3QIIA

Crystal structure of tudor domain 2 of human phd finger protein 20
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
52
structure length
52
Chain Sequence
EFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 20
publication title Crystal structures of the Tudor domains of human PHF20 reveal novel structural variations on the Royal Family of proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 12
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qiiA00
2VYTA 3OYLA 2DIQA 3M9QA 1H3ZA 2O4XA 1WJRA 2EFIA 4HCZA 2M16A 2XK0A 3E9GA 3OYGA 3QIIA 3L2VA 3FC3A 3SD4A 2E5QA 4ZTJA 1KHCA 2RJEA 3OS2A 3L2UA 2JZ2A 3QBYA 4L59A 5KCHA 4IKFA 5IAYA 3EAEA 2RJFA 2RI5A 4GY5A 4C5EA 3L2WA 4E7KA 2RHIA 5D6YA 4E7HA 4IUTA 1SSFA 4NS5A 2MWPA 2MWOA 2RI2A 4Z02A 1WGSA 3OS0A 1OI1A 2E6NA 3MO8A 3OYDA 3P8HA 4QQGA 4A4EA 5D6XA 4ZTFA 3MEVA 5KE3A 1N27A 2M0OA 3BDLA 2JTFA 2G3RA 2DAQA 3H8ZA 2CKKA 1MHNA 2RJCA 3NTIA 4OVAA 2RJDA 4UC4A 1WJSA 5C0MA 2L89A 4BACA 2O4XB 3CEYA 3S3NA 5FRMA 2R58A 3DB3A 3PMIA 5IN1A 2L8DA 3OYBA 4PLLA 2F5KA 4QQDA 3S6WA 3MP1A 2K3YA 3FDRA 3OB9A 3Q1JA 4CRIA 3FLGA 2PQWA 2P0KA 3L42A 2NLUA 3DLMA 3ASKA 2B8AA 2RHXA 5J39A 3S3MA 1WJQA 3PNWC 4IUPA 3MEWA 4B9WA 4BE0A 2LTOA 2DIGA 4RG2A 2BKDN 3OYHA 3S3OA 3MP8A 3OMGA 4C5HA 3O8VA 3OA6A 2FHDA 2EQKA 4LD6A 2K3XA 5CIUA 4QW2A 4QQ6A 3OYEA 2X35A 4EDUA 3OYMA 3OYKA 2L3RA 4BE1A 3OYIA 4E7LA 2X4XA 2RHYA 2GFAA 4E7IA 2QQRA 5FROA 3ME9A 2R57A 3FEOA 2HQXA 2QQSA 3LH0A 4II1A 4IURA 4BDZA 3MP6A 2LDMA 4N4GA 3P8DA 2EKOA 2M1HA 1G5VA 3OYCA 4C5IA 3OY9A 3L2RA 5KE2A 3OYJA 4A4GA 2R5AA 3H6ZA 1OZ3A 3META 3DB4A 1XNIA 2IG0A 4BE2A 3KUFA 4X34A 4Q5WA 4BDYA 2R5MA 2RHUA 4B9XA 2EQJA 1OZ2A 3QJ6A 2LVMA 2GFUA 4IUUA 4PLIA 3OYFA 5KH6A 3OYNA 2LCCA 4N4HA 3F70A 4QVZA 2WACA 2HQEA 4PL6A 3OMCA 4A4HA 3LLRA 2YRVA 4FL6A 5J26A 3OYAA 1RI0A 2X4WA 3E9FA 3PMTA 2GF7A 3NTKA 3OS1A 3ZEHA 2RI3A 3UWNA 3UT1A 2BIVA 2EQUA 4C5GA 4N4IA 5C6SA 3OQ5A 3C4SA 3GOXA 2XDPA 4IUQA 5KCOA 2EQMA 2LRQA 4E7JA 3MEAA 1OYXA 2D9TA 2BUDA 3QKJA 4FU6A 5M9OA 3LYIA 2RO0A 3LGLA 3LX7A 2RHZA 3MEUA 3PFSA 4A4FA 5D6WA 4BD3A 2X4YA 3LGFA 5FRNA 3NTHA 4IUVA 3L2QA
chains in the Genus database with same CATH superfamily
4M77F 1D3BB 1DJ7B 1GCQC 2BZYA 2I0NA 3L2ZA 2O2OA 3NGPA 4EMKA 4HA8A 4N0AC 4A54A 2RJEA 3QBYA 2W0ZA 2YXYA 2RI5A 2M02A 5A0DA 4CC7A 2CGHA 2DA9A 4E7KA 4KGZB 2MF2A 5I11A 3QUIA 1WGSA 2KK4A 4C92F 2A3LA 3GNGA 2EYZA 1NJIU 3TCJA 5GAOp 5CKFA 5GMKj 1LJOA 3OW2A 2HEQA 1Z9ZA 5GAN4 4OB2B 4PLLA 3QDFA 1OX9A 2FVUA 1YJNQ 2PQWA 4M77D 4CC4B 3DLMA 3EFOB 1R0BG 1M2VB 3G7ZA 2RN8A 2C06A 4M77A 2EPDA 3CCVQ 1VQOQ 3OYMA 1H3HA 4E7LA 1Q81R 1YJNT 2VASA 3G1JA 1W4SA 4C92D 1TOVA 3FB9A 3OSSC 5KE2A 1VQOT 1BIBA 2R5AA 4C92A 4RTYA 2YRCA 2IG0A 1TSFA 1QVFP 4OP0A 4DOWA 2L0AA 1UECA 1YN8A 3QJ6A 4CI0C 4PJOB 2KMTA 4J6WA 1LOJA 2P84A 2QQAA 5DLOA 4BI8B 4E6RA 4OMPA 4BUGA 2BIVA 4ZGDB 2QI2A 1P92A 2LT1A 2HDAA 2LRQA 2MCNA 2XU8A 4FSXA 4FW1A 4HKEA 2O88A 1G3YA 2K5LA 1QW1A 4KGVB 1B07A 2YHTA 2AZVA 3FJPA 1I5LA 4M7AD 2FPDA 1T3LA 3FC3A 1GBRA 2E5QA 1Q82C 3CCQA 2BZ8A 2XD0A 4R55A 1EFNA 4Y92A 3GLXA 4PJNA 4XU3A 4M7AA 1VQ8T 2J06A 4MMLA 4Y91A 1PSEA 1SPKA 1AEYA 4C0DB 4M7DB 1WZOA 3M59A 1X75C 1R0CB 4M75F 1AWXA 4BB7A 2XDDA 1B34B 1X43A 1N8RR 3JCMf 2DM1A 4JLGA 1I07A 5A0GA 4M75E 5FRMA 1MNEA 2XMFA 5GJVB 2HSEB 4JLIA 2RQVA 1K8AU 1I8FA 2P0KA 3DKMA 2RHXA 3QG1A 5GMKh 4OF1A 1W2BP 3MP8A 3CBPA 2OTJA 4LDXA 1UHCA 1IXDA 1YJWA 4JJNK 1TXQA 2FEIA 2EQIA 5FROA 1PWTA 4C8QE 2R57A 4PJJA 3C95A 5LJ3g 2LNHB 3CC4Q 3OYCA 1D0ZA 4GLMA 1KJWA 1Y96B 4A4GA 4F7UG 4M75A 3V8KA 4OB0B 2JJ9A 3JCMb 1WNLA 5AT1B 2GFUA 1MGQA 3J81E 1KC8C 4LE9A 3MPUB 5KH6A 2LCCA 2RH2A 3ZBDA 1UUEA 4PJOE 1WHHA 4FT2A 2P4TA 2OJ2A 1K9MU 4RCCA 3C0CA 2ZPEB 1M1KU 1NLOC 3HRTA 1VQ5Q 3CCLT 1VQPQ 4DEXA 3CCJA 1VOMA 2COYA 3EGDA 1K1ZA 2DTOA 2DZ9A 1K73U 1NPRA 1K0XA 1N9RA 1OX8A 1RUWA 1YJ9A 4M7DC 1YIJA 3RERA 2FG0A 1VQ5T 1VQPT 4FCYA 4F14A 2FYKA 1NEBA 3CCRQ 2A7YA 2JXBA 3G4SQ 1FMKA 1VYUA 4AFSC 2EJFA 2MWPA 1VIFA 4JZ3A 5GAN2 2JW4A 2LX7A 1U8RA 2DRKA 4RTTA 3CCRT 3REAB 3G4ST 3I55A 2KNBB 2QDLA 1YCSB 3VS4A 1ZA1B 5IN1A 2RD1A 3T9NA 1HXDA 5GAOr 2HL5C 4FYVB 3VS1A 2MYSA 3M58A 2E5KA 3L42A 1PKSA 2DYBA 2NLUA 3FIFA 4OMOA 4ZN3A 4J6XA 3CC2Q 1M5Q1 1MMDA 2FZKB 2QA4Q 4J6YA 1SRLA 2OTLQ 2XDBA 3OYKA 4ZGEB 3CMAQ 3VS3A 1QWFA 4HT8A 4CC2A 2DBMA 3EG9B 3FEOA 2J6OA 2RM4A 1KQ2A 4IURA 1MMNA 3MP6A 4DBHA 2QA4T 3I9QA 2CP5A 1VYTA 2A36A 3THKA 1J3TA 1OZ3A 3CMAT 4LDYA 2KSSA 3SEMA 2X4JA 1VQ7T 2KDSA 2GF7A 1ZSGA 2RI3A 3KBGA 4E2FB 2Z0WA 1WQWA 4K11A 2PVOB 2EQMA 2EGEA 2W10A 5EG2A 2D9TA 3QKJA 2LQ8A 2C0OA 3LX7A 5GAN6 2JMAA 5LJ5h 1M3CA 5CKBA 2J7IA 3SB2A 3G6EQ 4Y28E 3QZ9B 3C12A 4RCBA 2VUBA 4P5NA 4X1VA 1WI7A 4F7UB 2YUOA 1WHJA 2D6FA 4J7IA 4L59A 1UEBA 2DO3A 1WFWA 4M77G 1W70A 4GY5A 1VQ4Q 2MAMA 3CXCS 3G6ET 4IUTA 1W6XA 5I2SA 3R6NA 1AWOA 5KYXB 2X51A 2Y4YA 4HXJA 2F2XA 2EWNA 2ROLA 4ZTFA 3MEVA 2F5TX 1N5ZA 1ABOA 2G3RA 1VQ4T 1YI2A 1TG0A 1Y0MA 5FU6B 1IO6A 4UC4A 3EGXB 3A1PA 4C92G 4J9BA 2F5KA 2CP2A 3MP1A 2F2WA 5KYWA 2VXFA 4M78D 5GANe 3ASKA 3S3MA 1VQMQ 5LJ5e 1PRLC 1KIKA 2YLCA 2FHDA 1G83A 2IPOB 2EJGA 2KBTA 4M78A 5CIUA 1LPLA 4ELYC 3CCEQ 2D8HA 4XTVA 1RL2A 1RAIB 2BZXA 1VIEA 5DM7R 4JUVA 1K8AC 3CCUT 5DY9A 2CYZB 2ZPHB 4JS5A 2E3HA 5CQYA 4XTYA 3OYJA 3TREA 2LT4A 3CCET 1JBMA 4J9HA 3HFNA 4QT7A 4BDYA 2DZCA 4N4HA 4M7AG 1GFDA 1YP5A 3G71A 3H0FA 3UWNA 1VQKQ 5LJ3f 3E1SA 2KRNA 3AHUA 2ESWA 3MEAA 8AT1B 5D6WA 2VC8A 3CPWS 3JRZA 1BCMA 2VYTA 4PFZA 1VQKT 2O4XA 1K9MC 1WJRA 1M1KC 1NEGA 3A8OB 1BIAA 4EMKB 3CC7A 3RKWA 2CDTA 5GANd 1S72Q 3JCMW 4F7UE 3M55A 5FU6C 5LJ5d 3L2WA 5IT9E 4J83A 2NUTA 2DL7A 2EGAA 2EYYA 2RI2A 2V8IA 2DETA 1K73C 2DPPB 2MPXC 1BKBA 3CD6A 1GL5A 3JCMV 1S72T 1WX6A 3JCMc 3PIOA 3V8LA 2RJCA 3NTIA 2RJDA 4BACA 4LD9K 4QQDA 2F2VA 4J7FA 1W2BA 1RADB 2KVQG 3JB9G 2ZAEA 2ENMA 1JU5C 1MV0B 2F69A 3WVEB 4WF2A 1YBYA 5GAMf 3VYHB 4XU0A 1KD1R 2LQNA 2DIGA 1HK9A 3BDUA 1MMAA 1ZSZA 3OMGA 1VQNA 3EG0A 5HK0A 3OS5A 4LD6A 4MDXA 2K3XA 4EPCA 2CS7A 1YFNA 2WSCE 1A0NB 1UGRB 2PVDB 2J05A 2E12A 1M30A 4XU2A 4HT9A 2OX7A 4DQ2A 4IIMA 4M4ZA 5FW9A 3OY9A 1FX7A 2FRWA 3UDCA 4C92B 1XNIA 2JM8A 2PU9B 4Q5WA 4TVRA 3CCMQ 5HCKA 1YJNA 3D7SB 1WQ7A 1XQHA 5AYFA 3UT1A 2FL7A 1Q7YR 3CCVA 1VQOA 3GBQA 4EMKC 2BUDA 2RQUA 5LL6S 2KR3A 3LYIA 3GPLA 1G5VA 2RF0A 3QYHB 4D6WA 1IGUA 1JEGA 1SSHA 1E6HA 1SF9A 1UHFA 4DBQA 4O5VA 2KQWA 3VKIA 4M7AB 1VQ9Q 3CXCP 4E7HA 2LP5A 5GMKl 1C0MA 1OI1A 2CZ6B 3E19A 4QQGA 3RNJA 3HPWA 3I5SA 4OMNA 1GXIE 3BDLA 3JV3A 5KYYA 1VQ9T 1KQSP 4M77C 2L89A 1QP2A 1RLQC 3GF5A 3EGUA 2MMPA 2GGRA 2X3XD 3QO3A 2LMJA 2K6DA 1X2KA 1QLYA 2E70A 4F16A 5CVIA 1RLPC 4KGXB 4GLKA 4HVVA 4C5HA 3O8VA 3C94A 3RIRA 3VUZA 3I56T 4DA4A 4C92C 2DFUA 4KULA 2RA2A 1I81A 2K5FA 4FW2A 1JJ2S 3LH0A 3MKDA 2M51A 4MMKA 3M4GA 4JDSA 2IIMA 4ANJA 2SRCA 5GAN3 1NE8A 3QZ5B 1ZUUA 1YWPA 1YITT 2V26A 2DL5A 1KHIA 3A8MB 1GFCA 2YRVA 3OYAA 1RI0A 3M53A 2VKNA 3CCST 2LNVA 5IXBA 4XAXB 3X28B 1WHLA 3R6OA 1TUCA 1HSQA 2XDPA 5IHKA 4IUQA 1BI1A 1WXUA 2G6FX 2ZPGB 3RDVA 4OMLA 2WSFE 4QVCA 4M7AC 4FSSA 2VGMA 3CC4A 3EGDB 1H3ZA 2ECZA 1M90R 4BY6B 1KHCA 4IKFA 3OW2S 1ZX6A 2RJFA 4M78G 4C5EA 3BFMA 3UF4A 2K2VA 2QASA 4ME7A 4Z02A 3OS0A 1AZGB 4OMMA 3MO8A 1ZBJA 3RBBB 3GP8A 1VQ8Q 2RK2A 2M0OA 1IGQA 1UJ0A 2EYXA 1MHNA 1TS9A 2YDLA 3LWHA 1VQ5A 3CEYA 4XTZA 1VQPA 2VV5A 4QKUA 3OYBA 2DL3A 1UJYA 2PZ1A 5LJ5g 1RACB 2OAUA 1Q95G 4FT4A 4JRKA 2DTIA 2CZ0B 1D0XA 2ATCB 3CCRA 1X2QA 3G4SA 4E7IA 1JB0E 1YHQQ 4M75C 3M0UA 2ZCFB 1RABB 3N5BB 3RMQA 1S1NA 4RTWA 2JOYA 4C5IA 2DX1A 4C0FA 2FZCB 2MI6A 3OYYA 3L2RA 2CSQA 1QMCA 4RTZA 1K4US 2M9UA 1GBQA 1YHQT 5L23A 2XHCA 2EAYA 1QKWA 2HMAA 1NJIR 1D3BA 3EHQA 2DJQA 4C8QF 3F70A 2DMOA 3JCMe 2HQEA 3VS5A 3CC2A 4J9FA 1NYGA 1O75A 4J9GA 1M8MA 1TUGB 2KGTA 5FWCA 4N4IA 2QA4A 1D1AA 2OTLA 4M75D 4JJDA 4MDWA 3VJPA 4BY6C 3CMAA 1KQ1A 4VUBA 2NUZA 3VS2A 4FU6A 1Q81C 4IUVA 3A98A 3L2QA 2DNUA 3HRSA 4PJOF 1UB4A 4GBQA 3CCLQ 3UATA 2AKKA 1BYMA 1WLPB 5GANj 5IAYA 2AK5A 5LJ5j 1OPLA 1QVGA 2QEXQ 1C6VX 4C8QD 5A2QE 1VQLQ 2LQKA 3INZA 2DEQA 3SWNA 4BI3A 2MK5A 2A0FB 2AIRB 2WSEE 4C8QA 5ECAA 1B3QA 4NL2A 5CK9A 1M3BA 3A8LB 2QEXT 1VQLT 1BI0A 3PMIA 1TTHB 5HK3A 2I2LA 1YNZA 2XI9A 3G6EA 4PJOD 1IREB 2K3BA 4B9WA 9ATCB 2YSQA 1HD3A 3JCMd 2COWA 3BE3A 4M7DF 4PJOA 4M78B 1ZLMA 2E6ZA 1VQ4A 4M7DE 1VUBA 4LUDA 1H8KA 1M3AA 2LDMA 4J9EA 4JRIA 2FB7A 2NUPB 2L5QA 4D8KA 3X20B 4ORZA 1QVGS 4PFPA 1M4ZA 1TUDA 4AFZC 3QWYA 1N8RC 2RHUA 3QWXX 2KT8A 2C0TA 1UGVA 2X3WD 3O5ZA 2LX9A 4FL6A 2GQVA 4JJBA 1VQMA 4E7SA 3VV0A 2BTTA 3NHNA 3QDRB 2XKOC 1JQQA 3CCEA 1VQ7Q 2JTEA 3SDZA 1BBZA 2RO0A 4J9IA 1HJDA 2DILA 3LGFA 1B34A 1X69A 2GCXA 4Z89A 1YJWT 3URGA 3SFMA 4LXCA 1JXOA 3A8GB 4HCZA 2LJ1A 2X9HA 4JJCA 1EIFA 3HKSA 2JMCA 3JB9H 4MZTA 1Y71A 4ELZC 3H9NA 4NOYA 2DERA 2KXDA 2NUTB 4RMOA 5GANh 1BCOA 1UGQB 4IIOA 4AG2C 1KQSA 1VQKA 3PTAA 2CH4A 2A37A 3E2UA 3GIBA 1QVPA 5GAN5 2JTFA 2IVWA 1FMVA 4L5GA 1U3OA 2V1QA 1RAFB 4M78C 3CCJQ 3RR6A 3TQ7P 2DXBA 2L8DA 3Q1JA 2DK3A 1Q86R 1Y96A 1LNXA 2DVEA 3A8HB 2HAXA 3MEWA 4BE0A 3OYHA 1RAAB 3CCJT 1S72A 1K73R 4V2SA 2V8JA 1YIJT 5IXFA 2AKLA 4EMHA 5GAOn 3M54A 5I21A 3HSBA 3CCUQ 4BE2A 1M8VA 3M5AA 2LVMA 2RNAA 3FJ5A 5GAOq 3V7SA 4QVZA 3OBYA 4OB3B 1X6GA 3I55T 2OAWA 2O31A 7AT1B 3NTKA 3EFSA 3NPFA 2QDYB 4EIKA 2EQUA 3V8JA 3LWIA 1QVFA 1N9SA 4E7JA 2KRMA 2JT4A 4LUEA 3LGLA 4R56A 2DXTA 4OMFB 2QAZA 5FU7C 4LN2A 2LC4A 5CKHA 5KYUA 3OYGA 1BI2A 3NFCA 3DLLA 1T0HA 5IHNA 3OS2A 1Q7YU 3EHRA 1H641 2O9VA 3CCMA 4C0GA 1PD1A 3HFOA 1SSFA 2GBQA 4R0KA 1X27A 2H8HA 5DLQE 1IHVA 4HCCA 2QQBA 1AWWA 4FYWB 1UG1A 1ZSZC 3X25B 3JCMQ 3EG9A 1NG2A 4F7UF 1WHMA 5LJ3e 4CRIA 1XTDA 2HQHA 5KYNA 5J39A 1MNDA 3PNWC 1QVFS 2P0QA 3S3OA 1QQJA 1OQKA 4PKCC 5D7UA 2RQTA 3VS7A 1VQ9A 1T3SA 2YUNA 4KT0E 1H92A 2QQSA 2EKOA 4M75G 2L3PA 2ZPBB 5GAN8 5CCAA 4CC3A 4A4KA 1WHGA 3SHWA 4ATOA 4M77B 2DF6A 4WTOB 3JCMg 3OYNA 2E10A 3VU3C 1G3TA 1LCKA 1OPKA 4A4HA 4F7UA 5HKCA 1RAHB 3E9FA 2L3SA 4J8OA 4RTUA 2K57A 5FWBA 2A28A 3OQ5A 2HZYA 2NWMA 4C8QG 1IHWA 1UTIA 3M4YA 5CQXA 5GAMe 1TWBA 3WVDB 1WXBA 3J7AF 5GAOl 5GAN7 3M0SA 2PUOB 4JZ4A 2JUFA 1MUZA 1VQ6Q 3JB9J 2NYSA 2FRYA 1Q81U 1OU8A 5LJ3d 2GTJA 2M16A 2ZPFB 4L6V5 1KSWA 2QTXA 1SRMA 1ZUYA 1VQ6T 1W2BS 4RTXA 6AT1B 1XOVA 3CMEQ 1NZ9A 1JRIA 2ZGWA 1M1FA 3P8HA 5FLXE 2Y90A 2DTHA 1N27A 1AOJA 4LDWA 3G71T 3HHTB 1D0YA 1WJSA 4OGCA 1NPPA 3S3NA 1F1BB 3CQTA 3UPUA 4MZMA 3CMET 1K0SA 4KUIA 2PTKA 2Y4XA 2QYZA 1OULA 1D1BA 3P8BB 1WJQA 2LCLA 2EYQA 3KFVA 3TSWA 1G2BA 2EQKA 2P4RA 1WPYA 2X35A 2QTVA 1KG1A 1EZZB 3EH1A 2CZ7B 2GFAA 1I1JA 3JAME 3LH5A 4RTVA 1Y7XA 3LW5E 5GAMd 3I56Q 1VQ8A 1Q82R 3H6ZA 2VVKA 4OMQA 3FRNA 2K5IA 4OGEA 3QJYA 1OZ2A 2F1LA 3JCMP 2DVJA 2RQRA 3PVQA 1ABQA 1N8RU 4M77E 2CP6A 1VQNQ 2EBPA 2HD0A 3PMTA 4D8DA 1OU9A 4Z88A 1YITQ 1KD1C 1C1AA 1YCYA 3QXEB 4J9DA 1E7OA 3TU4K 2RQWA 4DOVA 5GMKm 3HP9A 5M9OA 1YHQA 3CCSQ 2H3EB 3MEUA 2RHZA 4XU1A 4A4FA 1R77A 1ZA2B 1VQNT 2ED0A 3HRUA 1WYXA 3I35A 4M75B 4C92E 3OYLA 1HYOA 2DIQA 3MHXA 5GMKi 2DXUA 2SEMA 3E9GA 4JS4A 3QIIA 2E1HA 1Y57A 2DJZA 2FO0A 4HVUA 2KYBA 2YUPA 3H0IA 3QHSA 5IH2A 2RHIA 3I5RA 2YLBA 4NS5A 4X9DA 1U5SA 1GCQA 4J5YA 2E6NA 4AG1C 3JCMJ 1PM3A 2O9SA 3SWNB 5D6XA 4N0AA 3CPWP 4C8QB 2YUQA 2JVVA 2V8KA 1Q7YC 2EIFA 4OVAA 2KYMA 1KC8R 2K4YA 1SHGA 2PUKB 3S6WA 2K3YA 4AFQC 1OEBA 2DYIA 3CCVT 4MZPA 1AD5A 4M7AF 4XTXA 2EYWA 4B6MA 1PHTA 3CCLA 1I5OB 4AT1B 4M7AE 1K76A 2KAFA 2MOXA 2L3RA 3OYIA 2QEXA 3M0QA 5IHIA 1WDXA 1VQLA 1U06A 2J6FA 2C0IA 3JCMh 4ZN1A 3P8DA 2CT3A 2LCSA 5GANg 4XK8E 2PNIA 2E41A 3EG2A 4RG8A 3MCAB 1UGPB 1I0CA 4KH0B 2R5MA 4B9XA 3ULRB 1QP3A 3OYFA 1UGSB 3OYDA 3J80E 1U1TA 5J26A 2RMOA 1GRIA 2FZGB 4FM4B 1UE9A 3QSUA 3VRZA 2LJ0A 2JN0A 2XICA 5KCOA 1LVKA 2XG8D 2PVGB 1OYXA 2XIDA 1CSKA 3KXTA 2RB6A 3JB9F 1QCFA 2EFIA 3SWNC 3V7RA 3SD4A 4C8QC 2DL8A 1IB8A 5KCHA 1Y07A 2E3IA 1XJWB 3EAEA 5L8RE 2DBKA 2FPFA 4DEYA 3ZL7C 1PRMC 3ER0A 2MWOA 3EFRA 1BB9A 1ACMB 1E6GA 2DE0X 1RAEB 2CUDA 4A4EA 3JCMX 2DKGA 1QWEA 1WXTA 1VQ7A 3H8ZA 2CKKA 1MV3A 1X6BA 1V1CA 4PJOC 3DB3A 2JNGA 2K9GA 4FYYB 1W1FA 1EX4A 3OB9A 4ESRA 1VYVA 3JB9D 2QG9B 2QK0A 5HY6A 3EFOA 4IUPA 2H3JA 1M2VA 2LTOA 4RG2A 4HCBA 2BKDN 1KK7A 2D1XA 4PK4A 3BY7A 3CC4T 1M90C 2ZPIB 2HNIA 5CAIA 3OSVA 2L3QA 2RHYA 4Z8AA 3WXMB 4E47A 1SG5A 4A53A 1WIEA 2DL4A 5I22A 1IRXA 5GMKe 1Q86U 5CKEA 2KI7A 3ZFJA 2MIOA 5KYWB 2DLPA 4PJMA 3VYGA 3META 1D09B 1FWZA 3KUFA 1Z9QA 3CCQQ 5GJWB 4XQ3A 4XTWA 2QGFB 1ZHIA 2EVRA 4DBRA 2BE7D 4C0DC 3PIPA 1JJ2P 3ZEHA 3CCQT 2KRSA 3UA7A 1MMGA 1M9SA 3GOXA 5GAMg 2CZ1B 3RUXA 1V76A 3PT9A 4BD3A 3PFSA 5C0MA 5FRNA 1TU0B 1M27C 1M2OA 3JSCA 5LJ3j 3L2VA 5KYUB 4ZTJA 3CCUA 2OTJQ 2D0QB 3L2UA 2AZSA 1YJWQ 4M7DD 1R8OB 2E65A 1K8AR 4A63B 1PNJA 2AT1B 5D6YA 1NJIC 2M0YA 1PKTA 1OV3A 2YRDA 5CKDA 3M0TA 4M7DA 4JRQA 2D0NA 2OTJT 2HL3A 1AHJB 2HCKA 2DRMA 3TEEA 1VA7A 2CP3A 1UDLA 5KE3A 3VUBA 2CSIA 1X6OA 3PVLA 5A0LA 3CC2T 1SHFA 2O4XB 2KXCA 2ROTA 3CXCA 4KBMB 3CPFA 3OW2P 2OTLT 2CUBA 3QPHA 2KE9A 1AZEA 2CP7A 2VXEA 5FU7B 2JS0A 1ZBXA 2RPNA 4QW2A 4QQ6A 1ZUKA 4EDUA 3RMSA 3VS0A 2E4HA 2X4XA 2JTMA 2QQ9A 3M57A 2HQXA 4II1A 5GAMj 3OBWA 4N4GA 1K9MR 5CR2A 1QCOA 1M1KR 4BI4A 2JS2A 2DXCA 1YJ9Q 1YIJQ 4AMCA 2YT6A 3HL8A 5EC7A 2VB6A 1ZSZB 4FYXB 1PSFA 4M78F 1G3SA 2D8JA 4HCKA 1V29B 3OMCA 4J9CA 2HKNA 2K79A 4M78E 1NYFA 1YJ9T 4HVWA 4PNOA 1M1GA 1JO8A 5C6SA 3M0PA 3IQLA 2O01E 3L1AA 3AT1B 4X9CA 3C4SA 2LQWA 3BW1A 3EG1A 4FIBA 3I55Q 5GANf 1OOTA 1KD1U 2RK1A 2B86A 3PE0A 5LJ5f 2ED1A 4YTLA 3QYGB 3M9QA 1PG5B 3EG3A 3CBMA 1KQSS 4O6JA 2XK0A 4RUGA 1SEMA 1ZQ1A 5LJ3h 1N6AA 1BU1A 3CPWA 2EJ9A 2EW3A 4F17A 4PFOA 1PC0A 1PD0A 3CBOA 3V7CA 2QXFA 1VQMT 2KT1A 1BK2A 3TVTA 2R58A 1AWJA 1NBEB 3EH2A 2CP0A 1IZ6A 2NUPA 1VQ6A 4LDUA 2B8AA 2LZ6B 3PGGA 2DEUA 3OA6A 4AFUC 2K7AA 2DD4A 1UFFA 4LDVA 2HSPA 4XTUA 4E7ZA 5KYYB 2J6KA 3GNFB 3X24B 1SKUB 3CMEA 5I2MA 4BDZA 4WCIA 1FYNA 1QKXA 4KRTA 1AT1B 3NMZC 2CREA 1WHKA 4RKUE 2GQIA 2CH4W 4C0ZA 1AVZC 5GAMh 3RKYA 1I4K1 2ABLA 3VRYA 2EQJA 4IUUA 2CT4A 4KH1B 2EKHA 1Q86C 2VGNA 1RI9A 2X4WA 2FPEA 3A5ZB 4C5GA 1QCNA 3TSZA 1YI2Q 1Q82U 1NLPC 4DBFA 1QVGP 1U1SA 2X4YA 2QGGA 3NTHA 3I56A 4F04B 1YI2T 4KUDK 1G3WA 2HKQB 2JZ2A 3REBB 1G8XA 1TH7A 1T0JA 3UA6A 5KYXA 2ZZDA 3RESA 3H0HA 1YITA 2BE9B 4QVDA 2V1RA 4OB1B 1NM7A 2DAQA 3EGXA 3M0RA 2HBWA 1WA7A 3CCSA 3M56A 2JM9A 1X01A 2L2PA 3FDRA 2OI3A 3FLGA 1PCXA 2GTOA 1K9AA 4PJOG 3JB9I 4LNPA 5J3BA 3G71Q 1FMWA 1JXMA 2P0PA 1D1CA 4PJLA 2DD5A 3RKXA 1KFZA 1CKAA 2A08A 2LJ3A 1RAGB 3HTRA 1O9SA 2K2MA 4ZNXA 3OYEA 4BE1A 2QQRA 2E64A 3ME9A 1KC8U 1M90U 2HBPA 4EMGA 5CO7A 2KEAA 2M1HA 4JPBW 2COZA 3CCMT 1YWOA 1B7TA 2AHJB 5GAOm 2EGCA 3DB4A 3CC7Q 4ZGJB 4X34A 1FXXA 3VS6A 3X26B 1JJ2A 2KROA 2YWWA 4PLIA 2KY9A 1GCPA 2WACA 4PL6A 4JRPA 3LLRA 3U23A 3OS1A 1CKBA 4NL3A 3CD6Q 3CC7T 8ATCB 4M7DG 2VWFA 1ARKA 1BI3A 2GNCA 3MJXA 3H41A 3CD6T
chains in the Genus database with same CATH topology
2GCXA 2RB6A 2VYTA 1VQKT 3JB9F 1YJWT 4M77F 3URGA 1D3BB 3SFMA 1DJ7B 2O4XA 1K9MC 1WJRA 2EFIA 3A8GB 4HCZA 3SWNC 3V7RA 3L2ZA 1M1KC 3A8OB 3SD4A 4HA8A 1BIAA 4N0AC 4C8QC 4EMKB 3RKWA 4A54A 4EMKA 2RJEA 5GANd 3CC7A 3QBYA 5KCHA 3JCMW 1Y07A 4F7UE 3M55A 3EAEA 5FU6C 1EIFA 2RI5A 3HKSA 5LJ5d 3L2WA 5IT9E 4MZTA 5L8RE 1Y71A 5A0DA 2CGHA 3JB9H 4ELZC 4E7KA 4J83A 2MF2A 4NOYA 3ER0A 2MWOA 3QUIA 2V8IA 3EFRA 2RI2A 4RMOA 1WGSA 5GANh 2KK4A 4C92F 2DPPB 1K73C 1BKBA 2A3LA 3GNGA 4A4EA 1UGQB 3CD6A 1KQSA 1NJIU 1VQKA 3PTAA 3JCMV 3JCMX 1S72T 3TCJA 5GAOp 2DKGA 5CKFA 3JCMc 3GIBA 1QVPA 5GAN5 2JTFA 2IVWA 3PIOA 3V8LA 1VQ7A 3H8ZA 2CKKA 2RJCA 3NTIA 4L5GA 1LJOA 2RJDA 5GMKj 3OW2A 4BACA 4M78C 4LD9K 4PJOC 3DB3A 2JNGA 5GAN4 2DXBA 2L8DA 4OB2B 4PLLA 4J7FA 2FVUA 4QQDA 1W2BA 3OB9A 2DK3A 3Q1JA 2KVQG 3JB9G 3JB9D 1Y96A 2PQWA 4M77D 5HY6A 3DLMA 2F69A 1LNXA 3WVEB 2DVEA 3A8HB 1YBYA 4WF2A 3VYHB 4IUPA 2H3JA 3MEWA 4XU0A 5GAMf 2LTOA 2DIGA 4RG2A 4BE0A 2BKDN 1HK9A 3BDUA 3G7ZA 3OYHA 4HCBA 3OMGA 1VQNA 5HK0A 3OS5A 4LD6A 4M77A 3CCJT 2K3XA 3BY7A 2C06A 4MDXA 1S72A 4EPCA 2CS7A 3CC4T 1M90C 2ZPIB 2WSCE 3OYMA 2HNIA 4E7LA 1UGRB 2PVDB 4V2SA 5CAIA 2E12A 1YJNT 3OSVA 2RHYA 4E47A 3WXMB 2V8JA 4XU2A 4HT9A 1YIJT 4DQ2A 1W4SA 4C92D 4A53A 5GMKe 1Q86U 5CKEA 3FB9A 3OY9A 3ZFJA 3OSSC 5KE2A 4EMHA 5GAOn 1FX7A 3UDCA 1BIBA 1VQOT 2R5AA 3M54A 3VYGA 4C92A 3META 5I21A 3HSBA 4C92B 1XNIA 2IG0A 4BE2A 2PU9B 1FWZA 3KUFA 4OP0A 1M8VA 4DOWA 4Q5WA 4TVRA 4XQ3A 4XTWA 1ZHIA 2LVMA 3M5AA 3QJ6A 4CI0C 5GAOq 4PJOB 2KMTA 3V7SA 1YJNA 4QVZA 4J6WA 3OBYA 4OB3B 1LOJA 1WQ7A 2QQAA 4C0DC 3I55T 5DLOA 3PIPA 1XQHA 3NTKA 4BI8B 3EFSA 3ZEHA 2QDYB 5AYFA 3UT1A 2FL7A 4BUGA 2BIVA 2EQUA 3V8JA 3CCQT 1M9SA 4ZGDB 2QI2A 1P92A 3CCVA 3LWIA 5GAMg 3GOXA 1QVFA 2CZ1B 1VQOA 2LT1A 3RUXA 4EMKC 1N9SA 2LRQA 3PT9A 4E7JA 2BUDA 2XU8A 5LL6S 4FSXA 3LYIA 4HKEA 3LGLA 3PFSA 4BD3A 4R56A 3GPLA 5C0MA 5FRNA 3CD6T 1G5VA 1G3YA 3QYHB 2DXTA 2K5LA 4OMFB 4D6WA 3JSCA 1QW1A 5FU7C 2LC4A 2YHTA 5LJ3j 3FJPA 1I5LA 4M7AD 5CKHA 3OYGA 1BI2A 3L2VA 3NFCA 3DLLA 3FC3A 2E5QA 3CCUA 4ZTJA 3OS2A 2D0QB 4O5VA 1H641 3L2UA 2KQWA 3CCQA 1Q7YU 1Q82C 2XD0A 4R55A 3GLXA 3CCMA 4XU3A 4M7DD 4C0GA 4M7AA 1R8OB 2E65A 3VKIA 1VQ8T 4M7AB 3HFOA 5D6YA 4E7HA 5GMKl 1SSFA 1NJIC 4MMLA 4Y91A 1PSEA 5CKDA 1OI1A 2CZ6B 4M7DA 4C0DB 4JRQA 4M7DB 3E19A 2OTJT 5DLQE 4QQGA 3M59A 1AHJB 1X75C 3HPWA 4M75F 3TEEA 5KE3A 4HCCA 4BB7A 2QQBA 3VUBA 1B34B 2XDDA 3BDLA 1GXIE 1X6OA 3JCMf 3X25B 3JCMQ 1VQ9T 4JLGA 5A0GA 4M75E 5A0LA 3CC2T 4M77C 2L89A 5FRMA 2O4XB 4F7UF 3CXCA 5LJ3e 4JLIA 3J81E 1QP2A 4CRIA 1XTDA 4KBMB 3GF5A 3CPFA 1I8FA 2MMPA 2P0KA 1K8AU 2OTLT 3QPHA 3QO3A 3DKMA 2RHXA 3QG1A 5J39A 5GMKh 2E70A 3PNWC 4OF1A 1QVFS 5CVIA 2P0QA 2VXEA 3S3OA 4GLKA 3MP8A 5FU7B 3CBPA 3O8VA 4C5HA 2OTJA 4LDXA 3C94A 4PKCC 1ZBXA 3RIRA 3VUZA 4QW2A 4QQ6A 3I56T 4DA4A 4EDUA 3RMSA 4C92C 1YJWA 4KULA 2RA2A 2X4XA 1I81A 4JJNK 1VQ9A 2JTMA 2K5FA 5FROA 1JJ2S 2QQ9A 4C8QE 2R57A 3M57A 3C95A 2HQXA 2QQSA 3LH0A 4KT0E 5LJ3g 4II1A 5GAMj 3OBWA 4N4GA 2EKOA 5CR2A 3OYCA 4MMKA 3M4GA 4M75G 4JDSA 4BI4A 2ZPBB 5GAN8 1Y96B 5CCAA 2DXCA 4A4GA 5GAN3 1NE8A 3QZ5B 4A4KA 3HL8A 4F7UG 4M75A 3V8KA 4OB0B 3JCMb 1YITT 1WNLA 4ATOA 4M77B 1KHIA 1PSFA 1MGQA 2GFUA 1G3SA 4M78F 3JCMg 5KH6A 2E10A 1V29B 2LCCA 3OYNA 1KC8C 3VU3C 1G3TA 3OMCA 2RH2A 3A8MB 4A4HA 3ZBDA 4F7UA 5HKCA 2YRVA 4M78E 3OYAA 1YJ9T 1RI0A 3E9FA 4PJOE 3M53A 4J8OA 3CCST 2LNVA 2K57A 4FT2A 4XAXB 4PNOA 2P4TA 1M1GA 3X28B 1K9MU 4RCCA 2ZPEB 5C6SA 1M1KU 3OQ5A 2O01E 3L1AA 3R6OA 4C8QG 4X9CA 3C4SA 2XDPA 4FIBA 1BI1A 3BW1A 4IUQA 3M4YA 5CQXA 5GAMe 5GANf 3WVDB 3HRTA 1KD1U 3J7AF 2RK1A 2ZPGB 5GAOl 5GAN7 3CCLT 5LJ5f 2PUOB 2WSFE 4QVCA 4YTLA 4M7AC 3QYGB 3CCJA 2JUFA 2VGMA 2DTOA 3CC4A 3JB9J 2DZ9A 1K73U 3M9QA 1NPRA 1H3ZA 1Q81U 5LJ3d 3CBMA 1N9RA 1KQSS 4O6JA 1YJ9A 4M7DC 2M16A 2XK0A 1YIJA 3RERA 4BY6B 2ZPFB 1VQ5T 1KHCA 1VQPT 1ZQ1A 4IKFA 4L6V5 2FYKA 3OW2S 2A7YA 2QTXA 2RJFA 4M78G 4C5EA 1VQ6T 5LJ3h 1N6AA 3BFMA 1W2BS 3CPWA 2K2VA 2EJFA 2MWPA 1VIFA 5GAN2 4ME7A 4Z02A 1XOVA 3OS0A 1NZ9A 2EJ9A 1JRIA 3MO8A 2ZGWA 1M1FA 3P8HA 5FLXE 3GP8A 1U8RA 2Y90A 2DTHA 2RK2A 1N27A 2M0OA 3V7CA 3CBOA 3CCRT 4LDWA 3G71T 2QXFA 3G4ST 1MHNA 3I55A 3HHTB 3LWHA 1WJSA 4OGCA 1NPPA 1VQMT 1VQ5A 3CEYA 3S3NA 2R58A 5IN1A 2RD1A 4XTZA 1HXDA 2VV5A 3T9NA 5GAOr 3OYBA 1VQPA 3UPUA 4MZMA 3CMET 1IZ6A 4KUIA 3M58A 3L42A 2NLUA 3FIFA 4LDUA 1VQ6A 4ZN3A 2Y4XA 2B8AA 4J6XA 5LJ5g 3P8BB 1WJQA 3PGGA 2OAUA 2LCLA 1M5Q1 2EYQA 4FT4A 4JRKA 2DTIA 3OA6A 2CZ0B 2EQKA 4J6YA 1WPYA 2XDBA 2DD4A 2X35A 3CCRA 3OYKA 1KG1A 4ZGEB 3G4SA 2CZ7B 2GFAA 4LDVA 4XTUA 4E7IA 1JB0E 4HT8A 4M75C 3JAME 3X24B 3GNFB 2ZCFB 3FEOA 2RM4A 1KQ2A 3N5BB 3RMQA 3CMEA 1Y7XA 3LW5E 4IURA 5I2MA 3MP6A 5GAMd 4BDZA 2JOYA 4C5IA 2QA4T 4C0FA 1VQ8A 2MI6A 3OYYA 3L2RA 3H6ZA 1OZ3A 3CMAT 2M9UA 4RKUE 4LDYA 3FRNA 1YHQT 2KSSA 2K5IA 2XHCA 4OGEA 4C0ZA 2EAYA 5GAMh 2X4JA 3RKYA 3QJYA 1I4K1 1OZ2A 2EQJA 1D3BA 3JCMP 4IUUA 4C8QF 3F70A 3JCMe 2HQEA 1N8RU 1VQ7T 4M77E 1Q86C 2VGNA 3CC2A 2X4WA 2HD0A 1O75A 2GF7A 2KDSA 3PMTA 2RI3A 3A5ZB 3KBGA 1KD1C 4C5GA 4N4IA 1WQWA 2QA4A 3QXEB 1YCYA 3TU4K 2OTLA 4DOVA 4M75D 2PVOB 2EQMA 4MDWA 3VJPA 3HP9A 4BY6C 5GMKm 3CMAA 1Q82U 1KQ1A 4VUBA 5EG2A 5M9OA 2D9TA 3QKJA 4FU6A 1YHQA 2LQ8A 3LX7A 3MEUA 4A4FA 2RHZA 4XU1A 5GAN6 1U1SA 1Q81C 1VQNT 2X4YA 5LJ5h 3HRUA 3NTHA 4IUVA 4M75B 3L2QA 5CKBA 4C92E 3OYLA 3SB2A 3I56A 2DIQA 3MHXA 3HRSA 4PJOF 1UB4A 4Y28E 2DXUA 5GMKi 3QZ9B 3C12A 1YI2T 4KUDK 3E9GA 4RCBA 4JS4A 3QIIA 1G3WA 2VUBA 4P5NA 4F7UB 2D6FA 2E1HA 1BYMA 5GANj 4J7IA 2DJZA 2JZ2A 4L59A 1UEBA 2DO3A 5IAYA 5LJ5j 4M77G 4GY5A 1QVGA 3QHSA 2MAMA 1TH7A 4C8QD 3CXCS 2RHIA 5A2QE 3G6ET 2LQKA 2YLBA 4IUTA 4NS5A 5I2SA 4X9DA 2ZZDA 4J5YA 3INZA 2DEQA 2E6NA 2Y4YA 3RESA 3SWNA 4BI3A 3JCMJ 3SWNB 2WSEE 2EWNA 5D6XA 4N0AA 4C8QA 4ZTFA 4C8QB 4QVDA 3MEVA 1YITA 2F5TX 4NL2A 5CK9A 3A8LB 2JVVA 4OB1B 2V8KA 2G3RA 2DAQA 1VQ4T 2QEXT 2EIFA 4OVAA 5FU6B 1YI2A 1Q7YC 4UC4A 1VQLT 1BI0A 4C92G 3CCSA 3PMIA 2K4YA 3M56A 1X01A 2F5KA 2PUKB 3S6WA 3MP1A 2K3YA 3FDRA 5HK3A 2HAXA 3FLGA 2I2LA 2VXFA 4MZPA 3CCVT 2XI9A 4M78D 5GANe 4PJOG 3ASKA 3JB9I 5J3BA 4XTXA 3G6EA 4M7AF 1IREB 4PJOD 3S3MA 2P0PA 4B9WA 5LJ5e 3RKXA 2DD5A 3CCLA 4M7AE 2YLCA 2FHDA 3JCMd 2EJGA 4M78A 5CIUA 1O9SA 4M7DF 4PJOA 4M78B 3OYEA 4ELYC 2KAFA 4XTVA 2L3RA 4BE1A 3OYIA 2E6ZA 1VQ4A 2QEXA 1RL2A 4M7DE 2QQRA 1VUBA 1VIEA 5DM7R 1VQLA 4JUVA 2E64A 3ME9A 1KC8U 1K8AC 3CCUT 1M90U 2HBPA 3JCMh 5DY9A 2CYZB 2ZPHB 5CO7A 4EMGA 4ZN1A 2LDMA 4JS5A 3JRZA 2M1HA 3P8DA 4JRIA 3CCMT 5CQYA 4XTYA 2FB7A 3TREA 5GANg 3OYJA 2AHJB 2L5QA 4XK8E 2LT4A 3CCET 1JBMA 3X20B 5GAOm 1QVGS 1M4ZA 3DB4A 3HFNA 2E41A 4RG8A 3MCAB 1UGPB 4ZGJB 4X34A 1N8RC 1FXXA 4BDYA 2R5MA 2RHUA 4B9XA 2DZCA 1QP3A 3X26B 1JJ2A 4PLIA 3OYFA 1UGSB 2KY9A 4N4HA 3J80E 3OYDA 4M7AG 2LX9A 2WACA 4PL6A 4JRPA 3G71A 3LLRA 1U1TA 4FL6A 2GQVA 5J26A 1VQMA 4FM4B 3OS1A 3QSUA 3UWNA 4NL3A 3VV0A 3CC7T 4M7DG 5LJ3f 3E1SA 3QDRB 2JN0A 2XKOC 2XICA 5KCOA 3CCEA 1BI3A 3AHUA 3MEAA 2XG8D 2PVGB 1OYXA 3SDZA 2XIDA 2RO0A 5D6WA 2VC8A 3KXTA 3LGFA 3CPWS 1B34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYT A;  3OYL A;  2DIQ A;  3M9Q A;  1H3Z A;  2O4X A;  1WJR A;  2EFI A;  4HCZ A;  2M16 A;  2XK0 A;  3E9G A;  3OYG A;  3QII A;  3L2V A;  3FC3 A;  3SD4 A;  2E5Q A;  4ZTJ A;  1KHC A;  2RJE A;  3OS2 A;  3L2U A;  2JZ2 A;  3QBY A;  4L59 A;  5KCH A;  4IKF A;  5IAY A;  3EAE A;  2RJF A;  2RI5 A;  4GY5 A;  4C5E A;  3L2W A;  4E7K A;  2RHI A;  5D6Y A;  4E7H A;  4IUT A;  1SSF A;  4NS5 A;  2MWP A;  2MWO A;  2RI2 A;  4Z02 A;  1WGS A;  3OS0 A;  1OI1 A;  2E6N A;  3MO8 A;  3OYD A;  3P8H A;  4QQG A;  4A4E A;  5D6X A;  4ZTF A;  3MEV A;  5KE3 A;  1N27 A;  2M0O A;  3BDL A;  2JTF A;  2G3R A;  2DAQ A;  3H8Z A;  2CKK A;  1MHN A;  2RJC A;  3NTI A;  4OVA A;  2RJD A;  4UC4 A;  1WJS A;  5C0M A;  2L89 A;  4BAC A;  2O4X B;  3CEY A;  3S3N A;  5FRM A;  2R58 A;  3DB3 A;  3PMI A;  5IN1 A;  2L8D A;  3OYB A;  4PLL A;  2F5K A;  4QQD A;  3S6W A;  3MP1 A;  2K3Y A;  3FDR A;  3OB9 A;  3Q1J A;  4CRI A;  3FLG A;  2PQW A;  2P0K A;  3L42 A;  2NLU A;  3DLM A;  3ASK A;  2B8A A;  2RHX A;  5J39 A;  3S3M A;  1WJQ A;  3PNW C;  4IUP A;  3MEW A;  4B9W A;  4BE0 A;  2LTO A;  2DIG A;  4RG2 A;  2BKD N;  3OYH A;  3S3O A;  3MP8 A;  3OMG A;  4C5H A;  3O8V A;  3OA6 A;  2FHD A;  2EQK A;  4LD6 A;  2K3X A;  5CIU A;  4QW2 A;  4QQ6 A;  3OYE A;  2X35 A;  4EDU A;  3OYM A;  3OYK A;  2L3R A;  4BE1 A;  3OYI A;  4E7L A;  2X4X A;  2RHY A;  2GFA A;  4E7I A;  2QQR A;  5FRO A;  3ME9 A;  2R57 A;  3FEO A;  2HQX A;  2QQS A;  3LH0 A;  4II1 A;  4IUR A;  4BDZ A;  3MP6 A;  2LDM A;  4N4G A;  3P8D A;  2EKO A;  2M1H A;  1G5V A;  3OYC A;  4C5I A;  3OY9 A;  3L2R A;  5KE2 A;  3OYJ A;  4A4G A;  2R5A A;  3H6Z A;  1OZ3 A;  3MET A;  3DB4 A;  1XNI A;  2IG0 A;  4BE2 A;  3KUF A;  4X34 A;  4Q5W A;  4BDY A;  2R5M A;  2RHU A;  4B9X A;  2EQJ A;  1OZ2 A;  3QJ6 A;  2LVM A;  2GFU A;  4IUU A;  4PLI A;  3OYF A;  5KH6 A;  3OYN A;  2LCC A;  4N4H A;  3F70 A;  4QVZ A;  2WAC A;  2HQE A;  4PL6 A;  3OMC A;  4A4H A;  3LLR A;  2YRV A;  4FL6 A;  5J26 A;  3OYA A;  1RI0 A;  2X4W A;  3E9F A;  3PMT A;  2GF7 A;  3NTK A;  3OS1 A;  3ZEH A;  2RI3 A;  3UWN A;  3UT1 A;  2BIV A;  2EQU A;  4C5G A;  4N4I A;  5C6S A;  3OQ5 A;  3C4S A;  3GOX A;  2XDP A;  4IUQ A;  5KCO A;  2EQM A;  2LRQ A;  4E7J A;  3MEA A;  1OYX A;  2D9T A;  2BUD A;  3QKJ A;  4FU6 A;  5M9O A;  3LYI A;  2RO0 A;  3LGL A;  3LX7 A;  2RHZ A;  3MEU A;  3PFS A;  4A4F A;  5D6W A;  4BD3 A;  2X4Y A;  3LGF A;  5FRN A;  3NTH A;  4IUV A;  3L2Q A; 
#chains in the Genus database with same CATH topology
 4M77 F;  1D3B B;  1DJ7 B;  1GCQ C;  2BZY A;  2I0N A;  3L2Z A;  2O2O A;  3NGP A;  4EMK A;  4HA8 A;  4N0A C;  4A54 A;  2RJE A;  3QBY A;  2W0Z A;  2YXY A;  2RI5 A;  2M02 A;  5A0D A;  4CC7 A;  2CGH A;  2DA9 A;  4E7K A;  4KGZ B;  2MF2 A;  5I11 A;  3QUI A;  1WGS A;  2KK4 A;  4C92 F;  2A3L A;  3GNG A;  2EYZ A;  1NJI U;  3TCJ A;  5GAO p;  5CKF A;  5GMK j;  1LJO A;  3OW2 A;  2HEQ A;  1Z9Z A;  5GAN 4;  4OB2 B;  4PLL A;  3QDF A;  1OX9 A;  2FVU A;  1YJN Q;  2PQW A;  4M77 D;  4CC4 B;  3DLM A;  3EFO B;  1R0B G;  1M2V B;  3G7Z A;  2RN8 A;  2C06 A;  4M77 A;  2EPD A;  3CCV Q;  1VQO Q;  3OYM A;  1H3H A;  4E7L A;  1Q81 R;  1YJN T;  2VAS A;  3G1J A;  1W4S A;  4C92 D;  1TOV A;  3FB9 A;  3OSS C;  5KE2 A;  1VQO T;  1BIB A;  2R5A A;  4C92 A;  4RTY A;  2YRC A;  2IG0 A;  1TSF A;  1QVF P;  4OP0 A;  4DOW A;  2L0A A;  1UEC A;  1YN8 A;  3QJ6 A;  4CI0 C;  4PJO B;  2KMT A;  4J6W A;  1LOJ A;  2P84 A;  2QQA A;  5DLO A;  4BI8 B;  4E6R A;  4OMP A;  4BUG A;  2BIV A;  4ZGD B;  2QI2 A;  1P92 A;  2LT1 A;  2HDA A;  2LRQ A;  2MCN A;  2XU8 A;  4FSX A;  4FW1 A;  4HKE A;  2O88 A;  1G3Y A;  2K5L A;  1QW1 A;  4KGV B;  1B07 A;  2YHT A;  2AZV A;  3FJP A;  1I5L A;  4M7A D;  2FPD A;  1T3L A;  3FC3 A;  1GBR A;  2E5Q A;  1Q82 C;  3CCQ A;  2BZ8 A;  2XD0 A;  4R55 A;  1EFN A;  4Y92 A;  3GLX A;  4PJN A;  4XU3 A;  4M7A A;  1VQ8 T;  2J06 A;  4MML A;  4Y91 A;  1PSE A;  1SPK A;  1AEY A;  4C0D B;  4M7D B;  1WZO A;  3M59 A;  1X75 C;  1R0C B;  4M75 F;  1AWX A;  4BB7 A;  2XDD A;  1B34 B;  1X43 A;  1N8R R;  3JCM f;  2DM1 A;  4JLG A;  1I07 A;  5A0G A;  4M75 E;  5FRM A;  1MNE A;  2XMF A;  5GJV B;  2HSE B;  4JLI A;  2RQV A;  1K8A U;  1I8F A;  2P0K A;  3DKM A;  2RHX A;  3QG1 A;  5GMK h;  4OF1 A;  1W2B P;  3MP8 A;  3CBP A;  2OTJ A;  4LDX A;  1UHC A;  1IXD A;  1YJW A;  4JJN K;  1TXQ A;  2FEI A;  2EQI A;  5FRO A;  1PWT A;  4C8Q E;  2R57 A;  4PJJ A;  3C95 A;  5LJ3 g;  2LNH B;  3CC4 Q;  3OYC A;  1D0Z A;  4GLM A;  1KJW A;  1Y96 B;  4A4G A;  4F7U G;  4M75 A;  3V8K A;  4OB0 B;  2JJ9 A;  3JCM b;  1WNL A;  5AT1 B;  2GFU A;  1MGQ A;  3J81 E;  1KC8 C;  4LE9 A;  3MPU B;  5KH6 A;  2LCC A;  2RH2 A;  3ZBD A;  1UUE A;  4PJO E;  1WHH A;  4FT2 A;  2P4T A;  2OJ2 A;  1K9M U;  4RCC A;  3C0C A;  2ZPE B;  1M1K U;  1NLO C;  3HRT A;  1VQ5 Q;  3CCL T;  1VQP Q;  4DEX A;  3CCJ A;  1VOM A;  2COY A;  3EGD A;  1K1Z A;  2DTO A;  2DZ9 A;  1K73 U;  1NPR A;  1K0X A;  1N9R A;  1OX8 A;  1RUW A;  1YJ9 A;  4M7D C;  1YIJ A;  3RER A;  2FG0 A;  1VQ5 T;  1VQP T;  4FCY A;  4F14 A;  2FYK A;  1NEB A;  3CCR Q;  2A7Y A;  2JXB A;  3G4S Q;  1FMK A;  1VYU A;  4AFS C;  2EJF A;  2MWP A;  1VIF A;  4JZ3 A;  5GAN 2;  2JW4 A;  2LX7 A;  1U8R A;  2DRK A;  4RTT A;  3CCR T;  3REA B;  3G4S T;  3I55 A;  2KNB B;  2QDL A;  1YCS B;  3VS4 A;  1ZA1 B;  5IN1 A;  2RD1 A;  3T9N A;  1HXD A;  5GAO r;  2HL5 C;  4FYV B;  3VS1 A;  2MYS A;  3M58 A;  2E5K A;  3L42 A;  1PKS A;  2DYB A;  2NLU A;  3FIF A;  4OMO A;  4ZN3 A;  4J6X A;  3CC2 Q;  1M5Q 1;  1MMD A;  2FZK B;  2QA4 Q;  4J6Y A;  1SRL A;  2OTL Q;  2XDB A;  3OYK A;  4ZGE B;  3CMA Q;  3VS3 A;  1QWF A;  4HT8 A;  4CC2 A;  2DBM A;  3EG9 B;  3FEO A;  2J6O A;  2RM4 A;  1KQ2 A;  4IUR A;  1MMN A;  3MP6 A;  4DBH A;  2QA4 T;  3I9Q A;  2CP5 A;  1VYT A;  2A36 A;  3THK A;  1J3T A;  1OZ3 A;  3CMA T;  4LDY A;  2KSS A;  3SEM A;  2X4J A;  1VQ7 T;  2KDS A;  2GF7 A;  1ZSG A;  2RI3 A;  3KBG A;  4E2F B;  2Z0W A;  1WQW A;  4K11 A;  2PVO B;  2EQM A;  2EGE A;  2W10 A;  5EG2 A;  2D9T A;  3QKJ A;  2LQ8 A;  2C0O A;  3LX7 A;  5GAN 6;  2JMA A;  5LJ5 h;  1M3C A;  5CKB A;  2J7I A;  3SB2 A;  3G6E Q;  4Y28 E;  3QZ9 B;  3C12 A;  4RCB A;  2VUB A;  4P5N A;  4X1V A;  1WI7 A;  4F7U B;  2YUO A;  1WHJ A;  2D6F A;  4J7I A;  4L59 A;  1UEB A;  2DO3 A;  1WFW A;  4M77 G;  1W70 A;  4GY5 A;  1VQ4 Q;  2MAM A;  3CXC S;  3G6E T;  4IUT A;  1W6X A;  5I2S A;  3R6N A;  1AWO A;  5KYX B;  2X51 A;  2Y4Y A;  4HXJ A;  2F2X A;  2EWN A;  2ROL A;  4ZTF A;  3MEV A;  2F5T X;  1N5Z A;  1ABO A;  2G3R A;  1VQ4 T;  1YI2 A;  1TG0 A;  1Y0M A;  5FU6 B;  1IO6 A;  4UC4 A;  3EGX B;  3A1P A;  4C92 G;  4J9B A;  2F5K A;  2CP2 A;  3MP1 A;  2F2W A;  5KYW A;  2VXF A;  4M78 D;  5GAN e;  3ASK A;  3S3M A;  1VQM Q;  5LJ5 e;  1PRL C;  1KIK A;  2YLC A;  2FHD A;  1G83 A;  2IPO B;  2EJG A;  2KBT A;  4M78 A;  5CIU A;  1LPL A;  4ELY C;  3CCE Q;  2D8H A;  4XTV A;  1RL2 A;  1RAI B;  2BZX A;  1VIE A;  5DM7 R;  4JUV A;  1K8A C;  3CCU T;  5DY9 A;  2CYZ B;  2ZPH B;  4JS5 A;  2E3H A;  5CQY A;  4XTY A;  3OYJ A;  3TRE A;  2LT4 A;  3CCE T;  1JBM A;  4J9H A;  3HFN A;  4QT7 A;  4BDY A;  2DZC A;  4N4H A;  4M7A G;  1GFD A;  1YP5 A;  3G71 A;  3H0F A;  3UWN A;  1VQK Q;  5LJ3 f;  3E1S A;  2KRN A;  3AHU A;  2ESW A;  3MEA A;  8AT1 B;  5D6W A;  2VC8 A;  3CPW S;  3JRZ A;  1BCM A;  2VYT A;  4PFZ A;  1VQK T;  2O4X A;  1K9M C;  1WJR A;  1M1K C;  1NEG A;  3A8O B;  1BIA A;  4EMK B;  3CC7 A;  3RKW A;  2CDT A;  5GAN d;  1S72 Q;  3JCM W;  4F7U E;  3M55 A;  5FU6 C;  5LJ5 d;  3L2W A;  5IT9 E;  4J83 A;  2NUT A;  2DL7 A;  2EGA A;  2EYY A;  2RI2 A;  2V8I A;  2DET A;  1K73 C;  2DPP B;  2MPX C;  1BKB A;  3CD6 A;  1GL5 A;  3JCM V;  1S72 T;  1WX6 A;  3JCM c;  3PIO A;  3V8L A;  2RJC A;  3NTI A;  2RJD A;  4BAC A;  4LD9 K;  4QQD A;  2F2V A;  4J7F A;  1W2B A;  1RAD B;  2KVQ G;  3JB9 G;  2ZAE A;  2ENM A;  1JU5 C;  1MV0 B;  2F69 A;  3WVE B;  4WF2 A;  1YBY A;  5GAM f;  3VYH B;  4XU0 A;  1KD1 R;  2LQN A;  2DIG A;  1HK9 A;  3BDU A;  1MMA A;  1ZSZ A;  3OMG A;  1VQN A;  3EG0 A;  5HK0 A;  3OS5 A;  4LD6 A;  4MDX A;  2K3X A;  4EPC A;  2CS7 A;  1YFN A;  2WSC E;  1A0N B;  1UGR B;  2PVD B;  2J05 A;  2E12 A;  1M30 A;  4XU2 A;  4HT9 A;  2OX7 A;  4DQ2 A;  4IIM A;  4M4Z A;  5FW9 A;  3OY9 A;  1FX7 A;  2FRW A;  3UDC A;  4C92 B;  1XNI A;  2JM8 A;  2PU9 B;  4Q5W A;  4TVR A;  3CCM Q;  5HCK A;  1YJN A;  3D7S B;  1WQ7 A;  1XQH A;  5AYF A;  3UT1 A;  2FL7 A;  1Q7Y R;  3CCV A;  1VQO A;  3GBQ A;  4EMK C;  2BUD A;  2RQU A;  5LL6 S;  2KR3 A;  3LYI A;  3GPL A;  1G5V A;  2RF0 A;  3QYH B;  4D6W A;  1IGU A;  1JEG A;  1SSH A;  1E6H A;  1SF9 A;  1UHF A;  4DBQ A;  4O5V A;  2KQW A;  3VKI A;  4M7A B;  1VQ9 Q;  3CXC P;  4E7H A;  2LP5 A;  5GMK l;  1C0M A;  1OI1 A;  2CZ6 B;  3E19 A;  4QQG A;  3RNJ A;  3HPW A;  3I5S A;  4OMN A;  1GXI E;  3BDL A;  3JV3 A;  5KYY A;  1VQ9 T;  1KQS P;  4M77 C;  2L89 A;  1QP2 A;  1RLQ C;  3GF5 A;  3EGU A;  2MMP A;  2GGR A;  2X3X D;  3QO3 A;  2LMJ A;  2K6D A;  1X2K A;  1QLY A;  2E70 A;  4F16 A;  5CVI A;  1RLP C;  4KGX B;  4GLK A;  4HVV A;  4C5H A;  3O8V A;  3C94 A;  3RIR A;  3VUZ A;  3I56 T;  4DA4 A;  4C92 C;  2DFU A;  4KUL A;  2RA2 A;  1I81 A;  2K5F A;  4FW2 A;  1JJ2 S;  3LH0 A;  3MKD A;  2M51 A;  4MMK A;  3M4G A;  4JDS A;  2IIM A;  4ANJ A;  2SRC A;  5GAN 3;  1NE8 A;  3QZ5 B;  1ZUU A;  1YWP A;  1YIT T;  2V26 A;  2DL5 A;  1KHI A;  3A8M B;  1GFC A;  2YRV A;  3OYA A;  1RI0 A;  3M53 A;  2VKN A;  3CCS T;  2LNV A;  5IXB A;  4XAX B;  3X28 B;  1WHL A;  3R6O A;  1TUC A;  1HSQ A;  2XDP A;  5IHK A;  4IUQ A;  1BI1 A;  1WXU A;  2G6F X;  2ZPG B;  3RDV A;  4OML A;  2WSF E;  4QVC A;  4M7A C;  4FSS A;  2VGM A;  3CC4 A;  3EGD B;  1H3Z A;  2ECZ A;  1M90 R;  4BY6 B;  1KHC A;  4IKF A;  3OW2 S;  1ZX6 A;  2RJF A;  4M78 G;  4C5E A;  3BFM A;  3UF4 A;  2K2V A;  2QAS A;  4ME7 A;  4Z02 A;  3OS0 A;  1AZG B;  4OMM A;  3MO8 A;  1ZBJ A;  3RBB B;  3GP8 A;  1VQ8 Q;  2RK2 A;  2M0O A;  1IGQ A;  1UJ0 A;  2EYX A;  1MHN A;  1TS9 A;  2YDL A;  3LWH A;  1VQ5 A;  3CEY A;  4XTZ A;  1VQP A;  2VV5 A;  4QKU A;  3OYB A;  2DL3 A;  1UJY A;  2PZ1 A;  5LJ5 g;  1RAC B;  2OAU A;  1Q95 G;  4FT4 A;  4JRK A;  2DTI A;  2CZ0 B;  1D0X A;  2ATC B;  3CCR A;  1X2Q A;  3G4S A;  4E7I A;  1JB0 E;  1YHQ Q;  4M75 C;  3M0U A;  2ZCF B;  1RAB B;  3N5B B;  3RMQ A;  1S1N A;  4RTW A;  2JOY A;  4C5I A;  2DX1 A;  4C0F A;  2FZC B;  2MI6 A;  3OYY A;  3L2R A;  2CSQ A;  1QMC A;  4RTZ A;  1K4U S;  2M9U A;  1GBQ A;  1YHQ T;  5L23 A;  2XHC A;  2EAY A;  1QKW A;  2HMA A;  1NJI R;  1D3B A;  3EHQ A;  2DJQ A;  4C8Q F;  3F70 A;  2DMO A;  3JCM e;  2HQE A;  3VS5 A;  3CC2 A;  4J9F A;  1NYG A;  1O75 A;  4J9G A;  1M8M A;  1TUG B;  2KGT A;  5FWC A;  4N4I A;  2QA4 A;  1D1A A;  2OTL A;  4M75 D;  4JJD A;  4MDW A;  3VJP A;  4BY6 C;  3CMA A;  1KQ1 A;  4VUB A;  2NUZ A;  3VS2 A;  4FU6 A;  1Q81 C;  4IUV A;  3A98 A;  3L2Q A;  2DNU A;  3HRS A;  4PJO F;  1UB4 A;  4GBQ A;  3CCL Q;  3UAT A;  2AKK A;  1BYM A;  1WLP B;  5GAN j;  5IAY A;  2AK5 A;  5LJ5 j;  1OPL A;  1QVG A;  2QEX Q;  1C6V X;  4C8Q D;  5A2Q E;  1VQL Q;  2LQK A;  3INZ A;  2DEQ A;  3SWN A;  4BI3 A;  2MK5 A;  2A0F B;  2AIR B;  2WSE E;  4C8Q A;  5ECA A;  1B3Q A;  4NL2 A;  5CK9 A;  1M3B A;  3A8L B;  2QEX T;  1VQL T;  1BI0 A;  3PMI A;  1TTH B;  5HK3 A;  2I2L A;  1YNZ A;  2XI9 A;  3G6E A;  4PJO D;  1IRE B;  2K3B A;  4B9W A;  9ATC B;  2YSQ A;  1HD3 A;  3JCM d;  2COW A;  3BE3 A;  4M7D F;  4PJO A;  4M78 B;  1ZLM A;  2E6Z A;  1VQ4 A;  4M7D E;  1VUB A;  4LUD A;  1H8K A;  1M3A A;  2LDM A;  4J9E A;  4JRI A;  2FB7 A;  2NUP B;  2L5Q A;  4D8K A;  3X20 B;  4ORZ A;  1QVG S;  4PFP A;  1M4Z A;  1TUD A;  4AFZ C;  3QWY A;  1N8R C;  2RHU A;  3QWX X;  2KT8 A;  2C0T A;  1UGV A;  2X3W D;  3O5Z A;  2LX9 A;  4FL6 A;  2GQV A;  4JJB A;  1VQM A;  4E7S A;  3VV0 A;  2BTT A;  3NHN A;  3QDR B;  2XKO C;  1JQQ A;  3CCE A;  1VQ7 Q;  2JTE A;  3SDZ A;  1BBZ A;  2RO0 A;  4J9I A;  1HJD A;  2DIL A;  3LGF A;  1B34 A;  1X69 A;  2GCX A;  4Z89 A;  1YJW T;  3URG A;  3SFM A;  4LXC A;  1JXO A;  3A8G B;  4HCZ A;  2LJ1 A;  2X9H A;  4JJC A;  1EIF A;  3HKS A;  2JMC A;  3JB9 H;  4MZT A;  1Y71 A;  4ELZ C;  3H9N A;  4NOY A;  2DER A;  2KXD A;  2NUT B;  4RMO A;  5GAN h;  1BCO A;  1UGQ B;  4IIO A;  4AG2 C;  1KQS A;  1VQK A;  3PTA A;  2CH4 A;  2A37 A;  3E2U A;  3GIB A;  1QVP A;  5GAN 5;  2JTF A;  2IVW A;  1FMV A;  4L5G A;  1U3O A;  2V1Q A;  1RAF B;  4M78 C;  3CCJ Q;  3RR6 A;  3TQ7 P;  2DXB A;  2L8D A;  3Q1J A;  2DK3 A;  1Q86 R;  1Y96 A;  1LNX A;  2DVE A;  3A8H B;  2HAX A;  3MEW A;  4BE0 A;  3OYH A;  1RAA B;  3CCJ T;  1S72 A;  1K73 R;  4V2S A;  2V8J A;  1YIJ T;  5IXF A;  2AKL A;  4EMH A;  5GAO n;  3M54 A;  5I21 A;  3HSB A;  3CCU Q;  4BE2 A;  1M8V A;  3M5A A;  2LVM A;  2RNA A;  3FJ5 A;  5GAO q;  3V7S A;  4QVZ A;  3OBY A;  4OB3 B;  1X6G A;  3I55 T;  2OAW A;  2O31 A;  7AT1 B;  3NTK A;  3EFS A;  3NPF A;  2QDY B;  4EIK A;  2EQU A;  3V8J A;  3LWI A;  1QVF A;  1N9S A;  4E7J A;  2KRM A;  2JT4 A;  4LUE A;  3LGL A;  4R56 A;  2DXT A;  4OMF B;  2QAZ A;  5FU7 C;  4LN2 A;  2LC4 A;  5CKH A;  5KYU A;  3OYG A;  1BI2 A;  3NFC A;  3DLL A;  1T0H A;  5IHN A;  3OS2 A;  1Q7Y U;  3EHR A;  1H64 1;  2O9V A;  3CCM A;  4C0G A;  1PD1 A;  3HFO A;  1SSF A;  2GBQ A;  4R0K A;  1X27 A;  2H8H A;  5DLQ E;  1IHV A;  4HCC A;  2QQB A;  1AWW A;  4FYW B;  1UG1 A;  1ZSZ C;  3X25 B;  3JCM Q;  3EG9 A;  1NG2 A;  4F7U F;  1WHM A;  5LJ3 e;  4CRI A;  1XTD A;  2HQH A;  5KYN A;  5J39 A;  1MND A;  3PNW C;  1QVF S;  2P0Q A;  3S3O A;  1QQJ A;  1OQK A;  4PKC C;  5D7U A;  2RQT A;  3VS7 A;  1VQ9 A;  1T3S A;  2YUN A;  4KT0 E;  1H92 A;  2QQS A;  2EKO A;  4M75 G;  2L3P A;  2ZPB B;  5GAN 8;  5CCA A;  4CC3 A;  4A4K A;  1WHG A;  3SHW A;  4ATO A;  4M77 B;  2DF6 A;  4WTO B;  3JCM g;  3OYN A;  2E10 A;  3VU3 C;  1G3T A;  1LCK A;  1OPK A;  4A4H A;  4F7U A;  5HKC A;  1RAH B;  3E9F A;  2L3S A;  4J8O A;  4RTU A;  2K57 A;  5FWB A;  2A28 A;  3OQ5 A;  2HZY A;  2NWM A;  4C8Q G;  1IHW A;  1UTI A;  3M4Y A;  5CQX A;  5GAM e;  1TWB A;  3WVD B;  1WXB A;  3J7A F;  5GAO l;  5GAN 7;  3M0S A;  2PUO B;  4JZ4 A;  2JUF A;  1MUZ A;  1VQ6 Q;  3JB9 J;  2NYS A;  2FRY A;  1Q81 U;  1OU8 A;  5LJ3 d;  2GTJ A;  2M16 A;  2ZPF B;  4L6V 5;  1KSW A;  2QTX A;  1SRM A;  1ZUY A;  1VQ6 T;  1W2B S;  4RTX A;  6AT1 B;  1XOV A;  3CME Q;  1NZ9 A;  1JRI A;  2ZGW A;  1M1F A;  3P8H A;  5FLX E;  2Y90 A;  2DTH A;  1N27 A;  1AOJ A;  4LDW A;  3G71 T;  3HHT B;  1D0Y A;  1WJS A;  4OGC A;  1NPP A;  3S3N A;  1F1B B;  3CQT A;  3UPU A;  4MZM A;  3CME T;  1K0S A;  4KUI A;  2PTK A;  2Y4X A;  2QYZ A;  1OUL A;  1D1B A;  3P8B B;  1WJQ A;  2LCL A;  2EYQ A;  3KFV A;  3TSW A;  1G2B A;  2EQK A;  2P4R A;  1WPY A;  2X35 A;  2QTV A;  1KG1 A;  1EZZ B;  3EH1 A;  2CZ7 B;  2GFA A;  1I1J A;  3JAM E;  3LH5 A;  4RTV A;  1Y7X A;  3LW5 E;  5GAM d;  3I56 Q;  1VQ8 A;  1Q82 R;  3H6Z A;  2VVK A;  4OMQ A;  3FRN A;  2K5I A;  4OGE A;  3QJY A;  1OZ2 A;  2F1L A;  3JCM P;  2DVJ A;  2RQR A;  3PVQ A;  1ABQ A;  1N8R U;  4M77 E;  2CP6 A;  1VQN Q;  2EBP A;  2HD0 A;  3PMT A;  4D8D A;  1OU9 A;  4Z88 A;  1YIT Q;  1KD1 C;  1C1A A;  1YCY A;  3QXE B;  4J9D A;  1E7O A;  3TU4 K;  2RQW A;  4DOV A;  5GMK m;  3HP9 A;  5M9O A;  1YHQ A;  3CCS Q;  2H3E B;  3MEU A;  2RHZ A;  4XU1 A;  4A4F A;  1R77 A;  1ZA2 B;  1VQN T;  2ED0 A;  3HRU A;  1WYX A;  3I35 A;  4M75 B;  4C92 E;  3OYL A;  1HYO A;  2DIQ A;  3MHX A;  5GMK i;  2DXU A;  2SEM A;  3E9G A;  4JS4 A;  3QII A;  2E1H A;  1Y57 A;  2DJZ A;  2FO0 A;  4HVU A;  2KYB A;  2YUP A;  3H0I A;  3QHS A;  5IH2 A;  2RHI A;  3I5R A;  2YLB A;  4NS5 A;  4X9D A;  1U5S A;  1GCQ A;  4J5Y A;  2E6N A;  4AG1 C;  3JCM J;  1PM3 A;  2O9S A;  3SWN B;  5D6X A;  4N0A A;  3CPW P;  4C8Q B;  2YUQ A;  2JVV A;  2V8K A;  1Q7Y C;  2EIF A;  4OVA A;  2KYM A;  1KC8 R;  2K4Y A;  1SHG A;  2PUK B;  3S6W A;  2K3Y A;  4AFQ C;  1OEB A;  2DYI A;  3CCV T;  4MZP A;  1AD5 A;  4M7A F;  4XTX A;  2EYW A;  4B6M A;  1PHT A;  3CCL A;  1I5O B;  4AT1 B;  4M7A E;  1K76 A;  2KAF A;  2MOX A;  2L3R A;  3OYI A;  2QEX A;  3M0Q A;  5IHI A;  1WDX A;  1VQL A;  1U06 A;  2J6F A;  2C0I A;  3JCM h;  4ZN1 A;  3P8D A;  2CT3 A;  2LCS A;  5GAN g;  4XK8 E;  2PNI A;  2E41 A;  3EG2 A;  4RG8 A;  3MCA B;  1UGP B;  1I0C A;  4KH0 B;  2R5M A;  4B9X A;  3ULR B;  1QP3 A;  3OYF A;  1UGS B;  3OYD A;  3J80 E;  1U1T A;  5J26 A;  2RMO A;  1GRI A;  2FZG B;  4FM4 B;  1UE9 A;  3QSU A;  3VRZ A;  2LJ0 A;  2JN0 A;  2XIC A;  5KCO A;  1LVK A;  2XG8 D;  2PVG B;  1OYX A;  2XID A;  1CSK A;  3KXT A;  2RB6 A;  3JB9 F;  1QCF A;  2EFI A;  3SWN C;  3V7R A;  3SD4 A;  4C8Q C;  2DL8 A;  1IB8 A;  5KCH A;  1Y07 A;  2E3I A;  1XJW B;  3EAE A;  5L8R E;  2DBK A;  2FPF A;  4DEY A;  3ZL7 C;  1PRM C;  3ER0 A;  2MWO A;  3EFR A;  1BB9 A;  1ACM B;  1E6G A;  2DE0 X;  1RAE B;  2CUD A;  4A4E A;  3JCM X;  2DKG A;  1QWE A;  1WXT A;  1VQ7 A;  3H8Z A;  2CKK A;  1MV3 A;  1X6B A;  1V1C A;  4PJO C;  3DB3 A;  2JNG A;  2K9G A;  4FYY B;  1W1F A;  1EX4 A;  3OB9 A;  4ESR A;  1VYV A;  3JB9 D;  2QG9 B;  2QK0 A;  5HY6 A;  3EFO A;  4IUP A;  2H3J A;  1M2V A;  2LTO A;  4RG2 A;  4HCB A;  2BKD N;  1KK7 A;  2D1X A;  4PK4 A;  3BY7 A;  3CC4 T;  1M90 C;  2ZPI B;  2HNI A;  5CAI A;  3OSV A;  2L3Q A;  2RHY A;  4Z8A A;  3WXM B;  4E47 A;  1SG5 A;  4A53 A;  1WIE A;  2DL4 A;  5I22 A;  1IRX A;  5GMK e;  1Q86 U;  5CKE A;  2KI7 A;  3ZFJ A;  2MIO A;  5KYW B;  2DLP A;  4PJM A;  3VYG A;  3MET A;  1D09 B;  1FWZ A;  3KUF A;  1Z9Q A;  3CCQ Q;  5GJW B;  4XQ3 A;  4XTW A;  2QGF B;  1ZHI A;  2EVR A;  4DBR A;  2BE7 D;  4C0D C;  3PIP A;  1JJ2 P;  3ZEH A;  3CCQ T;  2KRS A;  3UA7 A;  1MMG A;  1M9S A;  3GOX A;  5GAM g;  2CZ1 B;  3RUX A;  1V76 A;  3PT9 A;  4BD3 A;  3PFS A;  5C0M A;  5FRN A;  1TU0 B;  1M27 C;  1M2O A;  3JSC A;  5LJ3 j;  3L2V A;  5KYU B;  4ZTJ A;  3CCU A;  2OTJ Q;  2D0Q B;  3L2U A;  2AZS A;  1YJW Q;  4M7D D;  1R8O B;  2E65 A;  1K8A R;  4A63 B;  1PNJ A;  2AT1 B;  5D6Y A;  1NJI C;  2M0Y A;  1PKT A;  1OV3 A;  2YRD A;  5CKD A;  3M0T A;  4M7D A;  4JRQ A;  2D0N A;  2OTJ T;  2HL3 A;  1AHJ B;  2HCK A;  2DRM A;  3TEE A;  1VA7 A;  2CP3 A;  1UDL A;  5KE3 A;  3VUB A;  2CSI A;  1X6O A;  3PVL A;  5A0L A;  3CC2 T;  1SHF A;  2O4X B;  2KXC A;  2ROT A;  3CXC A;  4KBM B;  3CPF A;  3OW2 P;  2OTL T;  2CUB A;  3QPH A;  2KE9 A;  1AZE A;  2CP7 A;  2VXE A;  5FU7 B;  2JS0 A;  1ZBX A;  2RPN A;  4QW2 A;  4QQ6 A;  1ZUK A;  4EDU A;  3RMS A;  3VS0 A;  2E4H A;  2X4X A;  2JTM A;  2QQ9 A;  3M57 A;  2HQX A;  4II1 A;  5GAM j;  3OBW A;  4N4G A;  1K9M R;  5CR2 A;  1QCO A;  1M1K R;  4BI4 A;  2JS2 A;  2DXC A;  1YJ9 Q;  1YIJ Q;  4AMC A;  2YT6 A;  3HL8 A;  5EC7 A;  2VB6 A;  1ZSZ B;  4FYX B;  1PSF A;  4M78 F;  1G3S A;  2D8J A;  4HCK A;  1V29 B;  3OMC A;  4J9C A;  2HKN A;  2K79 A;  4M78 E;  1NYF A;  1YJ9 T;  4HVW A;  4PNO A;  1M1G A;  1JO8 A;  5C6S A;  3M0P A;  3IQL A;  2O01 E;  3L1A A;  3AT1 B;  4X9C A;  3C4S A;  2LQW A;  3BW1 A;  3EG1 A;  4FIB A;  3I55 Q;  5GAN f;  1OOT A;  1KD1 U;  2RK1 A;  2B86 A;  3PE0 A;  5LJ5 f;  2ED1 A;  4YTL A;  3QYG B;  3M9Q A;  1PG5 B;  3EG3 A;  3CBM A;  1KQS S;  4O6J A;  2XK0 A;  4RUG A;  1SEM A;  1ZQ1 A;  5LJ3 h;  1N6A A;  1BU1 A;  3CPW A;  2EJ9 A;  2EW3 A;  4F17 A;  4PFO A;  1PC0 A;  1PD0 A;  3CBO A;  3V7C A;  2QXF A;  1VQM T;  2KT1 A;  1BK2 A;  3TVT A;  2R58 A;  1AWJ A;  1NBE B;  3EH2 A;  2CP0 A;  1IZ6 A;  2NUP A;  1VQ6 A;  4LDU A;  2B8A A;  2LZ6 B;  3PGG A;  2DEU A;  3OA6 A;  4AFU C;  2K7A A;  2DD4 A;  1UFF A;  4LDV A;  2HSP A;  4XTU A;  4E7Z A;  5KYY B;  2J6K A;  3GNF B;  3X24 B;  1SKU B;  3CME A;  5I2M A;  4BDZ A;  4WCI A;  1FYN A;  1QKX A;  4KRT A;  1AT1 B;  3NMZ C;  2CRE A;  1WHK A;  4RKU E;  2GQI A;  2CH4 W;  4C0Z A;  1AVZ C;  5GAM h;  3RKY A;  1I4K 1;  2ABL A;  3VRY A;  2EQJ A;  4IUU A;  2CT4 A;  4KH1 B;  2EKH A;  1Q86 C;  2VGN A;  1RI9 A;  2X4W A;  2FPE A;  3A5Z B;  4C5G A;  1QCN A;  3TSZ A;  1YI2 Q;  1Q82 U;  1NLP C;  4DBF A;  1QVG P;  1U1S A;  2X4Y A;  2QGG A;  3NTH A;  3I56 A;  4F04 B;  1YI2 T;  4KUD K;  1G3W A;  2HKQ B;  2JZ2 A;  3REB B;  1G8X A;  1TH7 A;  1T0J A;  3UA6 A;  5KYX A;  2ZZD A;  3RES A;  3H0H A;  1YIT A;  2BE9 B;  4QVD A;  2V1R A;  4OB1 B;  1NM7 A;  2DAQ A;  3EGX A;  3M0R A;  2HBW A;  1WA7 A;  3CCS A;  3M56 A;  2JM9 A;  1X01 A;  2L2P A;  3FDR A;  2OI3 A;  3FLG A;  1PCX A;  2GTO A;  1K9A A;  4PJO G;  3JB9 I;  4LNP A;  5J3B A;  3G71 Q;  1FMW A;  1JXM A;  2P0P A;  1D1C A;  4PJL A;  2DD5 A;  3RKX A;  1KFZ A;  1CKA A;  2A08 A;  2LJ3 A;  1RAG B;  3HTR A;  1O9S A;  2K2M A;  4ZNX A;  3OYE A;  4BE1 A;  2QQR A;  2E64 A;  3ME9 A;  1KC8 U;  1M90 U;  2HBP A;  4EMG A;  5CO7 A;  2KEA A;  2M1H A;  4JPB W;  2COZ A;  3CCM T;  1YWO A;  1B7T A;  2AHJ B;  5GAO m;  2EGC A;  3DB4 A;  3CC7 Q;  4ZGJ B;  4X34 A;  1FXX A;  3VS6 A;  3X26 B;  1JJ2 A;  2KRO A;  2YWW A;  4PLI A;  2KY9 A;  1GCP A;  2WAC A;  4PL6 A;  4JRP A;  3LLR A;  3U23 A;  3OS1 A;  1CKB A;  4NL3 A;  3CD6 Q;  3CC7 T;  8ATC B;  4M7D G;  2VWF A;  1ARK A;  1BI3 A;  2GNC A;  3MJX A;  3H41 A;  3CD6 T; 
#chains in the Genus database with same CATH homology
 2GCX A;  2RB6 A;  2VYT A;  1VQK T;  3JB9 F;  1YJW T;  4M77 F;  3URG A;  1D3B B;  3SFM A;  1DJ7 B;  2O4X A;  1K9M C;  1WJR A;  2EFI A;  3A8G B;  4HCZ A;  3SWN C;  3V7R A;  3L2Z A;  1M1K C;  3A8O B;  3SD4 A;  4HA8 A;  1BIA A;  4N0A C;  4C8Q C;  4EMK B;  3RKW A;  4A54 A;  4EMK A;  2RJE A;  5GAN d;  3CC7 A;  3QBY A;  5KCH A;  3JCM W;  1Y07 A;  4F7U E;  3M55 A;  3EAE A;  5FU6 C;  1EIF A;  2RI5 A;  3HKS A;  5LJ5 d;  3L2W A;  5IT9 E;  4MZT A;  5L8R E;  1Y71 A;  5A0D A;  2CGH A;  3JB9 H;  4ELZ C;  4E7K A;  4J83 A;  2MF2 A;  4NOY A;  3ER0 A;  2MWO A;  3QUI A;  2V8I A;  3EFR A;  2RI2 A;  4RMO A;  1WGS A;  5GAN h;  2KK4 A;  4C92 F;  2DPP B;  1K73 C;  1BKB A;  2A3L A;  3GNG A;  4A4E A;  1UGQ B;  3CD6 A;  1KQS A;  1NJI U;  1VQK A;  3PTA A;  3JCM V;  3JCM X;  1S72 T;  3TCJ A;  5GAO p;  2DKG A;  5CKF A;  3JCM c;  3GIB A;  1QVP A;  5GAN 5;  2JTF A;  2IVW A;  3PIO A;  3V8L A;  1VQ7 A;  3H8Z A;  2CKK A;  2RJC A;  3NTI A;  4L5G A;  1LJO A;  2RJD A;  5GMK j;  3OW2 A;  4BAC A;  4M78 C;  4LD9 K;  4PJO C;  3DB3 A;  2JNG A;  5GAN 4;  2DXB A;  2L8D A;  4OB2 B;  4PLL A;  4J7F A;  2FVU A;  4QQD A;  1W2B A;  3OB9 A;  2DK3 A;  3Q1J A;  2KVQ G;  3JB9 G;  3JB9 D;  1Y96 A;  2PQW A;  4M77 D;  5HY6 A;  3DLM A;  2F69 A;  1LNX A;  3WVE B;  2DVE A;  3A8H B;  1YBY A;  4WF2 A;  3VYH B;  4IUP A;  2H3J A;  3MEW A;  4XU0 A;  5GAM f;  2LTO A;  2DIG A;  4RG2 A;  4BE0 A;  2BKD N;  1HK9 A;  3BDU A;  3G7Z A;  3OYH A;  4HCB A;  3OMG A;  1VQN A;  5HK0 A;  3OS5 A;  4LD6 A;  4M77 A;  3CCJ T;  2K3X A;  3BY7 A;  2C06 A;  4MDX A;  1S72 A;  4EPC A;  2CS7 A;  3CC4 T;  1M90 C;  2ZPI B;  2WSC E;  3OYM A;  2HNI A;  4E7L A;  1UGR B;  2PVD B;  4V2S A;  5CAI A;  2E12 A;  1YJN T;  3OSV A;  2RHY A;  4E47 A;  3WXM B;  2V8J A;  4XU2 A;  4HT9 A;  1YIJ T;  4DQ2 A;  1W4S A;  4C92 D;  4A53 A;  5GMK e;  1Q86 U;  5CKE A;  3FB9 A;  3OY9 A;  3ZFJ A;  3OSS C;  5KE2 A;  4EMH A;  5GAO n;  1FX7 A;  3UDC A;  1BIB A;  1VQO T;  2R5A A;  3M54 A;  3VYG A;  4C92 A;  3MET A;  5I21 A;  3HSB A;  4C92 B;  1XNI A;  2IG0 A;  4BE2 A;  2PU9 B;  1FWZ A;  3KUF A;  4OP0 A;  1M8V A;  4DOW A;  4Q5W A;  4TVR A;  4XQ3 A;  4XTW A;  1ZHI A;  2LVM A;  3M5A A;  3QJ6 A;  4CI0 C;  5GAO q;  4PJO B;  2KMT A;  3V7S A;  1YJN A;  4QVZ A;  4J6W A;  3OBY A;  4OB3 B;  1LOJ A;  1WQ7 A;  2QQA A;  4C0D C;  3I55 T;  5DLO A;  3PIP A;  1XQH A;  3NTK A;  4BI8 B;  3EFS A;  3ZEH A;  2QDY B;  5AYF A;  3UT1 A;  2FL7 A;  4BUG A;  2BIV A;  2EQU A;  3V8J A;  3CCQ T;  1M9S A;  4ZGD B;  2QI2 A;  1P92 A;  3CCV A;  3LWI A;  5GAM g;  3GOX A;  1QVF A;  2CZ1 B;  1VQO A;  2LT1 A;  3RUX A;  4EMK C;  1N9S A;  2LRQ A;  3PT9 A;  4E7J A;  2BUD A;  2XU8 A;  5LL6 S;  4FSX A;  3LYI A;  4HKE A;  3LGL A;  3PFS A;  4BD3 A;  4R56 A;  3GPL A;  5C0M A;  5FRN A;  3CD6 T;  1G5V A;  1G3Y A;  3QYH B;  2DXT A;  2K5L A;  4OMF B;  4D6W A;  3JSC A;  1QW1 A;  5FU7 C;  2LC4 A;  2YHT A;  5LJ3 j;  3FJP A;  1I5L A;  4M7A D;  5CKH A;  3OYG A;  1BI2 A;  3L2V A;  3NFC A;  3DLL A;  3FC3 A;  2E5Q A;  3CCU A;  4ZTJ A;  3OS2 A;  2D0Q B;  4O5V A;  1H64 1;  3L2U A;  2KQW A;  3CCQ A;  1Q7Y U;  1Q82 C;  2XD0 A;  4R55 A;  3GLX A;  3CCM A;  4XU3 A;  4M7D D;  4C0G A;  4M7A A;  1R8O B;  2E65 A;  3VKI A;  1VQ8 T;  4M7A B;  3HFO A;  5D6Y A;  4E7H A;  5GMK l;  1SSF A;  1NJI C;  4MML A;  4Y91 A;  1PSE A;  5CKD A;  1OI1 A;  2CZ6 B;  4M7D A;  4C0D B;  4JRQ A;  4M7D B;  3E19 A;  2OTJ T;  5DLQ E;  4QQG A;  3M59 A;  1AHJ B;  1X75 C;  3HPW A;  4M75 F;  3TEE A;  5KE3 A;  4HCC A;  4BB7 A;  2QQB A;  3VUB A;  1B34 B;  2XDD A;  3BDL A;  1GXI E;  1X6O A;  3JCM f;  3X25 B;  3JCM Q;  1VQ9 T;  4JLG A;  5A0G A;  4M75 E;  5A0L A;  3CC2 T;  4M77 C;  2L89 A;  5FRM A;  2O4X B;  4F7U F;  3CXC A;  5LJ3 e;  4JLI A;  3J81 E;  1QP2 A;  4CRI A;  1XTD A;  4KBM B;  3GF5 A;  3CPF A;  1I8F A;  2MMP A;  2P0K A;  1K8A U;  2OTL T;  3QPH A;  3QO3 A;  3DKM A;  2RHX A;  3QG1 A;  5J39 A;  5GMK h;  2E70 A;  3PNW C;  4OF1 A;  1QVF S;  5CVI A;  2P0Q A;  2VXE A;  3S3O A;  4GLK A;  3MP8 A;  5FU7 B;  3CBP A;  3O8V A;  4C5H A;  2OTJ A;  4LDX A;  3C94 A;  4PKC C;  1ZBX A;  3RIR A;  3VUZ A;  4QW2 A;  4QQ6 A;  3I56 T;  4DA4 A;  4EDU A;  3RMS A;  4C92 C;  1YJW A;  4KUL A;  2RA2 A;  2X4X A;  1I81 A;  4JJN K;  1VQ9 A;  2JTM A;  2K5F A;  5FRO A;  1JJ2 S;  2QQ9 A;  4C8Q E;  2R57 A;  3M57 A;  3C95 A;  2HQX A;  2QQS A;  3LH0 A;  4KT0 E;  5LJ3 g;  4II1 A;  5GAM j;  3OBW A;  4N4G A;  2EKO A;  5CR2 A;  3OYC A;  4MMK A;  3M4G A;  4M75 G;  4JDS A;  4BI4 A;  2ZPB B;  5GAN 8;  1Y96 B;  5CCA A;  2DXC A;  4A4G A;  5GAN 3;  1NE8 A;  3QZ5 B;  4A4K A;  3HL8 A;  4F7U G;  4M75 A;  3V8K A;  4OB0 B;  3JCM b;  1YIT T;  1WNL A;  4ATO A;  4M77 B;  1KHI A;  1PSF A;  1MGQ A;  2GFU A;  1G3S A;  4M78 F;  3JCM g;  5KH6 A;  2E10 A;  1V29 B;  2LCC A;  3OYN A;  1KC8 C;  3VU3 C;  1G3T A;  3OMC A;  2RH2 A;  3A8M B;  4A4H A;  3ZBD A;  4F7U A;  5HKC A;  2YRV A;  4M78 E;  3OYA A;  1YJ9 T;  1RI0 A;  3E9F A;  4PJO E;  3M53 A;  4J8O A;  3CCS T;  2LNV A;  2K57 A;  4FT2 A;  4XAX B;  4PNO A;  2P4T A;  1M1G A;  3X28 B;  1K9M U;  4RCC A;  2ZPE B;  5C6S A;  1M1K U;  3OQ5 A;  2O01 E;  3L1A A;  3R6O A;  4C8Q G;  4X9C A;  3C4S A;  2XDP A;  4FIB A;  1BI1 A;  3BW1 A;  4IUQ A;  3M4Y A;  5CQX A;  5GAM e;  5GAN f;  3WVD B;  3HRT A;  1KD1 U;  3J7A F;  2RK1 A;  2ZPG B;  5GAO l;  5GAN 7;  3CCL T;  5LJ5 f;  2PUO B;  2WSF E;  4QVC A;  4YTL A;  4M7A C;  3QYG B;  3CCJ A;  2JUF A;  2VGM A;  2DTO A;  3CC4 A;  3JB9 J;  2DZ9 A;  1K73 U;  3M9Q A;  1NPR A;  1H3Z A;  1Q81 U;  5LJ3 d;  3CBM A;  1N9R A;  1KQS S;  4O6J A;  1YJ9 A;  4M7D C;  2M16 A;  2XK0 A;  1YIJ A;  3RER A;  4BY6 B;  2ZPF B;  1VQ5 T;  1KHC A;  1VQP T;  1ZQ1 A;  4IKF A;  4L6V 5;  2FYK A;  3OW2 S;  2A7Y A;  2QTX A;  2RJF A;  4M78 G;  4C5E A;  1VQ6 T;  5LJ3 h;  1N6A A;  3BFM A;  1W2B S;  3CPW A;  2K2V A;  2EJF A;  2MWP A;  1VIF A;  5GAN 2;  4ME7 A;  4Z02 A;  1XOV A;  3OS0 A;  1NZ9 A;  2EJ9 A;  1JRI A;  3MO8 A;  2ZGW A;  1M1F A;  3P8H A;  5FLX E;  3GP8 A;  1U8R A;  2Y90 A;  2DTH A;  2RK2 A;  1N27 A;  2M0O A;  3V7C A;  3CBO A;  3CCR T;  4LDW A;  3G71 T;  2QXF A;  3G4S T;  1MHN A;  3I55 A;  3HHT B;  3LWH A;  1WJS A;  4OGC A;  1NPP A;  1VQM T;  1VQ5 A;  3CEY A;  3S3N A;  2R58 A;  5IN1 A;  2RD1 A;  4XTZ A;  1HXD A;  2VV5 A;  3T9N A;  5GAO r;  3OYB A;  1VQP A;  3UPU A;  4MZM A;  3CME T;  1IZ6 A;  4KUI A;  3M58 A;  3L42 A;  2NLU A;  3FIF A;  4LDU A;  1VQ6 A;  4ZN3 A;  2Y4X A;  2B8A A;  4J6X A;  5LJ5 g;  3P8B B;  1WJQ A;  3PGG A;  2OAU A;  2LCL A;  1M5Q 1;  2EYQ A;  4FT4 A;  4JRK A;  2DTI A;  3OA6 A;  2CZ0 B;  2EQK A;  4J6Y A;  1WPY A;  2XDB A;  2DD4 A;  2X35 A;  3CCR A;  3OYK A;  1KG1 A;  4ZGE B;  3G4S A;  2CZ7 B;  2GFA A;  4LDV A;  4XTU A;  4E7I A;  1JB0 E;  4HT8 A;  4M75 C;  3JAM E;  3X24 B;  3GNF B;  2ZCF B;  3FEO A;  2RM4 A;  1KQ2 A;  3N5B B;  3RMQ A;  3CME A;  1Y7X A;  3LW5 E;  4IUR A;  5I2M A;  3MP6 A;  5GAM d;  4BDZ A;  2JOY A;  4C5I A;  2QA4 T;  4C0F A;  1VQ8 A;  2MI6 A;  3OYY A;  3L2R A;  3H6Z A;  1OZ3 A;  3CMA T;  2M9U A;  4RKU E;  4LDY A;  3FRN A;  1YHQ T;  2KSS A;  2K5I A;  2XHC A;  4OGE A;  4C0Z A;  2EAY A;  5GAM h;  2X4J A;  3RKY A;  3QJY A;  1I4K 1;  1OZ2 A;  2EQJ A;  1D3B A;  3JCM P;  4IUU A;  4C8Q F;  3F70 A;  3JCM e;  2HQE A;  1N8R U;  1VQ7 T;  4M77 E;  1Q86 C;  2VGN A;  3CC2 A;  2X4W A;  2HD0 A;  1O75 A;  2GF7 A;  2KDS A;  3PMT A;  2RI3 A;  3A5Z B;  3KBG A;  1KD1 C;  4C5G A;  4N4I A;  1WQW A;  2QA4 A;  3QXE B;  1YCY A;  3TU4 K;  2OTL A;  4DOV A;  4M75 D;  2PVO B;  2EQM A;  4MDW A;  3VJP A;  3HP9 A;  4BY6 C;  5GMK m;  3CMA A;  1Q82 U;  1KQ1 A;  4VUB A;  5EG2 A;  5M9O A;  2D9T A;  3QKJ A;  4FU6 A;  1YHQ A;  2LQ8 A;  3LX7 A;  3MEU A;  4A4F A;  2RHZ A;  4XU1 A;  5GAN 6;  1U1S A;  1Q81 C;  1VQN T;  2X4Y A;  5LJ5 h;  3HRU A;  3NTH A;  4IUV A;  4M75 B;  3L2Q A;  5CKB A;  4C92 E;  3OYL A;  3SB2 A;  3I56 A;  2DIQ A;  3MHX A;  3HRS A;  4PJO F;  1UB4 A;  4Y28 E;  2DXU A;  5GMK i;  3QZ9 B;  3C12 A;  1YI2 T;  4KUD K;  3E9G A;  4RCB A;  4JS4 A;  3QII A;  1G3W A;  2VUB A;  4P5N A;  4F7U B;  2D6F A;  2E1H A;  1BYM A;  5GAN j;  4J7I A;  2DJZ A;  2JZ2 A;  4L59 A;  1UEB A;  2DO3 A;  5IAY A;  5LJ5 j;  4M77 G;  4GY5 A;  1QVG A;  3QHS A;  2MAM A;  1TH7 A;  4C8Q D;  3CXC S;  2RHI A;  5A2Q E;  3G6E T;  2LQK A;  2YLB A;  4IUT A;  4NS5 A;  5I2S A;  4X9D A;  2ZZD A;  4J5Y A;  3INZ A;  2DEQ A;  2E6N A;  2Y4Y A;  3RES A;  3SWN A;  4BI3 A;  3JCM J;  3SWN B;  2WSE E;  2EWN A;  5D6X A;  4N0A A;  4C8Q A;  4ZTF A;  4C8Q B;  4QVD A;  3MEV A;  1YIT A;  2F5T X;  4NL2 A;  5CK9 A;  3A8L B;  2JVV A;  4OB1 B;  2V8K A;  2G3R A;  2DAQ A;  1VQ4 T;  2QEX T;  2EIF A;  4OVA A;  5FU6 B;  1YI2 A;  1Q7Y C;  4UC4 A;  1VQL T;  1BI0 A;  4C92 G;  3CCS A;  3PMI A;  2K4Y A;  3M56 A;  1X01 A;  2F5K A;  2PUK B;  3S6W A;  3MP1 A;  2K3Y A;  3FDR A;  5HK3 A;  2HAX A;  3FLG A;  2I2L A;  2VXF A;  4MZP A;  3CCV T;  2XI9 A;  4M78 D;  5GAN e;  4PJO G;  3ASK A;  3JB9 I;  5J3B A;  4XTX A;  3G6E A;  4M7A F;  1IRE B;  4PJO D;  3S3M A;  2P0P A;  4B9W A;  5LJ5 e;  3RKX A;  2DD5 A;  3CCL A;  4M7A E;  2YLC A;  2FHD A;  3JCM d;  2EJG A;  4M78 A;  5CIU A;  1O9S A;  4M7D F;  4PJO A;  4M78 B;  3OYE A;  4ELY C;  2KAF A;  4XTV A;  2L3R A;  4BE1 A;  3OYI A;  2E6Z A;  1VQ4 A;  2QEX A;  1RL2 A;  4M7D E;  2QQR A;  1VUB A;  1VIE A;  5DM7 R;  1VQL A;  4JUV A;  2E64 A;  3ME9 A;  1KC8 U;  1K8A C;  3CCU T;  1M90 U;  2HBP A;  3JCM h;  5DY9 A;  2CYZ B;  2ZPH B;  5CO7 A;  4EMG A;  4ZN1 A;  2LDM A;  4JS5 A;  3JRZ A;  2M1H A;  3P8D A;  4JRI A;  3CCM T;  5CQY A;  4XTY A;  2FB7 A;  3TRE A;  5GAN g;  3OYJ A;  2AHJ B;  2L5Q A;  4XK8 E;  2LT4 A;  3CCE T;  1JBM A;  3X20 B;  5GAO m;  1QVG S;  1M4Z A;  3DB4 A;  3HFN A;  2E41 A;  4RG8 A;  3MCA B;  1UGP B;  4ZGJ B;  4X34 A;  1N8R C;  1FXX A;  4BDY A;  2R5M A;  2RHU A;  4B9X A;  2DZC A;  1QP3 A;  3X26 B;  1JJ2 A;  4PLI A;  3OYF A;  1UGS B;  2KY9 A;  4N4H A;  3J80 E;  3OYD A;  4M7A G;  2LX9 A;  2WAC A;  4PL6 A;  4JRP A;  3G71 A;  3LLR A;  1U1T A;  4FL6 A;  2GQV A;  5J26 A;  1VQM A;  4FM4 B;  3OS1 A;  3QSU A;  3UWN A;  4NL3 A;  3VV0 A;  3CC7 T;  4M7D G;  5LJ3 f;  3E1S A;  3QDR B;  2JN0 A;  2XKO C;  2XIC A;  5KCO A;  3CCE A;  1BI3 A;  3AHU A;  3MEA A;  2XG8 D;  2PVG B;  1OYX A;  3SDZ A;  2XID A;  2RO0 A;  5D6W A;  2VC8 A;  3KXT A;  3LGF A;  3CPW S;  1B34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...