1NEBA

Sh3 domain from human nebulin, nmr, minimized average structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
b'TAGKIFRAMYDYMAADADEVSFKDGDAIINVQAIDEGWMYGTVQRTGRTGMLPANYVEAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEBULIN
publication title SH3 in muscles: solution structure of the SH3 domain from nebulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 4
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1997-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nebA00
1A0NB 1K76A 2YUQA 2GBQA 2RQWA 2JTEA 3I5SA 1RI9A 2SEMA 2FG0A 1YN8A 2EYWA 3VS2A 1K0SA 2CDTA 4RTWA 3REAB 2CREA 2KEAA 1E6GA 2RQUA 2LZ6B 1NEBA 4HVUA 2RMOA 3ULRB 3M0SA 2FO0A 1S1NA 2RQTA 2EYZA 4K11A 1YP5A 1VYTA 1UE9A 1ZUKA 4HCKA 2DBMA 2D8HA 2YT6A 2L3PA 4F17A 2A37A 1OOTA 2M51A 2ENMA 1ZBJA 1NYFA 2KXCA 1AOJA 1RUWA 4DEYA 1U3OA 1W70A 2FEIA 2KBTA 3VS0A 3VS3A 2J05A 4AG2C 4ESRA 1UJYA 1X6GA 4X1VA 1VA7A 1GBQA 2DF6A 2DL7A 4JPBW 1GCQA 1SHGA 2PNIA 4F16A 2DL8A 1MUZA 1QCFA 3JV3A 3NHNA 1WI7A 2DVJA 1VYUA 1KJWA 2LQNA 1T0HA 2YUNA 2IIMA 1E6HA 4RTVA 1WX6A 2J7IA 4JZ4A 2DL5A 2YSQA 2BZ8A 3VS6A 3H0FA 2EBPA 4AG1C 5FWBA 1ZUUA 5IXBA 1JU5C 2EVRA 2DBKA 2EPDA 3PVLA 2CH4W 2O31A 1QWEA 2DX1A 1U06A 2O9VA 1UHCA 4WCIA 1NEGA 2C0TA 3LH5A 1TUDA 4LN2A 2A08A 1PNJA 2CSIA 2H8HA 4LUEA 2DL4A 1KIKA 2AZSA 3GBQA 2K6DA 2M0YA 3TVTA 1PRLC 1AEYA 3UA7A 1HD3A 3I9QA 1AD5A 2LX7A 4M4ZA 1H92A 3QWXX 3SHWA 5GJWB 3I35A 4J9HA 3EHQA 4ORZA 2FRYA 2KRMA 2EGEA 2X3XD 3H0IA 2D0NA 4JJBA 4OMNA 2G6FX 3UATA 1X43A 1X69A 4E6RA 2KRSA 2MOXA 1WLPB 5HCKA 5IH2A 3A98A 1K9AA 1M3AA 2JMAA 2RF0A 1Z9ZA 3NPFA 2KR3A 2L2PA 3TSWA 4GLMA 1YNZA 1AWWA 2KGTA 2KXDA 1RLPC 1ARKA 5IHNA 1SPKA 2LQWA 4J9BA 2L3QA 5ECAA 1BB9A 4GBQA 2OJ2A 5I11A 1SRMA 1K0XA 1UGVA 3H0HA 3EGUA 1TG0A 3M0PA 4OMOA 1FMKA 2KYBA 1Y0MA 1M3CA 2NUZA 2K79A 1YWOA 3TSZA 1ABOA 4CC7A 1AWXA 4OMMA 5I22A 4JJCA 2OAWA 4Z88A 2DYBA 2YUPA 2EYXA 2YDLA 3M0RA 4OMQA 2ED1A 2D1XA 2EW3A 2AK5A 2RQRA 1IO6A 1T0JA 1WFWA 2K7AA 4AFSC 1N5ZA 1WXUA 1Z9QA 1ZUYA 1K1ZA 2W0ZA 2V1RA 3VS5A 3EG1A 1Y57A 3H41A 1TUCA 2VVKA 1PWTA 4RTXA 2DRKA 3UA6A 1BBZA 2CT4A 3UF4A 1I07A 1UUEA 1NLOC 4IIOA 4RTTA 1V1CA 2JW4A 3EHRA 2ED0A 4DEXA 1YCSB 4AFQC 1ABQA 1T3LA 1PKSA 1SEMA 3R6NA 1M3BA 5IHIA 3REBB 3VS7A 4J9CA 1JXOA 1GCPA 4HVWA 1GFCA 3VRYA 1AZEA 1FYNA 2DNUA 4Y92A 3VS4A 1H8KA 2K3BA 1UDLA 1X6BA 2GTOA 2FPEA 2A28A 1KSWA 2KNBB 1OEBA 4QT7A 1ZX6A 1JO8A 1U5SA 2HBWA 3EG2A 2KT8A 1X2KA 3ZL7C 1W6XA 2D8JA 3VRZA 1PHTA 4Z89A 2RN8A 1AZGB 1GRIA 4IIMA 2QDLA 1NYGA 4RTUA 3U23A 1OPKA 3KFVA 4LNPA 1W1FA 1AWOA 3RNJA 1NM7A 1GFDA 1SHFA 4LE9A 2FPDA 4HXJA 4AFUC 1ZLMA 1UG1A 1OV3A 4A63B 1UJ0A 2JM9A 4RTYA 2ESWA 2HEQA 2LP5A 2JXBA 2CUDA 2EYYA 1X27A 3PE0A 3IQLA 1E7OA 2O88A 4CC3A 2LCSA 2EQIA 2RQVA 1OPLA 1LCKA 4J9GA 2XMFA 2MCNA 2GQIA 1KFZA 3EG3A 2EGAA 2ROTA 2P4RA 2ECZA 1UTIA 1QKXA 2ROLA 3C0CA 1YWPA 4JJDA 1UHFA 1AVZC 1H3HA 5IXFA 4CC2A 1J3TA 1WYXA 2DRMA 4ZNXA 3SEMA 5EC7A 2BTTA 1ZSGA 2JMCA 2C0OA 2CH4A 4J9IA 1B3QA 1WXBA 2F2VA 1HJDA 2PTKA 3M0QA 2K2MA 1JXMA 4D8KA 2DLPA 2EGCA 2X3WD 2FRWA 1X2QA 1NLPC 1HSQA 1K4US 4R0KA 1RLQC 2LJ1A 2HDAA 2CSQA 2O2OA 4CC4B 5FWCA 1I0CA 2NWMA 2CUBA 2BZXA 2DL3A 3EG0A 1JQQA 1MV3A 2DE0X 4J9EA 1B07A 2F2XA 1I1JA 2SRCA 4F14A 1WDXA 1G83A 1CKBA 1WXTA 2KE9A 4J9DA 2RNAA 2C0IA 2L3SA 5GJVB 3RBBB 1SSHA 2AKKA 4J9FA 3O5ZA 2JM8A 3THKA 1QLYA 2J6OA 1WIEA 1M30A 2A36A 3NMZC 1QKWA 3M0UA 2JS0A 2DM1A 2BZYA 2GTJA 1PRMC 1AWJA 4EIKA 2LJ0A 1SRLA 2LNHB 2OI3A 1BK2A 1T3SA 2KROA 1UFFA 2I0NA 1NG2A 2KRNA 3I5RA 2ABLA 2AZVA 1GL5A 2PZ1A 4OMPA 2DILA 2B86A 2J06A 1M27C 2DMOA 4D8DA 2GGRA 1GBRA 1PKTA 3CQTA 1JEGA 1BU1A 2LMJA 2KYMA 2KT1A 3NGPA 2J6KA 4JZ3A 2E5KA 2FPFA 5IHKA 4HVVA 4FSSA 1M8MA 2L0AA 5FW9A 2W10A 1VYVA 2YUOA 1EFNA 4RTZA 1G2BA 1CSKA 2HCKA 2MIOA 2DA9A 2VKNA 4Z8AA 1UECA 3FJ5A 1QWFA 2JS2A 2JT4A 1GCQC 2F2WA 1MV0B 4AFZC 2K9GA 2J6FA 2RPNA 2DJQA 4LUDA 1WA7A 2CT3A 2LJ3A 2EKHA 4RUGA 3M0TA 2AKLA 2HSPA 3VS1A 2GNCA 3QWYA 1CKAA 1XOVA 2O9SA 3PVQA 2V1QA 5L23A 4OMLA 2VWFA 4KRTA
chains in the Genus database with same CATH superfamily
1M2OA 1RAEB 4BDYA 3A8LB 1N9SA 4M75G 4P5NA 3CCJT 2JTEA 1G3YA 1YI2A 4RTWA 2CREA 2RQUA 3HKSA 1W2BA 1SSFA 3M0SA 2FO0A 1M90C 3G6EA 1K8AU 4M7DA 1G3WA 4XTWA 3OYAA 1IHVA 1UGPB 2FZCB 2L3PA 4F17A 3CCVA 3SDZA 1NYFA 4DEYA 2P0KA 2DIQA 2COZA 2KBTA 4A53A 2ZZDA 1PD0A 2G3RA 2CYZB 1YJ9A 1W2BP 2BE7D 4KGZB 1GBQA 2DF6A 2ZGWA 4PKCC 1IB8A 1MMGA 4JPBW 1GCQA 1VQ9T 5FU6C 4C0GA 4M77A 4L5GA 2OTLQ 1H641 5FLXE 4O6JA 5FRNA 4F7UB 2K5LA 3G7ZA 3ER0A 3UPUA 4MDXA 4F7UF 2CS7A 4JZ4A 2DL5A 4C5GA 3SFMA 1TUGB 3OBWA 2EBPA 4AG1C 1QVFS 2EVRA 2DBKA 4BI8B 2EPDA 3G4SQ 3RDVA 5CIUA 3CC7T 2CH4W 3OQ5A 2DX1A 3HRUA 3C12A 4F04B 5HK3A 3KXTA 3FRNA 5KCHA 2DFUA 4J7FA 2RA2A 5GAOp 3L42A 1MMDA 1VQPT 3FLGA 1YCYA 2CSIA 2H8HA 4LUEA 1BYMA 2QQAA 2XKOC 2AIRB 3GBQA 2M0YA 3QDRB 2L5QA 1PSFA 3I55Q 3I9QA 2QGFB 4M4ZA 3QWXX 3JB9D 4ORZA 3JAME 2X4YA 3JCMe 3H0IA 4OMNA 3UATA 1QW1A 3FC3A 5GAN7 2MOXA 1BIBA 1BI0A 2CZ6B 3HP9A 1K9AA 1XTDA 4OB3B 2L2PA 2I2LA 4FW1A 4DBQA 3M53A 5GAMe 1YNZA 4QVZA 4PLIA 2QK0A 3I56Q 1AWWA 2XICA 3N5BB 2KXDA 1ARKA 4J9BA 2OTJT 3GIBA 4GBQA 4C92D 3GF5A 1Q7YR 1SRMA 3EH1A 3SWNB 5CKBA 1W4SA 3M0PA 4IKFA 3LLRA 1FMKA 2QYZA 3TSZA 1YWOA 1ABOA 2RI5A 4Z88A 4ZTFA 2D1XA 1IO6A 1T0JA 4PJNA 4C0ZA 5HKCA 1MMNA 1M9SA 3TQ7P 1K1ZA 2V1RA 3EG1A 1TUCA 3CBPA 4EDUA 1QMCA 6AT1B 2DRKA 1K73U 1YJNQ 1BBZA 3UF4A 1KQSS 2DKGA 2RB6A 1I07A 1I5OB 4RTTA 4C0FA 2RI3A 2JTMA 3G71T 3CCLQ 4GY5A 2E65A 1QVFA 4C8QD 5CKDA 4AFQC 3OYBA 1YHQT 5KYUB 1ABQA 1YIJQ 4EMHA 1O75A 2NUPA 1PG5B 1D1CA 2F5TX 5GANh 1IGQA 3MO8A 3CD6A 1HXDA 2GCXA 2LRQA 4QW2A 5FU6B 1JXOA 1IZ6A 1GCPA 1GFCA 5LJ3f 3LWIA 1U8RA 3VRYA 3CCST 3HRTA 3CCQQ 2K3BA 4PFOA 4BD3A 1QVFP 2FZKB 3INZA 1QP3A 4QT7A 1ZX6A 3JCMc 3A1PA 1JO8A 4A54A 5CQYA 3QBYA 3TEEA 1YI2Q 3G6ET 5IN1A 3VRZA 4Z89A 1AZGB 4IIMA 1G8XA 1KK7A 3M5AA 2MAMA 1NYGA 1OPKA 3VUZA 1JJ2A 3PFSA 1G3SA 5D6XA 4AFUC 1ZLMA 1M1FA 3CCVQ 2HKQB 4XU2A 1UJ0A 4PJOB 1YJ9T 2ESWA 4PK4A 4C92C 3ME9A 3IQLA 5CQXA 4PJOF 4QQ6A 1OPLA 1JJ2P 4CI0C 2MCNA 3E9GA 2JNGA 3VV0A 3EG3A 1IXDA 5AYFA 2DXBA 2IPOB 1YWPA 2V8JA 1UHFA 2RJCA 1QCNA 1S72A 1H3HA 2NUPB 1J3TA 4ZNXA 2MK5A 2IVWA 2JMCA 2CH4A 5CO7A 1WXBA 1M90R 2CP0A 1HJDA 4N4HA 3M0QA 2K2MA 2QASA 4HA8A 2ZPFB 1JXMA 3JCMg 1AT1B 2FRWA 5GAN5 1EZZB 4C8QC 1PSEA 3TCJA 1HSQA 2E10A 2ZAEA 4BACA 1K4US 1RLQC 1VQOT 4MZPA 2A7YA 3OYLA 2EQJA 5D6YA 2BZXA 3EG0A 1WZOA 1Q86C 2DE0X 2K5IA 3RKWA 1HK9A 3URGA 5D7UA 1VQ8Q 3X25B 1X75C 4JRQA 4HKEA 4VUBA 4XU1A 5GJVB 2AKKA 4J9FA 4C92A 4BE2A 2J6OA 2MPXC 1KC8R 1M30A 1WHJA 1PC0A 2COYA 2DM1A 2BZYA 2GTJA 1WJSA 4J6WA 4BUGA 4M7AG 1AWJA 5C6SA 4A4GA 2LJ0A 2O4XB 1SRLA 2DEUA 1UFFA 2QA4A 3BE3A 3MP8A 3HPWA 2PZ1A 4IUVA 3ZBDA 2D9TA 3LGFA 5M9OA 2YWWA 2GQVA 5GAOn 1M27C 4Q5WA 4J6XA 1PKTA 4OGEA 1NE8A 2KT1A 4PL6A 5KE2A 1VQLT 5IHKA 2RK2A 4FSSA 1U1SA 2DK3A 2L0AA 3D7SB 3EH2A 2DXCA 4C8QA 2YUOA 3FB9A 3UDCA 1G2BA 3JRZA 3C4SA 1P92A 4FYYB 2VKNA 1AHJB 1C0MA 1WPYA 3JCMV 4UC4A 4JS5A 1K9MR 2JT4A 2XK0A 2F2WA 1FXXA 1MV0B 5AT1B 3X24B 5J3BA 1M2VB 2K9GA 3OS5A 2HNIA 2K3XA 2LJ3A 4JS4A 4RUGA 3HRSA 4C92G 3GNFB 3VS1A 1CKAA 3J80E 3PVQA 2V1QA 1QVGA 2DTOA 1Y96B 1K76A 1VQKT 4BE0A 2LQKA 3I5SA 2SEMA 2FG0A 2EYWA 2LC4A 2M1HA 4NL2A 1OU8A 4ZGEB 3CD6Q 4NOYA 2NYSA 1E6GA 4HVUA 2DXUA 2E6NA 3CBOA 4J6YA 1S1NA 1QVGP 3I55A 4K11A 2RI2A 1VYTA 1R8OB 4TVRA 4HCKA 2DBMA 4OMFB 5GAN2 3C95A 5GANf 4J8OA 3BFMA 2A37A 1WQWA 3M57A 1W2BS 2M51A 4MDWA 1RAAB 1RUWA 2XD0A 4O5VA 1WHMA 2GFAA 2X35A 2R5MA 5LJ5d 5GMKe 4X1VA 2DL7A 2JN0A 2AHJB 3EGDB 1SHGA 2PNIA 1MNDA 5CK9A 2VV5A 4F16A 3I56A 3MPUB 2D0QB 3EG9A 2HZYA 1MGQA 1XJWB 2VXFA 3MHXA 1WI7A 2MMPA 4M78E 3HSBA 4RTVA 1WX6A 1ACMB 2JTFA 1BCOA 2L89A 2YSQA 2BZ8A 4N0AC 3H0FA 4FYXB 5IXBA 2KI7A 2EQKA 3CC2T 3LX7A 3GOXA 2O9VA 1NJIC 2ATCB 1S72Q 2E3IA 2LX9A 3OMGA 3MEWA 2C0TA 3LH5A 1TUDA 1NZ9A 4LN2A 1Q81C 2A08A 3X26B 1I8FA 1PNJA 5GAN8 2VASA 3A8MB 3L2RA 1KIKA 4F7UA 3TVTA 1PRLC 4NL3A 3HL8A 4FSXA 3I35A 3CCEA 4J9HA 1SKUB 4M78B 3BY7A 4M75E 2KRMA 2EGEA 2QQ9A 3L2VA 4PJOD 2DTHA 4J7IA 3ZEHA 5GAN6 2C06A 2KQWA 5J26A 1V76A 4E6RA 2EAYA 2K2VA 2KRSA 4M78F 3GPLA 1WLPB 3KBGA 3L2WA 3A98A 4XTXA 3SWNC 1QCOA 3NTHA 2DERA 2KY9A 5KYXB 1WHKA 3EFOB 3EG9B 2QGGA 4N4IA 2E64A 5A0DA 2HL3A 2F1LA 5KYYA 2JZ2A 1BCMA 2RHXA 5IHNA 4N0AA 2LQWA 3OYGA 1IGUA 3CMEA 1BB9A 3CCUT 2X4WA 2DXTA 1K0XA 1UGVA 4OVAA 4E2FB 2H3JA 2LNVA 2QA4Q 4PJLA 1M3CA 4CC7A 2ZPBB 2CZ7B 2EYQA 3PTAA 1R0CB 3MP6A 1D0ZA 1TS9A 2ED1A 3M4YA 1WFWA 1Q86R 1WXUA 3GNGA 3QKJA 4F7UG 2OTLT 1OYXA 3CXCA 3VS5A 2BE9B 2VVKA 1PWTA 1KQ2A 2RJDA 1FWZA 1UUEA 1NLOC 1TSFA 4HT8A 3OW2A 1VQMT 2JW4A 3CCMQ 1RACB 3OSVA 1YCSB 2XDBA 2VB6A 3G4ST 1LOJA 1T3LA 1MNEA 1OQKA 2EJFA 3QZ5B 3SWNA 1D0XA 3CXCP 1YITA 2E12A 4M7DE 2O01E 3REBB 3VS7A 4JUVA 2VC8A 1WHLA 2M9UA 2LT1A 1AZEA 3VS4A 3JCMh 3OW2P 4FT4A 2FPEA 3NTIA 2X4JA 3EFRA 4M7DG 5KYYB 4PJOC 3SD4A 3I55T 1K73R 3QUIA 4RCCA 2D8JA 1VQ8A 5GAMh 4RTUA 2RM4A 4LNPA 5CR2A 1NM7A 1GFDA 2EJGA 2FPDA 3V8JA 5KYUA 1UGQB 5A2QE 3R6OA 3JCMJ 1KD1C 4A63B 1H3ZA 3A8OB 1JJ2S 2CZ1B 4M77G 2HD0A 1Q86U 2HEQA 2JXBA 5GAMj 2E5QA 1X27A 1DJ7B 4RCBA 1WHGA 4ELYC 3DKMA 2O88A 2LVMA 4E7HA 2LCSA 1VQ7A 3RERA 2P0PA 4J9GA 1LCKA 2EQMA 2XMFA 2EGAA 5GMKl 2QAZA 4C5EA 2ROLA 3C0CA 3GLXA 1AVZC 2HKNA 1KHIA 3WVEB 3M55A 3OYHA 4BI4A 2QEXQ 2LTOA 1ZSGA 1Q82C 3QO3A 2EWNA 3OSSC 2C0OA 4J9IA 1B3QA 2P0QA 3TREA 2PTKA 3M59A 1N27A 1VOMA 2OX7A 4FM4B 3VU3C 2DTIA 2EGCA 3CCRA 3VKIA 5LJ5e 4PJOA 1X2QA 1NLPC 1C1AA 4ZN3A 1B34B 1YJNT 2MF2A 2K5FA 2YLCA 4MMLA 2NWMA 2CUBA 2DL3A 1JQQA 1MV3A 1B07A 2BKDN 3CCLT 3H6ZA 1I1JA 4XQ3A 1TH7A 3HFOA 4KGVB 1YIJT 1G3TA 1CKBA 1WXTA 2KE9A 3S3NA 4J9DA 1SSHA 1VQNA 1U1TA 3CCEQ 3O5ZA 2HQXA 3THKA 1QLYA 1FMWA 3V7SA 3VYHB 1PM3A 2A36A 3M0UA 3CCQT 1B7TA 3EFSA 3RKYA 2Y4YA 3CMAQ 4LDUA 4E7LA 3QJYA 5KYNA 1VQ4A 1T3SA 5HY6A 1NG2A 2ABLA 2AZVA 1YI2T 1GL5A 2HL5C 4RG2A 4FCYA 1NJIR 3OB9A 4ATOA 1RABB 2R58A 4OB1B 3QZ9B 2YRDA 1JEGA 1BU1A 2LMJA 1UB4A 2COWA 3CMEQ 2PUOB 4JZ3A 3CC4A 4HVVA 4PJOG 3CCVT 3ZFJA 1OU9A 4EMGA 1M1GA 4A4KA 2VXEA 4RTZA 4RMOA 3J7AF 2MIOA 3F70A 3WVDB 4Z8AA 4DBFA 1TXQA 1QWFA 2XIDA 2JS2A 4E7IA 5GANe 2QTXA 1WNLA 4M78D 4AFZC 3ASKA 2O4XA 3A5ZB 2J6FA 2DJQA 2CT3A 1LPLA 4MMKA 4XTZA 4LXCA 4JLGA 4A4HA 3M0TA 3L2QA 3BDUA 1BI1A 4OMLA 2P4TA 4ZGJB 3E9FA 1A0NB 3P8DA 2YUQA 1WJQA 4PLLA 2GBQA 1NBEB 1QVGS 4XTVA 3O8VA 1YN8A 1YITQ 2QQRA 3REAB 1R77A 1EX4A 5I2MA 2KEAA 1VQ6A 2LZ6B 1NEBA 5CKHA 3ULRB 3OS2A 2RQTA 2EYZA 1YP5A 3L2ZA 3MJXA 2WSFE 4IUUA 2D8HA 4PFZA 1NJIU 2YT6A 2BUDA 5LJ3d 1M2VA 2ENMA 2M0OA 1VQ5A 3JB9H 2KXCA 1AOJA 2PVOB 5LL6S 5GAMg 4FU6A 1W70A 2FEIA 1Q81U 4AG2C 1UJYA 3JCMf 1X6GA 2F69A 4M7AE 1Y96A 2PVDB 2QI2A 4C0DB 3NFCA 2RJFA 2RHYA 2X51A 3T9NA 1SG5A 4DOWA 5GAOr 1SF9A 2QTVA 4NS5A 2DL8A 3V7CA 1MUZA 3OMCA 2EIFA 2JVVA 4Y28E 2GFUA 3LGLA 3NHNA 4AMCA 5EG2A 4L6V5 1KJWA 2LQNA 2YUNA 5LJ5g 1E6HA 3OYMA 1VQ7Q 2YRCA 1IHWA 3VS6A 2WACA 3NTKA 1JU5C 3CPFA 2K3YA 3X28B 1ZQ1A 2EKOA 1N8RC 4OF1A 2DD5A 3E2UA 3JCMb 2O31A 1U06A 5DY9A 3AHUA 4LDYA 3JB9G 2H3EB 4FW2A 4M78C 4WCIA 2KSSA 4E7ZA 4BDZA 1RAIB 4E7KA 4M7AB 2AT1B 4E47A 3V8KA 1YJWQ 3EGDA 1OI1A 4C92E 1I81A 3CCRQ 4M7AF 3LH0A 1BIAA 3CCMA 1AEYA 3UA7A 1HD3A 2ZPHB 1KD1R 1AD5A 4B9XA 3EHQA 2X3XD 2PVGB 4BB7A 1RAHB 2G6FX 1X43A 1VQ9A 3MEAA 2DPPB 2RK1A 5IH2A 3RKXA 2HBPA 1M3AA 2JMAA 2RF0A 2YXYA 3DLMA 3CD6T 3NPFA 1PD1A 1VQNQ 2DETA 3TSWA 1JRIA 4N4GA 5GMKh 4M75C 4HCBA 2KGTA 1KHCA 2CP6A 5DM7R 1RLPC 2DEQA 1Q82R 2QDYB 2L3QA 1ZHIA 3CC7A 5I11A 4OGCA 3MKDA 4DOVA 1VQ4Q 3LYIA 1F1BB 4BI3A 2RJEA 3JCMW 1Y0MA 1O9SA 4C5IA 2NUZA 5GMKj 2K79A 5IT9E 1Q7YC 2DD4A 2WSCE 5I21A 4M78A 4JRIA 5CAIA 4B6MA 4C8QG 4OMMA 3RMQA 2RHUA 2OAWA 1VQPA 4KH0B 2YUPA 2YDLA 3OYYA 4OMQA 4AT1B 2EW3A 2AK5A 2PUKB 5IAYA 2DZCA 2KDSA 4AFSC 5GAOl 1Z9QA 1ZUYA 3CC4Q 2W0ZA 2E1HA 3EAEA 9ATCB 5KH6A 3UA6A 5CCAA 5KYXA 1NPPA 2CT4A 3EFOA 3CXCS 3FDRA 4IIOA 1KD1U 1V1CA 4B9WA 3EHRA 3UWNA 2DAQA 2ED0A 2CZ0B 4QVDA 3SB2A 5A0LA 2QEXA 3BDLA 1RADB 1PKSA 3OW2S 3R6NA 1M3BA 3E1SA 5IHIA 1S72T 3M58A 4HVWA 4Y91A 2X9HA 4Y92A 2D6FA 1X6BA 2OTJA 2A28A 2KNBB 2KAFA 2YLBA 3EGXA 2Y4XA 4XTYA 1U5SA 2HBWA 3CPWA 1Q82U 2E6ZA 3FJPA 4KUIA 4OB0B 2CP3A 1YBYA 1VQ6Q 2RN8A 1GRIA 1JBMA 2QDLA 4XU0A 1W1FA 1AWOA 1SHFA 1WJRA 4LE9A 4KBMB 4HXJA 3TU4K 2XDDA 1UG1A 2M02A 3META 3JB9I 1D0YA 1OV3A 4V2SA 3QG1A 5FU7B 1VQ5Q 2JM9A 4RTYA 3PT9A 3CPWP 3CMAA 2LP5A 5GANd 2CUDA 4PJJA 4ZN1A 1E7OA 2Y90A 5GMKi 4CC3A 1PCXA 2XDPA 2EQIA 3OYKA 3M54A 2RQVA 1ZBXA 2DVEA 3MEVA 2A3LA 1YHQA 2GQIA 1KFZA 2ROTA 3PGGA 2IG0A 4RG8A 1M1KC 1UTIA 1QKXA 3QYHB 4DBRA 5LJ3j 1Y7XA 2QA4T 4CC2A 3RMSA 4IUPA 2R5AA 2P84A 3MEUA 2RHZA 1ZA2B 5EC7A 3CCSA 2HAXA 5LJ3e 1RAFB 2CP7A 4F7UE 1TWBA 3CCJQ 2NUTB 1HYOA 2ZPEB 4D8KA 2DLPA 4M75B 4QQDA 2KMTA 3PIOA 3M4GA 2LJ1A 1BKBA 3EGXB 4M75F 2O2OA 1D1BA 3M9QA 4CC4B 3CCUQ 2X4XA 1JB0E 2BIVA 3X20B 5KYWA 2LQ8A 3CCMT 2SRCA 4BY6B 1G83A 3QXEB 1I4K1 4IURA 4FYWB 2E41A 3Q1JA 2RNAA 4ZGDB 3RBBB 1ZA1B 2MI6A 3OYJA 1WIEA 2XHCA 2DO3A 4II1A 1RI0A 3NMZC 3S3MA 1QKWA 1OX9A 2JS0A 1VQ9Q 3WXMB 1PRMC 1N9RA 1KC8C 4BE1A 2LNHB 2OI3A 3OYCA 5KE3A 4MZTA 2KROA 1N8RR 3DB3A 1VQMQ 3I5RA 2F5KA 4OMPA 1B34A 2ZPIB 1OZ3A 4A4FA 4ANJA 4JJNK 3OY9A 4EMKC 2B86A 3V7RA 2KK4A 4D8DA 4M77E 2KYMA 4D6WA 3CC7Q 2E5KA 3VYGA 1M8MA 4M7AD 3MP1A 4XAXB 1VQOA 1TOVA 8AT1B 2HCKA 2K57A 4J83A 3FJ5A 3V8LA 1VQPQ 1VUBA 4M7DB 3RESA 2YHTA 3JCMP 1RAGB 1K9MC 3I56T 4LUDA 3OYIA 4ZTJA 4M7DF 5KYWB 1WA7A 5GAN3 4RKUE 5LJ5h 2EKHA 3JCMX 2AKLA 3BW1A 1FMVA 1XOVA 1Q95G 2O9SA 3OA6A 2VUBA 1LNXA 1M4ZA 2VWFA 2QEXT 3CEYA 4KRTA 4QVCA 3M56A 2RQWA 2V8IA 4M77B 4KULA 3P8HA 1RI9A 5LJ5j 2MWOA 4EPCA 1K0SA 3VS2A 1YJWA 1X6OA 3PMTA 2CDTA 3H9NA 4M77F 2RMOA 3VJPA 5GMKm 1N8RU 4EMKA 4C0DC 1UE9A 1ZUKA 2OTJQ 1VQLA 1YFNA 2JUFA 1OOTA 2QQBA 3RR6A 1ZBJA 2L3RA 1U3OA 2FHDA 3KUFA 3HTRA 3VS0A 2NLUA 3VS3A 2J05A 4CRIA 3OYNA 4ESRA 3CCET 1VA7A 2K4YA 2FVUA 1QVPA 1NPRA 5A0GA 5LJ3g 2QG9B 3CMAT 3QHSA 2CKKA 4LDXA 3FIFA 3OYFA 3HHTB 1QCFA 3JV3A 3QSUA 1VIFA 2PQWA 2DVJA 3AT1B 1VYUA 4WTOB 2FL7A 3HFNA 1T0HA 1WHHA 2IIMA 1UGRB 2V8KA 1UGSB 1X01A 2J7IA 4FYVB 3S3OA 4M7AC 3G71Q 4HT9A 1VQKA 4PFPA 4PJOE 2XI9A 5FWBA 1ZUUA 3VUBA 1YHQQ 4JDSA 1C6VX 3CMET 1K8AC 3PVLA 1QWEA 2DYIA 2FB7A 8ATCB 4L59A 3L1AA 1Q81R 1UHCA 4HCZA 2PU9B 4ME7A 5GAN4 1NEGA 4XTUA 3CCSQ 5GANj 2QXFA 4PJMA 3QYGB 2VYTA 1OZ2A 2DL4A 3RUXA 2AZSA 1Q7YU 2K6DA 4EMKB 4PNOA 3G6EQ 2LX7A 1H92A 3SHWA 5GJWB 4WF2A 5J39A 4IUQA 1EIFA 4A4EA 2FRYA 4XU3A 2XU8A 2D0NA 2LCCA 4JJBA 1X69A 5HCKA 4R56A 1I5LA 2LCLA 1MHNA 2EQUA 4C5HA 1YJ9Q 1M1KR 2LT4A 1YITT 1XNIA 1Z9ZA 3MCAB 5CKEA 2KR3A 5DLQE 2DJZA 4GLMA 3QIIA 3J81E 4M7AA 1ZSZC 1SPKA 1LJOA 5ECAA 4LDVA 3CC2A 2OJ2A 2GF7A 2MWPA 3FEOA 3H0HA 3EGUA 1TG0A 4OMOA 2KYBA 3PMIA 4X34A 3A8GB 1KG1A 4M75D 1TTHB 1VQ8T 2ZPGB 1AWXA 5I22A 4JJCA 2DYBA 2EYXA 1XQHA 3M0RA 2RQRA 2K7AA 3JCMQ 4XK8E 1KQSA 1N5ZA 3OBYA 4HCCA 1D3BA 4J5YA 2QQSA 1RL2A 1Y57A 3H41A 3JB9J 4RTXA 1VQOQ 2RD1A 3JSCA 4YTLA 5GAMf 1BI2A 1VQ7T 3P8BB 4DEXA 2Z0WA 4JLIA 5D6WA 4KUDK 3OYEA 2JOYA 4DQ2A 1V29B 1KQSP 2EFIA 1SEMA 3CCJA 4J9CA 1UEBA 4R55A 2XG8D 4OP0A 3A8HB 4FIBA 3LW5E 1M1KU 1FYNA 2DNUA 2LDMA 1H8KA 1UDLA 1ZSZA 2GTOA 4QKUA 1KSWA 2ZCFB 1YJWT 3CCUA 1OEBA 1D1AA 1N6AA 5LJ5f 5FU7C 5FROA 5C0MA 3CCRT 3E19A 1OULA 3EG2A 3OS1A 2HSEB 2KT8A 1X2KA 3C94A 3ZL7C 1W6XA 1PHTA 1G5VA 2DIGA 3U23A 3KFVA 3CPWS 1K73C 3RNJA 2V26A 1M90U 2B8AA 2HMAA 2E4HA 1VQLQ 2OTLA 7AT1B 3GP8A 4DBHA 2KVQG 4M7DD 2DZ9A 2JJ9A 3S6WA 1Y71A 2HQHA 2VGNA 5CKFA 2EYYA 3PE0A 1D3BB 3JB9F 1VQNT 4OB2B 3G1JA 1VQMA 3RIRA 1IRXA 2CGHA 3G4SA 3QDFA 2P4RA 3JCMd 2ECZA 1OX8A 4IUTA 4X9CA 1M8VA 4E7JA 1VQ4T 4C8QE 4E7SA 4JJDA 1D09B 5IXFA 5GANg 1BI3A 1WYXA 4JRKA 2DRMA 4M77D 3SEMA 4C92B 3OYDA 5KCOA 2BTTA 1KC8U 3DB4A 3PIPA 2HQEA 1VQKQ 5GAMd 2F2VA 4X9DA 4BY6C 4C92F 3QPHA 3OS0A 2X3WD 3CC4T 2YRVA 4LD9K 1ZSZB 4FT2A 4R0KA 2RHIA 2CP5A 2HDAA 2CSQA 5L8RE 5FWCA 1I0CA 1M5Q1 2RO0A 5FRMA 4JRPA 2OAUA 2E3HA 2RH2A 1KQ1A 4J9EA 2F2XA 1IREB 4Z02A 4F14A 2WSEE 1WDXA 1GXIE 3QJ6A 5HK0A 5DLOA 4FL6A 2MYSA 4C8QB 2C0IA 2L3SA 1FX7A 5GAOm 2JM8A 1K9MU 2FYKA 4C8QF 1WGSA 5CVIA 1R0BG 2VGMA 4LDWA 2NUTA 1QQJA 4M75A 4EIKA 1WQ7A 1LVKA 2EJ9A 1BK2A 2I0NA 1K8AR 2KRNA 5GAOq 3PNWC 3H8ZA 4MZMA 1VIEA 1Y07A 1VQ6T 3UT1A 2DILA 2J06A 4M7DC 1QP2A 2CP2A 4M78G 2DMOA 4KH1B 2GGRA 1GBRA 2R57A 3CQTA 3NGPA 2J6KA 3CC2Q 1MMAA 2FPFA 3L2UA 2M16A 1VQ5T 2L8DA 5FW9A 2W10A 1VYVA 1YJNA 1EFNA 2A0FB 4QQGA 1CSKA 2DA9A 4DA4A 1UECA 3DLLA 5LJ3h 3CCLA 1GCQC 4KGXB 4LD6A 4M77C 3CBMA 1YIJA 3G71A 5I2SA 1TU0B 2RPNA 2FZGB 4GLKA 2HSPA 2GNCA 3QWYA 3LWHA 2E70A 4ELZC 5L23A 4KT0E 3CCQA
chains in the Genus database with same CATH topology
1A0NB 1K76A 2YUQA 2GBQA 2RQWA 2JTEA 3I5SA 1RI9A 2SEMA 2FG0A 1YN8A 2EYWA 3VS2A 1K0SA 2CDTA 4RTWA 3REAB 2CREA 2KEAA 1E6GA 2RQUA 2LZ6B 1NEBA 4HVUA 2RMOA 3ULRB 3M0SA 2FO0A 1S1NA 2RQTA 2EYZA 4K11A 1YP5A 1VYTA 1UE9A 1ZUKA 4HCKA 2DBMA 2D8HA 2YT6A 2L3PA 4F17A 2A37A 1OOTA 2M51A 2ENMA 1ZBJA 1NYFA 2KXCA 1AOJA 1RUWA 4DEYA 1U3OA 1W70A 2FEIA 2KBTA 3VS0A 3VS3A 2J05A 4AG2C 4ESRA 1UJYA 1X6GA 4X1VA 1VA7A 1GBQA 2DF6A 2DL7A 4JPBW 1GCQA 1SHGA 2PNIA 4F16A 2DL8A 1MUZA 1QCFA 3JV3A 3NHNA 1WI7A 2DVJA 1VYUA 1KJWA 2LQNA 1T0HA 2YUNA 2IIMA 1E6HA 4RTVA 1WX6A 2J7IA 4JZ4A 2DL5A 2YSQA 2BZ8A 3VS6A 3H0FA 2EBPA 4AG1C 5FWBA 1ZUUA 5IXBA 1JU5C 2EVRA 2DBKA 2EPDA 3PVLA 2CH4W 2O31A 1QWEA 2DX1A 1U06A 2O9VA 1UHCA 4WCIA 1NEGA 2C0TA 3LH5A 1TUDA 4LN2A 2A08A 1PNJA 2CSIA 2H8HA 4LUEA 2DL4A 1KIKA 2AZSA 3GBQA 2K6DA 2M0YA 3TVTA 1PRLC 1AEYA 3UA7A 1HD3A 3I9QA 1AD5A 2LX7A 4M4ZA 1H92A 3QWXX 3SHWA 5GJWB 3I35A 4J9HA 3EHQA 4ORZA 2FRYA 2KRMA 2EGEA 2X3XD 3H0IA 2D0NA 4JJBA 4OMNA 2G6FX 3UATA 1X43A 1X69A 4E6RA 2KRSA 2MOXA 1WLPB 5HCKA 5IH2A 3A98A 1K9AA 1M3AA 2JMAA 2RF0A 1Z9ZA 3NPFA 2KR3A 2L2PA 3TSWA 4GLMA 1YNZA 1AWWA 2KGTA 2KXDA 1RLPC 1ARKA 5IHNA 1SPKA 2LQWA 4J9BA 2L3QA 5ECAA 1BB9A 4GBQA 2OJ2A 5I11A 1SRMA 1K0XA 1UGVA 3H0HA 3EGUA 1TG0A 3M0PA 4OMOA 1FMKA 2KYBA 1Y0MA 1M3CA 2NUZA 2K79A 1YWOA 3TSZA 1ABOA 4CC7A 1AWXA 4OMMA 5I22A 4JJCA 2OAWA 4Z88A 2DYBA 2YUPA 2EYXA 2YDLA 3M0RA 4OMQA 2ED1A 2D1XA 2EW3A 2AK5A 2RQRA 1IO6A 1T0JA 1WFWA 2K7AA 4AFSC 1N5ZA 1WXUA 1Z9QA 1ZUYA 1K1ZA 2W0ZA 2V1RA 3VS5A 3EG1A 1Y57A 3H41A 1TUCA 2VVKA 1PWTA 4RTXA 2DRKA 3UA6A 1BBZA 2CT4A 3UF4A 1I07A 1UUEA 1NLOC 4IIOA 4RTTA 1V1CA 2JW4A 3EHRA 2ED0A 4DEXA 1YCSB 4AFQC 1ABQA 1T3LA 1PKSA 1SEMA 3R6NA 1M3BA 5IHIA 3REBB 3VS7A 4J9CA 1JXOA 1GCPA 4HVWA 1GFCA 3VRYA 1AZEA 1FYNA 2DNUA 4Y92A 3VS4A 1H8KA 2K3BA 1UDLA 1X6BA 2GTOA 2FPEA 2A28A 1KSWA 2KNBB 1OEBA 4QT7A 1ZX6A 1JO8A 1U5SA 2HBWA 3EG2A 2KT8A 1X2KA 3ZL7C 1W6XA 2D8JA 3VRZA 1PHTA 4Z89A 2RN8A 1AZGB 1GRIA 4IIMA 2QDLA 1NYGA 4RTUA 3U23A 1OPKA 3KFVA 4LNPA 1W1FA 1AWOA 3RNJA 1NM7A 1GFDA 1SHFA 4LE9A 2FPDA 4HXJA 4AFUC 1ZLMA 1UG1A 1OV3A 4A63B 1UJ0A 2JM9A 4RTYA 2ESWA 2HEQA 2LP5A 2JXBA 2CUDA 2EYYA 1X27A 3PE0A 3IQLA 1E7OA 2O88A 4CC3A 2LCSA 2EQIA 2RQVA 1OPLA 1LCKA 4J9GA 2XMFA 2MCNA 2GQIA 1KFZA 3EG3A 2EGAA 2ROTA 2P4RA 2ECZA 1UTIA 1QKXA 2ROLA 3C0CA 1YWPA 4JJDA 1UHFA 1AVZC 1H3HA 5IXFA 4CC2A 1J3TA 1WYXA 2DRMA 4ZNXA 3SEMA 5EC7A 2BTTA 1ZSGA 2JMCA 2C0OA 2CH4A 4J9IA 1B3QA 1WXBA 2F2VA 1HJDA 2PTKA 3M0QA 2K2MA 1JXMA 4D8KA 2DLPA 2EGCA 2X3WD 2FRWA 1X2QA 1NLPC 1HSQA 1K4US 4R0KA 1RLQC 2LJ1A 2HDAA 2CSQA 2O2OA 4CC4B 5FWCA 1I0CA 2NWMA 2CUBA 2BZXA 2DL3A 3EG0A 1JQQA 1MV3A 2DE0X 4J9EA 1B07A 2F2XA 1I1JA 2SRCA 4F14A 1WDXA 1G83A 1CKBA 1WXTA 2KE9A 4J9DA 2RNAA 2C0IA 2L3SA 5GJVB 3RBBB 1SSHA 2AKKA 4J9FA 3O5ZA 2JM8A 3THKA 1QLYA 2J6OA 1WIEA 1M30A 2A36A 3NMZC 1QKWA 3M0UA 2JS0A 2DM1A 2BZYA 2GTJA 1PRMC 1AWJA 4EIKA 2LJ0A 1SRLA 2LNHB 2OI3A 1BK2A 1T3SA 2KROA 1UFFA 2I0NA 1NG2A 2KRNA 3I5RA 2ABLA 2AZVA 1GL5A 2PZ1A 4OMPA 2DILA 2B86A 2J06A 1M27C 2DMOA 4D8DA 2GGRA 1GBRA 1PKTA 3CQTA 1JEGA 1BU1A 2LMJA 2KYMA 2KT1A 3NGPA 2J6KA 4JZ3A 2E5KA 2FPFA 5IHKA 4HVVA 4FSSA 1M8MA 2L0AA 5FW9A 2W10A 1VYVA 2YUOA 1EFNA 4RTZA 1G2BA 1CSKA 2HCKA 2MIOA 2DA9A 2VKNA 4Z8AA 1UECA 3FJ5A 1QWFA 2JS2A 2JT4A 1GCQC 2F2WA 1MV0B 4AFZC 2K9GA 2J6FA 2RPNA 2DJQA 4LUDA 1WA7A 2CT3A 2LJ3A 2EKHA 4RUGA 3M0TA 2AKLA 2HSPA 3VS1A 2GNCA 3QWYA 1CKAA 1XOVA 2O9SA 3PVQA 2V1QA 5L23A 4OMLA 2VWFA 4KRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0N B;  1K76 A;  2YUQ A;  2GBQ A;  2RQW A;  2JTE A;  3I5S A;  1RI9 A;  2SEM A;  2FG0 A;  1YN8 A;  2EYW A;  3VS2 A;  1K0S A;  2CDT A;  4RTW A;  3REA B;  2CRE A;  2KEA A;  1E6G A;  2RQU A;  2LZ6 B;  1NEB A;  4HVU A;  2RMO A;  3ULR B;  3M0S A;  2FO0 A;  1S1N A;  2RQT A;  2EYZ A;  4K11 A;  1YP5 A;  1VYT A;  1UE9 A;  1ZUK A;  4HCK A;  2DBM A;  2D8H A;  2YT6 A;  2L3P A;  4F17 A;  2A37 A;  1OOT A;  2M51 A;  2ENM A;  1ZBJ A;  1NYF A;  2KXC A;  1AOJ A;  1RUW A;  4DEY A;  1U3O A;  1W70 A;  2FEI A;  2KBT A;  3VS0 A;  3VS3 A;  2J05 A;  4AG2 C;  4ESR A;  1UJY A;  1X6G A;  4X1V A;  1VA7 A;  1GBQ A;  2DF6 A;  2DL7 A;  4JPB W;  1GCQ A;  1SHG A;  2PNI A;  4F16 A;  2DL8 A;  1MUZ A;  1QCF A;  3JV3 A;  3NHN A;  1WI7 A;  2DVJ A;  1VYU A;  1KJW A;  2LQN A;  1T0H A;  2YUN A;  2IIM A;  1E6H A;  4RTV A;  1WX6 A;  2J7I A;  4JZ4 A;  2DL5 A;  2YSQ A;  2BZ8 A;  3VS6 A;  3H0F A;  2EBP A;  4AG1 C;  5FWB A;  1ZUU A;  5IXB A;  1JU5 C;  2EVR A;  2DBK A;  2EPD A;  3PVL A;  2CH4 W;  2O31 A;  1QWE A;  2DX1 A;  1U06 A;  2O9V A;  1UHC A;  4WCI A;  1NEG A;  2C0T A;  3LH5 A;  1TUD A;  4LN2 A;  2A08 A;  1PNJ A;  2CSI A;  2H8H A;  4LUE A;  2DL4 A;  1KIK A;  2AZS A;  3GBQ A;  2K6D A;  2M0Y A;  3TVT A;  1PRL C;  1AEY A;  3UA7 A;  1HD3 A;  3I9Q A;  1AD5 A;  2LX7 A;  4M4Z A;  1H92 A;  3QWX X;  3SHW A;  5GJW B;  3I35 A;  4J9H A;  3EHQ A;  4ORZ A;  2FRY A;  2KRM A;  2EGE A;  2X3X D;  3H0I A;  2D0N A;  4JJB A;  4OMN A;  2G6F X;  3UAT A;  1X43 A;  1X69 A;  4E6R A;  2KRS A;  2MOX A;  1WLP B;  5HCK A;  5IH2 A;  3A98 A;  1K9A A;  1M3A A;  2JMA A;  2RF0 A;  1Z9Z A;  3NPF A;  2KR3 A;  2L2P A;  3TSW A;  4GLM A;  1YNZ A;  1AWW A;  2KGT A;  2KXD A;  1RLP C;  1ARK A;  5IHN A;  1SPK A;  2LQW A;  4J9B A;  2L3Q A;  5ECA A;  1BB9 A;  4GBQ A;  2OJ2 A;  5I11 A;  1SRM A;  1K0X A;  1UGV A;  3H0H A;  3EGU A;  1TG0 A;  3M0P A;  4OMO A;  1FMK A;  2KYB A;  1Y0M A;  1M3C A;  2NUZ A;  2K79 A;  1YWO A;  3TSZ A;  1ABO A;  4CC7 A;  1AWX A;  4OMM A;  5I22 A;  4JJC A;  2OAW A;  4Z88 A;  2DYB A;  2YUP A;  2EYX A;  2YDL A;  3M0R A;  4OMQ A;  2ED1 A;  2D1X A;  2EW3 A;  2AK5 A;  2RQR A;  1IO6 A;  1T0J A;  1WFW A;  2K7A A;  4AFS C;  1N5Z A;  1WXU A;  1Z9Q A;  1ZUY A;  1K1Z A;  2W0Z A;  2V1R A;  3VS5 A;  3EG1 A;  1Y57 A;  3H41 A;  1TUC A;  2VVK A;  1PWT A;  4RTX A;  2DRK A;  3UA6 A;  1BBZ A;  2CT4 A;  3UF4 A;  1I07 A;  1UUE A;  1NLO C;  4IIO A;  4RTT A;  1V1C A;  2JW4 A;  3EHR A;  2ED0 A;  4DEX A;  1YCS B;  4AFQ C;  1ABQ A;  1T3L A;  1PKS A;  1SEM A;  3R6N A;  1M3B A;  5IHI A;  3REB B;  3VS7 A;  4J9C A;  1JXO A;  1GCP A;  4HVW A;  1GFC A;  3VRY A;  1AZE A;  1FYN A;  2DNU A;  4Y92 A;  3VS4 A;  1H8K A;  2K3B A;  1UDL A;  1X6B A;  2GTO A;  2FPE A;  2A28 A;  1KSW A;  2KNB B;  1OEB A;  4QT7 A;  1ZX6 A;  1JO8 A;  1U5S A;  2HBW A;  3EG2 A;  2KT8 A;  1X2K A;  3ZL7 C;  1W6X A;  2D8J A;  3VRZ A;  1PHT A;  4Z89 A;  2RN8 A;  1AZG B;  1GRI A;  4IIM A;  2QDL A;  1NYG A;  4RTU A;  3U23 A;  1OPK A;  3KFV A;  4LNP A;  1W1F A;  1AWO A;  3RNJ A;  1NM7 A;  1GFD A;  1SHF A;  4LE9 A;  2FPD A;  4HXJ A;  4AFU C;  1ZLM A;  1UG1 A;  1OV3 A;  4A63 B;  1UJ0 A;  2JM9 A;  4RTY A;  2ESW A;  2HEQ A;  2LP5 A;  2JXB A;  2CUD A;  2EYY A;  1X27 A;  3PE0 A;  3IQL A;  1E7O A;  2O88 A;  4CC3 A;  2LCS A;  2EQI A;  2RQV A;  1OPL A;  1LCK A;  4J9G A;  2XMF A;  2MCN A;  2GQI A;  1KFZ A;  3EG3 A;  2EGA A;  2ROT A;  2P4R A;  2ECZ A;  1UTI A;  1QKX A;  2ROL A;  3C0C A;  1YWP A;  4JJD A;  1UHF A;  1AVZ C;  1H3H A;  5IXF A;  4CC2 A;  1J3T A;  1WYX A;  2DRM A;  4ZNX A;  3SEM A;  5EC7 A;  2BTT A;  1ZSG A;  2JMC A;  2C0O A;  2CH4 A;  4J9I A;  1B3Q A;  1WXB A;  2F2V A;  1HJD A;  2PTK A;  3M0Q A;  2K2M A;  1JXM A;  4D8K A;  2DLP A;  2EGC A;  2X3W D;  2FRW A;  1X2Q A;  1NLP C;  1HSQ A;  1K4U S;  4R0K A;  1RLQ C;  2LJ1 A;  2HDA A;  2CSQ A;  2O2O A;  4CC4 B;  5FWC A;  1I0C A;  2NWM A;  2CUB A;  2BZX A;  2DL3 A;  3EG0 A;  1JQQ A;  1MV3 A;  2DE0 X;  4J9E A;  1B07 A;  2F2X A;  1I1J A;  2SRC A;  4F14 A;  1WDX A;  1G83 A;  1CKB A;  1WXT A;  2KE9 A;  4J9D A;  2RNA A;  2C0I A;  2L3S A;  5GJV B;  3RBB B;  1SSH A;  2AKK A;  4J9F A;  3O5Z A;  2JM8 A;  3THK A;  1QLY A;  2J6O A;  1WIE A;  1M30 A;  2A36 A;  3NMZ C;  1QKW A;  3M0U A;  2JS0 A;  2DM1 A;  2BZY A;  2GTJ A;  1PRM C;  1AWJ A;  4EIK A;  2LJ0 A;  1SRL A;  2LNH B;  2OI3 A;  1BK2 A;  1T3S A;  2KRO A;  1UFF A;  2I0N A;  1NG2 A;  2KRN A;  3I5R A;  2ABL A;  2AZV A;  1GL5 A;  2PZ1 A;  4OMP A;  2DIL A;  2B86 A;  2J06 A;  1M27 C;  2DMO A;  4D8D A;  2GGR A;  1GBR A;  1PKT A;  3CQT A;  1JEG A;  1BU1 A;  2LMJ A;  2KYM A;  2KT1 A;  3NGP A;  2J6K A;  4JZ3 A;  2E5K A;  2FPF A;  5IHK A;  4HVV A;  4FSS A;  1M8M A;  2L0A A;  5FW9 A;  2W10 A;  1VYV A;  2YUO A;  1EFN A;  4RTZ A;  1G2B A;  1CSK A;  2HCK A;  2MIO A;  2DA9 A;  2VKN A;  4Z8A A;  1UEC A;  3FJ5 A;  1QWF A;  2JS2 A;  2JT4 A;  1GCQ C;  2F2W A;  1MV0 B;  4AFZ C;  2K9G A;  2J6F A;  2RPN A;  2DJQ A;  4LUD A;  1WA7 A;  2CT3 A;  2LJ3 A;  2EKH A;  4RUG A;  3M0T A;  2AKL A;  2HSP A;  3VS1 A;  2GNC A;  3QWY A;  1CKA A;  1XOV A;  2O9S A;  3PVQ A;  2V1Q A;  5L23 A;  4OML A;  2VWF A;  4KRT A; 
#chains in the Genus database with same CATH topology
 1M2O A;  1RAE B;  4BDY A;  3A8L B;  1N9S A;  4M75 G;  4P5N A;  3CCJ T;  2JTE A;  1G3Y A;  1YI2 A;  4RTW A;  2CRE A;  2RQU A;  3HKS A;  1W2B A;  1SSF A;  3M0S A;  2FO0 A;  1M90 C;  3G6E A;  1K8A U;  4M7D A;  1G3W A;  4XTW A;  3OYA A;  1IHV A;  1UGP B;  2FZC B;  2L3P A;  4F17 A;  3CCV A;  3SDZ A;  1NYF A;  4DEY A;  2P0K A;  2DIQ A;  2COZ A;  2KBT A;  4A53 A;  2ZZD A;  1PD0 A;  2G3R A;  2CYZ B;  1YJ9 A;  1W2B P;  2BE7 D;  4KGZ B;  1GBQ A;  2DF6 A;  2ZGW A;  4PKC C;  1IB8 A;  1MMG A;  4JPB W;  1GCQ A;  1VQ9 T;  5FU6 C;  4C0G A;  4M77 A;  4L5G A;  2OTL Q;  1H64 1;  5FLX E;  4O6J A;  5FRN A;  4F7U B;  2K5L A;  3G7Z A;  3ER0 A;  3UPU A;  4MDX A;  4F7U F;  2CS7 A;  4JZ4 A;  2DL5 A;  4C5G A;  3SFM A;  1TUG B;  3OBW A;  2EBP A;  4AG1 C;  1QVF S;  2EVR A;  2DBK A;  4BI8 B;  2EPD A;  3G4S Q;  3RDV A;  5CIU A;  3CC7 T;  2CH4 W;  3OQ5 A;  2DX1 A;  3HRU A;  3C12 A;  4F04 B;  5HK3 A;  3KXT A;  3FRN A;  5KCH A;  2DFU A;  4J7F A;  2RA2 A;  5GAO p;  3L42 A;  1MMD A;  1VQP T;  3FLG A;  1YCY A;  2CSI A;  2H8H A;  4LUE A;  1BYM A;  2QQA A;  2XKO C;  2AIR B;  3GBQ A;  2M0Y A;  3QDR B;  2L5Q A;  1PSF A;  3I55 Q;  3I9Q A;  2QGF B;  4M4Z A;  3QWX X;  3JB9 D;  4ORZ A;  3JAM E;  2X4Y A;  3JCM e;  3H0I A;  4OMN A;  3UAT A;  1QW1 A;  3FC3 A;  5GAN 7;  2MOX A;  1BIB A;  1BI0 A;  2CZ6 B;  3HP9 A;  1K9A A;  1XTD A;  4OB3 B;  2L2P A;  2I2L A;  4FW1 A;  4DBQ A;  3M53 A;  5GAM e;  1YNZ A;  4QVZ A;  4PLI A;  2QK0 A;  3I56 Q;  1AWW A;  2XIC A;  3N5B B;  2KXD A;  1ARK A;  4J9B A;  2OTJ T;  3GIB A;  4GBQ A;  4C92 D;  3GF5 A;  1Q7Y R;  1SRM A;  3EH1 A;  3SWN B;  5CKB A;  1W4S A;  3M0P A;  4IKF A;  3LLR A;  1FMK A;  2QYZ A;  3TSZ A;  1YWO A;  1ABO A;  2RI5 A;  4Z88 A;  4ZTF A;  2D1X A;  1IO6 A;  1T0J A;  4PJN A;  4C0Z A;  5HKC A;  1MMN A;  1M9S A;  3TQ7 P;  1K1Z A;  2V1R A;  3EG1 A;  1TUC A;  3CBP A;  4EDU A;  1QMC A;  6AT1 B;  2DRK A;  1K73 U;  1YJN Q;  1BBZ A;  3UF4 A;  1KQS S;  2DKG A;  2RB6 A;  1I07 A;  1I5O B;  4RTT A;  4C0F A;  2RI3 A;  2JTM A;  3G71 T;  3CCL Q;  4GY5 A;  2E65 A;  1QVF A;  4C8Q D;  5CKD A;  4AFQ C;  3OYB A;  1YHQ T;  5KYU B;  1ABQ A;  1YIJ Q;  4EMH A;  1O75 A;  2NUP A;  1PG5 B;  1D1C A;  2F5T X;  5GAN h;  1IGQ A;  3MO8 A;  3CD6 A;  1HXD A;  2GCX A;  2LRQ A;  4QW2 A;  5FU6 B;  1JXO A;  1IZ6 A;  1GCP A;  1GFC A;  5LJ3 f;  3LWI A;  1U8R A;  3VRY A;  3CCS T;  3HRT A;  3CCQ Q;  2K3B A;  4PFO A;  4BD3 A;  1QVF P;  2FZK B;  3INZ A;  1QP3 A;  4QT7 A;  1ZX6 A;  3JCM c;  3A1P A;  1JO8 A;  4A54 A;  5CQY A;  3QBY A;  3TEE A;  1YI2 Q;  3G6E T;  5IN1 A;  3VRZ A;  4Z89 A;  1AZG B;  4IIM A;  1G8X A;  1KK7 A;  3M5A A;  2MAM A;  1NYG A;  1OPK A;  3VUZ A;  1JJ2 A;  3PFS A;  1G3S A;  5D6X A;  4AFU C;  1ZLM A;  1M1F A;  3CCV Q;  2HKQ B;  4XU2 A;  1UJ0 A;  4PJO B;  1YJ9 T;  2ESW A;  4PK4 A;  4C92 C;  3ME9 A;  3IQL A;  5CQX A;  4PJO F;  4QQ6 A;  1OPL A;  1JJ2 P;  4CI0 C;  2MCN A;  3E9G A;  2JNG A;  3VV0 A;  3EG3 A;  1IXD A;  5AYF A;  2DXB A;  2IPO B;  1YWP A;  2V8J A;  1UHF A;  2RJC A;  1QCN A;  1S72 A;  1H3H A;  2NUP B;  1J3T A;  4ZNX A;  2MK5 A;  2IVW A;  2JMC A;  2CH4 A;  5CO7 A;  1WXB A;  1M90 R;  2CP0 A;  1HJD A;  4N4H A;  3M0Q A;  2K2M A;  2QAS A;  4HA8 A;  2ZPF B;  1JXM A;  3JCM g;  1AT1 B;  2FRW A;  5GAN 5;  1EZZ B;  4C8Q C;  1PSE A;  3TCJ A;  1HSQ A;  2E10 A;  2ZAE A;  4BAC A;  1K4U S;  1RLQ C;  1VQO T;  4MZP A;  2A7Y A;  3OYL A;  2EQJ A;  5D6Y A;  2BZX A;  3EG0 A;  1WZO A;  1Q86 C;  2DE0 X;  2K5I A;  3RKW A;  1HK9 A;  3URG A;  5D7U A;  1VQ8 Q;  3X25 B;  1X75 C;  4JRQ A;  4HKE A;  4VUB A;  4XU1 A;  5GJV B;  2AKK A;  4J9F A;  4C92 A;  4BE2 A;  2J6O A;  2MPX C;  1KC8 R;  1M30 A;  1WHJ A;  1PC0 A;  2COY A;  2DM1 A;  2BZY A;  2GTJ A;  1WJS A;  4J6W A;  4BUG A;  4M7A G;  1AWJ A;  5C6S A;  4A4G A;  2LJ0 A;  2O4X B;  1SRL A;  2DEU A;  1UFF A;  2QA4 A;  3BE3 A;  3MP8 A;  3HPW A;  2PZ1 A;  4IUV A;  3ZBD A;  2D9T A;  3LGF A;  5M9O A;  2YWW A;  2GQV A;  5GAO n;  1M27 C;  4Q5W A;  4J6X A;  1PKT A;  4OGE A;  1NE8 A;  2KT1 A;  4PL6 A;  5KE2 A;  1VQL T;  5IHK A;  2RK2 A;  4FSS A;  1U1S A;  2DK3 A;  2L0A A;  3D7S B;  3EH2 A;  2DXC A;  4C8Q A;  2YUO A;  3FB9 A;  3UDC A;  1G2B A;  3JRZ A;  3C4S A;  1P92 A;  4FYY B;  2VKN A;  1AHJ B;  1C0M A;  1WPY A;  3JCM V;  4UC4 A;  4JS5 A;  1K9M R;  2JT4 A;  2XK0 A;  2F2W A;  1FXX A;  1MV0 B;  5AT1 B;  3X24 B;  5J3B A;  1M2V B;  2K9G A;  3OS5 A;  2HNI A;  2K3X A;  2LJ3 A;  4JS4 A;  4RUG A;  3HRS A;  4C92 G;  3GNF B;  3VS1 A;  1CKA A;  3J80 E;  3PVQ A;  2V1Q A;  1QVG A;  2DTO A;  1Y96 B;  1K76 A;  1VQK T;  4BE0 A;  2LQK A;  3I5S A;  2SEM A;  2FG0 A;  2EYW A;  2LC4 A;  2M1H A;  4NL2 A;  1OU8 A;  4ZGE B;  3CD6 Q;  4NOY A;  2NYS A;  1E6G A;  4HVU A;  2DXU A;  2E6N A;  3CBO A;  4J6Y A;  1S1N A;  1QVG P;  3I55 A;  4K11 A;  2RI2 A;  1VYT A;  1R8O B;  4TVR A;  4HCK A;  2DBM A;  4OMF B;  5GAN 2;  3C95 A;  5GAN f;  4J8O A;  3BFM A;  2A37 A;  1WQW A;  3M57 A;  1W2B S;  2M51 A;  4MDW A;  1RAA B;  1RUW A;  2XD0 A;  4O5V A;  1WHM A;  2GFA A;  2X35 A;  2R5M A;  5LJ5 d;  5GMK e;  4X1V A;  2DL7 A;  2JN0 A;  2AHJ B;  3EGD B;  1SHG A;  2PNI A;  1MND A;  5CK9 A;  2VV5 A;  4F16 A;  3I56 A;  3MPU B;  2D0Q B;  3EG9 A;  2HZY A;  1MGQ A;  1XJW B;  2VXF A;  3MHX A;  1WI7 A;  2MMP A;  4M78 E;  3HSB A;  4RTV A;  1WX6 A;  1ACM B;  2JTF A;  1BCO A;  2L89 A;  2YSQ A;  2BZ8 A;  4N0A C;  3H0F A;  4FYX B;  5IXB A;  2KI7 A;  2EQK A;  3CC2 T;  3LX7 A;  3GOX A;  2O9V A;  1NJI C;  2ATC B;  1S72 Q;  2E3I A;  2LX9 A;  3OMG A;  3MEW A;  2C0T A;  3LH5 A;  1TUD A;  1NZ9 A;  4LN2 A;  1Q81 C;  2A08 A;  3X26 B;  1I8F A;  1PNJ A;  5GAN 8;  2VAS A;  3A8M B;  3L2R A;  1KIK A;  4F7U A;  3TVT A;  1PRL C;  4NL3 A;  3HL8 A;  4FSX A;  3I35 A;  3CCE A;  4J9H A;  1SKU B;  4M78 B;  3BY7 A;  4M75 E;  2KRM A;  2EGE A;  2QQ9 A;  3L2V A;  4PJO D;  2DTH A;  4J7I A;  3ZEH A;  5GAN 6;  2C06 A;  2KQW A;  5J26 A;  1V76 A;  4E6R A;  2EAY A;  2K2V A;  2KRS A;  4M78 F;  3GPL A;  1WLP B;  3KBG A;  3L2W A;  3A98 A;  4XTX A;  3SWN C;  1QCO A;  3NTH A;  2DER A;  2KY9 A;  5KYX B;  1WHK A;  3EFO B;  3EG9 B;  2QGG A;  4N4I A;  2E64 A;  5A0D A;  2HL3 A;  2F1L A;  5KYY A;  2JZ2 A;  1BCM A;  2RHX A;  5IHN A;  4N0A A;  2LQW A;  3OYG A;  1IGU A;  3CME A;  1BB9 A;  3CCU T;  2X4W A;  2DXT A;  1K0X A;  1UGV A;  4OVA A;  4E2F B;  2H3J A;  2LNV A;  2QA4 Q;  4PJL A;  1M3C A;  4CC7 A;  2ZPB B;  2CZ7 B;  2EYQ A;  3PTA A;  1R0C B;  3MP6 A;  1D0Z A;  1TS9 A;  2ED1 A;  3M4Y A;  1WFW A;  1Q86 R;  1WXU A;  3GNG A;  3QKJ A;  4F7U G;  2OTL T;  1OYX A;  3CXC A;  3VS5 A;  2BE9 B;  2VVK A;  1PWT A;  1KQ2 A;  2RJD A;  1FWZ A;  1UUE A;  1NLO C;  1TSF A;  4HT8 A;  3OW2 A;  1VQM T;  2JW4 A;  3CCM Q;  1RAC B;  3OSV A;  1YCS B;  2XDB A;  2VB6 A;  3G4S T;  1LOJ A;  1T3L A;  1MNE A;  1OQK A;  2EJF A;  3QZ5 B;  3SWN A;  1D0X A;  3CXC P;  1YIT A;  2E12 A;  4M7D E;  2O01 E;  3REB B;  3VS7 A;  4JUV A;  2VC8 A;  1WHL A;  2M9U A;  2LT1 A;  1AZE A;  3VS4 A;  3JCM h;  3OW2 P;  4FT4 A;  2FPE A;  3NTI A;  2X4J A;  3EFR A;  4M7D G;  5KYY B;  4PJO C;  3SD4 A;  3I55 T;  1K73 R;  3QUI A;  4RCC A;  2D8J A;  1VQ8 A;  5GAM h;  4RTU A;  2RM4 A;  4LNP A;  5CR2 A;  1NM7 A;  1GFD A;  2EJG A;  2FPD A;  3V8J A;  5KYU A;  1UGQ B;  5A2Q E;  3R6O A;  3JCM J;  1KD1 C;  4A63 B;  1H3Z A;  3A8O B;  1JJ2 S;  2CZ1 B;  4M77 G;  2HD0 A;  1Q86 U;  2HEQ A;  2JXB A;  5GAM j;  2E5Q A;  1X27 A;  1DJ7 B;  4RCB A;  1WHG A;  4ELY C;  3DKM A;  2O88 A;  2LVM A;  4E7H A;  2LCS A;  1VQ7 A;  3RER A;  2P0P A;  4J9G A;  1LCK A;  2EQM A;  2XMF A;  2EGA A;  5GMK l;  2QAZ A;  4C5E A;  2ROL A;  3C0C A;  3GLX A;  1AVZ C;  2HKN A;  1KHI A;  3WVE B;  3M55 A;  3OYH A;  4BI4 A;  2QEX Q;  2LTO A;  1ZSG A;  1Q82 C;  3QO3 A;  2EWN A;  3OSS C;  2C0O A;  4J9I A;  1B3Q A;  2P0Q A;  3TRE A;  2PTK A;  3M59 A;  1N27 A;  1VOM A;  2OX7 A;  4FM4 B;  3VU3 C;  2DTI A;  2EGC A;  3CCR A;  3VKI A;  5LJ5 e;  4PJO A;  1X2Q A;  1NLP C;  1C1A A;  4ZN3 A;  1B34 B;  1YJN T;  2MF2 A;  2K5F A;  2YLC A;  4MML A;  2NWM A;  2CUB A;  2DL3 A;  1JQQ A;  1MV3 A;  1B07 A;  2BKD N;  3CCL T;  3H6Z A;  1I1J A;  4XQ3 A;  1TH7 A;  3HFO A;  4KGV B;  1YIJ T;  1G3T A;  1CKB A;  1WXT A;  2KE9 A;  3S3N A;  4J9D A;  1SSH A;  1VQN A;  1U1T A;  3CCE Q;  3O5Z A;  2HQX A;  3THK A;  1QLY A;  1FMW A;  3V7S A;  3VYH B;  1PM3 A;  2A36 A;  3M0U A;  3CCQ T;  1B7T A;  3EFS A;  3RKY A;  2Y4Y A;  3CMA Q;  4LDU A;  4E7L A;  3QJY A;  5KYN A;  1VQ4 A;  1T3S A;  5HY6 A;  1NG2 A;  2ABL A;  2AZV A;  1YI2 T;  1GL5 A;  2HL5 C;  4RG2 A;  4FCY A;  1NJI R;  3OB9 A;  4ATO A;  1RAB B;  2R58 A;  4OB1 B;  3QZ9 B;  2YRD A;  1JEG A;  1BU1 A;  2LMJ A;  1UB4 A;  2COW A;  3CME Q;  2PUO B;  4JZ3 A;  3CC4 A;  4HVV A;  4PJO G;  3CCV T;  3ZFJ A;  1OU9 A;  4EMG A;  1M1G A;  4A4K A;  2VXE A;  4RTZ A;  4RMO A;  3J7A F;  2MIO A;  3F70 A;  3WVD B;  4Z8A A;  4DBF A;  1TXQ A;  1QWF A;  2XID A;  2JS2 A;  4E7I A;  5GAN e;  2QTX A;  1WNL A;  4M78 D;  4AFZ C;  3ASK A;  2O4X A;  3A5Z B;  2J6F A;  2DJQ A;  2CT3 A;  1LPL A;  4MMK A;  4XTZ A;  4LXC A;  4JLG A;  4A4H A;  3M0T A;  3L2Q A;  3BDU A;  1BI1 A;  4OML A;  2P4T A;  4ZGJ B;  3E9F A;  1A0N B;  3P8D A;  2YUQ A;  1WJQ A;  4PLL A;  2GBQ A;  1NBE B;  1QVG S;  4XTV A;  3O8V A;  1YN8 A;  1YIT Q;  2QQR A;  3REA B;  1R77 A;  1EX4 A;  5I2M A;  2KEA A;  1VQ6 A;  2LZ6 B;  1NEB A;  5CKH A;  3ULR B;  3OS2 A;  2RQT A;  2EYZ A;  1YP5 A;  3L2Z A;  3MJX A;  2WSF E;  4IUU A;  2D8H A;  4PFZ A;  1NJI U;  2YT6 A;  2BUD A;  5LJ3 d;  1M2V A;  2ENM A;  2M0O A;  1VQ5 A;  3JB9 H;  2KXC A;  1AOJ A;  2PVO B;  5LL6 S;  5GAM g;  4FU6 A;  1W70 A;  2FEI A;  1Q81 U;  4AG2 C;  1UJY A;  3JCM f;  1X6G A;  2F69 A;  4M7A E;  1Y96 A;  2PVD B;  2QI2 A;  4C0D B;  3NFC A;  2RJF A;  2RHY A;  2X51 A;  3T9N A;  1SG5 A;  4DOW A;  5GAO r;  1SF9 A;  2QTV A;  4NS5 A;  2DL8 A;  3V7C A;  1MUZ A;  3OMC A;  2EIF A;  2JVV A;  4Y28 E;  2GFU A;  3LGL A;  3NHN A;  4AMC A;  5EG2 A;  4L6V 5;  1KJW A;  2LQN A;  2YUN A;  5LJ5 g;  1E6H A;  3OYM A;  1VQ7 Q;  2YRC A;  1IHW A;  3VS6 A;  2WAC A;  3NTK A;  1JU5 C;  3CPF A;  2K3Y A;  3X28 B;  1ZQ1 A;  2EKO A;  1N8R C;  4OF1 A;  2DD5 A;  3E2U A;  3JCM b;  2O31 A;  1U06 A;  5DY9 A;  3AHU A;  4LDY A;  3JB9 G;  2H3E B;  4FW2 A;  4M78 C;  4WCI A;  2KSS A;  4E7Z A;  4BDZ A;  1RAI B;  4E7K A;  4M7A B;  2AT1 B;  4E47 A;  3V8K A;  1YJW Q;  3EGD A;  1OI1 A;  4C92 E;  1I81 A;  3CCR Q;  4M7A F;  3LH0 A;  1BIA A;  3CCM A;  1AEY A;  3UA7 A;  1HD3 A;  2ZPH B;  1KD1 R;  1AD5 A;  4B9X A;  3EHQ A;  2X3X D;  2PVG B;  4BB7 A;  1RAH B;  2G6F X;  1X43 A;  1VQ9 A;  3MEA A;  2DPP B;  2RK1 A;  5IH2 A;  3RKX A;  2HBP A;  1M3A A;  2JMA A;  2RF0 A;  2YXY A;  3DLM A;  3CD6 T;  3NPF A;  1PD1 A;  1VQN Q;  2DET A;  3TSW A;  1JRI A;  4N4G A;  5GMK h;  4M75 C;  4HCB A;  2KGT A;  1KHC A;  2CP6 A;  5DM7 R;  1RLP C;  2DEQ A;  1Q82 R;  2QDY B;  2L3Q A;  1ZHI A;  3CC7 A;  5I11 A;  4OGC A;  3MKD A;  4DOV A;  1VQ4 Q;  3LYI A;  1F1B B;  4BI3 A;  2RJE A;  3JCM W;  1Y0M A;  1O9S A;  4C5I A;  2NUZ A;  5GMK j;  2K79 A;  5IT9 E;  1Q7Y C;  2DD4 A;  2WSC E;  5I21 A;  4M78 A;  4JRI A;  5CAI A;  4B6M A;  4C8Q G;  4OMM A;  3RMQ A;  2RHU A;  2OAW A;  1VQP A;  4KH0 B;  2YUP A;  2YDL A;  3OYY A;  4OMQ A;  4AT1 B;  2EW3 A;  2AK5 A;  2PUK B;  5IAY A;  2DZC A;  2KDS A;  4AFS C;  5GAO l;  1Z9Q A;  1ZUY A;  3CC4 Q;  2W0Z A;  2E1H A;  3EAE A;  9ATC B;  5KH6 A;  3UA6 A;  5CCA A;  5KYX A;  1NPP A;  2CT4 A;  3EFO A;  3CXC S;  3FDR A;  4IIO A;  1KD1 U;  1V1C A;  4B9W A;  3EHR A;  3UWN A;  2DAQ A;  2ED0 A;  2CZ0 B;  4QVD A;  3SB2 A;  5A0L A;  2QEX A;  3BDL A;  1RAD B;  1PKS A;  3OW2 S;  3R6N A;  1M3B A;  3E1S A;  5IHI A;  1S72 T;  3M58 A;  4HVW A;  4Y91 A;  2X9H A;  4Y92 A;  2D6F A;  1X6B A;  2OTJ A;  2A28 A;  2KNB B;  2KAF A;  2YLB A;  3EGX A;  2Y4X A;  4XTY A;  1U5S A;  2HBW A;  3CPW A;  1Q82 U;  2E6Z A;  3FJP A;  4KUI A;  4OB0 B;  2CP3 A;  1YBY A;  1VQ6 Q;  2RN8 A;  1GRI A;  1JBM A;  2QDL A;  4XU0 A;  1W1F A;  1AWO A;  1SHF A;  1WJR A;  4LE9 A;  4KBM B;  4HXJ A;  3TU4 K;  2XDD A;  1UG1 A;  2M02 A;  3MET A;  3JB9 I;  1D0Y A;  1OV3 A;  4V2S A;  3QG1 A;  5FU7 B;  1VQ5 Q;  2JM9 A;  4RTY A;  3PT9 A;  3CPW P;  3CMA A;  2LP5 A;  5GAN d;  2CUD A;  4PJJ A;  4ZN1 A;  1E7O A;  2Y90 A;  5GMK i;  4CC3 A;  1PCX A;  2XDP A;  2EQI A;  3OYK A;  3M54 A;  2RQV A;  1ZBX A;  2DVE A;  3MEV A;  2A3L A;  1YHQ A;  2GQI A;  1KFZ A;  2ROT A;  3PGG A;  2IG0 A;  4RG8 A;  1M1K C;  1UTI A;  1QKX A;  3QYH B;  4DBR A;  5LJ3 j;  1Y7X A;  2QA4 T;  4CC2 A;  3RMS A;  4IUP A;  2R5A A;  2P84 A;  3MEU A;  2RHZ A;  1ZA2 B;  5EC7 A;  3CCS A;  2HAX A;  5LJ3 e;  1RAF B;  2CP7 A;  4F7U E;  1TWB A;  3CCJ Q;  2NUT B;  1HYO A;  2ZPE B;  4D8K A;  2DLP A;  4M75 B;  4QQD A;  2KMT A;  3PIO A;  3M4G A;  2LJ1 A;  1BKB A;  3EGX B;  4M75 F;  2O2O A;  1D1B A;  3M9Q A;  4CC4 B;  3CCU Q;  2X4X A;  1JB0 E;  2BIV A;  3X20 B;  5KYW A;  2LQ8 A;  3CCM T;  2SRC A;  4BY6 B;  1G83 A;  3QXE B;  1I4K 1;  4IUR A;  4FYW B;  2E41 A;  3Q1J A;  2RNA A;  4ZGD B;  3RBB B;  1ZA1 B;  2MI6 A;  3OYJ A;  1WIE A;  2XHC A;  2DO3 A;  4II1 A;  1RI0 A;  3NMZ C;  3S3M A;  1QKW A;  1OX9 A;  2JS0 A;  1VQ9 Q;  3WXM B;  1PRM C;  1N9R A;  1KC8 C;  4BE1 A;  2LNH B;  2OI3 A;  3OYC A;  5KE3 A;  4MZT A;  2KRO A;  1N8R R;  3DB3 A;  1VQM Q;  3I5R A;  2F5K A;  4OMP A;  1B34 A;  2ZPI B;  1OZ3 A;  4A4F A;  4ANJ A;  4JJN K;  3OY9 A;  4EMK C;  2B86 A;  3V7R A;  2KK4 A;  4D8D A;  4M77 E;  2KYM A;  4D6W A;  3CC7 Q;  2E5K A;  3VYG A;  1M8M A;  4M7A D;  3MP1 A;  4XAX B;  1VQO A;  1TOV A;  8AT1 B;  2HCK A;  2K57 A;  4J83 A;  3FJ5 A;  3V8L A;  1VQP Q;  1VUB A;  4M7D B;  3RES A;  2YHT A;  3JCM P;  1RAG B;  1K9M C;  3I56 T;  4LUD A;  3OYI A;  4ZTJ A;  4M7D F;  5KYW B;  1WA7 A;  5GAN 3;  4RKU E;  5LJ5 h;  2EKH A;  3JCM X;  2AKL A;  3BW1 A;  1FMV A;  1XOV A;  1Q95 G;  2O9S A;  3OA6 A;  2VUB A;  1LNX A;  1M4Z A;  2VWF A;  2QEX T;  3CEY A;  4KRT A;  4QVC A;  3M56 A;  2RQW A;  2V8I A;  4M77 B;  4KUL A;  3P8H A;  1RI9 A;  5LJ5 j;  2MWO A;  4EPC A;  1K0S A;  3VS2 A;  1YJW A;  1X6O A;  3PMT A;  2CDT A;  3H9N A;  4M77 F;  2RMO A;  3VJP A;  5GMK m;  1N8R U;  4EMK A;  4C0D C;  1UE9 A;  1ZUK A;  2OTJ Q;  1VQL A;  1YFN A;  2JUF A;  1OOT A;  2QQB A;  3RR6 A;  1ZBJ A;  2L3R A;  1U3O A;  2FHD A;  3KUF A;  3HTR A;  3VS0 A;  2NLU A;  3VS3 A;  2J05 A;  4CRI A;  3OYN A;  4ESR A;  3CCE T;  1VA7 A;  2K4Y A;  2FVU A;  1QVP A;  1NPR A;  5A0G A;  5LJ3 g;  2QG9 B;  3CMA T;  3QHS A;  2CKK A;  4LDX A;  3FIF A;  3OYF A;  3HHT B;  1QCF A;  3JV3 A;  3QSU A;  1VIF A;  2PQW A;  2DVJ A;  3AT1 B;  1VYU A;  4WTO B;  2FL7 A;  3HFN A;  1T0H A;  1WHH A;  2IIM A;  1UGR B;  2V8K A;  1UGS B;  1X01 A;  2J7I A;  4FYV B;  3S3O A;  4M7A C;  3G71 Q;  4HT9 A;  1VQK A;  4PFP A;  4PJO E;  2XI9 A;  5FWB A;  1ZUU A;  3VUB A;  1YHQ Q;  4JDS A;  1C6V X;  3CME T;  1K8A C;  3PVL A;  1QWE A;  2DYI A;  2FB7 A;  8ATC B;  4L59 A;  3L1A A;  1Q81 R;  1UHC A;  4HCZ A;  2PU9 B;  4ME7 A;  5GAN 4;  1NEG A;  4XTU A;  3CCS Q;  5GAN j;  2QXF A;  4PJM A;  3QYG B;  2VYT A;  1OZ2 A;  2DL4 A;  3RUX A;  2AZS A;  1Q7Y U;  2K6D A;  4EMK B;  4PNO A;  3G6E Q;  2LX7 A;  1H92 A;  3SHW A;  5GJW B;  4WF2 A;  5J39 A;  4IUQ A;  1EIF A;  4A4E A;  2FRY A;  4XU3 A;  2XU8 A;  2D0N A;  2LCC A;  4JJB A;  1X69 A;  5HCK A;  4R56 A;  1I5L A;  2LCL A;  1MHN A;  2EQU A;  4C5H A;  1YJ9 Q;  1M1K R;  2LT4 A;  1YIT T;  1XNI A;  1Z9Z A;  3MCA B;  5CKE A;  2KR3 A;  5DLQ E;  2DJZ A;  4GLM A;  3QII A;  3J81 E;  4M7A A;  1ZSZ C;  1SPK A;  1LJO A;  5ECA A;  4LDV A;  3CC2 A;  2OJ2 A;  2GF7 A;  2MWP A;  3FEO A;  3H0H A;  3EGU A;  1TG0 A;  4OMO A;  2KYB A;  3PMI A;  4X34 A;  3A8G B;  1KG1 A;  4M75 D;  1TTH B;  1VQ8 T;  2ZPG B;  1AWX A;  5I22 A;  4JJC A;  2DYB A;  2EYX A;  1XQH A;  3M0R A;  2RQR A;  2K7A A;  3JCM Q;  4XK8 E;  1KQS A;  1N5Z A;  3OBY A;  4HCC A;  1D3B A;  4J5Y A;  2QQS A;  1RL2 A;  1Y57 A;  3H41 A;  3JB9 J;  4RTX A;  1VQO Q;  2RD1 A;  3JSC A;  4YTL A;  5GAM f;  1BI2 A;  1VQ7 T;  3P8B B;  4DEX A;  2Z0W A;  4JLI A;  5D6W A;  4KUD K;  3OYE A;  2JOY A;  4DQ2 A;  1V29 B;  1KQS P;  2EFI A;  1SEM A;  3CCJ A;  4J9C A;  1UEB A;  4R55 A;  2XG8 D;  4OP0 A;  3A8H B;  4FIB A;  3LW5 E;  1M1K U;  1FYN A;  2DNU A;  2LDM A;  1H8K A;  1UDL A;  1ZSZ A;  2GTO A;  4QKU A;  1KSW A;  2ZCF B;  1YJW T;  3CCU A;  1OEB A;  1D1A A;  1N6A A;  5LJ5 f;  5FU7 C;  5FRO A;  5C0M A;  3CCR T;  3E19 A;  1OUL A;  3EG2 A;  3OS1 A;  2HSE B;  2KT8 A;  1X2K A;  3C94 A;  3ZL7 C;  1W6X A;  1PHT A;  1G5V A;  2DIG A;  3U23 A;  3KFV A;  3CPW S;  1K73 C;  3RNJ A;  2V26 A;  1M90 U;  2B8A A;  2HMA A;  2E4H A;  1VQL Q;  2OTL A;  7AT1 B;  3GP8 A;  4DBH A;  2KVQ G;  4M7D D;  2DZ9 A;  2JJ9 A;  3S6W A;  1Y71 A;  2HQH A;  2VGN A;  5CKF A;  2EYY A;  3PE0 A;  1D3B B;  3JB9 F;  1VQN T;  4OB2 B;  3G1J A;  1VQM A;  3RIR A;  1IRX A;  2CGH A;  3G4S A;  3QDF A;  2P4R A;  3JCM d;  2ECZ A;  1OX8 A;  4IUT A;  4X9C A;  1M8V A;  4E7J A;  1VQ4 T;  4C8Q E;  4E7S A;  4JJD A;  1D09 B;  5IXF A;  5GAN g;  1BI3 A;  1WYX A;  4JRK A;  2DRM A;  4M77 D;  3SEM A;  4C92 B;  3OYD A;  5KCO A;  2BTT A;  1KC8 U;  3DB4 A;  3PIP A;  2HQE A;  1VQK Q;  5GAM d;  2F2V A;  4X9D A;  4BY6 C;  4C92 F;  3QPH A;  3OS0 A;  2X3W D;  3CC4 T;  2YRV A;  4LD9 K;  1ZSZ B;  4FT2 A;  4R0K A;  2RHI A;  2CP5 A;  2HDA A;  2CSQ A;  5L8R E;  5FWC A;  1I0C A;  1M5Q 1;  2RO0 A;  5FRM A;  4JRP A;  2OAU A;  2E3H A;  2RH2 A;  1KQ1 A;  4J9E A;  2F2X A;  1IRE B;  4Z02 A;  4F14 A;  2WSE E;  1WDX A;  1GXI E;  3QJ6 A;  5HK0 A;  5DLO A;  4FL6 A;  2MYS A;  4C8Q B;  2C0I A;  2L3S A;  1FX7 A;  5GAO m;  2JM8 A;  1K9M U;  2FYK A;  4C8Q F;  1WGS A;  5CVI A;  1R0B G;  2VGM A;  4LDW A;  2NUT A;  1QQJ A;  4M75 A;  4EIK A;  1WQ7 A;  1LVK A;  2EJ9 A;  1BK2 A;  2I0N A;  1K8A R;  2KRN A;  5GAO q;  3PNW C;  3H8Z A;  4MZM A;  1VIE A;  1Y07 A;  1VQ6 T;  3UT1 A;  2DIL A;  2J06 A;  4M7D C;  1QP2 A;  2CP2 A;  4M78 G;  2DMO A;  4KH1 B;  2GGR A;  1GBR A;  2R57 A;  3CQT A;  3NGP A;  2J6K A;  3CC2 Q;  1MMA A;  2FPF A;  3L2U A;  2M16 A;  1VQ5 T;  2L8D A;  5FW9 A;  2W10 A;  1VYV A;  1YJN A;  1EFN A;  2A0F B;  4QQG A;  1CSK A;  2DA9 A;  4DA4 A;  1UEC A;  3DLL A;  5LJ3 h;  3CCL A;  1GCQ C;  4KGX B;  4LD6 A;  4M77 C;  3CBM A;  1YIJ A;  3G71 A;  5I2S A;  1TU0 B;  2RPN A;  2FZG B;  4GLK A;  2HSP A;  2GNC A;  3QWY A;  3LWH A;  2E70 A;  4ELZ C;  5L23 A;  4KT0 E;  3CCQ A; 
#chains in the Genus database with same CATH homology
 1A0N B;  1K76 A;  2YUQ A;  2GBQ A;  2RQW A;  2JTE A;  3I5S A;  1RI9 A;  2SEM A;  2FG0 A;  1YN8 A;  2EYW A;  3VS2 A;  1K0S A;  2CDT A;  4RTW A;  3REA B;  2CRE A;  2KEA A;  1E6G A;  2RQU A;  2LZ6 B;  1NEB A;  4HVU A;  2RMO A;  3ULR B;  3M0S A;  2FO0 A;  1S1N A;  2RQT A;  2EYZ A;  4K11 A;  1YP5 A;  1VYT A;  1UE9 A;  1ZUK A;  4HCK A;  2DBM A;  2D8H A;  2YT6 A;  2L3P A;  4F17 A;  2A37 A;  1OOT A;  2M51 A;  2ENM A;  1ZBJ A;  1NYF A;  2KXC A;  1AOJ A;  1RUW A;  4DEY A;  1U3O A;  1W70 A;  2FEI A;  2KBT A;  3VS0 A;  3VS3 A;  2J05 A;  4AG2 C;  4ESR A;  1UJY A;  1X6G A;  4X1V A;  1VA7 A;  1GBQ A;  2DF6 A;  2DL7 A;  4JPB W;  1GCQ A;  1SHG A;  2PNI A;  4F16 A;  2DL8 A;  1MUZ A;  1QCF A;  3JV3 A;  3NHN A;  1WI7 A;  2DVJ A;  1VYU A;  1KJW A;  2LQN A;  1T0H A;  2YUN A;  2IIM A;  1E6H A;  4RTV A;  1WX6 A;  2J7I A;  4JZ4 A;  2DL5 A;  2YSQ A;  2BZ8 A;  3VS6 A;  3H0F A;  2EBP A;  4AG1 C;  5FWB A;  1ZUU A;  5IXB A;  1JU5 C;  2EVR A;  2DBK A;  2EPD A;  3PVL A;  2CH4 W;  2O31 A;  1QWE A;  2DX1 A;  1U06 A;  2O9V A;  1UHC A;  4WCI A;  1NEG A;  2C0T A;  3LH5 A;  1TUD A;  4LN2 A;  2A08 A;  1PNJ A;  2CSI A;  2H8H A;  4LUE A;  2DL4 A;  1KIK A;  2AZS A;  3GBQ A;  2K6D A;  2M0Y A;  3TVT A;  1PRL C;  1AEY A;  3UA7 A;  1HD3 A;  3I9Q A;  1AD5 A;  2LX7 A;  4M4Z A;  1H92 A;  3QWX X;  3SHW A;  5GJW B;  3I35 A;  4J9H A;  3EHQ A;  4ORZ A;  2FRY A;  2KRM A;  2EGE A;  2X3X D;  3H0I A;  2D0N A;  4JJB A;  4OMN A;  2G6F X;  3UAT A;  1X43 A;  1X69 A;  4E6R A;  2KRS A;  2MOX A;  1WLP B;  5HCK A;  5IH2 A;  3A98 A;  1K9A A;  1M3A A;  2JMA A;  2RF0 A;  1Z9Z A;  3NPF A;  2KR3 A;  2L2P A;  3TSW A;  4GLM A;  1YNZ A;  1AWW A;  2KGT A;  2KXD A;  1RLP C;  1ARK A;  5IHN A;  1SPK A;  2LQW A;  4J9B A;  2L3Q A;  5ECA A;  1BB9 A;  4GBQ A;  2OJ2 A;  5I11 A;  1SRM A;  1K0X A;  1UGV A;  3H0H A;  3EGU A;  1TG0 A;  3M0P A;  4OMO A;  1FMK A;  2KYB A;  1Y0M A;  1M3C A;  2NUZ A;  2K79 A;  1YWO A;  3TSZ A;  1ABO A;  4CC7 A;  1AWX A;  4OMM A;  5I22 A;  4JJC A;  2OAW A;  4Z88 A;  2DYB A;  2YUP A;  2EYX A;  2YDL A;  3M0R A;  4OMQ A;  2ED1 A;  2D1X A;  2EW3 A;  2AK5 A;  2RQR A;  1IO6 A;  1T0J A;  1WFW A;  2K7A A;  4AFS C;  1N5Z A;  1WXU A;  1Z9Q A;  1ZUY A;  1K1Z A;  2W0Z A;  2V1R A;  3VS5 A;  3EG1 A;  1Y57 A;  3H41 A;  1TUC A;  2VVK A;  1PWT A;  4RTX A;  2DRK A;  3UA6 A;  1BBZ A;  2CT4 A;  3UF4 A;  1I07 A;  1UUE A;  1NLO C;  4IIO A;  4RTT A;  1V1C A;  2JW4 A;  3EHR A;  2ED0 A;  4DEX A;  1YCS B;  4AFQ C;  1ABQ A;  1T3L A;  1PKS A;  1SEM A;  3R6N A;  1M3B A;  5IHI A;  3REB B;  3VS7 A;  4J9C A;  1JXO A;  1GCP A;  4HVW A;  1GFC A;  3VRY A;  1AZE A;  1FYN A;  2DNU A;  4Y92 A;  3VS4 A;  1H8K A;  2K3B A;  1UDL A;  1X6B A;  2GTO A;  2FPE A;  2A28 A;  1KSW A;  2KNB B;  1OEB A;  4QT7 A;  1ZX6 A;  1JO8 A;  1U5S A;  2HBW A;  3EG2 A;  2KT8 A;  1X2K A;  3ZL7 C;  1W6X A;  2D8J A;  3VRZ A;  1PHT A;  4Z89 A;  2RN8 A;  1AZG B;  1GRI A;  4IIM A;  2QDL A;  1NYG A;  4RTU A;  3U23 A;  1OPK A;  3KFV A;  4LNP A;  1W1F A;  1AWO A;  3RNJ A;  1NM7 A;  1GFD A;  1SHF A;  4LE9 A;  2FPD A;  4HXJ A;  4AFU C;  1ZLM A;  1UG1 A;  1OV3 A;  4A63 B;  1UJ0 A;  2JM9 A;  4RTY A;  2ESW A;  2HEQ A;  2LP5 A;  2JXB A;  2CUD A;  2EYY A;  1X27 A;  3PE0 A;  3IQL A;  1E7O A;  2O88 A;  4CC3 A;  2LCS A;  2EQI A;  2RQV A;  1OPL A;  1LCK A;  4J9G A;  2XMF A;  2MCN A;  2GQI A;  1KFZ A;  3EG3 A;  2EGA A;  2ROT A;  2P4R A;  2ECZ A;  1UTI A;  1QKX A;  2ROL A;  3C0C A;  1YWP A;  4JJD A;  1UHF A;  1AVZ C;  1H3H A;  5IXF A;  4CC2 A;  1J3T A;  1WYX A;  2DRM A;  4ZNX A;  3SEM A;  5EC7 A;  2BTT A;  1ZSG A;  2JMC A;  2C0O A;  2CH4 A;  4J9I A;  1B3Q A;  1WXB A;  2F2V A;  1HJD A;  2PTK A;  3M0Q A;  2K2M A;  1JXM A;  4D8K A;  2DLP A;  2EGC A;  2X3W D;  2FRW A;  1X2Q A;  1NLP C;  1HSQ A;  1K4U S;  4R0K A;  1RLQ C;  2LJ1 A;  2HDA A;  2CSQ A;  2O2O A;  4CC4 B;  5FWC A;  1I0C A;  2NWM A;  2CUB A;  2BZX A;  2DL3 A;  3EG0 A;  1JQQ A;  1MV3 A;  2DE0 X;  4J9E A;  1B07 A;  2F2X A;  1I1J A;  2SRC A;  4F14 A;  1WDX A;  1G83 A;  1CKB A;  1WXT A;  2KE9 A;  4J9D A;  2RNA A;  2C0I A;  2L3S A;  5GJV B;  3RBB B;  1SSH A;  2AKK A;  4J9F A;  3O5Z A;  2JM8 A;  3THK A;  1QLY A;  2J6O A;  1WIE A;  1M30 A;  2A36 A;  3NMZ C;  1QKW A;  3M0U A;  2JS0 A;  2DM1 A;  2BZY A;  2GTJ A;  1PRM C;  1AWJ A;  4EIK A;  2LJ0 A;  1SRL A;  2LNH B;  2OI3 A;  1BK2 A;  1T3S A;  2KRO A;  1UFF A;  2I0N A;  1NG2 A;  2KRN A;  3I5R A;  2ABL A;  2AZV A;  1GL5 A;  2PZ1 A;  4OMP A;  2DIL A;  2B86 A;  2J06 A;  1M27 C;  2DMO A;  4D8D A;  2GGR A;  1GBR A;  1PKT A;  3CQT A;  1JEG A;  1BU1 A;  2LMJ A;  2KYM A;  2KT1 A;  3NGP A;  2J6K A;  4JZ3 A;  2E5K A;  2FPF A;  5IHK A;  4HVV A;  4FSS A;  1M8M A;  2L0A A;  5FW9 A;  2W10 A;  1VYV A;  2YUO A;  1EFN A;  4RTZ A;  1G2B A;  1CSK A;  2HCK A;  2MIO A;  2DA9 A;  2VKN A;  4Z8A A;  1UEC A;  3FJ5 A;  1QWF A;  2JS2 A;  2JT4 A;  1GCQ C;  2F2W A;  1MV0 B;  4AFZ C;  2K9G A;  2J6F A;  2RPN A;  2DJQ A;  4LUD A;  1WA7 A;  2CT3 A;  2LJ3 A;  2EKH A;  4RUG A;  3M0T A;  2AKL A;  2HSP A;  3VS1 A;  2GNC A;  3QWY A;  1CKA A;  1XOV A;  2O9S A;  3PVQ A;  2V1Q A;  5L23 A;  4OML A;  2VWF A;  4KRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...