3QIIA

Crystal structure of tudor domain 2 of human phd finger protein 20
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
52
structure length
52
Chain Sequence
EFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords PHD finger protein 20
publication title Crystal structures of the Tudor domains of human PHF20 reveal novel structural variations on the Royal Family of proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qiiA00
4BD3A 3UWNA 3NTKA 2GF7A 4C5IA 4E7JA 4QW2A 3L2VA 4PLIA 1SSFA 3MEAA 2PQWA 2DIQA 3OYIA 3OYJA 1OZ2A 3ME9A 5KE2A 4BDYA 3LGLA 5KH6A 2X4XA 4ZTFA 3MEWA 4QQ6A 4E7LA 3MEUA 1XNIA 5D6WA 3LYIA 4E7HA 4C5GA 2X4WA 2EQMA 2XDPA 3L42A 4A4FA 3C4SA 3OB9A 5J26A 2RJFA 2L3RA 5FRNA 3OYHA 2EFIA 2RI5A 2RHXA 2CKKA 4A4EA 4IURA 5FROA 3DLMA 1G5VA 2EQUA 2RI3A 4QVZA 3OYFA 3L2RA 2M0OA 4FL6A 2B8AA 3LH0A 4N4IA 4OVAA 4X34A 2RI2A 4B9WA 2E5QA 2LVMA 2RJDA 2RJCA 3FLGA 5CIUA 3SD4A 5C0MA 3S3OA 3LLRA 4ZTJA 1OZ3A 3GOXA 4IKFA 4EDUA 4B9XA 2IG0A 3QJ6A 5C6SA 2WACA 2MWPA 2LRQA 1OI1A 4N4HA 2DIGA 4BE1A 5D6XA 2X4YA 3BDLA 4GY5A 3OS1A 1MHNA 3OA6A 2L89A 3LGFA 3PMTA 4BE2A 3NTIA 5FRMA 3QBYA 4BDZA 3OYKA 3CEYA 4HCZA 2LTOA 4IUVA 2XK0A 2VYTA 3OS2A 4C5HA 4PL6A 4BACA 2M16A 3META 3E9GA 4N4GA 2G3RA 2R5MA 2M1HA 2HQXA 2JTFA 3MO8A 4RG2A 4C5EA 3KUFA 3H8ZA 3OMCA 2GFAA 3PMIA 3O8VA 3UT1A 2EQKA 2EQJA 3OYMA 3QKJA 3S6WA 4FU6A 3L2QA 4IUTA 3L2UA 4II1A 2YRVA 3FEOA 2BIVA 3P8DA 4UC4A 5IAYA 2R5AA 3OYCA 3Q1JA 4LD6A 5KCHA 1WJQA 3OS0A 2F5KA 3MP1A 2RHIA 5KE3A 2EKOA 4IUUA 3OYNA 3DB4A 2L8DA 2QQSA 2RHZA 4IUQA 2R57A 4QQGA 3H6ZA 4BE0A 1RI0A 4PLLA 2RHUA 2O4XB 3OYDA 3OYEA 3P8HA 3EAEA 3NTHA 5M9OA 2JZ2A 4NS5A 2K3XA 5J39A 3MEVA 3OYAA 5IN1A 3OQ5A 1WJSA 4A4GA 4L59A 3FDRA 3OYBA 3OYLA 2K3YA 3PNWC 3DB3A 3FC3A 3S3NA 4E7KA 1H3ZA 3LX7A 4CRIA 3OMGA 4E7IA 3MP6A 3S3MA 1WJRA 2E6NA 3F70A 2MWOA 4Z02A 3OY9A 2RJEA 2O4XA 2GFUA 3ZEHA 2RO0A 2FHDA 3E9FA 1KHCA 2NLUA 2DAQA 2P0KA 2RHYA 3PFSA 4A4HA 3M9QA 4Q5WA 3OYGA 5D6YA 2D9TA 2LDMA 3ASKA 2BUDA 3QIIA 4IUPA 3MP8A 2BKDN 5KCOA 3L2WA 1OYXA 1N27A 2HQEA 2LCCA 2QQRA 2X35A 1WGSA 4QQDA 2R58A
chains in the Genus database with same CATH superfamily
4XTVA 2CP6A 3NTKA 1KD1U 5GAOn 2F5TX 2JNGA 3MEAA 3CCVA 2RF0A 1KJWA 3BW1A 4ZTFA 2V1QA 3OYYA 2FZGB 4KRTA 3X24B 1RI9A 2EGAA 2QI2A 2KE9A 2F2XA 3G71T 1KG1A 1NYFA 1VA7A 2L3RA 1YCSB 4FIBA 1OU9A 2CUBA 5GAMg 1SRMA 1TOVA 1HXDA 3OYFA 3VYGA 1SF9A 1G3SA 2DLPA 2LNVA 3MJXA 1IHWA 2RI2A 4M77G 2HNIA 1U06A 1WHGA 3KFVA 4R0KA 2YLBA 4RUGA 3EHQA 2ZGWA 2MWPA 2DIGA 5D6XA 2E3HA 4C8QG 1NM7A 2MIOA 1SHFA 4N0AC 2KSSA 2LJ1A 2M16A 2LCSA 1NLPC 1XTDA 2ZZDA 1LVKA 4KT0E 2IPOB 1EFNA 2KT8A 3KUFA 2GFAA 3A8MB 2EQJA 1BYMA 1YI2T 4RTUA 4OMPA 4IUTA 1VQPT 5GJVB 2KMTA 5KYNA 5FW9A 2CP2A 3BFMA 3VRYA 3DB4A 1M1KR 3URGA 1S72Q 1VQKT 2OI3A 2QAZA 1E6GA 1UEBA 2EKHA 2DYBA 3TQ7P 2YUNA 1VQ6T 3NGPA 4CRIA 3CCST 3VU3C 2E5KA 3GPLA 3JCMX 3CPWS 3JCMJ 1MMGA 2D9TA 4OF1A 2I0NA 5IHIA 2LCCA 1VOMA 2QYZA 4ME7A 2COWA 3EG9A 2JM9A 2BE7D 4D8DA 1WDXA 8ATCB 2DL5A 2AKKA 3I55T 4RTZA 2HKNA 2X4XA 3I9QA 4QQ6A 1UGQB 1RAHB 1UG1A 2VGNA 4LNPA 5IHKA 1XOVA 4E7HA 2AHJB 3L42A 2JS2A 1QVFS 3CCQA 5L23A 2GTOA 4C8QC 1MNEA 3QUIA 3G71Q 5GMKj 4ZNXA 2MPXC 1JB0E 4QT7A 4DEXA 2V1RA 1N8RC 2HL5C 1RAFB 4OVAA 4OMQA 1D3BB 4OMOA 2RJCA 2CDTA 1QMCA 2JJ9A 3LLRA 3GOXA 4B9XA 4J7FA 5C6SA 4AFZC 2ZPFB 4BE1A 4M75A 1M27C 3CMAT 3OS1A 5LL6S 3CQTA 3OA6A 1AOJA 2CZ1B 2G6FX 5GANj 2XICA 4LDXA 1N8RR 1YHQA 4M7DC 1QVFA 3CCEA 1I4K1 2E4HA 3UA7A 1ZBXA 2P4RA 3UATA 5IAYA 1YI2Q 1YIJT 4LD6A 2DEQA 3A1PA 2GQIA 1WX6A 2DXBA 4HCBA 1QWFA 1WHJA 1EIFA 1ZX6A 2EPDA 2DL7A 3OYDA 3OYEA 1PSFA 3CXCP 3NTHA 1VQKQ 2K57A 4FT4A 2L0AA 1YCYA 1WHHA 1WJSA 2FZCB 1NPPA 1H92A 3OYLA 1IRXA 4ELYC 2XDDA 5LJ5e 1SG5A 1YBYA 3JCMe 3OMGA 2DTHA 2KRSA 1VYTA 2EJGA 3ER0A 3G6EA 1M5Q1 2P0KA 2KXDA 3J80E 4Q5WA 2KVQG 1QQJA 4JRPA 3DKMA 2EBPA 2ABLA 2BZXA 3C94A 3IQLA 3QYGB 1FYNA 2DVJA 1WZOA 3RERA 3UDCA 1VQ8A 2P0QA 4C8QB 3I55Q 2E12A 3C95A 2RHXA 4JJCA 1WQWA 4PFPA 5FROA 1HJDA 4J6WA 1WHMA 4J9IA 1W70A 2B8AA 4X34A 1M8MA 1UTIA 3FLGA 5C0MA 3I56A 1Q81R 2DXTA 3CC4A 4XU1A 4X1VA 3CCLT 2QASA 1N5ZA 1X2KA 2X4YA 3RKYA 3NTIA 3L2ZA 2QTVA 3CMAQ 2PTKA 2DXCA 3JCMV 1ZA2B 2KY9A 4M7DB 2J6FA 2K5FA 4RG2A 3OMCA 1I1JA 2QEXT 1RAGB 5GAMf 2PZ1A 4PJOE 3HFNA 3M0SA 3QZ5B 1K73C 1AEYA 3Q1JA 4RTTA 1F1BB 2QDLA 3M0TA 1PKTA 1AHJB 5GAN7 3CMEQ 1YIJQ 2QXFA 2FO0A 2LJ0A 3A98A 1D3BA 4M77F 1JO8A 3P8HA 4RTYA 4M75D 1W2BP 2E65A 4N0AA 4C8QF 1K73R 1H3ZA 2ROTA 1B07A 9ATCB 2MWOA 2RO0A 2P84A 3PFSA 2RHYA 2D8HA 4KH0B 2E3IA 1B3QA 1OYXA 3EG1A 1UJYA 3VYHB 2DJZA 2OJ2A 1SKUB 3TU4K 4E7JA 2DRMA 2MAMA 3RNJA 1MMAA 3CPWP 3OYIA 4JJBA 3RMSA 3N5BB 3CCMA 4LUDA 1MV3A 4F17A 1HSQA 2PVOB 1RABB 2W0ZA 4M7DF 2LX9A 1Y7XA 3SWNC 2YRDA 4DA4A 4DBRA 3X20B 5LJ3d 2PU9B 2EGEA 4QVZA 3EG3A 2KDSA 4JS5A 1WLPB 2RQWA 4IKFA 1M90U 1PRLC 1QVGP 5KYUB 3LGFA 2CT4A 2JW4A 4IUVA 2BTTA 2LJ3A 1D0XA 3OBYA 4M75G 4N4GA 2G3RA 4RTVA 1FMKA 3HKSA 3QJYA 3MHXA 2MI6A 1I0CA 3HTRA 3M4YA 1IXDA 2QEXQ 3P8DA 1WJQA 4KBMB 5KE3A 2VUBA 2EKOA 4QQGA 2LQWA 1K73U 1BU1A 2EW3A 4Y92A 4PJMA 1MV0B 1VQMT 2ED0A 1QVPA 2QA4A 4E7KA 4LD9K 2DD5A 2MOXA 3OY9A 3A5ZB 4J5YA 3ZEHA 4M7DA 1U1TA 1YWPA 3EG2A 3HHTB 1M30A 1LCKA 2GCXA 2ZPEB 3L2WA 4C92C 1WGSA 2D0NA 1YWOA 2D8JA 1Y71A 1SHGA 2H3EB 1N9RA 2DFUA 2CP7A 1K76A 4EMKC 1U3OA 4J9EA 5D6WA 3OBWA 4HA8A 4AG1C 3SWNB 2C0IA 4A4FA 1VQ9A 2X51A 5FRNA 2FZKB 2L5QA 5CKHA 1NE8A 1PKSA 3V8LA 1VQ7Q 2K5IA 2C06A 4LUEA 1AVZC 1OPKA 2XIDA 4Z88A 4EMGA 2M0OA 4JZ3A 3L2RA 3LH0A 1GL5A 5CK9A 2FL7A 5GJWB 1M2VA 5CIUA 1KQ2A 1VQ4T 5FWCA 3QYHB 2J7IA 2L89A 2QGGA 2K2MA 4OMFB 1YITT 2LP5A 3HP9A 1NJIU 2XK0A 3TREA 1RL2A 2AT1B 3CC7Q 5GAN3 3VS5A 4E2FB 1RUWA 4HCCA 3T9NA 4FU6A 1U5SA 3GIBA 1Q86U 3OSVA 1ZSGA 4YTLA 1VQ5T 2NYSA 2XU8A 4UC4A 4C0DC 4WTOB 2MK5A 1S72A 2VXFA 1T0HA 2L8DA 4IUQA 1RAAB 3GLXA 8AT1B 3RUXA 2EJ9A 2YRCA 2CREA 2RH2A 3CPFA 1BI1A 2YUPA 1MNDA 1CSKA 4FYWB 2DX1A 3H0FA 2K4YA 4KGZB 5KYUA 1YN8A 1VQMQ 4LXCA 2DEUA 2JOYA 2EYWA 2FPFA 3GNFB 1LNXA 1NLOC 4ZGJB 2XDBA 4C92B 2LDMA 1VQNT 4C8QD 1IGQA 1X43A 1TTHB 3VS3A 2QQRA 1JQQA 1Y57A 5CAIA 1GFCA 2GF7A 2HBPA 1AWXA 1T3SA 3E19A 4CC4B 3L2VA 3M58A 4EMKB 4HT8A 4PLIA 1HD3A 2Y90A 4J6XA 1NPRA 1SSHA 4D6WA 1TH7A 1OZ2A 1ARKA 1W1FA 2DA9A 4C5GA 1Z9QA 1IZ6A 3G71A 2EFIA 2AZVA 2RI5A 3JRZA 1IO6A 2ZPHB 4M7DD 1AT1B 3SD4A 4C0FA 1T0JA 4JPBW 3O5ZA 5LJ5d 3JCMd 2CGHA 2RN8A 5FRMA 1VQ4Q 4GLMA 1WHKA 4CC3A 2DL8A 4JLGA 5I2MA 4O6JA 4M78C 3JCMc 3G7ZA 2D0QB 2O88A 1FMWA 4F14A 2J6OA 3SWNA 2CUDA 3OSSC 1TWBA 4KUDK 4C0DB 2COZA 1YI2A 4RTXA 4PJNA 3CCJT 2KAFA 1VQLT 2F5KA 1G3WA 2ROLA 1VQ5Q 3E1SA 5GANg 1M2OA 1WA7A 1RI0A 1VQKA 1M1KC 4HXJA 4PJOC 1V76A 1KQSP 5IN1A 4HVWA 5CKBA 4QVDA 3S3NA 1R0CB 1V1CA 2HCKA 4FYXB 2SEMA 2E6NA 2RM4A 4JRKA 2EIFA 2M51A 3QZ9B 4M75F 5I21A 2JS0A 2XMFA 3JAME 2A0FB 1AZGB 4QQDA 4M7DG 4QKUA 5GAN6 5GAOl 3P8BB 2K9GA 1NZ9A 1VUBA 4LDUA 3OYJA 2EYQA 4J9BA 3ME9A 2X3XD 1ZSZC 5CVIA 1PC0A 1XNIA 2E41A 1OX8A 1K8AR 4FYYB 1YJNT 2VVKA 2DKGA 1X75C 1WIEA 1OX9A 3M5AA 2KYBA 1WHLA 4PJJA 1G5VA 1OU8A 1UE9A 4Y28E 1UGRB 1H641 4C92A 3OS5A 3M53A 1M9SA 5LJ3g 3CMAA 2QG9B 4M78B 2J05A 5AYFA 4EMKA 2AIRB 1BBZA 3SDZA 3E9GA 4XU3A 1BCOA 3X28B 2JT4A 1BI2A 4ELZC 2JTFA 1V29B 3PMIA 3VRZA 2KI7A 3L2QA 3CD6A 2MCNA 2YRVA 4PFOA 4OB1B 3EFOB 2CH4W 5GAN4 4OMMA 3CMEA 1YIJA 1GCQC 3CCJQ 2QQSA 2W10A 1QCFA 5DM7R 4PJOB 5GAMj 2FYKA 2NUTB 4XU0A 5IXFA 3EGUA 3MEVA 1S1NA 1PG5B 4XK8E 3G4ST 2DE0X 4F7UB 4R56A 1JJ2P 3A8OB 4A4KA 1M1KU 1QLYA 3H0HA 1XJWB 1JEGA 3CCQT 2DVEA 1VQPQ 1ZBJA 1N27A 1I5OB 2OAWA 2ED1A 2VWFA 3UA6A 1E6HA 1NBEB 1ZSZB 5KH6A 3HRUA 2XD0A 1YFNA 1X27A 1WNLA 1VQ6Q 3CCSQ 2IVWA 1KFZA 1G83A 1YJNQ 1YHQT 3CCRT 3CCET 2DTOA 2RNAA 4Z89A 3EFSA 3QWYA 4BI3A 5GMKh 4K11A 1RLPC 3I35A 4N4HA 4MZTA 5HCKA 1Q81C 4OB3B 2PNIA 2VGMA 1PD1A 2V26A 4ZN1A 5CKEA 3VUBA 3OYKA 2CZ6B 1AWOA 4F7UF 3HFOA 1CKAA 4PL6A 2AZSA 2LCLA 4AFUC 2KRMA 3SB2A 4C5EA 5HKCA 3QKJA 1PD0A 5GANh 1QP2A 1IB8A 1UGPB 4J7IA 2QEXA 4M7AC 3EH2A 4LN2A 5GMKm 1RADB 3G6ET 1N8RU 2DTIA 5L8RE 1Q7YR 3SEMA 4C92D 1GBQA 1Y07A 1SPKA 3JCMP 2FB7A 3OYAA 5GANd 1WFWA 4L59A 2RQTA 4QVCA 1UJ0A 1AD5A 1JXOA 3G4SQ 1VQ8T 2FRYA 4M78A 2F2VA 3TSWA 3QDRB 3U23A 2O4XA 1ZUUA 2DERA 2NLUA 2DAQA 4JRQA 3PGGA 3M9QA 4HVUA 3X26B 1ZUKA 2HD0A 2HL3A 3A8GB 1Q82C 3RESA 4A63B 4DEYA 5GANf 2KK4A 1G8XA 5A2QE 2PQWA 3EFOA 4MZPA 1A0NB 2HDAA 5FU6C 3LGLA 1E7OA 2EQIA 1H3HA 3MEUA 3V8JA 4PJOA 1M2VB 3QPHA 2NUTA 5FU7C 4AMCA 1Q82R 1KSWA 2OAUA 1VQ7A 1UHFA 1D09B 1U8RA 1X6BA 2CKKA 3QWXX 4F7UA 1I8FA 2DD4A 3M0PA 2RI3A 2PVDB 1YHQQ 4XTXA 5LJ3h 3I5SA 3CCRQ 4FYVB 3CCEQ 1K0SA 3S3OA 3M54A 1R77A 1HK9A 2IG0A 1OOTA 2KEAA 1VQOT 4X9DA 4C92G 4BDZA 2DRKA 5CR2A 4J8OA 4BACA 3CC7A 1Q81U 1WXBA 1ZSZA 1QKXA 2M1HA 2GTJA 3MKDA 3R6OA 3D7SB 5LJ5g 2EQKA 2JTMA 2QDYB 4M7AB 3JCMg 1QVFP 1WQ7A 3HL8A 2EAYA 3S6WA 1FMVA 2RQRA 2BIVA 3I5RA 3L1AA 2R5AA 4FW2A 4XQ3A 1LPLA 2LQ8A 4M77E 1K9MR 1TS9A 3CCLQ 4OMNA 3PVQA 4J9FA 1BKBA 5LJ3f 4C8QE 4RMOA 2QK0A 4AFQC 1VQMA 3FDRA 1NEBA 2O2OA 3OW2A 2K3YA 5ECAA 1WJRA 2DJQA 1KHCA 3VJPA 2DZ9A 5AT1B 2BUDA 3QIIA 3RMQA 1G3YA 1KC8C 5I11A 3GP8A 1QCOA 2XG8D 5GAN8 3MPUB 5FU6B 1GCQA 2DIQA 5IHNA 5KYXB 4NL3A 4IIMA 2BE9B 4M7DE 3M57A 3MEWA 5FU7B 4JZ4A 2P0PA 4ESRA 5GMKi 1PCXA 2X4WA 1JXMA 4RCBA 1TUGB 2K2VA 1RLQC 2NUPB 1D1AA 1KC8R 1X6GA 4M78D 1OQKA 2CP0A 4EIKA 1NG2A 5I2SA 1H8KA 1VIEA 1W4SA 2YSQA 2Z0WA 4KGXB 4WCIA 5GAN5 3FRNA 4ZGEB 2EYZA 4ANJA 1I07A 1MHNA 1VQ4A 2CP5A 1D1CA 3PMTA 2JM8A 3M0QA 1VQOQ 5I22A 2HSPA 1J3TA 2DXUA 2FPEA 3H41A 4OGEA 2CS7A 2LC4A 4PJOD 1IHVA 5GAMe 5IH2A 1X2QA 2RPNA 4JRIA 4BUGA 3V7SA 3OYMA 3REBB 1X69A 3DLLA 1I81A 3PTAA 2EVRA 4CC7A 1VQ5A 1KD1C 3JB9D 4KH1B 1WXTA 4C0ZA 2LNHB 1P92A 1U1SA 4DBHA 2DO3A 1YJWT 1UFFA 1KK7A 1M3CA 3RR6A 3E2UA 3LWHA 4NS5A 5J39A 2E1HA 5GAOq 1X6OA 1X01A 1WXUA 3BE3A 1UGSB 1KD1R 5A0GA 1VQ9T 2HSEB 2GFUA 1C0MA 1PM3A 1O9SA 2L3QA 4A4HA 5HY6A 2OTJT 5KYYB 3CCUT 4JLIA 4M78G 1MGQA 4M7AA 3UPUA 4P5NA 1ZA1B 3RDVA 5GAN2 4FM4B 1CKBA 2H3JA 4J9GA 3A8LB 2RK1A 4BDYA 4FCYA 2HZYA 3NHNA 1LJOA 4E7LA 1D1BA 3INZA 4L5GA 1OV3A 2O9VA 1JBMA 4PJOG 2MF2A 3DLMA 2CZ0B 1ACMB 2XKOC 5CKDA 4OGCA 2AKLA 2DL4A 1EZZB 3RBBB 1UGVA 4F7UG 2YXYA 2RJDA 5IXBA 2VKNA 1FXXA 5D7UA 4EDUA 3CXCS 2L2PA 1PHTA 1GRIA 3CC2T 3JB9G 1OI1A 5CQYA 1VYVA 1M3BA 5LJ5h 4BE2A 3JCMh 2VB6A 3VS1A 5KYXA 3FIFA 1MUZA 1JJ2A 3GF5A 4LE9A 4PK4A 2XI9A 1N6AA 5DLOA 2NUPA 2O9SA 4II1A 1ZUYA 3ULRB 2CSQA 2V8KA 1NEGA 2HKQB 3CCJA 4IUUA 3FJPA 3LWIA 1T3LA 1ZQ1A 4PLLA 2D6FA 3CXCA 1YITQ 1YJ9T 2OTLT 2KROA 2BZYA 1YJWQ 5J3BA 1Y96A 2ZPIB 2RK2A 1KQ1A 2YLCA 4A53A 4RG8A 4C92F 5LJ5f 3MP6A 1LOJA 3JCMf 2A7YA 1VQPA 1VQ9Q 5GAOm 1QP3A 2BKDN 3SHWA 2VXEA 2DPPB 3EHRA 2OTJQ 1M8VA 4V2SA 3CCUQ 2KNBB 4LDWA 3UWNA 3H0IA 4C5IA 3CCVT 2LQKA 3PT9A 2A08A 4RKUE 1BK2A 3HRTA 3EGDA 1R8OB 2CH4A 2XHCA 1VQ6A 3BY7A 2IIMA 1SRLA 1GXIE 2M02A 4F04B 3CCSA 2EQMA 3V7RA 1M3AA 3C4SA 3OB9A 5DY9A 1ABQA 4PJLA 3OYHA 1YJNA 4C0GA 1K8AC 2O01E 4CI0C 1Z9ZA 4A4EA 1VQNQ 2EQUA 2JVVA 1UECA 1D0ZA 4N4IA 1JRIA 2YHTA 2LVMA 3KBGA 3QSUA 2GQVA 1IREB 4M7AD 1ABOA 2WACA 5KYYA 3EGXA 2LRQA 1W2BS 3I55A 1JU5C 4IIOA 5EC7A 3CC2Q 4HCZA 2RMOA 4RTWA 5DLQE 2CSIA 2FRWA 2R5MA 4XTZA 4C92E 4KULA 2GBQA 2VC8A 2K6DA 4E47A 2P4TA 3J81E 1WPYA 3PIPA 4X9CA 3FEOA 1QWEA 3VS6A 3OYCA 2Y4YA 3THKA 3ZFJA 3KXTA 3LH5A 5KYWB 3M0UA 3JCMb 3R6NA 3VS7A 4BE0A 4JJDA 4HT9A 2COYA 2O4XB 2RHUA 3REAB 7AT1B 1W2BA 1IGUA 2KR3A 1PNJA 1YJ9Q 2ESWA 2K5LA 3G4SA 2OTLQ 3PNWC 4M77C 2ZPGB 3DB3A 3CBPA 4M75E 1AZEA 4PFZA 3RKXA 4E7IA 3M55A 2HMAA 1BCMA 1K0XA 5A0DA 5KCOA 2K3BA 1VQLQ 1QVGS 2R58A 5A0LA 3CPWA 2GGRA 2ECZA 2M9UA 4M7AG 1MMNA 3A8HB 3CCVQ 3JSCA 4MDWA 3GNGA 3JB9I 4DOVA 3LYIA 4GLKA 1BIBA 3FB9A 3QDFA 2RJFA 3H9NA 4E7SA 2RB6A 3TCJA 2LQNA 4HKEA 4R55A 1UUEA 2K7AA 2PUOB 3PVLA 4IURA 2JUFA 3JCMW 4FL6A 3CBMA 3CCRA 1K8AU 2WSCE 2I2LA 3WVEB 4B9WA 3CD6T 3M4GA 1AWJA 2D1XA 4FW1A 1QVGA 2X4JA 3J7AF 4ZN3A 3CMET 2VASA 4M78F 3BDLA 1RAIB 2FG0A 4EMHA 3NFCA 3PE0A 4XTYA 2LT1A 4OB0B 3NMZC 3M59A 6AT1B 3OS2A 4AG2C 1ZHIA 5FWBA 2OX7A 1B34B 2EYXA 5FLXE 2KT1A 4D8KA 2WSFE 3EH1A 2MYSA 3L2UA 1G2BA 3X25B 3BDUA 4PJOF 3CCLA 2CT3A 2B86A 1Q7YC 3H6ZA 3HPWA 2F1LA 3JCMQ 2QQBA 3VS0A 2NUZA 1EX4A 2K3XA 1UB4A 2X9HA 1M4ZA 4J9DA 4M77B 2Y4XA 3EFRA 1SEMA 1QCNA 4HVVA 3JB9F 1GFDA 1M1GA 1C6VX 1VIFA 3LW5E 5GAMh 5GAOr 1N9SA 2RJEA 1FWZA 2FHDA 5LJ3j 4JJNK 2QGFB 4KGVB 1M90C 2CYZB 4BD3A 1GBRA 3HRSA 4QW2A 1B7TA 1SSFA 4M78E 2HQHA 3VS2A 5GAMd 4ATOA 2CP3A 2QTXA 2KXCA 5KYWA 2EGCA 2A28A 4KUIA 1YNZA 5CO7A 2JTEA 4Y91A 1M90R 5CKFA 3CCQQ 4MZMA 2JMCA 2PUKB 1M1FA 3V7CA 3PIOA 4AT1B 1OEBA 2X3WD 4PKCC 1K1ZA 3I56T 4MMKA 2E5QA 3CC4T 4ZTJA 4E7ZA 4OB2B 3CD6Q 2YUOA 2DBMA 3RIRA 1C1AA 1VQOA 2E64A 4F7UE 3QBYA 5GMKl 3CEYA 2KBTA 2BZ8A 1TUCA 2LTOA 2VYTA 2JXBA 2E6ZA 2KQWA 3TVTA 1K4US 1VYUA 4FT2A 1UHCA 5CCAA 1GCPA 2O31A 3G1JA 2QQ9A 3ZL7C 4FSXA 3V8KA 5KCHA 2FEIA 4XAXB 3UF4A 2C0OA 4XTWA 3OYNA 2WSEE 2RHZA 3OW2S 3VUZA 1K9MC 2VV5A 2ZPBB 2JZ2A 2M0YA 3JB9J 4XTUA 1I5LA 2DK3A 1Q7YU 3OYBA 1OULA 4ORZA 3LX7A 1D0YA 2DILA 4L6V5 1VQ7T 1FX7A 4DBQA 1OPLA 3OYGA 3G6EQ 1B34A 3MP8A 3VV0A 1PWTA 3NPFA 4XU2A 1MMDA 2AK5A 2DETA 3AHUA 4O5VA 2DYIA 5IT9E 2L3PA 2A3LA 1BI3A 2DF6A 4ZGDB 4LDYA 1RACB 5KE2A 3CCMT 1QW1A 4DBFA 1TU0B 1NJIC 2DM1A 2JMAA 3WVDB 3MCAB 2XDPA 1VQ8Q 2LT4A 4J6YA 3CC7T 4JUVA 4M77A 3M56A 1ZLMA 4HCKA 1Q86C 4BY6C 4PNOA 2YT6A 1NJIR 4C8QA 2NWMA 2E10A 2FVUA 2YDLA 5GAOp 1OZ3A 3C12A 4AFSC 1Q82U 3I56Q 3QJ6A 4E6RA 3CC4Q 1KQSS 2ZCFB 4NL2A 4GY5A 2EYYA 4VUBA 4F16A 2LZ6B 2K79A 2RD1A 1Q86R 1UDLA 1RAEB 4C5HA 3CBOA 3VKIA 2A37A 4M7AF 3EG0A 2HQXA 1WYXA 2V8IA 4J9CA 2DNUA 3MO8A 3H8ZA 3UT1A 3O8VA 1YP5A 2KRNA 3VS4A 2QQAA 1Y96B 2F2WA 4EPCA 3OS0A 3MP1A 4B6MA 2DL3A 2F69A 2R57A 4TVRA 1YITA 3HSBA 1YJWA 1KQSA 2CZ7B 5GMKe 1Y0MA 4J83A 4A4GA 2QA4T 1K9MU 3FC3A 1WI7A 2HBWA 4Z02A 2V8JA 3E9FA 4MDXA 2MMPA 1K9AA 3EGDB 2PVGB 3QXEB 4WF2A 2OTJA 5EG2A 2HQEA 3CCUA 2X35A 3QHSA 3JV3A 5GANe 1R0BG 2GNCA 4M75C 2JN0A 2YWWA 1W6XA 2C0TA 5LJ5j 1KIKA 4JDSA 4NOYA 1G3TA 1XQHA 2HEQA 2YUQA 1HYOA 1TXQA 1DJ7B 1Q95G 5HK0A 3CCMQ 3WXMB 4M7AE 5J26A 2A36A 4Z8AA 1QKWA 3EGXB 3QO3A 1VQNA 4BY6B 4MMLA 1BIAA 2ATCB 4OP0A 1KHIA 2EJFA 2J6KA 2LMJA 3RKWA 1KC8U 2J06A 4BI8B 2L3SA 4BI4A 3CC2A 2EWNA 1JJ2S 4CC2A 3GBQA 4JS4A 2LX7A 4GBQA 5HK3A 2ZAEA 3META 3SFMA 4DQ2A 1BI0A 2DBKA 3AT1B 4A54A 4M77D 3C0CA 3EG9B 3FJ5A 2HAXA 1S72T 2DMOA 2RQUA 2RHIA 1TSFA 2RA2A 4LDVA 1TUDA 4DOWA 5LJ3e 2KYMA 4OMLA 2ENMA 3M0RA 1AWWA 3EAEA 5CQXA 5M9OA 3TSZA 1YJ9A 3OQ5A 3QG1A 2KGTA 2OTLA 2DZCA 2E70A 1NYGA 2RQVA 2SRCA 4J9HA 1PRMC 3OW2P 2FPDA 2QA4Q 3S3MA 4BB7A 3F70A 4FSSA 3JB9H 1O75A 4RCCA 4M4ZA 1TG0A 1VQLA 5D6YA 3ASKA 4IUPA 1PSEA 4M75B 1BB9A 3TEEA 3ZBDA 2H8HA
chains in the Genus database with same CATH topology
1Y71A 4XTVA 3RESA 5A0LA 3NTKA 1KD1U 5GANf 1N9RA 2KK4A 3CPWA 5GAOn 2F5TX 2M9UA 5A2QE 2JNGA 3MEAA 3CCVA 2PQWA 4MZPA 4M7AG 3BW1A 3A8HB 5FU6C 4EMKC 3JSCA 3LGLA 4ZTFA 3MEUA 3OYYA 4MDWA 3V8JA 3GNGA 5D6WA 3OBWA 4HA8A 3JB9I 4DOVA 3LYIA 4GLKA 3SWNB 4PJOA 3X24B 2QI2A 1KG1A 3G71T 3QPHA 1BIBA 4A4FA 1VQ9A 3FB9A 5FU7C 2RJFA 2L3RA 2RB6A 5FRNA 3TCJA 2L5QA 2OAUA 5CKHA 1VQ7A 1NE8A 4HKEA 3V8LA 4R55A 1U8RA 2CKKA 4F7UA 1I8FA 4FIBA 2PUOB 2DD4A 4IURA 2K5IA 5GAMg 2C06A 2JUFA 3JCMW 2RI3A 1HXDA 3OYFA 3VYGA 2XIDA 4EMGA 2PVDB 3L2RA 1G3SA 2LNVA 2M0OA 3CBMA 3LH0A 2WSCE 4FL6A 2FL7A 4XTXA 2I2LA 2RI2A 2HNIA 4M77G 5LJ3h 5CK9A 3WVEB 4B9WA 3CD6T 3M4GA 5CIUA 3CCRA 3S3OA 3M54A 1QVGA 1HK9A 2X4JA 2IG0A 2YLBA 4ZN3A 1KQ2A 3J7AF 3CMET 2ZGWA 2MWPA 1VQOT 4X9DA 1VQ4T 2DIGA 4M78F 5D6XA 3QYHB 4C8QG 3BDLA 2L89A 4N0AC 4OMFB 4C92G 4BDZA 4EMHA 1YITT 5CR2A 2KSSA 3HP9A 3NFCA 4XTYA 2LT1A 1NJIU 4J8OA 4OB0B 2XK0A 3M59A 1RL2A 3TREA 3OS2A 4BACA 3CC7A 1ZHIA 2M16A 1Q81U 1XTDA 2ZZDA 2M1HA 1B34B 4KT0E 5GAN3 3R6OA 3KUFA 5LJ5g 5FLXE 2GFAA 3A8MB 2EQKA 2EQJA 2JTMA 2QDYB 4M7AB 3JCMg 2WSFE 1WQ7A 4HCCA 3T9NA 1BYMA 3HL8A 1YI2T 2EAYA 3S6WA 4FU6A 3L2UA 4IUTA 3GIBA 1Q86U 1VQPT 3OSVA 2BIVA 3L1AA 4YTLA 2XU8A 4UC4A 1VQ5T 2R5AA 4C0DC 4XQ3A 2KMTA 3X25B 3BFMA 2LQ8A 3BDUA 4M77E 4PJOF 1S72A 3CCLA 2VXFA 3DB4A 2L8DA 3URGA 4IUQA 1VQKT 1Q7YC 3H6ZA 3GLXA 3HPWA 3RUXA 2EJ9A 3JCMQ 1BKBA 2QQBA 5LJ3f 2RH2A 3CPFA 4C8QE 4RMOA 2K3XA 1BI1A 1UB4A 1UEBA 1M4ZA 4M77B 1VQMA 3FDRA 2Y4XA 2K4YA 3EFRA 3JB9F 1M1GA 3OW2A 2K3YA 1VQ6T 1VIFA 4CRIA 3LW5E 5GAMh 3CCST 5GAOr 2JOYA 1WJRA 1N9SA 3GNFB 3VU3C 2RJEA 1LNXA 1FWZA 2FHDA 1KHCA 4ZGJB 5LJ3j 3VJPA 2DZ9A 4C92B 3GPLA 2XDBA 3JCMX 3CPWS 4JJNK 3JCMJ 2D9TA 2LDMA 1VQNT 2BUDA 4C8QD 4OF1A 3QIIA 2LCCA 2QQRA 3RMQA 1G3YA 5CAIA 4ME7A 1M90C 2CYZB 4BD3A 1KC8C 2GF7A 2HBPA 3E19A 3GP8A 2XG8D 5GAN8 3HRSA 4QW2A 3M58A 4EMKB 5FU6B 3L2VA 4HT8A 4PLIA 1SSFA 4M78E 2DIQA 2Y90A 4J6XA 1NPRA 4D6WA 5GAMd 1TH7A 4NL3A 1OZ2A 4ATOA 3I55T 2QTXA 2X4XA 3M57A 4M7DE 3MEWA 1UGQB 4QQ6A 4KUIA 2VGNA 5FU7B 2P0PA 5CO7A 1XOVA 5GMKi 4C5GA 4E7HA 2X4WA 2AHJB 3L42A 4RCBA 4Y91A 1QVFS 3CCQA 1IZ6A 3G71A 2K2VA 4C8QC 2EFIA 5CKFA 2RI5A 3JRZA 3QUIA 5GMKj 2ZPHB 4M78D 4MZMA 1JB0E 2PUKB 1M1FA 3V7CA 3PIOA 1N8RC 4M7DD 5I2SA 4PKCC 1VIEA 1W4SA 4OVAA 3I56T 1D3BB 4MMKA 2E5QA 3CC4T 2RJCA 3SD4A 3LLRA 4C0FA 3GOXA 4ZTJA 4OB2B 4J7FA 4B9XA 5C6SA 5GAN5 3FRNA 4ZGEB 5LJ5d 4BE1A 2ZPFB 4M75A 3RIRA 2CGHA 3JCMd 3CMAT 3OS1A 5LL6S 2E64A 1MHNA 4F7UE 3OA6A 1VQ4A 1VQOA 3PMTA 5FRMA 3QBYA 5GMKl 3CEYA 2CZ1B 2DXUA 5GANj 2LTOA 2XICA 4LDXA 2VYTA 4OGEA 4JLGA 5I2MA 2CS7A 4O6JA 4M78C 3JCMc 2LC4A 3G7ZA 2D0QB 2E6ZA 4PJOD 2KQWA 1YHQA 4M7DC 5GAMe 1QVFA 4FT2A 4JRIA 3CCEA 1I4K1 4BUGA 3SWNA 3V7SA 3OYMA 5CCAA 3OSSC 4KUDK 4C0DB 1YI2A 2QQ9A 3DLLA 1ZBXA 1I81A 3PTAA 3CCJT 2KAFA 1YIJT 5IAYA 4FSXA 3V8KA 4LD6A 1VQLT 2DEQA 5KCHA 1VQ5A 2F5KA 4XAXB 3JB9D 1KD1C 1G3WA 2DXBA 4XTWA 4HCBA 3OYNA 2WSEE 4C0ZA 1P92A 1U1SA 3E1SA 2RHZA 5GANg 1EIFA 2DO3A 3OW2S 1RI0A 3VUZA 1YJWT 1K9MC 1VQKA 3OYDA 3OYEA 1M1KC 2VV5A 1PSFA 2ZPBB 3NTHA 3LWHA 2JZ2A 4NS5A 5J39A 4PJOC 2K57A 4FT4A 2E1HA 5IN1A 1YCYA 3JB9J 4XTUA 1I5LA 1WJSA 2DK3A 5GAOq 1Q7YU 5CKBA 3OYBA 1NPPA 1X6OA 3OYLA 4QVDA 1X01A 4ELYC 2XDDA 5LJ5e 3S3NA 1YBYA 3LX7A 3JCMe 1UGSB 3OMGA 2DTHA 4L6V5 5A0GA 1VQ9T 2E6NA 2RM4A 4JRKA 2EIFA 2EJGA 2GFUA 3ER0A 3QZ9B 3G6EA 1M5Q1 2P0KA 1O9SA 4M75F 5I21A 1VQ7T 1FX7A 3J80E 4A4HA 4Q5WA 5HY6A 3JAME 3OYGA 1B34A 2OTJT 3CCUT 3MP8A 3VV0A 2KVQG 4JLIA 4M78G 4XU2A 1MGQA 4QQDA 3AHUA 4M7AA 4JRPA 4O5VA 3UPUA 4M7DG 4P5NA 5GAN6 3DKMA 5GAOl 3P8BB 5IT9E 5GAN2 2A3LA 4FM4B 1BI3A 3C94A 2H3JA 1NZ9A 1VUBA 4LDUA 4ZGDB 3OYJA 2EYQA 4LDYA 3QYGB 3A8LB 2RK1A 3ME9A 1QW1A 5KE2A 3CCMT 4BDYA 1NJIC 1LJOA 3RERA 4E7LA 5CVIA 1XNIA 3UDCA 1VQ8A 2E41A 3WVDB 3MCAB 2P0QA 4C8QB 2XDPA 3INZA 1YJNT 4L5GA 2LT4A 4J6YA 2DKGA 1X75C 3CC7T 4JUVA 2E12A 3C95A 4M77A 3M56A 1JBMA 2RHXA 3M5AA 1WQWA 2MF2A 4PJOG 5FROA 4J6WA 3DLMA 1G5VA 2CZ0B 1Q86C 2XKOC 4BY6C 5CKDA 4PNOA 4OGCA 2B8AA 4X34A 4Y28E 4C8QA 4F7UG 1UGRB 2E10A 2RJDA 3FLGA 5C0MA 3I56A 2FVUA 1H641 1FXXA 4C92A 2DXTA 1OZ3A 3C12A 4XU1A 5GAOp 3OS5A 4EDUA 3CXCS 1Q82U 3M53A 3QJ6A 1KQSS 3CC2T 3JB9G 1OI1A 5CQYA 3CCLT 2ZCFB 4NL2A 1M9SA 2X4YA 4GY5A 3RKYA 5LJ5h 4VUBA 3NTIA 5LJ3g 3CMAA 4BE2A 3L2ZA 3JCMh 4M78B 2DXCA 3JCMV 5AYFA 4EMKA 2RD1A 4C5HA 2KY9A 3CBOA 3SDZA 3E9GA 4M7DB 3VKIA 4XU3A 3X28B 4M7AF 1BI2A 2HQXA 2V8IA 3FIFA 4ELZC 2JTFA 1JJ2A 2K5FA 3MO8A 3GF5A 4RG2A 1V29B 3OMCA 3H8ZA 3PMIA 3UT1A 3O8VA 2QEXT 2XI9A 1N6AA 5GAMf 5DLOA 4PJOE 3L2QA 3CD6A 4II1A 2QQAA 2YRVA 3HFNA 4OB1B 1Y96B 2V8KA 3QZ5B 4EPCA 1K73C 3Q1JA 3CCJA 5GAN4 3OS0A 3CMEA 3MP1A 1YIJA 4IUUA 1AHJB 5GAN7 3FJPA 3LWIA 2QQSA 2F69A 2QXFA 2R57A 5DM7R 4TVRA 1ZQ1A 4PLLA 1YITA 1D3BA 3CXCA 4M77F 2D6FA 4PJOB 5GAMj 3HSBA 2FYKA 1YJWA 3P8HA 1KQSA 2CZ7B 5GMKe 4XU0A 4M75D 1YJ9T 2OTLT 3MEVA 4XK8E 2E65A 1Y96A 4J83A 5J3BA 4A4GA 3G4ST 4F7UB 4N0AA 2ZPIB 4R56A 2RK2A 2QA4T 1KQ1A 2YLCA 1K9MU 3A8OB 4C8QF 4A4KA 1M1KU 3FC3A 4A53A 4RG8A 1H3ZA 1K8AU 4C92F 5LJ5f 3MP6A 1LOJA 2MWOA 4Z02A 2A7YA 2DVEA 2V8JA 3JCMf 3CCQT 1VQPA 2RO0A 3E9FA 3PFSA 2MMPA 4MDXA 2RHYA 5GAOm 2PVGB 1QP3A 3QXEB 2BKDN 4WF2A 1OYXA 1N27A 2HQEA 2VXEA 5EG2A 2X35A 3CCUA 2OTJA 3QHSA 2DPPB 3VYHB 5GANe 2DJZA 1M8VA 4V2SA 4LDWA 4M75C 3UWNA 4C5IA 2JN0A 3TU4K 3CCVT 2LQKA 4E7JA 2MAMA 3PT9A 5LJ5j 4JDSA 4NOYA 3OYIA 4RKUE 1G3TA 1XQHA 3HRTA 1R8OB 3RMSA 5KH6A 3HRUA 2XD0A 2XHCA 3N5BB 3CCMA 1VQ6A 3BY7A 1GXIE 1DJ7B 5HK0A 1WNLA 3CCSA 2EQMA 2PVOB 3V7RA 3WXMB 4M7DF 3C4SA 3OB9A 2LX9A 5DY9A 1Y7XA 5J26A 4M7AE 2IVWA 3SWNC 3OYHA 1YJNA 4C0GA 1K8AC 4DA4A 2O01E 3QO3A 4CI0C 1VQNA 3X20B 4A4EA 4BY6B 4MMLA 1BIAA 1YHQT 5LJ3d 2EQUA 3CCRT 2PU9B 4QVZA 3CCET 2JVVA 2DTOA 4OP0A 2KDSA 4N4IA 4JS5A 1JRIA 1KHIA 2YHTA 2LVMA 3EFSA 3KBGA 2EJFA 3QSUA 4BI3A 5GMKh 4IKFA 1M90U 2GQVA 1IREB 3RKWA 4M7AD 1KC8U 2WACA 2LRQA 1W2BS 4BI8B 4N4HA 3I55A 4MZTA 1Q81C 4OB3B 2VGMA 4BI4A 2EWNA 3CC2A 1JJ2S 3LGFA 4ZN1A 5CKEA 3VUBA 4JS4A 3OYKA 4HCZA 2CZ6B 5HK3A 5DLQE 4IUVA 4F7UF 4M75G 3HFOA 3OBYA 4PL6A 3META 3SFMA 2LCLA 2G3RA 1BI0A 4N4GA 4DQ2A 2R5MA 4XTZA 3SB2A 4C92E 3HKSA 4C5EA 3QJYA 3MHXA 4KULA 5HKCA 4A54A 3QKJA 2MI6A 2VC8A 5GANh 4M77D 1QP2A 1UGPB 3M4YA 4J7IA 2P4TA 4E47A 2QEXA 3J81E 1WPYA 4M7AC 3PIPA 3G6ET 5GMKm 4X9CA 3FEOA 2HAXA 3P8DA 1N8RU 3OYCA 2DTIA 2Y4YA 1S72T 1WJQA 4KBMB 5L8RE 3ZFJA 3KXTA 2RHIA 5KE3A 2VUBA 2EKOA 2RA2A 3JCMb 4LDVA 4DOWA 4QQGA 4C92D 5LJ3e 4BE0A 1Y07A 1K73U 4HT9A 3JCMP 2RHUA 2O4XB 2FB7A 1W2BA 3EAEA 5CQXA 5M9OA 1VQMT 3OYAA 1YJ9A 3OQ5A 3QG1A 2OTLA 5GANd 2DZCA 4L59A 2E70A 4QVCA 3CC4A 2K5LA 3G4SA 1QVPA 3PNWC 4M77C 2ZPGB 3DB3A 3CBPA 4M75E 2QA4A 4E7KA 1VQ8T 3RKXA 4E7IA 4M78A 4BB7A 3S3MA 4LD9K 2DD5A 3F70A 3QDRB 3M55A 3OY9A 2O4XA 3A5ZB 4J5YA 3JB9H 3ZEHA 1O75A 2NLUA 2DAQA 4RCCA 4JRQA 4M7DA 1U1TA 3PGGA 3M9QA 3HHTB 1VQLA 5D6YA 3X26B 3ASKA 5A0DA 4IUPA 2GCXA 2ZPEB 5KCOA 3L2WA 2HD0A 1PSEA 4C92C 4M75B 3TEEA 1QVGS 1WGSA 3A8GB 2R58A 3ZBDA 1Q82C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BD3 A;  3UWN A;  3NTK A;  2GF7 A;  4C5I A;  4E7J A;  4QW2 A;  3L2V A;  4PLI A;  1SSF A;  3MEA A;  2PQW A;  2DIQ A;  3OYI A;  3OYJ A;  1OZ2 A;  3ME9 A;  5KE2 A;  4BDY A;  3LGL A;  5KH6 A;  2X4X A;  4ZTF A;  3MEW A;  4QQ6 A;  4E7L A;  3MEU A;  1XNI A;  5D6W A;  3LYI A;  4E7H A;  4C5G A;  2X4W A;  2EQM A;  2XDP A;  3L42 A;  4A4F A;  3C4S A;  3OB9 A;  5J26 A;  2RJF A;  2L3R A;  5FRN A;  3OYH A;  2EFI A;  2RI5 A;  2RHX A;  2CKK A;  4A4E A;  4IUR A;  5FRO A;  3DLM A;  1G5V A;  2EQU A;  2RI3 A;  4QVZ A;  3OYF A;  3L2R A;  2M0O A;  4FL6 A;  2B8A A;  3LH0 A;  4N4I A;  4OVA A;  4X34 A;  2RI2 A;  4B9W A;  2E5Q A;  2LVM A;  2RJD A;  2RJC A;  3FLG A;  5CIU A;  3SD4 A;  5C0M A;  3S3O A;  3LLR A;  4ZTJ A;  1OZ3 A;  3GOX A;  4IKF A;  4EDU A;  4B9X A;  2IG0 A;  3QJ6 A;  5C6S A;  2WAC A;  2MWP A;  2LRQ A;  1OI1 A;  4N4H A;  2DIG A;  4BE1 A;  5D6X A;  2X4Y A;  3BDL A;  4GY5 A;  3OS1 A;  1MHN A;  3OA6 A;  2L89 A;  3LGF A;  3PMT A;  4BE2 A;  3NTI A;  5FRM A;  3QBY A;  4BDZ A;  3OYK A;  3CEY A;  4HCZ A;  2LTO A;  4IUV A;  2XK0 A;  2VYT A;  3OS2 A;  4C5H A;  4PL6 A;  4BAC A;  2M16 A;  3MET A;  3E9G A;  4N4G A;  2G3R A;  2R5M A;  2M1H A;  2HQX A;  2JTF A;  3MO8 A;  4RG2 A;  4C5E A;  3KUF A;  3H8Z A;  3OMC A;  2GFA A;  3PMI A;  3O8V A;  3UT1 A;  2EQK A;  2EQJ A;  3OYM A;  3QKJ A;  3S6W A;  4FU6 A;  3L2Q A;  4IUT A;  3L2U A;  4II1 A;  2YRV A;  3FEO A;  2BIV A;  3P8D A;  4UC4 A;  5IAY A;  2R5A A;  3OYC A;  3Q1J A;  4LD6 A;  5KCH A;  1WJQ A;  3OS0 A;  2F5K A;  3MP1 A;  2RHI A;  5KE3 A;  2EKO A;  4IUU A;  3OYN A;  3DB4 A;  2L8D A;  2QQS A;  2RHZ A;  4IUQ A;  2R57 A;  4QQG A;  3H6Z A;  4BE0 A;  1RI0 A;  4PLL A;  2RHU A;  2O4X B;  3OYD A;  3OYE A;  3P8H A;  3EAE A;  3NTH A;  5M9O A;  2JZ2 A;  4NS5 A;  2K3X A;  5J39 A;  3MEV A;  3OYA A;  5IN1 A;  3OQ5 A;  1WJS A;  4A4G A;  4L59 A;  3FDR A;  3OYB A;  3OYL A;  2K3Y A;  3PNW C;  3DB3 A;  3FC3 A;  3S3N A;  4E7K A;  1H3Z A;  3LX7 A;  4CRI A;  3OMG A;  4E7I A;  3MP6 A;  3S3M A;  1WJR A;  2E6N A;  3F70 A;  2MWO A;  4Z02 A;  3OY9 A;  2RJE A;  2O4X A;  2GFU A;  3ZEH A;  2RO0 A;  2FHD A;  3E9F A;  1KHC A;  2NLU A;  2DAQ A;  2P0K A;  2RHY A;  3PFS A;  4A4H A;  3M9Q A;  4Q5W A;  3OYG A;  5D6Y A;  2D9T A;  2LDM A;  3ASK A;  2BUD A;  3QII A;  4IUP A;  3MP8 A;  2BKD N;  5KCO A;  3L2W A;  1OYX A;  1N27 A;  2HQE A;  2LCC A;  2QQR A;  2X35 A;  1WGS A;  4QQD A;  2R58 A; 
#chains in the Genus database with same CATH topology
 4XTV A;  2CP6 A;  3NTK A;  1KD1 U;  5GAO n;  2F5T X;  2JNG A;  3MEA A;  3CCV A;  2RF0 A;  1KJW A;  3BW1 A;  4ZTF A;  2V1Q A;  3OYY A;  2FZG B;  4KRT A;  3X24 B;  1RI9 A;  2EGA A;  2QI2 A;  2KE9 A;  2F2X A;  3G71 T;  1KG1 A;  1NYF A;  1VA7 A;  2L3R A;  1YCS B;  4FIB A;  1OU9 A;  2CUB A;  5GAM g;  1SRM A;  1TOV A;  1HXD A;  3OYF A;  3VYG A;  1SF9 A;  1G3S A;  2DLP A;  2LNV A;  3MJX A;  1IHW A;  2RI2 A;  4M77 G;  2HNI A;  1U06 A;  1WHG A;  3KFV A;  4R0K A;  2YLB A;  4RUG A;  3EHQ A;  2ZGW A;  2MWP A;  2DIG A;  5D6X A;  2E3H A;  4C8Q G;  1NM7 A;  2MIO A;  1SHF A;  4N0A C;  2KSS A;  2LJ1 A;  2M16 A;  2LCS A;  1NLP C;  1XTD A;  2ZZD A;  1LVK A;  4KT0 E;  2IPO B;  1EFN A;  2KT8 A;  3KUF A;  2GFA A;  3A8M B;  2EQJ A;  1BYM A;  1YI2 T;  4RTU A;  4OMP A;  4IUT A;  1VQP T;  5GJV B;  2KMT A;  5KYN A;  5FW9 A;  2CP2 A;  3BFM A;  3VRY A;  3DB4 A;  1M1K R;  3URG A;  1S72 Q;  1VQK T;  2OI3 A;  2QAZ A;  1E6G A;  1UEB A;  2EKH A;  2DYB A;  3TQ7 P;  2YUN A;  1VQ6 T;  3NGP A;  4CRI A;  3CCS T;  3VU3 C;  2E5K A;  3GPL A;  3JCM X;  3CPW S;  3JCM J;  1MMG A;  2D9T A;  4OF1 A;  2I0N A;  5IHI A;  2LCC A;  1VOM A;  2QYZ A;  4ME7 A;  2COW A;  3EG9 A;  2JM9 A;  2BE7 D;  4D8D A;  1WDX A;  8ATC B;  2DL5 A;  2AKK A;  3I55 T;  4RTZ A;  2HKN A;  2X4X A;  3I9Q A;  4QQ6 A;  1UGQ B;  1RAH B;  1UG1 A;  2VGN A;  4LNP A;  5IHK A;  1XOV A;  4E7H A;  2AHJ B;  3L42 A;  2JS2 A;  1QVF S;  3CCQ A;  5L23 A;  2GTO A;  4C8Q C;  1MNE A;  3QUI A;  3G71 Q;  5GMK j;  4ZNX A;  2MPX C;  1JB0 E;  4QT7 A;  4DEX A;  2V1R A;  1N8R C;  2HL5 C;  1RAF B;  4OVA A;  4OMQ A;  1D3B B;  4OMO A;  2RJC A;  2CDT A;  1QMC A;  2JJ9 A;  3LLR A;  3GOX A;  4B9X A;  4J7F A;  5C6S A;  4AFZ C;  2ZPF B;  4BE1 A;  4M75 A;  1M27 C;  3CMA T;  3OS1 A;  5LL6 S;  3CQT A;  3OA6 A;  1AOJ A;  2CZ1 B;  2G6F X;  5GAN j;  2XIC A;  4LDX A;  1N8R R;  1YHQ A;  4M7D C;  1QVF A;  3CCE A;  1I4K 1;  2E4H A;  3UA7 A;  1ZBX A;  2P4R A;  3UAT A;  5IAY A;  1YI2 Q;  1YIJ T;  4LD6 A;  2DEQ A;  3A1P A;  2GQI A;  1WX6 A;  2DXB A;  4HCB A;  1QWF A;  1WHJ A;  1EIF A;  1ZX6 A;  2EPD A;  2DL7 A;  3OYD A;  3OYE A;  1PSF A;  3CXC P;  3NTH A;  1VQK Q;  2K57 A;  4FT4 A;  2L0A A;  1YCY A;  1WHH A;  1WJS A;  2FZC B;  1NPP A;  1H92 A;  3OYL A;  1IRX A;  4ELY C;  2XDD A;  5LJ5 e;  1SG5 A;  1YBY A;  3JCM e;  3OMG A;  2DTH A;  2KRS A;  1VYT A;  2EJG A;  3ER0 A;  3G6E A;  1M5Q 1;  2P0K A;  2KXD A;  3J80 E;  4Q5W A;  2KVQ G;  1QQJ A;  4JRP A;  3DKM A;  2EBP A;  2ABL A;  2BZX A;  3C94 A;  3IQL A;  3QYG B;  1FYN A;  2DVJ A;  1WZO A;  3RER A;  3UDC A;  1VQ8 A;  2P0Q A;  4C8Q B;  3I55 Q;  2E12 A;  3C95 A;  2RHX A;  4JJC A;  1WQW A;  4PFP A;  5FRO A;  1HJD A;  4J6W A;  1WHM A;  4J9I A;  1W70 A;  2B8A A;  4X34 A;  1M8M A;  1UTI A;  3FLG A;  5C0M A;  3I56 A;  1Q81 R;  2DXT A;  3CC4 A;  4XU1 A;  4X1V A;  3CCL T;  2QAS A;  1N5Z A;  1X2K A;  2X4Y A;  3RKY A;  3NTI A;  3L2Z A;  2QTV A;  3CMA Q;  2PTK A;  2DXC A;  3JCM V;  1ZA2 B;  2KY9 A;  4M7D B;  2J6F A;  2K5F A;  4RG2 A;  3OMC A;  1I1J A;  2QEX T;  1RAG B;  5GAM f;  2PZ1 A;  4PJO E;  3HFN A;  3M0S A;  3QZ5 B;  1K73 C;  1AEY A;  3Q1J A;  4RTT A;  1F1B B;  2QDL A;  3M0T A;  1PKT A;  1AHJ B;  5GAN 7;  3CME Q;  1YIJ Q;  2QXF A;  2FO0 A;  2LJ0 A;  3A98 A;  1D3B A;  4M77 F;  1JO8 A;  3P8H A;  4RTY A;  4M75 D;  1W2B P;  2E65 A;  4N0A A;  4C8Q F;  1K73 R;  1H3Z A;  2ROT A;  1B07 A;  9ATC B;  2MWO A;  2RO0 A;  2P84 A;  3PFS A;  2RHY A;  2D8H A;  4KH0 B;  2E3I A;  1B3Q A;  1OYX A;  3EG1 A;  1UJY A;  3VYH B;  2DJZ A;  2OJ2 A;  1SKU B;  3TU4 K;  4E7J A;  2DRM A;  2MAM A;  3RNJ A;  1MMA A;  3CPW P;  3OYI A;  4JJB A;  3RMS A;  3N5B B;  3CCM A;  4LUD A;  1MV3 A;  4F17 A;  1HSQ A;  2PVO B;  1RAB B;  2W0Z A;  4M7D F;  2LX9 A;  1Y7X A;  3SWN C;  2YRD A;  4DA4 A;  4DBR A;  3X20 B;  5LJ3 d;  2PU9 B;  2EGE A;  4QVZ A;  3EG3 A;  2KDS A;  4JS5 A;  1WLP B;  2RQW A;  4IKF A;  1M90 U;  1PRL C;  1QVG P;  5KYU B;  3LGF A;  2CT4 A;  2JW4 A;  4IUV A;  2BTT A;  2LJ3 A;  1D0X A;  3OBY A;  4M75 G;  4N4G A;  2G3R A;  4RTV A;  1FMK A;  3HKS A;  3QJY A;  3MHX A;  2MI6 A;  1I0C A;  3HTR A;  3M4Y A;  1IXD A;  2QEX Q;  3P8D A;  1WJQ A;  4KBM B;  5KE3 A;  2VUB A;  2EKO A;  4QQG A;  2LQW A;  1K73 U;  1BU1 A;  2EW3 A;  4Y92 A;  4PJM A;  1MV0 B;  1VQM T;  2ED0 A;  1QVP A;  2QA4 A;  4E7K A;  4LD9 K;  2DD5 A;  2MOX A;  3OY9 A;  3A5Z B;  4J5Y A;  3ZEH A;  4M7D A;  1U1T A;  1YWP A;  3EG2 A;  3HHT B;  1M30 A;  1LCK A;  2GCX A;  2ZPE B;  3L2W A;  4C92 C;  1WGS A;  2D0N A;  1YWO A;  2D8J A;  1Y71 A;  1SHG A;  2H3E B;  1N9R A;  2DFU A;  2CP7 A;  1K76 A;  4EMK C;  1U3O A;  4J9E A;  5D6W A;  3OBW A;  4HA8 A;  4AG1 C;  3SWN B;  2C0I A;  4A4F A;  1VQ9 A;  2X51 A;  5FRN A;  2FZK B;  2L5Q A;  5CKH A;  1NE8 A;  1PKS A;  3V8L A;  1VQ7 Q;  2K5I A;  2C06 A;  4LUE A;  1AVZ C;  1OPK A;  2XID A;  4Z88 A;  4EMG A;  2M0O A;  4JZ3 A;  3L2R A;  3LH0 A;  1GL5 A;  5CK9 A;  2FL7 A;  5GJW B;  1M2V A;  5CIU A;  1KQ2 A;  1VQ4 T;  5FWC A;  3QYH B;  2J7I A;  2L89 A;  2QGG A;  2K2M A;  4OMF B;  1YIT T;  2LP5 A;  3HP9 A;  1NJI U;  2XK0 A;  3TRE A;  1RL2 A;  2AT1 B;  3CC7 Q;  5GAN 3;  3VS5 A;  4E2F B;  1RUW A;  4HCC A;  3T9N A;  4FU6 A;  1U5S A;  3GIB A;  1Q86 U;  3OSV A;  1ZSG A;  4YTL A;  1VQ5 T;  2NYS A;  2XU8 A;  4UC4 A;  4C0D C;  4WTO B;  2MK5 A;  1S72 A;  2VXF A;  1T0H A;  2L8D A;  4IUQ A;  1RAA B;  3GLX A;  8AT1 B;  3RUX A;  2EJ9 A;  2YRC A;  2CRE A;  2RH2 A;  3CPF A;  1BI1 A;  2YUP A;  1MND A;  1CSK A;  4FYW B;  2DX1 A;  3H0F A;  2K4Y A;  4KGZ B;  5KYU A;  1YN8 A;  1VQM Q;  4LXC A;  2DEU A;  2JOY A;  2EYW A;  2FPF A;  3GNF B;  1LNX A;  1NLO C;  4ZGJ B;  2XDB A;  4C92 B;  2LDM A;  1VQN T;  4C8Q D;  1IGQ A;  1X43 A;  1TTH B;  3VS3 A;  2QQR A;  1JQQ A;  1Y57 A;  5CAI A;  1GFC A;  2GF7 A;  2HBP A;  1AWX A;  1T3S A;  3E19 A;  4CC4 B;  3L2V A;  3M58 A;  4EMK B;  4HT8 A;  4PLI A;  1HD3 A;  2Y90 A;  4J6X A;  1NPR A;  1SSH A;  4D6W A;  1TH7 A;  1OZ2 A;  1ARK A;  1W1F A;  2DA9 A;  4C5G A;  1Z9Q A;  1IZ6 A;  3G71 A;  2EFI A;  2AZV A;  2RI5 A;  3JRZ A;  1IO6 A;  2ZPH B;  4M7D D;  1AT1 B;  3SD4 A;  4C0F A;  1T0J A;  4JPB W;  3O5Z A;  5LJ5 d;  3JCM d;  2CGH A;  2RN8 A;  5FRM A;  1VQ4 Q;  4GLM A;  1WHK A;  4CC3 A;  2DL8 A;  4JLG A;  5I2M A;  4O6J A;  4M78 C;  3JCM c;  3G7Z A;  2D0Q B;  2O88 A;  1FMW A;  4F14 A;  2J6O A;  3SWN A;  2CUD A;  3OSS C;  1TWB A;  4KUD K;  4C0D B;  2COZ A;  1YI2 A;  4RTX A;  4PJN A;  3CCJ T;  2KAF A;  1VQL T;  2F5K A;  1G3W A;  2ROL A;  1VQ5 Q;  3E1S A;  5GAN g;  1M2O A;  1WA7 A;  1RI0 A;  1VQK A;  1M1K C;  4HXJ A;  4PJO C;  1V76 A;  1KQS P;  5IN1 A;  4HVW A;  5CKB A;  4QVD A;  3S3N A;  1R0C B;  1V1C A;  2HCK A;  4FYX B;  2SEM A;  2E6N A;  2RM4 A;  4JRK A;  2EIF A;  2M51 A;  3QZ9 B;  4M75 F;  5I21 A;  2JS0 A;  2XMF A;  3JAM E;  2A0F B;  1AZG B;  4QQD A;  4M7D G;  4QKU A;  5GAN 6;  5GAO l;  3P8B B;  2K9G A;  1NZ9 A;  1VUB A;  4LDU A;  3OYJ A;  2EYQ A;  4J9B A;  3ME9 A;  2X3X D;  1ZSZ C;  5CVI A;  1PC0 A;  1XNI A;  2E41 A;  1OX8 A;  1K8A R;  4FYY B;  1YJN T;  2VVK A;  2DKG A;  1X75 C;  1WIE A;  1OX9 A;  3M5A A;  2KYB A;  1WHL A;  4PJJ A;  1G5V A;  1OU8 A;  1UE9 A;  4Y28 E;  1UGR B;  1H64 1;  4C92 A;  3OS5 A;  3M53 A;  1M9S A;  5LJ3 g;  3CMA A;  2QG9 B;  4M78 B;  2J05 A;  5AYF A;  4EMK A;  2AIR B;  1BBZ A;  3SDZ A;  3E9G A;  4XU3 A;  1BCO A;  3X28 B;  2JT4 A;  1BI2 A;  4ELZ C;  2JTF A;  1V29 B;  3PMI A;  3VRZ A;  2KI7 A;  3L2Q A;  3CD6 A;  2MCN A;  2YRV A;  4PFO A;  4OB1 B;  3EFO B;  2CH4 W;  5GAN 4;  4OMM A;  3CME A;  1YIJ A;  1GCQ C;  3CCJ Q;  2QQS A;  2W10 A;  1QCF A;  5DM7 R;  4PJO B;  5GAM j;  2FYK A;  2NUT B;  4XU0 A;  5IXF A;  3EGU A;  3MEV A;  1S1N A;  1PG5 B;  4XK8 E;  3G4S T;  2DE0 X;  4F7U B;  4R56 A;  1JJ2 P;  3A8O B;  4A4K A;  1M1K U;  1QLY A;  3H0H A;  1XJW B;  1JEG A;  3CCQ T;  2DVE A;  1VQP Q;  1ZBJ A;  1N27 A;  1I5O B;  2OAW A;  2ED1 A;  2VWF A;  3UA6 A;  1E6H A;  1NBE B;  1ZSZ B;  5KH6 A;  3HRU A;  2XD0 A;  1YFN A;  1X27 A;  1WNL A;  1VQ6 Q;  3CCS Q;  2IVW A;  1KFZ A;  1G83 A;  1YJN Q;  1YHQ T;  3CCR T;  3CCE T;  2DTO A;  2RNA A;  4Z89 A;  3EFS A;  3QWY A;  4BI3 A;  5GMK h;  4K11 A;  1RLP C;  3I35 A;  4N4H A;  4MZT A;  5HCK A;  1Q81 C;  4OB3 B;  2PNI A;  2VGM A;  1PD1 A;  2V26 A;  4ZN1 A;  5CKE A;  3VUB A;  3OYK A;  2CZ6 B;  1AWO A;  4F7U F;  3HFO A;  1CKA A;  4PL6 A;  2AZS A;  2LCL A;  4AFU C;  2KRM A;  3SB2 A;  4C5E A;  5HKC A;  3QKJ A;  1PD0 A;  5GAN h;  1QP2 A;  1IB8 A;  1UGP B;  4J7I A;  2QEX A;  4M7A C;  3EH2 A;  4LN2 A;  5GMK m;  1RAD B;  3G6E T;  1N8R U;  2DTI A;  5L8R E;  1Q7Y R;  3SEM A;  4C92 D;  1GBQ A;  1Y07 A;  1SPK A;  3JCM P;  2FB7 A;  3OYA A;  5GAN d;  1WFW A;  4L59 A;  2RQT A;  4QVC A;  1UJ0 A;  1AD5 A;  1JXO A;  3G4S Q;  1VQ8 T;  2FRY A;  4M78 A;  2F2V A;  3TSW A;  3QDR B;  3U23 A;  2O4X A;  1ZUU A;  2DER A;  2NLU A;  2DAQ A;  4JRQ A;  3PGG A;  3M9Q A;  4HVU A;  3X26 B;  1ZUK A;  2HD0 A;  2HL3 A;  3A8G B;  1Q82 C;  3RES A;  4A63 B;  4DEY A;  5GAN f;  2KK4 A;  1G8X A;  5A2Q E;  2PQW A;  3EFO A;  4MZP A;  1A0N B;  2HDA A;  5FU6 C;  3LGL A;  1E7O A;  2EQI A;  1H3H A;  3MEU A;  3V8J A;  4PJO A;  1M2V B;  3QPH A;  2NUT A;  5FU7 C;  4AMC A;  1Q82 R;  1KSW A;  2OAU A;  1VQ7 A;  1UHF A;  1D09 B;  1U8R A;  1X6B A;  2CKK A;  3QWX X;  4F7U A;  1I8F A;  2DD4 A;  3M0P A;  2RI3 A;  2PVD B;  1YHQ Q;  4XTX A;  5LJ3 h;  3I5S A;  3CCR Q;  4FYV B;  3CCE Q;  1K0S A;  3S3O A;  3M54 A;  1R77 A;  1HK9 A;  2IG0 A;  1OOT A;  2KEA A;  1VQO T;  4X9D A;  4C92 G;  4BDZ A;  2DRK A;  5CR2 A;  4J8O A;  4BAC A;  3CC7 A;  1Q81 U;  1WXB A;  1ZSZ A;  1QKX A;  2M1H A;  2GTJ A;  3MKD A;  3R6O A;  3D7S B;  5LJ5 g;  2EQK A;  2JTM A;  2QDY B;  4M7A B;  3JCM g;  1QVF P;  1WQ7 A;  3HL8 A;  2EAY A;  3S6W A;  1FMV A;  2RQR A;  2BIV A;  3I5R A;  3L1A A;  2R5A A;  4FW2 A;  4XQ3 A;  1LPL A;  2LQ8 A;  4M77 E;  1K9M R;  1TS9 A;  3CCL Q;  4OMN A;  3PVQ A;  4J9F A;  1BKB A;  5LJ3 f;  4C8Q E;  4RMO A;  2QK0 A;  4AFQ C;  1VQM A;  3FDR A;  1NEB A;  2O2O A;  3OW2 A;  2K3Y A;  5ECA A;  1WJR A;  2DJQ A;  1KHC A;  3VJP A;  2DZ9 A;  5AT1 B;  2BUD A;  3QII A;  3RMQ A;  1G3Y A;  1KC8 C;  5I11 A;  3GP8 A;  1QCO A;  2XG8 D;  5GAN 8;  3MPU B;  5FU6 B;  1GCQ A;  2DIQ A;  5IHN A;  5KYX B;  4NL3 A;  4IIM A;  2BE9 B;  4M7D E;  3M57 A;  3MEW A;  5FU7 B;  4JZ4 A;  2P0P A;  4ESR A;  5GMK i;  1PCX A;  2X4W A;  1JXM A;  4RCB A;  1TUG B;  2K2V A;  1RLQ C;  2NUP B;  1D1A A;  1KC8 R;  1X6G A;  4M78 D;  1OQK A;  2CP0 A;  4EIK A;  1NG2 A;  5I2S A;  1H8K A;  1VIE A;  1W4S A;  2YSQ A;  2Z0W A;  4KGX B;  4WCI A;  5GAN 5;  3FRN A;  4ZGE B;  2EYZ A;  4ANJ A;  1I07 A;  1MHN A;  1VQ4 A;  2CP5 A;  1D1C A;  3PMT A;  2JM8 A;  3M0Q A;  1VQO Q;  5I22 A;  2HSP A;  1J3T A;  2DXU A;  2FPE A;  3H41 A;  4OGE A;  2CS7 A;  2LC4 A;  4PJO D;  1IHV A;  5GAM e;  5IH2 A;  1X2Q A;  2RPN A;  4JRI A;  4BUG A;  3V7S A;  3OYM A;  3REB B;  1X69 A;  3DLL A;  1I81 A;  3PTA A;  2EVR A;  4CC7 A;  1VQ5 A;  1KD1 C;  3JB9 D;  4KH1 B;  1WXT A;  4C0Z A;  2LNH B;  1P92 A;  1U1S A;  4DBH A;  2DO3 A;  1YJW T;  1UFF A;  1KK7 A;  1M3C A;  3RR6 A;  3E2U A;  3LWH A;  4NS5 A;  5J39 A;  2E1H A;  5GAO q;  1X6O A;  1X01 A;  1WXU A;  3BE3 A;  1UGS B;  1KD1 R;  5A0G A;  1VQ9 T;  2HSE B;  2GFU A;  1C0M A;  1PM3 A;  1O9S A;  2L3Q A;  4A4H A;  5HY6 A;  2OTJ T;  5KYY B;  3CCU T;  4JLI A;  4M78 G;  1MGQ A;  4M7A A;  3UPU A;  4P5N A;  1ZA1 B;  3RDV A;  5GAN 2;  4FM4 B;  1CKB A;  2H3J A;  4J9G A;  3A8L B;  2RK1 A;  4BDY A;  4FCY A;  2HZY A;  3NHN A;  1LJO A;  4E7L A;  1D1B A;  3INZ A;  4L5G A;  1OV3 A;  2O9V A;  1JBM A;  4PJO G;  2MF2 A;  3DLM A;  2CZ0 B;  1ACM B;  2XKO C;  5CKD A;  4OGC A;  2AKL A;  2DL4 A;  1EZZ B;  3RBB B;  1UGV A;  4F7U G;  2YXY A;  2RJD A;  5IXB A;  2VKN A;  1FXX A;  5D7U A;  4EDU A;  3CXC S;  2L2P A;  1PHT A;  1GRI A;  3CC2 T;  3JB9 G;  1OI1 A;  5CQY A;  1VYV A;  1M3B A;  5LJ5 h;  4BE2 A;  3JCM h;  2VB6 A;  3VS1 A;  5KYX A;  3FIF A;  1MUZ A;  1JJ2 A;  3GF5 A;  4LE9 A;  4PK4 A;  2XI9 A;  1N6A A;  5DLO A;  2NUP A;  2O9S A;  4II1 A;  1ZUY A;  3ULR B;  2CSQ A;  2V8K A;  1NEG A;  2HKQ B;  3CCJ A;  4IUU A;  3FJP A;  3LWI A;  1T3L A;  1ZQ1 A;  4PLL A;  2D6F A;  3CXC A;  1YIT Q;  1YJ9 T;  2OTL T;  2KRO A;  2BZY A;  1YJW Q;  5J3B A;  1Y96 A;  2ZPI B;  2RK2 A;  1KQ1 A;  2YLC A;  4A53 A;  4RG8 A;  4C92 F;  5LJ5 f;  3MP6 A;  1LOJ A;  3JCM f;  2A7Y A;  1VQP A;  1VQ9 Q;  5GAO m;  1QP3 A;  2BKD N;  3SHW A;  2VXE A;  2DPP B;  3EHR A;  2OTJ Q;  1M8V A;  4V2S A;  3CCU Q;  2KNB B;  4LDW A;  3UWN A;  3H0I A;  4C5I A;  3CCV T;  2LQK A;  3PT9 A;  2A08 A;  4RKU E;  1BK2 A;  3HRT A;  3EGD A;  1R8O B;  2CH4 A;  2XHC A;  1VQ6 A;  3BY7 A;  2IIM A;  1SRL A;  1GXI E;  2M02 A;  4F04 B;  3CCS A;  2EQM A;  3V7R A;  1M3A A;  3C4S A;  3OB9 A;  5DY9 A;  1ABQ A;  4PJL A;  3OYH A;  1YJN A;  4C0G A;  1K8A C;  2O01 E;  4CI0 C;  1Z9Z A;  4A4E A;  1VQN Q;  2EQU A;  2JVV A;  1UEC A;  1D0Z A;  4N4I A;  1JRI A;  2YHT A;  2LVM A;  3KBG A;  3QSU A;  2GQV A;  1IRE B;  4M7A D;  1ABO A;  2WAC A;  5KYY A;  3EGX A;  2LRQ A;  1W2B S;  3I55 A;  1JU5 C;  4IIO A;  5EC7 A;  3CC2 Q;  4HCZ A;  2RMO A;  4RTW A;  5DLQ E;  2CSI A;  2FRW A;  2R5M A;  4XTZ A;  4C92 E;  4KUL A;  2GBQ A;  2VC8 A;  2K6D A;  4E47 A;  2P4T A;  3J81 E;  1WPY A;  3PIP A;  4X9C A;  3FEO A;  1QWE A;  3VS6 A;  3OYC A;  2Y4Y A;  3THK A;  3ZFJ A;  3KXT A;  3LH5 A;  5KYW B;  3M0U A;  3JCM b;  3R6N A;  3VS7 A;  4BE0 A;  4JJD A;  4HT9 A;  2COY A;  2O4X B;  2RHU A;  3REA B;  7AT1 B;  1W2B A;  1IGU A;  2KR3 A;  1PNJ A;  1YJ9 Q;  2ESW A;  2K5L A;  3G4S A;  2OTL Q;  3PNW C;  4M77 C;  2ZPG B;  3DB3 A;  3CBP A;  4M75 E;  1AZE A;  4PFZ A;  3RKX A;  4E7I A;  3M55 A;  2HMA A;  1BCM A;  1K0X A;  5A0D A;  5KCO A;  2K3B A;  1VQL Q;  1QVG S;  2R58 A;  5A0L A;  3CPW A;  2GGR A;  2ECZ A;  2M9U A;  4M7A G;  1MMN A;  3A8H B;  3CCV Q;  3JSC A;  4MDW A;  3GNG A;  3JB9 I;  4DOV A;  3LYI A;  4GLK A;  1BIB A;  3FB9 A;  3QDF A;  2RJF A;  3H9N A;  4E7S A;  2RB6 A;  3TCJ A;  2LQN A;  4HKE A;  4R55 A;  1UUE A;  2K7A A;  2PUO B;  3PVL A;  4IUR A;  2JUF A;  3JCM W;  4FL6 A;  3CBM A;  3CCR A;  1K8A U;  2WSC E;  2I2L A;  3WVE B;  4B9W A;  3CD6 T;  3M4G A;  1AWJ A;  2D1X A;  4FW1 A;  1QVG A;  2X4J A;  3J7A F;  4ZN3 A;  3CME T;  2VAS A;  4M78 F;  3BDL A;  1RAI B;  2FG0 A;  4EMH A;  3NFC A;  3PE0 A;  4XTY A;  2LT1 A;  4OB0 B;  3NMZ C;  3M59 A;  6AT1 B;  3OS2 A;  4AG2 C;  1ZHI A;  5FWB A;  2OX7 A;  1B34 B;  2EYX A;  5FLX E;  2KT1 A;  4D8K A;  2WSF E;  3EH1 A;  2MYS A;  3L2U A;  1G2B A;  3X25 B;  3BDU A;  4PJO F;  3CCL A;  2CT3 A;  2B86 A;  1Q7Y C;  3H6Z A;  3HPW A;  2F1L A;  3JCM Q;  2QQB A;  3VS0 A;  2NUZ A;  1EX4 A;  2K3X A;  1UB4 A;  2X9H A;  1M4Z A;  4J9D A;  4M77 B;  2Y4X A;  3EFR A;  1SEM A;  1QCN A;  4HVV A;  3JB9 F;  1GFD A;  1M1G A;  1C6V X;  1VIF A;  3LW5 E;  5GAM h;  5GAO r;  1N9S A;  2RJE A;  1FWZ A;  2FHD A;  5LJ3 j;  4JJN K;  2QGF B;  4KGV B;  1M90 C;  2CYZ B;  4BD3 A;  1GBR A;  3HRS A;  4QW2 A;  1B7T A;  1SSF A;  4M78 E;  2HQH A;  3VS2 A;  5GAM d;  4ATO A;  2CP3 A;  2QTX A;  2KXC A;  5KYW A;  2EGC A;  2A28 A;  4KUI A;  1YNZ A;  5CO7 A;  2JTE A;  4Y91 A;  1M90 R;  5CKF A;  3CCQ Q;  4MZM A;  2JMC A;  2PUK B;  1M1F A;  3V7C A;  3PIO A;  4AT1 B;  1OEB A;  2X3W D;  4PKC C;  1K1Z A;  3I56 T;  4MMK A;  2E5Q A;  3CC4 T;  4ZTJ A;  4E7Z A;  4OB2 B;  3CD6 Q;  2YUO A;  2DBM A;  3RIR A;  1C1A A;  1VQO A;  2E64 A;  4F7U E;  3QBY A;  5GMK l;  3CEY A;  2KBT A;  2BZ8 A;  1TUC A;  2LTO A;  2VYT A;  2JXB A;  2E6Z A;  2KQW A;  3TVT A;  1K4U S;  1VYU A;  4FT2 A;  1UHC A;  5CCA A;  1GCP A;  2O31 A;  3G1J A;  2QQ9 A;  3ZL7 C;  4FSX A;  3V8K A;  5KCH A;  2FEI A;  4XAX B;  3UF4 A;  2C0O A;  4XTW A;  3OYN A;  2WSE E;  2RHZ A;  3OW2 S;  3VUZ A;  1K9M C;  2VV5 A;  2ZPB B;  2JZ2 A;  2M0Y A;  3JB9 J;  4XTU A;  1I5L A;  2DK3 A;  1Q7Y U;  3OYB A;  1OUL A;  4ORZ A;  3LX7 A;  1D0Y A;  2DIL A;  4L6V 5;  1VQ7 T;  1FX7 A;  4DBQ A;  1OPL A;  3OYG A;  3G6E Q;  1B34 A;  3MP8 A;  3VV0 A;  1PWT A;  3NPF A;  4XU2 A;  1MMD A;  2AK5 A;  2DET A;  3AHU A;  4O5V A;  2DYI A;  5IT9 E;  2L3P A;  2A3L A;  1BI3 A;  2DF6 A;  4ZGD B;  4LDY A;  1RAC B;  5KE2 A;  3CCM T;  1QW1 A;  4DBF A;  1TU0 B;  1NJI C;  2DM1 A;  2JMA A;  3WVD B;  3MCA B;  2XDP A;  1VQ8 Q;  2LT4 A;  4J6Y A;  3CC7 T;  4JUV A;  4M77 A;  3M56 A;  1ZLM A;  4HCK A;  1Q86 C;  4BY6 C;  4PNO A;  2YT6 A;  1NJI R;  4C8Q A;  2NWM A;  2E10 A;  2FVU A;  2YDL A;  5GAO p;  1OZ3 A;  3C12 A;  4AFS C;  1Q82 U;  3I56 Q;  3QJ6 A;  4E6R A;  3CC4 Q;  1KQS S;  2ZCF B;  4NL2 A;  4GY5 A;  2EYY A;  4VUB A;  4F16 A;  2LZ6 B;  2K79 A;  2RD1 A;  1Q86 R;  1UDL A;  1RAE B;  4C5H A;  3CBO A;  3VKI A;  2A37 A;  4M7A F;  3EG0 A;  2HQX A;  1WYX A;  2V8I A;  4J9C A;  2DNU A;  3MO8 A;  3H8Z A;  3UT1 A;  3O8V A;  1YP5 A;  2KRN A;  3VS4 A;  2QQA A;  1Y96 B;  2F2W A;  4EPC A;  3OS0 A;  3MP1 A;  4B6M A;  2DL3 A;  2F69 A;  2R57 A;  4TVR A;  1YIT A;  3HSB A;  1YJW A;  1KQS A;  2CZ7 B;  5GMK e;  1Y0M A;  4J83 A;  4A4G A;  2QA4 T;  1K9M U;  3FC3 A;  1WI7 A;  2HBW A;  4Z02 A;  2V8J A;  3E9F A;  4MDX A;  2MMP A;  1K9A A;  3EGD B;  2PVG B;  3QXE B;  4WF2 A;  2OTJ A;  5EG2 A;  2HQE A;  3CCU A;  2X35 A;  3QHS A;  3JV3 A;  5GAN e;  1R0B G;  2GNC A;  4M75 C;  2JN0 A;  2YWW A;  1W6X A;  2C0T A;  5LJ5 j;  1KIK A;  4JDS A;  4NOY A;  1G3T A;  1XQH A;  2HEQ A;  2YUQ A;  1HYO A;  1TXQ A;  1DJ7 B;  1Q95 G;  5HK0 A;  3CCM Q;  3WXM B;  4M7A E;  5J26 A;  2A36 A;  4Z8A A;  1QKW A;  3EGX B;  3QO3 A;  1VQN A;  4BY6 B;  4MML A;  1BIA A;  2ATC B;  4OP0 A;  1KHI A;  2EJF A;  2J6K A;  2LMJ A;  3RKW A;  1KC8 U;  2J06 A;  4BI8 B;  2L3S A;  4BI4 A;  3CC2 A;  2EWN A;  1JJ2 S;  4CC2 A;  3GBQ A;  4JS4 A;  2LX7 A;  4GBQ A;  5HK3 A;  2ZAE A;  3MET A;  3SFM A;  4DQ2 A;  1BI0 A;  2DBK A;  3AT1 B;  4A54 A;  4M77 D;  3C0C A;  3EG9 B;  3FJ5 A;  2HAX A;  1S72 T;  2DMO A;  2RQU A;  2RHI A;  1TSF A;  2RA2 A;  4LDV A;  1TUD A;  4DOW A;  5LJ3 e;  2KYM A;  4OML A;  2ENM A;  3M0R A;  1AWW A;  3EAE A;  5CQX A;  5M9O A;  3TSZ A;  1YJ9 A;  3OQ5 A;  3QG1 A;  2KGT A;  2OTL A;  2DZC A;  2E70 A;  1NYG A;  2RQV A;  2SRC A;  4J9H A;  1PRM C;  3OW2 P;  2FPD A;  2QA4 Q;  3S3M A;  4BB7 A;  3F70 A;  4FSS A;  3JB9 H;  1O75 A;  4RCC A;  4M4Z A;  1TG0 A;  1VQL A;  5D6Y A;  3ASK A;  4IUP A;  1PSE A;  4M75 B;  1BB9 A;  3TEE A;  3ZBD A;  2H8H A; 
#chains in the Genus database with same CATH homology
 1Y71 A;  4XTV A;  3RES A;  5A0L A;  3NTK A;  1KD1 U;  5GAN f;  1N9R A;  2KK4 A;  3CPW A;  5GAO n;  2F5T X;  2M9U A;  5A2Q E;  2JNG A;  3MEA A;  3CCV A;  2PQW A;  4MZP A;  4M7A G;  3BW1 A;  3A8H B;  5FU6 C;  4EMK C;  3JSC A;  3LGL A;  4ZTF A;  3MEU A;  3OYY A;  4MDW A;  3V8J A;  3GNG A;  5D6W A;  3OBW A;  4HA8 A;  3JB9 I;  4DOV A;  3LYI A;  4GLK A;  3SWN B;  4PJO A;  3X24 B;  2QI2 A;  1KG1 A;  3G71 T;  3QPH A;  1BIB A;  4A4F A;  1VQ9 A;  3FB9 A;  5FU7 C;  2RJF A;  2L3R A;  2RB6 A;  5FRN A;  3TCJ A;  2L5Q A;  2OAU A;  5CKH A;  1VQ7 A;  1NE8 A;  4HKE A;  3V8L A;  4R55 A;  1U8R A;  2CKK A;  4F7U A;  1I8F A;  4FIB A;  2PUO B;  2DD4 A;  4IUR A;  2K5I A;  5GAM g;  2C06 A;  2JUF A;  3JCM W;  2RI3 A;  1HXD A;  3OYF A;  3VYG A;  2XID A;  4EMG A;  2PVD B;  3L2R A;  1G3S A;  2LNV A;  2M0O A;  3CBM A;  3LH0 A;  2WSC E;  4FL6 A;  2FL7 A;  4XTX A;  2I2L A;  2RI2 A;  2HNI A;  4M77 G;  5LJ3 h;  5CK9 A;  3WVE B;  4B9W A;  3CD6 T;  3M4G A;  5CIU A;  3CCR A;  3S3O A;  3M54 A;  1QVG A;  1HK9 A;  2X4J A;  2IG0 A;  2YLB A;  4ZN3 A;  1KQ2 A;  3J7A F;  3CME T;  2ZGW A;  2MWP A;  1VQO T;  4X9D A;  1VQ4 T;  2DIG A;  4M78 F;  5D6X A;  3QYH B;  4C8Q G;  3BDL A;  2L89 A;  4N0A C;  4OMF B;  4C92 G;  4BDZ A;  4EMH A;  1YIT T;  5CR2 A;  2KSS A;  3HP9 A;  3NFC A;  4XTY A;  2LT1 A;  1NJI U;  4J8O A;  4OB0 B;  2XK0 A;  3M59 A;  1RL2 A;  3TRE A;  3OS2 A;  4BAC A;  3CC7 A;  1ZHI A;  2M16 A;  1Q81 U;  1XTD A;  2ZZD A;  2M1H A;  1B34 B;  4KT0 E;  5GAN 3;  3R6O A;  3KUF A;  5LJ5 g;  5FLX E;  2GFA A;  3A8M B;  2EQK A;  2EQJ A;  2JTM A;  2QDY B;  4M7A B;  3JCM g;  2WSF E;  1WQ7 A;  4HCC A;  3T9N A;  1BYM A;  3HL8 A;  1YI2 T;  2EAY A;  3S6W A;  4FU6 A;  3L2U A;  4IUT A;  3GIB A;  1Q86 U;  1VQP T;  3OSV A;  2BIV A;  3L1A A;  4YTL A;  2XU8 A;  4UC4 A;  1VQ5 T;  2R5A A;  4C0D C;  4XQ3 A;  2KMT A;  3X25 B;  3BFM A;  2LQ8 A;  3BDU A;  4M77 E;  4PJO F;  1S72 A;  3CCL A;  2VXF A;  3DB4 A;  2L8D A;  3URG A;  4IUQ A;  1VQK T;  1Q7Y C;  3H6Z A;  3GLX A;  3HPW A;  3RUX A;  2EJ9 A;  3JCM Q;  1BKB A;  2QQB A;  5LJ3 f;  2RH2 A;  3CPF A;  4C8Q E;  4RMO A;  2K3X A;  1BI1 A;  1UB4 A;  1UEB A;  1M4Z A;  4M77 B;  1VQM A;  3FDR A;  2Y4X A;  2K4Y A;  3EFR A;  3JB9 F;  1M1G A;  3OW2 A;  2K3Y A;  1VQ6 T;  1VIF A;  4CRI A;  3LW5 E;  5GAM h;  3CCS T;  5GAO r;  2JOY A;  1WJR A;  1N9S A;  3GNF B;  3VU3 C;  2RJE A;  1LNX A;  1FWZ A;  2FHD A;  1KHC A;  4ZGJ B;  5LJ3 j;  3VJP A;  2DZ9 A;  4C92 B;  3GPL A;  2XDB A;  3JCM X;  3CPW S;  4JJN K;  3JCM J;  2D9T A;  2LDM A;  1VQN T;  2BUD A;  4C8Q D;  4OF1 A;  3QII A;  2LCC A;  2QQR A;  3RMQ A;  1G3Y A;  5CAI A;  4ME7 A;  1M90 C;  2CYZ B;  4BD3 A;  1KC8 C;  2GF7 A;  2HBP A;  3E19 A;  3GP8 A;  2XG8 D;  5GAN 8;  3HRS A;  4QW2 A;  3M58 A;  4EMK B;  5FU6 B;  3L2V A;  4HT8 A;  4PLI A;  1SSF A;  4M78 E;  2DIQ A;  2Y90 A;  4J6X A;  1NPR A;  4D6W A;  5GAM d;  1TH7 A;  4NL3 A;  1OZ2 A;  4ATO A;  3I55 T;  2QTX A;  2X4X A;  3M57 A;  4M7D E;  3MEW A;  1UGQ B;  4QQ6 A;  4KUI A;  2VGN A;  5FU7 B;  2P0P A;  5CO7 A;  1XOV A;  5GMK i;  4C5G A;  4E7H A;  2X4W A;  2AHJ B;  3L42 A;  4RCB A;  4Y91 A;  1QVF S;  3CCQ A;  1IZ6 A;  3G71 A;  2K2V A;  4C8Q C;  2EFI A;  5CKF A;  2RI5 A;  3JRZ A;  3QUI A;  5GMK j;  2ZPH B;  4M78 D;  4MZM A;  1JB0 E;  2PUK B;  1M1F A;  3V7C A;  3PIO A;  1N8R C;  4M7D D;  5I2S A;  4PKC C;  1VIE A;  1W4S A;  4OVA A;  3I56 T;  1D3B B;  4MMK A;  2E5Q A;  3CC4 T;  2RJC A;  3SD4 A;  3LLR A;  4C0F A;  3GOX A;  4ZTJ A;  4OB2 B;  4J7F A;  4B9X A;  5C6S A;  5GAN 5;  3FRN A;  4ZGE B;  5LJ5 d;  4BE1 A;  2ZPF B;  4M75 A;  3RIR A;  2CGH A;  3JCM d;  3CMA T;  3OS1 A;  5LL6 S;  2E64 A;  1MHN A;  4F7U E;  3OA6 A;  1VQ4 A;  1VQO A;  3PMT A;  5FRM A;  3QBY A;  5GMK l;  3CEY A;  2CZ1 B;  2DXU A;  5GAN j;  2LTO A;  2XIC A;  4LDX A;  2VYT A;  4OGE A;  4JLG A;  5I2M A;  2CS7 A;  4O6J A;  4M78 C;  3JCM c;  2LC4 A;  3G7Z A;  2D0Q B;  2E6Z A;  4PJO D;  2KQW A;  1YHQ A;  4M7D C;  5GAM e;  1QVF A;  4FT2 A;  4JRI A;  3CCE A;  1I4K 1;  4BUG A;  3SWN A;  3V7S A;  3OYM A;  5CCA A;  3OSS C;  4KUD K;  4C0D B;  1YI2 A;  2QQ9 A;  3DLL A;  1ZBX A;  1I81 A;  3PTA A;  3CCJ T;  2KAF A;  1YIJ T;  5IAY A;  4FSX A;  3V8K A;  4LD6 A;  1VQL T;  2DEQ A;  5KCH A;  1VQ5 A;  2F5K A;  4XAX B;  3JB9 D;  1KD1 C;  1G3W A;  2DXB A;  4XTW A;  4HCB A;  3OYN A;  2WSE E;  4C0Z A;  1P92 A;  1U1S A;  3E1S A;  2RHZ A;  5GAN g;  1EIF A;  2DO3 A;  3OW2 S;  1RI0 A;  3VUZ A;  1YJW T;  1K9M C;  1VQK A;  3OYD A;  3OYE A;  1M1K C;  2VV5 A;  1PSF A;  2ZPB B;  3NTH A;  3LWH A;  2JZ2 A;  4NS5 A;  5J39 A;  4PJO C;  2K57 A;  4FT4 A;  2E1H A;  5IN1 A;  1YCY A;  3JB9 J;  4XTU A;  1I5L A;  1WJS A;  2DK3 A;  5GAO q;  1Q7Y U;  5CKB A;  3OYB A;  1NPP A;  1X6O A;  3OYL A;  4QVD A;  1X01 A;  4ELY C;  2XDD A;  5LJ5 e;  3S3N A;  1YBY A;  3LX7 A;  3JCM e;  1UGS B;  3OMG A;  2DTH A;  4L6V 5;  5A0G A;  1VQ9 T;  2E6N A;  2RM4 A;  4JRK A;  2EIF A;  2EJG A;  2GFU A;  3ER0 A;  3QZ9 B;  3G6E A;  1M5Q 1;  2P0K A;  1O9S A;  4M75 F;  5I21 A;  1VQ7 T;  1FX7 A;  3J80 E;  4A4H A;  4Q5W A;  5HY6 A;  3JAM E;  3OYG A;  1B34 A;  2OTJ T;  3CCU T;  3MP8 A;  3VV0 A;  2KVQ G;  4JLI A;  4M78 G;  4XU2 A;  1MGQ A;  4QQD A;  3AHU A;  4M7A A;  4JRP A;  4O5V A;  3UPU A;  4M7D G;  4P5N A;  5GAN 6;  3DKM A;  5GAO l;  3P8B B;  5IT9 E;  5GAN 2;  2A3L A;  4FM4 B;  1BI3 A;  3C94 A;  2H3J A;  1NZ9 A;  1VUB A;  4LDU A;  4ZGD B;  3OYJ A;  2EYQ A;  4LDY A;  3QYG B;  3A8L B;  2RK1 A;  3ME9 A;  1QW1 A;  5KE2 A;  3CCM T;  4BDY A;  1NJI C;  1LJO A;  3RER A;  4E7L A;  5CVI A;  1XNI A;  3UDC A;  1VQ8 A;  2E41 A;  3WVD B;  3MCA B;  2P0Q A;  4C8Q B;  2XDP A;  3INZ A;  1YJN T;  4L5G A;  2LT4 A;  4J6Y A;  2DKG A;  1X75 C;  3CC7 T;  4JUV A;  2E12 A;  3C95 A;  4M77 A;  3M56 A;  1JBM A;  2RHX A;  3M5A A;  1WQW A;  2MF2 A;  4PJO G;  5FRO A;  4J6W A;  3DLM A;  1G5V A;  2CZ0 B;  1Q86 C;  2XKO C;  4BY6 C;  5CKD A;  4PNO A;  4OGC A;  2B8A A;  4X34 A;  4Y28 E;  4C8Q A;  4F7U G;  1UGR B;  2E10 A;  2RJD A;  3FLG A;  5C0M A;  3I56 A;  2FVU A;  1H64 1;  1FXX A;  4C92 A;  2DXT A;  1OZ3 A;  3C12 A;  4XU1 A;  5GAO p;  3OS5 A;  4EDU A;  3CXC S;  1Q82 U;  3M53 A;  3QJ6 A;  1KQS S;  3CC2 T;  3JB9 G;  1OI1 A;  5CQY A;  3CCL T;  2ZCF B;  4NL2 A;  1M9S A;  2X4Y A;  4GY5 A;  3RKY A;  5LJ5 h;  4VUB A;  3NTI A;  5LJ3 g;  3CMA A;  4BE2 A;  3L2Z A;  3JCM h;  4M78 B;  2DXC A;  3JCM V;  5AYF A;  4EMK A;  2RD1 A;  4C5H A;  2KY9 A;  3CBO A;  3SDZ A;  3E9G A;  4M7D B;  3VKI A;  4XU3 A;  3X28 B;  4M7A F;  1BI2 A;  2HQX A;  2V8I A;  3FIF A;  4ELZ C;  2JTF A;  1JJ2 A;  2K5F A;  3MO8 A;  3GF5 A;  4RG2 A;  1V29 B;  3OMC A;  3H8Z A;  3PMI A;  3UT1 A;  3O8V A;  2QEX T;  2XI9 A;  1N6A A;  5GAM f;  5DLO A;  4PJO E;  3L2Q A;  3CD6 A;  4II1 A;  2QQA A;  2YRV A;  3HFN A;  4OB1 B;  1Y96 B;  2V8K A;  3QZ5 B;  4EPC A;  1K73 C;  3Q1J A;  3CCJ A;  5GAN 4;  3OS0 A;  3CME A;  3MP1 A;  1YIJ A;  4IUU A;  1AHJ B;  5GAN 7;  3FJP A;  3LWI A;  2QQS A;  2F69 A;  2QXF A;  2R57 A;  5DM7 R;  4TVR A;  1ZQ1 A;  4PLL A;  1YIT A;  1D3B A;  3CXC A;  4M77 F;  2D6F A;  4PJO B;  5GAM j;  3HSB A;  2FYK A;  1YJW A;  3P8H A;  1KQS A;  2CZ7 B;  5GMK e;  4XU0 A;  4M75 D;  1YJ9 T;  2OTL T;  3MEV A;  4XK8 E;  2E65 A;  1Y96 A;  4J83 A;  5J3B A;  4A4G A;  3G4S T;  4F7U B;  4N0A A;  2ZPI B;  4R56 A;  2RK2 A;  2QA4 T;  1KQ1 A;  2YLC A;  1K9M U;  3A8O B;  4C8Q F;  4A4K A;  1M1K U;  3FC3 A;  4A53 A;  4RG8 A;  1H3Z A;  1K8A U;  4C92 F;  5LJ5 f;  3MP6 A;  1LOJ A;  2MWO A;  4Z02 A;  2A7Y A;  2DVE A;  2V8J A;  3JCM f;  3CCQ T;  1VQP A;  2RO0 A;  3E9F A;  3PFS A;  2MMP A;  4MDX A;  2RHY A;  5GAO m;  2PVG B;  1QP3 A;  3QXE B;  2BKD N;  4WF2 A;  1OYX A;  1N27 A;  2HQE A;  2VXE A;  5EG2 A;  2X35 A;  3CCU A;  2OTJ A;  3QHS A;  2DPP B;  3VYH B;  5GAN e;  2DJZ A;  1M8V A;  4V2S A;  4LDW A;  4M75 C;  3UWN A;  4C5I A;  2JN0 A;  3TU4 K;  3CCV T;  2LQK A;  4E7J A;  2MAM A;  3PT9 A;  5LJ5 j;  4JDS A;  4NOY A;  3OYI A;  4RKU E;  1G3T A;  1XQH A;  3HRT A;  1R8O B;  3RMS A;  5KH6 A;  3HRU A;  2XD0 A;  2XHC A;  3N5B B;  3CCM A;  1VQ6 A;  3BY7 A;  1GXI E;  1DJ7 B;  5HK0 A;  1WNL A;  3CCS A;  2EQM A;  2PVO B;  3V7R A;  3WXM B;  4M7D F;  3C4S A;  3OB9 A;  2LX9 A;  5DY9 A;  1Y7X A;  5J26 A;  4M7A E;  2IVW A;  3SWN C;  3OYH A;  1YJN A;  4C0G A;  1K8A C;  4DA4 A;  2O01 E;  3QO3 A;  4CI0 C;  1VQN A;  3X20 B;  4A4E A;  4BY6 B;  4MML A;  1BIA A;  1YHQ T;  5LJ3 d;  2EQU A;  3CCR T;  2PU9 B;  4QVZ A;  3CCE T;  2JVV A;  2DTO A;  4OP0 A;  2KDS A;  4N4I A;  4JS5 A;  1JRI A;  1KHI A;  2YHT A;  2LVM A;  3EFS A;  3KBG A;  2EJF A;  3QSU A;  4BI3 A;  5GMK h;  4IKF A;  1M90 U;  2GQV A;  1IRE B;  3RKW A;  4M7A D;  1KC8 U;  2WAC A;  2LRQ A;  1W2B S;  4BI8 B;  4N4H A;  3I55 A;  4MZT A;  1Q81 C;  4OB3 B;  2VGM A;  4BI4 A;  2EWN A;  3CC2 A;  1JJ2 S;  3LGF A;  4ZN1 A;  5CKE A;  3VUB A;  4JS4 A;  3OYK A;  4HCZ A;  2CZ6 B;  5HK3 A;  5DLQ E;  4IUV A;  4F7U F;  4M75 G;  3HFO A;  3OBY A;  4PL6 A;  3MET A;  3SFM A;  2LCL A;  2G3R A;  1BI0 A;  4N4G A;  4DQ2 A;  2R5M A;  4XTZ A;  3SB2 A;  4C92 E;  3HKS A;  4C5E A;  3QJY A;  3MHX A;  4KUL A;  5HKC A;  4A54 A;  3QKJ A;  2MI6 A;  2VC8 A;  5GAN h;  4M77 D;  1QP2 A;  1UGP B;  3M4Y A;  4J7I A;  2P4T A;  4E47 A;  2QEX A;  3J81 E;  1WPY A;  4M7A C;  3PIP A;  3G6E T;  5GMK m;  4X9C A;  3FEO A;  2HAX A;  3P8D A;  1N8R U;  3OYC A;  2DTI A;  2Y4Y A;  1S72 T;  1WJQ A;  4KBM B;  5L8R E;  3ZFJ A;  3KXT A;  2RHI A;  5KE3 A;  2VUB A;  2EKO A;  2RA2 A;  3JCM b;  4LDV A;  4DOW A;  4QQG A;  4C92 D;  5LJ3 e;  4BE0 A;  1Y07 A;  1K73 U;  4HT9 A;  3JCM P;  2RHU A;  2O4X B;  2FB7 A;  1W2B A;  3EAE A;  5CQX A;  5M9O A;  1VQM T;  3OYA A;  1YJ9 A;  3OQ5 A;  3QG1 A;  2OTL A;  5GAN d;  2DZC A;  4L59 A;  2E70 A;  4QVC A;  3CC4 A;  2K5L A;  3G4S A;  1QVP A;  3PNW C;  4M77 C;  2ZPG B;  3DB3 A;  3CBP A;  4M75 E;  2QA4 A;  4E7K A;  1VQ8 T;  3RKX A;  4E7I A;  4M78 A;  4BB7 A;  3S3M A;  4LD9 K;  2DD5 A;  3F70 A;  3QDR B;  3M55 A;  3OY9 A;  2O4X A;  3A5Z B;  4J5Y A;  3JB9 H;  3ZEH A;  1O75 A;  2NLU A;  2DAQ A;  4RCC A;  4JRQ A;  4M7D A;  1U1T A;  3PGG A;  3M9Q A;  3HHT B;  1VQL A;  5D6Y A;  3X26 B;  3ASK A;  5A0D A;  4IUP A;  2GCX A;  2ZPE B;  5KCO A;  3L2W A;  2HD0 A;  1PSE A;  4C92 C;  4M75 B;  3TEE A;  1QVG S;  1WGS A;  3A8G B;  2R58 A;  3ZBD A;  1Q82 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...