1WDXA

Yeast bbc1 sh3 domain, triclinic crystal form
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
PEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin tail region-interacting protein MTI1
publication title Crystal structure of Yeast BBC1 SH3 domain, triclinic crystal form
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 14
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wdxA00
1M8MA 3EGUA 1SHGA 4RUGA 3CQTA 2HCKA 2FO0A 1MV0B 1U5SA 2CSIA 2DRMA 2KRSA 2YUQA 5L23A 1YN8A 1CKBA 2LX7A 4OMQA 1FYNA 2W0ZA 4J9FA 2JM9A 3NPFA 4EIKA 2O31A 2ESWA 1QLYA 2HEQA 2KYBA 1SHFA 2ED0A 2BTTA 2RNAA 2AKKA 1BB9A 3UA6A 1GBQA 1YWPA 4J9DA 2K9GA 2KBTA 4ORZA 1AD5A 2L2PA 2ROLA 2DVJA 4AG2C 1X43A 1X2QA 1ABQA 1ZBJA 1UUEA 1WXBA 2A08A 1RLPC 2KR3A 2MCNA 3VRYA 1X2KA 1JO8A 1HJDA 2DL4A 1QWEA 3M0TA 4JJBA 2OJ2A 3QWXX 1QCFA 4KRTA 4DEYA 2F2VA 1HD3A 1M3BA 2C0IA 4AFUC 2DF6A 3SEMA 2HSPA 3NMZC 1OPLA 1E6HA 1N5ZA 1J3TA 2GQIA 2YUNA 3I5SA 1FMKA 4HVWA 2KRMA 4WCIA 2CH4A 4JZ3A 1ARKA 2O9VA 1B07A 2O9SA 2RF0A 5ECAA 2L3QA 2JS2A 5IHKA 2HBWA 1AWXA 4X1VA 2K2MA 1NYFA 2AK5A 4JJDA 3PVQA 2RQWA 1SRLA 2KRNA 5GJVB 1UFFA 4RTZA 2EGEA 1T3SA 2V1RA 1I1JA 4ESRA 1I0CA 4J9CA 4Y92A 2F2XA 1NG2A 1G83A 2EVRA 2NUZA 1KIKA 2JT4A 2CT4A 2VKNA 4LNPA 4DEXA 2DBKA 2K7AA 1M3AA 1W6XA 4AFZC 1NEGA 1PWTA 4GBQA 4RTXA 1AWOA 2EYWA 4FSSA 1UG1A 2X3WD 3VS0A 3M0QA 2A37A 2YUPA 1GCQA 1TUCA 3THKA 3VS5A 1OEBA 4Z88A 1Y57A 3UF4A 4J9GA 1TG0A 2ABLA 1K9AA 2LJ0A 2I0NA 1YCSB 2DL5A 2DMOA 1ZUKA 1AWWA 2O2OA 1PKTA 2J06A 4RTVA 1Y0MA 1X69A 2F2WA 3U23A 2CH4W 2CUDA 1TUDA 5IXBA 2IIMA 1K76A 1AVZC 2LJ1A 1UECA 4GLMA 1VYUA 2C0TA 1U06A 2KT8A 3UA7A 2BZYA 2B86A 5EC7A 1PRLC 1U3OA 2D8HA 2OI3A 1NLOC 1AEYA 2AZVA 3VS6A 2DNUA 2KEAA 1NM7A 1WDXA 2GTJA 2ECZA 5IXFA 2MOXA 2XMFA 2EW3A 5I11A 3H0FA 2DILA 3NHNA 2JM8A 1QWFA 2K6DA 3EG2A 1GFCA 3EG1A 2BZ8A 2DBMA 2FPEA 2VWFA 2DYBA 1H8KA 2KT1A 2CSQA 2CUBA 2KNBB 2DM1A 1OV3A 2O88A 2DL8A 4HVVA 2ENMA 2KYMA 1KSWA 1AZEA 1W1FA 1X6GA 5I22A 1I07A 4RTWA 2V1QA 1Z9QA 2GBQA 1PNJA 2W10A 1Z9ZA 2QDLA 2DE0X 5GJWB 4JPBW 3TVTA 2KGTA 2HDAA 3RBBB 3QWYA 4LE9A 1BK2A 1A0NB 2YUOA 2SRCA 3LH5A 2ROTA 1ZUUA 1GCPA 3H41A 3A98A 1IO6A 1QKXA 1VA7A 4HXJA 1K0XA 2RQRA 3VS4A 2JW4A 3GBQA 1K4US 2RQUA 2M0YA 2LQNA 4AFSC 4CC3A 5HCKA 1GFDA 2AKLA 1SPKA 2JMAA 4OMNA 1GBRA 1AZGB 1UDLA 4F14A 1V1CA 2KXDA 4D8KA 2FRWA 4F17A 2DL3A 2KE9A 3JV3A 2K3BA 2G6FX 4Z8AA 3I9QA 5FWBA 2CT3A 2BZXA 2J6KA 4K11A 3VS3A 3UATA 2GTOA 3PE0A 1SEMA 2LJ3A 1M30A 2YDLA 2EYXA 2RN8A 1JXMA 1H92A 1AWJA 1G2BA 2FPFA 3EG3A 1OOTA 4JZ4A 3REBB 1YNZA 4E6RA 1WI7A 4RTUA 1M27C 1UTIA 2YT6A 4RTTA 1WX6A 1T0JA 2J6FA 1M3CA 3RNJA 1X6BA 1ZLMA 2VVKA 2PNIA 2JTEA 1K1ZA 1RI9A 1YWOA 4HVUA 2JS0A 2EPDA 1WA7A 1WYXA 2RMOA 2DRKA 2EQIA 2LP5A 1EFNA 4A63B 4CC7A 4JJCA 1AOJA 4OMOA 1VYTA 1S1NA 3O5ZA 3IQLA 3TSWA 1QKWA 2JXBA 1E6GA 2OAWA 2ED1A 2RQTA 1WXUA 4QT7A 4OMLA 2DJQA 2FG0A 4LN2A 1VYVA 2EBPA 4F16A 4ZNXA 2EYZA 2D8JA 2CREA 2GNCA 2LNHB 3M0SA 4Z89A 3VS7A 4IIMA 2CDTA 3TSZA 2PTKA 5IH2A 2RPNA 3M0UA 2KROA 1PKSA 1T3LA 5IHNA 1UJYA 2GGRA 1ZX6A 3EG0A 3R6NA 4CC2A 3ULRB 1UE9A 2YSQA 1WFWA 4D8DA 1JQQA 1KFZA 4M4ZA 4AFQC 4HCKA 4OMPA 1MV3A 2NWMA 2A28A 3I35A 1WIEA 2EKHA 1ABOA 2MIOA 1YP5A 1UGVA 2DL7A 3H0IA 2EGAA 3EHRA 1WLPB 2A36A 3VS2A 2AZSA 1MUZA 1SRMA 1XOVA 2L3SA 1RUWA 2FPDA 4R0KA 1JXOA 1GCQC 1CSKA 1UHFA 2L3PA 1PHTA 1UHCA 2D0NA 4CC4B 1OPKA 3I5RA 4RTYA 5FW9A 1K0SA 2E5KA 3FJ5A 4J9IA 1JEGA 1HSQA 2H8HA 4IIOA 2J7IA 2K79A 4LUEA 3VS1A 1W70A 1WXTA 2D1XA 3NGPA 1CKAA 3C0CA 1E7OA 2SEMA 1BU1A 2DX1A 2J6OA 1GRIA 5FWCA 3M0RA 1ZSGA 3EHQA 1JU5C 1SSHA 1GL5A 2LMJA 2EGCA 3PVLA 2FRYA 1T0HA 2X3XD 1H3HA 1PRMC 2J05A 1X27A 2PZ1A 3KFVA 4LUDA 1B3QA 3VRZA 2L0AA 2RQVA 3M0PA 1NLPC 4J9BA 1KJWA 1ZUYA 2C0OA 1NYGA 2LCSA 1NEBA 5IHIA 3SHWA 2FEIA 3REAB 2LQWA 1RLQC 3ZL7C 2P4RA 2M51A 2EYYA 1LCKA 2JMCA 2DLPA 2LZ6B 1BBZA 4OMMA 3H0HA 4J9HA 4J9EA 4AG1C 1UJ0A 2DA9A 2KXCA
chains in the Genus database with same CATH superfamily
3CC2Q 4LDXA 4FYVB 1SHGA 1W2BA 1IGUA 2HCKA 3X20B 5CO7A 1KHCA 2RJEA 2CSIA 4PJNA 2KRSA 3DLLA 1YN8A 3OYAA 3QJ6A 2W0ZA 3HKSA 3GNFB 3VJPA 2RI5A 2ESWA 1QLYA 2OAUA 3OYFA 2BTTA 3L2ZA 5KYXA 2FYKA 3UA6A 4J9DA 2KBTA 1FWZA 1RAHB 2ROLA 3X25B 2JNGA 4AG2C 1BI3A 3A8LB 4J6WA 3JCMW 3CMEQ 2A08A 3EH2A 1X2KA 2AIRB 5KYWB 2D6FA 3DKMA 1YIJQ 2K5LA 2L89A 4JRKA 5HK3A 2OJ2A 3OYKA 1IZ6A 1QCFA 4KRTA 4M7DA 1HD3A 4QVCA 3QYGB 1VQ4Q 2ZCFB 4A4FA 2LC4A 1OPLA 1WPYA 1VQKT 4DA4A 5GAN4 1JJ2A 4MZTA 1QP3A 1D1AA 4JZ3A 2O9VA 3CD6T 5GAN7 2L3QA 1AWXA 4OVAA 2EFIA 1NYFA 1SRLA 1UFFA 4RTZA 2QTVA 2OTLQ 3X24B 2XDPA 2Z0WA 4M78F 4J9CA 1X01A 1UB4A 5GAOn 3I55A 1PG5B 2NUZA 4BD3A 4D6WA 1V29B 3CEYA 2K4YA 5FU7C 3PFSA 1PWTA 3OYMA 4RTXA 2V8IA 4FSSA 2XD0A 4FW1A 1YHQT 3M0QA 2A37A 2A3LA 3G4SQ 2QYZA 3THKA 4M7DD 2QAZA 2PU9B 4DBHA 5A0LA 2HNIA 2ZPHB 1TG0A 3CCQA 1K9AA 2I0NA 4AMCA 1VQNQ 5AT1B 4KGVB 1K8AR 2O2OA 4M75C 4A4GA 4RTVA 2X4YA 4ZGDB 5A0GA 1G3TA 2QA4T 4C5EA 8AT1B 3DLMA 2G3RA 2JN0A 3TQ7P 1F1BB 1VQKA 1IHWA 1U06A 2KT8A 1M1GA 2DETA 2B86A 5GAN6 4KUIA 2YXYA 3CD6A 2KEAA 1NM7A 1BKBA 2AT1B 2EAYA 5I11A 5GAN5 2DILA 2FVUA 1OYXA 6AT1B 2BUDA 1O75A 3EG2A 5IT9E 2DBMA 4KH0B 2VWFA 2DYBA 4GY5A 2KT1A 3CCLT 4OGCA 1MMNA 2KNBB 2O88A 3CCUT 3M58A 2DL8A 4HVVA 2KYMA 5FU6C 3OS5A 1W1FA 3CMAA 3QZ9B 1YHQA 1S72Q 4X9CA 1DJ7B 4HCCA 4Y28E 2FZKB 3GIBA 2LQ8A 2MAMA 2LNVA 3RBBB 4EMKC 4OB3B 3QDRB 4M7DF 2SRCA 3LH5A 2ROTA 3A98A 1LJOA 4KGXB 4C0ZA 1MNEA 4HXJA 2JW4A 1N6AA 4VUBA 2XI9A 1NZ9A 3HRTA 2F1LA 2DIGA 2QA4A 4AFSC 2EQKA 3EG9A 3CBMA 5GMKe 4AT1B 2XICA 1QP2A 4KT0E 1VQLT 1GBRA 4PKCC 3OYIA 2WACA 3HRSA 2FRWA 3JV3A 3OW2P 3RMSA 1EIFA 2QGFB 1G5VA 1SSFA 3I9QA 4ME7A 1K73C 1M2VB 2CP0A 2J6KA 4K11A 2GTOA 1N8RR 3PE0A 1PD0A 5KCHA 4XTZA 2EYXA 3A8HB 2FZGB 1PSFA 1YJ9T 1QVPA 1AWJA 3CCLA 3CCET 4PL6A 5A2QE 1OOTA 4JZ4A 1YNZA 2RK1A 3CCUA 2E70A 4A4EA 3A8MB 2LCLA 4RTUA 5CKFA 1PD1A 1UTIA 4RTTA 1KHIA 2RI2A 4O5VA 3CPWP 2PNIA 1K1ZA 1RI9A 4UC4A 1Q81C 1WA7A 2CGHA 2RMOA 4PJOG 2R5AA 2LP5A 4CC7A 5FU7B 5GMKj 1VYTA 3C94A 3QYHB 3SWNB 2JXBA 2CZ0B 2Y4YA 3L2VA 1WNLA 4QT7A 2NYSA 4OMLA 4Z02A 1VQPQ 4ZNXA 2D8JA 1OU8A 3VS7A 1VQLA 3NTKA 4A54A 3JSCA 1K9MR 3OS0A 2PQWA 2IG0A 1YJNQ 5IHNA 4P5NA 4M75B 4J8OA 2IPOB 3JCMc 3JB9J 4XTVA 2YSQA 5GANf 2E12A 1WFWA 1SG5A 1JQQA 2EJGA 1KFZA 4MMLA 4E7HA 4PLIA 4AFQC 4HCKA 4M75E 1MV3A 1M90C 1WIEA 1YP5A 3CCEA 1WQWA 2EYQA 1N9SA 2A36A 1MUZA 3CC2T 2L3SA 1RUWA 1JJ2S 1RAEB 3A8OB 1M5Q1 1UHFA 3L1AA 1PHTA 4CC4B 2K3XA 2X4JA 4RTYA 3L2RA 1Y07A 3VUZA 2F5KA 4KUDK 4M77G 4C92G 1UEBA 4PJOB 5LJ5g 1HSQA 2RJCA 4M7AG 1FX7A 3M57A 5LJ5e 2J7IA 3CXCP 4LUEA 3JAME 5GAMf 2DZCA 1E7OA 2SEMA 3S3NA 2DIQA 2I2LA 3OYCA 2J6OA 2DX1A 2YRCA 4E7SA 1SSHA 3CMET 3LLRA 1FMVA 2DPPB 2LMJA 3RKYA 2VXFA 2O4XB 1Q86R 2IVWA 4OB1B 5CCAA 1PRMC 1KC8R 1X27A 4EMKA 4R56A 3JB9F 1O9SA 1QQJA 3CCSQ 2KMTA 4J9BA 1NLPC 2V8JA 1VQ4T 1VQOQ 1U1TA 4BE2A 2HZYA 4N0AC 5LJ5d 5IHIA 2FEIA 4TVRA 3V7CA 4N4IA 2B8AA 5CR2A 4IUQA 1RLQC 1IREB 4JLGA 4BY6C 2DLPA 3CPFA 2X4WA 4B9WA 2MK5A 3PNWC 2OTLT 2ZPGB 4J9HA 2COZA 3CC2A 1BCOA 4AG1C 1R77A 4OMNA 3L2WA 5LJ5j 2HKQB 2MIOA 4C0DB 2NUPA 1OZ2A 3RUXA 2H3JA 4KULA 3UT1A 4C0FA 3LW5E 2D9TA 4PFPA 4C92B 1D1BA 4ZGJB 1MV0B 2RHIA 3C95A 2QXFA 2LX7A 4E7LA 4BE0A 4C8QG 1M2OA 3I56Q 2JM9A 4EIKA 3G4ST 4C92E 1WHLA 2LT1A 3BY7A 2NUTA 2DD4A 4PNOA 2RB6A 4X34A 1BB9A 3CCJQ 4RG8A 3EGDA 3CMEA 4E7ZA 1NJIR 1M1KR 1X2QA 1ABQA 4J7IA 4M75F 1YIJA 1D3BB 1ZBJA 2KR3A 1EZZB 1R0CB 1JO8A 2DL4A 2MWOA 3M0TA 1YJ9Q 3MP6A 1VQ4A 3P8DA 3QWXX 3M9QA 1NPPA 2F2VA 1M3BA 2C0IA 4RKUE 3OYJA 2DF6A 2VASA 1BI2A 1RAIB 2HSPA 3SEMA 3NMZC 4Y91A 5CIUA 1E6HA 1N5ZA 2GQVA 1J3TA 3I5SA 2F69A 4HVWA 4A4KA 5IHKA 1N8RU 2DTHA 4X1VA 2ZAEA 2OTLA 3OB9A 2K2MA 2AK5A 9ATCB 5GAN3 2CP2A 1WZOA 2EQUA 3MEWA 5J26A 4ESRA 2PVOB 1R0BG 4Y92A 5CAIA 1BI1A 2F2XA 1NG2A 1KQSS 3EFOB 1RI0A 1G83A 3QZ5B 3EFSA 4C8QB 4JLIA 4DEXA 2DBKA 5KYUB 1M3AA 4EMGA 1S72T 1AWOA 3G4SA 2EYWA 1LOJA 3CC4Q 1AHJB 1UG1A 3MO8A 2DK3A 4C8QE 2XDDA 3OYGA 1TUCA 4CI0C 3M4GA 1TXQA 4CRIA 3OYHA 4Z88A 5IN1A 2GCXA 3ZFJA 1VQNA 4J9GA 2ABLA 2K5IA 2LJ0A 2DEUA 1YCSB 2DMOA 2DJZA 3G6EQ 3RERA 2J06A 4JRIA 3ME9A 4ZN3A 1K9MU 2CUDA 3VUBA 3GPLA 1K76A 1AVZC 3GP8A 1WHJA 1BYMA 4QQGA 4V2SA 1UECA 2C0TA 1RADB 3UA7A 1Y71A 2OI3A 1AEYA 1NLOC 5FLXE 2DNUA 2YWWA 3BW1A 1WDXA 3OMCA 2YLBA 2XMFA 5DLQE 4C92F 3NTHA 3NHNA 4BI8B 2KK4A 1HYOA 4N0AA 3E9GA 3O8VA 1GFCA 3EG1A 2BZ8A 3FJPA 2C06A 4J6XA 4LDUA 4L59A 3OW2A 3P8BB 4E47A 1KQ1A 4DBRA 1D0ZA 4BY6B 5DY9A 2CUBA 1Y96B 4A53A 3SB2A 2ENMA 4PJJA 5DLOA 1S72A 1X6GA 2KY9A 4J7FA 2OX7A 5KYWA 4RTWA 3ZBDA 4QVZA 2EWNA 1Z9QA 1I81A 3QUIA 3JRZA 2W10A 5GMKm 2QDLA 1G3YA 4JPBW 5GMKi 4NL3A 2R5MA 4HT8A 1M8VA 3QWYA 5GAN8 4LE9A 1BK2A 2YUOA 2E41A 3M54A 4X9DA 1VQ5Q 1IO6A 3CPWA 3JB9H 1QKXA 1VA7A 4RCBA 3M53A 3MCAB 2E4HA 1VQPT 1K0XA 1NPRA 1Q86U 1KC8U 1GFDA 2AKLA 1SPKA 2JMAA 3L2UA 1PC0A 1WJQA 3RIRA 5C0MA 1YJNT 1QW1A 3M56A 3MPUB 4LDWA 1UDLA 4F14A 1V1CA 3J80E 4D8KA 3CCRQ 4Z8AA 3CC7T 3SWNC 5FWBA 4FT2A 2K3YA 2YRVA 1WHKA 3G71Q 2HQHA 3VS3A 4XTXA 5FROA 2DTOA 1MNDA 4C8QF 4OP0A 4BE1A 5LJ3f 1JXMA 3EG3A 4NS5A 2JUFA 3KUFA 2OTJQ 3QG1A 4QKUA 3NTIA 3INZA 2L8DA 3AHUA 1PSEA 2DYIA 2RJDA 1QVFS 1T0JA 1GXIE 2AHJB 2M0OA 3JCMb 2VVKA 2JTEA 3RDVA 3LGLA 1WYXA 4XU3A 2K2VA 4A63B 1EFNA 4PK4A 4JJCA 4OMOA 2MWPA 3QBYA 1KD1C 1RAAB 8ATCB 1VQPA 1NJIU 2M16A 4MMKA 3TEEA 5LJ3g 1M1KU 1B7TA 2MI6A 2FG0A 4LN2A 1ZSZC 3META 1Q82R 5LJ3e 4E7JA 1FMWA 2CKKA 3M0SA 4Z89A 2CDTA 3CXCA 2PTKA 1JB0E 1ZHIA 1YJNA 2CP5A 3M0UA 1K8AC 2KROA 1Q7YC 3URGA 1PKSA 4ELZC 3CCST 4PJOC 1VQOT 3AT1B 2GGRA 3EG0A 2QQRA 1ACMB 2FL7A 4D8DA 4C5HA 3LWHA 4M4ZA 2FZCB 1YBYA 5M9OA 3E9FA 3RR6A 2KVQG 3S3OA 5EG2A 2V26A 4ZTFA 5LJ3d 3JCMf 2RH2A 3H0IA 3EHRA 3VS2A 1VQ8Q 2V8KA 4DBQA 3JCMJ 5CVIA 4HT9A 4JJNK 3T9NA 3LWIA 3I5RA 1K73R 4EPCA 3OA6A 3I56T 1JEGA 5LJ3j 4IIOA 2K79A 3FC3A 3HHTB 4IKFA 3VS1A 2XK0A 2RJFA 3EGXB 3RESA 1UGQB 5LL6S 3E2UA 3CCJT 2X4XA 2QEXQ 3JCMg 3M0RA 1ZSGA 1M2VA 3C12A 2E10A 4IUPA 4C0DC 3JCMe 1GL5A 2EGCA 2VYTA 4BDYA 4M77C 2RO0A 4C92C 2CP3A 2FRYA 3DB4A 1T0HA 4M7AC 3CCSA 3N5BB 3PTAA 1IHVA 1QVGS 2PZ1A 2COYA 4MDXA 2LCCA 4LUDA 1VQOA 4FYYB 1B3QA 1VQ6T 2FHDA 3VRZA 2VGMA 2L0AA 2RQVA 3X26B 1ZUYA 1NYGA 1BIBA 3E1SA 3MP8A 4II1A 3SHWA 5KH6A 3BDUA 2E1HA 3HFOA 1X75C 4FM4B 3RMQA 3ZL7C 3WXMB 5I2SA 2P4RA 4F7UG 3JCMQ 2EYYA 2KI7A 1RABB 1WQ7A 1LPLA 2JMCA 1W2BS 2MMPA 2JTMA 3JCMd 2LZ6B 1BBZA 4OMMA 2HMAA 1JJ2P 5DM7R 1UJ0A 3SWNA 5HKCA 3EGUA 3CQTA 3MHXA 2P0PA 2PVGB 2K5FA 2P4TA 2FO0A 4QVDA 1U5SA 3JB9D 3J7AF 5CKEA 3FEOA 3I56A 2YUQA 5L23A 2DD5A 3A8GB 1OQKA 1CKBA 4OMQA 3CC4T 4ANJA 5IAYA 1OX8A 3NPFA 1M90R 2O31A 2PVDB 2HEQA 2KYBA 1SHFA 4M75A 2ED0A 1PM3A 4J5YA 3CCJA 3QKJA 5LJ5f 2AKKA 3OS1A 3CC7Q 1GBQA 3PMIA 3TCJA 3CCVQ 3KXTA 1VOMA 3KBGA 1VQMQ 1PCXA 1X43A 1XJWB 1WXBA 2COWA 3HP9A 5C6SA 3G6ET 2HKNA 3JCMP 1YJ9A 1RLPC 2F5TX 2MCNA 2QQ9A 1XQHA 2EQJA 4C8QC 4MDWA 1HXDA 3QDFA 5CQXA 1ZSZB 5GAOm 1YCYA 3OY9A 1YFNA 3BFMA 1YJWQ 1FXXA 3EH1A 4F7UB 4HCBA 5KYYB 1U8RA 2HBPA 2CZ6B 2GQIA 2YUNA 1FMKA 2CH4A 4PJOA 1ARKA 1B07A 2O9SA 5ECAA 3LGFA 3ER0A 3CCMQ 1VQ9Q 4JJDA 3PVQA 2KRNA 2LX9A 4ATOA 4PJOE 2EGEA 1T3SA 2V1RA 3HSBA 1I1JA 1I0CA 4M75D 3H8ZA 3GOXA 2EVRA 2DO3A 2CT4A 4EDUA 1H3ZA 4XAXB 2K7AA 3CC4A 2O4XA 1W6XA 4AFZC 2DXBA 2X3WD 1TSFA 1G3WA 2QTXA 1H641 2CYZB 2E64A 2Y90A 3WVEB 3UF4A 1VQ5T 4XQ3A 4C5IA 4HA8A 3G6EA 1ZUKA 3A1PA 1Q82U 5D6YA 5GAOl 2L3RA 3PT9A 4XU2A 1AWWA 4LDYA 2QASA 2L5QA 5CKBA 1PKTA 4IUTA 2ZPFB 1X69A 4B6MA 2VXEA 3U23A 1TUDA 2VUBA 4C5GA 7AT1B 1ZQ1A 4QQ6A 4GLMA 1VYUA 2QQSA 4M77B 3CCRT 4M7AB 4M78G 4KBMB 4C92A 2BZYA 5EC7A 1ZBXA 1PRLC 1U3OA 2D8HA 5FRNA 2GTJA 3OBYA 2ECZA 3HRUA 3G71T 4MZPA 2DTIA 2MOXA 4M77E 2EW3A 2XDBA 4M7AE 4KGZB 2JM8A 1QWFA 3V8KA 2K6DA 1KQSP 3EAEA 5HK0A 3DB3A 2XU8A 2OTJT 1H8KA 2E5QA 2DM1A 4XTUA 1OV3A 1D3BA 1JBMA 1W4SA 3H9NA 1K73U 5I22A 3QIIA 2E3HA 1I07A 2CP6A 3MJXA 4FW2A 1VQ6Q 1PNJA 1Z9ZA 3VKIA 2KAFA 3E19A 3QXEB 4LD9K 2QQBA 2KGTA 2A0FB 3MEVA 1VQ5A 3OYEA 3GLXA 3OMGA 2FB7A 3M5AA 4C92D 2YHTA 5CKHA 3GBQA 1K4US 3LH0A 2RQUA 2RHXA 3OYBA 2LQNA 4CC3A 1N27A 4PJOF 1C0MA 3VYHB 1Q81U 3GNGA 1WHHA 4F04B 4M78B 4A4HA 2E6ZA 3CCRA 2HL3A 3EFOA 2KXDA 2P0QA 4F17A 2DL3A 4B9XA 2K3BA 4XK8E 4C8QA 3G71A 3P8HA 5KYUA 4M78E 2CT3A 5GANh 1TOVA 1SEMA 2ZZDA 1BIAA 2XKOC 2RN8A 1VQ8T 2GFUA 2QQAA 2OTJA 4RCCA 2DKGA 3PMTA 4OF1A 1RL2A 3HFNA 4IUVA 5CKDA 3PIPA 4JDSA 4M7DG 1M27C 1D0XA 4XU0A 2YT6A 3ZEHA 1WX6A 1G3SA 2J6FA 4FYXB 1M3CA 1X6BA 1M90U 2RHZA 1YWOA 2JS0A 1Y7XA 2DRKA 1B34B 1S1NA 3TSWA 1QKWA 3BE3A 2KSSA 2QEXT 2ED1A 2RQTA 1WXUA 5GAMh 4C8QD 3MP1A 4M77F 1VYVA 2EBPA 3HPWA 4F16A 4M7AF 2GNCA 2LNHB 3I55T 3TSZA 5IH2A 5FRMA 3EFRA 1UGSB 2MPXC 3FLGA 3SFMA 1YITQ 1UJYA 3G1JA 1Y96A 5KYXB 5D6WA 3ULRB 2X35A 1UE9A 3QJYA 5CQYA 4OMPA 2CP7A 3CCQT 2A28A 3HTRA 1VQ8A 3JCMV 2EKHA 1ABOA 4FIBA 2DEQA 1UGVA 1NBEB 2DL7A 1M1FA 1QCNA 1HK9A 1SRMA 2DFUA 4M7DB 1XOVA 4QQDA 1QVFP 4R0KA 1GCQC 1CSKA 1OPKA 4GLKA 4DOVA 4M7DE 2E5KA 1K0SA 1JRIA 4J9IA 1I8FA 4DOWA 2R57A 3NFCA 5CK9A 3LX7A 3SDZA 2LRQA 2BKDN 2O01E 2MF2A 1W70A 2QEXA 1WXTA 2D1XA 3NGPA 2NLUA 1UGPB 3QSUA 3C0CA 3CCVT 1BU1A 3TU4K 1GRIA 5FWCA 1VQMT 3SD4A 3MEUA 1JU5C 2A7YA 1VIFA 3X28B 2BE9B 1LVKA 4OMFB 4E2FB 2YLCA 2HQXA 4Q5WA 2D0QB 3Q1JA 4HCZA 4XTWA 2J05A 3HL8A 2M1HA 5KCOA 3RKWA 3CBPA 1ZA1B 3CMAT 5GMKl 1KJWA 2C0OA 1YJWT 1KD1R 3CBOA 1RAFB 1NEBA 2E65A 1OULA 4RG2A 2JTFA 5D6XA 2LDMA 5D7UA 2M51A 3CCMT 5A0DA 4MZMA 1VQ9T 1OZ3A 2WSCE 3QPHA 1Q7YR 3H0HA 4J9EA 4WF2A 2K57A 1MMAA 1M8MA 4RUGA 1R8OB 1LNXA 2KDSA 4BUGA 3RKXA 4NOYA 2DRMA 2EJFA 4QW2A 4OB0B 1FYNA 4J9FA 4E7IA 4FU6A 2HQEA 3CC7A 1VQ7T 3CCVA 5J3BA 4ZN1A 3JB9G 2RNAA 1M4ZA 1VQMA 2EQMA 1YWPA 2K9GA 2HSEB 1IB8A 4ORZA 1AD5A 2L2PA 2DVJA 1QVGP 3C4SA 1UUEA 1WHGA 3VRYA 1P92A 3OSVA 1QMCA 3S3MA 1Q82C 1HJDA 1VIEA 2M9UA 1QWEA 3OS2A 4JJBA 3M55A 1M9SA 2DXUA 4DEYA 1YJWA 4AFUC 4J83A 2XHCA 3CCMA 1VQ9A 4OB2B 1W2BP 2DVEA 2KRMA 4WCIA 2RF0A 2JS2A 2HBWA 4E7KA 2ZGWA 4OGEA 3S6WA 2RQWA 3EG9B 5GJVB 4FCYA 4L5GA 4PLLA 3EGXA 1D1CA 2RM4A 4JS5A 3V7RA 3JCMX 4C0GA 1KIKA 2JT4A 3V7SA 2VKNA 4LNPA 2EKOA 2X51A 3I55Q 4FYWB 1NEGA 4GBQA 4M75G 1Q81R 1KQSA 3OYYA 2VV5A 3PIOA 4FSXA 5AYFA 1VQ7A 4J6YA 1MGQA 3VS0A 2DAQA 2YUPA 1GCQA 3VS5A 1OEBA 4IURA 2XG8D 3G7ZA 2LT4A 1Y57A 2QK0A 4JUVA 1KK7A 2DL5A 1VUBA 1RAGB 3CCQQ 3V8LA 3FIFA 4YTLA 3VV0A 1Y0MA 2F2WA 1N8RC 2CH4W 2GFAA 2Y4XA 5IXBA 2IIMA 2ATCB 2JOYA 2LJ1A 1YI2T 3OQ5A 4LD6A 1AT1B 3ASKA 1TWBA 4DBFA 4BDZA 4LXCA 1VQKQ 2AZVA 3VS6A 3VU3C 3JB9I 5KE2A 1QCOA 5IXFA 3OW2S 3CD6Q 3H0FA 5GAOr 4JRQA 1KQ2A 4NL2A 4FT4A 1EX4A 2H3EB 4PFZA 1TU0B 2E3IA 3H6ZA 3QHSA 2FPEA 4M78C 2CSQA 5LJ3h 4N4HA 1KSWA 1I5OB 1AZEA 1VQ6A 2WSEE 2V1QA 2GBQA 4BI3A 3CMAQ 1K9MC 4HKEA 1NE8A 1ZSZA 1IGQA 2DE0X 5GJWB 1YHQQ 3CPWS 4BACA 3R6OA 3TVTA 1C6VX 3FB9A 1X6OA 2HDAA 1A0NB 1I5LA 1D0YA 4F7UA 2DZ9A 3V8JA 5KYYA 1ZUUA 1GCPA 2QG9B 3H41A 2DERA 4PJMA 5I21A 2RQRA 3VS4A 4F7UE 1G8XA 5L8RE 2M0YA 2RD1A 1WJRA 3QO3A 5HCKA 4RMOA 1YI2A 5GANg 2QA4Q 4O6JA 2JZ2A 2RHYA 1AZGB 2E6NA 1YITT 4FL6A 5GANe 2WSFE 1KD1U 2EJ9A 4N4GA 2KE9A 5FU6B 3BDLA 3M59A 2G6FX 5GMKh 3MEAA 2BZXA 2HL5C 4BI4A 3UATA 1OX9A 1ZA2B 1VQ7Q 1OI1A 3UPUA 1K8AU 1Q7YU 2LJ3A 1M30A 1TUGB 2YDLA 4EMKB 1YIJT 3OBWA 2X9HA 4ELYC 1H92A 1G2BA 2FPFA 2QGGA 3REBB 4E6RA 3JCMh 2M02A 5GAOp 1WI7A 3CCLQ 4PJOD 4ZTJA 4R55A 5I2MA 5GANd 3CCUQ 4ZGEB 2RK2A 3WVDB 1Q86C 2VGNA 3RNJA 1ZLMA 5GAMg 1KC8C 1TH7A 4HVUA 5GAMe 2EPDA 2CZ7B 1BI0A 4DQ2A 4M77A 2EQIA 1QVFA 1AOJA 5KYNA 4M7AA 3O5ZA 2R58A 3IQLA 3TREA 2EIFA 1WHMA 1E6GA 3CXCS 2OAWA 2NUPB 1MMGA 5GANj 4M7DC 5GAOq 2DJQA 1RACB 1IXDA 2ZPEB 3OYNA 1MHNA 2EYZA 5HY6A 2CREA 3LYIA 5GAN2 1XNIA 4IIMA 1Q95G 3D7SB 2RPNA 2ZPBB 1YITA 3GF5A 1T3LA 3OYLA 1VQLQ 2BIVA 2NUTB 2RI3A 3OSSC 2KQWA 1ZX6A 3R6NA 1MMDA 1OU9A 4CC2A 2QI2A 3UWNA 5GAMd 3EGDB 4EMHA 4JS4A 4BB7A 2P84A 3FRNA 1D09B 3MKDA 3UDCA 1VQNT 1IRXA 2NWMA 1TTHB 4KH1B 3I35A 4JRPA 2RA2A 3J81E 2EGAA 1WLPB 2AZSA 4M77D 2PUOB 5GAMj 3CCEQ 4M7AD 2DXCA 1U1SA 2FPDA 1NJIC 3VYGA 1JXOA 2YRDA 1M1KC 4F7UF 2L3PA 1UHCA 4XTYA 2D0NA 3OYDA 2GF7A 5FW9A 4XU1A 3FJ5A 3FDRA 1SKUB 2H8HA 4M78A 2HAXA 1YI2Q 1XTDA 2LVMA 1V76A 4LDVA 1I4K1 1CKAA 2JVVA 2P0KA 4PJLA 2CS7A 2HD0A 2VB6A 2ZPIB 3EHQA 5LJ5h 3M4YA 3F70A 1KG1A 2CZ1B 3L42A 1WGSA 2DXTA 3PVLA 4WTOB 2X3XD 1BCMA 1H3HA 2XIDA 3KFVA 3PGGA 2QDYB 1TS9A 3M0PA 2BE7D 5J39A 2LCSA 2PUKB 2VC8A 1QVGA 1C1AA 3REAB 2RHUA 2LQWA 2JJ9A 3A5ZB 4IUUA 2LQKA 1LCKA 2MYSA 2LTOA 5KE3A 1N9RA 4L6V5 4PFOA 4M78D 1WJSA 1B34A 3L2QA 1UGRB 1SF9A 2DA9A 2KXCA
chains in the Genus database with same CATH topology
1M8MA 3EGUA 1SHGA 4RUGA 3CQTA 2HCKA 2FO0A 1MV0B 1U5SA 2CSIA 2DRMA 2KRSA 2YUQA 5L23A 1YN8A 1CKBA 2LX7A 4OMQA 1FYNA 2W0ZA 4J9FA 2JM9A 3NPFA 4EIKA 2O31A 2ESWA 1QLYA 2HEQA 2KYBA 1SHFA 2ED0A 2BTTA 2RNAA 2AKKA 1BB9A 3UA6A 1GBQA 1YWPA 4J9DA 2K9GA 2KBTA 4ORZA 1AD5A 2L2PA 2ROLA 2DVJA 4AG2C 1X43A 1X2QA 1ABQA 1ZBJA 1UUEA 1WXBA 2A08A 1RLPC 2KR3A 2MCNA 3VRYA 1X2KA 1JO8A 1HJDA 2DL4A 1QWEA 3M0TA 4JJBA 2OJ2A 3QWXX 1QCFA 4KRTA 4DEYA 2F2VA 1HD3A 1M3BA 2C0IA 4AFUC 2DF6A 3SEMA 2HSPA 3NMZC 1OPLA 1E6HA 1N5ZA 1J3TA 2GQIA 2YUNA 3I5SA 1FMKA 4HVWA 2KRMA 4WCIA 2CH4A 4JZ3A 1ARKA 2O9VA 1B07A 2O9SA 2RF0A 5ECAA 2L3QA 2JS2A 5IHKA 2HBWA 1AWXA 4X1VA 2K2MA 1NYFA 2AK5A 4JJDA 3PVQA 2RQWA 1SRLA 2KRNA 5GJVB 1UFFA 4RTZA 2EGEA 1T3SA 2V1RA 1I1JA 4ESRA 1I0CA 4J9CA 4Y92A 2F2XA 1NG2A 1G83A 2EVRA 2NUZA 1KIKA 2JT4A 2CT4A 2VKNA 4LNPA 4DEXA 2DBKA 2K7AA 1M3AA 1W6XA 4AFZC 1NEGA 1PWTA 4GBQA 4RTXA 1AWOA 2EYWA 4FSSA 1UG1A 2X3WD 3VS0A 3M0QA 2A37A 2YUPA 1GCQA 1TUCA 3THKA 3VS5A 1OEBA 4Z88A 1Y57A 3UF4A 4J9GA 1TG0A 2ABLA 1K9AA 2LJ0A 2I0NA 1YCSB 2DL5A 2DMOA 1ZUKA 1AWWA 2O2OA 1PKTA 2J06A 4RTVA 1Y0MA 1X69A 2F2WA 3U23A 2CH4W 2CUDA 1TUDA 5IXBA 2IIMA 1K76A 1AVZC 2LJ1A 1UECA 4GLMA 1VYUA 2C0TA 1U06A 2KT8A 3UA7A 2BZYA 2B86A 5EC7A 1PRLC 1U3OA 2D8HA 2OI3A 1NLOC 1AEYA 2AZVA 3VS6A 2DNUA 2KEAA 1NM7A 1WDXA 2GTJA 2ECZA 5IXFA 2MOXA 2XMFA 2EW3A 5I11A 3H0FA 2DILA 3NHNA 2JM8A 1QWFA 2K6DA 3EG2A 1GFCA 3EG1A 2BZ8A 2DBMA 2FPEA 2VWFA 2DYBA 1H8KA 2KT1A 2CSQA 2CUBA 2KNBB 2DM1A 1OV3A 2O88A 2DL8A 4HVVA 2ENMA 2KYMA 1KSWA 1AZEA 1W1FA 1X6GA 5I22A 1I07A 4RTWA 2V1QA 1Z9QA 2GBQA 1PNJA 2W10A 1Z9ZA 2QDLA 2DE0X 5GJWB 4JPBW 3TVTA 2KGTA 2HDAA 3RBBB 3QWYA 4LE9A 1BK2A 1A0NB 2YUOA 2SRCA 3LH5A 2ROTA 1ZUUA 1GCPA 3H41A 3A98A 1IO6A 1QKXA 1VA7A 4HXJA 1K0XA 2RQRA 3VS4A 2JW4A 3GBQA 1K4US 2RQUA 2M0YA 2LQNA 4AFSC 4CC3A 5HCKA 1GFDA 2AKLA 1SPKA 2JMAA 4OMNA 1GBRA 1AZGB 1UDLA 4F14A 1V1CA 2KXDA 4D8KA 2FRWA 4F17A 2DL3A 2KE9A 3JV3A 2K3BA 2G6FX 4Z8AA 3I9QA 5FWBA 2CT3A 2BZXA 2J6KA 4K11A 3VS3A 3UATA 2GTOA 3PE0A 1SEMA 2LJ3A 1M30A 2YDLA 2EYXA 2RN8A 1JXMA 1H92A 1AWJA 1G2BA 2FPFA 3EG3A 1OOTA 4JZ4A 3REBB 1YNZA 4E6RA 1WI7A 4RTUA 1M27C 1UTIA 2YT6A 4RTTA 1WX6A 1T0JA 2J6FA 1M3CA 3RNJA 1X6BA 1ZLMA 2VVKA 2PNIA 2JTEA 1K1ZA 1RI9A 1YWOA 4HVUA 2JS0A 2EPDA 1WA7A 1WYXA 2RMOA 2DRKA 2EQIA 2LP5A 1EFNA 4A63B 4CC7A 4JJCA 1AOJA 4OMOA 1VYTA 1S1NA 3O5ZA 3IQLA 3TSWA 1QKWA 2JXBA 1E6GA 2OAWA 2ED1A 2RQTA 1WXUA 4QT7A 4OMLA 2DJQA 2FG0A 4LN2A 1VYVA 2EBPA 4F16A 4ZNXA 2EYZA 2D8JA 2CREA 2GNCA 2LNHB 3M0SA 4Z89A 3VS7A 4IIMA 2CDTA 3TSZA 2PTKA 5IH2A 2RPNA 3M0UA 2KROA 1PKSA 1T3LA 5IHNA 1UJYA 2GGRA 1ZX6A 3EG0A 3R6NA 4CC2A 3ULRB 1UE9A 2YSQA 1WFWA 4D8DA 1JQQA 1KFZA 4M4ZA 4AFQC 4HCKA 4OMPA 1MV3A 2NWMA 2A28A 3I35A 1WIEA 2EKHA 1ABOA 2MIOA 1YP5A 1UGVA 2DL7A 3H0IA 2EGAA 3EHRA 1WLPB 2A36A 3VS2A 2AZSA 1MUZA 1SRMA 1XOVA 2L3SA 1RUWA 2FPDA 4R0KA 1JXOA 1GCQC 1CSKA 1UHFA 2L3PA 1PHTA 1UHCA 2D0NA 4CC4B 1OPKA 3I5RA 4RTYA 5FW9A 1K0SA 2E5KA 3FJ5A 4J9IA 1JEGA 1HSQA 2H8HA 4IIOA 2J7IA 2K79A 4LUEA 3VS1A 1W70A 1WXTA 2D1XA 3NGPA 1CKAA 3C0CA 1E7OA 2SEMA 1BU1A 2DX1A 2J6OA 1GRIA 5FWCA 3M0RA 1ZSGA 3EHQA 1JU5C 1SSHA 1GL5A 2LMJA 2EGCA 3PVLA 2FRYA 1T0HA 2X3XD 1H3HA 1PRMC 2J05A 1X27A 2PZ1A 3KFVA 4LUDA 1B3QA 3VRZA 2L0AA 2RQVA 3M0PA 1NLPC 4J9BA 1KJWA 1ZUYA 2C0OA 1NYGA 2LCSA 1NEBA 5IHIA 3SHWA 2FEIA 3REAB 2LQWA 1RLQC 3ZL7C 2P4RA 2M51A 2EYYA 1LCKA 2JMCA 2DLPA 2LZ6B 1BBZA 4OMMA 3H0HA 4J9HA 4J9EA 4AG1C 1UJ0A 2DA9A 2KXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8M A;  3EGU A;  1SHG A;  4RUG A;  3CQT A;  2HCK A;  2FO0 A;  1MV0 B;  1U5S A;  2CSI A;  2DRM A;  2KRS A;  2YUQ A;  5L23 A;  1YN8 A;  1CKB A;  2LX7 A;  4OMQ A;  1FYN A;  2W0Z A;  4J9F A;  2JM9 A;  3NPF A;  4EIK A;  2O31 A;  2ESW A;  1QLY A;  2HEQ A;  2KYB A;  1SHF A;  2ED0 A;  2BTT A;  2RNA A;  2AKK A;  1BB9 A;  3UA6 A;  1GBQ A;  1YWP A;  4J9D A;  2K9G A;  2KBT A;  4ORZ A;  1AD5 A;  2L2P A;  2ROL A;  2DVJ A;  4AG2 C;  1X43 A;  1X2Q A;  1ABQ A;  1ZBJ A;  1UUE A;  1WXB A;  2A08 A;  1RLP C;  2KR3 A;  2MCN A;  3VRY A;  1X2K A;  1JO8 A;  1HJD A;  2DL4 A;  1QWE A;  3M0T A;  4JJB A;  2OJ2 A;  3QWX X;  1QCF A;  4KRT A;  4DEY A;  2F2V A;  1HD3 A;  1M3B A;  2C0I A;  4AFU C;  2DF6 A;  3SEM A;  2HSP A;  3NMZ C;  1OPL A;  1E6H A;  1N5Z A;  1J3T A;  2GQI A;  2YUN A;  3I5S A;  1FMK A;  4HVW A;  2KRM A;  4WCI A;  2CH4 A;  4JZ3 A;  1ARK A;  2O9V A;  1B07 A;  2O9S A;  2RF0 A;  5ECA A;  2L3Q A;  2JS2 A;  5IHK A;  2HBW A;  1AWX A;  4X1V A;  2K2M A;  1NYF A;  2AK5 A;  4JJD A;  3PVQ A;  2RQW A;  1SRL A;  2KRN A;  5GJV B;  1UFF A;  4RTZ A;  2EGE A;  1T3S A;  2V1R A;  1I1J A;  4ESR A;  1I0C A;  4J9C A;  4Y92 A;  2F2X A;  1NG2 A;  1G83 A;  2EVR A;  2NUZ A;  1KIK A;  2JT4 A;  2CT4 A;  2VKN A;  4LNP A;  4DEX A;  2DBK A;  2K7A A;  1M3A A;  1W6X A;  4AFZ C;  1NEG A;  1PWT A;  4GBQ A;  4RTX A;  1AWO A;  2EYW A;  4FSS A;  1UG1 A;  2X3W D;  3VS0 A;  3M0Q A;  2A37 A;  2YUP A;  1GCQ A;  1TUC A;  3THK A;  3VS5 A;  1OEB A;  4Z88 A;  1Y57 A;  3UF4 A;  4J9G A;  1TG0 A;  2ABL A;  1K9A A;  2LJ0 A;  2I0N A;  1YCS B;  2DL5 A;  2DMO A;  1ZUK A;  1AWW A;  2O2O A;  1PKT A;  2J06 A;  4RTV A;  1Y0M A;  1X69 A;  2F2W A;  3U23 A;  2CH4 W;  2CUD A;  1TUD A;  5IXB A;  2IIM A;  1K76 A;  1AVZ C;  2LJ1 A;  1UEC A;  4GLM A;  1VYU A;  2C0T A;  1U06 A;  2KT8 A;  3UA7 A;  2BZY A;  2B86 A;  5EC7 A;  1PRL C;  1U3O A;  2D8H A;  2OI3 A;  1NLO C;  1AEY A;  2AZV A;  3VS6 A;  2DNU A;  2KEA A;  1NM7 A;  1WDX A;  2GTJ A;  2ECZ A;  5IXF A;  2MOX A;  2XMF A;  2EW3 A;  5I11 A;  3H0F A;  2DIL A;  3NHN A;  2JM8 A;  1QWF A;  2K6D A;  3EG2 A;  1GFC A;  3EG1 A;  2BZ8 A;  2DBM A;  2FPE A;  2VWF A;  2DYB A;  1H8K A;  2KT1 A;  2CSQ A;  2CUB A;  2KNB B;  2DM1 A;  1OV3 A;  2O88 A;  2DL8 A;  4HVV A;  2ENM A;  2KYM A;  1KSW A;  1AZE A;  1W1F A;  1X6G A;  5I22 A;  1I07 A;  4RTW A;  2V1Q A;  1Z9Q A;  2GBQ A;  1PNJ A;  2W10 A;  1Z9Z A;  2QDL A;  2DE0 X;  5GJW B;  4JPB W;  3TVT A;  2KGT A;  2HDA A;  3RBB B;  3QWY A;  4LE9 A;  1BK2 A;  1A0N B;  2YUO A;  2SRC A;  3LH5 A;  2ROT A;  1ZUU A;  1GCP A;  3H41 A;  3A98 A;  1IO6 A;  1QKX A;  1VA7 A;  4HXJ A;  1K0X A;  2RQR A;  3VS4 A;  2JW4 A;  3GBQ A;  1K4U S;  2RQU A;  2M0Y A;  2LQN A;  4AFS C;  4CC3 A;  5HCK A;  1GFD A;  2AKL A;  1SPK A;  2JMA A;  4OMN A;  1GBR A;  1AZG B;  1UDL A;  4F14 A;  1V1C A;  2KXD A;  4D8K A;  2FRW A;  4F17 A;  2DL3 A;  2KE9 A;  3JV3 A;  2K3B A;  2G6F X;  4Z8A A;  3I9Q A;  5FWB A;  2CT3 A;  2BZX A;  2J6K A;  4K11 A;  3VS3 A;  3UAT A;  2GTO A;  3PE0 A;  1SEM A;  2LJ3 A;  1M30 A;  2YDL A;  2EYX A;  2RN8 A;  1JXM A;  1H92 A;  1AWJ A;  1G2B A;  2FPF A;  3EG3 A;  1OOT A;  4JZ4 A;  3REB B;  1YNZ A;  4E6R A;  1WI7 A;  4RTU A;  1M27 C;  1UTI A;  2YT6 A;  4RTT A;  1WX6 A;  1T0J A;  2J6F A;  1M3C A;  3RNJ A;  1X6B A;  1ZLM A;  2VVK A;  2PNI A;  2JTE A;  1K1Z A;  1RI9 A;  1YWO A;  4HVU A;  2JS0 A;  2EPD A;  1WA7 A;  1WYX A;  2RMO A;  2DRK A;  2EQI A;  2LP5 A;  1EFN A;  4A63 B;  4CC7 A;  4JJC A;  1AOJ A;  4OMO A;  1VYT A;  1S1N A;  3O5Z A;  3IQL A;  3TSW A;  1QKW A;  2JXB A;  1E6G A;  2OAW A;  2ED1 A;  2RQT A;  1WXU A;  4QT7 A;  4OML A;  2DJQ A;  2FG0 A;  4LN2 A;  1VYV A;  2EBP A;  4F16 A;  4ZNX A;  2EYZ A;  2D8J A;  2CRE A;  2GNC A;  2LNH B;  3M0S A;  4Z89 A;  3VS7 A;  4IIM A;  2CDT A;  3TSZ A;  2PTK A;  5IH2 A;  2RPN A;  3M0U A;  2KRO A;  1PKS A;  1T3L A;  5IHN A;  1UJY A;  2GGR A;  1ZX6 A;  3EG0 A;  3R6N A;  4CC2 A;  3ULR B;  1UE9 A;  2YSQ A;  1WFW A;  4D8D A;  1JQQ A;  1KFZ A;  4M4Z A;  4AFQ C;  4HCK A;  4OMP A;  1MV3 A;  2NWM A;  2A28 A;  3I35 A;  1WIE A;  2EKH A;  1ABO A;  2MIO A;  1YP5 A;  1UGV A;  2DL7 A;  3H0I A;  2EGA A;  3EHR A;  1WLP B;  2A36 A;  3VS2 A;  2AZS A;  1MUZ A;  1SRM A;  1XOV A;  2L3S A;  1RUW A;  2FPD A;  4R0K A;  1JXO A;  1GCQ C;  1CSK A;  1UHF A;  2L3P A;  1PHT A;  1UHC A;  2D0N A;  4CC4 B;  1OPK A;  3I5R A;  4RTY A;  5FW9 A;  1K0S A;  2E5K A;  3FJ5 A;  4J9I A;  1JEG A;  1HSQ A;  2H8H A;  4IIO A;  2J7I A;  2K79 A;  4LUE A;  3VS1 A;  1W70 A;  1WXT A;  2D1X A;  3NGP A;  1CKA A;  3C0C A;  1E7O A;  2SEM A;  1BU1 A;  2DX1 A;  2J6O A;  1GRI A;  5FWC A;  3M0R A;  1ZSG A;  3EHQ A;  1JU5 C;  1SSH A;  1GL5 A;  2LMJ A;  2EGC A;  3PVL A;  2FRY A;  1T0H A;  2X3X D;  1H3H A;  1PRM C;  2J05 A;  1X27 A;  2PZ1 A;  3KFV A;  4LUD A;  1B3Q A;  3VRZ A;  2L0A A;  2RQV A;  3M0P A;  1NLP C;  4J9B A;  1KJW A;  1ZUY A;  2C0O A;  1NYG A;  2LCS A;  1NEB A;  5IHI A;  3SHW A;  2FEI A;  3REA B;  2LQW A;  1RLQ C;  3ZL7 C;  2P4R A;  2M51 A;  2EYY A;  1LCK A;  2JMC A;  2DLP A;  2LZ6 B;  1BBZ A;  4OMM A;  3H0H A;  4J9H A;  4J9E A;  4AG1 C;  1UJ0 A;  2DA9 A;  2KXC A; 
#chains in the Genus database with same CATH topology
 3CC2 Q;  4LDX A;  4FYV B;  1SHG A;  1W2B A;  1IGU A;  2HCK A;  3X20 B;  5CO7 A;  1KHC A;  2RJE A;  2CSI A;  4PJN A;  2KRS A;  3DLL A;  1YN8 A;  3OYA A;  3QJ6 A;  2W0Z A;  3HKS A;  3GNF B;  3VJP A;  2RI5 A;  2ESW A;  1QLY A;  2OAU A;  3OYF A;  2BTT A;  3L2Z A;  5KYX A;  2FYK A;  3UA6 A;  4J9D A;  2KBT A;  1FWZ A;  1RAH B;  2ROL A;  3X25 B;  2JNG A;  4AG2 C;  1BI3 A;  3A8L B;  4J6W A;  3JCM W;  3CME Q;  2A08 A;  3EH2 A;  1X2K A;  2AIR B;  5KYW B;  2D6F A;  3DKM A;  1YIJ Q;  2K5L A;  2L89 A;  4JRK A;  5HK3 A;  2OJ2 A;  3OYK A;  1IZ6 A;  1QCF A;  4KRT A;  4M7D A;  1HD3 A;  4QVC A;  3QYG B;  1VQ4 Q;  2ZCF B;  4A4F A;  2LC4 A;  1OPL A;  1WPY A;  1VQK T;  4DA4 A;  5GAN 4;  1JJ2 A;  4MZT A;  1QP3 A;  1D1A A;  4JZ3 A;  2O9V A;  3CD6 T;  5GAN 7;  2L3Q A;  1AWX A;  4OVA A;  2EFI A;  1NYF A;  1SRL A;  1UFF A;  4RTZ A;  2QTV A;  2OTL Q;  3X24 B;  2XDP A;  2Z0W A;  4M78 F;  4J9C A;  1X01 A;  1UB4 A;  5GAO n;  3I55 A;  1PG5 B;  2NUZ A;  4BD3 A;  4D6W A;  1V29 B;  3CEY A;  2K4Y A;  5FU7 C;  3PFS A;  1PWT A;  3OYM A;  4RTX A;  2V8I A;  4FSS A;  2XD0 A;  4FW1 A;  1YHQ T;  3M0Q A;  2A37 A;  2A3L A;  3G4S Q;  2QYZ A;  3THK A;  4M7D D;  2QAZ A;  2PU9 B;  4DBH A;  5A0L A;  2HNI A;  2ZPH B;  1TG0 A;  3CCQ A;  1K9A A;  2I0N A;  4AMC A;  1VQN Q;  5AT1 B;  4KGV B;  1K8A R;  2O2O A;  4M75 C;  4A4G A;  4RTV A;  2X4Y A;  4ZGD B;  5A0G A;  1G3T A;  2QA4 T;  4C5E A;  8AT1 B;  3DLM A;  2G3R A;  2JN0 A;  3TQ7 P;  1F1B B;  1VQK A;  1IHW A;  1U06 A;  2KT8 A;  1M1G A;  2DET A;  2B86 A;  5GAN 6;  4KUI A;  2YXY A;  3CD6 A;  2KEA A;  1NM7 A;  1BKB A;  2AT1 B;  2EAY A;  5I11 A;  5GAN 5;  2DIL A;  2FVU A;  1OYX A;  6AT1 B;  2BUD A;  1O75 A;  3EG2 A;  5IT9 E;  2DBM A;  4KH0 B;  2VWF A;  2DYB A;  4GY5 A;  2KT1 A;  3CCL T;  4OGC A;  1MMN A;  2KNB B;  2O88 A;  3CCU T;  3M58 A;  2DL8 A;  4HVV A;  2KYM A;  5FU6 C;  3OS5 A;  1W1F A;  3CMA A;  3QZ9 B;  1YHQ A;  1S72 Q;  4X9C A;  1DJ7 B;  4HCC A;  4Y28 E;  2FZK B;  3GIB A;  2LQ8 A;  2MAM A;  2LNV A;  3RBB B;  4EMK C;  4OB3 B;  3QDR B;  4M7D F;  2SRC A;  3LH5 A;  2ROT A;  3A98 A;  1LJO A;  4KGX B;  4C0Z A;  1MNE A;  4HXJ A;  2JW4 A;  1N6A A;  4VUB A;  2XI9 A;  1NZ9 A;  3HRT A;  2F1L A;  2DIG A;  2QA4 A;  4AFS C;  2EQK A;  3EG9 A;  3CBM A;  5GMK e;  4AT1 B;  2XIC A;  1QP2 A;  4KT0 E;  1VQL T;  1GBR A;  4PKC C;  3OYI A;  2WAC A;  3HRS A;  2FRW A;  3JV3 A;  3OW2 P;  3RMS A;  1EIF A;  2QGF B;  1G5V A;  1SSF A;  3I9Q A;  4ME7 A;  1K73 C;  1M2V B;  2CP0 A;  2J6K A;  4K11 A;  2GTO A;  1N8R R;  3PE0 A;  1PD0 A;  5KCH A;  4XTZ A;  2EYX A;  3A8H B;  2FZG B;  1PSF A;  1YJ9 T;  1QVP A;  1AWJ A;  3CCL A;  3CCE T;  4PL6 A;  5A2Q E;  1OOT A;  4JZ4 A;  1YNZ A;  2RK1 A;  3CCU A;  2E70 A;  4A4E A;  3A8M B;  2LCL A;  4RTU A;  5CKF A;  1PD1 A;  1UTI A;  4RTT A;  1KHI A;  2RI2 A;  4O5V A;  3CPW P;  2PNI A;  1K1Z A;  1RI9 A;  4UC4 A;  1Q81 C;  1WA7 A;  2CGH A;  2RMO A;  4PJO G;  2R5A A;  2LP5 A;  4CC7 A;  5FU7 B;  5GMK j;  1VYT A;  3C94 A;  3QYH B;  3SWN B;  2JXB A;  2CZ0 B;  2Y4Y A;  3L2V A;  1WNL A;  4QT7 A;  2NYS A;  4OML A;  4Z02 A;  1VQP Q;  4ZNX A;  2D8J A;  1OU8 A;  3VS7 A;  1VQL A;  3NTK A;  4A54 A;  3JSC A;  1K9M R;  3OS0 A;  2PQW A;  2IG0 A;  1YJN Q;  5IHN A;  4P5N A;  4M75 B;  4J8O A;  2IPO B;  3JCM c;  3JB9 J;  4XTV A;  2YSQ A;  5GAN f;  2E12 A;  1WFW A;  1SG5 A;  1JQQ A;  2EJG A;  1KFZ A;  4MML A;  4E7H A;  4PLI A;  4AFQ C;  4HCK A;  4M75 E;  1MV3 A;  1M90 C;  1WIE A;  1YP5 A;  3CCE A;  1WQW A;  2EYQ A;  1N9S A;  2A36 A;  1MUZ A;  3CC2 T;  2L3S A;  1RUW A;  1JJ2 S;  1RAE B;  3A8O B;  1M5Q 1;  1UHF A;  3L1A A;  1PHT A;  4CC4 B;  2K3X A;  2X4J A;  4RTY A;  3L2R A;  1Y07 A;  3VUZ A;  2F5K A;  4KUD K;  4M77 G;  4C92 G;  1UEB A;  4PJO B;  5LJ5 g;  1HSQ A;  2RJC A;  4M7A G;  1FX7 A;  3M57 A;  5LJ5 e;  2J7I A;  3CXC P;  4LUE A;  3JAM E;  5GAM f;  2DZC A;  1E7O A;  2SEM A;  3S3N A;  2DIQ A;  2I2L A;  3OYC A;  2J6O A;  2DX1 A;  2YRC A;  4E7S A;  1SSH A;  3CME T;  3LLR A;  1FMV A;  2DPP B;  2LMJ A;  3RKY A;  2VXF A;  2O4X B;  1Q86 R;  2IVW A;  4OB1 B;  5CCA A;  1PRM C;  1KC8 R;  1X27 A;  4EMK A;  4R56 A;  3JB9 F;  1O9S A;  1QQJ A;  3CCS Q;  2KMT A;  4J9B A;  1NLP C;  2V8J A;  1VQ4 T;  1VQO Q;  1U1T A;  4BE2 A;  2HZY A;  4N0A C;  5LJ5 d;  5IHI A;  2FEI A;  4TVR A;  3V7C A;  4N4I A;  2B8A A;  5CR2 A;  4IUQ A;  1RLQ C;  1IRE B;  4JLG A;  4BY6 C;  2DLP A;  3CPF A;  2X4W A;  4B9W A;  2MK5 A;  3PNW C;  2OTL T;  2ZPG B;  4J9H A;  2COZ A;  3CC2 A;  1BCO A;  4AG1 C;  1R77 A;  4OMN A;  3L2W A;  5LJ5 j;  2HKQ B;  2MIO A;  4C0D B;  2NUP A;  1OZ2 A;  3RUX A;  2H3J A;  4KUL A;  3UT1 A;  4C0F A;  3LW5 E;  2D9T A;  4PFP A;  4C92 B;  1D1B A;  4ZGJ B;  1MV0 B;  2RHI A;  3C95 A;  2QXF A;  2LX7 A;  4E7L A;  4BE0 A;  4C8Q G;  1M2O A;  3I56 Q;  2JM9 A;  4EIK A;  3G4S T;  4C92 E;  1WHL A;  2LT1 A;  3BY7 A;  2NUT A;  2DD4 A;  4PNO A;  2RB6 A;  4X34 A;  1BB9 A;  3CCJ Q;  4RG8 A;  3EGD A;  3CME A;  4E7Z A;  1NJI R;  1M1K R;  1X2Q A;  1ABQ A;  4J7I A;  4M75 F;  1YIJ A;  1D3B B;  1ZBJ A;  2KR3 A;  1EZZ B;  1R0C B;  1JO8 A;  2DL4 A;  2MWO A;  3M0T A;  1YJ9 Q;  3MP6 A;  1VQ4 A;  3P8D A;  3QWX X;  3M9Q A;  1NPP A;  2F2V A;  1M3B A;  2C0I A;  4RKU E;  3OYJ A;  2DF6 A;  2VAS A;  1BI2 A;  1RAI B;  2HSP A;  3SEM A;  3NMZ C;  4Y91 A;  5CIU A;  1E6H A;  1N5Z A;  2GQV A;  1J3T A;  3I5S A;  2F69 A;  4HVW A;  4A4K A;  5IHK A;  1N8R U;  2DTH A;  4X1V A;  2ZAE A;  2OTL A;  3OB9 A;  2K2M A;  2AK5 A;  9ATC B;  5GAN 3;  2CP2 A;  1WZO A;  2EQU A;  3MEW A;  5J26 A;  4ESR A;  2PVO B;  1R0B G;  4Y92 A;  5CAI A;  1BI1 A;  2F2X A;  1NG2 A;  1KQS S;  3EFO B;  1RI0 A;  1G83 A;  3QZ5 B;  3EFS A;  4C8Q B;  4JLI A;  4DEX A;  2DBK A;  5KYU B;  1M3A A;  4EMG A;  1S72 T;  1AWO A;  3G4S A;  2EYW A;  1LOJ A;  3CC4 Q;  1AHJ B;  1UG1 A;  3MO8 A;  2DK3 A;  4C8Q E;  2XDD A;  3OYG A;  1TUC A;  4CI0 C;  3M4G A;  1TXQ A;  4CRI A;  3OYH A;  4Z88 A;  5IN1 A;  2GCX A;  3ZFJ A;  1VQN A;  4J9G A;  2ABL A;  2K5I A;  2LJ0 A;  2DEU A;  1YCS B;  2DMO A;  2DJZ A;  3G6E Q;  3RER A;  2J06 A;  4JRI A;  3ME9 A;  4ZN3 A;  1K9M U;  2CUD A;  3VUB A;  3GPL A;  1K76 A;  1AVZ C;  3GP8 A;  1WHJ A;  1BYM A;  4QQG A;  4V2S A;  1UEC A;  2C0T A;  1RAD B;  3UA7 A;  1Y71 A;  2OI3 A;  1AEY A;  1NLO C;  5FLX E;  2DNU A;  2YWW A;  3BW1 A;  1WDX A;  3OMC A;  2YLB A;  2XMF A;  5DLQ E;  4C92 F;  3NTH A;  3NHN A;  4BI8 B;  2KK4 A;  1HYO A;  4N0A A;  3E9G A;  3O8V A;  1GFC A;  3EG1 A;  2BZ8 A;  3FJP A;  2C06 A;  4J6X A;  4LDU A;  4L59 A;  3OW2 A;  3P8B B;  4E47 A;  1KQ1 A;  4DBR A;  1D0Z A;  4BY6 B;  5DY9 A;  2CUB A;  1Y96 B;  4A53 A;  3SB2 A;  2ENM A;  4PJJ A;  5DLO A;  1S72 A;  1X6G A;  2KY9 A;  4J7F A;  2OX7 A;  5KYW A;  4RTW A;  3ZBD A;  4QVZ A;  2EWN A;  1Z9Q A;  1I81 A;  3QUI A;  3JRZ A;  2W10 A;  5GMK m;  2QDL A;  1G3Y A;  4JPB W;  5GMK i;  4NL3 A;  2R5M A;  4HT8 A;  1M8V A;  3QWY A;  5GAN 8;  4LE9 A;  1BK2 A;  2YUO A;  2E41 A;  3M54 A;  4X9D A;  1VQ5 Q;  1IO6 A;  3CPW A;  3JB9 H;  1QKX A;  1VA7 A;  4RCB A;  3M53 A;  3MCA B;  2E4H A;  1VQP T;  1K0X A;  1NPR A;  1Q86 U;  1KC8 U;  1GFD A;  2AKL A;  1SPK A;  2JMA A;  3L2U A;  1PC0 A;  1WJQ A;  3RIR A;  5C0M A;  1YJN T;  1QW1 A;  3M56 A;  3MPU B;  4LDW A;  1UDL A;  4F14 A;  1V1C A;  3J80 E;  4D8K A;  3CCR Q;  4Z8A A;  3CC7 T;  3SWN C;  5FWB A;  4FT2 A;  2K3Y A;  2YRV A;  1WHK A;  3G71 Q;  2HQH A;  3VS3 A;  4XTX A;  5FRO A;  2DTO A;  1MND A;  4C8Q F;  4OP0 A;  4BE1 A;  5LJ3 f;  1JXM A;  3EG3 A;  4NS5 A;  2JUF A;  3KUF A;  2OTJ Q;  3QG1 A;  4QKU A;  3NTI A;  3INZ A;  2L8D A;  3AHU A;  1PSE A;  2DYI A;  2RJD A;  1QVF S;  1T0J A;  1GXI E;  2AHJ B;  2M0O A;  3JCM b;  2VVK A;  2JTE A;  3RDV A;  3LGL A;  1WYX A;  4XU3 A;  2K2V A;  4A63 B;  1EFN A;  4PK4 A;  4JJC A;  4OMO A;  2MWP A;  3QBY A;  1KD1 C;  1RAA B;  8ATC B;  1VQP A;  1NJI U;  2M16 A;  4MMK A;  3TEE A;  5LJ3 g;  1M1K U;  1B7T A;  2MI6 A;  2FG0 A;  4LN2 A;  1ZSZ C;  3MET A;  1Q82 R;  5LJ3 e;  4E7J A;  1FMW A;  2CKK A;  3M0S A;  4Z89 A;  2CDT A;  3CXC A;  2PTK A;  1JB0 E;  1ZHI A;  1YJN A;  2CP5 A;  3M0U A;  1K8A C;  2KRO A;  1Q7Y C;  3URG A;  1PKS A;  4ELZ C;  3CCS T;  4PJO C;  1VQO T;  3AT1 B;  2GGR A;  3EG0 A;  2QQR A;  1ACM B;  2FL7 A;  4D8D A;  4C5H A;  3LWH A;  4M4Z A;  2FZC B;  1YBY A;  5M9O A;  3E9F A;  3RR6 A;  2KVQ G;  3S3O A;  5EG2 A;  2V26 A;  4ZTF A;  5LJ3 d;  3JCM f;  2RH2 A;  3H0I A;  3EHR A;  3VS2 A;  1VQ8 Q;  2V8K A;  4DBQ A;  3JCM J;  5CVI A;  4HT9 A;  4JJN K;  3T9N A;  3LWI A;  3I5R A;  1K73 R;  4EPC A;  3OA6 A;  3I56 T;  1JEG A;  5LJ3 j;  4IIO A;  2K79 A;  3FC3 A;  3HHT B;  4IKF A;  3VS1 A;  2XK0 A;  2RJF A;  3EGX B;  3RES A;  1UGQ B;  5LL6 S;  3E2U A;  3CCJ T;  2X4X A;  2QEX Q;  3JCM g;  3M0R A;  1ZSG A;  1M2V A;  3C12 A;  2E10 A;  4IUP A;  4C0D C;  3JCM e;  1GL5 A;  2EGC A;  2VYT A;  4BDY A;  4M77 C;  2RO0 A;  4C92 C;  2CP3 A;  2FRY A;  3DB4 A;  1T0H A;  4M7A C;  3CCS A;  3N5B B;  3PTA A;  1IHV A;  1QVG S;  2PZ1 A;  2COY A;  4MDX A;  2LCC A;  4LUD A;  1VQO A;  4FYY B;  1B3Q A;  1VQ6 T;  2FHD A;  3VRZ A;  2VGM A;  2L0A A;  2RQV A;  3X26 B;  1ZUY A;  1NYG A;  1BIB A;  3E1S A;  3MP8 A;  4II1 A;  3SHW A;  5KH6 A;  3BDU A;  2E1H A;  3HFO A;  1X75 C;  4FM4 B;  3RMQ A;  3ZL7 C;  3WXM B;  5I2S A;  2P4R A;  4F7U G;  3JCM Q;  2EYY A;  2KI7 A;  1RAB B;  1WQ7 A;  1LPL A;  2JMC A;  1W2B S;  2MMP A;  2JTM A;  3JCM d;  2LZ6 B;  1BBZ A;  4OMM A;  2HMA A;  1JJ2 P;  5DM7 R;  1UJ0 A;  3SWN A;  5HKC A;  3EGU A;  3CQT A;  3MHX A;  2P0P A;  2PVG B;  2K5F A;  2P4T A;  2FO0 A;  4QVD A;  1U5S A;  3JB9 D;  3J7A F;  5CKE A;  3FEO A;  3I56 A;  2YUQ A;  5L23 A;  2DD5 A;  3A8G B;  1OQK A;  1CKB A;  4OMQ A;  3CC4 T;  4ANJ A;  5IAY A;  1OX8 A;  3NPF A;  1M90 R;  2O31 A;  2PVD B;  2HEQ A;  2KYB A;  1SHF A;  4M75 A;  2ED0 A;  1PM3 A;  4J5Y A;  3CCJ A;  3QKJ A;  5LJ5 f;  2AKK A;  3OS1 A;  3CC7 Q;  1GBQ A;  3PMI A;  3TCJ A;  3CCV Q;  3KXT A;  1VOM A;  3KBG A;  1VQM Q;  1PCX A;  1X43 A;  1XJW B;  1WXB A;  2COW A;  3HP9 A;  5C6S A;  3G6E T;  2HKN A;  3JCM P;  1YJ9 A;  1RLP C;  2F5T X;  2MCN A;  2QQ9 A;  1XQH A;  2EQJ A;  4C8Q C;  4MDW A;  1HXD A;  3QDF A;  5CQX A;  1ZSZ B;  5GAO m;  1YCY A;  3OY9 A;  1YFN A;  3BFM A;  1YJW Q;  1FXX A;  3EH1 A;  4F7U B;  4HCB A;  5KYY B;  1U8R A;  2HBP A;  2CZ6 B;  2GQI A;  2YUN A;  1FMK A;  2CH4 A;  4PJO A;  1ARK A;  1B07 A;  2O9S A;  5ECA A;  3LGF A;  3ER0 A;  3CCM Q;  1VQ9 Q;  4JJD A;  3PVQ A;  2KRN A;  2LX9 A;  4ATO A;  4PJO E;  2EGE A;  1T3S A;  2V1R A;  3HSB A;  1I1J A;  1I0C A;  4M75 D;  3H8Z A;  3GOX A;  2EVR A;  2DO3 A;  2CT4 A;  4EDU A;  1H3Z A;  4XAX B;  2K7A A;  3CC4 A;  2O4X A;  1W6X A;  4AFZ C;  2DXB A;  2X3W D;  1TSF A;  1G3W A;  2QTX A;  1H64 1;  2CYZ B;  2E64 A;  2Y90 A;  3WVE B;  3UF4 A;  1VQ5 T;  4XQ3 A;  4C5I A;  4HA8 A;  3G6E A;  1ZUK A;  3A1P A;  1Q82 U;  5D6Y A;  5GAO l;  2L3R A;  3PT9 A;  4XU2 A;  1AWW A;  4LDY A;  2QAS A;  2L5Q A;  5CKB A;  1PKT A;  4IUT A;  2ZPF B;  1X69 A;  4B6M A;  2VXE A;  3U23 A;  1TUD A;  2VUB A;  4C5G A;  7AT1 B;  1ZQ1 A;  4QQ6 A;  4GLM A;  1VYU A;  2QQS A;  4M77 B;  3CCR T;  4M7A B;  4M78 G;  4KBM B;  4C92 A;  2BZY A;  5EC7 A;  1ZBX A;  1PRL C;  1U3O A;  2D8H A;  5FRN A;  2GTJ A;  3OBY A;  2ECZ A;  3HRU A;  3G71 T;  4MZP A;  2DTI A;  2MOX A;  4M77 E;  2EW3 A;  2XDB A;  4M7A E;  4KGZ B;  2JM8 A;  1QWF A;  3V8K A;  2K6D A;  1KQS P;  3EAE A;  5HK0 A;  3DB3 A;  2XU8 A;  2OTJ T;  1H8K A;  2E5Q A;  2DM1 A;  4XTU A;  1OV3 A;  1D3B A;  1JBM A;  1W4S A;  3H9N A;  1K73 U;  5I22 A;  3QII A;  2E3H A;  1I07 A;  2CP6 A;  3MJX A;  4FW2 A;  1VQ6 Q;  1PNJ A;  1Z9Z A;  3VKI A;  2KAF A;  3E19 A;  3QXE B;  4LD9 K;  2QQB A;  2KGT A;  2A0F B;  3MEV A;  1VQ5 A;  3OYE A;  3GLX A;  3OMG A;  2FB7 A;  3M5A A;  4C92 D;  2YHT A;  5CKH A;  3GBQ A;  1K4U S;  3LH0 A;  2RQU A;  2RHX A;  3OYB A;  2LQN A;  4CC3 A;  1N27 A;  4PJO F;  1C0M A;  3VYH B;  1Q81 U;  3GNG A;  1WHH A;  4F04 B;  4M78 B;  4A4H A;  2E6Z A;  3CCR A;  2HL3 A;  3EFO A;  2KXD A;  2P0Q A;  4F17 A;  2DL3 A;  4B9X A;  2K3B A;  4XK8 E;  4C8Q A;  3G71 A;  3P8H A;  5KYU A;  4M78 E;  2CT3 A;  5GAN h;  1TOV A;  1SEM A;  2ZZD A;  1BIA A;  2XKO C;  2RN8 A;  1VQ8 T;  2GFU A;  2QQA A;  2OTJ A;  4RCC A;  2DKG A;  3PMT A;  4OF1 A;  1RL2 A;  3HFN A;  4IUV A;  5CKD A;  3PIP A;  4JDS A;  4M7D G;  1M27 C;  1D0X A;  4XU0 A;  2YT6 A;  3ZEH A;  1WX6 A;  1G3S A;  2J6F A;  4FYX B;  1M3C A;  1X6B A;  1M90 U;  2RHZ A;  1YWO A;  2JS0 A;  1Y7X A;  2DRK A;  1B34 B;  1S1N A;  3TSW A;  1QKW A;  3BE3 A;  2KSS A;  2QEX T;  2ED1 A;  2RQT A;  1WXU A;  5GAM h;  4C8Q D;  3MP1 A;  4M77 F;  1VYV A;  2EBP A;  3HPW A;  4F16 A;  4M7A F;  2GNC A;  2LNH B;  3I55 T;  3TSZ A;  5IH2 A;  5FRM A;  3EFR A;  1UGS B;  2MPX C;  3FLG A;  3SFM A;  1YIT Q;  1UJY A;  3G1J A;  1Y96 A;  5KYX B;  5D6W A;  3ULR B;  2X35 A;  1UE9 A;  3QJY A;  5CQY A;  4OMP A;  2CP7 A;  3CCQ T;  2A28 A;  3HTR A;  1VQ8 A;  3JCM V;  2EKH A;  1ABO A;  4FIB A;  2DEQ A;  1UGV A;  1NBE B;  2DL7 A;  1M1F A;  1QCN A;  1HK9 A;  1SRM A;  2DFU A;  4M7D B;  1XOV A;  4QQD A;  1QVF P;  4R0K A;  1GCQ C;  1CSK A;  1OPK A;  4GLK A;  4DOV A;  4M7D E;  2E5K A;  1K0S A;  1JRI A;  4J9I A;  1I8F A;  4DOW A;  2R57 A;  3NFC A;  5CK9 A;  3LX7 A;  3SDZ A;  2LRQ A;  2BKD N;  2O01 E;  2MF2 A;  1W70 A;  2QEX A;  1WXT A;  2D1X A;  3NGP A;  2NLU A;  1UGP B;  3QSU A;  3C0C A;  3CCV T;  1BU1 A;  3TU4 K;  1GRI A;  5FWC A;  1VQM T;  3SD4 A;  3MEU A;  1JU5 C;  2A7Y A;  1VIF A;  3X28 B;  2BE9 B;  1LVK A;  4OMF B;  4E2F B;  2YLC A;  2HQX A;  4Q5W A;  2D0Q B;  3Q1J A;  4HCZ A;  4XTW A;  2J05 A;  3HL8 A;  2M1H A;  5KCO A;  3RKW A;  3CBP A;  1ZA1 B;  3CMA T;  5GMK l;  1KJW A;  2C0O A;  1YJW T;  1KD1 R;  3CBO A;  1RAF B;  1NEB A;  2E65 A;  1OUL A;  4RG2 A;  2JTF A;  5D6X A;  2LDM A;  5D7U A;  2M51 A;  3CCM T;  5A0D A;  4MZM A;  1VQ9 T;  1OZ3 A;  2WSC E;  3QPH A;  1Q7Y R;  3H0H A;  4J9E A;  4WF2 A;  2K57 A;  1MMA A;  1M8M A;  4RUG A;  1R8O B;  1LNX A;  2KDS A;  4BUG A;  3RKX A;  4NOY A;  2DRM A;  2EJF A;  4QW2 A;  4OB0 B;  1FYN A;  4J9F A;  4E7I A;  4FU6 A;  2HQE A;  3CC7 A;  1VQ7 T;  3CCV A;  5J3B A;  4ZN1 A;  3JB9 G;  2RNA A;  1M4Z A;  1VQM A;  2EQM A;  1YWP A;  2K9G A;  2HSE B;  1IB8 A;  4ORZ A;  1AD5 A;  2L2P A;  2DVJ A;  1QVG P;  3C4S A;  1UUE A;  1WHG A;  3VRY A;  1P92 A;  3OSV A;  1QMC A;  3S3M A;  1Q82 C;  1HJD A;  1VIE A;  2M9U A;  1QWE A;  3OS2 A;  4JJB A;  3M55 A;  1M9S A;  2DXU A;  4DEY A;  1YJW A;  4AFU C;  4J83 A;  2XHC A;  3CCM A;  1VQ9 A;  4OB2 B;  1W2B P;  2DVE A;  2KRM A;  4WCI A;  2RF0 A;  2JS2 A;  2HBW A;  4E7K A;  2ZGW A;  4OGE A;  3S6W A;  2RQW A;  3EG9 B;  5GJV B;  4FCY A;  4L5G A;  4PLL A;  3EGX A;  1D1C A;  2RM4 A;  4JS5 A;  3V7R A;  3JCM X;  4C0G A;  1KIK A;  2JT4 A;  3V7S A;  2VKN A;  4LNP A;  2EKO A;  2X51 A;  3I55 Q;  4FYW B;  1NEG A;  4GBQ A;  4M75 G;  1Q81 R;  1KQS A;  3OYY A;  2VV5 A;  3PIO A;  4FSX A;  5AYF A;  1VQ7 A;  4J6Y A;  1MGQ A;  3VS0 A;  2DAQ A;  2YUP A;  1GCQ A;  3VS5 A;  1OEB A;  4IUR A;  2XG8 D;  3G7Z A;  2LT4 A;  1Y57 A;  2QK0 A;  4JUV A;  1KK7 A;  2DL5 A;  1VUB A;  1RAG B;  3CCQ Q;  3V8L A;  3FIF A;  4YTL A;  3VV0 A;  1Y0M A;  2F2W A;  1N8R C;  2CH4 W;  2GFA A;  2Y4X A;  5IXB A;  2IIM A;  2ATC B;  2JOY A;  2LJ1 A;  1YI2 T;  3OQ5 A;  4LD6 A;  1AT1 B;  3ASK A;  1TWB A;  4DBF A;  4BDZ A;  4LXC A;  1VQK Q;  2AZV A;  3VS6 A;  3VU3 C;  3JB9 I;  5KE2 A;  1QCO A;  5IXF A;  3OW2 S;  3CD6 Q;  3H0F A;  5GAO r;  4JRQ A;  1KQ2 A;  4NL2 A;  4FT4 A;  1EX4 A;  2H3E B;  4PFZ A;  1TU0 B;  2E3I A;  3H6Z A;  3QHS A;  2FPE A;  4M78 C;  2CSQ A;  5LJ3 h;  4N4H A;  1KSW A;  1I5O B;  1AZE A;  1VQ6 A;  2WSE E;  2V1Q A;  2GBQ A;  4BI3 A;  3CMA Q;  1K9M C;  4HKE A;  1NE8 A;  1ZSZ A;  1IGQ A;  2DE0 X;  5GJW B;  1YHQ Q;  3CPW S;  4BAC A;  3R6O A;  3TVT A;  1C6V X;  3FB9 A;  1X6O A;  2HDA A;  1A0N B;  1I5L A;  1D0Y A;  4F7U A;  2DZ9 A;  3V8J A;  5KYY A;  1ZUU A;  1GCP A;  2QG9 B;  3H41 A;  2DER A;  4PJM A;  5I21 A;  2RQR A;  3VS4 A;  4F7U E;  1G8X A;  5L8R E;  2M0Y A;  2RD1 A;  1WJR A;  3QO3 A;  5HCK A;  4RMO A;  1YI2 A;  5GAN g;  2QA4 Q;  4O6J A;  2JZ2 A;  2RHY A;  1AZG B;  2E6N A;  1YIT T;  4FL6 A;  5GAN e;  2WSF E;  1KD1 U;  2EJ9 A;  4N4G A;  2KE9 A;  5FU6 B;  3BDL A;  3M59 A;  2G6F X;  5GMK h;  3MEA A;  2BZX A;  2HL5 C;  4BI4 A;  3UAT A;  1OX9 A;  1ZA2 B;  1VQ7 Q;  1OI1 A;  3UPU A;  1K8A U;  1Q7Y U;  2LJ3 A;  1M30 A;  1TUG B;  2YDL A;  4EMK B;  1YIJ T;  3OBW A;  2X9H A;  4ELY C;  1H92 A;  1G2B A;  2FPF A;  2QGG A;  3REB B;  4E6R A;  3JCM h;  2M02 A;  5GAO p;  1WI7 A;  3CCL Q;  4PJO D;  4ZTJ A;  4R55 A;  5I2M A;  5GAN d;  3CCU Q;  4ZGE B;  2RK2 A;  3WVD B;  1Q86 C;  2VGN A;  3RNJ A;  1ZLM A;  5GAM g;  1KC8 C;  1TH7 A;  4HVU A;  5GAM e;  2EPD A;  2CZ7 B;  1BI0 A;  4DQ2 A;  4M77 A;  2EQI A;  1QVF A;  1AOJ A;  5KYN A;  4M7A A;  3O5Z A;  2R58 A;  3IQL A;  3TRE A;  2EIF A;  1WHM A;  1E6G A;  3CXC S;  2OAW A;  2NUP B;  1MMG A;  5GAN j;  4M7D C;  5GAO q;  2DJQ A;  1RAC B;  1IXD A;  2ZPE B;  3OYN A;  1MHN A;  2EYZ A;  5HY6 A;  2CRE A;  3LYI A;  5GAN 2;  1XNI A;  4IIM A;  1Q95 G;  3D7S B;  2RPN A;  2ZPB B;  1YIT A;  3GF5 A;  1T3L A;  3OYL A;  1VQL Q;  2BIV A;  2NUT B;  2RI3 A;  3OSS C;  2KQW A;  1ZX6 A;  3R6N A;  1MMD A;  1OU9 A;  4CC2 A;  2QI2 A;  3UWN A;  5GAM d;  3EGD B;  4EMH A;  4JS4 A;  4BB7 A;  2P84 A;  3FRN A;  1D09 B;  3MKD A;  3UDC A;  1VQN T;  1IRX A;  2NWM A;  1TTH B;  4KH1 B;  3I35 A;  4JRP A;  2RA2 A;  3J81 E;  2EGA A;  1WLP B;  2AZS A;  4M77 D;  2PUO B;  5GAM j;  3CCE Q;  4M7A D;  2DXC A;  1U1S A;  2FPD A;  1NJI C;  3VYG A;  1JXO A;  2YRD A;  1M1K C;  4F7U F;  2L3P A;  1UHC A;  4XTY A;  2D0N A;  3OYD A;  2GF7 A;  5FW9 A;  4XU1 A;  3FJ5 A;  3FDR A;  1SKU B;  2H8H A;  4M78 A;  2HAX A;  1YI2 Q;  1XTD A;  2LVM A;  1V76 A;  4LDV A;  1I4K 1;  1CKA A;  2JVV A;  2P0K A;  4PJL A;  2CS7 A;  2HD0 A;  2VB6 A;  2ZPI B;  3EHQ A;  5LJ5 h;  3M4Y A;  3F70 A;  1KG1 A;  2CZ1 B;  3L42 A;  1WGS A;  2DXT A;  3PVL A;  4WTO B;  2X3X D;  1BCM A;  1H3H A;  2XID A;  3KFV A;  3PGG A;  2QDY B;  1TS9 A;  3M0P A;  2BE7 D;  5J39 A;  2LCS A;  2PUK B;  2VC8 A;  1QVG A;  1C1A A;  3REA B;  2RHU A;  2LQW A;  2JJ9 A;  3A5Z B;  4IUU A;  2LQK A;  1LCK A;  2MYS A;  2LTO A;  5KE3 A;  1N9R A;  4L6V 5;  4PFO A;  4M78 D;  1WJS A;  1B34 A;  3L2Q A;  1UGR B;  1SF9 A;  2DA9 A;  2KXC A; 
#chains in the Genus database with same CATH homology
 1M8M A;  3EGU A;  1SHG A;  4RUG A;  3CQT A;  2HCK A;  2FO0 A;  1MV0 B;  1U5S A;  2CSI A;  2DRM A;  2KRS A;  2YUQ A;  5L23 A;  1YN8 A;  1CKB A;  2LX7 A;  4OMQ A;  1FYN A;  2W0Z A;  4J9F A;  2JM9 A;  3NPF A;  4EIK A;  2O31 A;  2ESW A;  1QLY A;  2HEQ A;  2KYB A;  1SHF A;  2ED0 A;  2BTT A;  2RNA A;  2AKK A;  1BB9 A;  3UA6 A;  1GBQ A;  1YWP A;  4J9D A;  2K9G A;  2KBT A;  4ORZ A;  1AD5 A;  2L2P A;  2ROL A;  2DVJ A;  4AG2 C;  1X43 A;  1X2Q A;  1ABQ A;  1ZBJ A;  1UUE A;  1WXB A;  2A08 A;  1RLP C;  2KR3 A;  2MCN A;  3VRY A;  1X2K A;  1JO8 A;  1HJD A;  2DL4 A;  1QWE A;  3M0T A;  4JJB A;  2OJ2 A;  3QWX X;  1QCF A;  4KRT A;  4DEY A;  2F2V A;  1HD3 A;  1M3B A;  2C0I A;  4AFU C;  2DF6 A;  3SEM A;  2HSP A;  3NMZ C;  1OPL A;  1E6H A;  1N5Z A;  1J3T A;  2GQI A;  2YUN A;  3I5S A;  1FMK A;  4HVW A;  2KRM A;  4WCI A;  2CH4 A;  4JZ3 A;  1ARK A;  2O9V A;  1B07 A;  2O9S A;  2RF0 A;  5ECA A;  2L3Q A;  2JS2 A;  5IHK A;  2HBW A;  1AWX A;  4X1V A;  2K2M A;  1NYF A;  2AK5 A;  4JJD A;  3PVQ A;  2RQW A;  1SRL A;  2KRN A;  5GJV B;  1UFF A;  4RTZ A;  2EGE A;  1T3S A;  2V1R A;  1I1J A;  4ESR A;  1I0C A;  4J9C A;  4Y92 A;  2F2X A;  1NG2 A;  1G83 A;  2EVR A;  2NUZ A;  1KIK A;  2JT4 A;  2CT4 A;  2VKN A;  4LNP A;  4DEX A;  2DBK A;  2K7A A;  1M3A A;  1W6X A;  4AFZ C;  1NEG A;  1PWT A;  4GBQ A;  4RTX A;  1AWO A;  2EYW A;  4FSS A;  1UG1 A;  2X3W D;  3VS0 A;  3M0Q A;  2A37 A;  2YUP A;  1GCQ A;  1TUC A;  3THK A;  3VS5 A;  1OEB A;  4Z88 A;  1Y57 A;  3UF4 A;  4J9G A;  1TG0 A;  2ABL A;  1K9A A;  2LJ0 A;  2I0N A;  1YCS B;  2DL5 A;  2DMO A;  1ZUK A;  1AWW A;  2O2O A;  1PKT A;  2J06 A;  4RTV A;  1Y0M A;  1X69 A;  2F2W A;  3U23 A;  2CH4 W;  2CUD A;  1TUD A;  5IXB A;  2IIM A;  1K76 A;  1AVZ C;  2LJ1 A;  1UEC A;  4GLM A;  1VYU A;  2C0T A;  1U06 A;  2KT8 A;  3UA7 A;  2BZY A;  2B86 A;  5EC7 A;  1PRL C;  1U3O A;  2D8H A;  2OI3 A;  1NLO C;  1AEY A;  2AZV A;  3VS6 A;  2DNU A;  2KEA A;  1NM7 A;  1WDX A;  2GTJ A;  2ECZ A;  5IXF A;  2MOX A;  2XMF A;  2EW3 A;  5I11 A;  3H0F A;  2DIL A;  3NHN A;  2JM8 A;  1QWF A;  2K6D A;  3EG2 A;  1GFC A;  3EG1 A;  2BZ8 A;  2DBM A;  2FPE A;  2VWF A;  2DYB A;  1H8K A;  2KT1 A;  2CSQ A;  2CUB A;  2KNB B;  2DM1 A;  1OV3 A;  2O88 A;  2DL8 A;  4HVV A;  2ENM A;  2KYM A;  1KSW A;  1AZE A;  1W1F A;  1X6G A;  5I22 A;  1I07 A;  4RTW A;  2V1Q A;  1Z9Q A;  2GBQ A;  1PNJ A;  2W10 A;  1Z9Z A;  2QDL A;  2DE0 X;  5GJW B;  4JPB W;  3TVT A;  2KGT A;  2HDA A;  3RBB B;  3QWY A;  4LE9 A;  1BK2 A;  1A0N B;  2YUO A;  2SRC A;  3LH5 A;  2ROT A;  1ZUU A;  1GCP A;  3H41 A;  3A98 A;  1IO6 A;  1QKX A;  1VA7 A;  4HXJ A;  1K0X A;  2RQR A;  3VS4 A;  2JW4 A;  3GBQ A;  1K4U S;  2RQU A;  2M0Y A;  2LQN A;  4AFS C;  4CC3 A;  5HCK A;  1GFD A;  2AKL A;  1SPK A;  2JMA A;  4OMN A;  1GBR A;  1AZG B;  1UDL A;  4F14 A;  1V1C A;  2KXD A;  4D8K A;  2FRW A;  4F17 A;  2DL3 A;  2KE9 A;  3JV3 A;  2K3B A;  2G6F X;  4Z8A A;  3I9Q A;  5FWB A;  2CT3 A;  2BZX A;  2J6K A;  4K11 A;  3VS3 A;  3UAT A;  2GTO A;  3PE0 A;  1SEM A;  2LJ3 A;  1M30 A;  2YDL A;  2EYX A;  2RN8 A;  1JXM A;  1H92 A;  1AWJ A;  1G2B A;  2FPF A;  3EG3 A;  1OOT A;  4JZ4 A;  3REB B;  1YNZ A;  4E6R A;  1WI7 A;  4RTU A;  1M27 C;  1UTI A;  2YT6 A;  4RTT A;  1WX6 A;  1T0J A;  2J6F A;  1M3C A;  3RNJ A;  1X6B A;  1ZLM A;  2VVK A;  2PNI A;  2JTE A;  1K1Z A;  1RI9 A;  1YWO A;  4HVU A;  2JS0 A;  2EPD A;  1WA7 A;  1WYX A;  2RMO A;  2DRK A;  2EQI A;  2LP5 A;  1EFN A;  4A63 B;  4CC7 A;  4JJC A;  1AOJ A;  4OMO A;  1VYT A;  1S1N A;  3O5Z A;  3IQL A;  3TSW A;  1QKW A;  2JXB A;  1E6G A;  2OAW A;  2ED1 A;  2RQT A;  1WXU A;  4QT7 A;  4OML A;  2DJQ A;  2FG0 A;  4LN2 A;  1VYV A;  2EBP A;  4F16 A;  4ZNX A;  2EYZ A;  2D8J A;  2CRE A;  2GNC A;  2LNH B;  3M0S A;  4Z89 A;  3VS7 A;  4IIM A;  2CDT A;  3TSZ A;  2PTK A;  5IH2 A;  2RPN A;  3M0U A;  2KRO A;  1PKS A;  1T3L A;  5IHN A;  1UJY A;  2GGR A;  1ZX6 A;  3EG0 A;  3R6N A;  4CC2 A;  3ULR B;  1UE9 A;  2YSQ A;  1WFW A;  4D8D A;  1JQQ A;  1KFZ A;  4M4Z A;  4AFQ C;  4HCK A;  4OMP A;  1MV3 A;  2NWM A;  2A28 A;  3I35 A;  1WIE A;  2EKH A;  1ABO A;  2MIO A;  1YP5 A;  1UGV A;  2DL7 A;  3H0I A;  2EGA A;  3EHR A;  1WLP B;  2A36 A;  3VS2 A;  2AZS A;  1MUZ A;  1SRM A;  1XOV A;  2L3S A;  1RUW A;  2FPD A;  4R0K A;  1JXO A;  1GCQ C;  1CSK A;  1UHF A;  2L3P A;  1PHT A;  1UHC A;  2D0N A;  4CC4 B;  1OPK A;  3I5R A;  4RTY A;  5FW9 A;  1K0S A;  2E5K A;  3FJ5 A;  4J9I A;  1JEG A;  1HSQ A;  2H8H A;  4IIO A;  2J7I A;  2K79 A;  4LUE A;  3VS1 A;  1W70 A;  1WXT A;  2D1X A;  3NGP A;  1CKA A;  3C0C A;  1E7O A;  2SEM A;  1BU1 A;  2DX1 A;  2J6O A;  1GRI A;  5FWC A;  3M0R A;  1ZSG A;  3EHQ A;  1JU5 C;  1SSH A;  1GL5 A;  2LMJ A;  2EGC A;  3PVL A;  2FRY A;  1T0H A;  2X3X D;  1H3H A;  1PRM C;  2J05 A;  1X27 A;  2PZ1 A;  3KFV A;  4LUD A;  1B3Q A;  3VRZ A;  2L0A A;  2RQV A;  3M0P A;  1NLP C;  4J9B A;  1KJW A;  1ZUY A;  2C0O A;  1NYG A;  2LCS A;  1NEB A;  5IHI A;  3SHW A;  2FEI A;  3REA B;  2LQW A;  1RLQ C;  3ZL7 C;  2P4R A;  2M51 A;  2EYY A;  1LCK A;  2JMC A;  2DLP A;  2LZ6 B;  1BBZ A;  4OMM A;  3H0H A;  4J9H A;  4J9E A;  4AG1 C;  1UJ0 A;  2DA9 A;  2KXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...