3JCMg

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
66
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 9
structure length 66
sequence length 80
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmg00
3V8KA 4M7AC 4C8QC 2YHTA 2DTIA 4C8QF 3JCMW 5I21A 1TH7A 4M78C 2E64A 2RB6A 4M75B 2DTHA 4C92G 4M78F 5LJ3e 5LJ3j 5LJ3g 5LJ5h 1WQWA 3RERA 4JLIA 5GAMh 3HFNA 5GANd 3RUXA 5DY9A 4M78G 3RKWA 5GAN2 4NL3A 4JRIA 5GMKe 5GMKj 3JB9J 2FYKA 2EJ9A 2RA2A 3RESA 4N0AA 3BY7A 3JCMP 1LNXA 4A53A 4HT9A 1HK9A 4M75F 3SWNB 3HSBA 1JBMA 5GANg 5GANe 4QVDA 5GANj 5GANf 4XTXA 3VU3C 3JCMJ 4PJOD 2EAYA 5GMKm 2E65A 3JB9G 4NOYA 4XTWA 2HNIA 2RM4A 1I4K1 4C92D 2E41A 4M7AD 4MMLA 4HA8A 4WF2A 4C92A 4M7AA 2ZGWA 4M7DB 1U1SA 3SWNC 3JCMd 1Y96A 4F7UG 1BIAA 4M77G 4XTZA 3V7SA 4M78A 1B34B 4M75E 4PJOB 3INZA 4RCCA 3QHSA 2DEQA 5LJ3h 4C8QG 1I81A 1HXDA 1N9RA 4EMHA 3PGGA 5GAN7 2VXFA 4JUVA 5CAIA 3QUIA 3V7CA 2Y90A 3V8JA 4M7DF 5GMKh 2E10A 2JN0A 3JCMf 4EMKA 5GMKi 4M75C 4X9CA 1LOJA 3JB9D 3L2ZA 4J6XA 1M8VA 3JCMQ 1YCYA 1BIBA 3BDUA 4PJOF 3JCMb 1JRIA 2DZ9A 4PNOA 2YLBA 3RKXA 4M75G 5GANh 3GIBA 2K57A 4M77D 4MMKA 4EMKB 4F7UA 4M77A 3JCMV 1D3BA 4C8QD 4DQ2A 1X01A 4M7DE 4M78D 4C8QA 4Y91A 2YLCA 3BW1A 5GMKl 3JCMX 5GAN3 1KQ2A 2VXEA 2EJFA 2DVEA 4XU0A 5GAOm 4PJOE 4J6YA 4J6WA 3FB9A 4M7AB 4C92B 4JRKA 4XU2A 1WNLA 2DXTA 4M7DC 4V2SA 4XTUA 3JCMg 3JCMe 1Y96B 4M75D 3RIRA 4OP0A 3BFMA 3JCMh 3QO3A 4M78B 5LJ5d 5LJ3d 2EJGA 4J5YA 4M75A 1H641 4A54A 5GAMd 5GAOl 5GAN5 3EFSA 5GAOr 4M7AG 3RKYA 4M7DG 5GAN6 4PJOC 1KQ1A 1U1TA 3JB9H 1M5Q1 3L1AA 2RD1A 4C92F 4M7AF 4PJOG 2DKGA 4RCBA 2QTXA 4EMGA 4XQ3A 2DXUA 5LJ5g 5LJ5j 5LJ5e 3M4GA 5GAMe 1I8FA 5LJ5f 5GAMj 5GAMg 5LJ3f 5GAMf 1WQ7A 3SWNA 3JCMc 5GAN8 3V7RA 3SB2A 4XTYA 1LJOA 2DJZA 2FB7A 1N9SA 4XTVA 4XU3A 3JB9I 2VC8A 4EMKC 4F7UB 4M7DD 4M77B 2DZCA 1D3BB 4N0AC 4F7UE 4M77E 4XU1A 4C92E 5GAN4 4M7AE 4M7DA 4NL2A 2CGHA 4QVCA 4C8QB 3JB9F 4C8QE 2E1HA 2EWNA 3QSUA 3V8LA 3FIFA 4M78E 4HT8A 1B34A 3FJPA 5GAOn 4PJOA 1I5LA 2I2LA 5GAOp 5GAOq 2DTOA 3AHUA 3HFOA 4M77C 1WPYA 3EFRA 4C92C 4F7UF 1MGQA 4M77F 4X9DA
chains in the Genus database with same CATH superfamily
3FLGA 5I21A 1Z9ZA 2KT1A 2MYSA 4A63B 3URGA 3EG1A 1M1KC 1T3LA 1T3SA 4LNPA 5GAN2 5EC7A 3CCQT 3THKA 4OMPA 3BY7A 5IHIA 3DLMA 1PWTA 1QQJA 4ZN1A 3EHRA 2KEAA 4C92D 2JTMA 2ROLA 3OS5A 1Q81U 5L23A 1B07A 3FJ5A 1WX6A 3A8GB 4M75E 3GBQA 5LJ3h 3O5ZA 1ABOA 1QP3A 4CRIA 4EMHA 1YJNT 1TG0A 3CXCS 2H8HA 2OTJQ 1SRMA 1JRIA 4E7HA 1WHHA 2YLBA 1YN8A 2JTFA 4LXCA 2RO0A 2EYXA 1JJ2A 4M77A 4M78D 3CC4A 3QZ9B 2R57A 8AT1B 5A0LA 1M3AA 2H3EB 2J7IA 1OQKA 2RI5A 2CZ1B 4Y28E 1WHLA 2A36A 4RTTA 1CSKA 1XTDA 3OSVA 1RAEB 1EIFA 4PJJA 1TSFA 4RCBA 1VQPA 5LJ5e 2QXFA 2OTJT 1YJWA 4JDSA 3BE3A 3C95A 4M7DD 4N0AC 2RF0A 1UUEA 2FZCB 4NL2A 2HZYA 2E1HA 4TVRA 4FCYA 4M78E 4R56A 3UWNA 1PRLC 3FJPA 3QDRB 3HFOA 3LWIA 2CZ6B 2M0YA 2QAZA 1OV3A 3AT1B 3TVTA 3RUXA 1XQHA 1N8RC 2CS7A 3S6WA 1S72A 1NE8A 2ABLA 2K4YA 2RA2A 2D1XA 4KH0B 3QYHB 4N0AA 1Q86C 2MK5A 2YUPA 4WCIA 2HL3A 2DL4A 2DPPB 4QVDA 3VS4A 3M53A 3TSWA 3HRSA 2CP7A 2E41A 2KI7A 3MEAA 3Q1JA 3CC4Q 4EPCA 4GLMA 2ED1A 2DEQA 1M3CA 3PFSA 2EFIA 5GMKi 1TWBA 4M4ZA 2YRCA 4D8KA 1ZQ1A 2FVUA 3T9NA 3FRNA 4P5NA 1YJWQ 1IZ6A 5M9OA 2X3WD 3JCMV 1BI0A 3HTRA 1X6GA 1TUGB 3MHXA 2DVEA 2YT6A 4X1VA 4M7AB 1HJDA 2QG9B 2HEQA 2K2MA 1K4US 1X69A 3CC4T 1HD3A 1IREB 2COZA 4BY6C 4HCBA 1GCQC 2KRMA 4C92F 2LCLA 2DXUA 5GAN8 2DRKA 4OMLA 3PT9A 3CCEA 1VQ6A 3QXEB 2K9GA 2HAXA 2O2OA 3OSSC 2JZ2A 1C0MA 5D6XA 5C0MA 1GCPA 4XU1A 5GAN4 1YJWT 1KFZA 1Q82U 1K8AU 1IB8A 2R58A 2X4XA 3V8LA 2QASA 1E6GA 1WPYA 4M7AC 3MP6A 1PD1A 4C8QC 4DBQA 2PQWA 2CP5A 1RAIB 2RB6A 5LJ3e 4M78F 3OYEA 2LJ3A 5GANd 4CC7A 3G4SA 2CT3A 1ZX6A 1UGRB 1R8OB 1Y7XA 1RLPC 2ZPHB 2KXCA 4QQGA 1D09B 1N6AA 4HA8A 4M7AA 1K76A 1VUBA 2FO0A 2FPFA 4OMQA 4UC4A 2DAQA 1M90C 5KCHA 4HCCA 3E9FA 4JUVA 3A8MB 4OGCA 1PD0A 4M7DF 2QA4Q 1XOVA 4DEYA 3CCJA 3RMSA 4E7KA 3CCEQ 4M77D 2DLPA 3EG3A 2K7AA 2HQEA 1GBQA 3EGXB 4J7FA 3ME9A 1UHFA 1UJYA 1WXUA 3LH0A 2RNAA 1T0JA 2CKKA 3NFCA 4RTUA 4OP0A 2M0OA 3PMIA 2RQVA 2JS0A 5LJ3d 1LCKA 1E7OA 5GAN5 1D1CA 1AWOA 1JB0E 4F04B 5HK0A 4LUEA 1SG5A 5LJ5j 4GY5A 3MEWA 4WTOB 3MP8A 2QA4T 4XTYA 2ATCB 5A0GA 4MZPA 1BI2A 3JB9I 1NJIU 2RMOA 5CKBA 3VJPA 8ATCB 4M77E 3CCET 4BDYA 2K3BA 2BIVA 3M55A 5D6WA 4BI4A 4KUDK 5HK3A 2GTOA 2L0AA 1PKSA 4HVUA 3CCJQ 5FU7B 3HHTB 4HXJA 4YTLA 2O31A 4LDUA 1KD1R 5CKHA 1M3BA 1YIJA 1M2OA 4ZTJA 1ZLMA 3EGXA 3VU3C 4PJOD 4C0FA 5J26A 2E65A 2MI6A 4MMLA 4B6MA 4R0KA 3SWNC 1KC8U 2QDYB 4IUQA 3GNFB 3M57A 3HPWA 3CPWP 1UJ0A 3INZA 4C0ZA 1VQ4Q 1IXDA 3DLLA 1NM7A 1F1BB 2PVGB 2E10A 3VS2A 3M9QA 2KQWA 4J6XA 1MMNA 2DZ9A 5FU7C 3I9QA 2L2PA 2PTKA 3CCJT 1M1KU 2GTJA 2ZPGB 2YUNA 1QVGP 5GMKl 3CCLA 2NUZA 4PJOE 5FU6B 4BI3A 3UDCA 4J6YA 2MF2A 2EKHA 5CKFA 3I35A 3META 3JCMg 2JOYA 3RIRA 3JCMh 3GIBA 3SDZA 2ECZA 1BCOA 5GAOr 3UPUA 1VQ8Q 2VB6A 1M1GA 4AG2C 4LDXA 1VQ4T 1YIJQ 3SFMA 4EIKA 3H0HA 3X25B 2DJZA 4XTVA 2VC8A 2LP5A 1YJ9A 1RUWA 2HKQB 2RJEA 4E7JA 1QVPA 2KNBB 2YSQA 2V1RA 2MWPA 4Z89A 2LT1A 1G2BA 4LD9K 1AWJA 4ZTFA 3AHUA 4M77F 3H8ZA 2CP6A 4DOWA 3G6EQ 5LJ3j 4HVVA 1WQWA 2P0KA 3QWXX 3J80E 3OBWA 3UA7A 4DEXA 1SPKA 1VQ8T 2OI3A 2ZPBB 5GANf 1M4ZA 1YIJT 3QIIA 1V76A 4NOYA 4A4EA 3CCLQ 4M7AD 2M16A 5ECAA 2PVDB 2GCXA 2JM9A 3TU4K 1UECA 4R55A 2P84A 2KGTA 4PFOA 3NPFA 4C8QG 3EGUA 3J7AF 2H3JA 3PGGA 4C5EA 1G3WA 1YCYA 3G6ET 2A08A 2DO3A 2G3RA 3P8BB 1BYMA 1QW1A 2K2VA 2HSPA 2MPXC 2K79A 2HSEB 2PNIA 2R5MA 3CC2A 4MMKA 1RAGB 2F1LA 1N8RU 3MEUA 2K6DA 1W2BP 2YLCA 5GAN3 4JRQA 2M51A 1FYNA 1Q86U 3WVDB 3PVLA 3CPWS 2HMAA 3ZEHA 5CVIA 2P4RA 3CD6A 3CCLT 1ABQA 3ZL7C 3QBYA 4J5YA 2JW4A 3TQ7P 3EFSA 1QCNA 2KT8A 1AOJA 1MHNA 3SD4A 4RTYA 2RD1A 2JS2A 1W70A 3CXCA 1UDLA 5LJ3f 1GBRA 2OX7A 4FW1A 1QVGS 2D0QB 2RQUA 4QT7A 1RACB 2QQ9A 4Y92A 2DIQA 1NG2A 2CGHA 3A8OB 4OMMA 5CQXA 2EWNA 1X6BA 3UT1A 3OS0A 1YJ9T 3QSUA 1RAAB 2CSQA 4N4IA 5GAOp 1U06A 4RTWA 2O4XB 2GBQA 1X27A 5GJWB 3LGLA 3CCSA 1TH7A 5IXFA 2Y4YA 5CQYA 4ME7A 5GAMh 2IG0A 5DY9A 2OAUA 2GGRA 1LNXA 4A53A 3KUFA 1HK9A 5HY6A 5I2MA 1VQOA 5GANg 2J6OA 2DXCA 2PU9B 2QK0A 1PCXA 1GRIA 1YITA 3EFOB 5IH2A 1M8MA 1Z9QA 3VRZA 5AYFA 3VYHB 1TS9A 1O9SA 4F7UG 4XTZA 1YWOA 2KRNA 2PVOB 1QVFP 2IVWA 1I81A 1M1FA 2PUKB 2NLUA 3A8LB 4LDWA 2VASA 5KH6A 2EQMA 3JCMQ 2XDPA 1PSEA 4M75G 3SEMA 1GFCA 3LGFA 2LC4A 1OPLA 5CR2A 1VIEA 4J9FA 1QCFA 2JUFA 1OULA 1AVZC 1Q82R 2HD0A 2P0PA 4FYYB 2DXBA 2KXDA 3UF4A 2WSCE 1ARKA 2FZGB 2DXTA 1ZSZB 2O4XA 1Y96B 2QI2A 4CC3A 2COWA 1QVFA 3CD6T 1OU9A 4BB7A 4OF1A 2C06A 4BACA 1SF9A 2X4WA 4M7AF 5J39A 1M90U 1MUZA 1KK7A 4FM4B 2DRMA 3EH2A 2L3PA 1I8FA 3EAEA 3CCMA 1VQOQ 1W2BS 2I0NA 4C0GA 3PIOA 2QQSA 4ELZC 3EFOA 2EW3A 1YITQ 2AK5A 4FSSA 5CO7A 1D3BB 4KBMB 2CP0A 4C92E 3E2UA 2DL5A 3VUZA 4OMFB 1M27C 1K1ZA 1RI0A 3A5ZB 4AFSC 4J7IA 1ZSZC 2XIDA 2YHTA 1PSFA 4RG2A 3NHNA 3FEOA 2BE7D 1CKAA 2SEMA 4IURA 2RPNA 3BDLA 4M78G 1XNIA 2BZYA 1TXQA 2HQHA 3L42A 2F2WA 3RESA 3LW5E 1PNJA 2BZXA 2AZSA 1VQ9A 2EAYA 1NYFA 1VQOT 2EPDA 1J3TA 1E6HA 2DIGA 4X34A 1I0CA 1ZSZA 2HKNA 5KYNA 1YITT 1Y96A 2LCCA 2QDLA 2FHDA 1B34B 4ZN3A 2QGFB 1K9MC 4KGXB 3EG9B 1VQKA 4PK4A 3CBMA 2X4JA 3JRZA 3QZ5B 1K73R 2VWFA 1BI1A 1W4SA 1MNDA 1M2VB 1W1FA 1NJIR 1VQ5A 1D3BA 4M7DE 2DYBA 4VUBA 1CKBA 3CC7A 5FLXE 4RTXA 1IGQA 1MMDA 4BY6B 4PJMA 2VYTA 1QWEA 3OYIA 2ROTA 2RQTA 1QVFS 4AMCA 2KAFA 5LJ5d 5FROA 1VQPQ 4BDZA 2DETA 3OYLA 3H0IA 1KD1C 3VS3A 1QWFA 5GAMe 3NMZC 2GFUA 3OMCA 2E6ZA 2A37A 1C1AA 4LE9A 4Z02A 4RKUE 2DZCA 3QJ6A 3R6NA 4C8QB 3FC3A 4HCZA 4HT8A 1B34A 2JTEA 5GAOn 3S3NA 2DILA 4E7SA 2P4TA 4JS5A 2EGAA 3EG9A 1QKWA 1S72Q 3OYAA 3JCMW 1JXMA 1NEBA 2LTOA 3OY9A 2NYSA 1VQKQ 3OS1A 2CH4W 4NL3A 1VQPT 2D6FA 3WVEB 3NTIA 1I1JA 2QQRA 3I55A 3L2WA 1M2VA 4QW2A 3HRUA 3HSBA 1VQ5Q 4Z88A 1JBMA 5L8RE 1AWWA 2FG0A 1RABB 4B9XA 1RI9A 1V29B 2LZ6B 3TREA 1D0XA 5IT9E 1GCQA 4JRPA 3KFVA 4IUPA 1YFNA 5DLQE 4PJLA 2E6NA 1TU0B 3NTKA 2ENMA 5GAN7 4FT4A 2PZ1A 2CUBA 3X26B 1S72T 1G3YA 3C0CA 4LDVA 4PNOA 3OW2P 3CQTA 1VQKT 2CT4A 1Y71A 4HKEA 4D6WA 1KJWA 4C8QA 4Y91A 2X4YA 2KRSA 1VQ5T 2DX1A 4J83A 2EYQA 2LNVA 4KT0E 3FB9A 2EYYA 1WNLA 1X6OA 4XTUA 3CC7T 2O9VA 2LNHB 1ZBXA 1FMVA 1WJRA 2M02A 4AFZC 1XJWB 2MOXA 3MPUB 2F2XA 1VQNA 1VQ6Q 3QWYA 3I55Q 4A4KA 4FT2A 4IKFA 2AHJB 3M0RA 1ZUYA 3PTAA 1BI3A 4F7UB 3PNWC 4PKCC 1OZ3A 1OX8A 2LX7A 4KULA 1VA7A 5KYYB 1Y57A 3IQLA 2EYWA 1ACMB 2V1QA 2F5KA 3C12A 2EKOA 3L2QA 3G4SQ 3JV3A 1EZZB 2AT1B 4JJBA 3I56A 2MAMA 4M75B 3M0PA 2QQBA 5DM7R 2OJ2A 4PLIA 2XICA 4D8DA 4PFZA 2O88A 5KYWB 3CMEA 2B8AA 2X9HA 3SWNB 1VQ6T 4HCKA 4ESRA 1SRLA 5HCKA 4OMNA 3I55T 1GXIE 4XTWA 1UB4A 4OB2B 4KH1B 2RHXA 1G8XA 3ASKA 1D0ZA 3A8HB 2K5IA 3MO8A 1VYVA 5IHNA 1Q7YC 1PM3A 3M0TA 1T0HA 4JJCA 2AKKA 2ZAEA 3L2RA 2NUPB 1HXDA 2CREA 1FMKA 2VXFA 1MV0B 2Y90A 4M75C 1LOJA 3G4ST 2KE9A 4Z8AA 1WI7A 2HBWA 1NZ9A 1OEBA 5CK9A 4ANJA 3CCVA 4OB0B 3QJYA 4F7UA 2HBPA 2A0FB 2KROA 4A4GA 5KYYA 2KBTA 2RJFA 4MDXA 4L6V5 1PHTA 2W10A 1MV3A 3VS1A 4M78B 3HRTA 4M75A 2XI9A 4PJNA 1M5Q1 3L1AA 2DD4A 4PJOG 2LX9A 3OW2S 4C5HA 1V1CA 2QTXA 3VV0A 4EMGA 5KYWA 3M4GA 3M0QA 4E6RA 5LJ5f 5GAMj 2RJCA 2RQWA 3CMEQ 3SWNA 2YWWA 1H8KA 4PLLA 1N9SA 4XU3A 2CDTA 1RAFB 2GQIA 2JM8A 1C6VX 4QVZA 5IHKA 2CZ0B 4AFQC 4AFUC 2RK1A 2DA9A 3CPWA 3M56A 2V26A 3MP1A 3NTHA 2DERA 5GAOq 2NUPA 1P92A 1B3QA 2DJQA 1HSQA 1TTHB 4F17A 4M78C 3DB4A 5CCAA 3X20B 4QQDA 1U3OA 2DL7A 2JMCA 2D9TA 3M59A 3I56T 4JRIA 4HVWA 4LN2A 1UGQB 4JZ4A 3CCVQ 5CKDA 4C0DC 1JO8A 1Q81R 1QVGA 1WLPB 1OZ2A 2VKNA 2OAWA 3CMET 3PIPA 2FEIA 2RH2A 3JB9G 4JJDA 5FWBA 1H92A 2J6FA 4J9IA 2DVJA 3EG0A 4M78A 2K3YA 2XMFA 1OX9A 4B9WA 4PFPA 1M90R 2E5KA 1M8VA 3QPHA 4RTZA 3BDUA 2ZPIB 2FPEA 2QQAA 1PC0A 3OYNA 3OYKA 2AIRB 4EMKB 1FXXA 3NGPA 4C8QD 1AHJB 4LD6A 2FL7A 2JVVA 3CCVT 1WIEA 1KQ2A 2ZCFB 1NYGA 1YWPA 1RAHB 2ZZDA 1K0XA 4KUIA 4V2SA 1NLPC 2YRDA 3KBGA 4DBHA 2D8HA 1H641 6AT1B 3CMAA 1G5VA 2MMPA 2ZPEB 3JAME 1N5ZA 3G7ZA 1TUDA 4IIMA 2QGGA 2IPOB 3D7SB 4FIBA 4GBQA 5LJ5g 1K9MU 5FW9A 3GOXA 1YJ9Q 5HKCA 3JCMc 2XKOC 3ER0A 2C0IA 4EMKC 2SRCA 2BUDA 1KHIA 4FU6A 2K3XA 2CYZB 2RHUA 3H0FA 4M7AE 1G83A 4C8QE 1R0CB 1WHKA 1U5SA 1WA7A 3V8KA 4AG1C 4K11A 4C5IA 1I07A 2XDDA 3RKWA 1VQLA 3I5SA 2COYA 5FRNA 1SSFA 1W2BA 1NPRA 1KD1U 1JU5C 7AT1B 1KQSP 1AZGB 1VYUA 2XDBA 1RLQC 1PG5B 1IHVA 2ZPFB 5IAYA 3EGDB 2C0OA 2K5FA 3MJXA 3QHSA 1KG1A 3CMAQ 3QUIA 5J3BA 5GMKh 3CC2Q 2GFAA 1UTIA 5EG2A 3JCMb 1BU1A 2MIOA 2WSFE 5GANh 2JNGA 2DL3A 4OGEA 5CKEA 2OTJA 4L59A 4FSXA 3M5AA 1UE9A 3TCJA 4A4FA 4J9DA 3CD6Q 2EJFA 2EGEA 4N4GA 4ZGDB 2KYMA 1M9SA 2QEXA 3JCMe 2L3RA 4M75D 3QO3A 2XK0A 2DNUA 1KQ1A 1U1TA 2LDMA 3E19A 3OYHA 4XAXB 4F14A 4QKUA 1ZA2B 4XK8E 1VQLQ 3CMAT 1YBYA 2RHYA 3X24B 1WQ7A 2AKLA 3GF5A 2L3SA 3SB2A 3CCRA 3CC2T 3H9NA 2FB7A 2L5QA 1K8AR 3CBOA 1MMAA 1JJ2P 2A7YA 4F7UE 3EG2A 5A0DA 4IUVA 1BBZA 1BCMA 2Y4XA 3EGDA 2RK2A 4KRTA 3CCSQ 1WDXA 3MKDA 1I5LA 5FWCA 1UG1A 4M77C 2MWOA 4J9BA 1MMGA 3RR6A 3H41A 4C8QF 2KR3A 4C92G 5LJ3g 4FYVB 3RERA 1ZUUA 3CCUA 2OTLA 2XU8A 2X3XD 3DB3A 2KK4A 3JB9J 1QKXA 3EHQA 3REAB 2YUOA 2IIMA 2V8KA 1VQLT 2EGCA 2B86A 1I4K1 1VQMA 3JCMd 4EDUA 2EQJA 2XG8D 2QEXQ 1BIAA 2RHIA 2V8JA 4PJOB 5D6YA 3CCST 2FPDA 3A1PA 3V8JA 2CSIA 1DJ7B 3M0UA 2YXYA 1RADB 4JPBW 1WJQA 3CEYA 4RMOA 3CCRQ 1VOMA 1WHMA 1KQSS 3L2UA 3C94A 2HL5C 3OYYA 3BW1A 3FDRA 5KCOA 3LYIA 2QYZA 4XU0A 1UFFA 2QTVA 3WXMB 4J6WA 1TOVA 2GQVA 3VS5A 2EQKA 2LQKA 2R5AA 2CUDA 4A54A 1H3HA 4M7DG 4F16A 4PJOC 1Q7YU 1UGVA 1NBEB 3A98A 2QEXT 3CCUQ 2OTLQ 1SHFA 3CCMQ 4JJNK 1YI2A 2LQNA 3TSZA 2K5LA 2WSEE 1X2KA 1WFWA 5GJVB 3M4YA 2KDSA 1QMCA 1Y07A 3O8VA 1OU8A 1IRXA 2DD5A 3VRYA 1UHCA 1X2QA 2BZ8A 3CCRT 1KIKA 1WJSA 1VQMQ 1HYOA 1PRMC 3FIFA 4PJOA 4DBFA 4OVAA 1PKTA 5I22A 3EFRA 4F7UF 2E3HA 1QP2A 2A28A 3SHWA 3OYJA 4N4HA 2LJ1A 3G1JA 2HDAA 3I5RA 2E64A 4DBRA 4MZMA 4JLIA 3CPFA 3HFNA 2VVKA 4BE1A 4A4HA 5GMKe 3ULRB 1VQ9Q 2FYKA 4GLKA 3CCUT 2OTLT 2EBPA 4ZNXA 3CCMT 3GLXA 1JJ2S 4M75F 1R0BG 2O9SA 2L8DA 2E5QA 5GANe 5I11A 4XTXA 1KC8R 4OB3B 1RL2A 2KSSA 2RM4A 1WGSA 3U23A 1VQ7A 1U1SA 4ZGJB 1JXOA 4NS5A 5I2SA 1VQMT 4MDWA 1NLOC 3G71A 1B7TA 3RBBB 2VV5A 1M30A 4RTVA 3VS0A 1KHCA 1YI2Q 1M1KR 1MNEA 1AD5A 4KGVB 3RKXA 2LQWA 2QA4A 3CC7Q 3OYGA 2D0NA 4AT1B 4J9CA 1VQ9T 2DF6A 1VYTA 2RN8A 4FL6A 3VYGA 5GAOm 1AT1B 3S3MA 4Q5WA 3LWHA 4XU2A 1KSWA 3RNJA 4E7LA 3BFMA 5GAOl 5GAMd 1JQQA 1N27A 2Z0WA 3REBB 4BE2A 3GPLA 3RKYA 5GAN6 3JB9H 9ATCB 1AWXA 3M58A 1SHGA 3ZFJA 2CZ7B 4IUUA 3OMGA 1K9AA 3S3OA 4FYWB 1QCOA 2G6FX 1YI2T 1Q81C 2E70A 4LUDA 3PE0A 3RDVA 3R6OA 2LVMA 2L3QA 1YHQA 1NPPA 1VQ7Q 1FWZA 1S1NA 2W0ZA 2RQRA 3G71Q 1MGQA 5IN1A 4BD3A 2JMAA 1G3TA 2X35A 1D1AA 2EYZA 5A2QE 3OBYA 2FZKB 1BKBA 3L2VA 3OW2A 3HP9A 1ZA1B 2DE0X 2EJ9A 3P8DA 1IHWA 2J05A 4E7ZA 5LL6S 1LPLA 1X75C 2RI3A 3QDFA 3DKMA 5KE3A 3H6ZA 1ZBJA 4WF2A 2BE9B 1BK2A 4M77G 3V7SA 2KY9A 2LMJA 1VQ7T 3VS6A 3VS7A 1OPKA 2M1HA 3P8HA 1N9RA 1ZHIA 2KMTA 3V7CA 3PVQA 3X28B 2JN0A 3JCMf 3G71T 1VQ4A 1N8RR 2ESWA 1K9MR 3MEVA 4DOVA 3UA6A 1Q86R 3LH5A 1OI1A 1X01A 4E2FB 1YHQQ 1K73U 2VXEA 4E47A 1ZSGA 4C92B 4JRKA 2KYBA 1FX7A 3OYCA 5FRMA 4J9EA 1VQNQ 4ATOA 1WHJA 2DK3A 4BE0A 2DBMA 3HL8A 2DKGA 4DA4A 2JJ9A 1VQ8A 3E9GA 4ZGEB 2F2VA 4CI0C 2XD0A 2XHCA 3HKSA 3LX7A 4L5GA 4QVCA 3I56Q 3OA6A 1UGPB 2J6KA 1YHQT 1WXBA 2DTOA 4C92C 2E4HA 4X9DA 2E3IA 2RHZA 5CIUA 2DTIA 2LT4A 4C0DB 3M54A 4HT9A 4BI8B 2DTHA 1VQNT 4O5VA 3G6EA 5GMKj 5DLOA 2YDLA 2WACA 2DFUA 2FRWA 3UATA 5GANj 1WYXA 4JS4A 3JCMJ 1K0SA 4JZ3A 5GMKm 1U8RA 1EFNA 3OB9A 4C92A 2FRYA 2ZGWA 4IUTA 4M7DB 3OYBA 5IXBA 2RJDA 2BTTA 2E12A 5AT1B 1G3SA 2MCNA 4OMOA 3F70A 1FMWA 3KXTA 3C4SA 4IIOA 1VIFA 1D0YA 3JB9D 3L2ZA 4CC4B 4CC2A 1BIBA 2LCSA 1AEYA 3JSCA 4PL6A 3RMQA 1Q82C 1YP5A 3LLRA 1K8AC 1YCSB 2VGNA 4OB1B 1IGUA 4DQ2A 1Q95G 2EIFA 3ZBDA 3JCMX 2HCKA 4QQ6A 4O6JA 2GNCA 2PUOB 3PMTA 2DBKA 4M7DC 2F69A 3QYGB 1QLYA 2EJGA 4J9GA 2ED0A 3VKIA 2BKDN 3CBPA 2LJ0A 5FU6C 2KVQG 2EQIA 2V8IA 3QKJA 2J06A 4ORZA 3OYMA 2YRVA 2GF7A 5GAMf 2M9UA 1LJOA 3J81E 2X51A 5C6SA 3M0SA 2CP2A 4J9HA 1A0NB 4M7DA 2A3LA 2DM1A 4LDYA 2EVRA 2O01E 3N5BB 2AZVA 2DYIA 2YUQA 3QG1A 3CCQA 5D7UA 1OOTA 4M7AG 1WXTA 5LJ5h 2JXBA 4II1A 2D8JA 3CXCP 5KYUB 1OYXA 1BB9A 1SSHA 3JCMP 3GP8A 1H3ZA 1EX4A 1W6XA 2NUTB 1GL5A 4E7IA 3TEEA 1TUCA 2HNIA 4JLGA 3OYDA 5KYXB 4FW2A 2DEUA 1UEBA 1GFDA 1YNZA 1YJNA 3OQ5A 1D1BA 4RCCA 3OS2A 4BUGA 2NWMA 1Q7YR 5CAIA 4RG8A 2VUBA 4FYXB 4EMKA 4RUGA 1K73C 2EQUA 4X9CA 3OYFA 2DL8A 2VGMA 1NJIC 2JT4A 4PJOF 4C5GA 2C0TA 1UGSB 1JEGA 1IO6A 3EH1A 1X43A 2K57A 1O75A 2LRQA 4MZTA 2L89A 1WHGA 5KE2A 2CH4A 1R77A 3CCQQ 1LVKA 2CP3A 4KGZB 2LQ8A 1NEGA 1SKUB 4XQ3A 2F5TX 5KYUA 1ZUKA 5GAMg 1AZEA 2P0QA 3E1SA 3V7RA 2NUTA 1I5OB 2DMOA 1KQSA 3MCAB 1KC8C 2RI2A 4M77B 3GNGA 1WZOA 5KYXA 2HQXA 4ELYC 3JB9F 3VUBA 2I2LA 1YJNQ 1SEMA 1Y0MA 4J8OA
chains in the Genus database with same CATH topology
3L2QA 3OYJA 4N4HA 4DOWA 3I56A 3FLGA 2MAMA 4M75B 5I21A 2E64A 5LJ3j 4MZMA 2QQBA 5DM7R 1WQWA 3URGA 2P0KA 4JLIA 3CPFA 3HFNA 1M1KC 3J80E 4PLIA 4BE1A 3OBWA 5GAN2 3CCQT 2XICA 4M77F 4A4HA 5GMKe 2FYKA 4GLKA 3CCUT 1VQ8T 2OTLT 3CMEA 2B8AA 3GLXA 3BY7A 3CCMT 1JJ2S 4M75F 3SWNB 1VQ6T 3DLMA 4HCBA 5GANe 2L8DA 2E5QA 4ZN1A 3I55T 2ZPBB 4XTXA 1M4ZA 5GANf 1GXIE 1YIJT 4OB3B 3QIIA 1RL2A 4NOYA 4XTWA 4A4EA 2KSSA 1UB4A 1WGSA 2JTMA 2M16A 2RM4A 4OB2B 3OS5A 4C92D 2RHXA 1Q81U 1VQ7A 3ASKA 1U1SA 3A8HB 2PVDB 2GCXA 2K5IA 3MO8A 4ZGJB 1Q7YC 3A8GB 4NS5A 3TU4K 5I2SA 1VQMT 4M75E 4R55A 3L2RA 4MDWA 3G71A 5LJ3h 4C8QG 1QP3A 1HXDA 3J7AF 4CRIA 2H3JA 3PGGA 4EMHA 2VV5A 2VXFA 2Y90A 1YJNT 1KHCA 4C5EA 3CXCS 4M75C 1LOJA 3G4ST 1G3WA 1YCYA 1NZ9A 2DO3A 2G3RA 3G6ET 3P8BB 1JRIA 4E7HA 1BYMA 2YLBA 3RKXA 1QW1A 2K2VA 5CK9A 2JTFA 2R5MA 2RO0A 2QA4A 3CCVA 3CC2A 1JJ2A 4MMKA 4OB0B 3QJYA 3OYGA 1N8RU 4F7UA 4M77A 2HBPA 1VQ9T 3MEUA 4M78D 2YLCA 5GAN3 4JRQA 4A4GA 1Q86U 4FL6A 3WVDB 2RJFA 3VYGA 4MDXA 3CPWS 5GAOm 3S3MA 4L6V5 4Q5WA 3CC4A 3ZEHA 3LWHA 4XU2A 3QZ9B 2R57A 5CVIA 3CD6A 3CCLT 4E7LA 5A0LA 3BFMA 3QBYA 4M78B 3HRTA 5GAOl 4J5YA 4M75A 1N27A 5GAMd 2RI5A 2CZ1B 3EFSA 4Y28E 3GPLA 3RKYA 4BE2A 5GAN6 2XI9A 3JB9H 1M5Q1 1MHNA 3L1AA 3SD4A 2RD1A 2DD4A 1XTDA 3CXCA 4PJOG 2LX9A 3M58A 4C5HA 3OSVA 3OW2S 1EIFA 4RCBA 2QTXA 3ZFJA 3VV0A 4EMGA 1VQPA 5LJ5e 3M4GA 5GAMj 5LJ5f 2CZ7B 2RJCA 4IUUA 5LJ3f 3OMGA 3SWNA 3S3OA 2QXFA 1YI2T 2OTJT 1Q81C 2E70A 1YJWA 1QVGS 4PLLA 1N9SA 4XU3A 2D0QB 4JDSA 3C95A 3R6OA 2QQ9A 4N0AC 4M7DD 4QVZA 2LVMA 2DIQA 1YHQA 4NL2A 2CGHA 1NPPA 2CZ0B 3A8OB 2E1HA 2RK1A 5CQXA 2EWNA 1FWZA 3UT1A 3OS0A 3M56A 4TVRA 3CPWA 4M78E 1YJ9T 4R56A 3UWNA 3FJPA 3QDRB 3MP1A 3NTHA 4N4IA 5GAOp 5GAOq 1P92A 3HFOA 3LWIA 1MGQA 2CZ6B 2O4XB 5IN1A 4BD3A 1G3TA 2X35A 3LGLA 3CCSA 1TH7A 4M78C 3OBYA 5A2QE 3DB4A 5CCAA 2Y4YA 3X20B 4QQDA 5CQYA 4ME7A 5GAMh 1BKBA 3RUXA 2IG0A 1XQHA 3M59A 2D9TA 2CS7A 3L2VA 5DY9A 3OW2A 3HP9A 1N8RC 2OAUA 3I56T 4JRIA 3S6WA 1S72A 1NE8A 1UGQB 2K4YA 2EJ9A 2RA2A 3P8DA 5CKDA 3QYHB 4N0AA 4C0DC 1Q86C 1LNXA 4A53A 3KUFA 1HK9A 5HY6A 5I2MA 2DPPB 1VQOA 5LL6S 1QVGA 5GANg 4QVDA 1OZ2A 2DXCA 1X75C 2PU9B 2RI3A 3M53A 3HRSA 3CMET 1YITA 3PIPA 3DKMA 5KE3A 2RH2A 3H6ZA 3JB9G 2E41A 4WF2A 3MEAA 3Q1JA 5AYFA 3VYHB 1O9SA 4F7UG 4M77G 4XTZA 3V7SA 4EPCA 2KY9A 4M78A 2PVOB 2K3YA 1VQ7T 2DEQA 2M1HA 2IVWA 3P8HA 1I81A 1N9RA 1ZHIA 2KMTA 1M1FA 3PFSA 3V7CA 4B9WA 2PUKB 2NLUA 3X28B 2JN0A 3JCMf 3A8LB 2EFIA 3G71T 5GMKi 4LDWA 1M8VA 1VQ4A 5KH6A 2EQMA 3QPHA 3JCMQ 2XDPA 2ZPIB 3BDUA 1PSEA 3MEVA 4M75G 1ZQ1A 2QQAA 2FVUA 3T9NA 4DOVA 3FRNA 4P5NA 3OYNA 3OYKA 4EMKB 1IZ6A 3LGFA 5M9OA 3JCMV 1FXXA 2LC4A 4C8QD 1OI1A 1X01A 5CR2A 1BI0A 1AHJB 1VIEA 4LD6A 2FL7A 2JVVA 2JUFA 3CCVT 1K73U 1KQ2A 2VXEA 4E47A 2ZCFB 3MHXA 2DVEA 2HD0A 2P0PA 2DXBA 2WSCE 4M7AB 4C92B 2ZZDA 4JRKA 2DXTA 4KUIA 4V2SA 2O4XA 1FX7A 3OYCA 1Y96B 3KBGA 2QI2A 5FRMA 4ATOA 3CC4T 1H641 1IREB 4BY6C 1QVFA 3CD6T 4BB7A 4OF1A 3CMAA 2C06A 2MMPA 2ZPEB 3JAME 2DK3A 3G7ZA 4BACA 4BE0A 2X4WA 4C92F 5J39A 4M7AF 1M90U 2LCLA 3HL8A 4FM4B 2DKGA 4FIBA 5LJ5g 2DXUA 1K9MU 4M7AE 3GOXA 1I8FA 5GAN8 4DA4A 5HKCA 3JCMc 3EAEA 2XKOC 3PT9A 1VQ8A 3E9GA 3CCMA 3CCEA 4ZGEB 1VQ6A 1W2BS 3QXEB 3ER0A 4C0GA 2QQSA 3PIOA 4ELZC 2HAXA 3OSSC 2JZ2A 4CI0C 5D6XA 4EMKC 2XD0A 2XHCA 5CO7A 1D3BB 2BUDA 4KBMB 1KHIA 3HKSA 2K3XA 2CYZB 2RHUA 3LX7A 4FU6A 4L5GA 4XU1A 4C92E 4QVCA 5GAN4 1YJWT 1Q82U 4C8QE 1K8AU 2R58A 3VUZA 2X4XA 3V8LA 4OMFB 3OA6A 1UGPB 1RI0A 1YHQT 2DTOA 5C0MA 1WPYA 3A5ZB 4C92C 4J7IA 4M7AC 4X9DA 3V8KA 3MP6A 2RHZA 5CIUA 4C5IA 2XIDA 2YHTA 4C8QC 2PQWA 1PSFA 2DTIA 2LT4A 4C0DB 3M54A 4HT9A 2RB6A 5LJ3e 4BI8B 2DTHA 4RG2A 3FEOA 4M78F 2XDDA 3OYEA 1VQNT 5GANd 3G4SA 4O5VA 4IURA 4M78G 3BDLA 3RKWA 1XNIA 3G6EA 5GMKj 5DLOA 1VQLA 3L42A 2WACA 1UGRB 1R8OB 1Y7XA 3RESA 5FRNA 2ZPHB 1SSFA 3LW5E 4QQGA 1W2BA 1NPRA 5GANj 1KD1U 4JS4A 3JCMJ 1VQ9A 2EAYA 1N6AA 2XDBA 5GMKm 1U8RA 1VQOT 2ZPFB 2DIGA 3OB9A 4HA8A 4X34A 2ZGWA 4IUTA 4C92A 5IAYA 3OYBA 4M7AA 4M7DB 1VUBA 1YITT 1Y96A 2LCCA 2RJDA 2E12A 4M7AD 4UC4A 2FHDA 1B34B 1G3SA 2DAQA 1M90C 5KCHA 2K5FA 3QHSA 1KG1A 4HCCA 3F70A 3E9FA 4ZN3A 1QP2A 1K9MC 3KXTA 3C4SA 4JUVA 3A8MB 4OGCA 3QUIA 4M7DF 5J3BA 1VIFA 5GMKh 1XOVA 3JB9D 2GFAA 3L2ZA 1VQKA 3CCJA 5EG2A 3RMSA 1BIBA 3JCMb 3CBMA 4E7KA 2X4JA 3JRZA 2WSFE 3JSCA 5GANh 4PL6A 2JNGA 3QZ5B 4OGEA 5CKEA 3RMQA 4M77D 1BI1A 1W4SA 1Q82C 4FSXA 4L59A 3M5AA 1K8AC 3LLRA 2OTJA 1VQ5A 1D3BA 2VGNA 4OB1B 4DQ2A 2HQEA 4M7DE 3TCJA 2EIFA 3ZBDA 4J7FA 4A4FA 3JCMX 4QQ6A 3ME9A 4VUBA 4O6JA 3CC7A 5FLXE 2EJFA 3LH0A 4N4GA 4BY6B 4ZGDB 2VYTA 3OYIA 2PUOB 3PMTA 1QVFS 2CKKA 4M7DC 1M9SA 2QEXA 3JCMe 3NFCA 2KAFA 2L3RA 4M75D 2F69A 4OP0A 2M0OA 3QYGB 3PMIA 5LJ5d 3QO3A 5LJ3d 2EJGA 5FROA 2XK0A 3VKIA 2BKDN 3CBPA 5GAN5 5FU6C 1KQ1A 1U1TA 2LDMA 3E19A 4BDZA 2KVQG 3OYHA 1JB0E 4XAXB 4XK8E 3OYLA 5HK0A 2V8IA 3QKJA 1KD1C 5LJ5j 3OYMA 4GY5A 5GAMe 3CMAT 1YBYA 2RHYA 2YRVA 3MEWA 2GF7A 1WQ7A 3X24B 5GAMf 3GF5A 2GFUA 3MP8A 3SB2A 2QA4T 2M9UA 4XTYA 1LJOA 3OMCA 5A0GA 3CCRA 2E6ZA 4MZPA 3CC2T 3J81E 1BI2A 2FB7A 5C6SA 2L5QA 3JB9I 3CBOA 1NJIU 5CKBA 3VJPA 4Z02A 4RKUE 2A7YA 2DZCA 4F7UE 3QJ6A 4M77E 4IUVA 5A0DA 4BDYA 3CCET 4M7DA 2A3LA 2Y4XA 4C8QB 3FC3A 4LDYA 2BIVA 3M55A 2RK2A 5D6WA 2O01E 4HCZA 4HT8A 1B34A 3N5BB 4BI4A 5GAOn 1I5LA 4KUDK 3S3NA 4M77C 2MWOA 2P4TA 4JS5A 5HK3A 3QG1A 3CCQA 4C8QF 3OYAA 3JCMW 4C92G 5LJ3g 4M7AG 2LTOA 5LJ5h 3RERA 3CCUA 2OTLA 3OY9A 5FU7B 3HHTB 3OS1A 2XU8A 4YTLA 4II1A 3DB3A 4LDUA 4NL3A 1VQPT 5CKHA 3WVEB 2D6FA 3NTIA 2KK4A 3I55A 2QQRA 3JB9J 3L2WA 1YIJA 1OYXA 4QW2A 3JCMP 3HRUA 2V8KA 4ZTJA 3HSBA 3GP8A 1H3ZA 1JBMA 5L8RE 1VQLT 3VU3C 4PJOD 4C0FA 4E7IA 3TEEA 4B9XA 5J26A 2E65A 2HNIA 1I4K1 1V29B 4JLGA 2MI6A 3TREA 3OYDA 1VQMA 5IT9E 4MMLA 3SWNC 1KC8U 3JCMd 4EDUA 2QDYB 4IUQA 3GNFB 4JRPA 1UEBA 2EQJA 2XG8D 3M57A 1BIAA 2RHIA 3HPWA 4IUPA 1YJNA 5DLQE 2V8JA 3OQ5A 2E6NA 4PJOB 5D6YA 3INZA 4RCCA 4C0ZA 3OS2A 4BUGA 3CCST 3NTKA 3DLLA 5GAN7 4FT4A 5CAIA 4RG8A 2VUBA 3V8JA 2PVGB 1DJ7B 2E10A 4EMKA 1K73C 2EQUA 1WJQA 4X9CA 3OYFA 2VGMA 2KQWA 3M9QA 4J6XA 3CEYA 3X26B 1NJIC 4PJOF 1G3YA 4LDVA 4C5GA 1S72T 2DZ9A 4PNOA 5FU7C 1UGSB 4RMOA 2K57A 1KQSS 1VQKT 3L2UA 3CCJT 1M1KU 1O75A 1Y71A 3C94A 2LRQA 4MZTA 2L89A 2ZPGB 4HKEA 3OYYA 4D6WA 4C8QA 4Y91A 2X4YA 3BW1A 3FDRA 5KE2A 5GMKl 5KCOA 3CCLA 3LYIA 1VQ5T 4J83A 4XU0A 2EYQA 2LNVA 5FU6B 4PJOE 4KT0E 3WXMB 4BI3A 3UDCA 4J6YA 2MF2A 4J6WA 3FB9A 5CKFA 1WNLA 2GQVA 3META 1X6OA 4XTUA 3JCMg 2EQKA 3CC7T 2JOYA 3RIRA 2LQKA 2R5AA 3JCMh 3GIBA 4A54A 3SDZA 1ZBXA 4M7DG 4PJOC 5GAOr 1Q7YU 1WJRA 2QEXT 3UPUA 1M1GA 1VQNA 2LQ8A 4JJNK 1VQ4T 4LDXA 1YI2A 2K5LA 4XQ3A 2WSEE 2F5TX 5GAMg 4A4KA 4FT2A 2P0QA 3E1SA 3V7RA 3M4YA 2KDSA 3SFMA 3QSUA 4IKFA 1Y07A 3O8VA 2AHJB 3X25B 2DJZA 3MCAB 1KQSA 2DD5A 4XTVA 1KC8C 2VC8A 3PTAA 1YJ9A 2RI2A 1BI3A 4F7UB 4M77B 3GNGA 3CCRT 2RJEA 3PNWC 4E7JA 1WJSA 4PKCC 1QVPA 1OZ3A 2HQXA 1G5VA 4KULA 4ELYC 3JB9F 2MWPA 2LT1A 3FIFA 3VUBA 4PJOA 2I2LA 3C12A 2F5KA 4OVAA 4LD9K 4J8OA 4ZTFA 3AHUA 3EFRA 4F7UF 2EKOA 3H8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8K A;  4M7A C;  4C8Q C;  2YHT A;  2DTI A;  4C8Q F;  3JCM W;  5I21 A;  1TH7 A;  4M78 C;  2E64 A;  2RB6 A;  4M75 B;  2DTH A;  4C92 G;  4M78 F;  5LJ3 e;  5LJ3 j;  5LJ3 g;  5LJ5 h;  1WQW A;  3RER A;  4JLI A;  5GAM h;  3HFN A;  5GAN d;  3RUX A;  5DY9 A;  4M78 G;  3RKW A;  5GAN 2;  4NL3 A;  4JRI A;  5GMK e;  5GMK j;  3JB9 J;  2FYK A;  2EJ9 A;  2RA2 A;  3RES A;  4N0A A;  3BY7 A;  3JCM P;  1LNX A;  4A53 A;  4HT9 A;  1HK9 A;  4M75 F;  3SWN B;  3HSB A;  1JBM A;  5GAN g;  5GAN e;  4QVD A;  5GAN j;  5GAN f;  4XTX A;  3VU3 C;  3JCM J;  4PJO D;  2EAY A;  5GMK m;  2E65 A;  3JB9 G;  4NOY A;  4XTW A;  2HNI A;  2RM4 A;  1I4K 1;  4C92 D;  2E41 A;  4M7A D;  4MML A;  4HA8 A;  4WF2 A;  4C92 A;  4M7A A;  2ZGW A;  4M7D B;  1U1S A;  3SWN C;  3JCM d;  1Y96 A;  4F7U G;  1BIA A;  4M77 G;  4XTZ A;  3V7S A;  4M78 A;  1B34 B;  4M75 E;  4PJO B;  3INZ A;  4RCC A;  3QHS A;  2DEQ A;  5LJ3 h;  4C8Q G;  1I81 A;  1HXD A;  1N9R A;  4EMH A;  3PGG A;  5GAN 7;  2VXF A;  4JUV A;  5CAI A;  3QUI A;  3V7C A;  2Y90 A;  3V8J A;  4M7D F;  5GMK h;  2E10 A;  2JN0 A;  3JCM f;  4EMK A;  5GMK i;  4M75 C;  4X9C A;  1LOJ A;  3JB9 D;  3L2Z A;  4J6X A;  1M8V A;  3JCM Q;  1YCY A;  1BIB A;  3BDU A;  4PJO F;  3JCM b;  1JRI A;  2DZ9 A;  4PNO A;  2YLB A;  3RKX A;  4M75 G;  5GAN h;  3GIB A;  2K57 A;  4M77 D;  4MMK A;  4EMK B;  4F7U A;  4M77 A;  3JCM V;  1D3B A;  4C8Q D;  4DQ2 A;  1X01 A;  4M7D E;  4M78 D;  4C8Q A;  4Y91 A;  2YLC A;  3BW1 A;  5GMK l;  3JCM X;  5GAN 3;  1KQ2 A;  2VXE A;  2EJF A;  2DVE A;  4XU0 A;  5GAO m;  4PJO E;  4J6Y A;  4J6W A;  3FB9 A;  4M7A B;  4C92 B;  4JRK A;  4XU2 A;  1WNL A;  2DXT A;  4M7D C;  4V2S A;  4XTU A;  3JCM g;  3JCM e;  1Y96 B;  4M75 D;  3RIR A;  4OP0 A;  3BFM A;  3JCM h;  3QO3 A;  4M78 B;  5LJ5 d;  5LJ3 d;  2EJG A;  4J5Y A;  4M75 A;  1H64 1;  4A54 A;  5GAM d;  5GAO l;  5GAN 5;  3EFS A;  5GAO r;  4M7A G;  3RKY A;  4M7D G;  5GAN 6;  4PJO C;  1KQ1 A;  1U1T A;  3JB9 H;  1M5Q 1;  3L1A A;  2RD1 A;  4C92 F;  4M7A F;  4PJO G;  2DKG A;  4RCB A;  2QTX A;  4EMG A;  4XQ3 A;  2DXU A;  5LJ5 g;  5LJ5 j;  5LJ5 e;  3M4G A;  5GAM e;  1I8F A;  5LJ5 f;  5GAM j;  5GAM g;  5LJ3 f;  5GAM f;  1WQ7 A;  3SWN A;  3JCM c;  5GAN 8;  3V7R A;  3SB2 A;  4XTY A;  1LJO A;  2DJZ A;  2FB7 A;  1N9S A;  4XTV A;  4XU3 A;  3JB9 I;  2VC8 A;  4EMK C;  4F7U B;  4M7D D;  4M77 B;  2DZC A;  1D3B B;  4N0A C;  4F7U E;  4M77 E;  4XU1 A;  4C92 E;  5GAN 4;  4M7A E;  4M7D A;  4NL2 A;  2CGH A;  4QVC A;  4C8Q B;  3JB9 F;  4C8Q E;  2E1H A;  2EWN A;  3QSU A;  3V8L A;  3FIF A;  4M78 E;  4HT8 A;  1B34 A;  3FJP A;  5GAO n;  4PJO A;  1I5L A;  2I2L A;  5GAO p;  5GAO q;  2DTO A;  3AHU A;  3HFO A;  4M77 C;  1WPY A;  3EFR A;  4C92 C;  4F7U F;  1MGQ A;  4M77 F;  4X9D A; 
#chains in the Genus database with same CATH topology
 3FLG A;  5I21 A;  1Z9Z A;  2KT1 A;  2MYS A;  4A63 B;  3URG A;  3EG1 A;  1M1K C;  1T3L A;  1T3S A;  4LNP A;  5GAN 2;  5EC7 A;  3CCQ T;  3THK A;  4OMP A;  3BY7 A;  5IHI A;  3DLM A;  1PWT A;  1QQJ A;  4ZN1 A;  3EHR A;  2KEA A;  4C92 D;  2JTM A;  2ROL A;  3OS5 A;  1Q81 U;  5L23 A;  1B07 A;  3FJ5 A;  1WX6 A;  3A8G B;  4M75 E;  3GBQ A;  5LJ3 h;  3O5Z A;  1ABO A;  1QP3 A;  4CRI A;  4EMH A;  1YJN T;  1TG0 A;  3CXC S;  2H8H A;  2OTJ Q;  1SRM A;  1JRI A;  4E7H A;  1WHH A;  2YLB A;  1YN8 A;  2JTF A;  4LXC A;  2RO0 A;  2EYX A;  1JJ2 A;  4M77 A;  4M78 D;  3CC4 A;  3QZ9 B;  2R57 A;  8AT1 B;  5A0L A;  1M3A A;  2H3E B;  2J7I A;  1OQK A;  2RI5 A;  2CZ1 B;  4Y28 E;  1WHL A;  2A36 A;  4RTT A;  1CSK A;  1XTD A;  3OSV A;  1RAE B;  1EIF A;  4PJJ A;  1TSF A;  4RCB A;  1VQP A;  5LJ5 e;  2QXF A;  2OTJ T;  1YJW A;  4JDS A;  3BE3 A;  3C95 A;  4M7D D;  4N0A C;  2RF0 A;  1UUE A;  2FZC B;  4NL2 A;  2HZY A;  2E1H A;  4TVR A;  4FCY A;  4M78 E;  4R56 A;  3UWN A;  1PRL C;  3FJP A;  3QDR B;  3HFO A;  3LWI A;  2CZ6 B;  2M0Y A;  2QAZ A;  1OV3 A;  3AT1 B;  3TVT A;  3RUX A;  1XQH A;  1N8R C;  2CS7 A;  3S6W A;  1S72 A;  1NE8 A;  2ABL A;  2K4Y A;  2RA2 A;  2D1X A;  4KH0 B;  3QYH B;  4N0A A;  1Q86 C;  2MK5 A;  2YUP A;  4WCI A;  2HL3 A;  2DL4 A;  2DPP B;  4QVD A;  3VS4 A;  3M53 A;  3TSW A;  3HRS A;  2CP7 A;  2E41 A;  2KI7 A;  3MEA A;  3Q1J A;  3CC4 Q;  4EPC A;  4GLM A;  2ED1 A;  2DEQ A;  1M3C A;  3PFS A;  2EFI A;  5GMK i;  1TWB A;  4M4Z A;  2YRC A;  4D8K A;  1ZQ1 A;  2FVU A;  3T9N A;  3FRN A;  4P5N A;  1YJW Q;  1IZ6 A;  5M9O A;  2X3W D;  3JCM V;  1BI0 A;  3HTR A;  1X6G A;  1TUG B;  3MHX A;  2DVE A;  2YT6 A;  4X1V A;  4M7A B;  1HJD A;  2QG9 B;  2HEQ A;  2K2M A;  1K4U S;  1X69 A;  3CC4 T;  1HD3 A;  1IRE B;  2COZ A;  4BY6 C;  4HCB A;  1GCQ C;  2KRM A;  4C92 F;  2LCL A;  2DXU A;  5GAN 8;  2DRK A;  4OML A;  3PT9 A;  3CCE A;  1VQ6 A;  3QXE B;  2K9G A;  2HAX A;  2O2O A;  3OSS C;  2JZ2 A;  1C0M A;  5D6X A;  5C0M A;  1GCP A;  4XU1 A;  5GAN 4;  1YJW T;  1KFZ A;  1Q82 U;  1K8A U;  1IB8 A;  2R58 A;  2X4X A;  3V8L A;  2QAS A;  1E6G A;  1WPY A;  4M7A C;  3MP6 A;  1PD1 A;  4C8Q C;  4DBQ A;  2PQW A;  2CP5 A;  1RAI B;  2RB6 A;  5LJ3 e;  4M78 F;  3OYE A;  2LJ3 A;  5GAN d;  4CC7 A;  3G4S A;  2CT3 A;  1ZX6 A;  1UGR B;  1R8O B;  1Y7X A;  1RLP C;  2ZPH B;  2KXC A;  4QQG A;  1D09 B;  1N6A A;  4HA8 A;  4M7A A;  1K76 A;  1VUB A;  2FO0 A;  2FPF A;  4OMQ A;  4UC4 A;  2DAQ A;  1M90 C;  5KCH A;  4HCC A;  3E9F A;  4JUV A;  3A8M B;  4OGC A;  1PD0 A;  4M7D F;  2QA4 Q;  1XOV A;  4DEY A;  3CCJ A;  3RMS A;  4E7K A;  3CCE Q;  4M77 D;  2DLP A;  3EG3 A;  2K7A A;  2HQE A;  1GBQ A;  3EGX B;  4J7F A;  3ME9 A;  1UHF A;  1UJY A;  1WXU A;  3LH0 A;  2RNA A;  1T0J A;  2CKK A;  3NFC A;  4RTU A;  4OP0 A;  2M0O A;  3PMI A;  2RQV A;  2JS0 A;  5LJ3 d;  1LCK A;  1E7O A;  5GAN 5;  1D1C A;  1AWO A;  1JB0 E;  4F04 B;  5HK0 A;  4LUE A;  1SG5 A;  5LJ5 j;  4GY5 A;  3MEW A;  4WTO B;  3MP8 A;  2QA4 T;  4XTY A;  2ATC B;  5A0G A;  4MZP A;  1BI2 A;  3JB9 I;  1NJI U;  2RMO A;  5CKB A;  3VJP A;  8ATC B;  4M77 E;  3CCE T;  4BDY A;  2K3B A;  2BIV A;  3M55 A;  5D6W A;  4BI4 A;  4KUD K;  5HK3 A;  2GTO A;  2L0A A;  1PKS A;  4HVU A;  3CCJ Q;  5FU7 B;  3HHT B;  4HXJ A;  4YTL A;  2O31 A;  4LDU A;  1KD1 R;  5CKH A;  1M3B A;  1YIJ A;  1M2O A;  4ZTJ A;  1ZLM A;  3EGX A;  3VU3 C;  4PJO D;  4C0F A;  5J26 A;  2E65 A;  2MI6 A;  4MML A;  4B6M A;  4R0K A;  3SWN C;  1KC8 U;  2QDY B;  4IUQ A;  3GNF B;  3M57 A;  3HPW A;  3CPW P;  1UJ0 A;  3INZ A;  4C0Z A;  1VQ4 Q;  1IXD A;  3DLL A;  1NM7 A;  1F1B B;  2PVG B;  2E10 A;  3VS2 A;  3M9Q A;  2KQW A;  4J6X A;  1MMN A;  2DZ9 A;  5FU7 C;  3I9Q A;  2L2P A;  2PTK A;  3CCJ T;  1M1K U;  2GTJ A;  2ZPG B;  2YUN A;  1QVG P;  5GMK l;  3CCL A;  2NUZ A;  4PJO E;  5FU6 B;  4BI3 A;  3UDC A;  4J6Y A;  2MF2 A;  2EKH A;  5CKF A;  3I35 A;  3MET A;  3JCM g;  2JOY A;  3RIR A;  3JCM h;  3GIB A;  3SDZ A;  2ECZ A;  1BCO A;  5GAO r;  3UPU A;  1VQ8 Q;  2VB6 A;  1M1G A;  4AG2 C;  4LDX A;  1VQ4 T;  1YIJ Q;  3SFM A;  4EIK A;  3H0H A;  3X25 B;  2DJZ A;  4XTV A;  2VC8 A;  2LP5 A;  1YJ9 A;  1RUW A;  2HKQ B;  2RJE A;  4E7J A;  1QVP A;  2KNB B;  2YSQ A;  2V1R A;  2MWP A;  4Z89 A;  2LT1 A;  1G2B A;  4LD9 K;  1AWJ A;  4ZTF A;  3AHU A;  4M77 F;  3H8Z A;  2CP6 A;  4DOW A;  3G6E Q;  5LJ3 j;  4HVV A;  1WQW A;  2P0K A;  3QWX X;  3J80 E;  3OBW A;  3UA7 A;  4DEX A;  1SPK A;  1VQ8 T;  2OI3 A;  2ZPB B;  5GAN f;  1M4Z A;  1YIJ T;  3QII A;  1V76 A;  4NOY A;  4A4E A;  3CCL Q;  4M7A D;  2M16 A;  5ECA A;  2PVD B;  2GCX A;  2JM9 A;  3TU4 K;  1UEC A;  4R55 A;  2P84 A;  2KGT A;  4PFO A;  3NPF A;  4C8Q G;  3EGU A;  3J7A F;  2H3J A;  3PGG A;  4C5E A;  1G3W A;  1YCY A;  3G6E T;  2A08 A;  2DO3 A;  2G3R A;  3P8B B;  1BYM A;  1QW1 A;  2K2V A;  2HSP A;  2MPX C;  2K79 A;  2HSE B;  2PNI A;  2R5M A;  3CC2 A;  4MMK A;  1RAG B;  2F1L A;  1N8R U;  3MEU A;  2K6D A;  1W2B P;  2YLC A;  5GAN 3;  4JRQ A;  2M51 A;  1FYN A;  1Q86 U;  3WVD B;  3PVL A;  3CPW S;  2HMA A;  3ZEH A;  5CVI A;  2P4R A;  3CD6 A;  3CCL T;  1ABQ A;  3ZL7 C;  3QBY A;  4J5Y A;  2JW4 A;  3TQ7 P;  3EFS A;  1QCN A;  2KT8 A;  1AOJ A;  1MHN A;  3SD4 A;  4RTY A;  2RD1 A;  2JS2 A;  1W70 A;  3CXC A;  1UDL A;  5LJ3 f;  1GBR A;  2OX7 A;  4FW1 A;  1QVG S;  2D0Q B;  2RQU A;  4QT7 A;  1RAC B;  2QQ9 A;  4Y92 A;  2DIQ A;  1NG2 A;  2CGH A;  3A8O B;  4OMM A;  5CQX A;  2EWN A;  1X6B A;  3UT1 A;  3OS0 A;  1YJ9 T;  3QSU A;  1RAA B;  2CSQ A;  4N4I A;  5GAO p;  1U06 A;  4RTW A;  2O4X B;  2GBQ A;  1X27 A;  5GJW B;  3LGL A;  3CCS A;  1TH7 A;  5IXF A;  2Y4Y A;  5CQY A;  4ME7 A;  5GAM h;  2IG0 A;  5DY9 A;  2OAU A;  2GGR A;  1LNX A;  4A53 A;  3KUF A;  1HK9 A;  5HY6 A;  5I2M A;  1VQO A;  5GAN g;  2J6O A;  2DXC A;  2PU9 B;  2QK0 A;  1PCX A;  1GRI A;  1YIT A;  3EFO B;  5IH2 A;  1M8M A;  1Z9Q A;  3VRZ A;  5AYF A;  3VYH B;  1TS9 A;  1O9S A;  4F7U G;  4XTZ A;  1YWO A;  2KRN A;  2PVO B;  1QVF P;  2IVW A;  1I81 A;  1M1F A;  2PUK B;  2NLU A;  3A8L B;  4LDW A;  2VAS A;  5KH6 A;  2EQM A;  3JCM Q;  2XDP A;  1PSE A;  4M75 G;  3SEM A;  1GFC A;  3LGF A;  2LC4 A;  1OPL A;  5CR2 A;  1VIE A;  4J9F A;  1QCF A;  2JUF A;  1OUL A;  1AVZ C;  1Q82 R;  2HD0 A;  2P0P A;  4FYY B;  2DXB A;  2KXD A;  3UF4 A;  2WSC E;  1ARK A;  2FZG B;  2DXT A;  1ZSZ B;  2O4X A;  1Y96 B;  2QI2 A;  4CC3 A;  2COW A;  1QVF A;  3CD6 T;  1OU9 A;  4BB7 A;  4OF1 A;  2C06 A;  4BAC A;  1SF9 A;  2X4W A;  4M7A F;  5J39 A;  1M90 U;  1MUZ A;  1KK7 A;  4FM4 B;  2DRM A;  3EH2 A;  2L3P A;  1I8F A;  3EAE A;  3CCM A;  1VQO Q;  1W2B S;  2I0N A;  4C0G A;  3PIO A;  2QQS A;  4ELZ C;  3EFO A;  2EW3 A;  1YIT Q;  2AK5 A;  4FSS A;  5CO7 A;  1D3B B;  4KBM B;  2CP0 A;  4C92 E;  3E2U A;  2DL5 A;  3VUZ A;  4OMF B;  1M27 C;  1K1Z A;  1RI0 A;  3A5Z B;  4AFS C;  4J7I A;  1ZSZ C;  2XID A;  2YHT A;  1PSF A;  4RG2 A;  3NHN A;  3FEO A;  2BE7 D;  1CKA A;  2SEM A;  4IUR A;  2RPN A;  3BDL A;  4M78 G;  1XNI A;  2BZY A;  1TXQ A;  2HQH A;  3L42 A;  2F2W A;  3RES A;  3LW5 E;  1PNJ A;  2BZX A;  2AZS A;  1VQ9 A;  2EAY A;  1NYF A;  1VQO T;  2EPD A;  1J3T A;  1E6H A;  2DIG A;  4X34 A;  1I0C A;  1ZSZ A;  2HKN A;  5KYN A;  1YIT T;  1Y96 A;  2LCC A;  2QDL A;  2FHD A;  1B34 B;  4ZN3 A;  2QGF B;  1K9M C;  4KGX B;  3EG9 B;  1VQK A;  4PK4 A;  3CBM A;  2X4J A;  3JRZ A;  3QZ5 B;  1K73 R;  2VWF A;  1BI1 A;  1W4S A;  1MND A;  1M2V B;  1W1F A;  1NJI R;  1VQ5 A;  1D3B A;  4M7D E;  2DYB A;  4VUB A;  1CKB A;  3CC7 A;  5FLX E;  4RTX A;  1IGQ A;  1MMD A;  4BY6 B;  4PJM A;  2VYT A;  1QWE A;  3OYI A;  2ROT A;  2RQT A;  1QVF S;  4AMC A;  2KAF A;  5LJ5 d;  5FRO A;  1VQP Q;  4BDZ A;  2DET A;  3OYL A;  3H0I A;  1KD1 C;  3VS3 A;  1QWF A;  5GAM e;  3NMZ C;  2GFU A;  3OMC A;  2E6Z A;  2A37 A;  1C1A A;  4LE9 A;  4Z02 A;  4RKU E;  2DZC A;  3QJ6 A;  3R6N A;  4C8Q B;  3FC3 A;  4HCZ A;  4HT8 A;  1B34 A;  2JTE A;  5GAO n;  3S3N A;  2DIL A;  4E7S A;  2P4T A;  4JS5 A;  2EGA A;  3EG9 A;  1QKW A;  1S72 Q;  3OYA A;  3JCM W;  1JXM A;  1NEB A;  2LTO A;  3OY9 A;  2NYS A;  1VQK Q;  3OS1 A;  2CH4 W;  4NL3 A;  1VQP T;  2D6F A;  3WVE B;  3NTI A;  1I1J A;  2QQR A;  3I55 A;  3L2W A;  1M2V A;  4QW2 A;  3HRU A;  3HSB A;  1VQ5 Q;  4Z88 A;  1JBM A;  5L8R E;  1AWW A;  2FG0 A;  1RAB B;  4B9X A;  1RI9 A;  1V29 B;  2LZ6 B;  3TRE A;  1D0X A;  5IT9 E;  1GCQ A;  4JRP A;  3KFV A;  4IUP A;  1YFN A;  5DLQ E;  4PJL A;  2E6N A;  1TU0 B;  3NTK A;  2ENM A;  5GAN 7;  4FT4 A;  2PZ1 A;  2CUB A;  3X26 B;  1S72 T;  1G3Y A;  3C0C A;  4LDV A;  4PNO A;  3OW2 P;  3CQT A;  1VQK T;  2CT4 A;  1Y71 A;  4HKE A;  4D6W A;  1KJW A;  4C8Q A;  4Y91 A;  2X4Y A;  2KRS A;  1VQ5 T;  2DX1 A;  4J83 A;  2EYQ A;  2LNV A;  4KT0 E;  3FB9 A;  2EYY A;  1WNL A;  1X6O A;  4XTU A;  3CC7 T;  2O9V A;  2LNH B;  1ZBX A;  1FMV A;  1WJR A;  2M02 A;  4AFZ C;  1XJW B;  2MOX A;  3MPU B;  2F2X A;  1VQN A;  1VQ6 Q;  3QWY A;  3I55 Q;  4A4K A;  4FT2 A;  4IKF A;  2AHJ B;  3M0R A;  1ZUY A;  3PTA A;  1BI3 A;  4F7U B;  3PNW C;  4PKC C;  1OZ3 A;  1OX8 A;  2LX7 A;  4KUL A;  1VA7 A;  5KYY B;  1Y57 A;  3IQL A;  2EYW A;  1ACM B;  2V1Q A;  2F5K A;  3C12 A;  2EKO A;  3L2Q A;  3G4S Q;  3JV3 A;  1EZZ B;  2AT1 B;  4JJB A;  3I56 A;  2MAM A;  4M75 B;  3M0P A;  2QQB A;  5DM7 R;  2OJ2 A;  4PLI A;  2XIC A;  4D8D A;  4PFZ A;  2O88 A;  5KYW B;  3CME A;  2B8A A;  2X9H A;  3SWN B;  1VQ6 T;  4HCK A;  4ESR A;  1SRL A;  5HCK A;  4OMN A;  3I55 T;  1GXI E;  4XTW A;  1UB4 A;  4OB2 B;  4KH1 B;  2RHX A;  1G8X A;  3ASK A;  1D0Z A;  3A8H B;  2K5I A;  3MO8 A;  1VYV A;  5IHN A;  1Q7Y C;  1PM3 A;  3M0T A;  1T0H A;  4JJC A;  2AKK A;  2ZAE A;  3L2R A;  2NUP B;  1HXD A;  2CRE A;  1FMK A;  2VXF A;  1MV0 B;  2Y90 A;  4M75 C;  1LOJ A;  3G4S T;  2KE9 A;  4Z8A A;  1WI7 A;  2HBW A;  1NZ9 A;  1OEB A;  5CK9 A;  4ANJ A;  3CCV A;  4OB0 B;  3QJY A;  4F7U A;  2HBP A;  2A0F B;  2KRO A;  4A4G A;  5KYY A;  2KBT A;  2RJF A;  4MDX A;  4L6V 5;  1PHT A;  2W10 A;  1MV3 A;  3VS1 A;  4M78 B;  3HRT A;  4M75 A;  2XI9 A;  4PJN A;  1M5Q 1;  3L1A A;  2DD4 A;  4PJO G;  2LX9 A;  3OW2 S;  4C5H A;  1V1C A;  2QTX A;  3VV0 A;  4EMG A;  5KYW A;  3M4G A;  3M0Q A;  4E6R A;  5LJ5 f;  5GAM j;  2RJC A;  2RQW A;  3CME Q;  3SWN A;  2YWW A;  1H8K A;  4PLL A;  1N9S A;  4XU3 A;  2CDT A;  1RAF B;  2GQI A;  2JM8 A;  1C6V X;  4QVZ A;  5IHK A;  2CZ0 B;  4AFQ C;  4AFU C;  2RK1 A;  2DA9 A;  3CPW A;  3M56 A;  2V26 A;  3MP1 A;  3NTH A;  2DER A;  5GAO q;  2NUP A;  1P92 A;  1B3Q A;  2DJQ A;  1HSQ A;  1TTH B;  4F17 A;  4M78 C;  3DB4 A;  5CCA A;  3X20 B;  4QQD A;  1U3O A;  2DL7 A;  2JMC A;  2D9T A;  3M59 A;  3I56 T;  4JRI A;  4HVW A;  4LN2 A;  1UGQ B;  4JZ4 A;  3CCV Q;  5CKD A;  4C0D C;  1JO8 A;  1Q81 R;  1QVG A;  1WLP B;  1OZ2 A;  2VKN A;  2OAW A;  3CME T;  3PIP A;  2FEI A;  2RH2 A;  3JB9 G;  4JJD A;  5FWB A;  1H92 A;  2J6F A;  4J9I A;  2DVJ A;  3EG0 A;  4M78 A;  2K3Y A;  2XMF A;  1OX9 A;  4B9W A;  4PFP A;  1M90 R;  2E5K A;  1M8V A;  3QPH A;  4RTZ A;  3BDU A;  2ZPI B;  2FPE A;  2QQA A;  1PC0 A;  3OYN A;  3OYK A;  2AIR B;  4EMK B;  1FXX A;  3NGP A;  4C8Q D;  1AHJ B;  4LD6 A;  2FL7 A;  2JVV A;  3CCV T;  1WIE A;  1KQ2 A;  2ZCF B;  1NYG A;  1YWP A;  1RAH B;  2ZZD A;  1K0X A;  4KUI A;  4V2S A;  1NLP C;  2YRD A;  3KBG A;  4DBH A;  2D8H A;  1H64 1;  6AT1 B;  3CMA A;  1G5V A;  2MMP A;  2ZPE B;  3JAM E;  1N5Z A;  3G7Z A;  1TUD A;  4IIM A;  2QGG A;  2IPO B;  3D7S B;  4FIB A;  4GBQ A;  5LJ5 g;  1K9M U;  5FW9 A;  3GOX A;  1YJ9 Q;  5HKC A;  3JCM c;  2XKO C;  3ER0 A;  2C0I A;  4EMK C;  2SRC A;  2BUD A;  1KHI A;  4FU6 A;  2K3X A;  2CYZ B;  2RHU A;  3H0F A;  4M7A E;  1G83 A;  4C8Q E;  1R0C B;  1WHK A;  1U5S A;  1WA7 A;  3V8K A;  4AG1 C;  4K11 A;  4C5I A;  1I07 A;  2XDD A;  3RKW A;  1VQL A;  3I5S A;  2COY A;  5FRN A;  1SSF A;  1W2B A;  1NPR A;  1KD1 U;  1JU5 C;  7AT1 B;  1KQS P;  1AZG B;  1VYU A;  2XDB A;  1RLQ C;  1PG5 B;  1IHV A;  2ZPF B;  5IAY A;  3EGD B;  2C0O A;  2K5F A;  3MJX A;  3QHS A;  1KG1 A;  3CMA Q;  3QUI A;  5J3B A;  5GMK h;  3CC2 Q;  2GFA A;  1UTI A;  5EG2 A;  3JCM b;  1BU1 A;  2MIO A;  2WSF E;  5GAN h;  2JNG A;  2DL3 A;  4OGE A;  5CKE A;  2OTJ A;  4L59 A;  4FSX A;  3M5A A;  1UE9 A;  3TCJ A;  4A4F A;  4J9D A;  3CD6 Q;  2EJF A;  2EGE A;  4N4G A;  4ZGD B;  2KYM A;  1M9S A;  2QEX A;  3JCM e;  2L3R A;  4M75 D;  3QO3 A;  2XK0 A;  2DNU A;  1KQ1 A;  1U1T A;  2LDM A;  3E19 A;  3OYH A;  4XAX B;  4F14 A;  4QKU A;  1ZA2 B;  4XK8 E;  1VQL Q;  3CMA T;  1YBY A;  2RHY A;  3X24 B;  1WQ7 A;  2AKL A;  3GF5 A;  2L3S A;  3SB2 A;  3CCR A;  3CC2 T;  3H9N A;  2FB7 A;  2L5Q A;  1K8A R;  3CBO A;  1MMA A;  1JJ2 P;  2A7Y A;  4F7U E;  3EG2 A;  5A0D A;  4IUV A;  1BBZ A;  1BCM A;  2Y4X A;  3EGD A;  2RK2 A;  4KRT A;  3CCS Q;  1WDX A;  3MKD A;  1I5L A;  5FWC A;  1UG1 A;  4M77 C;  2MWO A;  4J9B A;  1MMG A;  3RR6 A;  3H41 A;  4C8Q F;  2KR3 A;  4C92 G;  5LJ3 g;  4FYV B;  3RER A;  1ZUU A;  3CCU A;  2OTL A;  2XU8 A;  2X3X D;  3DB3 A;  2KK4 A;  3JB9 J;  1QKX A;  3EHQ A;  3REA B;  2YUO A;  2IIM A;  2V8K A;  1VQL T;  2EGC A;  2B86 A;  1I4K 1;  1VQM A;  3JCM d;  4EDU A;  2EQJ A;  2XG8 D;  2QEX Q;  1BIA A;  2RHI A;  2V8J A;  4PJO B;  5D6Y A;  3CCS T;  2FPD A;  3A1P A;  3V8J A;  2CSI A;  1DJ7 B;  3M0U A;  2YXY A;  1RAD B;  4JPB W;  1WJQ A;  3CEY A;  4RMO A;  3CCR Q;  1VOM A;  1WHM A;  1KQS S;  3L2U A;  3C94 A;  2HL5 C;  3OYY A;  3BW1 A;  3FDR A;  5KCO A;  3LYI A;  2QYZ A;  4XU0 A;  1UFF A;  2QTV A;  3WXM B;  4J6W A;  1TOV A;  2GQV A;  3VS5 A;  2EQK A;  2LQK A;  2R5A A;  2CUD A;  4A54 A;  1H3H A;  4M7D G;  4F16 A;  4PJO C;  1Q7Y U;  1UGV A;  1NBE B;  3A98 A;  2QEX T;  3CCU Q;  2OTL Q;  1SHF A;  3CCM Q;  4JJN K;  1YI2 A;  2LQN A;  3TSZ A;  2K5L A;  2WSE E;  1X2K A;  1WFW A;  5GJV B;  3M4Y A;  2KDS A;  1QMC A;  1Y07 A;  3O8V A;  1OU8 A;  1IRX A;  2DD5 A;  3VRY A;  1UHC A;  1X2Q A;  2BZ8 A;  3CCR T;  1KIK A;  1WJS A;  1VQM Q;  1HYO A;  1PRM C;  3FIF A;  4PJO A;  4DBF A;  4OVA A;  1PKT A;  5I22 A;  3EFR A;  4F7U F;  2E3H A;  1QP2 A;  2A28 A;  3SHW A;  3OYJ A;  4N4H A;  2LJ1 A;  3G1J A;  2HDA A;  3I5R A;  2E64 A;  4DBR A;  4MZM A;  4JLI A;  3CPF A;  3HFN A;  2VVK A;  4BE1 A;  4A4H A;  5GMK e;  3ULR B;  1VQ9 Q;  2FYK A;  4GLK A;  3CCU T;  2OTL T;  2EBP A;  4ZNX A;  3CCM T;  3GLX A;  1JJ2 S;  4M75 F;  1R0B G;  2O9S A;  2L8D A;  2E5Q A;  5GAN e;  5I11 A;  4XTX A;  1KC8 R;  4OB3 B;  1RL2 A;  2KSS A;  2RM4 A;  1WGS A;  3U23 A;  1VQ7 A;  1U1S A;  4ZGJ B;  1JXO A;  4NS5 A;  5I2S A;  1VQM T;  4MDW A;  1NLO C;  3G71 A;  1B7T A;  3RBB B;  2VV5 A;  1M30 A;  4RTV A;  3VS0 A;  1KHC A;  1YI2 Q;  1M1K R;  1MNE A;  1AD5 A;  4KGV B;  3RKX A;  2LQW A;  2QA4 A;  3CC7 Q;  3OYG A;  2D0N A;  4AT1 B;  4J9C A;  1VQ9 T;  2DF6 A;  1VYT A;  2RN8 A;  4FL6 A;  3VYG A;  5GAO m;  1AT1 B;  3S3M A;  4Q5W A;  3LWH A;  4XU2 A;  1KSW A;  3RNJ A;  4E7L A;  3BFM A;  5GAO l;  5GAM d;  1JQQ A;  1N27 A;  2Z0W A;  3REB B;  4BE2 A;  3GPL A;  3RKY A;  5GAN 6;  3JB9 H;  9ATC B;  1AWX A;  3M58 A;  1SHG A;  3ZFJ A;  2CZ7 B;  4IUU A;  3OMG A;  1K9A A;  3S3O A;  4FYW B;  1QCO A;  2G6F X;  1YI2 T;  1Q81 C;  2E70 A;  4LUD A;  3PE0 A;  3RDV A;  3R6O A;  2LVM A;  2L3Q A;  1YHQ A;  1NPP A;  1VQ7 Q;  1FWZ A;  1S1N A;  2W0Z A;  2RQR A;  3G71 Q;  1MGQ A;  5IN1 A;  4BD3 A;  2JMA A;  1G3T A;  2X35 A;  1D1A A;  2EYZ A;  5A2Q E;  3OBY A;  2FZK B;  1BKB A;  3L2V A;  3OW2 A;  3HP9 A;  1ZA1 B;  2DE0 X;  2EJ9 A;  3P8D A;  1IHW A;  2J05 A;  4E7Z A;  5LL6 S;  1LPL A;  1X75 C;  2RI3 A;  3QDF A;  3DKM A;  5KE3 A;  3H6Z A;  1ZBJ A;  4WF2 A;  2BE9 B;  1BK2 A;  4M77 G;  3V7S A;  2KY9 A;  2LMJ A;  1VQ7 T;  3VS6 A;  3VS7 A;  1OPK A;  2M1H A;  3P8H A;  1N9R A;  1ZHI A;  2KMT A;  3V7C A;  3PVQ A;  3X28 B;  2JN0 A;  3JCM f;  3G71 T;  1VQ4 A;  1N8R R;  2ESW A;  1K9M R;  3MEV A;  4DOV A;  3UA6 A;  1Q86 R;  3LH5 A;  1OI1 A;  1X01 A;  4E2F B;  1YHQ Q;  1K73 U;  2VXE A;  4E47 A;  1ZSG A;  4C92 B;  4JRK A;  2KYB A;  1FX7 A;  3OYC A;  5FRM A;  4J9E A;  1VQN Q;  4ATO A;  1WHJ A;  2DK3 A;  4BE0 A;  2DBM A;  3HL8 A;  2DKG A;  4DA4 A;  2JJ9 A;  1VQ8 A;  3E9G A;  4ZGE B;  2F2V A;  4CI0 C;  2XD0 A;  2XHC A;  3HKS A;  3LX7 A;  4L5G A;  4QVC A;  3I56 Q;  3OA6 A;  1UGP B;  2J6K A;  1YHQ T;  1WXB A;  2DTO A;  4C92 C;  2E4H A;  4X9D A;  2E3I A;  2RHZ A;  5CIU A;  2DTI A;  2LT4 A;  4C0D B;  3M54 A;  4HT9 A;  4BI8 B;  2DTH A;  1VQN T;  4O5V A;  3G6E A;  5GMK j;  5DLO A;  2YDL A;  2WAC A;  2DFU A;  2FRW A;  3UAT A;  5GAN j;  1WYX A;  4JS4 A;  3JCM J;  1K0S A;  4JZ3 A;  5GMK m;  1U8R A;  1EFN A;  3OB9 A;  4C92 A;  2FRY A;  2ZGW A;  4IUT A;  4M7D B;  3OYB A;  5IXB A;  2RJD A;  2BTT A;  2E12 A;  5AT1 B;  1G3S A;  2MCN A;  4OMO A;  3F70 A;  1FMW A;  3KXT A;  3C4S A;  4IIO A;  1VIF A;  1D0Y A;  3JB9 D;  3L2Z A;  4CC4 B;  4CC2 A;  1BIB A;  2LCS A;  1AEY A;  3JSC A;  4PL6 A;  3RMQ A;  1Q82 C;  1YP5 A;  3LLR A;  1K8A C;  1YCS B;  2VGN A;  4OB1 B;  1IGU A;  4DQ2 A;  1Q95 G;  2EIF A;  3ZBD A;  3JCM X;  2HCK A;  4QQ6 A;  4O6J A;  2GNC A;  2PUO B;  3PMT A;  2DBK A;  4M7D C;  2F69 A;  3QYG B;  1QLY A;  2EJG A;  4J9G A;  2ED0 A;  3VKI A;  2BKD N;  3CBP A;  2LJ0 A;  5FU6 C;  2KVQ G;  2EQI A;  2V8I A;  3QKJ A;  2J06 A;  4ORZ A;  3OYM A;  2YRV A;  2GF7 A;  5GAM f;  2M9U A;  1LJO A;  3J81 E;  2X51 A;  5C6S A;  3M0S A;  2CP2 A;  4J9H A;  1A0N B;  4M7D A;  2A3L A;  2DM1 A;  4LDY A;  2EVR A;  2O01 E;  3N5B B;  2AZV A;  2DYI A;  2YUQ A;  3QG1 A;  3CCQ A;  5D7U A;  1OOT A;  4M7A G;  1WXT A;  5LJ5 h;  2JXB A;  4II1 A;  2D8J A;  3CXC P;  5KYU B;  1OYX A;  1BB9 A;  1SSH A;  3JCM P;  3GP8 A;  1H3Z A;  1EX4 A;  1W6X A;  2NUT B;  1GL5 A;  4E7I A;  3TEE A;  1TUC A;  2HNI A;  4JLG A;  3OYD A;  5KYX B;  4FW2 A;  2DEU A;  1UEB A;  1GFD A;  1YNZ A;  1YJN A;  3OQ5 A;  1D1B A;  4RCC A;  3OS2 A;  4BUG A;  2NWM A;  1Q7Y R;  5CAI A;  4RG8 A;  2VUB A;  4FYX B;  4EMK A;  4RUG A;  1K73 C;  2EQU A;  4X9C A;  3OYF A;  2DL8 A;  2VGM A;  1NJI C;  2JT4 A;  4PJO F;  4C5G A;  2C0T A;  1UGS B;  1JEG A;  1IO6 A;  3EH1 A;  1X43 A;  2K57 A;  1O75 A;  2LRQ A;  4MZT A;  2L89 A;  1WHG A;  5KE2 A;  2CH4 A;  1R77 A;  3CCQ Q;  1LVK A;  2CP3 A;  4KGZ B;  2LQ8 A;  1NEG A;  1SKU B;  4XQ3 A;  2F5T X;  5KYU A;  1ZUK A;  5GAM g;  1AZE A;  2P0Q A;  3E1S A;  3V7R A;  2NUT A;  1I5O B;  2DMO A;  1KQS A;  3MCA B;  1KC8 C;  2RI2 A;  4M77 B;  3GNG A;  1WZO A;  5KYX A;  2HQX A;  4ELY C;  3JB9 F;  3VUB A;  2I2L A;  1YJN Q;  1SEM A;  1Y0M A;  4J8O A; 
#chains in the Genus database with same CATH homology
 3L2Q A;  3OYJ A;  4N4H A;  4DOW A;  3I56 A;  3FLG A;  2MAM A;  4M75 B;  5I21 A;  2E64 A;  5LJ3 j;  4MZM A;  2QQB A;  5DM7 R;  1WQW A;  3URG A;  2P0K A;  4JLI A;  3CPF A;  3HFN A;  1M1K C;  3J80 E;  4PLI A;  4BE1 A;  3OBW A;  5GAN 2;  3CCQ T;  2XIC A;  4M77 F;  4A4H A;  5GMK e;  2FYK A;  4GLK A;  3CCU T;  1VQ8 T;  2OTL T;  3CME A;  2B8A A;  3GLX A;  3BY7 A;  3CCM T;  1JJ2 S;  4M75 F;  3SWN B;  1VQ6 T;  3DLM A;  4HCB A;  5GAN e;  2L8D A;  2E5Q A;  4ZN1 A;  3I55 T;  2ZPB B;  4XTX A;  1M4Z A;  5GAN f;  1GXI E;  1YIJ T;  4OB3 B;  3QII A;  1RL2 A;  4NOY A;  4XTW A;  4A4E A;  2KSS A;  1UB4 A;  1WGS A;  2JTM A;  2M16 A;  2RM4 A;  4OB2 B;  3OS5 A;  4C92 D;  2RHX A;  1Q81 U;  1VQ7 A;  3ASK A;  1U1S A;  3A8H B;  2PVD B;  2GCX A;  2K5I A;  3MO8 A;  4ZGJ B;  1Q7Y C;  3A8G B;  4NS5 A;  3TU4 K;  5I2S A;  1VQM T;  4M75 E;  4R55 A;  3L2R A;  4MDW A;  3G71 A;  5LJ3 h;  4C8Q G;  1QP3 A;  1HXD A;  3J7A F;  4CRI A;  2H3J A;  3PGG A;  4EMH A;  2VV5 A;  2VXF A;  2Y90 A;  1YJN T;  1KHC A;  4C5E A;  3CXC S;  4M75 C;  1LOJ A;  3G4S T;  1G3W A;  1YCY A;  1NZ9 A;  2DO3 A;  2G3R A;  3G6E T;  3P8B B;  1JRI A;  4E7H A;  1BYM A;  2YLB A;  3RKX A;  1QW1 A;  2K2V A;  5CK9 A;  2JTF A;  2R5M A;  2RO0 A;  2QA4 A;  3CCV A;  3CC2 A;  1JJ2 A;  4MMK A;  4OB0 B;  3QJY A;  3OYG A;  1N8R U;  4F7U A;  4M77 A;  2HBP A;  1VQ9 T;  3MEU A;  4M78 D;  2YLC A;  5GAN 3;  4JRQ A;  4A4G A;  1Q86 U;  4FL6 A;  3WVD B;  2RJF A;  3VYG A;  4MDX A;  3CPW S;  5GAO m;  3S3M A;  4L6V 5;  4Q5W A;  3CC4 A;  3ZEH A;  3LWH A;  4XU2 A;  3QZ9 B;  2R57 A;  5CVI A;  3CD6 A;  3CCL T;  4E7L A;  5A0L A;  3BFM A;  3QBY A;  4M78 B;  3HRT A;  5GAO l;  4J5Y A;  4M75 A;  1N27 A;  5GAM d;  2RI5 A;  2CZ1 B;  3EFS A;  4Y28 E;  3GPL A;  3RKY A;  4BE2 A;  5GAN 6;  2XI9 A;  3JB9 H;  1M5Q 1;  1MHN A;  3L1A A;  3SD4 A;  2RD1 A;  2DD4 A;  1XTD A;  3CXC A;  4PJO G;  2LX9 A;  3M58 A;  4C5H A;  3OSV A;  3OW2 S;  1EIF A;  4RCB A;  2QTX A;  3ZFJ A;  3VV0 A;  4EMG A;  1VQP A;  5LJ5 e;  3M4G A;  5GAM j;  5LJ5 f;  2CZ7 B;  2RJC A;  4IUU A;  5LJ3 f;  3OMG A;  3SWN A;  3S3O A;  2QXF A;  1YI2 T;  2OTJ T;  1Q81 C;  2E70 A;  1YJW A;  1QVG S;  4PLL A;  1N9S A;  4XU3 A;  2D0Q B;  4JDS A;  3C95 A;  3R6O A;  2QQ9 A;  4N0A C;  4M7D D;  4QVZ A;  2LVM A;  2DIQ A;  1YHQ A;  4NL2 A;  2CGH A;  1NPP A;  2CZ0 B;  3A8O B;  2E1H A;  2RK1 A;  5CQX A;  2EWN A;  1FWZ A;  3UT1 A;  3OS0 A;  3M56 A;  4TVR A;  3CPW A;  4M78 E;  1YJ9 T;  4R56 A;  3UWN A;  3FJP A;  3QDR B;  3MP1 A;  3NTH A;  4N4I A;  5GAO p;  5GAO q;  1P92 A;  3HFO A;  3LWI A;  1MGQ A;  2CZ6 B;  2O4X B;  5IN1 A;  4BD3 A;  1G3T A;  2X35 A;  3LGL A;  3CCS A;  1TH7 A;  4M78 C;  3OBY A;  5A2Q E;  3DB4 A;  5CCA A;  2Y4Y A;  3X20 B;  4QQD A;  5CQY A;  4ME7 A;  5GAM h;  1BKB A;  3RUX A;  2IG0 A;  1XQH A;  3M59 A;  2D9T A;  2CS7 A;  3L2V A;  5DY9 A;  3OW2 A;  3HP9 A;  1N8R C;  2OAU A;  3I56 T;  4JRI A;  3S6W A;  1S72 A;  1NE8 A;  1UGQ B;  2K4Y A;  2EJ9 A;  2RA2 A;  3P8D A;  5CKD A;  3QYH B;  4N0A A;  4C0D C;  1Q86 C;  1LNX A;  4A53 A;  3KUF A;  1HK9 A;  5HY6 A;  5I2M A;  2DPP B;  1VQO A;  5LL6 S;  1QVG A;  5GAN g;  4QVD A;  1OZ2 A;  2DXC A;  1X75 C;  2PU9 B;  2RI3 A;  3M53 A;  3HRS A;  3CME T;  1YIT A;  3PIP A;  3DKM A;  5KE3 A;  2RH2 A;  3H6Z A;  3JB9 G;  2E41 A;  4WF2 A;  3MEA A;  3Q1J A;  5AYF A;  3VYH B;  1O9S A;  4F7U G;  4M77 G;  4XTZ A;  3V7S A;  4EPC A;  2KY9 A;  4M78 A;  2PVO B;  2K3Y A;  1VQ7 T;  2DEQ A;  2M1H A;  2IVW A;  3P8H A;  1I81 A;  1N9R A;  1ZHI A;  2KMT A;  1M1F A;  3PFS A;  3V7C A;  4B9W A;  2PUK B;  2NLU A;  3X28 B;  2JN0 A;  3JCM f;  3A8L B;  2EFI A;  3G71 T;  5GMK i;  4LDW A;  1M8V A;  1VQ4 A;  5KH6 A;  2EQM A;  3QPH A;  3JCM Q;  2XDP A;  2ZPI B;  3BDU A;  1PSE A;  3MEV A;  4M75 G;  1ZQ1 A;  2QQA A;  2FVU A;  3T9N A;  4DOV A;  3FRN A;  4P5N A;  3OYN A;  3OYK A;  4EMK B;  1IZ6 A;  3LGF A;  5M9O A;  3JCM V;  1FXX A;  2LC4 A;  4C8Q D;  1OI1 A;  1X01 A;  5CR2 A;  1BI0 A;  1AHJ B;  1VIE A;  4LD6 A;  2FL7 A;  2JVV A;  2JUF A;  3CCV T;  1K73 U;  1KQ2 A;  2VXE A;  4E47 A;  2ZCF B;  3MHX A;  2DVE A;  2HD0 A;  2P0P A;  2DXB A;  2WSC E;  4M7A B;  4C92 B;  2ZZD A;  4JRK A;  2DXT A;  4KUI A;  4V2S A;  2O4X A;  1FX7 A;  3OYC A;  1Y96 B;  3KBG A;  2QI2 A;  5FRM A;  4ATO A;  3CC4 T;  1H64 1;  1IRE B;  4BY6 C;  1QVF A;  3CD6 T;  4BB7 A;  4OF1 A;  3CMA A;  2C06 A;  2MMP A;  2ZPE B;  3JAM E;  2DK3 A;  3G7Z A;  4BAC A;  4BE0 A;  2X4W A;  4C92 F;  5J39 A;  4M7A F;  1M90 U;  2LCL A;  3HL8 A;  4FM4 B;  2DKG A;  4FIB A;  5LJ5 g;  2DXU A;  1K9M U;  4M7A E;  3GOX A;  1I8F A;  5GAN 8;  4DA4 A;  5HKC A;  3JCM c;  3EAE A;  2XKO C;  3PT9 A;  1VQ8 A;  3E9G A;  3CCM A;  3CCE A;  4ZGE B;  1VQ6 A;  1W2B S;  3QXE B;  3ER0 A;  4C0G A;  2QQS A;  3PIO A;  4ELZ C;  2HAX A;  3OSS C;  2JZ2 A;  4CI0 C;  5D6X A;  4EMK C;  2XD0 A;  2XHC A;  5CO7 A;  1D3B B;  2BUD A;  4KBM B;  1KHI A;  3HKS A;  2K3X A;  2CYZ B;  2RHU A;  3LX7 A;  4FU6 A;  4L5G A;  4XU1 A;  4C92 E;  4QVC A;  5GAN 4;  1YJW T;  1Q82 U;  4C8Q E;  1K8A U;  2R58 A;  3VUZ A;  2X4X A;  3V8L A;  4OMF B;  3OA6 A;  1UGP B;  1RI0 A;  1YHQ T;  2DTO A;  5C0M A;  1WPY A;  3A5Z B;  4C92 C;  4J7I A;  4M7A C;  4X9D A;  3V8K A;  3MP6 A;  2RHZ A;  5CIU A;  4C5I A;  2XID A;  2YHT A;  4C8Q C;  2PQW A;  1PSF A;  2DTI A;  2LT4 A;  4C0D B;  3M54 A;  4HT9 A;  2RB6 A;  5LJ3 e;  4BI8 B;  2DTH A;  4RG2 A;  3FEO A;  4M78 F;  2XDD A;  3OYE A;  1VQN T;  5GAN d;  3G4S A;  4O5V A;  4IUR A;  4M78 G;  3BDL A;  3RKW A;  1XNI A;  3G6E A;  5GMK j;  5DLO A;  1VQL A;  3L42 A;  2WAC A;  1UGR B;  1R8O B;  1Y7X A;  3RES A;  5FRN A;  2ZPH B;  1SSF A;  3LW5 E;  4QQG A;  1W2B A;  1NPR A;  5GAN j;  1KD1 U;  4JS4 A;  3JCM J;  1VQ9 A;  2EAY A;  1N6A A;  2XDB A;  5GMK m;  1U8R A;  1VQO T;  2ZPF B;  2DIG A;  3OB9 A;  4HA8 A;  4X34 A;  2ZGW A;  4IUT A;  4C92 A;  5IAY A;  3OYB A;  4M7A A;  4M7D B;  1VUB A;  1YIT T;  1Y96 A;  2LCC A;  2RJD A;  2E12 A;  4M7A D;  4UC4 A;  2FHD A;  1B34 B;  1G3S A;  2DAQ A;  1M90 C;  5KCH A;  2K5F A;  3QHS A;  1KG1 A;  4HCC A;  3F70 A;  3E9F A;  4ZN3 A;  1QP2 A;  1K9M C;  3KXT A;  3C4S A;  4JUV A;  3A8M B;  4OGC A;  3QUI A;  4M7D F;  5J3B A;  1VIF A;  5GMK h;  1XOV A;  3JB9 D;  2GFA A;  3L2Z A;  1VQK A;  3CCJ A;  5EG2 A;  3RMS A;  1BIB A;  3JCM b;  3CBM A;  4E7K A;  2X4J A;  3JRZ A;  2WSF E;  3JSC A;  5GAN h;  4PL6 A;  2JNG A;  3QZ5 B;  4OGE A;  5CKE A;  3RMQ A;  4M77 D;  1BI1 A;  1W4S A;  1Q82 C;  4FSX A;  4L59 A;  3M5A A;  1K8A C;  3LLR A;  2OTJ A;  1VQ5 A;  1D3B A;  2VGN A;  4OB1 B;  4DQ2 A;  2HQE A;  4M7D E;  3TCJ A;  2EIF A;  3ZBD A;  4J7F A;  4A4F A;  3JCM X;  4QQ6 A;  3ME9 A;  4VUB A;  4O6J A;  3CC7 A;  5FLX E;  2EJF A;  3LH0 A;  4N4G A;  4BY6 B;  4ZGD B;  2VYT A;  3OYI A;  2PUO B;  3PMT A;  1QVF S;  2CKK A;  4M7D C;  1M9S A;  2QEX A;  3JCM e;  3NFC A;  2KAF A;  2L3R A;  4M75 D;  2F69 A;  4OP0 A;  2M0O A;  3QYG B;  3PMI A;  5LJ5 d;  3QO3 A;  5LJ3 d;  2EJG A;  5FRO A;  2XK0 A;  3VKI A;  2BKD N;  3CBP A;  5GAN 5;  5FU6 C;  1KQ1 A;  1U1T A;  2LDM A;  3E19 A;  4BDZ A;  2KVQ G;  3OYH A;  1JB0 E;  4XAX B;  4XK8 E;  3OYL A;  5HK0 A;  2V8I A;  3QKJ A;  1KD1 C;  5LJ5 j;  3OYM A;  4GY5 A;  5GAM e;  3CMA T;  1YBY A;  2RHY A;  2YRV A;  3MEW A;  2GF7 A;  1WQ7 A;  3X24 B;  5GAM f;  3GF5 A;  2GFU A;  3MP8 A;  3SB2 A;  2QA4 T;  2M9U A;  4XTY A;  1LJO A;  3OMC A;  5A0G A;  3CCR A;  2E6Z A;  4MZP A;  3CC2 T;  3J81 E;  1BI2 A;  2FB7 A;  5C6S A;  2L5Q A;  3JB9 I;  3CBO A;  1NJI U;  5CKB A;  3VJP A;  4Z02 A;  4RKU E;  2A7Y A;  2DZC A;  4F7U E;  3QJ6 A;  4M77 E;  4IUV A;  5A0D A;  4BDY A;  3CCE T;  4M7D A;  2A3L A;  2Y4X A;  4C8Q B;  3FC3 A;  4LDY A;  2BIV A;  3M55 A;  2RK2 A;  5D6W A;  2O01 E;  4HCZ A;  4HT8 A;  1B34 A;  3N5B B;  4BI4 A;  5GAO n;  1I5L A;  4KUD K;  3S3N A;  4M77 C;  2MWO A;  2P4T A;  4JS5 A;  5HK3 A;  3QG1 A;  3CCQ A;  4C8Q F;  3OYA A;  3JCM W;  4C92 G;  5LJ3 g;  4M7A G;  2LTO A;  5LJ5 h;  3RER A;  3CCU A;  2OTL A;  3OY9 A;  5FU7 B;  3HHT B;  3OS1 A;  2XU8 A;  4YTL A;  4II1 A;  3DB3 A;  4LDU A;  4NL3 A;  1VQP T;  5CKH A;  3WVE B;  2D6F A;  3NTI A;  2KK4 A;  3I55 A;  2QQR A;  3JB9 J;  3L2W A;  1YIJ A;  1OYX A;  4QW2 A;  3JCM P;  3HRU A;  2V8K A;  4ZTJ A;  3HSB A;  3GP8 A;  1H3Z A;  1JBM A;  5L8R E;  1VQL T;  3VU3 C;  4PJO D;  4C0F A;  4E7I A;  3TEE A;  4B9X A;  5J26 A;  2E65 A;  2HNI A;  1I4K 1;  1V29 B;  4JLG A;  2MI6 A;  3TRE A;  3OYD A;  1VQM A;  5IT9 E;  4MML A;  3SWN C;  1KC8 U;  3JCM d;  4EDU A;  2QDY B;  4IUQ A;  3GNF B;  4JRP A;  1UEB A;  2EQJ A;  2XG8 D;  3M57 A;  1BIA A;  2RHI A;  3HPW A;  4IUP A;  1YJN A;  5DLQ E;  2V8J A;  3OQ5 A;  2E6N A;  4PJO B;  5D6Y A;  3INZ A;  4RCC A;  4C0Z A;  3OS2 A;  4BUG A;  3CCS T;  3NTK A;  3DLL A;  5GAN 7;  4FT4 A;  5CAI A;  4RG8 A;  2VUB A;  3V8J A;  2PVG B;  1DJ7 B;  2E10 A;  4EMK A;  1K73 C;  2EQU A;  1WJQ A;  4X9C A;  3OYF A;  2VGM A;  2KQW A;  3M9Q A;  4J6X A;  3CEY A;  3X26 B;  1NJI C;  4PJO F;  1G3Y A;  4LDV A;  4C5G A;  1S72 T;  2DZ9 A;  4PNO A;  5FU7 C;  1UGS B;  4RMO A;  2K57 A;  1KQS S;  1VQK T;  3L2U A;  3CCJ T;  1M1K U;  1O75 A;  1Y71 A;  3C94 A;  2LRQ A;  4MZT A;  2L89 A;  2ZPG B;  4HKE A;  3OYY A;  4D6W A;  4C8Q A;  4Y91 A;  2X4Y A;  3BW1 A;  3FDR A;  5KE2 A;  5GMK l;  5KCO A;  3CCL A;  3LYI A;  1VQ5 T;  4J83 A;  4XU0 A;  2EYQ A;  2LNV A;  5FU6 B;  4PJO E;  4KT0 E;  3WXM B;  4BI3 A;  3UDC A;  4J6Y A;  2MF2 A;  4J6W A;  3FB9 A;  5CKF A;  1WNL A;  2GQV A;  3MET A;  1X6O A;  4XTU A;  3JCM g;  2EQK A;  3CC7 T;  2JOY A;  3RIR A;  2LQK A;  2R5A A;  3JCM h;  3GIB A;  4A54 A;  3SDZ A;  1ZBX A;  4M7D G;  4PJO C;  5GAO r;  1Q7Y U;  1WJR A;  2QEX T;  3UPU A;  1M1G A;  1VQN A;  2LQ8 A;  4JJN K;  1VQ4 T;  4LDX A;  1YI2 A;  2K5L A;  4XQ3 A;  2WSE E;  2F5T X;  5GAM g;  4A4K A;  4FT2 A;  2P0Q A;  3E1S A;  3V7R A;  3M4Y A;  2KDS A;  3SFM A;  3QSU A;  4IKF A;  1Y07 A;  3O8V A;  2AHJ B;  3X25 B;  2DJZ A;  3MCA B;  1KQS A;  2DD5 A;  4XTV A;  1KC8 C;  2VC8 A;  3PTA A;  1YJ9 A;  2RI2 A;  1BI3 A;  4F7U B;  4M77 B;  3GNG A;  3CCR T;  2RJE A;  3PNW C;  4E7J A;  1WJS A;  4PKC C;  1QVP A;  1OZ3 A;  2HQX A;  1G5V A;  4KUL A;  4ELY C;  3JB9 F;  2MWP A;  2LT1 A;  3FIF A;  3VUB A;  4PJO A;  2I2L A;  3C12 A;  2F5K A;  4OVA A;  4LD9 K;  4J8O A;  4ZTF A;  3AHU A;  3EFR A;  4F7U F;  2EKO A;  3H8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...