3OA6A

Human msl3 chromodomain bound to dna and h4k20me1 peptide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
FKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDENRRLQRKLARKAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Male-specific lethal 3 homolog
total genus 19
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oa6A01
3UWNA 3ZEHA 2O4XB 2EKOA 3SD4A 4BDYA 2QQSA 2YRVA 3PMTA 3S3NA 3ME9A 3FC3A 2X35A 3KUFA 2EQKA 3FLGA 4E7HA 3EAEA 2EQUA 2L8DA 2L3RA 3BDLA 3GOXA 1WJQA 4IUUA 3OMCA 4QVZA 4LD6A 5D6YA 5C0MA 4E7IA 3MEUA 4PLLA 3L42A 4BE1A 4ZTJA 2QQRA 2RJEA 1OZ3A 3MEWA 5KE3A 2LDMA 3OYIA 4N4IA 4IKFA 3LH0A 2E6NA 4QQ6A 2B8AA 2MWPA 4BE2A 2RJFA 3LGLA 1N27A 3LGFA 4ZTFA 2K3XA 2EQJA 2RHZA 3QIIA 3H6ZA 2FHDA 3OYJA 2F5KA 2PQWA 4C5EA 2GFAA 3MP1A 2R5AA 3LLRA 4BE0A 1WGSA 1RI0A 2CKKA 5M9OA 4QW2A 3OS0A 3L2RA 4FL6A 2MWOA 2LCCA 4IURA 4Z02A 4C5GA 2LRQA 5FRNA 3CEYA 1XNIA 4BACA 3MO8A 1SSFA 3F70A 3PNWC 4QQDA 4FU6A 3L2QA 4IUPA 3UT1A 4RG2A 1H3ZA 4PL6A 4PLIA 3OYBA 4QQGA 2GF7A 2HQEA 2M1HA 4HCZA 4NS5A 3OYAA 2HQXA 3L2WA 1KHCA 4A4HA 4X34A 3NTIA 4E7LA 2D9TA 4B9XA 5KE2A 3DB3A 5C6SA 2XDPA 2O4XA 4BDZA 2X4XA 2E5QA 3OYHA 3P8DA 3Q1JA 5J26A 2M16A 2IG0A 2EFIA 2R5MA 4E7JA 5D6WA 3L2VA 2DIGA 2R58A 4A4EA 3S3OA 2RJCA 2GFUA 4BD3A 3OY9A 3OMGA 2RJDA 1OZ2A 3MP6A 3S3MA 2RO0A 2RHIA 3NTHA 2P0KA 3OYCA 3M9QA 2JTFA 3QKJA 3OYNA 4C5IA 5D6XA 3OYEA 2BKDN 3H8ZA 3DB4A 3OQ5A 2L89A 4C5HA 1OI1A 2EQMA 2VYTA 2X4WA 2R57A 2X4YA 4A4FA 4A4GA 5KH6A 3LX7A 2BUDA 1MHNA 2DIQA 2LVMA 3E9FA 4N4GA 4OVAA 2M0OA 3L2UA 5FRMA 3OYFA 1WJRA 3E9GA 5IAYA 2RHYA 2RHUA 1G5VA 3LYIA 2WACA 2G3RA 3S6WA 4UC4A 2XK0A 4IUQA 5FROA 3OYMA 2BIVA 3OS2A 4II1A 3OS1A 4B9WA 4E7KA 2RI5A 3MEAA 1OYXA 3OYLA 5J39A 3OYKA 2JZ2A 4L59A 4Q5WA 4EDUA 3FDRA 3FEOA 3O8VA 3QJ6A 3PFSA 3OYGA 3P8HA 5KCOA 2LTOA 3C4SA 3OYDA 3OA6A 2RHXA 3MEVA 3PMIA 2NLUA 2RI3A 3QBYA 3OB9A 1WJSA 3ASKA 3META 4N4HA 3DLMA 4IUTA 4CRIA 2K3YA 2DAQA 5IN1A 5KCHA 3MP8A 2RI2A 3NTKA 5CIUA 4IUVA 4GY5A
chains in the Genus database with same CATH superfamily
1N6AA 2YRVA 2FRYA 1B34A 1KQ1A 2DJZA 3GOXA 3O5ZA 4JJCA 4M78E 3OMCA 5IHNA 2DVEA 3HL8A 1PRMC 1VQMQ 3JB9D 1OU8A 2KEAA 4OF1A 1VQ8A 4RCBA 4HA8A 2K3XA 1YITT 4E7ZA 3H6ZA 5KYUB 1U5SA 3MP1A 3ZL7C 4CC2A 4BE0A 1BIAA 2DPPB 1KD1R 4M75A 1YI2A 3TVTA 1XNIA 2RD1A 2XHCA 2HSEB 1YI2Q 3JB9H 5GAOm 2CS7A 1XTDA 2K9GA 2RH2A 4Y92A 1IO6A 1YP5A 2CH4W 1M1KR 1QLYA 5KYYB 1X43A 3RKXA 3CCJA 1B34B 4L6V5 5IT9E 3I5SA 1UE9A 4GBQA 4M75B 4PJMA 4M7AD 2EBPA 1FX7A 1QWFA 1YBYA 1BI1A 1G3YA 2RJCA 4OMNA 1Q81U 4F7UF 1B07A 1M2OA 1CKAA 3RMQA 1OZ2A 1WNLA 1FXXA 4M77G 1QVFA 1VQKQ 3M9QA 1MMAA 3JCMP 2K5IA 3SEMA 1D0ZA 2DILA 3X25B 8AT1B 2KVQG 3CMEQ 3E9FA 3CBPA 3IQLA 4ELZC 3PVQA 2CZ7B 2HQHA 3LYIA 3QXEB 4DBHA 2RQVA 2XU8A 3JRZA 1AWXA 4IUQA 3OS1A 4XAXB 3G4SA 2JZ2A 3FEOA 1Y0MA 3O8VA 2A08A 1X6OA 1H3HA 1GFDA 1YHQT 3OA6A 2PVGB 3ZFJA 4RTTA 5LJ5g 2E70A 3M4GA 3LW5E 1G3WA 1Q82U 2XI9A 2QGGA 3V7RA 5GMKh 2QQSA 2X35A 1Q86U 1VQPQ 1PKSA 2LCLA 2RQTA 3CCLQ 1VQMA 1BI3A 1AWJA 2GQVA 2ED1A 1X2KA 3THKA 4IKFA 4E7SA 3SWNA 1D09B 3A8GB 2YUNA 1I1JA 2QEXQ 2VXFA 4ZTFA 4M77E 4O5VA 2KT1A 2R5AA 2DETA 2DL5A 2NUZA 1OPKA 4LDVA 2V1QA 3PNWC 3KXTA 3HRTA 1NJIR 2NWMA 1VQ5T 1UUEA 2MK5A 4A53A 3M0UA 1KFZA 1VQLQ 1UB4A 2R5MA 4JZ4A 2EYQA 3P8BB 4KUIA 2O9SA 3CMAA 1T0HA 2KDSA 3M58A 2RHIA 5HK3A 2OTLT 5GAOl 2ZPGB 3L2ZA 1OX8A 1RACB 3TSZA 2R57A 4J8OA 1I5OB 1SRLA 2ZPFB 4OMQA 3E9GA 4M77D 2D6FA 1TXQA 2LNHB 1C0MA 1GXIE 2COYA 2KY9A 1VQPT 3OYMA 3EG2A 3JB9F 1V1CA 1VQ9T 2DM1A 4FW1A 1ZUKA 2IVWA 4KGXB 2L3QA 5HY6A 4AMCA 1WFWA 5GAOp 3CCUA 1Q82C 2KRMA 1ABQA 1VYVA 4E2FB 5GMKi 1NBEB 4O6JA 1RAHB 1TOVA 1PNJA 3QBYA 4N0AC 4ZGEB 2K3YA 2DZ9A 3NMZC 2PZ1A 2QASA 1Q7YU 2MYSA 2QTVA 2H3EB 4EIKA 1Y7XA 4PJLA 5IHIA 3KUFA 5HK0A 5EC7A 2L8DA 3PIPA 1S72Q 3EG1A 1VQKA 5LJ5e 1VIFA 5LJ3j 4PJOD 4M7AE 1JEGA 3CCRT 3JCMc 3CCEQ 3R6OA 1PKTA 2FPDA 2DKGA 1VQ7T 3JCMe 5GMKl 1KG1A 5CVIA 2XMFA 1RAGB 4ESRA 1WXUA 2FHDA 2GFAA 5GANh 4RTXA 5FU6C 1C1AA 4C5GA 4V2SA 2ENMA 3MHXA 4M7DG 2J6KA 1Z9ZA 1UFFA 3SB2A 5IHKA 2V1RA 2JS0A 3GLXA 1KHIA 4FYYB 1NYGA 2PVDB 4MMKA 1FMKA 3CCRA 4HCCA 2Y4YA 4A4EA 5A0DA 2D0QB 3OY9A 4FW2A 2K2VA 4BUGA 1OULA 2AKKA 5FW9A 1HD3A 2GNCA 3E2UA 4WCIA 1RAAB 5D6XA 2YHTA 3H8ZA 1RUWA 1KC8U 3L2UA 1NLOC 2K7AA 3G71Q 3CMAT 2DRKA 2WACA 2KMTA 1ZSZC 2DX1A 4FT2A 2RF0A 1AZEA 3CCVA 2E3IA 1W6XA 2LNVA 2DEUA 2OAWA 3A8LB 5L23A 3CXCS 3VYHB 3CD6A 3PGGA 4OB3B 2BE7D 4JLGA 1UGSB 4J9HA 2O88A 1NZ9A 3CC2T 2F2VA 2QK0A 3PMTA 4LNPA 4E7HA 3FJPA 4LD6A 4DEYA 5C0MA 3KBGA 1R8OB 2YDLA 2YUOA 1YJWT 2AHJB 3EGUA 3VRZA 3LGFA 3CC7Q 2RHZA 4MMLA 4C92D 1RI0A 3VS1A 3JB9I 2LQNA 4Y28E 2W0ZA 1M1FA 1RL2A 2LJ3A 2RQUA 2I0NA 2EJFA 4BACA 3JCMJ 2D8JA 3QZ5B 1N8RU 5DLQE 1BI2A 1PM3A 2M1HA 4GLMA 4XTYA 2L3SA 2FVUA 3V8KA 1UJYA 5I22A 2E5QA 1M2VA 5D6WA 1K9AA 2DIGA 2GFUA 2P0KA 4L5GA 1VQNQ 2HEQA 4JJBA 4FM4B 1EZZB 4J7FA 2NUTB 2JTMA 1D1BA 4K11A 2M0OA 2IIMA 2FRWA 5CKBA 3MCAB 4AG1C 4DOWA 3PVLA 4N0AA 4JRQA 2ZAEA 1S72T 1OV3A 5J39A 3OYKA 2VKNA 2DXCA 3EFSA 3GNGA 1RAFB 3I55T 3MEVA 2CP6A 4EPCA 4A54A 1UECA 3J80E 4Z8AA 4M78D 1M9SA 4XU3A 4A4KA 1VQ6Q 2DEQA 3BW1A 1I81A 4E47A 1EFNA 2MMPA 3SDZA 1HXDA 3BE3A 2L3RA 1NJIU 1CSKA 1UGQB 2MI6A 2AIRB 1M90U 2FYKA 2J05A 4PLLA 4X9CA 5GJWB 3TU4K 1NEBA 2LDMA 4N4IA 4C0ZA 3V7SA 1IZ6A 1YNZA 1VQOQ 2EQJA 4Z89A 1C6VX 1VQ8Q 2MAMA 4ZN1A 2EYWA 1RADB 2V26A 3UA7A 3RIRA 3QG1A 3FB9A 3UT1A 2RK1A 1G3TA 3EGXB 2EIFA 3CXCA 3M57A 1VQ6A 1AEYA 4C92F 4JJNK 2NUPA 2OAUA 2HCKA 1TG0A 2QXFA 1PCXA 4E7JA 4DBFA 2VVKA 3FRNA 4D6WA 2RQRA 3V8LA 3NTHA 3CMET 4F7UB 3EG9B 3OYCA 3TQ7P 4XQ3A 4C5HA 2EQMA 2VYTA 2YSQA 5GJVB 4AFZC 4QKUA 3CCJT 3DKMA 3OYFA 4FYXB 1ZLMA 2FEIA 2X9HA 2ZCFB 2EGCA 5GANg 1OX9A 4BI8B 3C95A 2DXUA 3BFMA 1BK2A 4II1A 1VQ6T 3EGDA 1OYXA 2WSEE 1X75C 2FG0A 2GTJA 4M78A 3OYDA 4M75D 2COWA 2DVJA 8ATCB 1WHJA 2KRNA 1YHQQ 3NFCA 3MP8A 1Q81C 3GIBA 5LJ5h 1Z9QA 1PSFA 1MV3A 3SD4A 3I55Q 2E1HA 4C8QD 1YITQ 2HMAA 2EQKA 1O9SA 5CKHA 4M78C 2MCNA 1ZBXA 5FWBA 2QEXT 5FU7C 2BZYA 4ZTJA 2XG8D 3RMSA 5KE3A 4J7IA 2VUBA 4LDUA 2PUKB 2B8AA 2MWPA 2E6ZA 1JBMA 2AK5A 1BBZA 1QVPA 1EX4A 2PQWA 2HBWA 2JS2A 2ROTA 4RKUE 3OYYA 2AT1B 5FRNA 3VS6A 1W1FA 4M7DB 5LJ5j 1MNEA 1SSHA 1YJNT 4PL6A 1K4US 1XOVA 4J9CA 4J9GA 4OMMA 1D1AA 5CCAA 2QDYB 1QQJA 3EH2A 4M7DA 2P0QA 4JZ3A 1VQLA 1YI2T 3A98A 5I2MA 3VJPA 4C92A 3CMAQ 3INZA 1QVGP 4Z88A 3QKJA 3OYNA 4XTWA 2X4JA 4F14A 2ZGWA 1MHNA 1CKBA 3EG3A 4PK4A 3CC4A 2RHYA 3CC2Q 2L2PA 3CC4Q 4MZPA 5CKFA 2XK0A 5FROA 2BIVA 1OQKA 3JB9G 3E19A 2F1LA 4L59A 1RI9A 1TUCA 3QJ6A 2E5KA 3EGXA 3PFSA 4M75F 1AWWA 1BU1A 2NLUA 1M8VA 2CT3A 2CT4A 2KXCA 3CPFA 1YJNQ 3G6EA 4HT8A 1YJNA 4M75G 5IXFA 1WHMA 3H0HA 2V8IA 3VS3A 1WHLA 2HD0A 2YUQA 4J6XA 1E6HA 1K76A 4TVRA 2HAXA 2PUOB 4QVZA 1S1NA 3G71T 2HL5C 3BY7A 4RMOA 2KYMA 3QWYA 2CZ1B 1Q82R 3GF5A 2RJFA 2AZVA 3CC7A 3EG9A 4Y91A 1LCKA 2K5FA 4C5EA 1K0XA 3OS0A 1NPPA 3SHWA 4C0GA 1WQ7A 4OMPA 1W4SA 1BYMA 3CC4T 3L2QA 1AVZC 1A0NB 1Q7YC 2W10A 4RG2A 1H3ZA 4RTYA 2KQWA 4LE9A 3URGA 5CR2A 3HRSA 1NEGA 1KHCA 3R6NA 2VV5A 4C0DB 2O4XA 4PJOA 2DO3A 3NGPA 4C8QB 1QCNA 1VQPA 3S3OA 3J7AF 4BD3A 3UA6A 1QVFP 2RJDA 3EHRA 3V7CA 6AT1B 4BY6B 3UPUA 1HJDA 1VQ4T 1RAEB 4EMGA 3DB4A 2DL8A 2DNUA 1OI1A 2MOXA 1PD0A 2C06A 4M4ZA 2QA4A 1BB9A 1WXBA 2GGRA 2OI3A 1IGUA 3WXMB 4HVUA 4B9WA 2K5LA 3D7SB 2EPDA 2CREA 3PIOA 4JRPA 3PTAA 5I21A 3CCUQ 4MZMA 1PC0A 3CD6Q 2B86A 2SRCA 2HBPA 4CI0C 2MF2A 5LJ5d 1K8AR 2J7IA 2RI3A 3QUIA 1WX6A 1VQ9Q 5GAN6 2RI2A 3G1JA 3VUBA 1FWZA 1WHHA 3LH5A 3S3NA 3ME9A 3FC3A 1U3OA 2G6FX 3FLGA 1UGPB 2BTTA 1AWOA 3JCMg 1ZHIA 3QO3A 4HKEA 5GAN3 4BB7A 1M27C 3M54A 4M7AA 3UATA 4KUDK 5FU7B 3CXCP 1I07A 1IHWA 3JCMf 1BI0A 4FL6A 3X20B 3CEYA 1M90R 2LT4A 4QQDA 2O31A 3CCMA 1TUGB 3M4YA 2QA4T 5GANe 3X24B 3TSWA 3JSCA 4R56A 4JS5A 4X1VA 5KE2A 3VS5A 5C6SA 2EYYA 3P8DA 1WLPB 2Y90A 2HKQB 4XTUA 5GAMj 2M16A 2IG0A 4M7AB 4BI4A 1LNXA 1PD1A 1O75A 3HPWA 1D1CA 1M4ZA 3QWXX 1QW1A 4FSXA 4M78B 4C8QF 2K6DA 2XICA 3REAB 3ZBDA 2V8JA 4OB2B 1NE8A 4BDZA 2X4WA 5CAIA 1ARKA 4A4FA 2O9VA 2RN8A 1SKUB 2KBTA 2A36A 2LMJA 1K9MR 5J3BA 3CBMA 1QVGA 1FYNA 2DZCA 2VWFA 4J9IA 3FDRA 3HRUA 1T3SA 4AFSC 3P8HA 2VGMA 1UTIA 4F7UA 2JVVA 1G2BA 1VQ7Q 5KYXA 2OTLA 1WDXA 2EQIA 5IN1A 2XDDA 1DJ7B 3U23A 1BIBA 3H0IA 3SWNC 5KYYA 1KQ2A 1K73R 1WZOA 2GCXA 2DYBA 4QVDA 5GMKm 4M78G 2JN0A 4LDWA 1SF9A 4RTVA 3HTRA 2QA4Q 2MPXC 3QJYA 4QQ6A 1HK9A 4M7DD 1GRIA 2E64A 5A0GA 3CC2A 3CCUT 2OTJA 4B6MA 5FLXE 1WGSA 1WQWA 5M9OA 2JMCA 2CP7A 3M55A 4RTUA 2X3XD 3CCMQ 1D3BB 1KC8R 4F17A 1N9SA 1AHJB 2PU9B 2WSFE 3CCQA 5GAMd 2VXEA 4NS5A 4EMKC 1VQNT 1Y07A 4CC7A 4A4HA 1QMCA 1Y71A 4RUGA 3L1AA 2MIOA 3DB3A 2XDPA 2RM4A 4GLKA 2F69A 5CK9A 2LC4A 1QP3A 4JUVA 4JRIA 4C8QE 2EFIA 3JCMW 2LZ6B 5GMKj 1E6GA 3OMGA 2DD5A 2LT1A 3MP6A 1M1GA 2RNAA 1Q86R 2CUBA 2RO0A 3FJ5A 2LX9A 1VQ5A 1V76A 2I2LA 1ZSZB 4FYVB 3CD6T 4C8QA 1NYFA 2BUDA 1D3BA 1YCSB 4M7AF 5EG2A 1JB0E 2HSPA 2CP3A 2HL3A 5KYWB 3QYHB 1M1KU 3C0CA 3RBBB 5DY9A 4F16A 1VIEA 5GANd 1R0CB 2M9UA 3I56T 4NOYA 4AFUC 1WJSA 3ASKA 4N4HA 2E3HA 4IUTA 4M77F 2DTOA 4M75E 2CZ6B 5KYNA 3JCMX 5GAN4 3NTKA 1SHFA 4KGVB 2NUPB 2JMAA 1B7TA 2DTIA 2EYZA 3EAEA 3VS4A 2KSSA 4OP0A 4KT0E 2FZKB 4XK8E 4IUUA 1VQNA 5LJ3e 2YLBA 3GP8A 4HXJA 3L42A 2P4RA 3A1PA 2DYIA 3CCSA 2F2WA 3VYGA 2AKLA 4C92E 3I56Q 3G71A 4ZN3A 1YIJQ 3VV0A 5CQYA 2OX7A 3I56A 1X6GA 3HKSA 3QIIA 1GCPA 1KD1C 3OYJA 2F5KA 1AOJA 2P4TA 1AT1B 1QVGS 3CC7T 5D7UA 2H8HA 1U1TA 3MO8A 1SSFA 1KD1U 3EFRA 1MUZA 4AFQC 4JPBW 1YJ9A 1WHGA 2GF7A 5GAN2 2DTHA 3OYAA 5FWCA 2FPEA 2JUFA 1ZUYA 3L2WA 3A8OB 4QVCA 2DXBA 1YJWQ 4HCKA 2DL4A 1NM7A 1ZX6A 3SWNB 2LQWA 4P5NA 5GANj 2CDTA 2DL7A 3S3MA 2VC8A 1EIFA 3WVDB 3VUZA 1H641 2DFUA 1YWPA 1WJRA 1W70A 1I4K1 1TH7A 3S6WA 4XU0A 2QQBA 4E7KA 2CGHA 1VQLT 4XU2A 2D0NA 3OSVA 1Y96A 1WHKA 2YRCA 3VKIA 5GAOq 3JCMV 1UGVA 1WIEA 2JM8A 1YHQA 4CRIA 1T0JA 4OB1B 1LVKA 1NJIC 2LCSA 1NPRA 1UHCA 2CP2A 2NUTA 2CSIA 1K9MU 2CYZB 4BDYA 3BDLA 3QYGB 4WF2A 5IXBA 1K8AU 2DF6A 2DLPA 2DRMA 2A3LA 3X28B 2DBMA 3MEUA 1ACMB 4RTWA 3VS2A 4BE1A 2OJ2A 4ATOA 3ULRB 1Q86C 4KBMB 2E10A 2Z0WA 1PSEA 4F04B 2E12A 2GTOA 1Q95G 1ZUUA 2DA9A 2LCCA 1JXOA 5GAMh 1QCOA 2JT4A 1NLPC 4C92G 1V29B 2CSQA 2HQEA 3OS5A 1Q7YR 7AT1B 3I9QA 5A0LA 3M0TA 3G4ST 5J26A 3C12A 1H8KA 4EMKB 4KRTA 2JXBA 3M5AA 3JCMd 3TCJA 4C92C 1OPLA 2COZA 2VB6A 1U1SA 2VASA 3QPHA 4RCCA 4VUBA 4PJOE 4J83A 2X51A 2L5QA 2L89A 3HSBA 1BKBA 2FO0A 5GANf 3M56A 3WVEB 3SFMA 4J5YA 1G5VA 2HKNA 1LJOA 2OTJQ 1K73C 4D8KA 2XIDA 1RABB 4RG8A 4DA4A 2YLCA 1FMWA 4KH0B 1VQ4Q 3C4SA 2DE0X 1I0CA 3EH1A 4M77A 5LL6S 1VQ4A 1X69A 1K9MC 1IREB 1OEBA 3DLMA 2DMOA 3RERA 2BZ8A 2YT6A 2ZPBB 3AT1B 1K8AC 5KYWA 3N5BB 1P92A 2E4HA 1PHTA 4JS4A 2E41A 4IUVA 2LP5A 2O4XB 1KC8C 2OTJT 2CH4A 2EGAA 1M3BA 4J9EA 2L0AA 2EWNA 4F7UG 2AZSA 2CZ0B 1IHVA 1VQ5Q 3RESA 2DL3A 3H9NA 1GL5A 5GAMf 2QQRA 1OZ3A 3MEWA 3M0QA 3LH0A 2FPFA 2LQ8A 5KYXB 4PJOG 4OMLA 4LD9K 1HYOA 2J6OA 3M0PA 4M7DF 3LGLA 3QSUA 4LDYA 2EVRA 1RAIB 5AYFA 2LJ1A 3L2RA 1VYTA 3EFOB 1MNDA 9ATCB 2LRQA 3EGDB 2IPOB 4LUDA 3RUXA 3VS7A 1W2BP 2D1XA 3REBB 2ABLA 3CPWS 1VQOT 2CP5A 3M0SA 3NTIA 4E7LA 4KGZB 4FCYA 3RR6A 3Q1JA 2VGNA 4R0KA 1Y57A 2A37A 1M8MA 3I55A 1QKWA 3MJXA 1HSQA 1PG5B 2ROLA 3L2VA 4DEXA 4J9DA 4PJOF 1JJ2P 4NL2A 1N9RA 4JRKA 2A7YA 1K73U 4QT7A 4C5IA 5GAOn 2M0YA 4AT1B 3OBWA 3OQ5A 3CCSQ 5IH2A 1JJ2S 2QAZA 4FSSA 4PJOB 4UC4A 4XTVA 4ZNXA 3OS2A 1D0YA 2EGEA 5I2SA 2RI5A 3OYLA 1N8RR 2P84A 3OYGA 3LWIA 2LTOA 4KH1B 1VQ7A 5GAMg 4OB0B 1PWTA 3OB9A 2K3BA 4XTXA 2HNIA 3H41A 2JOYA 1UHFA 2H3JA 4C0DC 2JNGA 3RKYA 2QDLA 5CIUA 2EKHA 1MMNA 3A8HB 3JB9J 2BE9B 3CBOA 2EKOA 1Y96B 1VQKT 4ANJA 1XJWB 3HFNA 2EQUA 1YITA 2FB7A 4C92B 2ED0A 1M3AA 4HVVA 2NYSA 3CCLA 4OMFB 1FMVA 4BY6C 2QG9B 3UF4A 1E7OA 2XDBA 3OYIA 4LXCA 2E6NA 2CP0A 3ER0A 1ZQ1A 1KIKA 4IIOA 4ZGJB 2D8HA 1N27A 1X6BA 3MKDA 1KSWA 3LLRA 1R77A 2MWOA 4DQ2A 5GAN7 1JQQA 4HT9A 1LPLA 3F70A 3JCMb 2KK4A 4XTZA 4MDWA 3PE0A 3OSSC 3JCMQ 4PLIA 1YFNA 2HQXA 1PRLC 4M7DC 4FYWB 4EMHA 3KFVA 4JJDA 4FIBA 2KE9A 3CCVT 5LJ3d 4MZTA 3FIFA 1UDLA 2YXYA 2Y4XA 1QP2A 5A2QE 1T3LA 2J06A 1VOMA 4YTLA 2JTFA 1YIJT 2RQWA 4KULA 3OYEA 3E1SA 4A4GA 3LX7A 2LVMA 3CCEA 1UGRB 1OOTA 1SPKA 3TREA 1YCYA 4ORZA 4R55A 1IGQA 3QHSA 3M53A 4Q5WA 4M77C 4XU1A 2ECZA 1U06A 1IXDA 1VUBA 4PJJA 2ESWA 4OMOA 2KGTA 2BZXA 4DBRA 2J6FA 2KNBB 4PFPA 4WTOB 1VQMT 3GBQA 4ELYC 2DAQA 3CPWA 5KCHA 1JRIA 2L3PA 1MMGA 2YRDA 1QWEA 4OGCA 5CKDA 3ZEHA 1TTHB 2C0TA 2EW3A 1RLPC 3EHQA 1TUDA 3I35A 3C94A 4F7UE 2K57A 1WYXA 2HZYA 4E7IA 1M2VB 1ZBJA 3GNFB 4HCBA 2EAYA 3TEEA 1VQOA 4MDXA 4BE2A 5GAMe 3HP9A 1ZSGA 1SRMA 4J9FA 4EMKA 1M90C 2GQIA 2DERA 4QW2A 1MGQA 4DOVA 3CCET 1IB8A 2P0PA 4M75C 1GBRA 1QKXA 4QQGA 5LJ5f 4J9BA 3CCLT 1YJ9Q 4PJNA 5HCKA 4X34A 2RMOA 2D9TA 4B9XA 2DBKA 2FZGB 3QDFA 1VQ9A 1N5ZA 2C0IA 1RLQC 2C0OA 1QVFS 4M78F 3RDVA 2LX7A 2V8KA 2ZPHB 4RTZA 4HVWA 3NHNA 2YUPA 5HKCA 4J6WA 1R0BG 4DBQA 1Q81R 1WXTA 1ZA1B 1G8XA 4E6RA 2DIQA 4OVAA 2RB6A 2EJ9A 5IAYA 1J3TA 3M0RA 2KROA 2JM9A 2G3RA 3UDCA 3HFOA 5GAN5 1X2QA 3EG0A 3MEAA 5CKEA 3MPUB 3BDUA 4PFZA 5CQXA 4C0FA 1VYUA 2RPNA 2QTXA 3CCJQ 2QYZA 1GBQA 2K4YA 1GCQC 1GFCA 4BI3A 1AZGB 5CO7A 2RK2A 5FU6B 4GY5A 5L8RE 3CCMT 1WA7A 1K1ZA 2YWWA 1WJQA 1U8RA 1OU9A 5GAN8 3VRYA 1JXMA 1TS9A 3A5ZB 2KT8A 4J6YA 2LQKA 2O2OA 1AD5A 5LJ3g 3CMEA 1WI7A 5LJ3h 4PFOA 4ZGDB 3G4SQ 4CC4B 2CKKA 2A0FB 4IURA 3RNJA 4M77B 4PNOA 4FU6A 3G7ZA 4LDXA 2FL7A 1UG1A 4FT4A 2F5TX 3CCST 3OYBA 3NPFA 1G83A 1UJ0A 2DJQA 4ME7A 2JJ9A 4D8DA 3GPLA 5GAOr 1UEBA 5AT1B 1H92A 2R58A 3RKWA 2LJ0A 1VA7A 2ZZDA 4LUEA 5DM7R 3OW2P 4PKCC 3HHTB 2KI7A 2XD0A 1G3SA 2BKDN 1F1BB 5KH6A 3AHUA 4N4GA 5FRMA 1KJWA 2SEMA 4NL3A 2ZPIB 2PTKA 1MV0B 2QEXA 4CC3A 2JW4A 2HDAA 3JV3A 1JJ2A 2KYBA 2X3WD 2M02A 2DK3A 2DXTA 2GBQA 3A8MB 5KYUA 2QGFB 3CCVQ 2QI2A 4EDUA 4C8QC 3LWHA 2K2MA 4M7AC 5KCOA 3I5RA 1X01A 2RHXA 1XQHA 3DLLA 3META 1KQSP 1K0SA 1YJWA 4M7AG 4JLIA 4IIMA 1N8RC 2ATCB 5DLOA 4OGEA 3JAME 3UWNA 5LJ3f 1BCOA 1M30A 2M51A 1VQ8T 3X26B 3JCMh 1YWOA 3CPWP 5D6YA 2K79A 2RJEA 2E65A 3QZ9B 1KQSS 1ZSZA 4JDSA 3VU3C 4LN2A 2FZCB 3T9NA 4A63B 1KQSA 1D0XA 1ABOA 1QCFA 3V8JA 4X9DA 3VS0A 2QQ9A 1SHGA 1SEMA 1TSFA 2PNIA 4Z02A 1M3CA 2KAFA 4M7DE 4IUPA 1GCQA 2EJGA 2O01E 1I5LA 2A28A 2KRSA 4HCZA 4PJOC 1JO8A 3CCQQ 3PT9A 3H0FA 3OBYA 1M5Q1 2X4XA 3OYHA 3G6EQ 1KK7A 2CUDA 3OW2S 3M59A 5GMKe 1S72A 1B3QA 1TU0B 3OW2A 3G6ET 2JTEA 5I11A 1BCMA 3CQTA 2RA2A 1JU5C 5ECAA 3J81E 2F2XA 3CCQT 2DD4A 1SG5A 4AG2C 3QDRB 2KXDA 2X4YA 1M1KC 1YIJA 2EYXA 2WSCE 1YJ9T 2RHUA 1IRXA 1I8FA 1YN8A 1WPYA 1TWBA 3EFOA 1LOJA 1W2BA 1ZA2B 1NG2A 2QQAA 3PMIA 2OTLQ 2PVOB 1W2BS 3CCRQ 1X27A 4C8QG 2XKOC 2ZPEB 2KR3A 1MMDA
chains in the Genus database with same CATH topology
3CBOA 1BIBA 1N6AA 1Y96B 2EKOA 2MMPA 3SDZA 2YRVA 3SWNC 1VQKT 1KQ2A 1HXDA 2GCXA 1B34A 3HFNA 1KQ1A 2EQUA 2L3RA 2DJZA 4QVDA 5GMKm 3GOXA 4M78G 2FB7A 4C92B 1YITA 4M78E 1NJIU 3OMCA 2DVEA 1UGQB 3CCLA 2JN0A 4OMFB 3HL8A 2MI6A 4BY6C 1M90U 2FYKA 4LDWA 4PLLA 4X9CA 3JB9D 3TU4K 2LDMA 2XDBA 3OYIA 4N4IA 4C0ZA 2E6NA 3QJYA 4OF1A 4QQ6A 3V7SA 1HK9A 1IZ6A 3ER0A 1ZQ1A 4M7DD 4ZGJB 2E64A 1VQ8A 1N27A 4HA8A 4RCBA 2K3XA 2EQJA 1YITT 3H6ZA 2MAMA 5A0GA 4ZN1A 3CC2A 3CCUT 2OTJA 3MP1A 5FLXE 3LLRA 4BE0A 1WGSA 1WQWA 5M9OA 1BIAA 3M55A 2DPPB 2MWOA 4M75A 4DQ2A 5GAN7 1YI2A 4HT9A 1XNIA 1D3BB 2RD1A 2XHCA 3F70A 3QG1A 2KK4A 4XTZA 3RIRA 3JCMb 3JB9H 5GAOm 3FB9A 2CS7A 1XTDA 2RH2A 4MDWA 3UT1A 1N9SA 3JCMQ 3OSSC 2RK1A 1G3TA 1AHJB 2PU9B 2WSFE 4PLIA 3RKXA 3CCJA 3CCQA 5GAMd 2VXEA 1B34B 4NS5A 2HQXA 4EMKC 1VQNT 1Y07A 4L6V5 4A4HA 2EIFA 5IT9E 4M7DC 1Y71A 3CXCA 3L1AA 3M57A 3DB3A 4C92F 2XDPA 4JJNK 2OAUA 2RM4A 4GLKA 2F69A 4M75B 4EMHA 2LC4A 5CK9A 1QP3A 4JUVA 4JRIA 2QXFA 4C8QE 2EFIA 4FIBA 3CCVT 5LJ3d 4E7JA 3JCMW 4M7AD 4MZTA 1FX7A 1YBYA 3FIFA 5GMKj 1BI1A 1G3YA 2RJCA 2Y4XA 1Q81U 1QP2A 4F7UF 3OMGA 2DD5A 2LT1A 5A2QE 3FRNA 3RMQA 1OZ2A 1M1GA 3MP6A 3V8LA 1WNLA 1FXXA 2RO0A 4D6WA 3NTHA 4M77G 4F7UB 3CMET 1QVFA 4YTLA 3OYCA 3M9QA 2JTFA 1YIJT 2LX9A 1VQ5A 4KULA 2I2LA 2K5IA 4XQ3A 4C5HA 3JCMP 3OYEA 3CD6T 2EQMA 2VYTA 3E1SA 3X25B 4A4GA 2KVQG 4C8QA 3LX7A 2BUDA 2LVMA 1D3BA 3E9FA 3CCEA 3CCJT 1UGRB 3CBPA 3DKMA 3OYFA 4M7AF 5EG2A 1JB0E 3TREA 4ELZC 2CZ7B 3LYIA 2ZCFB 3QXEB 1YCYA 2XU8A 3JRZA 5GANg 4BI8B 3C95A 2DXUA 4R55A 4IUQA 3BFMA 4II1A 3OS1A 1VQ6T 4XAXB 3QHSA 1OYXA 3G4SA 3QYHB 3M53A 1M1KU 2JZ2A 4Q5WA 4M77C 2WSEE 4XU1A 3FEOA 3O8VA 1X75C 1VUBA 1X6OA 5DY9A 1VIEA 4M78A 5GANd 4M75D 3OYDA 3OA6A 1YHQT 2PVGB 2M9UA 3I56T 4NOYA 3ZFJA 1WJSA 3ASKA 4N4HA 4IUTA 1VQMT 3CPWA 4ELYC 2DAQA 4M77F 5LJ5g 2E70A 2DTOA 3NFCA 5KCHA 3MP8A 3M4GA 2CZ6B 4M75E 5LJ5h 1Q81C 1JRIA 3GIBA 3JCMX 5GAN4 1PSFA 3NTKA 3LW5E 1G3WA 1Q82U 4OGCA 2XI9A 5CKDA 3V7RA 3ZEHA 5GMKh 3SD4A 2QQSA 2E1HA 4C8QD 2DTIA 2X35A 2EQKA 1Q86U 3EAEA 1O9SA 2LCLA 5CKHA 2KSSA 4OP0A 4M78C 3C94A 4F7UE 4KT0E 4XK8E 3BW1A 2K57A 4IUUA 5LJ3e 1VQMA 1BI3A 1VQNA 2YLBA 4E7IA 1ZBXA 3GP8A 2QEXT 5FU7C 2GQVA 3L42A 4ZTJA 2XG8D 3RMSA 5KE3A 4J7IA 2VUBA 4LDUA 2PUKB 3GNFB 3CCSA 4IKFA 4HCBA 2EAYA 3SWNA 3VYGA 2B8AA 3A8GB 4C92E 2MWPA 3TEEA 1VQOA 3G71A 4ZN3A 4MDXA 2E6ZA 4BE2A 1JBMA 5GAMe 3VV0A 5CQYA 3HP9A 3I56A 2VXFA 4ZTFA 4M77E 4O5VA 3HKSA 3QIIA 1QVPA 1KD1C 3OYJA 2F5KA 2PQWA 4EMKA 2R5AA 1M90C 2P4TA 4QW2A 4RKUE 1MGQA 1QVGS 4DOVA 3CC7T 3OYYA 4LDVA 5FRNA 1U1TA 3MO8A 1SSFA 3PNWC 1KD1U 4M7DB 3EFRA 5LJ5j 3KXTA 3CCET 1YJNT 2P0PA 3HRTA 4M75C 4PL6A 1YJ9A 4QQGA 5LJ5f 2GF7A 5GAN2 1XOVA 2DTHA 1VQ5T 3CCLT 3OYAA 2JUFA 4A53A 3L2WA 3A8OB 4X34A 4QVCA 2DXBA 2D9TA 4B9XA 5CCAA 1VQ9A 2QDYB 1UB4A 2R5MA 4M7DA 2P0QA 1VQLA 1YI2T 3SWNB 5I2MA 2EYQA 3VJPA 4C92A 3P8BB 4KUIA 1QVFS 3INZA 4M78F 4P5NA 3CMAA 5GANj 2KDSA 3S3MA 3M58A 2RHIA 2V8KA 2VC8A 1EIFA 5HK3A 2OTLT 3WVDB 2ZPHB 3VUZA 5GAOl 1H641 3QKJA 3OYNA 2ZPGB 5HKCA 4XTWA 4J6WA 2X4JA 3L2ZA 2ZGWA 2R57A 4J8OA 2DIQA 1MHNA 4OVAA 2RB6A 2ZPFB 2EJ9A 1WJRA 3E9GA 4M77D 5IAYA 3CC4A 2D6FA 2RHYA 1I4K1 2G3RA 4MZPA 1GXIE 1TH7A 3UDCA 5CKFA 3S6WA 2KY9A 2XK0A 4XU0A 5FROA 3OYMA 2BIVA 2QQBA 3HFOA 1VQPT 3JB9F 5GAN5 4E7KA 3JB9G 3E19A 1VQ9T 3MEAA 2CGHA 5CKEA 3BDUA 5CQXA 2IVWA 4L59A 1VQLT 4C0FA 4XU2A 5HY6A 3QJ6A 3PFSA 3JB9J 3OSVA 1Y96A 4M75F 5GAOp 3CCUA 1Q82C 2QTXA 2K4YA 3VKIA 2NLUA 5GMKi 3JCMV 5GAOq 4O6JA 1M8VA 4BI3A 3QBYA 4N0AC 4ZGEB 1YHQA 4CRIA 3CPFA 2K3YA 2DZ9A 4OB1B 3G6EA 5CO7A 2RK2A 1Q7YU 4HT8A 1YJNA 4M75G 1NJIC 5FU6B 1Y7XA 1NPRA 4GY5A 2V8IA 5L8RE 1K9MU 3CCMT 2CYZB 4BDYA 2HD0A 4J6XA 3KUFA 5HK0A 3PIPA 2L8DA 3BDLA 3QYGB 1VQKA 4WF2A 4TVRA 1WJQA 1VIFA 2PUOB 4QVZA 2A3LA 3X28B 5LJ3j 5LJ5e 1U8RA 5GAN8 4PJOD 4M7AE 3MEUA 3A5ZB 4BE1A 3G71T 3BY7A 4ATOA 4RMOA 3CCRT 4J6YA 3JCMc 2LQKA 3R6OA 2DKGA 2CZ1B 1VQ7T 3JCMe 3GF5A 1Q86C 4KBMB 2E10A 5GMKl 5LJ3g 3CMEA 1KG1A 5CVIA 2RJFA 5LJ3h 1PSEA 3CC7A 2FHDA 4Y91A 2K5FA 4C5EA 2GFAA 5GANh 4ZGDB 2CKKA 1NPPA 2E12A 5FU6C 4C0GA 3OS0A 1WQ7A 1BYMA 1W4SA 2LCCA 4IURA 4C5GA 3CC4T 4V2SA 5GAMh 4M77B 4PNOA 4FU6A 3G7ZA 3MHXA 3L2QA 4LDXA 2FL7A 4M7DG 4FT4A 3SB2A 4C92G 2F5TX 1Q7YC 1V29B 4RG2A 3CCST 1H3ZA 3OYBA 2KQWA 2HQEA 3URGA 3OS5A 5CR2A 3HRSA 3GLXA 1KHCA 1KHIA 4ME7A 2VV5A 2PVDB 4MMKA 4C0DB 5A0LA 3CCRA 4HCCA 2O4XA 4PJOA 2DO3A 3G4ST 5J26A 4C8QB 3C12A 3GPLA 5GAOr 1UEBA 4EMKB 1VQPA 2R58A 2Y4YA 4A4EA 5A0DA 2D0QB 3S3OA 3J7AF 4BD3A 3OY9A 3RKWA 3M5AA 2RJDA 2K2VA 4BUGA 3JCMd 3V7CA 2ZZDA 3TCJA 4C92C 1U1SA 3QPHA 4BY6B 5DM7R 4RCCA 4PKCC 3HHTB 4VUBA 3UPUA 5D6XA 2XD0A 1G3SA 4PJOE 2HAXA 2BKDN 4J83A 2YHTA 1VQ4T 2L5QA 3DB4A 3H8ZA 2L89A 4EMGA 1OI1A 1BKBA 5KH6A 1KC8U 3HSBA 2C06A 3AHUA 5GANf 3M56A 3L2UA 4N4GA 2QA4A 5FRMA 3WVEB 3SFMA 4NL3A 2ZPIB 4J5YA 3WXMB 1G5VA 3CMAT 1LJOA 2WACA 2QEXA 1K73C 2KMTA 1K8AU 1JJ2A 2DK3A 2XIDA 4B9WA 2DXTA 4FT2A 3A8MB 4RG8A 2K5LA 2QI2A 3PIOA 4EDUA 4C8QC 3PTAA 3CCVA 5I21A 3LWHA 2YLCA 4JRPA 4DA4A 4M7AC 4MZMA 2LNVA 5KCOA 3C4SA 3A8LB 1X01A 5LL6S 4M77A 2HBPA 1VQ4A 2RHXA 4CI0C 3VYHB 3CXCS 2MF2A 1K9MC 3PGGA 5LJ5d 3CD6A 1IREB 2RI3A 4OB3B 4JLGA 1XQHA 3QUIA 3DLLA 3META 3DLMA 1YJWA 4M7AG 4JLIA 3RERA 2ZPBB 1K8AC 1N8RC 1UGSB 3N5BB 1P92A 2RI2A 5GAN6 5DLOA 4OGEA 3VUBA 4JS4A 3JAME 1FWZA 2E41A 4IUVA 1NZ9A 3UWNA 2O4XB 1KC8C 2OTJT 5LJ3f 3CC2T 3PMTA 3S3NA 3ME9A 3FC3A 4E7HA 3FLGA 3FJPA 1UGPB 3X26B 1VQ8T 3JCMh 2EWNA 4F7UG 3JCMg 1ZHIA 2CZ0B 5D6YA 4LD6A 5C0MA 3KBGA 1R8OB 3RESA 5GAMf 2QQRA 2RJEA 3QO3A 1OZ3A 3MEWA 3M54A 4HKEA 4BB7A 5GAN3 4M7AA 2E65A 3LH0A 1YJWT 2LQ8A 3QZ9B 1KQSS 2AHJB 4PJOG 4LD9K 4KUDK 4JDSA 4M7DF 3LGLA 3LGFA 3VU3C 3QSUA 4LDYA 5FU7B 2RHZA 4MMLA 3T9NA 1KQSA 5AYFA 3JCMf 3V8JA 4C92D 4X9DA 1RI0A 2QQ9A 3JB9I 3L2RA 1BI0A 4FL6A 4Y28E 1M1FA 1RL2A 4Z02A 3X20B 2LRQA 2EJFA 3CEYA 4BACA 2LT4A 2KAFA 4QQDA 3CCMA 3JCMJ 3RUXA 4M7DE 4IUPA 2EJGA 3M4YA 2QA4T 3QZ5B 1N8RU 5DLQE 5GANe 3X24B 1BI2A 2O01E 1I5LA 3CPWS 2M1HA 4HCZA 4PJOC 1VQOT 3JSCA 3PT9A 4R56A 4XTYA 4JS5A 3NTIA 3OBYA 4E7LA 2FVUA 1M5Q1 3V8KA 5KE2A 5C6SA 2X4XA 2E5QA 3OYHA 3P8DA 3Q1JA 2VGNA 2Y90A 4XTUA 5GAMj 3OW2S 3I55A 2M16A 2IG0A 3M59A 4M7AB 5D6WA 4BI4A 5GMKe 1LNXA 3L2VA 2DIGA 1O75A 4PJOF 1S72A 2GFUA 3OW2A 3HPWA 3G6ET 4NL2A 1N9RA 1M4ZA 1QW1A 2RA2A 4FSXA 4JRKA 2A7YA 2P0KA 4M78B 4L5GA 4C8QF 1K73U 2XICA 3ZBDA 3J81E 2V8JA 4OB2B 3CCQT 2DD4A 1NE8A 4C5IA 4FM4B 5GAOn 3QDRB 3OBWA 3OQ5A 4J7FA 4BDZA 2JTMA 2X4WA 5CAIA 4A4FA 2X4YA 1M1KC 1YIJA 2M0OA 2WSCE 1YJ9T 5CKBA 3MCAB 1JJ2S 2RHUA 4DOWA 5J3BA 4PJOB 3CBMA 1QVGA 4UC4A 4XTVA 4N0AA 2DZCA 3OS2A 1I8FA 4JRQA 1S72T 5I2SA 2RI5A 3OYLA 5J39A 3OYKA 1WPYA 2DXCA 3EFSA 3FDRA 3GNGA 3I55T 3HRUA 3OYGA 3LWIA 1LOJA 1W2BA 3P8HA 2VGMA 2LTOA 4F7UA 2JVVA 1VQ7A 3MEVA 2QQAA 3PMIA 4EPCA 2PVOB 5GAMg 4A54A 1W2BS 4OB0B 3J80E 2OTLA 3OB9A 4M78D 4XTXA 1M9SA 4XU3A 2HNIA 4A4KA 4C8QG 5IN1A 2ZPEB 2JOYA 2H3JA 2XKOC 4C0DC 2XDDA 2JNGA 3RKYA 2DEQA 1DJ7B 5CIUA 1VQ6A 3A8HB 1I81A 4E47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UWN A;  3ZEH A;  2O4X B;  2EKO A;  3SD4 A;  4BDY A;  2QQS A;  2YRV A;  3PMT A;  3S3N A;  3ME9 A;  3FC3 A;  2X35 A;  3KUF A;  2EQK A;  3FLG A;  4E7H A;  3EAE A;  2EQU A;  2L8D A;  2L3R A;  3BDL A;  3GOX A;  1WJQ A;  4IUU A;  3OMC A;  4QVZ A;  4LD6 A;  5D6Y A;  5C0M A;  4E7I A;  3MEU A;  4PLL A;  3L42 A;  4BE1 A;  4ZTJ A;  2QQR A;  2RJE A;  1OZ3 A;  3MEW A;  5KE3 A;  2LDM A;  3OYI A;  4N4I A;  4IKF A;  3LH0 A;  2E6N A;  4QQ6 A;  2B8A A;  2MWP A;  4BE2 A;  2RJF A;  3LGL A;  1N27 A;  3LGF A;  4ZTF A;  2K3X A;  2EQJ A;  2RHZ A;  3QII A;  3H6Z A;  2FHD A;  3OYJ A;  2F5K A;  2PQW A;  4C5E A;  2GFA A;  3MP1 A;  2R5A A;  3LLR A;  4BE0 A;  1WGS A;  1RI0 A;  2CKK A;  5M9O A;  4QW2 A;  3OS0 A;  3L2R A;  4FL6 A;  2MWO A;  2LCC A;  4IUR A;  4Z02 A;  4C5G A;  2LRQ A;  5FRN A;  3CEY A;  1XNI A;  4BAC A;  3MO8 A;  1SSF A;  3F70 A;  3PNW C;  4QQD A;  4FU6 A;  3L2Q A;  4IUP A;  3UT1 A;  4RG2 A;  1H3Z A;  4PL6 A;  4PLI A;  3OYB A;  4QQG A;  2GF7 A;  2HQE A;  2M1H A;  4HCZ A;  4NS5 A;  3OYA A;  2HQX A;  3L2W A;  1KHC A;  4A4H A;  4X34 A;  3NTI A;  4E7L A;  2D9T A;  4B9X A;  5KE2 A;  3DB3 A;  5C6S A;  2XDP A;  2O4X A;  4BDZ A;  2X4X A;  2E5Q A;  3OYH A;  3P8D A;  3Q1J A;  5J26 A;  2M16 A;  2IG0 A;  2EFI A;  2R5M A;  4E7J A;  5D6W A;  3L2V A;  2DIG A;  2R58 A;  4A4E A;  3S3O A;  2RJC A;  2GFU A;  4BD3 A;  3OY9 A;  3OMG A;  2RJD A;  1OZ2 A;  3MP6 A;  3S3M A;  2RO0 A;  2RHI A;  3NTH A;  2P0K A;  3OYC A;  3M9Q A;  2JTF A;  3QKJ A;  3OYN A;  4C5I A;  5D6X A;  3OYE A;  2BKD N;  3H8Z A;  3DB4 A;  3OQ5 A;  2L89 A;  4C5H A;  1OI1 A;  2EQM A;  2VYT A;  2X4W A;  2R57 A;  2X4Y A;  4A4F A;  4A4G A;  5KH6 A;  3LX7 A;  2BUD A;  1MHN A;  2DIQ A;  2LVM A;  3E9F A;  4N4G A;  4OVA A;  2M0O A;  3L2U A;  5FRM A;  3OYF A;  1WJR A;  3E9G A;  5IAY A;  2RHY A;  2RHU A;  1G5V A;  3LYI A;  2WAC A;  2G3R A;  3S6W A;  4UC4 A;  2XK0 A;  4IUQ A;  5FRO A;  3OYM A;  2BIV A;  3OS2 A;  4II1 A;  3OS1 A;  4B9W A;  4E7K A;  2RI5 A;  3MEA A;  1OYX A;  3OYL A;  5J39 A;  3OYK A;  2JZ2 A;  4L59 A;  4Q5W A;  4EDU A;  3FDR A;  3FEO A;  3O8V A;  3QJ6 A;  3PFS A;  3OYG A;  3P8H A;  5KCO A;  2LTO A;  3C4S A;  3OYD A;  3OA6 A;  2RHX A;  3MEV A;  3PMI A;  2NLU A;  2RI3 A;  3QBY A;  3OB9 A;  1WJS A;  3ASK A;  3MET A;  4N4H A;  3DLM A;  4IUT A;  4CRI A;  2K3Y A;  2DAQ A;  5IN1 A;  5KCH A;  3MP8 A;  2RI2 A;  3NTK A;  5CIU A;  4IUV A;  4GY5 A; 
#chains in the Genus database with same CATH topology
 1N6A A;  2YRV A;  2FRY A;  1B34 A;  1KQ1 A;  2DJZ A;  3GOX A;  3O5Z A;  4JJC A;  4M78 E;  3OMC A;  5IHN A;  2DVE A;  3HL8 A;  1PRM C;  1VQM Q;  3JB9 D;  1OU8 A;  2KEA A;  4OF1 A;  1VQ8 A;  4RCB A;  4HA8 A;  2K3X A;  1YIT T;  4E7Z A;  3H6Z A;  5KYU B;  1U5S A;  3MP1 A;  3ZL7 C;  4CC2 A;  4BE0 A;  1BIA A;  2DPP B;  1KD1 R;  4M75 A;  1YI2 A;  3TVT A;  1XNI A;  2RD1 A;  2XHC A;  2HSE B;  1YI2 Q;  3JB9 H;  5GAO m;  2CS7 A;  1XTD A;  2K9G A;  2RH2 A;  4Y92 A;  1IO6 A;  1YP5 A;  2CH4 W;  1M1K R;  1QLY A;  5KYY B;  1X43 A;  3RKX A;  3CCJ A;  1B34 B;  4L6V 5;  5IT9 E;  3I5S A;  1UE9 A;  4GBQ A;  4M75 B;  4PJM A;  4M7A D;  2EBP A;  1FX7 A;  1QWF A;  1YBY A;  1BI1 A;  1G3Y A;  2RJC A;  4OMN A;  1Q81 U;  4F7U F;  1B07 A;  1M2O A;  1CKA A;  3RMQ A;  1OZ2 A;  1WNL A;  1FXX A;  4M77 G;  1QVF A;  1VQK Q;  3M9Q A;  1MMA A;  3JCM P;  2K5I A;  3SEM A;  1D0Z A;  2DIL A;  3X25 B;  8AT1 B;  2KVQ G;  3CME Q;  3E9F A;  3CBP A;  3IQL A;  4ELZ C;  3PVQ A;  2CZ7 B;  2HQH A;  3LYI A;  3QXE B;  4DBH A;  2RQV A;  2XU8 A;  3JRZ A;  1AWX A;  4IUQ A;  3OS1 A;  4XAX B;  3G4S A;  2JZ2 A;  3FEO A;  1Y0M A;  3O8V A;  2A08 A;  1X6O A;  1H3H A;  1GFD A;  1YHQ T;  3OA6 A;  2PVG B;  3ZFJ A;  4RTT A;  5LJ5 g;  2E70 A;  3M4G A;  3LW5 E;  1G3W A;  1Q82 U;  2XI9 A;  2QGG A;  3V7R A;  5GMK h;  2QQS A;  2X35 A;  1Q86 U;  1VQP Q;  1PKS A;  2LCL A;  2RQT A;  3CCL Q;  1VQM A;  1BI3 A;  1AWJ A;  2GQV A;  2ED1 A;  1X2K A;  3THK A;  4IKF A;  4E7S A;  3SWN A;  1D09 B;  3A8G B;  2YUN A;  1I1J A;  2QEX Q;  2VXF A;  4ZTF A;  4M77 E;  4O5V A;  2KT1 A;  2R5A A;  2DET A;  2DL5 A;  2NUZ A;  1OPK A;  4LDV A;  2V1Q A;  3PNW C;  3KXT A;  3HRT A;  1NJI R;  2NWM A;  1VQ5 T;  1UUE A;  2MK5 A;  4A53 A;  3M0U A;  1KFZ A;  1VQL Q;  1UB4 A;  2R5M A;  4JZ4 A;  2EYQ A;  3P8B B;  4KUI A;  2O9S A;  3CMA A;  1T0H A;  2KDS A;  3M58 A;  2RHI A;  5HK3 A;  2OTL T;  5GAO l;  2ZPG B;  3L2Z A;  1OX8 A;  1RAC B;  3TSZ A;  2R57 A;  4J8O A;  1I5O B;  1SRL A;  2ZPF B;  4OMQ A;  3E9G A;  4M77 D;  2D6F A;  1TXQ A;  2LNH B;  1C0M A;  1GXI E;  2COY A;  2KY9 A;  1VQP T;  3OYM A;  3EG2 A;  3JB9 F;  1V1C A;  1VQ9 T;  2DM1 A;  4FW1 A;  1ZUK A;  2IVW A;  4KGX B;  2L3Q A;  5HY6 A;  4AMC A;  1WFW A;  5GAO p;  3CCU A;  1Q82 C;  2KRM A;  1ABQ A;  1VYV A;  4E2F B;  5GMK i;  1NBE B;  4O6J A;  1RAH B;  1TOV A;  1PNJ A;  3QBY A;  4N0A C;  4ZGE B;  2K3Y A;  2DZ9 A;  3NMZ C;  2PZ1 A;  2QAS A;  1Q7Y U;  2MYS A;  2QTV A;  2H3E B;  4EIK A;  1Y7X A;  4PJL A;  5IHI A;  3KUF A;  5HK0 A;  5EC7 A;  2L8D A;  3PIP A;  1S72 Q;  3EG1 A;  1VQK A;  5LJ5 e;  1VIF A;  5LJ3 j;  4PJO D;  4M7A E;  1JEG A;  3CCR T;  3JCM c;  3CCE Q;  3R6O A;  1PKT A;  2FPD A;  2DKG A;  1VQ7 T;  3JCM e;  5GMK l;  1KG1 A;  5CVI A;  2XMF A;  1RAG B;  4ESR A;  1WXU A;  2FHD A;  2GFA A;  5GAN h;  4RTX A;  5FU6 C;  1C1A A;  4C5G A;  4V2S A;  2ENM A;  3MHX A;  4M7D G;  2J6K A;  1Z9Z A;  1UFF A;  3SB2 A;  5IHK A;  2V1R A;  2JS0 A;  3GLX A;  1KHI A;  4FYY B;  1NYG A;  2PVD B;  4MMK A;  1FMK A;  3CCR A;  4HCC A;  2Y4Y A;  4A4E A;  5A0D A;  2D0Q B;  3OY9 A;  4FW2 A;  2K2V A;  4BUG A;  1OUL A;  2AKK A;  5FW9 A;  1HD3 A;  2GNC A;  3E2U A;  4WCI A;  1RAA B;  5D6X A;  2YHT A;  3H8Z A;  1RUW A;  1KC8 U;  3L2U A;  1NLO C;  2K7A A;  3G71 Q;  3CMA T;  2DRK A;  2WAC A;  2KMT A;  1ZSZ C;  2DX1 A;  4FT2 A;  2RF0 A;  1AZE A;  3CCV A;  2E3I A;  1W6X A;  2LNV A;  2DEU A;  2OAW A;  3A8L B;  5L23 A;  3CXC S;  3VYH B;  3CD6 A;  3PGG A;  4OB3 B;  2BE7 D;  4JLG A;  1UGS B;  4J9H A;  2O88 A;  1NZ9 A;  3CC2 T;  2F2V A;  2QK0 A;  3PMT A;  4LNP A;  4E7H A;  3FJP A;  4LD6 A;  4DEY A;  5C0M A;  3KBG A;  1R8O B;  2YDL A;  2YUO A;  1YJW T;  2AHJ B;  3EGU A;  3VRZ A;  3LGF A;  3CC7 Q;  2RHZ A;  4MML A;  4C92 D;  1RI0 A;  3VS1 A;  3JB9 I;  2LQN A;  4Y28 E;  2W0Z A;  1M1F A;  1RL2 A;  2LJ3 A;  2RQU A;  2I0N A;  2EJF A;  4BAC A;  3JCM J;  2D8J A;  3QZ5 B;  1N8R U;  5DLQ E;  1BI2 A;  1PM3 A;  2M1H A;  4GLM A;  4XTY A;  2L3S A;  2FVU A;  3V8K A;  1UJY A;  5I22 A;  2E5Q A;  1M2V A;  5D6W A;  1K9A A;  2DIG A;  2GFU A;  2P0K A;  4L5G A;  1VQN Q;  2HEQ A;  4JJB A;  4FM4 B;  1EZZ B;  4J7F A;  2NUT B;  2JTM A;  1D1B A;  4K11 A;  2M0O A;  2IIM A;  2FRW A;  5CKB A;  3MCA B;  4AG1 C;  4DOW A;  3PVL A;  4N0A A;  4JRQ A;  2ZAE A;  1S72 T;  1OV3 A;  5J39 A;  3OYK A;  2VKN A;  2DXC A;  3EFS A;  3GNG A;  1RAF B;  3I55 T;  3MEV A;  2CP6 A;  4EPC A;  4A54 A;  1UEC A;  3J80 E;  4Z8A A;  4M78 D;  1M9S A;  4XU3 A;  4A4K A;  1VQ6 Q;  2DEQ A;  3BW1 A;  1I81 A;  4E47 A;  1EFN A;  2MMP A;  3SDZ A;  1HXD A;  3BE3 A;  2L3R A;  1NJI U;  1CSK A;  1UGQ B;  2MI6 A;  2AIR B;  1M90 U;  2FYK A;  2J05 A;  4PLL A;  4X9C A;  5GJW B;  3TU4 K;  1NEB A;  2LDM A;  4N4I A;  4C0Z A;  3V7S A;  1IZ6 A;  1YNZ A;  1VQO Q;  2EQJ A;  4Z89 A;  1C6V X;  1VQ8 Q;  2MAM A;  4ZN1 A;  2EYW A;  1RAD B;  2V26 A;  3UA7 A;  3RIR A;  3QG1 A;  3FB9 A;  3UT1 A;  2RK1 A;  1G3T A;  3EGX B;  2EIF A;  3CXC A;  3M57 A;  1VQ6 A;  1AEY A;  4C92 F;  4JJN K;  2NUP A;  2OAU A;  2HCK A;  1TG0 A;  2QXF A;  1PCX A;  4E7J A;  4DBF A;  2VVK A;  3FRN A;  4D6W A;  2RQR A;  3V8L A;  3NTH A;  3CME T;  4F7U B;  3EG9 B;  3OYC A;  3TQ7 P;  4XQ3 A;  4C5H A;  2EQM A;  2VYT A;  2YSQ A;  5GJV B;  4AFZ C;  4QKU A;  3CCJ T;  3DKM A;  3OYF A;  4FYX B;  1ZLM A;  2FEI A;  2X9H A;  2ZCF B;  2EGC A;  5GAN g;  1OX9 A;  4BI8 B;  3C95 A;  2DXU A;  3BFM A;  1BK2 A;  4II1 A;  1VQ6 T;  3EGD A;  1OYX A;  2WSE E;  1X75 C;  2FG0 A;  2GTJ A;  4M78 A;  3OYD A;  4M75 D;  2COW A;  2DVJ A;  8ATC B;  1WHJ A;  2KRN A;  1YHQ Q;  3NFC A;  3MP8 A;  1Q81 C;  3GIB A;  5LJ5 h;  1Z9Q A;  1PSF A;  1MV3 A;  3SD4 A;  3I55 Q;  2E1H A;  4C8Q D;  1YIT Q;  2HMA A;  2EQK A;  1O9S A;  5CKH A;  4M78 C;  2MCN A;  1ZBX A;  5FWB A;  2QEX T;  5FU7 C;  2BZY A;  4ZTJ A;  2XG8 D;  3RMS A;  5KE3 A;  4J7I A;  2VUB A;  4LDU A;  2PUK B;  2B8A A;  2MWP A;  2E6Z A;  1JBM A;  2AK5 A;  1BBZ A;  1QVP A;  1EX4 A;  2PQW A;  2HBW A;  2JS2 A;  2ROT A;  4RKU E;  3OYY A;  2AT1 B;  5FRN A;  3VS6 A;  1W1F A;  4M7D B;  5LJ5 j;  1MNE A;  1SSH A;  1YJN T;  4PL6 A;  1K4U S;  1XOV A;  4J9C A;  4J9G A;  4OMM A;  1D1A A;  5CCA A;  2QDY B;  1QQJ A;  3EH2 A;  4M7D A;  2P0Q A;  4JZ3 A;  1VQL A;  1YI2 T;  3A98 A;  5I2M A;  3VJP A;  4C92 A;  3CMA Q;  3INZ A;  1QVG P;  4Z88 A;  3QKJ A;  3OYN A;  4XTW A;  2X4J A;  4F14 A;  2ZGW A;  1MHN A;  1CKB A;  3EG3 A;  4PK4 A;  3CC4 A;  2RHY A;  3CC2 Q;  2L2P A;  3CC4 Q;  4MZP A;  5CKF A;  2XK0 A;  5FRO A;  2BIV A;  1OQK A;  3JB9 G;  3E19 A;  2F1L A;  4L59 A;  1RI9 A;  1TUC A;  3QJ6 A;  2E5K A;  3EGX A;  3PFS A;  4M75 F;  1AWW A;  1BU1 A;  2NLU A;  1M8V A;  2CT3 A;  2CT4 A;  2KXC A;  3CPF A;  1YJN Q;  3G6E A;  4HT8 A;  1YJN A;  4M75 G;  5IXF A;  1WHM A;  3H0H A;  2V8I A;  3VS3 A;  1WHL A;  2HD0 A;  2YUQ A;  4J6X A;  1E6H A;  1K76 A;  4TVR A;  2HAX A;  2PUO B;  4QVZ A;  1S1N A;  3G71 T;  2HL5 C;  3BY7 A;  4RMO A;  2KYM A;  3QWY A;  2CZ1 B;  1Q82 R;  3GF5 A;  2RJF A;  2AZV A;  3CC7 A;  3EG9 A;  4Y91 A;  1LCK A;  2K5F A;  4C5E A;  1K0X A;  3OS0 A;  1NPP A;  3SHW A;  4C0G A;  1WQ7 A;  4OMP A;  1W4S A;  1BYM A;  3CC4 T;  3L2Q A;  1AVZ C;  1A0N B;  1Q7Y C;  2W10 A;  4RG2 A;  1H3Z A;  4RTY A;  2KQW A;  4LE9 A;  3URG A;  5CR2 A;  3HRS A;  1NEG A;  1KHC A;  3R6N A;  2VV5 A;  4C0D B;  2O4X A;  4PJO A;  2DO3 A;  3NGP A;  4C8Q B;  1QCN A;  1VQP A;  3S3O A;  3J7A F;  4BD3 A;  3UA6 A;  1QVF P;  2RJD A;  3EHR A;  3V7C A;  6AT1 B;  4BY6 B;  3UPU A;  1HJD A;  1VQ4 T;  1RAE B;  4EMG A;  3DB4 A;  2DL8 A;  2DNU A;  1OI1 A;  2MOX A;  1PD0 A;  2C06 A;  4M4Z A;  2QA4 A;  1BB9 A;  1WXB A;  2GGR A;  2OI3 A;  1IGU A;  3WXM B;  4HVU A;  4B9W A;  2K5L A;  3D7S B;  2EPD A;  2CRE A;  3PIO A;  4JRP A;  3PTA A;  5I21 A;  3CCU Q;  4MZM A;  1PC0 A;  3CD6 Q;  2B86 A;  2SRC A;  2HBP A;  4CI0 C;  2MF2 A;  5LJ5 d;  1K8A R;  2J7I A;  2RI3 A;  3QUI A;  1WX6 A;  1VQ9 Q;  5GAN 6;  2RI2 A;  3G1J A;  3VUB A;  1FWZ A;  1WHH A;  3LH5 A;  3S3N A;  3ME9 A;  3FC3 A;  1U3O A;  2G6F X;  3FLG A;  1UGP B;  2BTT A;  1AWO A;  3JCM g;  1ZHI A;  3QO3 A;  4HKE A;  5GAN 3;  4BB7 A;  1M27 C;  3M54 A;  4M7A A;  3UAT A;  4KUD K;  5FU7 B;  3CXC P;  1I07 A;  1IHW A;  3JCM f;  1BI0 A;  4FL6 A;  3X20 B;  3CEY A;  1M90 R;  2LT4 A;  4QQD A;  2O31 A;  3CCM A;  1TUG B;  3M4Y A;  2QA4 T;  5GAN e;  3X24 B;  3TSW A;  3JSC A;  4R56 A;  4JS5 A;  4X1V A;  5KE2 A;  3VS5 A;  5C6S A;  2EYY A;  3P8D A;  1WLP B;  2Y90 A;  2HKQ B;  4XTU A;  5GAM j;  2M16 A;  2IG0 A;  4M7A B;  4BI4 A;  1LNX A;  1PD1 A;  1O75 A;  3HPW A;  1D1C A;  1M4Z A;  3QWX X;  1QW1 A;  4FSX A;  4M78 B;  4C8Q F;  2K6D A;  2XIC A;  3REA B;  3ZBD A;  2V8J A;  4OB2 B;  1NE8 A;  4BDZ A;  2X4W A;  5CAI A;  1ARK A;  4A4F A;  2O9V A;  2RN8 A;  1SKU B;  2KBT A;  2A36 A;  2LMJ A;  1K9M R;  5J3B A;  3CBM A;  1QVG A;  1FYN A;  2DZC A;  2VWF A;  4J9I A;  3FDR A;  3HRU A;  1T3S A;  4AFS C;  3P8H A;  2VGM A;  1UTI A;  4F7U A;  2JVV A;  1G2B A;  1VQ7 Q;  5KYX A;  2OTL A;  1WDX A;  2EQI A;  5IN1 A;  2XDD A;  1DJ7 B;  3U23 A;  1BIB A;  3H0I A;  3SWN C;  5KYY A;  1KQ2 A;  1K73 R;  1WZO A;  2GCX A;  2DYB A;  4QVD A;  5GMK m;  4M78 G;  2JN0 A;  4LDW A;  1SF9 A;  4RTV A;  3HTR A;  2QA4 Q;  2MPX C;  3QJY A;  4QQ6 A;  1HK9 A;  4M7D D;  1GRI A;  2E64 A;  5A0G A;  3CC2 A;  3CCU T;  2OTJ A;  4B6M A;  5FLX E;  1WGS A;  1WQW A;  5M9O A;  2JMC A;  2CP7 A;  3M55 A;  4RTU A;  2X3X D;  3CCM Q;  1D3B B;  1KC8 R;  4F17 A;  1N9S A;  1AHJ B;  2PU9 B;  2WSF E;  3CCQ A;  5GAM d;  2VXE A;  4NS5 A;  4EMK C;  1VQN T;  1Y07 A;  4CC7 A;  4A4H A;  1QMC A;  1Y71 A;  4RUG A;  3L1A A;  2MIO A;  3DB3 A;  2XDP A;  2RM4 A;  4GLK A;  2F69 A;  5CK9 A;  2LC4 A;  1QP3 A;  4JUV A;  4JRI A;  4C8Q E;  2EFI A;  3JCM W;  2LZ6 B;  5GMK j;  1E6G A;  3OMG A;  2DD5 A;  2LT1 A;  3MP6 A;  1M1G A;  2RNA A;  1Q86 R;  2CUB A;  2RO0 A;  3FJ5 A;  2LX9 A;  1VQ5 A;  1V76 A;  2I2L A;  1ZSZ B;  4FYV B;  3CD6 T;  4C8Q A;  1NYF A;  2BUD A;  1D3B A;  1YCS B;  4M7A F;  5EG2 A;  1JB0 E;  2HSP A;  2CP3 A;  2HL3 A;  5KYW B;  3QYH B;  1M1K U;  3C0C A;  3RBB B;  5DY9 A;  4F16 A;  1VIE A;  5GAN d;  1R0C B;  2M9U A;  3I56 T;  4NOY A;  4AFU C;  1WJS A;  3ASK A;  4N4H A;  2E3H A;  4IUT A;  4M77 F;  2DTO A;  4M75 E;  2CZ6 B;  5KYN A;  3JCM X;  5GAN 4;  3NTK A;  1SHF A;  4KGV B;  2NUP B;  2JMA A;  1B7T A;  2DTI A;  2EYZ A;  3EAE A;  3VS4 A;  2KSS A;  4OP0 A;  4KT0 E;  2FZK B;  4XK8 E;  4IUU A;  1VQN A;  5LJ3 e;  2YLB A;  3GP8 A;  4HXJ A;  3L42 A;  2P4R A;  3A1P A;  2DYI A;  3CCS A;  2F2W A;  3VYG A;  2AKL A;  4C92 E;  3I56 Q;  3G71 A;  4ZN3 A;  1YIJ Q;  3VV0 A;  5CQY A;  2OX7 A;  3I56 A;  1X6G A;  3HKS A;  3QII A;  1GCP A;  1KD1 C;  3OYJ A;  2F5K A;  1AOJ A;  2P4T A;  1AT1 B;  1QVG S;  3CC7 T;  5D7U A;  2H8H A;  1U1T A;  3MO8 A;  1SSF A;  1KD1 U;  3EFR A;  1MUZ A;  4AFQ C;  4JPB W;  1YJ9 A;  1WHG A;  2GF7 A;  5GAN 2;  2DTH A;  3OYA A;  5FWC A;  2FPE A;  2JUF A;  1ZUY A;  3L2W A;  3A8O B;  4QVC A;  2DXB A;  1YJW Q;  4HCK A;  2DL4 A;  1NM7 A;  1ZX6 A;  3SWN B;  2LQW A;  4P5N A;  5GAN j;  2CDT A;  2DL7 A;  3S3M A;  2VC8 A;  1EIF A;  3WVD B;  3VUZ A;  1H64 1;  2DFU A;  1YWP A;  1WJR A;  1W70 A;  1I4K 1;  1TH7 A;  3S6W A;  4XU0 A;  2QQB A;  4E7K A;  2CGH A;  1VQL T;  4XU2 A;  2D0N A;  3OSV A;  1Y96 A;  1WHK A;  2YRC A;  3VKI A;  5GAO q;  3JCM V;  1UGV A;  1WIE A;  2JM8 A;  1YHQ A;  4CRI A;  1T0J A;  4OB1 B;  1LVK A;  1NJI C;  2LCS A;  1NPR A;  1UHC A;  2CP2 A;  2NUT A;  2CSI A;  1K9M U;  2CYZ B;  4BDY A;  3BDL A;  3QYG B;  4WF2 A;  5IXB A;  1K8A U;  2DF6 A;  2DLP A;  2DRM A;  2A3L A;  3X28 B;  2DBM A;  3MEU A;  1ACM B;  4RTW A;  3VS2 A;  4BE1 A;  2OJ2 A;  4ATO A;  3ULR B;  1Q86 C;  4KBM B;  2E10 A;  2Z0W A;  1PSE A;  4F04 B;  2E12 A;  2GTO A;  1Q95 G;  1ZUU A;  2DA9 A;  2LCC A;  1JXO A;  5GAM h;  1QCO A;  2JT4 A;  1NLP C;  4C92 G;  1V29 B;  2CSQ A;  2HQE A;  3OS5 A;  1Q7Y R;  7AT1 B;  3I9Q A;  5A0L A;  3M0T A;  3G4S T;  5J26 A;  3C12 A;  1H8K A;  4EMK B;  4KRT A;  2JXB A;  3M5A A;  3JCM d;  3TCJ A;  4C92 C;  1OPL A;  2COZ A;  2VB6 A;  1U1S A;  2VAS A;  3QPH A;  4RCC A;  4VUB A;  4PJO E;  4J83 A;  2X51 A;  2L5Q A;  2L89 A;  3HSB A;  1BKB A;  2FO0 A;  5GAN f;  3M56 A;  3WVE B;  3SFM A;  4J5Y A;  1G5V A;  2HKN A;  1LJO A;  2OTJ Q;  1K73 C;  4D8K A;  2XID A;  1RAB B;  4RG8 A;  4DA4 A;  2YLC A;  1FMW A;  4KH0 B;  1VQ4 Q;  3C4S A;  2DE0 X;  1I0C A;  3EH1 A;  4M77 A;  5LL6 S;  1VQ4 A;  1X69 A;  1K9M C;  1IRE B;  1OEB A;  3DLM A;  2DMO A;  3RER A;  2BZ8 A;  2YT6 A;  2ZPB B;  3AT1 B;  1K8A C;  5KYW A;  3N5B B;  1P92 A;  2E4H A;  1PHT A;  4JS4 A;  2E41 A;  4IUV A;  2LP5 A;  2O4X B;  1KC8 C;  2OTJ T;  2CH4 A;  2EGA A;  1M3B A;  4J9E A;  2L0A A;  2EWN A;  4F7U G;  2AZS A;  2CZ0 B;  1IHV A;  1VQ5 Q;  3RES A;  2DL3 A;  3H9N A;  1GL5 A;  5GAM f;  2QQR A;  1OZ3 A;  3MEW A;  3M0Q A;  3LH0 A;  2FPF A;  2LQ8 A;  5KYX B;  4PJO G;  4OML A;  4LD9 K;  1HYO A;  2J6O A;  3M0P A;  4M7D F;  3LGL A;  3QSU A;  4LDY A;  2EVR A;  1RAI B;  5AYF A;  2LJ1 A;  3L2R A;  1VYT A;  3EFO B;  1MND A;  9ATC B;  2LRQ A;  3EGD B;  2IPO B;  4LUD A;  3RUX A;  3VS7 A;  1W2B P;  2D1X A;  3REB B;  2ABL A;  3CPW S;  1VQO T;  2CP5 A;  3M0S A;  3NTI A;  4E7L A;  4KGZ B;  4FCY A;  3RR6 A;  3Q1J A;  2VGN A;  4R0K A;  1Y57 A;  2A37 A;  1M8M A;  3I55 A;  1QKW A;  3MJX A;  1HSQ A;  1PG5 B;  2ROL A;  3L2V A;  4DEX A;  4J9D A;  4PJO F;  1JJ2 P;  4NL2 A;  1N9R A;  4JRK A;  2A7Y A;  1K73 U;  4QT7 A;  4C5I A;  5GAO n;  2M0Y A;  4AT1 B;  3OBW A;  3OQ5 A;  3CCS Q;  5IH2 A;  1JJ2 S;  2QAZ A;  4FSS A;  4PJO B;  4UC4 A;  4XTV A;  4ZNX A;  3OS2 A;  1D0Y A;  2EGE A;  5I2S A;  2RI5 A;  3OYL A;  1N8R R;  2P84 A;  3OYG A;  3LWI A;  2LTO A;  4KH1 B;  1VQ7 A;  5GAM g;  4OB0 B;  1PWT A;  3OB9 A;  2K3B A;  4XTX A;  2HNI A;  3H41 A;  2JOY A;  1UHF A;  2H3J A;  4C0D C;  2JNG A;  3RKY A;  2QDL A;  5CIU A;  2EKH A;  1MMN A;  3A8H B;  3JB9 J;  2BE9 B;  3CBO A;  2EKO A;  1Y96 B;  1VQK T;  4ANJ A;  1XJW B;  3HFN A;  2EQU A;  1YIT A;  2FB7 A;  4C92 B;  2ED0 A;  1M3A A;  4HVV A;  2NYS A;  3CCL A;  4OMF B;  1FMV A;  4BY6 C;  2QG9 B;  3UF4 A;  1E7O A;  2XDB A;  3OYI A;  4LXC A;  2E6N A;  2CP0 A;  3ER0 A;  1ZQ1 A;  1KIK A;  4IIO A;  4ZGJ B;  2D8H A;  1N27 A;  1X6B A;  3MKD A;  1KSW A;  3LLR A;  1R77 A;  2MWO A;  4DQ2 A;  5GAN 7;  1JQQ A;  4HT9 A;  1LPL A;  3F70 A;  3JCM b;  2KK4 A;  4XTZ A;  4MDW A;  3PE0 A;  3OSS C;  3JCM Q;  4PLI A;  1YFN A;  2HQX A;  1PRL C;  4M7D C;  4FYW B;  4EMH A;  3KFV A;  4JJD A;  4FIB A;  2KE9 A;  3CCV T;  5LJ3 d;  4MZT A;  3FIF A;  1UDL A;  2YXY A;  2Y4X A;  1QP2 A;  5A2Q E;  1T3L A;  2J06 A;  1VOM A;  4YTL A;  2JTF A;  1YIJ T;  2RQW A;  4KUL A;  3OYE A;  3E1S A;  4A4G A;  3LX7 A;  2LVM A;  3CCE A;  1UGR B;  1OOT A;  1SPK A;  3TRE A;  1YCY A;  4ORZ A;  4R55 A;  1IGQ A;  3QHS A;  3M53 A;  4Q5W A;  4M77 C;  4XU1 A;  2ECZ A;  1U06 A;  1IXD A;  1VUB A;  4PJJ A;  2ESW A;  4OMO A;  2KGT A;  2BZX A;  4DBR A;  2J6F A;  2KNB B;  4PFP A;  4WTO B;  1VQM T;  3GBQ A;  4ELY C;  2DAQ A;  3CPW A;  5KCH A;  1JRI A;  2L3P A;  1MMG A;  2YRD A;  1QWE A;  4OGC A;  5CKD A;  3ZEH A;  1TTH B;  2C0T A;  2EW3 A;  1RLP C;  3EHQ A;  1TUD A;  3I35 A;  3C94 A;  4F7U E;  2K57 A;  1WYX A;  2HZY A;  4E7I A;  1M2V B;  1ZBJ A;  3GNF B;  4HCB A;  2EAY A;  3TEE A;  1VQO A;  4MDX A;  4BE2 A;  5GAM e;  3HP9 A;  1ZSG A;  1SRM A;  4J9F A;  4EMK A;  1M90 C;  2GQI A;  2DER A;  4QW2 A;  1MGQ A;  4DOV A;  3CCE T;  1IB8 A;  2P0P A;  4M75 C;  1GBR A;  1QKX A;  4QQG A;  5LJ5 f;  4J9B A;  3CCL T;  1YJ9 Q;  4PJN A;  5HCK A;  4X34 A;  2RMO A;  2D9T A;  4B9X A;  2DBK A;  2FZG B;  3QDF A;  1VQ9 A;  1N5Z A;  2C0I A;  1RLQ C;  2C0O A;  1QVF S;  4M78 F;  3RDV A;  2LX7 A;  2V8K A;  2ZPH B;  4RTZ A;  4HVW A;  3NHN A;  2YUP A;  5HKC A;  4J6W A;  1R0B G;  4DBQ A;  1Q81 R;  1WXT A;  1ZA1 B;  1G8X A;  4E6R A;  2DIQ A;  4OVA A;  2RB6 A;  2EJ9 A;  5IAY A;  1J3T A;  3M0R A;  2KRO A;  2JM9 A;  2G3R A;  3UDC A;  3HFO A;  5GAN 5;  1X2Q A;  3EG0 A;  3MEA A;  5CKE A;  3MPU B;  3BDU A;  4PFZ A;  5CQX A;  4C0F A;  1VYU A;  2RPN A;  2QTX A;  3CCJ Q;  2QYZ A;  1GBQ A;  2K4Y A;  1GCQ C;  1GFC A;  4BI3 A;  1AZG B;  5CO7 A;  2RK2 A;  5FU6 B;  4GY5 A;  5L8R E;  3CCM T;  1WA7 A;  1K1Z A;  2YWW A;  1WJQ A;  1U8R A;  1OU9 A;  5GAN 8;  3VRY A;  1JXM A;  1TS9 A;  3A5Z B;  2KT8 A;  4J6Y A;  2LQK A;  2O2O A;  1AD5 A;  5LJ3 g;  3CME A;  1WI7 A;  5LJ3 h;  4PFO A;  4ZGD B;  3G4S Q;  4CC4 B;  2CKK A;  2A0F B;  4IUR A;  3RNJ A;  4M77 B;  4PNO A;  4FU6 A;  3G7Z A;  4LDX A;  2FL7 A;  1UG1 A;  4FT4 A;  2F5T X;  3CCS T;  3OYB A;  3NPF A;  1G83 A;  1UJ0 A;  2DJQ A;  4ME7 A;  2JJ9 A;  4D8D A;  3GPL A;  5GAO r;  1UEB A;  5AT1 B;  1H92 A;  2R58 A;  3RKW A;  2LJ0 A;  1VA7 A;  2ZZD A;  4LUE A;  5DM7 R;  3OW2 P;  4PKC C;  3HHT B;  2KI7 A;  2XD0 A;  1G3S A;  2BKD N;  1F1B B;  5KH6 A;  3AHU A;  4N4G A;  5FRM A;  1KJW A;  2SEM A;  4NL3 A;  2ZPI B;  2PTK A;  1MV0 B;  2QEX A;  4CC3 A;  2JW4 A;  2HDA A;  3JV3 A;  1JJ2 A;  2KYB A;  2X3W D;  2M02 A;  2DK3 A;  2DXT A;  2GBQ A;  3A8M B;  5KYU A;  2QGF B;  3CCV Q;  2QI2 A;  4EDU A;  4C8Q C;  3LWH A;  2K2M A;  4M7A C;  5KCO A;  3I5R A;  1X01 A;  2RHX A;  1XQH A;  3DLL A;  3MET A;  1KQS P;  1K0S A;  1YJW A;  4M7A G;  4JLI A;  4IIM A;  1N8R C;  2ATC B;  5DLO A;  4OGE A;  3JAM E;  3UWN A;  5LJ3 f;  1BCO A;  1M30 A;  2M51 A;  1VQ8 T;  3X26 B;  3JCM h;  1YWO A;  3CPW P;  5D6Y A;  2K79 A;  2RJE A;  2E65 A;  3QZ9 B;  1KQS S;  1ZSZ A;  4JDS A;  3VU3 C;  4LN2 A;  2FZC B;  3T9N A;  4A63 B;  1KQS A;  1D0X A;  1ABO A;  1QCF A;  3V8J A;  4X9D A;  3VS0 A;  2QQ9 A;  1SHG A;  1SEM A;  1TSF A;  2PNI A;  4Z02 A;  1M3C A;  2KAF A;  4M7D E;  4IUP A;  1GCQ A;  2EJG A;  2O01 E;  1I5L A;  2A28 A;  2KRS A;  4HCZ A;  4PJO C;  1JO8 A;  3CCQ Q;  3PT9 A;  3H0F A;  3OBY A;  1M5Q 1;  2X4X A;  3OYH A;  3G6E Q;  1KK7 A;  2CUD A;  3OW2 S;  3M59 A;  5GMK e;  1S72 A;  1B3Q A;  1TU0 B;  3OW2 A;  3G6E T;  2JTE A;  5I11 A;  1BCM A;  3CQT A;  2RA2 A;  1JU5 C;  5ECA A;  3J81 E;  2F2X A;  3CCQ T;  2DD4 A;  1SG5 A;  4AG2 C;  3QDR B;  2KXD A;  2X4Y A;  1M1K C;  1YIJ A;  2EYX A;  2WSC E;  1YJ9 T;  2RHU A;  1IRX A;  1I8F A;  1YN8 A;  1WPY A;  1TWB A;  3EFO A;  1LOJ A;  1W2B A;  1ZA2 B;  1NG2 A;  2QQA A;  3PMI A;  2OTL Q;  2PVO B;  1W2B S;  3CCR Q;  1X27 A;  4C8Q G;  2XKO C;  2ZPE B;  2KR3 A;  1MMD A; 
#chains in the Genus database with same CATH homology
 3CBO A;  1BIB A;  1N6A A;  1Y96 B;  2EKO A;  2MMP A;  3SDZ A;  2YRV A;  3SWN C;  1VQK T;  1KQ2 A;  1HXD A;  2GCX A;  1B34 A;  3HFN A;  1KQ1 A;  2EQU A;  2L3R A;  2DJZ A;  4QVD A;  5GMK m;  3GOX A;  4M78 G;  2FB7 A;  4C92 B;  1YIT A;  4M78 E;  1NJI U;  3OMC A;  2DVE A;  1UGQ B;  3CCL A;  2JN0 A;  4OMF B;  3HL8 A;  2MI6 A;  4BY6 C;  1M90 U;  2FYK A;  4LDW A;  4PLL A;  4X9C A;  3JB9 D;  3TU4 K;  2LDM A;  2XDB A;  3OYI A;  4N4I A;  4C0Z A;  2E6N A;  3QJY A;  4OF1 A;  4QQ6 A;  3V7S A;  1HK9 A;  1IZ6 A;  3ER0 A;  1ZQ1 A;  4M7D D;  4ZGJ B;  2E64 A;  1VQ8 A;  1N27 A;  4HA8 A;  4RCB A;  2K3X A;  2EQJ A;  1YIT T;  3H6Z A;  2MAM A;  5A0G A;  4ZN1 A;  3CC2 A;  3CCU T;  2OTJ A;  3MP1 A;  5FLX E;  3LLR A;  4BE0 A;  1WGS A;  1WQW A;  5M9O A;  1BIA A;  3M55 A;  2DPP B;  2MWO A;  4M75 A;  4DQ2 A;  5GAN 7;  1YI2 A;  4HT9 A;  1XNI A;  1D3B B;  2RD1 A;  2XHC A;  3F70 A;  3QG1 A;  2KK4 A;  4XTZ A;  3RIR A;  3JCM b;  3JB9 H;  5GAO m;  3FB9 A;  2CS7 A;  1XTD A;  2RH2 A;  4MDW A;  3UT1 A;  1N9S A;  3JCM Q;  3OSS C;  2RK1 A;  1G3T A;  1AHJ B;  2PU9 B;  2WSF E;  4PLI A;  3RKX A;  3CCJ A;  3CCQ A;  5GAM d;  2VXE A;  1B34 B;  4NS5 A;  2HQX A;  4EMK C;  1VQN T;  1Y07 A;  4L6V 5;  4A4H A;  2EIF A;  5IT9 E;  4M7D C;  1Y71 A;  3CXC A;  3L1A A;  3M57 A;  3DB3 A;  4C92 F;  2XDP A;  4JJN K;  2OAU A;  2RM4 A;  4GLK A;  2F69 A;  4M75 B;  4EMH A;  2LC4 A;  5CK9 A;  1QP3 A;  4JUV A;  4JRI A;  2QXF A;  4C8Q E;  2EFI A;  4FIB A;  3CCV T;  5LJ3 d;  4E7J A;  3JCM W;  4M7A D;  4MZT A;  1FX7 A;  1YBY A;  3FIF A;  5GMK j;  1BI1 A;  1G3Y A;  2RJC A;  2Y4X A;  1Q81 U;  1QP2 A;  4F7U F;  3OMG A;  2DD5 A;  2LT1 A;  5A2Q E;  3FRN A;  3RMQ A;  1OZ2 A;  1M1G A;  3MP6 A;  3V8L A;  1WNL A;  1FXX A;  2RO0 A;  4D6W A;  3NTH A;  4M77 G;  4F7U B;  3CME T;  1QVF A;  4YTL A;  3OYC A;  3M9Q A;  2JTF A;  1YIJ T;  2LX9 A;  1VQ5 A;  4KUL A;  2I2L A;  2K5I A;  4XQ3 A;  4C5H A;  3JCM P;  3OYE A;  3CD6 T;  2EQM A;  2VYT A;  3E1S A;  3X25 B;  4A4G A;  2KVQ G;  4C8Q A;  3LX7 A;  2BUD A;  2LVM A;  1D3B A;  3E9F A;  3CCE A;  3CCJ T;  1UGR B;  3CBP A;  3DKM A;  3OYF A;  4M7A F;  5EG2 A;  1JB0 E;  3TRE A;  4ELZ C;  2CZ7 B;  3LYI A;  2ZCF B;  3QXE B;  1YCY A;  2XU8 A;  3JRZ A;  5GAN g;  4BI8 B;  3C95 A;  2DXU A;  4R55 A;  4IUQ A;  3BFM A;  4II1 A;  3OS1 A;  1VQ6 T;  4XAX B;  3QHS A;  1OYX A;  3G4S A;  3QYH B;  3M53 A;  1M1K U;  2JZ2 A;  4Q5W A;  4M77 C;  2WSE E;  4XU1 A;  3FEO A;  3O8V A;  1X75 C;  1VUB A;  1X6O A;  5DY9 A;  1VIE A;  4M78 A;  5GAN d;  4M75 D;  3OYD A;  3OA6 A;  1YHQ T;  2PVG B;  2M9U A;  3I56 T;  4NOY A;  3ZFJ A;  1WJS A;  3ASK A;  4N4H A;  4IUT A;  1VQM T;  3CPW A;  4ELY C;  2DAQ A;  4M77 F;  5LJ5 g;  2E70 A;  2DTO A;  3NFC A;  5KCH A;  3MP8 A;  3M4G A;  2CZ6 B;  4M75 E;  5LJ5 h;  1Q81 C;  1JRI A;  3GIB A;  3JCM X;  5GAN 4;  1PSF A;  3NTK A;  3LW5 E;  1G3W A;  1Q82 U;  4OGC A;  2XI9 A;  5CKD A;  3V7R A;  3ZEH A;  5GMK h;  3SD4 A;  2QQS A;  2E1H A;  4C8Q D;  2DTI A;  2X35 A;  2EQK A;  1Q86 U;  3EAE A;  1O9S A;  2LCL A;  5CKH A;  2KSS A;  4OP0 A;  4M78 C;  3C94 A;  4F7U E;  4KT0 E;  4XK8 E;  3BW1 A;  2K57 A;  4IUU A;  5LJ3 e;  1VQM A;  1BI3 A;  1VQN A;  2YLB A;  4E7I A;  1ZBX A;  3GP8 A;  2QEX T;  5FU7 C;  2GQV A;  3L42 A;  4ZTJ A;  2XG8 D;  3RMS A;  5KE3 A;  4J7I A;  2VUB A;  4LDU A;  2PUK B;  3GNF B;  3CCS A;  4IKF A;  4HCB A;  2EAY A;  3SWN A;  3VYG A;  2B8A A;  3A8G B;  4C92 E;  2MWP A;  3TEE A;  1VQO A;  3G71 A;  4ZN3 A;  4MDX A;  2E6Z A;  4BE2 A;  1JBM A;  5GAM e;  3VV0 A;  5CQY A;  3HP9 A;  3I56 A;  2VXF A;  4ZTF A;  4M77 E;  4O5V A;  3HKS A;  3QII A;  1QVP A;  1KD1 C;  3OYJ A;  2F5K A;  2PQW A;  4EMK A;  2R5A A;  1M90 C;  2P4T A;  4QW2 A;  4RKU E;  1MGQ A;  1QVG S;  4DOV A;  3CC7 T;  3OYY A;  4LDV A;  5FRN A;  1U1T A;  3MO8 A;  1SSF A;  3PNW C;  1KD1 U;  4M7D B;  3EFR A;  5LJ5 j;  3KXT A;  3CCE T;  1YJN T;  2P0P A;  3HRT A;  4M75 C;  4PL6 A;  1YJ9 A;  4QQG A;  5LJ5 f;  2GF7 A;  5GAN 2;  1XOV A;  2DTH A;  1VQ5 T;  3CCL T;  3OYA A;  2JUF A;  4A53 A;  3L2W A;  3A8O B;  4X34 A;  4QVC A;  2DXB A;  2D9T A;  4B9X A;  5CCA A;  1VQ9 A;  2QDY B;  1UB4 A;  2R5M A;  4M7D A;  2P0Q A;  1VQL A;  1YI2 T;  3SWN B;  5I2M A;  2EYQ A;  3VJP A;  4C92 A;  3P8B B;  4KUI A;  1QVF S;  3INZ A;  4M78 F;  4P5N A;  3CMA A;  5GAN j;  2KDS A;  3S3M A;  3M58 A;  2RHI A;  2V8K A;  2VC8 A;  1EIF A;  5HK3 A;  2OTL T;  3WVD B;  2ZPH B;  3VUZ A;  5GAO l;  1H64 1;  3QKJ A;  3OYN A;  2ZPG B;  5HKC A;  4XTW A;  4J6W A;  2X4J A;  3L2Z A;  2ZGW A;  2R57 A;  4J8O A;  2DIQ A;  1MHN A;  4OVA A;  2RB6 A;  2ZPF B;  2EJ9 A;  1WJR A;  3E9G A;  4M77 D;  5IAY A;  3CC4 A;  2D6F A;  2RHY A;  1I4K 1;  2G3R A;  4MZP A;  1GXI E;  1TH7 A;  3UDC A;  5CKF A;  3S6W A;  2KY9 A;  2XK0 A;  4XU0 A;  5FRO A;  3OYM A;  2BIV A;  2QQB A;  3HFO A;  1VQP T;  3JB9 F;  5GAN 5;  4E7K A;  3JB9 G;  3E19 A;  1VQ9 T;  3MEA A;  2CGH A;  5CKE A;  3BDU A;  5CQX A;  2IVW A;  4L59 A;  1VQL T;  4C0F A;  4XU2 A;  5HY6 A;  3QJ6 A;  3PFS A;  3JB9 J;  3OSV A;  1Y96 A;  4M75 F;  5GAO p;  3CCU A;  1Q82 C;  2QTX A;  2K4Y A;  3VKI A;  2NLU A;  5GMK i;  3JCM V;  5GAO q;  4O6J A;  1M8V A;  4BI3 A;  3QBY A;  4N0A C;  4ZGE B;  1YHQ A;  4CRI A;  3CPF A;  2K3Y A;  2DZ9 A;  4OB1 B;  3G6E A;  5CO7 A;  2RK2 A;  1Q7Y U;  4HT8 A;  1YJN A;  4M75 G;  1NJI C;  5FU6 B;  1Y7X A;  1NPR A;  4GY5 A;  2V8I A;  5L8R E;  1K9M U;  3CCM T;  2CYZ B;  4BDY A;  2HD0 A;  4J6X A;  3KUF A;  5HK0 A;  3PIP A;  2L8D A;  3BDL A;  3QYG B;  1VQK A;  4WF2 A;  4TVR A;  1WJQ A;  1VIF A;  2PUO B;  4QVZ A;  2A3L A;  3X28 B;  5LJ3 j;  5LJ5 e;  1U8R A;  5GAN 8;  4PJO D;  4M7A E;  3MEU A;  3A5Z B;  4BE1 A;  3G71 T;  3BY7 A;  4ATO A;  4RMO A;  3CCR T;  4J6Y A;  3JCM c;  2LQK A;  3R6O A;  2DKG A;  2CZ1 B;  1VQ7 T;  3JCM e;  3GF5 A;  1Q86 C;  4KBM B;  2E10 A;  5GMK l;  5LJ3 g;  3CME A;  1KG1 A;  5CVI A;  2RJF A;  5LJ3 h;  1PSE A;  3CC7 A;  2FHD A;  4Y91 A;  2K5F A;  4C5E A;  2GFA A;  5GAN h;  4ZGD B;  2CKK A;  1NPP A;  2E12 A;  5FU6 C;  4C0G A;  3OS0 A;  1WQ7 A;  1BYM A;  1W4S A;  2LCC A;  4IUR A;  4C5G A;  3CC4 T;  4V2S A;  5GAM h;  4M77 B;  4PNO A;  4FU6 A;  3G7Z A;  3MHX A;  3L2Q A;  4LDX A;  2FL7 A;  4M7D G;  4FT4 A;  3SB2 A;  4C92 G;  2F5T X;  1Q7Y C;  1V29 B;  4RG2 A;  3CCS T;  1H3Z A;  3OYB A;  2KQW A;  2HQE A;  3URG A;  3OS5 A;  5CR2 A;  3HRS A;  3GLX A;  1KHC A;  1KHI A;  4ME7 A;  2VV5 A;  2PVD B;  4MMK A;  4C0D B;  5A0L A;  3CCR A;  4HCC A;  2O4X A;  4PJO A;  2DO3 A;  3G4S T;  5J26 A;  4C8Q B;  3C12 A;  3GPL A;  5GAO r;  1UEB A;  4EMK B;  1VQP A;  2R58 A;  2Y4Y A;  4A4E A;  5A0D A;  2D0Q B;  3S3O A;  3J7A F;  4BD3 A;  3OY9 A;  3RKW A;  3M5A A;  2RJD A;  2K2V A;  4BUG A;  3JCM d;  3V7C A;  2ZZD A;  3TCJ A;  4C92 C;  1U1S A;  3QPH A;  4BY6 B;  5DM7 R;  4RCC A;  4PKC C;  3HHT B;  4VUB A;  3UPU A;  5D6X A;  2XD0 A;  1G3S A;  4PJO E;  2HAX A;  2BKD N;  4J83 A;  2YHT A;  1VQ4 T;  2L5Q A;  3DB4 A;  3H8Z A;  2L89 A;  4EMG A;  1OI1 A;  1BKB A;  5KH6 A;  1KC8 U;  3HSB A;  2C06 A;  3AHU A;  5GAN f;  3M56 A;  3L2U A;  4N4G A;  2QA4 A;  5FRM A;  3WVE B;  3SFM A;  4NL3 A;  2ZPI B;  4J5Y A;  3WXM B;  1G5V A;  3CMA T;  1LJO A;  2WAC A;  2QEX A;  1K73 C;  2KMT A;  1K8A U;  1JJ2 A;  2DK3 A;  2XID A;  4B9W A;  2DXT A;  4FT2 A;  3A8M B;  4RG8 A;  2K5L A;  2QI2 A;  3PIO A;  4EDU A;  4C8Q C;  3PTA A;  3CCV A;  5I21 A;  3LWH A;  2YLC A;  4JRP A;  4DA4 A;  4M7A C;  4MZM A;  2LNV A;  5KCO A;  3C4S A;  3A8L B;  1X01 A;  5LL6 S;  4M77 A;  2HBP A;  1VQ4 A;  2RHX A;  4CI0 C;  3VYH B;  3CXC S;  2MF2 A;  1K9M C;  3PGG A;  5LJ5 d;  3CD6 A;  1IRE B;  2RI3 A;  4OB3 B;  4JLG A;  1XQH A;  3QUI A;  3DLL A;  3MET A;  3DLM A;  1YJW A;  4M7A G;  4JLI A;  3RER A;  2ZPB B;  1K8A C;  1N8R C;  1UGS B;  3N5B B;  1P92 A;  2RI2 A;  5GAN 6;  5DLO A;  4OGE A;  3VUB A;  4JS4 A;  3JAM E;  1FWZ A;  2E41 A;  4IUV A;  1NZ9 A;  3UWN A;  2O4X B;  1KC8 C;  2OTJ T;  5LJ3 f;  3CC2 T;  3PMT A;  3S3N A;  3ME9 A;  3FC3 A;  4E7H A;  3FLG A;  3FJP A;  1UGP B;  3X26 B;  1VQ8 T;  3JCM h;  2EWN A;  4F7U G;  3JCM g;  1ZHI A;  2CZ0 B;  5D6Y A;  4LD6 A;  5C0M A;  3KBG A;  1R8O B;  3RES A;  5GAM f;  2QQR A;  2RJE A;  3QO3 A;  1OZ3 A;  3MEW A;  3M54 A;  4HKE A;  4BB7 A;  5GAN 3;  4M7A A;  2E65 A;  3LH0 A;  1YJW T;  2LQ8 A;  3QZ9 B;  1KQS S;  2AHJ B;  4PJO G;  4LD9 K;  4KUD K;  4JDS A;  4M7D F;  3LGL A;  3LGF A;  3VU3 C;  3QSU A;  4LDY A;  5FU7 B;  2RHZ A;  4MML A;  3T9N A;  1KQS A;  5AYF A;  3JCM f;  3V8J A;  4C92 D;  4X9D A;  1RI0 A;  2QQ9 A;  3JB9 I;  3L2R A;  1BI0 A;  4FL6 A;  4Y28 E;  1M1F A;  1RL2 A;  4Z02 A;  3X20 B;  2LRQ A;  2EJF A;  3CEY A;  4BAC A;  2LT4 A;  2KAF A;  4QQD A;  3CCM A;  3JCM J;  3RUX A;  4M7D E;  4IUP A;  2EJG A;  3M4Y A;  2QA4 T;  3QZ5 B;  1N8R U;  5DLQ E;  5GAN e;  3X24 B;  1BI2 A;  2O01 E;  1I5L A;  3CPW S;  2M1H A;  4HCZ A;  4PJO C;  1VQO T;  3JSC A;  3PT9 A;  4R56 A;  4XTY A;  4JS5 A;  3NTI A;  3OBY A;  4E7L A;  2FVU A;  1M5Q 1;  3V8K A;  5KE2 A;  5C6S A;  2X4X A;  2E5Q A;  3OYH A;  3P8D A;  3Q1J A;  2VGN A;  2Y90 A;  4XTU A;  5GAM j;  3OW2 S;  3I55 A;  2M16 A;  2IG0 A;  3M59 A;  4M7A B;  5D6W A;  4BI4 A;  5GMK e;  1LNX A;  3L2V A;  2DIG A;  1O75 A;  4PJO F;  1S72 A;  2GFU A;  3OW2 A;  3HPW A;  3G6E T;  4NL2 A;  1N9R A;  1M4Z A;  1QW1 A;  2RA2 A;  4FSX A;  4JRK A;  2A7Y A;  2P0K A;  4M78 B;  4L5G A;  4C8Q F;  1K73 U;  2XIC A;  3ZBD A;  3J81 E;  2V8J A;  4OB2 B;  3CCQ T;  2DD4 A;  1NE8 A;  4C5I A;  4FM4 B;  5GAO n;  3QDR B;  3OBW A;  3OQ5 A;  4J7F A;  4BDZ A;  2JTM A;  2X4W A;  5CAI A;  4A4F A;  2X4Y A;  1M1K C;  1YIJ A;  2M0O A;  2WSC E;  1YJ9 T;  5CKB A;  3MCA B;  1JJ2 S;  2RHU A;  4DOW A;  5J3B A;  4PJO B;  3CBM A;  1QVG A;  4UC4 A;  4XTV A;  4N0A A;  2DZC A;  3OS2 A;  1I8F A;  4JRQ A;  1S72 T;  5I2S A;  2RI5 A;  3OYL A;  5J39 A;  3OYK A;  1WPY A;  2DXC A;  3EFS A;  3FDR A;  3GNG A;  3I55 T;  3HRU A;  3OYG A;  3LWI A;  1LOJ A;  1W2B A;  3P8H A;  2VGM A;  2LTO A;  4F7U A;  2JVV A;  1VQ7 A;  3MEV A;  2QQA A;  3PMI A;  4EPC A;  2PVO B;  5GAM g;  4A54 A;  1W2B S;  4OB0 B;  3J80 E;  2OTL A;  3OB9 A;  4M78 D;  4XTX A;  1M9S A;  4XU3 A;  2HNI A;  4A4K A;  4C8Q G;  5IN1 A;  2ZPE B;  2JOY A;  2H3J A;  2XKO C;  4C0D C;  2XDD A;  2JNG A;  3RKY A;  2DEQ A;  1DJ7 B;  5CIU A;  1VQ6 A;  3A8H B;  1I81 A;  4E47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...