1SPKA

Solution structure of rsgi ruh-010, an sh3 domain from mouse cdna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
72
structure length
72
Chain Sequence
b'GSSGSSGQKVKTIFPHTAGNNKTLLSFAQGDVLTLLIPEEKDGWLYGEHDTTKARGWFPSSYTKLLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 1300006M19
molecule tags Structural genomics, unknown function
source organism Mus musculus
publication title Solution Structure of RSGI RUH-010, an SH3 Domain from Mouse cDNA
rcsb
total genus 7
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1spkA00
1SSHA 1JEGA 1T0HA 4A63B 1KSWA 3I35A 1W1FA 4Z89A 1NLPC 1OV3A 1ZX6A 3UF4A 1TG0A 5L23A 2LMJA 2A36A 1BK2A 4GBQA 3M0UA 3REBB 5IXFA 2CT3A 1QKWA 1GCPA 2ED0A 2DL7A 1UG1A 1M3CA 2LZ6B 1GCQA 1RLPC 3LH5A 2KR3A 3C0CA 4WCIA 2NWMA 2KE9A 2BTTA 4LUEA 1WYXA 2EKHA 2DM1A 4RTYA 2DBKA 1G83A 1SRMA 1JU5C 5FWCA 1ZBJA 2OJ2A 2OI3A 1GBRA 2RN8A 1M27C 1X2KA 2PTKA 2D0NA 2RQTA 2HDAA 1AWOA 5IH2A 1JXOA 1GFCA 1YN8A 4JPBW 1T0JA 1YCSB 2JTEA 2A08A 2M0YA 2K9GA 1PKSA 2D8JA 3M0RA 1WXTA 4JZ4A 2YSQA 1KIKA 5GJVB 4J9CA 2LJ1A 1K4US 2O9SA 4JJBA 4OMMA 3M0PA 3QWYA 5IHIA 3NMZC 2JMAA 2AKLA 2D1XA 2ABLA 1H8KA 1UTIA 3VS5A 1QCFA 1ARKA 2JM9A 2DNUA 3R6NA 1PWTA 1H3HA 4OMLA 3I5RA 1OEBA 2LQNA 1UFFA 2KROA 2CDTA 3EGUA 3REAB 2M51A 2KRSA 1BBZA 1QLYA 3VS1A 2DL4A 4LNPA 1H92A 2KXCA 1UHFA 3I9QA 4AFQC 5IXBA 2RNAA 3CQTA 2KT1A 2GTJA 1UDLA 1Z9QA 1WI7A 1E7OA 1GCQC 2L3SA 1VYUA 1A0NB 4CC3A 2CUBA 2J6KA 2A37A 4JZ3A 4FSSA 2YDLA 2HCKA 2KT8A 1MV3A 2DF6A 4J9GA 2P4RA 3UATA 2CSIA 2V1QA 2YUQA 2KGTA 3VS0A 2C0TA 2DE0X 1KFZA 2AK5A 2DA9A 2KRNA 2DL5A 2ROTA 2ESWA 1AVZC 1WX6A 1M8MA 4J9DA 2KNBB 4HVWA 1ZSGA 4IIOA 3PVLA 4RTUA 2CT4A 1HSQA 4K11A 3IQLA 1ABQA 1RLQC 2RF0A 4OMQA 2GBQA 1WDXA 1G2BA 1UE9A 1ZUUA 5EC7A 2FPDA 2GTOA 4DEYA 4J9IA 2IIMA 4F17A 1SHFA 2DBMA 2EW3A 3FJ5A 5IHKA 2RPNA 1S1NA 1Y57A 2HBWA 1EFNA 2PZ1A 2LNHB 2RQVA 2ENMA 1QWFA 2DRKA 5GJWB 2O2OA 1X2QA 4J9EA 4AFSC 1X69A 1UGVA 4HXJA 3VS6A 4X1VA 3JV3A 2G6FX 4JJDA 3EG1A 2W10A 2L0AA 2CUDA 4AFUC 1K76A 2RQRA 1WIEA 1OPKA 3EHRA 1Y0MA 2SRCA 2CH4W 1X43A 4EIKA 2GQIA 2DILA 2C0OA 2ROLA 2DYBA 2CH4A 4CC7A 2FRWA 2JMCA 2KEAA 3EG2A 2X3XD 2NUZA 2AKKA 2FPFA 2YUNA 2FG0A 1FMKA 2GGRA 2J7IA 2YT6A 4CC4B 3UA7A 2RMOA 1GFDA 2J6FA 4Z8AA 1SRLA 2VWFA 3VS7A 1MUZA 1UUEA 1JO8A 1UJ0A 1WFWA 2EQIA 3RBBB 2JS2A 1K9AA 2BZYA 3H41A 3M0SA 2DMOA 1RUWA 1FYNA 2DL3A 4HVVA 2JT4A 1YP5A 1UHCA 2EYZA 1W6XA 4LE9A 4KRTA 1I1JA 2K6DA 2DX1A 2LJ0A 2SEMA 2RQUA 1BB9A 1QKXA 1PRMC 1WXBA 5FW9A 1AEYA 1JQQA 2I0NA 1CKBA 1OPLA 2O88A 1AWWA 2X3WD 1WA7A 2JS0A 1BU1A 4Y92A 4AFZC 4RTVA 1LCKA 2EPDA 2J06A 2ED1A 1SEMA 1HD3A 2KRMA 1KJWA 1I07A 2FRYA 2L3QA 1M3BA 1CSKA 2DLPA 4HCKA 1TUCA 3U23A 2MOXA 3SHWA 3NHNA 4RTWA 4OMPA 3SEMA 1K1ZA 2EGEA 2J6OA 2KXDA 2BZ8A 2KYMA 3UA6A 4AG1C 2LQWA 3THKA 3EHQA 4M4ZA 2HEQA 4LUDA 2LCSA 1VYVA 3I5SA 4F16A 2K7AA 1VA7A 4E6RA 1B3QA 1YWPA 3GBQA 1JXMA 5I11A 2EYXA 1T3SA 4ZNXA 1GL5A 2GNCA 1IO6A 4ORZA 4IIMA 4DEXA 3H0IA 2F2XA 1W70A 2L2PA 1WLPB 1CKAA 1NYFA 1AZGB 2K3BA 1UJYA 2LJ3A 2A28A 4GLMA 2EBPA 2JW4A 3EG0A 2F2WA 4J9FA 1E6HA 1WXUA 2DJQA 2EYYA 1TUDA 1HJDA 2H8HA 2CREA 2JM8A 2XMFA 4QT7A 1N5ZA 2L3PA 4D8KA 4ESRA 5IHNA 2LP5A 1ZUKA 4RTTA 3ULRB 4F14A 3O5ZA 3VS2A 4OMNA 1T3LA 2MCNA 3VS3A 2VKNA 3PE0A 1M3AA 4LN2A 3VRYA 1PHTA 1YNZA 2E5KA 1PRLC 1NG2A 3M0TA 1PKTA 1X27A 1NM7A 3VS4A 5I22A 2C0IA 2EGAA 3H0FA 4AG2C 2B86A 2DVJA 4HVUA 3KFVA 4D8DA 2KBTA 3ZL7C 2ECZA 2KYBA 2RQWA 2JXBA 2CSQA 2YUPA 1J3TA 2MIOA 1AWJA 2VVKA 3RNJA 2D8HA 1VYTA 1AOJA 1ZLMA 3EG3A 1M30A 3H0HA 3VRZA 1QWEA 1NEGA 1RI9A 1ZUYA 2HSPA 2BZXA 2O9VA 1ABOA 2W0ZA 4JJCA 2QDLA 5HCKA 2AZSA 3PVQA 1Z9ZA 1V1CA 2K2MA 2FEIA 1NEBA 3TSWA 2OAWA 5FWBA 2V1RA 2FPEA 1U5SA 1B07A 5ECAA 1MV0B 1K0XA 2DRMA 1AD5A 3TSZA 2FO0A 4R0KA 1YWOA 1AZEA 1GBQA 2K79A 1AWXA 1X6BA 4J9HA 4CC2A 2O31A 2J05A 1E6GA 1K0SA 1XOVA 2EYWA 4J9BA 4RUGA 3NGPA 4RTZA 1SPKA 1UECA 4Z88A 1U06A 2F2VA 3A98A 3QWXX 1PNJA 2DL8A 2PNIA 1I0CA 1U3OA 2YUOA 1GRIA 2LX7A 2EVRA 2AZVA 1OOTA 1NLOC 4RTXA 1X6GA 3M0QA 4OMOA 1SHGA 3NPFA 3TVTA 2EGCA 1NYGA
chains in the Genus database with same CATH superfamily
2ZZDA 1T0HA 3MEWA 1B7TA 4M75B 3OYNA 4C92F 1VQPA 3FB9A 1W1FA 1OZ3A 4BI4A 1GXIE 4HT9A 4XTUA 5L23A 4KUDK 2LMJA 1K73U 3REBB 1RL2A 2XG8D 1M90C 4LDXA 1QKWA 3HL8A 1VQ7Q 4PJOE 4LD6A 1M3CA 3TQ7P 1Q81R 4GY5A 3QKJA 4PJOF 5CVIA 5LJ3g 1KG1A 2EFIA 2RI3A 2OTLT 3CEYA 4J8OA 2KR3A 3CD6A 5CKBA 2XKOC 2BTTA 1FX7A 4RTYA 4M7DG 1QVGS 4VUBA 3VYGA 3G6ET 1JU5C 5FWCA 2OJ2A 1BIBA 1M27C 3TREA 4DA4A 1X2KA 2M1HA 2RQTA 5IH2A 1BKBA 3META 4FT2A 4ELYC 4HCCA 3J7AF 2A08A 4QVCA 1M2VB 2K9GA 5DLOA 1WXTA 3CPWA 1SG5A 1R0CB 4A4KA 4BI3A 3CCJT 1K4US 4JJBA 4AT1B 5IHIA 2JMAA 4N4HA 2AKLA 2EAYA 3VS5A 3RMQA 1ARKA 1K8AR 2R5MA 5GANh 3R6NA 2KAFA 2CZ6B 3A8GB 3VU3C 1Y96B 2LQNA 5IT9E 2KROA 1RABB 3EGUA 4N4IA 1VIFA 2M51A 3GP8A 2DD5A 3HSBA 3NFCA 1VQKQ 3RUXA 1QLYA 4N0AA 4M77E 1H92A 5KYUB 1VQPT 4KUIA 3DKMA 4F7UA 1E7OA 4ZN3A 2X4WA 3HTRA 2QEXQ 1YIJA 2QTXA 5DLQE 4JZ3A 4MZTA 3X24B 4J6XA 2E3HA 3VUBA 2CSIA 2RO0A 2JTMA 1OU8A 3JB9J 4YTLA 4PJLA 3CD6T 2DE0X 2DL5A 4M75C 2IVWA 2F69A 3VKIA 3OS5A 3TU4K 1VQ9A 1NJIU 4IIOA 4RMOA 2CT4A 1OX8A 1AHJB 3CMAT 3OYHA 1M1GA 2EJ9A 3JB9G 4XU3A 4MZPA 4OMQA 2ZGWA 3NTHA 3ZEHA 2RB6A 5LJ3e 2E5QA 2E6ZA 3OYIA 2NUTB 5GANf 2X4XA 4C8QA 2QQAA 2RQVA 2FHDA 2DD4A 2DRKA 1WHMA 1N9SA 2HZYA 2EYQA 3CPWS 1Q86U 3JV3A 1FWZA 3I56T 1H3ZA 2QASA 2M02A 2RQRA 1MHNA 1Y0MA 2BUDA 2SRCA 4EIKA 2FL7A 1ZA1B 4L59A 2QQRA 1M1KC 1O75A 1TU0B 4JRKA 3CCMA 2OX7A 3OA6A 1FMKA 3QZ5B 2BE7D 3E9GA 4M7AF 5J39A 4JRQA 1MUZA 4OGEA 4HT8A 4MMKA 1WFWA 2RJFA 2BKDN 2EQIA 2QEXA 4B9XA 2VB6A 2BZYA 3H41A 4F7UB 1Q7YR 1VQKT 3OYJA 2ZPBB 4J6YA 3QSUA 4M7AB 2JT4A 2M16A 1VQPQ 1YP5A 1EZZB 2IG0A 4A4GA 2WSEE 4M7DF 1VQMQ 2EYZA 1G3WA 4M7AC 3L42A 4KRTA 1NJIC 2DX1A 5KE3A 3OYEA 3HHTB 2RQUA 2DEQA 1Y07A 2GF7A 4Y91A 3X20B 2MK5A 2RM4A 5GAN6 1U1SA 5LJ5f 3G6EQ 1IRXA 4JJNK 3PTAA 4FT4A 4PNOA 2DPPB 4QQDA 1AWWA 3SWNA 3L1AA 4J83A 1WA7A 4KULA 1BU1A 2DXTA 3CD6Q 1SSFA 4AFZC 1VQNT 2RHYA 4RTVA 1LCKA 2LT1A 2RK2A 1SEMA 1K9MR 5KYWA 1I07A 1M1KR 5LJ3d 5FRNA 4M7AD 1CSKA 1WJQA 4M75G 3U23A 2E12A 2E65A 3NHNA 1PCXA 3EFOA 4RTWA 3QJYA 3G71Q 4JDSA 2KXDA 2BZ8A 4A53A 1TH7A 1S72T 5KYYA 3X26B 2DYIA 2HSEB 5CKHA 2HEQA 2LCSA 4OB0B 2PVOB 5LJ5g 3EAEA 2JZ2A 2CS7A 2QYZA 1G5VA 3HRTA 3GBQA 4Q5WA 1F1BB 3OYKA 4ZN1A 5CCAA 1I4K1 1K73R 4ORZA 2F2XA 2RD1A 2RH2A 2X35A 1AZGB 2K3BA 4LDUA 3L2WA 1M1KU 1G3SA 3C12A 1S72A 2A28A 3G4SA 1K9MU 4OB3B 4J9FA 1WXUA 2DZCA 2EYYA 2EQKA 5GMKj 2H8HA 3LH0A 2FVUA 2A7YA 2P0QA 4ESRA 2OTJA 3PIPA 2ZPEB 3VS2A 4OMNA 1T3LA 2EJGA 3H6ZA 2ZCFB 4RG8A 2WACA 3VRYA 4M7AA 1PRLC 5I22A 4AG2C 1JJ2P 3JAME 2AIRB 4PJOD 4D8DA 1YJ9A 2KBTA 2RQWA 2CSQA 3UPUA 1J3TA 2VC8A 4BACA 8ATCB 2PQWA 3BY7A 3EG3A 1AOJA 1HK9A 2LX9A 3H0HA 3EGDA 4M77A 1X01A 4DBRA 1ZUYA 2QA4T 5HCKA 3PVQA 3CCJA 1LPLA 3G71A 2FEIA 4XU0A 3QUIA 1VIEA 2NUPA 4QQGA 5FWBA 4F7UG 4M7DA 3CC2Q 2FPEA 3FIFA 1N9RA 1MMDA 2DXUA 1MNDA 4DBQA 2FO0A 1QW1A 1D3BB 4M78C 1YI2T 2KDSA 1R0BG 4DOVA 2K79A 1W2BA 2EQMA 2K5IA 2HKQB 2DJZA 2HAXA 3CMAQ 1ZSZB 1XOVA 1D1BA 1BYMA 4J9BA 1PM3A 2P0PA 2QG9B 4RTZA 2D6FA 3WVEB 1UECA 1VQ6A 1U06A 3A98A 3CPWP 2QQSA 3JSCA 2KY9A 2KK4A 2EVRA 2LX7A 3QDFA 3VV0A 2AZVA 1OOTA 4E7IA 3E2UA 1TUGB 3NPFA 3TVTA 1NYGA 3UF4A 3S3OA 4FYXB 4XAXB 1WZOA 4ANJA 4M78B 3P8BB 2ZPFB 1IZ6A 5FU6C 5AT1B 2YLBA 2LZ6B 3RIRA 3N5BB 3V7SA 1VQ8Q 5HY6A 3S3NA 1KD1U 1RLPC 1WQ7A 4OP0A 1N6AA 2NWMA 1O9SA 2EKHA 2KSSA 2DBKA 1G83A 3CC7Q 1D1CA 3QDRB 1WJRA 3L2QA 1IB8A 4OF1A 4M7DE 2LTOA 5GAN2 2NLUA 2OI3A 4IUTA 1GBRA 1VQKA 1UGQB 1YI2A 4DBHA 1G3YA 4WF2A 2HDAA 1AWOA 1JXOA 3EH1A 1YN8A 3V7RA 4FU6A 5GMKm 1T0JA 1YCSB 2JTEA 2M0YA 4FW1A 1N8RU 2BIVA 1BIAA 1I8FA 4HCZA 2D8JA 4LDVA 3ER0A 1KIKA 5GMKi 4J9CA 2LCLA 3M0PA 3FEOA 1B34B 2D1XA 4X34A 3UDCA 1H8KA 4C8QG 2YLCA 3CC2T 3CMAA 3C95A 2JM9A 1K9MC 4OMLA 3CBOA 2Y90A 1OEBA 1XQHA 4ZGDB 2Y4XA 1UFFA 3CPFA 1M4ZA 4F04B 2CDTA 4ZTJA 2WSCE 3EGDB 2KRSA 2QGFB 2DEUA 4C5EA 4ZTFA 3OYGA 4PJOC 2R57A 1UDLA 1WI7A 1PSEA 1A0NB 1TTHB 3EGXA 2CUBA 2A37A 1D0ZA 1WHLA 2B8AA 5D6WA 3J81E 4C92C 2DF6A 1QVGP 3OS1A 5A0LA 1I5OB 2P4RA 2L3RA 1K8AC 2HMAA 2KGTA 4PJJA 3S6WA 3PNWC 4M77C 1KC8C 2QQ9A 2ROTA 3ASKA 1V29B 1WX6A 1VQ6T 3OS0A 2KNBB 4HVWA 2V8IA 3CXCP 3CCMT 3CCQA 5KYYB 3PFSA 3HPWA 3MO8A 1RLQC 3NTIA 4M7DC 1TXQA 1G2BA 3F70A 5EC7A 4FW2A 3MHXA 4NS5A 4XU1A 2GTOA 3T9NA 4PJOA 4QVDA 6AT1B 2EW3A 2RPNA 2HBWA 1QWFA 2COZA 1R77A 2LRQA 4E2FB 1VQ8T 1X69A 4OB1B 4NOYA 2E10A 4M78A 2M0OA 2CUDA 4AFUC 4RKUE 1VQ7T 3JCMe 2DETA 2PVGB 2ROLA 3PT9A 1QP3A 1D0XA 1TOVA 3JCMP 1WHJA 1VQOT 3P8HA 5GAOr 1OQKA 3CCET 2V8KA 2X3XD 2FZKB 4FIBA 5KYUA 4C92D 4PLLA 3M4GA 4JRPA 5CO7A 5I2SA 4EPCA 2MWPA 3V8JA 1U8RA 4EMKC 1GFDA 4Z8AA 5GMKl 2QA4Q 1FMVA 2DIQA 4C5IA 1VQ4T 2VWFA 3VS7A 2DTIA 1JO8A 1QCNA 3EGXB 3D7SB 1XTDA 1Q95G 1KQSS 2YRVA 2XK0A 2JS2A 2F5TX 4X9DA 5KYXA 3LYIA 1AT1B 2DL3A 4M77B 5GAN7 4BDZA 3DLLA 2DAQA 5FROA 4LE9A 2PUKB 2E4HA 2MAMA 2SEMA 1QKXA 3MP1A 1NBEB 1AEYA 2MYSA 2NUPB 3QG1A 4JS4A 4LDWA 3H8ZA 5GAOp 1VQLA 5GAMf 1UGPB 3UT1A 3ZFJA 4KH0B 2V26A 1V76A 2JS0A 1QVFA 4EMKB 3MPUB 3M54A 5CQXA 2J06A 2Z0WA 2ED1A 2RJEA 3QPHA 2JTFA 2KRMA 1KJWA 1ZA2B 4QW2A 3CC4T 4QVZA 1TUCA 2VUBA 2QEXT 4B6MA 4OMPA 1K1ZA 2EGEA 3I56Q 3LLRA 2CP5A 1NPPA 2KYMA 2OTJQ 4KGZB 4BY6C 4AG1C 1BCOA 3THKA 3EHQA 3LWIA 2CP2A 2K57A 4LUDA 5I2MA 1VYVA 3BE3A 2RHIA 3Q1JA 1C1AA 1VQNA 2EKOA 3OB9A 2RA2A 4V2SA 1T3SA 1H641 3H0IA 1W70A 1WLPB 1CKAA 3CC7T 1NYFA 1MNEA 4JUVA 2XDBA 2O01E 1HXDA 3EG0A 2F2WA 2DJQA 4N4GA 2LCCA 3J80E 1HJDA 3OSSC 5GAMh 2XMFA 3X25B 3SWNC 3PMTA 1OYXA 4XQ3A 5IHNA 2LP5A 3JCMd 3VS3A 2MCNA 1RAGB 4C92B 1SF9A 1M3AA 2OAUA 3AT1B 1QVFP 2FYKA 2HQEA 1IGQA 3GNGA 2C0IA 2EGAA 3H0FA 2B86A 2LT4A 1K73C 4HVUA 3ZL7C 2RHZA 2ECZA 5GAN5 2YUPA 1VQNQ 5GANd 2MIOA 4X9CA 1WPYA 2G3RA 4JLGA 2CP3A 1W2BP 2VVKA 2O4XB 5KYWB 1VYTA 2EIFA 3VRZA 3SFMA 2XI9A 2COYA 3OSVA 2BZXA 2XHCA 2E6NA 4GLKA 3LWHA 1V1CA 3I56A 4BE0A 1NEBA 2A3LA 3JB9F 4C8QF 2D9TA 1VQ5Q 3O8VA 3MJXA 1U5SA 1B07A 5ECAA 4KH1B 4R56A 2DRMA 2E3IA 4R0KA 1AZEA 1AWXA 4J9HA 2O31A 3MEUA 4M7DD 4JLIA 1JB0E 1K0SA 1WHGA 3KXTA 2EYWA 4J7FA 4RUGA 3OYDA 2CGHA 3RKXA 3OQ5A 4EDUA 4BE2A 4OMFB 1RAIB 3CCRT 4IUVA 2DL8A 2L89A 3CCSQ 2YUOA 1GRIA 1RAAB 4RTXA 2QA4A 2COWA 4PLIA 1YI2Q 2P84A 1PSFA 3RERA 1SSHA 1JEGA 4LD9K 3I35A 3OMGA 1NLPC 1OV3A 1TS9A 1XJWB 4Z89A 3JB9D 1VQ5A 1TG0A 3A8MB 1KC8U 2A36A 1BK2A 2I2LA 3M0UA 4BDYA 3OW2S 2CT3A 4MDXA 1W4SA 2X9HA 1GCPA 2ED0A 2DL7A 3FLGA 3R6OA 1VQOQ 4FL6A 2EJFA 2VASA 2A0FB 1VQLQ 3CC4Q 3LH5A 1XNIA 1OU9A 2F5KA 4C0GA 2MF2A 3A8LB 1WYXA 2DM1A 2GCXA 2HNIA 1SRMA 3RESA 2FZCB 2RN8A 3SDZA 2PTKA 2D0NA 4PFOA 1YIJT 2JUFA 2DERA 1GFCA 3I55A 4JPBW 4RCBA 4M77G 4NL2A 3OYFA 2JVVA 1PD1A 2CKKA 3C4SA 1PKSA 3M0RA 5GAOq 2YSQA 3LW5E 4KGXB 5GJVB 4C8QB 1ZSZA 4E7ZA 4C92E 4OMMA 4BE1A 1EX4A 3QWYA 1N8RC 5FU7C 2DKGA 1W2BS 4DQ2A 4F7UF 4IUUA 2EQJA 1BCMA 1QCFA 1I5LA 1PWTA 4FYYB 1VQ9T 3FRNA 3CMEA 2NUTA 3JCMW 3QBYA 3CCQQ 2OTLA 3JCMh 1QCOA 3JRZA 1RAEB 1QVPA 2GFAA 1BBZA 5J26A 2D0QB 4IUPA 1Q7YC 3VS1A 4A4HA 2K4YA 2KXCA 3I9QA 1NE8A 5IXBA 3OYLA 2HQHA 2RNAA 3CQTA 4O6JA 2XD0A 3SB2A 4J7IA 4TVRA 3M9QA 2L3SA 4M78G 2OTJT 2DZ9A 1KC8R 4HCBA 2M9UA 2HCKA 1MV3A 4J9GA 1WHKA 2V1QA 1NPRA 3VS0A 4Z02A 2C0TA 3CCRQ 2AK5A 2KRNA 2ESWA 1AVZC 1M2VA 1M8MA 3L2VA 3A1PA 3PVLA 4RTUA 4PJNA 3RMSA 1ABQA 3M57A 3TCJA 1UE9A 4QKUA 1ZUUA 2FPDA 3FJPA 3HFNA 3I55Q 4J9IA 2IIMA 1VQ7A 4F17A 2DBMA 1VQ8A 2KVQG 1S1NA 1G3TA 1Y57A 5J3BA 1Q81U 3JCMX 2DTOA 4M75E 5GJWB 3WXMB 3E9FA 4AFSC 4DBFA 1UEBA 4X1VA 4C92A 2W10A 3ME9A 4PK4A 2L0AA 1OZ2A 1WIEA 2EQUA 3EHRA 1R8OB 2CH4W 2GQIA 2DILA 1D0YA 2KMTA 5DM7R 1IHWA 2CH4A 4CC7A 2FRWA 2JMCA 2R5AA 5GMKh 4PJMA 2NUZA 3RKWA 1M1FA 2HKNA 2AKKA 3X28B 5FRMA 2KI7A 2YUNA 5GANe 2ZPIB 4CC4B 3UA7A 3RR6A 4F7UE 5GAMe 1VQMA 3M4YA 4ATOA 1SRLA 4L6V5 4A54A 2HBPA 1UUEA 4E47A 1UJ0A 3PMIA 1K9AA 2XDPA 9ATCB 3G6EA 4PKCC 1VQ5T 1RADB 3M0SA 2DMOA 1FYNA 4HVVA 2AHJB 2QGGA 2HL5C 1W6XA 1RAHB 1I1JA 1KHCA 1VQ6Q 4DOWA 1WXBA 5FW9A 4M78F 3HRSA 1VQMT 4LXCA 1JQQA 2VGNA 2I0NA 1CKBA 1OPLA 3GOXA 1VQOA 3JCMb 1YJWA 2C06A 2K3XA 1YIJQ 5HK3A 1DJ7B 3H9NA 1HD3A 2L3QA 4OVAA 2DTHA 5KH6A 3OY9A 2DLPA 4HCKA 4RCCA 4JS5A 2DFUA 4ME7A 3SHWA 5GAMg 3RKYA 2J6OA 2PU9B 5GAN4 2XU8A 3OYYA 2YRCA 2LQWA 2QQBA 2LQKA 4M4ZA 5CKDA 4ZGEB 5C6SA 2HL3A 3EG9B 3PIOA 5KYXB 4F16A 2K7AA 3BFMA 1B3QA 4OB2B 4C0FA 3DB4A 1YWPA 1VQLT 1HYOA 2QI2A 2VV5A 5I11A 2RHXA 1UB4A 4ZNXA 2CZ0B 2HD0A 1GL5A 4IIMA 4PL6A 2L2PA 3LGFA 4E7JA 3OMCA 3HRUA 1YJNQ 1OI1A 1UJYA 3OW2P 2ZAEA 4XU2A 2EBPA 2LC4A 2JW4A 2JOYA 3QYGB 1TUDA 4MZMA 1NZ9A 1YITT 4EMGA 2L3PA 1KQSA 4D8KA 1KD1R 5KCOA 1ZUKA 5FU7B 3O5ZA 3CCUT 2XICA 4C8QC 4C0DB 3PE0A 2Y4YA 2LQ8A 4LN2A 1PHTA 1YNZA 3DB3A 2QDYB 2E5KA 1JRIA 3M0TA 1ZBXA 1PKTA 1BI1A 3VS4A 5GANj 1LVKA 3CCRA 2DVJA 1YBYA 3GLXA 4EMHA 1EIFA 4M75F 3BW1A 2JXBA 3PGGA 1AWJA 1M9SA 1QVFS 3EH2A 2QK0A 3RNJA 3JB9I 3OBYA 2D8HA 1QVGA 1M30A 1YHQT 1FMWA 2K3YA 1QWEA 4BB7A 2AT1B 1RI9A 3A8OB 2HSPA 4JJCA 2ATCB 2DXBA 4D6WA 1N27A 2K2MA 2LNVA 4E7HA 4ELZC 1IGUA 1PG5B 1MV0B 4J6WA 3MEVA 4FYVB 4BY6B 1AD5A 2MMPA 1M2OA 1YWOA 4M7AG 1KHIA 1Y96A 2V8JA 5CK9A 3CCEA 5IAYA 5CQYA 3CCJQ 4FCYA 1LOJA 2BE9B 4KBMB 4CC2A 2CP6A 1Q86C 2J05A 3G7ZA 2VXEA 4A4EA 1JJ2A 4PJOG 3S3MA 3NGPA 4Z88A 3QWXX 3CBMA 1I0CA 2PNIA 3I55T 3BDLA 1NLOC 1X6GA 2H3JA 2RK1A 1Q7YU 1WGSA 5D7UA 2EGCA 4C8QE 1KK7A 4A63B 1KSWA 3GF5A 5KCHA 1ZX6A 3CCVQ 2X51A 3EFRA 4GBQA 5IXFA 3G1JA 3CC7A 5M9OA 2XDDA 3G4SQ 4ZGJB 1UG1A 3HKSA 4KT0E 1Q82R 3CXCA 1OX9A 1GCQA 2FZGB 3WVDB 3INZA 3C0CA 4WCIA 3CMEQ 2KE9A 4LUEA 1RACB 4XTYA 4M7AE 3JCMg 1SKUB 1IREB 1ZBJA 4M7DB 2GFUA 1VOMA 4KGVB 2JN0A 3JCMc 5GAMj 2QAZA 3V7CA 4P5NA 4JZ4A 4C92G 2LVMA 1OULA 3E1SA 1YCYA 4R55A 2LJ1A 2O9SA 3NMZC 2GQVA 2DXCA 3M55A 2ABLA 1UTIA 4M78E 5GMKe 5LL6S 4C0ZA 1YJNT 4IKFA 1U1TA 3QYHB 1WQWA 1BI0A 2K5FA 2DNUA 4XTZA 1H3HA 3I5RA 1NJIR 1JJ2S 2YWWA 4BI8B 3CCST 3MP6A 3UWNA 4MMLA 3REAB 2IPOB 5GAOl 2MPXC 2RHUA 2DL4A 5LJ5e 4LNPA 1VUBA 1UHFA 5CIUA 4AFQC 5CKEA 2KT1A 2GTJA 3M5AA 1Z9QA 3EFSA 1GCQC 3DLMA 1VYUA 8AT1B 4CC3A 1KQSP 4FSXA 2P4TA 2J6KA 4E7LA 4FSSA 2YDLA 2ZPHB 3GPLA 5LJ5j 1LJOA 2KT8A 2HQXA 2YRDA 3UATA 3OYMA 3OW2A 2YUQA 3JCMJ 1Y7XA 1KFZA 1MMNA 2DA9A 5FLXE 5GANg 2DVEA 3CXCS 1I81A 3SWNB 4J9DA 2CYZB 1MGQA 1ZSGA 3BDUA 1YJ9T 3CCVT 1HSQA 1ZHIA 4HA8A 1IHVA 3CC2A 1K8AU 4C8QD 4K11A 3IQLA 3LGLA 1QQJA 1PC0A 2RF0A 2EWNA 4FM4B 3A5ZB 3GNFB 2GBQA 1WDXA 1FXXA 3EFOB 2JNGA 4BUGA 2F1LA 4J5YA 5GAN3 4DEYA 1QMCA 1YITQ 5IHKA 1SHFA 3FJ5A 1VQ4A 3G4ST 2PZ1A 1EFNA 2LNHB 2ENMA 3QXEB 2O2OA 4PFZA 1X2QA 4J9EA 3QHSA 4M75A 1UGVA 3QJ6A 4HXJA 3VS6A 2G6FX 4JJDA 5LJ3h 3G71T 3EG1A 3CCLA 3CMET 5LJ3j 1WJSA 1RAFB 1K76A 1YHQA 1OPKA 1S72Q 4E7SA 1UGRB 1X43A 1VQ9Q 2C0OA 2DYBA 1KQ1A 3CCEQ 3KUFA 3CCQT 2L8DA 2KEAA 4B9WA 1BI2A 2RJDA 3EG2A 1MMGA 5A0GA 2H3EB 5D6XA 2FPFA 1M5Q1 1Q81C 2FG0A 3E19A 5CKFA 2E70A 2GGRA 3JCMf 2J7IA 2YT6A 3JB9H 2RMOA 2J6FA 1PD0A 4L5GA 3MP8A 1BI3A 3L2UA 1KD1C 2R58A 5L8RE 2VGMA 3RBBB 2PVDB 1VQ4Q 1M90U 2MI6A 3MCAB 1N8RR 2K5LA 5KYNA 4WTOB 1RUWA 1C0MA 5FU6B 5A0DA 5C0MA 4C5HA 4M77D 3HP9A 1UHCA 5I21A 3QO3A 3CCVA 1D1AA 2K6DA 3A8HB 2LJ0A 1BB9A 1TSFA 1C6VX 3CCSA 1PRMC 2PUOB 1Q82U 1YJWT 3EG9A 2KQWA 5DY9A 2O88A 4OGCA 4M75D 2X3WD 4PJOB 3URGA 2DK3A 4Y92A 2RI2A 3OS2A 2QXFA 7AT1B 3FDRA 4CRIA 2RJCA 2EPDA 1IXDA 2E41A 1YJNA 2ZPGB 2DO3A 3CCUA 5GAN8 4AMCA 1YITA 2FRYA 1M3BA 1ZSZC 5AYFA 4Y28E 4UC4A 2MOXA 3SEMA 2NYSA 3C94A 4FYWB 2X4YA 1M90R 3JCMQ 3CC4A 3CCLQ 3L2RA 1D3BA 4IURA 2CP0A 3UA6A 3CBPA 3ZBDA 2MWOA 4M77F 2O4XA 4C5GA 1WNLA 5GAOn 1ACMB 2CP7A 5HK0A 3I5SA 5CAIA 4E6RA 1VA7A 2JJ9A 4CI0C 5LJ3f 2CZ1B 1JXMA 3VUZA 2EYXA 2YXYA 1ZQ1A 2GNCA 1IO6A 4DEXA 4A4FA 2YHTA 4JRIA 4BD3A 5A2QE 3OYCA 2LJ3A 4GLMA 3M56A 2VYTA 3P8DA 1E6HA 3JCMV 5GAMd 3KBGA 2CREA 2JM8A 4QT7A 1N5ZA 4EMKA 4RTTA 4F14A 3ULRB 1G8XA 1X75C 3M59A 2L5QA 3L2ZA 4IUQA 4O5VA 2VKNA 1JBMA 1Q82C 2OTLQ 2WSFE 4MDWA 4C0DC 1D09B 4XTXA 3GIBA 3VJPA 1KQ2A 5LJ5h 1NG2A 1X27A 2P0KA 1NM7A 3OYBA 3KFVA 5IN1A 1RI0A 3OYAA 3AHUA 2K2VA 2KYBA 4PFPA 1LNXA 3OBWA 4E7KA 3RDVA 2CZ7B 4II1A 1ZLMA 3CCUQ 3MKDA 3NTKA 1NEGA 5EG2A 1MMAA 1YFNA 4HKEA 2O9VA 1ABOA 2W0ZA 4QQ6A 2QDLA 5GAOm 3FC3A 2AZSA 3QZ9B 3QIIA 2E64A 1Z9ZA 1YJWQ 5KE2A 5LJ5d 3VYHB 3TSWA 2E1HA 2OAWA 2V1RA 4XK8E 1TWBA 3LX7A 2X4JA 1Q86R 3V8KA 1K0XA 4RG2A 1P92A 3SD4A 3TSZA 2FB7A 3V8LA 3TEEA 2LDMA 1YHQQ 4NL3A 1GBQA 1Y71A 3M58A 1X6BA 4XTVA 1YJ9Q 1B34A 3HFOA 3MEAA 5HKCA 1E6GA 2DIGA 4XTWA 3CCMQ 4M78D 2RI5A 1QP2A 1WHHA 1SPKA 2QTVA 1M8VA 1UGSB 3CCLT 1X6OA 2F2VA 5D6YA 1PNJA 4LDYA 1U3OA 3M0QA 5CR2A 4OMOA 2XIDA 2VXFA 1SHGA 4N0AC 3M53A
chains in the Genus database with same CATH topology
1SSHA 1JEGA 1T0HA 4A63B 1KSWA 3I35A 1W1FA 4Z89A 1NLPC 1OV3A 1ZX6A 3UF4A 1TG0A 5L23A 2LMJA 2A36A 1BK2A 4GBQA 3M0UA 3REBB 5IXFA 2CT3A 1QKWA 1GCPA 2ED0A 2DL7A 1UG1A 1M3CA 2LZ6B 1GCQA 1RLPC 3LH5A 2KR3A 3C0CA 4WCIA 2NWMA 2KE9A 2BTTA 4LUEA 1WYXA 2EKHA 2DM1A 4RTYA 2DBKA 1G83A 1SRMA 1JU5C 5FWCA 1ZBJA 2OJ2A 2OI3A 1GBRA 2RN8A 1M27C 1X2KA 2PTKA 2D0NA 2RQTA 2HDAA 1AWOA 5IH2A 1JXOA 1GFCA 1YN8A 4JPBW 1T0JA 1YCSB 2JTEA 2A08A 2M0YA 2K9GA 1PKSA 2D8JA 3M0RA 1WXTA 4JZ4A 2YSQA 1KIKA 5GJVB 4J9CA 2LJ1A 1K4US 2O9SA 4JJBA 4OMMA 3M0PA 3QWYA 5IHIA 3NMZC 2JMAA 2AKLA 2D1XA 2ABLA 1H8KA 1UTIA 3VS5A 1QCFA 1ARKA 2JM9A 2DNUA 3R6NA 1PWTA 1H3HA 4OMLA 3I5RA 1OEBA 2LQNA 1UFFA 2KROA 2CDTA 3EGUA 3REAB 2M51A 2KRSA 1BBZA 1QLYA 3VS1A 2DL4A 4LNPA 1H92A 2KXCA 1UHFA 3I9QA 4AFQC 5IXBA 2RNAA 3CQTA 2KT1A 2GTJA 1UDLA 1Z9QA 1WI7A 1E7OA 1GCQC 2L3SA 1VYUA 1A0NB 4CC3A 2CUBA 2J6KA 2A37A 4JZ3A 4FSSA 2YDLA 2HCKA 2KT8A 1MV3A 2DF6A 4J9GA 2P4RA 3UATA 2CSIA 2V1QA 2YUQA 2KGTA 3VS0A 2C0TA 2DE0X 1KFZA 2AK5A 2DA9A 2KRNA 2DL5A 2ROTA 2ESWA 1AVZC 1WX6A 1M8MA 4J9DA 2KNBB 4HVWA 1ZSGA 4IIOA 3PVLA 4RTUA 2CT4A 1HSQA 4K11A 3IQLA 1ABQA 1RLQC 2RF0A 4OMQA 2GBQA 1WDXA 1G2BA 1UE9A 1ZUUA 5EC7A 2FPDA 2GTOA 4DEYA 4J9IA 2IIMA 4F17A 1SHFA 2DBMA 2EW3A 3FJ5A 5IHKA 2RPNA 1S1NA 1Y57A 2HBWA 1EFNA 2PZ1A 2LNHB 2RQVA 2ENMA 1QWFA 2DRKA 5GJWB 2O2OA 1X2QA 4J9EA 4AFSC 1X69A 1UGVA 4HXJA 3VS6A 4X1VA 3JV3A 2G6FX 4JJDA 3EG1A 2W10A 2L0AA 2CUDA 4AFUC 1K76A 2RQRA 1WIEA 1OPKA 3EHRA 1Y0MA 2SRCA 2CH4W 1X43A 4EIKA 2GQIA 2DILA 2C0OA 2ROLA 2DYBA 2CH4A 4CC7A 2FRWA 2JMCA 2KEAA 3EG2A 2X3XD 2NUZA 2AKKA 2FPFA 2YUNA 2FG0A 1FMKA 2GGRA 2J7IA 2YT6A 4CC4B 3UA7A 2RMOA 1GFDA 2J6FA 4Z8AA 1SRLA 2VWFA 3VS7A 1MUZA 1UUEA 1JO8A 1UJ0A 1WFWA 2EQIA 3RBBB 2JS2A 1K9AA 2BZYA 3H41A 3M0SA 2DMOA 1RUWA 1FYNA 2DL3A 4HVVA 2JT4A 1YP5A 1UHCA 2EYZA 1W6XA 4LE9A 4KRTA 1I1JA 2K6DA 2DX1A 2LJ0A 2SEMA 2RQUA 1BB9A 1QKXA 1PRMC 1WXBA 5FW9A 1AEYA 1JQQA 2I0NA 1CKBA 1OPLA 2O88A 1AWWA 2X3WD 1WA7A 2JS0A 1BU1A 4Y92A 4AFZC 4RTVA 1LCKA 2EPDA 2J06A 2ED1A 1SEMA 1HD3A 2KRMA 1KJWA 1I07A 2FRYA 2L3QA 1M3BA 1CSKA 2DLPA 4HCKA 1TUCA 3U23A 2MOXA 3SHWA 3NHNA 4RTWA 4OMPA 3SEMA 1K1ZA 2EGEA 2J6OA 2KXDA 2BZ8A 2KYMA 3UA6A 4AG1C 2LQWA 3THKA 3EHQA 4M4ZA 2HEQA 4LUDA 2LCSA 1VYVA 3I5SA 4F16A 2K7AA 1VA7A 4E6RA 1B3QA 1YWPA 3GBQA 1JXMA 5I11A 2EYXA 1T3SA 4ZNXA 1GL5A 2GNCA 1IO6A 4ORZA 4IIMA 4DEXA 3H0IA 2F2XA 1W70A 2L2PA 1WLPB 1CKAA 1NYFA 1AZGB 2K3BA 1UJYA 2LJ3A 2A28A 4GLMA 2EBPA 2JW4A 3EG0A 2F2WA 4J9FA 1E6HA 1WXUA 2DJQA 2EYYA 1TUDA 1HJDA 2H8HA 2CREA 2JM8A 2XMFA 4QT7A 1N5ZA 2L3PA 4D8KA 4ESRA 5IHNA 2LP5A 1ZUKA 4RTTA 3ULRB 4F14A 3O5ZA 3VS2A 4OMNA 1T3LA 2MCNA 3VS3A 2VKNA 3PE0A 1M3AA 4LN2A 3VRYA 1PHTA 1YNZA 2E5KA 1PRLC 1NG2A 3M0TA 1PKTA 1X27A 1NM7A 3VS4A 5I22A 2C0IA 2EGAA 3H0FA 4AG2C 2B86A 2DVJA 4HVUA 3KFVA 4D8DA 2KBTA 3ZL7C 2ECZA 2KYBA 2RQWA 2JXBA 2CSQA 2YUPA 1J3TA 2MIOA 1AWJA 2VVKA 3RNJA 2D8HA 1VYTA 1AOJA 1ZLMA 3EG3A 1M30A 3H0HA 3VRZA 1QWEA 1NEGA 1RI9A 1ZUYA 2HSPA 2BZXA 2O9VA 1ABOA 2W0ZA 4JJCA 2QDLA 5HCKA 2AZSA 3PVQA 1Z9ZA 1V1CA 2K2MA 2FEIA 1NEBA 3TSWA 2OAWA 5FWBA 2V1RA 2FPEA 1U5SA 1B07A 5ECAA 1MV0B 1K0XA 2DRMA 1AD5A 3TSZA 2FO0A 4R0KA 1YWOA 1AZEA 1GBQA 2K79A 1AWXA 1X6BA 4J9HA 4CC2A 2O31A 2J05A 1E6GA 1K0SA 1XOVA 2EYWA 4J9BA 4RUGA 3NGPA 4RTZA 1SPKA 1UECA 4Z88A 1U06A 2F2VA 3A98A 3QWXX 1PNJA 2DL8A 2PNIA 1I0CA 1U3OA 2YUOA 1GRIA 2LX7A 2EVRA 2AZVA 1OOTA 1NLOC 4RTXA 1X6GA 3M0QA 4OMOA 1SHGA 3NPFA 3TVTA 2EGCA 1NYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSH A;  1JEG A;  1T0H A;  4A63 B;  1KSW A;  3I35 A;  1W1F A;  4Z89 A;  1NLP C;  1OV3 A;  1ZX6 A;  3UF4 A;  1TG0 A;  5L23 A;  2LMJ A;  2A36 A;  1BK2 A;  4GBQ A;  3M0U A;  3REB B;  5IXF A;  2CT3 A;  1QKW A;  1GCP A;  2ED0 A;  2DL7 A;  1UG1 A;  1M3C A;  2LZ6 B;  1GCQ A;  1RLP C;  3LH5 A;  2KR3 A;  3C0C A;  4WCI A;  2NWM A;  2KE9 A;  2BTT A;  4LUE A;  1WYX A;  2EKH A;  2DM1 A;  4RTY A;  2DBK A;  1G83 A;  1SRM A;  1JU5 C;  5FWC A;  1ZBJ A;  2OJ2 A;  2OI3 A;  1GBR A;  2RN8 A;  1M27 C;  1X2K A;  2PTK A;  2D0N A;  2RQT A;  2HDA A;  1AWO A;  5IH2 A;  1JXO A;  1GFC A;  1YN8 A;  4JPB W;  1T0J A;  1YCS B;  2JTE A;  2A08 A;  2M0Y A;  2K9G A;  1PKS A;  2D8J A;  3M0R A;  1WXT A;  4JZ4 A;  2YSQ A;  1KIK A;  5GJV B;  4J9C A;  2LJ1 A;  1K4U S;  2O9S A;  4JJB A;  4OMM A;  3M0P A;  3QWY A;  5IHI A;  3NMZ C;  2JMA A;  2AKL A;  2D1X A;  2ABL A;  1H8K A;  1UTI A;  3VS5 A;  1QCF A;  1ARK A;  2JM9 A;  2DNU A;  3R6N A;  1PWT A;  1H3H A;  4OML A;  3I5R A;  1OEB A;  2LQN A;  1UFF A;  2KRO A;  2CDT A;  3EGU A;  3REA B;  2M51 A;  2KRS A;  1BBZ A;  1QLY A;  3VS1 A;  2DL4 A;  4LNP A;  1H92 A;  2KXC A;  1UHF A;  3I9Q A;  4AFQ C;  5IXB A;  2RNA A;  3CQT A;  2KT1 A;  2GTJ A;  1UDL A;  1Z9Q A;  1WI7 A;  1E7O A;  1GCQ C;  2L3S A;  1VYU A;  1A0N B;  4CC3 A;  2CUB A;  2J6K A;  2A37 A;  4JZ3 A;  4FSS A;  2YDL A;  2HCK A;  2KT8 A;  1MV3 A;  2DF6 A;  4J9G A;  2P4R A;  3UAT A;  2CSI A;  2V1Q A;  2YUQ A;  2KGT A;  3VS0 A;  2C0T A;  2DE0 X;  1KFZ A;  2AK5 A;  2DA9 A;  2KRN A;  2DL5 A;  2ROT A;  2ESW A;  1AVZ C;  1WX6 A;  1M8M A;  4J9D A;  2KNB B;  4HVW A;  1ZSG A;  4IIO A;  3PVL A;  4RTU A;  2CT4 A;  1HSQ A;  4K11 A;  3IQL A;  1ABQ A;  1RLQ C;  2RF0 A;  4OMQ A;  2GBQ A;  1WDX A;  1G2B A;  1UE9 A;  1ZUU A;  5EC7 A;  2FPD A;  2GTO A;  4DEY A;  4J9I A;  2IIM A;  4F17 A;  1SHF A;  2DBM A;  2EW3 A;  3FJ5 A;  5IHK A;  2RPN A;  1S1N A;  1Y57 A;  2HBW A;  1EFN A;  2PZ1 A;  2LNH B;  2RQV A;  2ENM A;  1QWF A;  2DRK A;  5GJW B;  2O2O A;  1X2Q A;  4J9E A;  4AFS C;  1X69 A;  1UGV A;  4HXJ A;  3VS6 A;  4X1V A;  3JV3 A;  2G6F X;  4JJD A;  3EG1 A;  2W10 A;  2L0A A;  2CUD A;  4AFU C;  1K76 A;  2RQR A;  1WIE A;  1OPK A;  3EHR A;  1Y0M A;  2SRC A;  2CH4 W;  1X43 A;  4EIK A;  2GQI A;  2DIL A;  2C0O A;  2ROL A;  2DYB A;  2CH4 A;  4CC7 A;  2FRW A;  2JMC A;  2KEA A;  3EG2 A;  2X3X D;  2NUZ A;  2AKK A;  2FPF A;  2YUN A;  2FG0 A;  1FMK A;  2GGR A;  2J7I A;  2YT6 A;  4CC4 B;  3UA7 A;  2RMO A;  1GFD A;  2J6F A;  4Z8A A;  1SRL A;  2VWF A;  3VS7 A;  1MUZ A;  1UUE A;  1JO8 A;  1UJ0 A;  1WFW A;  2EQI A;  3RBB B;  2JS2 A;  1K9A A;  2BZY A;  3H41 A;  3M0S A;  2DMO A;  1RUW A;  1FYN A;  2DL3 A;  4HVV A;  2JT4 A;  1YP5 A;  1UHC A;  2EYZ A;  1W6X A;  4LE9 A;  4KRT A;  1I1J A;  2K6D A;  2DX1 A;  2LJ0 A;  2SEM A;  2RQU A;  1BB9 A;  1QKX A;  1PRM C;  1WXB A;  5FW9 A;  1AEY A;  1JQQ A;  2I0N A;  1CKB A;  1OPL A;  2O88 A;  1AWW A;  2X3W D;  1WA7 A;  2JS0 A;  1BU1 A;  4Y92 A;  4AFZ C;  4RTV A;  1LCK A;  2EPD A;  2J06 A;  2ED1 A;  1SEM A;  1HD3 A;  2KRM A;  1KJW A;  1I07 A;  2FRY A;  2L3Q A;  1M3B A;  1CSK A;  2DLP A;  4HCK A;  1TUC A;  3U23 A;  2MOX A;  3SHW A;  3NHN A;  4RTW A;  4OMP A;  3SEM A;  1K1Z A;  2EGE A;  2J6O A;  2KXD A;  2BZ8 A;  2KYM A;  3UA6 A;  4AG1 C;  2LQW A;  3THK A;  3EHQ A;  4M4Z A;  2HEQ A;  4LUD A;  2LCS A;  1VYV A;  3I5S A;  4F16 A;  2K7A A;  1VA7 A;  4E6R A;  1B3Q A;  1YWP A;  3GBQ A;  1JXM A;  5I11 A;  2EYX A;  1T3S A;  4ZNX A;  1GL5 A;  2GNC A;  1IO6 A;  4ORZ A;  4IIM A;  4DEX A;  3H0I A;  2F2X A;  1W70 A;  2L2P A;  1WLP B;  1CKA A;  1NYF A;  1AZG B;  2K3B A;  1UJY A;  2LJ3 A;  2A28 A;  4GLM A;  2EBP A;  2JW4 A;  3EG0 A;  2F2W A;  4J9F A;  1E6H A;  1WXU A;  2DJQ A;  2EYY A;  1TUD A;  1HJD A;  2H8H A;  2CRE A;  2JM8 A;  2XMF A;  4QT7 A;  1N5Z A;  2L3P A;  4D8K A;  4ESR A;  5IHN A;  2LP5 A;  1ZUK A;  4RTT A;  3ULR B;  4F14 A;  3O5Z A;  3VS2 A;  4OMN A;  1T3L A;  2MCN A;  3VS3 A;  2VKN A;  3PE0 A;  1M3A A;  4LN2 A;  3VRY A;  1PHT A;  1YNZ A;  2E5K A;  1PRL C;  1NG2 A;  3M0T A;  1PKT A;  1X27 A;  1NM7 A;  3VS4 A;  5I22 A;  2C0I A;  2EGA A;  3H0F A;  4AG2 C;  2B86 A;  2DVJ A;  4HVU A;  3KFV A;  4D8D A;  2KBT A;  3ZL7 C;  2ECZ A;  2KYB A;  2RQW A;  2JXB A;  2CSQ A;  2YUP A;  1J3T A;  2MIO A;  1AWJ A;  2VVK A;  3RNJ A;  2D8H A;  1VYT A;  1AOJ A;  1ZLM A;  3EG3 A;  1M30 A;  3H0H A;  3VRZ A;  1QWE A;  1NEG A;  1RI9 A;  1ZUY A;  2HSP A;  2BZX A;  2O9V A;  1ABO A;  2W0Z A;  4JJC A;  2QDL A;  5HCK A;  2AZS A;  3PVQ A;  1Z9Z A;  1V1C A;  2K2M A;  2FEI A;  1NEB A;  3TSW A;  2OAW A;  5FWB A;  2V1R A;  2FPE A;  1U5S A;  1B07 A;  5ECA A;  1MV0 B;  1K0X A;  2DRM A;  1AD5 A;  3TSZ A;  2FO0 A;  4R0K A;  1YWO A;  1AZE A;  1GBQ A;  2K79 A;  1AWX A;  1X6B A;  4J9H A;  4CC2 A;  2O31 A;  2J05 A;  1E6G A;  1K0S A;  1XOV A;  2EYW A;  4J9B A;  4RUG A;  3NGP A;  4RTZ A;  1SPK A;  1UEC A;  4Z88 A;  1U06 A;  2F2V A;  3A98 A;  3QWX X;  1PNJ A;  2DL8 A;  2PNI A;  1I0C A;  1U3O A;  2YUO A;  1GRI A;  2LX7 A;  2EVR A;  2AZV A;  1OOT A;  1NLO C;  4RTX A;  1X6G A;  3M0Q A;  4OMO A;  1SHG A;  3NPF A;  3TVT A;  2EGC A;  1NYG A; 
#chains in the Genus database with same CATH topology
 2ZZD A;  1T0H A;  3MEW A;  1B7T A;  4M75 B;  3OYN A;  4C92 F;  1VQP A;  3FB9 A;  1W1F A;  1OZ3 A;  4BI4 A;  1GXI E;  4HT9 A;  4XTU A;  5L23 A;  4KUD K;  2LMJ A;  1K73 U;  3REB B;  1RL2 A;  2XG8 D;  1M90 C;  4LDX A;  1QKW A;  3HL8 A;  1VQ7 Q;  4PJO E;  4LD6 A;  1M3C A;  3TQ7 P;  1Q81 R;  4GY5 A;  3QKJ A;  4PJO F;  5CVI A;  5LJ3 g;  1KG1 A;  2EFI A;  2RI3 A;  2OTL T;  3CEY A;  4J8O A;  2KR3 A;  3CD6 A;  5CKB A;  2XKO C;  2BTT A;  1FX7 A;  4RTY A;  4M7D G;  1QVG S;  4VUB A;  3VYG A;  3G6E T;  1JU5 C;  5FWC A;  2OJ2 A;  1BIB A;  1M27 C;  3TRE A;  4DA4 A;  1X2K A;  2M1H A;  2RQT A;  5IH2 A;  1BKB A;  3MET A;  4FT2 A;  4ELY C;  4HCC A;  3J7A F;  2A08 A;  4QVC A;  1M2V B;  2K9G A;  5DLO A;  1WXT A;  3CPW A;  1SG5 A;  1R0C B;  4A4K A;  4BI3 A;  3CCJ T;  1K4U S;  4JJB A;  4AT1 B;  5IHI A;  2JMA A;  4N4H A;  2AKL A;  2EAY A;  3VS5 A;  3RMQ A;  1ARK A;  1K8A R;  2R5M A;  5GAN h;  3R6N A;  2KAF A;  2CZ6 B;  3A8G B;  3VU3 C;  1Y96 B;  2LQN A;  5IT9 E;  2KRO A;  1RAB B;  3EGU A;  4N4I A;  1VIF A;  2M51 A;  3GP8 A;  2DD5 A;  3HSB A;  3NFC A;  1VQK Q;  3RUX A;  1QLY A;  4N0A A;  4M77 E;  1H92 A;  5KYU B;  1VQP T;  4KUI A;  3DKM A;  4F7U A;  1E7O A;  4ZN3 A;  2X4W A;  3HTR A;  2QEX Q;  1YIJ A;  2QTX A;  5DLQ E;  4JZ3 A;  4MZT A;  3X24 B;  4J6X A;  2E3H A;  3VUB A;  2CSI A;  2RO0 A;  2JTM A;  1OU8 A;  3JB9 J;  4YTL A;  4PJL A;  3CD6 T;  2DE0 X;  2DL5 A;  4M75 C;  2IVW A;  2F69 A;  3VKI A;  3OS5 A;  3TU4 K;  1VQ9 A;  1NJI U;  4IIO A;  4RMO A;  2CT4 A;  1OX8 A;  1AHJ B;  3CMA T;  3OYH A;  1M1G A;  2EJ9 A;  3JB9 G;  4XU3 A;  4MZP A;  4OMQ A;  2ZGW A;  3NTH A;  3ZEH A;  2RB6 A;  5LJ3 e;  2E5Q A;  2E6Z A;  3OYI A;  2NUT B;  5GAN f;  2X4X A;  4C8Q A;  2QQA A;  2RQV A;  2FHD A;  2DD4 A;  2DRK A;  1WHM A;  1N9S A;  2HZY A;  2EYQ A;  3CPW S;  1Q86 U;  3JV3 A;  1FWZ A;  3I56 T;  1H3Z A;  2QAS A;  2M02 A;  2RQR A;  1MHN A;  1Y0M A;  2BUD A;  2SRC A;  4EIK A;  2FL7 A;  1ZA1 B;  4L59 A;  2QQR A;  1M1K C;  1O75 A;  1TU0 B;  4JRK A;  3CCM A;  2OX7 A;  3OA6 A;  1FMK A;  3QZ5 B;  2BE7 D;  3E9G A;  4M7A F;  5J39 A;  4JRQ A;  1MUZ A;  4OGE A;  4HT8 A;  4MMK A;  1WFW A;  2RJF A;  2BKD N;  2EQI A;  2QEX A;  4B9X A;  2VB6 A;  2BZY A;  3H41 A;  4F7U B;  1Q7Y R;  1VQK T;  3OYJ A;  2ZPB B;  4J6Y A;  3QSU A;  4M7A B;  2JT4 A;  2M16 A;  1VQP Q;  1YP5 A;  1EZZ B;  2IG0 A;  4A4G A;  2WSE E;  4M7D F;  1VQM Q;  2EYZ A;  1G3W A;  4M7A C;  3L42 A;  4KRT A;  1NJI C;  2DX1 A;  5KE3 A;  3OYE A;  3HHT B;  2RQU A;  2DEQ A;  1Y07 A;  2GF7 A;  4Y91 A;  3X20 B;  2MK5 A;  2RM4 A;  5GAN 6;  1U1S A;  5LJ5 f;  3G6E Q;  1IRX A;  4JJN K;  3PTA A;  4FT4 A;  4PNO A;  2DPP B;  4QQD A;  1AWW A;  3SWN A;  3L1A A;  4J83 A;  1WA7 A;  4KUL A;  1BU1 A;  2DXT A;  3CD6 Q;  1SSF A;  4AFZ C;  1VQN T;  2RHY A;  4RTV A;  1LCK A;  2LT1 A;  2RK2 A;  1SEM A;  1K9M R;  5KYW A;  1I07 A;  1M1K R;  5LJ3 d;  5FRN A;  4M7A D;  1CSK A;  1WJQ A;  4M75 G;  3U23 A;  2E12 A;  2E65 A;  3NHN A;  1PCX A;  3EFO A;  4RTW A;  3QJY A;  3G71 Q;  4JDS A;  2KXD A;  2BZ8 A;  4A53 A;  1TH7 A;  1S72 T;  5KYY A;  3X26 B;  2DYI A;  2HSE B;  5CKH A;  2HEQ A;  2LCS A;  4OB0 B;  2PVO B;  5LJ5 g;  3EAE A;  2JZ2 A;  2CS7 A;  2QYZ A;  1G5V A;  3HRT A;  3GBQ A;  4Q5W A;  1F1B B;  3OYK A;  4ZN1 A;  5CCA A;  1I4K 1;  1K73 R;  4ORZ A;  2F2X A;  2RD1 A;  2RH2 A;  2X35 A;  1AZG B;  2K3B A;  4LDU A;  3L2W A;  1M1K U;  1G3S A;  3C12 A;  1S72 A;  2A28 A;  3G4S A;  1K9M U;  4OB3 B;  4J9F A;  1WXU A;  2DZC A;  2EYY A;  2EQK A;  5GMK j;  2H8H A;  3LH0 A;  2FVU A;  2A7Y A;  2P0Q A;  4ESR A;  2OTJ A;  3PIP A;  2ZPE B;  3VS2 A;  4OMN A;  1T3L A;  2EJG A;  3H6Z A;  2ZCF B;  4RG8 A;  2WAC A;  3VRY A;  4M7A A;  1PRL C;  5I22 A;  4AG2 C;  1JJ2 P;  3JAM E;  2AIR B;  4PJO D;  4D8D A;  1YJ9 A;  2KBT A;  2RQW A;  2CSQ A;  3UPU A;  1J3T A;  2VC8 A;  4BAC A;  8ATC B;  2PQW A;  3BY7 A;  3EG3 A;  1AOJ A;  1HK9 A;  2LX9 A;  3H0H A;  3EGD A;  4M77 A;  1X01 A;  4DBR A;  1ZUY A;  2QA4 T;  5HCK A;  3PVQ A;  3CCJ A;  1LPL A;  3G71 A;  2FEI A;  4XU0 A;  3QUI A;  1VIE A;  2NUP A;  4QQG A;  5FWB A;  4F7U G;  4M7D A;  3CC2 Q;  2FPE A;  3FIF A;  1N9R A;  1MMD A;  2DXU A;  1MND A;  4DBQ A;  2FO0 A;  1QW1 A;  1D3B B;  4M78 C;  1YI2 T;  2KDS A;  1R0B G;  4DOV A;  2K79 A;  1W2B A;  2EQM A;  2K5I A;  2HKQ B;  2DJZ A;  2HAX A;  3CMA Q;  1ZSZ B;  1XOV A;  1D1B A;  1BYM A;  4J9B A;  1PM3 A;  2P0P A;  2QG9 B;  4RTZ A;  2D6F A;  3WVE B;  1UEC A;  1VQ6 A;  1U06 A;  3A98 A;  3CPW P;  2QQS A;  3JSC A;  2KY9 A;  2KK4 A;  2EVR A;  2LX7 A;  3QDF A;  3VV0 A;  2AZV A;  1OOT A;  4E7I A;  3E2U A;  1TUG B;  3NPF A;  3TVT A;  1NYG A;  3UF4 A;  3S3O A;  4FYX B;  4XAX B;  1WZO A;  4ANJ A;  4M78 B;  3P8B B;  2ZPF B;  1IZ6 A;  5FU6 C;  5AT1 B;  2YLB A;  2LZ6 B;  3RIR A;  3N5B B;  3V7S A;  1VQ8 Q;  5HY6 A;  3S3N A;  1KD1 U;  1RLP C;  1WQ7 A;  4OP0 A;  1N6A A;  2NWM A;  1O9S A;  2EKH A;  2KSS A;  2DBK A;  1G83 A;  3CC7 Q;  1D1C A;  3QDR B;  1WJR A;  3L2Q A;  1IB8 A;  4OF1 A;  4M7D E;  2LTO A;  5GAN 2;  2NLU A;  2OI3 A;  4IUT A;  1GBR A;  1VQK A;  1UGQ B;  1YI2 A;  4DBH A;  1G3Y A;  4WF2 A;  2HDA A;  1AWO A;  1JXO A;  3EH1 A;  1YN8 A;  3V7R A;  4FU6 A;  5GMK m;  1T0J A;  1YCS B;  2JTE A;  2M0Y A;  4FW1 A;  1N8R U;  2BIV A;  1BIA A;  1I8F A;  4HCZ A;  2D8J A;  4LDV A;  3ER0 A;  1KIK A;  5GMK i;  4J9C A;  2LCL A;  3M0P A;  3FEO A;  1B34 B;  2D1X A;  4X34 A;  3UDC A;  1H8K A;  4C8Q G;  2YLC A;  3CC2 T;  3CMA A;  3C95 A;  2JM9 A;  1K9M C;  4OML A;  3CBO A;  2Y90 A;  1OEB A;  1XQH A;  4ZGD B;  2Y4X A;  1UFF A;  3CPF A;  1M4Z A;  4F04 B;  2CDT A;  4ZTJ A;  2WSC E;  3EGD B;  2KRS A;  2QGF B;  2DEU A;  4C5E A;  4ZTF A;  3OYG A;  4PJO C;  2R57 A;  1UDL A;  1WI7 A;  1PSE A;  1A0N B;  1TTH B;  3EGX A;  2CUB A;  2A37 A;  1D0Z A;  1WHL A;  2B8A A;  5D6W A;  3J81 E;  4C92 C;  2DF6 A;  1QVG P;  3OS1 A;  5A0L A;  1I5O B;  2P4R A;  2L3R A;  1K8A C;  2HMA A;  2KGT A;  4PJJ A;  3S6W A;  3PNW C;  4M77 C;  1KC8 C;  2QQ9 A;  2ROT A;  3ASK A;  1V29 B;  1WX6 A;  1VQ6 T;  3OS0 A;  2KNB B;  4HVW A;  2V8I A;  3CXC P;  3CCM T;  3CCQ A;  5KYY B;  3PFS A;  3HPW A;  3MO8 A;  1RLQ C;  3NTI A;  4M7D C;  1TXQ A;  1G2B A;  3F70 A;  5EC7 A;  4FW2 A;  3MHX A;  4NS5 A;  4XU1 A;  2GTO A;  3T9N A;  4PJO A;  4QVD A;  6AT1 B;  2EW3 A;  2RPN A;  2HBW A;  1QWF A;  2COZ A;  1R77 A;  2LRQ A;  4E2F B;  1VQ8 T;  1X69 A;  4OB1 B;  4NOY A;  2E10 A;  4M78 A;  2M0O A;  2CUD A;  4AFU C;  4RKU E;  1VQ7 T;  3JCM e;  2DET A;  2PVG B;  2ROL A;  3PT9 A;  1QP3 A;  1D0X A;  1TOV A;  3JCM P;  1WHJ A;  1VQO T;  3P8H A;  5GAO r;  1OQK A;  3CCE T;  2V8K A;  2X3X D;  2FZK B;  4FIB A;  5KYU A;  4C92 D;  4PLL A;  3M4G A;  4JRP A;  5CO7 A;  5I2S A;  4EPC A;  2MWP A;  3V8J A;  1U8R A;  4EMK C;  1GFD A;  4Z8A A;  5GMK l;  2QA4 Q;  1FMV A;  2DIQ A;  4C5I A;  1VQ4 T;  2VWF A;  3VS7 A;  2DTI A;  1JO8 A;  1QCN A;  3EGX B;  3D7S B;  1XTD A;  1Q95 G;  1KQS S;  2YRV A;  2XK0 A;  2JS2 A;  2F5T X;  4X9D A;  5KYX A;  3LYI A;  1AT1 B;  2DL3 A;  4M77 B;  5GAN 7;  4BDZ A;  3DLL A;  2DAQ A;  5FRO A;  4LE9 A;  2PUK B;  2E4H A;  2MAM A;  2SEM A;  1QKX A;  3MP1 A;  1NBE B;  1AEY A;  2MYS A;  2NUP B;  3QG1 A;  4JS4 A;  4LDW A;  3H8Z A;  5GAO p;  1VQL A;  5GAM f;  1UGP B;  3UT1 A;  3ZFJ A;  4KH0 B;  2V26 A;  1V76 A;  2JS0 A;  1QVF A;  4EMK B;  3MPU B;  3M54 A;  5CQX A;  2J06 A;  2Z0W A;  2ED1 A;  2RJE A;  3QPH A;  2JTF A;  2KRM A;  1KJW A;  1ZA2 B;  4QW2 A;  3CC4 T;  4QVZ A;  1TUC A;  2VUB A;  2QEX T;  4B6M A;  4OMP A;  1K1Z A;  2EGE A;  3I56 Q;  3LLR A;  2CP5 A;  1NPP A;  2KYM A;  2OTJ Q;  4KGZ B;  4BY6 C;  4AG1 C;  1BCO A;  3THK A;  3EHQ A;  3LWI A;  2CP2 A;  2K57 A;  4LUD A;  5I2M A;  1VYV A;  3BE3 A;  2RHI A;  3Q1J A;  1C1A A;  1VQN A;  2EKO A;  3OB9 A;  2RA2 A;  4V2S A;  1T3S A;  1H64 1;  3H0I A;  1W70 A;  1WLP B;  1CKA A;  3CC7 T;  1NYF A;  1MNE A;  4JUV A;  2XDB A;  2O01 E;  1HXD A;  3EG0 A;  2F2W A;  2DJQ A;  4N4G A;  2LCC A;  3J80 E;  1HJD A;  3OSS C;  5GAM h;  2XMF A;  3X25 B;  3SWN C;  3PMT A;  1OYX A;  4XQ3 A;  5IHN A;  2LP5 A;  3JCM d;  3VS3 A;  2MCN A;  1RAG B;  4C92 B;  1SF9 A;  1M3A A;  2OAU A;  3AT1 B;  1QVF P;  2FYK A;  2HQE A;  1IGQ A;  3GNG A;  2C0I A;  2EGA A;  3H0F A;  2B86 A;  2LT4 A;  1K73 C;  4HVU A;  3ZL7 C;  2RHZ A;  2ECZ A;  5GAN 5;  2YUP A;  1VQN Q;  5GAN d;  2MIO A;  4X9C A;  1WPY A;  2G3R A;  4JLG A;  2CP3 A;  1W2B P;  2VVK A;  2O4X B;  5KYW B;  1VYT A;  2EIF A;  3VRZ A;  3SFM A;  2XI9 A;  2COY A;  3OSV A;  2BZX A;  2XHC A;  2E6N A;  4GLK A;  3LWH A;  1V1C A;  3I56 A;  4BE0 A;  1NEB A;  2A3L A;  3JB9 F;  4C8Q F;  2D9T A;  1VQ5 Q;  3O8V A;  3MJX A;  1U5S A;  1B07 A;  5ECA A;  4KH1 B;  4R56 A;  2DRM A;  2E3I A;  4R0K A;  1AZE A;  1AWX A;  4J9H A;  2O31 A;  3MEU A;  4M7D D;  4JLI A;  1JB0 E;  1K0S A;  1WHG A;  3KXT A;  2EYW A;  4J7F A;  4RUG A;  3OYD A;  2CGH A;  3RKX A;  3OQ5 A;  4EDU A;  4BE2 A;  4OMF B;  1RAI B;  3CCR T;  4IUV A;  2DL8 A;  2L89 A;  3CCS Q;  2YUO A;  1GRI A;  1RAA B;  4RTX A;  2QA4 A;  2COW A;  4PLI A;  1YI2 Q;  2P84 A;  1PSF A;  3RER A;  1SSH A;  1JEG A;  4LD9 K;  3I35 A;  3OMG A;  1NLP C;  1OV3 A;  1TS9 A;  1XJW B;  4Z89 A;  3JB9 D;  1VQ5 A;  1TG0 A;  3A8M B;  1KC8 U;  2A36 A;  1BK2 A;  2I2L A;  3M0U A;  4BDY A;  3OW2 S;  2CT3 A;  4MDX A;  1W4S A;  2X9H A;  1GCP A;  2ED0 A;  2DL7 A;  3FLG A;  3R6O A;  1VQO Q;  4FL6 A;  2EJF A;  2VAS A;  2A0F B;  1VQL Q;  3CC4 Q;  3LH5 A;  1XNI A;  1OU9 A;  2F5K A;  4C0G A;  2MF2 A;  3A8L B;  1WYX A;  2DM1 A;  2GCX A;  2HNI A;  1SRM A;  3RES A;  2FZC B;  2RN8 A;  3SDZ A;  2PTK A;  2D0N A;  4PFO A;  1YIJ T;  2JUF A;  2DER A;  1GFC A;  3I55 A;  4JPB W;  4RCB A;  4M77 G;  4NL2 A;  3OYF A;  2JVV A;  1PD1 A;  2CKK A;  3C4S A;  1PKS A;  3M0R A;  5GAO q;  2YSQ A;  3LW5 E;  4KGX B;  5GJV B;  4C8Q B;  1ZSZ A;  4E7Z A;  4C92 E;  4OMM A;  4BE1 A;  1EX4 A;  3QWY A;  1N8R C;  5FU7 C;  2DKG A;  1W2B S;  4DQ2 A;  4F7U F;  4IUU A;  2EQJ A;  1BCM A;  1QCF A;  1I5L A;  1PWT A;  4FYY B;  1VQ9 T;  3FRN A;  3CME A;  2NUT A;  3JCM W;  3QBY A;  3CCQ Q;  2OTL A;  3JCM h;  1QCO A;  3JRZ A;  1RAE B;  1QVP A;  2GFA A;  1BBZ A;  5J26 A;  2D0Q B;  4IUP A;  1Q7Y C;  3VS1 A;  4A4H A;  2K4Y A;  2KXC A;  3I9Q A;  1NE8 A;  5IXB A;  3OYL A;  2HQH A;  2RNA A;  3CQT A;  4O6J A;  2XD0 A;  3SB2 A;  4J7I A;  4TVR A;  3M9Q A;  2L3S A;  4M78 G;  2OTJ T;  2DZ9 A;  1KC8 R;  4HCB A;  2M9U A;  2HCK A;  1MV3 A;  4J9G A;  1WHK A;  2V1Q A;  1NPR A;  3VS0 A;  4Z02 A;  2C0T A;  3CCR Q;  2AK5 A;  2KRN A;  2ESW A;  1AVZ C;  1M2V A;  1M8M A;  3L2V A;  3A1P A;  3PVL A;  4RTU A;  4PJN A;  3RMS A;  1ABQ A;  3M57 A;  3TCJ A;  1UE9 A;  4QKU A;  1ZUU A;  2FPD A;  3FJP A;  3HFN A;  3I55 Q;  4J9I A;  2IIM A;  1VQ7 A;  4F17 A;  2DBM A;  1VQ8 A;  2KVQ G;  1S1N A;  1G3T A;  1Y57 A;  5J3B A;  1Q81 U;  3JCM X;  2DTO A;  4M75 E;  5GJW B;  3WXM B;  3E9F A;  4AFS C;  4DBF A;  1UEB A;  4X1V A;  4C92 A;  2W10 A;  3ME9 A;  4PK4 A;  2L0A A;  1OZ2 A;  1WIE A;  2EQU A;  3EHR A;  1R8O B;  2CH4 W;  2GQI A;  2DIL A;  1D0Y A;  2KMT A;  5DM7 R;  1IHW A;  2CH4 A;  4CC7 A;  2FRW A;  2JMC A;  2R5A A;  5GMK h;  4PJM A;  2NUZ A;  3RKW A;  1M1F A;  2HKN A;  2AKK A;  3X28 B;  5FRM A;  2KI7 A;  2YUN A;  5GAN e;  2ZPI B;  4CC4 B;  3UA7 A;  3RR6 A;  4F7U E;  5GAM e;  1VQM A;  3M4Y A;  4ATO A;  1SRL A;  4L6V 5;  4A54 A;  2HBP A;  1UUE A;  4E47 A;  1UJ0 A;  3PMI A;  1K9A A;  2XDP A;  9ATC B;  3G6E A;  4PKC C;  1VQ5 T;  1RAD B;  3M0S A;  2DMO A;  1FYN A;  4HVV A;  2AHJ B;  2QGG A;  2HL5 C;  1W6X A;  1RAH B;  1I1J A;  1KHC A;  1VQ6 Q;  4DOW A;  1WXB A;  5FW9 A;  4M78 F;  3HRS A;  1VQM T;  4LXC A;  1JQQ A;  2VGN A;  2I0N A;  1CKB A;  1OPL A;  3GOX A;  1VQO A;  3JCM b;  1YJW A;  2C06 A;  2K3X A;  1YIJ Q;  5HK3 A;  1DJ7 B;  3H9N A;  1HD3 A;  2L3Q A;  4OVA A;  2DTH A;  5KH6 A;  3OY9 A;  2DLP A;  4HCK A;  4RCC A;  4JS5 A;  2DFU A;  4ME7 A;  3SHW A;  5GAM g;  3RKY A;  2J6O A;  2PU9 B;  5GAN 4;  2XU8 A;  3OYY A;  2YRC A;  2LQW A;  2QQB A;  2LQK A;  4M4Z A;  5CKD A;  4ZGE B;  5C6S A;  2HL3 A;  3EG9 B;  3PIO A;  5KYX B;  4F16 A;  2K7A A;  3BFM A;  1B3Q A;  4OB2 B;  4C0F A;  3DB4 A;  1YWP A;  1VQL T;  1HYO A;  2QI2 A;  2VV5 A;  5I11 A;  2RHX A;  1UB4 A;  4ZNX A;  2CZ0 B;  2HD0 A;  1GL5 A;  4IIM A;  4PL6 A;  2L2P A;  3LGF A;  4E7J A;  3OMC A;  3HRU A;  1YJN Q;  1OI1 A;  1UJY A;  3OW2 P;  2ZAE A;  4XU2 A;  2EBP A;  2LC4 A;  2JW4 A;  2JOY A;  3QYG B;  1TUD A;  4MZM A;  1NZ9 A;  1YIT T;  4EMG A;  2L3P A;  1KQS A;  4D8K A;  1KD1 R;  5KCO A;  1ZUK A;  5FU7 B;  3O5Z A;  3CCU T;  2XIC A;  4C8Q C;  4C0D B;  3PE0 A;  2Y4Y A;  2LQ8 A;  4LN2 A;  1PHT A;  1YNZ A;  3DB3 A;  2QDY B;  2E5K A;  1JRI A;  3M0T A;  1ZBX A;  1PKT A;  1BI1 A;  3VS4 A;  5GAN j;  1LVK A;  3CCR A;  2DVJ A;  1YBY A;  3GLX A;  4EMH A;  1EIF A;  4M75 F;  3BW1 A;  2JXB A;  3PGG A;  1AWJ A;  1M9S A;  1QVF S;  3EH2 A;  2QK0 A;  3RNJ A;  3JB9 I;  3OBY A;  2D8H A;  1QVG A;  1M30 A;  1YHQ T;  1FMW A;  2K3Y A;  1QWE A;  4BB7 A;  2AT1 B;  1RI9 A;  3A8O B;  2HSP A;  4JJC A;  2ATC B;  2DXB A;  4D6W A;  1N27 A;  2K2M A;  2LNV A;  4E7H A;  4ELZ C;  1IGU A;  1PG5 B;  1MV0 B;  4J6W A;  3MEV A;  4FYV B;  4BY6 B;  1AD5 A;  2MMP A;  1M2O A;  1YWO A;  4M7A G;  1KHI A;  1Y96 A;  2V8J A;  5CK9 A;  3CCE A;  5IAY A;  5CQY A;  3CCJ Q;  4FCY A;  1LOJ A;  2BE9 B;  4KBM B;  4CC2 A;  2CP6 A;  1Q86 C;  2J05 A;  3G7Z A;  2VXE A;  4A4E A;  1JJ2 A;  4PJO G;  3S3M A;  3NGP A;  4Z88 A;  3QWX X;  3CBM A;  1I0C A;  2PNI A;  3I55 T;  3BDL A;  1NLO C;  1X6G A;  2H3J A;  2RK1 A;  1Q7Y U;  1WGS A;  5D7U A;  2EGC A;  4C8Q E;  1KK7 A;  4A63 B;  1KSW A;  3GF5 A;  5KCH A;  1ZX6 A;  3CCV Q;  2X51 A;  3EFR A;  4GBQ A;  5IXF A;  3G1J A;  3CC7 A;  5M9O A;  2XDD A;  3G4S Q;  4ZGJ B;  1UG1 A;  3HKS A;  4KT0 E;  1Q82 R;  3CXC A;  1OX9 A;  1GCQ A;  2FZG B;  3WVD B;  3INZ A;  3C0C A;  4WCI A;  3CME Q;  2KE9 A;  4LUE A;  1RAC B;  4XTY A;  4M7A E;  3JCM g;  1SKU B;  1IRE B;  1ZBJ A;  4M7D B;  2GFU A;  1VOM A;  4KGV B;  2JN0 A;  3JCM c;  5GAM j;  2QAZ A;  3V7C A;  4P5N A;  4JZ4 A;  4C92 G;  2LVM A;  1OUL A;  3E1S A;  1YCY A;  4R55 A;  2LJ1 A;  2O9S A;  3NMZ C;  2GQV A;  2DXC A;  3M55 A;  2ABL A;  1UTI A;  4M78 E;  5GMK e;  5LL6 S;  4C0Z A;  1YJN T;  4IKF A;  1U1T A;  3QYH B;  1WQW A;  1BI0 A;  2K5F A;  2DNU A;  4XTZ A;  1H3H A;  3I5R A;  1NJI R;  1JJ2 S;  2YWW A;  4BI8 B;  3CCS T;  3MP6 A;  3UWN A;  4MML A;  3REA B;  2IPO B;  5GAO l;  2MPX C;  2RHU A;  2DL4 A;  5LJ5 e;  4LNP A;  1VUB A;  1UHF A;  5CIU A;  4AFQ C;  5CKE A;  2KT1 A;  2GTJ A;  3M5A A;  1Z9Q A;  3EFS A;  1GCQ C;  3DLM A;  1VYU A;  8AT1 B;  4CC3 A;  1KQS P;  4FSX A;  2P4T A;  2J6K A;  4E7L A;  4FSS A;  2YDL A;  2ZPH B;  3GPL A;  5LJ5 j;  1LJO A;  2KT8 A;  2HQX A;  2YRD A;  3UAT A;  3OYM A;  3OW2 A;  2YUQ A;  3JCM J;  1Y7X A;  1KFZ A;  1MMN A;  2DA9 A;  5FLX E;  5GAN g;  2DVE A;  3CXC S;  1I81 A;  3SWN B;  4J9D A;  2CYZ B;  1MGQ A;  1ZSG A;  3BDU A;  1YJ9 T;  3CCV T;  1HSQ A;  1ZHI A;  4HA8 A;  1IHV A;  3CC2 A;  1K8A U;  4C8Q D;  4K11 A;  3IQL A;  3LGL A;  1QQJ A;  1PC0 A;  2RF0 A;  2EWN A;  4FM4 B;  3A5Z B;  3GNF B;  2GBQ A;  1WDX A;  1FXX A;  3EFO B;  2JNG A;  4BUG A;  2F1L A;  4J5Y A;  5GAN 3;  4DEY A;  1QMC A;  1YIT Q;  5IHK A;  1SHF A;  3FJ5 A;  1VQ4 A;  3G4S T;  2PZ1 A;  1EFN A;  2LNH B;  2ENM A;  3QXE B;  2O2O A;  4PFZ A;  1X2Q A;  4J9E A;  3QHS A;  4M75 A;  1UGV A;  3QJ6 A;  4HXJ A;  3VS6 A;  2G6F X;  4JJD A;  5LJ3 h;  3G71 T;  3EG1 A;  3CCL A;  3CME T;  5LJ3 j;  1WJS A;  1RAF B;  1K76 A;  1YHQ A;  1OPK A;  1S72 Q;  4E7S A;  1UGR B;  1X43 A;  1VQ9 Q;  2C0O A;  2DYB A;  1KQ1 A;  3CCE Q;  3KUF A;  3CCQ T;  2L8D A;  2KEA A;  4B9W A;  1BI2 A;  2RJD A;  3EG2 A;  1MMG A;  5A0G A;  2H3E B;  5D6X A;  2FPF A;  1M5Q 1;  1Q81 C;  2FG0 A;  3E19 A;  5CKF A;  2E70 A;  2GGR A;  3JCM f;  2J7I A;  2YT6 A;  3JB9 H;  2RMO A;  2J6F A;  1PD0 A;  4L5G A;  3MP8 A;  1BI3 A;  3L2U A;  1KD1 C;  2R58 A;  5L8R E;  2VGM A;  3RBB B;  2PVD B;  1VQ4 Q;  1M90 U;  2MI6 A;  3MCA B;  1N8R R;  2K5L A;  5KYN A;  4WTO B;  1RUW A;  1C0M A;  5FU6 B;  5A0D A;  5C0M A;  4C5H A;  4M77 D;  3HP9 A;  1UHC A;  5I21 A;  3QO3 A;  3CCV A;  1D1A A;  2K6D A;  3A8H B;  2LJ0 A;  1BB9 A;  1TSF A;  1C6V X;  3CCS A;  1PRM C;  2PUO B;  1Q82 U;  1YJW T;  3EG9 A;  2KQW A;  5DY9 A;  2O88 A;  4OGC A;  4M75 D;  2X3W D;  4PJO B;  3URG A;  2DK3 A;  4Y92 A;  2RI2 A;  3OS2 A;  2QXF A;  7AT1 B;  3FDR A;  4CRI A;  2RJC A;  2EPD A;  1IXD A;  2E41 A;  1YJN A;  2ZPG B;  2DO3 A;  3CCU A;  5GAN 8;  4AMC A;  1YIT A;  2FRY A;  1M3B A;  1ZSZ C;  5AYF A;  4Y28 E;  4UC4 A;  2MOX A;  3SEM A;  2NYS A;  3C94 A;  4FYW B;  2X4Y A;  1M90 R;  3JCM Q;  3CC4 A;  3CCL Q;  3L2R A;  1D3B A;  4IUR A;  2CP0 A;  3UA6 A;  3CBP A;  3ZBD A;  2MWO A;  4M77 F;  2O4X A;  4C5G A;  1WNL A;  5GAO n;  1ACM B;  2CP7 A;  5HK0 A;  3I5S A;  5CAI A;  4E6R A;  1VA7 A;  2JJ9 A;  4CI0 C;  5LJ3 f;  2CZ1 B;  1JXM A;  3VUZ A;  2EYX A;  2YXY A;  1ZQ1 A;  2GNC A;  1IO6 A;  4DEX A;  4A4F A;  2YHT A;  4JRI A;  4BD3 A;  5A2Q E;  3OYC A;  2LJ3 A;  4GLM A;  3M56 A;  2VYT A;  3P8D A;  1E6H A;  3JCM V;  5GAM d;  3KBG A;  2CRE A;  2JM8 A;  4QT7 A;  1N5Z A;  4EMK A;  4RTT A;  4F14 A;  3ULR B;  1G8X A;  1X75 C;  3M59 A;  2L5Q A;  3L2Z A;  4IUQ A;  4O5V A;  2VKN A;  1JBM A;  1Q82 C;  2OTL Q;  2WSF E;  4MDW A;  4C0D C;  1D09 B;  4XTX A;  3GIB A;  3VJP A;  1KQ2 A;  5LJ5 h;  1NG2 A;  1X27 A;  2P0K A;  1NM7 A;  3OYB A;  3KFV A;  5IN1 A;  1RI0 A;  3OYA A;  3AHU A;  2K2V A;  2KYB A;  4PFP A;  1LNX A;  3OBW A;  4E7K A;  3RDV A;  2CZ7 B;  4II1 A;  1ZLM A;  3CCU Q;  3MKD A;  3NTK A;  1NEG A;  5EG2 A;  1MMA A;  1YFN A;  4HKE A;  2O9V A;  1ABO A;  2W0Z A;  4QQ6 A;  2QDL A;  5GAO m;  3FC3 A;  2AZS A;  3QZ9 B;  3QII A;  2E64 A;  1Z9Z A;  1YJW Q;  5KE2 A;  5LJ5 d;  3VYH B;  3TSW A;  2E1H A;  2OAW A;  2V1R A;  4XK8 E;  1TWB A;  3LX7 A;  2X4J A;  1Q86 R;  3V8K A;  1K0X A;  4RG2 A;  1P92 A;  3SD4 A;  3TSZ A;  2FB7 A;  3V8L A;  3TEE A;  2LDM A;  1YHQ Q;  4NL3 A;  1GBQ A;  1Y71 A;  3M58 A;  1X6B A;  4XTV A;  1YJ9 Q;  1B34 A;  3HFO A;  3MEA A;  5HKC A;  1E6G A;  2DIG A;  4XTW A;  3CCM Q;  4M78 D;  2RI5 A;  1QP2 A;  1WHH A;  1SPK A;  2QTV A;  1M8V A;  1UGS B;  3CCL T;  1X6O A;  2F2V A;  5D6Y A;  1PNJ A;  4LDY A;  1U3O A;  3M0Q A;  5CR2 A;  4OMO A;  2XID A;  2VXF A;  1SHG A;  4N0A C;  3M53 A; 
#chains in the Genus database with same CATH homology
 1SSH A;  1JEG A;  1T0H A;  4A63 B;  1KSW A;  3I35 A;  1W1F A;  4Z89 A;  1NLP C;  1OV3 A;  1ZX6 A;  3UF4 A;  1TG0 A;  5L23 A;  2LMJ A;  2A36 A;  1BK2 A;  4GBQ A;  3M0U A;  3REB B;  5IXF A;  2CT3 A;  1QKW A;  1GCP A;  2ED0 A;  2DL7 A;  1UG1 A;  1M3C A;  2LZ6 B;  1GCQ A;  1RLP C;  3LH5 A;  2KR3 A;  3C0C A;  4WCI A;  2NWM A;  2KE9 A;  2BTT A;  4LUE A;  1WYX A;  2EKH A;  2DM1 A;  4RTY A;  2DBK A;  1G83 A;  1SRM A;  1JU5 C;  5FWC A;  1ZBJ A;  2OJ2 A;  2OI3 A;  1GBR A;  2RN8 A;  1M27 C;  1X2K A;  2PTK A;  2D0N A;  2RQT A;  2HDA A;  1AWO A;  5IH2 A;  1JXO A;  1GFC A;  1YN8 A;  4JPB W;  1T0J A;  1YCS B;  2JTE A;  2A08 A;  2M0Y A;  2K9G A;  1PKS A;  2D8J A;  3M0R A;  1WXT A;  4JZ4 A;  2YSQ A;  1KIK A;  5GJV B;  4J9C A;  2LJ1 A;  1K4U S;  2O9S A;  4JJB A;  4OMM A;  3M0P A;  3QWY A;  5IHI A;  3NMZ C;  2JMA A;  2AKL A;  2D1X A;  2ABL A;  1H8K A;  1UTI A;  3VS5 A;  1QCF A;  1ARK A;  2JM9 A;  2DNU A;  3R6N A;  1PWT A;  1H3H A;  4OML A;  3I5R A;  1OEB A;  2LQN A;  1UFF A;  2KRO A;  2CDT A;  3EGU A;  3REA B;  2M51 A;  2KRS A;  1BBZ A;  1QLY A;  3VS1 A;  2DL4 A;  4LNP A;  1H92 A;  2KXC A;  1UHF A;  3I9Q A;  4AFQ C;  5IXB A;  2RNA A;  3CQT A;  2KT1 A;  2GTJ A;  1UDL A;  1Z9Q A;  1WI7 A;  1E7O A;  1GCQ C;  2L3S A;  1VYU A;  1A0N B;  4CC3 A;  2CUB A;  2J6K A;  2A37 A;  4JZ3 A;  4FSS A;  2YDL A;  2HCK A;  2KT8 A;  1MV3 A;  2DF6 A;  4J9G A;  2P4R A;  3UAT A;  2CSI A;  2V1Q A;  2YUQ A;  2KGT A;  3VS0 A;  2C0T A;  2DE0 X;  1KFZ A;  2AK5 A;  2DA9 A;  2KRN A;  2DL5 A;  2ROT A;  2ESW A;  1AVZ C;  1WX6 A;  1M8M A;  4J9D A;  2KNB B;  4HVW A;  1ZSG A;  4IIO A;  3PVL A;  4RTU A;  2CT4 A;  1HSQ A;  4K11 A;  3IQL A;  1ABQ A;  1RLQ C;  2RF0 A;  4OMQ A;  2GBQ A;  1WDX A;  1G2B A;  1UE9 A;  1ZUU A;  5EC7 A;  2FPD A;  2GTO A;  4DEY A;  4J9I A;  2IIM A;  4F17 A;  1SHF A;  2DBM A;  2EW3 A;  3FJ5 A;  5IHK A;  2RPN A;  1S1N A;  1Y57 A;  2HBW A;  1EFN A;  2PZ1 A;  2LNH B;  2RQV A;  2ENM A;  1QWF A;  2DRK A;  5GJW B;  2O2O A;  1X2Q A;  4J9E A;  4AFS C;  1X69 A;  1UGV A;  4HXJ A;  3VS6 A;  4X1V A;  3JV3 A;  2G6F X;  4JJD A;  3EG1 A;  2W10 A;  2L0A A;  2CUD A;  4AFU C;  1K76 A;  2RQR A;  1WIE A;  1OPK A;  3EHR A;  1Y0M A;  2SRC A;  2CH4 W;  1X43 A;  4EIK A;  2GQI A;  2DIL A;  2C0O A;  2ROL A;  2DYB A;  2CH4 A;  4CC7 A;  2FRW A;  2JMC A;  2KEA A;  3EG2 A;  2X3X D;  2NUZ A;  2AKK A;  2FPF A;  2YUN A;  2FG0 A;  1FMK A;  2GGR A;  2J7I A;  2YT6 A;  4CC4 B;  3UA7 A;  2RMO A;  1GFD A;  2J6F A;  4Z8A A;  1SRL A;  2VWF A;  3VS7 A;  1MUZ A;  1UUE A;  1JO8 A;  1UJ0 A;  1WFW A;  2EQI A;  3RBB B;  2JS2 A;  1K9A A;  2BZY A;  3H41 A;  3M0S A;  2DMO A;  1RUW A;  1FYN A;  2DL3 A;  4HVV A;  2JT4 A;  1YP5 A;  1UHC A;  2EYZ A;  1W6X A;  4LE9 A;  4KRT A;  1I1J A;  2K6D A;  2DX1 A;  2LJ0 A;  2SEM A;  2RQU A;  1BB9 A;  1QKX A;  1PRM C;  1WXB A;  5FW9 A;  1AEY A;  1JQQ A;  2I0N A;  1CKB A;  1OPL A;  2O88 A;  1AWW A;  2X3W D;  1WA7 A;  2JS0 A;  1BU1 A;  4Y92 A;  4AFZ C;  4RTV A;  1LCK A;  2EPD A;  2J06 A;  2ED1 A;  1SEM A;  1HD3 A;  2KRM A;  1KJW A;  1I07 A;  2FRY A;  2L3Q A;  1M3B A;  1CSK A;  2DLP A;  4HCK A;  1TUC A;  3U23 A;  2MOX A;  3SHW A;  3NHN A;  4RTW A;  4OMP A;  3SEM A;  1K1Z A;  2EGE A;  2J6O A;  2KXD A;  2BZ8 A;  2KYM A;  3UA6 A;  4AG1 C;  2LQW A;  3THK A;  3EHQ A;  4M4Z A;  2HEQ A;  4LUD A;  2LCS A;  1VYV A;  3I5S A;  4F16 A;  2K7A A;  1VA7 A;  4E6R A;  1B3Q A;  1YWP A;  3GBQ A;  1JXM A;  5I11 A;  2EYX A;  1T3S A;  4ZNX A;  1GL5 A;  2GNC A;  1IO6 A;  4ORZ A;  4IIM A;  4DEX A;  3H0I A;  2F2X A;  1W70 A;  2L2P A;  1WLP B;  1CKA A;  1NYF A;  1AZG B;  2K3B A;  1UJY A;  2LJ3 A;  2A28 A;  4GLM A;  2EBP A;  2JW4 A;  3EG0 A;  2F2W A;  4J9F A;  1E6H A;  1WXU A;  2DJQ A;  2EYY A;  1TUD A;  1HJD A;  2H8H A;  2CRE A;  2JM8 A;  2XMF A;  4QT7 A;  1N5Z A;  2L3P A;  4D8K A;  4ESR A;  5IHN A;  2LP5 A;  1ZUK A;  4RTT A;  3ULR B;  4F14 A;  3O5Z A;  3VS2 A;  4OMN A;  1T3L A;  2MCN A;  3VS3 A;  2VKN A;  3PE0 A;  1M3A A;  4LN2 A;  3VRY A;  1PHT A;  1YNZ A;  2E5K A;  1PRL C;  1NG2 A;  3M0T A;  1PKT A;  1X27 A;  1NM7 A;  3VS4 A;  5I22 A;  2C0I A;  2EGA A;  3H0F A;  4AG2 C;  2B86 A;  2DVJ A;  4HVU A;  3KFV A;  4D8D A;  2KBT A;  3ZL7 C;  2ECZ A;  2KYB A;  2RQW A;  2JXB A;  2CSQ A;  2YUP A;  1J3T A;  2MIO A;  1AWJ A;  2VVK A;  3RNJ A;  2D8H A;  1VYT A;  1AOJ A;  1ZLM A;  3EG3 A;  1M30 A;  3H0H A;  3VRZ A;  1QWE A;  1NEG A;  1RI9 A;  1ZUY A;  2HSP A;  2BZX A;  2O9V A;  1ABO A;  2W0Z A;  4JJC A;  2QDL A;  5HCK A;  2AZS A;  3PVQ A;  1Z9Z A;  1V1C A;  2K2M A;  2FEI A;  1NEB A;  3TSW A;  2OAW A;  5FWB A;  2V1R A;  2FPE A;  1U5S A;  1B07 A;  5ECA A;  1MV0 B;  1K0X A;  2DRM A;  1AD5 A;  3TSZ A;  2FO0 A;  4R0K A;  1YWO A;  1AZE A;  1GBQ A;  2K79 A;  1AWX A;  1X6B A;  4J9H A;  4CC2 A;  2O31 A;  2J05 A;  1E6G A;  1K0S A;  1XOV A;  2EYW A;  4J9B A;  4RUG A;  3NGP A;  4RTZ A;  1SPK A;  1UEC A;  4Z88 A;  1U06 A;  2F2V A;  3A98 A;  3QWX X;  1PNJ A;  2DL8 A;  2PNI A;  1I0C A;  1U3O A;  2YUO A;  1GRI A;  2LX7 A;  2EVR A;  2AZV A;  1OOT A;  1NLO C;  4RTX A;  1X6G A;  3M0Q A;  4OMO A;  1SHG A;  3NPF A;  3TVT A;  2EGC A;  1NYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...