1WDXA

Yeast bbc1 sh3 domain, triclinic crystal form
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
PEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Yeast BBC1 SH3 domain, triclinic crystal form
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Myosin tail region-interacting protein MTI1
total genus 14
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wdxA00
3PVQA 1ZUKA 1AWXA 3JV3A 2LQNA 1LCKA 4DEXA 4CC2A 3NPFA 3VS0A 1UG1A 1ARKA 1ABOA 3RBBB 3FJ5A 2M51A 2FG0A 2KNBB 2V1RA 2IIMA 2EYZA 4J9HA 1CKAA 4IIMA 1X6BA 1K1ZA 3REBB 2CH4A 2FPEA 2F2WA 5FWBA 1PWTA 1K76A 3KFVA 3UA7A 2PNIA 4Z89A 5L23A 2DA9A 2JMAA 2ECZA 2HEQA 1E7OA 2EYXA 1QKWA 1VYVA 1RLPC 2EPDA 2FRWA 2O88A 1GCPA 2K2MA 1WI7A 1AEYA 4JZ4A 3VRZA 1WXUA 2JTEA 2FPDA 3EG3A 2K7AA 1M3BA 2VVKA 2BZXA 1UECA 4JJCA 1SPKA 2DM1A 2O2OA 2DBKA 2SEMA 2A08A 2A28A 1J3TA 2XMFA 2YUNA 2KYMA 3EG1A 4HVUA 1W70A 1CSKA 2O31A 2CT4A 3VRYA 1FYNA 4LNPA 2JM9A 4K11A 1M8MA 2OJ2A 4EIKA 2BTTA 1B3QA 1W6XA 2KGTA 2DX1A 4AG2C 4J9BA 4JZ3A 2O9SA 2OAWA 5IXBA 2K9GA 2GNCA 2JM8A 2DRMA 1KJWA 2DRKA 1OOTA 1PHTA 4RTVA 1I07A 5IHNA 3VS7A 1VYUA 1YNZA 1FMKA 1I1JA 4X1VA 2BZ8A 2AKLA 2CUDA 1WXBA 1U5SA 4HVWA 2J06A 4AFZC 4J9GA 2F2XA 2JS2A 4RTTA 3UATA 2FRYA 3EHRA 1MV0B 2KBTA 4CC7A 4LUDA 2D0NA 2ED1A 1OEBA 2JT4A 1E6GA 1AZGB 1WX6A 2VWFA 3QWXX 2HSPA 1Y0MA 1Y57A 1UE9A 4JJDA 1UJ0A 2DF6A 2EYWA 3PVLA 2D8HA 1H3HA 3NHNA 1ZUYA 2DMOA 2RN8A 4Y92A 2YUQA 4RUGA 1G83A 3PE0A 2LMJA 1BK2A 2LZ6B 2GTOA 2L2PA 3THKA 3VS1A 5GJWB 2C0TA 4F14A 4WCIA 1WIEA 3ULRB 1M27C 2KE9A 5I11A 1QWFA 2CUBA 4CC4B 2KYBA 1G2BA 2KXCA 4M4ZA 1XOVA 4RTWA 3RNJA 5IH2A 4ZNXA 1PKTA 2M0YA 4OMMA 2DE0X 2DNUA 2SRCA 2EGCA 3M0QA 3VS6A 2YUPA 3M0RA 1AWJA 1HJDA 3UF4A 2HDAA 2GQIA 5EC7A 2DVJA 2LJ3A 4E6RA 4RTUA 3U23A 1EFNA 2KT8A 2PTKA 1X43A 2V1QA 2W0ZA 5HCKA 2EQIA 3UA6A 2LJ1A 1CKBA 2E5KA 2VKNA 2O9VA 4OMQA 1QWEA 4HVVA 1ZX6A 1U3OA 1ZUUA 4D8KA 2DL4A 3H0HA 2KRNA 4FSSA 4GLMA 1IO6A 3ZL7C 5IXFA 2ABLA 1T3SA 3NGPA 1I0CA 1JXMA 1PRMC 1BU1A 2FEIA 2RPNA 4OMOA 2RQRA 1UHCA 4QT7A 2KT1A 1NEBA 1KSWA 1H92A 1SRMA 2MCNA 1ZSGA 1X6GA 1M3AA 2KXDA 3R6NA 1AOJA 1U06A 2W10A 4RTXA 2K3BA 2DBMA 2CREA 1M3CA 3LH5A 1UUEA 2KEAA 1KFZA 1X27A 3O5ZA 4LE9A 4CC3A 2J6KA 4KRTA 5GJVB 3I35A 3VS5A 2EYYA 3GBQA 1OPKA 1QLYA 4HXJA 1ZLMA 2CDTA 2FPFA 1GRIA 3QWYA 1GCQA 1YP5A 1Z9ZA 2MOXA 2EW3A 5ECAA 3TSWA 1AD5A 2L3QA 4HCKA 1AVZC 4IIOA 4AFQC 2RNAA 1AWOA 2LQWA 4J9CA 3I5RA 1GCQC 3M0TA 1H8KA 1X2QA 1YCSB 4OMNA 1RI9A 1K9AA 2PZ1A 1UFFA 1MUZA 1WYXA 2DJQA 2LCSA 3REAB 3A98A 3TVTA 2NUZA 1GBQA 4R0KA 2GTJA 4OMLA 1JO8A 4F17A 1HSQA 1KIKA 2LX7A 1OPLA 1T0JA 1GBRA 2ROTA 1MV3A 4LUEA 1T0HA 3NMZC 1NEGA 1YN8A 2ENMA 1QKXA 1UGVA 1JXOA 2JW4A 1TUDA 4OMPA 4RTYA 4Z8AA 1NYFA 1SHFA 1X2KA 3TSZA 1UTIA 1NG2A 5FWCA 1TG0A 1UHFA 2H8HA 2CT3A 2J05A 4J9FA 2RQTA 2CSIA 4AG1C 1OV3A 2L0AA 1GFDA 2J6FA 2HBWA 2YSQA 1S1NA 2GBQA 3VS4A 1ABQA 2DL3A 3M0UA 2DILA 2K6DA 1K4US 2KR3A 3SEMA 1SEMA 2K79A 1WDXA 1NYGA 2DL7A 3M0PA 1UJYA 1WA7A 4LN2A 3VS2A 2KRMA 2AZSA 4J9DA 4J9EA 1RUWA 1NM7A 4Z88A 4J9IA 2CSQA 3IQLA 3VS3A 2HCKA 2DL5A 1E6HA 2RF0A 4F16A 1GFCA 1A0NB 2RQWA 1V1CA 2NWMA 1PKSA 2LJ0A 2J7IA 1PNJA 2AZVA 2FO0A 1K0SA 2RQVA 3H0IA 1VA7A 1T3LA 2A37A 2EVRA 2JMCA 2GGRA 1VYTA 4JJBA 2D8JA 3H41A 2LNHB 2J6OA 2G6FX 3CQTA 1PRLC 1HD3A 2DYBA 4AFSC 3SHWA 1JU5C 3I9QA 1WFWA 2EGEA 2MIOA 1W1FA 2DL8A 2D1XA 2YT6A 5IHIA 2BZYA 1Z9QA 2P4RA 5IHKA 1YWPA 4D8DA 2YUOA 2RMOA 1ZBJA 4AFUC 2AK5A 2C0OA 3EGUA 1BBZA 2EGAA 1M30A 4RTZA 1X69A 2EKHA 2B86A 2I0NA 2X3XD 2ROLA 5FW9A 4A63B 1SSHA 2ESWA 1BB9A 3C0CA 4ORZA 3EG0A 4JPBW 1SRLA 1YWOA 4DEYA 2KROA 2RQUA 1WLPB 2CH4W 1JQQA 2L3SA 3H0FA 4ESRA 2DLPA 3EG2A 2F2VA 1TUCA 1QCFA 1K0XA 1JEGA 2YDLA 1B07A 2JS0A 2KRSA 2X3WD 1GL5A 3I5SA 2LP5A 1NLOC 3M0SA 1SHGA 2AKKA 1UDLA 2JXBA 1RLQC 1WXTA 3EHQA 2C0IA 2EBPA 2A36A 1NLPC 2QDLA 1AZEA 2OI3A 1N5ZA 2ED0A 4GBQA 1AWWA 2L3PA 5I22A
chains in the Genus database with same CATH superfamily
1Q86C 3PVQA 4HCZA 2PU9B 1Q95G 3MP1A 3VS0A 5FU6B 3S3NA 2FZCB 4OGEA 3FJ5A 1M1KR 2FG0A 3RESA 2V1RA 2IIMA 4OB1B 3LLRA 3M57A 4J9HA 2G3RA 1OX9A 3REBB 2CH4A 2F69A 2LQ8A 3CCLT 2PNIA 4RCCA 4LD6A 4XK8E 3JB9F 3MEWA 2E41A 2EJ9A 1SF9A 2L3RA 2ECZA 3URGA 3QBYA 3L2WA 1VYVA 3TU4K 3CMAT 3FLGA 2FVUA 1GCPA 2LQKA 5D6YA 2O88A 1WI7A 2LT4A 4HT8A 1M1FA 2RI5A 3J80E 1M1KU 2X9HA 3NFCA 1K73R 1WJSA 2OAUA 3RKXA 2CT4A 5CVIA 3V7RA 1EIFA 2A3LA 4E7IA 3UT1A 2OJ2A 3FRNA 4EIKA 1WQ7A 1W6XA 4E7ZA 3A8MB 4JZ3A 3P8DA 2OAWA 4BY6B 1EZZB 1Y96B 5IXBA 1QCNA 1TSFA 2JM8A 2GQVA 4X34A 1KJWA 2DRKA 1OOTA 2LX9A 3UWNA 1PSEA 2EJFA 3HTRA 5IHNA 5AT1B 3OW2S 1K8AR 4Z02A 2OTJQ 1RI0A 2CUDA 1B34B 3G4SQ 1W2BS 4HVWA 1RADB 2JS2A 3GNFB 4P5NA 4II1A 2FRYA 1K73U 2DD5A 2D0NA 3BW1A 3QWXX 2HSPA 5CK9A 4RKUE 1Y0MA 1PSFA 3F70A 1UJ0A 4KH0B 2E6ZA 3NTHA 3PVLA 4KGVB 4C92B 4PNOA 1WHLA 3OYNA 4BE0A 3JCMX 1VQ9Q 2HL5C 4PLIA 4RUGA 3JCMd 1BK2A 4XU0A 3THKA 1LPLA 2RD1A 5GJWB 4WCIA 3LH0A 4NOYA 1KHIA 2D9TA 2KE9A 3G4SA 4R55A 1YFNA 2XDBA 4CC4B 2KYBA 2KXCA 2M0YA 2DE0X 2SRCA 5LJ3e 3VS6A 2X4WA 3CC7A 4Y91A 4PJOA 3JCMf 4C8QC 4MZPA 1VQLQ 2DTHA 2VGNA 2KT8A 3G1JA 3M55A 5HCKA 3RMSA 3EFRA 2VKNA 1YITA 3QSUA 1U3OA 4FL6A 3UPUA 1N9SA 2PUKB 4HCBA 2QEXT 2MWOA 2QK0A 5J3BA 4GLMA 1KG1A 2E64A 3ZL7C 2R57A 2ABLA 1VQ7T 4ELZC 2FEIA 2DIGA 5LJ3f 2RQRA 4X9CA 3CPWA 3JCMg 5A0DA 3CCUT 3S3MA 2XKOC 1YI2T 2EQUA 1SRMA 3G6EQ 5C0MA 3HL8A 3JSCA 1D0YA 1UB4A 4J6WA 1FWZA 3CC2Q 2I2LA 4RTXA 2K3BA 5KYYA 1SKUB 5FU6C 4XU1A 2DBMA 4JS4A 3CPWS 2DD4A 4FSXA 3MCAB 4LE9A 5GJVB 2PVDB 3I35A 2QTVA 1HXDA 4FW2A 1C6VX 3OYHA 4EMHA 5CKEA 4AT1B 1UGQB 4FYVB 4HXJA 3L2VA 3A8OB 5I2MA 2FPFA 4M75D 5KE2A 1C0MA 2NLUA 1Z9ZA 2MOXA 2WSEE 1QP3A 3OBYA 1ACMB 4C92E 8AT1B 3INZA 3G6EA 3QUIA 4EMKC 5GAMj 4AFQC 3CC2A 3C4SA 2MMPA 4M77G 1GCQC 4FYYB 4M77A 5DLOA 1NBEB 1RI9A 1K9AA 1WYXA 3DLLA 2DJQA 1YJWQ 2NUZA 1YI2Q 3CCJA 1JO8A 1KIKA 3LWIA 1NEGA 1YN8A 2ENMA 3OW2A 4LDVA 4WTOB 1JXOA 1TUDA 4OMPA 4YTLA 3BFMA 2CP0A 4LD9K 1UTIA 5FWCA 3E9GA 2K4YA 1IXDA 3OW2P 2CT3A 2EJGA 2QTXA 3C95A 1W2BA 2KDSA 1JB0E 2J6FA 3P8BB 4KBMB 2GBQA 3VS4A 1I4K1 2V26A 3VYGA 3PMIA 2XDDA 4M7DB 2M02A 5CO7A 2KR3A 1VQ8A 1SEMA 1WHGA 3FEOA 1WA7A 2X4YA 5IT9E 3PIOA 1BI1A 1M2VA 2AZSA 4J9DA 1VIFA 4KH1B 3M54A 1BI0A 1LOJA 1WQWA 4Z88A 4J9IA 2RHYA 5LJ5d 5L8RE 3JCMb 1OU9A 3ZBDA 4E7SA 4BACA 2RF0A 3BDUA 2RQWA 4JJNK 1YJ9A 1PKSA 1IGQA 2J7IA 2ZPFB 5GAN2 2AZVA 2A37A 4M75E 5GANf 2ZAEA 4E7LA 1YJNT 3MPUB 3G4ST 3CQTA 4TVRA 4X9DA 1JU5C 2RHIA 1O75A 2DFUA 1ZSZB 4JLGA 3JCMP 4PK4A 1W1FA 2JZ2A 2L5QA 3I55A 2PUOB 2V8KA 5IHIA 4PL6A 5IHKA 4M75C 1ZBJA 2AK5A 3OSVA 5GANj 4OB3B 2EGAA 2VV5A 3EGDA 1GXIE 4B9XA 3JCMe 4BI3A 2ROLA 1D09B 1SSHA 4M78A 1IREB 2K2VA 1IHWA 1SRLA 4DEYA 1PC0A 2DJZA 1WLPB 2CH4W 3EG9A 3CXCP 3EG2A 2RK1A 1TUCA 2PQWA 1K0XA 4C92G 1JEGA 1YITQ 1B07A 4C8QE 3JRZA 2KRSA 2QI2A 3HKSA 3I5SA 4HCCA 4DOWA 2HQEA 2RHZA 1U8RA 4NL2A 1FXXA 3HP9A 5GAOq 1UDLA 2JXBA 1RLQC 2EKOA 1WXTA 4A4HA 1N8RC 2C0IA 4XTZA 1NLPC 4C5IA 3V8JA 2ED0A 1Q82R 4M77B 2XK0A 2DKGA 5KYWA 3S6WA 3JV3A 3CBMA 1NPRA 4JLIA 4FT4A 1G5VA 2MWPA 4C8QD 5GAMe 3PNWC 4JRQA 3SFMA 4IIMA 2ZPGB 4M7DD 1QVGA 1M90C 5FWBA 1K76A 1VQKT 2IPOB 4IURA 3VUBA 2X51A 2E3HA 2WSFE 2XHCA 2MPXC 1N6AA 4WF2A 2HEQA 3QZ9B 3SD4A 1R8OB 1M1GA 4MZTA 2DPPB 3T9NA 2EPDA 3FJPA 2K2MA 4JZ4A 3SDZA 1KQSS 3VRZA 3S3OA 3EGXA 4PFZA 3C94A 1WHMA 2YWWA 1M3BA 3CMEQ 3CBPA 3VUZA 2VVKA 1UECA 1SPKA 1J3TA 2A08A 2A28A 2YUNA 3EG1A 2DZCA 3QG1A 1BIAA 1CSKA 1M1KC 1W2BP 1G3SA 2QG9B 1VQNA 2HAXA 1B3QA 2KGTA 1S72T 2NUPB 2K3YA 3OS5A 2O9SA 3EH1A 4ZGDB 3GLXA 2E65A 2K9GA 2L89A 4FM4B 1BCMA 4M77F 4NS5A 2OTJT 5CAIA 3MKDA 3E1SA 2NUTA 3VS7A 3ME9A 1YNZA 2KAFA 1NPPA 4IUQA 3HRTA 2NYSA 3OS0A 2J06A 4J9GA 5GMKm 4KUIA 2QYZA 2ZPIB 2DEQA 1M90R 1OEBA 1D3BA 1E6GA 1KC8C 1OU8A 4HT9A 1KHCA 1SG5A 3AHUA 2JJ9A 4M77E 2D8HA 1H3HA 2DMOA 2COYA 2YRDA 2YUQA 3QJ6A 2AIRB 5I21A 4FW1A 1G83A 3HFNA 2LMJA 2LZ6B 2OTLA 3GIBA 2CKKA 1WNLA 4M78B 4PJOC 1WIEA 3QYGB 5I2SA 3CCEA 1RAHB 3CCVT 3OYMA 4M4ZA 1XOVA 4OMMA 2MAMA 2DNUA 5CQXA 3G7ZA 2WACA 3M0QA 3CMAQ 5KYXB 4OB0B 3UF4A 2HDAA 2GQIA 2LJ3A 2RJFA 3EFOB 2ZGWA 3A8HB 4QQGA 1EFNA 4XQ3A 1X43A 2LJ1A 3CCST 4C5HA 2COZA 3TCJA 5J26A 4ZN1A 2O9VA 1Q7YC 4O5VA 5IN1A 1VQNT 3WVDB 3CPWP 3H0HA 2JN0A 3HHTB 4EMGA 4EDUA 3CCVQ 2YRCA 3E9FA 3NGPA 1YI2A 7AT1B 3HSBA 2RPNA 4M7AB 2ATCB 4C92A 3OQ5A 1UHCA 2KT1A 5GAMh 2DXBA 1H92A 3KBGA 4LDUA 2EYQA 2K57A 3OA6A 9ATCB 2LDMA 1D0ZA 3BY7A 3PTAA 1QMCA 5CKBA 3RKWA 3OSSC 1Q81C 2QAZA 4KRTA 3VS5A 4DQ2A 3RIRA 1NJIU 2EYYA 4PJOB 3JB9H 2LRQA 1NE8A 2FYKA 4E7JA 3QWYA 1QVFA 2CYZB 2F5KA 3RMQA 3TREA 4D6WA 1MMAA 5GAN5 2EW3A 3TSWA 2D0QB 2CZ1B 1AVZC 5J39A 2RJEA 4J9CA 4M78E 3O8VA 2KK4A 1X2QA 4OMNA 4DBRA 2PZ1A 1UFFA 3CCQA 1NJIR 2QQAA 4A4EA 4A4GA 2LCSA 3QZ5B 2DXCA 3M5AA 1VUBA 2FB7A 3PT9A 5KCHA 2LX7A 2P4TA 4J5YA 8ATCB 1WJRA 5HY6A 4PFPA 1QKXA 1V29B 4RTYA 1Y7XA 1RAFB 1NYFA 1YITT 1OI1A 1ZSZC 5A2QE 4CI0C 1MNEA 3TSZA 3GPLA 4E2FB 4ZTFA 1TG0A 2K5IA 2DXUA 3CMEA 3HPWA 4F7UB 2AT1B 3OYIA 1VQKQ 1V76A 2L0AA 4KGXB 3G71Q 4E7HA 3A5ZB 3V8KA 3NTIA 2YSQA 2OX7A 3FIFA 2VC8A 5LJ5e 1QVPA 3M0UA 4M7AE 2O4XB 2K6DA 1VQNQ 4XAXB 3P8HA 2E6NA 1K9MR 2DXTA 2DL7A 3VS2A 1G8XA 1R0CB 2KRMA 3R6OA 4PLLA 3SWNC 4BDZA 3VKIA 3MP6A 4OMFB 4J9EA 4M7AG 3M53A 5LJ5g 5A0LA 4N4IA 2YHTA 1M2VB 1LNXA 1UGPB 3VU3C 5AYFA 4F04B 1Q82C 1WGSA 3ASKA 1PCXA 1VQ5Q 4CRIA 4MMKA 4JDSA 1VQLA 2RJCA 1K0SA 3OYBA 1Q86U 2OTLT 2JMCA 1VYTA 2LNHB 1QVGS 1PRLC 1K9MU 3OYGA 3QIIA 2MIOA 2E10A 2D1XA 3MO8A 2P4RA 2PVGB 3JB9I 2RMOA 3CC7T 4AFUC 2RB6A 2DTIA 3GOXA 4IKFA 2QQ9A 2JNGA 4OVAA 2C0OA 2EQJA 3EGUA 4RTZA 4IUVA 2YXYA 1X69A 1BYMA 4QW2A 1X6OA 2K3XA 5KYNA 2GFAA 2ZPHB 4JPBW 1YWOA 2BIVA 2LCCA 1KD1U 3HFOA 4ESRA 2CS7A 2F2VA 4EPCA 4QQDA 2XIDA 4RCBA 3LGLA 1BKBA 4C8QF 3PFSA 1UEBA 1U1TA 2LP5A 4PJMA 1IHVA 4M7DE 1NLOC 2XG8D 2Y90A 2D6FA 3M0SA 4JRIA 2AKKA 2X35A 4PFOA 3EHQA 1X75C 2A36A 1AZEA 4XTXA 2R58A 4L5GA 4M7AF 1N5ZA 3N5BB 3Q1JA 5GAOl 3JCMW 4ZTJA 1AWXA 1B34A 3DB3A 4QVCA 4FYWB 3NPFA 3CBOA 4GY5A 2RA2A 1ARKA 1ABOA 3RBBB 3SWNB 2M51A 5CKFA 2LT1A 5KYWB 3BE3A 4M75B 1PD1A 3HRSA 3RDVA 2F1LA 1X6BA 1YJ9T 2FPEA 2F2WA 3OYKA 5D6XA 1IZ6A 3KFVA 3UA7A 4Z89A 2M1HA 1VQPA 2JMAA 1ZHIA 1QKWA 2RHUA 1QCOA 2KSSA 1RLPC 4A54A 3MP8A 2FRWA 1JBMA 4MZMA 3M58A 2JTEA 4JUVA 2FPDA 4C0GA 4AMCA 5IAYA 2K7AA 1BI3A 2ZPBB 2BE9B 4OF1A 2DM1A 2O2OA 5GMKl 1OYXA 2DBKA 3L2ZA 2XMFA 3JCMh 2DIQA 3QDFA 1QW1A 4PJLA 2V8JA 4PJOD 3X28B 2VXFA 1MMDA 2O31A 3VRYA 1FYNA 2JM9A 1S72A 4K11A 1X01A 2BTTA 1M9SA 5HK0A 5KH6A 2DX1A 4PKCC 3LGFA 4AG2C 4J9BA 3RUXA 4GLKA 4PJOF 1I5LA 2RI2A 2DRMA 3A1PA 2QXFA 3G71T 1PHTA 4RTVA 2LCLA 2EIFA 1VYUA 2RI3A 3EFSA 2BUDA 3OY9A 1I1JA 5LJ5f 2H3EB 4X1VA 1YJ9Q 3META 5KYUA 2ZCFB 2JOYA 2NUTB 1DJ7B 4RTTA 1ZQ1A 5GAOp 3EHRA 1U1SA 3OYCA 1MV0B 5GAN3 2KBTA 4J7FA 2V8IA 1VQ4T 2ED1A 2QASA 4UC4A 5GMKi 1AZGB 1WX6A 3CC4Q 1UE9A 4JJDA 2EFIA 1PG5B 4ME7A 2EYWA 4M78G 2KVQG 1IB8A 3NHNA 1WHJA 4Y92A 1VQMQ 3PE0A 2GTOA 2L2PA 2DZ9A 1M4ZA 3G6ET 3RKYA 4F14A 3CCUQ 1M27C 4Y28E 5I11A 2HD0A 3M59A 1VQ7Q 1I5OB 5LJ3d 3RNJA 3A8GB 5EG2A 2ZPEB 3JCMV 2EGCA 1RABB 2YUPA 3M0RA 1AWJA 4N4HA 1HJDA 1YCYA 4ZGJB 3CMAA 2DVJA 4E6RA 2PTKA 1D0XA 3ER0A 2W0ZA 5A0GA 2E5QA 2EQIA 3UA6A 3DKMA 3QDRB 3VJPA 2E5KA 4M7AD 1JJ2P 4HVVA 1ZUUA 3X25B 1MNDA 4ELYC 5GMKh 1TUGB 4D8KA 3OS1A 2DL4A 3A8LB 2KRNA 4FSSA 1D3BB 3CC7Q 4BE1A 5HKCA 2KQWA 3FDRA 1HK9A 1I0CA 3JB9D 4OMOA 3FB9A 1KSWA 4OB2B 2RM4A 1ZSGA 3V7SA 4JS5A 1M3AA 2KXDA 1YIJQ 1U06A 2R5MA 2OTLQ 4ZN3A 4PJNA 2CREA 3MEUA 1M3CA 1UUEA 2KEAA 2FHDA 1KFZA 5D6WA 3O5ZA 1VQ4A 4CC3A 4N0AA 4A4KA 3GBQA 1BIBA 4O6JA 5DM7R 1YJWT 4EMKA 1QLYA 3EFOA 3OBWA 2E70A 3CCLQ 4BD3A 1GCQA 2K5FA 4IUPA 1YP5A 5GAN6 4BI4A 4N0AC 4ANJA 1JJ2A 5GAN7 1G3WA 5M9OA 5ECAA 1AD5A 3CCRA 1K8AC 4RG8A 2BKDN 4HCKA 4IIOA 1AWOA 1TU0B 4XU3A 2CP6A 5LJ5j 1QVGP 1KQ2A 2YLBA 1YIJT 3GP8A 3H8ZA 4C5EA 4M7AA 3REAB 5FRNA 1ZSZA 4R0KA 2FZGB 4OMLA 1VQ8Q 1HSQA 1K8AU 2QA4A 2DVEA 1VQPQ 1GBRA 1WHKA 2ROTA 1TTHB 5DLQE 1T0HA 3NMZC 3CCRQ 1I8FA 2JW4A 1XNIA 4OGCA 1SHFA 4L59A 4M75G 1UHFA 2HL3A 1WHHA 3AT1B 6AT1B 2YLCA 3BDLA 3OYAA 1D1AA 2RQTA 4XTVA 2CSIA 1VQ7A 1OV3A 1OX8A 1GFDA 4XU2A 3PGGA 5GAMf 4F7UA 2E4HA 1XQHA 3G71A 4BUGA 2DL3A 3OYJA 2QEXQ 2DTOA 4LDXA 1S72Q 4BB7A 3L1AA 2H3JA 3I55Q 4ZGEB 3M9QA 1TS9A 3I56A 2Y4YA 4MMLA 2LC4A 4DBHA 4HKEA 4FCYA 1NM7A 2RO0A 3KUFA 1VQMT 2CSQA 3IQLA 4FT2A 1RACB 3EAEA 1N9RA 2ZZDA 1WZOA 4QVZA 2MYSA 1E6HA 1MMNA 2LTOA 4M7DF 1GFCA 1A0NB 1V1CA 4JRPA 2NWMA 3CCRT 1YHQQ 2M16A 5C6SA 4M75F 1KC8U 3OYYA 2FO0A 2RQVA 1R77A 3H0IA 1VA7A 2GGRA 4JJBA 3CCET 4XTWA 2J6OA 4C92F 2DYBA 4AFSC 1AHJB 3SHWA 1YIJA 2HNIA 2DL8A 4M78C 2YT6A 1YBYA 1FMWA 1MMGA 1Z9QA 1M90U 3I56Q 4DA4A 2YUOA 1ZA1B 4L6V5 2MI6A 2M9UA 1M30A 4BI8B 3CCJT 2RJDA 3RR6A 5GAOm 2EKHA 2B86A 2I0NA 2X3XD 4R56A 4KUDK 1MGQA 2GFUA 3EGXB 2ESWA 2K5LA 1BB9A 1P92A 4ORZA 1BCOA 3L2UA 1KC8R 5FU7B 4M7DC 4C8QB 2RQUA 1YHQA 1KD1C 1UGSB 3H0FA 4HA8A 4XTYA 2CP7A 4LDWA 1Y07A 5CQYA 4JRKA 5LJ5h 4C8QG 1H641 2YDLA 5KCOA 4C0DB 1Y71A 2DEUA 2KMTA 3TQ7P 1GL5A 2O01E 2FL7A 3CEYA 2XICA 2C06A 3CD6Q 1G3YA 3CXCA 4M7DA 2P84A 1SSFA 3QO3A 3X24B 2DETA 1SHGA 4J83A 2QGGA 1D1BA 2HMAA 5CIUA 3OYLA 2XI9A 2OI3A 3QHSA 1I81A 1RAEB 5LJ3j 1AWWA 4RTWA 2HQXA 4RG2A 1LJOA 5I22A 1ZUKA 1VQ9A 2LQNA 1LCKA 4DEXA 4CC2A 2VXEA 1UG1A 2XDPA 5CKDA 3UDCA 1IRXA 4BE2A 2KNBB 2EYZA 1TXQA 1KK7A 1M2OA 1XJWB 1CKAA 1Q81U 1K1ZA 5CR2A 5GAOn 2HBPA 1PWTA 3CCVA 2VUBA 3JB9G 5L23A 2DA9A 3JAME 4J8OA 1E7OA 3JB9J 4N4GA 2EYXA 2LNVA 2P0PA 3CCMT 3NTKA 1R0BG 3OMCA 2R5AA 5FRMA 2RH2A 2JTFA 1AEYA 2FZKB 1WXUA 4M78D 3EG3A 4DBFA 1XTDA 1ZBXA 4BY6C 3CCSA 5KYXA 2BZXA 4JJCA 3CCMQ 2DAQA 1VQOA 2SEMA 5GAMg 3EG9B 3X20B 1LVKA 4A53A 2KYMA 2QA4T 4HVUA 1Q81R 1W70A 4LNPA 5CCAA 2LVMA 5GMKe 1M8VA 3MHXA 1M8MA 3TEEA 1RAAB 2VB6A 3M4YA 4C0ZA 3V7CA 2GNCA 2CZ7B 3L42A 5LJ3g 1I07A 3L2RA 1FMKA 3M4GA 3ZFJA 2BZ8A 2AKLA 2QDYB 5D7UA 3PIPA 1WXBA 1U5SA 1VQOQ 4AFZC 2E3IA 2F2XA 2VASA 5DY9A 3UATA 1VIEA 2CP3A 4F7UF 2EQKA 4CC7A 2HKQB 4LUDA 4M77D 3QYHB 5KYUB 2EQMA 2JT4A 1QVFS 2VWFA 3CD6T 4J6XA 1Y57A 2Y4XA 5GAOr 2L8DA 2DF6A 1VQMA 1ZUYA 5CKHA 4XTUA 2RN8A 2B8AA 3WXMB 2A0FB 1D1CA 4VUBA 2EWNA 3VS1A 2HZYA 2C0TA 3QJYA 2DYIA 4OP0A 3ULRB 3J7AF 4C8QA 1QWFA 2CUBA 1TH7A 1G2BA 5IH2A 1UGRB 4ZNXA 1PKTA 3MEVA 4QKUA 3CCJQ 2QQBA 1NZ9A 4IUTA 4KULA 1VQ6T 4IUUA 2CGHA 4V2SA 5EC7A 2VYTA 4RTUA 3JCMQ 3U23A 2CZ6B 3CXCS 2V1QA 3J81E 4QQ6A 2GF7A 1CKBA 3CCEQ 4OMQA 2XD0A 4FU6A 1QWEA 1Q82U 1ZX6A 2NUPA 1Q86R 1ZA2B 1QVFP 3FC3A 1YHQT 1VOMA 4DOVA 1IO6A 5IXFA 2HQHA 2P0KA 1T3SA 2P0QA 4J6YA 1JXMA 3QXEB 1PRMC 1BU1A 5HK3A 3CC4A 2DO3A 2YRVA 4QT7A 1NEBA 5KYYB 5GANd 3LW5E 2MCNA 2XU8A 1X6GA 3R6NA 4QVDA 1YJNQ 4KGZB 1AOJA 3GF5A 1C1AA 2W10A 1G3TA 4ATOA 3E19A 2BE7D 2E12A 1BI2A 3LH5A 3MJXA 1X27A 1IGUA 4C92C 2VGMA 3OB9A 2J6KA 2JUFA 2O4XA 3LWHA 1KD1R 5LL6S 1Q7YU 3CD6A 3VV0A 2CP5A 1OPKA 3JCMc 3GNGA 3CCQQ 3SB2A 4LXCA 3OYEA 4KT0E 3OYDA 1FMVA 1ZLMA 2CDTA 1GRIA 4M7DG 4M77C 4PJOE 1VQLT 1OZ2A 3CCLA 3HRUA 4EMKB 3LX7A 4C92D 4M7AC 2JTMA 2L3QA 4NL3A 3H9NA 1OQKA 1HYOA 2RNAA 1RAIB 2KY9A 2LQWA 3V8LA 3I5RA 1VQPT 5GANh 3M0TA 1H8KA 1YCSB 4J7IA 2IVWA 1MUZA 1Q7YR 4A4FA 2X4JA 3A98A 3TVTA 3CCQT 1EX4A 1GBQA 1JRIA 2QA4Q 3ZEHA 2GTJA 4F17A 3DB4A 1N27A 1RAGB 1OPLA 1T0JA 1MV3A 4LUEA 1VQ5T 4RMOA 3D7SB 3M56A 1UGVA 4Z8AA 1H3ZA 2HKNA 1X2KA 2M0OA 1FX7A 1NG2A 1AT1B 2H8HA 3CCSQ 2MK5A 2J05A 4J9FA 4AG1C 2OTJA 5KE3A 2E1HA 4C0FA 3QPHA 4B6MA 5GAN4 2HBWA 3H6ZA 2EAYA 2IG0A 1S1NA 5LJ3h 4F7UE 4DBQA 1WJQA 2MF2A 1ABQA 5GANe 2DILA 1OULA 4E7KA 1K4US 3SEMA 2K79A 1WDXA 1NYGA 2CZ0B 3I56T 3M0PA 1UJYA 4LN2A 3L2QA 5FROA 1RUWA 2Z0WA 3VS3A 3WVEB 4F7UG 4MDWA 3EH2A 1Y96A 2HCKA 2QGFB 2DL5A 1VQ6Q 1OZ3A 1YJWA 4F16A 4MDXA 2LJ0A 3SWNA 5GAN8 1PNJA 1VQKA 3DLMA 1T3LA 4M75A 2EVRA 3CC2T 1K73C 2D8JA 3H41A 5FU7C 2G6FX 3KXTA 1HD3A 3PMTA 1YJNA 3I9QA 5GANg 1N8RR 1QP2A 1TOVA 1WFWA 2EGEA 4BDYA 1KQ1A 2BZYA 3CCMA 3EGDB 1YWPA 4D8DA 3I55T 2A7YA 3OMGA 1VQ6A 5FLXE 2RHXA 1QQJA 2PVOB 1BBZA 2KI7A 1KQSP 4Q5WA 2HSEB 4B9WA 2DK3A 3CPFA 3OS2A 1VQ5A 2GCXA 1B7TA 2DERA 3C12A 2WSCE 5FW9A 1O9SA 4A63B 1TWBA 2QQSA 1VQOT 2F5TX 3C0CA 3EG0A 2QEXA 4M78F 3LYIA 4FIBA 2KROA 2RK2A 1JQQA 2L3SA 2AHJB 2DLPA 1QCFA 3RERA 2JVVA 2JS0A 2X4XA 1N8RU 2X3WD 3CCUA 1NJIC 4PJJA 1JJ2S 2QQRA 3CMET 1M5Q1 4PJOG 1F1BB 5GAMd 3CC4T 1W4SA 4FYXB 1PM3A 4C5GA 4C0DC 3JCMJ 1VQ4Q 3QKJA 1WPYA 4LDYA 2CP2A 3VYHB 1VQ8T 3E2UA 2COWA 2EBPA 3MEAA 2QDLA 1PD0A 4E47A 1K9MC 5GMKj 1MHNA 3X26B 1KQSA 4GBQA 1VQ9T 1RL2A 2L3PA 3OYFA
chains in the Genus database with same CATH topology
3PVQA 1ZUKA 1AWXA 3JV3A 2LQNA 1LCKA 4DEXA 4CC2A 3NPFA 3VS0A 1UG1A 1ARKA 1ABOA 3RBBB 3FJ5A 2M51A 2FG0A 2KNBB 2V1RA 2IIMA 2EYZA 4J9HA 1CKAA 4IIMA 1X6BA 1K1ZA 3REBB 2CH4A 2FPEA 2F2WA 5FWBA 1PWTA 1K76A 3KFVA 3UA7A 2PNIA 4Z89A 5L23A 2DA9A 2JMAA 2ECZA 2HEQA 1E7OA 2EYXA 1QKWA 1VYVA 1RLPC 2EPDA 2FRWA 2O88A 1GCPA 2K2MA 1WI7A 1AEYA 4JZ4A 3VRZA 1WXUA 2JTEA 2FPDA 3EG3A 2K7AA 1M3BA 2VVKA 2BZXA 1UECA 4JJCA 1SPKA 2DM1A 2O2OA 2DBKA 2SEMA 2A08A 2A28A 1J3TA 2XMFA 2YUNA 2KYMA 3EG1A 4HVUA 1W70A 1CSKA 2O31A 2CT4A 3VRYA 1FYNA 4LNPA 2JM9A 4K11A 1M8MA 2OJ2A 4EIKA 2BTTA 1B3QA 1W6XA 2KGTA 2DX1A 4AG2C 4J9BA 4JZ3A 2O9SA 2OAWA 5IXBA 2K9GA 2GNCA 2JM8A 2DRMA 1KJWA 2DRKA 1OOTA 1PHTA 4RTVA 1I07A 5IHNA 3VS7A 1VYUA 1YNZA 1FMKA 1I1JA 4X1VA 2BZ8A 2AKLA 2CUDA 1WXBA 1U5SA 4HVWA 2J06A 4AFZC 4J9GA 2F2XA 2JS2A 4RTTA 3UATA 2FRYA 3EHRA 1MV0B 2KBTA 4CC7A 4LUDA 2D0NA 2ED1A 1OEBA 2JT4A 1E6GA 1AZGB 1WX6A 2VWFA 3QWXX 2HSPA 1Y0MA 1Y57A 1UE9A 4JJDA 1UJ0A 2DF6A 2EYWA 3PVLA 2D8HA 1H3HA 3NHNA 1ZUYA 2DMOA 2RN8A 4Y92A 2YUQA 4RUGA 1G83A 3PE0A 2LMJA 1BK2A 2LZ6B 2GTOA 2L2PA 3THKA 3VS1A 5GJWB 2C0TA 4F14A 4WCIA 1WIEA 3ULRB 1M27C 2KE9A 5I11A 1QWFA 2CUBA 4CC4B 2KYBA 1G2BA 2KXCA 4M4ZA 1XOVA 4RTWA 3RNJA 5IH2A 4ZNXA 1PKTA 2M0YA 4OMMA 2DE0X 2DNUA 2SRCA 2EGCA 3M0QA 3VS6A 2YUPA 3M0RA 1AWJA 1HJDA 3UF4A 2HDAA 2GQIA 5EC7A 2DVJA 2LJ3A 4E6RA 4RTUA 3U23A 1EFNA 2KT8A 2PTKA 1X43A 2V1QA 2W0ZA 5HCKA 2EQIA 3UA6A 2LJ1A 1CKBA 2E5KA 2VKNA 2O9VA 4OMQA 1QWEA 4HVVA 1ZX6A 1U3OA 1ZUUA 4D8KA 2DL4A 3H0HA 2KRNA 4FSSA 4GLMA 1IO6A 3ZL7C 5IXFA 2ABLA 1T3SA 3NGPA 1I0CA 1JXMA 1PRMC 1BU1A 2FEIA 2RPNA 4OMOA 2RQRA 1UHCA 4QT7A 2KT1A 1NEBA 1KSWA 1H92A 1SRMA 2MCNA 1ZSGA 1X6GA 1M3AA 2KXDA 3R6NA 1AOJA 1U06A 2W10A 4RTXA 2K3BA 2DBMA 2CREA 1M3CA 3LH5A 1UUEA 2KEAA 1KFZA 1X27A 3O5ZA 4LE9A 4CC3A 2J6KA 4KRTA 5GJVB 3I35A 3VS5A 2EYYA 3GBQA 1OPKA 1QLYA 4HXJA 1ZLMA 2CDTA 2FPFA 1GRIA 3QWYA 1GCQA 1YP5A 1Z9ZA 2MOXA 2EW3A 5ECAA 3TSWA 1AD5A 2L3QA 4HCKA 1AVZC 4IIOA 4AFQC 2RNAA 1AWOA 2LQWA 4J9CA 3I5RA 1GCQC 3M0TA 1H8KA 1X2QA 1YCSB 4OMNA 1RI9A 1K9AA 2PZ1A 1UFFA 1MUZA 1WYXA 2DJQA 2LCSA 3REAB 3A98A 3TVTA 2NUZA 1GBQA 4R0KA 2GTJA 4OMLA 1JO8A 4F17A 1HSQA 1KIKA 2LX7A 1OPLA 1T0JA 1GBRA 2ROTA 1MV3A 4LUEA 1T0HA 3NMZC 1NEGA 1YN8A 2ENMA 1QKXA 1UGVA 1JXOA 2JW4A 1TUDA 4OMPA 4RTYA 4Z8AA 1NYFA 1SHFA 1X2KA 3TSZA 1UTIA 1NG2A 5FWCA 1TG0A 1UHFA 2H8HA 2CT3A 2J05A 4J9FA 2RQTA 2CSIA 4AG1C 1OV3A 2L0AA 1GFDA 2J6FA 2HBWA 2YSQA 1S1NA 2GBQA 3VS4A 1ABQA 2DL3A 3M0UA 2DILA 2K6DA 1K4US 2KR3A 3SEMA 1SEMA 2K79A 1WDXA 1NYGA 2DL7A 3M0PA 1UJYA 1WA7A 4LN2A 3VS2A 2KRMA 2AZSA 4J9DA 4J9EA 1RUWA 1NM7A 4Z88A 4J9IA 2CSQA 3IQLA 3VS3A 2HCKA 2DL5A 1E6HA 2RF0A 4F16A 1GFCA 1A0NB 2RQWA 1V1CA 2NWMA 1PKSA 2LJ0A 2J7IA 1PNJA 2AZVA 2FO0A 1K0SA 2RQVA 3H0IA 1VA7A 1T3LA 2A37A 2EVRA 2JMCA 2GGRA 1VYTA 4JJBA 2D8JA 3H41A 2LNHB 2J6OA 2G6FX 3CQTA 1PRLC 1HD3A 2DYBA 4AFSC 3SHWA 1JU5C 3I9QA 1WFWA 2EGEA 2MIOA 1W1FA 2DL8A 2D1XA 2YT6A 5IHIA 2BZYA 1Z9QA 2P4RA 5IHKA 1YWPA 4D8DA 2YUOA 2RMOA 1ZBJA 4AFUC 2AK5A 2C0OA 3EGUA 1BBZA 2EGAA 1M30A 4RTZA 1X69A 2EKHA 2B86A 2I0NA 2X3XD 2ROLA 5FW9A 4A63B 1SSHA 2ESWA 1BB9A 3C0CA 4ORZA 3EG0A 4JPBW 1SRLA 1YWOA 4DEYA 2KROA 2RQUA 1WLPB 2CH4W 1JQQA 2L3SA 3H0FA 4ESRA 2DLPA 3EG2A 2F2VA 1TUCA 1QCFA 1K0XA 1JEGA 2YDLA 1B07A 2JS0A 2KRSA 2X3WD 1GL5A 3I5SA 2LP5A 1NLOC 3M0SA 1SHGA 2AKKA 1UDLA 2JXBA 1RLQC 1WXTA 3EHQA 2C0IA 2EBPA 2A36A 1NLPC 2QDLA 1AZEA 2OI3A 1N5ZA 2ED0A 4GBQA 1AWWA 2L3PA 5I22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVQ A;  1ZUK A;  1AWX A;  3JV3 A;  2LQN A;  1LCK A;  4DEX A;  4CC2 A;  3NPF A;  3VS0 A;  1UG1 A;  1ARK A;  1ABO A;  3RBB B;  3FJ5 A;  2M51 A;  2FG0 A;  2KNB B;  2V1R A;  2IIM A;  2EYZ A;  4J9H A;  1CKA A;  4IIM A;  1X6B A;  1K1Z A;  3REB B;  2CH4 A;  2FPE A;  2F2W A;  5FWB A;  1PWT A;  1K76 A;  3KFV A;  3UA7 A;  2PNI A;  4Z89 A;  5L23 A;  2DA9 A;  2JMA A;  2ECZ A;  2HEQ A;  1E7O A;  2EYX A;  1QKW A;  1VYV A;  1RLP C;  2EPD A;  2FRW A;  2O88 A;  1GCP A;  2K2M A;  1WI7 A;  1AEY A;  4JZ4 A;  3VRZ A;  1WXU A;  2JTE A;  2FPD A;  3EG3 A;  2K7A A;  1M3B A;  2VVK A;  2BZX A;  1UEC A;  4JJC A;  1SPK A;  2DM1 A;  2O2O A;  2DBK A;  2SEM A;  2A08 A;  2A28 A;  1J3T A;  2XMF A;  2YUN A;  2KYM A;  3EG1 A;  4HVU A;  1W70 A;  1CSK A;  2O31 A;  2CT4 A;  3VRY A;  1FYN A;  4LNP A;  2JM9 A;  4K11 A;  1M8M A;  2OJ2 A;  4EIK A;  2BTT A;  1B3Q A;  1W6X A;  2KGT A;  2DX1 A;  4AG2 C;  4J9B A;  4JZ3 A;  2O9S A;  2OAW A;  5IXB A;  2K9G A;  2GNC A;  2JM8 A;  2DRM A;  1KJW A;  2DRK A;  1OOT A;  1PHT A;  4RTV A;  1I07 A;  5IHN A;  3VS7 A;  1VYU A;  1YNZ A;  1FMK A;  1I1J A;  4X1V A;  2BZ8 A;  2AKL A;  2CUD A;  1WXB A;  1U5S A;  4HVW A;  2J06 A;  4AFZ C;  4J9G A;  2F2X A;  2JS2 A;  4RTT A;  3UAT A;  2FRY A;  3EHR A;  1MV0 B;  2KBT A;  4CC7 A;  4LUD A;  2D0N A;  2ED1 A;  1OEB A;  2JT4 A;  1E6G A;  1AZG B;  1WX6 A;  2VWF A;  3QWX X;  2HSP A;  1Y0M A;  1Y57 A;  1UE9 A;  4JJD A;  1UJ0 A;  2DF6 A;  2EYW A;  3PVL A;  2D8H A;  1H3H A;  3NHN A;  1ZUY A;  2DMO A;  2RN8 A;  4Y92 A;  2YUQ A;  4RUG A;  1G83 A;  3PE0 A;  2LMJ A;  1BK2 A;  2LZ6 B;  2GTO A;  2L2P A;  3THK A;  3VS1 A;  5GJW B;  2C0T A;  4F14 A;  4WCI A;  1WIE A;  3ULR B;  1M27 C;  2KE9 A;  5I11 A;  1QWF A;  2CUB A;  4CC4 B;  2KYB A;  1G2B A;  2KXC A;  4M4Z A;  1XOV A;  4RTW A;  3RNJ A;  5IH2 A;  4ZNX A;  1PKT A;  2M0Y A;  4OMM A;  2DE0 X;  2DNU A;  2SRC A;  2EGC A;  3M0Q A;  3VS6 A;  2YUP A;  3M0R A;  1AWJ A;  1HJD A;  3UF4 A;  2HDA A;  2GQI A;  5EC7 A;  2DVJ A;  2LJ3 A;  4E6R A;  4RTU A;  3U23 A;  1EFN A;  2KT8 A;  2PTK A;  1X43 A;  2V1Q A;  2W0Z A;  5HCK A;  2EQI A;  3UA6 A;  2LJ1 A;  1CKB A;  2E5K A;  2VKN A;  2O9V A;  4OMQ A;  1QWE A;  4HVV A;  1ZX6 A;  1U3O A;  1ZUU A;  4D8K A;  2DL4 A;  3H0H A;  2KRN A;  4FSS A;  4GLM A;  1IO6 A;  3ZL7 C;  5IXF A;  2ABL A;  1T3S A;  3NGP A;  1I0C A;  1JXM A;  1PRM C;  1BU1 A;  2FEI A;  2RPN A;  4OMO A;  2RQR A;  1UHC A;  4QT7 A;  2KT1 A;  1NEB A;  1KSW A;  1H92 A;  1SRM A;  2MCN A;  1ZSG A;  1X6G A;  1M3A A;  2KXD A;  3R6N A;  1AOJ A;  1U06 A;  2W10 A;  4RTX A;  2K3B A;  2DBM A;  2CRE A;  1M3C A;  3LH5 A;  1UUE A;  2KEA A;  1KFZ A;  1X27 A;  3O5Z A;  4LE9 A;  4CC3 A;  2J6K A;  4KRT A;  5GJV B;  3I35 A;  3VS5 A;  2EYY A;  3GBQ A;  1OPK A;  1QLY A;  4HXJ A;  1ZLM A;  2CDT A;  2FPF A;  1GRI A;  3QWY A;  1GCQ A;  1YP5 A;  1Z9Z A;  2MOX A;  2EW3 A;  5ECA A;  3TSW A;  1AD5 A;  2L3Q A;  4HCK A;  1AVZ C;  4IIO A;  4AFQ C;  2RNA A;  1AWO A;  2LQW A;  4J9C A;  3I5R A;  1GCQ C;  3M0T A;  1H8K A;  1X2Q A;  1YCS B;  4OMN A;  1RI9 A;  1K9A A;  2PZ1 A;  1UFF A;  1MUZ A;  1WYX A;  2DJQ A;  2LCS A;  3REA B;  3A98 A;  3TVT A;  2NUZ A;  1GBQ A;  4R0K A;  2GTJ A;  4OML A;  1JO8 A;  4F17 A;  1HSQ A;  1KIK A;  2LX7 A;  1OPL A;  1T0J A;  1GBR A;  2ROT A;  1MV3 A;  4LUE A;  1T0H A;  3NMZ C;  1NEG A;  1YN8 A;  2ENM A;  1QKX A;  1UGV A;  1JXO A;  2JW4 A;  1TUD A;  4OMP A;  4RTY A;  4Z8A A;  1NYF A;  1SHF A;  1X2K A;  3TSZ A;  1UTI A;  1NG2 A;  5FWC A;  1TG0 A;  1UHF A;  2H8H A;  2CT3 A;  2J05 A;  4J9F A;  2RQT A;  2CSI A;  4AG1 C;  1OV3 A;  2L0A A;  1GFD A;  2J6F A;  2HBW A;  2YSQ A;  1S1N A;  2GBQ A;  3VS4 A;  1ABQ A;  2DL3 A;  3M0U A;  2DIL A;  2K6D A;  1K4U S;  2KR3 A;  3SEM A;  1SEM A;  2K79 A;  1WDX A;  1NYG A;  2DL7 A;  3M0P A;  1UJY A;  1WA7 A;  4LN2 A;  3VS2 A;  2KRM A;  2AZS A;  4J9D A;  4J9E A;  1RUW A;  1NM7 A;  4Z88 A;  4J9I A;  2CSQ A;  3IQL A;  3VS3 A;  2HCK A;  2DL5 A;  1E6H A;  2RF0 A;  4F16 A;  1GFC A;  1A0N B;  2RQW A;  1V1C A;  2NWM A;  1PKS A;  2LJ0 A;  2J7I A;  1PNJ A;  2AZV A;  2FO0 A;  1K0S A;  2RQV A;  3H0I A;  1VA7 A;  1T3L A;  2A37 A;  2EVR A;  2JMC A;  2GGR A;  1VYT A;  4JJB A;  2D8J A;  3H41 A;  2LNH B;  2J6O A;  2G6F X;  3CQT A;  1PRL C;  1HD3 A;  2DYB A;  4AFS C;  3SHW A;  1JU5 C;  3I9Q A;  1WFW A;  2EGE A;  2MIO A;  1W1F A;  2DL8 A;  2D1X A;  2YT6 A;  5IHI A;  2BZY A;  1Z9Q A;  2P4R A;  5IHK A;  1YWP A;  4D8D A;  2YUO A;  2RMO A;  1ZBJ A;  4AFU C;  2AK5 A;  2C0O A;  3EGU A;  1BBZ A;  2EGA A;  1M30 A;  4RTZ A;  1X69 A;  2EKH A;  2B86 A;  2I0N A;  2X3X D;  2ROL A;  5FW9 A;  4A63 B;  1SSH A;  2ESW A;  1BB9 A;  3C0C A;  4ORZ A;  3EG0 A;  4JPB W;  1SRL A;  1YWO A;  4DEY A;  2KRO A;  2RQU A;  1WLP B;  2CH4 W;  1JQQ A;  2L3S A;  3H0F A;  4ESR A;  2DLP A;  3EG2 A;  2F2V A;  1TUC A;  1QCF A;  1K0X A;  1JEG A;  2YDL A;  1B07 A;  2JS0 A;  2KRS A;  2X3W D;  1GL5 A;  3I5S A;  2LP5 A;  1NLO C;  3M0S A;  1SHG A;  2AKK A;  1UDL A;  2JXB A;  1RLQ C;  1WXT A;  3EHQ A;  2C0I A;  2EBP A;  2A36 A;  1NLP C;  2QDL A;  1AZE A;  2OI3 A;  1N5Z A;  2ED0 A;  4GBQ A;  1AWW A;  2L3P A;  5I22 A; 
#chains in the Genus database with same CATH topology
 1Q86 C;  3PVQ A;  4HCZ A;  2PU9 B;  1Q95 G;  3MP1 A;  3VS0 A;  5FU6 B;  3S3N A;  2FZC B;  4OGE A;  3FJ5 A;  1M1K R;  2FG0 A;  3RES A;  2V1R A;  2IIM A;  4OB1 B;  3LLR A;  3M57 A;  4J9H A;  2G3R A;  1OX9 A;  3REB B;  2CH4 A;  2F69 A;  2LQ8 A;  3CCL T;  2PNI A;  4RCC A;  4LD6 A;  4XK8 E;  3JB9 F;  3MEW A;  2E41 A;  2EJ9 A;  1SF9 A;  2L3R A;  2ECZ A;  3URG A;  3QBY A;  3L2W A;  1VYV A;  3TU4 K;  3CMA T;  3FLG A;  2FVU A;  1GCP A;  2LQK A;  5D6Y A;  2O88 A;  1WI7 A;  2LT4 A;  4HT8 A;  1M1F A;  2RI5 A;  3J80 E;  1M1K U;  2X9H A;  3NFC A;  1K73 R;  1WJS A;  2OAU A;  3RKX A;  2CT4 A;  5CVI A;  3V7R A;  1EIF A;  2A3L A;  4E7I A;  3UT1 A;  2OJ2 A;  3FRN A;  4EIK A;  1WQ7 A;  1W6X A;  4E7Z A;  3A8M B;  4JZ3 A;  3P8D A;  2OAW A;  4BY6 B;  1EZZ B;  1Y96 B;  5IXB A;  1QCN A;  1TSF A;  2JM8 A;  2GQV A;  4X34 A;  1KJW A;  2DRK A;  1OOT A;  2LX9 A;  3UWN A;  1PSE A;  2EJF A;  3HTR A;  5IHN A;  5AT1 B;  3OW2 S;  1K8A R;  4Z02 A;  2OTJ Q;  1RI0 A;  2CUD A;  1B34 B;  3G4S Q;  1W2B S;  4HVW A;  1RAD B;  2JS2 A;  3GNF B;  4P5N A;  4II1 A;  2FRY A;  1K73 U;  2DD5 A;  2D0N A;  3BW1 A;  3QWX X;  2HSP A;  5CK9 A;  4RKU E;  1Y0M A;  1PSF A;  3F70 A;  1UJ0 A;  4KH0 B;  2E6Z A;  3NTH A;  3PVL A;  4KGV B;  4C92 B;  4PNO A;  1WHL A;  3OYN A;  4BE0 A;  3JCM X;  1VQ9 Q;  2HL5 C;  4PLI A;  4RUG A;  3JCM d;  1BK2 A;  4XU0 A;  3THK A;  1LPL A;  2RD1 A;  5GJW B;  4WCI A;  3LH0 A;  4NOY A;  1KHI A;  2D9T A;  2KE9 A;  3G4S A;  4R55 A;  1YFN A;  2XDB A;  4CC4 B;  2KYB A;  2KXC A;  2M0Y A;  2DE0 X;  2SRC A;  5LJ3 e;  3VS6 A;  2X4W A;  3CC7 A;  4Y91 A;  4PJO A;  3JCM f;  4C8Q C;  4MZP A;  1VQL Q;  2DTH A;  2VGN A;  2KT8 A;  3G1J A;  3M55 A;  5HCK A;  3RMS A;  3EFR A;  2VKN A;  1YIT A;  3QSU A;  1U3O A;  4FL6 A;  3UPU A;  1N9S A;  2PUK B;  4HCB A;  2QEX T;  2MWO A;  2QK0 A;  5J3B A;  4GLM A;  1KG1 A;  2E64 A;  3ZL7 C;  2R57 A;  2ABL A;  1VQ7 T;  4ELZ C;  2FEI A;  2DIG A;  5LJ3 f;  2RQR A;  4X9C A;  3CPW A;  3JCM g;  5A0D A;  3CCU T;  3S3M A;  2XKO C;  1YI2 T;  2EQU A;  1SRM A;  3G6E Q;  5C0M A;  3HL8 A;  3JSC A;  1D0Y A;  1UB4 A;  4J6W A;  1FWZ A;  3CC2 Q;  2I2L A;  4RTX A;  2K3B A;  5KYY A;  1SKU B;  5FU6 C;  4XU1 A;  2DBM A;  4JS4 A;  3CPW S;  2DD4 A;  4FSX A;  3MCA B;  4LE9 A;  5GJV B;  2PVD B;  3I35 A;  2QTV A;  1HXD A;  4FW2 A;  1C6V X;  3OYH A;  4EMH A;  5CKE A;  4AT1 B;  1UGQ B;  4FYV B;  4HXJ A;  3L2V A;  3A8O B;  5I2M A;  2FPF A;  4M75 D;  5KE2 A;  1C0M A;  2NLU A;  1Z9Z A;  2MOX A;  2WSE E;  1QP3 A;  3OBY A;  1ACM B;  4C92 E;  8AT1 B;  3INZ A;  3G6E A;  3QUI A;  4EMK C;  5GAM j;  4AFQ C;  3CC2 A;  3C4S A;  2MMP A;  4M77 G;  1GCQ C;  4FYY B;  4M77 A;  5DLO A;  1NBE B;  1RI9 A;  1K9A A;  1WYX A;  3DLL A;  2DJQ A;  1YJW Q;  2NUZ A;  1YI2 Q;  3CCJ A;  1JO8 A;  1KIK A;  3LWI A;  1NEG A;  1YN8 A;  2ENM A;  3OW2 A;  4LDV A;  4WTO B;  1JXO A;  1TUD A;  4OMP A;  4YTL A;  3BFM A;  2CP0 A;  4LD9 K;  1UTI A;  5FWC A;  3E9G A;  2K4Y A;  1IXD A;  3OW2 P;  2CT3 A;  2EJG A;  2QTX A;  3C95 A;  1W2B A;  2KDS A;  1JB0 E;  2J6F A;  3P8B B;  4KBM B;  2GBQ A;  3VS4 A;  1I4K 1;  2V26 A;  3VYG A;  3PMI A;  2XDD A;  4M7D B;  2M02 A;  5CO7 A;  2KR3 A;  1VQ8 A;  1SEM A;  1WHG A;  3FEO A;  1WA7 A;  2X4Y A;  5IT9 E;  3PIO A;  1BI1 A;  1M2V A;  2AZS A;  4J9D A;  1VIF A;  4KH1 B;  3M54 A;  1BI0 A;  1LOJ A;  1WQW A;  4Z88 A;  4J9I A;  2RHY A;  5LJ5 d;  5L8R E;  3JCM b;  1OU9 A;  3ZBD A;  4E7S A;  4BAC A;  2RF0 A;  3BDU A;  2RQW A;  4JJN K;  1YJ9 A;  1PKS A;  1IGQ A;  2J7I A;  2ZPF B;  5GAN 2;  2AZV A;  2A37 A;  4M75 E;  5GAN f;  2ZAE A;  4E7L A;  1YJN T;  3MPU B;  3G4S T;  3CQT A;  4TVR A;  4X9D A;  1JU5 C;  2RHI A;  1O75 A;  2DFU A;  1ZSZ B;  4JLG A;  3JCM P;  4PK4 A;  1W1F A;  2JZ2 A;  2L5Q A;  3I55 A;  2PUO B;  2V8K A;  5IHI A;  4PL6 A;  5IHK A;  4M75 C;  1ZBJ A;  2AK5 A;  3OSV A;  5GAN j;  4OB3 B;  2EGA A;  2VV5 A;  3EGD A;  1GXI E;  4B9X A;  3JCM e;  4BI3 A;  2ROL A;  1D09 B;  1SSH A;  4M78 A;  1IRE B;  2K2V A;  1IHW A;  1SRL A;  4DEY A;  1PC0 A;  2DJZ A;  1WLP B;  2CH4 W;  3EG9 A;  3CXC P;  3EG2 A;  2RK1 A;  1TUC A;  2PQW A;  1K0X A;  4C92 G;  1JEG A;  1YIT Q;  1B07 A;  4C8Q E;  3JRZ A;  2KRS A;  2QI2 A;  3HKS A;  3I5S A;  4HCC A;  4DOW A;  2HQE A;  2RHZ A;  1U8R A;  4NL2 A;  1FXX A;  3HP9 A;  5GAO q;  1UDL A;  2JXB A;  1RLQ C;  2EKO A;  1WXT A;  4A4H A;  1N8R C;  2C0I A;  4XTZ A;  1NLP C;  4C5I A;  3V8J A;  2ED0 A;  1Q82 R;  4M77 B;  2XK0 A;  2DKG A;  5KYW A;  3S6W A;  3JV3 A;  3CBM A;  1NPR A;  4JLI A;  4FT4 A;  1G5V A;  2MWP A;  4C8Q D;  5GAM e;  3PNW C;  4JRQ A;  3SFM A;  4IIM A;  2ZPG B;  4M7D D;  1QVG A;  1M90 C;  5FWB A;  1K76 A;  1VQK T;  2IPO B;  4IUR A;  3VUB A;  2X51 A;  2E3H A;  2WSF E;  2XHC A;  2MPX C;  1N6A A;  4WF2 A;  2HEQ A;  3QZ9 B;  3SD4 A;  1R8O B;  1M1G A;  4MZT A;  2DPP B;  3T9N A;  2EPD A;  3FJP A;  2K2M A;  4JZ4 A;  3SDZ A;  1KQS S;  3VRZ A;  3S3O A;  3EGX A;  4PFZ A;  3C94 A;  1WHM A;  2YWW A;  1M3B A;  3CME Q;  3CBP A;  3VUZ A;  2VVK A;  1UEC A;  1SPK A;  1J3T A;  2A08 A;  2A28 A;  2YUN A;  3EG1 A;  2DZC A;  3QG1 A;  1BIA A;  1CSK A;  1M1K C;  1W2B P;  1G3S A;  2QG9 B;  1VQN A;  2HAX A;  1B3Q A;  2KGT A;  1S72 T;  2NUP B;  2K3Y A;  3OS5 A;  2O9S A;  3EH1 A;  4ZGD B;  3GLX A;  2E65 A;  2K9G A;  2L89 A;  4FM4 B;  1BCM A;  4M77 F;  4NS5 A;  2OTJ T;  5CAI A;  3MKD A;  3E1S A;  2NUT A;  3VS7 A;  3ME9 A;  1YNZ A;  2KAF A;  1NPP A;  4IUQ A;  3HRT A;  2NYS A;  3OS0 A;  2J06 A;  4J9G A;  5GMK m;  4KUI A;  2QYZ A;  2ZPI B;  2DEQ A;  1M90 R;  1OEB A;  1D3B A;  1E6G A;  1KC8 C;  1OU8 A;  4HT9 A;  1KHC A;  1SG5 A;  3AHU A;  2JJ9 A;  4M77 E;  2D8H A;  1H3H A;  2DMO A;  2COY A;  2YRD A;  2YUQ A;  3QJ6 A;  2AIR B;  5I21 A;  4FW1 A;  1G83 A;  3HFN A;  2LMJ A;  2LZ6 B;  2OTL A;  3GIB A;  2CKK A;  1WNL A;  4M78 B;  4PJO C;  1WIE A;  3QYG B;  5I2S A;  3CCE A;  1RAH B;  3CCV T;  3OYM A;  4M4Z A;  1XOV A;  4OMM A;  2MAM A;  2DNU A;  5CQX A;  3G7Z A;  2WAC A;  3M0Q A;  3CMA Q;  5KYX B;  4OB0 B;  3UF4 A;  2HDA A;  2GQI A;  2LJ3 A;  2RJF A;  3EFO B;  2ZGW A;  3A8H B;  4QQG A;  1EFN A;  4XQ3 A;  1X43 A;  2LJ1 A;  3CCS T;  4C5H A;  2COZ A;  3TCJ A;  5J26 A;  4ZN1 A;  2O9V A;  1Q7Y C;  4O5V A;  5IN1 A;  1VQN T;  3WVD B;  3CPW P;  3H0H A;  2JN0 A;  3HHT B;  4EMG A;  4EDU A;  3CCV Q;  2YRC A;  3E9F A;  3NGP A;  1YI2 A;  7AT1 B;  3HSB A;  2RPN A;  4M7A B;  2ATC B;  4C92 A;  3OQ5 A;  1UHC A;  2KT1 A;  5GAM h;  2DXB A;  1H92 A;  3KBG A;  4LDU A;  2EYQ A;  2K57 A;  3OA6 A;  9ATC B;  2LDM A;  1D0Z A;  3BY7 A;  3PTA A;  1QMC A;  5CKB A;  3RKW A;  3OSS C;  1Q81 C;  2QAZ A;  4KRT A;  3VS5 A;  4DQ2 A;  3RIR A;  1NJI U;  2EYY A;  4PJO B;  3JB9 H;  2LRQ A;  1NE8 A;  2FYK A;  4E7J A;  3QWY A;  1QVF A;  2CYZ B;  2F5K A;  3RMQ A;  3TRE A;  4D6W A;  1MMA A;  5GAN 5;  2EW3 A;  3TSW A;  2D0Q B;  2CZ1 B;  1AVZ C;  5J39 A;  2RJE A;  4J9C A;  4M78 E;  3O8V A;  2KK4 A;  1X2Q A;  4OMN A;  4DBR A;  2PZ1 A;  1UFF A;  3CCQ A;  1NJI R;  2QQA A;  4A4E A;  4A4G A;  2LCS A;  3QZ5 B;  2DXC A;  3M5A A;  1VUB A;  2FB7 A;  3PT9 A;  5KCH A;  2LX7 A;  2P4T A;  4J5Y A;  8ATC B;  1WJR A;  5HY6 A;  4PFP A;  1QKX A;  1V29 B;  4RTY A;  1Y7X A;  1RAF B;  1NYF A;  1YIT T;  1OI1 A;  1ZSZ C;  5A2Q E;  4CI0 C;  1MNE A;  3TSZ A;  3GPL A;  4E2F B;  4ZTF A;  1TG0 A;  2K5I A;  2DXU A;  3CME A;  3HPW A;  4F7U B;  2AT1 B;  3OYI A;  1VQK Q;  1V76 A;  2L0A A;  4KGX B;  3G71 Q;  4E7H A;  3A5Z B;  3V8K A;  3NTI A;  2YSQ A;  2OX7 A;  3FIF A;  2VC8 A;  5LJ5 e;  1QVP A;  3M0U A;  4M7A E;  2O4X B;  2K6D A;  1VQN Q;  4XAX B;  3P8H A;  2E6N A;  1K9M R;  2DXT A;  2DL7 A;  3VS2 A;  1G8X A;  1R0C B;  2KRM A;  3R6O A;  4PLL A;  3SWN C;  4BDZ A;  3VKI A;  3MP6 A;  4OMF B;  4J9E A;  4M7A G;  3M53 A;  5LJ5 g;  5A0L A;  4N4I A;  2YHT A;  1M2V B;  1LNX A;  1UGP B;  3VU3 C;  5AYF A;  4F04 B;  1Q82 C;  1WGS A;  3ASK A;  1PCX A;  1VQ5 Q;  4CRI A;  4MMK A;  4JDS A;  1VQL A;  2RJC A;  1K0S A;  3OYB A;  1Q86 U;  2OTL T;  2JMC A;  1VYT A;  2LNH B;  1QVG S;  1PRL C;  1K9M U;  3OYG A;  3QII A;  2MIO A;  2E10 A;  2D1X A;  3MO8 A;  2P4R A;  2PVG B;  3JB9 I;  2RMO A;  3CC7 T;  4AFU C;  2RB6 A;  2DTI A;  3GOX A;  4IKF A;  2QQ9 A;  2JNG A;  4OVA A;  2C0O A;  2EQJ A;  3EGU A;  4RTZ A;  4IUV A;  2YXY A;  1X69 A;  1BYM A;  4QW2 A;  1X6O A;  2K3X A;  5KYN A;  2GFA A;  2ZPH B;  4JPB W;  1YWO A;  2BIV A;  2LCC A;  1KD1 U;  3HFO A;  4ESR A;  2CS7 A;  2F2V A;  4EPC A;  4QQD A;  2XID A;  4RCB A;  3LGL A;  1BKB A;  4C8Q F;  3PFS A;  1UEB A;  1U1T A;  2LP5 A;  4PJM A;  1IHV A;  4M7D E;  1NLO C;  2XG8 D;  2Y90 A;  2D6F A;  3M0S A;  4JRI A;  2AKK A;  2X35 A;  4PFO A;  3EHQ A;  1X75 C;  2A36 A;  1AZE A;  4XTX A;  2R58 A;  4L5G A;  4M7A F;  1N5Z A;  3N5B B;  3Q1J A;  5GAO l;  3JCM W;  4ZTJ A;  1AWX A;  1B34 A;  3DB3 A;  4QVC A;  4FYW B;  3NPF A;  3CBO A;  4GY5 A;  2RA2 A;  1ARK A;  1ABO A;  3RBB B;  3SWN B;  2M51 A;  5CKF A;  2LT1 A;  5KYW B;  3BE3 A;  4M75 B;  1PD1 A;  3HRS A;  3RDV A;  2F1L A;  1X6B A;  1YJ9 T;  2FPE A;  2F2W A;  3OYK A;  5D6X A;  1IZ6 A;  3KFV A;  3UA7 A;  4Z89 A;  2M1H A;  1VQP A;  2JMA A;  1ZHI A;  1QKW A;  2RHU A;  1QCO A;  2KSS A;  1RLP C;  4A54 A;  3MP8 A;  2FRW A;  1JBM A;  4MZM A;  3M58 A;  2JTE A;  4JUV A;  2FPD A;  4C0G A;  4AMC A;  5IAY A;  2K7A A;  1BI3 A;  2ZPB B;  2BE9 B;  4OF1 A;  2DM1 A;  2O2O A;  5GMK l;  1OYX A;  2DBK A;  3L2Z A;  2XMF A;  3JCM h;  2DIQ A;  3QDF A;  1QW1 A;  4PJL A;  2V8J A;  4PJO D;  3X28 B;  2VXF A;  1MMD A;  2O31 A;  3VRY A;  1FYN A;  2JM9 A;  1S72 A;  4K11 A;  1X01 A;  2BTT A;  1M9S A;  5HK0 A;  5KH6 A;  2DX1 A;  4PKC C;  3LGF A;  4AG2 C;  4J9B A;  3RUX A;  4GLK A;  4PJO F;  1I5L A;  2RI2 A;  2DRM A;  3A1P A;  2QXF A;  3G71 T;  1PHT A;  4RTV A;  2LCL A;  2EIF A;  1VYU A;  2RI3 A;  3EFS A;  2BUD A;  3OY9 A;  1I1J A;  5LJ5 f;  2H3E B;  4X1V A;  1YJ9 Q;  3MET A;  5KYU A;  2ZCF B;  2JOY A;  2NUT B;  1DJ7 B;  4RTT A;  1ZQ1 A;  5GAO p;  3EHR A;  1U1S A;  3OYC A;  1MV0 B;  5GAN 3;  2KBT A;  4J7F A;  2V8I A;  1VQ4 T;  2ED1 A;  2QAS A;  4UC4 A;  5GMK i;  1AZG B;  1WX6 A;  3CC4 Q;  1UE9 A;  4JJD A;  2EFI A;  1PG5 B;  4ME7 A;  2EYW A;  4M78 G;  2KVQ G;  1IB8 A;  3NHN A;  1WHJ A;  4Y92 A;  1VQM Q;  3PE0 A;  2GTO A;  2L2P A;  2DZ9 A;  1M4Z A;  3G6E T;  3RKY A;  4F14 A;  3CCU Q;  1M27 C;  4Y28 E;  5I11 A;  2HD0 A;  3M59 A;  1VQ7 Q;  1I5O B;  5LJ3 d;  3RNJ A;  3A8G B;  5EG2 A;  2ZPE B;  3JCM V;  2EGC A;  1RAB B;  2YUP A;  3M0R A;  1AWJ A;  4N4H A;  1HJD A;  1YCY A;  4ZGJ B;  3CMA A;  2DVJ A;  4E6R A;  2PTK A;  1D0X A;  3ER0 A;  2W0Z A;  5A0G A;  2E5Q A;  2EQI A;  3UA6 A;  3DKM A;  3QDR B;  3VJP A;  2E5K A;  4M7A D;  1JJ2 P;  4HVV A;  1ZUU A;  3X25 B;  1MND A;  4ELY C;  5GMK h;  1TUG B;  4D8K A;  3OS1 A;  2DL4 A;  3A8L B;  2KRN A;  4FSS A;  1D3B B;  3CC7 Q;  4BE1 A;  5HKC A;  2KQW A;  3FDR A;  1HK9 A;  1I0C A;  3JB9 D;  4OMO A;  3FB9 A;  1KSW A;  4OB2 B;  2RM4 A;  1ZSG A;  3V7S A;  4JS5 A;  1M3A A;  2KXD A;  1YIJ Q;  1U06 A;  2R5M A;  2OTL Q;  4ZN3 A;  4PJN A;  2CRE A;  3MEU A;  1M3C A;  1UUE A;  2KEA A;  2FHD A;  1KFZ A;  5D6W A;  3O5Z A;  1VQ4 A;  4CC3 A;  4N0A A;  4A4K A;  3GBQ A;  1BIB A;  4O6J A;  5DM7 R;  1YJW T;  4EMK A;  1QLY A;  3EFO A;  3OBW A;  2E70 A;  3CCL Q;  4BD3 A;  1GCQ A;  2K5F A;  4IUP A;  1YP5 A;  5GAN 6;  4BI4 A;  4N0A C;  4ANJ A;  1JJ2 A;  5GAN 7;  1G3W A;  5M9O A;  5ECA A;  1AD5 A;  3CCR A;  1K8A C;  4RG8 A;  2BKD N;  4HCK A;  4IIO A;  1AWO A;  1TU0 B;  4XU3 A;  2CP6 A;  5LJ5 j;  1QVG P;  1KQ2 A;  2YLB A;  1YIJ T;  3GP8 A;  3H8Z A;  4C5E A;  4M7A A;  3REA B;  5FRN A;  1ZSZ A;  4R0K A;  2FZG B;  4OML A;  1VQ8 Q;  1HSQ A;  1K8A U;  2QA4 A;  2DVE A;  1VQP Q;  1GBR A;  1WHK A;  2ROT A;  1TTH B;  5DLQ E;  1T0H A;  3NMZ C;  3CCR Q;  1I8F A;  2JW4 A;  1XNI A;  4OGC A;  1SHF A;  4L59 A;  4M75 G;  1UHF A;  2HL3 A;  1WHH A;  3AT1 B;  6AT1 B;  2YLC A;  3BDL A;  3OYA A;  1D1A A;  2RQT A;  4XTV A;  2CSI A;  1VQ7 A;  1OV3 A;  1OX8 A;  1GFD A;  4XU2 A;  3PGG A;  5GAM f;  4F7U A;  2E4H A;  1XQH A;  3G71 A;  4BUG A;  2DL3 A;  3OYJ A;  2QEX Q;  2DTO A;  4LDX A;  1S72 Q;  4BB7 A;  3L1A A;  2H3J A;  3I55 Q;  4ZGE B;  3M9Q A;  1TS9 A;  3I56 A;  2Y4Y A;  4MML A;  2LC4 A;  4DBH A;  4HKE A;  4FCY A;  1NM7 A;  2RO0 A;  3KUF A;  1VQM T;  2CSQ A;  3IQL A;  4FT2 A;  1RAC B;  3EAE A;  1N9R A;  2ZZD A;  1WZO A;  4QVZ A;  2MYS A;  1E6H A;  1MMN A;  2LTO A;  4M7D F;  1GFC A;  1A0N B;  1V1C A;  4JRP A;  2NWM A;  3CCR T;  1YHQ Q;  2M16 A;  5C6S A;  4M75 F;  1KC8 U;  3OYY A;  2FO0 A;  2RQV A;  1R77 A;  3H0I A;  1VA7 A;  2GGR A;  4JJB A;  3CCE T;  4XTW A;  2J6O A;  4C92 F;  2DYB A;  4AFS C;  1AHJ B;  3SHW A;  1YIJ A;  2HNI A;  2DL8 A;  4M78 C;  2YT6 A;  1YBY A;  1FMW A;  1MMG A;  1Z9Q A;  1M90 U;  3I56 Q;  4DA4 A;  2YUO A;  1ZA1 B;  4L6V 5;  2MI6 A;  2M9U A;  1M30 A;  4BI8 B;  3CCJ T;  2RJD A;  3RR6 A;  5GAO m;  2EKH A;  2B86 A;  2I0N A;  2X3X D;  4R56 A;  4KUD K;  1MGQ A;  2GFU A;  3EGX B;  2ESW A;  2K5L A;  1BB9 A;  1P92 A;  4ORZ A;  1BCO A;  3L2U A;  1KC8 R;  5FU7 B;  4M7D C;  4C8Q B;  2RQU A;  1YHQ A;  1KD1 C;  1UGS B;  3H0F A;  4HA8 A;  4XTY A;  2CP7 A;  4LDW A;  1Y07 A;  5CQY A;  4JRK A;  5LJ5 h;  4C8Q G;  1H64 1;  2YDL A;  5KCO A;  4C0D B;  1Y71 A;  2DEU A;  2KMT A;  3TQ7 P;  1GL5 A;  2O01 E;  2FL7 A;  3CEY A;  2XIC A;  2C06 A;  3CD6 Q;  1G3Y A;  3CXC A;  4M7D A;  2P84 A;  1SSF A;  3QO3 A;  3X24 B;  2DET A;  1SHG A;  4J83 A;  2QGG A;  1D1B A;  2HMA A;  5CIU A;  3OYL A;  2XI9 A;  2OI3 A;  3QHS A;  1I81 A;  1RAE B;  5LJ3 j;  1AWW A;  4RTW A;  2HQX A;  4RG2 A;  1LJO A;  5I22 A;  1ZUK A;  1VQ9 A;  2LQN A;  1LCK A;  4DEX A;  4CC2 A;  2VXE A;  1UG1 A;  2XDP A;  5CKD A;  3UDC A;  1IRX A;  4BE2 A;  2KNB B;  2EYZ A;  1TXQ A;  1KK7 A;  1M2O A;  1XJW B;  1CKA A;  1Q81 U;  1K1Z A;  5CR2 A;  5GAO n;  2HBP A;  1PWT A;  3CCV A;  2VUB A;  3JB9 G;  5L23 A;  2DA9 A;  3JAM E;  4J8O A;  1E7O A;  3JB9 J;  4N4G A;  2EYX A;  2LNV A;  2P0P A;  3CCM T;  3NTK A;  1R0B G;  3OMC A;  2R5A A;  5FRM A;  2RH2 A;  2JTF A;  1AEY A;  2FZK B;  1WXU A;  4M78 D;  3EG3 A;  4DBF A;  1XTD A;  1ZBX A;  4BY6 C;  3CCS A;  5KYX A;  2BZX A;  4JJC A;  3CCM Q;  2DAQ A;  1VQO A;  2SEM A;  5GAM g;  3EG9 B;  3X20 B;  1LVK A;  4A53 A;  2KYM A;  2QA4 T;  4HVU A;  1Q81 R;  1W70 A;  4LNP A;  5CCA A;  2LVM A;  5GMK e;  1M8V A;  3MHX A;  1M8M A;  3TEE A;  1RAA B;  2VB6 A;  3M4Y A;  4C0Z A;  3V7C A;  2GNC A;  2CZ7 B;  3L42 A;  5LJ3 g;  1I07 A;  3L2R A;  1FMK A;  3M4G A;  3ZFJ A;  2BZ8 A;  2AKL A;  2QDY B;  5D7U A;  3PIP A;  1WXB A;  1U5S A;  1VQO Q;  4AFZ C;  2E3I A;  2F2X A;  2VAS A;  5DY9 A;  3UAT A;  1VIE A;  2CP3 A;  4F7U F;  2EQK A;  4CC7 A;  2HKQ B;  4LUD A;  4M77 D;  3QYH B;  5KYU B;  2EQM A;  2JT4 A;  1QVF S;  2VWF A;  3CD6 T;  4J6X A;  1Y57 A;  2Y4X A;  5GAO r;  2L8D A;  2DF6 A;  1VQM A;  1ZUY A;  5CKH A;  4XTU A;  2RN8 A;  2B8A A;  3WXM B;  2A0F B;  1D1C A;  4VUB A;  2EWN A;  3VS1 A;  2HZY A;  2C0T A;  3QJY A;  2DYI A;  4OP0 A;  3ULR B;  3J7A F;  4C8Q A;  1QWF A;  2CUB A;  1TH7 A;  1G2B A;  5IH2 A;  1UGR B;  4ZNX A;  1PKT A;  3MEV A;  4QKU A;  3CCJ Q;  2QQB A;  1NZ9 A;  4IUT A;  4KUL A;  1VQ6 T;  4IUU A;  2CGH A;  4V2S A;  5EC7 A;  2VYT A;  4RTU A;  3JCM Q;  3U23 A;  2CZ6 B;  3CXC S;  2V1Q A;  3J81 E;  4QQ6 A;  2GF7 A;  1CKB A;  3CCE Q;  4OMQ A;  2XD0 A;  4FU6 A;  1QWE A;  1Q82 U;  1ZX6 A;  2NUP A;  1Q86 R;  1ZA2 B;  1QVF P;  3FC3 A;  1YHQ T;  1VOM A;  4DOV A;  1IO6 A;  5IXF A;  2HQH A;  2P0K A;  1T3S A;  2P0Q A;  4J6Y A;  1JXM A;  3QXE B;  1PRM C;  1BU1 A;  5HK3 A;  3CC4 A;  2DO3 A;  2YRV A;  4QT7 A;  1NEB A;  5KYY B;  5GAN d;  3LW5 E;  2MCN A;  2XU8 A;  1X6G A;  3R6N A;  4QVD A;  1YJN Q;  4KGZ B;  1AOJ A;  3GF5 A;  1C1A A;  2W10 A;  1G3T A;  4ATO A;  3E19 A;  2BE7 D;  2E12 A;  1BI2 A;  3LH5 A;  3MJX A;  1X27 A;  1IGU A;  4C92 C;  2VGM A;  3OB9 A;  2J6K A;  2JUF A;  2O4X A;  3LWH A;  1KD1 R;  5LL6 S;  1Q7Y U;  3CD6 A;  3VV0 A;  2CP5 A;  1OPK A;  3JCM c;  3GNG A;  3CCQ Q;  3SB2 A;  4LXC A;  3OYE A;  4KT0 E;  3OYD A;  1FMV A;  1ZLM A;  2CDT A;  1GRI A;  4M7D G;  4M77 C;  4PJO E;  1VQL T;  1OZ2 A;  3CCL A;  3HRU A;  4EMK B;  3LX7 A;  4C92 D;  4M7A C;  2JTM A;  2L3Q A;  4NL3 A;  3H9N A;  1OQK A;  1HYO A;  2RNA A;  1RAI B;  2KY9 A;  2LQW A;  3V8L A;  3I5R A;  1VQP T;  5GAN h;  3M0T A;  1H8K A;  1YCS B;  4J7I A;  2IVW A;  1MUZ A;  1Q7Y R;  4A4F A;  2X4J A;  3A98 A;  3TVT A;  3CCQ T;  1EX4 A;  1GBQ A;  1JRI A;  2QA4 Q;  3ZEH A;  2GTJ A;  4F17 A;  3DB4 A;  1N27 A;  1RAG B;  1OPL A;  1T0J A;  1MV3 A;  4LUE A;  1VQ5 T;  4RMO A;  3D7S B;  3M56 A;  1UGV A;  4Z8A A;  1H3Z A;  2HKN A;  1X2K A;  2M0O A;  1FX7 A;  1NG2 A;  1AT1 B;  2H8H A;  3CCS Q;  2MK5 A;  2J05 A;  4J9F A;  4AG1 C;  2OTJ A;  5KE3 A;  2E1H A;  4C0F A;  3QPH A;  4B6M A;  5GAN 4;  2HBW A;  3H6Z A;  2EAY A;  2IG0 A;  1S1N A;  5LJ3 h;  4F7U E;  4DBQ A;  1WJQ A;  2MF2 A;  1ABQ A;  5GAN e;  2DIL A;  1OUL A;  4E7K A;  1K4U S;  3SEM A;  2K79 A;  1WDX A;  1NYG A;  2CZ0 B;  3I56 T;  3M0P A;  1UJY A;  4LN2 A;  3L2Q A;  5FRO A;  1RUW A;  2Z0W A;  3VS3 A;  3WVE B;  4F7U G;  4MDW A;  3EH2 A;  1Y96 A;  2HCK A;  2QGF B;  2DL5 A;  1VQ6 Q;  1OZ3 A;  1YJW A;  4F16 A;  4MDX A;  2LJ0 A;  3SWN A;  5GAN 8;  1PNJ A;  1VQK A;  3DLM A;  1T3L A;  4M75 A;  2EVR A;  3CC2 T;  1K73 C;  2D8J A;  3H41 A;  5FU7 C;  2G6F X;  3KXT A;  1HD3 A;  3PMT A;  1YJN A;  3I9Q A;  5GAN g;  1N8R R;  1QP2 A;  1TOV A;  1WFW A;  2EGE A;  4BDY A;  1KQ1 A;  2BZY A;  3CCM A;  3EGD B;  1YWP A;  4D8D A;  3I55 T;  2A7Y A;  3OMG A;  1VQ6 A;  5FLX E;  2RHX A;  1QQJ A;  2PVO B;  1BBZ A;  2KI7 A;  1KQS P;  4Q5W A;  2HSE B;  4B9W A;  2DK3 A;  3CPF A;  3OS2 A;  1VQ5 A;  2GCX A;  1B7T A;  2DER A;  3C12 A;  2WSC E;  5FW9 A;  1O9S A;  4A63 B;  1TWB A;  2QQS A;  1VQO T;  2F5T X;  3C0C A;  3EG0 A;  2QEX A;  4M78 F;  3LYI A;  4FIB A;  2KRO A;  2RK2 A;  1JQQ A;  2L3S A;  2AHJ B;  2DLP A;  1QCF A;  3RER A;  2JVV A;  2JS0 A;  2X4X A;  1N8R U;  2X3W D;  3CCU A;  1NJI C;  4PJJ A;  1JJ2 S;  2QQR A;  3CME T;  1M5Q 1;  4PJO G;  1F1B B;  5GAM d;  3CC4 T;  1W4S A;  4FYX B;  1PM3 A;  4C5G A;  4C0D C;  3JCM J;  1VQ4 Q;  3QKJ A;  1WPY A;  4LDY A;  2CP2 A;  3VYH B;  1VQ8 T;  3E2U A;  2COW A;  2EBP A;  3MEA A;  2QDL A;  1PD0 A;  4E47 A;  1K9M C;  5GMK j;  1MHN A;  3X26 B;  1KQS A;  4GBQ A;  1VQ9 T;  1RL2 A;  2L3P A;  3OYF A; 
#chains in the Genus database with same CATH homology
 3PVQ A;  1ZUK A;  1AWX A;  3JV3 A;  2LQN A;  1LCK A;  4DEX A;  4CC2 A;  3NPF A;  3VS0 A;  1UG1 A;  1ARK A;  1ABO A;  3RBB B;  3FJ5 A;  2M51 A;  2FG0 A;  2KNB B;  2V1R A;  2IIM A;  2EYZ A;  4J9H A;  1CKA A;  4IIM A;  1X6B A;  1K1Z A;  3REB B;  2CH4 A;  2FPE A;  2F2W A;  5FWB A;  1PWT A;  1K76 A;  3KFV A;  3UA7 A;  2PNI A;  4Z89 A;  5L23 A;  2DA9 A;  2JMA A;  2ECZ A;  2HEQ A;  1E7O A;  2EYX A;  1QKW A;  1VYV A;  1RLP C;  2EPD A;  2FRW A;  2O88 A;  1GCP A;  2K2M A;  1WI7 A;  1AEY A;  4JZ4 A;  3VRZ A;  1WXU A;  2JTE A;  2FPD A;  3EG3 A;  2K7A A;  1M3B A;  2VVK A;  2BZX A;  1UEC A;  4JJC A;  1SPK A;  2DM1 A;  2O2O A;  2DBK A;  2SEM A;  2A08 A;  2A28 A;  1J3T A;  2XMF A;  2YUN A;  2KYM A;  3EG1 A;  4HVU A;  1W70 A;  1CSK A;  2O31 A;  2CT4 A;  3VRY A;  1FYN A;  4LNP A;  2JM9 A;  4K11 A;  1M8M A;  2OJ2 A;  4EIK A;  2BTT A;  1B3Q A;  1W6X A;  2KGT A;  2DX1 A;  4AG2 C;  4J9B A;  4JZ3 A;  2O9S A;  2OAW A;  5IXB A;  2K9G A;  2GNC A;  2JM8 A;  2DRM A;  1KJW A;  2DRK A;  1OOT A;  1PHT A;  4RTV A;  1I07 A;  5IHN A;  3VS7 A;  1VYU A;  1YNZ A;  1FMK A;  1I1J A;  4X1V A;  2BZ8 A;  2AKL A;  2CUD A;  1WXB A;  1U5S A;  4HVW A;  2J06 A;  4AFZ C;  4J9G A;  2F2X A;  2JS2 A;  4RTT A;  3UAT A;  2FRY A;  3EHR A;  1MV0 B;  2KBT A;  4CC7 A;  4LUD A;  2D0N A;  2ED1 A;  1OEB A;  2JT4 A;  1E6G A;  1AZG B;  1WX6 A;  2VWF A;  3QWX X;  2HSP A;  1Y0M A;  1Y57 A;  1UE9 A;  4JJD A;  1UJ0 A;  2DF6 A;  2EYW A;  3PVL A;  2D8H A;  1H3H A;  3NHN A;  1ZUY A;  2DMO A;  2RN8 A;  4Y92 A;  2YUQ A;  4RUG A;  1G83 A;  3PE0 A;  2LMJ A;  1BK2 A;  2LZ6 B;  2GTO A;  2L2P A;  3THK A;  3VS1 A;  5GJW B;  2C0T A;  4F14 A;  4WCI A;  1WIE A;  3ULR B;  1M27 C;  2KE9 A;  5I11 A;  1QWF A;  2CUB A;  4CC4 B;  2KYB A;  1G2B A;  2KXC A;  4M4Z A;  1XOV A;  4RTW A;  3RNJ A;  5IH2 A;  4ZNX A;  1PKT A;  2M0Y A;  4OMM A;  2DE0 X;  2DNU A;  2SRC A;  2EGC A;  3M0Q A;  3VS6 A;  2YUP A;  3M0R A;  1AWJ A;  1HJD A;  3UF4 A;  2HDA A;  2GQI A;  5EC7 A;  2DVJ A;  2LJ3 A;  4E6R A;  4RTU A;  3U23 A;  1EFN A;  2KT8 A;  2PTK A;  1X43 A;  2V1Q A;  2W0Z A;  5HCK A;  2EQI A;  3UA6 A;  2LJ1 A;  1CKB A;  2E5K A;  2VKN A;  2O9V A;  4OMQ A;  1QWE A;  4HVV A;  1ZX6 A;  1U3O A;  1ZUU A;  4D8K A;  2DL4 A;  3H0H A;  2KRN A;  4FSS A;  4GLM A;  1IO6 A;  3ZL7 C;  5IXF A;  2ABL A;  1T3S A;  3NGP A;  1I0C A;  1JXM A;  1PRM C;  1BU1 A;  2FEI A;  2RPN A;  4OMO A;  2RQR A;  1UHC A;  4QT7 A;  2KT1 A;  1NEB A;  1KSW A;  1H92 A;  1SRM A;  2MCN A;  1ZSG A;  1X6G A;  1M3A A;  2KXD A;  3R6N A;  1AOJ A;  1U06 A;  2W10 A;  4RTX A;  2K3B A;  2DBM A;  2CRE A;  1M3C A;  3LH5 A;  1UUE A;  2KEA A;  1KFZ A;  1X27 A;  3O5Z A;  4LE9 A;  4CC3 A;  2J6K A;  4KRT A;  5GJV B;  3I35 A;  3VS5 A;  2EYY A;  3GBQ A;  1OPK A;  1QLY A;  4HXJ A;  1ZLM A;  2CDT A;  2FPF A;  1GRI A;  3QWY A;  1GCQ A;  1YP5 A;  1Z9Z A;  2MOX A;  2EW3 A;  5ECA A;  3TSW A;  1AD5 A;  2L3Q A;  4HCK A;  1AVZ C;  4IIO A;  4AFQ C;  2RNA A;  1AWO A;  2LQW A;  4J9C A;  3I5R A;  1GCQ C;  3M0T A;  1H8K A;  1X2Q A;  1YCS B;  4OMN A;  1RI9 A;  1K9A A;  2PZ1 A;  1UFF A;  1MUZ A;  1WYX A;  2DJQ A;  2LCS A;  3REA B;  3A98 A;  3TVT A;  2NUZ A;  1GBQ A;  4R0K A;  2GTJ A;  4OML A;  1JO8 A;  4F17 A;  1HSQ A;  1KIK A;  2LX7 A;  1OPL A;  1T0J A;  1GBR A;  2ROT A;  1MV3 A;  4LUE A;  1T0H A;  3NMZ C;  1NEG A;  1YN8 A;  2ENM A;  1QKX A;  1UGV A;  1JXO A;  2JW4 A;  1TUD A;  4OMP A;  4RTY A;  4Z8A A;  1NYF A;  1SHF A;  1X2K A;  3TSZ A;  1UTI A;  1NG2 A;  5FWC A;  1TG0 A;  1UHF A;  2H8H A;  2CT3 A;  2J05 A;  4J9F A;  2RQT A;  2CSI A;  4AG1 C;  1OV3 A;  2L0A A;  1GFD A;  2J6F A;  2HBW A;  2YSQ A;  1S1N A;  2GBQ A;  3VS4 A;  1ABQ A;  2DL3 A;  3M0U A;  2DIL A;  2K6D A;  1K4U S;  2KR3 A;  3SEM A;  1SEM A;  2K79 A;  1WDX A;  1NYG A;  2DL7 A;  3M0P A;  1UJY A;  1WA7 A;  4LN2 A;  3VS2 A;  2KRM A;  2AZS A;  4J9D A;  4J9E A;  1RUW A;  1NM7 A;  4Z88 A;  4J9I A;  2CSQ A;  3IQL A;  3VS3 A;  2HCK A;  2DL5 A;  1E6H A;  2RF0 A;  4F16 A;  1GFC A;  1A0N B;  2RQW A;  1V1C A;  2NWM A;  1PKS A;  2LJ0 A;  2J7I A;  1PNJ A;  2AZV A;  2FO0 A;  1K0S A;  2RQV A;  3H0I A;  1VA7 A;  1T3L A;  2A37 A;  2EVR A;  2JMC A;  2GGR A;  1VYT A;  4JJB A;  2D8J A;  3H41 A;  2LNH B;  2J6O A;  2G6F X;  3CQT A;  1PRL C;  1HD3 A;  2DYB A;  4AFS C;  3SHW A;  1JU5 C;  3I9Q A;  1WFW A;  2EGE A;  2MIO A;  1W1F A;  2DL8 A;  2D1X A;  2YT6 A;  5IHI A;  2BZY A;  1Z9Q A;  2P4R A;  5IHK A;  1YWP A;  4D8D A;  2YUO A;  2RMO A;  1ZBJ A;  4AFU C;  2AK5 A;  2C0O A;  3EGU A;  1BBZ A;  2EGA A;  1M30 A;  4RTZ A;  1X69 A;  2EKH A;  2B86 A;  2I0N A;  2X3X D;  2ROL A;  5FW9 A;  4A63 B;  1SSH A;  2ESW A;  1BB9 A;  3C0C A;  4ORZ A;  3EG0 A;  4JPB W;  1SRL A;  1YWO A;  4DEY A;  2KRO A;  2RQU A;  1WLP B;  2CH4 W;  1JQQ A;  2L3S A;  3H0F A;  4ESR A;  2DLP A;  3EG2 A;  2F2V A;  1TUC A;  1QCF A;  1K0X A;  1JEG A;  2YDL A;  1B07 A;  2JS0 A;  2KRS A;  2X3W D;  1GL5 A;  3I5S A;  2LP5 A;  1NLO C;  3M0S A;  1SHG A;  2AKK A;  1UDL A;  2JXB A;  1RLQ C;  1WXT A;  3EHQ A;  2C0I A;  2EBP A;  2A36 A;  1NLP C;  2QDL A;  1AZE A;  2OI3 A;  1N5Z A;  2ED0 A;  4GBQ A;  1AWW A;  2L3P A;  5I22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...