3M0SA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0sA00
4JZ3A 2W10A 4DEYA 1T3LA 5IHKA 2JS0A 3RNJA 1M3AA 2C0TA 2F2VA 2FG0A 2O88A 1Z9ZA 2L3QA 1U3OA 1QCFA 4LUEA 1Y0MA 3M0SA 1VYUA 1ARKA 3TSZA 1IO6A 1K1ZA 2LJ1A 2HSPA 2LCSA 3H41A 1K0XA 1TUDA 2ROTA 2CH4W 1M8MA 2BTTA 2GNCA 3EHRA 3UA7A 2BZ8A 2LJ3A 2ABLA 1BB9A 4QT7A 2SRCA 1JU5C 2MIOA 1UUEA 1NEBA 2LQWA 3PVLA 3I5SA 1WYXA 2B86A 2L3SA 1X6GA 2GTJA 1FYNA 1E6GA 2KT1A 2KGTA 4AFZC 3UF4A 2MCNA 2O2OA 1NYGA 4HXJA 1I07A 2K7AA 1CSKA 3QWYA 1BU1A 2KYBA 1SHFA 2GBQA 1BBZA 2RPNA 1H8KA 1N5ZA 2JM8A 2CT4A 1X6BA 3EHQA 1VYVA 2A28A 1X2KA 1KSWA 4HCKA 1M3BA 2DRMA 1SPKA 2JMCA 4HVUA 2DL7A 4Y92A 2OJ2A 1JO8A 1SRLA 2FRWA 4JPBW 4RUGA 2KBTA 2ED0A 1AWXA 4GBQA 1SHGA 1PNJA 3O5ZA 4CC7A 3JV3A 1GRIA 4OMPA 4LNPA 4RTYA 1OV3A 1AWWA 1UHFA 1RUWA 4CC4B 2LNHB 1NYFA 2KR3A 2J6FA 2J05A 2L2PA 2DL4A 2DVJA 5IXBA 1W70A 4J9GA 1RLPC 2YT6A 1X43A 4IIOA 1GCQA 3TVTA 4OMOA 1I0CA 1BK2A 2LP5A 1XOVA 4AFQC 2ENMA 2RMOA 4WCIA 3RBBB 3PVQA 1UTIA 1AZEA 2K79A 2RQRA 1NLOC 1K4US 5I22A 1UGVA 3GBQA 1HD3A 3QWXX 1H92A 1UG1A 2X3XD 3THKA 1PRLC 2JTEA 5GJWB 1WI7A 2C0OA 1ZX6A 2QDLA 3VRYA 3EG0A 4J9FA 2J06A 1ZBJA 3NHNA 4AFSC 2NWMA 2AZSA 1X69A 4OMMA 4RTXA 2D8HA 1M30A 2PNIA 3M0UA 2DA9A 4JJBA 2EGCA 2DX1A 1Z9QA 2JS2A 1PWTA 2IIMA 2ROLA 4JZ4A 2DL3A 2VKNA 2CSQA 2F2WA 2LMJA 2E5KA 1GFDA 4OMNA 3FJ5A 1AVZC 1UE9A 2FO0A 1ABQA 4A63B 1JXOA 2W0ZA 2CH4A 1UFFA 2HDAA 4CC2A 2KXDA 1YWPA 1RI9A 2D8JA 1UJ0A 3EGUA 5GJVB 3IQLA 2K6DA 1CKAA 3REBB 3H0IA 2YUPA 2KXCA 1QWEA 2HEQA 1SRMA 5I11A 1QKXA 4R0KA 3NGPA 1OPKA 4JJCA 2SEMA 1JQQA 2EKHA 2JMAA 4RTUA 2G6FX 1GCQC 4F16A 1AD5A 4KRTA 2EBPA 3C0CA 2C0IA 2A36A 1GBRA 2PTKA 1UJYA 2DNUA 2MOXA 1NM7A 2RQUA 2EYXA 3CQTA 2EYYA 4J9DA 3VS2A 2CT3A 2ESWA 4K11A 3M0QA 2VWFA 1ZUYA 2RQWA 1YWOA 5FWBA 3VS0A 3VS1A 3REAB 1KFZA 2RN8A 3TSWA 1VA7A 4JJDA 1MV3A 2FPEA 2YDLA 4FSSA 3VS6A 2V1QA 1U06A 3EG3A 2VVKA 2JW4A 2RNAA 1ZSGA 2BZYA 1H3HA 1A0NB 1OEBA 3VS7A 2LZ6B 3UATA 4ORZA 2H8HA 2CUBA 4AFUC 3VS3A 1T3SA 2J7IA 1YP5A 2DMOA 1WXUA 1E6HA 1NLPC 4D8DA 1WA7A 3H0FA 2I0NA 2DM1A 3NMZC 1PHTA 2EVRA 1W1FA 2DF6A 1AOJA 2EGAA 2V1RA 1GCPA 2DILA 1HJDA 4RTVA 4ESRA 2AK5A 4EIKA 2FPFA 1SSHA 2RQVA 3I5RA 5IXFA 1GL5A 2M51A 1SEMA 1UDLA 2KYMA 1MV0B 2DLPA 2EQIA 3M0RA 3SEMA 2X3WD 4M4ZA 1M3CA 3ZL7C 4E6RA 2OI3A 1GBQA 1AZGB 1KJWA 2BZXA 1Y57A 1KIKA 3NPFA 3EG1A 1AWJA 2A08A 1I1JA 2ED1A 2EW3A 2EYZA 3KFVA 4LE9A 1OOTA 2OAWA 4Z8AA 3VRZA 5FW9A 2FPDA 4RTTA 1E7OA 2YUOA 4HVWA 1V1CA 2YUNA 1T0HA 1ABOA 1UHCA 1K9AA 4CC3A 2DJQA 1NG2A 1WDXA 2JM9A 3A98A 2DBKA 5IHIA 3M0PA 2KNBB 2AKKA 3I9QA 1QLYA 2EGEA 1CKBA 3LH5A 2F2XA 5EC7A 4J9CA 3M0TA 1ZLMA 1U5SA 2RQTA 2O9SA 2DBMA 1PKTA 1JEGA 1PRMC 2O31A 2L3PA 1YNZA 1VYTA 3VS5A 3ULRB 2EPDA 1X27A 4LN2A 2FRYA 2K2MA 1S1NA 2P4RA 3VS4A 4D8KA 2ECZA 1ZUKA 1RLQC 1K0SA 2L0AA 2KE9A 1JXMA 1AWOA 3SHWA 2KROA 2AZVA 1ZUUA 1WXBA 1EFNA 4AG2C 5IHNA 1K76A 2KRMA 4ZNXA 2HBWA 3UA6A 4F14A 4RTWA 4J9EA 4HVVA 1UECA 4GLMA 2KEAA 3H0HA 1B07A 2J6KA 1GFCA 2K3BA 2GGRA 1W6XA 2CDTA 2KRNA 4J9BA 2HCKA 1WLPB 2CUDA 2O9VA 2A37A 1YCSB 2LX7A 5HCKA 2XMFA 1QKWA 4J9IA 4Z89A 2DYBA 3U23A 2D0NA 2KT8A 1YN8A 2GQIA 2NUZA 2LQNA 4F17A 3I35A 5L23A 1TG0A 2DE0X 1G2BA 1TUCA 3EG2A 1PKSA 4Z88A 4DEXA 1T0JA 2FEIA 2LJ0A 2YSQA 1AEYA 2M0YA 2D1XA 1LCKA 1MUZA 1NEGA 2JXBA 2JT4A 2YUQA 2AKLA 4RTZA 2DL8A 4X1VA 2KRSA 4OMQA 3R6NA 5FWCA 1M27C 1WIEA 2CREA 2PZ1A 4IIMA 2CSIA 2DL5A 5ECAA 2RF0A 4LUDA 2DRKA 2EYWA 1WX6A 1G83A 2K9GA 3PE0A 1HSQA 1QWFA 1X2QA 1FMKA 2GTOA 5IH2A 1J3TA 1WFWA 1B3QA 1OPLA 2J6OA 4OMLA 1WXTA 4J9HA 4AG1C
chains in the Genus database with same CATH superfamily
1WPYA 3JCMc 2W10A 1N8RC 1T3LA 4QVZA 2K57A 4L6V5 2ZGWA 1MHNA 3BDLA 2QA4Q 2F2VA 5LJ5d 2DK3A 1D1BA 1U3OA 1QCFA 3CC4Q 2PVGB 1HXDA 2RJCA 5C6SA 1UGQB 3QSUA 2LCSA 1SKUB 2BTTA 2GNCA 2FZCB 2HQHA 4XTWA 4Y91A 1JU5C 4M7DG 3UWNA 4PJLA 1PM3A 2GF7A 2YRCA 4EMKA 2EWNA 2GTJA 1E6GA 4IUPA 1WHGA 3OS2A 2KGTA 5CVIA 1VQ8Q 3GPLA 2JJ9A 4JJNK 1YJWA 3HHTB 3MEUA 4N0AC 3CCLT 1SHFA 3M4GA 1BBZA 5KE3A 3A8MB 1W2BP 1N9SA 2CT4A 5HKCA 4E7IA 1MNEA 1M2VB 3OB9A 4HCKA 5A0LA 5CIUA 3BY7A 3G4SQ 4XK8E 4F7UF 4NL3A 3JCMP 2DL7A 1VQNT 2NYSA 4Y92A 4J7FA 1SRLA 1VQPA 3BE3A 5KYWA 4GBQA 1RAGB 1PNJA 4OMPA 2CS7A 1YHQT 5FRNA 1OV3A 2K4YA 4M7AF 1RUWA 4KGZB 4C8QG 2DXCA 1NYFA 1XQHA 2J6FA 5KH6A 1IGUA 2L2PA 2DVJA 1W70A 3INZA 4J9GA 1RLPC 2YLBA 1FWZA 2DYIA 4OB2B 1IHVA 1BK2A 4LDVA 3L2RA 1YI2T 1G3WA 4KBMB 1Q86C 3GNFB 5LJ3f 2QGFB 2RQRA 1YITQ 5I22A 2RHYA 2O01E 5KYNA 2QQRA 1PRLC 1WI7A 2X35A 3CXCS 3VRYA 4J9FA 1ZBJA 3NHNA 3QYHB 3V8JA 1X69A 4OMMA 2GFAA 2ZPGB 4QQDA 1NPRA 3X24B 1VQKA 2C06A 1TS9A 2DL3A 3E9GA 4JS5A 2E5KA 2M02A 5GAN3 2FO0A 1OULA 5KYYB 2VB6A 3JCMb 3CCVA 1M1GA 3CC4T 2KXDA 1LOJA 1RI9A 2D8JA 4Y28E 2AIRB 3JCMf 3IQLA 3OYFA 2MAMA 2YUPA 1TSFA 3G6ET 3G6EQ 3CEYA 5I11A 4LXCA 5KYUA 2KY9A 1JQQA 3N5BB 4M75C 7AT1B 3OY9A 3CD6A 1GCQC 2EBPA 1S72Q 4OMFB 4C8QE 1VQNQ 4LDYA 5GAOp 1G3SA 3OW2A 3FC3A 2OTJT 3LWHA 4OF1A 4F7UB 1BI0A 4BDZA 4J9DA 4C8QF 2L3RA 2MPXC 4DBFA 2CT3A 2R5AA 5FRMA 2ESWA 4ELZC 3M0QA 2VWFA 4MMKA 5FWBA 1KG1A 4KT0E 4PJOC 1Y96B 2XK0A 1VQ9A 4JJDA 4AMCA 2X4WA 4C5IA 3ZFJA 2JW4A 1WHLA 2BZYA 1A0NB 3VV0A 3ER0A 2F5TX 2H3EB 1VUBA 5CKFA 3UT1A 4XAXB 1LVKA 2FZKB 1R0BG 3CMET 5KCOA 4XU2A 3CC2T 3I55Q 5I2SA 4M7DA 2DM1A 2K5FA 2PQWA 2DPPB 3CMAA 2DF6A 2BKDN 2V1RA 1GCPA 3CCRA 2ZPHB 1VQ4A 4ESRA 4JS4A 2FPFA 1SSHA 2RK2A 2RQVA 3I5RA 1ACMB 2K3YA 1MV0B 4ZGEB 2EQIA 3QPHA 4FCYA 3RMQA 4PKCC 4M78E 3CXCP 1YIJA 1I5OB 4O6JA 2PUKB 2QYZA 4E6RA 1GBQA 2HAXA 2BZXA 1Y57A 4NOYA 1KIKA 3JB9J 2E4HA 1YJ9A 3D7SB 1QQJA 2ED1A 3KFVA 4F04B 1SG5A 3FLGA 4UC4A 4MDXA 2RA2A 1NZ9A 4EMGA 5KYUB 5FLXE 1R77A 4NS5A 5D6XA 4RTTA 4HVWA 3OBYA 2Y4XA 4O5VA 2LTOA 4E2FB 4FYVB 3DLLA 3SFMA 1VQKQ 1W2BA 1QMCA 2JM9A 1N27A 2KQWA 1D3BA 5IHIA 3M0PA 2KNBB 3L2VA 4C8QC 2GFUA 4M7AC 1QLYA 4ZTFA 4OB3B 1QVPA 5EC7A 2RO0A 2EJ9A 1JJ2S 2DBMA 4C5GA 2O31A 2YWWA 1YNZA 1VYTA 1KC8R 2DIQA 5GAOn 2M9UA 1D0YA 3OYBA 3VS4A 4D8KA 1ZUKA 1K0SA 3G71A 3CCMA 3QO3A 4ZGJB 1QVFS 3CCST 1RAEB 1PD1A 3CCSQ 3GNGA 2KSSA 4M78B 4AG2C 2DIGA 4WTOB 2LRQA 2KRMA 3EH2A 4F14A 4OVAA 2JNGA 3CCRT 1YHQA 2NUPB 4JUVA 4QQ6A 1VQ4T 1WHHA 4HCBA 2HL5C 5HK3A 2J6KA 2GGRA 2CDTA 3OS1A 4IKFA 2HCKA 2YHTA 3A8LB 2O9VA 1OYXA 2A37A 3MEVA 4OGEA 4M75D 4J9IA 3U23A 2D0NA 4FW1A 5IN1A 2KT8A 1W2BS 2LQNA 3CCVT 3EAEA 3L1AA 1TUCA 3EG2A 3RR6A 3CCJT 1LCKA 4FIBA 1NPPA 2HL3A 4N4HA 1I81A 3KXTA 2YUQA 4RTZA 2DL8A 1KK7A 2CKKA 4TVRA 4OMQA 5FWCA 1M27C 4CRIA 2E12A 2DL5A 1PCXA 1WX6A 4C5EA 2X4YA 5CCAA 1VQOQ 2JTFA 1LNXA 4XTZA 5LJ3g 2QG9B 2NUPA 3VKIA 1HSQA 3OMCA 4C92A 2VGNA 3CBOA 2EKOA 1FMKA 2GTOA 4QW2A 4M75G 4WF2A 3FIFA 2J6OA 2MYSA 4OMLA 4AG1C 5GAMe 2JS0A 3RNJA 3CCJA 2VUBA 2K5LA 3G6EA 1R0CB 4BE0A 3JAME 3A5ZB 5FU6C 2PU9B 2RK1A 3CPWP 5KYXA 2P0QA 1M90U 3X20B 1Y0MA 3M0SA 3CD6Q 1JBMA 1IO6A 1K1ZA 3UPUA 3OSSC 3JB9I 1G5VA 4PJOG 1PSFA 2DO3A 3VJPA 4E7LA 3CC7Q 2DEUA 2CH4W 5C0MA 3A8GB 3S3MA 5A0GA 2OAUA 1ZA2B 2BZ8A 5J3BA 2ABLA 3WVDB 5GAN8 2ZPEB 2DD4A 4XU0A 3CCVQ 5GAN7 2FB7A 1VQKT 1WYXA 2K5IA 1FYNA 1D1AA 5GAOr 3JCMV 3OYMA 3EGDA 3RKXA 2MCNA 2K7AA 3QWYA 3OYGA 5GANh 2QTVA 5DM7R 1QVGS 1VIFA 2RPNA 1H8KA 1ZQ1A 3URGA 4M7AD 3GP8A 1X6BA 4RMOA 3NTKA 3G71Q 2XD0A 4J6WA 1SPKA 2Z0WA 2EAYA 4RG2A 5LJ3e 3QBYA 2OJ2A 1MMAA 1U8RA 1K8AU 3EGDB 1SHGA 2D6FA 4C0ZA 3O5ZA 4CC7A 3S3NA 1GRIA 4LNPA 2QI2A 3TU4K 2DETA 1AWWA 1UHFA 4CC4B 3JCMe 2M16A 2KR3A 2J05A 4MZTA 2LQKA 3JCMX 2FZGB 1TOVA 5LJ3h 3TVTA 4OMOA 2P0PA 4DOVA 2KK4A 4MZMA 4M77C 5CQXA 5LJ5e 3LX7A 4M7AG 1OQKA 3JCMQ 3CCUT 4WCIA 3PVQA 5D6YA 3GF5A 2K79A 1OI1A 3M9QA 2QGGA 3GBQA 1HD3A 3QWXX 4M77D 1UG1A 1H92A 3CC2Q 4A4EA 3LW5E 1OX9A 2JUFA 4FYXB 3THKA 3CCRQ 3RKWA 3EG0A 1HYOA 2OTLA 2DXUA 1IHWA 5GAOl 3FDRA 3OYLA 1VQOA 3L2WA 5LL6S 2D8HA 4M78D 1PSEA 3PTAA 3M0UA 2DX1A 2WSFE 1QVGA 1Z9QA 4OGCA 3J80E 4LDXA 2JS2A 2L89A 4JZ4A 3MP6A 1TU0B 3MKDA 5GANg 4M7AB 1K73U 5GMKj 1BI1A 3CCJQ 1M1KR 4E7JA 4PNOA 1KQ2A 2DTHA 4GY5A 3HKSA 2K2VA 5DLOA 2CH4A 2HDAA 3PMTA 1YWPA 3CBMA 1FMWA 4ME7A 1UJ0A 2RM4A 5GJVB 4XQ3A 2GQVA 2K6DA 1CKAA 3CC7T 3P8DA 1QKXA 3M54A 5EG2A 2JMAA 1Q7YU 3CCLA 4RTUA 2P84A 3PIPA 4EMKC 1AD5A 4M77A 4KRTA 3TEEA 3QG1A 2NUTB 2COZA 1G3YA 4DA4A 2OTLT 1KD1U 1NJIR 1UJYA 4MZPA 2EYXA 3CQTA 4PFZA 2HSEB 5CQYA 1EIFA 2R58A 5CKEA 4K11A 4PL6A 2RQWA 3VS1A 4LDWA 2RN8A 3RIRA 1VA7A 1MV3A 2FPEA 1Q82R 2CP7A 2MI6A 2ATCB 1QVGP 1VQ8T 2OTJA 4C8QB 2XHCA 3EFOA 1QVFA 4E7SA 3FRNA 3QJYA 2CP6A 3CCEQ 1RAIB 3CMAT 1WJRA 1Q7YR 1WXUA 1YITA 2O4XB 1QVFP 1WA7A 3H0FA 4P5NA 2I0NA 4JRQA 3NMZC 1PHTA 2EVRA 1W1FA 1RAHB 4A4GA 4C8QD 3PIOA 2MK5A 2DILA 5CR2A 2K3XA 3M5AA 3EFSA 1OZ2A 1GL5A 4XTVA 1SEMA 5A0DA 1NJIC 2DLPA 1P92A 1W4SA 1K8AC 2NLUA 1OX8A 3SEMA 1NBEB 3ZL7C 3CCMT 4DQ2A 3CC2A 5D6WA 5J39A 1KJWA 2CP5A 3GOXA 2COWA 2ZAEA 5HK0A 1N8RR 2A08A 2EYZA 1RADB 2HQXA 2PVOB 4LE9A 2XICA 2OAWA 4Z8AA 4IURA 2OTLQ 2DXBA 2FPDA 4GLKA 1Q95G 2WSEE 3A8HB 4FM4B 1V1CA 2QEXQ 1QP3A 1OU9A 2VGMA 4LDUA 3I55A 4C92F 1NG2A 1WDXA 2L5QA 4PJOD 2AKKA 4XU3A 2LCCA 4FYYB 4M78C 4J9CA 1ZLMA 1Q86R 5GMKm 3SWNB 2A0FB 3VS5A 1Y96A 2DZCA 3SWNA 2RI2A 2KMTA 1BCOA 1WGSA 3VU3C 1RLQC 4M7DF 2KE9A 1AWOA 4C92D 3SHWA 2HKNA 4PJOB 5GAMf 4HKEA 2QXFA 4IUQA 1K9MC 2AZVA 1SSFA 1G8XA 4BD3A 1AT1B 4PJOA 4DBHA 4J83A 2MMPA 4RKUE 4RTWA 3UA6A 4JRKA 1ZHIA 1B07A 9ATCB 4J9BA 3JB9H 4IUUA 4M77B 5FROA 4PFOA 3OBWA 2LX7A 3GLXA 2BUDA 2XDPA 1YN8A 2GQIA 2RH2A 2NUZA 4EPCA 4FW2A 4F17A 3OYHA 4QVCA 2VXEA 2COYA 2DE0X 3NFCA 4DEXA 2QDYB 1NE8A 2M0YA 4YTLA 1MMDA 1WJQA 5KYYA 1M5Q1 2KI7A 4M77F 2FHDA 2JTMA 4JRPA 3X26B 2LDMA 2JXBA 3J7AF 1S72A 3FEOA 1MMNA 4IUTA 2KRSA 2QTXA 4C0DB 2IVWA 1EX4A 1VQNA 5GANf 4BI8B 1M8VA 2CSIA 5ECAA 2RF0A 4LUDA 4BY6B 1RAFB 3SWNC 2AHJB 2OX7A 3PE0A 3RKYA 3ZBDA 2LQ8A 2DXTA 3HRUA 1J3TA 2YRVA 1OPLA 4A4FA 2CZ0B 4E7KA 4JZ3A 4DEYA 1YJ9Q 1K9MR 3X28B 1G3TA 5FU6B 5GANd 4D6WA 3JB9F 2CZ7B 3LH0A 2YLCA 2FG0A 3PFSA 2O88A 1Z9ZA 2PUOB 2QQBA 1VYUA 3OYJA 1ARKA 1TH7A 3TSZA 5GMKh 2HSPA 2VV5A 1JB0E 3H41A 3MEWA 2DTIA 1K0XA 1VQ4Q 2KVQG 3ME9A 2RD1A 1M8MA 3EFRA 2X4JA 3EHRA 4NL2A 4A54A 1BB9A 2SRCA 3R6OA 5DY9A 4OP0A 1U1TA 1UUEA 1S72T 1YI2A 3L2UA 2B86A 2CP2A 3JB9D 4AFZC 5CO7A 1Q7YC 1I07A 2FYKA 3RMSA 1CSKA 3LGLA 1KC8C 5DLQE 3OYKA 1N5ZA 2JM8A 2DZ9A 4DBRA 4PLIA 2QK0A 2A28A 4LD6A 1KSWA 5IAYA 5LJ5g 5LJ5f 4KGVB 1VQ9Q 5CK9A 2DRMA 4XTYA 2HNIA 4M78F 2DJZA 3I56Q 4JPBW 4RUGA 3G71T 1PG5B 3CC7A 2ED0A 1M4ZA 4F7UE 3JV3A 4RTYA 3JCMJ 2MWPA 4M78A 2IPOB 3E19A 4ZTJA 2RHIA 4M7AA 1R8OB 4II1A 1BIAA 1C6VX 2M1HA 4BUGA 1X43A 1N9RA 4IIOA 1KD1C 1I0CA 2LP5A 1XOVA 4FT4A 2PVDB 4X34A 2RMOA 3CCQA 3RBBB 1UTIA 4EMKB 1YIJQ 4C92G 4EDUA 2ZPFB 1NLOC 1UGVA 2X3XD 4VUBA 2YRDA 3UDCA 4ANJA 2RJFA 3L42A 2E6NA 4PFPA 2XU8A 4AFSC 1M1FA 1JJ2P 2AZSA 1YJWT 5CKBA 1RI0A 4RTXA 1QCOA 3LLRA 4J8OA 3QUIA 2VASA 1B34A 1M30A 2PNIA 2VXFA 3OS5A 3TCJA 4JJBA 1BYMA 3PMIA 5I21A 4ZN1A 5FU7C 2JVVA 1PWTA 2IIMA 2JOYA 2Y4YA 3QZ9B 2LT4A 1N6AA 3FJ5A 3HFNA 1AVZC 3M4YA 2DKGA 2BE7D 5KE2A 1VQ6Q 2MWOA 1IGQA 2RB6A 3G4ST 3CMEA 3META 3EGUA 4N4GA 3H0IA 1Y7XA 3J81E 1OZ3A 2KXCA 3C4SA 1YHQQ 1QWEA 2HEQA 5GAN2 1SRMA 3NGPA 1OPKA 2SEMA 4DOWA 2EKHA 2QQ9A 2CP3A 2G6FX 1X6OA 3C0CA 4PJOE 2C0IA 2CP0A 4FT2A 1XTDA 4M75A 4B6MA 2DNUA 3LYIA 3DKMA 1NM7A 1YJNQ 1XNIA 2EYYA 3T9NA 3VS2A 2X51A 1ZUYA 1KFZA 1I5LA 1FMVA 2YDLA 4FSSA 4RCCA 3V8KA 4R56A 3MCAB 1UEBA 2CZ1B 3MP8A 5GMKe 3H6ZA 1U06A 3RDVA 2VVKA 2RNAA 1ZSGA 1VOMA 3V7SA 1H3HA 3M58A 1OEBA 4QVDA 3VS7A 4J6YA 2LZ6B 1YJ9T 3UATA 4ORZA 2H8HA 2E3IA 4MMLA 1VQMA 1T3SA 2J7IA 2E41A 1YP5A 2DMOA 3CCLQ 3RESA 1M90R 3DB4A 1VQLQ 4C0GA 3CCET 4C8QA 2D9TA 1AOJA 1BKBA 5GAMd 1HJDA 2AK5A 4EIKA 5IXFA 2F1LA 5M9OA 1UDLA 3HL8A 4M75B 2DERA 1IREB 4Q5WA 2OI3A 1X75C 3EG1A 3KBGA 1TWBA 2QAZA 5LJ5j 4QKUA 1I1JA 4M7AE 2OTJQ 3DLMA 1OOTA 2EFIA 3VRZA 3GIBA 5FW9A 1KC8U 1E7OA 2QA4A 3Q1JA 1VQ7Q 2BIVA 4PLLA 3V8LA 1T0HA 1UHCA 3PGGA 1K9AA 3JB9G 1H3ZA 4CC3A 3A98A 2CGHA 4FSXA 2JZ2A 2DBKA 4KGXB 4M7DB 2G3RA 3QHSA 1VQ5T 2EGEA 3HSBA 2F2XA 3M0TA 1BCMA 1HK9A 2RQTA 2O9SA 4A4HA 3LGFA 1JEGA 1LJOA 5LJ3j 3ULRB 5AYFA 1X27A 4LN2A 1FX7A 1TXQA 2X4XA 1V29B 2FRYA 2K2MA 1S1NA 3X25B 2P4RA 2KDSA 3OS0A 4XU1A 2L0AA 1VQPT 1JXMA 2A7YA 1M1KC 4KULA 4MDWA 4JRIA 4JDSA 3O8VA 1UGPB 1ZUUA 1D0ZA 1YJWQ 1KHIA 1EFNA 4XTUA 1B34B 2CYZB 4XTXA 5IHNA 4B9WA 2XDDA 4J9EA 3L2ZA 1MNDA 4F7UA 2KEAA 3H0HA 1GFCA 2X9HA 1W6XA 4C0FA 1WLPB 1M2VA 1YIJT 4OB0B 3WVEB 2LNVA 2RI5A 5HCKA 5GMKl 3H8ZA 3SB2A 2P4TA 4RCBA 1VQ6T 1M2OA 1YJNA 2O4XA 5L8RE 1G2BA 2V8IA 3F70A 1PKSA 1PD0A 1T0JA 2FEIA 1AEYA 1MUZA 2ZCFB 5GANj 1NEGA 1WNLA 2AKLA 4X1VA 1H641 4RG8A 5I2MA 5D7UA 4M77E 5GAMj 4M75F 2CREA 2QQSA 3ASKA 4IIMA 2R5MA 1M1KU 3CCQQ 4E7ZA 3RERA 2MF2A 2V8KA 3MPUB 2K9GA 3ZEHA 1VQMQ 1X2QA 4C92C 3C95A 1C0MA 1WZOA 1B3QA 1RL2A 3JCMd 3CMEQ 1VQ8A 1O9SA 4PJMA 1WXTA 4J9HA 3NTHA 3EFOB 4ATOA 2M0OA 5IHKA 4KUDK 5A2QE 1YBYA 4PJOF 4BI3A 2EJGA 1M3AA 2C0TA 2P0KA 1VQ7T 2L3QA 3E2UA 2RHZA 4LUEA 2EJFA 4ELYC 1VQ5A 4HCCA 2LC4A 2LJ1A 3BFMA 4C0DC 4IUVA 3I55T 1BI2A 1O75A 1Y71A 1TUDA 2ROTA 3G1JA 3UA7A 1ZSZC 2LJ3A 4BB7A 4QT7A 1VQLT 2MIOA 1VQOT 1VQ6A 1NEBA 2LQWA 3PVLA 1FXXA 2E70A 2R57A 2RHUA 3I5SA 5GAOq 4HA8A 2L3SA 1X6GA 2LT1A 2V26A 1IXDA 2KT1A 1MMGA 1PC0A 1K73C 1QP2A 3SD4A 3UF4A 1D09B 1EZZB 6AT1B 2O2OA 1NYGA 4HXJA 1X01A 4J6XA 4AT1B 2DTOA 3JCMg 1K8AR 1D0XA 3LWIA 1BU1A 2FL7A 2KYBA 3OYIA 2GBQA 2XKOC 2E65A 4JLIA 5GAN5 3EHQA 1YCYA 1VYVA 3OW2P 3VYGA 3CXCA 1X2KA 3HRSA 2ZPBB 8AT1B 1M3BA 2IG0A 2JMCA 2AT1B 3OQ5A 4HVUA 2E3HA 1OU8A 1JO8A 4BE1A 2FRWA 2KBTA 1AWXA 2ZPIB 4N4IA 1WQ7A 2Y90A 3QZ5B 3CCEA 2YXYA 2RI3A 1XJWB 3QYGB 5CAIA 3SDZA 2E64A 3OA6A 4E47A 1JRIA 2B8AA 2LNHB 2EQMA 3VUZA 2E5QA 4F7UG 1ZBXA 8ATCB 4M78G 3V7CA 1I4K1 1Q82C 3QJ6A 2DL4A 5IXBA 3JRZA 2YT6A 1GCQA 3M55A 1V76A 1UGSB 2DD5A 4A4KA 4AFQC 2ENMA 3HRTA 1AZEA 2RHXA 3MEAA 2EQKA 4R55A 1VQLA 1K4US 1Q81U 4ZGDB 2FVUA 2L8DA 3CMAQ 2JTEA 5GJWB 4X9DA 3I56A 2C0OA 2DEQA 1ZX6A 2QDLA 1Q86U 2CZ6B 2J06A 1K73R 3C94A 5J26A 2NWMA 3OYCA 4B9XA 1KQSS 4OB1B 2QEXA 1KQ1A 2DA9A 2EGCA 5LJ5h 4C5HA 1WQWA 1B7TA 2HD0A 3CCSA 3CCUA 4CI0C 5AT1B 1WJSA 2ROLA 1YJNT 2LCLA 4FYWB 2VKNA 2CSQA 2F2WA 2LMJA 4M7DC 3OMGA 1D1CA 4PK4A 3JCMh 1GFDA 4OMNA 1UE9A 2I2LA 1ABQA 1IZ6A 4A63B 1JXOA 3CPFA 2W0ZA 1F1BB 4EMHA 2KAFA 1UFFA 3OYYA 1YI2Q 4CC2A 3AHUA 4M7DD 1Q81R 3I56T 2F5KA 5KYWB 1YFNA 2QQAA 1BI3A 3G7ZA 2EQJA 3DB3A 3REBB 1QCNA 2EYQA 4N0AA 1WHJA 4R0KA 3CPWS 4JJCA 4FL6A 1M90C 3CC4A 3CCMQ 4F16A 5GANe 3JCMW 3RUXA 1SF9A 3BW1A 2VYTA 2A36A 3V7RA 1GBRA 2PTKA 2MOXA 2WSCE 3JSCA 3P8BB 2RQUA 3EH1A 2DVEA 3FB9A 3M56A 3HTRA 1RAAB 1YWOA 2DFUA 3VS0A 2JN0A 3REAB 3CD6T 3TSWA 3EGXA 4E7HA 1KQSA 3VS6A 1Q81C 2A3LA 4L5GA 2V1QA 3EG3A 3OSVA 4PJNA 2E10A 2RJDA 4BY6C 1VQ7A 2HMAA 3QDFA 2CUBA 4AFUC 2E1HA 3VS3A 3C12A 4JLGA 1E6HA 1NLPC 1MGQA 4D8DA 3QDRB 1Q82U 2QASA 1VQMT 3EG9B 2HQEA 1QW1A 2EGAA 3E9FA 5FU7B 5GAN4 1Y07A 3MHXA 4RTVA 2QEXT 2M51A 1GXIE 1BIBA 4J7IA 4KH1B 2KYMA 3CCQT 3OYDA 4BDYA 2BE9B 3NTIA 4BACA 2QA4T 3M0RA 3AT1B 1ZSZA 4DBQA 2X3WD 4M4ZA 1M3CA 3QKJA 2NUTA 3WXMB 1AZGB 4QQGA 1KQSP 4ZN3A 3NPFA 1AWJA 4KUIA 4BE2A 2EW3A 2XIDA 3CPWA 5GAN6 2XG8D 3HP9A 1RABB 3H9NA 1YITT 2EQUA 4C92E 3HPWA 2YUOA 1TTHB 2YUNA 4J5YA 1ABOA 3M57A 5GAMh 1WHMA 5IT9E 3EG9A 2DJQA 3VUBA 5HY6A 4HT9A 3I9QA 4PJJA 1N8RU 3OYEA 1CKBA 3LH5A 1UGRB 2HZYA 4FU6A 2XDBA 1U5SA 1PKTA 2H3JA 1PRMC 1D3BB 2L3PA 4V2SA 2EPDA 3TREA 1U1SA 1M9SA 3HFOA 2V8JA 2RJEA 2ECZA 3PT9A 3G4SA 2KROA 3L2QA 5KYXB 1VQPQ 1WXBA 2HBPA 4M7DE 3BDUA 3MJXA 3M53A 1K76A 3S6WA 3MP1A 2LVMA 3MO8A 4ZNXA 2HBWA 4HVVA 1UECA 4GLMA 3KUFA 4KH0B 3OYAA 3QIIA 1VIEA 1IRXA 5GAOm 2E6ZA 1WHKA 4LD9K 2K3BA 4Z02A 2KRNA 3PNWC 2GCXA 4X9CA 1LPLA 2CUDA 4C92B 2F69A 3VYHB 1YCSB 2VC8A 2XMFA 1QKWA 4Z89A 1VQ9T 2DYBA 1C1AA 3FJPA 3QXEB 2EIFA 3I35A 5L23A 1TG0A 3OW2S 1I8FA 3S3OA 4Z88A 2LJ0A 2YSQA 1ZA1B 2D1XA 5CKHA 2HKQB 1VQ5Q 2WACA 2JT4A 2ZZDA 4BI4A 3A1PA 3E1SA 4HT8A 3P8HA 1KD1R 3CCUQ 4L59A 3R6NA 1AHJB 3OYNA 1WIEA 2PZ1A 1NJIU 1K9MU 5LJ3d 3A8OB 2DAQA 2DRKA 2EYWA 1ZSZB 1IB8A 3CBPA 2LX9A 4A53A 5CKDA 1KHCA 4M77G 4M75E 1DJ7B 1G83A 1TUGB 3TQ7P 1QWFA 5KCHA 5GAMg 1UB4A 5IH2A 1WFWA 1RACB 1JJ2A 3EGXB 4HCZA 2D0QB 2XI9A 3M59A 5GMKi
chains in the Genus database with same CATH topology
4JZ3A 2W10A 4DEYA 1T3LA 5IHKA 2JS0A 3RNJA 1M3AA 2C0TA 2F2VA 2FG0A 2O88A 1Z9ZA 2L3QA 1U3OA 1QCFA 4LUEA 1Y0MA 3M0SA 1VYUA 1ARKA 3TSZA 1IO6A 1K1ZA 2LJ1A 2HSPA 2LCSA 3H41A 1K0XA 1TUDA 2ROTA 2CH4W 1M8MA 2BTTA 2GNCA 3EHRA 3UA7A 2BZ8A 2LJ3A 2ABLA 1BB9A 4QT7A 2SRCA 1JU5C 2MIOA 1UUEA 1NEBA 2LQWA 3PVLA 3I5SA 1WYXA 2B86A 2L3SA 1X6GA 2GTJA 1FYNA 1E6GA 2KT1A 2KGTA 4AFZC 3UF4A 2MCNA 2O2OA 1NYGA 4HXJA 1I07A 2K7AA 1CSKA 3QWYA 1BU1A 2KYBA 1SHFA 2GBQA 1BBZA 2RPNA 1H8KA 1N5ZA 2JM8A 2CT4A 1X6BA 3EHQA 1VYVA 2A28A 1X2KA 1KSWA 4HCKA 1M3BA 2DRMA 1SPKA 2JMCA 4HVUA 2DL7A 4Y92A 2OJ2A 1JO8A 1SRLA 2FRWA 4JPBW 4RUGA 2KBTA 2ED0A 1AWXA 4GBQA 1SHGA 1PNJA 3O5ZA 4CC7A 3JV3A 1GRIA 4OMPA 4LNPA 4RTYA 1OV3A 1AWWA 1UHFA 1RUWA 4CC4B 2LNHB 1NYFA 2KR3A 2J6FA 2J05A 2L2PA 2DL4A 2DVJA 5IXBA 1W70A 4J9GA 1RLPC 2YT6A 1X43A 4IIOA 1GCQA 3TVTA 4OMOA 1I0CA 1BK2A 2LP5A 1XOVA 4AFQC 2ENMA 2RMOA 4WCIA 3RBBB 3PVQA 1UTIA 1AZEA 2K79A 2RQRA 1NLOC 1K4US 5I22A 1UGVA 3GBQA 1HD3A 3QWXX 1H92A 1UG1A 2X3XD 3THKA 1PRLC 2JTEA 5GJWB 1WI7A 2C0OA 1ZX6A 2QDLA 3VRYA 3EG0A 4J9FA 2J06A 1ZBJA 3NHNA 4AFSC 2NWMA 2AZSA 1X69A 4OMMA 4RTXA 2D8HA 1M30A 2PNIA 3M0UA 2DA9A 4JJBA 2EGCA 2DX1A 1Z9QA 2JS2A 1PWTA 2IIMA 2ROLA 4JZ4A 2DL3A 2VKNA 2CSQA 2F2WA 2LMJA 2E5KA 1GFDA 4OMNA 3FJ5A 1AVZC 1UE9A 2FO0A 1ABQA 4A63B 1JXOA 2W0ZA 2CH4A 1UFFA 2HDAA 4CC2A 2KXDA 1YWPA 1RI9A 2D8JA 1UJ0A 3EGUA 5GJVB 3IQLA 2K6DA 1CKAA 3REBB 3H0IA 2YUPA 2KXCA 1QWEA 2HEQA 1SRMA 5I11A 1QKXA 4R0KA 3NGPA 1OPKA 4JJCA 2SEMA 1JQQA 2EKHA 2JMAA 4RTUA 2G6FX 1GCQC 4F16A 1AD5A 4KRTA 2EBPA 3C0CA 2C0IA 2A36A 1GBRA 2PTKA 1UJYA 2DNUA 2MOXA 1NM7A 2RQUA 2EYXA 3CQTA 2EYYA 4J9DA 3VS2A 2CT3A 2ESWA 4K11A 3M0QA 2VWFA 1ZUYA 2RQWA 1YWOA 5FWBA 3VS0A 3VS1A 3REAB 1KFZA 2RN8A 3TSWA 1VA7A 4JJDA 1MV3A 2FPEA 2YDLA 4FSSA 3VS6A 2V1QA 1U06A 3EG3A 2VVKA 2JW4A 2RNAA 1ZSGA 2BZYA 1H3HA 1A0NB 1OEBA 3VS7A 2LZ6B 3UATA 4ORZA 2H8HA 2CUBA 4AFUC 3VS3A 1T3SA 2J7IA 1YP5A 2DMOA 1WXUA 1E6HA 1NLPC 4D8DA 1WA7A 3H0FA 2I0NA 2DM1A 3NMZC 1PHTA 2EVRA 1W1FA 2DF6A 1AOJA 2EGAA 2V1RA 1GCPA 2DILA 1HJDA 4RTVA 4ESRA 2AK5A 4EIKA 2FPFA 1SSHA 2RQVA 3I5RA 5IXFA 1GL5A 2M51A 1SEMA 1UDLA 2KYMA 1MV0B 2DLPA 2EQIA 3M0RA 3SEMA 2X3WD 4M4ZA 1M3CA 3ZL7C 4E6RA 2OI3A 1GBQA 1AZGB 1KJWA 2BZXA 1Y57A 1KIKA 3NPFA 3EG1A 1AWJA 2A08A 1I1JA 2ED1A 2EW3A 2EYZA 3KFVA 4LE9A 1OOTA 2OAWA 4Z8AA 3VRZA 5FW9A 2FPDA 4RTTA 1E7OA 2YUOA 4HVWA 1V1CA 2YUNA 1T0HA 1ABOA 1UHCA 1K9AA 4CC3A 2DJQA 1NG2A 1WDXA 2JM9A 3A98A 2DBKA 5IHIA 3M0PA 2KNBB 2AKKA 3I9QA 1QLYA 2EGEA 1CKBA 3LH5A 2F2XA 5EC7A 4J9CA 3M0TA 1ZLMA 1U5SA 2RQTA 2O9SA 2DBMA 1PKTA 1JEGA 1PRMC 2O31A 2L3PA 1YNZA 1VYTA 3VS5A 3ULRB 2EPDA 1X27A 4LN2A 2FRYA 2K2MA 1S1NA 2P4RA 3VS4A 4D8KA 2ECZA 1ZUKA 1RLQC 1K0SA 2L0AA 2KE9A 1JXMA 1AWOA 3SHWA 2KROA 2AZVA 1ZUUA 1WXBA 1EFNA 4AG2C 5IHNA 1K76A 2KRMA 4ZNXA 2HBWA 3UA6A 4F14A 4RTWA 4J9EA 4HVVA 1UECA 4GLMA 2KEAA 3H0HA 1B07A 2J6KA 1GFCA 2K3BA 2GGRA 1W6XA 2CDTA 2KRNA 4J9BA 2HCKA 1WLPB 2CUDA 2O9VA 2A37A 1YCSB 2LX7A 5HCKA 2XMFA 1QKWA 4J9IA 4Z89A 2DYBA 3U23A 2D0NA 2KT8A 1YN8A 2GQIA 2NUZA 2LQNA 4F17A 3I35A 5L23A 1TG0A 2DE0X 1G2BA 1TUCA 3EG2A 1PKSA 4Z88A 4DEXA 1T0JA 2FEIA 2LJ0A 2YSQA 1AEYA 2M0YA 2D1XA 1LCKA 1MUZA 1NEGA 2JXBA 2JT4A 2YUQA 2AKLA 4RTZA 2DL8A 4X1VA 2KRSA 4OMQA 3R6NA 5FWCA 1M27C 1WIEA 2CREA 2PZ1A 4IIMA 2CSIA 2DL5A 5ECAA 2RF0A 4LUDA 2DRKA 2EYWA 1WX6A 1G83A 2K9GA 3PE0A 1HSQA 1QWFA 1X2QA 1FMKA 2GTOA 5IH2A 1J3TA 1WFWA 1B3QA 1OPLA 2J6OA 4OMLA 1WXTA 4J9HA 4AG1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ3 A;  2W10 A;  4DEY A;  1T3L A;  5IHK A;  2JS0 A;  3RNJ A;  1M3A A;  2C0T A;  2F2V A;  2FG0 A;  2O88 A;  1Z9Z A;  2L3Q A;  1U3O A;  1QCF A;  4LUE A;  1Y0M A;  3M0S A;  1VYU A;  1ARK A;  3TSZ A;  1IO6 A;  1K1Z A;  2LJ1 A;  2HSP A;  2LCS A;  3H41 A;  1K0X A;  1TUD A;  2ROT A;  2CH4 W;  1M8M A;  2BTT A;  2GNC A;  3EHR A;  3UA7 A;  2BZ8 A;  2LJ3 A;  2ABL A;  1BB9 A;  4QT7 A;  2SRC A;  1JU5 C;  2MIO A;  1UUE A;  1NEB A;  2LQW A;  3PVL A;  3I5S A;  1WYX A;  2B86 A;  2L3S A;  1X6G A;  2GTJ A;  1FYN A;  1E6G A;  2KT1 A;  2KGT A;  4AFZ C;  3UF4 A;  2MCN A;  2O2O A;  1NYG A;  4HXJ A;  1I07 A;  2K7A A;  1CSK A;  3QWY A;  1BU1 A;  2KYB A;  1SHF A;  2GBQ A;  1BBZ A;  2RPN A;  1H8K A;  1N5Z A;  2JM8 A;  2CT4 A;  1X6B A;  3EHQ A;  1VYV A;  2A28 A;  1X2K A;  1KSW A;  4HCK A;  1M3B A;  2DRM A;  1SPK A;  2JMC A;  4HVU A;  2DL7 A;  4Y92 A;  2OJ2 A;  1JO8 A;  1SRL A;  2FRW A;  4JPB W;  4RUG A;  2KBT A;  2ED0 A;  1AWX A;  4GBQ A;  1SHG A;  1PNJ A;  3O5Z A;  4CC7 A;  3JV3 A;  1GRI A;  4OMP A;  4LNP A;  4RTY A;  1OV3 A;  1AWW A;  1UHF A;  1RUW A;  4CC4 B;  2LNH B;  1NYF A;  2KR3 A;  2J6F A;  2J05 A;  2L2P A;  2DL4 A;  2DVJ A;  5IXB A;  1W70 A;  4J9G A;  1RLP C;  2YT6 A;  1X43 A;  4IIO A;  1GCQ A;  3TVT A;  4OMO A;  1I0C A;  1BK2 A;  2LP5 A;  1XOV A;  4AFQ C;  2ENM A;  2RMO A;  4WCI A;  3RBB B;  3PVQ A;  1UTI A;  1AZE A;  2K79 A;  2RQR A;  1NLO C;  1K4U S;  5I22 A;  1UGV A;  3GBQ A;  1HD3 A;  3QWX X;  1H92 A;  1UG1 A;  2X3X D;  3THK A;  1PRL C;  2JTE A;  5GJW B;  1WI7 A;  2C0O A;  1ZX6 A;  2QDL A;  3VRY A;  3EG0 A;  4J9F A;  2J06 A;  1ZBJ A;  3NHN A;  4AFS C;  2NWM A;  2AZS A;  1X69 A;  4OMM A;  4RTX A;  2D8H A;  1M30 A;  2PNI A;  3M0U A;  2DA9 A;  4JJB A;  2EGC A;  2DX1 A;  1Z9Q A;  2JS2 A;  1PWT A;  2IIM A;  2ROL A;  4JZ4 A;  2DL3 A;  2VKN A;  2CSQ A;  2F2W A;  2LMJ A;  2E5K A;  1GFD A;  4OMN A;  3FJ5 A;  1AVZ C;  1UE9 A;  2FO0 A;  1ABQ A;  4A63 B;  1JXO A;  2W0Z A;  2CH4 A;  1UFF A;  2HDA A;  4CC2 A;  2KXD A;  1YWP A;  1RI9 A;  2D8J A;  1UJ0 A;  3EGU A;  5GJV B;  3IQL A;  2K6D A;  1CKA A;  3REB B;  3H0I A;  2YUP A;  2KXC A;  1QWE A;  2HEQ A;  1SRM A;  5I11 A;  1QKX A;  4R0K A;  3NGP A;  1OPK A;  4JJC A;  2SEM A;  1JQQ A;  2EKH A;  2JMA A;  4RTU A;  2G6F X;  1GCQ C;  4F16 A;  1AD5 A;  4KRT A;  2EBP A;  3C0C A;  2C0I A;  2A36 A;  1GBR A;  2PTK A;  1UJY A;  2DNU A;  2MOX A;  1NM7 A;  2RQU A;  2EYX A;  3CQT A;  2EYY A;  4J9D A;  3VS2 A;  2CT3 A;  2ESW A;  4K11 A;  3M0Q A;  2VWF A;  1ZUY A;  2RQW A;  1YWO A;  5FWB A;  3VS0 A;  3VS1 A;  3REA B;  1KFZ A;  2RN8 A;  3TSW A;  1VA7 A;  4JJD A;  1MV3 A;  2FPE A;  2YDL A;  4FSS A;  3VS6 A;  2V1Q A;  1U06 A;  3EG3 A;  2VVK A;  2JW4 A;  2RNA A;  1ZSG A;  2BZY A;  1H3H A;  1A0N B;  1OEB A;  3VS7 A;  2LZ6 B;  3UAT A;  4ORZ A;  2H8H A;  2CUB A;  4AFU C;  3VS3 A;  1T3S A;  2J7I A;  1YP5 A;  2DMO A;  1WXU A;  1E6H A;  1NLP C;  4D8D A;  1WA7 A;  3H0F A;  2I0N A;  2DM1 A;  3NMZ C;  1PHT A;  2EVR A;  1W1F A;  2DF6 A;  1AOJ A;  2EGA A;  2V1R A;  1GCP A;  2DIL A;  1HJD A;  4RTV A;  4ESR A;  2AK5 A;  4EIK A;  2FPF A;  1SSH A;  2RQV A;  3I5R A;  5IXF A;  1GL5 A;  2M51 A;  1SEM A;  1UDL A;  2KYM A;  1MV0 B;  2DLP A;  2EQI A;  3M0R A;  3SEM A;  2X3W D;  4M4Z A;  1M3C A;  3ZL7 C;  4E6R A;  2OI3 A;  1GBQ A;  1AZG B;  1KJW A;  2BZX A;  1Y57 A;  1KIK A;  3NPF A;  3EG1 A;  1AWJ A;  2A08 A;  1I1J A;  2ED1 A;  2EW3 A;  2EYZ A;  3KFV A;  4LE9 A;  1OOT A;  2OAW A;  4Z8A A;  3VRZ A;  5FW9 A;  2FPD A;  4RTT A;  1E7O A;  2YUO A;  4HVW A;  1V1C A;  2YUN A;  1T0H A;  1ABO A;  1UHC A;  1K9A A;  4CC3 A;  2DJQ A;  1NG2 A;  1WDX A;  2JM9 A;  3A98 A;  2DBK A;  5IHI A;  3M0P A;  2KNB B;  2AKK A;  3I9Q A;  1QLY A;  2EGE A;  1CKB A;  3LH5 A;  2F2X A;  5EC7 A;  4J9C A;  3M0T A;  1ZLM A;  1U5S A;  2RQT A;  2O9S A;  2DBM A;  1PKT A;  1JEG A;  1PRM C;  2O31 A;  2L3P A;  1YNZ A;  1VYT A;  3VS5 A;  3ULR B;  2EPD A;  1X27 A;  4LN2 A;  2FRY A;  2K2M A;  1S1N A;  2P4R A;  3VS4 A;  4D8K A;  2ECZ A;  1ZUK A;  1RLQ C;  1K0S A;  2L0A A;  2KE9 A;  1JXM A;  1AWO A;  3SHW A;  2KRO A;  2AZV A;  1ZUU A;  1WXB A;  1EFN A;  4AG2 C;  5IHN A;  1K76 A;  2KRM A;  4ZNX A;  2HBW A;  3UA6 A;  4F14 A;  4RTW A;  4J9E A;  4HVV A;  1UEC A;  4GLM A;  2KEA A;  3H0H A;  1B07 A;  2J6K A;  1GFC A;  2K3B A;  2GGR A;  1W6X A;  2CDT A;  2KRN A;  4J9B A;  2HCK A;  1WLP B;  2CUD A;  2O9V A;  2A37 A;  1YCS B;  2LX7 A;  5HCK A;  2XMF A;  1QKW A;  4J9I A;  4Z89 A;  2DYB A;  3U23 A;  2D0N A;  2KT8 A;  1YN8 A;  2GQI A;  2NUZ A;  2LQN A;  4F17 A;  3I35 A;  5L23 A;  1TG0 A;  2DE0 X;  1G2B A;  1TUC A;  3EG2 A;  1PKS A;  4Z88 A;  4DEX A;  1T0J A;  2FEI A;  2LJ0 A;  2YSQ A;  1AEY A;  2M0Y A;  2D1X A;  1LCK A;  1MUZ A;  1NEG A;  2JXB A;  2JT4 A;  2YUQ A;  2AKL A;  4RTZ A;  2DL8 A;  4X1V A;  2KRS A;  4OMQ A;  3R6N A;  5FWC A;  1M27 C;  1WIE A;  2CRE A;  2PZ1 A;  4IIM A;  2CSI A;  2DL5 A;  5ECA A;  2RF0 A;  4LUD A;  2DRK A;  2EYW A;  1WX6 A;  1G83 A;  2K9G A;  3PE0 A;  1HSQ A;  1QWF A;  1X2Q A;  1FMK A;  2GTO A;  5IH2 A;  1J3T A;  1WFW A;  1B3Q A;  1OPL A;  2J6O A;  4OML A;  1WXT A;  4J9H A;  4AG1 C; 
#chains in the Genus database with same CATH topology
 1WPY A;  3JCM c;  2W10 A;  1N8R C;  1T3L A;  4QVZ A;  2K57 A;  4L6V 5;  2ZGW A;  1MHN A;  3BDL A;  2QA4 Q;  2F2V A;  5LJ5 d;  2DK3 A;  1D1B A;  1U3O A;  1QCF A;  3CC4 Q;  2PVG B;  1HXD A;  2RJC A;  5C6S A;  1UGQ B;  3QSU A;  2LCS A;  1SKU B;  2BTT A;  2GNC A;  2FZC B;  2HQH A;  4XTW A;  4Y91 A;  1JU5 C;  4M7D G;  3UWN A;  4PJL A;  1PM3 A;  2GF7 A;  2YRC A;  4EMK A;  2EWN A;  2GTJ A;  1E6G A;  4IUP A;  1WHG A;  3OS2 A;  2KGT A;  5CVI A;  1VQ8 Q;  3GPL A;  2JJ9 A;  4JJN K;  1YJW A;  3HHT B;  3MEU A;  4N0A C;  3CCL T;  1SHF A;  3M4G A;  1BBZ A;  5KE3 A;  3A8M B;  1W2B P;  1N9S A;  2CT4 A;  5HKC A;  4E7I A;  1MNE A;  1M2V B;  3OB9 A;  4HCK A;  5A0L A;  5CIU A;  3BY7 A;  3G4S Q;  4XK8 E;  4F7U F;  4NL3 A;  3JCM P;  2DL7 A;  1VQN T;  2NYS A;  4Y92 A;  4J7F A;  1SRL A;  1VQP A;  3BE3 A;  5KYW A;  4GBQ A;  1RAG B;  1PNJ A;  4OMP A;  2CS7 A;  1YHQ T;  5FRN A;  1OV3 A;  2K4Y A;  4M7A F;  1RUW A;  4KGZ B;  4C8Q G;  2DXC A;  1NYF A;  1XQH A;  2J6F A;  5KH6 A;  1IGU A;  2L2P A;  2DVJ A;  1W70 A;  3INZ A;  4J9G A;  1RLP C;  2YLB A;  1FWZ A;  2DYI A;  4OB2 B;  1IHV A;  1BK2 A;  4LDV A;  3L2R A;  1YI2 T;  1G3W A;  4KBM B;  1Q86 C;  3GNF B;  5LJ3 f;  2QGF B;  2RQR A;  1YIT Q;  5I22 A;  2RHY A;  2O01 E;  5KYN A;  2QQR A;  1PRL C;  1WI7 A;  2X35 A;  3CXC S;  3VRY A;  4J9F A;  1ZBJ A;  3NHN A;  3QYH B;  3V8J A;  1X69 A;  4OMM A;  2GFA A;  2ZPG B;  4QQD A;  1NPR A;  3X24 B;  1VQK A;  2C06 A;  1TS9 A;  2DL3 A;  3E9G A;  4JS5 A;  2E5K A;  2M02 A;  5GAN 3;  2FO0 A;  1OUL A;  5KYY B;  2VB6 A;  3JCM b;  3CCV A;  1M1G A;  3CC4 T;  2KXD A;  1LOJ A;  1RI9 A;  2D8J A;  4Y28 E;  2AIR B;  3JCM f;  3IQL A;  3OYF A;  2MAM A;  2YUP A;  1TSF A;  3G6E T;  3G6E Q;  3CEY A;  5I11 A;  4LXC A;  5KYU A;  2KY9 A;  1JQQ A;  3N5B B;  4M75 C;  7AT1 B;  3OY9 A;  3CD6 A;  1GCQ C;  2EBP A;  1S72 Q;  4OMF B;  4C8Q E;  1VQN Q;  4LDY A;  5GAO p;  1G3S A;  3OW2 A;  3FC3 A;  2OTJ T;  3LWH A;  4OF1 A;  4F7U B;  1BI0 A;  4BDZ A;  4J9D A;  4C8Q F;  2L3R A;  2MPX C;  4DBF A;  2CT3 A;  2R5A A;  5FRM A;  2ESW A;  4ELZ C;  3M0Q A;  2VWF A;  4MMK A;  5FWB A;  1KG1 A;  4KT0 E;  4PJO C;  1Y96 B;  2XK0 A;  1VQ9 A;  4JJD A;  4AMC A;  2X4W A;  4C5I A;  3ZFJ A;  2JW4 A;  1WHL A;  2BZY A;  1A0N B;  3VV0 A;  3ER0 A;  2F5T X;  2H3E B;  1VUB A;  5CKF A;  3UT1 A;  4XAX B;  1LVK A;  2FZK B;  1R0B G;  3CME T;  5KCO A;  4XU2 A;  3CC2 T;  3I55 Q;  5I2S A;  4M7D A;  2DM1 A;  2K5F A;  2PQW A;  2DPP B;  3CMA A;  2DF6 A;  2BKD N;  2V1R A;  1GCP A;  3CCR A;  2ZPH B;  1VQ4 A;  4ESR A;  4JS4 A;  2FPF A;  1SSH A;  2RK2 A;  2RQV A;  3I5R A;  1ACM B;  2K3Y A;  1MV0 B;  4ZGE B;  2EQI A;  3QPH A;  4FCY A;  3RMQ A;  4PKC C;  4M78 E;  3CXC P;  1YIJ A;  1I5O B;  4O6J A;  2PUK B;  2QYZ A;  4E6R A;  1GBQ A;  2HAX A;  2BZX A;  1Y57 A;  4NOY A;  1KIK A;  3JB9 J;  2E4H A;  1YJ9 A;  3D7S B;  1QQJ A;  2ED1 A;  3KFV A;  4F04 B;  1SG5 A;  3FLG A;  4UC4 A;  4MDX A;  2RA2 A;  1NZ9 A;  4EMG A;  5KYU B;  5FLX E;  1R77 A;  4NS5 A;  5D6X A;  4RTT A;  4HVW A;  3OBY A;  2Y4X A;  4O5V A;  2LTO A;  4E2F B;  4FYV B;  3DLL A;  3SFM A;  1VQK Q;  1W2B A;  1QMC A;  2JM9 A;  1N27 A;  2KQW A;  1D3B A;  5IHI A;  3M0P A;  2KNB B;  3L2V A;  4C8Q C;  2GFU A;  4M7A C;  1QLY A;  4ZTF A;  4OB3 B;  1QVP A;  5EC7 A;  2RO0 A;  2EJ9 A;  1JJ2 S;  2DBM A;  4C5G A;  2O31 A;  2YWW A;  1YNZ A;  1VYT A;  1KC8 R;  2DIQ A;  5GAO n;  2M9U A;  1D0Y A;  3OYB A;  3VS4 A;  4D8K A;  1ZUK A;  1K0S A;  3G71 A;  3CCM A;  3QO3 A;  4ZGJ B;  1QVF S;  3CCS T;  1RAE B;  1PD1 A;  3CCS Q;  3GNG A;  2KSS A;  4M78 B;  4AG2 C;  2DIG A;  4WTO B;  2LRQ A;  2KRM A;  3EH2 A;  4F14 A;  4OVA A;  2JNG A;  3CCR T;  1YHQ A;  2NUP B;  4JUV A;  4QQ6 A;  1VQ4 T;  1WHH A;  4HCB A;  2HL5 C;  5HK3 A;  2J6K A;  2GGR A;  2CDT A;  3OS1 A;  4IKF A;  2HCK A;  2YHT A;  3A8L B;  2O9V A;  1OYX A;  2A37 A;  3MEV A;  4OGE A;  4M75 D;  4J9I A;  3U23 A;  2D0N A;  4FW1 A;  5IN1 A;  2KT8 A;  1W2B S;  2LQN A;  3CCV T;  3EAE A;  3L1A A;  1TUC A;  3EG2 A;  3RR6 A;  3CCJ T;  1LCK A;  4FIB A;  1NPP A;  2HL3 A;  4N4H A;  1I81 A;  3KXT A;  2YUQ A;  4RTZ A;  2DL8 A;  1KK7 A;  2CKK A;  4TVR A;  4OMQ A;  5FWC A;  1M27 C;  4CRI A;  2E12 A;  2DL5 A;  1PCX A;  1WX6 A;  4C5E A;  2X4Y A;  5CCA A;  1VQO Q;  2JTF A;  1LNX A;  4XTZ A;  5LJ3 g;  2QG9 B;  2NUP A;  3VKI A;  1HSQ A;  3OMC A;  4C92 A;  2VGN A;  3CBO A;  2EKO A;  1FMK A;  2GTO A;  4QW2 A;  4M75 G;  4WF2 A;  3FIF A;  2J6O A;  2MYS A;  4OML A;  4AG1 C;  5GAM e;  2JS0 A;  3RNJ A;  3CCJ A;  2VUB A;  2K5L A;  3G6E A;  1R0C B;  4BE0 A;  3JAM E;  3A5Z B;  5FU6 C;  2PU9 B;  2RK1 A;  3CPW P;  5KYX A;  2P0Q A;  1M90 U;  3X20 B;  1Y0M A;  3M0S A;  3CD6 Q;  1JBM A;  1IO6 A;  1K1Z A;  3UPU A;  3OSS C;  3JB9 I;  1G5V A;  4PJO G;  1PSF A;  2DO3 A;  3VJP A;  4E7L A;  3CC7 Q;  2DEU A;  2CH4 W;  5C0M A;  3A8G B;  3S3M A;  5A0G A;  2OAU A;  1ZA2 B;  2BZ8 A;  5J3B A;  2ABL A;  3WVD B;  5GAN 8;  2ZPE B;  2DD4 A;  4XU0 A;  3CCV Q;  5GAN 7;  2FB7 A;  1VQK T;  1WYX A;  2K5I A;  1FYN A;  1D1A A;  5GAO r;  3JCM V;  3OYM A;  3EGD A;  3RKX A;  2MCN A;  2K7A A;  3QWY A;  3OYG A;  5GAN h;  2QTV A;  5DM7 R;  1QVG S;  1VIF A;  2RPN A;  1H8K A;  1ZQ1 A;  3URG A;  4M7A D;  3GP8 A;  1X6B A;  4RMO A;  3NTK A;  3G71 Q;  2XD0 A;  4J6W A;  1SPK A;  2Z0W A;  2EAY A;  4RG2 A;  5LJ3 e;  3QBY A;  2OJ2 A;  1MMA A;  1U8R A;  1K8A U;  3EGD B;  1SHG A;  2D6F A;  4C0Z A;  3O5Z A;  4CC7 A;  3S3N A;  1GRI A;  4LNP A;  2QI2 A;  3TU4 K;  2DET A;  1AWW A;  1UHF A;  4CC4 B;  3JCM e;  2M16 A;  2KR3 A;  2J05 A;  4MZT A;  2LQK A;  3JCM X;  2FZG B;  1TOV A;  5LJ3 h;  3TVT A;  4OMO A;  2P0P A;  4DOV A;  2KK4 A;  4MZM A;  4M77 C;  5CQX A;  5LJ5 e;  3LX7 A;  4M7A G;  1OQK A;  3JCM Q;  3CCU T;  4WCI A;  3PVQ A;  5D6Y A;  3GF5 A;  2K79 A;  1OI1 A;  3M9Q A;  2QGG A;  3GBQ A;  1HD3 A;  3QWX X;  4M77 D;  1UG1 A;  1H92 A;  3CC2 Q;  4A4E A;  3LW5 E;  1OX9 A;  2JUF A;  4FYX B;  3THK A;  3CCR Q;  3RKW A;  3EG0 A;  1HYO A;  2OTL A;  2DXU A;  1IHW A;  5GAO l;  3FDR A;  3OYL A;  1VQO A;  3L2W A;  5LL6 S;  2D8H A;  4M78 D;  1PSE A;  3PTA A;  3M0U A;  2DX1 A;  2WSF E;  1QVG A;  1Z9Q A;  4OGC A;  3J80 E;  4LDX A;  2JS2 A;  2L89 A;  4JZ4 A;  3MP6 A;  1TU0 B;  3MKD A;  5GAN g;  4M7A B;  1K73 U;  5GMK j;  1BI1 A;  3CCJ Q;  1M1K R;  4E7J A;  4PNO A;  1KQ2 A;  2DTH A;  4GY5 A;  3HKS A;  2K2V A;  5DLO A;  2CH4 A;  2HDA A;  3PMT A;  1YWP A;  3CBM A;  1FMW A;  4ME7 A;  1UJ0 A;  2RM4 A;  5GJV B;  4XQ3 A;  2GQV A;  2K6D A;  1CKA A;  3CC7 T;  3P8D A;  1QKX A;  3M54 A;  5EG2 A;  2JMA A;  1Q7Y U;  3CCL A;  4RTU A;  2P84 A;  3PIP A;  4EMK C;  1AD5 A;  4M77 A;  4KRT A;  3TEE A;  3QG1 A;  2NUT B;  2COZ A;  1G3Y A;  4DA4 A;  2OTL T;  1KD1 U;  1NJI R;  1UJY A;  4MZP A;  2EYX A;  3CQT A;  4PFZ A;  2HSE B;  5CQY A;  1EIF A;  2R58 A;  5CKE A;  4K11 A;  4PL6 A;  2RQW A;  3VS1 A;  4LDW A;  2RN8 A;  3RIR A;  1VA7 A;  1MV3 A;  2FPE A;  1Q82 R;  2CP7 A;  2MI6 A;  2ATC B;  1QVG P;  1VQ8 T;  2OTJ A;  4C8Q B;  2XHC A;  3EFO A;  1QVF A;  4E7S A;  3FRN A;  3QJY A;  2CP6 A;  3CCE Q;  1RAI B;  3CMA T;  1WJR A;  1Q7Y R;  1WXU A;  1YIT A;  2O4X B;  1QVF P;  1WA7 A;  3H0F A;  4P5N A;  2I0N A;  4JRQ A;  3NMZ C;  1PHT A;  2EVR A;  1W1F A;  1RAH B;  4A4G A;  4C8Q D;  3PIO A;  2MK5 A;  2DIL A;  5CR2 A;  2K3X A;  3M5A A;  3EFS A;  1OZ2 A;  1GL5 A;  4XTV A;  1SEM A;  5A0D A;  1NJI C;  2DLP A;  1P92 A;  1W4S A;  1K8A C;  2NLU A;  1OX8 A;  3SEM A;  1NBE B;  3ZL7 C;  3CCM T;  4DQ2 A;  3CC2 A;  5D6W A;  5J39 A;  1KJW A;  2CP5 A;  3GOX A;  2COW A;  2ZAE A;  5HK0 A;  1N8R R;  2A08 A;  2EYZ A;  1RAD B;  2HQX A;  2PVO B;  4LE9 A;  2XIC A;  2OAW A;  4Z8A A;  4IUR A;  2OTL Q;  2DXB A;  2FPD A;  4GLK A;  1Q95 G;  2WSE E;  3A8H B;  4FM4 B;  1V1C A;  2QEX Q;  1QP3 A;  1OU9 A;  2VGM A;  4LDU A;  3I55 A;  4C92 F;  1NG2 A;  1WDX A;  2L5Q A;  4PJO D;  2AKK A;  4XU3 A;  2LCC A;  4FYY B;  4M78 C;  4J9C A;  1ZLM A;  1Q86 R;  5GMK m;  3SWN B;  2A0F B;  3VS5 A;  1Y96 A;  2DZC A;  3SWN A;  2RI2 A;  2KMT A;  1BCO A;  1WGS A;  3VU3 C;  1RLQ C;  4M7D F;  2KE9 A;  1AWO A;  4C92 D;  3SHW A;  2HKN A;  4PJO B;  5GAM f;  4HKE A;  2QXF A;  4IUQ A;  1K9M C;  2AZV A;  1SSF A;  1G8X A;  4BD3 A;  1AT1 B;  4PJO A;  4DBH A;  4J83 A;  2MMP A;  4RKU E;  4RTW A;  3UA6 A;  4JRK A;  1ZHI A;  1B07 A;  9ATC B;  4J9B A;  3JB9 H;  4IUU A;  4M77 B;  5FRO A;  4PFO A;  3OBW A;  2LX7 A;  3GLX A;  2BUD A;  2XDP A;  1YN8 A;  2GQI A;  2RH2 A;  2NUZ A;  4EPC A;  4FW2 A;  4F17 A;  3OYH A;  4QVC A;  2VXE A;  2COY A;  2DE0 X;  3NFC A;  4DEX A;  2QDY B;  1NE8 A;  2M0Y A;  4YTL A;  1MMD A;  1WJQ A;  5KYY A;  1M5Q 1;  2KI7 A;  4M77 F;  2FHD A;  2JTM A;  4JRP A;  3X26 B;  2LDM A;  2JXB A;  3J7A F;  1S72 A;  3FEO A;  1MMN A;  4IUT A;  2KRS A;  2QTX A;  4C0D B;  2IVW A;  1EX4 A;  1VQN A;  5GAN f;  4BI8 B;  1M8V A;  2CSI A;  5ECA A;  2RF0 A;  4LUD A;  4BY6 B;  1RAF B;  3SWN C;  2AHJ B;  2OX7 A;  3PE0 A;  3RKY A;  3ZBD A;  2LQ8 A;  2DXT A;  3HRU A;  1J3T A;  2YRV A;  1OPL A;  4A4F A;  2CZ0 B;  4E7K A;  4JZ3 A;  4DEY A;  1YJ9 Q;  1K9M R;  3X28 B;  1G3T A;  5FU6 B;  5GAN d;  4D6W A;  3JB9 F;  2CZ7 B;  3LH0 A;  2YLC A;  2FG0 A;  3PFS A;  2O88 A;  1Z9Z A;  2PUO B;  2QQB A;  1VYU A;  3OYJ A;  1ARK A;  1TH7 A;  3TSZ A;  5GMK h;  2HSP A;  2VV5 A;  1JB0 E;  3H41 A;  3MEW A;  2DTI A;  1K0X A;  1VQ4 Q;  2KVQ G;  3ME9 A;  2RD1 A;  1M8M A;  3EFR A;  2X4J A;  3EHR A;  4NL2 A;  4A54 A;  1BB9 A;  2SRC A;  3R6O A;  5DY9 A;  4OP0 A;  1U1T A;  1UUE A;  1S72 T;  1YI2 A;  3L2U A;  2B86 A;  2CP2 A;  3JB9 D;  4AFZ C;  5CO7 A;  1Q7Y C;  1I07 A;  2FYK A;  3RMS A;  1CSK A;  3LGL A;  1KC8 C;  5DLQ E;  3OYK A;  1N5Z A;  2JM8 A;  2DZ9 A;  4DBR A;  4PLI A;  2QK0 A;  2A28 A;  4LD6 A;  1KSW A;  5IAY A;  5LJ5 g;  5LJ5 f;  4KGV B;  1VQ9 Q;  5CK9 A;  2DRM A;  4XTY A;  2HNI A;  4M78 F;  2DJZ A;  3I56 Q;  4JPB W;  4RUG A;  3G71 T;  1PG5 B;  3CC7 A;  2ED0 A;  1M4Z A;  4F7U E;  3JV3 A;  4RTY A;  3JCM J;  2MWP A;  4M78 A;  2IPO B;  3E19 A;  4ZTJ A;  2RHI A;  4M7A A;  1R8O B;  4II1 A;  1BIA A;  1C6V X;  2M1H A;  4BUG A;  1X43 A;  1N9R A;  4IIO A;  1KD1 C;  1I0C A;  2LP5 A;  1XOV A;  4FT4 A;  2PVD B;  4X34 A;  2RMO A;  3CCQ A;  3RBB B;  1UTI A;  4EMK B;  1YIJ Q;  4C92 G;  4EDU A;  2ZPF B;  1NLO C;  1UGV A;  2X3X D;  4VUB A;  2YRD A;  3UDC A;  4ANJ A;  2RJF A;  3L42 A;  2E6N A;  4PFP A;  2XU8 A;  4AFS C;  1M1F A;  1JJ2 P;  2AZS A;  1YJW T;  5CKB A;  1RI0 A;  4RTX A;  1QCO A;  3LLR A;  4J8O A;  3QUI A;  2VAS A;  1B34 A;  1M30 A;  2PNI A;  2VXF A;  3OS5 A;  3TCJ A;  4JJB A;  1BYM A;  3PMI A;  5I21 A;  4ZN1 A;  5FU7 C;  2JVV A;  1PWT A;  2IIM A;  2JOY A;  2Y4Y A;  3QZ9 B;  2LT4 A;  1N6A A;  3FJ5 A;  3HFN A;  1AVZ C;  3M4Y A;  2DKG A;  2BE7 D;  5KE2 A;  1VQ6 Q;  2MWO A;  1IGQ A;  2RB6 A;  3G4S T;  3CME A;  3MET A;  3EGU A;  4N4G A;  3H0I A;  1Y7X A;  3J81 E;  1OZ3 A;  2KXC A;  3C4S A;  1YHQ Q;  1QWE A;  2HEQ A;  5GAN 2;  1SRM A;  3NGP A;  1OPK A;  2SEM A;  4DOW A;  2EKH A;  2QQ9 A;  2CP3 A;  2G6F X;  1X6O A;  3C0C A;  4PJO E;  2C0I A;  2CP0 A;  4FT2 A;  1XTD A;  4M75 A;  4B6M A;  2DNU A;  3LYI A;  3DKM A;  1NM7 A;  1YJN Q;  1XNI A;  2EYY A;  3T9N A;  3VS2 A;  2X51 A;  1ZUY A;  1KFZ A;  1I5L A;  1FMV A;  2YDL A;  4FSS A;  4RCC A;  3V8K A;  4R56 A;  3MCA B;  1UEB A;  2CZ1 B;  3MP8 A;  5GMK e;  3H6Z A;  1U06 A;  3RDV A;  2VVK A;  2RNA A;  1ZSG A;  1VOM A;  3V7S A;  1H3H A;  3M58 A;  1OEB A;  4QVD A;  3VS7 A;  4J6Y A;  2LZ6 B;  1YJ9 T;  3UAT A;  4ORZ A;  2H8H A;  2E3I A;  4MML A;  1VQM A;  1T3S A;  2J7I A;  2E41 A;  1YP5 A;  2DMO A;  3CCL Q;  3RES A;  1M90 R;  3DB4 A;  1VQL Q;  4C0G A;  3CCE T;  4C8Q A;  2D9T A;  1AOJ A;  1BKB A;  5GAM d;  1HJD A;  2AK5 A;  4EIK A;  5IXF A;  2F1L A;  5M9O A;  1UDL A;  3HL8 A;  4M75 B;  2DER A;  1IRE B;  4Q5W A;  2OI3 A;  1X75 C;  3EG1 A;  3KBG A;  1TWB A;  2QAZ A;  5LJ5 j;  4QKU A;  1I1J A;  4M7A E;  2OTJ Q;  3DLM A;  1OOT A;  2EFI A;  3VRZ A;  3GIB A;  5FW9 A;  1KC8 U;  1E7O A;  2QA4 A;  3Q1J A;  1VQ7 Q;  2BIV A;  4PLL A;  3V8L A;  1T0H A;  1UHC A;  3PGG A;  1K9A A;  3JB9 G;  1H3Z A;  4CC3 A;  3A98 A;  2CGH A;  4FSX A;  2JZ2 A;  2DBK A;  4KGX B;  4M7D B;  2G3R A;  3QHS A;  1VQ5 T;  2EGE A;  3HSB A;  2F2X A;  3M0T A;  1BCM A;  1HK9 A;  2RQT A;  2O9S A;  4A4H A;  3LGF A;  1JEG A;  1LJO A;  5LJ3 j;  3ULR B;  5AYF A;  1X27 A;  4LN2 A;  1FX7 A;  1TXQ A;  2X4X A;  1V29 B;  2FRY A;  2K2M A;  1S1N A;  3X25 B;  2P4R A;  2KDS A;  3OS0 A;  4XU1 A;  2L0A A;  1VQP T;  1JXM A;  2A7Y A;  1M1K C;  4KUL A;  4MDW A;  4JRI A;  4JDS A;  3O8V A;  1UGP B;  1ZUU A;  1D0Z A;  1YJW Q;  1KHI A;  1EFN A;  4XTU A;  1B34 B;  2CYZ B;  4XTX A;  5IHN A;  4B9W A;  2XDD A;  4J9E A;  3L2Z A;  1MND A;  4F7U A;  2KEA A;  3H0H A;  1GFC A;  2X9H A;  1W6X A;  4C0F A;  1WLP B;  1M2V A;  1YIJ T;  4OB0 B;  3WVE B;  2LNV A;  2RI5 A;  5HCK A;  5GMK l;  3H8Z A;  3SB2 A;  2P4T A;  4RCB A;  1VQ6 T;  1M2O A;  1YJN A;  2O4X A;  5L8R E;  1G2B A;  2V8I A;  3F70 A;  1PKS A;  1PD0 A;  1T0J A;  2FEI A;  1AEY A;  1MUZ A;  2ZCF B;  5GAN j;  1NEG A;  1WNL A;  2AKL A;  4X1V A;  1H64 1;  4RG8 A;  5I2M A;  5D7U A;  4M77 E;  5GAM j;  4M75 F;  2CRE A;  2QQS A;  3ASK A;  4IIM A;  2R5M A;  1M1K U;  3CCQ Q;  4E7Z A;  3RER A;  2MF2 A;  2V8K A;  3MPU B;  2K9G A;  3ZEH A;  1VQM Q;  1X2Q A;  4C92 C;  3C95 A;  1C0M A;  1WZO A;  1B3Q A;  1RL2 A;  3JCM d;  3CME Q;  1VQ8 A;  1O9S A;  4PJM A;  1WXT A;  4J9H A;  3NTH A;  3EFO B;  4ATO A;  2M0O A;  5IHK A;  4KUD K;  5A2Q E;  1YBY A;  4PJO F;  4BI3 A;  2EJG A;  1M3A A;  2C0T A;  2P0K A;  1VQ7 T;  2L3Q A;  3E2U A;  2RHZ A;  4LUE A;  2EJF A;  4ELY C;  1VQ5 A;  4HCC A;  2LC4 A;  2LJ1 A;  3BFM A;  4C0D C;  4IUV A;  3I55 T;  1BI2 A;  1O75 A;  1Y71 A;  1TUD A;  2ROT A;  3G1J A;  3UA7 A;  1ZSZ C;  2LJ3 A;  4BB7 A;  4QT7 A;  1VQL T;  2MIO A;  1VQO T;  1VQ6 A;  1NEB A;  2LQW A;  3PVL A;  1FXX A;  2E70 A;  2R57 A;  2RHU A;  3I5S A;  5GAO q;  4HA8 A;  2L3S A;  1X6G A;  2LT1 A;  2V26 A;  1IXD A;  2KT1 A;  1MMG A;  1PC0 A;  1K73 C;  1QP2 A;  3SD4 A;  3UF4 A;  1D09 B;  1EZZ B;  6AT1 B;  2O2O A;  1NYG A;  4HXJ A;  1X01 A;  4J6X A;  4AT1 B;  2DTO A;  3JCM g;  1K8A R;  1D0X A;  3LWI A;  1BU1 A;  2FL7 A;  2KYB A;  3OYI A;  2GBQ A;  2XKO C;  2E65 A;  4JLI A;  5GAN 5;  3EHQ A;  1YCY A;  1VYV A;  3OW2 P;  3VYG A;  3CXC A;  1X2K A;  3HRS A;  2ZPB B;  8AT1 B;  1M3B A;  2IG0 A;  2JMC A;  2AT1 B;  3OQ5 A;  4HVU A;  2E3H A;  1OU8 A;  1JO8 A;  4BE1 A;  2FRW A;  2KBT A;  1AWX A;  2ZPI B;  4N4I A;  1WQ7 A;  2Y90 A;  3QZ5 B;  3CCE A;  2YXY A;  2RI3 A;  1XJW B;  3QYG B;  5CAI A;  3SDZ A;  2E64 A;  3OA6 A;  4E47 A;  1JRI A;  2B8A A;  2LNH B;  2EQM A;  3VUZ A;  2E5Q A;  4F7U G;  1ZBX A;  8ATC B;  4M78 G;  3V7C A;  1I4K 1;  1Q82 C;  3QJ6 A;  2DL4 A;  5IXB A;  3JRZ A;  2YT6 A;  1GCQ A;  3M55 A;  1V76 A;  1UGS B;  2DD5 A;  4A4K A;  4AFQ C;  2ENM A;  3HRT A;  1AZE A;  2RHX A;  3MEA A;  2EQK A;  4R55 A;  1VQL A;  1K4U S;  1Q81 U;  4ZGD B;  2FVU A;  2L8D A;  3CMA Q;  2JTE A;  5GJW B;  4X9D A;  3I56 A;  2C0O A;  2DEQ A;  1ZX6 A;  2QDL A;  1Q86 U;  2CZ6 B;  2J06 A;  1K73 R;  3C94 A;  5J26 A;  2NWM A;  3OYC A;  4B9X A;  1KQS S;  4OB1 B;  2QEX A;  1KQ1 A;  2DA9 A;  2EGC A;  5LJ5 h;  4C5H A;  1WQW A;  1B7T A;  2HD0 A;  3CCS A;  3CCU A;  4CI0 C;  5AT1 B;  1WJS A;  2ROL A;  1YJN T;  2LCL A;  4FYW B;  2VKN A;  2CSQ A;  2F2W A;  2LMJ A;  4M7D C;  3OMG A;  1D1C A;  4PK4 A;  3JCM h;  1GFD A;  4OMN A;  1UE9 A;  2I2L A;  1ABQ A;  1IZ6 A;  4A63 B;  1JXO A;  3CPF A;  2W0Z A;  1F1B B;  4EMH A;  2KAF A;  1UFF A;  3OYY A;  1YI2 Q;  4CC2 A;  3AHU A;  4M7D D;  1Q81 R;  3I56 T;  2F5K A;  5KYW B;  1YFN A;  2QQA A;  1BI3 A;  3G7Z A;  2EQJ A;  3DB3 A;  3REB B;  1QCN A;  2EYQ A;  4N0A A;  1WHJ A;  4R0K A;  3CPW S;  4JJC A;  4FL6 A;  1M90 C;  3CC4 A;  3CCM Q;  4F16 A;  5GAN e;  3JCM W;  3RUX A;  1SF9 A;  3BW1 A;  2VYT A;  2A36 A;  3V7R A;  1GBR A;  2PTK A;  2MOX A;  2WSC E;  3JSC A;  3P8B B;  2RQU A;  3EH1 A;  2DVE A;  3FB9 A;  3M56 A;  3HTR A;  1RAA B;  1YWO A;  2DFU A;  3VS0 A;  2JN0 A;  3REA B;  3CD6 T;  3TSW A;  3EGX A;  4E7H A;  1KQS A;  3VS6 A;  1Q81 C;  2A3L A;  4L5G A;  2V1Q A;  3EG3 A;  3OSV A;  4PJN A;  2E10 A;  2RJD A;  4BY6 C;  1VQ7 A;  2HMA A;  3QDF A;  2CUB A;  4AFU C;  2E1H A;  3VS3 A;  3C12 A;  4JLG A;  1E6H A;  1NLP C;  1MGQ A;  4D8D A;  3QDR B;  1Q82 U;  2QAS A;  1VQM T;  3EG9 B;  2HQE A;  1QW1 A;  2EGA A;  3E9F A;  5FU7 B;  5GAN 4;  1Y07 A;  3MHX A;  4RTV A;  2QEX T;  2M51 A;  1GXI E;  1BIB A;  4J7I A;  4KH1 B;  2KYM A;  3CCQ T;  3OYD A;  4BDY A;  2BE9 B;  3NTI A;  4BAC A;  2QA4 T;  3M0R A;  3AT1 B;  1ZSZ A;  4DBQ A;  2X3W D;  4M4Z A;  1M3C A;  3QKJ A;  2NUT A;  3WXM B;  1AZG B;  4QQG A;  1KQS P;  4ZN3 A;  3NPF A;  1AWJ A;  4KUI A;  4BE2 A;  2EW3 A;  2XID A;  3CPW A;  5GAN 6;  2XG8 D;  3HP9 A;  1RAB B;  3H9N A;  1YIT T;  2EQU A;  4C92 E;  3HPW A;  2YUO A;  1TTH B;  2YUN A;  4J5Y A;  1ABO A;  3M57 A;  5GAM h;  1WHM A;  5IT9 E;  3EG9 A;  2DJQ A;  3VUB A;  5HY6 A;  4HT9 A;  3I9Q A;  4PJJ A;  1N8R U;  3OYE A;  1CKB A;  3LH5 A;  1UGR B;  2HZY A;  4FU6 A;  2XDB A;  1U5S A;  1PKT A;  2H3J A;  1PRM C;  1D3B B;  2L3P A;  4V2S A;  2EPD A;  3TRE A;  1U1S A;  1M9S A;  3HFO A;  2V8J A;  2RJE A;  2ECZ A;  3PT9 A;  3G4S A;  2KRO A;  3L2Q A;  5KYX B;  1VQP Q;  1WXB A;  2HBP A;  4M7D E;  3BDU A;  3MJX A;  3M53 A;  1K76 A;  3S6W A;  3MP1 A;  2LVM A;  3MO8 A;  4ZNX A;  2HBW A;  4HVV A;  1UEC A;  4GLM A;  3KUF A;  4KH0 B;  3OYA A;  3QII A;  1VIE A;  1IRX A;  5GAO m;  2E6Z A;  1WHK A;  4LD9 K;  2K3B A;  4Z02 A;  2KRN A;  3PNW C;  2GCX A;  4X9C A;  1LPL A;  2CUD A;  4C92 B;  2F69 A;  3VYH B;  1YCS B;  2VC8 A;  2XMF A;  1QKW A;  4Z89 A;  1VQ9 T;  2DYB A;  1C1A A;  3FJP A;  3QXE B;  2EIF A;  3I35 A;  5L23 A;  1TG0 A;  3OW2 S;  1I8F A;  3S3O A;  4Z88 A;  2LJ0 A;  2YSQ A;  1ZA1 B;  2D1X A;  5CKH A;  2HKQ B;  1VQ5 Q;  2WAC A;  2JT4 A;  2ZZD A;  4BI4 A;  3A1P A;  3E1S A;  4HT8 A;  3P8H A;  1KD1 R;  3CCU Q;  4L59 A;  3R6N A;  1AHJ B;  3OYN A;  1WIE A;  2PZ1 A;  1NJI U;  1K9M U;  5LJ3 d;  3A8O B;  2DAQ A;  2DRK A;  2EYW A;  1ZSZ B;  1IB8 A;  3CBP A;  2LX9 A;  4A53 A;  5CKD A;  1KHC A;  4M77 G;  4M75 E;  1DJ7 B;  1G83 A;  1TUG B;  3TQ7 P;  1QWF A;  5KCH A;  5GAM g;  1UB4 A;  5IH2 A;  1WFW A;  1RAC B;  1JJ2 A;  3EGX B;  4HCZ A;  2D0Q B;  2XI9 A;  3M59 A;  5GMK i; 
#chains in the Genus database with same CATH homology
 4JZ3 A;  2W10 A;  4DEY A;  1T3L A;  5IHK A;  2JS0 A;  3RNJ A;  1M3A A;  2C0T A;  2F2V A;  2FG0 A;  2O88 A;  1Z9Z A;  2L3Q A;  1U3O A;  1QCF A;  4LUE A;  1Y0M A;  3M0S A;  1VYU A;  1ARK A;  3TSZ A;  1IO6 A;  1K1Z A;  2LJ1 A;  2HSP A;  2LCS A;  3H41 A;  1K0X A;  1TUD A;  2ROT A;  2CH4 W;  1M8M A;  2BTT A;  2GNC A;  3EHR A;  3UA7 A;  2BZ8 A;  2LJ3 A;  2ABL A;  1BB9 A;  4QT7 A;  2SRC A;  1JU5 C;  2MIO A;  1UUE A;  1NEB A;  2LQW A;  3PVL A;  3I5S A;  1WYX A;  2B86 A;  2L3S A;  1X6G A;  2GTJ A;  1FYN A;  1E6G A;  2KT1 A;  2KGT A;  4AFZ C;  3UF4 A;  2MCN A;  2O2O A;  1NYG A;  4HXJ A;  1I07 A;  2K7A A;  1CSK A;  3QWY A;  1BU1 A;  2KYB A;  1SHF A;  2GBQ A;  1BBZ A;  2RPN A;  1H8K A;  1N5Z A;  2JM8 A;  2CT4 A;  1X6B A;  3EHQ A;  1VYV A;  2A28 A;  1X2K A;  1KSW A;  4HCK A;  1M3B A;  2DRM A;  1SPK A;  2JMC A;  4HVU A;  2DL7 A;  4Y92 A;  2OJ2 A;  1JO8 A;  1SRL A;  2FRW A;  4JPB W;  4RUG A;  2KBT A;  2ED0 A;  1AWX A;  4GBQ A;  1SHG A;  1PNJ A;  3O5Z A;  4CC7 A;  3JV3 A;  1GRI A;  4OMP A;  4LNP A;  4RTY A;  1OV3 A;  1AWW A;  1UHF A;  1RUW A;  4CC4 B;  2LNH B;  1NYF A;  2KR3 A;  2J6F A;  2J05 A;  2L2P A;  2DL4 A;  2DVJ A;  5IXB A;  1W70 A;  4J9G A;  1RLP C;  2YT6 A;  1X43 A;  4IIO A;  1GCQ A;  3TVT A;  4OMO A;  1I0C A;  1BK2 A;  2LP5 A;  1XOV A;  4AFQ C;  2ENM A;  2RMO A;  4WCI A;  3RBB B;  3PVQ A;  1UTI A;  1AZE A;  2K79 A;  2RQR A;  1NLO C;  1K4U S;  5I22 A;  1UGV A;  3GBQ A;  1HD3 A;  3QWX X;  1H92 A;  1UG1 A;  2X3X D;  3THK A;  1PRL C;  2JTE A;  5GJW B;  1WI7 A;  2C0O A;  1ZX6 A;  2QDL A;  3VRY A;  3EG0 A;  4J9F A;  2J06 A;  1ZBJ A;  3NHN A;  4AFS C;  2NWM A;  2AZS A;  1X69 A;  4OMM A;  4RTX A;  2D8H A;  1M30 A;  2PNI A;  3M0U A;  2DA9 A;  4JJB A;  2EGC A;  2DX1 A;  1Z9Q A;  2JS2 A;  1PWT A;  2IIM A;  2ROL A;  4JZ4 A;  2DL3 A;  2VKN A;  2CSQ A;  2F2W A;  2LMJ A;  2E5K A;  1GFD A;  4OMN A;  3FJ5 A;  1AVZ C;  1UE9 A;  2FO0 A;  1ABQ A;  4A63 B;  1JXO A;  2W0Z A;  2CH4 A;  1UFF A;  2HDA A;  4CC2 A;  2KXD A;  1YWP A;  1RI9 A;  2D8J A;  1UJ0 A;  3EGU A;  5GJV B;  3IQL A;  2K6D A;  1CKA A;  3REB B;  3H0I A;  2YUP A;  2KXC A;  1QWE A;  2HEQ A;  1SRM A;  5I11 A;  1QKX A;  4R0K A;  3NGP A;  1OPK A;  4JJC A;  2SEM A;  1JQQ A;  2EKH A;  2JMA A;  4RTU A;  2G6F X;  1GCQ C;  4F16 A;  1AD5 A;  4KRT A;  2EBP A;  3C0C A;  2C0I A;  2A36 A;  1GBR A;  2PTK A;  1UJY A;  2DNU A;  2MOX A;  1NM7 A;  2RQU A;  2EYX A;  3CQT A;  2EYY A;  4J9D A;  3VS2 A;  2CT3 A;  2ESW A;  4K11 A;  3M0Q A;  2VWF A;  1ZUY A;  2RQW A;  1YWO A;  5FWB A;  3VS0 A;  3VS1 A;  3REA B;  1KFZ A;  2RN8 A;  3TSW A;  1VA7 A;  4JJD A;  1MV3 A;  2FPE A;  2YDL A;  4FSS A;  3VS6 A;  2V1Q A;  1U06 A;  3EG3 A;  2VVK A;  2JW4 A;  2RNA A;  1ZSG A;  2BZY A;  1H3H A;  1A0N B;  1OEB A;  3VS7 A;  2LZ6 B;  3UAT A;  4ORZ A;  2H8H A;  2CUB A;  4AFU C;  3VS3 A;  1T3S A;  2J7I A;  1YP5 A;  2DMO A;  1WXU A;  1E6H A;  1NLP C;  4D8D A;  1WA7 A;  3H0F A;  2I0N A;  2DM1 A;  3NMZ C;  1PHT A;  2EVR A;  1W1F A;  2DF6 A;  1AOJ A;  2EGA A;  2V1R A;  1GCP A;  2DIL A;  1HJD A;  4RTV A;  4ESR A;  2AK5 A;  4EIK A;  2FPF A;  1SSH A;  2RQV A;  3I5R A;  5IXF A;  1GL5 A;  2M51 A;  1SEM A;  1UDL A;  2KYM A;  1MV0 B;  2DLP A;  2EQI A;  3M0R A;  3SEM A;  2X3W D;  4M4Z A;  1M3C A;  3ZL7 C;  4E6R A;  2OI3 A;  1GBQ A;  1AZG B;  1KJW A;  2BZX A;  1Y57 A;  1KIK A;  3NPF A;  3EG1 A;  1AWJ A;  2A08 A;  1I1J A;  2ED1 A;  2EW3 A;  2EYZ A;  3KFV A;  4LE9 A;  1OOT A;  2OAW A;  4Z8A A;  3VRZ A;  5FW9 A;  2FPD A;  4RTT A;  1E7O A;  2YUO A;  4HVW A;  1V1C A;  2YUN A;  1T0H A;  1ABO A;  1UHC A;  1K9A A;  4CC3 A;  2DJQ A;  1NG2 A;  1WDX A;  2JM9 A;  3A98 A;  2DBK A;  5IHI A;  3M0P A;  2KNB B;  2AKK A;  3I9Q A;  1QLY A;  2EGE A;  1CKB A;  3LH5 A;  2F2X A;  5EC7 A;  4J9C A;  3M0T A;  1ZLM A;  1U5S A;  2RQT A;  2O9S A;  2DBM A;  1PKT A;  1JEG A;  1PRM C;  2O31 A;  2L3P A;  1YNZ A;  1VYT A;  3VS5 A;  3ULR B;  2EPD A;  1X27 A;  4LN2 A;  2FRY A;  2K2M A;  1S1N A;  2P4R A;  3VS4 A;  4D8K A;  2ECZ A;  1ZUK A;  1RLQ C;  1K0S A;  2L0A A;  2KE9 A;  1JXM A;  1AWO A;  3SHW A;  2KRO A;  2AZV A;  1ZUU A;  1WXB A;  1EFN A;  4AG2 C;  5IHN A;  1K76 A;  2KRM A;  4ZNX A;  2HBW A;  3UA6 A;  4F14 A;  4RTW A;  4J9E A;  4HVV A;  1UEC A;  4GLM A;  2KEA A;  3H0H A;  1B07 A;  2J6K A;  1GFC A;  2K3B A;  2GGR A;  1W6X A;  2CDT A;  2KRN A;  4J9B A;  2HCK A;  1WLP B;  2CUD A;  2O9V A;  2A37 A;  1YCS B;  2LX7 A;  5HCK A;  2XMF A;  1QKW A;  4J9I A;  4Z89 A;  2DYB A;  3U23 A;  2D0N A;  2KT8 A;  1YN8 A;  2GQI A;  2NUZ A;  2LQN A;  4F17 A;  3I35 A;  5L23 A;  1TG0 A;  2DE0 X;  1G2B A;  1TUC A;  3EG2 A;  1PKS A;  4Z88 A;  4DEX A;  1T0J A;  2FEI A;  2LJ0 A;  2YSQ A;  1AEY A;  2M0Y A;  2D1X A;  1LCK A;  1MUZ A;  1NEG A;  2JXB A;  2JT4 A;  2YUQ A;  2AKL A;  4RTZ A;  2DL8 A;  4X1V A;  2KRS A;  4OMQ A;  3R6N A;  5FWC A;  1M27 C;  1WIE A;  2CRE A;  2PZ1 A;  4IIM A;  2CSI A;  2DL5 A;  5ECA A;  2RF0 A;  4LUD A;  2DRK A;  2EYW A;  1WX6 A;  1G83 A;  2K9G A;  3PE0 A;  1HSQ A;  1QWF A;  1X2Q A;  1FMK A;  2GTO A;  5IH2 A;  1J3T A;  1WFW A;  1B3Q A;  1OPL A;  2J6O A;  4OML A;  1WXT A;  4J9H A;  4AG1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...