1SPKA

Solution structure of rsgi ruh-010, an sh3 domain from mouse cdna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
72
structure length
72
Chain Sequence
GSSGSSGQKVKTIFPHTAGNNKTLLSFAQGDVLTLLIPEEKDGWLYGEHDTTKARGWFPSSYTKLLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-010, an SH3 Domain from Mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 1300006M19
total genus 7
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1spkA00
1SRMA 4LNPA 2OAWA 3UF4A 3M0UA 1VA7A 3EG1A 1PNJA 3NHNA 2LJ0A 1X2KA 2M51A 2E5KA 1AWXA 2H8HA 3IQLA 1AVZC 4JJDA 2J06A 2GTOA 2CH4A 3PE0A 3ULRB 2OJ2A 1QKWA 4J9FA 1HSQA 2MIOA 1AWWA 3H0IA 4IIMA 2ED0A 4RUGA 2EGEA 4AFQC 4EIKA 1G83A 3SHWA 1B3QA 2KEAA 1SEMA 2YT6A 3CQTA 1OPLA 2L3QA 5IHNA 1VYUA 1NG2A 2J05A 2EYYA 2ROTA 1YNZA 2GQIA 4J9CA 4ORZA 4QT7A 1H92A 1I0CA 2DLPA 2CREA 1OOTA 2RQUA 2KT1A 1K0XA 1FMKA 3NPFA 5L23A 1GCPA 2J6KA 5HCKA 1AD5A 1W70A 2LJ1A 1WA7A 2O9SA 2GBQA 3I9QA 1E7OA 3SEMA 1SPKA 3H0HA 2EKHA 3KFVA 2YUNA 2YUQA 2DX1A 1YCSB 2F2VA 2C0TA 5ECAA 1KIKA 2B86A 2EPDA 2J6OA 1ZLMA 2DF6A 2JS0A 3FJ5A 1X6GA 4CC7A 1WXUA 2JM8A 1QWEA 2DBKA 1ZSGA 1J3TA 1PHTA 1SSHA 5IHKA 4AFZC 2LJ3A 5FW9A 2LQNA 4J9DA 1NM7A 1ABQA 3EG3A 2RMOA 4Y92A 2JXBA 5GJVB 4JPBW 2DVJA 2DL4A 1QWFA 4OMLA 2GNCA 5IXBA 1QCFA 1NEGA 2SRCA 1ABOA 2KR3A 3QWXX 1S1NA 2X3WD 2AK5A 4LUEA 5GJWB 1G2BA 1U5SA 2DA9A 1K76A 5I11A 1X69A 2AKLA 1KJWA 4Z89A 1GFDA 3VRYA 1V1CA 1MV0B 2IIMA 2KXDA 2A36A 2KT8A 1GCQA 2A28A 1M3BA 1Z9ZA 3H0FA 3REBB 2PTKA 3QWYA 2I0NA 3REAB 1W1FA 1M8MA 2VKNA 3U23A 1TUDA 2CDTA 1WXTA 1ZUYA 1JU5C 2QDLA 2EBPA 1K4US 2J7IA 5FWCA 2JT4A 2KE9A 4HVUA 4OMOA 2F2XA 2KRMA 1T3LA 1H3HA 2DL5A 4A63B 5IH2A 1RI9A 2EYWA 1JO8A 2HEQA 1UGVA 3VS2A 2CUBA 4J9EA 1Y0MA 2K79A 1WI7A 2LCSA 1U06A 1GRIA 1AEYA 3VS5A 2CUDA 2EGAA 4RTVA 4AG1C 2PZ1A 2W10A 1E6HA 1N5ZA 2NUZA 1SRLA 1UFFA 2ENMA 2CT4A 2CT3A 3EG0A 1NLPC 2A37A 3H41A 4JZ4A 3ZL7C 2CSIA 2DL8A 4ZNXA 4LE9A 2FG0A 4GBQA 2EQIA 3M0SA 3EGUA 2KNBB 1CKBA 4RTYA 1WLPB 1CSKA 4RTUA 2FPDA 1NYFA 3EG2A 2KROA 4RTWA 3M0QA 1NLOC 1UHCA 1VYVA 1BK2A 4CC3A 4HVWA 1T0JA 1YN8A 1M27C 4OMPA 3R6NA 1WFWA 4AG2C 2J6FA 1PRLC 1YP5A 1QLYA 2BZ8A 1A0NB 1UUEA 1AOJA 1PWTA 4JJCA 1AZGB 2LNHB 1WX6A 2EYZA 2FO0A 2K7AA 1Y57A 1YWPA 2LZ6B 1GL5A 2HBWA 5I22A 4J9HA 2DILA 4CC4B 2AZVA 4GLMA 3LH5A 2RQWA 4HXJA 2DNUA 4F16A 1K0SA 2DE0X 1RLPC 4D8DA 2FRYA 2CSQA 3UA6A 4DEXA 1M30A 2ED1A 4HVVA 3M0PA 1OPKA 4JJBA 5EC7A 2P4RA 2DJQA 4DEYA 4OMNA 2LMJA 1UG1A 1OV3A 1ZX6A 2BTTA 1ZUUA 1AZEA 4KRTA 3THKA 4RTTA 3VS7A 2YUOA 3NMZC 1T3SA 1Z9QA 2BZXA 1LCKA 2RQVA 2L2PA 2W0ZA 1SHGA 1UJYA 2K3BA 3UA7A 2L3PA 1E6GA 5FWBA 4CC2A 4ESRA 1NYGA 1TG0A 2SEMA 4D8KA 1UDLA 1UE9A 2KYMA 3VS4A 1U3OA 2M0YA 3VRZA 1ARKA 1HD3A 3TSZA 1KSWA 3M0TA 1WYXA 2L3SA 1NEBA 2DYBA 3PVQA 3I5SA 1M3AA 2JTEA 1K9AA 1SHFA 2EW3A 1WXBA 2RPNA 2C0IA 2CH4W 2RN8A 2DRMA 1MV3A 2RQTA 4X1VA 3VS0A 5IHIA 1M3CA 1K1ZA 1ZBJA 3TSWA 1RLQC 1EFNA 3JV3A 3VS1A 2K6DA 1GCQC 4RTXA 2RQRA 3TVTA 1JEGA 4IIOA 1GBRA 4HCKA 2LQWA 4LUDA 2OI3A 2KXCA 2RNAA 2C0OA 2KRNA 3RNJA 2VWFA 2A08A 1PKTA 2RF0A 2ROLA 3UATA 1GBQA 1BB9A 2EYXA 1YWOA 3VS6A 2MOXA 2O2OA 3PVLA 4OMQA 2GTJA 3RBBB 4Z88A 2V1QA 1UTIA 2EGCA 4AFSC 2L0AA 2AZSA 1JXOA 2D8HA 1PRMC 3M0RA 1ZUKA 2D0NA 1OEBA 2V1RA 2JW4A 2DBMA 2HCKA 1X43A 1H8KA 2LX7A 3O5ZA 2DMOA 3EHRA 3NGPA 2FPFA 4R0KA 3I35A 5IXFA 1KFZA 1JXMA 2KBTA 2PNIA 2AKKA 1X27A 2FPEA 2DL3A 1W6XA 2O88A 2BZYA 2ESWA 1AWJA 2O9VA 1FYNA 4F17A 2HSPA 2O31A 4J9BA 1BBZA 1BU1A 1TUCA 1UECA 2FRWA 2YSQA 2KRSA 1XOVA 1X2QA 2JMCA 2FEIA 1QKXA 2NWMA 4AFUC 2YDLA 2DL7A 1AWOA 2K9GA 2X3XD 1X6BA 1IO6A 2JMAA 2JS2A 2D1XA 3C0CA 1JQQA 1GFCA 1PKSA 4JZ3A 4LN2A 2KYBA 1WDXA 2G6FX 2YUPA 4RTZA 3EHQA 2DM1A 2MCNA 1CKAA 1WIEA 1B07A 2F2WA 4K11A 4Z8AA 4OMMA 1VYTA 1UHFA 3A98A 4J9GA 1I07A 1MUZA 2GGRA 2VVKA 4J9IA 1T0HA 2JM9A 2ABLA 3I5RA 2LP5A 4E6RA 1RUWA 2ECZA 2DRKA 1HJDA 3VS3A 2K2MA 3GBQA 2EVRA 2XMFA 2D8JA 4WCIA 1I1JA 4FSSA 4M4ZA 1UJ0A 2HDAA 4F14A 2KGTA
chains in the Genus database with same CATH superfamily
2HQHA 2OAWA 2DO3A 3M0UA 3G4SA 1VA7A 4RG2A 4DOVA 4DQ2A 2M51A 2PQWA 4A4HA 4PFZA 3CCLT 3A1PA 3RKXA 1WJSA 5IT9E 1VQ5A 1WHHA 2P0KA 1RAIB 2DZCA 2J06A 2GTOA 2MK5A 1WJRA 2M9UA 4M75E 4OB1B 1KQSP 2RJCA 3HL8A 4PL6A 2MIOA 3CC7Q 3H0IA 1XTDA 1QVGP 2ED0A 4C8QE 1WHMA 2HMAA 2BE9B 4OGEA 4NS5A 3SHWA 3M59A 1YJNQ 2KI7A 3M56A 5FRMA 1SEMA 5CKBA 2RJEA 3X20B 2DJZA 2E64A 3L1AA 3EFRA 1KC8U 2RA2A 5FROA 4C92D 4B9WA 1RAFB 2ROTA 1NPPA 1YNZA 4QT7A 4ORZA 1H92A 2D9TA 1EX4A 4LDWA 1K0XA 3EFOB 3I56Q 1M2VA 5L23A 2J6KA 5HCKA 1N8RR 1WPYA 1BI2A 3CXCA 4PJOB 4HT8A 1ZA1B 2F5TX 5L8RE 1SPKA 3KFVA 2YUNA 4ATOA 2C0TA 1ZLMA 1YHQQ 2DF6A 3JB9D 3FJ5A 1M8VA 1B34A 4PJNA 2CP0A 5GANd 4A4GA 1YJNA 1BIAA 1I4K1 3EGDB 4J9DA 1LNXA 4EMGA 4C0ZA 3LX7A 4JPBW 2DVJA 2DL4A 5GAMj 1QWFA 3L2RA 1ABOA 1U1SA 2HKNA 2X3WD 1G2BA 1Y71A 3JSCA 1U5SA 1K76A 1K73R 3C95A 3CCVQ 5GAOr 3NTKA 4NL2A 1NJIR 3HFNA 1VQLA 5GANg 1NZ9A 5IAYA 2IIMA 1FMVA 2F5KA 3V7SA 2QGFB 1KHIA 3QWYA 4L6V5 2D6FA 3FDRA 1RAHB 3CCVT 4C0FA 2VC8A 4C92E 3CCEA 2MI6A 1FMWA 3RDVA 1NJIC 1BCOA 4OMOA 3QJYA 1K73C 4DBRA 4M7DA 1T3LA 1BIBA 2VV5A 1RI9A 1JRIA 3OYCA 1UGVA 1N27A 2CUBA 4J9EA 2WSFE 2LQKA 4M75C 2K79A 1U06A 1VQ8A 5GAN3 4ZGDB 4ZN3A 2EGAA 1YJ9Q 1JB0E 4RTVA 4AG1C 2PZ1A 1E6HA 3NTHA 5KYUA 9ATCB 1WHJA 2DZ9A 3OS0A 1Y7XA 3E9FA 4O5VA 2DL8A 3G4SQ 3VYGA 8AT1B 4GBQA 3QJ6A 3QZ9B 3EGUA 3H8ZA 4XU1A 3VUZA 4LDUA 4RTUA 5A0DA 2CS7A 3INZA 1NYFA 3EG2A 4LD6A 3M0QA 5LJ3d 3RMQA 1VYVA 2DK3A 5CKDA 2AHJB 4HVWA 3LWHA 1WFWA 3LW5E 2HQXA 1YP5A 2BZ8A 1A0NB 3JRZA 1UUEA 5J3BA 1G8XA 2EQUA 2LNHB 5GAOm 2EYZA 2FO0A 2K7AA 1Y57A 1YWPA 6AT1B 1U1TA 4CRIA 2DILA 3JCMb 2AZVA 2RQWA 3JCMW 4F16A 2DNUA 2NUPA 4FIBA 1K0SA 1M2OA 1G3WA 3EH1A 3UA6A 4C92A 3MO8A 2CZ0B 2EWNA 4M77A 4DEXA 2LVMA 4JRIA 1MNEA 1YJWA 2P4RA 2LMJA 4DBFA 2EAYA 1I5LA 1UG1A 1KQ1A 2BTTA 3QG1A 1OX9A 3OYAA 2BZXA 4EMKB 5GAN2 2L2PA 5GMKl 3MP1A 4M77D 1FWZA 2L3PA 3LGLA 5GAN7 4CC2A 3CCUQ 2ZPEB 1G3YA 1UDLA 4JRKA 3MEWA 4OF1A 1ACMB 1U3OA 2M0YA 1PSFA 1N8RU 1VQNA 1HD3A 1KSWA 3G4ST 3UWNA 4BI4A 2C06A 2Y4YA 3ZFJA 1K9AA 1SHFA 2PVGB 4MZTA 3GOXA 3TEEA 1IRXA 3MHXA 4FW1A 1MMAA 1UGQB 2X51A 3ER0A 8ATCB 1YJWT 2E65A 4KGVB 3OYGA 3JCMQ 2JUFA 1EFNA 2XHCA 2K3XA 3JV3A 1YHQT 1V29B 2K6DA 1GCQC 4A53A 2RQRA 3TVTA 1KD1C 4M75B 1X6OA 1W2BA 3QPHA 1M90C 5CKHA 2HSEB 2OTLT 2C0OA 4M78E 4HA8A 2EQMA 2PVDB 1PKTA 2ROLA 3VV0A 2DTHA 3M4YA 1BB9A 2EYXA 1YWOA 3KUFA 1JJ2A 3VS6A 4ZN1A 5CK9A 2HNIA 4OMQA 2FYKA 5FU6C 1UTIA 1QCOA 2MMPA 2L0AA 2AZSA 3VYHB 1PRMC 4M77G 4XTWA 1BI3A 1ZUKA 2RHUA 4HT9A 2OTLQ 1OEBA 1X43A 1H8KA 3I35A 1KFZA 4B6MA 1OZ2A 3CCSA 2K5FA 2E10A 2PNIA 1Q82C 2AKKA 3ASKA 1W6XA 2DTOA 2QYZA 3OYMA 1ZQ1A 2HSPA 3EGXB 1OULA 5HY6A 3CCJA 1BU1A 3CBOA 3LH0A 4FL6A 2DKGA 1X2QA 3QXEB 2YDLA 5C6SA 4M7DG 3PMIA 4EDUA 3CCEQ 2K9GA 5HK0A 5GANe 2D1XA 1VQOA 1GFCA 1PKSA 4JZ3A 4LN2A 2YUPA 1VQ4Q 3EHQA 2V8IA 1VQLQ 1K8AC 1WIEA 5CO7A 1RABB 1ZHIA 5LJ3e 1Q81C 2HAXA 1I07A 2EQKA 2RB6A 3NTIA 1WGSA 2BKDN 1WHGA 4E6RA 1VQ4T 1RUWA 2ECZA 2DEQA 1HJDA 3VS3A 1IXDA 2GCXA 4M4ZA 4ME7A 1UJ0A 2QEXQ 3JCMg 5FU7C 1SRMA 4LNPA 3JB9G 3ZEHA 3EG1A 2LJ0A 2R57A 3CC7T 2ZAEA 4M75D 1AWXA 2H8HA 3OS5A 3IQLA 1Q81R 1VIFA 1AVZC 2QXFA 3I55T 1C1AA 1YITQ 1RI0A 4PJOG 2CH4A 3ULRB 1IGUA 2V8KA 2OJ2A 4J9FA 4PFOA 1K8AR 4M77C 1D0YA 3CCST 1MMDA 4J7FA 3A8LB 4LXCA 2PVOB 1OZ3A 1KHCA 5FLXE 1WNLA 4RUGA 1TH7A 1QVPA 2DIGA 4E7ZA 1PD1A 3OYYA 2KEAA 4BY6B 1IHVA 4KULA 3CMAA 2YT6A 3BW1A 1OPLA 1S72Q 2J05A 2EYYA 2CP7A 2ZPGB 5GAMe 3OSSC 4J9CA 3RR6A 4M77F 1I0CA 1FXXA 2CREA 1OOTA 2RQUA 3PT9A 4AT1B 2OTLA 2LJ1A 1WA7A 2O9SA 2CZ1B 2KQWA 3I9QA 1E7OA 3V8JA 3SEMA 1VQ5Q 5GAN4 2FHDA 3H0HA 3V7CA 3J80E 5KYYA 2JJ9A 3QYGB 1TS9A 2F2VA 1KIKA 3HFOA 2J6OA 1M90R 5GAOp 2JS0A 1KD1R 4M7AE 2CP6A 3VJPA 3CCMQ 2HBPA 2LCCA 3EG9A 4AFZC 2V8JA 5FW9A 2LQNA 1VUBA 2YWWA 3MEAA 4WF2A 3QZ5B 4OMLA 3CC4A 3KBGA 2KR3A 3QWXX 3NFCA 2MWOA 5CAIA 5GJWB 4HCBA 4JLGA 3CD6A 2PUOB 4XU2A 5CVIA 1IGQA 1UB4A 2AKLA 1KJWA 1GFDA 1VQ8Q 1V1CA 4JDSA 2XG8D 4J5YA 1Q86C 4J6YA 2KXDA 3OYIA 2A36A 2ZZDA 3REBB 2PTKA 2I0NA 3REAB 1W1FA 1MGQA 3RKYA 3A8GB 3CCLQ 2CDTA 1WXTA 1JU5C 1B34B 2EBPA 5FWCA 2KE9A 3FRNA 4HVUA 3CMET 3PNWC 4MDWA 3CCQT 3E1SA 2KRMA 1LOJA 1VQ9A 2YRVA 5LJ5f 2DL5A 4IUUA 5IH2A 2DFUA 5KYXB 1YJ9T 2HEQA 3CEYA 3EFOA 4M77E 4C0GA 3H9NA 2FZGB 1VIEA 4M78G 4FM4B 2DERA 2HL3A 3JCMc 3G6ET 1GRIA 3H6ZA 3CCQQ 4LDVA 2F69A 4XTYA 4QQGA 2ENMA 1WZOA 2A7YA 5LL6S 3CCMT 2CT4A 3OS1A 1NLPC 3H41A 2RI2A 2DVEA 4JZ4A 5KH6A 2LTOA 2CSIA 4M7DC 2O4XB 4FSXA 4ZNXA 4MZPA 2QA4T 4GY5A 5GAMd 2QQSA 4RTYA 1SKUB 2FPDA 3BDUA 2E70A 1UHCA 1BK2A 1KQSS 3J81E 2KVQG 3UPUA 3CPWA 1YN8A 5KYWB 3SFMA 2RJFA 3X24B 1D1AA 5FRNA 1C6VX 1VQ9T 3MP6A 3Q1JA 1AZGB 3HPWA 3QDFA 3PMTA 2HBWA 5I22A 2IPOB 5GMKj 1S72A 5AYFA 4F7UA 2DE0X 3FIFA 2CZ7B 4MMLA 2X35A 2LRQA 5KCHA 2Y4XA 1OPKA 4JJBA 2VASA 2WSCE 2DJQA 3VU3C 1D3BA 3I56T 1ZUUA 1ZSZA 4F7UG 3GNGA 4C92G 3CD6T 2CZ6B 1VQMQ 1TSFA 1LCKA 1ZSZB 4C92C 1SHGA 4JLIA 1UJYA 1UGPB 1VQLT 5GAN8 3BDLA 5FWBA 4C92F 3MP8A 1NYGA 1YCYA 1TG0A 1OU9A 2K5LA 4D8KA 5GAN6 1D1BA 2DXTA 4X9DA 1NEBA 1VQMT 2YHTA 3PVQA 3GP8A 3S3OA 2QTVA 1R77A 5KCOA 1OX8A 2CH4W 4TVRA 2RN8A 3V7RA 1K9MC 4C8QF 2QQBA 1MV3A 4HCCA 2RQTA 3C12A 3CC2A 3OYFA 4X1VA 2XU8A 1ZBJA 2MWPA 2VUBA 1R0CB 4XAXB 1MMNA 2K4YA 3VS1A 4OP0A 4RTXA 3L2WA 1QP2A 1D1CA 1UGRB 2NUTA 4N0AC 1TWBA 3P8HA 2COZA 4C8QG 3L2QA 4PJOD 3CMAQ 2A08A 4WTOB 3SWNA 1GBQA 4F7UF 2LDMA 4ZGJB 1TXQA 1I8FA 1PD0A 1U8RA 4FYWB 2RHZA 2O2OA 4ANJA 4BE2A 3PGGA 5M9OA 4Z88A 1YIJA 1H641 2EGCA 1JXOA 2VB6A 3SWNC 4JS4A 4M78C 3E19A 3QDRB 3OS2A 1VQMA 3LLRA 2JW4A 4QKUA 3WVEB 3S3NA 1OU8A 2DMOA 3EHRA 5CKEA 4XU0A 1JXMA 4RKUE 2DL3A 2O88A 2ESWA 4M78F 3BFMA 5GMKi 1N6AA 2O9VA 2QQRA 5CQXA 5DY9A 1VQ5T 3EAEA 3OA6A 2XIDA 4M7AF 4LDYA 5KE2A 2KRSA 4DA4A 2EFIA 1W4SA 1QVFP 2BE7D 3A8OB 1AWOA 2X3XD 2M0OA 3GIBA 3X28B 2RK2A 3LWIA 5HKCA 2G6FX 4OB3B 4RTZA 3M57A 2COWA 1QW1A 4PK4A 1QMCA 2DM1A 1CKAA 2CP5A 1B07A 1O75A 1Q86R 4K11A 3OSVA 4Z8AA 4JRQA 1VQOT 2YRCA 4OMMA 1Q86U 1VYTA 3A98A 1MUZA 1I81A 2GGRA 2VVKA 1T0HA 1B7TA 2ABLA 5KE3A 7AT1B 4IUPA 3VKIA 2RD1A 2QA4Q 4BDYA 2JTFA 1PSEA 4WCIA 3GLXA 1I1JA 4FSSA 3EG9B 2E6NA 2RI5A 4F14A 3M54A 3PIPA 3OQ5A 2OTJQ 2QA4A 4FU6A 1X2KA 4Y28E 3CCSQ 2E5KA 4LDXA 4XU3A 5CR2A 1G3TA 4JUVA 4JJDA 1WHKA 3PE0A 2CKKA 1QKWA 2DXUA 2RM4A 2GFUA 4A4KA 2E6ZA 2VGNA 3J7AF 1JJ2P 1MHNA 3AT1B 5EG2A 2IG0A 2EGEA 4AFQC 4JJNK 1BYMA 4EPCA 3G6EQ 3PFSA 1R8OB 1B3QA 5LJ3h 3CQTA 2L3QA 5IHNA 1N9RA 1NG2A 1VYUA 5J26A 3PIOA 3F70A 2HD0A 1H3ZA 3MEUA 2BUDA 3CMEA 3HRSA 2DLPA 3RIRA 3SDZA 3OYDA 3CD6Q 4BY6C 2KT1A 2L89A 2G3RA 1GCPA 4L5GA 1AD5A 1VQNQ 1W70A 1YJWQ 5GAOq 2GBQA 4F7UB 4FW2A 2P84A 3JCMh 4PJMA 2DX1A 1YCSB 2EPDA 2YXYA 4YTLA 3CCET 5LJ5e 1IREB 2QGGA 2JM8A 2DBKA 2LCLA 5AT1B 4GLKA 1MNDA 1J3TA 1PHTA 2EYQA 5IHKA 1VQNT 4BE1A 3X26B 2OX7A 2LJ3A 1SF9A 5LJ5h 3KXTA 1NM7A 1BCMA 1ABQA 3EG3A 2JXBA 4M78B 2EJ9A 4NL3A 1VQ7A 1ZBXA 1QCNA 4M7AC 4A4FA 5IXBA 1S1NA 4LUEA 4C0DC 2E5QA 2LQ8A 4RCBA 3JCMf 1AT1B 2DA9A 3WVDB 2QEXA 1X69A 2Z0WA 2O4XA 3TQ7P 4FT2A 4OB2B 1MV0B 3DB4A 4KGZB 4JRPA 2R58A 2DYIA 2KT8A 1YI2T 4C0DB 1M3BA 1Z9ZA 2VYTA 3CXCS 4QW2A 1W2BP 5I2MA 5HK3A 1KD1U 1M8MA 1KK7A 2VKNA 1Q7YC 1RAGB 3JCMd 2FZKB 4N4HA 1ZUYA 4X34A 1D0XA 2P4TA 1K4US 4FYVB 2CP3A 3EFSA 2QTXA 1N9SA 3HP9A 1OQKA 1YFNA 3RUXA 4A63B 2HZYA 2EYWA 2EJGA 1JJ2S 3PTAA 2KAFA 1YI2A 2DXCA 4IURA 3CC2T 2LCSA 4J83A 4C8QA 1AEYA 3VS5A 1N5ZA 3R6OA 3C94A 4OGCA 1Q82U 2LT4A 4ELYC 2CT3A 3EG0A 2A37A 5GAN5 4A4EA 4IUTA 1X01A 5I21A 2OTJA 4QVZA 2QEXT 4Z02A 2FG0A 2E41A 2JVVA 3OYNA 1CKBA 2DAQA 2ZGWA 1WLPB 3X25B 3RESA 1SSFA 1EZZB 3G1JA 5KYWA 5KYXA 1VQOQ 2DETA 2K3YA 1RACB 2E1HA 3OY9A 4AG2C 2JOYA 1VQ4A 1PRLC 1QLYA 4OVAA 2XDDA 3OBYA 4PJOC 2BIVA 1PWTA 4JJCA 4KUIA 5FU6B 1M5Q1 4J9HA 1Q81U 3LH5A 5KYYB 4HXJA 4QQDA 4M7AA 1RLPC 4PJOE 4A54A 1GXIE 2FRYA 2RHIA 1S72T 3RERA 3OYLA 2LX9A 5CKFA 1WJQA 1M30A 2YRDA 3M0PA 2YLCA 1XQHA 5LJ3g 3ME9A 4DEYA 4J6XA 2MPXC 1OV3A 1ZX6A 3G71A 3CPFA 4KRTA 3DB3A 3M53A 3M55A 2QI2A 3THKA 5GANh 1LPLA 3NMZC 2E3HA 3GNFB 2ZCFB 2RQVA 3G71Q 4N0AA 1M1KC 3UA7A 3MJXA 2O01E 3S3MA 4ESRA 2JZ2A 3BE3A 2SEMA 1UE9A 4XK8E 3VS4A 1M4ZA 1V76A 3OYBA 3SB2A 1LVKA 3VRZA 1ARKA 3TSZA 4C92B 4O6JA 4VUBA 1IB8A 3META 2NYSA 5GAMf 3HKSA 2RPNA 2C0IA 2DRMA 4M7AG 1RAEB 5IHIA 1M3CA 3TSWA 2QDYB 1RLQC 3QIIA 4F04B 2COYA 5A0GA 1OYXA 2EQJA 3MKDA 2X4JA 1JEGA 2FVUA 4C8QC 5D6YA 1PC0A 2OI3A 3JCMP 1QVFS 4PJJA 1M1FA 2KXCA 3QO3A 2YLBA 2KRNA 3RNJA 1NJIU 4RCCA 2RF0A 3UATA 1K9MR 1K73U 4P5NA 4PJOF 2MOXA 3CPWS 3A5ZB 3PVLA 5GAOn 3CMEQ 1IHWA 3RBBB 3N5BB 4M7DD 3S6WA 3O8VA 4XTUA 2H3EB 1Q95G 3HRTA 3M0RA 2JTMA 1RAAB 4KBMB 2V1RA 3CCRA 2DBMA 2HCKA 3O5ZA 2LX7A 3NGPA 3QUIA 1M1KR 5IXFA 5GMKe 1IZ6A 4ZTJA 2DD5A 3BY7A 4C8QD 3AHUA 2X4WA 4MDXA 3EGXA 2BZYA 3JAME 3P8BB 1QVGS 1AWJA 1FYNA 4F17A 2O31A 4J9BA 4M7DB 3LGFA 3JB9I 4R56A 1KQ2A 1UECA 2YSQA 3UDCA 1BKBA 1XOVA 2B8AA 2JMCA 4OB0B 2V26A 1YBYA 4AFUC 3DLLA 2DL7A 2MYSA 2DD4A 1JQQA 5C0MA 2HQEA 4BE0A 2MAMA 2I2LA 5LJ5j 4XTXA 1I5OB 2MCNA 2KSSA 1XNIA 4MMKA 2LNVA 3OBWA 2RH2A 2RI3A 1UHFA 3RKWA 4J9IA 2JM9A 3M58A 4M7DF 2AT1B 4M7AB 3GF5A 2CYZB 4M75A 3M5AA 2LP5A 4DBQA 4PKCC 5GANf 2QQ9A 1Q7YU 4M7AD 5CQYA 1BI0A 5A2QE 2D8JA 4M78D 2HDAA 4C8QB 4F7UE 2KGTA 3CCRQ 4IUQA 3UF4A 3DKMA 1F1BB 1PNJA 3NHNA 2KDSA 3JCMX 3I55A 5GAOl 3JB9J 4IKFA 3CPWP 2XDBA 2GQVA 5GAMh 1HSQA 5GAMg 1M2VB 1M90U 1AWWA 1N8RC 4HKEA 4IIMA 4J7IA 1VQ8T 2X9HA 4EIKA 1G83A 1EIFA 2PUKB 1BI1A 5CIUA 2M02A 5GANj 2MF2A 3I56A 5KYNA 2GQIA 3QBYA 1VQ7Q 1O9SA 4UC4A 4LD9K 4KH1B 1FMKA 3NPFA 5GMKm 3CCVA 2DIQA 2EKHA 2JN0A 4II1A 2YUQA 2M16A 3CBMA 5ECAA 1NPRA 2B86A 4E47A 2OAUA 1ZSZC 1X6GA 1RL2A 4CC7A 5I2SA 3CCUT 1WXUA 1QWEA 4OMFB 3UT1A 1ZSGA 2H3JA 3TCJA 4J8OA 1SSHA 4C5HA 4ELZC 3MCAB 3RMSA 4FT4A 3OB9A 1WHLA 3DLMA 1JBMA 4BI8B 4V2SA 4E7LA 2RMOA 3CCJT 1VQ6Q 4Y92A 3L2VA 5GJVB 1KC8R 1PM3A 2GNCA 1QCFA 4E7JA 3OYJA 1NEGA 2SRCA 4XTVA 3E9GA 2AK5A 3FB9A 1VQKT 1YITA 5I11A 1K8AU 1VQKA 1K9MU 4XTZA 4EMKC 4Z89A 5A0LA 5GMKh 3VRYA 4RMOA 3TU4K 3G6EA 3CCJQ 1VQ6T 3QSUA 1GCQA 2X4YA 1Q7YR 2A28A 3H0FA 2FB7A 2HKQB 1YJ9A 5DM7R 1PG5B 2ZPBB 1VQKQ 3G71T 3U23A 2QG9B 4PLIA 1TUDA 2EJFA 1MMGA 3QHSA 2K57A 4NOYA 2E12A 3QYHB 4FYXB 2VXFA 2QDLA 4RG8A 3CBPA 4C5GA 2J7IA 2F1LA 1QVFA 2JT4A 3L2ZA 1X75C 1UGSB 4IUVA 2DTIA 2F2XA 2ZPFB 1G5VA 3D7SB 1H3HA 3CC2Q 2WACA 2Y90A 3CCQA 1XJWB 4EMKA 2K5IA 1M1GA 4R55A 3G7ZA 1JO8A 3VS2A 2RK1A 1Y0MA 5D6WA 2RO0A 1WI7A 1PCXA 3FC3A 4QQ6A 1NBEB 1TU0B 3LYIA 4E7KA 2CUDA 5LJ3j 4DBHA 1VOMA 2W10A 4M77B 2NUZA 2CP2A 1SRLA 1DJ7B 1UFFA 2EKOA 2WSEE 4ZGEB 3L2UA 2M1HA 1NE8A 2NUPB 3JB9F 3CC4T 4M78A 3ZL7C 5KYUB 3HHTB 3CCLA 1YIJQ 3OW2S 4LE9A 4E7IA 2EQIA 3M0SA 4BACA 2CGHA 2L3RA 2L8DA 2KNBB 2OTJT 1CSKA 1ZA2B 2KROA 4N4GA 4AMCA 4RTWA 1TUGB 3OW2A 1NLOC 1WQWA 4CC3A 1T0JA 2XICA 1M27C 4OMPA 3R6NA 4DOWA 3OYHA 1Y96B 1VQPA 1Y07A 2J6FA 1YIJT 4KH0B 1AOJA 2DXBA 1D0ZA 4MZMA 1WX6A 4X9CA 2LZ6B 1GL5A 5LJ5d 3V8LA 1W2BS 1AHJB 4CC4B 4GLMA 5LJ3f 3JB9H 3OYEA 2AIRB 3P8DA 5DLOA 4D8DA 2CSQA 4PNOA 3EH2A 3OMCA 2ED1A 4HVVA 4L59A 3CMAT 4BI3A 1HK9A 4D6WA 3A8HB 4B9XA 1VQ6A 3FEOA 2R5MA 5EC7A 5FU7B 4OMNA 2L5QA 1WQ7A 3ZBDA 1AZEA 3V8KA 4RTTA 3VS7A 2YUOA 5D6XA 2QK0A 4BD3A 1T3SA 3HSBA 1QVGA 1Z9QA 2A3LA 1YITT 1Q82R 3A8MB 2GFAA 2FL7A 4Y91A 4QVDA 2W0ZA 2K3BA 2XKOC 1KQSA 3E2UA 2ZPIB 1LJOA 1E6GA 3CC7A 2KYMA 2VGMA 3FJPA 3M0TA 5J39A 2NUTB 1WYXA 2L3SA 2DYBA 2NLUA 1VQ7T 2JNGA 3CCUA 3I5SA 2EIFA 1M3AA 2JTEA 2EW3A 1WXBA 3HRUA 2D0QB 4FYYB 1TTHB 1KC8C 4N4IA 4PJOA 2QAZA 1VQ9Q 4J6WA 3CCRT 3VS0A 1K1ZA 2VXEA 4PJLA 4HCZA 4JS5A 2FZCB 1Y96A 3CXCP 2KMTA 1KG1A 3OYKA 2E3IA 2R5AA 4PLLA 1QP3A 1M9SA 1YI2Q 4IIOA 1GBRA 3HTRA 1C0MA 4HCKA 3WXMB 2LQWA 2XI9A 2DEUA 4LUDA 2LC4A 2RNAA 2P0PA 4E2FB 4BB7A 3SWNB 2VWFA 3EGDA 4CI0C 3I55Q 4BDZA 3MPUB 4QVCA 2GTJA 3L42A 2X4XA 2V1QA 1FX7A 4AFSC 4E7HA 2D8HA 1QQJA 2RHXA 2D0NA 4M75F 4PFPA 1G3SA 2QQAA 3T9NA 3URGA 4EMHA 4ZTFA 4R0KA 2A0FB 2FPFA 2XD0A 2XDPA 4E7SA 5D7UA 2KBTA 5DLQE 2P0QA 1X27A 2FPEA 3QKJA 2E4HA 2IVWA 4FCYA 1BBZA 3CCMA 1SG5A 1TUCA 2FRWA 1HXDA 2GF7A 2FEIA 1YJNT 1QKXA 2NWMA 3TREA 4C5EA 2DPPB 2K2VA 2ATCB 5LJ5g 1X6BA 1D09B 1IO6A 2JMAA 2JS2A 3C0CA 3OW2P 2KYBA 1WDXA 4XQ3A 5IN1A 1RADB 2HL5C 1VQPQ 4Q5WA 2KK4A 3JCMV 2XK0A 4BUGA 2ZPHB 4M75G 3VUBA 3JCMe 1D3BB 3OMGA 4KT0E 2F2WA 1M1KU 3JCMJ 2RHYA 4KUDK 4J9GA 5CCAA 3MEVA 3M4GA 2RJDA 3CC4Q 3I5RA 1OI1A 1VQPT 1TOVA 3FLGA 2DRKA 1YHQA 2LT1A 2QASA 1HYOA 2K2MA 2KY9A 2PU9B 3GBQA 2EVRA 1UEBA 2XMFA 4M7DE 3M9QA 3GPLA 4C5IA 3SD4A 4KGXB 1R0BG 1P92A 3C4SA
chains in the Genus database with same CATH topology
1SRMA 4LNPA 2OAWA 3UF4A 3M0UA 1VA7A 3EG1A 1PNJA 3NHNA 2LJ0A 1X2KA 2M51A 2E5KA 1AWXA 2H8HA 3IQLA 1AVZC 4JJDA 2J06A 2GTOA 2CH4A 3PE0A 3ULRB 2OJ2A 1QKWA 4J9FA 1HSQA 2MIOA 1AWWA 3H0IA 4IIMA 2ED0A 4RUGA 2EGEA 4AFQC 4EIKA 1G83A 3SHWA 1B3QA 2KEAA 1SEMA 2YT6A 3CQTA 1OPLA 2L3QA 5IHNA 1VYUA 1NG2A 2J05A 2EYYA 2ROTA 1YNZA 2GQIA 4J9CA 4ORZA 4QT7A 1H92A 1I0CA 2DLPA 2CREA 1OOTA 2RQUA 2KT1A 1K0XA 1FMKA 3NPFA 5L23A 1GCPA 2J6KA 5HCKA 1AD5A 1W70A 2LJ1A 1WA7A 2O9SA 2GBQA 3I9QA 1E7OA 3SEMA 1SPKA 3H0HA 2EKHA 3KFVA 2YUNA 2YUQA 2DX1A 1YCSB 2F2VA 2C0TA 5ECAA 1KIKA 2B86A 2EPDA 2J6OA 1ZLMA 2DF6A 2JS0A 3FJ5A 1X6GA 4CC7A 1WXUA 2JM8A 1QWEA 2DBKA 1ZSGA 1J3TA 1PHTA 1SSHA 5IHKA 4AFZC 2LJ3A 5FW9A 2LQNA 4J9DA 1NM7A 1ABQA 3EG3A 2RMOA 4Y92A 2JXBA 5GJVB 4JPBW 2DVJA 2DL4A 1QWFA 4OMLA 2GNCA 5IXBA 1QCFA 1NEGA 2SRCA 1ABOA 2KR3A 3QWXX 1S1NA 2X3WD 2AK5A 4LUEA 5GJWB 1G2BA 1U5SA 2DA9A 1K76A 5I11A 1X69A 2AKLA 1KJWA 4Z89A 1GFDA 3VRYA 1V1CA 1MV0B 2IIMA 2KXDA 2A36A 2KT8A 1GCQA 2A28A 1M3BA 1Z9ZA 3H0FA 3REBB 2PTKA 3QWYA 2I0NA 3REAB 1W1FA 1M8MA 2VKNA 3U23A 1TUDA 2CDTA 1WXTA 1ZUYA 1JU5C 2QDLA 2EBPA 1K4US 2J7IA 5FWCA 2JT4A 2KE9A 4HVUA 4OMOA 2F2XA 2KRMA 1T3LA 1H3HA 2DL5A 4A63B 5IH2A 1RI9A 2EYWA 1JO8A 2HEQA 1UGVA 3VS2A 2CUBA 4J9EA 1Y0MA 2K79A 1WI7A 2LCSA 1U06A 1GRIA 1AEYA 3VS5A 2CUDA 2EGAA 4RTVA 4AG1C 2PZ1A 2W10A 1E6HA 1N5ZA 2NUZA 1SRLA 1UFFA 2ENMA 2CT4A 2CT3A 3EG0A 1NLPC 2A37A 3H41A 4JZ4A 3ZL7C 2CSIA 2DL8A 4ZNXA 4LE9A 2FG0A 4GBQA 2EQIA 3M0SA 3EGUA 2KNBB 1CKBA 4RTYA 1WLPB 1CSKA 4RTUA 2FPDA 1NYFA 3EG2A 2KROA 4RTWA 3M0QA 1NLOC 1UHCA 1VYVA 1BK2A 4CC3A 4HVWA 1T0JA 1YN8A 1M27C 4OMPA 3R6NA 1WFWA 4AG2C 2J6FA 1PRLC 1YP5A 1QLYA 2BZ8A 1A0NB 1UUEA 1AOJA 1PWTA 4JJCA 1AZGB 2LNHB 1WX6A 2EYZA 2FO0A 2K7AA 1Y57A 1YWPA 2LZ6B 1GL5A 2HBWA 5I22A 4J9HA 2DILA 4CC4B 2AZVA 4GLMA 3LH5A 2RQWA 4HXJA 2DNUA 4F16A 1K0SA 2DE0X 1RLPC 4D8DA 2FRYA 2CSQA 3UA6A 4DEXA 1M30A 2ED1A 4HVVA 3M0PA 1OPKA 4JJBA 5EC7A 2P4RA 2DJQA 4DEYA 4OMNA 2LMJA 1UG1A 1OV3A 1ZX6A 2BTTA 1ZUUA 1AZEA 4KRTA 3THKA 4RTTA 3VS7A 2YUOA 3NMZC 1T3SA 1Z9QA 2BZXA 1LCKA 2RQVA 2L2PA 2W0ZA 1SHGA 1UJYA 2K3BA 3UA7A 2L3PA 1E6GA 5FWBA 4CC2A 4ESRA 1NYGA 1TG0A 2SEMA 4D8KA 1UDLA 1UE9A 2KYMA 3VS4A 1U3OA 2M0YA 3VRZA 1ARKA 1HD3A 3TSZA 1KSWA 3M0TA 1WYXA 2L3SA 1NEBA 2DYBA 3PVQA 3I5SA 1M3AA 2JTEA 1K9AA 1SHFA 2EW3A 1WXBA 2RPNA 2C0IA 2CH4W 2RN8A 2DRMA 1MV3A 2RQTA 4X1VA 3VS0A 5IHIA 1M3CA 1K1ZA 1ZBJA 3TSWA 1RLQC 1EFNA 3JV3A 3VS1A 2K6DA 1GCQC 4RTXA 2RQRA 3TVTA 1JEGA 4IIOA 1GBRA 4HCKA 2LQWA 4LUDA 2OI3A 2KXCA 2RNAA 2C0OA 2KRNA 3RNJA 2VWFA 2A08A 1PKTA 2RF0A 2ROLA 3UATA 1GBQA 1BB9A 2EYXA 1YWOA 3VS6A 2MOXA 2O2OA 3PVLA 4OMQA 2GTJA 3RBBB 4Z88A 2V1QA 1UTIA 2EGCA 4AFSC 2L0AA 2AZSA 1JXOA 2D8HA 1PRMC 3M0RA 1ZUKA 2D0NA 1OEBA 2V1RA 2JW4A 2DBMA 2HCKA 1X43A 1H8KA 2LX7A 3O5ZA 2DMOA 3EHRA 3NGPA 2FPFA 4R0KA 3I35A 5IXFA 1KFZA 1JXMA 2KBTA 2PNIA 2AKKA 1X27A 2FPEA 2DL3A 1W6XA 2O88A 2BZYA 2ESWA 1AWJA 2O9VA 1FYNA 4F17A 2HSPA 2O31A 4J9BA 1BBZA 1BU1A 1TUCA 1UECA 2FRWA 2YSQA 2KRSA 1XOVA 1X2QA 2JMCA 2FEIA 1QKXA 2NWMA 4AFUC 2YDLA 2DL7A 1AWOA 2K9GA 2X3XD 1X6BA 1IO6A 2JMAA 2JS2A 2D1XA 3C0CA 1JQQA 1GFCA 1PKSA 4JZ3A 4LN2A 2KYBA 1WDXA 2G6FX 2YUPA 4RTZA 3EHQA 2DM1A 2MCNA 1CKAA 1WIEA 1B07A 2F2WA 4K11A 4Z8AA 4OMMA 1VYTA 1UHFA 3A98A 4J9GA 1I07A 1MUZA 2GGRA 2VVKA 4J9IA 1T0HA 2JM9A 2ABLA 3I5RA 2LP5A 4E6RA 1RUWA 2ECZA 2DRKA 1HJDA 3VS3A 2K2MA 3GBQA 2EVRA 2XMFA 2D8JA 4WCIA 1I1JA 4FSSA 4M4ZA 1UJ0A 2HDAA 4F14A 2KGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRM A;  4LNP A;  2OAW A;  3UF4 A;  3M0U A;  1VA7 A;  3EG1 A;  1PNJ A;  3NHN A;  2LJ0 A;  1X2K A;  2M51 A;  2E5K A;  1AWX A;  2H8H A;  3IQL A;  1AVZ C;  4JJD A;  2J06 A;  2GTO A;  2CH4 A;  3PE0 A;  3ULR B;  2OJ2 A;  1QKW A;  4J9F A;  1HSQ A;  2MIO A;  1AWW A;  3H0I A;  4IIM A;  2ED0 A;  4RUG A;  2EGE A;  4AFQ C;  4EIK A;  1G83 A;  3SHW A;  1B3Q A;  2KEA A;  1SEM A;  2YT6 A;  3CQT A;  1OPL A;  2L3Q A;  5IHN A;  1VYU A;  1NG2 A;  2J05 A;  2EYY A;  2ROT A;  1YNZ A;  2GQI A;  4J9C A;  4ORZ A;  4QT7 A;  1H92 A;  1I0C A;  2DLP A;  2CRE A;  1OOT A;  2RQU A;  2KT1 A;  1K0X A;  1FMK A;  3NPF A;  5L23 A;  1GCP A;  2J6K A;  5HCK A;  1AD5 A;  1W70 A;  2LJ1 A;  1WA7 A;  2O9S A;  2GBQ A;  3I9Q A;  1E7O A;  3SEM A;  1SPK A;  3H0H A;  2EKH A;  3KFV A;  2YUN A;  2YUQ A;  2DX1 A;  1YCS B;  2F2V A;  2C0T A;  5ECA A;  1KIK A;  2B86 A;  2EPD A;  2J6O A;  1ZLM A;  2DF6 A;  2JS0 A;  3FJ5 A;  1X6G A;  4CC7 A;  1WXU A;  2JM8 A;  1QWE A;  2DBK A;  1ZSG A;  1J3T A;  1PHT A;  1SSH A;  5IHK A;  4AFZ C;  2LJ3 A;  5FW9 A;  2LQN A;  4J9D A;  1NM7 A;  1ABQ A;  3EG3 A;  2RMO A;  4Y92 A;  2JXB A;  5GJV B;  4JPB W;  2DVJ A;  2DL4 A;  1QWF A;  4OML A;  2GNC A;  5IXB A;  1QCF A;  1NEG A;  2SRC A;  1ABO A;  2KR3 A;  3QWX X;  1S1N A;  2X3W D;  2AK5 A;  4LUE A;  5GJW B;  1G2B A;  1U5S A;  2DA9 A;  1K76 A;  5I11 A;  1X69 A;  2AKL A;  1KJW A;  4Z89 A;  1GFD A;  3VRY A;  1V1C A;  1MV0 B;  2IIM A;  2KXD A;  2A36 A;  2KT8 A;  1GCQ A;  2A28 A;  1M3B A;  1Z9Z A;  3H0F A;  3REB B;  2PTK A;  3QWY A;  2I0N A;  3REA B;  1W1F A;  1M8M A;  2VKN A;  3U23 A;  1TUD A;  2CDT A;  1WXT A;  1ZUY A;  1JU5 C;  2QDL A;  2EBP A;  1K4U S;  2J7I A;  5FWC A;  2JT4 A;  2KE9 A;  4HVU A;  4OMO A;  2F2X A;  2KRM A;  1T3L A;  1H3H A;  2DL5 A;  4A63 B;  5IH2 A;  1RI9 A;  2EYW A;  1JO8 A;  2HEQ A;  1UGV A;  3VS2 A;  2CUB A;  4J9E A;  1Y0M A;  2K79 A;  1WI7 A;  2LCS A;  1U06 A;  1GRI A;  1AEY A;  3VS5 A;  2CUD A;  2EGA A;  4RTV A;  4AG1 C;  2PZ1 A;  2W10 A;  1E6H A;  1N5Z A;  2NUZ A;  1SRL A;  1UFF A;  2ENM A;  2CT4 A;  2CT3 A;  3EG0 A;  1NLP C;  2A37 A;  3H41 A;  4JZ4 A;  3ZL7 C;  2CSI A;  2DL8 A;  4ZNX A;  4LE9 A;  2FG0 A;  4GBQ A;  2EQI A;  3M0S A;  3EGU A;  2KNB B;  1CKB A;  4RTY A;  1WLP B;  1CSK A;  4RTU A;  2FPD A;  1NYF A;  3EG2 A;  2KRO A;  4RTW A;  3M0Q A;  1NLO C;  1UHC A;  1VYV A;  1BK2 A;  4CC3 A;  4HVW A;  1T0J A;  1YN8 A;  1M27 C;  4OMP A;  3R6N A;  1WFW A;  4AG2 C;  2J6F A;  1PRL C;  1YP5 A;  1QLY A;  2BZ8 A;  1A0N B;  1UUE A;  1AOJ A;  1PWT A;  4JJC A;  1AZG B;  2LNH B;  1WX6 A;  2EYZ A;  2FO0 A;  2K7A A;  1Y57 A;  1YWP A;  2LZ6 B;  1GL5 A;  2HBW A;  5I22 A;  4J9H A;  2DIL A;  4CC4 B;  2AZV A;  4GLM A;  3LH5 A;  2RQW A;  4HXJ A;  2DNU A;  4F16 A;  1K0S A;  2DE0 X;  1RLP C;  4D8D A;  2FRY A;  2CSQ A;  3UA6 A;  4DEX A;  1M30 A;  2ED1 A;  4HVV A;  3M0P A;  1OPK A;  4JJB A;  5EC7 A;  2P4R A;  2DJQ A;  4DEY A;  4OMN A;  2LMJ A;  1UG1 A;  1OV3 A;  1ZX6 A;  2BTT A;  1ZUU A;  1AZE A;  4KRT A;  3THK A;  4RTT A;  3VS7 A;  2YUO A;  3NMZ C;  1T3S A;  1Z9Q A;  2BZX A;  1LCK A;  2RQV A;  2L2P A;  2W0Z A;  1SHG A;  1UJY A;  2K3B A;  3UA7 A;  2L3P A;  1E6G A;  5FWB A;  4CC2 A;  4ESR A;  1NYG A;  1TG0 A;  2SEM A;  4D8K A;  1UDL A;  1UE9 A;  2KYM A;  3VS4 A;  1U3O A;  2M0Y A;  3VRZ A;  1ARK A;  1HD3 A;  3TSZ A;  1KSW A;  3M0T A;  1WYX A;  2L3S A;  1NEB A;  2DYB A;  3PVQ A;  3I5S A;  1M3A A;  2JTE A;  1K9A A;  1SHF A;  2EW3 A;  1WXB A;  2RPN A;  2C0I A;  2CH4 W;  2RN8 A;  2DRM A;  1MV3 A;  2RQT A;  4X1V A;  3VS0 A;  5IHI A;  1M3C A;  1K1Z A;  1ZBJ A;  3TSW A;  1RLQ C;  1EFN A;  3JV3 A;  3VS1 A;  2K6D A;  1GCQ C;  4RTX A;  2RQR A;  3TVT A;  1JEG A;  4IIO A;  1GBR A;  4HCK A;  2LQW A;  4LUD A;  2OI3 A;  2KXC A;  2RNA A;  2C0O A;  2KRN A;  3RNJ A;  2VWF A;  2A08 A;  1PKT A;  2RF0 A;  2ROL A;  3UAT A;  1GBQ A;  1BB9 A;  2EYX A;  1YWO A;  3VS6 A;  2MOX A;  2O2O A;  3PVL A;  4OMQ A;  2GTJ A;  3RBB B;  4Z88 A;  2V1Q A;  1UTI A;  2EGC A;  4AFS C;  2L0A A;  2AZS A;  1JXO A;  2D8H A;  1PRM C;  3M0R A;  1ZUK A;  2D0N A;  1OEB A;  2V1R A;  2JW4 A;  2DBM A;  2HCK A;  1X43 A;  1H8K A;  2LX7 A;  3O5Z A;  2DMO A;  3EHR A;  3NGP A;  2FPF A;  4R0K A;  3I35 A;  5IXF A;  1KFZ A;  1JXM A;  2KBT A;  2PNI A;  2AKK A;  1X27 A;  2FPE A;  2DL3 A;  1W6X A;  2O88 A;  2BZY A;  2ESW A;  1AWJ A;  2O9V A;  1FYN A;  4F17 A;  2HSP A;  2O31 A;  4J9B A;  1BBZ A;  1BU1 A;  1TUC A;  1UEC A;  2FRW A;  2YSQ A;  2KRS A;  1XOV A;  1X2Q A;  2JMC A;  2FEI A;  1QKX A;  2NWM A;  4AFU C;  2YDL A;  2DL7 A;  1AWO A;  2K9G A;  2X3X D;  1X6B A;  1IO6 A;  2JMA A;  2JS2 A;  2D1X A;  3C0C A;  1JQQ A;  1GFC A;  1PKS A;  4JZ3 A;  4LN2 A;  2KYB A;  1WDX A;  2G6F X;  2YUP A;  4RTZ A;  3EHQ A;  2DM1 A;  2MCN A;  1CKA A;  1WIE A;  1B07 A;  2F2W A;  4K11 A;  4Z8A A;  4OMM A;  1VYT A;  1UHF A;  3A98 A;  4J9G A;  1I07 A;  1MUZ A;  2GGR A;  2VVK A;  4J9I A;  1T0H A;  2JM9 A;  2ABL A;  3I5R A;  2LP5 A;  4E6R A;  1RUW A;  2ECZ A;  2DRK A;  1HJD A;  3VS3 A;  2K2M A;  3GBQ A;  2EVR A;  2XMF A;  2D8J A;  4WCI A;  1I1J A;  4FSS A;  4M4Z A;  1UJ0 A;  2HDA A;  4F14 A;  2KGT A; 
#chains in the Genus database with same CATH topology
 2HQH A;  2OAW A;  2DO3 A;  3M0U A;  3G4S A;  1VA7 A;  4RG2 A;  4DOV A;  4DQ2 A;  2M51 A;  2PQW A;  4A4H A;  4PFZ A;  3CCL T;  3A1P A;  3RKX A;  1WJS A;  5IT9 E;  1VQ5 A;  1WHH A;  2P0K A;  1RAI B;  2DZC A;  2J06 A;  2GTO A;  2MK5 A;  1WJR A;  2M9U A;  4M75 E;  4OB1 B;  1KQS P;  2RJC A;  3HL8 A;  4PL6 A;  2MIO A;  3CC7 Q;  3H0I A;  1XTD A;  1QVG P;  2ED0 A;  4C8Q E;  1WHM A;  2HMA A;  2BE9 B;  4OGE A;  4NS5 A;  3SHW A;  3M59 A;  1YJN Q;  2KI7 A;  3M56 A;  5FRM A;  1SEM A;  5CKB A;  2RJE A;  3X20 B;  2DJZ A;  2E64 A;  3L1A A;  3EFR A;  1KC8 U;  2RA2 A;  5FRO A;  4C92 D;  4B9W A;  1RAF B;  2ROT A;  1NPP A;  1YNZ A;  4QT7 A;  4ORZ A;  1H92 A;  2D9T A;  1EX4 A;  4LDW A;  1K0X A;  3EFO B;  3I56 Q;  1M2V A;  5L23 A;  2J6K A;  5HCK A;  1N8R R;  1WPY A;  1BI2 A;  3CXC A;  4PJO B;  4HT8 A;  1ZA1 B;  2F5T X;  5L8R E;  1SPK A;  3KFV A;  2YUN A;  4ATO A;  2C0T A;  1ZLM A;  1YHQ Q;  2DF6 A;  3JB9 D;  3FJ5 A;  1M8V A;  1B34 A;  4PJN A;  2CP0 A;  5GAN d;  4A4G A;  1YJN A;  1BIA A;  1I4K 1;  3EGD B;  4J9D A;  1LNX A;  4EMG A;  4C0Z A;  3LX7 A;  4JPB W;  2DVJ A;  2DL4 A;  5GAM j;  1QWF A;  3L2R A;  1ABO A;  1U1S A;  2HKN A;  2X3W D;  1G2B A;  1Y71 A;  3JSC A;  1U5S A;  1K76 A;  1K73 R;  3C95 A;  3CCV Q;  5GAO r;  3NTK A;  4NL2 A;  1NJI R;  3HFN A;  1VQL A;  5GAN g;  1NZ9 A;  5IAY A;  2IIM A;  1FMV A;  2F5K A;  3V7S A;  2QGF B;  1KHI A;  3QWY A;  4L6V 5;  2D6F A;  3FDR A;  1RAH B;  3CCV T;  4C0F A;  2VC8 A;  4C92 E;  3CCE A;  2MI6 A;  1FMW A;  3RDV A;  1NJI C;  1BCO A;  4OMO A;  3QJY A;  1K73 C;  4DBR A;  4M7D A;  1T3L A;  1BIB A;  2VV5 A;  1RI9 A;  1JRI A;  3OYC A;  1UGV A;  1N27 A;  2CUB A;  4J9E A;  2WSF E;  2LQK A;  4M75 C;  2K79 A;  1U06 A;  1VQ8 A;  5GAN 3;  4ZGD B;  4ZN3 A;  2EGA A;  1YJ9 Q;  1JB0 E;  4RTV A;  4AG1 C;  2PZ1 A;  1E6H A;  3NTH A;  5KYU A;  9ATC B;  1WHJ A;  2DZ9 A;  3OS0 A;  1Y7X A;  3E9F A;  4O5V A;  2DL8 A;  3G4S Q;  3VYG A;  8AT1 B;  4GBQ A;  3QJ6 A;  3QZ9 B;  3EGU A;  3H8Z A;  4XU1 A;  3VUZ A;  4LDU A;  4RTU A;  5A0D A;  2CS7 A;  3INZ A;  1NYF A;  3EG2 A;  4LD6 A;  3M0Q A;  5LJ3 d;  3RMQ A;  1VYV A;  2DK3 A;  5CKD A;  2AHJ B;  4HVW A;  3LWH A;  1WFW A;  3LW5 E;  2HQX A;  1YP5 A;  2BZ8 A;  1A0N B;  3JRZ A;  1UUE A;  5J3B A;  1G8X A;  2EQU A;  2LNH B;  5GAO m;  2EYZ A;  2FO0 A;  2K7A A;  1Y57 A;  1YWP A;  6AT1 B;  1U1T A;  4CRI A;  2DIL A;  3JCM b;  2AZV A;  2RQW A;  3JCM W;  4F16 A;  2DNU A;  2NUP A;  4FIB A;  1K0S A;  1M2O A;  1G3W A;  3EH1 A;  3UA6 A;  4C92 A;  3MO8 A;  2CZ0 B;  2EWN A;  4M77 A;  4DEX A;  2LVM A;  4JRI A;  1MNE A;  1YJW A;  2P4R A;  2LMJ A;  4DBF A;  2EAY A;  1I5L A;  1UG1 A;  1KQ1 A;  2BTT A;  3QG1 A;  1OX9 A;  3OYA A;  2BZX A;  4EMK B;  5GAN 2;  2L2P A;  5GMK l;  3MP1 A;  4M77 D;  1FWZ A;  2L3P A;  3LGL A;  5GAN 7;  4CC2 A;  3CCU Q;  2ZPE B;  1G3Y A;  1UDL A;  4JRK A;  3MEW A;  4OF1 A;  1ACM B;  1U3O A;  2M0Y A;  1PSF A;  1N8R U;  1VQN A;  1HD3 A;  1KSW A;  3G4S T;  3UWN A;  4BI4 A;  2C06 A;  2Y4Y A;  3ZFJ A;  1K9A A;  1SHF A;  2PVG B;  4MZT A;  3GOX A;  3TEE A;  1IRX A;  3MHX A;  4FW1 A;  1MMA A;  1UGQ B;  2X51 A;  3ER0 A;  8ATC B;  1YJW T;  2E65 A;  4KGV B;  3OYG A;  3JCM Q;  2JUF A;  1EFN A;  2XHC A;  2K3X A;  3JV3 A;  1YHQ T;  1V29 B;  2K6D A;  1GCQ C;  4A53 A;  2RQR A;  3TVT A;  1KD1 C;  4M75 B;  1X6O A;  1W2B A;  3QPH A;  1M90 C;  5CKH A;  2HSE B;  2OTL T;  2C0O A;  4M78 E;  4HA8 A;  2EQM A;  2PVD B;  1PKT A;  2ROL A;  3VV0 A;  2DTH A;  3M4Y A;  1BB9 A;  2EYX A;  1YWO A;  3KUF A;  1JJ2 A;  3VS6 A;  4ZN1 A;  5CK9 A;  2HNI A;  4OMQ A;  2FYK A;  5FU6 C;  1UTI A;  1QCO A;  2MMP A;  2L0A A;  2AZS A;  3VYH B;  1PRM C;  4M77 G;  4XTW A;  1BI3 A;  1ZUK A;  2RHU A;  4HT9 A;  2OTL Q;  1OEB A;  1X43 A;  1H8K A;  3I35 A;  1KFZ A;  4B6M A;  1OZ2 A;  3CCS A;  2K5F A;  2E10 A;  2PNI A;  1Q82 C;  2AKK A;  3ASK A;  1W6X A;  2DTO A;  2QYZ A;  3OYM A;  1ZQ1 A;  2HSP A;  3EGX B;  1OUL A;  5HY6 A;  3CCJ A;  1BU1 A;  3CBO A;  3LH0 A;  4FL6 A;  2DKG A;  1X2Q A;  3QXE B;  2YDL A;  5C6S A;  4M7D G;  3PMI A;  4EDU A;  3CCE Q;  2K9G A;  5HK0 A;  5GAN e;  2D1X A;  1VQO A;  1GFC A;  1PKS A;  4JZ3 A;  4LN2 A;  2YUP A;  1VQ4 Q;  3EHQ A;  2V8I A;  1VQL Q;  1K8A C;  1WIE A;  5CO7 A;  1RAB B;  1ZHI A;  5LJ3 e;  1Q81 C;  2HAX A;  1I07 A;  2EQK A;  2RB6 A;  3NTI A;  1WGS A;  2BKD N;  1WHG A;  4E6R A;  1VQ4 T;  1RUW A;  2ECZ A;  2DEQ A;  1HJD A;  3VS3 A;  1IXD A;  2GCX A;  4M4Z A;  4ME7 A;  1UJ0 A;  2QEX Q;  3JCM g;  5FU7 C;  1SRM A;  4LNP A;  3JB9 G;  3ZEH A;  3EG1 A;  2LJ0 A;  2R57 A;  3CC7 T;  2ZAE A;  4M75 D;  1AWX A;  2H8H A;  3OS5 A;  3IQL A;  1Q81 R;  1VIF A;  1AVZ C;  2QXF A;  3I55 T;  1C1A A;  1YIT Q;  1RI0 A;  4PJO G;  2CH4 A;  3ULR B;  1IGU A;  2V8K A;  2OJ2 A;  4J9F A;  4PFO A;  1K8A R;  4M77 C;  1D0Y A;  3CCS T;  1MMD A;  4J7F A;  3A8L B;  4LXC A;  2PVO B;  1OZ3 A;  1KHC A;  5FLX E;  1WNL A;  4RUG A;  1TH7 A;  1QVP A;  2DIG A;  4E7Z A;  1PD1 A;  3OYY A;  2KEA A;  4BY6 B;  1IHV A;  4KUL A;  3CMA A;  2YT6 A;  3BW1 A;  1OPL A;  1S72 Q;  2J05 A;  2EYY A;  2CP7 A;  2ZPG B;  5GAM e;  3OSS C;  4J9C A;  3RR6 A;  4M77 F;  1I0C A;  1FXX A;  2CRE A;  1OOT A;  2RQU A;  3PT9 A;  4AT1 B;  2OTL A;  2LJ1 A;  1WA7 A;  2O9S A;  2CZ1 B;  2KQW A;  3I9Q A;  1E7O A;  3V8J A;  3SEM A;  1VQ5 Q;  5GAN 4;  2FHD A;  3H0H A;  3V7C A;  3J80 E;  5KYY A;  2JJ9 A;  3QYG B;  1TS9 A;  2F2V A;  1KIK A;  3HFO A;  2J6O A;  1M90 R;  5GAO p;  2JS0 A;  1KD1 R;  4M7A E;  2CP6 A;  3VJP A;  3CCM Q;  2HBP A;  2LCC A;  3EG9 A;  4AFZ C;  2V8J A;  5FW9 A;  2LQN A;  1VUB A;  2YWW A;  3MEA A;  4WF2 A;  3QZ5 B;  4OML A;  3CC4 A;  3KBG A;  2KR3 A;  3QWX X;  3NFC A;  2MWO A;  5CAI A;  5GJW B;  4HCB A;  4JLG A;  3CD6 A;  2PUO B;  4XU2 A;  5CVI A;  1IGQ A;  1UB4 A;  2AKL A;  1KJW A;  1GFD A;  1VQ8 Q;  1V1C A;  4JDS A;  2XG8 D;  4J5Y A;  1Q86 C;  4J6Y A;  2KXD A;  3OYI A;  2A36 A;  2ZZD A;  3REB B;  2PTK A;  2I0N A;  3REA B;  1W1F A;  1MGQ A;  3RKY A;  3A8G B;  3CCL Q;  2CDT A;  1WXT A;  1JU5 C;  1B34 B;  2EBP A;  5FWC A;  2KE9 A;  3FRN A;  4HVU A;  3CME T;  3PNW C;  4MDW A;  3CCQ T;  3E1S A;  2KRM A;  1LOJ A;  1VQ9 A;  2YRV A;  5LJ5 f;  2DL5 A;  4IUU A;  5IH2 A;  2DFU A;  5KYX B;  1YJ9 T;  2HEQ A;  3CEY A;  3EFO A;  4M77 E;  4C0G A;  3H9N A;  2FZG B;  1VIE A;  4M78 G;  4FM4 B;  2DER A;  2HL3 A;  3JCM c;  3G6E T;  1GRI A;  3H6Z A;  3CCQ Q;  4LDV A;  2F69 A;  4XTY A;  4QQG A;  2ENM A;  1WZO A;  2A7Y A;  5LL6 S;  3CCM T;  2CT4 A;  3OS1 A;  1NLP C;  3H41 A;  2RI2 A;  2DVE A;  4JZ4 A;  5KH6 A;  2LTO A;  2CSI A;  4M7D C;  2O4X B;  4FSX A;  4ZNX A;  4MZP A;  2QA4 T;  4GY5 A;  5GAM d;  2QQS A;  4RTY A;  1SKU B;  2FPD A;  3BDU A;  2E70 A;  1UHC A;  1BK2 A;  1KQS S;  3J81 E;  2KVQ G;  3UPU A;  3CPW A;  1YN8 A;  5KYW B;  3SFM A;  2RJF A;  3X24 B;  1D1A A;  5FRN A;  1C6V X;  1VQ9 T;  3MP6 A;  3Q1J A;  1AZG B;  3HPW A;  3QDF A;  3PMT A;  2HBW A;  5I22 A;  2IPO B;  5GMK j;  1S72 A;  5AYF A;  4F7U A;  2DE0 X;  3FIF A;  2CZ7 B;  4MML A;  2X35 A;  2LRQ A;  5KCH A;  2Y4X A;  1OPK A;  4JJB A;  2VAS A;  2WSC E;  2DJQ A;  3VU3 C;  1D3B A;  3I56 T;  1ZUU A;  1ZSZ A;  4F7U G;  3GNG A;  4C92 G;  3CD6 T;  2CZ6 B;  1VQM Q;  1TSF A;  1LCK A;  1ZSZ B;  4C92 C;  1SHG A;  4JLI A;  1UJY A;  1UGP B;  1VQL T;  5GAN 8;  3BDL A;  5FWB A;  4C92 F;  3MP8 A;  1NYG A;  1YCY A;  1TG0 A;  1OU9 A;  2K5L A;  4D8K A;  5GAN 6;  1D1B A;  2DXT A;  4X9D A;  1NEB A;  1VQM T;  2YHT A;  3PVQ A;  3GP8 A;  3S3O A;  2QTV A;  1R77 A;  5KCO A;  1OX8 A;  2CH4 W;  4TVR A;  2RN8 A;  3V7R A;  1K9M C;  4C8Q F;  2QQB A;  1MV3 A;  4HCC A;  2RQT A;  3C12 A;  3CC2 A;  3OYF A;  4X1V A;  2XU8 A;  1ZBJ A;  2MWP A;  2VUB A;  1R0C B;  4XAX B;  1MMN A;  2K4Y A;  3VS1 A;  4OP0 A;  4RTX A;  3L2W A;  1QP2 A;  1D1C A;  1UGR B;  2NUT A;  4N0A C;  1TWB A;  3P8H A;  2COZ A;  4C8Q G;  3L2Q A;  4PJO D;  3CMA Q;  2A08 A;  4WTO B;  3SWN A;  1GBQ A;  4F7U F;  2LDM A;  4ZGJ B;  1TXQ A;  1I8F A;  1PD0 A;  1U8R A;  4FYW B;  2RHZ A;  2O2O A;  4ANJ A;  4BE2 A;  3PGG A;  5M9O A;  4Z88 A;  1YIJ A;  1H64 1;  2EGC A;  1JXO A;  2VB6 A;  3SWN C;  4JS4 A;  4M78 C;  3E19 A;  3QDR B;  3OS2 A;  1VQM A;  3LLR A;  2JW4 A;  4QKU A;  3WVE B;  3S3N A;  1OU8 A;  2DMO A;  3EHR A;  5CKE A;  4XU0 A;  1JXM A;  4RKU E;  2DL3 A;  2O88 A;  2ESW A;  4M78 F;  3BFM A;  5GMK i;  1N6A A;  2O9V A;  2QQR A;  5CQX A;  5DY9 A;  1VQ5 T;  3EAE A;  3OA6 A;  2XID A;  4M7A F;  4LDY A;  5KE2 A;  2KRS A;  4DA4 A;  2EFI A;  1W4S A;  1QVF P;  2BE7 D;  3A8O B;  1AWO A;  2X3X D;  2M0O A;  3GIB A;  3X28 B;  2RK2 A;  3LWI A;  5HKC A;  2G6F X;  4OB3 B;  4RTZ A;  3M57 A;  2COW A;  1QW1 A;  4PK4 A;  1QMC A;  2DM1 A;  1CKA A;  2CP5 A;  1B07 A;  1O75 A;  1Q86 R;  4K11 A;  3OSV A;  4Z8A A;  4JRQ A;  1VQO T;  2YRC A;  4OMM A;  1Q86 U;  1VYT A;  3A98 A;  1MUZ A;  1I81 A;  2GGR A;  2VVK A;  1T0H A;  1B7T A;  2ABL A;  5KE3 A;  7AT1 B;  4IUP A;  3VKI A;  2RD1 A;  2QA4 Q;  4BDY A;  2JTF A;  1PSE A;  4WCI A;  3GLX A;  1I1J A;  4FSS A;  3EG9 B;  2E6N A;  2RI5 A;  4F14 A;  3M54 A;  3PIP A;  3OQ5 A;  2OTJ Q;  2QA4 A;  4FU6 A;  1X2K A;  4Y28 E;  3CCS Q;  2E5K A;  4LDX A;  4XU3 A;  5CR2 A;  1G3T A;  4JUV A;  4JJD A;  1WHK A;  3PE0 A;  2CKK A;  1QKW A;  2DXU A;  2RM4 A;  2GFU A;  4A4K A;  2E6Z A;  2VGN A;  3J7A F;  1JJ2 P;  1MHN A;  3AT1 B;  5EG2 A;  2IG0 A;  2EGE A;  4AFQ C;  4JJN K;  1BYM A;  4EPC A;  3G6E Q;  3PFS A;  1R8O B;  1B3Q A;  5LJ3 h;  3CQT A;  2L3Q A;  5IHN A;  1N9R A;  1NG2 A;  1VYU A;  5J26 A;  3PIO A;  3F70 A;  2HD0 A;  1H3Z A;  3MEU A;  2BUD A;  3CME A;  3HRS A;  2DLP A;  3RIR A;  3SDZ A;  3OYD A;  3CD6 Q;  4BY6 C;  2KT1 A;  2L89 A;  2G3R A;  1GCP A;  4L5G A;  1AD5 A;  1VQN Q;  1W70 A;  1YJW Q;  5GAO q;  2GBQ A;  4F7U B;  4FW2 A;  2P84 A;  3JCM h;  4PJM A;  2DX1 A;  1YCS B;  2EPD A;  2YXY A;  4YTL A;  3CCE T;  5LJ5 e;  1IRE B;  2QGG A;  2JM8 A;  2DBK A;  2LCL A;  5AT1 B;  4GLK A;  1MND A;  1J3T A;  1PHT A;  2EYQ A;  5IHK A;  1VQN T;  4BE1 A;  3X26 B;  2OX7 A;  2LJ3 A;  1SF9 A;  5LJ5 h;  3KXT A;  1NM7 A;  1BCM A;  1ABQ A;  3EG3 A;  2JXB A;  4M78 B;  2EJ9 A;  4NL3 A;  1VQ7 A;  1ZBX A;  1QCN A;  4M7A C;  4A4F A;  5IXB A;  1S1N A;  4LUE A;  4C0D C;  2E5Q A;  2LQ8 A;  4RCB A;  3JCM f;  1AT1 B;  2DA9 A;  3WVD B;  2QEX A;  1X69 A;  2Z0W A;  2O4X A;  3TQ7 P;  4FT2 A;  4OB2 B;  1MV0 B;  3DB4 A;  4KGZ B;  4JRP A;  2R58 A;  2DYI A;  2KT8 A;  1YI2 T;  4C0D B;  1M3B A;  1Z9Z A;  2VYT A;  3CXC S;  4QW2 A;  1W2B P;  5I2M A;  5HK3 A;  1KD1 U;  1M8M A;  1KK7 A;  2VKN A;  1Q7Y C;  1RAG B;  3JCM d;  2FZK B;  4N4H A;  1ZUY A;  4X34 A;  1D0X A;  2P4T A;  1K4U S;  4FYV B;  2CP3 A;  3EFS A;  2QTX A;  1N9S A;  3HP9 A;  1OQK A;  1YFN A;  3RUX A;  4A63 B;  2HZY A;  2EYW A;  2EJG A;  1JJ2 S;  3PTA A;  2KAF A;  1YI2 A;  2DXC A;  4IUR A;  3CC2 T;  2LCS A;  4J83 A;  4C8Q A;  1AEY A;  3VS5 A;  1N5Z A;  3R6O A;  3C94 A;  4OGC A;  1Q82 U;  2LT4 A;  4ELY C;  2CT3 A;  3EG0 A;  2A37 A;  5GAN 5;  4A4E A;  4IUT A;  1X01 A;  5I21 A;  2OTJ A;  4QVZ A;  2QEX T;  4Z02 A;  2FG0 A;  2E41 A;  2JVV A;  3OYN A;  1CKB A;  2DAQ A;  2ZGW A;  1WLP B;  3X25 B;  3RES A;  1SSF A;  1EZZ B;  3G1J A;  5KYW A;  5KYX A;  1VQO Q;  2DET A;  2K3Y A;  1RAC B;  2E1H A;  3OY9 A;  4AG2 C;  2JOY A;  1VQ4 A;  1PRL C;  1QLY A;  4OVA A;  2XDD A;  3OBY A;  4PJO C;  2BIV A;  1PWT A;  4JJC A;  4KUI A;  5FU6 B;  1M5Q 1;  4J9H A;  1Q81 U;  3LH5 A;  5KYY B;  4HXJ A;  4QQD A;  4M7A A;  1RLP C;  4PJO E;  4A54 A;  1GXI E;  2FRY A;  2RHI A;  1S72 T;  3RER A;  3OYL A;  2LX9 A;  5CKF A;  1WJQ A;  1M30 A;  2YRD A;  3M0P A;  2YLC A;  1XQH A;  5LJ3 g;  3ME9 A;  4DEY A;  4J6X A;  2MPX C;  1OV3 A;  1ZX6 A;  3G71 A;  3CPF A;  4KRT A;  3DB3 A;  3M53 A;  3M55 A;  2QI2 A;  3THK A;  5GAN h;  1LPL A;  3NMZ C;  2E3H A;  3GNF B;  2ZCF B;  2RQV A;  3G71 Q;  4N0A A;  1M1K C;  3UA7 A;  3MJX A;  2O01 E;  3S3M A;  4ESR A;  2JZ2 A;  3BE3 A;  2SEM A;  1UE9 A;  4XK8 E;  3VS4 A;  1M4Z A;  1V76 A;  3OYB A;  3SB2 A;  1LVK A;  3VRZ A;  1ARK A;  3TSZ A;  4C92 B;  4O6J A;  4VUB A;  1IB8 A;  3MET A;  2NYS A;  5GAM f;  3HKS A;  2RPN A;  2C0I A;  2DRM A;  4M7A G;  1RAE B;  5IHI A;  1M3C A;  3TSW A;  2QDY B;  1RLQ C;  3QII A;  4F04 B;  2COY A;  5A0G A;  1OYX A;  2EQJ A;  3MKD A;  2X4J A;  1JEG A;  2FVU A;  4C8Q C;  5D6Y A;  1PC0 A;  2OI3 A;  3JCM P;  1QVF S;  4PJJ A;  1M1F A;  2KXC A;  3QO3 A;  2YLB A;  2KRN A;  3RNJ A;  1NJI U;  4RCC A;  2RF0 A;  3UAT A;  1K9M R;  1K73 U;  4P5N A;  4PJO F;  2MOX A;  3CPW S;  3A5Z B;  3PVL A;  5GAO n;  3CME Q;  1IHW A;  3RBB B;  3N5B B;  4M7D D;  3S6W A;  3O8V A;  4XTU A;  2H3E B;  1Q95 G;  3HRT A;  3M0R A;  2JTM A;  1RAA B;  4KBM B;  2V1R A;  3CCR A;  2DBM A;  2HCK A;  3O5Z A;  2LX7 A;  3NGP A;  3QUI A;  1M1K R;  5IXF A;  5GMK e;  1IZ6 A;  4ZTJ A;  2DD5 A;  3BY7 A;  4C8Q D;  3AHU A;  2X4W A;  4MDX A;  3EGX A;  2BZY A;  3JAM E;  3P8B B;  1QVG S;  1AWJ A;  1FYN A;  4F17 A;  2O31 A;  4J9B A;  4M7D B;  3LGF A;  3JB9 I;  4R56 A;  1KQ2 A;  1UEC A;  2YSQ A;  3UDC A;  1BKB A;  1XOV A;  2B8A A;  2JMC A;  4OB0 B;  2V26 A;  1YBY A;  4AFU C;  3DLL A;  2DL7 A;  2MYS A;  2DD4 A;  1JQQ A;  5C0M A;  2HQE A;  4BE0 A;  2MAM A;  2I2L A;  5LJ5 j;  4XTX A;  1I5O B;  2MCN A;  2KSS A;  1XNI A;  4MMK A;  2LNV A;  3OBW A;  2RH2 A;  2RI3 A;  1UHF A;  3RKW A;  4J9I A;  2JM9 A;  3M58 A;  4M7D F;  2AT1 B;  4M7A B;  3GF5 A;  2CYZ B;  4M75 A;  3M5A A;  2LP5 A;  4DBQ A;  4PKC C;  5GAN f;  2QQ9 A;  1Q7Y U;  4M7A D;  5CQY A;  1BI0 A;  5A2Q E;  2D8J A;  4M78 D;  2HDA A;  4C8Q B;  4F7U E;  2KGT A;  3CCR Q;  4IUQ A;  3UF4 A;  3DKM A;  1F1B B;  1PNJ A;  3NHN A;  2KDS A;  3JCM X;  3I55 A;  5GAO l;  3JB9 J;  4IKF A;  3CPW P;  2XDB A;  2GQV A;  5GAM h;  1HSQ A;  5GAM g;  1M2V B;  1M90 U;  1AWW A;  1N8R C;  4HKE A;  4IIM A;  4J7I A;  1VQ8 T;  2X9H A;  4EIK A;  1G83 A;  1EIF A;  2PUK B;  1BI1 A;  5CIU A;  2M02 A;  5GAN j;  2MF2 A;  3I56 A;  5KYN A;  2GQI A;  3QBY A;  1VQ7 Q;  1O9S A;  4UC4 A;  4LD9 K;  4KH1 B;  1FMK A;  3NPF A;  5GMK m;  3CCV A;  2DIQ A;  2EKH A;  2JN0 A;  4II1 A;  2YUQ A;  2M16 A;  3CBM A;  5ECA A;  1NPR A;  2B86 A;  4E47 A;  2OAU A;  1ZSZ C;  1X6G A;  1RL2 A;  4CC7 A;  5I2S A;  3CCU T;  1WXU A;  1QWE A;  4OMF B;  3UT1 A;  1ZSG A;  2H3J A;  3TCJ A;  4J8O A;  1SSH A;  4C5H A;  4ELZ C;  3MCA B;  3RMS A;  4FT4 A;  3OB9 A;  1WHL A;  3DLM A;  1JBM A;  4BI8 B;  4V2S A;  4E7L A;  2RMO A;  3CCJ T;  1VQ6 Q;  4Y92 A;  3L2V A;  5GJV B;  1KC8 R;  1PM3 A;  2GNC A;  1QCF A;  4E7J A;  3OYJ A;  1NEG A;  2SRC A;  4XTV A;  3E9G A;  2AK5 A;  3FB9 A;  1VQK T;  1YIT A;  5I11 A;  1K8A U;  1VQK A;  1K9M U;  4XTZ A;  4EMK C;  4Z89 A;  5A0L A;  5GMK h;  3VRY A;  4RMO A;  3TU4 K;  3G6E A;  3CCJ Q;  1VQ6 T;  3QSU A;  1GCQ A;  2X4Y A;  1Q7Y R;  2A28 A;  3H0F A;  2FB7 A;  2HKQ B;  1YJ9 A;  5DM7 R;  1PG5 B;  2ZPB B;  1VQK Q;  3G71 T;  3U23 A;  2QG9 B;  4PLI A;  1TUD A;  2EJF A;  1MMG A;  3QHS A;  2K57 A;  4NOY A;  2E12 A;  3QYH B;  4FYX B;  2VXF A;  2QDL A;  4RG8 A;  3CBP A;  4C5G A;  2J7I A;  2F1L A;  1QVF A;  2JT4 A;  3L2Z A;  1X75 C;  1UGS B;  4IUV A;  2DTI A;  2F2X A;  2ZPF B;  1G5V A;  3D7S B;  1H3H A;  3CC2 Q;  2WAC A;  2Y90 A;  3CCQ A;  1XJW B;  4EMK A;  2K5I A;  1M1G A;  4R55 A;  3G7Z A;  1JO8 A;  3VS2 A;  2RK1 A;  1Y0M A;  5D6W A;  2RO0 A;  1WI7 A;  1PCX A;  3FC3 A;  4QQ6 A;  1NBE B;  1TU0 B;  3LYI A;  4E7K A;  2CUD A;  5LJ3 j;  4DBH A;  1VOM A;  2W10 A;  4M77 B;  2NUZ A;  2CP2 A;  1SRL A;  1DJ7 B;  1UFF A;  2EKO A;  2WSE E;  4ZGE B;  3L2U A;  2M1H A;  1NE8 A;  2NUP B;  3JB9 F;  3CC4 T;  4M78 A;  3ZL7 C;  5KYU B;  3HHT B;  3CCL A;  1YIJ Q;  3OW2 S;  4LE9 A;  4E7I A;  2EQI A;  3M0S A;  4BAC A;  2CGH A;  2L3R A;  2L8D A;  2KNB B;  2OTJ T;  1CSK A;  1ZA2 B;  2KRO A;  4N4G A;  4AMC A;  4RTW A;  1TUG B;  3OW2 A;  1NLO C;  1WQW A;  4CC3 A;  1T0J A;  2XIC A;  1M27 C;  4OMP A;  3R6N A;  4DOW A;  3OYH A;  1Y96 B;  1VQP A;  1Y07 A;  2J6F A;  1YIJ T;  4KH0 B;  1AOJ A;  2DXB A;  1D0Z A;  4MZM A;  1WX6 A;  4X9C A;  2LZ6 B;  1GL5 A;  5LJ5 d;  3V8L A;  1W2B S;  1AHJ B;  4CC4 B;  4GLM A;  5LJ3 f;  3JB9 H;  3OYE A;  2AIR B;  3P8D A;  5DLO A;  4D8D A;  2CSQ A;  4PNO A;  3EH2 A;  3OMC A;  2ED1 A;  4HVV A;  4L59 A;  3CMA T;  4BI3 A;  1HK9 A;  4D6W A;  3A8H B;  4B9X A;  1VQ6 A;  3FEO A;  2R5M A;  5EC7 A;  5FU7 B;  4OMN A;  2L5Q A;  1WQ7 A;  3ZBD A;  1AZE A;  3V8K A;  4RTT A;  3VS7 A;  2YUO A;  5D6X A;  2QK0 A;  4BD3 A;  1T3S A;  3HSB A;  1QVG A;  1Z9Q A;  2A3L A;  1YIT T;  1Q82 R;  3A8M B;  2GFA A;  2FL7 A;  4Y91 A;  4QVD A;  2W0Z A;  2K3B A;  2XKO C;  1KQS A;  3E2U A;  2ZPI B;  1LJO A;  1E6G A;  3CC7 A;  2KYM A;  2VGM A;  3FJP A;  3M0T A;  5J39 A;  2NUT B;  1WYX A;  2L3S A;  2DYB A;  2NLU A;  1VQ7 T;  2JNG A;  3CCU A;  3I5S A;  2EIF A;  1M3A A;  2JTE A;  2EW3 A;  1WXB A;  3HRU A;  2D0Q B;  4FYY B;  1TTH B;  1KC8 C;  4N4I A;  4PJO A;  2QAZ A;  1VQ9 Q;  4J6W A;  3CCR T;  3VS0 A;  1K1Z A;  2VXE A;  4PJL A;  4HCZ A;  4JS5 A;  2FZC B;  1Y96 A;  3CXC P;  2KMT A;  1KG1 A;  3OYK A;  2E3I A;  2R5A A;  4PLL A;  1QP3 A;  1M9S A;  1YI2 Q;  4IIO A;  1GBR A;  3HTR A;  1C0M A;  4HCK A;  3WXM B;  2LQW A;  2XI9 A;  2DEU A;  4LUD A;  2LC4 A;  2RNA A;  2P0P A;  4E2F B;  4BB7 A;  3SWN B;  2VWF A;  3EGD A;  4CI0 C;  3I55 Q;  4BDZ A;  3MPU B;  4QVC A;  2GTJ A;  3L42 A;  2X4X A;  2V1Q A;  1FX7 A;  4AFS C;  4E7H A;  2D8H A;  1QQJ A;  2RHX A;  2D0N A;  4M75 F;  4PFP A;  1G3S A;  2QQA A;  3T9N A;  3URG A;  4EMH A;  4ZTF A;  4R0K A;  2A0F B;  2FPF A;  2XD0 A;  2XDP A;  4E7S A;  5D7U A;  2KBT A;  5DLQ E;  2P0Q A;  1X27 A;  2FPE A;  3QKJ A;  2E4H A;  2IVW A;  4FCY A;  1BBZ A;  3CCM A;  1SG5 A;  1TUC A;  2FRW A;  1HXD A;  2GF7 A;  2FEI A;  1YJN T;  1QKX A;  2NWM A;  3TRE A;  4C5E A;  2DPP B;  2K2V A;  2ATC B;  5LJ5 g;  1X6B A;  1D09 B;  1IO6 A;  2JMA A;  2JS2 A;  3C0C A;  3OW2 P;  2KYB A;  1WDX A;  4XQ3 A;  5IN1 A;  1RAD B;  2HL5 C;  1VQP Q;  4Q5W A;  2KK4 A;  3JCM V;  2XK0 A;  4BUG A;  2ZPH B;  4M75 G;  3VUB A;  3JCM e;  1D3B B;  3OMG A;  4KT0 E;  2F2W A;  1M1K U;  3JCM J;  2RHY A;  4KUD K;  4J9G A;  5CCA A;  3MEV A;  3M4G A;  2RJD A;  3CC4 Q;  3I5R A;  1OI1 A;  1VQP T;  1TOV A;  3FLG A;  2DRK A;  1YHQ A;  2LT1 A;  2QAS A;  1HYO A;  2K2M A;  2KY9 A;  2PU9 B;  3GBQ A;  2EVR A;  1UEB A;  2XMF A;  4M7D E;  3M9Q A;  3GPL A;  4C5I A;  3SD4 A;  4KGX B;  1R0B G;  1P92 A;  3C4S A; 
#chains in the Genus database with same CATH homology
 1SRM A;  4LNP A;  2OAW A;  3UF4 A;  3M0U A;  1VA7 A;  3EG1 A;  1PNJ A;  3NHN A;  2LJ0 A;  1X2K A;  2M51 A;  2E5K A;  1AWX A;  2H8H A;  3IQL A;  1AVZ C;  4JJD A;  2J06 A;  2GTO A;  2CH4 A;  3PE0 A;  3ULR B;  2OJ2 A;  1QKW A;  4J9F A;  1HSQ A;  2MIO A;  1AWW A;  3H0I A;  4IIM A;  2ED0 A;  4RUG A;  2EGE A;  4AFQ C;  4EIK A;  1G83 A;  3SHW A;  1B3Q A;  2KEA A;  1SEM A;  2YT6 A;  3CQT A;  1OPL A;  2L3Q A;  5IHN A;  1VYU A;  1NG2 A;  2J05 A;  2EYY A;  2ROT A;  1YNZ A;  2GQI A;  4J9C A;  4ORZ A;  4QT7 A;  1H92 A;  1I0C A;  2DLP A;  2CRE A;  1OOT A;  2RQU A;  2KT1 A;  1K0X A;  1FMK A;  3NPF A;  5L23 A;  1GCP A;  2J6K A;  5HCK A;  1AD5 A;  1W70 A;  2LJ1 A;  1WA7 A;  2O9S A;  2GBQ A;  3I9Q A;  1E7O A;  3SEM A;  1SPK A;  3H0H A;  2EKH A;  3KFV A;  2YUN A;  2YUQ A;  2DX1 A;  1YCS B;  2F2V A;  2C0T A;  5ECA A;  1KIK A;  2B86 A;  2EPD A;  2J6O A;  1ZLM A;  2DF6 A;  2JS0 A;  3FJ5 A;  1X6G A;  4CC7 A;  1WXU A;  2JM8 A;  1QWE A;  2DBK A;  1ZSG A;  1J3T A;  1PHT A;  1SSH A;  5IHK A;  4AFZ C;  2LJ3 A;  5FW9 A;  2LQN A;  4J9D A;  1NM7 A;  1ABQ A;  3EG3 A;  2RMO A;  4Y92 A;  2JXB A;  5GJV B;  4JPB W;  2DVJ A;  2DL4 A;  1QWF A;  4OML A;  2GNC A;  5IXB A;  1QCF A;  1NEG A;  2SRC A;  1ABO A;  2KR3 A;  3QWX X;  1S1N A;  2X3W D;  2AK5 A;  4LUE A;  5GJW B;  1G2B A;  1U5S A;  2DA9 A;  1K76 A;  5I11 A;  1X69 A;  2AKL A;  1KJW A;  4Z89 A;  1GFD A;  3VRY A;  1V1C A;  1MV0 B;  2IIM A;  2KXD A;  2A36 A;  2KT8 A;  1GCQ A;  2A28 A;  1M3B A;  1Z9Z A;  3H0F A;  3REB B;  2PTK A;  3QWY A;  2I0N A;  3REA B;  1W1F A;  1M8M A;  2VKN A;  3U23 A;  1TUD A;  2CDT A;  1WXT A;  1ZUY A;  1JU5 C;  2QDL A;  2EBP A;  1K4U S;  2J7I A;  5FWC A;  2JT4 A;  2KE9 A;  4HVU A;  4OMO A;  2F2X A;  2KRM A;  1T3L A;  1H3H A;  2DL5 A;  4A63 B;  5IH2 A;  1RI9 A;  2EYW A;  1JO8 A;  2HEQ A;  1UGV A;  3VS2 A;  2CUB A;  4J9E A;  1Y0M A;  2K79 A;  1WI7 A;  2LCS A;  1U06 A;  1GRI A;  1AEY A;  3VS5 A;  2CUD A;  2EGA A;  4RTV A;  4AG1 C;  2PZ1 A;  2W10 A;  1E6H A;  1N5Z A;  2NUZ A;  1SRL A;  1UFF A;  2ENM A;  2CT4 A;  2CT3 A;  3EG0 A;  1NLP C;  2A37 A;  3H41 A;  4JZ4 A;  3ZL7 C;  2CSI A;  2DL8 A;  4ZNX A;  4LE9 A;  2FG0 A;  4GBQ A;  2EQI A;  3M0S A;  3EGU A;  2KNB B;  1CKB A;  4RTY A;  1WLP B;  1CSK A;  4RTU A;  2FPD A;  1NYF A;  3EG2 A;  2KRO A;  4RTW A;  3M0Q A;  1NLO C;  1UHC A;  1VYV A;  1BK2 A;  4CC3 A;  4HVW A;  1T0J A;  1YN8 A;  1M27 C;  4OMP A;  3R6N A;  1WFW A;  4AG2 C;  2J6F A;  1PRL C;  1YP5 A;  1QLY A;  2BZ8 A;  1A0N B;  1UUE A;  1AOJ A;  1PWT A;  4JJC A;  1AZG B;  2LNH B;  1WX6 A;  2EYZ A;  2FO0 A;  2K7A A;  1Y57 A;  1YWP A;  2LZ6 B;  1GL5 A;  2HBW A;  5I22 A;  4J9H A;  2DIL A;  4CC4 B;  2AZV A;  4GLM A;  3LH5 A;  2RQW A;  4HXJ A;  2DNU A;  4F16 A;  1K0S A;  2DE0 X;  1RLP C;  4D8D A;  2FRY A;  2CSQ A;  3UA6 A;  4DEX A;  1M30 A;  2ED1 A;  4HVV A;  3M0P A;  1OPK A;  4JJB A;  5EC7 A;  2P4R A;  2DJQ A;  4DEY A;  4OMN A;  2LMJ A;  1UG1 A;  1OV3 A;  1ZX6 A;  2BTT A;  1ZUU A;  1AZE A;  4KRT A;  3THK A;  4RTT A;  3VS7 A;  2YUO A;  3NMZ C;  1T3S A;  1Z9Q A;  2BZX A;  1LCK A;  2RQV A;  2L2P A;  2W0Z A;  1SHG A;  1UJY A;  2K3B A;  3UA7 A;  2L3P A;  1E6G A;  5FWB A;  4CC2 A;  4ESR A;  1NYG A;  1TG0 A;  2SEM A;  4D8K A;  1UDL A;  1UE9 A;  2KYM A;  3VS4 A;  1U3O A;  2M0Y A;  3VRZ A;  1ARK A;  1HD3 A;  3TSZ A;  1KSW A;  3M0T A;  1WYX A;  2L3S A;  1NEB A;  2DYB A;  3PVQ A;  3I5S A;  1M3A A;  2JTE A;  1K9A A;  1SHF A;  2EW3 A;  1WXB A;  2RPN A;  2C0I A;  2CH4 W;  2RN8 A;  2DRM A;  1MV3 A;  2RQT A;  4X1V A;  3VS0 A;  5IHI A;  1M3C A;  1K1Z A;  1ZBJ A;  3TSW A;  1RLQ C;  1EFN A;  3JV3 A;  3VS1 A;  2K6D A;  1GCQ C;  4RTX A;  2RQR A;  3TVT A;  1JEG A;  4IIO A;  1GBR A;  4HCK A;  2LQW A;  4LUD A;  2OI3 A;  2KXC A;  2RNA A;  2C0O A;  2KRN A;  3RNJ A;  2VWF A;  2A08 A;  1PKT A;  2RF0 A;  2ROL A;  3UAT A;  1GBQ A;  1BB9 A;  2EYX A;  1YWO A;  3VS6 A;  2MOX A;  2O2O A;  3PVL A;  4OMQ A;  2GTJ A;  3RBB B;  4Z88 A;  2V1Q A;  1UTI A;  2EGC A;  4AFS C;  2L0A A;  2AZS A;  1JXO A;  2D8H A;  1PRM C;  3M0R A;  1ZUK A;  2D0N A;  1OEB A;  2V1R A;  2JW4 A;  2DBM A;  2HCK A;  1X43 A;  1H8K A;  2LX7 A;  3O5Z A;  2DMO A;  3EHR A;  3NGP A;  2FPF A;  4R0K A;  3I35 A;  5IXF A;  1KFZ A;  1JXM A;  2KBT A;  2PNI A;  2AKK A;  1X27 A;  2FPE A;  2DL3 A;  1W6X A;  2O88 A;  2BZY A;  2ESW A;  1AWJ A;  2O9V A;  1FYN A;  4F17 A;  2HSP A;  2O31 A;  4J9B A;  1BBZ A;  1BU1 A;  1TUC A;  1UEC A;  2FRW A;  2YSQ A;  2KRS A;  1XOV A;  1X2Q A;  2JMC A;  2FEI A;  1QKX A;  2NWM A;  4AFU C;  2YDL A;  2DL7 A;  1AWO A;  2K9G A;  2X3X D;  1X6B A;  1IO6 A;  2JMA A;  2JS2 A;  2D1X A;  3C0C A;  1JQQ A;  1GFC A;  1PKS A;  4JZ3 A;  4LN2 A;  2KYB A;  1WDX A;  2G6F X;  2YUP A;  4RTZ A;  3EHQ A;  2DM1 A;  2MCN A;  1CKA A;  1WIE A;  1B07 A;  2F2W A;  4K11 A;  4Z8A A;  4OMM A;  1VYT A;  1UHF A;  3A98 A;  4J9G A;  1I07 A;  1MUZ A;  2GGR A;  2VVK A;  4J9I A;  1T0H A;  2JM9 A;  2ABL A;  3I5R A;  2LP5 A;  4E6R A;  1RUW A;  2ECZ A;  2DRK A;  1HJD A;  3VS3 A;  2K2M A;  3GBQ A;  2EVR A;  2XMF A;  2D8J A;  4WCI A;  1I1J A;  4FSS A;  4M4Z A;  1UJ0 A;  2HDA A;  4F14 A;  2KGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...