3OA6A

Human msl3 chromodomain bound to dna and h4k20me1 peptide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
FKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDENRRLQRKLARKAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Male-specific lethal 3 homolog
total genus 19
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oa6A01
3LH0A 3OS2A 3OYCA 4LD6A 2FHDA 5IAYA 3O8VA 4N4HA 3LX7A 3QIIA 3QJ6A 3OYEA 3OYDA 3EAEA 2O4XB 2G3RA 4RG2A 5KE3A 1WGSA 4E7IA 4OVAA 2RJDA 2K3YA 4ZTJA 2JTFA 4C5EA 5KH6A 3BDLA 4FU6A 3LYIA 3ZEHA 3OYHA 5CIUA 4IURA 3LGFA 1MHNA 3CEYA 4II1A 4B9XA 2BKDN 2RJFA 3OYBA 2RHXA 3DB3A 3OYJA 2BUDA 4A4EA 2MWPA 3OMCA 2K3XA 2L89A 2LRQA 2RHIA 3QBYA 4CRIA 4IUTA 3L2QA 2GFUA 1RI0A 1OYXA 2E6NA 3OS0A 3OYIA 4BE1A 1OZ2A 2DAQA 2E5QA 2LCCA 3H8ZA 3OYLA 5FRNA 2L8DA 5D6YA 4A4GA 2EKOA 4X34A 2O4XA 2BIVA 4N4GA 4C5GA 2XK0A 3OYGA 2RHZA 2DIGA 3MP8A 1OI1A 3OYAA 2QQSA 2LVMA 4NS5A 4QW2A 2DIQA 4IKFA 3H6ZA 4E7JA 5M9OA 3FDRA 3PFSA 4Z02A 3ASKA 4EDUA 3Q1JA 4QQ6A 1OZ3A 3MEVA 3DB4A 2M1HA 2X4XA 3MO8A 4IUUA 2X4YA 3OYKA 4E7LA 2R57A 4N4IA 3OYMA 2EQUA 3KUFA 4L59A 3SD4A 2RJCA 4QVZA 4IUVA 4FL6A 1WJQA 2HQXA 4C5HA 3FC3A 4ZTFA 4QQDA 3OS1A 2CKKA 3OY9A 3L2RA 2GFAA 2PQWA 1G5VA 5J39A 4HCZA 3LLRA 5IN1A 5FROA 3FEOA 3OYNA 2MWOA 2P0KA 4BDZA 2EQJA 3MEWA 3MP6A 2RJEA 3PMIA 2R58A 3GOXA 4GY5A 3L2VA 2R5MA 2RO0A 2GF7A 3DLMA 3OQ5A 5D6WA 4E7KA 4A4FA 3E9FA 3S3NA 2HQEA 2YRVA 2EQMA 3S3OA 2QQRA 3MP1A 5C0MA 3F70A 3P8HA 3P8DA 3FLGA 2RHUA 3OMGA 5D6XA 4PLIA 1XNIA 3NTIA 3PNWC 3OB9A 4UC4A 1WJRA 3MEUA 4QQGA 3NTHA 4BE2A 4BD3A 3OA6A 3UT1A 3M9QA 2L3RA 2B8AA 5KCOA 1H3ZA 3META 2RI3A 4BE0A 4A4HA 3L2WA 2IG0A 5KCHA 3S6WA 2F5KA 4C5IA 4PLLA 5FRMA 2NLUA 2EQKA 2LTOA 3E9GA 2X35A 3ME9A 3PMTA 4IUPA 2M0OA 3QKJA 2X4WA 4E7HA 2XDPA 2D9TA 2M16A 2RHYA 3C4SA 3S3MA 3L42A 2RI5A 2VYTA 3LGLA 5KE2A 2LDMA 2WACA 3NTKA 3UWNA 4PL6A 2R5AA 2RI2A 4IUQA 1SSFA 3L2UA 1N27A 3OYFA 2JZ2A 3MEAA 4B9WA 4BACA 2EFIA 4BDYA 5C6SA 1KHCA 5J26A 1WJSA 4Q5WA
chains in the Genus database with same CATH superfamily
2VC8A 3M53A 2E4HA 2HCKA 4N4HA 4QVDA 5KYUB 2JMCA 2L0AA 3EAEA 5KE3A 2CP3A 1D3BA 1RAGB 5FWBA 4OMNA 1PD0A 2HNIA 2OAUA 1YITT 4KULA 2O2OA 2Z0WA 2XU8A 2HBPA 4BY6B 2OTJT 1UB4A 2FEIA 3OW2S 3G71T 3TSZA 1KG1A 1GCPA 1YJWA 4E7JA 3GP8A 1G3WA 4DBFA 1Q7YR 5GAN5 3CXCP 1M5Q1 4RCCA 3BE3A 3CMAT 3QYHB 5GAOl 1A0NB 1Q95G 5LJ5f 3OY9A 3M5AA 5LJ3d 1M90U 4DBHA 2ZAEA 3CCEQ 2C0OA 2CDTA 1Y57A 2RJEA 3OQ5A 3S3NA 2E3IA 1WQWA 3QXEB 3JCMP 2QQRA 2CZ0B 5C0MA 4CC7A 1I5OB 2JJ9A 1XNIA 1V76A 3VS4A 1FYNA 3OB9A 4F7UB 2A36A 4C92D 4XU0A 2CT4A 1BCMA 4DOWA 2BTTA 1NLOC 3CMET 4M7AG 1X75C 1ZSZB 2KGTA 2NWMA 2QQBA 2VYTA 4PKCC 2LDMA 1GBQA 4M75C 3UF4A 1W1FA 1BI3A 3CPWP 1YJNQ 4OMQA 3VYHB 1VIFA 1I0CA 4HVUA 2G6FX 3EG9A 1JEGA 2NUZA 2HKNA 1RLPC 4HCCA 4OB3B 3G4SQ 4ZTJA 3SEMA 2DERA 4JJNK 4KGVB 1PM3A 1Q82C 1PNJA 5CQXA 1ZX6A 4M7AB 4J7FA 4CRIA 1S72Q 2VV5A 1D1BA 1SHGA 4HT9A 2A37A 2XICA 2RD1A 2L8DA 5CKFA 2RQVA 4E7ZA 1X6OA 4LDYA 4DBQA 4C5GA 3G6EA 1H3HA 5KYUA 2GGRA 5A0DA 1S72A 1UTIA 4M7DD 2J6FA 4OGCA 2H3EB 3OW2A 3ASKA 1SKUB 2X4YA 3CCRT 5I2MA 1NPRA 1V1CA 2E1HA 4L59A 2HQXA 2HAXA 5L23A 5EG2A 2XMFA 1X2QA 4JZ4A 1ARKA 2DZCA 3MP6A 4EMGA 2EGAA 1VQOA 4BI3A 2OX7A 3M0RA 2DMOA 1GBRA 2YRVA 5FU7B 3S3OA 3MP1A 1B3QA 2M02A 4M75D 1EZZB 2JS0A 5LJ3f 4KUIA 2B8AA 1RACB 1NZ9A 2HSEB 3EFRA 5DM7R 1WXBA 2NLUA 4J9FA 2KAFA 4DEYA 3VJPA 4XU2A 4LE9A 2LMJA 4GBQA 2M16A 1UUEA 3NPFA 2LT4A 3CD6Q 5KE2A 1KJWA 1N9RA 3UPUA 1ZUKA 1IHWA 5I22A 1UECA 1N8RC 1M8VA 5IHNA 2OTJA 4LDVA 4BDYA 1KC8U 2SEMA 5IAYA 3M58A 2PVDB 3RKYA 3MPUB 1YJWT 2E10A 2BE9B 4HA8A 1PC0A 2OJ2A 3RMSA 4OVAA 3CBMA 1I5LA 1Q86C 4JRQA 4RG8A 4GLMA 1Q7YC 4LDXA 4R0KA 1XTDA 1KQSA 1K8AU 3TVTA 2CSQA 1OPLA 1KD1U 1Y71A 3RESA 2LT1A 1JO8A 5FU6C 2BZYA 3J7AF 2K5FA 5IXFA 1OOTA 1BI1A 5IH2A 2DPPB 5FRNA 3AT1B 4EPCA 2BIVA 4M7AF 3EH1A 3CC4A 1RAFB 2DIGA 5KYNA 4NS5A 3QDRB 2GNCA 1VQNA 1VQ5A 4M7DE 4EMKC 4E7LA 3LW5E 1AT1B 1C6VX 1Z9ZA 4M77F 3EG1A 1YHQQ 1X01A 2GFAA 1VQ5Q 2RNAA 2ROTA 3M4GA 2RQRA 2H8HA 2R58A 1QWEA 1O75A 2CH4A 2RHUA 2EW3A 5FU7C 2A0FB 4NL2A 2DK3A 2DF6A 4UC4A 4JRIA 2QEXT 3NGPA 2AT1B 4HT8A 2RI3A 3WVDB 1D09B 3FIFA 3QYGB 1Y96A 4IIMA 4JRKA 2LTOA 2X35A 2CP5A 3GPLA 2M0OA 4C92F 2EYQA 2FYKA 2K5IA 4LNPA 4A54A 1M4ZA 4J6XA 3C4SA 5CKDA 3RMQA 1PCXA 4M78G 3VYGA 3L42A 2GTOA 5LJ3h 2D8HA 2YDLA 4D8KA 1ZHIA 2KYMA 3ULRB 4ZNXA 2JZ2A 3EG9B 1QP2A 1AWXA 3R6OA 3OYCA 1QLYA 1SG5A 1GCQC 3PVLA 4J5YA 3OYEA 4D6WA 4J9IA 2LQKA 3JB9J 1PSEA 2W0ZA 1ZSZA 3ZEHA 2QK0A 4XAXB 1YJNT 1TU0B 1C1AA 4II1A 1C0MA 2ZPFB 2L89A 2RHIA 3A8OB 5GMKl 5HCKA 2O88A 1SSHA 1T3SA 2GFUA 1D0XA 2ZPIB 2OTLA 2F5TX 1KQSS 4IIOA 4OB0B 1QKXA 1NEBA 2EKOA 3J81E 3BW1A 1N5ZA 2QA4Q 4RTWA 3CCSQ 4OMOA 5IXBA 1M1KU 2J6OA 2VB6A 2QTVA 4C8QE 2OTLQ 4RTUA 2LX9A 3CC2Q 2DTHA 1M1FA 2DKGA 4MZTA 3EGXA 8AT1B 3X24B 2PNIA 2MI6A 3U23A 3L2RA 1E6GA 2CZ1B 1Q81R 1G5VA 1QQJA 1EIFA 2DL8A 5IN1A 1KSWA 2YUNA 1YWPA 4MDWA 1KIKA 4E7KA 3M4YA 4FSSA 3OSSC 5GAMg 1YJWQ 1YNZA 1VQ9A 3I35A 2PZ1A 3FLGA 4ANJA 3X26B 1YCSB 2DXTA 4F7UG 1H8KA 3NTHA 5GAOm 5I21A 2COWA 1OEBA 2HQHA 4FYXB 3X28B 2QASA 1QCOA 1Q82U 1ZLMA 1OX8A 4C92B 5ECAA 2Y4XA 4L5GA 1I81A 3CCQT 1J3TA 2CP0A 4HCKA 1HYOA 4Z89A 2EWNA 4BY6C 4XTVA 3HSBA 4C8QA 3CCUA 2G3RA 5HY6A 1B34B 3OBYA 2ESWA 3V7RA 1R0CB 5GAN3 4PJOC 2CGHA 2NYSA 1YJ9T 4MMKA 3EHRA 2KNBB 5FU6B 4F16A 4HCBA 5KYXA 2DNUA 3TU4K 2EYWA 1MMDA 3QHSA 3C95A 4LDUA 2ATCB 1VQPA 3OYGA 3FJPA 2P4TA 2JW4A 2EGCA 2HL5C 3CXCS 1FXXA 2K79A 2AIRB 4EDUA 3PT9A 1OULA 5GAMj 2QEXA 1YJNA 3OW2P 1WJQA 1B34A 4XTYA 4F17A 5FROA 3HFNA 5CCAA 3I56A 2EPDA 3MEWA 4JPBW 2MYSA 4C0FA 1M1KR 2X9HA 3EHQA 1KHIA 1Y0MA 3F70A 3P8DA 4A63B 5GANe 1WYXA 1VQNT 2IVWA 1Y7XA 3E1SA 1PG5B 2KR3A 1NYGA 2C0IA 3META 3L2WA 3QZ5B 1MMAA 2QXFA 1E6HA 5FRMA 2EQKA 2YLCA 2FZKB 1JXOA 2X51A 3O5ZA 3OSVA 1CSKA 5GJVB 2RI2A 3QO3A 2DEQA 1TSFA 2FPDA 1ZQ1A 1YIJQ 2RB6A 3EG2A 4BB7A 3VS1A 1KHCA 3L2VA 4M7DC 1PSFA 1W70A 1UJYA 2O01E 3LH5A 4Z88A 1RAHB 5J3BA 1JU5C 3I5RA 4Y91A 1K9AA 2K2MA 3VUBA 5IHIA 2A28A 2CSIA 5KH6A 2FRYA 5A2QE 3VRYA 3VS3A 5LJ5e 4J9BA 3QBYA 1AD5A 1UGSB 1VIEA 2DL7A 1RAEB 2B86A 2DRMA 4HKEA 1BU1A 2O4XA 4WTOB 3V7SA 4J7IA 5FLXE 2CT3A 2M9UA 3BY7A 4J9GA 2VXFA 2DEUA 3RERA 2BZXA 3JCMg 4QKUA 1KK7A 1KC8R 4LDWA 1QVPA 2ZCFB 4EMHA 4M75E 2M1HA 1U1TA 2WSFE 3CCJA 4N4IA 4DA4A 5AYFA 3FC3A 2EIFA 3IQLA 2J6KA 2OTJQ 2CKKA 3UA7A 2PQWA 1BCOA 4HCZA 2LX7A 1M3BA 2OTLT 1NE8A 5GANd 3SB2A 1ZA2B 3JCMf 2YUOA 3CMAQ 2V8JA 1Z9QA 3G4ST 1V29B 3VUZA 3DKMA 1MV0B 2JNGA 3LWIA 1VYTA 3H0IA 3MEUA 2KSSA 1IGUA 3JCMQ 2XI9A 2EJFA 5FW9A 2DRKA 3CMAA 4V2SA 1D0YA 4C92E 7AT1B 2KMTA 3TSWA 1VYVA 2DILA 3CC4Q 1XJWB 1NJIR 2COZA 2QTXA 1VQ8T 1VQLA 1VOMA 2JT4A 2HZYA 3LGLA 4RTTA 2WACA 3NTKA 2O9VA 5GANj 2EYXA 1T0HA 4HXJA 3PIOA 3OYFA 1JXMA 3SFMA 1VQLQ 2BE7D 1FWZA 2JM9A 1YHQA 3SWNB 2CUBA 3JCMX 1WXUA 1SEMA 4ZGEB 4RCBA 1BYMA 1TTHB 4HVWA 3GBQA 1ABOA 3H0HA 2C0TA 2GTJA 3QWYA 4B9XA 2PUKB 1G2BA 3OYJA 5GMKh 4C92G 2AZSA 2XD0A 2NUPB 2DAQA 2LZ6B 2EYYA 1Q81U 2RHZA 3CC7A 2QQSA 4DBRA 3T9NA 1WX6A 3FDRA 3SDZA 1AEYA 3ZL7C 3RDVA 2VWFA 1UJ0A 1ZA1B 3HHTB 3RUXA 4AT1B 1UHCA 3ER0A 2QQAA 2EQUA 3H41A 3V8JA 1MMGA 1MMNA 1GXIE 4ZGJB 2OI3A 5J39A 3FEOA 2P0KA 1YITA 2YHTA 3QG1A 2BZ8A 2RO0A 4A53A 1CKBA 2QDYB 3CCVT 3M56A 2DTOA 3G71A 3EG0A 3JCMe 4FCYA 1N8RR 3JAME 3CCET 4LUEA 3SWNC 3HKSA 4KH0B 3HTRA 2VASA 5KCHA 4PJOE 3NHNA 1VQ6A 3CCSA 4AFSC 1PKTA 2DXBA 6AT1B 3EFOA 4E7HA 3HRTA 1UGRB 3CC2A 1ABQA 1WXTA 1M3CA 3JCMW 1SSFA 4M75B 1BI2A 2K5LA 2X3XD 1QWFA 5DLOA 1W4SA 2EFIA 2V26A 4D8DA 4Q5WA 3CCLA 1PWTA 2FHDA 4E7SA 4RMOA 1FMVA 1SPKA 2DVJA 2GQIA 1W2BP 4AFZC 3OYDA 3CXCA 2AKLA 1WGSA 3V8LA 1WHMA 1BK2A 3RBBB 1NJIC 4J83A 4AFUC 4RTYA 3D7SB 4M7AE 5GMKm 4ZN1A 3E2UA 1IGQA 4F14A 3CCMT 3I56T 2E6NA 3OS0A 4BE1A 4LN2A 2E5QA 4M77D 4M4ZA 1HJDA 5D6YA 2MCNA 1LVKA 4EMKA 2QAZA 3I5SA 2HKQB 1OU9A 3M54A 1O9SA 4JUVA 3L2ZA 3JCMb 5GAMf 3JB9H 5GANf 9ATCB 2KEAA 3PFSA 1YIJT 4M7AA 4XQ3A 2X4XA 2KDSA 3UA6A 5CQYA 3QZ9B 4ZN3A 2RQWA 4M7AD 4EIKA 2FL7A 3CMEA 1YP5A 1ZBJA 1UFFA 2JTEA 2K4YA 4BDZA 1WHJA 5LJ5j 1AOJA 5CKHA 5HKCA 3DLMA 3CCRQ 2EQMA 1BIAA 4TVRA 2D0NA 4JRPA 2PVGB 1VQ5T 4JS4A 2QGFB 1NLPC 1IXDA 2XHCA 3CBOA 1K9MR 3I55T 4KT0E 2F5KA 3THKA 3I56Q 1RAAB 4PLLA 4OGEA 3ME9A 2X4WA 2CZ6B 1D1AA 4F7UA 3M59A 1G8XA 4JZ3A 4PJJA 2QEXQ 2DZ9A 4C0GA 3MEAA 1YWOA 1BIBA 4OMPA 3QSUA 5EC7A 3LH0A 4BI4A 3CC7T 2X3WD 3V7CA 3LX7A 1MV3A 1M9SA 4M75F 1QCFA 1TUGB 2RJDA 1WIEA 4N0AC 2WSEE 4FU6A 2P4RA 3OYHA 1VQ6T 1HK9A 1VUBA 2YRDA 3DLLA 2RJFA 2QYZA 4A4EA 1VQLT 2KE9A 1VYUA 4PNOA 1QW1A 3CCVQ 2KVQG 1FMWA 1RI9A 1PHTA 2KBTA 4NL3A 3M0QA 1G3TA 1KQSP 3R6NA 1TOVA 3INZA 1ZUYA 3JCMh 4OB1B 2AKKA 1QVGA 3CCEA 4WCIA 1W2BA 3GIBA 4AMCA 1RABB 2RJCA 1D3BB 1K73R 1Q7YU 4C0DC 2KI7A 2HL3A 3PTAA 1NBEB 1JJ2A 1K8AR 5GAN8 1QVGS 3KFVA 2LC4A 2PUOB 3HP9A 1KQ1A 3REAB 3E9FA 4MZMA 5IT9E 2HEQA 3QJYA 1VQMQ 1M2OA 4RTVA 5CO7A 3OMGA 3EGUA 3A1PA 3RR6A 5GAN2 3NTIA 5CKEA 1HXDA 5KYWB 2DFUA 2L3RA 5KCOA 3JCMd 5GAOq 4PFPA 3L1AA 2JS2A 4IUPA 5A0LA 1NPPA 3QKJA 4FYVB 2YRCA 4PL6A 3M0SA 3QPHA 4FIBA 2XDBA 5C6SA 4J9DA 3TCJA 1JJ2S 4OF1A 2ZPEB 2LJ0A 1TXQA 1YFNA 1G3SA 4L6V5 2I0NA 1OU8A 1R77A 2PVOB 4IURA 5HK3A 3WVEB 2FPEA 3M0TA 3C94A 1UGPB 4IUTA 3L2QA 2NUTA 5CK9A 8ATCB 1M90C 1WFWA 4PJOB 3OYLA 3H9NA 4FW1A 1VQNQ 2F2VA 3EGXB 1M2VB 1NM7A 4Y28E 3OYAA 4AFQC 3EGDB 4OB2B 1M27C 3CCUT 2IPOB 4PFZA 2SRCA 4M78F 4WF2A 4A4KA 3OYMA 2JVVA 1R0BG 2J05A 4ZTFA 4FT4A 3CCST 1X27A 2ED1A 3GF5A 1IRXA 5LJ3g 3CPWA 3OYNA 3SHWA 1TUDA 2DD4A 4JJCA 1AVZC 1XOVA 3CC2T 3CC7Q 2FB7A 1M3AA 2WSCE 3TQ7P 4K11A 3P8BB 3CCLT 1WQ7A 1PKSA 1YIJA 4BD3A 3VU3C 1K73U 2MF2A 1SRMA 4BE0A 2FO0A 1E7OA 1X6BA 1VQ7Q 3PMTA 2LQNA 2FRWA 3RKWA 1TH7A 2E12A 3S3MA 1YCYA 2EVRA 2Y90A 1RAIB 1Y96B 4LUDA 3UWNA 2CUDA 2YUPA 4IUQA 2LQ8A 2CP6A 2YT6A 1VA7A 5KYYA 4C8QG 2RK1A 4ME7A 2V1RA 5KYYB 2E5KA 2L3SA 3CD6A 3QJ6A 4CC2A 2P0PA 4OMMA 1QVGP 2O31A 1KD1R 5CAIA 3LYIA 1AHJB 5CIUA 2ZZDA 4M78D 1AWOA 4XU3A 1YI2A 4R55A 1FMKA 2MWPA 4M7DG 2K3XA 4JLIA 4B6MA 1QMCA 2XDDA 3RKXA 2M51A 3KXTA 4M7DF 4FSXA 1OZ2A 1FX7A 2YXYA 4BI8B 2E65A 1BB9A 3VS5A 2D0QB 3CCLQ 1YI2Q 2ZGWA 2M0YA 4X34A 4KGXB 1VQ6Q 1X2KA 4MMLA 1MNEA 2DJZA 3MP8A 3X20B 2EKHA 2CZ7B 4IKFA 4LXCA 4PJOF 2JOYA 4OMFB 2HDAA 4M75A 1S1NA 3G6EQ 3DB4A 2VXEA 2EJ9A 5IHKA 3URGA 4QVZA 2DJQA 3I55A 4J9CA 3OS5A 3JSCA 2CH4W 3VS2A 2H3JA 3LLRA 5I2SA 1N6AA 4XTZA 2P84A 2VGNA 1MUZA 2JTMA 3OBWA 2EQJA 2AK5A 2F2XA 2JUFA 2R5MA 1Q86R 2RA2A 4DOVA 3CPWS 3C0CA 4AG1C 1Y07A 5GMKi 2RQTA 2KRSA 5GAMe 1M2VA 5D6XA 1VQOQ 1PRLC 2EAYA 4O6JA 4ESRA 1U06A 3M57A 4JLGA 4PJOA 1NJIU 1KFZA 3VS6A 4JS5A 1K9MC 4Y92A 1JQQA 2RN8A 2IG0A 3QWXX 2EQIA 2O9SA 1UEBA 2P0QA 3E9GA 1QVFP 2DL3A 1TS9A 2DYIA 2ABLA 5L8RE 2VUBA 2RI5A 2C06A 1KD1C 1K76A 1YJ9A 4E6RA 3L2UA 1VQ4Q 2DLPA 3JB9I 1HD3A 5J26A 5GANh 1VQPT 2JM8A 1H641 1S72T 1DJ7B 1YJ9Q 2V1QA 4QVCA 3G1JA 1LOJA 2QGGA 3MHXA 1VQMT 1R8OB 4C5EA 2NUPA 2ECZA 2EJGA 4AG2C 4BUGA 3OYBA 1UGVA 3DB3A 1T0JA 2LRQA 2A3LA 1OYXA 1RUWA 1OV3A 1VQOT 2HSPA 2L2PA 2RM4A 3JCMJ 5D7UA 1NEGA 2FPFA 1I07A 3SWNA 2QG9B 4CI0C 2ROLA 2F1LA 3MEVA 2QA4A 2MK5A 5GAN6 4PJNA 3JRZA 1GCQA 4LD9K 2YSQA 2KRMA 2XG8D 3HRSA 5LJ5h 5LJ5g 1N9SA 1BI0A 1IZ6A 2E70A 2LNVA 2MWOA 3X25B 2MOXA 2K2VA 4DEXA 1N8RU 2KROA 4ORZA 4P5NA 4J6YA 1WHHA 1I8FA 4PLIA 1YHQT 1M1KC 2VVKA 4J9HA 1JBMA 1X6GA 1SRLA 1VQ9Q 2LP5A 3JV3A 3EH2A 2KK4A 2DM1A 3S6WA 1NYFA 3MKDA 1QVFS 2DTIA 4MZPA 2CYZB 4X9DA 4X1VA 4KRTA 2DETA 1WHGA 1ACMB 1N27A 3E19A 4GLKA 3G6ET 1WJSA 1UG1A 3RIRA 1P92A 3QIIA 3C12A 4J9EA 2O4XB 1G83A 2ZPBB 1ZSGA 2D1XA 4OP0A 1SHFA 3JB9F 3VRZA 2K3BA 1OX9A 2MMPA 2YLBA 3OMCA 3LWHA 4FYYB 2LCLA 3PE0A 4QT7A 3NFCA 3G7ZA 2KYBA 2LCCA 4FW2A 5CR2A 4A4GA 1B7TA 2COYA 1M30A 1WPYA 1IHVA 1X43A 3G4SA 4C0DB 4M77C 5GAMh 2JN0A 2ZPHB 3FB9A 2E64A 4Z02A 4QQ6A 3A8GB 3CPFA 2R57A 4YTLA 1K1ZA 3SD4A 1YI2T 4IUVA 1U8RA 1U3OA 4C5HA 3A5ZB 4QQDA 2Y4YA 2RPNA 5LJ3j 1K73C 2DO3A 4KGZB 1PD1A 4XTUA 2F2WA 3BFMA 1VQKT 4JJDA 4PJOG 3MCAB 2DVEA 2GBQA 2AHJB 3PMIA 2L5QA 4PFOA 5LJ3e 2V8IA 5D6WA 1OQKA 1TWBA 3CC4T 2HQEA 1M90R 4EMKB 2ZPGB 3A8LB 2HBWA 3GNGA 4C8QD 4BE2A 1WI7A 3M9QA 4RKUE 1RLQC 2RF0A 4XU1A 2DE0X 1X69A 3TREA 3GLXA 4M7AC 5FWCA 1JRIA 4J8OA 4ATOA 1MGQA 2XDPA 2VGMA 1H92A 5GAOp 3CCVA 3GNFB 4ELZC 3A98A 1KQ2A 1M1GA 4B9WA 3PGGA 2LJ3A 4CC4B 2XIDA 2PU9B 5I11A 1GFCA 1OPKA 5GAOr 2QI2A 1B07A 2GCXA 4FT2A 1SF9A 2RH2A 2QA4T 2A08A 3BDLA 3EG3A 3EFOB 1K9MU 1MHNA 3QUIA 4XTXA 1VQ4T 1UGQB 2FZCB 2RHXA 2JMAA 2KY9A 2KRNA 2X4JA 2K6DA 3A8MB 2LNHB 1RI0A 2I2LA 4F04B 5GAN7 4N4GA 1F1BB 2XK0A 1LPLA 4E2FB 1VQ7A 1IB8A 3VV0A 4C92C 1HSQA 4FM4B 2ED0A 3HFOA 3CCMQ 4MDXA 3Q1JA 1VQMA 4C92A 4M77B 4M7DA 1VQPQ 1GL5A 1CKAA 1NG2A 2GQVA 3KUFA 1LNXA 4FL6A 3BDUA 1AWJA 2EBPA 2DBKA 3CCMA 1YN8A 1UHFA 2CP7A 4GY5A 2KXDA 3JB9D 2EGEA 3P8HA 4CC3A 3RNJA 3JCMV 2EYZA 4M78C 4XK8E 3PNWC 2DBMA 1EX4A 2DL5A 1M8MA 3QDFA 3JCMc 3UT1A 1H3ZA 2RK2A 4Z8AA 3N5BB 4C0ZA 2D8JA 3HL8A 2FVUA 2XKOC 2D9TA 3VKIA 3HRUA 2K9GA 4ELYC 2PTKA 1VQ9T 4BACA 2L3PA 3I55Q 2AZVA 3OS2A 3O8VA 2DXUA 4PK4A 4RG2A 4N0AA 1AWWA 2K3YA 2JTFA 2W10A 3FJ5A 2MIOA 2RMOA 2LQWA 5GAN4 3LGFA 3CEYA 5CVIA 3ZFJA 2BUDA 2K57A 2QDLA 3CBPA 4M78A 3MJXA 1ZSZC 2KXCA 2K7AA 4ZGDB 2CREA 4F7UE 3PIPA 4JDSA 1U5SA 2J7IA 1LJOA 5CKBA 1D1CA 3OYYA 4QW2A 5GMKj 2DD5A 4JJBA 3FRNA 5M9OA 3VS7A 2HMAA 3CQTA 4VUBA 4M77G 3CMEQ 4IUUA 4RTZA 4X9CA 4KUDK 3I9QA 1Q86U 1VQ4A 4FYWB 3OS1A 1I4K1 5LL6S 1UDLA 4M78B 3CCJQ 4PJLA 3GOXA 2GF7A 3M55A 4A4FA 5GANg 5DY9A 5DLQE 3CCQA 4DQ2A 3V8KA 1W2BS 4QQGA 4J6WA 1VQKQ 5AT1B 3NMZC 3AHUA 3CCQQ 2CS7A 2MPXC 3HPWA 4C8QF 1I1JA 2E3HA 2HD0A 5A0GA 2D6FA 1VQKA 2DX1A 2KT8A 1WDXA 3TEEA 1JJ2P 4KH1B 1WHLA 1BKBA 2R5AA 3UDCA 4PJMA 3J80E 3PVQA 3UATA 1WLPB 4M77E 1ZBXA 3H0FA 1K4US 4LD6A 2LCSA 1VQ7T 4E47A 1Q81C 1GRIA 2YWWA 4E7IA 1GFDA 1W6XA 1U1SA 3CCJT 1WHKA 3M0PA 2BKDN 2LJ1A 2ENMA 1ZUUA 2QQ9A 2V8KA 4C8QC 1QKWA 3ZBDA 2F69A 1MNDA 1G3YA 1K0XA 1QP3A 3M0UA 3OYIA 3EGDA 3H8ZA 2DA9A 3JB9G 2FG0A 2MAMA 2E6ZA 1WNLA 1YBYA 4M77A 1IREB 1OI1A 3REBB 4M7DB 4M75G 2RQUA 2LVMA 2DIQA 3H6ZA 2NUTB 1T3LA 1WZOA 1K0SA 1OZ3A 3OYKA 4PJOD 3MO8A 1JB0E 4RUGA 2VKNA 2DXCA 4R56A 1Q82R 5GJWB 4HVVA 5GAOn 1IO6A 3A8HB 1RL2A 1VQ8A 3WXMB 2CP2A 3CCUQ 2DYBA 1EFNA 1XQHA 4NOYA 1UE9A 4F7UF 1KC8C 1QVFA 1TUCA 1YITQ 1VQ8Q 4M78E 4KBMB 4O5VA 5HK0A 3CD6T 5KYXB 1WJRA 2JXBA 3EFSA 1D0ZA 3CCRA 1TG0A 3OA6A 3G71Q 1LCKA 2DL4A 3KBGA 3VS0A 2IIMA 4A4HA 1QCNA 2KQWA 4C5IA 4RTXA 1K8AC 2L3QA 2FZGB 5KYWA 2RHYA 5GMKe 5LJ5d 2A7YA 4XTWA 2KT1A 2J06A 1BBZA 1AZEA 4C8QB 2OAWA 4OMLA 1AZGB 1PRMC 2E41A 1WA7A 2YUQA 5GAMd 1RADB
chains in the Genus database with same CATH topology
3LH0A 2VC8A 4BI4A 3RIRA 3CC7T 3M53A 3V7CA 4N4HA 4QVDA 2EWNA 1P92A 3LX7A 3QIIA 1M9SA 4M75F 4BY6C 4XTVA 3C12A 3HSBA 3EAEA 2O4XB 4C8QA 2ZPBB 2G3RA 3CCUA 5KE3A 2RJDA 4OP0A 4N0AC 2WSEE 1D3BA 4FU6A 5HY6A 3JB9F 1B34B 3OBYA 3OYHA 1HK9A 1VUBA 1VQ6T 3DLLA 2RJFA 3V7RA 5GAN3 4A4EA 1VQLT 2MMPA 2YLBA 3OMCA 4PNOA 1QW1A 3LWHA 2KVQG 4PJOC 2HNIA 2LCLA 2CGHA 3NFCA 3G7ZA 4MMKA 1YJ9T 2OAUA 1YITT 4KULA 5FU6B 2LCCA 4HCBA 2XU8A 2HBPA 4BY6B 5CR2A 4NL3A 3TU4K 4A4GA 4MDXA 2OTJT 3QHSA 3C95A 4LDUA 1G3TA 1VQPA 1UB4A 3OYGA 3FJPA 1WPYA 2P4TA 3OW2S 3G71T 1KG1A 1YJWA 3G4SA 3INZA 4C0DB 3GP8A 4M77C 3JCMh 4E7JA 1G3WA 4OB1B 2JN0A 2ZPHB 3FB9A 2E64A 5GAMh 1FXXA 3CXCS 1QVGA 4Z02A 4EDUA 4QQ6A 3PT9A 3A8GB 5GAN5 3CCEA 1M5Q1 3CPFA 2R57A 4RCCA 4YTLA 5GAMj 2QEXA 1YJNA 3QYHB 5GAOl 1W2BA 3CMAT 3GIBA 3SD4A 2RJCA 1YI2T 4IUVA 1U8RA 1WJQA 1B34A 3A5ZB 4C5HA 4QQDA 1D3BB 5LJ5f 3OY9A 2Y4YA 3M5AA 5LJ3d 1Q7YU 4C0DC 4XTYA 5LJ3j 2DO3A 1K73C 1M90U 3PTAA 4PJOD 4XTUA 5FROA 3HFNA 3BFMA 5CCAA 3I56A 1VQKT 4PJOG 3MCAB 2DVEA 2AHJB 3MEWA 1JJ2A 2RJEA 3PMIA 5GAN8 2L5QA 1QVGS 2LC4A 5LJ3e 2PUOB 2V8IA 5D6WA 3HP9A 3OQ5A 4C0FA 1KQ1A 3CC4T 3E9FA 4MZMA 3S3NA 2HQEA 3QXEB 1WQWA 5IT9E 3JCMP 2QQRA 2CZ0B 1KHIA 5C0MA 3QJYA 3F70A 3P8DA 5CO7A 3OMGA 5GANe 4EMKB 5GAN2 1XNIA 3NTIA 2ZPGB 3A8LB 1VQNT 5CKEA 2IVWA 1Y7XA 3OB9A 1HXDA 4F7UB 4C92D 3E1SA 4XU0A 3GNGA 4C8QD 4BE2A 3M9QA 2L3RA 4RKUE 5KCOA 3JCMd 5GAOq 3META 4M7DG 4DOWA 3L1AA 3L2WA 3QZ5B 4XU1A 2QXFA 3TREA 3GLXA 4M7AC 5FRMA 2EQKA 3CMET 1JRIA 4IUPA 2YLCA 4J8OA 5A0LA 1NPPA 4ATOA 3QKJA 4M7AG 1MGQA 2XDPA 1X75C 2VGMA 3OSVA 2QQBA 2VYTA 4PKCC 2LDMA 4M75C 4PL6A 2RI2A 3QO3A 5GAOp 3CCVA 1BI3A 3GNFB 2DEQA 4ELZC 3VYHB 1VIFA 1KQ2A 1M1GA 1ZQ1A 3QPHA 4FIBA 2RB6A 3PGGA 4B9WA 4BB7A 1KHCA 5C6SA 3L2VA 1PSFA 2XDBA 4M7DC 2O01E 2XIDA 2PU9B 3TCJA 5J3BA 1JJ2S 4OF1A 4Y91A 2ZPEB 5GAOr 4HCCA 2QI2A 4OB3B 2GCXA 3VUBA 4ZTJA 1G3SA 4FT2A 4L6V5 2RH2A 5KH6A 2QA4T 3BDLA 1K9MU 2PVOB 4IURA 5HK3A 4JJNK 5A2QE 1MHNA 3QUIA 4XTXA 1VQ4T 1UGQB 2RHXA 3WVEB 5LJ5e 2KY9A 1Q82C 2X4JA 5CQXA 3A8MB 3C94A 3QBYA 4J7FA 1UGPB 4M7AB 4CRIA 4IUTA 1UGSB 3L2QA 1VIEA 1RI0A 2VV5A 2I2LA 5CK9A 4HT9A 4HKEA 1M90C 4PJOB 2XICA 3OYLA 2RD1A 2L8DA 5CKFA 2O4XA 3V7SA 5GAN7 1X6OA 4LDYA 4J7IA 4N4GA 2M9UA 4C5GA 5FLXE 2XK0A 3BY7A 3G6EA 4Y28E 2VXFA 3OYAA 5A0DA 1S72A 1VQ7A 4M7DD 3RERA 4OB2B 3JCMg 3VV0A 4C92C 4OGCA 3CCUT 4FM4B 4LDWA 3HFOA 1QVPA 2ZCFB 3ASKA 3Q1JA 3OW2A 4C92A 4EMHA 1VQMA 4M75E 2M1HA 4M77B 4M7DA 1U1TA 2WSFE 2X4YA 3CCJA 2GQVA 3CCRT 4A4KA 4M78F 4N4IA 4WF2A 5AYFA 5I2MA 3OYMA 4DA4A 1NPRA 2JVVA 3KUFA 2E1HA 1LNXA 4L59A 3FC3A 4ZTFA 4FL6A 2HQXA 3BDUA 2EIFA 2HAXA 4FT4A 2CKKA 3CCST 2PQWA 3CCMA 3GF5A 5LJ3g 4HCZA 5EG2A 3CPWA 3OYNA 2DZCA 2OTLT 1NE8A 3MP6A 4EMGA 1VQOA 2DD4A 4BI3A 5GANd 4GY5A 1XOVA 3SB2A 3CC2T 2FB7A 3JCMf 2WSCE 2YRVA 5FU7B 3S3OA 2V8JA 3JB9D 3MP1A 3G4ST 3P8HA 1V29B 3JCMV 3P8BB 3VUZA 4M78C 1WQ7A 3CCLT 4XK8E 3PNWC 1YIJA 3DKMA 2JNGA 4M75D 3LWIA 3MEUA 5LJ3f 2KSSA 3JCMQ 2XI9A 2EJFA 3JCMc 3CMAA 4BD3A 3UT1A 4KUIA 4V2SA 2B8AA 1H3ZA 1NZ9A 3VU3C 1K73U 2MF2A 4C92E 4BE0A 2KMTA 2RK2A 4LDXA 3EFRA 5DM7R 3N5BB 4C0ZA 2NLUA 2KAFA 3PMTA 3VJPA 4XU2A 2QTXA 3HL8A 1VQ8T 2FVUA 2XKOC 2D9TA 3VKIA 2M16A 1TH7A 3RKWA 3HRUA 2LT4A 2E12A 3S3MA 1YCYA 2Y90A 3LGLA 5KE2A 1Y96B 1N9RA 2WACA 3NTKA 3UWNA 3UPUA 5GANj 4ELYC 4IUQA 2LQ8A 3PIOA 1N8RC 1VQ9T 3OYFA 1M8VA 4BACA 3SFMA 4LDVA 4BDYA 1KC8U 2OTJA 4C8QG 2RK1A 4ME7A 1FWZA 3OS2A 1YHQA 5IAYA 3SWNB 3O8VA 2DXUA 3JCMX 3CD6A 3M58A 2PVDB 3RKYA 3QJ6A 1YJWT 2E10A 4HA8A 2P0PA 4RG2A 4N0AA 3RMSA 4OVAA 4ZGEB 4RCBA 3CBMA 1I5LA 1BYMA 2K3YA 1Q86C 2JTFA 5CAIA 4JRQA 4RG8A 3LYIA 1AHJB 5CIUA 2ZZDA 4M78D 3LGFA 5GAN4 3CEYA 5CVIA 4B9XA 4XU3A 1YI2A 1Q7YC 1XTDA 3ZFJA 2PUKB 4R55A 1KQSA 3OYJA 1K8AU 2BUDA 1KD1U 5GMKh 1Y71A 2K57A 2MWPA 3CBPA 2K3XA 3RESA 2LT1A 4C92G 4JLIA 2XDDA 4M78A 3RKXA 5FU6C 3J7AF 3KXTA 2K5FA 4M7DF 2XD0A 4FSXA 1OZ2A 1BI1A 1FX7A 4ZGDB 2DAQA 4BI8B 4F7UE 2DPPB 2E65A 3PIPA 2D0QB 5FRNA 2ZGWA 4X34A 4EPCA 4JDSA 2BIVA 1Q81U 4M7AF 3CC4A 1LJOA 5CKBA 3X20B 2RHZA 2DIGA 2DJZA 3MP8A 4MMLA 3CC7A 3OYYA 2QQSA 2CZ7B 4NS5A 4QW2A 3T9NA 3QDRB 4PJOF 2DD5A 5GMKj 4IKFA 3FRNA 5M9OA 3FDRA 3SDZA 2JOYA 1VQNA 4OMFB 1VQ5A 4M75A 4M7DE 3DB4A 4M77G 4VUBA 4IUUA 4EMKC 4E7LA 2VXEA 4X9CA 3HHTB 4KUDK 3LW5E 2EJ9A 3RUXA 3ER0A 2QQAA 2EQUA 3URGA 1VQ4A 1Q86U 4QVZA 3I55A 3V8JA 3OS5A 3OS1A 1I4K1 4M77F 1GXIE 4ZGJB 1X01A 2GFAA 5LL6S 3JSCA 4M78B 5J39A 3M4GA 2H3JA 3LLRA 5I2SA 1N6AA 3FEOA 4XTZA 2P0KA 1YITA 2VGNA 2JTMA 3OBWA 2EQJA 2YHTA 3QG1A 2R58A 3GOXA 2JUFA 2R5MA 2RO0A 2GF7A 4A53A 2QDYB 3M55A 1O75A 4A4FA 5GANg 3CCVT 3M56A 2RA2A 4DOVA 3CPWS 2DTOA 5DY9A 5DLQE 3G71A 1Y07A 5GMKi 3JCMe 2RHUA 5GAMe 5D6XA 4DQ2A 5FU7C 3V8KA 3CCQA 4NL2A 2DK3A 2EAYA 4O6JA 3JAME 3M57A 4JLGA 4UC4A 1W2BS 4PJOA 4JRIA 4QQGA 3CCET 4J6WA 2QEXT 1NJIU 3SWNC 3HKSA 4HT8A 4JS5A 1K9MC 2RI3A 3WVDB 3AHUA 2IG0A 5KCHA 4PJOE 2CS7A 3FIFA 1VQ6A 3HPWA 3CCSA 3QYGB 1Y96A 2P0QA 1UEBA 2LTOA 2HD0A 2X35A 3E9GA 4JRKA 4C8QF 2M0OA 5A0GA 3GPLA 2D6FA 4C92F 2DXBA 2EYQA 4E7HA 2FYKA 2K5IA 1VQKA 4A54A 1M4ZA 4J6XA 3C4SA 5L8RE 3RMQA 3HRTA 2VUBA 4M78G 3VYGA 1UGRB 2RI5A 3L42A 2C06A 5LJ3h 3TEEA 3CC2A 1KD1C 1YJ9A 1BKBA 2R5AA 1ZHIA 3UDCA 3J80E 3JCMW 1SSFA 4M75B 4M77E 3L2UA 1BI2A 1ZBXA 2K5LA 2JZ2A 5DLOA 3JB9I 1QP2A 1W4SA 2EFIA 5J26A 5GANh 4Q5WA 3R6OA 1VQPT 3CCLA 5CKDA 3OYCA 4LD6A 2FHDA 4RMOA 1VQ7T 1H641 4J5YA 4E47A 3OYEA 1DJ7B 1S72T 4D6WA 1Q81C 4QVCA 3OYDA 3CXCA 2LQKA 1VQLA 3JB9J 1PSEA 1LOJA 4E7IA 1WGSA 3MHXA 3V8LA 1VQMT 1R8OB 4C5EA 1U1SA 1NJIC 4J83A 3CCJT 3ZEHA 4XAXB 1YJNT 2EJGA 4M7AE 4BUGA 5GMKm 4II1A 2BKDN 3OYBA 4ZN1A 3DB3A 2ZPFB 2QQ9A 2V8KA 4C8QC 2L89A 2LRQA 2RHIA 3A8OB 5GMKl 3CCMT 3ZBDA 2A3LA 2F69A 1G3YA 2GFUA 3I56T 1OYXA 2E6NA 1QP3A 3OS0A 3OYIA 4BE1A 2ZPIB 2OTLA 2E5QA 2F5TX 4M77D 1KQSS 3H8ZA 4OB0B 3JB9G 1VQOT 2MAMA 5D6YA 2EKOA 2E6ZA 4EMKA 3J81E 3BW1A 1WNLA 2RM4A 3JCMJ 1YBYA 3M54A 1O9SA 4JUVA 3L2ZA 1IREB 1OI1A 4M77A 3SWNA 3JCMb 4M75G 4M7DB 2LVMA 1M1KU 2DIQA 3H6ZA 5GAMf 3JB9H 5GANf 4CI0C 4C8QE 2LX9A 3PFSA 1YIJT 4M7AA 1OZ3A 2DTHA 3MEVA 2X4XA 3MO8A 2KDSA 1M1FA 4XQ3A 3OYKA 2QA4A 2DKGA 5CQYA 1JB0E 4MZTA 3JRZA 3QZ9B 5GAN6 2DXCA 4ZN3A 4LD9K 4R56A 3X24B 4M7AD 2XG8D 3HRSA 5LJ5h 5LJ5g 2MI6A 5GAOn 1N9SA 2FL7A 3L2RA 1BI0A 1IZ6A 2CZ1B 2E70A 3CMEA 1G5VA 3A8HB 1EIFA 1RL2A 2K4YA 5IN1A 2LNVA 2MWOA 1VQ8A 3X25B 4BDZA 2K2VA 3WXMB 5LJ5j 5CKHA 5HKCA 1N8RU 4MDWA 1XQHA 3DLMA 4NOYA 4E7KA 3M4YA 5GAMg 3OSSC 4F7UF 1KC8C 1QVFA 2EQMA 1VQ9A 1BIAA 4P5NA 4J6YA 4TVRA 3FLGA 3X26B 1I8FA 4JRPA 4PLIA 4M78E 1YHQT 4KBMB 2PVGB 4O5VA 2DXTA 4F7UG 5HK0A 1M1KC 1VQ5T 3CD6T 4JS4A 1WJRA 3NTHA 3EFSA 3CCRA 5GAOm 2XHCA 5I21A 1JBMA 3OA6A 3CBOA 3KBGA 2KK4A 4A4HA 3I55T 3S6WA 1QVFS 4KT0E 2F5KA 2KQWA 4C5IA 3X28B 1K8AC 4PLLA 2DTIA 4OGEA 3ME9A 4MZPA 2X4WA 2CYZB 2RHYA 2CZ6B 4X9DA 5GMKe 2A7YA 4XTWA 4F7UA 5LJ5d 3M59A 1Q82U 4C8QB 2DZ9A 4C0GA 4C92B 2Y4XA 1N27A 2E41A 5GAMd 3E19A 3MEAA 4GLKA 4L5GA 1I81A 1BIBA 3G6ET 3CCQT 1WJSA 3QSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH0 A;  3OS2 A;  3OYC A;  4LD6 A;  2FHD A;  5IAY A;  3O8V A;  4N4H A;  3LX7 A;  3QII A;  3QJ6 A;  3OYE A;  3OYD A;  3EAE A;  2O4X B;  2G3R A;  4RG2 A;  5KE3 A;  1WGS A;  4E7I A;  4OVA A;  2RJD A;  2K3Y A;  4ZTJ A;  2JTF A;  4C5E A;  5KH6 A;  3BDL A;  4FU6 A;  3LYI A;  3ZEH A;  3OYH A;  5CIU A;  4IUR A;  3LGF A;  1MHN A;  3CEY A;  4II1 A;  4B9X A;  2BKD N;  2RJF A;  3OYB A;  2RHX A;  3DB3 A;  3OYJ A;  2BUD A;  4A4E A;  2MWP A;  3OMC A;  2K3X A;  2L89 A;  2LRQ A;  2RHI A;  3QBY A;  4CRI A;  4IUT A;  3L2Q A;  2GFU A;  1RI0 A;  1OYX A;  2E6N A;  3OS0 A;  3OYI A;  4BE1 A;  1OZ2 A;  2DAQ A;  2E5Q A;  2LCC A;  3H8Z A;  3OYL A;  5FRN A;  2L8D A;  5D6Y A;  4A4G A;  2EKO A;  4X34 A;  2O4X A;  2BIV A;  4N4G A;  4C5G A;  2XK0 A;  3OYG A;  2RHZ A;  2DIG A;  3MP8 A;  1OI1 A;  3OYA A;  2QQS A;  2LVM A;  4NS5 A;  4QW2 A;  2DIQ A;  4IKF A;  3H6Z A;  4E7J A;  5M9O A;  3FDR A;  3PFS A;  4Z02 A;  3ASK A;  4EDU A;  3Q1J A;  4QQ6 A;  1OZ3 A;  3MEV A;  3DB4 A;  2M1H A;  2X4X A;  3MO8 A;  4IUU A;  2X4Y A;  3OYK A;  4E7L A;  2R57 A;  4N4I A;  3OYM A;  2EQU A;  3KUF A;  4L59 A;  3SD4 A;  2RJC A;  4QVZ A;  4IUV A;  4FL6 A;  1WJQ A;  2HQX A;  4C5H A;  3FC3 A;  4ZTF A;  4QQD A;  3OS1 A;  2CKK A;  3OY9 A;  3L2R A;  2GFA A;  2PQW A;  1G5V A;  5J39 A;  4HCZ A;  3LLR A;  5IN1 A;  5FRO A;  3FEO A;  3OYN A;  2MWO A;  2P0K A;  4BDZ A;  2EQJ A;  3MEW A;  3MP6 A;  2RJE A;  3PMI A;  2R58 A;  3GOX A;  4GY5 A;  3L2V A;  2R5M A;  2RO0 A;  2GF7 A;  3DLM A;  3OQ5 A;  5D6W A;  4E7K A;  4A4F A;  3E9F A;  3S3N A;  2HQE A;  2YRV A;  2EQM A;  3S3O A;  2QQR A;  3MP1 A;  5C0M A;  3F70 A;  3P8H A;  3P8D A;  3FLG A;  2RHU A;  3OMG A;  5D6X A;  4PLI A;  1XNI A;  3NTI A;  3PNW C;  3OB9 A;  4UC4 A;  1WJR A;  3MEU A;  4QQG A;  3NTH A;  4BE2 A;  4BD3 A;  3OA6 A;  3UT1 A;  3M9Q A;  2L3R A;  2B8A A;  5KCO A;  1H3Z A;  3MET A;  2RI3 A;  4BE0 A;  4A4H A;  3L2W A;  2IG0 A;  5KCH A;  3S6W A;  2F5K A;  4C5I A;  4PLL A;  5FRM A;  2NLU A;  2EQK A;  2LTO A;  3E9G A;  2X35 A;  3ME9 A;  3PMT A;  4IUP A;  2M0O A;  3QKJ A;  2X4W A;  4E7H A;  2XDP A;  2D9T A;  2M16 A;  2RHY A;  3C4S A;  3S3M A;  3L42 A;  2RI5 A;  2VYT A;  3LGL A;  5KE2 A;  2LDM A;  2WAC A;  3NTK A;  3UWN A;  4PL6 A;  2R5A A;  2RI2 A;  4IUQ A;  1SSF A;  3L2U A;  1N27 A;  3OYF A;  2JZ2 A;  3MEA A;  4B9W A;  4BAC A;  2EFI A;  4BDY A;  5C6S A;  1KHC A;  5J26 A;  1WJS A;  4Q5W A; 
#chains in the Genus database with same CATH topology
 2VC8 A;  3M53 A;  2E4H A;  2HCK A;  4N4H A;  4QVD A;  5KYU B;  2JMC A;  2L0A A;  3EAE A;  5KE3 A;  2CP3 A;  1D3B A;  1RAG B;  5FWB A;  4OMN A;  1PD0 A;  2HNI A;  2OAU A;  1YIT T;  4KUL A;  2O2O A;  2Z0W A;  2XU8 A;  2HBP A;  4BY6 B;  2OTJ T;  1UB4 A;  2FEI A;  3OW2 S;  3G71 T;  3TSZ A;  1KG1 A;  1GCP A;  1YJW A;  4E7J A;  3GP8 A;  1G3W A;  4DBF A;  1Q7Y R;  5GAN 5;  3CXC P;  1M5Q 1;  4RCC A;  3BE3 A;  3CMA T;  3QYH B;  5GAO l;  1A0N B;  1Q95 G;  5LJ5 f;  3OY9 A;  3M5A A;  5LJ3 d;  1M90 U;  4DBH A;  2ZAE A;  3CCE Q;  2C0O A;  2CDT A;  1Y57 A;  2RJE A;  3OQ5 A;  3S3N A;  2E3I A;  1WQW A;  3QXE B;  3JCM P;  2QQR A;  2CZ0 B;  5C0M A;  4CC7 A;  1I5O B;  2JJ9 A;  1XNI A;  1V76 A;  3VS4 A;  1FYN A;  3OB9 A;  4F7U B;  2A36 A;  4C92 D;  4XU0 A;  2CT4 A;  1BCM A;  4DOW A;  2BTT A;  1NLO C;  3CME T;  4M7A G;  1X75 C;  1ZSZ B;  2KGT A;  2NWM A;  2QQB A;  2VYT A;  4PKC C;  2LDM A;  1GBQ A;  4M75 C;  3UF4 A;  1W1F A;  1BI3 A;  3CPW P;  1YJN Q;  4OMQ A;  3VYH B;  1VIF A;  1I0C A;  4HVU A;  2G6F X;  3EG9 A;  1JEG A;  2NUZ A;  2HKN A;  1RLP C;  4HCC A;  4OB3 B;  3G4S Q;  4ZTJ A;  3SEM A;  2DER A;  4JJN K;  4KGV B;  1PM3 A;  1Q82 C;  1PNJ A;  5CQX A;  1ZX6 A;  4M7A B;  4J7F A;  4CRI A;  1S72 Q;  2VV5 A;  1D1B A;  1SHG A;  4HT9 A;  2A37 A;  2XIC A;  2RD1 A;  2L8D A;  5CKF A;  2RQV A;  4E7Z A;  1X6O A;  4LDY A;  4DBQ A;  4C5G A;  3G6E A;  1H3H A;  5KYU A;  2GGR A;  5A0D A;  1S72 A;  1UTI A;  4M7D D;  2J6F A;  4OGC A;  2H3E B;  3OW2 A;  3ASK A;  1SKU B;  2X4Y A;  3CCR T;  5I2M A;  1NPR A;  1V1C A;  2E1H A;  4L59 A;  2HQX A;  2HAX A;  5L23 A;  5EG2 A;  2XMF A;  1X2Q A;  4JZ4 A;  1ARK A;  2DZC A;  3MP6 A;  4EMG A;  2EGA A;  1VQO A;  4BI3 A;  2OX7 A;  3M0R A;  2DMO A;  1GBR A;  2YRV A;  5FU7 B;  3S3O A;  3MP1 A;  1B3Q A;  2M02 A;  4M75 D;  1EZZ B;  2JS0 A;  5LJ3 f;  4KUI A;  2B8A A;  1RAC B;  1NZ9 A;  2HSE B;  3EFR A;  5DM7 R;  1WXB A;  2NLU A;  4J9F A;  2KAF A;  4DEY A;  3VJP A;  4XU2 A;  4LE9 A;  2LMJ A;  4GBQ A;  2M16 A;  1UUE A;  3NPF A;  2LT4 A;  3CD6 Q;  5KE2 A;  1KJW A;  1N9R A;  3UPU A;  1ZUK A;  1IHW A;  5I22 A;  1UEC A;  1N8R C;  1M8V A;  5IHN A;  2OTJ A;  4LDV A;  4BDY A;  1KC8 U;  2SEM A;  5IAY A;  3M58 A;  2PVD B;  3RKY A;  3MPU B;  1YJW T;  2E10 A;  2BE9 B;  4HA8 A;  1PC0 A;  2OJ2 A;  3RMS A;  4OVA A;  3CBM A;  1I5L A;  1Q86 C;  4JRQ A;  4RG8 A;  4GLM A;  1Q7Y C;  4LDX A;  4R0K A;  1XTD A;  1KQS A;  1K8A U;  3TVT A;  2CSQ A;  1OPL A;  1KD1 U;  1Y71 A;  3RES A;  2LT1 A;  1JO8 A;  5FU6 C;  2BZY A;  3J7A F;  2K5F A;  5IXF A;  1OOT A;  1BI1 A;  5IH2 A;  2DPP B;  5FRN A;  3AT1 B;  4EPC A;  2BIV A;  4M7A F;  3EH1 A;  3CC4 A;  1RAF B;  2DIG A;  5KYN A;  4NS5 A;  3QDR B;  2GNC A;  1VQN A;  1VQ5 A;  4M7D E;  4EMK C;  4E7L A;  3LW5 E;  1AT1 B;  1C6V X;  1Z9Z A;  4M77 F;  3EG1 A;  1YHQ Q;  1X01 A;  2GFA A;  1VQ5 Q;  2RNA A;  2ROT A;  3M4G A;  2RQR A;  2H8H A;  2R58 A;  1QWE A;  1O75 A;  2CH4 A;  2RHU A;  2EW3 A;  5FU7 C;  2A0F B;  4NL2 A;  2DK3 A;  2DF6 A;  4UC4 A;  4JRI A;  2QEX T;  3NGP A;  2AT1 B;  4HT8 A;  2RI3 A;  3WVD B;  1D09 B;  3FIF A;  3QYG B;  1Y96 A;  4IIM A;  4JRK A;  2LTO A;  2X35 A;  2CP5 A;  3GPL A;  2M0O A;  4C92 F;  2EYQ A;  2FYK A;  2K5I A;  4LNP A;  4A54 A;  1M4Z A;  4J6X A;  3C4S A;  5CKD A;  3RMQ A;  1PCX A;  4M78 G;  3VYG A;  3L42 A;  2GTO A;  5LJ3 h;  2D8H A;  2YDL A;  4D8K A;  1ZHI A;  2KYM A;  3ULR B;  4ZNX A;  2JZ2 A;  3EG9 B;  1QP2 A;  1AWX A;  3R6O A;  3OYC A;  1QLY A;  1SG5 A;  1GCQ C;  3PVL A;  4J5Y A;  3OYE A;  4D6W A;  4J9I A;  2LQK A;  3JB9 J;  1PSE A;  2W0Z A;  1ZSZ A;  3ZEH A;  2QK0 A;  4XAX B;  1YJN T;  1TU0 B;  1C1A A;  4II1 A;  1C0M A;  2ZPF B;  2L89 A;  2RHI A;  3A8O B;  5GMK l;  5HCK A;  2O88 A;  1SSH A;  1T3S A;  2GFU A;  1D0X A;  2ZPI B;  2OTL A;  2F5T X;  1KQS S;  4IIO A;  4OB0 B;  1QKX A;  1NEB A;  2EKO A;  3J81 E;  3BW1 A;  1N5Z A;  2QA4 Q;  4RTW A;  3CCS Q;  4OMO A;  5IXB A;  1M1K U;  2J6O A;  2VB6 A;  2QTV A;  4C8Q E;  2OTL Q;  4RTU A;  2LX9 A;  3CC2 Q;  2DTH A;  1M1F A;  2DKG A;  4MZT A;  3EGX A;  8AT1 B;  3X24 B;  2PNI A;  2MI6 A;  3U23 A;  3L2R A;  1E6G A;  2CZ1 B;  1Q81 R;  1G5V A;  1QQJ A;  1EIF A;  2DL8 A;  5IN1 A;  1KSW A;  2YUN A;  1YWP A;  4MDW A;  1KIK A;  4E7K A;  3M4Y A;  4FSS A;  3OSS C;  5GAM g;  1YJW Q;  1YNZ A;  1VQ9 A;  3I35 A;  2PZ1 A;  3FLG A;  4ANJ A;  3X26 B;  1YCS B;  2DXT A;  4F7U G;  1H8K A;  3NTH A;  5GAO m;  5I21 A;  2COW A;  1OEB A;  2HQH A;  4FYX B;  3X28 B;  2QAS A;  1QCO A;  1Q82 U;  1ZLM A;  1OX8 A;  4C92 B;  5ECA A;  2Y4X A;  4L5G A;  1I81 A;  3CCQ T;  1J3T A;  2CP0 A;  4HCK A;  1HYO A;  4Z89 A;  2EWN A;  4BY6 C;  4XTV A;  3HSB A;  4C8Q A;  3CCU A;  2G3R A;  5HY6 A;  1B34 B;  3OBY A;  2ESW A;  3V7R A;  1R0C B;  5GAN 3;  4PJO C;  2CGH A;  2NYS A;  1YJ9 T;  4MMK A;  3EHR A;  2KNB B;  5FU6 B;  4F16 A;  4HCB A;  5KYX A;  2DNU A;  3TU4 K;  2EYW A;  1MMD A;  3QHS A;  3C95 A;  4LDU A;  2ATC B;  1VQP A;  3OYG A;  3FJP A;  2P4T A;  2JW4 A;  2EGC A;  2HL5 C;  3CXC S;  1FXX A;  2K79 A;  2AIR B;  4EDU A;  3PT9 A;  1OUL A;  5GAM j;  2QEX A;  1YJN A;  3OW2 P;  1WJQ A;  1B34 A;  4XTY A;  4F17 A;  5FRO A;  3HFN A;  5CCA A;  3I56 A;  2EPD A;  3MEW A;  4JPB W;  2MYS A;  4C0F A;  1M1K R;  2X9H A;  3EHQ A;  1KHI A;  1Y0M A;  3F70 A;  3P8D A;  4A63 B;  5GAN e;  1WYX A;  1VQN T;  2IVW A;  1Y7X A;  3E1S A;  1PG5 B;  2KR3 A;  1NYG A;  2C0I A;  3MET A;  3L2W A;  3QZ5 B;  1MMA A;  2QXF A;  1E6H A;  5FRM A;  2EQK A;  2YLC A;  2FZK B;  1JXO A;  2X51 A;  3O5Z A;  3OSV A;  1CSK A;  5GJV B;  2RI2 A;  3QO3 A;  2DEQ A;  1TSF A;  2FPD A;  1ZQ1 A;  1YIJ Q;  2RB6 A;  3EG2 A;  4BB7 A;  3VS1 A;  1KHC A;  3L2V A;  4M7D C;  1PSF A;  1W70 A;  1UJY A;  2O01 E;  3LH5 A;  4Z88 A;  1RAH B;  5J3B A;  1JU5 C;  3I5R A;  4Y91 A;  1K9A A;  2K2M A;  3VUB A;  5IHI A;  2A28 A;  2CSI A;  5KH6 A;  2FRY A;  5A2Q E;  3VRY A;  3VS3 A;  5LJ5 e;  4J9B A;  3QBY A;  1AD5 A;  1UGS B;  1VIE A;  2DL7 A;  1RAE B;  2B86 A;  2DRM A;  4HKE A;  1BU1 A;  2O4X A;  4WTO B;  3V7S A;  4J7I A;  5FLX E;  2CT3 A;  2M9U A;  3BY7 A;  4J9G A;  2VXF A;  2DEU A;  3RER A;  2BZX A;  3JCM g;  4QKU A;  1KK7 A;  1KC8 R;  4LDW A;  1QVP A;  2ZCF B;  4EMH A;  4M75 E;  2M1H A;  1U1T A;  2WSF E;  3CCJ A;  4N4I A;  4DA4 A;  5AYF A;  3FC3 A;  2EIF A;  3IQL A;  2J6K A;  2OTJ Q;  2CKK A;  3UA7 A;  2PQW A;  1BCO A;  4HCZ A;  2LX7 A;  1M3B A;  2OTL T;  1NE8 A;  5GAN d;  3SB2 A;  1ZA2 B;  3JCM f;  2YUO A;  3CMA Q;  2V8J A;  1Z9Q A;  3G4S T;  1V29 B;  3VUZ A;  3DKM A;  1MV0 B;  2JNG A;  3LWI A;  1VYT A;  3H0I A;  3MEU A;  2KSS A;  1IGU A;  3JCM Q;  2XI9 A;  2EJF A;  5FW9 A;  2DRK A;  3CMA A;  4V2S A;  1D0Y A;  4C92 E;  7AT1 B;  2KMT A;  3TSW A;  1VYV A;  2DIL A;  3CC4 Q;  1XJW B;  1NJI R;  2COZ A;  2QTX A;  1VQ8 T;  1VQL A;  1VOM A;  2JT4 A;  2HZY A;  3LGL A;  4RTT A;  2WAC A;  3NTK A;  2O9V A;  5GAN j;  2EYX A;  1T0H A;  4HXJ A;  3PIO A;  3OYF A;  1JXM A;  3SFM A;  1VQL Q;  2BE7 D;  1FWZ A;  2JM9 A;  1YHQ A;  3SWN B;  2CUB A;  3JCM X;  1WXU A;  1SEM A;  4ZGE B;  4RCB A;  1BYM A;  1TTH B;  4HVW A;  3GBQ A;  1ABO A;  3H0H A;  2C0T A;  2GTJ A;  3QWY A;  4B9X A;  2PUK B;  1G2B A;  3OYJ A;  5GMK h;  4C92 G;  2AZS A;  2XD0 A;  2NUP B;  2DAQ A;  2LZ6 B;  2EYY A;  1Q81 U;  2RHZ A;  3CC7 A;  2QQS A;  4DBR A;  3T9N A;  1WX6 A;  3FDR A;  3SDZ A;  1AEY A;  3ZL7 C;  3RDV A;  2VWF A;  1UJ0 A;  1ZA1 B;  3HHT B;  3RUX A;  4AT1 B;  1UHC A;  3ER0 A;  2QQA A;  2EQU A;  3H41 A;  3V8J A;  1MMG A;  1MMN A;  1GXI E;  4ZGJ B;  2OI3 A;  5J39 A;  3FEO A;  2P0K A;  1YIT A;  2YHT A;  3QG1 A;  2BZ8 A;  2RO0 A;  4A53 A;  1CKB A;  2QDY B;  3CCV T;  3M56 A;  2DTO A;  3G71 A;  3EG0 A;  3JCM e;  4FCY A;  1N8R R;  3JAM E;  3CCE T;  4LUE A;  3SWN C;  3HKS A;  4KH0 B;  3HTR A;  2VAS A;  5KCH A;  4PJO E;  3NHN A;  1VQ6 A;  3CCS A;  4AFS C;  1PKT A;  2DXB A;  6AT1 B;  3EFO A;  4E7H A;  3HRT A;  1UGR B;  3CC2 A;  1ABQ A;  1WXT A;  1M3C A;  3JCM W;  1SSF A;  4M75 B;  1BI2 A;  2K5L A;  2X3X D;  1QWF A;  5DLO A;  1W4S A;  2EFI A;  2V26 A;  4D8D A;  4Q5W A;  3CCL A;  1PWT A;  2FHD A;  4E7S A;  4RMO A;  1FMV A;  1SPK A;  2DVJ A;  2GQI A;  1W2B P;  4AFZ C;  3OYD A;  3CXC A;  2AKL A;  1WGS A;  3V8L A;  1WHM A;  1BK2 A;  3RBB B;  1NJI C;  4J83 A;  4AFU C;  4RTY A;  3D7S B;  4M7A E;  5GMK m;  4ZN1 A;  3E2U A;  1IGQ A;  4F14 A;  3CCM T;  3I56 T;  2E6N A;  3OS0 A;  4BE1 A;  4LN2 A;  2E5Q A;  4M77 D;  4M4Z A;  1HJD A;  5D6Y A;  2MCN A;  1LVK A;  4EMK A;  2QAZ A;  3I5S A;  2HKQ B;  1OU9 A;  3M54 A;  1O9S A;  4JUV A;  3L2Z A;  3JCM b;  5GAM f;  3JB9 H;  5GAN f;  9ATC B;  2KEA A;  3PFS A;  1YIJ T;  4M7A A;  4XQ3 A;  2X4X A;  2KDS A;  3UA6 A;  5CQY A;  3QZ9 B;  4ZN3 A;  2RQW A;  4M7A D;  4EIK A;  2FL7 A;  3CME A;  1YP5 A;  1ZBJ A;  1UFF A;  2JTE A;  2K4Y A;  4BDZ A;  1WHJ A;  5LJ5 j;  1AOJ A;  5CKH A;  5HKC A;  3DLM A;  3CCR Q;  2EQM A;  1BIA A;  4TVR A;  2D0N A;  4JRP A;  2PVG B;  1VQ5 T;  4JS4 A;  2QGF B;  1NLP C;  1IXD A;  2XHC A;  3CBO A;  1K9M R;  3I55 T;  4KT0 E;  2F5K A;  3THK A;  3I56 Q;  1RAA B;  4PLL A;  4OGE A;  3ME9 A;  2X4W A;  2CZ6 B;  1D1A A;  4F7U A;  3M59 A;  1G8X A;  4JZ3 A;  4PJJ A;  2QEX Q;  2DZ9 A;  4C0G A;  3MEA A;  1YWO A;  1BIB A;  4OMP A;  3QSU A;  5EC7 A;  3LH0 A;  4BI4 A;  3CC7 T;  2X3W D;  3V7C A;  3LX7 A;  1MV3 A;  1M9S A;  4M75 F;  1QCF A;  1TUG B;  2RJD A;  1WIE A;  4N0A C;  2WSE E;  4FU6 A;  2P4R A;  3OYH A;  1VQ6 T;  1HK9 A;  1VUB A;  2YRD A;  3DLL A;  2RJF A;  2QYZ A;  4A4E A;  1VQL T;  2KE9 A;  1VYU A;  4PNO A;  1QW1 A;  3CCV Q;  2KVQ G;  1FMW A;  1RI9 A;  1PHT A;  2KBT A;  4NL3 A;  3M0Q A;  1G3T A;  1KQS P;  3R6N A;  1TOV A;  3INZ A;  1ZUY A;  3JCM h;  4OB1 B;  2AKK A;  1QVG A;  3CCE A;  4WCI A;  1W2B A;  3GIB A;  4AMC A;  1RAB B;  2RJC A;  1D3B B;  1K73 R;  1Q7Y U;  4C0D C;  2KI7 A;  2HL3 A;  3PTA A;  1NBE B;  1JJ2 A;  1K8A R;  5GAN 8;  1QVG S;  3KFV A;  2LC4 A;  2PUO B;  3HP9 A;  1KQ1 A;  3REA B;  3E9F A;  4MZM A;  5IT9 E;  2HEQ A;  3QJY A;  1VQM Q;  1M2O A;  4RTV A;  5CO7 A;  3OMG A;  3EGU A;  3A1P A;  3RR6 A;  5GAN 2;  3NTI A;  5CKE A;  1HXD A;  5KYW B;  2DFU A;  2L3R A;  5KCO A;  3JCM d;  5GAO q;  4PFP A;  3L1A A;  2JS2 A;  4IUP A;  5A0L A;  1NPP A;  3QKJ A;  4FYV B;  2YRC A;  4PL6 A;  3M0S A;  3QPH A;  4FIB A;  2XDB A;  5C6S A;  4J9D A;  3TCJ A;  1JJ2 S;  4OF1 A;  2ZPE B;  2LJ0 A;  1TXQ A;  1YFN A;  1G3S A;  4L6V 5;  2I0N A;  1OU8 A;  1R77 A;  2PVO B;  4IUR A;  5HK3 A;  3WVE B;  2FPE A;  3M0T A;  3C94 A;  1UGP B;  4IUT A;  3L2Q A;  2NUT A;  5CK9 A;  8ATC B;  1M90 C;  1WFW A;  4PJO B;  3OYL A;  3H9N A;  4FW1 A;  1VQN Q;  2F2V A;  3EGX B;  1M2V B;  1NM7 A;  4Y28 E;  3OYA A;  4AFQ C;  3EGD B;  4OB2 B;  1M27 C;  3CCU T;  2IPO B;  4PFZ A;  2SRC A;  4M78 F;  4WF2 A;  4A4K A;  3OYM A;  2JVV A;  1R0B G;  2J05 A;  4ZTF A;  4FT4 A;  3CCS T;  1X27 A;  2ED1 A;  3GF5 A;  1IRX A;  5LJ3 g;  3CPW A;  3OYN A;  3SHW A;  1TUD A;  2DD4 A;  4JJC A;  1AVZ C;  1XOV A;  3CC2 T;  3CC7 Q;  2FB7 A;  1M3A A;  2WSC E;  3TQ7 P;  4K11 A;  3P8B B;  3CCL T;  1WQ7 A;  1PKS A;  1YIJ A;  4BD3 A;  3VU3 C;  1K73 U;  2MF2 A;  1SRM A;  4BE0 A;  2FO0 A;  1E7O A;  1X6B A;  1VQ7 Q;  3PMT A;  2LQN A;  2FRW A;  3RKW A;  1TH7 A;  2E12 A;  3S3M A;  1YCY A;  2EVR A;  2Y90 A;  1RAI B;  1Y96 B;  4LUD A;  3UWN A;  2CUD A;  2YUP A;  4IUQ A;  2LQ8 A;  2CP6 A;  2YT6 A;  1VA7 A;  5KYY A;  4C8Q G;  2RK1 A;  4ME7 A;  2V1R A;  5KYY B;  2E5K A;  2L3S A;  3CD6 A;  3QJ6 A;  4CC2 A;  2P0P A;  4OMM A;  1QVG P;  2O31 A;  1KD1 R;  5CAI A;  3LYI A;  1AHJ B;  5CIU A;  2ZZD A;  4M78 D;  1AWO A;  4XU3 A;  1YI2 A;  4R55 A;  1FMK A;  2MWP A;  4M7D G;  2K3X A;  4JLI A;  4B6M A;  1QMC A;  2XDD A;  3RKX A;  2M51 A;  3KXT A;  4M7D F;  4FSX A;  1OZ2 A;  1FX7 A;  2YXY A;  4BI8 B;  2E65 A;  1BB9 A;  3VS5 A;  2D0Q B;  3CCL Q;  1YI2 Q;  2ZGW A;  2M0Y A;  4X34 A;  4KGX B;  1VQ6 Q;  1X2K A;  4MML A;  1MNE A;  2DJZ A;  3MP8 A;  3X20 B;  2EKH A;  2CZ7 B;  4IKF A;  4LXC A;  4PJO F;  2JOY A;  4OMF B;  2HDA A;  4M75 A;  1S1N A;  3G6E Q;  3DB4 A;  2VXE A;  2EJ9 A;  5IHK A;  3URG A;  4QVZ A;  2DJQ A;  3I55 A;  4J9C A;  3OS5 A;  3JSC A;  2CH4 W;  3VS2 A;  2H3J A;  3LLR A;  5I2S A;  1N6A A;  4XTZ A;  2P84 A;  2VGN A;  1MUZ A;  2JTM A;  3OBW A;  2EQJ A;  2AK5 A;  2F2X A;  2JUF A;  2R5M A;  1Q86 R;  2RA2 A;  4DOV A;  3CPW S;  3C0C A;  4AG1 C;  1Y07 A;  5GMK i;  2RQT A;  2KRS A;  5GAM e;  1M2V A;  5D6X A;  1VQO Q;  1PRL C;  2EAY A;  4O6J A;  4ESR A;  1U06 A;  3M57 A;  4JLG A;  4PJO A;  1NJI U;  1KFZ A;  3VS6 A;  4JS5 A;  1K9M C;  4Y92 A;  1JQQ A;  2RN8 A;  2IG0 A;  3QWX X;  2EQI A;  2O9S A;  1UEB A;  2P0Q A;  3E9G A;  1QVF P;  2DL3 A;  1TS9 A;  2DYI A;  2ABL A;  5L8R E;  2VUB A;  2RI5 A;  2C06 A;  1KD1 C;  1K76 A;  1YJ9 A;  4E6R A;  3L2U A;  1VQ4 Q;  2DLP A;  3JB9 I;  1HD3 A;  5J26 A;  5GAN h;  1VQP T;  2JM8 A;  1H64 1;  1S72 T;  1DJ7 B;  1YJ9 Q;  2V1Q A;  4QVC A;  3G1J A;  1LOJ A;  2QGG A;  3MHX A;  1VQM T;  1R8O B;  4C5E A;  2NUP A;  2ECZ A;  2EJG A;  4AG2 C;  4BUG A;  3OYB A;  1UGV A;  3DB3 A;  1T0J A;  2LRQ A;  2A3L A;  1OYX A;  1RUW A;  1OV3 A;  1VQO T;  2HSP A;  2L2P A;  2RM4 A;  3JCM J;  5D7U A;  1NEG A;  2FPF A;  1I07 A;  3SWN A;  2QG9 B;  4CI0 C;  2ROL A;  2F1L A;  3MEV A;  2QA4 A;  2MK5 A;  5GAN 6;  4PJN A;  3JRZ A;  1GCQ A;  4LD9 K;  2YSQ A;  2KRM A;  2XG8 D;  3HRS A;  5LJ5 h;  5LJ5 g;  1N9S A;  1BI0 A;  1IZ6 A;  2E70 A;  2LNV A;  2MWO A;  3X25 B;  2MOX A;  2K2V A;  4DEX A;  1N8R U;  2KRO A;  4ORZ A;  4P5N A;  4J6Y A;  1WHH A;  1I8F A;  4PLI A;  1YHQ T;  1M1K C;  2VVK A;  4J9H A;  1JBM A;  1X6G A;  1SRL A;  1VQ9 Q;  2LP5 A;  3JV3 A;  3EH2 A;  2KK4 A;  2DM1 A;  3S6W A;  1NYF A;  3MKD A;  1QVF S;  2DTI A;  4MZP A;  2CYZ B;  4X9D A;  4X1V A;  4KRT A;  2DET A;  1WHG A;  1ACM B;  1N27 A;  3E19 A;  4GLK A;  3G6E T;  1WJS A;  1UG1 A;  3RIR A;  1P92 A;  3QII A;  3C12 A;  4J9E A;  2O4X B;  1G83 A;  2ZPB B;  1ZSG A;  2D1X A;  4OP0 A;  1SHF A;  3JB9 F;  3VRZ A;  2K3B A;  1OX9 A;  2MMP A;  2YLB A;  3OMC A;  3LWH A;  4FYY B;  2LCL A;  3PE0 A;  4QT7 A;  3NFC A;  3G7Z A;  2KYB A;  2LCC A;  4FW2 A;  5CR2 A;  4A4G A;  1B7T A;  2COY A;  1M30 A;  1WPY A;  1IHV A;  1X43 A;  3G4S A;  4C0D B;  4M77 C;  5GAM h;  2JN0 A;  2ZPH B;  3FB9 A;  2E64 A;  4Z02 A;  4QQ6 A;  3A8G B;  3CPF A;  2R57 A;  4YTL A;  1K1Z A;  3SD4 A;  1YI2 T;  4IUV A;  1U8R A;  1U3O A;  4C5H A;  3A5Z B;  4QQD A;  2Y4Y A;  2RPN A;  5LJ3 j;  1K73 C;  2DO3 A;  4KGZ B;  1PD1 A;  4XTU A;  2F2W A;  3BFM A;  1VQK T;  4JJD A;  4PJO G;  3MCA B;  2DVE A;  2GBQ A;  2AHJ B;  3PMI A;  2L5Q A;  4PFO A;  5LJ3 e;  2V8I A;  5D6W A;  1OQK A;  1TWB A;  3CC4 T;  2HQE A;  1M90 R;  4EMK B;  2ZPG B;  3A8L B;  2HBW A;  3GNG A;  4C8Q D;  4BE2 A;  1WI7 A;  3M9Q A;  4RKU E;  1RLQ C;  2RF0 A;  4XU1 A;  2DE0 X;  1X69 A;  3TRE A;  3GLX A;  4M7A C;  5FWC A;  1JRI A;  4J8O A;  4ATO A;  1MGQ A;  2XDP A;  2VGM A;  1H92 A;  5GAO p;  3CCV A;  3GNF B;  4ELZ C;  3A98 A;  1KQ2 A;  1M1G A;  4B9W A;  3PGG A;  2LJ3 A;  4CC4 B;  2XID A;  2PU9 B;  5I11 A;  1GFC A;  1OPK A;  5GAO r;  2QI2 A;  1B07 A;  2GCX A;  4FT2 A;  1SF9 A;  2RH2 A;  2QA4 T;  2A08 A;  3BDL A;  3EG3 A;  3EFO B;  1K9M U;  1MHN A;  3QUI A;  4XTX A;  1VQ4 T;  1UGQ B;  2FZC B;  2RHX A;  2JMA A;  2KY9 A;  2KRN A;  2X4J A;  2K6D A;  3A8M B;  2LNH B;  1RI0 A;  2I2L A;  4F04 B;  5GAN 7;  4N4G A;  1F1B B;  2XK0 A;  1LPL A;  4E2F B;  1VQ7 A;  1IB8 A;  3VV0 A;  4C92 C;  1HSQ A;  4FM4 B;  2ED0 A;  3HFO A;  3CCM Q;  4MDX A;  3Q1J A;  1VQM A;  4C92 A;  4M77 B;  4M7D A;  1VQP Q;  1GL5 A;  1CKA A;  1NG2 A;  2GQV A;  3KUF A;  1LNX A;  4FL6 A;  3BDU A;  1AWJ A;  2EBP A;  2DBK A;  3CCM A;  1YN8 A;  1UHF A;  2CP7 A;  4GY5 A;  2KXD A;  3JB9 D;  2EGE A;  3P8H A;  4CC3 A;  3RNJ A;  3JCM V;  2EYZ A;  4M78 C;  4XK8 E;  3PNW C;  2DBM A;  1EX4 A;  2DL5 A;  1M8M A;  3QDF A;  3JCM c;  3UT1 A;  1H3Z A;  2RK2 A;  4Z8A A;  3N5B B;  4C0Z A;  2D8J A;  3HL8 A;  2FVU A;  2XKO C;  2D9T A;  3VKI A;  3HRU A;  2K9G A;  4ELY C;  2PTK A;  1VQ9 T;  4BAC A;  2L3P A;  3I55 Q;  2AZV A;  3OS2 A;  3O8V A;  2DXU A;  4PK4 A;  4RG2 A;  4N0A A;  1AWW A;  2K3Y A;  2JTF A;  2W10 A;  3FJ5 A;  2MIO A;  2RMO A;  2LQW A;  5GAN 4;  3LGF A;  3CEY A;  5CVI A;  3ZFJ A;  2BUD A;  2K57 A;  2QDL A;  3CBP A;  4M78 A;  3MJX A;  1ZSZ C;  2KXC A;  2K7A A;  4ZGD B;  2CRE A;  4F7U E;  3PIP A;  4JDS A;  1U5S A;  2J7I A;  1LJO A;  5CKB A;  1D1C A;  3OYY A;  4QW2 A;  5GMK j;  2DD5 A;  4JJB A;  3FRN A;  5M9O A;  3VS7 A;  2HMA A;  3CQT A;  4VUB A;  4M77 G;  3CME Q;  4IUU A;  4RTZ A;  4X9C A;  4KUD K;  3I9Q A;  1Q86 U;  1VQ4 A;  4FYW B;  3OS1 A;  1I4K 1;  5LL6 S;  1UDL A;  4M78 B;  3CCJ Q;  4PJL A;  3GOX A;  2GF7 A;  3M55 A;  4A4F A;  5GAN g;  5DY9 A;  5DLQ E;  3CCQ A;  4DQ2 A;  3V8K A;  1W2B S;  4QQG A;  4J6W A;  1VQK Q;  5AT1 B;  3NMZ C;  3AHU A;  3CCQ Q;  2CS7 A;  2MPX C;  3HPW A;  4C8Q F;  1I1J A;  2E3H A;  2HD0 A;  5A0G A;  2D6F A;  1VQK A;  2DX1 A;  2KT8 A;  1WDX A;  3TEE A;  1JJ2 P;  4KH1 B;  1WHL A;  1BKB A;  2R5A A;  3UDC A;  4PJM A;  3J80 E;  3PVQ A;  3UAT A;  1WLP B;  4M77 E;  1ZBX A;  3H0F A;  1K4U S;  4LD6 A;  2LCS A;  1VQ7 T;  4E47 A;  1Q81 C;  1GRI A;  2YWW A;  4E7I A;  1GFD A;  1W6X A;  1U1S A;  3CCJ T;  1WHK A;  3M0P A;  2BKD N;  2LJ1 A;  2ENM A;  1ZUU A;  2QQ9 A;  2V8K A;  4C8Q C;  1QKW A;  3ZBD A;  2F69 A;  1MND A;  1G3Y A;  1K0X A;  1QP3 A;  3M0U A;  3OYI A;  3EGD A;  3H8Z A;  2DA9 A;  3JB9 G;  2FG0 A;  2MAM A;  2E6Z A;  1WNL A;  1YBY A;  4M77 A;  1IRE B;  1OI1 A;  3REB B;  4M7D B;  4M75 G;  2RQU A;  2LVM A;  2DIQ A;  3H6Z A;  2NUT B;  1T3L A;  1WZO A;  1K0S A;  1OZ3 A;  3OYK A;  4PJO D;  3MO8 A;  1JB0 E;  4RUG A;  2VKN A;  2DXC A;  4R56 A;  1Q82 R;  5GJW B;  4HVV A;  5GAO n;  1IO6 A;  3A8H B;  1RL2 A;  1VQ8 A;  3WXM B;  2CP2 A;  3CCU Q;  2DYB A;  1EFN A;  1XQH A;  4NOY A;  1UE9 A;  4F7U F;  1KC8 C;  1QVF A;  1TUC A;  1YIT Q;  1VQ8 Q;  4M78 E;  4KBM B;  4O5V A;  5HK0 A;  3CD6 T;  5KYX B;  1WJR A;  2JXB A;  3EFS A;  1D0Z A;  3CCR A;  1TG0 A;  3OA6 A;  3G71 Q;  1LCK A;  2DL4 A;  3KBG A;  3VS0 A;  2IIM A;  4A4H A;  1QCN A;  2KQW A;  4C5I A;  4RTX A;  1K8A C;  2L3Q A;  2FZG B;  5KYW A;  2RHY A;  5GMK e;  5LJ5 d;  2A7Y A;  4XTW A;  2KT1 A;  2J06 A;  1BBZ A;  1AZE A;  4C8Q B;  2OAW A;  4OML A;  1AZG B;  1PRM C;  2E41 A;  1WA7 A;  2YUQ A;  5GAM d;  1RAD B; 
#chains in the Genus database with same CATH homology
 3LH0 A;  2VC8 A;  4BI4 A;  3RIR A;  3CC7 T;  3M53 A;  3V7C A;  4N4H A;  4QVD A;  2EWN A;  1P92 A;  3LX7 A;  3QII A;  1M9S A;  4M75 F;  4BY6 C;  4XTV A;  3C12 A;  3HSB A;  3EAE A;  2O4X B;  4C8Q A;  2ZPB B;  2G3R A;  3CCU A;  5KE3 A;  2RJD A;  4OP0 A;  4N0A C;  2WSE E;  1D3B A;  4FU6 A;  5HY6 A;  3JB9 F;  1B34 B;  3OBY A;  3OYH A;  1HK9 A;  1VUB A;  1VQ6 T;  3DLL A;  2RJF A;  3V7R A;  5GAN 3;  4A4E A;  1VQL T;  2MMP A;  2YLB A;  3OMC A;  4PNO A;  1QW1 A;  3LWH A;  2KVQ G;  4PJO C;  2HNI A;  2LCL A;  2CGH A;  3NFC A;  3G7Z A;  4MMK A;  1YJ9 T;  2OAU A;  1YIT T;  4KUL A;  5FU6 B;  2LCC A;  4HCB A;  2XU8 A;  2HBP A;  4BY6 B;  5CR2 A;  4NL3 A;  3TU4 K;  4A4G A;  4MDX A;  2OTJ T;  3QHS A;  3C95 A;  4LDU A;  1G3T A;  1VQP A;  1UB4 A;  3OYG A;  3FJP A;  1WPY A;  2P4T A;  3OW2 S;  3G71 T;  1KG1 A;  1YJW A;  3G4S A;  3INZ A;  4C0D B;  3GP8 A;  4M77 C;  3JCM h;  4E7J A;  1G3W A;  4OB1 B;  2JN0 A;  2ZPH B;  3FB9 A;  2E64 A;  5GAM h;  1FXX A;  3CXC S;  1QVG A;  4Z02 A;  4EDU A;  4QQ6 A;  3PT9 A;  3A8G B;  5GAN 5;  3CCE A;  1M5Q 1;  3CPF A;  2R57 A;  4RCC A;  4YTL A;  5GAM j;  2QEX A;  1YJN A;  3QYH B;  5GAO l;  1W2B A;  3CMA T;  3GIB A;  3SD4 A;  2RJC A;  1YI2 T;  4IUV A;  1U8R A;  1WJQ A;  1B34 A;  3A5Z B;  4C5H A;  4QQD A;  1D3B B;  5LJ5 f;  3OY9 A;  2Y4Y A;  3M5A A;  5LJ3 d;  1Q7Y U;  4C0D C;  4XTY A;  5LJ3 j;  2DO3 A;  1K73 C;  1M90 U;  3PTA A;  4PJO D;  4XTU A;  5FRO A;  3HFN A;  3BFM A;  5CCA A;  3I56 A;  1VQK T;  4PJO G;  3MCA B;  2DVE A;  2AHJ B;  3MEW A;  1JJ2 A;  2RJE A;  3PMI A;  5GAN 8;  2L5Q A;  1QVG S;  2LC4 A;  5LJ3 e;  2PUO B;  2V8I A;  5D6W A;  3HP9 A;  3OQ5 A;  4C0F A;  1KQ1 A;  3CC4 T;  3E9F A;  4MZM A;  3S3N A;  2HQE A;  3QXE B;  1WQW A;  5IT9 E;  3JCM P;  2QQR A;  2CZ0 B;  1KHI A;  5C0M A;  3QJY A;  3F70 A;  3P8D A;  5CO7 A;  3OMG A;  5GAN e;  4EMK B;  5GAN 2;  1XNI A;  3NTI A;  2ZPG B;  3A8L B;  1VQN T;  5CKE A;  2IVW A;  1Y7X A;  3OB9 A;  1HXD A;  4F7U B;  4C92 D;  3E1S A;  4XU0 A;  3GNG A;  4C8Q D;  4BE2 A;  3M9Q A;  2L3R A;  4RKU E;  5KCO A;  3JCM d;  5GAO q;  3MET A;  4M7D G;  4DOW A;  3L1A A;  3L2W A;  3QZ5 B;  4XU1 A;  2QXF A;  3TRE A;  3GLX A;  4M7A C;  5FRM A;  2EQK A;  3CME T;  1JRI A;  4IUP A;  2YLC A;  4J8O A;  5A0L A;  1NPP A;  4ATO A;  3QKJ A;  4M7A G;  1MGQ A;  2XDP A;  1X75 C;  2VGM A;  3OSV A;  2QQB A;  2VYT A;  4PKC C;  2LDM A;  4M75 C;  4PL6 A;  2RI2 A;  3QO3 A;  5GAO p;  3CCV A;  1BI3 A;  3GNF B;  2DEQ A;  4ELZ C;  3VYH B;  1VIF A;  1KQ2 A;  1M1G A;  1ZQ1 A;  3QPH A;  4FIB A;  2RB6 A;  3PGG A;  4B9W A;  4BB7 A;  1KHC A;  5C6S A;  3L2V A;  1PSF A;  2XDB A;  4M7D C;  2O01 E;  2XID A;  2PU9 B;  3TCJ A;  5J3B A;  1JJ2 S;  4OF1 A;  4Y91 A;  2ZPE B;  5GAO r;  4HCC A;  2QI2 A;  4OB3 B;  2GCX A;  3VUB A;  4ZTJ A;  1G3S A;  4FT2 A;  4L6V 5;  2RH2 A;  5KH6 A;  2QA4 T;  3BDL A;  1K9M U;  2PVO B;  4IUR A;  5HK3 A;  4JJN K;  5A2Q E;  1MHN A;  3QUI A;  4XTX A;  1VQ4 T;  1UGQ B;  2RHX A;  3WVE B;  5LJ5 e;  2KY9 A;  1Q82 C;  2X4J A;  5CQX A;  3A8M B;  3C94 A;  3QBY A;  4J7F A;  1UGP B;  4M7A B;  4CRI A;  4IUT A;  1UGS B;  3L2Q A;  1VIE A;  1RI0 A;  2VV5 A;  2I2L A;  5CK9 A;  4HT9 A;  4HKE A;  1M90 C;  4PJO B;  2XIC A;  3OYL A;  2RD1 A;  2L8D A;  5CKF A;  2O4X A;  3V7S A;  5GAN 7;  1X6O A;  4LDY A;  4J7I A;  4N4G A;  2M9U A;  4C5G A;  5FLX E;  2XK0 A;  3BY7 A;  3G6E A;  4Y28 E;  2VXF A;  3OYA A;  5A0D A;  1S72 A;  1VQ7 A;  4M7D D;  3RER A;  4OB2 B;  3JCM g;  3VV0 A;  4C92 C;  4OGC A;  3CCU T;  4FM4 B;  4LDW A;  3HFO A;  1QVP A;  2ZCF B;  3ASK A;  3Q1J A;  3OW2 A;  4C92 A;  4EMH A;  1VQM A;  4M75 E;  2M1H A;  4M77 B;  4M7D A;  1U1T A;  2WSF E;  2X4Y A;  3CCJ A;  2GQV A;  3CCR T;  4A4K A;  4M78 F;  4N4I A;  4WF2 A;  5AYF A;  5I2M A;  3OYM A;  4DA4 A;  1NPR A;  2JVV A;  3KUF A;  2E1H A;  1LNX A;  4L59 A;  3FC3 A;  4ZTF A;  4FL6 A;  2HQX A;  3BDU A;  2EIF A;  2HAX A;  4FT4 A;  2CKK A;  3CCS T;  2PQW A;  3CCM A;  3GF5 A;  5LJ3 g;  4HCZ A;  5EG2 A;  3CPW A;  3OYN A;  2DZC A;  2OTL T;  1NE8 A;  3MP6 A;  4EMG A;  1VQO A;  2DD4 A;  4BI3 A;  5GAN d;  4GY5 A;  1XOV A;  3SB2 A;  3CC2 T;  2FB7 A;  3JCM f;  2WSC E;  2YRV A;  5FU7 B;  3S3O A;  2V8J A;  3JB9 D;  3MP1 A;  3G4S T;  3P8H A;  1V29 B;  3JCM V;  3P8B B;  3VUZ A;  4M78 C;  1WQ7 A;  3CCL T;  4XK8 E;  3PNW C;  1YIJ A;  3DKM A;  2JNG A;  4M75 D;  3LWI A;  3MEU A;  5LJ3 f;  2KSS A;  3JCM Q;  2XI9 A;  2EJF A;  3JCM c;  3CMA A;  4BD3 A;  3UT1 A;  4KUI A;  4V2S A;  2B8A A;  1H3Z A;  1NZ9 A;  3VU3 C;  1K73 U;  2MF2 A;  4C92 E;  4BE0 A;  2KMT A;  2RK2 A;  4LDX A;  3EFR A;  5DM7 R;  3N5B B;  4C0Z A;  2NLU A;  2KAF A;  3PMT A;  3VJP A;  4XU2 A;  2QTX A;  3HL8 A;  1VQ8 T;  2FVU A;  2XKO C;  2D9T A;  3VKI A;  2M16 A;  1TH7 A;  3RKW A;  3HRU A;  2LT4 A;  2E12 A;  3S3M A;  1YCY A;  2Y90 A;  3LGL A;  5KE2 A;  1Y96 B;  1N9R A;  2WAC A;  3NTK A;  3UWN A;  3UPU A;  5GAN j;  4ELY C;  4IUQ A;  2LQ8 A;  3PIO A;  1N8R C;  1VQ9 T;  3OYF A;  1M8V A;  4BAC A;  3SFM A;  4LDV A;  4BDY A;  1KC8 U;  2OTJ A;  4C8Q G;  2RK1 A;  4ME7 A;  1FWZ A;  3OS2 A;  1YHQ A;  5IAY A;  3SWN B;  3O8V A;  2DXU A;  3JCM X;  3CD6 A;  3M58 A;  2PVD B;  3RKY A;  3QJ6 A;  1YJW T;  2E10 A;  4HA8 A;  2P0P A;  4RG2 A;  4N0A A;  3RMS A;  4OVA A;  4ZGE B;  4RCB A;  3CBM A;  1I5L A;  1BYM A;  2K3Y A;  1Q86 C;  2JTF A;  5CAI A;  4JRQ A;  4RG8 A;  3LYI A;  1AHJ B;  5CIU A;  2ZZD A;  4M78 D;  3LGF A;  5GAN 4;  3CEY A;  5CVI A;  4B9X A;  4XU3 A;  1YI2 A;  1Q7Y C;  1XTD A;  3ZFJ A;  2PUK B;  4R55 A;  1KQS A;  3OYJ A;  1K8A U;  2BUD A;  1KD1 U;  5GMK h;  1Y71 A;  2K57 A;  2MWP A;  3CBP A;  2K3X A;  3RES A;  2LT1 A;  4C92 G;  4JLI A;  2XDD A;  4M78 A;  3RKX A;  5FU6 C;  3J7A F;  3KXT A;  2K5F A;  4M7D F;  2XD0 A;  4FSX A;  1OZ2 A;  1BI1 A;  1FX7 A;  4ZGD B;  2DAQ A;  4BI8 B;  4F7U E;  2DPP B;  2E65 A;  3PIP A;  2D0Q B;  5FRN A;  2ZGW A;  4X34 A;  4EPC A;  4JDS A;  2BIV A;  1Q81 U;  4M7A F;  3CC4 A;  1LJO A;  5CKB A;  3X20 B;  2RHZ A;  2DIG A;  2DJZ A;  3MP8 A;  4MML A;  3CC7 A;  3OYY A;  2QQS A;  2CZ7 B;  4NS5 A;  4QW2 A;  3T9N A;  3QDR B;  4PJO F;  2DD5 A;  5GMK j;  4IKF A;  3FRN A;  5M9O A;  3FDR A;  3SDZ A;  2JOY A;  1VQN A;  4OMF B;  1VQ5 A;  4M75 A;  4M7D E;  3DB4 A;  4M77 G;  4VUB A;  4IUU A;  4EMK C;  4E7L A;  2VXE A;  4X9C A;  3HHT B;  4KUD K;  3LW5 E;  2EJ9 A;  3RUX A;  3ER0 A;  2QQA A;  2EQU A;  3URG A;  1VQ4 A;  1Q86 U;  4QVZ A;  3I55 A;  3V8J A;  3OS5 A;  3OS1 A;  1I4K 1;  4M77 F;  1GXI E;  4ZGJ B;  1X01 A;  2GFA A;  5LL6 S;  3JSC A;  4M78 B;  5J39 A;  3M4G A;  2H3J A;  3LLR A;  5I2S A;  1N6A A;  3FEO A;  4XTZ A;  2P0K A;  1YIT A;  2VGN A;  2JTM A;  3OBW A;  2EQJ A;  2YHT A;  3QG1 A;  2R58 A;  3GOX A;  2JUF A;  2R5M A;  2RO0 A;  2GF7 A;  4A53 A;  2QDY B;  3M55 A;  1O75 A;  4A4F A;  5GAN g;  3CCV T;  3M56 A;  2RA2 A;  4DOV A;  3CPW S;  2DTO A;  5DY9 A;  5DLQ E;  3G71 A;  1Y07 A;  5GMK i;  3JCM e;  2RHU A;  5GAM e;  5D6X A;  4DQ2 A;  5FU7 C;  3V8K A;  3CCQ A;  4NL2 A;  2DK3 A;  2EAY A;  4O6J A;  3JAM E;  3M57 A;  4JLG A;  4UC4 A;  1W2B S;  4PJO A;  4JRI A;  4QQG A;  3CCE T;  4J6W A;  2QEX T;  1NJI U;  3SWN C;  3HKS A;  4HT8 A;  4JS5 A;  1K9M C;  2RI3 A;  3WVD B;  3AHU A;  2IG0 A;  5KCH A;  4PJO E;  2CS7 A;  3FIF A;  1VQ6 A;  3HPW A;  3CCS A;  3QYG B;  1Y96 A;  2P0Q A;  1UEB A;  2LTO A;  2HD0 A;  2X35 A;  3E9G A;  4JRK A;  4C8Q F;  2M0O A;  5A0G A;  3GPL A;  2D6F A;  4C92 F;  2DXB A;  2EYQ A;  4E7H A;  2FYK A;  2K5I A;  1VQK A;  4A54 A;  1M4Z A;  4J6X A;  3C4S A;  5L8R E;  3RMQ A;  3HRT A;  2VUB A;  4M78 G;  3VYG A;  1UGR B;  2RI5 A;  3L42 A;  2C06 A;  5LJ3 h;  3TEE A;  3CC2 A;  1KD1 C;  1YJ9 A;  1BKB A;  2R5A A;  1ZHI A;  3UDC A;  3J80 E;  3JCM W;  1SSF A;  4M75 B;  4M77 E;  3L2U A;  1BI2 A;  1ZBX A;  2K5L A;  2JZ2 A;  5DLO A;  3JB9 I;  1QP2 A;  1W4S A;  2EFI A;  5J26 A;  5GAN h;  4Q5W A;  3R6O A;  1VQP T;  3CCL A;  5CKD A;  3OYC A;  4LD6 A;  2FHD A;  4RMO A;  1VQ7 T;  1H64 1;  4J5Y A;  4E47 A;  3OYE A;  1DJ7 B;  1S72 T;  4D6W A;  1Q81 C;  4QVC A;  3OYD A;  3CXC A;  2LQK A;  1VQL A;  3JB9 J;  1PSE A;  1LOJ A;  4E7I A;  1WGS A;  3MHX A;  3V8L A;  1VQM T;  1R8O B;  4C5E A;  1U1S A;  1NJI C;  4J83 A;  3CCJ T;  3ZEH A;  4XAX B;  1YJN T;  2EJG A;  4M7A E;  4BUG A;  5GMK m;  4II1 A;  2BKD N;  3OYB A;  4ZN1 A;  3DB3 A;  2ZPF B;  2QQ9 A;  2V8K A;  4C8Q C;  2L89 A;  2LRQ A;  2RHI A;  3A8O B;  5GMK l;  3CCM T;  3ZBD A;  2A3L A;  2F69 A;  1G3Y A;  2GFU A;  3I56 T;  1OYX A;  2E6N A;  1QP3 A;  3OS0 A;  3OYI A;  4BE1 A;  2ZPI B;  2OTL A;  2E5Q A;  2F5T X;  4M77 D;  1KQS S;  3H8Z A;  4OB0 B;  3JB9 G;  1VQO T;  2MAM A;  5D6Y A;  2EKO A;  2E6Z A;  4EMK A;  3J81 E;  3BW1 A;  1WNL A;  2RM4 A;  3JCM J;  1YBY A;  3M54 A;  1O9S A;  4JUV A;  3L2Z A;  1IRE B;  1OI1 A;  4M77 A;  3SWN A;  3JCM b;  4M75 G;  4M7D B;  2LVM A;  1M1K U;  2DIQ A;  3H6Z A;  5GAM f;  3JB9 H;  5GAN f;  4CI0 C;  4C8Q E;  2LX9 A;  3PFS A;  1YIJ T;  4M7A A;  1OZ3 A;  2DTH A;  3MEV A;  2X4X A;  3MO8 A;  2KDS A;  1M1F A;  4XQ3 A;  3OYK A;  2QA4 A;  2DKG A;  5CQY A;  1JB0 E;  4MZT A;  3JRZ A;  3QZ9 B;  5GAN 6;  2DXC A;  4ZN3 A;  4LD9 K;  4R56 A;  3X24 B;  4M7A D;  2XG8 D;  3HRS A;  5LJ5 h;  5LJ5 g;  2MI6 A;  5GAO n;  1N9S A;  2FL7 A;  3L2R A;  1BI0 A;  1IZ6 A;  2CZ1 B;  2E70 A;  3CME A;  1G5V A;  3A8H B;  1EIF A;  1RL2 A;  2K4Y A;  5IN1 A;  2LNV A;  2MWO A;  1VQ8 A;  3X25 B;  4BDZ A;  2K2V A;  3WXM B;  5LJ5 j;  5CKH A;  5HKC A;  1N8R U;  4MDW A;  1XQH A;  3DLM A;  4NOY A;  4E7K A;  3M4Y A;  5GAM g;  3OSS C;  4F7U F;  1KC8 C;  1QVF A;  2EQM A;  1VQ9 A;  1BIA A;  4P5N A;  4J6Y A;  4TVR A;  3FLG A;  3X26 B;  1I8F A;  4JRP A;  4PLI A;  4M78 E;  1YHQ T;  4KBM B;  2PVG B;  4O5V A;  2DXT A;  4F7U G;  5HK0 A;  1M1K C;  1VQ5 T;  3CD6 T;  4JS4 A;  1WJR A;  3NTH A;  3EFS A;  3CCR A;  5GAO m;  2XHC A;  5I21 A;  1JBM A;  3OA6 A;  3CBO A;  3KBG A;  2KK4 A;  4A4H A;  3I55 T;  3S6W A;  1QVF S;  4KT0 E;  2F5K A;  2KQW A;  4C5I A;  3X28 B;  1K8A C;  4PLL A;  2DTI A;  4OGE A;  3ME9 A;  4MZP A;  2X4W A;  2CYZ B;  2RHY A;  2CZ6 B;  4X9D A;  5GMK e;  2A7Y A;  4XTW A;  4F7U A;  5LJ5 d;  3M59 A;  1Q82 U;  4C8Q B;  2DZ9 A;  4C0G A;  4C92 B;  2Y4X A;  1N27 A;  2E41 A;  5GAM d;  3E19 A;  3MEA A;  4GLK A;  4L5G A;  1I81 A;  1BIB A;  3G6E T;  3CCQ T;  1WJS A;  3QSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...