3JCMg

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
66
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 9
structure length 66
sequence length 80
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmg00
2HNIA 3BW1A 1I8FA 4XTWA 4M78C 4M75C 4WF2A 3HFNA 2I2LA 4XU3A 5LJ3f 3RKYA 5LJ5f 4M7DE 1LJOA 3V7RA 4C8QB 4M7DF 2DJZA 2RD1A 2Y90A 1I81A 3JCMX 5LJ3d 2E65A 4EMGA 4M75G 4M78G 2YLCA 3JB9I 5DY9A 3V8JA 3QUIA 4HA8A 5GMKj 3QSUA 3BFMA 4J6YA 1U1SA 2E1HA 3SWNB 5GAOp 4XTYA 3HSBA 3JB9D 1HK9A 1X01A 5GAMj 1KQ2A 5GAMg 4M77E 3JB9J 3AHUA 4M7DA 5GAOr 2DVEA 3RKXA 4M77C 5GAN7 3L2ZA 2EJ9A 4XTVA 4PJOF 3JB9H 4M75D 4M78D 4RCCA 5LJ5h 4A53A 5LJ3h 4M7AB 4RCBA 4C92D 5LJ5j 1KQ1A 4M77G 2K57A 2E41A 1JBMA 4NL2A 5GMKi 5LJ5g 3JCMV 4C8QE 2DKGA 5LJ3g 5GAMd 4C8QF 3RIRA 1M5Q1 3EFRA 4JUVA 4C92B 4M7DC 3QO3A 5LJ3e 4M77A 3RERA 5GANf 1LNXA 5LJ5d 2EAYA 3FJPA 1D3BB 2CGHA 5GMKm 1WQWA 5GAOl 5GMKh 2RA2A 3INZA 2EWNA 4F7UB 4M7DG 3QHSA 4Y91A 3M4GA 4XU2A 3JCMQ 4J6XA 4HT9A 1WQ7A 3JCMf 3SB2A 2EJGA 5GAMh 4C8QA 3JCMW 3VU3C 2YLBA 2E10A 3JCMd 4QVCA 3V8LA 5GMKe 4M7AE 1B34A 4A54A 3JB9F 3V8KA 4PJOE 4M7AF 1MGQA 1Y96A 2FB7A 4PJOC 3JCMc 2DXUA 4EMKB 3SWNA 5GAMe 4M7DD 5I21A 4XU1A 4C92E 3L1AA 2ZGWA 2JN0A 1H641 1N9RA 4PJOG 4M75B 4M78B 2YHTA 4XTZA 4C92F 4C8QC 5GANg 3JCMJ 5GANj 4J5YA 1N9SA 5LJ5e 3GIBA 4F7UE 3EFSA 3JCMh 5GAOm 4M7AA 1M8VA 4F7UF 4PJOA 4C8QG 4XTXA 3JCMg 5GAN3 4MMLA 3SWNC 5GANd 2RB6A 4M77D 4X9CA 4JLIA 4F7UG 3HFOA 4PNOA 4QVDA 3JCMb 5GAN5 4N0AC 3V7CA 3JCMe 5GAOn 4XU0A 1I5LA 1D3BA 4M77B 5GAN8 3V7SA 2RM4A 4JRKA 2DTOA 4F7UA 1BIAA 4M7AC 2DTIA 4C8QD 3PGGA 2DZ9A 4M78E 4M75E 3FIFA 1TH7A 3JCMP 4HT8A 3BY7A 4JRIA 4XTUA 4M75F 4M78F 3JB9G 5GANh 4M7AG 1YCYA 3BDUA 4C92C 2QTXA 4N0AA 2DTHA 4DQ2A 2DXTA 1HXDA 5CAIA 1LOJA 4M7DB 2VXEA 4MMKA 1B34B 4J6WA 3RUXA 5GMKl 3RESA 4NL3A 4EMKA 5GAN6 3RKWA 2DZCA 1BIBA 1Y96B 1U1TA 2DEQA 4C92G 4X9DA 2FYKA 2E64A 5GANe 2VXFA 5GAN4 2EJFA 4M75A 4M78A 5GAOq 4XQ3A 4M7AD 1WNLA 4OP0A 4C92A 4PJOD 4M77F 4EMHA 4V2SA 3FB9A 5GAMf 1JRIA 4NOYA 4EMKC 1WPYA 4PJOB 5GAN2 5LJ3j 2VC8A 1I4K1
chains in the Genus database with same CATH superfamily
1KQSA 3E1SA 2P4RA 1Q81U 5I11A 3H6ZA 2HSPA 2QQSA 1NJIC 3QSUA 2BE9B 4BACA 3SWNB 5GAOp 3CXCA 3G6EA 1IB8A 2KRMA 3QDFA 5I2MA 2L2PA 1M9SA 3RKXA 5GAN7 1PRMC 4IUVA 4BY6C 2RO0A 4BUGA 2LJ3A 3JB9H 4RCBA 5LJ5j 2P4TA 4X1VA 5IHKA 3J7AF 5IH2A 2E6ZA 3CCSQ 4QQ6A 1D3BB 4F16A 2KI7A 3M4GA 1YWOA 5GAMh 2JNGA 1IZ6A 1YJ9T 2DL4A 3GPLA 2D0QB 3MP1A 1VQ6A 1BK2A 2LZ6B 1W2BP 1WX6A 2DL8A 3HPWA 1KC8C 1CKBA 2EYXA 1BI0A 3L2VA 4FCYA 2A0FB 1KD1R 5AYFA 2XI9A 4IIMA 1VQKA 4ZTJA 2DIQA 3GNFB 2ZPGB 2VKNA 3OYFA 1QWEA 2RHYA 1WHGA 3M53A 3LWHA 2EBPA 2DTOA 3I55Q 3CMEA 1KD1U 1VYUA 1UGPB 3FIFA 3OW2S 3BY7A 4XTUA 2GGRA 1OQKA 1JO8A 2DTHA 1D1AA 2K2VA 1LOJA 2DL3A 1B34B 4MMKA 2C06A 1VQOQ 2E64A 3CCJA 1R0BG 1UGQB 3CC7A 3QBYA 4KUDK 4IKFA 3QZ5B 4M77F 2RHZA 3FB9A 2H3EB 1VQ5Q 3VUZA 2RI3A 2X4YA 4FYYB 2JUFA 1RL2A 2EKOA 3S6WA 2E12A 5HY6A 1I8FA 3C12A 3PFSA 4M7DE 4XU3A 1FX7A 1MMGA 1AWXA 4PJNA 4J9BA 3UPUA 2R57A 4HVWA 1TTHB 4FT2A 2QQ9A 1PHTA 3EFOB 1Q86R 4JRPA 1G3YA 2GQVA 1X01A 2DXBA 2ZPHB 2CDTA 2RMOA 1XJWB 3A8OB 1WI7A 5LJ5h 4M7AB 1S1NA 4QQGA 4C8QF 3RIRA 3QIIA 2EQJA 2LP5A 4C0ZA 4AFSC 3JAME 2QG9B 1Q86U 1Q7YR 3O5ZA 3DB3A 3JCMf 2KK4A 2HEQA 2QEXA 1ZA2B 2L89A 1VQ4T 3V8LA 2OTJQ 1VQNQ 5GMKe 3REBB 1AOJA 5C0MA 2LT4A 1YJWA 3SWNA 1EFNA 4E7KA 5GANj 4M78B 1Q7YU 1IHVA 1YNZA 2VGNA 1M8VA 2PNIA 1ABQA 3JCMg 3CPFA 1M3BA 3GP8A 4BDZA 1M3AA 5FU6C 7AT1B 3FLGA 2LTOA 1W1FA 4XU0A 1UTIA 1I5LA 1D3BA 1T0HA 2DNUA 4F14A 1ZBXA 1Q82R 1WHJA 2FRYA 3H9NA 2KAFA 4JRIA 4P5NA 1B07A 4Z88A 1RAIB 1GBQA 4J6WA 3QWXX 3LYIA 1C6VX 1C0MA 3C94A 5L8RE 1I1JA 1WYXA 1YJ9A 1QVFP 2H8HA 2KY9A 3OYIA 3G4SQ 1M90R 1Q82U 2OJ2A 2CUBA 2FZCB 3CC2T 2CYZB 2YT6A 4PKCC 6AT1B 2KXDA 2P84A 4C0DC 1UFFA 4M75C 3OS2A 2NUPA 2LNVA 2NUTA 2O31A 4GY5A 3OBYA 3OS5A 2RNAA 3QUIA 2OAWA 3BFMA 1M90U 3QJYA 3MJXA 2LRQA 3VYGA 2XD0A 1YCSB 3N5BB 2JW4A 2HQHA 4JZ3A 1VQ5A 3NHNA 4NL2A 1SRMA 2HDAA 4C92B 1AD5A 1IO6A 3L42A 1ABOA 1G8XA 4F7UB 4M7DG 3CC4Q 3CMAT 2J7IA 2L3RA 2DIGA 4DBRA 1WJSA 1D1CA 1W4SA 4EMKB 3EFOA 5CVIA 4FSXA 1OPLA 1PG5B 4E6RA 2ZGWA 1TG0A 3DKMA 4AG2C 4LXCA 4BE0A 1M1KC 2KNBB 2FZKB 2ROLA 4M7AA 1ZBJA 4GBQA 3CPWP 2E3HA 1UHFA 3OW2P 5KYXB 1G3TA 1W70A 3M0PA 1IHWA 3VUBA 4LDUA 4C8QD 1BKBA 2WSEE 1VQNA 1GRIA 1VA7A 1EX4A 4L59A 2GTOA 2VXEA 3SEMA 3OYYA 5GMKl 1YP5A 3DLMA 3RKWA 3EH2A 2DILA 5GAN6 3CCLT 2YRDA 2FYKA 1UUEA 3M5AA 4HCKA 4M78A 3PVLA 1VQ4A 2PVDB 1RUWA 2K6DA 4PJOD 2H3JA 2AIRB 4IURA 1ZA1B 1Y07A 2O9SA 3J81E 1YITQ 4PLIA 1VYVA 1TUCA 2CZ1B 1R0CB 2PVGB 4J9CA 4MDWA 4O5VA 2RHIA 2FZGB 4M77E 2E6NA 1KK7A 4DBFA 2GNCA 3SHWA 1JQQA 3QPHA 2X3WD 3G4SA 4E7ZA 1KQ1A 4LUDA 4Y92A 1MUZA 3QXEB 5CIUA 2ZPEB 1TOVA 2X4XA 4AT1B 5LJ5d 4C0FA 4ATOA 3FJPA 2PQWA 4LDYA 2QAZA 5GMKh 1QVFA 1KFZA 2MYSA 3REAB 3NTKA 5D6WA 1KIKA 3CC2A 3BE3A 2M02A 2K3YA 3RMSA 2MCNA 2JVVA 1VYTA 1S72T 4BI4A 2JN0A 1GCPA 2YHTA 4KGXB 5GJVB 3NTHA 1GL5A 1PSEA 4XTXA 2JOYA 2LCSA 2RJFA 3R6NA 3META 4HCCA 1JXOA 2X9HA 1M3CA 5CKEA 4F7UA 1VQ7Q 2CS7A 3LGLA 5CQXA 1UB4A 2M51A 2IIMA 3CCMQ 1T3SA 4EMKA 2DMOA 1WXTA 2LCCA 2QQAA 1YIJQ 2L3PA 3ASKA 1O75A 3G6ET 4OP0A 4EMHA 2AT1B 4NOYA 1G83A 4E7IA 1PKTA 5LJ3j 2VC8A 2I0NA 9ATCB 5LJ5f 2COYA 2KT8A 2CH4A 4KRTA 3CPWA 4M7DF 3VKIA 2Z0WA 2LJ0A 3JB9D 3FJ5A 1ARKA 2EJ9A 2Y4XA 2F2XA 2RQTA 4FW1A 5CKFA 4A63B 4CC7A 4K11A 1ZUKA 1M1FA 2VB6A 5LJ5g 2PTKA 4RMOA 1TU0B 1YJNT 1MNEA 3CCLA 3VS1A 5GMKm 2EPDA 5FRNA 2D9TA 1H8KA 3UATA 2DETA 4J6XA 4CC4B 2JTMA 1C1AA 1RAFB 4FYXB 1R8OB 3FEOA 3U23A 4AFUC 1OU9A 1ZUUA 3OYBA 3MO8A 2KE9A 2COWA 5CKHA 3VRZA 5KYUB 1AWWA 3L1AA 4Q5WA 1NE8A 1H641 4II1A 3DB4A 4XTZA 5LL6S 4GLMA 5LJ5e 1BBZA 3EFSA 2DLPA 2FHDA 3M0SA 1OOTA 5IXFA 2FVUA 4BB7A 3M57A 5GANd 2JTFA 1PCXA 3TCJA 4ZGDB 1PSFA 2HKNA 4M77B 1K9MR 2XIDA 4HT8A 3CCEQ 4E7HA 1PKSA 3RMQA 3BDUA 3TEEA 1VUBA 3J80E 1M4ZA 2HQEA 1QLYA 5CR2A 3MCAB 3PNWC 4B9WA 3F70A 1NJIR 1KG1A 1AWJA 2WSCE 1BU1A 2DERA 1SEMA 5FWBA 1S72A 1NZ9A 2EQKA 4FU6A 4ESRA 1VQ7A 5ECAA 1GXIE 4OF1A 4C8QB 1ACMB 4J9EA 3CD6Q 1NJIU 2KROA 2MOXA 1K73C 1X43A 3OYNA 4J9DA 1K9MC 4PFPA 3PTAA 2K7AA 3L2ZA 3PIOA 3BDLA 1YWPA 3OS1A 4C92D 1JBMA 2DKGA 4CC2A 1KC8R 1XNIA 1QVPA 3A8MB 3PMTA 4KH1B 2G3RA 1OPKA 2MWOA 2MWPA 5GANf 3C4SA 2GFUA 2DRKA 1SPKA 2HBPA 5KYWA 2RA2A 1KHIA 4N4IA 2YRCA 1RLPC 2EJGA 3CCST 3QKJA 3MP8A 4A4GA 1ZUYA 1K4US 3ME9A 3VS5A 4OMMA 4PJOC 1AZGB 1AHJB 2DAQA 1KC8U 4M7DD 3HL8A 2CT4A 1WHLA 5GANg 5IHNA 2JMCA 2MF2A 3OQ5A 3CEYA 2YWWA 3SWNC 1QMCA 1ZQ1A 1NM7A 3P8DA 1TSFA 1AT1B 4ZGEB 5I2SA 1AEYA 2YUQA 1OI1A 3M59A 2F2VA 1JEGA 4IIOA 3M56A 2DZ9A 4M75E 4HCBA 2PUOB 1YJNA 1TS9A 1RACB 2KYMA 3JV3A 2DFUA 2VGMA 3I55T 4J8OA 3KFVA 5GANe 4XQ3A 1VQOT 3EGUA 1OU8A 2FPEA 3CPWS 1G2BA 2XMFA 3EG3A 4DEXA 3KXTA 4EDUA 1VQ5T 1LJOA 1IRXA 2Y90A 4J9IA 3CCEA 2O2OA 4EMGA 2K3BA 2HAXA 2QA4Q 5J26A 3MEUA 4J6YA 3C0CA 4IUUA 2DL7A 2D1XA 1Z9ZA 4ELYC 2J06A 5CKDA 1NBEB 2B8AA 2EYWA 2RQVA 1QCOA 2RI2A 3RR6A 4LDWA 3UWNA 2L3SA 3E2UA 3QO3A 3THKA 3RERA 2F1LA 1DJ7B 1W6XA 2DL5A 4ORZA 4HT9A 1EZZB 4PL6A 1OULA 4C8QA 2NLUA 2GBQA 2E10A 4AFQC 4JJBA 2FL7A 1Y96A 3JCMc 1IGQA 3H0HA 3ZBDA 1FXXA 1BCOA 2CREA 2OTJT 1VQNT 4JS5A 1N9SA 1JJ2A 1IREB 1N8RC 3LLRA 2K2MA 3A8HB 2AZVA 4OB1B 4PJOA 1BI2A 1VQPQ 1WHMA 2DA9A 4HKEA 1LPLA 4A4EA 4X9CA 4JLIA 3EHQA 4QVDA 5GAOn 3EGXB 1TUGB 1RI0A 4BI8B 4XAXB 4M7AC 1BIAA 2R5MA 2QQBA 3EAEA 5KE2A 4ZTFA 1I0CA 1TH7A 1FMKA 1XOVA 1FYNA 2R5AA 1MNDA 2QTXA 2DYBA 2O88A 2DO3A 4OMQA 3OBWA 3CCQQ 2EJFA 3CCSA 3MEAA 3CCVQ 2YDLA 1SSFA 4LDXA 4QQDA 3Q1JA 2YSQA 1NLPC 1F1BB 1GBRA 2OI3A 2DD4A 3G4ST 4BE2A 1VQ9Q 4M78C 4JPBW 2HMAA 2DJZA 4OB2B 5LJ3d 1E6GA 4IUTA 4M75G 2ROTA 2KXCA 4LDVA 1OX8A 1AZEA 1G5VA 2FG0A 3JB9J 1D1BA 1HSQA 3GBQA 2VVKA 4J83A 5AT1B 2KQWA 2K57A 2A37A 5GMKi 1QKWA 1LCKA 4A4HA 4JUVA 2K4YA 2JZ2A 3I55A 1JU5C 2RHXA 1UECA 1M1KR 4OMFB 3INZA 4E2FB 4XU2A 3X20B 1MV3A 2KDSA 1D0YA 3JCMW 3MEWA 1VQOA 3M55A 1B34A 1M30A 3VS2A 4D8KA 3CC4T 2LQNA 5DLOA 2CH4W 1QVGA 2E5QA 4RG2A 1M1KU 2EGEA 2YUOA 5KCOA 3NTIA 1ZSZB 1CSKA 4M77D 4F7UG 4FM4B 2BZXA 4N0AC 4EIKA 2GTJA 5KE3A 4GLKA 3L2WA 3PMIA 2V8IA 2CSIA 3JCMP 2J05A 4HVUA 2DPPB 3KUFA 1XTDA 5GANh 4DBQA 4C92C 4E47A 1HXDA 2RJEA 5CAIA 3OYAA 1YI2Q 4M7DB 3I56Q 1WA7A 2DZCA 1U1TA 1ZSZC 1UE9A 2CSQA 2HL3A 4JS4A 4C5EA 2HKQB 4BE1A 1BI1A 1WNLA 2NWMA 1O9SA 8ATCB 4EMKC 2F69A 1I4K1 1VOMA 2E4HA 2OTJA 2QYZA 2G6FX 3EGXA 3RKYA 2I2LA 1H3HA 3OY9A 4FYWB 2EYZA 5CO7A 1PNJA 1YITT 3VS3A 5DY9A 4A4KA 3UDCA 4RTZA 3CCUQ 3CBOA 3CBPA 1IGUA 2FEIA 3S3OA 3TU4K 4KBMB 4WCIA 1NLOC 2IPOB 2V8JA 4A53A 2ZZDA 4NS5A 1VQLT 5FU7B 4FYVB 2X4JA 5LJ3e 1BI3A 2DBKA 3EG9B 2EAYA 1YHQQ 1KJWA 1K8AC 1VQ8Q 3X28B 2IG0A 2P0KA 2X51A 1WQ7A 1RAHB 3SB2A 1VQLQ 1RADB 1X2KA 4E7SA 3HRSA 5KYYB 1MGQA 1TXQA 1JJ2S 4F04B 2V1QA 1QP3A 3JCMJ 2M16A 2LDMA 2KT1A 2CP7A 2LQKA 4PFZA 2XDDA 3QJ6A 4OGEA 2XICA 4J9HA 3PGGA 2R58A 2M1HA 4M75F 4JJNK 4N0AA 2BTTA 1I5OB 4CRIA 1VQ7T 1SKUB 1N6AA 4JDSA 3EG0A 2L0AA 4C0GA 4E7JA 1UJ0A 1BCMA 5A0DA 2DK3A 2O01E 3CCMT 3VYHB 1G3SA 4C92A 3CC4A 1YIJT 1WPYA 4BD3A 1ZSZA 1U3OA 2JM9A 2F5KA 2QDLA 3TQ7P 2V8KA 1CKAA 1Y0MA 3R6OA 1PRLC 2L3QA 4RTTA 4HA8A 1YI2A 1WHKA 2D6FA 1U1SA 4KT0E 1GFDA 3RBBB 3PIPA 3JSCA 2OTLQ 4M7DA 2DVEA 3OA6A 3P8BB 2VWFA 2RQWA 2O4XB 3UF4A 2AK5A 2EGCA 2CP5A 3MP6A 1Y7XA 5KYXA 3ULRB 1MHNA 2DJQA 2MIOA 2CGHA 5FROA 3M9QA 4PJMA 2BE7D 3MPUB 2FO0A 1VIFA 4FIBA 3NMZC 2DRMA 5KH6A 3UA6A 3RDVA 1QVGS 4IUQA 3X24B 1UGVA 1SSHA 2RQRA 3VS4A 2CP2A 2DM1A 2DXUA 1RAEB 1Z9QA 2X35A 3SFMA 2D8JA 3LW5E 3OYHA 2V1RA 2JT4A 5IN1A 2VUBA 4X34A 2L8DA 1YITA 4BI3A 2QTVA 4PK4A 1M1GA 2X3XD 2PZ1A 2DEUA 3EG9A 2QQRA 2M9UA 5GAN8 1E7OA 4B9XA 1VQLA 3OSVA 1FWZA 2VASA 4QW2A 2RH2A 2P0QA 3VS7A 3JRZA 5KYYA 4RG8A 3RESA 4A4FA 4CC3A 2DEQA 4Y28E 3CCET 1T3LA 4QT7A 1D0XA 5GAN4 5HKCA 1X75C 1VQ6Q 1GFCA 1SF9A 2CZ7B 1SRLA 4V2SA 3G7ZA 1K73R 3HHTB 1D0ZA 3A8LB 5GAN2 1FMVA 1VQKQ 4LUEA 3TVTA 4RKUE 3OYCA 2QDYB 3GF5A 4WF2A 3L2QA 2NYSA 1MMNA 5GJWB 2D8HA 4KULA 1X69A 1NPRA 1WJRA 2IVWA 2D0NA 2KMTA 1FMWA 2HBWA 1B3QA 3GLXA 3ZFJA 5GAMj 1K9MU 4ZN1A 3CD6T 2C0TA 5HK3A 3CMEQ 5GAOr 4M77C 2LQWA 4M75D 5LJ3h 2ECZA 1U5SA 2GFAA 3QWYA 2E41A 2BIVA 3I35A 3CCJQ 2DF6A 1WGSA 4OMLA 3D7SB 3CC7Q 3OYLA 1JJ2P 5KCHA 3EGDB 3CCMA 3GOXA 2GCXA 2NUZA 5DLQE 3VU3C 4OB0B 2FPFA 4M7AE 3M0QA 1YIJA 2LNHB 2FB7A 1EIFA 4KUIA 2EQUA 3UA7A 5FLXE 1D09B 4PJOG 5D6XA 4C8QC 3I5SA 1N27A 4J9FA 2BKDN 2CP3A 3H8ZA 3S3NA 2O4XA 1K76A 3IQLA 1U8RA 2ED0A 2A3LA 2PU9B 3X26B 4DOVA 4AG1C 3FDRA 2MPXC 3V7SA 2RM4A 2KSSA 4BY6B 1WDXA 4ZN3A 3M4YA 2AKKA 1UHCA 4M78E 2GQIA 3A5ZB 1NEGA 1RAAB 1YFNA 3G71Q 3PVQA 4MDXA 3RNJA 2AZSA 2LCLA 4B6MA 5IXBA 2QEXQ 1Q95G 2ATCB 3URGA 3CCRQ 3VV0A 1OZ3A 2F2WA 1OV3A 2DVJA 1TUDA 1YJWQ 2YUPA 2ZPBB 3LWIA 2ED1A 2A28A 5EC7A 4N4GA 4OVAA 2YUNA 2HNIA 4PLLA 3WVEB 4ELZC 4XTWA 5D6YA 2RD1A 4DEYA 1Q81C 2E65A 2J6FA 5KYUA 1V76A 4WTOB 2QXFA 1KSWA 2EVRA 3FRNA 4OB3B 5A0GA 2K3XA 3M0RA 2QA4T 1QQJA 2YXYA 3M58A 2B86A 4OGCA 3QYHB 1ZHIA 2RHUA 3HP9A 4M77A 1YBYA 1QVGP 1YJ9Q 5CCAA 1WQWA 3DLLA 3GNGA 1RAGB 1N8RR 3MEVA 2DX1A 1NPPA 2VV5A 2W10A 2NUPB 3JCMd 2NUTB 3TSZA 2DD5A 1WXBA 3OMCA 4D6WA 3AT1B 4C92E 1WFWA 1PD0A 3E19A 1N9RA 2Y4YA 4DOWA 2C0IA 1NEBA 1VQMT 1N8RU 2JM8A 1MV0B 2JTEA 2LC4A 1K9AA 4F7UE 5GAOm 4FW2A 2EKHA 1BB9A 2RB6A 4R0KA 3L2RA 3CD6A 2RPNA 3QZ9B 3FC3A 1VQPT 2ZPIB 4JRKA 3OB9A 1M2VB 5CK9A 3EGDA 1VQMQ 3PT9A 3EH1A 2XDBA 2CT3A 1KD1C 3HTRA 1BYMA 3JB9G 4KGZB 4M7AG 1YCYA 2CKKA 3ER0A 2J6OA 4DBHA 2CP6A 3OMGA 2EYQA 3S3MA 4X9DA 3E9GA 1X2QA 1TWBA 2DE0X 8AT1B 4J9GA 1B7TA 3LX7A 1SHGA 2AHJB 4TVRA 5IT9E 3CCQT 2BUDA 3CCVT 4CI0C 1LVKA 2A7YA 3BW1A 5CKBA 1WLPB 1OZ2A 3OYMA 3G71A 1XQHA 4M78G 4JJCA 4JLGA 1VQ9T 2SEMA 2W0ZA 4RTYA 2FRWA 2RI5A 3HKSA 5FU6B 4XTYA 3CCRA 4QKUA 3C95A 5FWCA 1K0SA 4MZPA 3NPFA 4PJOF 1N5ZA 3QG1A 5KYNA 4AMCA 3JCMV 2K5LA 4R56A 2KYBA 1VQ4Q 1Q86C 2CZ6B 2KGTA 2ZCFB 1IXDA 4ZNXA 1HD3A 4UC4A 2K5IA 2BZ8A 4PJJA 1PWTA 4ME7A 1K1ZA 2E3IA 4A54A 4KH0B 5I21A 2EQIA 1V1CA 5CQYA 4C0DB 2KBTA 4M75B 3HRUA 1Q7YC 3GIBA 2K79A 3LH0A 3VS6A 5GAN3 3TREA 4C5HA 3JCMe 1MMDA 5DM7R 1KQSS 2KVQG 1W2BA 3VJPA 2QA4A 1UJYA 4O6JA 1ZSGA 2HSEB 4RTWA 1UGRB 4M4ZA 3M54A 1V29B 3CXCS 2O9VA 5IHIA 2DXTA 2P0PA 4FT4A 2XKOC 4C92G 1PC0A 3P8HA 4J7IA 3CC2Q 3TSWA 4HXJA 1YI2T 1M27C 2LX7A 3I56T 1JXMA 1KHCA 1Q82C 4J7FA 3H0IA 2JS0A 1I07A 3EG2A 1VIEA 3ZEHA 2A36A 3SDZA 1VQMA 5LJ3f 3WVDB 3JCMX 1M2VA 1GCQC 1AWOA 3JB9I 2YLCA 2KRSA 2J6KA 2EGAA 5GMKj 4EPCA 1M90C 1K8AR 4OMNA 1HK9A 4D8DA 2RK2A 1ZLMA 1VQPA 1A0NB 1RI9A 1UG1A 2E5KA 3CCUT 3PE0A 2XHCA 1PD1A 5LJ3g 5GAMd 2QASA 3NGPA 4IUPA 3EFRA 5FRMA 3CMAQ 4M7DC 4ZGJB 1HYOA 3MHXA 4FL6A 1K8AU 5HCKA 5J39A 4PFOA 3JCMQ 4LD6A 4MZMA 2ENMA 2M0YA 1YHQT 3OYEA 1VQ8T 3CCQA 4LD9K 3JB9F 3V8KA 5HK0A 3CCVA 4M7AF 4L5GA 4R55A 2LT1A 2JS2A 1RLQC 2XU8A 2VYTA 1X27A 2LX9A 3M0TA 1VQ9A 1WJQA 5L23A 4RUGA 3VRYA 3V7CA 2LQ8A 3KBGA 1QKXA 4LE9A 5FU7C 1JB0E 4Z02A 3CCLQ 4M78F 2QGGA 2ABLA 2EFIA 4RTXA 3RUXA 3LH5A 4VUBA 3X25B 4NL3A 3OYJA 4RTUA 2LMJA 2EW3A 2V26A 2HCKA 4M75A 1YN8A 2KEAA 1E6HA 2K9GA 3CBMA 5GAMf 3LGFA 1JRIA 2QI2A 2JXBA 1H3ZA 4OMPA 2JJ9A 2RQUA 4LN2A 2LJ1A 4C5GA 2X4WA 3OYKA 2WACA 1WZOA 4FSSA 2MK5A 1NYGA 4OMOA 3V8JA 5J3BA 4PJLA 2F5TX 2E1HA 2MMPA 1KQ2A 5GAMg 5I22A 2QGFB 5C6SA 2HD0A 3I9QA 1NYFA 2M0OA 1GCQA 4RCCA 3I5RA 3HRTA 5D7UA 4KGVB 2OTLT 4C8QE 3QDRB 2RK1A 3ZL7C 1SHFA 2HZYA 3G1JA 3O8VA 1QW1A 2EWNA 2XK0A 4C5IA 4Y91A 2ZPFB 3I56A 2RN8A 1UEBA 2EQMA 2EYYA 2YLBA 1S72Q 1G3WA 1MMAA 5FW9A 4PJOE 2CZ0B 1ZX6A 1OEBA 2XDPA 5GAMe 4XU1A 1NG2A 4C92F 1PM3A 2MI6A 3T9NA 2BZYA 1KQSP 2RJCA 3JCMh 1W2BS 3A1PA 1AVZC 4F7UF 1Y71A 2JMAA 3H0FA 3CMAA 2MAMA 2QK0A 2DBMA 3CQTA 5M9OA 3CXCP 1OX9A 2K5FA 3CCUA 2KR3A 5KYWB 4BDYA 2AKLA 5IAYA 2RJDA 1QWFA 2FPDA 3G6EQ 2DXCA 3OW2A 2CP0A 1H92A 2VXFA 4HCZA 2OAUA 1M8MA 1YHQA 4M7AD 1VQ8A 1K0XA 1QCNA 1WXUA 1UDLA 4QVZA 1HJDA 4Z89A 3NFCA 4DA4A 1VQ6T 1QP2A 4Z8AA 1RABB 4ANJA 3HFNA 1WIEA 3V7RA 4LNPA 1I81A 1VQKT 4N4HA 3OYDA 3OSSC 3M0UA 1Y57A 3QYGB 1X6OA 2L5QA 3HSBA 3AHUA 2C0OA 1YJNQ 4F17A 2LVMA 3MKDA 4XTVA 4M78D 4HVVA 2KRNA 4YTLA 4MZTA 1UGSB 4M77G 3CMET 2PUKB 1R77A 1WHHA 3A98A 1J3TA 2CUDA 1M5Q1 1X6BA 4JZ4A 1LNXA 5GAOl 2PVOB 3QHSA 3CCJT 1T0JA 2XG8D 2HQXA 5EG2A 3A8GB 3CC7T 1K73U 3SD4A 4QVCA 1P92A 4AFZC 1X6GA 3EHRA 3EG1A 1SG5A 1QCFA 2EIFA 2SRCA 4RTVA 2GF7A 1OYXA 2A08A 3UT1A 2E70A 4J5YA 3OYGA 4C8QG 4MMLA 2DYIA 4XK8E 3HFOA 4PNOA 3JCMb 5GAN5 3OS0A 2ZAEA 2YRVA 3VS0A 3WXMB 1U06A 2DTIA 2OTLA 3L2UA 4JJDA 2WSFE 4DQ2A 4E7LA 5A0LA 1M2OA 1BIBA 1Y96B 3E9FA 4JRQA 1Q81R 3G71T 2COZA 5A2QE 2HL5C 5GAOq 4L6V5 2QEXT 2ESWA 3CCRT 2RF0A 3H41A 2OX7A 4PJOB 1YJWT 1QVFS
chains in the Genus database with same CATH topology
3BW1A 1KQSA 3E1SA 5LJ5f 3RKYA 2I2LA 5CKBA 3OY9A 1OZ2A 3CPWA 4M7DF 1Q81U 5CO7A 3OYMA 3H6ZA 3G71A 1XQHA 4M78G 2QQSA 3VKIA 1YITT 4JLGA 5DY9A 1VQ9T 4A4KA 1NJIC 3UDCA 3QSUA 2RI5A 4BACA 3SWNB 5GAOp 3CXCA 3HKSA 3G6EA 3CBOA 4XTYA 5FU6B 3CBPA 5I2MA 3CCRA 3JB9D 3S3OA 3TU4K 1M9SA 3RKXA 3C95A 4KBMB 5GAN7 4IUVA 4MZPA 4BY6C 2EJ9A 2RO0A 2Y4XA 4PJOF 4BUGA 3JB9H 2V8JA 5CKFA 4A53A 2ZZDA 4NS5A 1VQLT 3QG1A 1M1FA 4RCBA 5LJ5g 5LJ5j 4RMOA 2P4TA 3JCMV 2K5LA 5FU7B 1YJNT 2X4JA 3J7AF 4R56A 5LJ3e 1BI3A 2E6ZA 4QQ6A 3CCLA 2EAYA 1D3BB 5GMKm 1Q86C 2CZ6B 1K8AC 2ZCFB 3X28B 5FRNA 2D9TA 2IG0A 2P0KA 3M4GA 4J6XA 1WQ7A 4UC4A 2JTMA 2K5IA 3SB2A 5GAMh 2JNGA 1IZ6A 4ME7A 1YJ9T 3GPLA 1R8OB 3FEOA 4A54A 2D0QB 3HRSA 3MP1A 3MO8A 1MGQA 3OYBA 1VQ6A 1JJ2S 5CKHA 3HPWA 5I21A 1KC8C 5CQYA 4C0DB 3L1AA 4Q5WA 1BI0A 1NE8A 1QP3A 3L2VA 1H641 4II1A 3DB4A 4M75B 4XTZA 3HRUA 3JCMJ 5AYFA 2XI9A 5LL6S 1Q7YC 2M16A 1VQKA 4ZTJA 5LJ5e 3GIBA 2DIQA 3EFSA 2LDMA 2FHDA 3LH0A 3GNFB 2FVUA 2ZPGB 4BB7A 5GAN3 3M57A 2LQKA 5GANd 3TREA 4C5HA 3OYFA 2RHYA 2JTFA 3JCMe 3TCJA 5DM7R 1KQSS 4ZGDB 1PSFA 2KVQG 3M53A 3VJPA 3LWHA 2XDDA 2QA4A 3QJ6A 1W2BA 4M77B 4OGEA 4O6JA 2XICA 2DTOA 1UGRB 2XIDA 3PGGA 3CMEA 3M54A 1KD1U 1V29B 3OW2S 1UGPB 3FIFA 4HT8A 3BY7A 4XTUA 2R58A 2M1HA 4M75F 4JJNK 4E7HA 3CXCS 3RMQA 3BDUA 4N0AA 2DTHA 1VUBA 3TEEA 2DXTA 4CRIA 2K2VA 1M4ZA 3J80E 1VQ7T 1LOJA 4MMKA 1B34B 2P0PA 4FT4A 1N6AA 4JDSA 2C06A 2HQEA 2XKOC 4C92G 4C0GA 2E64A 3CCJA 4E7JA 5CR2A 5A0DA 3P8HA 3MCAB 3PNWC 4J7IA 1UGQB 2DK3A 2O01E 3F70A 3QBYA 4B9WA 3I56T 3VYHB 3CC7A 3CCMT 1YI2T 1G3SA 4IKFA 4KUDK 4C92A 1KG1A 1KHCA 3QZ5B 2WSCE 4M77F 1Q82C 2RHZA 3FB9A 3CC4A 4J7FA 3VUZA 2RI3A 2X4YA 2JUFA 1RL2A 1YIJT 2EKOA 1WPYA 3S6WA 4BD3A 1S72A 2F5KA 1VIEA 2E12A 3ZEHA 1NZ9A 2EQKA 4FU6A 2V8KA 5HY6A 3SDZA 1I8FA 3C12A 3PFSA 1VQ7A 4M7DE 1VQMA 3R6OA 4XU3A 1FX7A 5LJ3f 3WVDB 1GXIE 4OF1A 4C8QB 3UPUA 3JCMX 2R57A 3JB9I 2YLCA 1NJIU 4FT2A 5GAOl 4HA8A 1YI2A 2QQ9A 5GMKj 4EPCA 2D6FA 1U1SA 4KT0E 1M90C 4JRPA 1G3YA 1HK9A 1X01A 2DXBA 2GQVA 2RK2A 2ZPHB 3JSCA 3PIPA 3OYNA 1VQPA 2DVEA 1K9MC 4M7DA 3PTAA 3OA6A 3P8BB 3A8OB 3L2ZA 3PIOA 3BDLA 5LJ5h 3CCUT 3OS1A 4M7AB 2O4XB 2XHCA 4C92D 4ATOA 1JBMA 5LJ3g 5GAMd 4QQGA 2DKGA 4IUPA 3MP6A 1Y7XA 4C8QF 3RIRA 3QIIA 2EQJA 1XNIA 3EFRA 1QVPA 3A8MB 3PMTA 4C0ZA 2G3RA 5FRMA 4M7DC 1MHNA 2MWOA 4ZGJB 2MWPA 3JAME 3MHXA 5GANf 3C4SA 2GFUA 4FL6A 1Q86U 2CGHA 5FROA 2HBPA 3M9QA 1K8AU 5J39A 2RA2A 1KHIA 4N4IA 1VIFA 4FIBA 3JCMQ 3DB3A 4LD6A 4MZMA 3JCMf 2EJGA 2KK4A 5KH6A 3CCST 3QKJA 2QEXA 2L89A 1YHQT 3MP8A 4A4GA 1VQ4T 3OYEA 3V8LA 1QVGS 3CCQA 5GMKe 4IUQA 3X24B 3ME9A 1VQ8T 4LD9K 3JB9F 3V8KA 5C0MA 5HK0A 3CCVA 2LT4A 4L5GA 4R55A 4M7AF 4PJOC 1YJWA 2LT1A 1AHJB 2DXUA 2DAQA 3SWNA 1KC8U 2X35A 3HL8A 4M7DD 3SFMA 3LW5E 4E7KA 3OYHA 2XU8A 5GANj 4M78B 2VYTA 5GANg 5IN1A 2VUBA 1Q7YU 4X34A 2L8DA 2VGNA 2LX9A 1YITA 2MF2A 1VQ9A 1M8VA 1WJQA 3OQ5A 4BI3A 3CEYA 3JCMg 3CPFA 3GP8A 3SWNC 4BDZA 1M1GA 5FU6C 1ZQ1A 3FLGA 2LTOA 3V7CA 2LQ8A 4XU0A 2QQRA 1I5LA 3KBGA 2M9UA 3P8DA 1D3BA 4ZGEB 5I2SA 5GAN8 1VQLA 4B9XA 3OSVA 1OI1A 1ZBXA 3M59A 1FWZA 3M56A 2DZ9A 4M75E 2RH2A 2PUOB 4QW2A 2P0QA 1JB0E 5FU7C 4Z02A 2KAFA 4JRIA 4M78F 1YJNA 4P5NA 2EFIA 2VGMA 3JRZA 4J8OA 3I55T 4RG8A 4J6WA 3RUXA 3RESA 4A4FA 4VUBA 3X25B 3LYIA 4NL3A 3OYJA 2DEQA 3C94A 4Y28E 5L8RE 3CCET 5GANe 5GAN4 5HKCA 4M75A 1X75C 1YJ9A 4XQ3A 2KY9A 3OYIA 2CZ7B 1Q82U 1VQOT 4V2SA 3CBMA 3G7ZA 5GAMf 3LGFA 3HHTB 3CPWS 1JRIA 3CC2T 2CYZB 3A8LB 4PKCC 2QI2A 5GAN2 1H3ZA 4RKUE 4C0DC 3OYCA 2QDYB 3KXTA 4EDUA 3GF5A 4M75C 4WF2A 4C5GA 1VQ5T 3OS2A 3L2QA 2LNVA 1LJOA 2X4WA 3OYKA 2Y90A 2WACA 4KULA 3CCEA 4EMGA 2HAXA 1NPRA 1WJRA 2IVWA 3OBYA 2KMTA 3OS5A 4GY5A 3V8JA 5J3BA 3QUIA 3BFMA 5J26A 3MEUA 3GLXA 2F5TX 3QJYA 4J6YA 2E1HA 1M90U 3VYGA 2LRQA 2XD0A 4IUUA 2MMPA 3ZFJA 4ELYC 1KQ2A 5GAMj 1K9MU 4ZN1A 5GAMg 3CD6T 5CKDA 5HK3A 5GAOr 5C6SA 2HD0A 4M77C 1I4K1 3N5BB 2B8AA 2M0OA 2RI2A 4M75D 4RCCA 5LJ3h 4LDWA 3HRTA 2GFAA 1VQ5A 2E41A 2OTLT 4NL2A 2BIVA 4C8QE 3QDRB 2RK1A 3UWNA 4C92B 3QO3A 3L42A 3RERA 1WGSA 3O8VA 1DJ7B 3OYLA 1QW1A 2EWNA 2XK0A 4C5IA 4F7UB 4M7DG 4Y91A 5KCHA 2ZPFB 4HT9A 3CMAT 3I56A 3CCMA 3GOXA 2GCXA 2L3RA 4PL6A 5DLQE 1UEBA 4C8QA 2NLUA 3VU3C 2EQMA 2YLBA 2E10A 4OB0B 2DIGA 2FL7A 4M7AE 1G3WA 1YIJA 1WJSA 4PJOE 2CZ0B 1Y96A 2FB7A 3JCMc 1W4SA 1EIFA 4EMKB 2XDPA 4KUIA 5CVIA 2EQUA 3ZBDA 5GAMe 4XU1A 4FSXA 1FXXA 5FLXE 2OTJT 1VQNT 2ZGWA 4PJOG 4C92F 3DKMA 5D6XA 4C8QC 2MI6A 3T9NA 4BE0A 1N27A 4JS5A 1N9SA 1M1KC 1IREB 2RJCA 1N8RC 2BKDN 3H8ZA 3LLRA 3JCMh 1JJ2A 3S3NA 1W2BS 4M7AA 2O4XA 4F7UF 3A8HB 1Y71A 4OB1B 3CMAA 4PJOA 2MAMA 1BI2A 1U8RA 4HKEA 4A4EA 2A3LA 2PU9B 4X9CA 4JLIA 4QVDA 3X26B 1G3TA 5GAOn 4DOVA 5M9OA 1RI0A 2K5FA 3FDRA 4BI8B 3CCUA 3V7SA 2RM4A 2KSSA 4XAXB 4BY6B 3VUBA 4LDUA 1BIAA 4ZN3A 4M7AC 4C8QD 3M4YA 2R5MA 1BKBA 2WSEE 4BDYA 2QQBA 3EAEA 5KE2A 4M78E 4ZTFA 1VQNA 1TH7A 3A5ZB 1XOVA 2R5AA 5IAYA 2RJDA 2QTXA 4L59A 4MDXA 2LCLA 2VXEA 2DO3A 3OYYA 5GMKl 3OBWA 2DXCA 3DLMA 5GAN6 3RKWA 3CCLT 3OW2A 3URGA 3VV0A 2FYKA 1OZ3A 2VXFA 4HCZA 2EJFA 2OAUA 3M5AA 3CCSA 3MEAA 4M78A 4HCBA 1SSFA 1YHQA 1VQ4A 4M7AD 4LDXA 2PVDB 4QQDA 1VQ8A 2ZPBB 4PJOD 3LWIA 3Q1JA 2H3JA 4QVZA 3NFCA 4N4GA 4IURA 4DA4A 1VQ6T 2DD4A 4OVAA 1QP2A 1Y07A 3G4ST 2HNIA 4PLLA 3WVEB 3J81E 4ELZC 4BE2A 4XTWA 4M78C 5D6YA 3HFNA 4PLIA 3V7RA 2DJZA 2RD1A 1I81A 4OB2B 1Q81C 1VQKT 4N4HA 2E65A 5LJ3d 3OYDA 4IUTA 2CZ1B 3OSSC 4M75G 2PVGB 4LDVA 3QYGB 4MDWA 1X6OA 2L5QA 4O5VA 3HSBA 2RHIA 2QXFA 1G5VA 3AHUA 3JB9J 4M77E 3FRNA 4OB3B 5A0GA 2K3XA 2E6NA 2LVMA 2QA4T 4XTVA 4M78D 3QPHA 3G4SA 4J83A 4YTLA 4MZTA 1UGSB 1KQ1A 2KQWA 2K57A 3M58A 4M77G 5GMKi 3CMET 2PUKB 4A4HA 4OGCA 3QYHB 1M5Q1 1ZHIA 3QXEB 2ZPEB 2K4YA 2JZ2A 2RHUA 4JUVA 5CIUA 3I55A 3HP9A 4M77A 2X4XA 1LNXA 1YBYA 4C0FA 3FJPA 5LJ5d 2PQWA 5CCAA 1WQWA 2RHXA 3GNGA 4LDYA 3DLLA 4OMFB 3INZA 3MEVA 5GMKh 1QVFA 2PVOB 3QHSA 4XU2A 3CCJT 1NPPA 3X20B 3NTKA 2XG8D 2HQXA 5D6WA 2KDSA 5EG2A 3A8GB 3JCMW 3MEWA 2VV5A 3CC7T 1VQOA 3SD4A 1K73U 3JCMd 4QVCA 3M55A 1P92A 1B34A 1K73C 3CC2A 3CC4T 2K3YA 3RMSA 5DLOA 2DD5A 2EIFA 3OMCA 2JVVA 4D6WA 4C92E 1S72T 4BI4A 2GF7A 3E19A 1OYXA 1QVGA 2JN0A 1N9RA 2Y4YA 4DOWA 3UT1A 2YHTA 2E5QA 4RG2A 1VQMT 2E70A 4J5YA 1N8RU 1M1KU 2LC4A 3NTHA 4F7UE 3OYGA 5GAOm 5KCOA 3NTIA 1PSEA 4C8QG 4XTXA 4MMLA 2JOYA 2RJFA 2RB6A 4M77D 4XK8E 3L2RA 4F7UG 3HFOA 4FM4B 3QZ9B 4PNOA 3JCMb 5GAN5 4N0AC 3OS0A 3CD6A 3META 4HCCA 3FC3A 2YRVA 5KE3A 4GLKA 1VQPT 3L2WA 3PMIA 2ZPIB 4JRKA 3WXMB 5CKEA 3OB9A 4F7UA 2V8IA 2DTIA 5CK9A 2CS7A 2OTLA 3LGLA 3L2UA 3PT9A 2XDBA 3JCMP 1KD1C 1BYMA 2DPPB 3JB9G 3KUFA 1XTDA 5GANh 5CQXA 1UB4A 4M7AG 1YCYA 2CKKA 2WSFE 4C92C 4DQ2A 3ER0A 1HXDA 2RJEA 4E47A 5CAIA 3OYAA 3OMGA 4E7LA 4M7DB 5A0LA 2EYQA 4EMKA 2DZCA 1BIBA 1Y96B 1U1TA 2LCCA 3S3MA 3E9FA 4X9DA 4JRQA 2QQAA 3E9GA 3G71T 3ASKA 4JS4A 4C5EA 5A2QE 5GAOq 4BE1A 1O75A 4L6V5 1BI1A 1WNLA 3LX7A 4OP0A 3G6ET 2QEXT 4EMHA 2AHJB 3CCRT 4TVRA 1O9SA 5IT9E 3CCQT 4NOYA 2BUDA 4EMKC 3CCVT 4PJOB 4E7IA 4CI0C 5LJ3j 2VC8A 2F69A 2A7YA 1YJWT 2OTJA 1QVFS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HNI A;  3BW1 A;  1I8F A;  4XTW A;  4M78 C;  4M75 C;  4WF2 A;  3HFN A;  2I2L A;  4XU3 A;  5LJ3 f;  3RKY A;  5LJ5 f;  4M7D E;  1LJO A;  3V7R A;  4C8Q B;  4M7D F;  2DJZ A;  2RD1 A;  2Y90 A;  1I81 A;  3JCM X;  5LJ3 d;  2E65 A;  4EMG A;  4M75 G;  4M78 G;  2YLC A;  3JB9 I;  5DY9 A;  3V8J A;  3QUI A;  4HA8 A;  5GMK j;  3QSU A;  3BFM A;  4J6Y A;  1U1S A;  2E1H A;  3SWN B;  5GAO p;  4XTY A;  3HSB A;  3JB9 D;  1HK9 A;  1X01 A;  5GAM j;  1KQ2 A;  5GAM g;  4M77 E;  3JB9 J;  3AHU A;  4M7D A;  5GAO r;  2DVE A;  3RKX A;  4M77 C;  5GAN 7;  3L2Z A;  2EJ9 A;  4XTV A;  4PJO F;  3JB9 H;  4M75 D;  4M78 D;  4RCC A;  5LJ5 h;  4A53 A;  5LJ3 h;  4M7A B;  4RCB A;  4C92 D;  5LJ5 j;  1KQ1 A;  4M77 G;  2K57 A;  2E41 A;  1JBM A;  4NL2 A;  5GMK i;  5LJ5 g;  3JCM V;  4C8Q E;  2DKG A;  5LJ3 g;  5GAM d;  4C8Q F;  3RIR A;  1M5Q 1;  3EFR A;  4JUV A;  4C92 B;  4M7D C;  3QO3 A;  5LJ3 e;  4M77 A;  3RER A;  5GAN f;  1LNX A;  5LJ5 d;  2EAY A;  3FJP A;  1D3B B;  2CGH A;  5GMK m;  1WQW A;  5GAO l;  5GMK h;  2RA2 A;  3INZ A;  2EWN A;  4F7U B;  4M7D G;  3QHS A;  4Y91 A;  3M4G A;  4XU2 A;  3JCM Q;  4J6X A;  4HT9 A;  1WQ7 A;  3JCM f;  3SB2 A;  2EJG A;  5GAM h;  4C8Q A;  3JCM W;  3VU3 C;  2YLB A;  2E10 A;  3JCM d;  4QVC A;  3V8L A;  5GMK e;  4M7A E;  1B34 A;  4A54 A;  3JB9 F;  3V8K A;  4PJO E;  4M7A F;  1MGQ A;  1Y96 A;  2FB7 A;  4PJO C;  3JCM c;  2DXU A;  4EMK B;  3SWN A;  5GAM e;  4M7D D;  5I21 A;  4XU1 A;  4C92 E;  3L1A A;  2ZGW A;  2JN0 A;  1H64 1;  1N9R A;  4PJO G;  4M75 B;  4M78 B;  2YHT A;  4XTZ A;  4C92 F;  4C8Q C;  5GAN g;  3JCM J;  5GAN j;  4J5Y A;  1N9S A;  5LJ5 e;  3GIB A;  4F7U E;  3EFS A;  3JCM h;  5GAO m;  4M7A A;  1M8V A;  4F7U F;  4PJO A;  4C8Q G;  4XTX A;  3JCM g;  5GAN 3;  4MML A;  3SWN C;  5GAN d;  2RB6 A;  4M77 D;  4X9C A;  4JLI A;  4F7U G;  3HFO A;  4PNO A;  4QVD A;  3JCM b;  5GAN 5;  4N0A C;  3V7C A;  3JCM e;  5GAO n;  4XU0 A;  1I5L A;  1D3B A;  4M77 B;  5GAN 8;  3V7S A;  2RM4 A;  4JRK A;  2DTO A;  4F7U A;  1BIA A;  4M7A C;  2DTI A;  4C8Q D;  3PGG A;  2DZ9 A;  4M78 E;  4M75 E;  3FIF A;  1TH7 A;  3JCM P;  4HT8 A;  3BY7 A;  4JRI A;  4XTU A;  4M75 F;  4M78 F;  3JB9 G;  5GAN h;  4M7A G;  1YCY A;  3BDU A;  4C92 C;  2QTX A;  4N0A A;  2DTH A;  4DQ2 A;  2DXT A;  1HXD A;  5CAI A;  1LOJ A;  4M7D B;  2VXE A;  4MMK A;  1B34 B;  4J6W A;  3RUX A;  5GMK l;  3RES A;  4NL3 A;  4EMK A;  5GAN 6;  3RKW A;  2DZC A;  1BIB A;  1Y96 B;  1U1T A;  2DEQ A;  4C92 G;  4X9D A;  2FYK A;  2E64 A;  5GAN e;  2VXF A;  5GAN 4;  2EJF A;  4M75 A;  4M78 A;  5GAO q;  4XQ3 A;  4M7A D;  1WNL A;  4OP0 A;  4C92 A;  4PJO D;  4M77 F;  4EMH A;  4V2S A;  3FB9 A;  5GAM f;  1JRI A;  4NOY A;  4EMK C;  1WPY A;  4PJO B;  5GAN 2;  5LJ3 j;  2VC8 A;  1I4K 1; 
#chains in the Genus database with same CATH topology
 1KQS A;  3E1S A;  2P4R A;  1Q81 U;  5I11 A;  3H6Z A;  2HSP A;  2QQS A;  1NJI C;  3QSU A;  2BE9 B;  4BAC A;  3SWN B;  5GAO p;  3CXC A;  3G6E A;  1IB8 A;  2KRM A;  3QDF A;  5I2M A;  2L2P A;  1M9S A;  3RKX A;  5GAN 7;  1PRM C;  4IUV A;  4BY6 C;  2RO0 A;  4BUG A;  2LJ3 A;  3JB9 H;  4RCB A;  5LJ5 j;  2P4T A;  4X1V A;  5IHK A;  3J7A F;  5IH2 A;  2E6Z A;  3CCS Q;  4QQ6 A;  1D3B B;  4F16 A;  2KI7 A;  3M4G A;  1YWO A;  5GAM h;  2JNG A;  1IZ6 A;  1YJ9 T;  2DL4 A;  3GPL A;  2D0Q B;  3MP1 A;  1VQ6 A;  1BK2 A;  2LZ6 B;  1W2B P;  1WX6 A;  2DL8 A;  3HPW A;  1KC8 C;  1CKB A;  2EYX A;  1BI0 A;  3L2V A;  4FCY A;  2A0F B;  1KD1 R;  5AYF A;  2XI9 A;  4IIM A;  1VQK A;  4ZTJ A;  2DIQ A;  3GNF B;  2ZPG B;  2VKN A;  3OYF A;  1QWE A;  2RHY A;  1WHG A;  3M53 A;  3LWH A;  2EBP A;  2DTO A;  3I55 Q;  3CME A;  1KD1 U;  1VYU A;  1UGP B;  3FIF A;  3OW2 S;  3BY7 A;  4XTU A;  2GGR A;  1OQK A;  1JO8 A;  2DTH A;  1D1A A;  2K2V A;  1LOJ A;  2DL3 A;  1B34 B;  4MMK A;  2C06 A;  1VQO Q;  2E64 A;  3CCJ A;  1R0B G;  1UGQ B;  3CC7 A;  3QBY A;  4KUD K;  4IKF A;  3QZ5 B;  4M77 F;  2RHZ A;  3FB9 A;  2H3E B;  1VQ5 Q;  3VUZ A;  2RI3 A;  2X4Y A;  4FYY B;  2JUF A;  1RL2 A;  2EKO A;  3S6W A;  2E12 A;  5HY6 A;  1I8F A;  3C12 A;  3PFS A;  4M7D E;  4XU3 A;  1FX7 A;  1MMG A;  1AWX A;  4PJN A;  4J9B A;  3UPU A;  2R57 A;  4HVW A;  1TTH B;  4FT2 A;  2QQ9 A;  1PHT A;  3EFO B;  1Q86 R;  4JRP A;  1G3Y A;  2GQV A;  1X01 A;  2DXB A;  2ZPH B;  2CDT A;  2RMO A;  1XJW B;  3A8O B;  1WI7 A;  5LJ5 h;  4M7A B;  1S1N A;  4QQG A;  4C8Q F;  3RIR A;  3QII A;  2EQJ A;  2LP5 A;  4C0Z A;  4AFS C;  3JAM E;  2QG9 B;  1Q86 U;  1Q7Y R;  3O5Z A;  3DB3 A;  3JCM f;  2KK4 A;  2HEQ A;  2QEX A;  1ZA2 B;  2L89 A;  1VQ4 T;  3V8L A;  2OTJ Q;  1VQN Q;  5GMK e;  3REB B;  1AOJ A;  5C0M A;  2LT4 A;  1YJW A;  3SWN A;  1EFN A;  4E7K A;  5GAN j;  4M78 B;  1Q7Y U;  1IHV A;  1YNZ A;  2VGN A;  1M8V A;  2PNI A;  1ABQ A;  3JCM g;  3CPF A;  1M3B A;  3GP8 A;  4BDZ A;  1M3A A;  5FU6 C;  7AT1 B;  3FLG A;  2LTO A;  1W1F A;  4XU0 A;  1UTI A;  1I5L A;  1D3B A;  1T0H A;  2DNU A;  4F14 A;  1ZBX A;  1Q82 R;  1WHJ A;  2FRY A;  3H9N A;  2KAF A;  4JRI A;  4P5N A;  1B07 A;  4Z88 A;  1RAI B;  1GBQ A;  4J6W A;  3QWX X;  3LYI A;  1C6V X;  1C0M A;  3C94 A;  5L8R E;  1I1J A;  1WYX A;  1YJ9 A;  1QVF P;  2H8H A;  2KY9 A;  3OYI A;  3G4S Q;  1M90 R;  1Q82 U;  2OJ2 A;  2CUB A;  2FZC B;  3CC2 T;  2CYZ B;  2YT6 A;  4PKC C;  6AT1 B;  2KXD A;  2P84 A;  4C0D C;  1UFF A;  4M75 C;  3OS2 A;  2NUP A;  2LNV A;  2NUT A;  2O31 A;  4GY5 A;  3OBY A;  3OS5 A;  2RNA A;  3QUI A;  2OAW A;  3BFM A;  1M90 U;  3QJY A;  3MJX A;  2LRQ A;  3VYG A;  2XD0 A;  1YCS B;  3N5B B;  2JW4 A;  2HQH A;  4JZ3 A;  1VQ5 A;  3NHN A;  4NL2 A;  1SRM A;  2HDA A;  4C92 B;  1AD5 A;  1IO6 A;  3L42 A;  1ABO A;  1G8X A;  4F7U B;  4M7D G;  3CC4 Q;  3CMA T;  2J7I A;  2L3R A;  2DIG A;  4DBR A;  1WJS A;  1D1C A;  1W4S A;  4EMK B;  3EFO A;  5CVI A;  4FSX A;  1OPL A;  1PG5 B;  4E6R A;  2ZGW A;  1TG0 A;  3DKM A;  4AG2 C;  4LXC A;  4BE0 A;  1M1K C;  2KNB B;  2FZK B;  2ROL A;  4M7A A;  1ZBJ A;  4GBQ A;  3CPW P;  2E3H A;  1UHF A;  3OW2 P;  5KYX B;  1G3T A;  1W70 A;  3M0P A;  1IHW A;  3VUB A;  4LDU A;  4C8Q D;  1BKB A;  2WSE E;  1VQN A;  1GRI A;  1VA7 A;  1EX4 A;  4L59 A;  2GTO A;  2VXE A;  3SEM A;  3OYY A;  5GMK l;  1YP5 A;  3DLM A;  3RKW A;  3EH2 A;  2DIL A;  5GAN 6;  3CCL T;  2YRD A;  2FYK A;  1UUE A;  3M5A A;  4HCK A;  4M78 A;  3PVL A;  1VQ4 A;  2PVD B;  1RUW A;  2K6D A;  4PJO D;  2H3J A;  2AIR B;  4IUR A;  1ZA1 B;  1Y07 A;  2O9S A;  3J81 E;  1YIT Q;  4PLI A;  1VYV A;  1TUC A;  2CZ1 B;  1R0C B;  2PVG B;  4J9C A;  4MDW A;  4O5V A;  2RHI A;  2FZG B;  4M77 E;  2E6N A;  1KK7 A;  4DBF A;  2GNC A;  3SHW A;  1JQQ A;  3QPH A;  2X3W D;  3G4S A;  4E7Z A;  1KQ1 A;  4LUD A;  4Y92 A;  1MUZ A;  3QXE B;  5CIU A;  2ZPE B;  1TOV A;  2X4X A;  4AT1 B;  5LJ5 d;  4C0F A;  4ATO A;  3FJP A;  2PQW A;  4LDY A;  2QAZ A;  5GMK h;  1QVF A;  1KFZ A;  2MYS A;  3REA B;  3NTK A;  5D6W A;  1KIK A;  3CC2 A;  3BE3 A;  2M02 A;  2K3Y A;  3RMS A;  2MCN A;  2JVV A;  1VYT A;  1S72 T;  4BI4 A;  2JN0 A;  1GCP A;  2YHT A;  4KGX B;  5GJV B;  3NTH A;  1GL5 A;  1PSE A;  4XTX A;  2JOY A;  2LCS A;  2RJF A;  3R6N A;  3MET A;  4HCC A;  1JXO A;  2X9H A;  1M3C A;  5CKE A;  4F7U A;  1VQ7 Q;  2CS7 A;  3LGL A;  5CQX A;  1UB4 A;  2M51 A;  2IIM A;  3CCM Q;  1T3S A;  4EMK A;  2DMO A;  1WXT A;  2LCC A;  2QQA A;  1YIJ Q;  2L3P A;  3ASK A;  1O75 A;  3G6E T;  4OP0 A;  4EMH A;  2AT1 B;  4NOY A;  1G83 A;  4E7I A;  1PKT A;  5LJ3 j;  2VC8 A;  2I0N A;  9ATC B;  5LJ5 f;  2COY A;  2KT8 A;  2CH4 A;  4KRT A;  3CPW A;  4M7D F;  3VKI A;  2Z0W A;  2LJ0 A;  3JB9 D;  3FJ5 A;  1ARK A;  2EJ9 A;  2Y4X A;  2F2X A;  2RQT A;  4FW1 A;  5CKF A;  4A63 B;  4CC7 A;  4K11 A;  1ZUK A;  1M1F A;  2VB6 A;  5LJ5 g;  2PTK A;  4RMO A;  1TU0 B;  1YJN T;  1MNE A;  3CCL A;  3VS1 A;  5GMK m;  2EPD A;  5FRN A;  2D9T A;  1H8K A;  3UAT A;  2DET A;  4J6X A;  4CC4 B;  2JTM A;  1C1A A;  1RAF B;  4FYX B;  1R8O B;  3FEO A;  3U23 A;  4AFU C;  1OU9 A;  1ZUU A;  3OYB A;  3MO8 A;  2KE9 A;  2COW A;  5CKH A;  3VRZ A;  5KYU B;  1AWW A;  3L1A A;  4Q5W A;  1NE8 A;  1H64 1;  4II1 A;  3DB4 A;  4XTZ A;  5LL6 S;  4GLM A;  5LJ5 e;  1BBZ A;  3EFS A;  2DLP A;  2FHD A;  3M0S A;  1OOT A;  5IXF A;  2FVU A;  4BB7 A;  3M57 A;  5GAN d;  2JTF A;  1PCX A;  3TCJ A;  4ZGD B;  1PSF A;  2HKN A;  4M77 B;  1K9M R;  2XID A;  4HT8 A;  3CCE Q;  4E7H A;  1PKS A;  3RMQ A;  3BDU A;  3TEE A;  1VUB A;  3J80 E;  1M4Z A;  2HQE A;  1QLY A;  5CR2 A;  3MCA B;  3PNW C;  4B9W A;  3F70 A;  1NJI R;  1KG1 A;  1AWJ A;  2WSC E;  1BU1 A;  2DER A;  1SEM A;  5FWB A;  1S72 A;  1NZ9 A;  2EQK A;  4FU6 A;  4ESR A;  1VQ7 A;  5ECA A;  1GXI E;  4OF1 A;  4C8Q B;  1ACM B;  4J9E A;  3CD6 Q;  1NJI U;  2KRO A;  2MOX A;  1K73 C;  1X43 A;  3OYN A;  4J9D A;  1K9M C;  4PFP A;  3PTA A;  2K7A A;  3L2Z A;  3PIO A;  3BDL A;  1YWP A;  3OS1 A;  4C92 D;  1JBM A;  2DKG A;  4CC2 A;  1KC8 R;  1XNI A;  1QVP A;  3A8M B;  3PMT A;  4KH1 B;  2G3R A;  1OPK A;  2MWO A;  2MWP A;  5GAN f;  3C4S A;  2GFU A;  2DRK A;  1SPK A;  2HBP A;  5KYW A;  2RA2 A;  1KHI A;  4N4I A;  2YRC A;  1RLP C;  2EJG A;  3CCS T;  3QKJ A;  3MP8 A;  4A4G A;  1ZUY A;  1K4U S;  3ME9 A;  3VS5 A;  4OMM A;  4PJO C;  1AZG B;  1AHJ B;  2DAQ A;  1KC8 U;  4M7D D;  3HL8 A;  2CT4 A;  1WHL A;  5GAN g;  5IHN A;  2JMC A;  2MF2 A;  3OQ5 A;  3CEY A;  2YWW A;  3SWN C;  1QMC A;  1ZQ1 A;  1NM7 A;  3P8D A;  1TSF A;  1AT1 B;  4ZGE B;  5I2S A;  1AEY A;  2YUQ A;  1OI1 A;  3M59 A;  2F2V A;  1JEG A;  4IIO A;  3M56 A;  2DZ9 A;  4M75 E;  4HCB A;  2PUO B;  1YJN A;  1TS9 A;  1RAC B;  2KYM A;  3JV3 A;  2DFU A;  2VGM A;  3I55 T;  4J8O A;  3KFV A;  5GAN e;  4XQ3 A;  1VQO T;  3EGU A;  1OU8 A;  2FPE A;  3CPW S;  1G2B A;  2XMF A;  3EG3 A;  4DEX A;  3KXT A;  4EDU A;  1VQ5 T;  1LJO A;  1IRX A;  2Y90 A;  4J9I A;  3CCE A;  2O2O A;  4EMG A;  2K3B A;  2HAX A;  2QA4 Q;  5J26 A;  3MEU A;  4J6Y A;  3C0C A;  4IUU A;  2DL7 A;  2D1X A;  1Z9Z A;  4ELY C;  2J06 A;  5CKD A;  1NBE B;  2B8A A;  2EYW A;  2RQV A;  1QCO A;  2RI2 A;  3RR6 A;  4LDW A;  3UWN A;  2L3S A;  3E2U A;  3QO3 A;  3THK A;  3RER A;  2F1L A;  1DJ7 B;  1W6X A;  2DL5 A;  4ORZ A;  4HT9 A;  1EZZ B;  4PL6 A;  1OUL A;  4C8Q A;  2NLU A;  2GBQ A;  2E10 A;  4AFQ C;  4JJB A;  2FL7 A;  1Y96 A;  3JCM c;  1IGQ A;  3H0H A;  3ZBD A;  1FXX A;  1BCO A;  2CRE A;  2OTJ T;  1VQN T;  4JS5 A;  1N9S A;  1JJ2 A;  1IRE B;  1N8R C;  3LLR A;  2K2M A;  3A8H B;  2AZV A;  4OB1 B;  4PJO A;  1BI2 A;  1VQP Q;  1WHM A;  2DA9 A;  4HKE A;  1LPL A;  4A4E A;  4X9C A;  4JLI A;  3EHQ A;  4QVD A;  5GAO n;  3EGX B;  1TUG B;  1RI0 A;  4BI8 B;  4XAX B;  4M7A C;  1BIA A;  2R5M A;  2QQB A;  3EAE A;  5KE2 A;  4ZTF A;  1I0C A;  1TH7 A;  1FMK A;  1XOV A;  1FYN A;  2R5A A;  1MND A;  2QTX A;  2DYB A;  2O88 A;  2DO3 A;  4OMQ A;  3OBW A;  3CCQ Q;  2EJF A;  3CCS A;  3MEA A;  3CCV Q;  2YDL A;  1SSF A;  4LDX A;  4QQD A;  3Q1J A;  2YSQ A;  1NLP C;  1F1B B;  1GBR A;  2OI3 A;  2DD4 A;  3G4S T;  4BE2 A;  1VQ9 Q;  4M78 C;  4JPB W;  2HMA A;  2DJZ A;  4OB2 B;  5LJ3 d;  1E6G A;  4IUT A;  4M75 G;  2ROT A;  2KXC A;  4LDV A;  1OX8 A;  1AZE A;  1G5V A;  2FG0 A;  3JB9 J;  1D1B A;  1HSQ A;  3GBQ A;  2VVK A;  4J83 A;  5AT1 B;  2KQW A;  2K57 A;  2A37 A;  5GMK i;  1QKW A;  1LCK A;  4A4H A;  4JUV A;  2K4Y A;  2JZ2 A;  3I55 A;  1JU5 C;  2RHX A;  1UEC A;  1M1K R;  4OMF B;  3INZ A;  4E2F B;  4XU2 A;  3X20 B;  1MV3 A;  2KDS A;  1D0Y A;  3JCM W;  3MEW A;  1VQO A;  3M55 A;  1B34 A;  1M30 A;  3VS2 A;  4D8K A;  3CC4 T;  2LQN A;  5DLO A;  2CH4 W;  1QVG A;  2E5Q A;  4RG2 A;  1M1K U;  2EGE A;  2YUO A;  5KCO A;  3NTI A;  1ZSZ B;  1CSK A;  4M77 D;  4F7U G;  4FM4 B;  2BZX A;  4N0A C;  4EIK A;  2GTJ A;  5KE3 A;  4GLK A;  3L2W A;  3PMI A;  2V8I A;  2CSI A;  3JCM P;  2J05 A;  4HVU A;  2DPP B;  3KUF A;  1XTD A;  5GAN h;  4DBQ A;  4C92 C;  4E47 A;  1HXD A;  2RJE A;  5CAI A;  3OYA A;  1YI2 Q;  4M7D B;  3I56 Q;  1WA7 A;  2DZC A;  1U1T A;  1ZSZ C;  1UE9 A;  2CSQ A;  2HL3 A;  4JS4 A;  4C5E A;  2HKQ B;  4BE1 A;  1BI1 A;  1WNL A;  2NWM A;  1O9S A;  8ATC B;  4EMK C;  2F69 A;  1I4K 1;  1VOM A;  2E4H A;  2OTJ A;  2QYZ A;  2G6F X;  3EGX A;  3RKY A;  2I2L A;  1H3H A;  3OY9 A;  4FYW B;  2EYZ A;  5CO7 A;  1PNJ A;  1YIT T;  3VS3 A;  5DY9 A;  4A4K A;  3UDC A;  4RTZ A;  3CCU Q;  3CBO A;  3CBP A;  1IGU A;  2FEI A;  3S3O A;  3TU4 K;  4KBM B;  4WCI A;  1NLO C;  2IPO B;  2V8J A;  4A53 A;  2ZZD A;  4NS5 A;  1VQL T;  5FU7 B;  4FYV B;  2X4J A;  5LJ3 e;  1BI3 A;  2DBK A;  3EG9 B;  2EAY A;  1YHQ Q;  1KJW A;  1K8A C;  1VQ8 Q;  3X28 B;  2IG0 A;  2P0K A;  2X51 A;  1WQ7 A;  1RAH B;  3SB2 A;  1VQL Q;  1RAD B;  1X2K A;  4E7S A;  3HRS A;  5KYY B;  1MGQ A;  1TXQ A;  1JJ2 S;  4F04 B;  2V1Q A;  1QP3 A;  3JCM J;  2M16 A;  2LDM A;  2KT1 A;  2CP7 A;  2LQK A;  4PFZ A;  2XDD A;  3QJ6 A;  4OGE A;  2XIC A;  4J9H A;  3PGG A;  2R58 A;  2M1H A;  4M75 F;  4JJN K;  4N0A A;  2BTT A;  1I5O B;  4CRI A;  1VQ7 T;  1SKU B;  1N6A A;  4JDS A;  3EG0 A;  2L0A A;  4C0G A;  4E7J A;  1UJ0 A;  1BCM A;  5A0D A;  2DK3 A;  2O01 E;  3CCM T;  3VYH B;  1G3S A;  4C92 A;  3CC4 A;  1YIJ T;  1WPY A;  4BD3 A;  1ZSZ A;  1U3O A;  2JM9 A;  2F5K A;  2QDL A;  3TQ7 P;  2V8K A;  1CKA A;  1Y0M A;  3R6O A;  1PRL C;  2L3Q A;  4RTT A;  4HA8 A;  1YI2 A;  1WHK A;  2D6F A;  1U1S A;  4KT0 E;  1GFD A;  3RBB B;  3PIP A;  3JSC A;  2OTL Q;  4M7D A;  2DVE A;  3OA6 A;  3P8B B;  2VWF A;  2RQW A;  2O4X B;  3UF4 A;  2AK5 A;  2EGC A;  2CP5 A;  3MP6 A;  1Y7X A;  5KYX A;  3ULR B;  1MHN A;  2DJQ A;  2MIO A;  2CGH A;  5FRO A;  3M9Q A;  4PJM A;  2BE7 D;  3MPU B;  2FO0 A;  1VIF A;  4FIB A;  3NMZ C;  2DRM A;  5KH6 A;  3UA6 A;  3RDV A;  1QVG S;  4IUQ A;  3X24 B;  1UGV A;  1SSH A;  2RQR A;  3VS4 A;  2CP2 A;  2DM1 A;  2DXU A;  1RAE B;  1Z9Q A;  2X35 A;  3SFM A;  2D8J A;  3LW5 E;  3OYH A;  2V1R A;  2JT4 A;  5IN1 A;  2VUB A;  4X34 A;  2L8D A;  1YIT A;  4BI3 A;  2QTV A;  4PK4 A;  1M1G A;  2X3X D;  2PZ1 A;  2DEU A;  3EG9 A;  2QQR A;  2M9U A;  5GAN 8;  1E7O A;  4B9X A;  1VQL A;  3OSV A;  1FWZ A;  2VAS A;  4QW2 A;  2RH2 A;  2P0Q A;  3VS7 A;  3JRZ A;  5KYY A;  4RG8 A;  3RES A;  4A4F A;  4CC3 A;  2DEQ A;  4Y28 E;  3CCE T;  1T3L A;  4QT7 A;  1D0X A;  5GAN 4;  5HKC A;  1X75 C;  1VQ6 Q;  1GFC A;  1SF9 A;  2CZ7 B;  1SRL A;  4V2S A;  3G7Z A;  1K73 R;  3HHT B;  1D0Z A;  3A8L B;  5GAN 2;  1FMV A;  1VQK Q;  4LUE A;  3TVT A;  4RKU E;  3OYC A;  2QDY B;  3GF5 A;  4WF2 A;  3L2Q A;  2NYS A;  1MMN A;  5GJW B;  2D8H A;  4KUL A;  1X69 A;  1NPR A;  1WJR A;  2IVW A;  2D0N A;  2KMT A;  1FMW A;  2HBW A;  1B3Q A;  3GLX A;  3ZFJ A;  5GAM j;  1K9M U;  4ZN1 A;  3CD6 T;  2C0T A;  5HK3 A;  3CME Q;  5GAO r;  4M77 C;  2LQW A;  4M75 D;  5LJ3 h;  2ECZ A;  1U5S A;  2GFA A;  3QWY A;  2E41 A;  2BIV A;  3I35 A;  3CCJ Q;  2DF6 A;  1WGS A;  4OML A;  3D7S B;  3CC7 Q;  3OYL A;  1JJ2 P;  5KCH A;  3EGD B;  3CCM A;  3GOX A;  2GCX A;  2NUZ A;  5DLQ E;  3VU3 C;  4OB0 B;  2FPF A;  4M7A E;  3M0Q A;  1YIJ A;  2LNH B;  2FB7 A;  1EIF A;  4KUI A;  2EQU A;  3UA7 A;  5FLX E;  1D09 B;  4PJO G;  5D6X A;  4C8Q C;  3I5S A;  1N27 A;  4J9F A;  2BKD N;  2CP3 A;  3H8Z A;  3S3N A;  2O4X A;  1K76 A;  3IQL A;  1U8R A;  2ED0 A;  2A3L A;  2PU9 B;  3X26 B;  4DOV A;  4AG1 C;  3FDR A;  2MPX C;  3V7S A;  2RM4 A;  2KSS A;  4BY6 B;  1WDX A;  4ZN3 A;  3M4Y A;  2AKK A;  1UHC A;  4M78 E;  2GQI A;  3A5Z B;  1NEG A;  1RAA B;  1YFN A;  3G71 Q;  3PVQ A;  4MDX A;  3RNJ A;  2AZS A;  2LCL A;  4B6M A;  5IXB A;  2QEX Q;  1Q95 G;  2ATC B;  3URG A;  3CCR Q;  3VV0 A;  1OZ3 A;  2F2W A;  1OV3 A;  2DVJ A;  1TUD A;  1YJW Q;  2YUP A;  2ZPB B;  3LWI A;  2ED1 A;  2A28 A;  5EC7 A;  4N4G A;  4OVA A;  2YUN A;  2HNI A;  4PLL A;  3WVE B;  4ELZ C;  4XTW A;  5D6Y A;  2RD1 A;  4DEY A;  1Q81 C;  2E65 A;  2J6F A;  5KYU A;  1V76 A;  4WTO B;  2QXF A;  1KSW A;  2EVR A;  3FRN A;  4OB3 B;  5A0G A;  2K3X A;  3M0R A;  2QA4 T;  1QQJ A;  2YXY A;  3M58 A;  2B86 A;  4OGC A;  3QYH B;  1ZHI A;  2RHU A;  3HP9 A;  4M77 A;  1YBY A;  1QVG P;  1YJ9 Q;  5CCA A;  1WQW A;  3DLL A;  3GNG A;  1RAG B;  1N8R R;  3MEV A;  2DX1 A;  1NPP A;  2VV5 A;  2W10 A;  2NUP B;  3JCM d;  2NUT B;  3TSZ A;  2DD5 A;  1WXB A;  3OMC A;  4D6W A;  3AT1 B;  4C92 E;  1WFW A;  1PD0 A;  3E19 A;  1N9R A;  2Y4Y A;  4DOW A;  2C0I A;  1NEB A;  1VQM T;  1N8R U;  2JM8 A;  1MV0 B;  2JTE A;  2LC4 A;  1K9A A;  4F7U E;  5GAO m;  4FW2 A;  2EKH A;  1BB9 A;  2RB6 A;  4R0K A;  3L2R A;  3CD6 A;  2RPN A;  3QZ9 B;  3FC3 A;  1VQP T;  2ZPI B;  4JRK A;  3OB9 A;  1M2V B;  5CK9 A;  3EGD A;  1VQM Q;  3PT9 A;  3EH1 A;  2XDB A;  2CT3 A;  1KD1 C;  3HTR A;  1BYM A;  3JB9 G;  4KGZ B;  4M7A G;  1YCY A;  2CKK A;  3ER0 A;  2J6O A;  4DBH A;  2CP6 A;  3OMG A;  2EYQ A;  3S3M A;  4X9D A;  3E9G A;  1X2Q A;  1TWB A;  2DE0 X;  8AT1 B;  4J9G A;  1B7T A;  3LX7 A;  1SHG A;  2AHJ B;  4TVR A;  5IT9 E;  3CCQ T;  2BUD A;  3CCV T;  4CI0 C;  1LVK A;  2A7Y A;  3BW1 A;  5CKB A;  1WLP B;  1OZ2 A;  3OYM A;  3G71 A;  1XQH A;  4M78 G;  4JJC A;  4JLG A;  1VQ9 T;  2SEM A;  2W0Z A;  4RTY A;  2FRW A;  2RI5 A;  3HKS A;  5FU6 B;  4XTY A;  3CCR A;  4QKU A;  3C95 A;  5FWC A;  1K0S A;  4MZP A;  3NPF A;  4PJO F;  1N5Z A;  3QG1 A;  5KYN A;  4AMC A;  3JCM V;  2K5L A;  4R56 A;  2KYB A;  1VQ4 Q;  1Q86 C;  2CZ6 B;  2KGT A;  2ZCF B;  1IXD A;  4ZNX A;  1HD3 A;  4UC4 A;  2K5I A;  2BZ8 A;  4PJJ A;  1PWT A;  4ME7 A;  1K1Z A;  2E3I A;  4A54 A;  4KH0 B;  5I21 A;  2EQI A;  1V1C A;  5CQY A;  4C0D B;  2KBT A;  4M75 B;  3HRU A;  1Q7Y C;  3GIB A;  2K79 A;  3LH0 A;  3VS6 A;  5GAN 3;  3TRE A;  4C5H A;  3JCM e;  1MMD A;  5DM7 R;  1KQS S;  2KVQ G;  1W2B A;  3VJP A;  2QA4 A;  1UJY A;  4O6J A;  1ZSG A;  2HSE B;  4RTW A;  1UGR B;  4M4Z A;  3M54 A;  1V29 B;  3CXC S;  2O9V A;  5IHI A;  2DXT A;  2P0P A;  4FT4 A;  2XKO C;  4C92 G;  1PC0 A;  3P8H A;  4J7I A;  3CC2 Q;  3TSW A;  4HXJ A;  1YI2 T;  1M27 C;  2LX7 A;  3I56 T;  1JXM A;  1KHC A;  1Q82 C;  4J7F A;  3H0I A;  2JS0 A;  1I07 A;  3EG2 A;  1VIE A;  3ZEH A;  2A36 A;  3SDZ A;  1VQM A;  5LJ3 f;  3WVD B;  3JCM X;  1M2V A;  1GCQ C;  1AWO A;  3JB9 I;  2YLC A;  2KRS A;  2J6K A;  2EGA A;  5GMK j;  4EPC A;  1M90 C;  1K8A R;  4OMN A;  1HK9 A;  4D8D A;  2RK2 A;  1ZLM A;  1VQP A;  1A0N B;  1RI9 A;  1UG1 A;  2E5K A;  3CCU T;  3PE0 A;  2XHC A;  1PD1 A;  5LJ3 g;  5GAM d;  2QAS A;  3NGP A;  4IUP A;  3EFR A;  5FRM A;  3CMA Q;  4M7D C;  4ZGJ B;  1HYO A;  3MHX A;  4FL6 A;  1K8A U;  5HCK A;  5J39 A;  4PFO A;  3JCM Q;  4LD6 A;  4MZM A;  2ENM A;  2M0Y A;  1YHQ T;  3OYE A;  1VQ8 T;  3CCQ A;  4LD9 K;  3JB9 F;  3V8K A;  5HK0 A;  3CCV A;  4M7A F;  4L5G A;  4R55 A;  2LT1 A;  2JS2 A;  1RLQ C;  2XU8 A;  2VYT A;  1X27 A;  2LX9 A;  3M0T A;  1VQ9 A;  1WJQ A;  5L23 A;  4RUG A;  3VRY A;  3V7C A;  2LQ8 A;  3KBG A;  1QKX A;  4LE9 A;  5FU7 C;  1JB0 E;  4Z02 A;  3CCL Q;  4M78 F;  2QGG A;  2ABL A;  2EFI A;  4RTX A;  3RUX A;  3LH5 A;  4VUB A;  3X25 B;  4NL3 A;  3OYJ A;  4RTU A;  2LMJ A;  2EW3 A;  2V26 A;  2HCK A;  4M75 A;  1YN8 A;  2KEA A;  1E6H A;  2K9G A;  3CBM A;  5GAM f;  3LGF A;  1JRI A;  2QI2 A;  2JXB A;  1H3Z A;  4OMP A;  2JJ9 A;  2RQU A;  4LN2 A;  2LJ1 A;  4C5G A;  2X4W A;  3OYK A;  2WAC A;  1WZO A;  4FSS A;  2MK5 A;  1NYG A;  4OMO A;  3V8J A;  5J3B A;  4PJL A;  2F5T X;  2E1H A;  2MMP A;  1KQ2 A;  5GAM g;  5I22 A;  2QGF B;  5C6S A;  2HD0 A;  3I9Q A;  1NYF A;  2M0O A;  1GCQ A;  4RCC A;  3I5R A;  3HRT A;  5D7U A;  4KGV B;  2OTL T;  4C8Q E;  3QDR B;  2RK1 A;  3ZL7 C;  1SHF A;  2HZY A;  3G1J A;  3O8V A;  1QW1 A;  2EWN A;  2XK0 A;  4C5I A;  4Y91 A;  2ZPF B;  3I56 A;  2RN8 A;  1UEB A;  2EQM A;  2EYY A;  2YLB A;  1S72 Q;  1G3W A;  1MMA A;  5FW9 A;  4PJO E;  2CZ0 B;  1ZX6 A;  1OEB A;  2XDP A;  5GAM e;  4XU1 A;  1NG2 A;  4C92 F;  1PM3 A;  2MI6 A;  3T9N A;  2BZY A;  1KQS P;  2RJC A;  3JCM h;  1W2B S;  3A1P A;  1AVZ C;  4F7U F;  1Y71 A;  2JMA A;  3H0F A;  3CMA A;  2MAM A;  2QK0 A;  2DBM A;  3CQT A;  5M9O A;  3CXC P;  1OX9 A;  2K5F A;  3CCU A;  2KR3 A;  5KYW B;  4BDY A;  2AKL A;  5IAY A;  2RJD A;  1QWF A;  2FPD A;  3G6E Q;  2DXC A;  3OW2 A;  2CP0 A;  1H92 A;  2VXF A;  4HCZ A;  2OAU A;  1M8M A;  1YHQ A;  4M7A D;  1VQ8 A;  1K0X A;  1QCN A;  1WXU A;  1UDL A;  4QVZ A;  1HJD A;  4Z89 A;  3NFC A;  4DA4 A;  1VQ6 T;  1QP2 A;  4Z8A A;  1RAB B;  4ANJ A;  3HFN A;  1WIE A;  3V7R A;  4LNP A;  1I81 A;  1VQK T;  4N4H A;  3OYD A;  3OSS C;  3M0U A;  1Y57 A;  3QYG B;  1X6O A;  2L5Q A;  3HSB A;  3AHU A;  2C0O A;  1YJN Q;  4F17 A;  2LVM A;  3MKD A;  4XTV A;  4M78 D;  4HVV A;  2KRN A;  4YTL A;  4MZT A;  1UGS B;  4M77 G;  3CME T;  2PUK B;  1R77 A;  1WHH A;  3A98 A;  1J3T A;  2CUD A;  1M5Q 1;  1X6B A;  4JZ4 A;  1LNX A;  5GAO l;  2PVO B;  3QHS A;  3CCJ T;  1T0J A;  2XG8 D;  2HQX A;  5EG2 A;  3A8G B;  3CC7 T;  1K73 U;  3SD4 A;  4QVC A;  1P92 A;  4AFZ C;  1X6G A;  3EHR A;  3EG1 A;  1SG5 A;  1QCF A;  2EIF A;  2SRC A;  4RTV A;  2GF7 A;  1OYX A;  2A08 A;  3UT1 A;  2E70 A;  4J5Y A;  3OYG A;  4C8Q G;  4MML A;  2DYI A;  4XK8 E;  3HFO A;  4PNO A;  3JCM b;  5GAN 5;  3OS0 A;  2ZAE A;  2YRV A;  3VS0 A;  3WXM B;  1U06 A;  2DTI A;  2OTL A;  3L2U A;  4JJD A;  2WSF E;  4DQ2 A;  4E7L A;  5A0L A;  1M2O A;  1BIB A;  1Y96 B;  3E9F A;  4JRQ A;  1Q81 R;  3G71 T;  2COZ A;  5A2Q E;  2HL5 C;  5GAO q;  4L6V 5;  2QEX T;  2ESW A;  3CCR T;  2RF0 A;  3H41 A;  2OX7 A;  4PJO B;  1YJW T;  1QVF S; 
#chains in the Genus database with same CATH homology
 3BW1 A;  1KQS A;  3E1S A;  5LJ5 f;  3RKY A;  2I2L A;  5CKB A;  3OY9 A;  1OZ2 A;  3CPW A;  4M7D F;  1Q81 U;  5CO7 A;  3OYM A;  3H6Z A;  3G71 A;  1XQH A;  4M78 G;  2QQS A;  3VKI A;  1YIT T;  4JLG A;  5DY9 A;  1VQ9 T;  4A4K A;  1NJI C;  3UDC A;  3QSU A;  2RI5 A;  4BAC A;  3SWN B;  5GAO p;  3CXC A;  3HKS A;  3G6E A;  3CBO A;  4XTY A;  5FU6 B;  3CBP A;  5I2M A;  3CCR A;  3JB9 D;  3S3O A;  3TU4 K;  1M9S A;  3RKX A;  3C95 A;  4KBM B;  5GAN 7;  4IUV A;  4MZP A;  4BY6 C;  2EJ9 A;  2RO0 A;  2Y4X A;  4PJO F;  4BUG A;  3JB9 H;  2V8J A;  5CKF A;  4A53 A;  2ZZD A;  4NS5 A;  1VQL T;  3QG1 A;  1M1F A;  4RCB A;  5LJ5 g;  5LJ5 j;  4RMO A;  2P4T A;  3JCM V;  2K5L A;  5FU7 B;  1YJN T;  2X4J A;  3J7A F;  4R56 A;  5LJ3 e;  1BI3 A;  2E6Z A;  4QQ6 A;  3CCL A;  2EAY A;  1D3B B;  5GMK m;  1Q86 C;  2CZ6 B;  1K8A C;  2ZCF B;  3X28 B;  5FRN A;  2D9T A;  2IG0 A;  2P0K A;  3M4G A;  4J6X A;  1WQ7 A;  4UC4 A;  2JTM A;  2K5I A;  3SB2 A;  5GAM h;  2JNG A;  1IZ6 A;  4ME7 A;  1YJ9 T;  3GPL A;  1R8O B;  3FEO A;  4A54 A;  2D0Q B;  3HRS A;  3MP1 A;  3MO8 A;  1MGQ A;  3OYB A;  1VQ6 A;  1JJ2 S;  5CKH A;  3HPW A;  5I21 A;  1KC8 C;  5CQY A;  4C0D B;  3L1A A;  4Q5W A;  1BI0 A;  1NE8 A;  1QP3 A;  3L2V A;  1H64 1;  4II1 A;  3DB4 A;  4M75 B;  4XTZ A;  3HRU A;  3JCM J;  5AYF A;  2XI9 A;  5LL6 S;  1Q7Y C;  2M16 A;  1VQK A;  4ZTJ A;  5LJ5 e;  3GIB A;  2DIQ A;  3EFS A;  2LDM A;  2FHD A;  3LH0 A;  3GNF B;  2FVU A;  2ZPG B;  4BB7 A;  5GAN 3;  3M57 A;  2LQK A;  5GAN d;  3TRE A;  4C5H A;  3OYF A;  2RHY A;  2JTF A;  3JCM e;  3TCJ A;  5DM7 R;  1KQS S;  4ZGD B;  1PSF A;  2KVQ G;  3M53 A;  3VJP A;  3LWH A;  2XDD A;  2QA4 A;  3QJ6 A;  1W2B A;  4M77 B;  4OGE A;  4O6J A;  2XIC A;  2DTO A;  1UGR B;  2XID A;  3PGG A;  3CME A;  3M54 A;  1KD1 U;  1V29 B;  3OW2 S;  1UGP B;  3FIF A;  4HT8 A;  3BY7 A;  4XTU A;  2R58 A;  2M1H A;  4M75 F;  4JJN K;  4E7H A;  3CXC S;  3RMQ A;  3BDU A;  4N0A A;  2DTH A;  1VUB A;  3TEE A;  2DXT A;  4CRI A;  2K2V A;  1M4Z A;  3J80 E;  1VQ7 T;  1LOJ A;  4MMK A;  1B34 B;  2P0P A;  4FT4 A;  1N6A A;  4JDS A;  2C06 A;  2HQE A;  2XKO C;  4C92 G;  4C0G A;  2E64 A;  3CCJ A;  4E7J A;  5CR2 A;  5A0D A;  3P8H A;  3MCA B;  3PNW C;  4J7I A;  1UGQ B;  2DK3 A;  2O01 E;  3F70 A;  3QBY A;  4B9W A;  3I56 T;  3VYH B;  3CC7 A;  3CCM T;  1YI2 T;  1G3S A;  4IKF A;  4KUD K;  4C92 A;  1KG1 A;  1KHC A;  3QZ5 B;  2WSC E;  4M77 F;  1Q82 C;  2RHZ A;  3FB9 A;  3CC4 A;  4J7F A;  3VUZ A;  2RI3 A;  2X4Y A;  2JUF A;  1RL2 A;  1YIJ T;  2EKO A;  1WPY A;  3S6W A;  4BD3 A;  1S72 A;  2F5K A;  1VIE A;  2E12 A;  3ZEH A;  1NZ9 A;  2EQK A;  4FU6 A;  2V8K A;  5HY6 A;  3SDZ A;  1I8F A;  3C12 A;  3PFS A;  1VQ7 A;  4M7D E;  1VQM A;  3R6O A;  4XU3 A;  1FX7 A;  5LJ3 f;  3WVD B;  1GXI E;  4OF1 A;  4C8Q B;  3UPU A;  3JCM X;  2R57 A;  3JB9 I;  2YLC A;  1NJI U;  4FT2 A;  5GAO l;  4HA8 A;  1YI2 A;  2QQ9 A;  5GMK j;  4EPC A;  2D6F A;  1U1S A;  4KT0 E;  1M90 C;  4JRP A;  1G3Y A;  1HK9 A;  1X01 A;  2DXB A;  2GQV A;  2RK2 A;  2ZPH B;  3JSC A;  3PIP A;  3OYN A;  1VQP A;  2DVE A;  1K9M C;  4M7D A;  3PTA A;  3OA6 A;  3P8B B;  3A8O B;  3L2Z A;  3PIO A;  3BDL A;  5LJ5 h;  3CCU T;  3OS1 A;  4M7A B;  2O4X B;  2XHC A;  4C92 D;  4ATO A;  1JBM A;  5LJ3 g;  5GAM d;  4QQG A;  2DKG A;  4IUP A;  3MP6 A;  1Y7X A;  4C8Q F;  3RIR A;  3QII A;  2EQJ A;  1XNI A;  3EFR A;  1QVP A;  3A8M B;  3PMT A;  4C0Z A;  2G3R A;  5FRM A;  4M7D C;  1MHN A;  2MWO A;  4ZGJ B;  2MWP A;  3JAM E;  3MHX A;  5GAN f;  3C4S A;  2GFU A;  4FL6 A;  1Q86 U;  2CGH A;  5FRO A;  2HBP A;  3M9Q A;  1K8A U;  5J39 A;  2RA2 A;  1KHI A;  4N4I A;  1VIF A;  4FIB A;  3JCM Q;  3DB3 A;  4LD6 A;  4MZM A;  3JCM f;  2EJG A;  2KK4 A;  5KH6 A;  3CCS T;  3QKJ A;  2QEX A;  2L89 A;  1YHQ T;  3MP8 A;  4A4G A;  1VQ4 T;  3OYE A;  3V8L A;  1QVG S;  3CCQ A;  5GMK e;  4IUQ A;  3X24 B;  3ME9 A;  1VQ8 T;  4LD9 K;  3JB9 F;  3V8K A;  5C0M A;  5HK0 A;  3CCV A;  2LT4 A;  4L5G A;  4R55 A;  4M7A F;  4PJO C;  1YJW A;  2LT1 A;  1AHJ B;  2DXU A;  2DAQ A;  3SWN A;  1KC8 U;  2X35 A;  3HL8 A;  4M7D D;  3SFM A;  3LW5 E;  4E7K A;  3OYH A;  2XU8 A;  5GAN j;  4M78 B;  2VYT A;  5GAN g;  5IN1 A;  2VUB A;  1Q7Y U;  4X34 A;  2L8D A;  2VGN A;  2LX9 A;  1YIT A;  2MF2 A;  1VQ9 A;  1M8V A;  1WJQ A;  3OQ5 A;  4BI3 A;  3CEY A;  3JCM g;  3CPF A;  3GP8 A;  3SWN C;  4BDZ A;  1M1G A;  5FU6 C;  1ZQ1 A;  3FLG A;  2LTO A;  3V7C A;  2LQ8 A;  4XU0 A;  2QQR A;  1I5L A;  3KBG A;  2M9U A;  3P8D A;  1D3B A;  4ZGE B;  5I2S A;  5GAN 8;  1VQL A;  4B9X A;  3OSV A;  1OI1 A;  1ZBX A;  3M59 A;  1FWZ A;  3M56 A;  2DZ9 A;  4M75 E;  2RH2 A;  2PUO B;  4QW2 A;  2P0Q A;  1JB0 E;  5FU7 C;  4Z02 A;  2KAF A;  4JRI A;  4M78 F;  1YJN A;  4P5N A;  2EFI A;  2VGM A;  3JRZ A;  4J8O A;  3I55 T;  4RG8 A;  4J6W A;  3RUX A;  3RES A;  4A4F A;  4VUB A;  3X25 B;  3LYI A;  4NL3 A;  3OYJ A;  2DEQ A;  3C94 A;  4Y28 E;  5L8R E;  3CCE T;  5GAN e;  5GAN 4;  5HKC A;  4M75 A;  1X75 C;  1YJ9 A;  4XQ3 A;  2KY9 A;  3OYI A;  2CZ7 B;  1Q82 U;  1VQO T;  4V2S A;  3CBM A;  3G7Z A;  5GAM f;  3LGF A;  3HHT B;  3CPW S;  1JRI A;  3CC2 T;  2CYZ B;  3A8L B;  4PKC C;  2QI2 A;  5GAN 2;  1H3Z A;  4RKU E;  4C0D C;  3OYC A;  2QDY B;  3KXT A;  4EDU A;  3GF5 A;  4M75 C;  4WF2 A;  4C5G A;  1VQ5 T;  3OS2 A;  3L2Q A;  2LNV A;  1LJO A;  2X4W A;  3OYK A;  2Y90 A;  2WAC A;  4KUL A;  3CCE A;  4EMG A;  2HAX A;  1NPR A;  1WJR A;  2IVW A;  3OBY A;  2KMT A;  3OS5 A;  4GY5 A;  3V8J A;  5J3B A;  3QUI A;  3BFM A;  5J26 A;  3MEU A;  3GLX A;  2F5T X;  3QJY A;  4J6Y A;  2E1H A;  1M90 U;  3VYG A;  2LRQ A;  2XD0 A;  4IUU A;  2MMP A;  3ZFJ A;  4ELY C;  1KQ2 A;  5GAM j;  1K9M U;  4ZN1 A;  5GAM g;  3CD6 T;  5CKD A;  5HK3 A;  5GAO r;  5C6S A;  2HD0 A;  4M77 C;  1I4K 1;  3N5B B;  2B8A A;  2M0O A;  2RI2 A;  4M75 D;  4RCC A;  5LJ3 h;  4LDW A;  3HRT A;  2GFA A;  1VQ5 A;  2E41 A;  2OTL T;  4NL2 A;  2BIV A;  4C8Q E;  3QDR B;  2RK1 A;  3UWN A;  4C92 B;  3QO3 A;  3L42 A;  3RER A;  1WGS A;  3O8V A;  1DJ7 B;  3OYL A;  1QW1 A;  2EWN A;  2XK0 A;  4C5I A;  4F7U B;  4M7D G;  4Y91 A;  5KCH A;  2ZPF B;  4HT9 A;  3CMA T;  3I56 A;  3CCM A;  3GOX A;  2GCX A;  2L3R A;  4PL6 A;  5DLQ E;  1UEB A;  4C8Q A;  2NLU A;  3VU3 C;  2EQM A;  2YLB A;  2E10 A;  4OB0 B;  2DIG A;  2FL7 A;  4M7A E;  1G3W A;  1YIJ A;  1WJS A;  4PJO E;  2CZ0 B;  1Y96 A;  2FB7 A;  3JCM c;  1W4S A;  1EIF A;  4EMK B;  2XDP A;  4KUI A;  5CVI A;  2EQU A;  3ZBD A;  5GAM e;  4XU1 A;  4FSX A;  1FXX A;  5FLX E;  2OTJ T;  1VQN T;  2ZGW A;  4PJO G;  4C92 F;  3DKM A;  5D6X A;  4C8Q C;  2MI6 A;  3T9N A;  4BE0 A;  1N27 A;  4JS5 A;  1N9S A;  1M1K C;  1IRE B;  2RJC A;  1N8R C;  2BKD N;  3H8Z A;  3LLR A;  3JCM h;  1JJ2 A;  3S3N A;  1W2B S;  4M7A A;  2O4X A;  4F7U F;  3A8H B;  1Y71 A;  4OB1 B;  3CMA A;  4PJO A;  2MAM A;  1BI2 A;  1U8R A;  4HKE A;  4A4E A;  2A3L A;  2PU9 B;  4X9C A;  4JLI A;  4QVD A;  3X26 B;  1G3T A;  5GAO n;  4DOV A;  5M9O A;  1RI0 A;  2K5F A;  3FDR A;  4BI8 B;  3CCU A;  3V7S A;  2RM4 A;  2KSS A;  4XAX B;  4BY6 B;  3VUB A;  4LDU A;  1BIA A;  4ZN3 A;  4M7A C;  4C8Q D;  3M4Y A;  2R5M A;  1BKB A;  2WSE E;  4BDY A;  2QQB A;  3EAE A;  5KE2 A;  4M78 E;  4ZTF A;  1VQN A;  1TH7 A;  3A5Z B;  1XOV A;  2R5A A;  5IAY A;  2RJD A;  2QTX A;  4L59 A;  4MDX A;  2LCL A;  2VXE A;  2DO3 A;  3OYY A;  5GMK l;  3OBW A;  2DXC A;  3DLM A;  5GAN 6;  3RKW A;  3CCL T;  3OW2 A;  3URG A;  3VV0 A;  2FYK A;  1OZ3 A;  2VXF A;  4HCZ A;  2EJF A;  2OAU A;  3M5A A;  3CCS A;  3MEA A;  4M78 A;  4HCB A;  1SSF A;  1YHQ A;  1VQ4 A;  4M7A D;  4LDX A;  2PVD B;  4QQD A;  1VQ8 A;  2ZPB B;  4PJO D;  3LWI A;  3Q1J A;  2H3J A;  4QVZ A;  3NFC A;  4N4G A;  4IUR A;  4DA4 A;  1VQ6 T;  2DD4 A;  4OVA A;  1QP2 A;  1Y07 A;  3G4S T;  2HNI A;  4PLL A;  3WVE B;  3J81 E;  4ELZ C;  4BE2 A;  4XTW A;  4M78 C;  5D6Y A;  3HFN A;  4PLI A;  3V7R A;  2DJZ A;  2RD1 A;  1I81 A;  4OB2 B;  1Q81 C;  1VQK T;  4N4H A;  2E65 A;  5LJ3 d;  3OYD A;  4IUT A;  2CZ1 B;  3OSS C;  4M75 G;  2PVG B;  4LDV A;  3QYG B;  4MDW A;  1X6O A;  2L5Q A;  4O5V A;  3HSB A;  2RHI A;  2QXF A;  1G5V A;  3AHU A;  3JB9 J;  4M77 E;  3FRN A;  4OB3 B;  5A0G A;  2K3X A;  2E6N A;  2LVM A;  2QA4 T;  4XTV A;  4M78 D;  3QPH A;  3G4S A;  4J83 A;  4YTL A;  4MZT A;  1UGS B;  1KQ1 A;  2KQW A;  2K57 A;  3M58 A;  4M77 G;  5GMK i;  3CME T;  2PUK B;  4A4H A;  4OGC A;  3QYH B;  1M5Q 1;  1ZHI A;  3QXE B;  2ZPE B;  2K4Y A;  2JZ2 A;  2RHU A;  4JUV A;  5CIU A;  3I55 A;  3HP9 A;  4M77 A;  2X4X A;  1LNX A;  1YBY A;  4C0F A;  3FJP A;  5LJ5 d;  2PQW A;  5CCA A;  1WQW A;  2RHX A;  3GNG A;  4LDY A;  3DLL A;  4OMF B;  3INZ A;  3MEV A;  5GMK h;  1QVF A;  2PVO B;  3QHS A;  4XU2 A;  3CCJ T;  1NPP A;  3X20 B;  3NTK A;  2XG8 D;  2HQX A;  5D6W A;  2KDS A;  5EG2 A;  3A8G B;  3JCM W;  3MEW A;  2VV5 A;  3CC7 T;  1VQO A;  3SD4 A;  1K73 U;  3JCM d;  4QVC A;  3M55 A;  1P92 A;  1B34 A;  1K73 C;  3CC2 A;  3CC4 T;  2K3Y A;  3RMS A;  5DLO A;  2DD5 A;  2EIF A;  3OMC A;  2JVV A;  4D6W A;  4C92 E;  1S72 T;  4BI4 A;  2GF7 A;  3E19 A;  1OYX A;  1QVG A;  2JN0 A;  1N9R A;  2Y4Y A;  4DOW A;  3UT1 A;  2YHT A;  2E5Q A;  4RG2 A;  1VQM T;  2E70 A;  4J5Y A;  1N8R U;  1M1K U;  2LC4 A;  3NTH A;  4F7U E;  3OYG A;  5GAO m;  5KCO A;  3NTI A;  1PSE A;  4C8Q G;  4XTX A;  4MML A;  2JOY A;  2RJF A;  2RB6 A;  4M77 D;  4XK8 E;  3L2R A;  4F7U G;  3HFO A;  4FM4 B;  3QZ9 B;  4PNO A;  3JCM b;  5GAN 5;  4N0A C;  3OS0 A;  3CD6 A;  3MET A;  4HCC A;  3FC3 A;  2YRV A;  5KE3 A;  4GLK A;  1VQP T;  3L2W A;  3PMI A;  2ZPI B;  4JRK A;  3WXM B;  5CKE A;  3OB9 A;  4F7U A;  2V8I A;  2DTI A;  5CK9 A;  2CS7 A;  2OTL A;  3LGL A;  3L2U A;  3PT9 A;  2XDB A;  3JCM P;  1KD1 C;  1BYM A;  2DPP B;  3JB9 G;  3KUF A;  1XTD A;  5GAN h;  5CQX A;  1UB4 A;  4M7A G;  1YCY A;  2CKK A;  2WSF E;  4C92 C;  4DQ2 A;  3ER0 A;  1HXD A;  2RJE A;  4E47 A;  5CAI A;  3OYA A;  3OMG A;  4E7L A;  4M7D B;  5A0L A;  2EYQ A;  4EMK A;  2DZC A;  1BIB A;  1Y96 B;  1U1T A;  2LCC A;  3S3M A;  3E9F A;  4X9D A;  4JRQ A;  2QQA A;  3E9G A;  3G71 T;  3ASK A;  4JS4 A;  4C5E A;  5A2Q E;  5GAO q;  4BE1 A;  1O75 A;  4L6V 5;  1BI1 A;  1WNL A;  3LX7 A;  4OP0 A;  3G6E T;  2QEX T;  4EMH A;  2AHJ B;  3CCR T;  4TVR A;  1O9S A;  5IT9 E;  3CCQ T;  4NOY A;  2BUD A;  4EMK C;  3CCV T;  4PJO B;  4E7I A;  4CI0 C;  5LJ3 j;  2VC8 A;  2F69 A;  2A7Y A;  1YJW T;  2OTJ A;  1QVF S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...