1SPKA

Solution structure of rsgi ruh-010, an sh3 domain from mouse cdna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
72
structure length
72
Chain Sequence
GSSGSSGQKVKTIFPHTAGNNKTLLSFAQGDVLTLLIPEEKDGWLYGEHDTTKARGWFPSSYTKLLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 1300006M19
publication title Solution Structure of RSGI RUH-010, an SH3 Domain from Mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 7
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1spkA00
1WDXA 2YT6A 2A36A 1WX6A 1AWOA 2CH4W 1LCKA 2OI3A 1GL5A 4JJBA 2O88A 2KEAA 1G83A 1X2KA 2GQIA 2O2OA 4HVWA 4ORZA 2C0OA 2W0ZA 2GGRA 2K3BA 2KYMA 3M0QA 4JJDA 3RBBB 3M0TA 4IIOA 1AWJA 1U06A 3NMZC 1M8MA 2E5KA 3UA7A 1NLPC 1SHGA 4J9DA 1RLQC 1BU1A 1H3HA 2KRMA 1VYUA 2DJQA 4OMMA 3C0CA 1E6GA 1KJWA 2L3QA 1PNJA 2CREA 2EGAA 4HVUA 2DL5A 2ED0A 4Z89A 4ZNXA 4CC3A 4GBQA 1WIEA 3QWXX 4WCIA 2KRNA 3REAB 2LJ1A 2ESWA 1OV3A 1Z9ZA 2BZYA 3M0UA 2K79A 2RQTA 2QDLA 4RTUA 5GJVB 4JZ3A 4EIKA 1VYTA 2FEIA 1KSWA 2RQUA 2LJ0A 4DEYA 1M3AA 1X69A 5L23A 1E6HA 2P4RA 1YNZA 1PRLC 4OMQA 2FO0A 1H92A 3EG2A 4RTWA 4E6RA 2RF0A 1G2BA 4J9IA 2DF6A 4J9HA 2K2MA 1NLOC 1UECA 2VKNA 1QKWA 1TG0A 3NGPA 3ZL7C 3PE0A 1M27C 3H0FA 3REBB 1SSHA 2EQIA 2HCKA 3GBQA 1UDLA 3EHRA 2ABLA 2DVJA 2JMCA 3O5ZA 4HCKA 2HEQA 3U23A 3PVLA 1CSKA 2JTEA 3NPFA 3SEMA 1BBZA 2J6OA 1ZLMA 2RPNA 1T0HA 1JEGA 3VS6A 1KFZA 2ECZA 1ZUYA 2AZVA 2LX7A 4A63B 2GNCA 1AZGB 1X2QA 2EPDA 2PZ1A 2AKKA 2KROA 5FWCA 1NYFA 3LH5A 4RUGA 1ZUKA 3UA6A 3JV3A 2HDAA 1WXTA 1WLPB 2PTKA 1RUWA 1FYNA 2LJ3A 1GBQA 4RTTA 1AEYA 3UATA 2DILA 3I5RA 1W70A 1Z9QA 2C0IA 2J6FA 2YUOA 2VVKA 1FMKA 2FRYA 2I0NA 5I11A 1AVZC 5IH2A 2LCSA 1XOVA 1EFNA 1PWTA 2VWFA 3M0PA 2MOXA 2DL7A 1TUDA 2KE9A 4OMPA 2FPDA 1X43A 1AOJA 4F17A 1UHFA 1WXUA 3SHWA 2M0YA 1K9AA 3VRYA 2EKHA 3M0SA 5EC7A 1ZUUA 2C0TA 5FWBA 2RQRA 3H0IA 5IXFA 1S1NA 1J3TA 4GLMA 2X3WD 4AFSC 1A0NB 2YUPA 1GFDA 2JS0A 1ABQA 1VA7A 1GCQA 1ZX6A 4Z88A 4OMLA 2FPFA 2DLPA 2LP5A 1H8KA 2J06A 4R0KA 2EYXA 5HCKA 1X27A 1K0SA 3I9QA 2D0NA 2L3PA 1Y57A 3QWYA 2J7IA 1JO8A 2EW3A 1M3BA 2K6DA 2A28A 2AZSA 1SRLA 5I22A 2H8HA 4J9FA 1N5ZA 1BB9A 1UJYA 4J9GA 2JMAA 2JS2A 2B86A 2PNIA 1UGVA 2RN8A 2EBPA 2KT8A 2RMOA 2MCNA 2CUDA 2DL4A 4RTVA 4HXJA 4Y92A 2KBTA 2BZ8A 2DMOA 4AFZC 5IHKA 1HSQA 4HVVA 2KYBA 2EYWA 2J6KA 2DNUA 1AWWA 2HBWA 2HSPA 4AG1C 2FG0A 5GJWB 2LQNA 1B3QA 2SEMA 1I1JA 3EG0A 2O31A 1GCQC 1UTIA 2SRCA 2G6FX 1I07A 1I0CA 1GRIA 2DRMA 2ED1A 1WXBA 2GTJA 1NM7A 2NUZA 1KIKA 2IIMA 1MV3A 2V1RA 1YWOA 2JW4A 5ECAA 3H41A 2EVRA 1HD3A 1X6GA 1PKSA 3ULRB 1QWEA 5FW9A 1M3CA 2AK5A 1UE9A 1VYVA 1PHTA 3I5SA 1Y0MA 3EG3A 1QWFA 4F14A 2L3SA 1ZSGA 1UJ0A 2W10A 1JQQA 2CSQA 2KR3A 3PVQA 1NEGA 1JXMA 3KFVA 3TSWA 1NYGA 1MV0B 2DBKA 3VS0A 1CKBA 2RNAA 3VS5A 1PRMC 2DRKA 4CC7A 1QCFA 1NG2A 3CQTA 4LUDA 2CT4A 2XMFA 3NHNA 3EGUA 4ESRA 1X6BA 1K0XA 2F2XA 2F2WA 2CDTA 2OJ2A 3UF4A 1QLYA 2BZXA 1V1CA 2FRWA 3I35A 1WFWA 4M4ZA 2ROLA 1JXOA 4X1VA 2DA9A 2EGEA 1YP5A 2DE0X 1MUZA 2JM9A 4CC4B 1RI9A 1T3LA 2LQWA 1U5SA 2DYBA 2J05A 3VS1A 2KXCA 1W1FA 3VS4A 1UG1A 4RTYA 4J9BA 1AWXA 1HJDA 4QT7A 2YSQA 1OPLA 3VRZA 2KT1A 1K4US 2DL3A 4AG2C 1W6XA 3VS3A 1OEBA 1YWPA 3TVTA 1CKAA 4KRTA 4F16A 2DL8A 1SHFA 4RTXA 1E7OA 1AD5A 1YN8A 4FSSA 3TSZA 5IXBA 1SPKA 4Z8AA 2CH4A 1T3SA 2DM1A 2EGCA 4D8KA 4JJCA 3VS2A 2DBMA 4LN2A 1K76A 2MIOA 2V1QA 1ARKA 2LMJA 1OOTA 2D8HA 2F2VA 2D8JA 1TUCA 2RQVA 2ROTA 1GFCA 1BK2A 2YUNA 3M0RA 2D1XA 3EHQA 1WYXA 4AFUC 5IHIA 3H0HA 1WI7A 1GCPA 2RQWA 3THKA 3FJ5A 2AKLA 1SEMA 3RNJA 2LNHB 4CC2A 4JPBW 1AZEA 2LZ6B 2KNBB 5IHNA 4D8DA 2KGTA 1GBRA 1RLPC 2JXBA 2O9VA 2JT4A 1B07A 4LE9A 2CUBA 4OMOA 2BTTA 2O9SA 1YCSB 4IIMA 2A37A 1UFFA 2CSIA 4DEXA 2L2PA 4J9EA 2FPEA 2OAWA 2EYYA 3R6NA 2L0AA 3A98A 2CT3A 2YDLA 2GTOA 2NWMA 2YUQA 2K9GA 1SRMA 2DX1A 1M30A 1UUEA 4J9CA 2EYZA 2JM8A 1ZBJA 1NEBA 3VS7A 4RTZA 2K7AA 2KXDA 4OMNA 1OPKA 4K11A 2A08A 1T0JA 1UHCA 2X3XD 2ENMA 1IO6A 2GBQA 2KRSA 3EG1A 4LNPA 1WA7A 1QKXA 1K1ZA 1U3OA 2M51A 4AFQC 4LUEA 1PKTA 4JZ4A 3IQLA 1ABOA 1JU5C
chains in the Genus database with same CATH superfamily
1WDXA 2E65A 1PD0A 4LDWA 3RESA 5A0DA 2CH4W 1AWOA 2OI3A 5GAN2 4E7IA 2O88A 3CCLQ 4DBQA 1SKUB 1X2KA 2RHUA 2GQIA 2ATCB 2EJ9A 3F70A 3CC2A 4XU2A 1VQ9T 4HVWA 4ANJA 1Q7YU 3INZA 1C6VX 2CYZB 5CKDA 2QQ9A 4BE2A 1WJQA 2WSFE 4NOYA 1M2VB 4M7AG 3A1PA 2DZ9A 4PL6A 1M8MA 3CCSQ 3HFOA 1SHGA 1VQPA 1RLQC 1LJOA 3CCQT 1VQNA 4L59A 4E7ZA 1E6GA 1KJWA 1QVFA 2L3QA 3G7ZA 1G5VA 2CREA 2DEUA 1OZ2A 4Z89A 3CMAT 1WIEA 4PLLA 3G4SA 4WCIA 4M77A 5DLOA 3EFOB 4M78C 1TXQA 1JJ2P 2DFUA 3LYIA 3QHSA 5GAOm 4JZ3A 4V2SA 3G6EQ 1VYTA 2BE7D 1TH7A 3ZEHA 2LJ0A 4DEYA 3CBPA 1X69A 4OB1B 1QMCA 2JN0A 4OMQA 5CKFA 2FO0A 1N8RC 1H92A 4JRPA 2F69A 4IKFA 2MYSA 4J9IA 5LJ3e 5GAOl 1VQ9A 4J9HA 2K2MA 3LWHA 4J83A 3PE0A 3RKYA 1M27C 2HCKA 5D7UA 2ABLA 4HCKA 4J6YA 2HEQA 3LGLA 3CC7A 1CSKA 2V8KA 3CCQA 1ZLMA 2RJDA 1TOVA 5M9OA 5LJ3g 4EMGA 2AT1B 4N4GA 2LX7A 2CP7A 1X2QA 3CMAA 2HNIA 4QVCA 5LJ5h 4E7JA 3EGDB 4RUGA 5GAN3 1ZUKA 1Y96A 4C5HA 3UA6A 1SF9A 3OMCA 4JRQA 5I2MA 4J5YA 1WXTA 1WLPB 3CCRQ 2PTKA 4MDWA 1Q82C 4M7DB 2LJ3A 5CQXA 1O75A 2QQAA 3UATA 1YI2Q 4MZMA 4FW1A 2J6FA 4J7IA 1S72Q 4C92A 2FRYA 4M7AC 2MF2A 3GOXA 1PWTA 1N8RR 1JRIA 4LDXA 2DJZA 2VWFA 3M0PA 2DL7A 3EAEA 2KE9A 4OMPA 3HHTB 4KULA 4F17A 1UHFA 2QTVA 3QBYA 1B34A 1M1KR 2RQRA 1J3TA 2QDYB 1D0YA 2YUPA 3CCJT 3CCLT 3OYYA 2JS0A 1ZX6A 3P8DA 4OMLA 4Y91A 1F1BB 5C0MA 3JCMP 1SG5A 3OYFA 2BIVA 4R0KA 4LDYA 2XDDA 3QG1A 4DOWA 1D1BA 3QWYA 2EW3A 2JJ9A 3OBWA 3OYAA 5KH6A 5I22A 1SRLA 5FU6B 4QQ6A 3E9FA 2LT4A 1N8RU 1UJYA 4J9GA 1Q82R 3QJYA 1Q81C 3WVEB 1K73C 4XTYA 2H3EB 2RN8A 2KT8A 2Y4YA 3HRSA 4RKUE 2ZPIB 1VQKQ 4N4IA 1IZ6A 2R57A 4HXJA 5A2QE 1VQOT 2XDPA 3X28B 5IHKA 1RACB 1HSQA 3MEWA 2EYWA 2FZKB 2VC8A 2RI2A 3EGXB 1AWWA 3P8BB 3M4YA 3V8JA 5GJWB 1B3QA 3G6ET 1I1JA 2O31A 3Q1JA 1W4SA 4P5NA 3CPFA 4Y28E 4ATOA 3AHUA 3CCJA 3CCLA 1IRXA 1I0CA 2DRMA 2VXEA 1NM7A 2NUZA 3SWNA 1RADB 1MV3A 1YWOA 2HSEB 3MP6A 3OB9A 5GAOr 1JB0E 3OW2A 1IB8A 1PKSA 1M3CA 2K4YA 1Q82U 2V8IA 4BACA 1RAIB 4OGEA 5GAOp 1VQLT 3EG3A 2X4WA 1QWFA 3QPHA 3OYBA 1QP3A 3GNFB 1ZHIA 1YIJQ 3NTKA 3T9NA 3NTIA 2CZ7B 2M9UA 4QVDA 2WSEE 2ZPBB 3CC4Q 2M02A 1KQSA 2COYA 3HFNA 1VQOA 4QQDA 2PQWA 3E9GA 2DTOA 5KYXA 1NG2A 3EFRA 3H9NA 2CT4A 4PK4A 3CMEQ 2E12A 4KT0E 4C8QF 4ESRA 1D0ZA 3CPWA 2F2XA 4M78A 2OTLT 1AT1B 1QP2A 1YI2T 4CRIA 1RI0A 2BZXA 4A4HA 2K5LA 4Z02A 2ROLA 2RB6A 1QVPA 7AT1B 2EGEA 1W2BS 1MUZA 2EIFA 1Q86R 2LQWA 1QCNA 1U1TA 2HAXA 5J39A 2J05A 1W1FA 4M75G 1G3TA 4J9BA 2KDSA 1YBYA 1HJDA 2KT1A 5GAMf 3EFSA 2DL3A 1VQLA 4UC4A 3VU3C 1Q81U 3TREA 4QVZA 2RK2A 2P0PA 4PFZA 2FB7A 4C8QE 4XU0A 3TSZA 2KSSA 4X9CA 2CH4A 2CP5A 4OB3B 2EGCA 4D8KA 2R5AA 3VS2A 2VXFA 1K76A 1MNDA 2ZGWA 5EG2A 2DIGA 4KH1B 3L2RA 1ZSZB 1KQ1A 2V1QA 3BW1A 2P84A 1OOTA 3LLRA 2F2VA 4IUPA 1TUCA 3M0RA 3DKMA 1PM3A 3C94A 4DQ2A 2JUFA 2OTLA 4XU3A 3JCMb 4AFUC 4BY6C 1YI2A 1VIEA 3MJXA 4DBRA 3QUIA 5GAMh 1N9SA 4EMKB 3PMIA 3HTRA 3RNJA 1W2BP 2VV5A 3L2WA 3AT1B 2L5QA 1SSFA 1VQPQ 1VQKT 1AZEA 1DJ7B 4PJMA 2KNBB 1VQNQ 1OQKA 1BKBA 1IREB 4M7AA 2ZAEA 4OMOA 1X01A 4IIMA 2DETA 3A8HB 3G4SQ 3OYMA 4IUQA 4C8QD 2QQBA 2YUQA 3VYHB 2K9GA 4JLGA 4PKCC 2E5QA 2M1HA 3HP9A 2JM8A 3OQ5A 1LOJA 2A08A 2NUPA 4B9WA 2XU8A 2GBQA 3JCMc 2KRSA 2HQXA 2JTMA 1RAAB 1VQ9Q 4B6MA 3GLXA 1QKXA 4PJOG 2NYSA 2M51A 2Y4XA 4AFQC 4LUEA 4M75C 3SD4A 1LVKA 5CKEA 3FJPA 1WX6A 5CVIA 2F5TX 3CC7Q 1GL5A 1VQKA 2KEAA 2XIDA 3L42A 1R77A 3CCQQ 3CC4T 4J8OA 1RAGB 4M77D 9ATCB 3S3OA 3X26B 4NL2A 5FRMA 4J6XA 1RAEB 3MP8A 4A4KA 3CMAQ 3OYIA 4LDUA 3RBBB 3D7SB 1AWJA 5FRNA 4PFOA 1U06A 4J6WA 2F1LA 2E70A 5LJ5d 4QW2A 1H3HA 2KRMA 4RG8A 4OMMA 4BI8B 1VQ7T 4C92E 1PNJA 3C12A 3CCMT 2H3JA 1R0CB 2BE9B 2DL5A 2ED0A 4C0GA 5GANe 4CC3A 2KI7A 2LX9A 3REAB 4E2FB 2EQUA 3PIPA 3GP8A 3M0UA 2K79A 1QW1A 1WPYA 1NZ9A 5GJVB 4EIKA 3J7AF 3CXCS 2DAQA 4QKUA 2RQUA 5L23A 1E6HA 3MKDA 3E1SA 1PRLC 5GANg 2DXUA 2XG8D 3CC4A 3G1JA 3KXTA 1WJRA 3V7RA 4MZTA 4NL3A 1G3WA 5KYUA 4XTWA 2VKNA 1QKWA 3NGPA 4JRIA 3REBB 3UT1A 5GAN4 5GMKh 3NPFA 1ZQ1A 3SEMA 4C92D 1BBZA 5D6WA 5FU7B 4E7LA 2E1HA 4PJOC 1FMVA 1I81A 1VQ7A 3VS6A 2ECZA 4FW2A 3CCMA 1I4K1 4C8QB 4J7FA 2QA4T 1B7TA 2EPDA 2PZ1A 2AKKA 1NYFA 3LH5A 1Y7XA 2E6NA 2L3RA 3JV3A 1VQ6A 2NUTA 2HDAA 2CZ1B 4A53A 4HA8A 1M90C 3CXCP 2O4XB 1FYNA 1GBQA 3HL8A 3GIBA 2BKDN 2DILA 2ZPFB 1UGQB 5CKHA 3PMTA 1Z9QA 2YUOA 4E7HA 1FMKA 1WHHA 5FU6C 3GNGA 3CCJQ 3QDFA 1NPRA 1R0BG 5IH2A 2LCSA 2QEXQ 2L89A 1M5Q1 2MOXA 1MMGA 2A0FB 2G3RA 2GFUA 4C0DB 3N5BB 3S3MA 1YJNT 1YJ9A 2Z0WA 3CC7T 1MMNA 1GFDA 2K2VA 1ABQA 3QZ5B 3X25B 4FU6A 2FPFA 3HPWA 4BI4A 2MI6A 1HXDA 2QA4A 3PGGA 2YLBA 1HK9A 3QSUA 1X75C 1K0SA 1YJWT 1M4ZA 2GCXA 2L3PA 2EWNA 1JO8A 1XQHA 1VQ4Q 1VQOQ 1M3BA 5D6XA 4M78E 3QZ9B 2H8HA 1N5ZA 2DXCA 3JB9H 1M90R 2JMAA 2B86A 2HKQB 2PNIA 1UGVA 2EBPA 2MCNA 2WSCE 5LJ5f 4PFPA 5LJ5j 5C6SA 2GQVA 3OMGA 1WJSA 1IGQA 1QVFS 4HVVA 2YLCA 3FRNA 2KYBA 2J6KA 4KGXB 4AG1C 1IHVA 1M1KC 1C0MA 2SEMA 1YJNA 2KY9A 1Y96B 3EG0A 1GCQC 1V29B 3C4SA 1VQLQ 2G6FX 2K5FA 4QQGA 2VYTA 4M75A 3JB9G 2OAUA 2XK0A 2EQMA 1VQ8A 5HY6A 1HD3A 3ULRB 3X20B 3H6ZA 2PVDB 4C92B 1YJWA 1M90U 4M78D 2FHDA 3RUXA 3ZFJA 1O9SA 3P8HA 5LJ3h 2COWA 3A8OB 4FM4B 2L3SA 2COZA 4JS4A 2F5KA 2LRQA 4FT4A 2W10A 2OTLQ 3PVQA 5GAN8 3EH1A 4F7UG 3KFVA 3JCMe 4RG2A 4XK8E 3TSWA 5DY9A 1B34B 2KAFA 2RJCA 3RR6A 2DZCA 4A4FA 3JB9J 4O5VA 1KQ2A 1QVFP 4FIBA 3VS5A 5GAMd 1IXDA 5DM7R 4CC7A 1QVGA 3CQTA 3CD6T 3EGUA 1X6BA 4AMCA 1K0XA 4ZN1A 1GXIE 2DK3A 3JCMg 3VYGA 4GLKA 4JS5A 1WFWA 5I21A 2CZ0B 1ZBXA 3A5ZB 5CR2A 1YP5A 3VUBA 2VGMA 1D1CA 2QEXT 4XTUA 2DYBA 3QYGB 4JRKA 2KXCA 1WQWA 3LW5E 3VS4A 1UG1A 1AWXA 4KGVB 5KCHA 1RAHB 1K4US 2LNVA 3M59A 4DBFA 2GFAA 2KVQG 3TVTA 5KE3A 1CKAA 2XHCA 2DL8A 1SHFA 2LCCA 2DD5A 3M57A 4C5EA 3X24B 4X9DA 3OYGA 2DM1A 4M7AD 4PJOA 3TCJA 4HT8A 2EYQA 2IG0A 1K8AC 1NJIR 2QQRA 1ARKA 4AT1B 1M1KU 3SWNB 3CD6A 2RH2A 3BFMA 2HMAA 4OF1A 1VQ4T 4A4GA 2ROTA 1BK2A 2K5IA 2VGNA 3MHXA 2GF7A 2RQWA 3THKA 3MP1A 3R6OA 1SEMA 3LH0A 3JCMV 1Q86C 4II1A 2WACA 5IHNA 2QEXA 1OX8A 1B07A 1NPPA 2O9SA 2P0QA 1M2OA 2A3LA 5CCAA 4ME7A 2L2PA 1BI3A 5KYXB 3R6NA 3A98A 4DA4A 4XTVA 4ZTFA 5GAN7 4TVRA 2DX1A 4J9CA 1OULA 3MPUB 5CAIA 4M78B 1ZBJA 1I5LA 1NEBA 1ZA2B 1D3BB 3L2VA 2DTIA 4C5GA 1UHCA 4LD9K 1VQ4A 4LNPA 2MWOA 1K8AR 2QASA 3OW2S 2JVVA 2LQKA 1W2BA 1UB4A 1PKTA 3IQLA 2QK0A 3V7SA 2A36A 5DLQE 1LCKA 2AHJB 1G83A 3UDCA 1MHNA 1VQ7Q 4ORZA 3CCMQ 3OYDA 4JJNK 2W0ZA 2RHIA 2R58A 4NS5A 3M0QA 4FYWB 4JJDA 3M0TA 2E41A 4HCZA 2AIRB 4FT2A 3NMZC 4LDVA 5GAMj 1FWZA 2RHXA 3UA7A 1VQ6Q 3S6WA 3GF5A 8AT1B 4J9DA 1BU1A 3RERA 1TUGB 3CPWS 2DJQA 4MMLA 1K8AU 3JCMW 2K57A 5CIUA 2EGAA 4M77F 4ZNXA 4GBQA 2YRDA 1V76A 1K9MC 2RHZA 3OW2P 2LJ1A 2HKNA 3KUFA 4KUIA 1OV3A 1Z9ZA 2BZYA 2RA2A 1I8FA 2XICA 2RQTA 3JCMJ 4RTUA 1VQMQ 3OS5A 1Q86U 1KSWA 2C06A 1KD1C 1M3AA 3JRZA 1YNZA 3QKJA 1YJ9Q 3EG2A 3TU4K 4RTWA 2RF0A 3FB9A 1G2BA 2X4XA 1NLOC 4VUBA 1G8XA 2QA4Q 1TG0A 2CKKA 4M77E 1UEBA 2NUPB 3H0FA 3FEOA 3GBQA 1UDLA 3EHRA 2DVJA 3O5ZA 2QG9B 4M7DG 3U23A 3CPWP 3PVLA 3V8LA 2JTEA 2DYIA 2J6OA 3M4GA 3URGA 4DBHA 1T0HA 1JEGA 1D1AA 4C5IA 2M0OA 4A63B 1EX4A 3QDRB 1AZGB 3V7CA 1FXXA 5FWCA 3J80E 2E6ZA 3A8LB 4OB0B 1Q95G 2B8AA 2K3YA 1K9MR 3L2UA 4RTTA 2ZPEB 4C92F 2ZPHB 2FVUA 3I5RA 1W70A 4M75E 1YJNQ 2C0IA 3DLMA 5HK3A 2JTFA 2I0NA 3QO3A 1KD1R 3JCMQ 1VUBA 2Y90A 1AVZC 1XOVA 2I2LA 1VQ8Q 1Y07A 1X43A 1AOJA 3TEEA 4ZN3A 1YJWQ 4IUTA 1R8OB 2M0YA 1K9AA 3VRYA 2EKHA 1ZUUA 2C0TA 5FWBA 3H0IA 5IXFA 2X3WD 4AFSC 1M1GA 1VA7A 1K9MU 4XAXB 5LJ3d 2EAYA 4EPCA 4A54A 1N6AA 8ATCB 1MMDA 2J06A 3J81E 1MGQA 2EYXA 5KYYA 3I9QA 5A0LA 4ELYC 2J7IA 1NE8A 1WHMA 1KD1U 5GMKj 2K6DA 4F7UA 1VQ6T 2A28A 1BI1A 2KQWA 4HT9A 4M75D 1UGPB 3OS0A 1X6OA 2JS2A 3HSBA 2FZCB 2RMOA 3EG9A 4M7DC 1H3ZA 2DL4A 2KBTA 1OI1A 2DMOA 4AFZC 1BYMA 2HQEA 2DXBA 2DNUA 1OZ3A 2FG0A 4ZGJB 1VQMT 1M8VA 4FYXB 2DO3A 5GANh 3FC3A 1UTIA 1PSFA 2SRCA 2NUTB 2ZCFB 1I07A 3CCVQ 2YXYA 4XU1A 3VV0A 2ED1A 4Q5WA 1YJ9T 1WXBA 1OU8A 1KIKA 2IIMA 3PT9A 2JW4A 5ECAA 3H41A 4PJOE 2EVRA 1X6GA 3OSSC 2OTJT 1QWEA 5FW9A 2YHTA 1JJ2A 5KYWA 1WHLA 4A4EA 1TU0B 1VYVA 1PHTA 2CS7A 4C0FA 1N27A 5HKCA 1Y0MA 3CD6Q 2DKGA 3C95A 1UJ0A 1Q7YR 1JQQA 4FYYB 1UGRB 1KC8C 2KR3A 3VKIA 1NEGA 2QI2A 2X51A 2LQ8A 4R56A 1UGSB 2FZGB 1NYGA 1MV0B 2YRCA 2DBKA 1WHGA 4JDSA 4XQ3A 1CKBA 1WZOA 4BY6B 1TSFA 2HQHA 3OYKA 3OYLA 3M56A 3OSVA 1QCFA 2FL7A 1IGUA 4LUDA 4M78F 1BIAA 1Y71A 2XMFA 4KH0B 3NHNA 5KYNA 1M1FA 1VQMA 2RI3A 4O6JA 3QYHB 4ZGEB 3LWIA 3UF4A 3SWNC 2LTOA 5GAOn 4M77B 3I35A 3LX7A 1V1CA 2X9HA 4M4ZA 4PJOD 2O01E 1JXOA 1YCYA 2DA9A 2XDBA 1WQ7A 2JM9A 1RI9A 2XKOC 2O4XA 2OTJA 1U5SA 1D09B 3VS1A 1VQ8T 2IPOB 4RTYA 3JB9I 3FDRA 2CGHA 2YSQA 4AG2C 1W6XA 3VS3A 1OEBA 1TTHB 4KRTA 4F16A 2P0KA 2XD0A 2EJFA 2RHYA 4FSSA 3I56T 5GAN6 5IXBA 4Z8AA 3V8KA 3M53A 1LPLA 4BDYA 1YFNA 1FX7A 4JJCA 4BB7A 1BCOA 4LN2A 1KC8R 4M75B 2DPPB 3NFCA 5GMKm 2ZZDA 2M16A 2EQJA 1M2VA 1QCOA 3M9QA 2PVGB 3META 2LMJA 5LJ3f 2A7YA 5LL6S 3CCEA 2RQVA 1GFCA 4D6WA 5LJ3j 3CCUQ 2DD4A 1WYXA 1FMWA 1KK7A 3H0HA 2VUBA 1WI7A 2BUDA 2EJGA 2RD1A 2ZPGB 5LJ5e 5GMKl 2LNHB 4E47A 4M7AF 3EFOA 2KGTA 1GBRA 3ME9A 1RLPC 2JXBA 3PTAA 5KCOA 2JT4A 3QXEB 3ER0A 2E64A 1G3YA 4WTOB 2CUBA 2BTTA 1RABB 3OA6A 2A37A 2MK5A 2CSIA 1LNXA 2QGGA 4J9EA 1VQ5T 1KC8U 1VOMA 2OAWA 1PSEA 2EYYA 5LJ5g 1ZA1B 2CT3A 3CCVT 2GTOA 1D0XA 2NWMA 4BI3A 1KHCA 2V26A 4KUDK 1HYOA 3I56A 2DVEA 1UUEA 3OYCA 3OYHA 3JAME 3VS7A 2E4HA 4RTZA 1I5OB 2K7AA 2KXDA 4OMFB 3PFSA 1OPKA 3JCMf 1NJIC 4K11A 3SDZA 1T0JA 2ENMA 2EQKA 1IO6A 2PVOB 3DB3A 4M7AE 1WA7A 3HKSA 1K1ZA 4JZ4A 1ZSZC 2EKOA 2KMTA 1ABOA 4N0AC 3FIFA 1JU5C 2CP3A 5CKBA 2YT6A 2K3XA 3BY7A 3I55T 3H8ZA 3WXMB 4JJBA 3EGDA 3DLLA 3CBMA 1YHQT 2O2OA 3JB9F 2X4JA 5CQYA 3UWNA 3OBYA 4M7DA 4EMKC 2C0OA 3JCMh 3FLGA 4PJOB 2GGRA 2JNGA 2K3BA 2KYMA 4BD3A 2PUKB 4IIOA 1VQ5A 1EZZB 1QVGS 3OS1A 3CCVA 1WGSA 5AYFA 3VUZA 2E5KA 1NBEB 1NLPC 3G71Q 4L5GA 2JZ2A 2X4YA 4N4HA 4PJLA 2QGFB 1VYUA 4LD6A 3C0CA 2VASA 4HVUA 2DERA 4F7UF 3QWXX 2KRNA 3QJ6A 3HRTA 3EH2A 1VIFA 3L1AA 2ESWA 4R55A 4JUVA 3CCST 3MEAA 3JCMX 3ASKA 2QDLA 2FEIA 2CP0A 2YWWA 2NLUA 2LVMA 4FYVB 3I55A 2P4RA 1WHJA 2DTHA 3CBOA 1BIBA 4E6RA 1YHQA 5HK0A 2DF6A 4YTLA 4C8QG 2HL3A 3A8MB 2X35A 4E7KA 4OB2B 1UECA 1XTDA 2RM4A 1PG5B 3CCUT 3QIIA 3ZL7C 5IAYA 1QVGP 4FSXA 4LXCA 1SSHA 2E3IA 4F7UE 2EQIA 2JMCA 1NJIU 2RPNA 3TQ7P 2D9TA 1KFZA 1ZUYA 2AZVA 2EFIA 2GNCA 4BE1A 5GAN5 2DIQA 3EGXA 4ZGDB 3RMSA 4RCBA 2V8JA 2KROA 3RIRA 3JB9D 3MEVA 1RL2A 1IHWA 3M54A 5I2SA 3CCSA 3UPUA 4OGCA 3NTHA 1RUWA 3RKXA 1WHKA 5KE2A 3E19A 4M77G 1AEYA 4OP0A 4BDZA 4KBMB 3MO8A 2VVKA 1Q81R 5GANd 1K73R 3OYNA 5CK9A 5I11A 1P92A 1YITQ 1EFNA 3CCRT 3CCUA 1BI2A 1TUDA 2FPDA 3G6EA 3L2ZA 3KBGA 3BE3A 5D6YA 1D3BA 4BUGA 1WXUA 2IVWA 3SHWA 1KQSS 2MAMA 3M0SA 5EC7A 1S72T 2PUOB 2PU9B 3BDUA 2QAZA 1S1NA 1A0NB 1BCMA 4GLMA 2JOYA 1U1SA 4GY5A 4HKEA 3RKWA 1GCQA 4Z88A 3ZBDA 2DLPA 2CP6A 2LP5A 1H8KA 1KG1A 5AT1B 4MDXA 2HBPA 5HCKA 5FU7C 1X27A 2QYZA 2D0NA 5GAMe 4EDUA 1Y57A 5FLXE 4PNOA 5GAOq 4PLIA 1K73U 2AZSA 3S3NA 4C8QC 3G71T 4J9FA 4M7AB 1M9SA 1U8RA 3A8GB 1BB9A 3RDVA 2L8DA 4MMKA 2RK1A 4E7SA 2CUDA 4L6V5 5GAMg 4DOVA 3OYEA 4RTVA 4Y92A 2BZ8A 1TWBA 4JLIA 1AHJB 3CCRA 3CC2Q 4HCBA 2FYKA 4C92G 2MPXC 2OTJQ 2HBWA 2HSPA 1KQSP 2LQNA 3MCAB 1BI0A 2QQSA 4M75F 1OU9A 1PC0A 1S72A 2LDMA 4ZTJA 3SB2A 3SFMA 1ZSZA 3E2UA 4N0AA 1GRIA 4X34A 2GTJA 3CEYA 4C0DC 2V1RA 4M77C 3WVDB 2MWPA 2KK4A 2AK5A 1UE9A 4EMKA 3I5SA 2RJEA 3G71A 4F14A 3CCEQ 1ZSGA 5GMKi 2E3HA 2CSQA 2QXFA 3M55A 1JXMA 4FCYA 3OYJA 4OVAA 3VS0A 4RMOA 2RNAA 1MMAA 1PRMC 2DRKA 4EMHA 3M5AA 2D6FA 1PCXA 4MZPA 1YIJT 3L2QA 2F2WA 2CDTA 5KYYB 1OYXA 2OJ2A 3PIOA 1MNEA 2CZ6B 2CP2A 4IUVA 4XTZA 1RAFB 2LC4A 3OS2A 1QLYA 2FRWA 2E10A 2RI5A 4F7UB 4XTXA 4WF2A 4X1VA 4M7DF 2LCLA 1KHIA 2DE0X 1PD1A 3I56Q 1YITT 4CC4B 2D0QB 1T3LA 3CMET 2HD0A 6AT1B 3LGFA 4QT7A 1OPLA 3CXCA 3EG9B 3VRZA 1TS9A 3DB4A 4PJJA 5GANf 1G3SA 4RCCA 5GANj 1XJWB 1H641 1YWPA 4FL6A 5CO7A 1Q7YC 4BE0A 3VJPA 4RTXA 5KYUB 1E7OA 2LT1A 4C92C 1AD5A 1YN8A 4PJOF 3MEUA 1SPKA 4IUUA 1QQJA 1T3SA 3OY9A 2RO0A 2DBMA 2MIOA 5GMKe 4M7DE 2MMPA 5J3BA 1OX9A 2D8HA 2DXTA 2D8JA 2YUNA 4IURA 4C0ZA 1YIJA 2D1XA 3EHQA 5KYWB 2HL5C 5IHIA 2QTXA 1XNIA 2R5MA 1GCPA 1N9RA 3BDLA 5L8RE 1WNLA 3O8VA 1VQ5Q 1EIFA 3FJ5A 5IN1A 2AKLA 3JCMd 2P4TA 4B9XA 4CC2A 1ACMB 4M78G 4JPBW 1YITA 2LZ6B 5IT9E 4D8DA 3CMEA 2O9VA 4KGZB 3CC2T 4LE9A 4ELZC 1JBMA 1YCSB 4HCCA 2RJFA 1UFFA 5FROA 4CI0C 4DEXA 2FPEA 4F04B 2L0AA 2HZYA 2YDLA 3GPLA 1SRMA 1VQPT 1M30A 2OX7A 2EYZA 4PJNA 1VQNT 3RMQA 4OMNA 2VB6A 2XI9A 4M7DD 3I55Q 2X3XD 3JSCA 5J26A 2DEQA 3G4ST 1YHQQ 3EG1A 3HRUA 3M58A 5A0GA 1U3OA 3CCET 1JJ2S 1C1AA 2YRVA 3PNWC 4C8QA
chains in the Genus database with same CATH topology
1WDXA 2YT6A 2A36A 1WX6A 1AWOA 2CH4W 1LCKA 2OI3A 1GL5A 4JJBA 2O88A 2KEAA 1G83A 1X2KA 2GQIA 2O2OA 4HVWA 4ORZA 2C0OA 2W0ZA 2GGRA 2K3BA 2KYMA 3M0QA 4JJDA 3RBBB 3M0TA 4IIOA 1AWJA 1U06A 3NMZC 1M8MA 2E5KA 3UA7A 1NLPC 1SHGA 4J9DA 1RLQC 1BU1A 1H3HA 2KRMA 1VYUA 2DJQA 4OMMA 3C0CA 1E6GA 1KJWA 2L3QA 1PNJA 2CREA 2EGAA 4HVUA 2DL5A 2ED0A 4Z89A 4ZNXA 4CC3A 4GBQA 1WIEA 3QWXX 4WCIA 2KRNA 3REAB 2LJ1A 2ESWA 1OV3A 1Z9ZA 2BZYA 3M0UA 2K79A 2RQTA 2QDLA 4RTUA 5GJVB 4JZ3A 4EIKA 1VYTA 2FEIA 1KSWA 2RQUA 2LJ0A 4DEYA 1M3AA 1X69A 5L23A 1E6HA 2P4RA 1YNZA 1PRLC 4OMQA 2FO0A 1H92A 3EG2A 4RTWA 4E6RA 2RF0A 1G2BA 4J9IA 2DF6A 4J9HA 2K2MA 1NLOC 1UECA 2VKNA 1QKWA 1TG0A 3NGPA 3ZL7C 3PE0A 1M27C 3H0FA 3REBB 1SSHA 2EQIA 2HCKA 3GBQA 1UDLA 3EHRA 2ABLA 2DVJA 2JMCA 3O5ZA 4HCKA 2HEQA 3U23A 3PVLA 1CSKA 2JTEA 3NPFA 3SEMA 1BBZA 2J6OA 1ZLMA 2RPNA 1T0HA 1JEGA 3VS6A 1KFZA 2ECZA 1ZUYA 2AZVA 2LX7A 4A63B 2GNCA 1AZGB 1X2QA 2EPDA 2PZ1A 2AKKA 2KROA 5FWCA 1NYFA 3LH5A 4RUGA 1ZUKA 3UA6A 3JV3A 2HDAA 1WXTA 1WLPB 2PTKA 1RUWA 1FYNA 2LJ3A 1GBQA 4RTTA 1AEYA 3UATA 2DILA 3I5RA 1W70A 1Z9QA 2C0IA 2J6FA 2YUOA 2VVKA 1FMKA 2FRYA 2I0NA 5I11A 1AVZC 5IH2A 2LCSA 1XOVA 1EFNA 1PWTA 2VWFA 3M0PA 2MOXA 2DL7A 1TUDA 2KE9A 4OMPA 2FPDA 1X43A 1AOJA 4F17A 1UHFA 1WXUA 3SHWA 2M0YA 1K9AA 3VRYA 2EKHA 3M0SA 5EC7A 1ZUUA 2C0TA 5FWBA 2RQRA 3H0IA 5IXFA 1S1NA 1J3TA 4GLMA 2X3WD 4AFSC 1A0NB 2YUPA 1GFDA 2JS0A 1ABQA 1VA7A 1GCQA 1ZX6A 4Z88A 4OMLA 2FPFA 2DLPA 2LP5A 1H8KA 2J06A 4R0KA 2EYXA 5HCKA 1X27A 1K0SA 3I9QA 2D0NA 2L3PA 1Y57A 3QWYA 2J7IA 1JO8A 2EW3A 1M3BA 2K6DA 2A28A 2AZSA 1SRLA 5I22A 2H8HA 4J9FA 1N5ZA 1BB9A 1UJYA 4J9GA 2JMAA 2JS2A 2B86A 2PNIA 1UGVA 2RN8A 2EBPA 2KT8A 2RMOA 2MCNA 2CUDA 2DL4A 4RTVA 4HXJA 4Y92A 2KBTA 2BZ8A 2DMOA 4AFZC 5IHKA 1HSQA 4HVVA 2KYBA 2EYWA 2J6KA 2DNUA 1AWWA 2HBWA 2HSPA 4AG1C 2FG0A 5GJWB 2LQNA 1B3QA 2SEMA 1I1JA 3EG0A 2O31A 1GCQC 1UTIA 2SRCA 2G6FX 1I07A 1I0CA 1GRIA 2DRMA 2ED1A 1WXBA 2GTJA 1NM7A 2NUZA 1KIKA 2IIMA 1MV3A 2V1RA 1YWOA 2JW4A 5ECAA 3H41A 2EVRA 1HD3A 1X6GA 1PKSA 3ULRB 1QWEA 5FW9A 1M3CA 2AK5A 1UE9A 1VYVA 1PHTA 3I5SA 1Y0MA 3EG3A 1QWFA 4F14A 2L3SA 1ZSGA 1UJ0A 2W10A 1JQQA 2CSQA 2KR3A 3PVQA 1NEGA 1JXMA 3KFVA 3TSWA 1NYGA 1MV0B 2DBKA 3VS0A 1CKBA 2RNAA 3VS5A 1PRMC 2DRKA 4CC7A 1QCFA 1NG2A 3CQTA 4LUDA 2CT4A 2XMFA 3NHNA 3EGUA 4ESRA 1X6BA 1K0XA 2F2XA 2F2WA 2CDTA 2OJ2A 3UF4A 1QLYA 2BZXA 1V1CA 2FRWA 3I35A 1WFWA 4M4ZA 2ROLA 1JXOA 4X1VA 2DA9A 2EGEA 1YP5A 2DE0X 1MUZA 2JM9A 4CC4B 1RI9A 1T3LA 2LQWA 1U5SA 2DYBA 2J05A 3VS1A 2KXCA 1W1FA 3VS4A 1UG1A 4RTYA 4J9BA 1AWXA 1HJDA 4QT7A 2YSQA 1OPLA 3VRZA 2KT1A 1K4US 2DL3A 4AG2C 1W6XA 3VS3A 1OEBA 1YWPA 3TVTA 1CKAA 4KRTA 4F16A 2DL8A 1SHFA 4RTXA 1E7OA 1AD5A 1YN8A 4FSSA 3TSZA 5IXBA 1SPKA 4Z8AA 2CH4A 1T3SA 2DM1A 2EGCA 4D8KA 4JJCA 3VS2A 2DBMA 4LN2A 1K76A 2MIOA 2V1QA 1ARKA 2LMJA 1OOTA 2D8HA 2F2VA 2D8JA 1TUCA 2RQVA 2ROTA 1GFCA 1BK2A 2YUNA 3M0RA 2D1XA 3EHQA 1WYXA 4AFUC 5IHIA 3H0HA 1WI7A 1GCPA 2RQWA 3THKA 3FJ5A 2AKLA 1SEMA 3RNJA 2LNHB 4CC2A 4JPBW 1AZEA 2LZ6B 2KNBB 5IHNA 4D8DA 2KGTA 1GBRA 1RLPC 2JXBA 2O9VA 2JT4A 1B07A 4LE9A 2CUBA 4OMOA 2BTTA 2O9SA 1YCSB 4IIMA 2A37A 1UFFA 2CSIA 4DEXA 2L2PA 4J9EA 2FPEA 2OAWA 2EYYA 3R6NA 2L0AA 3A98A 2CT3A 2YDLA 2GTOA 2NWMA 2YUQA 2K9GA 1SRMA 2DX1A 1M30A 1UUEA 4J9CA 2EYZA 2JM8A 1ZBJA 1NEBA 3VS7A 4RTZA 2K7AA 2KXDA 4OMNA 1OPKA 4K11A 2A08A 1T0JA 1UHCA 2X3XD 2ENMA 1IO6A 2GBQA 2KRSA 3EG1A 4LNPA 1WA7A 1QKXA 1K1ZA 1U3OA 2M51A 4AFQC 4LUEA 1PKTA 4JZ4A 3IQLA 1ABOA 1JU5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDX A;  2YT6 A;  2A36 A;  1WX6 A;  1AWO A;  2CH4 W;  1LCK A;  2OI3 A;  1GL5 A;  4JJB A;  2O88 A;  2KEA A;  1G83 A;  1X2K A;  2GQI A;  2O2O A;  4HVW A;  4ORZ A;  2C0O A;  2W0Z A;  2GGR A;  2K3B A;  2KYM A;  3M0Q A;  4JJD A;  3RBB B;  3M0T A;  4IIO A;  1AWJ A;  1U06 A;  3NMZ C;  1M8M A;  2E5K A;  3UA7 A;  1NLP C;  1SHG A;  4J9D A;  1RLQ C;  1BU1 A;  1H3H A;  2KRM A;  1VYU A;  2DJQ A;  4OMM A;  3C0C A;  1E6G A;  1KJW A;  2L3Q A;  1PNJ A;  2CRE A;  2EGA A;  4HVU A;  2DL5 A;  2ED0 A;  4Z89 A;  4ZNX A;  4CC3 A;  4GBQ A;  1WIE A;  3QWX X;  4WCI A;  2KRN A;  3REA B;  2LJ1 A;  2ESW A;  1OV3 A;  1Z9Z A;  2BZY A;  3M0U A;  2K79 A;  2RQT A;  2QDL A;  4RTU A;  5GJV B;  4JZ3 A;  4EIK A;  1VYT A;  2FEI A;  1KSW A;  2RQU A;  2LJ0 A;  4DEY A;  1M3A A;  1X69 A;  5L23 A;  1E6H A;  2P4R A;  1YNZ A;  1PRL C;  4OMQ A;  2FO0 A;  1H92 A;  3EG2 A;  4RTW A;  4E6R A;  2RF0 A;  1G2B A;  4J9I A;  2DF6 A;  4J9H A;  2K2M A;  1NLO C;  1UEC A;  2VKN A;  1QKW A;  1TG0 A;  3NGP A;  3ZL7 C;  3PE0 A;  1M27 C;  3H0F A;  3REB B;  1SSH A;  2EQI A;  2HCK A;  3GBQ A;  1UDL A;  3EHR A;  2ABL A;  2DVJ A;  2JMC A;  3O5Z A;  4HCK A;  2HEQ A;  3U23 A;  3PVL A;  1CSK A;  2JTE A;  3NPF A;  3SEM A;  1BBZ A;  2J6O A;  1ZLM A;  2RPN A;  1T0H A;  1JEG A;  3VS6 A;  1KFZ A;  2ECZ A;  1ZUY A;  2AZV A;  2LX7 A;  4A63 B;  2GNC A;  1AZG B;  1X2Q A;  2EPD A;  2PZ1 A;  2AKK A;  2KRO A;  5FWC A;  1NYF A;  3LH5 A;  4RUG A;  1ZUK A;  3UA6 A;  3JV3 A;  2HDA A;  1WXT A;  1WLP B;  2PTK A;  1RUW A;  1FYN A;  2LJ3 A;  1GBQ A;  4RTT A;  1AEY A;  3UAT A;  2DIL A;  3I5R A;  1W70 A;  1Z9Q A;  2C0I A;  2J6F A;  2YUO A;  2VVK A;  1FMK A;  2FRY A;  2I0N A;  5I11 A;  1AVZ C;  5IH2 A;  2LCS A;  1XOV A;  1EFN A;  1PWT A;  2VWF A;  3M0P A;  2MOX A;  2DL7 A;  1TUD A;  2KE9 A;  4OMP A;  2FPD A;  1X43 A;  1AOJ A;  4F17 A;  1UHF A;  1WXU A;  3SHW A;  2M0Y A;  1K9A A;  3VRY A;  2EKH A;  3M0S A;  5EC7 A;  1ZUU A;  2C0T A;  5FWB A;  2RQR A;  3H0I A;  5IXF A;  1S1N A;  1J3T A;  4GLM A;  2X3W D;  4AFS C;  1A0N B;  2YUP A;  1GFD A;  2JS0 A;  1ABQ A;  1VA7 A;  1GCQ A;  1ZX6 A;  4Z88 A;  4OML A;  2FPF A;  2DLP A;  2LP5 A;  1H8K A;  2J06 A;  4R0K A;  2EYX A;  5HCK A;  1X27 A;  1K0S A;  3I9Q A;  2D0N A;  2L3P A;  1Y57 A;  3QWY A;  2J7I A;  1JO8 A;  2EW3 A;  1M3B A;  2K6D A;  2A28 A;  2AZS A;  1SRL A;  5I22 A;  2H8H A;  4J9F A;  1N5Z A;  1BB9 A;  1UJY A;  4J9G A;  2JMA A;  2JS2 A;  2B86 A;  2PNI A;  1UGV A;  2RN8 A;  2EBP A;  2KT8 A;  2RMO A;  2MCN A;  2CUD A;  2DL4 A;  4RTV A;  4HXJ A;  4Y92 A;  2KBT A;  2BZ8 A;  2DMO A;  4AFZ C;  5IHK A;  1HSQ A;  4HVV A;  2KYB A;  2EYW A;  2J6K A;  2DNU A;  1AWW A;  2HBW A;  2HSP A;  4AG1 C;  2FG0 A;  5GJW B;  2LQN A;  1B3Q A;  2SEM A;  1I1J A;  3EG0 A;  2O31 A;  1GCQ C;  1UTI A;  2SRC A;  2G6F X;  1I07 A;  1I0C A;  1GRI A;  2DRM A;  2ED1 A;  1WXB A;  2GTJ A;  1NM7 A;  2NUZ A;  1KIK A;  2IIM A;  1MV3 A;  2V1R A;  1YWO A;  2JW4 A;  5ECA A;  3H41 A;  2EVR A;  1HD3 A;  1X6G A;  1PKS A;  3ULR B;  1QWE A;  5FW9 A;  1M3C A;  2AK5 A;  1UE9 A;  1VYV A;  1PHT A;  3I5S A;  1Y0M A;  3EG3 A;  1QWF A;  4F14 A;  2L3S A;  1ZSG A;  1UJ0 A;  2W10 A;  1JQQ A;  2CSQ A;  2KR3 A;  3PVQ A;  1NEG A;  1JXM A;  3KFV A;  3TSW A;  1NYG A;  1MV0 B;  2DBK A;  3VS0 A;  1CKB A;  2RNA A;  3VS5 A;  1PRM C;  2DRK A;  4CC7 A;  1QCF A;  1NG2 A;  3CQT A;  4LUD A;  2CT4 A;  2XMF A;  3NHN A;  3EGU A;  4ESR A;  1X6B A;  1K0X A;  2F2X A;  2F2W A;  2CDT A;  2OJ2 A;  3UF4 A;  1QLY A;  2BZX A;  1V1C A;  2FRW A;  3I35 A;  1WFW A;  4M4Z A;  2ROL A;  1JXO A;  4X1V A;  2DA9 A;  2EGE A;  1YP5 A;  2DE0 X;  1MUZ A;  2JM9 A;  4CC4 B;  1RI9 A;  1T3L A;  2LQW A;  1U5S A;  2DYB A;  2J05 A;  3VS1 A;  2KXC A;  1W1F A;  3VS4 A;  1UG1 A;  4RTY A;  4J9B A;  1AWX A;  1HJD A;  4QT7 A;  2YSQ A;  1OPL A;  3VRZ A;  2KT1 A;  1K4U S;  2DL3 A;  4AG2 C;  1W6X A;  3VS3 A;  1OEB A;  1YWP A;  3TVT A;  1CKA A;  4KRT A;  4F16 A;  2DL8 A;  1SHF A;  4RTX A;  1E7O A;  1AD5 A;  1YN8 A;  4FSS A;  3TSZ A;  5IXB A;  1SPK A;  4Z8A A;  2CH4 A;  1T3S A;  2DM1 A;  2EGC A;  4D8K A;  4JJC A;  3VS2 A;  2DBM A;  4LN2 A;  1K76 A;  2MIO A;  2V1Q A;  1ARK A;  2LMJ A;  1OOT A;  2D8H A;  2F2V A;  2D8J A;  1TUC A;  2RQV A;  2ROT A;  1GFC A;  1BK2 A;  2YUN A;  3M0R A;  2D1X A;  3EHQ A;  1WYX A;  4AFU C;  5IHI A;  3H0H A;  1WI7 A;  1GCP A;  2RQW A;  3THK A;  3FJ5 A;  2AKL A;  1SEM A;  3RNJ A;  2LNH B;  4CC2 A;  4JPB W;  1AZE A;  2LZ6 B;  2KNB B;  5IHN A;  4D8D A;  2KGT A;  1GBR A;  1RLP C;  2JXB A;  2O9V A;  2JT4 A;  1B07 A;  4LE9 A;  2CUB A;  4OMO A;  2BTT A;  2O9S A;  1YCS B;  4IIM A;  2A37 A;  1UFF A;  2CSI A;  4DEX A;  2L2P A;  4J9E A;  2FPE A;  2OAW A;  2EYY A;  3R6N A;  2L0A A;  3A98 A;  2CT3 A;  2YDL A;  2GTO A;  2NWM A;  2YUQ A;  2K9G A;  1SRM A;  2DX1 A;  1M30 A;  1UUE A;  4J9C A;  2EYZ A;  2JM8 A;  1ZBJ A;  1NEB A;  3VS7 A;  4RTZ A;  2K7A A;  2KXD A;  4OMN A;  1OPK A;  4K11 A;  2A08 A;  1T0J A;  1UHC A;  2X3X D;  2ENM A;  1IO6 A;  2GBQ A;  2KRS A;  3EG1 A;  4LNP A;  1WA7 A;  1QKX A;  1K1Z A;  1U3O A;  2M51 A;  4AFQ C;  4LUE A;  1PKT A;  4JZ4 A;  3IQL A;  1ABO A;  1JU5 C; 
#chains in the Genus database with same CATH topology
 1WDX A;  2E65 A;  1PD0 A;  4LDW A;  3RES A;  5A0D A;  2CH4 W;  1AWO A;  2OI3 A;  5GAN 2;  4E7I A;  2O88 A;  3CCL Q;  4DBQ A;  1SKU B;  1X2K A;  2RHU A;  2GQI A;  2ATC B;  2EJ9 A;  3F70 A;  3CC2 A;  4XU2 A;  1VQ9 T;  4HVW A;  4ANJ A;  1Q7Y U;  3INZ A;  1C6V X;  2CYZ B;  5CKD A;  2QQ9 A;  4BE2 A;  1WJQ A;  2WSF E;  4NOY A;  1M2V B;  4M7A G;  3A1P A;  2DZ9 A;  4PL6 A;  1M8M A;  3CCS Q;  3HFO A;  1SHG A;  1VQP A;  1RLQ C;  1LJO A;  3CCQ T;  1VQN A;  4L59 A;  4E7Z A;  1E6G A;  1KJW A;  1QVF A;  2L3Q A;  3G7Z A;  1G5V A;  2CRE A;  2DEU A;  1OZ2 A;  4Z89 A;  3CMA T;  1WIE A;  4PLL A;  3G4S A;  4WCI A;  4M77 A;  5DLO A;  3EFO B;  4M78 C;  1TXQ A;  1JJ2 P;  2DFU A;  3LYI A;  3QHS A;  5GAO m;  4JZ3 A;  4V2S A;  3G6E Q;  1VYT A;  2BE7 D;  1TH7 A;  3ZEH A;  2LJ0 A;  4DEY A;  3CBP A;  1X69 A;  4OB1 B;  1QMC A;  2JN0 A;  4OMQ A;  5CKF A;  2FO0 A;  1N8R C;  1H92 A;  4JRP A;  2F69 A;  4IKF A;  2MYS A;  4J9I A;  5LJ3 e;  5GAO l;  1VQ9 A;  4J9H A;  2K2M A;  3LWH A;  4J83 A;  3PE0 A;  3RKY A;  1M27 C;  2HCK A;  5D7U A;  2ABL A;  4HCK A;  4J6Y A;  2HEQ A;  3LGL A;  3CC7 A;  1CSK A;  2V8K A;  3CCQ A;  1ZLM A;  2RJD A;  1TOV A;  5M9O A;  5LJ3 g;  4EMG A;  2AT1 B;  4N4G A;  2LX7 A;  2CP7 A;  1X2Q A;  3CMA A;  2HNI A;  4QVC A;  5LJ5 h;  4E7J A;  3EGD B;  4RUG A;  5GAN 3;  1ZUK A;  1Y96 A;  4C5H A;  3UA6 A;  1SF9 A;  3OMC A;  4JRQ A;  5I2M A;  4J5Y A;  1WXT A;  1WLP B;  3CCR Q;  2PTK A;  4MDW A;  1Q82 C;  4M7D B;  2LJ3 A;  5CQX A;  1O75 A;  2QQA A;  3UAT A;  1YI2 Q;  4MZM A;  4FW1 A;  2J6F A;  4J7I A;  1S72 Q;  4C92 A;  2FRY A;  4M7A C;  2MF2 A;  3GOX A;  1PWT A;  1N8R R;  1JRI A;  4LDX A;  2DJZ A;  2VWF A;  3M0P A;  2DL7 A;  3EAE A;  2KE9 A;  4OMP A;  3HHT B;  4KUL A;  4F17 A;  1UHF A;  2QTV A;  3QBY A;  1B34 A;  1M1K R;  2RQR A;  1J3T A;  2QDY B;  1D0Y A;  2YUP A;  3CCJ T;  3CCL T;  3OYY A;  2JS0 A;  1ZX6 A;  3P8D A;  4OML A;  4Y91 A;  1F1B B;  5C0M A;  3JCM P;  1SG5 A;  3OYF A;  2BIV A;  4R0K A;  4LDY A;  2XDD A;  3QG1 A;  4DOW A;  1D1B A;  3QWY A;  2EW3 A;  2JJ9 A;  3OBW A;  3OYA A;  5KH6 A;  5I22 A;  1SRL A;  5FU6 B;  4QQ6 A;  3E9F A;  2LT4 A;  1N8R U;  1UJY A;  4J9G A;  1Q82 R;  3QJY A;  1Q81 C;  3WVE B;  1K73 C;  4XTY A;  2H3E B;  2RN8 A;  2KT8 A;  2Y4Y A;  3HRS A;  4RKU E;  2ZPI B;  1VQK Q;  4N4I A;  1IZ6 A;  2R57 A;  4HXJ A;  5A2Q E;  1VQO T;  2XDP A;  3X28 B;  5IHK A;  1RAC B;  1HSQ A;  3MEW A;  2EYW A;  2FZK B;  2VC8 A;  2RI2 A;  3EGX B;  1AWW A;  3P8B B;  3M4Y A;  3V8J A;  5GJW B;  1B3Q A;  3G6E T;  1I1J A;  2O31 A;  3Q1J A;  1W4S A;  4P5N A;  3CPF A;  4Y28 E;  4ATO A;  3AHU A;  3CCJ A;  3CCL A;  1IRX A;  1I0C A;  2DRM A;  2VXE A;  1NM7 A;  2NUZ A;  3SWN A;  1RAD B;  1MV3 A;  1YWO A;  2HSE B;  3MP6 A;  3OB9 A;  5GAO r;  1JB0 E;  3OW2 A;  1IB8 A;  1PKS A;  1M3C A;  2K4Y A;  1Q82 U;  2V8I A;  4BAC A;  1RAI B;  4OGE A;  5GAO p;  1VQL T;  3EG3 A;  2X4W A;  1QWF A;  3QPH A;  3OYB A;  1QP3 A;  3GNF B;  1ZHI A;  1YIJ Q;  3NTK A;  3T9N A;  3NTI A;  2CZ7 B;  2M9U A;  4QVD A;  2WSE E;  2ZPB B;  3CC4 Q;  2M02 A;  1KQS A;  2COY A;  3HFN A;  1VQO A;  4QQD A;  2PQW A;  3E9G A;  2DTO A;  5KYX A;  1NG2 A;  3EFR A;  3H9N A;  2CT4 A;  4PK4 A;  3CME Q;  2E12 A;  4KT0 E;  4C8Q F;  4ESR A;  1D0Z A;  3CPW A;  2F2X A;  4M78 A;  2OTL T;  1AT1 B;  1QP2 A;  1YI2 T;  4CRI A;  1RI0 A;  2BZX A;  4A4H A;  2K5L A;  4Z02 A;  2ROL A;  2RB6 A;  1QVP A;  7AT1 B;  2EGE A;  1W2B S;  1MUZ A;  2EIF A;  1Q86 R;  2LQW A;  1QCN A;  1U1T A;  2HAX A;  5J39 A;  2J05 A;  1W1F A;  4M75 G;  1G3T A;  4J9B A;  2KDS A;  1YBY A;  1HJD A;  2KT1 A;  5GAM f;  3EFS A;  2DL3 A;  1VQL A;  4UC4 A;  3VU3 C;  1Q81 U;  3TRE A;  4QVZ A;  2RK2 A;  2P0P A;  4PFZ A;  2FB7 A;  4C8Q E;  4XU0 A;  3TSZ A;  2KSS A;  4X9C A;  2CH4 A;  2CP5 A;  4OB3 B;  2EGC A;  4D8K A;  2R5A A;  3VS2 A;  2VXF A;  1K76 A;  1MND A;  2ZGW A;  5EG2 A;  2DIG A;  4KH1 B;  3L2R A;  1ZSZ B;  1KQ1 A;  2V1Q A;  3BW1 A;  2P84 A;  1OOT A;  3LLR A;  2F2V A;  4IUP A;  1TUC A;  3M0R A;  3DKM A;  1PM3 A;  3C94 A;  4DQ2 A;  2JUF A;  2OTL A;  4XU3 A;  3JCM b;  4AFU C;  4BY6 C;  1YI2 A;  1VIE A;  3MJX A;  4DBR A;  3QUI A;  5GAM h;  1N9S A;  4EMK B;  3PMI A;  3HTR A;  3RNJ A;  1W2B P;  2VV5 A;  3L2W A;  3AT1 B;  2L5Q A;  1SSF A;  1VQP Q;  1VQK T;  1AZE A;  1DJ7 B;  4PJM A;  2KNB B;  1VQN Q;  1OQK A;  1BKB A;  1IRE B;  4M7A A;  2ZAE A;  4OMO A;  1X01 A;  4IIM A;  2DET A;  3A8H B;  3G4S Q;  3OYM A;  4IUQ A;  4C8Q D;  2QQB A;  2YUQ A;  3VYH B;  2K9G A;  4JLG A;  4PKC C;  2E5Q A;  2M1H A;  3HP9 A;  2JM8 A;  3OQ5 A;  1LOJ A;  2A08 A;  2NUP A;  4B9W A;  2XU8 A;  2GBQ A;  3JCM c;  2KRS A;  2HQX A;  2JTM A;  1RAA B;  1VQ9 Q;  4B6M A;  3GLX A;  1QKX A;  4PJO G;  2NYS A;  2M51 A;  2Y4X A;  4AFQ C;  4LUE A;  4M75 C;  3SD4 A;  1LVK A;  5CKE A;  3FJP A;  1WX6 A;  5CVI A;  2F5T X;  3CC7 Q;  1GL5 A;  1VQK A;  2KEA A;  2XID A;  3L42 A;  1R77 A;  3CCQ Q;  3CC4 T;  4J8O A;  1RAG B;  4M77 D;  9ATC B;  3S3O A;  3X26 B;  4NL2 A;  5FRM A;  4J6X A;  1RAE B;  3MP8 A;  4A4K A;  3CMA Q;  3OYI A;  4LDU A;  3RBB B;  3D7S B;  1AWJ A;  5FRN A;  4PFO A;  1U06 A;  4J6W A;  2F1L A;  2E70 A;  5LJ5 d;  4QW2 A;  1H3H A;  2KRM A;  4RG8 A;  4OMM A;  4BI8 B;  1VQ7 T;  4C92 E;  1PNJ A;  3C12 A;  3CCM T;  2H3J A;  1R0C B;  2BE9 B;  2DL5 A;  2ED0 A;  4C0G A;  5GAN e;  4CC3 A;  2KI7 A;  2LX9 A;  3REA B;  4E2F B;  2EQU A;  3PIP A;  3GP8 A;  3M0U A;  2K79 A;  1QW1 A;  1WPY A;  1NZ9 A;  5GJV B;  4EIK A;  3J7A F;  3CXC S;  2DAQ A;  4QKU A;  2RQU A;  5L23 A;  1E6H A;  3MKD A;  3E1S A;  1PRL C;  5GAN g;  2DXU A;  2XG8 D;  3CC4 A;  3G1J A;  3KXT A;  1WJR A;  3V7R A;  4MZT A;  4NL3 A;  1G3W A;  5KYU A;  4XTW A;  2VKN A;  1QKW A;  3NGP A;  4JRI A;  3REB B;  3UT1 A;  5GAN 4;  5GMK h;  3NPF A;  1ZQ1 A;  3SEM A;  4C92 D;  1BBZ A;  5D6W A;  5FU7 B;  4E7L A;  2E1H A;  4PJO C;  1FMV A;  1I81 A;  1VQ7 A;  3VS6 A;  2ECZ A;  4FW2 A;  3CCM A;  1I4K 1;  4C8Q B;  4J7F A;  2QA4 T;  1B7T A;  2EPD A;  2PZ1 A;  2AKK A;  1NYF A;  3LH5 A;  1Y7X A;  2E6N A;  2L3R A;  3JV3 A;  1VQ6 A;  2NUT A;  2HDA A;  2CZ1 B;  4A53 A;  4HA8 A;  1M90 C;  3CXC P;  2O4X B;  1FYN A;  1GBQ A;  3HL8 A;  3GIB A;  2BKD N;  2DIL A;  2ZPF B;  1UGQ B;  5CKH A;  3PMT A;  1Z9Q A;  2YUO A;  4E7H A;  1FMK A;  1WHH A;  5FU6 C;  3GNG A;  3CCJ Q;  3QDF A;  1NPR A;  1R0B G;  5IH2 A;  2LCS A;  2QEX Q;  2L89 A;  1M5Q 1;  2MOX A;  1MMG A;  2A0F B;  2G3R A;  2GFU A;  4C0D B;  3N5B B;  3S3M A;  1YJN T;  1YJ9 A;  2Z0W A;  3CC7 T;  1MMN A;  1GFD A;  2K2V A;  1ABQ A;  3QZ5 B;  3X25 B;  4FU6 A;  2FPF A;  3HPW A;  4BI4 A;  2MI6 A;  1HXD A;  2QA4 A;  3PGG A;  2YLB A;  1HK9 A;  3QSU A;  1X75 C;  1K0S A;  1YJW T;  1M4Z A;  2GCX A;  2L3P A;  2EWN A;  1JO8 A;  1XQH A;  1VQ4 Q;  1VQO Q;  1M3B A;  5D6X A;  4M78 E;  3QZ9 B;  2H8H A;  1N5Z A;  2DXC A;  3JB9 H;  1M90 R;  2JMA A;  2B86 A;  2HKQ B;  2PNI A;  1UGV A;  2EBP A;  2MCN A;  2WSC E;  5LJ5 f;  4PFP A;  5LJ5 j;  5C6S A;  2GQV A;  3OMG A;  1WJS A;  1IGQ A;  1QVF S;  4HVV A;  2YLC A;  3FRN A;  2KYB A;  2J6K A;  4KGX B;  4AG1 C;  1IHV A;  1M1K C;  1C0M A;  2SEM A;  1YJN A;  2KY9 A;  1Y96 B;  3EG0 A;  1GCQ C;  1V29 B;  3C4S A;  1VQL Q;  2G6F X;  2K5F A;  4QQG A;  2VYT A;  4M75 A;  3JB9 G;  2OAU A;  2XK0 A;  2EQM A;  1VQ8 A;  5HY6 A;  1HD3 A;  3ULR B;  3X20 B;  3H6Z A;  2PVD B;  4C92 B;  1YJW A;  1M90 U;  4M78 D;  2FHD A;  3RUX A;  3ZFJ A;  1O9S A;  3P8H A;  5LJ3 h;  2COW A;  3A8O B;  4FM4 B;  2L3S A;  2COZ A;  4JS4 A;  2F5K A;  2LRQ A;  4FT4 A;  2W10 A;  2OTL Q;  3PVQ A;  5GAN 8;  3EH1 A;  4F7U G;  3KFV A;  3JCM e;  4RG2 A;  4XK8 E;  3TSW A;  5DY9 A;  1B34 B;  2KAF A;  2RJC A;  3RR6 A;  2DZC A;  4A4F A;  3JB9 J;  4O5V A;  1KQ2 A;  1QVF P;  4FIB A;  3VS5 A;  5GAM d;  1IXD A;  5DM7 R;  4CC7 A;  1QVG A;  3CQT A;  3CD6 T;  3EGU A;  1X6B A;  4AMC A;  1K0X A;  4ZN1 A;  1GXI E;  2DK3 A;  3JCM g;  3VYG A;  4GLK A;  4JS5 A;  1WFW A;  5I21 A;  2CZ0 B;  1ZBX A;  3A5Z B;  5CR2 A;  1YP5 A;  3VUB A;  2VGM A;  1D1C A;  2QEX T;  4XTU A;  2DYB A;  3QYG B;  4JRK A;  2KXC A;  1WQW A;  3LW5 E;  3VS4 A;  1UG1 A;  1AWX A;  4KGV B;  5KCH A;  1RAH B;  1K4U S;  2LNV A;  3M59 A;  4DBF A;  2GFA A;  2KVQ G;  3TVT A;  5KE3 A;  1CKA A;  2XHC A;  2DL8 A;  1SHF A;  2LCC A;  2DD5 A;  3M57 A;  4C5E A;  3X24 B;  4X9D A;  3OYG A;  2DM1 A;  4M7A D;  4PJO A;  3TCJ A;  4HT8 A;  2EYQ A;  2IG0 A;  1K8A C;  1NJI R;  2QQR A;  1ARK A;  4AT1 B;  1M1K U;  3SWN B;  3CD6 A;  2RH2 A;  3BFM A;  2HMA A;  4OF1 A;  1VQ4 T;  4A4G A;  2ROT A;  1BK2 A;  2K5I A;  2VGN A;  3MHX A;  2GF7 A;  2RQW A;  3THK A;  3MP1 A;  3R6O A;  1SEM A;  3LH0 A;  3JCM V;  1Q86 C;  4II1 A;  2WAC A;  5IHN A;  2QEX A;  1OX8 A;  1B07 A;  1NPP A;  2O9S A;  2P0Q A;  1M2O A;  2A3L A;  5CCA A;  4ME7 A;  2L2P A;  1BI3 A;  5KYX B;  3R6N A;  3A98 A;  4DA4 A;  4XTV A;  4ZTF A;  5GAN 7;  4TVR A;  2DX1 A;  4J9C A;  1OUL A;  3MPU B;  5CAI A;  4M78 B;  1ZBJ A;  1I5L A;  1NEB A;  1ZA2 B;  1D3B B;  3L2V A;  2DTI A;  4C5G A;  1UHC A;  4LD9 K;  1VQ4 A;  4LNP A;  2MWO A;  1K8A R;  2QAS A;  3OW2 S;  2JVV A;  2LQK A;  1W2B A;  1UB4 A;  1PKT A;  3IQL A;  2QK0 A;  3V7S A;  2A36 A;  5DLQ E;  1LCK A;  2AHJ B;  1G83 A;  3UDC A;  1MHN A;  1VQ7 Q;  4ORZ A;  3CCM Q;  3OYD A;  4JJN K;  2W0Z A;  2RHI A;  2R58 A;  4NS5 A;  3M0Q A;  4FYW B;  4JJD A;  3M0T A;  2E41 A;  4HCZ A;  2AIR B;  4FT2 A;  3NMZ C;  4LDV A;  5GAM j;  1FWZ A;  2RHX A;  3UA7 A;  1VQ6 Q;  3S6W A;  3GF5 A;  8AT1 B;  4J9D A;  1BU1 A;  3RER A;  1TUG B;  3CPW S;  2DJQ A;  4MML A;  1K8A U;  3JCM W;  2K57 A;  5CIU A;  2EGA A;  4M77 F;  4ZNX A;  4GBQ A;  2YRD A;  1V76 A;  1K9M C;  2RHZ A;  3OW2 P;  2LJ1 A;  2HKN A;  3KUF A;  4KUI A;  1OV3 A;  1Z9Z A;  2BZY A;  2RA2 A;  1I8F A;  2XIC A;  2RQT A;  3JCM J;  4RTU A;  1VQM Q;  3OS5 A;  1Q86 U;  1KSW A;  2C06 A;  1KD1 C;  1M3A A;  3JRZ A;  1YNZ A;  3QKJ A;  1YJ9 Q;  3EG2 A;  3TU4 K;  4RTW A;  2RF0 A;  3FB9 A;  1G2B A;  2X4X A;  1NLO C;  4VUB A;  1G8X A;  2QA4 Q;  1TG0 A;  2CKK A;  4M77 E;  1UEB A;  2NUP B;  3H0F A;  3FEO A;  3GBQ A;  1UDL A;  3EHR A;  2DVJ A;  3O5Z A;  2QG9 B;  4M7D G;  3U23 A;  3CPW P;  3PVL A;  3V8L A;  2JTE A;  2DYI A;  2J6O A;  3M4G A;  3URG A;  4DBH A;  1T0H A;  1JEG A;  1D1A A;  4C5I A;  2M0O A;  4A63 B;  1EX4 A;  3QDR B;  1AZG B;  3V7C A;  1FXX A;  5FWC A;  3J80 E;  2E6Z A;  3A8L B;  4OB0 B;  1Q95 G;  2B8A A;  2K3Y A;  1K9M R;  3L2U A;  4RTT A;  2ZPE B;  4C92 F;  2ZPH B;  2FVU A;  3I5R A;  1W70 A;  4M75 E;  1YJN Q;  2C0I A;  3DLM A;  5HK3 A;  2JTF A;  2I0N A;  3QO3 A;  1KD1 R;  3JCM Q;  1VUB A;  2Y90 A;  1AVZ C;  1XOV A;  2I2L A;  1VQ8 Q;  1Y07 A;  1X43 A;  1AOJ A;  3TEE A;  4ZN3 A;  1YJW Q;  4IUT A;  1R8O B;  2M0Y A;  1K9A A;  3VRY A;  2EKH A;  1ZUU A;  2C0T A;  5FWB A;  3H0I A;  5IXF A;  2X3W D;  4AFS C;  1M1G A;  1VA7 A;  1K9M U;  4XAX B;  5LJ3 d;  2EAY A;  4EPC A;  4A54 A;  1N6A A;  8ATC B;  1MMD A;  2J06 A;  3J81 E;  1MGQ A;  2EYX A;  5KYY A;  3I9Q A;  5A0L A;  4ELY C;  2J7I A;  1NE8 A;  1WHM A;  1KD1 U;  5GMK j;  2K6D A;  4F7U A;  1VQ6 T;  2A28 A;  1BI1 A;  2KQW A;  4HT9 A;  4M75 D;  1UGP B;  3OS0 A;  1X6O A;  2JS2 A;  3HSB A;  2FZC B;  2RMO A;  3EG9 A;  4M7D C;  1H3Z A;  2DL4 A;  2KBT A;  1OI1 A;  2DMO A;  4AFZ C;  1BYM A;  2HQE A;  2DXB A;  2DNU A;  1OZ3 A;  2FG0 A;  4ZGJ B;  1VQM T;  1M8V A;  4FYX B;  2DO3 A;  5GAN h;  3FC3 A;  1UTI A;  1PSF A;  2SRC A;  2NUT B;  2ZCF B;  1I07 A;  3CCV Q;  2YXY A;  4XU1 A;  3VV0 A;  2ED1 A;  4Q5W A;  1YJ9 T;  1WXB A;  1OU8 A;  1KIK A;  2IIM A;  3PT9 A;  2JW4 A;  5ECA A;  3H41 A;  4PJO E;  2EVR A;  1X6G A;  3OSS C;  2OTJ T;  1QWE A;  5FW9 A;  2YHT A;  1JJ2 A;  5KYW A;  1WHL A;  4A4E A;  1TU0 B;  1VYV A;  1PHT A;  2CS7 A;  4C0F A;  1N27 A;  5HKC A;  1Y0M A;  3CD6 Q;  2DKG A;  3C95 A;  1UJ0 A;  1Q7Y R;  1JQQ A;  4FYY B;  1UGR B;  1KC8 C;  2KR3 A;  3VKI A;  1NEG A;  2QI2 A;  2X51 A;  2LQ8 A;  4R56 A;  1UGS B;  2FZG B;  1NYG A;  1MV0 B;  2YRC A;  2DBK A;  1WHG A;  4JDS A;  4XQ3 A;  1CKB A;  1WZO A;  4BY6 B;  1TSF A;  2HQH A;  3OYK A;  3OYL A;  3M56 A;  3OSV A;  1QCF A;  2FL7 A;  1IGU A;  4LUD A;  4M78 F;  1BIA A;  1Y71 A;  2XMF A;  4KH0 B;  3NHN A;  5KYN A;  1M1F A;  1VQM A;  2RI3 A;  4O6J A;  3QYH B;  4ZGE B;  3LWI A;  3UF4 A;  3SWN C;  2LTO A;  5GAO n;  4M77 B;  3I35 A;  3LX7 A;  1V1C A;  2X9H A;  4M4Z A;  4PJO D;  2O01 E;  1JXO A;  1YCY A;  2DA9 A;  2XDB A;  1WQ7 A;  2JM9 A;  1RI9 A;  2XKO C;  2O4X A;  2OTJ A;  1U5S A;  1D09 B;  3VS1 A;  1VQ8 T;  2IPO B;  4RTY A;  3JB9 I;  3FDR A;  2CGH A;  2YSQ A;  4AG2 C;  1W6X A;  3VS3 A;  1OEB A;  1TTH B;  4KRT A;  4F16 A;  2P0K A;  2XD0 A;  2EJF A;  2RHY A;  4FSS A;  3I56 T;  5GAN 6;  5IXB A;  4Z8A A;  3V8K A;  3M53 A;  1LPL A;  4BDY A;  1YFN A;  1FX7 A;  4JJC A;  4BB7 A;  1BCO A;  4LN2 A;  1KC8 R;  4M75 B;  2DPP B;  3NFC A;  5GMK m;  2ZZD A;  2M16 A;  2EQJ A;  1M2V A;  1QCO A;  3M9Q A;  2PVG B;  3MET A;  2LMJ A;  5LJ3 f;  2A7Y A;  5LL6 S;  3CCE A;  2RQV A;  1GFC A;  4D6W A;  5LJ3 j;  3CCU Q;  2DD4 A;  1WYX A;  1FMW A;  1KK7 A;  3H0H A;  2VUB A;  1WI7 A;  2BUD A;  2EJG A;  2RD1 A;  2ZPG B;  5LJ5 e;  5GMK l;  2LNH B;  4E47 A;  4M7A F;  3EFO A;  2KGT A;  1GBR A;  3ME9 A;  1RLP C;  2JXB A;  3PTA A;  5KCO A;  2JT4 A;  3QXE B;  3ER0 A;  2E64 A;  1G3Y A;  4WTO B;  2CUB A;  2BTT A;  1RAB B;  3OA6 A;  2A37 A;  2MK5 A;  2CSI A;  1LNX A;  2QGG A;  4J9E A;  1VQ5 T;  1KC8 U;  1VOM A;  2OAW A;  1PSE A;  2EYY A;  5LJ5 g;  1ZA1 B;  2CT3 A;  3CCV T;  2GTO A;  1D0X A;  2NWM A;  4BI3 A;  1KHC A;  2V26 A;  4KUD K;  1HYO A;  3I56 A;  2DVE A;  1UUE A;  3OYC A;  3OYH A;  3JAM E;  3VS7 A;  2E4H A;  4RTZ A;  1I5O B;  2K7A A;  2KXD A;  4OMF B;  3PFS A;  1OPK A;  3JCM f;  1NJI C;  4K11 A;  3SDZ A;  1T0J A;  2ENM A;  2EQK A;  1IO6 A;  2PVO B;  3DB3 A;  4M7A E;  1WA7 A;  3HKS A;  1K1Z A;  4JZ4 A;  1ZSZ C;  2EKO A;  2KMT A;  1ABO A;  4N0A C;  3FIF A;  1JU5 C;  2CP3 A;  5CKB A;  2YT6 A;  2K3X A;  3BY7 A;  3I55 T;  3H8Z A;  3WXM B;  4JJB A;  3EGD A;  3DLL A;  3CBM A;  1YHQ T;  2O2O A;  3JB9 F;  2X4J A;  5CQY A;  3UWN A;  3OBY A;  4M7D A;  4EMK C;  2C0O A;  3JCM h;  3FLG A;  4PJO B;  2GGR A;  2JNG A;  2K3B A;  2KYM A;  4BD3 A;  2PUK B;  4IIO A;  1VQ5 A;  1EZZ B;  1QVG S;  3OS1 A;  3CCV A;  1WGS A;  5AYF A;  3VUZ A;  2E5K A;  1NBE B;  1NLP C;  3G71 Q;  4L5G A;  2JZ2 A;  2X4Y A;  4N4H A;  4PJL A;  2QGF B;  1VYU A;  4LD6 A;  3C0C A;  2VAS A;  4HVU A;  2DER A;  4F7U F;  3QWX X;  2KRN A;  3QJ6 A;  3HRT A;  3EH2 A;  1VIF A;  3L1A A;  2ESW A;  4R55 A;  4JUV A;  3CCS T;  3MEA A;  3JCM X;  3ASK A;  2QDL A;  2FEI A;  2CP0 A;  2YWW A;  2NLU A;  2LVM A;  4FYV B;  3I55 A;  2P4R A;  1WHJ A;  2DTH A;  3CBO A;  1BIB A;  4E6R A;  1YHQ A;  5HK0 A;  2DF6 A;  4YTL A;  4C8Q G;  2HL3 A;  3A8M B;  2X35 A;  4E7K A;  4OB2 B;  1UEC A;  1XTD A;  2RM4 A;  1PG5 B;  3CCU T;  3QII A;  3ZL7 C;  5IAY A;  1QVG P;  4FSX A;  4LXC A;  1SSH A;  2E3I A;  4F7U E;  2EQI A;  2JMC A;  1NJI U;  2RPN A;  3TQ7 P;  2D9T A;  1KFZ A;  1ZUY A;  2AZV A;  2EFI A;  2GNC A;  4BE1 A;  5GAN 5;  2DIQ A;  3EGX A;  4ZGD B;  3RMS A;  4RCB A;  2V8J A;  2KRO A;  3RIR A;  3JB9 D;  3MEV A;  1RL2 A;  1IHW A;  3M54 A;  5I2S A;  3CCS A;  3UPU A;  4OGC A;  3NTH A;  1RUW A;  3RKX A;  1WHK A;  5KE2 A;  3E19 A;  4M77 G;  1AEY A;  4OP0 A;  4BDZ A;  4KBM B;  3MO8 A;  2VVK A;  1Q81 R;  5GAN d;  1K73 R;  3OYN A;  5CK9 A;  5I11 A;  1P92 A;  1YIT Q;  1EFN A;  3CCR T;  3CCU A;  1BI2 A;  1TUD A;  2FPD A;  3G6E A;  3L2Z A;  3KBG A;  3BE3 A;  5D6Y A;  1D3B A;  4BUG A;  1WXU A;  2IVW A;  3SHW A;  1KQS S;  2MAM A;  3M0S A;  5EC7 A;  1S72 T;  2PUO B;  2PU9 B;  3BDU A;  2QAZ A;  1S1N A;  1A0N B;  1BCM A;  4GLM A;  2JOY A;  1U1S A;  4GY5 A;  4HKE A;  3RKW A;  1GCQ A;  4Z88 A;  3ZBD A;  2DLP A;  2CP6 A;  2LP5 A;  1H8K A;  1KG1 A;  5AT1 B;  4MDX A;  2HBP A;  5HCK A;  5FU7 C;  1X27 A;  2QYZ A;  2D0N A;  5GAM e;  4EDU A;  1Y57 A;  5FLX E;  4PNO A;  5GAO q;  4PLI A;  1K73 U;  2AZS A;  3S3N A;  4C8Q C;  3G71 T;  4J9F A;  4M7A B;  1M9S A;  1U8R A;  3A8G B;  1BB9 A;  3RDV A;  2L8D A;  4MMK A;  2RK1 A;  4E7S A;  2CUD A;  4L6V 5;  5GAM g;  4DOV A;  3OYE A;  4RTV A;  4Y92 A;  2BZ8 A;  1TWB A;  4JLI A;  1AHJ B;  3CCR A;  3CC2 Q;  4HCB A;  2FYK A;  4C92 G;  2MPX C;  2OTJ Q;  2HBW A;  2HSP A;  1KQS P;  2LQN A;  3MCA B;  1BI0 A;  2QQS A;  4M75 F;  1OU9 A;  1PC0 A;  1S72 A;  2LDM A;  4ZTJ A;  3SB2 A;  3SFM A;  1ZSZ A;  3E2U A;  4N0A A;  1GRI A;  4X34 A;  2GTJ A;  3CEY A;  4C0D C;  2V1R A;  4M77 C;  3WVD B;  2MWP A;  2KK4 A;  2AK5 A;  1UE9 A;  4EMK A;  3I5S A;  2RJE A;  3G71 A;  4F14 A;  3CCE Q;  1ZSG A;  5GMK i;  2E3H A;  2CSQ A;  2QXF A;  3M55 A;  1JXM A;  4FCY A;  3OYJ A;  4OVA A;  3VS0 A;  4RMO A;  2RNA A;  1MMA A;  1PRM C;  2DRK A;  4EMH A;  3M5A A;  2D6F A;  1PCX A;  4MZP A;  1YIJ T;  3L2Q A;  2F2W A;  2CDT A;  5KYY B;  1OYX A;  2OJ2 A;  3PIO A;  1MNE A;  2CZ6 B;  2CP2 A;  4IUV A;  4XTZ A;  1RAF B;  2LC4 A;  3OS2 A;  1QLY A;  2FRW A;  2E10 A;  2RI5 A;  4F7U B;  4XTX A;  4WF2 A;  4X1V A;  4M7D F;  2LCL A;  1KHI A;  2DE0 X;  1PD1 A;  3I56 Q;  1YIT T;  4CC4 B;  2D0Q B;  1T3L A;  3CME T;  2HD0 A;  6AT1 B;  3LGF A;  4QT7 A;  1OPL A;  3CXC A;  3EG9 B;  3VRZ A;  1TS9 A;  3DB4 A;  4PJJ A;  5GAN f;  1G3S A;  4RCC A;  5GAN j;  1XJW B;  1H64 1;  1YWP A;  4FL6 A;  5CO7 A;  1Q7Y C;  4BE0 A;  3VJP A;  4RTX A;  5KYU B;  1E7O A;  2LT1 A;  4C92 C;  1AD5 A;  1YN8 A;  4PJO F;  3MEU A;  1SPK A;  4IUU A;  1QQJ A;  1T3S A;  3OY9 A;  2RO0 A;  2DBM A;  2MIO A;  5GMK e;  4M7D E;  2MMP A;  5J3B A;  1OX9 A;  2D8H A;  2DXT A;  2D8J A;  2YUN A;  4IUR A;  4C0Z A;  1YIJ A;  2D1X A;  3EHQ A;  5KYW B;  2HL5 C;  5IHI A;  2QTX A;  1XNI A;  2R5M A;  1GCP A;  1N9R A;  3BDL A;  5L8R E;  1WNL A;  3O8V A;  1VQ5 Q;  1EIF A;  3FJ5 A;  5IN1 A;  2AKL A;  3JCM d;  2P4T A;  4B9X A;  4CC2 A;  1ACM B;  4M78 G;  4JPB W;  1YIT A;  2LZ6 B;  5IT9 E;  4D8D A;  3CME A;  2O9V A;  4KGZ B;  3CC2 T;  4LE9 A;  4ELZ C;  1JBM A;  1YCS B;  4HCC A;  2RJF A;  1UFF A;  5FRO A;  4CI0 C;  4DEX A;  2FPE A;  4F04 B;  2L0A A;  2HZY A;  2YDL A;  3GPL A;  1SRM A;  1VQP T;  1M30 A;  2OX7 A;  2EYZ A;  4PJN A;  1VQN T;  3RMQ A;  4OMN A;  2VB6 A;  2XI9 A;  4M7D D;  3I55 Q;  2X3X D;  3JSC A;  5J26 A;  2DEQ A;  3G4S T;  1YHQ Q;  3EG1 A;  3HRU A;  3M58 A;  5A0G A;  1U3O A;  3CCE T;  1JJ2 S;  1C1A A;  2YRV A;  3PNW C;  4C8Q A; 
#chains in the Genus database with same CATH homology
 1WDX A;  2YT6 A;  2A36 A;  1WX6 A;  1AWO A;  2CH4 W;  1LCK A;  2OI3 A;  1GL5 A;  4JJB A;  2O88 A;  2KEA A;  1G83 A;  1X2K A;  2GQI A;  2O2O A;  4HVW A;  4ORZ A;  2C0O A;  2W0Z A;  2GGR A;  2K3B A;  2KYM A;  3M0Q A;  4JJD A;  3RBB B;  3M0T A;  4IIO A;  1AWJ A;  1U06 A;  3NMZ C;  1M8M A;  2E5K A;  3UA7 A;  1NLP C;  1SHG A;  4J9D A;  1RLQ C;  1BU1 A;  1H3H A;  2KRM A;  1VYU A;  2DJQ A;  4OMM A;  3C0C A;  1E6G A;  1KJW A;  2L3Q A;  1PNJ A;  2CRE A;  2EGA A;  4HVU A;  2DL5 A;  2ED0 A;  4Z89 A;  4ZNX A;  4CC3 A;  4GBQ A;  1WIE A;  3QWX X;  4WCI A;  2KRN A;  3REA B;  2LJ1 A;  2ESW A;  1OV3 A;  1Z9Z A;  2BZY A;  3M0U A;  2K79 A;  2RQT A;  2QDL A;  4RTU A;  5GJV B;  4JZ3 A;  4EIK A;  1VYT A;  2FEI A;  1KSW A;  2RQU A;  2LJ0 A;  4DEY A;  1M3A A;  1X69 A;  5L23 A;  1E6H A;  2P4R A;  1YNZ A;  1PRL C;  4OMQ A;  2FO0 A;  1H92 A;  3EG2 A;  4RTW A;  4E6R A;  2RF0 A;  1G2B A;  4J9I A;  2DF6 A;  4J9H A;  2K2M A;  1NLO C;  1UEC A;  2VKN A;  1QKW A;  1TG0 A;  3NGP A;  3ZL7 C;  3PE0 A;  1M27 C;  3H0F A;  3REB B;  1SSH A;  2EQI A;  2HCK A;  3GBQ A;  1UDL A;  3EHR A;  2ABL A;  2DVJ A;  2JMC A;  3O5Z A;  4HCK A;  2HEQ A;  3U23 A;  3PVL A;  1CSK A;  2JTE A;  3NPF A;  3SEM A;  1BBZ A;  2J6O A;  1ZLM A;  2RPN A;  1T0H A;  1JEG A;  3VS6 A;  1KFZ A;  2ECZ A;  1ZUY A;  2AZV A;  2LX7 A;  4A63 B;  2GNC A;  1AZG B;  1X2Q A;  2EPD A;  2PZ1 A;  2AKK A;  2KRO A;  5FWC A;  1NYF A;  3LH5 A;  4RUG A;  1ZUK A;  3UA6 A;  3JV3 A;  2HDA A;  1WXT A;  1WLP B;  2PTK A;  1RUW A;  1FYN A;  2LJ3 A;  1GBQ A;  4RTT A;  1AEY A;  3UAT A;  2DIL A;  3I5R A;  1W70 A;  1Z9Q A;  2C0I A;  2J6F A;  2YUO A;  2VVK A;  1FMK A;  2FRY A;  2I0N A;  5I11 A;  1AVZ C;  5IH2 A;  2LCS A;  1XOV A;  1EFN A;  1PWT A;  2VWF A;  3M0P A;  2MOX A;  2DL7 A;  1TUD A;  2KE9 A;  4OMP A;  2FPD A;  1X43 A;  1AOJ A;  4F17 A;  1UHF A;  1WXU A;  3SHW A;  2M0Y A;  1K9A A;  3VRY A;  2EKH A;  3M0S A;  5EC7 A;  1ZUU A;  2C0T A;  5FWB A;  2RQR A;  3H0I A;  5IXF A;  1S1N A;  1J3T A;  4GLM A;  2X3W D;  4AFS C;  1A0N B;  2YUP A;  1GFD A;  2JS0 A;  1ABQ A;  1VA7 A;  1GCQ A;  1ZX6 A;  4Z88 A;  4OML A;  2FPF A;  2DLP A;  2LP5 A;  1H8K A;  2J06 A;  4R0K A;  2EYX A;  5HCK A;  1X27 A;  1K0S A;  3I9Q A;  2D0N A;  2L3P A;  1Y57 A;  3QWY A;  2J7I A;  1JO8 A;  2EW3 A;  1M3B A;  2K6D A;  2A28 A;  2AZS A;  1SRL A;  5I22 A;  2H8H A;  4J9F A;  1N5Z A;  1BB9 A;  1UJY A;  4J9G A;  2JMA A;  2JS2 A;  2B86 A;  2PNI A;  1UGV A;  2RN8 A;  2EBP A;  2KT8 A;  2RMO A;  2MCN A;  2CUD A;  2DL4 A;  4RTV A;  4HXJ A;  4Y92 A;  2KBT A;  2BZ8 A;  2DMO A;  4AFZ C;  5IHK A;  1HSQ A;  4HVV A;  2KYB A;  2EYW A;  2J6K A;  2DNU A;  1AWW A;  2HBW A;  2HSP A;  4AG1 C;  2FG0 A;  5GJW B;  2LQN A;  1B3Q A;  2SEM A;  1I1J A;  3EG0 A;  2O31 A;  1GCQ C;  1UTI A;  2SRC A;  2G6F X;  1I07 A;  1I0C A;  1GRI A;  2DRM A;  2ED1 A;  1WXB A;  2GTJ A;  1NM7 A;  2NUZ A;  1KIK A;  2IIM A;  1MV3 A;  2V1R A;  1YWO A;  2JW4 A;  5ECA A;  3H41 A;  2EVR A;  1HD3 A;  1X6G A;  1PKS A;  3ULR B;  1QWE A;  5FW9 A;  1M3C A;  2AK5 A;  1UE9 A;  1VYV A;  1PHT A;  3I5S A;  1Y0M A;  3EG3 A;  1QWF A;  4F14 A;  2L3S A;  1ZSG A;  1UJ0 A;  2W10 A;  1JQQ A;  2CSQ A;  2KR3 A;  3PVQ A;  1NEG A;  1JXM A;  3KFV A;  3TSW A;  1NYG A;  1MV0 B;  2DBK A;  3VS0 A;  1CKB A;  2RNA A;  3VS5 A;  1PRM C;  2DRK A;  4CC7 A;  1QCF A;  1NG2 A;  3CQT A;  4LUD A;  2CT4 A;  2XMF A;  3NHN A;  3EGU A;  4ESR A;  1X6B A;  1K0X A;  2F2X A;  2F2W A;  2CDT A;  2OJ2 A;  3UF4 A;  1QLY A;  2BZX A;  1V1C A;  2FRW A;  3I35 A;  1WFW A;  4M4Z A;  2ROL A;  1JXO A;  4X1V A;  2DA9 A;  2EGE A;  1YP5 A;  2DE0 X;  1MUZ A;  2JM9 A;  4CC4 B;  1RI9 A;  1T3L A;  2LQW A;  1U5S A;  2DYB A;  2J05 A;  3VS1 A;  2KXC A;  1W1F A;  3VS4 A;  1UG1 A;  4RTY A;  4J9B A;  1AWX A;  1HJD A;  4QT7 A;  2YSQ A;  1OPL A;  3VRZ A;  2KT1 A;  1K4U S;  2DL3 A;  4AG2 C;  1W6X A;  3VS3 A;  1OEB A;  1YWP A;  3TVT A;  1CKA A;  4KRT A;  4F16 A;  2DL8 A;  1SHF A;  4RTX A;  1E7O A;  1AD5 A;  1YN8 A;  4FSS A;  3TSZ A;  5IXB A;  1SPK A;  4Z8A A;  2CH4 A;  1T3S A;  2DM1 A;  2EGC A;  4D8K A;  4JJC A;  3VS2 A;  2DBM A;  4LN2 A;  1K76 A;  2MIO A;  2V1Q A;  1ARK A;  2LMJ A;  1OOT A;  2D8H A;  2F2V A;  2D8J A;  1TUC A;  2RQV A;  2ROT A;  1GFC A;  1BK2 A;  2YUN A;  3M0R A;  2D1X A;  3EHQ A;  1WYX A;  4AFU C;  5IHI A;  3H0H A;  1WI7 A;  1GCP A;  2RQW A;  3THK A;  3FJ5 A;  2AKL A;  1SEM A;  3RNJ A;  2LNH B;  4CC2 A;  4JPB W;  1AZE A;  2LZ6 B;  2KNB B;  5IHN A;  4D8D A;  2KGT A;  1GBR A;  1RLP C;  2JXB A;  2O9V A;  2JT4 A;  1B07 A;  4LE9 A;  2CUB A;  4OMO A;  2BTT A;  2O9S A;  1YCS B;  4IIM A;  2A37 A;  1UFF A;  2CSI A;  4DEX A;  2L2P A;  4J9E A;  2FPE A;  2OAW A;  2EYY A;  3R6N A;  2L0A A;  3A98 A;  2CT3 A;  2YDL A;  2GTO A;  2NWM A;  2YUQ A;  2K9G A;  1SRM A;  2DX1 A;  1M30 A;  1UUE A;  4J9C A;  2EYZ A;  2JM8 A;  1ZBJ A;  1NEB A;  3VS7 A;  4RTZ A;  2K7A A;  2KXD A;  4OMN A;  1OPK A;  4K11 A;  2A08 A;  1T0J A;  1UHC A;  2X3X D;  2ENM A;  1IO6 A;  2GBQ A;  2KRS A;  3EG1 A;  4LNP A;  1WA7 A;  1QKX A;  1K1Z A;  1U3O A;  2M51 A;  4AFQ C;  4LUE A;  1PKT A;  4JZ4 A;  3IQL A;  1ABO A;  1JU5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...