3M0SA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0sA00
3SEMA 3TVTA 4ZNXA 4OMLA 1AVZC 1WDXA 4LE9A 3EHQA 4CC7A 1ZUKA 2HBWA 4KRTA 1JQQA 2O9VA 1SHFA 2EQIA 4JJCA 4M4ZA 2K9GA 2KYMA 4AFZC 4RTYA 2RQRA 4RTXA 3TSWA 4RTZA 3UA6A 2CT3A 4JJDA 1AEYA 1SSHA 2HEQA 2XMFA 2L0AA 1WXTA 3ZL7C 3H0FA 1CSKA 1AZGB 2KT8A 3VS2A 1X6BA 2LJ1A 2M0YA 4IIMA 4Z89A 1QLYA 2NUZA 1CKAA 2A37A 4J9IA 2DRMA 2RQUA 1FMKA 2H8HA 1YN8A 4RTVA 2KGTA 1YWPA 3THKA 5IHNA 2YUOA 2LX7A 3VS3A 3A98A 3TSZA 1NEBA 2PNIA 1PNJA 1K0SA 2CDTA 2NWMA 4A63B 5L23A 2D8HA 5I22A 2X3XD 3C0CA 1K4US 4OMMA 1UHFA 3EHRA 5GJWB 1QKXA 2EYYA 1PRLC 2RF0A 1M3CA 4RTUA 1UG1A 3M0UA 4FSSA 4HCKA 3EG2A 3FJ5A 1YWOA 1GCPA 1RUWA 1JU5C 3IQLA 2L3QA 2ECZA 2L3PA 2C0IA 5EC7A 2YT6A 4Y92A 1HSQA 1ZSGA 2GBQA 4LN2A 3SHWA 4JPBW 2KRMA 2LJ0A 1VYVA 1ZX6A 2BZ8A 1H92A 1UTIA 2K6DA 4HVUA 2BTTA 2FRWA 1UE9A 2F2XA 1QKWA 1SRMA 2DL3A 1MV0B 2EBPA 2LMJA 4D8DA 3H0HA 1X2QA 1Z9QA 2YSQA 3M0TA 3KFVA 4J9GA 4OMQA 2FO0A 3QWYA 2KEAA 1X6GA 1RLQC 2A28A 3VS4A 4F16A 1ZLMA 2SEMA 2DRKA 4GBQA 2O31A 2LQWA 3PE0A 1AWXA 1IO6A 2EGAA 1WA7A 4J9HA 4IIOA 2DL7A 1WXBA 3EGUA 2RQVA 4JZ3A 2FPFA 5ECAA 1G83A 3VS1A 2CH4A 1WI7A 2DNUA 1UGVA 1A0NB 2LZ6B 3ULRB 1GFCA 2GQIA 3GBQA 1QCFA 5I11A 2C0TA 2RPNA 3NGPA 1OPKA 4J9BA 2O2OA 4AG2C 1AD5A 5IXFA 1NLOC 3M0QA 2BZYA 2CUBA 1X2KA 2DF6A 2EYZA 2FPEA 2M51A 4LNPA 1WIEA 2VVKA 3I5RA 1PKSA 1NYGA 2CREA 1JO8A 1TUDA 2DMOA 4CC3A 4J9DA 3U23A 1H8KA 2O88A 1NM7A 1M8MA 1K76A 5IHKA 1UECA 1BU1A 1VYTA 3LH5A 1BB9A 2IIMA 2VWFA 2EYWA 2GTJA 1VYUA 3NHNA 1YP5A 5IH2A 1ABQA 1CKBA 2PZ1A 2RNAA 2KT1A 2D1XA 2DBMA 2FEIA 2YUNA 1PKTA 1UFFA 2C0OA 3H41A 2J05A 2GNCA 2KXCA 2GGRA 3VS5A 2A08A 2YUQA 2JM9A 1GBRA 1X69A 4CC4B 3UF4A 1GCQC 1FYNA 4ESRA 1RLPC 1U3OA 1Y0MA 2KR3A 4X1VA 2ESWA 2EKHA 2FPDA 1WFWA 5FW9A 2RN8A 4AFUC 1WYXA 2W0ZA 2F2WA 1T3LA 3UATA 1QWFA 1M3BA 1KJWA 1UDLA 2KNBB 3VS7A 1KSWA 1GCQA 1QWEA 2J06A 1HJDA 4RTWA 1N5ZA 2DLPA 2MCNA 1AOJA 4WCIA 3I5SA 2MOXA 2DBKA 2EGCA 2JM8A 1I0CA 1MV3A 1ZBJA 4JJBA 1ARKA 1YNZA 1BBZA 1ZUYA 3M0SA 2D8JA 1TG0A 2KROA 4HVWA 3I9QA 4QT7A 2PTKA 4HXJA 2DL5A 1BK2A 4OMNA 1GBQA 4Z8AA 1HD3A 3R6NA 4LUEA 2A36A 2SRCA 1X27A 1T3SA 2V1QA 2L2PA 2LJ3A 2DL4A 3M0RA 2G6FX 1OV3A 4J9EA 4OMPA 2JS2A 1NLPC 2VKNA 1UJ0A 4E6RA 2AK5A 4RTTA 2X3WD 3O5ZA 2DE0X 2EPDA 1K0XA 2ABLA 3REAB 2LNHB 2HDAA 2W10A 1V1CA 2I0NA 1TUCA 2B86A 4F14A 1U06A 1AZEA 1VA7A 1E6HA 5IXBA 2K3BA 4R0KA 1GFDA 2AZVA 3NMZC 1B3QA 2EYXA 3PVQA 4GLMA 2DM1A 1KIKA 1M30A 3NPFA 5FWBA 2P4RA 2EVRA 1T0JA 3EG0A 3H0IA 1T0HA 4F17A 2EW3A 1OEBA 2LQNA 2JXBA 4DEYA 3VRYA 1NG2A 1YCSB 2AZSA 1Z9ZA 2J7IA 1X43A 2ED1A 2CSIA 2JMAA 3EG3A 1J3TA 3REBB 2KXDA 2ED0A 1AWOA 2AKKA 2EGEA 1G2BA 1GL5A 2JS0A 2RQWA 1H3HA 2J6FA 3M0PA 2ROTA 4J9CA 2CH4W 2JMCA 2JT4A 2F2VA 1UJYA 3RNJA 2QDLA 1UUEA 2YDLA 3I35A 3CQTA 1LCKA 1SHGA 2ENMA 2RMOA 1M27C 1GRIA 2JW4A 2DA9A 1E7OA 2J6OA 1SEMA 4RUGA 2K2MA 2JTEA 2MIOA 4DEXA 3RBBB 4AG1C 1K1ZA 4Z88A 1JXMA 2HSPA 4EIKA 1OPLA 1M3AA 1MUZA 2J6KA 4CC2A 2D0NA 1SPKA 3JV3A 2KRSA 2FRYA 5FWCA 1U5SA 2YUPA 2K79A 5IHIA 1PHTA 2CT4A 2LCSA 1AWJA 1ZUUA 2KBTA 1KFZA 1JXOA 2BZXA 2HCKA 4AFQC 3EG1A 2CSQA 1ABOA 4OMOA 4JZ4A 3QWXX 2ROLA 4AFSC 2DYBA 1W6XA 1AWWA 4K11A 1UHCA 1PRMC 2E5KA 2DX1A 2O9SA 1EFNA 2KE9A 1W1FA 1K9AA 1OOTA 1PWTA 2KYBA 3PVLA 2CUDA 2DJQA 2KRNA 2OI3A 2K7AA 2OJ2A 1SRLA 2FG0A 1S1NA 1Y57A 1XOVA 4LUDA 1I07A 4D8KA 1NYFA 1WXUA 1E6GA 1WLPB 2OAWA 1JEGA 1WX6A 3VRZA 2AKLA 3UA7A 1NEGA 2DVJA 4HVVA 1W70A 3VS6A 4ORZA 1I1JA 2V1RA 2LP5A 4J9FA 2DILA 2DL8A 2GTOA 2L3SA 5GJVB 1B07A 2RQTA 3VS0A 5HCKA 1RI9A
chains in the Genus database with same CATH superfamily
4OMLA 4J5YA 1VQ4Q 5GAMg 3META 2KVQG 3EHQA 2RK1A 4KULA 4CC7A 2L3RA 1Q82R 3EGXA 5FU7B 4RG8A 2CP0A 3M55A 2RQRA 4RTXA 3J80E 3TSWA 1N9SA 4RTZA 3CPWP 1TWBA 1WQ7A 2DZCA 3I56Q 4IUVA 3O8VA 1D1CA 1CSKA 2MWOA 2QTVA 4PK4A 5GAMe 3VS2A 4IIMA 1Q82U 1C6VX 1MMDA 2P0PA 4BE2A 2A37A 4J9IA 2DRMA 4J8OA 4Y91A 2KSSA 3M53A 4ZN3A 5IHNA 4RCBA 4JDSA 2DKGA 4OGCA 3SD4A 3SWNB 2PNIA 4EMGA 3OS2A 1K0SA 2X4XA 4QVZA 2D8HA 4PNOA 5I22A 3GF5A 2ZPEB 4FYVB 1OU8A 1VQOT 2QQRA 5CKDA 1K4US 1NZ9A 3EHRA 1IXDA 4M7AA 2K5LA 5GAMh 5GANd 2EYYA 4ZGEB 2FZCB 3EG2A 4E7KA 3MHXA 1JU5C 3IQLA 3LX7A 2EYQA 3CCUA 3EGXB 1JB0E 2C0IA 2DEQA 3L2RA 3HRUA 4MMLA 1ZSGA 3SHWA 2WSEE 1VYVA 4M77C 4C8QG 4M75A 5LJ5j 1V29B 2CKKA 1UTIA 2K6DA 4XTVA 1B7TA 2BTTA 2FRWA 3G4SA 2LMJA 1MV0B 2EBPA 4DOWA 3OYCA 3RMSA 2EJFA 3V8KA 1YJNQ 3RKWA 3M56A 4J9GA 3FRNA 1C0MA 1X6GA 2A28A 4F16A 4KUDK 3CEYA 2HQHA 5A0GA 2Y4XA 1XQHA 1ZHIA 2BE9B 2DO3A 5DLQE 4EPCA 2F1LA 4PJOG 9ATCB 2DRKA 5LJ5g 3ASKA 2HZYA 2LQWA 2VXEA 2DVEA 2M16A 1WJSA 3HSBA 2PU9B 2NLUA 1YI2A 4M7AB 3L2QA 2VGMA 1AWXA 1IO6A 4Y28E 1OZ3A 4PKCC 4AMCA 4HKEA 1LJOA 3WXMB 1G83A 3CCLA 1LOJA 2DNUA 5I2SA 1IHWA 4FL6A 1VQ8A 2GQIA 1JJ2S 5KYUA 2C0TA 2HQXA 4M75B 1YJ9A 3M57A 3JB9G 1UEBA 1AD5A 4NS5A 2BZYA 3M59A 4RG2A 1M90C 1X2KA 4J7IA 1Q86C 2DF6A 3GP8A 2FPEA 2FHDA 1VQLQ 2XU8A 1WIEA 3HTRA 4PFPA 4GLKA 3I5RA 1D0ZA 1NYGA 5GANg 3PFSA 2D6FA 2CREA 1PG5B 4J9DA 3U23A 1H8KA 5LJ5h 2O88A 3JRZA 1M8MA 1BU1A 3RESA 1N27A 3LH5A 3HPWA 2CP5A 2VWFA 2OTLA 3C12A 1W2BS 3CC2A 1VYUA 3DKMA 4LD9K 5GANe 1QVGS 2PZ1A 4IUTA 4JJNK 1PKTA 1UFFA 2FVUA 3FJPA 3CCVQ 2QA4Q 1RL2A 1V76A 2C0OA 2RO0A 3H41A 3QO3A 2ZPHB 3G7ZA 4A54A 2GFAA 4HA8A 2A08A 3H6ZA 1K8AU 1D0YA 2YUQA 1GBRA 1X69A 1N9RA 3CCET 5FU7C 2XDBA 1EX4A 2KR3A 4X1VA 5HKCA 5GMKm 5IT9E 5KYUB 4OF1A 3JCMd 2FPDA 4PFOA 2RN8A 1WYXA 2DJZA 2W0ZA 4BD3A 3UATA 1M3BA 1KJWA 1UDLA 2KNBB 4OB0B 4XTYA 5GANh 1R0BG 4RTWA 2GF7A 3VYGA 2EWNA 4J7FA 3I5SA 3KBGA 1X01A 2JM8A 5GAOq 1TOVA 4PJJA 1VQMQ 1ZBJA 1UGPB 1ARKA 3G71T 5GAOm 3M0SA 2V8JA 2O4XA 1ZA1B 3L2UA 1U8RA 2QTXA 2PTKA 2DL5A 1TH7A 2K5FA 4M78G 2O01E 3ER0A 1I8FA 3R6NA 2E4HA 2A36A 5GAN4 1X27A 2RI5A 2V1QA 4C92A 1VQ6Q 3QYGB 3M0RA 4C0DC 4J9EA 4PJNA 2JS2A 2VKNA 2COYA 3LLRA 4E6RA 3I56A 3HRTA 2M9UA 1M1KU 4A4KA 1M4ZA 2RI3A 2ABLA 2QG9B 2W10A 1QMCA 2XI9A 4M75F 1YFNA 1M8VA 1NPRA 1TUCA 3JCMW 3PMIA 5GAOr 4R0KA 1M5Q1 1WQWA 2CP3A 3NMZC 7AT1B 2HKQB 4GLMA 2DM1A 2DFUA 2HNIA 5GAMf 3VUZA 3JB9J 1YITT 1WJQA 2XICA 1YIJA 1T0HA 2EW3A 3J7AF 3OYYA 1OEBA 2LQNA 3VUBA 4Z02A 2WSFE 1X43A 2LTOA 3EG3A 3E19A 2KI7A 1O9SA 1G2BA 3OYFA 2RQWA 5CKBA 2CH4W 2VB6A 2JMCA 4E7JA 4QQ6A 3JCMg 4C92B 1MMNA 1LCKA 2QQBA 3M4GA 4JUVA 2J6OA 5DLOA 2QK0A 4OB2B 4M7AE 2A3LA 2I2LA 1K1ZA 1NJIC 3JCMe 1KC8U 1M90R 1Q86R 1QCOA 2J6KA 4X9DA 4CC2A 1BCMA 4IUUA 4M7DD 4LD6A 1YJNA 3CMAT 1TTHB 5IHIA 4QVDA 2CT4A 4E7IA 3PTAA 1KFZA 2EQMA 1JXOA 2CSQA 1ABOA 3CCUQ 3GLXA 3QWXX 4FSXA 1M90U 3GOXA 1Q86U 1PC0A 3JB9H 5FRMA 4ZTJA 1PRMC 2DX1A 1EFNA 2KE9A 1TXQA 3JCMh 2R58A 1SG5A 2KYBA 3OS1A 3WVDB 1KQSS 2YRDA 2OTJQ 1OX8A 1XNIA 3NTHA 3OYJA 1IHVA 1MNDA 4LUDA 4D8KA 2KY9A 3RKXA 1E6GA 2DETA 1JEGA 3CBPA 1WX6A 3VRZA 2AKLA 3UA7A 1RAFB 2DVJA 2V1RA 2LP5A 4J9FA 5GJVB 2GTOA 4BDZA 1QVGP 1VQ9Q 1D3BA 5HCKA 5GAOp 2MK5A 3OYEA 4OB3B 4J6XA 3VJPA 1VQLA 1YI2Q 1U1SA 1WDXA 5GAN8 2DD4A 2EIFA 2K5IA 4LDUA 4EMKA 3MCAB 4M7AG 2EQIA 4M4ZA 2K9GA 2KYMA 5D7UA 3LW5E 3UA6A 2CT3A 1AEYA 1NPPA 3EFRA 2XMFA 3CCLQ 2L0AA 1WXTA 3ZL7C 2EAYA 1VQ8Q 1B34A 2X9HA 1AZGB 3BFMA 2CP7A 2D9TA 1X6BA 2LVMA 1CKAA 2RQUA 2H8HA 4M75G 2AT1B 3SDZA 3E9GA 1YWPA 3THKA 2YUOA 2COWA 3QJ6A 1VQ5T 5GANf 3TSZA 1NEBA 1U1TA 1ZQ1A 2QEXT 3FDRA 5I2MA 1ZSZA 2X3XD 5KYYA 3GIBA 2F5TX 2ZZDA 3DLMA 2JUFA 1I5LA 5GJWB 3OYMA 1AT1B 1D3BB 1PRLC 1X6OA 3JCMP 4RTUA 4BI8B 4FSSA 4HCKA 1PCXA 2L3QA 1QW1A 3LWIA 5FU6C 2YT6A 4R55A 2R5MA 3RMQA 3CC4T 4JS4A 2E1HA 4LN2A 1K9MU 4JPBW 4BACA 2LJ0A 3VKIA 2DERA 3CC7T 4PJMA 3MKDA 5KYWA 1B34B 4KH0B 3V7SA 1QKWA 2DL3A 4D8DA 2HSEB 3LGLA 3CCVT 2NUTA 1Z9QA 2KDSA 3M0TA 3KFVA 4PJLA 4OMQA 5A2QE 1VQ6A 1BI1A 5GAMj 2D0QB 2RJDA 1RLQC 2RJFA 5LJ3d 1LNXA 1ZLMA 1ACMB 4IKFA 1ZSZB 1NJIR 5KYYB 4M77D 4GBQA 3CPFA 3PE0A 4C8QC 3G6EQ 5GMKi 1GXIE 4C92E 5DM7R 3E2UA 2R5AA 4P5NA 1K8AC 2EGAA 2F5KA 4AT1B 2RB6A 2KAFA 4IIOA 5FRNA 2ZPIB 1Y71A 1WXBA 1VQMT 2FPFA 3X26B 5CK9A 3KXTA 1NJIU 5ECAA 4C5EA 1I5OB 1WI7A 4VUBA 1A0NB 2LZ6B 1GFCA 3GBQA 1QCFA 2B8AA 2RPNA 4J9BA 1YJWT 3P8BB 3QXEB 2RHUA 3JSCA 3CXCS 2HMAA 2FZKB 4PJOC 5KYWB 1IZ6A 1RI0A 4DQ2A 3CCQT 4O5VA 1QP2A 2EYZA 4L5GA 5GAN5 1LVKA 2QI2A 2NUTB 2JZ2A 1X75C 3MEVA 4E7LA 2RJEA 1JO8A 1D09B 4OP0A 1YIJQ 3MP6A 1S72Q 1K76A 8ATCB 1VYTA 2M02A 3A5ZB 1BB9A 4NL2A 3NHNA 5IH2A 1CKBA 3TREA 1K73C 2KT1A 2D1XA 2DBMA 1M1KC 3QPHA 3L2VA 3JCMf 1IGQA 2GGRA 4OMFB 4JRPA 2Y90A 1VQ7A 2DXBA 2JM9A 4BY6B 2DXTA 4C92G 4CC4B 3CMEQ 3I55Q 1FYNA 4M78F 1Y0MA 1H641 2EKHA 2EQJA 1WFWA 4AFUC 4A4HA 2JOYA 2EKOA 4Q5WA 4JRKA 1GCQA 1ZBXA 2DLPA 2OTJA 4WCIA 4ZGDB 2FZGB 2DBKA 4O6JA 3INZA 1I0CA 5LL6S 4FCYA 4CI0C 4JJBA 1RABB 1KD1C 3C95A 1ZUYA 3VU3C 2E65A 3NTIA 1C1AA 4A53A 4ZTFA 1Y7XA 3I9QA 1VQNQ 3N5BB 4FT2A 4M77E 4B9XA 3TU4K 1PM3A 4RMOA 1VQ9A 1WZOA 3DB3A 4OMNA 3CCRQ 4CRIA 2XDDA 3EFOB 4QKUA 2SRCA 3L42A 1D0XA 3HRSA 5AT1B 2A7YA 1RAAB 1G5VA 3CCUT 3JCMQ 3OYDA 4FYYB 1KC8C 5GANj 4C0FA 1WHGA 3MP1A 1UJ0A 3V8LA 2QDYB 4RTTA 5KYNA 1NE8A 2X3WD 2BIVA 3QJYA 4JS5A 2DE0X 1KHCA 1G3YA 1VQKA 4FW1A 2LNHB 4EMKC 5M9OA 3CXCA 2M1HA 3G4ST 3OS5A 4XAXB 4B6MA 1R77A 5CCAA 2K3BA 4M78C 2E10A 5HK0A 2AZVA 1B3QA 3Q1JA 4EMHA 4DOVA 4XTUA 1M30A 5IAYA 5KE3A 1T0JA 3LYIA 3CBOA 1PSEA 3ZEHA 4FIBA 1Z9ZA 1BIBA 1BIAA 2ED1A 1FX7A 2G3RA 2CSIA 1O75A 2DEUA 5CVIA 1YI2T 1K8AR 3QHSA 4JLIA 1GL5A 4J9CA 2JN0A 3OYNA 2QDLA 4HT8A 1OX9A 3DB4A 1YHQA 4XU3A 4QQDA 1OI1A 3I35A 3CCLT 1E7OA 1SEMA 3OBYA 4OB1B 1VQ8T 1KG1A 3H8ZA 3PMTA 3CCJQ 4AG1C 2XHCA 2QQAA 2K3YA 3QKJA 2HSPA 1YJ9T 4EIKA 4II1A 2XG8D 1M3AA 4N4HA 2RD1A 2E70A 1VQPQ 3CD6Q 1I81A 3JV3A 2KRSA 2FRYA 2XKOC 3FLGA 5FWCA 3CCSA 2JTFA 2FL7A 2LCSA 1AWJA 1ZUUA 5C0MA 1YBYA 5GMKj 2CS7A 3PGGA 4OMOA 2K3XA 2ROLA 3EAEA 4AFSC 3SFMA 3CXCP 1W6XA 4K11A 2OTLT 3CC2T 1K73R 4FU6A 2O9SA 3A8GB 3G6EA 3SWNC 1M1KR 4DBRA 4UC4A 5CIUA 3EG9B 4M7AF 2CUDA 2DPPB 1PSFA 4HT9A 2KRNA 2K7AA 2OJ2A 2FG0A 1S1NA 1I07A 4M7DB 1NYFA 2X35A 5CQYA 5FROA 1WLPB 1K73U 4BUGA 1W70A 4A4EA 1JJ2A 1I1JA 2DILA 2RQTA 3VS0A 6AT1B 1WNLA 3UT1A 1RI9A 5GMKe 3SEMA 1F1BB 1OQKA 4FW2A 1K9MC 4L59A 4KRTA 2O9VA 1SHFA 4JJCA 4TVRA 4AFZC 4RTYA 1KD1R 3MEWA 1S72A 2P0QA 3M54A 4LDYA 4A4GA 2Z0WA 3H0FA 1VQOQ 2KT8A 4J83A 2QXFA 1BI2A 2PUOB 3JAME 3NFCA 4Z89A 1W2BA 2DIGA 2KK4A 1QVGA 2E64A 1SSFA 1VQ4T 1FMKA 5GMKh 1KD1U 1YN8A 2KGTA 1RAIB 1KC8R 2VGNA 5IN1A 2ZAEA 2LX7A 4KH1B 3A98A 3VS3A 3CBMA 1FWZA 5D6YA 1G8XA 1PNJA 4XU0A 2CDTA 2MYSA 1MHNA 4A63B 3I56T 4M7AC 3NTKA 5L23A 1VIEA 2ATCB 3CMEA 3I55A 3C0CA 4ZN1A 3MJXA 2F69A 5DY9A 4XK8E 1QKXA 3JCMJ 1IRXA 3OW2S 1M3CA 2DXCA 1UG1A 3CCMA 3M0UA 3AHUA 3FJ5A 1YWOA 1RAEB 4M75C 4X9CA 3BW1A 2L3PA 1Q81C 4LXCA 4Y92A 2YRVA 1JJ2P 2GBQA 4QW2A 4R56A 1VQ7Q 2OX7A 1VQNA 3L2WA 4HVUA 4FYWB 1UE9A 2F2XA 5LJ3f 3CCRA 1SRMA 3OSSC 2YLCA 4L6V5 4BDYA 3RKYA 1X2QA 2YSQA 4M77A 4PLIA 2FO0A 3QWYA 2KEAA 4B9WA 1VUBA 3VS4A 4FT4A 2IG0A 2YXYA 4ATOA 3JB9I 4ME7A 2WSCE 2RK2A 5D6WA 3FC3A 1TS9A 3A8OB 4LDWA 1M2VA 3V8JA 1BI3A 2RHYA 3OY9A 2HD0A 2O31A 1W2BP 5FLXE 4IURA 1YJNT 4WTOB 1WA7A 4E2FB 4E7ZA 4J9HA 2RM4A 3QZ9B 4F7UE 2DL7A 4HCCA 3EGUA 4JZ3A 3TQ7P 2QEXA 2CH4A 1IGUA 2K57A 1UGVA 2X4JA 4N4GA 4PL6A 3ULRB 4PLLA 2V8IA 5I11A 2P4TA 3NGPA 4LDVA 2LRQA 5KCOA 3JCMX 1VQKQ 2DTHA 1NLOC 3M0QA 4C8QD 2CUBA 4N0AA 1BYMA 3H9NA 2JTMA 2M51A 1M9SA 2LQ8A 4M77B 2XD0A 2RI2A 2HBPA 3GNFB 1TUDA 4C92F 2YLBA 4XTZA 2E6NA 5IHKA 1UECA 3CCJA 1QP3A 4LDXA 2IIMA 2GTJA 1M2VB 1DJ7B 1VQPA 2X4WA 4PJOD 3CD6A 1VQLT 1K9MR 2FEIA 2YUNA 4KUIA 4M7DE 3D7SB 3LGFA 4KT0E 5KCHA 1YCYA 2LT4A 1QVPA 2J05A 2BE7D 3ZFJA 3TCJA 2PVOB 3P8HA 3X25B 1YHQQ 3RUXA 2H3EB 3VS5A 3LH0A 2DAQA 3G71Q 1UGQB 4XU1A 2LCLA 1WJRA 1U3OA 2L8DA 4XTWA 1ZA2B 3LWHA 5FW9A 1WHLA 1T3LA 2F2WA 1QVFS 1KSWA 1QWEA 1HJDA 1N5ZA 3OYLA 2MWPA 2QA4T 3JB9D 1AOJA 3QYHB 1KQSA 2Y4YA 2MOXA 1XJWB 3CCSQ 4A4FA 5J39A 1MV3A 5HY6A 4HCBA 4HVWA 2E3HA 4HXJA 4C92C 2CZ7B 1GBQA 4E7HA 4Z8AA 1HD3A 2CP6A 4LUEA 1EIFA 4C5HA 2ZPBB 1I4K1 1T3SA 4KGVB 2L2PA 1M2OA 1Q81R 5C6SA 3A8MB 1YITQ 2G6FX 3QUIA 2ZPFB 2CZ1B 1NLPC 3AT1B 5J26A 2AK5A 2YWWA 3O5ZA 2P0KA 1WPYA 2EPDA 1WHKA 4M7DG 2EQUA 2GQVA 1VQOA 5D6XA 1V1CA 1G3SA 3C4SA 2B86A 1U06A 1Q81U 4C8QE 1EZZB 3PIPA 1VA7A 1E6HA 4DBFA 5IXBA 3RIRA 1GFDA 3HKSA 1VQ6T 1KIKA 5LJ5d 4M77F 3NPFA 1LPLA 1VIFA 2P4RA 4PFZA 2HL3A 1UGRB 4C5IA 2HL5C 4XU2A 3RDVA 3M4YA 2LC4A 3H0IA 3OB9A 4YTLA 4F17A 2JXBA 2RH2A 4DEYA 1NG2A 1YCSB 2AZSA 3T9NA 4J6YA 1PD0A 1M1FA 2JMAA 4HCZA 3REBB 2KXDA 1KQ2A 1AWOA 5LJ3j 3EFOA 2EGEA 4PJOE 2P84A 1KQSP 2ROTA 4M78D 3HHTB 2JT4A 3RNJA 3L1AA 3CMAQ 1NBEB 5AYFA 3WVEB 2ENMA 1VOMA 2RMOA 3MEUA 1GRIA 2DA9A 1P92A 2K2MA 2JTEA 2GCXA 3QIIA 2MIOA 4DEXA 2DTIA 3MPUB 4C0DB 4QVCA 2BKDN 2EQKA 2D0NA 5LJ3g 1SPKA 1MNEA 4FM4B 1QVFA 4MMKA 2JNGA 3QDRB 2YUPA 2K79A 3CCMQ 3DLLA 3FB9A 2EFIA 2E6ZA 2BZXA 1H3HA 5GAOn 4AFQC 3EG1A 5HK3A 3GNGA 3RERA 1KHIA 4RKUE 1WHJA 1BI0A 1TU0B 5LJ3e 1OYXA 1AWWA 2AIRB 2E5KA 3FEOA 4ZGJB 5I21A 3MEAA 1H3ZA 4BE0A 1SF9A 1K9AA 3EFSA 4ELYC 1PWTA 2HAXA 4NL3A 5EG2A 5KYXA 2OI3A 1Y57A 3A8HB 3OSVA 1VQ7T 2OAWA 4F7UA 3SB2A 4C0ZA 4HVVA 5CQXA 2FB7A 4X34A 4ELZC 5LJ3h 2DL8A 2L3SA 1B07A 3HL8A 2DYIA 3E1SA 3TVTA 4ZNXA 3PIOA 2OTJT 1AVZC 4LE9A 1FXXA 1ZUKA 3A8LB 1XTDA 2HBWA 3QDFA 5LJ5e 1JQQA 4DBHA 1IREB 1RAHB 2IPOB 3OS0A 1VQ5Q 1WGSA 4C5GA 2QQ9A 4JJDA 4N0AC 1SSHA 2EJGA 2HEQA 2QEXQ 2LX9A 3M5AA 4JRQA 3CCEA 3BY7A 1VQ9T 1QVFP 2LJ1A 2M0YA 2JVVA 1QLYA 2NUZA 2NUPA 1ZSZC 3EG9A 4OVAA 1RACB 4M78E 4RTVA 4IUPA 2LNVA 2QGGA 5KYXB 2DD5A 2E3IA 4M7DA 2NWMA 4M77G 1PD1A 3EH1A 3G71A 2JJ9A 3CC4Q 1VQKT 4F7UB 5CR2A 4OMMA 3V7RA 1UHFA 2PVGB 3CC7Q 8AT1B 2BUDA 4BI3A 1D1BA 2RF0A 1WHHA 2V26A 3F70A 1GCPA 1RUWA 2LCCA 2ECZA 3OA6A 2VASA 5EC7A 3OYKA 3OMCA 3QZ5B 1D1AA 4M7AD 1HSQA 3ZBDA 2KRMA 2DTOA 1ZX6A 2BZ8A 1H92A 1HYOA 2V8KA 2HQEA 3H0HA 3FIFA 4GY5A 5GMKl 2RJCA 2NUPB 1YHQT 1YITA 2CZ0B 2E12A 3PNWC 4IUQA 2E41A 4KGZB 4M75D 2MAMA 2RHXA 2XK0A 4MDXA 3URGA 2SEMA 3S3MA 5A0DA 4EDUA 1UGSB 2XIDA 1Q95G 2QAZA 3BE3A 1YJWQ 3BDUA 2PQWA 2ZCFB 4N4IA 1VQ4A 5GAOl 2LQKA 2VXFA 4BY6C 3CCQQ 2GFUA 3MO8A 1Q7YC 3CCST 3VYHB 4C8QA 2H3JA 2RQVA 3TEEA 3VS1A 4XTXA 1BKBA 1N6AA 4D6WA 1OPKA 3KUFA 3OQ5A 1G3WA 3G6ET 2O2OA 4AG2C 3OYBA 1SKUB 3BDLA 2VC8A 1M1GA 5IXFA 5FU6B 4LNPA 3J81E 3G1JA 2VVKA 1PKSA 3CMAA 4PJOA 3OBWA 3JCMb 2HKNA 3ME9A 3JCMV 2YRCA 4J6WA 2DMOA 4KBMB 1W4SA 4CC3A 1KK7A 1N8RC 2MPXC 2O4XB 1NM7A 2FYKA 5CAIA 3OYIA 4F7UF 1HXDA 5GAN7 3OYGA 1Y96A 2EYWA 2X4YA 1YP5A 1ABQA 2WACA 2RNAA 2VV5A 2YHTA 3RR6A 1G3TA 4MZPA 2GNCA 4JRIA 5GAN2 2AHJB 4C8QB 2KXCA 1YIJT 1S72T 4MDWA 3UF4A 1GCQC 4ESRA 3CPWS 1RLPC 3PT9A 1FMWA 1TSFA 2ESWA 2L89A 4XQ3A 3OMGA 5A0LA 5GAN6 1QWFA 1OZ2A 4KGXB 4MZMA 5J3BA 5L8RE 3VS7A 1AHJB 3HP9A 2J06A 3L2ZA 2PVDB 5CKHA 2MMPA 2ZGWA 2MCNA 4F04B 2M0OA 2EGCA 2K4YA 3A1PA 1Q82C 1FMVA 4M75E 4PJOB 1YNZA 4M7DF 2QASA 3CMET 1BBZA 3I55T 3MP8A 3VV0A 2D8JA 5CKFA 1TG0A 2KROA 4QT7A 2ZPGB 3V7CA 4BI4A 1BK2A 4E47A 1Y96B 4DBQA 3G4SQ 2X51A 3CCMT 4BE1A 2K2VA 1QQJA 2R57A 2LJ3A 2DL4A 1OV3A 5GAN3 1VQ5A 3EGDA 2QQSA 4OMPA 2A0FB 2MI6A 5LJ5f 1VQNT 1JBMA 1K0XA 3REAB 1IB8A 2HDAA 1BCOA 2LT1A 3CCRT 2CP2A 2I0NA 4C92D 3HFNA 4E7SA 4F14A 4ANJA 1AZEA 2DXUA 5KE2A 2C06A 2EYXA 3PVQA 1RAGB 5FWBA 2EVRA 5CKEA 2RHIA 4RCCA 3EG0A 2NYSA 3P8DA 4M78A 4C0GA 4MZTA 2VYTA 3CC4A 2QGFB 3VRYA 3QSUA 3X24B 1WHMA 2J7IA 5GAMd 3CC7A 3CCEQ 2CZ6B 2PUKB 1JRIA 1YJ9Q 4M7DC 1J3TA 1R0CB 2MF2A 2ED0A 2IVWA 2AKKA 1Q7YR 2RHZA 2L5QA 3OW2A 3S3OA 3CCVA 2JS0A 4V2SA 1RADB 2J6FA 2QA4A 1UB4A 3M0PA 4QQGA 3X20B 2DZ9A 2DK3A 2LDMA 2F2VA 1UJYA 3GPLA 2QYZA 1MMGA 3S3NA 1UUEA 2YDLA 1KQ1A 3CQTA 2OAUA 1SHGA 3UWNA 1M27C 4C8QF 2JW4A 3EGDB 1TUGB 4RUGA 3UDCA 3CPWA 2CYZB 2KMTA 1HK9A 3QBYA 3RBBB 1Q7YU 4OGEA 4Z88A 1JXMA 3UPUA 4WF2A 1MGQA 2OTLQ 1OPLA 3CC2Q 2RA2A 1MUZA 1QCNA 1R8OB 4BB7A 4F7UG 3OYHA 1OU9A 1Y07A 1U5SA 1PHTA 4EMKB 2KBTA 4JLGA 5CO7A 2E5QA 1VQMA 2HCKA 3M9QA 3EH2A 1N8RR 4NOYA 4PJOF 4JZ4A 2EJ9A 4M78B 2DYBA 3CCJT 1OULA 3X28B 3OYAA 1UHCA 3E9FA 2KQWA 1YJWA 1W1FA 1VQPT 3CD6T 2XDPA 1OOTA 4FYXB 3CCQA 3PVLA 1N8RU 2CGHA 2DJQA 2COZA 3HFOA 3S6WA 3M58A 1SRLA 3SWNA 4DA4A 1XOVA 3JCMc 3C94A 1WXUA 2DIQA 3JB9F 3R6OA 1NEGA 3VS6A 4ORZA 2VUBA 1MMAA 3QG1A 5KH6A 3OW2P
chains in the Genus database with same CATH topology
3SEMA 3TVTA 4ZNXA 4OMLA 1AVZC 1WDXA 4LE9A 3EHQA 4CC7A 1ZUKA 2HBWA 4KRTA 1JQQA 2O9VA 1SHFA 2EQIA 4JJCA 4M4ZA 2K9GA 2KYMA 4AFZC 4RTYA 2RQRA 4RTXA 3TSWA 4RTZA 3UA6A 2CT3A 4JJDA 1AEYA 1SSHA 2HEQA 2XMFA 2L0AA 1WXTA 3ZL7C 3H0FA 1CSKA 1AZGB 2KT8A 3VS2A 1X6BA 2LJ1A 2M0YA 4IIMA 4Z89A 1QLYA 2NUZA 1CKAA 2A37A 4J9IA 2DRMA 2RQUA 1FMKA 2H8HA 1YN8A 4RTVA 2KGTA 1YWPA 3THKA 5IHNA 2YUOA 2LX7A 3VS3A 3A98A 3TSZA 1NEBA 2PNIA 1PNJA 1K0SA 2CDTA 2NWMA 4A63B 5L23A 2D8HA 5I22A 2X3XD 3C0CA 1K4US 4OMMA 1UHFA 3EHRA 5GJWB 1QKXA 2EYYA 1PRLC 2RF0A 1M3CA 4RTUA 1UG1A 3M0UA 4FSSA 4HCKA 3EG2A 3FJ5A 1YWOA 1GCPA 1RUWA 1JU5C 3IQLA 2L3QA 2ECZA 2L3PA 2C0IA 5EC7A 2YT6A 4Y92A 1HSQA 1ZSGA 2GBQA 4LN2A 3SHWA 4JPBW 2KRMA 2LJ0A 1VYVA 1ZX6A 2BZ8A 1H92A 1UTIA 2K6DA 4HVUA 2BTTA 2FRWA 1UE9A 2F2XA 1QKWA 1SRMA 2DL3A 1MV0B 2EBPA 2LMJA 4D8DA 3H0HA 1X2QA 1Z9QA 2YSQA 3M0TA 3KFVA 4J9GA 4OMQA 2FO0A 3QWYA 2KEAA 1X6GA 1RLQC 2A28A 3VS4A 4F16A 1ZLMA 2SEMA 2DRKA 4GBQA 2O31A 2LQWA 3PE0A 1AWXA 1IO6A 2EGAA 1WA7A 4J9HA 4IIOA 2DL7A 1WXBA 3EGUA 2RQVA 4JZ3A 2FPFA 5ECAA 1G83A 3VS1A 2CH4A 1WI7A 2DNUA 1UGVA 1A0NB 2LZ6B 3ULRB 1GFCA 2GQIA 3GBQA 1QCFA 5I11A 2C0TA 2RPNA 3NGPA 1OPKA 4J9BA 2O2OA 4AG2C 1AD5A 5IXFA 1NLOC 3M0QA 2BZYA 2CUBA 1X2KA 2DF6A 2EYZA 2FPEA 2M51A 4LNPA 1WIEA 2VVKA 3I5RA 1PKSA 1NYGA 2CREA 1JO8A 1TUDA 2DMOA 4CC3A 4J9DA 3U23A 1H8KA 2O88A 1NM7A 1M8MA 1K76A 5IHKA 1UECA 1BU1A 1VYTA 3LH5A 1BB9A 2IIMA 2VWFA 2EYWA 2GTJA 1VYUA 3NHNA 1YP5A 5IH2A 1ABQA 1CKBA 2PZ1A 2RNAA 2KT1A 2D1XA 2DBMA 2FEIA 2YUNA 1PKTA 1UFFA 2C0OA 3H41A 2J05A 2GNCA 2KXCA 2GGRA 3VS5A 2A08A 2YUQA 2JM9A 1GBRA 1X69A 4CC4B 3UF4A 1GCQC 1FYNA 4ESRA 1RLPC 1U3OA 1Y0MA 2KR3A 4X1VA 2ESWA 2EKHA 2FPDA 1WFWA 5FW9A 2RN8A 4AFUC 1WYXA 2W0ZA 2F2WA 1T3LA 3UATA 1QWFA 1M3BA 1KJWA 1UDLA 2KNBB 3VS7A 1KSWA 1GCQA 1QWEA 2J06A 1HJDA 4RTWA 1N5ZA 2DLPA 2MCNA 1AOJA 4WCIA 3I5SA 2MOXA 2DBKA 2EGCA 2JM8A 1I0CA 1MV3A 1ZBJA 4JJBA 1ARKA 1YNZA 1BBZA 1ZUYA 3M0SA 2D8JA 1TG0A 2KROA 4HVWA 3I9QA 4QT7A 2PTKA 4HXJA 2DL5A 1BK2A 4OMNA 1GBQA 4Z8AA 1HD3A 3R6NA 4LUEA 2A36A 2SRCA 1X27A 1T3SA 2V1QA 2L2PA 2LJ3A 2DL4A 3M0RA 2G6FX 1OV3A 4J9EA 4OMPA 2JS2A 1NLPC 2VKNA 1UJ0A 4E6RA 2AK5A 4RTTA 2X3WD 3O5ZA 2DE0X 2EPDA 1K0XA 2ABLA 3REAB 2LNHB 2HDAA 2W10A 1V1CA 2I0NA 1TUCA 2B86A 4F14A 1U06A 1AZEA 1VA7A 1E6HA 5IXBA 2K3BA 4R0KA 1GFDA 2AZVA 3NMZC 1B3QA 2EYXA 3PVQA 4GLMA 2DM1A 1KIKA 1M30A 3NPFA 5FWBA 2P4RA 2EVRA 1T0JA 3EG0A 3H0IA 1T0HA 4F17A 2EW3A 1OEBA 2LQNA 2JXBA 4DEYA 3VRYA 1NG2A 1YCSB 2AZSA 1Z9ZA 2J7IA 1X43A 2ED1A 2CSIA 2JMAA 3EG3A 1J3TA 3REBB 2KXDA 2ED0A 1AWOA 2AKKA 2EGEA 1G2BA 1GL5A 2JS0A 2RQWA 1H3HA 2J6FA 3M0PA 2ROTA 4J9CA 2CH4W 2JMCA 2JT4A 2F2VA 1UJYA 3RNJA 2QDLA 1UUEA 2YDLA 3I35A 3CQTA 1LCKA 1SHGA 2ENMA 2RMOA 1M27C 1GRIA 2JW4A 2DA9A 1E7OA 2J6OA 1SEMA 4RUGA 2K2MA 2JTEA 2MIOA 4DEXA 3RBBB 4AG1C 1K1ZA 4Z88A 1JXMA 2HSPA 4EIKA 1OPLA 1M3AA 1MUZA 2J6KA 4CC2A 2D0NA 1SPKA 3JV3A 2KRSA 2FRYA 5FWCA 1U5SA 2YUPA 2K79A 5IHIA 1PHTA 2CT4A 2LCSA 1AWJA 1ZUUA 2KBTA 1KFZA 1JXOA 2BZXA 2HCKA 4AFQC 3EG1A 2CSQA 1ABOA 4OMOA 4JZ4A 3QWXX 2ROLA 4AFSC 2DYBA 1W6XA 1AWWA 4K11A 1UHCA 1PRMC 2E5KA 2DX1A 2O9SA 1EFNA 2KE9A 1W1FA 1K9AA 1OOTA 1PWTA 2KYBA 3PVLA 2CUDA 2DJQA 2KRNA 2OI3A 2K7AA 2OJ2A 1SRLA 2FG0A 1S1NA 1Y57A 1XOVA 4LUDA 1I07A 4D8KA 1NYFA 1WXUA 1E6GA 1WLPB 2OAWA 1JEGA 1WX6A 3VRZA 2AKLA 3UA7A 1NEGA 2DVJA 4HVVA 1W70A 3VS6A 4ORZA 1I1JA 2V1RA 2LP5A 4J9FA 2DILA 2DL8A 2GTOA 2L3SA 5GJVB 1B07A 2RQTA 3VS0A 5HCKA 1RI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEM A;  3TVT A;  4ZNX A;  4OML A;  1AVZ C;  1WDX A;  4LE9 A;  3EHQ A;  4CC7 A;  1ZUK A;  2HBW A;  4KRT A;  1JQQ A;  2O9V A;  1SHF A;  2EQI A;  4JJC A;  4M4Z A;  2K9G A;  2KYM A;  4AFZ C;  4RTY A;  2RQR A;  4RTX A;  3TSW A;  4RTZ A;  3UA6 A;  2CT3 A;  4JJD A;  1AEY A;  1SSH A;  2HEQ A;  2XMF A;  2L0A A;  1WXT A;  3ZL7 C;  3H0F A;  1CSK A;  1AZG B;  2KT8 A;  3VS2 A;  1X6B A;  2LJ1 A;  2M0Y A;  4IIM A;  4Z89 A;  1QLY A;  2NUZ A;  1CKA A;  2A37 A;  4J9I A;  2DRM A;  2RQU A;  1FMK A;  2H8H A;  1YN8 A;  4RTV A;  2KGT A;  1YWP A;  3THK A;  5IHN A;  2YUO A;  2LX7 A;  3VS3 A;  3A98 A;  3TSZ A;  1NEB A;  2PNI A;  1PNJ A;  1K0S A;  2CDT A;  2NWM A;  4A63 B;  5L23 A;  2D8H A;  5I22 A;  2X3X D;  3C0C A;  1K4U S;  4OMM A;  1UHF A;  3EHR A;  5GJW B;  1QKX A;  2EYY A;  1PRL C;  2RF0 A;  1M3C A;  4RTU A;  1UG1 A;  3M0U A;  4FSS A;  4HCK A;  3EG2 A;  3FJ5 A;  1YWO A;  1GCP A;  1RUW A;  1JU5 C;  3IQL A;  2L3Q A;  2ECZ A;  2L3P A;  2C0I A;  5EC7 A;  2YT6 A;  4Y92 A;  1HSQ A;  1ZSG A;  2GBQ A;  4LN2 A;  3SHW A;  4JPB W;  2KRM A;  2LJ0 A;  1VYV A;  1ZX6 A;  2BZ8 A;  1H92 A;  1UTI A;  2K6D A;  4HVU A;  2BTT A;  2FRW A;  1UE9 A;  2F2X A;  1QKW A;  1SRM A;  2DL3 A;  1MV0 B;  2EBP A;  2LMJ A;  4D8D A;  3H0H A;  1X2Q A;  1Z9Q A;  2YSQ A;  3M0T A;  3KFV A;  4J9G A;  4OMQ A;  2FO0 A;  3QWY A;  2KEA A;  1X6G A;  1RLQ C;  2A28 A;  3VS4 A;  4F16 A;  1ZLM A;  2SEM A;  2DRK A;  4GBQ A;  2O31 A;  2LQW A;  3PE0 A;  1AWX A;  1IO6 A;  2EGA A;  1WA7 A;  4J9H A;  4IIO A;  2DL7 A;  1WXB A;  3EGU A;  2RQV A;  4JZ3 A;  2FPF A;  5ECA A;  1G83 A;  3VS1 A;  2CH4 A;  1WI7 A;  2DNU A;  1UGV A;  1A0N B;  2LZ6 B;  3ULR B;  1GFC A;  2GQI A;  3GBQ A;  1QCF A;  5I11 A;  2C0T A;  2RPN A;  3NGP A;  1OPK A;  4J9B A;  2O2O A;  4AG2 C;  1AD5 A;  5IXF A;  1NLO C;  3M0Q A;  2BZY A;  2CUB A;  1X2K A;  2DF6 A;  2EYZ A;  2FPE A;  2M51 A;  4LNP A;  1WIE A;  2VVK A;  3I5R A;  1PKS A;  1NYG A;  2CRE A;  1JO8 A;  1TUD A;  2DMO A;  4CC3 A;  4J9D A;  3U23 A;  1H8K A;  2O88 A;  1NM7 A;  1M8M A;  1K76 A;  5IHK A;  1UEC A;  1BU1 A;  1VYT A;  3LH5 A;  1BB9 A;  2IIM A;  2VWF A;  2EYW A;  2GTJ A;  1VYU A;  3NHN A;  1YP5 A;  5IH2 A;  1ABQ A;  1CKB A;  2PZ1 A;  2RNA A;  2KT1 A;  2D1X A;  2DBM A;  2FEI A;  2YUN A;  1PKT A;  1UFF A;  2C0O A;  3H41 A;  2J05 A;  2GNC A;  2KXC A;  2GGR A;  3VS5 A;  2A08 A;  2YUQ A;  2JM9 A;  1GBR A;  1X69 A;  4CC4 B;  3UF4 A;  1GCQ C;  1FYN A;  4ESR A;  1RLP C;  1U3O A;  1Y0M A;  2KR3 A;  4X1V A;  2ESW A;  2EKH A;  2FPD A;  1WFW A;  5FW9 A;  2RN8 A;  4AFU C;  1WYX A;  2W0Z A;  2F2W A;  1T3L A;  3UAT A;  1QWF A;  1M3B A;  1KJW A;  1UDL A;  2KNB B;  3VS7 A;  1KSW A;  1GCQ A;  1QWE A;  2J06 A;  1HJD A;  4RTW A;  1N5Z A;  2DLP A;  2MCN A;  1AOJ A;  4WCI A;  3I5S A;  2MOX A;  2DBK A;  2EGC A;  2JM8 A;  1I0C A;  1MV3 A;  1ZBJ A;  4JJB A;  1ARK A;  1YNZ A;  1BBZ A;  1ZUY A;  3M0S A;  2D8J A;  1TG0 A;  2KRO A;  4HVW A;  3I9Q A;  4QT7 A;  2PTK A;  4HXJ A;  2DL5 A;  1BK2 A;  4OMN A;  1GBQ A;  4Z8A A;  1HD3 A;  3R6N A;  4LUE A;  2A36 A;  2SRC A;  1X27 A;  1T3S A;  2V1Q A;  2L2P A;  2LJ3 A;  2DL4 A;  3M0R A;  2G6F X;  1OV3 A;  4J9E A;  4OMP A;  2JS2 A;  1NLP C;  2VKN A;  1UJ0 A;  4E6R A;  2AK5 A;  4RTT A;  2X3W D;  3O5Z A;  2DE0 X;  2EPD A;  1K0X A;  2ABL A;  3REA B;  2LNH B;  2HDA A;  2W10 A;  1V1C A;  2I0N A;  1TUC A;  2B86 A;  4F14 A;  1U06 A;  1AZE A;  1VA7 A;  1E6H A;  5IXB A;  2K3B A;  4R0K A;  1GFD A;  2AZV A;  3NMZ C;  1B3Q A;  2EYX A;  3PVQ A;  4GLM A;  2DM1 A;  1KIK A;  1M30 A;  3NPF A;  5FWB A;  2P4R A;  2EVR A;  1T0J A;  3EG0 A;  3H0I A;  1T0H A;  4F17 A;  2EW3 A;  1OEB A;  2LQN A;  2JXB A;  4DEY A;  3VRY A;  1NG2 A;  1YCS B;  2AZS A;  1Z9Z A;  2J7I A;  1X43 A;  2ED1 A;  2CSI A;  2JMA A;  3EG3 A;  1J3T A;  3REB B;  2KXD A;  2ED0 A;  1AWO A;  2AKK A;  2EGE A;  1G2B A;  1GL5 A;  2JS0 A;  2RQW A;  1H3H A;  2J6F A;  3M0P A;  2ROT A;  4J9C A;  2CH4 W;  2JMC A;  2JT4 A;  2F2V A;  1UJY A;  3RNJ A;  2QDL A;  1UUE A;  2YDL A;  3I35 A;  3CQT A;  1LCK A;  1SHG A;  2ENM A;  2RMO A;  1M27 C;  1GRI A;  2JW4 A;  2DA9 A;  1E7O A;  2J6O A;  1SEM A;  4RUG A;  2K2M A;  2JTE A;  2MIO A;  4DEX A;  3RBB B;  4AG1 C;  1K1Z A;  4Z88 A;  1JXM A;  2HSP A;  4EIK A;  1OPL A;  1M3A A;  1MUZ A;  2J6K A;  4CC2 A;  2D0N A;  1SPK A;  3JV3 A;  2KRS A;  2FRY A;  5FWC A;  1U5S A;  2YUP A;  2K79 A;  5IHI A;  1PHT A;  2CT4 A;  2LCS A;  1AWJ A;  1ZUU A;  2KBT A;  1KFZ A;  1JXO A;  2BZX A;  2HCK A;  4AFQ C;  3EG1 A;  2CSQ A;  1ABO A;  4OMO A;  4JZ4 A;  3QWX X;  2ROL A;  4AFS C;  2DYB A;  1W6X A;  1AWW A;  4K11 A;  1UHC A;  1PRM C;  2E5K A;  2DX1 A;  2O9S A;  1EFN A;  2KE9 A;  1W1F A;  1K9A A;  1OOT A;  1PWT A;  2KYB A;  3PVL A;  2CUD A;  2DJQ A;  2KRN A;  2OI3 A;  2K7A A;  2OJ2 A;  1SRL A;  2FG0 A;  1S1N A;  1Y57 A;  1XOV A;  4LUD A;  1I07 A;  4D8K A;  1NYF A;  1WXU A;  1E6G A;  1WLP B;  2OAW A;  1JEG A;  1WX6 A;  3VRZ A;  2AKL A;  3UA7 A;  1NEG A;  2DVJ A;  4HVV A;  1W70 A;  3VS6 A;  4ORZ A;  1I1J A;  2V1R A;  2LP5 A;  4J9F A;  2DIL A;  2DL8 A;  2GTO A;  2L3S A;  5GJV B;  1B07 A;  2RQT A;  3VS0 A;  5HCK A;  1RI9 A; 
#chains in the Genus database with same CATH topology
 4OML A;  4J5Y A;  1VQ4 Q;  5GAM g;  3MET A;  2KVQ G;  3EHQ A;  2RK1 A;  4KUL A;  4CC7 A;  2L3R A;  1Q82 R;  3EGX A;  5FU7 B;  4RG8 A;  2CP0 A;  3M55 A;  2RQR A;  4RTX A;  3J80 E;  3TSW A;  1N9S A;  4RTZ A;  3CPW P;  1TWB A;  1WQ7 A;  2DZC A;  3I56 Q;  4IUV A;  3O8V A;  1D1C A;  1CSK A;  2MWO A;  2QTV A;  4PK4 A;  5GAM e;  3VS2 A;  4IIM A;  1Q82 U;  1C6V X;  1MMD A;  2P0P A;  4BE2 A;  2A37 A;  4J9I A;  2DRM A;  4J8O A;  4Y91 A;  2KSS A;  3M53 A;  4ZN3 A;  5IHN A;  4RCB A;  4JDS A;  2DKG A;  4OGC A;  3SD4 A;  3SWN B;  2PNI A;  4EMG A;  3OS2 A;  1K0S A;  2X4X A;  4QVZ A;  2D8H A;  4PNO A;  5I22 A;  3GF5 A;  2ZPE B;  4FYV B;  1OU8 A;  1VQO T;  2QQR A;  5CKD A;  1K4U S;  1NZ9 A;  3EHR A;  1IXD A;  4M7A A;  2K5L A;  5GAM h;  5GAN d;  2EYY A;  4ZGE B;  2FZC B;  3EG2 A;  4E7K A;  3MHX A;  1JU5 C;  3IQL A;  3LX7 A;  2EYQ A;  3CCU A;  3EGX B;  1JB0 E;  2C0I A;  2DEQ A;  3L2R A;  3HRU A;  4MML A;  1ZSG A;  3SHW A;  2WSE E;  1VYV A;  4M77 C;  4C8Q G;  4M75 A;  5LJ5 j;  1V29 B;  2CKK A;  1UTI A;  2K6D A;  4XTV A;  1B7T A;  2BTT A;  2FRW A;  3G4S A;  2LMJ A;  1MV0 B;  2EBP A;  4DOW A;  3OYC A;  3RMS A;  2EJF A;  3V8K A;  1YJN Q;  3RKW A;  3M56 A;  4J9G A;  3FRN A;  1C0M A;  1X6G A;  2A28 A;  4F16 A;  4KUD K;  3CEY A;  2HQH A;  5A0G A;  2Y4X A;  1XQH A;  1ZHI A;  2BE9 B;  2DO3 A;  5DLQ E;  4EPC A;  2F1L A;  4PJO G;  9ATC B;  2DRK A;  5LJ5 g;  3ASK A;  2HZY A;  2LQW A;  2VXE A;  2DVE A;  2M16 A;  1WJS A;  3HSB A;  2PU9 B;  2NLU A;  1YI2 A;  4M7A B;  3L2Q A;  2VGM A;  1AWX A;  1IO6 A;  4Y28 E;  1OZ3 A;  4PKC C;  4AMC A;  4HKE A;  1LJO A;  3WXM B;  1G83 A;  3CCL A;  1LOJ A;  2DNU A;  5I2S A;  1IHW A;  4FL6 A;  1VQ8 A;  2GQI A;  1JJ2 S;  5KYU A;  2C0T A;  2HQX A;  4M75 B;  1YJ9 A;  3M57 A;  3JB9 G;  1UEB A;  1AD5 A;  4NS5 A;  2BZY A;  3M59 A;  4RG2 A;  1M90 C;  1X2K A;  4J7I A;  1Q86 C;  2DF6 A;  3GP8 A;  2FPE A;  2FHD A;  1VQL Q;  2XU8 A;  1WIE A;  3HTR A;  4PFP A;  4GLK A;  3I5R A;  1D0Z A;  1NYG A;  5GAN g;  3PFS A;  2D6F A;  2CRE A;  1PG5 B;  4J9D A;  3U23 A;  1H8K A;  5LJ5 h;  2O88 A;  3JRZ A;  1M8M A;  1BU1 A;  3RES A;  1N27 A;  3LH5 A;  3HPW A;  2CP5 A;  2VWF A;  2OTL A;  3C12 A;  1W2B S;  3CC2 A;  1VYU A;  3DKM A;  4LD9 K;  5GAN e;  1QVG S;  2PZ1 A;  4IUT A;  4JJN K;  1PKT A;  1UFF A;  2FVU A;  3FJP A;  3CCV Q;  2QA4 Q;  1RL2 A;  1V76 A;  2C0O A;  2RO0 A;  3H41 A;  3QO3 A;  2ZPH B;  3G7Z A;  4A54 A;  2GFA A;  4HA8 A;  2A08 A;  3H6Z A;  1K8A U;  1D0Y A;  2YUQ A;  1GBR A;  1X69 A;  1N9R A;  3CCE T;  5FU7 C;  2XDB A;  1EX4 A;  2KR3 A;  4X1V A;  5HKC A;  5GMK m;  5IT9 E;  5KYU B;  4OF1 A;  3JCM d;  2FPD A;  4PFO A;  2RN8 A;  1WYX A;  2DJZ A;  2W0Z A;  4BD3 A;  3UAT A;  1M3B A;  1KJW A;  1UDL A;  2KNB B;  4OB0 B;  4XTY A;  5GAN h;  1R0B G;  4RTW A;  2GF7 A;  3VYG A;  2EWN A;  4J7F A;  3I5S A;  3KBG A;  1X01 A;  2JM8 A;  5GAO q;  1TOV A;  4PJJ A;  1VQM Q;  1ZBJ A;  1UGP B;  1ARK A;  3G71 T;  5GAO m;  3M0S A;  2V8J A;  2O4X A;  1ZA1 B;  3L2U A;  1U8R A;  2QTX A;  2PTK A;  2DL5 A;  1TH7 A;  2K5F A;  4M78 G;  2O01 E;  3ER0 A;  1I8F A;  3R6N A;  2E4H A;  2A36 A;  5GAN 4;  1X27 A;  2RI5 A;  2V1Q A;  4C92 A;  1VQ6 Q;  3QYG B;  3M0R A;  4C0D C;  4J9E A;  4PJN A;  2JS2 A;  2VKN A;  2COY A;  3LLR A;  4E6R A;  3I56 A;  3HRT A;  2M9U A;  1M1K U;  4A4K A;  1M4Z A;  2RI3 A;  2ABL A;  2QG9 B;  2W10 A;  1QMC A;  2XI9 A;  4M75 F;  1YFN A;  1M8V A;  1NPR A;  1TUC A;  3JCM W;  3PMI A;  5GAO r;  4R0K A;  1M5Q 1;  1WQW A;  2CP3 A;  3NMZ C;  7AT1 B;  2HKQ B;  4GLM A;  2DM1 A;  2DFU A;  2HNI A;  5GAM f;  3VUZ A;  3JB9 J;  1YIT T;  1WJQ A;  2XIC A;  1YIJ A;  1T0H A;  2EW3 A;  3J7A F;  3OYY A;  1OEB A;  2LQN A;  3VUB A;  4Z02 A;  2WSF E;  1X43 A;  2LTO A;  3EG3 A;  3E19 A;  2KI7 A;  1O9S A;  1G2B A;  3OYF A;  2RQW A;  5CKB A;  2CH4 W;  2VB6 A;  2JMC A;  4E7J A;  4QQ6 A;  3JCM g;  4C92 B;  1MMN A;  1LCK A;  2QQB A;  3M4G A;  4JUV A;  2J6O A;  5DLO A;  2QK0 A;  4OB2 B;  4M7A E;  2A3L A;  2I2L A;  1K1Z A;  1NJI C;  3JCM e;  1KC8 U;  1M90 R;  1Q86 R;  1QCO A;  2J6K A;  4X9D A;  4CC2 A;  1BCM A;  4IUU A;  4M7D D;  4LD6 A;  1YJN A;  3CMA T;  1TTH B;  5IHI A;  4QVD A;  2CT4 A;  4E7I A;  3PTA A;  1KFZ A;  2EQM A;  1JXO A;  2CSQ A;  1ABO A;  3CCU Q;  3GLX A;  3QWX X;  4FSX A;  1M90 U;  3GOX A;  1Q86 U;  1PC0 A;  3JB9 H;  5FRM A;  4ZTJ A;  1PRM C;  2DX1 A;  1EFN A;  2KE9 A;  1TXQ A;  3JCM h;  2R58 A;  1SG5 A;  2KYB A;  3OS1 A;  3WVD B;  1KQS S;  2YRD A;  2OTJ Q;  1OX8 A;  1XNI A;  3NTH A;  3OYJ A;  1IHV A;  1MND A;  4LUD A;  4D8K A;  2KY9 A;  3RKX A;  1E6G A;  2DET A;  1JEG A;  3CBP A;  1WX6 A;  3VRZ A;  2AKL A;  3UA7 A;  1RAF B;  2DVJ A;  2V1R A;  2LP5 A;  4J9F A;  5GJV B;  2GTO A;  4BDZ A;  1QVG P;  1VQ9 Q;  1D3B A;  5HCK A;  5GAO p;  2MK5 A;  3OYE A;  4OB3 B;  4J6X A;  3VJP A;  1VQL A;  1YI2 Q;  1U1S A;  1WDX A;  5GAN 8;  2DD4 A;  2EIF A;  2K5I A;  4LDU A;  4EMK A;  3MCA B;  4M7A G;  2EQI A;  4M4Z A;  2K9G A;  2KYM A;  5D7U A;  3LW5 E;  3UA6 A;  2CT3 A;  1AEY A;  1NPP A;  3EFR A;  2XMF A;  3CCL Q;  2L0A A;  1WXT A;  3ZL7 C;  2EAY A;  1VQ8 Q;  1B34 A;  2X9H A;  1AZG B;  3BFM A;  2CP7 A;  2D9T A;  1X6B A;  2LVM A;  1CKA A;  2RQU A;  2H8H A;  4M75 G;  2AT1 B;  3SDZ A;  3E9G A;  1YWP A;  3THK A;  2YUO A;  2COW A;  3QJ6 A;  1VQ5 T;  5GAN f;  3TSZ A;  1NEB A;  1U1T A;  1ZQ1 A;  2QEX T;  3FDR A;  5I2M A;  1ZSZ A;  2X3X D;  5KYY A;  3GIB A;  2F5T X;  2ZZD A;  3DLM A;  2JUF A;  1I5L A;  5GJW B;  3OYM A;  1AT1 B;  1D3B B;  1PRL C;  1X6O A;  3JCM P;  4RTU A;  4BI8 B;  4FSS A;  4HCK A;  1PCX A;  2L3Q A;  1QW1 A;  3LWI A;  5FU6 C;  2YT6 A;  4R55 A;  2R5M A;  3RMQ A;  3CC4 T;  4JS4 A;  2E1H A;  4LN2 A;  1K9M U;  4JPB W;  4BAC A;  2LJ0 A;  3VKI A;  2DER A;  3CC7 T;  4PJM A;  3MKD A;  5KYW A;  1B34 B;  4KH0 B;  3V7S A;  1QKW A;  2DL3 A;  4D8D A;  2HSE B;  3LGL A;  3CCV T;  2NUT A;  1Z9Q A;  2KDS A;  3M0T A;  3KFV A;  4PJL A;  4OMQ A;  5A2Q E;  1VQ6 A;  1BI1 A;  5GAM j;  2D0Q B;  2RJD A;  1RLQ C;  2RJF A;  5LJ3 d;  1LNX A;  1ZLM A;  1ACM B;  4IKF A;  1ZSZ B;  1NJI R;  5KYY B;  4M77 D;  4GBQ A;  3CPF A;  3PE0 A;  4C8Q C;  3G6E Q;  5GMK i;  1GXI E;  4C92 E;  5DM7 R;  3E2U A;  2R5A A;  4P5N A;  1K8A C;  2EGA A;  2F5K A;  4AT1 B;  2RB6 A;  2KAF A;  4IIO A;  5FRN A;  2ZPI B;  1Y71 A;  1WXB A;  1VQM T;  2FPF A;  3X26 B;  5CK9 A;  3KXT A;  1NJI U;  5ECA A;  4C5E A;  1I5O B;  1WI7 A;  4VUB A;  1A0N B;  2LZ6 B;  1GFC A;  3GBQ A;  1QCF A;  2B8A A;  2RPN A;  4J9B A;  1YJW T;  3P8B B;  3QXE B;  2RHU A;  3JSC A;  3CXC S;  2HMA A;  2FZK B;  4PJO C;  5KYW B;  1IZ6 A;  1RI0 A;  4DQ2 A;  3CCQ T;  4O5V A;  1QP2 A;  2EYZ A;  4L5G A;  5GAN 5;  1LVK A;  2QI2 A;  2NUT B;  2JZ2 A;  1X75 C;  3MEV A;  4E7L A;  2RJE A;  1JO8 A;  1D09 B;  4OP0 A;  1YIJ Q;  3MP6 A;  1S72 Q;  1K76 A;  8ATC B;  1VYT A;  2M02 A;  3A5Z B;  1BB9 A;  4NL2 A;  3NHN A;  5IH2 A;  1CKB A;  3TRE A;  1K73 C;  2KT1 A;  2D1X A;  2DBM A;  1M1K C;  3QPH A;  3L2V A;  3JCM f;  1IGQ A;  2GGR A;  4OMF B;  4JRP A;  2Y90 A;  1VQ7 A;  2DXB A;  2JM9 A;  4BY6 B;  2DXT A;  4C92 G;  4CC4 B;  3CME Q;  3I55 Q;  1FYN A;  4M78 F;  1Y0M A;  1H64 1;  2EKH A;  2EQJ A;  1WFW A;  4AFU C;  4A4H A;  2JOY A;  2EKO A;  4Q5W A;  4JRK A;  1GCQ A;  1ZBX A;  2DLP A;  2OTJ A;  4WCI A;  4ZGD B;  2FZG B;  2DBK A;  4O6J A;  3INZ A;  1I0C A;  5LL6 S;  4FCY A;  4CI0 C;  4JJB A;  1RAB B;  1KD1 C;  3C95 A;  1ZUY A;  3VU3 C;  2E65 A;  3NTI A;  1C1A A;  4A53 A;  4ZTF A;  1Y7X A;  3I9Q A;  1VQN Q;  3N5B B;  4FT2 A;  4M77 E;  4B9X A;  3TU4 K;  1PM3 A;  4RMO A;  1VQ9 A;  1WZO A;  3DB3 A;  4OMN A;  3CCR Q;  4CRI A;  2XDD A;  3EFO B;  4QKU A;  2SRC A;  3L42 A;  1D0X A;  3HRS A;  5AT1 B;  2A7Y A;  1RAA B;  1G5V A;  3CCU T;  3JCM Q;  3OYD A;  4FYY B;  1KC8 C;  5GAN j;  4C0F A;  1WHG A;  3MP1 A;  1UJ0 A;  3V8L A;  2QDY B;  4RTT A;  5KYN A;  1NE8 A;  2X3W D;  2BIV A;  3QJY A;  4JS5 A;  2DE0 X;  1KHC A;  1G3Y A;  1VQK A;  4FW1 A;  2LNH B;  4EMK C;  5M9O A;  3CXC A;  2M1H A;  3G4S T;  3OS5 A;  4XAX B;  4B6M A;  1R77 A;  5CCA A;  2K3B A;  4M78 C;  2E10 A;  5HK0 A;  2AZV A;  1B3Q A;  3Q1J A;  4EMH A;  4DOV A;  4XTU A;  1M30 A;  5IAY A;  5KE3 A;  1T0J A;  3LYI A;  3CBO A;  1PSE A;  3ZEH A;  4FIB A;  1Z9Z A;  1BIB A;  1BIA A;  2ED1 A;  1FX7 A;  2G3R A;  2CSI A;  1O75 A;  2DEU A;  5CVI A;  1YI2 T;  1K8A R;  3QHS A;  4JLI A;  1GL5 A;  4J9C A;  2JN0 A;  3OYN A;  2QDL A;  4HT8 A;  1OX9 A;  3DB4 A;  1YHQ A;  4XU3 A;  4QQD A;  1OI1 A;  3I35 A;  3CCL T;  1E7O A;  1SEM A;  3OBY A;  4OB1 B;  1VQ8 T;  1KG1 A;  3H8Z A;  3PMT A;  3CCJ Q;  4AG1 C;  2XHC A;  2QQA A;  2K3Y A;  3QKJ A;  2HSP A;  1YJ9 T;  4EIK A;  4II1 A;  2XG8 D;  1M3A A;  4N4H A;  2RD1 A;  2E70 A;  1VQP Q;  3CD6 Q;  1I81 A;  3JV3 A;  2KRS A;  2FRY A;  2XKO C;  3FLG A;  5FWC A;  3CCS A;  2JTF A;  2FL7 A;  2LCS A;  1AWJ A;  1ZUU A;  5C0M A;  1YBY A;  5GMK j;  2CS7 A;  3PGG A;  4OMO A;  2K3X A;  2ROL A;  3EAE A;  4AFS C;  3SFM A;  3CXC P;  1W6X A;  4K11 A;  2OTL T;  3CC2 T;  1K73 R;  4FU6 A;  2O9S A;  3A8G B;  3G6E A;  3SWN C;  1M1K R;  4DBR A;  4UC4 A;  5CIU A;  3EG9 B;  4M7A F;  2CUD A;  2DPP B;  1PSF A;  4HT9 A;  2KRN A;  2K7A A;  2OJ2 A;  2FG0 A;  1S1N A;  1I07 A;  4M7D B;  1NYF A;  2X35 A;  5CQY A;  5FRO A;  1WLP B;  1K73 U;  4BUG A;  1W70 A;  4A4E A;  1JJ2 A;  1I1J A;  2DIL A;  2RQT A;  3VS0 A;  6AT1 B;  1WNL A;  3UT1 A;  1RI9 A;  5GMK e;  3SEM A;  1F1B B;  1OQK A;  4FW2 A;  1K9M C;  4L59 A;  4KRT A;  2O9V A;  1SHF A;  4JJC A;  4TVR A;  4AFZ C;  4RTY A;  1KD1 R;  3MEW A;  1S72 A;  2P0Q A;  3M54 A;  4LDY A;  4A4G A;  2Z0W A;  3H0F A;  1VQO Q;  2KT8 A;  4J83 A;  2QXF A;  1BI2 A;  2PUO B;  3JAM E;  3NFC A;  4Z89 A;  1W2B A;  2DIG A;  2KK4 A;  1QVG A;  2E64 A;  1SSF A;  1VQ4 T;  1FMK A;  5GMK h;  1KD1 U;  1YN8 A;  2KGT A;  1RAI B;  1KC8 R;  2VGN A;  5IN1 A;  2ZAE A;  2LX7 A;  4KH1 B;  3A98 A;  3VS3 A;  3CBM A;  1FWZ A;  5D6Y A;  1G8X A;  1PNJ A;  4XU0 A;  2CDT A;  2MYS A;  1MHN A;  4A63 B;  3I56 T;  4M7A C;  3NTK A;  5L23 A;  1VIE A;  2ATC B;  3CME A;  3I55 A;  3C0C A;  4ZN1 A;  3MJX A;  2F69 A;  5DY9 A;  4XK8 E;  1QKX A;  3JCM J;  1IRX A;  3OW2 S;  1M3C A;  2DXC A;  1UG1 A;  3CCM A;  3M0U A;  3AHU A;  3FJ5 A;  1YWO A;  1RAE B;  4M75 C;  4X9C A;  3BW1 A;  2L3P A;  1Q81 C;  4LXC A;  4Y92 A;  2YRV A;  1JJ2 P;  2GBQ A;  4QW2 A;  4R56 A;  1VQ7 Q;  2OX7 A;  1VQN A;  3L2W A;  4HVU A;  4FYW B;  1UE9 A;  2F2X A;  5LJ3 f;  3CCR A;  1SRM A;  3OSS C;  2YLC A;  4L6V 5;  4BDY A;  3RKY A;  1X2Q A;  2YSQ A;  4M77 A;  4PLI A;  2FO0 A;  3QWY A;  2KEA A;  4B9W A;  1VUB A;  3VS4 A;  4FT4 A;  2IG0 A;  2YXY A;  4ATO A;  3JB9 I;  4ME7 A;  2WSC E;  2RK2 A;  5D6W A;  3FC3 A;  1TS9 A;  3A8O B;  4LDW A;  1M2V A;  3V8J A;  1BI3 A;  2RHY A;  3OY9 A;  2HD0 A;  2O31 A;  1W2B P;  5FLX E;  4IUR A;  1YJN T;  4WTO B;  1WA7 A;  4E2F B;  4E7Z A;  4J9H A;  2RM4 A;  3QZ9 B;  4F7U E;  2DL7 A;  4HCC A;  3EGU A;  4JZ3 A;  3TQ7 P;  2QEX A;  2CH4 A;  1IGU A;  2K57 A;  1UGV A;  2X4J A;  4N4G A;  4PL6 A;  3ULR B;  4PLL A;  2V8I A;  5I11 A;  2P4T A;  3NGP A;  4LDV A;  2LRQ A;  5KCO A;  3JCM X;  1VQK Q;  2DTH A;  1NLO C;  3M0Q A;  4C8Q D;  2CUB A;  4N0A A;  1BYM A;  3H9N A;  2JTM A;  2M51 A;  1M9S A;  2LQ8 A;  4M77 B;  2XD0 A;  2RI2 A;  2HBP A;  3GNF B;  1TUD A;  4C92 F;  2YLB A;  4XTZ A;  2E6N A;  5IHK A;  1UEC A;  3CCJ A;  1QP3 A;  4LDX A;  2IIM A;  2GTJ A;  1M2V B;  1DJ7 B;  1VQP A;  2X4W A;  4PJO D;  3CD6 A;  1VQL T;  1K9M R;  2FEI A;  2YUN A;  4KUI A;  4M7D E;  3D7S B;  3LGF A;  4KT0 E;  5KCH A;  1YCY A;  2LT4 A;  1QVP A;  2J05 A;  2BE7 D;  3ZFJ A;  3TCJ A;  2PVO B;  3P8H A;  3X25 B;  1YHQ Q;  3RUX A;  2H3E B;  3VS5 A;  3LH0 A;  2DAQ A;  3G71 Q;  1UGQ B;  4XU1 A;  2LCL A;  1WJR A;  1U3O A;  2L8D A;  4XTW A;  1ZA2 B;  3LWH A;  5FW9 A;  1WHL A;  1T3L A;  2F2W A;  1QVF S;  1KSW A;  1QWE A;  1HJD A;  1N5Z A;  3OYL A;  2MWP A;  2QA4 T;  3JB9 D;  1AOJ A;  3QYH B;  1KQS A;  2Y4Y A;  2MOX A;  1XJW B;  3CCS Q;  4A4F A;  5J39 A;  1MV3 A;  5HY6 A;  4HCB A;  4HVW A;  2E3H A;  4HXJ A;  4C92 C;  2CZ7 B;  1GBQ A;  4E7H A;  4Z8A A;  1HD3 A;  2CP6 A;  4LUE A;  1EIF A;  4C5H A;  2ZPB B;  1I4K 1;  1T3S A;  4KGV B;  2L2P A;  1M2O A;  1Q81 R;  5C6S A;  3A8M B;  1YIT Q;  2G6F X;  3QUI A;  2ZPF B;  2CZ1 B;  1NLP C;  3AT1 B;  5J26 A;  2AK5 A;  2YWW A;  3O5Z A;  2P0K A;  1WPY A;  2EPD A;  1WHK A;  4M7D G;  2EQU A;  2GQV A;  1VQO A;  5D6X A;  1V1C A;  1G3S A;  3C4S A;  2B86 A;  1U06 A;  1Q81 U;  4C8Q E;  1EZZ B;  3PIP A;  1VA7 A;  1E6H A;  4DBF A;  5IXB A;  3RIR A;  1GFD A;  3HKS A;  1VQ6 T;  1KIK A;  5LJ5 d;  4M77 F;  3NPF A;  1LPL A;  1VIF A;  2P4R A;  4PFZ A;  2HL3 A;  1UGR B;  4C5I A;  2HL5 C;  4XU2 A;  3RDV A;  3M4Y A;  2LC4 A;  3H0I A;  3OB9 A;  4YTL A;  4F17 A;  2JXB A;  2RH2 A;  4DEY A;  1NG2 A;  1YCS B;  2AZS A;  3T9N A;  4J6Y A;  1PD0 A;  1M1F A;  2JMA A;  4HCZ A;  3REB B;  2KXD A;  1KQ2 A;  1AWO A;  5LJ3 j;  3EFO A;  2EGE A;  4PJO E;  2P84 A;  1KQS P;  2ROT A;  4M78 D;  3HHT B;  2JT4 A;  3RNJ A;  3L1A A;  3CMA Q;  1NBE B;  5AYF A;  3WVE B;  2ENM A;  1VOM A;  2RMO A;  3MEU A;  1GRI A;  2DA9 A;  1P92 A;  2K2M A;  2JTE A;  2GCX A;  3QII A;  2MIO A;  4DEX A;  2DTI A;  3MPU B;  4C0D B;  4QVC A;  2BKD N;  2EQK A;  2D0N A;  5LJ3 g;  1SPK A;  1MNE A;  4FM4 B;  1QVF A;  4MMK A;  2JNG A;  3QDR B;  2YUP A;  2K79 A;  3CCM Q;  3DLL A;  3FB9 A;  2EFI A;  2E6Z A;  2BZX A;  1H3H A;  5GAO n;  4AFQ C;  3EG1 A;  5HK3 A;  3GNG A;  3RER A;  1KHI A;  4RKU E;  1WHJ A;  1BI0 A;  1TU0 B;  5LJ3 e;  1OYX A;  1AWW A;  2AIR B;  2E5K A;  3FEO A;  4ZGJ B;  5I21 A;  3MEA A;  1H3Z A;  4BE0 A;  1SF9 A;  1K9A A;  3EFS A;  4ELY C;  1PWT A;  2HAX A;  4NL3 A;  5EG2 A;  5KYX A;  2OI3 A;  1Y57 A;  3A8H B;  3OSV A;  1VQ7 T;  2OAW A;  4F7U A;  3SB2 A;  4C0Z A;  4HVV A;  5CQX A;  2FB7 A;  4X34 A;  4ELZ C;  5LJ3 h;  2DL8 A;  2L3S A;  1B07 A;  3HL8 A;  2DYI A;  3E1S A;  3TVT A;  4ZNX A;  3PIO A;  2OTJ T;  1AVZ C;  4LE9 A;  1FXX A;  1ZUK A;  3A8L B;  1XTD A;  2HBW A;  3QDF A;  5LJ5 e;  1JQQ A;  4DBH A;  1IRE B;  1RAH B;  2IPO B;  3OS0 A;  1VQ5 Q;  1WGS A;  4C5G A;  2QQ9 A;  4JJD A;  4N0A C;  1SSH A;  2EJG A;  2HEQ A;  2QEX Q;  2LX9 A;  3M5A A;  4JRQ A;  3CCE A;  3BY7 A;  1VQ9 T;  1QVF P;  2LJ1 A;  2M0Y A;  2JVV A;  1QLY A;  2NUZ A;  2NUP A;  1ZSZ C;  3EG9 A;  4OVA A;  1RAC B;  4M78 E;  4RTV A;  4IUP A;  2LNV A;  2QGG A;  5KYX B;  2DD5 A;  2E3I A;  4M7D A;  2NWM A;  4M77 G;  1PD1 A;  3EH1 A;  3G71 A;  2JJ9 A;  3CC4 Q;  1VQK T;  4F7U B;  5CR2 A;  4OMM A;  3V7R A;  1UHF A;  2PVG B;  3CC7 Q;  8AT1 B;  2BUD A;  4BI3 A;  1D1B A;  2RF0 A;  1WHH A;  2V26 A;  3F70 A;  1GCP A;  1RUW A;  2LCC A;  2ECZ A;  3OA6 A;  2VAS A;  5EC7 A;  3OYK A;  3OMC A;  3QZ5 B;  1D1A A;  4M7A D;  1HSQ A;  3ZBD A;  2KRM A;  2DTO A;  1ZX6 A;  2BZ8 A;  1H92 A;  1HYO A;  2V8K A;  2HQE A;  3H0H A;  3FIF A;  4GY5 A;  5GMK l;  2RJC A;  2NUP B;  1YHQ T;  1YIT A;  2CZ0 B;  2E12 A;  3PNW C;  4IUQ A;  2E41 A;  4KGZ B;  4M75 D;  2MAM A;  2RHX A;  2XK0 A;  4MDX A;  3URG A;  2SEM A;  3S3M A;  5A0D A;  4EDU A;  1UGS B;  2XID A;  1Q95 G;  2QAZ A;  3BE3 A;  1YJW Q;  3BDU A;  2PQW A;  2ZCF B;  4N4I A;  1VQ4 A;  5GAO l;  2LQK A;  2VXF A;  4BY6 C;  3CCQ Q;  2GFU A;  3MO8 A;  1Q7Y C;  3CCS T;  3VYH B;  4C8Q A;  2H3J A;  2RQV A;  3TEE A;  3VS1 A;  4XTX A;  1BKB A;  1N6A A;  4D6W A;  1OPK A;  3KUF A;  3OQ5 A;  1G3W A;  3G6E T;  2O2O A;  4AG2 C;  3OYB A;  1SKU B;  3BDL A;  2VC8 A;  1M1G A;  5IXF A;  5FU6 B;  4LNP A;  3J81 E;  3G1J A;  2VVK A;  1PKS A;  3CMA A;  4PJO A;  3OBW A;  3JCM b;  2HKN A;  3ME9 A;  3JCM V;  2YRC A;  4J6W A;  2DMO A;  4KBM B;  1W4S A;  4CC3 A;  1KK7 A;  1N8R C;  2MPX C;  2O4X B;  1NM7 A;  2FYK A;  5CAI A;  3OYI A;  4F7U F;  1HXD A;  5GAN 7;  3OYG A;  1Y96 A;  2EYW A;  2X4Y A;  1YP5 A;  1ABQ A;  2WAC A;  2RNA A;  2VV5 A;  2YHT A;  3RR6 A;  1G3T A;  4MZP A;  2GNC A;  4JRI A;  5GAN 2;  2AHJ B;  4C8Q B;  2KXC A;  1YIJ T;  1S72 T;  4MDW A;  3UF4 A;  1GCQ C;  4ESR A;  3CPW S;  1RLP C;  3PT9 A;  1FMW A;  1TSF A;  2ESW A;  2L89 A;  4XQ3 A;  3OMG A;  5A0L A;  5GAN 6;  1QWF A;  1OZ2 A;  4KGX B;  4MZM A;  5J3B A;  5L8R E;  3VS7 A;  1AHJ B;  3HP9 A;  2J06 A;  3L2Z A;  2PVD B;  5CKH A;  2MMP A;  2ZGW A;  2MCN A;  4F04 B;  2M0O A;  2EGC A;  2K4Y A;  3A1P A;  1Q82 C;  1FMV A;  4M75 E;  4PJO B;  1YNZ A;  4M7D F;  2QAS A;  3CME T;  1BBZ A;  3I55 T;  3MP8 A;  3VV0 A;  2D8J A;  5CKF A;  1TG0 A;  2KRO A;  4QT7 A;  2ZPG B;  3V7C A;  4BI4 A;  1BK2 A;  4E47 A;  1Y96 B;  4DBQ A;  3G4S Q;  2X51 A;  3CCM T;  4BE1 A;  2K2V A;  1QQJ A;  2R57 A;  2LJ3 A;  2DL4 A;  1OV3 A;  5GAN 3;  1VQ5 A;  3EGD A;  2QQS A;  4OMP A;  2A0F B;  2MI6 A;  5LJ5 f;  1VQN T;  1JBM A;  1K0X A;  3REA B;  1IB8 A;  2HDA A;  1BCO A;  2LT1 A;  3CCR T;  2CP2 A;  2I0N A;  4C92 D;  3HFN A;  4E7S A;  4F14 A;  4ANJ A;  1AZE A;  2DXU A;  5KE2 A;  2C06 A;  2EYX A;  3PVQ A;  1RAG B;  5FWB A;  2EVR A;  5CKE A;  2RHI A;  4RCC A;  3EG0 A;  2NYS A;  3P8D A;  4M78 A;  4C0G A;  4MZT A;  2VYT A;  3CC4 A;  2QGF B;  3VRY A;  3QSU A;  3X24 B;  1WHM A;  2J7I A;  5GAM d;  3CC7 A;  3CCE Q;  2CZ6 B;  2PUK B;  1JRI A;  1YJ9 Q;  4M7D C;  1J3T A;  1R0C B;  2MF2 A;  2ED0 A;  2IVW A;  2AKK A;  1Q7Y R;  2RHZ A;  2L5Q A;  3OW2 A;  3S3O A;  3CCV A;  2JS0 A;  4V2S A;  1RAD B;  2J6F A;  2QA4 A;  1UB4 A;  3M0P A;  4QQG A;  3X20 B;  2DZ9 A;  2DK3 A;  2LDM A;  2F2V A;  1UJY A;  3GPL A;  2QYZ A;  1MMG A;  3S3N A;  1UUE A;  2YDL A;  1KQ1 A;  3CQT A;  2OAU A;  1SHG A;  3UWN A;  1M27 C;  4C8Q F;  2JW4 A;  3EGD B;  1TUG B;  4RUG A;  3UDC A;  3CPW A;  2CYZ B;  2KMT A;  1HK9 A;  3QBY A;  3RBB B;  1Q7Y U;  4OGE A;  4Z88 A;  1JXM A;  3UPU A;  4WF2 A;  1MGQ A;  2OTL Q;  1OPL A;  3CC2 Q;  2RA2 A;  1MUZ A;  1QCN A;  1R8O B;  4BB7 A;  4F7U G;  3OYH A;  1OU9 A;  1Y07 A;  1U5S A;  1PHT A;  4EMK B;  2KBT A;  4JLG A;  5CO7 A;  2E5Q A;  1VQM A;  2HCK A;  3M9Q A;  3EH2 A;  1N8R R;  4NOY A;  4PJO F;  4JZ4 A;  2EJ9 A;  4M78 B;  2DYB A;  3CCJ T;  1OUL A;  3X28 B;  3OYA A;  1UHC A;  3E9F A;  2KQW A;  1YJW A;  1W1F A;  1VQP T;  3CD6 T;  2XDP A;  1OOT A;  4FYX B;  3CCQ A;  3PVL A;  1N8R U;  2CGH A;  2DJQ A;  2COZ A;  3HFO A;  3S6W A;  3M58 A;  1SRL A;  3SWN A;  4DA4 A;  1XOV A;  3JCM c;  3C94 A;  1WXU A;  2DIQ A;  3JB9 F;  3R6O A;  1NEG A;  3VS6 A;  4ORZ A;  2VUB A;  1MMA A;  3QG1 A;  5KH6 A;  3OW2 P; 
#chains in the Genus database with same CATH homology
 3SEM A;  3TVT A;  4ZNX A;  4OML A;  1AVZ C;  1WDX A;  4LE9 A;  3EHQ A;  4CC7 A;  1ZUK A;  2HBW A;  4KRT A;  1JQQ A;  2O9V A;  1SHF A;  2EQI A;  4JJC A;  4M4Z A;  2K9G A;  2KYM A;  4AFZ C;  4RTY A;  2RQR A;  4RTX A;  3TSW A;  4RTZ A;  3UA6 A;  2CT3 A;  4JJD A;  1AEY A;  1SSH A;  2HEQ A;  2XMF A;  2L0A A;  1WXT A;  3ZL7 C;  3H0F A;  1CSK A;  1AZG B;  2KT8 A;  3VS2 A;  1X6B A;  2LJ1 A;  2M0Y A;  4IIM A;  4Z89 A;  1QLY A;  2NUZ A;  1CKA A;  2A37 A;  4J9I A;  2DRM A;  2RQU A;  1FMK A;  2H8H A;  1YN8 A;  4RTV A;  2KGT A;  1YWP A;  3THK A;  5IHN A;  2YUO A;  2LX7 A;  3VS3 A;  3A98 A;  3TSZ A;  1NEB A;  2PNI A;  1PNJ A;  1K0S A;  2CDT A;  2NWM A;  4A63 B;  5L23 A;  2D8H A;  5I22 A;  2X3X D;  3C0C A;  1K4U S;  4OMM A;  1UHF A;  3EHR A;  5GJW B;  1QKX A;  2EYY A;  1PRL C;  2RF0 A;  1M3C A;  4RTU A;  1UG1 A;  3M0U A;  4FSS A;  4HCK A;  3EG2 A;  3FJ5 A;  1YWO A;  1GCP A;  1RUW A;  1JU5 C;  3IQL A;  2L3Q A;  2ECZ A;  2L3P A;  2C0I A;  5EC7 A;  2YT6 A;  4Y92 A;  1HSQ A;  1ZSG A;  2GBQ A;  4LN2 A;  3SHW A;  4JPB W;  2KRM A;  2LJ0 A;  1VYV A;  1ZX6 A;  2BZ8 A;  1H92 A;  1UTI A;  2K6D A;  4HVU A;  2BTT A;  2FRW A;  1UE9 A;  2F2X A;  1QKW A;  1SRM A;  2DL3 A;  1MV0 B;  2EBP A;  2LMJ A;  4D8D A;  3H0H A;  1X2Q A;  1Z9Q A;  2YSQ A;  3M0T A;  3KFV A;  4J9G A;  4OMQ A;  2FO0 A;  3QWY A;  2KEA A;  1X6G A;  1RLQ C;  2A28 A;  3VS4 A;  4F16 A;  1ZLM A;  2SEM A;  2DRK A;  4GBQ A;  2O31 A;  2LQW A;  3PE0 A;  1AWX A;  1IO6 A;  2EGA A;  1WA7 A;  4J9H A;  4IIO A;  2DL7 A;  1WXB A;  3EGU A;  2RQV A;  4JZ3 A;  2FPF A;  5ECA A;  1G83 A;  3VS1 A;  2CH4 A;  1WI7 A;  2DNU A;  1UGV A;  1A0N B;  2LZ6 B;  3ULR B;  1GFC A;  2GQI A;  3GBQ A;  1QCF A;  5I11 A;  2C0T A;  2RPN A;  3NGP A;  1OPK A;  4J9B A;  2O2O A;  4AG2 C;  1AD5 A;  5IXF A;  1NLO C;  3M0Q A;  2BZY A;  2CUB A;  1X2K A;  2DF6 A;  2EYZ A;  2FPE A;  2M51 A;  4LNP A;  1WIE A;  2VVK A;  3I5R A;  1PKS A;  1NYG A;  2CRE A;  1JO8 A;  1TUD A;  2DMO A;  4CC3 A;  4J9D A;  3U23 A;  1H8K A;  2O88 A;  1NM7 A;  1M8M A;  1K76 A;  5IHK A;  1UEC A;  1BU1 A;  1VYT A;  3LH5 A;  1BB9 A;  2IIM A;  2VWF A;  2EYW A;  2GTJ A;  1VYU A;  3NHN A;  1YP5 A;  5IH2 A;  1ABQ A;  1CKB A;  2PZ1 A;  2RNA A;  2KT1 A;  2D1X A;  2DBM A;  2FEI A;  2YUN A;  1PKT A;  1UFF A;  2C0O A;  3H41 A;  2J05 A;  2GNC A;  2KXC A;  2GGR A;  3VS5 A;  2A08 A;  2YUQ A;  2JM9 A;  1GBR A;  1X69 A;  4CC4 B;  3UF4 A;  1GCQ C;  1FYN A;  4ESR A;  1RLP C;  1U3O A;  1Y0M A;  2KR3 A;  4X1V A;  2ESW A;  2EKH A;  2FPD A;  1WFW A;  5FW9 A;  2RN8 A;  4AFU C;  1WYX A;  2W0Z A;  2F2W A;  1T3L A;  3UAT A;  1QWF A;  1M3B A;  1KJW A;  1UDL A;  2KNB B;  3VS7 A;  1KSW A;  1GCQ A;  1QWE A;  2J06 A;  1HJD A;  4RTW A;  1N5Z A;  2DLP A;  2MCN A;  1AOJ A;  4WCI A;  3I5S A;  2MOX A;  2DBK A;  2EGC A;  2JM8 A;  1I0C A;  1MV3 A;  1ZBJ A;  4JJB A;  1ARK A;  1YNZ A;  1BBZ A;  1ZUY A;  3M0S A;  2D8J A;  1TG0 A;  2KRO A;  4HVW A;  3I9Q A;  4QT7 A;  2PTK A;  4HXJ A;  2DL5 A;  1BK2 A;  4OMN A;  1GBQ A;  4Z8A A;  1HD3 A;  3R6N A;  4LUE A;  2A36 A;  2SRC A;  1X27 A;  1T3S A;  2V1Q A;  2L2P A;  2LJ3 A;  2DL4 A;  3M0R A;  2G6F X;  1OV3 A;  4J9E A;  4OMP A;  2JS2 A;  1NLP C;  2VKN A;  1UJ0 A;  4E6R A;  2AK5 A;  4RTT A;  2X3W D;  3O5Z A;  2DE0 X;  2EPD A;  1K0X A;  2ABL A;  3REA B;  2LNH B;  2HDA A;  2W10 A;  1V1C A;  2I0N A;  1TUC A;  2B86 A;  4F14 A;  1U06 A;  1AZE A;  1VA7 A;  1E6H A;  5IXB A;  2K3B A;  4R0K A;  1GFD A;  2AZV A;  3NMZ C;  1B3Q A;  2EYX A;  3PVQ A;  4GLM A;  2DM1 A;  1KIK A;  1M30 A;  3NPF A;  5FWB A;  2P4R A;  2EVR A;  1T0J A;  3EG0 A;  3H0I A;  1T0H A;  4F17 A;  2EW3 A;  1OEB A;  2LQN A;  2JXB A;  4DEY A;  3VRY A;  1NG2 A;  1YCS B;  2AZS A;  1Z9Z A;  2J7I A;  1X43 A;  2ED1 A;  2CSI A;  2JMA A;  3EG3 A;  1J3T A;  3REB B;  2KXD A;  2ED0 A;  1AWO A;  2AKK A;  2EGE A;  1G2B A;  1GL5 A;  2JS0 A;  2RQW A;  1H3H A;  2J6F A;  3M0P A;  2ROT A;  4J9C A;  2CH4 W;  2JMC A;  2JT4 A;  2F2V A;  1UJY A;  3RNJ A;  2QDL A;  1UUE A;  2YDL A;  3I35 A;  3CQT A;  1LCK A;  1SHG A;  2ENM A;  2RMO A;  1M27 C;  1GRI A;  2JW4 A;  2DA9 A;  1E7O A;  2J6O A;  1SEM A;  4RUG A;  2K2M A;  2JTE A;  2MIO A;  4DEX A;  3RBB B;  4AG1 C;  1K1Z A;  4Z88 A;  1JXM A;  2HSP A;  4EIK A;  1OPL A;  1M3A A;  1MUZ A;  2J6K A;  4CC2 A;  2D0N A;  1SPK A;  3JV3 A;  2KRS A;  2FRY A;  5FWC A;  1U5S A;  2YUP A;  2K79 A;  5IHI A;  1PHT A;  2CT4 A;  2LCS A;  1AWJ A;  1ZUU A;  2KBT A;  1KFZ A;  1JXO A;  2BZX A;  2HCK A;  4AFQ C;  3EG1 A;  2CSQ A;  1ABO A;  4OMO A;  4JZ4 A;  3QWX X;  2ROL A;  4AFS C;  2DYB A;  1W6X A;  1AWW A;  4K11 A;  1UHC A;  1PRM C;  2E5K A;  2DX1 A;  2O9S A;  1EFN A;  2KE9 A;  1W1F A;  1K9A A;  1OOT A;  1PWT A;  2KYB A;  3PVL A;  2CUD A;  2DJQ A;  2KRN A;  2OI3 A;  2K7A A;  2OJ2 A;  1SRL A;  2FG0 A;  1S1N A;  1Y57 A;  1XOV A;  4LUD A;  1I07 A;  4D8K A;  1NYF A;  1WXU A;  1E6G A;  1WLP B;  2OAW A;  1JEG A;  1WX6 A;  3VRZ A;  2AKL A;  3UA7 A;  1NEG A;  2DVJ A;  4HVV A;  1W70 A;  3VS6 A;  4ORZ A;  1I1J A;  2V1R A;  2LP5 A;  4J9F A;  2DIL A;  2DL8 A;  2GTO A;  2L3S A;  5GJV B;  1B07 A;  2RQT A;  3VS0 A;  5HCK A;  1RI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...