3OA6A

Human msl3 chromodomain bound to dna and h4k20me1 peptide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
FKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDENRRLQRKLARKAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Male-specific lethal 3 homolog
publication title Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oa6A01
2VYTA 3BDLA 3MEAA 2RHXA 5J39A 2M1HA 2O4XA 3L2QA 3KUFA 3P8DA 3META 3S3MA 3H6ZA 4NS5A 3GOXA 2IG0A 2CKKA 3MP1A 4A4FA 4ZTJA 3E9GA 2RHUA 4FL6A 3L2WA 3L2VA 4C5IA 2HQXA 3OYKA 4BE0A 2LCCA 4RG2A 2QQRA 2PQWA 3QJ6A 4FU6A 4QVZA 3OYEA 3LGLA 3NTKA 2X4WA 3OYCA 3OYNA 4IKFA 4GY5A 2F5KA 5IAYA 2GF7A 5CIUA 4BACA 1OI1A 3MO8A 2JTFA 3EAEA 3PMIA 3OY9A 1WJRA 2RI3A 4C5HA 3QBYA 3PMTA 5KE2A 3Q1JA 2G3RA 2R5MA 2R57A 4OVAA 2BIVA 2RHYA 1RI0A 4Q5WA 3OYIA 4A4EA 4N4GA 2LDMA 3NTIA 2RJDA 4ZTFA 2GFAA 5FROA 4LD6A 2E5QA 3OQ5A 1N27A 2LRQA 3L42A 3O8VA 3MP8A 1OYXA 1WJQA 2BKDN 4X34A 2EQJA 2M16A 2X4XA 4IUTA 3DLMA 3UT1A 1H3ZA 3MEVA 3NTHA 5D6YA 3ZEHA 5FRNA 3DB3A 2JZ2A 3S6WA 4HCZA 1KHCA 3MP6A 2MWOA 4BD3A 4B9XA 2RHIA 3OS1A 3OS0A 3FLGA 2NLUA 4IURA 2EQMA 5J26A 4QQDA 4C5EA 1MHNA 2O4XB 4QQ6A 2P0KA 4QQGA 2R58A 3H8ZA 3MEWA 2K3XA 2L8DA 4QW2A 3FEOA 3OYDA 2LTOA 3C4SA 3OYBA 1G5VA 2B8AA 5D6XA 3OS2A 3LYIA 2EQKA 3M9QA 1SSFA 3F70A 5D6WA 4BDYA 4II1A 4A4GA 5KE3A 4L59A 3OMCA 5KCOA 2L89A 2L3RA 4C5GA 4BE2A 2R5AA 3L2RA 2X35A 3LH0A 3QKJA 3CEYA 3ME9A 5KH6A 4E7JA 3OYAA 2M0OA 4IUVA 2DIGA 3LGFA 2RHZA 4PLIA 3OMGA 1OZ3A 2DIQA 5C6SA 2HQEA 2RJEA 2BUDA 2XK0A 3PFSA 3OYJA 1WGSA 4N4HA 4E7IA 2RJFA 3E9FA 2EQUA 3S3NA 4PLLA 2EKOA 3OB9A 3OYGA 4E7HA 2GFUA 4EDUA 4E7LA 4IUQA 2D9TA 4PL6A 3FC3A 5IN1A 2RJCA 3UWNA 2X4YA 3DB4A 2LVMA 4B9WA 3ASKA 3P8HA 3FDRA 2QQSA 3MEUA 5KCHA 5FRMA 5C0MA 3OA6A 2K3YA 4A4HA 1XNIA 2RI2A 2EFIA 2XDPA 3OYHA 4E7KA 2DAQA 1WJSA 4IUUA 2MWPA 3OYLA 3QIIA 4CRIA 2FHDA 2E6NA 3LLRA 2RO0A 1OZ2A 2YRVA 4IUPA 3L2UA 2WACA 3SD4A 5M9OA 3OYMA 4N4IA 4Z02A 4UC4A 3S3OA 4BE1A 4BDZA 2RI5A 3LX7A 3OYFA 3PNWC
chains in the Genus database with same CATH superfamily
4ZN1A 2ED0A 2DJQA 2WSFE 5J39A 4R0KA 3LWHA 3S3MA 1VQOQ 2PTKA 4ZTJA 4D6WA 1QW1A 5FU6C 1H641 5GMKj 3PGGA 3M0QA 1MV3A 1NEBA 2M51A 4IKFA 1PRLC 5IAYA 5GAMe 2CDTA 1KFZA 1OOTA 3JCMQ 2QEXA 2JTFA 2DNUA 3BFMA 1ZSZC 3HFNA 1N5ZA 5CQXA 2RJDA 5FROA 1IGQA 2Y4YA 2HL3A 4HVWA 5IXBA 2BKDN 2HBPA 1AZGB 3C94A 1B7TA 4DQ2A 2EYZA 5KYWA 3CCUT 2DZ9A 3S6WA 4EMGA 2CH4A 4R56A 2DTOA 4BD3A 2EQMA 1R0BG 1MHNA 1Q86R 1ZX6A 1M1KR 5LJ3h 5GAN5 5KYUB 2LMJA 5KE3A 3QUIA 1UG1A 1X75C 1TU0B 2EAYA 5IHKA 1Q7YC 2GQVA 1B34B 2DK3A 4J9CA 2KRNA 1UHCA 4DOVA 5GMKi 3JCMb 1WLPB 1NG2A 1M90R 5I11A 2EKOA 4TVRA 1VQ5A 1KD1R 4FYYB 4B9WA 2RD1A 2E6ZA 3FDRA 4C0FA 2KQWA 3G1JA 4RUGA 3M4YA 1PC0A 2K2VA 2VASA 1VQ7T 2MK5A 3UATA 1QCNA 2ZPHB 3CC7A 3G6ET 4Z02A 4ZGEB 3I5SA 5FW9A 3QG1A 3CMAT 1IREB 2M1HA 4XTYA 1QWEA 1ARKA 1YIJQ 1G3TA 3CBMA 2FO0A 1VQPT 4KULA 3TSZA 4EMKA 1H8KA 1TS9A 1CKAA 1PKTA 1K9MR 5KYWB 2KI7A 2HDAA 4M7DD 1K73R 4BACA 3V7RA 2CP3A 3GNFB 2OTLA 2KRSA 3CPWA 5FLXE 3UPUA 2G3RA 3REBB 1Z9ZA 2XD0A 3VS0A 3CPFA 1VQ5Q 1YJNA 4IUTA 1YI2T 2FEIA 2ZZDA 4OMLA 1X2KA 4JRIA 3CC4T 2CZ0B 4HCZA 1YITT 3IQLA 4AT1B 2RHIA 2VVKA 3EH2A 1ZSGA 3A8MB 2KNBB 3QDFA 2AZSA 2QYZA 2KAFA 3CC7Q 1KQ2A 3C4SA 5I2MA 3CCQT 4E6RA 4PNOA 3CXCA 1KK7A 2BZYA 3HRSA 1QWFA 4JJCA 3H9NA 2GCXA 1PKSA 4KRTA 4M4ZA 2DTHA 1G3YA 1WXBA 2MYSA 3OYGA 1N9SA 2BE9B 4E7LA 4JLGA 3I56Q 3CCJA 3FC3A 5IN1A 1O9SA 2O31A 2OJ2A 3ULRB 3OW2S 2OTLQ 5I22A 4EMKB 1WIEA 2E12A 2K79A 2M9UA 1B07A 1EIFA 4UC4A 2KXDA 3GIBA 1YJNQ 5IH2A 3QSUA 3PNWC 2RHXA 2FVUA 2QK0A 4J6YA 3META 2CKKA 4PJOF 2RHUA 1RLQC 3A8HB 1VQMT 2W0ZA 2X9HA 1KC8C 2DEUA 4FU6A 3OYCA 1AEYA 1WI7A 3A8OB 3JRZA 3RIRA 1VYUA 2CZ7B 3M58A 3MO8A 5GMKe 2RI3A 2OI3A 2R57A 1WPYA 1RI0A 1S1NA 4M78E 2GFAA 3G6EA 1N27A 3CCJQ 4YTLA 1BIBA 2LJ1A 3OYYA 1QVGS 3CCUQ 1M3CA 1MV0B 2CP0A 3DB3A 1MNDA 1LNXA 3CPWP 2X51A 5GAMd 4FSSA 1LVKA 1CKBA 4C92E 5CK9A 2ROLA 2DJZA 1YP5A 2O4XB 4MMKA 3H8ZA 5GAN2 4XQ3A 1QLYA 2LTOA 3FJ5A 4X9DA 2RMOA 3X28B 4HT8A 2WSCE 5FU7C 4L59A 1YJWT 3JB9D 5HKCA 1EX4A 3H0HA 4LXCA 3L2RA 3QKJA 4M78D 1BB9A 2VB6A 2NUZA 4M77E 3PVLA 1R77A 1ZUKA 1M1FA 2FL7A 4JZ4A 3EFSA 1UE9A 2HQHA 4N4HA 1BK2A 4DBFA 3NPFA 1D0ZA 4HCKA 4C92D 3A8GB 1N8RC 1UGSB 1ZUYA 3KBGA 3MCAB 2JM8A 4XTZA 2K3YA 2DLPA 1XNIA 3JB9G 4E7KA 4M78G 1WJSA 1Q7YU 2MWPA 3OYLA 1VQ7Q 4V2SA 1VQ8T 3QJYA 3D7SB 4OGCA 4FSXA 2A36A 3G6EQ 3JCMe 4PJOC 3OYFA 3M53A 3JCMg 2O88A 3QPHA 2JM9A 1GFDA 4C92G 2JMAA 2KK4A 3CCMA 2RQVA 2RQWA 1VQPQ 3NGPA 2L0AA 3ER0A 4C8QF 1W4SA 4RCBA 1ZA2B 4LDXA 2H3JA 2QDYB 2A37A 2JT4A 2QGGA 2F5KA 2RA2A 2ROTA 4JRPA 3QYHB 1AVZC 1NYFA 2YT6A 4DOWA 4C5HA 3QBYA 1UJ0A 1YCSB 5KE2A 2A7YA 4J7IA 2L5QA 4OVAA 4AG1C 1NJIU 3V7SA 3REAB 2K3BA 3SFMA 4C0DB 1M9SA 1VUBA 1LOJA 3J81E 2E70A 4A4KA 3VUBA 1YI2Q 1BI0A 2EQJA 3PE0A 2K5FA 2KY9A 4ELYC 2E1HA 4HKEA 3CC4Q 3RNJA 2EGEA 3QYGB 1JRIA 2JZ2A 1KIKA 5GJWB 1M2VA 1PCXA 1YCYA 5CR2A 5LJ3d 3X24B 2ZPEB 3OS0A 2IVWA 4IURA 3WVEB 3HHTB 1RAAB 1M30A 4QQDA 4NL3A 2HKQB 5CO7A 2V8IA 2HSPA 3QXEB 4KGVB 2QXFA 4QT7A 2YHTA 3SWNA 4E7JA 2M0OA 3QZ9B 2CYZB 2KBTA 2RJFA 2YSQA 1K8AC 1I5LA 3VV0A 2PVDB 1N9RA 1NM7A 1VQLT 2X4YA 3DKMA 4J8OA 3QZ5B 3OA6A 1PNJA 3I9QA 1UB4A 1J3TA 1RI9A 5DM7R 1QP2A 4ORZA 1YFNA 4DEYA 1BYMA 4N4IA 3GPLA 1GL5A 2JVVA 1I0CA 3VRYA 1WHJA 2ATCB 3P8DA 4C8QC 3G4SA 2ABLA 4C8QB 2V1RA 3QO3A 1D1CA 4RTXA 2E4HA 3JCMf 1DJ7B 2OX7A 1KQSP 2QQRA 3JSCA 3RERA 1KD1U 1H3HA 4JRQA 4J6WA 2BTTA 3PMIA 2DXUA 2EGCA 2D8HA 3KXTA 1VQ8A 1Y96A 4Q5WA 1NE8A 2LP5A 2QI2A 2D1XA 3TSWA 1KC8U 4HCBA 1S72A 4M77A 1VQ4T 3CCLA 5IHNA 1AD5A 5LJ3j 4JS4A 1OX8A 1VQKT 5CVIA 5FWCA 3HSBA 5CAIA 4Z88A 3ZL7C 3GNGA 2LNHB 5A0DA 4QVDA 2R58A 3ZFJA 5GAOq 4J9IA 4ZN3A 2DBMA 2LCLA 4CC3A 1SHGA 1YJWQ 1VIFA 4A4GA 1U8RA 4C5GA 1HYOA 4M7AF 4JUVA 3V7CA 3VS3A 5IHIA 2HQEA 2COYA 2EQUA 2ECZA 1OULA 3HTRA 3QWXX 3QDRB 2RJCA 1ZSZA 1GXIE 5GAOn 5GANh 2DMOA 3P8HA 4LNPA 1YWPA 4BY6B 1G83A 3OYHA 2XI9A 1VQ8Q 2E6NA 1OZ2A 2EPDA 1VYVA 2WACA 3SD4A 4WTOB 3O5ZA 3OS5A 1S72Q 4BI8B 2PUKB 3CCLQ 3L2QA 3KUFA 1N8RU 2CS7A 2IG0A 2HCKA 4EPCA 3RR6A 4FL6A 5KYUA 4F04B 1PG5B 1SSHA 1MMNA 1I81A 2KT8A 1VQ9A 2FG0A 1M3AA 2KR3A 1VQNT 3JCMd 3HKSA 2VKNA 5LJ5h 3DLLA 1JB0E 2MPXC 3EAEA 3UF4A 1NLPC 2RK2A 3J7AF 1QVFP 1XOVA 5GAOl 2DVEA 1VQ6T 4DBHA 5FU6B 3NTHA 4R55A 2H3EB 3M59A 2L3QA 3VKIA 1JU5C 1LCKA 4DBRA 5GAMg 3MEWA 2K3XA 3CD6A 4M7AC 2DM1A 2LQNA 1ZSZB 5D6XA 3VUZA 2EQKA 2JW4A 2M02A 2PUOB 1YJ9A 1QCOA 1I1JA 1MUZA 4BB7A 5KH6A 4PLIA 3UA6A 3I55A 3OMGA 4JS5A 3OYJA 1YIJA 2HL5C 4M75F 1SHFA 1VQ9Q 3EHQA 1WZOA 1RAEB 4PJOE 1WYXA 2GFUA 2HD0A 1NPRA 1BIAA 3CC2A 3DB4A 4J9DA 1UFFA 1W2BS 4RCCA 4ESRA 2O01E 1YN8A 3WVDB 2FHDA 3LLRA 1OV3A 4MDXA 2KYMA 3TU4K 4GLKA 3UA7A 4F7UF 2GTJA 1MNEA 2QQBA 4BDZA 1K8AU 3VS4A 1RAFB 2DXCA 4JJDA 4LD9K 1Y07A 2LQ8A 2DVJA 1AWJA 3QHSA 2FZKB 5CKHA 1JO8A 3BE3A 2XKOC 2ED1A 4XAXB 3BW1A 2LJ3A 5ECAA 3JCMP 2CP2A 1UTIA 1GCQC 5AYFA 2YRCA 3CCRA 3CD6Q 1SRLA 1W2BP 3NMZC 2PQWA 5A2QE 1OPKA 2RF0A 4B6MA 1LPLA 1ZBXA 1YJ9Q 2YUQA 5GAN8 1KC8R 1IXDA 3OY9A 3AHUA 3I55Q 2LC4A 1PSFA 2DFUA 2Y4XA 2YUOA 2A0FB 2EJ9A 2XDBA 2RH2A 4J5YA 3HPWA 2J7IA 1VQ4Q 2ENMA 1WHLA 2X4XA 2M16A 3CC2Q 1VQKQ 1JJ2A 3I56A 1OX9A 1HJDA 2IPOB 3G71T 1XJWB 6AT1B 5J26A 3TEEA 2KT1A 5LJ3e 2LJ0A 1K0SA 5LJ3g 2KXCA 4FYWB 2RK1A 1Y71A 3T9NA 1SSFA 3OBWA 4BDYA 5GAMf 4M75C 3CEYA 4OGEA 3OYAA 1X27A 2JS2A 3C95A 2MF2A 2MOXA 3CCRQ 3S3NA 2J6FA 1UGQB 1A0NB 3PVQA 3LH5A 3X25B 4C8QE 4LE9A 4HVUA 3ASKA 2HNIA 2QTVA 1BBZA 4F7UB 2DBKA 2XDPA 4L6V5 4XTVA 2ESWA 2CSIA 4IUPA 1N8RR 2PU9B 3OYMA 2O2OA 1WHMA 1U5SA 2NYSA 3MJXA 1QVGA 1YHQT 2CT4A 2O4XA 2DTIA 4F17A 1TH7A 5GMKh 3MP1A 3CCUA 3E9GA 4AFSC 1LJOA 2YLBA 2JXBA 2DXBA 2LX7A 2EW3A 1FYNA 2WSEE 3LGLA 2ZGWA 3EG9A 4DEXA 3CCST 4ZGDB 1WHGA 5CIUA 3CMET 3EG2A 1GBRA 2W10A 2OAWA 3SDZA 2HAXA 2RHYA 2ZPIB 3VS7A 5A0LA 2KROA 3CCET 1Z9QA 3X26B 1QVPA 2JS0A 2L2PA 2GQIA 3CPWS 4L5GA 3DLMA 3ZEHA 2AKLA 1BCOA 3MP6A 4AFQC 3JCMX 1KQ1A 2F1LA 3HRUA 3FLGA 4PJOA 1M8MA 2ZCFB 4KH0B 2OTJT 1WQWA 3OYBA 1VQ7A 4HVVA 1SF9A 4OMQA 1QP3A 2L89A 2V1QA 4BE2A 2X35A 1WHHA 2FPFA 1GFCA 5LJ3f 2O9VA 3CMAA 3LGFA 2DIQA 5AT1B 1AT1B 2JN0A 1UDLA 1VQPA 4E7SA 4PJLA 2LCSA 3TQ7P 2D9TA 2JUFA 3UWNA 1OU9A 4FYVB 1PD0A 2RQRA 3JCMW 1K8AR 3M0SA 1D0XA 1UGVA 4F14A 2RI2A 2DAQA 3TCJA 5FU7B 2A28A 5J3BA 4OMOA 1K4US 1K76A 2XG8D 1RACB 3L2UA 2YRVA 4OMMA 4M7DF 2BE7D 3EHRA 1FX7A 3EG9B 2AHJB 3LX7A 1WDXA 4PKCC 3M5AA 1TSFA 2DXTA 4NS5A 3URGA 3CXCP 1BKBA 4LDYA 1YI2A 2RPNA 2E5KA 4RTTA 3CC4A 1NEGA 3L2VA 4M7DA 2ZAEA 1YNZA 1YITA 1D1BA 4AG2C 5LJ5d 3CCVT 2QQ9A 2HSEB 2ZPGB 2L3SA 1G3WA 2QA4T 1RAIB 4Z89A 2VC8A 2GF7A 4E2FB 3CCQA 3EG1A 4BI4A 4M77D 3CMAQ 4PJOB 1WJRA 2DRKA 4RTVA 1K9AA 2DKGA 1C6VX 2JTEA 4KBMB 1TTHB 2EYYA 5GAN7 2JOYA 1TUGB 1O75A 1OU8A 2EJFA 5DLQE 3OSSC 3EG3A 1IGUA 3R6NA 5CQYA 1TUDA 1B3QA 2EVRA 4IIOA 4M77G 2C0OA 3H0FA 4C5EA 2YXYA 1TG0A 3FEOA 4C8QA 3SB2A 1K1ZA 5D6WA 2L3RA 4RKUE 2CH4W 1I8FA 5GANj 1YITQ 4J9HA 2RNAA 3H41A 3MHXA 4Y91A 4J9BA 1Q81C 1VQMA 2OAUA 1VQOT 2DL8A 5HK0A 1M3BA 3CCQQ 1ZLMA 2LVMA 3HFOA 1RL2A 1JBMA 3M0TA 5DY9A 4M7DC 5KYXA 2CREA 4A4HA 4M7DB 2EFIA 5GAOr 4XTXA 4XTWA 2COZA 1OQKA 3VYGA 2P4TA 3G7ZA 2KYBA 1YHQQ 2RM4A 3MEAA 4PJJA 2E65A 5HY6A 3H6ZA 3GOXA 2JNGA 4A4FA 5LJ5j 2F2WA 1KQSS 1SKUB 5IT9E 1NLOC 2V8JA 4LDWA 1VA7A 2X4WA 3CCSQ 3RDVA 4GY5A 1RADB 4IIMA 3CMEQ 4BI3A 1OI1A 2LQKA 8AT1B 1YJWA 3GF5A 1V29B 4HXJA 1U1SA 2BIVA 3RBBB 2K7AA 1JQQA 3NTIA 4LD6A 3JB9F 3L42A 3FB9A 3MP8A 4M78F 1VQMQ 4N0AC 1G2BA 2FPDA 4M75E 4AMCA 1KHCA 2SEMA 7AT1B 4J9FA 4CC4B 2MI6A 2CP6A 4QQ6A 4C92F 3PT9A 3R6OA 3VS6A 2OTJQ 3M54A 4FM4B 2QEXT 5KYXB 2D0NA 3OMCA 5KCOA 4F7UE 2R5AA 2K5IA 2L3PA 3PIPA 2DIGA 2RHZA 2DF6A 2B86A 1UEBA 1PWTA 4PLLA 4HT9A 4E47A 2FZGB 3FRNA 4PL6A 1W6XA 5GMKl 1BI2A 5LL6S 2DX1A 1V76A 3JB9J 3GBQA 2D6FA 2EJGA 4IUUA 1ABOA 1MMAA 4OB2B 2VGMA 3EG0A 3VYHB 1SEMA 5DLOA 1WNLA 2VYTA 3BDLA 5GAN3 4MMLA 4MZPA 4M7AA 2V8KA 4LUEA 1PD1A 4D8KA 2HQXA 4HCCA 1MGQA 1VQ5T 1M27C 1TOVA 2P0QA 2XU8A 1SRMA 4JJBA 2QA4Q 9ATCB 3WXMB 4PK4A 3M55A 4MZTA 5D7UA 2H8HA 3EGUA 2AT1B 1QCFA 4M78C 5GAMh 2HKNA 3Q1JA 1QQJA 3CC7T 1QVFS 2LDMA 3LW5E 5GMKm 4CC2A 2FPEA 3U23A 5IXFA 2LRQA 2CUDA 1OYXA 2FYKA 5FRNA 3HRTA 4JZ3A 4C92C 3M57A 4AFZC 1VQLA 4GBQA 2MWOA 3M56A 1KSWA 2CZ6B 2NLUA 3RMSA 2NUPB 4ME7A 1E7OA 5KYYB 3JCMV 2P0KA 4QQGA 2L8DA 3OS2A 2MAMA 1IZ6A 2OTLT 2MIOA 2PZ1A 4OB3B 1TUCA 3JAME 1GCQA 1ZQ1A 2FRWA 2G6FX 1WX6A 5GAN4 4PJNA 5CKEA 2AK5A 4E7ZA 1GRIA 5C6SA 2KSSA 2KDSA 4KUIA 1X2QA 3E9FA 4JJNK 1YJNT 3JCMJ 5GANe 2J05A 1AWOA 2F5TX 2J06A 3EH1A 5GANg 3HP9A 1WA7A 4ELZC 2FZCB 1VIEA 4OB1B 1SG5A 2HMAA 4M7AB 4RTYA 3EGDA 3EFRA 2AKKA 2HEQA 2DRMA 1OEBA 2DO3A 4RMOA 2C0IA 4ANJA 1HSQA 4BE1A 5GAN6 5I2SA 1X6GA 1Q81U 2D8JA 5CKFA 1BI1A 5HK3A 4MDWA 2X4JA 1VQLQ 1VQ4A 4GLMA 2FRYA 3L2WA 1VQKA 3MPUB 3OYKA 3CCJT 4M75A 5LJ5e 5GAOm 3OYEA 1AHJB 4X1VA 2GNCA 1AOJA 1D09B 5LJ5g 3GLXA 4KT0E 4RTZA 3CBPA 4PJOD 2Y90A 4F7UA 4OP0A 3M0PA 3UT1A 2K6DA 1IB8A 1I4K1 4C0GA 4XU1A 2BZ8A 1NYGA 2VXEA 1QKXA 2DYBA 3LWIA 5GAOp 4Y92A 3OS1A 1UJYA 1HK9A 1ZHIA 2KGTA 3H0IA 4FIBA 1G5VA 4PJOG 3LYIA 2QEXQ 3HL8A 1GBQA 3EGDB 4M7DE 3JV3A 4C0ZA 3ME9A 3JB9I 2NWMA 1FWZA 4AFUC 1Y7XA 2K9GA 2LT4A 1OZ3A 2DL5A 4VUBA 3PFSA 3OW2A 3M0RA 1UGPB 3M4GA 2RN8A 3SEMA 3VS2A 2RB6A 2I0NA 1NJIC 1YBYA 1VQNA 1PM3A 4HA8A 5GANf 1RAHB 3C12A 2A08A 4M75B 1TWBA 2GTOA 1JXMA 4PFPA 4XU3A 2AIRB 2CUBA 5GJVB 2HZYA 4J6XA 3M0UA 3UDCA 2K2MA 1UUEA 1BCMA 1VQ6A 2QASA 4WCIA 3VRZA 1YWOA 3VU3C 4JPBW 4J9GA 3L1AA 4LN2A 3QJ6A 3I35A 2E64A 2EYWA 4M7DG 4LDUA 2E41A 1G3SA 2QAZA 2KVQG 2QG9B 3RKWA 1HXDA 5LJ5f 2VXFA 4N4GA 3E19A 4OMFB 1ACMB 4ZTFA 4ZGJB 5CKBA 3EFOA 3V8KA 1WJQA 4X34A 4C8QD 3CCMT 3MEVA 1Q86C 4LDVA 1MMDA 3RUXA 1VQNQ 1QMCA 1M1KC 1R8OB 2CSQA 2RQUA 4CI0C 2EIFA 2GGRA 1Q82R 3OYDA 1JJ2S 4A54A 4PFZA 1M5Q1 2YUNA 2ZPBB 3M9QA 4EMKC 3OSVA 1ZUUA 1M90C 4C8QG 1VQ6Q 3FIFA 4XTUA 1M8VA 4IUVA 4NL2A 1KD1C 3L2ZA 4LUDA 1WGSA 2QTXA 2LQWA 1Q95G 2BZXA 4E7HA 4ATOA 5EC7A 1BU1A 3INZA 2XIDA 2QQSA 1NPPA 2J6OA 5KCHA 3CBOA 1Q81R 1JJ2P 2YLCA 2ZPFB 2LX9A 3OW2P 1EFNA 4A53A 4CRIA 1I5OB 1EZZB 4P5NA 4X9CA 3VS1A 5FWBA 3X20B 1D0YA 4KUDK 1WXTA 5GANd 3CXCS 2DA9A 1RAGB 2VGNA 4RG8A 2EYXA 1T3LA 3JCMh 1K9MC 2GBQA 1M1GA 2K57A 4DBQA 1IRXA 3RKYA 1K73C 1T0HA 1KG1A 2MMPA 3G71A 1XQHA 4FW2A 4BE0A 3EFOB 2P84A 4FCYA 4QVZA 1W70A 4XU2A 4EMHA 2YRDA 1VOMA 1E6GA 4KH1B 3JCMc 2XDDA 3VJPA 3I5RA 1OPLA 2JMCA 2LT1A 3OQ5A 2VUBA 3PTAA 1RABB 3G4ST 1H3ZA 2LZ6B 2P0PA 2C06A 2MCNA 2KRMA 2CP7A 2DL4A 1QVGP 4NOYA 3CQTA 5CKDA 1WXUA 1ABQA 2DE0X 2P4RA 4PFOA 3N5BB 2E3HA 2B8AA 3BY7A 4M7AE 1FMWA 2K5LA 2QGFB 2PVOB 3LH0A 1FXXA 1Q82C 2PVGB 1YHQA 4KGXB 1E6HA 2XK0A 1KQSA 5A0GA 3G71Q 1S72T 5CCAA 2EYQA 2O9SA 3CCLT 2CP5A 2K4YA 2EKHA 4FT2A 5HCKA 2KEAA 3FJPA 1X43A 2CT3A 3A98A 3CCSA 3CMEA 2FB7A 4M7AD 4Y28E 4N0AA 5M9OA 4JRKA 3QWYA 2M0YA 1V1CA 1FMVA 3CCEA 1RUWA 4OF1A 4QVCA 5EG2A 2VWFA 1G8XA 4C0DC 4ZNXA 3E1SA 4CC7A 1H92A 2Z0WA 5GAMj 2LCCA 2F2XA 4M7AG 4RG2A 4A63B 2YUPA 1JXOA 2DILA 4JDSA 3OYNA 2OTJA 3V8LA 2DL3A 2F2VA 1U1TA 1X6BA 2I2LA 2R5MA 3TVTA 1TXQA 3P8BB 4A4EA 2D0QB 2EGAA 1F1BB 3EGXA 3BDUA 3CCMQ 2JTMA 2DD5A 4XK8E 5D6YA 1JEGA 1CSKA 3C0CA 4B9XA 1AZEA 3NFCA 1P92A 1M4ZA 1UHFA 1XTDA 1VQ9T 1BI3A 5L8RE 1SPKA 4DA4A 2EWNA 4QW2A 1ZBJA 1Y0MA 3J80E 1UGRB 3CCEQ 2DZCA 4PJMA 1GCPA 1HD3A 1Q86U 1KJWA 1M2OA 1M1KU 3NHNA 2RJEA 3VS5A 2BUDA 1QKWA 1UECA 3OB9A 4EDUA 1AWWA 2EBPA 4IUQA 4FT4A 2HBWA 4M78A 3CCVA 3GP8A 2YDLA 1I07A 2A3LA 4OB0B 4O5VA 2DD4A 4BUGA 2PNIA 3MEUA 2QA4A 5FRMA 2V26A 1U3OA 4D8DA 1M90U 1VYTA 1R0CB 3PIOA 4OMPA 3CD6T 3RESA 4KGZB 1QVFA 2CZ1B 1PSEA 4JLIA 4C92A 1YJ9T 1M2VB 3V8JA 4M77F 4RTWA 2NUPA 4M75D 3KFVA 4Z8AA 3RKXA 2DYIA 4QKUA 5KYYA 4OMNA 3I55T 2J6KA 1ZA1B 2XHCA 3E2UA 2KMTA 1YIJT 2F69A 2DEQA 2YWWA 3A5ZB 4C5IA 2LNVA 2E3IA 1PRMC 4J9EA 5L23A 2NUTA 1U06A 3SWNC 3EGXB 4O6JA 3CC2T 1MMGA 3SWNB 2X3XD 3NTKA 1WQ7A 3AT1B 2KE9A 4XU0A 1D3BA 4M75G 4FW1A 4MZMA 3RMQA 5KYNA 1X69A 3ZBDA 1K9MU 2C0TA 3PMTA 3THKA 2JJ9A 2DERA 1T0JA 3OYIA 1K0XA 3A1PA 2COWA 1C0MA 2XMFA 1K73U 2E5QA 3O8VA 3G4SQ 1NZ9A 3CCVQ 1IO6A 1X01A 2IIMA 4EIKA 3OBYA 1NBEB 1WFWA 2AZVA 4RTUA 2DETA 3MKDA 4F7UG 1VQOA 3JB9H 3A8LB 3CCRT 1C1AA 1Q7YR 1AWXA 1WHKA 1RLPC 2RQTA 1KHIA 1IHVA 1PHTA 4K11A 4M78B 5I21A 4BY6C 3F70A 4II1A 2SRCA 1T3SA 4J7FA 4FYXB 2VV5A 3TREA 1IHWA 2EQIA 1W2BA 1X6OA 4E7IA 1FMKA 4C92B 2QQAA 1Y57A 1D1AA 2CGHA 4WF2A 3I56T 2DPPB 2X3WD 1Y96B 4J83A 5C0MA 2DL7A 2XICA 4F16A 1Q82U 1N6AA 4M77C 1B34A 3QIIA 4M77B 2QDLA 2NUTB 2RO0A 1NJIR 2E10A 8ATCB 3SHWA 3S3OA 1W1FA 2RI5A 1D3BB
chains in the Genus database with same CATH topology
4ZN1A 4J6XA 4PKCC 2WSFE 3UDCA 3M5AA 5J39A 3LWHA 3P8DA 4C8QC 3S3MA 3G4SA 2DXTA 4NS5A 3URGA 4C8QB 1BKBA 4LDYA 3QO3A 4ZTJA 1YI2A 1VQ6A 4D6WA 3VU3C 3CC4A 3L2VA 4M7DA 1YITA 3JCMf 1DJ7B 3L1AA 1QW1A 5FU6C 5LJ5d 3CCVT 1H641 2QQRA 2QQ9A 3JSCA 5GMKj 3PGGA 3QJ6A 3RERA 2E64A 2ZPGB 4M7DG 1KD1U 1G3WA 2QA4T 4LDUA 2E41A 4IKFA 1G3SA 2VC8A 2KVQG 5IAYA 2GF7A 5GAMe 3CCQA 4JRQA 4J6WA 4BI4A 4M77D 3JCMQ 2JTFA 2QEXA 3PMIA 4PJOB 1WJRA 2DXUA 3BFMA 3HFNA 3RKWA 3KXTA 1HXDA 2DKGA 5LJ5f 1Y96A 4Q5WA 1VQ8A 1NE8A 2VXFA 4N4GA 3E19A 4KBMB 4OMFB 5CQXA 2RJDA 5GAN7 2JOYA 5FROA 2Y4YA 4ZGJB 4ZTFA 2QI2A 5CKBA 1O75A 3V8KA 2EJFA 1KC8U 1WJQA 2BKDN 2HBPA 4X34A 1S72A 4HCBA 4M77A 3C94A 4C8QD 3CCMT 1VQ4T 3MEVA 5LJ3j 1Q86C 4LDVA 3OSSC 5DLQE 4DQ2A 3CCUT 4JS4A 2DZ9A 3RUXA 3S6WA 1VQKT 1M1KC 1R8OB 5CVIA 5CQYA 4EMGA 4R56A 2DTOA 4CI0C 4BD3A 3HSBA 2EIFA 5CAIA 4M77G 2EQMA 3GNGA 4C5EA 1MHNA 5A0DA 4QVDA 2R58A 3OYDA 3ZFJA 3FEOA 4C8QA 5GAOq 1JJ2S 3SB2A 4ZN3A 4A54A 5LJ3h 1M5Q1 5GAN5 2ZPBB 3M9QA 4EMKC 2LCLA 5D6WA 3OSVA 1VIFA 4A4GA 5KE3A 3QUIA 1U8RA 1M90C 4C5GA 2L3RA 4RKUE 4C8QG 4M7AF 4JUVA 1X75C 2EAYA 1Q7YC 3FIFA 1I8FA 2GQVA 1B34B 4XTUA 5GANj 1M8VA 2DK3A 4IUVA 3V7CA 4NL2A 1KD1C 3L2ZA 4DOVA 2HQEA 5GMKi 3JCMb 1WGSA 2EQUA 3MHXA 2QTXA 4Y91A 2EKOA 1Q81C 4E7HA 4TVRA 4ATOA 3QDRB 1VQ5A 1VQMA 2OAUA 2RJCA 1VQOT 5HK0A 1GXIE 5GAOn 3INZA 2LVMA 5GANh 4B9WA 2XIDA 3HFOA 3P8HA 2RD1A 1RL2A 1NPPA 1JBMA 2E6ZA 2QQSA 3FDRA 5DY9A 4BY6B 4A4HA 4C0FA 5KCHA 4M7DC 3CBOA 4M7DB 2EFIA 2YLCA 2ZPFB 3OYHA 5GAOr 2LX9A 2KQWA 2XI9A 4XTXA 4A53A 4CRIA 2E6NA 4P5NA 3M4YA 2K2VA 4X9CA 4XTWA 1VQ7T 1OZ2A 2WACA 3SD4A 3VYGA 2ZPHB 3CC7A 3G6ET 2P4TA 3X20B 3OS5A 3G7ZA 4Z02A 4KUDK 4ZGEB 4BI8B 5GANd 2PUKB 3CXCS 4RG8A 2VGNA 3QG1A 2RM4A 1IREB 3MEAA 3CMAT 2M1HA 4XTYA 2E65A 3KUFA 3JCMh 3L2QA 5HY6A 1K9MC 3H6ZA 1M1GA 3GOXA 1N8RU 1G3TA 2CS7A 2IG0A 2JNGA 2K57A 3CBMA 4A4FA 4EPCA 5LJ5j 4FL6A 1VQPT 4KULA 1KQSS 3RKYA 4EMKA 1K73C 1I81A 1KG1A 2MMPA 3G71A 1XQHA 4BE0A 5IT9E 1VQ9A 2V8JA 4QVZA 4LDWA 2X4WA 4XU2A 3CCLA 1VQNT 4GY5A 3JCMd 4EMHA 4M7DD 3HKSA 5LJ5h 3DLLA 4BACA 1N8RC 3V7RA 4BI3A 1OI1A 1JB0E 3EAEA 2LQKA 3GNFB 2OTLA 1YJWA 3GF5A 3CPWA 3JCMc 1V29B 5FLXE 2XDDA 2G3RA 1U1SA 3VJPA 3UPUA 2BIVA 2RK2A 2XD0A 3J7AF 3NTIA 4LD6A 2LT1A 3JB9F 3OQ5A 2VUBA 3CPFA 3L42A 3FB9A 1XOVA 3MP8A 4M78F 5GAOl 3PTAA 1YJNA 3G4ST 1H3ZA 2DVEA 4IUTA 1VQ6T 4N0AC 1YI2T 5FU6B 3NTHA 4M75E 2P0PA 2ZZDA 2C06A 4R55A 4JRIA 3CC4T 2CZ0B 4HCZA 1YITT 1KHCA 3M59A 4NOYA 5CKDA 2RHIA 3VKIA 3A8MB 2MI6A 5GAMg 4QQ6A 3N5BB 4C92F 3MEWA 3PT9A 3R6OA 2K3XA 3CD6A 4M7AC 2KAFA 3M54A 4FM4B 1KQ2A 3C4SA 5I2MA 3BY7A 2B8AA 5D6XA 3CCQT 3VUZA 4M7AE 2EQKA 2K5LA 2QEXT 2PVOB 4PNOA 3CXCA 2PUOB 1YJ9A 3OMCA 5KCOA 4F7UE 2R5AA 2K5IA 3HRSA 3LH0A 1FXXA 4BB7A 5KH6A 1Q82C 3PIPA 2AHJB 2PVGB 1YHQA 2DIGA 2RHZA 4PLIA 3I55A 2GCXA 3OMGA 4JS5A 2XK0A 1KQSA 3OYJA 5A0GA 1YIJA 1UEBA 4M75F 2DTHA 1G3YA 1S72T 5CCAA 4PLLA 2EYQA 4HT9A 3CCLT 4PJOE 4E47A 3OYGA 1N9SA 2GFUA 4E7LA 4JLGA 2HD0A 3FRNA 3CCJA 2K4YA 4PL6A 1NPRA 5IN1A 3FC3A 1O9SA 1BIAA 4FT2A 5GMKl 1BI2A 3CC2A 3DB4A 5LL6S 1W2BS 3FJPA 3OW2S 4RCCA 2O01E 3CCSA 3JB9J 3WVDB 2D6FA 4EMKB 2EJGA 4IUUA 2FHDA 2FB7A 3CMEA 2E12A 3LLRA 4M7AD 4Y28E 4N0AA 4MDXA 4OB2B 3TU4K 4GLKA 2VGMA 2M9UA 5M9OA 1EIFA 4F7UF 4JRKA 3VYHB 4UC4A 5DLOA 1WNLA 3GIBA 2QQBA 4BDZA 1K8AU 2DXCA 3QSUA 3PNWC 2VYTA 4LD9K 1Y07A 2LQ8A 3BDLA 3CCEA 3QHSA 2RHXA 4OF1A 2FVUA 5CKHA 4QVCA 5GAN3 5EG2A 4J6YA 3META 4MMLA 4C0DC 4MZPA 2XKOC 4M7AA 2V8KA 2CKKA 4XAXB 4PJOF 3BW1A 2RHUA 3E1SA 3JCMP 3A8HB 2HQXA 4HCCA 1MGQA 5AYFA 1VQ5T 5GAMj 1VQMT 3CCRA 2P0QA 2LCCA 2XU8A 4M7AG 4RG2A 1KC8C 2PQWA 4FU6A 5A2QE 3WXMB 3OYCA 4JDSA 3OYNA 1ZBXA 3A8OB 2OTJA 3M55A 3V8LA 3JRZA 3RIRA 4MZTA 5GAN8 2CZ7B 3M58A 3MO8A 1U1TA 5GMKe 3OY9A 3AHUA 2RI3A 4M78C 2LC4A 1PSFA 2Y4XA 5GAMh 2I2LA 2R5MA 3Q1JA 2R57A 3P8BB 3CC7T 1WPYA 1QVFS 1RI0A 2EJ9A 4A4EA 4M78E 2LDMA 3LW5E 5GMKm 2D0QB 2XDBA 2RH2A 4J5YA 2GFAA 3G6EA 1N27A 2LRQA 3HPWA 3BDUA 1OYXA 2JTMA 1BIBA 2DD5A 2X4XA 2M16A 3OYYA 4YTLA 1QVGS 2FYKA 2RI5A 4XK8E 5D6YA 5FRNA 3DB3A 1JJ2A 3HRTA 1LNXA 4C92C 3I56A 3M57A 1VQLA 5GAMd 2MWOA 3G71T 3M56A 4B9XA 3NFCA 4C92E 1P92A 1M4ZA 1XTDA 2CZ6B 2NLUA 5J26A 3RMSA 1BI3A 3TEEA 1VQ9T 4ME7A 2DJZA 5L8RE 5LJ3e 2O4XB 4MMKA 4DA4A 3JCMV 2P0KA 4QQGA 2EWNA 3H8ZA 2L8DA 4QW2A 5LJ3g 5GAN2 4XQ3A 2LTOA 4X9DA 3X28B 3OS2A 4HT8A 2MAMA 2RK1A 2WSCE 1Y71A 3T9NA 1SSFA 1IZ6A 3J80E 1UGRB 3OBWA 2DZCA 5FU7C 4BDYA 4OB3B 2OTLT 4L59A 1YJWT 3JAME 1ZQ1A 3JB9D 5GAMf 4M75C 5HKCA 3L2RA 3QKJA 3CEYA 4M78D 1Q86U 4OGEA 5GAN4 3OYAA 4M77E 5CKEA 1M1KU 1M1FA 5C6SA 2KSSA 2RJEA 2BUDA 2FL7A 2KDSA 2MF2A 3C95A 4KUIA 3EFSA 4N4HA 3E9FA 4JJNK 1YJNT 3S3NA 3JCMJ 5GANe 3JB9H 3OB9A 1UGQB 4EDUA 4IUQA 4FT4A 2F5TX 4M78A 3X25B 5GANg 3GP8A 3HP9A 4ELZC 3CCVA 4C92D 1VIEA 2A3LA 4C8QE 4OB0B 4OB1B 3A8GB 2DD4A 1UGSB 4O5VA 3ASKA 3KBGA 4M7AB 2HNIA 4BUGA 3MCAB 3MEUA 2QA4A 5FRMA 4XTZA 2K3YA 3EFRA 1M90U 1XNIA 3JB9G 3PIOA 4F7UB 2XDPA 4E7KA 4L6V5 4M78G 1WJSA 1Q7YU 4XTVA 3CD6T 2MWPA 3OYLA 3RESA 4V2SA 2DO3A 4RMOA 1VQ8T 3QJYA 1QVFA 4IUPA 4OGCA 2CZ1B 2PU9B 4FSXA 3OYMA 1Q82U 1PSEA 4JLIA 4C92A 4BE1A 1YJ9T 3JCMe 5GAN6 5I2SA 3V8JA 4M77F 4PJOC 3OYFA 3M53A 1Q81U 4M75D 5CKFA 1BI1A 5HK3A 3JCMg 1QVGA 4MDWA 3RKXA 1YHQT 2O4XA 2DTIA 3QPHA 3I55T 2X4JA 4C92G 1TH7A 5GMKh 2XHCA 2KK4A 3CCMA 2KMTA 3MP1A 1VQ4A 1YIJT 3CCUA 2F69A 3E9GA 2DEQA 1LJOA 3L2WA 2YLBA 1VQKA 3A5ZB 4C5IA 2LNVA 2DXBA 3OYKA 3CCJT 3ER0A 4C8QF 1W4SA 4RCBA 4M75A 4O6JA 3SWNC 3CC2T 3SWNB 5LJ5e 2WSEE 5GAOm 3OYEA 3LGLA 1AHJB 4LDXA 3NTKA 2H3JA 2ZGWA 2QDYB 1WQ7A 3CCST 5LJ5g 4ZGDB 4JRPA 4XU0A 2F5KA 2RA2A 1D3BA 5CIUA 3QYHB 4M75G 4MZMA 3CMET 3RMQA 3ZBDA 3GLXA 4DOWA 1K9MU 3SDZA 4C5HA 3QBYA 3PMTA 4KT0E 2A7YA 4J7IA 2L5QA 4OVAA 5KE2A 3CBPA 2RHYA 1NJIU 3V7SA 3OYIA 2ZPIB 3SFMA 2HAXA 4C0DB 5A0LA 1K73U 4PJOD 1M9SA 1VUBA 3CCET 1LOJA 2E5QA 2Y90A 2E70A 3X26B 4A4KA 4F7UA 1QVPA 3O8VA 3VUBA 3J81E 1NZ9A 4OP0A 3UT1A 1BI0A 2EQJA 3CPWS 4L5GA 3DLMA 1I4K1 2K5FA 2KY9A 4C0GA 2E1HA 4HKEA 4XU1A 3ZEHA 1X01A 4ELYC 1JRIA 2JZ2A 3OBYA 3QYGB 2VXEA 4F7UG 3MP6A 1VQOA 3JCMX 3LWIA 1YCYA 5CR2A 5GAOp 3A8LB 1KQ1A 5LJ3d 2ZPEB 3X24B 3HRUA 2IVWA 3FLGA 4IURA 3WVEB 3OS0A 3OS1A 4PJOA 3HHTB 1HK9A 1ZHIA 4QQDA 4NL3A 5CK9A 1KHIA 2ZCFB 2OTJT 1WQWA 4M78B 2V8IA 5CO7A 5I21A 4FIBA 3OYBA 4BY6C 1VQ7A 4PJOG 1G5VA 3LYIA 3QXEB 3F70A 3HL8A 4II1A 1QP3A 4M7DE 2L89A 2QXFA 4BE2A 2X35A 4C0ZA 4J7FA 2YHTA 3ME9A 3JB9I 5LJ3f 3SWNA 1FWZA 2VV5A 3CMAA 2M0OA 4E7JA 1Y7XA 3TREA 2LT4A 3QZ9B 3LGFA 1OZ3A 2DIQA 2CYZB 4VUBA 1X6OA 3PFSA 1W2BA 4E7IA 3OW2A 2RJFA 4C92B 2QQAA 2JN0A 1K8AC 1VQPA 1UGPB 1I5LA 2CGHA 3M4GA 2PVDB 4WF2A 3VV0A 2D9TA 2RB6A 2DPPB 2JUFA 3I56T 1N9RA 3UWNA 1VQLT 2X4YA 1NJIC 3DKMA 1Y96B 4J83A 4J8OA 1YBYA 3JCMW 3QZ5B 1VQNA 5C0MA 3OA6A 2RI2A 2XICA 1UB4A 2DAQA 3TCJA 5FU7B 5J3BA 1N6AA 4M77C 5DM7R 1B34A 3QIIA 4HA8A 1QP2A 5GANf 4M77B 3C12A 3CCRT 2RO0A 4M75B 2XG8D 3L2UA 2E10A 2YRVA 4M7DF 1BYMA 4N4IA 3S3OA 1FX7A 3GPLA 4XU3A 2JVVA 3LX7A 1D3BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYT A;  3BDL A;  3MEA A;  2RHX A;  5J39 A;  2M1H A;  2O4X A;  3L2Q A;  3KUF A;  3P8D A;  3MET A;  3S3M A;  3H6Z A;  4NS5 A;  3GOX A;  2IG0 A;  2CKK A;  3MP1 A;  4A4F A;  4ZTJ A;  3E9G A;  2RHU A;  4FL6 A;  3L2W A;  3L2V A;  4C5I A;  2HQX A;  3OYK A;  4BE0 A;  2LCC A;  4RG2 A;  2QQR A;  2PQW A;  3QJ6 A;  4FU6 A;  4QVZ A;  3OYE A;  3LGL A;  3NTK A;  2X4W A;  3OYC A;  3OYN A;  4IKF A;  4GY5 A;  2F5K A;  5IAY A;  2GF7 A;  5CIU A;  4BAC A;  1OI1 A;  3MO8 A;  2JTF A;  3EAE A;  3PMI A;  3OY9 A;  1WJR A;  2RI3 A;  4C5H A;  3QBY A;  3PMT A;  5KE2 A;  3Q1J A;  2G3R A;  2R5M A;  2R57 A;  4OVA A;  2BIV A;  2RHY A;  1RI0 A;  4Q5W A;  3OYI A;  4A4E A;  4N4G A;  2LDM A;  3NTI A;  2RJD A;  4ZTF A;  2GFA A;  5FRO A;  4LD6 A;  2E5Q A;  3OQ5 A;  1N27 A;  2LRQ A;  3L42 A;  3O8V A;  3MP8 A;  1OYX A;  1WJQ A;  2BKD N;  4X34 A;  2EQJ A;  2M16 A;  2X4X A;  4IUT A;  3DLM A;  3UT1 A;  1H3Z A;  3MEV A;  3NTH A;  5D6Y A;  3ZEH A;  5FRN A;  3DB3 A;  2JZ2 A;  3S6W A;  4HCZ A;  1KHC A;  3MP6 A;  2MWO A;  4BD3 A;  4B9X A;  2RHI A;  3OS1 A;  3OS0 A;  3FLG A;  2NLU A;  4IUR A;  2EQM A;  5J26 A;  4QQD A;  4C5E A;  1MHN A;  2O4X B;  4QQ6 A;  2P0K A;  4QQG A;  2R58 A;  3H8Z A;  3MEW A;  2K3X A;  2L8D A;  4QW2 A;  3FEO A;  3OYD A;  2LTO A;  3C4S A;  3OYB A;  1G5V A;  2B8A A;  5D6X A;  3OS2 A;  3LYI A;  2EQK A;  3M9Q A;  1SSF A;  3F70 A;  5D6W A;  4BDY A;  4II1 A;  4A4G A;  5KE3 A;  4L59 A;  3OMC A;  5KCO A;  2L89 A;  2L3R A;  4C5G A;  4BE2 A;  2R5A A;  3L2R A;  2X35 A;  3LH0 A;  3QKJ A;  3CEY A;  3ME9 A;  5KH6 A;  4E7J A;  3OYA A;  2M0O A;  4IUV A;  2DIG A;  3LGF A;  2RHZ A;  4PLI A;  3OMG A;  1OZ3 A;  2DIQ A;  5C6S A;  2HQE A;  2RJE A;  2BUD A;  2XK0 A;  3PFS A;  3OYJ A;  1WGS A;  4N4H A;  4E7I A;  2RJF A;  3E9F A;  2EQU A;  3S3N A;  4PLL A;  2EKO A;  3OB9 A;  3OYG A;  4E7H A;  2GFU A;  4EDU A;  4E7L A;  4IUQ A;  2D9T A;  4PL6 A;  3FC3 A;  5IN1 A;  2RJC A;  3UWN A;  2X4Y A;  3DB4 A;  2LVM A;  4B9W A;  3ASK A;  3P8H A;  3FDR A;  2QQS A;  3MEU A;  5KCH A;  5FRM A;  5C0M A;  3OA6 A;  2K3Y A;  4A4H A;  1XNI A;  2RI2 A;  2EFI A;  2XDP A;  3OYH A;  4E7K A;  2DAQ A;  1WJS A;  4IUU A;  2MWP A;  3OYL A;  3QII A;  4CRI A;  2FHD A;  2E6N A;  3LLR A;  2RO0 A;  1OZ2 A;  2YRV A;  4IUP A;  3L2U A;  2WAC A;  3SD4 A;  5M9O A;  3OYM A;  4N4I A;  4Z02 A;  4UC4 A;  3S3O A;  4BE1 A;  4BDZ A;  2RI5 A;  3LX7 A;  3OYF A;  3PNW C; 
#chains in the Genus database with same CATH topology
 4ZN1 A;  2ED0 A;  2DJQ A;  2WSF E;  5J39 A;  4R0K A;  3LWH A;  3S3M A;  1VQO Q;  2PTK A;  4ZTJ A;  4D6W A;  1QW1 A;  5FU6 C;  1H64 1;  5GMK j;  3PGG A;  3M0Q A;  1MV3 A;  1NEB A;  2M51 A;  4IKF A;  1PRL C;  5IAY A;  5GAM e;  2CDT A;  1KFZ A;  1OOT A;  3JCM Q;  2QEX A;  2JTF A;  2DNU A;  3BFM A;  1ZSZ C;  3HFN A;  1N5Z A;  5CQX A;  2RJD A;  5FRO A;  1IGQ A;  2Y4Y A;  2HL3 A;  4HVW A;  5IXB A;  2BKD N;  2HBP A;  1AZG B;  3C94 A;  1B7T A;  4DQ2 A;  2EYZ A;  5KYW A;  3CCU T;  2DZ9 A;  3S6W A;  4EMG A;  2CH4 A;  4R56 A;  2DTO A;  4BD3 A;  2EQM A;  1R0B G;  1MHN A;  1Q86 R;  1ZX6 A;  1M1K R;  5LJ3 h;  5GAN 5;  5KYU B;  2LMJ A;  5KE3 A;  3QUI A;  1UG1 A;  1X75 C;  1TU0 B;  2EAY A;  5IHK A;  1Q7Y C;  2GQV A;  1B34 B;  2DK3 A;  4J9C A;  2KRN A;  1UHC A;  4DOV A;  5GMK i;  3JCM b;  1WLP B;  1NG2 A;  1M90 R;  5I11 A;  2EKO A;  4TVR A;  1VQ5 A;  1KD1 R;  4FYY B;  4B9W A;  2RD1 A;  2E6Z A;  3FDR A;  4C0F A;  2KQW A;  3G1J A;  4RUG A;  3M4Y A;  1PC0 A;  2K2V A;  2VAS A;  1VQ7 T;  2MK5 A;  3UAT A;  1QCN A;  2ZPH B;  3CC7 A;  3G6E T;  4Z02 A;  4ZGE B;  3I5S A;  5FW9 A;  3QG1 A;  3CMA T;  1IRE B;  2M1H A;  4XTY A;  1QWE A;  1ARK A;  1YIJ Q;  1G3T A;  3CBM A;  2FO0 A;  1VQP T;  4KUL A;  3TSZ A;  4EMK A;  1H8K A;  1TS9 A;  1CKA A;  1PKT A;  1K9M R;  5KYW B;  2KI7 A;  2HDA A;  4M7D D;  1K73 R;  4BAC A;  3V7R A;  2CP3 A;  3GNF B;  2OTL A;  2KRS A;  3CPW A;  5FLX E;  3UPU A;  2G3R A;  3REB B;  1Z9Z A;  2XD0 A;  3VS0 A;  3CPF A;  1VQ5 Q;  1YJN A;  4IUT A;  1YI2 T;  2FEI A;  2ZZD A;  4OML A;  1X2K A;  4JRI A;  3CC4 T;  2CZ0 B;  4HCZ A;  1YIT T;  3IQL A;  4AT1 B;  2RHI A;  2VVK A;  3EH2 A;  1ZSG A;  3A8M B;  2KNB B;  3QDF A;  2AZS A;  2QYZ A;  2KAF A;  3CC7 Q;  1KQ2 A;  3C4S A;  5I2M A;  3CCQ T;  4E6R A;  4PNO A;  3CXC A;  1KK7 A;  2BZY A;  3HRS A;  1QWF A;  4JJC A;  3H9N A;  2GCX A;  1PKS A;  4KRT A;  4M4Z A;  2DTH A;  1G3Y A;  1WXB A;  2MYS A;  3OYG A;  1N9S A;  2BE9 B;  4E7L A;  4JLG A;  3I56 Q;  3CCJ A;  3FC3 A;  5IN1 A;  1O9S A;  2O31 A;  2OJ2 A;  3ULR B;  3OW2 S;  2OTL Q;  5I22 A;  4EMK B;  1WIE A;  2E12 A;  2K79 A;  2M9U A;  1B07 A;  1EIF A;  4UC4 A;  2KXD A;  3GIB A;  1YJN Q;  5IH2 A;  3QSU A;  3PNW C;  2RHX A;  2FVU A;  2QK0 A;  4J6Y A;  3MET A;  2CKK A;  4PJO F;  2RHU A;  1RLQ C;  3A8H B;  1VQM T;  2W0Z A;  2X9H A;  1KC8 C;  2DEU A;  4FU6 A;  3OYC A;  1AEY A;  1WI7 A;  3A8O B;  3JRZ A;  3RIR A;  1VYU A;  2CZ7 B;  3M58 A;  3MO8 A;  5GMK e;  2RI3 A;  2OI3 A;  2R57 A;  1WPY A;  1RI0 A;  1S1N A;  4M78 E;  2GFA A;  3G6E A;  1N27 A;  3CCJ Q;  4YTL A;  1BIB A;  2LJ1 A;  3OYY A;  1QVG S;  3CCU Q;  1M3C A;  1MV0 B;  2CP0 A;  3DB3 A;  1MND A;  1LNX A;  3CPW P;  2X51 A;  5GAM d;  4FSS A;  1LVK A;  1CKB A;  4C92 E;  5CK9 A;  2ROL A;  2DJZ A;  1YP5 A;  2O4X B;  4MMK A;  3H8Z A;  5GAN 2;  4XQ3 A;  1QLY A;  2LTO A;  3FJ5 A;  4X9D A;  2RMO A;  3X28 B;  4HT8 A;  2WSC E;  5FU7 C;  4L59 A;  1YJW T;  3JB9 D;  5HKC A;  1EX4 A;  3H0H A;  4LXC A;  3L2R A;  3QKJ A;  4M78 D;  1BB9 A;  2VB6 A;  2NUZ A;  4M77 E;  3PVL A;  1R77 A;  1ZUK A;  1M1F A;  2FL7 A;  4JZ4 A;  3EFS A;  1UE9 A;  2HQH A;  4N4H A;  1BK2 A;  4DBF A;  3NPF A;  1D0Z A;  4HCK A;  4C92 D;  3A8G B;  1N8R C;  1UGS B;  1ZUY A;  3KBG A;  3MCA B;  2JM8 A;  4XTZ A;  2K3Y A;  2DLP A;  1XNI A;  3JB9 G;  4E7K A;  4M78 G;  1WJS A;  1Q7Y U;  2MWP A;  3OYL A;  1VQ7 Q;  4V2S A;  1VQ8 T;  3QJY A;  3D7S B;  4OGC A;  4FSX A;  2A36 A;  3G6E Q;  3JCM e;  4PJO C;  3OYF A;  3M53 A;  3JCM g;  2O88 A;  3QPH A;  2JM9 A;  1GFD A;  4C92 G;  2JMA A;  2KK4 A;  3CCM A;  2RQV A;  2RQW A;  1VQP Q;  3NGP A;  2L0A A;  3ER0 A;  4C8Q F;  1W4S A;  4RCB A;  1ZA2 B;  4LDX A;  2H3J A;  2QDY B;  2A37 A;  2JT4 A;  2QGG A;  2F5K A;  2RA2 A;  2ROT A;  4JRP A;  3QYH B;  1AVZ C;  1NYF A;  2YT6 A;  4DOW A;  4C5H A;  3QBY A;  1UJ0 A;  1YCS B;  5KE2 A;  2A7Y A;  4J7I A;  2L5Q A;  4OVA A;  4AG1 C;  1NJI U;  3V7S A;  3REA B;  2K3B A;  3SFM A;  4C0D B;  1M9S A;  1VUB A;  1LOJ A;  3J81 E;  2E70 A;  4A4K A;  3VUB A;  1YI2 Q;  1BI0 A;  2EQJ A;  3PE0 A;  2K5F A;  2KY9 A;  4ELY C;  2E1H A;  4HKE A;  3CC4 Q;  3RNJ A;  2EGE A;  3QYG B;  1JRI A;  2JZ2 A;  1KIK A;  5GJW B;  1M2V A;  1PCX A;  1YCY A;  5CR2 A;  5LJ3 d;  3X24 B;  2ZPE B;  3OS0 A;  2IVW A;  4IUR A;  3WVE B;  3HHT B;  1RAA B;  1M30 A;  4QQD A;  4NL3 A;  2HKQ B;  5CO7 A;  2V8I A;  2HSP A;  3QXE B;  4KGV B;  2QXF A;  4QT7 A;  2YHT A;  3SWN A;  4E7J A;  2M0O A;  3QZ9 B;  2CYZ B;  2KBT A;  2RJF A;  2YSQ A;  1K8A C;  1I5L A;  3VV0 A;  2PVD B;  1N9R A;  1NM7 A;  1VQL T;  2X4Y A;  3DKM A;  4J8O A;  3QZ5 B;  3OA6 A;  1PNJ A;  3I9Q A;  1UB4 A;  1J3T A;  1RI9 A;  5DM7 R;  1QP2 A;  4ORZ A;  1YFN A;  4DEY A;  1BYM A;  4N4I A;  3GPL A;  1GL5 A;  2JVV A;  1I0C A;  3VRY A;  1WHJ A;  2ATC B;  3P8D A;  4C8Q C;  3G4S A;  2ABL A;  4C8Q B;  2V1R A;  3QO3 A;  1D1C A;  4RTX A;  2E4H A;  3JCM f;  1DJ7 B;  2OX7 A;  1KQS P;  2QQR A;  3JSC A;  3RER A;  1KD1 U;  1H3H A;  4JRQ A;  4J6W A;  2BTT A;  3PMI A;  2DXU A;  2EGC A;  2D8H A;  3KXT A;  1VQ8 A;  1Y96 A;  4Q5W A;  1NE8 A;  2LP5 A;  2QI2 A;  2D1X A;  3TSW A;  1KC8 U;  4HCB A;  1S72 A;  4M77 A;  1VQ4 T;  3CCL A;  5IHN A;  1AD5 A;  5LJ3 j;  4JS4 A;  1OX8 A;  1VQK T;  5CVI A;  5FWC A;  3HSB A;  5CAI A;  4Z88 A;  3ZL7 C;  3GNG A;  2LNH B;  5A0D A;  4QVD A;  2R58 A;  3ZFJ A;  5GAO q;  4J9I A;  4ZN3 A;  2DBM A;  2LCL A;  4CC3 A;  1SHG A;  1YJW Q;  1VIF A;  4A4G A;  1U8R A;  4C5G A;  1HYO A;  4M7A F;  4JUV A;  3V7C A;  3VS3 A;  5IHI A;  2HQE A;  2COY A;  2EQU A;  2ECZ A;  1OUL A;  3HTR A;  3QWX X;  3QDR B;  2RJC A;  1ZSZ A;  1GXI E;  5GAO n;  5GAN h;  2DMO A;  3P8H A;  4LNP A;  1YWP A;  4BY6 B;  1G83 A;  3OYH A;  2XI9 A;  1VQ8 Q;  2E6N A;  1OZ2 A;  2EPD A;  1VYV A;  2WAC A;  3SD4 A;  4WTO B;  3O5Z A;  3OS5 A;  1S72 Q;  4BI8 B;  2PUK B;  3CCL Q;  3L2Q A;  3KUF A;  1N8R U;  2CS7 A;  2IG0 A;  2HCK A;  4EPC A;  3RR6 A;  4FL6 A;  5KYU A;  4F04 B;  1PG5 B;  1SSH A;  1MMN A;  1I81 A;  2KT8 A;  1VQ9 A;  2FG0 A;  1M3A A;  2KR3 A;  1VQN T;  3JCM d;  3HKS A;  2VKN A;  5LJ5 h;  3DLL A;  1JB0 E;  2MPX C;  3EAE A;  3UF4 A;  1NLP C;  2RK2 A;  3J7A F;  1QVF P;  1XOV A;  5GAO l;  2DVE A;  1VQ6 T;  4DBH A;  5FU6 B;  3NTH A;  4R55 A;  2H3E B;  3M59 A;  2L3Q A;  3VKI A;  1JU5 C;  1LCK A;  4DBR A;  5GAM g;  3MEW A;  2K3X A;  3CD6 A;  4M7A C;  2DM1 A;  2LQN A;  1ZSZ B;  5D6X A;  3VUZ A;  2EQK A;  2JW4 A;  2M02 A;  2PUO B;  1YJ9 A;  1QCO A;  1I1J A;  1MUZ A;  4BB7 A;  5KH6 A;  4PLI A;  3UA6 A;  3I55 A;  3OMG A;  4JS5 A;  3OYJ A;  1YIJ A;  2HL5 C;  4M75 F;  1SHF A;  1VQ9 Q;  3EHQ A;  1WZO A;  1RAE B;  4PJO E;  1WYX A;  2GFU A;  2HD0 A;  1NPR A;  1BIA A;  3CC2 A;  3DB4 A;  4J9D A;  1UFF A;  1W2B S;  4RCC A;  4ESR A;  2O01 E;  1YN8 A;  3WVD B;  2FHD A;  3LLR A;  1OV3 A;  4MDX A;  2KYM A;  3TU4 K;  4GLK A;  3UA7 A;  4F7U F;  2GTJ A;  1MNE A;  2QQB A;  4BDZ A;  1K8A U;  3VS4 A;  1RAF B;  2DXC A;  4JJD A;  4LD9 K;  1Y07 A;  2LQ8 A;  2DVJ A;  1AWJ A;  3QHS A;  2FZK B;  5CKH A;  1JO8 A;  3BE3 A;  2XKO C;  2ED1 A;  4XAX B;  3BW1 A;  2LJ3 A;  5ECA A;  3JCM P;  2CP2 A;  1UTI A;  1GCQ C;  5AYF A;  2YRC A;  3CCR A;  3CD6 Q;  1SRL A;  1W2B P;  3NMZ C;  2PQW A;  5A2Q E;  1OPK A;  2RF0 A;  4B6M A;  1LPL A;  1ZBX A;  1YJ9 Q;  2YUQ A;  5GAN 8;  1KC8 R;  1IXD A;  3OY9 A;  3AHU A;  3I55 Q;  2LC4 A;  1PSF A;  2DFU A;  2Y4X A;  2YUO A;  2A0F B;  2EJ9 A;  2XDB A;  2RH2 A;  4J5Y A;  3HPW A;  2J7I A;  1VQ4 Q;  2ENM A;  1WHL A;  2X4X A;  2M16 A;  3CC2 Q;  1VQK Q;  1JJ2 A;  3I56 A;  1OX9 A;  1HJD A;  2IPO B;  3G71 T;  1XJW B;  6AT1 B;  5J26 A;  3TEE A;  2KT1 A;  5LJ3 e;  2LJ0 A;  1K0S A;  5LJ3 g;  2KXC A;  4FYW B;  2RK1 A;  1Y71 A;  3T9N A;  1SSF A;  3OBW A;  4BDY A;  5GAM f;  4M75 C;  3CEY A;  4OGE A;  3OYA A;  1X27 A;  2JS2 A;  3C95 A;  2MF2 A;  2MOX A;  3CCR Q;  3S3N A;  2J6F A;  1UGQ B;  1A0N B;  3PVQ A;  3LH5 A;  3X25 B;  4C8Q E;  4LE9 A;  4HVU A;  3ASK A;  2HNI A;  2QTV A;  1BBZ A;  4F7U B;  2DBK A;  2XDP A;  4L6V 5;  4XTV A;  2ESW A;  2CSI A;  4IUP A;  1N8R R;  2PU9 B;  3OYM A;  2O2O A;  1WHM A;  1U5S A;  2NYS A;  3MJX A;  1QVG A;  1YHQ T;  2CT4 A;  2O4X A;  2DTI A;  4F17 A;  1TH7 A;  5GMK h;  3MP1 A;  3CCU A;  3E9G A;  4AFS C;  1LJO A;  2YLB A;  2JXB A;  2DXB A;  2LX7 A;  2EW3 A;  1FYN A;  2WSE E;  3LGL A;  2ZGW A;  3EG9 A;  4DEX A;  3CCS T;  4ZGD B;  1WHG A;  5CIU A;  3CME T;  3EG2 A;  1GBR A;  2W10 A;  2OAW A;  3SDZ A;  2HAX A;  2RHY A;  2ZPI B;  3VS7 A;  5A0L A;  2KRO A;  3CCE T;  1Z9Q A;  3X26 B;  1QVP A;  2JS0 A;  2L2P A;  2GQI A;  3CPW S;  4L5G A;  3DLM A;  3ZEH A;  2AKL A;  1BCO A;  3MP6 A;  4AFQ C;  3JCM X;  1KQ1 A;  2F1L A;  3HRU A;  3FLG A;  4PJO A;  1M8M A;  2ZCF B;  4KH0 B;  2OTJ T;  1WQW A;  3OYB A;  1VQ7 A;  4HVV A;  1SF9 A;  4OMQ A;  1QP3 A;  2L89 A;  2V1Q A;  4BE2 A;  2X35 A;  1WHH A;  2FPF A;  1GFC A;  5LJ3 f;  2O9V A;  3CMA A;  3LGF A;  2DIQ A;  5AT1 B;  1AT1 B;  2JN0 A;  1UDL A;  1VQP A;  4E7S A;  4PJL A;  2LCS A;  3TQ7 P;  2D9T A;  2JUF A;  3UWN A;  1OU9 A;  4FYV B;  1PD0 A;  2RQR A;  3JCM W;  1K8A R;  3M0S A;  1D0X A;  1UGV A;  4F14 A;  2RI2 A;  2DAQ A;  3TCJ A;  5FU7 B;  2A28 A;  5J3B A;  4OMO A;  1K4U S;  1K76 A;  2XG8 D;  1RAC B;  3L2U A;  2YRV A;  4OMM A;  4M7D F;  2BE7 D;  3EHR A;  1FX7 A;  3EG9 B;  2AHJ B;  3LX7 A;  1WDX A;  4PKC C;  3M5A A;  1TSF A;  2DXT A;  4NS5 A;  3URG A;  3CXC P;  1BKB A;  4LDY A;  1YI2 A;  2RPN A;  2E5K A;  4RTT A;  3CC4 A;  1NEG A;  3L2V A;  4M7D A;  2ZAE A;  1YNZ A;  1YIT A;  1D1B A;  4AG2 C;  5LJ5 d;  3CCV T;  2QQ9 A;  2HSE B;  2ZPG B;  2L3S A;  1G3W A;  2QA4 T;  1RAI B;  4Z89 A;  2VC8 A;  2GF7 A;  4E2F B;  3CCQ A;  3EG1 A;  4BI4 A;  4M77 D;  3CMA Q;  4PJO B;  1WJR A;  2DRK A;  4RTV A;  1K9A A;  2DKG A;  1C6V X;  2JTE A;  4KBM B;  1TTH B;  2EYY A;  5GAN 7;  2JOY A;  1TUG B;  1O75 A;  1OU8 A;  2EJF A;  5DLQ E;  3OSS C;  3EG3 A;  1IGU A;  3R6N A;  5CQY A;  1TUD A;  1B3Q A;  2EVR A;  4IIO A;  4M77 G;  2C0O A;  3H0F A;  4C5E A;  2YXY A;  1TG0 A;  3FEO A;  4C8Q A;  3SB2 A;  1K1Z A;  5D6W A;  2L3R A;  4RKU E;  2CH4 W;  1I8F A;  5GAN j;  1YIT Q;  4J9H A;  2RNA A;  3H41 A;  3MHX A;  4Y91 A;  4J9B A;  1Q81 C;  1VQM A;  2OAU A;  1VQO T;  2DL8 A;  5HK0 A;  1M3B A;  3CCQ Q;  1ZLM A;  2LVM A;  3HFO A;  1RL2 A;  1JBM A;  3M0T A;  5DY9 A;  4M7D C;  5KYX A;  2CRE A;  4A4H A;  4M7D B;  2EFI A;  5GAO r;  4XTX A;  4XTW A;  2COZ A;  1OQK A;  3VYG A;  2P4T A;  3G7Z A;  2KYB A;  1YHQ Q;  2RM4 A;  3MEA A;  4PJJ A;  2E65 A;  5HY6 A;  3H6Z A;  3GOX A;  2JNG A;  4A4F A;  5LJ5 j;  2F2W A;  1KQS S;  1SKU B;  5IT9 E;  1NLO C;  2V8J A;  4LDW A;  1VA7 A;  2X4W A;  3CCS Q;  3RDV A;  4GY5 A;  1RAD B;  4IIM A;  3CME Q;  4BI3 A;  1OI1 A;  2LQK A;  8AT1 B;  1YJW A;  3GF5 A;  1V29 B;  4HXJ A;  1U1S A;  2BIV A;  3RBB B;  2K7A A;  1JQQ A;  3NTI A;  4LD6 A;  3JB9 F;  3L42 A;  3FB9 A;  3MP8 A;  4M78 F;  1VQM Q;  4N0A C;  1G2B A;  2FPD A;  4M75 E;  4AMC A;  1KHC A;  2SEM A;  7AT1 B;  4J9F A;  4CC4 B;  2MI6 A;  2CP6 A;  4QQ6 A;  4C92 F;  3PT9 A;  3R6O A;  3VS6 A;  2OTJ Q;  3M54 A;  4FM4 B;  2QEX T;  5KYX B;  2D0N A;  3OMC A;  5KCO A;  4F7U E;  2R5A A;  2K5I A;  2L3P A;  3PIP A;  2DIG A;  2RHZ A;  2DF6 A;  2B86 A;  1UEB A;  1PWT A;  4PLL A;  4HT9 A;  4E47 A;  2FZG B;  3FRN A;  4PL6 A;  1W6X A;  5GMK l;  1BI2 A;  5LL6 S;  2DX1 A;  1V76 A;  3JB9 J;  3GBQ A;  2D6F A;  2EJG A;  4IUU A;  1ABO A;  1MMA A;  4OB2 B;  2VGM A;  3EG0 A;  3VYH B;  1SEM A;  5DLO A;  1WNL A;  2VYT A;  3BDL A;  5GAN 3;  4MML A;  4MZP A;  4M7A A;  2V8K A;  4LUE A;  1PD1 A;  4D8K A;  2HQX A;  4HCC A;  1MGQ A;  1VQ5 T;  1M27 C;  1TOV A;  2P0Q A;  2XU8 A;  1SRM A;  4JJB A;  2QA4 Q;  9ATC B;  3WXM B;  4PK4 A;  3M55 A;  4MZT A;  5D7U A;  2H8H A;  3EGU A;  2AT1 B;  1QCF A;  4M78 C;  5GAM h;  2HKN A;  3Q1J A;  1QQJ A;  3CC7 T;  1QVF S;  2LDM A;  3LW5 E;  5GMK m;  4CC2 A;  2FPE A;  3U23 A;  5IXF A;  2LRQ A;  2CUD A;  1OYX A;  2FYK A;  5FRN A;  3HRT A;  4JZ3 A;  4C92 C;  3M57 A;  4AFZ C;  1VQL A;  4GBQ A;  2MWO A;  3M56 A;  1KSW A;  2CZ6 B;  2NLU A;  3RMS A;  2NUP B;  4ME7 A;  1E7O A;  5KYY B;  3JCM V;  2P0K A;  4QQG A;  2L8D A;  3OS2 A;  2MAM A;  1IZ6 A;  2OTL T;  2MIO A;  2PZ1 A;  4OB3 B;  1TUC A;  3JAM E;  1GCQ A;  1ZQ1 A;  2FRW A;  2G6F X;  1WX6 A;  5GAN 4;  4PJN A;  5CKE A;  2AK5 A;  4E7Z A;  1GRI A;  5C6S A;  2KSS A;  2KDS A;  4KUI A;  1X2Q A;  3E9F A;  4JJN K;  1YJN T;  3JCM J;  5GAN e;  2J05 A;  1AWO A;  2F5T X;  2J06 A;  3EH1 A;  5GAN g;  3HP9 A;  1WA7 A;  4ELZ C;  2FZC B;  1VIE A;  4OB1 B;  1SG5 A;  2HMA A;  4M7A B;  4RTY A;  3EGD A;  3EFR A;  2AKK A;  2HEQ A;  2DRM A;  1OEB A;  2DO3 A;  4RMO A;  2C0I A;  4ANJ A;  1HSQ A;  4BE1 A;  5GAN 6;  5I2S A;  1X6G A;  1Q81 U;  2D8J A;  5CKF A;  1BI1 A;  5HK3 A;  4MDW A;  2X4J A;  1VQL Q;  1VQ4 A;  4GLM A;  2FRY A;  3L2W A;  1VQK A;  3MPU B;  3OYK A;  3CCJ T;  4M75 A;  5LJ5 e;  5GAO m;  3OYE A;  1AHJ B;  4X1V A;  2GNC A;  1AOJ A;  1D09 B;  5LJ5 g;  3GLX A;  4KT0 E;  4RTZ A;  3CBP A;  4PJO D;  2Y90 A;  4F7U A;  4OP0 A;  3M0P A;  3UT1 A;  2K6D A;  1IB8 A;  1I4K 1;  4C0G A;  4XU1 A;  2BZ8 A;  1NYG A;  2VXE A;  1QKX A;  2DYB A;  3LWI A;  5GAO p;  4Y92 A;  3OS1 A;  1UJY A;  1HK9 A;  1ZHI A;  2KGT A;  3H0I A;  4FIB A;  1G5V A;  4PJO G;  3LYI A;  2QEX Q;  3HL8 A;  1GBQ A;  3EGD B;  4M7D E;  3JV3 A;  4C0Z A;  3ME9 A;  3JB9 I;  2NWM A;  1FWZ A;  4AFU C;  1Y7X A;  2K9G A;  2LT4 A;  1OZ3 A;  2DL5 A;  4VUB A;  3PFS A;  3OW2 A;  3M0R A;  1UGP B;  3M4G A;  2RN8 A;  3SEM A;  3VS2 A;  2RB6 A;  2I0N A;  1NJI C;  1YBY A;  1VQN A;  1PM3 A;  4HA8 A;  5GAN f;  1RAH B;  3C12 A;  2A08 A;  4M75 B;  1TWB A;  2GTO A;  1JXM A;  4PFP A;  4XU3 A;  2AIR B;  2CUB A;  5GJV B;  2HZY A;  4J6X A;  3M0U A;  3UDC A;  2K2M A;  1UUE A;  1BCM A;  1VQ6 A;  2QAS A;  4WCI A;  3VRZ A;  1YWO A;  3VU3 C;  4JPB W;  4J9G A;  3L1A A;  4LN2 A;  3QJ6 A;  3I35 A;  2E64 A;  2EYW A;  4M7D G;  4LDU A;  2E41 A;  1G3S A;  2QAZ A;  2KVQ G;  2QG9 B;  3RKW A;  1HXD A;  5LJ5 f;  2VXF A;  4N4G A;  3E19 A;  4OMF B;  1ACM B;  4ZTF A;  4ZGJ B;  5CKB A;  3EFO A;  3V8K A;  1WJQ A;  4X34 A;  4C8Q D;  3CCM T;  3MEV A;  1Q86 C;  4LDV A;  1MMD A;  3RUX A;  1VQN Q;  1QMC A;  1M1K C;  1R8O B;  2CSQ A;  2RQU A;  4CI0 C;  2EIF A;  2GGR A;  1Q82 R;  3OYD A;  1JJ2 S;  4A54 A;  4PFZ A;  1M5Q 1;  2YUN A;  2ZPB B;  3M9Q A;  4EMK C;  3OSV A;  1ZUU A;  1M90 C;  4C8Q G;  1VQ6 Q;  3FIF A;  4XTU A;  1M8V A;  4IUV A;  4NL2 A;  1KD1 C;  3L2Z A;  4LUD A;  1WGS A;  2QTX A;  2LQW A;  1Q95 G;  2BZX A;  4E7H A;  4ATO A;  5EC7 A;  1BU1 A;  3INZ A;  2XID A;  2QQS A;  1NPP A;  2J6O A;  5KCH A;  3CBO A;  1Q81 R;  1JJ2 P;  2YLC A;  2ZPF B;  2LX9 A;  3OW2 P;  1EFN A;  4A53 A;  4CRI A;  1I5O B;  1EZZ B;  4P5N A;  4X9C A;  3VS1 A;  5FWB A;  3X20 B;  1D0Y A;  4KUD K;  1WXT A;  5GAN d;  3CXC S;  2DA9 A;  1RAG B;  2VGN A;  4RG8 A;  2EYX A;  1T3L A;  3JCM h;  1K9M C;  2GBQ A;  1M1G A;  2K57 A;  4DBQ A;  1IRX A;  3RKY A;  1K73 C;  1T0H A;  1KG1 A;  2MMP A;  3G71 A;  1XQH A;  4FW2 A;  4BE0 A;  3EFO B;  2P84 A;  4FCY A;  4QVZ A;  1W70 A;  4XU2 A;  4EMH A;  2YRD A;  1VOM A;  1E6G A;  4KH1 B;  3JCM c;  2XDD A;  3VJP A;  3I5R A;  1OPL A;  2JMC A;  2LT1 A;  3OQ5 A;  2VUB A;  3PTA A;  1RAB B;  3G4S T;  1H3Z A;  2LZ6 B;  2P0P A;  2C06 A;  2MCN A;  2KRM A;  2CP7 A;  2DL4 A;  1QVG P;  4NOY A;  3CQT A;  5CKD A;  1WXU A;  1ABQ A;  2DE0 X;  2P4R A;  4PFO A;  3N5B B;  2E3H A;  2B8A A;  3BY7 A;  4M7A E;  1FMW A;  2K5L A;  2QGF B;  2PVO B;  3LH0 A;  1FXX A;  1Q82 C;  2PVG B;  1YHQ A;  4KGX B;  1E6H A;  2XK0 A;  1KQS A;  5A0G A;  3G71 Q;  1S72 T;  5CCA A;  2EYQ A;  2O9S A;  3CCL T;  2CP5 A;  2K4Y A;  2EKH A;  4FT2 A;  5HCK A;  2KEA A;  3FJP A;  1X43 A;  2CT3 A;  3A98 A;  3CCS A;  3CME A;  2FB7 A;  4M7A D;  4Y28 E;  4N0A A;  5M9O A;  4JRK A;  3QWY A;  2M0Y A;  1V1C A;  1FMV A;  3CCE A;  1RUW A;  4OF1 A;  4QVC A;  5EG2 A;  2VWF A;  1G8X A;  4C0D C;  4ZNX A;  3E1S A;  4CC7 A;  1H92 A;  2Z0W A;  5GAM j;  2LCC A;  2F2X A;  4M7A G;  4RG2 A;  4A63 B;  2YUP A;  1JXO A;  2DIL A;  4JDS A;  3OYN A;  2OTJ A;  3V8L A;  2DL3 A;  2F2V A;  1U1T A;  1X6B A;  2I2L A;  2R5M A;  3TVT A;  1TXQ A;  3P8B B;  4A4E A;  2D0Q B;  2EGA A;  1F1B B;  3EGX A;  3BDU A;  3CCM Q;  2JTM A;  2DD5 A;  4XK8 E;  5D6Y A;  1JEG A;  1CSK A;  3C0C A;  4B9X A;  1AZE A;  3NFC A;  1P92 A;  1M4Z A;  1UHF A;  1XTD A;  1VQ9 T;  1BI3 A;  5L8R E;  1SPK A;  4DA4 A;  2EWN A;  4QW2 A;  1ZBJ A;  1Y0M A;  3J80 E;  1UGR B;  3CCE Q;  2DZC A;  4PJM A;  1GCP A;  1HD3 A;  1Q86 U;  1KJW A;  1M2O A;  1M1K U;  3NHN A;  2RJE A;  3VS5 A;  2BUD A;  1QKW A;  1UEC A;  3OB9 A;  4EDU A;  1AWW A;  2EBP A;  4IUQ A;  4FT4 A;  2HBW A;  4M78 A;  3CCV A;  3GP8 A;  2YDL A;  1I07 A;  2A3L A;  4OB0 B;  4O5V A;  2DD4 A;  4BUG A;  2PNI A;  3MEU A;  2QA4 A;  5FRM A;  2V26 A;  1U3O A;  4D8D A;  1M90 U;  1VYT A;  1R0C B;  3PIO A;  4OMP A;  3CD6 T;  3RES A;  4KGZ B;  1QVF A;  2CZ1 B;  1PSE A;  4JLI A;  4C92 A;  1YJ9 T;  1M2V B;  3V8J A;  4M77 F;  4RTW A;  2NUP A;  4M75 D;  3KFV A;  4Z8A A;  3RKX A;  2DYI A;  4QKU A;  5KYY A;  4OMN A;  3I55 T;  2J6K A;  1ZA1 B;  2XHC A;  3E2U A;  2KMT A;  1YIJ T;  2F69 A;  2DEQ A;  2YWW A;  3A5Z B;  4C5I A;  2LNV A;  2E3I A;  1PRM C;  4J9E A;  5L23 A;  2NUT A;  1U06 A;  3SWN C;  3EGX B;  4O6J A;  3CC2 T;  1MMG A;  3SWN B;  2X3X D;  3NTK A;  1WQ7 A;  3AT1 B;  2KE9 A;  4XU0 A;  1D3B A;  4M75 G;  4FW1 A;  4MZM A;  3RMQ A;  5KYN A;  1X69 A;  3ZBD A;  1K9M U;  2C0T A;  3PMT A;  3THK A;  2JJ9 A;  2DER A;  1T0J A;  3OYI A;  1K0X A;  3A1P A;  2COW A;  1C0M A;  2XMF A;  1K73 U;  2E5Q A;  3O8V A;  3G4S Q;  1NZ9 A;  3CCV Q;  1IO6 A;  1X01 A;  2IIM A;  4EIK A;  3OBY A;  1NBE B;  1WFW A;  2AZV A;  4RTU A;  2DET A;  3MKD A;  4F7U G;  1VQO A;  3JB9 H;  3A8L B;  3CCR T;  1C1A A;  1Q7Y R;  1AWX A;  1WHK A;  1RLP C;  2RQT A;  1KHI A;  1IHV A;  1PHT A;  4K11 A;  4M78 B;  5I21 A;  4BY6 C;  3F70 A;  4II1 A;  2SRC A;  1T3S A;  4J7F A;  4FYX B;  2VV5 A;  3TRE A;  1IHW A;  2EQI A;  1W2B A;  1X6O A;  4E7I A;  1FMK A;  4C92 B;  2QQA A;  1Y57 A;  1D1A A;  2CGH A;  4WF2 A;  3I56 T;  2DPP B;  2X3W D;  1Y96 B;  4J83 A;  5C0M A;  2DL7 A;  2XIC A;  4F16 A;  1Q82 U;  1N6A A;  4M77 C;  1B34 A;  3QII A;  4M77 B;  2QDL A;  2NUT B;  2RO0 A;  1NJI R;  2E10 A;  8ATC B;  3SHW A;  3S3O A;  1W1F A;  2RI5 A;  1D3B B; 
#chains in the Genus database with same CATH homology
 4ZN1 A;  4J6X A;  4PKC C;  2WSF E;  3UDC A;  3M5A A;  5J39 A;  3LWH A;  3P8D A;  4C8Q C;  3S3M A;  3G4S A;  2DXT A;  4NS5 A;  3URG A;  4C8Q B;  1BKB A;  4LDY A;  3QO3 A;  4ZTJ A;  1YI2 A;  1VQ6 A;  4D6W A;  3VU3 C;  3CC4 A;  3L2V A;  4M7D A;  1YIT A;  3JCM f;  1DJ7 B;  3L1A A;  1QW1 A;  5FU6 C;  5LJ5 d;  3CCV T;  1H64 1;  2QQR A;  2QQ9 A;  3JSC A;  5GMK j;  3PGG A;  3QJ6 A;  3RER A;  2E64 A;  2ZPG B;  4M7D G;  1KD1 U;  1G3W A;  2QA4 T;  4LDU A;  2E41 A;  4IKF A;  1G3S A;  2VC8 A;  2KVQ G;  5IAY A;  2GF7 A;  5GAM e;  3CCQ A;  4JRQ A;  4J6W A;  4BI4 A;  4M77 D;  3JCM Q;  2JTF A;  2QEX A;  3PMI A;  4PJO B;  1WJR A;  2DXU A;  3BFM A;  3HFN A;  3RKW A;  3KXT A;  1HXD A;  2DKG A;  5LJ5 f;  1Y96 A;  4Q5W A;  1VQ8 A;  1NE8 A;  2VXF A;  4N4G A;  3E19 A;  4KBM B;  4OMF B;  5CQX A;  2RJD A;  5GAN 7;  2JOY A;  5FRO A;  2Y4Y A;  4ZGJ B;  4ZTF A;  2QI2 A;  5CKB A;  1O75 A;  3V8K A;  2EJF A;  1KC8 U;  1WJQ A;  2BKD N;  2HBP A;  4X34 A;  1S72 A;  4HCB A;  4M77 A;  3C94 A;  4C8Q D;  3CCM T;  1VQ4 T;  3MEV A;  5LJ3 j;  1Q86 C;  4LDV A;  3OSS C;  5DLQ E;  4DQ2 A;  3CCU T;  4JS4 A;  2DZ9 A;  3RUX A;  3S6W A;  1VQK T;  1M1K C;  1R8O B;  5CVI A;  5CQY A;  4EMG A;  4R56 A;  2DTO A;  4CI0 C;  4BD3 A;  3HSB A;  2EIF A;  5CAI A;  4M77 G;  2EQM A;  3GNG A;  4C5E A;  1MHN A;  5A0D A;  4QVD A;  2R58 A;  3OYD A;  3ZFJ A;  3FEO A;  4C8Q A;  5GAO q;  1JJ2 S;  3SB2 A;  4ZN3 A;  4A54 A;  5LJ3 h;  1M5Q 1;  5GAN 5;  2ZPB B;  3M9Q A;  4EMK C;  2LCL A;  5D6W A;  3OSV A;  1VIF A;  4A4G A;  5KE3 A;  3QUI A;  1U8R A;  1M90 C;  4C5G A;  2L3R A;  4RKU E;  4C8Q G;  4M7A F;  4JUV A;  1X75 C;  2EAY A;  1Q7Y C;  3FIF A;  1I8F A;  2GQV A;  1B34 B;  4XTU A;  5GAN j;  1M8V A;  2DK3 A;  4IUV A;  3V7C A;  4NL2 A;  1KD1 C;  3L2Z A;  4DOV A;  2HQE A;  5GMK i;  3JCM b;  1WGS A;  2EQU A;  3MHX A;  2QTX A;  4Y91 A;  2EKO A;  1Q81 C;  4E7H A;  4TVR A;  4ATO A;  3QDR B;  1VQ5 A;  1VQM A;  2OAU A;  2RJC A;  1VQO T;  5HK0 A;  1GXI E;  5GAO n;  3INZ A;  2LVM A;  5GAN h;  4B9W A;  2XID A;  3HFO A;  3P8H A;  2RD1 A;  1RL2 A;  1NPP A;  1JBM A;  2E6Z A;  2QQS A;  3FDR A;  5DY9 A;  4BY6 B;  4A4H A;  4C0F A;  5KCH A;  4M7D C;  3CBO A;  4M7D B;  2EFI A;  2YLC A;  2ZPF B;  3OYH A;  5GAO r;  2LX9 A;  2KQW A;  2XI9 A;  4XTX A;  4A53 A;  4CRI A;  2E6N A;  4P5N A;  3M4Y A;  2K2V A;  4X9C A;  4XTW A;  1VQ7 T;  1OZ2 A;  2WAC A;  3SD4 A;  3VYG A;  2ZPH B;  3CC7 A;  3G6E T;  2P4T A;  3X20 B;  3OS5 A;  3G7Z A;  4Z02 A;  4KUD K;  4ZGE B;  4BI8 B;  5GAN d;  2PUK B;  3CXC S;  4RG8 A;  2VGN A;  3QG1 A;  2RM4 A;  1IRE B;  3MEA A;  3CMA T;  2M1H A;  4XTY A;  2E65 A;  3KUF A;  3JCM h;  3L2Q A;  5HY6 A;  1K9M C;  3H6Z A;  1M1G A;  3GOX A;  1N8R U;  1G3T A;  2CS7 A;  2IG0 A;  2JNG A;  2K57 A;  3CBM A;  4A4F A;  4EPC A;  5LJ5 j;  4FL6 A;  1VQP T;  4KUL A;  1KQS S;  3RKY A;  4EMK A;  1K73 C;  1I81 A;  1KG1 A;  2MMP A;  3G71 A;  1XQH A;  4BE0 A;  5IT9 E;  1VQ9 A;  2V8J A;  4QVZ A;  4LDW A;  2X4W A;  4XU2 A;  3CCL A;  1VQN T;  4GY5 A;  3JCM d;  4EMH A;  4M7D D;  3HKS A;  5LJ5 h;  3DLL A;  4BAC A;  1N8R C;  3V7R A;  4BI3 A;  1OI1 A;  1JB0 E;  3EAE A;  2LQK A;  3GNF B;  2OTL A;  1YJW A;  3GF5 A;  3CPW A;  3JCM c;  1V29 B;  5FLX E;  2XDD A;  2G3R A;  1U1S A;  3VJP A;  3UPU A;  2BIV A;  2RK2 A;  2XD0 A;  3J7A F;  3NTI A;  4LD6 A;  2LT1 A;  3JB9 F;  3OQ5 A;  2VUB A;  3CPF A;  3L42 A;  3FB9 A;  1XOV A;  3MP8 A;  4M78 F;  5GAO l;  3PTA A;  1YJN A;  3G4S T;  1H3Z A;  2DVE A;  4IUT A;  1VQ6 T;  4N0A C;  1YI2 T;  5FU6 B;  3NTH A;  4M75 E;  2P0P A;  2ZZD A;  2C06 A;  4R55 A;  4JRI A;  3CC4 T;  2CZ0 B;  4HCZ A;  1YIT T;  1KHC A;  3M59 A;  4NOY A;  5CKD A;  2RHI A;  3VKI A;  3A8M B;  2MI6 A;  5GAM g;  4QQ6 A;  3N5B B;  4C92 F;  3MEW A;  3PT9 A;  3R6O A;  2K3X A;  3CD6 A;  4M7A C;  2KAF A;  3M54 A;  4FM4 B;  1KQ2 A;  3C4S A;  5I2M A;  3BY7 A;  2B8A A;  5D6X A;  3CCQ T;  3VUZ A;  4M7A E;  2EQK A;  2K5L A;  2QEX T;  2PVO B;  4PNO A;  3CXC A;  2PUO B;  1YJ9 A;  3OMC A;  5KCO A;  4F7U E;  2R5A A;  2K5I A;  3HRS A;  3LH0 A;  1FXX A;  4BB7 A;  5KH6 A;  1Q82 C;  3PIP A;  2AHJ B;  2PVG B;  1YHQ A;  2DIG A;  2RHZ A;  4PLI A;  3I55 A;  2GCX A;  3OMG A;  4JS5 A;  2XK0 A;  1KQS A;  3OYJ A;  5A0G A;  1YIJ A;  1UEB A;  4M75 F;  2DTH A;  1G3Y A;  1S72 T;  5CCA A;  4PLL A;  2EYQ A;  4HT9 A;  3CCL T;  4PJO E;  4E47 A;  3OYG A;  1N9S A;  2GFU A;  4E7L A;  4JLG A;  2HD0 A;  3FRN A;  3CCJ A;  2K4Y A;  4PL6 A;  1NPR A;  5IN1 A;  3FC3 A;  1O9S A;  1BIA A;  4FT2 A;  5GMK l;  1BI2 A;  3CC2 A;  3DB4 A;  5LL6 S;  1W2B S;  3FJP A;  3OW2 S;  4RCC A;  2O01 E;  3CCS A;  3JB9 J;  3WVD B;  2D6F A;  4EMK B;  2EJG A;  4IUU A;  2FHD A;  2FB7 A;  3CME A;  2E12 A;  3LLR A;  4M7A D;  4Y28 E;  4N0A A;  4MDX A;  4OB2 B;  3TU4 K;  4GLK A;  2VGM A;  2M9U A;  5M9O A;  1EIF A;  4F7U F;  4JRK A;  3VYH B;  4UC4 A;  5DLO A;  1WNL A;  3GIB A;  2QQB A;  4BDZ A;  1K8A U;  2DXC A;  3QSU A;  3PNW C;  2VYT A;  4LD9 K;  1Y07 A;  2LQ8 A;  3BDL A;  3CCE A;  3QHS A;  2RHX A;  4OF1 A;  2FVU A;  5CKH A;  4QVC A;  5GAN 3;  5EG2 A;  4J6Y A;  3MET A;  4MML A;  4C0D C;  4MZP A;  2XKO C;  4M7A A;  2V8K A;  2CKK A;  4XAX B;  4PJO F;  3BW1 A;  2RHU A;  3E1S A;  3JCM P;  3A8H B;  2HQX A;  4HCC A;  1MGQ A;  5AYF A;  1VQ5 T;  5GAM j;  1VQM T;  3CCR A;  2P0Q A;  2LCC A;  2XU8 A;  4M7A G;  4RG2 A;  1KC8 C;  2PQW A;  4FU6 A;  5A2Q E;  3WXM B;  3OYC A;  4JDS A;  3OYN A;  1ZBX A;  3A8O B;  2OTJ A;  3M55 A;  3V8L A;  3JRZ A;  3RIR A;  4MZT A;  5GAN 8;  2CZ7 B;  3M58 A;  3MO8 A;  1U1T A;  5GMK e;  3OY9 A;  3AHU A;  2RI3 A;  4M78 C;  2LC4 A;  1PSF A;  2Y4X A;  5GAM h;  2I2L A;  2R5M A;  3Q1J A;  2R57 A;  3P8B B;  3CC7 T;  1WPY A;  1QVF S;  1RI0 A;  2EJ9 A;  4A4E A;  4M78 E;  2LDM A;  3LW5 E;  5GMK m;  2D0Q B;  2XDB A;  2RH2 A;  4J5Y A;  2GFA A;  3G6E A;  1N27 A;  2LRQ A;  3HPW A;  3BDU A;  1OYX A;  2JTM A;  1BIB A;  2DD5 A;  2X4X A;  2M16 A;  3OYY A;  4YTL A;  1QVG S;  2FYK A;  2RI5 A;  4XK8 E;  5D6Y A;  5FRN A;  3DB3 A;  1JJ2 A;  3HRT A;  1LNX A;  4C92 C;  3I56 A;  3M57 A;  1VQL A;  5GAM d;  2MWO A;  3G71 T;  3M56 A;  4B9X A;  3NFC A;  4C92 E;  1P92 A;  1M4Z A;  1XTD A;  2CZ6 B;  2NLU A;  5J26 A;  3RMS A;  1BI3 A;  3TEE A;  1VQ9 T;  4ME7 A;  2DJZ A;  5L8R E;  5LJ3 e;  2O4X B;  4MMK A;  4DA4 A;  3JCM V;  2P0K A;  4QQG A;  2EWN A;  3H8Z A;  2L8D A;  4QW2 A;  5LJ3 g;  5GAN 2;  4XQ3 A;  2LTO A;  4X9D A;  3X28 B;  3OS2 A;  4HT8 A;  2MAM A;  2RK1 A;  2WSC E;  1Y71 A;  3T9N A;  1SSF A;  1IZ6 A;  3J80 E;  1UGR B;  3OBW A;  2DZC A;  5FU7 C;  4BDY A;  4OB3 B;  2OTL T;  4L59 A;  1YJW T;  3JAM E;  1ZQ1 A;  3JB9 D;  5GAM f;  4M75 C;  5HKC A;  3L2R A;  3QKJ A;  3CEY A;  4M78 D;  1Q86 U;  4OGE A;  5GAN 4;  3OYA A;  4M77 E;  5CKE A;  1M1K U;  1M1F A;  5C6S A;  2KSS A;  2RJE A;  2BUD A;  2FL7 A;  2KDS A;  2MF2 A;  3C95 A;  4KUI A;  3EFS A;  4N4H A;  3E9F A;  4JJN K;  1YJN T;  3S3N A;  3JCM J;  5GAN e;  3JB9 H;  3OB9 A;  1UGQ B;  4EDU A;  4IUQ A;  4FT4 A;  2F5T X;  4M78 A;  3X25 B;  5GAN g;  3GP8 A;  3HP9 A;  4ELZ C;  3CCV A;  4C92 D;  1VIE A;  2A3L A;  4C8Q E;  4OB0 B;  4OB1 B;  3A8G B;  2DD4 A;  1UGS B;  4O5V A;  3ASK A;  3KBG A;  4M7A B;  2HNI A;  4BUG A;  3MCA B;  3MEU A;  2QA4 A;  5FRM A;  4XTZ A;  2K3Y A;  3EFR A;  1M90 U;  1XNI A;  3JB9 G;  3PIO A;  4F7U B;  2XDP A;  4E7K A;  4L6V 5;  4M78 G;  1WJS A;  1Q7Y U;  4XTV A;  3CD6 T;  2MWP A;  3OYL A;  3RES A;  4V2S A;  2DO3 A;  4RMO A;  1VQ8 T;  3QJY A;  1QVF A;  4IUP A;  4OGC A;  2CZ1 B;  2PU9 B;  4FSX A;  3OYM A;  1Q82 U;  1PSE A;  4JLI A;  4C92 A;  4BE1 A;  1YJ9 T;  3JCM e;  5GAN 6;  5I2S A;  3V8J A;  4M77 F;  4PJO C;  3OYF A;  3M53 A;  1Q81 U;  4M75 D;  5CKF A;  1BI1 A;  5HK3 A;  3JCM g;  1QVG A;  4MDW A;  3RKX A;  1YHQ T;  2O4X A;  2DTI A;  3QPH A;  3I55 T;  2X4J A;  4C92 G;  1TH7 A;  5GMK h;  2XHC A;  2KK4 A;  3CCM A;  2KMT A;  3MP1 A;  1VQ4 A;  1YIJ T;  3CCU A;  2F69 A;  3E9G A;  2DEQ A;  1LJO A;  3L2W A;  2YLB A;  1VQK A;  3A5Z B;  4C5I A;  2LNV A;  2DXB A;  3OYK A;  3CCJ T;  3ER0 A;  4C8Q F;  1W4S A;  4RCB A;  4M75 A;  4O6J A;  3SWN C;  3CC2 T;  3SWN B;  5LJ5 e;  2WSE E;  5GAO m;  3OYE A;  3LGL A;  1AHJ B;  4LDX A;  3NTK A;  2H3J A;  2ZGW A;  2QDY B;  1WQ7 A;  3CCS T;  5LJ5 g;  4ZGD B;  4JRP A;  4XU0 A;  2F5K A;  2RA2 A;  1D3B A;  5CIU A;  3QYH B;  4M75 G;  4MZM A;  3CME T;  3RMQ A;  3ZBD A;  3GLX A;  4DOW A;  1K9M U;  3SDZ A;  4C5H A;  3QBY A;  3PMT A;  4KT0 E;  2A7Y A;  4J7I A;  2L5Q A;  4OVA A;  5KE2 A;  3CBP A;  2RHY A;  1NJI U;  3V7S A;  3OYI A;  2ZPI B;  3SFM A;  2HAX A;  4C0D B;  5A0L A;  1K73 U;  4PJO D;  1M9S A;  1VUB A;  3CCE T;  1LOJ A;  2E5Q A;  2Y90 A;  2E70 A;  3X26 B;  4A4K A;  4F7U A;  1QVP A;  3O8V A;  3VUB A;  3J81 E;  1NZ9 A;  4OP0 A;  3UT1 A;  1BI0 A;  2EQJ A;  3CPW S;  4L5G A;  3DLM A;  1I4K 1;  2K5F A;  2KY9 A;  4C0G A;  2E1H A;  4HKE A;  4XU1 A;  3ZEH A;  1X01 A;  4ELY C;  1JRI A;  2JZ2 A;  3OBY A;  3QYG B;  2VXE A;  4F7U G;  3MP6 A;  1VQO A;  3JCM X;  3LWI A;  1YCY A;  5CR2 A;  5GAO p;  3A8L B;  1KQ1 A;  5LJ3 d;  2ZPE B;  3X24 B;  3HRU A;  2IVW A;  3FLG A;  4IUR A;  3WVE B;  3OS0 A;  3OS1 A;  4PJO A;  3HHT B;  1HK9 A;  1ZHI A;  4QQD A;  4NL3 A;  5CK9 A;  1KHI A;  2ZCF B;  2OTJ T;  1WQW A;  4M78 B;  2V8I A;  5CO7 A;  5I21 A;  4FIB A;  3OYB A;  4BY6 C;  1VQ7 A;  4PJO G;  1G5V A;  3LYI A;  3QXE B;  3F70 A;  3HL8 A;  4II1 A;  1QP3 A;  4M7D E;  2L89 A;  2QXF A;  4BE2 A;  2X35 A;  4C0Z A;  4J7F A;  2YHT A;  3ME9 A;  3JB9 I;  5LJ3 f;  3SWN A;  1FWZ A;  2VV5 A;  3CMA A;  2M0O A;  4E7J A;  1Y7X A;  3TRE A;  2LT4 A;  3QZ9 B;  3LGF A;  1OZ3 A;  2DIQ A;  2CYZ B;  4VUB A;  1X6O A;  3PFS A;  1W2B A;  4E7I A;  3OW2 A;  2RJF A;  4C92 B;  2QQA A;  2JN0 A;  1K8A C;  1VQP A;  1UGP B;  1I5L A;  2CGH A;  3M4G A;  2PVD B;  4WF2 A;  3VV0 A;  2D9T A;  2RB6 A;  2DPP B;  2JUF A;  3I56 T;  1N9R A;  3UWN A;  1VQL T;  2X4Y A;  1NJI C;  3DKM A;  1Y96 B;  4J83 A;  4J8O A;  1YBY A;  3JCM W;  3QZ5 B;  1VQN A;  5C0M A;  3OA6 A;  2RI2 A;  2XIC A;  1UB4 A;  2DAQ A;  3TCJ A;  5FU7 B;  5J3B A;  1N6A A;  4M77 C;  5DM7 R;  1B34 A;  3QII A;  4HA8 A;  1QP2 A;  5GAN f;  4M77 B;  3C12 A;  3CCR T;  2RO0 A;  4M75 B;  2XG8 D;  3L2U A;  2E10 A;  2YRV A;  4M7D F;  1BYM A;  4N4I A;  3S3O A;  1FX7 A;  3GPL A;  4XU3 A;  2JVV A;  3LX7 A;  1D3B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...