3M0SA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0sA00
2JS0A 1AWWA 2DE0X 2LP5A 1QWEA 5GJWB 2X3XD 2KT1A 2V1RA 1QKXA 2F2WA 2GBQA 1X43A 2FRWA 1ZUUA 4AFQC 1M3AA 2RQRA 1NLPC 2K9GA 2BZYA 2KR3A 2MCNA 1K1ZA 4JJDA 1G83A 1ZBJA 1XOVA 2L3SA 1I0CA 2VVKA 2A36A 1HJDA 1W6XA 4IIOA 4J9GA 2HEQA 1X69A 3SHWA 2GTJA 4M4ZA 1KFZA 2LQWA 2SRCA 1MV3A 1B3QA 2FPDA 2DF6A 4CC3A 2EYXA 4HCKA 2VWFA 2JTEA 1WXBA 1VA7A 5FWCA 3UATA 4JZ3A 2RPNA 1QKWA 2EGEA 1M8MA 2BTTA 1WDXA 3THKA 1PRLC 1T0JA 3PVLA 3KFVA 3M0SA 4OMOA 1OPLA 2ESWA 2EGAA 4AFUC 5HCKA 2L2PA 1X27A 1RLPC 2ABLA 2O88A 3UF4A 2HCKA 1AEYA 2EBPA 3REBB 1LCKA 2LQNA 4OMQA 4F17A 1YN8A 1J3TA 2DA9A 2JW4A 4KRTA 4LUEA 4LN2A 1VYVA 4GLMA 3M0QA 3RBBB 2O9VA 3JV3A 1K9AA 2BZXA 2LJ3A 1PRMC 1RUWA 2QDLA 2K2MA 2DBKA 4OMMA 2KRSA 1JO8A 1IO6A 3REAB 2SEMA 3H41A 2DVJA 1SRLA 1TUCA 2J05A 2AZSA 2EPDA 1H8KA 1JQQA 4JJBA 2PNIA 3VS7A 4D8DA 1YWOA 3ULRB 2RMOA 2V1QA 1YWPA 3SEMA 1MUZA 5L23A 4DEXA 1JXMA 2B86A 2JM9A 2K7AA 2KRNA 1OOTA 2D1XA 4JJCA 5IXBA 1U06A 2H8HA 1PKSA 1UHCA 2KT8A 2VKNA 3M0UA 1ZSGA 4K11A 4HVUA 4J9FA 1CKBA 1NM7A 4F16A 2ENMA 1KJWA 2X3WD 5ECAA 4OMPA 4CC4B 3VS0A 4AFZC 2CUDA 4F14A 4LE9A 2C0TA 2E5KA 2L3QA 1HSQA 3R6NA 3I35A 3M0TA 1KIKA 3PVQA 2DNUA 2RNAA 2KGTA 2YUPA 2OI3A 1B07A 3VRZA 2W0ZA 1WLPB 2KEAA 2EYYA 1AWOA 1X2KA 2ED1A 3EG1A 1FMKA 1GFDA 2J6OA 2AK5A 2LJ0A 2CT3A 1VYUA 2CH4A 4WCIA 3I5RA 2GGRA 1AWJA 2EYWA 4RTUA 2DM1A 1SHGA 4RUGA 2PTKA 2KXDA 2OJ2A 3ZL7C 5IXFA 1U5SA 3M0PA 5I22A 1GL5A 2IIMA 4QT7A 2F2VA 1TUDA 1QCFA 2RF0A 3NHNA 4J9DA 1S1NA 1AVZC 2LJ1A 2C0OA 1TG0A 3M0RA 2MOXA 3IQLA 3NGPA 2CUBA 2EW3A 2C0IA 3EG2A 1W1FA 3LH5A 4AFSC 2CH4W 1SRMA 1WI7A 1K0SA 1BK2A 2GNCA 3QWXX 2CT4A 4J9CA 4J9EA 4RTZA 3TSWA 2J6KA 2LX7A 2K6DA 4Y92A 1AOJA 5FW9A 4HVWA 2DRMA 1AZEA 3VRYA 1T3SA 2LNHB 2J7IA 3EGUA 3O5ZA 2JXBA 1NLOC 4RTYA 2K3BA 1V1CA 2L0AA 1WIEA 1WX6A 1PWTA 1UJ0A 1ZUYA 2ROTA 4ORZA 1U3OA 1K0XA 1PKTA 1I07A 1ZUKA 1T3LA 1OEBA 3QWYA 4ZNXA 4AG1C 1BBZA 2J6FA 1N5ZA 4X1VA 2JMCA 3GBQA 1NYFA 1KSWA 2RN8A 2AZVA 1JXOA 1H92A 1CKAA 1WXTA 3VS6A 2AKKA 2KXCA 3H0HA 2NUZA 3NPFA 1BU1A 1GRIA 3CQTA 2EQIA 4OMNA 2HBWA 1K4US 2FO0A 1E6HA 4IIMA 2G6FX 2EYZA 4AG2C 1I1JA 2DL5A 3PE0A 2RQWA 2M0YA 4Z8AA 2GTOA 3TVTA 2DYBA 1M3BA 2HSPA 1Z9ZA 4GBQA 2JT4A 1GBRA 5IHIA 4RTWA 2DMOA 1HD3A 2YUOA 2ROLA 1UUEA 3VS3A 2YDLA 4FSSA 2YUNA 4LUDA 4RTXA 4CC7A 2CSQA 2KE9A 4LNPA 2EGCA 2A08A 1BB9A 1WXUA 1UJYA 3RNJA 1E7OA 1X6BA 4Z89A 3H0FA 2RQTA 4R0KA 4RTVA 1JU5C 3U23A 3VS2A 2DILA 2OAWA 1UG1A 1UGVA 4CC2A 2DL7A 3EHQA 4HVVA 2DJQA 2XMFA 1M30A 2LZ6B 2JM8A 2FPFA 1UE9A 5GJVB 2A28A 2DRKA 2P4RA 2W10A 1Z9QA 2YSQA 1SPKA 2YUQA 5IHNA 2KNBB 2PZ1A 3H0IA 2EVRA 2O31A 5IH2A 1M3CA 2FRYA 1MV0B 3NMZC 2HDAA 2LMJA 2MIOA 2FG0A 2DL8A 1GBQA 1VYTA 2BZ8A 5EC7A 3UA7A 1AWXA 1OPKA 1WFWA 4JPBW 4ESRA 4Z88A 1PHTA 1T0HA 1YNZA 1QWFA 2ECZA 1NG2A 1W70A 1NYGA 1UFFA 3UA6A 5IHKA 4J9IA 3TSZA 1WA7A 4RTTA 4D8KA 1AD5A 1ABQA 2J06A 2O2OA 1UDLA 2NWMA 4OMLA 1SEMA 1CSKA 2AKLA 2A37A 2KBTA 4E6RA 2YT6A 1GCQA 3I5SA 4DEYA 2K79A 3EG0A 2FPEA 1ZLMA 1ZX6A 1GCQC 3EHRA 4EIKA 1PNJA 1RLQC 1NEBA 1NEGA 1QLYA 1SHFA 4J9HA 2RQUA 1YP5A 4HXJA 2KYMA 1A0NB 2F2XA 2FEIA 3VS4A 1WYXA 1OV3A 2DL4A 1AZGB 4JZ4A 1Y57A 5I11A 2I0NA 1ARKA 1K76A 1X6GA 2DL3A 2CSIA 5FWBA 2EKHA 1SSHA 1UTIA 3A98A 2KRMA 3EG3A 2KROA 2D8JA 1GCPA 1M27C 1GFCA 2CREA 2LCSA 1ABOA 3I9QA 2D0NA 2DBMA 2ED0A 2DLPA 2L3PA 1X2QA 1E6GA 2GQIA 2KYBA 1UHFA 2JMAA 1RI9A 3VS5A 1H3HA 2DX1A 2RQVA 1FYNA 2CDTA 3C0CA 1G2BA 3VS1A 4A63B 2M51A 4J9BA 2D8HA 1JEGA 1EFNA 3FJ5A 2JS2A 2O9SA 1YCSB 1UECA 1Y0MA
chains in the Genus database with same CATH superfamily
3FJPA 1AWWA 1VIFA 1QWEA 1QVFS 2L5QA 1C1AA 5CKHA 2E6ZA 5FRMA 4JJDA 3SWNB 5GAMj 4JRQA 4FIBA 3GLXA 4JLGA 2L3SA 1K9MR 1K9MU 2OTJA 4J9GA 4JS5A 2F69A 3SHWA 4PJJA 3F70A 1H3ZA 4M75C 1MV3A 2DXBA 2FPDA 2DTOA 3JB9H 1WXBA 3CCEA 1D1CA 4PJOD 2HBPA 2V8KA 3UATA 3CC7A 3CMAT 3PVLA 1JJ2P 1H641 3Q1JA 2EGAA 3CCQQ 4QVZA 2RB6A 2K3XA 1K8AU 2ABLA 5CO7A 3UF4A 2HCKA 1IREB 4BI4A 1VQ4Q 1QVFP 1KHCA 4N0AC 3PTAA 3HRTA 4FCYA 1YN8A 2JW4A 2XDBA 1MMAA 1VYVA 3X28B 3C4SA 3LLRA 4GLMA 5D6YA 1G8XA 3M0QA 1K9AA 3RMSA 1JRIA 3G6EA 2K2MA 2RH2A 1TTHB 2FYKA 3REAB 1KQ2A 3GIBA 4KBMB 1SG5A 5GAN2 3JB9D 4JJBA 1H8KA 2PNIA 3VS7A 3ULRB 2RD1A 3X25B 3QDRB 1MUZA 2R5AA 4DEXA 1JXMA 1WHGA 1VQPQ 4R56A 2KRNA 4JJCA 4C5HA 5FU7B 4PJLA 2VKNA 2KT8A 3JB9G 4K11A 4HVUA 1KC8C 3S3OA 3OMGA 2RI5A 2BUDA 5CCAA 2QAZA 4DQ2A 3G4ST 2VC8A 2X3WD 4F14A 4OMPA 2C0TA 2MWPA 4PNOA 3TCJA 1N8RC 1R8OB 2DNUA 2DIGA 3WVDB 3OYIA 1ZQ1A 3OYNA 1WLPB 2EYYA 1KQSP 5FRNA 4OF1A 2DKGA 2RI3A 1X2KA 3EG1A 1FMKA 1WZOA 3WXMB 1VYUA 2KQWA 1I5LA 1BI3A 1ZHIA 2CS7A 3I5RA 2BKDN 2QQ9A 4RCBA 1SHGA 4RUGA 1AHJB 1RAHB 2KXDA 1GL5A 4PJOE 2F2VA 5LJ3f 2RHIA 1U1TA 5GMKj 1FWZA 2YWWA 4BI3A 4A4EA 2P0KA 3UDCA 4MZTA 1Y96A 1TG0A 1Q7YU 4HCBA 2EW3A 4Z02A 3CCQA 2K5IA 1K0SA 2DAQA 2VXFA 5FU6B 3OSVA 2O4XB 5FW9A 1WPYA 1AOJA 4HVWA 1AZEA 3HTRA 2LNHB 3EFOA 3ER0A 4M7AC 2JXBA 4C8QF 3KBGA 3EG9B 5GAMe 4RTYA 3RESA 1VQ6T 1V1CA 3BY7A 2HL5C 1W2BA 2K4YA 2L0AA 1YJNA 3L2WA 1S72A 2WSCE 1ZUYA 3QO3A 4ORZA 3AHUA 1PKTA 4V2SA 8AT1B 1QVGS 1OEBA 4D6WA 2BE9B 1YHQT 2K5LA 2X51A 3CCMQ 1VQLQ 2J6FA 1N5ZA 3CC7T 4JUVA 1NYFA 4Y91A 1OU8A 3EGDB 1BI0A 3CCSA 2JN0A 4BDZA 4NL2A 1IHWA 3CCUA 2KXCA 3H8ZA 1JJ2A 3NPFA 2GCXA 1YHQA 1N8RU 1GRIA 3O8VA 2EQIA 2F1LA 3I55A 1YFNA 5HKCA 5CKBA 3E9GA 4AG2C 3VUBA 2QASA 3H6ZA 2X4JA 4C92E 3QZ5B 4E7HA 2I2LA 5GAN3 2DYBA 2COWA 2HSPA 1YCYA 4E7JA 3QYGB 1VQ9A 1N9SA 3OMCA 2DEQA 2LDMA 1LPLA 1QVGP 1HD3A 3VS3A 2VGNA 4PJOF 4UC4A 1D3BA 2ZPIB 2HQEA 5CKDA 1Q7YC 4LNPA 3OYEA 1N27A 1BB9A 2RJFA 2XD0A 3VJPA 1B34B 1WXUA 3CMAA 3RNJA 1E7OA 1NPPA 1RAEB 4FW1A 2QQSA 2RQTA 2WSFE 3U23A 2OAWA 1YIJT 1Q86U 1UGVA 2LT4A 4HVVA 2JM8A 4LD9K 2FB7A 4J6WA 2W10A 1RL2A 3QPHA 2LQKA 2QEXA 1G5VA 5IHNA 4M7AF 2AIRB 4FM4B 3ZFJA 2FRYA 2HDAA 3FDRA 1VYTA 4BY6C 2JZ2A 1VQOQ 3UA7A 4BD3A 4JPBW 5LJ5e 1K8AC 4BB7A 1T0HA 2QA4T 1WHJA 1MNEA 1QWFA 3OA6A 2DYIA 1D0YA 3L2VA 1NYGA 1UFFA 3UA6A 3MEUA 2OX7A 2OTLQ 4IUPA 1NJIC 1ABQA 3CCSQ 3R6OA 4DBQA 4II1A 1CSKA 2KBTA 1BIAA 2YT6A 4DEYA 2QG9B 4F7UF 4OB1B 2DXCA 1RI0A 1KQSS 2RO0A 1EIFA 1GCQC 1KD1U 5GANd 1XTDA 1YJ9Q 3OYBA 1D0ZA 1VQMQ 2EQUA 2H3JA 5IN1A 2EJGA 2FEIA 3UT1A 1M1KC 1PM3A 3CBPA 3QDFA 3JRZA 4A4KA 1Y07A 4BACA 2PVOB 5I11A 4E7KA 2XICA 1WHHA 2KRMA 3V8JA 2HKQB 1M27C 2MPXC 2D0NA 1YJ9T 4PFPA 2RK1A 2KYBA 1YJWT 3T9NA 2JMAA 1Q82R 1D1BA 3CMET 3CCET 4C5EA 4M75G 1FYNA 2KMTA 1VQPA 2QEXT 1UEBA 4MDXA 1MNDA 1Q82C 4JDSA 4M7AD 2E41A 5DY9A 2D8HA 2PQWA 4JRPA 1JEGA 1EFNA 3MP6A 1BI2A 2QA4A 2O9SA 1UGSB 3M57A 1YCSB 1QVPA 1OPKA 3JCMe 5GANf 2JS0A 1Q81R 2LP5A 4O6JA 1YITA 2B8AA 2X3XD 2KT1A 2M16A 4C0DB 1QKXA 5KE3A 2FRWA 5CQXA 2DTIA 2RQRA 5KYUA 3MEAA 5AT1B 2E10A 2KR3A 2EJFA 3J7AF 2L89A 3HRSA 1PC0A 1BCMA 4J5YA 2PUOB 4XTXA 1X01A 2KK4A 5CIUA 4C5IA 4ME7A 4M4ZA 4M78C 2D6FA 2YLCA 2DF6A 2EYXA 1S72Q 3OYHA 2DD5A 3GP8A 5FWCA 2RPNA 1QKWA 1M8MA 3THKA 3M5AA 3TEEA 1T0JA 3KFVA 5EG2A 1WGSA 5HCKA 1KD1C 1YBYA 2X4WA 2ATCB 2HKNA 4OMQA 4A4GA 3PIOA 3J81E 1J3TA 3HFOA 4KRTA 7AT1B 2CYZB 1FX7A 3RBBB 2RJDA 3JV3A 5KH6A 1PRMC 3RIRA 2DBKA 3MPUB 4OMMA 3VV0A 4M7AA 2KRSA 1OU9A 5IAYA 2SEMA 3H41A 1VIEA 3JCMf 4N0AA 1TUGB 1MMGA 2EPDA 3LH0A 1JQQA 4D8DA 2RMOA 2E65A 5GAN4 3TQ7P 2NUTA 2E6NA 3SWNA 2FZCB 3UWNA 1U06A 1UHCA 2CP6A 1ZSGA 5CKFA 1NPRA 2ZGWA 3HSBA 1CKBA 3EFOB 2K2VA 1VQ5A 1YHQQ 1Q7YR 3CXCA 1KJWA 1U1SA 5ECAA 2CUDA 4LE9A 1OZ2A 4C8QB 3RMQA 1HSQA 3R6NA 1QW1A 5I21A 3M0TA 3HL8A 5CKEA 1B07A 1M1GA 2P84A 2JUFA 2XU8A 2EQKA 3L42A 1M8VA 3CXCS 1VQNQ 2XIDA 4WTOB 3GOXA 2HSEB 1AWOA 2X9HA 1GFDA 1VQKQ 5LJ5g 2CT3A 2E64A 2CH4A 4WCIA 2QEXQ 1VQ8A 2GGRA 1AWJA 4JLIA 3MJXA 2DM1A 1U8RA 3ZL7C 4IUUA 5IXFA 5I22A 2YRDA 2HMAA 1QQJA 5FU6C 3OS5A 2DPPB 1QCFA 3NHNA 3CCRA 1IZ6A 4OP0A 2MOXA 3IQLA 5I2MA 3QJYA 3A1PA 1IGUA 2XHCA 3VUZA 2DVEA 5CK9A 6AT1B 2DEUA 4HT8A 4M7DE 1GXIE 3TU4K 1OX8A 3FRNA 3PGGA 3QWXX 1QVFA 3TSWA 4XU3A 2DRMA 3I56A 3VRYA 3M59A 3O5ZA 1VQ6A 1NLOC 3CPWA 2K3BA 4M77D 3DB4A 2CZ0B 1WIEA 1UJ0A 1V29B 3RR6A 2O4XA 2ZPEB 4P5NA 4WF2A 3EGXA 5I2SA 3M4YA 5KYYA 5KYWA 1I07A 1T3LA 3EH2A 3FEOA 4M7DC 3QG1A 3BW1A 4X9CA 1BBZA 4XU1A 2RJCA 2G3RA 4X1VA 2KAFA 3GBQA 1KSWA 4BY6B 4DBFA 4M77C 5D6WA 1CKAA 1WXTA 2EFIA 3VS6A 1K8AR 4C92C 1WJRA 3G1JA 2NUZA 4B9WA 1KC8U 2QK0A 3HHTB 4MZPA 3VYHB 4C8QA 4OMNA 2DXTA 2XK0A 4M78A 2HZYA 1K4US 2FO0A 4M7DB 2G6FX 2DXUA 5GAOl 1O9SA 1S72T 2Y4XA 4Z8AA 4ELZC 4C8QD 2GTOA 3NFCA 1M3BA 1VQ7A 1VQNA 1Q82U 4M78F 1JBMA 3AT1B 5A2QE 1RACB 5IHIA 1Y71A 3ZEHA 2YUOA 1UUEA 5J3BA 3GNFB 3MP1A 4XTWA 2YDLA 3X20B 2YUNA 3OYLA 2KY9A 2XDPA 2KE9A 2A08A 2IVWA 1OQKA 2MWOA 4BUGA 2MI6A 1MHNA 3E9FA 4GLKA 4C0DC 2Y90A 4F7UB 1NJIU 1VQKT 2V8JA 1KQ1A 5GAN5 4ATOA 2CKKA 4ZTFA 1M1KR 4Z89A 2OTJT 3JCMX 1VQNT 2ZPHB 4R0KA 2GFAA 4DOWA 4ZGEB 4M7DA 3OW2S 2DJQA 4M75D 2XMFA 4J7FA 4IUVA 2LZ6B 1BYMA 5D6XA 1UE9A 4RCCA 2CZ1B 2DRKA 3M55A 2P4RA 1DJ7B 4AT1B 2YSQA 3FLGA 2YUQA 3INZA 3CCEQ 1X6OA 3LW5E 4KH1B 5CR2A 2EVRA 2O31A 3V8KA 3CXCP 1OX9A 3OYAA 4J83A 5GAMf 1YJWQ 2FG0A 2DL8A 4Y28E 1AWXA 1Q81C 4ESRA 1TSFA 4Z88A 2JJ9A 5GAOq 1WHMA 1IRXA 4J9IA 4RTTA 3EFRA 4D8KA 2YRCA 2J06A 3QBYA 2NWMA 4OMLA 8ATCB 2A37A 4E6RA 4PLLA 3EG0A 4M78D 4KUIA 3A5ZB 3CCLA 1OI1A 1ZX6A 4M77F 1M1FA 1RLQC 1QLYA 2OTJQ 2KDSA 2QA4Q 1YP5A 4HXJA 2KYMA 4RG2A 2F2XA 1WJSA 1WYXA 1OV3A 2HD0A 5KYNA 4XTUA 2EKHA 4HKEA 2LCLA 3BE3A 1TU0B 4CRIA 1ABOA 3OW2A 1X2QA 4F7UA 4M77A 1JJ2S 5GMKe 3GPLA 2BIVA 1I4K1 3NTHA 3JCMP 3VS5A 4L6V5 2DX1A 3CMEA 4C92F 2VUBA 1G2BA 2EJ9A 2H3EB 3HRUA 3JCMd 4LDUA 3BDUA 2L8DA 1YIJQ 1D1AA 2DZCA 1VQ5Q 2K3YA 2DE0X 5GJWB 5FU7C 2CP5A 4F04B 2AT1B 4JRIA 1C0MA 2OAUA 3FIFA 2VB6A 2GBQA 2JVVA 1ZUUA 2M1HA 3CC4A 2CZ7B 1VUBA 4ELYC 4HT9A 4QW2A 3CD6T 1NLPC 1FXXA 2K9GA 4M78B 3N5BB 3JCMV 4EPCA 1M5Q1 1VQ8T 2O01E 2RJEA 2K57A 1ZBJA 3L2ZA 3V7RA 3CC2A 3PFSA 2VVKA 2Y4YA 2A36A 1VQPT 2EQMA 1HJDA 4X34A 2HEQA 1VQMA 4QQ6A 1M90R 1KFZA 1ZSZA 1KK7A 1B3QA 4XTYA 3OBWA 4M78E 2VWFA 2JTEA 3P8HA 3MCAB 1HXDA 3OBYA 1ACMB 2EGEA 3MP8A 1WDXA 1ZSZC 2ZPBB 5GANe 4OB2B 5KYWB 1D09B 4OMOA 3MEWA 2ESWA 4AFUC 2CP0A 4PJOA 2NYSA 2VV5A 1RLPC 3OYYA 4DBRA 1UB4A 2O88A 3G71A 4IUQA 4IKFA 3A8OB 3OYJA 2E70A 1LCKA 2LQNA 4F17A 5D7UA 2NUTB 2DA9A 4LN2A 1VQ6Q 1VQLT 2XKOC 4R55A 1YI2Q 2LJ3A 4L59A 3L2QA 2QDLA 1LVKA 3D7SB 4J8OA 3H9NA 5LJ5d 2LNVA 1TUCA 2OTLT 1BI1A 3QZ9B 2J05A 1PSEA 3E2UA 1WQWA 4M75F 1YWPA 5GAOr 3S6WA 4E7IA 2A0FB 2B86A 2CP3A 2R57A 5GAN7 2K7AA 2QYZA 2D1XA 3WVEB 5IXBA 2LRQA 3V7SA 3A8HB 3QXEB 1PKSA 2JOYA 3M0UA 2DJZA 4Q5WA 5GAMd 4J9FA 1ZA2B 3SDZA 4CC4B 3EGDA 5GAMg 1UGRB 4FYXB 1O75A 4LDYA 3CCMA 4VUBA 3PVQA 4ZTJA 2XDDA 2RNAA 3RUXA 4QVDA 2YUPA 2OI3A 3SWNC 2E4HA 1QP2A 2W0ZA 4M7AG 1R0CB 4B9XA 2VASA 4O5VA 5GAOp 4NL3A 3JCMJ 1KD1R 2WSEE 4HCZA 3OS1A 4E47A 3M4GA 2DK3A 4EMHA 1Q86C 1K73C 3CCLT 5LJ5f 2AK5A 3OS0A 2DTHA 2LJ0A 4J6XA 1TS9A 2JTMA 5C0MA 2EYWA 3PT9A 2M0OA 1U5SA 3M0PA 2IIMA 4QT7A 3JCMW 1TUDA 4C92G 1VQLA 2RF0A 3MHXA 3G71T 4J9DA 2LTOA 4OMFB 5GMKh 2LJ1A 4YTLA 2M02A 3NGPA 4ZGJB 3E1SA 2CUBA 3EG2A 2A7YA 1W1FA 3LH5A 2CH4W 3MO8A 1WI7A 1Y7XA 2GNCA 4M7DG 4J9CA 4J9EA 4RTZA 2K6DA 3CCJQ 2EYQA 1IGQA 2VXEA 3LWIA 3JCMQ 1QCNA 4OB0B 3RKYA 2LX9A 5KCHA 4M7AE 3QHSA 1IB8A 2HL3A 4KGZB 1PWTA 4FL6A 2ROTA 1VQ9Q 1OULA 1W4SA 2D9TA 1K9MC 1G3TA 4C0ZA 3CCUT 3CC7Q 3CCMT 3CCQT 3QWYA 3VU3C 2FVUA 4NS5A 4ZNXA 3GNGA 3OW2P 2EWNA 2JMCA 4LDXA 2GFUA 4IUTA 4OVAA 3DB3A 2AZVA 2FZKB 3DKMA 3OYCA 5LJ3g 2MYSA 2RM4A 4RG8A 1TWBA 5GMKi 4C8QC 1QMCA 4M75B 5HK0A 3CQTA 4HCCA 3G6EQ 2HBWA 2LT1A 5DLOA 4PK4A 1E6HA 3JB9J 2MF2A 2OTLA 3OYMA 2DL5A 3A8MB 2DFUA 3CMEQ 2RQWA 3SFMA 3TVTA 5FROA 1P92A 2KVQG 5CVIA 2P0QA 4GBQA 1NJIR 3QUIA 2JT4A 2DMOA 2PUKB 4PFZA 3OY9A 3I55T 5GANh 4FSSA 4LUDA 1OZ3A 4PLIA 4CC7A 2QQAA 2ZCFB 5LL6S 3X24B 3EH1A 3LX7A 3FC3A 5GMKm 3QYHB 5A0LA 2E1HA 1EZZB 3M56A 3CPWP 3RKXA 2QI2A 3PNWC 1JU5C 1C6VX 3FB9A 5GANg 2GQVA 1LJOA 2YHTA 1UG1A 2GF7A 4CC2A 2DD4A 4MZMA 1BIBA 5GJVB 1YJNT 4C0FA 1MMDA 2X4YA 4N4IA 1SPKA 5LJ3e 2KNBB 1NBEB 2PZ1A 2YXYA 3CCST 4QKUA 3SB2A 4PFOA 1JB0E 5IH2A 1M3CA 4QQDA 3I56T 1WHLA 4XTZA 3LWHA 1MV0B 2ZPGB 1RABB 2LMJA 2HNIA 4XAXB 4KULA 2BZ8A 4ZN1A 5EC7A 4BE1A 1YNZA 1VQOT 3I55Q 1W70A 2CP2A 4BI8B 5GAN6 3VKIA 3TSZA 1WA7A 3JCMg 1AD5A 5CQYA 1XNIA 2YRVA 3LGLA 1SKUB 2O2OA 3KUFA 2ZPFB 3X26B 1SEMA 4PJOC 2AKLA 3HKSA 2PVDB 3GF5A 5GMKl 1GCQA 3NTIA 4M75E 2K79A 2EQJA 4C92A 1M9SA 4BE0A 2IG0A 3CEYA 3JCMh 1G3SA 4LD6A 3RERA 3EHRA 4FSXA 1PNJA 1WQ7A 4J9HA 4PJNA 2QQBA 2RQUA 1RAGB 5GAOn 4TVRA 1PCXA 4GY5A 1ZBXA 4JJNK 2A3LA 3VS4A 2F5KA 4C8QG 3CMAQ 1QVGA 4JZ4A 1B34A 4N4HA 2I0NA 1K76A 1X6GA 5KE2A 5FWBA 2E3IA 3RKWA 3CCUQ 3QJ6A 3OYGA 3EG3A 2KROA 2D8JA 1GCPA 1GFCA 2LCSA 3I9QA 2DBMA 3OQ5A 2DETA 2DLPA 3PMTA 4QQGA 4A53A 1VOMA 1NZ9A 1MMNA 2P4TA 1MGQA 2BE7D 5GAN8 2QXFA 4RKUE 5LJ5j 3OB9A 2R5MA 3C0CA 4A63B 1VQKA 3CCVA 4A4HA 3G4SA 2QTVA 1YJ9A 1VQOA 3MEVA 3FJ5A 2JS2A 1UECA 1Y0MA 5FLXE 4KGXB 2Z0WA 4KGVB 1RAAB 2V1RA 3QKJA 3G71Q 5M9OA 4FU6A 4OGEA 4MMLA 2F2WA 1X43A 3CC4T 4AFQC 2DZ9A 1M3AA 4DBHA 5IT9E 1RAIB 1M4ZA 1KQSA 1PD0A 2BZYA 2MCNA 1VQMT 1K1ZA 2L3RA 1G83A 3M58A 1XOVA 2DIQA 4PJMA 1I0CA 3CC2T 3V7CA 1Q86R 1W6XA 4IIOA 3CPWS 3QSUA 1X69A 5C6SA 2GTJA 1HK9A 4E7ZA 1OYXA 2LQWA 3EG9A 2COYA 2SRCA 3SD4A 4C92D 4EMKB 4HCKA 2ZAEA 1VA7A 3V8LA 4JZ3A 2BTTA 4M77G 3LYIA 1PRLC 5LJ3h 3DLLA 3M0SA 5J39A 1OPLA 4KT0E 2QGGA 2L2PA 5HY6A 1X27A 3CCRT 2EIFA 1AEYA 4FYVB 2EBPA 2QDYB 3REBB 4KUDK 4MDWA 4QVCA 4LUEA 3CCRQ 3KXTA 4XTVA 5KYUB 4M78G 2O9VA 3S3NA 2BZXA 2RA2A 1RUWA 1W2BP 3VYGA 1TXQA 2MAMA 1JO8A 1M2OA 1IO6A 2DVJA 1SRLA 1YIJA 4FW2A 3S3MA 2AZSA 3G6ET 1RAFB 4N4GA 1YWOA 2E5QA 2V1QA 1YITQ 3SEMA 3OSSC 1SF9A 5L23A 2JM9A 1HYOA 5LJ3d 1OOTA 3G7ZA 2ZZDA 5A0GA 2LVMA 4F7UG 9ATCB 2H8HA 1IXDA 3G4SQ 4KH0B 1UGQB 3C94A 1NM7A 4F16A 2ENMA 3VS0A 4AFZC 1PD1A 2E5KA 2L3QA 3C12A 2FZGB 1I81A 3I35A 2K5FA 1KIKA 2P0PA 2KGTA 1VQ9T 3VRZA 4M75A 1WNLA 3NTKA 4XU2A 4M7DD 2KI7A 3CCJA 2KEAA 2RHYA 3TREA 1XJWB 4FYYB 2ED1A 4A54A 4NOYA 2J6OA 4EDUA 5HK3A 3JCMc 2COZA 3JSCA 5AYFA 4PJOG 4RTUA 3L1AA 5A0DA 3CD6Q 2PTKA 3HFNA 4EMKA 2OJ2A 1WJQA 2E3HA 4BDYA 3A8GB 1S1NA 1AVZC 2C0OA 3M0RA 3M53A 1F1BB 1YITT 4OGCA 2IPOB 1V76A 2C0IA 1AT1B 3BDLA 4B6MA 4AFSC 1SRMA 2RK2A 1BK2A 2NLUA 2CT4A 2J6KA 2LX7A 4Y92A 4FT4A 4AMCA 2DO3A 1EX4A 1T3SA 1R0BG 1XQHA 2J7IA 3EGUA 2XI9A 4E7SA 3MKDA 1UGPB 3E19A 1KG1A 1WX6A 1RADB 1N9RA 1U3OA 2LC4A 3QIIA 4F7UE 3PIPA 1I5OB 3C95A 1ZA1B 1K0XA 3JCMb 1M2VA 3OYDA 1ZUKA 4JS4A 4A4FA 2DERA 2M9UA 2LQ8A 4RMOA 2LCCA 3HP9A 4AG1C 2JNGA 2EKOA 3OYFA 1K73R 3P8BB 2RN8A 4OB3B 2RI2A 1VQ4A 1JXOA 1H92A 4BE2A 2RHXA 1BCOA 2AKKA 4MMKA 3H0HA 1B7TA 2QQRA 3EAEA 4E2FB 5DLQE 1Q81U 1BU1A 4IURA 3I56Q 4IIMA 2EYZA 1I1JA 2RHZA 4ANJA 3PE0A 3ZBDA 2M0YA 1M1KU 1KC8R 1KHIA 1IHVA 2PVGB 1YJNQ 1YI2T 3CCVQ 1D0XA 1Z9ZA 1R77A 1GBRA 4RTWA 1N8RR 2ROLA 2WACA 3EGXB 4ZGDB 2XG8D 1K73U 3ME9A 4RTXA 2HAXA 4XU0A 2HQHA 3ASKA 2CSQA 4DOVA 5KYXB 3L2RA 2EGCA 3CD6A 4PKCC 3PMIA 2F5TX 3CC4Q 2MK5A 3UPUA 4EMGA 2V8IA 4HA8A 3RDVA 4LDWA 1UJYA 2D0QB 1X6BA 1LOJA 3H0FA 4RTVA 4J7IA 3VS2A 4LDVA 2DILA 4M7DF 1I8FA 2FL7A 2DL7A 3EHQA 2EAYA 1M30A 2FPFA 2A28A 1D3BB 4J6YA 3JB9I 1Z9QA 1VQ7Q 1G3WA 3L2UA 1VQ8Q 2NUPB 3H0IA 2KSSA 4C5GA 2E12A 1QP3A 2CP7A 4XQ3A 2QGFB 1SSFA 3NMZC 4FT2A 2MIOA 1GBQA 1VQ4T 3P8DA 1ZSZB 5LJ3j 1WFWA 4LXCA 4PJOB 1PHTA 4JRKA 1PSFA 2HQXA 2ECZA 3J80E 1NG2A 1G3YA 2RHUA 5IHKA 1VQ5T 1PG5B 1Q95G 5KCOA 2FHDA 3META 1UDLA 2X35A 4CI0C 2CGHA 1N6AA 4L5GA 1VQ7T 5KYYB 5KYXA 3HPWA 1Y96B 1W2BS 3I5SA 2JTFA 1M90C 3JB9F 4XK8E 2FPEA 3OS2A 3URGA 1ZLMA 1NE8A 3A8LB 4EIKA 3CPFA 3EFSA 1QCOA 4PL6A 1NEBA 3BFMA 1LNXA 2CZ6B 1NEGA 1SHFA 4C8QE 5DM7R 2AHJB 1TOVA 3M54A 3M9QA 1A0NB 2QTXA 2NUPA 2VGMA 3CCJT 5GAMh 3DLMA 2C06A 2DL4A 1WHKA 1AZGB 2VYTA 1Y57A 3JAME 1ARKA 4FYWB 2DL3A 2CSIA 5J26A 1FMWA 4M7AB 1SSHA 1UTIA 1X75C 3A98A 2X4XA 1FMVA 5GANj 4X9DA 2CREA 2ED0A 2L3PA 1TH7A 1E6GA 2GQIA 5CAIA 4ZN3A 4EMKC 2YLBA 3LGFA 3CC2Q 3CCVT 1UHFA 2R58A 4C0GA 1RI9A 3CBMA 1H3HA 2MMPA 2V26A 2RQVA 2PU9B 4E7LA 2CDTA 1YI2A 5GAOm 1M90U 1BKBA 3CBOA 4M77E 3VS1A 2M51A 3CCLQ 4J9BA 1YJWA 1M2VB 4C92B 5LJ5h 3OYKA 4DA4A 4M77B 4CC3A 5L8RE
chains in the Genus database with same CATH topology
2JS0A 1AWWA 2DE0X 2LP5A 1QWEA 5GJWB 2X3XD 2KT1A 2V1RA 1QKXA 2F2WA 2GBQA 1X43A 2FRWA 1ZUUA 4AFQC 1M3AA 2RQRA 1NLPC 2K9GA 2BZYA 2KR3A 2MCNA 1K1ZA 4JJDA 1G83A 1ZBJA 1XOVA 2L3SA 1I0CA 2VVKA 2A36A 1HJDA 1W6XA 4IIOA 4J9GA 2HEQA 1X69A 3SHWA 2GTJA 4M4ZA 1KFZA 2LQWA 2SRCA 1MV3A 1B3QA 2FPDA 2DF6A 4CC3A 2EYXA 4HCKA 2VWFA 2JTEA 1WXBA 1VA7A 5FWCA 3UATA 4JZ3A 2RPNA 1QKWA 2EGEA 1M8MA 2BTTA 1WDXA 3THKA 1PRLC 1T0JA 3PVLA 3KFVA 3M0SA 4OMOA 1OPLA 2ESWA 2EGAA 4AFUC 5HCKA 2L2PA 1X27A 1RLPC 2ABLA 2O88A 3UF4A 2HCKA 1AEYA 2EBPA 3REBB 1LCKA 2LQNA 4OMQA 4F17A 1YN8A 1J3TA 2DA9A 2JW4A 4KRTA 4LUEA 4LN2A 1VYVA 4GLMA 3M0QA 3RBBB 2O9VA 3JV3A 1K9AA 2BZXA 2LJ3A 1PRMC 1RUWA 2QDLA 2K2MA 2DBKA 4OMMA 2KRSA 1JO8A 1IO6A 3REAB 2SEMA 3H41A 2DVJA 1SRLA 1TUCA 2J05A 2AZSA 2EPDA 1H8KA 1JQQA 4JJBA 2PNIA 3VS7A 4D8DA 1YWOA 3ULRB 2RMOA 2V1QA 1YWPA 3SEMA 1MUZA 5L23A 4DEXA 1JXMA 2B86A 2JM9A 2K7AA 2KRNA 1OOTA 2D1XA 4JJCA 5IXBA 1U06A 2H8HA 1PKSA 1UHCA 2KT8A 2VKNA 3M0UA 1ZSGA 4K11A 4HVUA 4J9FA 1CKBA 1NM7A 4F16A 2ENMA 1KJWA 2X3WD 5ECAA 4OMPA 4CC4B 3VS0A 4AFZC 2CUDA 4F14A 4LE9A 2C0TA 2E5KA 2L3QA 1HSQA 3R6NA 3I35A 3M0TA 1KIKA 3PVQA 2DNUA 2RNAA 2KGTA 2YUPA 2OI3A 1B07A 3VRZA 2W0ZA 1WLPB 2KEAA 2EYYA 1AWOA 1X2KA 2ED1A 3EG1A 1FMKA 1GFDA 2J6OA 2AK5A 2LJ0A 2CT3A 1VYUA 2CH4A 4WCIA 3I5RA 2GGRA 1AWJA 2EYWA 4RTUA 2DM1A 1SHGA 4RUGA 2PTKA 2KXDA 2OJ2A 3ZL7C 5IXFA 1U5SA 3M0PA 5I22A 1GL5A 2IIMA 4QT7A 2F2VA 1TUDA 1QCFA 2RF0A 3NHNA 4J9DA 1S1NA 1AVZC 2LJ1A 2C0OA 1TG0A 3M0RA 2MOXA 3IQLA 3NGPA 2CUBA 2EW3A 2C0IA 3EG2A 1W1FA 3LH5A 4AFSC 2CH4W 1SRMA 1WI7A 1K0SA 1BK2A 2GNCA 3QWXX 2CT4A 4J9CA 4J9EA 4RTZA 3TSWA 2J6KA 2LX7A 2K6DA 4Y92A 1AOJA 5FW9A 4HVWA 2DRMA 1AZEA 3VRYA 1T3SA 2LNHB 2J7IA 3EGUA 3O5ZA 2JXBA 1NLOC 4RTYA 2K3BA 1V1CA 2L0AA 1WIEA 1WX6A 1PWTA 1UJ0A 1ZUYA 2ROTA 4ORZA 1U3OA 1K0XA 1PKTA 1I07A 1ZUKA 1T3LA 1OEBA 3QWYA 4ZNXA 4AG1C 1BBZA 2J6FA 1N5ZA 4X1VA 2JMCA 3GBQA 1NYFA 1KSWA 2RN8A 2AZVA 1JXOA 1H92A 1CKAA 1WXTA 3VS6A 2AKKA 2KXCA 3H0HA 2NUZA 3NPFA 1BU1A 1GRIA 3CQTA 2EQIA 4OMNA 2HBWA 1K4US 2FO0A 1E6HA 4IIMA 2G6FX 2EYZA 4AG2C 1I1JA 2DL5A 3PE0A 2RQWA 2M0YA 4Z8AA 2GTOA 3TVTA 2DYBA 1M3BA 2HSPA 1Z9ZA 4GBQA 2JT4A 1GBRA 5IHIA 4RTWA 2DMOA 1HD3A 2YUOA 2ROLA 1UUEA 3VS3A 2YDLA 4FSSA 2YUNA 4LUDA 4RTXA 4CC7A 2CSQA 2KE9A 4LNPA 2EGCA 2A08A 1BB9A 1WXUA 1UJYA 3RNJA 1E7OA 1X6BA 4Z89A 3H0FA 2RQTA 4R0KA 4RTVA 1JU5C 3U23A 3VS2A 2DILA 2OAWA 1UG1A 1UGVA 4CC2A 2DL7A 3EHQA 4HVVA 2DJQA 2XMFA 1M30A 2LZ6B 2JM8A 2FPFA 1UE9A 5GJVB 2A28A 2DRKA 2P4RA 2W10A 1Z9QA 2YSQA 1SPKA 2YUQA 5IHNA 2KNBB 2PZ1A 3H0IA 2EVRA 2O31A 5IH2A 1M3CA 2FRYA 1MV0B 3NMZC 2HDAA 2LMJA 2MIOA 2FG0A 2DL8A 1GBQA 1VYTA 2BZ8A 5EC7A 3UA7A 1AWXA 1OPKA 1WFWA 4JPBW 4ESRA 4Z88A 1PHTA 1T0HA 1YNZA 1QWFA 2ECZA 1NG2A 1W70A 1NYGA 1UFFA 3UA6A 5IHKA 4J9IA 3TSZA 1WA7A 4RTTA 4D8KA 1AD5A 1ABQA 2J06A 2O2OA 1UDLA 2NWMA 4OMLA 1SEMA 1CSKA 2AKLA 2A37A 2KBTA 4E6RA 2YT6A 1GCQA 3I5SA 4DEYA 2K79A 3EG0A 2FPEA 1ZLMA 1ZX6A 1GCQC 3EHRA 4EIKA 1PNJA 1RLQC 1NEBA 1NEGA 1QLYA 1SHFA 4J9HA 2RQUA 1YP5A 4HXJA 2KYMA 1A0NB 2F2XA 2FEIA 3VS4A 1WYXA 1OV3A 2DL4A 1AZGB 4JZ4A 1Y57A 5I11A 2I0NA 1ARKA 1K76A 1X6GA 2DL3A 2CSIA 5FWBA 2EKHA 1SSHA 1UTIA 3A98A 2KRMA 3EG3A 2KROA 2D8JA 1GCPA 1M27C 1GFCA 2CREA 2LCSA 1ABOA 3I9QA 2D0NA 2DBMA 2ED0A 2DLPA 2L3PA 1X2QA 1E6GA 2GQIA 2KYBA 1UHFA 2JMAA 1RI9A 3VS5A 1H3HA 2DX1A 2RQVA 1FYNA 2CDTA 3C0CA 1G2BA 3VS1A 4A63B 2M51A 4J9BA 2D8HA 1JEGA 1EFNA 3FJ5A 2JS2A 2O9SA 1YCSB 1UECA 1Y0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS0 A;  1AWW A;  2DE0 X;  2LP5 A;  1QWE A;  5GJW B;  2X3X D;  2KT1 A;  2V1R A;  1QKX A;  2F2W A;  2GBQ A;  1X43 A;  2FRW A;  1ZUU A;  4AFQ C;  1M3A A;  2RQR A;  1NLP C;  2K9G A;  2BZY A;  2KR3 A;  2MCN A;  1K1Z A;  4JJD A;  1G83 A;  1ZBJ A;  1XOV A;  2L3S A;  1I0C A;  2VVK A;  2A36 A;  1HJD A;  1W6X A;  4IIO A;  4J9G A;  2HEQ A;  1X69 A;  3SHW A;  2GTJ A;  4M4Z A;  1KFZ A;  2LQW A;  2SRC A;  1MV3 A;  1B3Q A;  2FPD A;  2DF6 A;  4CC3 A;  2EYX A;  4HCK A;  2VWF A;  2JTE A;  1WXB A;  1VA7 A;  5FWC A;  3UAT A;  4JZ3 A;  2RPN A;  1QKW A;  2EGE A;  1M8M A;  2BTT A;  1WDX A;  3THK A;  1PRL C;  1T0J A;  3PVL A;  3KFV A;  3M0S A;  4OMO A;  1OPL A;  2ESW A;  2EGA A;  4AFU C;  5HCK A;  2L2P A;  1X27 A;  1RLP C;  2ABL A;  2O88 A;  3UF4 A;  2HCK A;  1AEY A;  2EBP A;  3REB B;  1LCK A;  2LQN A;  4OMQ A;  4F17 A;  1YN8 A;  1J3T A;  2DA9 A;  2JW4 A;  4KRT A;  4LUE A;  4LN2 A;  1VYV A;  4GLM A;  3M0Q A;  3RBB B;  2O9V A;  3JV3 A;  1K9A A;  2BZX A;  2LJ3 A;  1PRM C;  1RUW A;  2QDL A;  2K2M A;  2DBK A;  4OMM A;  2KRS A;  1JO8 A;  1IO6 A;  3REA B;  2SEM A;  3H41 A;  2DVJ A;  1SRL A;  1TUC A;  2J05 A;  2AZS A;  2EPD A;  1H8K A;  1JQQ A;  4JJB A;  2PNI A;  3VS7 A;  4D8D A;  1YWO A;  3ULR B;  2RMO A;  2V1Q A;  1YWP A;  3SEM A;  1MUZ A;  5L23 A;  4DEX A;  1JXM A;  2B86 A;  2JM9 A;  2K7A A;  2KRN A;  1OOT A;  2D1X A;  4JJC A;  5IXB A;  1U06 A;  2H8H A;  1PKS A;  1UHC A;  2KT8 A;  2VKN A;  3M0U A;  1ZSG A;  4K11 A;  4HVU A;  4J9F A;  1CKB A;  1NM7 A;  4F16 A;  2ENM A;  1KJW A;  2X3W D;  5ECA A;  4OMP A;  4CC4 B;  3VS0 A;  4AFZ C;  2CUD A;  4F14 A;  4LE9 A;  2C0T A;  2E5K A;  2L3Q A;  1HSQ A;  3R6N A;  3I35 A;  3M0T A;  1KIK A;  3PVQ A;  2DNU A;  2RNA A;  2KGT A;  2YUP A;  2OI3 A;  1B07 A;  3VRZ A;  2W0Z A;  1WLP B;  2KEA A;  2EYY A;  1AWO A;  1X2K A;  2ED1 A;  3EG1 A;  1FMK A;  1GFD A;  2J6O A;  2AK5 A;  2LJ0 A;  2CT3 A;  1VYU A;  2CH4 A;  4WCI A;  3I5R A;  2GGR A;  1AWJ A;  2EYW A;  4RTU A;  2DM1 A;  1SHG A;  4RUG A;  2PTK A;  2KXD A;  2OJ2 A;  3ZL7 C;  5IXF A;  1U5S A;  3M0P A;  5I22 A;  1GL5 A;  2IIM A;  4QT7 A;  2F2V A;  1TUD A;  1QCF A;  2RF0 A;  3NHN A;  4J9D A;  1S1N A;  1AVZ C;  2LJ1 A;  2C0O A;  1TG0 A;  3M0R A;  2MOX A;  3IQL A;  3NGP A;  2CUB A;  2EW3 A;  2C0I A;  3EG2 A;  1W1F A;  3LH5 A;  4AFS C;  2CH4 W;  1SRM A;  1WI7 A;  1K0S A;  1BK2 A;  2GNC A;  3QWX X;  2CT4 A;  4J9C A;  4J9E A;  4RTZ A;  3TSW A;  2J6K A;  2LX7 A;  2K6D A;  4Y92 A;  1AOJ A;  5FW9 A;  4HVW A;  2DRM A;  1AZE A;  3VRY A;  1T3S A;  2LNH B;  2J7I A;  3EGU A;  3O5Z A;  2JXB A;  1NLO C;  4RTY A;  2K3B A;  1V1C A;  2L0A A;  1WIE A;  1WX6 A;  1PWT A;  1UJ0 A;  1ZUY A;  2ROT A;  4ORZ A;  1U3O A;  1K0X A;  1PKT A;  1I07 A;  1ZUK A;  1T3L A;  1OEB A;  3QWY A;  4ZNX A;  4AG1 C;  1BBZ A;  2J6F A;  1N5Z A;  4X1V A;  2JMC A;  3GBQ A;  1NYF A;  1KSW A;  2RN8 A;  2AZV A;  1JXO A;  1H92 A;  1CKA A;  1WXT A;  3VS6 A;  2AKK A;  2KXC A;  3H0H A;  2NUZ A;  3NPF A;  1BU1 A;  1GRI A;  3CQT A;  2EQI A;  4OMN A;  2HBW A;  1K4U S;  2FO0 A;  1E6H A;  4IIM A;  2G6F X;  2EYZ A;  4AG2 C;  1I1J A;  2DL5 A;  3PE0 A;  2RQW A;  2M0Y A;  4Z8A A;  2GTO A;  3TVT A;  2DYB A;  1M3B A;  2HSP A;  1Z9Z A;  4GBQ A;  2JT4 A;  1GBR A;  5IHI A;  4RTW A;  2DMO A;  1HD3 A;  2YUO A;  2ROL A;  1UUE A;  3VS3 A;  2YDL A;  4FSS A;  2YUN A;  4LUD A;  4RTX A;  4CC7 A;  2CSQ A;  2KE9 A;  4LNP A;  2EGC A;  2A08 A;  1BB9 A;  1WXU A;  1UJY A;  3RNJ A;  1E7O A;  1X6B A;  4Z89 A;  3H0F A;  2RQT A;  4R0K A;  4RTV A;  1JU5 C;  3U23 A;  3VS2 A;  2DIL A;  2OAW A;  1UG1 A;  1UGV A;  4CC2 A;  2DL7 A;  3EHQ A;  4HVV A;  2DJQ A;  2XMF A;  1M30 A;  2LZ6 B;  2JM8 A;  2FPF A;  1UE9 A;  5GJV B;  2A28 A;  2DRK A;  2P4R A;  2W10 A;  1Z9Q A;  2YSQ A;  1SPK A;  2YUQ A;  5IHN A;  2KNB B;  2PZ1 A;  3H0I A;  2EVR A;  2O31 A;  5IH2 A;  1M3C A;  2FRY A;  1MV0 B;  3NMZ C;  2HDA A;  2LMJ A;  2MIO A;  2FG0 A;  2DL8 A;  1GBQ A;  1VYT A;  2BZ8 A;  5EC7 A;  3UA7 A;  1AWX A;  1OPK A;  1WFW A;  4JPB W;  4ESR A;  4Z88 A;  1PHT A;  1T0H A;  1YNZ A;  1QWF A;  2ECZ A;  1NG2 A;  1W70 A;  1NYG A;  1UFF A;  3UA6 A;  5IHK A;  4J9I A;  3TSZ A;  1WA7 A;  4RTT A;  4D8K A;  1AD5 A;  1ABQ A;  2J06 A;  2O2O A;  1UDL A;  2NWM A;  4OML A;  1SEM A;  1CSK A;  2AKL A;  2A37 A;  2KBT A;  4E6R A;  2YT6 A;  1GCQ A;  3I5S A;  4DEY A;  2K79 A;  3EG0 A;  2FPE A;  1ZLM A;  1ZX6 A;  1GCQ C;  3EHR A;  4EIK A;  1PNJ A;  1RLQ C;  1NEB A;  1NEG A;  1QLY A;  1SHF A;  4J9H A;  2RQU A;  1YP5 A;  4HXJ A;  2KYM A;  1A0N B;  2F2X A;  2FEI A;  3VS4 A;  1WYX A;  1OV3 A;  2DL4 A;  1AZG B;  4JZ4 A;  1Y57 A;  5I11 A;  2I0N A;  1ARK A;  1K76 A;  1X6G A;  2DL3 A;  2CSI A;  5FWB A;  2EKH A;  1SSH A;  1UTI A;  3A98 A;  2KRM A;  3EG3 A;  2KRO A;  2D8J A;  1GCP A;  1M27 C;  1GFC A;  2CRE A;  2LCS A;  1ABO A;  3I9Q A;  2D0N A;  2DBM A;  2ED0 A;  2DLP A;  2L3P A;  1X2Q A;  1E6G A;  2GQI A;  2KYB A;  1UHF A;  2JMA A;  1RI9 A;  3VS5 A;  1H3H A;  2DX1 A;  2RQV A;  1FYN A;  2CDT A;  3C0C A;  1G2B A;  3VS1 A;  4A63 B;  2M51 A;  4J9B A;  2D8H A;  1JEG A;  1EFN A;  3FJ5 A;  2JS2 A;  2O9S A;  1YCS B;  1UEC A;  1Y0M A; 
#chains in the Genus database with same CATH topology
 3FJP A;  1AWW A;  1VIF A;  1QWE A;  1QVF S;  2L5Q A;  1C1A A;  5CKH A;  2E6Z A;  5FRM A;  4JJD A;  3SWN B;  5GAM j;  4JRQ A;  4FIB A;  3GLX A;  4JLG A;  2L3S A;  1K9M R;  1K9M U;  2OTJ A;  4J9G A;  4JS5 A;  2F69 A;  3SHW A;  4PJJ A;  3F70 A;  1H3Z A;  4M75 C;  1MV3 A;  2DXB A;  2FPD A;  2DTO A;  3JB9 H;  1WXB A;  3CCE A;  1D1C A;  4PJO D;  2HBP A;  2V8K A;  3UAT A;  3CC7 A;  3CMA T;  3PVL A;  1JJ2 P;  1H64 1;  3Q1J A;  2EGA A;  3CCQ Q;  4QVZ A;  2RB6 A;  2K3X A;  1K8A U;  2ABL A;  5CO7 A;  3UF4 A;  2HCK A;  1IRE B;  4BI4 A;  1VQ4 Q;  1QVF P;  1KHC A;  4N0A C;  3PTA A;  3HRT A;  4FCY A;  1YN8 A;  2JW4 A;  2XDB A;  1MMA A;  1VYV A;  3X28 B;  3C4S A;  3LLR A;  4GLM A;  5D6Y A;  1G8X A;  3M0Q A;  1K9A A;  3RMS A;  1JRI A;  3G6E A;  2K2M A;  2RH2 A;  1TTH B;  2FYK A;  3REA B;  1KQ2 A;  3GIB A;  4KBM B;  1SG5 A;  5GAN 2;  3JB9 D;  4JJB A;  1H8K A;  2PNI A;  3VS7 A;  3ULR B;  2RD1 A;  3X25 B;  3QDR B;  1MUZ A;  2R5A A;  4DEX A;  1JXM A;  1WHG A;  1VQP Q;  4R56 A;  2KRN A;  4JJC A;  4C5H A;  5FU7 B;  4PJL A;  2VKN A;  2KT8 A;  3JB9 G;  4K11 A;  4HVU A;  1KC8 C;  3S3O A;  3OMG A;  2RI5 A;  2BUD A;  5CCA A;  2QAZ A;  4DQ2 A;  3G4S T;  2VC8 A;  2X3W D;  4F14 A;  4OMP A;  2C0T A;  2MWP A;  4PNO A;  3TCJ A;  1N8R C;  1R8O B;  2DNU A;  2DIG A;  3WVD B;  3OYI A;  1ZQ1 A;  3OYN A;  1WLP B;  2EYY A;  1KQS P;  5FRN A;  4OF1 A;  2DKG A;  2RI3 A;  1X2K A;  3EG1 A;  1FMK A;  1WZO A;  3WXM B;  1VYU A;  2KQW A;  1I5L A;  1BI3 A;  1ZHI A;  2CS7 A;  3I5R A;  2BKD N;  2QQ9 A;  4RCB A;  1SHG A;  4RUG A;  1AHJ B;  1RAH B;  2KXD A;  1GL5 A;  4PJO E;  2F2V A;  5LJ3 f;  2RHI A;  1U1T A;  5GMK j;  1FWZ A;  2YWW A;  4BI3 A;  4A4E A;  2P0K A;  3UDC A;  4MZT A;  1Y96 A;  1TG0 A;  1Q7Y U;  4HCB A;  2EW3 A;  4Z02 A;  3CCQ A;  2K5I A;  1K0S A;  2DAQ A;  2VXF A;  5FU6 B;  3OSV A;  2O4X B;  5FW9 A;  1WPY A;  1AOJ A;  4HVW A;  1AZE A;  3HTR A;  2LNH B;  3EFO A;  3ER0 A;  4M7A C;  2JXB A;  4C8Q F;  3KBG A;  3EG9 B;  5GAM e;  4RTY A;  3RES A;  1VQ6 T;  1V1C A;  3BY7 A;  2HL5 C;  1W2B A;  2K4Y A;  2L0A A;  1YJN A;  3L2W A;  1S72 A;  2WSC E;  1ZUY A;  3QO3 A;  4ORZ A;  3AHU A;  1PKT A;  4V2S A;  8AT1 B;  1QVG S;  1OEB A;  4D6W A;  2BE9 B;  1YHQ T;  2K5L A;  2X51 A;  3CCM Q;  1VQL Q;  2J6F A;  1N5Z A;  3CC7 T;  4JUV A;  1NYF A;  4Y91 A;  1OU8 A;  3EGD B;  1BI0 A;  3CCS A;  2JN0 A;  4BDZ A;  4NL2 A;  1IHW A;  3CCU A;  2KXC A;  3H8Z A;  1JJ2 A;  3NPF A;  2GCX A;  1YHQ A;  1N8R U;  1GRI A;  3O8V A;  2EQI A;  2F1L A;  3I55 A;  1YFN A;  5HKC A;  5CKB A;  3E9G A;  4AG2 C;  3VUB A;  2QAS A;  3H6Z A;  2X4J A;  4C92 E;  3QZ5 B;  4E7H A;  2I2L A;  5GAN 3;  2DYB A;  2COW A;  2HSP A;  1YCY A;  4E7J A;  3QYG B;  1VQ9 A;  1N9S A;  3OMC A;  2DEQ A;  2LDM A;  1LPL A;  1QVG P;  1HD3 A;  3VS3 A;  2VGN A;  4PJO F;  4UC4 A;  1D3B A;  2ZPI B;  2HQE A;  5CKD A;  1Q7Y C;  4LNP A;  3OYE A;  1N27 A;  1BB9 A;  2RJF A;  2XD0 A;  3VJP A;  1B34 B;  1WXU A;  3CMA A;  3RNJ A;  1E7O A;  1NPP A;  1RAE B;  4FW1 A;  2QQS A;  2RQT A;  2WSF E;  3U23 A;  2OAW A;  1YIJ T;  1Q86 U;  1UGV A;  2LT4 A;  4HVV A;  2JM8 A;  4LD9 K;  2FB7 A;  4J6W A;  2W10 A;  1RL2 A;  3QPH A;  2LQK A;  2QEX A;  1G5V A;  5IHN A;  4M7A F;  2AIR B;  4FM4 B;  3ZFJ A;  2FRY A;  2HDA A;  3FDR A;  1VYT A;  4BY6 C;  2JZ2 A;  1VQO Q;  3UA7 A;  4BD3 A;  4JPB W;  5LJ5 e;  1K8A C;  4BB7 A;  1T0H A;  2QA4 T;  1WHJ A;  1MNE A;  1QWF A;  3OA6 A;  2DYI A;  1D0Y A;  3L2V A;  1NYG A;  1UFF A;  3UA6 A;  3MEU A;  2OX7 A;  2OTL Q;  4IUP A;  1NJI C;  1ABQ A;  3CCS Q;  3R6O A;  4DBQ A;  4II1 A;  1CSK A;  2KBT A;  1BIA A;  2YT6 A;  4DEY A;  2QG9 B;  4F7U F;  4OB1 B;  2DXC A;  1RI0 A;  1KQS S;  2RO0 A;  1EIF A;  1GCQ C;  1KD1 U;  5GAN d;  1XTD A;  1YJ9 Q;  3OYB A;  1D0Z A;  1VQM Q;  2EQU A;  2H3J A;  5IN1 A;  2EJG A;  2FEI A;  3UT1 A;  1M1K C;  1PM3 A;  3CBP A;  3QDF A;  3JRZ A;  4A4K A;  1Y07 A;  4BAC A;  2PVO B;  5I11 A;  4E7K A;  2XIC A;  1WHH A;  2KRM A;  3V8J A;  2HKQ B;  1M27 C;  2MPX C;  2D0N A;  1YJ9 T;  4PFP A;  2RK1 A;  2KYB A;  1YJW T;  3T9N A;  2JMA A;  1Q82 R;  1D1B A;  3CME T;  3CCE T;  4C5E A;  4M75 G;  1FYN A;  2KMT A;  1VQP A;  2QEX T;  1UEB A;  4MDX A;  1MND A;  1Q82 C;  4JDS A;  4M7A D;  2E41 A;  5DY9 A;  2D8H A;  2PQW A;  4JRP A;  1JEG A;  1EFN A;  3MP6 A;  1BI2 A;  2QA4 A;  2O9S A;  1UGS B;  3M57 A;  1YCS B;  1QVP A;  1OPK A;  3JCM e;  5GAN f;  2JS0 A;  1Q81 R;  2LP5 A;  4O6J A;  1YIT A;  2B8A A;  2X3X D;  2KT1 A;  2M16 A;  4C0D B;  1QKX A;  5KE3 A;  2FRW A;  5CQX A;  2DTI A;  2RQR A;  5KYU A;  3MEA A;  5AT1 B;  2E10 A;  2KR3 A;  2EJF A;  3J7A F;  2L89 A;  3HRS A;  1PC0 A;  1BCM A;  4J5Y A;  2PUO B;  4XTX A;  1X01 A;  2KK4 A;  5CIU A;  4C5I A;  4ME7 A;  4M4Z A;  4M78 C;  2D6F A;  2YLC A;  2DF6 A;  2EYX A;  1S72 Q;  3OYH A;  2DD5 A;  3GP8 A;  5FWC A;  2RPN A;  1QKW A;  1M8M A;  3THK A;  3M5A A;  3TEE A;  1T0J A;  3KFV A;  5EG2 A;  1WGS A;  5HCK A;  1KD1 C;  1YBY A;  2X4W A;  2ATC B;  2HKN A;  4OMQ A;  4A4G A;  3PIO A;  3J81 E;  1J3T A;  3HFO A;  4KRT A;  7AT1 B;  2CYZ B;  1FX7 A;  3RBB B;  2RJD A;  3JV3 A;  5KH6 A;  1PRM C;  3RIR A;  2DBK A;  3MPU B;  4OMM A;  3VV0 A;  4M7A A;  2KRS A;  1OU9 A;  5IAY A;  2SEM A;  3H41 A;  1VIE A;  3JCM f;  4N0A A;  1TUG B;  1MMG A;  2EPD A;  3LH0 A;  1JQQ A;  4D8D A;  2RMO A;  2E65 A;  5GAN 4;  3TQ7 P;  2NUT A;  2E6N A;  3SWN A;  2FZC B;  3UWN A;  1U06 A;  1UHC A;  2CP6 A;  1ZSG A;  5CKF A;  1NPR A;  2ZGW A;  3HSB A;  1CKB A;  3EFO B;  2K2V A;  1VQ5 A;  1YHQ Q;  1Q7Y R;  3CXC A;  1KJW A;  1U1S A;  5ECA A;  2CUD A;  4LE9 A;  1OZ2 A;  4C8Q B;  3RMQ A;  1HSQ A;  3R6N A;  1QW1 A;  5I21 A;  3M0T A;  3HL8 A;  5CKE A;  1B07 A;  1M1G A;  2P84 A;  2JUF A;  2XU8 A;  2EQK A;  3L42 A;  1M8V A;  3CXC S;  1VQN Q;  2XID A;  4WTO B;  3GOX A;  2HSE B;  1AWO A;  2X9H A;  1GFD A;  1VQK Q;  5LJ5 g;  2CT3 A;  2E64 A;  2CH4 A;  4WCI A;  2QEX Q;  1VQ8 A;  2GGR A;  1AWJ A;  4JLI A;  3MJX A;  2DM1 A;  1U8R A;  3ZL7 C;  4IUU A;  5IXF A;  5I22 A;  2YRD A;  2HMA A;  1QQJ A;  5FU6 C;  3OS5 A;  2DPP B;  1QCF A;  3NHN A;  3CCR A;  1IZ6 A;  4OP0 A;  2MOX A;  3IQL A;  5I2M A;  3QJY A;  3A1P A;  1IGU A;  2XHC A;  3VUZ A;  2DVE A;  5CK9 A;  6AT1 B;  2DEU A;  4HT8 A;  4M7D E;  1GXI E;  3TU4 K;  1OX8 A;  3FRN A;  3PGG A;  3QWX X;  1QVF A;  3TSW A;  4XU3 A;  2DRM A;  3I56 A;  3VRY A;  3M59 A;  3O5Z A;  1VQ6 A;  1NLO C;  3CPW A;  2K3B A;  4M77 D;  3DB4 A;  2CZ0 B;  1WIE A;  1UJ0 A;  1V29 B;  3RR6 A;  2O4X A;  2ZPE B;  4P5N A;  4WF2 A;  3EGX A;  5I2S A;  3M4Y A;  5KYY A;  5KYW A;  1I07 A;  1T3L A;  3EH2 A;  3FEO A;  4M7D C;  3QG1 A;  3BW1 A;  4X9C A;  1BBZ A;  4XU1 A;  2RJC A;  2G3R A;  4X1V A;  2KAF A;  3GBQ A;  1KSW A;  4BY6 B;  4DBF A;  4M77 C;  5D6W A;  1CKA A;  1WXT A;  2EFI A;  3VS6 A;  1K8A R;  4C92 C;  1WJR A;  3G1J A;  2NUZ A;  4B9W A;  1KC8 U;  2QK0 A;  3HHT B;  4MZP A;  3VYH B;  4C8Q A;  4OMN A;  2DXT A;  2XK0 A;  4M78 A;  2HZY A;  1K4U S;  2FO0 A;  4M7D B;  2G6F X;  2DXU A;  5GAO l;  1O9S A;  1S72 T;  2Y4X A;  4Z8A A;  4ELZ C;  4C8Q D;  2GTO A;  3NFC A;  1M3B A;  1VQ7 A;  1VQN A;  1Q82 U;  4M78 F;  1JBM A;  3AT1 B;  5A2Q E;  1RAC B;  5IHI A;  1Y71 A;  3ZEH A;  2YUO A;  1UUE A;  5J3B A;  3GNF B;  3MP1 A;  4XTW A;  2YDL A;  3X20 B;  2YUN A;  3OYL A;  2KY9 A;  2XDP A;  2KE9 A;  2A08 A;  2IVW A;  1OQK A;  2MWO A;  4BUG A;  2MI6 A;  1MHN A;  3E9F A;  4GLK A;  4C0D C;  2Y90 A;  4F7U B;  1NJI U;  1VQK T;  2V8J A;  1KQ1 A;  5GAN 5;  4ATO A;  2CKK A;  4ZTF A;  1M1K R;  4Z89 A;  2OTJ T;  3JCM X;  1VQN T;  2ZPH B;  4R0K A;  2GFA A;  4DOW A;  4ZGE B;  4M7D A;  3OW2 S;  2DJQ A;  4M75 D;  2XMF A;  4J7F A;  4IUV A;  2LZ6 B;  1BYM A;  5D6X A;  1UE9 A;  4RCC A;  2CZ1 B;  2DRK A;  3M55 A;  2P4R A;  1DJ7 B;  4AT1 B;  2YSQ A;  3FLG A;  2YUQ A;  3INZ A;  3CCE Q;  1X6O A;  3LW5 E;  4KH1 B;  5CR2 A;  2EVR A;  2O31 A;  3V8K A;  3CXC P;  1OX9 A;  3OYA A;  4J83 A;  5GAM f;  1YJW Q;  2FG0 A;  2DL8 A;  4Y28 E;  1AWX A;  1Q81 C;  4ESR A;  1TSF A;  4Z88 A;  2JJ9 A;  5GAO q;  1WHM A;  1IRX A;  4J9I A;  4RTT A;  3EFR A;  4D8K A;  2YRC A;  2J06 A;  3QBY A;  2NWM A;  4OML A;  8ATC B;  2A37 A;  4E6R A;  4PLL A;  3EG0 A;  4M78 D;  4KUI A;  3A5Z B;  3CCL A;  1OI1 A;  1ZX6 A;  4M77 F;  1M1F A;  1RLQ C;  1QLY A;  2OTJ Q;  2KDS A;  2QA4 Q;  1YP5 A;  4HXJ A;  2KYM A;  4RG2 A;  2F2X A;  1WJS A;  1WYX A;  1OV3 A;  2HD0 A;  5KYN A;  4XTU A;  2EKH A;  4HKE A;  2LCL A;  3BE3 A;  1TU0 B;  4CRI A;  1ABO A;  3OW2 A;  1X2Q A;  4F7U A;  4M77 A;  1JJ2 S;  5GMK e;  3GPL A;  2BIV A;  1I4K 1;  3NTH A;  3JCM P;  3VS5 A;  4L6V 5;  2DX1 A;  3CME A;  4C92 F;  2VUB A;  1G2B A;  2EJ9 A;  2H3E B;  3HRU A;  3JCM d;  4LDU A;  3BDU A;  2L8D A;  1YIJ Q;  1D1A A;  2DZC A;  1VQ5 Q;  2K3Y A;  2DE0 X;  5GJW B;  5FU7 C;  2CP5 A;  4F04 B;  2AT1 B;  4JRI A;  1C0M A;  2OAU A;  3FIF A;  2VB6 A;  2GBQ A;  2JVV A;  1ZUU A;  2M1H A;  3CC4 A;  2CZ7 B;  1VUB A;  4ELY C;  4HT9 A;  4QW2 A;  3CD6 T;  1NLP C;  1FXX A;  2K9G A;  4M78 B;  3N5B B;  3JCM V;  4EPC A;  1M5Q 1;  1VQ8 T;  2O01 E;  2RJE A;  2K57 A;  1ZBJ A;  3L2Z A;  3V7R A;  3CC2 A;  3PFS A;  2VVK A;  2Y4Y A;  2A36 A;  1VQP T;  2EQM A;  1HJD A;  4X34 A;  2HEQ A;  1VQM A;  4QQ6 A;  1M90 R;  1KFZ A;  1ZSZ A;  1KK7 A;  1B3Q A;  4XTY A;  3OBW A;  4M78 E;  2VWF A;  2JTE A;  3P8H A;  3MCA B;  1HXD A;  3OBY A;  1ACM B;  2EGE A;  3MP8 A;  1WDX A;  1ZSZ C;  2ZPB B;  5GAN e;  4OB2 B;  5KYW B;  1D09 B;  4OMO A;  3MEW A;  2ESW A;  4AFU C;  2CP0 A;  4PJO A;  2NYS A;  2VV5 A;  1RLP C;  3OYY A;  4DBR A;  1UB4 A;  2O88 A;  3G71 A;  4IUQ A;  4IKF A;  3A8O B;  3OYJ A;  2E70 A;  1LCK A;  2LQN A;  4F17 A;  5D7U A;  2NUT B;  2DA9 A;  4LN2 A;  1VQ6 Q;  1VQL T;  2XKO C;  4R55 A;  1YI2 Q;  2LJ3 A;  4L59 A;  3L2Q A;  2QDL A;  1LVK A;  3D7S B;  4J8O A;  3H9N A;  5LJ5 d;  2LNV A;  1TUC A;  2OTL T;  1BI1 A;  3QZ9 B;  2J05 A;  1PSE A;  3E2U A;  1WQW A;  4M75 F;  1YWP A;  5GAO r;  3S6W A;  4E7I A;  2A0F B;  2B86 A;  2CP3 A;  2R57 A;  5GAN 7;  2K7A A;  2QYZ A;  2D1X A;  3WVE B;  5IXB A;  2LRQ A;  3V7S A;  3A8H B;  3QXE B;  1PKS A;  2JOY A;  3M0U A;  2DJZ A;  4Q5W A;  5GAM d;  4J9F A;  1ZA2 B;  3SDZ A;  4CC4 B;  3EGD A;  5GAM g;  1UGR B;  4FYX B;  1O75 A;  4LDY A;  3CCM A;  4VUB A;  3PVQ A;  4ZTJ A;  2XDD A;  2RNA A;  3RUX A;  4QVD A;  2YUP A;  2OI3 A;  3SWN C;  2E4H A;  1QP2 A;  2W0Z A;  4M7A G;  1R0C B;  4B9X A;  2VAS A;  4O5V A;  5GAO p;  4NL3 A;  3JCM J;  1KD1 R;  2WSE E;  4HCZ A;  3OS1 A;  4E47 A;  3M4G A;  2DK3 A;  4EMH A;  1Q86 C;  1K73 C;  3CCL T;  5LJ5 f;  2AK5 A;  3OS0 A;  2DTH A;  2LJ0 A;  4J6X A;  1TS9 A;  2JTM A;  5C0M A;  2EYW A;  3PT9 A;  2M0O A;  1U5S A;  3M0P A;  2IIM A;  4QT7 A;  3JCM W;  1TUD A;  4C92 G;  1VQL A;  2RF0 A;  3MHX A;  3G71 T;  4J9D A;  2LTO A;  4OMF B;  5GMK h;  2LJ1 A;  4YTL A;  2M02 A;  3NGP A;  4ZGJ B;  3E1S A;  2CUB A;  3EG2 A;  2A7Y A;  1W1F A;  3LH5 A;  2CH4 W;  3MO8 A;  1WI7 A;  1Y7X A;  2GNC A;  4M7D G;  4J9C A;  4J9E A;  4RTZ A;  2K6D A;  3CCJ Q;  2EYQ A;  1IGQ A;  2VXE A;  3LWI A;  3JCM Q;  1QCN A;  4OB0 B;  3RKY A;  2LX9 A;  5KCH A;  4M7A E;  3QHS A;  1IB8 A;  2HL3 A;  4KGZ B;  1PWT A;  4FL6 A;  2ROT A;  1VQ9 Q;  1OUL A;  1W4S A;  2D9T A;  1K9M C;  1G3T A;  4C0Z A;  3CCU T;  3CC7 Q;  3CCM T;  3CCQ T;  3QWY A;  3VU3 C;  2FVU A;  4NS5 A;  4ZNX A;  3GNG A;  3OW2 P;  2EWN A;  2JMC A;  4LDX A;  2GFU A;  4IUT A;  4OVA A;  3DB3 A;  2AZV A;  2FZK B;  3DKM A;  3OYC A;  5LJ3 g;  2MYS A;  2RM4 A;  4RG8 A;  1TWB A;  5GMK i;  4C8Q C;  1QMC A;  4M75 B;  5HK0 A;  3CQT A;  4HCC A;  3G6E Q;  2HBW A;  2LT1 A;  5DLO A;  4PK4 A;  1E6H A;  3JB9 J;  2MF2 A;  2OTL A;  3OYM A;  2DL5 A;  3A8M B;  2DFU A;  3CME Q;  2RQW A;  3SFM A;  3TVT A;  5FRO A;  1P92 A;  2KVQ G;  5CVI A;  2P0Q A;  4GBQ A;  1NJI R;  3QUI A;  2JT4 A;  2DMO A;  2PUK B;  4PFZ A;  3OY9 A;  3I55 T;  5GAN h;  4FSS A;  4LUD A;  1OZ3 A;  4PLI A;  4CC7 A;  2QQA A;  2ZCF B;  5LL6 S;  3X24 B;  3EH1 A;  3LX7 A;  3FC3 A;  5GMK m;  3QYH B;  5A0L A;  2E1H A;  1EZZ B;  3M56 A;  3CPW P;  3RKX A;  2QI2 A;  3PNW C;  1JU5 C;  1C6V X;  3FB9 A;  5GAN g;  2GQV A;  1LJO A;  2YHT A;  1UG1 A;  2GF7 A;  4CC2 A;  2DD4 A;  4MZM A;  1BIB A;  5GJV B;  1YJN T;  4C0F A;  1MMD A;  2X4Y A;  4N4I A;  1SPK A;  5LJ3 e;  2KNB B;  1NBE B;  2PZ1 A;  2YXY A;  3CCS T;  4QKU A;  3SB2 A;  4PFO A;  1JB0 E;  5IH2 A;  1M3C A;  4QQD A;  3I56 T;  1WHL A;  4XTZ A;  3LWH A;  1MV0 B;  2ZPG B;  1RAB B;  2LMJ A;  2HNI A;  4XAX B;  4KUL A;  2BZ8 A;  4ZN1 A;  5EC7 A;  4BE1 A;  1YNZ A;  1VQO T;  3I55 Q;  1W70 A;  2CP2 A;  4BI8 B;  5GAN 6;  3VKI A;  3TSZ A;  1WA7 A;  3JCM g;  1AD5 A;  5CQY A;  1XNI A;  2YRV A;  3LGL A;  1SKU B;  2O2O A;  3KUF A;  2ZPF B;  3X26 B;  1SEM A;  4PJO C;  2AKL A;  3HKS A;  2PVD B;  3GF5 A;  5GMK l;  1GCQ A;  3NTI A;  4M75 E;  2K79 A;  2EQJ A;  4C92 A;  1M9S A;  4BE0 A;  2IG0 A;  3CEY A;  3JCM h;  1G3S A;  4LD6 A;  3RER A;  3EHR A;  4FSX A;  1PNJ A;  1WQ7 A;  4J9H A;  4PJN A;  2QQB A;  2RQU A;  1RAG B;  5GAO n;  4TVR A;  1PCX A;  4GY5 A;  1ZBX A;  4JJN K;  2A3L A;  3VS4 A;  2F5K A;  4C8Q G;  3CMA Q;  1QVG A;  4JZ4 A;  1B34 A;  4N4H A;  2I0N A;  1K76 A;  1X6G A;  5KE2 A;  5FWB A;  2E3I A;  3RKW A;  3CCU Q;  3QJ6 A;  3OYG A;  3EG3 A;  2KRO A;  2D8J A;  1GCP A;  1GFC A;  2LCS A;  3I9Q A;  2DBM A;  3OQ5 A;  2DET A;  2DLP A;  3PMT A;  4QQG A;  4A53 A;  1VOM A;  1NZ9 A;  1MMN A;  2P4T A;  1MGQ A;  2BE7 D;  5GAN 8;  2QXF A;  4RKU E;  5LJ5 j;  3OB9 A;  2R5M A;  3C0C A;  4A63 B;  1VQK A;  3CCV A;  4A4H A;  3G4S A;  2QTV A;  1YJ9 A;  1VQO A;  3MEV A;  3FJ5 A;  2JS2 A;  1UEC A;  1Y0M A;  5FLX E;  4KGX B;  2Z0W A;  4KGV B;  1RAA B;  2V1R A;  3QKJ A;  3G71 Q;  5M9O A;  4FU6 A;  4OGE A;  4MML A;  2F2W A;  1X43 A;  3CC4 T;  4AFQ C;  2DZ9 A;  1M3A A;  4DBH A;  5IT9 E;  1RAI B;  1M4Z A;  1KQS A;  1PD0 A;  2BZY A;  2MCN A;  1VQM T;  1K1Z A;  2L3R A;  1G83 A;  3M58 A;  1XOV A;  2DIQ A;  4PJM A;  1I0C A;  3CC2 T;  3V7C A;  1Q86 R;  1W6X A;  4IIO A;  3CPW S;  3QSU A;  1X69 A;  5C6S A;  2GTJ A;  1HK9 A;  4E7Z A;  1OYX A;  2LQW A;  3EG9 A;  2COY A;  2SRC A;  3SD4 A;  4C92 D;  4EMK B;  4HCK A;  2ZAE A;  1VA7 A;  3V8L A;  4JZ3 A;  2BTT A;  4M77 G;  3LYI A;  1PRL C;  5LJ3 h;  3DLL A;  3M0S A;  5J39 A;  1OPL A;  4KT0 E;  2QGG A;  2L2P A;  5HY6 A;  1X27 A;  3CCR T;  2EIF A;  1AEY A;  4FYV B;  2EBP A;  2QDY B;  3REB B;  4KUD K;  4MDW A;  4QVC A;  4LUE A;  3CCR Q;  3KXT A;  4XTV A;  5KYU B;  4M78 G;  2O9V A;  3S3N A;  2BZX A;  2RA2 A;  1RUW A;  1W2B P;  3VYG A;  1TXQ A;  2MAM A;  1JO8 A;  1M2O A;  1IO6 A;  2DVJ A;  1SRL A;  1YIJ A;  4FW2 A;  3S3M A;  2AZS A;  3G6E T;  1RAF B;  4N4G A;  1YWO A;  2E5Q A;  2V1Q A;  1YIT Q;  3SEM A;  3OSS C;  1SF9 A;  5L23 A;  2JM9 A;  1HYO A;  5LJ3 d;  1OOT A;  3G7Z A;  2ZZD A;  5A0G A;  2LVM A;  4F7U G;  9ATC B;  2H8H A;  1IXD A;  3G4S Q;  4KH0 B;  1UGQ B;  3C94 A;  1NM7 A;  4F16 A;  2ENM A;  3VS0 A;  4AFZ C;  1PD1 A;  2E5K A;  2L3Q A;  3C12 A;  2FZG B;  1I81 A;  3I35 A;  2K5F A;  1KIK A;  2P0P A;  2KGT A;  1VQ9 T;  3VRZ A;  4M75 A;  1WNL A;  3NTK A;  4XU2 A;  4M7D D;  2KI7 A;  3CCJ A;  2KEA A;  2RHY A;  3TRE A;  1XJW B;  4FYY B;  2ED1 A;  4A54 A;  4NOY A;  2J6O A;  4EDU A;  5HK3 A;  3JCM c;  2COZ A;  3JSC A;  5AYF A;  4PJO G;  4RTU A;  3L1A A;  5A0D A;  3CD6 Q;  2PTK A;  3HFN A;  4EMK A;  2OJ2 A;  1WJQ A;  2E3H A;  4BDY A;  3A8G B;  1S1N A;  1AVZ C;  2C0O A;  3M0R A;  3M53 A;  1F1B B;  1YIT T;  4OGC A;  2IPO B;  1V76 A;  2C0I A;  1AT1 B;  3BDL A;  4B6M A;  4AFS C;  1SRM A;  2RK2 A;  1BK2 A;  2NLU A;  2CT4 A;  2J6K A;  2LX7 A;  4Y92 A;  4FT4 A;  4AMC A;  2DO3 A;  1EX4 A;  1T3S A;  1R0B G;  1XQH A;  2J7I A;  3EGU A;  2XI9 A;  4E7S A;  3MKD A;  1UGP B;  3E19 A;  1KG1 A;  1WX6 A;  1RAD B;  1N9R A;  1U3O A;  2LC4 A;  3QII A;  4F7U E;  3PIP A;  1I5O B;  3C95 A;  1ZA1 B;  1K0X A;  3JCM b;  1M2V A;  3OYD A;  1ZUK A;  4JS4 A;  4A4F A;  2DER A;  2M9U A;  2LQ8 A;  4RMO A;  2LCC A;  3HP9 A;  4AG1 C;  2JNG A;  2EKO A;  3OYF A;  1K73 R;  3P8B B;  2RN8 A;  4OB3 B;  2RI2 A;  1VQ4 A;  1JXO A;  1H92 A;  4BE2 A;  2RHX A;  1BCO A;  2AKK A;  4MMK A;  3H0H A;  1B7T A;  2QQR A;  3EAE A;  4E2F B;  5DLQ E;  1Q81 U;  1BU1 A;  4IUR A;  3I56 Q;  4IIM A;  2EYZ A;  1I1J A;  2RHZ A;  4ANJ A;  3PE0 A;  3ZBD A;  2M0Y A;  1M1K U;  1KC8 R;  1KHI A;  1IHV A;  2PVG B;  1YJN Q;  1YI2 T;  3CCV Q;  1D0X A;  1Z9Z A;  1R77 A;  1GBR A;  4RTW A;  1N8R R;  2ROL A;  2WAC A;  3EGX B;  4ZGD B;  2XG8 D;  1K73 U;  3ME9 A;  4RTX A;  2HAX A;  4XU0 A;  2HQH A;  3ASK A;  2CSQ A;  4DOV A;  5KYX B;  3L2R A;  2EGC A;  3CD6 A;  4PKC C;  3PMI A;  2F5T X;  3CC4 Q;  2MK5 A;  3UPU A;  4EMG A;  2V8I A;  4HA8 A;  3RDV A;  4LDW A;  1UJY A;  2D0Q B;  1X6B A;  1LOJ A;  3H0F A;  4RTV A;  4J7I A;  3VS2 A;  4LDV A;  2DIL A;  4M7D F;  1I8F A;  2FL7 A;  2DL7 A;  3EHQ A;  2EAY A;  1M30 A;  2FPF A;  2A28 A;  1D3B B;  4J6Y A;  3JB9 I;  1Z9Q A;  1VQ7 Q;  1G3W A;  3L2U A;  1VQ8 Q;  2NUP B;  3H0I A;  2KSS A;  4C5G A;  2E12 A;  1QP3 A;  2CP7 A;  4XQ3 A;  2QGF B;  1SSF A;  3NMZ C;  4FT2 A;  2MIO A;  1GBQ A;  1VQ4 T;  3P8D A;  1ZSZ B;  5LJ3 j;  1WFW A;  4LXC A;  4PJO B;  1PHT A;  4JRK A;  1PSF A;  2HQX A;  2ECZ A;  3J80 E;  1NG2 A;  1G3Y A;  2RHU A;  5IHK A;  1VQ5 T;  1PG5 B;  1Q95 G;  5KCO A;  2FHD A;  3MET A;  1UDL A;  2X35 A;  4CI0 C;  2CGH A;  1N6A A;  4L5G A;  1VQ7 T;  5KYY B;  5KYX A;  3HPW A;  1Y96 B;  1W2B S;  3I5S A;  2JTF A;  1M90 C;  3JB9 F;  4XK8 E;  2FPE A;  3OS2 A;  3URG A;  1ZLM A;  1NE8 A;  3A8L B;  4EIK A;  3CPF A;  3EFS A;  1QCO A;  4PL6 A;  1NEB A;  3BFM A;  1LNX A;  2CZ6 B;  1NEG A;  1SHF A;  4C8Q E;  5DM7 R;  2AHJ B;  1TOV A;  3M54 A;  3M9Q A;  1A0N B;  2QTX A;  2NUP A;  2VGM A;  3CCJ T;  5GAM h;  3DLM A;  2C06 A;  2DL4 A;  1WHK A;  1AZG B;  2VYT A;  1Y57 A;  3JAM E;  1ARK A;  4FYW B;  2DL3 A;  2CSI A;  5J26 A;  1FMW A;  4M7A B;  1SSH A;  1UTI A;  1X75 C;  3A98 A;  2X4X A;  1FMV A;  5GAN j;  4X9D A;  2CRE A;  2ED0 A;  2L3P A;  1TH7 A;  1E6G A;  2GQI A;  5CAI A;  4ZN3 A;  4EMK C;  2YLB A;  3LGF A;  3CC2 Q;  3CCV T;  1UHF A;  2R58 A;  4C0G A;  1RI9 A;  3CBM A;  1H3H A;  2MMP A;  2V26 A;  2RQV A;  2PU9 B;  4E7L A;  2CDT A;  1YI2 A;  5GAO m;  1M90 U;  1BKB A;  3CBO A;  4M77 E;  3VS1 A;  2M51 A;  3CCL Q;  4J9B A;  1YJW A;  1M2V B;  4C92 B;  5LJ5 h;  3OYK A;  4DA4 A;  4M77 B;  4CC3 A;  5L8R E; 
#chains in the Genus database with same CATH homology
 2JS0 A;  1AWW A;  2DE0 X;  2LP5 A;  1QWE A;  5GJW B;  2X3X D;  2KT1 A;  2V1R A;  1QKX A;  2F2W A;  2GBQ A;  1X43 A;  2FRW A;  1ZUU A;  4AFQ C;  1M3A A;  2RQR A;  1NLP C;  2K9G A;  2BZY A;  2KR3 A;  2MCN A;  1K1Z A;  4JJD A;  1G83 A;  1ZBJ A;  1XOV A;  2L3S A;  1I0C A;  2VVK A;  2A36 A;  1HJD A;  1W6X A;  4IIO A;  4J9G A;  2HEQ A;  1X69 A;  3SHW A;  2GTJ A;  4M4Z A;  1KFZ A;  2LQW A;  2SRC A;  1MV3 A;  1B3Q A;  2FPD A;  2DF6 A;  4CC3 A;  2EYX A;  4HCK A;  2VWF A;  2JTE A;  1WXB A;  1VA7 A;  5FWC A;  3UAT A;  4JZ3 A;  2RPN A;  1QKW A;  2EGE A;  1M8M A;  2BTT A;  1WDX A;  3THK A;  1PRL C;  1T0J A;  3PVL A;  3KFV A;  3M0S A;  4OMO A;  1OPL A;  2ESW A;  2EGA A;  4AFU C;  5HCK A;  2L2P A;  1X27 A;  1RLP C;  2ABL A;  2O88 A;  3UF4 A;  2HCK A;  1AEY A;  2EBP A;  3REB B;  1LCK A;  2LQN A;  4OMQ A;  4F17 A;  1YN8 A;  1J3T A;  2DA9 A;  2JW4 A;  4KRT A;  4LUE A;  4LN2 A;  1VYV A;  4GLM A;  3M0Q A;  3RBB B;  2O9V A;  3JV3 A;  1K9A A;  2BZX A;  2LJ3 A;  1PRM C;  1RUW A;  2QDL A;  2K2M A;  2DBK A;  4OMM A;  2KRS A;  1JO8 A;  1IO6 A;  3REA B;  2SEM A;  3H41 A;  2DVJ A;  1SRL A;  1TUC A;  2J05 A;  2AZS A;  2EPD A;  1H8K A;  1JQQ A;  4JJB A;  2PNI A;  3VS7 A;  4D8D A;  1YWO A;  3ULR B;  2RMO A;  2V1Q A;  1YWP A;  3SEM A;  1MUZ A;  5L23 A;  4DEX A;  1JXM A;  2B86 A;  2JM9 A;  2K7A A;  2KRN A;  1OOT A;  2D1X A;  4JJC A;  5IXB A;  1U06 A;  2H8H A;  1PKS A;  1UHC A;  2KT8 A;  2VKN A;  3M0U A;  1ZSG A;  4K11 A;  4HVU A;  4J9F A;  1CKB A;  1NM7 A;  4F16 A;  2ENM A;  1KJW A;  2X3W D;  5ECA A;  4OMP A;  4CC4 B;  3VS0 A;  4AFZ C;  2CUD A;  4F14 A;  4LE9 A;  2C0T A;  2E5K A;  2L3Q A;  1HSQ A;  3R6N A;  3I35 A;  3M0T A;  1KIK A;  3PVQ A;  2DNU A;  2RNA A;  2KGT A;  2YUP A;  2OI3 A;  1B07 A;  3VRZ A;  2W0Z A;  1WLP B;  2KEA A;  2EYY A;  1AWO A;  1X2K A;  2ED1 A;  3EG1 A;  1FMK A;  1GFD A;  2J6O A;  2AK5 A;  2LJ0 A;  2CT3 A;  1VYU A;  2CH4 A;  4WCI A;  3I5R A;  2GGR A;  1AWJ A;  2EYW A;  4RTU A;  2DM1 A;  1SHG A;  4RUG A;  2PTK A;  2KXD A;  2OJ2 A;  3ZL7 C;  5IXF A;  1U5S A;  3M0P A;  5I22 A;  1GL5 A;  2IIM A;  4QT7 A;  2F2V A;  1TUD A;  1QCF A;  2RF0 A;  3NHN A;  4J9D A;  1S1N A;  1AVZ C;  2LJ1 A;  2C0O A;  1TG0 A;  3M0R A;  2MOX A;  3IQL A;  3NGP A;  2CUB A;  2EW3 A;  2C0I A;  3EG2 A;  1W1F A;  3LH5 A;  4AFS C;  2CH4 W;  1SRM A;  1WI7 A;  1K0S A;  1BK2 A;  2GNC A;  3QWX X;  2CT4 A;  4J9C A;  4J9E A;  4RTZ A;  3TSW A;  2J6K A;  2LX7 A;  2K6D A;  4Y92 A;  1AOJ A;  5FW9 A;  4HVW A;  2DRM A;  1AZE A;  3VRY A;  1T3S A;  2LNH B;  2J7I A;  3EGU A;  3O5Z A;  2JXB A;  1NLO C;  4RTY A;  2K3B A;  1V1C A;  2L0A A;  1WIE A;  1WX6 A;  1PWT A;  1UJ0 A;  1ZUY A;  2ROT A;  4ORZ A;  1U3O A;  1K0X A;  1PKT A;  1I07 A;  1ZUK A;  1T3L A;  1OEB A;  3QWY A;  4ZNX A;  4AG1 C;  1BBZ A;  2J6F A;  1N5Z A;  4X1V A;  2JMC A;  3GBQ A;  1NYF A;  1KSW A;  2RN8 A;  2AZV A;  1JXO A;  1H92 A;  1CKA A;  1WXT A;  3VS6 A;  2AKK A;  2KXC A;  3H0H A;  2NUZ A;  3NPF A;  1BU1 A;  1GRI A;  3CQT A;  2EQI A;  4OMN A;  2HBW A;  1K4U S;  2FO0 A;  1E6H A;  4IIM A;  2G6F X;  2EYZ A;  4AG2 C;  1I1J A;  2DL5 A;  3PE0 A;  2RQW A;  2M0Y A;  4Z8A A;  2GTO A;  3TVT A;  2DYB A;  1M3B A;  2HSP A;  1Z9Z A;  4GBQ A;  2JT4 A;  1GBR A;  5IHI A;  4RTW A;  2DMO A;  1HD3 A;  2YUO A;  2ROL A;  1UUE A;  3VS3 A;  2YDL A;  4FSS A;  2YUN A;  4LUD A;  4RTX A;  4CC7 A;  2CSQ A;  2KE9 A;  4LNP A;  2EGC A;  2A08 A;  1BB9 A;  1WXU A;  1UJY A;  3RNJ A;  1E7O A;  1X6B A;  4Z89 A;  3H0F A;  2RQT A;  4R0K A;  4RTV A;  1JU5 C;  3U23 A;  3VS2 A;  2DIL A;  2OAW A;  1UG1 A;  1UGV A;  4CC2 A;  2DL7 A;  3EHQ A;  4HVV A;  2DJQ A;  2XMF A;  1M30 A;  2LZ6 B;  2JM8 A;  2FPF A;  1UE9 A;  5GJV B;  2A28 A;  2DRK A;  2P4R A;  2W10 A;  1Z9Q A;  2YSQ A;  1SPK A;  2YUQ A;  5IHN A;  2KNB B;  2PZ1 A;  3H0I A;  2EVR A;  2O31 A;  5IH2 A;  1M3C A;  2FRY A;  1MV0 B;  3NMZ C;  2HDA A;  2LMJ A;  2MIO A;  2FG0 A;  2DL8 A;  1GBQ A;  1VYT A;  2BZ8 A;  5EC7 A;  3UA7 A;  1AWX A;  1OPK A;  1WFW A;  4JPB W;  4ESR A;  4Z88 A;  1PHT A;  1T0H A;  1YNZ A;  1QWF A;  2ECZ A;  1NG2 A;  1W70 A;  1NYG A;  1UFF A;  3UA6 A;  5IHK A;  4J9I A;  3TSZ A;  1WA7 A;  4RTT A;  4D8K A;  1AD5 A;  1ABQ A;  2J06 A;  2O2O A;  1UDL A;  2NWM A;  4OML A;  1SEM A;  1CSK A;  2AKL A;  2A37 A;  2KBT A;  4E6R A;  2YT6 A;  1GCQ A;  3I5S A;  4DEY A;  2K79 A;  3EG0 A;  2FPE A;  1ZLM A;  1ZX6 A;  1GCQ C;  3EHR A;  4EIK A;  1PNJ A;  1RLQ C;  1NEB A;  1NEG A;  1QLY A;  1SHF A;  4J9H A;  2RQU A;  1YP5 A;  4HXJ A;  2KYM A;  1A0N B;  2F2X A;  2FEI A;  3VS4 A;  1WYX A;  1OV3 A;  2DL4 A;  1AZG B;  4JZ4 A;  1Y57 A;  5I11 A;  2I0N A;  1ARK A;  1K76 A;  1X6G A;  2DL3 A;  2CSI A;  5FWB A;  2EKH A;  1SSH A;  1UTI A;  3A98 A;  2KRM A;  3EG3 A;  2KRO A;  2D8J A;  1GCP A;  1M27 C;  1GFC A;  2CRE A;  2LCS A;  1ABO A;  3I9Q A;  2D0N A;  2DBM A;  2ED0 A;  2DLP A;  2L3P A;  1X2Q A;  1E6G A;  2GQI A;  2KYB A;  1UHF A;  2JMA A;  1RI9 A;  3VS5 A;  1H3H A;  2DX1 A;  2RQV A;  1FYN A;  2CDT A;  3C0C A;  1G2B A;  3VS1 A;  4A63 B;  2M51 A;  4J9B A;  2D8H A;  1JEG A;  1EFN A;  3FJ5 A;  2JS2 A;  2O9S A;  1YCS B;  1UEC A;  1Y0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...