1NEBA

Sh3 domain from human nebulin, nmr, minimized average structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
TAGKIFRAMYDYMAADADEVSFKDGDAIINVQAIDEGWMYGTVQRTGRTGMLPANYVEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEBULIN
publication title SH3 in muscles: solution structure of the SH3 domain from nebulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 4
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1997-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nebA00
1RLQC 1QWEA 2KEAA 1T0JA 2DM1A 1RLPC 1M3AA 2F2VA 1T0HA 3QWXX 2K79A 1I1JA 1VYVA 2ED1A 3NMZC 2YSQA 3NGPA 2PZ1A 1U3OA 1X2KA 5IHIA 2AK5A 1BK2A 1J3TA 2F2WA 1I0CA 2RN8A 4Z8AA 1JXMA 2DJQA 1M30A 2RQWA 5L23A 3THKA 2SEMA 2G6FX 1X2QA 4J9HA 1OEBA 3SEMA 2K9GA 4CC3A 2EBPA 2DRMA 4HVUA 4ZNXA 2LZ6B 4Z89A 1ZUKA 1N5ZA 3EG1A 2CUBA 2K2MA 2YUOA 2OI3A 4D8KA 2EGCA 2V1RA 1GL5A 1CKAA 1JEGA 2DL4A 2RPNA 2EVRA 3VS5A 2K6DA 1QWFA 3NHNA 1K4US 2CH4A 2QDLA 1A0NB 2VKNA 1RI9A 2O2OA 3PE0A 2CH4W 2J6FA 1MV0B 1WIEA 3M0SA 2JM8A 3TVTA 2JS0A 1X69A 2BTTA 1AEYA 4CC2A 2YUNA 4RTWA 2GNCA 1PWTA 1UGVA 3NPFA 2P4RA 3PVQA 1BB9A 2NWMA 2J7IA 2JXBA 4Y92A 2ESWA 4JJCA 1WLPB 1W70A 5IXFA 2CT3A 2AKKA 2JMAA 3VS1A 2EYWA 1LCKA 1ZBJA 1E7OA 3U23A 1W6XA 5IHKA 2KT1A 4RTXA 1E6GA 2GQIA 2IIMA 1CSKA 2KGTA 4RTTA 3REAB 1ZX6A 3VRZA 1CKBA 1OPKA 2K7AA 3VS3A 1GCQC 3ZL7C 2C0OA 1ZUYA 1UECA 1K9AA 1WXTA 3LH5A 1AVZC 1M27C 2CUDA 1NLPC 2GGRA 4J9GA 3M0PA 1YWPA 2MOXA 3GBQA 4AFQC 1UG1A 2EPDA 1ZSGA 5I22A 4J9BA 2D0NA 2KT8A 4LE9A 3I5SA 4R0KA 2I0NA 2O31A 2OAWA 2X3WD 1GFDA 1T3LA 4QT7A 1IO6A 4LN2A 5IHNA 2ECZA 3A98A 2NUZA 4JZ4A 1BU1A 1V1CA 3TSWA 4JPBW 2DA9A 4RTZA 2KXCA 2RF0A 2SRCA 1GBRA 2LX7A 1JO8A 1K0SA 2ABLA 2YUQA 3M0UA 2JM9A 2JTEA 5EC7A 4OMLA 4D8DA 4LUDA 2CT4A 1WDXA 1NLOC 1GBQA 4J9DA 4AFUC 2PTKA 4FSSA 3SHWA 3PVLA 1EFNA 2HDAA 3UATA 3TSZA 4DEXA 1I07A 3EGUA 1HD3A 1MUZA 2JT4A 4RTUA 4AG2C 2RMOA 2XMFA 1JQQA 2JW4A 3UA6A 2M0YA 1GFCA 3H0HA 4LUEA 1H3HA 3H0FA 2LP5A 2GTJA 5IXBA 1X6GA 4WCIA 2A36A 4J9FA 1NG2A 1KSWA 1TUDA 2VWFA 2J05A 2EW3A 3ULRB 3M0QA 2DF6A 1K1ZA 1YCSB 1MV3A 2FPFA 2EGEA 2DILA 4ORZA 2RQVA 1AZGB 2B86A 2VVKA 3EG2A 4J9IA 1YN8A 1VYUA 1X6BA 1UJ0A 2DBKA 2GTOA 2KBTA 2H8HA 2EKHA 2RQRA 4GLMA 4ESRA 1B07A 4IIMA 1AZEA 1UE9A 5GJWB 2DMOA 3UA7A 2LMJA 2A37A 5I11A 2LQWA 1GCQA 1M3CA 1PRMC 2JS2A 2FO0A 2KXDA 2DL5A 2DYBA 2DBMA 1UHCA 2KRNA 2EYXA 2YDLA 2CDTA 2BZXA 2ROLA 2YT6A 3H0IA 4OMOA 4OMQA 1PRLC 1OV3A 1SHFA 1PKSA 4HXJA 4RUGA 1M3BA 2AZVA 1Y0MA 1VA7A 2ENMA 4J9CA 1Y57A 1WI7A 2FG0A 1JXOA 3IQLA 1GCPA 1SHGA 1WXBA 3JV3A 1OOTA 2PNIA 4M4ZA 1AOJA 1SPKA 2LQNA 2RNAA 5IH2A 1VYTA 1KJWA 1G2BA 2M51A 1BBZA 1UFFA 4Z88A 1Z9ZA 2MCNA 2EGAA 2KROA 4AFSC 1QKWA 2DVJA 2L3SA 2E5KA 2KE9A 2DE0X 1GRIA 1QLYA 5FWBA 4J9EA 4RTYA 2DL3A 5ECAA 3O5ZA 1HJDA 2L0AA 2DLPA 1NEGA 2RQTA 1W1FA 2O9SA 2RQUA 2O88A 2D8HA 3VS2A 1NYFA 3VS7A 3VS4A 1QKXA 2J6KA 3I35A 1H8KA 5FW9A 1YWOA 3C0CA 3R6NA 2KYBA 1SEMA 1E6HA 1AD5A 1YP5A 3RNJA 3I5RA 1ZUUA 3M0RA 3VRYA 3EHRA 3EG0A 1QCFA 1WXUA 1KFZA 2GBQA 4CC7A 1X27A 1SRLA 1S1NA 4K11A 1ARKA 1TG0A 2W0ZA 2A28A 1X43A 2AKLA 3VS0A 2KYMA 1AWWA 1OPLA 1UUEA 2JMCA 2ED0A 2FRWA 3M0TA 2FEIA 2L3PA 4DEYA 2D1XA 1PHTA 1G83A 4HVWA 4CC4B 2LJ1A 2X3XD 4E6RA 1TUCA 2HSPA 4KRTA 5HCKA 1WYXA 1RUWA 2KR3A 2DNUA 3UF4A 3CQTA 2DRKA 2J06A 1FYNA 4JZ3A 2CSIA 2LJ3A 1XOVA 2HBWA 2C0IA 1Z9QA 1ZLMA 1HSQA 1WA7A 4JJBA 2DX1A 2AZSA 1PNJA 4F17A 1AWXA 3QWYA 2LJ0A 2A08A 1UJYA 1ABOA 4RTVA 1K76A 3REBB 2KRMA 2CSQA 2L2PA 2YUPA 2O9VA 2FPDA 1PKTA 4OMNA 3VS6A 1NEBA 4EIKA 2CREA 3EG3A 3RBBB 4JJDA 1ABQA 2BZYA 1H92A 2C0TA 4HVVA 2BZ8A 1JU5C 2V1QA 1SSHA 1M8MA 4F16A 2K3BA 1K0XA 3I9QA 2OJ2A 1U5SA 2KRSA 2L3QA 1T3SA 4OMMA 4X1VA 4AG1C 2DL8A 1AWJA 2LNHB 4AFZC 4LNPA 4A63B 1AWOA 1UHFA 1WFWA 2LCSA 2J6OA 2KNBB 2EQIA 2MIOA 2HEQA 4GBQA 1YNZA 4F14A 2ROTA 3FJ5A 1NYGA 3H41A 1WX6A 1FMKA 2DL7A 4HCKA 4OMPA 3EHQA 2HCKA 3KFVA 2D8JA 2FRYA 1SRMA 5GJVB 1U06A 2W10A 1KIKA 1NM7A 4IIOA 5FWCA 2EYYA 2F2XA 1UDLA 1B3QA 1UTIA 2EYZA 2FPEA
chains in the Genus database with same CATH superfamily
1XJWB 3DLMA 4M78A 1T0JA 2DM1A 4B6MA 3PGGA 4HCCA 2F2VA 2YRCA 1VQOT 3QWXX 1I81A 2MAMA 3GF5A 4XTYA 3NMZC 2ED1A 1VQ5Q 3NGPA 1U3OA 4M77B 4L59A 1J3TA 2F2WA 2RN8A 4XTUA 1NPRA 1K73U 1D0XA 2P84A 2RQWA 1ZQ1A 2RD1A 2G6FX 2QTVA 3PMIA 2QQBA 4FL6A 3RESA 1WQWA 5GAMg 2K2VA 1KQSA 2GFAA 2DPPB 1ZHIA 1OYXA 3EG1A 1N5ZA 2CUBA 1KD1C 1NE8A 4ZGDB 4D8KA 1JJ2S 5I21A 2V1RA 2JJ9A 3OYKA 1QVFP 3AHUA 2OTJT 4LDWA 2Y90A 2HBPA 4RCCA 3I56T 5CQXA 2M16A 4X9CA 3M9QA 1MV0B 3MP1A 1LJOA 1Q81C 1S72Q 4M7DF 1X69A 4DA4A 3CD6T 4EMKB 4PJOA 1D3BA 3S6WA 2GNCA 1PWTA 4ATOA 5GAN5 5LJ5f 4TVRA 3CPFA 4KT0E 2NWMA 2J7IA 3VUZA 1G3TA 1SKUB 2ESWA 1W70A 5IXFA 3QJYA 2CT3A 2AKKA 4N0AC 2XDPA 1E7OA 3U23A 2CS7A 1UGQB 1BCOA 2X4XA 1E6GA 3M56A 4RTXA 2QK0A 1Y96B 2DD4A 2IIMA 4BI8B 1ZX6A 4C8QG 2QQRA 2V8KA 1CKBA 2ZPBB 1YJWQ 1GCQC 4M75E 2C0OA 1UECA 1D1CA 1WXTA 4M77C 5KCOA 4PJLA 1NLPC 3M0PA 5GMKh 5GANj 1WGSA 4AFQC 3MP6A 2EPDA 3C4SA 4E47A 4J9BA 2EJFA 3EH1A 1M8VA 1Q7YR 3JCMf 2I0NA 2E12A 3CMAA 2DO3A 2KK4A 1IO6A 1Y07A 4IURA 5LJ3j 2QEXT 2NUZA 3S3MA 4O6JA 1V1CA 3TSWA 4C8QB 2RF0A 2FB7A 3EGDA 2LX7A 1JO8A 1Q95G 4B9WA 1K0SA 3CXCP 2JM9A 3OBYA 3VYGA 4OMLA 5J3BA 2FYKA 2JN0A 4M78G 1NLOC 3FC3A 4AFUC 2A7YA 1VQOQ 3LLRA 1I07A 2X4JA 1VQMT 1MUZA 1LOJA 2PVDB 2XMFA 4Y28E 2JW4A 4RG8A 1GFCA 3H0HA 1PM3A 4EMKC 1R77A 4QQDA 5I2MA 2DIQA 5GAMe 4J9FA 3NTIA 2VUBA 1VQ6A 3R6OA 4C8QD 2EW3A 2JTFA 2NYSA 3PIPA 3JB9F 5CAIA 2RHXA 1YCSB 3L2RA 3A8LB 1JJ2A 1M9SA 2VVKA 4LD6A 2NUPA 2E4HA 1UJ0A 3QSUA 1Q82C 4GLMA 1BKBA 1B07A 1VQ9A 1AZEA 1UE9A 2DTIA 5GJWB 3CCVT 1ZSZA 4QVDA 4M7AG 4FU6A 2P0KA 4HT8A 1F1BB 3HKSA 2YXYA 2DYBA 5GMKl 1DJ7B 3CCJT 4JS5A 1UHCA 2E3IA 3CCQQ 2DK3A 1PRLC 4HXJA 2E1HA 1I4K1 1X6OA 2GQVA 3A5ZB 4FSXA 4M78D 1VA7A 1M90C 3M53A 2JNGA 3CCST 1Y57A 1OX9A 1NZ9A 5AYFA 4C8QC 1VQ4Q 1JXOA 1SHGA 2XDDA 5CCAA 4XAXB 4ANJA 5IH2A 1VYTA 4M77F 3L2ZA 2P4TA 1K8AU 2K5LA 4Z88A 1R0CB 2MCNA 3OA6A 2HMAA 1QKWA 2L3SA 2QASA 2E5KA 2HQHA 2KE9A 2DXBA 4OB2B 3S3NA 3E2UA 4PLIA 3V7RA 3E19A 3TREA 2DD5A 2L0AA 2DLPA 4E7LA 2RQTA 2O9SA 2RQUA 4PJOB 3WVDB 3CC7T 1D3BB 3VS2A 2DEQA 4NL2A 1H8KA 5FW9A 1YWOA 2X4WA 3URGA 2E5QA 5IT9E 3JCMh 1QW1A 2YRDA 3G6EA 2EQJA 3RNJA 1ZUUA 2GCXA 1TTHB 5CKBA 1QCFA 2CP3A 4E7SA 1RL2A 2LX9A 1X27A 3QZ9B 1YBYA 4J7IA 3FIFA 4M7AD 2FZCB 4KGZB 3GIBA 4FW1A 2LRQA 4MZMA 1YHQQ 3OS2A 1Y71A 2Y4YA 1UUEA 2JMCA 2VGNA 5CKHA 4CI0C 4X9DA 3VV0A 5GAOr 2EQMA 2FEIA 1NBEB 5CIUA 1TUGB 1Q82R 2RI5A 1PHTA 4CC4B 3CC2Q 1H3ZA 2HSPA 5HCKA 3HSBA 2DIGA 3CCLT 4FW2A 5D7UA 2DNUA 3UF4A 3CQTA 1VQ8A 4BE0A 7AT1B 2J06A 4JZ3A 2WSEE 3JCMW 4CRIA 1Z9QA 3OW2A 1Q86C 1AWXA 2LJ0A 3CC4T 2A08A 4YTLA 3EGDB 4RKUE 1N6AA 2CSQA 3TCJA 1M90R 1O9SA 1JBMA 2FPDA 1NEBA 2CP6A 5GANh 1ABQA 4OP0A 3GLXA 3EFRA 1BIBA 1M8MA 1SSHA 4FYYB 2OJ2A 4RMOA 2K3YA 2MK5A 3FB9A 5KYUB 5LJ3h 2OTLT 1MGQA 2CP0A 4X1VA 4HA8A 3D7SB 3N5BB 3I55Q 4QVZA 4JRQA 3CBMA 1UHFA 2HAXA 1S72A 4BD3A 3M5AA 4PJOC 2E3HA 3OSSC 1OZ2A 2O4XA 4BDYA 2KNBB 2DFUA 4C5HA 3HRTA 4FYXB 3ZEHA 1RAIB 5J39A 1MHNA 4M75B 2O01E 1YJ9Q 3EG9A 5GJVB 4OGEA 4IIOA 2PUKB 3H9NA 1UDLA 1B3QA 2NUPB 4C8QE 4LXCA 1QWEA 3OYYA 2KEAA 2BUDA 1M3AA 3CCMT 4PNOA 3JAME 4KULA 4EMHA 2XK0A 3F70A 2LT1A 1I1JA 1VYVA 1ZSZB 4GLKA 3CMET 2PZ1A 4E7KA 1VQPT 1D09B 2C06A 1ZA2B 2FVUA 5A0LA 5IAYA 1VQ6Q 8ATCB 1BIAA 1C0MA 3GNGA 4Z8AA 4JUVA 1IZ6A 1LVKA 4J9HA 2OAUA 5CQYA 3SEMA 4C92G 1IGQA 4CC3A 2EBPA 1Q86R 2DRMA 4UC4A 3JB9H 3FLGA 1ZUKA 4M78E 3GOXA 2YUOA 4MMLA 2OI3A 1K9MU 3KXTA 3SDZA 1UGPB 1WHLA 2DZCA 1VQOA 2EVRA 1QWFA 1K4US 1A0NB 1RI9A 2HL5C 1FWZA 2QA4Q 2O2OA 4R55A 3PE0A 1VQ7T 2E70A 3TVTA 2NUTB 2BTTA 2V8IA 3S3OA 1UGVA 3JCMP 3MHXA 1N9SA 1GXIE 4Y92A 4JJCA 1WLPB 4M75C 2BIVA 4L6V5 1RAEB 2ZPFB 4OB3B 1M1KU 3MEVA 5IN1A 1LCKA 4E7IA 2RI3A 4E7ZA 3CC4Q 1W6XA 4MZTA 2M0OA 2LQ8A 4PJOF 4PFPA 2M02A 3M4GA 3VRZA 4M7AE 1AT1B 5AT1B 1ZSZC 1KG1A 5GAMf 3KBGA 5KE3A 1U8RA 4C92D 2VASA 5HK0A 3GP8A 3JRZA 3CCQA 2MOXA 2F1LA 3QBYA 3L42A 3DB3A 1ZSGA 5I22A 3CD6A 3I5SA 3G1JA 4R0KA 2O31A 3SB2A 1T3LA 4QT7A 4LN2A 2ECZA 1VQ4A 5LJ5j 1BU1A 5DLQE 4LDXA 4JPBW 4A54A 2DA9A 4RTZA 4BB7A 5A0DA 3X28B 2SRCA 2AIRB 1B7TA 1VOMA 2YUQA 3MEAA 1Q7YC 4D8DA 3OYNA 3EFSA 4LUDA 1OZ3A 2CT4A 2FHDA 3OYGA 3JCMQ 1VQ8Q 3SHWA 5FRNA 3WVEB 1V29B 1EFNA 3UATA 4A4KA 3OMGA 1K8AR 2DTOA 2F5TX 1HD3A 2R57A 4JJNK 3O8VA 2E41A 3CMEQ 2K4YA 8AT1B 4XK8E 1VQPQ 4R56A 2M0YA 5GAN7 4F7UE 1H3HA 4II1A 1QVPA 2OX7A 2RJEA 1H641 4J6YA 1KSWA 1TUDA 2VWFA 1YIJT 3EG9B 3CBOA 3OYHA 4M7AA 2MF2A 4P5NA 2DF6A 1YJNT 1MV3A 2EGEA 2DILA 3CCRQ 1PSFA 3HRSA 1YHQA 4C0GA 1M4ZA 3RIRA 2YWWA 4FYWB 2RJCA 1VQKQ 2DBKA 2QXFA 1WPYA 1TOVA 2H8HA 2EKHA 3OMCA 4PFZA 2R5AA 3CC2A 2MYSA 2VB6A 2A37A 1LPLA 4DBFA 1M3CA 1TWBA 4M75F 1PRMC 4QVCA 3NTHA 2EYXA 2YDLA 2ROLA 4OMOA 3H0IA 1UGRB 2QAZA 1FXXA 3E9FA 1RABB 4PL6A 1TU0B 1RAGB 3PNWC 4M7DE 2EYQA 4OGCA 3CCET 1WXBA 2PUOB 4FCYA 1OOTA 2PNIA 2D6FA 2RNAA 2DAQA 2A0FB 2QQ9A 3FDRA 1G2BA 4DOVA 2MPXC 2M51A 1UFFA 2RHZA 1OX8A 3CCUT 2HKQB 4LDYA 1BI0A 4AFSC 2BKDN 1NJIC 4F7UA 2DVJA 1OQKA 1GRIA 3I55A 1QLYA 2K3XA 2HSEB 5FWBA 4BUGA 3CPWS 1BI3A 4RTYA 1WJSA 2DL3A 5ECAA 3O5ZA 1YCYA 2CGHA 1NEGA 2LDMA 4OB0B 1TXQA 4AMCA 1NYFA 3G4SQ 3I35A 3CCJA 4BE2A 3C0CA 3R6NA 1I5LA 3M57A 4QQ6A 4O5VA 1YJ9A 1AD5A 1YP5A 3LWHA 3C95A 2X4YA 2JZ2A 2QTXA 3M0RA 1IHVA 3EHRA 3J80E 3GPLA 2BE9B 4RG2A 5KYWA 2GBQA 4K11A 3JCMX 3BW1A 4MMKA 1ARKA 2QGGA 1TG0A 2W0ZA 3OSVA 1VIFA 3ZBDA 1QVGP 1OPLA 1W2BP 2FRWA 3EGXA 1MMDA 2VC8A 2RK2A 2GFUA 2P0QA 2L3PA 5GMKe 2L3RA 3OW2S 4PLLA 3QPHA 1RAAB 2XICA 2LJ1A 3RUXA 4M78B 4FIBA 2R5MA 1WYXA 1OU8A 2KR3A 4M7DA 2YLBA 1SSFA 5CVIA 2DRKA 1KHCA 4C92E 4BI4A 2CSIA 3RKWA 3JCMg 2HBWA 2RHIA 4JJBA 2DX1A 2AZSA 4JRIA 1PNJA 4F17A 2BE7D 4WF2A 1PD0A 2X35A 3TQ7P 1YI2T 3OYAA 1QQJA 3A8MB 2OTJQ 2O9VA 1PKTA 3VS6A 1KQSP 1ZA1B 3I56Q 2BZYA 2C0TA 3MJXA 2XIDA 3RKYA 2LQKA 3CMAT 1K73C 4HKEA 3M58A 4XQ3A 2X9HA 1FMWA 2QA4A 1ACMB 3CD6Q 5LJ5h 1NJIR 1K9MR 4A63B 4PJJA 1G3SA 2ZZDA 4A4HA 1YITT 2ATCB 3HFOA 2WSFE 2COZA 4E7HA 2RB6A 4DBQA 3OBWA 2J6OA 1M2OA 1VQNT 5CKEA 4GBQA 4C0ZA 5DM7R 4F14A 2F69A 4M7AB 4RCBA 2DL7A 5CO7A 4QKUA 2RJFA 3EHQA 2X51A 5FRMA 3WXMB 3FJPA 2CKKA 1SRMA 4ZTJA 3CC4A 1U06A 2W10A 1QMCA 1SF9A 5FWCA 5GANg 1WNLA 2CP2A 3CCEQ 5LJ3g 2DXUA 4IUUA 1QVFS 4C92A 3CPWA 2B8AA 4XTVA 4F7UG 3CCUQ 1EZZB 3A8OB 1VQLT 2HD0A 4BY6B 1BK2A 4M78C 3OYFA 1I0CA 1I5OB 2QEXQ 1JXMA 2KQWA 2DJQA 3JCMV 1QCOA 4A53A 3THKA 4BE1A 2EWNA 2JTMA 2MI6A 1VQ9T 1OEBA 3EAEA 1EX4A 3DLLA 2K9GA 4C0DB 1RAFB 4ZNXA 3JB9I 5FU6B 1WJRA 2K2MA 1VQMQ 4F7UB 2EGCA 5L8RE 1W4SA 2R58A 3VYHB 2L5QA 2DL4A 1JEGA 2RPNA 3A8HB 4A4EA 1RACB 2VV5A 1K73R 3JCMc 3QG1A 3NHNA 2COYA 3JB9J 2CH4A 2QDLA 4J6WA 2VKNA 3CMEA 2WSCE 4IUTA 3VJPA 2V8JA 1VQPA 2CH4W 2J6FA 4N0AA 3JCMJ 3JCMe 3HTRA 2DEUA 3V8JA 3T9NA 3MEUA 1AEYA 1QP3A 4M7DG 3P8DA 1X01A 2EIFA 2DTHA 4M7AC 2PQWA 5GAOm 3PVQA 5KYWB 1BB9A 5DLOA 2V26A 1MNDA 4Q5WA 5D6XA 3CCRA 3VS1A 2E6NA 2KY9A 2EFIA 2EYWA 5A2QE 1ZBJA 2JVVA 1R0BG 2VXEA 1VQKA 3V7CA 3CCVQ 3CXCS 2KT1A 3L2WA 3OQ5A 1JJ2P 2GQIA 4C8QF 3J7AF 2CZ0B 3MPUB 3X20B 3REAB 4RTTA 1VIEA 3VKIA 2XDBA 4JLGA 3CCJQ 3QKJA 2MWOA 3G71T 2K7AA 1M2VA 4ME7A 1KD1U 1WHJA 2LVMA 3X24B 1ZUYA 1K9AA 2CYZB 4M7DB 4BY6C 1M27C 2CUDA 1IRXA 1D1BA 1MMGA 2GGRA 1WHKA 1YWPA 1U1SA 3CCSQ 1VQ5T 2EQUA 1YITQ 4KGXB 1QVGS 1W2BS 4NOYA 5HKCA 3L2QA 2X3WD 1GFDA 1VQNQ 5GANe 3C12A 3PTAA 2EJGA 3OS1A 3A98A 2ZPEB 3MEWA 4JZ4A 4C0DC 4OVAA 1Q81U 3GNFB 5I2SA 3FEOA 2E65A 5FU6C 5LJ3e 1GBRA 4EDUA 5D6WA 3M0UA 4ZN3A 4M78F 1D1AA 2EQKA 2JOYA 1QVFA 3QUIA 3OYIA 3EH2A 1WDXA 3CC7Q 1GBQA 1P92A 4FSSA 3PVLA 2P0PA 1KHIA 1PSEA 1XTDA 2AT1B 4D6WA 4M7DD 3TSZA 1D0ZA 3QJ6A 3V7SA 2JT4A 4RTUA 4FYVB 5GAMj 3G4SA 1VQLQ 5HK3A 4LUEA 2GTJA 5IXBA 5KYYA 1X6GA 4WCIA 5EG2A 1BI2A 1NG2A 4LDVA 5FLXE 1FX7A 1K8AC 4AT1B 2J05A 4J83A 2QYZA 1QCNA 1G8XA 3M0QA 1S72T 3CEYA 1K1ZA 2HKNA 2FPFA 3JB9G 5GAOn 3V8LA 4J9IA 4JS4A 4C92B 2XD0A 1X6BA 4E7JA 4E2FB 2FZGB 3CCLQ 4J6XA 4JDSA 2KBTA 4ELYC 4ESRA 1LNXA 2IPOB 5D6YA 4M7AF 2DMOA 3UA7A 2LMJA 2A3LA 2LQWA 4JRKA 2AHJB 5I11A 4M7DC 2FO0A 2KXDA 4OMFB 2DL5A 3OS0A 1YJWT 2KRNA 2BZXA 2YT6A 4OMQA 4ZGJB 2RHUA 3ZFJA 1OV3A 4IUQA 5J26A 4RUGA 1M3BA 2LCLA 4F04B 1Y0MA 2OTJA 2WACA 2HL3A 4J9CA 3HPWA 2OTLQ 1WI7A 2E6ZA 3I56A 2FG0A 3JV3A 2DZ9A 1GCPA 5GMKi 3CXCA 3M4YA 4M4ZA 1YJNA 1SPKA 3MO8A 2LQNA 5GAOp 2CP5A 1KJWA 1BBZA 3OYEA 4M77G 2EGAA 3JCMd 3MCAB 2RM4A 2KROA 2I2LA 4BDZA 2DE0X 3E9GA 3MKDA 2VXFA 3FRNA 3JCMb 5GAN3 5GAN2 5GAN8 3G71Q 1BYMA 2Z0WA 3X26B 3JSCA 3UWNA 1W1FA 2HQEA 2D8HA 1QVGA 3OYJA 1W2BA 3J81E 3VS4A 1QKXA 1Q82U 2DXCA 3JB9D 4F7UF 2VYTA 2KYBA 1E6HA 4KBMB 3OYLA 4FM4B 4JLIA 3ASKA 3CCMQ 3VRYA 2HZYA 3NFCA 2O4XB 3RDVA 1WXUA 1KFZA 3OYMA 1AHJB 4J7FA 1SRLA 1S1NA 3CCEA 4J5YA 3EFOA 2RI2A 4C92C 1X43A 3UDCA 1M2VB 3VS0A 3VUBA 3X25B 1M90U 3CCUA 2K5FA 5GAN6 1G83A 1N8RU 2QEXA 3BDUA 5GANd 1TUCA 4Z02A 4KRTA 2XHCA 2K57A 1TS9A 4A4FA 4DBHA 3L2UA 5LJ3d 3PMTA 2LC4A 4C5IA 4EPCA 1XOVA 2QQAA 2C0IA 1HSQA 1FMVA 1WA7A 4ZGEB 4M77D 2DETA 3QWYA 3TEEA 2RA2A 2RJDA 1JB0E 1XNIA 1JRIA 4RTVA 2KRMA 2ZCFB 1VQMA 2L2PA 2YUPA 3CCQT 3Q1JA 4EIKA 2QDYB 3BFMA 3EG3A 1H92A 1OULA 2BZ8A 5M9OA 2DJZA 1VQ7Q 2KSSA 3I9QA 4ZN1A 3OY9A 2KRSA 2L3QA 2D0QB 1VQ4T 4AG1C 1UB4A 1AWJA 2LNHB 4LNPA 1NPPA 3QYHB 3LWIA 3HRUA 1WFWA 1KC8U 5KYNA 5KYYB 2YRVA 3HP9A 5KE2A 2EQIA 3DB4A 2MIOA 2HEQA 4LDUA 1PG5B 2ROTA 3RERA 3QZ5B 1G3WA 4PK4A 1K9MC 3M59A 4HCKA 4OMPA 5FROA 5GMKm 3KFVA 3L2VA 2FRYA 3QDFA 3M54A 2H3JA 4OF1A 1UGSB 1I8FA 1YI2A 5GAMh 3MP8A 2F2XA 3CCVA 2RH2A 2FPEA 1RLQC 3SWNA 1RLPC 1T0HA 1Q86U 3QO3A 2K79A 5LJ5g 3V8KA 3QIIA 4XU3A 2L8DA 2YSQA 2ZAEA 1RADB 1X2KA 4PFOA 5IHIA 5CR2A 2AK5A 2MMPA 3CCSA 1YHQT 1TH7A 2LTOA 4OB1B 3RR6A 1YITA 5KYXA 5C0MA 2KDSA 1KD1R 1M1KC 5GAN4 1M30A 5L23A 2HNIA 1WZOA 4LD9K 3H8ZA 1VQNA 4KUIA 2SEMA 1YFNA 1X2QA 4C92F 3CC2T 2VGMA 4B9XA 3RMQA 5KYUA 9ATCB 2CZ1B 3AT1B 2EAYA 1BCMA 4HVUA 4EMGA 2LZ6B 4Z89A 3HL8A 3VU3C 2EJ9A 2IG0A 2CZ6B 3CC7A 1Q81R 2DYIA 4IUVA 1GL5A 1CKAA 2M1HA 2PVGB 4ZTFA 3VS5A 2K6DA 4BACA 2XI9A 4J8OA 1RI0A 2D9TA 3L1AA 4M75A 5GANf 1VQLA 1YIJQ 3OB9A 4FT4A 1WIEA 3M0SA 2JM8A 2XU8A 3META 2JS0A 1YJNQ 3PFSA 5LJ3f 2YUNA 4CC2A 4RTWA 3I55T 3NPFA 2HQXA 5CK9A 2P4RA 2JXBA 2JUFA 1ZBXA 3ER0A 3EFOB 1U1TA 2JMAA 3TU4K 1PC0A 2YHTA 3RMSA 4IKFA 5IHKA 2ZPIB 2FZKB 1OU9A 1B34A 2RHYA 3CCLA 1CSKA 2KGTA 1YJ9T 4N4GA 2K5IA 4PJOG 4PJMA 1OPKA 3VS3A 4C5EA 5CKDA 4XTXA 3ZL7C 1M1FA 4MDWA 4PKCC 4JRPA 3LH5A 1AVZC 1C6VX 1TSFA 3INZA 4J9GA 1N8RC 2IVWA 3GBQA 1G5VA 4BI3A 2Y4XA 2KAFA 3BE3A 1UG1A 4GY5A 5C6SA 2D0NA 2KT8A 4LE9A 1M1KR 1UEBA 2OAWA 1HYOA 1VQ6T 5IHNA 3OYDA 2OTLA 1HXDA 3BDLA 2M9UA 1N9RA 4L5GA 3G7ZA 4HT9A 4M77E 2KXCA 3QDRB 1EIFA 1V76A 4N4IA 2LCCA 3HHTB 3A8GB 1RAHB 5LJ5e 2ABLA 2JTEA 5EC7A 1KK7A 2NUTA 3OYBA 4XU2A 2KI7A 4J9DA 2PTKA 1IXDA 2HDAA 1G3YA 5A0GA 4DEXA 3G71A 2RO0A 2PU9B 3EGUA 4A4GA 1WHMA 3NTKA 3PT9A 2DXTA 4X34A 4AG2C 4DOWA 2RMOA 1PCXA 1JQQA 2KMTA 3UA6A 1KC8C 4C0FA 3C94A 3H0FA 2LP5A 3ME9A 1VQ5A 3LGLA 2A36A 4DQ2A 2QA4T 4KH1B 3CCMA 3DKMA 3E1SA 2LT4A 4PJOD 2F5KA 3ULRB 1WHGA 4FT2A 1WHHA 2E64A 3SWNB 4HCBA 4ORZA 2RQVA 2GF7A 1AZGB 2B86A 3EG2A 1YN8A 2COWA 1VYUA 1M1GA 1N27A 2CZ7B 1Y7XA 2GTOA 2DVEA 2H3EB 2ZPHB 2RQRA 2QQSA 2KVQG 4IIMA 2RK1A 3OYCA 4HCZA 5KYXB 1GCQA 1IB8A 1Q7YU 2JS2A 1MMNA 2FL7A 2DERA 4M75G 2XKOC 2DBMA 4M77A 1YI2Q 1MMAA 1MNEA 3EGXB 1N8RR 2CDTA 1QP2A 1SHFA 4ELZC 4KUDK 1PKSA 2ZGWA 3G6ET 4MZPA 2AZVA 5GAMd 2ENMA 5LL6S 3CMAQ 1VUBA 2EKOA 3UT1A 1IREB 3UPUA 3IQLA 2E10A 1IGUA 1AOJA 1VQ7A 3QYGB 1M5Q1 1Z9ZA 2QI2A 4KH0B 3LW5E 4NS5A 5CKFA 4J9EA 4WTOB 3CBPA 4Y91A 1HJDA 2DKGA 6AT1B 2O88A 4MDXA 1VQ8T 4KGVB 3VS7A 1HK9A 2ZPGB 3A1PA 4V2SA 1D0YA 2G3RA 2J6KA 1YJWA 1KC8R 1C1AA 2L89A 5FU7B 3KUFA 4DBRA 1SEMA 3RKXA 4EMKA 1XQHA 3I5RA 5GAOq 4XTWA 3EG0A 4NL3A 4XU0A 4C5GA 3SWNC 4CC7A 1KQSS 1B34B 4IUPA 4VUBA 2QGFB 2A28A 2AKLA 2KYMA 1BI1A 3P8HA 5GMKj 1AWWA 4M75D 2ED0A 5HY6A 4N4HA 1Y96A 2XG8D 3M0TA 3CCRT 4DEYA 3CPWP 2D1XA 4HVWA 1VQ9Q 1WJQA 2X3XD 1VQKT 4E6RA 5GAOl 3LX7A 2PVOB 1RUWA 4QW2A 1NJIU 3H6ZA 1FYNA 3PIOA 1OI1A 2LJ3A 4PJNA 3LYIA 3QHSA 5LJ5d 3M55A 1KQ2A 1ZLMA 3SFMA 3LGFA 2MWPA 1KQ1A 4XTZA 2LNVA 1UJYA 1PD1A 1ABOA 1K76A 3REBB 4OMNA 5KCHA 2CREA 3RBBB 4JJDA 3OS5A 4C8QA 1WQ7A 2V1QA 1JU5C 4HVVA 4F16A 2K3BA 1K0XA 1IHWA 3HFNA 1U5SA 2CP7A 1SG5A 1T3SA 4OMMA 1O75A 2DL8A 2YLCA 3OW2P 1YIJA 4XU1A 4AFZC 1AWOA 3LH0A 5DY9A 5KH6A 3SD4A 2NLUA 1X75C 2LCSA 3QXEB 1YNZA 2QG9B 3BY7A 3FJ5A 1NYGA 5FU7C 3H41A 1WX6A 1FMKA 1R8OB 2HCKA 2D8JA 3P8BB 3G6EQ 1KIKA 1NM7A 3G4ST 4QQGA 2EYYA 1UTIA 2EYZA 4PJOE
chains in the Genus database with same CATH topology
1RLQC 1QWEA 2KEAA 1T0JA 2DM1A 1RLPC 1M3AA 2F2VA 1T0HA 3QWXX 2K79A 1I1JA 1VYVA 2ED1A 3NMZC 2YSQA 3NGPA 2PZ1A 1U3OA 1X2KA 5IHIA 2AK5A 1BK2A 1J3TA 2F2WA 1I0CA 2RN8A 4Z8AA 1JXMA 2DJQA 1M30A 2RQWA 5L23A 3THKA 2SEMA 2G6FX 1X2QA 4J9HA 1OEBA 3SEMA 2K9GA 4CC3A 2EBPA 2DRMA 4HVUA 4ZNXA 2LZ6B 4Z89A 1ZUKA 1N5ZA 3EG1A 2CUBA 2K2MA 2YUOA 2OI3A 4D8KA 2EGCA 2V1RA 1GL5A 1CKAA 1JEGA 2DL4A 2RPNA 2EVRA 3VS5A 2K6DA 1QWFA 3NHNA 1K4US 2CH4A 2QDLA 1A0NB 2VKNA 1RI9A 2O2OA 3PE0A 2CH4W 2J6FA 1MV0B 1WIEA 3M0SA 2JM8A 3TVTA 2JS0A 1X69A 2BTTA 1AEYA 4CC2A 2YUNA 4RTWA 2GNCA 1PWTA 1UGVA 3NPFA 2P4RA 3PVQA 1BB9A 2NWMA 2J7IA 2JXBA 4Y92A 2ESWA 4JJCA 1WLPB 1W70A 5IXFA 2CT3A 2AKKA 2JMAA 3VS1A 2EYWA 1LCKA 1ZBJA 1E7OA 3U23A 1W6XA 5IHKA 2KT1A 4RTXA 1E6GA 2GQIA 2IIMA 1CSKA 2KGTA 4RTTA 3REAB 1ZX6A 3VRZA 1CKBA 1OPKA 2K7AA 3VS3A 1GCQC 3ZL7C 2C0OA 1ZUYA 1UECA 1K9AA 1WXTA 3LH5A 1AVZC 1M27C 2CUDA 1NLPC 2GGRA 4J9GA 3M0PA 1YWPA 2MOXA 3GBQA 4AFQC 1UG1A 2EPDA 1ZSGA 5I22A 4J9BA 2D0NA 2KT8A 4LE9A 3I5SA 4R0KA 2I0NA 2O31A 2OAWA 2X3WD 1GFDA 1T3LA 4QT7A 1IO6A 4LN2A 5IHNA 2ECZA 3A98A 2NUZA 4JZ4A 1BU1A 1V1CA 3TSWA 4JPBW 2DA9A 4RTZA 2KXCA 2RF0A 2SRCA 1GBRA 2LX7A 1JO8A 1K0SA 2ABLA 2YUQA 3M0UA 2JM9A 2JTEA 5EC7A 4OMLA 4D8DA 4LUDA 2CT4A 1WDXA 1NLOC 1GBQA 4J9DA 4AFUC 2PTKA 4FSSA 3SHWA 3PVLA 1EFNA 2HDAA 3UATA 3TSZA 4DEXA 1I07A 3EGUA 1HD3A 1MUZA 2JT4A 4RTUA 4AG2C 2RMOA 2XMFA 1JQQA 2JW4A 3UA6A 2M0YA 1GFCA 3H0HA 4LUEA 1H3HA 3H0FA 2LP5A 2GTJA 5IXBA 1X6GA 4WCIA 2A36A 4J9FA 1NG2A 1KSWA 1TUDA 2VWFA 2J05A 2EW3A 3ULRB 3M0QA 2DF6A 1K1ZA 1YCSB 1MV3A 2FPFA 2EGEA 2DILA 4ORZA 2RQVA 1AZGB 2B86A 2VVKA 3EG2A 4J9IA 1YN8A 1VYUA 1X6BA 1UJ0A 2DBKA 2GTOA 2KBTA 2H8HA 2EKHA 2RQRA 4GLMA 4ESRA 1B07A 4IIMA 1AZEA 1UE9A 5GJWB 2DMOA 3UA7A 2LMJA 2A37A 5I11A 2LQWA 1GCQA 1M3CA 1PRMC 2JS2A 2FO0A 2KXDA 2DL5A 2DYBA 2DBMA 1UHCA 2KRNA 2EYXA 2YDLA 2CDTA 2BZXA 2ROLA 2YT6A 3H0IA 4OMOA 4OMQA 1PRLC 1OV3A 1SHFA 1PKSA 4HXJA 4RUGA 1M3BA 2AZVA 1Y0MA 1VA7A 2ENMA 4J9CA 1Y57A 1WI7A 2FG0A 1JXOA 3IQLA 1GCPA 1SHGA 1WXBA 3JV3A 1OOTA 2PNIA 4M4ZA 1AOJA 1SPKA 2LQNA 2RNAA 5IH2A 1VYTA 1KJWA 1G2BA 2M51A 1BBZA 1UFFA 4Z88A 1Z9ZA 2MCNA 2EGAA 2KROA 4AFSC 1QKWA 2DVJA 2L3SA 2E5KA 2KE9A 2DE0X 1GRIA 1QLYA 5FWBA 4J9EA 4RTYA 2DL3A 5ECAA 3O5ZA 1HJDA 2L0AA 2DLPA 1NEGA 2RQTA 1W1FA 2O9SA 2RQUA 2O88A 2D8HA 3VS2A 1NYFA 3VS7A 3VS4A 1QKXA 2J6KA 3I35A 1H8KA 5FW9A 1YWOA 3C0CA 3R6NA 2KYBA 1SEMA 1E6HA 1AD5A 1YP5A 3RNJA 3I5RA 1ZUUA 3M0RA 3VRYA 3EHRA 3EG0A 1QCFA 1WXUA 1KFZA 2GBQA 4CC7A 1X27A 1SRLA 1S1NA 4K11A 1ARKA 1TG0A 2W0ZA 2A28A 1X43A 2AKLA 3VS0A 2KYMA 1AWWA 1OPLA 1UUEA 2JMCA 2ED0A 2FRWA 3M0TA 2FEIA 2L3PA 4DEYA 2D1XA 1PHTA 1G83A 4HVWA 4CC4B 2LJ1A 2X3XD 4E6RA 1TUCA 2HSPA 4KRTA 5HCKA 1WYXA 1RUWA 2KR3A 2DNUA 3UF4A 3CQTA 2DRKA 2J06A 1FYNA 4JZ3A 2CSIA 2LJ3A 1XOVA 2HBWA 2C0IA 1Z9QA 1ZLMA 1HSQA 1WA7A 4JJBA 2DX1A 2AZSA 1PNJA 4F17A 1AWXA 3QWYA 2LJ0A 2A08A 1UJYA 1ABOA 4RTVA 1K76A 3REBB 2KRMA 2CSQA 2L2PA 2YUPA 2O9VA 2FPDA 1PKTA 4OMNA 3VS6A 1NEBA 4EIKA 2CREA 3EG3A 3RBBB 4JJDA 1ABQA 2BZYA 1H92A 2C0TA 4HVVA 2BZ8A 1JU5C 2V1QA 1SSHA 1M8MA 4F16A 2K3BA 1K0XA 3I9QA 2OJ2A 1U5SA 2KRSA 2L3QA 1T3SA 4OMMA 4X1VA 4AG1C 2DL8A 1AWJA 2LNHB 4AFZC 4LNPA 4A63B 1AWOA 1UHFA 1WFWA 2LCSA 2J6OA 2KNBB 2EQIA 2MIOA 2HEQA 4GBQA 1YNZA 4F14A 2ROTA 3FJ5A 1NYGA 3H41A 1WX6A 1FMKA 2DL7A 4HCKA 4OMPA 3EHQA 2HCKA 3KFVA 2D8JA 2FRYA 1SRMA 5GJVB 1U06A 2W10A 1KIKA 1NM7A 4IIOA 5FWCA 2EYYA 2F2XA 1UDLA 1B3QA 1UTIA 2EYZA 2FPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLQ C;  1QWE A;  2KEA A;  1T0J A;  2DM1 A;  1RLP C;  1M3A A;  2F2V A;  1T0H A;  3QWX X;  2K79 A;  1I1J A;  1VYV A;  2ED1 A;  3NMZ C;  2YSQ A;  3NGP A;  2PZ1 A;  1U3O A;  1X2K A;  5IHI A;  2AK5 A;  1BK2 A;  1J3T A;  2F2W A;  1I0C A;  2RN8 A;  4Z8A A;  1JXM A;  2DJQ A;  1M30 A;  2RQW A;  5L23 A;  3THK A;  2SEM A;  2G6F X;  1X2Q A;  4J9H A;  1OEB A;  3SEM A;  2K9G A;  4CC3 A;  2EBP A;  2DRM A;  4HVU A;  4ZNX A;  2LZ6 B;  4Z89 A;  1ZUK A;  1N5Z A;  3EG1 A;  2CUB A;  2K2M A;  2YUO A;  2OI3 A;  4D8K A;  2EGC A;  2V1R A;  1GL5 A;  1CKA A;  1JEG A;  2DL4 A;  2RPN A;  2EVR A;  3VS5 A;  2K6D A;  1QWF A;  3NHN A;  1K4U S;  2CH4 A;  2QDL A;  1A0N B;  2VKN A;  1RI9 A;  2O2O A;  3PE0 A;  2CH4 W;  2J6F A;  1MV0 B;  1WIE A;  3M0S A;  2JM8 A;  3TVT A;  2JS0 A;  1X69 A;  2BTT A;  1AEY A;  4CC2 A;  2YUN A;  4RTW A;  2GNC A;  1PWT A;  1UGV A;  3NPF A;  2P4R A;  3PVQ A;  1BB9 A;  2NWM A;  2J7I A;  2JXB A;  4Y92 A;  2ESW A;  4JJC A;  1WLP B;  1W70 A;  5IXF A;  2CT3 A;  2AKK A;  2JMA A;  3VS1 A;  2EYW A;  1LCK A;  1ZBJ A;  1E7O A;  3U23 A;  1W6X A;  5IHK A;  2KT1 A;  4RTX A;  1E6G A;  2GQI A;  2IIM A;  1CSK A;  2KGT A;  4RTT A;  3REA B;  1ZX6 A;  3VRZ A;  1CKB A;  1OPK A;  2K7A A;  3VS3 A;  1GCQ C;  3ZL7 C;  2C0O A;  1ZUY A;  1UEC A;  1K9A A;  1WXT A;  3LH5 A;  1AVZ C;  1M27 C;  2CUD A;  1NLP C;  2GGR A;  4J9G A;  3M0P A;  1YWP A;  2MOX A;  3GBQ A;  4AFQ C;  1UG1 A;  2EPD A;  1ZSG A;  5I22 A;  4J9B A;  2D0N A;  2KT8 A;  4LE9 A;  3I5S A;  4R0K A;  2I0N A;  2O31 A;  2OAW A;  2X3W D;  1GFD A;  1T3L A;  4QT7 A;  1IO6 A;  4LN2 A;  5IHN A;  2ECZ A;  3A98 A;  2NUZ A;  4JZ4 A;  1BU1 A;  1V1C A;  3TSW A;  4JPB W;  2DA9 A;  4RTZ A;  2KXC A;  2RF0 A;  2SRC A;  1GBR A;  2LX7 A;  1JO8 A;  1K0S A;  2ABL A;  2YUQ A;  3M0U A;  2JM9 A;  2JTE A;  5EC7 A;  4OML A;  4D8D A;  4LUD A;  2CT4 A;  1WDX A;  1NLO C;  1GBQ A;  4J9D A;  4AFU C;  2PTK A;  4FSS A;  3SHW A;  3PVL A;  1EFN A;  2HDA A;  3UAT A;  3TSZ A;  4DEX A;  1I07 A;  3EGU A;  1HD3 A;  1MUZ A;  2JT4 A;  4RTU A;  4AG2 C;  2RMO A;  2XMF A;  1JQQ A;  2JW4 A;  3UA6 A;  2M0Y A;  1GFC A;  3H0H A;  4LUE A;  1H3H A;  3H0F A;  2LP5 A;  2GTJ A;  5IXB A;  1X6G A;  4WCI A;  2A36 A;  4J9F A;  1NG2 A;  1KSW A;  1TUD A;  2VWF A;  2J05 A;  2EW3 A;  3ULR B;  3M0Q A;  2DF6 A;  1K1Z A;  1YCS B;  1MV3 A;  2FPF A;  2EGE A;  2DIL A;  4ORZ A;  2RQV A;  1AZG B;  2B86 A;  2VVK A;  3EG2 A;  4J9I A;  1YN8 A;  1VYU A;  1X6B A;  1UJ0 A;  2DBK A;  2GTO A;  2KBT A;  2H8H A;  2EKH A;  2RQR A;  4GLM A;  4ESR A;  1B07 A;  4IIM A;  1AZE A;  1UE9 A;  5GJW B;  2DMO A;  3UA7 A;  2LMJ A;  2A37 A;  5I11 A;  2LQW A;  1GCQ A;  1M3C A;  1PRM C;  2JS2 A;  2FO0 A;  2KXD A;  2DL5 A;  2DYB A;  2DBM A;  1UHC A;  2KRN A;  2EYX A;  2YDL A;  2CDT A;  2BZX A;  2ROL A;  2YT6 A;  3H0I A;  4OMO A;  4OMQ A;  1PRL C;  1OV3 A;  1SHF A;  1PKS A;  4HXJ A;  4RUG A;  1M3B A;  2AZV A;  1Y0M A;  1VA7 A;  2ENM A;  4J9C A;  1Y57 A;  1WI7 A;  2FG0 A;  1JXO A;  3IQL A;  1GCP A;  1SHG A;  1WXB A;  3JV3 A;  1OOT A;  2PNI A;  4M4Z A;  1AOJ A;  1SPK A;  2LQN A;  2RNA A;  5IH2 A;  1VYT A;  1KJW A;  1G2B A;  2M51 A;  1BBZ A;  1UFF A;  4Z88 A;  1Z9Z A;  2MCN A;  2EGA A;  2KRO A;  4AFS C;  1QKW A;  2DVJ A;  2L3S A;  2E5K A;  2KE9 A;  2DE0 X;  1GRI A;  1QLY A;  5FWB A;  4J9E A;  4RTY A;  2DL3 A;  5ECA A;  3O5Z A;  1HJD A;  2L0A A;  2DLP A;  1NEG A;  2RQT A;  1W1F A;  2O9S A;  2RQU A;  2O88 A;  2D8H A;  3VS2 A;  1NYF A;  3VS7 A;  3VS4 A;  1QKX A;  2J6K A;  3I35 A;  1H8K A;  5FW9 A;  1YWO A;  3C0C A;  3R6N A;  2KYB A;  1SEM A;  1E6H A;  1AD5 A;  1YP5 A;  3RNJ A;  3I5R A;  1ZUU A;  3M0R A;  3VRY A;  3EHR A;  3EG0 A;  1QCF A;  1WXU A;  1KFZ A;  2GBQ A;  4CC7 A;  1X27 A;  1SRL A;  1S1N A;  4K11 A;  1ARK A;  1TG0 A;  2W0Z A;  2A28 A;  1X43 A;  2AKL A;  3VS0 A;  2KYM A;  1AWW A;  1OPL A;  1UUE A;  2JMC A;  2ED0 A;  2FRW A;  3M0T A;  2FEI A;  2L3P A;  4DEY A;  2D1X A;  1PHT A;  1G83 A;  4HVW A;  4CC4 B;  2LJ1 A;  2X3X D;  4E6R A;  1TUC A;  2HSP A;  4KRT A;  5HCK A;  1WYX A;  1RUW A;  2KR3 A;  2DNU A;  3UF4 A;  3CQT A;  2DRK A;  2J06 A;  1FYN A;  4JZ3 A;  2CSI A;  2LJ3 A;  1XOV A;  2HBW A;  2C0I A;  1Z9Q A;  1ZLM A;  1HSQ A;  1WA7 A;  4JJB A;  2DX1 A;  2AZS A;  1PNJ A;  4F17 A;  1AWX A;  3QWY A;  2LJ0 A;  2A08 A;  1UJY A;  1ABO A;  4RTV A;  1K76 A;  3REB B;  2KRM A;  2CSQ A;  2L2P A;  2YUP A;  2O9V A;  2FPD A;  1PKT A;  4OMN A;  3VS6 A;  1NEB A;  4EIK A;  2CRE A;  3EG3 A;  3RBB B;  4JJD A;  1ABQ A;  2BZY A;  1H92 A;  2C0T A;  4HVV A;  2BZ8 A;  1JU5 C;  2V1Q A;  1SSH A;  1M8M A;  4F16 A;  2K3B A;  1K0X A;  3I9Q A;  2OJ2 A;  1U5S A;  2KRS A;  2L3Q A;  1T3S A;  4OMM A;  4X1V A;  4AG1 C;  2DL8 A;  1AWJ A;  2LNH B;  4AFZ C;  4LNP A;  4A63 B;  1AWO A;  1UHF A;  1WFW A;  2LCS A;  2J6O A;  2KNB B;  2EQI A;  2MIO A;  2HEQ A;  4GBQ A;  1YNZ A;  4F14 A;  2ROT A;  3FJ5 A;  1NYG A;  3H41 A;  1WX6 A;  1FMK A;  2DL7 A;  4HCK A;  4OMP A;  3EHQ A;  2HCK A;  3KFV A;  2D8J A;  2FRY A;  1SRM A;  5GJV B;  1U06 A;  2W10 A;  1KIK A;  1NM7 A;  4IIO A;  5FWC A;  2EYY A;  2F2X A;  1UDL A;  1B3Q A;  1UTI A;  2EYZ A;  2FPE A; 
#chains in the Genus database with same CATH topology
 1XJW B;  3DLM A;  4M78 A;  1T0J A;  2DM1 A;  4B6M A;  3PGG A;  4HCC A;  2F2V A;  2YRC A;  1VQO T;  3QWX X;  1I81 A;  2MAM A;  3GF5 A;  4XTY A;  3NMZ C;  2ED1 A;  1VQ5 Q;  3NGP A;  1U3O A;  4M77 B;  4L59 A;  1J3T A;  2F2W A;  2RN8 A;  4XTU A;  1NPR A;  1K73 U;  1D0X A;  2P84 A;  2RQW A;  1ZQ1 A;  2RD1 A;  2G6F X;  2QTV A;  3PMI A;  2QQB A;  4FL6 A;  3RES A;  1WQW A;  5GAM g;  2K2V A;  1KQS A;  2GFA A;  2DPP B;  1ZHI A;  1OYX A;  3EG1 A;  1N5Z A;  2CUB A;  1KD1 C;  1NE8 A;  4ZGD B;  4D8K A;  1JJ2 S;  5I21 A;  2V1R A;  2JJ9 A;  3OYK A;  1QVF P;  3AHU A;  2OTJ T;  4LDW A;  2Y90 A;  2HBP A;  4RCC A;  3I56 T;  5CQX A;  2M16 A;  4X9C A;  3M9Q A;  1MV0 B;  3MP1 A;  1LJO A;  1Q81 C;  1S72 Q;  4M7D F;  1X69 A;  4DA4 A;  3CD6 T;  4EMK B;  4PJO A;  1D3B A;  3S6W A;  2GNC A;  1PWT A;  4ATO A;  5GAN 5;  5LJ5 f;  4TVR A;  3CPF A;  4KT0 E;  2NWM A;  2J7I A;  3VUZ A;  1G3T A;  1SKU B;  2ESW A;  1W70 A;  5IXF A;  3QJY A;  2CT3 A;  2AKK A;  4N0A C;  2XDP A;  1E7O A;  3U23 A;  2CS7 A;  1UGQ B;  1BCO A;  2X4X A;  1E6G A;  3M56 A;  4RTX A;  2QK0 A;  1Y96 B;  2DD4 A;  2IIM A;  4BI8 B;  1ZX6 A;  4C8Q G;  2QQR A;  2V8K A;  1CKB A;  2ZPB B;  1YJW Q;  1GCQ C;  4M75 E;  2C0O A;  1UEC A;  1D1C A;  1WXT A;  4M77 C;  5KCO A;  4PJL A;  1NLP C;  3M0P A;  5GMK h;  5GAN j;  1WGS A;  4AFQ C;  3MP6 A;  2EPD A;  3C4S A;  4E47 A;  4J9B A;  2EJF A;  3EH1 A;  1M8V A;  1Q7Y R;  3JCM f;  2I0N A;  2E12 A;  3CMA A;  2DO3 A;  2KK4 A;  1IO6 A;  1Y07 A;  4IUR A;  5LJ3 j;  2QEX T;  2NUZ A;  3S3M A;  4O6J A;  1V1C A;  3TSW A;  4C8Q B;  2RF0 A;  2FB7 A;  3EGD A;  2LX7 A;  1JO8 A;  1Q95 G;  4B9W A;  1K0S A;  3CXC P;  2JM9 A;  3OBY A;  3VYG A;  4OML A;  5J3B A;  2FYK A;  2JN0 A;  4M78 G;  1NLO C;  3FC3 A;  4AFU C;  2A7Y A;  1VQO Q;  3LLR A;  1I07 A;  2X4J A;  1VQM T;  1MUZ A;  1LOJ A;  2PVD B;  2XMF A;  4Y28 E;  2JW4 A;  4RG8 A;  1GFC A;  3H0H A;  1PM3 A;  4EMK C;  1R77 A;  4QQD A;  5I2M A;  2DIQ A;  5GAM e;  4J9F A;  3NTI A;  2VUB A;  1VQ6 A;  3R6O A;  4C8Q D;  2EW3 A;  2JTF A;  2NYS A;  3PIP A;  3JB9 F;  5CAI A;  2RHX A;  1YCS B;  3L2R A;  3A8L B;  1JJ2 A;  1M9S A;  2VVK A;  4LD6 A;  2NUP A;  2E4H A;  1UJ0 A;  3QSU A;  1Q82 C;  4GLM A;  1BKB A;  1B07 A;  1VQ9 A;  1AZE A;  1UE9 A;  2DTI A;  5GJW B;  3CCV T;  1ZSZ A;  4QVD A;  4M7A G;  4FU6 A;  2P0K A;  4HT8 A;  1F1B B;  3HKS A;  2YXY A;  2DYB A;  5GMK l;  1DJ7 B;  3CCJ T;  4JS5 A;  1UHC A;  2E3I A;  3CCQ Q;  2DK3 A;  1PRL C;  4HXJ A;  2E1H A;  1I4K 1;  1X6O A;  2GQV A;  3A5Z B;  4FSX A;  4M78 D;  1VA7 A;  1M90 C;  3M53 A;  2JNG A;  3CCS T;  1Y57 A;  1OX9 A;  1NZ9 A;  5AYF A;  4C8Q C;  1VQ4 Q;  1JXO A;  1SHG A;  2XDD A;  5CCA A;  4XAX B;  4ANJ A;  5IH2 A;  1VYT A;  4M77 F;  3L2Z A;  2P4T A;  1K8A U;  2K5L A;  4Z88 A;  1R0C B;  2MCN A;  3OA6 A;  2HMA A;  1QKW A;  2L3S A;  2QAS A;  2E5K A;  2HQH A;  2KE9 A;  2DXB A;  4OB2 B;  3S3N A;  3E2U A;  4PLI A;  3V7R A;  3E19 A;  3TRE A;  2DD5 A;  2L0A A;  2DLP A;  4E7L A;  2RQT A;  2O9S A;  2RQU A;  4PJO B;  3WVD B;  3CC7 T;  1D3B B;  3VS2 A;  2DEQ A;  4NL2 A;  1H8K A;  5FW9 A;  1YWO A;  2X4W A;  3URG A;  2E5Q A;  5IT9 E;  3JCM h;  1QW1 A;  2YRD A;  3G6E A;  2EQJ A;  3RNJ A;  1ZUU A;  2GCX A;  1TTH B;  5CKB A;  1QCF A;  2CP3 A;  4E7S A;  1RL2 A;  2LX9 A;  1X27 A;  3QZ9 B;  1YBY A;  4J7I A;  3FIF A;  4M7A D;  2FZC B;  4KGZ B;  3GIB A;  4FW1 A;  2LRQ A;  4MZM A;  1YHQ Q;  3OS2 A;  1Y71 A;  2Y4Y A;  1UUE A;  2JMC A;  2VGN A;  5CKH A;  4CI0 C;  4X9D A;  3VV0 A;  5GAO r;  2EQM A;  2FEI A;  1NBE B;  5CIU A;  1TUG B;  1Q82 R;  2RI5 A;  1PHT A;  4CC4 B;  3CC2 Q;  1H3Z A;  2HSP A;  5HCK A;  3HSB A;  2DIG A;  3CCL T;  4FW2 A;  5D7U A;  2DNU A;  3UF4 A;  3CQT A;  1VQ8 A;  4BE0 A;  7AT1 B;  2J06 A;  4JZ3 A;  2WSE E;  3JCM W;  4CRI A;  1Z9Q A;  3OW2 A;  1Q86 C;  1AWX A;  2LJ0 A;  3CC4 T;  2A08 A;  4YTL A;  3EGD B;  4RKU E;  1N6A A;  2CSQ A;  3TCJ A;  1M90 R;  1O9S A;  1JBM A;  2FPD A;  1NEB A;  2CP6 A;  5GAN h;  1ABQ A;  4OP0 A;  3GLX A;  3EFR A;  1BIB A;  1M8M A;  1SSH A;  4FYY B;  2OJ2 A;  4RMO A;  2K3Y A;  2MK5 A;  3FB9 A;  5KYU B;  5LJ3 h;  2OTL T;  1MGQ A;  2CP0 A;  4X1V A;  4HA8 A;  3D7S B;  3N5B B;  3I55 Q;  4QVZ A;  4JRQ A;  3CBM A;  1UHF A;  2HAX A;  1S72 A;  4BD3 A;  3M5A A;  4PJO C;  2E3H A;  3OSS C;  1OZ2 A;  2O4X A;  4BDY A;  2KNB B;  2DFU A;  4C5H A;  3HRT A;  4FYX B;  3ZEH A;  1RAI B;  5J39 A;  1MHN A;  4M75 B;  2O01 E;  1YJ9 Q;  3EG9 A;  5GJV B;  4OGE A;  4IIO A;  2PUK B;  3H9N A;  1UDL A;  1B3Q A;  2NUP B;  4C8Q E;  4LXC A;  1QWE A;  3OYY A;  2KEA A;  2BUD A;  1M3A A;  3CCM T;  4PNO A;  3JAM E;  4KUL A;  4EMH A;  2XK0 A;  3F70 A;  2LT1 A;  1I1J A;  1VYV A;  1ZSZ B;  4GLK A;  3CME T;  2PZ1 A;  4E7K A;  1VQP T;  1D09 B;  2C06 A;  1ZA2 B;  2FVU A;  5A0L A;  5IAY A;  1VQ6 Q;  8ATC B;  1BIA A;  1C0M A;  3GNG A;  4Z8A A;  4JUV A;  1IZ6 A;  1LVK A;  4J9H A;  2OAU A;  5CQY A;  3SEM A;  4C92 G;  1IGQ A;  4CC3 A;  2EBP A;  1Q86 R;  2DRM A;  4UC4 A;  3JB9 H;  3FLG A;  1ZUK A;  4M78 E;  3GOX A;  2YUO A;  4MML A;  2OI3 A;  1K9M U;  3KXT A;  3SDZ A;  1UGP B;  1WHL A;  2DZC A;  1VQO A;  2EVR A;  1QWF A;  1K4U S;  1A0N B;  1RI9 A;  2HL5 C;  1FWZ A;  2QA4 Q;  2O2O A;  4R55 A;  3PE0 A;  1VQ7 T;  2E70 A;  3TVT A;  2NUT B;  2BTT A;  2V8I A;  3S3O A;  1UGV A;  3JCM P;  3MHX A;  1N9S A;  1GXI E;  4Y92 A;  4JJC A;  1WLP B;  4M75 C;  2BIV A;  4L6V 5;  1RAE B;  2ZPF B;  4OB3 B;  1M1K U;  3MEV A;  5IN1 A;  1LCK A;  4E7I A;  2RI3 A;  4E7Z A;  3CC4 Q;  1W6X A;  4MZT A;  2M0O A;  2LQ8 A;  4PJO F;  4PFP A;  2M02 A;  3M4G A;  3VRZ A;  4M7A E;  1AT1 B;  5AT1 B;  1ZSZ C;  1KG1 A;  5GAM f;  3KBG A;  5KE3 A;  1U8R A;  4C92 D;  2VAS A;  5HK0 A;  3GP8 A;  3JRZ A;  3CCQ A;  2MOX A;  2F1L A;  3QBY A;  3L42 A;  3DB3 A;  1ZSG A;  5I22 A;  3CD6 A;  3I5S A;  3G1J A;  4R0K A;  2O31 A;  3SB2 A;  1T3L A;  4QT7 A;  4LN2 A;  2ECZ A;  1VQ4 A;  5LJ5 j;  1BU1 A;  5DLQ E;  4LDX A;  4JPB W;  4A54 A;  2DA9 A;  4RTZ A;  4BB7 A;  5A0D A;  3X28 B;  2SRC A;  2AIR B;  1B7T A;  1VOM A;  2YUQ A;  3MEA A;  1Q7Y C;  4D8D A;  3OYN A;  3EFS A;  4LUD A;  1OZ3 A;  2CT4 A;  2FHD A;  3OYG A;  3JCM Q;  1VQ8 Q;  3SHW A;  5FRN A;  3WVE B;  1V29 B;  1EFN A;  3UAT A;  4A4K A;  3OMG A;  1K8A R;  2DTO A;  2F5T X;  1HD3 A;  2R57 A;  4JJN K;  3O8V A;  2E41 A;  3CME Q;  2K4Y A;  8AT1 B;  4XK8 E;  1VQP Q;  4R56 A;  2M0Y A;  5GAN 7;  4F7U E;  1H3H A;  4II1 A;  1QVP A;  2OX7 A;  2RJE A;  1H64 1;  4J6Y A;  1KSW A;  1TUD A;  2VWF A;  1YIJ T;  3EG9 B;  3CBO A;  3OYH A;  4M7A A;  2MF2 A;  4P5N A;  2DF6 A;  1YJN T;  1MV3 A;  2EGE A;  2DIL A;  3CCR Q;  1PSF A;  3HRS A;  1YHQ A;  4C0G A;  1M4Z A;  3RIR A;  2YWW A;  4FYW B;  2RJC A;  1VQK Q;  2DBK A;  2QXF A;  1WPY A;  1TOV A;  2H8H A;  2EKH A;  3OMC A;  4PFZ A;  2R5A A;  3CC2 A;  2MYS A;  2VB6 A;  2A37 A;  1LPL A;  4DBF A;  1M3C A;  1TWB A;  4M75 F;  1PRM C;  4QVC A;  3NTH A;  2EYX A;  2YDL A;  2ROL A;  4OMO A;  3H0I A;  1UGR B;  2QAZ A;  1FXX A;  3E9F A;  1RAB B;  4PL6 A;  1TU0 B;  1RAG B;  3PNW C;  4M7D E;  2EYQ A;  4OGC A;  3CCE T;  1WXB A;  2PUO B;  4FCY A;  1OOT A;  2PNI A;  2D6F A;  2RNA A;  2DAQ A;  2A0F B;  2QQ9 A;  3FDR A;  1G2B A;  4DOV A;  2MPX C;  2M51 A;  1UFF A;  2RHZ A;  1OX8 A;  3CCU T;  2HKQ B;  4LDY A;  1BI0 A;  4AFS C;  2BKD N;  1NJI C;  4F7U A;  2DVJ A;  1OQK A;  1GRI A;  3I55 A;  1QLY A;  2K3X A;  2HSE B;  5FWB A;  4BUG A;  3CPW S;  1BI3 A;  4RTY A;  1WJS A;  2DL3 A;  5ECA A;  3O5Z A;  1YCY A;  2CGH A;  1NEG A;  2LDM A;  4OB0 B;  1TXQ A;  4AMC A;  1NYF A;  3G4S Q;  3I35 A;  3CCJ A;  4BE2 A;  3C0C A;  3R6N A;  1I5L A;  3M57 A;  4QQ6 A;  4O5V A;  1YJ9 A;  1AD5 A;  1YP5 A;  3LWH A;  3C95 A;  2X4Y A;  2JZ2 A;  2QTX A;  3M0R A;  1IHV A;  3EHR A;  3J80 E;  3GPL A;  2BE9 B;  4RG2 A;  5KYW A;  2GBQ A;  4K11 A;  3JCM X;  3BW1 A;  4MMK A;  1ARK A;  2QGG A;  1TG0 A;  2W0Z A;  3OSV A;  1VIF A;  3ZBD A;  1QVG P;  1OPL A;  1W2B P;  2FRW A;  3EGX A;  1MMD A;  2VC8 A;  2RK2 A;  2GFU A;  2P0Q A;  2L3P A;  5GMK e;  2L3R A;  3OW2 S;  4PLL A;  3QPH A;  1RAA B;  2XIC A;  2LJ1 A;  3RUX A;  4M78 B;  4FIB A;  2R5M A;  1WYX A;  1OU8 A;  2KR3 A;  4M7D A;  2YLB A;  1SSF A;  5CVI A;  2DRK A;  1KHC A;  4C92 E;  4BI4 A;  2CSI A;  3RKW A;  3JCM g;  2HBW A;  2RHI A;  4JJB A;  2DX1 A;  2AZS A;  4JRI A;  1PNJ A;  4F17 A;  2BE7 D;  4WF2 A;  1PD0 A;  2X35 A;  3TQ7 P;  1YI2 T;  3OYA A;  1QQJ A;  3A8M B;  2OTJ Q;  2O9V A;  1PKT A;  3VS6 A;  1KQS P;  1ZA1 B;  3I56 Q;  2BZY A;  2C0T A;  3MJX A;  2XID A;  3RKY A;  2LQK A;  3CMA T;  1K73 C;  4HKE A;  3M58 A;  4XQ3 A;  2X9H A;  1FMW A;  2QA4 A;  1ACM B;  3CD6 Q;  5LJ5 h;  1NJI R;  1K9M R;  4A63 B;  4PJJ A;  1G3S A;  2ZZD A;  4A4H A;  1YIT T;  2ATC B;  3HFO A;  2WSF E;  2COZ A;  4E7H A;  2RB6 A;  4DBQ A;  3OBW A;  2J6O A;  1M2O A;  1VQN T;  5CKE A;  4GBQ A;  4C0Z A;  5DM7 R;  4F14 A;  2F69 A;  4M7A B;  4RCB A;  2DL7 A;  5CO7 A;  4QKU A;  2RJF A;  3EHQ A;  2X51 A;  5FRM A;  3WXM B;  3FJP A;  2CKK A;  1SRM A;  4ZTJ A;  3CC4 A;  1U06 A;  2W10 A;  1QMC A;  1SF9 A;  5FWC A;  5GAN g;  1WNL A;  2CP2 A;  3CCE Q;  5LJ3 g;  2DXU A;  4IUU A;  1QVF S;  4C92 A;  3CPW A;  2B8A A;  4XTV A;  4F7U G;  3CCU Q;  1EZZ B;  3A8O B;  1VQL T;  2HD0 A;  4BY6 B;  1BK2 A;  4M78 C;  3OYF A;  1I0C A;  1I5O B;  2QEX Q;  1JXM A;  2KQW A;  2DJQ A;  3JCM V;  1QCO A;  4A53 A;  3THK A;  4BE1 A;  2EWN A;  2JTM A;  2MI6 A;  1VQ9 T;  1OEB A;  3EAE A;  1EX4 A;  3DLL A;  2K9G A;  4C0D B;  1RAF B;  4ZNX A;  3JB9 I;  5FU6 B;  1WJR A;  2K2M A;  1VQM Q;  4F7U B;  2EGC A;  5L8R E;  1W4S A;  2R58 A;  3VYH B;  2L5Q A;  2DL4 A;  1JEG A;  2RPN A;  3A8H B;  4A4E A;  1RAC B;  2VV5 A;  1K73 R;  3JCM c;  3QG1 A;  3NHN A;  2COY A;  3JB9 J;  2CH4 A;  2QDL A;  4J6W A;  2VKN A;  3CME A;  2WSC E;  4IUT A;  3VJP A;  2V8J A;  1VQP A;  2CH4 W;  2J6F A;  4N0A A;  3JCM J;  3JCM e;  3HTR A;  2DEU A;  3V8J A;  3T9N A;  3MEU A;  1AEY A;  1QP3 A;  4M7D G;  3P8D A;  1X01 A;  2EIF A;  2DTH A;  4M7A C;  2PQW A;  5GAO m;  3PVQ A;  5KYW B;  1BB9 A;  5DLO A;  2V26 A;  1MND A;  4Q5W A;  5D6X A;  3CCR A;  3VS1 A;  2E6N A;  2KY9 A;  2EFI A;  2EYW A;  5A2Q E;  1ZBJ A;  2JVV A;  1R0B G;  2VXE A;  1VQK A;  3V7C A;  3CCV Q;  3CXC S;  2KT1 A;  3L2W A;  3OQ5 A;  1JJ2 P;  2GQI A;  4C8Q F;  3J7A F;  2CZ0 B;  3MPU B;  3X20 B;  3REA B;  4RTT A;  1VIE A;  3VKI A;  2XDB A;  4JLG A;  3CCJ Q;  3QKJ A;  2MWO A;  3G71 T;  2K7A A;  1M2V A;  4ME7 A;  1KD1 U;  1WHJ A;  2LVM A;  3X24 B;  1ZUY A;  1K9A A;  2CYZ B;  4M7D B;  4BY6 C;  1M27 C;  2CUD A;  1IRX A;  1D1B A;  1MMG A;  2GGR A;  1WHK A;  1YWP A;  1U1S A;  3CCS Q;  1VQ5 T;  2EQU A;  1YIT Q;  4KGX B;  1QVG S;  1W2B S;  4NOY A;  5HKC A;  3L2Q A;  2X3W D;  1GFD A;  1VQN Q;  5GAN e;  3C12 A;  3PTA A;  2EJG A;  3OS1 A;  3A98 A;  2ZPE B;  3MEW A;  4JZ4 A;  4C0D C;  4OVA A;  1Q81 U;  3GNF B;  5I2S A;  3FEO A;  2E65 A;  5FU6 C;  5LJ3 e;  1GBR A;  4EDU A;  5D6W A;  3M0U A;  4ZN3 A;  4M78 F;  1D1A A;  2EQK A;  2JOY A;  1QVF A;  3QUI A;  3OYI A;  3EH2 A;  1WDX A;  3CC7 Q;  1GBQ A;  1P92 A;  4FSS A;  3PVL A;  2P0P A;  1KHI A;  1PSE A;  1XTD A;  2AT1 B;  4D6W A;  4M7D D;  3TSZ A;  1D0Z A;  3QJ6 A;  3V7S A;  2JT4 A;  4RTU A;  4FYV B;  5GAM j;  3G4S A;  1VQL Q;  5HK3 A;  4LUE A;  2GTJ A;  5IXB A;  5KYY A;  1X6G A;  4WCI A;  5EG2 A;  1BI2 A;  1NG2 A;  4LDV A;  5FLX E;  1FX7 A;  1K8A C;  4AT1 B;  2J05 A;  4J83 A;  2QYZ A;  1QCN A;  1G8X A;  3M0Q A;  1S72 T;  3CEY A;  1K1Z A;  2HKN A;  2FPF A;  3JB9 G;  5GAO n;  3V8L A;  4J9I A;  4JS4 A;  4C92 B;  2XD0 A;  1X6B A;  4E7J A;  4E2F B;  2FZG B;  3CCL Q;  4J6X A;  4JDS A;  2KBT A;  4ELY C;  4ESR A;  1LNX A;  2IPO B;  5D6Y A;  4M7A F;  2DMO A;  3UA7 A;  2LMJ A;  2A3L A;  2LQW A;  4JRK A;  2AHJ B;  5I11 A;  4M7D C;  2FO0 A;  2KXD A;  4OMF B;  2DL5 A;  3OS0 A;  1YJW T;  2KRN A;  2BZX A;  2YT6 A;  4OMQ A;  4ZGJ B;  2RHU A;  3ZFJ A;  1OV3 A;  4IUQ A;  5J26 A;  4RUG A;  1M3B A;  2LCL A;  4F04 B;  1Y0M A;  2OTJ A;  2WAC A;  2HL3 A;  4J9C A;  3HPW A;  2OTL Q;  1WI7 A;  2E6Z A;  3I56 A;  2FG0 A;  3JV3 A;  2DZ9 A;  1GCP A;  5GMK i;  3CXC A;  3M4Y A;  4M4Z A;  1YJN A;  1SPK A;  3MO8 A;  2LQN A;  5GAO p;  2CP5 A;  1KJW A;  1BBZ A;  3OYE A;  4M77 G;  2EGA A;  3JCM d;  3MCA B;  2RM4 A;  2KRO A;  2I2L A;  4BDZ A;  2DE0 X;  3E9G A;  3MKD A;  2VXF A;  3FRN A;  3JCM b;  5GAN 3;  5GAN 2;  5GAN 8;  3G71 Q;  1BYM A;  2Z0W A;  3X26 B;  3JSC A;  3UWN A;  1W1F A;  2HQE A;  2D8H A;  1QVG A;  3OYJ A;  1W2B A;  3J81 E;  3VS4 A;  1QKX A;  1Q82 U;  2DXC A;  3JB9 D;  4F7U F;  2VYT A;  2KYB A;  1E6H A;  4KBM B;  3OYL A;  4FM4 B;  4JLI A;  3ASK A;  3CCM Q;  3VRY A;  2HZY A;  3NFC A;  2O4X B;  3RDV A;  1WXU A;  1KFZ A;  3OYM A;  1AHJ B;  4J7F A;  1SRL A;  1S1N A;  3CCE A;  4J5Y A;  3EFO A;  2RI2 A;  4C92 C;  1X43 A;  3UDC A;  1M2V B;  3VS0 A;  3VUB A;  3X25 B;  1M90 U;  3CCU A;  2K5F A;  5GAN 6;  1G83 A;  1N8R U;  2QEX A;  3BDU A;  5GAN d;  1TUC A;  4Z02 A;  4KRT A;  2XHC A;  2K57 A;  1TS9 A;  4A4F A;  4DBH A;  3L2U A;  5LJ3 d;  3PMT A;  2LC4 A;  4C5I A;  4EPC A;  1XOV A;  2QQA A;  2C0I A;  1HSQ A;  1FMV A;  1WA7 A;  4ZGE B;  4M77 D;  2DET A;  3QWY A;  3TEE A;  2RA2 A;  2RJD A;  1JB0 E;  1XNI A;  1JRI A;  4RTV A;  2KRM A;  2ZCF B;  1VQM A;  2L2P A;  2YUP A;  3CCQ T;  3Q1J A;  4EIK A;  2QDY B;  3BFM A;  3EG3 A;  1H92 A;  1OUL A;  2BZ8 A;  5M9O A;  2DJZ A;  1VQ7 Q;  2KSS A;  3I9Q A;  4ZN1 A;  3OY9 A;  2KRS A;  2L3Q A;  2D0Q B;  1VQ4 T;  4AG1 C;  1UB4 A;  1AWJ A;  2LNH B;  4LNP A;  1NPP A;  3QYH B;  3LWI A;  3HRU A;  1WFW A;  1KC8 U;  5KYN A;  5KYY B;  2YRV A;  3HP9 A;  5KE2 A;  2EQI A;  3DB4 A;  2MIO A;  2HEQ A;  4LDU A;  1PG5 B;  2ROT A;  3RER A;  3QZ5 B;  1G3W A;  4PK4 A;  1K9M C;  3M59 A;  4HCK A;  4OMP A;  5FRO A;  5GMK m;  3KFV A;  3L2V A;  2FRY A;  3QDF A;  3M54 A;  2H3J A;  4OF1 A;  1UGS B;  1I8F A;  1YI2 A;  5GAM h;  3MP8 A;  2F2X A;  3CCV A;  2RH2 A;  2FPE A;  1RLQ C;  3SWN A;  1RLP C;  1T0H A;  1Q86 U;  3QO3 A;  2K79 A;  5LJ5 g;  3V8K A;  3QII A;  4XU3 A;  2L8D A;  2YSQ A;  2ZAE A;  1RAD B;  1X2K A;  4PFO A;  5IHI A;  5CR2 A;  2AK5 A;  2MMP A;  3CCS A;  1YHQ T;  1TH7 A;  2LTO A;  4OB1 B;  3RR6 A;  1YIT A;  5KYX A;  5C0M A;  2KDS A;  1KD1 R;  1M1K C;  5GAN 4;  1M30 A;  5L23 A;  2HNI A;  1WZO A;  4LD9 K;  3H8Z A;  1VQN A;  4KUI A;  2SEM A;  1YFN A;  1X2Q A;  4C92 F;  3CC2 T;  2VGM A;  4B9X A;  3RMQ A;  5KYU A;  9ATC B;  2CZ1 B;  3AT1 B;  2EAY A;  1BCM A;  4HVU A;  4EMG A;  2LZ6 B;  4Z89 A;  3HL8 A;  3VU3 C;  2EJ9 A;  2IG0 A;  2CZ6 B;  3CC7 A;  1Q81 R;  2DYI A;  4IUV A;  1GL5 A;  1CKA A;  2M1H A;  2PVG B;  4ZTF A;  3VS5 A;  2K6D A;  4BAC A;  2XI9 A;  4J8O A;  1RI0 A;  2D9T A;  3L1A A;  4M75 A;  5GAN f;  1VQL A;  1YIJ Q;  3OB9 A;  4FT4 A;  1WIE A;  3M0S A;  2JM8 A;  2XU8 A;  3MET A;  2JS0 A;  1YJN Q;  3PFS A;  5LJ3 f;  2YUN A;  4CC2 A;  4RTW A;  3I55 T;  3NPF A;  2HQX A;  5CK9 A;  2P4R A;  2JXB A;  2JUF A;  1ZBX A;  3ER0 A;  3EFO B;  1U1T A;  2JMA A;  3TU4 K;  1PC0 A;  2YHT A;  3RMS A;  4IKF A;  5IHK A;  2ZPI B;  2FZK B;  1OU9 A;  1B34 A;  2RHY A;  3CCL A;  1CSK A;  2KGT A;  1YJ9 T;  4N4G A;  2K5I A;  4PJO G;  4PJM A;  1OPK A;  3VS3 A;  4C5E A;  5CKD A;  4XTX A;  3ZL7 C;  1M1F A;  4MDW A;  4PKC C;  4JRP A;  3LH5 A;  1AVZ C;  1C6V X;  1TSF A;  3INZ A;  4J9G A;  1N8R C;  2IVW A;  3GBQ A;  1G5V A;  4BI3 A;  2Y4X A;  2KAF A;  3BE3 A;  1UG1 A;  4GY5 A;  5C6S A;  2D0N A;  2KT8 A;  4LE9 A;  1M1K R;  1UEB A;  2OAW A;  1HYO A;  1VQ6 T;  5IHN A;  3OYD A;  2OTL A;  1HXD A;  3BDL A;  2M9U A;  1N9R A;  4L5G A;  3G7Z A;  4HT9 A;  4M77 E;  2KXC A;  3QDR B;  1EIF A;  1V76 A;  4N4I A;  2LCC A;  3HHT B;  3A8G B;  1RAH B;  5LJ5 e;  2ABL A;  2JTE A;  5EC7 A;  1KK7 A;  2NUT A;  3OYB A;  4XU2 A;  2KI7 A;  4J9D A;  2PTK A;  1IXD A;  2HDA A;  1G3Y A;  5A0G A;  4DEX A;  3G71 A;  2RO0 A;  2PU9 B;  3EGU A;  4A4G A;  1WHM A;  3NTK A;  3PT9 A;  2DXT A;  4X34 A;  4AG2 C;  4DOW A;  2RMO A;  1PCX A;  1JQQ A;  2KMT A;  3UA6 A;  1KC8 C;  4C0F A;  3C94 A;  3H0F A;  2LP5 A;  3ME9 A;  1VQ5 A;  3LGL A;  2A36 A;  4DQ2 A;  2QA4 T;  4KH1 B;  3CCM A;  3DKM A;  3E1S A;  2LT4 A;  4PJO D;  2F5K A;  3ULR B;  1WHG A;  4FT2 A;  1WHH A;  2E64 A;  3SWN B;  4HCB A;  4ORZ A;  2RQV A;  2GF7 A;  1AZG B;  2B86 A;  3EG2 A;  1YN8 A;  2COW A;  1VYU A;  1M1G A;  1N27 A;  2CZ7 B;  1Y7X A;  2GTO A;  2DVE A;  2H3E B;  2ZPH B;  2RQR A;  2QQS A;  2KVQ G;  4IIM A;  2RK1 A;  3OYC A;  4HCZ A;  5KYX B;  1GCQ A;  1IB8 A;  1Q7Y U;  2JS2 A;  1MMN A;  2FL7 A;  2DER A;  4M75 G;  2XKO C;  2DBM A;  4M77 A;  1YI2 Q;  1MMA A;  1MNE A;  3EGX B;  1N8R R;  2CDT A;  1QP2 A;  1SHF A;  4ELZ C;  4KUD K;  1PKS A;  2ZGW A;  3G6E T;  4MZP A;  2AZV A;  5GAM d;  2ENM A;  5LL6 S;  3CMA Q;  1VUB A;  2EKO A;  3UT1 A;  1IRE B;  3UPU A;  3IQL A;  2E10 A;  1IGU A;  1AOJ A;  1VQ7 A;  3QYG B;  1M5Q 1;  1Z9Z A;  2QI2 A;  4KH0 B;  3LW5 E;  4NS5 A;  5CKF A;  4J9E A;  4WTO B;  3CBP A;  4Y91 A;  1HJD A;  2DKG A;  6AT1 B;  2O88 A;  4MDX A;  1VQ8 T;  4KGV B;  3VS7 A;  1HK9 A;  2ZPG B;  3A1P A;  4V2S A;  1D0Y A;  2G3R A;  2J6K A;  1YJW A;  1KC8 R;  1C1A A;  2L89 A;  5FU7 B;  3KUF A;  4DBR A;  1SEM A;  3RKX A;  4EMK A;  1XQH A;  3I5R A;  5GAO q;  4XTW A;  3EG0 A;  4NL3 A;  4XU0 A;  4C5G A;  3SWN C;  4CC7 A;  1KQS S;  1B34 B;  4IUP A;  4VUB A;  2QGF B;  2A28 A;  2AKL A;  2KYM A;  1BI1 A;  3P8H A;  5GMK j;  1AWW A;  4M75 D;  2ED0 A;  5HY6 A;  4N4H A;  1Y96 A;  2XG8 D;  3M0T A;  3CCR T;  4DEY A;  3CPW P;  2D1X A;  4HVW A;  1VQ9 Q;  1WJQ A;  2X3X D;  1VQK T;  4E6R A;  5GAO l;  3LX7 A;  2PVO B;  1RUW A;  4QW2 A;  1NJI U;  3H6Z A;  1FYN A;  3PIO A;  1OI1 A;  2LJ3 A;  4PJN A;  3LYI A;  3QHS A;  5LJ5 d;  3M55 A;  1KQ2 A;  1ZLM A;  3SFM A;  3LGF A;  2MWP A;  1KQ1 A;  4XTZ A;  2LNV A;  1UJY A;  1PD1 A;  1ABO A;  1K76 A;  3REB B;  4OMN A;  5KCH A;  2CRE A;  3RBB B;  4JJD A;  3OS5 A;  4C8Q A;  1WQ7 A;  2V1Q A;  1JU5 C;  4HVV A;  4F16 A;  2K3B A;  1K0X A;  1IHW A;  3HFN A;  1U5S A;  2CP7 A;  1SG5 A;  1T3S A;  4OMM A;  1O75 A;  2DL8 A;  2YLC A;  3OW2 P;  1YIJ A;  4XU1 A;  4AFZ C;  1AWO A;  3LH0 A;  5DY9 A;  5KH6 A;  3SD4 A;  2NLU A;  1X75 C;  2LCS A;  3QXE B;  1YNZ A;  2QG9 B;  3BY7 A;  3FJ5 A;  1NYG A;  5FU7 C;  3H41 A;  1WX6 A;  1FMK A;  1R8O B;  2HCK A;  2D8J A;  3P8B B;  3G6E Q;  1KIK A;  1NM7 A;  3G4S T;  4QQG A;  2EYY A;  1UTI A;  2EYZ A;  4PJO E; 
#chains in the Genus database with same CATH homology
 1RLQ C;  1QWE A;  2KEA A;  1T0J A;  2DM1 A;  1RLP C;  1M3A A;  2F2V A;  1T0H A;  3QWX X;  2K79 A;  1I1J A;  1VYV A;  2ED1 A;  3NMZ C;  2YSQ A;  3NGP A;  2PZ1 A;  1U3O A;  1X2K A;  5IHI A;  2AK5 A;  1BK2 A;  1J3T A;  2F2W A;  1I0C A;  2RN8 A;  4Z8A A;  1JXM A;  2DJQ A;  1M30 A;  2RQW A;  5L23 A;  3THK A;  2SEM A;  2G6F X;  1X2Q A;  4J9H A;  1OEB A;  3SEM A;  2K9G A;  4CC3 A;  2EBP A;  2DRM A;  4HVU A;  4ZNX A;  2LZ6 B;  4Z89 A;  1ZUK A;  1N5Z A;  3EG1 A;  2CUB A;  2K2M A;  2YUO A;  2OI3 A;  4D8K A;  2EGC A;  2V1R A;  1GL5 A;  1CKA A;  1JEG A;  2DL4 A;  2RPN A;  2EVR A;  3VS5 A;  2K6D A;  1QWF A;  3NHN A;  1K4U S;  2CH4 A;  2QDL A;  1A0N B;  2VKN A;  1RI9 A;  2O2O A;  3PE0 A;  2CH4 W;  2J6F A;  1MV0 B;  1WIE A;  3M0S A;  2JM8 A;  3TVT A;  2JS0 A;  1X69 A;  2BTT A;  1AEY A;  4CC2 A;  2YUN A;  4RTW A;  2GNC A;  1PWT A;  1UGV A;  3NPF A;  2P4R A;  3PVQ A;  1BB9 A;  2NWM A;  2J7I A;  2JXB A;  4Y92 A;  2ESW A;  4JJC A;  1WLP B;  1W70 A;  5IXF A;  2CT3 A;  2AKK A;  2JMA A;  3VS1 A;  2EYW A;  1LCK A;  1ZBJ A;  1E7O A;  3U23 A;  1W6X A;  5IHK A;  2KT1 A;  4RTX A;  1E6G A;  2GQI A;  2IIM A;  1CSK A;  2KGT A;  4RTT A;  3REA B;  1ZX6 A;  3VRZ A;  1CKB A;  1OPK A;  2K7A A;  3VS3 A;  1GCQ C;  3ZL7 C;  2C0O A;  1ZUY A;  1UEC A;  1K9A A;  1WXT A;  3LH5 A;  1AVZ C;  1M27 C;  2CUD A;  1NLP C;  2GGR A;  4J9G A;  3M0P A;  1YWP A;  2MOX A;  3GBQ A;  4AFQ C;  1UG1 A;  2EPD A;  1ZSG A;  5I22 A;  4J9B A;  2D0N A;  2KT8 A;  4LE9 A;  3I5S A;  4R0K A;  2I0N A;  2O31 A;  2OAW A;  2X3W D;  1GFD A;  1T3L A;  4QT7 A;  1IO6 A;  4LN2 A;  5IHN A;  2ECZ A;  3A98 A;  2NUZ A;  4JZ4 A;  1BU1 A;  1V1C A;  3TSW A;  4JPB W;  2DA9 A;  4RTZ A;  2KXC A;  2RF0 A;  2SRC A;  1GBR A;  2LX7 A;  1JO8 A;  1K0S A;  2ABL A;  2YUQ A;  3M0U A;  2JM9 A;  2JTE A;  5EC7 A;  4OML A;  4D8D A;  4LUD A;  2CT4 A;  1WDX A;  1NLO C;  1GBQ A;  4J9D A;  4AFU C;  2PTK A;  4FSS A;  3SHW A;  3PVL A;  1EFN A;  2HDA A;  3UAT A;  3TSZ A;  4DEX A;  1I07 A;  3EGU A;  1HD3 A;  1MUZ A;  2JT4 A;  4RTU A;  4AG2 C;  2RMO A;  2XMF A;  1JQQ A;  2JW4 A;  3UA6 A;  2M0Y A;  1GFC A;  3H0H A;  4LUE A;  1H3H A;  3H0F A;  2LP5 A;  2GTJ A;  5IXB A;  1X6G A;  4WCI A;  2A36 A;  4J9F A;  1NG2 A;  1KSW A;  1TUD A;  2VWF A;  2J05 A;  2EW3 A;  3ULR B;  3M0Q A;  2DF6 A;  1K1Z A;  1YCS B;  1MV3 A;  2FPF A;  2EGE A;  2DIL A;  4ORZ A;  2RQV A;  1AZG B;  2B86 A;  2VVK A;  3EG2 A;  4J9I A;  1YN8 A;  1VYU A;  1X6B A;  1UJ0 A;  2DBK A;  2GTO A;  2KBT A;  2H8H A;  2EKH A;  2RQR A;  4GLM A;  4ESR A;  1B07 A;  4IIM A;  1AZE A;  1UE9 A;  5GJW B;  2DMO A;  3UA7 A;  2LMJ A;  2A37 A;  5I11 A;  2LQW A;  1GCQ A;  1M3C A;  1PRM C;  2JS2 A;  2FO0 A;  2KXD A;  2DL5 A;  2DYB A;  2DBM A;  1UHC A;  2KRN A;  2EYX A;  2YDL A;  2CDT A;  2BZX A;  2ROL A;  2YT6 A;  3H0I A;  4OMO A;  4OMQ A;  1PRL C;  1OV3 A;  1SHF A;  1PKS A;  4HXJ A;  4RUG A;  1M3B A;  2AZV A;  1Y0M A;  1VA7 A;  2ENM A;  4J9C A;  1Y57 A;  1WI7 A;  2FG0 A;  1JXO A;  3IQL A;  1GCP A;  1SHG A;  1WXB A;  3JV3 A;  1OOT A;  2PNI A;  4M4Z A;  1AOJ A;  1SPK A;  2LQN A;  2RNA A;  5IH2 A;  1VYT A;  1KJW A;  1G2B A;  2M51 A;  1BBZ A;  1UFF A;  4Z88 A;  1Z9Z A;  2MCN A;  2EGA A;  2KRO A;  4AFS C;  1QKW A;  2DVJ A;  2L3S A;  2E5K A;  2KE9 A;  2DE0 X;  1GRI A;  1QLY A;  5FWB A;  4J9E A;  4RTY A;  2DL3 A;  5ECA A;  3O5Z A;  1HJD A;  2L0A A;  2DLP A;  1NEG A;  2RQT A;  1W1F A;  2O9S A;  2RQU A;  2O88 A;  2D8H A;  3VS2 A;  1NYF A;  3VS7 A;  3VS4 A;  1QKX A;  2J6K A;  3I35 A;  1H8K A;  5FW9 A;  1YWO A;  3C0C A;  3R6N A;  2KYB A;  1SEM A;  1E6H A;  1AD5 A;  1YP5 A;  3RNJ A;  3I5R A;  1ZUU A;  3M0R A;  3VRY A;  3EHR A;  3EG0 A;  1QCF A;  1WXU A;  1KFZ A;  2GBQ A;  4CC7 A;  1X27 A;  1SRL A;  1S1N A;  4K11 A;  1ARK A;  1TG0 A;  2W0Z A;  2A28 A;  1X43 A;  2AKL A;  3VS0 A;  2KYM A;  1AWW A;  1OPL A;  1UUE A;  2JMC A;  2ED0 A;  2FRW A;  3M0T A;  2FEI A;  2L3P A;  4DEY A;  2D1X A;  1PHT A;  1G83 A;  4HVW A;  4CC4 B;  2LJ1 A;  2X3X D;  4E6R A;  1TUC A;  2HSP A;  4KRT A;  5HCK A;  1WYX A;  1RUW A;  2KR3 A;  2DNU A;  3UF4 A;  3CQT A;  2DRK A;  2J06 A;  1FYN A;  4JZ3 A;  2CSI A;  2LJ3 A;  1XOV A;  2HBW A;  2C0I A;  1Z9Q A;  1ZLM A;  1HSQ A;  1WA7 A;  4JJB A;  2DX1 A;  2AZS A;  1PNJ A;  4F17 A;  1AWX A;  3QWY A;  2LJ0 A;  2A08 A;  1UJY A;  1ABO A;  4RTV A;  1K76 A;  3REB B;  2KRM A;  2CSQ A;  2L2P A;  2YUP A;  2O9V A;  2FPD A;  1PKT A;  4OMN A;  3VS6 A;  1NEB A;  4EIK A;  2CRE A;  3EG3 A;  3RBB B;  4JJD A;  1ABQ A;  2BZY A;  1H92 A;  2C0T A;  4HVV A;  2BZ8 A;  1JU5 C;  2V1Q A;  1SSH A;  1M8M A;  4F16 A;  2K3B A;  1K0X A;  3I9Q A;  2OJ2 A;  1U5S A;  2KRS A;  2L3Q A;  1T3S A;  4OMM A;  4X1V A;  4AG1 C;  2DL8 A;  1AWJ A;  2LNH B;  4AFZ C;  4LNP A;  4A63 B;  1AWO A;  1UHF A;  1WFW A;  2LCS A;  2J6O A;  2KNB B;  2EQI A;  2MIO A;  2HEQ A;  4GBQ A;  1YNZ A;  4F14 A;  2ROT A;  3FJ5 A;  1NYG A;  3H41 A;  1WX6 A;  1FMK A;  2DL7 A;  4HCK A;  4OMP A;  3EHQ A;  2HCK A;  3KFV A;  2D8J A;  2FRY A;  1SRM A;  5GJV B;  1U06 A;  2W10 A;  1KIK A;  1NM7 A;  4IIO A;  5FWC A;  2EYY A;  2F2X A;  1UDL A;  1B3Q A;  1UTI A;  2EYZ A;  2FPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...