1SPKA

Solution structure of rsgi ruh-010, an sh3 domain from mouse cdna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
72
structure length
72
Chain Sequence
GSSGSSGQKVKTIFPHTAGNNKTLLSFAQGDVLTLLIPEEKDGWLYGEHDTTKARGWFPSSYTKLLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 1300006M19
publication title Solution Structure of RSGI RUH-010, an SH3 Domain from Mouse cDNA
rcsb
source organism Mus musculus
total genus 7
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1spkA00
1U3OA 2HSPA 4AFZC 2VKNA 3UA7A 2NUZA 1NEGA 1XOVA 1M30A 2YUQA 3UA6A 4AG2C 2ABLA 2DBMA 4OMMA 3ZL7C 1X6GA 2B86A 2F2WA 2V1QA 5IH2A 1CKAA 2O88A 1OV3A 3THKA 2C0OA 3RNJA 1NLPC 4J9DA 2QDLA 2ED0A 1CKBA 4OMOA 1WA7A 2XMFA 2ECZA 4AFUC 2EYYA 1T0HA 2L0AA 1S1NA 1M3AA 1UTIA 4J9HA 1HJDA 1H92A 2DA9A 1WX6A 4J9EA 1GCQA 4RTVA 1KFZA 4WCIA 1QLYA 1FYNA 1KSWA 1QCFA 2CUBA 1OOTA 1H3HA 2EYWA 1WIEA 4IIMA 1LCKA 2SEMA 3M0RA 3KFVA 3PVLA 3VS4A 1JXMA 2DL7A 1N5ZA 1ZX6A 1NLOC 1NG2A 2DMOA 2RQUA 1AD5A 3VRYA 2PTKA 2DVJA 4A63B 2KE9A 3EHQA 2JW4A 2DRKA 3VRZA 2A37A 3REAB 3H0FA 4JPBW 2JXBA 2YT6A 3A98A 2DBKA 2A08A 3EGUA 2OI3A 2FG0A 1ABOA 4KRTA 2RQRA 3NMZC 4HVWA 4LNPA 1B07A 2DYBA 1X69A 2EGCA 2LCSA 2OAWA 4CC3A 1AOJA 1BU1A 4RTWA 4Z89A 1CSKA 2CT3A 2KYMA 1G83A 2X3XD 3UF4A 1YNZA 2LX7A 4J9FA 2F2VA 2L3QA 3H0IA 3I5SA 1GCPA 1JQQA 1NEBA 3PVQA 2FRYA 1VYVA 1ZLMA 5GJVB 4JZ4A 3VS0A 1IO6A 2DL3A 3VS2A 2ED1A 3M0PA 4J9BA 1OPLA 1JXOA 2KXCA 2FRWA 2M51A 4HXJA 5FWBA 2PZ1A 5IHKA 2D1XA 2JMCA 2LQWA 2LMJA 2AZVA 1UJYA 2DRMA 1SHGA 4RUGA 1AWOA 3M0SA 5FWCA 1UHCA 2K9GA 2C0TA 3R6NA 1AWWA 1AZGB 4R0KA 4F16A 5FW9A 2KROA 1J3TA 2FO0A 2IIMA 3EHRA 4RTYA 3VS6A 2J6KA 1K9AA 3CQTA 1I07A 2GBQA 2FPEA 2A28A 2KNBB 3VS5A 1GBRA 1EFNA 2RNAA 1Z9ZA 4JZ3A 4RTXA 2J05A 1AVZC 3NPFA 5EC7A 2DNUA 2YSQA 1RLQC 1SRLA 5IHNA 4HVUA 1NYFA 1E6HA 2KT1A 3IQLA 1UUEA 3TSWA 1PKSA 2LJ3A 1YCSB 1VA7A 2GNCA 1W6XA 3EG2A 2W10A 4AG1C 4ZNXA 3I35A 3GBQA 2KYBA 2RQVA 4M4ZA 1K4US 4J9CA 1QWFA 4Z88A 1UE9A 2L3PA 1BB9A 4LE9A 1JO8A 1UG1A 2MCNA 2X3WD 4X1VA 1I0CA 4F17A 1A0NB 2HEQA 2JM8A 3RBBB 2D0NA 2JM9A 3TVTA 1PHTA 2AKLA 2C0IA 1SPKA 3M0TA 1OPKA 1GRIA 5IXFA 1V1CA 1YWPA 1T3SA 3TSZA 2MOXA 1PKTA 2I0NA 1UHFA 2RF0A 1GFDA 2K2MA 2LQNA 4LUDA 2RPNA 4CC7A 2JS0A 1AZEA 1UFFA 4RTTA 2JT4A 2J06A 2RQTA 2KXDA 1AWJA 3QWXX 2KBTA 1PRLC 1K1ZA 2EBPA 1QKWA 2K3BA 2O9VA 2RMOA 2VVKA 1UJ0A 1RI9A 4GLMA 2GTOA 2HDAA 5IHIA 1M27C 3EG1A 4GBQA 1YN8A 2BZYA 2ROLA 3VS1A 2MIOA 1GBQA 1VYUA 1MV3A 2DJQA 1K76A 2KEAA 1NM7A 1TUDA 1ABQA 5HCKA 1UGVA 4RTZA 4HVVA 1M3BA 1X27A 4J9GA 2O2OA 1HSQA 1E7OA 1B3QA 3EG3A 1OEBA 4OMPA 1GL5A 3ULRB 1K0SA 3NGPA 1JU5C 1RLPC 1PRMC 2JTEA 3EG0A 2KRMA 2P4RA 1QWEA 2VWFA 2BTTA 2D8JA 2SRCA 1MV0B 3M0QA 1ZUUA 3PE0A 2LJ1A 2K7AA 2J6OA 1FMKA 5GJWB 1ZUYA 2NWMA 4QT7A 4K11A 1WXBA 1KIKA 1I1JA 1T0JA 2FPFA 3JV3A 2AK5A 4AFSC 3SEMA 2A36A 2G6FX 1AEYA 3QWYA 2FPDA 1YP5A 2LP5A 1JEGA 2PNIA 2CSIA 1SHFA 1WYXA 2LZ6B 1AWXA 1H8KA 2F2XA 4ESRA 2DM1A 2O31A 2V1RA 1X2KA 1WXUA 2HBWA 1WDXA 3M0UA 5L23A 1ZUKA 2DLPA 1GFCA 4ORZA 4DEXA 1U06A 5I11A 1SRMA 2DL5A 2RN8A 1WFWA 3SHWA 2K6DA 1SEMA 4JJBA 1KJWA 2O9SA 2EGAA 3VS3A 2EYXA 4IIOA 3U23A 1WLPB 2H8HA 1W70A 3C0CA 3FJ5A 1K0XA 2EGEA 1PWTA 4DEYA 2E5KA 3I5RA 1Y57A 2ENMA 3I9QA 2CDTA 4Y92A 3REBB 4JJCA 1TUCA 1Z9QA 1BK2A 2AKKA 4EIKA 2KRNA 5I22A 1NYGA 2KR3A 2DILA 3O5ZA 1X6BA 1UECA 4CC2A 1T3LA 1U5SA 2YDLA 1BBZA 1MUZA 2DX1A 2JS2A 4OMQA 1ARKA 1M8MA 4OMLA 1E6GA 1G2BA 2EPDA 4D8DA 1WXTA 2EYZA 2EVRA 4JJDA 4RTUA 2EQIA 2L2PA 2DL4A 2M0YA 4E6RA 4D8KA 2DE0X 2CT4A 2DL8A 1UDLA 2RQWA 4Z8AA 2AZSA 1YWOA 1M3CA 2D8HA 2HCKA 2KGTA 3VS7A 1QKXA 4LN2A 2KT8A 5IXBA 4HCKA 1VYTA 3UATA 1RUWA 2ESWA 2CUDA 4AFQC 1HD3A 2OJ2A 1W1FA 2FEIA 1ZSGA 2GGRA 2LNHB 1GCQC 4CC4B 3H0HA 2BZ8A 2L3SA 3NHNA 2LJ0A 4OMNA 2CSQA 1PNJA 1X43A 2GQIA 2YUOA 2YUPA 3LH5A 2JMAA 4J9IA 2CH4A 1X2QA 2J7IA 1ZBJA 2EKHA 1SSHA 3H41A 5ECAA 2CREA 4LUEA 2GTJA 2CH4W 2YUNA 1WI7A 2J6FA 2ROTA 2DF6A 2W0ZA 4F14A 2BZXA 1Y0MA 2KRSA 2EW3A 4FSSA 1TG0A 2K79A
chains in the Genus database with same CATH superfamily
4AFZC 1O9SA 2DERA 1QVFA 2NUZA 1XOVA 2LCCA 1AT1B 1YJ9T 4XK8E 4OMMA 5J39A 2LQ8A 4M77G 2FYKA 2V1QA 2EYQA 9ATCB 1OV3A 2C0OA 2P0PA 4M77D 2QDLA 5FRNA 2ED0A 1BIBA 4AFUC 4DBHA 4EMGA 1VQNA 2L0AA 3QZ9B 1R0BG 4M77C 3M58A 4D6WA 3PT9A 1HJDA 2DA9A 1WX6A 2ZPHB 3CMET 4WCIA 1FYNA 3E2UA 2CUBA 2L5QA 2BE7D 2EIFA 1H3HA 3G6ET 1YITA 4IIMA 3CD6T 4C0FA 1M9SA 3PVLA 3VS4A 4C8QB 1JXMA 2DL7A 1B7TA 2LNVA 2RD1A 3JCMP 1ZX6A 5FLXE 3FIFA 3EFRA 1KQ1A 1YIJA 1YJNA 2RQUA 3QIIA 4A63B 2KE9A 3EHQA 2JW4A 5CAIA 5KE3A 5IT9E 4HCCA 1M1GA 2DTIA 4MZTA 5CKFA 3REAB 3WXMB 3H0FA 4JPBW 4RMOA 4E47A 2JXBA 3JRZA 1TOVA 2A08A 3TU4K 3QUIA 3CC2T 3VYHB 1ABOA 3JAME 4KRTA 2JVVA 5GAOp 2OTJQ 4HVWA 4F7UB 1B07A 2DYBA 3OS2A 2F5KA 2LT4A 3DB3A 1AOJA 1BU1A 1CSKA 2CT3A 1VQ7Q 2CYZB 3UF4A 3LGFA 1NE8A 3A1PA 1UB4A 3OYKA 3H0IA 1XTDA 1GCPA 1NEBA 4FYYB 1VQKQ 2MMPA 2FRYA 5KYXB 1ZA1B 3F70A 4JZ4A 1IO6A 2DL3A 5GAOq 4PJOB 1IRXA 4L6V5 1RAEB 2FRWA 2PUOB 2PZ1A 4A4KA 2RO0A 2VC8A 1QVFP 4M7DE 4EMKA 5GAOl 4QQGA 1VQPQ 2CZ6B 2VASA 1KC8R 1KQSA 1W2BA 1QW1A 2HL3A 2LQWA 2LMJA 5D7UA 1NZ9A 1UGSB 1BI0A 4BI3A 1YJ9A 1MMDA 2DXUA 2CZ1B 3RMQA 1AWWA 4R0KA 3JB9I 4M7AC 4F16A 2IIMA 2LX9A 3GPLA 2J6KA 1I07A 2P4TA 4XQ3A 2WACA 2A28A 2FZKB 4RTXA 4ZGEB 2M1HA 4XU0A 1OULA 1Y07A 1M2OA 3QXEB 3CMEA 1G3YA 1IGUA 3A8HB 1VA7A 1ZHIA 2DD4A 5CQYA 1W6XA 4AG1C 4ZNXA 5GAOr 2K5LA 3GBQA 3DLMA 3X26B 3CD6A 3L2QA 2X4WA 2YRDA 2GCXA 4LE9A 2CKKA 2OTLQ 3QBYA 2MCNA 4X1VA 4F17A 1WGSA 2JN0A 1IXDA 4M7DA 4IUTA 2NYSA 1TTHB 1PHTA 3TVTA 1SPKA 3G6EQ 2E5QA 1RADB 3MEUA 1V1CA 3SWNB 1YWPA 3TSZA 3EGXB 2MOXA 3FB9A 1NJIR 3SD4A 2HMAA 1OX8A 3CXCS 1VQ5T 3S3OA 3CC2A 3J81E 1U8RA 1Q86R 3VKIA 4LUDA 8ATCB 2EQMA 3JCMJ 1W4SA 3GP8A 4CC7A 1D1AA 1OZ3A 4KGXB 5LJ5e 4C8QG 1X6OA 6AT1B 1AWJA 1VQ4A 2VGNA 2O9VA 2I2LA 5KCHA 2RMOA 4C8QD 1UJ0A 4PJMA 3QYHB 4C92F 5D6XA 1M27C 4GBQA 3CCST 2ROLA 4C8QC 1W2BP 2A0FB 2DJQA 1BI3A 1K76A 2WSFE 1TUDA 1QVGA 5HCKA 3OB9A 4HVVA 2E10A 4F7UG 5HK0A 4J7FA 2RHXA 3CCMT 2CP7A 1E7OA 1OEBA 1K0SA 1JU5C 1RLPC 1H641 3EG0A 2QA4Q 1RAAB 2KRMA 1QWEA 2XDPA 2ZCFB 4JRQA 1N8RU 2D8JA 1I5LA 2SRCA 1MV0B 2RH2A 3NTKA 4X9DA 1IHWA 1M1FA 2CZ0B 1YJWT 4JRKA 5GAMe 3ZBDA 4EMKB 4PJOG 1VUBA 1OI1A 1RAIB 2CP6A 2HKNA 1I1JA 4ZTFA 1N9SA 2CGHA 5CKBA 4FYVB 1ZQ1A 2EAYA 4O5VA 4PJOD 2G6FX 3QWYA 2FPDA 3INZA 1Y96A 2WSCE 4OGEA 1H3ZA 4PJOC 4C5HA 4FIBA 1WDXA 5L23A 2ZPEB 2HQEA 4MDWA 4ATOA 3M55A 3GIBA 1U06A 5I11A 4M78F 4OF1A 4HCZA 2KI7A 4FT4A 3CCVQ 3CCRQ 2O9SA 4IIOA 3M4GA 2MI6A 2RHZA 4DBFA 2KY9A 4MMLA 1K0XA 2EGEA 1U1SA 2E5KA 1ZSZA 2F69A 4Y92A 1JJ2A 4PJLA 2E3HA 2MYSA 3OYDA 1WHKA 2KRNA 1EIFA 1NYGA 3HRTA 2DILA 2KK4A 1VQ5A 4M75E 1G8XA 1VQLT 3O5ZA 3I56Q 2DX1A 5D6WA 1E6GA 4M7DB 1G2BA 2X51A 4D8DA 1WXTA 2EYZA 1RAFB 1TU0B 4RTUA 2QTXA 4D8KA 2RQWA 2KSSA 1JB0E 2ATCB 3HHTB 1QVGP 4Y91A 1QKXA 3JCMW 3OW2P 3CCSA 1D1CA 5CIUA 4L5GA 4AFQC 1HD3A 2FEIA 7AT1B 2GGRA 3NFCA 3HSBA 1BKBA 1PD1A 1BI1A 4JS4A 3JB9J 4XTWA 1NPPA 3LYIA 1PNJA 3RKWA 3CCMA 3ASKA 3TEEA 3LH5A 2JMAA 1LNXA 2OX7A 3VYGA 1IB8A 5DLQE 4M77F 2CH4A 2QXFA 1X2QA 5M9OA 1U1TA 2EKHA 1ACMB 3C94A 4DOWA 2XDBA 5ECAA 4HT9A 1OZ2A 1OYXA 2YRCA 2DJZA 2J6FA 1R77A 2PVDB 5LJ5j 1MHNA 5GAN2 1YHQA 1D3BA 4M75A 3OS5A 2HZYA 3RESA 2K79A 5AT1B 2HSPA 3CPWA 3L1AA 4ANJA 4L59A 3UA7A 1NEGA 4E7LA 1VQMQ 2YUQA 2HAXA 2MAMA 1PD0A 2DBMA 1YJWQ 4E7SA 3JB9G 3PTAA 2EFIA 5IH2A 1CKAA 2O88A 4N0AA 3BE3A 3THKA 4KGZB 2DXCA 3CCQT 1NLPC 3EG9A 3JB9D 2HQXA 1QVPA 3OA6A 5CR2A 2KMTA 2ECZA 1Y96B 3AT1B 1UGRB 1JJ2P 2HBPA 1S1NA 3OYHA 1M3AA 1UTIA 1H92A 1QLYA 4C5IA 2XIDA 2LTOA 5GAMj 4QVZA 5GANe 2XI9A 1WIEA 3HKSA 1LCKA 4A54A 4IURA 3M0RA 4IUUA 2E70A 3M57A 1FXXA 1N5ZA 1NLOC 3MKDA 1NG2A 3MPUB 3CCLT 1ZSZB 1RABB 1RI0A 5LJ5f 1YJNT 2DVJA 1KHCA 4KULA 1KK7A 3VRZA 1WHJA 3LX7A 4GLKA 2F5TX 4BI8B 3CCUT 1QCNA 3A98A 1VQLQ 3O8VA 5J3BA 3EGUA 4A4GA 2OI3A 2FG0A 3L42A 4NOYA 2RQRA 3NMZC 3PIOA 4M7AB 5LJ3e 3V7SA 3CC7Q 3VUZA 4Z89A 2GFAA 4ME7A 2KYMA 1YI2Q 2JTMA 2OAUA 4LXCA 2DETA 3JCMQ 4M7DG 4J9FA 2XICA 3META 1JQQA 3S3MA 2EQJA 1ZA2B 4KH0B 1VYVA 3VS0A 4XTZA 1OPLA 1JXOA 4PKCC 1VQ6Q 1M8VA 3I55Q 4M7DC 5GAMf 4P5NA 3CPWP 5IHKA 2D1XA 3RIRA 4EPCA 2B8AA 2JMCA 4ZN3A 3QHSA 1TH7A 3JSCA 1UJYA 1SHGA 1AWOA 3M4YA 5GMKe 3MEAA 4QQ6A 3R6NA 1RAHB 5GAN6 3GOXA 2KROA 1J3TA 1D3BB 4M75B 3CCQA 5LJ5g 4RTYA 1MNEA 1M1KR 2GBQA 2KNBB 3RR6A 1GBRA 2RNAA 2A3LA 3MEWA 3NPFA 1OQKA 1RLQC 5IHNA 3RKXA 4HVUA 1E6HA 3LLRA 2ZPBB 1PKSA 2DK3A 2MPXC 3EG2A 1G3SA 3EG9B 3GF5A 1Q82C 2K5IA 3I35A 1K4US 4LD9K 4J9CA 2RA2A 2RJFA 4C8QF 1Q81R 1VQNQ 1KD1R 1K9MC 1JO8A 3L2UA 1XQHA 1GXIE 2BUDA 2NUTB 2E6NA 4JLIA 1A0NB 3CCLA 3NTHA 4HA8A 2D0NA 1LOJA 1O75A 4A4FA 1VOMA 2AKLA 3A5ZB 1WHMA 2MF2A 1RL2A 1VQOT 1YITQ 2RJDA 3CCUA 3CMAT 5GAMg 2I0NA 2RJCA 4R55A 4LDVA 5KYYA 3ME9A 2K2MA 1PM3A 2RPNA 4X34A 4F7UF 4BI4A 3QDRB 1QP3A 1TUGB 2BIVA 4EMHA 1AZEA 1YIJQ 1FMVA 1YJNQ 1I8FA 2J06A 1XNIA 4PFPA 2RQTA 2COYA 2KBTA 1PRLC 1K8AU 2RI3A 2LRQA 1VQ4T 2EBPA 4A4HA 3FRNA 1DJ7B 2VVKA 5GANj 1RI9A 4M78E 2HDAA 1BYMA 3EG1A 1S72A 1M5Q1 3OS0A 4J5YA 1MNDA 3ZFJA 4PJOF 2DAQA 1GBQA 1VYUA 1MV3A 4MMKA 4HT8A 3WVDB 1NM7A 3V8KA 1R8OB 1ZSZC 3BDUA 4RTZA 3EH2A 4TVRA 1HSQA 4M7AG 5LJ5h 2K3XA 3ULRB 1N8RC 3RUXA 2JTEA 1MMNA 3G71T 3G1JA 2VWFA 4M7AD 2BTTA 3EFSA 4NS5A 3M0QA 1PC0A 3PE0A 2QASA 4CI0C 2LJ1A 2DIQA 1ZBXA 1EZZB 1FMKA 5GJWB 3PMTA 1ZUYA 4PK4A 2NWMA 5LJ3j 4QT7A 4PL6A 2NUPB 3MHXA 1T0JA 2FPFA 2Y90A 2AK5A 3MP1A 1OU9A 3SEMA 1UGPB 2XU8A 4Z02A 4DBRA 2PU9B 3RMSA 2QGFB 1YJ9Q 2BE9B 1WYXA 3OW2S 1H8KA 3ER0A 8AT1B 2V1RA 2DM1A 2O31A 1VIEA 3M0UA 1ZUKA 2DLPA 4B9XA 1M90U 2XD0A 4DEXA 2X4JA 2L89A 1SRMA 2RN8A 4ELYC 4M78A 5GANf 1WFWA 4UC4A 1SSFA 5GAMh 3SHWA 1Q82U 3CC4A 3M9QA 4M75G 3OYJA 2EYXA 1MMAA 1WNLA 1WLPB 3FJPA 2YWWA 1W70A 3J80E 1D09B 5GMKj 1K73C 1K9MU 1PWTA 4DEYA 3CMEQ 1WQWA 1TUCA 4BE2A 1VQOA 5LJ5d 1M4ZA 1BK2A 3CMAA 2AKKA 4M75C 1D0XA 3CD6Q 5I22A 3C95A 2RI2A 5KYWA 3V7CA 1WHLA 1X6BA 4YTLA 4CC2A 1MUZA 2HQHA 5L8RE 1ARKA 3T9NA 2P84A 2EPDA 5I2MA 4KUIA 5LJ3f 4B6MA 3HTRA 2EQIA 2L2PA 2DL4A 4N0AC 2DE0X 1KQ2A 2DL8A 2ZZDA 2QYZA 1YWOA 1M3CA 4IUQA 5KYYB 2D8HA 4R56A 3CC2Q 2LT1A 3VS7A 4HCKA 3MJXA 2CUDA 1KQSP 3AHUA 1ZSGA 1JJ2S 3RKYA 2LNHB 1R0CB 3CCJT 3H0HA 1X01A 4J6XA 3NHNA 1VQ4Q 2JJ9A 3L2ZA 2CSQA 1X43A 2YUOA 5GAMd 2YUPA 2A7YA 1SKUB 3JB9F 3VU3C 2P0QA 4J8OA 3G71A 5GANg 3RDVA 4BY6C 3HRUA 1ZBJA 1SSHA 2CREA 4ZN1A 2GTJA 3EGDA 2CH4W 1PG5B 1WI7A 2QGGA 2DF6A 4F14A 1I81A 1YHQT 1BIAA 3M54A 4MDXA 3C12A 1Y0MA 2K3YA 3FLGA 4FSSA 4C0DB 3ZEHA 1U3OA 2K5FA 2VKNA 3G4SA 3UA6A 2PQWA 5DY9A 4AG2C 2KQWA 5HKCA 3OYYA 2QTVA 3CBMA 1X6GA 4JRPA 2E3IA 1WJRA 3HFNA 2B86A 2EJGA 3CCET 1Q7YC 1LVKA 5FU6C 3RNJA 5LJ3g 4J9DA 1P92A 1WA7A 4A53A 4E7HA 2EWNA 2EKOA 3CXCA 2RB6A 2IVWA 1TSFA 3QO3A 1X75C 4DA4A 2VXFA 1GCQA 2MK5A 4RTVA 5GAN7 1KFZA 3JCMX 2D9TA 1G3WA 5GMKm 1K73U 4AMCA 2E12A 2R5AA 5CK9A 3CPWS 3UDCA 5DM7R 1QP2A 2DD5A 3OYCA 2HL5C 4M7DF 2CP0A 2CP2A 2DMOA 2PVGB 2K57A 5IAYA 1D0YA 2GQVA 3QJ6A 4FCYA 2YT6A 5KYWB 5A0DA 1VQ5Q 3TCJA 2DBKA 5CCAA 3PNWC 2QDYB 5GANh 2IG0A 4LNPA 2H3JA 4N4IA 2EGCA 2LCSA 4CC3A 2VYTA 3CCJA 4J6YA 2D6FA 5CVIA 2X3XD 2DXBA 1YNZA 2DEQA 2LX7A 2RHIA 1SF9A 2F2VA 2L3QA 3OSSC 2RK1A 5KYNA 5GAN3 2L3RA 2RHUA 4A4EA 3CCSQ 5GJVB 2ED1A 3M0PA 4J9BA 3M59A 3URGA 2QEXT 1Y7XA 2M51A 1D0ZA 3L2WA 4FL6A 4HXJA 5FWBA 5LL6S 4RG8A 2Z0WA 1N8RR 3QSUA 3CCMQ 2AZVA 5LJ3h 2DRMA 4B9WA 4AT1B 5CQXA 1KC8C 3UT1A 5FWCA 3CBPA 4DOVA 4HCBA 1UHCA 1BCMA 2K9GA 3EGDB 4PLIA 1AZGB 3CCEA 4J7IA 3DKMA 5FW9A 1YHQQ 2QQAA 2FO0A 1V76A 2Y4XA 1Q7YU 2MWOA 3EHRA 3VS6A 1K9AA 3CQTA 1FMWA 2FPEA 5GANd 3FDRA 1EFNA 3HP9A 1Z9ZA 3DB4A 4JZ3A 4PJJA 1G5VA 5CKHA 5EC7A 2O01E 2DNUA 2YSQA 4IKFA 3OBWA 2D0QB 1N6AA 5GMKh 2DTOA 3TSWA 2M16A 2RK2A 3SFMA 1PCXA 2RQVA 4FU6A 4RCBA 1QVFS 1K73R 2AIRB 1BB9A 4C0DC 2X3WD 5D6YA 1I0CA 4KGVB 2HEQA 3OYEA 3OYBA 2JM9A 2O4XA 1C6VX 3CPFA 5IXFA 5LJ3d 4FSXA 1PKTA 2JUFA 1GFDA 3PIPA 2M02A 2OTJT 2JS0A 1NJIC 5J26A 2JT4A 1Q86C 4M7AF 1K8AC 1EX4A 3QWXX 2H3EB 1VQ9A 1IZ6A 4C0ZA 3UWNA 1K1ZA 1QKWA 4M78C 3BY7A 3X20B 3QDFA 2XK0A 5FRMA 2RHYA 2E6ZA 4GLMA 3TREA 5IHIA 4E2FB 1VQKT 2QQRA 1WQ7A 4M7DD 1VIFA 1S72T 2MIOA 3BDLA 3H8ZA 2X4XA 2QEXA 4CRIA 2KEAA 3Q1JA 3LWHA 2E64A 4FM4B 5KYUA 1I5OB 1UGVA 4BDZA 3VJPA 2MWPA 4J9GA 5EG2A 3FEOA 1VQPT 2NLUA 1UGQB 3EG3A 4OMPA 4LDWA 4J83A 1TS9A 2AHJB 3P8DA 4XU3A 3N5BB 2HD0A 2P4RA 4KH1B 3QYGB 1KC8U 4FW2A 2HSEB 3JCMe 4N4GA 2CP5A 2J6OA 2DIGA 4M75F 4K11A 3S6WA 1WHHA 4OB1B 1WXBA 3M53A 1WZOA 3JV3A 4AFSC 4OVAA 4QVDA 1Q7YR 2LP5A 1JEGA 2PNIA 4C92E 2LZ6B 3OY9A 2F2XA 1M90C 4ESRA 1V29B 1KG1A 1Y71A 1WXUA 5A0GA 1IREB 3UPUA 2BKDN 1LJOA 1KQSS 1GFCA 1W2BS 4ORZA 4QVCA 2DL5A 3CCQQ 3JCMc 2XHCA 1KHIA 2VV5A 4JJBA 3FC3A 1KJWA 3CC4T 2EGAA 3U23A 2H8HA 5DLOA 2OTLT 1SG5A 3FJ5A 2RM4A 3I5RA 3I9QA 2CDTA 2EQKA 5GAN4 1Z9QA 3PMIA 3SWNA 2X9HA 4BDYA 1OX9A 4RCCA 3E9FA 3EGXA 4OP0A 3QJYA 4BY6B 1FWZA 2YDLA 2JS2A 2E1HA 3P8BB 2IPOB 2OTJA 2DO3A 1WJSA 3CCLQ 1JBMA 3G7ZA 2CP3A 1NJIU 2EVRA 2O4XB 4JJDA 4FYWB 1Q86U 2M0YA 1VQ7A 3LWIA 3TQ7P 3CCUQ 3HL8A 4Q5WA 1VQKA 4LN2A 4C92A 1IGQA 1OU8A 1RUWA 2ESWA 5GAOm 2OJ2A 4KBMB 4C0GA 1GCQC 4CC4B 2JZ2A 2BZ8A 2L3SA 3QKJA 5FU6B 3OYNA 2DVEA 4OMNA 2HKQB 1VQPA 2P0KA 2X35A 3QZ5B 4XTYA 4BB7A 1S72Q 2QA4T 5HY6A 2DZ9A 2EQUA 2J7IA 3L2RA 3SB2A 2V8IA 2LVMA 1JRIA 3H41A 5IN1A 2DYIA 4LUEA 5KYUB 1G3TA 2YUNA 2RJEA 3OS1A 3GNGA 3E1SA 2DXTA 2W0ZA 2QAZA 4PNOA 1VQ8T 1FX7A 2KRSA 2EW3A 3MP8A 3OYAA 1TXQA 2JM8A 5I21A 2YLBA 2E4HA 1RACB 1M30A 3G4ST 2ABLA 1QVGS 4JRIA 3ZL7C 4ZTJA 2F2WA 4JDSA 4NL3A 5GMKi 4MZMA 1WJQA 3CCVT 1CKBA 4OMOA 5I2SA 1C1AA 2XMFA 3CCRT 2EYYA 3OYLA 1T0HA 2OTLA 3E19A 3KUFA 3OMCA 4EDUA 4J9HA 4XU2A 3OYMA 4J9EA 4N4HA 4M77E 3MO8A 1UEBA 4M75D 3H6ZA 4IUPA 1KSWA 1QCFA 1WHGA 3G6EA 1OOTA 1NPRA 2DEUA 3HRSA 3R6OA 2RI5A 2EYWA 3A8MB 1NBEB 2SEMA 4WTOB 2LC4A 3CC4Q 3KFVA 1QQJA 4OB0B 3EFOA 1Q95G 1N27A 3I56T 1BCOA 2FZCB 5KCOA 4OMFB 2K2VA 2LCLA 4DQ2A 1AD5A 3VRYA 2PTKA 2ZPIB 2DRKA 1PSEA 2A37A 2GF7A 1VQOQ 3CMAQ 2CZ7B 3X24B 1K8AR 2KDSA 4GY5A 5AYFA 1X69A 2VGMA 2OAWA 2EJFA 2VB6A 4BUGA 4RTWA 5C6SA 2FVUA 1G83A 1HXDA 3PGGA 1QMCA 3JCMV 3BW1A 4F04B 1IHVA 3V7RA 2FZGB 3I5SA 1MMGA 3GLXA 3PVQA 5CKDA 4C92B 4XTUA 2QA4A 1ZLMA 5KE2A 2PUKB 4M77A 3VS2A 4C5EA 1YBYA 2KXCA 3M56A 3JCMf 1D1BA 3OW2A 1I4K1 4LDUA 4LD6A 3MCAB 1VQ8A 2QI2A 4RUGA 2E41A 3M0SA 3G71Q 2QK0A 2ZAEA 3OMGA 1M2VA 3OYFA 1VQMT 2C0TA 1MGQA 3E9GA 1F1BB 4M7AE 1VQ8Q 3SDZA 4QQDA 2DFUA 4E7ZA 4VUBA 3CCVA 4MZPA 1M90R 5C0MA 3CCRA 5GAN5 3VS5A 3G4SQ 2J05A 2V8KA 2VUBA 1AVZC 5GAOn 1M1KC 2F1LA 2LDMA 1SRLA 4KT0E 1Q82R 5FU7B 1NYFA 3GNFB 1HYOA 2KT1A 3IQLA 4FYXB 1YFNA 1B34A 1UUEA 2R5MA 3C4SA 2LJ3A 1YCSB 2GNCA 4M78B 2W10A 4XTXA 1K9MR 3M5AA 2KYBA 2XG8D 4M4ZA 3P8HA 2C06A 1QWFA 4Z88A 2KAFA 1UE9A 3DLLA 2L3PA 3I56A 2M0OA 1UG1A 5GAN8 3OBYA 3RBBB 1Q81C 1HK9A 1KD1C 1BI2A 1XJWB 2C0IA 3M0TA 1OPKA 1GRIA 1T3SA 3JCMg 2LQKA 2V8JA 1UHFA 2RF0A 3EFOB 2COZA 5GMKl 3VUBA 4JS5A 2LQNA 3OQ5A 4LDYA 4ZGDB 3VV0A 4ZGJB 4PJNA 4BACA 1UFFA 2FL7A 4RTTA 4NL2A 2R58A 3A8LB 1PSFA 4KUDK 2GFUA 4M7AA 2KXDA 3CC7T 1YI2T 1VQ9T 1LPLA 2K3BA 4BE1A 3OYIA 5A2QE 3EH1A 4XTVA 1TWBA 2GTOA 1YN8A 2BZYA 3VS1A 2VXEA 3H9NA 4XU1A 4C8QE 1VQ6T 1ABQA 3CCJQ 3I55T 2DZCA 1M3BA 1X27A 5KH6A 2O2OA 3LW5E 3SWNC 4C5GA 1B3QA 3J7AF 3WVEB 1GL5A 5HK3A 3NGPA 4FW1A 4E7IA 3HFOA 1PRMC 2JTFA 4M77B 1VQMA 4JUVA 3A8OB 3JB9H 1ZUUA 2JNGA 1YJWA 2WSEE 2K7AA 4OGCA 4C92G 3MEVA 2XDDA 4F7UE 5FROA 2YXYA 3KBGA 3CXCP 2AT1B 2KVQG 2L8DA 4C92D 1KIKA 3MP6A 2A36A 5A0LA 1AEYA 2DTHA 2JOYA 4V2SA 2EJ9A 4BD3A 1M2VB 4C92C 1YP5A 1QCOA 3EAEA 2CSIA 2QQBA 1SHFA 2YRVA 1AWXA 1X2KA 3CCEQ 2HBWA 1YCYA 1M1KU 3QG1A 4PJOE 3PFSA 2CS7A 4QW2A 3LGLA 3JCMh 4J6WA 3RERA 2K6DA 1N9RA 2YHTA 1SEMA 2FB7A 2G3RA 1RAGB 4E7KA 3VS3A 1VQNT 4C8QA 3X28B 2DPPB 2YLCA 2NUTA 2M9UA 3C0CA 3HPWA 2PVOB 1Y57A 2ENMA 2HNIA 4DBQA 1B34B 4HKEA 1AHJB 3REBB 4EMKC 4JJCA 1Q81U 3KXTA 1KD1U 4LDXA 1YITT 5CKEA 4EIKA 3BFMA 1VQLA 2KR3A 2DKGA 4PLLA 1UECA 4M78G 1T3LA 1U5SA 4QKUA 1BBZA 4OMQA 1M8MA 4OMLA 4F7UA 1YIJT 2COWA 4BE0A 4OB3B 4M78D 2E65A 3CC7A 5FU7C 2X4YA 4E6RA 2QQ9A 3L2VA 2XKOC 4FT2A 1YI2A 1VQ7T 2CT4A 4WF2A 1UDLA 4Z8AA 2AZSA 2QG9B 4JLGA 1WPYA 4IUVA 1C0MA 2HCKA 2KGTA 2ZGWA 2KT8A 4XAXB 5IXBA 3LH0A 4X9CA 1VYTA 2QQSA 5KYXA 3UATA 3D7SB 4Y28E 3NTIA 4RG2A 3JCMb 3CBOA 1W1FA 4PJOA 4O6JA 1VQ6A 3I55A 1VQ9Q 2LJ0A 3JCMd 2GQIA 4OB2B 4II1A 3X25B 4ELZC 4PFOA 3OYGA 3V8LA 4J9IA 5CO7A 4E7JA 3V8JA 2ZPFB 3QPHA 2QEXQ 2ZPGB 2FHDA 2Y4YA 2V26A 3S3NA 2ROTA 4RKUE 2R57A 3A8GB 4PFZA 4JJNK 2BZXA 2NUPA 3OSVA 2K4YA 1TG0A 3CEYA
chains in the Genus database with same CATH topology
1U3OA 2HSPA 4AFZC 2VKNA 3UA7A 2NUZA 1NEGA 1XOVA 1M30A 2YUQA 3UA6A 4AG2C 2ABLA 2DBMA 4OMMA 3ZL7C 1X6GA 2B86A 2F2WA 2V1QA 5IH2A 1CKAA 2O88A 1OV3A 3THKA 2C0OA 3RNJA 1NLPC 4J9DA 2QDLA 2ED0A 1CKBA 4OMOA 1WA7A 2XMFA 2ECZA 4AFUC 2EYYA 1T0HA 2L0AA 1S1NA 1M3AA 1UTIA 4J9HA 1HJDA 1H92A 2DA9A 1WX6A 4J9EA 1GCQA 4RTVA 1KFZA 4WCIA 1QLYA 1FYNA 1KSWA 1QCFA 2CUBA 1OOTA 1H3HA 2EYWA 1WIEA 4IIMA 1LCKA 2SEMA 3M0RA 3KFVA 3PVLA 3VS4A 1JXMA 2DL7A 1N5ZA 1ZX6A 1NLOC 1NG2A 2DMOA 2RQUA 1AD5A 3VRYA 2PTKA 2DVJA 4A63B 2KE9A 3EHQA 2JW4A 2DRKA 3VRZA 2A37A 3REAB 3H0FA 4JPBW 2JXBA 2YT6A 3A98A 2DBKA 2A08A 3EGUA 2OI3A 2FG0A 1ABOA 4KRTA 2RQRA 3NMZC 4HVWA 4LNPA 1B07A 2DYBA 1X69A 2EGCA 2LCSA 2OAWA 4CC3A 1AOJA 1BU1A 4RTWA 4Z89A 1CSKA 2CT3A 2KYMA 1G83A 2X3XD 3UF4A 1YNZA 2LX7A 4J9FA 2F2VA 2L3QA 3H0IA 3I5SA 1GCPA 1JQQA 1NEBA 3PVQA 2FRYA 1VYVA 1ZLMA 5GJVB 4JZ4A 3VS0A 1IO6A 2DL3A 3VS2A 2ED1A 3M0PA 4J9BA 1OPLA 1JXOA 2KXCA 2FRWA 2M51A 4HXJA 5FWBA 2PZ1A 5IHKA 2D1XA 2JMCA 2LQWA 2LMJA 2AZVA 1UJYA 2DRMA 1SHGA 4RUGA 1AWOA 3M0SA 5FWCA 1UHCA 2K9GA 2C0TA 3R6NA 1AWWA 1AZGB 4R0KA 4F16A 5FW9A 2KROA 1J3TA 2FO0A 2IIMA 3EHRA 4RTYA 3VS6A 2J6KA 1K9AA 3CQTA 1I07A 2GBQA 2FPEA 2A28A 2KNBB 3VS5A 1GBRA 1EFNA 2RNAA 1Z9ZA 4JZ3A 4RTXA 2J05A 1AVZC 3NPFA 5EC7A 2DNUA 2YSQA 1RLQC 1SRLA 5IHNA 4HVUA 1NYFA 1E6HA 2KT1A 3IQLA 1UUEA 3TSWA 1PKSA 2LJ3A 1YCSB 1VA7A 2GNCA 1W6XA 3EG2A 2W10A 4AG1C 4ZNXA 3I35A 3GBQA 2KYBA 2RQVA 4M4ZA 1K4US 4J9CA 1QWFA 4Z88A 1UE9A 2L3PA 1BB9A 4LE9A 1JO8A 1UG1A 2MCNA 2X3WD 4X1VA 1I0CA 4F17A 1A0NB 2HEQA 2JM8A 3RBBB 2D0NA 2JM9A 3TVTA 1PHTA 2AKLA 2C0IA 1SPKA 3M0TA 1OPKA 1GRIA 5IXFA 1V1CA 1YWPA 1T3SA 3TSZA 2MOXA 1PKTA 2I0NA 1UHFA 2RF0A 1GFDA 2K2MA 2LQNA 4LUDA 2RPNA 4CC7A 2JS0A 1AZEA 1UFFA 4RTTA 2JT4A 2J06A 2RQTA 2KXDA 1AWJA 3QWXX 2KBTA 1PRLC 1K1ZA 2EBPA 1QKWA 2K3BA 2O9VA 2RMOA 2VVKA 1UJ0A 1RI9A 4GLMA 2GTOA 2HDAA 5IHIA 1M27C 3EG1A 4GBQA 1YN8A 2BZYA 2ROLA 3VS1A 2MIOA 1GBQA 1VYUA 1MV3A 2DJQA 1K76A 2KEAA 1NM7A 1TUDA 1ABQA 5HCKA 1UGVA 4RTZA 4HVVA 1M3BA 1X27A 4J9GA 2O2OA 1HSQA 1E7OA 1B3QA 3EG3A 1OEBA 4OMPA 1GL5A 3ULRB 1K0SA 3NGPA 1JU5C 1RLPC 1PRMC 2JTEA 3EG0A 2KRMA 2P4RA 1QWEA 2VWFA 2BTTA 2D8JA 2SRCA 1MV0B 3M0QA 1ZUUA 3PE0A 2LJ1A 2K7AA 2J6OA 1FMKA 5GJWB 1ZUYA 2NWMA 4QT7A 4K11A 1WXBA 1KIKA 1I1JA 1T0JA 2FPFA 3JV3A 2AK5A 4AFSC 3SEMA 2A36A 2G6FX 1AEYA 3QWYA 2FPDA 1YP5A 2LP5A 1JEGA 2PNIA 2CSIA 1SHFA 1WYXA 2LZ6B 1AWXA 1H8KA 2F2XA 4ESRA 2DM1A 2O31A 2V1RA 1X2KA 1WXUA 2HBWA 1WDXA 3M0UA 5L23A 1ZUKA 2DLPA 1GFCA 4ORZA 4DEXA 1U06A 5I11A 1SRMA 2DL5A 2RN8A 1WFWA 3SHWA 2K6DA 1SEMA 4JJBA 1KJWA 2O9SA 2EGAA 3VS3A 2EYXA 4IIOA 3U23A 1WLPB 2H8HA 1W70A 3C0CA 3FJ5A 1K0XA 2EGEA 1PWTA 4DEYA 2E5KA 3I5RA 1Y57A 2ENMA 3I9QA 2CDTA 4Y92A 3REBB 4JJCA 1TUCA 1Z9QA 1BK2A 2AKKA 4EIKA 2KRNA 5I22A 1NYGA 2KR3A 2DILA 3O5ZA 1X6BA 1UECA 4CC2A 1T3LA 1U5SA 2YDLA 1BBZA 1MUZA 2DX1A 2JS2A 4OMQA 1ARKA 1M8MA 4OMLA 1E6GA 1G2BA 2EPDA 4D8DA 1WXTA 2EYZA 2EVRA 4JJDA 4RTUA 2EQIA 2L2PA 2DL4A 2M0YA 4E6RA 4D8KA 2DE0X 2CT4A 2DL8A 1UDLA 2RQWA 4Z8AA 2AZSA 1YWOA 1M3CA 2D8HA 2HCKA 2KGTA 3VS7A 1QKXA 4LN2A 2KT8A 5IXBA 4HCKA 1VYTA 3UATA 1RUWA 2ESWA 2CUDA 4AFQC 1HD3A 2OJ2A 1W1FA 2FEIA 1ZSGA 2GGRA 2LNHB 1GCQC 4CC4B 3H0HA 2BZ8A 2L3SA 3NHNA 2LJ0A 4OMNA 2CSQA 1PNJA 1X43A 2GQIA 2YUOA 2YUPA 3LH5A 2JMAA 4J9IA 2CH4A 1X2QA 2J7IA 1ZBJA 2EKHA 1SSHA 3H41A 5ECAA 2CREA 4LUEA 2GTJA 2CH4W 2YUNA 1WI7A 2J6FA 2ROTA 2DF6A 2W0ZA 4F14A 2BZXA 1Y0MA 2KRSA 2EW3A 4FSSA 1TG0A 2K79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3O A;  2HSP A;  4AFZ C;  2VKN A;  3UA7 A;  2NUZ A;  1NEG A;  1XOV A;  1M30 A;  2YUQ A;  3UA6 A;  4AG2 C;  2ABL A;  2DBM A;  4OMM A;  3ZL7 C;  1X6G A;  2B86 A;  2F2W A;  2V1Q A;  5IH2 A;  1CKA A;  2O88 A;  1OV3 A;  3THK A;  2C0O A;  3RNJ A;  1NLP C;  4J9D A;  2QDL A;  2ED0 A;  1CKB A;  4OMO A;  1WA7 A;  2XMF A;  2ECZ A;  4AFU C;  2EYY A;  1T0H A;  2L0A A;  1S1N A;  1M3A A;  1UTI A;  4J9H A;  1HJD A;  1H92 A;  2DA9 A;  1WX6 A;  4J9E A;  1GCQ A;  4RTV A;  1KFZ A;  4WCI A;  1QLY A;  1FYN A;  1KSW A;  1QCF A;  2CUB A;  1OOT A;  1H3H A;  2EYW A;  1WIE A;  4IIM A;  1LCK A;  2SEM A;  3M0R A;  3KFV A;  3PVL A;  3VS4 A;  1JXM A;  2DL7 A;  1N5Z A;  1ZX6 A;  1NLO C;  1NG2 A;  2DMO A;  2RQU A;  1AD5 A;  3VRY A;  2PTK A;  2DVJ A;  4A63 B;  2KE9 A;  3EHQ A;  2JW4 A;  2DRK A;  3VRZ A;  2A37 A;  3REA B;  3H0F A;  4JPB W;  2JXB A;  2YT6 A;  3A98 A;  2DBK A;  2A08 A;  3EGU A;  2OI3 A;  2FG0 A;  1ABO A;  4KRT A;  2RQR A;  3NMZ C;  4HVW A;  4LNP A;  1B07 A;  2DYB A;  1X69 A;  2EGC A;  2LCS A;  2OAW A;  4CC3 A;  1AOJ A;  1BU1 A;  4RTW A;  4Z89 A;  1CSK A;  2CT3 A;  2KYM A;  1G83 A;  2X3X D;  3UF4 A;  1YNZ A;  2LX7 A;  4J9F A;  2F2V A;  2L3Q A;  3H0I A;  3I5S A;  1GCP A;  1JQQ A;  1NEB A;  3PVQ A;  2FRY A;  1VYV A;  1ZLM A;  5GJV B;  4JZ4 A;  3VS0 A;  1IO6 A;  2DL3 A;  3VS2 A;  2ED1 A;  3M0P A;  4J9B A;  1OPL A;  1JXO A;  2KXC A;  2FRW A;  2M51 A;  4HXJ A;  5FWB A;  2PZ1 A;  5IHK A;  2D1X A;  2JMC A;  2LQW A;  2LMJ A;  2AZV A;  1UJY A;  2DRM A;  1SHG A;  4RUG A;  1AWO A;  3M0S A;  5FWC A;  1UHC A;  2K9G A;  2C0T A;  3R6N A;  1AWW A;  1AZG B;  4R0K A;  4F16 A;  5FW9 A;  2KRO A;  1J3T A;  2FO0 A;  2IIM A;  3EHR A;  4RTY A;  3VS6 A;  2J6K A;  1K9A A;  3CQT A;  1I07 A;  2GBQ A;  2FPE A;  2A28 A;  2KNB B;  3VS5 A;  1GBR A;  1EFN A;  2RNA A;  1Z9Z A;  4JZ3 A;  4RTX A;  2J05 A;  1AVZ C;  3NPF A;  5EC7 A;  2DNU A;  2YSQ A;  1RLQ C;  1SRL A;  5IHN A;  4HVU A;  1NYF A;  1E6H A;  2KT1 A;  3IQL A;  1UUE A;  3TSW A;  1PKS A;  2LJ3 A;  1YCS B;  1VA7 A;  2GNC A;  1W6X A;  3EG2 A;  2W10 A;  4AG1 C;  4ZNX A;  3I35 A;  3GBQ A;  2KYB A;  2RQV A;  4M4Z A;  1K4U S;  4J9C A;  1QWF A;  4Z88 A;  1UE9 A;  2L3P A;  1BB9 A;  4LE9 A;  1JO8 A;  1UG1 A;  2MCN A;  2X3W D;  4X1V A;  1I0C A;  4F17 A;  1A0N B;  2HEQ A;  2JM8 A;  3RBB B;  2D0N A;  2JM9 A;  3TVT A;  1PHT A;  2AKL A;  2C0I A;  1SPK A;  3M0T A;  1OPK A;  1GRI A;  5IXF A;  1V1C A;  1YWP A;  1T3S A;  3TSZ A;  2MOX A;  1PKT A;  2I0N A;  1UHF A;  2RF0 A;  1GFD A;  2K2M A;  2LQN A;  4LUD A;  2RPN A;  4CC7 A;  2JS0 A;  1AZE A;  1UFF A;  4RTT A;  2JT4 A;  2J06 A;  2RQT A;  2KXD A;  1AWJ A;  3QWX X;  2KBT A;  1PRL C;  1K1Z A;  2EBP A;  1QKW A;  2K3B A;  2O9V A;  2RMO A;  2VVK A;  1UJ0 A;  1RI9 A;  4GLM A;  2GTO A;  2HDA A;  5IHI A;  1M27 C;  3EG1 A;  4GBQ A;  1YN8 A;  2BZY A;  2ROL A;  3VS1 A;  2MIO A;  1GBQ A;  1VYU A;  1MV3 A;  2DJQ A;  1K76 A;  2KEA A;  1NM7 A;  1TUD A;  1ABQ A;  5HCK A;  1UGV A;  4RTZ A;  4HVV A;  1M3B A;  1X27 A;  4J9G A;  2O2O A;  1HSQ A;  1E7O A;  1B3Q A;  3EG3 A;  1OEB A;  4OMP A;  1GL5 A;  3ULR B;  1K0S A;  3NGP A;  1JU5 C;  1RLP C;  1PRM C;  2JTE A;  3EG0 A;  2KRM A;  2P4R A;  1QWE A;  2VWF A;  2BTT A;  2D8J A;  2SRC A;  1MV0 B;  3M0Q A;  1ZUU A;  3PE0 A;  2LJ1 A;  2K7A A;  2J6O A;  1FMK A;  5GJW B;  1ZUY A;  2NWM A;  4QT7 A;  4K11 A;  1WXB A;  1KIK A;  1I1J A;  1T0J A;  2FPF A;  3JV3 A;  2AK5 A;  4AFS C;  3SEM A;  2A36 A;  2G6F X;  1AEY A;  3QWY A;  2FPD A;  1YP5 A;  2LP5 A;  1JEG A;  2PNI A;  2CSI A;  1SHF A;  1WYX A;  2LZ6 B;  1AWX A;  1H8K A;  2F2X A;  4ESR A;  2DM1 A;  2O31 A;  2V1R A;  1X2K A;  1WXU A;  2HBW A;  1WDX A;  3M0U A;  5L23 A;  1ZUK A;  2DLP A;  1GFC A;  4ORZ A;  4DEX A;  1U06 A;  5I11 A;  1SRM A;  2DL5 A;  2RN8 A;  1WFW A;  3SHW A;  2K6D A;  1SEM A;  4JJB A;  1KJW A;  2O9S A;  2EGA A;  3VS3 A;  2EYX A;  4IIO A;  3U23 A;  1WLP B;  2H8H A;  1W70 A;  3C0C A;  3FJ5 A;  1K0X A;  2EGE A;  1PWT A;  4DEY A;  2E5K A;  3I5R A;  1Y57 A;  2ENM A;  3I9Q A;  2CDT A;  4Y92 A;  3REB B;  4JJC A;  1TUC A;  1Z9Q A;  1BK2 A;  2AKK A;  4EIK A;  2KRN A;  5I22 A;  1NYG A;  2KR3 A;  2DIL A;  3O5Z A;  1X6B A;  1UEC A;  4CC2 A;  1T3L A;  1U5S A;  2YDL A;  1BBZ A;  1MUZ A;  2DX1 A;  2JS2 A;  4OMQ A;  1ARK A;  1M8M A;  4OML A;  1E6G A;  1G2B A;  2EPD A;  4D8D A;  1WXT A;  2EYZ A;  2EVR A;  4JJD A;  4RTU A;  2EQI A;  2L2P A;  2DL4 A;  2M0Y A;  4E6R A;  4D8K A;  2DE0 X;  2CT4 A;  2DL8 A;  1UDL A;  2RQW A;  4Z8A A;  2AZS A;  1YWO A;  1M3C A;  2D8H A;  2HCK A;  2KGT A;  3VS7 A;  1QKX A;  4LN2 A;  2KT8 A;  5IXB A;  4HCK A;  1VYT A;  3UAT A;  1RUW A;  2ESW A;  2CUD A;  4AFQ C;  1HD3 A;  2OJ2 A;  1W1F A;  2FEI A;  1ZSG A;  2GGR A;  2LNH B;  1GCQ C;  4CC4 B;  3H0H A;  2BZ8 A;  2L3S A;  3NHN A;  2LJ0 A;  4OMN A;  2CSQ A;  1PNJ A;  1X43 A;  2GQI A;  2YUO A;  2YUP A;  3LH5 A;  2JMA A;  4J9I A;  2CH4 A;  1X2Q A;  2J7I A;  1ZBJ A;  2EKH A;  1SSH A;  3H41 A;  5ECA A;  2CRE A;  4LUE A;  2GTJ A;  2CH4 W;  2YUN A;  1WI7 A;  2J6F A;  2ROT A;  2DF6 A;  2W0Z A;  4F14 A;  2BZX A;  1Y0M A;  2KRS A;  2EW3 A;  4FSS A;  1TG0 A;  2K79 A; 
#chains in the Genus database with same CATH topology
 4AFZ C;  1O9S A;  2DER A;  1QVF A;  2NUZ A;  1XOV A;  2LCC A;  1AT1 B;  1YJ9 T;  4XK8 E;  4OMM A;  5J39 A;  2LQ8 A;  4M77 G;  2FYK A;  2V1Q A;  2EYQ A;  9ATC B;  1OV3 A;  2C0O A;  2P0P A;  4M77 D;  2QDL A;  5FRN A;  2ED0 A;  1BIB A;  4AFU C;  4DBH A;  4EMG A;  1VQN A;  2L0A A;  3QZ9 B;  1R0B G;  4M77 C;  3M58 A;  4D6W A;  3PT9 A;  1HJD A;  2DA9 A;  1WX6 A;  2ZPH B;  3CME T;  4WCI A;  1FYN A;  3E2U A;  2CUB A;  2L5Q A;  2BE7 D;  2EIF A;  1H3H A;  3G6E T;  1YIT A;  4IIM A;  3CD6 T;  4C0F A;  1M9S A;  3PVL A;  3VS4 A;  4C8Q B;  1JXM A;  2DL7 A;  1B7T A;  2LNV A;  2RD1 A;  3JCM P;  1ZX6 A;  5FLX E;  3FIF A;  3EFR A;  1KQ1 A;  1YIJ A;  1YJN A;  2RQU A;  3QII A;  4A63 B;  2KE9 A;  3EHQ A;  2JW4 A;  5CAI A;  5KE3 A;  5IT9 E;  4HCC A;  1M1G A;  2DTI A;  4MZT A;  5CKF A;  3REA B;  3WXM B;  3H0F A;  4JPB W;  4RMO A;  4E47 A;  2JXB A;  3JRZ A;  1TOV A;  2A08 A;  3TU4 K;  3QUI A;  3CC2 T;  3VYH B;  1ABO A;  3JAM E;  4KRT A;  2JVV A;  5GAO p;  2OTJ Q;  4HVW A;  4F7U B;  1B07 A;  2DYB A;  3OS2 A;  2F5K A;  2LT4 A;  3DB3 A;  1AOJ A;  1BU1 A;  1CSK A;  2CT3 A;  1VQ7 Q;  2CYZ B;  3UF4 A;  3LGF A;  1NE8 A;  3A1P A;  1UB4 A;  3OYK A;  3H0I A;  1XTD A;  1GCP A;  1NEB A;  4FYY B;  1VQK Q;  2MMP A;  2FRY A;  5KYX B;  1ZA1 B;  3F70 A;  4JZ4 A;  1IO6 A;  2DL3 A;  5GAO q;  4PJO B;  1IRX A;  4L6V 5;  1RAE B;  2FRW A;  2PUO B;  2PZ1 A;  4A4K A;  2RO0 A;  2VC8 A;  1QVF P;  4M7D E;  4EMK A;  5GAO l;  4QQG A;  1VQP Q;  2CZ6 B;  2VAS A;  1KC8 R;  1KQS A;  1W2B A;  1QW1 A;  2HL3 A;  2LQW A;  2LMJ A;  5D7U A;  1NZ9 A;  1UGS B;  1BI0 A;  4BI3 A;  1YJ9 A;  1MMD A;  2DXU A;  2CZ1 B;  3RMQ A;  1AWW A;  4R0K A;  3JB9 I;  4M7A C;  4F16 A;  2IIM A;  2LX9 A;  3GPL A;  2J6K A;  1I07 A;  2P4T A;  4XQ3 A;  2WAC A;  2A28 A;  2FZK B;  4RTX A;  4ZGE B;  2M1H A;  4XU0 A;  1OUL A;  1Y07 A;  1M2O A;  3QXE B;  3CME A;  1G3Y A;  1IGU A;  3A8H B;  1VA7 A;  1ZHI A;  2DD4 A;  5CQY A;  1W6X A;  4AG1 C;  4ZNX A;  5GAO r;  2K5L A;  3GBQ A;  3DLM A;  3X26 B;  3CD6 A;  3L2Q A;  2X4W A;  2YRD A;  2GCX A;  4LE9 A;  2CKK A;  2OTL Q;  3QBY A;  2MCN A;  4X1V A;  4F17 A;  1WGS A;  2JN0 A;  1IXD A;  4M7D A;  4IUT A;  2NYS A;  1TTH B;  1PHT A;  3TVT A;  1SPK A;  3G6E Q;  2E5Q A;  1RAD B;  3MEU A;  1V1C A;  3SWN B;  1YWP A;  3TSZ A;  3EGX B;  2MOX A;  3FB9 A;  1NJI R;  3SD4 A;  2HMA A;  1OX8 A;  3CXC S;  1VQ5 T;  3S3O A;  3CC2 A;  3J81 E;  1U8R A;  1Q86 R;  3VKI A;  4LUD A;  8ATC B;  2EQM A;  3JCM J;  1W4S A;  3GP8 A;  4CC7 A;  1D1A A;  1OZ3 A;  4KGX B;  5LJ5 e;  4C8Q G;  1X6O A;  6AT1 B;  1AWJ A;  1VQ4 A;  2VGN A;  2O9V A;  2I2L A;  5KCH A;  2RMO A;  4C8Q D;  1UJ0 A;  4PJM A;  3QYH B;  4C92 F;  5D6X A;  1M27 C;  4GBQ A;  3CCS T;  2ROL A;  4C8Q C;  1W2B P;  2A0F B;  2DJQ A;  1BI3 A;  1K76 A;  2WSF E;  1TUD A;  1QVG A;  5HCK A;  3OB9 A;  4HVV A;  2E10 A;  4F7U G;  5HK0 A;  4J7F A;  2RHX A;  3CCM T;  2CP7 A;  1E7O A;  1OEB A;  1K0S A;  1JU5 C;  1RLP C;  1H64 1;  3EG0 A;  2QA4 Q;  1RAA B;  2KRM A;  1QWE A;  2XDP A;  2ZCF B;  4JRQ A;  1N8R U;  2D8J A;  1I5L A;  2SRC A;  1MV0 B;  2RH2 A;  3NTK A;  4X9D A;  1IHW A;  1M1F A;  2CZ0 B;  1YJW T;  4JRK A;  5GAM e;  3ZBD A;  4EMK B;  4PJO G;  1VUB A;  1OI1 A;  1RAI B;  2CP6 A;  2HKN A;  1I1J A;  4ZTF A;  1N9S A;  2CGH A;  5CKB A;  4FYV B;  1ZQ1 A;  2EAY A;  4O5V A;  4PJO D;  2G6F X;  3QWY A;  2FPD A;  3INZ A;  1Y96 A;  2WSC E;  4OGE A;  1H3Z A;  4PJO C;  4C5H A;  4FIB A;  1WDX A;  5L23 A;  2ZPE B;  2HQE A;  4MDW A;  4ATO A;  3M55 A;  3GIB A;  1U06 A;  5I11 A;  4M78 F;  4OF1 A;  4HCZ A;  2KI7 A;  4FT4 A;  3CCV Q;  3CCR Q;  2O9S A;  4IIO A;  3M4G A;  2MI6 A;  2RHZ A;  4DBF A;  2KY9 A;  4MML A;  1K0X A;  2EGE A;  1U1S A;  2E5K A;  1ZSZ A;  2F69 A;  4Y92 A;  1JJ2 A;  4PJL A;  2E3H A;  2MYS A;  3OYD A;  1WHK A;  2KRN A;  1EIF A;  1NYG A;  3HRT A;  2DIL A;  2KK4 A;  1VQ5 A;  4M75 E;  1G8X A;  1VQL T;  3O5Z A;  3I56 Q;  2DX1 A;  5D6W A;  1E6G A;  4M7D B;  1G2B A;  2X51 A;  4D8D A;  1WXT A;  2EYZ A;  1RAF B;  1TU0 B;  4RTU A;  2QTX A;  4D8K A;  2RQW A;  2KSS A;  1JB0 E;  2ATC B;  3HHT B;  1QVG P;  4Y91 A;  1QKX A;  3JCM W;  3OW2 P;  3CCS A;  1D1C A;  5CIU A;  4L5G A;  4AFQ C;  1HD3 A;  2FEI A;  7AT1 B;  2GGR A;  3NFC A;  3HSB A;  1BKB A;  1PD1 A;  1BI1 A;  4JS4 A;  3JB9 J;  4XTW A;  1NPP A;  3LYI A;  1PNJ A;  3RKW A;  3CCM A;  3ASK A;  3TEE A;  3LH5 A;  2JMA A;  1LNX A;  2OX7 A;  3VYG A;  1IB8 A;  5DLQ E;  4M77 F;  2CH4 A;  2QXF A;  1X2Q A;  5M9O A;  1U1T A;  2EKH A;  1ACM B;  3C94 A;  4DOW A;  2XDB A;  5ECA A;  4HT9 A;  1OZ2 A;  1OYX A;  2YRC A;  2DJZ A;  2J6F A;  1R77 A;  2PVD B;  5LJ5 j;  1MHN A;  5GAN 2;  1YHQ A;  1D3B A;  4M75 A;  3OS5 A;  2HZY A;  3RES A;  2K79 A;  5AT1 B;  2HSP A;  3CPW A;  3L1A A;  4ANJ A;  4L59 A;  3UA7 A;  1NEG A;  4E7L A;  1VQM Q;  2YUQ A;  2HAX A;  2MAM A;  1PD0 A;  2DBM A;  1YJW Q;  4E7S A;  3JB9 G;  3PTA A;  2EFI A;  5IH2 A;  1CKA A;  2O88 A;  4N0A A;  3BE3 A;  3THK A;  4KGZ B;  2DXC A;  3CCQ T;  1NLP C;  3EG9 A;  3JB9 D;  2HQX A;  1QVP A;  3OA6 A;  5CR2 A;  2KMT A;  2ECZ A;  1Y96 B;  3AT1 B;  1UGR B;  1JJ2 P;  2HBP A;  1S1N A;  3OYH A;  1M3A A;  1UTI A;  1H92 A;  1QLY A;  4C5I A;  2XID A;  2LTO A;  5GAM j;  4QVZ A;  5GAN e;  2XI9 A;  1WIE A;  3HKS A;  1LCK A;  4A54 A;  4IUR A;  3M0R A;  4IUU A;  2E70 A;  3M57 A;  1FXX A;  1N5Z A;  1NLO C;  3MKD A;  1NG2 A;  3MPU B;  3CCL T;  1ZSZ B;  1RAB B;  1RI0 A;  5LJ5 f;  1YJN T;  2DVJ A;  1KHC A;  4KUL A;  1KK7 A;  3VRZ A;  1WHJ A;  3LX7 A;  4GLK A;  2F5T X;  4BI8 B;  3CCU T;  1QCN A;  3A98 A;  1VQL Q;  3O8V A;  5J3B A;  3EGU A;  4A4G A;  2OI3 A;  2FG0 A;  3L42 A;  4NOY A;  2RQR A;  3NMZ C;  3PIO A;  4M7A B;  5LJ3 e;  3V7S A;  3CC7 Q;  3VUZ A;  4Z89 A;  2GFA A;  4ME7 A;  2KYM A;  1YI2 Q;  2JTM A;  2OAU A;  4LXC A;  2DET A;  3JCM Q;  4M7D G;  4J9F A;  2XIC A;  3MET A;  1JQQ A;  3S3M A;  2EQJ A;  1ZA2 B;  4KH0 B;  1VYV A;  3VS0 A;  4XTZ A;  1OPL A;  1JXO A;  4PKC C;  1VQ6 Q;  1M8V A;  3I55 Q;  4M7D C;  5GAM f;  4P5N A;  3CPW P;  5IHK A;  2D1X A;  3RIR A;  4EPC A;  2B8A A;  2JMC A;  4ZN3 A;  3QHS A;  1TH7 A;  3JSC A;  1UJY A;  1SHG A;  1AWO A;  3M4Y A;  5GMK e;  3MEA A;  4QQ6 A;  3R6N A;  1RAH B;  5GAN 6;  3GOX A;  2KRO A;  1J3T A;  1D3B B;  4M75 B;  3CCQ A;  5LJ5 g;  4RTY A;  1MNE A;  1M1K R;  2GBQ A;  2KNB B;  3RR6 A;  1GBR A;  2RNA A;  2A3L A;  3MEW A;  3NPF A;  1OQK A;  1RLQ C;  5IHN A;  3RKX A;  4HVU A;  1E6H A;  3LLR A;  2ZPB B;  1PKS A;  2DK3 A;  2MPX C;  3EG2 A;  1G3S A;  3EG9 B;  3GF5 A;  1Q82 C;  2K5I A;  3I35 A;  1K4U S;  4LD9 K;  4J9C A;  2RA2 A;  2RJF A;  4C8Q F;  1Q81 R;  1VQN Q;  1KD1 R;  1K9M C;  1JO8 A;  3L2U A;  1XQH A;  1GXI E;  2BUD A;  2NUT B;  2E6N A;  4JLI A;  1A0N B;  3CCL A;  3NTH A;  4HA8 A;  2D0N A;  1LOJ A;  1O75 A;  4A4F A;  1VOM A;  2AKL A;  3A5Z B;  1WHM A;  2MF2 A;  1RL2 A;  1VQO T;  1YIT Q;  2RJD A;  3CCU A;  3CMA T;  5GAM g;  2I0N A;  2RJC A;  4R55 A;  4LDV A;  5KYY A;  3ME9 A;  2K2M A;  1PM3 A;  2RPN A;  4X34 A;  4F7U F;  4BI4 A;  3QDR B;  1QP3 A;  1TUG B;  2BIV A;  4EMH A;  1AZE A;  1YIJ Q;  1FMV A;  1YJN Q;  1I8F A;  2J06 A;  1XNI A;  4PFP A;  2RQT A;  2COY A;  2KBT A;  1PRL C;  1K8A U;  2RI3 A;  2LRQ A;  1VQ4 T;  2EBP A;  4A4H A;  3FRN A;  1DJ7 B;  2VVK A;  5GAN j;  1RI9 A;  4M78 E;  2HDA A;  1BYM A;  3EG1 A;  1S72 A;  1M5Q 1;  3OS0 A;  4J5Y A;  1MND A;  3ZFJ A;  4PJO F;  2DAQ A;  1GBQ A;  1VYU A;  1MV3 A;  4MMK A;  4HT8 A;  3WVD B;  1NM7 A;  3V8K A;  1R8O B;  1ZSZ C;  3BDU A;  4RTZ A;  3EH2 A;  4TVR A;  1HSQ A;  4M7A G;  5LJ5 h;  2K3X A;  3ULR B;  1N8R C;  3RUX A;  2JTE A;  1MMN A;  3G71 T;  3G1J A;  2VWF A;  4M7A D;  2BTT A;  3EFS A;  4NS5 A;  3M0Q A;  1PC0 A;  3PE0 A;  2QAS A;  4CI0 C;  2LJ1 A;  2DIQ A;  1ZBX A;  1EZZ B;  1FMK A;  5GJW B;  3PMT A;  1ZUY A;  4PK4 A;  2NWM A;  5LJ3 j;  4QT7 A;  4PL6 A;  2NUP B;  3MHX A;  1T0J A;  2FPF A;  2Y90 A;  2AK5 A;  3MP1 A;  1OU9 A;  3SEM A;  1UGP B;  2XU8 A;  4Z02 A;  4DBR A;  2PU9 B;  3RMS A;  2QGF B;  1YJ9 Q;  2BE9 B;  1WYX A;  3OW2 S;  1H8K A;  3ER0 A;  8AT1 B;  2V1R A;  2DM1 A;  2O31 A;  1VIE A;  3M0U A;  1ZUK A;  2DLP A;  4B9X A;  1M90 U;  2XD0 A;  4DEX A;  2X4J A;  2L89 A;  1SRM A;  2RN8 A;  4ELY C;  4M78 A;  5GAN f;  1WFW A;  4UC4 A;  1SSF A;  5GAM h;  3SHW A;  1Q82 U;  3CC4 A;  3M9Q A;  4M75 G;  3OYJ A;  2EYX A;  1MMA A;  1WNL A;  1WLP B;  3FJP A;  2YWW A;  1W70 A;  3J80 E;  1D09 B;  5GMK j;  1K73 C;  1K9M U;  1PWT A;  4DEY A;  3CME Q;  1WQW A;  1TUC A;  4BE2 A;  1VQO A;  5LJ5 d;  1M4Z A;  1BK2 A;  3CMA A;  2AKK A;  4M75 C;  1D0X A;  3CD6 Q;  5I22 A;  3C95 A;  2RI2 A;  5KYW A;  3V7C A;  1WHL A;  1X6B A;  4YTL A;  4CC2 A;  1MUZ A;  2HQH A;  5L8R E;  1ARK A;  3T9N A;  2P84 A;  2EPD A;  5I2M A;  4KUI A;  5LJ3 f;  4B6M A;  3HTR A;  2EQI A;  2L2P A;  2DL4 A;  4N0A C;  2DE0 X;  1KQ2 A;  2DL8 A;  2ZZD A;  2QYZ A;  1YWO A;  1M3C A;  4IUQ A;  5KYY B;  2D8H A;  4R56 A;  3CC2 Q;  2LT1 A;  3VS7 A;  4HCK A;  3MJX A;  2CUD A;  1KQS P;  3AHU A;  1ZSG A;  1JJ2 S;  3RKY A;  2LNH B;  1R0C B;  3CCJ T;  3H0H A;  1X01 A;  4J6X A;  3NHN A;  1VQ4 Q;  2JJ9 A;  3L2Z A;  2CSQ A;  1X43 A;  2YUO A;  5GAM d;  2YUP A;  2A7Y A;  1SKU B;  3JB9 F;  3VU3 C;  2P0Q A;  4J8O A;  3G71 A;  5GAN g;  3RDV A;  4BY6 C;  3HRU A;  1ZBJ A;  1SSH A;  2CRE A;  4ZN1 A;  2GTJ A;  3EGD A;  2CH4 W;  1PG5 B;  1WI7 A;  2QGG A;  2DF6 A;  4F14 A;  1I81 A;  1YHQ T;  1BIA A;  3M54 A;  4MDX A;  3C12 A;  1Y0M A;  2K3Y A;  3FLG A;  4FSS A;  4C0D B;  3ZEH A;  1U3O A;  2K5F A;  2VKN A;  3G4S A;  3UA6 A;  2PQW A;  5DY9 A;  4AG2 C;  2KQW A;  5HKC A;  3OYY A;  2QTV A;  3CBM A;  1X6G A;  4JRP A;  2E3I A;  1WJR A;  3HFN A;  2B86 A;  2EJG A;  3CCE T;  1Q7Y C;  1LVK A;  5FU6 C;  3RNJ A;  5LJ3 g;  4J9D A;  1P92 A;  1WA7 A;  4A53 A;  4E7H A;  2EWN A;  2EKO A;  3CXC A;  2RB6 A;  2IVW A;  1TSF A;  3QO3 A;  1X75 C;  4DA4 A;  2VXF A;  1GCQ A;  2MK5 A;  4RTV A;  5GAN 7;  1KFZ A;  3JCM X;  2D9T A;  1G3W A;  5GMK m;  1K73 U;  4AMC A;  2E12 A;  2R5A A;  5CK9 A;  3CPW S;  3UDC A;  5DM7 R;  1QP2 A;  2DD5 A;  3OYC A;  2HL5 C;  4M7D F;  2CP0 A;  2CP2 A;  2DMO A;  2PVG B;  2K57 A;  5IAY A;  1D0Y A;  2GQV A;  3QJ6 A;  4FCY A;  2YT6 A;  5KYW B;  5A0D A;  1VQ5 Q;  3TCJ A;  2DBK A;  5CCA A;  3PNW C;  2QDY B;  5GAN h;  2IG0 A;  4LNP A;  2H3J A;  4N4I A;  2EGC A;  2LCS A;  4CC3 A;  2VYT A;  3CCJ A;  4J6Y A;  2D6F A;  5CVI A;  2X3X D;  2DXB A;  1YNZ A;  2DEQ A;  2LX7 A;  2RHI A;  1SF9 A;  2F2V A;  2L3Q A;  3OSS C;  2RK1 A;  5KYN A;  5GAN 3;  2L3R A;  2RHU A;  4A4E A;  3CCS Q;  5GJV B;  2ED1 A;  3M0P A;  4J9B A;  3M59 A;  3URG A;  2QEX T;  1Y7X A;  2M51 A;  1D0Z A;  3L2W A;  4FL6 A;  4HXJ A;  5FWB A;  5LL6 S;  4RG8 A;  2Z0W A;  1N8R R;  3QSU A;  3CCM Q;  2AZV A;  5LJ3 h;  2DRM A;  4B9W A;  4AT1 B;  5CQX A;  1KC8 C;  3UT1 A;  5FWC A;  3CBP A;  4DOV A;  4HCB A;  1UHC A;  1BCM A;  2K9G A;  3EGD B;  4PLI A;  1AZG B;  3CCE A;  4J7I A;  3DKM A;  5FW9 A;  1YHQ Q;  2QQA A;  2FO0 A;  1V76 A;  2Y4X A;  1Q7Y U;  2MWO A;  3EHR A;  3VS6 A;  1K9A A;  3CQT A;  1FMW A;  2FPE A;  5GAN d;  3FDR A;  1EFN A;  3HP9 A;  1Z9Z A;  3DB4 A;  4JZ3 A;  4PJJ A;  1G5V A;  5CKH A;  5EC7 A;  2O01 E;  2DNU A;  2YSQ A;  4IKF A;  3OBW A;  2D0Q B;  1N6A A;  5GMK h;  2DTO A;  3TSW A;  2M16 A;  2RK2 A;  3SFM A;  1PCX A;  2RQV A;  4FU6 A;  4RCB A;  1QVF S;  1K73 R;  2AIR B;  1BB9 A;  4C0D C;  2X3W D;  5D6Y A;  1I0C A;  4KGV B;  2HEQ A;  3OYE A;  3OYB A;  2JM9 A;  2O4X A;  1C6V X;  3CPF A;  5IXF A;  5LJ3 d;  4FSX A;  1PKT A;  2JUF A;  1GFD A;  3PIP A;  2M02 A;  2OTJ T;  2JS0 A;  1NJI C;  5J26 A;  2JT4 A;  1Q86 C;  4M7A F;  1K8A C;  1EX4 A;  3QWX X;  2H3E B;  1VQ9 A;  1IZ6 A;  4C0Z A;  3UWN A;  1K1Z A;  1QKW A;  4M78 C;  3BY7 A;  3X20 B;  3QDF A;  2XK0 A;  5FRM A;  2RHY A;  2E6Z A;  4GLM A;  3TRE A;  5IHI A;  4E2F B;  1VQK T;  2QQR A;  1WQ7 A;  4M7D D;  1VIF A;  1S72 T;  2MIO A;  3BDL A;  3H8Z A;  2X4X A;  2QEX A;  4CRI A;  2KEA A;  3Q1J A;  3LWH A;  2E64 A;  4FM4 B;  5KYU A;  1I5O B;  1UGV A;  4BDZ A;  3VJP A;  2MWP A;  4J9G A;  5EG2 A;  3FEO A;  1VQP T;  2NLU A;  1UGQ B;  3EG3 A;  4OMP A;  4LDW A;  4J83 A;  1TS9 A;  2AHJ B;  3P8D A;  4XU3 A;  3N5B B;  2HD0 A;  2P4R A;  4KH1 B;  3QYG B;  1KC8 U;  4FW2 A;  2HSE B;  3JCM e;  4N4G A;  2CP5 A;  2J6O A;  2DIG A;  4M75 F;  4K11 A;  3S6W A;  1WHH A;  4OB1 B;  1WXB A;  3M53 A;  1WZO A;  3JV3 A;  4AFS C;  4OVA A;  4QVD A;  1Q7Y R;  2LP5 A;  1JEG A;  2PNI A;  4C92 E;  2LZ6 B;  3OY9 A;  2F2X A;  1M90 C;  4ESR A;  1V29 B;  1KG1 A;  1Y71 A;  1WXU A;  5A0G A;  1IRE B;  3UPU A;  2BKD N;  1LJO A;  1KQS S;  1GFC A;  1W2B S;  4ORZ A;  4QVC A;  2DL5 A;  3CCQ Q;  3JCM c;  2XHC A;  1KHI A;  2VV5 A;  4JJB A;  3FC3 A;  1KJW A;  3CC4 T;  2EGA A;  3U23 A;  2H8H A;  5DLO A;  2OTL T;  1SG5 A;  3FJ5 A;  2RM4 A;  3I5R A;  3I9Q A;  2CDT A;  2EQK A;  5GAN 4;  1Z9Q A;  3PMI A;  3SWN A;  2X9H A;  4BDY A;  1OX9 A;  4RCC A;  3E9F A;  3EGX A;  4OP0 A;  3QJY A;  4BY6 B;  1FWZ A;  2YDL A;  2JS2 A;  2E1H A;  3P8B B;  2IPO B;  2OTJ A;  2DO3 A;  1WJS A;  3CCL Q;  1JBM A;  3G7Z A;  2CP3 A;  1NJI U;  2EVR A;  2O4X B;  4JJD A;  4FYW B;  1Q86 U;  2M0Y A;  1VQ7 A;  3LWI A;  3TQ7 P;  3CCU Q;  3HL8 A;  4Q5W A;  1VQK A;  4LN2 A;  4C92 A;  1IGQ A;  1OU8 A;  1RUW A;  2ESW A;  5GAO m;  2OJ2 A;  4KBM B;  4C0G A;  1GCQ C;  4CC4 B;  2JZ2 A;  2BZ8 A;  2L3S A;  3QKJ A;  5FU6 B;  3OYN A;  2DVE A;  4OMN A;  2HKQ B;  1VQP A;  2P0K A;  2X35 A;  3QZ5 B;  4XTY A;  4BB7 A;  1S72 Q;  2QA4 T;  5HY6 A;  2DZ9 A;  2EQU A;  2J7I A;  3L2R A;  3SB2 A;  2V8I A;  2LVM A;  1JRI A;  3H41 A;  5IN1 A;  2DYI A;  4LUE A;  5KYU B;  1G3T A;  2YUN A;  2RJE A;  3OS1 A;  3GNG A;  3E1S A;  2DXT A;  2W0Z A;  2QAZ A;  4PNO A;  1VQ8 T;  1FX7 A;  2KRS A;  2EW3 A;  3MP8 A;  3OYA A;  1TXQ A;  2JM8 A;  5I21 A;  2YLB A;  2E4H A;  1RAC B;  1M30 A;  3G4S T;  2ABL A;  1QVG S;  4JRI A;  3ZL7 C;  4ZTJ A;  2F2W A;  4JDS A;  4NL3 A;  5GMK i;  4MZM A;  1WJQ A;  3CCV T;  1CKB A;  4OMO A;  5I2S A;  1C1A A;  2XMF A;  3CCR T;  2EYY A;  3OYL A;  1T0H A;  2OTL A;  3E19 A;  3KUF A;  3OMC A;  4EDU A;  4J9H A;  4XU2 A;  3OYM A;  4J9E A;  4N4H A;  4M77 E;  3MO8 A;  1UEB A;  4M75 D;  3H6Z A;  4IUP A;  1KSW A;  1QCF A;  1WHG A;  3G6E A;  1OOT A;  1NPR A;  2DEU A;  3HRS A;  3R6O A;  2RI5 A;  2EYW A;  3A8M B;  1NBE B;  2SEM A;  4WTO B;  2LC4 A;  3CC4 Q;  3KFV A;  1QQJ A;  4OB0 B;  3EFO A;  1Q95 G;  1N27 A;  3I56 T;  1BCO A;  2FZC B;  5KCO A;  4OMF B;  2K2V A;  2LCL A;  4DQ2 A;  1AD5 A;  3VRY A;  2PTK A;  2ZPI B;  2DRK A;  1PSE A;  2A37 A;  2GF7 A;  1VQO Q;  3CMA Q;  2CZ7 B;  3X24 B;  1K8A R;  2KDS A;  4GY5 A;  5AYF A;  1X69 A;  2VGM A;  2OAW A;  2EJF A;  2VB6 A;  4BUG A;  4RTW A;  5C6S A;  2FVU A;  1G83 A;  1HXD A;  3PGG A;  1QMC A;  3JCM V;  3BW1 A;  4F04 B;  1IHV A;  3V7R A;  2FZG B;  3I5S A;  1MMG A;  3GLX A;  3PVQ A;  5CKD A;  4C92 B;  4XTU A;  2QA4 A;  1ZLM A;  5KE2 A;  2PUK B;  4M77 A;  3VS2 A;  4C5E A;  1YBY A;  2KXC A;  3M56 A;  3JCM f;  1D1B A;  3OW2 A;  1I4K 1;  4LDU A;  4LD6 A;  3MCA B;  1VQ8 A;  2QI2 A;  4RUG A;  2E41 A;  3M0S A;  3G71 Q;  2QK0 A;  2ZAE A;  3OMG A;  1M2V A;  3OYF A;  1VQM T;  2C0T A;  1MGQ A;  3E9G A;  1F1B B;  4M7A E;  1VQ8 Q;  3SDZ A;  4QQD A;  2DFU A;  4E7Z A;  4VUB A;  3CCV A;  4MZP A;  1M90 R;  5C0M A;  3CCR A;  5GAN 5;  3VS5 A;  3G4S Q;  2J05 A;  2V8K A;  2VUB A;  1AVZ C;  5GAO n;  1M1K C;  2F1L A;  2LDM A;  1SRL A;  4KT0 E;  1Q82 R;  5FU7 B;  1NYF A;  3GNF B;  1HYO A;  2KT1 A;  3IQL A;  4FYX B;  1YFN A;  1B34 A;  1UUE A;  2R5M A;  3C4S A;  2LJ3 A;  1YCS B;  2GNC A;  4M78 B;  2W10 A;  4XTX A;  1K9M R;  3M5A A;  2KYB A;  2XG8 D;  4M4Z A;  3P8H A;  2C06 A;  1QWF A;  4Z88 A;  2KAF A;  1UE9 A;  3DLL A;  2L3P A;  3I56 A;  2M0O A;  1UG1 A;  5GAN 8;  3OBY A;  3RBB B;  1Q81 C;  1HK9 A;  1KD1 C;  1BI2 A;  1XJW B;  2C0I A;  3M0T A;  1OPK A;  1GRI A;  1T3S A;  3JCM g;  2LQK A;  2V8J A;  1UHF A;  2RF0 A;  3EFO B;  2COZ A;  5GMK l;  3VUB A;  4JS5 A;  2LQN A;  3OQ5 A;  4LDY A;  4ZGD B;  3VV0 A;  4ZGJ B;  4PJN A;  4BAC A;  1UFF A;  2FL7 A;  4RTT A;  4NL2 A;  2R58 A;  3A8L B;  1PSF A;  4KUD K;  2GFU A;  4M7A A;  2KXD A;  3CC7 T;  1YI2 T;  1VQ9 T;  1LPL A;  2K3B A;  4BE1 A;  3OYI A;  5A2Q E;  3EH1 A;  4XTV A;  1TWB A;  2GTO A;  1YN8 A;  2BZY A;  3VS1 A;  2VXE A;  3H9N A;  4XU1 A;  4C8Q E;  1VQ6 T;  1ABQ A;  3CCJ Q;  3I55 T;  2DZC A;  1M3B A;  1X27 A;  5KH6 A;  2O2O A;  3LW5 E;  3SWN C;  4C5G A;  1B3Q A;  3J7A F;  3WVE B;  1GL5 A;  5HK3 A;  3NGP A;  4FW1 A;  4E7I A;  3HFO A;  1PRM C;  2JTF A;  4M77 B;  1VQM A;  4JUV A;  3A8O B;  3JB9 H;  1ZUU A;  2JNG A;  1YJW A;  2WSE E;  2K7A A;  4OGC A;  4C92 G;  3MEV A;  2XDD A;  4F7U E;  5FRO A;  2YXY A;  3KBG A;  3CXC P;  2AT1 B;  2KVQ G;  2L8D A;  4C92 D;  1KIK A;  3MP6 A;  2A36 A;  5A0L A;  1AEY A;  2DTH A;  2JOY A;  4V2S A;  2EJ9 A;  4BD3 A;  1M2V B;  4C92 C;  1YP5 A;  1QCO A;  3EAE A;  2CSI A;  2QQB A;  1SHF A;  2YRV A;  1AWX A;  1X2K A;  3CCE Q;  2HBW A;  1YCY A;  1M1K U;  3QG1 A;  4PJO E;  3PFS A;  2CS7 A;  4QW2 A;  3LGL A;  3JCM h;  4J6W A;  3RER A;  2K6D A;  1N9R A;  2YHT A;  1SEM A;  2FB7 A;  2G3R A;  1RAG B;  4E7K A;  3VS3 A;  1VQN T;  4C8Q A;  3X28 B;  2DPP B;  2YLC A;  2NUT A;  2M9U A;  3C0C A;  3HPW A;  2PVO B;  1Y57 A;  2ENM A;  2HNI A;  4DBQ A;  1B34 B;  4HKE A;  1AHJ B;  3REB B;  4EMK C;  4JJC A;  1Q81 U;  3KXT A;  1KD1 U;  4LDX A;  1YIT T;  5CKE A;  4EIK A;  3BFM A;  1VQL A;  2KR3 A;  2DKG A;  4PLL A;  1UEC A;  4M78 G;  1T3L A;  1U5S A;  4QKU A;  1BBZ A;  4OMQ A;  1M8M A;  4OML A;  4F7U A;  1YIJ T;  2COW A;  4BE0 A;  4OB3 B;  4M78 D;  2E65 A;  3CC7 A;  5FU7 C;  2X4Y A;  4E6R A;  2QQ9 A;  3L2V A;  2XKO C;  4FT2 A;  1YI2 A;  1VQ7 T;  2CT4 A;  4WF2 A;  1UDL A;  4Z8A A;  2AZS A;  2QG9 B;  4JLG A;  1WPY A;  4IUV A;  1C0M A;  2HCK A;  2KGT A;  2ZGW A;  2KT8 A;  4XAX B;  5IXB A;  3LH0 A;  4X9C A;  1VYT A;  2QQS A;  5KYX A;  3UAT A;  3D7S B;  4Y28 E;  3NTI A;  4RG2 A;  3JCM b;  3CBO A;  1W1F A;  4PJO A;  4O6J A;  1VQ6 A;  3I55 A;  1VQ9 Q;  2LJ0 A;  3JCM d;  2GQI A;  4OB2 B;  4II1 A;  3X25 B;  4ELZ C;  4PFO A;  3OYG A;  3V8L A;  4J9I A;  5CO7 A;  4E7J A;  3V8J A;  2ZPF B;  3QPH A;  2QEX Q;  2ZPG B;  2FHD A;  2Y4Y A;  2V26 A;  3S3N A;  2ROT A;  4RKU E;  2R57 A;  3A8G B;  4PFZ A;  4JJN K;  2BZX A;  2NUP A;  3OSV A;  2K4Y A;  1TG0 A;  3CEY A; 
#chains in the Genus database with same CATH homology
 1U3O A;  2HSP A;  4AFZ C;  2VKN A;  3UA7 A;  2NUZ A;  1NEG A;  1XOV A;  1M30 A;  2YUQ A;  3UA6 A;  4AG2 C;  2ABL A;  2DBM A;  4OMM A;  3ZL7 C;  1X6G A;  2B86 A;  2F2W A;  2V1Q A;  5IH2 A;  1CKA A;  2O88 A;  1OV3 A;  3THK A;  2C0O A;  3RNJ A;  1NLP C;  4J9D A;  2QDL A;  2ED0 A;  1CKB A;  4OMO A;  1WA7 A;  2XMF A;  2ECZ A;  4AFU C;  2EYY A;  1T0H A;  2L0A A;  1S1N A;  1M3A A;  1UTI A;  4J9H A;  1HJD A;  1H92 A;  2DA9 A;  1WX6 A;  4J9E A;  1GCQ A;  4RTV A;  1KFZ A;  4WCI A;  1QLY A;  1FYN A;  1KSW A;  1QCF A;  2CUB A;  1OOT A;  1H3H A;  2EYW A;  1WIE A;  4IIM A;  1LCK A;  2SEM A;  3M0R A;  3KFV A;  3PVL A;  3VS4 A;  1JXM A;  2DL7 A;  1N5Z A;  1ZX6 A;  1NLO C;  1NG2 A;  2DMO A;  2RQU A;  1AD5 A;  3VRY A;  2PTK A;  2DVJ A;  4A63 B;  2KE9 A;  3EHQ A;  2JW4 A;  2DRK A;  3VRZ A;  2A37 A;  3REA B;  3H0F A;  4JPB W;  2JXB A;  2YT6 A;  3A98 A;  2DBK A;  2A08 A;  3EGU A;  2OI3 A;  2FG0 A;  1ABO A;  4KRT A;  2RQR A;  3NMZ C;  4HVW A;  4LNP A;  1B07 A;  2DYB A;  1X69 A;  2EGC A;  2LCS A;  2OAW A;  4CC3 A;  1AOJ A;  1BU1 A;  4RTW A;  4Z89 A;  1CSK A;  2CT3 A;  2KYM A;  1G83 A;  2X3X D;  3UF4 A;  1YNZ A;  2LX7 A;  4J9F A;  2F2V A;  2L3Q A;  3H0I A;  3I5S A;  1GCP A;  1JQQ A;  1NEB A;  3PVQ A;  2FRY A;  1VYV A;  1ZLM A;  5GJV B;  4JZ4 A;  3VS0 A;  1IO6 A;  2DL3 A;  3VS2 A;  2ED1 A;  3M0P A;  4J9B A;  1OPL A;  1JXO A;  2KXC A;  2FRW A;  2M51 A;  4HXJ A;  5FWB A;  2PZ1 A;  5IHK A;  2D1X A;  2JMC A;  2LQW A;  2LMJ A;  2AZV A;  1UJY A;  2DRM A;  1SHG A;  4RUG A;  1AWO A;  3M0S A;  5FWC A;  1UHC A;  2K9G A;  2C0T A;  3R6N A;  1AWW A;  1AZG B;  4R0K A;  4F16 A;  5FW9 A;  2KRO A;  1J3T A;  2FO0 A;  2IIM A;  3EHR A;  4RTY A;  3VS6 A;  2J6K A;  1K9A A;  3CQT A;  1I07 A;  2GBQ A;  2FPE A;  2A28 A;  2KNB B;  3VS5 A;  1GBR A;  1EFN A;  2RNA A;  1Z9Z A;  4JZ3 A;  4RTX A;  2J05 A;  1AVZ C;  3NPF A;  5EC7 A;  2DNU A;  2YSQ A;  1RLQ C;  1SRL A;  5IHN A;  4HVU A;  1NYF A;  1E6H A;  2KT1 A;  3IQL A;  1UUE A;  3TSW A;  1PKS A;  2LJ3 A;  1YCS B;  1VA7 A;  2GNC A;  1W6X A;  3EG2 A;  2W10 A;  4AG1 C;  4ZNX A;  3I35 A;  3GBQ A;  2KYB A;  2RQV A;  4M4Z A;  1K4U S;  4J9C A;  1QWF A;  4Z88 A;  1UE9 A;  2L3P A;  1BB9 A;  4LE9 A;  1JO8 A;  1UG1 A;  2MCN A;  2X3W D;  4X1V A;  1I0C A;  4F17 A;  1A0N B;  2HEQ A;  2JM8 A;  3RBB B;  2D0N A;  2JM9 A;  3TVT A;  1PHT A;  2AKL A;  2C0I A;  1SPK A;  3M0T A;  1OPK A;  1GRI A;  5IXF A;  1V1C A;  1YWP A;  1T3S A;  3TSZ A;  2MOX A;  1PKT A;  2I0N A;  1UHF A;  2RF0 A;  1GFD A;  2K2M A;  2LQN A;  4LUD A;  2RPN A;  4CC7 A;  2JS0 A;  1AZE A;  1UFF A;  4RTT A;  2JT4 A;  2J06 A;  2RQT A;  2KXD A;  1AWJ A;  3QWX X;  2KBT A;  1PRL C;  1K1Z A;  2EBP A;  1QKW A;  2K3B A;  2O9V A;  2RMO A;  2VVK A;  1UJ0 A;  1RI9 A;  4GLM A;  2GTO A;  2HDA A;  5IHI A;  1M27 C;  3EG1 A;  4GBQ A;  1YN8 A;  2BZY A;  2ROL A;  3VS1 A;  2MIO A;  1GBQ A;  1VYU A;  1MV3 A;  2DJQ A;  1K76 A;  2KEA A;  1NM7 A;  1TUD A;  1ABQ A;  5HCK A;  1UGV A;  4RTZ A;  4HVV A;  1M3B A;  1X27 A;  4J9G A;  2O2O A;  1HSQ A;  1E7O A;  1B3Q A;  3EG3 A;  1OEB A;  4OMP A;  1GL5 A;  3ULR B;  1K0S A;  3NGP A;  1JU5 C;  1RLP C;  1PRM C;  2JTE A;  3EG0 A;  2KRM A;  2P4R A;  1QWE A;  2VWF A;  2BTT A;  2D8J A;  2SRC A;  1MV0 B;  3M0Q A;  1ZUU A;  3PE0 A;  2LJ1 A;  2K7A A;  2J6O A;  1FMK A;  5GJW B;  1ZUY A;  2NWM A;  4QT7 A;  4K11 A;  1WXB A;  1KIK A;  1I1J A;  1T0J A;  2FPF A;  3JV3 A;  2AK5 A;  4AFS C;  3SEM A;  2A36 A;  2G6F X;  1AEY A;  3QWY A;  2FPD A;  1YP5 A;  2LP5 A;  1JEG A;  2PNI A;  2CSI A;  1SHF A;  1WYX A;  2LZ6 B;  1AWX A;  1H8K A;  2F2X A;  4ESR A;  2DM1 A;  2O31 A;  2V1R A;  1X2K A;  1WXU A;  2HBW A;  1WDX A;  3M0U A;  5L23 A;  1ZUK A;  2DLP A;  1GFC A;  4ORZ A;  4DEX A;  1U06 A;  5I11 A;  1SRM A;  2DL5 A;  2RN8 A;  1WFW A;  3SHW A;  2K6D A;  1SEM A;  4JJB A;  1KJW A;  2O9S A;  2EGA A;  3VS3 A;  2EYX A;  4IIO A;  3U23 A;  1WLP B;  2H8H A;  1W70 A;  3C0C A;  3FJ5 A;  1K0X A;  2EGE A;  1PWT A;  4DEY A;  2E5K A;  3I5R A;  1Y57 A;  2ENM A;  3I9Q A;  2CDT A;  4Y92 A;  3REB B;  4JJC A;  1TUC A;  1Z9Q A;  1BK2 A;  2AKK A;  4EIK A;  2KRN A;  5I22 A;  1NYG A;  2KR3 A;  2DIL A;  3O5Z A;  1X6B A;  1UEC A;  4CC2 A;  1T3L A;  1U5S A;  2YDL A;  1BBZ A;  1MUZ A;  2DX1 A;  2JS2 A;  4OMQ A;  1ARK A;  1M8M A;  4OML A;  1E6G A;  1G2B A;  2EPD A;  4D8D A;  1WXT A;  2EYZ A;  2EVR A;  4JJD A;  4RTU A;  2EQI A;  2L2P A;  2DL4 A;  2M0Y A;  4E6R A;  4D8K A;  2DE0 X;  2CT4 A;  2DL8 A;  1UDL A;  2RQW A;  4Z8A A;  2AZS A;  1YWO A;  1M3C A;  2D8H A;  2HCK A;  2KGT A;  3VS7 A;  1QKX A;  4LN2 A;  2KT8 A;  5IXB A;  4HCK A;  1VYT A;  3UAT A;  1RUW A;  2ESW A;  2CUD A;  4AFQ C;  1HD3 A;  2OJ2 A;  1W1F A;  2FEI A;  1ZSG A;  2GGR A;  2LNH B;  1GCQ C;  4CC4 B;  3H0H A;  2BZ8 A;  2L3S A;  3NHN A;  2LJ0 A;  4OMN A;  2CSQ A;  1PNJ A;  1X43 A;  2GQI A;  2YUO A;  2YUP A;  3LH5 A;  2JMA A;  4J9I A;  2CH4 A;  1X2Q A;  2J7I A;  1ZBJ A;  2EKH A;  1SSH A;  3H41 A;  5ECA A;  2CRE A;  4LUE A;  2GTJ A;  2CH4 W;  2YUN A;  1WI7 A;  2J6F A;  2ROT A;  2DF6 A;  2W0Z A;  4F14 A;  2BZX A;  1Y0M A;  2KRS A;  2EW3 A;  4FSS A;  1TG0 A;  2K79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...