1WDXA

Yeast bbc1 sh3 domain, triclinic crystal form
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
b'PEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin tail region-interacting protein MTI1
publication title Crystal structure of Yeast BBC1 SH3 domain, triclinic crystal form
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 14
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wdxA00
1EFNA 3UA7A 3C0CA 2RMOA 1E7OA 1ARKA 2SEMA 2KRMA 2KROA 1BU1A 2ED0A 2DM1A 4CC3A 4Z89A 2KXDA 4IIMA 4OMPA 2LJ1A 3VRYA 1UJ0A 1UE9A 2JS0A 2A08A 4M4ZA 4LUEA 4CC4B 3M0QA 2A37A 2PZ1A 1KIKA 1X6BA 2D0NA 4AFSC 4E6RA 1X27A 5HCKA 3VS7A 1QKXA 1M3BA 1Y0MA 4AG1C 4AFQC 2D1XA 5I22A 3ZL7C 1VYUA 3QWYA 2J6FA 2LJ0A 3NPFA 4RTUA 1ZUUA 3EG0A 1UJYA 1GFCA 2C0TA 1M3AA 3R6NA 2K9GA 1NYGA 2LCSA 3U23A 1HD3A 1WX6A 3UA6A 3PE0A 5L23A 2DL4A 1T3LA 5I11A 1X2QA 2EPDA 2FO0A 3O5ZA 1SHFA 1WXTA 1I1JA 2LJ3A 2L2PA 4OMLA 3UATA 1CKAA 2CH4W 5IHNA 2GTJA 2CUDA 2IIMA 3SEMA 3REAB 1H3HA 2KGTA 1GRIA 1TUDA 2JTEA 2EW3A 1KJWA 1UHCA 2W10A 1NM7A 2FPFA 1AWJA 1MUZA 2P4RA 2PNIA 2CSQA 4J9EA 1QCFA 2LQWA 2YUPA 1UFFA 1AWOA 3PVQA 1B3QA 3RNJA 1JQQA 4WCIA 1JU5C 1PKTA 4HXJA 1H8KA 1UTIA 2D8HA 5IXBA 4JJBA 2EQIA 2MCNA 1K1ZA 2JS2A 5FWBA 2DBMA 2DL8A 1M30A 2DNUA 1W70A 2KE9A 1QWEA 1OEBA 1GCQC 1YP5A 4J9FA 1GFDA 2JW4A 2B86A 2CDTA 3NGPA 2XMFA 4RTTA 4JZ4A 1PHTA 2KEAA 3EG2A 2GGRA 1ZBJA 2J06A 2RN8A 1RI9A 1X69A 3QWXX 2EYYA 2X3XD 5IXFA 3NMZC 1H92A 1NLPC 2VVKA 2MIOA 2J7IA 4LNPA 4X1VA 1NG2A 1K76A 4FSSA 1G83A 1U06A 3IQLA 2RQUA 2FRYA 1JEGA 4LE9A 1TG0A 2F2XA 3VS5A 2YSQA 2LZ6B 4F14A 4AG2C 2EYZA 4Z8AA 2EYXA 2AKLA 4GBQA 2DYBA 2KRNA 2KT1A 3PVLA 1OPKA 1NEBA 1GBRA 1RUWA 2DL5A 2D8JA 2O31A 4F17A 1LCKA 1FMKA 1T0JA 1KFZA 4JPBW 2HBWA 1SRLA 1WXBA 3THKA 2O88A 2KXCA 4IIOA 1OV3A 2JT4A 4CC7A 2K7AA 2DA9A 1K0XA 4EIKA 2CH4A 2DRMA 3GBQA 2ROTA 1RLPC 3REBB 1AZGB 2HDAA 2KYBA 4ZNXA 5IHKA 1WYXA 2MOXA 2CT3A 4DEYA 1B07A 1SRMA 3A98A 2FEIA 3VS2A 1ABOA 4ESRA 2L0AA 2RQWA 2EKHA 2H8HA 2GTOA 2RQTA 2YUOA 3I5RA 1AWXA 1FYNA 1G2BA 2BZYA 2ROLA 3UF4A 1SSHA 1TUCA 2K2MA 1CKBA 1W6XA 1MV3A 2HSPA 2O2OA 1AD5A 2ENMA 1GCPA 1NLOC 2RNAA 5EC7A 2C0OA 4J9GA 1M8MA 3VS1A 1OOTA 1ZLMA 1BK2A 1S1NA 2KBTA 1HSQA 2EGCA 1SHGA 1GL5A 4JJDA 1PRLC 2FRWA 3I9QA 2K3BA 2DE0X 3VRZA 2EGEA 4RTXA 2JM8A 1ZX6A 3H41A 1IO6A 2VWFA 1VYVA 4A63B 1ABQA 3H0IA 3EHRA 1E6GA 1N5ZA 4QT7A 4J9CA 3TVTA 1UECA 1GCQA 2ECZA 1X2KA 1JXMA 2G6FX 1UUEA 4HVWA 4ORZA 3M0TA 2LQNA 2FPDA 2LMJA 1Z9ZA 4F16A 2EVRA 1YCSB 2GNCA 2L3PA 1I0CA 2SRCA 1HJDA 5FW9A 2YUNA 3EG1A 4J9HA 1U3OA 1K4US 2FPEA 1W1FA 2F2VA 4Y92A 2L3QA 2QDLA 2FG0A 4GLMA 1WIEA 1RLQC 3TSWA 1M27C 1SEMA 2I0NA 1OPLA 2RQVA 2F2WA 2DBKA 2V1RA 1T3SA 2K6DA 2ED1A 2EYWA 1V1CA 2V1QA 4HCKA 5IH2A 4J9BA 2DX1A 4KRTA 2NWMA 5GJWB 1PWTA 2YUQA 2O9SA 4DEXA 1ZUKA 4RTYA 1U5SA 4HVVA 2DF6A 2DMOA 3KFVA 1WFWA 2O9VA 2OAWA 2JXBA 2E5KA 2HEQA 3I35A 1YWOA 1WDXA 2DILA 3TSZA 2KRSA 2KR3A 3RBBB 3JV3A 4Z88A 1YWPA 4RTVA 2OJ2A 2GBQA 3M0PA 1K0SA 2KT8A 2DVJA 2OI3A 2YT6A 2PTKA 5IHIA 4OMMA 1AZEA 1VYTA 4RTZA 2CREA 2JMAA 1X6GA 3CQTA 3VS4A 4JJCA 2EGAA 2J6KA 1GBQA 3EHQA 1X43A 1Z9QA 1WA7A 3LH5A 2DJQA 3M0SA 3M0RA 2CT4A 3FJ5A 2DLPA 1ZUYA 4D8DA 4RUGA 1NEGA 1AWWA 2NUZA 2KNBB 3NHNA 1UGVA 1BB9A 2AK5A 2J05A 1I07A 4JZ3A 1XOVA 2DL7A 3VS0A 1AEYA 4OMNA 4J9DA 1E6HA 2EBPA 1KSWA 1QKWA 1JO8A 2J6OA 4AFZC 2BTTA 3H0FA 2DL3A 4J9IA 1MV0B 2K79A 4D8KA 2KYMA 2CSIA 4AFUC 2BZXA 2X3WD 2HCKA 1AOJA 2L3SA 3EG3A 2JM9A 2M0YA 1WLPB 1YN8A 4OMQA 2ESWA 1NYFA 3EGUA 3I5SA 5ECAA 4R0KA 1K9AA 1QWFA 4RTWA 1UHFA 2AZSA 1PNJA 5GJVB 1AVZC 4HVUA 3SHWA 1UG1A 2RPNA 1ZSGA 1WXUA 1T0HA 5FWCA 2BZ8A 3ULRB 1Y57A 2GQIA 3M0UA 1J3TA 1WI7A 4LN2A 1CSKA 2LX7A 1M3CA 2AZVA 3VS6A 1PRMC 1BBZA 2VKNA 2CUBA 2AKKA 2ABLA 2JMCA 3VS3A 1SPKA 1PKSA 2W0ZA 3H0HA 4LUDA 4CC2A 2LP5A 2C0IA 2M51A 4OMOA 2RF0A 1A0NB 2DRKA 2RQRA 2YDLA 1UDLA 2LNHB 1QLYA 1JXOA 4K11A 2A28A 1YNZA 1VA7A 2A36A
chains in the Genus database with same CATH superfamily
1WHGA 4NL3A 4M77D 1EFNA 2XK0A 1H3ZA 3KUFA 4QW2A 3C0CA 2RMOA 1E7OA 2XU8A 3E19A 4RKUE 4DBFA 2DTIA 3CD6T 4C0GA 4D6WA 3PNWC 4V2SA 2ED0A 4CC3A 5KYWA 4Z89A 5GAOl 4FCYA 2LJ1A 3PFSA 2A08A 1VQ4T 1Y07A 1VQ6A 4N0AC 3QBYA 2BIVA 4C8QC 2YHTA 4CRIA 1N8RR 3L2VA 2DD4A 3PGGA 4B6MA 1YFNA 3ER0A 2LT4A 3EG9B 1GXIE 2QA4T 3LX7A 2LJ0A 4RTUA 3JCMe 1K8AR 1O75A 2ZPIB 2C0TA 1PC0A 3R6NA 3JCMP 1NYGA 3U23A 4KULA 3CC2T 4E7ZA 1YI2Q 4M7DG 5I11A 2FO0A 1NE8A 3GNGA 5FU7B 2DEUA 5J26A 1I1JA 2L2PA 4OMLA 3UATA 1R0CB 4PFZA 2GTJA 1HK9A 1G3TA 2EW3A 2MWPA 2M9UA 3FJPA 3OA6A 1RAAB 2KSSA 1NM7A 3JB9J 4FYVB 2FPFA 1AWJA 2HL3A 2PNIA 1VIFA 1KHCA 1VQMT 2LQWA 4MDWA 1C0MA 4C5GA 5KH6A 3OYCA 5LJ3g 1JU5C 3OYYA 3DLLA 1PKTA 1H8KA 4JJBA 5LJ5e 2MCNA 2OTJA 3HPWA 4C8QE 2JS2A 4ZGEB 4M7DF 4HCZA 4EMKC 2NYSA 4ELYC 1QWEA 3QSUA 2EKOA 2CP7A 1TOVA 5CKBA 4IUTA 2B86A 4XTWA 3CC7A 2R57A 2KEAA 3EG2A 3H8ZA 2A7YA 2HMAA 1YJNT 3M54A 2OTLA 3S3MA 1PM3A 1X69A 2EYYA 5IAYA 1H92A 1WHLA 1G83A 2YXYA 1JEGA 4BI3A 3CPFA 2DJZA 2F2XA 3VS5A 2YSQA 2EYZA 4Z8AA 1X75C 1U8RA 2AKLA 1VQOA 2DYBA 1OI1A 3PVLA 3I56A 3BW1A 1RUWA 3OYLA 4F17A 1FMKA 1T0JA 2OTJQ 2KXCA 2DIQA 2JT4A 3LW5E 3OY9A 1VQ5A 3MP6A 3SWNB 1RI0A 4E2FB 2QQRA 3E9GA 4KUIA 3CC7Q 3CCVT 3CD6A 4KGVB 1ZA1B 1Q7YU 1WYXA 2CT3A 1N9RA 4M7AG 2OTLQ 1B07A 3V8KA 4DBQA 1B34B 3DLMA 3JCMg 1VQ4A 5M9OA 3M4YA 2MPXC 2RQTA 3I5RA 4NL2A 4M77A 4XU1A 1FYNA 5KYXA 3G6ET 2QAZA 3UF4A 3V7RA 2E6NA 1D0YA 3KXTA 2HSPA 1VQOQ 3M57A 2ENMA 3I56Q 4M78E 2QA4A 2C0OA 3VS1A 3EGDA 1N8RU 2WSEE 2KBTA 2BE7D 2CGHA 4CI0C 1GL5A 4EDUA 1VQNA 1G8XA 1VQ5Q 1PRLC 1YIJT 2FRWA 1PG5B 4M7AF 1W4SA 3RR6A 1D3BA 3CC2A 4NOYA 4RTXA 5GAOp 3MPUB 2JM8A 1MHNA 1IO6A 4MMLA 2E5QA 3CD6Q 1JRIA 2YRDA 2M02A 4DOWA 4HCBA 1QCNA 4ATOA 3H9NA 1KQ1A 1KQSP 1VQ4Q 4BD3A 1JXMA 4E7IA 2CS7A 2LMJA 3FB9A 4XAXB 1BI3A 1YCSB 2GNCA 2CZ1B 1VQMA 5J39A 2SRCA 3META 1Y7XA 2YUNA 2K57A 2RHYA 1JJ2A 2YLBA 2F5TX 4HT8A 2L3QA 2QA4Q 1UGPB 2FG0A 4E7HA 4ELZC 1N8RC 2RQVA 3HFNA 3JAME 2DBKA 1WPYA 1KQ2A 1V1CA 2X4JA 3CC2Q 1YJWT 1PWTA 1QVFP 4KBMB 5CIUA 3HRTA 2DF6A 5GAMe 1K8AC 1YJNA 1YHQT 2HBPA 4L6V5 1TTHB 4KT0E 4BI8B 2E5KA 1QMCA 3HP9A 2HEQA 3RKWA 2P0KA 2DILA 3VU3C 4M75G 2ZZDA 4MDXA 4RTVA 3M0PA 3ZFJA 5CK9A 1VQ7T 4OMMA 4FYWB 2RM4A 3HSBA 1VQMQ 4C8QG 3GP8A 1Q82C 2EIFA 2BKDN 3QIIA 2AHJB 4KH0B 2PVGB 2RHUA 4XTZA 3LH5A 2V8IA 4IUPA 3M0SA 1ZSZA 5HK3A 1WHKA 2DLPA 3A8HB 2RHXA 2JOYA 1HXDA 4X9CA 3CCJT 3JCMW 4R55A 3NHNA 1UGVA 1WQWA 3FC3A 3PIPA 2AK5A 2C06A 2IG0A 3CCVA 4HCCA 4M75F 3VS0A 1YJNQ 1E6HA 2EBPA 1KSWA 1QKWA 4PJOB 4M7DC 1KQSS 3M56A 5EG2A 4ZGDB 3CBPA 2K5FA 4J9IA 1UGRB 3FRNA 4PLLA 3GNFB 1R8OB 4A4FA 3JCMX 4QVZA 3J7AF 4O5VA 1D09B 1VQKT 2NUPB 1TUGB 2QQ9A 4BY6B 2L3SA 3EG3A 2RD1A 2JM9A 2M0YA 4RMOA 1WLPB 2ESWA 3EGUA 4R0KA 2Y4XA 1QWFA 2XDPA 3QKJA 3EG9A 4WTOB 1MMGA 5HKCA 2JZ2A 1PNJA 5KYYB 5GJVB 4MMKA 2QEXT 1YIJA 5C0MA 5GAN8 3L2RA 3OYAA 1BCMA 5FWCA 1QVFS 4C0DB 2GQIA 2HNIA 3INZA 5CKFA 2E65A 3V7CA 3CCVQ 3O8VA 1M90C 2LX7A 2QQSA 4PJNA 1BBZA 1LVKA 2ABLA 4DQ2A 2XKOC 2W0ZA 3H0HA 5L8RE 2F5KA 3CMET 3CCST 2C0IA 2LC4A 4M78G 1JBMA 3G71T 3G6EQ 4FYYB 1A0NB 2DRKA 2RQRA 5GANd 2E70A 2LQKA 1Q81R 2LDMA 1QLYA 4II1A 5LJ3d 2A36A 5GAOn 4XQ3A 1ARKA 1VQ8T 2V8JA 4M77E 4Y28E 1YIJQ 5FRMA 2SEMA 4C5EA 2KROA 3FEOA 3EGDB 2V8KA 4F04B 1BU1A 1IGQA 1YJWA 3C94A 3N5BB 4IIMA 4JLIA 2JS0A 4M4ZA 1PD1A 5CKEA 1YHQA 4LUEA 3M58A 1M5Q1 4M78F 5A0DA 1G3WA 4FIBA 5GAN3 3LGLA 1X6BA 2D0NA 2MF2A 3QO3A 2XG8D 4E6RA 1X27A 1QKXA 1WNLA 1M3BA 1VQ7A 1Y96B 4AFQC 5I21A 1WQ7A 2VV5A 1VQ9T 5I22A 3J80E 2NLUA 2I2LA 5A0GA 5LJ3j 1M3AA 1BIBA 1HD3A 3JCMQ 3EFSA 2KY9A 5L23A 2BUDA 4E7SA 4PJOD 1UGSB 2EPDA 5LJ3f 2ZPEB 3CCJA 1SHFA 2B8AA 2LJ3A 5DLOA 1YJWQ 3SWNA 4EMGA 1CKAA 3QZ5B 2CUDA 5GANh 3REAB 4GY5A 5C6SA 1YHQQ 1GRIA 1TUDA 2JTEA 1UHCA 2X51A 3UPUA 2GFAA 1MUZA 3JCMd 2P4RA 3WVEB 1B34A 4PFOA 1QCFA 2HL5C 1AWOA 1RAGB 1UFFA 2DXUA 3PVQA 1RL2A 3CMAT 4KUDK 3QDFA 3RNJA 1NJIC 1JQQA 1VQ7Q 4WCIA 1MGQA 1VQKA 1OYXA 2GQVA 2D8HA 2EQIA 3V7SA 5FWBA 3M9QA 2DBMA 3X26B 2QG9B 2QTVA 3HHTB 1M30A 3EFOA 1YP5A 4M7AB 1GFDA 3OSSC 2JW4A 2QEXA 3NGPA 2ZAEA 2QASA 3CCJQ 2FZGB 1K73R 1OZ3A 1PHTA 2J06A 2CYZB 3EH2A 3QWXX 2X3XD 3NMZC 4F7UB 5CQXA 3D7SB 4LNPA 1PCXA 1NG2A 2VGMA 3EFRA 4FSSA 3HTRA 3NTHA 2RQUA 1OZ2A 1YI2A 1TG0A 3CMEA 4F14A 4AG2C 3CCSA 4BDZA 1M1KR 4GBQA 4AMCA 3G71A 2CZ0B 1Q86R 2KRNA 3HKSA 5CCAA 4M75C 1GBRA 1VQKQ 2O31A 1YBYA 4LDUA 1LCKA 1C1AA 1PSEA 2HBWA 1WXBA 1M8VA 3THKA 2O88A 4JRKA 1I5LA 2K7AA 1I81A 4MZPA 3GBQA 4OB2B 3JCMh 4C92B 2DO3A 1VQ8A 2ATCB 2QEXQ 5GMKj 2M1HA 1Q81U 2KDSA 2KYBA 2DVEA 5IHKA 2VYTA 8AT1B 1YJ9Q 2DEQA 3JB9G 3M55A 1SRMA 3G7ZA 4J8OA 1ABOA 4MZMA 4ESRA 4PFPA 2RH2A 2RQWA 2GTOA 1KQSA 2CZ6B 4ZTFA 1AWXA 3OYMA 4BE1A 2K3YA 2BE9B 3CMEQ 3CCSQ 4P5NA 1CKBA 1LPLA 1N6AA 1MV3A 4FT2A 3G71Q 2FYKA 1AD5A 2Y4YA 5GMKh 1VQ9A 3RKYA 2L89A 1Q82R 1M8MA 4FU6A 1K9MR 1BK2A 3OYEA 4J6YA 4M77G 2EGCA 1SHGA 4BDYA 3LGFA 4JJDA 5CR2A 3JB9F 2CP0A 5LL6S 1IRXA 2DE0X 5GANg 3VRZA 1G3SA 2LCCA 4IUUA 2CP2A 2PUKB 4Q5WA 1VQ8Q 4M75E 3H41A 1M9SA 3CC4T 1Q81C 3X25B 1QVFA 1ABQA 1M2VB 3AHUA 3TVTA 3MEAA 3JCMb 1GCQA 1YCYA 2ECZA 1X2KA 2RO0A 2X4XA 2G6FX 5DM7R 3QYGB 1UUEA 4ORZA 4C8QB 3M0TA 3JRZA 2FHDA 1Z9ZA 2DKGA 4PJOA 2EVRA 4UC4A 3G4ST 3E1SA 1XQHA 1KG1A 2H3EB 4M77F 4J7FA 3MHXA 3CMAA 3F70A 4J9HA 3RUXA 2FPEA 1VQ9Q 3EGXB 5A0LA 4M7AD 5D7UA 4XTVA 4GLMA 4M78C 1RLQC 3TSWA 2NUPA 2F2WA 3VKIA 2QK0A 2V1RA 4JRIA 1T3SA 2ED1A 2DETA 3QXEB 2V1QA 3MKDA 5DY9A 7AT1B 4J9BA 1VQLT 3RESA 2RB6A 4JS5A 4HVVA 5KYYA 3KFVA 3UT1A 2RJFA 1WFWA 1QVGP 2O9VA 2JXBA 1WDXA 1M90R 3JV3A 3OYIA 1V29B 1K73U 2OJ2A 2GBQA 1SG5A 2E12A 3MJXA 2VB6A 3E9FA 2EJFA 2JMAA 1X6GA 2XD0A 3CQTA 3CMAQ 4AT1B 2PVOB 3BDLA 2J6KA 4C92D 3LLRA 1X43A 1Z9QA 5GAMd 2ZCFB 3S3NA 1M1KU 4EMKB 3J81E 4RUGA 2EAYA 1Q86U 4GLKA 2CKKA 1AWWA 3OS0A 2KQWA 2KNBB 4J6WA 4M7DA 4PL6A 2J05A 3PMTA 2XDDA 1XOVA 2KI7A 1G3YA 4OB0B 2CP5A 3P8BB 3EFOB 1JO8A 2J6OA 2P84A 1NBEB 2A0FB 4D8KA 2D9TA 2DK3A 3MCAB 4AFUC 1K73C 2BZXA 3OBWA 2COZA 4LXCA 4Y91A 2OX7A 1FXXA 1K8AU 2RJEA 1KC8C 3QJYA 1BI0A 1YN8A 3OS1A 3I5SA 5LJ5g 1M1FA 1Y96A 1OX8A 2RJCA 2AZSA 4OGEA 5IN1A 1M1KC 1AVZC 1EIFA 2K3XA 1Q86C 2EQMA 1OU9A 1WXUA 1OQKA 4PJJA 2JTFA 2QTXA 3ULRB 1Q82U 3CCQT 4C8QD 3CCRT 3PT9A 4B9XA 3CC4A 1J3TA 1QVGS 1M3CA 2AZVA 1PRMC 3OYBA 2CUBA 4LDWA 2HKQB 3VS3A 1SPKA 2PQWA 1YITT 4L59A 5GAMh 4CC2A 2LP5A 2E6ZA 2RK2A 2M51A 5D6YA 2RF0A 3G4SA 5CKHA 1ZQ1A 2K4YA 1UDLA 2MYSA 1D1BA 1NJIR 1JXOA 4N4IA 4C5IA 5GAN6 2L8DA 1VOMA 5CVIA 1P92A 2FZCB 2IPOB 4XU0A 4NS5A 2DTHA 2RJDA 3CCET 2H3JA 1VQLA 2O4XB 1K9MC 4OMPA 1UE9A 3CC4Q 2LTOA 5KYUB 4M7AA 3M4GA 3S3OA 4FM4B 2OAUA 4CC4B 3M0QA 1S72Q 3HFOA 2A37A 2PZ1A 2DYIA 1KIKA 4IUVA 3NFCA 2WACA 3VS7A 1I4K1 2EQUA 1Y0MA 2YLCA 4F7UA 1ZA2B 2YRVA 2KK4A 3G4SQ 3KBGA 4C5HA 4LDVA 3QWYA 1M90U 2J6FA 1ZUUA 3LYIA 4BB7A 1UJYA 1GFCA 1TH7A 5AT1B 2K5IA 2K9GA 2GCXA 1WX6A 3UA6A 1WZOA 4XU3A 1IHVA 1XJWB 3PE0A 3TEEA 2DL4A 1T3LA 1X2QA 3O5ZA 3G6EA 3JCMJ 1WXTA 4OP0A 1M2OA 3OB9A 4M77C 3OYNA 4HT9A 4L5GA 4IKFA 1VQLQ 5IHNA 5KCOA 2A3LA 2IIMA 1MMNA 4C92A 3SDZA 3UWNA 4KH1B 2P0QA 5CO7A 3OW2P 2CSQA 4PLIA 2ZPBB 5GAN5 1KD1R 2YUPA 3PIOA 1YJ9T 2CZ7B 4HXJA 1UGQB 5IXBA 1K1ZA 2EJGA 2P0PA 4PNOA 4HKEA 2DL8A 4J5YA 2DNUA 2KE9A 1QQJA 2HD0A 4OB1B 4DBHA 1OEBA 1LJOA 4DA4A 4J9FA 4JZ4A 3CBOA 3GIBA 2RN8A 1HYOA 3P8DA 2YRCA 5GAMg 3CCQA 3CCRA 3MO8A 3VYGA 2RI2A 3HL8A 2MAMA 5IXFA 1NLPC 4WF2A 4M7DB 3MP1A 1W2BP 2MIOA 2J7IA 3M59A 2O01E 1M2VA 1K76A 1U06A 1ACMB 3L2WA 4BUGA 2FRYA 1YITA 3ZEHA 2L3RA 2JJ9A 2EYXA 4N0AA 2XDBA 4B9WA 2QXFA 2KT1A 1OPKA 3PMIA 4C8QA 1NEBA 5I2SA 5GAN7 2DL5A 2D8JA 1BI1A 3JCMc 1KFZA 2E3HA 4RG8A 2ZGWA 4JPBW 4A4HA 4IIOA 1OV3A 3A5ZB 3RMSA 2Y90A 2DA9A 3EGXA 3TCJA 1K0XA 4EIKA 3QYHB 2DRMA 2MI6A 4FW1A 3REBB 2V26A 1NJIU 3CCEA 5GANj 3VS2A 4XTUA 3CCQQ 3CCRQ 2R5MA 2L0AA 3DB4A 1B7TA 2EQJA 1XNIA 2YUOA 5HK0A 3OW2S 5GANf 2JVVA 1YITQ 1SSHA 3V8LA 2HKNA 5CQYA 4ZGJB 1FX7A 1TXQA 4QQ6A 1ZSZC 3R6OA 2LX9A 1NLOC 2RNAA 2E64A 4J9GA 3Q1JA 2JTMA 4KGZB 3QG1A 1ZLMA 4PJMA 2KMTA 5D6WA 1S1NA 2DD5A 5FU6C 1HSQA 2DXCA 3LH0A 5GAN4 4BE2A 3RERA 2ZPFB 5J3BA 4QQGA 2K3BA 4JS4A 1I8FA 2F69A 2CP3A 1DJ7B 2EGEA 2PVDB 4A63B 2D6FA 1D0ZA 1VYVA 2R5AA 5D6XA 4EMKA 3EHRA 4A4EA 4QT7A 4EMHA 4J9CA 3CCEQ 1QVGA 1UECA 4JLGA 2MMPA 4E7LA 1W2BS 1V76A 2M16A 1ZHIA 1MNEA 2FPDA 4F16A 2PU9B 2L3PA 2NUTB 1G5VA 5LJ3e 5FW9A 1YJ9A 4JJNK 3OS2A 3L42A 2DERA 1X6OA 5GMKi 2QQBA 3OS5A 2F2VA 4Y92A 2QDLA 5KCHA 3CCMT 5GMKm 3RIRA 1KC8R 1M27C 2I0NA 2HQHA 3AT1B 1OU8A 4PJOG 5LJ5d 2EYWA 5FU7C 2MWOA 2KVQG 4PKCC 4FL6A 1M4ZA 5IH2A 3BY7A 4M7DD 6AT1B 2YUQA 1ZUKA 4RTYA 2FVUA 2DMOA 4Z02A 4F7UE 3JCMf 1Q7YR 2QGGA 1YWOA 2KRSA 1SSFA 3PTAA 3G1JA 2F1LA 1FMWA 4DBRA 2DZ9A 3ME9A 2KT8A 2DVJA 5I2MA 1M1GA 3TREA 2PTKA 4PK4A 1AZEA 1VYTA 5FRNA 2DAQA 3VS4A 2DIGA 4JJCA 4PJOF 2JN0A 1WJRA 3NTIA 1GBQA 3EHQA 4OB3B 1WA7A 2AT1B 2LRQA 1TWBA 3OSVA 4C92E 3LWHA 3M0RA 5A2QE 2JNGA 3FJ5A 3FDRA 1KD1C 5LJ5j 4D8DA 4A54A 1ZBXA 5KYNA 3FIFA 3OYKA 3BDUA 4JZ3A 1BKBA 1RAFB 2DL7A 3V8JA 5LJ5f 3CXCP 1AEYA 3CPWP 4OMNA 4J9DA 3QPHA 3CEYA 1VQNT 3L1AA 1MV0B 3OYDA 3SFMA 2O4XA 2KYMA 3CCUT 3JB9H 5KYUA 5LJ5h 1Y71A 1QCOA 4RCCA 4VUBA 3WXMB 2E10A 4E47A 4M75B 1QW1A 1D0XA 1S72T 1VQ6Q 5ECAA 1K9AA 5GMKe 1UHFA 3SWNC 1I5OB 3C4SA 3SHWA 1FMVA 1FWZA 2RPNA 1NPPA 2BZ8A 1Y57A 3CBMA 1WJSA 3OQ5A 1CSKA 4JRQA 3A8GB 3VS6A 2VKNA 5CKDA 2AKKA 2JMCA 2MK5A 4FYXB 1PKSA 2HQXA 5GAOr 4LUDA 4XTXA 2LCLA 4KGXB 3BFMA 2EYQA 3ZBDA 1AT1B 3C12A 4OMOA 4XTYA 2YDLA 1BIAA 4N4HA 2X35A 2LNHB 2RK1A 2DXTA 1QP2A 4K11A 4QVDA 2A28A 4JDSA 2LVMA 1VUBA 3CCMA 1PD0A 1SKUB 2YWWA 2GFUA 3TQ7P 3UA7A 2KRMA 5GMKl 3QHSA 4BI4A 1MMAA 3HRSA 2DM1A 4JUVA 1EX4A 3CXCS 2KXDA 3CPWS 3VRYA 1KC8U 1UJ0A 2R58A 2K2VA 2VXFA 4ME7A 4IUQA 2EQKA 3QJ6A 1R0BG 4AFSC 2QYZA 2JUFA 1QVPA 3OW2A 5HCKA 4ZTJA 4A53A 3GLXA 4AG1C 3URGA 4E7JA 4BACA 2D1XA 3ZL7C 1VYUA 2XHCA 3OMGA 2COYA 3QDRB 3NPFA 5IT9E 4OF1A 3EG0A 4LD6A 2LQ8A 5GAN2 4M78B 2LCSA 3CCMQ 4EPCA 1U1SA 4A4GA 4F7UG 4QKUA 2FZKB 2PUOB 3MEUA 1O9SA 4J7IA 3MP8A 2CH4W 2EFIA 4LDXA 3SEMA 1H3HA 4HA8A 1UEBA 2KGTA 3I55T 1NPRA 2EJ9A 1KJWA 3DKMA 3M5AA 2W10A 2QDYB 5HY6A 3SB2A 5GAMj 2DZCA 1W2BA 2KAFA 1SF9A 4M75D 1IXDA 3CCUA 2COWA 2Z0WA 4J9EA 3OYGA 3L2UA 2WSFE 2ZPGB 1B3QA 5GAMf 2XIDA 2E41A 1Q7YC 1Q95G 3A1PA 1K9MU 1UTIA 1H641 4C92G 1NZ9A 1IREB 4F7UF 1S72A 1RADB 3JSCA 1R77A 5KYWB 1W70A 3MEWA 1WGSA 3VUZA 4BE0A 1GCQC 4LDYA 2CDTA 3C95A 2XMFA 4RTTA 3VYHB 3M53A 2GGRA 1ZBJA 1RI9A 2K5LA 4MZTA 3OBYA 1RAIB 4PJOC 1VQPT 2VVKA 1IB8A 4X1VA 1VQNQ 3IQLA 4LE9A 4C92F 2LZ6B 3CCUQ 4BY6C 2E3IA 4N4GA 2FB7A 5FROA 1IZ6A 2RHIA 1KK7A 3GPLA 2NUTA 1SRLA 2LNVA 3OYJA 2VGNA 4CC7A 2E1HA 3GOXA 2CH4A 1F1BB 2ROTA 1RLPC 4C0DC 1EZZB 1D1CA 3TU4K 1AZGB 2HDAA 4ZNXA 2L5QA 2QGFB 3CCLT 2MOXA 4DEYA 1PSFA 3BE3A 3OYHA 4C0FA 3A98A 2FEIA 4OMFB 3DB3A 1WJQA 2P4TA 3S6WA 2EKHA 2H8HA 3UDCA 1KHIA 1G2BA 2BZYA 2ROLA 4O6JA 1TUCA 2XICA 2K2MA 1W6XA 4M78D 2O2OA 3RDVA 4A4KA 4TVRA 4PJOE 3QZ9B 1GCPA 5EC7A 2HSEB 1OOTA 4C8QF 1RABB 3I9QA 1LOJA 3EH1A 4FW2A 2RI5A 1OULA 3X28B 5AYFA 1ZX6A 3LWIA 2VWFA 3H0IA 1E6GA 1N5ZA 4IURA 8ATCB 2DPPB 3I55A 4HVWA 4YTLA 2LQNA 3VUBA 4PJLA 4R56A 2VXEA 2QQAA 3E2UA 1I0CA 3GF5A 1HJDA 4XU2A 3P8HA 3EG1A 1U3OA 1K4US 1TS9A 3JCMV 1W1FA 3RMQA 2VASA 1WIEA 2LT1A 5KE3A 1SEMA 1OPLA 3A8MB 1YI2T 4QVCA 5GAOm 2K6DA 4M75A 4HCKA 4RG2A 2VC8A 3JB9I 2DX1A 4J83A 4KRTA 1XTDA 2NWMA 5GJWB 2O9SA 4DEXA 1U5SA 4FT4A 4M77B 4J6XA 5KYXB 4M7DE 3WVDB 3CXCA 1VQ6T 3CPWA 2OAWA 1VQPA 3I35A 1UB4A 3TSZA 2E4HA 2CP6A 1OX9A 2KR3A 3RBBB 4Z88A 3I55Q 1YWPA 3SD4A 1K0SA 1WHMA 1C6VX 2OI3A 2RA2A 2YT6A 3OYFA 4C0ZA 5IHIA 3A8OB 3L2QA 3T9NA 3EAEA 2CREA 4RTZA 1BI2A 1JJ2P 2EGAA 3ASKA 1D3BB 3X20B 5GAOq 4X34A 2DJQA 2CT4A 4M7AC 1ZUYA 4ANJA 1NEGA 2NUZA 2DFUA 1BB9A 4JRPA 1N9SA 1WHHA 1JB0E 2HAXA 5FLXE 2HZYA 1VIEA 1I07A 1LNXA 1TU0B 2D0QB 4X9DA 3CCLA 3VV0A 3MEVA 1X01A 4FSXA 2EWNA 4ZN3A 4LD9K 1VQPQ 4AFZC 2BTTA 2RI3A 3H0FA 2DL3A 3X24B 2K79A 4RCBA 2CSIA 2HQEA 2X3WD 1QP3A 2HCKA 1AHJB 4ZN1A 1D1AA 9ATCB 1IHWA 1AOJA 3A8LB 1BYMA 2DTOA 1RAHB 3HRUA 1N27A 2OTJT 4OMQA 1NYFA 1TSFA 1RACB 2AIRB 2GF7A 3FLGA 4RTWA 5LJ3h 2M0OA 3QUIA 2DXBA 5GANe 4HVUA 4C92C 4QQDA 1UG1A 3CC7T 1ZSGA 4E7KA 1T0HA 2X4YA 4M78A 2OTLT 1WHJA 4XK8E 3M0UA 3OMCA 2XI9A 1WI7A 4LN2A 2VUBA 3CCLQ 2WSCE 3JB9D 2ZPHB 3NTKA 3H6ZA 4M7AE 2FL7A 3RKXA 3L2ZA 5KE2A 2RHZA 1KD1U 5DLQE 2X9HA 1U1TA 3VJPA 1VQOT 1BCOA 4OVAA 1IGUA 2QI2A 3I56T 2IVWA 1JJ2S 2X4WA 1RAEB 1ZSZB 4DOVA 5CAIA 4OGCA 1YNZA 1MMDA 2G3RA 1VQ5T 1VA7A 1MNDA 5FU6B
chains in the Genus database with same CATH topology
1EFNA 3UA7A 3C0CA 2RMOA 1E7OA 1ARKA 2SEMA 2KRMA 2KROA 1BU1A 2ED0A 2DM1A 4CC3A 4Z89A 2KXDA 4IIMA 4OMPA 2LJ1A 3VRYA 1UJ0A 1UE9A 2JS0A 2A08A 4M4ZA 4LUEA 4CC4B 3M0QA 2A37A 2PZ1A 1KIKA 1X6BA 2D0NA 4AFSC 4E6RA 1X27A 5HCKA 3VS7A 1QKXA 1M3BA 1Y0MA 4AG1C 4AFQC 2D1XA 5I22A 3ZL7C 1VYUA 3QWYA 2J6FA 2LJ0A 3NPFA 4RTUA 1ZUUA 3EG0A 1UJYA 1GFCA 2C0TA 1M3AA 3R6NA 2K9GA 1NYGA 2LCSA 3U23A 1HD3A 1WX6A 3UA6A 3PE0A 5L23A 2DL4A 1T3LA 5I11A 1X2QA 2EPDA 2FO0A 3O5ZA 1SHFA 1WXTA 1I1JA 2LJ3A 2L2PA 4OMLA 3UATA 1CKAA 2CH4W 5IHNA 2GTJA 2CUDA 2IIMA 3SEMA 3REAB 1H3HA 2KGTA 1GRIA 1TUDA 2JTEA 2EW3A 1KJWA 1UHCA 2W10A 1NM7A 2FPFA 1AWJA 1MUZA 2P4RA 2PNIA 2CSQA 4J9EA 1QCFA 2LQWA 2YUPA 1UFFA 1AWOA 3PVQA 1B3QA 3RNJA 1JQQA 4WCIA 1JU5C 1PKTA 4HXJA 1H8KA 1UTIA 2D8HA 5IXBA 4JJBA 2EQIA 2MCNA 1K1ZA 2JS2A 5FWBA 2DBMA 2DL8A 1M30A 2DNUA 1W70A 2KE9A 1QWEA 1OEBA 1GCQC 1YP5A 4J9FA 1GFDA 2JW4A 2B86A 2CDTA 3NGPA 2XMFA 4RTTA 4JZ4A 1PHTA 2KEAA 3EG2A 2GGRA 1ZBJA 2J06A 2RN8A 1RI9A 1X69A 3QWXX 2EYYA 2X3XD 5IXFA 3NMZC 1H92A 1NLPC 2VVKA 2MIOA 2J7IA 4LNPA 4X1VA 1NG2A 1K76A 4FSSA 1G83A 1U06A 3IQLA 2RQUA 2FRYA 1JEGA 4LE9A 1TG0A 2F2XA 3VS5A 2YSQA 2LZ6B 4F14A 4AG2C 2EYZA 4Z8AA 2EYXA 2AKLA 4GBQA 2DYBA 2KRNA 2KT1A 3PVLA 1OPKA 1NEBA 1GBRA 1RUWA 2DL5A 2D8JA 2O31A 4F17A 1LCKA 1FMKA 1T0JA 1KFZA 4JPBW 2HBWA 1SRLA 1WXBA 3THKA 2O88A 2KXCA 4IIOA 1OV3A 2JT4A 4CC7A 2K7AA 2DA9A 1K0XA 4EIKA 2CH4A 2DRMA 3GBQA 2ROTA 1RLPC 3REBB 1AZGB 2HDAA 2KYBA 4ZNXA 5IHKA 1WYXA 2MOXA 2CT3A 4DEYA 1B07A 1SRMA 3A98A 2FEIA 3VS2A 1ABOA 4ESRA 2L0AA 2RQWA 2EKHA 2H8HA 2GTOA 2RQTA 2YUOA 3I5RA 1AWXA 1FYNA 1G2BA 2BZYA 2ROLA 3UF4A 1SSHA 1TUCA 2K2MA 1CKBA 1W6XA 1MV3A 2HSPA 2O2OA 1AD5A 2ENMA 1GCPA 1NLOC 2RNAA 5EC7A 2C0OA 4J9GA 1M8MA 3VS1A 1OOTA 1ZLMA 1BK2A 1S1NA 2KBTA 1HSQA 2EGCA 1SHGA 1GL5A 4JJDA 1PRLC 2FRWA 3I9QA 2K3BA 2DE0X 3VRZA 2EGEA 4RTXA 2JM8A 1ZX6A 3H41A 1IO6A 2VWFA 1VYVA 4A63B 1ABQA 3H0IA 3EHRA 1E6GA 1N5ZA 4QT7A 4J9CA 3TVTA 1UECA 1GCQA 2ECZA 1X2KA 1JXMA 2G6FX 1UUEA 4HVWA 4ORZA 3M0TA 2LQNA 2FPDA 2LMJA 1Z9ZA 4F16A 2EVRA 1YCSB 2GNCA 2L3PA 1I0CA 2SRCA 1HJDA 5FW9A 2YUNA 3EG1A 4J9HA 1U3OA 1K4US 2FPEA 1W1FA 2F2VA 4Y92A 2L3QA 2QDLA 2FG0A 4GLMA 1WIEA 1RLQC 3TSWA 1M27C 1SEMA 2I0NA 1OPLA 2RQVA 2F2WA 2DBKA 2V1RA 1T3SA 2K6DA 2ED1A 2EYWA 1V1CA 2V1QA 4HCKA 5IH2A 4J9BA 2DX1A 4KRTA 2NWMA 5GJWB 1PWTA 2YUQA 2O9SA 4DEXA 1ZUKA 4RTYA 1U5SA 4HVVA 2DF6A 2DMOA 3KFVA 1WFWA 2O9VA 2OAWA 2JXBA 2E5KA 2HEQA 3I35A 1YWOA 1WDXA 2DILA 3TSZA 2KRSA 2KR3A 3RBBB 3JV3A 4Z88A 1YWPA 4RTVA 2OJ2A 2GBQA 3M0PA 1K0SA 2KT8A 2DVJA 2OI3A 2YT6A 2PTKA 5IHIA 4OMMA 1AZEA 1VYTA 4RTZA 2CREA 2JMAA 1X6GA 3CQTA 3VS4A 4JJCA 2EGAA 2J6KA 1GBQA 3EHQA 1X43A 1Z9QA 1WA7A 3LH5A 2DJQA 3M0SA 3M0RA 2CT4A 3FJ5A 2DLPA 1ZUYA 4D8DA 4RUGA 1NEGA 1AWWA 2NUZA 2KNBB 3NHNA 1UGVA 1BB9A 2AK5A 2J05A 1I07A 4JZ3A 1XOVA 2DL7A 3VS0A 1AEYA 4OMNA 4J9DA 1E6HA 2EBPA 1KSWA 1QKWA 1JO8A 2J6OA 4AFZC 2BTTA 3H0FA 2DL3A 4J9IA 1MV0B 2K79A 4D8KA 2KYMA 2CSIA 4AFUC 2BZXA 2X3WD 2HCKA 1AOJA 2L3SA 3EG3A 2JM9A 2M0YA 1WLPB 1YN8A 4OMQA 2ESWA 1NYFA 3EGUA 3I5SA 5ECAA 4R0KA 1K9AA 1QWFA 4RTWA 1UHFA 2AZSA 1PNJA 5GJVB 1AVZC 4HVUA 3SHWA 1UG1A 2RPNA 1ZSGA 1WXUA 1T0HA 5FWCA 2BZ8A 3ULRB 1Y57A 2GQIA 3M0UA 1J3TA 1WI7A 4LN2A 1CSKA 2LX7A 1M3CA 2AZVA 3VS6A 1PRMC 1BBZA 2VKNA 2CUBA 2AKKA 2ABLA 2JMCA 3VS3A 1SPKA 1PKSA 2W0ZA 3H0HA 4LUDA 4CC2A 2LP5A 2C0IA 2M51A 4OMOA 2RF0A 1A0NB 2DRKA 2RQRA 2YDLA 1UDLA 2LNHB 1QLYA 1JXOA 4K11A 2A28A 1YNZA 1VA7A 2A36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFN A;  3UA7 A;  3C0C A;  2RMO A;  1E7O A;  1ARK A;  2SEM A;  2KRM A;  2KRO A;  1BU1 A;  2ED0 A;  2DM1 A;  4CC3 A;  4Z89 A;  2KXD A;  4IIM A;  4OMP A;  2LJ1 A;  3VRY A;  1UJ0 A;  1UE9 A;  2JS0 A;  2A08 A;  4M4Z A;  4LUE A;  4CC4 B;  3M0Q A;  2A37 A;  2PZ1 A;  1KIK A;  1X6B A;  2D0N A;  4AFS C;  4E6R A;  1X27 A;  5HCK A;  3VS7 A;  1QKX A;  1M3B A;  1Y0M A;  4AG1 C;  4AFQ C;  2D1X A;  5I22 A;  3ZL7 C;  1VYU A;  3QWY A;  2J6F A;  2LJ0 A;  3NPF A;  4RTU A;  1ZUU A;  3EG0 A;  1UJY A;  1GFC A;  2C0T A;  1M3A A;  3R6N A;  2K9G A;  1NYG A;  2LCS A;  3U23 A;  1HD3 A;  1WX6 A;  3UA6 A;  3PE0 A;  5L23 A;  2DL4 A;  1T3L A;  5I11 A;  1X2Q A;  2EPD A;  2FO0 A;  3O5Z A;  1SHF A;  1WXT A;  1I1J A;  2LJ3 A;  2L2P A;  4OML A;  3UAT A;  1CKA A;  2CH4 W;  5IHN A;  2GTJ A;  2CUD A;  2IIM A;  3SEM A;  3REA B;  1H3H A;  2KGT A;  1GRI A;  1TUD A;  2JTE A;  2EW3 A;  1KJW A;  1UHC A;  2W10 A;  1NM7 A;  2FPF A;  1AWJ A;  1MUZ A;  2P4R A;  2PNI A;  2CSQ A;  4J9E A;  1QCF A;  2LQW A;  2YUP A;  1UFF A;  1AWO A;  3PVQ A;  1B3Q A;  3RNJ A;  1JQQ A;  4WCI A;  1JU5 C;  1PKT A;  4HXJ A;  1H8K A;  1UTI A;  2D8H A;  5IXB A;  4JJB A;  2EQI A;  2MCN A;  1K1Z A;  2JS2 A;  5FWB A;  2DBM A;  2DL8 A;  1M30 A;  2DNU A;  1W70 A;  2KE9 A;  1QWE A;  1OEB A;  1GCQ C;  1YP5 A;  4J9F A;  1GFD A;  2JW4 A;  2B86 A;  2CDT A;  3NGP A;  2XMF A;  4RTT A;  4JZ4 A;  1PHT A;  2KEA A;  3EG2 A;  2GGR A;  1ZBJ A;  2J06 A;  2RN8 A;  1RI9 A;  1X69 A;  3QWX X;  2EYY A;  2X3X D;  5IXF A;  3NMZ C;  1H92 A;  1NLP C;  2VVK A;  2MIO A;  2J7I A;  4LNP A;  4X1V A;  1NG2 A;  1K76 A;  4FSS A;  1G83 A;  1U06 A;  3IQL A;  2RQU A;  2FRY A;  1JEG A;  4LE9 A;  1TG0 A;  2F2X A;  3VS5 A;  2YSQ A;  2LZ6 B;  4F14 A;  4AG2 C;  2EYZ A;  4Z8A A;  2EYX A;  2AKL A;  4GBQ A;  2DYB A;  2KRN A;  2KT1 A;  3PVL A;  1OPK A;  1NEB A;  1GBR A;  1RUW A;  2DL5 A;  2D8J A;  2O31 A;  4F17 A;  1LCK A;  1FMK A;  1T0J A;  1KFZ A;  4JPB W;  2HBW A;  1SRL A;  1WXB A;  3THK A;  2O88 A;  2KXC A;  4IIO A;  1OV3 A;  2JT4 A;  4CC7 A;  2K7A A;  2DA9 A;  1K0X A;  4EIK A;  2CH4 A;  2DRM A;  3GBQ A;  2ROT A;  1RLP C;  3REB B;  1AZG B;  2HDA A;  2KYB A;  4ZNX A;  5IHK A;  1WYX A;  2MOX A;  2CT3 A;  4DEY A;  1B07 A;  1SRM A;  3A98 A;  2FEI A;  3VS2 A;  1ABO A;  4ESR A;  2L0A A;  2RQW A;  2EKH A;  2H8H A;  2GTO A;  2RQT A;  2YUO A;  3I5R A;  1AWX A;  1FYN A;  1G2B A;  2BZY A;  2ROL A;  3UF4 A;  1SSH A;  1TUC A;  2K2M A;  1CKB A;  1W6X A;  1MV3 A;  2HSP A;  2O2O A;  1AD5 A;  2ENM A;  1GCP A;  1NLO C;  2RNA A;  5EC7 A;  2C0O A;  4J9G A;  1M8M A;  3VS1 A;  1OOT A;  1ZLM A;  1BK2 A;  1S1N A;  2KBT A;  1HSQ A;  2EGC A;  1SHG A;  1GL5 A;  4JJD A;  1PRL C;  2FRW A;  3I9Q A;  2K3B A;  2DE0 X;  3VRZ A;  2EGE A;  4RTX A;  2JM8 A;  1ZX6 A;  3H41 A;  1IO6 A;  2VWF A;  1VYV A;  4A63 B;  1ABQ A;  3H0I A;  3EHR A;  1E6G A;  1N5Z A;  4QT7 A;  4J9C A;  3TVT A;  1UEC A;  1GCQ A;  2ECZ A;  1X2K A;  1JXM A;  2G6F X;  1UUE A;  4HVW A;  4ORZ A;  3M0T A;  2LQN A;  2FPD A;  2LMJ A;  1Z9Z A;  4F16 A;  2EVR A;  1YCS B;  2GNC A;  2L3P A;  1I0C A;  2SRC A;  1HJD A;  5FW9 A;  2YUN A;  3EG1 A;  4J9H A;  1U3O A;  1K4U S;  2FPE A;  1W1F A;  2F2V A;  4Y92 A;  2L3Q A;  2QDL A;  2FG0 A;  4GLM A;  1WIE A;  1RLQ C;  3TSW A;  1M27 C;  1SEM A;  2I0N A;  1OPL A;  2RQV A;  2F2W A;  2DBK A;  2V1R A;  1T3S A;  2K6D A;  2ED1 A;  2EYW A;  1V1C A;  2V1Q A;  4HCK A;  5IH2 A;  4J9B A;  2DX1 A;  4KRT A;  2NWM A;  5GJW B;  1PWT A;  2YUQ A;  2O9S A;  4DEX A;  1ZUK A;  4RTY A;  1U5S A;  4HVV A;  2DF6 A;  2DMO A;  3KFV A;  1WFW A;  2O9V A;  2OAW A;  2JXB A;  2E5K A;  2HEQ A;  3I35 A;  1YWO A;  1WDX A;  2DIL A;  3TSZ A;  2KRS A;  2KR3 A;  3RBB B;  3JV3 A;  4Z88 A;  1YWP A;  4RTV A;  2OJ2 A;  2GBQ A;  3M0P A;  1K0S A;  2KT8 A;  2DVJ A;  2OI3 A;  2YT6 A;  2PTK A;  5IHI A;  4OMM A;  1AZE A;  1VYT A;  4RTZ A;  2CRE A;  2JMA A;  1X6G A;  3CQT A;  3VS4 A;  4JJC A;  2EGA A;  2J6K A;  1GBQ A;  3EHQ A;  1X43 A;  1Z9Q A;  1WA7 A;  3LH5 A;  2DJQ A;  3M0S A;  3M0R A;  2CT4 A;  3FJ5 A;  2DLP A;  1ZUY A;  4D8D A;  4RUG A;  1NEG A;  1AWW A;  2NUZ A;  2KNB B;  3NHN A;  1UGV A;  1BB9 A;  2AK5 A;  2J05 A;  1I07 A;  4JZ3 A;  1XOV A;  2DL7 A;  3VS0 A;  1AEY A;  4OMN A;  4J9D A;  1E6H A;  2EBP A;  1KSW A;  1QKW A;  1JO8 A;  2J6O A;  4AFZ C;  2BTT A;  3H0F A;  2DL3 A;  4J9I A;  1MV0 B;  2K79 A;  4D8K A;  2KYM A;  2CSI A;  4AFU C;  2BZX A;  2X3W D;  2HCK A;  1AOJ A;  2L3S A;  3EG3 A;  2JM9 A;  2M0Y A;  1WLP B;  1YN8 A;  4OMQ A;  2ESW A;  1NYF A;  3EGU A;  3I5S A;  5ECA A;  4R0K A;  1K9A A;  1QWF A;  4RTW A;  1UHF A;  2AZS A;  1PNJ A;  5GJV B;  1AVZ C;  4HVU A;  3SHW A;  1UG1 A;  2RPN A;  1ZSG A;  1WXU A;  1T0H A;  5FWC A;  2BZ8 A;  3ULR B;  1Y57 A;  2GQI A;  3M0U A;  1J3T A;  1WI7 A;  4LN2 A;  1CSK A;  2LX7 A;  1M3C A;  2AZV A;  3VS6 A;  1PRM C;  1BBZ A;  2VKN A;  2CUB A;  2AKK A;  2ABL A;  2JMC A;  3VS3 A;  1SPK A;  1PKS A;  2W0Z A;  3H0H A;  4LUD A;  4CC2 A;  2LP5 A;  2C0I A;  2M51 A;  4OMO A;  2RF0 A;  1A0N B;  2DRK A;  2RQR A;  2YDL A;  1UDL A;  2LNH B;  1QLY A;  1JXO A;  4K11 A;  2A28 A;  1YNZ A;  1VA7 A;  2A36 A; 
#chains in the Genus database with same CATH topology
 1WHG A;  4NL3 A;  4M77 D;  1EFN A;  2XK0 A;  1H3Z A;  3KUF A;  4QW2 A;  3C0C A;  2RMO A;  1E7O A;  2XU8 A;  3E19 A;  4RKU E;  4DBF A;  2DTI A;  3CD6 T;  4C0G A;  4D6W A;  3PNW C;  4V2S A;  2ED0 A;  4CC3 A;  5KYW A;  4Z89 A;  5GAO l;  4FCY A;  2LJ1 A;  3PFS A;  2A08 A;  1VQ4 T;  1Y07 A;  1VQ6 A;  4N0A C;  3QBY A;  2BIV A;  4C8Q C;  2YHT A;  4CRI A;  1N8R R;  3L2V A;  2DD4 A;  3PGG A;  4B6M A;  1YFN A;  3ER0 A;  2LT4 A;  3EG9 B;  1GXI E;  2QA4 T;  3LX7 A;  2LJ0 A;  4RTU A;  3JCM e;  1K8A R;  1O75 A;  2ZPI B;  2C0T A;  1PC0 A;  3R6N A;  3JCM P;  1NYG A;  3U23 A;  4KUL A;  3CC2 T;  4E7Z A;  1YI2 Q;  4M7D G;  5I11 A;  2FO0 A;  1NE8 A;  3GNG A;  5FU7 B;  2DEU A;  5J26 A;  1I1J A;  2L2P A;  4OML A;  3UAT A;  1R0C B;  4PFZ A;  2GTJ A;  1HK9 A;  1G3T A;  2EW3 A;  2MWP A;  2M9U A;  3FJP A;  3OA6 A;  1RAA B;  2KSS A;  1NM7 A;  3JB9 J;  4FYV B;  2FPF A;  1AWJ A;  2HL3 A;  2PNI A;  1VIF A;  1KHC A;  1VQM T;  2LQW A;  4MDW A;  1C0M A;  4C5G A;  5KH6 A;  3OYC A;  5LJ3 g;  1JU5 C;  3OYY A;  3DLL A;  1PKT A;  1H8K A;  4JJB A;  5LJ5 e;  2MCN A;  2OTJ A;  3HPW A;  4C8Q E;  2JS2 A;  4ZGE B;  4M7D F;  4HCZ A;  4EMK C;  2NYS A;  4ELY C;  1QWE A;  3QSU A;  2EKO A;  2CP7 A;  1TOV A;  5CKB A;  4IUT A;  2B86 A;  4XTW A;  3CC7 A;  2R57 A;  2KEA A;  3EG2 A;  3H8Z A;  2A7Y A;  2HMA A;  1YJN T;  3M54 A;  2OTL A;  3S3M A;  1PM3 A;  1X69 A;  2EYY A;  5IAY A;  1H92 A;  1WHL A;  1G83 A;  2YXY A;  1JEG A;  4BI3 A;  3CPF A;  2DJZ A;  2F2X A;  3VS5 A;  2YSQ A;  2EYZ A;  4Z8A A;  1X75 C;  1U8R A;  2AKL A;  1VQO A;  2DYB A;  1OI1 A;  3PVL A;  3I56 A;  3BW1 A;  1RUW A;  3OYL A;  4F17 A;  1FMK A;  1T0J A;  2OTJ Q;  2KXC A;  2DIQ A;  2JT4 A;  3LW5 E;  3OY9 A;  1VQ5 A;  3MP6 A;  3SWN B;  1RI0 A;  4E2F B;  2QQR A;  3E9G A;  4KUI A;  3CC7 Q;  3CCV T;  3CD6 A;  4KGV B;  1ZA1 B;  1Q7Y U;  1WYX A;  2CT3 A;  1N9R A;  4M7A G;  2OTL Q;  1B07 A;  3V8K A;  4DBQ A;  1B34 B;  3DLM A;  3JCM g;  1VQ4 A;  5M9O A;  3M4Y A;  2MPX C;  2RQT A;  3I5R A;  4NL2 A;  4M77 A;  4XU1 A;  1FYN A;  5KYX A;  3G6E T;  2QAZ A;  3UF4 A;  3V7R A;  2E6N A;  1D0Y A;  3KXT A;  2HSP A;  1VQO Q;  3M57 A;  2ENM A;  3I56 Q;  4M78 E;  2QA4 A;  2C0O A;  3VS1 A;  3EGD A;  1N8R U;  2WSE E;  2KBT A;  2BE7 D;  2CGH A;  4CI0 C;  1GL5 A;  4EDU A;  1VQN A;  1G8X A;  1VQ5 Q;  1PRL C;  1YIJ T;  2FRW A;  1PG5 B;  4M7A F;  1W4S A;  3RR6 A;  1D3B A;  3CC2 A;  4NOY A;  4RTX A;  5GAO p;  3MPU B;  2JM8 A;  1MHN A;  1IO6 A;  4MML A;  2E5Q A;  3CD6 Q;  1JRI A;  2YRD A;  2M02 A;  4DOW A;  4HCB A;  1QCN A;  4ATO A;  3H9N A;  1KQ1 A;  1KQS P;  1VQ4 Q;  4BD3 A;  1JXM A;  4E7I A;  2CS7 A;  2LMJ A;  3FB9 A;  4XAX B;  1BI3 A;  1YCS B;  2GNC A;  2CZ1 B;  1VQM A;  5J39 A;  2SRC A;  3MET A;  1Y7X A;  2YUN A;  2K57 A;  2RHY A;  1JJ2 A;  2YLB A;  2F5T X;  4HT8 A;  2L3Q A;  2QA4 Q;  1UGP B;  2FG0 A;  4E7H A;  4ELZ C;  1N8R C;  2RQV A;  3HFN A;  3JAM E;  2DBK A;  1WPY A;  1KQ2 A;  1V1C A;  2X4J A;  3CC2 Q;  1YJW T;  1PWT A;  1QVF P;  4KBM B;  5CIU A;  3HRT A;  2DF6 A;  5GAM e;  1K8A C;  1YJN A;  1YHQ T;  2HBP A;  4L6V 5;  1TTH B;  4KT0 E;  4BI8 B;  2E5K A;  1QMC A;  3HP9 A;  2HEQ A;  3RKW A;  2P0K A;  2DIL A;  3VU3 C;  4M75 G;  2ZZD A;  4MDX A;  4RTV A;  3M0P A;  3ZFJ A;  5CK9 A;  1VQ7 T;  4OMM A;  4FYW B;  2RM4 A;  3HSB A;  1VQM Q;  4C8Q G;  3GP8 A;  1Q82 C;  2EIF A;  2BKD N;  3QII A;  2AHJ B;  4KH0 B;  2PVG B;  2RHU A;  4XTZ A;  3LH5 A;  2V8I A;  4IUP A;  3M0S A;  1ZSZ A;  5HK3 A;  1WHK A;  2DLP A;  3A8H B;  2RHX A;  2JOY A;  1HXD A;  4X9C A;  3CCJ T;  3JCM W;  4R55 A;  3NHN A;  1UGV A;  1WQW A;  3FC3 A;  3PIP A;  2AK5 A;  2C06 A;  2IG0 A;  3CCV A;  4HCC A;  4M75 F;  3VS0 A;  1YJN Q;  1E6H A;  2EBP A;  1KSW A;  1QKW A;  4PJO B;  4M7D C;  1KQS S;  3M56 A;  5EG2 A;  4ZGD B;  3CBP A;  2K5F A;  4J9I A;  1UGR B;  3FRN A;  4PLL A;  3GNF B;  1R8O B;  4A4F A;  3JCM X;  4QVZ A;  3J7A F;  4O5V A;  1D09 B;  1VQK T;  2NUP B;  1TUG B;  2QQ9 A;  4BY6 B;  2L3S A;  3EG3 A;  2RD1 A;  2JM9 A;  2M0Y A;  4RMO A;  1WLP B;  2ESW A;  3EGU A;  4R0K A;  2Y4X A;  1QWF A;  2XDP A;  3QKJ A;  3EG9 A;  4WTO B;  1MMG A;  5HKC A;  2JZ2 A;  1PNJ A;  5KYY B;  5GJV B;  4MMK A;  2QEX T;  1YIJ A;  5C0M A;  5GAN 8;  3L2R A;  3OYA A;  1BCM A;  5FWC A;  1QVF S;  4C0D B;  2GQI A;  2HNI A;  3INZ A;  5CKF A;  2E65 A;  3V7C A;  3CCV Q;  3O8V A;  1M90 C;  2LX7 A;  2QQS A;  4PJN A;  1BBZ A;  1LVK A;  2ABL A;  4DQ2 A;  2XKO C;  2W0Z A;  3H0H A;  5L8R E;  2F5K A;  3CME T;  3CCS T;  2C0I A;  2LC4 A;  4M78 G;  1JBM A;  3G71 T;  3G6E Q;  4FYY B;  1A0N B;  2DRK A;  2RQR A;  5GAN d;  2E70 A;  2LQK A;  1Q81 R;  2LDM A;  1QLY A;  4II1 A;  5LJ3 d;  2A36 A;  5GAO n;  4XQ3 A;  1ARK A;  1VQ8 T;  2V8J A;  4M77 E;  4Y28 E;  1YIJ Q;  5FRM A;  2SEM A;  4C5E A;  2KRO A;  3FEO A;  3EGD B;  2V8K A;  4F04 B;  1BU1 A;  1IGQ A;  1YJW A;  3C94 A;  3N5B B;  4IIM A;  4JLI A;  2JS0 A;  4M4Z A;  1PD1 A;  5CKE A;  1YHQ A;  4LUE A;  3M58 A;  1M5Q 1;  4M78 F;  5A0D A;  1G3W A;  4FIB A;  5GAN 3;  3LGL A;  1X6B A;  2D0N A;  2MF2 A;  3QO3 A;  2XG8 D;  4E6R A;  1X27 A;  1QKX A;  1WNL A;  1M3B A;  1VQ7 A;  1Y96 B;  4AFQ C;  5I21 A;  1WQ7 A;  2VV5 A;  1VQ9 T;  5I22 A;  3J80 E;  2NLU A;  2I2L A;  5A0G A;  5LJ3 j;  1M3A A;  1BIB A;  1HD3 A;  3JCM Q;  3EFS A;  2KY9 A;  5L23 A;  2BUD A;  4E7S A;  4PJO D;  1UGS B;  2EPD A;  5LJ3 f;  2ZPE B;  3CCJ A;  1SHF A;  2B8A A;  2LJ3 A;  5DLO A;  1YJW Q;  3SWN A;  4EMG A;  1CKA A;  3QZ5 B;  2CUD A;  5GAN h;  3REA B;  4GY5 A;  5C6S A;  1YHQ Q;  1GRI A;  1TUD A;  2JTE A;  1UHC A;  2X51 A;  3UPU A;  2GFA A;  1MUZ A;  3JCM d;  2P4R A;  3WVE B;  1B34 A;  4PFO A;  1QCF A;  2HL5 C;  1AWO A;  1RAG B;  1UFF A;  2DXU A;  3PVQ A;  1RL2 A;  3CMA T;  4KUD K;  3QDF A;  3RNJ A;  1NJI C;  1JQQ A;  1VQ7 Q;  4WCI A;  1MGQ A;  1VQK A;  1OYX A;  2GQV A;  2D8H A;  2EQI A;  3V7S A;  5FWB A;  3M9Q A;  2DBM A;  3X26 B;  2QG9 B;  2QTV A;  3HHT B;  1M30 A;  3EFO A;  1YP5 A;  4M7A B;  1GFD A;  3OSS C;  2JW4 A;  2QEX A;  3NGP A;  2ZAE A;  2QAS A;  3CCJ Q;  2FZG B;  1K73 R;  1OZ3 A;  1PHT A;  2J06 A;  2CYZ B;  3EH2 A;  3QWX X;  2X3X D;  3NMZ C;  4F7U B;  5CQX A;  3D7S B;  4LNP A;  1PCX A;  1NG2 A;  2VGM A;  3EFR A;  4FSS A;  3HTR A;  3NTH A;  2RQU A;  1OZ2 A;  1YI2 A;  1TG0 A;  3CME A;  4F14 A;  4AG2 C;  3CCS A;  4BDZ A;  1M1K R;  4GBQ A;  4AMC A;  3G71 A;  2CZ0 B;  1Q86 R;  2KRN A;  3HKS A;  5CCA A;  4M75 C;  1GBR A;  1VQK Q;  2O31 A;  1YBY A;  4LDU A;  1LCK A;  1C1A A;  1PSE A;  2HBW A;  1WXB A;  1M8V A;  3THK A;  2O88 A;  4JRK A;  1I5L A;  2K7A A;  1I81 A;  4MZP A;  3GBQ A;  4OB2 B;  3JCM h;  4C92 B;  2DO3 A;  1VQ8 A;  2ATC B;  2QEX Q;  5GMK j;  2M1H A;  1Q81 U;  2KDS A;  2KYB A;  2DVE A;  5IHK A;  2VYT A;  8AT1 B;  1YJ9 Q;  2DEQ A;  3JB9 G;  3M55 A;  1SRM A;  3G7Z A;  4J8O A;  1ABO A;  4MZM A;  4ESR A;  4PFP A;  2RH2 A;  2RQW A;  2GTO A;  1KQS A;  2CZ6 B;  4ZTF A;  1AWX A;  3OYM A;  4BE1 A;  2K3Y A;  2BE9 B;  3CME Q;  3CCS Q;  4P5N A;  1CKB A;  1LPL A;  1N6A A;  1MV3 A;  4FT2 A;  3G71 Q;  2FYK A;  1AD5 A;  2Y4Y A;  5GMK h;  1VQ9 A;  3RKY A;  2L89 A;  1Q82 R;  1M8M A;  4FU6 A;  1K9M R;  1BK2 A;  3OYE A;  4J6Y A;  4M77 G;  2EGC A;  1SHG A;  4BDY A;  3LGF A;  4JJD A;  5CR2 A;  3JB9 F;  2CP0 A;  5LL6 S;  1IRX A;  2DE0 X;  5GAN g;  3VRZ A;  1G3S A;  2LCC A;  4IUU A;  2CP2 A;  2PUK B;  4Q5W A;  1VQ8 Q;  4M75 E;  3H41 A;  1M9S A;  3CC4 T;  1Q81 C;  3X25 B;  1QVF A;  1ABQ A;  1M2V B;  3AHU A;  3TVT A;  3MEA A;  3JCM b;  1GCQ A;  1YCY A;  2ECZ A;  1X2K A;  2RO0 A;  2X4X A;  2G6F X;  5DM7 R;  3QYG B;  1UUE A;  4ORZ A;  4C8Q B;  3M0T A;  3JRZ A;  2FHD A;  1Z9Z A;  2DKG A;  4PJO A;  2EVR A;  4UC4 A;  3G4S T;  3E1S A;  1XQH A;  1KG1 A;  2H3E B;  4M77 F;  4J7F A;  3MHX A;  3CMA A;  3F70 A;  4J9H A;  3RUX A;  2FPE A;  1VQ9 Q;  3EGX B;  5A0L A;  4M7A D;  5D7U A;  4XTV A;  4GLM A;  4M78 C;  1RLQ C;  3TSW A;  2NUP A;  2F2W A;  3VKI A;  2QK0 A;  2V1R A;  4JRI A;  1T3S A;  2ED1 A;  2DET A;  3QXE B;  2V1Q A;  3MKD A;  5DY9 A;  7AT1 B;  4J9B A;  1VQL T;  3RES A;  2RB6 A;  4JS5 A;  4HVV A;  5KYY A;  3KFV A;  3UT1 A;  2RJF A;  1WFW A;  1QVG P;  2O9V A;  2JXB A;  1WDX A;  1M90 R;  3JV3 A;  3OYI A;  1V29 B;  1K73 U;  2OJ2 A;  2GBQ A;  1SG5 A;  2E12 A;  3MJX A;  2VB6 A;  3E9F A;  2EJF A;  2JMA A;  1X6G A;  2XD0 A;  3CQT A;  3CMA Q;  4AT1 B;  2PVO B;  3BDL A;  2J6K A;  4C92 D;  3LLR A;  1X43 A;  1Z9Q A;  5GAM d;  2ZCF B;  3S3N A;  1M1K U;  4EMK B;  3J81 E;  4RUG A;  2EAY A;  1Q86 U;  4GLK A;  2CKK A;  1AWW A;  3OS0 A;  2KQW A;  2KNB B;  4J6W A;  4M7D A;  4PL6 A;  2J05 A;  3PMT A;  2XDD A;  1XOV A;  2KI7 A;  1G3Y A;  4OB0 B;  2CP5 A;  3P8B B;  3EFO B;  1JO8 A;  2J6O A;  2P84 A;  1NBE B;  2A0F B;  4D8K A;  2D9T A;  2DK3 A;  3MCA B;  4AFU C;  1K73 C;  2BZX A;  3OBW A;  2COZ A;  4LXC A;  4Y91 A;  2OX7 A;  1FXX A;  1K8A U;  2RJE A;  1KC8 C;  3QJY A;  1BI0 A;  1YN8 A;  3OS1 A;  3I5S A;  5LJ5 g;  1M1F A;  1Y96 A;  1OX8 A;  2RJC A;  2AZS A;  4OGE A;  5IN1 A;  1M1K C;  1AVZ C;  1EIF A;  2K3X A;  1Q86 C;  2EQM A;  1OU9 A;  1WXU A;  1OQK A;  4PJJ A;  2JTF A;  2QTX A;  3ULR B;  1Q82 U;  3CCQ T;  4C8Q D;  3CCR T;  3PT9 A;  4B9X A;  3CC4 A;  1J3T A;  1QVG S;  1M3C A;  2AZV A;  1PRM C;  3OYB A;  2CUB A;  4LDW A;  2HKQ B;  3VS3 A;  1SPK A;  2PQW A;  1YIT T;  4L59 A;  5GAM h;  4CC2 A;  2LP5 A;  2E6Z A;  2RK2 A;  2M51 A;  5D6Y A;  2RF0 A;  3G4S A;  5CKH A;  1ZQ1 A;  2K4Y A;  1UDL A;  2MYS A;  1D1B A;  1NJI R;  1JXO A;  4N4I A;  4C5I A;  5GAN 6;  2L8D A;  1VOM A;  5CVI A;  1P92 A;  2FZC B;  2IPO B;  4XU0 A;  4NS5 A;  2DTH A;  2RJD A;  3CCE T;  2H3J A;  1VQL A;  2O4X B;  1K9M C;  4OMP A;  1UE9 A;  3CC4 Q;  2LTO A;  5KYU B;  4M7A A;  3M4G A;  3S3O A;  4FM4 B;  2OAU A;  4CC4 B;  3M0Q A;  1S72 Q;  3HFO A;  2A37 A;  2PZ1 A;  2DYI A;  1KIK A;  4IUV A;  3NFC A;  2WAC A;  3VS7 A;  1I4K 1;  2EQU A;  1Y0M A;  2YLC A;  4F7U A;  1ZA2 B;  2YRV A;  2KK4 A;  3G4S Q;  3KBG A;  4C5H A;  4LDV A;  3QWY A;  1M90 U;  2J6F A;  1ZUU A;  3LYI A;  4BB7 A;  1UJY A;  1GFC A;  1TH7 A;  5AT1 B;  2K5I A;  2K9G A;  2GCX A;  1WX6 A;  3UA6 A;  1WZO A;  4XU3 A;  1IHV A;  1XJW B;  3PE0 A;  3TEE A;  2DL4 A;  1T3L A;  1X2Q A;  3O5Z A;  3G6E A;  3JCM J;  1WXT A;  4OP0 A;  1M2O A;  3OB9 A;  4M77 C;  3OYN A;  4HT9 A;  4L5G A;  4IKF A;  1VQL Q;  5IHN A;  5KCO A;  2A3L A;  2IIM A;  1MMN A;  4C92 A;  3SDZ A;  3UWN A;  4KH1 B;  2P0Q A;  5CO7 A;  3OW2 P;  2CSQ A;  4PLI A;  2ZPB B;  5GAN 5;  1KD1 R;  2YUP A;  3PIO A;  1YJ9 T;  2CZ7 B;  4HXJ A;  1UGQ B;  5IXB A;  1K1Z A;  2EJG A;  2P0P A;  4PNO A;  4HKE A;  2DL8 A;  4J5Y A;  2DNU A;  2KE9 A;  1QQJ A;  2HD0 A;  4OB1 B;  4DBH A;  1OEB A;  1LJO A;  4DA4 A;  4J9F A;  4JZ4 A;  3CBO A;  3GIB A;  2RN8 A;  1HYO A;  3P8D A;  2YRC A;  5GAM g;  3CCQ A;  3CCR A;  3MO8 A;  3VYG A;  2RI2 A;  3HL8 A;  2MAM A;  5IXF A;  1NLP C;  4WF2 A;  4M7D B;  3MP1 A;  1W2B P;  2MIO A;  2J7I A;  3M59 A;  2O01 E;  1M2V A;  1K76 A;  1U06 A;  1ACM B;  3L2W A;  4BUG A;  2FRY A;  1YIT A;  3ZEH A;  2L3R A;  2JJ9 A;  2EYX A;  4N0A A;  2XDB A;  4B9W A;  2QXF A;  2KT1 A;  1OPK A;  3PMI A;  4C8Q A;  1NEB A;  5I2S A;  5GAN 7;  2DL5 A;  2D8J A;  1BI1 A;  3JCM c;  1KFZ A;  2E3H A;  4RG8 A;  2ZGW A;  4JPB W;  4A4H A;  4IIO A;  1OV3 A;  3A5Z B;  3RMS A;  2Y90 A;  2DA9 A;  3EGX A;  3TCJ A;  1K0X A;  4EIK A;  3QYH B;  2DRM A;  2MI6 A;  4FW1 A;  3REB B;  2V26 A;  1NJI U;  3CCE A;  5GAN j;  3VS2 A;  4XTU A;  3CCQ Q;  3CCR Q;  2R5M A;  2L0A A;  3DB4 A;  1B7T A;  2EQJ A;  1XNI A;  2YUO A;  5HK0 A;  3OW2 S;  5GAN f;  2JVV A;  1YIT Q;  1SSH A;  3V8L A;  2HKN A;  5CQY A;  4ZGJ B;  1FX7 A;  1TXQ A;  4QQ6 A;  1ZSZ C;  3R6O A;  2LX9 A;  1NLO C;  2RNA A;  2E64 A;  4J9G A;  3Q1J A;  2JTM A;  4KGZ B;  3QG1 A;  1ZLM A;  4PJM A;  2KMT A;  5D6W A;  1S1N A;  2DD5 A;  5FU6 C;  1HSQ A;  2DXC A;  3LH0 A;  5GAN 4;  4BE2 A;  3RER A;  2ZPF B;  5J3B A;  4QQG A;  2K3B A;  4JS4 A;  1I8F A;  2F69 A;  2CP3 A;  1DJ7 B;  2EGE A;  2PVD B;  4A63 B;  2D6F A;  1D0Z A;  1VYV A;  2R5A A;  5D6X A;  4EMK A;  3EHR A;  4A4E A;  4QT7 A;  4EMH A;  4J9C A;  3CCE Q;  1QVG A;  1UEC A;  4JLG A;  2MMP A;  4E7L A;  1W2B S;  1V76 A;  2M16 A;  1ZHI A;  1MNE A;  2FPD A;  4F16 A;  2PU9 B;  2L3P A;  2NUT B;  1G5V A;  5LJ3 e;  5FW9 A;  1YJ9 A;  4JJN K;  3OS2 A;  3L42 A;  2DER A;  1X6O A;  5GMK i;  2QQB A;  3OS5 A;  2F2V A;  4Y92 A;  2QDL A;  5KCH A;  3CCM T;  5GMK m;  3RIR A;  1KC8 R;  1M27 C;  2I0N A;  2HQH A;  3AT1 B;  1OU8 A;  4PJO G;  5LJ5 d;  2EYW A;  5FU7 C;  2MWO A;  2KVQ G;  4PKC C;  4FL6 A;  1M4Z A;  5IH2 A;  3BY7 A;  4M7D D;  6AT1 B;  2YUQ A;  1ZUK A;  4RTY A;  2FVU A;  2DMO A;  4Z02 A;  4F7U E;  3JCM f;  1Q7Y R;  2QGG A;  1YWO A;  2KRS A;  1SSF A;  3PTA A;  3G1J A;  2F1L A;  1FMW A;  4DBR A;  2DZ9 A;  3ME9 A;  2KT8 A;  2DVJ A;  5I2M A;  1M1G A;  3TRE A;  2PTK A;  4PK4 A;  1AZE A;  1VYT A;  5FRN A;  2DAQ A;  3VS4 A;  2DIG A;  4JJC A;  4PJO F;  2JN0 A;  1WJR A;  3NTI A;  1GBQ A;  3EHQ A;  4OB3 B;  1WA7 A;  2AT1 B;  2LRQ A;  1TWB A;  3OSV A;  4C92 E;  3LWH A;  3M0R A;  5A2Q E;  2JNG A;  3FJ5 A;  3FDR A;  1KD1 C;  5LJ5 j;  4D8D A;  4A54 A;  1ZBX A;  5KYN A;  3FIF A;  3OYK A;  3BDU A;  4JZ3 A;  1BKB A;  1RAF B;  2DL7 A;  3V8J A;  5LJ5 f;  3CXC P;  1AEY A;  3CPW P;  4OMN A;  4J9D A;  3QPH A;  3CEY A;  1VQN T;  3L1A A;  1MV0 B;  3OYD A;  3SFM A;  2O4X A;  2KYM A;  3CCU T;  3JB9 H;  5KYU A;  5LJ5 h;  1Y71 A;  1QCO A;  4RCC A;  4VUB A;  3WXM B;  2E10 A;  4E47 A;  4M75 B;  1QW1 A;  1D0X A;  1S72 T;  1VQ6 Q;  5ECA A;  1K9A A;  5GMK e;  1UHF A;  3SWN C;  1I5O B;  3C4S A;  3SHW A;  1FMV A;  1FWZ A;  2RPN A;  1NPP A;  2BZ8 A;  1Y57 A;  3CBM A;  1WJS A;  3OQ5 A;  1CSK A;  4JRQ A;  3A8G B;  3VS6 A;  2VKN A;  5CKD A;  2AKK A;  2JMC A;  2MK5 A;  4FYX B;  1PKS A;  2HQX A;  5GAO r;  4LUD A;  4XTX A;  2LCL A;  4KGX B;  3BFM A;  2EYQ A;  3ZBD A;  1AT1 B;  3C12 A;  4OMO A;  4XTY A;  2YDL A;  1BIA A;  4N4H A;  2X35 A;  2LNH B;  2RK1 A;  2DXT A;  1QP2 A;  4K11 A;  4QVD A;  2A28 A;  4JDS A;  2LVM A;  1VUB A;  3CCM A;  1PD0 A;  1SKU B;  2YWW A;  2GFU A;  3TQ7 P;  3UA7 A;  2KRM A;  5GMK l;  3QHS A;  4BI4 A;  1MMA A;  3HRS A;  2DM1 A;  4JUV A;  1EX4 A;  3CXC S;  2KXD A;  3CPW S;  3VRY A;  1KC8 U;  1UJ0 A;  2R58 A;  2K2V A;  2VXF A;  4ME7 A;  4IUQ A;  2EQK A;  3QJ6 A;  1R0B G;  4AFS C;  2QYZ A;  2JUF A;  1QVP A;  3OW2 A;  5HCK A;  4ZTJ A;  4A53 A;  3GLX A;  4AG1 C;  3URG A;  4E7J A;  4BAC A;  2D1X A;  3ZL7 C;  1VYU A;  2XHC A;  3OMG A;  2COY A;  3QDR B;  3NPF A;  5IT9 E;  4OF1 A;  3EG0 A;  4LD6 A;  2LQ8 A;  5GAN 2;  4M78 B;  2LCS A;  3CCM Q;  4EPC A;  1U1S A;  4A4G A;  4F7U G;  4QKU A;  2FZK B;  2PUO B;  3MEU A;  1O9S A;  4J7I A;  3MP8 A;  2CH4 W;  2EFI A;  4LDX A;  3SEM A;  1H3H A;  4HA8 A;  1UEB A;  2KGT A;  3I55 T;  1NPR A;  2EJ9 A;  1KJW A;  3DKM A;  3M5A A;  2W10 A;  2QDY B;  5HY6 A;  3SB2 A;  5GAM j;  2DZC A;  1W2B A;  2KAF A;  1SF9 A;  4M75 D;  1IXD A;  3CCU A;  2COW A;  2Z0W A;  4J9E A;  3OYG A;  3L2U A;  2WSF E;  2ZPG B;  1B3Q A;  5GAM f;  2XID A;  2E41 A;  1Q7Y C;  1Q95 G;  3A1P A;  1K9M U;  1UTI A;  1H64 1;  4C92 G;  1NZ9 A;  1IRE B;  4F7U F;  1S72 A;  1RAD B;  3JSC A;  1R77 A;  5KYW B;  1W70 A;  3MEW A;  1WGS A;  3VUZ A;  4BE0 A;  1GCQ C;  4LDY A;  2CDT A;  3C95 A;  2XMF A;  4RTT A;  3VYH B;  3M53 A;  2GGR A;  1ZBJ A;  1RI9 A;  2K5L A;  4MZT A;  3OBY A;  1RAI B;  4PJO C;  1VQP T;  2VVK A;  1IB8 A;  4X1V A;  1VQN Q;  3IQL A;  4LE9 A;  4C92 F;  2LZ6 B;  3CCU Q;  4BY6 C;  2E3I A;  4N4G A;  2FB7 A;  5FRO A;  1IZ6 A;  2RHI A;  1KK7 A;  3GPL A;  2NUT A;  1SRL A;  2LNV A;  3OYJ A;  2VGN A;  4CC7 A;  2E1H A;  3GOX A;  2CH4 A;  1F1B B;  2ROT A;  1RLP C;  4C0D C;  1EZZ B;  1D1C A;  3TU4 K;  1AZG B;  2HDA A;  4ZNX A;  2L5Q A;  2QGF B;  3CCL T;  2MOX A;  4DEY A;  1PSF A;  3BE3 A;  3OYH A;  4C0F A;  3A98 A;  2FEI A;  4OMF B;  3DB3 A;  1WJQ A;  2P4T A;  3S6W A;  2EKH A;  2H8H A;  3UDC A;  1KHI A;  1G2B A;  2BZY A;  2ROL A;  4O6J A;  1TUC A;  2XIC A;  2K2M A;  1W6X A;  4M78 D;  2O2O A;  3RDV A;  4A4K A;  4TVR A;  4PJO E;  3QZ9 B;  1GCP A;  5EC7 A;  2HSE B;  1OOT A;  4C8Q F;  1RAB B;  3I9Q A;  1LOJ A;  3EH1 A;  4FW2 A;  2RI5 A;  1OUL A;  3X28 B;  5AYF A;  1ZX6 A;  3LWI A;  2VWF A;  3H0I A;  1E6G A;  1N5Z A;  4IUR A;  8ATC B;  2DPP B;  3I55 A;  4HVW A;  4YTL A;  2LQN A;  3VUB A;  4PJL A;  4R56 A;  2VXE A;  2QQA A;  3E2U A;  1I0C A;  3GF5 A;  1HJD A;  4XU2 A;  3P8H A;  3EG1 A;  1U3O A;  1K4U S;  1TS9 A;  3JCM V;  1W1F A;  3RMQ A;  2VAS A;  1WIE A;  2LT1 A;  5KE3 A;  1SEM A;  1OPL A;  3A8M B;  1YI2 T;  4QVC A;  5GAO m;  2K6D A;  4M75 A;  4HCK A;  4RG2 A;  2VC8 A;  3JB9 I;  2DX1 A;  4J83 A;  4KRT A;  1XTD A;  2NWM A;  5GJW B;  2O9S A;  4DEX A;  1U5S A;  4FT4 A;  4M77 B;  4J6X A;  5KYX B;  4M7D E;  3WVD B;  3CXC A;  1VQ6 T;  3CPW A;  2OAW A;  1VQP A;  3I35 A;  1UB4 A;  3TSZ A;  2E4H A;  2CP6 A;  1OX9 A;  2KR3 A;  3RBB B;  4Z88 A;  3I55 Q;  1YWP A;  3SD4 A;  1K0S A;  1WHM A;  1C6V X;  2OI3 A;  2RA2 A;  2YT6 A;  3OYF A;  4C0Z A;  5IHI A;  3A8O B;  3L2Q A;  3T9N A;  3EAE A;  2CRE A;  4RTZ A;  1BI2 A;  1JJ2 P;  2EGA A;  3ASK A;  1D3B B;  3X20 B;  5GAO q;  4X34 A;  2DJQ A;  2CT4 A;  4M7A C;  1ZUY A;  4ANJ A;  1NEG A;  2NUZ A;  2DFU A;  1BB9 A;  4JRP A;  1N9S A;  1WHH A;  1JB0 E;  2HAX A;  5FLX E;  2HZY A;  1VIE A;  1I07 A;  1LNX A;  1TU0 B;  2D0Q B;  4X9D A;  3CCL A;  3VV0 A;  3MEV A;  1X01 A;  4FSX A;  2EWN A;  4ZN3 A;  4LD9 K;  1VQP Q;  4AFZ C;  2BTT A;  2RI3 A;  3H0F A;  2DL3 A;  3X24 B;  2K79 A;  4RCB A;  2CSI A;  2HQE A;  2X3W D;  1QP3 A;  2HCK A;  1AHJ B;  4ZN1 A;  1D1A A;  9ATC B;  1IHW A;  1AOJ A;  3A8L B;  1BYM A;  2DTO A;  1RAH B;  3HRU A;  1N27 A;  2OTJ T;  4OMQ A;  1NYF A;  1TSF A;  1RAC B;  2AIR B;  2GF7 A;  3FLG A;  4RTW A;  5LJ3 h;  2M0O A;  3QUI A;  2DXB A;  5GAN e;  4HVU A;  4C92 C;  4QQD A;  1UG1 A;  3CC7 T;  1ZSG A;  4E7K A;  1T0H A;  2X4Y A;  4M78 A;  2OTL T;  1WHJ A;  4XK8 E;  3M0U A;  3OMC A;  2XI9 A;  1WI7 A;  4LN2 A;  2VUB A;  3CCL Q;  2WSC E;  3JB9 D;  2ZPH B;  3NTK A;  3H6Z A;  4M7A E;  2FL7 A;  3RKX A;  3L2Z A;  5KE2 A;  2RHZ A;  1KD1 U;  5DLQ E;  2X9H A;  1U1T A;  3VJP A;  1VQO T;  1BCO A;  4OVA A;  1IGU A;  2QI2 A;  3I56 T;  2IVW A;  1JJ2 S;  2X4W A;  1RAE B;  1ZSZ B;  4DOV A;  5CAI A;  4OGC A;  1YNZ A;  1MMD A;  2G3R A;  1VQ5 T;  1VA7 A;  1MND A;  5FU6 B; 
#chains in the Genus database with same CATH homology
 1EFN A;  3UA7 A;  3C0C A;  2RMO A;  1E7O A;  1ARK A;  2SEM A;  2KRM A;  2KRO A;  1BU1 A;  2ED0 A;  2DM1 A;  4CC3 A;  4Z89 A;  2KXD A;  4IIM A;  4OMP A;  2LJ1 A;  3VRY A;  1UJ0 A;  1UE9 A;  2JS0 A;  2A08 A;  4M4Z A;  4LUE A;  4CC4 B;  3M0Q A;  2A37 A;  2PZ1 A;  1KIK A;  1X6B A;  2D0N A;  4AFS C;  4E6R A;  1X27 A;  5HCK A;  3VS7 A;  1QKX A;  1M3B A;  1Y0M A;  4AG1 C;  4AFQ C;  2D1X A;  5I22 A;  3ZL7 C;  1VYU A;  3QWY A;  2J6F A;  2LJ0 A;  3NPF A;  4RTU A;  1ZUU A;  3EG0 A;  1UJY A;  1GFC A;  2C0T A;  1M3A A;  3R6N A;  2K9G A;  1NYG A;  2LCS A;  3U23 A;  1HD3 A;  1WX6 A;  3UA6 A;  3PE0 A;  5L23 A;  2DL4 A;  1T3L A;  5I11 A;  1X2Q A;  2EPD A;  2FO0 A;  3O5Z A;  1SHF A;  1WXT A;  1I1J A;  2LJ3 A;  2L2P A;  4OML A;  3UAT A;  1CKA A;  2CH4 W;  5IHN A;  2GTJ A;  2CUD A;  2IIM A;  3SEM A;  3REA B;  1H3H A;  2KGT A;  1GRI A;  1TUD A;  2JTE A;  2EW3 A;  1KJW A;  1UHC A;  2W10 A;  1NM7 A;  2FPF A;  1AWJ A;  1MUZ A;  2P4R A;  2PNI A;  2CSQ A;  4J9E A;  1QCF A;  2LQW A;  2YUP A;  1UFF A;  1AWO A;  3PVQ A;  1B3Q A;  3RNJ A;  1JQQ A;  4WCI A;  1JU5 C;  1PKT A;  4HXJ A;  1H8K A;  1UTI A;  2D8H A;  5IXB A;  4JJB A;  2EQI A;  2MCN A;  1K1Z A;  2JS2 A;  5FWB A;  2DBM A;  2DL8 A;  1M30 A;  2DNU A;  1W70 A;  2KE9 A;  1QWE A;  1OEB A;  1GCQ C;  1YP5 A;  4J9F A;  1GFD A;  2JW4 A;  2B86 A;  2CDT A;  3NGP A;  2XMF A;  4RTT A;  4JZ4 A;  1PHT A;  2KEA A;  3EG2 A;  2GGR A;  1ZBJ A;  2J06 A;  2RN8 A;  1RI9 A;  1X69 A;  3QWX X;  2EYY A;  2X3X D;  5IXF A;  3NMZ C;  1H92 A;  1NLP C;  2VVK A;  2MIO A;  2J7I A;  4LNP A;  4X1V A;  1NG2 A;  1K76 A;  4FSS A;  1G83 A;  1U06 A;  3IQL A;  2RQU A;  2FRY A;  1JEG A;  4LE9 A;  1TG0 A;  2F2X A;  3VS5 A;  2YSQ A;  2LZ6 B;  4F14 A;  4AG2 C;  2EYZ A;  4Z8A A;  2EYX A;  2AKL A;  4GBQ A;  2DYB A;  2KRN A;  2KT1 A;  3PVL A;  1OPK A;  1NEB A;  1GBR A;  1RUW A;  2DL5 A;  2D8J A;  2O31 A;  4F17 A;  1LCK A;  1FMK A;  1T0J A;  1KFZ A;  4JPB W;  2HBW A;  1SRL A;  1WXB A;  3THK A;  2O88 A;  2KXC A;  4IIO A;  1OV3 A;  2JT4 A;  4CC7 A;  2K7A A;  2DA9 A;  1K0X A;  4EIK A;  2CH4 A;  2DRM A;  3GBQ A;  2ROT A;  1RLP C;  3REB B;  1AZG B;  2HDA A;  2KYB A;  4ZNX A;  5IHK A;  1WYX A;  2MOX A;  2CT3 A;  4DEY A;  1B07 A;  1SRM A;  3A98 A;  2FEI A;  3VS2 A;  1ABO A;  4ESR A;  2L0A A;  2RQW A;  2EKH A;  2H8H A;  2GTO A;  2RQT A;  2YUO A;  3I5R A;  1AWX A;  1FYN A;  1G2B A;  2BZY A;  2ROL A;  3UF4 A;  1SSH A;  1TUC A;  2K2M A;  1CKB A;  1W6X A;  1MV3 A;  2HSP A;  2O2O A;  1AD5 A;  2ENM A;  1GCP A;  1NLO C;  2RNA A;  5EC7 A;  2C0O A;  4J9G A;  1M8M A;  3VS1 A;  1OOT A;  1ZLM A;  1BK2 A;  1S1N A;  2KBT A;  1HSQ A;  2EGC A;  1SHG A;  1GL5 A;  4JJD A;  1PRL C;  2FRW A;  3I9Q A;  2K3B A;  2DE0 X;  3VRZ A;  2EGE A;  4RTX A;  2JM8 A;  1ZX6 A;  3H41 A;  1IO6 A;  2VWF A;  1VYV A;  4A63 B;  1ABQ A;  3H0I A;  3EHR A;  1E6G A;  1N5Z A;  4QT7 A;  4J9C A;  3TVT A;  1UEC A;  1GCQ A;  2ECZ A;  1X2K A;  1JXM A;  2G6F X;  1UUE A;  4HVW A;  4ORZ A;  3M0T A;  2LQN A;  2FPD A;  2LMJ A;  1Z9Z A;  4F16 A;  2EVR A;  1YCS B;  2GNC A;  2L3P A;  1I0C A;  2SRC A;  1HJD A;  5FW9 A;  2YUN A;  3EG1 A;  4J9H A;  1U3O A;  1K4U S;  2FPE A;  1W1F A;  2F2V A;  4Y92 A;  2L3Q A;  2QDL A;  2FG0 A;  4GLM A;  1WIE A;  1RLQ C;  3TSW A;  1M27 C;  1SEM A;  2I0N A;  1OPL A;  2RQV A;  2F2W A;  2DBK A;  2V1R A;  1T3S A;  2K6D A;  2ED1 A;  2EYW A;  1V1C A;  2V1Q A;  4HCK A;  5IH2 A;  4J9B A;  2DX1 A;  4KRT A;  2NWM A;  5GJW B;  1PWT A;  2YUQ A;  2O9S A;  4DEX A;  1ZUK A;  4RTY A;  1U5S A;  4HVV A;  2DF6 A;  2DMO A;  3KFV A;  1WFW A;  2O9V A;  2OAW A;  2JXB A;  2E5K A;  2HEQ A;  3I35 A;  1YWO A;  1WDX A;  2DIL A;  3TSZ A;  2KRS A;  2KR3 A;  3RBB B;  3JV3 A;  4Z88 A;  1YWP A;  4RTV A;  2OJ2 A;  2GBQ A;  3M0P A;  1K0S A;  2KT8 A;  2DVJ A;  2OI3 A;  2YT6 A;  2PTK A;  5IHI A;  4OMM A;  1AZE A;  1VYT A;  4RTZ A;  2CRE A;  2JMA A;  1X6G A;  3CQT A;  3VS4 A;  4JJC A;  2EGA A;  2J6K A;  1GBQ A;  3EHQ A;  1X43 A;  1Z9Q A;  1WA7 A;  3LH5 A;  2DJQ A;  3M0S A;  3M0R A;  2CT4 A;  3FJ5 A;  2DLP A;  1ZUY A;  4D8D A;  4RUG A;  1NEG A;  1AWW A;  2NUZ A;  2KNB B;  3NHN A;  1UGV A;  1BB9 A;  2AK5 A;  2J05 A;  1I07 A;  4JZ3 A;  1XOV A;  2DL7 A;  3VS0 A;  1AEY A;  4OMN A;  4J9D A;  1E6H A;  2EBP A;  1KSW A;  1QKW A;  1JO8 A;  2J6O A;  4AFZ C;  2BTT A;  3H0F A;  2DL3 A;  4J9I A;  1MV0 B;  2K79 A;  4D8K A;  2KYM A;  2CSI A;  4AFU C;  2BZX A;  2X3W D;  2HCK A;  1AOJ A;  2L3S A;  3EG3 A;  2JM9 A;  2M0Y A;  1WLP B;  1YN8 A;  4OMQ A;  2ESW A;  1NYF A;  3EGU A;  3I5S A;  5ECA A;  4R0K A;  1K9A A;  1QWF A;  4RTW A;  1UHF A;  2AZS A;  1PNJ A;  5GJV B;  1AVZ C;  4HVU A;  3SHW A;  1UG1 A;  2RPN A;  1ZSG A;  1WXU A;  1T0H A;  5FWC A;  2BZ8 A;  3ULR B;  1Y57 A;  2GQI A;  3M0U A;  1J3T A;  1WI7 A;  4LN2 A;  1CSK A;  2LX7 A;  1M3C A;  2AZV A;  3VS6 A;  1PRM C;  1BBZ A;  2VKN A;  2CUB A;  2AKK A;  2ABL A;  2JMC A;  3VS3 A;  1SPK A;  1PKS A;  2W0Z A;  3H0H A;  4LUD A;  4CC2 A;  2LP5 A;  2C0I A;  2M51 A;  4OMO A;  2RF0 A;  1A0N B;  2DRK A;  2RQR A;  2YDL A;  1UDL A;  2LNH B;  1QLY A;  1JXO A;  4K11 A;  2A28 A;  1YNZ A;  1VA7 A;  2A36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...