3JCMg

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
66
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 9
structure length 66
sequence length 80
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmg00
3V8KA 4PJOG 1D3BB 4XTYA 5GAN7 5GAMj 3JCMP 2HNIA 1B34A 2DEQA 4J6WA 4XTXA 4F7UE 4EMKA 3JCMQ 4M77F 3SWNB 5GAMe 3JCMW 1U1SA 4C92A 4M7AE 4C8QB 2VXFA 4EMGA 3PGGA 4RCCA 3FIFA 4XTVA 4M77D 5DY9A 4M78E 5GAMg 5GAOq 2DJZA 3L1AA 3SB2A 3M4GA 1H641 2RM4A 3FB9A 5LJ5d 5GAN3 3EFRA 2E65A 5GMKm 3JCMd 5LJ5g 3QSUA 3V8JA 2DTOA 5GAN2 4M75A 5GAOp 5GAMd 4M75E 4M7AF 4F7UA 4C92C 1BIAA 2EAYA 3JB9I 4XTUA 4C8QD 4EMKC 4JRKA 3HFOA 4M77A 4M78C 5LJ3d 4PJOD 4XU1A 3QHSA 4M78A 4PJOC 4NOYA 2E64A 4M7AG 3QO3A 1U1TA 1YCYA 2DZ9A 1LOJA 2RB6A 4NL2A 4X9CA 4JLIA 3V8LA 3JCMX 4PJOA 2FB7A 3V7SA 3RKYA 4F7UG 5I21A 5GAN6 5GANe 3RKWA 1M5Q1 3JCMb 4M75C 4M77B 2DXUA 4A53A 2VC8A 4DQ2A 5GAOn 4C92F 5LJ5h 4M7AC 1N9RA 2DXTA 3JB9J 3JCMc 4M75F 3JCMh 2DTIA 5LJ3e 5GAOm 4QVCA 4J6YA 5GAOr 3BDUA 4F7UF 3HSBA 2JN0A 5GMKi 5GAMh 4M7DE 5GMKl 4M75B 4M77C 1I5LA 3GIBA 4PJOF 4A54A 3RERA 1WPYA 4M78G 2YHTA 5LJ3g 1WQWA 5GANh 4F7UB 4M78F 1X01A 1KQ2A 2FYKA 2DVEA 5LJ3h 1HK9A 2EWNA 4M7AB 4PJOB 4V2SA 2EJFA 4HT9A 3JCMe 3JB9H 1I81A 3EFSA 4M78B 5GMKh 3HFNA 4M75G 4MMKA 2DKGA 3QUIA 3RESA 4J5YA 4C8QE 5GANj 3FJPA 1D3BA 4XTZA 4XU2A 4Y91A 5GAMf 4C92E 1HXDA 4PJOE 1I4K1 1I8FA 3RKXA 3JCMV 2EJ9A 4M7DA 4PNOA 2CGHA 1KQ1A 3JCMf 2DZCA 3RIRA 5GANg 4NL3A 1Y96B 2E1HA 4EMKB 4HA8A 1TH7A 3V7CA 4C92B 3SWNA 5LJ5j 4XU3A 4M7DD 4XU0A 5GAOl 2DTHA 5GAN5 5GAN4 1LNXA 4X9DA 5LJ5e 5GANd 2E10A 4M78D 4RCBA 5GAN8 3JB9D 1Y96A 4C8QC 5LJ3j 2E41A 4N0AC 1LJOA 4C8QA 2RD1A 3VU3C 3JCMJ 4JRIA 4MMLA 4N0AA 5LJ3f 4M7AD 4XTWA 2YLCA 4HT8A 3JCMg 3V7RA 4M77E 2ZGWA 3L2ZA 5GANf 4OP0A 4JUVA 4M75D 4M7DG 4J6XA 4M7DC 4C92G 2I2LA 1MGQA 2VXEA 4EMHA 3SWNC 1M8VA 2EJGA 4QVDA 3JB9G 1N9SA 5GMKj 1BIBA 2QTXA 1JRIA 3RUXA 4WF2A 1B34B 1WNLA 4M7DF 5LJ5f 3INZA 5GMKe 5CAIA 1WQ7A 3AHUA 3BFMA 2YLBA 3BW1A 2K57A 2RA2A 3BY7A 4M77G 4C92D 4XQ3A 1JBMA 3JB9F 4C8QG 4M7DB 4M7AA 4C8QF 2Y90A
chains in the Genus database with same CATH superfamily
1NYFA 4AFSC 2HNIA 2R5AA 4BE1A 1NLPC 2DD4A 1X27A 5HK0A 1CSKA 1X6GA 2VXFA 4M7AE 2KK4A 3FIFA 3KFVA 4XTVA 5DY9A 1VQPA 5GAMg 1WHJA 2CS7A 1Q82U 4J8OA 5GAN3 2E65A 2BE7D 1M90R 2P0QA 1VQ7A 2V1RA 1G8XA 1W2BP 2VVKA 1VQ5A 5L8RE 3HFOA 1Q81U 4RMOA 3QHSA 3GP8A 4NL2A 5A0LA 1K1ZA 1KD1U 1YIJQ 3VS7A 1KC8C 3OSSC 4E7KA 3MEUA 4OB1B 2LT1A 3JCMh 1S72A 1BB9A 4F7UF 2W0ZA 4B9XA 4M7DE 4N4IA 1WPYA 5KYWB 1WXUA 3EH2A 1RADB 4XK8E 2VKNA 1X01A 1KQ2A 2LJ3A 2QTVA 1IGUA 3QIIA 3PMIA 4E7ZA 2NUTA 4X1VA 2JTFA 2M02A 1YITQ 1VQKT 3M9QA 2E3HA 4PJOE 2J6KA 1TOVA 2CGHA 2QQRA 4C5HA 1QVGA 1I0CA 4J9CA 1K8AC 2EFIA 3G71T 1K4US 3H0FA 2DLPA 4C8QA 1OX9A 2GQVA 2J7IA 2OX7A 4WTOB 3V7RA 2HSEB 4LD6A 3I56T 3AT1B 2V1QA 2C06A 2IG0A 4ANJA 4M77G 2O88A 3CCUA 1IHVA 2L3RA 5A0DA 2XIDA 4XTYA 5GAMj 3UWNA 5CCAA 4F7UE 1NJIR 1BI0A 4Y28E 3PTAA 2HKQB 5IHKA 4EMGA 4M77D 3A8OB 2HQXA 3CCMT 3CXCP 5GAN2 2CZ7B 2DXBA 1UTIA 4N4GA 2BTTA 1G83A 1UGRB 4X9CA 5KH6A 2NWMA 1PRLC 2LZ6B 5GAOm 4JZ3A 4QVCA 4E2FB 2KSSA 4KULA 9ATCB 1HD3A 3M56A 1VQ9Q 4IIMA 3OYNA 1T0HA 1VQ6T 2YWWA 4FCYA 2JM8A 4FM4B 3OBYA 1M1KR 3OS2A 1JU5C 2A28A 5IH2A 2XDDA 2D0QB 1I8FA 2DL4A 3GNFB 2O31A 5KYUA 5EG2A 3WVEB 2CP3A 1JXMA 1OYXA 2X3WD 3CCEA 1RLQC 3A8GB 5IHNA 2LVMA 4C8QC 1BK2A 5CQYA 2E41A 1YI2T 2K2VA 3NFCA 1UB4A 2HQHA 1VQOT 2QTXA 1Q7YC 2A0FB 3I35A 2RI5A 3DKMA 3EG9A 4M7DF 4OMLA 4X34A 3META 3CMAA 3L2UA 2V8KA 3JB9F 2LQKA 3X24B 2DEUA 1LCKA 2XG8D 1YWPA 1TG0A 2E6NA 1VYVA 2JMAA 2LJ0A 3PGGA 1U06A 2EKOA 2QQBA 4F17A 3M58A 1H641 5CR2A 1S72Q 3GLXA 3MP1A 5I2SA 1IREB 5GMKm 3M5AA 4QKUA 1D1AA 4KUDK 3MKDA 5GAOp 2J06A 4A4KA 2YRCA 2D9TA 2DRKA 2ENMA 4XU1A 3SEMA 1LOJA 2FO0A 2QA4T 1YP5A 3QWXX 2FG0A 4C0DB 4AFZC 1N9RA 1MMAA 2DTIA 1QP2A 4BE0A 1M1KC 4EIKA 5GAOr 2M51A 1QLYA 4C5GA 2JN0A 4M77C 1WHMA 3RERA 4IUTA 2CP5A 3CMEA 5GANh 1WQWA 1TUDA 1OX8A 2LRQA 4J83A 1H8KA 3EFOA 2VB6A 4OMMA 1QCFA 3UPUA 1K9MC 2PZ1A 3GNGA 4LXCA 2QQAA 2M9UA 3RKXA 4OMPA 4KT0E 3EAEA 5GAN5 4M78D 3TCJA 1M1GA 1TTHB 2OJ2A 4RTTA 4VUBA 5LJ3f 2JTMA 3A1PA 1JQQA 3FRNA 2A7YA 4M75D 1KK7A 3SDZA 2LX9A 3ZEHA 3SWNC 1QVGP 1D09B 2DERA 1JRIA 3CD6T 1B34B 3I56A 3ASKA 2GTJA 1SEMA 3E9FA 1NJIC 1NBEB 1PM3A 1OOTA 3M0UA 3G4SA 5FLXE 3JCMW 3NGPA 2RJFA 2QI2A 4RCCA 5CK9A 3VUBA 5GAOq 3L1AA 3M4GA 3CPWA 2RM4A 1QVFS 2QGFB 1D0XA 2DTOA 1RAIB 4P5NA 5GAMd 1ZUUA 1QWEA 5CKEA 4ZTJA 1WJSA 3OS0A 2AKKA 1YCYA 1NM7A 1WHLA 3N5BB 1RAAB 5GAN6 3CPWP 6AT1B 4JJCA 3OYGA 1JJ2P 3J81E 1N8RU 1E6HA 1UGSB 2RF0A 1AOJA 2EPDA 1NE8A 2VYTA 2EQKA 2K5FA 1NEBA 1AHJB 4R55A 3CBOA 2DVJA 4BD3A 1X6BA 2MPXC 4IKFA 4XAXB 1K73R 3QUIA 2WACA 3EG0A 3RNJA 2OTJT 4QT7A 3NPFA 1XTDA 3JCMf 1Q86R 4FT2A 4HA8A 2ESWA 1TSFA 2KRMA 3SWNA 1WHGA 2R5MA 5GAOl 1Q86C 4X9DA 2WSCE 2QEXQ 1SF9A 1RAGB 2CT3A 1AWXA 1LVKA 2FHDA 2RD1A 4OMOA 2OAWA 5FU6B 1M4ZA 1WLPB 4FL6A 1PNJA 3M0SA 4JDSA 2KE9A 1DJ7B 3CD6A 4EMHA 2HD0A 4JZ4A 1S1NA 2MOXA 2JZ2A 2FZGB 3AHUA 2CP7A 2YLBA 2DXCA 3E2UA 3QYGB 1KD1R 1OEBA 1Q86U 1D3BB 1ZX6A 2DEQA 1IXDA 3SWNB 1IHWA 5CQXA 5A0GA 3LX7A 1I1JA 3G6EA 3CC7A 1C1AA 5LJ5g 5FROA 3O8VA 1N6AA 2HKNA 3PE0A 3EGUA 1WHHA 3JB9I 2P0KA 1OULA 1ZSZA 1R0BG 5LJ3d 1VQKQ 1AWJA 2AK5A 1VQMQ 3TQ7P 5KE2A 5DLOA 1YITT 2LQWA 2E64A 1YHQQ 1QWFA 3V8LA 4CI0C 2M16A 2FB7A 3VUZA 3RKWA 2QA4A 1FMWA 3VJPA 3JB9J 1WX6A 1X69A 1QKXA 5D6YA 5M9OA 5GMKl 1KJWA 2KGTA 1Y71A 4LD9K 3MCAB 4UC4A 1G3TA 1WDXA 4M78F 2DVEA 1V1CA 5KYNA 4JS5A 1YWOA 4HT9A 1M8MA 3EFSA 4RG8A 1JO8A 1UUEA 2JW4A 2L3QA 1HXDA 3UA6A 1HJDA 2DIGA 4DEYA 2HQEA 1OZ3A 1YJNT 1PCXA 5GAN4 3OA6A 5KCHA 3C0CA 2H3JA 3CCLQ 3CCVQ 2IVWA 3PIPA 4HCKA 2E5KA 4NS5A 2DIQA 3G6EQ 2KBTA 4TVRA 2GBQA 4AFUC 2QQSA 4M7DG 1E7OA 4F04B 2VXEA 1YJWQ 1Q81C 1JEGA 1U8RA 5KCOA 5CKDA 5LJ5f 3EG9B 3CXCA 1SPKA 2E12A 3OS5A 2J05A 4RTUA 2QXFA 4PJOG 1NYGA 1TXQA 1T3SA 4FT4A 3TSZA 2FZCB 5I11A 1VQNQ 4LN2A 3M4YA 4E7LA 2XU8A 3SB2A 4RTVA 4ELYC 4PJJA 3EGXA 1M1KU 5D6WA 1JB0E 2MMPA 1CKBA 2RQUA 4F7UA 3CPWS 1UFFA 4J9DA 3CCRT 1RAEB 4ME7A 4FU6A 2CREA 2RHYA 2AZSA 4JRKA 4M77A 4M78C 4LUEA 2RH2A 1M90U 1QVGS 1PSEA 3R6NA 2DXUA 3CCQA 2ZPFB 3OYIA 2C0OA 3CCSQ 2DXTA 4J6YA 2ED1A 3CC7Q 4IURA 3HSBA 3PVLA 3M0RA 2LMJA 4M75B 2L89A 2PNIA 3RBBB 1Q7YR 2IIMA 1FMVA 2HZYA 2BZYA 2OTLT 4BUGA 5KE3A 4M78B 4C5EA 3MP6A 4PFZA 1JJ2A 5C6SA 2EVRA 3CD6Q 3J7AF 3RESA 4ZNXA 1D3BA 4XTZA 3HP9A 3ZL7C 2DJQA 1SKUB 2CDTA 3T9NA 1KSWA 5GJWB 4YTLA 5IN1A 2LC4A 2O2OA 3A8MB 1UGVA 1VQPQ 4BDYA 5DLQE 2E10A 3VS6A 1G3YA 1QKWA 3BDLA 3I5SA 4N0AC 2KYBA 3M0PA 1H92A 3VU3C 1K73C 3O5ZA 3EHRA 2ZAEA 2MYSA 4OP0A 5L23A 4M7DC 4DOWA 2B86A 2VV5A 1R77A 1BU1A 2X4XA 3S6WA 4OMNA 5CAIA 3VS1A 2GF7A 1PRMC 2HDAA 3JRZA 2RA2A 1Q82C 4M7DB 1Y07A 1GBQA 3LGFA 3V8KA 4KGVB 3JCMP 3FEOA 3NTIA 4C0ZA 2E5QA 4ESRA 2DD5A 3NTHA 4MZPA 2FZKB 1U5SA 2EQUA 2QA4Q 2JMCA 3LLRA 3CCRA 3C95A 4ZTFA 2CYZB 3PIOA 2VUBA 2EAYA 2JNGA 2K79A 3OBWA 2DYBA 1GBRA 1WI7A 4BB7A 3VYHB 2K2MA 2KXDA 5I2MA 1Y7XA 1YITA 1FWZA 1VQLA 3CCJQ 5ECAA 4R56A 2ZPGB 2COWA 2LX7A 2K6DA 2RHIA 1X6OA 3OS1A 3I5RA 2QDYB 4M78G 3D7SB 2DILA 3L2VA 3M54A 1M3CA 2EJFA 1VQMA 3OW2A 4M4ZA 2A37A 3HFNA 1D0ZA 1OZ2A 2FPDA 3VS0A 5EC7A 1N27A 3HTRA 1Y57A 2LDMA 3QYHB 2DZCA 1K8AR 1U3OA 2HBWA 2V8JA 2XKOC 4QVZA 3EGDA 4XU3A 4XU0A 4JJBA 1H3ZA 1SSFA 2EKHA 1ZA1B 1WGSA 3RDVA 5A2QE 4M77E 4PLLA 2DL5A 2DBKA 4LE9A 2GCXA 1VYTA 2RPNA 4PL6A 3G4ST 3BFMA 3RMQA 1VQ6Q 4HXJA 3NHNA 4M75E 1N8RR 4OF1A 3VS4A 1KC8R 1VQ9T 3CXCS 3LH5A 2DFUA 4PK4A 1YJWA 3OYLA 3FLGA 2CH4W 5FWCA 1JJ2S 1Q81R 3OYDA 2PVOB 2BKDN 2ZPBB 1VQ7T 1UGPB 2ED0A 3CCLA 1NEGA 2VGNA 2DL3A 3CCQQ 2CT4A 2NUTB 2M1HA 1OPKA 1V76A 1IZ6A 2EBPA 1VQLT 4F7UG 2XICA 4OVAA 2RQRA 2YDLA 1B7TA 4C92F 1KC8U 3BDUA 5LL6S 2LJ1A 3OQ5A 4A54A 4LDUA 2EQIA 2YHTA 5KYYB 1MMGA 4V2SA 2X4YA 4BY6C 4LUDA 1NZ9A 1QVPA 3CMAQ 1GFCA 3NTKA 4C92E 1I4K1 3DLMA 5FWBA 2CZ0B 5FU6C 3X26B 2XK0A 3OYCA 3QPHA 2DRMA 5C0MA 3LW5E 2ROTA 2GGRA 2CH4A 2LCSA 2MK5A 2MAMA 4CC4B 5LJ3j 1PD1A 1NG2A 3H0IA 2YT6A 1G3WA 2HL5C 2MCNA 1QVFA 4II1A 4DA4A 2COZA 3ME9A 1YFNA 4HVUA 4J9IA 1X43A 3QDRB 4ZN1A 2LP5A 2QGGA 2ZPEB 2KY9A 4C92D 3UA7A 2RMOA 5FU7C 4ELZC 5GAN7 1YJWT 1OPLA 2HEQA 2RJEA 5DM7R 5GAMe 1QVFP 3G6ET 3I55Q 3JV3A 4RTXA 3CCJA 1B3QA 1EFNA 3CCLT 1WYXA 1R0CB 3TEEA 3PMTA 1E6GA 4LDXA 2JVVA 2F5TX 1YJNQ 1BCMA 2D8HA 2F5KA 1ARKA 1BIAA 1IB8A 1M27C 2DL8A 5J3BA 1G2BA 2DF6A 4HCZA 4MDXA 1M3AA 3BE3A 3X25B 4M7AG 2DZ9A 4MZMA 2HSPA 1Q7YU 4PFOA 3OYAA 1M5Q1 2EYXA 3FJ5A 4M77B 3KBGA 4IUQA 1VOMA 5GAOn 4M7AC 3GPLA 2QQ9A 3R6OA 2RHXA 1GCQA 2SEMA 5GMKi 1IRXA 1W2BS 4FW1A 4C0DC 1YBYA 2R58A 3QBYA 1N5ZA 3G1JA 5LJ3h 1HK9A 1PG5B 3WVDB 1K9MU 3S3MA 4F14A 2YUNA 5GMKh 3ZBDA 1VQMT 2KR3A 3FJPA 4XU2A 1UG1A 1M30A 3ER0A 1ABOA 3UDCA 4PNOA 1RUWA 4NL3A 4JPBW 3OW2S 2V26A 2QASA 5LJ5j 2FRWA 4O5VA 4E7HA 5IT9E 4QW2A 2GFAA 3JB9D 1YI2A 2L0AA 1KQSS 1VQOA 5GANf 4AG1C 2ZGWA 2KEAA 3JAME 1VQ8T 1MNDA 5FRNA 1VQNA 2I2LA 3JB9G 2XMFA 5GMKj 2W10A 3CMAT 3TSWA 1WNLA 2RHUA 4IUVA 5GMKe 2DNUA 3VKIA 1BKBA 1VQ4Q 3RMSA 4CC3A 1BI2A 1WFWA 2PUKB 2AKLA 2DMOA 3BY7A 1GXIE 5FW9A 2O4XB 4RTYA 1OQKA 1SHGA 1TWBA 4Z02A 3TREA 3LH0A 1FXXA 2DJZA 4L59A 2F2XA 2CP0A 2L3PA 1V29B 2MI6A 3A5ZB 2RN8A 3V8JA 3OSVA 2A36A 3QXEB 3HRSA 1VQLQ 2OAUA 1XJWB 1SSHA 4DBQA 3C12A 2OTJQ 4PJOD 4LDVA 4M78A 5I22A 2RB6A 1FX7A 4PJOA 3V7SA 3RKYA 2K5LA 2B8AA 3MEVA 3CCQT 3A8LB 3OYBA 1ZA2B 4M75C 3MP8A 1VQ7Q 4KBMB 4DQ2A 2YRVA 4J9FA 2F69A 2VWFA 2CZ1B 3P8BB 2KAFA 1X2KA 4FYYB 5LJ3g 2EQMA 3E19A 2EWNA 2J6FA 2LQNA 3G4SQ 2FEIA 4PJNA 3CCUQ 5HCKA 4A63B 1SRLA 4A4GA 5GANg 3RIRA 4KGZB 1TUGB 4WCIA 2RI2A 3M53A 3EGXB 2K5IA 3GF5A 4E6RA 1VIFA 2ZCFB 2DTHA 4HCBA 2BE9B 2LNVA 3G71A 5HKCA 1ZUYA 4MZTA 2A08A 2KQWA 2JS2A 5KYUB 2BUDA 2HCKA 2YLCA 1P92A 2XD0A 1UHCA 4RTZA 2QG9B 2GQIA 1T0JA 3CC2Q 3CC4A 2F2WA 3TU4K 3OYHA 3CMEQ 4XQ3A 1W2BA 4C8QG 2CSIA 4IUPA 2DA9A 3DB3A 4XTXA 4EMKA 3JCMQ 2O9SA 2HAXA 4C8QB 1UE9A 4KGXB 2BZ8A 2EGEA 2KMTA 3E1SA 1KQSP 5IHIA 3CCJT 1A0NB 3PT9A 3QSUA 2KROA 1HSQA 1IGQA 1K0XA 2PVGB 2GNCA 3M55A 3CEYA 4ATOA 3QKJA 1Z9QA 2KYMA 1M3BA 1PKSA 1ZBXA 3QG1A 3OY9A 4PJOC 1U1TA 1VQ5Q 1FMKA 1K8AU 2FVUA 4QQ6A 8AT1B 1KQSA 4E47A 2KT1A 1I07A 5GANe 1MNEA 4EPCA 2CUDA 2JXBA 1OI1A 1B07A 5FU7B 4HVWA 1I5LA 4DEXA 1NLOC 5FRMA 2P4TA 4M7AB 2CSQA 5HK3A 3LGLA 3JB9H 1I81A 1M1FA 1KIKA 4MMKA 3E9GA 3MJXA 4E7SA 5GANj 2C0TA 4LNPA 3H8ZA 2DYIA 2RI3A 3QJYA 3H0HA 4EMKB 2ZZDA 4C92B 2QEXA 3HL8A 1KHCA 5J26A 1GFDA 1OV3A 4MMLA 1ZUKA 1RABB 3JCMg 1RACB 3GBQA 1KFZA 3EG1A 1MGQA 2EYQA 1BI3A 1YN8A 2RNAA 4BY6B 4QQGA 1AD5A 4WF2A 1HYOA 3KUFA 5J39A 4PJMA 3SHWA 2K57A 1AWOA 1JBMA 2OI3A 4K11A 2MIOA 1VQOQ 1B34A 3I9QA 4BI4A 4ZGJB 4KUIA 3CC7T 2E3IA 3LYIA 4M78E 3CCST 3FDRA 2PU9B 1M2OA 1AT1B 2ABLA 4A4FA 2HBPA 1EIFA 4M7AF 2HL3A 1SRMA 2BZXA 4FYWB 5KYWA 1WHKA 2QK0A 2KVQG 2D6FA 1O9SA 3FC3A 2AT1B 3C94A 2VC8A 2Z0WA 4J7FA 1UJYA 2QYZA 2DAQA 3CPFA 1K9MR 3X20B 2EGAA 2P0PA 2CP6A 4PKCC 4F7UB 2AHJB 5CIUA 1MMNA 3L2WA 3PVQA 4CC7A 2GTOA 1D1BA 1MMDA 4C8QE 4J5YA 2LQ8A 3JCMV 1ABQA 4M7DA 1YJNA 1Y96B 1MUZA 2XHCA 3CCVT 3VS5A 2SRCA 1Y96A 2O9VA 1VUBA 3JCMJ 4M7AD 2LTOA 1YJ9A 2H8HA 2X4WA 1O75A 4JUVA 3L2QA 1M90C 4D8DA 3I55A 1AWWA 1M2VB 1JXOA 2AZVA 2F2VA 1RL2A 1K9AA 3NMZC 1QCOA 1NJIU 4Q5WA 3ZFJA 3ULRB 3INZA 4J9HA 3CC4T 3J80E 2M0OA 4FYXB 3EFOB 3BW1A 2CZ6B 1GL5A 3S3OA 2DETA 1VQ8Q 4J6WA 1RI0A 1ZQ1A 3MEAA 2E6ZA 5CO7A 2WSFE 2MWPA 2Y4YA 2EIFA 1FYNA 3VS3A 3P8DA 1ACMB 3FB9A 2RK2A 3EFRA 2EYWA 3CBPA 3JCMd 4AFQC 3G71Q 1RAFB 3VYGA 1YHQT 3UF4A 4C92C 3REBB 4XTUA 1LPLA 4NOYA 4GBQA 1BYMA 4ZN3A 5D7UA 2BIVA 5LJ5h 5KYXA 1X75C 1GCQC 1AZGB 2L5QA 1F1BB 5CKFA 4RKUE 2OTLA 3EG2A 2FRYA 3M57A 4OB2B 2PQWA 1YIJT 1AVZC 1K76A 1UEBA 4Y92A 1RLPC 4Z88A 3CC4Q 2G6FX 3HHTB 4CC2A 4O6JA 5GAMf 2D8JA 1VQKA 2Y4XA 2FL7A 2EYYA 3V7CA 1GCPA 5LJ5e 2DE0X 2RHZA 5GANd 2RJDA 2MWOA 2PVDB 2QEXT 2K9GA 4DBHA 4Z89A 2K3XA 1W70A 3VV0A 1LJOA 1ZHIA 3OW2P 4EDUA 4N0AA 3I55T 2YXYA 1YCSB 4XTWA 1XOVA 3H41A 4J6XA 1BBZA 1SG5A 2ROLA 1M8VA 1PKTA 2DK3A 2EJGA 4PLIA 3EG3A 3RUXA 1UGQB 4B6MA 2DPPB 2YUQA 2H3EB 4KH0B 1MV0B 2JM9A 5D6XA 3MO8A 4LDWA 1N8RC 4OGCA 1KG1A 3DB4A 1MHNA 1U1SA 2JJ9A 4C92A 1PC0A 1GRIA 3OYFA 2LCLA 1W4SA 2CKKA 3QZ5B 4A4EA 2KT8A 1YJ9Q 3Q1JA 3MEWA 5KYYA 1YHQA 5HY6A 2RQWA 3CCEQ 1G5VA 3L2RA 4GY5A 1SHFA 1ZSZC 4OB0B 4C5IA 5CKBA 4HKEA 1R8OB 3QDFA 3JCMX 1ZSGA 4JS4A 3OMCA 4PFPA 2D1XA 4N4HA 3JCMb 2ATCB 3REAB 1BI1A 1PD0A 2E4HA 3IQLA 4OMQA 4JRPA 3PNWC 2FPEA 1NPRA 1EZZB 3HKSA 1TUCA 4C0FA 2JT4A 3H6ZA 2EGCA 2C0IA 5GAMh 2A3LA 4PJOF 3M59A 4BACA 2FYKA 1VQ4A 2O4XA 3OYYA 4PJOB 2X35A 4J9GA 3CQTA 2NLUA 2DKGA 4OGEA 3SD4A 4Y91A 2X51A 3C4SA 3WXMB 4BE2A 2ZPIB 4MDWA 4B9WA 3CC2A 4AMCA 1AZEA 3GOXA 4GLMA 1TH7A 1T3LA 2CUBA 3H9NA 2J6OA 4D8KA 3OYJA 4M7DD 2RQVA 4RCBA 2G3RA 3CCVA 1OU9A 2F1LA 3SFMA 3X28B 4RG2A 4HT8A 3L2ZA 1XNIA 4PJLA 3M0TA 4BI3A 2P4RA 1RAHB 3LWHA 1D0YA 4KH1B 4QVDA 1VYUA 1N9SA 2K4YA 2QAZA 2L3SA 2IPOB 4JRQA 4FYVB 3KXTA 2JUFA 2X9HA 1VQ9A 2L2PA 1Q82R 2EYZA 4M77F 1TS9A 7AT1B 4AT1B 1H3HA 3P8HA 5IXFA 1G3SA 1Z9ZA 3UT1A 1M9SA 3VRZA 4AG2C 1VQ5T 1C6VX 4C0GA 2KXCA 4J9BA 1PHTA 2LNHB 4C8QD 1WJQA 4FSXA 1UECA 4JJDA 5CVIA 2AIRB 3QO3A 4ZGEB 3QWYA 4IUUA 4JLIA 2CP2A 1C0MA 4J7IA 2L8DA 3RR6A 1PSFA 1S72T 4A53A 3THKA 2VASA 4L6V5 1KHIA 3JCMc 4M75F 2RO0A 2PUOB 2FPFA 4FSSA 2K7AA 5KYXB 4KRTA 2RQTA 3GIBA 1UDLA 1WZOA 4IIOA 3VS2A 4F16A 1ZLMA 2YSQA 2DBMA 1D1CA 4A4HA 3CMET 3EH1A 2EQJA 3JCMe 1YIJA 2K3YA 1QCNA 2X4JA 4M75G 1ZSZB 4ORZA 3MPUB 4DBFA 3CC2T 3PFSA 1KQ1A 1QW1A 2HMAA 2O01E 2E1HA 1NPPA 2DO3A 2JS0A 1YI2Q 5GJVB 1LNXA 1QMCA 4E7IA 3HRTA 5GAN8 1OU8A 2NUPB 2YUPA 1J3TA 4CRIA 4JRIA 1VIEA 2KDSA 3G7ZA 1WIEA 2RJCA 2XDBA 2RK1A 3L42A 2EW3A 4FIBA 4GLKA 1Q95G 5AT1B 1BIBA 4E7JA 3EGDB 2M0YA 1X2QA 2KRNA 3CCUT 8ATCB 3HPWA 2Y90A 1WXBA 4ZGDB 4OB3B 3MHXA 1AEYA 3CCSA 2KNBB 2K3BA 2V8IA 2YRDA 3CCMA 3OYMA 5IXBA 1TU0B 1UJ0A 2JOYA 2I0NA 1W6XA 5LJ5d 1VQPT 5AYFA 4L5GA 3A8HB 4M75A 1IO6A 5IAYA 4D6WA 4BDZA 3OB9A 4EMKC 4JLGA 4BI8B 4FW2A 2LCCA 3A98A 2DM1A 1WJRA 2QDLA 3JSCA 1W1FA 5I21A 4JJNK 1UHFA 3EHQA 3CCMQ 2OTLQ 2JTEA 3OYKA 1PWTA 2P84A 4LDYA 2KI7A 1Y0MA 3HRUA 5LJ3e 2GFUA 2VGMA 4DOVA 2WSEE 1WXTA 1BCOA 2ZPHB 3M0QA 1VQ6A 4RUGA 1EX4A 2X3XD 3CBMA 4J9EA 2XDPA 2R57A 5CKHA 3LWIA 1YNZA 1VA7A 3QZ9B 1VQ4T 1MV3A 3URGA 1M2VA 3TVTA 2KRSA 3OYEA 3U23A 3VRYA 1ZBJA 4RTWA 4OMFB 2DX1A 4HCCA 3I56Q 2EJ9A 3CCRQ 1QQJA 3DLLA 4DBRA 2OTJA 1K0SA 2COYA 2NYSA 3CCET 4R0KA 1CKAA 1RI9A 2NUPA 1YJ9T 2MF2A 3S3NA 1VQ8A 1VQNT 3UATA 1I5OB 2NUZA 2PTKA 4HVVA 3OMGA 4C92G 1XQHA 2ECZA 2LT4A 1QP3A 2XI9A 1WQ7A 2E70A 1K73U 3F70A 4Z8AA 2DL7A 2YUOA 1WA7A 2D0NA 3QJ6A 4QQDA 4M7AA 4C8QF 1KD1C
chains in the Genus database with same CATH topology
1Q86U 1D3BB 5FU7C 4ELZC 5GAN7 1YJWT 2HNIA 2R5AA 2DEQA 4J6WA 1RI0A 1ZQ1A 3MEAA 4BE1A 2RJEA 3SWNB 2DD4A 2E6ZA 5CO7A 5GAMe 2WSFE 5HK0A 5DM7R 2MWPA 2VXFA 3G6ET 4M7AE 2KK4A 3FIFA 4XTVA 5CQXA 2Y4YA 2EIFA 3LX7A 5DY9A 5A0GA 3CCJA 1VQPA 5GAMg 3P8DA 3CCLT 3G6EA 2CS7A 3CC7A 1Q82U 3FB9A 4J8OA 3TEEA 2RK2A 3PMTA 5GAN3 2E65A 3EFRA 3CBPA 3JCMd 5LJ5g 4LDXA 2JVVA 2F5TX 5FROA 2P0QA 1VQ7A 3O8VA 1N6AA 3VYGA 2F5KA 1YHQT 4C92C 1BIAA 3JB9I 2P0KA 4XTUA 1VQ5A 5L8RE 5J3BA 3HFOA 1Q81U 5LJ3d 4RMOA 3QHSA 4HCZA 4MDXA 5KE2A 5DLOA 4NOYA 3X25B 2E64A 3GP8A 1YITT 4M7AG 2DZ9A 3V8LA 4NL2A 4MZMA 4CI0C 2M16A 2FB7A 5A0LA 1BYMA 1Q7YU 3VUZA 1KD1U 4ZN3A 3RKWA 3OYAA 1M5Q1 4M77B 1KC8C 3KBGA 4IUQA 3OSSC 2BIVA 2QA4A 5GAOn 4E7KA 3MEUA 5LJ5h 4OB1B 4M7AC 3GPLA 2QQ9A 3VJPA 3JB9J 2LT1A 3JCMh 1X75C 1S72A 2L5QA 2RHXA 3R6OA 4F7UF 4B9XA 5CKFA 4RKUE 5GMKi 4M7DE 4N4IA 5D6YA 5M9OA 1W2BS 5GMKl 2OTLA 1Y71A 4LD9K 3MCAB 4UC4A 4C0DC 1WPYA 1YBYA 1G3TA 2R58A 3QBYA 4M78F 4XK8E 1X01A 1KQ2A 3M57A 2DVEA 2PQWA 4OB2B 1HK9A 5LJ3h 1YIJT 1UEBA 3QIIA 3WVDB 1K9MU 4JS5A 3PMIA 4HT9A 3S3MA 3EFSA 2JTFA 5GMKh 3HHTB 3ZBDA 4RG8A 1VQMT 3FJPA 1VQKT 4O6JA 3M9QA 4XU2A 5GAMf 1HXDA 3ER0A 4PJOE 3UDCA 4PNOA 2CGHA 2QQRA 2Y4XA 4C5HA 1QVGA 4NL3A 1VQKA 3OW2S 2DIGA 2FL7A 2HQEA 1OZ3A 3V7CA 1YJNT 1K8AC 5LJ5j 2EFIA 3G71T 4O5VA 5GAN4 3OA6A 5KCHA 4E7HA 5IT9E 2H3JA 5LJ5e 2RHZA 5GANd 4IKFA 2RJDA 2MWOA 2PVDB 4QW2A 2QEXT 2GFAA 3JB9D 2K3XA 1YI2A 3VV0A 1LJOA 4C8QA 2IVWA 1ZHIA 3PIPA 4EDUA 2GQVA 4N0AA 4NS5A 3I55T 2DIQA 4XTWA 1KQSS 4TVRA 1VQOA 5GANf 3V7RA 1XOVA 2ZGWA 2QQSA 4M7DG 4J6XA 3JAME 1VQ8T 5FRNA 1VQNA 2I2LA 2VXEA 4LD6A 1M8VA 2DK3A 3I56T 2EJGA 3JB9G 1Q81C 5GMKj 4PLIA 2C06A 1U8RA 5KCOA 3RUXA 3CMAT 1UGQB 1WNLA 2RHUA 5CKDA 4IUVA 5GMKe 5LJ5f 2DPPB 2IG0A 3VKIA 1BKBA 3CXCA 3RMSA 2E12A 3OS5A 1BI2A 2PUKB 3BY7A 4M77G 1GXIE 5D6XA 3MO8A 4LDWA 1N8RC 4OGCA 3CCUA 2QXFA 2L3RA 5A0DA 2XIDA 2O4XB 4PJOG 4XTYA 1KG1A 5GAMj 3UWNA 5CCAA 4FT4A 4F7UE 3DB4A 1BI0A 1MHNA 4Y28E 1U1SA 4C92A 3PTAA 4EMGA 3OYFA 2LCLA 4Z02A 1W4SA 3TREA 4M77D 3M4YA 3A8OB 3LH0A 1FXXA 2XU8A 4E7LA 2CKKA 2DJZA 3QZ5B 4A4EA 4L59A 3SB2A 3Q1JA 2HQXA 3MEWA 3CCMT 1V29B 2MI6A 3A5ZB 4ELYC 5HY6A 1YHQA 3V8JA 1M1KU 3OSVA 3QXEB 5GAN2 5D6WA 1JB0E 1G5VA 3L2RA 3HRSA 2CZ7B 2MMPA 4GY5A 4F7UA 2DXBA 2OAUA 3CPWS 4N4GA 3CCRT 4OB0B 4ME7A 4C5IA 4FU6A 5CKBA 2RHYA 3C12A 4JRKA 4HKEA 1R8OB 4M77A 4M78C 4PJOD 4LDVA 4M78A 1UGRB 2RB6A 1FX7A 2RH2A 4X9CA 5KH6A 3JCMX 1M90U 4PJOA 3V7SA 1PSEA 2K5LA 2B8AA 3MEVA 3OMCA 3RKYA 3A8LB 3CCQT 4JS4A 3OYBA 4N4HA 3JCMb 4M75C 1BI1A 2DXUA 3MP8A 4JRPA 4KBMB 3CCQA 4DQ2A 2ZPFB 3PNWC 3OYIA 2YRVA 2DXTA 1NPRA 3HKSA 4C0FA 5GAOm 4QVCA 2KSSA 2F69A 3H6ZA 4J6YA 4KULA 4IURA 3HSBA 2CZ1B 3P8BB 2KAFA 5GAMh 3M56A 2A3LA 4M75B 2L89A 4PJOF 5LJ3g 3M59A 4BACA 2FYKA 2EQMA 3OYNA 3E19A 1VQ4A 2OTLT 2O4XA 1VQ6T 2EWNA 3OYYA 4PJOB 4BUGA 2X35A 4FM4B 3OBYA 2NLUA 4M78B 4C5EA 3MP6A 5KE3A 3OS2A 1JJ2A 5C6SA 2DKGA 3J7AF 3RESA 4OGEA 3SD4A 4Y91A 1D3BA 4XTZA 3HP9A 2XDDA 2D0QB 1I8FA 4A4GA 3GNFB 3C4SA 3WXMB 4BE2A 2ZPIB 4MDWA 5GANg 3RIRA 4B9WA 3CC2A 3T9NA 2RI2A 3M53A 3GOXA 2K5IA 3GF5A 4YTLA 1TH7A 5EG2A 3WVEB 5IN1A 1VIFA 4M7DD 3OYJA 2ZCFB 2DTHA 2LC4A 3A8MB 4HCBA 4BDYA 1OYXA 5DLQE 2E10A 4RCBA 3CCEA 1G3YA 2LNVA 3G71A 2G3RA 3A8GB 5HKCA 2LVMA 4C8QC 4MZTA 3CCVA 2KQWA 3BDLA 5CQYA 2E41A 4N0AC 3VU3C 1K73C 2BUDA 3SFMA 1YI2T 2K2VA 3X28B 2YLCA 4RG2A 1P92A 4HT8A 3NFCA 3L2ZA 1XNIA 4OP0A 1UB4A 2XD0A 4BI3A 4M7DC 4DOWA 1VQOT 2VV5A 3LWHA 4QVDA 1N9SA 3CC4A 2K4YA 2QTXA 1Q7YC 2X4XA 2RI5A 3DKMA 3TU4K 3OYHA 4M7DF 3S6WA 5CAIA 4X34A 4JRQA 2GF7A 3META 3JRZA 3KXTA 3CMAA 2JUFA 2RA2A 3L2UA 1Q82C 2V8KA 4XQ3A 1W2BA 4M7DB 3JB9F 4C8QG 2LQKA 4IUPA 3X24B 1Y07A 1VQ9A 2XG8D 3LGFA 3DB3A 3V8KA 3JCMP 3FEOA 3NTIA 2E6NA 4XTXA 4C0ZA 2E5QA 4EMKA 3JCMQ 4M77F 2HAXA 4C8QB 3PGGA 2EKOA 3P8HA 2QQBA 2DD5A 2KMTA 3E1SA 3NTHA 4MZPA 1G3SA 3M58A 1H641 5CR2A 3CCJT 3GLXA 3MP1A 3PT9A 5I2SA 1IREB 5GMKm 3M5AA 2EQUA 3QSUA 3UT1A 1M9SA 3LLRA 4KUDK 3CCRA 3C95A 5GAOp 2PVGB 1VQ5T 4ZTFA 4A4KA 4C0GA 2CYZB 3PIOA 2VUBA 2EAYA 2D9TA 3M55A 2JNGA 4C8QD 3CEYA 1WJQA 4ATOA 3QKJA 3OBWA 4FSXA 4XU1A 1ZBXA 3QG1A 4BB7A 3OY9A 4PJOC 5CVIA 3QO3A 1U1TA 1LOJA 4IUUA 4ZGEB 3VYHB 4JLIA 1K8AU 2FVUA 1Y7XA 4QQ6A 5I2MA 2QA4T 4E47A 1YITA 1FWZA 5GANe 4C0DB 4J7IA 2L8DA 1VQLA 1PSFA 1S72T 4A53A 1N9RA 4L6V5 1KHIA 4EPCA 3JCMc 4M75F 4R56A 2DTIA 2PUOB 1QP2A 2RO0A 4BE0A 1M1KC 1OI1A 2ZPGB 5GAOr 4C5GA 5FU7B 2JN0A 1KQSA 2RHIA 1X6OA 1I5LA 4M77C 3GIBA 3OS1A 3RERA 4IUTA 2QDYB 4M78G 3CMEA 5GANh 1WQWA 5FRMA 2P4TA 3L2VA 3M54A 4M7AB 5HK3A 4A4HA 3CMET 2LRQA 4J83A 2EJFA 1VQMA 3LGLA 2EQJA 3JCMe 1YIJA 1I81A 1M1FA 2K3YA 3OW2A 3JB9H 2X4JA 3HFNA 1OZ2A 4M75G 4MMKA 3UPUA 3E9GA 1K9MC 5GANj 3GNGA 3CC2T 2QQAA 2M9UA 3H8ZA 1N27A 3RKXA 2LDMA 3PFSA 1KQ1A 2RI3A 2DZCA 3QJYA 3QYHB 1QW1A 2O01E 2E1HA 1NPPA 4EMKB 2DO3A 4QVZA 2V8JA 2XKOC 2ZZDA 4KT0E 3EAEA 4C92B 2QEXA 4XU3A 4XU0A 5GAN5 1LNXA 3HL8A 4E7IA 4M78D 1H3ZA 3HRTA 1SSFA 5GAN8 3TCJA 1KHCA 1M1GA 5J26A 4CRIA 4VUBA 4JRIA 2JTMA 1VIEA 4MMLA 5LJ3f 1WGSA 2KDSA 3JCMg 3FRNA 4M77E 5A2QE 2A7YA 3G7ZA 4M75D 2XDBA 2RJCA 2RK1A 3SDZA 3L42A 1MGQA 2EYQA 2LX9A 4PLLA 1BI3A 3ZEHA 4FIBA 3SWNC 4GLKA 1BIBA 4QQGA 4BY6B 4E7JA 1JRIA 3CD6T 4WF2A 1B34B 3I56A 3ASKA 2GCXA 3CCUT 3KUFA 4PL6A 3E9FA 5J39A 3BFMA 3G4ST 1NJIC 3RMQA 2K57A 1JBMA 3HPWA 3G4SA 2Y90A 4M75E 4ZGDB 4OF1A 1B34A 4OB3B 1VQ9T 3CXCS 5FLXE 3MHXA 4BI4A 4ZGJB 3JCMW 3CCSA 1YJWA 2RJFA 2QI2A 4KUIA 4RCCA 3OYLA 5CK9A 3FLGA 3CC7T 2V8IA 3VUBA 3LYIA 4M78E 5GAOq 3OYMA 3CCST 3CCMA 1JJ2S 3L1AA 3FDRA 3M4GA 2PU9B 3OYDA 2JOYA 2PVOB 2BKDN 2RM4A 2ZPBB 3CPWA 1VQ7T 5LJ5d 1UGPB 1VQPT 3CCLA 4A4FA 1QVFS 2HBPA 2VGNA 4L5GA 5AYFA 1EIFA 3A8HB 2DTOA 4M75A 4P5NA 5GAMd 5IAYA 2M1HA 4M7AF 4D6WA 4BDZA 3OB9A 4EMKC 1IZ6A 4JLGA 4BI8B 5CKEA 2LCCA 4ZTJA 1WJSA 3OS0A 1WJRA 1VQLT 1YCYA 2KVQG 2D6FA 3N5BB 3JSCA 1O9SA 3FC3A 4F7UG 5I21A 5GAN6 4JJNK 2XICA 4OVAA 3OYGA 3C94A 3J81E 1N8RU 2VC8A 4J7FA 3OYKA 2DAQA 1UGSB 3CPFA 4C92F 3X20B 4LDYA 3HRUA 5LJ3e 2GFUA 1NE8A 1KC8U 3BDUA 2VYTA 2VGMA 5LL6S 2EQKA 4DOVA 2K5FA 3OQ5A 2P0PA 2WSEE 1AHJB 2ZPHB 4R55A 3CBOA 4A54A 1VQ6A 4LDUA 2YHTA 3CBMA 4PKCC 4F7UB 2XDPA 2AHJB 5CIUA 2R57A 4BD3A 5CKHA 3LWIA 4V2SA 3L2WA 2X4YA 3QZ9B 4BY6C 1VQ4T 1NZ9A 3URGA 1QVPA 4XAXB 3OYEA 3NTKA 3QUIA 2WACA 4J5YA 4C8QE 4OMFB 4HCCA 4C92E 2OTJT 1I4K1 2LQ8A 3DLMA 3JCMV 2EJ9A 4M7DA 2CZ0B 5FU6C 1XTDA 3X26B 3JCMf 2XK0A 3OYCA 4FT2A 3DLLA 1YJNA 3QPHA 1Y96B 5C0MA 2OTJA 3LW5E 4HA8A 2XHCA 3CCET 3SWNA 2R5MA 3CCVT 5GAOl 1Q86C 4X9DA 2WSCE 2MAMA 1YJ9T 1Y96A 5LJ3j 1QVGS 2FHDA 1VUBA 1G3WA 2RD1A 3JCMJ 2MF2A 3S3NA 1VQ8A 2LTOA 1YJ9A 2X4WA 5FU6B 1VQNT 4M7AD 1M4ZA 1QVFA 4FL6A 1O75A 4JUVA 4JDSA 3L2QA 1M90C 4II1A 3OMGA 3I55A 4C92G 4DA4A 1DJ7B 3CD6A 3ME9A 4EMHA 2HD0A 1RL2A 1XQHA 1NJIU 4Q5WA 3QDRB 3ZFJA 2LT4A 1QP3A 4ZN1A 3INZA 2JZ2A 2XI9A 2ZPEB 3J80E 1WQ7A 2E70A 3CC4T 2M0OA 3F70A 1K73U 2KY9A 3AHUA 2YLBA 3BW1A 2CZ6B 2DXCA 4C92D 3S3OA 3QYGB 3QJ6A 4QQDA 4M7AA 4C8QF 1KD1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8K A;  4PJO G;  1D3B B;  4XTY A;  5GAN 7;  5GAM j;  3JCM P;  2HNI A;  1B34 A;  2DEQ A;  4J6W A;  4XTX A;  4F7U E;  4EMK A;  3JCM Q;  4M77 F;  3SWN B;  5GAM e;  3JCM W;  1U1S A;  4C92 A;  4M7A E;  4C8Q B;  2VXF A;  4EMG A;  3PGG A;  4RCC A;  3FIF A;  4XTV A;  4M77 D;  5DY9 A;  4M78 E;  5GAM g;  5GAO q;  2DJZ A;  3L1A A;  3SB2 A;  3M4G A;  1H64 1;  2RM4 A;  3FB9 A;  5LJ5 d;  5GAN 3;  3EFR A;  2E65 A;  5GMK m;  3JCM d;  5LJ5 g;  3QSU A;  3V8J A;  2DTO A;  5GAN 2;  4M75 A;  5GAO p;  5GAM d;  4M75 E;  4M7A F;  4F7U A;  4C92 C;  1BIA A;  2EAY A;  3JB9 I;  4XTU A;  4C8Q D;  4EMK C;  4JRK A;  3HFO A;  4M77 A;  4M78 C;  5LJ3 d;  4PJO D;  4XU1 A;  3QHS A;  4M78 A;  4PJO C;  4NOY A;  2E64 A;  4M7A G;  3QO3 A;  1U1T A;  1YCY A;  2DZ9 A;  1LOJ A;  2RB6 A;  4NL2 A;  4X9C A;  4JLI A;  3V8L A;  3JCM X;  4PJO A;  2FB7 A;  3V7S A;  3RKY A;  4F7U G;  5I21 A;  5GAN 6;  5GAN e;  3RKW A;  1M5Q 1;  3JCM b;  4M75 C;  4M77 B;  2DXU A;  4A53 A;  2VC8 A;  4DQ2 A;  5GAO n;  4C92 F;  5LJ5 h;  4M7A C;  1N9R A;  2DXT A;  3JB9 J;  3JCM c;  4M75 F;  3JCM h;  2DTI A;  5LJ3 e;  5GAO m;  4QVC A;  4J6Y A;  5GAO r;  3BDU A;  4F7U F;  3HSB A;  2JN0 A;  5GMK i;  5GAM h;  4M7D E;  5GMK l;  4M75 B;  4M77 C;  1I5L A;  3GIB A;  4PJO F;  4A54 A;  3RER A;  1WPY A;  4M78 G;  2YHT A;  5LJ3 g;  1WQW A;  5GAN h;  4F7U B;  4M78 F;  1X01 A;  1KQ2 A;  2FYK A;  2DVE A;  5LJ3 h;  1HK9 A;  2EWN A;  4M7A B;  4PJO B;  4V2S A;  2EJF A;  4HT9 A;  3JCM e;  3JB9 H;  1I81 A;  3EFS A;  4M78 B;  5GMK h;  3HFN A;  4M75 G;  4MMK A;  2DKG A;  3QUI A;  3RES A;  4J5Y A;  4C8Q E;  5GAN j;  3FJP A;  1D3B A;  4XTZ A;  4XU2 A;  4Y91 A;  5GAM f;  4C92 E;  1HXD A;  4PJO E;  1I4K 1;  1I8F A;  3RKX A;  3JCM V;  2EJ9 A;  4M7D A;  4PNO A;  2CGH A;  1KQ1 A;  3JCM f;  2DZC A;  3RIR A;  5GAN g;  4NL3 A;  1Y96 B;  2E1H A;  4EMK B;  4HA8 A;  1TH7 A;  3V7C A;  4C92 B;  3SWN A;  5LJ5 j;  4XU3 A;  4M7D D;  4XU0 A;  5GAO l;  2DTH A;  5GAN 5;  5GAN 4;  1LNX A;  4X9D A;  5LJ5 e;  5GAN d;  2E10 A;  4M78 D;  4RCB A;  5GAN 8;  3JB9 D;  1Y96 A;  4C8Q C;  5LJ3 j;  2E41 A;  4N0A C;  1LJO A;  4C8Q A;  2RD1 A;  3VU3 C;  3JCM J;  4JRI A;  4MML A;  4N0A A;  5LJ3 f;  4M7A D;  4XTW A;  2YLC A;  4HT8 A;  3JCM g;  3V7R A;  4M77 E;  2ZGW A;  3L2Z A;  5GAN f;  4OP0 A;  4JUV A;  4M75 D;  4M7D G;  4J6X A;  4M7D C;  4C92 G;  2I2L A;  1MGQ A;  2VXE A;  4EMH A;  3SWN C;  1M8V A;  2EJG A;  4QVD A;  3JB9 G;  1N9S A;  5GMK j;  1BIB A;  2QTX A;  1JRI A;  3RUX A;  4WF2 A;  1B34 B;  1WNL A;  4M7D F;  5LJ5 f;  3INZ A;  5GMK e;  5CAI A;  1WQ7 A;  3AHU A;  3BFM A;  2YLB A;  3BW1 A;  2K57 A;  2RA2 A;  3BY7 A;  4M77 G;  4C92 D;  4XQ3 A;  1JBM A;  3JB9 F;  4C8Q G;  4M7D B;  4M7A A;  4C8Q F;  2Y90 A; 
#chains in the Genus database with same CATH topology
 1NYF A;  4AFS C;  2HNI A;  2R5A A;  4BE1 A;  1NLP C;  2DD4 A;  1X27 A;  5HK0 A;  1CSK A;  1X6G A;  2VXF A;  4M7A E;  2KK4 A;  3FIF A;  3KFV A;  4XTV A;  5DY9 A;  1VQP A;  5GAM g;  1WHJ A;  2CS7 A;  1Q82 U;  4J8O A;  5GAN 3;  2E65 A;  2BE7 D;  1M90 R;  2P0Q A;  1VQ7 A;  2V1R A;  1G8X A;  1W2B P;  2VVK A;  1VQ5 A;  5L8R E;  3HFO A;  1Q81 U;  4RMO A;  3QHS A;  3GP8 A;  4NL2 A;  5A0L A;  1K1Z A;  1KD1 U;  1YIJ Q;  3VS7 A;  1KC8 C;  3OSS C;  4E7K A;  3MEU A;  4OB1 B;  2LT1 A;  3JCM h;  1S72 A;  1BB9 A;  4F7U F;  2W0Z A;  4B9X A;  4M7D E;  4N4I A;  1WPY A;  5KYW B;  1WXU A;  3EH2 A;  1RAD B;  4XK8 E;  2VKN A;  1X01 A;  1KQ2 A;  2LJ3 A;  2QTV A;  1IGU A;  3QII A;  3PMI A;  4E7Z A;  2NUT A;  4X1V A;  2JTF A;  2M02 A;  1YIT Q;  1VQK T;  3M9Q A;  2E3H A;  4PJO E;  2J6K A;  1TOV A;  2CGH A;  2QQR A;  4C5H A;  1QVG A;  1I0C A;  4J9C A;  1K8A C;  2EFI A;  3G71 T;  1K4U S;  3H0F A;  2DLP A;  4C8Q A;  1OX9 A;  2GQV A;  2J7I A;  2OX7 A;  4WTO B;  3V7R A;  2HSE B;  4LD6 A;  3I56 T;  3AT1 B;  2V1Q A;  2C06 A;  2IG0 A;  4ANJ A;  4M77 G;  2O88 A;  3CCU A;  1IHV A;  2L3R A;  5A0D A;  2XID A;  4XTY A;  5GAM j;  3UWN A;  5CCA A;  4F7U E;  1NJI R;  1BI0 A;  4Y28 E;  3PTA A;  2HKQ B;  5IHK A;  4EMG A;  4M77 D;  3A8O B;  2HQX A;  3CCM T;  3CXC P;  5GAN 2;  2CZ7 B;  2DXB A;  1UTI A;  4N4G A;  2BTT A;  1G83 A;  1UGR B;  4X9C A;  5KH6 A;  2NWM A;  1PRL C;  2LZ6 B;  5GAO m;  4JZ3 A;  4QVC A;  4E2F B;  2KSS A;  4KUL A;  9ATC B;  1HD3 A;  3M56 A;  1VQ9 Q;  4IIM A;  3OYN A;  1T0H A;  1VQ6 T;  2YWW A;  4FCY A;  2JM8 A;  4FM4 B;  3OBY A;  1M1K R;  3OS2 A;  1JU5 C;  2A28 A;  5IH2 A;  2XDD A;  2D0Q B;  1I8F A;  2DL4 A;  3GNF B;  2O31 A;  5KYU A;  5EG2 A;  3WVE B;  2CP3 A;  1JXM A;  1OYX A;  2X3W D;  3CCE A;  1RLQ C;  3A8G B;  5IHN A;  2LVM A;  4C8Q C;  1BK2 A;  5CQY A;  2E41 A;  1YI2 T;  2K2V A;  3NFC A;  1UB4 A;  2HQH A;  1VQO T;  2QTX A;  1Q7Y C;  2A0F B;  3I35 A;  2RI5 A;  3DKM A;  3EG9 A;  4M7D F;  4OML A;  4X34 A;  3MET A;  3CMA A;  3L2U A;  2V8K A;  3JB9 F;  2LQK A;  3X24 B;  2DEU A;  1LCK A;  2XG8 D;  1YWP A;  1TG0 A;  2E6N A;  1VYV A;  2JMA A;  2LJ0 A;  3PGG A;  1U06 A;  2EKO A;  2QQB A;  4F17 A;  3M58 A;  1H64 1;  5CR2 A;  1S72 Q;  3GLX A;  3MP1 A;  5I2S A;  1IRE B;  5GMK m;  3M5A A;  4QKU A;  1D1A A;  4KUD K;  3MKD A;  5GAO p;  2J06 A;  4A4K A;  2YRC A;  2D9T A;  2DRK A;  2ENM A;  4XU1 A;  3SEM A;  1LOJ A;  2FO0 A;  2QA4 T;  1YP5 A;  3QWX X;  2FG0 A;  4C0D B;  4AFZ C;  1N9R A;  1MMA A;  2DTI A;  1QP2 A;  4BE0 A;  1M1K C;  4EIK A;  5GAO r;  2M51 A;  1QLY A;  4C5G A;  2JN0 A;  4M77 C;  1WHM A;  3RER A;  4IUT A;  2CP5 A;  3CME A;  5GAN h;  1WQW A;  1TUD A;  1OX8 A;  2LRQ A;  4J83 A;  1H8K A;  3EFO A;  2VB6 A;  4OMM A;  1QCF A;  3UPU A;  1K9M C;  2PZ1 A;  3GNG A;  4LXC A;  2QQA A;  2M9U A;  3RKX A;  4OMP A;  4KT0 E;  3EAE A;  5GAN 5;  4M78 D;  3TCJ A;  1M1G A;  1TTH B;  2OJ2 A;  4RTT A;  4VUB A;  5LJ3 f;  2JTM A;  3A1P A;  1JQQ A;  3FRN A;  2A7Y A;  4M75 D;  1KK7 A;  3SDZ A;  2LX9 A;  3ZEH A;  3SWN C;  1QVG P;  1D09 B;  2DER A;  1JRI A;  3CD6 T;  1B34 B;  3I56 A;  3ASK A;  2GTJ A;  1SEM A;  3E9F A;  1NJI C;  1NBE B;  1PM3 A;  1OOT A;  3M0U A;  3G4S A;  5FLX E;  3JCM W;  3NGP A;  2RJF A;  2QI2 A;  4RCC A;  5CK9 A;  3VUB A;  5GAO q;  3L1A A;  3M4G A;  3CPW A;  2RM4 A;  1QVF S;  2QGF B;  1D0X A;  2DTO A;  1RAI B;  4P5N A;  5GAM d;  1ZUU A;  1QWE A;  5CKE A;  4ZTJ A;  1WJS A;  3OS0 A;  2AKK A;  1YCY A;  1NM7 A;  1WHL A;  3N5B B;  1RAA B;  5GAN 6;  3CPW P;  6AT1 B;  4JJC A;  3OYG A;  1JJ2 P;  3J81 E;  1N8R U;  1E6H A;  1UGS B;  2RF0 A;  1AOJ A;  2EPD A;  1NE8 A;  2VYT A;  2EQK A;  2K5F A;  1NEB A;  1AHJ B;  4R55 A;  3CBO A;  2DVJ A;  4BD3 A;  1X6B A;  2MPX C;  4IKF A;  4XAX B;  1K73 R;  3QUI A;  2WAC A;  3EG0 A;  3RNJ A;  2OTJ T;  4QT7 A;  3NPF A;  1XTD A;  3JCM f;  1Q86 R;  4FT2 A;  4HA8 A;  2ESW A;  1TSF A;  2KRM A;  3SWN A;  1WHG A;  2R5M A;  5GAO l;  1Q86 C;  4X9D A;  2WSC E;  2QEX Q;  1SF9 A;  1RAG B;  2CT3 A;  1AWX A;  1LVK A;  2FHD A;  2RD1 A;  4OMO A;  2OAW A;  5FU6 B;  1M4Z A;  1WLP B;  4FL6 A;  1PNJ A;  3M0S A;  4JDS A;  2KE9 A;  1DJ7 B;  3CD6 A;  4EMH A;  2HD0 A;  4JZ4 A;  1S1N A;  2MOX A;  2JZ2 A;  2FZG B;  3AHU A;  2CP7 A;  2YLB A;  2DXC A;  3E2U A;  3QYG B;  1KD1 R;  1OEB A;  1Q86 U;  1D3B B;  1ZX6 A;  2DEQ A;  1IXD A;  3SWN B;  1IHW A;  5CQX A;  5A0G A;  3LX7 A;  1I1J A;  3G6E A;  3CC7 A;  1C1A A;  5LJ5 g;  5FRO A;  3O8V A;  1N6A A;  2HKN A;  3PE0 A;  3EGU A;  1WHH A;  3JB9 I;  2P0K A;  1OUL A;  1ZSZ A;  1R0B G;  5LJ3 d;  1VQK Q;  1AWJ A;  2AK5 A;  1VQM Q;  3TQ7 P;  5KE2 A;  5DLO A;  1YIT T;  2LQW A;  2E64 A;  1YHQ Q;  1QWF A;  3V8L A;  4CI0 C;  2M16 A;  2FB7 A;  3VUZ A;  3RKW A;  2QA4 A;  1FMW A;  3VJP A;  3JB9 J;  1WX6 A;  1X69 A;  1QKX A;  5D6Y A;  5M9O A;  5GMK l;  1KJW A;  2KGT A;  1Y71 A;  4LD9 K;  3MCA B;  4UC4 A;  1G3T A;  1WDX A;  4M78 F;  2DVE A;  1V1C A;  5KYN A;  4JS5 A;  1YWO A;  4HT9 A;  1M8M A;  3EFS A;  4RG8 A;  1JO8 A;  1UUE A;  2JW4 A;  2L3Q A;  1HXD A;  3UA6 A;  1HJD A;  2DIG A;  4DEY A;  2HQE A;  1OZ3 A;  1YJN T;  1PCX A;  5GAN 4;  3OA6 A;  5KCH A;  3C0C A;  2H3J A;  3CCL Q;  3CCV Q;  2IVW A;  3PIP A;  4HCK A;  2E5K A;  4NS5 A;  2DIQ A;  3G6E Q;  2KBT A;  4TVR A;  2GBQ A;  4AFU C;  2QQS A;  4M7D G;  1E7O A;  4F04 B;  2VXE A;  1YJW Q;  1Q81 C;  1JEG A;  1U8R A;  5KCO A;  5CKD A;  5LJ5 f;  3EG9 B;  3CXC A;  1SPK A;  2E12 A;  3OS5 A;  2J05 A;  4RTU A;  2QXF A;  4PJO G;  1NYG A;  1TXQ A;  1T3S A;  4FT4 A;  3TSZ A;  2FZC B;  5I11 A;  1VQN Q;  4LN2 A;  3M4Y A;  4E7L A;  2XU8 A;  3SB2 A;  4RTV A;  4ELY C;  4PJJ A;  3EGX A;  1M1K U;  5D6W A;  1JB0 E;  2MMP A;  1CKB A;  2RQU A;  4F7U A;  3CPW S;  1UFF A;  4J9D A;  3CCR T;  1RAE B;  4ME7 A;  4FU6 A;  2CRE A;  2RHY A;  2AZS A;  4JRK A;  4M77 A;  4M78 C;  4LUE A;  2RH2 A;  1M90 U;  1QVG S;  1PSE A;  3R6N A;  2DXU A;  3CCQ A;  2ZPF B;  3OYI A;  2C0O A;  3CCS Q;  2DXT A;  4J6Y A;  2ED1 A;  3CC7 Q;  4IUR A;  3HSB A;  3PVL A;  3M0R A;  2LMJ A;  4M75 B;  2L89 A;  2PNI A;  3RBB B;  1Q7Y R;  2IIM A;  1FMV A;  2HZY A;  2BZY A;  2OTL T;  4BUG A;  5KE3 A;  4M78 B;  4C5E A;  3MP6 A;  4PFZ A;  1JJ2 A;  5C6S A;  2EVR A;  3CD6 Q;  3J7A F;  3RES A;  4ZNX A;  1D3B A;  4XTZ A;  3HP9 A;  3ZL7 C;  2DJQ A;  1SKU B;  2CDT A;  3T9N A;  1KSW A;  5GJW B;  4YTL A;  5IN1 A;  2LC4 A;  2O2O A;  3A8M B;  1UGV A;  1VQP Q;  4BDY A;  5DLQ E;  2E10 A;  3VS6 A;  1G3Y A;  1QKW A;  3BDL A;  3I5S A;  4N0A C;  2KYB A;  3M0P A;  1H92 A;  3VU3 C;  1K73 C;  3O5Z A;  3EHR A;  2ZAE A;  2MYS A;  4OP0 A;  5L23 A;  4M7D C;  4DOW A;  2B86 A;  2VV5 A;  1R77 A;  1BU1 A;  2X4X A;  3S6W A;  4OMN A;  5CAI A;  3VS1 A;  2GF7 A;  1PRM C;  2HDA A;  3JRZ A;  2RA2 A;  1Q82 C;  4M7D B;  1Y07 A;  1GBQ A;  3LGF A;  3V8K A;  4KGV B;  3JCM P;  3FEO A;  3NTI A;  4C0Z A;  2E5Q A;  4ESR A;  2DD5 A;  3NTH A;  4MZP A;  2FZK B;  1U5S A;  2EQU A;  2QA4 Q;  2JMC A;  3LLR A;  3CCR A;  3C95 A;  4ZTF A;  2CYZ B;  3PIO A;  2VUB A;  2EAY A;  2JNG A;  2K79 A;  3OBW A;  2DYB A;  1GBR A;  1WI7 A;  4BB7 A;  3VYH B;  2K2M A;  2KXD A;  5I2M A;  1Y7X A;  1YIT A;  1FWZ A;  1VQL A;  3CCJ Q;  5ECA A;  4R56 A;  2ZPG B;  2COW A;  2LX7 A;  2K6D A;  2RHI A;  1X6O A;  3OS1 A;  3I5R A;  2QDY B;  4M78 G;  3D7S B;  2DIL A;  3L2V A;  3M54 A;  1M3C A;  2EJF A;  1VQM A;  3OW2 A;  4M4Z A;  2A37 A;  3HFN A;  1D0Z A;  1OZ2 A;  2FPD A;  3VS0 A;  5EC7 A;  1N27 A;  3HTR A;  1Y57 A;  2LDM A;  3QYH B;  2DZC A;  1K8A R;  1U3O A;  2HBW A;  2V8J A;  2XKO C;  4QVZ A;  3EGD A;  4XU3 A;  4XU0 A;  4JJB A;  1H3Z A;  1SSF A;  2EKH A;  1ZA1 B;  1WGS A;  3RDV A;  5A2Q E;  4M77 E;  4PLL A;  2DL5 A;  2DBK A;  4LE9 A;  2GCX A;  1VYT A;  2RPN A;  4PL6 A;  3G4S T;  3BFM A;  3RMQ A;  1VQ6 Q;  4HXJ A;  3NHN A;  4M75 E;  1N8R R;  4OF1 A;  3VS4 A;  1KC8 R;  1VQ9 T;  3CXC S;  3LH5 A;  2DFU A;  4PK4 A;  1YJW A;  3OYL A;  3FLG A;  2CH4 W;  5FWC A;  1JJ2 S;  1Q81 R;  3OYD A;  2PVO B;  2BKD N;  2ZPB B;  1VQ7 T;  1UGP B;  2ED0 A;  3CCL A;  1NEG A;  2VGN A;  2DL3 A;  3CCQ Q;  2CT4 A;  2NUT B;  2M1H A;  1OPK A;  1V76 A;  1IZ6 A;  2EBP A;  1VQL T;  4F7U G;  2XIC A;  4OVA A;  2RQR A;  2YDL A;  1B7T A;  4C92 F;  1KC8 U;  3BDU A;  5LL6 S;  2LJ1 A;  3OQ5 A;  4A54 A;  4LDU A;  2EQI A;  2YHT A;  5KYY B;  1MMG A;  4V2S A;  2X4Y A;  4BY6 C;  4LUD A;  1NZ9 A;  1QVP A;  3CMA Q;  1GFC A;  3NTK A;  4C92 E;  1I4K 1;  3DLM A;  5FWB A;  2CZ0 B;  5FU6 C;  3X26 B;  2XK0 A;  3OYC A;  3QPH A;  2DRM A;  5C0M A;  3LW5 E;  2ROT A;  2GGR A;  2CH4 A;  2LCS A;  2MK5 A;  2MAM A;  4CC4 B;  5LJ3 j;  1PD1 A;  1NG2 A;  3H0I A;  2YT6 A;  1G3W A;  2HL5 C;  2MCN A;  1QVF A;  4II1 A;  4DA4 A;  2COZ A;  3ME9 A;  1YFN A;  4HVU A;  4J9I A;  1X43 A;  3QDR B;  4ZN1 A;  2LP5 A;  2QGG A;  2ZPE B;  2KY9 A;  4C92 D;  3UA7 A;  2RMO A;  5FU7 C;  4ELZ C;  5GAN 7;  1YJW T;  1OPL A;  2HEQ A;  2RJE A;  5DM7 R;  5GAM e;  1QVF P;  3G6E T;  3I55 Q;  3JV3 A;  4RTX A;  3CCJ A;  1B3Q A;  1EFN A;  3CCL T;  1WYX A;  1R0C B;  3TEE A;  3PMT A;  1E6G A;  4LDX A;  2JVV A;  2F5T X;  1YJN Q;  1BCM A;  2D8H A;  2F5K A;  1ARK A;  1BIA A;  1IB8 A;  1M27 C;  2DL8 A;  5J3B A;  1G2B A;  2DF6 A;  4HCZ A;  4MDX A;  1M3A A;  3BE3 A;  3X25 B;  4M7A G;  2DZ9 A;  4MZM A;  2HSP A;  1Q7Y U;  4PFO A;  3OYA A;  1M5Q 1;  2EYX A;  3FJ5 A;  4M77 B;  3KBG A;  4IUQ A;  1VOM A;  5GAO n;  4M7A C;  3GPL A;  2QQ9 A;  3R6O A;  2RHX A;  1GCQ A;  2SEM A;  5GMK i;  1IRX A;  1W2B S;  4FW1 A;  4C0D C;  1YBY A;  2R58 A;  3QBY A;  1N5Z A;  3G1J A;  5LJ3 h;  1HK9 A;  1PG5 B;  3WVD B;  1K9M U;  3S3M A;  4F14 A;  2YUN A;  5GMK h;  3ZBD A;  1VQM T;  2KR3 A;  3FJP A;  4XU2 A;  1UG1 A;  1M30 A;  3ER0 A;  1ABO A;  3UDC A;  4PNO A;  1RUW A;  4NL3 A;  4JPB W;  3OW2 S;  2V26 A;  2QAS A;  5LJ5 j;  2FRW A;  4O5V A;  4E7H A;  5IT9 E;  4QW2 A;  2GFA A;  3JB9 D;  1YI2 A;  2L0A A;  1KQS S;  1VQO A;  5GAN f;  4AG1 C;  2ZGW A;  2KEA A;  3JAM E;  1VQ8 T;  1MND A;  5FRN A;  1VQN A;  2I2L A;  3JB9 G;  2XMF A;  5GMK j;  2W10 A;  3CMA T;  3TSW A;  1WNL A;  2RHU A;  4IUV A;  5GMK e;  2DNU A;  3VKI A;  1BKB A;  1VQ4 Q;  3RMS A;  4CC3 A;  1BI2 A;  1WFW A;  2PUK B;  2AKL A;  2DMO A;  3BY7 A;  1GXI E;  5FW9 A;  2O4X B;  4RTY A;  1OQK A;  1SHG A;  1TWB A;  4Z02 A;  3TRE A;  3LH0 A;  1FXX A;  2DJZ A;  4L59 A;  2F2X A;  2CP0 A;  2L3P A;  1V29 B;  2MI6 A;  3A5Z B;  2RN8 A;  3V8J A;  3OSV A;  2A36 A;  3QXE B;  3HRS A;  1VQL Q;  2OAU A;  1XJW B;  1SSH A;  4DBQ A;  3C12 A;  2OTJ Q;  4PJO D;  4LDV A;  4M78 A;  5I22 A;  2RB6 A;  1FX7 A;  4PJO A;  3V7S A;  3RKY A;  2K5L A;  2B8A A;  3MEV A;  3CCQ T;  3A8L B;  3OYB A;  1ZA2 B;  4M75 C;  3MP8 A;  1VQ7 Q;  4KBM B;  4DQ2 A;  2YRV A;  4J9F A;  2F69 A;  2VWF A;  2CZ1 B;  3P8B B;  2KAF A;  1X2K A;  4FYY B;  5LJ3 g;  2EQM A;  3E19 A;  2EWN A;  2J6F A;  2LQN A;  3G4S Q;  2FEI A;  4PJN A;  3CCU Q;  5HCK A;  4A63 B;  1SRL A;  4A4G A;  5GAN g;  3RIR A;  4KGZ B;  1TUG B;  4WCI A;  2RI2 A;  3M53 A;  3EGX B;  2K5I A;  3GF5 A;  4E6R A;  1VIF A;  2ZCF B;  2DTH A;  4HCB A;  2BE9 B;  2LNV A;  3G71 A;  5HKC A;  1ZUY A;  4MZT A;  2A08 A;  2KQW A;  2JS2 A;  5KYU B;  2BUD A;  2HCK A;  2YLC A;  1P92 A;  2XD0 A;  1UHC A;  4RTZ A;  2QG9 B;  2GQI A;  1T0J A;  3CC2 Q;  3CC4 A;  2F2W A;  3TU4 K;  3OYH A;  3CME Q;  4XQ3 A;  1W2B A;  4C8Q G;  2CSI A;  4IUP A;  2DA9 A;  3DB3 A;  4XTX A;  4EMK A;  3JCM Q;  2O9S A;  2HAX A;  4C8Q B;  1UE9 A;  4KGX B;  2BZ8 A;  2EGE A;  2KMT A;  3E1S A;  1KQS P;  5IHI A;  3CCJ T;  1A0N B;  3PT9 A;  3QSU A;  2KRO A;  1HSQ A;  1IGQ A;  1K0X A;  2PVG B;  2GNC A;  3M55 A;  3CEY A;  4ATO A;  3QKJ A;  1Z9Q A;  2KYM A;  1M3B A;  1PKS A;  1ZBX A;  3QG1 A;  3OY9 A;  4PJO C;  1U1T A;  1VQ5 Q;  1FMK A;  1K8A U;  2FVU A;  4QQ6 A;  8AT1 B;  1KQS A;  4E47 A;  2KT1 A;  1I07 A;  5GAN e;  1MNE A;  4EPC A;  2CUD A;  2JXB A;  1OI1 A;  1B07 A;  5FU7 B;  4HVW A;  1I5L A;  4DEX A;  1NLO C;  5FRM A;  2P4T A;  4M7A B;  2CSQ A;  5HK3 A;  3LGL A;  3JB9 H;  1I81 A;  1M1F A;  1KIK A;  4MMK A;  3E9G A;  3MJX A;  4E7S A;  5GAN j;  2C0T A;  4LNP A;  3H8Z A;  2DYI A;  2RI3 A;  3QJY A;  3H0H A;  4EMK B;  2ZZD A;  4C92 B;  2QEX A;  3HL8 A;  1KHC A;  5J26 A;  1GFD A;  1OV3 A;  4MML A;  1ZUK A;  1RAB B;  3JCM g;  1RAC B;  3GBQ A;  1KFZ A;  3EG1 A;  1MGQ A;  2EYQ A;  1BI3 A;  1YN8 A;  2RNA A;  4BY6 B;  4QQG A;  1AD5 A;  4WF2 A;  1HYO A;  3KUF A;  5J39 A;  4PJM A;  3SHW A;  2K57 A;  1AWO A;  1JBM A;  2OI3 A;  4K11 A;  2MIO A;  1VQO Q;  1B34 A;  3I9Q A;  4BI4 A;  4ZGJ B;  4KUI A;  3CC7 T;  2E3I A;  3LYI A;  4M78 E;  3CCS T;  3FDR A;  2PU9 B;  1M2O A;  1AT1 B;  2ABL A;  4A4F A;  2HBP A;  1EIF A;  4M7A F;  2HL3 A;  1SRM A;  2BZX A;  4FYW B;  5KYW A;  1WHK A;  2QK0 A;  2KVQ G;  2D6F A;  1O9S A;  3FC3 A;  2AT1 B;  3C94 A;  2VC8 A;  2Z0W A;  4J7F A;  1UJY A;  2QYZ A;  2DAQ A;  3CPF A;  1K9M R;  3X20 B;  2EGA A;  2P0P A;  2CP6 A;  4PKC C;  4F7U B;  2AHJ B;  5CIU A;  1MMN A;  3L2W A;  3PVQ A;  4CC7 A;  2GTO A;  1D1B A;  1MMD A;  4C8Q E;  4J5Y A;  2LQ8 A;  3JCM V;  1ABQ A;  4M7D A;  1YJN A;  1Y96 B;  1MUZ A;  2XHC A;  3CCV T;  3VS5 A;  2SRC A;  1Y96 A;  2O9V A;  1VUB A;  3JCM J;  4M7A D;  2LTO A;  1YJ9 A;  2H8H A;  2X4W A;  1O75 A;  4JUV A;  3L2Q A;  1M90 C;  4D8D A;  3I55 A;  1AWW A;  1M2V B;  1JXO A;  2AZV A;  2F2V A;  1RL2 A;  1K9A A;  3NMZ C;  1QCO A;  1NJI U;  4Q5W A;  3ZFJ A;  3ULR B;  3INZ A;  4J9H A;  3CC4 T;  3J80 E;  2M0O A;  4FYX B;  3EFO B;  3BW1 A;  2CZ6 B;  1GL5 A;  3S3O A;  2DET A;  1VQ8 Q;  4J6W A;  1RI0 A;  1ZQ1 A;  3MEA A;  2E6Z A;  5CO7 A;  2WSF E;  2MWP A;  2Y4Y A;  2EIF A;  1FYN A;  3VS3 A;  3P8D A;  1ACM B;  3FB9 A;  2RK2 A;  3EFR A;  2EYW A;  3CBP A;  3JCM d;  4AFQ C;  3G71 Q;  1RAF B;  3VYG A;  1YHQ T;  3UF4 A;  4C92 C;  3REB B;  4XTU A;  1LPL A;  4NOY A;  4GBQ A;  1BYM A;  4ZN3 A;  5D7U A;  2BIV A;  5LJ5 h;  5KYX A;  1X75 C;  1GCQ C;  1AZG B;  2L5Q A;  1F1B B;  5CKF A;  4RKU E;  2OTL A;  3EG2 A;  2FRY A;  3M57 A;  4OB2 B;  2PQW A;  1YIJ T;  1AVZ C;  1K76 A;  1UEB A;  4Y92 A;  1RLP C;  4Z88 A;  3CC4 Q;  2G6F X;  3HHT B;  4CC2 A;  4O6J A;  5GAM f;  2D8J A;  1VQK A;  2Y4X A;  2FL7 A;  2EYY A;  3V7C A;  1GCP A;  5LJ5 e;  2DE0 X;  2RHZ A;  5GAN d;  2RJD A;  2MWO A;  2PVD B;  2QEX T;  2K9G A;  4DBH A;  4Z89 A;  2K3X A;  1W70 A;  3VV0 A;  1LJO A;  1ZHI A;  3OW2 P;  4EDU A;  4N0A A;  3I55 T;  2YXY A;  1YCS B;  4XTW A;  1XOV A;  3H41 A;  4J6X A;  1BBZ A;  1SG5 A;  2ROL A;  1M8V A;  1PKT A;  2DK3 A;  2EJG A;  4PLI A;  3EG3 A;  3RUX A;  1UGQ B;  4B6M A;  2DPP B;  2YUQ A;  2H3E B;  4KH0 B;  1MV0 B;  2JM9 A;  5D6X A;  3MO8 A;  4LDW A;  1N8R C;  4OGC A;  1KG1 A;  3DB4 A;  1MHN A;  1U1S A;  2JJ9 A;  4C92 A;  1PC0 A;  1GRI A;  3OYF A;  2LCL A;  1W4S A;  2CKK A;  3QZ5 B;  4A4E A;  2KT8 A;  1YJ9 Q;  3Q1J A;  3MEW A;  5KYY A;  1YHQ A;  5HY6 A;  2RQW A;  3CCE Q;  1G5V A;  3L2R A;  4GY5 A;  1SHF A;  1ZSZ C;  4OB0 B;  4C5I A;  5CKB A;  4HKE A;  1R8O B;  3QDF A;  3JCM X;  1ZSG A;  4JS4 A;  3OMC A;  4PFP A;  2D1X A;  4N4H A;  3JCM b;  2ATC B;  3REA B;  1BI1 A;  1PD0 A;  2E4H A;  3IQL A;  4OMQ A;  4JRP A;  3PNW C;  2FPE A;  1NPR A;  1EZZ B;  3HKS A;  1TUC A;  4C0F A;  2JT4 A;  3H6Z A;  2EGC A;  2C0I A;  5GAM h;  2A3L A;  4PJO F;  3M59 A;  4BAC A;  2FYK A;  1VQ4 A;  2O4X A;  3OYY A;  4PJO B;  2X35 A;  4J9G A;  3CQT A;  2NLU A;  2DKG A;  4OGE A;  3SD4 A;  4Y91 A;  2X51 A;  3C4S A;  3WXM B;  4BE2 A;  2ZPI B;  4MDW A;  4B9W A;  3CC2 A;  4AMC A;  1AZE A;  3GOX A;  4GLM A;  1TH7 A;  1T3L A;  2CUB A;  3H9N A;  2J6O A;  4D8K A;  3OYJ A;  4M7D D;  2RQV A;  4RCB A;  2G3R A;  3CCV A;  1OU9 A;  2F1L A;  3SFM A;  3X28 B;  4RG2 A;  4HT8 A;  3L2Z A;  1XNI A;  4PJL A;  3M0T A;  4BI3 A;  2P4R A;  1RAH B;  3LWH A;  1D0Y A;  4KH1 B;  4QVD A;  1VYU A;  1N9S A;  2K4Y A;  2QAZ A;  2L3S A;  2IPO B;  4JRQ A;  4FYV B;  3KXT A;  2JUF A;  2X9H A;  1VQ9 A;  2L2P A;  1Q82 R;  2EYZ A;  4M77 F;  1TS9 A;  7AT1 B;  4AT1 B;  1H3H A;  3P8H A;  5IXF A;  1G3S A;  1Z9Z A;  3UT1 A;  1M9S A;  3VRZ A;  4AG2 C;  1VQ5 T;  1C6V X;  4C0G A;  2KXC A;  4J9B A;  1PHT A;  2LNH B;  4C8Q D;  1WJQ A;  4FSX A;  1UEC A;  4JJD A;  5CVI A;  2AIR B;  3QO3 A;  4ZGE B;  3QWY A;  4IUU A;  4JLI A;  2CP2 A;  1C0M A;  4J7I A;  2L8D A;  3RR6 A;  1PSF A;  1S72 T;  4A53 A;  3THK A;  2VAS A;  4L6V 5;  1KHI A;  3JCM c;  4M75 F;  2RO0 A;  2PUO B;  2FPF A;  4FSS A;  2K7A A;  5KYX B;  4KRT A;  2RQT A;  3GIB A;  1UDL A;  1WZO A;  4IIO A;  3VS2 A;  4F16 A;  1ZLM A;  2YSQ A;  2DBM A;  1D1C A;  4A4H A;  3CME T;  3EH1 A;  2EQJ A;  3JCM e;  1YIJ A;  2K3Y A;  1QCN A;  2X4J A;  4M75 G;  1ZSZ B;  4ORZ A;  3MPU B;  4DBF A;  3CC2 T;  3PFS A;  1KQ1 A;  1QW1 A;  2HMA A;  2O01 E;  2E1H A;  1NPP A;  2DO3 A;  2JS0 A;  1YI2 Q;  5GJV B;  1LNX A;  1QMC A;  4E7I A;  3HRT A;  5GAN 8;  1OU8 A;  2NUP B;  2YUP A;  1J3T A;  4CRI A;  4JRI A;  1VIE A;  2KDS A;  3G7Z A;  1WIE A;  2RJC A;  2XDB A;  2RK1 A;  3L42 A;  2EW3 A;  4FIB A;  4GLK A;  1Q95 G;  5AT1 B;  1BIB A;  4E7J A;  3EGD B;  2M0Y A;  1X2Q A;  2KRN A;  3CCU T;  8ATC B;  3HPW A;  2Y90 A;  1WXB A;  4ZGD B;  4OB3 B;  3MHX A;  1AEY A;  3CCS A;  2KNB B;  2K3B A;  2V8I A;  2YRD A;  3CCM A;  3OYM A;  5IXB A;  1TU0 B;  1UJ0 A;  2JOY A;  2I0N A;  1W6X A;  5LJ5 d;  1VQP T;  5AYF A;  4L5G A;  3A8H B;  4M75 A;  1IO6 A;  5IAY A;  4D6W A;  4BDZ A;  3OB9 A;  4EMK C;  4JLG A;  4BI8 B;  4FW2 A;  2LCC A;  3A98 A;  2DM1 A;  1WJR A;  2QDL A;  3JSC A;  1W1F A;  5I21 A;  4JJN K;  1UHF A;  3EHQ A;  3CCM Q;  2OTL Q;  2JTE A;  3OYK A;  1PWT A;  2P84 A;  4LDY A;  2KI7 A;  1Y0M A;  3HRU A;  5LJ3 e;  2GFU A;  2VGM A;  4DOV A;  2WSE E;  1WXT A;  1BCO A;  2ZPH B;  3M0Q A;  1VQ6 A;  4RUG A;  1EX4 A;  2X3X D;  3CBM A;  4J9E A;  2XDP A;  2R57 A;  5CKH A;  3LWI A;  1YNZ A;  1VA7 A;  3QZ9 B;  1VQ4 T;  1MV3 A;  3URG A;  1M2V A;  3TVT A;  2KRS A;  3OYE A;  3U23 A;  3VRY A;  1ZBJ A;  4RTW A;  4OMF B;  2DX1 A;  4HCC A;  3I56 Q;  2EJ9 A;  3CCR Q;  1QQJ A;  3DLL A;  4DBR A;  2OTJ A;  1K0S A;  2COY A;  2NYS A;  3CCE T;  4R0K A;  1CKA A;  1RI9 A;  2NUP A;  1YJ9 T;  2MF2 A;  3S3N A;  1VQ8 A;  1VQN T;  3UAT A;  1I5O B;  2NUZ A;  2PTK A;  4HVV A;  3OMG A;  4C92 G;  1XQH A;  2ECZ A;  2LT4 A;  1QP3 A;  2XI9 A;  1WQ7 A;  2E70 A;  1K73 U;  3F70 A;  4Z8A A;  2DL7 A;  2YUO A;  1WA7 A;  2D0N A;  3QJ6 A;  4QQD A;  4M7A A;  4C8Q F;  1KD1 C; 
#chains in the Genus database with same CATH homology
 1Q86 U;  1D3B B;  5FU7 C;  4ELZ C;  5GAN 7;  1YJW T;  2HNI A;  2R5A A;  2DEQ A;  4J6W A;  1RI0 A;  1ZQ1 A;  3MEA A;  4BE1 A;  2RJE A;  3SWN B;  2DD4 A;  2E6Z A;  5CO7 A;  5GAM e;  2WSF E;  5HK0 A;  5DM7 R;  2MWP A;  2VXF A;  3G6E T;  4M7A E;  2KK4 A;  3FIF A;  4XTV A;  5CQX A;  2Y4Y A;  2EIF A;  3LX7 A;  5DY9 A;  5A0G A;  3CCJ A;  1VQP A;  5GAM g;  3P8D A;  3CCL T;  3G6E A;  2CS7 A;  3CC7 A;  1Q82 U;  3FB9 A;  4J8O A;  3TEE A;  2RK2 A;  3PMT A;  5GAN 3;  2E65 A;  3EFR A;  3CBP A;  3JCM d;  5LJ5 g;  4LDX A;  2JVV A;  2F5T X;  5FRO A;  2P0Q A;  1VQ7 A;  3O8V A;  1N6A A;  3VYG A;  2F5K A;  1YHQ T;  4C92 C;  1BIA A;  3JB9 I;  2P0K A;  4XTU A;  1VQ5 A;  5L8R E;  5J3B A;  3HFO A;  1Q81 U;  5LJ3 d;  4RMO A;  3QHS A;  4HCZ A;  4MDX A;  5KE2 A;  5DLO A;  4NOY A;  3X25 B;  2E64 A;  3GP8 A;  1YIT T;  4M7A G;  2DZ9 A;  3V8L A;  4NL2 A;  4MZM A;  4CI0 C;  2M16 A;  2FB7 A;  5A0L A;  1BYM A;  1Q7Y U;  3VUZ A;  1KD1 U;  4ZN3 A;  3RKW A;  3OYA A;  1M5Q 1;  4M77 B;  1KC8 C;  3KBG A;  4IUQ A;  3OSS C;  2BIV A;  2QA4 A;  5GAO n;  4E7K A;  3MEU A;  5LJ5 h;  4OB1 B;  4M7A C;  3GPL A;  2QQ9 A;  3VJP A;  3JB9 J;  2LT1 A;  3JCM h;  1X75 C;  1S72 A;  2L5Q A;  2RHX A;  3R6O A;  4F7U F;  4B9X A;  5CKF A;  4RKU E;  5GMK i;  4M7D E;  4N4I A;  5D6Y A;  5M9O A;  1W2B S;  5GMK l;  2OTL A;  1Y71 A;  4LD9 K;  3MCA B;  4UC4 A;  4C0D C;  1WPY A;  1YBY A;  1G3T A;  2R58 A;  3QBY A;  4M78 F;  4XK8 E;  1X01 A;  1KQ2 A;  3M57 A;  2DVE A;  2PQW A;  4OB2 B;  1HK9 A;  5LJ3 h;  1YIJ T;  1UEB A;  3QII A;  3WVD B;  1K9M U;  4JS5 A;  3PMI A;  4HT9 A;  3S3M A;  3EFS A;  2JTF A;  5GMK h;  3HHT B;  3ZBD A;  4RG8 A;  1VQM T;  3FJP A;  1VQK T;  4O6J A;  3M9Q A;  4XU2 A;  5GAM f;  1HXD A;  3ER0 A;  4PJO E;  3UDC A;  4PNO A;  2CGH A;  2QQR A;  2Y4X A;  4C5H A;  1QVG A;  4NL3 A;  1VQK A;  3OW2 S;  2DIG A;  2FL7 A;  2HQE A;  1OZ3 A;  3V7C A;  1YJN T;  1K8A C;  5LJ5 j;  2EFI A;  3G71 T;  4O5V A;  5GAN 4;  3OA6 A;  5KCH A;  4E7H A;  5IT9 E;  2H3J A;  5LJ5 e;  2RHZ A;  5GAN d;  4IKF A;  2RJD A;  2MWO A;  2PVD B;  4QW2 A;  2QEX T;  2GFA A;  3JB9 D;  2K3X A;  1YI2 A;  3VV0 A;  1LJO A;  4C8Q A;  2IVW A;  1ZHI A;  3PIP A;  4EDU A;  2GQV A;  4N0A A;  4NS5 A;  3I55 T;  2DIQ A;  4XTW A;  1KQS S;  4TVR A;  1VQO A;  5GAN f;  3V7R A;  1XOV A;  2ZGW A;  2QQS A;  4M7D G;  4J6X A;  3JAM E;  1VQ8 T;  5FRN A;  1VQN A;  2I2L A;  2VXE A;  4LD6 A;  1M8V A;  2DK3 A;  3I56 T;  2EJG A;  3JB9 G;  1Q81 C;  5GMK j;  4PLI A;  2C06 A;  1U8R A;  5KCO A;  3RUX A;  3CMA T;  1UGQ B;  1WNL A;  2RHU A;  5CKD A;  4IUV A;  5GMK e;  5LJ5 f;  2DPP B;  2IG0 A;  3VKI A;  1BKB A;  3CXC A;  3RMS A;  2E12 A;  3OS5 A;  1BI2 A;  2PUK B;  3BY7 A;  4M77 G;  1GXI E;  5D6X A;  3MO8 A;  4LDW A;  1N8R C;  4OGC A;  3CCU A;  2QXF A;  2L3R A;  5A0D A;  2XID A;  2O4X B;  4PJO G;  4XTY A;  1KG1 A;  5GAM j;  3UWN A;  5CCA A;  4FT4 A;  4F7U E;  3DB4 A;  1BI0 A;  1MHN A;  4Y28 E;  1U1S A;  4C92 A;  3PTA A;  4EMG A;  3OYF A;  2LCL A;  4Z02 A;  1W4S A;  3TRE A;  4M77 D;  3M4Y A;  3A8O B;  3LH0 A;  1FXX A;  2XU8 A;  4E7L A;  2CKK A;  2DJZ A;  3QZ5 B;  4A4E A;  4L59 A;  3SB2 A;  3Q1J A;  2HQX A;  3MEW A;  3CCM T;  1V29 B;  2MI6 A;  3A5Z B;  4ELY C;  5HY6 A;  1YHQ A;  3V8J A;  1M1K U;  3OSV A;  3QXE B;  5GAN 2;  5D6W A;  1JB0 E;  1G5V A;  3L2R A;  3HRS A;  2CZ7 B;  2MMP A;  4GY5 A;  4F7U A;  2DXB A;  2OAU A;  3CPW S;  4N4G A;  3CCR T;  4OB0 B;  4ME7 A;  4C5I A;  4FU6 A;  5CKB A;  2RHY A;  3C12 A;  4JRK A;  4HKE A;  1R8O B;  4M77 A;  4M78 C;  4PJO D;  4LDV A;  4M78 A;  1UGR B;  2RB6 A;  1FX7 A;  2RH2 A;  4X9C A;  5KH6 A;  3JCM X;  1M90 U;  4PJO A;  3V7S A;  1PSE A;  2K5L A;  2B8A A;  3MEV A;  3OMC A;  3RKY A;  3A8L B;  3CCQ T;  4JS4 A;  3OYB A;  4N4H A;  3JCM b;  4M75 C;  1BI1 A;  2DXU A;  3MP8 A;  4JRP A;  4KBM B;  3CCQ A;  4DQ2 A;  2ZPF B;  3PNW C;  3OYI A;  2YRV A;  2DXT A;  1NPR A;  3HKS A;  4C0F A;  5GAO m;  4QVC A;  2KSS A;  2F69 A;  3H6Z A;  4J6Y A;  4KUL A;  4IUR A;  3HSB A;  2CZ1 B;  3P8B B;  2KAF A;  5GAM h;  3M56 A;  2A3L A;  4M75 B;  2L89 A;  4PJO F;  5LJ3 g;  3M59 A;  4BAC A;  2FYK A;  2EQM A;  3OYN A;  3E19 A;  1VQ4 A;  2OTL T;  2O4X A;  1VQ6 T;  2EWN A;  3OYY A;  4PJO B;  4BUG A;  2X35 A;  4FM4 B;  3OBY A;  2NLU A;  4M78 B;  4C5E A;  3MP6 A;  5KE3 A;  3OS2 A;  1JJ2 A;  5C6S A;  2DKG A;  3J7A F;  3RES A;  4OGE A;  3SD4 A;  4Y91 A;  1D3B A;  4XTZ A;  3HP9 A;  2XDD A;  2D0Q B;  1I8F A;  4A4G A;  3GNF B;  3C4S A;  3WXM B;  4BE2 A;  2ZPI B;  4MDW A;  5GAN g;  3RIR A;  4B9W A;  3CC2 A;  3T9N A;  2RI2 A;  3M53 A;  3GOX A;  2K5I A;  3GF5 A;  4YTL A;  1TH7 A;  5EG2 A;  3WVE B;  5IN1 A;  1VIF A;  4M7D D;  3OYJ A;  2ZCF B;  2DTH A;  2LC4 A;  3A8M B;  4HCB A;  4BDY A;  1OYX A;  5DLQ E;  2E10 A;  4RCB A;  3CCE A;  1G3Y A;  2LNV A;  3G71 A;  2G3R A;  3A8G B;  5HKC A;  2LVM A;  4C8Q C;  4MZT A;  3CCV A;  2KQW A;  3BDL A;  5CQY A;  2E41 A;  4N0A C;  3VU3 C;  1K73 C;  2BUD A;  3SFM A;  1YI2 T;  2K2V A;  3X28 B;  2YLC A;  4RG2 A;  1P92 A;  4HT8 A;  3NFC A;  3L2Z A;  1XNI A;  4OP0 A;  1UB4 A;  2XD0 A;  4BI3 A;  4M7D C;  4DOW A;  1VQO T;  2VV5 A;  3LWH A;  4QVD A;  1N9S A;  3CC4 A;  2K4Y A;  2QTX A;  1Q7Y C;  2X4X A;  2RI5 A;  3DKM A;  3TU4 K;  3OYH A;  4M7D F;  3S6W A;  5CAI A;  4X34 A;  4JRQ A;  2GF7 A;  3MET A;  3JRZ A;  3KXT A;  3CMA A;  2JUF A;  2RA2 A;  3L2U A;  1Q82 C;  2V8K A;  4XQ3 A;  1W2B A;  4M7D B;  3JB9 F;  4C8Q G;  2LQK A;  4IUP A;  3X24 B;  1Y07 A;  1VQ9 A;  2XG8 D;  3LGF A;  3DB3 A;  3V8K A;  3JCM P;  3FEO A;  3NTI A;  2E6N A;  4XTX A;  4C0Z A;  2E5Q A;  4EMK A;  3JCM Q;  4M77 F;  2HAX A;  4C8Q B;  3PGG A;  2EKO A;  3P8H A;  2QQB A;  2DD5 A;  2KMT A;  3E1S A;  3NTH A;  4MZP A;  1G3S A;  3M58 A;  1H64 1;  5CR2 A;  3CCJ T;  3GLX A;  3MP1 A;  3PT9 A;  5I2S A;  1IRE B;  5GMK m;  3M5A A;  2EQU A;  3QSU A;  3UT1 A;  1M9S A;  3LLR A;  4KUD K;  3CCR A;  3C95 A;  5GAO p;  2PVG B;  1VQ5 T;  4ZTF A;  4A4K A;  4C0G A;  2CYZ B;  3PIO A;  2VUB A;  2EAY A;  2D9T A;  3M55 A;  2JNG A;  4C8Q D;  3CEY A;  1WJQ A;  4ATO A;  3QKJ A;  3OBW A;  4FSX A;  4XU1 A;  1ZBX A;  3QG1 A;  4BB7 A;  3OY9 A;  4PJO C;  5CVI A;  3QO3 A;  1U1T A;  1LOJ A;  4IUU A;  4ZGE B;  3VYH B;  4JLI A;  1K8A U;  2FVU A;  1Y7X A;  4QQ6 A;  5I2M A;  2QA4 T;  4E47 A;  1YIT A;  1FWZ A;  5GAN e;  4C0D B;  4J7I A;  2L8D A;  1VQL A;  1PSF A;  1S72 T;  4A53 A;  1N9R A;  4L6V 5;  1KHI A;  4EPC A;  3JCM c;  4M75 F;  4R56 A;  2DTI A;  2PUO B;  1QP2 A;  2RO0 A;  4BE0 A;  1M1K C;  1OI1 A;  2ZPG B;  5GAO r;  4C5G A;  5FU7 B;  2JN0 A;  1KQS A;  2RHI A;  1X6O A;  1I5L A;  4M77 C;  3GIB A;  3OS1 A;  3RER A;  4IUT A;  2QDY B;  4M78 G;  3CME A;  5GAN h;  1WQW A;  5FRM A;  2P4T A;  3L2V A;  3M54 A;  4M7A B;  5HK3 A;  4A4H A;  3CME T;  2LRQ A;  4J83 A;  2EJF A;  1VQM A;  3LGL A;  2EQJ A;  3JCM e;  1YIJ A;  1I81 A;  1M1F A;  2K3Y A;  3OW2 A;  3JB9 H;  2X4J A;  3HFN A;  1OZ2 A;  4M75 G;  4MMK A;  3UPU A;  3E9G A;  1K9M C;  5GAN j;  3GNG A;  3CC2 T;  2QQA A;  2M9U A;  3H8Z A;  1N27 A;  3RKX A;  2LDM A;  3PFS A;  1KQ1 A;  2RI3 A;  2DZC A;  3QJY A;  3QYH B;  1QW1 A;  2O01 E;  2E1H A;  1NPP A;  4EMK B;  2DO3 A;  4QVZ A;  2V8J A;  2XKO C;  2ZZD A;  4KT0 E;  3EAE A;  4C92 B;  2QEX A;  4XU3 A;  4XU0 A;  5GAN 5;  1LNX A;  3HL8 A;  4E7I A;  4M78 D;  1H3Z A;  3HRT A;  1SSF A;  5GAN 8;  3TCJ A;  1KHC A;  1M1G A;  5J26 A;  4CRI A;  4VUB A;  4JRI A;  2JTM A;  1VIE A;  4MML A;  5LJ3 f;  1WGS A;  2KDS A;  3JCM g;  3FRN A;  4M77 E;  5A2Q E;  2A7Y A;  3G7Z A;  4M75 D;  2XDB A;  2RJC A;  2RK1 A;  3SDZ A;  3L42 A;  1MGQ A;  2EYQ A;  2LX9 A;  4PLL A;  1BI3 A;  3ZEH A;  4FIB A;  3SWN C;  4GLK A;  1BIB A;  4QQG A;  4BY6 B;  4E7J A;  1JRI A;  3CD6 T;  4WF2 A;  1B34 B;  3I56 A;  3ASK A;  2GCX A;  3CCU T;  3KUF A;  4PL6 A;  3E9F A;  5J39 A;  3BFM A;  3G4S T;  1NJI C;  3RMQ A;  2K57 A;  1JBM A;  3HPW A;  3G4S A;  2Y90 A;  4M75 E;  4ZGD B;  4OF1 A;  1B34 A;  4OB3 B;  1VQ9 T;  3CXC S;  5FLX E;  3MHX A;  4BI4 A;  4ZGJ B;  3JCM W;  3CCS A;  1YJW A;  2RJF A;  2QI2 A;  4KUI A;  4RCC A;  3OYL A;  5CK9 A;  3FLG A;  3CC7 T;  2V8I A;  3VUB A;  3LYI A;  4M78 E;  5GAO q;  3OYM A;  3CCS T;  3CCM A;  1JJ2 S;  3L1A A;  3FDR A;  3M4G A;  2PU9 B;  3OYD A;  2JOY A;  2PVO B;  2BKD N;  2RM4 A;  2ZPB B;  3CPW A;  1VQ7 T;  5LJ5 d;  1UGP B;  1VQP T;  3CCL A;  4A4F A;  1QVF S;  2HBP A;  2VGN A;  4L5G A;  5AYF A;  1EIF A;  3A8H B;  2DTO A;  4M75 A;  4P5N A;  5GAM d;  5IAY A;  2M1H A;  4M7A F;  4D6W A;  4BDZ A;  3OB9 A;  4EMK C;  1IZ6 A;  4JLG A;  4BI8 B;  5CKE A;  2LCC A;  4ZTJ A;  1WJS A;  3OS0 A;  1WJR A;  1VQL T;  1YCY A;  2KVQ G;  2D6F A;  3N5B B;  3JSC A;  1O9S A;  3FC3 A;  4F7U G;  5I21 A;  5GAN 6;  4JJN K;  2XIC A;  4OVA A;  3OYG A;  3C94 A;  3J81 E;  1N8R U;  2VC8 A;  4J7F A;  3OYK A;  2DAQ A;  1UGS B;  3CPF A;  4C92 F;  3X20 B;  4LDY A;  3HRU A;  5LJ3 e;  2GFU A;  1NE8 A;  1KC8 U;  3BDU A;  2VYT A;  2VGM A;  5LL6 S;  2EQK A;  4DOV A;  2K5F A;  3OQ5 A;  2P0P A;  2WSE E;  1AHJ B;  2ZPH B;  4R55 A;  3CBO A;  4A54 A;  1VQ6 A;  4LDU A;  2YHT A;  3CBM A;  4PKC C;  4F7U B;  2XDP A;  2AHJ B;  5CIU A;  2R57 A;  4BD3 A;  5CKH A;  3LWI A;  4V2S A;  3L2W A;  2X4Y A;  3QZ9 B;  4BY6 C;  1VQ4 T;  1NZ9 A;  3URG A;  1QVP A;  4XAX B;  3OYE A;  3NTK A;  3QUI A;  2WAC A;  4J5Y A;  4C8Q E;  4OMF B;  4HCC A;  4C92 E;  2OTJ T;  1I4K 1;  2LQ8 A;  3DLM A;  3JCM V;  2EJ9 A;  4M7D A;  2CZ0 B;  5FU6 C;  1XTD A;  3X26 B;  3JCM f;  2XK0 A;  3OYC A;  4FT2 A;  3DLL A;  1YJN A;  3QPH A;  1Y96 B;  5C0M A;  2OTJ A;  3LW5 E;  4HA8 A;  2XHC A;  3CCE T;  3SWN A;  2R5M A;  3CCV T;  5GAO l;  1Q86 C;  4X9D A;  2WSC E;  2MAM A;  1YJ9 T;  1Y96 A;  5LJ3 j;  1QVG S;  2FHD A;  1VUB A;  1G3W A;  2RD1 A;  3JCM J;  2MF2 A;  3S3N A;  1VQ8 A;  2LTO A;  1YJ9 A;  2X4W A;  5FU6 B;  1VQN T;  4M7A D;  1M4Z A;  1QVF A;  4FL6 A;  1O75 A;  4JUV A;  4JDS A;  3L2Q A;  1M90 C;  4II1 A;  3OMG A;  3I55 A;  4C92 G;  4DA4 A;  1DJ7 B;  3CD6 A;  3ME9 A;  4EMH A;  2HD0 A;  1RL2 A;  1XQH A;  1NJI U;  4Q5W A;  3QDR B;  3ZFJ A;  2LT4 A;  1QP3 A;  4ZN1 A;  3INZ A;  2JZ2 A;  2XI9 A;  2ZPE B;  3J80 E;  1WQ7 A;  2E70 A;  3CC4 T;  2M0O A;  3F70 A;  1K73 U;  2KY9 A;  3AHU A;  2YLB A;  3BW1 A;  2CZ6 B;  2DXC A;  4C92 D;  3S3O A;  3QYG B;  3QJ6 A;  4QQD A;  4M7A A;  4C8Q F;  1KD1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...