3M0SA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0sA00
1SHFA 1QCFA 5IHIA 1IO6A 2JMAA 1SHGA 2LQWA 2JW4A 1ZBJA 2RQVA 2HEQA 1AZGB 1ZX6A 3FJ5A 2DL4A 2DE0X 2CH4W 4M4ZA 2VWFA 1YWPA 4LE9A 1BBZA 2DM1A 2YUPA 4Z88A 5L23A 1G83A 1I1JA 4AG1C 4OMMA 1GBRA 2LJ0A 1EFNA 4OMLA 1GFCA 3EG0A 2GGRA 1WXBA 1WX6A 1ZUYA 3SEMA 2J06A 3CQTA 1ZUKA 4OMPA 2MIOA 5ECAA 2LZ6B 2NWMA 1MV3A 3LH5A 1RI9A 1Y0MA 3VS6A 1AZEA 1M3CA 2EYXA 2KGTA 2YUNA 2ESWA 2CREA 3I9QA 2M51A 4JZ3A 2HSPA 1K4US 1MV0B 1PWTA 2MOXA 2K6DA 1M30A 4CC2A 4RTZA 2QDLA 1UG1A 1NEGA 1CKBA 1J3TA 2L3SA 3NMZC 5GJWB 2HBWA 1NM7A 2H8HA 2JS0A 2FPFA 2J6KA 4LNPA 3GBQA 3VS5A 2L3QA 3EG3A 4HVWA 4ESRA 2SEMA 1WIEA 3QWYA 1PKTA 1MUZA 2KYBA 2X3WD 2KXCA 2GTJA 4FSSA 2CUBA 1TUCA 2DL7A 2I0NA 2XMFA 3TSZA 2OAWA 3ULRB 2JTEA 3REBB 2DA9A 2DILA 2HCKA 5IHNA 2CT3A 2KROA 4CC3A 1JXMA 2JM9A 1Y57A 2DL3A 2M0YA 1ABQA 3EHRA 2CSIA 2C0IA 3I5RA 1RUWA 3VS1A 4J9IA 1NLPC 4OMNA 1KSWA 1OV3A 2KRSA 2D8JA 4K11A 4E6RA 1SEMA 3THKA 2KT1A 1VA7A 4J9BA 3KFVA 2SRCA 4Z8AA 2ED0A 1A0NB 3UA7A 2J7IA 4LUDA 3NPFA 4D8KA 2KYMA 4OMQA 1AWWA 1U3OA 1X2KA 4J9GA 1T0JA 2A37A 2LMJA 5IHKA 3UATA 1X2QA 4JZ4A 2LJ1A 2RNAA 3H0HA 2MCNA 5GJVB 2K9GA 1NLOC 2BZYA 2A08A 1BB9A 1QLYA 1JQQA 2O2OA 1H92A 1VYUA 4HVUA 1YNZA 1JEGA 2HDAA 2KBTA 2RQUA 2FG0A 3NGPA 1ZUUA 4J9EA 1GCQC 1KIKA 2FEIA 2O9SA 2LP5A 1WDXA 1JU5C 3I5SA 2F2XA 1AOJA 2CSQA 2DVJA 2B86A 2LQNA 2PZ1A 1UJ0A 2ECZA 2BZ8A 3PVQA 1W70A 2DYBA 4A63B 4J9FA 4CC4B 1ARKA 2LCSA 2CDTA 2EGCA 1K1ZA 2L3PA 1S1NA 4RTUA 3SHWA 4F14A 3UF4A 4GLMA 3I35A 2DF6A 1X69A 1PRMC 1SPKA 2AZSA 3TSWA 1K76A 2VVKA 1G2BA 3NHNA 1W6XA 4JJCA 2PNIA 1OPLA 4DEXA 1X6GA 2F2VA 1UE9A 4OMOA 2ABLA 2D8HA 1PRLC 4EIKA 4JJDA 3ZL7C 2RMOA 1AWJA 1K0SA 1GFDA 1OPKA 1WI7A 1YWOA 3VS2A 1QWEA 1B3QA 2JXBA 1UTIA 2EPDA 1RLPC 2J05A 1YP5A 1SSHA 2J6OA 4HVVA 1PKSA 1K0XA 2KRNA 3EGUA 2NUZA 1WLPB 1JO8A 1NEBA 3EG1A 2EVRA 3VRZA 1N5ZA 2DBKA 1TUDA 2K79A 3VS0A 1I0CA 4AG2C 2DLPA 3EHQA 2GBQA 2DBMA 1X27A 2EGEA 3VS3A 2FPDA 3O5ZA 2W10A 3H41A 1BK2A 3H0IA 3A98A 4R0KA 2RQWA 4DEYA 4J9DA 1WXTA 2W0ZA 1U5SA 1K9AA 1UECA 2KE9A 1CKAA 2CT4A 2KRMA 1UHFA 2FO0A 1AD5A 3VS4A 2ROLA 1B07A 1TG0A 2CUDA 2V1RA 1LCKA 4RTVA 1GCQA 3EG2A 4IIOA 2EYYA 4AFQC 1NYFA 1KFZA 2V1QA 2RF0A 1HJDA 1E6GA 1OOTA 4KRTA 1GRIA 1VYTA 4GBQA 2GTOA 1AWXA 2IIMA 4X1VA 4D8DA 2EYZA 1QKXA 1ABOA 4J9CA 2JS2A 3M0TA 2RQTA 2X3XD 2K2MA 2FPEA 2C0TA 4AFUC 2DRMA 2YUOA 2KXDA 1NYGA 1PNJA 3PVLA 4JJBA 4J9HA 4Y92A 3UA6A 1SRLA 4RUGA 2E5KA 2A36A 4LN2A 2PTKA 1FMKA 2D1XA 1NG2A 2F2WA 3RBBB 1Z9ZA 2GQIA 2CH4A 2EQIA 1T3LA 4RTWA 5IXFA 5EC7A 2O88A 3TVTA 2OI3A 2LX7A 2P4RA 3R6NA 1UJYA 2AKLA 4RTYA 5FWBA 4CC7A 1WYXA 1YCSB 3H0FA 2L0AA 1ZSGA 2ROTA 2YT6A 2L2PA 3JV3A 5FW9A 1UFFA 4IIMA 1H3HA 3REAB 2G6FX 3M0PA 1UUEA 1V1CA 1T3SA 2VKNA 3VRYA 2AZVA 1WFWA 2DL5A 1ZLMA 4Z89A 1HSQA 2EYWA 2LNHB 1KJWA 4ORZA 1M27C 2AK5A 1E6HA 1CSKA 2O9VA 1GCPA 2KR3A 1H8KA 1Z9QA 2AKKA 2EGAA 4WCIA 2JT4A 4HCKA 1AVZC 2DMOA 2FRWA 1FYNA 1WA7A 4RTXA 3U23A 3M0UA 2O31A 4QT7A 4RTTA 1M3BA 5IH2A 4AFZC 2RN8A 2JMCA 1M8MA 2A28A 3M0RA 2DRKA 2FRYA 2DX1A 1QKWA 2K7AA 2KNBB 3PE0A 2GNCA 3M0QA 1X43A 2ED1A 5I22A 2YSQA 1AWOA 4HXJA 2LJ3A 2DL8A 1YN8A 2J6FA 4JPBW 2YUQA 2EW3A 2OJ2A 2DJQA 1UGVA 2JM8A 1X6BA 1U06A 1VYVA 1XOVA 1QWFA 2YDLA 1UHCA 1UDLA 1GL5A 2ENMA 1SRMA 2RQRA 5FWCA 3VS7A 2BZXA 5HCKA 1M3AA 2DNUA 2EKHA 5IXBA 1T0HA 3IQLA 2RPNA 2D0NA 4F17A 2EBPA 2KEAA 1E7OA 1AEYA 2K3BA 3M0SA 4LUEA 1JXOA 1W1FA 1OEBA 1PHTA 3QWXX 4ZNXA 4F16A 1I07A 1WXUA 3RNJA 1BU1A 1HD3A 1RLQC 3C0CA 4AFSC 1GBQA 2C0OA 2KT8A 2BTTA 5I11A
chains in the Genus database with same CATH superfamily
1QCFA 5IHIA 1IO6A 2JW4A 4M78G 2RQVA 1KG1A 4FYWB 4PJMA 1AZGB 1ZX6A 2G3RA 4PJLA 4M4ZA 1G3WA 2DE0X 4C5EA 3M5AA 1VQMA 1YHQQ 4D6WA 4M78A 4AG1C 5D6YA 1Q7YU 3AHUA 2A0FB 3DB4A 1EFNA 5GAOp 4OMLA 1VQKQ 3E1SA 4P5NA 5GANd 3CCET 3EG0A 2GGRA 1WXBA 3A8GB 4E7LA 1WX6A 3A8HB 3SEMA 1ZUKA 4OMPA 1H641 2K4YA 2DTIA 1S72A 2QTXA 5KYNA 4C92D 4M7AB 5HK0A 1M90U 3RESA 3OYMA 1YJWA 1VQ4T 1X6OA 1M3CA 4QQDA 1JJ2P 1OX9A 4FM4B 3I9QA 5KE2A 3WVEB 4A4FA 4M7DE 5KYYA 3JB9G 4KGVB 3DB3A 3HFNA 3QO3A 4ZTJA 2OTLA 2K6DA 1M30A 4OF1A 2LT1A 3V7RA 2QDLA 3BDLA 2MYSA 1J3TA 1Q81R 2L3SA 2D6FA 4JJNK 4LNPA 4M75B 3GBQA 3VS5A 2L3QA 4WF2A 4HVWA 5LL6S 3BE3A 4ESRA 4DA4A 4KULA 1MUZA 1NJIR 2GTJA 1YI2A 2KSSA 3OYJA 2I0NA 2V8KA 2DILA 2HCKA 3CCUQ 2O4XB 8AT1B 3J7AF 2CT3A 1K73U 1IZ6A 2DO3A 2V8JA 4OMFB 3RERA 2JM9A 2IVWA 4PFZA 2CSIA 2C0IA 4J7FA 1OU9A 2QASA 3I5RA 1YIJT 3LYIA 1NLPC 3EFSA 3INZA 3CCSQ 1KSWA 1N9RA 3SD4A 2E3HA 2KRSA 2D8JA 2DERA 2Z0WA 3THKA 2QQAA 2KT1A 4Z02A 1VA7A 2L3RA 4J9BA 3MEWA 3RKYA 2SRCA 2HQHA 2ED0A 3EGXB 3G4ST 2J7IA 4D8KA 4PL6A 4OMQA 1AWWA 1U3OA 4J9GA 4JRIA 1T0JA 2XICA 2LMJA 4Y28E 4BDZA 2QGFB 1BCOA 3HKSA 2QA4T 3OYNA 1PC0A 1Q86C 3M57A 2HZYA 1JQQA 1TS9A 3HRTA 4HVUA 1YNZA 4M7AD 2HDAA 1VQMQ 4MZTA 4ZN1A 2FG0A 2M1HA 2M02A 2ZPHB 3M9QA 1D3BB 1GCQC 1JRIA 2LP5A 3CCJT 3CCEA 1K8AR 2DVJA 1M1FA 2B86A 4ELYC 2ECZA 4J5YA 3PVQA 2I2LA 4BY6C 4FW2A 3L2VA 2RA2A 4CC4B 1ARKA 4OGCA 3RUXA 2LCSA 4C92F 3EG9B 1VQ4A 1MMDA 1S72Q 4M75D 1BI0A 3NFCA 3GIBA 5CK9A 3J81E 1PRMC 1SPKA 1YJWQ 3X26B 1G2BA 1W6XA 2NUTB 4C0GA 2XD0A 2BIVA 3DKMA 4EIKA 4ZGJB 3ZL7C 2MMPA 1AWJA 3HPWA 2OTLQ 4M7DF 4XTWA 1WI7A 3VS2A 4J6XA 5IT9E 2K5FA 4C8QG 4N4GA 1JO8A 4E7ZA 3QYHB 1R0CB 2DZCA 1WNLA 2EVRA 3VRZA 5CO7A 1YJ9T 2DJZA 1D0ZA 1WQWA 1YI2Q 2VGMA 5KE3A 1I8FA 2GBQA 2L89A 2VV5A 4C0DC 4C8QA 1X27A 2EGEA 3S3NA 3A5ZB 2Y90A 5FLXE 3H41A 3EH1A 1PSFA 1QCNA 1YIJA 3QJYA 3H0IA 4RMOA 1W2BP 2RQWA 1X01A 3L2QA 3A8OB 3N5BB 2PUOB 2DD5A 2K3XA 5D7UA 2JTFA 5M9OA 2YXYA 1TG0A 2JZ2A 1KHCA 4RTVA 4OVAA 2E6ZA 3L42A 2CP3A 1M1KR 1RAHB 5LJ3f 2RF0A 3JB9I 4M77E 3CXCS 3JCMe 2E65A 1AWXA 3S3OA 1XJWB 2EYZA 2QA4A 4J9CA 3HHTB 3G7ZA 3C95A 5IAYA 1I5OB 3CPWP 4MDXA 4QVCA 1NPRA 1NBEB 2FVUA 3OB9A 4EMHA 2DRMA 3KBGA 2LTOA 2KXDA 4PJOE 3CCJA 1NYGA 3OW2A 2XI9A 4RCBA 2K57A 2PVGB 4NS5A 1QVPA 3P8HA 1Y96A 4RUGA 1N8RR 3L2RA 4L5GA 1WHKA 4LN2A 3VYGA 3CCEQ 2D1XA 1F1BB 1NG2A 2F2WA 5D6XA 3JCMJ 3CCVT 3RMQA 1QVFS 2EQIA 2RJEA 1T3LA 4RTWA 3L2UA 3EFRA 2OI3A 2LX7A 3FC3A 1UJYA 2R57A 2LQKA 1VQ4Q 3QYGB 4OB1B 3PFSA 5HK3A 4MMKA 1UFFA 2HMAA 3JCMP 3M0PA 3SB2A 1T3SA 4N0AC 4J8OA 2ZPBB 4LDVA 5GAOl 1ZLMA 1WHJA 4M77A 1Q7YC 2A7YA 2RHYA 2RJCA 4LXCA 1YJ9A 1E6HA 2O9VA 3OA6A 1SF9A 2HKQB 4WCIA 3TEEA 2JT4A 4HCKA 4A54A 5GANh 3NTKA 3GOXA 2RHZA 1FYNA 1WA7A 4RTXA 3RR6A 2XG8D 3M4YA 1M2VA 6AT1B 1ACMB 1M3BA 3VV0A 1YITT 4AFZC 2KQWA 5KYUB 2JMCA 1UGSB 5GAN6 4F7UB 2X4YA 1WQ7A 2HL3A 2QK0A 2DX1A 1YIJQ 4L6V5 3ER0A 1VQNA 4FU6A 1X43A 5I22A 2DL8A 1YN8A 2J6FA 4MZPA 3CD6A 2EW3A 2JM8A 2AT1B 1U06A 1XOVA 1PG5B 2YDLA 4BUGA 1D1BA 1ZHIA 2V8IA 3G4SQ 2XIDA 2F5KA 1RAGB 1UB4A 5CQXA 1WJQA 5FWCA 1RABB 2CGHA 2BZXA 4KH0B 2ZPEB 5GAOr 2E64A 1M3AA 2DNUA 4RKUE 4KBMB 4IUTA 5HCKA 1RACB 3OS0A 2EKHA 4BY6B 3TREA 2RPNA 2D0NA 2EBPA 3JCMV 4OB3B 2KEAA 3OY9A 2HNIA 1K73C 3GNFB 2QA4Q 2ZPIB 3L2ZA 3Q1JA 5LJ3g 3QWXX 2LRQA 4V2SA 1VQLT 3OS2A 1BU1A 4C5GA 1DJ7B 1K9MU 1R77A 4JLIA 5GAOq 1GBQA 3E9FA 2BTTA 5I11A 1SHFA 5DM7R 3QSUA 3CCJQ 4UC4A 2CZ7B 1OZ3A 4PJOF 3P8DA 2V26A 1SHGA 2LQWA 5GAN2 3CCVA 3OYGA 5CKFA 2HEQA 2GQVA 4A4EA 2QQRA 1KQSP 3UT1A 5I2MA 2RHUA 3FJPA 3SFMA 1YHQA 4LE9A 2GFUA 5C0MA 2YUPA 3MCAB 4E7JA 5GAMe 2PUKB 2JJ9A 2OX7A 5GAOn 1G8XA 1LNXA 1XNIA 2CP7A 1VQKA 4IURA 2E3IA 3EGDB 1VIFA 2IG0A 2KY9A 2J06A 5GMKi 3OYHA 4WTOB 2NWMA 2E12A 1MV3A 3V7CA 2VASA 3CEYA 1Q82R 1Y0MA 4E7HA 1ZSZA 1VQPT 4EPCA 3MKDA 2KGTA 1YJ9Q 2YUNA 2KAFA 5KYXB 2M51A 3QZ9B 4JZ3A 2HSPA 1K4US 2RHXA 1RI0A 2MK5A 3LX7A 1YITA 2MOXA 2FZCB 5KYWB 4HKEA 4RTZA 2HQXA 3CCLT 1OQKA 3EFOB 1KC8U 2HBWA 2JS0A 2FPFA 2J6KA 3D7SB 3LW5E 2LDMA 3PIOA 3L1AA 3QWYA 4JRKA 2X3WD 2KYBA 4QKUA 2KXCA 4DOVA 1TUCA 4TVRA 2JN0A 2RI5A 1VQOT 3PTAA 2VB6A 2QG9B 1JXMA 2DL3A 2HL5C 3HTRA 5GAMj 2ZCFB 3S6WA 4PLIA 1WHHA 2QYZA 1TSFA 3CCSA 3CC2T 1OV3A 2WACA 5GAN4 3LWHA 1VQLA 1QQJA 2NUPA 4HCCA 1WPYA 1C0MA 1O75A 1FMVA 2E1HA 4M78D 3C12A 3BY7A 5GAN8 4C5IA 5A0GA 1BCMA 2CP5A 3SWNA 4KT0E 3CCVQ 1LPLA 5LJ3d 2COWA 2RNAA 5GMKh 3JCMW 5GJVB 5GAN7 5CQYA 2A08A 1H92A 1VYUA 1OI1A 2CS7A 2JVVA 2ZZDA 1WHGA 1ZUUA 3PNWC 1IGUA 2RD1A 1QW1A 4J7IA 2F2XA 2CZ6B 4RCCA 2BZ8A 4C92E 1N6AA 4A63B 2CYZB 2R5AA 4QW2A 2CP6A 5C6SA 1VQPA 3JB9D 2FHDA 4DBHA 3CXCA 2AZSA 3X28B 3NHNA 5A2QE 3DLLA 1OULA 2KK4A 2DXBA 1X6GA 5J26A 3V7SA 1UE9A 4OMOA 3LH0A 4PNOA 2GCXA 3OYBA 3FRNA 5I21A 3CCLA 3URGA 1YITQ 1GFDA 1RAAB 1B3QA 2JXBA 2J05A 1M8VA 4PJNA 2EJ9A 4F04B 1QVGS 2NUZA 3E2UA 3EG1A 4HCZA 3JCMf 4LDXA 3ASKA 1UGRB 2DBKA 4JRPA 3KUFA 2XKOC 2P0QA 7AT1B 3M53A 1QVFA 1I0CA 4AG2C 2DLPA 2KMTA 3BW1A 3A8MB 4ELZC 5DLOA 3QDRB 1RL2A 4DBFA 3O5ZA 3X20B 1V29B 4IUPA 1QMCA 4C5HA 3PGGA 1OU8A 4ZGEB 3JB9J 4C92A 3CC2A 2W0ZA 1TWBA 1Q86R 4M7DG 2HD0A 2KRMA 1AD5A 2XK0A 4IUVA 1VQLQ 1B7TA 2CUDA 2FZKB 5FRNA 4IIOA 4AFQC 1RAFB 4YTLA 3J80E 4CRIA 2V1QA 4M7DA 3GPLA 2BUDA 2RK2A 1GRIA 1VYTA 2GTOA 4D8DA 4M7AE 2PVOB 4ANJA 4L59A 3M0TA 5LJ5e 2RQTA 1HXDA 2K2MA 4J6WA 2MWPA 3G71T 2LX9A 2YWWA 4JLGA 1Y96B 5GAN5 1PD1A 1M2OA 1SRLA 3H6ZA 3QJ6A 3X24B 3MPUB 3H8ZA 2E6NA 1LJOA 1FMKA 4AT1B 3HSBA 2HSEB 1K9MC 4M75E 3RBBB 1Z9ZA 2GQIA 1X75C 4OB2B 2RHIA 4X9DA 2FL7A 3OMCA 4RTYA 1R8OB 1QP2A 1VQPQ 1MMNA 3H0FA 1VQ7T 4HT9A 3OYYA 4OGEA 2YT6A 1QCOA 2L2PA 5FW9A 4C8QD 2QI2A 4Q5WA 3LGLA 3JCMX 3CCLQ 4FT2A 4AMCA 8ATCB 3MP8A 4M7AA 5AYFA 2ZPGB 4N4IA 2LCCA 5FRMA 1H8KA 2E5QA 4LD6A 2XDDA 4M78C 2EGAA 4XTUA 4BB7A 4ZN3A 1LVKA 3QUIA 3CPFA 3M59A 2DMOA 5LJ5j 2RJDA 1VQOQ 2DXUA 4RTTA 4QT7A 1Y07A 1BKBA 3JCMg 2QQSA 4JDSA 4KUIA 2X9HA 1M8MA 1Y7XA 1FWZA 3JRZA 2DRKA 2K7AA 2M0OA 4M75A 2E4HA 2CP2A 3CC2Q 1N9SA 4HXJA 4JPBW 1JJ2S 4NL2A 2OJ2A 1VYVA 1BI2A 3CC7T 1KC8C 3G4SA 1V76A 1UDLA 4B9WA 1BIBA 1GL5A 2ENMA 2RQRA 2LNVA 2O4XA 1IGQA 5GAMf 3VYHB 4ME7A 4FW1A 1G3YA 1T0HA 2P84A 3GP8A 3JCMc 4E47A 1JB0E 1E7OA 3I56T 3LWIA 1AEYA 4LUEA 1JXOA 1W1FA 3CCMT 1PHTA 4BE0A 1I07A 4M7AF 2DAQA 1C1AA 1HD3A 1RLQC 2O01E 4XTXA 3EGXA 2C0OA 2QDYB 3MEVA 2KT8A 3VKIA 3OYEA 1I81A 1YFNA 2QGGA 3P8BB 3QKJA 4XTZA 2JMAA 2L5QA 1ZBJA 2WSCE 3FEOA 1Q7YR 1MHNA 2L8DA 3FJ5A 1TUGB 2CH4W 2ZGWA 2P0PA 1YWPA 1VOMA 4M75F 2DM1A 1VQ7A 4Z88A 2PQWA 1R0BG 3S3MA 4VUBA 2X4XA 1I1JA 1MMAA 3OBWA 2XDPA 2DEUA 4M77G 4OMMA 1I5LA 2DTOA 1D3BA 1GBRA 3QBYA 5GAN3 1SG5A 4QVDA 3OYDA 1BYMA 5LJ3h 3CQTA 3QIIA 3CMAT 2MIOA 1IHWA 2LZ6B 3OW2P 2CP0A 3LH5A 1U1TA 1U1SA 1RI9A 1ZSZB 4PJOG 2DK3A 1AZEA 2WSEE 5CCAA 5KCHA 1YBYA 2ESWA 1HK9A 2HAXA 2NUTA 2OTJT 1PWTA 4NL3A 3C94A 2E70A 4PJOA 4CC2A 5J39A 1M90C 4EMKA 3WVDB 4LDYA 1UG1A 1CKBA 5GJWB 1NM7A 1M9SA 3ME9A 1K73R 2SEMA 3MHXA 1WIEA 1PKTA 3CC7A 1B34A 1Q81U 2DL7A 5CIUA 3JCMd 1WJSA 2OAWA 2DA9A 5CKBA 3V8JA 3NTIA 3OMGA 4XQ3A 1NJIU 3M4GA 3EHRA 3OQ5A 2R5MA 3VS1A 3UDCA 4J9IA 3I56A 1XTDA 4ATOA 2VUBA 4OMNA 4MZMA 3CCMA 2FB7A 4K11A 4E6RA 1KD1R 2LVMA 1SEMA 5GAMg 2AHJB 2QQ9A 4Z8AA 1A0NB 3UA7A 3G71Q 4LUDA 3NPFA 1QVGA 1D0XA 4C8QC 3PT9A 4FYYB 3PIPA 1TXQA 1X2KA 3OSSC 1PSEA 2NLUA 2A37A 1W2BS 1H3ZA 3CBOA 3RKXA 1GXIE 5CKEA 3I55T 4II1A 1X2QA 4JZ4A 2QEXQ 3TU4K 2LJ1A 2GFAA 3H0HA 3JSCA 2M16A 3JCMQ 1YJNT 1M1GA 1JEGA 4MMLA 4MDWA 2RQUA 4M78B 1WJRA 1VQ7Q 1PCXA 1D09B 4J9EA 4KGZB 2O9SA 1D0YA 1WDXA 1JBMA 1JU5C 4XAXB 3I5SA 1AOJA 2CSQA 2PZ1A 2RI2A 1ZQ1A 1O9SA 4F7UE 3CMAA 5HKCA 4RG8A 4GLKA 3CPWS 2DYIA 4RTUA 2EGCA 1K1ZA 2L3PA 1S1NA 1K8AU 1VQ9T 1FXXA 3SHWA 4F14A 4GLMA 3I35A 4IUQA 1X69A 1BI1A 2YHTA 3OSVA 3TSWA 1K76A 2VVKA 5FU6C 5KYYB 3NTHA 1OPLA 4DEXA 2OTJA 3QXEB 2VC8A 2F2VA 3G1JA 2MWOA 2YRDA 1PRLC 1EIFA 4B6MA 1KHIA 2RMOA 5A0LA 1K0SA 2EQUA 1OPKA 1YWOA 3MEUA 4BE1A 4O5VA 2EPDA 1RLPC 1SSHA 4HVVA 1TU0B 3EGUA 5L8RE 1WLPB 1KK7A 2H3JA 1NEBA 2DVEA 5GANe 2RB6A 3GLXA 3E19A 1N5ZA 2DZ9A 2K79A 3VS0A 3M58A 5LJ5f 1IREB 3CC7Q 2H3EB 4C0FA 3RMSA 1P92A 2FPDA 2W10A 1W4SA 5KYUA 4FIBA 3LGFA 3A98A 4R0KA 4DEYA 4M77C 3OYAA 4J9DA 1WXTA 1RADB 1K9AA 5J3BA 3I56Q 4M78E 4PJJA 2MI6A 2CT4A 4ZGDB 3E9GA 3CCMQ 2FO0A 3VS4A 2ROLA 1B07A 3WXMB 1GCQA 3EG2A 3SDZA 4X9CA 1TH7A 4M7DB 3MP6A 1NYFA 1HJDA 5CKHA 1E6GA 3A1PA 2EWNA 2VYTA 4GBQA 2IIMA 3MJXA 3V8LA 1AHJB 5GAMd 1QKXA 4KGXB 1ABOA 2RO0A 3VJPA 2JS2A 3BFMA 1YJNA 4EDUA 1M1KU 2C06A 2C0TA 4BACA 1D1CA 2YUOA 3F70A 1U8RA 2QXFA 5GANj 1G3SA 2AIRB 4J9HA 2MAMA 2ZAEA 3MO8A 1JJ2A 3JAME 5CR2A 1IRXA 2KVQG 4LDWA 2CH4A 4HT8A 3CMAQ 3TQ7P 1VQ9A 5CKDA 4E7SA 4F7UF 1BI3A 3CCQT 2P0KA 3CBMA 1N8RU 5FWBA 4CC7A 2L0AA 4XU3A 5A0DA 1WHMA 2WSFE 3O8VA 5FU7C 3G6ET 2PU9B 1V1CA 2OTJQ 1KQ1A 2VKNA 3EGDA 1VQ8T 2K5IA 3VRYA 2EJFA 2AZVA 2JOYA 2YRVA 4B9XA 4Z89A 1KJWA 1KQSS 1MMGA 4PKCC 1CSKA 2CZ0B 1UGQB 2P4TA 2KR3A 2HBPA 1Z9QA 2YLCA 3JB9H 5KYXA 3QG1A 1VQOA 4C92G 2DPPB 2LT4A 4C8QB 2FRWA 2E41A 4EMGA 1WGSA 2XHCA 3T9NA 3U23A 4BI8B 9ATCB 3M0UA 3ZBDA 5IH2A 3FLGA 4JS4A 5KYWA 2RN8A 4M7DD 2FZGB 2DIGA 2Y4YA 3EH2A 3L2WA 3CXCP 3M0RA 5LJ5g 2FRYA 4FYVB 2DFUA 3EFOA 3PE0A 2BE7D 2FYKA 1EX4A 3M0QA 2DIQA 2YSQA 4OP0A 1OYXA 4A53A 1ZSZC 2DJQA 1UGVA 5CVIA 1QWFA 2EQJA 4XU1A 4M78F 1MNEA 3CBPA 2ZPFB 4PK4A 3VS7A 3M55A 2M9UA 1KQ2A 1Q81C 1D1AA 5FROA 5IXBA 2RH2A 1K9MR 2RJFA 2GF7A 1LOJA 3I55Q 1QVFP 3A8LB 3MP1A 3M0SA 3JCMh 1YJNQ 1NJIC 4ZNXA 3RNJA 4X34A 2JTMA 3C0CA 5FU6B 4AFSC 3HP9A 3CC4T 3OBYA 4XU2A 2ATCB 2DKGA 2Y4XA 1KD1U 4FL6A 4IUUA 1ZA2B 5AT1B 5GMKe 4J6YA 4N0AA 5IN1A 2JNGA 1TTHB 4FT4A 2QEXT 2QTVA 2QAZA 2DL4A 1NPPA 3CMET 3CCQA 2VWFA 3AT1B 3JB9F 1VQ9Q 1IHVA 1BBZA 3BDUA 4C8QE 4O6JA 5L23A 1G83A 4XK8E 2R58A 1UGPB 3G6EA 4A4KA 2B8AA 2LJ0A 2MF2A 1VQ8A 3UPUA 1GFCA 2COYA 4M7AG 3SWNC 1ZUYA 2DXTA 4RG2A 4JRQA 1VQ6T 4M77B 5ECAA 3QDFA 2X35A 3DLMA 1PD0A 1MGQA 3VS6A 1Q95G 2EYXA 3MEAA 1W2BA 4BD3A 2CREA 3OS5A 1KC8R 4XU0A 2JUFA 2F69A 4PJOB 1M2VB 4FYXB 4M75G 4EMKB 1Q82U 1MV0B 1K8AC 4QQGA 2D9TA 2IPOB 2XU8A 3VUZA 1TOVA 3FB9A 3HRUA 1NEGA 3NMZC 2H8HA 4A4GA 3QHSA 4JUVA 3EG3A 1N27A 1YCYA 5GMKj 1B34B 2F5TX 5GAOm 2CZ1B 3X25B 3LLRA 4FSSA 2CUBA 2X51A 2XMFA 3TSZA 3ULRB 2JTEA 3REBB 5IHNA 4A4HA 3CPWA 2KROA 3JCMb 2VGNA 4CC3A 5LJ5d 1Y57A 2M0YA 3H9NA 1ABQA 4XTYA 1RUWA 2YRCA 1SSFA 1VQNT 3C4SA 2EQKA 2HQEA 3RDVA 3CD6T 1VQ5T 2D0QB 3CC4A 3KFVA 3G71A 4BE2A 4R55A 5FU7B 3R6OA 2KYMA 3PMTA 1M4ZA 2NYSA 3CCRT 4HCBA 2EIFA 3OYFA 2COZA 2VXFA 5IHKA 2A3LA 2QEXA 3UATA 4C92C 3CMEA 3PMIA 1OZ2A 4M77D 2MCNA 2K9GA 2RI3A 2X4WA 1NLOC 1IXDA 2BZYA 1BB9A 1QLYA 2O2OA 3CCQQ 2KBTA 2EJGA 1WHLA 5GANf 4E7KA 3NGPA 1KIKA 2FEIA 1IB8A 1FMWA 5KH6A 1M1KC 3G6EQ 4C8QF 3VUBA 1VIEA 2LQNA 1UJ0A 5GAMh 4PJOD 4M7DC 1M90R 1VQ6A 1VQ8Q 3OS1A 1W70A 1UEBA 2DYBA 5HY6A 3HFOA 4J9FA 1OX8A 3QPHA 3VU3C 2K2VA 2CDTA 1YHQT 4PFOA 2DEQA 3UF4A 3EG9A 2DF6A 1RAIB 4XTVA 4JJCA 2PNIA 4HA8A 1VQKT 2CKKA 2ABLA 2D8HA 1N8RC 4JJDA 4CI0C 2K3YA 3FIFA 4KUDK 4BDYA 1QWEA 1UTIA 3FDRA 1YP5A 2J6OA 1PKSA 1K0XA 2KRNA 1TUDA 3M54A 4OB0B 3EAEA 2K5LA 2EFIA 3EHQA 3GF5A 4DOWA 2DBMA 3VS3A 3UWNA 4N4HA 4QVZA 2DD4A 1EZZB 2E10A 3OYCA 1G5VA 2LC4A 3OYKA 2MPXC 1BK2A 1ZA1B 3HRSA 1U5SA 1UECA 4M7AC 2KE9A 1VQ5A 1SKUB 1CKAA 2NUPB 3OYIA 1UHFA 4QQ6A 2VXEA 3GNGA 2V1RA 3CCUT 3CC4Q 4DBQA 2KDSA 3CCRA 1KQSA 2EYYA 1Q86U 2DXCA 2XDBA 3SWNB 1XQHA 4DBRA 4R56A 1KFZA 1OOTA 4KRTA 4X1VA 4DQ2A 3CCST 4JS5A 1MNDA 4M77F 2DETA 2BE9B 4KH1B 4M75C 4NOYA 2QQBA 3CMEQ 2X3XD 2FPEA 3RIRA 4AFUC 4E7IA 1WZOA 3OYLA 1PNJA 4E2FB 4BI3A 3PVLA 4JJBA 4GY5A 4Y92A 3UA6A 2LCLA 2E5KA 2A36A 1I4K1 2PTKA 2KI7A 3ZEHA 5GMKm 1VQ6Q 2OAUA 5GANg 5IXFA 1KD1C 5EC7A 2O88A 3TVTA 1QVGP 5I2SA 2P4RA 4PFPA 3R6NA 2AKLA 4C0ZA 1VQMT 1WYXA 5D6WA 4J83A 1YCSB 1ZBXA 3ZFJA 4LD9K 2RM4A 1ZSGA 4IKFA 2ROTA 4C0DB 5LJ3e 2DTHA 1G3TA 3JV3A 1H3HA 4IIMA 1VUBA 3REAB 2EYQA 2G6FX 5KCOA 1UUEA 2BKDN 4ZTFA 1WFWA 2DL5A 1HSQA 2EYWA 2LNHB 3HL8A 2HKNA 4FSXA 4ORZA 1S72T 3TCJA 1QP3A 5CAIA 1M27C 2AK5A 4LDUA 3V8KA 1GCPA 1RAEB 1YJWT 4BI4A 1FX7A 1NE8A 2AKKA 1AVZC 4F7UG 2O31A 2OTLT 3META 2LQ8A 3KXTA 3RKWA 2A28A 5DLQE 4C92B 1QKWA 4PLLA 3OW2S 2KNBB 2EQMA 5EG2A 4F7UA 1M5Q1 2GNCA 1Q82C 1C6VX 1VQNQ 2ED1A 1AWOA 2LJ3A 3M56A 2YUQA 3CD6Q 1AT1B 1X6BA 3CCUA 1VQ5Q 1YI2T 2RK1A 2F1LA 1UHCA 1HYOA 1BIAA 1SRMA 2YLBA 3CCRQ 4PJOC 4EMKC 1NZ9A 5LJ3j 2EAYA 4FCYA 3IQLA 4F17A 3I55A 1PM3A 2K3BA 1OEBA 4F16A 5DY9A 1WXUA 4Y91A 2X4JA 5LJ5h 1Y71A 2EKOA 3QZ5B 5GMKl 1LCKA 2PVDB
chains in the Genus database with same CATH topology
1SHFA 1QCFA 5IHIA 1IO6A 2JMAA 1SHGA 2LQWA 2JW4A 1ZBJA 2RQVA 2HEQA 1AZGB 1ZX6A 3FJ5A 2DL4A 2DE0X 2CH4W 4M4ZA 2VWFA 1YWPA 4LE9A 1BBZA 2DM1A 2YUPA 4Z88A 5L23A 1G83A 1I1JA 4AG1C 4OMMA 1GBRA 2LJ0A 1EFNA 4OMLA 1GFCA 3EG0A 2GGRA 1WXBA 1WX6A 1ZUYA 3SEMA 2J06A 3CQTA 1ZUKA 4OMPA 2MIOA 5ECAA 2LZ6B 2NWMA 1MV3A 3LH5A 1RI9A 1Y0MA 3VS6A 1AZEA 1M3CA 2EYXA 2KGTA 2YUNA 2ESWA 2CREA 3I9QA 2M51A 4JZ3A 2HSPA 1K4US 1MV0B 1PWTA 2MOXA 2K6DA 1M30A 4CC2A 4RTZA 2QDLA 1UG1A 1NEGA 1CKBA 1J3TA 2L3SA 3NMZC 5GJWB 2HBWA 1NM7A 2H8HA 2JS0A 2FPFA 2J6KA 4LNPA 3GBQA 3VS5A 2L3QA 3EG3A 4HVWA 4ESRA 2SEMA 1WIEA 3QWYA 1PKTA 1MUZA 2KYBA 2X3WD 2KXCA 2GTJA 4FSSA 2CUBA 1TUCA 2DL7A 2I0NA 2XMFA 3TSZA 2OAWA 3ULRB 2JTEA 3REBB 2DA9A 2DILA 2HCKA 5IHNA 2CT3A 2KROA 4CC3A 1JXMA 2JM9A 1Y57A 2DL3A 2M0YA 1ABQA 3EHRA 2CSIA 2C0IA 3I5RA 1RUWA 3VS1A 4J9IA 1NLPC 4OMNA 1KSWA 1OV3A 2KRSA 2D8JA 4K11A 4E6RA 1SEMA 3THKA 2KT1A 1VA7A 4J9BA 3KFVA 2SRCA 4Z8AA 2ED0A 1A0NB 3UA7A 2J7IA 4LUDA 3NPFA 4D8KA 2KYMA 4OMQA 1AWWA 1U3OA 1X2KA 4J9GA 1T0JA 2A37A 2LMJA 5IHKA 3UATA 1X2QA 4JZ4A 2LJ1A 2RNAA 3H0HA 2MCNA 5GJVB 2K9GA 1NLOC 2BZYA 2A08A 1BB9A 1QLYA 1JQQA 2O2OA 1H92A 1VYUA 4HVUA 1YNZA 1JEGA 2HDAA 2KBTA 2RQUA 2FG0A 3NGPA 1ZUUA 4J9EA 1GCQC 1KIKA 2FEIA 2O9SA 2LP5A 1WDXA 1JU5C 3I5SA 2F2XA 1AOJA 2CSQA 2DVJA 2B86A 2LQNA 2PZ1A 1UJ0A 2ECZA 2BZ8A 3PVQA 1W70A 2DYBA 4A63B 4J9FA 4CC4B 1ARKA 2LCSA 2CDTA 2EGCA 1K1ZA 2L3PA 1S1NA 4RTUA 3SHWA 4F14A 3UF4A 4GLMA 3I35A 2DF6A 1X69A 1PRMC 1SPKA 2AZSA 3TSWA 1K76A 2VVKA 1G2BA 3NHNA 1W6XA 4JJCA 2PNIA 1OPLA 4DEXA 1X6GA 2F2VA 1UE9A 4OMOA 2ABLA 2D8HA 1PRLC 4EIKA 4JJDA 3ZL7C 2RMOA 1AWJA 1K0SA 1GFDA 1OPKA 1WI7A 1YWOA 3VS2A 1QWEA 1B3QA 2JXBA 1UTIA 2EPDA 1RLPC 2J05A 1YP5A 1SSHA 2J6OA 4HVVA 1PKSA 1K0XA 2KRNA 3EGUA 2NUZA 1WLPB 1JO8A 1NEBA 3EG1A 2EVRA 3VRZA 1N5ZA 2DBKA 1TUDA 2K79A 3VS0A 1I0CA 4AG2C 2DLPA 3EHQA 2GBQA 2DBMA 1X27A 2EGEA 3VS3A 2FPDA 3O5ZA 2W10A 3H41A 1BK2A 3H0IA 3A98A 4R0KA 2RQWA 4DEYA 4J9DA 1WXTA 2W0ZA 1U5SA 1K9AA 1UECA 2KE9A 1CKAA 2CT4A 2KRMA 1UHFA 2FO0A 1AD5A 3VS4A 2ROLA 1B07A 1TG0A 2CUDA 2V1RA 1LCKA 4RTVA 1GCQA 3EG2A 4IIOA 2EYYA 4AFQC 1NYFA 1KFZA 2V1QA 2RF0A 1HJDA 1E6GA 1OOTA 4KRTA 1GRIA 1VYTA 4GBQA 2GTOA 1AWXA 2IIMA 4X1VA 4D8DA 2EYZA 1QKXA 1ABOA 4J9CA 2JS2A 3M0TA 2RQTA 2X3XD 2K2MA 2FPEA 2C0TA 4AFUC 2DRMA 2YUOA 2KXDA 1NYGA 1PNJA 3PVLA 4JJBA 4J9HA 4Y92A 3UA6A 1SRLA 4RUGA 2E5KA 2A36A 4LN2A 2PTKA 1FMKA 2D1XA 1NG2A 2F2WA 3RBBB 1Z9ZA 2GQIA 2CH4A 2EQIA 1T3LA 4RTWA 5IXFA 5EC7A 2O88A 3TVTA 2OI3A 2LX7A 2P4RA 3R6NA 1UJYA 2AKLA 4RTYA 5FWBA 4CC7A 1WYXA 1YCSB 3H0FA 2L0AA 1ZSGA 2ROTA 2YT6A 2L2PA 3JV3A 5FW9A 1UFFA 4IIMA 1H3HA 3REAB 2G6FX 3M0PA 1UUEA 1V1CA 1T3SA 2VKNA 3VRYA 2AZVA 1WFWA 2DL5A 1ZLMA 4Z89A 1HSQA 2EYWA 2LNHB 1KJWA 4ORZA 1M27C 2AK5A 1E6HA 1CSKA 2O9VA 1GCPA 2KR3A 1H8KA 1Z9QA 2AKKA 2EGAA 4WCIA 2JT4A 4HCKA 1AVZC 2DMOA 2FRWA 1FYNA 1WA7A 4RTXA 3U23A 3M0UA 2O31A 4QT7A 4RTTA 1M3BA 5IH2A 4AFZC 2RN8A 2JMCA 1M8MA 2A28A 3M0RA 2DRKA 2FRYA 2DX1A 1QKWA 2K7AA 2KNBB 3PE0A 2GNCA 3M0QA 1X43A 2ED1A 5I22A 2YSQA 1AWOA 4HXJA 2LJ3A 2DL8A 1YN8A 2J6FA 4JPBW 2YUQA 2EW3A 2OJ2A 2DJQA 1UGVA 2JM8A 1X6BA 1U06A 1VYVA 1XOVA 1QWFA 2YDLA 1UHCA 1UDLA 1GL5A 2ENMA 1SRMA 2RQRA 5FWCA 3VS7A 2BZXA 5HCKA 1M3AA 2DNUA 2EKHA 5IXBA 1T0HA 3IQLA 2RPNA 2D0NA 4F17A 2EBPA 2KEAA 1E7OA 1AEYA 2K3BA 3M0SA 4LUEA 1JXOA 1W1FA 1OEBA 1PHTA 3QWXX 4ZNXA 4F16A 1I07A 1WXUA 3RNJA 1BU1A 1HD3A 1RLQC 3C0CA 4AFSC 1GBQA 2C0OA 2KT8A 2BTTA 5I11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHF A;  1QCF A;  5IHI A;  1IO6 A;  2JMA A;  1SHG A;  2LQW A;  2JW4 A;  1ZBJ A;  2RQV A;  2HEQ A;  1AZG B;  1ZX6 A;  3FJ5 A;  2DL4 A;  2DE0 X;  2CH4 W;  4M4Z A;  2VWF A;  1YWP A;  4LE9 A;  1BBZ A;  2DM1 A;  2YUP A;  4Z88 A;  5L23 A;  1G83 A;  1I1J A;  4AG1 C;  4OMM A;  1GBR A;  2LJ0 A;  1EFN A;  4OML A;  1GFC A;  3EG0 A;  2GGR A;  1WXB A;  1WX6 A;  1ZUY A;  3SEM A;  2J06 A;  3CQT A;  1ZUK A;  4OMP A;  2MIO A;  5ECA A;  2LZ6 B;  2NWM A;  1MV3 A;  3LH5 A;  1RI9 A;  1Y0M A;  3VS6 A;  1AZE A;  1M3C A;  2EYX A;  2KGT A;  2YUN A;  2ESW A;  2CRE A;  3I9Q A;  2M51 A;  4JZ3 A;  2HSP A;  1K4U S;  1MV0 B;  1PWT A;  2MOX A;  2K6D A;  1M30 A;  4CC2 A;  4RTZ A;  2QDL A;  1UG1 A;  1NEG A;  1CKB A;  1J3T A;  2L3S A;  3NMZ C;  5GJW B;  2HBW A;  1NM7 A;  2H8H A;  2JS0 A;  2FPF A;  2J6K A;  4LNP A;  3GBQ A;  3VS5 A;  2L3Q A;  3EG3 A;  4HVW A;  4ESR A;  2SEM A;  1WIE A;  3QWY A;  1PKT A;  1MUZ A;  2KYB A;  2X3W D;  2KXC A;  2GTJ A;  4FSS A;  2CUB A;  1TUC A;  2DL7 A;  2I0N A;  2XMF A;  3TSZ A;  2OAW A;  3ULR B;  2JTE A;  3REB B;  2DA9 A;  2DIL A;  2HCK A;  5IHN A;  2CT3 A;  2KRO A;  4CC3 A;  1JXM A;  2JM9 A;  1Y57 A;  2DL3 A;  2M0Y A;  1ABQ A;  3EHR A;  2CSI A;  2C0I A;  3I5R A;  1RUW A;  3VS1 A;  4J9I A;  1NLP C;  4OMN A;  1KSW A;  1OV3 A;  2KRS A;  2D8J A;  4K11 A;  4E6R A;  1SEM A;  3THK A;  2KT1 A;  1VA7 A;  4J9B A;  3KFV A;  2SRC A;  4Z8A A;  2ED0 A;  1A0N B;  3UA7 A;  2J7I A;  4LUD A;  3NPF A;  4D8K A;  2KYM A;  4OMQ A;  1AWW A;  1U3O A;  1X2K A;  4J9G A;  1T0J A;  2A37 A;  2LMJ A;  5IHK A;  3UAT A;  1X2Q A;  4JZ4 A;  2LJ1 A;  2RNA A;  3H0H A;  2MCN A;  5GJV B;  2K9G A;  1NLO C;  2BZY A;  2A08 A;  1BB9 A;  1QLY A;  1JQQ A;  2O2O A;  1H92 A;  1VYU A;  4HVU A;  1YNZ A;  1JEG A;  2HDA A;  2KBT A;  2RQU A;  2FG0 A;  3NGP A;  1ZUU A;  4J9E A;  1GCQ C;  1KIK A;  2FEI A;  2O9S A;  2LP5 A;  1WDX A;  1JU5 C;  3I5S A;  2F2X A;  1AOJ A;  2CSQ A;  2DVJ A;  2B86 A;  2LQN A;  2PZ1 A;  1UJ0 A;  2ECZ A;  2BZ8 A;  3PVQ A;  1W70 A;  2DYB A;  4A63 B;  4J9F A;  4CC4 B;  1ARK A;  2LCS A;  2CDT A;  2EGC A;  1K1Z A;  2L3P A;  1S1N A;  4RTU A;  3SHW A;  4F14 A;  3UF4 A;  4GLM A;  3I35 A;  2DF6 A;  1X69 A;  1PRM C;  1SPK A;  2AZS A;  3TSW A;  1K76 A;  2VVK A;  1G2B A;  3NHN A;  1W6X A;  4JJC A;  2PNI A;  1OPL A;  4DEX A;  1X6G A;  2F2V A;  1UE9 A;  4OMO A;  2ABL A;  2D8H A;  1PRL C;  4EIK A;  4JJD A;  3ZL7 C;  2RMO A;  1AWJ A;  1K0S A;  1GFD A;  1OPK A;  1WI7 A;  1YWO A;  3VS2 A;  1QWE A;  1B3Q A;  2JXB A;  1UTI A;  2EPD A;  1RLP C;  2J05 A;  1YP5 A;  1SSH A;  2J6O A;  4HVV A;  1PKS A;  1K0X A;  2KRN A;  3EGU A;  2NUZ A;  1WLP B;  1JO8 A;  1NEB A;  3EG1 A;  2EVR A;  3VRZ A;  1N5Z A;  2DBK A;  1TUD A;  2K79 A;  3VS0 A;  1I0C A;  4AG2 C;  2DLP A;  3EHQ A;  2GBQ A;  2DBM A;  1X27 A;  2EGE A;  3VS3 A;  2FPD A;  3O5Z A;  2W10 A;  3H41 A;  1BK2 A;  3H0I A;  3A98 A;  4R0K A;  2RQW A;  4DEY A;  4J9D A;  1WXT A;  2W0Z A;  1U5S A;  1K9A A;  1UEC A;  2KE9 A;  1CKA A;  2CT4 A;  2KRM A;  1UHF A;  2FO0 A;  1AD5 A;  3VS4 A;  2ROL A;  1B07 A;  1TG0 A;  2CUD A;  2V1R A;  1LCK A;  4RTV A;  1GCQ A;  3EG2 A;  4IIO A;  2EYY A;  4AFQ C;  1NYF A;  1KFZ A;  2V1Q A;  2RF0 A;  1HJD A;  1E6G A;  1OOT A;  4KRT A;  1GRI A;  1VYT A;  4GBQ A;  2GTO A;  1AWX A;  2IIM A;  4X1V A;  4D8D A;  2EYZ A;  1QKX A;  1ABO A;  4J9C A;  2JS2 A;  3M0T A;  2RQT A;  2X3X D;  2K2M A;  2FPE A;  2C0T A;  4AFU C;  2DRM A;  2YUO A;  2KXD A;  1NYG A;  1PNJ A;  3PVL A;  4JJB A;  4J9H A;  4Y92 A;  3UA6 A;  1SRL A;  4RUG A;  2E5K A;  2A36 A;  4LN2 A;  2PTK A;  1FMK A;  2D1X A;  1NG2 A;  2F2W A;  3RBB B;  1Z9Z A;  2GQI A;  2CH4 A;  2EQI A;  1T3L A;  4RTW A;  5IXF A;  5EC7 A;  2O88 A;  3TVT A;  2OI3 A;  2LX7 A;  2P4R A;  3R6N A;  1UJY A;  2AKL A;  4RTY A;  5FWB A;  4CC7 A;  1WYX A;  1YCS B;  3H0F A;  2L0A A;  1ZSG A;  2ROT A;  2YT6 A;  2L2P A;  3JV3 A;  5FW9 A;  1UFF A;  4IIM A;  1H3H A;  3REA B;  2G6F X;  3M0P A;  1UUE A;  1V1C A;  1T3S A;  2VKN A;  3VRY A;  2AZV A;  1WFW A;  2DL5 A;  1ZLM A;  4Z89 A;  1HSQ A;  2EYW A;  2LNH B;  1KJW A;  4ORZ A;  1M27 C;  2AK5 A;  1E6H A;  1CSK A;  2O9V A;  1GCP A;  2KR3 A;  1H8K A;  1Z9Q A;  2AKK A;  2EGA A;  4WCI A;  2JT4 A;  4HCK A;  1AVZ C;  2DMO A;  2FRW A;  1FYN A;  1WA7 A;  4RTX A;  3U23 A;  3M0U A;  2O31 A;  4QT7 A;  4RTT A;  1M3B A;  5IH2 A;  4AFZ C;  2RN8 A;  2JMC A;  1M8M A;  2A28 A;  3M0R A;  2DRK A;  2FRY A;  2DX1 A;  1QKW A;  2K7A A;  2KNB B;  3PE0 A;  2GNC A;  3M0Q A;  1X43 A;  2ED1 A;  5I22 A;  2YSQ A;  1AWO A;  4HXJ A;  2LJ3 A;  2DL8 A;  1YN8 A;  2J6F A;  4JPB W;  2YUQ A;  2EW3 A;  2OJ2 A;  2DJQ A;  1UGV A;  2JM8 A;  1X6B A;  1U06 A;  1VYV A;  1XOV A;  1QWF A;  2YDL A;  1UHC A;  1UDL A;  1GL5 A;  2ENM A;  1SRM A;  2RQR A;  5FWC A;  3VS7 A;  2BZX A;  5HCK A;  1M3A A;  2DNU A;  2EKH A;  5IXB A;  1T0H A;  3IQL A;  2RPN A;  2D0N A;  4F17 A;  2EBP A;  2KEA A;  1E7O A;  1AEY A;  2K3B A;  3M0S A;  4LUE A;  1JXO A;  1W1F A;  1OEB A;  1PHT A;  3QWX X;  4ZNX A;  4F16 A;  1I07 A;  1WXU A;  3RNJ A;  1BU1 A;  1HD3 A;  1RLQ C;  3C0C A;  4AFS C;  1GBQ A;  2C0O A;  2KT8 A;  2BTT A;  5I11 A; 
#chains in the Genus database with same CATH topology
 1QCF A;  5IHI A;  1IO6 A;  2JW4 A;  4M78 G;  2RQV A;  1KG1 A;  4FYW B;  4PJM A;  1AZG B;  1ZX6 A;  2G3R A;  4PJL A;  4M4Z A;  1G3W A;  2DE0 X;  4C5E A;  3M5A A;  1VQM A;  1YHQ Q;  4D6W A;  4M78 A;  4AG1 C;  5D6Y A;  1Q7Y U;  3AHU A;  2A0F B;  3DB4 A;  1EFN A;  5GAO p;  4OML A;  1VQK Q;  3E1S A;  4P5N A;  5GAN d;  3CCE T;  3EG0 A;  2GGR A;  1WXB A;  3A8G B;  4E7L A;  1WX6 A;  3A8H B;  3SEM A;  1ZUK A;  4OMP A;  1H64 1;  2K4Y A;  2DTI A;  1S72 A;  2QTX A;  5KYN A;  4C92 D;  4M7A B;  5HK0 A;  1M90 U;  3RES A;  3OYM A;  1YJW A;  1VQ4 T;  1X6O A;  1M3C A;  4QQD A;  1JJ2 P;  1OX9 A;  4FM4 B;  3I9Q A;  5KE2 A;  3WVE B;  4A4F A;  4M7D E;  5KYY A;  3JB9 G;  4KGV B;  3DB3 A;  3HFN A;  3QO3 A;  4ZTJ A;  2OTL A;  2K6D A;  1M30 A;  4OF1 A;  2LT1 A;  3V7R A;  2QDL A;  3BDL A;  2MYS A;  1J3T A;  1Q81 R;  2L3S A;  2D6F A;  4JJN K;  4LNP A;  4M75 B;  3GBQ A;  3VS5 A;  2L3Q A;  4WF2 A;  4HVW A;  5LL6 S;  3BE3 A;  4ESR A;  4DA4 A;  4KUL A;  1MUZ A;  1NJI R;  2GTJ A;  1YI2 A;  2KSS A;  3OYJ A;  2I0N A;  2V8K A;  2DIL A;  2HCK A;  3CCU Q;  2O4X B;  8AT1 B;  3J7A F;  2CT3 A;  1K73 U;  1IZ6 A;  2DO3 A;  2V8J A;  4OMF B;  3RER A;  2JM9 A;  2IVW A;  4PFZ A;  2CSI A;  2C0I A;  4J7F A;  1OU9 A;  2QAS A;  3I5R A;  1YIJ T;  3LYI A;  1NLP C;  3EFS A;  3INZ A;  3CCS Q;  1KSW A;  1N9R A;  3SD4 A;  2E3H A;  2KRS A;  2D8J A;  2DER A;  2Z0W A;  3THK A;  2QQA A;  2KT1 A;  4Z02 A;  1VA7 A;  2L3R A;  4J9B A;  3MEW A;  3RKY A;  2SRC A;  2HQH A;  2ED0 A;  3EGX B;  3G4S T;  2J7I A;  4D8K A;  4PL6 A;  4OMQ A;  1AWW A;  1U3O A;  4J9G A;  4JRI A;  1T0J A;  2XIC A;  2LMJ A;  4Y28 E;  4BDZ A;  2QGF B;  1BCO A;  3HKS A;  2QA4 T;  3OYN A;  1PC0 A;  1Q86 C;  3M57 A;  2HZY A;  1JQQ A;  1TS9 A;  3HRT A;  4HVU A;  1YNZ A;  4M7A D;  2HDA A;  1VQM Q;  4MZT A;  4ZN1 A;  2FG0 A;  2M1H A;  2M02 A;  2ZPH B;  3M9Q A;  1D3B B;  1GCQ C;  1JRI A;  2LP5 A;  3CCJ T;  3CCE A;  1K8A R;  2DVJ A;  1M1F A;  2B86 A;  4ELY C;  2ECZ A;  4J5Y A;  3PVQ A;  2I2L A;  4BY6 C;  4FW2 A;  3L2V A;  2RA2 A;  4CC4 B;  1ARK A;  4OGC A;  3RUX A;  2LCS A;  4C92 F;  3EG9 B;  1VQ4 A;  1MMD A;  1S72 Q;  4M75 D;  1BI0 A;  3NFC A;  3GIB A;  5CK9 A;  3J81 E;  1PRM C;  1SPK A;  1YJW Q;  3X26 B;  1G2B A;  1W6X A;  2NUT B;  4C0G A;  2XD0 A;  2BIV A;  3DKM A;  4EIK A;  4ZGJ B;  3ZL7 C;  2MMP A;  1AWJ A;  3HPW A;  2OTL Q;  4M7D F;  4XTW A;  1WI7 A;  3VS2 A;  4J6X A;  5IT9 E;  2K5F A;  4C8Q G;  4N4G A;  1JO8 A;  4E7Z A;  3QYH B;  1R0C B;  2DZC A;  1WNL A;  2EVR A;  3VRZ A;  5CO7 A;  1YJ9 T;  2DJZ A;  1D0Z A;  1WQW A;  1YI2 Q;  2VGM A;  5KE3 A;  1I8F A;  2GBQ A;  2L89 A;  2VV5 A;  4C0D C;  4C8Q A;  1X27 A;  2EGE A;  3S3N A;  3A5Z B;  2Y90 A;  5FLX E;  3H41 A;  3EH1 A;  1PSF A;  1QCN A;  1YIJ A;  3QJY A;  3H0I A;  4RMO A;  1W2B P;  2RQW A;  1X01 A;  3L2Q A;  3A8O B;  3N5B B;  2PUO B;  2DD5 A;  2K3X A;  5D7U A;  2JTF A;  5M9O A;  2YXY A;  1TG0 A;  2JZ2 A;  1KHC A;  4RTV A;  4OVA A;  2E6Z A;  3L42 A;  2CP3 A;  1M1K R;  1RAH B;  5LJ3 f;  2RF0 A;  3JB9 I;  4M77 E;  3CXC S;  3JCM e;  2E65 A;  1AWX A;  3S3O A;  1XJW B;  2EYZ A;  2QA4 A;  4J9C A;  3HHT B;  3G7Z A;  3C95 A;  5IAY A;  1I5O B;  3CPW P;  4MDX A;  4QVC A;  1NPR A;  1NBE B;  2FVU A;  3OB9 A;  4EMH A;  2DRM A;  3KBG A;  2LTO A;  2KXD A;  4PJO E;  3CCJ A;  1NYG A;  3OW2 A;  2XI9 A;  4RCB A;  2K57 A;  2PVG B;  4NS5 A;  1QVP A;  3P8H A;  1Y96 A;  4RUG A;  1N8R R;  3L2R A;  4L5G A;  1WHK A;  4LN2 A;  3VYG A;  3CCE Q;  2D1X A;  1F1B B;  1NG2 A;  2F2W A;  5D6X A;  3JCM J;  3CCV T;  3RMQ A;  1QVF S;  2EQI A;  2RJE A;  1T3L A;  4RTW A;  3L2U A;  3EFR A;  2OI3 A;  2LX7 A;  3FC3 A;  1UJY A;  2R57 A;  2LQK A;  1VQ4 Q;  3QYG B;  4OB1 B;  3PFS A;  5HK3 A;  4MMK A;  1UFF A;  2HMA A;  3JCM P;  3M0P A;  3SB2 A;  1T3S A;  4N0A C;  4J8O A;  2ZPB B;  4LDV A;  5GAO l;  1ZLM A;  1WHJ A;  4M77 A;  1Q7Y C;  2A7Y A;  2RHY A;  2RJC A;  4LXC A;  1YJ9 A;  1E6H A;  2O9V A;  3OA6 A;  1SF9 A;  2HKQ B;  4WCI A;  3TEE A;  2JT4 A;  4HCK A;  4A54 A;  5GAN h;  3NTK A;  3GOX A;  2RHZ A;  1FYN A;  1WA7 A;  4RTX A;  3RR6 A;  2XG8 D;  3M4Y A;  1M2V A;  6AT1 B;  1ACM B;  1M3B A;  3VV0 A;  1YIT T;  4AFZ C;  2KQW A;  5KYU B;  2JMC A;  1UGS B;  5GAN 6;  4F7U B;  2X4Y A;  1WQ7 A;  2HL3 A;  2QK0 A;  2DX1 A;  1YIJ Q;  4L6V 5;  3ER0 A;  1VQN A;  4FU6 A;  1X43 A;  5I22 A;  2DL8 A;  1YN8 A;  2J6F A;  4MZP A;  3CD6 A;  2EW3 A;  2JM8 A;  2AT1 B;  1U06 A;  1XOV A;  1PG5 B;  2YDL A;  4BUG A;  1D1B A;  1ZHI A;  2V8I A;  3G4S Q;  2XID A;  2F5K A;  1RAG B;  1UB4 A;  5CQX A;  1WJQ A;  5FWC A;  1RAB B;  2CGH A;  2BZX A;  4KH0 B;  2ZPE B;  5GAO r;  2E64 A;  1M3A A;  2DNU A;  4RKU E;  4KBM B;  4IUT A;  5HCK A;  1RAC B;  3OS0 A;  2EKH A;  4BY6 B;  3TRE A;  2RPN A;  2D0N A;  2EBP A;  3JCM V;  4OB3 B;  2KEA A;  3OY9 A;  2HNI A;  1K73 C;  3GNF B;  2QA4 Q;  2ZPI B;  3L2Z A;  3Q1J A;  5LJ3 g;  3QWX X;  2LRQ A;  4V2S A;  1VQL T;  3OS2 A;  1BU1 A;  4C5G A;  1DJ7 B;  1K9M U;  1R77 A;  4JLI A;  5GAO q;  1GBQ A;  3E9F A;  2BTT A;  5I11 A;  1SHF A;  5DM7 R;  3QSU A;  3CCJ Q;  4UC4 A;  2CZ7 B;  1OZ3 A;  4PJO F;  3P8D A;  2V26 A;  1SHG A;  2LQW A;  5GAN 2;  3CCV A;  3OYG A;  5CKF A;  2HEQ A;  2GQV A;  4A4E A;  2QQR A;  1KQS P;  3UT1 A;  5I2M A;  2RHU A;  3FJP A;  3SFM A;  1YHQ A;  4LE9 A;  2GFU A;  5C0M A;  2YUP A;  3MCA B;  4E7J A;  5GAM e;  2PUK B;  2JJ9 A;  2OX7 A;  5GAO n;  1G8X A;  1LNX A;  1XNI A;  2CP7 A;  1VQK A;  4IUR A;  2E3I A;  3EGD B;  1VIF A;  2IG0 A;  2KY9 A;  2J06 A;  5GMK i;  3OYH A;  4WTO B;  2NWM A;  2E12 A;  1MV3 A;  3V7C A;  2VAS A;  3CEY A;  1Q82 R;  1Y0M A;  4E7H A;  1ZSZ A;  1VQP T;  4EPC A;  3MKD A;  2KGT A;  1YJ9 Q;  2YUN A;  2KAF A;  5KYX B;  2M51 A;  3QZ9 B;  4JZ3 A;  2HSP A;  1K4U S;  2RHX A;  1RI0 A;  2MK5 A;  3LX7 A;  1YIT A;  2MOX A;  2FZC B;  5KYW B;  4HKE A;  4RTZ A;  2HQX A;  3CCL T;  1OQK A;  3EFO B;  1KC8 U;  2HBW A;  2JS0 A;  2FPF A;  2J6K A;  3D7S B;  3LW5 E;  2LDM A;  3PIO A;  3L1A A;  3QWY A;  4JRK A;  2X3W D;  2KYB A;  4QKU A;  2KXC A;  4DOV A;  1TUC A;  4TVR A;  2JN0 A;  2RI5 A;  1VQO T;  3PTA A;  2VB6 A;  2QG9 B;  1JXM A;  2DL3 A;  2HL5 C;  3HTR A;  5GAM j;  2ZCF B;  3S6W A;  4PLI A;  1WHH A;  2QYZ A;  1TSF A;  3CCS A;  3CC2 T;  1OV3 A;  2WAC A;  5GAN 4;  3LWH A;  1VQL A;  1QQJ A;  2NUP A;  4HCC A;  1WPY A;  1C0M A;  1O75 A;  1FMV A;  2E1H A;  4M78 D;  3C12 A;  3BY7 A;  5GAN 8;  4C5I A;  5A0G A;  1BCM A;  2CP5 A;  3SWN A;  4KT0 E;  3CCV Q;  1LPL A;  5LJ3 d;  2COW A;  2RNA A;  5GMK h;  3JCM W;  5GJV B;  5GAN 7;  5CQY A;  2A08 A;  1H92 A;  1VYU A;  1OI1 A;  2CS7 A;  2JVV A;  2ZZD A;  1WHG A;  1ZUU A;  3PNW C;  1IGU A;  2RD1 A;  1QW1 A;  4J7I A;  2F2X A;  2CZ6 B;  4RCC A;  2BZ8 A;  4C92 E;  1N6A A;  4A63 B;  2CYZ B;  2R5A A;  4QW2 A;  2CP6 A;  5C6S A;  1VQP A;  3JB9 D;  2FHD A;  4DBH A;  3CXC A;  2AZS A;  3X28 B;  3NHN A;  5A2Q E;  3DLL A;  1OUL A;  2KK4 A;  2DXB A;  1X6G A;  5J26 A;  3V7S A;  1UE9 A;  4OMO A;  3LH0 A;  4PNO A;  2GCX A;  3OYB A;  3FRN A;  5I21 A;  3CCL A;  3URG A;  1YIT Q;  1GFD A;  1RAA B;  1B3Q A;  2JXB A;  2J05 A;  1M8V A;  4PJN A;  2EJ9 A;  4F04 B;  1QVG S;  2NUZ A;  3E2U A;  3EG1 A;  4HCZ A;  3JCM f;  4LDX A;  3ASK A;  1UGR B;  2DBK A;  4JRP A;  3KUF A;  2XKO C;  2P0Q A;  7AT1 B;  3M53 A;  1QVF A;  1I0C A;  4AG2 C;  2DLP A;  2KMT A;  3BW1 A;  3A8M B;  4ELZ C;  5DLO A;  3QDR B;  1RL2 A;  4DBF A;  3O5Z A;  3X20 B;  1V29 B;  4IUP A;  1QMC A;  4C5H A;  3PGG A;  1OU8 A;  4ZGE B;  3JB9 J;  4C92 A;  3CC2 A;  2W0Z A;  1TWB A;  1Q86 R;  4M7D G;  2HD0 A;  2KRM A;  1AD5 A;  2XK0 A;  4IUV A;  1VQL Q;  1B7T A;  2CUD A;  2FZK B;  5FRN A;  4IIO A;  4AFQ C;  1RAF B;  4YTL A;  3J80 E;  4CRI A;  2V1Q A;  4M7D A;  3GPL A;  2BUD A;  2RK2 A;  1GRI A;  1VYT A;  2GTO A;  4D8D A;  4M7A E;  2PVO B;  4ANJ A;  4L59 A;  3M0T A;  5LJ5 e;  2RQT A;  1HXD A;  2K2M A;  4J6W A;  2MWP A;  3G71 T;  2LX9 A;  2YWW A;  4JLG A;  1Y96 B;  5GAN 5;  1PD1 A;  1M2O A;  1SRL A;  3H6Z A;  3QJ6 A;  3X24 B;  3MPU B;  3H8Z A;  2E6N A;  1LJO A;  1FMK A;  4AT1 B;  3HSB A;  2HSE B;  1K9M C;  4M75 E;  3RBB B;  1Z9Z A;  2GQI A;  1X75 C;  4OB2 B;  2RHI A;  4X9D A;  2FL7 A;  3OMC A;  4RTY A;  1R8O B;  1QP2 A;  1VQP Q;  1MMN A;  3H0F A;  1VQ7 T;  4HT9 A;  3OYY A;  4OGE A;  2YT6 A;  1QCO A;  2L2P A;  5FW9 A;  4C8Q D;  2QI2 A;  4Q5W A;  3LGL A;  3JCM X;  3CCL Q;  4FT2 A;  4AMC A;  8ATC B;  3MP8 A;  4M7A A;  5AYF A;  2ZPG B;  4N4I A;  2LCC A;  5FRM A;  1H8K A;  2E5Q A;  4LD6 A;  2XDD A;  4M78 C;  2EGA A;  4XTU A;  4BB7 A;  4ZN3 A;  1LVK A;  3QUI A;  3CPF A;  3M59 A;  2DMO A;  5LJ5 j;  2RJD A;  1VQO Q;  2DXU A;  4RTT A;  4QT7 A;  1Y07 A;  1BKB A;  3JCM g;  2QQS A;  4JDS A;  4KUI A;  2X9H A;  1M8M A;  1Y7X A;  1FWZ A;  3JRZ A;  2DRK A;  2K7A A;  2M0O A;  4M75 A;  2E4H A;  2CP2 A;  3CC2 Q;  1N9S A;  4HXJ A;  4JPB W;  1JJ2 S;  4NL2 A;  2OJ2 A;  1VYV A;  1BI2 A;  3CC7 T;  1KC8 C;  3G4S A;  1V76 A;  1UDL A;  4B9W A;  1BIB A;  1GL5 A;  2ENM A;  2RQR A;  2LNV A;  2O4X A;  1IGQ A;  5GAM f;  3VYH B;  4ME7 A;  4FW1 A;  1G3Y A;  1T0H A;  2P84 A;  3GP8 A;  3JCM c;  4E47 A;  1JB0 E;  1E7O A;  3I56 T;  3LWI A;  1AEY A;  4LUE A;  1JXO A;  1W1F A;  3CCM T;  1PHT A;  4BE0 A;  1I07 A;  4M7A F;  2DAQ A;  1C1A A;  1HD3 A;  1RLQ C;  2O01 E;  4XTX A;  3EGX A;  2C0O A;  2QDY B;  3MEV A;  2KT8 A;  3VKI A;  3OYE A;  1I81 A;  1YFN A;  2QGG A;  3P8B B;  3QKJ A;  4XTZ A;  2JMA A;  2L5Q A;  1ZBJ A;  2WSC E;  3FEO A;  1Q7Y R;  1MHN A;  2L8D A;  3FJ5 A;  1TUG B;  2CH4 W;  2ZGW A;  2P0P A;  1YWP A;  1VOM A;  4M75 F;  2DM1 A;  1VQ7 A;  4Z88 A;  2PQW A;  1R0B G;  3S3M A;  4VUB A;  2X4X A;  1I1J A;  1MMA A;  3OBW A;  2XDP A;  2DEU A;  4M77 G;  4OMM A;  1I5L A;  2DTO A;  1D3B A;  1GBR A;  3QBY A;  5GAN 3;  1SG5 A;  4QVD A;  3OYD A;  1BYM A;  5LJ3 h;  3CQT A;  3QII A;  3CMA T;  2MIO A;  1IHW A;  2LZ6 B;  3OW2 P;  2CP0 A;  3LH5 A;  1U1T A;  1U1S A;  1RI9 A;  1ZSZ B;  4PJO G;  2DK3 A;  1AZE A;  2WSE E;  5CCA A;  5KCH A;  1YBY A;  2ESW A;  1HK9 A;  2HAX A;  2NUT A;  2OTJ T;  1PWT A;  4NL3 A;  3C94 A;  2E70 A;  4PJO A;  4CC2 A;  5J39 A;  1M90 C;  4EMK A;  3WVD B;  4LDY A;  1UG1 A;  1CKB A;  5GJW B;  1NM7 A;  1M9S A;  3ME9 A;  1K73 R;  2SEM A;  3MHX A;  1WIE A;  1PKT A;  3CC7 A;  1B34 A;  1Q81 U;  2DL7 A;  5CIU A;  3JCM d;  1WJS A;  2OAW A;  2DA9 A;  5CKB A;  3V8J A;  3NTI A;  3OMG A;  4XQ3 A;  1NJI U;  3M4G A;  3EHR A;  3OQ5 A;  2R5M A;  3VS1 A;  3UDC A;  4J9I A;  3I56 A;  1XTD A;  4ATO A;  2VUB A;  4OMN A;  4MZM A;  3CCM A;  2FB7 A;  4K11 A;  4E6R A;  1KD1 R;  2LVM A;  1SEM A;  5GAM g;  2AHJ B;  2QQ9 A;  4Z8A A;  1A0N B;  3UA7 A;  3G71 Q;  4LUD A;  3NPF A;  1QVG A;  1D0X A;  4C8Q C;  3PT9 A;  4FYY B;  3PIP A;  1TXQ A;  1X2K A;  3OSS C;  1PSE A;  2NLU A;  2A37 A;  1W2B S;  1H3Z A;  3CBO A;  3RKX A;  1GXI E;  5CKE A;  3I55 T;  4II1 A;  1X2Q A;  4JZ4 A;  2QEX Q;  3TU4 K;  2LJ1 A;  2GFA A;  3H0H A;  3JSC A;  2M16 A;  3JCM Q;  1YJN T;  1M1G A;  1JEG A;  4MML A;  4MDW A;  2RQU A;  4M78 B;  1WJR A;  1VQ7 Q;  1PCX A;  1D09 B;  4J9E A;  4KGZ B;  2O9S A;  1D0Y A;  1WDX A;  1JBM A;  1JU5 C;  4XAX B;  3I5S A;  1AOJ A;  2CSQ A;  2PZ1 A;  2RI2 A;  1ZQ1 A;  1O9S A;  4F7U E;  3CMA A;  5HKC A;  4RG8 A;  4GLK A;  3CPW S;  2DYI A;  4RTU A;  2EGC A;  1K1Z A;  2L3P A;  1S1N A;  1K8A U;  1VQ9 T;  1FXX A;  3SHW A;  4F14 A;  4GLM A;  3I35 A;  4IUQ A;  1X69 A;  1BI1 A;  2YHT A;  3OSV A;  3TSW A;  1K76 A;  2VVK A;  5FU6 C;  5KYY B;  3NTH A;  1OPL A;  4DEX A;  2OTJ A;  3QXE B;  2VC8 A;  2F2V A;  3G1J A;  2MWO A;  2YRD A;  1PRL C;  1EIF A;  4B6M A;  1KHI A;  2RMO A;  5A0L A;  1K0S A;  2EQU A;  1OPK A;  1YWO A;  3MEU A;  4BE1 A;  4O5V A;  2EPD A;  1RLP C;  1SSH A;  4HVV A;  1TU0 B;  3EGU A;  5L8R E;  1WLP B;  1KK7 A;  2H3J A;  1NEB A;  2DVE A;  5GAN e;  2RB6 A;  3GLX A;  3E19 A;  1N5Z A;  2DZ9 A;  2K79 A;  3VS0 A;  3M58 A;  5LJ5 f;  1IRE B;  3CC7 Q;  2H3E B;  4C0F A;  3RMS A;  1P92 A;  2FPD A;  2W10 A;  1W4S A;  5KYU A;  4FIB A;  3LGF A;  3A98 A;  4R0K A;  4DEY A;  4M77 C;  3OYA A;  4J9D A;  1WXT A;  1RAD B;  1K9A A;  5J3B A;  3I56 Q;  4M78 E;  4PJJ A;  2MI6 A;  2CT4 A;  4ZGD B;  3E9G A;  3CCM Q;  2FO0 A;  3VS4 A;  2ROL A;  1B07 A;  3WXM B;  1GCQ A;  3EG2 A;  3SDZ A;  4X9C A;  1TH7 A;  4M7D B;  3MP6 A;  1NYF A;  1HJD A;  5CKH A;  1E6G A;  3A1P A;  2EWN A;  2VYT A;  4GBQ A;  2IIM A;  3MJX A;  3V8L A;  1AHJ B;  5GAM d;  1QKX A;  4KGX B;  1ABO A;  2RO0 A;  3VJP A;  2JS2 A;  3BFM A;  1YJN A;  4EDU A;  1M1K U;  2C06 A;  2C0T A;  4BAC A;  1D1C A;  2YUO A;  3F70 A;  1U8R A;  2QXF A;  5GAN j;  1G3S A;  2AIR B;  4J9H A;  2MAM A;  2ZAE A;  3MO8 A;  1JJ2 A;  3JAM E;  5CR2 A;  1IRX A;  2KVQ G;  4LDW A;  2CH4 A;  4HT8 A;  3CMA Q;  3TQ7 P;  1VQ9 A;  5CKD A;  4E7S A;  4F7U F;  1BI3 A;  3CCQ T;  2P0K A;  3CBM A;  1N8R U;  5FWB A;  4CC7 A;  2L0A A;  4XU3 A;  5A0D A;  1WHM A;  2WSF E;  3O8V A;  5FU7 C;  3G6E T;  2PU9 B;  1V1C A;  2OTJ Q;  1KQ1 A;  2VKN A;  3EGD A;  1VQ8 T;  2K5I A;  3VRY A;  2EJF A;  2AZV A;  2JOY A;  2YRV A;  4B9X A;  4Z89 A;  1KJW A;  1KQS S;  1MMG A;  4PKC C;  1CSK A;  2CZ0 B;  1UGQ B;  2P4T A;  2KR3 A;  2HBP A;  1Z9Q A;  2YLC A;  3JB9 H;  5KYX A;  3QG1 A;  1VQO A;  4C92 G;  2DPP B;  2LT4 A;  4C8Q B;  2FRW A;  2E41 A;  4EMG A;  1WGS A;  2XHC A;  3T9N A;  3U23 A;  4BI8 B;  9ATC B;  3M0U A;  3ZBD A;  5IH2 A;  3FLG A;  4JS4 A;  5KYW A;  2RN8 A;  4M7D D;  2FZG B;  2DIG A;  2Y4Y A;  3EH2 A;  3L2W A;  3CXC P;  3M0R A;  5LJ5 g;  2FRY A;  4FYV B;  2DFU A;  3EFO A;  3PE0 A;  2BE7 D;  2FYK A;  1EX4 A;  3M0Q A;  2DIQ A;  2YSQ A;  4OP0 A;  1OYX A;  4A53 A;  1ZSZ C;  2DJQ A;  1UGV A;  5CVI A;  1QWF A;  2EQJ A;  4XU1 A;  4M78 F;  1MNE A;  3CBP A;  2ZPF B;  4PK4 A;  3VS7 A;  3M55 A;  2M9U A;  1KQ2 A;  1Q81 C;  1D1A A;  5FRO A;  5IXB A;  2RH2 A;  1K9M R;  2RJF A;  2GF7 A;  1LOJ A;  3I55 Q;  1QVF P;  3A8L B;  3MP1 A;  3M0S A;  3JCM h;  1YJN Q;  1NJI C;  4ZNX A;  3RNJ A;  4X34 A;  2JTM A;  3C0C A;  5FU6 B;  4AFS C;  3HP9 A;  3CC4 T;  3OBY A;  4XU2 A;  2ATC B;  2DKG A;  2Y4X A;  1KD1 U;  4FL6 A;  4IUU A;  1ZA2 B;  5AT1 B;  5GMK e;  4J6Y A;  4N0A A;  5IN1 A;  2JNG A;  1TTH B;  4FT4 A;  2QEX T;  2QTV A;  2QAZ A;  2DL4 A;  1NPP A;  3CME T;  3CCQ A;  2VWF A;  3AT1 B;  3JB9 F;  1VQ9 Q;  1IHV A;  1BBZ A;  3BDU A;  4C8Q E;  4O6J A;  5L23 A;  1G83 A;  4XK8 E;  2R58 A;  1UGP B;  3G6E A;  4A4K A;  2B8A A;  2LJ0 A;  2MF2 A;  1VQ8 A;  3UPU A;  1GFC A;  2COY A;  4M7A G;  3SWN C;  1ZUY A;  2DXT A;  4RG2 A;  4JRQ A;  1VQ6 T;  4M77 B;  5ECA A;  3QDF A;  2X35 A;  3DLM A;  1PD0 A;  1MGQ A;  3VS6 A;  1Q95 G;  2EYX A;  3MEA A;  1W2B A;  4BD3 A;  2CRE A;  3OS5 A;  1KC8 R;  4XU0 A;  2JUF A;  2F69 A;  4PJO B;  1M2V B;  4FYX B;  4M75 G;  4EMK B;  1Q82 U;  1MV0 B;  1K8A C;  4QQG A;  2D9T A;  2IPO B;  2XU8 A;  3VUZ A;  1TOV A;  3FB9 A;  3HRU A;  1NEG A;  3NMZ C;  2H8H A;  4A4G A;  3QHS A;  4JUV A;  3EG3 A;  1N27 A;  1YCY A;  5GMK j;  1B34 B;  2F5T X;  5GAO m;  2CZ1 B;  3X25 B;  3LLR A;  4FSS A;  2CUB A;  2X51 A;  2XMF A;  3TSZ A;  3ULR B;  2JTE A;  3REB B;  5IHN A;  4A4H A;  3CPW A;  2KRO A;  3JCM b;  2VGN A;  4CC3 A;  5LJ5 d;  1Y57 A;  2M0Y A;  3H9N A;  1ABQ A;  4XTY A;  1RUW A;  2YRC A;  1SSF A;  1VQN T;  3C4S A;  2EQK A;  2HQE A;  3RDV A;  3CD6 T;  1VQ5 T;  2D0Q B;  3CC4 A;  3KFV A;  3G71 A;  4BE2 A;  4R55 A;  5FU7 B;  3R6O A;  2KYM A;  3PMT A;  1M4Z A;  2NYS A;  3CCR T;  4HCB A;  2EIF A;  3OYF A;  2COZ A;  2VXF A;  5IHK A;  2A3L A;  2QEX A;  3UAT A;  4C92 C;  3CME A;  3PMI A;  1OZ2 A;  4M77 D;  2MCN A;  2K9G A;  2RI3 A;  2X4W A;  1NLO C;  1IXD A;  2BZY A;  1BB9 A;  1QLY A;  2O2O A;  3CCQ Q;  2KBT A;  2EJG A;  1WHL A;  5GAN f;  4E7K A;  3NGP A;  1KIK A;  2FEI A;  1IB8 A;  1FMW A;  5KH6 A;  1M1K C;  3G6E Q;  4C8Q F;  3VUB A;  1VIE A;  2LQN A;  1UJ0 A;  5GAM h;  4PJO D;  4M7D C;  1M90 R;  1VQ6 A;  1VQ8 Q;  3OS1 A;  1W70 A;  1UEB A;  2DYB A;  5HY6 A;  3HFO A;  4J9F A;  1OX8 A;  3QPH A;  3VU3 C;  2K2V A;  2CDT A;  1YHQ T;  4PFO A;  2DEQ A;  3UF4 A;  3EG9 A;  2DF6 A;  1RAI B;  4XTV A;  4JJC A;  2PNI A;  4HA8 A;  1VQK T;  2CKK A;  2ABL A;  2D8H A;  1N8R C;  4JJD A;  4CI0 C;  2K3Y A;  3FIF A;  4KUD K;  4BDY A;  1QWE A;  1UTI A;  3FDR A;  1YP5 A;  2J6O A;  1PKS A;  1K0X A;  2KRN A;  1TUD A;  3M54 A;  4OB0 B;  3EAE A;  2K5L A;  2EFI A;  3EHQ A;  3GF5 A;  4DOW A;  2DBM A;  3VS3 A;  3UWN A;  4N4H A;  4QVZ A;  2DD4 A;  1EZZ B;  2E10 A;  3OYC A;  1G5V A;  2LC4 A;  3OYK A;  2MPX C;  1BK2 A;  1ZA1 B;  3HRS A;  1U5S A;  1UEC A;  4M7A C;  2KE9 A;  1VQ5 A;  1SKU B;  1CKA A;  2NUP B;  3OYI A;  1UHF A;  4QQ6 A;  2VXE A;  3GNG A;  2V1R A;  3CCU T;  3CC4 Q;  4DBQ A;  2KDS A;  3CCR A;  1KQS A;  2EYY A;  1Q86 U;  2DXC A;  2XDB A;  3SWN B;  1XQH A;  4DBR A;  4R56 A;  1KFZ A;  1OOT A;  4KRT A;  4X1V A;  4DQ2 A;  3CCS T;  4JS5 A;  1MND A;  4M77 F;  2DET A;  2BE9 B;  4KH1 B;  4M75 C;  4NOY A;  2QQB A;  3CME Q;  2X3X D;  2FPE A;  3RIR A;  4AFU C;  4E7I A;  1WZO A;  3OYL A;  1PNJ A;  4E2F B;  4BI3 A;  3PVL A;  4JJB A;  4GY5 A;  4Y92 A;  3UA6 A;  2LCL A;  2E5K A;  2A36 A;  1I4K 1;  2PTK A;  2KI7 A;  3ZEH A;  5GMK m;  1VQ6 Q;  2OAU A;  5GAN g;  5IXF A;  1KD1 C;  5EC7 A;  2O88 A;  3TVT A;  1QVG P;  5I2S A;  2P4R A;  4PFP A;  3R6N A;  2AKL A;  4C0Z A;  1VQM T;  1WYX A;  5D6W A;  4J83 A;  1YCS B;  1ZBX A;  3ZFJ A;  4LD9 K;  2RM4 A;  1ZSG A;  4IKF A;  2ROT A;  4C0D B;  5LJ3 e;  2DTH A;  1G3T A;  3JV3 A;  1H3H A;  4IIM A;  1VUB A;  3REA B;  2EYQ A;  2G6F X;  5KCO A;  1UUE A;  2BKD N;  4ZTF A;  1WFW A;  2DL5 A;  1HSQ A;  2EYW A;  2LNH B;  3HL8 A;  2HKN A;  4FSX A;  4ORZ A;  1S72 T;  3TCJ A;  1QP3 A;  5CAI A;  1M27 C;  2AK5 A;  4LDU A;  3V8K A;  1GCP A;  1RAE B;  1YJW T;  4BI4 A;  1FX7 A;  1NE8 A;  2AKK A;  1AVZ C;  4F7U G;  2O31 A;  2OTL T;  3MET A;  2LQ8 A;  3KXT A;  3RKW A;  2A28 A;  5DLQ E;  4C92 B;  1QKW A;  4PLL A;  3OW2 S;  2KNB B;  2EQM A;  5EG2 A;  4F7U A;  1M5Q 1;  2GNC A;  1Q82 C;  1C6V X;  1VQN Q;  2ED1 A;  1AWO A;  2LJ3 A;  3M56 A;  2YUQ A;  3CD6 Q;  1AT1 B;  1X6B A;  3CCU A;  1VQ5 Q;  1YI2 T;  2RK1 A;  2F1L A;  1UHC A;  1HYO A;  1BIA A;  1SRM A;  2YLB A;  3CCR Q;  4PJO C;  4EMK C;  1NZ9 A;  5LJ3 j;  2EAY A;  4FCY A;  3IQL A;  4F17 A;  3I55 A;  1PM3 A;  2K3B A;  1OEB A;  4F16 A;  5DY9 A;  1WXU A;  4Y91 A;  2X4J A;  5LJ5 h;  1Y71 A;  2EKO A;  3QZ5 B;  5GMK l;  1LCK A;  2PVD B; 
#chains in the Genus database with same CATH homology
 1SHF A;  1QCF A;  5IHI A;  1IO6 A;  2JMA A;  1SHG A;  2LQW A;  2JW4 A;  1ZBJ A;  2RQV A;  2HEQ A;  1AZG B;  1ZX6 A;  3FJ5 A;  2DL4 A;  2DE0 X;  2CH4 W;  4M4Z A;  2VWF A;  1YWP A;  4LE9 A;  1BBZ A;  2DM1 A;  2YUP A;  4Z88 A;  5L23 A;  1G83 A;  1I1J A;  4AG1 C;  4OMM A;  1GBR A;  2LJ0 A;  1EFN A;  4OML A;  1GFC A;  3EG0 A;  2GGR A;  1WXB A;  1WX6 A;  1ZUY A;  3SEM A;  2J06 A;  3CQT A;  1ZUK A;  4OMP A;  2MIO A;  5ECA A;  2LZ6 B;  2NWM A;  1MV3 A;  3LH5 A;  1RI9 A;  1Y0M A;  3VS6 A;  1AZE A;  1M3C A;  2EYX A;  2KGT A;  2YUN A;  2ESW A;  2CRE A;  3I9Q A;  2M51 A;  4JZ3 A;  2HSP A;  1K4U S;  1MV0 B;  1PWT A;  2MOX A;  2K6D A;  1M30 A;  4CC2 A;  4RTZ A;  2QDL A;  1UG1 A;  1NEG A;  1CKB A;  1J3T A;  2L3S A;  3NMZ C;  5GJW B;  2HBW A;  1NM7 A;  2H8H A;  2JS0 A;  2FPF A;  2J6K A;  4LNP A;  3GBQ A;  3VS5 A;  2L3Q A;  3EG3 A;  4HVW A;  4ESR A;  2SEM A;  1WIE A;  3QWY A;  1PKT A;  1MUZ A;  2KYB A;  2X3W D;  2KXC A;  2GTJ A;  4FSS A;  2CUB A;  1TUC A;  2DL7 A;  2I0N A;  2XMF A;  3TSZ A;  2OAW A;  3ULR B;  2JTE A;  3REB B;  2DA9 A;  2DIL A;  2HCK A;  5IHN A;  2CT3 A;  2KRO A;  4CC3 A;  1JXM A;  2JM9 A;  1Y57 A;  2DL3 A;  2M0Y A;  1ABQ A;  3EHR A;  2CSI A;  2C0I A;  3I5R A;  1RUW A;  3VS1 A;  4J9I A;  1NLP C;  4OMN A;  1KSW A;  1OV3 A;  2KRS A;  2D8J A;  4K11 A;  4E6R A;  1SEM A;  3THK A;  2KT1 A;  1VA7 A;  4J9B A;  3KFV A;  2SRC A;  4Z8A A;  2ED0 A;  1A0N B;  3UA7 A;  2J7I A;  4LUD A;  3NPF A;  4D8K A;  2KYM A;  4OMQ A;  1AWW A;  1U3O A;  1X2K A;  4J9G A;  1T0J A;  2A37 A;  2LMJ A;  5IHK A;  3UAT A;  1X2Q A;  4JZ4 A;  2LJ1 A;  2RNA A;  3H0H A;  2MCN A;  5GJV B;  2K9G A;  1NLO C;  2BZY A;  2A08 A;  1BB9 A;  1QLY A;  1JQQ A;  2O2O A;  1H92 A;  1VYU A;  4HVU A;  1YNZ A;  1JEG A;  2HDA A;  2KBT A;  2RQU A;  2FG0 A;  3NGP A;  1ZUU A;  4J9E A;  1GCQ C;  1KIK A;  2FEI A;  2O9S A;  2LP5 A;  1WDX A;  1JU5 C;  3I5S A;  2F2X A;  1AOJ A;  2CSQ A;  2DVJ A;  2B86 A;  2LQN A;  2PZ1 A;  1UJ0 A;  2ECZ A;  2BZ8 A;  3PVQ A;  1W70 A;  2DYB A;  4A63 B;  4J9F A;  4CC4 B;  1ARK A;  2LCS A;  2CDT A;  2EGC A;  1K1Z A;  2L3P A;  1S1N A;  4RTU A;  3SHW A;  4F14 A;  3UF4 A;  4GLM A;  3I35 A;  2DF6 A;  1X69 A;  1PRM C;  1SPK A;  2AZS A;  3TSW A;  1K76 A;  2VVK A;  1G2B A;  3NHN A;  1W6X A;  4JJC A;  2PNI A;  1OPL A;  4DEX A;  1X6G A;  2F2V A;  1UE9 A;  4OMO A;  2ABL A;  2D8H A;  1PRL C;  4EIK A;  4JJD A;  3ZL7 C;  2RMO A;  1AWJ A;  1K0S A;  1GFD A;  1OPK A;  1WI7 A;  1YWO A;  3VS2 A;  1QWE A;  1B3Q A;  2JXB A;  1UTI A;  2EPD A;  1RLP C;  2J05 A;  1YP5 A;  1SSH A;  2J6O A;  4HVV A;  1PKS A;  1K0X A;  2KRN A;  3EGU A;  2NUZ A;  1WLP B;  1JO8 A;  1NEB A;  3EG1 A;  2EVR A;  3VRZ A;  1N5Z A;  2DBK A;  1TUD A;  2K79 A;  3VS0 A;  1I0C A;  4AG2 C;  2DLP A;  3EHQ A;  2GBQ A;  2DBM A;  1X27 A;  2EGE A;  3VS3 A;  2FPD A;  3O5Z A;  2W10 A;  3H41 A;  1BK2 A;  3H0I A;  3A98 A;  4R0K A;  2RQW A;  4DEY A;  4J9D A;  1WXT A;  2W0Z A;  1U5S A;  1K9A A;  1UEC A;  2KE9 A;  1CKA A;  2CT4 A;  2KRM A;  1UHF A;  2FO0 A;  1AD5 A;  3VS4 A;  2ROL A;  1B07 A;  1TG0 A;  2CUD A;  2V1R A;  1LCK A;  4RTV A;  1GCQ A;  3EG2 A;  4IIO A;  2EYY A;  4AFQ C;  1NYF A;  1KFZ A;  2V1Q A;  2RF0 A;  1HJD A;  1E6G A;  1OOT A;  4KRT A;  1GRI A;  1VYT A;  4GBQ A;  2GTO A;  1AWX A;  2IIM A;  4X1V A;  4D8D A;  2EYZ A;  1QKX A;  1ABO A;  4J9C A;  2JS2 A;  3M0T A;  2RQT A;  2X3X D;  2K2M A;  2FPE A;  2C0T A;  4AFU C;  2DRM A;  2YUO A;  2KXD A;  1NYG A;  1PNJ A;  3PVL A;  4JJB A;  4J9H A;  4Y92 A;  3UA6 A;  1SRL A;  4RUG A;  2E5K A;  2A36 A;  4LN2 A;  2PTK A;  1FMK A;  2D1X A;  1NG2 A;  2F2W A;  3RBB B;  1Z9Z A;  2GQI A;  2CH4 A;  2EQI A;  1T3L A;  4RTW A;  5IXF A;  5EC7 A;  2O88 A;  3TVT A;  2OI3 A;  2LX7 A;  2P4R A;  3R6N A;  1UJY A;  2AKL A;  4RTY A;  5FWB A;  4CC7 A;  1WYX A;  1YCS B;  3H0F A;  2L0A A;  1ZSG A;  2ROT A;  2YT6 A;  2L2P A;  3JV3 A;  5FW9 A;  1UFF A;  4IIM A;  1H3H A;  3REA B;  2G6F X;  3M0P A;  1UUE A;  1V1C A;  1T3S A;  2VKN A;  3VRY A;  2AZV A;  1WFW A;  2DL5 A;  1ZLM A;  4Z89 A;  1HSQ A;  2EYW A;  2LNH B;  1KJW A;  4ORZ A;  1M27 C;  2AK5 A;  1E6H A;  1CSK A;  2O9V A;  1GCP A;  2KR3 A;  1H8K A;  1Z9Q A;  2AKK A;  2EGA A;  4WCI A;  2JT4 A;  4HCK A;  1AVZ C;  2DMO A;  2FRW A;  1FYN A;  1WA7 A;  4RTX A;  3U23 A;  3M0U A;  2O31 A;  4QT7 A;  4RTT A;  1M3B A;  5IH2 A;  4AFZ C;  2RN8 A;  2JMC A;  1M8M A;  2A28 A;  3M0R A;  2DRK A;  2FRY A;  2DX1 A;  1QKW A;  2K7A A;  2KNB B;  3PE0 A;  2GNC A;  3M0Q A;  1X43 A;  2ED1 A;  5I22 A;  2YSQ A;  1AWO A;  4HXJ A;  2LJ3 A;  2DL8 A;  1YN8 A;  2J6F A;  4JPB W;  2YUQ A;  2EW3 A;  2OJ2 A;  2DJQ A;  1UGV A;  2JM8 A;  1X6B A;  1U06 A;  1VYV A;  1XOV A;  1QWF A;  2YDL A;  1UHC A;  1UDL A;  1GL5 A;  2ENM A;  1SRM A;  2RQR A;  5FWC A;  3VS7 A;  2BZX A;  5HCK A;  1M3A A;  2DNU A;  2EKH A;  5IXB A;  1T0H A;  3IQL A;  2RPN A;  2D0N A;  4F17 A;  2EBP A;  2KEA A;  1E7O A;  1AEY A;  2K3B A;  3M0S A;  4LUE A;  1JXO A;  1W1F A;  1OEB A;  1PHT A;  3QWX X;  4ZNX A;  4F16 A;  1I07 A;  1WXU A;  3RNJ A;  1BU1 A;  1HD3 A;  1RLQ C;  3C0C A;  4AFS C;  1GBQ A;  2C0O A;  2KT8 A;  2BTT A;  5I11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...