1SPKA

Solution structure of rsgi ruh-010, an sh3 domain from mouse cdna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
72
structure length
72
Chain Sequence
GSSGSSGQKVKTIFPHTAGNNKTLLSFAQGDVLTLLIPEEKDGWLYGEHDTTKARGWFPSSYTKLLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-010, an SH3 Domain from Mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 1300006M19
total genus 7
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1spkA00
3PVQA 1ABQA 2VVKA 3VS4A 2DNUA 1OPKA 4QT7A 1JQQA 1QLYA 4AFQC 2BZ8A 1X43A 2LMJA 2FO0A 1SRLA 2IIMA 1WFWA 1G83A 2BZXA 1M27C 1OOTA 3SHWA 1X69A 2YUQA 1JO8A 2EYZA 2NUZA 2DRKA 1J3TA 3NMZC 4CC7A 4OMPA 2DVJA 3EG0A 4F16A 2LCSA 1S1NA 1RI9A 1SHGA 2V1QA 4RTVA 1RLPC 2CUDA 2EYXA 5GJVB 1W1FA 1E6GA 2X3XD 5IXFA 3GBQA 1PRMC 2RNAA 1KIKA 2CH4A 2KR3A 2RQVA 2L3QA 1AWXA 1E6HA 4X1VA 1EFNA 4D8KA 3VS1A 1WLPB 2DMOA 1WXTA 4AG1C 2EGAA 2YT6A 4HVWA 1H3HA 2V1RA 4DEXA 1AWWA 3EGUA 4J9CA 2KRNA 2X3WD 4ESRA 2DA9A 2JS2A 1ZLMA 2JT4A 1UGVA 2FG0A 1T3SA 3U23A 3M0UA 1I1JA 1TUCA 4RTYA 1NLOC 2K3BA 1BK2A 5IHIA 2PZ1A 1RLQC 5HCKA 1PHTA 1JXOA 1XOVA 1WI7A 2HBWA 4J9FA 1K0SA 3REBB 2JMAA 3ZL7C 4AFZC 2EGCA 2LX7A 3O5ZA 1WDXA 4LNPA 2L0AA 4AG2C 1UDLA 4RUGA 2J7IA 1Y0MA 2YUNA 2VWFA 1QKWA 2SRCA 1TUDA 2KT1A 1W6XA 1T0JA 2RQRA 3H0IA 1GCQA 3EG1A 1MUZA 1G2BA 1AEYA 4F14A 2FPFA 1K4US 2PNIA 1HJDA 2BZYA 2D1XA 2OJ2A 3NGPA 5IH2A 1ZSGA 3VS5A 4J9BA 2DM1A 2J06A 1AZEA 1WYXA 3H0HA 1I07A 2LQNA 3QWXX 5I22A 4JJDA 4Z88A 1NYFA 4ORZA 4J9DA 2JM9A 1YP5A 4JZ3A 2CSQA 3M0QA 1AWJA 2KEAA 2JS0A 2JM8A 2ESWA 4OMLA 1JEGA 2J05A 1U5SA 1W70A 1SSHA 2EGEA 1PKTA 2EYWA 1AZGB 3I9QA 1UECA 2H8HA 1UHCA 2FRWA 2DL7A 4DEYA 1UUEA 3A98A 1GCQC 2B86A 1X6GA 2RQTA 3TVTA 1VA7A 1GCPA 2FRYA 4A63B 2CREA 1M30A 2VKNA 1BU1A 3H41A 4CC4B 1SEMA 2DILA 4GLMA 2DLPA 1QKXA 3UATA 2K9GA 2KNBB 2C0TA 2CUBA 2RF0A 4HVUA 1T3LA 2EBPA 2LNHB 1K0XA 2DL8A 3VS2A 1BB9A 1RUWA 1SPKA 4LUEA 2AZSA 3EG2A 1GFDA 1PKSA 2DE0X 1HD3A 2DX1A 2NWMA 2O9SA 2ABLA 1AD5A 2KRMA 2BTTA 1B3QA 4AFSC 2EPDA 3JV3A 4JJBA 2D0NA 2YSQA 3VRZA 2AKKA 5EC7A 2K6DA 1M8MA 3VRYA 1UFFA 1SRMA 1YN8A 3UA6A 1X27A 1CSKA 1TG0A 2JMCA 4IIMA 3THKA 2A08A 4GBQA 1SHFA 1HSQA 4AFUC 1K76A 4K11A 1B07A 1YNZA 5IHKA 3EHQA 3R6NA 4R0KA 5L23A 4J9EA 2ROTA 3UA7A 3IQLA 2EQIA 1GBRA 3PE0A 2O88A 3NPFA 1VYUA 1Z9ZA 3EG3A 4FSSA 4M4ZA 1ZUYA 4CC3A 2MCNA 1FYNA 3KFVA 4OMQA 2KXCA 1NEBA 3NHNA 1IO6A 3RBBB 1UHFA 2AZVA 4EIKA 4HVVA 2L2PA 1VYVA 1BBZA 1UG1A 3M0RA 5IHNA 1I0CA 2A36A 2O31A 4JZ4A 2F2VA 3C0CA 2A28A 2HDAA 2HCKA 1V1CA 5FW9A 1CKAA 1JXMA 2RPNA 3I5RA 4LN2A 1WA7A 4RTZA 3EHRA 1PWTA 3VS3A 5FWBA 1OEBA 4RTTA 1E7OA 3FJ5A 4OMOA 3H0FA 2AKLA 2GTJA 4JJCA 1GFCA 2LJ3A 3TSZA 3CQTA 1YWPA 1WX6A 2C0IA 1PNJA 1UJYA 2DL3A 2L3SA 2KE9A 4IIOA 4F17A 1KSWA 2L3PA 3PVLA 3I5SA 3TSWA 1CKBA 1KJWA 2K79A 2GTOA 2KYBA 2YDLA 2GQIA 2M51A 2D8HA 2W10A 3SEMA 1FMKA 4Z8AA 1ZX6A 2ENMA 2ROLA 1NM7A 2KROA 4Y92A 2F2WA 1QWFA 2DF6A 1GL5A 2AK5A 2FPDA 2DL5A 1M3BA 3QWYA 1UE9A 4J9HA 3M0PA 4Z89A 2KYMA 2P4RA 2OAWA 3RNJA 1AVZC 1X2QA 2DBMA 2GNCA 1JU5C 3ULRB 1N5ZA 2MOXA 2KRSA 1ZUKA 2HEQA 2I0NA 2M0YA 1T0HA 1ZUUA 1M3AA 1QCFA 2DJQA 4JPBW 2YUOA 4RTWA 5GJWB 1MV3A 4CC2A 3VS7A 4HCKA 2JXBA 2ECZA 1ARKA 2CT4A 1H92A 1WXBA 2J6FA 2J6KA 4D8DA 4ZNXA 2E5KA 1ZBJA 4LUDA 1NG2A 2J6OA 1UTIA 2LQWA 1AWOA 1K9AA 4KRTA 2DRMA 2EYYA 1YWOA 4HXJA 2DYBA 4WCIA 2MIOA 2ED0A 2XMFA 1OPLA 2RQUA 2DBKA 1A0NB 1NYGA 1ABOA 2G6FX 5I11A 2CH4W 4OMMA 1GBQA 1GRIA 2KGTA 2EKHA 2EVRA 1LCKA 3LH5A 2O9VA 4LE9A 2LJ1A 1NLPC 1PRLC 1OV3A 2GBQA 2YUPA 5FWCA 2FPEA 4OMNA 2FEIA 4J9IA 3UF4A 1VYTA 1X2KA 2CSIA 2LP5A 3REAB 2A37A 2K7AA 1U06A 3VS0A 1QWEA 2KBTA 1U3OA 2F2XA 2RMOA 2D8JA 2QDLA 2RN8A 2GGRA 1K1ZA 2RQWA 4J9GA 3I35A 2JTEA 2O2OA 1MV0B 1H8KA 1KFZA 2C0OA 2KXDA 5ECAA 1M3CA 1WXUA 2OI3A 2EW3A 3VS6A 1AOJA 1Z9QA 2DL4A 2LJ0A 4RTUA 3M0TA 2ED1A 1Y57A 2K2MA 2CDTA 2KT8A 2SEMA 2CT3A 1YCSB 5IXBA 1WIEA 1X6BA 4E6RA 2HSPA 1UJ0A 4RTXA 2LZ6B 2W0ZA 2PTKA 1NEGA 3M0SA 2JW4A
chains in the Genus database with same CATH superfamily
1PG5B 3EG9A 4ZN1A 1JQQA 3J81E 1IXDA 2LMJA 1R0CB 1KC8R 1K73R 1SRLA 5FLXE 1WFWA 3QJYA 1VQ8Q 2CZ6B 2QXFA 1Q7YC 4FCYA 1VQKQ 4M78D 4BI3A 2BZXA 1M27C 1R77A 2YUQA 2DERA 3CPWS 2EYZA 4LDXA 1WHGA 2DRKA 3CCQA 2DVJA 3S6WA 4E7ZA 3EG0A 4E7LA 1FWZA 3R6OA 4DBHA 3J7AF 1RI9A 3CMEQ 1O75A 1RLPC 3QG1A 4J7IA 1JRIA 5FU6C 5FU6B 1I8FA 1W1FA 3GLXA 4LDVA 3Q1JA 8AT1B 1LOJA 1BI2A 4PJOF 1PRMC 4M78F 4XTVA 4L5GA 2DD5A 1WPYA 1KIKA 1M1KU 2LTOA 1WGSA 4PFPA 2JOYA 2RQVA 3CCQT 1YHQT 4MDWA 1E6HA 4X1VA 5LJ3e 1PM3A 1WLPB 3OYAA 2MAMA 4HVWA 2HKNA 1QVGP 1H3HA 5GAOp 3QJ6A 1KQSP 3OSVA 5KE2A 1HK9A 4J9CA 2X3WD 4B6MA 2XICA 1U1SA 4FM4B 1H641 1XNIA 1VIEA 1UGVA 1I1JA 4XU1A 3H9NA 2KMTA 2K3BA 2VYTA 2ZAEA 2MYSA 1BKBA 1ZBXA 1BI3A 5KYUB 3X20B 3JCMd 4M77F 1N6AA 1RLQC 3CCJT 3JCMf 1XJWB 2NUPB 5GAN6 3OBWA 3CXCS 1M2VA 2QASA 2H3JA 2LX7A 5A0DA 4J83A 2LCCA 4FL6A 4C5IA 4LNPA 1VQLT 1UDLA 2VWFA 1WJRA 4JRKA 5AT1B 1W6XA 1JJ2S 2VGNA 2HNIA 4A4HA 1GCQA 1VQMT 1G2BA 3A8GB 2OJ2A 4M7AE 1LNXA 2X4XA 4DQ2A 4J9BA 2J06A 1AZEA 1WQWA 2X35A 3QSUA 4XU3A 3QWXX 2MF2A 1NYFA 5LJ3f 3EGXB 5CAIA 3BE3A 2EFIA 3CC2Q 3OBYA 3S3NA 4BDYA 2D6FA 2J05A 1FX7A 4AT1B 3VYGA 1UECA 2KK4A 1JJ2A 5IN1A 1VQ4Q 5DLQE 2CP3A 4M77B 4JDSA 4M77C 1UUEA 4PFZA 3PTAA 4M78G 5GAOm 5CQXA 2EQJA 3I56Q 3G71Q 4Y91A 1M30A 2G3RA 5LJ5g 2E6NA 2DILA 4GLMA 5CKHA 1VQ8A 3C12A 3CPWA 2KNBB 2CUBA 2RF0A 3CCVT 3EFSA 1W4SA 1T3LA 1N8RU 5LJ3d 2HL5C 4PLLA 3WXMB 1RUWA 4LUEA 2RK1A 1K9MR 4J8OA 1HD3A 2RO0A 2NWMA 4KBMB 4C0GA 2OTJQ 2LVMA 1SF9A 5GAMd 3LGFA 2YSQA 2AKKA 3INZA 5CO7A 3RR6A 2P0PA 1UFFA 5CIUA 3UA6A 1CSKA 2JMCA 4IIMA 2CP5A 4IUUA 3OQ5A 2E70A 4AFUC 4C5EA 1RAGB 4HCBA 4X34A 3HRUA 3EHQA 2KAFA 3H6ZA 2K5LA 3EFRA 1VQ6T 3PE0A 2O88A 1Z9ZA 1FYNA 2FZGB 3G6EA 3CBOA 4OMQA 1BIBA 4FIBA 2XG8D 3RBBB 2D0QB 2O01E 1VQPA 2HD0A 3CMET 4C8QB 4C8QC 1I5LA 3OYIA 1I0CA 2O31A 3P8BB 3CCEQ 4CI0C 1TS9A 4C92A 4E7JA 2HCKA 1V1CA 1JXMA 3MEAA 1MMNA 4XU2A 1Q86U 2QDYB 4P5NA 3JCMh 1OEBA 3EGXA 4RTTA 3CCQQ 1E7OA 4V2SA 1D1BA 4XTXA 3H0FA 3X26B 3CMEA 2AIRB 1XQHA 4M75G 2LJ3A 1TSFA 2F69A 3CQTA 2OTLQ 1WX6A 3JCMb 4ZGDB 1TWBA 3E9FA 4QQDA 1Y71A 3X28B 3LW5E 3G4SA 3VU3C 1IHVA 1KSWA 3LWHA 1UGPB 2K4YA 1PSFA 3OYGA 9ATCB 1MGQA 2KYBA 3GP8A 1Q95G 2M51A 2E64A 2D8HA 3PMIA 3CCSQ 5LJ3j 3JB9J 1FMKA 1I81A 4Z8AA 1ZX6A 4C0ZA 2ROLA 3M55A 1TXQA 2RI2A 4Y92A 3TQ7P 1D3BA 5CKBA 2AK5A 1YI2A 2FPDA 2HSEB 4R55A 2V26A 3URGA 4Z89A 4FT2A 2KYMA 2OAWA 2V8JA 3G71A 2EAYA 1UB4A 1N5ZA 2FL7A 2KRSA 2O4XB 5GAOq 1N8RC 3LX7A 3BFMA 2M0YA 1OX8A 2NYSA 3S3OA 1QCFA 3HRSA 1VQNA 2YRVA 2DJZA 3WVEB 4F04B 3T9NA 1WHHA 2E5QA 3P8DA 2DZ9A 3CCVA 4ZTJA 3A8MB 2L8DA 2NLUA 4LUDA 1Q81C 2J6OA 1AWOA 2LQWA 4KRTA 2RHIA 4WCIA 1OZ2A 2DEUA 2ED0A 3CCLT 2RQUA 3PT9A 2CZ1B 2DBKA 4Z02A 1MMAA 4C0DB 4C0DC 3JCMP 1V29B 3KUFA 3JCMe 4DOWA 2KGTA 3OYFA 3L1AA 3GOXA 3CCRQ 1LCKA 2QTVA 5HK0A 1S72T 1OV3A 2YUPA 1VQOT 2FEIA 5L8RE 4J9IA 1IZ6A 2HZYA 3PNWC 3OYBA 3V8KA 4XTZA 5GAOl 2K7AA 1KHIA 4F7UB 2KBTA 4F7UE 2RMOA 2EQUA 2D8JA 2HL3A 4KGVB 4KGZB 2E6ZA 2RQWA 1FXXA 3I35A 2JTEA 2EYQA 1MV0B 1VUBA 5LJ5j 2KXDA 2CZ7B 5ECAA 2LT1A 3VS6A 4J7FA 5HK3A 1AOJA 3CC7T 3M4GA 4KUDK 2DL4A 4BDZA 1SKUB 2ED1A 5KH6A 2KT8A 4D6WA 2YRDA 3NTIA 1YJWA 1VQ7T 2HSPA 1D0ZA 2C06A 4ZTFA 3M5AA 1YJ9Q 2W0ZA 2PTKA 1NEGA 3M0SA 1H3ZA 1YCYA 3PVQA 1ABQA 3MP1A 1PCXA 3VS4A 4F7UA 2BZ8A 4M78C 4M78B 2FO0A 2IIMA 2LNVA 3DLLA 1M4ZA 2E1HA 1X69A 4E7SA 1N9SA 2NUZA 5J3BA 1VQ5A 3NMZC 1NZ9A 3JCMc 1WQ7A 2QTXA 2FZKB 2JJ9A 3FEOA 3G6EQ 4Y28E 3OYKA 2E41A 2DAQA 3QKJA 4OP0A 3MP8A 1RABB 2XI9A 2Y4XA 3UDCA 4HT9A 2RK2A 3M57A 1NJIR 2QA4Q 2L3QA 2A3LA 1KHCA 3RDVA 4PJOD 5LJ5h 2DPPB 4AG1C 3MPUB 2O4XA 2PU9B 4DEXA 1K8AC 2JTFA 2MWPA 3CCVQ 3F70A 4ESRA 1V76A 2JS2A 3UT1A 3OW2P 1ZLMA 3QZ5B 4OVAA 3L2WA 1T3SA 3U23A 3EH1A 4OB1B 1QW1A 2CP6A 1BK2A 5IHIA 3META 2A0FB 3MHXA 4RG8A 1EZZB 2E12A 3CBMA 4OGCA 1JXOA 1XOVA 4J9FA 4AFZC 2EGCA 3V7CA 4WTOB 2L0AA 2R5AA 5FU7C 2J7IA 5FU7B 3E2UA 1Y0MA 3J80E 2SRCA 3OYYA 1T0JA 7AT1B 3EG1A 1LJOA 3OYEA 3H8ZA 4JS4A 2Y90A 5KCOA 1K73C 3ASKA 2LT4A 3OW2A 1VQNT 2GCXA 1K4US 1VQLQ 4R56A 3KXTA 1YIJT 1QCOA 1S72A 4RKUE 1VQNQ 3NFCA 2M16A 5GANj 3CXCA 3ZEHA 5I22A 4X9CA 1I4K1 4JZ3A 4N4HA 2FZCB 2KEAA 2JM8A 2ESWA 1VQ9Q 3CCUT 1VQ7A 1U5SA 3MCAB 2H8HA 3CCUQ 2FRWA 2JTMA 4M75B 4M75C 1YJ9A 4BD3A 1NPRA 3VUBA 4L6V5 3P8HA 2RJFA 4LDWA 2EJ9A 2QQSA 3CCJA 3A8LB 4IUTA 4QQ6A 4EPCA 2FRYA 1KQSS 1G8XA 4EMKB 4EMKC 2CREA 5LJ3g 2VKNA 5GMKm 1BU1A 1SEMA 3UATA 1K8AR 2E3HA 2QQ9A 2PUOB 1OU8A 1VQPT 1MNDA 1VQ5Q 3TCJA 1KG1A 2LNHB 1K0XA 2AZSA 1PKSA 3EH2A 1AT1B 3TEEA 2DX1A 2O9SA 5LJ5d 2KRMA 1Q86R 3JV3A 2VUBA 1M90C 3VRYA 1YIJQ 1X27A 4C8QF 2QA4A 1PD0A 1QVPA 4A4GA 4K11A 1B07A 5A0GA 1BI0A 4B9WA 1B7TA 5GANh 2DXCA 3UA7A 1Q7YU 1P92A 1Q82U 3EG3A 4M4ZA 3OMGA 2MI6A 2E65A 2JUFA 3KFVA 3CC4Q 4C8QA 2CZ0B 1BIAA 2AZVA 5AYFA 4JRQA 4EMGA 4FW2A 4HVVA 1QVGA 2QQAA 1UG1A 2D9TA 5GANg 3M0RA 4PJOE 2A36A 2QQBA 4NL2A 4ATOA 2F2VA 3C0CA 1M5Q1 2HDAA 3CCLQ 1YJNQ 4O5VA 1WA7A 4II1A 1KD1R 4XQ3A 3RKXA 3GIBA 5KYYB 2ZPEB 2AKLA 3C95A 2LQKA 2DETA 1BYMA 6AT1B 4FYWB 4ZGEB 4C92D 2JNGA 2MK5A 3DLMA 3HTRA 4F17A 1TOVA 3L2RA 3V7SA 4HA8A 2QEXQ 4DBRA 1D1CA 3TSWA 1S72Q 4BACA 2CGHA 2RI5A 5KYWA 3SEMA 3RKWA 1PSEA 1VQ9A 1NM7A 4MMLA 2PVDB 1Q86C 2DF6A 3OYCA 3LYIA 2OTJT 4FW1A 2QA4T 3EFOB 1M90R 2P4RA 2DK3A 1G3YA 4DBQA 2R5MA 2DBMA 2GNCA 3RERA 3OMCA 3ULRB 3QYHB 2HEQA 3HHTB 1DJ7B 4E7HA 4PNOA 3N5BB 2GF7A 2XU8A 4LD9K 4RTWA 3E9GA 1M2OA 4CC2A 1D0XA 3VS7A 3OS1A 3CC2A 4UC4A 2XIDA 3GPLA 4IKFA 2JXBA 1UGRB 2ECZA 3DKMA 1WXBA 4D8DA 3HSBA 1Y07A 2E5KA 3LWIA 1UTIA 1K9AA 2EYYA 4HXJA 5GMKh 2DYBA 1YITQ 4JUVA 2XMFA 1ZSZC 1ZSZB 1A0NB 1D0YA 3QHSA 1ABOA 2E4HA 2G6FX 2CH4W 3DB4A 2QGGA 2HAXA 2HBPA 3MEWA 2EVRA 1YJNT 2LJ1A 2GBQA 4M75A 2ZGWA 4N4IA 4XTUA 4OGEA 1VYTA 3QDFA 4IUQA 2EQMA 1X2KA 1VQ5T 2RB6A 2CYZB 1EIFA 4EMKA 4NS5A 1F1BB 3OS0A 2X4YA 3VS0A 3HP9A 3EG9B 2RHZA 2RN8A 2DXTA 1K1ZA 1VQMA 1ACMB 3A5ZB 1KFZA 2C0OA 4NOYA 3LGLA 4J6YA 2QG9B 1Z9QA 2RH2A 5GAN7 2LJ0A 4RTUA 1QQJA 1Y57A 3X25B 2CDTA 4M75E 5DM7R 5GMKl 2YLBA 5IXBA 1X6BA 3A8OB 4RTXA 1X01A 2LZ6B 2K3YA 5GAN3 1M90U 2JN0A 4M7DC 4M7DB 2OX7A 1Y7XA 3CCEA 1RAIB 2DNUA 4QT7A 4AFQC 4XK8E 1YIJA 4M7DA 3OYLA 2A7YA 1X43A 2Z0WA 5KYXA 3JCMV 2CS7A 1G83A 1W2BS 5LL6S 4J6WA 3JB9H 1JO8A 3LH0A 4HKEA 2QK0A 5I21A 5HY6A 4CC7A 1WHLA 4F16A 2LCSA 1S1NA 3CMAA 4ZN3A 5GMKe 4BUGA 3OYMA 3CC4A 2LX9A 5KYWB 2WACA 3CBPA 3VJPA 2KVQG 1VQOQ 2OTJA 1E6GA 5IXFA 3EAEA 1D3BB 3GBQA 1OYXA 2RNAA 3JCMg 3CCRT 2DYIA 3AHUA 3CCMT 2CH4A 2KR3A 3UPUA 2COWA 3FDRA 3CCLA 3M9QA 1AWXA 3G1JA 1EFNA 4D8KA 3QIIA 3VS1A 3CMAT 2LQ8A 2BE9B 2ZPIB 2DMOA 1WXTA 3CCSA 2EGAA 5FRMA 1LVKA 3S3MA 1AWWA 3EGUA 2KRNA 2DA9A 3I55T 2JT4A 2M02A 2BE7D 2RD1A 3O8VA 2BKDN 3M0UA 2YRCA 4MMKA 4LXCA 4PJNA 1NLOC 2L5QA 4E2FB 2P0QA 1M1FA 2IG0A 3OYDA 3MKDA 1JB0E 1YHQA 2DIQA 3JB9D 1PHTA 2OAUA 5KYUA 3RMSA 2EIFA 1WI7A 5IT9E 3REBB 2JMAA 4QQGA 3ZL7C 2DEQA 2FVUA 1RAAB 4AG2C 3CC7A 4XU0A 1M8VA 3PFSA 1TUDA 2LC4A 3OS5A 4QKUA 2GFUA 2RQRA 3H0IA 1MUZA 1M9SA 3RMQA 2FYKA 4BI4A 4O6JA 4ZGJB 1FMWA 2FPFA 3JCMX 3G4SQ 1VQMQ 4FYYB 4M7AB 4M7AC 1HJDA 2BZYA 3MP6A 2D1XA 3NGPA 2CP0A 1ZSGA 3VS5A 4A4EA 3G4ST 2X9HA 4LDUA 1I07A 1G3WA 2IVWA 3CCRA 2JM9A 2NUPA 1OULA 5EG2A 3JCMQ 2CSQA 1AWJA 2JS0A 2FB7A 4OMLA 4YTLA 4M75D 1VQ4T 3I55Q 3JRZA 1KD1C 3CD6A 1W70A 2EGEA 1PKTA 2VB6A 2EYWA 2F5TX 1YI2Q 4PKCC 2XDPA 1UHCA 3WVDB 2DL7A 4C8QD 2B86A 2V8KA 5GMKi 2IPOB 2RQTA 2WSCE 1VA7A 1YITA 1GCPA 3OYHA 2DKGA 4CC4B 1K73U 1QKXA 3I56T 2DTHA 4RMOA 1X75C 1RACB 2EJGA 4BI8B 1BB9A 3FIFA 2ATCB 3M59A 3EG2A 4C0FA 2K57A 3QYGB 4JLIA 2L3RA 4VUBA 1YJWT 2ABLA 1JBMA 2BTTA 3V7RA 2DZCA 4AFSC 5KCHA 1TUGB 2ZPBB 2ZPFB 2EPDA 1KD1U 3SB2A 4JJBA 3SDZA 2D0NA 5EC7A 4FYXB 2K6DA 1YN8A 4M7AG 2A08A 3JB9F 1HSQA 5HKCA 1K76A 1YNZA 3SD4A 4FT4A 3FJPA 5GAMf 1Y96B 4RCCA 5L23A 2LCLA 4J9EA 2ROTA 1GBRA 2EQIA 1FMVA 5KYYA 2DO3A 3NPFA 2JZ2A 1VYUA 1K9MU 1BCOA 4FSSA 1ZUYA 2XKOC 4GLKA 4CC3A 2KXCA 1NEBA 2KI7A 2M9UA 3M56A 1TTHB 3FRNA 4PL6A 1UGQB 1ZSZA 1VYVA 3G7ZA 1BBZA 4L59A 1YHQQ 4JZ4A 1RAEB 3JB9G 3GNGA 4PJLA 4OB3B 5CVIA 2PVOB 5FW9A 1CKAA 5D7UA 3I5RA 3BY7A 4LN2A 2KSSA 3MEUA 5FROA 2VXEA 2K3XA 4BE0A 4C92C 4C92B 4RTZA 3EHRA 1SSFA 1PWTA 3VS3A 2KQWA 5FWBA 2B8AA 4LD6A 4F7UG 3ER0A 4JJCA 2RI3A 5DY9A 3CMAQ 4XTYA 1GFCA 3UWNA 1QVGS 1G5VA 3TSZA 4J6XA 3EFOA 5I2SA 1M1KR 4HT8A 2DL3A 2KE9A 2XK0A 2BUDA 4X9DA 1RAFB 2YXYA 3PVLA 5A2QE 2RJDA 2GQVA 3HFOA 1QP3A 2GQIA 3TU4K 3C4SA 2HQHA 5GAMh 2W10A 3CCMA 2CP7A 2ENMA 1M1GA 2DFUA 2KROA 2RHXA 4JLGA 4M7AA 2F2WA 3CD6Q 1GL5A 1IHWA 3QWYA 1M3BA 3NTKA 1VQ4A 1UE9A 3M54A 4J9HA 4ANJA 3RNJA 1AVZC 2E10A 1G3SA 1O9SA 5GAMg 4C92F 2EJFA 4C5GA 2MOXA 4M7AF 1T0HA 1M3AA 1AHJB 3MO8A 3GF5A 2YUOA 5GJWB 4QVDA 2RJCA 3OSSC 4HCKA 3M58A 2DXBA 2WSEE 3JAME 2CT4A 1H92A 3OY9A 2J6KA 3E19A 2OTLT 4KT0E 1ZBJA 2RM4A 1OU9A 3QXEB 2LRQA 5CKEA 1WJSA 1YJ9T 2DRMA 2MIOA 5CR2A 1OPLA 4BB7A 3OB9A 1NYGA 3CXCP 5CKFA 2XD0A 2RHYA 4XTWA 5GAOr 1GRIA 1QP2A 2P4TA 4PJMA 4OB2B 2X4WA 3AT1B 2NUTA 4FSXA 4N0AC 3OYJA 3LH5A 1NJIC 1NBEB 5CCAA 2H3EB 4M77A 5FWCA 3VUZA 2P0KA 3UF4A 5DLOA 1VQ9T 4MZMA 3I55A 2DXUA 3G6ET 1QVFP 2QYZA 2A37A 2WSFE 1U06A 2KDSA 1QWEA 4E47A 2FHDA 3HKSA 2F2XA 5CK9A 2QDLA 4M78A 3I56A 3QBYA 4EDUA 5GAMe 4JS5A 1VQLA 1EX4A 4OMFB 1C6VX 3VV0A 2CKKA 5KE3A 2MWOA 1G3TA 4C92E 4M77E 2SEMA 2CT3A 1YCSB 2M0OA 1C1AA 5GANd 3GNFB 2YLCA 4DBFA 4E6RA 1UJ0A 3D7SB 2OTLA 2ZZDA 3CCUA 4QVZA 3QDRB 2ZPHB 4C92G 4ELYC 2VVKA 5A0LA 5GMKj 1OPKA 1QLYA 4M78E 3JCMJ 4KULA 2QQRA 1JJ2P 3LLRA 5D6WA 3SHWA 1OOTA 2VASA 3CCMQ 4KUIA 1J3TA 4E7KA 4OMPA 3SFMA 5LJ5f 5GANf 1MHNA 1SHGA 1SG5A 2V1QA 3JSCA 1PD1A 4RTVA 2CUDA 4MZPA 3HRTA 2EYXA 4A53A 2P84A 3PMTA 1VQPQ 1QVFA 5GJVB 2VV5A 1ZQ1A 2X3XD 3CC4T 1BI1A 1BCMA 4PFOA 2QEXA 3BDUA 2DIGA 3FB9A 1QCNA 1OI1A 2VGMA 3ME9A 1IGQA 2YT6A 4M7DD 1IRXA 4N0AA 2V1RA 2X4JA 4PJOA 3L2QA 2VC8A 1RADB 2LDMA 1WHKA 3FLGA 1W2BA 3CCET 2K2VA 2QGFB 4A54A 2RA2A 1RL2A 2EQKA 2F1LA 2FG0A 4PJOB 4PJOC 1K9MC 3TREA 5CQYA 1TUCA 4KGXB 4RTYA 1YFNA 1HXDA 4CRIA 5LJ5e 2PZ1A 1YITT 3RKYA 4M75F 5HCKA 4DA4A 1N27A 1NJIU 1HYOA 3CEYA 3ZBDA 2QEXT 3M53A 2YWWA 2HBWA 1K0SA 3A1PA 3O5ZA 3QPHA 1WDXA 4M7AD 2DVEA 5GAN4 4RUGA 2YUNA 1QKWA 4A4KA 1WHMA 2KT1A 4JRPA 3RIRA 3L2UA 3X24B 1ZHIA 2YHTA 3CPWP 1AEYA 1KC8C 2L89A 5CKDA 4F14A 3CCST 1Q7YR 2PNIA 4XAXB 5IH2A 5D6XA 2DM1A 1VQ6Q 1OZ3A 1QMCA 4IUPA 1WYXA 3H0HA 2LQNA 4JJDA 4Z88A 4ORZA 2X51A 1IGUA 4J9DA 3VKIA 4MDXA 1YP5A 3M0QA 2AHJB 3V8LA 1M2VB 3PIOA 1ZA1B 1JEGA 4M77D 2XDDA 1SSHA 2QAZA 1YJWQ 1AZGB 1LPLA 3I9QA 3L42A 5GAN2 1UEBA 2COZA 4DEYA 4FYVB 3A98A 1GCQC 1X6GA 3EGDA 3TVTA 4A63B 1M1KC 3PIPA 3H41A 4LDYA 3CC2T 1U8RA 1N9RA 2DLPA 2F5KA 3MEVA 2K9GA 5GAN8 4A4FA 3M4YA 2C0TA 3SWNB 3SWNC 4HVUA 1I5OB 2EKOA 5GAOn 2EBPA 2DL8A 3BW1A 2MMPA 3VS2A 3BDLA 1SPKA 3SWNA 1GFDA 1OQKA 2ZCFB 3G71T 2DE0X 4EMHA 2M1HA 1AD5A 2VXFA 1TH7A 1B3QA 1NE8A 3CD6T 5J26A 3EGDB 5C6SA 3VRZA 2I2LA 4ELZC 1M8MA 4RCBA 1SRMA 2R57A 1TG0A 3THKA 5IAYA 4GBQA 1SHFA 4AMCA 4E7IA 1VQKA 5IHKA 3R6NA 4R0KA 3NTHA 3IQLA 1QVFS 3QUIA 2XDBA 4PJOG 2MCNA 4KH0B 4J5YA 2ZPGB 1C0MA 2CP2A 1WNLA 3L2ZA 3NHNA 4NL3A 1D1AA 1D09B 1IO6A 2DTIA 1UHFA 4EIKA 1VQOA 1MMGA 1NPPA 2K5IA 2L2PA 1VQ8T 1VQKT 5IHNA 3L2VA 5GANe 4RG2A 1Q81R 2A28A 1U1TA 3E1SA 4QVCA 2RPNA 2HQXA 4PLIA 2GFAA 3FJ5A 1Q82R 2JVVA 4OMOA 2GTJA 4JJNK 3DB3A 4M77G 4N4GA 4M7DE 1K8AU 1YWPA 5KYXB 4MZTA 3JB9I 4DOVA 1PC0A 4C5HA 2C0IA 1PNJA 1UJYA 2L3SA 2XHCA 4IIOA 3JCMW 2HQEA 2L3PA 3I5SA 2HMAA 5KYNA 1VQ6A 1CKBA 1KJWA 5GAN5 2K79A 4FU6A 1RI0A 2GTOA 2YDLA 4OF1A 1R0BG 1WJQA 3FC3A 5J39A 2E3IA 3CC7Q 1QWFA 1IREB 2DL5A 3RESA 1YI2T 3M0PA 3A8HB 1XTDA 5M9OA 4BY6C 4BY6B 1X2QA 1JU5C 4C8QG 1ZUKA 2I0NA 2EWNA 1ZUUA 1KC8U 1KK7A 2DJQA 4JPBW 4PK4A 3VYHB 1Q81U 1VIFA 4M7DG 3ZFJA 1X6OA 1MV3A 3PGGA 1WHJA 1TU0B 3OYNA 1WZOA 3OS2A 4QW2A 1ARKA 2RHUA 2J6FA 3CPFA 2BIVA 2R58A 2COYA 2K5FA 4ZNXA 4TVRA 1NG2A 1R8OB 4GY5A 2PVGB 1YWOA 4Q5WA 2Y4YA 8ATCB 2DTOA 1ZA2B 4ME7A 2PUKB 5I11A 4IURA 4F7UF 1YBYA 1GXIE 4OMMA 1GBQA 1OX9A 2MPXC 4HCCA 2DD4A 2V8IA 4M7DF 1Q82C 5D6YA 2EKHA 1MNEA 2O9VA 4LE9A 1NLPC 1PRLC 1KQ1A 5GAMj 2FPEA 4OMNA 3QO3A 5LJ3h 3V8JA 5FRNA 4WF2A 1RAHB 1B34B 1VQ7Q 2CSIA 2LP5A 2PQWA 5I2MA 3OA6A 1Y96A 3KBGA 3REAB 1W2BP 1B34A 4HCZA 4B9XA 1IB8A 3CCJQ 1U3OA 2GGRA 2AT1B 4J9GA 4OB0B 1YJNA 2O2OA 4C8QE 3OW2S 1UGSB 1H8KA 3C94A 1MMDA 2NUTB 2RJEA 1M3CA 4JRIA 1WXUA 2EW3A 2HKQB 2OI3A 3HFNA 4IUVA 3RUXA 3MJXA 3M0TA 3HL8A 2K2MA 2QI2A 3QZ9B 1KQ2A 5C0MA 4KH1B 4BE2A 1WIEA 1VOMA 4PJJA 1KQSA 4BE1A 3HPWA 1N8RR 2KY9A 2JW4A
chains in the Genus database with same CATH topology
3PVQA 1ABQA 2VVKA 3VS4A 2DNUA 1OPKA 4QT7A 1JQQA 1QLYA 4AFQC 2BZ8A 1X43A 2LMJA 2FO0A 1SRLA 2IIMA 1WFWA 1G83A 2BZXA 1M27C 1OOTA 3SHWA 1X69A 2YUQA 1JO8A 2EYZA 2NUZA 2DRKA 1J3TA 3NMZC 4CC7A 4OMPA 2DVJA 3EG0A 4F16A 2LCSA 1S1NA 1RI9A 1SHGA 2V1QA 4RTVA 1RLPC 2CUDA 2EYXA 5GJVB 1W1FA 1E6GA 2X3XD 5IXFA 3GBQA 1PRMC 2RNAA 1KIKA 2CH4A 2KR3A 2RQVA 2L3QA 1AWXA 1E6HA 4X1VA 1EFNA 4D8KA 3VS1A 1WLPB 2DMOA 1WXTA 4AG1C 2EGAA 2YT6A 4HVWA 1H3HA 2V1RA 4DEXA 1AWWA 3EGUA 4J9CA 2KRNA 2X3WD 4ESRA 2DA9A 2JS2A 1ZLMA 2JT4A 1UGVA 2FG0A 1T3SA 3U23A 3M0UA 1I1JA 1TUCA 4RTYA 1NLOC 2K3BA 1BK2A 5IHIA 2PZ1A 1RLQC 5HCKA 1PHTA 1JXOA 1XOVA 1WI7A 2HBWA 4J9FA 1K0SA 3REBB 2JMAA 3ZL7C 4AFZC 2EGCA 2LX7A 3O5ZA 1WDXA 4LNPA 2L0AA 4AG2C 1UDLA 4RUGA 2J7IA 1Y0MA 2YUNA 2VWFA 1QKWA 2SRCA 1TUDA 2KT1A 1W6XA 1T0JA 2RQRA 3H0IA 1GCQA 3EG1A 1MUZA 1G2BA 1AEYA 4F14A 2FPFA 1K4US 2PNIA 1HJDA 2BZYA 2D1XA 2OJ2A 3NGPA 5IH2A 1ZSGA 3VS5A 4J9BA 2DM1A 2J06A 1AZEA 1WYXA 3H0HA 1I07A 2LQNA 3QWXX 5I22A 4JJDA 4Z88A 1NYFA 4ORZA 4J9DA 2JM9A 1YP5A 4JZ3A 2CSQA 3M0QA 1AWJA 2KEAA 2JS0A 2JM8A 2ESWA 4OMLA 1JEGA 2J05A 1U5SA 1W70A 1SSHA 2EGEA 1PKTA 2EYWA 1AZGB 3I9QA 1UECA 2H8HA 1UHCA 2FRWA 2DL7A 4DEYA 1UUEA 3A98A 1GCQC 2B86A 1X6GA 2RQTA 3TVTA 1VA7A 1GCPA 2FRYA 4A63B 2CREA 1M30A 2VKNA 1BU1A 3H41A 4CC4B 1SEMA 2DILA 4GLMA 2DLPA 1QKXA 3UATA 2K9GA 2KNBB 2C0TA 2CUBA 2RF0A 4HVUA 1T3LA 2EBPA 2LNHB 1K0XA 2DL8A 3VS2A 1BB9A 1RUWA 1SPKA 4LUEA 2AZSA 3EG2A 1GFDA 1PKSA 2DE0X 1HD3A 2DX1A 2NWMA 2O9SA 2ABLA 1AD5A 2KRMA 2BTTA 1B3QA 4AFSC 2EPDA 3JV3A 4JJBA 2D0NA 2YSQA 3VRZA 2AKKA 5EC7A 2K6DA 1M8MA 3VRYA 1UFFA 1SRMA 1YN8A 3UA6A 1X27A 1CSKA 1TG0A 2JMCA 4IIMA 3THKA 2A08A 4GBQA 1SHFA 1HSQA 4AFUC 1K76A 4K11A 1B07A 1YNZA 5IHKA 3EHQA 3R6NA 4R0KA 5L23A 4J9EA 2ROTA 3UA7A 3IQLA 2EQIA 1GBRA 3PE0A 2O88A 3NPFA 1VYUA 1Z9ZA 3EG3A 4FSSA 4M4ZA 1ZUYA 4CC3A 2MCNA 1FYNA 3KFVA 4OMQA 2KXCA 1NEBA 3NHNA 1IO6A 3RBBB 1UHFA 2AZVA 4EIKA 4HVVA 2L2PA 1VYVA 1BBZA 1UG1A 3M0RA 5IHNA 1I0CA 2A36A 2O31A 4JZ4A 2F2VA 3C0CA 2A28A 2HDAA 2HCKA 1V1CA 5FW9A 1CKAA 1JXMA 2RPNA 3I5RA 4LN2A 1WA7A 4RTZA 3EHRA 1PWTA 3VS3A 5FWBA 1OEBA 4RTTA 1E7OA 3FJ5A 4OMOA 3H0FA 2AKLA 2GTJA 4JJCA 1GFCA 2LJ3A 3TSZA 3CQTA 1YWPA 1WX6A 2C0IA 1PNJA 1UJYA 2DL3A 2L3SA 2KE9A 4IIOA 4F17A 1KSWA 2L3PA 3PVLA 3I5SA 3TSWA 1CKBA 1KJWA 2K79A 2GTOA 2KYBA 2YDLA 2GQIA 2M51A 2D8HA 2W10A 3SEMA 1FMKA 4Z8AA 1ZX6A 2ENMA 2ROLA 1NM7A 2KROA 4Y92A 2F2WA 1QWFA 2DF6A 1GL5A 2AK5A 2FPDA 2DL5A 1M3BA 3QWYA 1UE9A 4J9HA 3M0PA 4Z89A 2KYMA 2P4RA 2OAWA 3RNJA 1AVZC 1X2QA 2DBMA 2GNCA 1JU5C 3ULRB 1N5ZA 2MOXA 2KRSA 1ZUKA 2HEQA 2I0NA 2M0YA 1T0HA 1ZUUA 1M3AA 1QCFA 2DJQA 4JPBW 2YUOA 4RTWA 5GJWB 1MV3A 4CC2A 3VS7A 4HCKA 2JXBA 2ECZA 1ARKA 2CT4A 1H92A 1WXBA 2J6FA 2J6KA 4D8DA 4ZNXA 2E5KA 1ZBJA 4LUDA 1NG2A 2J6OA 1UTIA 2LQWA 1AWOA 1K9AA 4KRTA 2DRMA 2EYYA 1YWOA 4HXJA 2DYBA 4WCIA 2MIOA 2ED0A 2XMFA 1OPLA 2RQUA 2DBKA 1A0NB 1NYGA 1ABOA 2G6FX 5I11A 2CH4W 4OMMA 1GBQA 1GRIA 2KGTA 2EKHA 2EVRA 1LCKA 3LH5A 2O9VA 4LE9A 2LJ1A 1NLPC 1PRLC 1OV3A 2GBQA 2YUPA 5FWCA 2FPEA 4OMNA 2FEIA 4J9IA 3UF4A 1VYTA 1X2KA 2CSIA 2LP5A 3REAB 2A37A 2K7AA 1U06A 3VS0A 1QWEA 2KBTA 1U3OA 2F2XA 2RMOA 2D8JA 2QDLA 2RN8A 2GGRA 1K1ZA 2RQWA 4J9GA 3I35A 2JTEA 2O2OA 1MV0B 1H8KA 1KFZA 2C0OA 2KXDA 5ECAA 1M3CA 1WXUA 2OI3A 2EW3A 3VS6A 1AOJA 1Z9QA 2DL4A 2LJ0A 4RTUA 3M0TA 2ED1A 1Y57A 2K2MA 2CDTA 2KT8A 2SEMA 2CT3A 1YCSB 5IXBA 1WIEA 1X6BA 4E6RA 2HSPA 1UJ0A 4RTXA 2LZ6B 2W0ZA 2PTKA 1NEGA 3M0SA 2JW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVQ A;  1ABQ A;  2VVK A;  3VS4 A;  2DNU A;  1OPK A;  4QT7 A;  1JQQ A;  1QLY A;  4AFQ C;  2BZ8 A;  1X43 A;  2LMJ A;  2FO0 A;  1SRL A;  2IIM A;  1WFW A;  1G83 A;  2BZX A;  1M27 C;  1OOT A;  3SHW A;  1X69 A;  2YUQ A;  1JO8 A;  2EYZ A;  2NUZ A;  2DRK A;  1J3T A;  3NMZ C;  4CC7 A;  4OMP A;  2DVJ A;  3EG0 A;  4F16 A;  2LCS A;  1S1N A;  1RI9 A;  1SHG A;  2V1Q A;  4RTV A;  1RLP C;  2CUD A;  2EYX A;  5GJV B;  1W1F A;  1E6G A;  2X3X D;  5IXF A;  3GBQ A;  1PRM C;  2RNA A;  1KIK A;  2CH4 A;  2KR3 A;  2RQV A;  2L3Q A;  1AWX A;  1E6H A;  4X1V A;  1EFN A;  4D8K A;  3VS1 A;  1WLP B;  2DMO A;  1WXT A;  4AG1 C;  2EGA A;  2YT6 A;  4HVW A;  1H3H A;  2V1R A;  4DEX A;  1AWW A;  3EGU A;  4J9C A;  2KRN A;  2X3W D;  4ESR A;  2DA9 A;  2JS2 A;  1ZLM A;  2JT4 A;  1UGV A;  2FG0 A;  1T3S A;  3U23 A;  3M0U A;  1I1J A;  1TUC A;  4RTY A;  1NLO C;  2K3B A;  1BK2 A;  5IHI A;  2PZ1 A;  1RLQ C;  5HCK A;  1PHT A;  1JXO A;  1XOV A;  1WI7 A;  2HBW A;  4J9F A;  1K0S A;  3REB B;  2JMA A;  3ZL7 C;  4AFZ C;  2EGC A;  2LX7 A;  3O5Z A;  1WDX A;  4LNP A;  2L0A A;  4AG2 C;  1UDL A;  4RUG A;  2J7I A;  1Y0M A;  2YUN A;  2VWF A;  1QKW A;  2SRC A;  1TUD A;  2KT1 A;  1W6X A;  1T0J A;  2RQR A;  3H0I A;  1GCQ A;  3EG1 A;  1MUZ A;  1G2B A;  1AEY A;  4F14 A;  2FPF A;  1K4U S;  2PNI A;  1HJD A;  2BZY A;  2D1X A;  2OJ2 A;  3NGP A;  5IH2 A;  1ZSG A;  3VS5 A;  4J9B A;  2DM1 A;  2J06 A;  1AZE A;  1WYX A;  3H0H A;  1I07 A;  2LQN A;  3QWX X;  5I22 A;  4JJD A;  4Z88 A;  1NYF A;  4ORZ A;  4J9D A;  2JM9 A;  1YP5 A;  4JZ3 A;  2CSQ A;  3M0Q A;  1AWJ A;  2KEA A;  2JS0 A;  2JM8 A;  2ESW A;  4OML A;  1JEG A;  2J05 A;  1U5S A;  1W70 A;  1SSH A;  2EGE A;  1PKT A;  2EYW A;  1AZG B;  3I9Q A;  1UEC A;  2H8H A;  1UHC A;  2FRW A;  2DL7 A;  4DEY A;  1UUE A;  3A98 A;  1GCQ C;  2B86 A;  1X6G A;  2RQT A;  3TVT A;  1VA7 A;  1GCP A;  2FRY A;  4A63 B;  2CRE A;  1M30 A;  2VKN A;  1BU1 A;  3H41 A;  4CC4 B;  1SEM A;  2DIL A;  4GLM A;  2DLP A;  1QKX A;  3UAT A;  2K9G A;  2KNB B;  2C0T A;  2CUB A;  2RF0 A;  4HVU A;  1T3L A;  2EBP A;  2LNH B;  1K0X A;  2DL8 A;  3VS2 A;  1BB9 A;  1RUW A;  1SPK A;  4LUE A;  2AZS A;  3EG2 A;  1GFD A;  1PKS A;  2DE0 X;  1HD3 A;  2DX1 A;  2NWM A;  2O9S A;  2ABL A;  1AD5 A;  2KRM A;  2BTT A;  1B3Q A;  4AFS C;  2EPD A;  3JV3 A;  4JJB A;  2D0N A;  2YSQ A;  3VRZ A;  2AKK A;  5EC7 A;  2K6D A;  1M8M A;  3VRY A;  1UFF A;  1SRM A;  1YN8 A;  3UA6 A;  1X27 A;  1CSK A;  1TG0 A;  2JMC A;  4IIM A;  3THK A;  2A08 A;  4GBQ A;  1SHF A;  1HSQ A;  4AFU C;  1K76 A;  4K11 A;  1B07 A;  1YNZ A;  5IHK A;  3EHQ A;  3R6N A;  4R0K A;  5L23 A;  4J9E A;  2ROT A;  3UA7 A;  3IQL A;  2EQI A;  1GBR A;  3PE0 A;  2O88 A;  3NPF A;  1VYU A;  1Z9Z A;  3EG3 A;  4FSS A;  4M4Z A;  1ZUY A;  4CC3 A;  2MCN A;  1FYN A;  3KFV A;  4OMQ A;  2KXC A;  1NEB A;  3NHN A;  1IO6 A;  3RBB B;  1UHF A;  2AZV A;  4EIK A;  4HVV A;  2L2P A;  1VYV A;  1BBZ A;  1UG1 A;  3M0R A;  5IHN A;  1I0C A;  2A36 A;  2O31 A;  4JZ4 A;  2F2V A;  3C0C A;  2A28 A;  2HDA A;  2HCK A;  1V1C A;  5FW9 A;  1CKA A;  1JXM A;  2RPN A;  3I5R A;  4LN2 A;  1WA7 A;  4RTZ A;  3EHR A;  1PWT A;  3VS3 A;  5FWB A;  1OEB A;  4RTT A;  1E7O A;  3FJ5 A;  4OMO A;  3H0F A;  2AKL A;  2GTJ A;  4JJC A;  1GFC A;  2LJ3 A;  3TSZ A;  3CQT A;  1YWP A;  1WX6 A;  2C0I A;  1PNJ A;  1UJY A;  2DL3 A;  2L3S A;  2KE9 A;  4IIO A;  4F17 A;  1KSW A;  2L3P A;  3PVL A;  3I5S A;  3TSW A;  1CKB A;  1KJW A;  2K79 A;  2GTO A;  2KYB A;  2YDL A;  2GQI A;  2M51 A;  2D8H A;  2W10 A;  3SEM A;  1FMK A;  4Z8A A;  1ZX6 A;  2ENM A;  2ROL A;  1NM7 A;  2KRO A;  4Y92 A;  2F2W A;  1QWF A;  2DF6 A;  1GL5 A;  2AK5 A;  2FPD A;  2DL5 A;  1M3B A;  3QWY A;  1UE9 A;  4J9H A;  3M0P A;  4Z89 A;  2KYM A;  2P4R A;  2OAW A;  3RNJ A;  1AVZ C;  1X2Q A;  2DBM A;  2GNC A;  1JU5 C;  3ULR B;  1N5Z A;  2MOX A;  2KRS A;  1ZUK A;  2HEQ A;  2I0N A;  2M0Y A;  1T0H A;  1ZUU A;  1M3A A;  1QCF A;  2DJQ A;  4JPB W;  2YUO A;  4RTW A;  5GJW B;  1MV3 A;  4CC2 A;  3VS7 A;  4HCK A;  2JXB A;  2ECZ A;  1ARK A;  2CT4 A;  1H92 A;  1WXB A;  2J6F A;  2J6K A;  4D8D A;  4ZNX A;  2E5K A;  1ZBJ A;  4LUD A;  1NG2 A;  2J6O A;  1UTI A;  2LQW A;  1AWO A;  1K9A A;  4KRT A;  2DRM A;  2EYY A;  1YWO A;  4HXJ A;  2DYB A;  4WCI A;  2MIO A;  2ED0 A;  2XMF A;  1OPL A;  2RQU A;  2DBK A;  1A0N B;  1NYG A;  1ABO A;  2G6F X;  5I11 A;  2CH4 W;  4OMM A;  1GBQ A;  1GRI A;  2KGT A;  2EKH A;  2EVR A;  1LCK A;  3LH5 A;  2O9V A;  4LE9 A;  2LJ1 A;  1NLP C;  1PRL C;  1OV3 A;  2GBQ A;  2YUP A;  5FWC A;  2FPE A;  4OMN A;  2FEI A;  4J9I A;  3UF4 A;  1VYT A;  1X2K A;  2CSI A;  2LP5 A;  3REA B;  2A37 A;  2K7A A;  1U06 A;  3VS0 A;  1QWE A;  2KBT A;  1U3O A;  2F2X A;  2RMO A;  2D8J A;  2QDL A;  2RN8 A;  2GGR A;  1K1Z A;  2RQW A;  4J9G A;  3I35 A;  2JTE A;  2O2O A;  1MV0 B;  1H8K A;  1KFZ A;  2C0O A;  2KXD A;  5ECA A;  1M3C A;  1WXU A;  2OI3 A;  2EW3 A;  3VS6 A;  1AOJ A;  1Z9Q A;  2DL4 A;  2LJ0 A;  4RTU A;  3M0T A;  2ED1 A;  1Y57 A;  2K2M A;  2CDT A;  2KT8 A;  2SEM A;  2CT3 A;  1YCS B;  5IXB A;  1WIE A;  1X6B A;  4E6R A;  2HSP A;  1UJ0 A;  4RTX A;  2LZ6 B;  2W0Z A;  2PTK A;  1NEG A;  3M0S A;  2JW4 A; 
#chains in the Genus database with same CATH topology
 1PG5 B;  3EG9 A;  4ZN1 A;  1JQQ A;  3J81 E;  1IXD A;  2LMJ A;  1R0C B;  1KC8 R;  1K73 R;  1SRL A;  5FLX E;  1WFW A;  3QJY A;  1VQ8 Q;  2CZ6 B;  2QXF A;  1Q7Y C;  4FCY A;  1VQK Q;  4M78 D;  4BI3 A;  2BZX A;  1M27 C;  1R77 A;  2YUQ A;  2DER A;  3CPW S;  2EYZ A;  4LDX A;  1WHG A;  2DRK A;  3CCQ A;  2DVJ A;  3S6W A;  4E7Z A;  3EG0 A;  4E7L A;  1FWZ A;  3R6O A;  4DBH A;  3J7A F;  1RI9 A;  3CME Q;  1O75 A;  1RLP C;  3QG1 A;  4J7I A;  1JRI A;  5FU6 C;  5FU6 B;  1I8F A;  1W1F A;  3GLX A;  4LDV A;  3Q1J A;  8AT1 B;  1LOJ A;  1BI2 A;  4PJO F;  1PRM C;  4M78 F;  4XTV A;  4L5G A;  2DD5 A;  1WPY A;  1KIK A;  1M1K U;  2LTO A;  1WGS A;  4PFP A;  2JOY A;  2RQV A;  3CCQ T;  1YHQ T;  4MDW A;  1E6H A;  4X1V A;  5LJ3 e;  1PM3 A;  1WLP B;  3OYA A;  2MAM A;  4HVW A;  2HKN A;  1QVG P;  1H3H A;  5GAO p;  3QJ6 A;  1KQS P;  3OSV A;  5KE2 A;  1HK9 A;  4J9C A;  2X3W D;  4B6M A;  2XIC A;  1U1S A;  4FM4 B;  1H64 1;  1XNI A;  1VIE A;  1UGV A;  1I1J A;  4XU1 A;  3H9N A;  2KMT A;  2K3B A;  2VYT A;  2ZAE A;  2MYS A;  1BKB A;  1ZBX A;  1BI3 A;  5KYU B;  3X20 B;  3JCM d;  4M77 F;  1N6A A;  1RLQ C;  3CCJ T;  3JCM f;  1XJW B;  2NUP B;  5GAN 6;  3OBW A;  3CXC S;  1M2V A;  2QAS A;  2H3J A;  2LX7 A;  5A0D A;  4J83 A;  2LCC A;  4FL6 A;  4C5I A;  4LNP A;  1VQL T;  1UDL A;  2VWF A;  1WJR A;  4JRK A;  5AT1 B;  1W6X A;  1JJ2 S;  2VGN A;  2HNI A;  4A4H A;  1GCQ A;  1VQM T;  1G2B A;  3A8G B;  2OJ2 A;  4M7A E;  1LNX A;  2X4X A;  4DQ2 A;  4J9B A;  2J06 A;  1AZE A;  1WQW A;  2X35 A;  3QSU A;  4XU3 A;  3QWX X;  2MF2 A;  1NYF A;  5LJ3 f;  3EGX B;  5CAI A;  3BE3 A;  2EFI A;  3CC2 Q;  3OBY A;  3S3N A;  4BDY A;  2D6F A;  2J05 A;  1FX7 A;  4AT1 B;  3VYG A;  1UEC A;  2KK4 A;  1JJ2 A;  5IN1 A;  1VQ4 Q;  5DLQ E;  2CP3 A;  4M77 B;  4JDS A;  4M77 C;  1UUE A;  4PFZ A;  3PTA A;  4M78 G;  5GAO m;  5CQX A;  2EQJ A;  3I56 Q;  3G71 Q;  4Y91 A;  1M30 A;  2G3R A;  5LJ5 g;  2E6N A;  2DIL A;  4GLM A;  5CKH A;  1VQ8 A;  3C12 A;  3CPW A;  2KNB B;  2CUB A;  2RF0 A;  3CCV T;  3EFS A;  1W4S A;  1T3L A;  1N8R U;  5LJ3 d;  2HL5 C;  4PLL A;  3WXM B;  1RUW A;  4LUE A;  2RK1 A;  1K9M R;  4J8O A;  1HD3 A;  2RO0 A;  2NWM A;  4KBM B;  4C0G A;  2OTJ Q;  2LVM A;  1SF9 A;  5GAM d;  3LGF A;  2YSQ A;  2AKK A;  3INZ A;  5CO7 A;  3RR6 A;  2P0P A;  1UFF A;  5CIU A;  3UA6 A;  1CSK A;  2JMC A;  4IIM A;  2CP5 A;  4IUU A;  3OQ5 A;  2E70 A;  4AFU C;  4C5E A;  1RAG B;  4HCB A;  4X34 A;  3HRU A;  3EHQ A;  2KAF A;  3H6Z A;  2K5L A;  3EFR A;  1VQ6 T;  3PE0 A;  2O88 A;  1Z9Z A;  1FYN A;  2FZG B;  3G6E A;  3CBO A;  4OMQ A;  1BIB A;  4FIB A;  2XG8 D;  3RBB B;  2D0Q B;  2O01 E;  1VQP A;  2HD0 A;  3CME T;  4C8Q B;  4C8Q C;  1I5L A;  3OYI A;  1I0C A;  2O31 A;  3P8B B;  3CCE Q;  4CI0 C;  1TS9 A;  4C92 A;  4E7J A;  2HCK A;  1V1C A;  1JXM A;  3MEA A;  1MMN A;  4XU2 A;  1Q86 U;  2QDY B;  4P5N A;  3JCM h;  1OEB A;  3EGX A;  4RTT A;  3CCQ Q;  1E7O A;  4V2S A;  1D1B A;  4XTX A;  3H0F A;  3X26 B;  3CME A;  2AIR B;  1XQH A;  4M75 G;  2LJ3 A;  1TSF A;  2F69 A;  3CQT A;  2OTL Q;  1WX6 A;  3JCM b;  4ZGD B;  1TWB A;  3E9F A;  4QQD A;  1Y71 A;  3X28 B;  3LW5 E;  3G4S A;  3VU3 C;  1IHV A;  1KSW A;  3LWH A;  1UGP B;  2K4Y A;  1PSF A;  3OYG A;  9ATC B;  1MGQ A;  2KYB A;  3GP8 A;  1Q95 G;  2M51 A;  2E64 A;  2D8H A;  3PMI A;  3CCS Q;  5LJ3 j;  3JB9 J;  1FMK A;  1I81 A;  4Z8A A;  1ZX6 A;  4C0Z A;  2ROL A;  3M55 A;  1TXQ A;  2RI2 A;  4Y92 A;  3TQ7 P;  1D3B A;  5CKB A;  2AK5 A;  1YI2 A;  2FPD A;  2HSE B;  4R55 A;  2V26 A;  3URG A;  4Z89 A;  4FT2 A;  2KYM A;  2OAW A;  2V8J A;  3G71 A;  2EAY A;  1UB4 A;  1N5Z A;  2FL7 A;  2KRS A;  2O4X B;  5GAO q;  1N8R C;  3LX7 A;  3BFM A;  2M0Y A;  1OX8 A;  2NYS A;  3S3O A;  1QCF A;  3HRS A;  1VQN A;  2YRV A;  2DJZ A;  3WVE B;  4F04 B;  3T9N A;  1WHH A;  2E5Q A;  3P8D A;  2DZ9 A;  3CCV A;  4ZTJ A;  3A8M B;  2L8D A;  2NLU A;  4LUD A;  1Q81 C;  2J6O A;  1AWO A;  2LQW A;  4KRT A;  2RHI A;  4WCI A;  1OZ2 A;  2DEU A;  2ED0 A;  3CCL T;  2RQU A;  3PT9 A;  2CZ1 B;  2DBK A;  4Z02 A;  1MMA A;  4C0D B;  4C0D C;  3JCM P;  1V29 B;  3KUF A;  3JCM e;  4DOW A;  2KGT A;  3OYF A;  3L1A A;  3GOX A;  3CCR Q;  1LCK A;  2QTV A;  5HK0 A;  1S72 T;  1OV3 A;  2YUP A;  1VQO T;  2FEI A;  5L8R E;  4J9I A;  1IZ6 A;  2HZY A;  3PNW C;  3OYB A;  3V8K A;  4XTZ A;  5GAO l;  2K7A A;  1KHI A;  4F7U B;  2KBT A;  4F7U E;  2RMO A;  2EQU A;  2D8J A;  2HL3 A;  4KGV B;  4KGZ B;  2E6Z A;  2RQW A;  1FXX A;  3I35 A;  2JTE A;  2EYQ A;  1MV0 B;  1VUB A;  5LJ5 j;  2KXD A;  2CZ7 B;  5ECA A;  2LT1 A;  3VS6 A;  4J7F A;  5HK3 A;  1AOJ A;  3CC7 T;  3M4G A;  4KUD K;  2DL4 A;  4BDZ A;  1SKU B;  2ED1 A;  5KH6 A;  2KT8 A;  4D6W A;  2YRD A;  3NTI A;  1YJW A;  1VQ7 T;  2HSP A;  1D0Z A;  2C06 A;  4ZTF A;  3M5A A;  1YJ9 Q;  2W0Z A;  2PTK A;  1NEG A;  3M0S A;  1H3Z A;  1YCY A;  3PVQ A;  1ABQ A;  3MP1 A;  1PCX A;  3VS4 A;  4F7U A;  2BZ8 A;  4M78 C;  4M78 B;  2FO0 A;  2IIM A;  2LNV A;  3DLL A;  1M4Z A;  2E1H A;  1X69 A;  4E7S A;  1N9S A;  2NUZ A;  5J3B A;  1VQ5 A;  3NMZ C;  1NZ9 A;  3JCM c;  1WQ7 A;  2QTX A;  2FZK B;  2JJ9 A;  3FEO A;  3G6E Q;  4Y28 E;  3OYK A;  2E41 A;  2DAQ A;  3QKJ A;  4OP0 A;  3MP8 A;  1RAB B;  2XI9 A;  2Y4X A;  3UDC A;  4HT9 A;  2RK2 A;  3M57 A;  1NJI R;  2QA4 Q;  2L3Q A;  2A3L A;  1KHC A;  3RDV A;  4PJO D;  5LJ5 h;  2DPP B;  4AG1 C;  3MPU B;  2O4X A;  2PU9 B;  4DEX A;  1K8A C;  2JTF A;  2MWP A;  3CCV Q;  3F70 A;  4ESR A;  1V76 A;  2JS2 A;  3UT1 A;  3OW2 P;  1ZLM A;  3QZ5 B;  4OVA A;  3L2W A;  1T3S A;  3U23 A;  3EH1 A;  4OB1 B;  1QW1 A;  2CP6 A;  1BK2 A;  5IHI A;  3MET A;  2A0F B;  3MHX A;  4RG8 A;  1EZZ B;  2E12 A;  3CBM A;  4OGC A;  1JXO A;  1XOV A;  4J9F A;  4AFZ C;  2EGC A;  3V7C A;  4WTO B;  2L0A A;  2R5A A;  5FU7 C;  2J7I A;  5FU7 B;  3E2U A;  1Y0M A;  3J80 E;  2SRC A;  3OYY A;  1T0J A;  7AT1 B;  3EG1 A;  1LJO A;  3OYE A;  3H8Z A;  4JS4 A;  2Y90 A;  5KCO A;  1K73 C;  3ASK A;  2LT4 A;  3OW2 A;  1VQN T;  2GCX A;  1K4U S;  1VQL Q;  4R56 A;  3KXT A;  1YIJ T;  1QCO A;  1S72 A;  4RKU E;  1VQN Q;  3NFC A;  2M16 A;  5GAN j;  3CXC A;  3ZEH A;  5I22 A;  4X9C A;  1I4K 1;  4JZ3 A;  4N4H A;  2FZC B;  2KEA A;  2JM8 A;  2ESW A;  1VQ9 Q;  3CCU T;  1VQ7 A;  1U5S A;  3MCA B;  2H8H A;  3CCU Q;  2FRW A;  2JTM A;  4M75 B;  4M75 C;  1YJ9 A;  4BD3 A;  1NPR A;  3VUB A;  4L6V 5;  3P8H A;  2RJF A;  4LDW A;  2EJ9 A;  2QQS A;  3CCJ A;  3A8L B;  4IUT A;  4QQ6 A;  4EPC A;  2FRY A;  1KQS S;  1G8X A;  4EMK B;  4EMK C;  2CRE A;  5LJ3 g;  2VKN A;  5GMK m;  1BU1 A;  1SEM A;  3UAT A;  1K8A R;  2E3H A;  2QQ9 A;  2PUO B;  1OU8 A;  1VQP T;  1MND A;  1VQ5 Q;  3TCJ A;  1KG1 A;  2LNH B;  1K0X A;  2AZS A;  1PKS A;  3EH2 A;  1AT1 B;  3TEE A;  2DX1 A;  2O9S A;  5LJ5 d;  2KRM A;  1Q86 R;  3JV3 A;  2VUB A;  1M90 C;  3VRY A;  1YIJ Q;  1X27 A;  4C8Q F;  2QA4 A;  1PD0 A;  1QVP A;  4A4G A;  4K11 A;  1B07 A;  5A0G A;  1BI0 A;  4B9W A;  1B7T A;  5GAN h;  2DXC A;  3UA7 A;  1Q7Y U;  1P92 A;  1Q82 U;  3EG3 A;  4M4Z A;  3OMG A;  2MI6 A;  2E65 A;  2JUF A;  3KFV A;  3CC4 Q;  4C8Q A;  2CZ0 B;  1BIA A;  2AZV A;  5AYF A;  4JRQ A;  4EMG A;  4FW2 A;  4HVV A;  1QVG A;  2QQA A;  1UG1 A;  2D9T A;  5GAN g;  3M0R A;  4PJO E;  2A36 A;  2QQB A;  4NL2 A;  4ATO A;  2F2V A;  3C0C A;  1M5Q 1;  2HDA A;  3CCL Q;  1YJN Q;  4O5V A;  1WA7 A;  4II1 A;  1KD1 R;  4XQ3 A;  3RKX A;  3GIB A;  5KYY B;  2ZPE B;  2AKL A;  3C95 A;  2LQK A;  2DET A;  1BYM A;  6AT1 B;  4FYW B;  4ZGE B;  4C92 D;  2JNG A;  2MK5 A;  3DLM A;  3HTR A;  4F17 A;  1TOV A;  3L2R A;  3V7S A;  4HA8 A;  2QEX Q;  4DBR A;  1D1C A;  3TSW A;  1S72 Q;  4BAC A;  2CGH A;  2RI5 A;  5KYW A;  3SEM A;  3RKW A;  1PSE A;  1VQ9 A;  1NM7 A;  4MML A;  2PVD B;  1Q86 C;  2DF6 A;  3OYC A;  3LYI A;  2OTJ T;  4FW1 A;  2QA4 T;  3EFO B;  1M90 R;  2P4R A;  2DK3 A;  1G3Y A;  4DBQ A;  2R5M A;  2DBM A;  2GNC A;  3RER A;  3OMC A;  3ULR B;  3QYH B;  2HEQ A;  3HHT B;  1DJ7 B;  4E7H A;  4PNO A;  3N5B B;  2GF7 A;  2XU8 A;  4LD9 K;  4RTW A;  3E9G A;  1M2O A;  4CC2 A;  1D0X A;  3VS7 A;  3OS1 A;  3CC2 A;  4UC4 A;  2XID A;  3GPL A;  4IKF A;  2JXB A;  1UGR B;  2ECZ A;  3DKM A;  1WXB A;  4D8D A;  3HSB A;  1Y07 A;  2E5K A;  3LWI A;  1UTI A;  1K9A A;  2EYY A;  4HXJ A;  5GMK h;  2DYB A;  1YIT Q;  4JUV A;  2XMF A;  1ZSZ C;  1ZSZ B;  1A0N B;  1D0Y A;  3QHS A;  1ABO A;  2E4H A;  2G6F X;  2CH4 W;  3DB4 A;  2QGG A;  2HAX A;  2HBP A;  3MEW A;  2EVR A;  1YJN T;  2LJ1 A;  2GBQ A;  4M75 A;  2ZGW A;  4N4I A;  4XTU A;  4OGE A;  1VYT A;  3QDF A;  4IUQ A;  2EQM A;  1X2K A;  1VQ5 T;  2RB6 A;  2CYZ B;  1EIF A;  4EMK A;  4NS5 A;  1F1B B;  3OS0 A;  2X4Y A;  3VS0 A;  3HP9 A;  3EG9 B;  2RHZ A;  2RN8 A;  2DXT A;  1K1Z A;  1VQM A;  1ACM B;  3A5Z B;  1KFZ A;  2C0O A;  4NOY A;  3LGL A;  4J6Y A;  2QG9 B;  1Z9Q A;  2RH2 A;  5GAN 7;  2LJ0 A;  4RTU A;  1QQJ A;  1Y57 A;  3X25 B;  2CDT A;  4M75 E;  5DM7 R;  5GMK l;  2YLB A;  5IXB A;  1X6B A;  3A8O B;  4RTX A;  1X01 A;  2LZ6 B;  2K3Y A;  5GAN 3;  1M90 U;  2JN0 A;  4M7D C;  4M7D B;  2OX7 A;  1Y7X A;  3CCE A;  1RAI B;  2DNU A;  4QT7 A;  4AFQ C;  4XK8 E;  1YIJ A;  4M7D A;  3OYL A;  2A7Y A;  1X43 A;  2Z0W A;  5KYX A;  3JCM V;  2CS7 A;  1G83 A;  1W2B S;  5LL6 S;  4J6W A;  3JB9 H;  1JO8 A;  3LH0 A;  4HKE A;  2QK0 A;  5I21 A;  5HY6 A;  4CC7 A;  1WHL A;  4F16 A;  2LCS A;  1S1N A;  3CMA A;  4ZN3 A;  5GMK e;  4BUG A;  3OYM A;  3CC4 A;  2LX9 A;  5KYW B;  2WAC A;  3CBP A;  3VJP A;  2KVQ G;  1VQO Q;  2OTJ A;  1E6G A;  5IXF A;  3EAE A;  1D3B B;  3GBQ A;  1OYX A;  2RNA A;  3JCM g;  3CCR T;  2DYI A;  3AHU A;  3CCM T;  2CH4 A;  2KR3 A;  3UPU A;  2COW A;  3FDR A;  3CCL A;  3M9Q A;  1AWX A;  3G1J A;  1EFN A;  4D8K A;  3QII A;  3VS1 A;  3CMA T;  2LQ8 A;  2BE9 B;  2ZPI B;  2DMO A;  1WXT A;  3CCS A;  2EGA A;  5FRM A;  1LVK A;  3S3M A;  1AWW A;  3EGU A;  2KRN A;  2DA9 A;  3I55 T;  2JT4 A;  2M02 A;  2BE7 D;  2RD1 A;  3O8V A;  2BKD N;  3M0U A;  2YRC A;  4MMK A;  4LXC A;  4PJN A;  1NLO C;  2L5Q A;  4E2F B;  2P0Q A;  1M1F A;  2IG0 A;  3OYD A;  3MKD A;  1JB0 E;  1YHQ A;  2DIQ A;  3JB9 D;  1PHT A;  2OAU A;  5KYU A;  3RMS A;  2EIF A;  1WI7 A;  5IT9 E;  3REB B;  2JMA A;  4QQG A;  3ZL7 C;  2DEQ A;  2FVU A;  1RAA B;  4AG2 C;  3CC7 A;  4XU0 A;  1M8V A;  3PFS A;  1TUD A;  2LC4 A;  3OS5 A;  4QKU A;  2GFU A;  2RQR A;  3H0I A;  1MUZ A;  1M9S A;  3RMQ A;  2FYK A;  4BI4 A;  4O6J A;  4ZGJ B;  1FMW A;  2FPF A;  3JCM X;  3G4S Q;  1VQM Q;  4FYY B;  4M7A B;  4M7A C;  1HJD A;  2BZY A;  3MP6 A;  2D1X A;  3NGP A;  2CP0 A;  1ZSG A;  3VS5 A;  4A4E A;  3G4S T;  2X9H A;  4LDU A;  1I07 A;  1G3W A;  2IVW A;  3CCR A;  2JM9 A;  2NUP A;  1OUL A;  5EG2 A;  3JCM Q;  2CSQ A;  1AWJ A;  2JS0 A;  2FB7 A;  4OML A;  4YTL A;  4M75 D;  1VQ4 T;  3I55 Q;  3JRZ A;  1KD1 C;  3CD6 A;  1W70 A;  2EGE A;  1PKT A;  2VB6 A;  2EYW A;  2F5T X;  1YI2 Q;  4PKC C;  2XDP A;  1UHC A;  3WVD B;  2DL7 A;  4C8Q D;  2B86 A;  2V8K A;  5GMK i;  2IPO B;  2RQT A;  2WSC E;  1VA7 A;  1YIT A;  1GCP A;  3OYH A;  2DKG A;  4CC4 B;  1K73 U;  1QKX A;  3I56 T;  2DTH A;  4RMO A;  1X75 C;  1RAC B;  2EJG A;  4BI8 B;  1BB9 A;  3FIF A;  2ATC B;  3M59 A;  3EG2 A;  4C0F A;  2K57 A;  3QYG B;  4JLI A;  2L3R A;  4VUB A;  1YJW T;  2ABL A;  1JBM A;  2BTT A;  3V7R A;  2DZC A;  4AFS C;  5KCH A;  1TUG B;  2ZPB B;  2ZPF B;  2EPD A;  1KD1 U;  3SB2 A;  4JJB A;  3SDZ A;  2D0N A;  5EC7 A;  4FYX B;  2K6D A;  1YN8 A;  4M7A G;  2A08 A;  3JB9 F;  1HSQ A;  5HKC A;  1K76 A;  1YNZ A;  3SD4 A;  4FT4 A;  3FJP A;  5GAM f;  1Y96 B;  4RCC A;  5L23 A;  2LCL A;  4J9E A;  2ROT A;  1GBR A;  2EQI A;  1FMV A;  5KYY A;  2DO3 A;  3NPF A;  2JZ2 A;  1VYU A;  1K9M U;  1BCO A;  4FSS A;  1ZUY A;  2XKO C;  4GLK A;  4CC3 A;  2KXC A;  1NEB A;  2KI7 A;  2M9U A;  3M56 A;  1TTH B;  3FRN A;  4PL6 A;  1UGQ B;  1ZSZ A;  1VYV A;  3G7Z A;  1BBZ A;  4L59 A;  1YHQ Q;  4JZ4 A;  1RAE B;  3JB9 G;  3GNG A;  4PJL A;  4OB3 B;  5CVI A;  2PVO B;  5FW9 A;  1CKA A;  5D7U A;  3I5R A;  3BY7 A;  4LN2 A;  2KSS A;  3MEU A;  5FRO A;  2VXE A;  2K3X A;  4BE0 A;  4C92 C;  4C92 B;  4RTZ A;  3EHR A;  1SSF A;  1PWT A;  3VS3 A;  2KQW A;  5FWB A;  2B8A A;  4LD6 A;  4F7U G;  3ER0 A;  4JJC A;  2RI3 A;  5DY9 A;  3CMA Q;  4XTY A;  1GFC A;  3UWN A;  1QVG S;  1G5V A;  3TSZ A;  4J6X A;  3EFO A;  5I2S A;  1M1K R;  4HT8 A;  2DL3 A;  2KE9 A;  2XK0 A;  2BUD A;  4X9D A;  1RAF B;  2YXY A;  3PVL A;  5A2Q E;  2RJD A;  2GQV A;  3HFO A;  1QP3 A;  2GQI A;  3TU4 K;  3C4S A;  2HQH A;  5GAM h;  2W10 A;  3CCM A;  2CP7 A;  2ENM A;  1M1G A;  2DFU A;  2KRO A;  2RHX A;  4JLG A;  4M7A A;  2F2W A;  3CD6 Q;  1GL5 A;  1IHW A;  3QWY A;  1M3B A;  3NTK A;  1VQ4 A;  1UE9 A;  3M54 A;  4J9H A;  4ANJ A;  3RNJ A;  1AVZ C;  2E10 A;  1G3S A;  1O9S A;  5GAM g;  4C92 F;  2EJF A;  4C5G A;  2MOX A;  4M7A F;  1T0H A;  1M3A A;  1AHJ B;  3MO8 A;  3GF5 A;  2YUO A;  5GJW B;  4QVD A;  2RJC A;  3OSS C;  4HCK A;  3M58 A;  2DXB A;  2WSE E;  3JAM E;  2CT4 A;  1H92 A;  3OY9 A;  2J6K A;  3E19 A;  2OTL T;  4KT0 E;  1ZBJ A;  2RM4 A;  1OU9 A;  3QXE B;  2LRQ A;  5CKE A;  1WJS A;  1YJ9 T;  2DRM A;  2MIO A;  5CR2 A;  1OPL A;  4BB7 A;  3OB9 A;  1NYG A;  3CXC P;  5CKF A;  2XD0 A;  2RHY A;  4XTW A;  5GAO r;  1GRI A;  1QP2 A;  2P4T A;  4PJM A;  4OB2 B;  2X4W A;  3AT1 B;  2NUT A;  4FSX A;  4N0A C;  3OYJ A;  3LH5 A;  1NJI C;  1NBE B;  5CCA A;  2H3E B;  4M77 A;  5FWC A;  3VUZ A;  2P0K A;  3UF4 A;  5DLO A;  1VQ9 T;  4MZM A;  3I55 A;  2DXU A;  3G6E T;  1QVF P;  2QYZ A;  2A37 A;  2WSF E;  1U06 A;  2KDS A;  1QWE A;  4E47 A;  2FHD A;  3HKS A;  2F2X A;  5CK9 A;  2QDL A;  4M78 A;  3I56 A;  3QBY A;  4EDU A;  5GAM e;  4JS5 A;  1VQL A;  1EX4 A;  4OMF B;  1C6V X;  3VV0 A;  2CKK A;  5KE3 A;  2MWO A;  1G3T A;  4C92 E;  4M77 E;  2SEM A;  2CT3 A;  1YCS B;  2M0O A;  1C1A A;  5GAN d;  3GNF B;  2YLC A;  4DBF A;  4E6R A;  1UJ0 A;  3D7S B;  2OTL A;  2ZZD A;  3CCU A;  4QVZ A;  3QDR B;  2ZPH B;  4C92 G;  4ELY C;  2VVK A;  5A0L A;  5GMK j;  1OPK A;  1QLY A;  4M78 E;  3JCM J;  4KUL A;  2QQR A;  1JJ2 P;  3LLR A;  5D6W A;  3SHW A;  1OOT A;  2VAS A;  3CCM Q;  4KUI A;  1J3T A;  4E7K A;  4OMP A;  3SFM A;  5LJ5 f;  5GAN f;  1MHN A;  1SHG A;  1SG5 A;  2V1Q A;  3JSC A;  1PD1 A;  4RTV A;  2CUD A;  4MZP A;  3HRT A;  2EYX A;  4A53 A;  2P84 A;  3PMT A;  1VQP Q;  1QVF A;  5GJV B;  2VV5 A;  1ZQ1 A;  2X3X D;  3CC4 T;  1BI1 A;  1BCM A;  4PFO A;  2QEX A;  3BDU A;  2DIG A;  3FB9 A;  1QCN A;  1OI1 A;  2VGM A;  3ME9 A;  1IGQ A;  2YT6 A;  4M7D D;  1IRX A;  4N0A A;  2V1R A;  2X4J A;  4PJO A;  3L2Q A;  2VC8 A;  1RAD B;  2LDM A;  1WHK A;  3FLG A;  1W2B A;  3CCE T;  2K2V A;  2QGF B;  4A54 A;  2RA2 A;  1RL2 A;  2EQK A;  2F1L A;  2FG0 A;  4PJO B;  4PJO C;  1K9M C;  3TRE A;  5CQY A;  1TUC A;  4KGX B;  4RTY A;  1YFN A;  1HXD A;  4CRI A;  5LJ5 e;  2PZ1 A;  1YIT T;  3RKY A;  4M75 F;  5HCK A;  4DA4 A;  1N27 A;  1NJI U;  1HYO A;  3CEY A;  3ZBD A;  2QEX T;  3M53 A;  2YWW A;  2HBW A;  1K0S A;  3A1P A;  3O5Z A;  3QPH A;  1WDX A;  4M7A D;  2DVE A;  5GAN 4;  4RUG A;  2YUN A;  1QKW A;  4A4K A;  1WHM A;  2KT1 A;  4JRP A;  3RIR A;  3L2U A;  3X24 B;  1ZHI A;  2YHT A;  3CPW P;  1AEY A;  1KC8 C;  2L89 A;  5CKD A;  4F14 A;  3CCS T;  1Q7Y R;  2PNI A;  4XAX B;  5IH2 A;  5D6X A;  2DM1 A;  1VQ6 Q;  1OZ3 A;  1QMC A;  4IUP A;  1WYX A;  3H0H A;  2LQN A;  4JJD A;  4Z88 A;  4ORZ A;  2X51 A;  1IGU A;  4J9D A;  3VKI A;  4MDX A;  1YP5 A;  3M0Q A;  2AHJ B;  3V8L A;  1M2V B;  3PIO A;  1ZA1 B;  1JEG A;  4M77 D;  2XDD A;  1SSH A;  2QAZ A;  1YJW Q;  1AZG B;  1LPL A;  3I9Q A;  3L42 A;  5GAN 2;  1UEB A;  2COZ A;  4DEY A;  4FYV B;  3A98 A;  1GCQ C;  1X6G A;  3EGD A;  3TVT A;  4A63 B;  1M1K C;  3PIP A;  3H41 A;  4LDY A;  3CC2 T;  1U8R A;  1N9R A;  2DLP A;  2F5K A;  3MEV A;  2K9G A;  5GAN 8;  4A4F A;  3M4Y A;  2C0T A;  3SWN B;  3SWN C;  4HVU A;  1I5O B;  2EKO A;  5GAO n;  2EBP A;  2DL8 A;  3BW1 A;  2MMP A;  3VS2 A;  3BDL A;  1SPK A;  3SWN A;  1GFD A;  1OQK A;  2ZCF B;  3G71 T;  2DE0 X;  4EMH A;  2M1H A;  1AD5 A;  2VXF A;  1TH7 A;  1B3Q A;  1NE8 A;  3CD6 T;  5J26 A;  3EGD B;  5C6S A;  3VRZ A;  2I2L A;  4ELZ C;  1M8M A;  4RCB A;  1SRM A;  2R57 A;  1TG0 A;  3THK A;  5IAY A;  4GBQ A;  1SHF A;  4AMC A;  4E7I A;  1VQK A;  5IHK A;  3R6N A;  4R0K A;  3NTH A;  3IQL A;  1QVF S;  3QUI A;  2XDB A;  4PJO G;  2MCN A;  4KH0 B;  4J5Y A;  2ZPG B;  1C0M A;  2CP2 A;  1WNL A;  3L2Z A;  3NHN A;  4NL3 A;  1D1A A;  1D09 B;  1IO6 A;  2DTI A;  1UHF A;  4EIK A;  1VQO A;  1MMG A;  1NPP A;  2K5I A;  2L2P A;  1VQ8 T;  1VQK T;  5IHN A;  3L2V A;  5GAN e;  4RG2 A;  1Q81 R;  2A28 A;  1U1T A;  3E1S A;  4QVC A;  2RPN A;  2HQX A;  4PLI A;  2GFA A;  3FJ5 A;  1Q82 R;  2JVV A;  4OMO A;  2GTJ A;  4JJN K;  3DB3 A;  4M77 G;  4N4G A;  4M7D E;  1K8A U;  1YWP A;  5KYX B;  4MZT A;  3JB9 I;  4DOV A;  1PC0 A;  4C5H A;  2C0I A;  1PNJ A;  1UJY A;  2L3S A;  2XHC A;  4IIO A;  3JCM W;  2HQE A;  2L3P A;  3I5S A;  2HMA A;  5KYN A;  1VQ6 A;  1CKB A;  1KJW A;  5GAN 5;  2K79 A;  4FU6 A;  1RI0 A;  2GTO A;  2YDL A;  4OF1 A;  1R0B G;  1WJQ A;  3FC3 A;  5J39 A;  2E3I A;  3CC7 Q;  1QWF A;  1IRE B;  2DL5 A;  3RES A;  1YI2 T;  3M0P A;  3A8H B;  1XTD A;  5M9O A;  4BY6 C;  4BY6 B;  1X2Q A;  1JU5 C;  4C8Q G;  1ZUK A;  2I0N A;  2EWN A;  1ZUU A;  1KC8 U;  1KK7 A;  2DJQ A;  4JPB W;  4PK4 A;  3VYH B;  1Q81 U;  1VIF A;  4M7D G;  3ZFJ A;  1X6O A;  1MV3 A;  3PGG A;  1WHJ A;  1TU0 B;  3OYN A;  1WZO A;  3OS2 A;  4QW2 A;  1ARK A;  2RHU A;  2J6F A;  3CPF A;  2BIV A;  2R58 A;  2COY A;  2K5F A;  4ZNX A;  4TVR A;  1NG2 A;  1R8O B;  4GY5 A;  2PVG B;  1YWO A;  4Q5W A;  2Y4Y A;  8ATC B;  2DTO A;  1ZA2 B;  4ME7 A;  2PUK B;  5I11 A;  4IUR A;  4F7U F;  1YBY A;  1GXI E;  4OMM A;  1GBQ A;  1OX9 A;  2MPX C;  4HCC A;  2DD4 A;  2V8I A;  4M7D F;  1Q82 C;  5D6Y A;  2EKH A;  1MNE A;  2O9V A;  4LE9 A;  1NLP C;  1PRL C;  1KQ1 A;  5GAM j;  2FPE A;  4OMN A;  3QO3 A;  5LJ3 h;  3V8J A;  5FRN A;  4WF2 A;  1RAH B;  1B34 B;  1VQ7 Q;  2CSI A;  2LP5 A;  2PQW A;  5I2M A;  3OA6 A;  1Y96 A;  3KBG A;  3REA B;  1W2B P;  1B34 A;  4HCZ A;  4B9X A;  1IB8 A;  3CCJ Q;  1U3O A;  2GGR A;  2AT1 B;  4J9G A;  4OB0 B;  1YJN A;  2O2O A;  4C8Q E;  3OW2 S;  1UGS B;  1H8K A;  3C94 A;  1MMD A;  2NUT B;  2RJE A;  1M3C A;  4JRI A;  1WXU A;  2EW3 A;  2HKQ B;  2OI3 A;  3HFN A;  4IUV A;  3RUX A;  3MJX A;  3M0T A;  3HL8 A;  2K2M A;  2QI2 A;  3QZ9 B;  1KQ2 A;  5C0M A;  4KH1 B;  4BE2 A;  1WIE A;  1VOM A;  4PJJ A;  1KQS A;  4BE1 A;  3HPW A;  1N8R R;  2KY9 A;  2JW4 A; 
#chains in the Genus database with same CATH homology
 3PVQ A;  1ABQ A;  2VVK A;  3VS4 A;  2DNU A;  1OPK A;  4QT7 A;  1JQQ A;  1QLY A;  4AFQ C;  2BZ8 A;  1X43 A;  2LMJ A;  2FO0 A;  1SRL A;  2IIM A;  1WFW A;  1G83 A;  2BZX A;  1M27 C;  1OOT A;  3SHW A;  1X69 A;  2YUQ A;  1JO8 A;  2EYZ A;  2NUZ A;  2DRK A;  1J3T A;  3NMZ C;  4CC7 A;  4OMP A;  2DVJ A;  3EG0 A;  4F16 A;  2LCS A;  1S1N A;  1RI9 A;  1SHG A;  2V1Q A;  4RTV A;  1RLP C;  2CUD A;  2EYX A;  5GJV B;  1W1F A;  1E6G A;  2X3X D;  5IXF A;  3GBQ A;  1PRM C;  2RNA A;  1KIK A;  2CH4 A;  2KR3 A;  2RQV A;  2L3Q A;  1AWX A;  1E6H A;  4X1V A;  1EFN A;  4D8K A;  3VS1 A;  1WLP B;  2DMO A;  1WXT A;  4AG1 C;  2EGA A;  2YT6 A;  4HVW A;  1H3H A;  2V1R A;  4DEX A;  1AWW A;  3EGU A;  4J9C A;  2KRN A;  2X3W D;  4ESR A;  2DA9 A;  2JS2 A;  1ZLM A;  2JT4 A;  1UGV A;  2FG0 A;  1T3S A;  3U23 A;  3M0U A;  1I1J A;  1TUC A;  4RTY A;  1NLO C;  2K3B A;  1BK2 A;  5IHI A;  2PZ1 A;  1RLQ C;  5HCK A;  1PHT A;  1JXO A;  1XOV A;  1WI7 A;  2HBW A;  4J9F A;  1K0S A;  3REB B;  2JMA A;  3ZL7 C;  4AFZ C;  2EGC A;  2LX7 A;  3O5Z A;  1WDX A;  4LNP A;  2L0A A;  4AG2 C;  1UDL A;  4RUG A;  2J7I A;  1Y0M A;  2YUN A;  2VWF A;  1QKW A;  2SRC A;  1TUD A;  2KT1 A;  1W6X A;  1T0J A;  2RQR A;  3H0I A;  1GCQ A;  3EG1 A;  1MUZ A;  1G2B A;  1AEY A;  4F14 A;  2FPF A;  1K4U S;  2PNI A;  1HJD A;  2BZY A;  2D1X A;  2OJ2 A;  3NGP A;  5IH2 A;  1ZSG A;  3VS5 A;  4J9B A;  2DM1 A;  2J06 A;  1AZE A;  1WYX A;  3H0H A;  1I07 A;  2LQN A;  3QWX X;  5I22 A;  4JJD A;  4Z88 A;  1NYF A;  4ORZ A;  4J9D A;  2JM9 A;  1YP5 A;  4JZ3 A;  2CSQ A;  3M0Q A;  1AWJ A;  2KEA A;  2JS0 A;  2JM8 A;  2ESW A;  4OML A;  1JEG A;  2J05 A;  1U5S A;  1W70 A;  1SSH A;  2EGE A;  1PKT A;  2EYW A;  1AZG B;  3I9Q A;  1UEC A;  2H8H A;  1UHC A;  2FRW A;  2DL7 A;  4DEY A;  1UUE A;  3A98 A;  1GCQ C;  2B86 A;  1X6G A;  2RQT A;  3TVT A;  1VA7 A;  1GCP A;  2FRY A;  4A63 B;  2CRE A;  1M30 A;  2VKN A;  1BU1 A;  3H41 A;  4CC4 B;  1SEM A;  2DIL A;  4GLM A;  2DLP A;  1QKX A;  3UAT A;  2K9G A;  2KNB B;  2C0T A;  2CUB A;  2RF0 A;  4HVU A;  1T3L A;  2EBP A;  2LNH B;  1K0X A;  2DL8 A;  3VS2 A;  1BB9 A;  1RUW A;  1SPK A;  4LUE A;  2AZS A;  3EG2 A;  1GFD A;  1PKS A;  2DE0 X;  1HD3 A;  2DX1 A;  2NWM A;  2O9S A;  2ABL A;  1AD5 A;  2KRM A;  2BTT A;  1B3Q A;  4AFS C;  2EPD A;  3JV3 A;  4JJB A;  2D0N A;  2YSQ A;  3VRZ A;  2AKK A;  5EC7 A;  2K6D A;  1M8M A;  3VRY A;  1UFF A;  1SRM A;  1YN8 A;  3UA6 A;  1X27 A;  1CSK A;  1TG0 A;  2JMC A;  4IIM A;  3THK A;  2A08 A;  4GBQ A;  1SHF A;  1HSQ A;  4AFU C;  1K76 A;  4K11 A;  1B07 A;  1YNZ A;  5IHK A;  3EHQ A;  3R6N A;  4R0K A;  5L23 A;  4J9E A;  2ROT A;  3UA7 A;  3IQL A;  2EQI A;  1GBR A;  3PE0 A;  2O88 A;  3NPF A;  1VYU A;  1Z9Z A;  3EG3 A;  4FSS A;  4M4Z A;  1ZUY A;  4CC3 A;  2MCN A;  1FYN A;  3KFV A;  4OMQ A;  2KXC A;  1NEB A;  3NHN A;  1IO6 A;  3RBB B;  1UHF A;  2AZV A;  4EIK A;  4HVV A;  2L2P A;  1VYV A;  1BBZ A;  1UG1 A;  3M0R A;  5IHN A;  1I0C A;  2A36 A;  2O31 A;  4JZ4 A;  2F2V A;  3C0C A;  2A28 A;  2HDA A;  2HCK A;  1V1C A;  5FW9 A;  1CKA A;  1JXM A;  2RPN A;  3I5R A;  4LN2 A;  1WA7 A;  4RTZ A;  3EHR A;  1PWT A;  3VS3 A;  5FWB A;  1OEB A;  4RTT A;  1E7O A;  3FJ5 A;  4OMO A;  3H0F A;  2AKL A;  2GTJ A;  4JJC A;  1GFC A;  2LJ3 A;  3TSZ A;  3CQT A;  1YWP A;  1WX6 A;  2C0I A;  1PNJ A;  1UJY A;  2DL3 A;  2L3S A;  2KE9 A;  4IIO A;  4F17 A;  1KSW A;  2L3P A;  3PVL A;  3I5S A;  3TSW A;  1CKB A;  1KJW A;  2K79 A;  2GTO A;  2KYB A;  2YDL A;  2GQI A;  2M51 A;  2D8H A;  2W10 A;  3SEM A;  1FMK A;  4Z8A A;  1ZX6 A;  2ENM A;  2ROL A;  1NM7 A;  2KRO A;  4Y92 A;  2F2W A;  1QWF A;  2DF6 A;  1GL5 A;  2AK5 A;  2FPD A;  2DL5 A;  1M3B A;  3QWY A;  1UE9 A;  4J9H A;  3M0P A;  4Z89 A;  2KYM A;  2P4R A;  2OAW A;  3RNJ A;  1AVZ C;  1X2Q A;  2DBM A;  2GNC A;  1JU5 C;  3ULR B;  1N5Z A;  2MOX A;  2KRS A;  1ZUK A;  2HEQ A;  2I0N A;  2M0Y A;  1T0H A;  1ZUU A;  1M3A A;  1QCF A;  2DJQ A;  4JPB W;  2YUO A;  4RTW A;  5GJW B;  1MV3 A;  4CC2 A;  3VS7 A;  4HCK A;  2JXB A;  2ECZ A;  1ARK A;  2CT4 A;  1H92 A;  1WXB A;  2J6F A;  2J6K A;  4D8D A;  4ZNX A;  2E5K A;  1ZBJ A;  4LUD A;  1NG2 A;  2J6O A;  1UTI A;  2LQW A;  1AWO A;  1K9A A;  4KRT A;  2DRM A;  2EYY A;  1YWO A;  4HXJ A;  2DYB A;  4WCI A;  2MIO A;  2ED0 A;  2XMF A;  1OPL A;  2RQU A;  2DBK A;  1A0N B;  1NYG A;  1ABO A;  2G6F X;  5I11 A;  2CH4 W;  4OMM A;  1GBQ A;  1GRI A;  2KGT A;  2EKH A;  2EVR A;  1LCK A;  3LH5 A;  2O9V A;  4LE9 A;  2LJ1 A;  1NLP C;  1PRL C;  1OV3 A;  2GBQ A;  2YUP A;  5FWC A;  2FPE A;  4OMN A;  2FEI A;  4J9I A;  3UF4 A;  1VYT A;  1X2K A;  2CSI A;  2LP5 A;  3REA B;  2A37 A;  2K7A A;  1U06 A;  3VS0 A;  1QWE A;  2KBT A;  1U3O A;  2F2X A;  2RMO A;  2D8J A;  2QDL A;  2RN8 A;  2GGR A;  1K1Z A;  2RQW A;  4J9G A;  3I35 A;  2JTE A;  2O2O A;  1MV0 B;  1H8K A;  1KFZ A;  2C0O A;  2KXD A;  5ECA A;  1M3C A;  1WXU A;  2OI3 A;  2EW3 A;  3VS6 A;  1AOJ A;  1Z9Q A;  2DL4 A;  2LJ0 A;  4RTU A;  3M0T A;  2ED1 A;  1Y57 A;  2K2M A;  2CDT A;  2KT8 A;  2SEM A;  2CT3 A;  1YCS B;  5IXB A;  1WIE A;  1X6B A;  4E6R A;  2HSP A;  1UJ0 A;  4RTX A;  2LZ6 B;  2W0Z A;  2PTK A;  1NEG A;  3M0S A;  2JW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...