3M0SA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0sA00
1WXUA 2KRSA 3VS4A 4CC4B 1MV0B 1WDXA 2C0OA 2HDAA 2PNIA 2O31A 4WCIA 2GQIA 1T0JA 4M4ZA 5L23A 2EGEA 2H8HA 4Z8AA 2A28A 2DE0X 3QWXX 1X6GA 1JO8A 2YUPA 1W6XA 3THKA 1UHCA 2GTJA 2B86A 2JS2A 2M0YA 1WXBA 3M0UA 1QLYA 2A37A 4RUGA 1WI7A 2LQNA 2X3XD 2KROA 3A98A 1YNZA 4ESRA 3H41A 2K79A 2K2MA 4CC2A 4JZ4A 1WFWA 2L3SA 1U5SA 1YN8A 1CKBA 1QKXA 2DNUA 1T3SA 1WIEA 5FW9A 2MIOA 2JM9A 3RNJA 2YUQA 2MOXA 3TSWA 4KRTA 3M0QA 2FPDA 2BTTA 1UFFA 3R6NA 2AZVA 4DEXA 2FRYA 3TSZA 1HD3A 4HVUA 1SHFA 3UF4A 1PKSA 1E7OA 5IHIA 3EG3A 4HVWA 3I5RA 2CUBA 2MCNA 2DBMA 4J9CA 2HBWA 5GJWB 2LJ0A 2P4RA 1ZX6A 2ED1A 2O9SA 2OAWA 2AKLA 5IXBA 1GBQA 2O2OA 2KGTA 2RPNA 2RQWA 2EKHA 1E6HA 1JQQA 2D0NA 2BZXA 4Y92A 1HJDA 1K0SA 4AFSC 4D8DA 4F16A 1G83A 2HSPA 1FMKA 2CT4A 1QCFA 2LJ3A 2DRMA 2YUOA 2JS0A 3EG2A 1VYVA 3M0TA 2ENMA 1W70A 4CC3A 1M27C 1WX6A 2BZYA 2E5KA 5I22A 1M3BA 2D8JA 2RQUA 1K4US 1NG2A 1RI9A 4RTWA 2KNBB 1X69A 2VWFA 2AK5A 2CUDA 4J9BA 2FPFA 4OMQA 4HCKA 3VRZA 2EQIA 4X1VA 3I35A 2OI3A 2ROTA 1ABOA 2KXCA 2PTKA 1X43A 1MV3A 1W1FA 2EYYA 1TUCA 1ZUYA 4AFUC 5IHKA 1X6BA 2KRNA 2YDLA 1T3LA 1KIKA 4HVVA 2JT4A 4JJCA 2EYZA 4AFQC 1KFZA 3SEMA 2FPEA 1Y57A 2DJQA 1UECA 2L0AA 1Z9ZA 3TVTA 1WYXA 2L2PA 1GCQA 3VS6A 4RTUA 1EFNA 1UGVA 4LN2A 2LQWA 1PWTA 1YWPA 1ABQA 2O88A 4ZNXA 2KXDA 1UJYA 1U3OA 2L3QA 2KT1A 1PRLC 2W0ZA 1RUWA 2X3WD 3ULRB 2K7AA 2EW3A 4LUEA 2GBQA 3EG0A 4RTYA 4LUDA 2V1QA 1GCQC 2RMOA 1GRIA 2K9GA 2J05A 3CQTA 4Z88A 1JXOA 1NLPC 3FJ5A 2PZ1A 4F14A 2C0IA 2LP5A 3VS2A 1PRMC 1ZUKA 1NM7A 4AG1C 1I1JA 1GFCA 1GFDA 1OEBA 2ESWA 5HCKA 1CKAA 2J06A 4JPBW 2F2WA 2CREA 3EGUA 1PHTA 4J9IA 5IHNA 2ROLA 1WLPB 1AZEA 3UA6A 1K76A 4OMMA 3VS7A 4D8KA 1M30A 4JJDA 3M0SA 4J9DA 1PKTA 3I9QA 2DL4A 1K1ZA 1GCPA 2W10A 5GJVB 5ECAA 2KBTA 4OMOA 1SRMA 3VS3A 2GNCA 1E6GA 4ORZA 2CH4A 4E6RA 1JXMA 2DYBA 2EGAA 1SRLA 3PE0A 1FYNA 1QWEA 2M51A 1B3QA 1Y0MA 2CDTA 2DF6A 1OV3A 2J6OA 1VYUA 3C0CA 2J6KA 2KE9A 3NHNA 4IIOA 2RQRA 2LCSA 2V1RA 2DVJA 1UG1A 2AZSA 2FEIA 3LH5A 4J9FA 2F2XA 1X2KA 4OMNA 1JEGA 1SPKA 2NWMA 2KEAA 1M3CA 1HSQA 1X2QA 1GBRA 2DLPA 3PVLA 2RN8A 2XMFA 1GL5A 2EYXA 4K11A 1YP5A 2JMAA 1SHGA 2HCKA 3M0PA 4LNPA 2JTEA 3U23A 1MUZA 1SEMA 5IXFA 2DL8A 3VS0A 1RLPC 3H0HA 1ARKA 5I11A 2LJ1A 3H0IA 2AKKA 1NEGA 2GTOA 3NGPA 1I07A 1OOTA 2YSQA 4OMLA 1AWXA 3H0FA 4RTZA 1QKWA 2LNHB 2EVRA 2RNAA 1AOJA 1K0XA 3REBB 4DEYA 4AFZC 1WXTA 2A36A 2O9VA 1J3TA 1NYFA 3I5SA 3VS5A 2F2VA 2LX7A 2YUNA 2K6DA 1ZSGA 3EHQA 3KFVA 1ZUUA 1KJWA 2DL5A 1NLOC 2G6FX 4HXJA 1UTIA 2FRWA 1ZLMA 1IO6A 2CH4W 1BK2A 4IIMA 1M8MA 2RQTA 2SEMA 4RTTA 1OPLA 2DRKA 1N5ZA 1K9AA 3M0RA 2D8HA 3EG1A 1U06A 1TUDA 1UJ0A 1CSKA 2VKNA 2RQVA 4F17A 1SSHA 1AZGB 2J7IA 2QDLA 1UE9A 2JXBA 2ECZA 3REAB 4LE9A 4AG2C 1VA7A 2JM8A 4OMPA 2DX1A 1T0HA 1RLQC 1JU5C 2KR3A 2I0NA 2DL3A 1KSWA 1WA7A 1H3HA 5FWCA 2A08A 2L3PA 1NEBA 2EGCA 2JW4A 2LZ6B 4FSSA 1M3AA 2DBKA 4J9GA 4CC7A 2NUZA 1UDLA 3PVQA 1AWJA 1S1NA 2D1XA 2BZ8A 3GBQA 2CSQA 2FG0A 1YWOA 1QWFA 2FO0A 2J6FA 3IQLA 4J9EA 2CT3A 3NMZC 3SHWA 3EHRA 4RTVA 1H8KA 1BB9A 1BBZA 2EYWA 2LMJA 4GLMA 2DA9A 2GGRA 4GBQA 3QWYA 2C0TA 1V1CA 1UUEA 2ABLA 2DMOA 1H92A 4R0KA 1G2BA 1AWWA 2OJ2A 1AEYA 2DM1A 1A0NB 1AWOA 1XOVA 2K3BA 4J9HA 3UATA 1ZBJA 1B07A 1I0CA 4RTXA 2VVKA 1Z9QA 2JMCA 1UHFA 4JZ3A 3NPFA 2DILA 2IIMA 1VYTA 4QT7A 2CSIA 4Z89A 2DL7A 2ED0A 3VRYA 1AVZC 5EC7A 1TG0A 1NYGA 4EIKA 2KYBA 5FWBA 3UA7A 2SRCA 4A63B 1OPKA 3RBBB 3VS1A 1LCKA 2EBPA 2YT6A 2EPDA 1X27A 2HEQA 3ZL7C 4JJBA 5IH2A 3JV3A 1PNJA 1AD5A 3O5ZA 2RF0A 1YCSB 2KYMA 1BU1A 2KRMA 2KT8A
chains in the Genus database with same CATH superfamily
1WXUA 2BKDN 4WCIA 2O31A 1MMNA 2GQIA 2M0OA 2PVGB 4GY5A 3CC4A 2EGEA 2DZ9A 2H8HA 3CPFA 1K8AC 2DE0X 2QK0A 1JO8A 1M2VA 3HRUA 1ZSZC 2VUBA 3M4YA 3I55T 3M0UA 1D0YA 2OTLT 3EFRA 5LJ5g 4RUGA 3L2ZA 2KSSA 1YNZA 3H8ZA 3QSUA 1OI1A 3BW1A 4CC2A 3OYHA 4WF2A 4J6XA 3CMAQ 2QQRA 1U5SA 2A3LA 3SWNA 1QKXA 1KQSP 3LWIA 1WIEA 4OB0B 2KQWA 4O5VA 3OYEA 5KYYA 2M02A 4AT1B 3OYKA 4KRTA 3CBPA 2X4JA 1YCYA 4C8QF 2AZVA 2C06A 1HD3A 2DEQA 1QW1A 4HVUA 2CZ6B 3HHTB 5IHIA 3OS1A 1KG1A 1KQSA 2XICA 2CUBA 4ZGEB 1VQ4T 1VQNQ 4PJOF 2HNIA 4J9CA 4XTXA 2ED1A 3I55Q 3CC2A 1RI0A 3FJPA 2FVUA 1VQ9A 2AKLA 3RKXA 4QQ6A 2OTLQ 1WJQA 3L1AA 1SSFA 3GNFB 2EJFA 1OQKA 1BI1A 4ZN3A 4NS5A 3V7CA 1Q86R 4BD3A 1VYVA 1WQ7A 3OS5A 1VQ6Q 1Q95G 2ENMA 1VQPA 2FZCB 1VOMA 2KAFA 1PCXA 1RAIB 5GANj 3OYBA 4CC3A 5GAOq 2QA4T 1BKBA 1M27C 1B34A 4EMKC 1K4US 4OF1A 1GXIE 4IUUA 2KNBB 1VQ4Q 5CKDA 2DYIA 2JOYA 2MF2A 1FMWA 1ZSZA 3I35A 1PSFA 2OI3A 1ABOA 2KXCA 2K2VA 3M55A 1IRXA 4AFUC 1X6BA 3JCMe 3HFNA 1KIKA 2LQ8A 1R77A 5GAN7 2EYZA 4AFQC 1KFZA 1K8AR 2DTOA 3SEMA 1Y57A 4KH1B 3M9QA 1Z9ZA 1WYXA 1Q86U 3CCQT 3M54A 4RTUA 4LN2A 2RI5A 1W2BS 2XU8A 3FDRA 3G6EA 1PD1A 1ABQA 3M58A 1BI2A 2XHCA 1TTHB 1WHMA 1N9SA 2OAUA 3DKMA 2L3QA 2KT1A 5CKBA 4FW1A 3M5AA 1RACB 3MO8A 3UDCA 2K7AA 4LUEA 3EH2A 3FRNA 4VUBA 3CQTA 4Z88A 1YHQA 5LJ3e 2C0IA 4BI8B 3HKSA 4BI4A 3CD6A 3JCMJ 3OSSC 4PJJA 1OEBA 1K8AU 2E4HA 5FU6B 5HCKA 4JRIA 2YLCA 2HSEB 2BIVA 4JPBW 3JAME 2K4YA 2HMAA 2CREA 1Q7YC 3EGUA 2QQBA 2ROLA 1AZEA 2E41A 1M30A 5GMKi 1WNLA 1C1AA 4EMKA 1LPLA 4C5IA 3OYIA 2XIDA 4PNOA 5LJ5f 5ECAA 4XU2A 2FZKB 5GAN6 3RUXA 4FL6A 1E6GA 3V7SA 3OMGA 1FMVA 4DOVA 4KGVB 3X26B 1VQ5T 2NUPA 4C0ZA 2CDTA 1WHJA 2IG0A 3OYFA 3CCMA 2KE9A 3NHNA 4IIOA 4BE1A 1UG1A 3JRZA 2RHZA 4BY6C 3LH5A 2EQJA 4M7DB 1M3CA 2EWNA 3PGGA 1X2QA 3S3OA 1TU0B 4QVDA 2D0QB 3PVLA 2RN8A 1GL5A 1H641 3META 2E65A 2V26A 3GOXA 1X01A 2DL8A 5GAN2 1QVGP 2BE7D 4M77B 3X20B 1RAFB 3NGPA 2RHIA 1AWXA 3G4ST 1EX4A 4RTZA 2K57A 2EVRA 2Z0WA 1AOJA 3REBB 1F1BB 4FYYB 1VQ5Q 1UGSB 3X24B 3RDVA 3RMSA 1YJWT 3OQ5A 2LX7A 4KUDK 1I5LA 3KFVA 1ZUUA 3JCMb 1QCOA 3CCET 3LYIA 1VQ7T 1MHNA 1OPLA 1N5ZA 4HCCA 1K9AA 4ZTFA 1YJNT 1I81A 2D8HA 1K73C 1CSKA 2BE9B 1SSHA 3G1JA 2H3EB 1UE9A 4C8QB 3FB9A 1VQLT 5KYXB 3REAB 2P84A 2EYQA 3G4SQ 1Q7YR 1JU5C 4M7DD 1WA7A 3P8HA 4PJOB 3A1PA 3PMIA 4EPCA 1YJWQ 1OYXA 3G7ZA 2DBKA 4J9GA 2JNGA 2NUZA 4DBFA 1Y07A 3CCEQ 4HT8A 1VQ7Q 4M77D 3OB9A 4L5GA 2A7YA 2L5QA 2LMJA 3G71T 2GGRA 2P0QA 4GBQA 3S6WA 3QWYA 1UUEA 2ABLA 2LCLA 1KK7A 4R0KA 1H92A 4M7AG 1EZZB 2CS7A 1AEYA 4QKUA 2IVWA 1G3WA 3MHXA 3UATA 1B07A 1I0CA 3MP8A 3VYHB 1Q7YU 2VVKA 1UHFA 1QP3A 2DILA 1FWZA 1VYTA 3PNWC 2EAYA 4PFPA 3CCSA 1AVZC 2QI2A 5IT9E 1PG5B 1LVKA 3UA7A 1U8RA 5CKEA 3JCMQ 2YT6A 5FU7B 1MNDA 3LW5E 2RHXA 3E1SA 4C8QD 5IH2A 2X9HA 5C0MA 3QO3A 3G71Q 1YI2T 5AT1B 3OYNA 1I5OB 2KRMA 2KT8A 5CKFA 4PJOD 2D9TA 1UB4A 4CC4B 2C0OA 5A0DA 2PNIA 4JS4A 1VQMA 3JB9G 2DK3A 3HRTA 3OYCA 2A28A 4F7UB 1X6GA 1W6XA 1YITA 2GTJA 2B86A 3H6ZA 5HY6A 4EMGA 3EH1A 3Q1JA 1K73R 1KC8C 3AHUA 3A98A 4M7AC 4QVZA 2CP5A 2JVVA 1VQ8T 2L3SA 1YN8A 1CKBA 1WHGA 2DNUA 5CR2A 5GAN5 3OYYA 4O6JA 2QASA 3OSVA 2YUQA 3TSWA 4BE2A 1IGUA 2FPDA 1Y96B 2NLUA 2ZGWA 1XNIA 4DEXA 2FRYA 3TSZA 3A8LB 1SHFA 1PC0A 4X34A 3UF4A 2EFIA 4KULA 5GAOl 4HVWA 4XU3A 2MCNA 2DTHA 5GAMg 3A8GB 2VGMA 3SWNC 1V29B 2O9SA 5LJ3j 2QEXA 4E7SA 3KUFA 5D6WA 2RJCA 5A0LA 3J81E 2ZPBB 2D6FA 1K9MC 2O2OA 1K73U 4JRKA 1BIBA 3M4GA 2RQWA 1E6HA 4CI0C 4M7AE 1K0SA 4F16A 2EQMA 1G83A 4E7LA 1FMKA 4FT4A 3CC4Q 4M75B 2LJ3A 2JS0A 2NUTB 2ZPHB 1W70A 2CZ1B 4KUIA 3OW2A 3QDFA 3I56T 3E9FA 1KQSS 3CC2T 1EIFA 2CP6A 3L2WA 4B6MA 2HL3A 2AT1B 4J6YA 3BDLA 2D8JA 2RQUA 3WVEB 4C92C 2CP3A 3QYGB 1WPYA 1X69A 2VWFA 4NL3A 2DIGA 3VKIA 2HBPA 4HCKA 1D0ZA 1TWBA 1MV3A 3TQ7P 1W1FA 4EDUA 1ZUYA 1VQPT 2YDLA 1T3LA 4M78B 2JT4A 4E7KA 2E1HA 2DJQA 3UT1A 5KYWA 1UECA 3MP1A 1VQNT 2HZYA 1QVPA 1GCQA 2L2PA 4C5EA 2LTOA 1EFNA 1WHLA 4NL2A 4A4GA 2IPOB 1YWPA 2CZ7B 4C5HA 5HK3A 2K5FA 3I56Q 1YIJA 1KC8R 3CC2Q 4M7AF 2O88A 1VQ9Q 2X4XA 2KXDA 4JUVA 1U3OA 1RUWA 3V7RA 4FYVB 2F1LA 2RK1A 2X3WD 2G3RA 5GANg 2GBQA 4LUDA 3EFSA 4M75D 1MMGA 2V1QA 2RMOA 1QVFP 1VQ6T 1GRIA 4E47A 1VQPQ 2PZ1A 2ZAEA 1N9RA 3RR6A 5KYXA 2F5TX 5CK9A 4IUPA 3G6ET 1PRMC 4ZTJA 4AG1C 2PVOB 5D7UA 3CPWS 3CCVA 1W4SA 1GFDA 2P0PA 3CXCA 1QVFA 1KQ1A 1TS9A 1PHTA 5FRNA 2DXTA 1WLPB 4JDSA 1K9MR 1KC8U 3INZA 4OMMA 4ZGDB 2VYTA 1M90C 2DXUA 3JB9F 1S72A 4C92A 5KYUB 2JUFA 1K1ZA 2W10A 4M78D 4OMOA 2DERA 3CD6T 2CP2A 1G3YA 4ORZA 4E6RA 1JXMA 3C4SA 3MEWA 3J80E 4KBMB 1M8VA 2ZPFB 2A0FB 4MDXA 1FYNA 1KQ2A 3GF5A 1Y0MA 2MYSA 2DF6A 1AT1B 3G6EQ 1OV3A 2J6OA 3HTRA 2J6KA 3QKJA 2LCSA 2HKQB 3QJYA 3JCMd 2FB7A 4BUGA 4HCBA 4J7IA 2O4XA 1SG5A 1YI2A 1K9MU 2MMPA 5GAMf 1SHGA 2HCKA 3M0PA 4LDVA 1MMAA 4LNPA 1YHQQ 3L2VA 5IXFA 1OU9A 4XTVA 1N27A 4PFOA 3X25B 3TREA 2HKNA 4A4HA 1ARKA 3PMTA 4LDUA 3H0IA 2GTOA 3CD6Q 4FW2A 1OOTA 2YSQA 4FU6A 2E64A 2VGNA 3H0FA 5GMKl 3LGLA 1QKWA 3PTAA 2DJZA 4XTZA 4N0AA 3VUZA 3HFOA 2YRVA 3SB2A 4F7UA 1J3TA 1RAEB 5A0GA 5LJ3d 2YUNA 1VQKA 3EHQA 4XTUA 1NLOC 3QZ5B 3TEEA 1IO6A 1M8MA 2SEMA 3HSBA 3P8DA 3DLLA 2DRKA 4OGCA 4FYWB 1JRIA 2QXFA 4JJNK 3CCRA 1D0XA 3BE3A 3EG1A 1KHIA 1UJ0A 5FROA 3QZ9B 3TCJA 3EG9A 3WXMB 1SKUB 3A8OB 4AMCA 4KGZB 3CCJA 1VA7A 2GCXA 2DX1A 1T0HA 1RLQC 1QVGS 2I0NA 2LC4A 2DL3A 2COWA 5KYNA 4IUQA 1KSWA 1M90R 4L59A 1D3BB 1JBMA 4RG8A 1TOVA 4EMHA 3CC7A 1UGQB 1NEBA 2R58A 3NTKA 2JW4A 2LZ6B 4QVCA 4FSSA 2E5QA 3EFOA 5GAMd 1UDLA 4A4FA 2D1XA 1MNEA 2BZ8A 3DB3A 2CSQA 2JJ9A 1RABB 4IUTA 2FG0A 4J9EA 2QA4A 1VIEA 4JLIA 1BBZA 2XK0A 4A4EA 1WHHA 4GLMA 2RJDA 4IKFA 5GAN3 5GANf 2C0TA 4C0DB 4M75A 4OVAA 4JS5A 1AWWA 3C94A 1W2BP 5KH6A 1IZ6A 3EGXA 3V8JA 1XOVA 2K3BA 2QG9B 1KD1C 2CP0A 1ZBJA 2K3XA 1ZQ1A 5KE3A 4ZN1A 4BACA 2IIMA 1M90U 3E9GA 2CSIA 4Z89A 3VRYA 1U1TA 2ED0A 1W2BA 4EIKA 2SRCA 2X35A 3RBBB 3CCQA 1LCKA 2ZPEB 1V76A 2E3HA 2ZPGB 1JJ2P 3MP6A 4Q5WA 4JJBA 4M78A 1VQOA 1PNJA 1AD5A 4J8OA 5D6XA 2AIRB 3SDZA 2RF0A 3OS0A 1YCSB 3PIOA 2JZ2A 1WJSA 3JB9I 3LWHA 1MV0B 3GLXA 1JJ2A 4M7AB 3CCST 1M4ZA 1T0JA 4M4ZA 1BI0A 4Z8AA 2DAQA 4J7FA 3QWXX 3OMCA 3THKA 1G8XA 1ZA1B 2JS2A 2Y90A 3JCMh 5CAIA 2VC8A 4MMKA 4XTWA 1M2VB 2QQSA 1WI7A 2X3XD 2KROA 3TU4K 4ESRA 2CZ0B 3S3MA 1M1KC 5GANd 1WFWA 2RI3A 1T3SA 1VQMT 3J7AF 5FW9A 2MIOA 2JM9A 4E7ZA 4ME7A 4E2FB 2GFUA 3CBOA 5EG2A 3WVDB 2MOXA 3A8MB 1RAGB 1YITT 3CEYA 2K5IA 2BTTA 5KYYB 1FX7A 1ZA2B 3JB9J 1TSFA 1PKSA 1E7OA 3CCSQ 6AT1B 3L2QA 2JTMA 3I5RA 1LJOA 4DOWA 2DTIA 5LJ5e 3HP9A 2HBWA 3MPUB 5GJWB 2LJ0A 2P4RA 3LH0A 5LJ3h 2OAWA 2E12A 2QYZA 3AT1B 5CIUA 5IXBA 4MZMA 2KVQG 1NBEB 2RH2A 1BI3A 2EJGA 5FU6C 1Q82C 1PD0A 3ASKA 1MMDA 1HJDA 4AFSC 4D8DA 2HSPA 2CT4A 3RESA 2MPXC 1VQMQ 2V8IA 5GAN4 2DRMA 1KD1R 4M7AD 3EG2A 3JCMg 3CBMA 3QIIA 3M0TA 4HKEA 5GMKe 3E2UA 1YITQ 4D6WA 1WX6A 2E5KA 2VXEA 2OTJT 4RTWA 2QGGA 1WZOA 2AK5A 2CUDA 4J9BA 5M9OA 3RKWA 4OP0A 2VXFA 4YTLA 1B34B 2HQEA 4QQGA 4LD6A 1X43A 2QQ9A 5GAMh 2Y4YA 3GPLA 1ZSZB 3H9NA 2KRNA 2KI7A 3QBYA 4HVVA 4M7DC 3ME9A 1KHCA 2E70A 3RIRA 2FPEA 3RMQA 4F04B 5LJ3g 2YRDA 2L0AA 1KD1U 4MMLA 1VIFA 5DM7R 2DKGA 1YJNA 2WACA 1UGVA 1M1FA 1UGPB 2LQWA 1PWTA 1QQJA 4LD9K 1R0CB 1XTDA 2K3YA 2V8KA 1UJYA 4M77C 3OBYA 4FCYA 1VQLA 1PRLC 2W0ZA 2OTJQ 2LT1A 1M1KR 4ELZC 5GAN8 2MWOA 1HXDA 2XDBA 2RJEA 4C92G 3FC3A 2DEUA 2XDDA 3CC4T 2EW3A 4IUVA 4PLIA 3EG0A 4RG2A 4RTYA 4BDYA 1GCQC 2DVEA 2K9GA 2J05A 2BUDA 4B9XA 3FJ5A 3F70A 4C0FA 2KDSA 1BIAA 4C5GA 2DFUA 3VS2A 3M56A 3M53A 2Y4XA 5GAOr 1GFCA 3C95A 2ESWA 4Y91A 1Y7XA 3L2UA 4KT0E 1M9SA 1NZ9A 2B8AA 2EJ9A 2NYSA 2RA2A 5CVIA 3UA6A 1K76A 2COZA 4J9DA 3OW2P 4C8QC 1Q82R 5I21A 1PKTA 3RKYA 4PKCC 1TH7A 3A8HB 5GJVB 2XKOC 1M1KU 3QG1A 5L8RE 2L3RA 4RCBA 3VS3A 4A4KA 4EMKB 1OULA 2CH4A 2DXCA 4KH0B 2WSFE 4PJOC 2EGAA 3PE0A 2YRCA 5GANh 1QWEA 2M51A 1YJ9A 3L2RA 1VQ9T 1VYUA 4LXCA 3C0CA 3VJPA 4M7DA 2ATCB 2DVJA 2YLBA 2NUPB 1NPRA 1S72T 4J9FA 4F7UG 1X2KA 4OMNA 1NPPA 1SPKA 2NWMA 3CCUA 2KEAA 4Y28E 1WJRA 4QW2A 1GBRA 3OA6A 1HYOA 2DLPA 1R0BG 2XMFA 2AHJB 2EYXA 1YP5A 1JB0E 2DO3A 2RHUA 4M77A 2YXYA 1G5VA 2JTEA 3U23A 1Q82U 1BYMA 2L8DA 3OS2A 4FYXB 2PUKB 3VS0A 2RD1A 3JCMW 1WGSA 3H0HA 5HKCA 1X6OA 5I11A 1NEGA 1OX9A 1I07A 8AT1B 1RADB 2LNHB 2R5AA 2RNAA 4DEYA 4B9WA 1HK9A 4AFZC 3JCMf 3V8LA 2A36A 1NYFA 3I5SA 1VQ8A 2F2VA 3MJXA 3LGFA 5FU7C 4HCZA 2VV5A 1ZSGA 1S72Q 3EAEA 2CGHA 1KJWA 2DL5A 7AT1B 3L42A 2MI6A 4HXJA 2RJFA 1OU8A 2FRWA 1ZLMA 2LX9A 4C92E 3CCLA 4II1A 4XU0A 2CH4W 4CRIA 2RB6A 4RTTA 5I2MA 3CXCP 4PLLA 4RMOA 2QGFB 2XDPA 4N0AC 4OGEA 3E19A 1U06A 2EKOA 4C8QA 4BB7A 3OYDA 1ZBXA 1YBYA 2J7IA 3VV0A 2QDLA 4RKUE 4M75G 2JXBA 4LE9A 4AG2C 4PJOA 1VQKT 5D6YA 4DA4A 4GLKA 2FZGB 2KY9A 3VYGA 2PQWA 4N4HA 5LJ3f 3NFCA 3CMEA 1IREB 1H3HA 5FWCA 1YI2Q 3M57A 1C0MA 2EGCA 3CCRT 1U1SA 2HQHA 1YHQT 1FXXA 4FM4B 4CC7A 4LDYA 4IURA 3PVQA 1S1NA 3GBQA 1YWOA 2J6FA 4BY6B 4OMFB 3IQLA 1PSEA 3SFMA 4JLGA 2QTVA 3I56A 2CT3A 3CCJT 2VB6A 4RTVA 1H8KA 2DD4A 2DA9A 2H3JA 3QDRB 4M78G 1WQWA 5KCHA 2DMOA 3ZEHA 5LJ5j 3OY9A 3CMAA 4C92F 5IAYA 1G2BA 2VASA 4ZGJB 3CC7T 2DM1A 1NJIC 4F7UE 1VQKQ 4E7HA 1X75C 4L6V5 1N6AA 1N8RC 1Z9QA 3HPWA 4FT2A 4JZ3A 4DQ2A 2DIQA 3M59A 4E7JA 3CCRQ 2DL7A 5EC7A 4J6WA 4M75C 1O75A 1NYGA 5CQXA 2KYBA 5FWBA 4A63B 1VQNA 1OPKA 3CCMT 2EBPA 2EPDA 1X27A 5GMKj 2HEQA 3I55A 2DD5A 4V2SA 2LQKA 3ZL7C 2EIFA 3FLGA 3CCJQ 3JV3A 2OTLA 1IXDA 1BCOA 5DLQE 2RI2A 3O5ZA 3NTHA 3CPWP 3OYLA 4XQ3A 2KYMA 1BU1A 4QQDA 4DBRA 2KRSA 5GAOp 1VUBA 3VS4A 3GP8A 1WDXA 3CC7Q 2HDAA 4OB1B 5L23A 5LL6S 4E7IA 1LOJA 3A5ZB 2M1HA 1VQ6A 3OYGA 2YUPA 1IHWA 1UHCA 3QUIA 3N5BB 3CPWA 2M0YA 2QTXA 1WXBA 3UWNA 2QA4Q 3MEUA 1QLYA 4M78C 4PL6A 1O9SA 2A37A 1VQOT 2HL5C 2LQNA 4F7UF 3OYAA 2LCCA 3H41A 3QHSA 4N4GA 2K79A 2K2MA 2LVMA 1VQ4A 1D1AA 4JZ4A 1OZ2A 3CCMQ 3JCMX 1AHJB 4M75E 1Y96A 1BCMA 3KBGA 3VUBA 3RNJA 4KGXB 4J5YA 1JJ2S 3JCMc 3M0QA 1UFFA 3R6NA 3D7SB 4X9DA 4P5NA 3P8BB 3EG3A 5I2SA 2RK2A 2JN0A 5FRMA 1PM3A 2DBMA 3ZBDA 3CCQQ 1ZX6A 5GAOm 4ANJA 4R56A 3GIBA 5C6SA 1GBQA 1VQOQ 2KGTA 2MAMA 2RPNA 4M78E 2R5MA 3OBWA 3RERA 2EKHA 1JQQA 2D0NA 2BZXA 4Y92A 2NUTA 1NJIR 3FIFA 1QCFA 2YUOA 3T9NA 2P4TA 1N8RR 4A54A 4LDXA 2E6NA 2MWPA 5GAMe 3QPHA 4R55A 2BZYA 3DLMA 4M75F 2QDYB 5I22A 1M3BA 5KE2A 1NG2A 1RI9A 1MGQA 2QAZA 1QCNA 3EGDB 2FPFA 4OMQA 3BFMA 3VRZA 2X4YA 2EQIA 4LDWA 4X1VA 2ROTA 2PTKA 2O01E 1D1BA 2EYYA 1TUCA 2OX7A 5IHKA 4JJCA 1IHVA 3QJ6A 1NJIU 3TVTA 3UPUA 3KXTA 1NE8A 3ER0A 3OYJA 1M1GA 2RO0A 3VS6A 1N8RU 4JRPA 4M78F 3GNGA 4DBQA 5KYWB 2FHDA 3DB4A 4ZNXA 2CKKA 1QVGA 5AYFA 1QMCA 5J3BA 5IN1A 4BDZA 4DBHA 3ULRB 2DPPB 8ATCB 4XU1A 5LJ5d 2ZPIB 3MCAB 1OX8A 2M16A 5KCOA 1M5Q1 3SWNB 4OB3B 2HAXA 1JXOA 1NLPC 1TUGB 4F14A 3ZFJA 1QP2A 2LRQA 1R8OB 2LP5A 4JRQA 1ZUKA 1NM7A 1I1JA 1Q81C 1DJ7B 2E6ZA 4M7DG 5GAOn 1CKAA 2J06A 9ATCB 2F2WA 2L89A 4XAXB 1VQ5A 4A53A 2RM4A 4J9IA 4PJLA 2PU9B 1G3TA 5IHNA 1RAAB 3NTIA 5KYUA 3VS7A 4D8KA 4JJDA 5GANe 5HK0A 3M0SA 5J26A 1LNXA 1ACMB 3I9QA 3QYHB 2DL4A 1P92A 3QXEB 4M77G 1GCPA 2COYA 2KBTA 3X28B 1SRMA 2LT4A 2GNCA 1XQHA 4C92B 2DYBA 3LX7A 3LLRA 1SRLA 4PK4A 4MZPA 1YJNQ 1B3QA 4C0GA 2QEXT 4PFZA 2XD0A 2XG8D 2ZCFB 2RQRA 2V1RA 2V8JA 2AZSA 2R57A 3PFSA 2FEIA 1VQLQ 2EQKA 2F2XA 3G4SA 2DXBA 1B7TA 2WSEE 1JEGA 2E10A 2YHTA 3BY7A 4MDWA 2KMTA 1HSQA 2P0KA 1UEBA 4C0DC 1YJWA 4N4IA 1ZHIA 4K11A 1SF9A 1G3SA 3FEOA 2JMAA 4FSXA 2X4WA 4BE0A 2O4XB 1YJ9T 1MUZA 1SEMA 1RLPC 2HQXA 1IB8A 4C8QG 3CCEA 2LJ1A 1OZ3A 2AKKA 1I8FA 1XJWB 1VQ7A 3OW2S 4OMLA 1YFNA 4XTYA 3CCUT 2DZCA 3JB9D 2CYZB 4XK8E 1K0XA 4PJOG 3C12A 4TVRA 2QEXQ 2F5KA 1WXTA 1RL2A 2GFAA 4ELYC 2O9VA 5GMKm 3VS5A 2K6DA 3O8VA 1IGQA 2LDMA 5CKHA 3JCMP 2K5LA 2G6FX 1UTIA 5FLXE 2X51A 1BK2A 4IIMA 2RQTA 3JSCA 3HRSA 4PJMA 4C92D 2YWWA 3PT9A 4PJNA 3M0RA 1TUDA 2CP7A 1YJ9Q 2VKNA 1C6VX 2RQVA 4UC4A 4WTOB 1YIJT 4F17A 1AZGB 3MEVA 2HD0A 1Q81R 4FIBA 5CQYA 4OB2B 2ECZA 2F69A 2RHYA 3OYMA 4M7DE 1RAHB 3MKDA 1D3BA 3CCUQ 2JM8A 4J83A 3EG9B 4NOYA 4OMPA 3SD4A 3G71A 2KR3A 5CCAA 3CCLT 2PUOB 2A08A 2L3PA 5A2QE 4Z02A 1M3AA 5J39A 2GF7A 4MZTA 4M77E 1UGRB 2DETA 1AWJA 4X9CA 2FO0A 1QWFA 3CCVT 3EFOB 3NMZC 3SHWA 3EHRA 1BB9A 2EYWA 2ZZDA 2QQAA 4ATOA 2OTJA 1V1CA 1WHKA 1YIJQ 3CMET 2EQUA 5DLOA 3R6OA 5LJ5h 3CXCS 1QVFS 3VU3C 2FYKA 1VQ8Q 2OJ2A 4HA8A 1Q81U 3S3NA 1A0NB 1I4K1 1AWOA 2MK5A 5DY9A 4J9HA 3PIPA 3JB9H 1Q86C 4RTXA 1H3ZA 3V8KA 2I2LA 3CCLQ 2JMCA 3EGXB 3NPFA 2E3IA 4QT7A 4BI3A 3EGDA 4M7DF 2FL7A 2KK4A 2JTFA 3BDUA 1TG0A 2GQVA 3URGA 2LNVA 4HT9A 1D1CA 4RCCA 4C8QE 3CMAT 3VS1A 1D09B 5GMKh 2XI9A 1Y71A 3JCMV 3CCVQ 5CO7A 5GAMj 2PVDB 3HL8A 2WSCE 4PJOE 1M2OA 4M7AA 1TXQA 3MEAA 4M77F 2M9UA 3CMEQ
chains in the Genus database with same CATH topology
1WXUA 2KRSA 3VS4A 4CC4B 1MV0B 1WDXA 2C0OA 2HDAA 2PNIA 2O31A 4WCIA 2GQIA 1T0JA 4M4ZA 5L23A 2EGEA 2H8HA 4Z8AA 2A28A 2DE0X 3QWXX 1X6GA 1JO8A 2YUPA 1W6XA 3THKA 1UHCA 2GTJA 2B86A 2JS2A 2M0YA 1WXBA 3M0UA 1QLYA 2A37A 4RUGA 1WI7A 2LQNA 2X3XD 2KROA 3A98A 1YNZA 4ESRA 3H41A 2K79A 2K2MA 4CC2A 4JZ4A 1WFWA 2L3SA 1U5SA 1YN8A 1CKBA 1QKXA 2DNUA 1T3SA 1WIEA 5FW9A 2MIOA 2JM9A 3RNJA 2YUQA 2MOXA 3TSWA 4KRTA 3M0QA 2FPDA 2BTTA 1UFFA 3R6NA 2AZVA 4DEXA 2FRYA 3TSZA 1HD3A 4HVUA 1SHFA 3UF4A 1PKSA 1E7OA 5IHIA 3EG3A 4HVWA 3I5RA 2CUBA 2MCNA 2DBMA 4J9CA 2HBWA 5GJWB 2LJ0A 2P4RA 1ZX6A 2ED1A 2O9SA 2OAWA 2AKLA 5IXBA 1GBQA 2O2OA 2KGTA 2RPNA 2RQWA 2EKHA 1E6HA 1JQQA 2D0NA 2BZXA 4Y92A 1HJDA 1K0SA 4AFSC 4D8DA 4F16A 1G83A 2HSPA 1FMKA 2CT4A 1QCFA 2LJ3A 2DRMA 2YUOA 2JS0A 3EG2A 1VYVA 3M0TA 2ENMA 1W70A 4CC3A 1M27C 1WX6A 2BZYA 2E5KA 5I22A 1M3BA 2D8JA 2RQUA 1K4US 1NG2A 1RI9A 4RTWA 2KNBB 1X69A 2VWFA 2AK5A 2CUDA 4J9BA 2FPFA 4OMQA 4HCKA 3VRZA 2EQIA 4X1VA 3I35A 2OI3A 2ROTA 1ABOA 2KXCA 2PTKA 1X43A 1MV3A 1W1FA 2EYYA 1TUCA 1ZUYA 4AFUC 5IHKA 1X6BA 2KRNA 2YDLA 1T3LA 1KIKA 4HVVA 2JT4A 4JJCA 2EYZA 4AFQC 1KFZA 3SEMA 2FPEA 1Y57A 2DJQA 1UECA 2L0AA 1Z9ZA 3TVTA 1WYXA 2L2PA 1GCQA 3VS6A 4RTUA 1EFNA 1UGVA 4LN2A 2LQWA 1PWTA 1YWPA 1ABQA 2O88A 4ZNXA 2KXDA 1UJYA 1U3OA 2L3QA 2KT1A 1PRLC 2W0ZA 1RUWA 2X3WD 3ULRB 2K7AA 2EW3A 4LUEA 2GBQA 3EG0A 4RTYA 4LUDA 2V1QA 1GCQC 2RMOA 1GRIA 2K9GA 2J05A 3CQTA 4Z88A 1JXOA 1NLPC 3FJ5A 2PZ1A 4F14A 2C0IA 2LP5A 3VS2A 1PRMC 1ZUKA 1NM7A 4AG1C 1I1JA 1GFCA 1GFDA 1OEBA 2ESWA 5HCKA 1CKAA 2J06A 4JPBW 2F2WA 2CREA 3EGUA 1PHTA 4J9IA 5IHNA 2ROLA 1WLPB 1AZEA 3UA6A 1K76A 4OMMA 3VS7A 4D8KA 1M30A 4JJDA 3M0SA 4J9DA 1PKTA 3I9QA 2DL4A 1K1ZA 1GCPA 2W10A 5GJVB 5ECAA 2KBTA 4OMOA 1SRMA 3VS3A 2GNCA 1E6GA 4ORZA 2CH4A 4E6RA 1JXMA 2DYBA 2EGAA 1SRLA 3PE0A 1FYNA 1QWEA 2M51A 1B3QA 1Y0MA 2CDTA 2DF6A 1OV3A 2J6OA 1VYUA 3C0CA 2J6KA 2KE9A 3NHNA 4IIOA 2RQRA 2LCSA 2V1RA 2DVJA 1UG1A 2AZSA 2FEIA 3LH5A 4J9FA 2F2XA 1X2KA 4OMNA 1JEGA 1SPKA 2NWMA 2KEAA 1M3CA 1HSQA 1X2QA 1GBRA 2DLPA 3PVLA 2RN8A 2XMFA 1GL5A 2EYXA 4K11A 1YP5A 2JMAA 1SHGA 2HCKA 3M0PA 4LNPA 2JTEA 3U23A 1MUZA 1SEMA 5IXFA 2DL8A 3VS0A 1RLPC 3H0HA 1ARKA 5I11A 2LJ1A 3H0IA 2AKKA 1NEGA 2GTOA 3NGPA 1I07A 1OOTA 2YSQA 4OMLA 1AWXA 3H0FA 4RTZA 1QKWA 2LNHB 2EVRA 2RNAA 1AOJA 1K0XA 3REBB 4DEYA 4AFZC 1WXTA 2A36A 2O9VA 1J3TA 1NYFA 3I5SA 3VS5A 2F2VA 2LX7A 2YUNA 2K6DA 1ZSGA 3EHQA 3KFVA 1ZUUA 1KJWA 2DL5A 1NLOC 2G6FX 4HXJA 1UTIA 2FRWA 1ZLMA 1IO6A 2CH4W 1BK2A 4IIMA 1M8MA 2RQTA 2SEMA 4RTTA 1OPLA 2DRKA 1N5ZA 1K9AA 3M0RA 2D8HA 3EG1A 1U06A 1TUDA 1UJ0A 1CSKA 2VKNA 2RQVA 4F17A 1SSHA 1AZGB 2J7IA 2QDLA 1UE9A 2JXBA 2ECZA 3REAB 4LE9A 4AG2C 1VA7A 2JM8A 4OMPA 2DX1A 1T0HA 1RLQC 1JU5C 2KR3A 2I0NA 2DL3A 1KSWA 1WA7A 1H3HA 5FWCA 2A08A 2L3PA 1NEBA 2EGCA 2JW4A 2LZ6B 4FSSA 1M3AA 2DBKA 4J9GA 4CC7A 2NUZA 1UDLA 3PVQA 1AWJA 1S1NA 2D1XA 2BZ8A 3GBQA 2CSQA 2FG0A 1YWOA 1QWFA 2FO0A 2J6FA 3IQLA 4J9EA 2CT3A 3NMZC 3SHWA 3EHRA 4RTVA 1H8KA 1BB9A 1BBZA 2EYWA 2LMJA 4GLMA 2DA9A 2GGRA 4GBQA 3QWYA 2C0TA 1V1CA 1UUEA 2ABLA 2DMOA 1H92A 4R0KA 1G2BA 1AWWA 2OJ2A 1AEYA 2DM1A 1A0NB 1AWOA 1XOVA 2K3BA 4J9HA 3UATA 1ZBJA 1B07A 1I0CA 4RTXA 2VVKA 1Z9QA 2JMCA 1UHFA 4JZ3A 3NPFA 2DILA 2IIMA 1VYTA 4QT7A 2CSIA 4Z89A 2DL7A 2ED0A 3VRYA 1AVZC 5EC7A 1TG0A 1NYGA 4EIKA 2KYBA 5FWBA 3UA7A 2SRCA 4A63B 1OPKA 3RBBB 3VS1A 1LCKA 2EBPA 2YT6A 2EPDA 1X27A 2HEQA 3ZL7C 4JJBA 5IH2A 3JV3A 1PNJA 1AD5A 3O5ZA 2RF0A 1YCSB 2KYMA 1BU1A 2KRMA 2KT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXU A;  2KRS A;  3VS4 A;  4CC4 B;  1MV0 B;  1WDX A;  2C0O A;  2HDA A;  2PNI A;  2O31 A;  4WCI A;  2GQI A;  1T0J A;  4M4Z A;  5L23 A;  2EGE A;  2H8H A;  4Z8A A;  2A28 A;  2DE0 X;  3QWX X;  1X6G A;  1JO8 A;  2YUP A;  1W6X A;  3THK A;  1UHC A;  2GTJ A;  2B86 A;  2JS2 A;  2M0Y A;  1WXB A;  3M0U A;  1QLY A;  2A37 A;  4RUG A;  1WI7 A;  2LQN A;  2X3X D;  2KRO A;  3A98 A;  1YNZ A;  4ESR A;  3H41 A;  2K79 A;  2K2M A;  4CC2 A;  4JZ4 A;  1WFW A;  2L3S A;  1U5S A;  1YN8 A;  1CKB A;  1QKX A;  2DNU A;  1T3S A;  1WIE A;  5FW9 A;  2MIO A;  2JM9 A;  3RNJ A;  2YUQ A;  2MOX A;  3TSW A;  4KRT A;  3M0Q A;  2FPD A;  2BTT A;  1UFF A;  3R6N A;  2AZV A;  4DEX A;  2FRY A;  3TSZ A;  1HD3 A;  4HVU A;  1SHF A;  3UF4 A;  1PKS A;  1E7O A;  5IHI A;  3EG3 A;  4HVW A;  3I5R A;  2CUB A;  2MCN A;  2DBM A;  4J9C A;  2HBW A;  5GJW B;  2LJ0 A;  2P4R A;  1ZX6 A;  2ED1 A;  2O9S A;  2OAW A;  2AKL A;  5IXB A;  1GBQ A;  2O2O A;  2KGT A;  2RPN A;  2RQW A;  2EKH A;  1E6H A;  1JQQ A;  2D0N A;  2BZX A;  4Y92 A;  1HJD A;  1K0S A;  4AFS C;  4D8D A;  4F16 A;  1G83 A;  2HSP A;  1FMK A;  2CT4 A;  1QCF A;  2LJ3 A;  2DRM A;  2YUO A;  2JS0 A;  3EG2 A;  1VYV A;  3M0T A;  2ENM A;  1W70 A;  4CC3 A;  1M27 C;  1WX6 A;  2BZY A;  2E5K A;  5I22 A;  1M3B A;  2D8J A;  2RQU A;  1K4U S;  1NG2 A;  1RI9 A;  4RTW A;  2KNB B;  1X69 A;  2VWF A;  2AK5 A;  2CUD A;  4J9B A;  2FPF A;  4OMQ A;  4HCK A;  3VRZ A;  2EQI A;  4X1V A;  3I35 A;  2OI3 A;  2ROT A;  1ABO A;  2KXC A;  2PTK A;  1X43 A;  1MV3 A;  1W1F A;  2EYY A;  1TUC A;  1ZUY A;  4AFU C;  5IHK A;  1X6B A;  2KRN A;  2YDL A;  1T3L A;  1KIK A;  4HVV A;  2JT4 A;  4JJC A;  2EYZ A;  4AFQ C;  1KFZ A;  3SEM A;  2FPE A;  1Y57 A;  2DJQ A;  1UEC A;  2L0A A;  1Z9Z A;  3TVT A;  1WYX A;  2L2P A;  1GCQ A;  3VS6 A;  4RTU A;  1EFN A;  1UGV A;  4LN2 A;  2LQW A;  1PWT A;  1YWP A;  1ABQ A;  2O88 A;  4ZNX A;  2KXD A;  1UJY A;  1U3O A;  2L3Q A;  2KT1 A;  1PRL C;  2W0Z A;  1RUW A;  2X3W D;  3ULR B;  2K7A A;  2EW3 A;  4LUE A;  2GBQ A;  3EG0 A;  4RTY A;  4LUD A;  2V1Q A;  1GCQ C;  2RMO A;  1GRI A;  2K9G A;  2J05 A;  3CQT A;  4Z88 A;  1JXO A;  1NLP C;  3FJ5 A;  2PZ1 A;  4F14 A;  2C0I A;  2LP5 A;  3VS2 A;  1PRM C;  1ZUK A;  1NM7 A;  4AG1 C;  1I1J A;  1GFC A;  1GFD A;  1OEB A;  2ESW A;  5HCK A;  1CKA A;  2J06 A;  4JPB W;  2F2W A;  2CRE A;  3EGU A;  1PHT A;  4J9I A;  5IHN A;  2ROL A;  1WLP B;  1AZE A;  3UA6 A;  1K76 A;  4OMM A;  3VS7 A;  4D8K A;  1M30 A;  4JJD A;  3M0S A;  4J9D A;  1PKT A;  3I9Q A;  2DL4 A;  1K1Z A;  1GCP A;  2W10 A;  5GJV B;  5ECA A;  2KBT A;  4OMO A;  1SRM A;  3VS3 A;  2GNC A;  1E6G A;  4ORZ A;  2CH4 A;  4E6R A;  1JXM A;  2DYB A;  2EGA A;  1SRL A;  3PE0 A;  1FYN A;  1QWE A;  2M51 A;  1B3Q A;  1Y0M A;  2CDT A;  2DF6 A;  1OV3 A;  2J6O A;  1VYU A;  3C0C A;  2J6K A;  2KE9 A;  3NHN A;  4IIO A;  2RQR A;  2LCS A;  2V1R A;  2DVJ A;  1UG1 A;  2AZS A;  2FEI A;  3LH5 A;  4J9F A;  2F2X A;  1X2K A;  4OMN A;  1JEG A;  1SPK A;  2NWM A;  2KEA A;  1M3C A;  1HSQ A;  1X2Q A;  1GBR A;  2DLP A;  3PVL A;  2RN8 A;  2XMF A;  1GL5 A;  2EYX A;  4K11 A;  1YP5 A;  2JMA A;  1SHG A;  2HCK A;  3M0P A;  4LNP A;  2JTE A;  3U23 A;  1MUZ A;  1SEM A;  5IXF A;  2DL8 A;  3VS0 A;  1RLP C;  3H0H A;  1ARK A;  5I11 A;  2LJ1 A;  3H0I A;  2AKK A;  1NEG A;  2GTO A;  3NGP A;  1I07 A;  1OOT A;  2YSQ A;  4OML A;  1AWX A;  3H0F A;  4RTZ A;  1QKW A;  2LNH B;  2EVR A;  2RNA A;  1AOJ A;  1K0X A;  3REB B;  4DEY A;  4AFZ C;  1WXT A;  2A36 A;  2O9V A;  1J3T A;  1NYF A;  3I5S A;  3VS5 A;  2F2V A;  2LX7 A;  2YUN A;  2K6D A;  1ZSG A;  3EHQ A;  3KFV A;  1ZUU A;  1KJW A;  2DL5 A;  1NLO C;  2G6F X;  4HXJ A;  1UTI A;  2FRW A;  1ZLM A;  1IO6 A;  2CH4 W;  1BK2 A;  4IIM A;  1M8M A;  2RQT A;  2SEM A;  4RTT A;  1OPL A;  2DRK A;  1N5Z A;  1K9A A;  3M0R A;  2D8H A;  3EG1 A;  1U06 A;  1TUD A;  1UJ0 A;  1CSK A;  2VKN A;  2RQV A;  4F17 A;  1SSH A;  1AZG B;  2J7I A;  2QDL A;  1UE9 A;  2JXB A;  2ECZ A;  3REA B;  4LE9 A;  4AG2 C;  1VA7 A;  2JM8 A;  4OMP A;  2DX1 A;  1T0H A;  1RLQ C;  1JU5 C;  2KR3 A;  2I0N A;  2DL3 A;  1KSW A;  1WA7 A;  1H3H A;  5FWC A;  2A08 A;  2L3P A;  1NEB A;  2EGC A;  2JW4 A;  2LZ6 B;  4FSS A;  1M3A A;  2DBK A;  4J9G A;  4CC7 A;  2NUZ A;  1UDL A;  3PVQ A;  1AWJ A;  1S1N A;  2D1X A;  2BZ8 A;  3GBQ A;  2CSQ A;  2FG0 A;  1YWO A;  1QWF A;  2FO0 A;  2J6F A;  3IQL A;  4J9E A;  2CT3 A;  3NMZ C;  3SHW A;  3EHR A;  4RTV A;  1H8K A;  1BB9 A;  1BBZ A;  2EYW A;  2LMJ A;  4GLM A;  2DA9 A;  2GGR A;  4GBQ A;  3QWY A;  2C0T A;  1V1C A;  1UUE A;  2ABL A;  2DMO A;  1H92 A;  4R0K A;  1G2B A;  1AWW A;  2OJ2 A;  1AEY A;  2DM1 A;  1A0N B;  1AWO A;  1XOV A;  2K3B A;  4J9H A;  3UAT A;  1ZBJ A;  1B07 A;  1I0C A;  4RTX A;  2VVK A;  1Z9Q A;  2JMC A;  1UHF A;  4JZ3 A;  3NPF A;  2DIL A;  2IIM A;  1VYT A;  4QT7 A;  2CSI A;  4Z89 A;  2DL7 A;  2ED0 A;  3VRY A;  1AVZ C;  5EC7 A;  1TG0 A;  1NYG A;  4EIK A;  2KYB A;  5FWB A;  3UA7 A;  2SRC A;  4A63 B;  1OPK A;  3RBB B;  3VS1 A;  1LCK A;  2EBP A;  2YT6 A;  2EPD A;  1X27 A;  2HEQ A;  3ZL7 C;  4JJB A;  5IH2 A;  3JV3 A;  1PNJ A;  1AD5 A;  3O5Z A;  2RF0 A;  1YCS B;  2KYM A;  1BU1 A;  2KRM A;  2KT8 A; 
#chains in the Genus database with same CATH topology
 1WXU A;  2BKD N;  4WCI A;  2O31 A;  1MMN A;  2GQI A;  2M0O A;  2PVG B;  4GY5 A;  3CC4 A;  2EGE A;  2DZ9 A;  2H8H A;  3CPF A;  1K8A C;  2DE0 X;  2QK0 A;  1JO8 A;  1M2V A;  3HRU A;  1ZSZ C;  2VUB A;  3M4Y A;  3I55 T;  3M0U A;  1D0Y A;  2OTL T;  3EFR A;  5LJ5 g;  4RUG A;  3L2Z A;  2KSS A;  1YNZ A;  3H8Z A;  3QSU A;  1OI1 A;  3BW1 A;  4CC2 A;  3OYH A;  4WF2 A;  4J6X A;  3CMA Q;  2QQR A;  1U5S A;  2A3L A;  3SWN A;  1QKX A;  1KQS P;  3LWI A;  1WIE A;  4OB0 B;  2KQW A;  4O5V A;  3OYE A;  5KYY A;  2M02 A;  4AT1 B;  3OYK A;  4KRT A;  3CBP A;  2X4J A;  1YCY A;  4C8Q F;  2AZV A;  2C06 A;  1HD3 A;  2DEQ A;  1QW1 A;  4HVU A;  2CZ6 B;  3HHT B;  5IHI A;  3OS1 A;  1KG1 A;  1KQS A;  2XIC A;  2CUB A;  4ZGE B;  1VQ4 T;  1VQN Q;  4PJO F;  2HNI A;  4J9C A;  4XTX A;  2ED1 A;  3I55 Q;  3CC2 A;  1RI0 A;  3FJP A;  2FVU A;  1VQ9 A;  2AKL A;  3RKX A;  4QQ6 A;  2OTL Q;  1WJQ A;  3L1A A;  1SSF A;  3GNF B;  2EJF A;  1OQK A;  1BI1 A;  4ZN3 A;  4NS5 A;  3V7C A;  1Q86 R;  4BD3 A;  1VYV A;  1WQ7 A;  3OS5 A;  1VQ6 Q;  1Q95 G;  2ENM A;  1VQP A;  2FZC B;  1VOM A;  2KAF A;  1PCX A;  1RAI B;  5GAN j;  3OYB A;  4CC3 A;  5GAO q;  2QA4 T;  1BKB A;  1M27 C;  1B34 A;  4EMK C;  1K4U S;  4OF1 A;  1GXI E;  4IUU A;  2KNB B;  1VQ4 Q;  5CKD A;  2DYI A;  2JOY A;  2MF2 A;  1FMW A;  1ZSZ A;  3I35 A;  1PSF A;  2OI3 A;  1ABO A;  2KXC A;  2K2V A;  3M55 A;  1IRX A;  4AFU C;  1X6B A;  3JCM e;  3HFN A;  1KIK A;  2LQ8 A;  1R77 A;  5GAN 7;  2EYZ A;  4AFQ C;  1KFZ A;  1K8A R;  2DTO A;  3SEM A;  1Y57 A;  4KH1 B;  3M9Q A;  1Z9Z A;  1WYX A;  1Q86 U;  3CCQ T;  3M54 A;  4RTU A;  4LN2 A;  2RI5 A;  1W2B S;  2XU8 A;  3FDR A;  3G6E A;  1PD1 A;  1ABQ A;  3M58 A;  1BI2 A;  2XHC A;  1TTH B;  1WHM A;  1N9S A;  2OAU A;  3DKM A;  2L3Q A;  2KT1 A;  5CKB A;  4FW1 A;  3M5A A;  1RAC B;  3MO8 A;  3UDC A;  2K7A A;  4LUE A;  3EH2 A;  3FRN A;  4VUB A;  3CQT A;  4Z88 A;  1YHQ A;  5LJ3 e;  2C0I A;  4BI8 B;  3HKS A;  4BI4 A;  3CD6 A;  3JCM J;  3OSS C;  4PJJ A;  1OEB A;  1K8A U;  2E4H A;  5FU6 B;  5HCK A;  4JRI A;  2YLC A;  2HSE B;  2BIV A;  4JPB W;  3JAM E;  2K4Y A;  2HMA A;  2CRE A;  1Q7Y C;  3EGU A;  2QQB A;  2ROL A;  1AZE A;  2E41 A;  1M30 A;  5GMK i;  1WNL A;  1C1A A;  4EMK A;  1LPL A;  4C5I A;  3OYI A;  2XID A;  4PNO A;  5LJ5 f;  5ECA A;  4XU2 A;  2FZK B;  5GAN 6;  3RUX A;  4FL6 A;  1E6G A;  3V7S A;  3OMG A;  1FMV A;  4DOV A;  4KGV B;  3X26 B;  1VQ5 T;  2NUP A;  4C0Z A;  2CDT A;  1WHJ A;  2IG0 A;  3OYF A;  3CCM A;  2KE9 A;  3NHN A;  4IIO A;  4BE1 A;  1UG1 A;  3JRZ A;  2RHZ A;  4BY6 C;  3LH5 A;  2EQJ A;  4M7D B;  1M3C A;  2EWN A;  3PGG A;  1X2Q A;  3S3O A;  1TU0 B;  4QVD A;  2D0Q B;  3PVL A;  2RN8 A;  1GL5 A;  1H64 1;  3MET A;  2E65 A;  2V26 A;  3GOX A;  1X01 A;  2DL8 A;  5GAN 2;  1QVG P;  2BE7 D;  4M77 B;  3X20 B;  1RAF B;  3NGP A;  2RHI A;  1AWX A;  3G4S T;  1EX4 A;  4RTZ A;  2K57 A;  2EVR A;  2Z0W A;  1AOJ A;  3REB B;  1F1B B;  4FYY B;  1VQ5 Q;  1UGS B;  3X24 B;  3RDV A;  3RMS A;  1YJW T;  3OQ5 A;  2LX7 A;  4KUD K;  1I5L A;  3KFV A;  1ZUU A;  3JCM b;  1QCO A;  3CCE T;  3LYI A;  1VQ7 T;  1MHN A;  1OPL A;  1N5Z A;  4HCC A;  1K9A A;  4ZTF A;  1YJN T;  1I81 A;  2D8H A;  1K73 C;  1CSK A;  2BE9 B;  1SSH A;  3G1J A;  2H3E B;  1UE9 A;  4C8Q B;  3FB9 A;  1VQL T;  5KYX B;  3REA B;  2P84 A;  2EYQ A;  3G4S Q;  1Q7Y R;  1JU5 C;  4M7D D;  1WA7 A;  3P8H A;  4PJO B;  3A1P A;  3PMI A;  4EPC A;  1YJW Q;  1OYX A;  3G7Z A;  2DBK A;  4J9G A;  2JNG A;  2NUZ A;  4DBF A;  1Y07 A;  3CCE Q;  4HT8 A;  1VQ7 Q;  4M77 D;  3OB9 A;  4L5G A;  2A7Y A;  2L5Q A;  2LMJ A;  3G71 T;  2GGR A;  2P0Q A;  4GBQ A;  3S6W A;  3QWY A;  1UUE A;  2ABL A;  2LCL A;  1KK7 A;  4R0K A;  1H92 A;  4M7A G;  1EZZ B;  2CS7 A;  1AEY A;  4QKU A;  2IVW A;  1G3W A;  3MHX A;  3UAT A;  1B07 A;  1I0C A;  3MP8 A;  3VYH B;  1Q7Y U;  2VVK A;  1UHF A;  1QP3 A;  2DIL A;  1FWZ A;  1VYT A;  3PNW C;  2EAY A;  4PFP A;  3CCS A;  1AVZ C;  2QI2 A;  5IT9 E;  1PG5 B;  1LVK A;  3UA7 A;  1U8R A;  5CKE A;  3JCM Q;  2YT6 A;  5FU7 B;  1MND A;  3LW5 E;  2RHX A;  3E1S A;  4C8Q D;  5IH2 A;  2X9H A;  5C0M A;  3QO3 A;  3G71 Q;  1YI2 T;  5AT1 B;  3OYN A;  1I5O B;  2KRM A;  2KT8 A;  5CKF A;  4PJO D;  2D9T A;  1UB4 A;  4CC4 B;  2C0O A;  5A0D A;  2PNI A;  4JS4 A;  1VQM A;  3JB9 G;  2DK3 A;  3HRT A;  3OYC A;  2A28 A;  4F7U B;  1X6G A;  1W6X A;  1YIT A;  2GTJ A;  2B86 A;  3H6Z A;  5HY6 A;  4EMG A;  3EH1 A;  3Q1J A;  1K73 R;  1KC8 C;  3AHU A;  3A98 A;  4M7A C;  4QVZ A;  2CP5 A;  2JVV A;  1VQ8 T;  2L3S A;  1YN8 A;  1CKB A;  1WHG A;  2DNU A;  5CR2 A;  5GAN 5;  3OYY A;  4O6J A;  2QAS A;  3OSV A;  2YUQ A;  3TSW A;  4BE2 A;  1IGU A;  2FPD A;  1Y96 B;  2NLU A;  2ZGW A;  1XNI A;  4DEX A;  2FRY A;  3TSZ A;  3A8L B;  1SHF A;  1PC0 A;  4X34 A;  3UF4 A;  2EFI A;  4KUL A;  5GAO l;  4HVW A;  4XU3 A;  2MCN A;  2DTH A;  5GAM g;  3A8G B;  2VGM A;  3SWN C;  1V29 B;  2O9S A;  5LJ3 j;  2QEX A;  4E7S A;  3KUF A;  5D6W A;  2RJC A;  5A0L A;  3J81 E;  2ZPB B;  2D6F A;  1K9M C;  2O2O A;  1K73 U;  4JRK A;  1BIB A;  3M4G A;  2RQW A;  1E6H A;  4CI0 C;  4M7A E;  1K0S A;  4F16 A;  2EQM A;  1G83 A;  4E7L A;  1FMK A;  4FT4 A;  3CC4 Q;  4M75 B;  2LJ3 A;  2JS0 A;  2NUT B;  2ZPH B;  1W70 A;  2CZ1 B;  4KUI A;  3OW2 A;  3QDF A;  3I56 T;  3E9F A;  1KQS S;  3CC2 T;  1EIF A;  2CP6 A;  3L2W A;  4B6M A;  2HL3 A;  2AT1 B;  4J6Y A;  3BDL A;  2D8J A;  2RQU A;  3WVE B;  4C92 C;  2CP3 A;  3QYG B;  1WPY A;  1X69 A;  2VWF A;  4NL3 A;  2DIG A;  3VKI A;  2HBP A;  4HCK A;  1D0Z A;  1TWB A;  1MV3 A;  3TQ7 P;  1W1F A;  4EDU A;  1ZUY A;  1VQP T;  2YDL A;  1T3L A;  4M78 B;  2JT4 A;  4E7K A;  2E1H A;  2DJQ A;  3UT1 A;  5KYW A;  1UEC A;  3MP1 A;  1VQN T;  2HZY A;  1QVP A;  1GCQ A;  2L2P A;  4C5E A;  2LTO A;  1EFN A;  1WHL A;  4NL2 A;  4A4G A;  2IPO B;  1YWP A;  2CZ7 B;  4C5H A;  5HK3 A;  2K5F A;  3I56 Q;  1YIJ A;  1KC8 R;  3CC2 Q;  4M7A F;  2O88 A;  1VQ9 Q;  2X4X A;  2KXD A;  4JUV A;  1U3O A;  1RUW A;  3V7R A;  4FYV B;  2F1L A;  2RK1 A;  2X3W D;  2G3R A;  5GAN g;  2GBQ A;  4LUD A;  3EFS A;  4M75 D;  1MMG A;  2V1Q A;  2RMO A;  1QVF P;  1VQ6 T;  1GRI A;  4E47 A;  1VQP Q;  2PZ1 A;  2ZAE A;  1N9R A;  3RR6 A;  5KYX A;  2F5T X;  5CK9 A;  4IUP A;  3G6E T;  1PRM C;  4ZTJ A;  4AG1 C;  2PVO B;  5D7U A;  3CPW S;  3CCV A;  1W4S A;  1GFD A;  2P0P A;  3CXC A;  1QVF A;  1KQ1 A;  1TS9 A;  1PHT A;  5FRN A;  2DXT A;  1WLP B;  4JDS A;  1K9M R;  1KC8 U;  3INZ A;  4OMM A;  4ZGD B;  2VYT A;  1M90 C;  2DXU A;  3JB9 F;  1S72 A;  4C92 A;  5KYU B;  2JUF A;  1K1Z A;  2W10 A;  4M78 D;  4OMO A;  2DER A;  3CD6 T;  2CP2 A;  1G3Y A;  4ORZ A;  4E6R A;  1JXM A;  3C4S A;  3MEW A;  3J80 E;  4KBM B;  1M8V A;  2ZPF B;  2A0F B;  4MDX A;  1FYN A;  1KQ2 A;  3GF5 A;  1Y0M A;  2MYS A;  2DF6 A;  1AT1 B;  3G6E Q;  1OV3 A;  2J6O A;  3HTR A;  2J6K A;  3QKJ A;  2LCS A;  2HKQ B;  3QJY A;  3JCM d;  2FB7 A;  4BUG A;  4HCB A;  4J7I A;  2O4X A;  1SG5 A;  1YI2 A;  1K9M U;  2MMP A;  5GAM f;  1SHG A;  2HCK A;  3M0P A;  4LDV A;  1MMA A;  4LNP A;  1YHQ Q;  3L2V A;  5IXF A;  1OU9 A;  4XTV A;  1N27 A;  4PFO A;  3X25 B;  3TRE A;  2HKN A;  4A4H A;  1ARK A;  3PMT A;  4LDU A;  3H0I A;  2GTO A;  3CD6 Q;  4FW2 A;  1OOT A;  2YSQ A;  4FU6 A;  2E64 A;  2VGN A;  3H0F A;  5GMK l;  3LGL A;  1QKW A;  3PTA A;  2DJZ A;  4XTZ A;  4N0A A;  3VUZ A;  3HFO A;  2YRV A;  3SB2 A;  4F7U A;  1J3T A;  1RAE B;  5A0G A;  5LJ3 d;  2YUN A;  1VQK A;  3EHQ A;  4XTU A;  1NLO C;  3QZ5 B;  3TEE A;  1IO6 A;  1M8M A;  2SEM A;  3HSB A;  3P8D A;  3DLL A;  2DRK A;  4OGC A;  4FYW B;  1JRI A;  2QXF A;  4JJN K;  3CCR A;  1D0X A;  3BE3 A;  3EG1 A;  1KHI A;  1UJ0 A;  5FRO A;  3QZ9 B;  3TCJ A;  3EG9 A;  3WXM B;  1SKU B;  3A8O B;  4AMC A;  4KGZ B;  3CCJ A;  1VA7 A;  2GCX A;  2DX1 A;  1T0H A;  1RLQ C;  1QVG S;  2I0N A;  2LC4 A;  2DL3 A;  2COW A;  5KYN A;  4IUQ A;  1KSW A;  1M90 R;  4L59 A;  1D3B B;  1JBM A;  4RG8 A;  1TOV A;  4EMH A;  3CC7 A;  1UGQ B;  1NEB A;  2R58 A;  3NTK A;  2JW4 A;  2LZ6 B;  4QVC A;  4FSS A;  2E5Q A;  3EFO A;  5GAM d;  1UDL A;  4A4F A;  2D1X A;  1MNE A;  2BZ8 A;  3DB3 A;  2CSQ A;  2JJ9 A;  1RAB B;  4IUT A;  2FG0 A;  4J9E A;  2QA4 A;  1VIE A;  4JLI A;  1BBZ A;  2XK0 A;  4A4E A;  1WHH A;  4GLM A;  2RJD A;  4IKF A;  5GAN 3;  5GAN f;  2C0T A;  4C0D B;  4M75 A;  4OVA A;  4JS5 A;  1AWW A;  3C94 A;  1W2B P;  5KH6 A;  1IZ6 A;  3EGX A;  3V8J A;  1XOV A;  2K3B A;  2QG9 B;  1KD1 C;  2CP0 A;  1ZBJ A;  2K3X A;  1ZQ1 A;  5KE3 A;  4ZN1 A;  4BAC A;  2IIM A;  1M90 U;  3E9G A;  2CSI A;  4Z89 A;  3VRY A;  1U1T A;  2ED0 A;  1W2B A;  4EIK A;  2SRC A;  2X35 A;  3RBB B;  3CCQ A;  1LCK A;  2ZPE B;  1V76 A;  2E3H A;  2ZPG B;  1JJ2 P;  3MP6 A;  4Q5W A;  4JJB A;  4M78 A;  1VQO A;  1PNJ A;  1AD5 A;  4J8O A;  5D6X A;  2AIR B;  3SDZ A;  2RF0 A;  3OS0 A;  1YCS B;  3PIO A;  2JZ2 A;  1WJS A;  3JB9 I;  3LWH A;  1MV0 B;  3GLX A;  1JJ2 A;  4M7A B;  3CCS T;  1M4Z A;  1T0J A;  4M4Z A;  1BI0 A;  4Z8A A;  2DAQ A;  4J7F A;  3QWX X;  3OMC A;  3THK A;  1G8X A;  1ZA1 B;  2JS2 A;  2Y90 A;  3JCM h;  5CAI A;  2VC8 A;  4MMK A;  4XTW A;  1M2V B;  2QQS A;  1WI7 A;  2X3X D;  2KRO A;  3TU4 K;  4ESR A;  2CZ0 B;  3S3M A;  1M1K C;  5GAN d;  1WFW A;  2RI3 A;  1T3S A;  1VQM T;  3J7A F;  5FW9 A;  2MIO A;  2JM9 A;  4E7Z A;  4ME7 A;  4E2F B;  2GFU A;  3CBO A;  5EG2 A;  3WVD B;  2MOX A;  3A8M B;  1RAG B;  1YIT T;  3CEY A;  2K5I A;  2BTT A;  5KYY B;  1FX7 A;  1ZA2 B;  3JB9 J;  1TSF A;  1PKS A;  1E7O A;  3CCS Q;  6AT1 B;  3L2Q A;  2JTM A;  3I5R A;  1LJO A;  4DOW A;  2DTI A;  5LJ5 e;  3HP9 A;  2HBW A;  3MPU B;  5GJW B;  2LJ0 A;  2P4R A;  3LH0 A;  5LJ3 h;  2OAW A;  2E12 A;  2QYZ A;  3AT1 B;  5CIU A;  5IXB A;  4MZM A;  2KVQ G;  1NBE B;  2RH2 A;  1BI3 A;  2EJG A;  5FU6 C;  1Q82 C;  1PD0 A;  3ASK A;  1MMD A;  1HJD A;  4AFS C;  4D8D A;  2HSP A;  2CT4 A;  3RES A;  2MPX C;  1VQM Q;  2V8I A;  5GAN 4;  2DRM A;  1KD1 R;  4M7A D;  3EG2 A;  3JCM g;  3CBM A;  3QII A;  3M0T A;  4HKE A;  5GMK e;  3E2U A;  1YIT Q;  4D6W A;  1WX6 A;  2E5K A;  2VXE A;  2OTJ T;  4RTW A;  2QGG A;  1WZO A;  2AK5 A;  2CUD A;  4J9B A;  5M9O A;  3RKW A;  4OP0 A;  2VXF A;  4YTL A;  1B34 B;  2HQE A;  4QQG A;  4LD6 A;  1X43 A;  2QQ9 A;  5GAM h;  2Y4Y A;  3GPL A;  1ZSZ B;  3H9N A;  2KRN A;  2KI7 A;  3QBY A;  4HVV A;  4M7D C;  3ME9 A;  1KHC A;  2E70 A;  3RIR A;  2FPE A;  3RMQ A;  4F04 B;  5LJ3 g;  2YRD A;  2L0A A;  1KD1 U;  4MML A;  1VIF A;  5DM7 R;  2DKG A;  1YJN A;  2WAC A;  1UGV A;  1M1F A;  1UGP B;  2LQW A;  1PWT A;  1QQJ A;  4LD9 K;  1R0C B;  1XTD A;  2K3Y A;  2V8K A;  1UJY A;  4M77 C;  3OBY A;  4FCY A;  1VQL A;  1PRL C;  2W0Z A;  2OTJ Q;  2LT1 A;  1M1K R;  4ELZ C;  5GAN 8;  2MWO A;  1HXD A;  2XDB A;  2RJE A;  4C92 G;  3FC3 A;  2DEU A;  2XDD A;  3CC4 T;  2EW3 A;  4IUV A;  4PLI A;  3EG0 A;  4RG2 A;  4RTY A;  4BDY A;  1GCQ C;  2DVE A;  2K9G A;  2J05 A;  2BUD A;  4B9X A;  3FJ5 A;  3F70 A;  4C0F A;  2KDS A;  1BIA A;  4C5G A;  2DFU A;  3VS2 A;  3M56 A;  3M53 A;  2Y4X A;  5GAO r;  1GFC A;  3C95 A;  2ESW A;  4Y91 A;  1Y7X A;  3L2U A;  4KT0 E;  1M9S A;  1NZ9 A;  2B8A A;  2EJ9 A;  2NYS A;  2RA2 A;  5CVI A;  3UA6 A;  1K76 A;  2COZ A;  4J9D A;  3OW2 P;  4C8Q C;  1Q82 R;  5I21 A;  1PKT A;  3RKY A;  4PKC C;  1TH7 A;  3A8H B;  5GJV B;  2XKO C;  1M1K U;  3QG1 A;  5L8R E;  2L3R A;  4RCB A;  3VS3 A;  4A4K A;  4EMK B;  1OUL A;  2CH4 A;  2DXC A;  4KH0 B;  2WSF E;  4PJO C;  2EGA A;  3PE0 A;  2YRC A;  5GAN h;  1QWE A;  2M51 A;  1YJ9 A;  3L2R A;  1VQ9 T;  1VYU A;  4LXC A;  3C0C A;  3VJP A;  4M7D A;  2ATC B;  2DVJ A;  2YLB A;  2NUP B;  1NPR A;  1S72 T;  4J9F A;  4F7U G;  1X2K A;  4OMN A;  1NPP A;  1SPK A;  2NWM A;  3CCU A;  2KEA A;  4Y28 E;  1WJR A;  4QW2 A;  1GBR A;  3OA6 A;  1HYO A;  2DLP A;  1R0B G;  2XMF A;  2AHJ B;  2EYX A;  1YP5 A;  1JB0 E;  2DO3 A;  2RHU A;  4M77 A;  2YXY A;  1G5V A;  2JTE A;  3U23 A;  1Q82 U;  1BYM A;  2L8D A;  3OS2 A;  4FYX B;  2PUK B;  3VS0 A;  2RD1 A;  3JCM W;  1WGS A;  3H0H A;  5HKC A;  1X6O A;  5I11 A;  1NEG A;  1OX9 A;  1I07 A;  8AT1 B;  1RAD B;  2LNH B;  2R5A A;  2RNA A;  4DEY A;  4B9W A;  1HK9 A;  4AFZ C;  3JCM f;  3V8L A;  2A36 A;  1NYF A;  3I5S A;  1VQ8 A;  2F2V A;  3MJX A;  3LGF A;  5FU7 C;  4HCZ A;  2VV5 A;  1ZSG A;  1S72 Q;  3EAE A;  2CGH A;  1KJW A;  2DL5 A;  7AT1 B;  3L42 A;  2MI6 A;  4HXJ A;  2RJF A;  1OU8 A;  2FRW A;  1ZLM A;  2LX9 A;  4C92 E;  3CCL A;  4II1 A;  4XU0 A;  2CH4 W;  4CRI A;  2RB6 A;  4RTT A;  5I2M A;  3CXC P;  4PLL A;  4RMO A;  2QGF B;  2XDP A;  4N0A C;  4OGE A;  3E19 A;  1U06 A;  2EKO A;  4C8Q A;  4BB7 A;  3OYD A;  1ZBX A;  1YBY A;  2J7I A;  3VV0 A;  2QDL A;  4RKU E;  4M75 G;  2JXB A;  4LE9 A;  4AG2 C;  4PJO A;  1VQK T;  5D6Y A;  4DA4 A;  4GLK A;  2FZG B;  2KY9 A;  3VYG A;  2PQW A;  4N4H A;  5LJ3 f;  3NFC A;  3CME A;  1IRE B;  1H3H A;  5FWC A;  1YI2 Q;  3M57 A;  1C0M A;  2EGC A;  3CCR T;  1U1S A;  2HQH A;  1YHQ T;  1FXX A;  4FM4 B;  4CC7 A;  4LDY A;  4IUR A;  3PVQ A;  1S1N A;  3GBQ A;  1YWO A;  2J6F A;  4BY6 B;  4OMF B;  3IQL A;  1PSE A;  3SFM A;  4JLG A;  2QTV A;  3I56 A;  2CT3 A;  3CCJ T;  2VB6 A;  4RTV A;  1H8K A;  2DD4 A;  2DA9 A;  2H3J A;  3QDR B;  4M78 G;  1WQW A;  5KCH A;  2DMO A;  3ZEH A;  5LJ5 j;  3OY9 A;  3CMA A;  4C92 F;  5IAY A;  1G2B A;  2VAS A;  4ZGJ B;  3CC7 T;  2DM1 A;  1NJI C;  4F7U E;  1VQK Q;  4E7H A;  1X75 C;  4L6V 5;  1N6A A;  1N8R C;  1Z9Q A;  3HPW A;  4FT2 A;  4JZ3 A;  4DQ2 A;  2DIQ A;  3M59 A;  4E7J A;  3CCR Q;  2DL7 A;  5EC7 A;  4J6W A;  4M75 C;  1O75 A;  1NYG A;  5CQX A;  2KYB A;  5FWB A;  4A63 B;  1VQN A;  1OPK A;  3CCM T;  2EBP A;  2EPD A;  1X27 A;  5GMK j;  2HEQ A;  3I55 A;  2DD5 A;  4V2S A;  2LQK A;  3ZL7 C;  2EIF A;  3FLG A;  3CCJ Q;  3JV3 A;  2OTL A;  1IXD A;  1BCO A;  5DLQ E;  2RI2 A;  3O5Z A;  3NTH A;  3CPW P;  3OYL A;  4XQ3 A;  2KYM A;  1BU1 A;  4QQD A;  4DBR A;  2KRS A;  5GAO p;  1VUB A;  3VS4 A;  3GP8 A;  1WDX A;  3CC7 Q;  2HDA A;  4OB1 B;  5L23 A;  5LL6 S;  4E7I A;  1LOJ A;  3A5Z B;  2M1H A;  1VQ6 A;  3OYG A;  2YUP A;  1IHW A;  1UHC A;  3QUI A;  3N5B B;  3CPW A;  2M0Y A;  2QTX A;  1WXB A;  3UWN A;  2QA4 Q;  3MEU A;  1QLY A;  4M78 C;  4PL6 A;  1O9S A;  2A37 A;  1VQO T;  2HL5 C;  2LQN A;  4F7U F;  3OYA A;  2LCC A;  3H41 A;  3QHS A;  4N4G A;  2K79 A;  2K2M A;  2LVM A;  1VQ4 A;  1D1A A;  4JZ4 A;  1OZ2 A;  3CCM Q;  3JCM X;  1AHJ B;  4M75 E;  1Y96 A;  1BCM A;  3KBG A;  3VUB A;  3RNJ A;  4KGX B;  4J5Y A;  1JJ2 S;  3JCM c;  3M0Q A;  1UFF A;  3R6N A;  3D7S B;  4X9D A;  4P5N A;  3P8B B;  3EG3 A;  5I2S A;  2RK2 A;  2JN0 A;  5FRM A;  1PM3 A;  2DBM A;  3ZBD A;  3CCQ Q;  1ZX6 A;  5GAO m;  4ANJ A;  4R56 A;  3GIB A;  5C6S A;  1GBQ A;  1VQO Q;  2KGT A;  2MAM A;  2RPN A;  4M78 E;  2R5M A;  3OBW A;  3RER A;  2EKH A;  1JQQ A;  2D0N A;  2BZX A;  4Y92 A;  2NUT A;  1NJI R;  3FIF A;  1QCF A;  2YUO A;  3T9N A;  2P4T A;  1N8R R;  4A54 A;  4LDX A;  2E6N A;  2MWP A;  5GAM e;  3QPH A;  4R55 A;  2BZY A;  3DLM A;  4M75 F;  2QDY B;  5I22 A;  1M3B A;  5KE2 A;  1NG2 A;  1RI9 A;  1MGQ A;  2QAZ A;  1QCN A;  3EGD B;  2FPF A;  4OMQ A;  3BFM A;  3VRZ A;  2X4Y A;  2EQI A;  4LDW A;  4X1V A;  2ROT A;  2PTK A;  2O01 E;  1D1B A;  2EYY A;  1TUC A;  2OX7 A;  5IHK A;  4JJC A;  1IHV A;  3QJ6 A;  1NJI U;  3TVT A;  3UPU A;  3KXT A;  1NE8 A;  3ER0 A;  3OYJ A;  1M1G A;  2RO0 A;  3VS6 A;  1N8R U;  4JRP A;  4M78 F;  3GNG A;  4DBQ A;  5KYW B;  2FHD A;  3DB4 A;  4ZNX A;  2CKK A;  1QVG A;  5AYF A;  1QMC A;  5J3B A;  5IN1 A;  4BDZ A;  4DBH A;  3ULR B;  2DPP B;  8ATC B;  4XU1 A;  5LJ5 d;  2ZPI B;  3MCA B;  1OX8 A;  2M16 A;  5KCO A;  1M5Q 1;  3SWN B;  4OB3 B;  2HAX A;  1JXO A;  1NLP C;  1TUG B;  4F14 A;  3ZFJ A;  1QP2 A;  2LRQ A;  1R8O B;  2LP5 A;  4JRQ A;  1ZUK A;  1NM7 A;  1I1J A;  1Q81 C;  1DJ7 B;  2E6Z A;  4M7D G;  5GAO n;  1CKA A;  2J06 A;  9ATC B;  2F2W A;  2L89 A;  4XAX B;  1VQ5 A;  4A53 A;  2RM4 A;  4J9I A;  4PJL A;  2PU9 B;  1G3T A;  5IHN A;  1RAA B;  3NTI A;  5KYU A;  3VS7 A;  4D8K A;  4JJD A;  5GAN e;  5HK0 A;  3M0S A;  5J26 A;  1LNX A;  1ACM B;  3I9Q A;  3QYH B;  2DL4 A;  1P92 A;  3QXE B;  4M77 G;  1GCP A;  2COY A;  2KBT A;  3X28 B;  1SRM A;  2LT4 A;  2GNC A;  1XQH A;  4C92 B;  2DYB A;  3LX7 A;  3LLR A;  1SRL A;  4PK4 A;  4MZP A;  1YJN Q;  1B3Q A;  4C0G A;  2QEX T;  4PFZ A;  2XD0 A;  2XG8 D;  2ZCF B;  2RQR A;  2V1R A;  2V8J A;  2AZS A;  2R57 A;  3PFS A;  2FEI A;  1VQL Q;  2EQK A;  2F2X A;  3G4S A;  2DXB A;  1B7T A;  2WSE E;  1JEG A;  2E10 A;  2YHT A;  3BY7 A;  4MDW A;  2KMT A;  1HSQ A;  2P0K A;  1UEB A;  4C0D C;  1YJW A;  4N4I A;  1ZHI A;  4K11 A;  1SF9 A;  1G3S A;  3FEO A;  2JMA A;  4FSX A;  2X4W A;  4BE0 A;  2O4X B;  1YJ9 T;  1MUZ A;  1SEM A;  1RLP C;  2HQX A;  1IB8 A;  4C8Q G;  3CCE A;  2LJ1 A;  1OZ3 A;  2AKK A;  1I8F A;  1XJW B;  1VQ7 A;  3OW2 S;  4OML A;  1YFN A;  4XTY A;  3CCU T;  2DZC A;  3JB9 D;  2CYZ B;  4XK8 E;  1K0X A;  4PJO G;  3C12 A;  4TVR A;  2QEX Q;  2F5K A;  1WXT A;  1RL2 A;  2GFA A;  4ELY C;  2O9V A;  5GMK m;  3VS5 A;  2K6D A;  3O8V A;  1IGQ A;  2LDM A;  5CKH A;  3JCM P;  2K5L A;  2G6F X;  1UTI A;  5FLX E;  2X51 A;  1BK2 A;  4IIM A;  2RQT A;  3JSC A;  3HRS A;  4PJM A;  4C92 D;  2YWW A;  3PT9 A;  4PJN A;  3M0R A;  1TUD A;  2CP7 A;  1YJ9 Q;  2VKN A;  1C6V X;  2RQV A;  4UC4 A;  4WTO B;  1YIJ T;  4F17 A;  1AZG B;  3MEV A;  2HD0 A;  1Q81 R;  4FIB A;  5CQY A;  4OB2 B;  2ECZ A;  2F69 A;  2RHY A;  3OYM A;  4M7D E;  1RAH B;  3MKD A;  1D3B A;  3CCU Q;  2JM8 A;  4J83 A;  3EG9 B;  4NOY A;  4OMP A;  3SD4 A;  3G71 A;  2KR3 A;  5CCA A;  3CCL T;  2PUO B;  2A08 A;  2L3P A;  5A2Q E;  4Z02 A;  1M3A A;  5J39 A;  2GF7 A;  4MZT A;  4M77 E;  1UGR B;  2DET A;  1AWJ A;  4X9C A;  2FO0 A;  1QWF A;  3CCV T;  3EFO B;  3NMZ C;  3SHW A;  3EHR A;  1BB9 A;  2EYW A;  2ZZD A;  2QQA A;  4ATO A;  2OTJ A;  1V1C A;  1WHK A;  1YIJ Q;  3CME T;  2EQU A;  5DLO A;  3R6O A;  5LJ5 h;  3CXC S;  1QVF S;  3VU3 C;  2FYK A;  1VQ8 Q;  2OJ2 A;  4HA8 A;  1Q81 U;  3S3N A;  1A0N B;  1I4K 1;  1AWO A;  2MK5 A;  5DY9 A;  4J9H A;  3PIP A;  3JB9 H;  1Q86 C;  4RTX A;  1H3Z A;  3V8K A;  2I2L A;  3CCL Q;  2JMC A;  3EGX B;  3NPF A;  2E3I A;  4QT7 A;  4BI3 A;  3EGD A;  4M7D F;  2FL7 A;  2KK4 A;  2JTF A;  3BDU A;  1TG0 A;  2GQV A;  3URG A;  2LNV A;  4HT9 A;  1D1C A;  4RCC A;  4C8Q E;  3CMA T;  3VS1 A;  1D09 B;  5GMK h;  2XI9 A;  1Y71 A;  3JCM V;  3CCV Q;  5CO7 A;  5GAM j;  2PVD B;  3HL8 A;  2WSC E;  4PJO E;  1M2O A;  4M7A A;  1TXQ A;  3MEA A;  4M77 F;  2M9U A;  3CME Q; 
#chains in the Genus database with same CATH homology
 1WXU A;  2KRS A;  3VS4 A;  4CC4 B;  1MV0 B;  1WDX A;  2C0O A;  2HDA A;  2PNI A;  2O31 A;  4WCI A;  2GQI A;  1T0J A;  4M4Z A;  5L23 A;  2EGE A;  2H8H A;  4Z8A A;  2A28 A;  2DE0 X;  3QWX X;  1X6G A;  1JO8 A;  2YUP A;  1W6X A;  3THK A;  1UHC A;  2GTJ A;  2B86 A;  2JS2 A;  2M0Y A;  1WXB A;  3M0U A;  1QLY A;  2A37 A;  4RUG A;  1WI7 A;  2LQN A;  2X3X D;  2KRO A;  3A98 A;  1YNZ A;  4ESR A;  3H41 A;  2K79 A;  2K2M A;  4CC2 A;  4JZ4 A;  1WFW A;  2L3S A;  1U5S A;  1YN8 A;  1CKB A;  1QKX A;  2DNU A;  1T3S A;  1WIE A;  5FW9 A;  2MIO A;  2JM9 A;  3RNJ A;  2YUQ A;  2MOX A;  3TSW A;  4KRT A;  3M0Q A;  2FPD A;  2BTT A;  1UFF A;  3R6N A;  2AZV A;  4DEX A;  2FRY A;  3TSZ A;  1HD3 A;  4HVU A;  1SHF A;  3UF4 A;  1PKS A;  1E7O A;  5IHI A;  3EG3 A;  4HVW A;  3I5R A;  2CUB A;  2MCN A;  2DBM A;  4J9C A;  2HBW A;  5GJW B;  2LJ0 A;  2P4R A;  1ZX6 A;  2ED1 A;  2O9S A;  2OAW A;  2AKL A;  5IXB A;  1GBQ A;  2O2O A;  2KGT A;  2RPN A;  2RQW A;  2EKH A;  1E6H A;  1JQQ A;  2D0N A;  2BZX A;  4Y92 A;  1HJD A;  1K0S A;  4AFS C;  4D8D A;  4F16 A;  1G83 A;  2HSP A;  1FMK A;  2CT4 A;  1QCF A;  2LJ3 A;  2DRM A;  2YUO A;  2JS0 A;  3EG2 A;  1VYV A;  3M0T A;  2ENM A;  1W70 A;  4CC3 A;  1M27 C;  1WX6 A;  2BZY A;  2E5K A;  5I22 A;  1M3B A;  2D8J A;  2RQU A;  1K4U S;  1NG2 A;  1RI9 A;  4RTW A;  2KNB B;  1X69 A;  2VWF A;  2AK5 A;  2CUD A;  4J9B A;  2FPF A;  4OMQ A;  4HCK A;  3VRZ A;  2EQI A;  4X1V A;  3I35 A;  2OI3 A;  2ROT A;  1ABO A;  2KXC A;  2PTK A;  1X43 A;  1MV3 A;  1W1F A;  2EYY A;  1TUC A;  1ZUY A;  4AFU C;  5IHK A;  1X6B A;  2KRN A;  2YDL A;  1T3L A;  1KIK A;  4HVV A;  2JT4 A;  4JJC A;  2EYZ A;  4AFQ C;  1KFZ A;  3SEM A;  2FPE A;  1Y57 A;  2DJQ A;  1UEC A;  2L0A A;  1Z9Z A;  3TVT A;  1WYX A;  2L2P A;  1GCQ A;  3VS6 A;  4RTU A;  1EFN A;  1UGV A;  4LN2 A;  2LQW A;  1PWT A;  1YWP A;  1ABQ A;  2O88 A;  4ZNX A;  2KXD A;  1UJY A;  1U3O A;  2L3Q A;  2KT1 A;  1PRL C;  2W0Z A;  1RUW A;  2X3W D;  3ULR B;  2K7A A;  2EW3 A;  4LUE A;  2GBQ A;  3EG0 A;  4RTY A;  4LUD A;  2V1Q A;  1GCQ C;  2RMO A;  1GRI A;  2K9G A;  2J05 A;  3CQT A;  4Z88 A;  1JXO A;  1NLP C;  3FJ5 A;  2PZ1 A;  4F14 A;  2C0I A;  2LP5 A;  3VS2 A;  1PRM C;  1ZUK A;  1NM7 A;  4AG1 C;  1I1J A;  1GFC A;  1GFD A;  1OEB A;  2ESW A;  5HCK A;  1CKA A;  2J06 A;  4JPB W;  2F2W A;  2CRE A;  3EGU A;  1PHT A;  4J9I A;  5IHN A;  2ROL A;  1WLP B;  1AZE A;  3UA6 A;  1K76 A;  4OMM A;  3VS7 A;  4D8K A;  1M30 A;  4JJD A;  3M0S A;  4J9D A;  1PKT A;  3I9Q A;  2DL4 A;  1K1Z A;  1GCP A;  2W10 A;  5GJV B;  5ECA A;  2KBT A;  4OMO A;  1SRM A;  3VS3 A;  2GNC A;  1E6G A;  4ORZ A;  2CH4 A;  4E6R A;  1JXM A;  2DYB A;  2EGA A;  1SRL A;  3PE0 A;  1FYN A;  1QWE A;  2M51 A;  1B3Q A;  1Y0M A;  2CDT A;  2DF6 A;  1OV3 A;  2J6O A;  1VYU A;  3C0C A;  2J6K A;  2KE9 A;  3NHN A;  4IIO A;  2RQR A;  2LCS A;  2V1R A;  2DVJ A;  1UG1 A;  2AZS A;  2FEI A;  3LH5 A;  4J9F A;  2F2X A;  1X2K A;  4OMN A;  1JEG A;  1SPK A;  2NWM A;  2KEA A;  1M3C A;  1HSQ A;  1X2Q A;  1GBR A;  2DLP A;  3PVL A;  2RN8 A;  2XMF A;  1GL5 A;  2EYX A;  4K11 A;  1YP5 A;  2JMA A;  1SHG A;  2HCK A;  3M0P A;  4LNP A;  2JTE A;  3U23 A;  1MUZ A;  1SEM A;  5IXF A;  2DL8 A;  3VS0 A;  1RLP C;  3H0H A;  1ARK A;  5I11 A;  2LJ1 A;  3H0I A;  2AKK A;  1NEG A;  2GTO A;  3NGP A;  1I07 A;  1OOT A;  2YSQ A;  4OML A;  1AWX A;  3H0F A;  4RTZ A;  1QKW A;  2LNH B;  2EVR A;  2RNA A;  1AOJ A;  1K0X A;  3REB B;  4DEY A;  4AFZ C;  1WXT A;  2A36 A;  2O9V A;  1J3T A;  1NYF A;  3I5S A;  3VS5 A;  2F2V A;  2LX7 A;  2YUN A;  2K6D A;  1ZSG A;  3EHQ A;  3KFV A;  1ZUU A;  1KJW A;  2DL5 A;  1NLO C;  2G6F X;  4HXJ A;  1UTI A;  2FRW A;  1ZLM A;  1IO6 A;  2CH4 W;  1BK2 A;  4IIM A;  1M8M A;  2RQT A;  2SEM A;  4RTT A;  1OPL A;  2DRK A;  1N5Z A;  1K9A A;  3M0R A;  2D8H A;  3EG1 A;  1U06 A;  1TUD A;  1UJ0 A;  1CSK A;  2VKN A;  2RQV A;  4F17 A;  1SSH A;  1AZG B;  2J7I A;  2QDL A;  1UE9 A;  2JXB A;  2ECZ A;  3REA B;  4LE9 A;  4AG2 C;  1VA7 A;  2JM8 A;  4OMP A;  2DX1 A;  1T0H A;  1RLQ C;  1JU5 C;  2KR3 A;  2I0N A;  2DL3 A;  1KSW A;  1WA7 A;  1H3H A;  5FWC A;  2A08 A;  2L3P A;  1NEB A;  2EGC A;  2JW4 A;  2LZ6 B;  4FSS A;  1M3A A;  2DBK A;  4J9G A;  4CC7 A;  2NUZ A;  1UDL A;  3PVQ A;  1AWJ A;  1S1N A;  2D1X A;  2BZ8 A;  3GBQ A;  2CSQ A;  2FG0 A;  1YWO A;  1QWF A;  2FO0 A;  2J6F A;  3IQL A;  4J9E A;  2CT3 A;  3NMZ C;  3SHW A;  3EHR A;  4RTV A;  1H8K A;  1BB9 A;  1BBZ A;  2EYW A;  2LMJ A;  4GLM A;  2DA9 A;  2GGR A;  4GBQ A;  3QWY A;  2C0T A;  1V1C A;  1UUE A;  2ABL A;  2DMO A;  1H92 A;  4R0K A;  1G2B A;  1AWW A;  2OJ2 A;  1AEY A;  2DM1 A;  1A0N B;  1AWO A;  1XOV A;  2K3B A;  4J9H A;  3UAT A;  1ZBJ A;  1B07 A;  1I0C A;  4RTX A;  2VVK A;  1Z9Q A;  2JMC A;  1UHF A;  4JZ3 A;  3NPF A;  2DIL A;  2IIM A;  1VYT A;  4QT7 A;  2CSI A;  4Z89 A;  2DL7 A;  2ED0 A;  3VRY A;  1AVZ C;  5EC7 A;  1TG0 A;  1NYG A;  4EIK A;  2KYB A;  5FWB A;  3UA7 A;  2SRC A;  4A63 B;  1OPK A;  3RBB B;  3VS1 A;  1LCK A;  2EBP A;  2YT6 A;  2EPD A;  1X27 A;  2HEQ A;  3ZL7 C;  4JJB A;  5IH2 A;  3JV3 A;  1PNJ A;  1AD5 A;  3O5Z A;  2RF0 A;  1YCS B;  2KYM A;  1BU1 A;  2KRM A;  2KT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...