3OA6A

Human msl3 chromodomain bound to dna and h4k20me1 peptide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
FKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDENRRLQRKLARKAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Male-specific lethal 3 homolog
publication title Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 19
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oa6A01
3F70A 2EFIA 2PQWA 3OYEA 3OS1A 4LD6A 4QQDA 1OZ2A 3O8VA 3OQ5A 3PNWC 5FRMA 2RI5A 3S6WA 4A4HA 4EDUA 2G3RA 3MO8A 3OYBA 3OYJA 2EQJA 4IUVA 4A4EA 3OYKA 2E6NA 5J26A 4PL6A 2CKKA 2HQEA 3FLGA 2DIQA 4X34A 2RJCA 3E9FA 4N4GA 3KUFA 3S3OA 3P8DA 3E9GA 2O4XA 1H3ZA 2K3YA 3MP1A 3MEAA 3OYIA 3OYCA 5D6YA 4CRIA 2LVMA 2MWOA 3H6ZA 4NS5A 3L2VA 4ZTJA 3MEWA 2EKOA 4N4HA 3L2QA 4BE0A 3QBYA 4QQGA 5FROA 3QKJA 4BDZA 3L2WA 3S3MA 5IAYA 2L89A 2RJEA 3PMTA 4B9WA 2FHDA 3NTKA 4C5EA 1WJQA 5C0MA 3OA6A 2RHXA 4Q5WA 5FRNA 1SSFA 5D6XA 1MHNA 3M9QA 2E5QA 2GFUA 2LTOA 5KH6A 4B9XA 3OS2A 4OVAA 4A4GA 2LRQA 2F5KA 2LCCA 2RI2A 5C6SA 4E7JA 1OI1A 5CIUA 3L42A 2M0OA 2RHZA 4FU6A 4A4FA 2EQMA 2WACA 3BDLA 4QQ6A 4BD3A 2QQRA 4IUPA 2R5MA 5KE2A 3OY9A 3Q1JA 1OZ3A 3OYAA 2X35A 3OYLA 2RJDA 2BKDN 3PMIA 4RG2A 3MEUA 2HQXA 3LGLA 4L59A 3ASKA 4E7IA 3CEYA 3LH0A 4E7LA 3EAEA 4GY5A 4UC4A 2O4XB 2R57A 2EQKA 3H8ZA 3OB9A 4C5HA 4ZTFA 5KCHA 4IKFA 3S3NA 2RHYA 2EQUA 2R58A 4BE2A 3DB4A 3META 3OYDA 2QQSA 2RO0A 4IUUA 3L2UA 2JZ2A 3QIIA 5IN1A 3FC3A 3OYNA 3GOXA 2K3XA 2M16A 1N27A 3MEVA 4QVZA 5D6WA 3QJ6A 4PLLA 4PLIA 2P0KA 3LX7A 1WJRA 3FDRA 2GF7A 3OS0A 2DAQA 2JTFA 2L8DA 1WGSA 3NTHA 4II1A 2BIVA 2LDMA 2RHIA 2M1HA 3OMCA 1RI0A 4C5GA 2D9TA 4Z02A 2RHUA 5M9OA 2B8AA 2NLUA 1WJSA 2VYTA 3NTIA 2XDPA 3UWNA 4QW2A 2L3RA 3OMGA 3OYMA 2X4YA 4IUTA 4BACA 5KE3A 3FEOA 2YRVA 4IUQA 4BE1A 1KHCA 4BDYA 2IG0A 2RJFA 4N4IA 5KCOA 3OYGA 3ME9A 3P8HA 3SD4A 1XNIA 1G5VA 3OYHA 4C5IA 3OYFA 3LGFA 3PFSA 4E7KA 3LLRA 1OYXA 4FL6A 2X4WA 5J39A 2XK0A 2MWPA 3L2RA 2BUDA 2RI3A 4IURA 3DLMA 3DB3A 3LYIA 3ZEHA 3C4SA 3MP8A 2DIGA 2R5AA 2X4XA 3UT1A 3MP6A 4HCZA 2GFAA 4E7HA
chains in the Genus database with same CATH superfamily
2P4RA 2AHJB 2EFIA 3F70A 9ATCB 4D8KA 2NYSA 1MMDA 2OTJQ 2OX7A 4M77B 2FZKB 3I5RA 3CCJA 2DVEA 2DERA 1GL5A 1PM3A 5L8RE 2O4XA 2QYZA 1VQ7A 1UDLA 1G3YA 2A3LA 4FYWB 3QUIA 1PG5B 3DKMA 4DOWA 1JBMA 3BE3A 3L2WA 1WHJA 1UGPB 1B34B 4CI0C 1NBEB 4B9WA 3P8BB 2XI9A 3JB9D 1SSHA 4C92F 4Q5WA 5A2QE 5GJVB 4D6WA 4JDSA 5GAMf 5LJ5e 3CCRQ 2RHZA 4M77E 2K5FA 3BDLA 4M78F 1I0CA 1PSFA 2HSPA 4JJCA 2CP6A 2XKOC 2JN0A 1G83A 2QTXA 5GAMd 1BI1A 3ASKA 4ZNXA 2SRCA 5IT9E 2O4XB 2PZ1A 3EGDA 1HSQA 1D0ZA 2EYWA 4EMKA 4EMKC 3GIBA 2E10A 3AT1B 5IN1A 2QGFB 4AT1B 3CPWP 5LJ5h 4LUDA 2M1HA 1KQSP 1PHTA 2DL5A 4J9GA 2B8AA 1W2BP 3R6NA 4IIMA 3GP8A 5HK3A 4GLKA 1NPRA 1ZSGA 2XMFA 1YCSB 3V7CA 1U06A 4MZMA 5LJ3j 2IG0A 4JJNK 1QLYA 3M4GA 3JRZA 4XK8E 2DKGA 3H0FA 1D0XA 1VYTA 4JRQA 4E7SA 2KYBA 4RTVA 4J6XA 3EGDB 3MP8A 1AWOA 2X4XA 1VQ8Q 2LQWA 2QEXQ 3CXCS 2HCKA 4AG2C 3OS1A 2NUTA 4EMKB 5FRMA 4BI3A 3MO8A 2YUPA 4RG8A 2J6FA 1UHCA 4A4EA 2CSQA 1M4ZA 2RJCA 1YITQ 3CCMA 5CKFA 3CMET 2A0FB 3OYIA 2KSSA 2VKNA 5L23A 2DRKA 3JCMV 1ACMB 4E2FB 2CS7A 2HDAA 4XU3A 1K1ZA 1G3TA 1AT1B 1K9AA 5CR2A 2D1XA 3JCMb 2GCXA 3I9QA 2K3BA 1VQOQ 1WI7A 1ZA2B 5DY9A 5GAOr 1D1BA 3QPHA 2O31A 4LDYA 4Z88A 4LD9K 2OI3A 3L42A 3CCEA 1RAAB 4BUGA 4A4FA 1Y07A 1X6OA 2NUTB 3G4SA 8ATCB 1WXBA 3M0SA 4ATOA 3BW1A 2PNIA 3THKA 4OMOA 2CZ7B 4J9FA 3OW2P 3FB9A 3IQLA 4HCBA 4UC4A 1X6BA 4C5HA 1MUZA 2EGCA 3META 1VQKT 1KG1A 1KQ2A 4JRKA 3QDFA 2DPPB 3HRSA 2M16A 3CCVT 3JAME 4DEYA 3OS0A 4AFQC 4DEXA 2BIVA 1VQ4T 1KD1C 3CC7T 2MK5A 5CQXA 2VB6A 3CCVQ 4PJOF 1YN8A 2QDYB 3UPUA 1KQSA 2F69A 1QW1A 1W2BA 4AG1C 1R77A 1QKWA 2MPXC 4E47A 4Z8AA 2X9HA 4HVVA 3V7SA 2QAZA 3HFNA 3VS0A 2ECZA 5KYXA 4GY5A 4M4ZA 2KMTA 4LD6A 2YT6A 2C0TA 4J7FA 1RAHB 2EYXA 2DD4A 5J26A 1S72A 3G6EQ 2C0OA 2QQ9A 2DL4A 1WHLA 3SEMA 1OPLA 1WPYA 3H6ZA 3MEWA 1WQ7A 2RK2A 5FROA 4E6RA 2QTVA 1ARKA 1BI2A 4WF2A 4ANJA 3MPUB 3PT9A 2DL8A 3PGGA 3NFCA 5C6SA 2A36A 4FU6A 5HK0A 1OZ3A 2DXBA 3VS6A 3X28B 1TSFA 2ZPFB 1VQMT 2BTTA 2XHCA 1PRMC 3CBPA 3JCMQ 2P84A 1R8OB 2O01E 2QQSA 3FC3A 3OW2A 1H3HA 4HT9A 3VS5A 1K9MU 2O88A 5CO7A 3LX7A 1B7TA 2JTFA 4C0DB 5I21A 1KIKA 3A98A 3AHUA 2XIDA 4ZN1A 4ZGEB 1QVGS 1OU8A 2NLUA 4Y92A 4V2SA 2YLBA 3OYMA 1RADB 1ZUYA 1VQKA 2KXDA 2C06A 5A0LA 2KVQG 2E41A 1SG5A 1R0CB 2GBQA 3ME9A 3P8HA 2JW4A 3QDRB 2I0NA 4FL6A 3VV0A 1VQ4A 2L2PA 2FPEA 1YNZA 1YJ9Q 2KGTA 3CC7A 2DIGA 2BZXA 2LMJA 2JM9A 3V8LA 1VQLT 3OYYA 1OZ2A 5GAOp 5AYFA 4FW2A 1IGQA 1K8AC 3E2UA 1C0MA 3OYBA 2EQJA 3KXTA 2H3JA 1PC0A 2FG0A 4XU2A 4PJOD 2HKQB 3OYCA 1LOJA 1I07A 4KGZB 5I2SA 2JVVA 4J7IA 1YP5A 1JRIA 3S3MA 1TG0A 2XDBA 1WXUA 5IAYA 1OU9A 1TUGB 1XTDA 4ELZC 2FHDA 4M77D 3NTKA 1M9SA 2QI2A 4C92C 2RQUA 4C92A 1O75A 1SSFA 3UA7A 3J7AF 1ZLMA 3JCMJ 4M78C 4M78A 5GAMj 2X3WD 1OX9A 1ZQ1A 2QASA 2Y90A 4RTZA 3X24B 1QVFS 2YDLA 1BI3A 2KY9A 4L59A 5J3BA 1ZA1B 3I55T 4E7LA 5GANj 3OB9A 2E1HA 2LJ1A 1M3AA 2RA2A 4PNOA 3DB4A 1T3SA 4IUUA 2M02A 2RM4A 2EJGA 1ABQA 3RERA 1BIBA 2P0QA 7AT1B 3CD6T 1I8FA 4J9DA 4CC3A 4C92B 1TXQA 4CC4B 5I2MA 1WYXA 1VQNT 3QJYA 2VYTA 3NTIA 2EBPA 4R0KA 3OSSC 1WA7A 1MGQA 2XDDA 1CKBA 4M78B 5FWBA 4N4IA 4RMOA 2JS0A 3SB2A 4J8OA 3CCLT 3C95A 1ZBJA 2MWPA 5GAN6 2DILA 3FJ5A 2RPNA 2BZ8A 1VQ6T 2K2MA 1EIFA 4E7HA 2HL5C 5GMKl 5KYNA 4C92E 5CKBA 2BZYA 2EYQA 3M57A 2E6NA 4PL6A 2CKKA 1KQ1A 4OGCA 4PFZA 2DIQA 1N8RR 3CCJT 2DA9A 3E9GA 4MZPA 3MP1A 1R0BG 4M78E 1MNDA 1GFCA 2PUOB 5D6YA 1QMCA 4NS5A 4JRIA 3PIPA 4K11A 1H641 1VQLA 2KRMA 1UHFA 3CCJQ 3BDUA 2EW3A 5IHKA 3CCST 2RJEA 3JSCA 3TEEA 1VQ7Q 2OTLT 3NGPA 3JCMg 5GAOq 5KH6A 1GBQA 4X9CA 4LNPA 1TWBA 2QQAA 5LJ5j 2LT1A 4WCIA 1YIJT 3NPFA 2Y4XA 1JXOA 1BK2A 4IIOA 2HMAA 3QO3A 3QYGB 2RJDA 3EHQA 4PFOA 1D1CA 2VGNA 2KRSA 4OF1A 3UA6A 1PD1A 4BI8B 4ZTFA 3JV3A 3QZ5B 1IHVA 2COWA 4C8QG 4DBRA 4RTUA 3QWXX 1YJWT 4B6MA 2DAQA 1W70A 3X26B 1RI0A 1T0JA 3CQTA 3LW5E 1HK9A 1SF9A 1WFWA 3KBGA 2RF0A 1N6AA 2CSIA 4PJOA 2L3RA 4PJOC 4M75G 4RTWA 1JO8A 2KK4A 1VIEA 3SD4A 1HYOA 3C12A 3M0RA 1N5ZA 2KQWA 3CD6A 4RUGA 1VA7A 3VJPA 4M77A 4M77C 3V8JA 1KK7A 2YWWA 4HCZA 3PVQA 1YHQT 1G2BA 2H3EB 4X1VA 2DEQA 1BIAA 4FYXB 5CAIA 3OYKA 1WX6A 2G6FX 2D0QB 2AT1B 2HQEA 1B34A 4N4GA 1ZX6A 2JMAA 3HP9A 2C0IA 2K3YA 3ZBDA 4M7AF 5DLQE 3CCMT 4HVUA 4PJOB 2ZPEB 1VQ6A 5GAOm 2EKOA 1TUCA 4J9CA 4OMQA 3REAB 3X20B 3GNFB 2KI7A 2DBMA 1NLOC 4C5EA 3GBQA 3ZL7C 5GMKe 4ZGJB 3OS2A 1VYVA 3JCMX 1UJ0A 2VVKA 2X4JA 2M0OA 3RKXA 5IXFA 4FCYA 1FYNA 1JJ2A 4D8DA 3CCET 3CXCP 1Z9ZA 2X35A 3HHTB 5KYUA 1Q86R 3G4ST 3RMQA 2DD5A 3CCSA 2HQXA 1OULA 1AZGB 1QWFA 4PJOE 2V26A 2OTLA 1IREB 3CCEQ 4XTWA 2J6KA 1BU1A 3G4SQ 2RO0A 1YIJA 2VASA 3QXEB 2CZ6B 4RTYA 1NG2A 1I5LA 1GCPA 4PLIA 1XOVA 4OMPA 3D7SB 4F7UG 3E1SA 2M0YA 3UATA 4M7DF 4JLIA 2D9TA 5M9OA 3PVLA 3PE0A 1C1AA 4GLMA 1JXMA 2PVOB 4BY6C 1FX7A 1YWPA 2VXEA 2HEQA 2OAUA 2P4TA 3EFOB 1M3CA 2RQRA 5KYUB 2GTJA 1G5VA 1QCFA 1YJWA 4DA4A 3L2RA 1MMAA 2AZSA 4P5NA 2EPDA 4C8QF 4JZ3A 1UJYA 1X27A 2PQWA 3O8VA 3OQ5A 4C0GA 1TU0B 3FLGA 3VS3A 3J80E 4HCKA 1S72T 1X6GA 2EJ9A 1YJNA 5EC7A 2ZAEA 1Y7XA 2KAFA 2LVMA 1K0SA 2JT4A 2LJ3A 4BY6B 4FYVB 1YHQA 2E64A 2XD0A 4XTXA 1K73R 1WHMA 4YTLA 2YSQA 1W6XA 3CBOA 3M9QA 3WVDB 3VS2A 2DMOA 4ORZA 2FL7A 2RH2A 1PCXA 1NJIR 1M5Q1 2FZCB 2R5MA 3OY9A 2DO3A 4HT8A 4RTXA 2I2LA 1BI0A 4OB1B 2RK1A 3PMIA 1WHGA 1IB8A 4M7AD 3CMEQ 1F1BB 1S1NA 3M56A 2E6ZA 3C0CA 1OPKA 3SWNA 4ME7A 1PSEA 1U1TA 3CBMA 2K7AA 5CKEA 1Q81R 1X75C 1AHJB 2QQBA 1CSKA 2E70A 2V1RA 2DXCA 1G3SA 2DM1A 5CQYA 2MF2A 1M2VA 1WLPB 3CC2T 4E7ZA 5KCOA 3OYGA 3V7RA 1VUBA 4JS4A 3HSBA 2LJ0A 2V8KA 4O5VA 1C6VX 3LLRA 1M27C 3M58A 2QGGA 2K4YA 3M54A 4C92D 4IURA 2PTKA 1VQKQ 1V29B 1D0YA 2GFAA 2XU8A 1N8RU 2VGMA 2ZPIB 4TVRA 1QQJA 3SWNB 2L0AA 4M78D 3CPWA 1W2BS 1MV0B 2DNUA 4M7DD 1VQ4Q 2EKHA 2FRYA 4LDVA 2DX1A 3CC7Q 1M3BA 1UGSB 3EGXB 4OB0B 1QVGP 2D6FA 1IZ6A 2VV5A 3QHSA 3I5SA 5GAN3 3A8LB 1M2VB 1X69A 2L5QA 5KYWA 3QKJA 4XTUA 3CCUT 1DJ7B 5C0MA 5FRNA 2CREA 2QA4T 2LTOA 3RR6A 1SPKA 3TU4K 1OOTA 4DBQA 4PJLA 1VQPT 1UE9A 2BKDN 3PTAA 2CT3A 4HKEA 3CMAT 1SHFA 2V8JA 4C0DC 4MMKA 2EQKA 2Z0WA 1VQ8A 3EG3A 4BE2A 2L3SA 5GJWB 1FMWA 1N27A 2JNGA 5KYWB 1AD5A 3JCMf 5IHIA 1K9MC 1SHGA 4AFZC 1WJRA 2M51A 3NTHA 3LH5A 2RHIA 3HKSA 4C5GA 3I56T 1NEBA 4Z02A 1MMNA 2LC4A 3R6OA 3JCMd 2DRMA 2A7YA 5GAMg 2AKLA 3OW2S 4BE1A 3QG1A 4BB7A 4FW1A 1XNIA 1QVFP 2HL3A 1VQOA 4XQ3A 5GAN5 5GANg 1OYXA 1VQMQ 5CCAA 3EGUA 3DB3A 1XQHA 3C4SA 1E6HA 3A8MB 4PKCC 2LT4A 1IO6A 3JCMP 3WVEB 2MMPA 2CP7A 3OS5A 1UGRB 4HVWA 3TCJA 3CC2A 1GBRA 3RUXA 3MEAA 4M7AA 4M7AC 2RMOA 4KH1B 3HRUA 2MWOA 2H8HA 3TVTA 2RQVA 2DYBA 3NMZC 4N4HA 5GMKi 1EFNA 3M55A 2K9GA 2MYSA 3SFMA 2J05A 3JB9G 2F5TX 1WIEA 2W0ZA 1Q86U 5DLOA 4A4GA 1QP3A 4KGXB 2RI2A 2LCCA 4DBHA 1VQLQ 3V8KA 5A0GA 4QQ6A 2WACA 5GAOn 2HD0A 1RLPC 4QT7A 3CCUA 2EAYA 1LJOA 3CCQT 2R57A 4L5GA 2QA4A 2EIFA 4M7AB 3HFOA 4IKFA 1FWZA 2LCLA 3QIIA 1KFZA 2CGHA 1YCYA 1VQPA 4LE9A 3G1JA 3SDZA 2EYZA 3CMAA 3SHWA 4M7DA 3M4YA 4M7DC 1SRMA 1GCQA 1GCQC 2LQNA 1UFFA 5LJ5g 2F1LA 3RKWA 1UTIA 3M0QA 3CPFA 2KNBB 2J06A 1U1SA 4FSXA 2SEMA 3I55Q 1QCNA 4M7AE 1K73C 2ENMA 1LPLA 2FPDA 3TQ7P 3I56A 2D0NA 2QG9B 1JQQA 1OX8A 4C8QA 1UB4A 1QVPA 2X3XD 1LVKA 2CZ1B 1PKSA 3CD6Q 3OYJA 2WSFE 2P0PA 2LQ8A 1BYMA 1BCOA 4FYYB 3G71T 1BBZA 1VQNQ 4M7DB 2CP2A 1K73U 1ABOA 1K4US 3EG2A 1NEGA 2EVRA 1A0NB 4BE0A 3JCMW 4BDZA 4F16A 1X43A 1VQ9T 3CCLQ 3EFSA 2DTIA 2ESWA 1NJIU 1AWJA 4PJJA 1Q81C 1WJQA 3I35A 3OA6A 1UGQB 4KUIA 3INZA 1QWEA 2GFUA 3A1PA 3PIOA 4J6YA 1VQ6Q 1WHKA 2F5KA 4E7JA 5CIUA 2FPFA 4C8QB 2KXCA 4JRPA 2EQIA 1PRLC 4FT2A 4OMFB 5FU7B 1G8XA 5I22A 3CC4T 4M7DE 2VWFA 1VQ5T 3HPWA 1U8RA 5HCKA 2KT1A 1RABB 5GAN8 3LH0A 1Q81U 1YJ9A 2OJ2A 2DYIA 3S3NA 1H8KA 3OYDA 4KH0B 2A28A 3CCSQ 1X01A 4PLLA 2L8DA 2OTLQ 4JJDA 4KULA 2BE9B 3HRTA 2L3PA 3EG0A 4JPBW 4C8QE 4KUDK 1IHWA 1NE8A 1YIJQ 2FB7A 3CCQA 2XDPA 3L2ZA 1TUDA 1M90R 4MDXA 1UG1A 1VYUA 3MJXA 4J9IA 4BACA 2KR3A 2LQKA 1CKAA 3DLLA 1RLQC 5CK9A 2XK0A 3VU3C 4WTOB 2V1QA 3QYHB 2R5AA 1YI2T 3URGA 3OYEA 2JOYA 2ATCB 2RB6A 3OSVA 1ZSZA 1YJWQ 4QKUA 4GBQA 4IUVA 5EG2A 3GLXA 1UEBA 3EG1A 3C94A 4LUEA 1U3OA 2IVWA 2O9SA 1YJNT 2FZGB 3EH2A 2LX7A 5HKCA 4RTTA 1BB9A 1T3LA 4MZTA 4A53A 3RDVA 1AOJA 1VOMA 1YJNQ 2O9VA 2E5QA 3G71A 4OVAA 2DXTA 2O2OA 1YHQQ 2ZZDA 1OV3A 5D7UA 2CT4A 2PVGB 2EWNA 2LCSA 4QVDA 3RKYA 4F7UB 1ZSZB 5LJ3g 1VQ9A 2MAMA 3X25B 1Q7YR 5GAN7 1VIFA 4E7IA 2LNHB 3ULRB 1ZUUA 3CCMQ 3TSWA 4EMHA 3LWHA 4RCCA 1JJ2S 3VRZA 1EX4A 4A4KA 4RKUE 3RNJA 3CC4A 2OTJT 1VQ5A 2K57A 5A0DA 3EFOA 4OP0A 2GTOA 4N0AC 4N0AA 3EFRA 2PVDB 2EGEA 3VS4A 2HKNA 3UWNA 3G7ZA 4F7UE 2K2VA 3FEOA 4XAXB 1SKUB 1QKXA 1WZOA 3H41A 3H0HA 3VYGA 4C5IA 2EYYA 5GMKh 3LGFA 3T9NA 2NUPB 3HL8A 2BUDA 2DFUA 4HXJA 2CP0A 4Z89A 3EG9A 1OQKA 3CCRT 4EIKA 1Y71A 3VS7A 2KT8A 1O9SA 1LCKA 4J9HA 4CC2A 3E9FA 2QK0A 1HXDA 3P8DA 1H3ZA 1K8AR 2E5KA 3JCMc 2JMCA 4JUVA 4O6JA 4PJOG 2Y4YA 3A8GB 2DE0X 2E3IA 1PD0A 1SEMA 1YI2A 2HBWA 5GANf 2HAXA 4QQGA 3UDCA 1Q82R 4FIBA 2DK3A 2MCNA 1G3WA 1M30A 4FT4A 3WXMB 4M77G 1M8MA 3VUZA 1WXTA 3JB9H 5GANd 1TTHB 3EH1A 3EG9B 4M75F 5FLXE 2QQRA 3M0UA 1JU5C 2D8JA 3GPLA 2CZ0B 3MEUA 4KGVB 1S72Q 3FJPA 1AVZC 3CEYA 3EAEA 4C0ZA 2AK5A 3NHNA 2JS2A 4OGEA 2RHYA 2MIOA 1KSWA 2ZPGB 1RACB 4CC7A 1VQ8T 2COZA 3GOXA 1FXXA 2QEXT 4XTVA 4BI4A 4JS5A 2L3QA 4QVZA 5D6WA 2E12A 3A5ZB 4R55A 3FDRA 2NWMA 4LDUA 1YITT 1V1CA 1IRXA 2JJ9A 1MV3A 3H0IA 2ED1A 2RNAA 2ZPBB 3CXCA 2V8IA 2CDTA 1KHCA 1NYGA 2DLPA 5KYYA 2LZ6B 3SWNC 4VUBA 2OTJA 3N5BB 3RMSA 8AT1B 4DOVA 1VQOT 1I4K1 3LYIA 2CP5A 3RBBB 1KC8R 3JCMe 1M1FA 3EGXA 2HQHA 1NM7A 5FWCA 4F17A 4QQDA 1IXDA 1N8RC 2EJFA 1YWOA 2F2WA 1N9RA 5LJ5f 4EMGA 4PFPA 3VKIA 2JXBA 2YUNA 3S3OA 1GRIA 1W1FA 2A08A 1FMVA 5IXBA 4OB2B 2LNVA 3JB9J 4ZTJA 5LJ5d 3LWIA 2YRDA 3CCRA 3CC2Q 3L1AA 5CKDA 3CPWS 1PWTA 2L89A 5KYYB 3JCMh 1KQSS 4HA8A 4F7UF 2KYMA 1RAEB 1AWWA 3JB9I 1D09B 2LRQA 3M59A 1OI1A 3REBB 5GMKm 1JEGA 1KHIA 1Y96A 4KBMB 4BD3A 3Q1JA 4DQ2A 2IIMA 1M90C 3TREA 3OYLA 2ED0A 2F2XA 4J5YA 2DL3A 2NUZA 3GF5A 2AZVA 4LN2A 3HTRA 2K6DA 3A8HB 2EQUA 2R58A 1WQWA 3L2UA 4C8QD 2W10A 2GQIA 3OYNA 1KJWA 2FRWA 1BCMA 3CCUQ 3GNGA 4M77F 1FMKA 2GF7A 1M90U 1J3TA 2FO0A 4QVCA 2XG8D 1KD1U 3QWYA 2QA4Q 2PU9B 3UF4A 3G6ET 4M75D 2DBKA 2JUFA 2YHTA 5IH2A 2E3HA 1VQPQ 2DTHA 5KE3A 1Y96B 2YRVA 5LJ3e 4BDYA 3VRYA 2PUKB 2QEXA 5GAOl 3CMAQ 3PFSA 4E7KA 1M1KR 4XU1A 2X4WA 5J39A 2RI3A 1YITA 3KFVA 4RCBA 3UT1A 3MP6A 1BKBA 5GAN2 2CYZB 4NL2A 2GGRA 4OMLA 2YUQA 3S6WA 2CH4A 2VC8A 2B86A 1QCOA 3CMEA 2WSCE 3I56Q 2CH4W 1Q7YC 2DEUA 5KYXB 1LNXA 5LJ3h 2YRCA 1TOVA 5CKHA 3EHRA 1UUEA 1U5SA 3BFMA 3L2QA 1D1AA 1RAIB 2RD1A 4PK4A 4XTZA 1Z9QA 2K79A 2DETA 2F2VA 5D6XA 1EZZB 2DL7A 2FEIA 1M8VA 1Q7YU 1Q86C 1H92A 2KBTA 2DF6A 3TSZA 1Y0MA 2IPOB 5KE2A 4R56A 4RG2A 1NZ9A 4FM4B 2K5LA 2YXYA 2HNIA 1QVGA 1M1GA 1K0XA 2JTEA 5KCHA 1YJ9T 2DZ9A 2BE7D 3CCVA 5LL6S 2K3XA 4MDWA 3MEVA 1WHHA 2LDMA 2AKKA 2KEAA 1RAGB 1IGUA 3QZ9B 4LDXA 2RHUA 1HJDA 5LJ3f 1N9SA 4IUTA 2EGAA 1AEYA 2ROLA 4JZ4A 4PJNA 4NOYA 1I1JA 1I5OB 2WSEE 4EPCA 2HSEB 1B3QA 1Q82C 1I81A 5GAN4 5LJ3d 2ZCFB 4ZGDB 3CCQQ 2COYA 2LP5A 1T0HA 2RQWA 3ZEHA 2DJZA 4J9BA 3G6EA 1ZBXA 4ESRA 4OB3B 1AZEA 3H9NA 1K8AU 4JJBA 1ZHIA 1QP2A 2RI5A 4A4HA 2G3RA 1Q95G 5FU6C 1D3BA 4NL3A 4X34A 3MHXA 1X2KA 1Q82U 1GFDA 1RL2A 4HCCA 3M53A 3L2VA 3RESA 4KT0E 4L6V5 4X9DA 3QBYA 3J81E 3O5ZA 4C8QC 1NPPA 1QVFA 3PMTA 2HBPA 5FU7C 3E19A 1NJIC 2FYKA 1MHNA 2X51A 3RIRA 4AMCA 4AFSC 1RI9A 4M75C 4M75A 2A37A 2CP3A 3OYAA 2KRNA 4PJMA 5FU6B 2CUBA 3G71Q 1D3BB 1VQMA 5I11A 2VXFA 2E4HA 4KRTA 2K5IA 2ZPHB 5HY6A 2AIRB 2E65A 4M7AG 1X2QA 5GMKj 4MMLA 1PNJA 1MMGA 2DZCA 4LXCA 1KC8C 1W4SA 2KE9A 1VQ9Q 4XTYA 1M2OA 1TH7A 3QJ6A 5DM7R 5IHNA 1WGSA 4II1A 1JB0E 2VUBA 3OMCA 2M9UA 3VUBA 1ZUKA 1WJSA 4QW2A 2DVJA 3OMGA 2X4YA 4M75B 4J6WA 5ECAA 2J6OA 3VS1A 4F04B 2YUOA 4IUQA 3CC4Q 1VQ5Q 1KC8U 4OMNA 3OYHA 1WNLA 1NLPC 3OYFA 1VQ7T 3JB9F 3M0TA 2LX9A 2MI6A 3DLMA 1GXIE 4C92G 4ELYC 2J7IA 3FIFA 1K76A 1PKTA 3PNWC 3QSUA 1JJ2P 1HD3A 4EDUA 2DTOA 2GNCA 2KROA 2RN8A 4M78G 2GQVA 1KD1R 1SRLA 4M7DG 3KUFA 2DXUA 1RAFB 2YLCA 4M75E 4A54A 1YBYA 1E6GA 4CRIA 1NYFA 2HZYA 4J9EA 6AT1B 2XICA 3VYHB 4F14A 3ZFJA 2ROTA 4F7UA 2RHXA 1ZSZC 4Y28E 4B9XA 1YI2Q 2ZGWA 3FRNA 1YFNA 1AWXA 2EQMA 4IUPA 5GAMe 3M0PA 1OEBA 3MKDA 3I55A 4OMMA 3LGLA 4AFUC 4LDWA 5GANe 4ZN3A 1M1KC 3H8ZA 2OAWA 2QXFA 3OBYA 3OBWA 2RQTA 2JZ2A 4FSSA 2P0KA 4Y91A 4JLGA 1Y57A 1VQNA 2FVUA 1V76A 5FW9A 1RUWA 5GAMh 3MCAB 5CVIA 1K9MR 1E7OA 4A63B 2NUPA 3BY7A 1M1KU 1B07A 5AT1B 2QDLA 4DBFA 3CCLA 3ER0A 2RJFA 2D8HA 3U23A 5GANh 4XU0A 4C0FA 1UECA 1WDXA 2DJQA 1XJWB 2ABLA 2MOXA 3M5AA 1MNEA 2KDSA 1UGVA 2JTMA 2CUDA 1P92A 3A8OB 1TS9A 2JM8A 4J83A
chains in the Genus database with same CATH topology
3F70A 2AHJB 2EFIA 4QQDA 4PKCC 1N8RC 5GMKl 2LT4A 3JCMP 3WVEB 2MMPA 2EJFA 3OS5A 5CKBA 4C92E 1UGRB 3M57A 2EYQA 1N9RA 4M77B 3TCJA 5LJ5f 2E6NA 3CCJA 4EMGA 4PL6A 2CKKA 1KQ1A 2DVEA 4OGCA 3VKIA 2DIQA 5L8RE 3CCJT 3S3OA 3E9GA 2O4XA 4MZPA 3MP1A 1VQ7A 3RUXA 1G3YA 2A3LA 3MEAA 4M7AA 4M78E 3QUIA 4M7AC 2PUOB 5D6YA 3HRUA 4OB2B 2LNVA 2MWOA 4NS5A 3JB9J 4ZTJA 4JRIA 5LJ5d 3PIPA 1H641 3LWIA 1VQLA 3DKMA 4N4HA 4DOWA 5GMKi 3CCRA 1JBMA 3BDUA 3L1AA 5CKDA 3L2WA 3M55A 1UGPB 3CPWS 1B34B 4CI0C 3CCST 2L89A 2RJEA 3JSCA 4B9WA 3P8BB 3JCMh 2XI9A 3JB9D 3TEEA 1KQSS 4C92F 4HA8A 3SFMA 4F7UF 2OTLT 4Q5WA 3JB9G 2F5TX 5A2QE 3JCMg 3JB9I 5GAOq 5KH6A 1Q86U 5DLOA 4X9CA 4A4GA 1QP3A 2LRQA 2RI2A 2LCCA 3M59A 2QQAA 4JDSA 1OI1A 2LT1A 4D6WA 5GAMf 3V8KA 5GMKm 2RHZA 4M77E 5LJ5j 2K5FA 5LJ5e 5A0GA 1KHIA 1Y96A 2WACA 2Y4XA 3BDLA 4KBMB 4M78F 4QQ6A 4BD3A 5GAOn 1PSFA 3Q1JA 4DQ2A 2HD0A 3QO3A 1M90C 3TREA 3QYGB 3OYLA 2XKOC 2RJDA 2JN0A 2QTXA 4J5YA 5GAMd 1BI1A 2EAYA 3ASKA 3CCUA 2VGNA 5IT9E 1LJOA 2O4XB 3GF5A 2R57A 4OF1A 4BI8B 3CCQT 4L5GA 4ZTFA 2QA4A 2EIFA 4M7AB 3A8HB 3HFOA 4IKFA 2EQUA 2R58A 1WQWA 3QZ5B 1FWZA 2LCLA 3L2UA 4EMKA 4EMKC 3GIBA 2E10A 3QIIA 5IN1A 4C8QD 3OYNA 2CGHA 1YCYA 4C8QG 1VQPA 3GNGA 4M77F 1YJWT 2GF7A 3SDZA 1M90U 2DAQA 4QVCA 5LJ5h 2XG8D 3CMAA 3X26B 1KD1U 4M7DA 3M4YA 4M7DC 2M1HA 1RI0A 2PU9B 3G6ET 2B8AA 5LJ5g 4M75D 1HK9A 3KBGA 3LW5E 3GP8A 2JUFA 2YHTA 4GLKA 1N6AA 1NPRA 3RKWA 2L3RA 5HK3A 4M75G 4PJOA 4PJOC 3CPFA 3V7CA 2DTHA 5KE3A 4MZMA 1Y96B 2YRVA 5LJ3j 2KK4A 5LJ3e 4BDYA 1VIEA 2IG0A 4JJNK 2PUKB 2QEXA 1U1SA 3M4GA 4FSXA 5GAOl 3SD4A 3JRZA 4XK8E 2DKGA 3C12A 4M7AE 2KQWA 3CD6A 3PFSA 1K73C 4E7KA 3VJPA 4XU1A 2X4WA 4M77A 4M77C 3V8JA 5J39A 4JRQA 2RI3A 1YITA 3I56A 4J6XA 3MP8A 4RCBA 2X4XA 3UT1A 4C8QA 3MP6A 4HCZA 1BKBA 5GAN2 1UB4A 1YHQT 2CYZB 1QVPA 4NL2A 3CXCS 3OS1A 2CZ1B 2DEQA 4EMKB 5FRMA 1YIJT 4BI3A 3S6WA 3MO8A 1BIAA 3OYJA 4RG8A 2VC8A 2WSFE 2P0PA 4A4EA 5CAIA 3OYKA 2LQ8A 1M4ZA 2D0QB 2HQEA 1BYMA 1B34A 2RJCA 4N4GA 3CMEA 2WSCE 3G71T 3CC2A 3HP9A 1Q7YC 2K3YA 4M7DB 1K73U 3CCMA 5CKFA 1LNXA 3CMET 5LJ3h 3ZBDA 3OYIA 2KSSA 4M7AF 5DLQE 3CCMT 5CKHA 4PJOB 2ZPEB 1VQ6A 3JCMV 3BFMA 5GAOm 2EKOA 3L2QA 4BE0A 3JCMW 4BDZA 2CS7A 4XU3A 2RD1A 1G3TA 3X20B 3GNFB 1VQ9T 3EFSA 2DTIA 4XTZA 5CR2A 3JCMb 2GCXA 1NJIU 1Q81C 4C5EA 1WJQA 3OA6A 1UGQB 5GMKe 4KUIA 3INZA 5D6XA 2GFUA 5DY9A 5GAOr 4ZGJB 4J6YA 3PIOA 3OS2A 1M8VA 1Q7YU 3QPHA 2F5KA 4LDYA 3JCMX 4E7JA 1Q86C 4LD9K 5CIUA 2X4JA 2M0OA 3L42A 4BUGA 3RKXA 3CCEA 4C8QB 4A4FA 1JJ2A 1Y07A 4JRPA 4FT2A 1X6OA 4OMFB 3CCET 5KE2A 5FU7B 3G4SA 3CC4T 2X35A 4M7DE 3HHTB 3HPWA 1VQ5T 3BW1A 1U8RA 4R56A 4RG2A 3G4ST 1NZ9A 3RMQA 2CZ7B 2DD5A 4FM4B 3CCSA 2HQXA 2K5LA 2HNIA 3FB9A 5GAN8 3LH0A 4PJOE 1Q81U 4HCBA 4UC4A 1IREB 1YJ9A 2OTLA 4XTWA 1QVGA 1M1GA 4C5HA 5KCHA 3S3NA 1YJ9T 3META 3OYDA 1VQKT 2DZ9A 1KQ2A 2RO0A 4JRKA 1KG1A 1YIJA 3QXEB 3CCVA 2DPPB 2CZ6B 3HRSA 5LL6S 2K3XA 2M16A 4MDWA 3MEVA 1I5LA 1X01A 4PLLA 4PLIA 3CCVT 3JAME 1XOVA 3OS0A 2L8DA 4KULA 2BIVA 2LDMA 4F7UG 3HRTA 3E1SA 1VQ4T 4M7DF 4JLIA 4C8QE 4KUDK 1KD1C 3QZ9B 4LDXA 2D9TA 1NE8A 3CC7T 2RHUA 5M9OA 2FB7A 3CCQA 5CQXA 2XDPA 4PJOF 5LJ3f 3L2ZA 2PVOB 1N9SA 4IUTA 4BY6C 1FX7A 4MDXA 4BACA 2QDYB 2VXEA 3UPUA 4NOYA 1KQSA 2F69A 2LQKA 2OAUA 2P4TA 1QW1A 2WSEE 1W2BA 4EPCA 1G5VA 1Q82C 1YJWA 4E47A 1I81A 5GAN4 5LJ3d 2ZCFB 3DLLA 4ZGDB 3L2RA 4DA4A 5CK9A 2XK0A 3VU3C 3QYHB 3ZEHA 2DJZA 3V7SA 4P5NA 3G6EA 1ZBXA 2R5AA 3HFNA 4C8QF 1YI2T 4OB3B 4GY5A 3URGA 2PQWA 1K8AU 2KMTA 1ZHIA 2JOYA 4LD6A 3OYEA 3O8VA 3OQ5A 1QP2A 2RB6A 3OSVA 2RI5A 4A4HA 2G3RA 4J7FA 4IUVA 5FU6C 5EG2A 2DD4A 1D3BA 5J26A 4C0GA 3GLXA 4NL3A 1S72A 3FLGA 1UEBA 4X34A 3C94A 3MHXA 3J80E 1S72T 2EJ9A 1Q82U 1YJNA 1RL2A 2QQ9A 4HCCA 2IVWA 1Y7XA 2KAFA 1WPYA 1YJNT 3M53A 2LVMA 3H6ZA 3L2VA 3RESA 3MEWA 1WQ7A 2RK2A 4KT0E 4BY6B 4L6V5 1YHQA 4X9DA 5HKCA 3QBYA 5FROA 3J81E 2E64A 2XD0A 4C8QC 4XTXA 1NPPA 1BI2A 4WF2A 1QVFA 4MZTA 3PMTA 4A53A 2HBPA 5FU7C 4YTLA 3E19A 1NJIC 2FYKA 3PT9A 3CBOA 1MHNA 3M9QA 3WVDB 2E5QA 3G71A 3RIRA 3PGGA 3NFCA 4OVAA 5C6SA 2DXTA 2FL7A 2RH2A 2ZZDA 4M75C 4M75A 4FU6A 1M5Q1 2R5MA 2PVGB 3OY9A 2DO3A 2EWNA 5HK0A 1OZ3A 4HT8A 4QVDA 3OYAA 2I2LA 3RKYA 1BI0A 4OB1B 4F7UB 2RK1A 3PMIA 5LJ3g 1VQ9A 2MAMA 3X25B 2DXBA 5FU6B 3X28B 5GAN7 1D3BB 1VIFA 1VQMA 4E7IA 4M7AD 2VXFA 2ZPFB 1VQMT 2XHCA 2K5IA 2ZPHB 5HY6A 4M7AG 2E65A 3CBPA 4EMHA 3M56A 3JCMQ 5GMKj 2E6ZA 3LWHA 4MMLA 4RCCA 1R8OB 2O01E 2QQSA 2DZCA 1KC8C 1JJ2S 3FC3A 3SWNA 3OW2A 4HT9A 1W4SA 4ME7A 4RKUE 4XTYA 4A4KA 1PSEA 1U1TA 1K9MU 1TH7A 3CBMA 5CKEA 3QJ6A 5CO7A 3LX7A 1X75C 3CC4A 1AHJB 2QQBA 5DM7R 2OTJT 2JTFA 1VQ5A 1WGSA 4C0DB 4II1A 5I21A 1JB0E 2K57A 5A0DA 2VUBA 4OP0A 3OMCA 3AHUA 2M9UA 2XIDA 3VUBA 4ZN1A 2E70A 4N0AC 4N0AA 3EFRA 4ZGEB 1QVGS 2PVDB 2NLUA 4V2SA 1WJSA 2DXCA 1G3SA 5CQYA 3G7ZA 2MF2A 2YLBA 4QW2A 3UWNA 2K2VA 4F7UE 3OMGA 3OYMA 2X4YA 4M75B 4J6WA 1VQKA 3FEOA 4XAXB 2C06A 4IUQA 5A0LA 2KVQG 2E41A 1KC8U 3CC2T 5KCOA 3OYGA 3V7RA 1VUBA 3ME9A 3P8HA 4JS4A 3HSBA 4O5VA 2V8KA 3VYGA 3OYHA 1WNLA 4C5IA 5GMKh 3LGFA 3OYFA 3LLRA 3QDRB 3M58A 3T9NA 4FL6A 1VQ7T 2K4YA 3VV0A 3M54A 3JB9F 3HL8A 4C92D 2LX9A 2BUDA 4IURA 1VQ4A 2MI6A 3DLMA 1GXIE 4C92G 3CC7A 1V29B 2DIGA 4ELYC 2GFAA 2XU8A 3FIFA 3V8LA 2VGMA 1N8RU 1VQLT 3CCRT 2ZPIB 3OYYA 4TVRA 1OZ2A 3PNWC 5GAOp 5AYFA 3QSUA 3SWNB 1K8AC 4M78D 2DTOA 1Y71A 4EDUA 3OYBA 3CPWA 1W2BS 2EQJA 3KXTA 4M78G 1O9SA 2GQVA 4M7DD 2H3JA 3E9FA 4LDVA 1HXDA 4M7DG 3KUFA 2DXUA 2YLCA 3P8DA 1H3ZA 4M75E 1UGSB 4A54A 4XU2A 1YBYA 4OB0B 4PJOD 3JCMc 3OYCA 1LOJA 4JUVA 4CRIA 2D6FA 4O6JA 1IZ6A 2JVVA 2Y4YA 3A8GB 4J7IA 2VV5A 3QHSA 4PJOG 5I2SA 5GAN3 3A8LB 1YI2A 1JRIA 2L5QA 5GANf 3S3MA 4QQGA 2HAXA 3QKJA 2XDBA 3UDCA 5IAYA 2XICA 3VYHB 4FIBA 2DK3A 3WXMB 1G3WA 1XTDA 4FT4A 4XTUA 3CCUT 4ELZC 2FHDA 3ZFJA 4M77D 3NTKA 1M9SA 1DJ7B 2QI2A 5C0MA 4C92C 4C92A 4F7UA 2RHXA 1O75A 4M77G 5FRNA 3VUZA 1SSFA 4Y28E 2QA4T 2LTOA 4ATOA 3JB9H 5GANd 4B9XA 2ZGWA 3FRNA 3TU4K 3J7AF 4M75F 5FLXE 2EQMA 3JCMJ 4M78C 2QQRA 4IUPA 4M78A 5GAMe 5GAMj 1VQPT 1ZQ1A 2BKDN 2Y90A 3X24B 3PTAA 3I55A 3GPLA 1QVFS 4HKEA 2CZ0B 3MEUA 3CMAT 1BI3A 2KY9A 2V8JA 3LGLA 4L59A 5J3BA 3FJPA 3I55T 3CEYA 4E7LA 3EAEA 4C0ZA 5GANj 4C0DC 4LDWA 5GANe 4ZN3A 4MMKA 1M1KC 2EQKA 3H8ZA 3OB9A 2E1HA 4OGEA 1VQ8A 2RHYA 2RA2A 2QXFA 3OBYA 4PNOA 3DB4A 3OBWA 2ZPGB 4BE2A 4IUUA 2JZ2A 1VQ8T 3GOXA 1FXXA 2QEXT 2RM4A 4XTVA 1N27A 2EJGA 2JNGA 4BI4A 4JS5A 4QVZA 5D6WA 2E12A 3JCMf 3RERA 1BIBA 2P0KA 2P0QA 3A5ZB 1K9MC 1WJRA 4R55A 3FDRA 4Y91A 1I8FA 4JLGA 3CD6T 3NTHA 1VQNA 2FVUA 2RHIA 3HKSA 4LDUA 4C5GA 4C92B 1YITT 3I56T 5GAMh 5I2MA 4Z02A 3MCAB 5CVIA 3QJYA 1VQNT 2VYTA 3NTIA 3R6OA 2LC4A 2ZPBB 3JCMd 2A7YA 3BY7A 1M1KU 5GAMg 3CXCA 3OSSC 3OW2S 2V8IA 1MGQA 2XDDA 4BE1A 4M78B 1KHCA 3CCLA 3ER0A 2RJFA 4N4IA 3QG1A 5GANh 4XU0A 4C0FA 4BB7A 3SB2A 4RMOA 4J8OA 3CCLT 1XNIA 3SWNC 3C95A 4VUBA 4XQ3A 5GAN5 1VQOA 2OTJA 3M5AA 3N5BB 3RMSA 5GANg 1OYXA 2KDSA 5CCAA 4DOVA 2MWPA 2JTMA 1VQOT 5GAN6 1I4K1 3DB3A 1XQHA 3LYIA 3JCMe 3C4SA 1M1FA 3A8MB 1P92A 3A8OB 1VQ6T 4J83A 1EIFA 4E7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F70 A;  2EFI A;  2PQW A;  3OYE A;  3OS1 A;  4LD6 A;  4QQD A;  1OZ2 A;  3O8V A;  3OQ5 A;  3PNW C;  5FRM A;  2RI5 A;  3S6W A;  4A4H A;  4EDU A;  2G3R A;  3MO8 A;  3OYB A;  3OYJ A;  2EQJ A;  4IUV A;  4A4E A;  3OYK A;  2E6N A;  5J26 A;  4PL6 A;  2CKK A;  2HQE A;  3FLG A;  2DIQ A;  4X34 A;  2RJC A;  3E9F A;  4N4G A;  3KUF A;  3S3O A;  3P8D A;  3E9G A;  2O4X A;  1H3Z A;  2K3Y A;  3MP1 A;  3MEA A;  3OYI A;  3OYC A;  5D6Y A;  4CRI A;  2LVM A;  2MWO A;  3H6Z A;  4NS5 A;  3L2V A;  4ZTJ A;  3MEW A;  2EKO A;  4N4H A;  3L2Q A;  4BE0 A;  3QBY A;  4QQG A;  5FRO A;  3QKJ A;  4BDZ A;  3L2W A;  3S3M A;  5IAY A;  2L89 A;  2RJE A;  3PMT A;  4B9W A;  2FHD A;  3NTK A;  4C5E A;  1WJQ A;  5C0M A;  3OA6 A;  2RHX A;  4Q5W A;  5FRN A;  1SSF A;  5D6X A;  1MHN A;  3M9Q A;  2E5Q A;  2GFU A;  2LTO A;  5KH6 A;  4B9X A;  3OS2 A;  4OVA A;  4A4G A;  2LRQ A;  2F5K A;  2LCC A;  2RI2 A;  5C6S A;  4E7J A;  1OI1 A;  5CIU A;  3L42 A;  2M0O A;  2RHZ A;  4FU6 A;  4A4F A;  2EQM A;  2WAC A;  3BDL A;  4QQ6 A;  4BD3 A;  2QQR A;  4IUP A;  2R5M A;  5KE2 A;  3OY9 A;  3Q1J A;  1OZ3 A;  3OYA A;  2X35 A;  3OYL A;  2RJD A;  2BKD N;  3PMI A;  4RG2 A;  3MEU A;  2HQX A;  3LGL A;  4L59 A;  3ASK A;  4E7I A;  3CEY A;  3LH0 A;  4E7L A;  3EAE A;  4GY5 A;  4UC4 A;  2O4X B;  2R57 A;  2EQK A;  3H8Z A;  3OB9 A;  4C5H A;  4ZTF A;  5KCH A;  4IKF A;  3S3N A;  2RHY A;  2EQU A;  2R58 A;  4BE2 A;  3DB4 A;  3MET A;  3OYD A;  2QQS A;  2RO0 A;  4IUU A;  3L2U A;  2JZ2 A;  3QII A;  5IN1 A;  3FC3 A;  3OYN A;  3GOX A;  2K3X A;  2M16 A;  1N27 A;  3MEV A;  4QVZ A;  5D6W A;  3QJ6 A;  4PLL A;  4PLI A;  2P0K A;  3LX7 A;  1WJR A;  3FDR A;  2GF7 A;  3OS0 A;  2DAQ A;  2JTF A;  2L8D A;  1WGS A;  3NTH A;  4II1 A;  2BIV A;  2LDM A;  2RHI A;  2M1H A;  3OMC A;  1RI0 A;  4C5G A;  2D9T A;  4Z02 A;  2RHU A;  5M9O A;  2B8A A;  2NLU A;  1WJS A;  2VYT A;  3NTI A;  2XDP A;  3UWN A;  4QW2 A;  2L3R A;  3OMG A;  3OYM A;  2X4Y A;  4IUT A;  4BAC A;  5KE3 A;  3FEO A;  2YRV A;  4IUQ A;  4BE1 A;  1KHC A;  4BDY A;  2IG0 A;  2RJF A;  4N4I A;  5KCO A;  3OYG A;  3ME9 A;  3P8H A;  3SD4 A;  1XNI A;  1G5V A;  3OYH A;  4C5I A;  3OYF A;  3LGF A;  3PFS A;  4E7K A;  3LLR A;  1OYX A;  4FL6 A;  2X4W A;  5J39 A;  2XK0 A;  2MWP A;  3L2R A;  2BUD A;  2RI3 A;  4IUR A;  3DLM A;  3DB3 A;  3LYI A;  3ZEH A;  3C4S A;  3MP8 A;  2DIG A;  2R5A A;  2X4X A;  3UT1 A;  3MP6 A;  4HCZ A;  2GFA A;  4E7H A; 
#chains in the Genus database with same CATH topology
 2P4R A;  2AHJ B;  2EFI A;  3F70 A;  9ATC B;  4D8K A;  2NYS A;  1MMD A;  2OTJ Q;  2OX7 A;  4M77 B;  2FZK B;  3I5R A;  3CCJ A;  2DVE A;  2DER A;  1GL5 A;  1PM3 A;  5L8R E;  2O4X A;  2QYZ A;  1VQ7 A;  1UDL A;  1G3Y A;  2A3L A;  4FYW B;  3QUI A;  1PG5 B;  3DKM A;  4DOW A;  1JBM A;  3BE3 A;  3L2W A;  1WHJ A;  1UGP B;  1B34 B;  4CI0 C;  1NBE B;  4B9W A;  3P8B B;  2XI9 A;  3JB9 D;  1SSH A;  4C92 F;  4Q5W A;  5A2Q E;  5GJV B;  4D6W A;  4JDS A;  5GAM f;  5LJ5 e;  3CCR Q;  2RHZ A;  4M77 E;  2K5F A;  3BDL A;  4M78 F;  1I0C A;  1PSF A;  2HSP A;  4JJC A;  2CP6 A;  2XKO C;  2JN0 A;  1G83 A;  2QTX A;  5GAM d;  1BI1 A;  3ASK A;  4ZNX A;  2SRC A;  5IT9 E;  2O4X B;  2PZ1 A;  3EGD A;  1HSQ A;  1D0Z A;  2EYW A;  4EMK A;  4EMK C;  3GIB A;  2E10 A;  3AT1 B;  5IN1 A;  2QGF B;  4AT1 B;  3CPW P;  5LJ5 h;  4LUD A;  2M1H A;  1KQS P;  1PHT A;  2DL5 A;  4J9G A;  2B8A A;  1W2B P;  3R6N A;  4IIM A;  3GP8 A;  5HK3 A;  4GLK A;  1NPR A;  1ZSG A;  2XMF A;  1YCS B;  3V7C A;  1U06 A;  4MZM A;  5LJ3 j;  2IG0 A;  4JJN K;  1QLY A;  3M4G A;  3JRZ A;  4XK8 E;  2DKG A;  3H0F A;  1D0X A;  1VYT A;  4JRQ A;  4E7S A;  2KYB A;  4RTV A;  4J6X A;  3EGD B;  3MP8 A;  1AWO A;  2X4X A;  1VQ8 Q;  2LQW A;  2QEX Q;  3CXC S;  2HCK A;  4AG2 C;  3OS1 A;  2NUT A;  4EMK B;  5FRM A;  4BI3 A;  3MO8 A;  2YUP A;  4RG8 A;  2J6F A;  1UHC A;  4A4E A;  2CSQ A;  1M4Z A;  2RJC A;  1YIT Q;  3CCM A;  5CKF A;  3CME T;  2A0F B;  3OYI A;  2KSS A;  2VKN A;  5L23 A;  2DRK A;  3JCM V;  1ACM B;  4E2F B;  2CS7 A;  2HDA A;  4XU3 A;  1K1Z A;  1G3T A;  1AT1 B;  1K9A A;  5CR2 A;  2D1X A;  3JCM b;  2GCX A;  3I9Q A;  2K3B A;  1VQO Q;  1WI7 A;  1ZA2 B;  5DY9 A;  5GAO r;  1D1B A;  3QPH A;  2O31 A;  4LDY A;  4Z88 A;  4LD9 K;  2OI3 A;  3L42 A;  3CCE A;  1RAA B;  4BUG A;  4A4F A;  1Y07 A;  1X6O A;  2NUT B;  3G4S A;  8ATC B;  1WXB A;  3M0S A;  4ATO A;  3BW1 A;  2PNI A;  3THK A;  4OMO A;  2CZ7 B;  4J9F A;  3OW2 P;  3FB9 A;  3IQL A;  4HCB A;  4UC4 A;  1X6B A;  4C5H A;  1MUZ A;  2EGC A;  3MET A;  1VQK T;  1KG1 A;  1KQ2 A;  4JRK A;  3QDF A;  2DPP B;  3HRS A;  2M16 A;  3CCV T;  3JAM E;  4DEY A;  3OS0 A;  4AFQ C;  4DEX A;  2BIV A;  1VQ4 T;  1KD1 C;  3CC7 T;  2MK5 A;  5CQX A;  2VB6 A;  3CCV Q;  4PJO F;  1YN8 A;  2QDY B;  3UPU A;  1KQS A;  2F69 A;  1QW1 A;  1W2B A;  4AG1 C;  1R77 A;  1QKW A;  2MPX C;  4E47 A;  4Z8A A;  2X9H A;  4HVV A;  3V7S A;  2QAZ A;  3HFN A;  3VS0 A;  2ECZ A;  5KYX A;  4GY5 A;  4M4Z A;  2KMT A;  4LD6 A;  2YT6 A;  2C0T A;  4J7F A;  1RAH B;  2EYX A;  2DD4 A;  5J26 A;  1S72 A;  3G6E Q;  2C0O A;  2QQ9 A;  2DL4 A;  1WHL A;  3SEM A;  1OPL A;  1WPY A;  3H6Z A;  3MEW A;  1WQ7 A;  2RK2 A;  5FRO A;  4E6R A;  2QTV A;  1ARK A;  1BI2 A;  4WF2 A;  4ANJ A;  3MPU B;  3PT9 A;  2DL8 A;  3PGG A;  3NFC A;  5C6S A;  2A36 A;  4FU6 A;  5HK0 A;  1OZ3 A;  2DXB A;  3VS6 A;  3X28 B;  1TSF A;  2ZPF B;  1VQM T;  2BTT A;  2XHC A;  1PRM C;  3CBP A;  3JCM Q;  2P84 A;  1R8O B;  2O01 E;  2QQS A;  3FC3 A;  3OW2 A;  1H3H A;  4HT9 A;  3VS5 A;  1K9M U;  2O88 A;  5CO7 A;  3LX7 A;  1B7T A;  2JTF A;  4C0D B;  5I21 A;  1KIK A;  3A98 A;  3AHU A;  2XID A;  4ZN1 A;  4ZGE B;  1QVG S;  1OU8 A;  2NLU A;  4Y92 A;  4V2S A;  2YLB A;  3OYM A;  1RAD B;  1ZUY A;  1VQK A;  2KXD A;  2C06 A;  5A0L A;  2KVQ G;  2E41 A;  1SG5 A;  1R0C B;  2GBQ A;  3ME9 A;  3P8H A;  2JW4 A;  3QDR B;  2I0N A;  4FL6 A;  3VV0 A;  1VQ4 A;  2L2P A;  2FPE A;  1YNZ A;  1YJ9 Q;  2KGT A;  3CC7 A;  2DIG A;  2BZX A;  2LMJ A;  2JM9 A;  3V8L A;  1VQL T;  3OYY A;  1OZ2 A;  5GAO p;  5AYF A;  4FW2 A;  1IGQ A;  1K8A C;  3E2U A;  1C0M A;  3OYB A;  2EQJ A;  3KXT A;  2H3J A;  1PC0 A;  2FG0 A;  4XU2 A;  4PJO D;  2HKQ B;  3OYC A;  1LOJ A;  1I07 A;  4KGZ B;  5I2S A;  2JVV A;  4J7I A;  1YP5 A;  1JRI A;  3S3M A;  1TG0 A;  2XDB A;  1WXU A;  5IAY A;  1OU9 A;  1TUG B;  1XTD A;  4ELZ C;  2FHD A;  4M77 D;  3NTK A;  1M9S A;  2QI2 A;  4C92 C;  2RQU A;  4C92 A;  1O75 A;  1SSF A;  3UA7 A;  3J7A F;  1ZLM A;  3JCM J;  4M78 C;  4M78 A;  5GAM j;  2X3W D;  1OX9 A;  1ZQ1 A;  2QAS A;  2Y90 A;  4RTZ A;  3X24 B;  1QVF S;  2YDL A;  1BI3 A;  2KY9 A;  4L59 A;  5J3B A;  1ZA1 B;  3I55 T;  4E7L A;  5GAN j;  3OB9 A;  2E1H A;  2LJ1 A;  1M3A A;  2RA2 A;  4PNO A;  3DB4 A;  1T3S A;  4IUU A;  2M02 A;  2RM4 A;  2EJG A;  1ABQ A;  3RER A;  1BIB A;  2P0Q A;  7AT1 B;  3CD6 T;  1I8F A;  4J9D A;  4CC3 A;  4C92 B;  1TXQ A;  4CC4 B;  5I2M A;  1WYX A;  1VQN T;  3QJY A;  2VYT A;  3NTI A;  2EBP A;  4R0K A;  3OSS C;  1WA7 A;  1MGQ A;  2XDD A;  1CKB A;  4M78 B;  5FWB A;  4N4I A;  4RMO A;  2JS0 A;  3SB2 A;  4J8O A;  3CCL T;  3C95 A;  1ZBJ A;  2MWP A;  5GAN 6;  2DIL A;  3FJ5 A;  2RPN A;  2BZ8 A;  1VQ6 T;  2K2M A;  1EIF A;  4E7H A;  2HL5 C;  5GMK l;  5KYN A;  4C92 E;  5CKB A;  2BZY A;  2EYQ A;  3M57 A;  2E6N A;  4PL6 A;  2CKK A;  1KQ1 A;  4OGC A;  4PFZ A;  2DIQ A;  1N8R R;  3CCJ T;  2DA9 A;  3E9G A;  4MZP A;  3MP1 A;  1R0B G;  4M78 E;  1MND A;  1GFC A;  2PUO B;  5D6Y A;  1QMC A;  4NS5 A;  4JRI A;  3PIP A;  4K11 A;  1H64 1;  1VQL A;  2KRM A;  1UHF A;  3CCJ Q;  3BDU A;  2EW3 A;  5IHK A;  3CCS T;  2RJE A;  3JSC A;  3TEE A;  1VQ7 Q;  2OTL T;  3NGP A;  3JCM g;  5GAO q;  5KH6 A;  1GBQ A;  4X9C A;  4LNP A;  1TWB A;  2QQA A;  5LJ5 j;  2LT1 A;  4WCI A;  1YIJ T;  3NPF A;  2Y4X A;  1JXO A;  1BK2 A;  4IIO A;  2HMA A;  3QO3 A;  3QYG B;  2RJD A;  3EHQ A;  4PFO A;  1D1C A;  2VGN A;  2KRS A;  4OF1 A;  3UA6 A;  1PD1 A;  4BI8 B;  4ZTF A;  3JV3 A;  3QZ5 B;  1IHV A;  2COW A;  4C8Q G;  4DBR A;  4RTU A;  3QWX X;  1YJW T;  4B6M A;  2DAQ A;  1W70 A;  3X26 B;  1RI0 A;  1T0J A;  3CQT A;  3LW5 E;  1HK9 A;  1SF9 A;  1WFW A;  3KBG A;  2RF0 A;  1N6A A;  2CSI A;  4PJO A;  2L3R A;  4PJO C;  4M75 G;  4RTW A;  1JO8 A;  2KK4 A;  1VIE A;  3SD4 A;  1HYO A;  3C12 A;  3M0R A;  1N5Z A;  2KQW A;  3CD6 A;  4RUG A;  1VA7 A;  3VJP A;  4M77 A;  4M77 C;  3V8J A;  1KK7 A;  2YWW A;  4HCZ A;  3PVQ A;  1YHQ T;  1G2B A;  2H3E B;  4X1V A;  2DEQ A;  1BIA A;  4FYX B;  5CAI A;  3OYK A;  1WX6 A;  2G6F X;  2D0Q B;  2AT1 B;  2HQE A;  1B34 A;  4N4G A;  1ZX6 A;  2JMA A;  3HP9 A;  2C0I A;  2K3Y A;  3ZBD A;  4M7A F;  5DLQ E;  3CCM T;  4HVU A;  4PJO B;  2ZPE B;  1VQ6 A;  5GAO m;  2EKO A;  1TUC A;  4J9C A;  4OMQ A;  3REA B;  3X20 B;  3GNF B;  2KI7 A;  2DBM A;  1NLO C;  4C5E A;  3GBQ A;  3ZL7 C;  5GMK e;  4ZGJ B;  3OS2 A;  1VYV A;  3JCM X;  1UJ0 A;  2VVK A;  2X4J A;  2M0O A;  3RKX A;  5IXF A;  4FCY A;  1FYN A;  1JJ2 A;  4D8D A;  3CCE T;  3CXC P;  1Z9Z A;  2X35 A;  3HHT B;  5KYU A;  1Q86 R;  3G4S T;  3RMQ A;  2DD5 A;  3CCS A;  2HQX A;  1OUL A;  1AZG B;  1QWF A;  4PJO E;  2V26 A;  2OTL A;  1IRE B;  3CCE Q;  4XTW A;  2J6K A;  1BU1 A;  3G4S Q;  2RO0 A;  1YIJ A;  2VAS A;  3QXE B;  2CZ6 B;  4RTY A;  1NG2 A;  1I5L A;  1GCP A;  4PLI A;  1XOV A;  4OMP A;  3D7S B;  4F7U G;  3E1S A;  2M0Y A;  3UAT A;  4M7D F;  4JLI A;  2D9T A;  5M9O A;  3PVL A;  3PE0 A;  1C1A A;  4GLM A;  1JXM A;  2PVO B;  4BY6 C;  1FX7 A;  1YWP A;  2VXE A;  2HEQ A;  2OAU A;  2P4T A;  3EFO B;  1M3C A;  2RQR A;  5KYU B;  2GTJ A;  1G5V A;  1QCF A;  1YJW A;  4DA4 A;  3L2R A;  1MMA A;  2AZS A;  4P5N A;  2EPD A;  4C8Q F;  4JZ3 A;  1UJY A;  1X27 A;  2PQW A;  3O8V A;  3OQ5 A;  4C0G A;  1TU0 B;  3FLG A;  3VS3 A;  3J80 E;  4HCK A;  1S72 T;  1X6G A;  2EJ9 A;  1YJN A;  5EC7 A;  2ZAE A;  1Y7X A;  2KAF A;  2LVM A;  1K0S A;  2JT4 A;  2LJ3 A;  4BY6 B;  4FYV B;  1YHQ A;  2E64 A;  2XD0 A;  4XTX A;  1K73 R;  1WHM A;  4YTL A;  2YSQ A;  1W6X A;  3CBO A;  3M9Q A;  3WVD B;  3VS2 A;  2DMO A;  4ORZ A;  2FL7 A;  2RH2 A;  1PCX A;  1NJI R;  1M5Q 1;  2FZC B;  2R5M A;  3OY9 A;  2DO3 A;  4HT8 A;  4RTX A;  2I2L A;  1BI0 A;  4OB1 B;  2RK1 A;  3PMI A;  1WHG A;  1IB8 A;  4M7A D;  3CME Q;  1F1B B;  1S1N A;  3M56 A;  2E6Z A;  3C0C A;  1OPK A;  3SWN A;  4ME7 A;  1PSE A;  1U1T A;  3CBM A;  2K7A A;  5CKE A;  1Q81 R;  1X75 C;  1AHJ B;  2QQB A;  1CSK A;  2E70 A;  2V1R A;  2DXC A;  1G3S A;  2DM1 A;  5CQY A;  2MF2 A;  1M2V A;  1WLP B;  3CC2 T;  4E7Z A;  5KCO A;  3OYG A;  3V7R A;  1VUB A;  4JS4 A;  3HSB A;  2LJ0 A;  2V8K A;  4O5V A;  1C6V X;  3LLR A;  1M27 C;  3M58 A;  2QGG A;  2K4Y A;  3M54 A;  4C92 D;  4IUR A;  2PTK A;  1VQK Q;  1V29 B;  1D0Y A;  2GFA A;  2XU8 A;  1N8R U;  2VGM A;  2ZPI B;  4TVR A;  1QQJ A;  3SWN B;  2L0A A;  4M78 D;  3CPW A;  1W2B S;  1MV0 B;  2DNU A;  4M7D D;  1VQ4 Q;  2EKH A;  2FRY A;  4LDV A;  2DX1 A;  3CC7 Q;  1M3B A;  1UGS B;  3EGX B;  4OB0 B;  1QVG P;  2D6F A;  1IZ6 A;  2VV5 A;  3QHS A;  3I5S A;  5GAN 3;  3A8L B;  1M2V B;  1X69 A;  2L5Q A;  5KYW A;  3QKJ A;  4XTU A;  3CCU T;  1DJ7 B;  5C0M A;  5FRN A;  2CRE A;  2QA4 T;  2LTO A;  3RR6 A;  1SPK A;  3TU4 K;  1OOT A;  4DBQ A;  4PJL A;  1VQP T;  1UE9 A;  2BKD N;  3PTA A;  2CT3 A;  4HKE A;  3CMA T;  1SHF A;  2V8J A;  4C0D C;  4MMK A;  2EQK A;  2Z0W A;  1VQ8 A;  3EG3 A;  4BE2 A;  2L3S A;  5GJW B;  1FMW A;  1N27 A;  2JNG A;  5KYW B;  1AD5 A;  3JCM f;  5IHI A;  1K9M C;  1SHG A;  4AFZ C;  1WJR A;  2M51 A;  3NTH A;  3LH5 A;  2RHI A;  3HKS A;  4C5G A;  3I56 T;  1NEB A;  4Z02 A;  1MMN A;  2LC4 A;  3R6O A;  3JCM d;  2DRM A;  2A7Y A;  5GAM g;  2AKL A;  3OW2 S;  4BE1 A;  3QG1 A;  4BB7 A;  4FW1 A;  1XNI A;  1QVF P;  2HL3 A;  1VQO A;  4XQ3 A;  5GAN 5;  5GAN g;  1OYX A;  1VQM Q;  5CCA A;  3EGU A;  3DB3 A;  1XQH A;  3C4S A;  1E6H A;  3A8M B;  4PKC C;  2LT4 A;  1IO6 A;  3JCM P;  3WVE B;  2MMP A;  2CP7 A;  3OS5 A;  1UGR B;  4HVW A;  3TCJ A;  3CC2 A;  1GBR A;  3RUX A;  3MEA A;  4M7A A;  4M7A C;  2RMO A;  4KH1 B;  3HRU A;  2MWO A;  2H8H A;  3TVT A;  2RQV A;  2DYB A;  3NMZ C;  4N4H A;  5GMK i;  1EFN A;  3M55 A;  2K9G A;  2MYS A;  3SFM A;  2J05 A;  3JB9 G;  2F5T X;  1WIE A;  2W0Z A;  1Q86 U;  5DLO A;  4A4G A;  1QP3 A;  4KGX B;  2RI2 A;  2LCC A;  4DBH A;  1VQL Q;  3V8K A;  5A0G A;  4QQ6 A;  2WAC A;  5GAO n;  2HD0 A;  1RLP C;  4QT7 A;  3CCU A;  2EAY A;  1LJO A;  3CCQ T;  2R57 A;  4L5G A;  2QA4 A;  2EIF A;  4M7A B;  3HFO A;  4IKF A;  1FWZ A;  2LCL A;  3QII A;  1KFZ A;  2CGH A;  1YCY A;  1VQP A;  4LE9 A;  3G1J A;  3SDZ A;  2EYZ A;  3CMA A;  3SHW A;  4M7D A;  3M4Y A;  4M7D C;  1SRM A;  1GCQ A;  1GCQ C;  2LQN A;  1UFF A;  5LJ5 g;  2F1L A;  3RKW A;  1UTI A;  3M0Q A;  3CPF A;  2KNB B;  2J06 A;  1U1S A;  4FSX A;  2SEM A;  3I55 Q;  1QCN A;  4M7A E;  1K73 C;  2ENM A;  1LPL A;  2FPD A;  3TQ7 P;  3I56 A;  2D0N A;  2QG9 B;  1JQQ A;  1OX8 A;  4C8Q A;  1UB4 A;  1QVP A;  2X3X D;  1LVK A;  2CZ1 B;  1PKS A;  3CD6 Q;  3OYJ A;  2WSF E;  2P0P A;  2LQ8 A;  1BYM A;  1BCO A;  4FYY B;  3G71 T;  1BBZ A;  1VQN Q;  4M7D B;  2CP2 A;  1K73 U;  1ABO A;  1K4U S;  3EG2 A;  1NEG A;  2EVR A;  1A0N B;  4BE0 A;  3JCM W;  4BDZ A;  4F16 A;  1X43 A;  1VQ9 T;  3CCL Q;  3EFS A;  2DTI A;  2ESW A;  1NJI U;  1AWJ A;  4PJJ A;  1Q81 C;  1WJQ A;  3I35 A;  3OA6 A;  1UGQ B;  4KUI A;  3INZ A;  1QWE A;  2GFU A;  3A1P A;  3PIO A;  4J6Y A;  1VQ6 Q;  1WHK A;  2F5K A;  4E7J A;  5CIU A;  2FPF A;  4C8Q B;  2KXC A;  4JRP A;  2EQI A;  1PRL C;  4FT2 A;  4OMF B;  5FU7 B;  1G8X A;  5I22 A;  3CC4 T;  4M7D E;  2VWF A;  1VQ5 T;  3HPW A;  1U8R A;  5HCK A;  2KT1 A;  1RAB B;  5GAN 8;  3LH0 A;  1Q81 U;  1YJ9 A;  2OJ2 A;  2DYI A;  3S3N A;  1H8K A;  3OYD A;  4KH0 B;  2A28 A;  3CCS Q;  1X01 A;  4PLL A;  2L8D A;  2OTL Q;  4JJD A;  4KUL A;  2BE9 B;  3HRT A;  2L3P A;  3EG0 A;  4JPB W;  4C8Q E;  4KUD K;  1IHW A;  1NE8 A;  1YIJ Q;  2FB7 A;  3CCQ A;  2XDP A;  3L2Z A;  1TUD A;  1M90 R;  4MDX A;  1UG1 A;  1VYU A;  3MJX A;  4J9I A;  4BAC A;  2KR3 A;  2LQK A;  1CKA A;  3DLL A;  1RLQ C;  5CK9 A;  2XK0 A;  3VU3 C;  4WTO B;  2V1Q A;  3QYH B;  2R5A A;  1YI2 T;  3URG A;  3OYE A;  2JOY A;  2ATC B;  2RB6 A;  3OSV A;  1ZSZ A;  1YJW Q;  4QKU A;  4GBQ A;  4IUV A;  5EG2 A;  3GLX A;  1UEB A;  3EG1 A;  3C94 A;  4LUE A;  1U3O A;  2IVW A;  2O9S A;  1YJN T;  2FZG B;  3EH2 A;  2LX7 A;  5HKC A;  4RTT A;  1BB9 A;  1T3L A;  4MZT A;  4A53 A;  3RDV A;  1AOJ A;  1VOM A;  1YJN Q;  2O9V A;  2E5Q A;  3G71 A;  4OVA A;  2DXT A;  2O2O A;  1YHQ Q;  2ZZD A;  1OV3 A;  5D7U A;  2CT4 A;  2PVG B;  2EWN A;  2LCS A;  4QVD A;  3RKY A;  4F7U B;  1ZSZ B;  5LJ3 g;  1VQ9 A;  2MAM A;  3X25 B;  1Q7Y R;  5GAN 7;  1VIF A;  4E7I A;  2LNH B;  3ULR B;  1ZUU A;  3CCM Q;  3TSW A;  4EMH A;  3LWH A;  4RCC A;  1JJ2 S;  3VRZ A;  1EX4 A;  4A4K A;  4RKU E;  3RNJ A;  3CC4 A;  2OTJ T;  1VQ5 A;  2K57 A;  5A0D A;  3EFO A;  4OP0 A;  2GTO A;  4N0A C;  4N0A A;  3EFR A;  2PVD B;  2EGE A;  3VS4 A;  2HKN A;  3UWN A;  3G7Z A;  4F7U E;  2K2V A;  3FEO A;  4XAX B;  1SKU B;  1QKX A;  1WZO A;  3H41 A;  3H0H A;  3VYG A;  4C5I A;  2EYY A;  5GMK h;  3LGF A;  3T9N A;  2NUP B;  3HL8 A;  2BUD A;  2DFU A;  4HXJ A;  2CP0 A;  4Z89 A;  3EG9 A;  1OQK A;  3CCR T;  4EIK A;  1Y71 A;  3VS7 A;  2KT8 A;  1O9S A;  1LCK A;  4J9H A;  4CC2 A;  3E9F A;  2QK0 A;  1HXD A;  3P8D A;  1H3Z A;  1K8A R;  2E5K A;  3JCM c;  2JMC A;  4JUV A;  4O6J A;  4PJO G;  2Y4Y A;  3A8G B;  2DE0 X;  2E3I A;  1PD0 A;  1SEM A;  1YI2 A;  2HBW A;  5GAN f;  2HAX A;  4QQG A;  3UDC A;  1Q82 R;  4FIB A;  2DK3 A;  2MCN A;  1G3W A;  1M30 A;  4FT4 A;  3WXM B;  4M77 G;  1M8M A;  3VUZ A;  1WXT A;  3JB9 H;  5GAN d;  1TTH B;  3EH1 A;  3EG9 B;  4M75 F;  5FLX E;  2QQR A;  3M0U A;  1JU5 C;  2D8J A;  3GPL A;  2CZ0 B;  3MEU A;  4KGV B;  1S72 Q;  3FJP A;  1AVZ C;  3CEY A;  3EAE A;  4C0Z A;  2AK5 A;  3NHN A;  2JS2 A;  4OGE A;  2RHY A;  2MIO A;  1KSW A;  2ZPG B;  1RAC B;  4CC7 A;  1VQ8 T;  2COZ A;  3GOX A;  1FXX A;  2QEX T;  4XTV A;  4BI4 A;  4JS5 A;  2L3Q A;  4QVZ A;  5D6W A;  2E12 A;  3A5Z B;  4R55 A;  3FDR A;  2NWM A;  4LDU A;  1YIT T;  1V1C A;  1IRX A;  2JJ9 A;  1MV3 A;  3H0I A;  2ED1 A;  2RNA A;  2ZPB B;  3CXC A;  2V8I A;  2CDT A;  1KHC A;  1NYG A;  2DLP A;  5KYY A;  2LZ6 B;  3SWN C;  4VUB A;  2OTJ A;  3N5B B;  3RMS A;  8AT1 B;  4DOV A;  1VQO T;  1I4K 1;  3LYI A;  2CP5 A;  3RBB B;  1KC8 R;  3JCM e;  1M1F A;  3EGX A;  2HQH A;  1NM7 A;  5FWC A;  4F17 A;  4QQD A;  1IXD A;  1N8R C;  2EJF A;  1YWO A;  2F2W A;  1N9R A;  5LJ5 f;  4EMG A;  4PFP A;  3VKI A;  2JXB A;  2YUN A;  3S3O A;  1GRI A;  1W1F A;  2A08 A;  1FMV A;  5IXB A;  4OB2 B;  2LNV A;  3JB9 J;  4ZTJ A;  5LJ5 d;  3LWI A;  2YRD A;  3CCR A;  3CC2 Q;  3L1A A;  5CKD A;  3CPW S;  1PWT A;  2L89 A;  5KYY B;  3JCM h;  1KQS S;  4HA8 A;  4F7U F;  2KYM A;  1RAE B;  1AWW A;  3JB9 I;  1D09 B;  2LRQ A;  3M59 A;  1OI1 A;  3REB B;  5GMK m;  1JEG A;  1KHI A;  1Y96 A;  4KBM B;  4BD3 A;  3Q1J A;  4DQ2 A;  2IIM A;  1M90 C;  3TRE A;  3OYL A;  2ED0 A;  2F2X A;  4J5Y A;  2DL3 A;  2NUZ A;  3GF5 A;  2AZV A;  4LN2 A;  3HTR A;  2K6D A;  3A8H B;  2EQU A;  2R58 A;  1WQW A;  3L2U A;  4C8Q D;  2W10 A;  2GQI A;  3OYN A;  1KJW A;  2FRW A;  1BCM A;  3CCU Q;  3GNG A;  4M77 F;  1FMK A;  2GF7 A;  1M90 U;  1J3T A;  2FO0 A;  4QVC A;  2XG8 D;  1KD1 U;  3QWY A;  2QA4 Q;  2PU9 B;  3UF4 A;  3G6E T;  4M75 D;  2DBK A;  2JUF A;  2YHT A;  5IH2 A;  2E3H A;  1VQP Q;  2DTH A;  5KE3 A;  1Y96 B;  2YRV A;  5LJ3 e;  4BDY A;  3VRY A;  2PUK B;  2QEX A;  5GAO l;  3CMA Q;  3PFS A;  4E7K A;  1M1K R;  4XU1 A;  2X4W A;  5J39 A;  2RI3 A;  1YIT A;  3KFV A;  4RCB A;  3UT1 A;  3MP6 A;  1BKB A;  5GAN 2;  2CYZ B;  4NL2 A;  2GGR A;  4OML A;  2YUQ A;  3S6W A;  2CH4 A;  2VC8 A;  2B86 A;  1QCO A;  3CME A;  2WSC E;  3I56 Q;  2CH4 W;  1Q7Y C;  2DEU A;  5KYX B;  1LNX A;  5LJ3 h;  2YRC A;  1TOV A;  5CKH A;  3EHR A;  1UUE A;  1U5S A;  3BFM A;  3L2Q A;  1D1A A;  1RAI B;  2RD1 A;  4PK4 A;  4XTZ A;  1Z9Q A;  2K79 A;  2DET A;  2F2V A;  5D6X A;  1EZZ B;  2DL7 A;  2FEI A;  1M8V A;  1Q7Y U;  1Q86 C;  1H92 A;  2KBT A;  2DF6 A;  3TSZ A;  1Y0M A;  2IPO B;  5KE2 A;  4R56 A;  4RG2 A;  1NZ9 A;  4FM4 B;  2K5L A;  2YXY A;  2HNI A;  1QVG A;  1M1G A;  1K0X A;  2JTE A;  5KCH A;  1YJ9 T;  2DZ9 A;  2BE7 D;  3CCV A;  5LL6 S;  2K3X A;  4MDW A;  3MEV A;  1WHH A;  2LDM A;  2AKK A;  2KEA A;  1RAG B;  1IGU A;  3QZ9 B;  4LDX A;  2RHU A;  1HJD A;  5LJ3 f;  1N9S A;  4IUT A;  2EGA A;  1AEY A;  2ROL A;  4JZ4 A;  4PJN A;  4NOY A;  1I1J A;  1I5O B;  2WSE E;  4EPC A;  2HSE B;  1B3Q A;  1Q82 C;  1I81 A;  5GAN 4;  5LJ3 d;  2ZCF B;  4ZGD B;  3CCQ Q;  2COY A;  2LP5 A;  1T0H A;  2RQW A;  3ZEH A;  2DJZ A;  4J9B A;  3G6E A;  1ZBX A;  4ESR A;  4OB3 B;  1AZE A;  3H9N A;  1K8A U;  4JJB A;  1ZHI A;  1QP2 A;  2RI5 A;  4A4H A;  2G3R A;  1Q95 G;  5FU6 C;  1D3B A;  4NL3 A;  4X34 A;  3MHX A;  1X2K A;  1Q82 U;  1GFD A;  1RL2 A;  4HCC A;  3M53 A;  3L2V A;  3RES A;  4KT0 E;  4L6V 5;  4X9D A;  3QBY A;  3J81 E;  3O5Z A;  4C8Q C;  1NPP A;  1QVF A;  3PMT A;  2HBP A;  5FU7 C;  3E19 A;  1NJI C;  2FYK A;  1MHN A;  2X51 A;  3RIR A;  4AMC A;  4AFS C;  1RI9 A;  4M75 C;  4M75 A;  2A37 A;  2CP3 A;  3OYA A;  2KRN A;  4PJM A;  5FU6 B;  2CUB A;  3G71 Q;  1D3B B;  1VQM A;  5I11 A;  2VXF A;  2E4H A;  4KRT A;  2K5I A;  2ZPH B;  5HY6 A;  2AIR B;  2E65 A;  4M7A G;  1X2Q A;  5GMK j;  4MML A;  1PNJ A;  1MMG A;  2DZC A;  4LXC A;  1KC8 C;  1W4S A;  2KE9 A;  1VQ9 Q;  4XTY A;  1M2O A;  1TH7 A;  3QJ6 A;  5DM7 R;  5IHN A;  1WGS A;  4II1 A;  1JB0 E;  2VUB A;  3OMC A;  2M9U A;  3VUB A;  1ZUK A;  1WJS A;  4QW2 A;  2DVJ A;  3OMG A;  2X4Y A;  4M75 B;  4J6W A;  5ECA A;  2J6O A;  3VS1 A;  4F04 B;  2YUO A;  4IUQ A;  3CC4 Q;  1VQ5 Q;  1KC8 U;  4OMN A;  3OYH A;  1WNL A;  1NLP C;  3OYF A;  1VQ7 T;  3JB9 F;  3M0T A;  2LX9 A;  2MI6 A;  3DLM A;  1GXI E;  4C92 G;  4ELY C;  2J7I A;  3FIF A;  1K76 A;  1PKT A;  3PNW C;  3QSU A;  1JJ2 P;  1HD3 A;  4EDU A;  2DTO A;  2GNC A;  2KRO A;  2RN8 A;  4M78 G;  2GQV A;  1KD1 R;  1SRL A;  4M7D G;  3KUF A;  2DXU A;  1RAF B;  2YLC A;  4M75 E;  4A54 A;  1YBY A;  1E6G A;  4CRI A;  1NYF A;  2HZY A;  4J9E A;  6AT1 B;  2XIC A;  3VYH B;  4F14 A;  3ZFJ A;  2ROT A;  4F7U A;  2RHX A;  1ZSZ C;  4Y28 E;  4B9X A;  1YI2 Q;  2ZGW A;  3FRN A;  1YFN A;  1AWX A;  2EQM A;  4IUP A;  5GAM e;  3M0P A;  1OEB A;  3MKD A;  3I55 A;  4OMM A;  3LGL A;  4AFU C;  4LDW A;  5GAN e;  4ZN3 A;  1M1K C;  3H8Z A;  2OAW A;  2QXF A;  3OBY A;  3OBW A;  2RQT A;  2JZ2 A;  4FSS A;  2P0K A;  4Y91 A;  4JLG A;  1Y57 A;  1VQN A;  2FVU A;  1V76 A;  5FW9 A;  1RUW A;  5GAM h;  3MCA B;  5CVI A;  1K9M R;  1E7O A;  4A63 B;  2NUP A;  3BY7 A;  1M1K U;  1B07 A;  5AT1 B;  2QDL A;  4DBF A;  3CCL A;  3ER0 A;  2RJF A;  2D8H A;  3U23 A;  5GAN h;  4XU0 A;  4C0F A;  1UEC A;  1WDX A;  2DJQ A;  1XJW B;  2ABL A;  2MOX A;  3M5A A;  1MNE A;  2KDS A;  1UGV A;  2JTM A;  2CUD A;  1P92 A;  3A8O B;  1TS9 A;  2JM8 A;  4J83 A; 
#chains in the Genus database with same CATH homology
 3F70 A;  2AHJ B;  2EFI A;  4QQD A;  4PKC C;  1N8R C;  5GMK l;  2LT4 A;  3JCM P;  3WVE B;  2MMP A;  2EJF A;  3OS5 A;  5CKB A;  4C92 E;  1UGR B;  3M57 A;  2EYQ A;  1N9R A;  4M77 B;  3TCJ A;  5LJ5 f;  2E6N A;  3CCJ A;  4EMG A;  4PL6 A;  2CKK A;  1KQ1 A;  2DVE A;  4OGC A;  3VKI A;  2DIQ A;  5L8R E;  3CCJ T;  3S3O A;  3E9G A;  2O4X A;  4MZP A;  3MP1 A;  1VQ7 A;  3RUX A;  1G3Y A;  2A3L A;  3MEA A;  4M7A A;  4M78 E;  3QUI A;  4M7A C;  2PUO B;  5D6Y A;  3HRU A;  4OB2 B;  2LNV A;  2MWO A;  4NS5 A;  3JB9 J;  4ZTJ A;  4JRI A;  5LJ5 d;  3PIP A;  1H64 1;  3LWI A;  1VQL A;  3DKM A;  4N4H A;  4DOW A;  5GMK i;  3CCR A;  1JBM A;  3BDU A;  3L1A A;  5CKD A;  3L2W A;  3M55 A;  1UGP B;  3CPW S;  1B34 B;  4CI0 C;  3CCS T;  2L89 A;  2RJE A;  3JSC A;  4B9W A;  3P8B B;  3JCM h;  2XI9 A;  3JB9 D;  3TEE A;  1KQS S;  4C92 F;  4HA8 A;  3SFM A;  4F7U F;  2OTL T;  4Q5W A;  3JB9 G;  2F5T X;  5A2Q E;  3JCM g;  3JB9 I;  5GAO q;  5KH6 A;  1Q86 U;  5DLO A;  4X9C A;  4A4G A;  1QP3 A;  2LRQ A;  2RI2 A;  2LCC A;  3M59 A;  2QQA A;  4JDS A;  1OI1 A;  2LT1 A;  4D6W A;  5GAM f;  3V8K A;  5GMK m;  2RHZ A;  4M77 E;  5LJ5 j;  2K5F A;  5LJ5 e;  5A0G A;  1KHI A;  1Y96 A;  2WAC A;  2Y4X A;  3BDL A;  4KBM B;  4M78 F;  4QQ6 A;  4BD3 A;  5GAO n;  1PSF A;  3Q1J A;  4DQ2 A;  2HD0 A;  3QO3 A;  1M90 C;  3TRE A;  3QYG B;  3OYL A;  2XKO C;  2RJD A;  2JN0 A;  2QTX A;  4J5Y A;  5GAM d;  1BI1 A;  2EAY A;  3ASK A;  3CCU A;  2VGN A;  5IT9 E;  1LJO A;  2O4X B;  3GF5 A;  2R57 A;  4OF1 A;  4BI8 B;  3CCQ T;  4L5G A;  4ZTF A;  2QA4 A;  2EIF A;  4M7A B;  3A8H B;  3HFO A;  4IKF A;  2EQU A;  2R58 A;  1WQW A;  3QZ5 B;  1FWZ A;  2LCL A;  3L2U A;  4EMK A;  4EMK C;  3GIB A;  2E10 A;  3QII A;  5IN1 A;  4C8Q D;  3OYN A;  2CGH A;  1YCY A;  4C8Q G;  1VQP A;  3GNG A;  4M77 F;  1YJW T;  2GF7 A;  3SDZ A;  1M90 U;  2DAQ A;  4QVC A;  5LJ5 h;  2XG8 D;  3CMA A;  3X26 B;  1KD1 U;  4M7D A;  3M4Y A;  4M7D C;  2M1H A;  1RI0 A;  2PU9 B;  3G6E T;  2B8A A;  5LJ5 g;  4M75 D;  1HK9 A;  3KBG A;  3LW5 E;  3GP8 A;  2JUF A;  2YHT A;  4GLK A;  1N6A A;  1NPR A;  3RKW A;  2L3R A;  5HK3 A;  4M75 G;  4PJO A;  4PJO C;  3CPF A;  3V7C A;  2DTH A;  5KE3 A;  4MZM A;  1Y96 B;  2YRV A;  5LJ3 j;  2KK4 A;  5LJ3 e;  4BDY A;  1VIE A;  2IG0 A;  4JJN K;  2PUK B;  2QEX A;  1U1S A;  3M4G A;  4FSX A;  5GAO l;  3SD4 A;  3JRZ A;  4XK8 E;  2DKG A;  3C12 A;  4M7A E;  2KQW A;  3CD6 A;  3PFS A;  1K73 C;  4E7K A;  3VJP A;  4XU1 A;  2X4W A;  4M77 A;  4M77 C;  3V8J A;  5J39 A;  4JRQ A;  2RI3 A;  1YIT A;  3I56 A;  4J6X A;  3MP8 A;  4RCB A;  2X4X A;  3UT1 A;  4C8Q A;  3MP6 A;  4HCZ A;  1BKB A;  5GAN 2;  1UB4 A;  1YHQ T;  2CYZ B;  1QVP A;  4NL2 A;  3CXC S;  3OS1 A;  2CZ1 B;  2DEQ A;  4EMK B;  5FRM A;  1YIJ T;  4BI3 A;  3S6W A;  3MO8 A;  1BIA A;  3OYJ A;  4RG8 A;  2VC8 A;  2WSF E;  2P0P A;  4A4E A;  5CAI A;  3OYK A;  2LQ8 A;  1M4Z A;  2D0Q B;  2HQE A;  1BYM A;  1B34 A;  2RJC A;  4N4G A;  3CME A;  2WSC E;  3G71 T;  3CC2 A;  3HP9 A;  1Q7Y C;  2K3Y A;  4M7D B;  1K73 U;  3CCM A;  5CKF A;  1LNX A;  3CME T;  5LJ3 h;  3ZBD A;  3OYI A;  2KSS A;  4M7A F;  5DLQ E;  3CCM T;  5CKH A;  4PJO B;  2ZPE B;  1VQ6 A;  3JCM V;  3BFM A;  5GAO m;  2EKO A;  3L2Q A;  4BE0 A;  3JCM W;  4BDZ A;  2CS7 A;  4XU3 A;  2RD1 A;  1G3T A;  3X20 B;  3GNF B;  1VQ9 T;  3EFS A;  2DTI A;  4XTZ A;  5CR2 A;  3JCM b;  2GCX A;  1NJI U;  1Q81 C;  4C5E A;  1WJQ A;  3OA6 A;  1UGQ B;  5GMK e;  4KUI A;  3INZ A;  5D6X A;  2GFU A;  5DY9 A;  5GAO r;  4ZGJ B;  4J6Y A;  3PIO A;  3OS2 A;  1M8V A;  1Q7Y U;  3QPH A;  2F5K A;  4LDY A;  3JCM X;  4E7J A;  1Q86 C;  4LD9 K;  5CIU A;  2X4J A;  2M0O A;  3L42 A;  4BUG A;  3RKX A;  3CCE A;  4C8Q B;  4A4F A;  1JJ2 A;  1Y07 A;  4JRP A;  4FT2 A;  1X6O A;  4OMF B;  3CCE T;  5KE2 A;  5FU7 B;  3G4S A;  3CC4 T;  2X35 A;  4M7D E;  3HHT B;  3HPW A;  1VQ5 T;  3BW1 A;  1U8R A;  4R56 A;  4RG2 A;  3G4S T;  1NZ9 A;  3RMQ A;  2CZ7 B;  2DD5 A;  4FM4 B;  3CCS A;  2HQX A;  2K5L A;  2HNI A;  3FB9 A;  5GAN 8;  3LH0 A;  4PJO E;  1Q81 U;  4HCB A;  4UC4 A;  1IRE B;  1YJ9 A;  2OTL A;  4XTW A;  1QVG A;  1M1G A;  4C5H A;  5KCH A;  3S3N A;  1YJ9 T;  3MET A;  3OYD A;  1VQK T;  2DZ9 A;  1KQ2 A;  2RO0 A;  4JRK A;  1KG1 A;  1YIJ A;  3QXE B;  3CCV A;  2DPP B;  2CZ6 B;  3HRS A;  5LL6 S;  2K3X A;  2M16 A;  4MDW A;  3MEV A;  1I5L A;  1X01 A;  4PLL A;  4PLI A;  3CCV T;  3JAM E;  1XOV A;  3OS0 A;  2L8D A;  4KUL A;  2BIV A;  2LDM A;  4F7U G;  3HRT A;  3E1S A;  1VQ4 T;  4M7D F;  4JLI A;  4C8Q E;  4KUD K;  1KD1 C;  3QZ9 B;  4LDX A;  2D9T A;  1NE8 A;  3CC7 T;  2RHU A;  5M9O A;  2FB7 A;  3CCQ A;  5CQX A;  2XDP A;  4PJO F;  5LJ3 f;  3L2Z A;  2PVO B;  1N9S A;  4IUT A;  4BY6 C;  1FX7 A;  4MDX A;  4BAC A;  2QDY B;  2VXE A;  3UPU A;  4NOY A;  1KQS A;  2F69 A;  2LQK A;  2OAU A;  2P4T A;  1QW1 A;  2WSE E;  1W2B A;  4EPC A;  1G5V A;  1Q82 C;  1YJW A;  4E47 A;  1I81 A;  5GAN 4;  5LJ3 d;  2ZCF B;  3DLL A;  4ZGD B;  3L2R A;  4DA4 A;  5CK9 A;  2XK0 A;  3VU3 C;  3QYH B;  3ZEH A;  2DJZ A;  3V7S A;  4P5N A;  3G6E A;  1ZBX A;  2R5A A;  3HFN A;  4C8Q F;  1YI2 T;  4OB3 B;  4GY5 A;  3URG A;  2PQW A;  1K8A U;  2KMT A;  1ZHI A;  2JOY A;  4LD6 A;  3OYE A;  3O8V A;  3OQ5 A;  1QP2 A;  2RB6 A;  3OSV A;  2RI5 A;  4A4H A;  2G3R A;  4J7F A;  4IUV A;  5FU6 C;  5EG2 A;  2DD4 A;  1D3B A;  5J26 A;  4C0G A;  3GLX A;  4NL3 A;  1S72 A;  3FLG A;  1UEB A;  4X34 A;  3C94 A;  3MHX A;  3J80 E;  1S72 T;  2EJ9 A;  1Q82 U;  1YJN A;  1RL2 A;  2QQ9 A;  4HCC A;  2IVW A;  1Y7X A;  2KAF A;  1WPY A;  1YJN T;  3M53 A;  2LVM A;  3H6Z A;  3L2V A;  3RES A;  3MEW A;  1WQ7 A;  2RK2 A;  4KT0 E;  4BY6 B;  4L6V 5;  1YHQ A;  4X9D A;  5HKC A;  3QBY A;  5FRO A;  3J81 E;  2E64 A;  2XD0 A;  4C8Q C;  4XTX A;  1NPP A;  1BI2 A;  4WF2 A;  1QVF A;  4MZT A;  3PMT A;  4A53 A;  2HBP A;  5FU7 C;  4YTL A;  3E19 A;  1NJI C;  2FYK A;  3PT9 A;  3CBO A;  1MHN A;  3M9Q A;  3WVD B;  2E5Q A;  3G71 A;  3RIR A;  3PGG A;  3NFC A;  4OVA A;  5C6S A;  2DXT A;  2FL7 A;  2RH2 A;  2ZZD A;  4M75 C;  4M75 A;  4FU6 A;  1M5Q 1;  2R5M A;  2PVG B;  3OY9 A;  2DO3 A;  2EWN A;  5HK0 A;  1OZ3 A;  4HT8 A;  4QVD A;  3OYA A;  2I2L A;  3RKY A;  1BI0 A;  4OB1 B;  4F7U B;  2RK1 A;  3PMI A;  5LJ3 g;  1VQ9 A;  2MAM A;  3X25 B;  2DXB A;  5FU6 B;  3X28 B;  5GAN 7;  1D3B B;  1VIF A;  1VQM A;  4E7I A;  4M7A D;  2VXF A;  2ZPF B;  1VQM T;  2XHC A;  2K5I A;  2ZPH B;  5HY6 A;  4M7A G;  2E65 A;  3CBP A;  4EMH A;  3M56 A;  3JCM Q;  5GMK j;  2E6Z A;  3LWH A;  4MML A;  4RCC A;  1R8O B;  2O01 E;  2QQS A;  2DZC A;  1KC8 C;  1JJ2 S;  3FC3 A;  3SWN A;  3OW2 A;  4HT9 A;  1W4S A;  4ME7 A;  4RKU E;  4XTY A;  4A4K A;  1PSE A;  1U1T A;  1K9M U;  1TH7 A;  3CBM A;  5CKE A;  3QJ6 A;  5CO7 A;  3LX7 A;  1X75 C;  3CC4 A;  1AHJ B;  2QQB A;  5DM7 R;  2OTJ T;  2JTF A;  1VQ5 A;  1WGS A;  4C0D B;  4II1 A;  5I21 A;  1JB0 E;  2K57 A;  5A0D A;  2VUB A;  4OP0 A;  3OMC A;  3AHU A;  2M9U A;  2XID A;  3VUB A;  4ZN1 A;  2E70 A;  4N0A C;  4N0A A;  3EFR A;  4ZGE B;  1QVG S;  2PVD B;  2NLU A;  4V2S A;  1WJS A;  2DXC A;  1G3S A;  5CQY A;  3G7Z A;  2MF2 A;  2YLB A;  4QW2 A;  3UWN A;  2K2V A;  4F7U E;  3OMG A;  3OYM A;  2X4Y A;  4M75 B;  4J6W A;  1VQK A;  3FEO A;  4XAX B;  2C06 A;  4IUQ A;  5A0L A;  2KVQ G;  2E41 A;  1KC8 U;  3CC2 T;  5KCO A;  3OYG A;  3V7R A;  1VUB A;  3ME9 A;  3P8H A;  4JS4 A;  3HSB A;  4O5V A;  2V8K A;  3VYG A;  3OYH A;  1WNL A;  4C5I A;  5GMK h;  3LGF A;  3OYF A;  3LLR A;  3QDR B;  3M58 A;  3T9N A;  4FL6 A;  1VQ7 T;  2K4Y A;  3VV0 A;  3M54 A;  3JB9 F;  3HL8 A;  4C92 D;  2LX9 A;  2BUD A;  4IUR A;  1VQ4 A;  2MI6 A;  3DLM A;  1GXI E;  4C92 G;  3CC7 A;  1V29 B;  2DIG A;  4ELY C;  2GFA A;  2XU8 A;  3FIF A;  3V8L A;  2VGM A;  1N8R U;  1VQL T;  3CCR T;  2ZPI B;  3OYY A;  4TVR A;  1OZ2 A;  3PNW C;  5GAO p;  5AYF A;  3QSU A;  3SWN B;  1K8A C;  4M78 D;  2DTO A;  1Y71 A;  4EDU A;  3OYB A;  3CPW A;  1W2B S;  2EQJ A;  3KXT A;  4M78 G;  1O9S A;  2GQV A;  4M7D D;  2H3J A;  3E9F A;  4LDV A;  1HXD A;  4M7D G;  3KUF A;  2DXU A;  2YLC A;  3P8D A;  1H3Z A;  4M75 E;  1UGS B;  4A54 A;  4XU2 A;  1YBY A;  4OB0 B;  4PJO D;  3JCM c;  3OYC A;  1LOJ A;  4JUV A;  4CRI A;  2D6F A;  4O6J A;  1IZ6 A;  2JVV A;  2Y4Y A;  3A8G B;  4J7I A;  2VV5 A;  3QHS A;  4PJO G;  5I2S A;  5GAN 3;  3A8L B;  1YI2 A;  1JRI A;  2L5Q A;  5GAN f;  3S3M A;  4QQG A;  2HAX A;  3QKJ A;  2XDB A;  3UDC A;  5IAY A;  2XIC A;  3VYH B;  4FIB A;  2DK3 A;  3WXM B;  1G3W A;  1XTD A;  4FT4 A;  4XTU A;  3CCU T;  4ELZ C;  2FHD A;  3ZFJ A;  4M77 D;  3NTK A;  1M9S A;  1DJ7 B;  2QI2 A;  5C0M A;  4C92 C;  4C92 A;  4F7U A;  2RHX A;  1O75 A;  4M77 G;  5FRN A;  3VUZ A;  1SSF A;  4Y28 E;  2QA4 T;  2LTO A;  4ATO A;  3JB9 H;  5GAN d;  4B9X A;  2ZGW A;  3FRN A;  3TU4 K;  3J7A F;  4M75 F;  5FLX E;  2EQM A;  3JCM J;  4M78 C;  2QQR A;  4IUP A;  4M78 A;  5GAM e;  5GAM j;  1VQP T;  1ZQ1 A;  2BKD N;  2Y90 A;  3X24 B;  3PTA A;  3I55 A;  3GPL A;  1QVF S;  4HKE A;  2CZ0 B;  3MEU A;  3CMA T;  1BI3 A;  2KY9 A;  2V8J A;  3LGL A;  4L59 A;  5J3B A;  3FJP A;  3I55 T;  3CEY A;  4E7L A;  3EAE A;  4C0Z A;  5GAN j;  4C0D C;  4LDW A;  5GAN e;  4ZN3 A;  4MMK A;  1M1K C;  2EQK A;  3H8Z A;  3OB9 A;  2E1H A;  4OGE A;  1VQ8 A;  2RHY A;  2RA2 A;  2QXF A;  3OBY A;  4PNO A;  3DB4 A;  3OBW A;  2ZPG B;  4BE2 A;  4IUU A;  2JZ2 A;  1VQ8 T;  3GOX A;  1FXX A;  2QEX T;  2RM4 A;  4XTV A;  1N27 A;  2EJG A;  2JNG A;  4BI4 A;  4JS5 A;  4QVZ A;  5D6W A;  2E12 A;  3JCM f;  3RER A;  1BIB A;  2P0K A;  2P0Q A;  3A5Z B;  1K9M C;  1WJR A;  4R55 A;  3FDR A;  4Y91 A;  1I8F A;  4JLG A;  3CD6 T;  3NTH A;  1VQN A;  2FVU A;  2RHI A;  3HKS A;  4LDU A;  4C5G A;  4C92 B;  1YIT T;  3I56 T;  5GAM h;  5I2M A;  4Z02 A;  3MCA B;  5CVI A;  3QJY A;  1VQN T;  2VYT A;  3NTI A;  3R6O A;  2LC4 A;  2ZPB B;  3JCM d;  2A7Y A;  3BY7 A;  1M1K U;  5GAM g;  3CXC A;  3OSS C;  3OW2 S;  2V8I A;  1MGQ A;  2XDD A;  4BE1 A;  4M78 B;  1KHC A;  3CCL A;  3ER0 A;  2RJF A;  4N4I A;  3QG1 A;  5GAN h;  4XU0 A;  4C0F A;  4BB7 A;  3SB2 A;  4RMO A;  4J8O A;  3CCL T;  1XNI A;  3SWN C;  3C95 A;  4VUB A;  4XQ3 A;  5GAN 5;  1VQO A;  2OTJ A;  3M5A A;  3N5B B;  3RMS A;  5GAN g;  1OYX A;  2KDS A;  5CCA A;  4DOV A;  2MWP A;  2JTM A;  1VQO T;  5GAN 6;  1I4K 1;  3DB3 A;  1XQH A;  3LYI A;  3JCM e;  3C4S A;  1M1F A;  3A8M B;  1P92 A;  3A8O B;  1VQ6 T;  4J83 A;  1EIF A;  4E7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...