3M0SA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'KELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0sA00
1I07A 2K9GA 3R6NA 2KE9A 1QWFA 2BTTA 2EYYA 3M0TA 3EG2A 1ZSGA 1K4US 1M3AA 2P4RA 4JPBW 4QT7A 3NHNA 3EG3A 1HSQA 1PKSA 1MUZA 2KR3A 1KIKA 2A28A 4OMNA 2CT3A 2JMCA 2EQIA 2BZXA 3NGPA 4LN2A 1OEBA 2L0AA 2C0OA 2VVKA 1E7OA 3KFVA 1SRMA 4RTWA 2CSQA 1A0NB 4F16A 2RMOA 2JS2A 2HCKA 1Y57A 1SHGA 1YWOA 5IHNA 1LCKA 1H3HA 2D1XA 4J9BA 4OMQA 4GLMA 4R0KA 2GQIA 1AWWA 2DVJA 2JT4A 4HVWA 2B86A 2KXDA 2O88A 2JW4A 2LJ1A 2RNAA 1AOJA 1SEMA 4J9GA 5IXBA 1GL5A 2X3WD 2CH4W 3IQLA 2YUNA 2NUZA 2DBKA 2OAWA 1RLPC 1KFZA 1AWJA 2NWMA 4AFQC 5I22A 1WXBA 2DRKA 3H0IA 3RBBB 1K76A 4Y92A 2LCSA 1H92A 4RTXA 2KXCA 2GNCA 1T3SA 2BZ8A 2CREA 4OMOA 3VS0A 2O9VA 2A36A 1M27C 1W70A 4LUEA 2KRMA 1UECA 2DYBA 4HCKA 2D8JA 1IO6A 5ECAA 1JQQA 2M0YA 2DMOA 2VKNA 2O2OA 1Y0MA 1RI9A 1WI7A 2RQVA 4RTZA 2PNIA 2KRNA 2LQNA 1QKXA 3UA6A 1NLOC 2PTKA 2E5KA 1TUDA 2JXBA 1WA7A 3TSWA 2V1RA 1WLPB 1JEGA 1M3BA 1ABQA 1AD5A 4HXJA 1TUCA 1ZUUA 4D8KA 4AG1C 2ABLA 3U23A 3VS6A 2M51A 2QDLA 2KYBA 2DA9A 4M4ZA 3I5RA 2FPEA 2JS0A 1ZBJA 4RTTA 2L3SA 4JJCA 1MV3A 1PRMC 3ULRB 4AFZC 2LQWA 4RTVA 1SPKA 4CC4B 2XMFA 1UHCA 3FJ5A 3LH5A 3M0PA 2K3BA 5FWBA 2RPNA 4IIMA 2H8HA 1V1CA 3I9QA 4ESRA 1WXUA 2O9SA 4A63B 5FW9A 1ZX6A 1GCQA 1RUWA 2ROLA 2FEIA 3SEMA 2LP5A 2KBTA 2GTJA 2SEMA 1G83A 1GFCA 3H0FA 2DL3A 1B3QA 2DL4A 1TG0A 1WX6A 1KJWA 2EYXA 2GBQA 2D0NA 1BBZA 4Z8AA 2A37A 2EPDA 1X69A 2OI3A 2W10A 1UHFA 1OV3A 4ORZA 2RQRA 5GJVB 5HCKA 2RN8A 1NLPC 1VYTA 3TVTA 1UTIA 1X2QA 2LJ0A 4HVVA 2GTOA 1E6HA 4EIKA 2KYMA 1BU1A 4RUGA 3THKA 1N5ZA 1FMKA 2LX7A 3SHWA 2HEQA 2DL8A 1BK2A 4FSSA 1YCSB 2DE0X 1QKWA 4AG2C 4LUDA 4JZ3A 2CSIA 4F14A 3REAB 1ZUYA 3I5SA 4JJDA 1VA7A 2F2XA 1OPKA 1B07A 1U3OA 5IXFA 1U06A 5FWCA 1T0JA 2ROTA 2EW3A 3CQTA 1G2BA 4ZNXA 2C0TA 3H41A 2DL5A 1J3TA 1YP5A 3H0HA 4J9HA 2SRCA 4JZ4A 1K9AA 1MV0B 1NEGA 1ARKA 3PVQA 1AEYA 1Z9QA 2RQUA 2GGRA 1KSWA 1RLQC 5EC7A 2MOXA 1YNZA 5IH2A 1ZUKA 2DBMA 1I1JA 4RTUA 3EHRA 3VS5A 2JTEA 1PRLC 1BB9A 1T3LA 2CT4A 4J9IA 2W0ZA 4KRTA 2LMJA 5I11A 2F2VA 1PHTA 1JXOA 2LNHB 5GJWB 1NYGA 3VS3A 4DEYA 1AWOA 2DRMA 5IHIA 2EYWA 2G6FX 1U5SA 4RTYA 1WDXA 1NM7A 2DJQA 2YUQA 2AK5A 3VS4A 2DL7A 4Z88A 2J05A 1M30A 2HDAA 3JV3A 5L23A 3VRZA 1PNJA 4J9DA 2KRSA 1UUEA 2FPFA 2KT1A 1NEBA 2CUDA 4LE9A 1PKTA 3C0CA 2MCNA 1OOTA 2J7IA 2LZ6B 1M3CA 3M0QA 3QWYA 1X6BA 2KEAA 3A98A 2MIOA 4X1VA 2D8HA 2EGEA 2CH4A 1SRLA 2DNUA 2A08A 2VWFA 3NPFA 3ZL7C 4F17A 3UF4A 2JM9A 1VYVA 1GFDA 3M0SA 2AZVA 1H8KA 2OJ2A 1W6XA 1K0SA 2FO0A 2KT8A 2RQTA 2L2PA 2K2MA 1AVZC 1EFNA 2JM8A 4CC7A 1UE9A 1X6GA 3VS2A 1ABOA 1VYUA 2EGAA 4LNPA 4CC2A 1QCFA 3QWXX 4J9FA 4DEXA 2FG0A 1HJDA 1CKAA 3VS1A 4OMMA 4JJBA 4E6RA 2IIMA 3UATA 1AWXA 4J9EA 4J9CA 2C0IA 2F2WA 2CDTA 1X2KA 2CUBA 4GBQA 4HVUA 4AFSC 2PZ1A 1OPLA 1K1ZA 2L3PA 2DM1A 3TSZA 2J6OA 1HD3A 1K0XA 1YWPA 2ED0A 3VS7A 4IIOA 3EHQA 3M0UA 2AKKA 3REBB 2EVRA 3RNJA 1AZEA 4AFUC 1WFWA 1E6GA 1JO8A 2O31A 2KNBB 2FPDA 2YSQA 1FYNA 3I35A 2K7AA 1WIEA 1SSHA 5IHKA 2K79A 4Z89A 1I0CA 2LJ3A 3UA7A 2V1QA 1UG1A 2KROA 2JMAA 2YDLA 1NYFA 1JXMA 1GRIA 1M8MA 1QLYA 1WXTA 3M0RA 1NG2A 1AZGB 1UGVA 2J06A 2RF0A 4CC3A 2HSPA 1QWEA 1UJ0A 1UJYA 2AKLA 1S1NA 2ECZA 3NMZC 1XOVA 1GCQC 3EG0A 3EG1A 1GCPA 2J6FA 3EGUA 1JU5C 2ED1A 1X27A 2DLPA 3PE0A 3VRYA 2YUPA 2J6KA 1Z9ZA 1WYXA 3PVLA 2K6DA 1X43A 2FRWA 4OMLA 2BZYA 2EGCA 4WCIA 2RQWA 2ENMA 2DF6A 2EYZA 1CSKA 4OMPA 1GBRA 3O5ZA 2YT6A 2AZSA 2EBPA 3GBQA 1SHFA 2FRYA 1UFFA 4K11A 1YN8A 2I0NA 2HBWA 2DILA 4D8DA 2YUOA 1T0HA 1CKBA 2ESWA 2DX1A 1PWTA 1GBQA 1UDLA 2EKHA 1W1FA 2X3XD 2KGTA 2L3QA 1ZLMA
chains in the Genus database with same CATH superfamily
1I07A 3HPWA 3R6NA 3I56T 1ZQ1A 5IT9E 2JZ2A 4JRKA 3OYCA 4E7HA 4JPBW 3EGXB 3CCMT 1OQKA 5CO7A 5LJ5f 2HMAA 1TWBA 4EMGA 5CCAA 2DXUA 2CT3A 1UEBA 2JMCA 2EQIA 2BZXA 4HCCA 1NZ9A 5GAN8 3CCJT 2EIFA 2C0OA 4FL6A 1SRMA 2CS7A 1G8XA 3TCJA 2RHUA 2RMOA 5KYUB 4YTLA 3X25B 5IHNA 1QCOA 4UC4A 5FLXE 4OMQA 4Z02A 5GMKm 1AWWA 4XU3A 4J6XA 1N8RR 2ZPFB 2E4HA 2X35A 2KXDA 1G3TA 2RNAA 2QQBA 3CCLT 4J9GA 5IXBA 2RJCA 1TSFA 3IQLA 1MMGA 5CKEA 1VQ7T 1RL2A 3HSBA 1RLPC 3E9GA 4JUVA 4Y28E 1KFZA 2AT1B 2QA4T 4L59A 1YJNQ 4PJOA 4E7SA 2I2LA 5I22A 5HK0A 3NTIA 1K9MR 3H0IA 4MDXA 1K76A 2OTLT 2LCSA 1Y96A 4RTXA 5GANd 2GFUA 4OGCA 5LJ5d 3LH0A 2DO3A 2GQVA 4HT9A 1TU0B 4LUEA 2KRMA 4J6WA 2DYBA 3FIFA 4FYWB 2D8JA 2R5MA 1IO6A 4M7AG 1LVKA 3G6ET 3P8BB 2O2OA 1RI9A 1WI7A 2LC4A 1VQOQ 2WACA 2YWWA 1NLOC 4DBQA 2NUPA 3A8GB 1YHQA 1WA7A 3PGGA 4C0ZA 1M90U 3X28B 1JEGA 3QSUA 5I2MA 1BCMA 4C92E 2ABLA 3VS6A 1VOMA 2QDLA 2FB7A 4F7UE 2DA9A 3QIIA 4M4ZA 2PUKB 3QBYA 1I4K1 2HAXA 3GIBA 2XG8D 3G1JA 2K3XA 2QGFB 4N4GA 4AFZC 5DY9A 4RTVA 3JCMJ 3BFMA 3FJ5A 3LH5A 4C8QB 1G5VA 5GANj 5LJ5h 4AT1B 4V2SA 2K3BA 3GLXA 2RPNA 1N9RA 5J39A 3QO3A 3QG1A 2ROLA 2HL3A 5L8RE 3OS0A 3FDRA 2KBTA 3V8KA 1G83A 3RKWA 1M5Q1 2DL4A 2X4XA 1KJWA 3RUXA 1BBZA 2A37A 2L89A 2W10A 2LRQA 5D6YA 1YJ9Q 3M4GA 3QJ6A 3GOXA 1B34B 2RQRA 2L5QA 1OZ3A 1I5OB 2RN8A 1YFNA 1ZSZA 1SKUB 5DM7R 4M77E 1PCXA 2GTOA 2DXTA 2EJFA 4A4FA 1MNDA 4BI3A 2MF2A 4MDWA 4ZN3A 1Y7XA 3EG9B 3RESA 1TOVA 1KG1A 2CZ0B 2MWPA 2VGMA 2CSIA 4F14A 3REAB 1WQWA 3OQ5A 3ZBDA 1VQLA 2QQ9A 3AHUA 4GY5A 2QQRA 3SB2A 4CRIA 5IAYA 4E7JA 1U06A 5FWCA 9ATCB 1T0JA 4C92D 5EG2A 1VQMA 1Q81R 4ZNXA 5KH6A 2C0TA 1YP5A 2DD5A 1ACMB 1I5LA 1K9AA 2F1LA 1BYMA 2HQHA 1KSWA 1MGQA 4M7DA 2DTHA 1WQ7A 4C92B 1I1JA 1YIJT 3QZ5B 3G71T 4F7UB 1QVGA 1OI1A 1PRLC 4EMHA 2CT4A 4M75G 4N0AA 1G3WA 3HTRA 1M90C 1VQ8T 4X34A 2K3YA 4P5NA 3QJYA 4DEYA 1KQ2A 3UPUA 2E6NA 2F5KA 2JJ9A 4DBRA 1Q82R 2PUOB 2RJEA 3ER0A 4RTYA 3P8HA 5DLQE 3J80E 2R57A 2DL7A 4Z88A 5LJ3e 5GANg 3CCET 4M77D 1HYOA 4PFPA 5LJ5g 5L23A 2KRSA 1I8FA 3C0CA 1QVGP 1TS9A 2MCNA 2J7IA 2L3RA 1YHQQ 3QWYA 1KHCA 4PFZA 1SRLA 2VWFA 2A08A 4NOYA 3NPFA 4J8OA 4F17A 2RK2A 3NTKA 3L2ZA 3M0SA 4XAXB 4FSXA 2QASA 4XU0A 1D3BB 4M77B 2KT8A 3LX7A 5CKDA 1IB8A 4DA4A 3JCMW 1UE9A 3V7SA 1GXIE 4M78G 1ABOA 4IUTA 4CC2A 2LT4A 1QCFA 3QWXX 1CKAA 2A7YA 4C8QG 2XD0A 4E6RA 4R55A 2KDSA 2IIMA 3UATA 1D1BA 5CKFA 4J9EA 3JB9F 2JVVA 2C0IA 2DEQA 2Z0WA 4GBQA 4HVUA 1VQ9T 2PZ1A 1AHJB 1K1ZA 3CMET 3TSZA 2HBPA 2X9HA 1YWPA 1M8VA 1YJWT 4ELYC 3A8OB 1WFWA 2XICA 1JO8A 5CIUA 2FPDA 3MHXA 2YSQA 1VQNT 2CYZB 4NL2A 2MPXC 2MYSA 3GPLA 1YITT 4ME7A 4F7UF 2COYA 2M9UA 2O01E 4BE0A 1YI2T 2K79A 1I0CA 2XK0A 3UA7A 2V1QA 2HD0A 1WHMA 5HY6A 1JXMA 2NUPB 1WXTA 3M0RA 3S6WA 1NG2A 1UGVA 2J06A 3QYGB 5FU7C 2XDDA 1UJYA 2P0PA 3V7CA 2AKLA 1D09B 3A8LB 2EKOA 3QPHA 5GAN7 4A4HA 4J6YA 2DK3A 4FCYA 3L2QA 2DLPA 2RJDA 1VQMQ 3LWHA 1Z9ZA 2RA2A 2DPPB 1OX9A 4JS5A 4LDVA 3L2VA 4WCIA 3X20B 2DF6A 2XDPA 1CSKA 4OMPA 1GBRA 1BIBA 2RO0A 1AT1B 5KE3A 4M77F 1KD1U 4K11A 3HHTB 2LQ8A 1CKBA 1KQ1A 2DX1A 1PWTA 2EKHA 1VQ5A 1O75A 2L3QA 1ZLMA 2ZPGB 1K73R 2YRDA 3ASKA 2F5TX 2BTTA 4XK8E 3M0TA 1TUGB 5D7UA 3KUFA 2X4YA 2P4RA 2EAYA 4C8QA 3META 2XU8A 3QUIA 3NHNA 1C1AA 4OMFB 2KR3A 2QQSA 1YJNA 4CI0C 1KIKA 1BI0A 2A28A 4OMNA 1MMDA 2WSEE 3KFVA 2OTJT 4RTWA 2RHYA 2QK0A 3OYFA 1Y57A 1RAIB 4LXCA 3N5BB 5C0MA 1VQ6T 4XTVA 2HL5C 2D1XA 4J9BA 3VV0A 4OGEA 2GQIA 2CP5A 3S3OA 3JB9H 4IUVA 4LDUA 5GAOm 3CPWA 4BI8B 1B34A 1AOJA 3OMCA 4EMKC 1FMVA 1K8AU 3OYBA 2OTLA 3D7SB 2CH4W 1RAGB 4J7FA 1M4ZA 1N27A 5J26A 3OYMA 3DKMA 5CKHA 4RKUE 2NYSA 8AT1B 2ZPBB 3QHSA 4AFQC 3CD6Q 1M1KU 2DRKA 2HKQB 3EG9A 4QKUA 1H92A 4Y92A 3NTHA 3JAME 1X75C 1SG5A 4OMOA 2A36A 4PJOG 1IRXA 4HCKA 3HL8A 2CP0A 5C6SA 2DMOA 2VKNA 4BD3A 3OS2A 2RJFA 4XQ3A 2LQNA 2QI2A 2PTKA 2E5KA 1QMCA 5CK9A 5LJ3d 1WLPB 1KC8U 4R56A 2DTOA 2RHXA 4C92A 4D8KA 4FIBA 4JJNK 4A53A 4C0DB 4F7UA 4D6WA 1YJ9A 2KYBA 4XTXA 2FHDA 4FM4B 4JJCA 2QEXT 4JRIA 1PRMC 3CMAT 3RDVA 2P84A 3C94A 4DOVA 2LQWA 4X9DA 1KD1C 4AMCA 1SPKA 4CC4B 2X51A 1UHCA 1OU8A 4B9WA 4ZN1A 3M0PA 4OB0B 5FWBA 3NFCA 3CXCS 4LD9K 4BY6C 2ZCFB 2H8HA 5GANf 2RI3A 3I55Q 1WXUA 3SEMA 2Y4YA 1VQKQ 5FRNA 1TG0A 1BIAA 2D0NA 3M53A 4PJOC 2EPDA 1QVFA 1X69A 4RG2A 1VIEA 5FU6C 3I56Q 1WGSA 2RD1A 1WZOA 5LJ3j 2AHJB 2FL7A 1NLPC 2FYKA 3M57A 1RAHB 5FRMA 3CCMQ 1D3BA 3HKSA 1F1BB 1ZHIA 2KMTA 4M77A 2YXYA 1VQPT 1VQ5Q 1IHWA 3HRTA 4HVVA 2MMPA 1PM3A 3THKA 1KK7A 1N5ZA 2LX7A 3SHWA 5J3BA 2E5QA 2M0OA 1K9MU 1K8AC 4FSSA 1YCSB 2DE0X 4MMLA 2YHTA 3VUZA 2LT1A 3V8LA 1QVFP 1OPKA 3VYGA 1B07A 1UB4A 2AIRB 3L1AA 1G2BA 2RH2A 1M1KC 2MI6A 3FJPA 3H41A 5GAMe 4II1A 3CCST 4JZ4A 2D9TA 1MV0B 1NEGA 2KQWA 1ARKA 1M1FA 3PVQA 2QA4Q 3CC4A 1JRIA 2H3JA 1V29B 2GGRA 4C5IA 2CP2A 5KYYB 2OTLQ 1C0MA 2MK5A 2CP6A 2MOXA 3AT1B 1ZUKA 2DBMA 5DLOA 2PVDB 1M2VA 4FW2A 1YCYA 2WSCE 4M7DG 1WHKA 3G6EQ 4FT2A 5I11A 3L42A 1KC8C 1JBMA 4FT4A 1JXOA 3VS3A 1NYGA 4KT0E 2DRMA 3PMTA 2P0QA 2JNGA 2G6FX 4C5GA 5FU7B 2IVWA 3CCUT 2DJQA 2YUQA 3VS4A 5GANh 1ZA2B 2J05A 2QAZA 1M30A 2HDAA 5CR2A 1M90R 4HCZA 1PNJA 1UUEA 3SWNB 5A0GA 4L5GA 1P92A 1NEBA 2CUDA 4LE9A 2DERA 1NPPA 4NL3A 4JS4A 1JJ2A 3V8JA 2MIOA 4X1VA 3T9NA 4KULA 2JM9A 1VYVA 1GFDA 2AZVA 4PLLA 1H8KA 2KSSA 1W6XA 1M1GA 2P0KA 4M7AC 1AVZC 1EFNA 2JM8A 2JTFA 5LJ3g 2RM4A 4CC7A 2K5IA 1QP3A 2R58A 2X4JA 3VS2A 3MEVA 2G3RA 2CZ7B 4BI4A 1XJWB 2FG0A 3JB9D 2QTVA 3VS1A 4JJBA 4J9CA 3RKYA 3EFRA 2PQWA 1Q81U 2AKKA 1K9MC 2EVRA 3RNJA 1NJIR 2JUFA 1E6GA 3S3NA 1RI0A 2O31A 4FYXB 1FYNA 4FYVB 3L2WA 6AT1B 1WIEA 1W2BA 1SSHA 1X6OA 5IHKA 1MNEA 3PNWC 3HP9A 3JCMV 2JMAA 2BE7D 1NYFA 1SSFA 2RF0A 3OA6A 4EMKB 3DLMA 3MP8A 3CC2A 2GFAA 1S72A 1D1AA 4IUUA 1S1NA 5M9OA 1GCQC 2COZA 2RK1A 3EG1A 3EGDB 5GMKi 4N4IA 2ZPHB 3EGUA 4E7IA 2ED1A 3HRUA 1X27A 1DJ7B 2YLBA 3M56A 4JRPA 3FB9A 3VRYA 5KCHA 2YUPA 3JCMd 2HSEB 2K6DA 1X43A 2RHIA 1W2BP 2K5FA 3CC7A 5GAOn 1YIJQ 2BZYA 2EFIA 3G71Q 4QVCA 1H641 2DIQA 4C5HA 2RQWA 3ME9A 4LDWA 4RG8A 3CC4Q 2EYZA 4JLGA 1G3SA 3CCQA 2COWA 2KAFA 2FRYA 2I0NA 1VQ8Q 1YHQT 3CCRA 1T0HA 2ESWA 1BI2A 2CP3A 1UDLA 2K9GA 2KE9A 3OYJA 3OW2A 5FROA 1QWFA 2EYYA 2OTJA 1MMAA 3EG2A 2E41A 3TU4K 4A54A 2DVEA 1M3AA 2QYZA 3P8DA 1PKSA 1VIFA 3RMQA 1OX8A 4PJLA 3CD6A 3M4YA 1OEBA 2L0AA 1VQ4A 2VVKA 1E7OA 2Y90A 2CSQA 4OB3B 4F16A 3FLGA 4PJOD 2JS2A 1SHGA 1YWOA 4M75C 1LCKA 2FVUA 4E47A 1V76A 4GLMA 3H8ZA 2BIVA 2DVJA 2FZGB 1QW1A 2E64A 2LJ1A 3HFNA 4EDUA 4XTUA 1SEMA 1YBYA 3OW2P 2RI5A 1GL5A 1UGRB 4PFOA 4ANJA 2E1HA 5GAMd 1Q81C 1OULA 2YUNA 3BE3A 2DBKA 2JN0A 2FZKB 1WHJA 3CMEQ 3A8HB 4XU1A 2DKGA 3MKDA 1WXBA 5KYWB 1NPRA 2KXCA 1M2VB 2GNCA 4M7AE 3QXEB 1QVGS 3VS0A 4IURA 4HCBA 4C0FA 1JB0E 1HXDA 3GNGA 3M54A 2DAQA 5GAOr 1UECA 2KVQG 3JCMc 1YITQ 3VYHB 1VQLT 2CZ6B 2VYTA 3EAEA 2DD4A 3CCVA 5A0LA 1VQMT 4E7LA 1Y0MA 4M78C 4RTZA 3I55A 3OYEA 2KRNA 3LLRA 1XQHA 1QKXA 1Y07A 2PU9B 2DIGA 5LJ5e 4C8QC 4OP0A 1U1TA 2JXBA 3TSWA 3KXTA 2V1RA 1VQKA 2EYQA 5KYYA 4RMOA 1MMNA 3FEOA 1TUCA 2VXEA 1ZBXA 4J5YA 5GAMj 3I56A 1C6VX 1D1CA 1WHHA 3I5RA 2FPEA 2JS0A 4C0GA 8ATCB 1PD0A 1K73U 2K2VA 3EH1A 4KGVB 3CCMA 1G3YA 2KY9A 4C92G 3CC2Q 3ULRB 2JOYA 1XNIA 3PIPA 1S72Q 3OW2S 1Q86R 4QQDA 4F7UG 5GAN2 3FRNA 4MZMA 3HFOA 3CCJA 4LDXA 3A5ZB 3BDUA 2HZYA 5GAN4 2CZ1B 4IIMA 4ESRA 5FW9A 1ZX6A 1RUWA 3M5AA 4LD6A 2SEMA 1GFCA 3H0FA 1B3QA 4QVZA 2PVOB 1Q7YU 1WX6A 3CC7Q 2GBQA 3SWNA 1R0CB 3CCLA 2OX7A 4Q5WA 1UHFA 3CCQQ 4PJOF 3JCMg 1VQ7A 4KGXB 5GJVB 5GAOl 4JLIA 4M7AD 3OSVA 1VYTA 3TVTA 3CCRQ 5GMKh 3OY9A 4PK4A 5GAN5 2QXFA 1IZ6A 4WF2A 2O4XB 2QA4A 2YRVA 1OYXA 5LJ3f 1UTIA 1X2QA 2LJ0A 3KBGA 1BU1A 4RUGA 2OTJQ 1FMKA 3RR6A 3OYKA 4M77G 4J7IA 2DL8A 3EFSA 1RAAB 1VQ6Q 3BY7A 1QKWA 4M7AB 2NUTB 4ZGEB 4LUDA 1W4SA 4JJDA 2F2XA 2IPOB 1VQ4Q 1IGUA 3G6EA 2ROTA 2EW3A 3M59A 3TEEA 4IUPA 1UGQB 2RHZA 4EPCA 2DL5A 1J3TA 2DXBA 4VUBA 3H0HA 4J9HA 2SRCA 1B7TA 3CPWP 4RCCA 4E7KA 3C95A 1WJSA 7AT1B 2ZAEA 3OBYA 1KHIA 4M75E 5GAN6 2E3IA 1D0ZA 2EJ9A 3G4ST 4ZGJB 4RTUA 1TXQA 3EHRA 1LPLA 2JTEA 4FU6A 3OYIA 2GCXA 2LVMA 4LDYA 4EMKA 2A3LA 4J9IA 5CAIA 2M1HA 2L8DA 3OMGA 2LMJA 3EGDA 2F2VA 1PHTA 5GJWB 3VJPA 2P4TA 3LWIA 4HKEA 4ZTFA 4IUQA 5IHIA 2EYWA 1WDXA 4PKCC 1NM7A 2XHCA 2QDYB 1K73C 2V8JA 4B9XA 4L6V5 2VASA 2DZ9A 3CCVQ 3JV3A 1EX4A 3JSCA 2CKKA 3JCMX 1NBEB 2LZ6B 2QEXQ 3M0QA 2RB6A 1X6BA 2KEAA 2QTXA 3S3MA 4GLKA 2D8HA 2EGEA 2DNUA 1FMWA 3UF4A 4HA8A 4MMKA 4M78E 5GMKl 2H3EB 3JRZA 4FYYB 1N8RU 1Q7YC 3PFSA 3OSSC 3HRSA 2L2PA 1ZA1B 5LJ3h 4C8QE 4BE1A 3CPWS 4OF1A 1QQJA 4IKFA 1VQ5T 1WJQA 1VYUA 4M7AF 1Q95G 3O8VA 4LNPA 2DFUA 4J9FA 2K57A 2DJZA 1QCNA 3CCJQ 4OMMA 2VUBA 2XIDA 1AWXA 4A4KA 3BW1A 2QQAA 2F2WA 2CDTA 2CUBA 4AFSC 1OPLA 2L3PA 2DM1A 4M75D 1YJNT 2J6OA 1K0XA 1SF9A 4M7DF 3REBB 2VB6A 1AZEA 3LGFA 4AFUC 1WHGA 1FWZA 2E3HA 5D6XA 1VQPQ 3E9FA 3OYAA 5I21A 3CCLQ 2KNBB 1WNLA 3MJXA 3SFMA 4MZTA 5CVIA 1VQ7Q 4DBFA 1BI1A 1U1SA 2K7AA 2XKOC 1YIJA 3G71A 3DLLA 4M75B 2LJ3A 3A8MB 2V26A 2BE9B 2DEUA 3MEAA 2YDLA 1VQOT 3ZEHA 1M8MA 1IREB 1AZGB 1VQ8A 1PG5B 4FW1A 5HKCA 5KYWA 2K4YA 4RCBA 3OYNA 3EG0A 1GCPA 2F69A 3SD4A 1JU5C 4XTYA 3JCMb 3CCSQ 1N9SA 3L2RA 3CCEA 3OS5A 3INZA 2E65A 4M78D 5AT1B 1OU9A 3QKJA 3PVLA 1HK9A 1VUBA 2DXCA 2EQJA 4C8QD 2FRWA 4OMLA 1ZSZC 5AYFA 2ENMA 4QW2A 1PD1A 4BUGA 3O5ZA 2YT6A 2AZSA 4XU2A 5A0DA 2EBPA 1FXXA 2HBWA 4M78B 4D8DA 1MHNA 3GNFB 1QVFS 3OYDA 1GBQA 1IXDA 4QQGA 2ZPIB 3CCUQ 2HNIA 1D0XA 5LJ5j 1YJ9T 4OB2B 2DETA 3BDLA 1ZSGA 1K4US 1M9SA 5GMKe 1WJRA 4WTOB 4QT7A 1OZ2A 3EG3A 4PL6A 2ZGWA 4OB1B 3OYHA 1HSQA 1U8RA 1VQ9A 1MUZA 2LCLA 3CMEA 1N8RC 3OS1A 5GAOq 3NGPA 4LN2A 1YJWA 4N4HA 3A1PA 4KH0B 1A0NB 5IN1A 2HCKA 5CQXA 3URGA 4PJNA 2VC8A 1H3HA 4M7DC 3FC3A 1NJIU 4KUIA 1VQNA 4R0KA 5KYXB 1PSEA 1YITA 3JCMf 4QVDA 1BI3A 1JJ2P 2IG0A 3M58A 3SDZA 2JT4A 4M75F 1YI2A 4HVWA 2B86A 4BE2A 2O88A 2JW4A 1LOJA 3H9NA 2HKNA 3R6OA 2V8KA 4N0AC 2X3WD 1X01A 2M02A 2O4XA 1BCOA 2NUZA 2OAWA 2R5AA 1XTDA 2ZZDA 1AWJA 1FX7A 3LGLA 2NWMA 3PTAA 4C5EA 4PJOE 2LNVA 3UT1A 4XTWA 3RBBB 1TH7A 4M7AA 2NUTA 3M9QA 1T3SA 1RADB 2BZ8A 2CREA 3V7RA 2O9VA 1M27C 1W70A 5KYNA 4C0DC 3EFOB 5ECAA 1JQQA 1KQSA 2M0YA 1I81A 4HT8A 1Q82U 2KK4A 4KUDK 2FZCB 2RQVA 2PNIA 3OBWA 3JB9I 2GF7A 3UA6A 3RKXA 2LDMA 4MZPA 4M78F 3OYGA 1TUDA 4F04B 1M3BA 1ABQA 1AD5A 3CC4T 4HXJA 1RACB 1ZUUA 4C8QF 4AG1C 3U23A 2M51A 2M16A 3MO8A 2E70A 1ZBJA 4RTTA 2L3SA 4DOWA 1JJ2S 1Y71A 3PT9A 5GAMf 1MV3A 3Q1JA 2E10A 3E1SA 1KQSP 2XMFA 4BDZA 4JRQA 3CCEQ 1V1CA 1QP2A 3MPUB 3I9QA 3WXMB 2O9SA 4A63B 3CBOA 1GCQA 1VQ6A 2FEIA 3MCAB 2LP5A 2GTJA 2DL3A 2LQKA 2EYXA 4Z8AA 2VGNA 2OI3A 3JCMh 3L2UA 3JCMP 1RAFB 2C06A 1OV3A 4ORZA 5HCKA 1NE8A 4BY6B 3DB3A 4B6MA 3EGXA 5KCOA 4PJMA 1NJIC 1E6HA 4EIKA 2KYMA 2MWOA 2XDBA 5GAOp 5KE2A 4ZGDB 2CGHA 5D6WA 4PJOB 1W2BS 2EJGA 2HEQA 1BK2A 1O9SA 5FU6B 3M55A 1Y96B 5KYUA 1VQ9Q 4AG2C 1IGQA 4JZ3A 4BB7A 1LNXA 1ZUYA 3I5SA 1VA7A 1YJWQ 1U3OA 3WVEB 5IXFA 2DTIA 3LW5E 3LYIA 5I2SA 5GAN3 3CQTA 4C92F 1KQSS 5CQYA 3G7ZA 4A4EA 3G4SA 1VQNQ 4DBHA 3C4SA 1YI2Q 1AEYA 2KI7A 1Z9QA 2RQUA 2LTOA 4M75A 3GP8A 1RLQC 3JB9J 5EC7A 4ZTJA 4M7DE 3JB9G 3TQ7P 3CBPA 1YNZA 3CEYA 5GANe 5IH2A 5LL6S 2QEXA 1Q82C 2A0FB 2OAUA 2EQKA 3VS5A 2BKDN 3H6ZA 3CMAA 1BB9A 1T3LA 3J81E 3TREA 1UGSB 3OYYA 5GAMh 2W0ZA 4KRTA 3SWNC 1VQLQ 3OB9A 1Q86U 3RIRA 2LNHB 3CC2T 1AWOA 3F70A 1S72T 2E12A 1BKBA 4X9CA 4OVAA 1UGPB 1U5SA 1EZZB 3VKIA 2AK5A 2YRCA 1R8OB 2CP7A 2B8AA 3QYHB 1PC0A 3ZFJA 3VRZA 4J9DA 4XTZA 1TTHB 2FPFA 2D0QB 2KT1A 2BUDA 1PKTA 3UWNA 3PIOA 1OOTA 3CC7T 2NLUA 3E2UA 1M3CA 1N6AA 4NS5A 1KD1R 2XI9A 3A98A 4JDSA 1M2OA 2CH4A 3ZL7C 1VQPA 4M78A 3CCQT 3PMIA 3MP6A 1ZSZB 2OJ2A 2V8IA 1H3ZA 1K0SA 2FO0A 2RQTA 2YLCA 2K2MA 2LX9A 3CCRT 3JCMQ 4A4GA 1RABB 3CXCA 4J83A 1X6GA 2EGAA 2HQXA 1IHVA 1R0BG 3CPFA 4DEXA 1HJDA 2WSFE 3MP1A 2HQEA 2VV5A 5A2QE 3VU3C 4E2FB 4O6JA 1Q7YR 2QGGA 2K5LA 3DB4A 1X2KA 1R77A 4O5VA 3CD6T 4M7DD 1HD3A 3VUBA 2ED0A 3VS7A 4IIOA 2E6ZA 3EHQA 5GMKj 1VQ4T 3CCSA 3M0UA 2DZCA 5KYXA 4C92C 2PVGB 3CBMA 1QVPA 1VQOA 2ZPEB 3E19A 2DYIA 3EH2A 4PNOA 3CXCP 2EQUA 3X24B 2JTMA 4ATOA 3I35A 1K8AR 4BDYA 4Z89A 4M7DB 1UG1A 2KROA 3X26B 4E7ZA 4BACA 1GRIA 1QLYA 1PSFA 4CC3A 4PLIA 2HSPA 1QWEA 3UDCA 2Y4XA 1UJ0A 1M1KR 2X4WA 5CKBA 2ECZA 3NMZC 3OYLA 1XOVA 4QQ6A 4KH1B 1RAEB 3QDFA 4ELZC 2J6FA 2VXFA 2RI2A 3CCUA 2LCCA 3GF5A 4Y91A 2ATCB 1EIFA 5GAMg 3PE0A 4DQ2A 3QZ9B 3EFOA 3QDRB 3J7AF 4TVRA 3RMSA 2J6KA 1LJOA 1WYXA 2EQMA 4PJJA 1WPYA 1Q86C 3G4SQ 3RERA 2EGCA 4M77C 3CCVT 5HK3A 3WVDB 2D6FA 4KBMB 2EWNA 2QG9B 3I55T 1WHLA 3GBQA 1KC8R 1SHFA 3MEWA 1UFFA 4KGZB 1YN8A 2MAMA 1VQKT 2DILA 2YUOA 1D0YA 3C12A 3MEUA 3JCMe 3CMAQ 1W1FA 2X3XD 2KGTA
chains in the Genus database with same CATH topology
1I07A 2K9GA 3R6NA 2KE9A 1QWFA 2BTTA 2EYYA 3M0TA 3EG2A 1ZSGA 1K4US 1M3AA 2P4RA 4JPBW 4QT7A 3NHNA 3EG3A 1HSQA 1PKSA 1MUZA 2KR3A 1KIKA 2A28A 4OMNA 2CT3A 2JMCA 2EQIA 2BZXA 3NGPA 4LN2A 1OEBA 2L0AA 2C0OA 2VVKA 1E7OA 3KFVA 1SRMA 4RTWA 2CSQA 1A0NB 4F16A 2RMOA 2JS2A 2HCKA 1Y57A 1SHGA 1YWOA 5IHNA 1LCKA 1H3HA 2D1XA 4J9BA 4OMQA 4GLMA 4R0KA 2GQIA 1AWWA 2DVJA 2JT4A 4HVWA 2B86A 2KXDA 2O88A 2JW4A 2LJ1A 2RNAA 1AOJA 1SEMA 4J9GA 5IXBA 1GL5A 2X3WD 2CH4W 3IQLA 2YUNA 2NUZA 2DBKA 2OAWA 1RLPC 1KFZA 1AWJA 2NWMA 4AFQC 5I22A 1WXBA 2DRKA 3H0IA 3RBBB 1K76A 4Y92A 2LCSA 1H92A 4RTXA 2KXCA 2GNCA 1T3SA 2BZ8A 2CREA 4OMOA 3VS0A 2O9VA 2A36A 1M27C 1W70A 4LUEA 2KRMA 1UECA 2DYBA 4HCKA 2D8JA 1IO6A 5ECAA 1JQQA 2M0YA 2DMOA 2VKNA 2O2OA 1Y0MA 1RI9A 1WI7A 2RQVA 4RTZA 2PNIA 2KRNA 2LQNA 1QKXA 3UA6A 1NLOC 2PTKA 2E5KA 1TUDA 2JXBA 1WA7A 3TSWA 2V1RA 1WLPB 1JEGA 1M3BA 1ABQA 1AD5A 4HXJA 1TUCA 1ZUUA 4D8KA 4AG1C 2ABLA 3U23A 3VS6A 2M51A 2QDLA 2KYBA 2DA9A 4M4ZA 3I5RA 2FPEA 2JS0A 1ZBJA 4RTTA 2L3SA 4JJCA 1MV3A 1PRMC 3ULRB 4AFZC 2LQWA 4RTVA 1SPKA 4CC4B 2XMFA 1UHCA 3FJ5A 3LH5A 3M0PA 2K3BA 5FWBA 2RPNA 4IIMA 2H8HA 1V1CA 3I9QA 4ESRA 1WXUA 2O9SA 4A63B 5FW9A 1ZX6A 1GCQA 1RUWA 2ROLA 2FEIA 3SEMA 2LP5A 2KBTA 2GTJA 2SEMA 1G83A 1GFCA 3H0FA 2DL3A 1B3QA 2DL4A 1TG0A 1WX6A 1KJWA 2EYXA 2GBQA 2D0NA 1BBZA 4Z8AA 2A37A 2EPDA 1X69A 2OI3A 2W10A 1UHFA 1OV3A 4ORZA 2RQRA 5GJVB 5HCKA 2RN8A 1NLPC 1VYTA 3TVTA 1UTIA 1X2QA 2LJ0A 4HVVA 2GTOA 1E6HA 4EIKA 2KYMA 1BU1A 4RUGA 3THKA 1N5ZA 1FMKA 2LX7A 3SHWA 2HEQA 2DL8A 1BK2A 4FSSA 1YCSB 2DE0X 1QKWA 4AG2C 4LUDA 4JZ3A 2CSIA 4F14A 3REAB 1ZUYA 3I5SA 4JJDA 1VA7A 2F2XA 1OPKA 1B07A 1U3OA 5IXFA 1U06A 5FWCA 1T0JA 2ROTA 2EW3A 3CQTA 1G2BA 4ZNXA 2C0TA 3H41A 2DL5A 1J3TA 1YP5A 3H0HA 4J9HA 2SRCA 4JZ4A 1K9AA 1MV0B 1NEGA 1ARKA 3PVQA 1AEYA 1Z9QA 2RQUA 2GGRA 1KSWA 1RLQC 5EC7A 2MOXA 1YNZA 5IH2A 1ZUKA 2DBMA 1I1JA 4RTUA 3EHRA 3VS5A 2JTEA 1PRLC 1BB9A 1T3LA 2CT4A 4J9IA 2W0ZA 4KRTA 2LMJA 5I11A 2F2VA 1PHTA 1JXOA 2LNHB 5GJWB 1NYGA 3VS3A 4DEYA 1AWOA 2DRMA 5IHIA 2EYWA 2G6FX 1U5SA 4RTYA 1WDXA 1NM7A 2DJQA 2YUQA 2AK5A 3VS4A 2DL7A 4Z88A 2J05A 1M30A 2HDAA 3JV3A 5L23A 3VRZA 1PNJA 4J9DA 2KRSA 1UUEA 2FPFA 2KT1A 1NEBA 2CUDA 4LE9A 1PKTA 3C0CA 2MCNA 1OOTA 2J7IA 2LZ6B 1M3CA 3M0QA 3QWYA 1X6BA 2KEAA 3A98A 2MIOA 4X1VA 2D8HA 2EGEA 2CH4A 1SRLA 2DNUA 2A08A 2VWFA 3NPFA 3ZL7C 4F17A 3UF4A 2JM9A 1VYVA 1GFDA 3M0SA 2AZVA 1H8KA 2OJ2A 1W6XA 1K0SA 2FO0A 2KT8A 2RQTA 2L2PA 2K2MA 1AVZC 1EFNA 2JM8A 4CC7A 1UE9A 1X6GA 3VS2A 1ABOA 1VYUA 2EGAA 4LNPA 4CC2A 1QCFA 3QWXX 4J9FA 4DEXA 2FG0A 1HJDA 1CKAA 3VS1A 4OMMA 4JJBA 4E6RA 2IIMA 3UATA 1AWXA 4J9EA 4J9CA 2C0IA 2F2WA 2CDTA 1X2KA 2CUBA 4GBQA 4HVUA 4AFSC 2PZ1A 1OPLA 1K1ZA 2L3PA 2DM1A 3TSZA 2J6OA 1HD3A 1K0XA 1YWPA 2ED0A 3VS7A 4IIOA 3EHQA 3M0UA 2AKKA 3REBB 2EVRA 3RNJA 1AZEA 4AFUC 1WFWA 1E6GA 1JO8A 2O31A 2KNBB 2FPDA 2YSQA 1FYNA 3I35A 2K7AA 1WIEA 1SSHA 5IHKA 2K79A 4Z89A 1I0CA 2LJ3A 3UA7A 2V1QA 1UG1A 2KROA 2JMAA 2YDLA 1NYFA 1JXMA 1GRIA 1M8MA 1QLYA 1WXTA 3M0RA 1NG2A 1AZGB 1UGVA 2J06A 2RF0A 4CC3A 2HSPA 1QWEA 1UJ0A 1UJYA 2AKLA 1S1NA 2ECZA 3NMZC 1XOVA 1GCQC 3EG0A 3EG1A 1GCPA 2J6FA 3EGUA 1JU5C 2ED1A 1X27A 2DLPA 3PE0A 3VRYA 2YUPA 2J6KA 1Z9ZA 1WYXA 3PVLA 2K6DA 1X43A 2FRWA 4OMLA 2BZYA 2EGCA 4WCIA 2RQWA 2ENMA 2DF6A 2EYZA 1CSKA 4OMPA 1GBRA 3O5ZA 2YT6A 2AZSA 2EBPA 3GBQA 1SHFA 2FRYA 1UFFA 4K11A 1YN8A 2I0NA 2HBWA 2DILA 4D8DA 2YUOA 1T0HA 1CKBA 2ESWA 2DX1A 1PWTA 1GBQA 1UDLA 2EKHA 1W1FA 2X3XD 2KGTA 2L3QA 1ZLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I07 A;  2K9G A;  3R6N A;  2KE9 A;  1QWF A;  2BTT A;  2EYY A;  3M0T A;  3EG2 A;  1ZSG A;  1K4U S;  1M3A A;  2P4R A;  4JPB W;  4QT7 A;  3NHN A;  3EG3 A;  1HSQ A;  1PKS A;  1MUZ A;  2KR3 A;  1KIK A;  2A28 A;  4OMN A;  2CT3 A;  2JMC A;  2EQI A;  2BZX A;  3NGP A;  4LN2 A;  1OEB A;  2L0A A;  2C0O A;  2VVK A;  1E7O A;  3KFV A;  1SRM A;  4RTW A;  2CSQ A;  1A0N B;  4F16 A;  2RMO A;  2JS2 A;  2HCK A;  1Y57 A;  1SHG A;  1YWO A;  5IHN A;  1LCK A;  1H3H A;  2D1X A;  4J9B A;  4OMQ A;  4GLM A;  4R0K A;  2GQI A;  1AWW A;  2DVJ A;  2JT4 A;  4HVW A;  2B86 A;  2KXD A;  2O88 A;  2JW4 A;  2LJ1 A;  2RNA A;  1AOJ A;  1SEM A;  4J9G A;  5IXB A;  1GL5 A;  2X3W D;  2CH4 W;  3IQL A;  2YUN A;  2NUZ A;  2DBK A;  2OAW A;  1RLP C;  1KFZ A;  1AWJ A;  2NWM A;  4AFQ C;  5I22 A;  1WXB A;  2DRK A;  3H0I A;  3RBB B;  1K76 A;  4Y92 A;  2LCS A;  1H92 A;  4RTX A;  2KXC A;  2GNC A;  1T3S A;  2BZ8 A;  2CRE A;  4OMO A;  3VS0 A;  2O9V A;  2A36 A;  1M27 C;  1W70 A;  4LUE A;  2KRM A;  1UEC A;  2DYB A;  4HCK A;  2D8J A;  1IO6 A;  5ECA A;  1JQQ A;  2M0Y A;  2DMO A;  2VKN A;  2O2O A;  1Y0M A;  1RI9 A;  1WI7 A;  2RQV A;  4RTZ A;  2PNI A;  2KRN A;  2LQN A;  1QKX A;  3UA6 A;  1NLO C;  2PTK A;  2E5K A;  1TUD A;  2JXB A;  1WA7 A;  3TSW A;  2V1R A;  1WLP B;  1JEG A;  1M3B A;  1ABQ A;  1AD5 A;  4HXJ A;  1TUC A;  1ZUU A;  4D8K A;  4AG1 C;  2ABL A;  3U23 A;  3VS6 A;  2M51 A;  2QDL A;  2KYB A;  2DA9 A;  4M4Z A;  3I5R A;  2FPE A;  2JS0 A;  1ZBJ A;  4RTT A;  2L3S A;  4JJC A;  1MV3 A;  1PRM C;  3ULR B;  4AFZ C;  2LQW A;  4RTV A;  1SPK A;  4CC4 B;  2XMF A;  1UHC A;  3FJ5 A;  3LH5 A;  3M0P A;  2K3B A;  5FWB A;  2RPN A;  4IIM A;  2H8H A;  1V1C A;  3I9Q A;  4ESR A;  1WXU A;  2O9S A;  4A63 B;  5FW9 A;  1ZX6 A;  1GCQ A;  1RUW A;  2ROL A;  2FEI A;  3SEM A;  2LP5 A;  2KBT A;  2GTJ A;  2SEM A;  1G83 A;  1GFC A;  3H0F A;  2DL3 A;  1B3Q A;  2DL4 A;  1TG0 A;  1WX6 A;  1KJW A;  2EYX A;  2GBQ A;  2D0N A;  1BBZ A;  4Z8A A;  2A37 A;  2EPD A;  1X69 A;  2OI3 A;  2W10 A;  1UHF A;  1OV3 A;  4ORZ A;  2RQR A;  5GJV B;  5HCK A;  2RN8 A;  1NLP C;  1VYT A;  3TVT A;  1UTI A;  1X2Q A;  2LJ0 A;  4HVV A;  2GTO A;  1E6H A;  4EIK A;  2KYM A;  1BU1 A;  4RUG A;  3THK A;  1N5Z A;  1FMK A;  2LX7 A;  3SHW A;  2HEQ A;  2DL8 A;  1BK2 A;  4FSS A;  1YCS B;  2DE0 X;  1QKW A;  4AG2 C;  4LUD A;  4JZ3 A;  2CSI A;  4F14 A;  3REA B;  1ZUY A;  3I5S A;  4JJD A;  1VA7 A;  2F2X A;  1OPK A;  1B07 A;  1U3O A;  5IXF A;  1U06 A;  5FWC A;  1T0J A;  2ROT A;  2EW3 A;  3CQT A;  1G2B A;  4ZNX A;  2C0T A;  3H41 A;  2DL5 A;  1J3T A;  1YP5 A;  3H0H A;  4J9H A;  2SRC A;  4JZ4 A;  1K9A A;  1MV0 B;  1NEG A;  1ARK A;  3PVQ A;  1AEY A;  1Z9Q A;  2RQU A;  2GGR A;  1KSW A;  1RLQ C;  5EC7 A;  2MOX A;  1YNZ A;  5IH2 A;  1ZUK A;  2DBM A;  1I1J A;  4RTU A;  3EHR A;  3VS5 A;  2JTE A;  1PRL C;  1BB9 A;  1T3L A;  2CT4 A;  4J9I A;  2W0Z A;  4KRT A;  2LMJ A;  5I11 A;  2F2V A;  1PHT A;  1JXO A;  2LNH B;  5GJW B;  1NYG A;  3VS3 A;  4DEY A;  1AWO A;  2DRM A;  5IHI A;  2EYW A;  2G6F X;  1U5S A;  4RTY A;  1WDX A;  1NM7 A;  2DJQ A;  2YUQ A;  2AK5 A;  3VS4 A;  2DL7 A;  4Z88 A;  2J05 A;  1M30 A;  2HDA A;  3JV3 A;  5L23 A;  3VRZ A;  1PNJ A;  4J9D A;  2KRS A;  1UUE A;  2FPF A;  2KT1 A;  1NEB A;  2CUD A;  4LE9 A;  1PKT A;  3C0C A;  2MCN A;  1OOT A;  2J7I A;  2LZ6 B;  1M3C A;  3M0Q A;  3QWY A;  1X6B A;  2KEA A;  3A98 A;  2MIO A;  4X1V A;  2D8H A;  2EGE A;  2CH4 A;  1SRL A;  2DNU A;  2A08 A;  2VWF A;  3NPF A;  3ZL7 C;  4F17 A;  3UF4 A;  2JM9 A;  1VYV A;  1GFD A;  3M0S A;  2AZV A;  1H8K A;  2OJ2 A;  1W6X A;  1K0S A;  2FO0 A;  2KT8 A;  2RQT A;  2L2P A;  2K2M A;  1AVZ C;  1EFN A;  2JM8 A;  4CC7 A;  1UE9 A;  1X6G A;  3VS2 A;  1ABO A;  1VYU A;  2EGA A;  4LNP A;  4CC2 A;  1QCF A;  3QWX X;  4J9F A;  4DEX A;  2FG0 A;  1HJD A;  1CKA A;  3VS1 A;  4OMM A;  4JJB A;  4E6R A;  2IIM A;  3UAT A;  1AWX A;  4J9E A;  4J9C A;  2C0I A;  2F2W A;  2CDT A;  1X2K A;  2CUB A;  4GBQ A;  4HVU A;  4AFS C;  2PZ1 A;  1OPL A;  1K1Z A;  2L3P A;  2DM1 A;  3TSZ A;  2J6O A;  1HD3 A;  1K0X A;  1YWP A;  2ED0 A;  3VS7 A;  4IIO A;  3EHQ A;  3M0U A;  2AKK A;  3REB B;  2EVR A;  3RNJ A;  1AZE A;  4AFU C;  1WFW A;  1E6G A;  1JO8 A;  2O31 A;  2KNB B;  2FPD A;  2YSQ A;  1FYN A;  3I35 A;  2K7A A;  1WIE A;  1SSH A;  5IHK A;  2K79 A;  4Z89 A;  1I0C A;  2LJ3 A;  3UA7 A;  2V1Q A;  1UG1 A;  2KRO A;  2JMA A;  2YDL A;  1NYF A;  1JXM A;  1GRI A;  1M8M A;  1QLY A;  1WXT A;  3M0R A;  1NG2 A;  1AZG B;  1UGV A;  2J06 A;  2RF0 A;  4CC3 A;  2HSP A;  1QWE A;  1UJ0 A;  1UJY A;  2AKL A;  1S1N A;  2ECZ A;  3NMZ C;  1XOV A;  1GCQ C;  3EG0 A;  3EG1 A;  1GCP A;  2J6F A;  3EGU A;  1JU5 C;  2ED1 A;  1X27 A;  2DLP A;  3PE0 A;  3VRY A;  2YUP A;  2J6K A;  1Z9Z A;  1WYX A;  3PVL A;  2K6D A;  1X43 A;  2FRW A;  4OML A;  2BZY A;  2EGC A;  4WCI A;  2RQW A;  2ENM A;  2DF6 A;  2EYZ A;  1CSK A;  4OMP A;  1GBR A;  3O5Z A;  2YT6 A;  2AZS A;  2EBP A;  3GBQ A;  1SHF A;  2FRY A;  1UFF A;  4K11 A;  1YN8 A;  2I0N A;  2HBW A;  2DIL A;  4D8D A;  2YUO A;  1T0H A;  1CKB A;  2ESW A;  2DX1 A;  1PWT A;  1GBQ A;  1UDL A;  2EKH A;  1W1F A;  2X3X D;  2KGT A;  2L3Q A;  1ZLM A; 
#chains in the Genus database with same CATH topology
 1I07 A;  3HPW A;  3R6N A;  3I56 T;  1ZQ1 A;  5IT9 E;  2JZ2 A;  4JRK A;  3OYC A;  4E7H A;  4JPB W;  3EGX B;  3CCM T;  1OQK A;  5CO7 A;  5LJ5 f;  2HMA A;  1TWB A;  4EMG A;  5CCA A;  2DXU A;  2CT3 A;  1UEB A;  2JMC A;  2EQI A;  2BZX A;  4HCC A;  1NZ9 A;  5GAN 8;  3CCJ T;  2EIF A;  2C0O A;  4FL6 A;  1SRM A;  2CS7 A;  1G8X A;  3TCJ A;  2RHU A;  2RMO A;  5KYU B;  4YTL A;  3X25 B;  5IHN A;  1QCO A;  4UC4 A;  5FLX E;  4OMQ A;  4Z02 A;  5GMK m;  1AWW A;  4XU3 A;  4J6X A;  1N8R R;  2ZPF B;  2E4H A;  2X35 A;  2KXD A;  1G3T A;  2RNA A;  2QQB A;  3CCL T;  4J9G A;  5IXB A;  2RJC A;  1TSF A;  3IQL A;  1MMG A;  5CKE A;  1VQ7 T;  1RL2 A;  3HSB A;  1RLP C;  3E9G A;  4JUV A;  4Y28 E;  1KFZ A;  2AT1 B;  2QA4 T;  4L59 A;  1YJN Q;  4PJO A;  4E7S A;  2I2L A;  5I22 A;  5HK0 A;  3NTI A;  1K9M R;  3H0I A;  4MDX A;  1K76 A;  2OTL T;  2LCS A;  1Y96 A;  4RTX A;  5GAN d;  2GFU A;  4OGC A;  5LJ5 d;  3LH0 A;  2DO3 A;  2GQV A;  4HT9 A;  1TU0 B;  4LUE A;  2KRM A;  4J6W A;  2DYB A;  3FIF A;  4FYW B;  2D8J A;  2R5M A;  1IO6 A;  4M7A G;  1LVK A;  3G6E T;  3P8B B;  2O2O A;  1RI9 A;  1WI7 A;  2LC4 A;  1VQO Q;  2WAC A;  2YWW A;  1NLO C;  4DBQ A;  2NUP A;  3A8G B;  1YHQ A;  1WA7 A;  3PGG A;  4C0Z A;  1M90 U;  3X28 B;  1JEG A;  3QSU A;  5I2M A;  1BCM A;  4C92 E;  2ABL A;  3VS6 A;  1VOM A;  2QDL A;  2FB7 A;  4F7U E;  2DA9 A;  3QII A;  4M4Z A;  2PUK B;  3QBY A;  1I4K 1;  2HAX A;  3GIB A;  2XG8 D;  3G1J A;  2K3X A;  2QGF B;  4N4G A;  4AFZ C;  5DY9 A;  4RTV A;  3JCM J;  3BFM A;  3FJ5 A;  3LH5 A;  4C8Q B;  1G5V A;  5GAN j;  5LJ5 h;  4AT1 B;  4V2S A;  2K3B A;  3GLX A;  2RPN A;  1N9R A;  5J39 A;  3QO3 A;  3QG1 A;  2ROL A;  2HL3 A;  5L8R E;  3OS0 A;  3FDR A;  2KBT A;  3V8K A;  1G83 A;  3RKW A;  1M5Q 1;  2DL4 A;  2X4X A;  1KJW A;  3RUX A;  1BBZ A;  2A37 A;  2L89 A;  2W10 A;  2LRQ A;  5D6Y A;  1YJ9 Q;  3M4G A;  3QJ6 A;  3GOX A;  1B34 B;  2RQR A;  2L5Q A;  1OZ3 A;  1I5O B;  2RN8 A;  1YFN A;  1ZSZ A;  1SKU B;  5DM7 R;  4M77 E;  1PCX A;  2GTO A;  2DXT A;  2EJF A;  4A4F A;  1MND A;  4BI3 A;  2MF2 A;  4MDW A;  4ZN3 A;  1Y7X A;  3EG9 B;  3RES A;  1TOV A;  1KG1 A;  2CZ0 B;  2MWP A;  2VGM A;  2CSI A;  4F14 A;  3REA B;  1WQW A;  3OQ5 A;  3ZBD A;  1VQL A;  2QQ9 A;  3AHU A;  4GY5 A;  2QQR A;  3SB2 A;  4CRI A;  5IAY A;  4E7J A;  1U06 A;  5FWC A;  9ATC B;  1T0J A;  4C92 D;  5EG2 A;  1VQM A;  1Q81 R;  4ZNX A;  5KH6 A;  2C0T A;  1YP5 A;  2DD5 A;  1ACM B;  1I5L A;  1K9A A;  2F1L A;  1BYM A;  2HQH A;  1KSW A;  1MGQ A;  4M7D A;  2DTH A;  1WQ7 A;  4C92 B;  1I1J A;  1YIJ T;  3QZ5 B;  3G71 T;  4F7U B;  1QVG A;  1OI1 A;  1PRL C;  4EMH A;  2CT4 A;  4M75 G;  4N0A A;  1G3W A;  3HTR A;  1M90 C;  1VQ8 T;  4X34 A;  2K3Y A;  4P5N A;  3QJY A;  4DEY A;  1KQ2 A;  3UPU A;  2E6N A;  2F5K A;  2JJ9 A;  4DBR A;  1Q82 R;  2PUO B;  2RJE A;  3ER0 A;  4RTY A;  3P8H A;  5DLQ E;  3J80 E;  2R57 A;  2DL7 A;  4Z88 A;  5LJ3 e;  5GAN g;  3CCE T;  4M77 D;  1HYO A;  4PFP A;  5LJ5 g;  5L23 A;  2KRS A;  1I8F A;  3C0C A;  1QVG P;  1TS9 A;  2MCN A;  2J7I A;  2L3R A;  1YHQ Q;  3QWY A;  1KHC A;  4PFZ A;  1SRL A;  2VWF A;  2A08 A;  4NOY A;  3NPF A;  4J8O A;  4F17 A;  2RK2 A;  3NTK A;  3L2Z A;  3M0S A;  4XAX B;  4FSX A;  2QAS A;  4XU0 A;  1D3B B;  4M77 B;  2KT8 A;  3LX7 A;  5CKD A;  1IB8 A;  4DA4 A;  3JCM W;  1UE9 A;  3V7S A;  1GXI E;  4M78 G;  1ABO A;  4IUT A;  4CC2 A;  2LT4 A;  1QCF A;  3QWX X;  1CKA A;  2A7Y A;  4C8Q G;  2XD0 A;  4E6R A;  4R55 A;  2KDS A;  2IIM A;  3UAT A;  1D1B A;  5CKF A;  4J9E A;  3JB9 F;  2JVV A;  2C0I A;  2DEQ A;  2Z0W A;  4GBQ A;  4HVU A;  1VQ9 T;  2PZ1 A;  1AHJ B;  1K1Z A;  3CME T;  3TSZ A;  2HBP A;  2X9H A;  1YWP A;  1M8V A;  1YJW T;  4ELY C;  3A8O B;  1WFW A;  2XIC A;  1JO8 A;  5CIU A;  2FPD A;  3MHX A;  2YSQ A;  1VQN T;  2CYZ B;  4NL2 A;  2MPX C;  2MYS A;  3GPL A;  1YIT T;  4ME7 A;  4F7U F;  2COY A;  2M9U A;  2O01 E;  4BE0 A;  1YI2 T;  2K79 A;  1I0C A;  2XK0 A;  3UA7 A;  2V1Q A;  2HD0 A;  1WHM A;  5HY6 A;  1JXM A;  2NUP B;  1WXT A;  3M0R A;  3S6W A;  1NG2 A;  1UGV A;  2J06 A;  3QYG B;  5FU7 C;  2XDD A;  1UJY A;  2P0P A;  3V7C A;  2AKL A;  1D09 B;  3A8L B;  2EKO A;  3QPH A;  5GAN 7;  4A4H A;  4J6Y A;  2DK3 A;  4FCY A;  3L2Q A;  2DLP A;  2RJD A;  1VQM Q;  3LWH A;  1Z9Z A;  2RA2 A;  2DPP B;  1OX9 A;  4JS5 A;  4LDV A;  3L2V A;  4WCI A;  3X20 B;  2DF6 A;  2XDP A;  1CSK A;  4OMP A;  1GBR A;  1BIB A;  2RO0 A;  1AT1 B;  5KE3 A;  4M77 F;  1KD1 U;  4K11 A;  3HHT B;  2LQ8 A;  1CKB A;  1KQ1 A;  2DX1 A;  1PWT A;  2EKH A;  1VQ5 A;  1O75 A;  2L3Q A;  1ZLM A;  2ZPG B;  1K73 R;  2YRD A;  3ASK A;  2F5T X;  2BTT A;  4XK8 E;  3M0T A;  1TUG B;  5D7U A;  3KUF A;  2X4Y A;  2P4R A;  2EAY A;  4C8Q A;  3MET A;  2XU8 A;  3QUI A;  3NHN A;  1C1A A;  4OMF B;  2KR3 A;  2QQS A;  1YJN A;  4CI0 C;  1KIK A;  1BI0 A;  2A28 A;  4OMN A;  1MMD A;  2WSE E;  3KFV A;  2OTJ T;  4RTW A;  2RHY A;  2QK0 A;  3OYF A;  1Y57 A;  1RAI B;  4LXC A;  3N5B B;  5C0M A;  1VQ6 T;  4XTV A;  2HL5 C;  2D1X A;  4J9B A;  3VV0 A;  4OGE A;  2GQI A;  2CP5 A;  3S3O A;  3JB9 H;  4IUV A;  4LDU A;  5GAO m;  3CPW A;  4BI8 B;  1B34 A;  1AOJ A;  3OMC A;  4EMK C;  1FMV A;  1K8A U;  3OYB A;  2OTL A;  3D7S B;  2CH4 W;  1RAG B;  4J7F A;  1M4Z A;  1N27 A;  5J26 A;  3OYM A;  3DKM A;  5CKH A;  4RKU E;  2NYS A;  8AT1 B;  2ZPB B;  3QHS A;  4AFQ C;  3CD6 Q;  1M1K U;  2DRK A;  2HKQ B;  3EG9 A;  4QKU A;  1H92 A;  4Y92 A;  3NTH A;  3JAM E;  1X75 C;  1SG5 A;  4OMO A;  2A36 A;  4PJO G;  1IRX A;  4HCK A;  3HL8 A;  2CP0 A;  5C6S A;  2DMO A;  2VKN A;  4BD3 A;  3OS2 A;  2RJF A;  4XQ3 A;  2LQN A;  2QI2 A;  2PTK A;  2E5K A;  1QMC A;  5CK9 A;  5LJ3 d;  1WLP B;  1KC8 U;  4R56 A;  2DTO A;  2RHX A;  4C92 A;  4D8K A;  4FIB A;  4JJN K;  4A53 A;  4C0D B;  4F7U A;  4D6W A;  1YJ9 A;  2KYB A;  4XTX A;  2FHD A;  4FM4 B;  4JJC A;  2QEX T;  4JRI A;  1PRM C;  3CMA T;  3RDV A;  2P84 A;  3C94 A;  4DOV A;  2LQW A;  4X9D A;  1KD1 C;  4AMC A;  1SPK A;  4CC4 B;  2X51 A;  1UHC A;  1OU8 A;  4B9W A;  4ZN1 A;  3M0P A;  4OB0 B;  5FWB A;  3NFC A;  3CXC S;  4LD9 K;  4BY6 C;  2ZCF B;  2H8H A;  5GAN f;  2RI3 A;  3I55 Q;  1WXU A;  3SEM A;  2Y4Y A;  1VQK Q;  5FRN A;  1TG0 A;  1BIA A;  2D0N A;  3M53 A;  4PJO C;  2EPD A;  1QVF A;  1X69 A;  4RG2 A;  1VIE A;  5FU6 C;  3I56 Q;  1WGS A;  2RD1 A;  1WZO A;  5LJ3 j;  2AHJ B;  2FL7 A;  1NLP C;  2FYK A;  3M57 A;  1RAH B;  5FRM A;  3CCM Q;  1D3B A;  3HKS A;  1F1B B;  1ZHI A;  2KMT A;  4M77 A;  2YXY A;  1VQP T;  1VQ5 Q;  1IHW A;  3HRT A;  4HVV A;  2MMP A;  1PM3 A;  3THK A;  1KK7 A;  1N5Z A;  2LX7 A;  3SHW A;  5J3B A;  2E5Q A;  2M0O A;  1K9M U;  1K8A C;  4FSS A;  1YCS B;  2DE0 X;  4MML A;  2YHT A;  3VUZ A;  2LT1 A;  3V8L A;  1QVF P;  1OPK A;  3VYG A;  1B07 A;  1UB4 A;  2AIR B;  3L1A A;  1G2B A;  2RH2 A;  1M1K C;  2MI6 A;  3FJP A;  3H41 A;  5GAM e;  4II1 A;  3CCS T;  4JZ4 A;  2D9T A;  1MV0 B;  1NEG A;  2KQW A;  1ARK A;  1M1F A;  3PVQ A;  2QA4 Q;  3CC4 A;  1JRI A;  2H3J A;  1V29 B;  2GGR A;  4C5I A;  2CP2 A;  5KYY B;  2OTL Q;  1C0M A;  2MK5 A;  2CP6 A;  2MOX A;  3AT1 B;  1ZUK A;  2DBM A;  5DLO A;  2PVD B;  1M2V A;  4FW2 A;  1YCY A;  2WSC E;  4M7D G;  1WHK A;  3G6E Q;  4FT2 A;  5I11 A;  3L42 A;  1KC8 C;  1JBM A;  4FT4 A;  1JXO A;  3VS3 A;  1NYG A;  4KT0 E;  2DRM A;  3PMT A;  2P0Q A;  2JNG A;  2G6F X;  4C5G A;  5FU7 B;  2IVW A;  3CCU T;  2DJQ A;  2YUQ A;  3VS4 A;  5GAN h;  1ZA2 B;  2J05 A;  2QAZ A;  1M30 A;  2HDA A;  5CR2 A;  1M90 R;  4HCZ A;  1PNJ A;  1UUE A;  3SWN B;  5A0G A;  4L5G A;  1P92 A;  1NEB A;  2CUD A;  4LE9 A;  2DER A;  1NPP A;  4NL3 A;  4JS4 A;  1JJ2 A;  3V8J A;  2MIO A;  4X1V A;  3T9N A;  4KUL A;  2JM9 A;  1VYV A;  1GFD A;  2AZV A;  4PLL A;  1H8K A;  2KSS A;  1W6X A;  1M1G A;  2P0K A;  4M7A C;  1AVZ C;  1EFN A;  2JM8 A;  2JTF A;  5LJ3 g;  2RM4 A;  4CC7 A;  2K5I A;  1QP3 A;  2R58 A;  2X4J A;  3VS2 A;  3MEV A;  2G3R A;  2CZ7 B;  4BI4 A;  1XJW B;  2FG0 A;  3JB9 D;  2QTV A;  3VS1 A;  4JJB A;  4J9C A;  3RKY A;  3EFR A;  2PQW A;  1Q81 U;  2AKK A;  1K9M C;  2EVR A;  3RNJ A;  1NJI R;  2JUF A;  1E6G A;  3S3N A;  1RI0 A;  2O31 A;  4FYX B;  1FYN A;  4FYV B;  3L2W A;  6AT1 B;  1WIE A;  1W2B A;  1SSH A;  1X6O A;  5IHK A;  1MNE A;  3PNW C;  3HP9 A;  3JCM V;  2JMA A;  2BE7 D;  1NYF A;  1SSF A;  2RF0 A;  3OA6 A;  4EMK B;  3DLM A;  3MP8 A;  3CC2 A;  2GFA A;  1S72 A;  1D1A A;  4IUU A;  1S1N A;  5M9O A;  1GCQ C;  2COZ A;  2RK1 A;  3EG1 A;  3EGD B;  5GMK i;  4N4I A;  2ZPH B;  3EGU A;  4E7I A;  2ED1 A;  3HRU A;  1X27 A;  1DJ7 B;  2YLB A;  3M56 A;  4JRP A;  3FB9 A;  3VRY A;  5KCH A;  2YUP A;  3JCM d;  2HSE B;  2K6D A;  1X43 A;  2RHI A;  1W2B P;  2K5F A;  3CC7 A;  5GAO n;  1YIJ Q;  2BZY A;  2EFI A;  3G71 Q;  4QVC A;  1H64 1;  2DIQ A;  4C5H A;  2RQW A;  3ME9 A;  4LDW A;  4RG8 A;  3CC4 Q;  2EYZ A;  4JLG A;  1G3S A;  3CCQ A;  2COW A;  2KAF A;  2FRY A;  2I0N A;  1VQ8 Q;  1YHQ T;  3CCR A;  1T0H A;  2ESW A;  1BI2 A;  2CP3 A;  1UDL A;  2K9G A;  2KE9 A;  3OYJ A;  3OW2 A;  5FRO A;  1QWF A;  2EYY A;  2OTJ A;  1MMA A;  3EG2 A;  2E41 A;  3TU4 K;  4A54 A;  2DVE A;  1M3A A;  2QYZ A;  3P8D A;  1PKS A;  1VIF A;  3RMQ A;  1OX8 A;  4PJL A;  3CD6 A;  3M4Y A;  1OEB A;  2L0A A;  1VQ4 A;  2VVK A;  1E7O A;  2Y90 A;  2CSQ A;  4OB3 B;  4F16 A;  3FLG A;  4PJO D;  2JS2 A;  1SHG A;  1YWO A;  4M75 C;  1LCK A;  2FVU A;  4E47 A;  1V76 A;  4GLM A;  3H8Z A;  2BIV A;  2DVJ A;  2FZG B;  1QW1 A;  2E64 A;  2LJ1 A;  3HFN A;  4EDU A;  4XTU A;  1SEM A;  1YBY A;  3OW2 P;  2RI5 A;  1GL5 A;  1UGR B;  4PFO A;  4ANJ A;  2E1H A;  5GAM d;  1Q81 C;  1OUL A;  2YUN A;  3BE3 A;  2DBK A;  2JN0 A;  2FZK B;  1WHJ A;  3CME Q;  3A8H B;  4XU1 A;  2DKG A;  3MKD A;  1WXB A;  5KYW B;  1NPR A;  2KXC A;  1M2V B;  2GNC A;  4M7A E;  3QXE B;  1QVG S;  3VS0 A;  4IUR A;  4HCB A;  4C0F A;  1JB0 E;  1HXD A;  3GNG A;  3M54 A;  2DAQ A;  5GAO r;  1UEC A;  2KVQ G;  3JCM c;  1YIT Q;  3VYH B;  1VQL T;  2CZ6 B;  2VYT A;  3EAE A;  2DD4 A;  3CCV A;  5A0L A;  1VQM T;  4E7L A;  1Y0M A;  4M78 C;  4RTZ A;  3I55 A;  3OYE A;  2KRN A;  3LLR A;  1XQH A;  1QKX A;  1Y07 A;  2PU9 B;  2DIG A;  5LJ5 e;  4C8Q C;  4OP0 A;  1U1T A;  2JXB A;  3TSW A;  3KXT A;  2V1R A;  1VQK A;  2EYQ A;  5KYY A;  4RMO A;  1MMN A;  3FEO A;  1TUC A;  2VXE A;  1ZBX A;  4J5Y A;  5GAM j;  3I56 A;  1C6V X;  1D1C A;  1WHH A;  3I5R A;  2FPE A;  2JS0 A;  4C0G A;  8ATC B;  1PD0 A;  1K73 U;  2K2V A;  3EH1 A;  4KGV B;  3CCM A;  1G3Y A;  2KY9 A;  4C92 G;  3CC2 Q;  3ULR B;  2JOY A;  1XNI A;  3PIP A;  1S72 Q;  3OW2 S;  1Q86 R;  4QQD A;  4F7U G;  5GAN 2;  3FRN A;  4MZM A;  3HFO A;  3CCJ A;  4LDX A;  3A5Z B;  3BDU A;  2HZY A;  5GAN 4;  2CZ1 B;  4IIM A;  4ESR A;  5FW9 A;  1ZX6 A;  1RUW A;  3M5A A;  4LD6 A;  2SEM A;  1GFC A;  3H0F A;  1B3Q A;  4QVZ A;  2PVO B;  1Q7Y U;  1WX6 A;  3CC7 Q;  2GBQ A;  3SWN A;  1R0C B;  3CCL A;  2OX7 A;  4Q5W A;  1UHF A;  3CCQ Q;  4PJO F;  3JCM g;  1VQ7 A;  4KGX B;  5GJV B;  5GAO l;  4JLI A;  4M7A D;  3OSV A;  1VYT A;  3TVT A;  3CCR Q;  5GMK h;  3OY9 A;  4PK4 A;  5GAN 5;  2QXF A;  1IZ6 A;  4WF2 A;  2O4X B;  2QA4 A;  2YRV A;  1OYX A;  5LJ3 f;  1UTI A;  1X2Q A;  2LJ0 A;  3KBG A;  1BU1 A;  4RUG A;  2OTJ Q;  1FMK A;  3RR6 A;  3OYK A;  4M77 G;  4J7I A;  2DL8 A;  3EFS A;  1RAA B;  1VQ6 Q;  3BY7 A;  1QKW A;  4M7A B;  2NUT B;  4ZGE B;  4LUD A;  1W4S A;  4JJD A;  2F2X A;  2IPO B;  1VQ4 Q;  1IGU A;  3G6E A;  2ROT A;  2EW3 A;  3M59 A;  3TEE A;  4IUP A;  1UGQ B;  2RHZ A;  4EPC A;  2DL5 A;  1J3T A;  2DXB A;  4VUB A;  3H0H A;  4J9H A;  2SRC A;  1B7T A;  3CPW P;  4RCC A;  4E7K A;  3C95 A;  1WJS A;  7AT1 B;  2ZAE A;  3OBY A;  1KHI A;  4M75 E;  5GAN 6;  2E3I A;  1D0Z A;  2EJ9 A;  3G4S T;  4ZGJ B;  4RTU A;  1TXQ A;  3EHR A;  1LPL A;  2JTE A;  4FU6 A;  3OYI A;  2GCX A;  2LVM A;  4LDY A;  4EMK A;  2A3L A;  4J9I A;  5CAI A;  2M1H A;  2L8D A;  3OMG A;  2LMJ A;  3EGD A;  2F2V A;  1PHT A;  5GJW B;  3VJP A;  2P4T A;  3LWI A;  4HKE A;  4ZTF A;  4IUQ A;  5IHI A;  2EYW A;  1WDX A;  4PKC C;  1NM7 A;  2XHC A;  2QDY B;  1K73 C;  2V8J A;  4B9X A;  4L6V 5;  2VAS A;  2DZ9 A;  3CCV Q;  3JV3 A;  1EX4 A;  3JSC A;  2CKK A;  3JCM X;  1NBE B;  2LZ6 B;  2QEX Q;  3M0Q A;  2RB6 A;  1X6B A;  2KEA A;  2QTX A;  3S3M A;  4GLK A;  2D8H A;  2EGE A;  2DNU A;  1FMW A;  3UF4 A;  4HA8 A;  4MMK A;  4M78 E;  5GMK l;  2H3E B;  3JRZ A;  4FYY B;  1N8R U;  1Q7Y C;  3PFS A;  3OSS C;  3HRS A;  2L2P A;  1ZA1 B;  5LJ3 h;  4C8Q E;  4BE1 A;  3CPW S;  4OF1 A;  1QQJ A;  4IKF A;  1VQ5 T;  1WJQ A;  1VYU A;  4M7A F;  1Q95 G;  3O8V A;  4LNP A;  2DFU A;  4J9F A;  2K57 A;  2DJZ A;  1QCN A;  3CCJ Q;  4OMM A;  2VUB A;  2XID A;  1AWX A;  4A4K A;  3BW1 A;  2QQA A;  2F2W A;  2CDT A;  2CUB A;  4AFS C;  1OPL A;  2L3P A;  2DM1 A;  4M75 D;  1YJN T;  2J6O A;  1K0X A;  1SF9 A;  4M7D F;  3REB B;  2VB6 A;  1AZE A;  3LGF A;  4AFU C;  1WHG A;  1FWZ A;  2E3H A;  5D6X A;  1VQP Q;  3E9F A;  3OYA A;  5I21 A;  3CCL Q;  2KNB B;  1WNL A;  3MJX A;  3SFM A;  4MZT A;  5CVI A;  1VQ7 Q;  4DBF A;  1BI1 A;  1U1S A;  2K7A A;  2XKO C;  1YIJ A;  3G71 A;  3DLL A;  4M75 B;  2LJ3 A;  3A8M B;  2V26 A;  2BE9 B;  2DEU A;  3MEA A;  2YDL A;  1VQO T;  3ZEH A;  1M8M A;  1IRE B;  1AZG B;  1VQ8 A;  1PG5 B;  4FW1 A;  5HKC A;  5KYW A;  2K4Y A;  4RCB A;  3OYN A;  3EG0 A;  1GCP A;  2F69 A;  3SD4 A;  1JU5 C;  4XTY A;  3JCM b;  3CCS Q;  1N9S A;  3L2R A;  3CCE A;  3OS5 A;  3INZ A;  2E65 A;  4M78 D;  5AT1 B;  1OU9 A;  3QKJ A;  3PVL A;  1HK9 A;  1VUB A;  2DXC A;  2EQJ A;  4C8Q D;  2FRW A;  4OML A;  1ZSZ C;  5AYF A;  2ENM A;  4QW2 A;  1PD1 A;  4BUG A;  3O5Z A;  2YT6 A;  2AZS A;  4XU2 A;  5A0D A;  2EBP A;  1FXX A;  2HBW A;  4M78 B;  4D8D A;  1MHN A;  3GNF B;  1QVF S;  3OYD A;  1GBQ A;  1IXD A;  4QQG A;  2ZPI B;  3CCU Q;  2HNI A;  1D0X A;  5LJ5 j;  1YJ9 T;  4OB2 B;  2DET A;  3BDL A;  1ZSG A;  1K4U S;  1M9S A;  5GMK e;  1WJR A;  4WTO B;  4QT7 A;  1OZ2 A;  3EG3 A;  4PL6 A;  2ZGW A;  4OB1 B;  3OYH A;  1HSQ A;  1U8R A;  1VQ9 A;  1MUZ A;  2LCL A;  3CME A;  1N8R C;  3OS1 A;  5GAO q;  3NGP A;  4LN2 A;  1YJW A;  4N4H A;  3A1P A;  4KH0 B;  1A0N B;  5IN1 A;  2HCK A;  5CQX A;  3URG A;  4PJN A;  2VC8 A;  1H3H A;  4M7D C;  3FC3 A;  1NJI U;  4KUI A;  1VQN A;  4R0K A;  5KYX B;  1PSE A;  1YIT A;  3JCM f;  4QVD A;  1BI3 A;  1JJ2 P;  2IG0 A;  3M58 A;  3SDZ A;  2JT4 A;  4M75 F;  1YI2 A;  4HVW A;  2B86 A;  4BE2 A;  2O88 A;  2JW4 A;  1LOJ A;  3H9N A;  2HKN A;  3R6O A;  2V8K A;  4N0A C;  2X3W D;  1X01 A;  2M02 A;  2O4X A;  1BCO A;  2NUZ A;  2OAW A;  2R5A A;  1XTD A;  2ZZD A;  1AWJ A;  1FX7 A;  3LGL A;  2NWM A;  3PTA A;  4C5E A;  4PJO E;  2LNV A;  3UT1 A;  4XTW A;  3RBB B;  1TH7 A;  4M7A A;  2NUT A;  3M9Q A;  1T3S A;  1RAD B;  2BZ8 A;  2CRE A;  3V7R A;  2O9V A;  1M27 C;  1W70 A;  5KYN A;  4C0D C;  3EFO B;  5ECA A;  1JQQ A;  1KQS A;  2M0Y A;  1I81 A;  4HT8 A;  1Q82 U;  2KK4 A;  4KUD K;  2FZC B;  2RQV A;  2PNI A;  3OBW A;  3JB9 I;  2GF7 A;  3UA6 A;  3RKX A;  2LDM A;  4MZP A;  4M78 F;  3OYG A;  1TUD A;  4F04 B;  1M3B A;  1ABQ A;  1AD5 A;  3CC4 T;  4HXJ A;  1RAC B;  1ZUU A;  4C8Q F;  4AG1 C;  3U23 A;  2M51 A;  2M16 A;  3MO8 A;  2E70 A;  1ZBJ A;  4RTT A;  2L3S A;  4DOW A;  1JJ2 S;  1Y71 A;  3PT9 A;  5GAM f;  1MV3 A;  3Q1J A;  2E10 A;  3E1S A;  1KQS P;  2XMF A;  4BDZ A;  4JRQ A;  3CCE Q;  1V1C A;  1QP2 A;  3MPU B;  3I9Q A;  3WXM B;  2O9S A;  4A63 B;  3CBO A;  1GCQ A;  1VQ6 A;  2FEI A;  3MCA B;  2LP5 A;  2GTJ A;  2DL3 A;  2LQK A;  2EYX A;  4Z8A A;  2VGN A;  2OI3 A;  3JCM h;  3L2U A;  3JCM P;  1RAF B;  2C06 A;  1OV3 A;  4ORZ A;  5HCK A;  1NE8 A;  4BY6 B;  3DB3 A;  4B6M A;  3EGX A;  5KCO A;  4PJM A;  1NJI C;  1E6H A;  4EIK A;  2KYM A;  2MWO A;  2XDB A;  5GAO p;  5KE2 A;  4ZGD B;  2CGH A;  5D6W A;  4PJO B;  1W2B S;  2EJG A;  2HEQ A;  1BK2 A;  1O9S A;  5FU6 B;  3M55 A;  1Y96 B;  5KYU A;  1VQ9 Q;  4AG2 C;  1IGQ A;  4JZ3 A;  4BB7 A;  1LNX A;  1ZUY A;  3I5S A;  1VA7 A;  1YJW Q;  1U3O A;  3WVE B;  5IXF A;  2DTI A;  3LW5 E;  3LYI A;  5I2S A;  5GAN 3;  3CQT A;  4C92 F;  1KQS S;  5CQY A;  3G7Z A;  4A4E A;  3G4S A;  1VQN Q;  4DBH A;  3C4S A;  1YI2 Q;  1AEY A;  2KI7 A;  1Z9Q A;  2RQU A;  2LTO A;  4M75 A;  3GP8 A;  1RLQ C;  3JB9 J;  5EC7 A;  4ZTJ A;  4M7D E;  3JB9 G;  3TQ7 P;  3CBP A;  1YNZ A;  3CEY A;  5GAN e;  5IH2 A;  5LL6 S;  2QEX A;  1Q82 C;  2A0F B;  2OAU A;  2EQK A;  3VS5 A;  2BKD N;  3H6Z A;  3CMA A;  1BB9 A;  1T3L A;  3J81 E;  3TRE A;  1UGS B;  3OYY A;  5GAM h;  2W0Z A;  4KRT A;  3SWN C;  1VQL Q;  3OB9 A;  1Q86 U;  3RIR A;  2LNH B;  3CC2 T;  1AWO A;  3F70 A;  1S72 T;  2E12 A;  1BKB A;  4X9C A;  4OVA A;  1UGP B;  1U5S A;  1EZZ B;  3VKI A;  2AK5 A;  2YRC A;  1R8O B;  2CP7 A;  2B8A A;  3QYH B;  1PC0 A;  3ZFJ A;  3VRZ A;  4J9D A;  4XTZ A;  1TTH B;  2FPF A;  2D0Q B;  2KT1 A;  2BUD A;  1PKT A;  3UWN A;  3PIO A;  1OOT A;  3CC7 T;  2NLU A;  3E2U A;  1M3C A;  1N6A A;  4NS5 A;  1KD1 R;  2XI9 A;  3A98 A;  4JDS A;  1M2O A;  2CH4 A;  3ZL7 C;  1VQP A;  4M78 A;  3CCQ T;  3PMI A;  3MP6 A;  1ZSZ B;  2OJ2 A;  2V8I A;  1H3Z A;  1K0S A;  2FO0 A;  2RQT A;  2YLC A;  2K2M A;  2LX9 A;  3CCR T;  3JCM Q;  4A4G A;  1RAB B;  3CXC A;  4J83 A;  1X6G A;  2EGA A;  2HQX A;  1IHV A;  1R0B G;  3CPF A;  4DEX A;  1HJD A;  2WSF E;  3MP1 A;  2HQE A;  2VV5 A;  5A2Q E;  3VU3 C;  4E2F B;  4O6J A;  1Q7Y R;  2QGG A;  2K5L A;  3DB4 A;  1X2K A;  1R77 A;  4O5V A;  3CD6 T;  4M7D D;  1HD3 A;  3VUB A;  2ED0 A;  3VS7 A;  4IIO A;  2E6Z A;  3EHQ A;  5GMK j;  1VQ4 T;  3CCS A;  3M0U A;  2DZC A;  5KYX A;  4C92 C;  2PVG B;  3CBM A;  1QVP A;  1VQO A;  2ZPE B;  3E19 A;  2DYI A;  3EH2 A;  4PNO A;  3CXC P;  2EQU A;  3X24 B;  2JTM A;  4ATO A;  3I35 A;  1K8A R;  4BDY A;  4Z89 A;  4M7D B;  1UG1 A;  2KRO A;  3X26 B;  4E7Z A;  4BAC A;  1GRI A;  1QLY A;  1PSF A;  4CC3 A;  4PLI A;  2HSP A;  1QWE A;  3UDC A;  2Y4X A;  1UJ0 A;  1M1K R;  2X4W A;  5CKB A;  2ECZ A;  3NMZ C;  3OYL A;  1XOV A;  4QQ6 A;  4KH1 B;  1RAE B;  3QDF A;  4ELZ C;  2J6F A;  2VXF A;  2RI2 A;  3CCU A;  2LCC A;  3GF5 A;  4Y91 A;  2ATC B;  1EIF A;  5GAM g;  3PE0 A;  4DQ2 A;  3QZ9 B;  3EFO A;  3QDR B;  3J7A F;  4TVR A;  3RMS A;  2J6K A;  1LJO A;  1WYX A;  2EQM A;  4PJJ A;  1WPY A;  1Q86 C;  3G4S Q;  3RER A;  2EGC A;  4M77 C;  3CCV T;  5HK3 A;  3WVD B;  2D6F A;  4KBM B;  2EWN A;  2QG9 B;  3I55 T;  1WHL A;  3GBQ A;  1KC8 R;  1SHF A;  3MEW A;  1UFF A;  4KGZ B;  1YN8 A;  2MAM A;  1VQK T;  2DIL A;  2YUO A;  1D0Y A;  3C12 A;  3MEU A;  3JCM e;  3CMA Q;  1W1F A;  2X3X D;  2KGT A; 
#chains in the Genus database with same CATH homology
 1I07 A;  2K9G A;  3R6N A;  2KE9 A;  1QWF A;  2BTT A;  2EYY A;  3M0T A;  3EG2 A;  1ZSG A;  1K4U S;  1M3A A;  2P4R A;  4JPB W;  4QT7 A;  3NHN A;  3EG3 A;  1HSQ A;  1PKS A;  1MUZ A;  2KR3 A;  1KIK A;  2A28 A;  4OMN A;  2CT3 A;  2JMC A;  2EQI A;  2BZX A;  3NGP A;  4LN2 A;  1OEB A;  2L0A A;  2C0O A;  2VVK A;  1E7O A;  3KFV A;  1SRM A;  4RTW A;  2CSQ A;  1A0N B;  4F16 A;  2RMO A;  2JS2 A;  2HCK A;  1Y57 A;  1SHG A;  1YWO A;  5IHN A;  1LCK A;  1H3H A;  2D1X A;  4J9B A;  4OMQ A;  4GLM A;  4R0K A;  2GQI A;  1AWW A;  2DVJ A;  2JT4 A;  4HVW A;  2B86 A;  2KXD A;  2O88 A;  2JW4 A;  2LJ1 A;  2RNA A;  1AOJ A;  1SEM A;  4J9G A;  5IXB A;  1GL5 A;  2X3W D;  2CH4 W;  3IQL A;  2YUN A;  2NUZ A;  2DBK A;  2OAW A;  1RLP C;  1KFZ A;  1AWJ A;  2NWM A;  4AFQ C;  5I22 A;  1WXB A;  2DRK A;  3H0I A;  3RBB B;  1K76 A;  4Y92 A;  2LCS A;  1H92 A;  4RTX A;  2KXC A;  2GNC A;  1T3S A;  2BZ8 A;  2CRE A;  4OMO A;  3VS0 A;  2O9V A;  2A36 A;  1M27 C;  1W70 A;  4LUE A;  2KRM A;  1UEC A;  2DYB A;  4HCK A;  2D8J A;  1IO6 A;  5ECA A;  1JQQ A;  2M0Y A;  2DMO A;  2VKN A;  2O2O A;  1Y0M A;  1RI9 A;  1WI7 A;  2RQV A;  4RTZ A;  2PNI A;  2KRN A;  2LQN A;  1QKX A;  3UA6 A;  1NLO C;  2PTK A;  2E5K A;  1TUD A;  2JXB A;  1WA7 A;  3TSW A;  2V1R A;  1WLP B;  1JEG A;  1M3B A;  1ABQ A;  1AD5 A;  4HXJ A;  1TUC A;  1ZUU A;  4D8K A;  4AG1 C;  2ABL A;  3U23 A;  3VS6 A;  2M51 A;  2QDL A;  2KYB A;  2DA9 A;  4M4Z A;  3I5R A;  2FPE A;  2JS0 A;  1ZBJ A;  4RTT A;  2L3S A;  4JJC A;  1MV3 A;  1PRM C;  3ULR B;  4AFZ C;  2LQW A;  4RTV A;  1SPK A;  4CC4 B;  2XMF A;  1UHC A;  3FJ5 A;  3LH5 A;  3M0P A;  2K3B A;  5FWB A;  2RPN A;  4IIM A;  2H8H A;  1V1C A;  3I9Q A;  4ESR A;  1WXU A;  2O9S A;  4A63 B;  5FW9 A;  1ZX6 A;  1GCQ A;  1RUW A;  2ROL A;  2FEI A;  3SEM A;  2LP5 A;  2KBT A;  2GTJ A;  2SEM A;  1G83 A;  1GFC A;  3H0F A;  2DL3 A;  1B3Q A;  2DL4 A;  1TG0 A;  1WX6 A;  1KJW A;  2EYX A;  2GBQ A;  2D0N A;  1BBZ A;  4Z8A A;  2A37 A;  2EPD A;  1X69 A;  2OI3 A;  2W10 A;  1UHF A;  1OV3 A;  4ORZ A;  2RQR A;  5GJV B;  5HCK A;  2RN8 A;  1NLP C;  1VYT A;  3TVT A;  1UTI A;  1X2Q A;  2LJ0 A;  4HVV A;  2GTO A;  1E6H A;  4EIK A;  2KYM A;  1BU1 A;  4RUG A;  3THK A;  1N5Z A;  1FMK A;  2LX7 A;  3SHW A;  2HEQ A;  2DL8 A;  1BK2 A;  4FSS A;  1YCS B;  2DE0 X;  1QKW A;  4AG2 C;  4LUD A;  4JZ3 A;  2CSI A;  4F14 A;  3REA B;  1ZUY A;  3I5S A;  4JJD A;  1VA7 A;  2F2X A;  1OPK A;  1B07 A;  1U3O A;  5IXF A;  1U06 A;  5FWC A;  1T0J A;  2ROT A;  2EW3 A;  3CQT A;  1G2B A;  4ZNX A;  2C0T A;  3H41 A;  2DL5 A;  1J3T A;  1YP5 A;  3H0H A;  4J9H A;  2SRC A;  4JZ4 A;  1K9A A;  1MV0 B;  1NEG A;  1ARK A;  3PVQ A;  1AEY A;  1Z9Q A;  2RQU A;  2GGR A;  1KSW A;  1RLQ C;  5EC7 A;  2MOX A;  1YNZ A;  5IH2 A;  1ZUK A;  2DBM A;  1I1J A;  4RTU A;  3EHR A;  3VS5 A;  2JTE A;  1PRL C;  1BB9 A;  1T3L A;  2CT4 A;  4J9I A;  2W0Z A;  4KRT A;  2LMJ A;  5I11 A;  2F2V A;  1PHT A;  1JXO A;  2LNH B;  5GJW B;  1NYG A;  3VS3 A;  4DEY A;  1AWO A;  2DRM A;  5IHI A;  2EYW A;  2G6F X;  1U5S A;  4RTY A;  1WDX A;  1NM7 A;  2DJQ A;  2YUQ A;  2AK5 A;  3VS4 A;  2DL7 A;  4Z88 A;  2J05 A;  1M30 A;  2HDA A;  3JV3 A;  5L23 A;  3VRZ A;  1PNJ A;  4J9D A;  2KRS A;  1UUE A;  2FPF A;  2KT1 A;  1NEB A;  2CUD A;  4LE9 A;  1PKT A;  3C0C A;  2MCN A;  1OOT A;  2J7I A;  2LZ6 B;  1M3C A;  3M0Q A;  3QWY A;  1X6B A;  2KEA A;  3A98 A;  2MIO A;  4X1V A;  2D8H A;  2EGE A;  2CH4 A;  1SRL A;  2DNU A;  2A08 A;  2VWF A;  3NPF A;  3ZL7 C;  4F17 A;  3UF4 A;  2JM9 A;  1VYV A;  1GFD A;  3M0S A;  2AZV A;  1H8K A;  2OJ2 A;  1W6X A;  1K0S A;  2FO0 A;  2KT8 A;  2RQT A;  2L2P A;  2K2M A;  1AVZ C;  1EFN A;  2JM8 A;  4CC7 A;  1UE9 A;  1X6G A;  3VS2 A;  1ABO A;  1VYU A;  2EGA A;  4LNP A;  4CC2 A;  1QCF A;  3QWX X;  4J9F A;  4DEX A;  2FG0 A;  1HJD A;  1CKA A;  3VS1 A;  4OMM A;  4JJB A;  4E6R A;  2IIM A;  3UAT A;  1AWX A;  4J9E A;  4J9C A;  2C0I A;  2F2W A;  2CDT A;  1X2K A;  2CUB A;  4GBQ A;  4HVU A;  4AFS C;  2PZ1 A;  1OPL A;  1K1Z A;  2L3P A;  2DM1 A;  3TSZ A;  2J6O A;  1HD3 A;  1K0X A;  1YWP A;  2ED0 A;  3VS7 A;  4IIO A;  3EHQ A;  3M0U A;  2AKK A;  3REB B;  2EVR A;  3RNJ A;  1AZE A;  4AFU C;  1WFW A;  1E6G A;  1JO8 A;  2O31 A;  2KNB B;  2FPD A;  2YSQ A;  1FYN A;  3I35 A;  2K7A A;  1WIE A;  1SSH A;  5IHK A;  2K79 A;  4Z89 A;  1I0C A;  2LJ3 A;  3UA7 A;  2V1Q A;  1UG1 A;  2KRO A;  2JMA A;  2YDL A;  1NYF A;  1JXM A;  1GRI A;  1M8M A;  1QLY A;  1WXT A;  3M0R A;  1NG2 A;  1AZG B;  1UGV A;  2J06 A;  2RF0 A;  4CC3 A;  2HSP A;  1QWE A;  1UJ0 A;  1UJY A;  2AKL A;  1S1N A;  2ECZ A;  3NMZ C;  1XOV A;  1GCQ C;  3EG0 A;  3EG1 A;  1GCP A;  2J6F A;  3EGU A;  1JU5 C;  2ED1 A;  1X27 A;  2DLP A;  3PE0 A;  3VRY A;  2YUP A;  2J6K A;  1Z9Z A;  1WYX A;  3PVL A;  2K6D A;  1X43 A;  2FRW A;  4OML A;  2BZY A;  2EGC A;  4WCI A;  2RQW A;  2ENM A;  2DF6 A;  2EYZ A;  1CSK A;  4OMP A;  1GBR A;  3O5Z A;  2YT6 A;  2AZS A;  2EBP A;  3GBQ A;  1SHF A;  2FRY A;  1UFF A;  4K11 A;  1YN8 A;  2I0N A;  2HBW A;  2DIL A;  4D8D A;  2YUO A;  1T0H A;  1CKB A;  2ESW A;  2DX1 A;  1PWT A;  1GBQ A;  1UDL A;  2EKH A;  1W1F A;  2X3X D;  2KGT A;  2L3Q A;  1ZLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...