1WDXA

Yeast bbc1 sh3 domain, triclinic crystal form
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
PEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin tail region-interacting protein MTI1
publication title Crystal structure of Yeast BBC1 SH3 domain, triclinic crystal form
rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wdxA00
1CKBA 2KE9A 3H0FA 2K7AA 4RTUA 3TSZA 1BB9A 1QLYA 2CSIA 1IO6A 2EYWA 4CC4B 2H8HA 1VYUA 2L2PA 1ZUYA 1VYTA 4J9HA 1YNZA 5ECAA 5FWCA 4EIKA 1K0XA 2EKHA 2CSQA 2K9GA 4J9DA 3I5SA 2FRYA 1CKAA 1KJWA 2A36A 1J3TA 2J6OA 3ZL7C 3EG3A 2A08A 1PRLC 1TUCA 4RTYA 1A0NB 4J9CA 4KRTA 2JTEA 2J7IA 5IH2A 2CT3A 3M0QA 3M0PA 1ZUUA 4RUGA 1SSHA 1JO8A 4HVWA 4JPBW 1G2BA 1U5SA 2EYZA 1BU1A 4RTWA 4WCIA 2JMAA 2C0TA 2DVJA 4OMOA 2HDAA 2ECZA 3VS6A 1X69A 3RNJA 1SHFA 1GBRA 2JS2A 1G83A 2JXBA 2O2OA 4DEYA 4IIOA 2GQIA 1ABOA 2F2VA 1AWXA 2EW3A 2PTKA 2YUOA 1WX6A 4F17A 1S1NA 4RTZA 2KT1A 2BZXA 1UG1A 2DBKA 1KFZA 2X3XD 2YUPA 2L3SA 2YDLA 1M3AA 1YWOA 2SEMA 1WXUA 2LJ0A 1X2QA 2O9SA 2K6DA 4CC7A 4JZ4A 2DA9A 5IXFA 2KRMA 4LUEA 2NWMA 2RMOA 1WFWA 2AZSA 3THKA 2DF6A 2DJQA 1SRLA 2KXCA 3H0IA 2LCSA 2CT4A 2OJ2A 4OMMA 2RQUA 2FPDA 3VS3A 4AG2C 2V1QA 3ULRB 3EHQA 1Y57A 1K9AA 3EGUA 1BBZA 2EGEA 1GCQA 2YUNA 2J6FA 1W70A 1E7OA 1JXMA 2ROTA 1X6BA 5IHNA 2K79A 2CH4A 2V1RA 3I35A 2BZYA 2XMFA 1KIKA 3H41A 2KT8A 1SHGA 1CSKA 1X6GA 1BK2A 4ESRA 1K0SA 1UHCA 1W1FA 1I07A 2NUZA 5IHKA 2J06A 1YCSB 1N5ZA 4J9IA 2VVKA 4J9FA 4AFZC 2PZ1A 2HSPA 2B86A 2AKLA 2LP5A 1UFFA 1M3BA 4AFQC 1H8KA 2VKNA 1UECA 2OAWA 2DRMA 2HCKA 1H92A 3VS4A 2F2WA 2YUQA 3GBQA 2J05A 1AWOA 4AFSC 1M3CA 2KROA 1NM7A 1PNJA 2FG0A 1GFCA 4AFUC 1I0CA 1E6HA 3M0RA 1T0JA 4HVUA 4JZ3A 2L0AA 1NG2A 1QKXA 2HBWA 1ZUKA 5GJVB 3NHNA 2ENMA 3KFVA 1NLOC 1SEMA 2KYBA 2OI3A 2DX1A 1GBQA 2RQWA 1PKSA 3PE0A 2LQWA 1ZLMA 1FYNA 2K2MA 1GCPA 4JJBA 3VS2A 2L3QA 3VS0A 1K1ZA 2HEQA 3REAB 2I0NA 3A98A 1YWPA 3U23A 1MV0B 4LNPA 1M27C 4OMLA 1Y0MA 2CUBA 1WLPB 2EYXA 4E6RA 3H0HA 3VRZA 1VYVA 1OOTA 5FW9A 2DILA 2JW4A 5GJWB 2IIMA 3IQLA 1UHFA 2FRWA 3EG1A 2O31A 4A63B 4K11A 4J9EA 5HCKA 1U06A 4AG1C 5IXBA 4D8KA 2FPEA 2KR3A 4OMQA 2K3BA 4ZNXA 4DEXA 4HCKA 4OMPA 3JV3A 2JMCA 2BZ8A 1B3QA 3SHWA 2LQNA 2LJ1A 1GCQC 2RQTA 1QKWA 4F14A 1NYGA 2EBPA 4LE9A 2GTOA 1PRMC 2PNIA 1WIEA 4OMNA 1ARKA 1HJDA 1RI9A 3QWYA 1ABQA 3LH5A 2ED0A 2GGRA 2GNCA 1JQQA 4RTXA 2CDTA 2DYBA 1ZBJA 2ESWA 2FO0A 2D0NA 1W6XA 2QDLA 2VWFA 4X1VA 4J9GA 4RTVA 1SPKA 3TSWA 2GTJA 1RLPC 2JS0A 1NLPC 1X43A 2G6FX 1LCKA 2FEIA 2A28A 1AZGB 2X3WD 2EQIA 2KEAA 2CH4W 3NMZC 2DL4A 2MOXA 2RF0A 3NPFA 1AOJA 4GBQA 4HVVA 4RTTA 4QT7A 1GFDA 4D8DA 2O88A 4Z88A 1GL5A 2DBMA 3QWXX 1T0HA 2DL8A 2LX7A 1WXBA 4Z89A 4IIMA 3M0TA 4ORZA 1WYXA 4JJCA 4Y92A 2EYYA 1YN8A 1T3SA 1T3LA 3UA6A 2ABLA 3UATA 2YSQA 2DL7A 4LN2A 1AD5A 2KRSA 2D8HA 1WA7A 2MIOA 2DM1A 1XOVA 1JU5C 3VRYA 2M51A 5FWBA 2C0OA 1UJYA 2M0YA 3O5ZA 4FSSA 3VS5A 3M0UA 4GLMA 2AK5A 3I5RA 3UF4A 2KNBB 4JJDA 3R6NA 1UDLA 3EG0A 2RPNA 3VS7A 2KYMA 1WI7A 2ROLA 2LZ6B 3TVTA 1AWJA 1VA7A 1K76A 2J6KA 1I1JA 3M0SA 1YP5A 1X2KA 2ED1A 2JT4A 1NEBA 4LUDA 3NGPA 1HD3A 1QWFA 3EG2A 3I9QA 2LNHB 2RQRA 2KGTA 3CQTA 1PWTA 1AEYA 2E5KA 5IHIA 3EHRA 1RUWA 1PHTA 3REBB 2DMOA 1OPKA 2EPDA 3RBBB 1ZX6A 1NEGA 3PVLA 2KBTA 2O9VA 1UE9A 2FPFA 2P4RA 2CUDA 1EFNA 1K4US 2JM8A 1M30A 2DL5A 1UUEA 1UTIA 5L23A 2AZVA 4CC2A 3SEMA 2DL3A 2DRKA 1PKTA 2KRNA 1QWEA 1UJ0A 2L3PA 2D1XA 1TUDA 3VS1A 4R0KA 1AWWA 5I22A 1TG0A 5EC7A 2LJ3A 1H3HA 1WXTA 2W10A 2RN8A 2YT6A 1JXOA 1QCFA 3FJ5A 2A37A 5I11A 2DLPA 2DNUA 2RQVA 2EGAA 2D8JA 2EGCA 2LMJA 1FMKA 2F2XA 4F16A 2BTTA 2EVRA 2C0IA 3PVQA 4M4ZA 2RNAA 1AVZC 2MCNA 2KXDA 1HSQA 1GRIA 4CC3A 1X27A 2CREA 4HXJA 1U3OA 4J9BA 3C0CA 2SRCA 2DE0X 1KSWA 1OEBA 1JEGA 1Z9ZA 1AZEA 1RLQC 1NYFA 1MUZA 1M8MA 3UA7A 2JM9A 1ZSGA 1MV3A 1V1CA 4Z8AA 1UGVA 1OPLA 1B07A 1E6GA 1OV3A 2GBQA 1WDXA 2AKKA 1Z9QA 1SRMA 2W0ZA
chains in the Genus database with same CATH superfamily
2ZPEB 3H0FA 2K7AA 3EH2A 3MP6A 3QYGB 3G4SA 1IO6A 2EYWA 3QKJA 1OX9A 2H8HA 2NUPA 2XU8A 3OS1A 4QQGA 5D7UA 1U1SA 4ME7A 4QW2A 4J9HA 2EIFA 5ECAA 2E5QA 2EKHA 4NS5A 1VQMQ 2XICA 2LDMA 1SF9A 2RA2A 3M54A 4CRIA 3CD6T 4M7AA 2AHJB 3H6ZA 1J3TA 3EG3A 1PRLC 1IGUA 4KRTA 2JTEA 2J7IA 4C92D 3PMTA 1VQKQ 1N8RR 4ELYC 2CT3A 2H3JA 3TQ7P 1K9MR 1YIJT 4RUGA 1VQ9A 2E4HA 1KD1C 1G2BA 3CC2T 4F7UA 4ZGEB 4WCIA 2JMAA 1RAFB 1YJWA 3UWNA 2QA4T 2HDAA 3HL8A 1WHMA 1BKBA 2R57A 2KVQG 3QJ6A 2QAZA 2JS2A 3A8MB 2CP3A 3OBYA 4FYVB 5D6XA 3WVEB 3RMQA 2CP2A 2O2OA 1H3ZA 2F5KA 2OTLT 1ABOA 2EQKA 3OYJA 2PTKA 2YUOA 1I5LA 2WACA 2E64A 1VQPA 2DBKA 1NJIU 1KFZA 3RMSA 1JBMA 1YHQT 2DD5A 2YDLA 2VGNA 3N5BB 3JCMQ 2SEMA 1VQ8A 2LJ0A 3HHTB 3QPHA 4PJOG 4MDXA 3PFSA 2O9SA 4PFPA 1ZHIA 2EJ9A 5IXFA 3A8GB 3CCRA 1YCYA 4M78G 2DVEA 1ZSZC 1NE8A 2QQ9A 1SRLA 2DJQA 2LCSA 2OJ2A 3META 4FCYA 1VQNQ 4AG2C 1VQOT 3ULRB 3QZ5B 3MKDA 2LT4A 2J6FA 2DPPB 3TREA 2DTHA 2D9TA 3CCJT 1TOVA 4OB1B 1KHCA 1MMDA 5KCHA 3H41A 1M1GA 2X4XA 3GNFB 5FU7C 4ESRA 1W1FA 2X9HA 3MJXA 5KYUB 4J9FA 5I2SA 1WQWA 4AFZC 4E2FB 5EG2A 1I4K1 2K5LA 1VQ5T 1YFNA 2DRMA 2I2LA 5I2MA 1VQ7T 3L2ZA 4JDSA 2KROA 2VB6A 1PNJA 3CMEA 2HSEB 4YTLA 1I0CA 1T0JA 4JZ3A 3I56Q 2KY9A 4ZTFA 4JS5A 5CQYA 2RHYA 5GJVB 1Q95G 3QG1A 3M59A 2B8AA 2ENMA 5LJ3j 3CCEQ 4C92G 2L8DA 3KFVA 1VQPQ 2PU9B 2COZA 1VQ6Q 1SEMA 1ZA1B 3ZFJA 1Q81C 3DKMA 4FYXB 4KGVB 4Y91A 4XU0A 1Q81U 1FYNA 2K2MA 1GCPA 3VS2A 5KYNA 5GAOm 1WHGA 2CGHA 2HEQA 2YHTA 3M4GA 3U23A 4TVRA 1MV0B 2V8IA 1HK9A 2QQAA 3H0HA 3VRZA 3JCMc 1VYVA 5FW9A 2DILA 3OS5A 2LC4A 3IQLA 1UHFA 1MHNA 1RACB 1U06A 2COYA 3LGFA 4M7DF 2YRVA 4E7SA 4C5IA 1G5VA 4XQ3A 1M2VA 2AIRB 4EMKC 4M75G 4Q5WA 5J26A 4PL6A 2JMCA 3CPWA 2DXBA 3QSUA 4KULA 4BDZA 4PFZA 5GANe 2LJ1A 1GCQC 4M7DC 3JCMh 1NBEB 2CZ7B 2O4XA 1C6VX 1M1FA 1M90R 1WIEA 1ZSZB 1D09B 1K8AR 4KBMB 1QVFA 5KH6A 3MEVA 4C8QF 2KSSA 4A4GA 2IPOB 2FL7A 2ESWA 4M7AE 2FO0A 2EFIA 2VWFA 3MCAB 4RTVA 3OYEA 3CMEQ 2DKGA 2CP7A 2XDPA 2GTJA 2M1HA 1Q82C 3CCUQ 1X43A 2A28A 2EQIA 4LD9K 1N8RC 1X75C 2CH4W 1YJNQ 1LOJA 2MOXA 3NPFA 1K9MC 4QT7A 3AHUA 1LPLA 4JS4A 3X28B 4F7UE 3OQ5A 3QWXX 1N8RU 1G3SA 2DL8A 3HPWA 4IIMA 4M7AC 5CIUA 4HT9A 1UGRB 4J83A 2P84A 2DEQA 4JJCA 2DIQA 1N9SA 2KDSA 2L5QA 1VQ5A 4KH1B 5GAMh 1SKUB 1T3LA 2CYZB 2RHZA 5GAMg 1VQ7A 2H3EB 1BIAA 4LN2A 1TSFA 5IN1A 5CKEA 3WVDB 2MIOA 2DM1A 1XOVA 1JU5C 1Q7YC 2C0OA 1EZZB 2XKOC 3CCMQ 4LXCA 4FSSA 3MP8A 4GLMA 5GAOq 1IREB 2RK1A 3P8DA 1JJ2S 1PD1A 4M78E 3GNGA 4JJDA 4PJOF 1UDLA 3CCST 5L8RE 8AT1B 4KGXB 3J80E 4Y28E 4JLGA 3M0SA 4M78F 2ED1A 1OX8A 3RDVA 4FYYB 2PUOB 4XTZA 3NGPA 2CZ6B 2LRQA 2K2VA 1PD0A 1MMNA 3CC7A 2MMPA 3GP8A 1RI0A 4C0FA 4IURA 1D3BA 5LJ5e 5GMKi 2FB7A 5KYWA 2HQXA 4M78C 3REBB 4XTVA 1OPKA 1YITA 2KBTA 4ELZC 1X6OA 2L89A 4MZMA 3CBPA 1K4US 2XDDA 1UTIA 5C0MA 3FIFA 2PVDB 1VQKT 1PKTA 1RAGB 2EWNA 2HKNA 2XG8D 1UJ0A 2QASA 2LJ3A 1S72A 3UT1A 2A37A 2K5IA 4F04B 1NJIR 1PCXA 4FT4A 1QQJA 3JB9J 1ZSZA 1BI1A 2BTTA 1M9SA 4XTWA 1MNEA 1RAAB 2RNAA 1AVZC 4KH0B 4C92E 2KXDA 3HKSA 1X27A 4HXJA 2MWPA 3CBMA 1MUZA 2COWA 2JM9A 4C92F 1WQ7A 1OPLA 4N4HA 2GBQA 4BD3A 1WDXA 2IVWA 2QQBA 5KE3A 1QCOA 1WJSA 2KE9A 2NUPB 4RTUA 3L2VA 4DA4A 1QLYA 2EYQA 4C92C 3G1JA 5GANd 3E9GA 1AT1B 5A0GA 1VYUA 2MF2A 4M7AB 4C8QD 4PLLA 1D1CA 1VQNT 5FWCA 4ZGDB 4EIKA 4QVZA 4A4HA 1R0BG 5FU6C 2A36A 3V8KA 3CCQQ 3P8BB 3CMAQ 5GAN8 1TUCA 3TU4K 1VQ4A 4RTYA 2NYSA 4V2SA 3CCVT 4F7UB 1ZUUA 4M75F 1BIBA 1SSHA 1QCNA 2FZGB 4JJNK 2XI9A 3SWNA 1O9SA 4IKFA 2C0TA 3D7SB 1M90C 1X69A 3RNJA 1K73R 1YJ9A 1GBRA 1K8AC 1G83A 5LJ3e 2JXBA 4FYWB 4IUPA 4XAXB 4X34A 4IIOA 1M90U 3PMIA 2K4YA 3CC4Q 1K8AU 4F17A 2BZXA 1UG1A 3G6EQ 1NPRA 3C12A 4X9CA 2P0PA 3I56T 3NTKA 4II1A 1XJWB 2L3SA 1M3AA 3OS2A 4IUTA 5HKCA 4PJOD 2OTJA 4XU2A 2P0QA 1VQ6T 2ZPHB 4CC7A 2DA9A 5KE2A 3JCMV 2GQVA 4LUEA 3RKXA 5GAMj 4EMKA 3THKA 4C5GA 4JRPA 3G71A 3H0IA 2KXCA 4C0DC 3MEAA 3RR6A 3DLLA 3OY9A 2V1QA 4N4IA 3V8JA 1GCQA 4FT2A 1W70A 2FVUA 5DLQE 4M7DA 1X6BA 3H9NA 3VU3C 2CH4A 1M4ZA 3I35A 2XMFA 3CPWP 1WNLA 1ZBXA 1YI2Q 1NPPA 3OMCA 1BK2A 2YLBA 3QJYA 1I07A 4MMLA 5IHKA 4LD6A 1YCSB 3MO8A 4M77D 3VKIA 4J9IA 3PIOA 3FEOA 3CPWS 2PZ1A 2HSPA 2B86A 1QVFP 3CCLQ 1HXDA 2X4JA 1D0YA 1IGQA 5FRMA 3OYBA 3CPFA 1VIFA 3M55A 2VKNA 1UECA 4C8QG 1M8VA 1UB4A 2E1HA 3GBQA 1QVFS 4AFSC 4J8OA 4E7LA 2HQHA 2XDBA 1YJ9Q 4OB2B 2VUBA 1NG2A 1QKXA 5DY9A 2MK5A 1ZUKA 3L2QA 1JRIA 5FU6B 1MMAA 5FROA 2RI2A 3MHXA 2JTFA 4DBQA 5GANf 1TU0B 4FU6A 1NLOC 5FRNA 3CCVA 1XTDA 5GAN5 3CCUT 2DEUA 3J81E 2DX1A 1GBQA 2Y90A 4KUIA 2ZZDA 2XHCA 4FL6A 3JAME 1VQLQ 2LQWA 4QVCA 3JB9I 2C06A 2L3QA 4J5YA 2PVGB 3VS0A 3REAB 3OYFA 2I0NA 1UEBA 1LVKA 1TS9A 1NJIC 1YBYA 4OB0B 5CCAA 1G8XA 1Y0MA 2DXUA 4E6RA 4ZN1A 1PSFA 1Q86R 5GJWB 1M2VB 2X4WA 1SG5A 4J6XA 3OA6A 4A63B 2O31A 3FDRA 4K11A 4ATOA 4PJOA 4AG1C 5IXBA 4D8KA 5CK9A 3OYDA 3HSBA 4M75D 4M78A 2HZYA 2DJZA 5FLXE 4OMQA 2K3BA 1SSFA 2O4XB 4OMPA 4E7JA 2BZ8A 1M5Q1 3S3NA 3G4SQ 2K3YA 4A4FA 4DBFA 5A0LA 2WSCE 3C95A 1NYGA 3OSVA 4OMNA 3UDCA 2EQJA 3QHSA 2A3LA 3QWYA 1ABQA 3CXCA 4PFOA 2ED0A 2GNCA 5J3BA 4C0DB 1N9RA 3JCMb 3S3OA 5LJ3d 2X35A 3E1SA 4PLIA 1RADB 2QDLA 4X1VA 4J9GA 3INZA 3JSCA 2YXYA 4QQDA 3TSWA 2K57A 4MZTA 1RLPC 1NLPC 4R55A 2FEIA 4IUUA 4E7IA 2AT1B 4M77G 5D6YA 1WJRA 3C94A 1VQ9Q 5KYXA 1GFDA 2O88A 4O6JA 1T0HA 2V8JA 4KGZB 4UC4A 4Z89A 1YJWQ 5LJ5f 5KYYA 1I81A 4L6V5 4Y92A 3OW2A 5C6SA 1N6AA 4C0ZA 4JRIA 4XTUA 4C92A 1VOMA 4FM4B 3CD6A 1K73U 2BIVA 5GAN6 4RCCA 4MZPA 3J7AF 3SWNC 2EKOA 4BE2A 3ME9A 5FWBA 1UJYA 5GMKm 2HL5C 2XD0A 1QP3A 1VQ8Q 1YIJA 3VS5A 2DXCA 1TUGB 2AK5A 3UF4A 1FXXA 3A1PA 2HKQB 3CC2A 1IXDA 3EG0A 2RPNA 3VS7A 2E70A 2KYMA 2QI2A 3CCRQ 3GPLA 2QA4A 1YP5A 2PUKB 1D3BB 5GAOn 5KYWB 1HD3A 2HAXA 3HRUA 2V8KA 4BUGA 4M7DE 2OTLA 2MAMA 2GFAA 2DO3A 1PWTA 2ZAEA 2E5KA 5IHIA 1R0CB 1PHTA 3JCMe 4C0GA 4M75A 1YHQA 1M1KR 2EPDA 2RHXA 1ZX6A 3LWHA 2LCCA 2FPFA 2CUDA 3CMAT 2JM8A 4LDXA 2DL5A 3I55T 2AZVA 1OYXA 3SEMA 4WF2A 4BE1A 1TUDA 2D0QB 1U1TA 4R0KA 4C8QE 2ZPBB 4KT0E 1TG0A 4A54A 4JRKA 3QDRB 2W10A 2RN8A 1VQOA 3JRZA 2HMAA 2DNUA 2RI5A 4A4EA 2XK0A 1B7TA 3CCJA 3E2UA 2FZKB 3SD4A 2WSFE 5J39A 2K3XA 3R6OA 1KC8U 2FZCB 4BACA 1KSWA 1OEBA 2RI3A 1GXIE 1Z9ZA 1RLQC 1MMGA 4C8QC 2KAFA 5GAMe 4Z8AA 1QVPA 3QYHB 3ZBDA 3G6ET 1UGVA 5FU7B 1E6GA 4HCZA 4ZTJA 2AKKA 4OF1A 3EG9A 5A0DA 1CKBA 2RJCA 2K5FA 5LJ3f 3TSZA 3RERA 2JJ9A 2VV5A 1BB9A 2QEXT 2CSIA 2BKDN 2MWOA 4NOYA 1PC0A 4BE0A 2IG0A 4CC4B 3QZ9B 1W4SA 2L2PA 2V26A 4J7FA 1VYTA 3GIBA 3KBGA 4FSXA 2Y4YA 1K0XA 3M4YA 2CSQA 1PSEA 1QMCA 1Q86C 2OTLQ 2K9GA 1QP2A 2FRYA 1CKAA 4PJOE 4AMCA 3ZL7C 2VXEA 4B9XA 1Q86U 3CEYA 1Y71A 1A0NB 2R58A 3RESA 3OBWA 3LX7A 3SWNB 3JB9H 5GAOl 3MPUB 1YI2T 3M0QA 3M0PA 1I5OB 4PJLA 1OU9A 4JPBW 2RM4A 1OZ2A 2LQKA 4RKUE 4RTWA 3BDLA 2DVJA 3LW5E 3CCLT 4PJOC 2M9UA 2ZPFB 1KQ1A 1SHFA 2E3HA 3HP9A 1VQMT 2NLUA 3A8OB 2F2VA 2VC8A 1JB0E 1WX6A 2R5MA 1S1NA 4RTZA 2KT1A 3A8LB 3RIRA 3RKYA 2GFUA 5CKBA 3EGXA 2X3XD 2LNVA 1YWOA 1WXUA 3HRSA 4EMKB 3OSSC 4M77F 2RK2A 1X2QA 1MNDA 2RHUA 4QQ6A 4E7ZA 2F5TX 3V7RA 2JVVA 1OQKA 2NWMA 2RMOA 1WFWA 2AZSA 4M7DB 2DF6A 5DLOA 1VQLT 2CT4A 4OMMA 3OYGA 1IHVA 3OYMA 1VQ5Q 1XNIA 4M77C 1TH7A 3EHQA 1Y57A 3EGUA 3L2WA 5LJ5g 1N27A 3SB2A 1BBZA 3VUZA 3HTRA 1VQ7Q 2P0KA 5IHNA 2F69A 4JUVA 3NFCA 3GLXA 2BZYA 3TEEA 1KIKA 4XTXA 3JCMd 5A2QE 1SHGA 4BI3A 2WSEE 1X6GA 3ASKA 4PJMA 1UHCA 1K0SA 2ZPIB 2J06A 2QQSA 4C8QB 4KUDK 2A7YA 2PQWA 3CXCP 3M53A 2QEXA 1M3BA 3G4ST 3S6WA 2OAWA 2HCKA 2RJDA 1H92A 3VS4A 2YUQA 2DTIA 2DAQA 2J05A 3CC7Q 3CXCS 8ATCB 1M3CA 1X01A 2FG0A 1GFCA 4A4KA 4M75E 1E6HA 4HVUA 1M1KC 4OGCA 2HL3A 2DETA 1YITQ 2NUTA 2E12A 3JB9G 3EFOA 4EPCA 3M56A 1OZ3A 1M1KU 2RH2A 2HD0A 2DXTA 3CCSA 2KYBA 4D6WA 2EJFA 5GAMd 2HBPA 1WHJA 2KI7A 2BUDA 4DOVA 1PKSA 3OW2P 3VUBA 1VQ9T 3OYCA 2YLCA 1UGPB 5CAIA 1ZLMA 2A0FB 4JJBA 1S72Q 4M75C 2LQ8A 1K1ZA 2Z0WA 1WHKA 1XQHA 1YJWT 3X24B 3A98A 4A53A 1YWPA 3OW2S 2F1LA 3LWIA 4LNPA 5CQXA 4BDYA 2MPXC 4PJOB 4RMOA 1WLPB 1OULA 2P4TA 2M16A 1OOTA 2JW4A 4M78B 4RG8A 2FRWA 3EG1A 3OYYA 2RD1A 4J9EA 3CCET 3HRTA 5IT9E 1VQPT 2LCLA 2YRDA 1QVGA 4BY6C 3Q1JA 1IRXA 1OI1A 1VQKA 2QTXA 4ZNXA 1VQ8T 4HCKA 3JV3A 1PM3A 2G3RA 3SHWA 2LQNA 2RQTA 3VYHB 3CCRT 1MGQA 1FMVA 4F14A 2EBPA 2GTOA 2OX7A 1RI9A 3KXTA 3BFMA 3LH5A 4XU1A 1Y96B 4GY5A 3TCJA 4DBHA 1F1BB 2CP6A 3M5AA 3EH1A 3QIIA 1W6XA 2QYZA 4ZGJB 2E6ZA 3PNWC 5KYXB 2RB6A 2QXFA 1VQ4Q 2GCXA 2G6FX 4LDVA 1LCKA 3QBYA 1AZGB 2KEAA 2DL4A 3VV0A 4HVVA 4D8DA 5KYYB 4Z88A 4C8QA 1JJ2A 2DBMA 1GL5A 4J6WA 4PNOA 1V76A 7AT1B 4OP0A 2LX7A 3V7CA 3M0TA 4C92B 3KUFA 1KC8R 4ORZA 3JCMf 1WYXA 5GAN3 1VQNA 1D0ZA 1YN8A 1T3SA 2FHDA 5HY6A 1TWBA 3UA6A 3FJPA 5GMKh 2DL7A 1AD5A 2CP5A 5CKDA 3CMET 1OU8A 1W2BA 1KQ2A 2DIGA 3VRYA 2M51A 2CZ0B 4QVDA 1D1AA 1YJNT 3O5ZA 5CR2A 4NL3A 2DERA 3A8HB 2OTJQ 4N4GA 4LDWA 4M7AG 1Q82R 2ATCB 3WXMB 2KNBB 3R6NA 4C5EA 1WI7A 5LJ5j 2ROLA 4WTOB 2LZ6B 3X25B 1AWJA 2JZ2A 4FW2A 3E19A 2KMTA 4OGEA 3G71Q 4J7IA 2JT4A 1NEBA 4LUDA 4DQ2A 1QWFA 3EG2A 2LNHB 4F7UG 2RQRA 4M75B 4XU3A 2KGTA 3CQTA 3SDZA 1KD1U 5I21A 5GAMf 2ZPGB 3HFNA 2JN0A 4CI0C 1B34A 4N0AC 2E6NA 3I56A 5AYFA 3RBBB 1FX7A 3CCEA 2O9VA 1UE9A 3CCMT 3X26B 1EFNA 1M30A 4RCBA 1Q7YR 1VQ6A 1UUEA 5L23A 5GAN4 1C0MA 4BY6B 2DRKA 2KRNA 1QWEA 2D1XA 4E7KA 1RAEB 5CO7A 5I22A 4R56A 5EC7A 4E47A 1WJQA 2YT6A 1JXOA 3FJ5A 5I11A 2DLPA 2EGAA 2D8JA 1FMKA 2EVRA 1KQSA 4Z02A 1ACMB 3FRNA 2EJGA 3PVQA 1Y96A 2MCNA 3RKWA 2CS7A 1HSQA 4M77A 2CREA 4J9BA 3BE3A 2SRCA 1JEGA 3EG9B 3JB9F 1NYFA 1ZSGA 5CKHA 2BE7D 1WPYA 2DD4A 1B07A 4HT8A 2DFUA 3CCVQ 4IUQA 2VASA 1OV3A 1Z9QA 4DBRA 4JLIA 2E65A 1SRMA 2W0ZA 3DLMA 1K73C 4PKCC 1NZ9A 5LL6S 3FB9A 1RAIB 5GAN2 4GLKA 1ZUYA 3LLRA 1YNZA 1H641 4FIBA 4JRQA 2YRCA 4J9DA 2QG9B 1I8FA 3I5SA 3AT1B 1KJWA 1V29B 2LVMA 2RJFA 2J6OA 1TTHB 2KK4A 2A08A 3E9FA 3ER0A 4J9CA 3CCUA 5IH2A 1YJNA 1IHWA 3GF5A 1JO8A 4HVWA 1U5SA 4E7HA 3LH0A 1UGQB 2EYZA 3C4SA 1BU1A 2CZ1B 4HA8A 3PTAA 2ZCFB 4OMOA 2MYSA 2ECZA 4J6YA 2E41A 3VS6A 3P8HA 3QXEB 1G3TA 1LJOA 2DYIA 3EGXB 1R77A 4DEYA 2GQIA 3L42A 4IUVA 3V8LA 1WHHA 3CC7T 1AWXA 2EQMA 2EW3A 4BI8B 3CCQT 1HYOA 4O5VA 4PJNA 3FC3A 4DOWA 1YITT 2YUPA 3CCMA 2O01E 1KK7A 1ZQ1A 1AHJB 4MMKA 3PT9A 1BCMA 3ZEHA 3HFOA 2K6DA 4JZ4A 4AT1B 2KRMA 2LT1A 2DZCA 1PG5B 1KC8C 5IAYA 2RO0A 5GMKj 2RQUA 1S72T 2FPDA 3VS3A 2M02A 1K9AA 1EIFA 1IB8A 2EGEA 2YUNA 3PIPA 3JCMg 1E7OA 2VGMA 1JXMA 3CD6Q 1QVGP 3VJPA 2ROTA 1QW1A 3CC4T 4C5HA 2K79A 5HK0A 2CKKA 3EFSA 1D0XA 2EAYA 2V1RA 5GANh 4B9WA 2KT8A 5M9OA 3OYIA 2MI6A 1YIJQ 5GANg 1QVGS 1CSKA 4L59A 2NUZA 5HK3A 4M7AF 2E3IA 3JCMW 3CC2Q 1N5ZA 2VVKA 1ZA2B 1M2OA 1EX4A 2AKLA 2QA4Q 1WHLA 1Q82U 3EGDB 3S3MA 2LP5A 4PJJA 1UFFA 4AFQC 5KYUA 3OYHA 1H8KA 3QDFA 5CKFA 1K9MU 3X20B 4MDWA 3BW1A 2F2WA 3CBOA 4OVAA 4F7UF 1AWOA 2NUTB 2X51A 5GMKl 3EFOB 1NM7A 4AFUC 3JCMP 3NTHA 1KG1A 3M0RA 3JB9D 4L5GA 2L0AA 1YHQQ 4HKEA 2HBWA 3QUIA 2JNGA 3NHNA 1C1AA 2FYKA 1JJ2P 2QTVA 1VQ4T 2OI3A 4OMFB 6AT1B 2DTOA 2RQWA 3OYLA 1LNXA 1Q7YU 3PE0A 4EMGA 1D1BA 1VQOQ 4ZN3A 1G3YA 3BY7A 5D6WA 5DM7R 1W2BP 1M27C 4LDYA 4OMLA 2CUBA 2EYXA 3CCJQ 1YJ9T 4EMHA 3VYGA 4ANJA 2QQRA 3URGA 3BDUA 2PVOB 4M77E 1G3WA 3FLGA 2IIMA 3M58A 1FMWA 2EQUA 3CCQA 1W2BS 5HCKA 3CMAA 2FPEA 3DB3A 3JCMX 2VYTA 2JUFA 3I55A 2KR3A 1BYMA 5AT1B 2E10A 5CVIA 4N0AA 2Y4XA 9ATCB 4DEXA 2OTJT 3G7ZA 3EAEA 1KD1R 3L2UA 1B3QA 2JTMA 5LJ5h 1QKWA 1WGSA 4LE9A 1PRMC 2PNIA 3NTIA 1HJDA 1ARKA 3G71T 3MEWA 4QKUA 3A5ZB 2GGRA 1JQQA 4FW1A 3O8VA 4RTXA 2CDTA 3PGGA 4LDUA 2DYBA 1ZBJA 1IZ6A 1KHIA 2D0NA 2CP0A 2QGGA 3CC4A 2JOYA 1SPKA 2QGFB 3G6EA 2JS0A 4HCCA 4RG2A 4BI4A 3L2RA 3OYNA 4M7DD 2X3WD 3NMZC 5GAN7 2RF0A 1AOJA 4GBQA 1Y7XA 4RTTA 4B6MA 1DJ7B 3OS0A 5GAOr 2M0OA 2D6FA 1WXBA 1KQSP 2ZGWA 3EGDA 3L1AA 1U8RA 2LTOA 2EYYA 1WZOA 1KQSS 2ABLA 4EDUA 3UATA 1VIEA 3MP1A 2YSQA 4BB7A 2KRSA 2D8HA 1WA7A 4VUBA 1TXQA 1R8OB 1VUBA 2M0YA 1YI2A 1BI3A 2HNIA 2YWWA 3MEUA 4M7AD 3M0UA 3I5RA 3LGLA 3I55Q 1BI0A 3EFRA 2VXFA 3TVTA 1VA7A 2RHIA 1K76A 2J6KA 1I1JA 3CCLA 3OYKA 1X2KA 1BI2A 1Y07A 2QDYB 1VQMA 1B34B 3I9QA 3OMGA 2DZ9A 2XIDA 1RL2A 4NL2A 5GANj 1AEYA 3QO3A 3EHRA 4XK8E 1RUWA 3RUXA 2DMOA 4XTYA 3M9QA 3LYIA 1NEGA 2L3RA 3V7SA 4PK4A 3DB4A 2HQEA 3JCMJ 2P4RA 3GOXA 5KCOA 2R5AA 4X9DA 1Q81R 4CC2A 2DL3A 2X4YA 5LJ3h 3OB9A 2GF7A 3SFMA 2OAUA 2L3PA 5LJ3g 3VS1A 1AWWA 2BE9B 3T9NA 1VQLA 2QEXQ 1H3HA 1WXTA 3M57A 1RAHB 4M78D 2QK0A 2LX9A 1QCFA 2RJEA 2RQVA 4M77B 2EGCA 2LMJA 1FWZA 2F2XA 4F16A 2C0IA 4M4ZA 5GAOp 3F70A 1RABB 1UGSB 1O75A 2KQWA 4OB3B 3OYAA 1GRIA 4CC3A 4HCBA 1U3OA 3C0CA 2DE0X 1AZEA 4M7DG 1M8MA 1P92A 3UA7A 1BCOA 1MV3A 1V1CA 4P5NA 5LJ5d 3H8ZA 3CCSQ 5GMKe 2DK3A 3PVLA 3UPUA
chains in the Genus database with same CATH topology
1CKBA 2KE9A 3H0FA 2K7AA 4RTUA 3TSZA 1BB9A 1QLYA 2CSIA 1IO6A 2EYWA 4CC4B 2H8HA 1VYUA 2L2PA 1ZUYA 1VYTA 4J9HA 1YNZA 5ECAA 5FWCA 4EIKA 1K0XA 2EKHA 2CSQA 2K9GA 4J9DA 3I5SA 2FRYA 1CKAA 1KJWA 2A36A 1J3TA 2J6OA 3ZL7C 3EG3A 2A08A 1PRLC 1TUCA 4RTYA 1A0NB 4J9CA 4KRTA 2JTEA 2J7IA 5IH2A 2CT3A 3M0QA 3M0PA 1ZUUA 4RUGA 1SSHA 1JO8A 4HVWA 4JPBW 1G2BA 1U5SA 2EYZA 1BU1A 4RTWA 4WCIA 2JMAA 2C0TA 2DVJA 4OMOA 2HDAA 2ECZA 3VS6A 1X69A 3RNJA 1SHFA 1GBRA 2JS2A 1G83A 2JXBA 2O2OA 4DEYA 4IIOA 2GQIA 1ABOA 2F2VA 1AWXA 2EW3A 2PTKA 2YUOA 1WX6A 4F17A 1S1NA 4RTZA 2KT1A 2BZXA 1UG1A 2DBKA 1KFZA 2X3XD 2YUPA 2L3SA 2YDLA 1M3AA 1YWOA 2SEMA 1WXUA 2LJ0A 1X2QA 2O9SA 2K6DA 4CC7A 4JZ4A 2DA9A 5IXFA 2KRMA 4LUEA 2NWMA 2RMOA 1WFWA 2AZSA 3THKA 2DF6A 2DJQA 1SRLA 2KXCA 3H0IA 2LCSA 2CT4A 2OJ2A 4OMMA 2RQUA 2FPDA 3VS3A 4AG2C 2V1QA 3ULRB 3EHQA 1Y57A 1K9AA 3EGUA 1BBZA 2EGEA 1GCQA 2YUNA 2J6FA 1W70A 1E7OA 1JXMA 2ROTA 1X6BA 5IHNA 2K79A 2CH4A 2V1RA 3I35A 2BZYA 2XMFA 1KIKA 3H41A 2KT8A 1SHGA 1CSKA 1X6GA 1BK2A 4ESRA 1K0SA 1UHCA 1W1FA 1I07A 2NUZA 5IHKA 2J06A 1YCSB 1N5ZA 4J9IA 2VVKA 4J9FA 4AFZC 2PZ1A 2HSPA 2B86A 2AKLA 2LP5A 1UFFA 1M3BA 4AFQC 1H8KA 2VKNA 1UECA 2OAWA 2DRMA 2HCKA 1H92A 3VS4A 2F2WA 2YUQA 3GBQA 2J05A 1AWOA 4AFSC 1M3CA 2KROA 1NM7A 1PNJA 2FG0A 1GFCA 4AFUC 1I0CA 1E6HA 3M0RA 1T0JA 4HVUA 4JZ3A 2L0AA 1NG2A 1QKXA 2HBWA 1ZUKA 5GJVB 3NHNA 2ENMA 3KFVA 1NLOC 1SEMA 2KYBA 2OI3A 2DX1A 1GBQA 2RQWA 1PKSA 3PE0A 2LQWA 1ZLMA 1FYNA 2K2MA 1GCPA 4JJBA 3VS2A 2L3QA 3VS0A 1K1ZA 2HEQA 3REAB 2I0NA 3A98A 1YWPA 3U23A 1MV0B 4LNPA 1M27C 4OMLA 1Y0MA 2CUBA 1WLPB 2EYXA 4E6RA 3H0HA 3VRZA 1VYVA 1OOTA 5FW9A 2DILA 2JW4A 5GJWB 2IIMA 3IQLA 1UHFA 2FRWA 3EG1A 2O31A 4A63B 4K11A 4J9EA 5HCKA 1U06A 4AG1C 5IXBA 4D8KA 2FPEA 2KR3A 4OMQA 2K3BA 4ZNXA 4DEXA 4HCKA 4OMPA 3JV3A 2JMCA 2BZ8A 1B3QA 3SHWA 2LQNA 2LJ1A 1GCQC 2RQTA 1QKWA 4F14A 1NYGA 2EBPA 4LE9A 2GTOA 1PRMC 2PNIA 1WIEA 4OMNA 1ARKA 1HJDA 1RI9A 3QWYA 1ABQA 3LH5A 2ED0A 2GGRA 2GNCA 1JQQA 4RTXA 2CDTA 2DYBA 1ZBJA 2ESWA 2FO0A 2D0NA 1W6XA 2QDLA 2VWFA 4X1VA 4J9GA 4RTVA 1SPKA 3TSWA 2GTJA 1RLPC 2JS0A 1NLPC 1X43A 2G6FX 1LCKA 2FEIA 2A28A 1AZGB 2X3WD 2EQIA 2KEAA 2CH4W 3NMZC 2DL4A 2MOXA 2RF0A 3NPFA 1AOJA 4GBQA 4HVVA 4RTTA 4QT7A 1GFDA 4D8DA 2O88A 4Z88A 1GL5A 2DBMA 3QWXX 1T0HA 2DL8A 2LX7A 1WXBA 4Z89A 4IIMA 3M0TA 4ORZA 1WYXA 4JJCA 4Y92A 2EYYA 1YN8A 1T3SA 1T3LA 3UA6A 2ABLA 3UATA 2YSQA 2DL7A 4LN2A 1AD5A 2KRSA 2D8HA 1WA7A 2MIOA 2DM1A 1XOVA 1JU5C 3VRYA 2M51A 5FWBA 2C0OA 1UJYA 2M0YA 3O5ZA 4FSSA 3VS5A 3M0UA 4GLMA 2AK5A 3I5RA 3UF4A 2KNBB 4JJDA 3R6NA 1UDLA 3EG0A 2RPNA 3VS7A 2KYMA 1WI7A 2ROLA 2LZ6B 3TVTA 1AWJA 1VA7A 1K76A 2J6KA 1I1JA 3M0SA 1YP5A 1X2KA 2ED1A 2JT4A 1NEBA 4LUDA 3NGPA 1HD3A 1QWFA 3EG2A 3I9QA 2LNHB 2RQRA 2KGTA 3CQTA 1PWTA 1AEYA 2E5KA 5IHIA 3EHRA 1RUWA 1PHTA 3REBB 2DMOA 1OPKA 2EPDA 3RBBB 1ZX6A 1NEGA 3PVLA 2KBTA 2O9VA 1UE9A 2FPFA 2P4RA 2CUDA 1EFNA 1K4US 2JM8A 1M30A 2DL5A 1UUEA 1UTIA 5L23A 2AZVA 4CC2A 3SEMA 2DL3A 2DRKA 1PKTA 2KRNA 1QWEA 1UJ0A 2L3PA 2D1XA 1TUDA 3VS1A 4R0KA 1AWWA 5I22A 1TG0A 5EC7A 2LJ3A 1H3HA 1WXTA 2W10A 2RN8A 2YT6A 1JXOA 1QCFA 3FJ5A 2A37A 5I11A 2DLPA 2DNUA 2RQVA 2EGAA 2D8JA 2EGCA 2LMJA 1FMKA 2F2XA 4F16A 2BTTA 2EVRA 2C0IA 3PVQA 4M4ZA 2RNAA 1AVZC 2MCNA 2KXDA 1HSQA 1GRIA 4CC3A 1X27A 2CREA 4HXJA 1U3OA 4J9BA 3C0CA 2SRCA 2DE0X 1KSWA 1OEBA 1JEGA 1Z9ZA 1AZEA 1RLQC 1NYFA 1MUZA 1M8MA 3UA7A 2JM9A 1ZSGA 1MV3A 1V1CA 4Z8AA 1UGVA 1OPLA 1B07A 1E6GA 1OV3A 2GBQA 1WDXA 2AKKA 1Z9QA 1SRMA 2W0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKB A;  2KE9 A;  3H0F A;  2K7A A;  4RTU A;  3TSZ A;  1BB9 A;  1QLY A;  2CSI A;  1IO6 A;  2EYW A;  4CC4 B;  2H8H A;  1VYU A;  2L2P A;  1ZUY A;  1VYT A;  4J9H A;  1YNZ A;  5ECA A;  5FWC A;  4EIK A;  1K0X A;  2EKH A;  2CSQ A;  2K9G A;  4J9D A;  3I5S A;  2FRY A;  1CKA A;  1KJW A;  2A36 A;  1J3T A;  2J6O A;  3ZL7 C;  3EG3 A;  2A08 A;  1PRL C;  1TUC A;  4RTY A;  1A0N B;  4J9C A;  4KRT A;  2JTE A;  2J7I A;  5IH2 A;  2CT3 A;  3M0Q A;  3M0P A;  1ZUU A;  4RUG A;  1SSH A;  1JO8 A;  4HVW A;  4JPB W;  1G2B A;  1U5S A;  2EYZ A;  1BU1 A;  4RTW A;  4WCI A;  2JMA A;  2C0T A;  2DVJ A;  4OMO A;  2HDA A;  2ECZ A;  3VS6 A;  1X69 A;  3RNJ A;  1SHF A;  1GBR A;  2JS2 A;  1G83 A;  2JXB A;  2O2O A;  4DEY A;  4IIO A;  2GQI A;  1ABO A;  2F2V A;  1AWX A;  2EW3 A;  2PTK A;  2YUO A;  1WX6 A;  4F17 A;  1S1N A;  4RTZ A;  2KT1 A;  2BZX A;  1UG1 A;  2DBK A;  1KFZ A;  2X3X D;  2YUP A;  2L3S A;  2YDL A;  1M3A A;  1YWO A;  2SEM A;  1WXU A;  2LJ0 A;  1X2Q A;  2O9S A;  2K6D A;  4CC7 A;  4JZ4 A;  2DA9 A;  5IXF A;  2KRM A;  4LUE A;  2NWM A;  2RMO A;  1WFW A;  2AZS A;  3THK A;  2DF6 A;  2DJQ A;  1SRL A;  2KXC A;  3H0I A;  2LCS A;  2CT4 A;  2OJ2 A;  4OMM A;  2RQU A;  2FPD A;  3VS3 A;  4AG2 C;  2V1Q A;  3ULR B;  3EHQ A;  1Y57 A;  1K9A A;  3EGU A;  1BBZ A;  2EGE A;  1GCQ A;  2YUN A;  2J6F A;  1W70 A;  1E7O A;  1JXM A;  2ROT A;  1X6B A;  5IHN A;  2K79 A;  2CH4 A;  2V1R A;  3I35 A;  2BZY A;  2XMF A;  1KIK A;  3H41 A;  2KT8 A;  1SHG A;  1CSK A;  1X6G A;  1BK2 A;  4ESR A;  1K0S A;  1UHC A;  1W1F A;  1I07 A;  2NUZ A;  5IHK A;  2J06 A;  1YCS B;  1N5Z A;  4J9I A;  2VVK A;  4J9F A;  4AFZ C;  2PZ1 A;  2HSP A;  2B86 A;  2AKL A;  2LP5 A;  1UFF A;  1M3B A;  4AFQ C;  1H8K A;  2VKN A;  1UEC A;  2OAW A;  2DRM A;  2HCK A;  1H92 A;  3VS4 A;  2F2W A;  2YUQ A;  3GBQ A;  2J05 A;  1AWO A;  4AFS C;  1M3C A;  2KRO A;  1NM7 A;  1PNJ A;  2FG0 A;  1GFC A;  4AFU C;  1I0C A;  1E6H A;  3M0R A;  1T0J A;  4HVU A;  4JZ3 A;  2L0A A;  1NG2 A;  1QKX A;  2HBW A;  1ZUK A;  5GJV B;  3NHN A;  2ENM A;  3KFV A;  1NLO C;  1SEM A;  2KYB A;  2OI3 A;  2DX1 A;  1GBQ A;  2RQW A;  1PKS A;  3PE0 A;  2LQW A;  1ZLM A;  1FYN A;  2K2M A;  1GCP A;  4JJB A;  3VS2 A;  2L3Q A;  3VS0 A;  1K1Z A;  2HEQ A;  3REA B;  2I0N A;  3A98 A;  1YWP A;  3U23 A;  1MV0 B;  4LNP A;  1M27 C;  4OML A;  1Y0M A;  2CUB A;  1WLP B;  2EYX A;  4E6R A;  3H0H A;  3VRZ A;  1VYV A;  1OOT A;  5FW9 A;  2DIL A;  2JW4 A;  5GJW B;  2IIM A;  3IQL A;  1UHF A;  2FRW A;  3EG1 A;  2O31 A;  4A63 B;  4K11 A;  4J9E A;  5HCK A;  1U06 A;  4AG1 C;  5IXB A;  4D8K A;  2FPE A;  2KR3 A;  4OMQ A;  2K3B A;  4ZNX A;  4DEX A;  4HCK A;  4OMP A;  3JV3 A;  2JMC A;  2BZ8 A;  1B3Q A;  3SHW A;  2LQN A;  2LJ1 A;  1GCQ C;  2RQT A;  1QKW A;  4F14 A;  1NYG A;  2EBP A;  4LE9 A;  2GTO A;  1PRM C;  2PNI A;  1WIE A;  4OMN A;  1ARK A;  1HJD A;  1RI9 A;  3QWY A;  1ABQ A;  3LH5 A;  2ED0 A;  2GGR A;  2GNC A;  1JQQ A;  4RTX A;  2CDT A;  2DYB A;  1ZBJ A;  2ESW A;  2FO0 A;  2D0N A;  1W6X A;  2QDL A;  2VWF A;  4X1V A;  4J9G A;  4RTV A;  1SPK A;  3TSW A;  2GTJ A;  1RLP C;  2JS0 A;  1NLP C;  1X43 A;  2G6F X;  1LCK A;  2FEI A;  2A28 A;  1AZG B;  2X3W D;  2EQI A;  2KEA A;  2CH4 W;  3NMZ C;  2DL4 A;  2MOX A;  2RF0 A;  3NPF A;  1AOJ A;  4GBQ A;  4HVV A;  4RTT A;  4QT7 A;  1GFD A;  4D8D A;  2O88 A;  4Z88 A;  1GL5 A;  2DBM A;  3QWX X;  1T0H A;  2DL8 A;  2LX7 A;  1WXB A;  4Z89 A;  4IIM A;  3M0T A;  4ORZ A;  1WYX A;  4JJC A;  4Y92 A;  2EYY A;  1YN8 A;  1T3S A;  1T3L A;  3UA6 A;  2ABL A;  3UAT A;  2YSQ A;  2DL7 A;  4LN2 A;  1AD5 A;  2KRS A;  2D8H A;  1WA7 A;  2MIO A;  2DM1 A;  1XOV A;  1JU5 C;  3VRY A;  2M51 A;  5FWB A;  2C0O A;  1UJY A;  2M0Y A;  3O5Z A;  4FSS A;  3VS5 A;  3M0U A;  4GLM A;  2AK5 A;  3I5R A;  3UF4 A;  2KNB B;  4JJD A;  3R6N A;  1UDL A;  3EG0 A;  2RPN A;  3VS7 A;  2KYM A;  1WI7 A;  2ROL A;  2LZ6 B;  3TVT A;  1AWJ A;  1VA7 A;  1K76 A;  2J6K A;  1I1J A;  3M0S A;  1YP5 A;  1X2K A;  2ED1 A;  2JT4 A;  1NEB A;  4LUD A;  3NGP A;  1HD3 A;  1QWF A;  3EG2 A;  3I9Q A;  2LNH B;  2RQR A;  2KGT A;  3CQT A;  1PWT A;  1AEY A;  2E5K A;  5IHI A;  3EHR A;  1RUW A;  1PHT A;  3REB B;  2DMO A;  1OPK A;  2EPD A;  3RBB B;  1ZX6 A;  1NEG A;  3PVL A;  2KBT A;  2O9V A;  1UE9 A;  2FPF A;  2P4R A;  2CUD A;  1EFN A;  1K4U S;  2JM8 A;  1M30 A;  2DL5 A;  1UUE A;  1UTI A;  5L23 A;  2AZV A;  4CC2 A;  3SEM A;  2DL3 A;  2DRK A;  1PKT A;  2KRN A;  1QWE A;  1UJ0 A;  2L3P A;  2D1X A;  1TUD A;  3VS1 A;  4R0K A;  1AWW A;  5I22 A;  1TG0 A;  5EC7 A;  2LJ3 A;  1H3H A;  1WXT A;  2W10 A;  2RN8 A;  2YT6 A;  1JXO A;  1QCF A;  3FJ5 A;  2A37 A;  5I11 A;  2DLP A;  2DNU A;  2RQV A;  2EGA A;  2D8J A;  2EGC A;  2LMJ A;  1FMK A;  2F2X A;  4F16 A;  2BTT A;  2EVR A;  2C0I A;  3PVQ A;  4M4Z A;  2RNA A;  1AVZ C;  2MCN A;  2KXD A;  1HSQ A;  1GRI A;  4CC3 A;  1X27 A;  2CRE A;  4HXJ A;  1U3O A;  4J9B A;  3C0C A;  2SRC A;  2DE0 X;  1KSW A;  1OEB A;  1JEG A;  1Z9Z A;  1AZE A;  1RLQ C;  1NYF A;  1MUZ A;  1M8M A;  3UA7 A;  2JM9 A;  1ZSG A;  1MV3 A;  1V1C A;  4Z8A A;  1UGV A;  1OPL A;  1B07 A;  1E6G A;  1OV3 A;  2GBQ A;  1WDX A;  2AKK A;  1Z9Q A;  1SRM A;  2W0Z A; 
#chains in the Genus database with same CATH topology
 2ZPE B;  3H0F A;  2K7A A;  3EH2 A;  3MP6 A;  3QYG B;  3G4S A;  1IO6 A;  2EYW A;  3QKJ A;  1OX9 A;  2H8H A;  2NUP A;  2XU8 A;  3OS1 A;  4QQG A;  5D7U A;  1U1S A;  4ME7 A;  4QW2 A;  4J9H A;  2EIF A;  5ECA A;  2E5Q A;  2EKH A;  4NS5 A;  1VQM Q;  2XIC A;  2LDM A;  1SF9 A;  2RA2 A;  3M54 A;  4CRI A;  3CD6 T;  4M7A A;  2AHJ B;  3H6Z A;  1J3T A;  3EG3 A;  1PRL C;  1IGU A;  4KRT A;  2JTE A;  2J7I A;  4C92 D;  3PMT A;  1VQK Q;  1N8R R;  4ELY C;  2CT3 A;  2H3J A;  3TQ7 P;  1K9M R;  1YIJ T;  4RUG A;  1VQ9 A;  2E4H A;  1KD1 C;  1G2B A;  3CC2 T;  4F7U A;  4ZGE B;  4WCI A;  2JMA A;  1RAF B;  1YJW A;  3UWN A;  2QA4 T;  2HDA A;  3HL8 A;  1WHM A;  1BKB A;  2R57 A;  2KVQ G;  3QJ6 A;  2QAZ A;  2JS2 A;  3A8M B;  2CP3 A;  3OBY A;  4FYV B;  5D6X A;  3WVE B;  3RMQ A;  2CP2 A;  2O2O A;  1H3Z A;  2F5K A;  2OTL T;  1ABO A;  2EQK A;  3OYJ A;  2PTK A;  2YUO A;  1I5L A;  2WAC A;  2E64 A;  1VQP A;  2DBK A;  1NJI U;  1KFZ A;  3RMS A;  1JBM A;  1YHQ T;  2DD5 A;  2YDL A;  2VGN A;  3N5B B;  3JCM Q;  2SEM A;  1VQ8 A;  2LJ0 A;  3HHT B;  3QPH A;  4PJO G;  4MDX A;  3PFS A;  2O9S A;  4PFP A;  1ZHI A;  2EJ9 A;  5IXF A;  3A8G B;  3CCR A;  1YCY A;  4M78 G;  2DVE A;  1ZSZ C;  1NE8 A;  2QQ9 A;  1SRL A;  2DJQ A;  2LCS A;  2OJ2 A;  3MET A;  4FCY A;  1VQN Q;  4AG2 C;  1VQO T;  3ULR B;  3QZ5 B;  3MKD A;  2LT4 A;  2J6F A;  2DPP B;  3TRE A;  2DTH A;  2D9T A;  3CCJ T;  1TOV A;  4OB1 B;  1KHC A;  1MMD A;  5KCH A;  3H41 A;  1M1G A;  2X4X A;  3GNF B;  5FU7 C;  4ESR A;  1W1F A;  2X9H A;  3MJX A;  5KYU B;  4J9F A;  5I2S A;  1WQW A;  4AFZ C;  4E2F B;  5EG2 A;  1I4K 1;  2K5L A;  1VQ5 T;  1YFN A;  2DRM A;  2I2L A;  5I2M A;  1VQ7 T;  3L2Z A;  4JDS A;  2KRO A;  2VB6 A;  1PNJ A;  3CME A;  2HSE B;  4YTL A;  1I0C A;  1T0J A;  4JZ3 A;  3I56 Q;  2KY9 A;  4ZTF A;  4JS5 A;  5CQY A;  2RHY A;  5GJV B;  1Q95 G;  3QG1 A;  3M59 A;  2B8A A;  2ENM A;  5LJ3 j;  3CCE Q;  4C92 G;  2L8D A;  3KFV A;  1VQP Q;  2PU9 B;  2COZ A;  1VQ6 Q;  1SEM A;  1ZA1 B;  3ZFJ A;  1Q81 C;  3DKM A;  4FYX B;  4KGV B;  4Y91 A;  4XU0 A;  1Q81 U;  1FYN A;  2K2M A;  1GCP A;  3VS2 A;  5KYN A;  5GAO m;  1WHG A;  2CGH A;  2HEQ A;  2YHT A;  3M4G A;  3U23 A;  4TVR A;  1MV0 B;  2V8I A;  1HK9 A;  2QQA A;  3H0H A;  3VRZ A;  3JCM c;  1VYV A;  5FW9 A;  2DIL A;  3OS5 A;  2LC4 A;  3IQL A;  1UHF A;  1MHN A;  1RAC B;  1U06 A;  2COY A;  3LGF A;  4M7D F;  2YRV A;  4E7S A;  4C5I A;  1G5V A;  4XQ3 A;  1M2V A;  2AIR B;  4EMK C;  4M75 G;  4Q5W A;  5J26 A;  4PL6 A;  2JMC A;  3CPW A;  2DXB A;  3QSU A;  4KUL A;  4BDZ A;  4PFZ A;  5GAN e;  2LJ1 A;  1GCQ C;  4M7D C;  3JCM h;  1NBE B;  2CZ7 B;  2O4X A;  1C6V X;  1M1F A;  1M90 R;  1WIE A;  1ZSZ B;  1D09 B;  1K8A R;  4KBM B;  1QVF A;  5KH6 A;  3MEV A;  4C8Q F;  2KSS A;  4A4G A;  2IPO B;  2FL7 A;  2ESW A;  4M7A E;  2FO0 A;  2EFI A;  2VWF A;  3MCA B;  4RTV A;  3OYE A;  3CME Q;  2DKG A;  2CP7 A;  2XDP A;  2GTJ A;  2M1H A;  1Q82 C;  3CCU Q;  1X43 A;  2A28 A;  2EQI A;  4LD9 K;  1N8R C;  1X75 C;  2CH4 W;  1YJN Q;  1LOJ A;  2MOX A;  3NPF A;  1K9M C;  4QT7 A;  3AHU A;  1LPL A;  4JS4 A;  3X28 B;  4F7U E;  3OQ5 A;  3QWX X;  1N8R U;  1G3S A;  2DL8 A;  3HPW A;  4IIM A;  4M7A C;  5CIU A;  4HT9 A;  1UGR B;  4J83 A;  2P84 A;  2DEQ A;  4JJC A;  2DIQ A;  1N9S A;  2KDS A;  2L5Q A;  1VQ5 A;  4KH1 B;  5GAM h;  1SKU B;  1T3L A;  2CYZ B;  2RHZ A;  5GAM g;  1VQ7 A;  2H3E B;  1BIA A;  4LN2 A;  1TSF A;  5IN1 A;  5CKE A;  3WVD B;  2MIO A;  2DM1 A;  1XOV A;  1JU5 C;  1Q7Y C;  2C0O A;  1EZZ B;  2XKO C;  3CCM Q;  4LXC A;  4FSS A;  3MP8 A;  4GLM A;  5GAO q;  1IRE B;  2RK1 A;  3P8D A;  1JJ2 S;  1PD1 A;  4M78 E;  3GNG A;  4JJD A;  4PJO F;  1UDL A;  3CCS T;  5L8R E;  8AT1 B;  4KGX B;  3J80 E;  4Y28 E;  4JLG A;  3M0S A;  4M78 F;  2ED1 A;  1OX8 A;  3RDV A;  4FYY B;  2PUO B;  4XTZ A;  3NGP A;  2CZ6 B;  2LRQ A;  2K2V A;  1PD0 A;  1MMN A;  3CC7 A;  2MMP A;  3GP8 A;  1RI0 A;  4C0F A;  4IUR A;  1D3B A;  5LJ5 e;  5GMK i;  2FB7 A;  5KYW A;  2HQX A;  4M78 C;  3REB B;  4XTV A;  1OPK A;  1YIT A;  2KBT A;  4ELZ C;  1X6O A;  2L89 A;  4MZM A;  3CBP A;  1K4U S;  2XDD A;  1UTI A;  5C0M A;  3FIF A;  2PVD B;  1VQK T;  1PKT A;  1RAG B;  2EWN A;  2HKN A;  2XG8 D;  1UJ0 A;  2QAS A;  2LJ3 A;  1S72 A;  3UT1 A;  2A37 A;  2K5I A;  4F04 B;  1NJI R;  1PCX A;  4FT4 A;  1QQJ A;  3JB9 J;  1ZSZ A;  1BI1 A;  2BTT A;  1M9S A;  4XTW A;  1MNE A;  1RAA B;  2RNA A;  1AVZ C;  4KH0 B;  4C92 E;  2KXD A;  3HKS A;  1X27 A;  4HXJ A;  2MWP A;  3CBM A;  1MUZ A;  2COW A;  2JM9 A;  4C92 F;  1WQ7 A;  1OPL A;  4N4H A;  2GBQ A;  4BD3 A;  1WDX A;  2IVW A;  2QQB A;  5KE3 A;  1QCO A;  1WJS A;  2KE9 A;  2NUP B;  4RTU A;  3L2V A;  4DA4 A;  1QLY A;  2EYQ A;  4C92 C;  3G1J A;  5GAN d;  3E9G A;  1AT1 B;  5A0G A;  1VYU A;  2MF2 A;  4M7A B;  4C8Q D;  4PLL A;  1D1C A;  1VQN T;  5FWC A;  4ZGD B;  4EIK A;  4QVZ A;  4A4H A;  1R0B G;  5FU6 C;  2A36 A;  3V8K A;  3CCQ Q;  3P8B B;  3CMA Q;  5GAN 8;  1TUC A;  3TU4 K;  1VQ4 A;  4RTY A;  2NYS A;  4V2S A;  3CCV T;  4F7U B;  1ZUU A;  4M75 F;  1BIB A;  1SSH A;  1QCN A;  2FZG B;  4JJN K;  2XI9 A;  3SWN A;  1O9S A;  4IKF A;  2C0T A;  3D7S B;  1M90 C;  1X69 A;  3RNJ A;  1K73 R;  1YJ9 A;  1GBR A;  1K8A C;  1G83 A;  5LJ3 e;  2JXB A;  4FYW B;  4IUP A;  4XAX B;  4X34 A;  4IIO A;  1M90 U;  3PMI A;  2K4Y A;  3CC4 Q;  1K8A U;  4F17 A;  2BZX A;  1UG1 A;  3G6E Q;  1NPR A;  3C12 A;  4X9C A;  2P0P A;  3I56 T;  3NTK A;  4II1 A;  1XJW B;  2L3S A;  1M3A A;  3OS2 A;  4IUT A;  5HKC A;  4PJO D;  2OTJ A;  4XU2 A;  2P0Q A;  1VQ6 T;  2ZPH B;  4CC7 A;  2DA9 A;  5KE2 A;  3JCM V;  2GQV A;  4LUE A;  3RKX A;  5GAM j;  4EMK A;  3THK A;  4C5G A;  4JRP A;  3G71 A;  3H0I A;  2KXC A;  4C0D C;  3MEA A;  3RR6 A;  3DLL A;  3OY9 A;  2V1Q A;  4N4I A;  3V8J A;  1GCQ A;  4FT2 A;  1W70 A;  2FVU A;  5DLQ E;  4M7D A;  1X6B A;  3H9N A;  3VU3 C;  2CH4 A;  1M4Z A;  3I35 A;  2XMF A;  3CPW P;  1WNL A;  1ZBX A;  1YI2 Q;  1NPP A;  3OMC A;  1BK2 A;  2YLB A;  3QJY A;  1I07 A;  4MML A;  5IHK A;  4LD6 A;  1YCS B;  3MO8 A;  4M77 D;  3VKI A;  4J9I A;  3PIO A;  3FEO A;  3CPW S;  2PZ1 A;  2HSP A;  2B86 A;  1QVF P;  3CCL Q;  1HXD A;  2X4J A;  1D0Y A;  1IGQ A;  5FRM A;  3OYB A;  3CPF A;  1VIF A;  3M55 A;  2VKN A;  1UEC A;  4C8Q G;  1M8V A;  1UB4 A;  2E1H A;  3GBQ A;  1QVF S;  4AFS C;  4J8O A;  4E7L A;  2HQH A;  2XDB A;  1YJ9 Q;  4OB2 B;  2VUB A;  1NG2 A;  1QKX A;  5DY9 A;  2MK5 A;  1ZUK A;  3L2Q A;  1JRI A;  5FU6 B;  1MMA A;  5FRO A;  2RI2 A;  3MHX A;  2JTF A;  4DBQ A;  5GAN f;  1TU0 B;  4FU6 A;  1NLO C;  5FRN A;  3CCV A;  1XTD A;  5GAN 5;  3CCU T;  2DEU A;  3J81 E;  2DX1 A;  1GBQ A;  2Y90 A;  4KUI A;  2ZZD A;  2XHC A;  4FL6 A;  3JAM E;  1VQL Q;  2LQW A;  4QVC A;  3JB9 I;  2C06 A;  2L3Q A;  4J5Y A;  2PVG B;  3VS0 A;  3REA B;  3OYF A;  2I0N A;  1UEB A;  1LVK A;  1TS9 A;  1NJI C;  1YBY A;  4OB0 B;  5CCA A;  1G8X A;  1Y0M A;  2DXU A;  4E6R A;  4ZN1 A;  1PSF A;  1Q86 R;  5GJW B;  1M2V B;  2X4W A;  1SG5 A;  4J6X A;  3OA6 A;  4A63 B;  2O31 A;  3FDR A;  4K11 A;  4ATO A;  4PJO A;  4AG1 C;  5IXB A;  4D8K A;  5CK9 A;  3OYD A;  3HSB A;  4M75 D;  4M78 A;  2HZY A;  2DJZ A;  5FLX E;  4OMQ A;  2K3B A;  1SSF A;  2O4X B;  4OMP A;  4E7J A;  2BZ8 A;  1M5Q 1;  3S3N A;  3G4S Q;  2K3Y A;  4A4F A;  4DBF A;  5A0L A;  2WSC E;  3C95 A;  1NYG A;  3OSV A;  4OMN A;  3UDC A;  2EQJ A;  3QHS A;  2A3L A;  3QWY A;  1ABQ A;  3CXC A;  4PFO A;  2ED0 A;  2GNC A;  5J3B A;  4C0D B;  1N9R A;  3JCM b;  3S3O A;  5LJ3 d;  2X35 A;  3E1S A;  4PLI A;  1RAD B;  2QDL A;  4X1V A;  4J9G A;  3INZ A;  3JSC A;  2YXY A;  4QQD A;  3TSW A;  2K57 A;  4MZT A;  1RLP C;  1NLP C;  4R55 A;  2FEI A;  4IUU A;  4E7I A;  2AT1 B;  4M77 G;  5D6Y A;  1WJR A;  3C94 A;  1VQ9 Q;  5KYX A;  1GFD A;  2O88 A;  4O6J A;  1T0H A;  2V8J A;  4KGZ B;  4UC4 A;  4Z89 A;  1YJW Q;  5LJ5 f;  5KYY A;  1I81 A;  4L6V 5;  4Y92 A;  3OW2 A;  5C6S A;  1N6A A;  4C0Z A;  4JRI A;  4XTU A;  4C92 A;  1VOM A;  4FM4 B;  3CD6 A;  1K73 U;  2BIV A;  5GAN 6;  4RCC A;  4MZP A;  3J7A F;  3SWN C;  2EKO A;  4BE2 A;  3ME9 A;  5FWB A;  1UJY A;  5GMK m;  2HL5 C;  2XD0 A;  1QP3 A;  1VQ8 Q;  1YIJ A;  3VS5 A;  2DXC A;  1TUG B;  2AK5 A;  3UF4 A;  1FXX A;  3A1P A;  2HKQ B;  3CC2 A;  1IXD A;  3EG0 A;  2RPN A;  3VS7 A;  2E70 A;  2KYM A;  2QI2 A;  3CCR Q;  3GPL A;  2QA4 A;  1YP5 A;  2PUK B;  1D3B B;  5GAO n;  5KYW B;  1HD3 A;  2HAX A;  3HRU A;  2V8K A;  4BUG A;  4M7D E;  2OTL A;  2MAM A;  2GFA A;  2DO3 A;  1PWT A;  2ZAE A;  2E5K A;  5IHI A;  1R0C B;  1PHT A;  3JCM e;  4C0G A;  4M75 A;  1YHQ A;  1M1K R;  2EPD A;  2RHX A;  1ZX6 A;  3LWH A;  2LCC A;  2FPF A;  2CUD A;  3CMA T;  2JM8 A;  4LDX A;  2DL5 A;  3I55 T;  2AZV A;  1OYX A;  3SEM A;  4WF2 A;  4BE1 A;  1TUD A;  2D0Q B;  1U1T A;  4R0K A;  4C8Q E;  2ZPB B;  4KT0 E;  1TG0 A;  4A54 A;  4JRK A;  3QDR B;  2W10 A;  2RN8 A;  1VQO A;  3JRZ A;  2HMA A;  2DNU A;  2RI5 A;  4A4E A;  2XK0 A;  1B7T A;  3CCJ A;  3E2U A;  2FZK B;  3SD4 A;  2WSF E;  5J39 A;  2K3X A;  3R6O A;  1KC8 U;  2FZC B;  4BAC A;  1KSW A;  1OEB A;  2RI3 A;  1GXI E;  1Z9Z A;  1RLQ C;  1MMG A;  4C8Q C;  2KAF A;  5GAM e;  4Z8A A;  1QVP A;  3QYH B;  3ZBD A;  3G6E T;  1UGV A;  5FU7 B;  1E6G A;  4HCZ A;  4ZTJ A;  2AKK A;  4OF1 A;  3EG9 A;  5A0D A;  1CKB A;  2RJC A;  2K5F A;  5LJ3 f;  3TSZ A;  3RER A;  2JJ9 A;  2VV5 A;  1BB9 A;  2QEX T;  2CSI A;  2BKD N;  2MWO A;  4NOY A;  1PC0 A;  4BE0 A;  2IG0 A;  4CC4 B;  3QZ9 B;  1W4S A;  2L2P A;  2V26 A;  4J7F A;  1VYT A;  3GIB A;  3KBG A;  4FSX A;  2Y4Y A;  1K0X A;  3M4Y A;  2CSQ A;  1PSE A;  1QMC A;  1Q86 C;  2OTL Q;  2K9G A;  1QP2 A;  2FRY A;  1CKA A;  4PJO E;  4AMC A;  3ZL7 C;  2VXE A;  4B9X A;  1Q86 U;  3CEY A;  1Y71 A;  1A0N B;  2R58 A;  3RES A;  3OBW A;  3LX7 A;  3SWN B;  3JB9 H;  5GAO l;  3MPU B;  1YI2 T;  3M0Q A;  3M0P A;  1I5O B;  4PJL A;  1OU9 A;  4JPB W;  2RM4 A;  1OZ2 A;  2LQK A;  4RKU E;  4RTW A;  3BDL A;  2DVJ A;  3LW5 E;  3CCL T;  4PJO C;  2M9U A;  2ZPF B;  1KQ1 A;  1SHF A;  2E3H A;  3HP9 A;  1VQM T;  2NLU A;  3A8O B;  2F2V A;  2VC8 A;  1JB0 E;  1WX6 A;  2R5M A;  1S1N A;  4RTZ A;  2KT1 A;  3A8L B;  3RIR A;  3RKY A;  2GFU A;  5CKB A;  3EGX A;  2X3X D;  2LNV A;  1YWO A;  1WXU A;  3HRS A;  4EMK B;  3OSS C;  4M77 F;  2RK2 A;  1X2Q A;  1MND A;  2RHU A;  4QQ6 A;  4E7Z A;  2F5T X;  3V7R A;  2JVV A;  1OQK A;  2NWM A;  2RMO A;  1WFW A;  2AZS A;  4M7D B;  2DF6 A;  5DLO A;  1VQL T;  2CT4 A;  4OMM A;  3OYG A;  1IHV A;  3OYM A;  1VQ5 Q;  1XNI A;  4M77 C;  1TH7 A;  3EHQ A;  1Y57 A;  3EGU A;  3L2W A;  5LJ5 g;  1N27 A;  3SB2 A;  1BBZ A;  3VUZ A;  3HTR A;  1VQ7 Q;  2P0K A;  5IHN A;  2F69 A;  4JUV A;  3NFC A;  3GLX A;  2BZY A;  3TEE A;  1KIK A;  4XTX A;  3JCM d;  5A2Q E;  1SHG A;  4BI3 A;  2WSE E;  1X6G A;  3ASK A;  4PJM A;  1UHC A;  1K0S A;  2ZPI B;  2J06 A;  2QQS A;  4C8Q B;  4KUD K;  2A7Y A;  2PQW A;  3CXC P;  3M53 A;  2QEX A;  1M3B A;  3G4S T;  3S6W A;  2OAW A;  2HCK A;  2RJD A;  1H92 A;  3VS4 A;  2YUQ A;  2DTI A;  2DAQ A;  2J05 A;  3CC7 Q;  3CXC S;  8ATC B;  1M3C A;  1X01 A;  2FG0 A;  1GFC A;  4A4K A;  4M75 E;  1E6H A;  4HVU A;  1M1K C;  4OGC A;  2HL3 A;  2DET A;  1YIT Q;  2NUT A;  2E12 A;  3JB9 G;  3EFO A;  4EPC A;  3M56 A;  1OZ3 A;  1M1K U;  2RH2 A;  2HD0 A;  2DXT A;  3CCS A;  2KYB A;  4D6W A;  2EJF A;  5GAM d;  2HBP A;  1WHJ A;  2KI7 A;  2BUD A;  4DOV A;  1PKS A;  3OW2 P;  3VUB A;  1VQ9 T;  3OYC A;  2YLC A;  1UGP B;  5CAI A;  1ZLM A;  2A0F B;  4JJB A;  1S72 Q;  4M75 C;  2LQ8 A;  1K1Z A;  2Z0W A;  1WHK A;  1XQH A;  1YJW T;  3X24 B;  3A98 A;  4A53 A;  1YWP A;  3OW2 S;  2F1L A;  3LWI A;  4LNP A;  5CQX A;  4BDY A;  2MPX C;  4PJO B;  4RMO A;  1WLP B;  1OUL A;  2P4T A;  2M16 A;  1OOT A;  2JW4 A;  4M78 B;  4RG8 A;  2FRW A;  3EG1 A;  3OYY A;  2RD1 A;  4J9E A;  3CCE T;  3HRT A;  5IT9 E;  1VQP T;  2LCL A;  2YRD A;  1QVG A;  4BY6 C;  3Q1J A;  1IRX A;  1OI1 A;  1VQK A;  2QTX A;  4ZNX A;  1VQ8 T;  4HCK A;  3JV3 A;  1PM3 A;  2G3R A;  3SHW A;  2LQN A;  2RQT A;  3VYH B;  3CCR T;  1MGQ A;  1FMV A;  4F14 A;  2EBP A;  2GTO A;  2OX7 A;  1RI9 A;  3KXT A;  3BFM A;  3LH5 A;  4XU1 A;  1Y96 B;  4GY5 A;  3TCJ A;  4DBH A;  1F1B B;  2CP6 A;  3M5A A;  3EH1 A;  3QII A;  1W6X A;  2QYZ A;  4ZGJ B;  2E6Z A;  3PNW C;  5KYX B;  2RB6 A;  2QXF A;  1VQ4 Q;  2GCX A;  2G6F X;  4LDV A;  1LCK A;  3QBY A;  1AZG B;  2KEA A;  2DL4 A;  3VV0 A;  4HVV A;  4D8D A;  5KYY B;  4Z88 A;  4C8Q A;  1JJ2 A;  2DBM A;  1GL5 A;  4J6W A;  4PNO A;  1V76 A;  7AT1 B;  4OP0 A;  2LX7 A;  3V7C A;  3M0T A;  4C92 B;  3KUF A;  1KC8 R;  4ORZ A;  3JCM f;  1WYX A;  5GAN 3;  1VQN A;  1D0Z A;  1YN8 A;  1T3S A;  2FHD A;  5HY6 A;  1TWB A;  3UA6 A;  3FJP A;  5GMK h;  2DL7 A;  1AD5 A;  2CP5 A;  5CKD A;  3CME T;  1OU8 A;  1W2B A;  1KQ2 A;  2DIG A;  3VRY A;  2M51 A;  2CZ0 B;  4QVD A;  1D1A A;  1YJN T;  3O5Z A;  5CR2 A;  4NL3 A;  2DER A;  3A8H B;  2OTJ Q;  4N4G A;  4LDW A;  4M7A G;  1Q82 R;  2ATC B;  3WXM B;  2KNB B;  3R6N A;  4C5E A;  1WI7 A;  5LJ5 j;  2ROL A;  4WTO B;  2LZ6 B;  3X25 B;  1AWJ A;  2JZ2 A;  4FW2 A;  3E19 A;  2KMT A;  4OGE A;  3G71 Q;  4J7I A;  2JT4 A;  1NEB A;  4LUD A;  4DQ2 A;  1QWF A;  3EG2 A;  2LNH B;  4F7U G;  2RQR A;  4M75 B;  4XU3 A;  2KGT A;  3CQT A;  3SDZ A;  1KD1 U;  5I21 A;  5GAM f;  2ZPG B;  3HFN A;  2JN0 A;  4CI0 C;  1B34 A;  4N0A C;  2E6N A;  3I56 A;  5AYF A;  3RBB B;  1FX7 A;  3CCE A;  2O9V A;  1UE9 A;  3CCM T;  3X26 B;  1EFN A;  1M30 A;  4RCB A;  1Q7Y R;  1VQ6 A;  1UUE A;  5L23 A;  5GAN 4;  1C0M A;  4BY6 B;  2DRK A;  2KRN A;  1QWE A;  2D1X A;  4E7K A;  1RAE B;  5CO7 A;  5I22 A;  4R56 A;  5EC7 A;  4E47 A;  1WJQ A;  2YT6 A;  1JXO A;  3FJ5 A;  5I11 A;  2DLP A;  2EGA A;  2D8J A;  1FMK A;  2EVR A;  1KQS A;  4Z02 A;  1ACM B;  3FRN A;  2EJG A;  3PVQ A;  1Y96 A;  2MCN A;  3RKW A;  2CS7 A;  1HSQ A;  4M77 A;  2CRE A;  4J9B A;  3BE3 A;  2SRC A;  1JEG A;  3EG9 B;  3JB9 F;  1NYF A;  1ZSG A;  5CKH A;  2BE7 D;  1WPY A;  2DD4 A;  1B07 A;  4HT8 A;  2DFU A;  3CCV Q;  4IUQ A;  2VAS A;  1OV3 A;  1Z9Q A;  4DBR A;  4JLI A;  2E65 A;  1SRM A;  2W0Z A;  3DLM A;  1K73 C;  4PKC C;  1NZ9 A;  5LL6 S;  3FB9 A;  1RAI B;  5GAN 2;  4GLK A;  1ZUY A;  3LLR A;  1YNZ A;  1H64 1;  4FIB A;  4JRQ A;  2YRC A;  4J9D A;  2QG9 B;  1I8F A;  3I5S A;  3AT1 B;  1KJW A;  1V29 B;  2LVM A;  2RJF A;  2J6O A;  1TTH B;  2KK4 A;  2A08 A;  3E9F A;  3ER0 A;  4J9C A;  3CCU A;  5IH2 A;  1YJN A;  1IHW A;  3GF5 A;  1JO8 A;  4HVW A;  1U5S A;  4E7H A;  3LH0 A;  1UGQ B;  2EYZ A;  3C4S A;  1BU1 A;  2CZ1 B;  4HA8 A;  3PTA A;  2ZCF B;  4OMO A;  2MYS A;  2ECZ A;  4J6Y A;  2E41 A;  3VS6 A;  3P8H A;  3QXE B;  1G3T A;  1LJO A;  2DYI A;  3EGX B;  1R77 A;  4DEY A;  2GQI A;  3L42 A;  4IUV A;  3V8L A;  1WHH A;  3CC7 T;  1AWX A;  2EQM A;  2EW3 A;  4BI8 B;  3CCQ T;  1HYO A;  4O5V A;  4PJN A;  3FC3 A;  4DOW A;  1YIT T;  2YUP A;  3CCM A;  2O01 E;  1KK7 A;  1ZQ1 A;  1AHJ B;  4MMK A;  3PT9 A;  1BCM A;  3ZEH A;  3HFO A;  2K6D A;  4JZ4 A;  4AT1 B;  2KRM A;  2LT1 A;  2DZC A;  1PG5 B;  1KC8 C;  5IAY A;  2RO0 A;  5GMK j;  2RQU A;  1S72 T;  2FPD A;  3VS3 A;  2M02 A;  1K9A A;  1EIF A;  1IB8 A;  2EGE A;  2YUN A;  3PIP A;  3JCM g;  1E7O A;  2VGM A;  1JXM A;  3CD6 Q;  1QVG P;  3VJP A;  2ROT A;  1QW1 A;  3CC4 T;  4C5H A;  2K79 A;  5HK0 A;  2CKK A;  3EFS A;  1D0X A;  2EAY A;  2V1R A;  5GAN h;  4B9W A;  2KT8 A;  5M9O A;  3OYI A;  2MI6 A;  1YIJ Q;  5GAN g;  1QVG S;  1CSK A;  4L59 A;  2NUZ A;  5HK3 A;  4M7A F;  2E3I A;  3JCM W;  3CC2 Q;  1N5Z A;  2VVK A;  1ZA2 B;  1M2O A;  1EX4 A;  2AKL A;  2QA4 Q;  1WHL A;  1Q82 U;  3EGD B;  3S3M A;  2LP5 A;  4PJJ A;  1UFF A;  4AFQ C;  5KYU A;  3OYH A;  1H8K A;  3QDF A;  5CKF A;  1K9M U;  3X20 B;  4MDW A;  3BW1 A;  2F2W A;  3CBO A;  4OVA A;  4F7U F;  1AWO A;  2NUT B;  2X51 A;  5GMK l;  3EFO B;  1NM7 A;  4AFU C;  3JCM P;  3NTH A;  1KG1 A;  3M0R A;  3JB9 D;  4L5G A;  2L0A A;  1YHQ Q;  4HKE A;  2HBW A;  3QUI A;  2JNG A;  3NHN A;  1C1A A;  2FYK A;  1JJ2 P;  2QTV A;  1VQ4 T;  2OI3 A;  4OMF B;  6AT1 B;  2DTO A;  2RQW A;  3OYL A;  1LNX A;  1Q7Y U;  3PE0 A;  4EMG A;  1D1B A;  1VQO Q;  4ZN3 A;  1G3Y A;  3BY7 A;  5D6W A;  5DM7 R;  1W2B P;  1M27 C;  4LDY A;  4OML A;  2CUB A;  2EYX A;  3CCJ Q;  1YJ9 T;  4EMH A;  3VYG A;  4ANJ A;  2QQR A;  3URG A;  3BDU A;  2PVO B;  4M77 E;  1G3W A;  3FLG A;  2IIM A;  3M58 A;  1FMW A;  2EQU A;  3CCQ A;  1W2B S;  5HCK A;  3CMA A;  2FPE A;  3DB3 A;  3JCM X;  2VYT A;  2JUF A;  3I55 A;  2KR3 A;  1BYM A;  5AT1 B;  2E10 A;  5CVI A;  4N0A A;  2Y4X A;  9ATC B;  4DEX A;  2OTJ T;  3G7Z A;  3EAE A;  1KD1 R;  3L2U A;  1B3Q A;  2JTM A;  5LJ5 h;  1QKW A;  1WGS A;  4LE9 A;  1PRM C;  2PNI A;  3NTI A;  1HJD A;  1ARK A;  3G71 T;  3MEW A;  4QKU A;  3A5Z B;  2GGR A;  1JQQ A;  4FW1 A;  3O8V A;  4RTX A;  2CDT A;  3PGG A;  4LDU A;  2DYB A;  1ZBJ A;  1IZ6 A;  1KHI A;  2D0N A;  2CP0 A;  2QGG A;  3CC4 A;  2JOY A;  1SPK A;  2QGF B;  3G6E A;  2JS0 A;  4HCC A;  4RG2 A;  4BI4 A;  3L2R A;  3OYN A;  4M7D D;  2X3W D;  3NMZ C;  5GAN 7;  2RF0 A;  1AOJ A;  4GBQ A;  1Y7X A;  4RTT A;  4B6M A;  1DJ7 B;  3OS0 A;  5GAO r;  2M0O A;  2D6F A;  1WXB A;  1KQS P;  2ZGW A;  3EGD A;  3L1A A;  1U8R A;  2LTO A;  2EYY A;  1WZO A;  1KQS S;  2ABL A;  4EDU A;  3UAT A;  1VIE A;  3MP1 A;  2YSQ A;  4BB7 A;  2KRS A;  2D8H A;  1WA7 A;  4VUB A;  1TXQ A;  1R8O B;  1VUB A;  2M0Y A;  1YI2 A;  1BI3 A;  2HNI A;  2YWW A;  3MEU A;  4M7A D;  3M0U A;  3I5R A;  3LGL A;  3I55 Q;  1BI0 A;  3EFR A;  2VXF A;  3TVT A;  1VA7 A;  2RHI A;  1K76 A;  2J6K A;  1I1J A;  3CCL A;  3OYK A;  1X2K A;  1BI2 A;  1Y07 A;  2QDY B;  1VQM A;  1B34 B;  3I9Q A;  3OMG A;  2DZ9 A;  2XID A;  1RL2 A;  4NL2 A;  5GAN j;  1AEY A;  3QO3 A;  3EHR A;  4XK8 E;  1RUW A;  3RUX A;  2DMO A;  4XTY A;  3M9Q A;  3LYI A;  1NEG A;  2L3R A;  3V7S A;  4PK4 A;  3DB4 A;  2HQE A;  3JCM J;  2P4R A;  3GOX A;  5KCO A;  2R5A A;  4X9D A;  1Q81 R;  4CC2 A;  2DL3 A;  2X4Y A;  5LJ3 h;  3OB9 A;  2GF7 A;  3SFM A;  2OAU A;  2L3P A;  5LJ3 g;  3VS1 A;  1AWW A;  2BE9 B;  3T9N A;  1VQL A;  2QEX Q;  1H3H A;  1WXT A;  3M57 A;  1RAH B;  4M78 D;  2QK0 A;  2LX9 A;  1QCF A;  2RJE A;  2RQV A;  4M77 B;  2EGC A;  2LMJ A;  1FWZ A;  2F2X A;  4F16 A;  2C0I A;  4M4Z A;  5GAO p;  3F70 A;  1RAB B;  1UGS B;  1O75 A;  2KQW A;  4OB3 B;  3OYA A;  1GRI A;  4CC3 A;  4HCB A;  1U3O A;  3C0C A;  2DE0 X;  1AZE A;  4M7D G;  1M8M A;  1P92 A;  3UA7 A;  1BCO A;  1MV3 A;  1V1C A;  4P5N A;  5LJ5 d;  3H8Z A;  3CCS Q;  5GMK e;  2DK3 A;  3PVL A;  3UPU A; 
#chains in the Genus database with same CATH homology
 1CKB A;  2KE9 A;  3H0F A;  2K7A A;  4RTU A;  3TSZ A;  1BB9 A;  1QLY A;  2CSI A;  1IO6 A;  2EYW A;  4CC4 B;  2H8H A;  1VYU A;  2L2P A;  1ZUY A;  1VYT A;  4J9H A;  1YNZ A;  5ECA A;  5FWC A;  4EIK A;  1K0X A;  2EKH A;  2CSQ A;  2K9G A;  4J9D A;  3I5S A;  2FRY A;  1CKA A;  1KJW A;  2A36 A;  1J3T A;  2J6O A;  3ZL7 C;  3EG3 A;  2A08 A;  1PRL C;  1TUC A;  4RTY A;  1A0N B;  4J9C A;  4KRT A;  2JTE A;  2J7I A;  5IH2 A;  2CT3 A;  3M0Q A;  3M0P A;  1ZUU A;  4RUG A;  1SSH A;  1JO8 A;  4HVW A;  4JPB W;  1G2B A;  1U5S A;  2EYZ A;  1BU1 A;  4RTW A;  4WCI A;  2JMA A;  2C0T A;  2DVJ A;  4OMO A;  2HDA A;  2ECZ A;  3VS6 A;  1X69 A;  3RNJ A;  1SHF A;  1GBR A;  2JS2 A;  1G83 A;  2JXB A;  2O2O A;  4DEY A;  4IIO A;  2GQI A;  1ABO A;  2F2V A;  1AWX A;  2EW3 A;  2PTK A;  2YUO A;  1WX6 A;  4F17 A;  1S1N A;  4RTZ A;  2KT1 A;  2BZX A;  1UG1 A;  2DBK A;  1KFZ A;  2X3X D;  2YUP A;  2L3S A;  2YDL A;  1M3A A;  1YWO A;  2SEM A;  1WXU A;  2LJ0 A;  1X2Q A;  2O9S A;  2K6D A;  4CC7 A;  4JZ4 A;  2DA9 A;  5IXF A;  2KRM A;  4LUE A;  2NWM A;  2RMO A;  1WFW A;  2AZS A;  3THK A;  2DF6 A;  2DJQ A;  1SRL A;  2KXC A;  3H0I A;  2LCS A;  2CT4 A;  2OJ2 A;  4OMM A;  2RQU A;  2FPD A;  3VS3 A;  4AG2 C;  2V1Q A;  3ULR B;  3EHQ A;  1Y57 A;  1K9A A;  3EGU A;  1BBZ A;  2EGE A;  1GCQ A;  2YUN A;  2J6F A;  1W70 A;  1E7O A;  1JXM A;  2ROT A;  1X6B A;  5IHN A;  2K79 A;  2CH4 A;  2V1R A;  3I35 A;  2BZY A;  2XMF A;  1KIK A;  3H41 A;  2KT8 A;  1SHG A;  1CSK A;  1X6G A;  1BK2 A;  4ESR A;  1K0S A;  1UHC A;  1W1F A;  1I07 A;  2NUZ A;  5IHK A;  2J06 A;  1YCS B;  1N5Z A;  4J9I A;  2VVK A;  4J9F A;  4AFZ C;  2PZ1 A;  2HSP A;  2B86 A;  2AKL A;  2LP5 A;  1UFF A;  1M3B A;  4AFQ C;  1H8K A;  2VKN A;  1UEC A;  2OAW A;  2DRM A;  2HCK A;  1H92 A;  3VS4 A;  2F2W A;  2YUQ A;  3GBQ A;  2J05 A;  1AWO A;  4AFS C;  1M3C A;  2KRO A;  1NM7 A;  1PNJ A;  2FG0 A;  1GFC A;  4AFU C;  1I0C A;  1E6H A;  3M0R A;  1T0J A;  4HVU A;  4JZ3 A;  2L0A A;  1NG2 A;  1QKX A;  2HBW A;  1ZUK A;  5GJV B;  3NHN A;  2ENM A;  3KFV A;  1NLO C;  1SEM A;  2KYB A;  2OI3 A;  2DX1 A;  1GBQ A;  2RQW A;  1PKS A;  3PE0 A;  2LQW A;  1ZLM A;  1FYN A;  2K2M A;  1GCP A;  4JJB A;  3VS2 A;  2L3Q A;  3VS0 A;  1K1Z A;  2HEQ A;  3REA B;  2I0N A;  3A98 A;  1YWP A;  3U23 A;  1MV0 B;  4LNP A;  1M27 C;  4OML A;  1Y0M A;  2CUB A;  1WLP B;  2EYX A;  4E6R A;  3H0H A;  3VRZ A;  1VYV A;  1OOT A;  5FW9 A;  2DIL A;  2JW4 A;  5GJW B;  2IIM A;  3IQL A;  1UHF A;  2FRW A;  3EG1 A;  2O31 A;  4A63 B;  4K11 A;  4J9E A;  5HCK A;  1U06 A;  4AG1 C;  5IXB A;  4D8K A;  2FPE A;  2KR3 A;  4OMQ A;  2K3B A;  4ZNX A;  4DEX A;  4HCK A;  4OMP A;  3JV3 A;  2JMC A;  2BZ8 A;  1B3Q A;  3SHW A;  2LQN A;  2LJ1 A;  1GCQ C;  2RQT A;  1QKW A;  4F14 A;  1NYG A;  2EBP A;  4LE9 A;  2GTO A;  1PRM C;  2PNI A;  1WIE A;  4OMN A;  1ARK A;  1HJD A;  1RI9 A;  3QWY A;  1ABQ A;  3LH5 A;  2ED0 A;  2GGR A;  2GNC A;  1JQQ A;  4RTX A;  2CDT A;  2DYB A;  1ZBJ A;  2ESW A;  2FO0 A;  2D0N A;  1W6X A;  2QDL A;  2VWF A;  4X1V A;  4J9G A;  4RTV A;  1SPK A;  3TSW A;  2GTJ A;  1RLP C;  2JS0 A;  1NLP C;  1X43 A;  2G6F X;  1LCK A;  2FEI A;  2A28 A;  1AZG B;  2X3W D;  2EQI A;  2KEA A;  2CH4 W;  3NMZ C;  2DL4 A;  2MOX A;  2RF0 A;  3NPF A;  1AOJ A;  4GBQ A;  4HVV A;  4RTT A;  4QT7 A;  1GFD A;  4D8D A;  2O88 A;  4Z88 A;  1GL5 A;  2DBM A;  3QWX X;  1T0H A;  2DL8 A;  2LX7 A;  1WXB A;  4Z89 A;  4IIM A;  3M0T A;  4ORZ A;  1WYX A;  4JJC A;  4Y92 A;  2EYY A;  1YN8 A;  1T3S A;  1T3L A;  3UA6 A;  2ABL A;  3UAT A;  2YSQ A;  2DL7 A;  4LN2 A;  1AD5 A;  2KRS A;  2D8H A;  1WA7 A;  2MIO A;  2DM1 A;  1XOV A;  1JU5 C;  3VRY A;  2M51 A;  5FWB A;  2C0O A;  1UJY A;  2M0Y A;  3O5Z A;  4FSS A;  3VS5 A;  3M0U A;  4GLM A;  2AK5 A;  3I5R A;  3UF4 A;  2KNB B;  4JJD A;  3R6N A;  1UDL A;  3EG0 A;  2RPN A;  3VS7 A;  2KYM A;  1WI7 A;  2ROL A;  2LZ6 B;  3TVT A;  1AWJ A;  1VA7 A;  1K76 A;  2J6K A;  1I1J A;  3M0S A;  1YP5 A;  1X2K A;  2ED1 A;  2JT4 A;  1NEB A;  4LUD A;  3NGP A;  1HD3 A;  1QWF A;  3EG2 A;  3I9Q A;  2LNH B;  2RQR A;  2KGT A;  3CQT A;  1PWT A;  1AEY A;  2E5K A;  5IHI A;  3EHR A;  1RUW A;  1PHT A;  3REB B;  2DMO A;  1OPK A;  2EPD A;  3RBB B;  1ZX6 A;  1NEG A;  3PVL A;  2KBT A;  2O9V A;  1UE9 A;  2FPF A;  2P4R A;  2CUD A;  1EFN A;  1K4U S;  2JM8 A;  1M30 A;  2DL5 A;  1UUE A;  1UTI A;  5L23 A;  2AZV A;  4CC2 A;  3SEM A;  2DL3 A;  2DRK A;  1PKT A;  2KRN A;  1QWE A;  1UJ0 A;  2L3P A;  2D1X A;  1TUD A;  3VS1 A;  4R0K A;  1AWW A;  5I22 A;  1TG0 A;  5EC7 A;  2LJ3 A;  1H3H A;  1WXT A;  2W10 A;  2RN8 A;  2YT6 A;  1JXO A;  1QCF A;  3FJ5 A;  2A37 A;  5I11 A;  2DLP A;  2DNU A;  2RQV A;  2EGA A;  2D8J A;  2EGC A;  2LMJ A;  1FMK A;  2F2X A;  4F16 A;  2BTT A;  2EVR A;  2C0I A;  3PVQ A;  4M4Z A;  2RNA A;  1AVZ C;  2MCN A;  2KXD A;  1HSQ A;  1GRI A;  4CC3 A;  1X27 A;  2CRE A;  4HXJ A;  1U3O A;  4J9B A;  3C0C A;  2SRC A;  2DE0 X;  1KSW A;  1OEB A;  1JEG A;  1Z9Z A;  1AZE A;  1RLQ C;  1NYF A;  1MUZ A;  1M8M A;  3UA7 A;  2JM9 A;  1ZSG A;  1MV3 A;  1V1C A;  4Z8A A;  1UGV A;  1OPL A;  1B07 A;  1E6G A;  1OV3 A;  2GBQ A;  1WDX A;  2AKK A;  1Z9Q A;  1SRM A;  2W0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...