2DL4A

Solution structure of the first sh3 domain of stac protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
b'GSSGSSGNTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Stac
publication title Solution structure of the first SH3 domain of Stac protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl4A00
1K4US 2X3WD 4QT7A 1PWTA 1E6GA 4AFQC 4RTZA 5IXFA 2ESWA 1OOTA 2L3QA 1T0HA 2KYMA 1S1NA 2YUQA 2CH4A 3PE0A 4IIOA 1K0SA 1UUEA 2KGTA 1TUDA 2C0TA 2K3BA 1SHGA 4F17A 2V1QA 2H8HA 1M8MA 1GRIA 3A98A 1ZBJA 4JZ4A 2O9SA 1T0JA 1X6GA 2DL5A 2EKHA 3QWXX 5HCKA 1ZUYA 2RQTA 4HVWA 1VYUA 2L2PA 2KNBB 1K9AA 2HBWA 2P4RA 2YDLA 2ED1A 2BZ8A 1M27C 3KFVA 3VS4A 4HCKA 2X3XD 1AWOA 2JMAA 2CDTA 1UECA 1RLQC 4M4ZA 1UHCA 4AFZC 2LMJA 2CSIA 1WXUA 2KRNA 2YUOA 3NGPA 3SEMA 3H41A 1QCFA 2RQVA 5IHNA 2FPDA 3REAB 1ARKA 1CSKA 1JEGA 4RTUA 2VWFA 2A36A 2JMCA 2JM8A 2J06A 2AKLA 3EG3A 3IQLA 1PRMC 1PRLC 2ROLA 1WXTA 1ZX6A 4JJBA 2PNIA 2JS2A 1TUCA 2FPEA 2DMOA 1AZGB 1QKXA 1RLPC 1YP5A 3UA7A 1AVZC 2EVRA 4J9EA 4HVVA 4R0KA 1AWJA 2DL8A 5IHIA 1GFCA 1WA7A 2L3SA 4Z89A 2DRKA 3UATA 2DM1A 1GFDA 2LJ0A 4Z8AA 1E6HA 1W1FA 4FSSA 4J9FA 2XMFA 3H0FA 3GBQA 2D0NA 5EC7A 1CKBA 2CT3A 3ULRB 4CC4B 4HXJA 2K2MA 1IO6A 2HDAA 4ORZA 3VS3A 4EIKA 1M30A 3EGUA 2ROTA 1PHTA 1GL5A 2J6FA 3EG2A 2AZSA 3EG1A 2L0AA 5GJVB 1B3QA 1ZUKA 2V1RA 1J3TA 5IH2A 2OJ2A 4K11A 2DE0X 2ECZA 1UG1A 4LN2A 2SEMA 2GTOA 2MIOA 1OPKA 1X69A 1JU5C 2EGAA 2GTJA 3M0TA 2JT4A 2KBTA 2FRYA 4JPBW 2CT4A 1WXBA 4ESRA 1AOJA 2FRWA 2BZXA 1JXOA 2LQWA 4RTWA 3UA6A 2J7IA 1ABOA 2RF0A 3H0IA 1U5SA 5FWBA 1X2QA 2QDLA 2KEAA 1NM7A 1GCPA 3QWYA 2IIMA 2KT8A 2DJQA 1A0NB 2KXDA 4Z88A 4J9HA 4CC2A 4AFUC 2MCNA 1KJWA 1I1JA 2DNUA 2CREA 2A08A 2LZ6B 1E7OA 1SSHA 1Z9ZA 4J9DA 2AKKA 3VS0A 1UJYA 1UE9A 1JO8A 2EYXA 1NEBA 4GBQA 2CUDA 2FEIA 2DL7A 1OPLA 1QKWA 2VVKA 1MUZA 4D8DA 1BBZA 1H8KA 4IIMA 3EHRA 3NPFA 3VS5A 3R6NA 2OAWA 2GBQA 2O2OA 3TSWA 1OV3A 3PVLA 1W70A 3SHWA 2GNCA 2HSPA 1WIEA 1KSWA 4J9GA 3UF4A 3VRYA 4DEYA 4AG1C 2DYBA 2PTKA 4OMLA 4ZNXA 5I11A 1AWXA 2CUBA 2J05A 2K9GA 1VYVA 5ECAA 2RNAA 1YCSB 3EHQA 1PNJA 1BK2A 2DA9A 2DILA 3I5RA 3M0QA 4LUDA 3VS7A 1X6BA 3CQTA 2LJ3A 2KR3A 1YN8A 1G83A 1AD5A 2NUZA 1WI7A 2HEQA 4CC3A 2I0NA 2KRMA 2EPDA 2F2WA 2EYYA 2LX7A 1T3LA 2OI3A 3C0CA 4D8KA 2W10A 4JZ3A 5IHKA 1UHFA 1QWEA 2EQIA 3NHNA 1AWWA 1CKAA 4GLMA 1UTIA 3I35A 1RUWA 2DBMA 1SPKA 1WYXA 3M0UA 3TSZA 1VYTA 2FO0A 2RQRA 1PKSA 2M51A 1HSQA 2EGEA 1BB9A 1NYFA 3ZL7C 2JS0A 4KRTA 1YNZA 3RBBB 2ENMA 1OEBA 3RNJA 1I07A 1U06A 4RTXA 1SRLA 2F2VA 1Y57A 5FWCA 2CH4W 2KT1A 2JXBA 1LCKA 1G2BA 2NWMA 3M0SA 2LJ1A 1HJDA 4OMPA 1GBQA 2JW4A 2YUNA 4HVUA 3REBB 4LNPA 2BZYA 2G6FX 1BU1A 2JTEA 4X1VA 2E5KA 2D1XA 1UGVA 2KE9A 3JV3A 2DL3A 1H92A 3EG0A 1ZUUA 2J6OA 2RQUA 2M0YA 4J9CA 4F14A 5FW9A 1WDXA 4OMOA 1M3AA 1K76A 4OMQA 3I9QA 2A37A 2EBPA 1X27A 2K79A 2ABLA 2B86A 1XOVA 1K1ZA 1MV3A 1QWFA 2O31A 2O9VA 1VA7A 2BTTA 3PVQA 5I22A 3THKA 3FJ5A 1FMKA 1ZLMA 4WCIA 1Z9QA 2EW3A 2AZVA 2K7AA 5L23A 4AG2C 1MV0B 1AEYA 2GGRA 1V1CA 1SEMA 2KRSA 1ZSGA 2AK5A 4E6RA 2RMOA 1X43A 2A28A 1H3HA 4DEXA 1KIKA 1JXMA 3VS1A 2YT6A 2FPFA 1M3CA 2D8HA 2C0IA 2L3PA 3U23A 5IXBA 2GQIA 1WLPB 2W0ZA 2DLPA 2YSQA 3M0RA 1UJ0A 2KYBA 2K6DA 2FG0A 1NEGA 4JJCA 1YWOA 1QLYA 2ED0A 2J6KA 4RTVA 4J9BA 2KROA 2KXCA 3I5SA 2PZ1A 3VS2A 4RTYA 2C0OA 4CC7A 2SRCA 1NG2A 2DBKA 2LNHB 2DVJA 1I0CA 2RN8A 2EGCA 1N5ZA 1SRMA 2DL4A 2LP5A 1WX6A 4OMNA 1M3BA 1B07A 1PKTA 3TVTA 1AZEA 3O5ZA 3VRZA 4RTTA 1W6XA 1UFFA 2LQNA 2F2XA 4Y92A 2O88A 4AFSC 1NLPC 1GCQC 3NMZC 2JM9A 3H0HA 1GBRA 2DX1A 4RUGA 1K0XA 4A63B 1WFWA 2CSQA 1T3SA 2RQWA 4F16A 1YWPA 1X2KA 2HCKA 2MOXA 1KFZA 1Y0MA 4OMMA 1ABQA 5GJWB 1U3OA 2DF6A 3M0PA 2YUPA 3VS6A 4LUEA 1FYNA 4J9IA 1EFNA 2LCSA 1NLOC 1NYGA 1SHFA 2DRMA 2VKNA 1GCQA 1TG0A 1RI9A 1UDLA 1HD3A 2D8JA 2EYWA 2RPNA 2EYZA 4JJDA 4LE9A 3LH5A 1JQQA
chains in the Genus database with same CATH superfamily
1PWTA 1E6GA 4AFQC 3P8BB 1QVFS 1BI0A 2L3QA 3OS2A 1S1NA 1X6OA 2KAFA 2RB6A 5IAYA 1K0SA 3CPWS 1OULA 2KGTA 1TUDA 4F17A 3E1SA 2H8HA 1M8MA 3JCMb 1GRIA 3LWHA 3S3NA 1VQ6A 4DBFA 3EGXA 4BUGA 2DO3A 1ZSZC 2DD5A 1X6GA 3G4SA 1ZUYA 4M7DE 1VQ6Q 1VYUA 3JRZA 4OF1A 2X3XD 5HKCA 3G4SQ 1RLQC 4M4ZA 3CCVA 1UHCA 2KRNA 3NGPA 3EGXB 1U8RA 1Q81U 2RQVA 3CCST 1ARKA 2YWWA 3CCVQ 4J6XA 1CSKA 3PGGA 4RTUA 2JMCA 1KC8R 4JRQA 5LJ5g 2CZ0B 1M1FA 3ZEHA 3URGA 1I4K1 3EGDA 3IQLA 2VASA 1M5Q1 1ZHIA 2X4WA 4JLGA 3BDUA 3VYHB 2P0KA 2JS2A 3OYHA 3FC3A 4MZTA 1QKXA 5GANd 3OYEA 1YP5A 4XTYA 2RI2A 1AVZC 4HVVA 3OMCA 4P5NA 4M7AC 3PMTA 1Q81C 5IHIA 5KYXB 3EGDB 1WA7A 4C8QA 3CCMQ 3HFOA 5DY9A 2WSEE 2CKKA 4FSSA 2XMFA 1VQOT 3GBQA 3C94A 2D0NA 1RACB 2PU9B 5A0GA 4OB1B 5GMKi 7AT1B 3ULRB 1XTDA 2O4XA 4ORZA 3M59A 2RJEA 1PHTA 1GL5A 2LRQA 3MO8A 4LDVA 2EJGA 1J3TA 5IH2A 1O75A 2E5QA 4K11A 2VB6A 2ECZA 2GTOA 2MIOA 2QQAA 3G6ET 2O4XB 4KH0B 5CIUA 4E7IA 4M7AD 2KBTA 4JPBW 3M58A 1UGSB 1QVGA 4RG8A 3MCAB 3EAEA 2CT4A 4PJNA 1WXBA 2BZXA 2J7IA 2E41A 1BYMA 1IXDA 1XQHA 1D3BA 4FYYB 1S72A 4XQ3A 2M16A 2KEAA 5GANg 1OU9A 4RCBA 4PJOA 2KXDA 5GMKj 4Z88A 1K73U 5GAN7 1S72Q 2MK5A 4AFUC 2CREA 2QA4A 2A08A 4B6MA 3PTAA 3CC7T 1D3BB 2DPPB 4J9DA 3OS0A 3VS0A 3M5AA 3DLMA 1UE9A 2EYXA 2MF2A 4GBQA 5GAOl 2V8JA 1QP3A 2EQMA 2QA4Q 1OPLA 4WTOB 4XU2A 4ZGDB 1BBZA 4IIMA 1U1SA 5I21A 4M77G 4LXCA 3X24B 2OAWA 1NPPA 3C95A 2NUTA 5CCAA 2IG0A 4MMLA 3PVLA 4M7DA 1K73C 2XI9A 5GAN4 4DEYA 3UF4A 1VQMT 1TH7A 2FZCB 4AG1C 5DLOA 3GLXA 2CZ6B 2LT4A 2K9GA 1VYVA 2MWOA 5FRMA 1YCSB 1PNJA 4JS5A 2X4JA 2Y4YA 3QDFA 1M2VB 3I5RA 3M0QA 1VQ4T 4JS4A 4A4HA 4E7HA 5IN1A 2HKQB 1RI0A 3VS7A 2HQXA 4DBHA 5GAOn 4B9WA 2NUZA 4CC3A 3OYNA 2DETA 4LD6A 3MEUA 2AIRB 4PNOA 4LD9K 4D8KA 3KUFA 2EQIA 4E7LA 3QPHA 3OYKA 1CKAA 1RAIB 4QW2A 5CKFA 5J26A 3PIPA 4OMFB 1VQ5A 3WVDB 4M75G 5HK3A 2X4YA 3M0UA 3TSZA 3CC2A 1VYTA 1K8AU 4BE2A 4PJJA 2YRCA 2QASA 2EGEA 4XAXB 1B7TA 1NYFA 1VQ5Q 1IZ6A 1BI2A 2EJFA 1N6AA 1OEBA 3RNJA 3A8GB 4HA8A 4RTXA 1SRLA 4BDYA 1WHKA 1Y57A 3F70A 2FYKA 4ELYC 1LCKA 1BI3A 3M0SA 1GBQA 4HVUA 5FRNA 4IURA 2ZPEB 4LNPA 1K8AC 2BZYA 3CMEA 3J7AF 1KQSA 4L59A 2E5KA 4ATOA 1RAGB 1FMVA 4KULA 4M77B 2J6OA 2JN0A 3CMEQ 2M0YA 4VUBA 3P8HA 5KCHA 1M3AA 2E4HA 4LDUA 4OMQA 1TWBA 4F7UF 1X27A 3MEWA 4XU1A 2A3LA 2B86A 2MAMA 3M57A 2O31A 1VA7A 2Y90A 3CCLT 5HK0A 3PVQA 1FMKA 1WNLA 5GAMf 4WCIA 1Z9QA 2EW3A 3X25B 5L23A 2LVMA 1VQ6T 4Y91A 3OYBA 1ZSGA 4FYWB 3HKSA 1ACMB 4EMGA 4ZN1A 3OYFA 3VKIA 2FPFA 1M3CA 4FYVB 2L3PA 3OSSC 3CCVT 2YSQA 1YIJA 1WQWA 2KYBA 3L42A 4B9XA 2EIFA 4M75F 4PLLA 4FU6A 3CCUA 4M7AE 2ED0A 4J9BA 2XDPA 3I5SA 2PZ1A 5C0MA 1YIJQ 1NJIR 2OTLA 4FYXB 2SRCA 3CCUQ 2LNHB 4C0ZA 1N5ZA 2OTLQ 2BE7D 2DL4A 1WX6A 1M3BA 1B07A 3BY7A 3VRZA 2CP2A 2COWA 1W6XA 4RTTA 1KD1U 2LQNA 1R0CB 4Y92A 4PL6A 2JTMA 1RAEB 1NLPC 4M78B 3SWNA 1YITA 4KT0E 1WFWA 1UB4A 1T3SA 1YWPA 2NUPA 4FL6A 3FDRA 4OMMA 1U3OA 1RAFB 1QQJA 3VUZA 1YITQ 3CPFA 1BIBA 3M0PA 2A7YA 5GAOq 1VQNA 2LNVA 1MNEA 1I81A 2DKGA 1VQNQ 4C5GA 1UDLA 1PD0A 4MMKA 4II1A 3TCJA 1QVGP 1JQQA 1KD1C 2X3WD 3UT1A 4C92G 1D0XA 5IXFA 2B8AA 2DXBA 4IIOA 3A1PA 1UUEA 2LT1A 4A4GA 1MHNA 3MP8A 5J3BA 4M77D 3GNGA 1Y71A 3OBWA 3R6OA 1UGQB 4FCYA 4JZ4A 3I56A 2O9SA 3JAME 2K5LA 3DB4A 1T0JA 3BW1A 1W2BA 5GAMe 5M9OA 1KQ2A 1IREB 3BFMA 2GCXA 3OYAA 2L2PA 2KNBB 2P4RA 1N9SA 2ED1A 2DEUA 5CQYA 4J6YA 3I56Q 4GLKA 4HCKA 1AWOA 2JMAA 4OB2B 1AT1B 1OQKA 2KQWA 1S72T 2CSIA 4PK4A 3C4SA 1MMNA 6AT1B 3JB9G 5DLQE 5GAOm 3VU3C 3C12A 1ZSZA 1JEGA 2PVOB 2VWFA 4M78C 2A36A 3M4YA 2QA4T 1H641 2PQWA 3E19A 1EIFA 1KK7A 2J06A 3MKDA 2ROLA 1WXTA 1LOJA 1ZX6A 3JCMV 1EZZB 2K3XA 2DMOA 1AZGB 1RLPC 2AHJB 4J9EA 2P0QA 3M55A 3OYDA 4R0KA 1AWJA 4QVDA 5FLXE 2V8IA 3L2VA 2L3SA 2PUOB 5HY6A 2LJ0A 3HRTA 1KHIA 4Z8AA 1W1FA 2M9UA 4FM4B 2D9TA 3H0FA 5EC7A 4C5EA 1ZA2B 1KC8U 1K9MC 2CT3A 4M78D 3VS3A 4BDZA 1G8XA 1MNDA 4C92F 2ROTA 1NE8A 5KYNA 5KYYA 3JCMQ 2J6FA 3EG2A 1WHMA 5GJVB 1JJ2A 2MWPA 2V1RA 2OX7A 2OJ2A 5LJ3h 1PCXA 4PFOA 2GQVA 1H3ZA 3L2ZA 2DJZA 3RDVA 1OPKA 1X69A 4RCCA 2GTJA 4O5VA 2JUFA 2VGNA 3OYCA 5KYYB 2FRYA 1YJWQ 1N8RU 1KC8C 2HZYA 2RM4A 3RERA 2VXFA 4ESRA 2GFAA 4C8QG 2LQWA 3UA6A 1VQ5T 2H3JA 3CC2T 1U5SA 2CP0A 2DTOA 1X2QA 2EQKA 2QDLA 2LCCA 3JB9F 3VYGA 1GCPA 3QXEB 5D7UA 2IIMA 2KT8A 2DJQA 1O9SA 3HFNA 1PSEA 1KJWA 1M2OA 3G71A 4ZTJA 3CXCA 2GF7A 1JRIA 2LZ6B 1SSHA 1Z9ZA 2AKKA 2A0FB 3CCEA 3HRUA 1N8RC 3G71Q 1QVGS 2FEIA 2NYSA 3QBYA 3CCEQ 3VUBA 3CMET 5DM7R 5CKDA 2MI6A 2CS7A 3RKYA 5FU7B 4R56A 1YFNA 3TSWA 1VQ9A 1BCMA 2FVUA 5KYXA 3ME9A 3SFMA 2HMAA 1WIEA 1KSWA 2R57A 1D1AA 1M90R 5GAN6 1YBYA 2PTKA 4ZNXA 1VQ9Q 3V8LA 3CCMA 1AWXA 5LJ3d 1VIEA 1WQ7A 1PD1A 4L5GA 2RNAA 3EHQA 3J81E 4OVAA 1Q86U 2FZKB 2P0PA 4PJOG 4QQDA 1B34B 2HQHA 2L8DA 1X6BA 4A4EA 2M1HA 1YN8A 2FL7A 2QK0A 4HT9A 4DOWA 2HEQA 3A8HB 4KUIA 2LX7A 5FU6B 3C0CA 2YHTA 2WACA 5CR2A 2W10A 3M9QA 3CBOA 4JRIA 1RAHB 1QWEA 4LDWA 2JJ9A 3NHNA 4N4HA 5I2MA 1VQLA 1XJWB 3DKMA 4C8QF 4GLMA 2AT1B 2LQ8A 3CCUT 4M77E 2RK2A 5J39A 1Q86C 1RUWA 1WPYA 1TTHB 3I55A 4M7DG 3JCMe 1FX7A 1VQLQ 2OTLT 1D0YA 2FO0A 2OTJA 2P84A 1PKSA 2LC4A 2L3RA 1HSQA 2M51A 1BB9A 2D0QB 3I55Q 4RMOA 2JS0A 2QQRA 2VC8A 4KRTA 2OTJQ 2XG8D 1YNZA 3JB9H 1U06A 1I07A 3A8OB 5FU7C 2F2VA 2R58A 1QW1A 1SG5A 5GAOp 2NWMA 2LJ1A 1HJDA 1YITT 2LDMA 5LL6S 5LJ3g 2D6FA 3REBB 1Q81R 1KG1A 1TOVA 4DBRA 2KE9A 3JSCA 3CCJA 1WHJA 5FW9A 2E10A 1LVKA 1W2BP 2EBPA 2DEQA 1M8VA 2ABLA 5CKHA 1XOVA 3CCJQ 4C5IA 1FWZA 4JLIA 4PJOF 5FU6C 1BKBA 1IHVA 4J5YA 5A0LA 4N4IA 2BTTA 3JCMJ 3JCMc 3FJ5A 1LPLA 3CMAA 2ATCB 2K7AA 1M2VA 3L1AA 1YHQA 2DFUA 2G3RA 2KRSA 3I56T 2AK5A 3CMAQ 1X43A 4M78E 1KQSS 1MMAA 1YHQQ 4F7UG 3WVEB 1D09B 2YT6A 4BE0A 2QQ9A 1R0BG 2GQIA 5GMKh 1WLPB 2W0ZA 2DLPA 3OY9A 3M0RA 4FT2A 3DLLA 5KCOA 4M7DF 4JJCA 2J6KA 4RTVA 2COZA 2KXCA 4C0DB 5FROA 3P8DA 3VS2A 3GNFB 4DOVA 2C0OA 3UPUA 3TREA 3RIRA 1NG2A 1WHGA 3V7SA 2DIGA 3A8MB 4KUDK 2MPXC 2EGCA 2DXUA 1SRMA 2WSCE 3AHUA 5CK9A 2E1HA 3OYYA 1PKTA 3OS5A 3TVTA 3O5ZA 5A2QE 1UFFA 4FSXA 1VQ7A 2Z0WA 2MYSA 1GCQC 3OBYA 3S3OA 4XTUA 1VQ7Q 2HAXA 1FXXA 2V26A 1JJ2P 1KFZA 1Y0MA 5GJWB 1ABQA 2QGFB 1K73R 1YCYA 4F04B 2YUPA 4TVRA 1IGQA 2E64A 3D7SB 5CO7A 4Z02A 4QVZA 1OZ3A 1FYNA 1EFNA 3CBMA 1NLOC 1SHFA 2RA2A 2DRMA 2VKNA 4M77A 1F1BB 3PNWC 1RI9A 2D8JA 1HD3A 2RPNA 4LE9A 2RJCA 4Q5WA 3UWNA 4NL3A 3G1JA 4QT7A 2ESWA 2YRDA 3PE0A 2CH4A 2K3BA 2C0TA 3OA6A 1SHGA 3NTIA 2V1QA 4O6JA 4KGZB 2RI5A 3QKJA 4BI8B 1ZBJA 3CCSA 2DL5A 2EKHA 3QWXX 4L6V5 4QKUA 1Y96A 4C0DC 2ZPHB 2RQTA 1IRXA 1QMCA 3X26B 2KSSA 1K9AA 2YDLA 2BZ8A 3KFVA 3CCSQ 3VS4A 4UC4A 1BIAA 2QAZA 3OYIA 2HNIA 1UECA 4F7UB 5CKEA 5CVIA 2XDBA 4AFZC 4N0AA 2YUOA 3SEMA 3FIFA 4DA4A 2IPOB 2X35A 1IGUA 2RI3A 1Y96B 3QHSA 3G4ST 3EFOA 5GAMj 2ZPBB 2CGHA 5EG2A 1LJOA 4IUUA 2QTXA 1HXDA 4BB7A 2X51A 4XTZA 3CCRA 1PRLC 1UGPB 2PNIA 1W2BS 4PKCC 3OS1A 3CCRQ 4A4KA 3EFOB 1PC0A 2X4XA 3FLGA 2XICA 1R77A 3QYHB 3META 2DL8A 1K8AR 4M78A 1D0ZA 1VQ9T 4M75B 4Z89A 2DRKA 3UATA 2DM1A 2CZ1B 3E9FA 5KE2A 4EMHA 1WHLA 2E6ZA 4J9FA 1TU0B 3OSVA 3CCMT 1CKBA 3RKWA 3RMQA 4OP0A 4M77C 1I8FA 2YXYA 2QXFA 5LJ5f 1Q82U 1OYXA 2XU8A 4EIKA 2VYTA 3ZFJA 1M30A 3EGUA 4BE1A 4OB3B 3L2RA 1X75C 4MDXA 2K2VA 1PM3A 1PSFA 2AZSA 1R8OB 4XTXA 2ZZDA 1VQKA 2BIVA 3FJPA 1B3QA 2FZGB 1G3TA 1UG1A 4LN2A 3QZ9B 1W4SA 1VQKQ 2EGAA 1KHCA 3M0TA 3RUXA 4RKUE 1VQLT 2DIQA 4KBMB 1NPRA 4X9CA 1AOJA 1Q82C 2HBPA 2RF0A 3J80E 3H0IA 3OB9A 1BCOA 4N0AC 2OTJT 4MDWA 3QWYA 3RR6A 3M53A 1JJ2S 4M7AG 1Q95G 3KBGA 1V76A 2M0OA 8AT1B 4M75C 3VJPA 5KH6A 4Y28E 1UJYA 1JO8A 3EH2A 2I2LA 2CUDA 2DL7A 5GAOr 3M54A 1C6VX 1QKWA 2VVKA 4D8DA 2EKOA 2ZPGB 3NPFA 1G5VA 4YTLA 4XU3A 2QGGA 1M1GA 2O2OA 3LW5E 4AT1B 2VV5A 3JCMX 2XIDA 5CQXA 1OV3A 3X28B 5KYUB 3SHWA 2GNCA 5GANf 3TQ7P 2HSPA 1I5LA 2RH2A 4PJMA 5LJ3f 1LNXA 5KYWB 4J9GA 3NTKA 4NOYA 1DJ7B 2DYBA 2RHXA 1QCOA 4OMLA 3ASKA 5I11A 3CXCS 2CUBA 1KD1R 2J05A 4NS5A 4E47A 2ZCFB 2BE9B 4J7IA 3INZA 3ZBDA 1BK2A 2KY9A 3CMAT 2ZAEA 2DILA 4M75D 1JBMA 1YHQT 4EMKB 1OZ2A 3V8JA 2KR3A 1VQ8A 1Q7YR 1HK9A 5LJ5e 1WI7A 2EAYA 1XNIA 2KRMA 3E9GA 3OQ5A 2F2WA 2EYYA 1VQ8Q 2OI3A 4E7KA 1ZA1B 3QDRB 5IT9E 4JZ3A 3EG9B 5IHKA 3V7RA 1TS9A 2QYZA 3HL8A 4C0GA 1SF9A 1AWWA 2RJFA 3GOXA 5GMKl 3SDZA 2ZPFB 1WYXA 4C92B 2CP6A 1YJWA 2BUDA 1VQPA 3QSUA 2O01E 3ZL7C 4ANJA 2QTVA 1M1KR 1VQPQ 4M7AF 4GY5A 2ENMA 2R5AA 1KQ1A 2YLCA 2K57A 5GAMg 3SD4A 2JZ2A 5FWCA 2CH4W 2Y4XA 2VUBA 3Q1JA 3OYMA 2JXBA 1G2BA 4CRIA 4OMPA 1RADB 2JW4A 2YUNA 1WGSA 2K5IA 3CCQA 5AT1B 1OU8A 2JVVA 1KQSP 2G6FX 1BU1A 3CCLA 4X1VA 3X20B 3CCQQ 4E2FB 2DL3A 1H92A 4BACA 3EG0A 2CP7A 4EMKC 1K9MR 1D1CA 3CCLQ 4KGXB 2DVEA 2A37A 3G7ZA 2K79A 2QI2A 3NFCA 4OGEA 1X01A 3WXMB 2O9VA 1YJNA 3PMIA 3THKA 3M56A 2COYA 2E65A 1ZLMA 3L2WA 5GANe 3VV0A 1G3YA 5LJ3e 2AZVA 1SSFA 4MZPA 1MV0B 1B34A 1VUBA 5GAN5 4LDXA 2R5MA 1YJNQ 1AEYA 3FB9A 1V1CA 1SEMA 2CP5A 1YJ9A 4J83A 1OX8A 2RMOA 4HCBA 2A28A 2XHCA 4X34A 3JCMh 4PLIA 4DEXA 1VIFA 4C92C 2HL3A 4C0FA 3VS1A 1N27A 3FEOA 4J6WA 2D8HA 1YI2A 1YJ9Q 2EQJA 3U23A 1ZQ1A 2DERA 2NLUA 3OW2A 1UJ0A 3QUIA 4KGVB 2K3YA 4XK8E 1YI2Q 1WHHA 2DZ9A 1YWOA 1IB8A 5KE3A 1QLYA 2L89A 4HKEA 2CYZB 4RTYA 1BI1A 2F69A 2QDYB 2EFIA 4FW2A 1Y07A 1ZBXA 3CCRT 4ME7A 2DBKA 3QIIA 2HD0A 2DVJA 1I0CA 1M9SA 2RN8A 3RKXA 1YIJT 1WZOA 1N8RR 1AZEA 2ZPIB 3OYLA 1QVFA 2K5FA 1U1TA 2O88A 3QO3A 2MMPA 2HQEA 4AFSC 2CP3A 3NMZC 4C92D 1TSFA 3H0HA 3CPWA 1GBRA 2DX1A 1K0XA 4A63B 4C8QB 2ZGWA 1HYOA 2RQWA 2HCKA 1WJRA 2MOXA 5GAN2 2E3IA 2PUKB 4F7UE 3VS6A 3OMGA 4LUEA 2LCSA 4J9IA 3NTHA 2RJDA 3RMSA 5D6WA 3LGLA 1GCQA 1TG0A 2EYWA 4JJDA 2L5QA 4EPCA 3LH5A 2QQBA 1K4US 1I5OB 3QG1A 4RTZA 3JCMd 1VQKT 4FIBA 2BKDN 1OOTA 3LH0A 1T0HA 2KYMA 1VQNT 2EQUA 2YUQA 1NBEB 3JB9D 3RESA 3HSBA 1D1BA 1OX9A 2HL5C 3A98A 3V8KA 2QEXA 2JNGA 1Y7XA 5HCKA 3CD6A 3CC4A 2RHIA 2XD0A 4HVWA 4M75E 2HBWA 2QEXQ 1M27C 5CKBA 4QQGA 4PFPA 3CD6Q 3CC4Q 1Q86R 2CDTA 2PVGB 2V8KA 4BY6B 2LMJA 1FMWA 1WXUA 3H41A 1QCFA 5IHNA 1RL2A 4PJOB 2FPDA 4DQ2A 3REAB 4IUPA 1P92A 4IUTA 3HPWA 3JB9I 3KXTA 2DAQA 1G3WA 2F5KA 4C8QC 4HT8A 2JM8A 2AKLA 3EG3A 1AHJB 2M02A 1PRMC 2FHDA 2EWNA 4R55A 2HKNA 4JJBA 1TUCA 4C5HA 2E3HA 2FPEA 4ZGJB 2LX9A 4WF2A 3UA7A 4XTVA 2EVRA 3JB9J 4N4GA 3N5BB 1EX4A 2NUTB 3JCMg 1GFCA 3JCMW 2HSEB 4M7DB 2DXTA 2E70A 1SKUB 1GFDA 3V7CA 1E6HA 2RHYA 3PIOA 1QVPA 3JCMP 2LQKA 2RHUA 4ZTFA 1VOMA 4ELZC 1MGQA 5A0DA 2JTFA 3BDLA 4A54A 4CC4B 2E6NA 4HXJA 2K2MA 2XDDA 1IO6A 2HDAA 4C8QD 2P4TA 3EG1A 3HRSA 2L0AA 1VQ8T 4ZN3A 3M4GA 1ZUKA 3TU4K 2DZCA 1NJIU 1C0MA 2OAUA 2DE0X 2F5TX 2SEMA 4BY6C 5GMKm 3MPUB 1JU5C 2DYIA 4PJOC 1IHWA 2JT4A 3PFSA 4DBQA 4E7SA 5GMKe 3CC2Q 3CEYA 2QG9B 2F1LA 4M78G 2KVQG 2FRWA 1JXOA 4RTWA 1ABOA 1YJWT 2RHZA 1VQPT 3QJYA 5FWBA 4F7UA 1NM7A 4HCZA 2JOYA 1MMDA 3T9NA 1A0NB 4KH1B 1NJIC 1N9RA 4M77F 2KMTA 4IUVA 4LDYA 4J9HA 4CC2A 4FW1A 3CXCP 2MCNA 1I1JA 2DNUA 1PG5B 2FB7A 4M7DC 1E7OA 3MHXA 4QVCA 4NL2A 3L2UA 4D6WA 1C1AA 1NEBA 1RABB 3H9NA 2DK3A 3CCQT 4PJOD 1MUZA 1TXQA 5GAN8 1H8KA 4A53A 3EHRA 3G71T 4OB0B 3VS5A 3R6NA 3MEAA 2GFUA 3LLRA 4PJLA 3TEEA 2GBQA 3HTRA 4A4FA 3CCET 2CZ7B 2RO0A 4M75A 1W70A 3H8ZA 5D6XA 3VRYA 4C92E 4XTWA 1VQOA 4MZMA 4JDSA 2KI7A 1YJNT 5ECAA 4BI4A 3A5ZB 3MP1A 2DA9A 3MP6A 2E12A 1VQOQ 3O8VA 3OW2P 4JJNK 4M7DD 4LUDA 3GP8A 3CQTA 2LJ3A 1YJ9T 4X9DA 5GAN3 1G83A 1AD5A 2I0NA 2EPDA 2VGMA 1T3LA 3G6EA 1YI2T 3GIBA 3FRNA 1NZ9A 2RK1A 4PFZA 8ATCB 1JB0E 1UHFA 4OGCA 3HHTB 2YLBA 4M78F 5GAMh 5AYFA 4J7FA 3G6EQ 5I2SA 1QVFP 1RAAB 1UGRB 1UTIA 3GF5A 3PT9A 3LGFA 3I35A 2DBMA 1SPKA 5LJ5j 1WJQA 1QCNA 2LCLA 3CPWP 5L8RE 1G3SA 2WSFE 4IUQA 2DD4A 1Q7YU 3RBBB 4ZGEB 1OI1A 2LTOA 3I55T 3CC7A 3DB3A 3SWNB 2KT1A 5CAIA 4QQ6A 2NUPB 3CC7Q 2K4YA 2EJ9A 2KDSA 4XU0A 4AMCA 2JTEA 2D1XA 1UGVA 3JV3A 3L2QA 2C06A 3UDCA 3OYJA 2H3EB 1ZUUA 2RQUA 4J9CA 4E7JA 1Q7YC 4F14A 1WDXA 4OMOA 5KYUA 1K76A 3EFRA 1M1KU 2DTIA 3CBPA 3I9QA 1WJSA 2XK0A 5KYWA 5LJ5h 1VQMA 4J8OA 3S3MA 1K1ZA 1MV3A 3HP9A 4FT4A 1QWFA 1QP2A 5I22A 3E2UA 4JUVA 1VQMQ 3EFSA 3H6ZA 3LX7A 1VQ4A 3CCJT 4AG2C 4IKFA 1V29B 5GAMd 2GGRA 2QEXT 4EMKA 4CI0C 4E6RA 9ATCB 4E7ZA 1H3HA 3QZ5B 3CC4T 2IVWA 4RG2A 3CD6T 4C8QE 1VQ4Q 1KIKA 3A8LB 2KK4A 1JXMA 4JRPA 3EH1A 1UEBA 3ER0A 4V2SA 2C0IA 2DTHA 5IXBA 5GANj 1Q82R 1M1KC 5LJ3j 3QJ6A 1K9MU 1TUGB 3EG9A 4JRKA 3LYIA 2YRVA 2K6DA 2FG0A 1NEGA 2DXCA 3MJXA 3AT1B 1ZSZB 2KROA 3SWNC 4C92A 2EYQA 4CC7A 4BI3A 5C6SA 1M4ZA 2XKOC 5D6YA 4EDUA 2LP5A 4OMNA 1M90U 3S6WA 2RD1A 3SB2A 3MEVA 2PVDB 2F2XA 4HCCA 2JM9A 4RUGA 4M7AA 3QYGB 3OW2S 2CSQA 3OYGA 4F16A 1X2KA 5LJ5d 1GXIE 2DF6A 2QQSA 3GPLA 5GANh 1VQ7T 1MMGA 4PJOE 2VXEA 1NYGA 4M7AB 1M90C 3LWIA 2X9HA 3JCMf 4BD3A 2EYZA 2RQRA 3BE3A
chains in the Genus database with same CATH topology
1K4US 2X3WD 4QT7A 1PWTA 1E6GA 4AFQC 4RTZA 5IXFA 2ESWA 1OOTA 2L3QA 1T0HA 2KYMA 1S1NA 2YUQA 2CH4A 3PE0A 4IIOA 1K0SA 1UUEA 2KGTA 1TUDA 2C0TA 2K3BA 1SHGA 4F17A 2V1QA 2H8HA 1M8MA 1GRIA 3A98A 1ZBJA 4JZ4A 2O9SA 1T0JA 1X6GA 2DL5A 2EKHA 3QWXX 5HCKA 1ZUYA 2RQTA 4HVWA 1VYUA 2L2PA 2KNBB 1K9AA 2HBWA 2P4RA 2YDLA 2ED1A 2BZ8A 1M27C 3KFVA 3VS4A 4HCKA 2X3XD 1AWOA 2JMAA 2CDTA 1UECA 1RLQC 4M4ZA 1UHCA 4AFZC 2LMJA 2CSIA 1WXUA 2KRNA 2YUOA 3NGPA 3SEMA 3H41A 1QCFA 2RQVA 5IHNA 2FPDA 3REAB 1ARKA 1CSKA 1JEGA 4RTUA 2VWFA 2A36A 2JMCA 2JM8A 2J06A 2AKLA 3EG3A 3IQLA 1PRMC 1PRLC 2ROLA 1WXTA 1ZX6A 4JJBA 2PNIA 2JS2A 1TUCA 2FPEA 2DMOA 1AZGB 1QKXA 1RLPC 1YP5A 3UA7A 1AVZC 2EVRA 4J9EA 4HVVA 4R0KA 1AWJA 2DL8A 5IHIA 1GFCA 1WA7A 2L3SA 4Z89A 2DRKA 3UATA 2DM1A 1GFDA 2LJ0A 4Z8AA 1E6HA 1W1FA 4FSSA 4J9FA 2XMFA 3H0FA 3GBQA 2D0NA 5EC7A 1CKBA 2CT3A 3ULRB 4CC4B 4HXJA 2K2MA 1IO6A 2HDAA 4ORZA 3VS3A 4EIKA 1M30A 3EGUA 2ROTA 1PHTA 1GL5A 2J6FA 3EG2A 2AZSA 3EG1A 2L0AA 5GJVB 1B3QA 1ZUKA 2V1RA 1J3TA 5IH2A 2OJ2A 4K11A 2DE0X 2ECZA 1UG1A 4LN2A 2SEMA 2GTOA 2MIOA 1OPKA 1X69A 1JU5C 2EGAA 2GTJA 3M0TA 2JT4A 2KBTA 2FRYA 4JPBW 2CT4A 1WXBA 4ESRA 1AOJA 2FRWA 2BZXA 1JXOA 2LQWA 4RTWA 3UA6A 2J7IA 1ABOA 2RF0A 3H0IA 1U5SA 5FWBA 1X2QA 2QDLA 2KEAA 1NM7A 1GCPA 3QWYA 2IIMA 2KT8A 2DJQA 1A0NB 2KXDA 4Z88A 4J9HA 4CC2A 4AFUC 2MCNA 1KJWA 1I1JA 2DNUA 2CREA 2A08A 2LZ6B 1E7OA 1SSHA 1Z9ZA 4J9DA 2AKKA 3VS0A 1UJYA 1UE9A 1JO8A 2EYXA 1NEBA 4GBQA 2CUDA 2FEIA 2DL7A 1OPLA 1QKWA 2VVKA 1MUZA 4D8DA 1BBZA 1H8KA 4IIMA 3EHRA 3NPFA 3VS5A 3R6NA 2OAWA 2GBQA 2O2OA 3TSWA 1OV3A 3PVLA 1W70A 3SHWA 2GNCA 2HSPA 1WIEA 1KSWA 4J9GA 3UF4A 3VRYA 4DEYA 4AG1C 2DYBA 2PTKA 4OMLA 4ZNXA 5I11A 1AWXA 2CUBA 2J05A 2K9GA 1VYVA 5ECAA 2RNAA 1YCSB 3EHQA 1PNJA 1BK2A 2DA9A 2DILA 3I5RA 3M0QA 4LUDA 3VS7A 1X6BA 3CQTA 2LJ3A 2KR3A 1YN8A 1G83A 1AD5A 2NUZA 1WI7A 2HEQA 4CC3A 2I0NA 2KRMA 2EPDA 2F2WA 2EYYA 2LX7A 1T3LA 2OI3A 3C0CA 4D8KA 2W10A 4JZ3A 5IHKA 1UHFA 1QWEA 2EQIA 3NHNA 1AWWA 1CKAA 4GLMA 1UTIA 3I35A 1RUWA 2DBMA 1SPKA 1WYXA 3M0UA 3TSZA 1VYTA 2FO0A 2RQRA 1PKSA 2M51A 1HSQA 2EGEA 1BB9A 1NYFA 3ZL7C 2JS0A 4KRTA 1YNZA 3RBBB 2ENMA 1OEBA 3RNJA 1I07A 1U06A 4RTXA 1SRLA 2F2VA 1Y57A 5FWCA 2CH4W 2KT1A 2JXBA 1LCKA 1G2BA 2NWMA 3M0SA 2LJ1A 1HJDA 4OMPA 1GBQA 2JW4A 2YUNA 4HVUA 3REBB 4LNPA 2BZYA 2G6FX 1BU1A 2JTEA 4X1VA 2E5KA 2D1XA 1UGVA 2KE9A 3JV3A 2DL3A 1H92A 3EG0A 1ZUUA 2J6OA 2RQUA 2M0YA 4J9CA 4F14A 5FW9A 1WDXA 4OMOA 1M3AA 1K76A 4OMQA 3I9QA 2A37A 2EBPA 1X27A 2K79A 2ABLA 2B86A 1XOVA 1K1ZA 1MV3A 1QWFA 2O31A 2O9VA 1VA7A 2BTTA 3PVQA 5I22A 3THKA 3FJ5A 1FMKA 1ZLMA 4WCIA 1Z9QA 2EW3A 2AZVA 2K7AA 5L23A 4AG2C 1MV0B 1AEYA 2GGRA 1V1CA 1SEMA 2KRSA 1ZSGA 2AK5A 4E6RA 2RMOA 1X43A 2A28A 1H3HA 4DEXA 1KIKA 1JXMA 3VS1A 2YT6A 2FPFA 1M3CA 2D8HA 2C0IA 2L3PA 3U23A 5IXBA 2GQIA 1WLPB 2W0ZA 2DLPA 2YSQA 3M0RA 1UJ0A 2KYBA 2K6DA 2FG0A 1NEGA 4JJCA 1YWOA 1QLYA 2ED0A 2J6KA 4RTVA 4J9BA 2KROA 2KXCA 3I5SA 2PZ1A 3VS2A 4RTYA 2C0OA 4CC7A 2SRCA 1NG2A 2DBKA 2LNHB 2DVJA 1I0CA 2RN8A 2EGCA 1N5ZA 1SRMA 2DL4A 2LP5A 1WX6A 4OMNA 1M3BA 1B07A 1PKTA 3TVTA 1AZEA 3O5ZA 3VRZA 4RTTA 1W6XA 1UFFA 2LQNA 2F2XA 4Y92A 2O88A 4AFSC 1NLPC 1GCQC 3NMZC 2JM9A 3H0HA 1GBRA 2DX1A 4RUGA 1K0XA 4A63B 1WFWA 2CSQA 1T3SA 2RQWA 4F16A 1YWPA 1X2KA 2HCKA 2MOXA 1KFZA 1Y0MA 4OMMA 1ABQA 5GJWB 1U3OA 2DF6A 3M0PA 2YUPA 3VS6A 4LUEA 1FYNA 4J9IA 1EFNA 2LCSA 1NLOC 1NYGA 1SHFA 2DRMA 2VKNA 1GCQA 1TG0A 1RI9A 1UDLA 1HD3A 2D8JA 2EYWA 2RPNA 2EYZA 4JJDA 4LE9A 3LH5A 1JQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4U S;  2X3W D;  4QT7 A;  1PWT A;  1E6G A;  4AFQ C;  4RTZ A;  5IXF A;  2ESW A;  1OOT A;  2L3Q A;  1T0H A;  2KYM A;  1S1N A;  2YUQ A;  2CH4 A;  3PE0 A;  4IIO A;  1K0S A;  1UUE A;  2KGT A;  1TUD A;  2C0T A;  2K3B A;  1SHG A;  4F17 A;  2V1Q A;  2H8H A;  1M8M A;  1GRI A;  3A98 A;  1ZBJ A;  4JZ4 A;  2O9S A;  1T0J A;  1X6G A;  2DL5 A;  2EKH A;  3QWX X;  5HCK A;  1ZUY A;  2RQT A;  4HVW A;  1VYU A;  2L2P A;  2KNB B;  1K9A A;  2HBW A;  2P4R A;  2YDL A;  2ED1 A;  2BZ8 A;  1M27 C;  3KFV A;  3VS4 A;  4HCK A;  2X3X D;  1AWO A;  2JMA A;  2CDT A;  1UEC A;  1RLQ C;  4M4Z A;  1UHC A;  4AFZ C;  2LMJ A;  2CSI A;  1WXU A;  2KRN A;  2YUO A;  3NGP A;  3SEM A;  3H41 A;  1QCF A;  2RQV A;  5IHN A;  2FPD A;  3REA B;  1ARK A;  1CSK A;  1JEG A;  4RTU A;  2VWF A;  2A36 A;  2JMC A;  2JM8 A;  2J06 A;  2AKL A;  3EG3 A;  3IQL A;  1PRM C;  1PRL C;  2ROL A;  1WXT A;  1ZX6 A;  4JJB A;  2PNI A;  2JS2 A;  1TUC A;  2FPE A;  2DMO A;  1AZG B;  1QKX A;  1RLP C;  1YP5 A;  3UA7 A;  1AVZ C;  2EVR A;  4J9E A;  4HVV A;  4R0K A;  1AWJ A;  2DL8 A;  5IHI A;  1GFC A;  1WA7 A;  2L3S A;  4Z89 A;  2DRK A;  3UAT A;  2DM1 A;  1GFD A;  2LJ0 A;  4Z8A A;  1E6H A;  1W1F A;  4FSS A;  4J9F A;  2XMF A;  3H0F A;  3GBQ A;  2D0N A;  5EC7 A;  1CKB A;  2CT3 A;  3ULR B;  4CC4 B;  4HXJ A;  2K2M A;  1IO6 A;  2HDA A;  4ORZ A;  3VS3 A;  4EIK A;  1M30 A;  3EGU A;  2ROT A;  1PHT A;  1GL5 A;  2J6F A;  3EG2 A;  2AZS A;  3EG1 A;  2L0A A;  5GJV B;  1B3Q A;  1ZUK A;  2V1R A;  1J3T A;  5IH2 A;  2OJ2 A;  4K11 A;  2DE0 X;  2ECZ A;  1UG1 A;  4LN2 A;  2SEM A;  2GTO A;  2MIO A;  1OPK A;  1X69 A;  1JU5 C;  2EGA A;  2GTJ A;  3M0T A;  2JT4 A;  2KBT A;  2FRY A;  4JPB W;  2CT4 A;  1WXB A;  4ESR A;  1AOJ A;  2FRW A;  2BZX A;  1JXO A;  2LQW A;  4RTW A;  3UA6 A;  2J7I A;  1ABO A;  2RF0 A;  3H0I A;  1U5S A;  5FWB A;  1X2Q A;  2QDL A;  2KEA A;  1NM7 A;  1GCP A;  3QWY A;  2IIM A;  2KT8 A;  2DJQ A;  1A0N B;  2KXD A;  4Z88 A;  4J9H A;  4CC2 A;  4AFU C;  2MCN A;  1KJW A;  1I1J A;  2DNU A;  2CRE A;  2A08 A;  2LZ6 B;  1E7O A;  1SSH A;  1Z9Z A;  4J9D A;  2AKK A;  3VS0 A;  1UJY A;  1UE9 A;  1JO8 A;  2EYX A;  1NEB A;  4GBQ A;  2CUD A;  2FEI A;  2DL7 A;  1OPL A;  1QKW A;  2VVK A;  1MUZ A;  4D8D A;  1BBZ A;  1H8K A;  4IIM A;  3EHR A;  3NPF A;  3VS5 A;  3R6N A;  2OAW A;  2GBQ A;  2O2O A;  3TSW A;  1OV3 A;  3PVL A;  1W70 A;  3SHW A;  2GNC A;  2HSP A;  1WIE A;  1KSW A;  4J9G A;  3UF4 A;  3VRY A;  4DEY A;  4AG1 C;  2DYB A;  2PTK A;  4OML A;  4ZNX A;  5I11 A;  1AWX A;  2CUB A;  2J05 A;  2K9G A;  1VYV A;  5ECA A;  2RNA A;  1YCS B;  3EHQ A;  1PNJ A;  1BK2 A;  2DA9 A;  2DIL A;  3I5R A;  3M0Q A;  4LUD A;  3VS7 A;  1X6B A;  3CQT A;  2LJ3 A;  2KR3 A;  1YN8 A;  1G83 A;  1AD5 A;  2NUZ A;  1WI7 A;  2HEQ A;  4CC3 A;  2I0N A;  2KRM A;  2EPD A;  2F2W A;  2EYY A;  2LX7 A;  1T3L A;  2OI3 A;  3C0C A;  4D8K A;  2W10 A;  4JZ3 A;  5IHK A;  1UHF A;  1QWE A;  2EQI A;  3NHN A;  1AWW A;  1CKA A;  4GLM A;  1UTI A;  3I35 A;  1RUW A;  2DBM A;  1SPK A;  1WYX A;  3M0U A;  3TSZ A;  1VYT A;  2FO0 A;  2RQR A;  1PKS A;  2M51 A;  1HSQ A;  2EGE A;  1BB9 A;  1NYF A;  3ZL7 C;  2JS0 A;  4KRT A;  1YNZ A;  3RBB B;  2ENM A;  1OEB A;  3RNJ A;  1I07 A;  1U06 A;  4RTX A;  1SRL A;  2F2V A;  1Y57 A;  5FWC A;  2CH4 W;  2KT1 A;  2JXB A;  1LCK A;  1G2B A;  2NWM A;  3M0S A;  2LJ1 A;  1HJD A;  4OMP A;  1GBQ A;  2JW4 A;  2YUN A;  4HVU A;  3REB B;  4LNP A;  2BZY A;  2G6F X;  1BU1 A;  2JTE A;  4X1V A;  2E5K A;  2D1X A;  1UGV A;  2KE9 A;  3JV3 A;  2DL3 A;  1H92 A;  3EG0 A;  1ZUU A;  2J6O A;  2RQU A;  2M0Y A;  4J9C A;  4F14 A;  5FW9 A;  1WDX A;  4OMO A;  1M3A A;  1K76 A;  4OMQ A;  3I9Q A;  2A37 A;  2EBP A;  1X27 A;  2K79 A;  2ABL A;  2B86 A;  1XOV A;  1K1Z A;  1MV3 A;  1QWF A;  2O31 A;  2O9V A;  1VA7 A;  2BTT A;  3PVQ A;  5I22 A;  3THK A;  3FJ5 A;  1FMK A;  1ZLM A;  4WCI A;  1Z9Q A;  2EW3 A;  2AZV A;  2K7A A;  5L23 A;  4AG2 C;  1MV0 B;  1AEY A;  2GGR A;  1V1C A;  1SEM A;  2KRS A;  1ZSG A;  2AK5 A;  4E6R A;  2RMO A;  1X43 A;  2A28 A;  1H3H A;  4DEX A;  1KIK A;  1JXM A;  3VS1 A;  2YT6 A;  2FPF A;  1M3C A;  2D8H A;  2C0I A;  2L3P A;  3U23 A;  5IXB A;  2GQI A;  1WLP B;  2W0Z A;  2DLP A;  2YSQ A;  3M0R A;  1UJ0 A;  2KYB A;  2K6D A;  2FG0 A;  1NEG A;  4JJC A;  1YWO A;  1QLY A;  2ED0 A;  2J6K A;  4RTV A;  4J9B A;  2KRO A;  2KXC A;  3I5S A;  2PZ1 A;  3VS2 A;  4RTY A;  2C0O A;  4CC7 A;  2SRC A;  1NG2 A;  2DBK A;  2LNH B;  2DVJ A;  1I0C A;  2RN8 A;  2EGC A;  1N5Z A;  1SRM A;  2DL4 A;  2LP5 A;  1WX6 A;  4OMN A;  1M3B A;  1B07 A;  1PKT A;  3TVT A;  1AZE A;  3O5Z A;  3VRZ A;  4RTT A;  1W6X A;  1UFF A;  2LQN A;  2F2X A;  4Y92 A;  2O88 A;  4AFS C;  1NLP C;  1GCQ C;  3NMZ C;  2JM9 A;  3H0H A;  1GBR A;  2DX1 A;  4RUG A;  1K0X A;  4A63 B;  1WFW A;  2CSQ A;  1T3S A;  2RQW A;  4F16 A;  1YWP A;  1X2K A;  2HCK A;  2MOX A;  1KFZ A;  1Y0M A;  4OMM A;  1ABQ A;  5GJW B;  1U3O A;  2DF6 A;  3M0P A;  2YUP A;  3VS6 A;  4LUE A;  1FYN A;  4J9I A;  1EFN A;  2LCS A;  1NLO C;  1NYG A;  1SHF A;  2DRM A;  2VKN A;  1GCQ A;  1TG0 A;  1RI9 A;  1UDL A;  1HD3 A;  2D8J A;  2EYW A;  2RPN A;  2EYZ A;  4JJD A;  4LE9 A;  3LH5 A;  1JQQ A; 
#chains in the Genus database with same CATH topology
 1PWT A;  1E6G A;  4AFQ C;  3P8B B;  1QVF S;  1BI0 A;  2L3Q A;  3OS2 A;  1S1N A;  1X6O A;  2KAF A;  2RB6 A;  5IAY A;  1K0S A;  3CPW S;  1OUL A;  2KGT A;  1TUD A;  4F17 A;  3E1S A;  2H8H A;  1M8M A;  3JCM b;  1GRI A;  3LWH A;  3S3N A;  1VQ6 A;  4DBF A;  3EGX A;  4BUG A;  2DO3 A;  1ZSZ C;  2DD5 A;  1X6G A;  3G4S A;  1ZUY A;  4M7D E;  1VQ6 Q;  1VYU A;  3JRZ A;  4OF1 A;  2X3X D;  5HKC A;  3G4S Q;  1RLQ C;  4M4Z A;  3CCV A;  1UHC A;  2KRN A;  3NGP A;  3EGX B;  1U8R A;  1Q81 U;  2RQV A;  3CCS T;  1ARK A;  2YWW A;  3CCV Q;  4J6X A;  1CSK A;  3PGG A;  4RTU A;  2JMC A;  1KC8 R;  4JRQ A;  5LJ5 g;  2CZ0 B;  1M1F A;  3ZEH A;  3URG A;  1I4K 1;  3EGD A;  3IQL A;  2VAS A;  1M5Q 1;  1ZHI A;  2X4W A;  4JLG A;  3BDU A;  3VYH B;  2P0K A;  2JS2 A;  3OYH A;  3FC3 A;  4MZT A;  1QKX A;  5GAN d;  3OYE A;  1YP5 A;  4XTY A;  2RI2 A;  1AVZ C;  4HVV A;  3OMC A;  4P5N A;  4M7A C;  3PMT A;  1Q81 C;  5IHI A;  5KYX B;  3EGD B;  1WA7 A;  4C8Q A;  3CCM Q;  3HFO A;  5DY9 A;  2WSE E;  2CKK A;  4FSS A;  2XMF A;  1VQO T;  3GBQ A;  3C94 A;  2D0N A;  1RAC B;  2PU9 B;  5A0G A;  4OB1 B;  5GMK i;  7AT1 B;  3ULR B;  1XTD A;  2O4X A;  4ORZ A;  3M59 A;  2RJE A;  1PHT A;  1GL5 A;  2LRQ A;  3MO8 A;  4LDV A;  2EJG A;  1J3T A;  5IH2 A;  1O75 A;  2E5Q A;  4K11 A;  2VB6 A;  2ECZ A;  2GTO A;  2MIO A;  2QQA A;  3G6E T;  2O4X B;  4KH0 B;  5CIU A;  4E7I A;  4M7A D;  2KBT A;  4JPB W;  3M58 A;  1UGS B;  1QVG A;  4RG8 A;  3MCA B;  3EAE A;  2CT4 A;  4PJN A;  1WXB A;  2BZX A;  2J7I A;  2E41 A;  1BYM A;  1IXD A;  1XQH A;  1D3B A;  4FYY B;  1S72 A;  4XQ3 A;  2M16 A;  2KEA A;  5GAN g;  1OU9 A;  4RCB A;  4PJO A;  2KXD A;  5GMK j;  4Z88 A;  1K73 U;  5GAN 7;  1S72 Q;  2MK5 A;  4AFU C;  2CRE A;  2QA4 A;  2A08 A;  4B6M A;  3PTA A;  3CC7 T;  1D3B B;  2DPP B;  4J9D A;  3OS0 A;  3VS0 A;  3M5A A;  3DLM A;  1UE9 A;  2EYX A;  2MF2 A;  4GBQ A;  5GAO l;  2V8J A;  1QP3 A;  2EQM A;  2QA4 Q;  1OPL A;  4WTO B;  4XU2 A;  4ZGD B;  1BBZ A;  4IIM A;  1U1S A;  5I21 A;  4M77 G;  4LXC A;  3X24 B;  2OAW A;  1NPP A;  3C95 A;  2NUT A;  5CCA A;  2IG0 A;  4MML A;  3PVL A;  4M7D A;  1K73 C;  2XI9 A;  5GAN 4;  4DEY A;  3UF4 A;  1VQM T;  1TH7 A;  2FZC B;  4AG1 C;  5DLO A;  3GLX A;  2CZ6 B;  2LT4 A;  2K9G A;  1VYV A;  2MWO A;  5FRM A;  1YCS B;  1PNJ A;  4JS5 A;  2X4J A;  2Y4Y A;  3QDF A;  1M2V B;  3I5R A;  3M0Q A;  1VQ4 T;  4JS4 A;  4A4H A;  4E7H A;  5IN1 A;  2HKQ B;  1RI0 A;  3VS7 A;  2HQX A;  4DBH A;  5GAO n;  4B9W A;  2NUZ A;  4CC3 A;  3OYN A;  2DET A;  4LD6 A;  3MEU A;  2AIR B;  4PNO A;  4LD9 K;  4D8K A;  3KUF A;  2EQI A;  4E7L A;  3QPH A;  3OYK A;  1CKA A;  1RAI B;  4QW2 A;  5CKF A;  5J26 A;  3PIP A;  4OMF B;  1VQ5 A;  3WVD B;  4M75 G;  5HK3 A;  2X4Y A;  3M0U A;  3TSZ A;  3CC2 A;  1VYT A;  1K8A U;  4BE2 A;  4PJJ A;  2YRC A;  2QAS A;  2EGE A;  4XAX B;  1B7T A;  1NYF A;  1VQ5 Q;  1IZ6 A;  1BI2 A;  2EJF A;  1N6A A;  1OEB A;  3RNJ A;  3A8G B;  4HA8 A;  4RTX A;  1SRL A;  4BDY A;  1WHK A;  1Y57 A;  3F70 A;  2FYK A;  4ELY C;  1LCK A;  1BI3 A;  3M0S A;  1GBQ A;  4HVU A;  5FRN A;  4IUR A;  2ZPE B;  4LNP A;  1K8A C;  2BZY A;  3CME A;  3J7A F;  1KQS A;  4L59 A;  2E5K A;  4ATO A;  1RAG B;  1FMV A;  4KUL A;  4M77 B;  2J6O A;  2JN0 A;  3CME Q;  2M0Y A;  4VUB A;  3P8H A;  5KCH A;  1M3A A;  2E4H A;  4LDU A;  4OMQ A;  1TWB A;  4F7U F;  1X27 A;  3MEW A;  4XU1 A;  2A3L A;  2B86 A;  2MAM A;  3M57 A;  2O31 A;  1VA7 A;  2Y90 A;  3CCL T;  5HK0 A;  3PVQ A;  1FMK A;  1WNL A;  5GAM f;  4WCI A;  1Z9Q A;  2EW3 A;  3X25 B;  5L23 A;  2LVM A;  1VQ6 T;  4Y91 A;  3OYB A;  1ZSG A;  4FYW B;  3HKS A;  1ACM B;  4EMG A;  4ZN1 A;  3OYF A;  3VKI A;  2FPF A;  1M3C A;  4FYV B;  2L3P A;  3OSS C;  3CCV T;  2YSQ A;  1YIJ A;  1WQW A;  2KYB A;  3L42 A;  4B9X A;  2EIF A;  4M75 F;  4PLL A;  4FU6 A;  3CCU A;  4M7A E;  2ED0 A;  4J9B A;  2XDP A;  3I5S A;  2PZ1 A;  5C0M A;  1YIJ Q;  1NJI R;  2OTL A;  4FYX B;  2SRC A;  3CCU Q;  2LNH B;  4C0Z A;  1N5Z A;  2OTL Q;  2BE7 D;  2DL4 A;  1WX6 A;  1M3B A;  1B07 A;  3BY7 A;  3VRZ A;  2CP2 A;  2COW A;  1W6X A;  4RTT A;  1KD1 U;  2LQN A;  1R0C B;  4Y92 A;  4PL6 A;  2JTM A;  1RAE B;  1NLP C;  4M78 B;  3SWN A;  1YIT A;  4KT0 E;  1WFW A;  1UB4 A;  1T3S A;  1YWP A;  2NUP A;  4FL6 A;  3FDR A;  4OMM A;  1U3O A;  1RAF B;  1QQJ A;  3VUZ A;  1YIT Q;  3CPF A;  1BIB A;  3M0P A;  2A7Y A;  5GAO q;  1VQN A;  2LNV A;  1MNE A;  1I81 A;  2DKG A;  1VQN Q;  4C5G A;  1UDL A;  1PD0 A;  4MMK A;  4II1 A;  3TCJ A;  1QVG P;  1JQQ A;  1KD1 C;  2X3W D;  3UT1 A;  4C92 G;  1D0X A;  5IXF A;  2B8A A;  2DXB A;  4IIO A;  3A1P A;  1UUE A;  2LT1 A;  4A4G A;  1MHN A;  3MP8 A;  5J3B A;  4M77 D;  3GNG A;  1Y71 A;  3OBW A;  3R6O A;  1UGQ B;  4FCY A;  4JZ4 A;  3I56 A;  2O9S A;  3JAM E;  2K5L A;  3DB4 A;  1T0J A;  3BW1 A;  1W2B A;  5GAM e;  5M9O A;  1KQ2 A;  1IRE B;  3BFM A;  2GCX A;  3OYA A;  2L2P A;  2KNB B;  2P4R A;  1N9S A;  2ED1 A;  2DEU A;  5CQY A;  4J6Y A;  3I56 Q;  4GLK A;  4HCK A;  1AWO A;  2JMA A;  4OB2 B;  1AT1 B;  1OQK A;  2KQW A;  1S72 T;  2CSI A;  4PK4 A;  3C4S A;  1MMN A;  6AT1 B;  3JB9 G;  5DLQ E;  5GAO m;  3VU3 C;  3C12 A;  1ZSZ A;  1JEG A;  2PVO B;  2VWF A;  4M78 C;  2A36 A;  3M4Y A;  2QA4 T;  1H64 1;  2PQW A;  3E19 A;  1EIF A;  1KK7 A;  2J06 A;  3MKD A;  2ROL A;  1WXT A;  1LOJ A;  1ZX6 A;  3JCM V;  1EZZ B;  2K3X A;  2DMO A;  1AZG B;  1RLP C;  2AHJ B;  4J9E A;  2P0Q A;  3M55 A;  3OYD A;  4R0K A;  1AWJ A;  4QVD A;  5FLX E;  2V8I A;  3L2V A;  2L3S A;  2PUO B;  5HY6 A;  2LJ0 A;  3HRT A;  1KHI A;  4Z8A A;  1W1F A;  2M9U A;  4FM4 B;  2D9T A;  3H0F A;  5EC7 A;  4C5E A;  1ZA2 B;  1KC8 U;  1K9M C;  2CT3 A;  4M78 D;  3VS3 A;  4BDZ A;  1G8X A;  1MND A;  4C92 F;  2ROT A;  1NE8 A;  5KYN A;  5KYY A;  3JCM Q;  2J6F A;  3EG2 A;  1WHM A;  5GJV B;  1JJ2 A;  2MWP A;  2V1R A;  2OX7 A;  2OJ2 A;  5LJ3 h;  1PCX A;  4PFO A;  2GQV A;  1H3Z A;  3L2Z A;  2DJZ A;  3RDV A;  1OPK A;  1X69 A;  4RCC A;  2GTJ A;  4O5V A;  2JUF A;  2VGN A;  3OYC A;  5KYY B;  2FRY A;  1YJW Q;  1N8R U;  1KC8 C;  2HZY A;  2RM4 A;  3RER A;  2VXF A;  4ESR A;  2GFA A;  4C8Q G;  2LQW A;  3UA6 A;  1VQ5 T;  2H3J A;  3CC2 T;  1U5S A;  2CP0 A;  2DTO A;  1X2Q A;  2EQK A;  2QDL A;  2LCC A;  3JB9 F;  3VYG A;  1GCP A;  3QXE B;  5D7U A;  2IIM A;  2KT8 A;  2DJQ A;  1O9S A;  3HFN A;  1PSE A;  1KJW A;  1M2O A;  3G71 A;  4ZTJ A;  3CXC A;  2GF7 A;  1JRI A;  2LZ6 B;  1SSH A;  1Z9Z A;  2AKK A;  2A0F B;  3CCE A;  3HRU A;  1N8R C;  3G71 Q;  1QVG S;  2FEI A;  2NYS A;  3QBY A;  3CCE Q;  3VUB A;  3CME T;  5DM7 R;  5CKD A;  2MI6 A;  2CS7 A;  3RKY A;  5FU7 B;  4R56 A;  1YFN A;  3TSW A;  1VQ9 A;  1BCM A;  2FVU A;  5KYX A;  3ME9 A;  3SFM A;  2HMA A;  1WIE A;  1KSW A;  2R57 A;  1D1A A;  1M90 R;  5GAN 6;  1YBY A;  2PTK A;  4ZNX A;  1VQ9 Q;  3V8L A;  3CCM A;  1AWX A;  5LJ3 d;  1VIE A;  1WQ7 A;  1PD1 A;  4L5G A;  2RNA A;  3EHQ A;  3J81 E;  4OVA A;  1Q86 U;  2FZK B;  2P0P A;  4PJO G;  4QQD A;  1B34 B;  2HQH A;  2L8D A;  1X6B A;  4A4E A;  2M1H A;  1YN8 A;  2FL7 A;  2QK0 A;  4HT9 A;  4DOW A;  2HEQ A;  3A8H B;  4KUI A;  2LX7 A;  5FU6 B;  3C0C A;  2YHT A;  2WAC A;  5CR2 A;  2W10 A;  3M9Q A;  3CBO A;  4JRI A;  1RAH B;  1QWE A;  4LDW A;  2JJ9 A;  3NHN A;  4N4H A;  5I2M A;  1VQL A;  1XJW B;  3DKM A;  4C8Q F;  4GLM A;  2AT1 B;  2LQ8 A;  3CCU T;  4M77 E;  2RK2 A;  5J39 A;  1Q86 C;  1RUW A;  1WPY A;  1TTH B;  3I55 A;  4M7D G;  3JCM e;  1FX7 A;  1VQL Q;  2OTL T;  1D0Y A;  2FO0 A;  2OTJ A;  2P84 A;  1PKS A;  2LC4 A;  2L3R A;  1HSQ A;  2M51 A;  1BB9 A;  2D0Q B;  3I55 Q;  4RMO A;  2JS0 A;  2QQR A;  2VC8 A;  4KRT A;  2OTJ Q;  2XG8 D;  1YNZ A;  3JB9 H;  1U06 A;  1I07 A;  3A8O B;  5FU7 C;  2F2V A;  2R58 A;  1QW1 A;  1SG5 A;  5GAO p;  2NWM A;  2LJ1 A;  1HJD A;  1YIT T;  2LDM A;  5LL6 S;  5LJ3 g;  2D6F A;  3REB B;  1Q81 R;  1KG1 A;  1TOV A;  4DBR A;  2KE9 A;  3JSC A;  3CCJ A;  1WHJ A;  5FW9 A;  2E10 A;  1LVK A;  1W2B P;  2EBP A;  2DEQ A;  1M8V A;  2ABL A;  5CKH A;  1XOV A;  3CCJ Q;  4C5I A;  1FWZ A;  4JLI A;  4PJO F;  5FU6 C;  1BKB A;  1IHV A;  4J5Y A;  5A0L A;  4N4I A;  2BTT A;  3JCM J;  3JCM c;  3FJ5 A;  1LPL A;  3CMA A;  2ATC B;  2K7A A;  1M2V A;  3L1A A;  1YHQ A;  2DFU A;  2G3R A;  2KRS A;  3I56 T;  2AK5 A;  3CMA Q;  1X43 A;  4M78 E;  1KQS S;  1MMA A;  1YHQ Q;  4F7U G;  3WVE B;  1D09 B;  2YT6 A;  4BE0 A;  2QQ9 A;  1R0B G;  2GQI A;  5GMK h;  1WLP B;  2W0Z A;  2DLP A;  3OY9 A;  3M0R A;  4FT2 A;  3DLL A;  5KCO A;  4M7D F;  4JJC A;  2J6K A;  4RTV A;  2COZ A;  2KXC A;  4C0D B;  5FRO A;  3P8D A;  3VS2 A;  3GNF B;  4DOV A;  2C0O A;  3UPU A;  3TRE A;  3RIR A;  1NG2 A;  1WHG A;  3V7S A;  2DIG A;  3A8M B;  4KUD K;  2MPX C;  2EGC A;  2DXU A;  1SRM A;  2WSC E;  3AHU A;  5CK9 A;  2E1H A;  3OYY A;  1PKT A;  3OS5 A;  3TVT A;  3O5Z A;  5A2Q E;  1UFF A;  4FSX A;  1VQ7 A;  2Z0W A;  2MYS A;  1GCQ C;  3OBY A;  3S3O A;  4XTU A;  1VQ7 Q;  2HAX A;  1FXX A;  2V26 A;  1JJ2 P;  1KFZ A;  1Y0M A;  5GJW B;  1ABQ A;  2QGF B;  1K73 R;  1YCY A;  4F04 B;  2YUP A;  4TVR A;  1IGQ A;  2E64 A;  3D7S B;  5CO7 A;  4Z02 A;  4QVZ A;  1OZ3 A;  1FYN A;  1EFN A;  3CBM A;  1NLO C;  1SHF A;  2RA2 A;  2DRM A;  2VKN A;  4M77 A;  1F1B B;  3PNW C;  1RI9 A;  2D8J A;  1HD3 A;  2RPN A;  4LE9 A;  2RJC A;  4Q5W A;  3UWN A;  4NL3 A;  3G1J A;  4QT7 A;  2ESW A;  2YRD A;  3PE0 A;  2CH4 A;  2K3B A;  2C0T A;  3OA6 A;  1SHG A;  3NTI A;  2V1Q A;  4O6J A;  4KGZ B;  2RI5 A;  3QKJ A;  4BI8 B;  1ZBJ A;  3CCS A;  2DL5 A;  2EKH A;  3QWX X;  4L6V 5;  4QKU A;  1Y96 A;  4C0D C;  2ZPH B;  2RQT A;  1IRX A;  1QMC A;  3X26 B;  2KSS A;  1K9A A;  2YDL A;  2BZ8 A;  3KFV A;  3CCS Q;  3VS4 A;  4UC4 A;  1BIA A;  2QAZ A;  3OYI A;  2HNI A;  1UEC A;  4F7U B;  5CKE A;  5CVI A;  2XDB A;  4AFZ C;  4N0A A;  2YUO A;  3SEM A;  3FIF A;  4DA4 A;  2IPO B;  2X35 A;  1IGU A;  2RI3 A;  1Y96 B;  3QHS A;  3G4S T;  3EFO A;  5GAM j;  2ZPB B;  2CGH A;  5EG2 A;  1LJO A;  4IUU A;  2QTX A;  1HXD A;  4BB7 A;  2X51 A;  4XTZ A;  3CCR A;  1PRL C;  1UGP B;  2PNI A;  1W2B S;  4PKC C;  3OS1 A;  3CCR Q;  4A4K A;  3EFO B;  1PC0 A;  2X4X A;  3FLG A;  2XIC A;  1R77 A;  3QYH B;  3MET A;  2DL8 A;  1K8A R;  4M78 A;  1D0Z A;  1VQ9 T;  4M75 B;  4Z89 A;  2DRK A;  3UAT A;  2DM1 A;  2CZ1 B;  3E9F A;  5KE2 A;  4EMH A;  1WHL A;  2E6Z A;  4J9F A;  1TU0 B;  3OSV A;  3CCM T;  1CKB A;  3RKW A;  3RMQ A;  4OP0 A;  4M77 C;  1I8F A;  2YXY A;  2QXF A;  5LJ5 f;  1Q82 U;  1OYX A;  2XU8 A;  4EIK A;  2VYT A;  3ZFJ A;  1M30 A;  3EGU A;  4BE1 A;  4OB3 B;  3L2R A;  1X75 C;  4MDX A;  2K2V A;  1PM3 A;  1PSF A;  2AZS A;  1R8O B;  4XTX A;  2ZZD A;  1VQK A;  2BIV A;  3FJP A;  1B3Q A;  2FZG B;  1G3T A;  1UG1 A;  4LN2 A;  3QZ9 B;  1W4S A;  1VQK Q;  2EGA A;  1KHC A;  3M0T A;  3RUX A;  4RKU E;  1VQL T;  2DIQ A;  4KBM B;  1NPR A;  4X9C A;  1AOJ A;  1Q82 C;  2HBP A;  2RF0 A;  3J80 E;  3H0I A;  3OB9 A;  1BCO A;  4N0A C;  2OTJ T;  4MDW A;  3QWY A;  3RR6 A;  3M53 A;  1JJ2 S;  4M7A G;  1Q95 G;  3KBG A;  1V76 A;  2M0O A;  8AT1 B;  4M75 C;  3VJP A;  5KH6 A;  4Y28 E;  1UJY A;  1JO8 A;  3EH2 A;  2I2L A;  2CUD A;  2DL7 A;  5GAO r;  3M54 A;  1C6V X;  1QKW A;  2VVK A;  4D8D A;  2EKO A;  2ZPG B;  3NPF A;  1G5V A;  4YTL A;  4XU3 A;  2QGG A;  1M1G A;  2O2O A;  3LW5 E;  4AT1 B;  2VV5 A;  3JCM X;  2XID A;  5CQX A;  1OV3 A;  3X28 B;  5KYU B;  3SHW A;  2GNC A;  5GAN f;  3TQ7 P;  2HSP A;  1I5L A;  2RH2 A;  4PJM A;  5LJ3 f;  1LNX A;  5KYW B;  4J9G A;  3NTK A;  4NOY A;  1DJ7 B;  2DYB A;  2RHX A;  1QCO A;  4OML A;  3ASK A;  5I11 A;  3CXC S;  2CUB A;  1KD1 R;  2J05 A;  4NS5 A;  4E47 A;  2ZCF B;  2BE9 B;  4J7I A;  3INZ A;  3ZBD A;  1BK2 A;  2KY9 A;  3CMA T;  2ZAE A;  2DIL A;  4M75 D;  1JBM A;  1YHQ T;  4EMK B;  1OZ2 A;  3V8J A;  2KR3 A;  1VQ8 A;  1Q7Y R;  1HK9 A;  5LJ5 e;  1WI7 A;  2EAY A;  1XNI A;  2KRM A;  3E9G A;  3OQ5 A;  2F2W A;  2EYY A;  1VQ8 Q;  2OI3 A;  4E7K A;  1ZA1 B;  3QDR B;  5IT9 E;  4JZ3 A;  3EG9 B;  5IHK A;  3V7R A;  1TS9 A;  2QYZ A;  3HL8 A;  4C0G A;  1SF9 A;  1AWW A;  2RJF A;  3GOX A;  5GMK l;  3SDZ A;  2ZPF B;  1WYX A;  4C92 B;  2CP6 A;  1YJW A;  2BUD A;  1VQP A;  3QSU A;  2O01 E;  3ZL7 C;  4ANJ A;  2QTV A;  1M1K R;  1VQP Q;  4M7A F;  4GY5 A;  2ENM A;  2R5A A;  1KQ1 A;  2YLC A;  2K57 A;  5GAM g;  3SD4 A;  2JZ2 A;  5FWC A;  2CH4 W;  2Y4X A;  2VUB A;  3Q1J A;  3OYM A;  2JXB A;  1G2B A;  4CRI A;  4OMP A;  1RAD B;  2JW4 A;  2YUN A;  1WGS A;  2K5I A;  3CCQ A;  5AT1 B;  1OU8 A;  2JVV A;  1KQS P;  2G6F X;  1BU1 A;  3CCL A;  4X1V A;  3X20 B;  3CCQ Q;  4E2F B;  2DL3 A;  1H92 A;  4BAC A;  3EG0 A;  2CP7 A;  4EMK C;  1K9M R;  1D1C A;  3CCL Q;  4KGX B;  2DVE A;  2A37 A;  3G7Z A;  2K79 A;  2QI2 A;  3NFC A;  4OGE A;  1X01 A;  3WXM B;  2O9V A;  1YJN A;  3PMI A;  3THK A;  3M56 A;  2COY A;  2E65 A;  1ZLM A;  3L2W A;  5GAN e;  3VV0 A;  1G3Y A;  5LJ3 e;  2AZV A;  1SSF A;  4MZP A;  1MV0 B;  1B34 A;  1VUB A;  5GAN 5;  4LDX A;  2R5M A;  1YJN Q;  1AEY A;  3FB9 A;  1V1C A;  1SEM A;  2CP5 A;  1YJ9 A;  4J83 A;  1OX8 A;  2RMO A;  4HCB A;  2A28 A;  2XHC A;  4X34 A;  3JCM h;  4PLI A;  4DEX A;  1VIF A;  4C92 C;  2HL3 A;  4C0F A;  3VS1 A;  1N27 A;  3FEO A;  4J6W A;  2D8H A;  1YI2 A;  1YJ9 Q;  2EQJ A;  3U23 A;  1ZQ1 A;  2DER A;  2NLU A;  3OW2 A;  1UJ0 A;  3QUI A;  4KGV B;  2K3Y A;  4XK8 E;  1YI2 Q;  1WHH A;  2DZ9 A;  1YWO A;  1IB8 A;  5KE3 A;  1QLY A;  2L89 A;  4HKE A;  2CYZ B;  4RTY A;  1BI1 A;  2F69 A;  2QDY B;  2EFI A;  4FW2 A;  1Y07 A;  1ZBX A;  3CCR T;  4ME7 A;  2DBK A;  3QII A;  2HD0 A;  2DVJ A;  1I0C A;  1M9S A;  2RN8 A;  3RKX A;  1YIJ T;  1WZO A;  1N8R R;  1AZE A;  2ZPI B;  3OYL A;  1QVF A;  2K5F A;  1U1T A;  2O88 A;  3QO3 A;  2MMP A;  2HQE A;  4AFS C;  2CP3 A;  3NMZ C;  4C92 D;  1TSF A;  3H0H A;  3CPW A;  1GBR A;  2DX1 A;  1K0X A;  4A63 B;  4C8Q B;  2ZGW A;  1HYO A;  2RQW A;  2HCK A;  1WJR A;  2MOX A;  5GAN 2;  2E3I A;  2PUK B;  4F7U E;  3VS6 A;  3OMG A;  4LUE A;  2LCS A;  4J9I A;  3NTH A;  2RJD A;  3RMS A;  5D6W A;  3LGL A;  1GCQ A;  1TG0 A;  2EYW A;  4JJD A;  2L5Q A;  4EPC A;  3LH5 A;  2QQB A;  1K4U S;  1I5O B;  3QG1 A;  4RTZ A;  3JCM d;  1VQK T;  4FIB A;  2BKD N;  1OOT A;  3LH0 A;  1T0H A;  2KYM A;  1VQN T;  2EQU A;  2YUQ A;  1NBE B;  3JB9 D;  3RES A;  3HSB A;  1D1B A;  1OX9 A;  2HL5 C;  3A98 A;  3V8K A;  2QEX A;  2JNG A;  1Y7X A;  5HCK A;  3CD6 A;  3CC4 A;  2RHI A;  2XD0 A;  4HVW A;  4M75 E;  2HBW A;  2QEX Q;  1M27 C;  5CKB A;  4QQG A;  4PFP A;  3CD6 Q;  3CC4 Q;  1Q86 R;  2CDT A;  2PVG B;  2V8K A;  4BY6 B;  2LMJ A;  1FMW A;  1WXU A;  3H41 A;  1QCF A;  5IHN A;  1RL2 A;  4PJO B;  2FPD A;  4DQ2 A;  3REA B;  4IUP A;  1P92 A;  4IUT A;  3HPW A;  3JB9 I;  3KXT A;  2DAQ A;  1G3W A;  2F5K A;  4C8Q C;  4HT8 A;  2JM8 A;  2AKL A;  3EG3 A;  1AHJ B;  2M02 A;  1PRM C;  2FHD A;  2EWN A;  4R55 A;  2HKN A;  4JJB A;  1TUC A;  4C5H A;  2E3H A;  2FPE A;  4ZGJ B;  2LX9 A;  4WF2 A;  3UA7 A;  4XTV A;  2EVR A;  3JB9 J;  4N4G A;  3N5B B;  1EX4 A;  2NUT B;  3JCM g;  1GFC A;  3JCM W;  2HSE B;  4M7D B;  2DXT A;  2E70 A;  1SKU B;  1GFD A;  3V7C A;  1E6H A;  2RHY A;  3PIO A;  1QVP A;  3JCM P;  2LQK A;  2RHU A;  4ZTF A;  1VOM A;  4ELZ C;  1MGQ A;  5A0D A;  2JTF A;  3BDL A;  4A54 A;  4CC4 B;  2E6N A;  4HXJ A;  2K2M A;  2XDD A;  1IO6 A;  2HDA A;  4C8Q D;  2P4T A;  3EG1 A;  3HRS A;  2L0A A;  1VQ8 T;  4ZN3 A;  3M4G A;  1ZUK A;  3TU4 K;  2DZC A;  1NJI U;  1C0M A;  2OAU A;  2DE0 X;  2F5T X;  2SEM A;  4BY6 C;  5GMK m;  3MPU B;  1JU5 C;  2DYI A;  4PJO C;  1IHW A;  2JT4 A;  3PFS A;  4DBQ A;  4E7S A;  5GMK e;  3CC2 Q;  3CEY A;  2QG9 B;  2F1L A;  4M78 G;  2KVQ G;  2FRW A;  1JXO A;  4RTW A;  1ABO A;  1YJW T;  2RHZ A;  1VQP T;  3QJY A;  5FWB A;  4F7U A;  1NM7 A;  4HCZ A;  2JOY A;  1MMD A;  3T9N A;  1A0N B;  4KH1 B;  1NJI C;  1N9R A;  4M77 F;  2KMT A;  4IUV A;  4LDY A;  4J9H A;  4CC2 A;  4FW1 A;  3CXC P;  2MCN A;  1I1J A;  2DNU A;  1PG5 B;  2FB7 A;  4M7D C;  1E7O A;  3MHX A;  4QVC A;  4NL2 A;  3L2U A;  4D6W A;  1C1A A;  1NEB A;  1RAB B;  3H9N A;  2DK3 A;  3CCQ T;  4PJO D;  1MUZ A;  1TXQ A;  5GAN 8;  1H8K A;  4A53 A;  3EHR A;  3G71 T;  4OB0 B;  3VS5 A;  3R6N A;  3MEA A;  2GFU A;  3LLR A;  4PJL A;  3TEE A;  2GBQ A;  3HTR A;  4A4F A;  3CCE T;  2CZ7 B;  2RO0 A;  4M75 A;  1W70 A;  3H8Z A;  5D6X A;  3VRY A;  4C92 E;  4XTW A;  1VQO A;  4MZM A;  4JDS A;  2KI7 A;  1YJN T;  5ECA A;  4BI4 A;  3A5Z B;  3MP1 A;  2DA9 A;  3MP6 A;  2E12 A;  1VQO Q;  3O8V A;  3OW2 P;  4JJN K;  4M7D D;  4LUD A;  3GP8 A;  3CQT A;  2LJ3 A;  1YJ9 T;  4X9D A;  5GAN 3;  1G83 A;  1AD5 A;  2I0N A;  2EPD A;  2VGM A;  1T3L A;  3G6E A;  1YI2 T;  3GIB A;  3FRN A;  1NZ9 A;  2RK1 A;  4PFZ A;  8ATC B;  1JB0 E;  1UHF A;  4OGC A;  3HHT B;  2YLB A;  4M78 F;  5GAM h;  5AYF A;  4J7F A;  3G6E Q;  5I2S A;  1QVF P;  1RAA B;  1UGR B;  1UTI A;  3GF5 A;  3PT9 A;  3LGF A;  3I35 A;  2DBM A;  1SPK A;  5LJ5 j;  1WJQ A;  1QCN A;  2LCL A;  3CPW P;  5L8R E;  1G3S A;  2WSF E;  4IUQ A;  2DD4 A;  1Q7Y U;  3RBB B;  4ZGE B;  1OI1 A;  2LTO A;  3I55 T;  3CC7 A;  3DB3 A;  3SWN B;  2KT1 A;  5CAI A;  4QQ6 A;  2NUP B;  3CC7 Q;  2K4Y A;  2EJ9 A;  2KDS A;  4XU0 A;  4AMC A;  2JTE A;  2D1X A;  1UGV A;  3JV3 A;  3L2Q A;  2C06 A;  3UDC A;  3OYJ A;  2H3E B;  1ZUU A;  2RQU A;  4J9C A;  4E7J A;  1Q7Y C;  4F14 A;  1WDX A;  4OMO A;  5KYU A;  1K76 A;  3EFR A;  1M1K U;  2DTI A;  3CBP A;  3I9Q A;  1WJS A;  2XK0 A;  5KYW A;  5LJ5 h;  1VQM A;  4J8O A;  3S3M A;  1K1Z A;  1MV3 A;  3HP9 A;  4FT4 A;  1QWF A;  1QP2 A;  5I22 A;  3E2U A;  4JUV A;  1VQM Q;  3EFS A;  3H6Z A;  3LX7 A;  1VQ4 A;  3CCJ T;  4AG2 C;  4IKF A;  1V29 B;  5GAM d;  2GGR A;  2QEX T;  4EMK A;  4CI0 C;  4E6R A;  9ATC B;  4E7Z A;  1H3H A;  3QZ5 B;  3CC4 T;  2IVW A;  4RG2 A;  3CD6 T;  4C8Q E;  1VQ4 Q;  1KIK A;  3A8L B;  2KK4 A;  1JXM A;  4JRP A;  3EH1 A;  1UEB A;  3ER0 A;  4V2S A;  2C0I A;  2DTH A;  5IXB A;  5GAN j;  1Q82 R;  1M1K C;  5LJ3 j;  3QJ6 A;  1K9M U;  1TUG B;  3EG9 A;  4JRK A;  3LYI A;  2YRV A;  2K6D A;  2FG0 A;  1NEG A;  2DXC A;  3MJX A;  3AT1 B;  1ZSZ B;  2KRO A;  3SWN C;  4C92 A;  2EYQ A;  4CC7 A;  4BI3 A;  5C6S A;  1M4Z A;  2XKO C;  5D6Y A;  4EDU A;  2LP5 A;  4OMN A;  1M90 U;  3S6W A;  2RD1 A;  3SB2 A;  3MEV A;  2PVD B;  2F2X A;  4HCC A;  2JM9 A;  4RUG A;  4M7A A;  3QYG B;  3OW2 S;  2CSQ A;  3OYG A;  4F16 A;  1X2K A;  5LJ5 d;  1GXI E;  2DF6 A;  2QQS A;  3GPL A;  5GAN h;  1VQ7 T;  1MMG A;  4PJO E;  2VXE A;  1NYG A;  4M7A B;  1M90 C;  3LWI A;  2X9H A;  3JCM f;  4BD3 A;  2EYZ A;  2RQR A;  3BE3 A; 
#chains in the Genus database with same CATH homology
 1K4U S;  2X3W D;  4QT7 A;  1PWT A;  1E6G A;  4AFQ C;  4RTZ A;  5IXF A;  2ESW A;  1OOT A;  2L3Q A;  1T0H A;  2KYM A;  1S1N A;  2YUQ A;  2CH4 A;  3PE0 A;  4IIO A;  1K0S A;  1UUE A;  2KGT A;  1TUD A;  2C0T A;  2K3B A;  1SHG A;  4F17 A;  2V1Q A;  2H8H A;  1M8M A;  1GRI A;  3A98 A;  1ZBJ A;  4JZ4 A;  2O9S A;  1T0J A;  1X6G A;  2DL5 A;  2EKH A;  3QWX X;  5HCK A;  1ZUY A;  2RQT A;  4HVW A;  1VYU A;  2L2P A;  2KNB B;  1K9A A;  2HBW A;  2P4R A;  2YDL A;  2ED1 A;  2BZ8 A;  1M27 C;  3KFV A;  3VS4 A;  4HCK A;  2X3X D;  1AWO A;  2JMA A;  2CDT A;  1UEC A;  1RLQ C;  4M4Z A;  1UHC A;  4AFZ C;  2LMJ A;  2CSI A;  1WXU A;  2KRN A;  2YUO A;  3NGP A;  3SEM A;  3H41 A;  1QCF A;  2RQV A;  5IHN A;  2FPD A;  3REA B;  1ARK A;  1CSK A;  1JEG A;  4RTU A;  2VWF A;  2A36 A;  2JMC A;  2JM8 A;  2J06 A;  2AKL A;  3EG3 A;  3IQL A;  1PRM C;  1PRL C;  2ROL A;  1WXT A;  1ZX6 A;  4JJB A;  2PNI A;  2JS2 A;  1TUC A;  2FPE A;  2DMO A;  1AZG B;  1QKX A;  1RLP C;  1YP5 A;  3UA7 A;  1AVZ C;  2EVR A;  4J9E A;  4HVV A;  4R0K A;  1AWJ A;  2DL8 A;  5IHI A;  1GFC A;  1WA7 A;  2L3S A;  4Z89 A;  2DRK A;  3UAT A;  2DM1 A;  1GFD A;  2LJ0 A;  4Z8A A;  1E6H A;  1W1F A;  4FSS A;  4J9F A;  2XMF A;  3H0F A;  3GBQ A;  2D0N A;  5EC7 A;  1CKB A;  2CT3 A;  3ULR B;  4CC4 B;  4HXJ A;  2K2M A;  1IO6 A;  2HDA A;  4ORZ A;  3VS3 A;  4EIK A;  1M30 A;  3EGU A;  2ROT A;  1PHT A;  1GL5 A;  2J6F A;  3EG2 A;  2AZS A;  3EG1 A;  2L0A A;  5GJV B;  1B3Q A;  1ZUK A;  2V1R A;  1J3T A;  5IH2 A;  2OJ2 A;  4K11 A;  2DE0 X;  2ECZ A;  1UG1 A;  4LN2 A;  2SEM A;  2GTO A;  2MIO A;  1OPK A;  1X69 A;  1JU5 C;  2EGA A;  2GTJ A;  3M0T A;  2JT4 A;  2KBT A;  2FRY A;  4JPB W;  2CT4 A;  1WXB A;  4ESR A;  1AOJ A;  2FRW A;  2BZX A;  1JXO A;  2LQW A;  4RTW A;  3UA6 A;  2J7I A;  1ABO A;  2RF0 A;  3H0I A;  1U5S A;  5FWB A;  1X2Q A;  2QDL A;  2KEA A;  1NM7 A;  1GCP A;  3QWY A;  2IIM A;  2KT8 A;  2DJQ A;  1A0N B;  2KXD A;  4Z88 A;  4J9H A;  4CC2 A;  4AFU C;  2MCN A;  1KJW A;  1I1J A;  2DNU A;  2CRE A;  2A08 A;  2LZ6 B;  1E7O A;  1SSH A;  1Z9Z A;  4J9D A;  2AKK A;  3VS0 A;  1UJY A;  1UE9 A;  1JO8 A;  2EYX A;  1NEB A;  4GBQ A;  2CUD A;  2FEI A;  2DL7 A;  1OPL A;  1QKW A;  2VVK A;  1MUZ A;  4D8D A;  1BBZ A;  1H8K A;  4IIM A;  3EHR A;  3NPF A;  3VS5 A;  3R6N A;  2OAW A;  2GBQ A;  2O2O A;  3TSW A;  1OV3 A;  3PVL A;  1W70 A;  3SHW A;  2GNC A;  2HSP A;  1WIE A;  1KSW A;  4J9G A;  3UF4 A;  3VRY A;  4DEY A;  4AG1 C;  2DYB A;  2PTK A;  4OML A;  4ZNX A;  5I11 A;  1AWX A;  2CUB A;  2J05 A;  2K9G A;  1VYV A;  5ECA A;  2RNA A;  1YCS B;  3EHQ A;  1PNJ A;  1BK2 A;  2DA9 A;  2DIL A;  3I5R A;  3M0Q A;  4LUD A;  3VS7 A;  1X6B A;  3CQT A;  2LJ3 A;  2KR3 A;  1YN8 A;  1G83 A;  1AD5 A;  2NUZ A;  1WI7 A;  2HEQ A;  4CC3 A;  2I0N A;  2KRM A;  2EPD A;  2F2W A;  2EYY A;  2LX7 A;  1T3L A;  2OI3 A;  3C0C A;  4D8K A;  2W10 A;  4JZ3 A;  5IHK A;  1UHF A;  1QWE A;  2EQI A;  3NHN A;  1AWW A;  1CKA A;  4GLM A;  1UTI A;  3I35 A;  1RUW A;  2DBM A;  1SPK A;  1WYX A;  3M0U A;  3TSZ A;  1VYT A;  2FO0 A;  2RQR A;  1PKS A;  2M51 A;  1HSQ A;  2EGE A;  1BB9 A;  1NYF A;  3ZL7 C;  2JS0 A;  4KRT A;  1YNZ A;  3RBB B;  2ENM A;  1OEB A;  3RNJ A;  1I07 A;  1U06 A;  4RTX A;  1SRL A;  2F2V A;  1Y57 A;  5FWC A;  2CH4 W;  2KT1 A;  2JXB A;  1LCK A;  1G2B A;  2NWM A;  3M0S A;  2LJ1 A;  1HJD A;  4OMP A;  1GBQ A;  2JW4 A;  2YUN A;  4HVU A;  3REB B;  4LNP A;  2BZY A;  2G6F X;  1BU1 A;  2JTE A;  4X1V A;  2E5K A;  2D1X A;  1UGV A;  2KE9 A;  3JV3 A;  2DL3 A;  1H92 A;  3EG0 A;  1ZUU A;  2J6O A;  2RQU A;  2M0Y A;  4J9C A;  4F14 A;  5FW9 A;  1WDX A;  4OMO A;  1M3A A;  1K76 A;  4OMQ A;  3I9Q A;  2A37 A;  2EBP A;  1X27 A;  2K79 A;  2ABL A;  2B86 A;  1XOV A;  1K1Z A;  1MV3 A;  1QWF A;  2O31 A;  2O9V A;  1VA7 A;  2BTT A;  3PVQ A;  5I22 A;  3THK A;  3FJ5 A;  1FMK A;  1ZLM A;  4WCI A;  1Z9Q A;  2EW3 A;  2AZV A;  2K7A A;  5L23 A;  4AG2 C;  1MV0 B;  1AEY A;  2GGR A;  1V1C A;  1SEM A;  2KRS A;  1ZSG A;  2AK5 A;  4E6R A;  2RMO A;  1X43 A;  2A28 A;  1H3H A;  4DEX A;  1KIK A;  1JXM A;  3VS1 A;  2YT6 A;  2FPF A;  1M3C A;  2D8H A;  2C0I A;  2L3P A;  3U23 A;  5IXB A;  2GQI A;  1WLP B;  2W0Z A;  2DLP A;  2YSQ A;  3M0R A;  1UJ0 A;  2KYB A;  2K6D A;  2FG0 A;  1NEG A;  4JJC A;  1YWO A;  1QLY A;  2ED0 A;  2J6K A;  4RTV A;  4J9B A;  2KRO A;  2KXC A;  3I5S A;  2PZ1 A;  3VS2 A;  4RTY A;  2C0O A;  4CC7 A;  2SRC A;  1NG2 A;  2DBK A;  2LNH B;  2DVJ A;  1I0C A;  2RN8 A;  2EGC A;  1N5Z A;  1SRM A;  2DL4 A;  2LP5 A;  1WX6 A;  4OMN A;  1M3B A;  1B07 A;  1PKT A;  3TVT A;  1AZE A;  3O5Z A;  3VRZ A;  4RTT A;  1W6X A;  1UFF A;  2LQN A;  2F2X A;  4Y92 A;  2O88 A;  4AFS C;  1NLP C;  1GCQ C;  3NMZ C;  2JM9 A;  3H0H A;  1GBR A;  2DX1 A;  4RUG A;  1K0X A;  4A63 B;  1WFW A;  2CSQ A;  1T3S A;  2RQW A;  4F16 A;  1YWP A;  1X2K A;  2HCK A;  2MOX A;  1KFZ A;  1Y0M A;  4OMM A;  1ABQ A;  5GJW B;  1U3O A;  2DF6 A;  3M0P A;  2YUP A;  3VS6 A;  4LUE A;  1FYN A;  4J9I A;  1EFN A;  2LCS A;  1NLO C;  1NYG A;  1SHF A;  2DRM A;  2VKN A;  1GCQ A;  1TG0 A;  1RI9 A;  1UDL A;  1HD3 A;  2D8J A;  2EYW A;  2RPN A;  2EYZ A;  4JJD A;  4LE9 A;  3LH5 A;  1JQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...