3OA6A

Human msl3 chromodomain bound to dna and h4k20me1 peptide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
b'FKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDENRRLQRKLARKAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Male-specific lethal 3 homolog
molecule tags Dna binding protein/dna
source organism Homo sapiens
publication title Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
pubmed doi rcsb
total genus 19
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oa6A01
2HQXA 2E6NA 3OQ5A 3P8HA 2E5QA 4PL6A 3MEVA 3S6WA 4ZTJA 2R58A 3OYIA 2RO0A 3NTIA 4RG2A 3LGFA 3H6ZA 3MEAA 4QQ6A 4L59A 3OYBA 2DAQA 3OYEA 3L2VA 4E7LA 2M16A 3UT1A 4QQDA 3UWNA 2RHIA 4CRIA 1KHCA 2G3RA 5KH6A 3O8VA 1XNIA 4E7JA 2RHYA 3MO8A 5J26A 2MWOA 3OB9A 2PQWA 3OS2A 3OYCA 2F5KA 5FRMA 4FL6A 2B8AA 4ZTFA 4Q5WA 2X4XA 3MEUA 4A4EA 2JTFA 4II1A 3QIIA 4IURA 4NS5A 3L2RA 1MHNA 2P0KA 3P8DA 2RJFA 3PNWC 2NLUA 2D9TA 2CKKA 2K3YA 2RJDA 5C6SA 4IUUA 4QVZA 4UC4A 4N4IA 3OYKA 2RI2A 3DB3A 3H8ZA 3S3MA 3MP1A 3MP8A 1H3ZA 5FRNA 3DLMA 3OS1A 2QQSA 3META 1WJRA 3E9FA 5IN1A 4Z02A 2GF7A 3DB4A 4A4GA 3LYIA 4C5HA 2XK0A 1OI1A 4C5GA 3QBYA 4PLIA 5KCOA 3OYJA 2O4XB 1WJSA 4IKFA 4N4GA 4EDUA 4GY5A 2K3XA 3OYFA 2EQJA 4IUTA 3OYAA 1WGSA 2BKDN 2LCCA 4QQGA 3PMIA 4X34A 2FHDA 3OMCA 2L3RA 4BE0A 1RI0A 4A4FA 3QJ6A 4IUPA 3CEYA 1OYXA 3E9GA 2RI3A 5D6YA 5FROA 5M9OA 3OYHA 3L42A 3C4SA 5CIUA 3OY9A 3OMGA 3OYNA 3FDRA 2M1HA 3L2UA 4E7HA 3FLGA 3LGLA 2RHXA 3F70A 2RI5A 3PFSA 2LVMA 5KCHA 2EQUA 3PMTA 2GFUA 3OS0A 3OYGA 2EQMA 2EFIA 5D6XA 3QKJA 2VYTA 4OVAA 3OA6A 4QW2A 4BDZA 2R57A 3M9QA 3L2WA 4IUQA 2L8DA 2X4WA 2O4XA 2RHUA 3ZEHA 3Q1JA 2RHZA 2L89A 3MEWA 4A4HA 3SD4A 3S3NA 1OZ2A 3KUFA 2R5AA 2LRQA 2RJEA 1N27A 2QQRA 4FU6A 2R5MA 2LDMA 2DIQA 3GOXA 2EKOA 4B9XA 2DIGA 5KE2A 1WJQA 2WACA 4E7KA 4PLLA 3MP6A 4HCZA 3L2QA 5C0MA 3OYMA 4IUVA 3OYDA 2JZ2A 3NTKA 3LLRA 3LX7A 3BDLA 3ME9A 3ASKA 3FEOA 5KE3A 4BE2A 4BDYA 2XDPA 2LTOA 2X35A 1SSFA 4N4HA 4BACA 4BE1A 2X4YA 2M0OA 3FC3A 4LD6A 4C5EA 2GFAA 3NTHA 5D6WA 2BIVA 2BUDA 3S3OA 4E7IA 4BD3A 3OYLA 2EQKA 5J39A 2YRVA 1OZ3A 5IAYA 4B9WA 4C5IA 2RJCA 2HQEA 2MWPA 1G5VA 3EAEA 2IG0A 3LH0A
chains in the Genus database with same CATH superfamily
4DBRA 3MEVA 4M77F 2CP6A 2LNVA 1EZZB 2OTJQ 3L2VA 4M78D 3UT1A 1VQ6Q 1YJNT 2AK5A 2IIMA 3FRNA 1T3SA 1PM3A 5EG2A 1YJNA 4HCKA 4AFSC 3CCMT 1VQMT 1KQSP 1UECA 1KQSA 4ORZA 5LJ3j 1MNDA 1V1CA 1MHNA 2CKKA 2C0OA 2QA4A 2RI2A 1Q81C 1YIJQ 3DLMA 4A63B 1HYOA 4Z02A 3KBGA 5KYXA 2HL5C 2MAMA 3CCJA 5GAMe 5GAMg 2HMAA 3JB9H 4E7SA 4F7UB 3GF5A 2BE9B 4J6WA 3M0TA 5IXFA 4BY6B 2CP0A 2Y4YA 4VUBA 2DVEA 1K9MC 4RG8A 2DPPB 3JCMf 4E7HA 3JB9F 4M7AG 4EMKB 2X3XD 5LJ5f 4J9FA 4BDZA 2X4WA 1GRIA 1Q7YR 3S3NA 1WX6A 1M27C 2R5AA 3GPLA 4M4ZA 1BBZA 5AT1B 1RACB 4ZGJB 5GAMd 2KBTA 2QTVA 2YSQA 2GNCA 1MMDA 3OYDA 2XICA 1O75A 2ZZDA 2LTOA 1VQPQ 5LJ5g 1D3BA 1SPKA 2LQKA 4M75D 4B6MA 2GBQA 3CC7T 4XTZA 2ED1A 2BE7D 2FL7A 4JJNK 4C5IA 2EJFA 2OAUA 1UGQB 3A1PA 2E1HA 1U8RA 3LH0A 1NLPC 1Z9ZA 1U1TA 4BUGA 2MOXA 3L1AA 2HZYA 2VVKA 1Y07A 4HKEA 1BI3A 2EWNA 1B7TA 2DRKA 3QPHA 3PT9A 1KFZA 1PKTA 1FMVA 1E6GA 2GGRA 5J3BA 4RUGA 2JW4A 4KGZB 4Q5WA 4A4EA 1U3OA 2P0KA 1H3HA 1E6HA 4OGCA 4KGXB 5C6SA 3RESA 3A98A 2CP5A 3OS5A 1KQ2A 2ZCFB 4J83A 2QDLA 5I22A 4KH0B 3I56T 3TSZA 2AT1B 2J06A 5IXBA 1CKAA 4Z8AA 4J6YA 1RAAB 3VS7A 1MMGA 3JCMg 4PLIA 3G4SA 2DEQA 2RQRA 1WPYA 2K79A 4OF1A 1WGSA 4BE0A 3QJ6A 1VQOA 2FYKA 3INZA 4WTOB 4C0DC 5IT9E 3P8BB 1VQNT 5FLXE 1QVPA 1I0CA 5KCHA 4J9IA 3CC4T 2EJGA 2CP2A 4JRKA 4E7ZA 1D1CA 3VUZA 3VYHB 1FX7A 1JU5C 4MMLA 1MNEA 2QA4Q 2D8HA 2LDMA 2O88A 1SHFA 2O01E 2DIGA 2RNAA 4HCZA 4PKCC 2LJ1A 3CMEQ 4N4HA 4BACA 1TU0B 3DKMA 3FC3A 1M5Q1 1VQKQ 3N5BB 2BUDA 1TG0A 2QEXA 5IAYA 4JJDA 2D8JA 1Q81R 2FPDA 3RKXA 2V8JA 2E5QA 5D7UA 3S6WA 3HTRA 2XD0A 4E7LA 4CRIA 1VQ9T 1UGSB 2ZPGB 4HVUA 4M78C 1W2BS 1QVGS 3CC4A 4IURA 1ZUUA 1M8MA 2NLUA 3JB9G 2CH4A 4XTUA 2J6OA 3X24B 3LYIA 1SG5A 2JMCA 4M7DC 5KYWA 1D1AA 1MV0B 2O4XB 4RTVA 1C1AA 1YI2T 2J6KA 8AT1B 4GLKA 2O2OA 2VV5A 1NBEB 2RK1A 1QCOA 5FROA 2E3HA 4PK4A 3OY9A 5LJ3h 4AG1C 3M55A 1QCFA 2J6FA 1QVGP 4OMMA 3EG3A 4JDSA 2EGAA 1HJDA 3HRSA 4FM4B 2RHZA 2L89A 1UG1A 2CZ1B 4XAXB 4M75B 3CCRA 4DOVA 2DBKA 2P0QA 1ZSZA 5C0MA 3OYMA 2V1QA 1N6AA 1BI2A 3EHQA 2XIDA 3ASKA 3MPUB 4CC2A 2FRYA 2XDPA 3R6OA 1JJ2P 1V29B 1KD1U 3QZ5B 1QWFA 2XMFA 2C0IA 3NTHA 1GXIE 4M78A 4M78G 2E10A 2KQWA 3G7ZA 2KRSA 2JNGA 1UDLA 1RAFB 1VQ9A 1M3CA 5LJ5e 1G2BA 1YFNA 3I5SA 1XQHA 2OTLT 2KVQG 1K9AA 2H8HA 1WQ7A 1X75C 2DO3A 3SFMA 3CMAA 2VUBA 1K4US 5LJ3f 1BCMA 2GQIA 1UGPB 4OB1B 4FL6A 2ECZA 1R8OB 1ZQ1A 2JTFA 2XU8A 4CC3A 1LVKA 2X4JA 2K3YA 4IUUA 1Q95G 4XU3A 4XK8E 2WSFE 2QQSA 1GFCA 3V7RA 3VV0A 1WJRA 3FJ5A 1M2VB 2HKNA 4DBHA 1B34A 2DJZA 1JJ2A 4E47A 3QO3A 2P0PA 4HVVA 2BZYA 4GY5A 2ESWA 1M1KR 2NUZA 3FIFA 3CCUT 3GBQA 3CCMQ 1AZGB 2LX9A 1RABB 1Q82U 3A8GB 3M0UA 5DY9A 4JRIA 3QWXX 3L2UA 4PJOA 2YUQA 3PFSA 2E5KA 2EVRA 4J9GA 2QGGA 2EGEA 2EKHA 3QZ9B 4FYVB 2EGCA 1BB9A 1I5OB 4PJLA 1NYFA 1YHQQ 4BI8B 1S72Q 9ATCB 1IXDA 1FWZA 1TS9A 2JS2A 2PUOB 2RJEA 3VS2A 2EAYA 3AHUA 1KQSS 3X20B 5GAN3 3CBOA 4PLLA 1NEBA 3L2QA 1QLYA 1Q86U 2J05A 1OV3A 2RH2A 1LCKA 2DNUA 2HAXA 3EFOB 2QDYB 3VU3C 3WVDB 5D6WA 4OMNA 2LNHB 4JJBA 2EQKA 1UE9A 4RTTA 1WQWA 1EIFA 2JUFA 2A08A 1YJWT 2ROLA 3QSUA 2RQWA 2KY9A 1IHWA 1Y96A 3A8MB 3SWNB 4C8QD 1UHFA 2VWFA 4R56A 2DXUA 5DLQE 4IIMA 3CCVA 4PJOG 2FPFA 1VIFA 3JCMe 5LJ5d 4RTZA 1K9MU 3OS2A 3HRTA 2DERA 5FRMA 2P4TA 3CCRQ 3I5RA 4ATOA 5ECAA 2RJDA 5IH2A 4UC4A 4N4IA 1QQJA 2YUNA 3EH2A 3MP1A 3MP8A 2AZVA 2K2MA 3DB4A 1JRIA 1BIBA 4C0DB 1YI2Q 4NL2A 2YRDA 1VQ8Q 1ZA1B 4ESRA 1B3QA 2BKDN 3JCMV 1JXOA 4F7UF 4M7DE 2QEXT 3G6EQ 1EX4A 4FYXB 2OJ2A 4FSXA 1OQKA 1H92A 4KUDK 1UGRB 1GL5A 5A0GA 1JBMA 5GANj 2LVMA 1KQ1A 1C0MA 3QKJA 3CCQT 1Y57A 4FW2A 3X26B 3HP9A 2KMTA 4M77C 2EYZA 3LW5E 3CCLA 1T0HA 5A0LA 1NPPA 2EKOA 5GAN7 1WJQA 2WACA 1RAEB 1N8RU 2YRCA 1NG2A 3X28B 2CREA 1SSFA 2DL8A 2HDAA 2AKLA 1SRMA 1VQOT 1KC8C 3OYLA 1HK9A 1VQMA 4LN2A 5IHNA 4HA8A 5CQYA 2HQXA 3VYGA 3JSCA 2KYBA 1TUDA 3PIOA 2JT4A 3OSSC 3MJXA 3EFRA 3NGPA 2PU9B 1VA7A 4QVCA 5KH6A 1WYXA 5CK9A 3I56A 3FB9A 2DL3A 3RUXA 4C92F 8ATCB 3TREA 5GAN6 1YWPA 1BK2A 1VQLA 1X2KA 1VQ5Q 5HKCA 3E2UA 1WLPB 4II1A 1MGQA 1VQNQ 4QVDA 5GAMf 2IPOB 3HSBA 4EMKC 3CBPA 2V8KA 1HXDA 2K9GA 3CD6Q 5I21A 2Y90A 4IKFA 3VS1A 2GQVA 3OYFA 4IUTA 3OYAA 4X34A 3OMCA 3UATA 1X01A 1PC0A 2O9SA 1U1SA 1VYUA 3CEYA 1M1FA 2DBMA 2QASA 1R77A 4RTXA 2CZ6B 1JXMA 2BZ8A 4J9CA 2M51A 1D0ZA 4ELYC 3OYNA 2M1HA 3LGLA 1G3SA 1PD1A 2YHTA 4HXJA 4M7AA 1AZEA 3HFOA 1ABQA 1QKWA 3M59A 1Q86R 4PJMA 1NPRA 2SRCA 4X9DA 2MF2A 2X9HA 4EMGA 2RHUA 1VQ4A 3A8HB 2H3JA 1OZ2A 3EG2A 3CPFA 4N0AA 1KD1C 5KE2A 1TUCA 3MP6A 1VQ7A 1HD3A 3LLRA 2EYYA 2MK5A 4FIBA 4BDYA 2X35A 5I2SA 2CZ0B 4JJCA 5GAMh 2LP5A 3VRZA 3OW2A 2O9VA 3CC2Q 4XQ3A 4X9CA 2EW3A 2ENMA 2QQ9A 1K8AU 5FU6C 1RL2A 2DL4A 4XTWA 3G6EA 3CPWS 2E41A 2QI2A 4DEYA 3P8HA 1W6XA 3EG0A 1VQOQ 2EQIA 3OYIA 4ZTJA 3JCMJ 2FZKB 4OB2B 2HSPA 1TWBA 3UWNA 3PVLA 5GAOm 2Z0WA 1XNIA 3G4SQ 4E7JA 4MZTA 5CKDA 2BZXA 2DTIA 3RKWA 3OB9A 4C8QC 5CKHA 3QIIA 2LMJA 4XU0A 4FYWB 1VOMA 3V7CA 2VKNA 4LE9A 4C5HA 1YJ9A 4LDXA 2MYSA 4LNPA 4J8OA 2C06A 4F14A 4C92G 1KSWA 1IGUA 4JLIA 1Q7YC 2VGMA 3KXTA 4EIKA 3CMEA 1SF9A 4F7UG 1VIEA 3F70A 2PZ1A 5GJVB 2HBWA 3TEEA 5GAOq 3JCMX 5KYXB 3VUBA 3I55Q 2LCLA 2X51A 1VQ5A 4M7AB 2O4XA 4WCIA 4OGEA 3Q1JA 3CCQA 3SEMA 3UA6A 3EG9B 1QVFS 4JPBW 1LPLA 2OTJT 3EGXB 2DIQA 3EFOA 1YN8A 4B9XA 5FW9A 3CPWP 2DKGA 5FU6B 1K8AC 1Y71A 2JZ2A 2K5FA 2QAZA 4BE2A 5GAN2 1SKUB 3M58A 4M78F 4CC7A 1C6VX 2AZSA 4CC4B 1WA7A 4RMOA 4C8QA 1NJIC 2HKQB 3S3OA 4L6V5 4AFUC 2DTHA 2L5QA 3G71Q 1N8RC 1ZX6A 1I5LA 3CCUQ 5GAOr 3TVTA 2IG0A 2DL5A 4AMCA 3M4YA 4J5YA 1PSFA 4GBQA 1K73C 4A53A 2RO0A 1K76A 1VUBA 4TVRA 2RK2A 4M7AE 4M7DD 3QG1A 2A3LA 4KBMB 4F17A 5GJWB 4M7DG 4JLGA 5GMKj 3CQTA 5FU7B 2X4XA 3CCVT 1M8VA 3QDFA 1RLQC 4KT0E 1OOTA 1UFFA 2M0YA 5GANd 3IQLA 3H41A 5CKEA 3X25B 1OULA 4XTVA 1N9SA 3JCMb 1VQ7Q 3CCST 3RIRA 3CPWA 4PJOC 3META 4P5NA 2XK0A 5GANf 4V2SA 3QHSA 4ME7A 2FG0A 1D3BB 2DTOA 4N4GA 2EQJA 4C8QB 5IHIA 4D8DA 1MV3A 4Y92A 4ZN1A 3QWYA 5D6YA 2YWWA 3SB2A 2JXBA 1VQ9Q 1T0JA 1XJWB 1AWOA 3RKYA 4M77G 2YT6A 4M77A 1A0NB 3H0HA 2EQMA 1J3TA 2MIOA 3M9QA 5LJ3d 2E70A 1LOJA 1AWXA 2KR3A 3T9NA 1N27A 5FU7C 3REBB 1OX8A 2LJ3A 4L5GA 2BTTA 2RA2A 2QG9B 3QYHB 3QXEB 4QT7A 4MZPA 3WXMB 2X4YA 2RD1A 2L3PA 2HCKA 3A8OB 2A7YA 3ZFJA 2RMOA 1IHVA 1OPLA 5LJ3g 5HK0A 3UDCA 4E6RA 4DBQA 1AWJA 1YHQT 3H6ZA 2RHIA 1KHCA 1RUWA 4DQ2A 3H9NA 1IZ6A 3ULRB 4RTYA 3CCQQ 3OYCA 2L2PA 3VRYA 4GLMA 2DYBA 1WI7A 1UTIA 3PNWC 1GCQA 1YIJT 4PNOA 2OTLA 2DE0X 3DB3A 2OAWA 5FRNA 3OS1A 4JRQA 5GANh 2FPEA 4PFOA 3OW2P 4JZ4A 2E6ZA 4A4GA 3CXCS 3G71T 5KCOA 1XTDA 1AOJA 2JMAA 1X27A 5CQXA 1QP2A 2VXFA 1IGQA 5A0DA 4WF2A 2DVJA 2QXFA 3LH5A 2RN8A 2JOYA 2RI3A 1NZ9A 1VQKT 3M57A 2Y4XA 1M2VA 3I9QA 3OYYA 2K6DA 1WNLA 1WXTA 1I8FA 5KYNA 3OS0A 2E12A 4J9BA 4OVAA 4FYYB 4JS4A 2DRMA 1QW1A 2RQVA 5AYFA 4LD9K 3E1SA 2SEMA 1TXQA 5GMKi 1GBRA 3M53A 4MMKA 2CSQA 1M3AA 2KRMA 4OMPA 1NEGA 3L2ZA 2M02A 4M75G 3GP8A 1KHIA 2AHJB 2DYIA 2COZA 1YI2A 1F1BB 4PFPA 4HT8A 2COYA 1B34B 1PNJA 1KJWA 4E7IA 1Q86C 1WXBA 2CGHA 1QCNA 5CKFA 1VYTA 2AKKA 1S72A 4C0FA 2D0QB 1GCQC 2HSEB 5KYUA 1M1KU 3I35A 1MUZA 3EGDA 2DAQA 4J9EA 4QQDA 1LJOA 3ZL7C 3CC7A 1N9RA 3SHWA 1VQ7T 1GFDA 1RAIB 3EG9A 3MEUA 4X1VA 2W0ZA 1M9SA 4F7UE 2DLPA 1VQ4T 4QKUA 3QYGB 2ROTA 1H3ZA 1PSEA 4C92D 3E9FA 1QP3A 1KC8R 2GCXA 2FVUA 5CO7A 1YITT 1OI1A 2NUPB 2LX7A 3QBYA 3OYJA 1WJSA 3URGA 4EDUA 1ZSZB 3CCLQ 2ED0A 4OMOA 3PMIA 2CS7A 1AT1B 3DLLA 4M75A 3QDRB 3FJPA 5LJ3e 4RTWA 2KGTA 1FMKA 1HSQA 1I07A 3FLGA 2RHXA 2LJ0A 3VS6A 3TCJA 3NPFA 5D6XA 2OX7A 3I56Q 2DM1A 3OA6A 1R0CB 5KYYA 3JCMW 1R0BG 2LQ8A 1VQLQ 3ZBDA 4BB7A 2QGFB 4M7DA 2FZCB 2KRNA 2OTLQ 2OI3A 1W2BA 1VQNA 4C92C 1NE8A 3M56A 4XTXA 3WVEB 5CAIA 4JRPA 4ELZC 3CCEQ 1D0XA 2L3SA 1NM7A 5GMKh 2YRVA 2H3EB 4OMLA 3A8LB 1ABOA 1M3BA 3RNJA 1ZBJA 3RMSA 3CD6A 4OP0A 2DILA 3LGFA 2RF0A 1WHHA 4LDYA 5GAN5 3OYEA 2M16A 1QVGA 2E65A 1FMWA 1NJIR 5A2QE 2DETA 1CKBA 3ER0A 2WSCE 3JAME 2HQHA 1Z9QA 1IO6A 4PJOD 1I81A 2F5KA 3M0RA 1YCYA 2DMOA 4M75C 5GMKm 3PIPA 1UJYA 2D0NA 2E3IA 2KNBB 3VS0A 3L2RA 1VQMQ 3PGGA 1M1GA 2KEAA 4F7UA 1FXXA 2VASA 1BI1A 1AHJB 3NFCA 2KYMA 4RKUE 4YTLA 3TSWA 1VQ4Q 2YLBA 1QWEA 2RQTA 3E19A 3HRUA 4AT1B 1UGVA 1WFWA 3UPUA 1RI9A 3M4GA 3RMQA 5GAOp 2CUBA 3VS3A 1S1NA 2YUOA 2KT1A 2FEIA 1BI0A 4D8KA 1SRLA 3CC2A 2MMPA 2KDSA 3JRZA 1K73U 1K0XA 1WZOA 4C0ZA 1SEMA 1LNXA 4PJOE 1ARKA 2K4YA 1KIKA 2FB7A 1ZHIA 4KULA 2L8DA 2V8IA 4HCCA 3RR6A 3MEWA 1NJIU 2LCSA 2OTJA 2M9UA 3TQ7P 1VQ6A 3LWIA 3C0CA 3LX7A 5I2MA 4M7AC 4C8QF 1YJNQ 3BFMA 1QKXA 1VQPT 4BE1A 4M77E 1S72T 1DJ7B 2LQWA 4C5EA 4BD3A 1ZUKA 1VQ8T 4JZ3A 1TTHB 4FCYA 1H8KA 1BU1A 2HQEA 5I11A 3CMET 4FT4A 2G6FX 5KYWB 1Y7XA 1V76A 2R58A 1GCPA 3JB9J 3MEAA 2QA4T 3VS4A 2B86A 2F2XA 2ZGWA 3CD6T 3QUIA 3SWNC 1K0SA 1KK7A 2CT4A 2LT4A 3CCJQ 2RHYA 1Q7YU 2DXTA 1UHCA 3MO8A 1G8XA 2K57A 1MMAA 1YJ9T 5J26A 1ZBXA 3NHNA 2QYZA 2HBPA 2KE9A 4RCCA 2EYWA 1YBYA 3TU4K 3V7SA 1M30A 3BW1A 5GAMj 3P8DA 1WXUA 1JQQA 2VC8A 2MCNA 2RB6A 3H8ZA 4DEXA 3JCMc 5LJ5j 1YJWQ 5IN1A 3I55A 1GBQA 4J9HA 3CCEA 4NL3A 3J81E 2O31A 2FO0A 4M78B 4PJNA 3G71A 1AVZC 5KYYB 3CCUA 1WHJA 4LXCA 3CCLT 2CZ7B 2MI6A 1CSKA 1Q82R 5M9OA 5GAN8 3OW2S 4M75E 3OYHA 4Y91A 2EIFA 4R0KA 2FZGB 3C4SA 1VQPA 1YITQ 3KFVA 3OMGA 2ZAEA 3CXCP 3VKIA 3CXCA 1YIJA 3PMTA 2F5TX 2PNIA 2LC4A 1G83A 4C8QE 3OYGA 2VYTA 3OSVA 1VQ6T 3GNGA 4EMHA 1YJ9Q 1D1BA 2JVVA 1PWTA 1RLPC 4K11A 3KUFA 1EFNA 1W4SA 1WDXA 2QQRA 4JS5A 1IREB 3HPWA 4NOYA 5IHKA 2JM8A 3CC2T 3ME9A 5CKBA 4ZNXA 5KE3A 3CMAT 1Y96B 2JTEA 4IIOA 4J7IA 3C94A 4R55A 4LD6A 2CP7A 1WHKA 4OMFB 1M90C 2A0FB 3M5AA 4PFZA 4OB3B 1OZ3A 3VS5A 1YWOA 3UA7A 4LUEA 3JCMh 2LT1A 2MWPA 1X6GA 1VYVA 4A54A 1UUEA 2E6NA 4PL6A 1G3WA 4RG2A 2K2VA 4L59A 2RQUA 1FYNA 2DZCA 2DF6A 2G3RA 4MDWA 2KROA 3MHXA 1WIEA 2KK4A 1X69A 3U23A 3GLXA 3EG1A 4E2FB 3CCRT 1G3TA 4NS5A 1OX9A 1X6BA 2A36A 3HHTB 5HK3A 3CBMA 1ZSZC 1OPKA 2XHCA 2K7AA 3M54A 5GAN4 1VQLT 1UEBA 2I0NA 2LQNA 4ZGDB 5FWBA 6AT1B 3C12A 1Q81U 2K3XA 2ZPBB 1G3YA 4XU2A 4LUDA 4XTYA 1E7OA 2F69A 1M2OA 3HL8A 4BI4A 5CIUA 3CCSA 1TSFA 1YNZA 1SHGA 2RI5A 1VQKA 2EQUA 2EYQA 4F04B 2DXCA 3H0FA 4KH1B 2AIRB 4PJOB 1YP5A 2V26A 4C92A 1WHLA 4HVWA 2PUKB 3O5ZA 2V1RA 2F2WA 2GTJA 2R5MA 2HNIA 3M0QA 1QMCA 2DEUA 1N8RR 1WHGA 3NTKA 1W70A 4BI3A 2E4HA 1Q82C 2IVWA 2NUTA 2KSSA 2CUDA 1X43A 3CC4Q 4AFZC 5HCKA 3OBWA 4B9WA 3BDUA 2RJCA 1ZUYA 1BKBA 2JJ9A 3NMZC 1BCOA 1BIAA 2KXDA 3OQ5A 4F16A 2QTXA 4J6XA 4J7FA 4Z89A 1RAGB 1YITA 3JCMd 3PE0A 2P84A 4OB0B 2DX1A 3JB9D 1M90R 3EGXA 3H0IA 3JCMP 2EBPA 4PJJA 2ZPEB 2EJ9A 1H641 4FSSA 2B8AA 3THKA 5L23A 2E64A 2D6FA 2EPDA 2QEXQ 1KG1A 4LDWA 2A37A 3AT1B 4QVZA 3GIBA 2DL7A 1OU9A 3S3MA 2HL3A 1NYGA 1KD1R 4D6WA 2VB6A 3V8KA 3SWNA 5EC7A 1Y0MA 5DLOA 3MCAB 4J9DA 1W2BP 2XKOC 1TOVA 1ZSGA 2HEQA 1YCSB 2DJQA 3MKDA 2LCCA 3JCMQ 1RAHB 3JV3A 1RI0A 4PJOF 2ZPHB 2C0TA 1X6OA 2PVDB 5HY6A 1ZA2B 1AWWA 4MZMA 3L42A 2X3WD 1OU8A 2LZ6B 3FDRA 1JO8A 1PHTA 2F2VA 2GFUA 2EFIA 2YUPA 2HD0A 4QW2A 2R57A 4A4HA 4EPCA 4RCBA 4O5VA 1M90U 1K9MR 4CI0C 1NLOC 4AFQC 5GANg 2P4RA 4DA4A 2QK0A 2CH4W 1K1ZA 1XOVA 2XI9A 2ABLA 2DXBA 2RM4A 3BDLA 2XDDA 3FEOA 2ZPFB 3QJYA 1RADB 2BIVA 1UB4A 2CT3A 2COWA 4DOWA 2KI7A 4C92B 4XU1A 2PVGB 1I4K1 1PRLC 1K73R 2XG8D 1MMNA 4ZGEB 4KRTA 4KGVB 5KYUB 2NYSA 4RTUA 5GAOn 2A28A 1O9SA 2GTOA 5FWCA 3CCSQ 3M0PA 4QQ6A 2DA9A 1OEBA 3OBYA 2J7IA 2NWMA 5CCAA 2MWOA 2PQWA 4ZTFA 1N5ZA 2NUPA 2CSIA 2W10A 4OMQA 1AD5A 3REAB 5L8RE 1IB8A 3EH1A 1U5SA 2CP3A 1YHQA 1SSHA 1X2QA 1PD0A 4C5GA 4DBFA 3CC7Q 4M77D 2JTMA 1D0YA 4Z88A 2XDBA 4IUPA 2DFUA 1U06A 2KXCA 1OYXA 3E9GA 2DK3A 2L3QA 3EGDB 4N0AC 3V8JA 3CMAQ 2JM9A 1QVFA 5DM7R 3D7SB 3PTAA 4M7AD 3L2WA 3C95A 3CCET 3I55T 2QQAA 1IRXA 3SD4A 3VJPA 3A5ZB 2LRQA 4FU6A 2EYXA 2PTKA 3GOXA 3BY7A 3CCMA 4M75F 4E7KA 3G1JA 2JN0A 3EFSA 2WSEE 2I2LA 2KT8A 3G4ST 2YDLA 2FRWA 2M0OA 1PCXA 2CDTA 2GFAA 1D09B 4C8QG 4O6JA 4LDUA 4HCBA 2JS0A 5J39A 3PVQA 2DD5A 3RDVA 2YLCA 4Y28E 3NTIA 1WHMA 2PVOB 2ZPIB 4M77B 5LJ5h 3OYBA 2NUTB 1W1FA 1TUGB 2D1XA 1VQ8A 3R6NA 1JB0E 3O8VA 3V8LA 2K3BA 1M1KC 3HKSA 2VGNA 1M4ZA 5GMKe 1JEGA 1QVFP 3G6ET 3RERA 2DD4A 4ZN3A 4LDVA 2RJFA 2D9TA 1JJ2S 3OYKA 3LWHA 2RPNA 2CYZB 4M7DF 3J80E 2GF7A 2YXYA 4FW1A 1TH7A 2ATCB 1BYMA 3GNFB 7AT1B 4QQGA 1T3LA 2DZ9A 2FHDA 2L3RA 1K8AR 2K5IA 4A4FA 4M7AF 2QQBA 5CR2A 2MPXC 5GMKl 4JUVA 3J7AF 4AG2C 4MDXA 2K5LA 3CCVQ 4M78E 3JB9I 4EMKA 1UJ0A 4FT2A 1B07A 2F1LA 4IUQA 1ZLMA 3ZEHA 1PKSA 3EGUA 1I1JA 5LL6S 4M7DB 1ACMB 4A4KA 1VQ5T 1P92A 3RBBB 3UF4A 5GAOl 1PRMC 3HFNA 1KC8U 3SDZA 4IUVA 3CCJT 1YJWA 3BE3A 2VXEA 3EHRA 2KAFA 4HT9A 4C0GA 4KUIA 5GANe 4ANJA 2L0AA 4C92E 3M0SA 5CVIA 1PG5B 3EAEA 4BY6C 1G5VA 1AEYA
chains in the Genus database with same CATH topology
4A54A 5LJ3g 2E6NA 5HK0A 3UDCA 1YJWT 4PL6A 3MEVA 4M77F 1G3WA 3QSUA 2LNVA 4RG2A 2K2VA 1YHQT 2KY9A 3H6ZA 1Y96A 3A8MB 4L59A 3SWNB 3L2VA 4M78D 3UT1A 4C8QD 2RHIA 4R56A 1KHCA 2DZCA 2G3RA 1YJNT 2DXUA 5DLQE 3FRNA 4DQ2A 3CCVA 4PJOG 5EG2A 3JCMe 1VIFA 4MDWA 1YJNA 1IZ6A 3MHXA 5LJ5d 2KK4A 3GLXA 1K9MU 3OS2A 3CCMT 3HRTA 3OYCA 1VQMT 3CCRT 5FRMA 1KQSA 1G3TA 5LJ3j 4NS5A 2P4TA 1MHNA 3PNWC 4ATOA 1YIJT 2CKKA 2RJDA 3HHTB 4PNOA 2QA4A 5HK3A 4UC4A 4N4IA 2OTLA 3CBMA 2RI2A 3DB3A 3MP1A 3MP8A 1Q81C 5FRNA 2XHCA 3DLMA 3OS1A 3M54A 4JRQA 5GAN4 5GANh 1VQLT 4Z02A 3DB4A 3KBGA 1UEBA 2E6ZA 4A4GA 1JRIA 1BIBA 4C0DB 4ZGDB 3CXCS 2MAMA 4NL2A 3G71T 5KCOA 1XTDA 3CCJA 5GAMe 3C12A 1Q81U 5GAMg 2K3XA 5CQXA 1QP2A 2VXFA 3JB9H 2BKDN 2ZPBB 3GF5A 3JCMV 1G3YA 4XU2A 4F7UB 4F7UF 5A0DA 4M7DE 2QEXT 4J6WA 4WF2A 2QXFA 4XTYA 4BY6B 2F69A 2JOYA 2RI3A 1NZ9A 2Y4YA 3HL8A 4VUBA 4FSXA 1VQKT 2DVEA 3M57A 4KUDK 4BI4A 1K9MC 2Y4XA 1UGRB 2DPPB 4RG8A 3JCMf 1JBMA 5CIUA 3OYYA 5A0GA 3CCSA 1WNLA 4E7HA 1I8FA 3JB9F 5GANj 2RI5A 4M7AG 2LVMA 1KQ1A 2EQUA 4EMKB 1VQKA 3OS0A 2EYQA 3QKJA 2E12A 2DXCA 4OVAA 3CCQT 5LJ5f 4PJOB 4BDZA 3X26B 2X4WA 4JS4A 4C92A 3HP9A 2KMTA 4M77C 3S3NA 2PUKB 1QW1A 5AYFA 2R5AA 3GPLA 3E1SA 4LD9K 3LW5E 3CCLA 5GMKi 2R5MA 3M53A 2HNIA 4ZGJB 5A0LA 1NPPA 4MMKA 2EKOA 5GAN7 5GAMd 1WJQA 2WACA 1N8RU 3X28B 3OYDA 3NTKA 2XICA 3L2ZA 1O75A 4BI3A 4M75G 3GP8A 1KHIA 2AHJB 1Q82C 2ZZDA 2IVWA 2LTOA 1SSFA 2KSSA 5LJ5g 1D3BA 1YI2A 4HT8A 2LQKA 4M75D 1B34B 1VQOT 3CC7T 4XTZA 4E7IA 3OBWA 1Q86C 1KC8C 2FL7A 3OYLA 4JJNK 1HK9A 2CGHA 4B9WA 4C5IA 5CKFA 1VQMA 2EJFA 2OAUA 3BDUA 1VQ8A 2RJCA 1UGQB 1S72A 1BKBA 4C0FA 2E1HA 2D0QB 1U8RA 3LH0A 4HA8A 5CQYA 1M1KU 2HQXA 1BIAA 3VYGA 3OQ5A 3JSCA 1U1TA 2QTXA 4J6XA 4J7FA 3PIOA 4C8QG 1YITA 4BUGA 3JCMd 3OSSC 3L1AA 3EFRA 5IT9E 2DAQA 1Y07A 4OB0B 4QQDA 4HKEA 2PU9B 1BI3A 4QVCA 1LJOA 2EWNA 5KH6A 5CK9A 3QPHA 3I56A 3JB9D 3FB9A 3RUXA 4C92F 3CC7A 1N9RA 3PT9A 3TREA 5GAN6 1VQ7T 3JCMP 5J3BA 1VQLA 2ZPEB 2EJ9A 1H641 2B8AA 5HKCA 4Q5WA 3MEUA 4A4EA 2E64A 2D6FA 4II1A 1MGQA 1M9SA 1KG1A 2P0KA 4F7UE 4LDWA 4OGCA 4QVDA 5GAMf 1VQ4T 5C6SA 3QYGB 4QVZA 3RESA 4EMKC 3CBPA 3GIBA 3HSBA 3S3OA 3OS5A 1KQ2A 2V8KA 2ZCFB 3S3MA 1HXDA 4J83A 1H3ZA 1PSEA 3I56T 4D6WA 4C92D 3E9FA 1QP3A 3V8KA 3SWNA 4J6YA 2GCXA 2FVUA 5CO7A 1YITT 5DLOA 5I21A 1OI1A 3MCAB 2Y90A 3JCMg 3QBYA 2XKOC 4PLIA 3OYJA 1WJSA 3G4SA 3URGA 4IKFA 2DEQA 1WPYA 4EDUA 2GQVA 3OYFA 4IUTA 4OF1A 3OYAA 1WGSA 2LCCA 3JCMQ 3PMIA 4X34A 2CS7A 3OMCA 3DLLA 4BE0A 4M75A 1X01A 4PJOF 1RI0A 2ZPHB 3QJ6A 1U1SA 3CEYA 1VQOA 1M1FA 2FYKA 1X6OA 2PVDB 3INZA 3QDRB 3FJPA 5HY6A 4C0DC 5LJ3e 3P8BB 2CZ6B 4MZMA 3L42A 1VQNT 3OYNA 3FDRA 5FLXE 2M1HA 1QVPA 4ELYC 3FLGA 3LGLA 2RHXA 5KCHA 1G3SA 2YHTA 3TCJA 4M7AA 2GFUA 3HFOA 3M59A 2EFIA 5D6XA 2HD0A 1NPRA 3OA6A 4QW2A 3CC4T 2EJGA 2R57A 4X9DA 3JCMW 2MF2A 4JRKA 4EMGA 2RHUA 2LQ8A 1VQ4A 4A4HA 4EPCA 3A8HB 2H3JA 4RCBA 3VUZA 3ZBDA 1OZ2A 3CPFA 4O5VA 4N0AA 3VYHB 1FX7A 4BB7A 1M90U 4MMLA 4CI0C 4M7DA 2LDMA 2O01E 1W2BA 1VQNA 2DIGA 1KD1C 5KE2A 5GANg 4DA4A 4C92C 1XOVA 3MP6A 4HCZA 1NE8A 4PKCC 1VQ7A 2XI9A 2DXBA 2RM4A 3M56A 4XTXA 3LLRA 3WVEB 3BDLA 2XDDA 3FEOA 2ZPFB 4FIBA 5CAIA 4BDYA 2X35A 5I2SA 2CZ0B 3QJYA 4N4HA 4JRPA 5GAMh 4BACA 3DKMA 3OW2A 4ELZC 3FC3A 1M5Q1 4XQ3A 4X9CA 3N5BB 2BIVA 2BUDA 2QQ9A 1K8AU 1UB4A 5FU6C 2QEXA 4DOWA 5GMKh 2YRVA 1RL2A 5IAYA 4C92B 4XU1A 4XTWA 3A8LB 2PVGB 3G6EA 3CPWS 1I4K1 2XG8D 4ZGEB 2E41A 3RKXA 2V8JA 2QI2A 3P8HA 2E5QA 5GAOn 3S6WA 4ZTJA 1O9SA 3OYIA 3RMSA 2XD0A 4LDYA 3LGFA 4OP0A 4QQ6A 4OB2B 3JCMJ 3CD6A 5GAN5 3OBYA 3OYEA 4E7LA 2M16A 3UWNA 1QVGA 2E65A 4CRIA 5GAOm 5A2QE 1VQ9T 1UGSB 3ER0A 1XNIA 2ZPGB 2WSCE 4E7JA 4MZTA 5CKDA 2DTIA 3RKWA 3JAME 5CCAA 2MWOA 3OB9A 2PQWA 4M78C 4C8QC 4PJOD 1I81A 2F5KA 4ZTFA 1W2BS 1QVGS 3CC4A 5CKHA 1YCYA 4M75C 5GMKm 3PIPA 3QIIA 4IURA 3L2RA 4HCCA 2NLUA 3PGGA 3JB9G 1M1GA 4XU0A 4F7UA 1FXXA 4XTUA 1BI1A 3X24B 3V7CA 5L8RE 3LYIA 4C5HA 1YJ9A 4LDXA 1AHJB 1YHQA 3NFCA 4M7DC 4RKUE 4YTLA 4C5GA 2O4XB 2YLBA 4M77D 3E19A 3HRUA 2JTMA 1YI2T 4J8OA 3UPUA 4GLKA 2C06A 3M4GA 3RMQA 2XDBA 2VV5A 4C92G 5GAOp 4IUPA 4JLIA 1Q7YC 2VGMA 2RK1A 3KXTA 1OYXA 3E9GA 3CMEA 2DK3A 5FROA 4F7UG 1BI0A 3OY9A 5LJ3h 1VIEA 4N0AC 3V8JA 3F70A 3CC2A 2MMPA 2KDSA 3JRZA 3M55A 1K73U 3TEEA 1QVFA 5GAOq 4C0ZA 3JCMX 1LNXA 4JDSA 3VUBA 2K4YA 4PJOE 2FB7A 1ZHIA 2LCLA 5DM7R 3PTAA 2OTJA 4KULA 3L2WA 3C95A 4M7AD 2L8DA 1VQ5A 4M7AB 2O4XA 2V8IA 3HRSA 4FM4B 4OGEA 3Q1JA 3CCET 2RHZA 2L89A 2QQAA 3MEWA 3SD4A 3VJPA 3I55T 3CCQA 3A5ZB 1NJIU 2CZ1B 2LRQA 1QVFS 4FU6A 4XAXB 2OTJT 2DIQA 4M75B 3CCRA 3GOXA 3BY7A 2M9UA 4B9XA 4M75F 4DOVA 3CCMA 2DKGA 2JN0A 4E7KA 5FU6B 3EFSA 2WSEE 1VQ6A 2P0QA 3LWIA 5C0MA 2I2LA 1Y71A 3OYMA 1N6AA 2JZ2A 1K8AC 1BI2A 2K5FA 3G4ST 3LX7A 2XIDA 3ASKA 5I2MA 5GAN2 4BE2A 4M7AC 3M58A 2XDPA 3R6OA 3BFMA 4M78F 4C8QF 1VQPT 4BE1A 1V29B 4M77E 1KD1U 2M0OA 3QZ5B 1S72T 1DJ7B 4RMOA 4C5EA 2GFAA 3NTHA 1GXIE 4M78A 4C8QA 1NJIC 4M78G 4O6JA 2E10A 4L6V5 2DTHA 2KQWA 2L5QA 3G7ZA 4LDUA 4BD3A 5J39A 4HCBA 1VQ8T 1N8RC 1I5LA 2JNGA 2HQEA 5GAOr 2IG0A 3CMET 2DD5A 4FT4A 3M4YA 2YLCA 4J5YA 1PSFA 1Y7XA 1K73C 1VQ9A 4A53A 2R58A 4Y28E 2RO0A 2PVOB 2ZPIB 3NTIA 4M77B 1XQHA 3MEAA 5LJ5h 3OYBA 2QA4T 3JB9J 2OTLT 1VUBA 4TVRA 2KVQG 2ZGWA 3CD6T 1WQ7A 1X75C 2DO3A 3QUIA 3SFMA 2RK2A 3SWNC 1JB0E 3O8VA 3V8LA 3CMAA 1M1KC 2LT4A 4M7DD 4M7AE 2RHYA 3QG1A 2DXTA 1Q7YU 2VUBA 3HKSA 3MO8A 2VGNA 1M4ZA 2K57A 2A3LA 5GMKe 1YJ9T 5J26A 1ZBXA 2HBPA 5LJ3f 4KBMB 3G6ET 3RERA 4RCCA 1UGPB 1YBYA 4OB1B 4M7DG 4JLGA 4FL6A 3V7SA 5GMKj 2DD4A 5FU7B 2X4XA 3CCVT 3TU4K 1M8VA 1R8OB 1ZQ1A 2JTFA 3BW1A 4KT0E 2XU8A 5GAMj 4ZN3A 4LDVA 3P8DA 2RJFA 2X4JA 5GANd 2D9TA 2K3YA 5CKEA 3X25B 2VC8A 4IUUA 1JJ2S 4XU3A 2RB6A 4XTVA 3OYKA 1N9SA 3JCMb 3LWHA 3H8ZA 4XK8E 3CCST 3RIRA 3JCMc 3CPWA 2WSFE 5LJ5j 4PJOC 2QQSA 3META 2CYZB 4M7DF 3V7RA 3VV0A 1WJRA 5IN1A 3J80E 2GF7A 3I55A 4P5NA 2XK0A 5GANf 3CCEA 1B34A 2DJZA 4V2SA 4NL3A 3J81E 4E47A 3QHSA 3QO3A 2P0PA 1JJ2A 4ME7A 1TH7A 1D3BB 1BYMA 3GNFB 2DTOA 4N4GA 4GY5A 2EQJA 4M78B 4C8QB 4QQGA 3G71A 3FIFA 2DZ9A 2FHDA 3CCUT 2L3RA 2LX9A 3CCUA 2K5IA 4A4FA 3CCLT 4ZN1A 2CZ7B 2MI6A 3A8GB 2QQBA 5CR2A 1Q82U 4M7AF 5D6YA 5M9OA 3SB2A 5GAN8 4M75E 5DY9A 3OYHA 4Y91A 5GMKl 2EIFA 3OW2S 4JRIA 3C4SA 4JUVA 1VQPA 3J7AF 3RKYA 3OMGA 4MDXA 4M77G 2K5LA 3VKIA 3L2UA 4M77A 3CXCA 4PJOA 3PFSA 1YIJA 3PMTA 2F5TX 3OYGA 2EQMA 2LC4A 4M78E 4C8QE 4EMKA 2VYTA 3OSVA 3QZ9B 3JB9I 3GNGA 1VQ6T 4FT2A 4EMHA 3M9QA 5LJ3d 4BI8B 4IUQA 2E70A 1LOJA 2JVVA 3ZEHA 1FWZA 3KUFA 1W4SA 2PUOB 5LL6S 4M7DB 4A4KA 2RJEA 3T9NA 1N27A 2QQRA 5FU7C 4JS5A 1P92A 2EAYA 1VQ5T 5GAOl 5LJ5e 3AHUA 1IREB 1KQSS 3X20B 5GAN3 3CBOA 3HPWA 3HFNA 4L5GA 4PLLA 3L2QA 3SDZA 4NOYA 4IUVA 1Q86U 1KC8U 3CCJT 2RA2A 2RH2A 3CC2T 3ME9A 5CKBA 5KE3A 1YJWA 3CMAT 3QYHB 1Y96B 2HAXA 3QXEB 4MZPA 2VXEA 3WXMB 2X4YA 2RD1A 2QDYB 3C94A 4J7IA 4R55A 4LD6A 2KAFA 4HT9A 3VU3C 4OMFB 1M90C 4C0GA 3WVDB 5D6WA 3M5AA 2EQKA 3A8OB 4KUIA 4OB3B 5GANe 1OZ3A 2A7YA 3ZFJA 3JCMh 2LT1A 4C92E 1WQWA 2MWPA 5CVIA 1G5VA 3EAEA 4BY6C 1EIFA 2JUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQX A;  2E6N A;  3OQ5 A;  3P8H A;  2E5Q A;  4PL6 A;  3MEV A;  3S6W A;  4ZTJ A;  2R58 A;  3OYI A;  2RO0 A;  3NTI A;  4RG2 A;  3LGF A;  3H6Z A;  3MEA A;  4QQ6 A;  4L59 A;  3OYB A;  2DAQ A;  3OYE A;  3L2V A;  4E7L A;  2M16 A;  3UT1 A;  4QQD A;  3UWN A;  2RHI A;  4CRI A;  1KHC A;  2G3R A;  5KH6 A;  3O8V A;  1XNI A;  4E7J A;  2RHY A;  3MO8 A;  5J26 A;  2MWO A;  3OB9 A;  2PQW A;  3OS2 A;  3OYC A;  2F5K A;  5FRM A;  4FL6 A;  2B8A A;  4ZTF A;  4Q5W A;  2X4X A;  3MEU A;  4A4E A;  2JTF A;  4II1 A;  3QII A;  4IUR A;  4NS5 A;  3L2R A;  1MHN A;  2P0K A;  3P8D A;  2RJF A;  3PNW C;  2NLU A;  2D9T A;  2CKK A;  2K3Y A;  2RJD A;  5C6S A;  4IUU A;  4QVZ A;  4UC4 A;  4N4I A;  3OYK A;  2RI2 A;  3DB3 A;  3H8Z A;  3S3M A;  3MP1 A;  3MP8 A;  1H3Z A;  5FRN A;  3DLM A;  3OS1 A;  2QQS A;  3MET A;  1WJR A;  3E9F A;  5IN1 A;  4Z02 A;  2GF7 A;  3DB4 A;  4A4G A;  3LYI A;  4C5H A;  2XK0 A;  1OI1 A;  4C5G A;  3QBY A;  4PLI A;  5KCO A;  3OYJ A;  2O4X B;  1WJS A;  4IKF A;  4N4G A;  4EDU A;  4GY5 A;  2K3X A;  3OYF A;  2EQJ A;  4IUT A;  3OYA A;  1WGS A;  2BKD N;  2LCC A;  4QQG A;  3PMI A;  4X34 A;  2FHD A;  3OMC A;  2L3R A;  4BE0 A;  1RI0 A;  4A4F A;  3QJ6 A;  4IUP A;  3CEY A;  1OYX A;  3E9G A;  2RI3 A;  5D6Y A;  5FRO A;  5M9O A;  3OYH A;  3L42 A;  3C4S A;  5CIU A;  3OY9 A;  3OMG A;  3OYN A;  3FDR A;  2M1H A;  3L2U A;  4E7H A;  3FLG A;  3LGL A;  2RHX A;  3F70 A;  2RI5 A;  3PFS A;  2LVM A;  5KCH A;  2EQU A;  3PMT A;  2GFU A;  3OS0 A;  3OYG A;  2EQM A;  2EFI A;  5D6X A;  3QKJ A;  2VYT A;  4OVA A;  3OA6 A;  4QW2 A;  4BDZ A;  2R57 A;  3M9Q A;  3L2W A;  4IUQ A;  2L8D A;  2X4W A;  2O4X A;  2RHU A;  3ZEH A;  3Q1J A;  2RHZ A;  2L89 A;  3MEW A;  4A4H A;  3SD4 A;  3S3N A;  1OZ2 A;  3KUF A;  2R5A A;  2LRQ A;  2RJE A;  1N27 A;  2QQR A;  4FU6 A;  2R5M A;  2LDM A;  2DIQ A;  3GOX A;  2EKO A;  4B9X A;  2DIG A;  5KE2 A;  1WJQ A;  2WAC A;  4E7K A;  4PLL A;  3MP6 A;  4HCZ A;  3L2Q A;  5C0M A;  3OYM A;  4IUV A;  3OYD A;  2JZ2 A;  3NTK A;  3LLR A;  3LX7 A;  3BDL A;  3ME9 A;  3ASK A;  3FEO A;  5KE3 A;  4BE2 A;  4BDY A;  2XDP A;  2LTO A;  2X35 A;  1SSF A;  4N4H A;  4BAC A;  4BE1 A;  2X4Y A;  2M0O A;  3FC3 A;  4LD6 A;  4C5E A;  2GFA A;  3NTH A;  5D6W A;  2BIV A;  2BUD A;  3S3O A;  4E7I A;  4BD3 A;  3OYL A;  2EQK A;  5J39 A;  2YRV A;  1OZ3 A;  5IAY A;  4B9W A;  4C5I A;  2RJC A;  2HQE A;  2MWP A;  1G5V A;  3EAE A;  2IG0 A;  3LH0 A; 
#chains in the Genus database with same CATH topology
 4DBR A;  3MEV A;  4M77 F;  2CP6 A;  2LNV A;  1EZZ B;  2OTJ Q;  3L2V A;  4M78 D;  3UT1 A;  1VQ6 Q;  1YJN T;  2AK5 A;  2IIM A;  3FRN A;  1T3S A;  1PM3 A;  5EG2 A;  1YJN A;  4HCK A;  4AFS C;  3CCM T;  1VQM T;  1KQS P;  1UEC A;  1KQS A;  4ORZ A;  5LJ3 j;  1MND A;  1V1C A;  1MHN A;  2CKK A;  2C0O A;  2QA4 A;  2RI2 A;  1Q81 C;  1YIJ Q;  3DLM A;  4A63 B;  1HYO A;  4Z02 A;  3KBG A;  5KYX A;  2HL5 C;  2MAM A;  3CCJ A;  5GAM e;  5GAM g;  2HMA A;  3JB9 H;  4E7S A;  4F7U B;  3GF5 A;  2BE9 B;  4J6W A;  3M0T A;  5IXF A;  4BY6 B;  2CP0 A;  2Y4Y A;  4VUB A;  2DVE A;  1K9M C;  4RG8 A;  2DPP B;  3JCM f;  4E7H A;  3JB9 F;  4M7A G;  4EMK B;  2X3X D;  5LJ5 f;  4J9F A;  4BDZ A;  2X4W A;  1GRI A;  1Q7Y R;  3S3N A;  1WX6 A;  1M27 C;  2R5A A;  3GPL A;  4M4Z A;  1BBZ A;  5AT1 B;  1RAC B;  4ZGJ B;  5GAM d;  2KBT A;  2QTV A;  2YSQ A;  2GNC A;  1MMD A;  3OYD A;  2XIC A;  1O75 A;  2ZZD A;  2LTO A;  1VQP Q;  5LJ5 g;  1D3B A;  1SPK A;  2LQK A;  4M75 D;  4B6M A;  2GBQ A;  3CC7 T;  4XTZ A;  2ED1 A;  2BE7 D;  2FL7 A;  4JJN K;  4C5I A;  2EJF A;  2OAU A;  1UGQ B;  3A1P A;  2E1H A;  1U8R A;  3LH0 A;  1NLP C;  1Z9Z A;  1U1T A;  4BUG A;  2MOX A;  3L1A A;  2HZY A;  2VVK A;  1Y07 A;  4HKE A;  1BI3 A;  2EWN A;  1B7T A;  2DRK A;  3QPH A;  3PT9 A;  1KFZ A;  1PKT A;  1FMV A;  1E6G A;  2GGR A;  5J3B A;  4RUG A;  2JW4 A;  4KGZ B;  4Q5W A;  4A4E A;  1U3O A;  2P0K A;  1H3H A;  1E6H A;  4OGC A;  4KGX B;  5C6S A;  3RES A;  3A98 A;  2CP5 A;  3OS5 A;  1KQ2 A;  2ZCF B;  4J83 A;  2QDL A;  5I22 A;  4KH0 B;  3I56 T;  3TSZ A;  2AT1 B;  2J06 A;  5IXB A;  1CKA A;  4Z8A A;  4J6Y A;  1RAA B;  3VS7 A;  1MMG A;  3JCM g;  4PLI A;  3G4S A;  2DEQ A;  2RQR A;  1WPY A;  2K79 A;  4OF1 A;  1WGS A;  4BE0 A;  3QJ6 A;  1VQO A;  2FYK A;  3INZ A;  4WTO B;  4C0D C;  5IT9 E;  3P8B B;  1VQN T;  5FLX E;  1QVP A;  1I0C A;  5KCH A;  4J9I A;  3CC4 T;  2EJG A;  2CP2 A;  4JRK A;  4E7Z A;  1D1C A;  3VUZ A;  3VYH B;  1FX7 A;  1JU5 C;  4MML A;  1MNE A;  2QA4 Q;  2D8H A;  2LDM A;  2O88 A;  1SHF A;  2O01 E;  2DIG A;  2RNA A;  4HCZ A;  4PKC C;  2LJ1 A;  3CME Q;  4N4H A;  4BAC A;  1TU0 B;  3DKM A;  3FC3 A;  1M5Q 1;  1VQK Q;  3N5B B;  2BUD A;  1TG0 A;  2QEX A;  5IAY A;  4JJD A;  2D8J A;  1Q81 R;  2FPD A;  3RKX A;  2V8J A;  2E5Q A;  5D7U A;  3S6W A;  3HTR A;  2XD0 A;  4E7L A;  4CRI A;  1VQ9 T;  1UGS B;  2ZPG B;  4HVU A;  4M78 C;  1W2B S;  1QVG S;  3CC4 A;  4IUR A;  1ZUU A;  1M8M A;  2NLU A;  3JB9 G;  2CH4 A;  4XTU A;  2J6O A;  3X24 B;  3LYI A;  1SG5 A;  2JMC A;  4M7D C;  5KYW A;  1D1A A;  1MV0 B;  2O4X B;  4RTV A;  1C1A A;  1YI2 T;  2J6K A;  8AT1 B;  4GLK A;  2O2O A;  2VV5 A;  1NBE B;  2RK1 A;  1QCO A;  5FRO A;  2E3H A;  4PK4 A;  3OY9 A;  5LJ3 h;  4AG1 C;  3M55 A;  1QCF A;  2J6F A;  1QVG P;  4OMM A;  3EG3 A;  4JDS A;  2EGA A;  1HJD A;  3HRS A;  4FM4 B;  2RHZ A;  2L89 A;  1UG1 A;  2CZ1 B;  4XAX B;  4M75 B;  3CCR A;  4DOV A;  2DBK A;  2P0Q A;  1ZSZ A;  5C0M A;  3OYM A;  2V1Q A;  1N6A A;  1BI2 A;  3EHQ A;  2XID A;  3ASK A;  3MPU B;  4CC2 A;  2FRY A;  2XDP A;  3R6O A;  1JJ2 P;  1V29 B;  1KD1 U;  3QZ5 B;  1QWF A;  2XMF A;  2C0I A;  3NTH A;  1GXI E;  4M78 A;  4M78 G;  2E10 A;  2KQW A;  3G7Z A;  2KRS A;  2JNG A;  1UDL A;  1RAF B;  1VQ9 A;  1M3C A;  5LJ5 e;  1G2B A;  1YFN A;  3I5S A;  1XQH A;  2OTL T;  2KVQ G;  1K9A A;  2H8H A;  1WQ7 A;  1X75 C;  2DO3 A;  3SFM A;  3CMA A;  2VUB A;  1K4U S;  5LJ3 f;  1BCM A;  2GQI A;  1UGP B;  4OB1 B;  4FL6 A;  2ECZ A;  1R8O B;  1ZQ1 A;  2JTF A;  2XU8 A;  4CC3 A;  1LVK A;  2X4J A;  2K3Y A;  4IUU A;  1Q95 G;  4XU3 A;  4XK8 E;  2WSF E;  2QQS A;  1GFC A;  3V7R A;  3VV0 A;  1WJR A;  3FJ5 A;  1M2V B;  2HKN A;  4DBH A;  1B34 A;  2DJZ A;  1JJ2 A;  4E47 A;  3QO3 A;  2P0P A;  4HVV A;  2BZY A;  4GY5 A;  2ESW A;  1M1K R;  2NUZ A;  3FIF A;  3CCU T;  3GBQ A;  3CCM Q;  1AZG B;  2LX9 A;  1RAB B;  1Q82 U;  3A8G B;  3M0U A;  5DY9 A;  4JRI A;  3QWX X;  3L2U A;  4PJO A;  2YUQ A;  3PFS A;  2E5K A;  2EVR A;  4J9G A;  2QGG A;  2EGE A;  2EKH A;  3QZ9 B;  4FYV B;  2EGC A;  1BB9 A;  1I5O B;  4PJL A;  1NYF A;  1YHQ Q;  4BI8 B;  1S72 Q;  9ATC B;  1IXD A;  1FWZ A;  1TS9 A;  2JS2 A;  2PUO B;  2RJE A;  3VS2 A;  2EAY A;  3AHU A;  1KQS S;  3X20 B;  5GAN 3;  3CBO A;  4PLL A;  1NEB A;  3L2Q A;  1QLY A;  1Q86 U;  2J05 A;  1OV3 A;  2RH2 A;  1LCK A;  2DNU A;  2HAX A;  3EFO B;  2QDY B;  3VU3 C;  3WVD B;  5D6W A;  4OMN A;  2LNH B;  4JJB A;  2EQK A;  1UE9 A;  4RTT A;  1WQW A;  1EIF A;  2JUF A;  2A08 A;  1YJW T;  2ROL A;  3QSU A;  2RQW A;  2KY9 A;  1IHW A;  1Y96 A;  3A8M B;  3SWN B;  4C8Q D;  1UHF A;  2VWF A;  4R56 A;  2DXU A;  5DLQ E;  4IIM A;  3CCV A;  4PJO G;  2FPF A;  1VIF A;  3JCM e;  5LJ5 d;  4RTZ A;  1K9M U;  3OS2 A;  3HRT A;  2DER A;  5FRM A;  2P4T A;  3CCR Q;  3I5R A;  4ATO A;  5ECA A;  2RJD A;  5IH2 A;  4UC4 A;  4N4I A;  1QQJ A;  2YUN A;  3EH2 A;  3MP1 A;  3MP8 A;  2AZV A;  2K2M A;  3DB4 A;  1JRI A;  1BIB A;  4C0D B;  1YI2 Q;  4NL2 A;  2YRD A;  1VQ8 Q;  1ZA1 B;  4ESR A;  1B3Q A;  2BKD N;  3JCM V;  1JXO A;  4F7U F;  4M7D E;  2QEX T;  3G6E Q;  1EX4 A;  4FYX B;  2OJ2 A;  4FSX A;  1OQK A;  1H92 A;  4KUD K;  1UGR B;  1GL5 A;  5A0G A;  1JBM A;  5GAN j;  2LVM A;  1KQ1 A;  1C0M A;  3QKJ A;  3CCQ T;  1Y57 A;  4FW2 A;  3X26 B;  3HP9 A;  2KMT A;  4M77 C;  2EYZ A;  3LW5 E;  3CCL A;  1T0H A;  5A0L A;  1NPP A;  2EKO A;  5GAN 7;  1WJQ A;  2WAC A;  1RAE B;  1N8R U;  2YRC A;  1NG2 A;  3X28 B;  2CRE A;  1SSF A;  2DL8 A;  2HDA A;  2AKL A;  1SRM A;  1VQO T;  1KC8 C;  3OYL A;  1HK9 A;  1VQM A;  4LN2 A;  5IHN A;  4HA8 A;  5CQY A;  2HQX A;  3VYG A;  3JSC A;  2KYB A;  1TUD A;  3PIO A;  2JT4 A;  3OSS C;  3MJX A;  3EFR A;  3NGP A;  2PU9 B;  1VA7 A;  4QVC A;  5KH6 A;  1WYX A;  5CK9 A;  3I56 A;  3FB9 A;  2DL3 A;  3RUX A;  4C92 F;  8ATC B;  3TRE A;  5GAN 6;  1YWP A;  1BK2 A;  1VQL A;  1X2K A;  1VQ5 Q;  5HKC A;  3E2U A;  1WLP B;  4II1 A;  1MGQ A;  1VQN Q;  4QVD A;  5GAM f;  2IPO B;  3HSB A;  4EMK C;  3CBP A;  2V8K A;  1HXD A;  2K9G A;  3CD6 Q;  5I21 A;  2Y90 A;  4IKF A;  3VS1 A;  2GQV A;  3OYF A;  4IUT A;  3OYA A;  4X34 A;  3OMC A;  3UAT A;  1X01 A;  1PC0 A;  2O9S A;  1U1S A;  1VYU A;  3CEY A;  1M1F A;  2DBM A;  2QAS A;  1R77 A;  4RTX A;  2CZ6 B;  1JXM A;  2BZ8 A;  4J9C A;  2M51 A;  1D0Z A;  4ELY C;  3OYN A;  2M1H A;  3LGL A;  1G3S A;  1PD1 A;  2YHT A;  4HXJ A;  4M7A A;  1AZE A;  3HFO A;  1ABQ A;  1QKW A;  3M59 A;  1Q86 R;  4PJM A;  1NPR A;  2SRC A;  4X9D A;  2MF2 A;  2X9H A;  4EMG A;  2RHU A;  1VQ4 A;  3A8H B;  2H3J A;  1OZ2 A;  3EG2 A;  3CPF A;  4N0A A;  1KD1 C;  5KE2 A;  1TUC A;  3MP6 A;  1VQ7 A;  1HD3 A;  3LLR A;  2EYY A;  2MK5 A;  4FIB A;  4BDY A;  2X35 A;  5I2S A;  2CZ0 B;  4JJC A;  5GAM h;  2LP5 A;  3VRZ A;  3OW2 A;  2O9V A;  3CC2 Q;  4XQ3 A;  4X9C A;  2EW3 A;  2ENM A;  2QQ9 A;  1K8A U;  5FU6 C;  1RL2 A;  2DL4 A;  4XTW A;  3G6E A;  3CPW S;  2E41 A;  2QI2 A;  4DEY A;  3P8H A;  1W6X A;  3EG0 A;  1VQO Q;  2EQI A;  3OYI A;  4ZTJ A;  3JCM J;  2FZK B;  4OB2 B;  2HSP A;  1TWB A;  3UWN A;  3PVL A;  5GAO m;  2Z0W A;  1XNI A;  3G4S Q;  4E7J A;  4MZT A;  5CKD A;  2BZX A;  2DTI A;  3RKW A;  3OB9 A;  4C8Q C;  5CKH A;  3QII A;  2LMJ A;  4XU0 A;  4FYW B;  1VOM A;  3V7C A;  2VKN A;  4LE9 A;  4C5H A;  1YJ9 A;  4LDX A;  2MYS A;  4LNP A;  4J8O A;  2C06 A;  4F14 A;  4C92 G;  1KSW A;  1IGU A;  4JLI A;  1Q7Y C;  2VGM A;  3KXT A;  4EIK A;  3CME A;  1SF9 A;  4F7U G;  1VIE A;  3F70 A;  2PZ1 A;  5GJV B;  2HBW A;  3TEE A;  5GAO q;  3JCM X;  5KYX B;  3VUB A;  3I55 Q;  2LCL A;  2X51 A;  1VQ5 A;  4M7A B;  2O4X A;  4WCI A;  4OGE A;  3Q1J A;  3CCQ A;  3SEM A;  3UA6 A;  3EG9 B;  1QVF S;  4JPB W;  1LPL A;  2OTJ T;  3EGX B;  2DIQ A;  3EFO A;  1YN8 A;  4B9X A;  5FW9 A;  3CPW P;  2DKG A;  5FU6 B;  1K8A C;  1Y71 A;  2JZ2 A;  2K5F A;  2QAZ A;  4BE2 A;  5GAN 2;  1SKU B;  3M58 A;  4M78 F;  4CC7 A;  1C6V X;  2AZS A;  4CC4 B;  1WA7 A;  4RMO A;  4C8Q A;  1NJI C;  2HKQ B;  3S3O A;  4L6V 5;  4AFU C;  2DTH A;  2L5Q A;  3G71 Q;  1N8R C;  1ZX6 A;  1I5L A;  3CCU Q;  5GAO r;  3TVT A;  2IG0 A;  2DL5 A;  4AMC A;  3M4Y A;  4J5Y A;  1PSF A;  4GBQ A;  1K73 C;  4A53 A;  2RO0 A;  1K76 A;  1VUB A;  4TVR A;  2RK2 A;  4M7A E;  4M7D D;  3QG1 A;  2A3L A;  4KBM B;  4F17 A;  5GJW B;  4M7D G;  4JLG A;  5GMK j;  3CQT A;  5FU7 B;  2X4X A;  3CCV T;  1M8V A;  3QDF A;  1RLQ C;  4KT0 E;  1OOT A;  1UFF A;  2M0Y A;  5GAN d;  3IQL A;  3H41 A;  5CKE A;  3X25 B;  1OUL A;  4XTV A;  1N9S A;  3JCM b;  1VQ7 Q;  3CCS T;  3RIR A;  3CPW A;  4PJO C;  3MET A;  4P5N A;  2XK0 A;  5GAN f;  4V2S A;  3QHS A;  4ME7 A;  2FG0 A;  1D3B B;  2DTO A;  4N4G A;  2EQJ A;  4C8Q B;  5IHI A;  4D8D A;  1MV3 A;  4Y92 A;  4ZN1 A;  3QWY A;  5D6Y A;  2YWW A;  3SB2 A;  2JXB A;  1VQ9 Q;  1T0J A;  1XJW B;  1AWO A;  3RKY A;  4M77 G;  2YT6 A;  4M77 A;  1A0N B;  3H0H A;  2EQM A;  1J3T A;  2MIO A;  3M9Q A;  5LJ3 d;  2E70 A;  1LOJ A;  1AWX A;  2KR3 A;  3T9N A;  1N27 A;  5FU7 C;  3REB B;  1OX8 A;  2LJ3 A;  4L5G A;  2BTT A;  2RA2 A;  2QG9 B;  3QYH B;  3QXE B;  4QT7 A;  4MZP A;  3WXM B;  2X4Y A;  2RD1 A;  2L3P A;  2HCK A;  3A8O B;  2A7Y A;  3ZFJ A;  2RMO A;  1IHV A;  1OPL A;  5LJ3 g;  5HK0 A;  3UDC A;  4E6R A;  4DBQ A;  1AWJ A;  1YHQ T;  3H6Z A;  2RHI A;  1KHC A;  1RUW A;  4DQ2 A;  3H9N A;  1IZ6 A;  3ULR B;  4RTY A;  3CCQ Q;  3OYC A;  2L2P A;  3VRY A;  4GLM A;  2DYB A;  1WI7 A;  1UTI A;  3PNW C;  1GCQ A;  1YIJ T;  4PNO A;  2OTL A;  2DE0 X;  3DB3 A;  2OAW A;  5FRN A;  3OS1 A;  4JRQ A;  5GAN h;  2FPE A;  4PFO A;  3OW2 P;  4JZ4 A;  2E6Z A;  4A4G A;  3CXC S;  3G71 T;  5KCO A;  1XTD A;  1AOJ A;  2JMA A;  1X27 A;  5CQX A;  1QP2 A;  2VXF A;  1IGQ A;  5A0D A;  4WF2 A;  2DVJ A;  2QXF A;  3LH5 A;  2RN8 A;  2JOY A;  2RI3 A;  1NZ9 A;  1VQK T;  3M57 A;  2Y4X A;  1M2V A;  3I9Q A;  3OYY A;  2K6D A;  1WNL A;  1WXT A;  1I8F A;  5KYN A;  3OS0 A;  2E12 A;  4J9B A;  4OVA A;  4FYY B;  4JS4 A;  2DRM A;  1QW1 A;  2RQV A;  5AYF A;  4LD9 K;  3E1S A;  2SEM A;  1TXQ A;  5GMK i;  1GBR A;  3M53 A;  4MMK A;  2CSQ A;  1M3A A;  2KRM A;  4OMP A;  1NEG A;  3L2Z A;  2M02 A;  4M75 G;  3GP8 A;  1KHI A;  2AHJ B;  2DYI A;  2COZ A;  1YI2 A;  1F1B B;  4PFP A;  4HT8 A;  2COY A;  1B34 B;  1PNJ A;  1KJW A;  4E7I A;  1Q86 C;  1WXB A;  2CGH A;  1QCN A;  5CKF A;  1VYT A;  2AKK A;  1S72 A;  4C0F A;  2D0Q B;  1GCQ C;  2HSE B;  5KYU A;  1M1K U;  3I35 A;  1MUZ A;  3EGD A;  2DAQ A;  4J9E A;  4QQD A;  1LJO A;  3ZL7 C;  3CC7 A;  1N9R A;  3SHW A;  1VQ7 T;  1GFD A;  1RAI B;  3EG9 A;  3MEU A;  4X1V A;  2W0Z A;  1M9S A;  4F7U E;  2DLP A;  1VQ4 T;  4QKU A;  3QYG B;  2ROT A;  1H3Z A;  1PSE A;  4C92 D;  3E9F A;  1QP3 A;  1KC8 R;  2GCX A;  2FVU A;  5CO7 A;  1YIT T;  1OI1 A;  2NUP B;  2LX7 A;  3QBY A;  3OYJ A;  1WJS A;  3URG A;  4EDU A;  1ZSZ B;  3CCL Q;  2ED0 A;  4OMO A;  3PMI A;  2CS7 A;  1AT1 B;  3DLL A;  4M75 A;  3QDR B;  3FJP A;  5LJ3 e;  4RTW A;  2KGT A;  1FMK A;  1HSQ A;  1I07 A;  3FLG A;  2RHX A;  2LJ0 A;  3VS6 A;  3TCJ A;  3NPF A;  5D6X A;  2OX7 A;  3I56 Q;  2DM1 A;  3OA6 A;  1R0C B;  5KYY A;  3JCM W;  1R0B G;  2LQ8 A;  1VQL Q;  3ZBD A;  4BB7 A;  2QGF B;  4M7D A;  2FZC B;  2KRN A;  2OTL Q;  2OI3 A;  1W2B A;  1VQN A;  4C92 C;  1NE8 A;  3M56 A;  4XTX A;  3WVE B;  5CAI A;  4JRP A;  4ELZ C;  3CCE Q;  1D0X A;  2L3S A;  1NM7 A;  5GMK h;  2YRV A;  2H3E B;  4OML A;  3A8L B;  1ABO A;  1M3B A;  3RNJ A;  1ZBJ A;  3RMS A;  3CD6 A;  4OP0 A;  2DIL A;  3LGF A;  2RF0 A;  1WHH A;  4LDY A;  5GAN 5;  3OYE A;  2M16 A;  1QVG A;  2E65 A;  1FMW A;  1NJI R;  5A2Q E;  2DET A;  1CKB A;  3ER0 A;  2WSC E;  3JAM E;  2HQH A;  1Z9Q A;  1IO6 A;  4PJO D;  1I81 A;  2F5K A;  3M0R A;  1YCY A;  2DMO A;  4M75 C;  5GMK m;  3PIP A;  1UJY A;  2D0N A;  2E3I A;  2KNB B;  3VS0 A;  3L2R A;  1VQM Q;  3PGG A;  1M1G A;  2KEA A;  4F7U A;  1FXX A;  2VAS A;  1BI1 A;  1AHJ B;  3NFC A;  2KYM A;  4RKU E;  4YTL A;  3TSW A;  1VQ4 Q;  2YLB A;  1QWE A;  2RQT A;  3E19 A;  3HRU A;  4AT1 B;  1UGV A;  1WFW A;  3UPU A;  1RI9 A;  3M4G A;  3RMQ A;  5GAO p;  2CUB A;  3VS3 A;  1S1N A;  2YUO A;  2KT1 A;  2FEI A;  1BI0 A;  4D8K A;  1SRL A;  3CC2 A;  2MMP A;  2KDS A;  3JRZ A;  1K73 U;  1K0X A;  1WZO A;  4C0Z A;  1SEM A;  1LNX A;  4PJO E;  1ARK A;  2K4Y A;  1KIK A;  2FB7 A;  1ZHI A;  4KUL A;  2L8D A;  2V8I A;  4HCC A;  3RR6 A;  3MEW A;  1NJI U;  2LCS A;  2OTJ A;  2M9U A;  3TQ7 P;  1VQ6 A;  3LWI A;  3C0C A;  3LX7 A;  5I2M A;  4M7A C;  4C8Q F;  1YJN Q;  3BFM A;  1QKX A;  1VQP T;  4BE1 A;  4M77 E;  1S72 T;  1DJ7 B;  2LQW A;  4C5E A;  4BD3 A;  1ZUK A;  1VQ8 T;  4JZ3 A;  1TTH B;  4FCY A;  1H8K A;  1BU1 A;  2HQE A;  5I11 A;  3CME T;  4FT4 A;  2G6F X;  5KYW B;  1Y7X A;  1V76 A;  2R58 A;  1GCP A;  3JB9 J;  3MEA A;  2QA4 T;  3VS4 A;  2B86 A;  2F2X A;  2ZGW A;  3CD6 T;  3QUI A;  3SWN C;  1K0S A;  1KK7 A;  2CT4 A;  2LT4 A;  3CCJ Q;  2RHY A;  1Q7Y U;  2DXT A;  1UHC A;  3MO8 A;  1G8X A;  2K57 A;  1MMA A;  1YJ9 T;  5J26 A;  1ZBX A;  3NHN A;  2QYZ A;  2HBP A;  2KE9 A;  4RCC A;  2EYW A;  1YBY A;  3TU4 K;  3V7S A;  1M30 A;  3BW1 A;  5GAM j;  3P8D A;  1WXU A;  1JQQ A;  2VC8 A;  2MCN A;  2RB6 A;  3H8Z A;  4DEX A;  3JCM c;  5LJ5 j;  1YJW Q;  5IN1 A;  3I55 A;  1GBQ A;  4J9H A;  3CCE A;  4NL3 A;  3J81 E;  2O31 A;  2FO0 A;  4M78 B;  4PJN A;  3G71 A;  1AVZ C;  5KYY B;  3CCU A;  1WHJ A;  4LXC A;  3CCL T;  2CZ7 B;  2MI6 A;  1CSK A;  1Q82 R;  5M9O A;  5GAN 8;  3OW2 S;  4M75 E;  3OYH A;  4Y91 A;  2EIF A;  4R0K A;  2FZG B;  3C4S A;  1VQP A;  1YIT Q;  3KFV A;  3OMG A;  2ZAE A;  3CXC P;  3VKI A;  3CXC A;  1YIJ A;  3PMT A;  2F5T X;  2PNI A;  2LC4 A;  1G83 A;  4C8Q E;  3OYG A;  2VYT A;  3OSV A;  1VQ6 T;  3GNG A;  4EMH A;  1YJ9 Q;  1D1B A;  2JVV A;  1PWT A;  1RLP C;  4K11 A;  3KUF A;  1EFN A;  1W4S A;  1WDX A;  2QQR A;  4JS5 A;  1IRE B;  3HPW A;  4NOY A;  5IHK A;  2JM8 A;  3CC2 T;  3ME9 A;  5CKB A;  4ZNX A;  5KE3 A;  3CMA T;  1Y96 B;  2JTE A;  4IIO A;  4J7I A;  3C94 A;  4R55 A;  4LD6 A;  2CP7 A;  1WHK A;  4OMF B;  1M90 C;  2A0F B;  3M5A A;  4PFZ A;  4OB3 B;  1OZ3 A;  3VS5 A;  1YWO A;  3UA7 A;  4LUE A;  3JCM h;  2LT1 A;  2MWP A;  1X6G A;  1VYV A;  4A54 A;  1UUE A;  2E6N A;  4PL6 A;  1G3W A;  4RG2 A;  2K2V A;  4L59 A;  2RQU A;  1FYN A;  2DZC A;  2DF6 A;  2G3R A;  4MDW A;  2KRO A;  3MHX A;  1WIE A;  2KK4 A;  1X69 A;  3U23 A;  3GLX A;  3EG1 A;  4E2F B;  3CCR T;  1G3T A;  4NS5 A;  1OX9 A;  1X6B A;  2A36 A;  3HHT B;  5HK3 A;  3CBM A;  1ZSZ C;  1OPK A;  2XHC A;  2K7A A;  3M54 A;  5GAN 4;  1VQL T;  1UEB A;  2I0N A;  2LQN A;  4ZGD B;  5FWB A;  6AT1 B;  3C12 A;  1Q81 U;  2K3X A;  2ZPB B;  1G3Y A;  4XU2 A;  4LUD A;  4XTY A;  1E7O A;  2F69 A;  1M2O A;  3HL8 A;  4BI4 A;  5CIU A;  3CCS A;  1TSF A;  1YNZ A;  1SHG A;  2RI5 A;  1VQK A;  2EQU A;  2EYQ A;  4F04 B;  2DXC A;  3H0F A;  4KH1 B;  2AIR B;  4PJO B;  1YP5 A;  2V26 A;  4C92 A;  1WHL A;  4HVW A;  2PUK B;  3O5Z A;  2V1R A;  2F2W A;  2GTJ A;  2R5M A;  2HNI A;  3M0Q A;  1QMC A;  2DEU A;  1N8R R;  1WHG A;  3NTK A;  1W70 A;  4BI3 A;  2E4H A;  1Q82 C;  2IVW A;  2NUT A;  2KSS A;  2CUD A;  1X43 A;  3CC4 Q;  4AFZ C;  5HCK A;  3OBW A;  4B9W A;  3BDU A;  2RJC A;  1ZUY A;  1BKB A;  2JJ9 A;  3NMZ C;  1BCO A;  1BIA A;  2KXD A;  3OQ5 A;  4F16 A;  2QTX A;  4J6X A;  4J7F A;  4Z89 A;  1RAG B;  1YIT A;  3JCM d;  3PE0 A;  2P84 A;  4OB0 B;  2DX1 A;  3JB9 D;  1M90 R;  3EGX A;  3H0I A;  3JCM P;  2EBP A;  4PJJ A;  2ZPE B;  2EJ9 A;  1H64 1;  4FSS A;  2B8A A;  3THK A;  5L23 A;  2E64 A;  2D6F A;  2EPD A;  2QEX Q;  1KG1 A;  4LDW A;  2A37 A;  3AT1 B;  4QVZ A;  3GIB A;  2DL7 A;  1OU9 A;  3S3M A;  2HL3 A;  1NYG A;  1KD1 R;  4D6W A;  2VB6 A;  3V8K A;  3SWN A;  5EC7 A;  1Y0M A;  5DLO A;  3MCA B;  4J9D A;  1W2B P;  2XKO C;  1TOV A;  1ZSG A;  2HEQ A;  1YCS B;  2DJQ A;  3MKD A;  2LCC A;  3JCM Q;  1RAH B;  3JV3 A;  1RI0 A;  4PJO F;  2ZPH B;  2C0T A;  1X6O A;  2PVD B;  5HY6 A;  1ZA2 B;  1AWW A;  4MZM A;  3L42 A;  2X3W D;  1OU8 A;  2LZ6 B;  3FDR A;  1JO8 A;  1PHT A;  2F2V A;  2GFU A;  2EFI A;  2YUP A;  2HD0 A;  4QW2 A;  2R57 A;  4A4H A;  4EPC A;  4RCB A;  4O5V A;  1M90 U;  1K9M R;  4CI0 C;  1NLO C;  4AFQ C;  5GAN g;  2P4R A;  4DA4 A;  2QK0 A;  2CH4 W;  1K1Z A;  1XOV A;  2XI9 A;  2ABL A;  2DXB A;  2RM4 A;  3BDL A;  2XDD A;  3FEO A;  2ZPF B;  3QJY A;  1RAD B;  2BIV A;  1UB4 A;  2CT3 A;  2COW A;  4DOW A;  2KI7 A;  4C92 B;  4XU1 A;  2PVG B;  1I4K 1;  1PRL C;  1K73 R;  2XG8 D;  1MMN A;  4ZGE B;  4KRT A;  4KGV B;  5KYU B;  2NYS A;  4RTU A;  5GAO n;  2A28 A;  1O9S A;  2GTO A;  5FWC A;  3CCS Q;  3M0P A;  4QQ6 A;  2DA9 A;  1OEB A;  3OBY A;  2J7I A;  2NWM A;  5CCA A;  2MWO A;  2PQW A;  4ZTF A;  1N5Z A;  2NUP A;  2CSI A;  2W10 A;  4OMQ A;  1AD5 A;  3REA B;  5L8R E;  1IB8 A;  3EH1 A;  1U5S A;  2CP3 A;  1YHQ A;  1SSH A;  1X2Q A;  1PD0 A;  4C5G A;  4DBF A;  3CC7 Q;  4M77 D;  2JTM A;  1D0Y A;  4Z88 A;  2XDB A;  4IUP A;  2DFU A;  1U06 A;  2KXC A;  1OYX A;  3E9G A;  2DK3 A;  2L3Q A;  3EGD B;  4N0A C;  3V8J A;  3CMA Q;  2JM9 A;  1QVF A;  5DM7 R;  3D7S B;  3PTA A;  4M7A D;  3L2W A;  3C95 A;  3CCE T;  3I55 T;  2QQA A;  1IRX A;  3SD4 A;  3VJP A;  3A5Z B;  2LRQ A;  4FU6 A;  2EYX A;  2PTK A;  3GOX A;  3BY7 A;  3CCM A;  4M75 F;  4E7K A;  3G1J A;  2JN0 A;  3EFS A;  2WSE E;  2I2L A;  2KT8 A;  3G4S T;  2YDL A;  2FRW A;  2M0O A;  1PCX A;  2CDT A;  2GFA A;  1D09 B;  4C8Q G;  4O6J A;  4LDU A;  4HCB A;  2JS0 A;  5J39 A;  3PVQ A;  2DD5 A;  3RDV A;  2YLC A;  4Y28 E;  3NTI A;  1WHM A;  2PVO B;  2ZPI B;  4M77 B;  5LJ5 h;  3OYB A;  2NUT B;  1W1F A;  1TUG B;  2D1X A;  1VQ8 A;  3R6N A;  1JB0 E;  3O8V A;  3V8L A;  2K3B A;  1M1K C;  3HKS A;  2VGN A;  1M4Z A;  5GMK e;  1JEG A;  1QVF P;  3G6E T;  3RER A;  2DD4 A;  4ZN3 A;  4LDV A;  2RJF A;  2D9T A;  1JJ2 S;  3OYK A;  3LWH A;  2RPN A;  2CYZ B;  4M7D F;  3J80 E;  2GF7 A;  2YXY A;  4FW1 A;  1TH7 A;  2ATC B;  1BYM A;  3GNF B;  7AT1 B;  4QQG A;  1T3L A;  2DZ9 A;  2FHD A;  2L3R A;  1K8A R;  2K5I A;  4A4F A;  4M7A F;  2QQB A;  5CR2 A;  2MPX C;  5GMK l;  4JUV A;  3J7A F;  4AG2 C;  4MDX A;  2K5L A;  3CCV Q;  4M78 E;  3JB9 I;  4EMK A;  1UJ0 A;  4FT2 A;  1B07 A;  2F1L A;  4IUQ A;  1ZLM A;  3ZEH A;  1PKS A;  3EGU A;  1I1J A;  5LL6 S;  4M7D B;  1ACM B;  4A4K A;  1VQ5 T;  1P92 A;  3RBB B;  3UF4 A;  5GAO l;  1PRM C;  3HFN A;  1KC8 U;  3SDZ A;  4IUV A;  3CCJ T;  1YJW A;  3BE3 A;  2VXE A;  3EHR A;  2KAF A;  4HT9 A;  4C0G A;  4KUI A;  5GAN e;  4ANJ A;  2L0A A;  4C92 E;  3M0S A;  5CVI A;  1PG5 B;  3EAE A;  4BY6 C;  1G5V A;  1AEY A; 
#chains in the Genus database with same CATH homology
 4A54 A;  5LJ3 g;  2E6N A;  5HK0 A;  3UDC A;  1YJW T;  4PL6 A;  3MEV A;  4M77 F;  1G3W A;  3QSU A;  2LNV A;  4RG2 A;  2K2V A;  1YHQ T;  2KY9 A;  3H6Z A;  1Y96 A;  3A8M B;  4L59 A;  3SWN B;  3L2V A;  4M78 D;  3UT1 A;  4C8Q D;  2RHI A;  4R56 A;  1KHC A;  2DZC A;  2G3R A;  1YJN T;  2DXU A;  5DLQ E;  3FRN A;  4DQ2 A;  3CCV A;  4PJO G;  5EG2 A;  3JCM e;  1VIF A;  4MDW A;  1YJN A;  1IZ6 A;  3MHX A;  5LJ5 d;  2KK4 A;  3GLX A;  1K9M U;  3OS2 A;  3CCM T;  3HRT A;  3OYC A;  1VQM T;  3CCR T;  5FRM A;  1KQS A;  1G3T A;  5LJ3 j;  4NS5 A;  2P4T A;  1MHN A;  3PNW C;  4ATO A;  1YIJ T;  2CKK A;  2RJD A;  3HHT B;  4PNO A;  2QA4 A;  5HK3 A;  4UC4 A;  4N4I A;  2OTL A;  3CBM A;  2RI2 A;  3DB3 A;  3MP1 A;  3MP8 A;  1Q81 C;  5FRN A;  2XHC A;  3DLM A;  3OS1 A;  3M54 A;  4JRQ A;  5GAN 4;  5GAN h;  1VQL T;  4Z02 A;  3DB4 A;  3KBG A;  1UEB A;  2E6Z A;  4A4G A;  1JRI A;  1BIB A;  4C0D B;  4ZGD B;  3CXC S;  2MAM A;  4NL2 A;  3G71 T;  5KCO A;  1XTD A;  3CCJ A;  5GAM e;  3C12 A;  1Q81 U;  5GAM g;  2K3X A;  5CQX A;  1QP2 A;  2VXF A;  3JB9 H;  2BKD N;  2ZPB B;  3GF5 A;  3JCM V;  1G3Y A;  4XU2 A;  4F7U B;  4F7U F;  5A0D A;  4M7D E;  2QEX T;  4J6W A;  4WF2 A;  2QXF A;  4XTY A;  4BY6 B;  2F69 A;  2JOY A;  2RI3 A;  1NZ9 A;  2Y4Y A;  3HL8 A;  4VUB A;  4FSX A;  1VQK T;  2DVE A;  3M57 A;  4KUD K;  4BI4 A;  1K9M C;  2Y4X A;  1UGR B;  2DPP B;  4RG8 A;  3JCM f;  1JBM A;  5CIU A;  3OYY A;  5A0G A;  3CCS A;  1WNL A;  4E7H A;  1I8F A;  3JB9 F;  5GAN j;  2RI5 A;  4M7A G;  2LVM A;  1KQ1 A;  2EQU A;  4EMK B;  1VQK A;  3OS0 A;  2EYQ A;  3QKJ A;  2E12 A;  2DXC A;  4OVA A;  3CCQ T;  5LJ5 f;  4PJO B;  4BDZ A;  3X26 B;  2X4W A;  4JS4 A;  4C92 A;  3HP9 A;  2KMT A;  4M77 C;  3S3N A;  2PUK B;  1QW1 A;  5AYF A;  2R5A A;  3GPL A;  3E1S A;  4LD9 K;  3LW5 E;  3CCL A;  5GMK i;  2R5M A;  3M53 A;  2HNI A;  4ZGJ B;  5A0L A;  1NPP A;  4MMK A;  2EKO A;  5GAN 7;  5GAM d;  1WJQ A;  2WAC A;  1N8R U;  3X28 B;  3OYD A;  3NTK A;  2XIC A;  3L2Z A;  1O75 A;  4BI3 A;  4M75 G;  3GP8 A;  1KHI A;  2AHJ B;  1Q82 C;  2ZZD A;  2IVW A;  2LTO A;  1SSF A;  2KSS A;  5LJ5 g;  1D3B A;  1YI2 A;  4HT8 A;  2LQK A;  4M75 D;  1B34 B;  1VQO T;  3CC7 T;  4XTZ A;  4E7I A;  3OBW A;  1Q86 C;  1KC8 C;  2FL7 A;  3OYL A;  4JJN K;  1HK9 A;  2CGH A;  4B9W A;  4C5I A;  5CKF A;  1VQM A;  2EJF A;  2OAU A;  3BDU A;  1VQ8 A;  2RJC A;  1UGQ B;  1S72 A;  1BKB A;  4C0F A;  2E1H A;  2D0Q B;  1U8R A;  3LH0 A;  4HA8 A;  5CQY A;  1M1K U;  2HQX A;  1BIA A;  3VYG A;  3OQ5 A;  3JSC A;  1U1T A;  2QTX A;  4J6X A;  4J7F A;  3PIO A;  4C8Q G;  1YIT A;  4BUG A;  3JCM d;  3OSS C;  3L1A A;  3EFR A;  5IT9 E;  2DAQ A;  1Y07 A;  4OB0 B;  4QQD A;  4HKE A;  2PU9 B;  1BI3 A;  4QVC A;  1LJO A;  2EWN A;  5KH6 A;  5CK9 A;  3QPH A;  3I56 A;  3JB9 D;  3FB9 A;  3RUX A;  4C92 F;  3CC7 A;  1N9R A;  3PT9 A;  3TRE A;  5GAN 6;  1VQ7 T;  3JCM P;  5J3B A;  1VQL A;  2ZPE B;  2EJ9 A;  1H64 1;  2B8A A;  5HKC A;  4Q5W A;  3MEU A;  4A4E A;  2E64 A;  2D6F A;  4II1 A;  1MGQ A;  1M9S A;  1KG1 A;  2P0K A;  4F7U E;  4LDW A;  4OGC A;  4QVD A;  5GAM f;  1VQ4 T;  5C6S A;  3QYG B;  4QVZ A;  3RES A;  4EMK C;  3CBP A;  3GIB A;  3HSB A;  3S3O A;  3OS5 A;  1KQ2 A;  2V8K A;  2ZCF B;  3S3M A;  1HXD A;  4J83 A;  1H3Z A;  1PSE A;  3I56 T;  4D6W A;  4C92 D;  3E9F A;  1QP3 A;  3V8K A;  3SWN A;  4J6Y A;  2GCX A;  2FVU A;  5CO7 A;  1YIT T;  5DLO A;  5I21 A;  1OI1 A;  3MCA B;  2Y90 A;  3JCM g;  3QBY A;  2XKO C;  4PLI A;  3OYJ A;  1WJS A;  3G4S A;  3URG A;  4IKF A;  2DEQ A;  1WPY A;  4EDU A;  2GQV A;  3OYF A;  4IUT A;  4OF1 A;  3OYA A;  1WGS A;  2LCC A;  3JCM Q;  3PMI A;  4X34 A;  2CS7 A;  3OMC A;  3DLL A;  4BE0 A;  4M75 A;  1X01 A;  4PJO F;  1RI0 A;  2ZPH B;  3QJ6 A;  1U1S A;  3CEY A;  1VQO A;  1M1F A;  2FYK A;  1X6O A;  2PVD B;  3INZ A;  3QDR B;  3FJP A;  5HY6 A;  4C0D C;  5LJ3 e;  3P8B B;  2CZ6 B;  4MZM A;  3L42 A;  1VQN T;  3OYN A;  3FDR A;  5FLX E;  2M1H A;  1QVP A;  4ELY C;  3FLG A;  3LGL A;  2RHX A;  5KCH A;  1G3S A;  2YHT A;  3TCJ A;  4M7A A;  2GFU A;  3HFO A;  3M59 A;  2EFI A;  5D6X A;  2HD0 A;  1NPR A;  3OA6 A;  4QW2 A;  3CC4 T;  2EJG A;  2R57 A;  4X9D A;  3JCM W;  2MF2 A;  4JRK A;  4EMG A;  2RHU A;  2LQ8 A;  1VQ4 A;  4A4H A;  4EPC A;  3A8H B;  2H3J A;  4RCB A;  3VUZ A;  3ZBD A;  1OZ2 A;  3CPF A;  4O5V A;  4N0A A;  3VYH B;  1FX7 A;  4BB7 A;  1M90 U;  4MML A;  4CI0 C;  4M7D A;  2LDM A;  2O01 E;  1W2B A;  1VQN A;  2DIG A;  1KD1 C;  5KE2 A;  5GAN g;  4DA4 A;  4C92 C;  1XOV A;  3MP6 A;  4HCZ A;  1NE8 A;  4PKC C;  1VQ7 A;  2XI9 A;  2DXB A;  2RM4 A;  3M56 A;  4XTX A;  3LLR A;  3WVE B;  3BDL A;  2XDD A;  3FEO A;  2ZPF B;  4FIB A;  5CAI A;  4BDY A;  2X35 A;  5I2S A;  2CZ0 B;  3QJY A;  4N4H A;  4JRP A;  5GAM h;  4BAC A;  3DKM A;  3OW2 A;  4ELZ C;  3FC3 A;  1M5Q 1;  4XQ3 A;  4X9C A;  3N5B B;  2BIV A;  2BUD A;  2QQ9 A;  1K8A U;  1UB4 A;  5FU6 C;  2QEX A;  4DOW A;  5GMK h;  2YRV A;  1RL2 A;  5IAY A;  4C92 B;  4XU1 A;  4XTW A;  3A8L B;  2PVG B;  3G6E A;  3CPW S;  1I4K 1;  2XG8 D;  4ZGE B;  2E41 A;  3RKX A;  2V8J A;  2QI2 A;  3P8H A;  2E5Q A;  5GAO n;  3S6W A;  4ZTJ A;  1O9S A;  3OYI A;  3RMS A;  2XD0 A;  4LDY A;  3LGF A;  4OP0 A;  4QQ6 A;  4OB2 B;  3JCM J;  3CD6 A;  5GAN 5;  3OBY A;  3OYE A;  4E7L A;  2M16 A;  3UWN A;  1QVG A;  2E65 A;  4CRI A;  5GAO m;  5A2Q E;  1VQ9 T;  1UGS B;  3ER0 A;  1XNI A;  2ZPG B;  2WSC E;  4E7J A;  4MZT A;  5CKD A;  2DTI A;  3RKW A;  3JAM E;  5CCA A;  2MWO A;  3OB9 A;  2PQW A;  4M78 C;  4C8Q C;  4PJO D;  1I81 A;  2F5K A;  4ZTF A;  1W2B S;  1QVG S;  3CC4 A;  5CKH A;  1YCY A;  4M75 C;  5GMK m;  3PIP A;  3QII A;  4IUR A;  3L2R A;  4HCC A;  2NLU A;  3PGG A;  3JB9 G;  1M1G A;  4XU0 A;  4F7U A;  1FXX A;  4XTU A;  1BI1 A;  3X24 B;  3V7C A;  5L8R E;  3LYI A;  4C5H A;  1YJ9 A;  4LDX A;  1AHJ B;  1YHQ A;  3NFC A;  4M7D C;  4RKU E;  4YTL A;  4C5G A;  2O4X B;  2YLB A;  4M77 D;  3E19 A;  3HRU A;  2JTM A;  1YI2 T;  4J8O A;  3UPU A;  4GLK A;  2C06 A;  3M4G A;  3RMQ A;  2XDB A;  2VV5 A;  4C92 G;  5GAO p;  4IUP A;  4JLI A;  1Q7Y C;  2VGM A;  2RK1 A;  3KXT A;  1OYX A;  3E9G A;  3CME A;  2DK3 A;  5FRO A;  4F7U G;  1BI0 A;  3OY9 A;  5LJ3 h;  1VIE A;  4N0A C;  3V8J A;  3F70 A;  3CC2 A;  2MMP A;  2KDS A;  3JRZ A;  3M55 A;  1K73 U;  3TEE A;  1QVF A;  5GAO q;  4C0Z A;  3JCM X;  1LNX A;  4JDS A;  3VUB A;  2K4Y A;  4PJO E;  2FB7 A;  1ZHI A;  2LCL A;  5DM7 R;  3PTA A;  2OTJ A;  4KUL A;  3L2W A;  3C95 A;  4M7A D;  2L8D A;  1VQ5 A;  4M7A B;  2O4X A;  2V8I A;  3HRS A;  4FM4 B;  4OGE A;  3Q1J A;  3CCE T;  2RHZ A;  2L89 A;  2QQA A;  3MEW A;  3SD4 A;  3VJP A;  3I55 T;  3CCQ A;  3A5Z B;  1NJI U;  2CZ1 B;  2LRQ A;  1QVF S;  4FU6 A;  4XAX B;  2OTJ T;  2DIQ A;  4M75 B;  3CCR A;  3GOX A;  3BY7 A;  2M9U A;  4B9X A;  4M75 F;  4DOV A;  3CCM A;  2DKG A;  2JN0 A;  4E7K A;  5FU6 B;  3EFS A;  2WSE E;  1VQ6 A;  2P0Q A;  3LWI A;  5C0M A;  2I2L A;  1Y71 A;  3OYM A;  1N6A A;  2JZ2 A;  1K8A C;  1BI2 A;  2K5F A;  3G4S T;  3LX7 A;  2XID A;  3ASK A;  5I2M A;  5GAN 2;  4BE2 A;  4M7A C;  3M58 A;  2XDP A;  3R6O A;  3BFM A;  4M78 F;  4C8Q F;  1VQP T;  4BE1 A;  1V29 B;  4M77 E;  1KD1 U;  2M0O A;  3QZ5 B;  1S72 T;  1DJ7 B;  4RMO A;  4C5E A;  2GFA A;  3NTH A;  1GXI E;  4M78 A;  4C8Q A;  1NJI C;  4M78 G;  4O6J A;  2E10 A;  4L6V 5;  2DTH A;  2KQW A;  2L5Q A;  3G7Z A;  4LDU A;  4BD3 A;  5J39 A;  4HCB A;  1VQ8 T;  1N8R C;  1I5L A;  2JNG A;  2HQE A;  5GAO r;  2IG0 A;  3CME T;  2DD5 A;  4FT4 A;  3M4Y A;  2YLC A;  4J5Y A;  1PSF A;  1Y7X A;  1K73 C;  1VQ9 A;  4A53 A;  2R58 A;  4Y28 E;  2RO0 A;  2PVO B;  2ZPI B;  3NTI A;  4M77 B;  1XQH A;  3MEA A;  5LJ5 h;  3OYB A;  2QA4 T;  3JB9 J;  2OTL T;  1VUB A;  4TVR A;  2KVQ G;  2ZGW A;  3CD6 T;  1WQ7 A;  1X75 C;  2DO3 A;  3QUI A;  3SFM A;  2RK2 A;  3SWN C;  1JB0 E;  3O8V A;  3V8L A;  3CMA A;  1M1K C;  2LT4 A;  4M7D D;  4M7A E;  2RHY A;  3QG1 A;  2DXT A;  1Q7Y U;  2VUB A;  3HKS A;  3MO8 A;  2VGN A;  1M4Z A;  2K57 A;  2A3L A;  5GMK e;  1YJ9 T;  5J26 A;  1ZBX A;  2HBP A;  5LJ3 f;  4KBM B;  3G6E T;  3RER A;  4RCC A;  1UGP B;  1YBY A;  4OB1 B;  4M7D G;  4JLG A;  4FL6 A;  3V7S A;  5GMK j;  2DD4 A;  5FU7 B;  2X4X A;  3CCV T;  3TU4 K;  1M8V A;  1R8O B;  1ZQ1 A;  2JTF A;  3BW1 A;  4KT0 E;  2XU8 A;  5GAM j;  4ZN3 A;  4LDV A;  3P8D A;  2RJF A;  2X4J A;  5GAN d;  2D9T A;  2K3Y A;  5CKE A;  3X25 B;  2VC8 A;  4IUU A;  1JJ2 S;  4XU3 A;  2RB6 A;  4XTV A;  3OYK A;  1N9S A;  3JCM b;  3LWH A;  3H8Z A;  4XK8 E;  3CCS T;  3RIR A;  3JCM c;  3CPW A;  2WSF E;  5LJ5 j;  4PJO C;  2QQS A;  3MET A;  2CYZ B;  4M7D F;  3V7R A;  3VV0 A;  1WJR A;  5IN1 A;  3J80 E;  2GF7 A;  3I55 A;  4P5N A;  2XK0 A;  5GAN f;  3CCE A;  1B34 A;  2DJZ A;  4V2S A;  4NL3 A;  3J81 E;  4E47 A;  3QHS A;  3QO3 A;  2P0P A;  1JJ2 A;  4ME7 A;  1TH7 A;  1D3B B;  1BYM A;  3GNF B;  2DTO A;  4N4G A;  4GY5 A;  2EQJ A;  4M78 B;  4C8Q B;  4QQG A;  3G71 A;  3FIF A;  2DZ9 A;  2FHD A;  3CCU T;  2L3R A;  2LX9 A;  3CCU A;  2K5I A;  4A4F A;  3CCL T;  4ZN1 A;  2CZ7 B;  2MI6 A;  3A8G B;  2QQB A;  5CR2 A;  1Q82 U;  4M7A F;  5D6Y A;  5M9O A;  3SB2 A;  5GAN 8;  4M75 E;  5DY9 A;  3OYH A;  4Y91 A;  5GMK l;  2EIF A;  3OW2 S;  4JRI A;  3C4S A;  4JUV A;  1VQP A;  3J7A F;  3RKY A;  3OMG A;  4MDX A;  4M77 G;  2K5L A;  3VKI A;  3L2U A;  4M77 A;  3CXC A;  4PJO A;  3PFS A;  1YIJ A;  3PMT A;  2F5T X;  3OYG A;  2EQM A;  2LC4 A;  4M78 E;  4C8Q E;  4EMK A;  2VYT A;  3OSV A;  3QZ9 B;  3JB9 I;  3GNG A;  1VQ6 T;  4FT2 A;  4EMH A;  3M9Q A;  5LJ3 d;  4BI8 B;  4IUQ A;  2E70 A;  1LOJ A;  2JVV A;  3ZEH A;  1FWZ A;  3KUF A;  1W4S A;  2PUO B;  5LL6 S;  4M7D B;  4A4K A;  2RJE A;  3T9N A;  1N27 A;  2QQR A;  5FU7 C;  4JS5 A;  1P92 A;  2EAY A;  1VQ5 T;  5GAO l;  5LJ5 e;  3AHU A;  1IRE B;  1KQS S;  3X20 B;  5GAN 3;  3CBO A;  3HPW A;  3HFN A;  4L5G A;  4PLL A;  3L2Q A;  3SDZ A;  4NOY A;  4IUV A;  1Q86 U;  1KC8 U;  3CCJ T;  2RA2 A;  2RH2 A;  3CC2 T;  3ME9 A;  5CKB A;  5KE3 A;  1YJW A;  3CMA T;  3QYH B;  1Y96 B;  2HAX A;  3QXE B;  4MZP A;  2VXE A;  3WXM B;  2X4Y A;  2RD1 A;  2QDY B;  3C94 A;  4J7I A;  4R55 A;  4LD6 A;  2KAF A;  4HT9 A;  3VU3 C;  4OMF B;  1M90 C;  4C0G A;  3WVD B;  5D6W A;  3M5A A;  2EQK A;  3A8O B;  4KUI A;  4OB3 B;  5GAN e;  1OZ3 A;  2A7Y A;  3ZFJ A;  3JCM h;  2LT1 A;  4C92 E;  1WQW A;  2MWP A;  5CVI A;  1G5V A;  3EAE A;  4BY6 C;  1EIF A;  2JUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...