  4M7D E;  4KGV B;  1OPL A;  2DIG A;  3SB2 A;  4A4K A;  3JCM c;  3OYG A;  3GBQ A;  2E5Q A;  1YWO A;  3CQT A;  3CME Q;  2HSE B;  3E9G A;  3V8K A;  1IO6 A;  4C5I A;  2DVJ A;  2SRC A;  4JRP A;  4OGE A;  4DA4 A;  2HQX A;  1V29 B;  3NPF A;  1XOV A;  4M7A B;  1OX9 A;  3JAM E;  2EQU A;  5CKE A;  2DET A;  3M5A A;  5GAN 5;  2ABL A;  2KK4 A;  2LX7 A;  2XID A;  3FJP A;  2OAU A;  3S3M A;  3H9N A;  1PG5 B;  2LRQ A;  1OPK A;  1RAH B;  5FU6 B;  3M9Q A;  4NS5 A;  1NEG A;  4M75 G;  1VQ6 A;  2R58 A;  2K5F A;  4EIK A;  4M78 B;  2DX1 A;  4CC7 A;  5GMK l;  4A4E A;  2KE9 A;  4J7I A;  1VQN T;  3I55 A;  1D1B A;  2DBM A;  2DLP A;  3OYM A;  1RUW A;  3MCA B;  5KE3 A;  3CC7 A;  4MDW A;  2GF7 A;  2JNG A;  2DVE A;  2E6Z A;  1VQ4 Q;  3EG3 A;  3G4S A;  3CCL T;  4M77 D;  4XU3 A;  2PZ1 A;  3OS1 A;  2KR3 A;  3JCM f;  2RNA A;  1ARK A;  1T0J A;  2DO3 A;  1V76 A;  4IKF A;  3ER0 A;  1YJ9 T;  1TOV A;  4ZGJ B;  1HD3 A;  4C92 B;  3LLR A;  1YJW Q;  3CEY A;  3QWY A;  1H3Z A;  5IHI A;  2LNH B;  1QP3 A;  2NYS A;  2EQI A;  5FLX E;  2JS2 A;  4FCY A;  1TUG B;  4M75 E;  2VXE A;  3OMC A;  3OYA A;  3OW2 A;  3INZ A;  3TSW A;  2LP5 A;  1M30 A;  1S72 A;  1A0N B;  2O2O A;  2LJ1 A;  3QZ5 B;  4QVD A;  1VQ5 A;  1UJ0 A;  4J9E A;  5GMK i;  3M55 A;  4DEY A;  2P4T A;  1YCS B;  2CP0 A;  2L3R A;  4Z88 A;  3MKD A;  1P92 A;  2VV5 A;  3CME A;  3CCM T;  1X6O A;  1MGQ A;  1IZ6 A;  2KAF A;  3QPH A;  3TU4 K;  3GNG A;  2QQS A;  3JCM e;  1WDX A;  1AWO A;  4FL6 A;  4LDY A;  3E19 A;  3JV3 A;  2CUB A;  2JJ9 A;  1G5V A;  2JXB A;  3MP1 A;  1VQO Q;  5D6X A;  5L23 A;  1Q7Y R;  1PSE A;  1ZUY A;  4FSX A;  3GF5 A;  4J9D A;  1I4K 1;  3FLG A;  1BI0 A;  3PIO A;  2XKO C;  2CP2 A;  4C0D C;  1TUD A;  2ESW A;  4HKE A;  4KH0 B;  2ZPI B;  2RH2 A;  2L3S A;  1D3B B;  4JZ3 A;  4JS5 A;  1AOJ A;  3FDR A;  3J80 E;  3OW2 P;  2JW4 A;  5I21 A;  4OVA A;  2H8H A;  3SWN A;  2B8A A;  1JXO A;  2K3B A;  2OTL Q;  2IVW A;  1WHM A;  3L42 A;  5IXB A;  2FZC B;  2FPF A;  1BK2 A;  2XDB A;  3VS4 A;  3OYF A;  3L2Z A;  4C8Q C;  3GP8 A;  1JJ2 P;  4M7A G;  4ME7 A;  2DL3 A;  2J06 A;  2NUZ A;  1FMW A;  4M7D D;  2RI2 A;  4JRI A;  2AKL A;  1NBE B;  2FB7 A;  2ZGW A;  1JEG A;  4IUR A;  2P0K A;  4F7U A;  4OB1 B;  1VQ7 A;  5GMK e;  3JCM d;  2O9S A;  2V8J A;  2COY A;  4QQD A;  2IIM A;  1NZ9 A;  3EFR A;  1M1K C;  1X69 A;  5GAN 3;  2D8H A;  4PJM A;  3SWN B;  3ZFJ A;  5IH2 A;  2R5M A;  3EG2 A;  1RAE B;  1M3A A;  2PVD B;  2LCS A;  3SD4 A;  2C0O A;  1U5S A;  4J9B A;  5KYX A;  3LWI A;  3QXE B;  1X01 A;  1B3Q A;  2KNB B;  4PK4 A;  4LDU A;  3JCM h;  2YUO A;  2MK5 A;  4M7A E;  2EIF A;  5IHK A;  3FIF A;  2MI6 A;  2MWP A;  1OOT A;  2RHX A;  1B07 A;  2EVR A;  4JJN K;  1YJN T;  1Y96 A;  2DXT A;  1WGS A;  4OGC A;  2QI2 A;  3MEW A;  3QII A;  1TXQ A;  2CKK A;  5GJW B;  5KYW A;  1EX4 A;  1WHJ A;  2HBP A;  2K9G A;  4HA8 A;  3S6W A;  2CH4 W;  2CP6 A;  1S1N A;  1VQ7 T;  3LW5 E;  5J39 A;  3M0T A;  4PJO D;  2YSQ A;  1KC8 R;  5A0D A;  3H6Z A;  4OMM A;  3HSB A;  4PJJ A;  1N8R U;  5AYF A;  3OA6 A;  1VQ5 Q;  3M0P A;  1RAB B;  1YI2 A;  5KCO A;  1MUZ A;  1S72 Q;  2RQW A;  3LWH A;  1K9M U;  1NM7 A;  1B34 B;  3QWX X;  4JJC A;  2ECZ A;  3THK A;  2FPE A;  2DL7 A;  4PKC C;  2RO0 A;  2NUP B;  3OSS C;  3JCM V;  2JS0 A;  4IIM A;  2BZY A;  1QWE A;  2YUQ A;  2CS7 A;  4OB3 B;  2CZ7 B;  1X27 A;  1I5O B;  4RTX A;  4E7L A;  5GAM f;  2E65 A;  1Y96 B;  1U8R A;  4E47 A;  3MJX A;  3A8O B;  2BE9 B;  4F14 A;  1GCP A;  4GLM A;  5A0G A;  3AT1 B;  2HMA A;  3OYE A;  2DJQ A;  3OYD A;  1WPY A;  3CC7 Q;  2K2M A;  1UGS B;  5CR2 A;  3M0R A;  3G71 Q;  3HTR A;  3OBY A;  3CPW P;  3PVL A;  2NWM A;  1UJY A;  1ZBX A;  2F5T X;  5EC7 A;  4M78 A;  4PJL A;  3NFC A;  1VQ6 Q;  2RPN A;  3S3N A;  1YHQ A;  2NUT B;  5LJ5 d;  1MMN A;  2EYX A;  4Z02 A;  3CCU T;  2YRC A;  3I56 Q;  1OZ3 A;  1CSK A;  1AD5 A;  2A08 A;  2J05 A;  4KT0 E;  1WLP B;  2O31 A;  1YFN A;  1KD1 R;  3MO8 A;  1NJI C;  2ED0 A;  2JT4 A;  4M77 A;  3VS2 A;  4PLI A;  2HQH A;  3DLL A;  3RES A;  2RF0 A;  2X3W D;  3CC4 T;  4QW2 A;  1MNE A;  1T0H A;  5GAM g;  1Y71 A;  4BUG A;  4E2F B;  1G83 A;  3RR6 A;  1OX8 A;  1SSF A;  2SEM A;  2QQR A;  1KSW A;  1M2V A;  3VS1 A;  4JDS A;  4AG2 C;  1VIE A;  3BY7 A;  3I56 T;  3QBY A;  1NYF A;  4XTU A;  2BTT A;  1VQM A;  1VOM A;  2RI3 A;  4NL3 A;  1VQ6 T;  2X4Y A;  1VQK T;  4AFZ C;  3CCV A;  3OBW A;  4DEX A;  1OU8 A;  2HAX A;  3LYI A;  2QAZ A;  3PT9 A;  3EH2 A;  2D0Q B;  1PNJ A;  3A1P A;  1Z9Z A;  2X9H A;  1LVK A;  3CC7 T;  1QVP A;  1WA7 A;  3EGD B;  1LCK A;  4ELZ C;  3CPW A;  2D0N A;  2BZ8 A;  1ZSZ B;  1N9R A;  2KRM A;  5D6W A;  1GFC A;  2CP7 A;  2DL5 A;  2ZPG B;  1K9M C;  1SEM A;  2DL8 A;  4N0A C;  1C6V X;  4CC4 B;  5LJ5 f;  3OYN A;  2P0Q A;  1VQ8 A;  5LJ5 g;  1TTH B;  1BIB A;  1GL5 A;  4ZN1 A;  4L6V 5;  1XJW B;  2DRM A;  1Q81 R; 
#chains in the Genus database with same CATH homology
 1W70 A;  1BBZ A;  2PNI A;  4EIK A;  2JM9 A;  2EPD A;  2KEA A;  2DX1 A;  4CC7 A;  2LMJ A;  1ABQ A;  2XMF A;  2KE9 A;  1M3B A;  2A28 A;  1FMK A;  2J6O A;  1W6X A;  2DBM A;  1ZX6 A;  2DLP A;  1RUW A;  1QKW A;  2JTE A;  2L0A A;  2MCN A;  2DYB A;  1E6G A;  3VRZ A;  3EG3 A;  4QT7 A;  2PZ1 A;  1PHT A;  1ZUU A;  2KR3 A;  2B86 A;  2RNA A;  1ARK A;  1T0J A;  1U3O A;  3UA6 A;  1VYU A;  2CSI A;  1HD3 A;  2CT3 A;  2YUP A;  4GBQ A;  3QWY A;  5IHI A;  2K79 A;  1T3L A;  2LNH B;  2GNC A;  1JU5 C;  3M0U A;  4HVW A;  3H0I A;  1SSH A;  2EQI A;  2AKK A;  3REB B;  2JS2 A;  1UGV A;  2C0T A;  2AZV A;  3TVT A;  2K7A A;  4A63 B;  1BB9 A;  2J6F A;  1VA7 A;  2RQR A;  1KJW A;  3TSW A;  2LP5 A;  1M30 A;  2L2P A;  1A0N B;  2LJ3 A;  2O2O A;  3VS6 A;  3UA7 A;  2LJ1 A;  2DMO A;  1UJ0 A;  4J9E A;  4RTW A;  4DEY A;  2FRW A;  5HCK A;  1GBR A;  1YCS B;  3I35 A;  4Z88 A;  1K0S A;  1ABO A;  4CC3 A;  4AG1 C;  4RTY A;  3SHW A;  3KFV A;  1SPK A;  1K4U S;  1JO8 A;  4HVV A;  1QLY A;  1WXU A;  2E5K A;  2EKH A;  1WDX A;  2OAW A;  1AWO A;  3U23 A;  2HSP A;  4D8K A;  1RLQ C;  3JV3 A;  2CUB A;  1U06 A;  3UAT A;  3I5S A;  2JXB A;  2CDT A;  1N5Z A;  3IQL A;  5L23 A;  2CRE A;  3VRY A;  1ZUY A;  3VS7 A;  2DRK A;  4J9D A;  2FO0 A;  1PKS A;  2KRN A;  4LNP A;  2KRO A;  1CKA A;  4WCI A;  1SHG A;  3M0Q A;  3I9Q A;  4IIO A;  4J9C A;  3NGP A;  4OMN A;  1TUD A;  2ESW A;  4E6R A;  2L3S A;  4JZ3 A;  2FRY A;  1AOJ A;  1UG1 A;  1WXT A;  2JW4 A;  1M3C A;  2H8H A;  2RN8 A;  2V1R A;  1CKB A;  1JXO A;  2A36 A;  2K3B A;  2YT6 A;  1QKX A;  2I0N A;  2PTK A;  5IXB A;  1MV0 B;  2RQV A;  1I07 A;  1ZSG A;  3O5Z A;  2FPF A;  1BK2 A;  1MV3 A;  3VS4 A;  2VWF A;  1E6H A;  2AZS A;  1PRL C;  2DL3 A;  3EGU A;  1SRM A;  2J06 A;  2NUZ A;  2DE0 X;  4J9I A;  1OEB A;  1WXB A;  2AKL A;  1JEG A;  5ECA A;  2MOX A;  4JPB W;  2CT4 A;  3FJ5 A;  3I5R A;  2L3P A;  1WX6 A;  4OMP A;  2QDL A;  2W0Z A;  4J9F A;  4HVU A;  1JQQ A;  1PWT A;  2VKN A;  3C0C A;  2O9S A;  2DF6 A;  2C0I A;  3NHN A;  3VS0 A;  1K0X A;  2IIM A;  2KT1 A;  4J9H A;  1X69 A;  2O9V A;  2EW3 A;  4X1V A;  2D8H A;  4ORZ A;  2D8J A;  5I11 A;  3SEM A;  2YDL A;  5IH2 A;  2O88 A;  3UF4 A;  1UUE A;  2EYY A;  1AEY A;  3EG2 A;  1AWJ A;  1M8M A;  1M3A A;  1WI7 A;  2LCS A;  1I1J A;  3PVQ A;  2C0O A;  2MIO A;  1V1C A;  3EHQ A;  1U5S A;  2EGE A;  4J9B A;  3VS5 A;  2KXC A;  1ZBJ A;  1B3Q A;  2KNB B;  2F2X A;  2YUO A;  3EG0 A;  4JJD A;  1T3S A;  1OV3 A;  2M0Y A;  1JXM A;  4RTU A;  5IHK A;  1KFZ A;  1OOT A;  2JMA A;  1B07 A;  2EVR A;  1QWF A;  2KYM A;  5FW9 A;  2EGA A;  1K76 A;  1H92 A;  1NLP C;  2OJ2 A;  2LZ6 B;  5GJW B;  4JZ4 A;  2EYW A;  2ENM A;  4LN2 A;  5GJV B;  1UFF A;  2J7I A;  2DNU A;  2K9G A;  1Z9Q A;  3ULR B;  2CH4 W;  1S1N A;  1UEC A;  3M0T A;  2YSQ A;  3A98 A;  1GCQ C;  4AFS C;  4CC2 A;  4OMO A;  4J9G A;  1FYN A;  1M27 C;  1SRL A;  4OMM A;  4AFQ C;  3H0F A;  2P4R A;  1WYX A;  1GRI A;  2GTJ A;  2DL4 A;  2J6K A;  3RBB B;  3M0P A;  1HJD A;  1PRM C;  2LQN A;  4Z8A A;  1MUZ A;  4RTV A;  5FWB A;  3REA B;  2EBP A;  2EGC A;  2LQW A;  2RQW A;  1E7O A;  1NM7 A;  2K6D A;  2VVK A;  1ZUK A;  3QWX X;  2KGT A;  4HCK A;  4JJC A;  2F2W A;  4LUE A;  2D1X A;  1ZLM A;  3H0H A;  2ECZ A;  3THK A;  3TSZ A;  2FPE A;  2DL7 A;  3PE0 A;  1K1Z A;  2GQI A;  1WIE A;  2ED1 A;  2JS0 A;  4IIM A;  1RI9 A;  2BZY A;  4LUD A;  2KRS A;  1QWE A;  2CH4 A;  2YUQ A;  4HXJ A;  5FWC A;  3H41 A;  1X27 A;  4RTX A;  3NMZ C;  2V1Q A;  2DBK A;  2ROT A;  4F14 A;  1GCP A;  2HEQ A;  3RNJ A;  4GLM A;  1K9A A;  5I22 A;  1X6G A;  1QCF A;  2JMC A;  1H3H A;  2GBQ A;  4JJB A;  2CUD A;  2DJQ A;  2KYB A;  1YP5 A;  2F2V A;  2RMO A;  1Y0M A;  1NEB A;  2K2M A;  4FSS A;  4RTT A;  2DA9 A;  3M0R A;  2HBW A;  1GBQ A;  1X6B A;  2G6F X;  3PVL A;  2NWM A;  4RTZ A;  2BZX A;  1UJY A;  3EHR A;  1G2B A;  4OMQ A;  5EC7 A;  3EG1 A;  2RPN A;  3VS3 A;  3R6N A;  2RQU A;  2EYX A;  4LE9 A;  3M0S A;  1YWP A;  1X2K A;  1CSK A;  1AD5 A;  2A08 A;  2J05 A;  2GGR A;  2CSQ A;  4D8D A;  1NYG A;  1WLP B;  2O31 A;  1RLP C;  2JM8 A;  2ED0 A;  2JT4 A;  4Y92 A;  1AVZ C;  3VS2 A;  4K11 A;  2RF0 A;  2X3W D;  2HCK A;  2A37 A;  1PKT A;  1X2Q A;  4AFU C;  1VYV A;  1T0H A;  5IHN A;  3ZL7 C;  1UHC A;  1WFW A;  1G83 A;  1W1F A;  1VYT A;  1UDL A;  1BU1 A;  1EFN A;  2SEM A;  2FEI A;  2X3X D;  1KSW A;  2YUN A;  1I0C A;  1TG0 A;  3VS1 A;  1AWX A;  1SHF A;  1UTI A;  1H8K A;  4RUG A;  4F16 A;  3LH5 A;  1KIK A;  4AG2 C;  2OI3 A;  1J3T A;  4Z89 A;  1TUC A;  4M4Z A;  1NYF A;  1AWW A;  1GCQ A;  2HDA A;  4KRT A;  1UHF A;  2M51 A;  2BTT A;  2GTO A;  4F17 A;  2RQT A;  2KXD A;  2ROL A;  4AFZ C;  2L3Q A;  4DEX A;  1NG2 A;  1AZE A;  1OPL A;  2W10 A;  1PNJ A;  2FG0 A;  3GBQ A;  1YWO A;  3CQT A;  1Z9Z A;  1WA7 A;  1YN8 A;  1HSQ A;  2KT8 A;  1IO6 A;  1LCK A;  2DVJ A;  2SRC A;  1GFD A;  3NPF A;  1YNZ A;  2D0N A;  1XOV A;  2KBT A;  2DM1 A;  2BZ8 A;  4R0K A;  4ZNX A;  1UE9 A;  1Y57 A;  2ABL A;  2KRM A;  2FPD A;  2LX7 A;  1GFC A;  2AK5 A;  4OML A;  2DL5 A;  1SEM A;  2DL8 A;  4CC4 B;  4ESR A;  2DIL A;  1AZG B;  1OPK A;  1GL5 A;  2LJ0 A;  1NLO C;  1X43 A;  1NEG A;  2DRM A;  2EYZ A;  5IXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...