1WDXA

Yeast bbc1 sh3 domain, triclinic crystal form
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
PEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Yeast BBC1 SH3 domain, triclinic crystal form
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Myosin tail region-interacting protein MTI1
total genus 14
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wdxA00
1SHGA 2CDTA 2KRMA 1GBQA 3VS0A 1TUCA 1X6GA 1WFWA 4M4ZA 1E7OA 2DL7A 1UFFA 1S1NA 1T3SA 2ENMA 1ZUYA 1FYNA 3KFVA 1NM7A 1B3QA 2D8HA 5IXFA 2AK5A 3H0IA 2JXBA 4E6RA 1AEYA 4KRTA 1ARKA 1E6GA 1T0HA 2PNIA 3M0QA 3ULRB 1RLQC 4ORZA 1JQQA 1PWTA 1W70A 4ZNXA 3RNJA 1WA7A 2X3XD 4LN2A 4JPBW 4HVWA 2JT4A 1UUEA 3LH5A 2GTJA 2PZ1A 2DL8A 1X43A 2EKHA 1HD3A 1UJYA 1X69A 4K11A 2FG0A 5IHKA 1OOTA 3H0HA 1NLOC 2HEQA 2I0NA 1GCQC 5IXBA 2YT6A 1UGVA 2KYMA 2IIMA 1JXOA 2GQIA 2F2WA 2CH4A 3R6NA 2JS0A 3O5ZA 4AFQC 4RUGA 3UF4A 2VKNA 4WCIA 3REBB 1M3BA 1Z9ZA 3IQLA 3TSZA 4EIKA 2G6FX 3NGPA 4CC2A 1YWOA 4J9HA 3JV3A 2RQTA 4J9EA 2SEMA 3REAB 5L23A 4JZ4A 2CUDA 4CC4B 4JJDA 1Y0MA 2RQUA 1I0CA 2OJ2A 3EGUA 4GBQA 2C0IA 2A37A 2KE9A 1VYUA 1WXUA 2RF0A 3A98A 1B07A 4DEXA 4RTUA 1X6BA 2PTKA 1CKBA 4RTZA 1AWJA 1H8KA 2O9SA 2MOXA 2XMFA 1MUZA 1G2BA 2DYBA 2FEIA 2RQVA 1GCQA 2HBWA 2K7AA 4R0KA 2M0YA 2ED1A 1QKXA 2L2PA 2E5KA 4AFUC 5FWBA 1ZUUA 2ESWA 4ESRA 2D8JA 2HCKA 2P4RA 2H8HA 1TUDA 1N5ZA 3NHNA 4RTXA 1J3TA 2ROTA 3VS5A 3PE0A 4OMQA 1UE9A 2A36A 1JO8A 3I9QA 2O9VA 1K0SA 1GFDA 5IH2A 5FW9A 2EGCA 2GGRA 2JMCA 2A08A 3UA6A 1GCPA 2SRCA 2DL3A 3I5RA 4J9GA 1HJDA 1WXTA 1WIEA 2CSIA 2DX1A 2KYBA 1UTIA 1Y57A 2ABLA 4F17A 4LNPA 2D0NA 2BZ8A 2AZVA 4RTWA 5HCKA 4Z88A 2YUNA 2KEAA 1K1ZA 3M0UA 3M0TA 3VS6A 1YP5A 2RPNA 1BK2A 1SSHA 4J9IA 2BZYA 1W1FA 1OPLA 1KFZA 1I1JA 2GNCA 1M27C 2KT8A 4DEYA 3NPFA 4OMLA 2A28A 3EHRA 2JTEA 4OMNA 2LJ0A 1KIKA 1QWFA 1GL5A 2KRNA 2VVKA 4AFZC 4HCKA 2KRSA 2LQNA 2MCNA 3RBBB 3SEMA 4JZ3A 1PHTA 2V1RA 1ZX6A 4CC7A 1SPKA 2EYXA 4GLMA 1MV0B 1V1CA 4Y92A 4Z8AA 2ED0A 1X27A 2L3PA 1AWWA 2YUPA 4X1VA 1VA7A 2RQWA 1YN8A 2C0OA 2JW4A 1M3AA 1NLPC 2EBPA 2JS2A 2DBKA 4AG2C 4J9CA 2K6DA 2NUZA 1WLPB 2K2MA 1XOVA 2DF6A 1AD5A 1UHFA 1H3HA 2FO0A 2YDLA 1LCKA 1UJ0A 2EYYA 1T3LA 2M51A 2LQWA 3UATA 1BBZA 1PKSA 2KGTA 2L0AA 3SHWA 1QLYA 2RQRA 2FPFA 4A63B 2L3SA 2FPEA 1NYFA 3FJ5A 1Z9QA 1BU1A 4JJCA 3U23A 1FMKA 2DRMA 1UECA 2MIOA 1KSWA 5IHIA 1AOJA 2BTTA 1AVZC 2NWMA 2EVRA 1BB9A 2DE0X 3I35A 3H0FA 1NYGA 2KR3A 1I07A 1WX6A 2EGAA 3TVTA 1PNJA 2J6FA 1M30A 2CH4W 4QT7A 2DJQA 2O88A 4IIOA 2RNAA 1NG2A 1X2KA 2K79A 5FWCA 4JJBA 2GBQA 5EC7A 2DLPA 1JEGA 1PRMC 2YUOA 2J6OA 2JM9A 2KXCA 1NEGA 2ROLA 4J9BA 1PKTA 2HSPA 3EG2A 1QKWA 2AZSA 2W0ZA 5GJVB 1ABOA 1RI9A 2VWFA 1JU5C 2K9GA 3QWYA 2J7IA 2LNHB 2RN8A 1EFNA 2KXDA 3VRZA 2OAWA 1AWXA 1G83A 2QDLA 1CKAA 1ZSGA 2W10A 3NMZC 2AKLA 4F14A 5ECAA 1AZEA 1OPKA 2CUBA 2DRKA 4Z89A 2LMJA 1K0XA 1U06A 3ZL7C 1WI7A 1UDLA 1WYXA 2CSQA 5GJWB 1VYTA 3GBQA 1SRMA 1SEMA 2DL5A 1A0NB 2DA9A 1K9AA 3M0PA 1AZGB 4D8DA 3VS2A 1RLPC 4LUEA 2ECZA 3H41A 2FRWA 1JXMA 2LP5A 1WXBA 2D1XA 2EW3A 5I22A 2DNUA 2CT3A 1GBRA 2YSQA 1YWPA 2KROA 1ZLMA 3EG3A 1M3CA 4D8KA 1T0JA 1OV3A 2CREA 2HDAA 3VS1A 1VYVA 2LZ6B 4CC3A 1GFCA 2CT4A 1WDXA 2KT1A 1SHFA 2J6KA 2O31A 4IIMA 1TG0A 2YUQA 1K76A 5I11A 2BZXA 2LJ1A 4OMMA 2EYWA 1KJWA 3C0CA 4RTYA 3VS7A 2EGEA 2KNBB 2K3BA 1QCFA 4OMPA 2FPDA 2DILA 4LE9A 4HXJA 2DBMA 2DM1A 4HVUA 2F2XA 2O2OA 1ABQA 2EYZA 1MV3A 2X3WD 3CQTA 2JM8A 1ZUKA 3M0SA 2JMAA 2EQIA 2EPDA 1UHCA 4AG1C 2DVJA 1W6XA 1GRIA 3EHQA 1ZBJA 3I5SA 2LCSA 4F16A 1RUWA 4OMOA 1K4US 1E6HA 3EG1A 2GTOA 2V1QA 1PRLC 2F2VA 4J9DA 3TSWA 2L3QA 2LJ3A 4FSSA 2RMOA 5IHNA 3VRYA 1AWOA 1M8MA 1OEBA 2C0TA 3M0RA 4AFSC 3VS3A 1SRLA 1U3OA 4RTTA 2B86A 2J05A 3UA7A 3QWXX 1NEBA 2FRYA 3PVLA 1YCSB 1CSKA 1QWEA 1HSQA 2DMOA 3PVQA 4HVVA 2LX7A 2J06A 2KBTA 3THKA 3VS4A 1IO6A 1H92A 1U5SA 2OI3A 4LUDA 1UG1A 1X2QA 2DL4A 4J9FA 3EG0A 4RTVA 2AKKA 1YNZA
chains in the Genus database with same CATH superfamily
5CAIA 2E70A 3HRTA 5FLXE 2O01E 1YJ9Q 3MKDA 3JSCA 4ZGDB 4FW2A 1UFFA 4NL3A 3G4SA 1ZUYA 4XU3A 2VC8A 1B3QA 2QYZA 3SWNB 3C94A 1ARKA 2DJZA 3H8ZA 2K3YA 4XU2A 3ULRB 1RLQC 4JUVA 1PWTA 3CCUA 1W70A 1Q7YR 4R55A 1LNXA 2GFUA 4PJJA 4LN2A 3JCMX 2OAUA 4HVWA 2JT4A 3QG1A 2HSEB 4C92F 3A8OB 2L5QA 2DYIA 4FU6A 1C1AA 3JCMP 1TUGB 3CC4A 4EMKB 4M75C 1UGVA 5KYXB 5KYYA 2E64A 2JS0A 4ZN3A 3O5ZA 4AFQC 2NLUA 5I2SA 2JJ9A 1QVGS 3ASKA 1G3YA 2DVEA 2RJDA 3IQLA 4EIKA 2KSSA 4CC2A 2RHXA 3S3NA 1M4ZA 3CXCA 1LJOA 2SEMA 4MMLA 1HK9A 2R58A 4JZ4A 1VQ4A 4JJDA 1Y0MA 4XQ3A 4DQ2A 4F7UF 2CP3A 2EAYA 3EGUA 2QQ9A 2R57A 3RESA 2KE9A 1SF9A 2IG0A 1N8RC 1WXUA 2RF0A 2K5LA 3A98A 1CKBA 4M7AG 2O9SA 1G3WA 2XMFA 3JB9H 1KG1A 3CC2A 2RQVA 2FEIA 3HSBA 4M7DA 3QDRB 3QPHA 1QKXA 2JNGA 4BB7A 2QG9B 2BUDA 1RAHB 2CP5A 1YIJQ 4E2FB 5J26A 1YJWT 2O4XA 1ZA2B 2KQWA 2RJEA 4FM4B 5FWBA 1TXQA 3BY7A 1YIJT 4ESRA 2D8JA 2NUTA 2MWOA 2P0KA 1VQKQ 4X9DA 4PFOA 2H8HA 2CZ0B 1N5ZA 2DXTA 4RTXA 1UB4A 2CP7A 2HAXA 2ROTA 3AHUA 3PE0A 4OMQA 5GMKi 1QCOA 3CD6A 2PUOB 1ACMB 1GFDA 4PFPA 1PD1A 1YJ9T 4O5VA 3M57A 3OYGA 2Y4YA 3JB9G 2SRCA 2DL3A 3I5RA 2DAQA 4J9GA 4O6JA 3VUBA 4PJOB 4M77F 1K9MR 4M7DE 2D0NA 4Z88A 3M0UA 1FMVA 1BK2A 1SSHA 1S72A 3L2WA 1KD1C 1VQ6A 3PT9A 4M75F 1OPLA 1I1JA 2GNCA 3SDZA 4M7AA 2KT8A 3FEOA 3UT1A 1NPRA 4KGXB 3VU3C 1LOJA 1B7TA 2HKQB 2JTEA 3M4YA 3META 3A8GB 3CBPA 1QWFA 4A4HA 2VVKA 5J3BA 2KRSA 2MWPA 3QJYA 3PNWC 3OW2S 3QJ6A 2V1RA 3JCMf 1TTHB 4C8QA 4XU0A 2CS7A 3X26B 3OYAA 4GLMA 5LJ5d 5DY9A 2YWWA 3BW1A 4Y92A 4Z8AA 3CCET 1JRIA 2L3PA 1AWWA 3QZ9B 4TVRA 2IPOB 1VIFA 2QK0A 1Q86R 1NLPC 2EBPA 2JS2A 2JTFA 5CKEA 5DM7R 2DZ9A 3CMAT 3X20B 4C5GA 2DERA 2WSCE 4OB2B 4QQDA 2EYYA 2MMPA 3HRSA 3CCUT 2LQWA 1IZ6A 2LQKA 3M54A 2DXBA 2KGTA 1VQLQ 1RAEB 1RACB 1NYFA 1WHMA 3FJ5A 1Z9QA 3RR6A 4JJCA 3U23A 5HY6A 4J7FA 1FX7A 2BTTA 1AVZC 2NWMA 1UGRB 5GANh 2DE0X 5LJ3f 3H0FA 2MI6A 2HQXA 3CD6Q 4ELYC 3CC7A 1X2KA 1C6VX 1Y71A 2GBQA 1ZA1B 2RHUA 2WSFE 5EC7A 4KH1B 3EFRA 2COWA 1OI1A 1PKTA 1KD1U 3E9FA 2AZSA 2YLCA 3L42A 2VWFA 1Y07A 3E1SA 1PCXA 2PU9B 1YJNT 4X9CA 1S72Q 2LNHB 1VQOT 3CXCP 5GAOp 5CKDA 2QGFB 2ZZDA 4P5NA 4BI8B 2XG8D 3UPUA 2OAWA 4L6V5 4A4FA 3OYNA 5J39A 4LDWA 2VYTA 1WJRA 2W10A 1NJIR 4J83A 3I56A 1YJNA 1G3TA 4NS5A 2QEXQ 1OPKA 3QO3A 5KE3A 4JLGA 4BE2A 2DRKA 4M7AC 3EFOA 2QEXT 4LDVA 3ZL7C 1TU0B 3GNGA 3ME9A 4M7DG 2CSQA 3CCSQ 2X51A 2CZ1B 1KHCA 1SEMA 2RI5A 3G71Q 1A0NB 2RH2A 5CKHA 4LD6A 2M1HA 1K9AA 3VYHB 3H41A 1N9RA 1JXMA 1OZ3A 1WXBA 5I22A 3L2ZA 3LWHA 2CT3A 2KY9A 3RIRA 1ZLMA 2DTOA 3BDLA 1OV3A 4RMOA 3HPWA 1WHJA 2KT1A 1SHFA 2J6KA 1G3SA 2E6ZA 1K76A 2HL5C 2LJ1A 3QSUA 3LW5E 4FIBA 2EGEA 1QCFA 4IUPA 1BIBA 3GNFB 3VKIA 4PJOC 3CC4Q 4PJOA 3E19A 1WGSA 3OYEA 1KQ2A 1ZUKA 1UGPB 4FW1A 4BUGA 1PSFA 4M75D 3GF5A 1U1TA 2EPDA 5LJ5e 1ZBXA 4PL6A 3MEAA 3EGXB 1W4SA 3MO8A 1ZBJA 3MCAB 3CD6T 3I5SA 5LJ3e 2LRQA 2XD0A 2D6FA 5GAOn 2MAMA 1VQ4Q 5GAMh 1GXIE 4J8OA 2F2VA 2JTMA 4J9DA 1VQ9A 1IRXA 2RMOA 4F04B 3MEWA 3OB9A 3M0RA 2P4TA 4C8QE 4RTTA 4EMGA 3EH2A 3UA7A 4LDYA 2LX7A 2KBTA 3THKA 1VQMA 4OB0B 2HMAA 1X01A 1IO6A 4M78E 1KD1R 3L2RA 4LUDA 3MHXA 1VQ5T 4OGEA 2EKOA 3PMTA 2VXEA 2FHDA 4FYYB 2ATCB 1VQOA 1SHGA 2P84A 3WVDB 2KRMA 2YRCA 2CZ7B 1F1BB 2E3IA 3WVEB 1OULA 1X6GA 4ZN1A 3G71T 1K8AR 3TU4K 3RKXA 1S1NA 4KGZB 3M4GA 2ENMA 2LQ8A 1KQSP 1FYNA 3CCMA 4IUVA 5GANe 4C0DC 1RAAB 5HKCA 4E6RA 1MMGA 3TREA 3FC3A 1NZ9A 1E6GA 1OU8A 3M0QA 3OS1A 3G4ST 1DJ7B 3GP8A 4M75E 4PNOA 2A0FB 1JQQA 4ZNXA 3RNJA 4JRPA 1W2BA 1QP3A 4JPBW 5GAOq 2F5TX 2PZ1A 3NFCA 3HFNA 2FG0A 2HEQA 2I0NA 4C0DB 2EQKA 3DB4A 4HCZA 5KYNA 2XDDA 4IUQA 1JXOA 3CMAA 2CH4A 4E7LA 1N8RR 2QQSA 4KUIA 4RUGA 3X28B 3UF4A 4M7DC 4LDUA 2GCXA 4QKUA 3REBB 3OYIA 1M3BA 5I2MA 3RMQA 7AT1B 2P0PA 4J9HA 5AYFA 3JV3A 4J9EA 3JCMg 1WQ7A 3FB9A 5IT9E 2CUDA 2RQUA 3OBYA 3BFMA 2VV5A 1I0CA 3P8DA 2HKNA 1VQNA 1ZSZA 2AT1B 1K73U 4DEXA 4RTUA 2LNVA 3HRUA 3QDFA 2DYBA 1GCQA 2HBWA 2M0YA 4JRIA 1MNEA 3G1JA 3A8LB 4F7UE 2F69A 3JCMW 2KDSA 2L2PA 2E5KA 3MP1A 4AFUC 3DLMA 5GAN2 2QQAA 3GPLA 3L2UA 1G5VA 2ESWA 2HCKA 1YHQQ 1YJ9A 2P4RA 3OYJA 1UE9A 2A36A 1VQPT 1BYMA 1KQ1A 1M90R 5KCOA 5FRMA 5IH2A 2JUFA 2EGCA 5GAN8 2GGRA 3OW2P 4J6WA 2A08A 3UA6A 1HJDA 5FU6B 2DX1A 1PG5B 1TOVA 1WNLA 1WJSA 2HZYA 2XI9A 3SFMA 5LJ5h 2YUNA 1KC8U 3LX7A 5GAOr 3VS6A 4J9IA 1VQ5Q 1D3BB 4MMKA 3LGLA 3M58A 4XK8E 1M27C 1K73C 3DKMA 5D6XA 4C92C 3CCVQ 1VQMT 1TWBA 4OMNA 3KUFA 1KIKA 4IURA 1GL5A 1N9SA 3JCMh 4HCKA 4AFZC 4PJMA 1YJNQ 2MCNA 3RBBB 5A0LA 4JZ3A 1QVFA 1PHTA 2CZ6B 2ZCFB 1VQPA 1SPKA 3CCSA 3LYIA 2ED0A 1X27A 1K8AU 2E6NA 2YUPA 4MZPA 1VA7A 1D0ZA 1K8AC 2RQWA 2E4HA 2E3HA 2EIFA 1I81A 3CCJA 2DBKA 3EGXA 1Y96A 4KH0B 3P8BB 4FYVB 2FVUA 2VGMA 4BE0A 3V7CA 2K6DA 2NUZA 5IN1A 2DF6A 1UHFA 3G7ZA 3JCMQ 5GANd 2FO0A 2YDLA 3OYKA 3CCQQ 1UJ0A 2CP2A 2WACA 2RJCA 3V7RA 4N4HA 3TQ7P 3UATA 4A4GA 2FB7A 1WPYA 2IVWA 4CRIA 3PIOA 3RUXA 3A8HB 2JN0A 2V8KA 1NE8A 3GOXA 4M78A 2QA4Q 2EJ9A 1KK7A 1UECA 3C4SA 3A8MB 3QZ5B 4BDZA 4QVZA 4F7UA 1RAIB 2EJGA 5D6WA 2ZPHB 3I35A 4J6XA 3I56T 1I07A 2J6FA 3C12A 2RNAA 2ZPIB 4BDYA 2OTLT 1I8FA 4M75G 2K3XA 2X9HA 3HP9A 4N4IA 3J81E 1H3ZA 1JEGA 1PRMC 4XTUA 4WF2A 2QASA 2KXCA 1NEGA 3L2VA 4M7DF 2YRDA 2HSPA 1QKWA 4M77C 1YITT 3EAEA 3QWYA 3EFOB 4UC4A 2J7IA 1VQ9Q 3L2QA 1Q7YC 2RN8A 1EFNA 1HXDA 2OTJQ 3QYHB 2DD4A 4XTXA 3CCVA 2C06A 4EPCA 1WHLA 4F14A 3VV0A 2LMJA 2LCCA 1K0XA 1M1KU 1U06A 2PQWA 1VQPQ 1UDLA 1RADB 2HNIA 3QIIA 1U8RA 4PJOD 1PM3A 4E7ZA 2R5MA 4JS4A 1MMAA 3M0PA 3RMSA 4D8DA 2DXCA 3VS2A 1RLPC 2ECZA 3M55A 2K57A 1U1SA 2LP5A 4QVCA 4ATOA 2EW3A 2DNUA 4M77D 3CCQA 3CCMQ 2YSQA 2B8AA 1IGQA 1TH7A 1VIEA 1TS9A 2K2VA 1OU9A 3VS1A 1VYVA 2EQUA 2LZ6B 4CC3A 1VQLA 3CCUQ 1Q86C 4IUTA 4A4KA 4IIMA 1WJQA 1I4K1 2YUQA 5GAN5 4M77A 3A1PA 2EYWA 1KJWA 2DETA 2NUPB 2YRVA 3VS7A 2KNBB 2K3BA 1YI2A 1WHGA 2FPDA 4CI0C 3CPWA 2F2XA 5CQYA 1QP2A 2X3WD 3CMAQ 2LT4A 2QXFA 4L59A 2E65A 1N6AA 1RI0A 3Q1JA 3OMGA 3V8JA 2LDMA 2CKKA 3T9NA 3NTIA 4F16A 4OMOA 3OBWA 3CBOA 3HFOA 4GLKA 4QQ6A 2MYSA 4QQGA 2DEUA 1M8MA 5A0DA 1M90C 2L8DA 1M9SA 3M53A 2RD1A 3OYBA 3WXMB 2B86A 2KAFA 3V7SA 2BE7D 3PVLA 2XKOC 1NJIC 1YCSB 3G6ET 1HSQA 5GMKl 2J06A 2QEXA 4C8QG 3CC2Q 1H92A 2DZCA 4ZGEB 2DK3A 3M9QA 1X2QA 4J9FA 1YIJA 3G71A 1OZ2A 2DO3A 2LX9A 5CVIA 1M5Q1 2DKGA 3VS0A 3JB9F 3M59A 1O9SA 3E9GA 3TCJA 1WFWA 1E7OA 4M7DD 4ELZC 4KT0E 3ZFJA 3OY9A 1T3SA 1R8OB 1QVFS 5D6YA 3RERA 1PC0A 5GMKe 2D8HA 2AK5A 2HL3A 4KRTA 3INZA 1R77A 3FLGA 3P8HA 4ORZA 5CK9A 2XHCA 2P0QA 4B6MA 4MDXA 2X3XD 2E1HA 2DTHA 1QVGP 5LJ3h 2GTJA 5I21A 3ZEHA 4M7DB 2DL8A 1VQ5A 1X43A 2EKHA 2MK5A 1YI2Q 5IHKA 1OOTA 1NLOC 3UWNA 4OVAA 3SWNC 5IXBA 2BKDN 2KYMA 2IIMA 2F2WA 3CMEA 4LD9K 2LTOA 2Y4XA 4J6YA 2VKNA 3ZBDA 3MP8A 4WCIA 1Z9ZA 4ANJA 3CCEA 5GAN6 3TSZA 4OF1A 3CCVT 1OYXA 4D6WA 4F7UG 1SG5A 3OYMA 4M7AD 2OJ2A 2OTLQ 4GBQA 1NJIU 2C0IA 2EJFA 4E7KA 5KE2A 1VYUA 2PVGB 1KHIA 5KYYB 5KYXA 3CPFA 3KXTA 1B07A 2XICA 4EMKA 5FU6C 4RTZA 1AWJA 5A2QE 3GLXA 2VUBA 2MOXA 1MUZA 1G2BA 2CP6A 2K7AA 3CEYA 4ZTFA 2X35A 2ED1A 3AT1B 4B9WA 1JJ2P 4ME7A 2RI2A 2EQJA 2VASA 2NYSA 4IUUA 5GAMe 3CPWS 1ZUUA 2X4WA 8ATCB 5FU7B 1W2BS 1BKBA 1TUDA 3SWNA 1YHQT 2K5FA 1OX8A 2EQMA 2ZPBB 1ZSZC 1JO8A 2BIVA 3J80E 2O9VA 2VB6A 5FW9A 4QVDA 2JMCA 3CCLA 1IXDA 1WXTA 2CSIA 2KYBA 1UTIA 1Y57A 5GAN4 2ZGWA 4LNPA 4M77G 2M16A 2LC4A 1R0BG 3JAME 3JCMb 5HCKA 1VOMA 4Q5WA 4JRQA 2A3LA 1YP5A 3CC2T 2RPNA 3OA6A 2DEQA 2BZYA 1W1FA 4FT2A 1Q95G 1TSFA 4GY5A 3JCMd 4PK4A 3NPFA 3NTKA 2KK4A 4OMLA 3CCST 4HT8A 2A28A 5L8RE 2FZKB 2KRNA 2LVMA 3OYLA 2LQNA 2PUKB 3SEMA 5GMKm 4C8QC 2EYXA 1JB0E 1MV0B 3X25B 4M7AE 4E7JA 3JCMe 1WHHA 4X1VA 4RCCA 1XTDA 3VJPA 1YN8A 1M3AA 1MNDA 3FJPA 1Q81R 4AG2C 2FL7A 4J9CA 4PJLA 1WLPB 4C92A 1XOVA 2COYA 3BE3A 3CCRA 1VQNQ 1QVFP 6AT1B 5FRNA 2A7YA 4L5GA 4NL2A 1T3LA 4MZMA 5KYUB 4OMFB 5LJ5g 2D0QB 3S6WA 2L0AA 3CPWP 1B34B 2RQRA 2FPFA 2L3SA 2RHZA 3A5ZB 4OB3B 3CC4T 1FMKA 1QCNA 2COZA 1KSWA 5IHIA 1AOJA 1OX9A 2EVRA 3LLRA 1N27A 1NYGA 4C8QB 2VXFA 1WX6A 1M2VA 2EGAA 3TVTA 2DFUA 1MMNA 1M30A 2RB6A 2DJQA 1AHJB 3QKJA 4PJOE 1NG2A 2V8IA 5FWCA 4M78B 4PKCC 2Z0WA 4C5HA 1M2VB 2J6OA 2JM9A 4M7AB 4DOVA 5IAYA 4JS5A 3JB9J 1KC8C 1C0MA 2K9GA 4E7IA 1R0CB 4C92D 1VQ6Q 4BACA 2HQEA 2PVOB 1IHVA 2LCLA 1B34A 1XNIA 1G83A 1YFNA 2QDLA 4YTLA 1Q82R 2OTJT 1ZSGA 4M78D 5KYUA 2AKLA 3MEVA 1X75C 2RA2A 2KI7A 5ECAA 1AZEA 1Y96B 3BDUA 1YBYA 4DA4A 3OS0A 2HBPA 4M78G 1WI7A 4WTOB 5GJWB 1SRMA 4C92B 2DL5A 2X4YA 2YXYA 1BI3A 2NUTB 4OP0A 1Q81U 1VQOQ 5CQXA 5DLOA 3CCJQ 4A4EA 1G8XA 4LUEA 3X24B 4J7IA 3QBYA 4XTWA 4A53A 2D1XA 2GQVA 4ZGJB 2AIRB 1Q82U 1GBRA 1V29B 2FZCB 4JRKA 1RL2A 1D0XA 1D3BA 1M3CA 1T0JA 5CKBA 2EFIA 3QHSA 1Q7YU 2CT4A 3R6OA 4JLIA 4PFZA 4DBHA 3FRNA 2BZXA 5GAMj 4Y28E 4OMMA 4E7SA 4BY6C 4RTYA 4OMPA 2DILA 4XTVA 4LE9A 4MDWA 1JBMA 4HXJA 2KMTA 3OYYA 4N0AC 1VQLT 2QAZA 3VYGA 1ABQA 3OSVA 1MV3A 3VUZA 4HA8A 2M02A 4PLLA 2JM8A 3CMEQ 2L3RA 1BI2A 2QGGA 4AG1C 2DVJA 2YLBA 1GRIA 3EHQA 4C92E 2LCSA 4AMCA 3MPUB 4M75A 2MF2A 2E10A 2GF7A 1K4US 1RAFB 5GAMg 1E6HA 2GTOA 1PRLC 4DBQA 3CBMA 1H641 1AWOA 5IHNA 2BE9B 3KBGA 1JJ2A 1D1AA 1D1CA 1OEBA 3GIBA 1SRLA 2EYQA 1ZSZB 2V26A 2E41A 4VUBA 1CSKA 1NPPA 1QWEA 3NTHA 1QMCA 5CIUA 1JJ2S 3PVQA 4HVVA 3CCJT 3I56Q 3VS4A 2RHIA 1VQ7Q 1XJWB 4HCBA 4R56A 1P92A 1ZHIA 1U5SA 2DD5A 3LH0A 2DL4A 1SSFA 3EG0A 1BI1A 1YNZA 1W2BP 1LPLA 1I5LA 4FSXA 2CDTA 2DXUA 2DIGA 3H9NA 1GBQA 1M1GA 4C5EA 2JVVA 4C92G 1VQKA 3HHTB 1TUCA 4M78F 4M4ZA 1YI2T 2DL7A 1O75A 3JCMJ 2XIDA 2Y90A 5FU7C 2K5IA 5LJ3j 3OW2A 3KFVA 1NM7A 2WSEE 3OYFA 5IXFA 3V8LA 3I55T 4BE1A 3H0IA 2JXBA 3OYDA 3CCLQ 3TEEA 1AEYA 2ZPEB 1T0HA 2PNIA 3CCMT 1M90U 4X34A 3CCLT 5KCHA 1HYOA 3S3MA 5D7UA 3OQ5A 1RABB 2YHTA 2JZ2A 3UDCA 1WA7A 2LT1A 3RKWA 3EGDA 4MZTA 1K9MU 1UUEA 3LH5A 1KQSS 2RI3A 4V2SA 1HD3A 1UJYA 1X69A 4K11A 3H0HA 3EFSA 5M9OA 1GCQC 3OYHA 3ER0A 2D9TA 4AT1B 1D1BA 2YT6A 9ATCB 3LGFA 2GQIA 2QQBA 4EMKC 3R6NA 3FDRA 4PLIA 2EWNA 3OMCA 3OYCA 1YJWA 3S3OA 3JRZA 5GAOm 2G6FX 3NGPA 1YWOA 1QW1A 2RQTA 3O8VA 2H3EB 1D09B 3REAB 5L23A 2DTIA 4CC4B 3J7AF 3PMIA 1Y7XA 4FCYA 4LXCA 2A37A 4DOWA 2ZPGB 4LDXA 3CCRQ 4E7HA 1AT1B 1PD0A 4FYXB 3RDVA 1VQ8A 4KUDK 1QVGA 1X6BA 2PTKA 2HD0A 4RG8A 1H8KA 3EG9A 1N8RU 3PIPA 2PVDB 4R0KA 3G6EQ 3MP6A 2CP0A 2QTXA 2OX7A 3PFSA 1QQJA 4KULA 1NBEB 2KVQG 4HT9A 5CR2A 1EX4A 3NHNA 1UGSB 1J3TA 4KBMB 2ZAEA 3VS5A 4J5YA 3I9QA 1K0SA 5CCAA 5LJ3g 2HQHA 1VQ6T 1KC8R 1GCPA 4RCBA 5KH6A 1BIAA 4E47A 1YITQ 1WIEA 4BY6B 1WZOA 2ABLA 4F17A 1WQWA 2BZ8A 2AZVA 3JCMV 4KGVB 4RTWA 3I55Q 1FMWA 2KEAA 1K1ZA 1IB8A 3M0TA 4HKEA 3V8KA 1V76A 2NUPA 1X6OA 4DBFA 3PGGA 3N5BB 4M77B 1KFZA 3SD4A 4DEYA 2F1LA 3OS2A 1M2OA 1WHKA 3EHRA 2DPPB 2LJ0A 5CKFA 5GANg 5FROA 5GAN3 3CCQT 4EDUA 4FYWB 2R5AA 4M78C 1ZX6A 3M5AA 3JCMc 4CC7A 1Q82C 3CCEQ 4BI3A 4JDSA 5GMKj 4M75B 1V1CA 1MGQA 4Y91A 1BI0A 5KYWB 2C0OA 2JW4A 5A0GA 3SB2A 2ZPFB 4PJOG 4FT4A 2FYKA 2V8JA 2FZGB 4PJOF 4II1A 2K2MA 2VGNA 1AD5A 1H3HA 2X4JA 1UEBA 1VQ8Q 1LCKA 1VQNT 2M9UA 4HCCA 4A54A 5GANj 3RKYA 5C6SA 2XK0A 1XQHA 2M51A 3CCRT 2G3RA 2X4XA 4RKUE 1EZZB 1BBZA 1VQ4T 1MHNA 1PKSA 3SHWA 1QLYA 4A63B 1IREB 2FPEA 1BU1A 3CMET 1M1FA 1IGUA 5KYWA 3DB3A 5LL6S 2DRMA 4BI4A 2MIOA 2XDPA 3CC7T 1YHQA 2E12A 3F70A 1BB9A 2CGHA 2KR3A 1D0YA 1EIFA 1BCOA 1PNJA 2QDYB 2RO0A 2CH4W 4QT7A 3FIFA 2O88A 2E5QA 4IIOA 4JJNK 2K79A 4XTYA 1SKUB 4JJBA 2XDBA 2DLPA 2RM4A 5GAMd 3JB9I 1YITA 2MPXC 2YUOA 1ZQ1A 4XU1A 2ROLA 4J9BA 1LVKA 3DLLA 4F7UB 2F5KA 3EG2A 4N0AA 4XTZA 2W0ZA 3I55A 5GJVB 1ABOA 2I2LA 1RI9A 3JB9D 2M0OA 1JU5C 3QUIA 1Q86U 1M1KC 2KXDA 4RG2A 1K9MC 3HL8A 3VRZA 5GAMf 1FWZA 5GANf 1AWXA 3H6ZA 3LWIA 3MEUA 4B9XA 4C0GA 1CKAA 3NMZC 1M8VA 2K4YA 3EH1A 4XAXB 1VQMQ 4N4GA 1VQ7A 4C8QD 2CUBA 2CYZB 2DIQA 4Z89A 3URGA 1WYXA 1VYTA 3GBQA 4NOYA 2QI2A 3QXEB 2DA9A 3D7SB 1I5OB 1VQ9T 1RAGB 2AHJB 1M1KR 1AZGB 1VQ7T 1VUBA 4ZTJA 2GFAA 2FRWA 5DLQE 5LJ5f 3L1AA 3G4SQ 4BD3A 4C0ZA 3EG9B 3HKSA 4FL6A 5LJ3d 1YWPA 2KROA 5EG2A 4OGCA 2RJFA 3EG3A 2JOYA 4D8KA 2RK1A 3HTRA 2CREA 2HDAA 5GAOl 1VQ8T 4QW2A 1GFCA 1WDXA 2O31A 5HK3A 1TG0A 4PJNA 5I11A 3PTAA 3C0CA 2QA4A 2H3JA 1IHWA 2RK2A 1UGQB 2RHYA 3C95A 2DBMA 2QA4T 3MJXA 2DM1A 4HVUA 2QQRA 2O2OA 4C0FA 3OS5A 2EYZA 3CQTA 3CC7Q 3M0SA 2JMAA 1S72T 1BCMA 2EQIA 1UHCA 5CO7A 4OB1B 4Z02A 1YJWQ 1Q81C 5GAN7 2O4XB 1W6XA 5AT1B 1OQKA 1RUWA 3E2UA 5C0MA 3EG1A 2V1QA 4M7AF 3EGDB 1MMDA 3OSSC 3TSWA 2OTLA 5LJ5j 2L3QA 2LJ3A 4FSSA 3VRYA 4DBRA 4M77E 2OTJA 2C0TA 4AFSC 3M56A 3VS3A 1U3OA 3CXCS 2J05A 5HK0A 3QWXX 1NEBA 2FRYA 4C5IA 2XU8A 1YCYA 2DMOA 4C8QF 4EMHA 1PSEA 3QYGB 1K73R 4IKFA 2OI3A 3G6EA 8AT1B 1VQKT 1FXXA 1KQSA 1UG1A 4RTVA 2L89A 2AKKA 5GMKh 1QVPA 2QTVA
chains in the Genus database with same CATH topology
1SHGA 2CDTA 2KRMA 1GBQA 3VS0A 1TUCA 1X6GA 1WFWA 4M4ZA 1E7OA 2DL7A 1UFFA 1S1NA 1T3SA 2ENMA 1ZUYA 1FYNA 3KFVA 1NM7A 1B3QA 2D8HA 5IXFA 2AK5A 3H0IA 2JXBA 4E6RA 1AEYA 4KRTA 1ARKA 1E6GA 1T0HA 2PNIA 3M0QA 3ULRB 1RLQC 4ORZA 1JQQA 1PWTA 1W70A 4ZNXA 3RNJA 1WA7A 2X3XD 4LN2A 4JPBW 4HVWA 2JT4A 1UUEA 3LH5A 2GTJA 2PZ1A 2DL8A 1X43A 2EKHA 1HD3A 1UJYA 1X69A 4K11A 2FG0A 5IHKA 1OOTA 3H0HA 1NLOC 2HEQA 2I0NA 1GCQC 5IXBA 2YT6A 1UGVA 2KYMA 2IIMA 1JXOA 2GQIA 2F2WA 2CH4A 3R6NA 2JS0A 3O5ZA 4AFQC 4RUGA 3UF4A 2VKNA 4WCIA 3REBB 1M3BA 1Z9ZA 3IQLA 3TSZA 4EIKA 2G6FX 3NGPA 4CC2A 1YWOA 4J9HA 3JV3A 2RQTA 4J9EA 2SEMA 3REAB 5L23A 4JZ4A 2CUDA 4CC4B 4JJDA 1Y0MA 2RQUA 1I0CA 2OJ2A 3EGUA 4GBQA 2C0IA 2A37A 2KE9A 1VYUA 1WXUA 2RF0A 3A98A 1B07A 4DEXA 4RTUA 1X6BA 2PTKA 1CKBA 4RTZA 1AWJA 1H8KA 2O9SA 2MOXA 2XMFA 1MUZA 1G2BA 2DYBA 2FEIA 2RQVA 1GCQA 2HBWA 2K7AA 4R0KA 2M0YA 2ED1A 1QKXA 2L2PA 2E5KA 4AFUC 5FWBA 1ZUUA 2ESWA 4ESRA 2D8JA 2HCKA 2P4RA 2H8HA 1TUDA 1N5ZA 3NHNA 4RTXA 1J3TA 2ROTA 3VS5A 3PE0A 4OMQA 1UE9A 2A36A 1JO8A 3I9QA 2O9VA 1K0SA 1GFDA 5IH2A 5FW9A 2EGCA 2GGRA 2JMCA 2A08A 3UA6A 1GCPA 2SRCA 2DL3A 3I5RA 4J9GA 1HJDA 1WXTA 1WIEA 2CSIA 2DX1A 2KYBA 1UTIA 1Y57A 2ABLA 4F17A 4LNPA 2D0NA 2BZ8A 2AZVA 4RTWA 5HCKA 4Z88A 2YUNA 2KEAA 1K1ZA 3M0UA 3M0TA 3VS6A 1YP5A 2RPNA 1BK2A 1SSHA 4J9IA 2BZYA 1W1FA 1OPLA 1KFZA 1I1JA 2GNCA 1M27C 2KT8A 4DEYA 3NPFA 4OMLA 2A28A 3EHRA 2JTEA 4OMNA 2LJ0A 1KIKA 1QWFA 1GL5A 2KRNA 2VVKA 4AFZC 4HCKA 2KRSA 2LQNA 2MCNA 3RBBB 3SEMA 4JZ3A 1PHTA 2V1RA 1ZX6A 4CC7A 1SPKA 2EYXA 4GLMA 1MV0B 1V1CA 4Y92A 4Z8AA 2ED0A 1X27A 2L3PA 1AWWA 2YUPA 4X1VA 1VA7A 2RQWA 1YN8A 2C0OA 2JW4A 1M3AA 1NLPC 2EBPA 2JS2A 2DBKA 4AG2C 4J9CA 2K6DA 2NUZA 1WLPB 2K2MA 1XOVA 2DF6A 1AD5A 1UHFA 1H3HA 2FO0A 2YDLA 1LCKA 1UJ0A 2EYYA 1T3LA 2M51A 2LQWA 3UATA 1BBZA 1PKSA 2KGTA 2L0AA 3SHWA 1QLYA 2RQRA 2FPFA 4A63B 2L3SA 2FPEA 1NYFA 3FJ5A 1Z9QA 1BU1A 4JJCA 3U23A 1FMKA 2DRMA 1UECA 2MIOA 1KSWA 5IHIA 1AOJA 2BTTA 1AVZC 2NWMA 2EVRA 1BB9A 2DE0X 3I35A 3H0FA 1NYGA 2KR3A 1I07A 1WX6A 2EGAA 3TVTA 1PNJA 2J6FA 1M30A 2CH4W 4QT7A 2DJQA 2O88A 4IIOA 2RNAA 1NG2A 1X2KA 2K79A 5FWCA 4JJBA 2GBQA 5EC7A 2DLPA 1JEGA 1PRMC 2YUOA 2J6OA 2JM9A 2KXCA 1NEGA 2ROLA 4J9BA 1PKTA 2HSPA 3EG2A 1QKWA 2AZSA 2W0ZA 5GJVB 1ABOA 1RI9A 2VWFA 1JU5C 2K9GA 3QWYA 2J7IA 2LNHB 2RN8A 1EFNA 2KXDA 3VRZA 2OAWA 1AWXA 1G83A 2QDLA 1CKAA 1ZSGA 2W10A 3NMZC 2AKLA 4F14A 5ECAA 1AZEA 1OPKA 2CUBA 2DRKA 4Z89A 2LMJA 1K0XA 1U06A 3ZL7C 1WI7A 1UDLA 1WYXA 2CSQA 5GJWB 1VYTA 3GBQA 1SRMA 1SEMA 2DL5A 1A0NB 2DA9A 1K9AA 3M0PA 1AZGB 4D8DA 3VS2A 1RLPC 4LUEA 2ECZA 3H41A 2FRWA 1JXMA 2LP5A 1WXBA 2D1XA 2EW3A 5I22A 2DNUA 2CT3A 1GBRA 2YSQA 1YWPA 2KROA 1ZLMA 3EG3A 1M3CA 4D8KA 1T0JA 1OV3A 2CREA 2HDAA 3VS1A 1VYVA 2LZ6B 4CC3A 1GFCA 2CT4A 1WDXA 2KT1A 1SHFA 2J6KA 2O31A 4IIMA 1TG0A 2YUQA 1K76A 5I11A 2BZXA 2LJ1A 4OMMA 2EYWA 1KJWA 3C0CA 4RTYA 3VS7A 2EGEA 2KNBB 2K3BA 1QCFA 4OMPA 2FPDA 2DILA 4LE9A 4HXJA 2DBMA 2DM1A 4HVUA 2F2XA 2O2OA 1ABQA 2EYZA 1MV3A 2X3WD 3CQTA 2JM8A 1ZUKA 3M0SA 2JMAA 2EQIA 2EPDA 1UHCA 4AG1C 2DVJA 1W6XA 1GRIA 3EHQA 1ZBJA 3I5SA 2LCSA 4F16A 1RUWA 4OMOA 1K4US 1E6HA 3EG1A 2GTOA 2V1QA 1PRLC 2F2VA 4J9DA 3TSWA 2L3QA 2LJ3A 4FSSA 2RMOA 5IHNA 3VRYA 1AWOA 1M8MA 1OEBA 2C0TA 3M0RA 4AFSC 3VS3A 1SRLA 1U3OA 4RTTA 2B86A 2J05A 3UA7A 3QWXX 1NEBA 2FRYA 3PVLA 1YCSB 1CSKA 1QWEA 1HSQA 2DMOA 3PVQA 4HVVA 2LX7A 2J06A 2KBTA 3THKA 3VS4A 1IO6A 1H92A 1U5SA 2OI3A 4LUDA 1UG1A 1X2QA 2DL4A 4J9FA 3EG0A 4RTVA 2AKKA 1YNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHG A;  2CDT A;  2KRM A;  1GBQ A;  3VS0 A;  1TUC A;  1X6G A;  1WFW A;  4M4Z A;  1E7O A;  2DL7 A;  1UFF A;  1S1N A;  1T3S A;  2ENM A;  1ZUY A;  1FYN A;  3KFV A;  1NM7 A;  1B3Q A;  2D8H A;  5IXF A;  2AK5 A;  3H0I A;  2JXB A;  4E6R A;  1AEY A;  4KRT A;  1ARK A;  1E6G A;  1T0H A;  2PNI A;  3M0Q A;  3ULR B;  1RLQ C;  4ORZ A;  1JQQ A;  1PWT A;  1W70 A;  4ZNX A;  3RNJ A;  1WA7 A;  2X3X D;  4LN2 A;  4JPB W;  4HVW A;  2JT4 A;  1UUE A;  3LH5 A;  2GTJ A;  2PZ1 A;  2DL8 A;  1X43 A;  2EKH A;  1HD3 A;  1UJY A;  1X69 A;  4K11 A;  2FG0 A;  5IHK A;  1OOT A;  3H0H A;  1NLO C;  2HEQ A;  2I0N A;  1GCQ C;  5IXB A;  2YT6 A;  1UGV A;  2KYM A;  2IIM A;  1JXO A;  2GQI A;  2F2W A;  2CH4 A;  3R6N A;  2JS0 A;  3O5Z A;  4AFQ C;  4RUG A;  3UF4 A;  2VKN A;  4WCI A;  3REB B;  1M3B A;  1Z9Z A;  3IQL A;  3TSZ A;  4EIK A;  2G6F X;  3NGP A;  4CC2 A;  1YWO A;  4J9H A;  3JV3 A;  2RQT A;  4J9E A;  2SEM A;  3REA B;  5L23 A;  4JZ4 A;  2CUD A;  4CC4 B;  4JJD A;  1Y0M A;  2RQU A;  1I0C A;  2OJ2 A;  3EGU A;  4GBQ A;  2C0I A;  2A37 A;  2KE9 A;  1VYU A;  1WXU A;  2RF0 A;  3A98 A;  1B07 A;  4DEX A;  4RTU A;  1X6B A;  2PTK A;  1CKB A;  4RTZ A;  1AWJ A;  1H8K A;  2O9S A;  2MOX A;  2XMF A;  1MUZ A;  1G2B A;  2DYB A;  2FEI A;  2RQV A;  1GCQ A;  2HBW A;  2K7A A;  4R0K A;  2M0Y A;  2ED1 A;  1QKX A;  2L2P A;  2E5K A;  4AFU C;  5FWB A;  1ZUU A;  2ESW A;  4ESR A;  2D8J A;  2HCK A;  2P4R A;  2H8H A;  1TUD A;  1N5Z A;  3NHN A;  4RTX A;  1J3T A;  2ROT A;  3VS5 A;  3PE0 A;  4OMQ A;  1UE9 A;  2A36 A;  1JO8 A;  3I9Q A;  2O9V A;  1K0S A;  1GFD A;  5IH2 A;  5FW9 A;  2EGC A;  2GGR A;  2JMC A;  2A08 A;  3UA6 A;  1GCP A;  2SRC A;  2DL3 A;  3I5R A;  4J9G A;  1HJD A;  1WXT A;  1WIE A;  2CSI A;  2DX1 A;  2KYB A;  1UTI A;  1Y57 A;  2ABL A;  4F17 A;  4LNP A;  2D0N A;  2BZ8 A;  2AZV A;  4RTW A;  5HCK A;  4Z88 A;  2YUN A;  2KEA A;  1K1Z A;  3M0U A;  3M0T A;  3VS6 A;  1YP5 A;  2RPN A;  1BK2 A;  1SSH A;  4J9I A;  2BZY A;  1W1F A;  1OPL A;  1KFZ A;  1I1J A;  2GNC A;  1M27 C;  2KT8 A;  4DEY A;  3NPF A;  4OML A;  2A28 A;  3EHR A;  2JTE A;  4OMN A;  2LJ0 A;  1KIK A;  1QWF A;  1GL5 A;  2KRN A;  2VVK A;  4AFZ C;  4HCK A;  2KRS A;  2LQN A;  2MCN A;  3RBB B;  3SEM A;  4JZ3 A;  1PHT A;  2V1R A;  1ZX6 A;  4CC7 A;  1SPK A;  2EYX A;  4GLM A;  1MV0 B;  1V1C A;  4Y92 A;  4Z8A A;  2ED0 A;  1X27 A;  2L3P A;  1AWW A;  2YUP A;  4X1V A;  1VA7 A;  2RQW A;  1YN8 A;  2C0O A;  2JW4 A;  1M3A A;  1NLP C;  2EBP A;  2JS2 A;  2DBK A;  4AG2 C;  4J9C A;  2K6D A;  2NUZ A;  1WLP B;  2K2M A;  1XOV A;  2DF6 A;  1AD5 A;  1UHF A;  1H3H A;  2FO0 A;  2YDL A;  1LCK A;  1UJ0 A;  2EYY A;  1T3L A;  2M51 A;  2LQW A;  3UAT A;  1BBZ A;  1PKS A;  2KGT A;  2L0A A;  3SHW A;  1QLY A;  2RQR A;  2FPF A;  4A63 B;  2L3S A;  2FPE A;  1NYF A;  3FJ5 A;  1Z9Q A;  1BU1 A;  4JJC A;  3U23 A;  1FMK A;  2DRM A;  1UEC A;  2MIO A;  1KSW A;  5IHI A;  1AOJ A;  2BTT A;  1AVZ C;  2NWM A;  2EVR A;  1BB9 A;  2DE0 X;  3I35 A;  3H0F A;  1NYG A;  2KR3 A;  1I07 A;  1WX6 A;  2EGA A;  3TVT A;  1PNJ A;  2J6F A;  1M30 A;  2CH4 W;  4QT7 A;  2DJQ A;  2O88 A;  4IIO A;  2RNA A;  1NG2 A;  1X2K A;  2K79 A;  5FWC A;  4JJB A;  2GBQ A;  5EC7 A;  2DLP A;  1JEG A;  1PRM C;  2YUO A;  2J6O A;  2JM9 A;  2KXC A;  1NEG A;  2ROL A;  4J9B A;  1PKT A;  2HSP A;  3EG2 A;  1QKW A;  2AZS A;  2W0Z A;  5GJV B;  1ABO A;  1RI9 A;  2VWF A;  1JU5 C;  2K9G A;  3QWY A;  2J7I A;  2LNH B;  2RN8 A;  1EFN A;  2KXD A;  3VRZ A;  2OAW A;  1AWX A;  1G83 A;  2QDL A;  1CKA A;  1ZSG A;  2W10 A;  3NMZ C;  2AKL A;  4F14 A;  5ECA A;  1AZE A;  1OPK A;  2CUB A;  2DRK A;  4Z89 A;  2LMJ A;  1K0X A;  1U06 A;  3ZL7 C;  1WI7 A;  1UDL A;  1WYX A;  2CSQ A;  5GJW B;  1VYT A;  3GBQ A;  1SRM A;  1SEM A;  2DL5 A;  1A0N B;  2DA9 A;  1K9A A;  3M0P A;  1AZG B;  4D8D A;  3VS2 A;  1RLP C;  4LUE A;  2ECZ A;  3H41 A;  2FRW A;  1JXM A;  2LP5 A;  1WXB A;  2D1X A;  2EW3 A;  5I22 A;  2DNU A;  2CT3 A;  1GBR A;  2YSQ A;  1YWP A;  2KRO A;  1ZLM A;  3EG3 A;  1M3C A;  4D8K A;  1T0J A;  1OV3 A;  2CRE A;  2HDA A;  3VS1 A;  1VYV A;  2LZ6 B;  4CC3 A;  1GFC A;  2CT4 A;  1WDX A;  2KT1 A;  1SHF A;  2J6K A;  2O31 A;  4IIM A;  1TG0 A;  2YUQ A;  1K76 A;  5I11 A;  2BZX A;  2LJ1 A;  4OMM A;  2EYW A;  1KJW A;  3C0C A;  4RTY A;  3VS7 A;  2EGE A;  2KNB B;  2K3B A;  1QCF A;  4OMP A;  2FPD A;  2DIL A;  4LE9 A;  4HXJ A;  2DBM A;  2DM1 A;  4HVU A;  2F2X A;  2O2O A;  1ABQ A;  2EYZ A;  1MV3 A;  2X3W D;  3CQT A;  2JM8 A;  1ZUK A;  3M0S A;  2JMA A;  2EQI A;  2EPD A;  1UHC A;  4AG1 C;  2DVJ A;  1W6X A;  1GRI A;  3EHQ A;  1ZBJ A;  3I5S A;  2LCS A;  4F16 A;  1RUW A;  4OMO A;  1K4U S;  1E6H A;  3EG1 A;  2GTO A;  2V1Q A;  1PRL C;  2F2V A;  4J9D A;  3TSW A;  2L3Q A;  2LJ3 A;  4FSS A;  2RMO A;  5IHN A;  3VRY A;  1AWO A;  1M8M A;  1OEB A;  2C0T A;  3M0R A;  4AFS C;  3VS3 A;  1SRL A;  1U3O A;  4RTT A;  2B86 A;  2J05 A;  3UA7 A;  3QWX X;  1NEB A;  2FRY A;  3PVL A;  1YCS B;  1CSK A;  1QWE A;  1HSQ A;  2DMO A;  3PVQ A;  4HVV A;  2LX7 A;  2J06 A;  2KBT A;  3THK A;  3VS4 A;  1IO6 A;  1H92 A;  1U5S A;  2OI3 A;  4LUD A;  1UG1 A;  1X2Q A;  2DL4 A;  4J9F A;  3EG0 A;  4RTV A;  2AKK A;  1YNZ A; 
#chains in the Genus database with same CATH topology
 5CAI A;  2E70 A;  3HRT A;  5FLX E;  2O01 E;  1YJ9 Q;  3MKD A;  3JSC A;  4ZGD B;  4FW2 A;  1UFF A;  4NL3 A;  3G4S A;  1ZUY A;  4XU3 A;  2VC8 A;  1B3Q A;  2QYZ A;  3SWN B;  3C94 A;  1ARK A;  2DJZ A;  3H8Z A;  2K3Y A;  4XU2 A;  3ULR B;  1RLQ C;  4JUV A;  1PWT A;  3CCU A;  1W70 A;  1Q7Y R;  4R55 A;  1LNX A;  2GFU A;  4PJJ A;  4LN2 A;  3JCM X;  2OAU A;  4HVW A;  2JT4 A;  3QG1 A;  2HSE B;  4C92 F;  3A8O B;  2L5Q A;  2DYI A;  4FU6 A;  1C1A A;  3JCM P;  1TUG B;  3CC4 A;  4EMK B;  4M75 C;  1UGV A;  5KYX B;  5KYY A;  2E64 A;  2JS0 A;  4ZN3 A;  3O5Z A;  4AFQ C;  2NLU A;  5I2S A;  2JJ9 A;  1QVG S;  3ASK A;  1G3Y A;  2DVE A;  2RJD A;  3IQL A;  4EIK A;  2KSS A;  4CC2 A;  2RHX A;  3S3N A;  1M4Z A;  3CXC A;  1LJO A;  2SEM A;  4MML A;  1HK9 A;  2R58 A;  4JZ4 A;  1VQ4 A;  4JJD A;  1Y0M A;  4XQ3 A;  4DQ2 A;  4F7U F;  2CP3 A;  2EAY A;  3EGU A;  2QQ9 A;  2R57 A;  3RES A;  2KE9 A;  1SF9 A;  2IG0 A;  1N8R C;  1WXU A;  2RF0 A;  2K5L A;  3A98 A;  1CKB A;  4M7A G;  2O9S A;  1G3W A;  2XMF A;  3JB9 H;  1KG1 A;  3CC2 A;  2RQV A;  2FEI A;  3HSB A;  4M7D A;  3QDR B;  3QPH A;  1QKX A;  2JNG A;  4BB7 A;  2QG9 B;  2BUD A;  1RAH B;  2CP5 A;  1YIJ Q;  4E2F B;  5J26 A;  1YJW T;  2O4X A;  1ZA2 B;  2KQW A;  2RJE A;  4FM4 B;  5FWB A;  1TXQ A;  3BY7 A;  1YIJ T;  4ESR A;  2D8J A;  2NUT A;  2MWO A;  2P0K A;  1VQK Q;  4X9D A;  4PFO A;  2H8H A;  2CZ0 B;  1N5Z A;  2DXT A;  4RTX A;  1UB4 A;  2CP7 A;  2HAX A;  2ROT A;  3AHU A;  3PE0 A;  4OMQ A;  5GMK i;  1QCO A;  3CD6 A;  2PUO B;  1ACM B;  1GFD A;  4PFP A;  1PD1 A;  1YJ9 T;  4O5V A;  3M57 A;  3OYG A;  2Y4Y A;  3JB9 G;  2SRC A;  2DL3 A;  3I5R A;  2DAQ A;  4J9G A;  4O6J A;  3VUB A;  4PJO B;  4M77 F;  1K9M R;  4M7D E;  2D0N A;  4Z88 A;  3M0U A;  1FMV A;  1BK2 A;  1SSH A;  1S72 A;  3L2W A;  1KD1 C;  1VQ6 A;  3PT9 A;  4M75 F;  1OPL A;  1I1J A;  2GNC A;  3SDZ A;  4M7A A;  2KT8 A;  3FEO A;  3UT1 A;  1NPR A;  4KGX B;  3VU3 C;  1LOJ A;  1B7T A;  2HKQ B;  2JTE A;  3M4Y A;  3MET A;  3A8G B;  3CBP A;  1QWF A;  4A4H A;  2VVK A;  5J3B A;  2KRS A;  2MWP A;  3QJY A;  3PNW C;  3OW2 S;  3QJ6 A;  2V1R A;  3JCM f;  1TTH B;  4C8Q A;  4XU0 A;  2CS7 A;  3X26 B;  3OYA A;  4GLM A;  5LJ5 d;  5DY9 A;  2YWW A;  3BW1 A;  4Y92 A;  4Z8A A;  3CCE T;  1JRI A;  2L3P A;  1AWW A;  3QZ9 B;  4TVR A;  2IPO B;  1VIF A;  2QK0 A;  1Q86 R;  1NLP C;  2EBP A;  2JS2 A;  2JTF A;  5CKE A;  5DM7 R;  2DZ9 A;  3CMA T;  3X20 B;  4C5G A;  2DER A;  2WSC E;  4OB2 B;  4QQD A;  2EYY A;  2MMP A;  3HRS A;  3CCU T;  2LQW A;  1IZ6 A;  2LQK A;  3M54 A;  2DXB A;  2KGT A;  1VQL Q;  1RAE B;  1RAC B;  1NYF A;  1WHM A;  3FJ5 A;  1Z9Q A;  3RR6 A;  4JJC A;  3U23 A;  5HY6 A;  4J7F A;  1FX7 A;  2BTT A;  1AVZ C;  2NWM A;  1UGR B;  5GAN h;  2DE0 X;  5LJ3 f;  3H0F A;  2MI6 A;  2HQX A;  3CD6 Q;  4ELY C;  3CC7 A;  1X2K A;  1C6V X;  1Y71 A;  2GBQ A;  1ZA1 B;  2RHU A;  2WSF E;  5EC7 A;  4KH1 B;  3EFR A;  2COW A;  1OI1 A;  1PKT A;  1KD1 U;  3E9F A;  2AZS A;  2YLC A;  3L42 A;  2VWF A;  1Y07 A;  3E1S A;  1PCX A;  2PU9 B;  1YJN T;  4X9C A;  1S72 Q;  2LNH B;  1VQO T;  3CXC P;  5GAO p;  5CKD A;  2QGF B;  2ZZD A;  4P5N A;  4BI8 B;  2XG8 D;  3UPU A;  2OAW A;  4L6V 5;  4A4F A;  3OYN A;  5J39 A;  4LDW A;  2VYT A;  1WJR A;  2W10 A;  1NJI R;  4J83 A;  3I56 A;  1YJN A;  1G3T A;  4NS5 A;  2QEX Q;  1OPK A;  3QO3 A;  5KE3 A;  4JLG A;  4BE2 A;  2DRK A;  4M7A C;  3EFO A;  2QEX T;  4LDV A;  3ZL7 C;  1TU0 B;  3GNG A;  3ME9 A;  4M7D G;  2CSQ A;  3CCS Q;  2X51 A;  2CZ1 B;  1KHC A;  1SEM A;  2RI5 A;  3G71 Q;  1A0N B;  2RH2 A;  5CKH A;  4LD6 A;  2M1H A;  1K9A A;  3VYH B;  3H41 A;  1N9R A;  1JXM A;  1OZ3 A;  1WXB A;  5I22 A;  3L2Z A;  3LWH A;  2CT3 A;  2KY9 A;  3RIR A;  1ZLM A;  2DTO A;  3BDL A;  1OV3 A;  4RMO A;  3HPW A;  1WHJ A;  2KT1 A;  1SHF A;  2J6K A;  1G3S A;  2E6Z A;  1K76 A;  2HL5 C;  2LJ1 A;  3QSU A;  3LW5 E;  4FIB A;  2EGE A;  1QCF A;  4IUP A;  1BIB A;  3GNF B;  3VKI A;  4PJO C;  3CC4 Q;  4PJO A;  3E19 A;  1WGS A;  3OYE A;  1KQ2 A;  1ZUK A;  1UGP B;  4FW1 A;  4BUG A;  1PSF A;  4M75 D;  3GF5 A;  1U1T A;  2EPD A;  5LJ5 e;  1ZBX A;  4PL6 A;  3MEA A;  3EGX B;  1W4S A;  3MO8 A;  1ZBJ A;  3MCA B;  3CD6 T;  3I5S A;  5LJ3 e;  2LRQ A;  2XD0 A;  2D6F A;  5GAO n;  2MAM A;  1VQ4 Q;  5GAM h;  1GXI E;  4J8O A;  2F2V A;  2JTM A;  4J9D A;  1VQ9 A;  1IRX A;  2RMO A;  4F04 B;  3MEW A;  3OB9 A;  3M0R A;  2P4T A;  4C8Q E;  4RTT A;  4EMG A;  3EH2 A;  3UA7 A;  4LDY A;  2LX7 A;  2KBT A;  3THK A;  1VQM A;  4OB0 B;  2HMA A;  1X01 A;  1IO6 A;  4M78 E;  1KD1 R;  3L2R A;  4LUD A;  3MHX A;  1VQ5 T;  4OGE A;  2EKO A;  3PMT A;  2VXE A;  2FHD A;  4FYY B;  2ATC B;  1VQO A;  1SHG A;  2P84 A;  3WVD B;  2KRM A;  2YRC A;  2CZ7 B;  1F1B B;  2E3I A;  3WVE B;  1OUL A;  1X6G A;  4ZN1 A;  3G71 T;  1K8A R;  3TU4 K;  3RKX A;  1S1N A;  4KGZ B;  3M4G A;  2ENM A;  2LQ8 A;  1KQS P;  1FYN A;  3CCM A;  4IUV A;  5GAN e;  4C0D C;  1RAA B;  5HKC A;  4E6R A;  1MMG A;  3TRE A;  3FC3 A;  1NZ9 A;  1E6G A;  1OU8 A;  3M0Q A;  3OS1 A;  3G4S T;  1DJ7 B;  3GP8 A;  4M75 E;  4PNO A;  2A0F B;  1JQQ A;  4ZNX A;  3RNJ A;  4JRP A;  1W2B A;  1QP3 A;  4JPB W;  5GAO q;  2F5T X;  2PZ1 A;  3NFC A;  3HFN A;  2FG0 A;  2HEQ A;  2I0N A;  4C0D B;  2EQK A;  3DB4 A;  4HCZ A;  5KYN A;  2XDD A;  4IUQ A;  1JXO A;  3CMA A;  2CH4 A;  4E7L A;  1N8R R;  2QQS A;  4KUI A;  4RUG A;  3X28 B;  3UF4 A;  4M7D C;  4LDU A;  2GCX A;  4QKU A;  3REB B;  3OYI A;  1M3B A;  5I2M A;  3RMQ A;  7AT1 B;  2P0P A;  4J9H A;  5AYF A;  3JV3 A;  4J9E A;  3JCM g;  1WQ7 A;  3FB9 A;  5IT9 E;  2CUD A;  2RQU A;  3OBY A;  3BFM A;  2VV5 A;  1I0C A;  3P8D A;  2HKN A;  1VQN A;  1ZSZ A;  2AT1 B;  1K73 U;  4DEX A;  4RTU A;  2LNV A;  3HRU A;  3QDF A;  2DYB A;  1GCQ A;  2HBW A;  2M0Y A;  4JRI A;  1MNE A;  3G1J A;  3A8L B;  4F7U E;  2F69 A;  3JCM W;  2KDS A;  2L2P A;  2E5K A;  3MP1 A;  4AFU C;  3DLM A;  5GAN 2;  2QQA A;  3GPL A;  3L2U A;  1G5V A;  2ESW A;  2HCK A;  1YHQ Q;  1YJ9 A;  2P4R A;  3OYJ A;  1UE9 A;  2A36 A;  1VQP T;  1BYM A;  1KQ1 A;  1M90 R;  5KCO A;  5FRM A;  5IH2 A;  2JUF A;  2EGC A;  5GAN 8;  2GGR A;  3OW2 P;  4J6W A;  2A08 A;  3UA6 A;  1HJD A;  5FU6 B;  2DX1 A;  1PG5 B;  1TOV A;  1WNL A;  1WJS A;  2HZY A;  2XI9 A;  3SFM A;  5LJ5 h;  2YUN A;  1KC8 U;  3LX7 A;  5GAO r;  3VS6 A;  4J9I A;  1VQ5 Q;  1D3B B;  4MMK A;  3LGL A;  3M58 A;  4XK8 E;  1M27 C;  1K73 C;  3DKM A;  5D6X A;  4C92 C;  3CCV Q;  1VQM T;  1TWB A;  4OMN A;  3KUF A;  1KIK A;  4IUR A;  1GL5 A;  1N9S A;  3JCM h;  4HCK A;  4AFZ C;  4PJM A;  1YJN Q;  2MCN A;  3RBB B;  5A0L A;  4JZ3 A;  1QVF A;  1PHT A;  2CZ6 B;  2ZCF B;  1VQP A;  1SPK A;  3CCS A;  3LYI A;  2ED0 A;  1X27 A;  1K8A U;  2E6N A;  2YUP A;  4MZP A;  1VA7 A;  1D0Z A;  1K8A C;  2RQW A;  2E4H A;  2E3H A;  2EIF A;  1I81 A;  3CCJ A;  2DBK A;  3EGX A;  1Y96 A;  4KH0 B;  3P8B B;  4FYV B;  2FVU A;  2VGM A;  4BE0 A;  3V7C A;  2K6D A;  2NUZ A;  5IN1 A;  2DF6 A;  1UHF A;  3G7Z A;  3JCM Q;  5GAN d;  2FO0 A;  2YDL A;  3OYK A;  3CCQ Q;  1UJ0 A;  2CP2 A;  2WAC A;  2RJC A;  3V7R A;  4N4H A;  3TQ7 P;  3UAT A;  4A4G A;  2FB7 A;  1WPY A;  2IVW A;  4CRI A;  3PIO A;  3RUX A;  3A8H B;  2JN0 A;  2V8K A;  1NE8 A;  3GOX A;  4M78 A;  2QA4 Q;  2EJ9 A;  1KK7 A;  1UEC A;  3C4S A;  3A8M B;  3QZ5 B;  4BDZ A;  4QVZ A;  4F7U A;  1RAI B;  2EJG A;  5D6W A;  2ZPH B;  3I35 A;  4J6X A;  3I56 T;  1I07 A;  2J6F A;  3C12 A;  2RNA A;  2ZPI B;  4BDY A;  2OTL T;  1I8F A;  4M75 G;  2K3X A;  2X9H A;  3HP9 A;  4N4I A;  3J81 E;  1H3Z A;  1JEG A;  1PRM C;  4XTU A;  4WF2 A;  2QAS A;  2KXC A;  1NEG A;  3L2V A;  4M7D F;  2YRD A;  2HSP A;  1QKW A;  4M77 C;  1YIT T;  3EAE A;  3QWY A;  3EFO B;  4UC4 A;  2J7I A;  1VQ9 Q;  3L2Q A;  1Q7Y C;  2RN8 A;  1EFN A;  1HXD A;  2OTJ Q;  3QYH B;  2DD4 A;  4XTX A;  3CCV A;  2C06 A;  4EPC A;  1WHL A;  4F14 A;  3VV0 A;  2LMJ A;  2LCC A;  1K0X A;  1M1K U;  1U06 A;  2PQW A;  1VQP Q;  1UDL A;  1RAD B;  2HNI A;  3QII A;  1U8R A;  4PJO D;  1PM3 A;  4E7Z A;  2R5M A;  4JS4 A;  1MMA A;  3M0P A;  3RMS A;  4D8D A;  2DXC A;  3VS2 A;  1RLP C;  2ECZ A;  3M55 A;  2K57 A;  1U1S A;  2LP5 A;  4QVC A;  4ATO A;  2EW3 A;  2DNU A;  4M77 D;  3CCQ A;  3CCM Q;  2YSQ A;  2B8A A;  1IGQ A;  1TH7 A;  1VIE A;  1TS9 A;  2K2V A;  1OU9 A;  3VS1 A;  1VYV A;  2EQU A;  2LZ6 B;  4CC3 A;  1VQL A;  3CCU Q;  1Q86 C;  4IUT A;  4A4K A;  4IIM A;  1WJQ A;  1I4K 1;  2YUQ A;  5GAN 5;  4M77 A;  3A1P A;  2EYW A;  1KJW A;  2DET A;  2NUP B;  2YRV A;  3VS7 A;  2KNB B;  2K3B A;  1YI2 A;  1WHG A;  2FPD A;  4CI0 C;  3CPW A;  2F2X A;  5CQY A;  1QP2 A;  2X3W D;  3CMA Q;  2LT4 A;  2QXF A;  4L59 A;  2E65 A;  1N6A A;  1RI0 A;  3Q1J A;  3OMG A;  3V8J A;  2LDM A;  2CKK A;  3T9N A;  3NTI A;  4F16 A;  4OMO A;  3OBW A;  3CBO A;  3HFO A;  4GLK A;  4QQ6 A;  2MYS A;  4QQG A;  2DEU A;  1M8M A;  5A0D A;  1M90 C;  2L8D A;  1M9S A;  3M53 A;  2RD1 A;  3OYB A;  3WXM B;  2B86 A;  2KAF A;  3V7S A;  2BE7 D;  3PVL A;  2XKO C;  1NJI C;  1YCS B;  3G6E T;  1HSQ A;  5GMK l;  2J06 A;  2QEX A;  4C8Q G;  3CC2 Q;  1H92 A;  2DZC A;  4ZGE B;  2DK3 A;  3M9Q A;  1X2Q A;  4J9F A;  1YIJ A;  3G71 A;  1OZ2 A;  2DO3 A;  2LX9 A;  5CVI A;  1M5Q 1;  2DKG A;  3VS0 A;  3JB9 F;  3M59 A;  1O9S A;  3E9G A;  3TCJ A;  1WFW A;  1E7O A;  4M7D D;  4ELZ C;  4KT0 E;  3ZFJ A;  3OY9 A;  1T3S A;  1R8O B;  1QVF S;  5D6Y A;  3RER A;  1PC0 A;  5GMK e;  2D8H A;  2AK5 A;  2HL3 A;  4KRT A;  3INZ A;  1R77 A;  3FLG A;  3P8H A;  4ORZ A;  5CK9 A;  2XHC A;  2P0Q A;  4B6M A;  4MDX A;  2X3X D;  2E1H A;  2DTH A;  1QVG P;  5LJ3 h;  2GTJ A;  5I21 A;  3ZEH A;  4M7D B;  2DL8 A;  1VQ5 A;  1X43 A;  2EKH A;  2MK5 A;  1YI2 Q;  5IHK A;  1OOT A;  1NLO C;  3UWN A;  4OVA A;  3SWN C;  5IXB A;  2BKD N;  2KYM A;  2IIM A;  2F2W A;  3CME A;  4LD9 K;  2LTO A;  2Y4X A;  4J6Y A;  2VKN A;  3ZBD A;  3MP8 A;  4WCI A;  1Z9Z A;  4ANJ A;  3CCE A;  5GAN 6;  3TSZ A;  4OF1 A;  3CCV T;  1OYX A;  4D6W A;  4F7U G;  1SG5 A;  3OYM A;  4M7A D;  2OJ2 A;  2OTL Q;  4GBQ A;  1NJI U;  2C0I A;  2EJF A;  4E7K A;  5KE2 A;  1VYU A;  2PVG B;  1KHI A;  5KYY B;  5KYX A;  3CPF A;  3KXT A;  1B07 A;  2XIC A;  4EMK A;  5FU6 C;  4RTZ A;  1AWJ A;  5A2Q E;  3GLX A;  2VUB A;  2MOX A;  1MUZ A;  1G2B A;  2CP6 A;  2K7A A;  3CEY A;  4ZTF A;  2X35 A;  2ED1 A;  3AT1 B;  4B9W A;  1JJ2 P;  4ME7 A;  2RI2 A;  2EQJ A;  2VAS A;  2NYS A;  4IUU A;  5GAM e;  3CPW S;  1ZUU A;  2X4W A;  8ATC B;  5FU7 B;  1W2B S;  1BKB A;  1TUD A;  3SWN A;  1YHQ T;  2K5F A;  1OX8 A;  2EQM A;  2ZPB B;  1ZSZ C;  1JO8 A;  2BIV A;  3J80 E;  2O9V A;  2VB6 A;  5FW9 A;  4QVD A;  2JMC A;  3CCL A;  1IXD A;  1WXT A;  2CSI A;  2KYB A;  1UTI A;  1Y57 A;  5GAN 4;  2ZGW A;  4LNP A;  4M77 G;  2M16 A;  2LC4 A;  1R0B G;  3JAM E;  3JCM b;  5HCK A;  1VOM A;  4Q5W A;  4JRQ A;  2A3L A;  1YP5 A;  3CC2 T;  2RPN A;  3OA6 A;  2DEQ A;  2BZY A;  1W1F A;  4FT2 A;  1Q95 G;  1TSF A;  4GY5 A;  3JCM d;  4PK4 A;  3NPF A;  3NTK A;  2KK4 A;  4OML A;  3CCS T;  4HT8 A;  2A28 A;  5L8R E;  2FZK B;  2KRN A;  2LVM A;  3OYL A;  2LQN A;  2PUK B;  3SEM A;  5GMK m;  4C8Q C;  2EYX A;  1JB0 E;  1MV0 B;  3X25 B;  4M7A E;  4E7J A;  3JCM e;  1WHH A;  4X1V A;  4RCC A;  1XTD A;  3VJP A;  1YN8 A;  1M3A A;  1MND A;  3FJP A;  1Q81 R;  4AG2 C;  2FL7 A;  4J9C A;  4PJL A;  1WLP B;  4C92 A;  1XOV A;  2COY A;  3BE3 A;  3CCR A;  1VQN Q;  1QVF P;  6AT1 B;  5FRN A;  2A7Y A;  4L5G A;  4NL2 A;  1T3L A;  4MZM A;  5KYU B;  4OMF B;  5LJ5 g;  2D0Q B;  3S6W A;  2L0A A;  3CPW P;  1B34 B;  2RQR A;  2FPF A;  2L3S A;  2RHZ A;  3A5Z B;  4OB3 B;  3CC4 T;  1FMK A;  1QCN A;  2COZ A;  1KSW A;  5IHI A;  1AOJ A;  1OX9 A;  2EVR A;  3LLR A;  1N27 A;  1NYG A;  4C8Q B;  2VXF A;  1WX6 A;  1M2V A;  2EGA A;  3TVT A;  2DFU A;  1MMN A;  1M30 A;  2RB6 A;  2DJQ A;  1AHJ B;  3QKJ A;  4PJO E;  1NG2 A;  2V8I A;  5FWC A;  4M78 B;  4PKC C;  2Z0W A;  4C5H A;  1M2V B;  2J6O A;  2JM9 A;  4M7A B;  4DOV A;  5IAY A;  4JS5 A;  3JB9 J;  1KC8 C;  1C0M A;  2K9G A;  4E7I A;  1R0C B;  4C92 D;  1VQ6 Q;  4BAC A;  2HQE A;  2PVO B;  1IHV A;  2LCL A;  1B34 A;  1XNI A;  1G83 A;  1YFN A;  2QDL A;  4YTL A;  1Q82 R;  2OTJ T;  1ZSG A;  4M78 D;  5KYU A;  2AKL A;  3MEV A;  1X75 C;  2RA2 A;  2KI7 A;  5ECA A;  1AZE A;  1Y96 B;  3BDU A;  1YBY A;  4DA4 A;  3OS0 A;  2HBP A;  4M78 G;  1WI7 A;  4WTO B;  5GJW B;  1SRM A;  4C92 B;  2DL5 A;  2X4Y A;  2YXY A;  1BI3 A;  2NUT B;  4OP0 A;  1Q81 U;  1VQO Q;  5CQX A;  5DLO A;  3CCJ Q;  4A4E A;  1G8X A;  4LUE A;  3X24 B;  4J7I A;  3QBY A;  4XTW A;  4A53 A;  2D1X A;  2GQV A;  4ZGJ B;  2AIR B;  1Q82 U;  1GBR A;  1V29 B;  2FZC B;  4JRK A;  1RL2 A;  1D0X A;  1D3B A;  1M3C A;  1T0J A;  5CKB A;  2EFI A;  3QHS A;  1Q7Y U;  2CT4 A;  3R6O A;  4JLI A;  4PFZ A;  4DBH A;  3FRN A;  2BZX A;  5GAM j;  4Y28 E;  4OMM A;  4E7S A;  4BY6 C;  4RTY A;  4OMP A;  2DIL A;  4XTV A;  4LE9 A;  4MDW A;  1JBM A;  4HXJ A;  2KMT A;  3OYY A;  4N0A C;  1VQL T;  2QAZ A;  3VYG A;  1ABQ A;  3OSV A;  1MV3 A;  3VUZ A;  4HA8 A;  2M02 A;  4PLL A;  2JM8 A;  3CME Q;  2L3R A;  1BI2 A;  2QGG A;  4AG1 C;  2DVJ A;  2YLB A;  1GRI A;  3EHQ A;  4C92 E;  2LCS A;  4AMC A;  3MPU B;  4M75 A;  2MF2 A;  2E10 A;  2GF7 A;  1K4U S;  1RAF B;  5GAM g;  1E6H A;  2GTO A;  1PRL C;  4DBQ A;  3CBM A;  1H64 1;  1AWO A;  5IHN A;  2BE9 B;  3KBG A;  1JJ2 A;  1D1A A;  1D1C A;  1OEB A;  3GIB A;  1SRL A;  2EYQ A;  1ZSZ B;  2V26 A;  2E41 A;  4VUB A;  1CSK A;  1NPP A;  1QWE A;  3NTH A;  1QMC A;  5CIU A;  1JJ2 S;  3PVQ A;  4HVV A;  3CCJ T;  3I56 Q;  3VS4 A;  2RHI A;  1VQ7 Q;  1XJW B;  4HCB A;  4R56 A;  1P92 A;  1ZHI A;  1U5S A;  2DD5 A;  3LH0 A;  2DL4 A;  1SSF A;  3EG0 A;  1BI1 A;  1YNZ A;  1W2B P;  1LPL A;  1I5L A;  4FSX A;  2CDT A;  2DXU A;  2DIG A;  3H9N A;  1GBQ A;  1M1G A;  4C5E A;  2JVV A;  4C92 G;  1VQK A;  3HHT B;  1TUC A;  4M78 F;  4M4Z A;  1YI2 T;  2DL7 A;  1O75 A;  3JCM J;  2XID A;  2Y90 A;  5FU7 C;  2K5I A;  5LJ3 j;  3OW2 A;  3KFV A;  1NM7 A;  2WSE E;  3OYF A;  5IXF A;  3V8L A;  3I55 T;  4BE1 A;  3H0I A;  2JXB A;  3OYD A;  3CCL Q;  3TEE A;  1AEY A;  2ZPE B;  1T0H A;  2PNI A;  3CCM T;  1M90 U;  4X34 A;  3CCL T;  5KCH A;  1HYO A;  3S3M A;  5D7U A;  3OQ5 A;  1RAB B;  2YHT A;  2JZ2 A;  3UDC A;  1WA7 A;  2LT1 A;  3RKW A;  3EGD A;  4MZT A;  1K9M U;  1UUE A;  3LH5 A;  1KQS S;  2RI3 A;  4V2S A;  1HD3 A;  1UJY A;  1X69 A;  4K11 A;  3H0H A;  3EFS A;  5M9O A;  1GCQ C;  3OYH A;  3ER0 A;  2D9T A;  4AT1 B;  1D1B A;  2YT6 A;  9ATC B;  3LGF A;  2GQI A;  2QQB A;  4EMK C;  3R6N A;  3FDR A;  4PLI A;  2EWN A;  3OMC A;  3OYC A;  1YJW A;  3S3O A;  3JRZ A;  5GAO m;  2G6F X;  3NGP A;  1YWO A;  1QW1 A;  2RQT A;  3O8V A;  2H3E B;  1D09 B;  3REA B;  5L23 A;  2DTI A;  4CC4 B;  3J7A F;  3PMI A;  1Y7X A;  4FCY A;  4LXC A;  2A37 A;  4DOW A;  2ZPG B;  4LDX A;  3CCR Q;  4E7H A;  1AT1 B;  1PD0 A;  4FYX B;  3RDV A;  1VQ8 A;  4KUD K;  1QVG A;  1X6B A;  2PTK A;  2HD0 A;  4RG8 A;  1H8K A;  3EG9 A;  1N8R U;  3PIP A;  2PVD B;  4R0K A;  3G6E Q;  3MP6 A;  2CP0 A;  2QTX A;  2OX7 A;  3PFS A;  1QQJ A;  4KUL A;  1NBE B;  2KVQ G;  4HT9 A;  5CR2 A;  1EX4 A;  3NHN A;  1UGS B;  1J3T A;  4KBM B;  2ZAE A;  3VS5 A;  4J5Y A;  3I9Q A;  1K0S A;  5CCA A;  5LJ3 g;  2HQH A;  1VQ6 T;  1KC8 R;  1GCP A;  4RCB A;  5KH6 A;  1BIA A;  4E47 A;  1YIT Q;  1WIE A;  4BY6 B;  1WZO A;  2ABL A;  4F17 A;  1WQW A;  2BZ8 A;  2AZV A;  3JCM V;  4KGV B;  4RTW A;  3I55 Q;  1FMW A;  2KEA A;  1K1Z A;  1IB8 A;  3M0T A;  4HKE A;  3V8K A;  1V76 A;  2NUP A;  1X6O A;  4DBF A;  3PGG A;  3N5B B;  4M77 B;  1KFZ A;  3SD4 A;  4DEY A;  2F1L A;  3OS2 A;  1M2O A;  1WHK A;  3EHR A;  2DPP B;  2LJ0 A;  5CKF A;  5GAN g;  5FRO A;  5GAN 3;  3CCQ T;  4EDU A;  4FYW B;  2R5A A;  4M78 C;  1ZX6 A;  3M5A A;  3JCM c;  4CC7 A;  1Q82 C;  3CCE Q;  4BI3 A;  4JDS A;  5GMK j;  4M75 B;  1V1C A;  1MGQ A;  4Y91 A;  1BI0 A;  5KYW B;  2C0O A;  2JW4 A;  5A0G A;  3SB2 A;  2ZPF B;  4PJO G;  4FT4 A;  2FYK A;  2V8J A;  2FZG B;  4PJO F;  4II1 A;  2K2M A;  2VGN A;  1AD5 A;  1H3H A;  2X4J A;  1UEB A;  1VQ8 Q;  1LCK A;  1VQN T;  2M9U A;  4HCC A;  4A54 A;  5GAN j;  3RKY A;  5C6S A;  2XK0 A;  1XQH A;  2M51 A;  3CCR T;  2G3R A;  2X4X A;  4RKU E;  1EZZ B;  1BBZ A;  1VQ4 T;  1MHN A;  1PKS A;  3SHW A;  1QLY A;  4A63 B;  1IRE B;  2FPE A;  1BU1 A;  3CME T;  1M1F A;  1IGU A;  5KYW A;  3DB3 A;  5LL6 S;  2DRM A;  4BI4 A;  2MIO A;  2XDP A;  3CC7 T;  1YHQ A;  2E12 A;  3F70 A;  1BB9 A;  2CGH A;  2KR3 A;  1D0Y A;  1EIF A;  1BCO A;  1PNJ A;  2QDY B;  2RO0 A;  2CH4 W;  4QT7 A;  3FIF A;  2O88 A;  2E5Q A;  4IIO A;  4JJN K;  2K79 A;  4XTY A;  1SKU B;  4JJB A;  2XDB A;  2DLP A;  2RM4 A;  5GAM d;  3JB9 I;  1YIT A;  2MPX C;  2YUO A;  1ZQ1 A;  4XU1 A;  2ROL A;  4J9B A;  1LVK A;  3DLL A;  4F7U B;  2F5K A;  3EG2 A;  4N0A A;  4XTZ A;  2W0Z A;  3I55 A;  5GJV B;  1ABO A;  2I2L A;  1RI9 A;  3JB9 D;  2M0O A;  1JU5 C;  3QUI A;  1Q86 U;  1M1K C;  2KXD A;  4RG2 A;  1K9M C;  3HL8 A;  3VRZ A;  5GAM f;  1FWZ A;  5GAN f;  1AWX A;  3H6Z A;  3LWI A;  3MEU A;  4B9X A;  4C0G A;  1CKA A;  3NMZ C;  1M8V A;  2K4Y A;  3EH1 A;  4XAX B;  1VQM Q;  4N4G A;  1VQ7 A;  4C8Q D;  2CUB A;  2CYZ B;  2DIQ A;  4Z89 A;  3URG A;  1WYX A;  1VYT A;  3GBQ A;  4NOY A;  2QI2 A;  3QXE B;  2DA9 A;  3D7S B;  1I5O B;  1VQ9 T;  1RAG B;  2AHJ B;  1M1K R;  1AZG B;  1VQ7 T;  1VUB A;  4ZTJ A;  2GFA A;  2FRW A;  5DLQ E;  5LJ5 f;  3L1A A;  3G4S Q;  4BD3 A;  4C0Z A;  3EG9 B;  3HKS A;  4FL6 A;  5LJ3 d;  1YWP A;  2KRO A;  5EG2 A;  4OGC A;  2RJF A;  3EG3 A;  2JOY A;  4D8K A;  2RK1 A;  3HTR A;  2CRE A;  2HDA A;  5GAO l;  1VQ8 T;  4QW2 A;  1GFC A;  1WDX A;  2O31 A;  5HK3 A;  1TG0 A;  4PJN A;  5I11 A;  3PTA A;  3C0C A;  2QA4 A;  2H3J A;  1IHW A;  2RK2 A;  1UGQ B;  2RHY A;  3C95 A;  2DBM A;  2QA4 T;  3MJX A;  2DM1 A;  4HVU A;  2QQR A;  2O2O A;  4C0F A;  3OS5 A;  2EYZ A;  3CQT A;  3CC7 Q;  3M0S A;  2JMA A;  1S72 T;  1BCM A;  2EQI A;  1UHC A;  5CO7 A;  4OB1 B;  4Z02 A;  1YJW Q;  1Q81 C;  5GAN 7;  2O4X B;  1W6X A;  5AT1 B;  1OQK A;  1RUW A;  3E2U A;  5C0M A;  3EG1 A;  2V1Q A;  4M7A F;  3EGD B;  1MMD A;  3OSS C;  3TSW A;  2OTL A;  5LJ5 j;  2L3Q A;  2LJ3 A;  4FSS A;  3VRY A;  4DBR A;  4M77 E;  2OTJ A;  2C0T A;  4AFS C;  3M56 A;  3VS3 A;  1U3O A;  3CXC S;  2J05 A;  5HK0 A;  3QWX X;  1NEB A;  2FRY A;  4C5I A;  2XU8 A;  1YCY A;  2DMO A;  4C8Q F;  4EMH A;  1PSE A;  3QYG B;  1K73 R;  4IKF A;  2OI3 A;  3G6E A;  8AT1 B;  1VQK T;  1FXX A;  1KQS A;  1UG1 A;  4RTV A;  2L89 A;  2AKK A;  5GMK h;  1QVP A;  2QTV A; 
#chains in the Genus database with same CATH homology
 1SHG A;  2CDT A;  2KRM A;  1GBQ A;  3VS0 A;  1TUC A;  1X6G A;  1WFW A;  4M4Z A;  1E7O A;  2DL7 A;  1UFF A;  1S1N A;  1T3S A;  2ENM A;  1ZUY A;  1FYN A;  3KFV A;  1NM7 A;  1B3Q A;  2D8H A;  5IXF A;  2AK5 A;  3H0I A;  2JXB A;  4E6R A;  1AEY A;  4KRT A;  1ARK A;  1E6G A;  1T0H A;  2PNI A;  3M0Q A;  3ULR B;  1RLQ C;  4ORZ A;  1JQQ A;  1PWT A;  1W70 A;  4ZNX A;  3RNJ A;  1WA7 A;  2X3X D;  4LN2 A;  4JPB W;  4HVW A;  2JT4 A;  1UUE A;  3LH5 A;  2GTJ A;  2PZ1 A;  2DL8 A;  1X43 A;  2EKH A;  1HD3 A;  1UJY A;  1X69 A;  4K11 A;  2FG0 A;  5IHK A;  1OOT A;  3H0H A;  1NLO C;  2HEQ A;  2I0N A;  1GCQ C;  5IXB A;  2YT6 A;  1UGV A;  2KYM A;  2IIM A;  1JXO A;  2GQI A;  2F2W A;  2CH4 A;  3R6N A;  2JS0 A;  3O5Z A;  4AFQ C;  4RUG A;  3UF4 A;  2VKN A;  4WCI A;  3REB B;  1M3B A;  1Z9Z A;  3IQL A;  3TSZ A;  4EIK A;  2G6F X;  3NGP A;  4CC2 A;  1YWO A;  4J9H A;  3JV3 A;  2RQT A;  4J9E A;  2SEM A;  3REA B;  5L23 A;  4JZ4 A;  2CUD A;  4CC4 B;  4JJD A;  1Y0M A;  2RQU A;  1I0C A;  2OJ2 A;  3EGU A;  4GBQ A;  2C0I A;  2A37 A;  2KE9 A;  1VYU A;  1WXU A;  2RF0 A;  3A98 A;  1B07 A;  4DEX A;  4RTU A;  1X6B A;  2PTK A;  1CKB A;  4RTZ A;  1AWJ A;  1H8K A;  2O9S A;  2MOX A;  2XMF A;  1MUZ A;  1G2B A;  2DYB A;  2FEI A;  2RQV A;  1GCQ A;  2HBW A;  2K7A A;  4R0K A;  2M0Y A;  2ED1 A;  1QKX A;  2L2P A;  2E5K A;  4AFU C;  5FWB A;  1ZUU A;  2ESW A;  4ESR A;  2D8J A;  2HCK A;  2P4R A;  2H8H A;  1TUD A;  1N5Z A;  3NHN A;  4RTX A;  1J3T A;  2ROT A;  3VS5 A;  3PE0 A;  4OMQ A;  1UE9 A;  2A36 A;  1JO8 A;  3I9Q A;  2O9V A;  1K0S A;  1GFD A;  5IH2 A;  5FW9 A;  2EGC A;  2GGR A;  2JMC A;  2A08 A;  3UA6 A;  1GCP A;  2SRC A;  2DL3 A;  3I5R A;  4J9G A;  1HJD A;  1WXT A;  1WIE A;  2CSI A;  2DX1 A;  2KYB A;  1UTI A;  1Y57 A;  2ABL A;  4F17 A;  4LNP A;  2D0N A;  2BZ8 A;  2AZV A;  4RTW A;  5HCK A;  4Z88 A;  2YUN A;  2KEA A;  1K1Z A;  3M0U A;  3M0T A;  3VS6 A;  1YP5 A;  2RPN A;  1BK2 A;  1SSH A;  4J9I A;  2BZY A;  1W1F A;  1OPL A;  1KFZ A;  1I1J A;  2GNC A;  1M27 C;  2KT8 A;  4DEY A;  3NPF A;  4OML A;  2A28 A;  3EHR A;  2JTE A;  4OMN A;  2LJ0 A;  1KIK A;  1QWF A;  1GL5 A;  2KRN A;  2VVK A;  4AFZ C;  4HCK A;  2KRS A;  2LQN A;  2MCN A;  3RBB B;  3SEM A;  4JZ3 A;  1PHT A;  2V1R A;  1ZX6 A;  4CC7 A;  1SPK A;  2EYX A;  4GLM A;  1MV0 B;  1V1C A;  4Y92 A;  4Z8A A;  2ED0 A;  1X27 A;  2L3P A;  1AWW A;  2YUP A;  4X1V A;  1VA7 A;  2RQW A;  1YN8 A;  2C0O A;  2JW4 A;  1M3A A;  1NLP C;  2EBP A;  2JS2 A;  2DBK A;  4AG2 C;  4J9C A;  2K6D A;  2NUZ A;  1WLP B;  2K2M A;  1XOV A;  2DF6 A;  1AD5 A;  1UHF A;  1H3H A;  2FO0 A;  2YDL A;  1LCK A;  1UJ0 A;  2EYY A;  1T3L A;  2M51 A;  2LQW A;  3UAT A;  1BBZ A;  1PKS A;  2KGT A;  2L0A A;  3SHW A;  1QLY A;  2RQR A;  2FPF A;  4A63 B;  2L3S A;  2FPE A;  1NYF A;  3FJ5 A;  1Z9Q A;  1BU1 A;  4JJC A;  3U23 A;  1FMK A;  2DRM A;  1UEC A;  2MIO A;  1KSW A;  5IHI A;  1AOJ A;  2BTT A;  1AVZ C;  2NWM A;  2EVR A;  1BB9 A;  2DE0 X;  3I35 A;  3H0F A;  1NYG A;  2KR3 A;  1I07 A;  1WX6 A;  2EGA A;  3TVT A;  1PNJ A;  2J6F A;  1M30 A;  2CH4 W;  4QT7 A;  2DJQ A;  2O88 A;  4IIO A;  2RNA A;  1NG2 A;  1X2K A;  2K79 A;  5FWC A;  4JJB A;  2GBQ A;  5EC7 A;  2DLP A;  1JEG A;  1PRM C;  2YUO A;  2J6O A;  2JM9 A;  2KXC A;  1NEG A;  2ROL A;  4J9B A;  1PKT A;  2HSP A;  3EG2 A;  1QKW A;  2AZS A;  2W0Z A;  5GJV B;  1ABO A;  1RI9 A;  2VWF A;  1JU5 C;  2K9G A;  3QWY A;  2J7I A;  2LNH B;  2RN8 A;  1EFN A;  2KXD A;  3VRZ A;  2OAW A;  1AWX A;  1G83 A;  2QDL A;  1CKA A;  1ZSG A;  2W10 A;  3NMZ C;  2AKL A;  4F14 A;  5ECA A;  1AZE A;  1OPK A;  2CUB A;  2DRK A;  4Z89 A;  2LMJ A;  1K0X A;  1U06 A;  3ZL7 C;  1WI7 A;  1UDL A;  1WYX A;  2CSQ A;  5GJW B;  1VYT A;  3GBQ A;  1SRM A;  1SEM A;  2DL5 A;  1A0N B;  2DA9 A;  1K9A A;  3M0P A;  1AZG B;  4D8D A;  3VS2 A;  1RLP C;  4LUE A;  2ECZ A;  3H41 A;  2FRW A;  1JXM A;  2LP5 A;  1WXB A;  2D1X A;  2EW3 A;  5I22 A;  2DNU A;  2CT3 A;  1GBR A;  2YSQ A;  1YWP A;  2KRO A;  1ZLM A;  3EG3 A;  1M3C A;  4D8K A;  1T0J A;  1OV3 A;  2CRE A;  2HDA A;  3VS1 A;  1VYV A;  2LZ6 B;  4CC3 A;  1GFC A;  2CT4 A;  1WDX A;  2KT1 A;  1SHF A;  2J6K A;  2O31 A;  4IIM A;  1TG0 A;  2YUQ A;  1K76 A;  5I11 A;  2BZX A;  2LJ1 A;  4OMM A;  2EYW A;  1KJW A;  3C0C A;  4RTY A;  3VS7 A;  2EGE A;  2KNB B;  2K3B A;  1QCF A;  4OMP A;  2FPD A;  2DIL A;  4LE9 A;  4HXJ A;  2DBM A;  2DM1 A;  4HVU A;  2F2X A;  2O2O A;  1ABQ A;  2EYZ A;  1MV3 A;  2X3W D;  3CQT A;  2JM8 A;  1ZUK A;  3M0S A;  2JMA A;  2EQI A;  2EPD A;  1UHC A;  4AG1 C;  2DVJ A;  1W6X A;  1GRI A;  3EHQ A;  1ZBJ A;  3I5S A;  2LCS A;  4F16 A;  1RUW A;  4OMO A;  1K4U S;  1E6H A;  3EG1 A;  2GTO A;  2V1Q A;  1PRL C;  2F2V A;  4J9D A;  3TSW A;  2L3Q A;  2LJ3 A;  4FSS A;  2RMO A;  5IHN A;  3VRY A;  1AWO A;  1M8M A;  1OEB A;  2C0T A;  3M0R A;  4AFS C;  3VS3 A;  1SRL A;  1U3O A;  4RTT A;  2B86 A;  2J05 A;  3UA7 A;  3QWX X;  1NEB A;  2FRY A;  3PVL A;  1YCS B;  1CSK A;  1QWE A;  1HSQ A;  2DMO A;  3PVQ A;  4HVV A;  2LX7 A;  2J06 A;  2KBT A;  3THK A;  3VS4 A;  1IO6 A;  1H92 A;  1U5S A;  2OI3 A;  4LUD A;  1UG1 A;  1X2Q A;  2DL4 A;  4J9F A;  3EG0 A;  4RTV A;  2AKK A;  1YNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...