2DL4A

Solution structure of the first sh3 domain of stac protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
GSSGSSGNTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Protein Stac
publication title Solution structure of the first SH3 domain of Stac protein
rcsb
source organism Homo sapiens
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl4A00
5IXFA 1EFNA 2LNHB 1GBRA 4J9DA 2M0YA 1YP5A 4OMPA 1BK2A 1H8KA 3VS5A 1E6GA 2W0ZA 2K79A 1CSKA 1UTIA 1WI7A 1OV3A 2LJ0A 2GGRA 1QKWA 2HSPA 3C0CA 4LE9A 1SHGA 4M4ZA 1GFDA 3NHNA 1CKBA 1Z9QA 2HCKA 1QWFA 2EQIA 4D8DA 3KFVA 1NM7A 2JW4A 2XMFA 3I5SA 3EHQA 2DF6A 1VYUA 1WXUA 2YUPA 5FWCA 1QWEA 2DNUA 1RLQC 4ESRA 2ECZA 1YNZA 3H0HA 1X43A 2CUDA 3JV3A 2DL3A 4LUEA 2CREA 1OEBA 1ZBJA 4WCIA 1QLYA 3UATA 2EYWA 2KRSA 2HEQA 2MCNA 1ZUYA 3I9QA 1OOTA 2JM8A 2H8HA 2PZ1A 1X2KA 1BU1A 1BB9A 2JXBA 2KGTA 1M8MA 1IO6A 1X6GA 2V1QA 1UJYA 1YWPA 2X3WD 2BTTA 1KJWA 2LP5A 1I1JA 2EPDA 3EGUA 1JU5C 1WX6A 1UJ0A 3UF4A 2ABLA 4Y92A 1ZLMA 4K11A 4Z8AA 1WIEA 1ABOA 2KXDA 1AWWA 1GFCA 4J9CA 2X3XD 1W70A 2AKLA 1X69A 2D8HA 3U23A 5HCKA 1K0SA 5FW9A 4RTXA 2KBTA 3LH5A 2D1XA 1NLPC 2EGAA 4RTWA 1NEGA 1WFWA 2EBPA 4LN2A 4AFQC 1M3AA 1QKXA 1JXOA 4IIMA 1SRLA 1YN8A 1SPKA 1JQQA 2DRMA 2JMCA 1K9AA 3PVQA 4HVWA 1OPLA 2A37A 4RTVA 4JJBA 1ZUUA 3I35A 1A0NB 2ROTA 2J7IA 2DBKA 1MV0B 1WA7A 1RI9A 2O2OA 2AZVA 2DRKA 2V1RA 1CKAA 3H0FA 2IIMA 1GL5A 4RUGA 1PHTA 2PNIA 4HCKA 1AWXA 3VS2A 3M0SA 3A98A 2RQWA 1RUWA 2LX7A 2KT8A 2A36A 2DILA 2FG0A 4J9EA 4CC7A 2C0OA 2L2PA 2M51A 1M27C 4J9HA 4X1VA 4D8KA 1NG2A 1WDXA 1NYFA 2KROA 2W10A 3RNJA 1UECA 2GBQA 2JS2A 1I07A 2J6FA 2MIOA 2KR3A 2RQVA 2L3QA 4EIKA 5IXBA 3VS6A 4QT7A 5IHNA 2RN8A 1M3CA 2DL8A 2JMAA 1BBZA 2OI3A 2L3SA 1M30A 2VVKA 4J9GA 3SEMA 2AK5A 1GRIA 1X6BA 1UHCA 3H41A 2DVJA 2SRCA 2JTEA 1UE9A 4Z88A 3TSWA 1FYNA 2B86A 3REAB 4RTZA 1AEYA 1Z9ZA 5I22A 2KEAA 1K4US 2F2XA 1S1NA 3M0PA 4JJCA 2FEIA 2GNCA 1UHFA 1GCQA 2ED1A 2KT1A 2E5KA 4CC4B 2YUNA 2KXCA 3EG3A 2YT6A 4JJDA 2FRWA 1MUZA 1SHFA 2DA9A 1SRMA 2FO0A 1B07A 2O31A 1K76A 1MV3A 2DE0X 2LQWA 1U06A 1PKSA 5FWBA 3RBBB 2F2VA 2K3BA 2VWFA 1TUCA 4RTUA 5IHKA 1T0JA 1KSWA 2DL7A 2EYXA 3EHRA 1E6HA 4RTYA 1AVZC 1ZX6A 2BZYA 3H0IA 3THKA 2YUOA 2VKNA 1AWOA 1SSHA 4HXJA 1RLPC 1HD3A 2ROLA 1T3LA 4ORZA 1G83A 2GTOA 1OPKA 2LZ6B 4JPBW 3VS3A 3SHWA 2J6OA 2OJ2A 2GTJA 1NEBA 1K1ZA 3VS0A 4OMQA 1PKTA 5I11A 2O9SA 4RTTA 3ULRB 1KIKA 2AKKA 1UG1A 2J05A 3VRZA 2DMOA 1LCKA 4DEYA 2LMJA 3GBQA 2JT4A 1G2BA 2K9GA 1UUEA 2CT3A 3QWYA 1VYTA 2KYMA 1ZSGA 3ZL7C 2CSIA 4IIOA 2RQRA 2P4RA 2RQUA 2JS0A 1PNJA 1X2QA 2LCSA 1GBQA 2MOXA 1E7OA 2CH4A 3O5ZA 4LNPA 2SEMA 1AZEA 1TUDA 4AFUC 4F16A 1XOVA 3REBB 2O88A 2ED0A 3M0TA 1H3HA 3VS7A 3NGPA 1Y0MA 4F17A 4OMMA 1YWOA 2DX1A 2BZXA 2KRNA 3FJ5A 1K0XA 2HBWA 2RNAA 1H92A 4E6RA 1W1FA 2DJQA 3VS4A 3NMZC 2LJ1A 1JO8A 2EVRA 3M0UA 4LUDA 4HVUA 4AG2C 2YSQA 3VS1A 2K7AA 2CSQA 4FSSA 2C0TA 1WLPB 1Y57A 1FMKA 4OMOA 1VA7A 2EYYA 3TVTA 2GQIA 2CUBA 2I0NA 3CQTA 4OMLA 1KFZA 2KYBA 1V1CA 2QDLA 3PE0A 2JM9A 2L3PA 1AOJA 4AG1C 3TSZA 3R6NA 4GLMA 4AFSC 1WXBA 1U5SA 2EKHA 4OMNA 2BZ8A 3VRYA 5EC7A 1I0CA 3I5RA 1PWTA 1U3OA 2HDAA 1ABQA 3EG0A 2EGCA 5IHIA 2EGEA 1W6XA 2FPDA 4R0KA 4JZ4A 3M0RA 4J9IA 2NUZA 2YUQA 3EG2A 5IH2A 4DEXA 2FPFA 5L23A 1N5ZA 1ARKA 1GCPA 3IQLA 2RPNA 1VYVA 1JEGA 2CH4W 3UA7A 5ECAA 2DYBA 2KNBB 2LJ3A 1T3SA 2KE9A 1SEMA 2J06A 2D0NA 4F14A 2DL4A 2DLPA 2DBMA 4JZ3A 2F2WA 4J9FA 2G6FX 5GJWB 2OAWA 2ENMA 2O9VA 2ESWA 1B3QA 4Z89A 4KRTA 2A08A 2K2MA 2RF0A 2LQNA 2RQTA 1GCQC 5GJVB 1PRLC 2C0IA 3QWXX 1NLOC 2D8JA 2K6DA 1UGVA 1M3BA 1YCSB 2FPEA 2EW3A 3NPFA 2CDTA 2J6KA 2RMOA 2L0AA 4HVVA 1X27A 1J3TA 2CT4A 4A63B 1ZUKA 1WXTA 1HJDA 3PVLA 2DM1A 1PRMC 1UDLA 4GBQA 1QCFA 2KRMA 2AZSA 2YDLA 2A28A 1JXMA 1NYGA 1TG0A 1UFFA 4ZNXA 2DL5A 2EYZA 1HSQA 4CC2A 3M0QA 1AZGB 1T0HA 1WYXA 2PTKA 2NWMA 3EG1A 4J9BA 3UA6A 4CC3A 4AFZC 2FRYA 1AD5A 1AWJA
chains in the Genus database with same CATH superfamily
4L59A 4HCCA 1K9MU 2LNHB 4FT4A 4J9DA 2ZCFB 5D6XA 2KY9A 3JCMb 4C92C 4Z02A 1Q7YC 4MMLA 3S3NA 2RHZA 4PJNA 3OYLA 3EG9A 2EQUA 2KAFA 9ATCB 2GGRA 3PIPA 2HKNA 5KYUA 1SHGA 4M4ZA 4M77D 2P4TA 3NHNA 2Z0WA 4C0DC 2FL7A 1PD0A 2LQKA 1X01A 3TCJA 3A8OB 1KQ2A 2EQIA 5FRNA 4MDWA 4C5IA 3KFVA 2VXEA 4M7AA 5KE3A 5GANe 2DF6A 1JB0E 1PM3A 5FWCA 1QWEA 2DNUA 2ECZA 5GAOr 1WHLA 3OS0A 2ZPBB 5GMKe 1W2BS 1SKUB 4A4GA 2E10A 5DY9A 2MAMA 2HQXA 4BY6C 3J80E 4LUEA 3SD4A 4ATOA 3UATA 1QLYA 1YIJA 2HEQA 2MCNA 5GAN5 1ZUYA 3PGGA 1VQMQ 1BU1A 3ER0A 2KGTA 2DXUA 1YJWQ 1X6GA 2HL3A 2EWNA 2X3WD 2BTTA 4PKCC 3QPHA 1I1JA 4OGEA 3BDUA 3EGUA 3QUIA 2LX9A 1WX6A 1UJ0A 3UF4A 2ABLA 4Y92A 4R56A 3JCMd 5KE2A 3G6EA 5GAN7 3CXCP 1ABOA 2KXDA 3QKJA 1QVGP 5KH6A 4C8QG 4M75F 1GFCA 1SSFA 2RH2A 1NJIC 4EMGA 2K57A 4KGZB 2KBTA 4PJOG 1NLPC 2EGAA 4JLGA 2FVUA 4AFQC 1YHQA 4M78F 3OYEA 3X26B 1N9SA 2NYSA 3INZA 3GPLA 1SPKA 2DRMA 2DVEA 5KYXB 1UEBA 3PVQA 2RJDA 4HVWA 4RTVA 3FEOA 4F7UG 3JCMQ 4JJBA 1JBMA 2DZCA 2QGGA 2J7IA 1QP2A 2ROTA 4KGVB 3VV0A 1WJQA 4M75B 1VQ4T 4M7DF 4KH1B 1Y07A 1IB8A 1BI0A 8AT1B 3CC2Q 4M78B 2RQWA 4ME7A 2X51A 3PTAA 2LX7A 1IRXA 2KT8A 4M77G 2FG0A 2H3EB 2OTLQ 1PC0A 1IXDA 3RUXA 5LJ5g 4A53A 2MMPA 3UWNA 1Q7YR 2CP2A 4M7DB 2QQBA 2KR3A 3PMIA 3VS6A 3TU4K 3LWHA 1HK9A 1I5LA 4XTVA 3FIFA 1NZ9A 1W2BA 3OMGA 2DIGA 4GY5A 2DL8A 3CC7T 4XTYA 3CCMQ 3DLLA 4PLLA 3QG1A 1I5OB 5CQYA 4C92D 2DVJA 2V8KA 4BACA 2FB7A 1FYNA 2WSFE 3REAB 2BE7D 1AEYA 3A1PA 5I22A 1K4US 4CI0C 1M1KC 2DPPB 2X4JA 4JS4A 4JJCA 1TSFA 3CCST 2KT1A 2ED1A 2XI9A 3EG3A 2C06A 2YT6A 4FYVB 4RCCA 2FRWA 2I2LA 1SHFA 2XU8A 5EG2A 2OTJQ 2O31A 1MV3A 4FT2A 2DKGA 1PKSA 4L5GA 3J7AF 2DXTA 1QMCA 3MP8A 3QSUA 2Y4XA 3EFOB 2NUTB 3DB4A 3QYGB 2XDPA 1KSWA 3EHRA 2YUOA 1NJIR 2VKNA 1SSHA 1OYXA 4MZPA 1RLPC 1NE8A 1T3LA 4N0AA 3CCVQ 1G83A 1OPKA 4JPBW 2VYTA 3CBOA 2GTJA 3JCMV 1MNDA 2F1LA 4RTTA 3I56A 3FC3A 1YJWA 4IUUA 2QGFB 5GAMe 3G4SA 1YJ9T 4X9CA 3GBQA 3CPWP 1VQPQ 1G2BA 4PL6A 3CCJQ 4F04B 4M75C 2V8IA 2KYMA 1ZSGA 3ZL7C 2RQRA 4DBQA 3CC4T 2LCSA 3EH2A 2COYA 4JRIA 4AFUC 3EAEA 5GAN2 4M78C 3NGPA 4F17A 2KRNA 2BZXA 2DETA 2HBWA 2DEUA 3CCRA 3M9QA 4IKFA 4FL6A 1W1FA 2DEQA 1VQ5T 3NMZC 4XTXA 2LDMA 2DFUA 3M0UA 4HVUA 2RJCA 2YXYA 4M7DC 3BY7A 1D1CA 1Y57A 3HTRA 2QA4A 4C92G 1ZA2B 2BIVA 2JM9A 2L3PA 1VQLQ 4OVAA 3OYKA 2DAQA 4GLMA 4M75E 3JCMX 3AHUA 3EFSA 4ZGDB 1NJIU 1MNEA 4HA8A 1TOVA 3A8GB 5C6SA 2MWPA 1LPLA 3HKSA 1ABQA 3VKIA 2EGCA 4M78E 2XD0A 1VIFA 1W6XA 3CCUQ 1M1KR 5IH2A 1OX9A 4DEXA 2WSCE 5GAN8 4MDXA 1N5ZA 5CKDA 5DLOA 1VQ7Q 3V8KA 3WXMB 1JJ2A 3JCMf 2AT1B 4M7DE 4PJOA 3VJPA 3PMTA 1VYVA 2E65A 3UA7A 5LJ3f 2KNBB 3HP9A 1T3SA 1N27A 3DLMA 1SEMA 2D0NA 3RMQA 3OYJA 1VQKQ 2DLPA 1C6VX 4NL3A 4J9FA 1RAHB 4ZGEB 3WVDB 2NUPB 3DB3A 3X25B 2OAWA 1IHVA 4PJJA 1VQ6Q 1R0BG 1B3QA 2MPXC 2K5IA 5HY6A 2LQNA 2V8JA 1Q86C 2DTOA 5CVIA 1GCQC 2MF2A 3LWIA 1VQMT 3E1SA 2D8JA 4J7IA 2QASA 2OTJA 3QIIA 1VQNQ 1YCSB 4C5EA 2EW3A 3FJPA 4EMKA 1YJWT 4BE2A 2J6KA 1RABB 1KG1A 3P8DA 1J3TA 3MEVA 1H641 2CT4A 3H8ZA 4BI4A 4M77A 4PJMA 1ZUKA 1LVKA 1OX8A 3CMAQ 1HJDA 4OF1A 1VQ8A 1O75A 1PRMC 1UDLA 3E2UA 4GBQA 2GF7A 4LDVA 4EPCA 3CCLQ 4BI8B 1TG0A 3CCVA 3OB9A 1Q82C 2EIFA 4ZTFA 2CS7A 2KSSA 1AZGB 5A0GA 2IVWA 1TXQA 2HZYA 2NWMA 4CC3A 3UA6A 1M1KU 4AFZC 2X35A 5CKHA 1EZZB 3HSBA 5IXFA 4M75D 5D6YA 1YCYA 3OYYA 5KYWA 1VOMA 1WJSA 1PCXA 3OQ5A 4JS5A 5FROA 4DOVA 1DJ7B 1M90C 1E6GA 1CSKA 1UTIA 1S72Q 5J26A 3VUBA 3QYHB 1B34A 3I55Q 1OV3A 2LJ0A 4M78D 1QKWA 2QXFA 3OW2S 2HSPA 2PQWA 2X4YA 3M58A 4J6WA 3JCMc 1ZQ1A 1GFDA 3CC2T 3PT9A 2HCKA 3A5ZB 3CCEQ 1QWFA 3SWNB 4D8DA 1QVFS 1AHJB 4FSXA 2E5QA 4X34A 1BCOA 2OTLT 4M7DD 4IUTA 1VYUA 1WXUA 2HNIA 2YUPA 2RK2A 1RLQC 4XTZA 4M7AF 5IT9E 1YITQ 4MMKA 2RJEA 1X43A 2CUDA 3JV3A 3X20B 3M55A 5LJ5h 1XTDA 4N4IA 1Y71A 1ZBJA 4QQGA 4RG8A 5A2QE 3CMEQ 3CCMT 3EG9B 3SB2A 3P8HA 2MWOA 3I9QA 5KYUB 1OOTA 2PZ1A 1D0XA 2DXCA 2BE9B 2JXBA 1HXDA 3C94A 5GAOp 3QDFA 4E7HA 2V1QA 2GQVA 1UJYA 3L2VA 2D6FA 1EX4A 2LRQA 1JU5C 4V2SA 1ZLMA 1WIEA 4ELZC 4JRPA 4A4EA 2QQSA 3HHTB 2QYZA 1X69A 1VQ7A 1WPYA 5HCKA 1Q86R 1K0SA 3MEUA 1Y96A 2OTJT 3LH5A 1VQ9Q 3ZEHA 2NLUA 1NEGA 2YWWA 3CBMA 1JXOA 4IIMA 2LVMA 3GP8A 3F70A 1M2VA 2EFIA 2A37A 1ACMB 1VQ4A 3I35A 1A0NB 2DBKA 3HRUA 8ATCB 1MV0B 3C4SA 4LDWA 4C92A 2CZ0B 1R77A 3V8JA 3CCVT 2O2OA 2RK1A 2DRKA 2V1RA 5GMKl 3L2WA 1Q82R 2K5LA 2IIMA 2YLBA 3VYGA 3QJ6A 4HCKA 2XHCA 3VS2A 3BW1A 1VQPT 1RUWA 1YI2Q 3OA6A 3N5BB 2YRCA 1KK7A 2L2PA 1M27C 4C5GA 4D8KA 1QVFA 4E7JA 1NYFA 1M90R 2EAYA 2KROA 4BD3A 3RNJA 4Y28E 1TTHB 2MIOA 3JB9F 2WSEE 2RB6A 2E41A 4QT7A 3CC7A 2RN8A 3SWNC 1VIEA 2JMAA 4TVRA 3EH1A 1MMGA 1QW1A 4OB0B 5FRMA 4J6XA 5IN1A 4J9GA 3SEMA 1UGQB 2AK5A 4OB1B 1UHCA 4FW2A 1Q86U 2SRCA 2FHDA 3FRNA 3JSCA 4RG2A 2DZ9A 2E6ZA 1W2BP 2F2XA 2ZPEB 3CCSA 2QK0A 5CO7A 5LJ3j 4OB2B 5GAOn 1VQLT 1OU8A 4AMCA 2GNCA 3GNGA 1WHGA 2M9UA 2YUNA 2B8AA 2DA9A 5GAMf 3GIBA 3M4YA 3L2RA 1Q82U 3PIOA 2K3BA 2VWFA 5LJ3d 3CCUT 4RTUA 4BI3A 5IHKA 2KMTA 2LTOA 1VUBA 1T0JA 2E6NA 1MHNA 2FZKB 1E6HA 4RTYA 2L3RA 2BZYA 3H0IA 1IREB 4ZN1A 1VQ7T 2QG9B 4HXJA 1FMWA 3CXCS 3BFMA 1QVGS 2XK0A 2LZ6B 3A8MB 3MP6A 3SHWA 1M90U 1NEBA 3VS0A 4OMQA 1PKTA 5GMKi 2O9SA 1KIKA 3NTKA 2AKKA 2EQMA 1YJ9A 4JDSA 2DK3A 4PNOA 3VRZA 3WVEB 2IPOB 4C5HA 3GNFB 2MK5A 4JRQA 2K9GA 2JTMA 3CC4A 1VQ6T 4C0GA 1G3WA 2P4RA 2RQUA 1PNJA 1GBQA 3KBGA 2R5MA 1E7OA 2CH4A 4M7AE 5GANj 3O5ZA 2SEMA 2JTFA 1AZEA 3RDVA 1TUDA 2QTXA 3REBB 1VQNT 3MO8A 1ZSZA 2E3HA 3VS7A 1VQ9A 2QQ9A 3PNWC 4DBFA 5GMKj 4OMMA 1VQ5A 4A4HA 5KCOA 4D6WA 3CMAT 1JO8A 1I8FA 2EQKA 4LUDA 1KQSP 2YSQA 1YJNQ 2K5FA 3GF5A 2YRVA 4FSSA 5C0MA 5GANd 1FMKA 4OMOA 3CCLT 2K3XA 1Q81C 2GQIA 1ZHIA 2L89A 4OMLA 2QDLA 3J81E 1QVPA 1VQOQ 4HKEA 3P8BB 4QW2A 2PVGB 2MI6A 4PFPA 2EKHA 4KGXB 4BDZA 5GAN6 1G3TA 1I0CA 3I5RA 1PWTA 3JB9J 4RKUE 1PD1A 1KD1C 3CCQQ 1S72T 2FPDA 1OULA 1R8OB 2CP6A 4R0KA 3I55T 2NUZA 4Y91A 2DTIA 3EG2A 2CYZB 4ZN3A 1LNXA 1TH7A 1SF9A 3FB9A 3CCET 2DYBA 2LJ3A 2PUKB 3CXCA 4F14A 4PJOF 5LJ5e 1V76A 2F2WA 5CKFA 1YITT 4BE0A 3LYIA 1JJ2P 3O8VA 3JCMh 2A08A 3CMET 3JCMW 1VQMA 3RKYA 1Q7YU 3V7CA 2VGMA 5GJVB 3QDRB 3HL8A 3S3MA 3LGLA 2WACA 4OB3B 4PJOB 2ZPFB 2VC8A 2JZ2A 3OSSC 3Q1JA 4DOWA 4M77F 4DA4A 2JVVA 2CGHA 2A28A 1NYGA 1K73C 1UFFA 2DL5A 2OX7A 1VQ9T 4N0AC 3M5AA 1IZ6A 1T0HA 4NL2A 1UGPB 3EG1A 2COZA 4PFZA 4FU6A 4NS5A 1AD5A 1GBRA 4E7ZA 2VB6A 2M0YA 1AT1B 4PFOA 5GAN3 2CZ6B 4LDYA 4OMPA 1BK2A 2XDBA 1H8KA 4QKUA 5AYFA 1WHMA 2W0ZA 2EQJA 4M77B 4PK4A 4BE1A 1Q81R 2HL5C 4QQDA 2E1HA 2O4XA 1TUGB 1SG5A 2RHUA 3C0CA 3RKWA 3CC2A 3CD6Q 2VUBA 3OSVA 5I21A 1CKBA 5AT1B 1RAIB 1Z9QA 4P5NA 1YI2T 2OTLA 3FLGA 3I5SA 1G8XA 3OYAA 3EHQA 4RMOA 3SFMA 2F69A 4ESRA 3EFOA 4C8QA 1KD1R 2LCLA 5KYWB 2KI7A 2QEXQ 3SDZA 2K4YA 2DL3A 5GAMj 3CCMA 2CREA 2CP0A 3CEYA 4ZTJA 2QQAA 4WCIA 1B34B 3BDLA 2JM8A 3C12A 4BB7A 3OY9A 1BB9A 4ANJA 1M8MA 1IO6A 1Y7XA 4F7UA 1KQ1A 3JB9D 1KJWA 2LP5A 2EPDA 1TWBA 5GAMd 4NOYA 2P0PA 1BKBA 2X3XD 1W70A 4J83A 2D9TA 3U23A 3M59A 4FYWB 2D1XA 4PJOC 1WFWA 1Q81U 1PSEA 4LN2A 4FCYA 1M3AA 3TQ7P 4IUPA 1YN8A 4Q5WA 4JJNK 2JMCA 4LXCA 4N4GA 5CR2A 3M54A 3OS2A 5M9OA 4OP0A 2PU9B 3BE3A 2E4HA 2HSEB 1WA7A 4VUBA 1HYOA 2RHXA 1RI9A 3G71Q 1FMVA 1K73R 4B9WA 4C92F 2HQHA 2PUOB 1GL5A 1KD1U 5GANf 4N4HA 4RUGA 2P84A 2PNIA 1VQPA 1R0CB 1AWXA 1Y96B 2COWA 3CCJA 1YBYA 3A98A 5GMKm 1EIFA 4JLIA 3X24B 2P0KA 3M4GA 3G1JA 5HK0A 2DILA 4M77C 4CC7A 1M8VA 2C0OA 2Y4YA 2M51A 5LL6S 2RI3A 3OBWA 4PJOE 1WDXA 1RACB 1M2VB 4DBHA 2LQ8A 4E47A 2ZGWA 3EGXA 2JS2A 2JOYA 1I07A 3HRSA 3URGA 2J6FA 1F1BB 4EIKA 5IXBA 5IHNA 5KYYA 1QCNA 3V7SA 3VUZA 1M3CA 5CAIA 1QCOA 2OI3A 2L3SA 1M30A 2CP5A 2VVKA 1GRIA 2LNVA 1YIJQ 3JCMg 1YJNT 2JTEA 4JUVA 3UT1A 5LJ3g 2HMAA 4PJLA 1D1BA 4RTZA 4YTLA 2KEAA 1M1FA 4KBMB 4DBRA 1PG5B 1VQLA 4XQ3A 1U8RA 2CZ7B 1S1NA 3M0PA 1VQOT 2V26A 3JB9G 1G3YA 3QZ5B 2K3YA 3G6EQ 2E5KA 4M77E 5FLXE 2KXCA 2DTHA 2O01E 1MUZA 1SRMA 4QVDA 4OGCA 2LQWA 1U06A 4M7AB 1K73U 5FWBA 1MMNA 3MJXA 3CCUA 1ZBXA 3RBBB 3CCQT 1H3ZA 1WHJA 3MPUB 2LC4A 2CP7A 4WF2A 1YHQQ 3GLXA 5KYNA 4IUVA 2KVQG 3L2QA 2DL7A 2EYXA 1UGRB 1G3SA 2VGNA 4MZMA 3THKA 1AWOA 3S3OA 4LDXA 1LOJA 3QZ9B 2ZAEA 1D3BA 4J8OA 4R55A 2ROLA 2GTOA 1VQKA 1D0YA 2J6OA 2OJ2A 1K1ZA 3OYMA 2KQWA 1RAEB 3QXEB 3QHSA 1RAFB 1UG1A 2J05A 4O6JA 2DMOA 5D7UA 2DO3A 2LMJA 4EDUA 1VQ6A 1D09B 4X9DA 4M75G 3ASKA 5GANg 3LW5E 1VYTA 4A4KA 2EJGA 2MOXA 4PJOD 1VQNA 2QDYB 4J5YA 1FX7A 1XOVA 1K8AC 2ED0A 1NPPA 1QP3A 1H3HA 3OW2A 1Q95G 4M78G 2CP3A 2A0FB 4KUIA 4E7SA 3CCJT 1K0XA 3CMAA 2RHIA 3VS4A 2LJ1A 3X28B 4M7DG 3CCLA 2K7AA 2CSQA 5I2SA 4BDYA 2C0TA 1WLPB 1VA7A 2EYYA 3TVTA 1N9RA 3G71A 2CUBA 2XIDA 2KYBA 1V1CA 1KFZA 1TU0B 3HFNA 2RD1A 5IAYA 1AOJA 3EGDA 2GCXA 1KHIA 1BYMA 4A4FA 4AFSC 4KH0B 2A7YA 4ZGJB 3NTIA 5LJ5f 2BUDA 1ZSZB 3RESA 4OMNA 3VRYA 5EC7A 2FYKA 4QVCA 1S72A 2HDAA 5CK9A 4XU3A 3I55A 5IHIA 2R58A 2ZPIB 4JZ4A 3M0RA 2AIRB 1N6AA 4GLKA 3CD6T 3CCEA 3H6ZA 5L23A 3RMSA 3OYFA 2H3JA 5HK3A 3NFCA 1GCPA 2RPNA 3CBPA 5HKCA 4M7AC 1JEGA 2CH4W 2RJFA 3EFRA 5ECAA 4LD9K 3OYDA 2J06A 2ZPHB 1WHHA 4FW1A 4C92E 4KUDK 1YITA 4KULA 3E9GA 4B6MA 1WGSA 3LX7A 3I56Q 1M5Q1 2QEXT 2EYQA 3G4SQ 3CMEA 2HBPA 2YRDA 5J39A 1RL2A 1V29B 2RQTA 1VQKT 1PRLC 3QWXX 1NLOC 2HKQB 2JJ9A 1NBEB 3RERA 4KT0E 2FPEA 3NPFA 3GOXA 2CDTA 2RMOA 2L0AA 4HVVA 1X27A 2M1HA 3D7SB 3UPUA 3A8LB 3CCRQ 4CRIA 1WQ7A 4IURA 4IUQA 1P92A 2KRMA 2E70A 2AZSA 2YDLA 1JXMA 4ZNXA 5GAOl 1IGUA 1K8AR 3M0QA 2QA4Q 4C0FA 1GXIE 4J9BA 4BUGA 1EFNA 2ATCB 3VYHB 1YP5A 2XG8D 5L8RE 5A0LA 3DKMA 2MYSA 3VS5A 3G71T 3TEEA 1KHCA 2K79A 1KQSS 2EJFA 1WI7A 2GFAA 3OYBA 1OZ3A 3HFOA 4XU2A 3OS1A 3JCMP 4LE9A 2F5KA 4ELYC 1ZSZC 1YI2A 2FZGB 2Y90A 3M57A 2RO0A 1B7TA 1NM7A 2JW4A 2PVDB 2XMFA 1X6OA 3HRTA 2EJ9A 3OBYA 5GAMg 2HQEA 1YNZA 2PVOB 5CKEA 3H0HA 4C8QF 2DERA 1OEBA 2QI2A 5A0DA 2O4XB 3QO3A 1X75C 2EYWA 2KRSA 4HT8A 1QVGA 4HCBA 6AT1B 1YIJT 2JN0A 2H8HA 1X2KA 5KYXA 2DD4A 4QVZA 1PSFA 3JB9H 2R57A 1YWPA 1K8AU 4M75A 2RA2A 2JUFA 4K11A 4Z8AA 4F7UF 2XICA 5DM7R 4RCBA 5LJ3h 1MMDA 1AWWA 3G6ET 4J9CA 4C8QB 2VXFA 1VQ8Q 2AKLA 5J3BA 1WQWA 2D8HA 3V8LA 1JJ2S 5FW9A 4M7AD 4XTWA 4RTXA 4LD6A 5GAOq 1BIAA 2HD0A 3A8HB 3OMCA 4M78A 4RTWA 1BI3A 2E12A 2EBPA 3OYIA 1FWZA 1QKXA 2GFUA 1SRLA 5DLQE 2E3IA 1JQQA 1YHQT 1K9AA 1ZA1B 3CPWS 3TREA 3RIRA 1OPLA 4M7DA 4F7UB 1ZUUA 3JRZA 3CPFA 3QJYA 3OYGA 4J7FA 1I81A 1M1GA 2D0QB 2E64A 2JNGA 1G5VA 3RKXA 2AZVA 1CKAA 3H0FA 1KQSA 3L2ZA 1PHTA 3E19A 4EMKB 3M0SA 3OYNA 3AT1B 3MP1A 2KK4A 1OQKA 2A36A 3C95A 4J9EA 4EMHA 2DXBA 5CCAA 1OU9A 3HPWA 3KXTA 4X1VA 4J9HA 4E7KA 3META 1NG2A 5FU7B 3S6WA 2W10A 4UC4A 1UECA 1N8RC 2GBQA 3G7ZA 5GANh 5LJ5j 2RQVA 2L3QA 1KC8C 5GMKh 3LLRA 1BBZA 5CKBA 5CQXA 2P0QA 1OZ2A 3JCMJ 4FYYB 1YJNA 2EKOA 1X6BA 4FIBA 1M2OA 3H41A 1BCMA 2NUTA 3M53A 2YHTA 1UE9A 4Z88A 3TSWA 2B86A 1Z9ZA 5LJ5d 4FYXB 1VQOA 3FDRA 1RAGB 3LH0A 5FU6B 4XU1A 2KDSA 2CKKA 1C1AA 4XTUA 2FEIA 1K9MC 1UHFA 1GCQA 4C0ZA 4CC4B 3EGXB 2QTVA 4JJDA 4O5VA 2FO0A 3E9FA 4B9XA 1D1AA 1B07A 4PLIA 4A54A 4OMFB 1K76A 5KYYB 2DE0X 1M4ZA 3CCQA 3R6OA 4M7AG 3L2UA 2M16A 1FXXA 2QQRA 2F2VA 2M02A 2XDDA 4AT1B 1TUCA 3OYHA 4C8QC 2R5AA 3MHXA 1AVZC 1ZX6A 1I4K1 3CPWA 2DIQA 5I2MA 3QBYA 3M56A 4E7IA 1HD3A 1VQ4Q 4ORZA 3KUFA 2QAZA 2F5TX 4J6YA 3VS3A 3LGFA 3OS5A 5I11A 3ULRB 1JRIA 3MEAA 3I56T 1LCKA 4L6V5 4DEYA 5D6WA 2JT4A 1IGQA 1UUEA 3G4ST 2CT3A 3QWYA 2CZ1B 3L1AA 1W4SA 3JAME 2CSIA 4IIOA 1WHKA 2JS0A 1X2QA 1RI0A 5GAN4 4LNPA 3MCAB 4F16A 2HAXA 2O88A 4EMKC 3M0TA 1Y0MA 4C8QE 1D3BB 1YWOA 2DX1A 3FJ5A 3CC7Q 2RNAA 1C0MA 4E6RA 1H92A 2DJQA 5FU7C 1BIBA 3CCRT 1BI1A 2EVRA 4AG2C 3VS1A 1WJRA 3NTHA 3OW2P 4LDUA 4XU0A 2I0NA 3CQTA 4C92B 1N8RR 3PE0A 4XK8E 1YFNA 2QA4T 4F7UE 1QVFP 4AG1C 3TSZA 2AHJB 1KC8R 3CCSQ 3MKDA 3R6NA 4HCZA 1RADB 1RAAB 4XAXB 1WXBA 1U5SA 2ZPGB 4E7LA 2X4WA 1XJWB 2BZ8A 4C0DB 2NUPA 4II1A 1U3OA 5FU6C 3EG0A 5CIUA 2VV5A 2EGEA 2XKOC 3RR6A 4J9IA 2M0OA 3CD6A 2YUQA 2RI2A 2FPFA 1K9MR 1WZOA 3OYCA 4QQ6A 1ARKA 2RHYA 3IQLA 4BY6B 1D0ZA 2L5QA 3EGDB 1XNIA 2KE9A 2DL4A 4JZ3A 2DBMA 2QEXA 1O9SA 2L8DA 4WTOB 2G3RA 2LT1A 1LJOA 2RM4A 2LCCA 1YJ9Q 2G6FX 5GJWB 2A3LA 2K2VA 3ZBDA 1M9SA 2ENMA 2O9VA 2ESWA 3JB9I 5GAMh 3VU3C 2YLCA 4Z89A 4KRTA 2K2MA 1WNLA 2RF0A 3CC4Q 4MZTA 4DQ2A 1TS9A 1MGQA 2C0IA 2LT4A 2BKDN 2K6DA 1UGVA 4E2FB 2X9HA 1M3BA 3L42A 7AT1B 4HT9A 4FM4B 3JCMe 2DD5A 1N8RU 1IHWA 1UB4A 3H9NA 3PFSA 5LJ3e 2IG0A 3V7RA 4C8QD 1U1SA 2VASA 4A63B 3ZFJA 1NPRA 1KC8U 1WXTA 1VQ5Q 2DJZA 3T9NA 1U1TA 3PVLA 2DM1A 1VQ8T 1QCFA 3MEWA 2RI5A 2X4XA 2FZCB 2ZZDA 1XQHA 1MMAA 2DYIA 4JRKA 2EYZA 1HSQA 3SWNA 4CC2A 1OI1A 2OAUA 1WYXA 5KCHA 1BI2A 1UGSB 2PTKA 3ME9A 3UDCA 5GAOm 2FRYA 1QQJA 1AWJA
chains in the Genus database with same CATH topology
5IXFA 1EFNA 2LNHB 1GBRA 4J9DA 2M0YA 1YP5A 4OMPA 1BK2A 1H8KA 3VS5A 1E6GA 2W0ZA 2K79A 1CSKA 1UTIA 1WI7A 1OV3A 2LJ0A 2GGRA 1QKWA 2HSPA 3C0CA 4LE9A 1SHGA 4M4ZA 1GFDA 3NHNA 1CKBA 1Z9QA 2HCKA 1QWFA 2EQIA 4D8DA 3KFVA 1NM7A 2JW4A 2XMFA 3I5SA 3EHQA 2DF6A 1VYUA 1WXUA 2YUPA 5FWCA 1QWEA 2DNUA 1RLQC 4ESRA 2ECZA 1YNZA 3H0HA 1X43A 2CUDA 3JV3A 2DL3A 4LUEA 2CREA 1OEBA 1ZBJA 4WCIA 1QLYA 3UATA 2EYWA 2KRSA 2HEQA 2MCNA 1ZUYA 3I9QA 1OOTA 2JM8A 2H8HA 2PZ1A 1X2KA 1BU1A 1BB9A 2JXBA 2KGTA 1M8MA 1IO6A 1X6GA 2V1QA 1UJYA 1YWPA 2X3WD 2BTTA 1KJWA 2LP5A 1I1JA 2EPDA 3EGUA 1JU5C 1WX6A 1UJ0A 3UF4A 2ABLA 4Y92A 1ZLMA 4K11A 4Z8AA 1WIEA 1ABOA 2KXDA 1AWWA 1GFCA 4J9CA 2X3XD 1W70A 2AKLA 1X69A 2D8HA 3U23A 5HCKA 1K0SA 5FW9A 4RTXA 2KBTA 3LH5A 2D1XA 1NLPC 2EGAA 4RTWA 1NEGA 1WFWA 2EBPA 4LN2A 4AFQC 1M3AA 1QKXA 1JXOA 4IIMA 1SRLA 1YN8A 1SPKA 1JQQA 2DRMA 2JMCA 1K9AA 3PVQA 4HVWA 1OPLA 2A37A 4RTVA 4JJBA 1ZUUA 3I35A 1A0NB 2ROTA 2J7IA 2DBKA 1MV0B 1WA7A 1RI9A 2O2OA 2AZVA 2DRKA 2V1RA 1CKAA 3H0FA 2IIMA 1GL5A 4RUGA 1PHTA 2PNIA 4HCKA 1AWXA 3VS2A 3M0SA 3A98A 2RQWA 1RUWA 2LX7A 2KT8A 2A36A 2DILA 2FG0A 4J9EA 4CC7A 2C0OA 2L2PA 2M51A 1M27C 4J9HA 4X1VA 4D8KA 1NG2A 1WDXA 1NYFA 2KROA 2W10A 3RNJA 1UECA 2GBQA 2JS2A 1I07A 2J6FA 2MIOA 2KR3A 2RQVA 2L3QA 4EIKA 5IXBA 3VS6A 4QT7A 5IHNA 2RN8A 1M3CA 2DL8A 2JMAA 1BBZA 2OI3A 2L3SA 1M30A 2VVKA 4J9GA 3SEMA 2AK5A 1GRIA 1X6BA 1UHCA 3H41A 2DVJA 2SRCA 2JTEA 1UE9A 4Z88A 3TSWA 1FYNA 2B86A 3REAB 4RTZA 1AEYA 1Z9ZA 5I22A 2KEAA 1K4US 2F2XA 1S1NA 3M0PA 4JJCA 2FEIA 2GNCA 1UHFA 1GCQA 2ED1A 2KT1A 2E5KA 4CC4B 2YUNA 2KXCA 3EG3A 2YT6A 4JJDA 2FRWA 1MUZA 1SHFA 2DA9A 1SRMA 2FO0A 1B07A 2O31A 1K76A 1MV3A 2DE0X 2LQWA 1U06A 1PKSA 5FWBA 3RBBB 2F2VA 2K3BA 2VWFA 1TUCA 4RTUA 5IHKA 1T0JA 1KSWA 2DL7A 2EYXA 3EHRA 1E6HA 4RTYA 1AVZC 1ZX6A 2BZYA 3H0IA 3THKA 2YUOA 2VKNA 1AWOA 1SSHA 4HXJA 1RLPC 1HD3A 2ROLA 1T3LA 4ORZA 1G83A 2GTOA 1OPKA 2LZ6B 4JPBW 3VS3A 3SHWA 2J6OA 2OJ2A 2GTJA 1NEBA 1K1ZA 3VS0A 4OMQA 1PKTA 5I11A 2O9SA 4RTTA 3ULRB 1KIKA 2AKKA 1UG1A 2J05A 3VRZA 2DMOA 1LCKA 4DEYA 2LMJA 3GBQA 2JT4A 1G2BA 2K9GA 1UUEA 2CT3A 3QWYA 1VYTA 2KYMA 1ZSGA 3ZL7C 2CSIA 4IIOA 2RQRA 2P4RA 2RQUA 2JS0A 1PNJA 1X2QA 2LCSA 1GBQA 2MOXA 1E7OA 2CH4A 3O5ZA 4LNPA 2SEMA 1AZEA 1TUDA 4AFUC 4F16A 1XOVA 3REBB 2O88A 2ED0A 3M0TA 1H3HA 3VS7A 3NGPA 1Y0MA 4F17A 4OMMA 1YWOA 2DX1A 2BZXA 2KRNA 3FJ5A 1K0XA 2HBWA 2RNAA 1H92A 4E6RA 1W1FA 2DJQA 3VS4A 3NMZC 2LJ1A 1JO8A 2EVRA 3M0UA 4LUDA 4HVUA 4AG2C 2YSQA 3VS1A 2K7AA 2CSQA 4FSSA 2C0TA 1WLPB 1Y57A 1FMKA 4OMOA 1VA7A 2EYYA 3TVTA 2GQIA 2CUBA 2I0NA 3CQTA 4OMLA 1KFZA 2KYBA 1V1CA 2QDLA 3PE0A 2JM9A 2L3PA 1AOJA 4AG1C 3TSZA 3R6NA 4GLMA 4AFSC 1WXBA 1U5SA 2EKHA 4OMNA 2BZ8A 3VRYA 5EC7A 1I0CA 3I5RA 1PWTA 1U3OA 2HDAA 1ABQA 3EG0A 2EGCA 5IHIA 2EGEA 1W6XA 2FPDA 4R0KA 4JZ4A 3M0RA 4J9IA 2NUZA 2YUQA 3EG2A 5IH2A 4DEXA 2FPFA 5L23A 1N5ZA 1ARKA 1GCPA 3IQLA 2RPNA 1VYVA 1JEGA 2CH4W 3UA7A 5ECAA 2DYBA 2KNBB 2LJ3A 1T3SA 2KE9A 1SEMA 2J06A 2D0NA 4F14A 2DL4A 2DLPA 2DBMA 4JZ3A 2F2WA 4J9FA 2G6FX 5GJWB 2OAWA 2ENMA 2O9VA 2ESWA 1B3QA 4Z89A 4KRTA 2A08A 2K2MA 2RF0A 2LQNA 2RQTA 1GCQC 5GJVB 1PRLC 2C0IA 3QWXX 1NLOC 2D8JA 2K6DA 1UGVA 1M3BA 1YCSB 2FPEA 2EW3A 3NPFA 2CDTA 2J6KA 2RMOA 2L0AA 4HVVA 1X27A 1J3TA 2CT4A 4A63B 1ZUKA 1WXTA 1HJDA 3PVLA 2DM1A 1PRMC 1UDLA 4GBQA 1QCFA 2KRMA 2AZSA 2YDLA 2A28A 1JXMA 1NYGA 1TG0A 1UFFA 4ZNXA 2DL5A 2EYZA 1HSQA 4CC2A 3M0QA 1AZGB 1T0HA 1WYXA 2PTKA 2NWMA 3EG1A 4J9BA 3UA6A 4CC3A 4AFZC 2FRYA 1AD5A 1AWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IXF A;  1EFN A;  2LNH B;  1GBR A;  4J9D A;  2M0Y A;  1YP5 A;  4OMP A;  1BK2 A;  1H8K A;  3VS5 A;  1E6G A;  2W0Z A;  2K79 A;  1CSK A;  1UTI A;  1WI7 A;  1OV3 A;  2LJ0 A;  2GGR A;  1QKW A;  2HSP A;  3C0C A;  4LE9 A;  1SHG A;  4M4Z A;  1GFD A;  3NHN A;  1CKB A;  1Z9Q A;  2HCK A;  1QWF A;  2EQI A;  4D8D A;  3KFV A;  1NM7 A;  2JW4 A;  2XMF A;  3I5S A;  3EHQ A;  2DF6 A;  1VYU A;  1WXU A;  2YUP A;  5FWC A;  1QWE A;  2DNU A;  1RLQ C;  4ESR A;  2ECZ A;  1YNZ A;  3H0H A;  1X43 A;  2CUD A;  3JV3 A;  2DL3 A;  4LUE A;  2CRE A;  1OEB A;  1ZBJ A;  4WCI A;  1QLY A;  3UAT A;  2EYW A;  2KRS A;  2HEQ A;  2MCN A;  1ZUY A;  3I9Q A;  1OOT A;  2JM8 A;  2H8H A;  2PZ1 A;  1X2K A;  1BU1 A;  1BB9 A;  2JXB A;  2KGT A;  1M8M A;  1IO6 A;  1X6G A;  2V1Q A;  1UJY A;  1YWP A;  2X3W D;  2BTT A;  1KJW A;  2LP5 A;  1I1J A;  2EPD A;  3EGU A;  1JU5 C;  1WX6 A;  1UJ0 A;  3UF4 A;  2ABL A;  4Y92 A;  1ZLM A;  4K11 A;  4Z8A A;  1WIE A;  1ABO A;  2KXD A;  1AWW A;  1GFC A;  4J9C A;  2X3X D;  1W70 A;  2AKL A;  1X69 A;  2D8H A;  3U23 A;  5HCK A;  1K0S A;  5FW9 A;  4RTX A;  2KBT A;  3LH5 A;  2D1X A;  1NLP C;  2EGA A;  4RTW A;  1NEG A;  1WFW A;  2EBP A;  4LN2 A;  4AFQ C;  1M3A A;  1QKX A;  1JXO A;  4IIM A;  1SRL A;  1YN8 A;  1SPK A;  1JQQ A;  2DRM A;  2JMC A;  1K9A A;  3PVQ A;  4HVW A;  1OPL A;  2A37 A;  4RTV A;  4JJB A;  1ZUU A;  3I35 A;  1A0N B;  2ROT A;  2J7I A;  2DBK A;  1MV0 B;  1WA7 A;  1RI9 A;  2O2O A;  2AZV A;  2DRK A;  2V1R A;  1CKA A;  3H0F A;  2IIM A;  1GL5 A;  4RUG A;  1PHT A;  2PNI A;  4HCK A;  1AWX A;  3VS2 A;  3M0S A;  3A98 A;  2RQW A;  1RUW A;  2LX7 A;  2KT8 A;  2A36 A;  2DIL A;  2FG0 A;  4J9E A;  4CC7 A;  2C0O A;  2L2P A;  2M51 A;  1M27 C;  4J9H A;  4X1V A;  4D8K A;  1NG2 A;  1WDX A;  1NYF A;  2KRO A;  2W10 A;  3RNJ A;  1UEC A;  2GBQ A;  2JS2 A;  1I07 A;  2J6F A;  2MIO A;  2KR3 A;  2RQV A;  2L3Q A;  4EIK A;  5IXB A;  3VS6 A;  4QT7 A;  5IHN A;  2RN8 A;  1M3C A;  2DL8 A;  2JMA A;  1BBZ A;  2OI3 A;  2L3S A;  1M30 A;  2VVK A;  4J9G A;  3SEM A;  2AK5 A;  1GRI A;  1X6B A;  1UHC A;  3H41 A;  2DVJ A;  2SRC A;  2JTE A;  1UE9 A;  4Z88 A;  3TSW A;  1FYN A;  2B86 A;  3REA B;  4RTZ A;  1AEY A;  1Z9Z A;  5I22 A;  2KEA A;  1K4U S;  2F2X A;  1S1N A;  3M0P A;  4JJC A;  2FEI A;  2GNC A;  1UHF A;  1GCQ A;  2ED1 A;  2KT1 A;  2E5K A;  4CC4 B;  2YUN A;  2KXC A;  3EG3 A;  2YT6 A;  4JJD A;  2FRW A;  1MUZ A;  1SHF A;  2DA9 A;  1SRM A;  2FO0 A;  1B07 A;  2O31 A;  1K76 A;  1MV3 A;  2DE0 X;  2LQW A;  1U06 A;  1PKS A;  5FWB A;  3RBB B;  2F2V A;  2K3B A;  2VWF A;  1TUC A;  4RTU A;  5IHK A;  1T0J A;  1KSW A;  2DL7 A;  2EYX A;  3EHR A;  1E6H A;  4RTY A;  1AVZ C;  1ZX6 A;  2BZY A;  3H0I A;  3THK A;  2YUO A;  2VKN A;  1AWO A;  1SSH A;  4HXJ A;  1RLP C;  1HD3 A;  2ROL A;  1T3L A;  4ORZ A;  1G83 A;  2GTO A;  1OPK A;  2LZ6 B;  4JPB W;  3VS3 A;  3SHW A;  2J6O A;  2OJ2 A;  2GTJ A;  1NEB A;  1K1Z A;  3VS0 A;  4OMQ A;  1PKT A;  5I11 A;  2O9S A;  4RTT A;  3ULR B;  1KIK A;  2AKK A;  1UG1 A;  2J05 A;  3VRZ A;  2DMO A;  1LCK A;  4DEY A;  2LMJ A;  3GBQ A;  2JT4 A;  1G2B A;  2K9G A;  1UUE A;  2CT3 A;  3QWY A;  1VYT A;  2KYM A;  1ZSG A;  3ZL7 C;  2CSI A;  4IIO A;  2RQR A;  2P4R A;  2RQU A;  2JS0 A;  1PNJ A;  1X2Q A;  2LCS A;  1GBQ A;  2MOX A;  1E7O A;  2CH4 A;  3O5Z A;  4LNP A;  2SEM A;  1AZE A;  1TUD A;  4AFU C;  4F16 A;  1XOV A;  3REB B;  2O88 A;  2ED0 A;  3M0T A;  1H3H A;  3VS7 A;  3NGP A;  1Y0M A;  4F17 A;  4OMM A;  1YWO A;  2DX1 A;  2BZX A;  2KRN A;  3FJ5 A;  1K0X A;  2HBW A;  2RNA A;  1H92 A;  4E6R A;  1W1F A;  2DJQ A;  3VS4 A;  3NMZ C;  2LJ1 A;  1JO8 A;  2EVR A;  3M0U A;  4LUD A;  4HVU A;  4AG2 C;  2YSQ A;  3VS1 A;  2K7A A;  2CSQ A;  4FSS A;  2C0T A;  1WLP B;  1Y57 A;  1FMK A;  4OMO A;  1VA7 A;  2EYY A;  3TVT A;  2GQI A;  2CUB A;  2I0N A;  3CQT A;  4OML A;  1KFZ A;  2KYB A;  1V1C A;  2QDL A;  3PE0 A;  2JM9 A;  2L3P A;  1AOJ A;  4AG1 C;  3TSZ A;  3R6N A;  4GLM A;  4AFS C;  1WXB A;  1U5S A;  2EKH A;  4OMN A;  2BZ8 A;  3VRY A;  5EC7 A;  1I0C A;  3I5R A;  1PWT A;  1U3O A;  2HDA A;  1ABQ A;  3EG0 A;  2EGC A;  5IHI A;  2EGE A;  1W6X A;  2FPD A;  4R0K A;  4JZ4 A;  3M0R A;  4J9I A;  2NUZ A;  2YUQ A;  3EG2 A;  5IH2 A;  4DEX A;  2FPF A;  5L23 A;  1N5Z A;  1ARK A;  1GCP A;  3IQL A;  2RPN A;  1VYV A;  1JEG A;  2CH4 W;  3UA7 A;  5ECA A;  2DYB A;  2KNB B;  2LJ3 A;  1T3S A;  2KE9 A;  1SEM A;  2J06 A;  2D0N A;  4F14 A;  2DL4 A;  2DLP A;  2DBM A;  4JZ3 A;  2F2W A;  4J9F A;  2G6F X;  5GJW B;  2OAW A;  2ENM A;  2O9V A;  2ESW A;  1B3Q A;  4Z89 A;  4KRT A;  2A08 A;  2K2M A;  2RF0 A;  2LQN A;  2RQT A;  1GCQ C;  5GJV B;  1PRL C;  2C0I A;  3QWX X;  1NLO C;  2D8J A;  2K6D A;  1UGV A;  1M3B A;  1YCS B;  2FPE A;  2EW3 A;  3NPF A;  2CDT A;  2J6K A;  2RMO A;  2L0A A;  4HVV A;  1X27 A;  1J3T A;  2CT4 A;  4A63 B;  1ZUK A;  1WXT A;  1HJD A;  3PVL A;  2DM1 A;  1PRM C;  1UDL A;  4GBQ A;  1QCF A;  2KRM A;  2AZS A;  2YDL A;  2A28 A;  1JXM A;  1NYG A;  1TG0 A;  1UFF A;  4ZNX A;  2DL5 A;  2EYZ A;  1HSQ A;  4CC2 A;  3M0Q A;  1AZG B;  1T0H A;  1WYX A;  2PTK A;  2NWM A;  3EG1 A;  4J9B A;  3UA6 A;  4CC3 A;  4AFZ C;  2FRY A;  1AD5 A;  1AWJ A; 
#chains in the Genus database with same CATH topology
 4L59 A;  4HCC A;  1K9M U;  2LNH B;  4FT4 A;  4J9D A;  2ZCF B;  5D6X A;  2KY9 A;  3JCM b;  4C92 C;  4Z02 A;  1Q7Y C;  4MML A;  3S3N A;  2RHZ A;  4PJN A;  3OYL A;  3EG9 A;  2EQU A;  2KAF A;  9ATC B;  2GGR A;  3PIP A;  2HKN A;  5KYU A;  1SHG A;  4M4Z A;  4M77 D;  2P4T A;  3NHN A;  2Z0W A;  4C0D C;  2FL7 A;  1PD0 A;  2LQK A;  1X01 A;  3TCJ A;  3A8O B;  1KQ2 A;  2EQI A;  5FRN A;  4MDW A;  4C5I A;  3KFV A;  2VXE A;  4M7A A;  5KE3 A;  5GAN e;  2DF6 A;  1JB0 E;  1PM3 A;  5FWC A;  1QWE A;  2DNU A;  2ECZ A;  5GAO r;  1WHL A;  3OS0 A;  2ZPB B;  5GMK e;  1W2B S;  1SKU B;  4A4G A;  2E10 A;  5DY9 A;  2MAM A;  2HQX A;  4BY6 C;  3J80 E;  4LUE A;  3SD4 A;  4ATO A;  3UAT A;  1QLY A;  1YIJ A;  2HEQ A;  2MCN A;  5GAN 5;  1ZUY A;  3PGG A;  1VQM Q;  1BU1 A;  3ER0 A;  2KGT A;  2DXU A;  1YJW Q;  1X6G A;  2HL3 A;  2EWN A;  2X3W D;  2BTT A;  4PKC C;  3QPH A;  1I1J A;  4OGE A;  3BDU A;  3EGU A;  3QUI A;  2LX9 A;  1WX6 A;  1UJ0 A;  3UF4 A;  2ABL A;  4Y92 A;  4R56 A;  3JCM d;  5KE2 A;  3G6E A;  5GAN 7;  3CXC P;  1ABO A;  2KXD A;  3QKJ A;  1QVG P;  5KH6 A;  4C8Q G;  4M75 F;  1GFC A;  1SSF A;  2RH2 A;  1NJI C;  4EMG A;  2K57 A;  4KGZ B;  2KBT A;  4PJO G;  1NLP C;  2EGA A;  4JLG A;  2FVU A;  4AFQ C;  1YHQ A;  4M78 F;  3OYE A;  3X26 B;  1N9S A;  2NYS A;  3INZ A;  3GPL A;  1SPK A;  2DRM A;  2DVE A;  5KYX B;  1UEB A;  3PVQ A;  2RJD A;  4HVW A;  4RTV A;  3FEO A;  4F7U G;  3JCM Q;  4JJB A;  1JBM A;  2DZC A;  2QGG A;  2J7I A;  1QP2 A;  2ROT A;  4KGV B;  3VV0 A;  1WJQ A;  4M75 B;  1VQ4 T;  4M7D F;  4KH1 B;  1Y07 A;  1IB8 A;  1BI0 A;  8AT1 B;  3CC2 Q;  4M78 B;  2RQW A;  4ME7 A;  2X51 A;  3PTA A;  2LX7 A;  1IRX A;  2KT8 A;  4M77 G;  2FG0 A;  2H3E B;  2OTL Q;  1PC0 A;  1IXD A;  3RUX A;  5LJ5 g;  4A53 A;  2MMP A;  3UWN A;  1Q7Y R;  2CP2 A;  4M7D B;  2QQB A;  2KR3 A;  3PMI A;  3VS6 A;  3TU4 K;  3LWH A;  1HK9 A;  1I5L A;  4XTV A;  3FIF A;  1NZ9 A;  1W2B A;  3OMG A;  2DIG A;  4GY5 A;  2DL8 A;  3CC7 T;  4XTY A;  3CCM Q;  3DLL A;  4PLL A;  3QG1 A;  1I5O B;  5CQY A;  4C92 D;  2DVJ A;  2V8K A;  4BAC A;  2FB7 A;  1FYN A;  2WSF E;  3REA B;  2BE7 D;  1AEY A;  3A1P A;  5I22 A;  1K4U S;  4CI0 C;  1M1K C;  2DPP B;  2X4J A;  4JS4 A;  4JJC A;  1TSF A;  3CCS T;  2KT1 A;  2ED1 A;  2XI9 A;  3EG3 A;  2C06 A;  2YT6 A;  4FYV B;  4RCC A;  2FRW A;  2I2L A;  1SHF A;  2XU8 A;  5EG2 A;  2OTJ Q;  2O31 A;  1MV3 A;  4FT2 A;  2DKG A;  1PKS A;  4L5G A;  3J7A F;  2DXT A;  1QMC A;  3MP8 A;  3QSU A;  2Y4X A;  3EFO B;  2NUT B;  3DB4 A;  3QYG B;  2XDP A;  1KSW A;  3EHR A;  2YUO A;  1NJI R;  2VKN A;  1SSH A;  1OYX A;  4MZP A;  1RLP C;  1NE8 A;  1T3L A;  4N0A A;  3CCV Q;  1G83 A;  1OPK A;  4JPB W;  2VYT A;  3CBO A;  2GTJ A;  3JCM V;  1MND A;  2F1L A;  4RTT A;  3I56 A;  3FC3 A;  1YJW A;  4IUU A;  2QGF B;  5GAM e;  3G4S A;  1YJ9 T;  4X9C A;  3GBQ A;  3CPW P;  1VQP Q;  1G2B A;  4PL6 A;  3CCJ Q;  4F04 B;  4M75 C;  2V8I A;  2KYM A;  1ZSG A;  3ZL7 C;  2RQR A;  4DBQ A;  3CC4 T;  2LCS A;  3EH2 A;  2COY A;  4JRI A;  4AFU C;  3EAE A;  5GAN 2;  4M78 C;  3NGP A;  4F17 A;  2KRN A;  2BZX A;  2DET A;  2HBW A;  2DEU A;  3CCR A;  3M9Q A;  4IKF A;  4FL6 A;  1W1F A;  2DEQ A;  1VQ5 T;  3NMZ C;  4XTX A;  2LDM A;  2DFU A;  3M0U A;  4HVU A;  2RJC A;  2YXY A;  4M7D C;  3BY7 A;  1D1C A;  1Y57 A;  3HTR A;  2QA4 A;  4C92 G;  1ZA2 B;  2BIV A;  2JM9 A;  2L3P A;  1VQL Q;  4OVA A;  3OYK A;  2DAQ A;  4GLM A;  4M75 E;  3JCM X;  3AHU A;  3EFS A;  4ZGD B;  1NJI U;  1MNE A;  4HA8 A;  1TOV A;  3A8G B;  5C6S A;  2MWP A;  1LPL A;  3HKS A;  1ABQ A;  3VKI A;  2EGC A;  4M78 E;  2XD0 A;  1VIF A;  1W6X A;  3CCU Q;  1M1K R;  5IH2 A;  1OX9 A;  4DEX A;  2WSC E;  5GAN 8;  4MDX A;  1N5Z A;  5CKD A;  5DLO A;  1VQ7 Q;  3V8K A;  3WXM B;  1JJ2 A;  3JCM f;  2AT1 B;  4M7D E;  4PJO A;  3VJP A;  3PMT A;  1VYV A;  2E65 A;  3UA7 A;  5LJ3 f;  2KNB B;  3HP9 A;  1T3S A;  1N27 A;  3DLM A;  1SEM A;  2D0N A;  3RMQ A;  3OYJ A;  1VQK Q;  2DLP A;  1C6V X;  4NL3 A;  4J9F A;  1RAH B;  4ZGE B;  3WVD B;  2NUP B;  3DB3 A;  3X25 B;  2OAW A;  1IHV A;  4PJJ A;  1VQ6 Q;  1R0B G;  1B3Q A;  2MPX C;  2K5I A;  5HY6 A;  2LQN A;  2V8J A;  1Q86 C;  2DTO A;  5CVI A;  1GCQ C;  2MF2 A;  3LWI A;  1VQM T;  3E1S A;  2D8J A;  4J7I A;  2QAS A;  2OTJ A;  3QII A;  1VQN Q;  1YCS B;  4C5E A;  2EW3 A;  3FJP A;  4EMK A;  1YJW T;  4BE2 A;  2J6K A;  1RAB B;  1KG1 A;  3P8D A;  1J3T A;  3MEV A;  1H64 1;  2CT4 A;  3H8Z A;  4BI4 A;  4M77 A;  4PJM A;  1ZUK A;  1LVK A;  1OX8 A;  3CMA Q;  1HJD A;  4OF1 A;  1VQ8 A;  1O75 A;  1PRM C;  1UDL A;  3E2U A;  4GBQ A;  2GF7 A;  4LDV A;  4EPC A;  3CCL Q;  4BI8 B;  1TG0 A;  3CCV A;  3OB9 A;  1Q82 C;  2EIF A;  4ZTF A;  2CS7 A;  2KSS A;  1AZG B;  5A0G A;  2IVW A;  1TXQ A;  2HZY A;  2NWM A;  4CC3 A;  3UA6 A;  1M1K U;  4AFZ C;  2X35 A;  5CKH A;  1EZZ B;  3HSB A;  5IXF A;  4M75 D;  5D6Y A;  1YCY A;  3OYY A;  5KYW A;  1VOM A;  1WJS A;  1PCX A;  3OQ5 A;  4JS5 A;  5FRO A;  4DOV A;  1DJ7 B;  1M90 C;  1E6G A;  1CSK A;  1UTI A;  1S72 Q;  5J26 A;  3VUB A;  3QYH B;  1B34 A;  3I55 Q;  1OV3 A;  2LJ0 A;  4M78 D;  1QKW A;  2QXF A;  3OW2 S;  2HSP A;  2PQW A;  2X4Y A;  3M58 A;  4J6W A;  3JCM c;  1ZQ1 A;  1GFD A;  3CC2 T;  3PT9 A;  2HCK A;  3A5Z B;  3CCE Q;  1QWF A;  3SWN B;  4D8D A;  1QVF S;  1AHJ B;  4FSX A;  2E5Q A;  4X34 A;  1BCO A;  2OTL T;  4M7D D;  4IUT A;  1VYU A;  1WXU A;  2HNI A;  2YUP A;  2RK2 A;  1RLQ C;  4XTZ A;  4M7A F;  5IT9 E;  1YIT Q;  4MMK A;  2RJE A;  1X43 A;  2CUD A;  3JV3 A;  3X20 B;  3M55 A;  5LJ5 h;  1XTD A;  4N4I A;  1Y71 A;  1ZBJ A;  4QQG A;  4RG8 A;  5A2Q E;  3CME Q;  3CCM T;  3EG9 B;  3SB2 A;  3P8H A;  2MWO A;  3I9Q A;  5KYU B;  1OOT A;  2PZ1 A;  1D0X A;  2DXC A;  2BE9 B;  2JXB A;  1HXD A;  3C94 A;  5GAO p;  3QDF A;  4E7H A;  2V1Q A;  2GQV A;  1UJY A;  3L2V A;  2D6F A;  1EX4 A;  2LRQ A;  1JU5 C;  4V2S A;  1ZLM A;  1WIE A;  4ELZ C;  4JRP A;  4A4E A;  2QQS A;  3HHT B;  2QYZ A;  1X69 A;  1VQ7 A;  1WPY A;  5HCK A;  1Q86 R;  1K0S A;  3MEU A;  1Y96 A;  2OTJ T;  3LH5 A;  1VQ9 Q;  3ZEH A;  2NLU A;  1NEG A;  2YWW A;  3CBM A;  1JXO A;  4IIM A;  2LVM A;  3GP8 A;  3F70 A;  1M2V A;  2EFI A;  2A37 A;  1ACM B;  1VQ4 A;  3I35 A;  1A0N B;  2DBK A;  3HRU A;  8ATC B;  1MV0 B;  3C4S A;  4LDW A;  4C92 A;  2CZ0 B;  1R77 A;  3V8J A;  3CCV T;  2O2O A;  2RK1 A;  2DRK A;  2V1R A;  5GMK l;  3L2W A;  1Q82 R;  2K5L A;  2IIM A;  2YLB A;  3VYG A;  3QJ6 A;  4HCK A;  2XHC A;  3VS2 A;  3BW1 A;  1VQP T;  1RUW A;  1YI2 Q;  3OA6 A;  3N5B B;  2YRC A;  1KK7 A;  2L2P A;  1M27 C;  4C5G A;  4D8K A;  1QVF A;  4E7J A;  1NYF A;  1M90 R;  2EAY A;  2KRO A;  4BD3 A;  3RNJ A;  4Y28 E;  1TTH B;  2MIO A;  3JB9 F;  2WSE E;  2RB6 A;  2E41 A;  4QT7 A;  3CC7 A;  2RN8 A;  3SWN C;  1VIE A;  2JMA A;  4TVR A;  3EH1 A;  1MMG A;  1QW1 A;  4OB0 B;  5FRM A;  4J6X A;  5IN1 A;  4J9G A;  3SEM A;  1UGQ B;  2AK5 A;  4OB1 B;  1UHC A;  4FW2 A;  1Q86 U;  2SRC A;  2FHD A;  3FRN A;  3JSC A;  4RG2 A;  2DZ9 A;  2E6Z A;  1W2B P;  2F2X A;  2ZPE B;  3CCS A;  2QK0 A;  5CO7 A;  5LJ3 j;  4OB2 B;  5GAO n;  1VQL T;  1OU8 A;  4AMC A;  2GNC A;  3GNG A;  1WHG A;  2M9U A;  2YUN A;  2B8A A;  2DA9 A;  5GAM f;  3GIB A;  3M4Y A;  3L2R A;  1Q82 U;  3PIO A;  2K3B A;  2VWF A;  5LJ3 d;  3CCU T;  4RTU A;  4BI3 A;  5IHK A;  2KMT A;  2LTO A;  1VUB A;  1T0J A;  2E6N A;  1MHN A;  2FZK B;  1E6H A;  4RTY A;  2L3R A;  2BZY A;  3H0I A;  1IRE B;  4ZN1 A;  1VQ7 T;  2QG9 B;  4HXJ A;  1FMW A;  3CXC S;  3BFM A;  1QVG S;  2XK0 A;  2LZ6 B;  3A8M B;  3MP6 A;  3SHW A;  1M90 U;  1NEB A;  3VS0 A;  4OMQ A;  1PKT A;  5GMK i;  2O9S A;  1KIK A;  3NTK A;  2AKK A;  2EQM A;  1YJ9 A;  4JDS A;  2DK3 A;  4PNO A;  3VRZ A;  3WVE B;  2IPO B;  4C5H A;  3GNF B;  2MK5 A;  4JRQ A;  2K9G A;  2JTM A;  3CC4 A;  1VQ6 T;  4C0G A;  1G3W A;  2P4R A;  2RQU A;  1PNJ A;  1GBQ A;  3KBG A;  2R5M A;  1E7O A;  2CH4 A;  4M7A E;  5GAN j;  3O5Z A;  2SEM A;  2JTF A;  1AZE A;  3RDV A;  1TUD A;  2QTX A;  3REB B;  1VQN T;  3MO8 A;  1ZSZ A;  2E3H A;  3VS7 A;  1VQ9 A;  2QQ9 A;  3PNW C;  4DBF A;  5GMK j;  4OMM A;  1VQ5 A;  4A4H A;  5KCO A;  4D6W A;  3CMA T;  1JO8 A;  1I8F A;  2EQK A;  4LUD A;  1KQS P;  2YSQ A;  1YJN Q;  2K5F A;  3GF5 A;  2YRV A;  4FSS A;  5C0M A;  5GAN d;  1FMK A;  4OMO A;  3CCL T;  2K3X A;  1Q81 C;  2GQI A;  1ZHI A;  2L89 A;  4OML A;  2QDL A;  3J81 E;  1QVP A;  1VQO Q;  4HKE A;  3P8B B;  4QW2 A;  2PVG B;  2MI6 A;  4PFP A;  2EKH A;  4KGX B;  4BDZ A;  5GAN 6;  1G3T A;  1I0C A;  3I5R A;  1PWT A;  3JB9 J;  4RKU E;  1PD1 A;  1KD1 C;  3CCQ Q;  1S72 T;  2FPD A;  1OUL A;  1R8O B;  2CP6 A;  4R0K A;  3I55 T;  2NUZ A;  4Y91 A;  2DTI A;  3EG2 A;  2CYZ B;  4ZN3 A;  1LNX A;  1TH7 A;  1SF9 A;  3FB9 A;  3CCE T;  2DYB A;  2LJ3 A;  2PUK B;  3CXC A;  4F14 A;  4PJO F;  5LJ5 e;  1V76 A;  2F2W A;  5CKF A;  1YIT T;  4BE0 A;  3LYI A;  1JJ2 P;  3O8V A;  3JCM h;  2A08 A;  3CME T;  3JCM W;  1VQM A;  3RKY A;  1Q7Y U;  3V7C A;  2VGM A;  5GJV B;  3QDR B;  3HL8 A;  3S3M A;  3LGL A;  2WAC A;  4OB3 B;  4PJO B;  2ZPF B;  2VC8 A;  2JZ2 A;  3OSS C;  3Q1J A;  4DOW A;  4M77 F;  4DA4 A;  2JVV A;  2CGH A;  2A28 A;  1NYG A;  1K73 C;  1UFF A;  2DL5 A;  2OX7 A;  1VQ9 T;  4N0A C;  3M5A A;  1IZ6 A;  1T0H A;  4NL2 A;  1UGP B;  3EG1 A;  2COZ A;  4PFZ A;  4FU6 A;  4NS5 A;  1AD5 A;  1GBR A;  4E7Z A;  2VB6 A;  2M0Y A;  1AT1 B;  4PFO A;  5GAN 3;  2CZ6 B;  4LDY A;  4OMP A;  1BK2 A;  2XDB A;  1H8K A;  4QKU A;  5AYF A;  1WHM A;  2W0Z A;  2EQJ A;  4M77 B;  4PK4 A;  4BE1 A;  1Q81 R;  2HL5 C;  4QQD A;  2E1H A;  2O4X A;  1TUG B;  1SG5 A;  2RHU A;  3C0C A;  3RKW A;  3CC2 A;  3CD6 Q;  2VUB A;  3OSV A;  5I21 A;  1CKB A;  5AT1 B;  1RAI B;  1Z9Q A;  4P5N A;  1YI2 T;  2OTL A;  3FLG A;  3I5S A;  1G8X A;  3OYA A;  3EHQ A;  4RMO A;  3SFM A;  2F69 A;  4ESR A;  3EFO A;  4C8Q A;  1KD1 R;  2LCL A;  5KYW B;  2KI7 A;  2QEX Q;  3SDZ A;  2K4Y A;  2DL3 A;  5GAM j;  3CCM A;  2CRE A;  2CP0 A;  3CEY A;  4ZTJ A;  2QQA A;  4WCI A;  1B34 B;  3BDL A;  2JM8 A;  3C12 A;  4BB7 A;  3OY9 A;  1BB9 A;  4ANJ A;  1M8M A;  1IO6 A;  1Y7X A;  4F7U A;  1KQ1 A;  3JB9 D;  1KJW A;  2LP5 A;  2EPD A;  1TWB A;  5GAM d;  4NOY A;  2P0P A;  1BKB A;  2X3X D;  1W70 A;  4J83 A;  2D9T A;  3U23 A;  3M59 A;  4FYW B;  2D1X A;  4PJO C;  1WFW A;  1Q81 U;  1PSE A;  4LN2 A;  4FCY A;  1M3A A;  3TQ7 P;  4IUP A;  1YN8 A;  4Q5W A;  4JJN K;  2JMC A;  4LXC A;  4N4G A;  5CR2 A;  3M54 A;  3OS2 A;  5M9O A;  4OP0 A;  2PU9 B;  3BE3 A;  2E4H A;  2HSE B;  1WA7 A;  4VUB A;  1HYO A;  2RHX A;  1RI9 A;  3G71 Q;  1FMV A;  1K73 R;  4B9W A;  4C92 F;  2HQH A;  2PUO B;  1GL5 A;  1KD1 U;  5GAN f;  4N4H A;  4RUG A;  2P84 A;  2PNI A;  1VQP A;  1R0C B;  1AWX A;  1Y96 B;  2COW A;  3CCJ A;  1YBY A;  3A98 A;  5GMK m;  1EIF A;  4JLI A;  3X24 B;  2P0K A;  3M4G A;  3G1J A;  5HK0 A;  2DIL A;  4M77 C;  4CC7 A;  1M8V A;  2C0O A;  2Y4Y A;  2M51 A;  5LL6 S;  2RI3 A;  3OBW A;  4PJO E;  1WDX A;  1RAC B;  1M2V B;  4DBH A;  2LQ8 A;  4E47 A;  2ZGW A;  3EGX A;  2JS2 A;  2JOY A;  1I07 A;  3HRS A;  3URG A;  2J6F A;  1F1B B;  4EIK A;  5IXB A;  5IHN A;  5KYY A;  1QCN A;  3V7S A;  3VUZ A;  1M3C A;  5CAI A;  1QCO A;  2OI3 A;  2L3S A;  1M30 A;  2CP5 A;  2VVK A;  1GRI A;  2LNV A;  1YIJ Q;  3JCM g;  1YJN T;  2JTE A;  4JUV A;  3UT1 A;  5LJ3 g;  2HMA A;  4PJL A;  1D1B A;  4RTZ A;  4YTL A;  2KEA A;  1M1F A;  4KBM B;  4DBR A;  1PG5 B;  1VQL A;  4XQ3 A;  1U8R A;  2CZ7 B;  1S1N A;  3M0P A;  1VQO T;  2V26 A;  3JB9 G;  1G3Y A;  3QZ5 B;  2K3Y A;  3G6E Q;  2E5K A;  4M77 E;  5FLX E;  2KXC A;  2DTH A;  2O01 E;  1MUZ A;  1SRM A;  4QVD A;  4OGC A;  2LQW A;  1U06 A;  4M7A B;  1K73 U;  5FWB A;  1MMN A;  3MJX A;  3CCU A;  1ZBX A;  3RBB B;  3CCQ T;  1H3Z A;  1WHJ A;  3MPU B;  2LC4 A;  2CP7 A;  4WF2 A;  1YHQ Q;  3GLX A;  5KYN A;  4IUV A;  2KVQ G;  3L2Q A;  2DL7 A;  2EYX A;  1UGR B;  1G3S A;  2VGN A;  4MZM A;  3THK A;  1AWO A;  3S3O A;  4LDX A;  1LOJ A;  3QZ9 B;  2ZAE A;  1D3B A;  4J8O A;  4R55 A;  2ROL A;  2GTO A;  1VQK A;  1D0Y A;  2J6O A;  2OJ2 A;  1K1Z A;  3OYM A;  2KQW A;  1RAE B;  3QXE B;  3QHS A;  1RAF B;  1UG1 A;  2J05 A;  4O6J A;  2DMO A;  5D7U A;  2DO3 A;  2LMJ A;  4EDU A;  1VQ6 A;  1D09 B;  4X9D A;  4M75 G;  3ASK A;  5GAN g;  3LW5 E;  1VYT A;  4A4K A;  2EJG A;  2MOX A;  4PJO D;  1VQN A;  2QDY B;  4J5Y A;  1FX7 A;  1XOV A;  1K8A C;  2ED0 A;  1NPP A;  1QP3 A;  1H3H A;  3OW2 A;  1Q95 G;  4M78 G;  2CP3 A;  2A0F B;  4KUI A;  4E7S A;  3CCJ T;  1K0X A;  3CMA A;  2RHI A;  3VS4 A;  2LJ1 A;  3X28 B;  4M7D G;  3CCL A;  2K7A A;  2CSQ A;  5I2S A;  4BDY A;  2C0T A;  1WLP B;  1VA7 A;  2EYY A;  3TVT A;  1N9R A;  3G71 A;  2CUB A;  2XID A;  2KYB A;  1V1C A;  1KFZ A;  1TU0 B;  3HFN A;  2RD1 A;  5IAY A;  1AOJ A;  3EGD A;  2GCX A;  1KHI A;  1BYM A;  4A4F A;  4AFS C;  4KH0 B;  2A7Y A;  4ZGJ B;  3NTI A;  5LJ5 f;  2BUD A;  1ZSZ B;  3RES A;  4OMN A;  3VRY A;  5EC7 A;  2FYK A;  4QVC A;  1S72 A;  2HDA A;  5CK9 A;  4XU3 A;  3I55 A;  5IHI A;  2R58 A;  2ZPI B;  4JZ4 A;  3M0R A;  2AIR B;  1N6A A;  4GLK A;  3CD6 T;  3CCE A;  3H6Z A;  5L23 A;  3RMS A;  3OYF A;  2H3J A;  5HK3 A;  3NFC A;  1GCP A;  2RPN A;  3CBP A;  5HKC A;  4M7A C;  1JEG A;  2CH4 W;  2RJF A;  3EFR A;  5ECA A;  4LD9 K;  3OYD A;  2J06 A;  2ZPH B;  1WHH A;  4FW1 A;  4C92 E;  4KUD K;  1YIT A;  4KUL A;  3E9G A;  4B6M A;  1WGS A;  3LX7 A;  3I56 Q;  1M5Q 1;  2QEX T;  2EYQ A;  3G4S Q;  3CME A;  2HBP A;  2YRD A;  5J39 A;  1RL2 A;  1V29 B;  2RQT A;  1VQK T;  1PRL C;  3QWX X;  1NLO C;  2HKQ B;  2JJ9 A;  1NBE B;  3RER A;  4KT0 E;  2FPE A;  3NPF A;  3GOX A;  2CDT A;  2RMO A;  2L0A A;  4HVV A;  1X27 A;  2M1H A;  3D7S B;  3UPU A;  3A8L B;  3CCR Q;  4CRI A;  1WQ7 A;  4IUR A;  4IUQ A;  1P92 A;  2KRM A;  2E70 A;  2AZS A;  2YDL A;  1JXM A;  4ZNX A;  5GAO l;  1IGU A;  1K8A R;  3M0Q A;  2QA4 Q;  4C0F A;  1GXI E;  4J9B A;  4BUG A;  1EFN A;  2ATC B;  3VYH B;  1YP5 A;  2XG8 D;  5L8R E;  5A0L A;  3DKM A;  2MYS A;  3VS5 A;  3G71 T;  3TEE A;  1KHC A;  2K79 A;  1KQS S;  2EJF A;  1WI7 A;  2GFA A;  3OYB A;  1OZ3 A;  3HFO A;  4XU2 A;  3OS1 A;  3JCM P;  4LE9 A;  2F5K A;  4ELY C;  1ZSZ C;  1YI2 A;  2FZG B;  2Y90 A;  3M57 A;  2RO0 A;  1B7T A;  1NM7 A;  2JW4 A;  2PVD B;  2XMF A;  1X6O A;  3HRT A;  2EJ9 A;  3OBY A;  5GAM g;  2HQE A;  1YNZ A;  2PVO B;  5CKE A;  3H0H A;  4C8Q F;  2DER A;  1OEB A;  2QI2 A;  5A0D A;  2O4X B;  3QO3 A;  1X75 C;  2EYW A;  2KRS A;  4HT8 A;  1QVG A;  4HCB A;  6AT1 B;  1YIJ T;  2JN0 A;  2H8H A;  1X2K A;  5KYX A;  2DD4 A;  4QVZ A;  1PSF A;  3JB9 H;  2R57 A;  1YWP A;  1K8A U;  4M75 A;  2RA2 A;  2JUF A;  4K11 A;  4Z8A A;  4F7U F;  2XIC A;  5DM7 R;  4RCB A;  5LJ3 h;  1MMD A;  1AWW A;  3G6E T;  4J9C A;  4C8Q B;  2VXF A;  1VQ8 Q;  2AKL A;  5J3B A;  1WQW A;  2D8H A;  3V8L A;  1JJ2 S;  5FW9 A;  4M7A D;  4XTW A;  4RTX A;  4LD6 A;  5GAO q;  1BIA A;  2HD0 A;  3A8H B;  3OMC A;  4M78 A;  4RTW A;  1BI3 A;  2E12 A;  2EBP A;  3OYI A;  1FWZ A;  1QKX A;  2GFU A;  1SRL A;  5DLQ E;  2E3I A;  1JQQ A;  1YHQ T;  1K9A A;  1ZA1 B;  3CPW S;  3TRE A;  3RIR A;  1OPL A;  4M7D A;  4F7U B;  1ZUU A;  3JRZ A;  3CPF A;  3QJY A;  3OYG A;  4J7F A;  1I81 A;  1M1G A;  2D0Q B;  2E64 A;  2JNG A;  1G5V A;  3RKX A;  2AZV A;  1CKA A;  3H0F A;  1KQS A;  3L2Z A;  1PHT A;  3E19 A;  4EMK B;  3M0S A;  3OYN A;  3AT1 B;  3MP1 A;  2KK4 A;  1OQK A;  2A36 A;  3C95 A;  4J9E A;  4EMH A;  2DXB A;  5CCA A;  1OU9 A;  3HPW A;  3KXT A;  4X1V A;  4J9H A;  4E7K A;  3MET A;  1NG2 A;  5FU7 B;  3S6W A;  2W10 A;  4UC4 A;  1UEC A;  1N8R C;  2GBQ A;  3G7Z A;  5GAN h;  5LJ5 j;  2RQV A;  2L3Q A;  1KC8 C;  5GMK h;  3LLR A;  1BBZ A;  5CKB A;  5CQX A;  2P0Q A;  1OZ2 A;  3JCM J;  4FYY B;  1YJN A;  2EKO A;  1X6B A;  4FIB A;  1M2O A;  3H41 A;  1BCM A;  2NUT A;  3M53 A;  2YHT A;  1UE9 A;  4Z88 A;  3TSW A;  2B86 A;  1Z9Z A;  5LJ5 d;  4FYX B;  1VQO A;  3FDR A;  1RAG B;  3LH0 A;  5FU6 B;  4XU1 A;  2KDS A;  2CKK A;  1C1A A;  4XTU A;  2FEI A;  1K9M C;  1UHF A;  1GCQ A;  4C0Z A;  4CC4 B;  3EGX B;  2QTV A;  4JJD A;  4O5V A;  2FO0 A;  3E9F A;  4B9X A;  1D1A A;  1B07 A;  4PLI A;  4A54 A;  4OMF B;  1K76 A;  5KYY B;  2DE0 X;  1M4Z A;  3CCQ A;  3R6O A;  4M7A G;  3L2U A;  2M16 A;  1FXX A;  2QQR A;  2F2V A;  2M02 A;  2XDD A;  4AT1 B;  1TUC A;  3OYH A;  4C8Q C;  2R5A A;  3MHX A;  1AVZ C;  1ZX6 A;  1I4K 1;  3CPW A;  2DIQ A;  5I2M A;  3QBY A;  3M56 A;  4E7I A;  1HD3 A;  1VQ4 Q;  4ORZ A;  3KUF A;  2QAZ A;  2F5T X;  4J6Y A;  3VS3 A;  3LGF A;  3OS5 A;  5I11 A;  3ULR B;  1JRI A;  3MEA A;  3I56 T;  1LCK A;  4L6V 5;  4DEY A;  5D6W A;  2JT4 A;  1IGQ A;  1UUE A;  3G4S T;  2CT3 A;  3QWY A;  2CZ1 B;  3L1A A;  1W4S A;  3JAM E;  2CSI A;  4IIO A;  1WHK A;  2JS0 A;  1X2Q A;  1RI0 A;  5GAN 4;  4LNP A;  3MCA B;  4F16 A;  2HAX A;  2O88 A;  4EMK C;  3M0T A;  1Y0M A;  4C8Q E;  1D3B B;  1YWO A;  2DX1 A;  3FJ5 A;  3CC7 Q;  2RNA A;  1C0M A;  4E6R A;  1H92 A;  2DJQ A;  5FU7 C;  1BIB A;  3CCR T;  1BI1 A;  2EVR A;  4AG2 C;  3VS1 A;  1WJR A;  3NTH A;  3OW2 P;  4LDU A;  4XU0 A;  2I0N A;  3CQT A;  4C92 B;  1N8R R;  3PE0 A;  4XK8 E;  1YFN A;  2QA4 T;  4F7U E;  1QVF P;  4AG1 C;  3TSZ A;  2AHJ B;  1KC8 R;  3CCS Q;  3MKD A;  3R6N A;  4HCZ A;  1RAD B;  1RAA B;  4XAX B;  1WXB A;  1U5S A;  2ZPG B;  4E7L A;  2X4W A;  1XJW B;  2BZ8 A;  4C0D B;  2NUP A;  4II1 A;  1U3O A;  5FU6 C;  3EG0 A;  5CIU A;  2VV5 A;  2EGE A;  2XKO C;  3RR6 A;  4J9I A;  2M0O A;  3CD6 A;  2YUQ A;  2RI2 A;  2FPF A;  1K9M R;  1WZO A;  3OYC A;  4QQ6 A;  1ARK A;  2RHY A;  3IQL A;  4BY6 B;  1D0Z A;  2L5Q A;  3EGD B;  1XNI A;  2KE9 A;  2DL4 A;  4JZ3 A;  2DBM A;  2QEX A;  1O9S A;  2L8D A;  4WTO B;  2G3R A;  2LT1 A;  1LJO A;  2RM4 A;  2LCC A;  1YJ9 Q;  2G6F X;  5GJW B;  2A3L A;  2K2V A;  3ZBD A;  1M9S A;  2ENM A;  2O9V A;  2ESW A;  3JB9 I;  5GAM h;  3VU3 C;  2YLC A;  4Z89 A;  4KRT A;  2K2M A;  1WNL A;  2RF0 A;  3CC4 Q;  4MZT A;  4DQ2 A;  1TS9 A;  1MGQ A;  2C0I A;  2LT4 A;  2BKD N;  2K6D A;  1UGV A;  4E2F B;  2X9H A;  1M3B A;  3L42 A;  7AT1 B;  4HT9 A;  4FM4 B;  3JCM e;  2DD5 A;  1N8R U;  1IHW A;  1UB4 A;  3H9N A;  3PFS A;  5LJ3 e;  2IG0 A;  3V7R A;  4C8Q D;  1U1S A;  2VAS A;  4A63 B;  3ZFJ A;  1NPR A;  1KC8 U;  1WXT A;  1VQ5 Q;  2DJZ A;  3T9N A;  1U1T A;  3PVL A;  2DM1 A;  1VQ8 T;  1QCF A;  3MEW A;  2RI5 A;  2X4X A;  2FZC B;  2ZZD A;  1XQH A;  1MMA A;  2DYI A;  4JRK A;  2EYZ A;  1HSQ A;  3SWN A;  4CC2 A;  1OI1 A;  2OAU A;  1WYX A;  5KCH A;  1BI2 A;  1UGS B;  2PTK A;  3ME9 A;  3UDC A;  5GAO m;  2FRY A;  1QQJ A;  1AWJ A; 
#chains in the Genus database with same CATH homology
 5IXF A;  1EFN A;  2LNH B;  1GBR A;  4J9D A;  2M0Y A;  1YP5 A;  4OMP A;  1BK2 A;  1H8K A;  3VS5 A;  1E6G A;  2W0Z A;  2K79 A;  1CSK A;  1UTI A;  1WI7 A;  1OV3 A;  2LJ0 A;  2GGR A;  1QKW A;  2HSP A;  3C0C A;  4LE9 A;  1SHG A;  4M4Z A;  1GFD A;  3NHN A;  1CKB A;  1Z9Q A;  2HCK A;  1QWF A;  2EQI A;  4D8D A;  3KFV A;  1NM7 A;  2JW4 A;  2XMF A;  3I5S A;  3EHQ A;  2DF6 A;  1VYU A;  1WXU A;  2YUP A;  5FWC A;  1QWE A;  2DNU A;  1RLQ C;  4ESR A;  2ECZ A;  1YNZ A;  3H0H A;  1X43 A;  2CUD A;  3JV3 A;  2DL3 A;  4LUE A;  2CRE A;  1OEB A;  1ZBJ A;  4WCI A;  1QLY A;  3UAT A;  2EYW A;  2KRS A;  2HEQ A;  2MCN A;  1ZUY A;  3I9Q A;  1OOT A;  2JM8 A;  2H8H A;  2PZ1 A;  1X2K A;  1BU1 A;  1BB9 A;  2JXB A;  2KGT A;  1M8M A;  1IO6 A;  1X6G A;  2V1Q A;  1UJY A;  1YWP A;  2X3W D;  2BTT A;  1KJW A;  2LP5 A;  1I1J A;  2EPD A;  3EGU A;  1JU5 C;  1WX6 A;  1UJ0 A;  3UF4 A;  2ABL A;  4Y92 A;  1ZLM A;  4K11 A;  4Z8A A;  1WIE A;  1ABO A;  2KXD A;  1AWW A;  1GFC A;  4J9C A;  2X3X D;  1W70 A;  2AKL A;  1X69 A;  2D8H A;  3U23 A;  5HCK A;  1K0S A;  5FW9 A;  4RTX A;  2KBT A;  3LH5 A;  2D1X A;  1NLP C;  2EGA A;  4RTW A;  1NEG A;  1WFW A;  2EBP A;  4LN2 A;  4AFQ C;  1M3A A;  1QKX A;  1JXO A;  4IIM A;  1SRL A;  1YN8 A;  1SPK A;  1JQQ A;  2DRM A;  2JMC A;  1K9A A;  3PVQ A;  4HVW A;  1OPL A;  2A37 A;  4RTV A;  4JJB A;  1ZUU A;  3I35 A;  1A0N B;  2ROT A;  2J7I A;  2DBK A;  1MV0 B;  1WA7 A;  1RI9 A;  2O2O A;  2AZV A;  2DRK A;  2V1R A;  1CKA A;  3H0F A;  2IIM A;  1GL5 A;  4RUG A;  1PHT A;  2PNI A;  4HCK A;  1AWX A;  3VS2 A;  3M0S A;  3A98 A;  2RQW A;  1RUW A;  2LX7 A;  2KT8 A;  2A36 A;  2DIL A;  2FG0 A;  4J9E A;  4CC7 A;  2C0O A;  2L2P A;  2M51 A;  1M27 C;  4J9H A;  4X1V A;  4D8K A;  1NG2 A;  1WDX A;  1NYF A;  2KRO A;  2W10 A;  3RNJ A;  1UEC A;  2GBQ A;  2JS2 A;  1I07 A;  2J6F A;  2MIO A;  2KR3 A;  2RQV A;  2L3Q A;  4EIK A;  5IXB A;  3VS6 A;  4QT7 A;  5IHN A;  2RN8 A;  1M3C A;  2DL8 A;  2JMA A;  1BBZ A;  2OI3 A;  2L3S A;  1M30 A;  2VVK A;  4J9G A;  3SEM A;  2AK5 A;  1GRI A;  1X6B A;  1UHC A;  3H41 A;  2DVJ A;  2SRC A;  2JTE A;  1UE9 A;  4Z88 A;  3TSW A;  1FYN A;  2B86 A;  3REA B;  4RTZ A;  1AEY A;  1Z9Z A;  5I22 A;  2KEA A;  1K4U S;  2F2X A;  1S1N A;  3M0P A;  4JJC A;  2FEI A;  2GNC A;  1UHF A;  1GCQ A;  2ED1 A;  2KT1 A;  2E5K A;  4CC4 B;  2YUN A;  2KXC A;  3EG3 A;  2YT6 A;  4JJD A;  2FRW A;  1MUZ A;  1SHF A;  2DA9 A;  1SRM A;  2FO0 A;  1B07 A;  2O31 A;  1K76 A;  1MV3 A;  2DE0 X;  2LQW A;  1U06 A;  1PKS A;  5FWB A;  3RBB B;  2F2V A;  2K3B A;  2VWF A;  1TUC A;  4RTU A;  5IHK A;  1T0J A;  1KSW A;  2DL7 A;  2EYX A;  3EHR A;  1E6H A;  4RTY A;  1AVZ C;  1ZX6 A;  2BZY A;  3H0I A;  3THK A;  2YUO A;  2VKN A;  1AWO A;  1SSH A;  4HXJ A;  1RLP C;  1HD3 A;  2ROL A;  1T3L A;  4ORZ A;  1G83 A;  2GTO A;  1OPK A;  2LZ6 B;  4JPB W;  3VS3 A;  3SHW A;  2J6O A;  2OJ2 A;  2GTJ A;  1NEB A;  1K1Z A;  3VS0 A;  4OMQ A;  1PKT A;  5I11 A;  2O9S A;  4RTT A;  3ULR B;  1KIK A;  2AKK A;  1UG1 A;  2J05 A;  3VRZ A;  2DMO A;  1LCK A;  4DEY A;  2LMJ A;  3GBQ A;  2JT4 A;  1G2B A;  2K9G A;  1UUE A;  2CT3 A;  3QWY A;  1VYT A;  2KYM A;  1ZSG A;  3ZL7 C;  2CSI A;  4IIO A;  2RQR A;  2P4R A;  2RQU A;  2JS0 A;  1PNJ A;  1X2Q A;  2LCS A;  1GBQ A;  2MOX A;  1E7O A;  2CH4 A;  3O5Z A;  4LNP A;  2SEM A;  1AZE A;  1TUD A;  4AFU C;  4F16 A;  1XOV A;  3REB B;  2O88 A;  2ED0 A;  3M0T A;  1H3H A;  3VS7 A;  3NGP A;  1Y0M A;  4F17 A;  4OMM A;  1YWO A;  2DX1 A;  2BZX A;  2KRN A;  3FJ5 A;  1K0X A;  2HBW A;  2RNA A;  1H92 A;  4E6R A;  1W1F A;  2DJQ A;  3VS4 A;  3NMZ C;  2LJ1 A;  1JO8 A;  2EVR A;  3M0U A;  4LUD A;  4HVU A;  4AG2 C;  2YSQ A;  3VS1 A;  2K7A A;  2CSQ A;  4FSS A;  2C0T A;  1WLP B;  1Y57 A;  1FMK A;  4OMO A;  1VA7 A;  2EYY A;  3TVT A;  2GQI A;  2CUB A;  2I0N A;  3CQT A;  4OML A;  1KFZ A;  2KYB A;  1V1C A;  2QDL A;  3PE0 A;  2JM9 A;  2L3P A;  1AOJ A;  4AG1 C;  3TSZ A;  3R6N A;  4GLM A;  4AFS C;  1WXB A;  1U5S A;  2EKH A;  4OMN A;  2BZ8 A;  3VRY A;  5EC7 A;  1I0C A;  3I5R A;  1PWT A;  1U3O A;  2HDA A;  1ABQ A;  3EG0 A;  2EGC A;  5IHI A;  2EGE A;  1W6X A;  2FPD A;  4R0K A;  4JZ4 A;  3M0R A;  4J9I A;  2NUZ A;  2YUQ A;  3EG2 A;  5IH2 A;  4DEX A;  2FPF A;  5L23 A;  1N5Z A;  1ARK A;  1GCP A;  3IQL A;  2RPN A;  1VYV A;  1JEG A;  2CH4 W;  3UA7 A;  5ECA A;  2DYB A;  2KNB B;  2LJ3 A;  1T3S A;  2KE9 A;  1SEM A;  2J06 A;  2D0N A;  4F14 A;  2DL4 A;  2DLP A;  2DBM A;  4JZ3 A;  2F2W A;  4J9F A;  2G6F X;  5GJW B;  2OAW A;  2ENM A;  2O9V A;  2ESW A;  1B3Q A;  4Z89 A;  4KRT A;  2A08 A;  2K2M A;  2RF0 A;  2LQN A;  2RQT A;  1GCQ C;  5GJV B;  1PRL C;  2C0I A;  3QWX X;  1NLO C;  2D8J A;  2K6D A;  1UGV A;  1M3B A;  1YCS B;  2FPE A;  2EW3 A;  3NPF A;  2CDT A;  2J6K A;  2RMO A;  2L0A A;  4HVV A;  1X27 A;  1J3T A;  2CT4 A;  4A63 B;  1ZUK A;  1WXT A;  1HJD A;  3PVL A;  2DM1 A;  1PRM C;  1UDL A;  4GBQ A;  1QCF A;  2KRM A;  2AZS A;  2YDL A;  2A28 A;  1JXM A;  1NYG A;  1TG0 A;  1UFF A;  4ZNX A;  2DL5 A;  2EYZ A;  1HSQ A;  4CC2 A;  3M0Q A;  1AZG B;  1T0H A;  1WYX A;  2PTK A;  2NWM A;  3EG1 A;  4J9B A;  3UA6 A;  4CC3 A;  4AFZ C;  2FRY A;  1AD5 A;  1AWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...