1NEBA

Sh3 domain from human nebulin, nmr, minimized average structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
TAGKIFRAMYDYMAADADEVSFKDGDAIINVQAIDEGWMYGTVQRTGRTGMLPANYVEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sh3 domain
molecule keywords NEBULIN
publication title SH3 in muscles: solution structure of the SH3 domain from nebulin.
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1997-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nebA00
2YUNA 1HSQA 2JS2A 2CREA 2JMCA 4Y92A 1ZBJA 4EIKA 1QWEA 1VYVA 1NG2A 1H92A 4J9BA 1WA7A 2JMAA 2C0IA 1AZEA 2PNIA 1G83A 1N5ZA 3M0SA 4CC3A 1I07A 1ZUKA 4J9EA 2J7IA 3NPFA 1NM7A 4OMQA 3EG0A 1SRMA 2KXCA 2L3SA 2CH4A 4HVUA 1X6BA 2DRMA 3EG3A 3PVLA 1TUCA 1M8MA 4A63B 1AD5A 1CKBA 1LCKA 2JT4A 4JPBW 2AZVA 2PTKA 1RLPC 1WIEA 1PRMC 1AEYA 2JS0A 4RUGA 1H3HA 3THKA 2V1QA 1NEBA 2YT6A 1UJ0A 2F2WA 2LP5A 5IHIA 1OEBA 2K3BA 1W70A 1AZGB 4J9GA 3UATA 4ZNXA 4M4ZA 2DRKA 1UUEA 1IO6A 1X27A 2DILA 1AVZC 1UECA 1M27C 2EYZA 1J3TA 4RTWA 1RUWA 4E6RA 4F17A 3O5ZA 2YSQA 2DJQA 2GTOA 2M51A 2RQVA 2L3QA 1AWOA 1BBZA 1WI7A 2JXBA 4OMNA 1UDLA 3REBB 2GBQA 3U23A 1H8KA 2OAWA 2A08A 2YDLA 4RTYA 3I5SA 2KRMA 4R0KA 1WX6A 1Y0MA 5EC7A 1OPKA 3M0PA 2K6DA 3REAB 2D8HA 2O9SA 1M3BA 1E6GA 1XOVA 4KRTA 2YUQA 3NHNA 1FYNA 2EYWA 3UF4A 1Y57A 1HD3A 2YUOA 4JZ4A 4RTTA 2CT3A 2F2XA 2EVRA 4CC2A 1B3QA 1VYTA 2DL4A 3M0TA 2CUBA 2FPEA 1ABQA 3JV3A 4J9FA 2ROLA 4LN2A 2K9GA 2EYXA 3IQLA 1KSWA 1M3AA 2LJ1A 3H0IA 4CC7A 1RLQC 3QWYA 4ESRA 1CSKA 2EQIA 1GFCA 2RQUA 4DEXA 1AOJA 2LMJA 2NUZA 2ED0A 2H8HA 2D1XA 4IIMA 1WXUA 2I0NA 4ORZA 3EHQA 3RBBB 1JXMA 1YNZA 1NEGA 1UHCA 2K2MA 4K11A 3LH5A 1AWXA 3I5RA 2DL3A 5FW9A 2FEIA 2DL7A 5GJWB 2FO0A 5FWCA 2LZ6B 3EG2A 2ENMA 4D8KA 1W1FA 3H41A 1FMKA 4AG1C 2HDAA 4AFSC 2J6OA 1KIKA 1Z9ZA 2A28A 1YN8A 4AFZC 4JJBA 1GCQC 2DF6A 4AFQC 1B07A 1K1ZA 2DYBA 1ARKA 2KXDA 4IIOA 2AZSA 4Z8AA 3VS3A 2O9VA 2PZ1A 3VRYA 3ZL7C 2LNHB 4AG2C 1YWPA 3CQTA 1GCPA 4OMPA 3H0HA 1UG1A 1GBQA 2MIOA 3VRZA 2ECZA 1T0JA 1EFNA 2V1RA 1ZLMA 2KGTA 1K4US 2K79A 4J9DA 2EPDA 1M30A 1WYXA 1BK2A 2CDTA 2FG0A 4HXJA 1OV3A 2EYYA 2HCKA 2DA9A 2X3XD 1X69A 2HBWA 2P4RA 3SHWA 3NMZC 2DL5A 2NWMA 1AWJA 4LNPA 2OJ2A 3H0FA 1UFFA 2DLPA 2CUDA 2ESWA 2BZYA 4OMMA 5IXFA 4WCIA 1ZSGA 2DX1A 1UHFA 1I0CA 4LUEA 1SRLA 2GTJA 2KEAA 1T3SA 2VWFA 5L23A 1WLPB 3VS2A 2JM8A 4GLMA 1GL5A 2VVKA 1SEMA 1JXOA 1T0HA 2KT1A 1GCQA 2KRNA 2LQNA 2XMFA 1BB9A 1JQQA 2KRSA 1X2KA 1SHFA 2L3PA 1X6GA 2RF0A 2G6FX 5IXBA 2J6FA 2LX7A 3SEMA 2CSIA 2GQIA 2RQWA 3EG1A 3NGPA 3M0RA 1T3LA 3RNJA 2ABLA 3EGUA 5IHKA 1VA7A 2DMOA 4Z89A 3FJ5A 4AFUC 1W6XA 2KYBA 1ZUUA 2B86A 3C0CA 1WDXA 2AKKA 2GGRA 1G2BA 3EHRA 2EKHA 1JEGA 2EW3A 2FRYA 1SHGA 3TSWA 4CC4B 2D8JA 4RTVA 4JJDA 5ECAA 1U5SA 2O88A 5FWBA 1PWTA 1E6HA 1JU5C 1PKTA 2EBPA 2OI3A 2DBKA 4OMOA 1NYGA 4D8DA 2DE0X 4FSSA 2J05A 4RTXA 2EGAA 2KYMA 1GBRA 3VS7A 1SPKA 2LCSA 1E7OA 3VS0A 2SRCA 4J9IA 2C0OA 4RTUA 1K76A 2RN8A 3UA6A 2JM9A 2O2OA 4OMLA 1PNJA 1ZX6A 2LJ3A 2YUPA 2DVJA 1X43A 2RMOA 4JZ3A 1QWFA 2W0ZA 2EGCA 4LE9A 1V1CA 2HSPA 2FRWA 2RPNA 5GJVB 2A36A 1PHTA 1SSHA 2F2VA 2BZ8A 3M0UA 4DEYA 3QWXX 2CH4W 1WFWA 1K0XA 1MV3A 2DNUA 2KBTA 1UTIA 2SEMA 1RI9A 2EGEA 1YCSB 2ROTA 2VKNA 1QKXA 2FPDA 3VS5A 5IHNA 1NYFA 1K9AA 2IIMA 2KT8A 1M3CA 1Z9QA 1PRLC 1QKWA 2M0YA 3VS6A 1U06A 3A98A 1AWWA 1UGVA 2O31A 1I1JA 1UE9A 2W10A 3VS4A 2KR3A 2KE9A 1MUZA 2L0AA 4HVWA 2A37A 1GFDA 2RNAA 4HCKA 2LJ0A 1YWOA 2KROA 4F16A 2D0NA 1QCFA 2X3WD 1HJDA 3R6NA 2J6KA 3VS1A 2LQWA 2L2PA 1S1NA 1TUDA 1BU1A 1YP5A 3GBQA 4X1VA 4LUDA 2CSQA 1VYUA 4J9CA 4JJCA 1OPLA 2MCNA 1K0SA 2BZXA 2DBMA 2ED1A 3I9QA 2DL8A 1PKSA 1NLOC 2AKLA 1GRIA 1ZUYA 2RQTA 1A0NB 1JO8A 2J06A 2QDLA 5HCKA 2C0TA 3UA7A 3TSZA 1TG0A 1WXBA 2RQRA 1ABOA 2AK5A 2K7AA 4GBQA 5I11A 4F14A 3ULRB 2HEQA 1MV0B 2KNBB 2BTTA 2CT4A 2E5KA 5I22A 4HVVA 1KJWA 1OOTA 2DM1A 3PE0A 1CKAA 2GNCA 4Z88A 1WXTA 1U3OA 3TVTA 4RTZA 3PVQA 3I35A 1NLPC 3M0QA 1KFZA 4J9HA 3KFVA 1X2QA 1UJYA 2JW4A 2MOXA 4QT7A 5IH2A 2FPFA 1QLYA 2JTEA
chains in the Genus database with same CATH superfamily
2CREA 2GF7A 5CCAA 2CZ0B 1NG2A 3A5ZB 2RI3A 1BIAA 2DEQA 1SSFA 1FMVA 3CCUQ 2L89A 4FL6A 4PLIA 2QEXA 3HL8A 4M78E 4KH1B 4Q5WA 1I07A 2OTLA 1VQKQ 2EKOA 1VQ5T 2V8KA 2OTLT 1TXQA 5FU7C 4X9DA 3OW2A 5CQYA 3CMAA 2RM4A 3H8ZA 1RABB 3CMAT 5KYXA 2CKKA 4QQGA 2AZVA 4OP0A 2O01E 2GCXA 4EMKC 2JS0A 2MK5A 1LVKA 1H3HA 3BFMA 1B34B 1UJ0A 1OQKA 2YHTA 5HY6A 2DPPB 1W70A 4M77E 1JBMA 4FSXA 4J9GA 2DRKA 3KXTA 3X28B 5LJ3g 2DILA 5J39A 2YXYA 1UGRB 1N8RC 2HNIA 4M7AD 4ELZC 1QP2A 1RUWA 3SWNC 4E6RA 4Y91A 3M9QA 2YSQA 5GANj 2M51A 2DD5A 1YIJT 1OX9A 4FW2A 2RQVA 4F7UF 1WI7A 2XU8A 3A8GB 3QDFA 4YTLA 2JXBA 1X01A 3URGA 1UDLA 3U23A 1IB8A 1H8KA 2E3HA 1OYXA 2IVWA 1D0XA 2A08A 3F70A 2YDLA 3MEAA 1EX4A 3CPWS 3I5SA 1BCOA 3O8VA 1YJWA 3JCMP 4KH0B 3OYAA 1YITQ 4OB3B 2ZZDA 2DTIA 1E6GA 5FRMA 2JTEA 2RHZA 1R8OB 4PFOA 1Y57A 4M7DD 3NTIA 2ZPEB 2Y90A 1VQ7A 2CT3A 3MPUB 2F2XA 1K8AU 1IGUA 1VQ7T 1TSFA 2HKQB 4CC2A 3RKYA 3D7SB 3M0TA 2DL4A 1KD1R 2ROLA 4QQDA 3UT1A 3L2UA 1KQSS 3IQLA 1KSWA 3H0IA 2LJ1A 3DB3A 5AT1B 4B9XA 4ESRA 1CSKA 4XU3A 3G71T 1Q81C 1K9MR 4HT9A 1IXDA 3META 3QJ6A 1JXMA 5LJ3h 3GF5A 3HHTB 5D6XA 1UHCA 1SF9A 5GAOp 3JB9I 5GAMe 1AWXA 5FW9A 3ZEHA 2DL7A 1M90R 3E2UA 2DTOA 1W1FA 2GFUA 3EGXB 1G8XA 2COYA 3CC7Q 5CO7A 4FU6A 2LT4A 4IUUA 4LDUA 5CKEA 3GIBA 4C8QD 1KQ2A 3CC4A 2HZYA 2QA4Q 2KXDA 4IIOA 4Z8AA 4E7SA 3VS3A 2O9VA 1PM3A 1YWPA 4OMPA 4BI3A 4XTZA 3SB2A 5GAN4 1EFNA 1YHQA 1P92A 1VQOA 1YHQT 2LT1A 4IUPA 2V1RA 4C92E 5LJ5f 1ZLMA 2DD4A 3LX7A 1GXIE 3CMEQ 1MNEA 2EPDA 1M30A 2JVVA 1W2BP 3OS2A 4BDZA 2FG0A 1OV3A 2X3XD 5J26A 3NMZC 4KUIA 2OJ2A 1VQ4Q 2DLPA 2MYSA 4XU2A 2CUDA 4KGVB 2BZYA 3RR6A 4X34A 2DX1A 1UHFA 1I0CA 1JJ2P 4LUEA 2CZ7B 3NTHA 1M1FA 3MP1A 4JS5A 3CCVQ 1T0HA 2KRNA 3OYJA 2LQNA 4M75B 2HKNA 5LJ5j 1XTDA 3J81E 1YFNA 2GQIA 4OMFB 1WHKA 3CCSA 4KUDK 3NGPA 1VA7A 3QDRB 2FZKB 1NPRA 3JB9D 1W6XA 1ZUUA 3LWIA 3C0CA 1K9MC 5LJ3j 4PJOB 1Q86R 2A0FB 2XDDA 2AKKA 1YJ9T 3GNGA 1M1KR 3X26B 2DETA 1TS9A 1RL2A 2FRYA 3ER0A 1YI2T 1BKBA 2D8JA 4RTVA 2XD0A 4JUVA 2LDMA 3J7AF 4E7ZA 2M02A 4MZTA 4M75D 2CP5A 2OTJA 2PU9B 2DE0X 4M78F 4NOYA 5A0LA 3OS1A 2KYMA 1SPKA 2EAYA 4Z02A 5FRNA 3FDRA 2LQ8A 3JCMf 4N0AA 4F7UA 2E3IA 3LLRA 2LJ3A 2EQKA 2DVJA 1QWFA 2EGCA 2HSPA 3JCMb 4N4HA 1EIFA 1MMGA 1FMWA 2E12A 2BZ8A 3M0UA 2VXEA 3HPWA 3QWXX 1KD1U 1WFWA 4XU0A 2KBTA 4Y28E 2YRCA 2SEMA 4M77F 3CC2Q 1YCSB 2VKNA 3V7RA 1KC8C 2NUTB 5IHNA 4JRKA 1Z9QA 3LH0A 1QKWA 2EWNA 1U06A 2L5QA 1RADB 2CP7A 4NS5A 2A37A 2QGGA 1YCYA 2MAMA 1GFDA 4HCKA 2KROA 1WJRA 5GAMf 3SDZA 1Y96B 1Q82C 3R6NA 2J6KA 4XTVA 1BU1A 5A0DA 5CKDA 2WSFE 2CSQA 1RACB 4RKUE 2RH2A 4JLIA 3NFCA 4RCBA 1OI1A 2MCNA 3I56Q 1NJIR 4PL6A 2DL8A 1QVFS 4XK8E 3KBGA 1NLOC 4M75C 2AKLA 3Q1JA 5KH6A 1KQSP 3BY7A 4O5VA 1TUGB 5AYFA 5HCKA 2C0TA 2K7AA 4F14A 1Q86C 3AHUA 2VV5A 3HP9A 2QYZA 3CCJT 1MV0B 2JTMA 3CBPA 4J8OA 2E64A 2R57A 1KJWA 1OOTA 3PE0A 1CKAA 1U3OA 4RTZA 3M0QA 3V8LA 1IHVA 2QI2A 1VQ9T 4PJOC 4QT7A 4DOVA 4KT0E 3VYGA 1VQMQ 2WACA 2Y4XA 2X9HA 4Y92A 1SG5A 4ANJA 4EIKA 1QWEA 1VOMA 3QUIA 4PJLA 2F5KA 3JCMX 2FHDA 1M4ZA 4J9BA 1PCXA 2C0IA 3CCET 1AZEA 2EIFA 3DB4A 1WHJA 3PGGA 2BIVA 1N5ZA 4CC3A 2X4JA 1VQ8A 4J9EA 3NPFA 1VQ8T 1WHHA 1OX8A 2CH4A 4HVUA 1X6BA 1IZ6A 3CCRQ 3CCLA 2E65A 2H3EB 3EG3A 2DXCA 3QKJA 2E6ZA 2JT4A 4DQ2A 3CXCA 2BE9B 3G6EQ 1OZ3A 1PRMC 1WIEA 4C92F 5KYYB 4RUGA 4EDUA 2X35A 3THKA 2V1QA 4LDWA 2R58A 2QTVA 2JZ2A 2F2WA 2ZCFB 1Y71A 4L5GA 2CP0A 1M1KU 1Q7YU 1Y7XA 5KYWB 2ZAEA 4M4ZA 4DBHA 1X27A 3CCMT 2EYQA 3RERA 1AVZC 1UECA 5KCOA 4HCCA 4R55A 1N8RR 1O75A 2KQWA 4OB2B 1V29B 4F17A 1QW1A 4NL3A 2KI7A 4LDVA 2DJQA 2JJ9A 5CR2A 1VQKA 4A4FA 2L8DA 3I55Q 1AWOA 1M1GA 1UEBA 2YLCA 5GANh 1IGQA 1VQLQ 2KRMA 4ZN1A 3G1JA 5D7UA 3M0PA 2K6DA 4M78A 3OYIA 5GAOn 1XOVA 4KRTA 2YUQA 3NHNA 1FYNA 2EYWA 3LGFA 3RIRA 1RAIB 1ZA1B 3EFSA 1QQJA 4LD9K 4HCZA 2FPEA 1VQNQ 3JV3A 4LN2A 5HKCA 4PFZA 1VQPQ 1MMDA 8ATCB 2XK0A 1FWZA 4PK4A 4CC7A 3HRSA 1RLQC 4A53A 3QSUA 2EQIA 3VU3C 2RQUA 4PLLA 1X75C 3OYEA 1BI2A 2LMJA 2NUZA 3VUBA 2CGHA 1Q81R 2H8HA 2D1XA 5A2QE 3UPUA 4M7DA 3L2ZA 4M77A 4ORZA 3RBBB 3CBOA 2RHXA 2XI9A 1NEGA 1G3TA 2DL3A 2FEIA 2FO0A 2QEXT 4D8KA 4M7AE 4FT4A 1FMKA 5KYUA 4HT8A 3MKDA 4PJNA 2LRQA 3S3MA 3GOXA 2RHYA 2EQJA 3EG9A 1WQ7A 4AFZC 1GCQC 4HA8A 5LJ5g 4A4HA 1RAHB 3JCMd 1NJIU 2AZSA 1UB4A 3BE3A 3S3NA 3VRYA 4AG2C 3CQTA 2QASA 3CXCS 3H0HA 1T0JA 2L3RA 4L6V5 3WVEB 3EFOB 2JUFA 2HQEA 5DLQE 2DERA 4R56A 3SFMA 2MWPA 4ZGEB 4M7DE 1K4US 5GAN6 3NTKA 4E7JA 3OBWA 1LPLA 1M2OA 4J7FA 2DXBA 1WYXA 2QGFB 5EG2A 1QVGP 3V7CA 2KVQG 4F7UG 2DA9A 2XICA 3QZ5B 3SHWA 2DL5A 4E7LA 1S72Q 3G7ZA 1ZQ1A 4LNPA 4M77B 4ATOA 4E47A 4ME7A 2DIQA 2ESWA 2HMAA 4OMMA 3CC7A 4WCIA 3H6ZA 1ZSGA 4V2SA 2RK1A 1SRLA 3MO8A 2GTJA 2KEAA 3LW5E 1PSEA 5L23A 1WLPB 4BB7A 4IUVA 2M16A 5GAMd 4GLMA 2MMPA 4TVRA 3JCMe 1Y07A 3JB9J 2VVKA 1YJWT 1QVFP 1NZ9A 2XMFA 1BB9A 4FIBA 3L2RA 1R0BG 1SHFA 2L3PA 3OS5A 3P8BB 5KYXB 2G6FX 2PVDB 2J6FA 3OSSC 4LD6A 1YJNA 5LJ5h 2LX7A 1YJNT 4C8QE 3ME9A 3CMEA 2CSIA 2X4XA 1VQ5Q 3LWHA 2OTLQ 3EG1A 2JOYA 3RNJA 3EGUA 3CMAQ 1YBYA 1FX7A 1VQ4A 3QBYA 4C92A 1KG1A 4AT1B 4FYYB 2DO3A 1G2BA 2DZ9A 3EHRA 2EKHA 1JEGA 3TSWA 3M5AA 5ECAA 1KHIA 1N8RU 3LGLA 1I5OB 3TCJA 2ATCB 5FWBA 1PWTA 3J80E 3CCVA 1TTHB 3JCMg 3OYKA 3QG1A 2OI3A 5CVIA 1NYGA 2NUPA 4XAXB 4D8DA 4FSSA 2VUBA 3M4GA 1H3ZA 2EGAA 2H3JA 2DAQA 3CC4T 2XHCA 2LCSA 2SRCA 2QTXA 3OW2S 1I5LA 4J9IA 4RTUA 2RN8A 1PG5B 1RAFB 1YIJQ 5GAOr 2YUPA 1X43A 2COWA 2RMOA 4JZ3A 2CZ6B 3M54A 5GMKh 2LNVA 3BDUA 2FRWA 1VQOT 1PHTA 2E70A 5IAYA 1SSHA 2V8JA 2FL7A 4DEYA 1D3BA 2CP2A 1K0XA 1MV3A 2DNUA 1I4K1 4E7IA 3TQ7P 2ROTA 3M58A 4BDYA 4EPCA 1QKXA 3VS5A 1KC8R 1VQ7Q 1M3CA 3OQ5A 2M0YA 5GAMg 1Q81U 1AWWA 1UE9A 1MUZA 2L0AA 3M53A 3QJYA 3OYMA 2RNAA 2DIGA 2LJ0A 3OY9A 3G4SQ 5CKHA 3G71Q 4M77C 4HKEA 1Q82R 3VS1A 2LQWA 1S1NA 1TUDA 2NUPB 4E2FB 1LNXA 1YP5A 2COZA 3MEUA 4M75E 3L2WA 9ATCB 2HBPA 5CKBA 2BZXA 2QQRA 3OYLA 2ED1A 3OYCA 4QW2A 1VIEA 1PKSA 3CCST 5FROA 2DFUA 3EH2A 1A0NB 3CC2A 2KDSA 3MHXA 3TSZA 1WXBA 2QK0A 4VUBA 2AK5A 2P0QA 4GBQA 1HXDA 5GAN5 1LOJA 2MF2A 4J6WA 5GAN8 2EQUA 3AT1B 4BI4A 4PKCC 1W4SA 2KNBB 4O6JA 4HVVA 2DM1A 5I2SA 2GNCA 4M78G 1YHQQ 3PVQA 4L59A 2EJFA 1UJYA 2RJDA 2RI5A 3EGDA 4OGCA 5IH2A 2FPFA 1QLYA 5CAIA 2YUNA 1HSQA 1U1TA 4N4IA 2XDPA 1ZBJA 2OTJT 3QZ9B 4M7AF 1WA7A 3PIPA 5KE2A 2DXTA 1ZSZA 2GQVA 2K5LA 2IPOB 1G83A 5DLOA 3OYNA 3I56A 1VQ6A 4MDXA 1ZUKA 1VQ6T 3CBMA 4KBMB 4C5HA 1NM7A 2KK4A 3GLXA 1BIBA 3TEEA 4A4KA 1U1SA 3EG0A 1SRMA 4QKUA 3PMTA 4M7DG 4M77G 4PJOD 2DRMA 3RMSA 5A0GA 4OF1A 2JNGA 4IUQA 1VUBA 3ZFJA 1TUCA 4MDWA 1M8MA 1HK9A 2YWWA 1AD5A 5I2MA 1K73R 1M8VA 2DVEA 4M7DF 1AEYA 2V26A 2YT6A 1IHWA 1K9MU 1OEBA 4C5IA 3FC3A 7AT1B 3HFOA 1VQMA 3OA6A 1AT1B 3UATA 1UUEA 2K5IA 2VASA 1IREB 3M56A 2RHIA 1XJWB 1D0YA 1M27C 3CPWP 3M59A 1M90U 5FU6B 3O5ZA 1YJ9Q 1WQWA 2HQHA 2GTOA 1W2BA 1BBZA 2E1HA 1YI2Q 4JS4A 5LL6S 2OAWA 3CCRA 3CCRT 4F7UB 4RTYA 4AMCA 4R0KA 1BYMA 4DBFA 1WX6A 1Y0MA 1OU8A 3HRTA 1HYOA 3PTAA 3G6EA 1WHMA 3OYDA 2ZPIB 3REAB 1JJ2A 2D8HA 2LCLA 2O9SA 1M3BA 4C8QF 5GANe 2I2LA 3RKXA 3PMIA 3UF4A 2XIDA 4EMKA 4JZ4A 4RTTA 4ZTJA 2EVRA 4KGXB 1VYTA 4LXCA 3L42A 1ABQA 4BACA 2D9TA 4FT2A 1NPPA 2F5TX 5GAMj 3PFSA 2M0OA 2LC4A 2VGNA 3QWYA 2AIRB 1GFCA 4DEXA 1KC8U 2PUKB 4GLKA 4C0GA 1WXUA 2O4XA 2RO0A 3SWNA 3EHQA 3GPLA 3I55A 5FLXE 3MP8A 2V8IA 4K11A 3CCQA 1KHCA 1M5Q1 2HSEB 3MEWA 5DM7R 3CCQT 3OW2P 3I5RA 5GMKe 5GJWB 5FWCA 3EG2A 1Q82U 2ENMA 3FLGA 3KUFA 4C92G 4AG1C 2HDAA 2J6OA 5GAN3 2LTOA 3OMCA 2E10A 3FJPA 3OYBA 3CCLT 3CD6A 4JJBA 1SKUB 3CD6T 2DF6A 4AFQC 1K1ZA 2DYBA 2FYKA 4C0FA 1ARKA 1K73C 2PZ1A 2LNHB 2RK2A 2DTHA 1GCPA 1V76A 2F69A 1M2VA 1GBQA 4GY5A 2ECZA 2XDBA 4XTUA 1UGPB 1QCNA 3QYGB 1K8AR 1EZZB 3OSVA 1Q86U 2RI2A 1OU9A 4FM4B 3DLMA 4PJJA 4C0ZA 2F1LA 5D6WA 1BK2A 2CDTA 2EYYA 2R5MA 3JB9F 1X69A 5GAOl 2VYTA 5GMKm 2P4RA 3CCUA 4CI0C 3CCUT 3MCAB 1AWJA 3OBYA 3H0FA 3CCJQ 5GAOm 3DKMA 1VQKT 5IXFA 4ZTFA 2WSCE 3GNFB 3QPHA 1T3SA 2VWFA 1VQ9Q 1JRIA 3P8DA 3RDVA 3VS2A 4M75F 2KMTA 5FU6C 3N5BB 3FIFA 1SEMA 3SD4A 4OVAA 2KT1A 4XQ3A 4ZGDB 4M7AA 2JTFA 4IUTA 3TU4K 2P4TA 2KRSA 1X2KA 1X6GA 2RF0A 4PJMA 2FZGB 5IXBA 3CCEQ 5CQXA 4N0AC 1I81A 2K4YA 3SEMA 2CYZB 3RUXA 4J83A 5HK0A 1VQ8Q 1D09B 1M2VB 1ACMB 2RHUA 1ZHIA 2HL5C 2ABLA 3R6OA 2DMOA 4Z89A 4AFUC 3ZBDA 2KYBA 4OB0B 2CP3A 2RA2A 3MJXA 3VV0A 1B34A 2VGMA 1KQSA 2GGRA 1BCMA 1QVPA 4A4GA 2PVOB 2EW3A 4EMGA 2CS7A 1U5SA 2MPXC 4ZN3A 2X51A 2DYIA 2DKGA 3L2QA 1E6HA 5LJ3e 1YITA 1JU5C 1PKTA 2XG8D 2EBPA 1YITT 1D1CA 4OMOA 3OYHA 3CCMQ 2J05A 4RTXA 1N9SA 3OS0A 3X20B 3FRNA 2A7YA 2C0OA 1I8FA 4JRQA 4D6WA 4M78B 3UA6A 2JM9A 4M7AB 2O2OA 2NLUA 4OMLA 1VQ5A 2W0ZA 1PSFA 2VB6A 2RPNA 3UWNA 5GJVB 2A36A 5GANf 4XTXA 3VJPA 1K8AC 1KK7A 4ELYC 2F2VA 2RJCA 2E41A 3TREA 2CH4W 4C8QA 1UTIA 1ZA2B 1RI9A 2EGEA 2B8AA 2QQAA 2Y4YA 3LYIA 4CRIA 2QQBA 3EFRA 5C6SA 2FPDA 2KT8A 1K9AA 4C0DB 4M7DB 2FVUA 3E19A 3A98A 4A4EA 5KE3A 3V7SA 2W10A 3QO3A 1G5VA 2KR3A 3CC7T 1WNLA 3OYYA 4BUGA 1RAGB 4M78D 3EAEA 1YWOA 4XTYA 2QA4A 2DK3A 1QCFA 2QA4T 5KYUB 2X3WD 3PNWC 1TOVA 4E7HA 3QXEB 1YIJA 2L2PA 3H9NA 2FB7A 4X1VA 4LUDA 3EGXA 2MWOA 1VYUA 3EG9B 4HCBA 3JCMV 2YRVA 3S6WA 2AT1B 3HRUA 4J9CA 4JRPA 2RJFA 1H641 3WXMB 2QEXQ 1TWBA 3CMET 3I9QA 4BE1A 1G3YA 2IG0A 4PNOA 1ZUYA 2RQTA 1OULA 4DOWA 2J06A 2QDLA 4DBQA 3UA7A 1TG0A 4M77D 2YLBA 1WZOA 4C8QB 3QHSA 1VQ4T 3ULRB 2HEQA 1R0CB 3A8HB 5I22A 1R77A 2P0PA 4KULA 1RAEB 4P5NA 3X25B 1WXTA 3RKWA 5GMKj 3I35A 1NLPC 4J9HA 3G4SA 2LVMA 3G71A 2JW4A 3G4ST 2MOXA 4XU1A 3HTRA 2O31A 1MMAA 2JS2A 4BY6B 1BI1A 2JMCA 3CCVT 3JCMc 1VYVA 1H92A 1D0ZA 2M1HA 3A8MB 2JMAA 4A54A 2PNIA 3E9FA 3M0SA 2K57A 4J5YA 4RG2A 2J7IA 4OMQA 3M55A 4QVCA 4XTWA 5GAOq 2KXCA 2L3SA 5IN1A 2DXUA 3VYHB 4WTOB 4M75A 2BUDA 2HL3A 3PVLA 3L1AA 4M78C 4A63B 1CKBA 1LCKA 4QVZA 4M7AC 1YJWQ 4JPBW 1WHGA 2PTKA 1RLPC 5J3BA 4DBRA 5GAN7 2D6FA 2PQWA 3VUZA 2HQXA 4JDSA 3X24B 2RD1A 2VC8A 3OB9A 4C92B 1NEBA 5GMKi 5GAN2 3M57A 1YJNQ 2LP5A 5IHIA 2K3BA 2C06A 3DLLA 4B9WA 4PJOA 1AZGB 1BI3A 8AT1B 4ZNXA 2P0KA 3PIOA 1IO6A 3JCMJ 4ZGJB 4C5EA 3E9GA 4C0DC 2EYZA 1J3TA 5HK3A 4M7DC 4RTWA 1G3SA 2HAXA 3INZA 1NE8A 3JAME 3JCMh 1QVGA 1UGSB 2L3QA 2HD0A 3PT9A 5LJ3f 3M4YA 4OMNA 3HFNA 3HKSA 3REBB 2GBQA 2ZPFB 5CK9A 1WHLA 3FB9A 3JB9H 2M9UA 4FW1A 5EC7A 1N27A 3MP6A 1OPKA 4FYVB 4MMKA 5M9OA 2E6NA 2ZGWA 4C92D 5IT9E 3CC2T 3UDCA 3A8LB 3CC4Q 1D3BB 3C94A 1HD3A 2YUOA 1KQ1A 4RCCA 4JJNK 3C4SA 2XKOC 1N9RA 1QVFA 4PJOE 3S3OA 1KD1C 1B3QA 2CUBA 4J9FA 2K9GA 2EYXA 1F1BB 2ZPBB 1TU0B 2QAZA 3HSBA 1M3AA 2NYSA 2PUOB 1VQOQ 4M7AG 1X6OA 1MGQA 4C8QC 5GAMh 1AOJA 2ED0A 4OGEA 2NUTA 4IIMA 1YJ9A 2I0NA 2FZCB 1Q7YR 2K2VA 1YNZA 1D1BA 1YI2A 2K2MA 4MMLA 3ASKA 1G3WA 3LH5A 4NL2A 2EJGA 2EJ9A 1M90C 4UC4A 3A1PA 2LZ6B 3I56T 4BY6C 3H41A 2JN0A 1Y96A 1BI0A 3CXCP 1U8RA 1JB0E 4KGZB 4AFSC 1KIKA 3OMGA 2K5FA 3BW1A 3MEVA 4BI8B 1Z9ZA 5KYNA 2A28A 3FEOA 1YN8A 2QQSA 2BE7D 3QYHB 1XNIA 2G3RA 1B07A 1C1AA 4FYWB 2QQ9A 1WPYA 3V8KA 3ZL7C 3C95A 1UG1A 2CP6A 1NBEB 2KAFA 2MIOA 3VRZA 5GANd 2RJEA 5KCHA 4E7KA 4J7IA 2EFIA 2KGTA 2K79A 4J9DA 4RMOA 1PD0A 1VQMT 3CCSQ 3A8OB 4HXJA 2HCKA 4BD3A 2EQMA 4C92C 2HBWA 3EGDB 2LQKA 2NWMA 3JCMQ 1UFFA 3E1SA 1N6AA 4JRIA 1B7TA 1ZSZB 4C8QG 4RG8A 1QVGS 2BKDN 5CKFA 2K3XA 2JM8A 4F7UE 1GL5A 4PFPA 1JXOA 1GCQA 3G6ET 2OTJQ 1PD1A 1JQQA 2YRDA 4C5GA 2X4WA 2RB6A 2Z0WA 4DA4A 1VQ6Q 3JSCA 2RQWA 3M0RA 2DZCA 1T3LA 5D6YA 5IHKA 1DJ7B 5KYYA 3FJ5A 3T9NA 3OYFA 2B86A 4QVDA 4J6YA 1WDXA 3C12A 4OB1B 3CCJA 1M1KC 1Q7YC 1D1AA 3JCMW 3I55T 1O9SA 1SHGA 5KYWA 1WJSA 1VQLA 4CC4B 1VQ9A 4JJDA 1VQLT 2O88A 3EH1A 2KY9A 2A3LA 2D0QB 1QMCA 4F04B 4WF2A 3VKIA 4EMHA 2E4HA 4JLGA 2DBKA 1OZ2A 2OX7A 4IKFA 2X4YA 1C6VX 5FU7B 3CCEA 1GBRA 3VS7A 1XQHA 1IRXA 5GANg 1E7OA 3VS0A 2QDYB 4N4GA 1K76A 2QXFA 1VQNA 1PNJA 1ZX6A 1MHNA 1VQPA 1VQNT 2LX9A 4BE0A 1VQPT 4BE2A 2VXFA 4LE9A 1V1CA 4EMKB 1ZBXA 3JB9G 4J6XA 3JRZA 6AT1B 2R5AA 4B6MA 5GMKl 2PVGB 3QIIA 2LCCA 1C0MA 1M9SA 4II1A 1FXXA 3CPFA 1MMNA 1UGQB 1NYFA 2IIMA 5LJ5d 1PC0A 5DY9A 2O4XB 1WJQA 1PRLC 4M75G 2KSSA 3SWNB 3VS6A 1UGVA 2OAUA 4FYXB 4QQ6A 1AHJB 1I1JA 3VS4A 2QG9B 2KE9A 4FCYA 4MZMA 1W2BS 4HVWA 1QCOA 3CCMA 5C0MA 1LJOA 2ZPHB 4F16A 2D0NA 1HJDA 1MNDA 4LDYA 4MZPA 5LJ3d 3GBQA 5I21A 1ZSZC 1RAAB 4PJOG 3CPWA 1JJ2S 1TH7A 2CZ1B 1QP3A 3CCQQ 2E5QA 4JJCA 1OPLA 1K0SA 1Q95G 3WVDB 3BDLA 2DBMA 1NJIC 3L2VA 1K73U 3P8HA 2ZPGB 3V8JA 4PJOF 1GRIA 3RMQA 3GP8A 1JO8A 5LJ5e 3CCLQ 2RQRA 1ABOA 1S72A 3OYGA 1WGSA 5I11A 2K3YA 1S72T 3CD6Q 1RI0A 3EFOA 2DJZA 2MI6A 1VIFA 2WSEE 2BTTA 2CT4A 2E5KA 4LDXA 3RESA 2AHJB 2P84A 4Z88A 4IURA 3TVTA 5L8RE 1KFZA 3KFVA 1X2QA 3CEYA 2DEUA 4X9CA 2GFAA 5CIUA
chains in the Genus database with same CATH topology
2YUNA 1HSQA 2JS2A 2CREA 2JMCA 4Y92A 1ZBJA 4EIKA 1QWEA 1VYVA 1NG2A 1H92A 4J9BA 1WA7A 2JMAA 2C0IA 1AZEA 2PNIA 1G83A 1N5ZA 3M0SA 4CC3A 1I07A 1ZUKA 4J9EA 2J7IA 3NPFA 1NM7A 4OMQA 3EG0A 1SRMA 2KXCA 2L3SA 2CH4A 4HVUA 1X6BA 2DRMA 3EG3A 3PVLA 1TUCA 1M8MA 4A63B 1AD5A 1CKBA 1LCKA 2JT4A 4JPBW 2AZVA 2PTKA 1RLPC 1WIEA 1PRMC 1AEYA 2JS0A 4RUGA 1H3HA 3THKA 2V1QA 1NEBA 2YT6A 1UJ0A 2F2WA 2LP5A 5IHIA 1OEBA 2K3BA 1W70A 1AZGB 4J9GA 3UATA 4ZNXA 4M4ZA 2DRKA 1UUEA 1IO6A 1X27A 2DILA 1AVZC 1UECA 1M27C 2EYZA 1J3TA 4RTWA 1RUWA 4E6RA 4F17A 3O5ZA 2YSQA 2DJQA 2GTOA 2M51A 2RQVA 2L3QA 1AWOA 1BBZA 1WI7A 2JXBA 4OMNA 1UDLA 3REBB 2GBQA 3U23A 1H8KA 2OAWA 2A08A 2YDLA 4RTYA 3I5SA 2KRMA 4R0KA 1WX6A 1Y0MA 5EC7A 1OPKA 3M0PA 2K6DA 3REAB 2D8HA 2O9SA 1M3BA 1E6GA 1XOVA 4KRTA 2YUQA 3NHNA 1FYNA 2EYWA 3UF4A 1Y57A 1HD3A 2YUOA 4JZ4A 4RTTA 2CT3A 2F2XA 2EVRA 4CC2A 1B3QA 1VYTA 2DL4A 3M0TA 2CUBA 2FPEA 1ABQA 3JV3A 4J9FA 2ROLA 4LN2A 2K9GA 2EYXA 3IQLA 1KSWA 1M3AA 2LJ1A 3H0IA 4CC7A 1RLQC 3QWYA 4ESRA 1CSKA 2EQIA 1GFCA 2RQUA 4DEXA 1AOJA 2LMJA 2NUZA 2ED0A 2H8HA 2D1XA 4IIMA 1WXUA 2I0NA 4ORZA 3EHQA 3RBBB 1JXMA 1YNZA 1NEGA 1UHCA 2K2MA 4K11A 3LH5A 1AWXA 3I5RA 2DL3A 5FW9A 2FEIA 2DL7A 5GJWB 2FO0A 5FWCA 2LZ6B 3EG2A 2ENMA 4D8KA 1W1FA 3H41A 1FMKA 4AG1C 2HDAA 4AFSC 2J6OA 1KIKA 1Z9ZA 2A28A 1YN8A 4AFZC 4JJBA 1GCQC 2DF6A 4AFQC 1B07A 1K1ZA 2DYBA 1ARKA 2KXDA 4IIOA 2AZSA 4Z8AA 3VS3A 2O9VA 2PZ1A 3VRYA 3ZL7C 2LNHB 4AG2C 1YWPA 3CQTA 1GCPA 4OMPA 3H0HA 1UG1A 1GBQA 2MIOA 3VRZA 2ECZA 1T0JA 1EFNA 2V1RA 1ZLMA 2KGTA 1K4US 2K79A 4J9DA 2EPDA 1M30A 1WYXA 1BK2A 2CDTA 2FG0A 4HXJA 1OV3A 2EYYA 2HCKA 2DA9A 2X3XD 1X69A 2HBWA 2P4RA 3SHWA 3NMZC 2DL5A 2NWMA 1AWJA 4LNPA 2OJ2A 3H0FA 1UFFA 2DLPA 2CUDA 2ESWA 2BZYA 4OMMA 5IXFA 4WCIA 1ZSGA 2DX1A 1UHFA 1I0CA 4LUEA 1SRLA 2GTJA 2KEAA 1T3SA 2VWFA 5L23A 1WLPB 3VS2A 2JM8A 4GLMA 1GL5A 2VVKA 1SEMA 1JXOA 1T0HA 2KT1A 1GCQA 2KRNA 2LQNA 2XMFA 1BB9A 1JQQA 2KRSA 1X2KA 1SHFA 2L3PA 1X6GA 2RF0A 2G6FX 5IXBA 2J6FA 2LX7A 3SEMA 2CSIA 2GQIA 2RQWA 3EG1A 3NGPA 3M0RA 1T3LA 3RNJA 2ABLA 3EGUA 5IHKA 1VA7A 2DMOA 4Z89A 3FJ5A 4AFUC 1W6XA 2KYBA 1ZUUA 2B86A 3C0CA 1WDXA 2AKKA 2GGRA 1G2BA 3EHRA 2EKHA 1JEGA 2EW3A 2FRYA 1SHGA 3TSWA 4CC4B 2D8JA 4RTVA 4JJDA 5ECAA 1U5SA 2O88A 5FWBA 1PWTA 1E6HA 1JU5C 1PKTA 2EBPA 2OI3A 2DBKA 4OMOA 1NYGA 4D8DA 2DE0X 4FSSA 2J05A 4RTXA 2EGAA 2KYMA 1GBRA 3VS7A 1SPKA 2LCSA 1E7OA 3VS0A 2SRCA 4J9IA 2C0OA 4RTUA 1K76A 2RN8A 3UA6A 2JM9A 2O2OA 4OMLA 1PNJA 1ZX6A 2LJ3A 2YUPA 2DVJA 1X43A 2RMOA 4JZ3A 1QWFA 2W0ZA 2EGCA 4LE9A 1V1CA 2HSPA 2FRWA 2RPNA 5GJVB 2A36A 1PHTA 1SSHA 2F2VA 2BZ8A 3M0UA 4DEYA 3QWXX 2CH4W 1WFWA 1K0XA 1MV3A 2DNUA 2KBTA 1UTIA 2SEMA 1RI9A 2EGEA 1YCSB 2ROTA 2VKNA 1QKXA 2FPDA 3VS5A 5IHNA 1NYFA 1K9AA 2IIMA 2KT8A 1M3CA 1Z9QA 1PRLC 1QKWA 2M0YA 3VS6A 1U06A 3A98A 1AWWA 1UGVA 2O31A 1I1JA 1UE9A 2W10A 3VS4A 2KR3A 2KE9A 1MUZA 2L0AA 4HVWA 2A37A 1GFDA 2RNAA 4HCKA 2LJ0A 1YWOA 2KROA 4F16A 2D0NA 1QCFA 2X3WD 1HJDA 3R6NA 2J6KA 3VS1A 2LQWA 2L2PA 1S1NA 1TUDA 1BU1A 1YP5A 3GBQA 4X1VA 4LUDA 2CSQA 1VYUA 4J9CA 4JJCA 1OPLA 2MCNA 1K0SA 2BZXA 2DBMA 2ED1A 3I9QA 2DL8A 1PKSA 1NLOC 2AKLA 1GRIA 1ZUYA 2RQTA 1A0NB 1JO8A 2J06A 2QDLA 5HCKA 2C0TA 3UA7A 3TSZA 1TG0A 1WXBA 2RQRA 1ABOA 2AK5A 2K7AA 4GBQA 5I11A 4F14A 3ULRB 2HEQA 1MV0B 2KNBB 2BTTA 2CT4A 2E5KA 5I22A 4HVVA 1KJWA 1OOTA 2DM1A 3PE0A 1CKAA 2GNCA 4Z88A 1WXTA 1U3OA 3TVTA 4RTZA 3PVQA 3I35A 1NLPC 3M0QA 1KFZA 4J9HA 3KFVA 1X2QA 1UJYA 2JW4A 2MOXA 4QT7A 5IH2A 2FPFA 1QLYA 2JTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUN A;  1HSQ A;  2JS2 A;  2CRE A;  2JMC A;  4Y92 A;  1ZBJ A;  4EIK A;  1QWE A;  1VYV A;  1NG2 A;  1H92 A;  4J9B A;  1WA7 A;  2JMA A;  2C0I A;  1AZE A;  2PNI A;  1G83 A;  1N5Z A;  3M0S A;  4CC3 A;  1I07 A;  1ZUK A;  4J9E A;  2J7I A;  3NPF A;  1NM7 A;  4OMQ A;  3EG0 A;  1SRM A;  2KXC A;  2L3S A;  2CH4 A;  4HVU A;  1X6B A;  2DRM A;  3EG3 A;  3PVL A;  1TUC A;  1M8M A;  4A63 B;  1AD5 A;  1CKB A;  1LCK A;  2JT4 A;  4JPB W;  2AZV A;  2PTK A;  1RLP C;  1WIE A;  1PRM C;  1AEY A;  2JS0 A;  4RUG A;  1H3H A;  3THK A;  2V1Q A;  1NEB A;  2YT6 A;  1UJ0 A;  2F2W A;  2LP5 A;  5IHI A;  1OEB A;  2K3B A;  1W70 A;  1AZG B;  4J9G A;  3UAT A;  4ZNX A;  4M4Z A;  2DRK A;  1UUE A;  1IO6 A;  1X27 A;  2DIL A;  1AVZ C;  1UEC A;  1M27 C;  2EYZ A;  1J3T A;  4RTW A;  1RUW A;  4E6R A;  4F17 A;  3O5Z A;  2YSQ A;  2DJQ A;  2GTO A;  2M51 A;  2RQV A;  2L3Q A;  1AWO A;  1BBZ A;  1WI7 A;  2JXB A;  4OMN A;  1UDL A;  3REB B;  2GBQ A;  3U23 A;  1H8K A;  2OAW A;  2A08 A;  2YDL A;  4RTY A;  3I5S A;  2KRM A;  4R0K A;  1WX6 A;  1Y0M A;  5EC7 A;  1OPK A;  3M0P A;  2K6D A;  3REA B;  2D8H A;  2O9S A;  1M3B A;  1E6G A;  1XOV A;  4KRT A;  2YUQ A;  3NHN A;  1FYN A;  2EYW A;  3UF4 A;  1Y57 A;  1HD3 A;  2YUO A;  4JZ4 A;  4RTT A;  2CT3 A;  2F2X A;  2EVR A;  4CC2 A;  1B3Q A;  1VYT A;  2DL4 A;  3M0T A;  2CUB A;  2FPE A;  1ABQ A;  3JV3 A;  4J9F A;  2ROL A;  4LN2 A;  2K9G A;  2EYX A;  3IQL A;  1KSW A;  1M3A A;  2LJ1 A;  3H0I A;  4CC7 A;  1RLQ C;  3QWY A;  4ESR A;  1CSK A;  2EQI A;  1GFC A;  2RQU A;  4DEX A;  1AOJ A;  2LMJ A;  2NUZ A;  2ED0 A;  2H8H A;  2D1X A;  4IIM A;  1WXU A;  2I0N A;  4ORZ A;  3EHQ A;  3RBB B;  1JXM A;  1YNZ A;  1NEG A;  1UHC A;  2K2M A;  4K11 A;  3LH5 A;  1AWX A;  3I5R A;  2DL3 A;  5FW9 A;  2FEI A;  2DL7 A;  5GJW B;  2FO0 A;  5FWC A;  2LZ6 B;  3EG2 A;  2ENM A;  4D8K A;  1W1F A;  3H41 A;  1FMK A;  4AG1 C;  2HDA A;  4AFS C;  2J6O A;  1KIK A;  1Z9Z A;  2A28 A;  1YN8 A;  4AFZ C;  4JJB A;  1GCQ C;  2DF6 A;  4AFQ C;  1B07 A;  1K1Z A;  2DYB A;  1ARK A;  2KXD A;  4IIO A;  2AZS A;  4Z8A A;  3VS3 A;  2O9V A;  2PZ1 A;  3VRY A;  3ZL7 C;  2LNH B;  4AG2 C;  1YWP A;  3CQT A;  1GCP A;  4OMP A;  3H0H A;  1UG1 A;  1GBQ A;  2MIO A;  3VRZ A;  2ECZ A;  1T0J A;  1EFN A;  2V1R A;  1ZLM A;  2KGT A;  1K4U S;  2K79 A;  4J9D A;  2EPD A;  1M30 A;  1WYX A;  1BK2 A;  2CDT A;  2FG0 A;  4HXJ A;  1OV3 A;  2EYY A;  2HCK A;  2DA9 A;  2X3X D;  1X69 A;  2HBW A;  2P4R A;  3SHW A;  3NMZ C;  2DL5 A;  2NWM A;  1AWJ A;  4LNP A;  2OJ2 A;  3H0F A;  1UFF A;  2DLP A;  2CUD A;  2ESW A;  2BZY A;  4OMM A;  5IXF A;  4WCI A;  1ZSG A;  2DX1 A;  1UHF A;  1I0C A;  4LUE A;  1SRL A;  2GTJ A;  2KEA A;  1T3S A;  2VWF A;  5L23 A;  1WLP B;  3VS2 A;  2JM8 A;  4GLM A;  1GL5 A;  2VVK A;  1SEM A;  1JXO A;  1T0H A;  2KT1 A;  1GCQ A;  2KRN A;  2LQN A;  2XMF A;  1BB9 A;  1JQQ A;  2KRS A;  1X2K A;  1SHF A;  2L3P A;  1X6G A;  2RF0 A;  2G6F X;  5IXB A;  2J6F A;  2LX7 A;  3SEM A;  2CSI A;  2GQI A;  2RQW A;  3EG1 A;  3NGP A;  3M0R A;  1T3L A;  3RNJ A;  2ABL A;  3EGU A;  5IHK A;  1VA7 A;  2DMO A;  4Z89 A;  3FJ5 A;  4AFU C;  1W6X A;  2KYB A;  1ZUU A;  2B86 A;  3C0C A;  1WDX A;  2AKK A;  2GGR A;  1G2B A;  3EHR A;  2EKH A;  1JEG A;  2EW3 A;  2FRY A;  1SHG A;  3TSW A;  4CC4 B;  2D8J A;  4RTV A;  4JJD A;  5ECA A;  1U5S A;  2O88 A;  5FWB A;  1PWT A;  1E6H A;  1JU5 C;  1PKT A;  2EBP A;  2OI3 A;  2DBK A;  4OMO A;  1NYG A;  4D8D A;  2DE0 X;  4FSS A;  2J05 A;  4RTX A;  2EGA A;  2KYM A;  1GBR A;  3VS7 A;  1SPK A;  2LCS A;  1E7O A;  3VS0 A;  2SRC A;  4J9I A;  2C0O A;  4RTU A;  1K76 A;  2RN8 A;  3UA6 A;  2JM9 A;  2O2O A;  4OML A;  1PNJ A;  1ZX6 A;  2LJ3 A;  2YUP A;  2DVJ A;  1X43 A;  2RMO A;  4JZ3 A;  1QWF A;  2W0Z A;  2EGC A;  4LE9 A;  1V1C A;  2HSP A;  2FRW A;  2RPN A;  5GJV B;  2A36 A;  1PHT A;  1SSH A;  2F2V A;  2BZ8 A;  3M0U A;  4DEY A;  3QWX X;  2CH4 W;  1WFW A;  1K0X A;  1MV3 A;  2DNU A;  2KBT A;  1UTI A;  2SEM A;  1RI9 A;  2EGE A;  1YCS B;  2ROT A;  2VKN A;  1QKX A;  2FPD A;  3VS5 A;  5IHN A;  1NYF A;  1K9A A;  2IIM A;  2KT8 A;  1M3C A;  1Z9Q A;  1PRL C;  1QKW A;  2M0Y A;  3VS6 A;  1U06 A;  3A98 A;  1AWW A;  1UGV A;  2O31 A;  1I1J A;  1UE9 A;  2W10 A;  3VS4 A;  2KR3 A;  2KE9 A;  1MUZ A;  2L0A A;  4HVW A;  2A37 A;  1GFD A;  2RNA A;  4HCK A;  2LJ0 A;  1YWO A;  2KRO A;  4F16 A;  2D0N A;  1QCF A;  2X3W D;  1HJD A;  3R6N A;  2J6K A;  3VS1 A;  2LQW A;  2L2P A;  1S1N A;  1TUD A;  1BU1 A;  1YP5 A;  3GBQ A;  4X1V A;  4LUD A;  2CSQ A;  1VYU A;  4J9C A;  4JJC A;  1OPL A;  2MCN A;  1K0S A;  2BZX A;  2DBM A;  2ED1 A;  3I9Q A;  2DL8 A;  1PKS A;  1NLO C;  2AKL A;  1GRI A;  1ZUY A;  2RQT A;  1A0N B;  1JO8 A;  2J06 A;  2QDL A;  5HCK A;  2C0T A;  3UA7 A;  3TSZ A;  1TG0 A;  1WXB A;  2RQR A;  1ABO A;  2AK5 A;  2K7A A;  4GBQ A;  5I11 A;  4F14 A;  3ULR B;  2HEQ A;  1MV0 B;  2KNB B;  2BTT A;  2CT4 A;  2E5K A;  5I22 A;  4HVV A;  1KJW A;  1OOT A;  2DM1 A;  3PE0 A;  1CKA A;  2GNC A;  4Z88 A;  1WXT A;  1U3O A;  3TVT A;  4RTZ A;  3PVQ A;  3I35 A;  1NLP C;  3M0Q A;  1KFZ A;  4J9H A;  3KFV A;  1X2Q A;  1UJY A;  2JW4 A;  2MOX A;  4QT7 A;  5IH2 A;  2FPF A;  1QLY A;  2JTE A; 
#chains in the Genus database with same CATH topology
 2CRE A;  2GF7 A;  5CCA A;  2CZ0 B;  1NG2 A;  3A5Z B;  2RI3 A;  1BIA A;  2DEQ A;  1SSF A;  1FMV A;  3CCU Q;  2L89 A;  4FL6 A;  4PLI A;  2QEX A;  3HL8 A;  4M78 E;  4KH1 B;  4Q5W A;  1I07 A;  2OTL A;  1VQK Q;  2EKO A;  1VQ5 T;  2V8K A;  2OTL T;  1TXQ A;  5FU7 C;  4X9D A;  3OW2 A;  5CQY A;  3CMA A;  2RM4 A;  3H8Z A;  1RAB B;  3CMA T;  5KYX A;  2CKK A;  4QQG A;  2AZV A;  4OP0 A;  2O01 E;  2GCX A;  4EMK C;  2JS0 A;  2MK5 A;  1LVK A;  1H3H A;  3BFM A;  1B34 B;  1UJ0 A;  1OQK A;  2YHT A;  5HY6 A;  2DPP B;  1W70 A;  4M77 E;  1JBM A;  4FSX A;  4J9G A;  2DRK A;  3KXT A;  3X28 B;  5LJ3 g;  2DIL A;  5J39 A;  2YXY A;  1UGR B;  1N8R C;  2HNI A;  4M7A D;  4ELZ C;  1QP2 A;  1RUW A;  3SWN C;  4E6R A;  4Y91 A;  3M9Q A;  2YSQ A;  5GAN j;  2M51 A;  2DD5 A;  1YIJ T;  1OX9 A;  4FW2 A;  2RQV A;  4F7U F;  1WI7 A;  2XU8 A;  3A8G B;  3QDF A;  4YTL A;  2JXB A;  1X01 A;  3URG A;  1UDL A;  3U23 A;  1IB8 A;  1H8K A;  2E3H A;  1OYX A;  2IVW A;  1D0X A;  2A08 A;  3F70 A;  2YDL A;  3MEA A;  1EX4 A;  3CPW S;  3I5S A;  1BCO A;  3O8V A;  1YJW A;  3JCM P;  4KH0 B;  3OYA A;  1YIT Q;  4OB3 B;  2ZZD A;  2DTI A;  1E6G A;  5FRM A;  2JTE A;  2RHZ A;  1R8O B;  4PFO A;  1Y57 A;  4M7D D;  3NTI A;  2ZPE B;  2Y90 A;  1VQ7 A;  2CT3 A;  3MPU B;  2F2X A;  1K8A U;  1IGU A;  1VQ7 T;  1TSF A;  2HKQ B;  4CC2 A;  3RKY A;  3D7S B;  3M0T A;  2DL4 A;  1KD1 R;  2ROL A;  4QQD A;  3UT1 A;  3L2U A;  1KQS S;  3IQL A;  1KSW A;  3H0I A;  2LJ1 A;  3DB3 A;  5AT1 B;  4B9X A;  4ESR A;  1CSK A;  4XU3 A;  3G71 T;  1Q81 C;  1K9M R;  4HT9 A;  1IXD A;  3MET A;  3QJ6 A;  1JXM A;  5LJ3 h;  3GF5 A;  3HHT B;  5D6X A;  1UHC A;  1SF9 A;  5GAO p;  3JB9 I;  5GAM e;  1AWX A;  5FW9 A;  3ZEH A;  2DL7 A;  1M90 R;  3E2U A;  2DTO A;  1W1F A;  2GFU A;  3EGX B;  1G8X A;  2COY A;  3CC7 Q;  5CO7 A;  4FU6 A;  2LT4 A;  4IUU A;  4LDU A;  5CKE A;  3GIB A;  4C8Q D;  1KQ2 A;  3CC4 A;  2HZY A;  2QA4 Q;  2KXD A;  4IIO A;  4Z8A A;  4E7S A;  3VS3 A;  2O9V A;  1PM3 A;  1YWP A;  4OMP A;  4BI3 A;  4XTZ A;  3SB2 A;  5GAN 4;  1EFN A;  1YHQ A;  1P92 A;  1VQO A;  1YHQ T;  2LT1 A;  4IUP A;  2V1R A;  4C92 E;  5LJ5 f;  1ZLM A;  2DD4 A;  3LX7 A;  1GXI E;  3CME Q;  1MNE A;  2EPD A;  1M30 A;  2JVV A;  1W2B P;  3OS2 A;  4BDZ A;  2FG0 A;  1OV3 A;  2X3X D;  5J26 A;  3NMZ C;  4KUI A;  2OJ2 A;  1VQ4 Q;  2DLP A;  2MYS A;  4XU2 A;  2CUD A;  4KGV B;  2BZY A;  3RR6 A;  4X34 A;  2DX1 A;  1UHF A;  1I0C A;  1JJ2 P;  4LUE A;  2CZ7 B;  3NTH A;  1M1F A;  3MP1 A;  4JS5 A;  3CCV Q;  1T0H A;  2KRN A;  3OYJ A;  2LQN A;  4M75 B;  2HKN A;  5LJ5 j;  1XTD A;  3J81 E;  1YFN A;  2GQI A;  4OMF B;  1WHK A;  3CCS A;  4KUD K;  3NGP A;  1VA7 A;  3QDR B;  2FZK B;  1NPR A;  3JB9 D;  1W6X A;  1ZUU A;  3LWI A;  3C0C A;  1K9M C;  5LJ3 j;  4PJO B;  1Q86 R;  2A0F B;  2XDD A;  2AKK A;  1YJ9 T;  3GNG A;  1M1K R;  3X26 B;  2DET A;  1TS9 A;  1RL2 A;  2FRY A;  3ER0 A;  1YI2 T;  1BKB A;  2D8J A;  4RTV A;  2XD0 A;  4JUV A;  2LDM A;  3J7A F;  4E7Z A;  2M02 A;  4MZT A;  4M75 D;  2CP5 A;  2OTJ A;  2PU9 B;  2DE0 X;  4M78 F;  4NOY A;  5A0L A;  3OS1 A;  2KYM A;  1SPK A;  2EAY A;  4Z02 A;  5FRN A;  3FDR A;  2LQ8 A;  3JCM f;  4N0A A;  4F7U A;  2E3I A;  3LLR A;  2LJ3 A;  2EQK A;  2DVJ A;  1QWF A;  2EGC A;  2HSP A;  3JCM b;  4N4H A;  1EIF A;  1MMG A;  1FMW A;  2E12 A;  2BZ8 A;  3M0U A;  2VXE A;  3HPW A;  3QWX X;  1KD1 U;  1WFW A;  4XU0 A;  2KBT A;  4Y28 E;  2YRC A;  2SEM A;  4M77 F;  3CC2 Q;  1YCS B;  2VKN A;  3V7R A;  1KC8 C;  2NUT B;  5IHN A;  4JRK A;  1Z9Q A;  3LH0 A;  1QKW A;  2EWN A;  1U06 A;  2L5Q A;  1RAD B;  2CP7 A;  4NS5 A;  2A37 A;  2QGG A;  1YCY A;  2MAM A;  1GFD A;  4HCK A;  2KRO A;  1WJR A;  5GAM f;  3SDZ A;  1Y96 B;  1Q82 C;  3R6N A;  2J6K A;  4XTV A;  1BU1 A;  5A0D A;  5CKD A;  2WSF E;  2CSQ A;  1RAC B;  4RKU E;  2RH2 A;  4JLI A;  3NFC A;  4RCB A;  1OI1 A;  2MCN A;  3I56 Q;  1NJI R;  4PL6 A;  2DL8 A;  1QVF S;  4XK8 E;  3KBG A;  1NLO C;  4M75 C;  2AKL A;  3Q1J A;  5KH6 A;  1KQS P;  3BY7 A;  4O5V A;  1TUG B;  5AYF A;  5HCK A;  2C0T A;  2K7A A;  4F14 A;  1Q86 C;  3AHU A;  2VV5 A;  3HP9 A;  2QYZ A;  3CCJ T;  1MV0 B;  2JTM A;  3CBP A;  4J8O A;  2E64 A;  2R57 A;  1KJW A;  1OOT A;  3PE0 A;  1CKA A;  1U3O A;  4RTZ A;  3M0Q A;  3V8L A;  1IHV A;  2QI2 A;  1VQ9 T;  4PJO C;  4QT7 A;  4DOV A;  4KT0 E;  3VYG A;  1VQM Q;  2WAC A;  2Y4X A;  2X9H A;  4Y92 A;  1SG5 A;  4ANJ A;  4EIK A;  1QWE A;  1VOM A;  3QUI A;  4PJL A;  2F5K A;  3JCM X;  2FHD A;  1M4Z A;  4J9B A;  1PCX A;  2C0I A;  3CCE T;  1AZE A;  2EIF A;  3DB4 A;  1WHJ A;  3PGG A;  2BIV A;  1N5Z A;  4CC3 A;  2X4J A;  1VQ8 A;  4J9E A;  3NPF A;  1VQ8 T;  1WHH A;  1OX8 A;  2CH4 A;  4HVU A;  1X6B A;  1IZ6 A;  3CCR Q;  3CCL A;  2E65 A;  2H3E B;  3EG3 A;  2DXC A;  3QKJ A;  2E6Z A;  2JT4 A;  4DQ2 A;  3CXC A;  2BE9 B;  3G6E Q;  1OZ3 A;  1PRM C;  1WIE A;  4C92 F;  5KYY B;  4RUG A;  4EDU A;  2X35 A;  3THK A;  2V1Q A;  4LDW A;  2R58 A;  2QTV A;  2JZ2 A;  2F2W A;  2ZCF B;  1Y71 A;  4L5G A;  2CP0 A;  1M1K U;  1Q7Y U;  1Y7X A;  5KYW B;  2ZAE A;  4M4Z A;  4DBH A;  1X27 A;  3CCM T;  2EYQ A;  3RER A;  1AVZ C;  1UEC A;  5KCO A;  4HCC A;  4R55 A;  1N8R R;  1O75 A;  2KQW A;  4OB2 B;  1V29 B;  4F17 A;  1QW1 A;  4NL3 A;  2KI7 A;  4LDV A;  2DJQ A;  2JJ9 A;  5CR2 A;  1VQK A;  4A4F A;  2L8D A;  3I55 Q;  1AWO A;  1M1G A;  1UEB A;  2YLC A;  5GAN h;  1IGQ A;  1VQL Q;  2KRM A;  4ZN1 A;  3G1J A;  5D7U A;  3M0P A;  2K6D A;  4M78 A;  3OYI A;  5GAO n;  1XOV A;  4KRT A;  2YUQ A;  3NHN A;  1FYN A;  2EYW A;  3LGF A;  3RIR A;  1RAI B;  1ZA1 B;  3EFS A;  1QQJ A;  4LD9 K;  4HCZ A;  2FPE A;  1VQN Q;  3JV3 A;  4LN2 A;  5HKC A;  4PFZ A;  1VQP Q;  1MMD A;  8ATC B;  2XK0 A;  1FWZ A;  4PK4 A;  4CC7 A;  3HRS A;  1RLQ C;  4A53 A;  3QSU A;  2EQI A;  3VU3 C;  2RQU A;  4PLL A;  1X75 C;  3OYE A;  1BI2 A;  2LMJ A;  2NUZ A;  3VUB A;  2CGH A;  1Q81 R;  2H8H A;  2D1X A;  5A2Q E;  3UPU A;  4M7D A;  3L2Z A;  4M77 A;  4ORZ A;  3RBB B;  3CBO A;  2RHX A;  2XI9 A;  1NEG A;  1G3T A;  2DL3 A;  2FEI A;  2FO0 A;  2QEX T;  4D8K A;  4M7A E;  4FT4 A;  1FMK A;  5KYU A;  4HT8 A;  3MKD A;  4PJN A;  2LRQ A;  3S3M A;  3GOX A;  2RHY A;  2EQJ A;  3EG9 A;  1WQ7 A;  4AFZ C;  1GCQ C;  4HA8 A;  5LJ5 g;  4A4H A;  1RAH B;  3JCM d;  1NJI U;  2AZS A;  1UB4 A;  3BE3 A;  3S3N A;  3VRY A;  4AG2 C;  3CQT A;  2QAS A;  3CXC S;  3H0H A;  1T0J A;  2L3R A;  4L6V 5;  3WVE B;  3EFO B;  2JUF A;  2HQE A;  5DLQ E;  2DER A;  4R56 A;  3SFM A;  2MWP A;  4ZGE B;  4M7D E;  1K4U S;  5GAN 6;  3NTK A;  4E7J A;  3OBW A;  1LPL A;  1M2O A;  4J7F A;  2DXB A;  1WYX A;  2QGF B;  5EG2 A;  1QVG P;  3V7C A;  2KVQ G;  4F7U G;  2DA9 A;  2XIC A;  3QZ5 B;  3SHW A;  2DL5 A;  4E7L A;  1S72 Q;  3G7Z A;  1ZQ1 A;  4LNP A;  4M77 B;  4ATO A;  4E47 A;  4ME7 A;  2DIQ A;  2ESW A;  2HMA A;  4OMM A;  3CC7 A;  4WCI A;  3H6Z A;  1ZSG A;  4V2S A;  2RK1 A;  1SRL A;  3MO8 A;  2GTJ A;  2KEA A;  3LW5 E;  1PSE A;  5L23 A;  1WLP B;  4BB7 A;  4IUV A;  2M16 A;  5GAM d;  4GLM A;  2MMP A;  4TVR A;  3JCM e;  1Y07 A;  3JB9 J;  2VVK A;  1YJW T;  1QVF P;  1NZ9 A;  2XMF A;  1BB9 A;  4FIB A;  3L2R A;  1R0B G;  1SHF A;  2L3P A;  3OS5 A;  3P8B B;  5KYX B;  2G6F X;  2PVD B;  2J6F A;  3OSS C;  4LD6 A;  1YJN A;  5LJ5 h;  2LX7 A;  1YJN T;  4C8Q E;  3ME9 A;  3CME A;  2CSI A;  2X4X A;  1VQ5 Q;  3LWH A;  2OTL Q;  3EG1 A;  2JOY A;  3RNJ A;  3EGU A;  3CMA Q;  1YBY A;  1FX7 A;  1VQ4 A;  3QBY A;  4C92 A;  1KG1 A;  4AT1 B;  4FYY B;  2DO3 A;  1G2B A;  2DZ9 A;  3EHR A;  2EKH A;  1JEG A;  3TSW A;  3M5A A;  5ECA A;  1KHI A;  1N8R U;  3LGL A;  1I5O B;  3TCJ A;  2ATC B;  5FWB A;  1PWT A;  3J80 E;  3CCV A;  1TTH B;  3JCM g;  3OYK A;  3QG1 A;  2OI3 A;  5CVI A;  1NYG A;  2NUP A;  4XAX B;  4D8D A;  4FSS A;  2VUB A;  3M4G A;  1H3Z A;  2EGA A;  2H3J A;  2DAQ A;  3CC4 T;  2XHC A;  2LCS A;  2SRC A;  2QTX A;  3OW2 S;  1I5L A;  4J9I A;  4RTU A;  2RN8 A;  1PG5 B;  1RAF B;  1YIJ Q;  5GAO r;  2YUP A;  1X43 A;  2COW A;  2RMO A;  4JZ3 A;  2CZ6 B;  3M54 A;  5GMK h;  2LNV A;  3BDU A;  2FRW A;  1VQO T;  1PHT A;  2E70 A;  5IAY A;  1SSH A;  2V8J A;  2FL7 A;  4DEY A;  1D3B A;  2CP2 A;  1K0X A;  1MV3 A;  2DNU A;  1I4K 1;  4E7I A;  3TQ7 P;  2ROT A;  3M58 A;  4BDY A;  4EPC A;  1QKX A;  3VS5 A;  1KC8 R;  1VQ7 Q;  1M3C A;  3OQ5 A;  2M0Y A;  5GAM g;  1Q81 U;  1AWW A;  1UE9 A;  1MUZ A;  2L0A A;  3M53 A;  3QJY A;  3OYM A;  2RNA A;  2DIG A;  2LJ0 A;  3OY9 A;  3G4S Q;  5CKH A;  3G71 Q;  4M77 C;  4HKE A;  1Q82 R;  3VS1 A;  2LQW A;  1S1N A;  1TUD A;  2NUP B;  4E2F B;  1LNX A;  1YP5 A;  2COZ A;  3MEU A;  4M75 E;  3L2W A;  9ATC B;  2HBP A;  5CKB A;  2BZX A;  2QQR A;  3OYL A;  2ED1 A;  3OYC A;  4QW2 A;  1VIE A;  1PKS A;  3CCS T;  5FRO A;  2DFU A;  3EH2 A;  1A0N B;  3CC2 A;  2KDS A;  3MHX A;  3TSZ A;  1WXB A;  2QK0 A;  4VUB A;  2AK5 A;  2P0Q A;  4GBQ A;  1HXD A;  5GAN 5;  1LOJ A;  2MF2 A;  4J6W A;  5GAN 8;  2EQU A;  3AT1 B;  4BI4 A;  4PKC C;  1W4S A;  2KNB B;  4O6J A;  4HVV A;  2DM1 A;  5I2S A;  2GNC A;  4M78 G;  1YHQ Q;  3PVQ A;  4L59 A;  2EJF A;  1UJY A;  2RJD A;  2RI5 A;  3EGD A;  4OGC A;  5IH2 A;  2FPF A;  1QLY A;  5CAI A;  2YUN A;  1HSQ A;  1U1T A;  4N4I A;  2XDP A;  1ZBJ A;  2OTJ T;  3QZ9 B;  4M7A F;  1WA7 A;  3PIP A;  5KE2 A;  2DXT A;  1ZSZ A;  2GQV A;  2K5L A;  2IPO B;  1G83 A;  5DLO A;  3OYN A;  3I56 A;  1VQ6 A;  4MDX A;  1ZUK A;  1VQ6 T;  3CBM A;  4KBM B;  4C5H A;  1NM7 A;  2KK4 A;  3GLX A;  1BIB A;  3TEE A;  4A4K A;  1U1S A;  3EG0 A;  1SRM A;  4QKU A;  3PMT A;  4M7D G;  4M77 G;  4PJO D;  2DRM A;  3RMS A;  5A0G A;  4OF1 A;  2JNG A;  4IUQ A;  1VUB A;  3ZFJ A;  1TUC A;  4MDW A;  1M8M A;  1HK9 A;  2YWW A;  1AD5 A;  5I2M A;  1K73 R;  1M8V A;  2DVE A;  4M7D F;  1AEY A;  2V26 A;  2YT6 A;  1IHW A;  1K9M U;  1OEB A;  4C5I A;  3FC3 A;  7AT1 B;  3HFO A;  1VQM A;  3OA6 A;  1AT1 B;  3UAT A;  1UUE A;  2K5I A;  2VAS A;  1IRE B;  3M56 A;  2RHI A;  1XJW B;  1D0Y A;  1M27 C;  3CPW P;  3M59 A;  1M90 U;  5FU6 B;  3O5Z A;  1YJ9 Q;  1WQW A;  2HQH A;  2GTO A;  1W2B A;  1BBZ A;  2E1H A;  1YI2 Q;  4JS4 A;  5LL6 S;  2OAW A;  3CCR A;  3CCR T;  4F7U B;  4RTY A;  4AMC A;  4R0K A;  1BYM A;  4DBF A;  1WX6 A;  1Y0M A;  1OU8 A;  3HRT A;  1HYO A;  3PTA A;  3G6E A;  1WHM A;  3OYD A;  2ZPI B;  3REA B;  1JJ2 A;  2D8H A;  2LCL A;  2O9S A;  1M3B A;  4C8Q F;  5GAN e;  2I2L A;  3RKX A;  3PMI A;  3UF4 A;  2XID A;  4EMK A;  4JZ4 A;  4RTT A;  4ZTJ A;  2EVR A;  4KGX B;  1VYT A;  4LXC A;  3L42 A;  1ABQ A;  4BAC A;  2D9T A;  4FT2 A;  1NPP A;  2F5T X;  5GAM j;  3PFS A;  2M0O A;  2LC4 A;  2VGN A;  3QWY A;  2AIR B;  1GFC A;  4DEX A;  1KC8 U;  2PUK B;  4GLK A;  4C0G A;  1WXU A;  2O4X A;  2RO0 A;  3SWN A;  3EHQ A;  3GPL A;  3I55 A;  5FLX E;  3MP8 A;  2V8I A;  4K11 A;  3CCQ A;  1KHC A;  1M5Q 1;  2HSE B;  3MEW A;  5DM7 R;  3CCQ T;  3OW2 P;  3I5R A;  5GMK e;  5GJW B;  5FWC A;  3EG2 A;  1Q82 U;  2ENM A;  3FLG A;  3KUF A;  4C92 G;  4AG1 C;  2HDA A;  2J6O A;  5GAN 3;  2LTO A;  3OMC A;  2E10 A;  3FJP A;  3OYB A;  3CCL T;  3CD6 A;  4JJB A;  1SKU B;  3CD6 T;  2DF6 A;  4AFQ C;  1K1Z A;  2DYB A;  2FYK A;  4C0F A;  1ARK A;  1K73 C;  2PZ1 A;  2LNH B;  2RK2 A;  2DTH A;  1GCP A;  1V76 A;  2F69 A;  1M2V A;  1GBQ A;  4GY5 A;  2ECZ A;  2XDB A;  4XTU A;  1UGP B;  1QCN A;  3QYG B;  1K8A R;  1EZZ B;  3OSV A;  1Q86 U;  2RI2 A;  1OU9 A;  4FM4 B;  3DLM A;  4PJJ A;  4C0Z A;  2F1L A;  5D6W A;  1BK2 A;  2CDT A;  2EYY A;  2R5M A;  3JB9 F;  1X69 A;  5GAO l;  2VYT A;  5GMK m;  2P4R A;  3CCU A;  4CI0 C;  3CCU T;  3MCA B;  1AWJ A;  3OBY A;  3H0F A;  3CCJ Q;  5GAO m;  3DKM A;  1VQK T;  5IXF A;  4ZTF A;  2WSC E;  3GNF B;  3QPH A;  1T3S A;  2VWF A;  1VQ9 Q;  1JRI A;  3P8D A;  3RDV A;  3VS2 A;  4M75 F;  2KMT A;  5FU6 C;  3N5B B;  3FIF A;  1SEM A;  3SD4 A;  4OVA A;  2KT1 A;  4XQ3 A;  4ZGD B;  4M7A A;  2JTF A;  4IUT A;  3TU4 K;  2P4T A;  2KRS A;  1X2K A;  1X6G A;  2RF0 A;  4PJM A;  2FZG B;  5IXB A;  3CCE Q;  5CQX A;  4N0A C;  1I81 A;  2K4Y A;  3SEM A;  2CYZ B;  3RUX A;  4J83 A;  5HK0 A;  1VQ8 Q;  1D09 B;  1M2V B;  1ACM B;  2RHU A;  1ZHI A;  2HL5 C;  2ABL A;  3R6O A;  2DMO A;  4Z89 A;  4AFU C;  3ZBD A;  2KYB A;  4OB0 B;  2CP3 A;  2RA2 A;  3MJX A;  3VV0 A;  1B34 A;  2VGM A;  1KQS A;  2GGR A;  1BCM A;  1QVP A;  4A4G A;  2PVO B;  2EW3 A;  4EMG A;  2CS7 A;  1U5S A;  2MPX C;  4ZN3 A;  2X51 A;  2DYI A;  2DKG A;  3L2Q A;  1E6H A;  5LJ3 e;  1YIT A;  1JU5 C;  1PKT A;  2XG8 D;  2EBP A;  1YIT T;  1D1C A;  4OMO A;  3OYH A;  3CCM Q;  2J05 A;  4RTX A;  1N9S A;  3OS0 A;  3X20 B;  3FRN A;  2A7Y A;  2C0O A;  1I8F A;  4JRQ A;  4D6W A;  4M78 B;  3UA6 A;  2JM9 A;  4M7A B;  2O2O A;  2NLU A;  4OML A;  1VQ5 A;  2W0Z A;  1PSF A;  2VB6 A;  2RPN A;  3UWN A;  5GJV B;  2A36 A;  5GAN f;  4XTX A;  3VJP A;  1K8A C;  1KK7 A;  4ELY C;  2F2V A;  2RJC A;  2E41 A;  3TRE A;  2CH4 W;  4C8Q A;  1UTI A;  1ZA2 B;  1RI9 A;  2EGE A;  2B8A A;  2QQA A;  2Y4Y A;  3LYI A;  4CRI A;  2QQB A;  3EFR A;  5C6S A;  2FPD A;  2KT8 A;  1K9A A;  4C0D B;  4M7D B;  2FVU A;  3E19 A;  3A98 A;  4A4E A;  5KE3 A;  3V7S A;  2W10 A;  3QO3 A;  1G5V A;  2KR3 A;  3CC7 T;  1WNL A;  3OYY A;  4BUG A;  1RAG B;  4M78 D;  3EAE A;  1YWO A;  4XTY A;  2QA4 A;  2DK3 A;  1QCF A;  2QA4 T;  5KYU B;  2X3W D;  3PNW C;  1TOV A;  4E7H A;  3QXE B;  1YIJ A;  2L2P A;  3H9N A;  2FB7 A;  4X1V A;  4LUD A;  3EGX A;  2MWO A;  1VYU A;  3EG9 B;  4HCB A;  3JCM V;  2YRV A;  3S6W A;  2AT1 B;  3HRU A;  4J9C A;  4JRP A;  2RJF A;  1H64 1;  3WXM B;  2QEX Q;  1TWB A;  3CME T;  3I9Q A;  4BE1 A;  1G3Y A;  2IG0 A;  4PNO A;  1ZUY A;  2RQT A;  1OUL A;  4DOW A;  2J06 A;  2QDL A;  4DBQ A;  3UA7 A;  1TG0 A;  4M77 D;  2YLB A;  1WZO A;  4C8Q B;  3QHS A;  1VQ4 T;  3ULR B;  2HEQ A;  1R0C B;  3A8H B;  5I22 A;  1R77 A;  2P0P A;  4KUL A;  1RAE B;  4P5N A;  3X25 B;  1WXT A;  3RKW A;  5GMK j;  3I35 A;  1NLP C;  4J9H A;  3G4S A;  2LVM A;  3G71 A;  2JW4 A;  3G4S T;  2MOX A;  4XU1 A;  3HTR A;  2O31 A;  1MMA A;  2JS2 A;  4BY6 B;  1BI1 A;  2JMC A;  3CCV T;  3JCM c;  1VYV A;  1H92 A;  1D0Z A;  2M1H A;  3A8M B;  2JMA A;  4A54 A;  2PNI A;  3E9F A;  3M0S A;  2K57 A;  4J5Y A;  4RG2 A;  2J7I A;  4OMQ A;  3M55 A;  4QVC A;  4XTW A;  5GAO q;  2KXC A;  2L3S A;  5IN1 A;  2DXU A;  3VYH B;  4WTO B;  4M75 A;  2BUD A;  2HL3 A;  3PVL A;  3L1A A;  4M78 C;  4A63 B;  1CKB A;  1LCK A;  4QVZ A;  4M7A C;  1YJW Q;  4JPB W;  1WHG A;  2PTK A;  1RLP C;  5J3B A;  4DBR A;  5GAN 7;  2D6F A;  2PQW A;  3VUZ A;  2HQX A;  4JDS A;  3X24 B;  2RD1 A;  2VC8 A;  3OB9 A;  4C92 B;  1NEB A;  5GMK i;  5GAN 2;  3M57 A;  1YJN Q;  2LP5 A;  5IHI A;  2K3B A;  2C06 A;  3DLL A;  4B9W A;  4PJO A;  1AZG B;  1BI3 A;  8AT1 B;  4ZNX A;  2P0K A;  3PIO A;  1IO6 A;  3JCM J;  4ZGJ B;  4C5E A;  3E9G A;  4C0D C;  2EYZ A;  1J3T A;  5HK3 A;  4M7D C;  4RTW A;  1G3S A;  2HAX A;  3INZ A;  1NE8 A;  3JAM E;  3JCM h;  1QVG A;  1UGS B;  2L3Q A;  2HD0 A;  3PT9 A;  5LJ3 f;  3M4Y A;  4OMN A;  3HFN A;  3HKS A;  3REB B;  2GBQ A;  2ZPF B;  5CK9 A;  1WHL A;  3FB9 A;  3JB9 H;  2M9U A;  4FW1 A;  5EC7 A;  1N27 A;  3MP6 A;  1OPK A;  4FYV B;  4MMK A;  5M9O A;  2E6N A;  2ZGW A;  4C92 D;  5IT9 E;  3CC2 T;  3UDC A;  3A8L B;  3CC4 Q;  1D3B B;  3C94 A;  1HD3 A;  2YUO A;  1KQ1 A;  4RCC A;  4JJN K;  3C4S A;  2XKO C;  1N9R A;  1QVF A;  4PJO E;  3S3O A;  1KD1 C;  1B3Q A;  2CUB A;  4J9F A;  2K9G A;  2EYX A;  1F1B B;  2ZPB B;  1TU0 B;  2QAZ A;  3HSB A;  1M3A A;  2NYS A;  2PUO B;  1VQO Q;  4M7A G;  1X6O A;  1MGQ A;  4C8Q C;  5GAM h;  1AOJ A;  2ED0 A;  4OGE A;  2NUT A;  4IIM A;  1YJ9 A;  2I0N A;  2FZC B;  1Q7Y R;  2K2V A;  1YNZ A;  1D1B A;  1YI2 A;  2K2M A;  4MML A;  3ASK A;  1G3W A;  3LH5 A;  4NL2 A;  2EJG A;  2EJ9 A;  1M90 C;  4UC4 A;  3A1P A;  2LZ6 B;  3I56 T;  4BY6 C;  3H41 A;  2JN0 A;  1Y96 A;  1BI0 A;  3CXC P;  1U8R A;  1JB0 E;  4KGZ B;  4AFS C;  1KIK A;  3OMG A;  2K5F A;  3BW1 A;  3MEV A;  4BI8 B;  1Z9Z A;  5KYN A;  2A28 A;  3FEO A;  1YN8 A;  2QQS A;  2BE7 D;  3QYH B;  1XNI A;  2G3R A;  1B07 A;  1C1A A;  4FYW B;  2QQ9 A;  1WPY A;  3V8K A;  3ZL7 C;  3C95 A;  1UG1 A;  2CP6 A;  1NBE B;  2KAF A;  2MIO A;  3VRZ A;  5GAN d;  2RJE A;  5KCH A;  4E7K A;  4J7I A;  2EFI A;  2KGT A;  2K79 A;  4J9D A;  4RMO A;  1PD0 A;  1VQM T;  3CCS Q;  3A8O B;  4HXJ A;  2HCK A;  4BD3 A;  2EQM A;  4C92 C;  2HBW A;  3EGD B;  2LQK A;  2NWM A;  3JCM Q;  1UFF A;  3E1S A;  1N6A A;  4JRI A;  1B7T A;  1ZSZ B;  4C8Q G;  4RG8 A;  1QVG S;  2BKD N;  5CKF A;  2K3X A;  2JM8 A;  4F7U E;  1GL5 A;  4PFP A;  1JXO A;  1GCQ A;  3G6E T;  2OTJ Q;  1PD1 A;  1JQQ A;  2YRD A;  4C5G A;  2X4W A;  2RB6 A;  2Z0W A;  4DA4 A;  1VQ6 Q;  3JSC A;  2RQW A;  3M0R A;  2DZC A;  1T3L A;  5D6Y A;  5IHK A;  1DJ7 B;  5KYY A;  3FJ5 A;  3T9N A;  3OYF A;  2B86 A;  4QVD A;  4J6Y A;  1WDX A;  3C12 A;  4OB1 B;  3CCJ A;  1M1K C;  1Q7Y C;  1D1A A;  3JCM W;  3I55 T;  1O9S A;  1SHG A;  5KYW A;  1WJS A;  1VQL A;  4CC4 B;  1VQ9 A;  4JJD A;  1VQL T;  2O88 A;  3EH1 A;  2KY9 A;  2A3L A;  2D0Q B;  1QMC A;  4F04 B;  4WF2 A;  3VKI A;  4EMH A;  2E4H A;  4JLG A;  2DBK A;  1OZ2 A;  2OX7 A;  4IKF A;  2X4Y A;  1C6V X;  5FU7 B;  3CCE A;  1GBR A;  3VS7 A;  1XQH A;  1IRX A;  5GAN g;  1E7O A;  3VS0 A;  2QDY B;  4N4G A;  1K76 A;  2QXF A;  1VQN A;  1PNJ A;  1ZX6 A;  1MHN A;  1VQP A;  1VQN T;  2LX9 A;  4BE0 A;  1VQP T;  4BE2 A;  2VXF A;  4LE9 A;  1V1C A;  4EMK B;  1ZBX A;  3JB9 G;  4J6X A;  3JRZ A;  6AT1 B;  2R5A A;  4B6M A;  5GMK l;  2PVG B;  3QII A;  2LCC A;  1C0M A;  1M9S A;  4II1 A;  1FXX A;  3CPF A;  1MMN A;  1UGQ B;  1NYF A;  2IIM A;  5LJ5 d;  1PC0 A;  5DY9 A;  2O4X B;  1WJQ A;  1PRL C;  4M75 G;  2KSS A;  3SWN B;  3VS6 A;  1UGV A;  2OAU A;  4FYX B;  4QQ6 A;  1AHJ B;  1I1J A;  3VS4 A;  2QG9 B;  2KE9 A;  4FCY A;  4MZM A;  1W2B S;  4HVW A;  1QCO A;  3CCM A;  5C0M A;  1LJO A;  2ZPH B;  4F16 A;  2D0N A;  1HJD A;  1MND A;  4LDY A;  4MZP A;  5LJ3 d;  3GBQ A;  5I21 A;  1ZSZ C;  1RAA B;  4PJO G;  3CPW A;  1JJ2 S;  1TH7 A;  2CZ1 B;  1QP3 A;  3CCQ Q;  2E5Q A;  4JJC A;  1OPL A;  1K0S A;  1Q95 G;  3WVD B;  3BDL A;  2DBM A;  1NJI C;  3L2V A;  1K73 U;  3P8H A;  2ZPG B;  3V8J A;  4PJO F;  1GRI A;  3RMQ A;  3GP8 A;  1JO8 A;  5LJ5 e;  3CCL Q;  2RQR A;  1ABO A;  1S72 A;  3OYG A;  1WGS A;  5I11 A;  2K3Y A;  1S72 T;  3CD6 Q;  1RI0 A;  3EFO A;  2DJZ A;  2MI6 A;  1VIF A;  2WSE E;  2BTT A;  2CT4 A;  2E5K A;  4LDX A;  3RES A;  2AHJ B;  2P84 A;  4Z88 A;  4IUR A;  3TVT A;  5L8R E;  1KFZ A;  3KFV A;  1X2Q A;  3CEY A;  2DEU A;  4X9C A;  2GFA A;  5CIU A; 
#chains in the Genus database with same CATH homology
 2YUN A;  1HSQ A;  2JS2 A;  2CRE A;  2JMC A;  4Y92 A;  1ZBJ A;  4EIK A;  1QWE A;  1VYV A;  1NG2 A;  1H92 A;  4J9B A;  1WA7 A;  2JMA A;  2C0I A;  1AZE A;  2PNI A;  1G83 A;  1N5Z A;  3M0S A;  4CC3 A;  1I07 A;  1ZUK A;  4J9E A;  2J7I A;  3NPF A;  1NM7 A;  4OMQ A;  3EG0 A;  1SRM A;  2KXC A;  2L3S A;  2CH4 A;  4HVU A;  1X6B A;  2DRM A;  3EG3 A;  3PVL A;  1TUC A;  1M8M A;  4A63 B;  1AD5 A;  1CKB A;  1LCK A;  2JT4 A;  4JPB W;  2AZV A;  2PTK A;  1RLP C;  1WIE A;  1PRM C;  1AEY A;  2JS0 A;  4RUG A;  1H3H A;  3THK A;  2V1Q A;  1NEB A;  2YT6 A;  1UJ0 A;  2F2W A;  2LP5 A;  5IHI A;  1OEB A;  2K3B A;  1W70 A;  1AZG B;  4J9G A;  3UAT A;  4ZNX A;  4M4Z A;  2DRK A;  1UUE A;  1IO6 A;  1X27 A;  2DIL A;  1AVZ C;  1UEC A;  1M27 C;  2EYZ A;  1J3T A;  4RTW A;  1RUW A;  4E6R A;  4F17 A;  3O5Z A;  2YSQ A;  2DJQ A;  2GTO A;  2M51 A;  2RQV A;  2L3Q A;  1AWO A;  1BBZ A;  1WI7 A;  2JXB A;  4OMN A;  1UDL A;  3REB B;  2GBQ A;  3U23 A;  1H8K A;  2OAW A;  2A08 A;  2YDL A;  4RTY A;  3I5S A;  2KRM A;  4R0K A;  1WX6 A;  1Y0M A;  5EC7 A;  1OPK A;  3M0P A;  2K6D A;  3REA B;  2D8H A;  2O9S A;  1M3B A;  1E6G A;  1XOV A;  4KRT A;  2YUQ A;  3NHN A;  1FYN A;  2EYW A;  3UF4 A;  1Y57 A;  1HD3 A;  2YUO A;  4JZ4 A;  4RTT A;  2CT3 A;  2F2X A;  2EVR A;  4CC2 A;  1B3Q A;  1VYT A;  2DL4 A;  3M0T A;  2CUB A;  2FPE A;  1ABQ A;  3JV3 A;  4J9F A;  2ROL A;  4LN2 A;  2K9G A;  2EYX A;  3IQL A;  1KSW A;  1M3A A;  2LJ1 A;  3H0I A;  4CC7 A;  1RLQ C;  3QWY A;  4ESR A;  1CSK A;  2EQI A;  1GFC A;  2RQU A;  4DEX A;  1AOJ A;  2LMJ A;  2NUZ A;  2ED0 A;  2H8H A;  2D1X A;  4IIM A;  1WXU A;  2I0N A;  4ORZ A;  3EHQ A;  3RBB B;  1JXM A;  1YNZ A;  1NEG A;  1UHC A;  2K2M A;  4K11 A;  3LH5 A;  1AWX A;  3I5R A;  2DL3 A;  5FW9 A;  2FEI A;  2DL7 A;  5GJW B;  2FO0 A;  5FWC A;  2LZ6 B;  3EG2 A;  2ENM A;  4D8K A;  1W1F A;  3H41 A;  1FMK A;  4AG1 C;  2HDA A;  4AFS C;  2J6O A;  1KIK A;  1Z9Z A;  2A28 A;  1YN8 A;  4AFZ C;  4JJB A;  1GCQ C;  2DF6 A;  4AFQ C;  1B07 A;  1K1Z A;  2DYB A;  1ARK A;  2KXD A;  4IIO A;  2AZS A;  4Z8A A;  3VS3 A;  2O9V A;  2PZ1 A;  3VRY A;  3ZL7 C;  2LNH B;  4AG2 C;  1YWP A;  3CQT A;  1GCP A;  4OMP A;  3H0H A;  1UG1 A;  1GBQ A;  2MIO A;  3VRZ A;  2ECZ A;  1T0J A;  1EFN A;  2V1R A;  1ZLM A;  2KGT A;  1K4U S;  2K79 A;  4J9D A;  2EPD A;  1M30 A;  1WYX A;  1BK2 A;  2CDT A;  2FG0 A;  4HXJ A;  1OV3 A;  2EYY A;  2HCK A;  2DA9 A;  2X3X D;  1X69 A;  2HBW A;  2P4R A;  3SHW A;  3NMZ C;  2DL5 A;  2NWM A;  1AWJ A;  4LNP A;  2OJ2 A;  3H0F A;  1UFF A;  2DLP A;  2CUD A;  2ESW A;  2BZY A;  4OMM A;  5IXF A;  4WCI A;  1ZSG A;  2DX1 A;  1UHF A;  1I0C A;  4LUE A;  1SRL A;  2GTJ A;  2KEA A;  1T3S A;  2VWF A;  5L23 A;  1WLP B;  3VS2 A;  2JM8 A;  4GLM A;  1GL5 A;  2VVK A;  1SEM A;  1JXO A;  1T0H A;  2KT1 A;  1GCQ A;  2KRN A;  2LQN A;  2XMF A;  1BB9 A;  1JQQ A;  2KRS A;  1X2K A;  1SHF A;  2L3P A;  1X6G A;  2RF0 A;  2G6F X;  5IXB A;  2J6F A;  2LX7 A;  3SEM A;  2CSI A;  2GQI A;  2RQW A;  3EG1 A;  3NGP A;  3M0R A;  1T3L A;  3RNJ A;  2ABL A;  3EGU A;  5IHK A;  1VA7 A;  2DMO A;  4Z89 A;  3FJ5 A;  4AFU C;  1W6X A;  2KYB A;  1ZUU A;  2B86 A;  3C0C A;  1WDX A;  2AKK A;  2GGR A;  1G2B A;  3EHR A;  2EKH A;  1JEG A;  2EW3 A;  2FRY A;  1SHG A;  3TSW A;  4CC4 B;  2D8J A;  4RTV A;  4JJD A;  5ECA A;  1U5S A;  2O88 A;  5FWB A;  1PWT A;  1E6H A;  1JU5 C;  1PKT A;  2EBP A;  2OI3 A;  2DBK A;  4OMO A;  1NYG A;  4D8D A;  2DE0 X;  4FSS A;  2J05 A;  4RTX A;  2EGA A;  2KYM A;  1GBR A;  3VS7 A;  1SPK A;  2LCS A;  1E7O A;  3VS0 A;  2SRC A;  4J9I A;  2C0O A;  4RTU A;  1K76 A;  2RN8 A;  3UA6 A;  2JM9 A;  2O2O A;  4OML A;  1PNJ A;  1ZX6 A;  2LJ3 A;  2YUP A;  2DVJ A;  1X43 A;  2RMO A;  4JZ3 A;  1QWF A;  2W0Z A;  2EGC A;  4LE9 A;  1V1C A;  2HSP A;  2FRW A;  2RPN A;  5GJV B;  2A36 A;  1PHT A;  1SSH A;  2F2V A;  2BZ8 A;  3M0U A;  4DEY A;  3QWX X;  2CH4 W;  1WFW A;  1K0X A;  1MV3 A;  2DNU A;  2KBT A;  1UTI A;  2SEM A;  1RI9 A;  2EGE A;  1YCS B;  2ROT A;  2VKN A;  1QKX A;  2FPD A;  3VS5 A;  5IHN A;  1NYF A;  1K9A A;  2IIM A;  2KT8 A;  1M3C A;  1Z9Q A;  1PRL C;  1QKW A;  2M0Y A;  3VS6 A;  1U06 A;  3A98 A;  1AWW A;  1UGV A;  2O31 A;  1I1J A;  1UE9 A;  2W10 A;  3VS4 A;  2KR3 A;  2KE9 A;  1MUZ A;  2L0A A;  4HVW A;  2A37 A;  1GFD A;  2RNA A;  4HCK A;  2LJ0 A;  1YWO A;  2KRO A;  4F16 A;  2D0N A;  1QCF A;  2X3W D;  1HJD A;  3R6N A;  2J6K A;  3VS1 A;  2LQW A;  2L2P A;  1S1N A;  1TUD A;  1BU1 A;  1YP5 A;  3GBQ A;  4X1V A;  4LUD A;  2CSQ A;  1VYU A;  4J9C A;  4JJC A;  1OPL A;  2MCN A;  1K0S A;  2BZX A;  2DBM A;  2ED1 A;  3I9Q A;  2DL8 A;  1PKS A;  1NLO C;  2AKL A;  1GRI A;  1ZUY A;  2RQT A;  1A0N B;  1JO8 A;  2J06 A;  2QDL A;  5HCK A;  2C0T A;  3UA7 A;  3TSZ A;  1TG0 A;  1WXB A;  2RQR A;  1ABO A;  2AK5 A;  2K7A A;  4GBQ A;  5I11 A;  4F14 A;  3ULR B;  2HEQ A;  1MV0 B;  2KNB B;  2BTT A;  2CT4 A;  2E5K A;  5I22 A;  4HVV A;  1KJW A;  1OOT A;  2DM1 A;  3PE0 A;  1CKA A;  2GNC A;  4Z88 A;  1WXT A;  1U3O A;  3TVT A;  4RTZ A;  3PVQ A;  3I35 A;  1NLP C;  3M0Q A;  1KFZ A;  4J9H A;  3KFV A;  1X2Q A;  1UJY A;  2JW4 A;  2MOX A;  4QT7 A;  5IH2 A;  2FPF A;  1QLY A;  2JTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...