3G1JA

Structure from the mobile metagenome of vibrio cholerae. integron cassette protein vch_cass4.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
GVDRDYLQSEYGVLKAGQCYKVVRSFRDYRNINYERGDVMRFLGSNFVPYESGLSLFFDKNGSERQIMLCVRPEFQMEIAHHLDSYFCKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integron cassette protein
publication title Structure from the mobile metagenome of Vibrio cholerae. Integron cassette protein VCH_CASS4.
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 20
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12208 DUF3601 Domain of unknown function (DUF3601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.350 Mainly Beta Roll SH3 type barrels. mobile metagenome of vibrio cholerae. Integron cassette protein vch_cass4. 3g1jA00
3G1JA
chains in the Genus database with same CATH superfamily
1TWBA 3A8MB 1M4ZA 2VYTA 5CKEA 2IG0A 1NZ9A 2COWA 4X1VA 2K3XA 4CC7A 2FPFA 2RH2A 1D0XA 3TREA 2DO3A 5LJ3g 1MHNA 2DM1A 4BDYA 2Y4YA 4B9WA 2KT8A 2YWWA 2M0YA 1IXDA 5FU7C 2DL8A 4DA4A 2WACA 3CCMQ 4AFUC 5EG2A 1QKXA 2OX7A 3CMEA 1YHQA 3M4YA 3OYCA 3RR6A 1Y71A 2JNGA 1VQ7A 2RI5A 2F2WA 3JRZA 2LQKA 3MP1A 4J9DA 3I56A 2XDDA 3OYFA 2BZ8A 3M4GA 3CMAQ 2P0KA 2D9TA 3JCMX 1AZEA 1ZX6A 4DOWA 2KQWA 2R5AA 2K4YA 4AFSC 4J9IA 1M8MA 4BUGA 2DA9A 5IH2A 1VQ5T 2OTJQ 4ORZA 1U1SA 2J7IA 5KE3A 2KR3A 2DL7A 3WXMB 4FT2A 1MNDA 3OYEA 1W4SA 2KAFA 4M78F 3JCMd 2HAXA 3JB9J 1M3BA 4KH0B 3UDCA 2DYBA 1GXIE 5J39A 2CGHA 4OGCA 5GAN7 1QMCA 3QKJA 3L2ZA 1FMKA 2PZ1A 4RMOA 4F7UF 1KIKA 4V2SA 5LJ5d 1TUCA 1WX6A 1WGSA 4F17A 3OYDA 4A4HA 2SEMA 4OB1B 1K0SA 3JCMQ 2DTOA 3CPWP 2E64A 2K2MA 3V8JA 2RQVA 4JRIA 1AWXA 3HSBA 2A08A 3M0QA 4HVWA 2QA4T 1VQLT 3EHQA 2LQNA 1M2VA 4KH1B 1SPKA 3A8GB 3OS0A 3NMZC 1X6GA 1HJDA 4PNOA 2CYZB 1VQNT 1Q81U 3JCMP 4C8QF 3JCMf 1K1ZA 4EMHA 3QXEB 2OI3A 1VQ6Q 4LDYA 3GP8A 2FRWA 4BE1A 4AFQC 5M9OA 1Q81R 2VWFA 1VQ8Q 1JJ2S 2KYMA 2YUOA 4K11A 1LPLA 2JMCA 3PIOA 4AFZC 5LJ5f 1RI0A 3G4SQ 4F7UE 1X6BA 2HEQA 5CQXA 1IB8A 4JJNK 3S3OA 2PVGB 2D8HA 1K8AC 1UGRB 3VJPA 3DB3A 2KDSA 3L2WA 1R0BG 2E70A 3RMQA 3N5BB 1RAIB 3CCQT 1VYTA 2LJ3A 1VA7A 1WLPB 5HK3A 2OTLQ 2D6FA 3CCMT 1V1CA 4J8OA 1M9SA 3LWHA 4A4FA 3L2RA 1W2BS 3DLLA 1T3LA 3OSVA 4ESRA 2BE9B 1IGQA 2NUPA 1N8RU 3CMAT 2KRMA 1MV0B 3CXCS 3VV0A 1KHCA 1WDXA 1N8RR 4M78B 5FROA 4AT1B 2OTJT 3I35A 2LX7A 1YITA 3LWIA 4KRTA 1RAFB 1VQ9Q 2DE0X 4F7UB 5DLOA 1VQNA 2DD5A 2XMFA 3HFOA 2VV5A 4A4EA 1M3CA 2LT1A 1OYXA 2FB7A 1RL2A 3L2VA 2K5LA 4J7FA 3GNFB 1EX4A 1UGQB 3V8LA 2X4JA 1X43A 1AHJB 4Q5WA 1MMGA 3T9NA 2D1XA 4HXJA 4II1A 2ZPFB 1U06A 1OX8A 2GGRA 2GCXA 4DOVA 2FYKA 4JZ4A 1WHMA 2L3PA 4M7AA 5GMKh 4C8QB 4RTXA 1D1AA 1BK2A 4M7DE 5D6YA 5CKDA 3CCEQ 2RK1A 2BZYA 2O9SA 2YHTA 3GBQA 3A8LB 4X34A 1YP5A 1VQ6T 2JW4A 5D7UA 4N0AA 2MK5A 2M9UA 4M7AC 2KI7A 4QKUA 1VQOA 1VQ8T 2ZPBB 1VQKQ 2CZ7B 2BZXA 2LZ6B 2O4XB 1A0NB 1G3TA 3CMAA 1G83A 2EYWA 4NOYA 3QZ9B 5KYXA 3G4ST 1KSWA 3SWNA 1VQPQ 3NGPA 3CCUA 3J81E 3MP6A 1EZZB 1GBQA 4RCCA 2FVUA 4PJOA 1UGSB 2HDAA 3CCRQ 2JN0A 5A0GA 2DL3A 2LCSA 1QWFA 2PTKA 2JOYA 4E7ZA 2BIVA 1Y7XA 1RAHB 1W70A 2HNIA 2HKNA 2E3IA 2KBTA 2DILA 2OTLT 5LJ3h 3HKSA 1YJNQ 1XNIA 3SWNC 4HCZA 1PC0A 3MEUA 3A98A 2L8DA 4PJOC 5GANh 2H3JA 2EWNA 4C92E 2DYIA 3FEOA 2RHUA 1KG1A 2VVKA 1WXBA 2QI2A 2DRKA 3QO3A 4JJCA 3OYIA 3O8VA 2YRDA 1TSFA 2LMJA 3L2UA 4MZTA 1YNZA 1G5VA 3OS2A 3CBOA 1GCQA 3FIFA 1YIJQ 3RUXA 2D0QB 1VQ9T 7AT1B 3LX7A 4KBMB 1ZA2B 1OV3A 5EC7A 2LNHB 2RQRA 2EJGA 1GBRA 3VKIA 2LX9A 3QWYA 2BKDN 1NE8A 5KCHA 2CZ0B 4O6JA 3INZA 1F1BB 1CKAA 1GCQC 1MMDA 2CP2A 3RKYA 2YSQA 2PVOB 1DJ7B 4M75E 4HKEA 5GMKl 2KGTA 4C8QD 3JSCA 5KYYA 1IHWA 1M5Q1 1SF9A 2XKOC 2CZ6B 3TVTA 1D1BA 1VQ4Q 3SD4A 2FZCB 1KQSS 2K79A 3RKXA 3CCET 5IHNA 1GCPA 2KXCA 1SEMA 1D1CA 4BI8B 3AT1B 3OYNA 1IGUA 2FHDA 2EGCA 3EFOA 1ZA1B 2EYXA 5GAMg 2M51A 4OMMA 4DBRA 1O75A 3OYGA 1EIFA 2COZA 2V8IA 2H8HA 2XICA 4M77G 3CCJQ 2CUBA 2R58A 4PFPA 3R6OA 1H8KA 3JCMe 2A0FB 3CCRT 1D3BB 1AWWA 2EBPA 2RHIA 1PG5B 5CCAA 1B34A 3EH1A 2NUTB 2DD4A 3OBWA 3CC2Q 3MCAB 4HCBA 1MV3A 1VQ9A 1NEGA 2EQIA 2RQUA 1KJWA 4CC2A 3FJPA 1SHGA 3X26B 1YJNT 4QVZA 2WSEE 1QVFS 3OS1A 4RKUE 4L6V5 2KROA 5LJ5e 1OEBA 1Z9ZA 5HY6A 4UC4A 2KSSA 4PL6A 5IXFA 3V7CA 1VQMA 4C5GA 4ATOA 2YUQA 3CBPA 3EFRA 4DQ2A 2JZ2A 3JAME 1WHGA 1E6HA 3REAB 3ZFJA 2O01E 3QSUA 1Y0MA 5CO7A 4JS5A 2YRCA 2AKLA 1JJ2P 3HRTA 3RERA 1M3AA 1UJ0A 4PJNA 1VYUA 2LCCA 3LYIA 4FYVB 1Q82U 2MWOA 3QDRB 3ME9A 2EVRA 2X35A 3H0FA 2QEXQ 2ZAEA 3A8OB 4FIBA 3EFSA 1Q82R 4DEXA 2I0NA 4HCKA 1K76A 4OB3B 3CCSQ 1LCKA 2L3QA 2DVEA 4E47A 4OMNA 2ED1A 2CH4A 1VQKA 3LH5A 4HVUA 4Y28E 2CP7A 4ELYC 4JLIA 4ZTJA 3JB9G 3OW2S 2EGAA 1VQPA 8ATCB 1WQWA 4KT0E 3JB9H 2HSEB 4RG8A 5CIUA 1KQ2A 2GQVA 3MP8A 1RAEB 2RF0A 1GFCA 4LNPA 1VQ4T 3CXCP 2K3YA 1K9AA 4LD6A 3ULRB 2EKOA 3FLGA 4JPBW 2LDMA 3I55Q 3M58A 5A0DA 5GAMj 2DEUA 3E9FA 1IZ6A 3EG2A 1BI1A 4JS4A 3CCQQ 3E1SA 2ZPEB 4BY6B 2CDTA 3HP9A 3MJXA 5GAOp 1QVGP 3OMCA 1I8FA 3VS7A 2RHZA 4M77F 2W10A 3ER0A 1KQ1A 2QG9B 3M57A 2EFIA 3E2UA 2DXCA 3QYHB 3CCJT 3META 2F69A 3VRZA 3RBBB 1H3ZA 3EGDB 4M4ZA 2QQBA 2RHYA 5CVIA 1U3OA 3A8HB 1N6AA 4ANJA 2DXBA 2K5IA 3CC2T 2FZGB 1YIJA 5GAN3 2GFUA 3ZEHA 1X69A 2RJEA 2R5MA 4QVDA 4M7DG 4A54A 5GAN2 1D09B 4ZN3A 3QUIA 1WHHA 1JEGA 2V1RA 2VASA 1N9SA 2AHJB 4J7IA 1HK9A 1YJ9A 4C0DB 3U23A 4BACA 5GAOq 2P4TA 1YJWA 2SRCA 1Y96B 2X4XA 3NTHA 3RKWA 4X9DA 2XDBA 3REBB 1RLPC 4PJLA 1M90U 2EJFA 3I5SA 1BI2A 4ME7A 1QP2A 1Q86U 2ZZDA 4OMLA 5I22A 4M77E 3TSZA 4RTVA 1M90R 4MZPA 5FU7B 3HL8A 1Q86R 1PRMC 3CD6T 2RQWA 3FB9A 2QDYB 1NJIC 1P92A 3BE3A 4ZGEB 2QQAA 2QEXT 3E19A 1M8VA 3OY9A 1QW1A 1FMWA 3CCST 3OQ5A 2BTTA 2P84A 2KVQG 5DY9A 3NFCA 3CQTA 1AD5A 5I21A 2QQ9A 4M78A 3QZ5B 4NL3A 2LRQA 3JB9F 4C92G 2QTXA 2E5KA 1YWPA 5FLXE 2KMTA 2YT6A 1NM7A 3L1AA 3UA6A 1SHFA 4J5YA 2DJQA 2ZCFB 1NG2A 3DLMA 4F7UA 3LW5E 1M1KU 1BU1A 1WQ7A 2LT4A 2NLUA 2CH4W 4D8DA 1G3YA 4M78C 3QDFA 1Q7YU 1WHKA 4QQGA 1H3HA 1RAGB 5CR2A 3I55T 1M1KR 2XD0A 1K9MR 1VQ5A 1UB4A 3RESA 1CKBA 3H0IA 1Q7YR 1EFNA 5IN1A 1VOMA 2AK5A 4M77B 2FL7A 1UHFA 4L59A 5I2SA 1KFZA 1NPRA 1LJOA 4PLIA 5GAN8 4C8QA 3G6EQ 1HD3A 1ZSGA 2CSQA 3PE0A 2QQSA 4E7KA 4HCCA 1ZBJA 3RIRA 4M75G 2E1HA 3EG1A 3QHSA 4FW1A 4TVRA 5GAMh 4BDZA 3PFSA 4IIOA 5J26A 2LJ0A 3BY7A 3M55A 5DLQE 1AWJA 4Z02A 3OYKA 5KYWB 2A28A 4M7DF 4ZGJB 1Q82C 4C8QC 2ESWA 4RTYA 2KY9A 2O4XA 2PQWA 1T0JA 1C1AA 3OMGA 2QA4A 1VQLA 1PM3A 2J6OA 1N5ZA 1KK7A 1PD1A 1KQSP 1WJQA 4BB7A 4E7SA 2KRNA 4J9BA 1NLPC 3EH2A 1RACB 2HCKA 1BKBA 1WHJA 2ABLA 3SDZA 2EQKA 2PUKB 3CC7T 4C5HA 5LJ3d 2RQTA 3C94A 5IT9E 1QVGA 3ZL7C 4RTTA 1UHCA 3EHRA 1KHIA 5GMKm 3PMTA 5GANd 1SSFA 2M1HA 4RCBA 4E7HA 2RPNA 1ZUYA 1ACMB 4M7DA 4D8KA 4OMFB 2D8JA 4F04B 2MYSA 3PIPA 2EYZA 3IQLA 1KC8U 1PSEA 2BE7D 1PCXA 2CUDA 3M0TA 3CCQA 3GF5A 2DRMA 2X4YA 5IXBA 2DMOA 1TXQA 2AZSA 4C92F 2JUFA 4J9HA 1MGQA 1YN8A 3LLRA 2DTHA 3CCMA 1QVFP 2J6KA 1KC8R 5GJWB 2COYA 2Y90A 2VXFA 4IKFA 2KT1A 4OMPA 4KUDK 3EGUA 1NYFA 4HT9A 1CSKA 1IO6A 3VS0A 4MMLA 4KULA 4M7AE 2B8AA 1OI1A 4E7LA 2HQEA 3JV3A 2E4HA 2CS7A 3VU3C 2XG8D 4LXCA 2F1LA 5LJ3f 2RI2A 2MAMA 2RJDA 1TS9A 3RMSA 4N0AC 3CCVT 2OTJA 4LD9K 3VRYA 3QJ6A 5GANf 2CP5A 3A1PA 2HSPA 5FW9A 5L8RE 1YCYA 3OYYA 3TCJA 3M54A 2ECZA 1QKWA 4BI4A 3PGGA 1QQJA 4XTZA 3CPWA 2RMOA 1I5OB 1ZBXA 4M75F 3G6ET 3JB9I 2F2VA 1JB0E 1M90C 4PJOE 1R8OB 1Q86C 4M7DB 4LDXA 4M78D 1HSQA 3CC4T 3EG9A 2HZYA 3UWNA 5D6WA 3OS5A 2X4WA 4FCYA 2XU8A 5HK0A 4EPCA 5FU6B 5KH6A 4Z88A 1G3WA 4JLGA 1H92A 3VS1A 2K57A 4Z8AA 1XOVA 2KYBA 3S3MA 4IUTA 1YHQQ 1YBYA 1VQ7Q 3M0UA 1SG5A 2M02A 3A5ZB 1AZGB 3KXTA 3I56Q 4QQ6A 1Q81C 2XK0A 2YUPA 5C0MA 1D3BA 3MO8A 3V8KA 2ENMA 1VQ6A 4N4GA 3LH0A 2NUTA 4FYXB 1AEYA 1T0HA 2XDPA 2DXTA 4KUIA 1VQ8A 4A4KA 3QWXX 4IUUA 4JUVA 2EYQA 2LQWA 3OYAA 1XTDA 2FO0A 3S6WA 3PTAA 1QCFA 1M1KC 4LDUA 2DKGA 2RA2A 3MPUB 3G4SA 2E12A 3NHNA 4BE2A 3EGXB 4XU1A 1Q7YC 1PRLC 1VIFA 2JTFA 4C92B 2JMAA 2GQIA 4PJMA 2B86A 1ZHIA 2ZPIB 1FWZA 3VUZA 3C95A 3SFMA 4MDXA 4XTVA 4FSSA 3JCMg 2DX1A 2RB6A 2OTLA 3EG9B 4CC4B 2DK3A 2GF7A 4JJDA 3PMIA 1S72Q 1W6XA 4RTZA 2LVMA 4RG2A 4MDWA 4C0FA 1ZQ1A 5DM7R 4XK8E 1JQQA 5LJ5g 5ECAA 4OVAA 2AZVA 1N8RC 3MHXA 1LNXA 2MCNA 3OYJA 2QGGA 4GY5A 1WXTA 2EGEA 2QQRA 2A37A 2MOXA 4XTWA 2FZKB 1FMVA 5CKHA 2K3BA 4RTWA 5A0LA 2X9HA 3GPLA 2RJFA 1TUDA 4XTXA 2IVWA 3M59A 2GTOA 2O2OA 5KCOA 1QCOA 4OP0A 1ZUKA 4M75B 2PU9B 2DZCA 1VIEA 3NPFA 2A7YA 1PKSA 4LUEA 4IIMA 4JZ3A 1R77A 1B07A 3VS4A 9ATCB 4M7DD 4R56A 1BCMA 5J3BA 2QGFB 4J9CA 4Y92A 2KNBB 4P5NA 2MPXC 2KEAA 3H8ZA 3EAEA 1WI7A 2LP5A 4OMOA 5GAOm 4YTLA 1RLQC 4QVCA 4FSXA 1X2QA 4KGVB 2CT3A 4F16A 3VYGA 1BIAA 4J6WA 3WVEB 2RJCA 1OZ3A 3SB2A 2E6ZA 2YLCA 3JCMb 3HRUA 1OZ2A 1JU5C 2C0IA 3CD6Q 1YHQT 1FYNA 1VQ7T 3VYHB 1KC8C 4MZMA 3CCEA 4E2FB 4AG2C 2EJ9A 3I56T 3JCMW 2NUZA 4BY6C 3EGDA 4FU6A 1X6OA 1G8XA 4F14A 1UDLA 2Z0WA 3D7SB 1ABOA 1I07A 3ASKA 3G1JA 5CKBA 4E7IA 2EAYA 3QYGB 2M16A 3HTRA 2C06A 4C92D 2K9GA 1YITQ 2DPPB 1FX7A 3M9QA 1IRXA 3EG3A 4HA8A 2K7AA 3BDUA 1W2BP 3QG1A 5IAYA 1ABQA 5I2MA 2JJ9A 3BW1A 2V1QA 2D0NA 1ZLMA 2PVDB 1C0MA 5IHKA 1K0XA 1M1FA 1Y96A 3CCRA 3UA7A 5CAIA 4E6RA 1RAAB 3UF4A 2A3LA 2E6NA 5LJ5j 1UJYA 2CT4A 5CKFA 4LDVA 4AG1C 2CP3A 1W1FA 5GMKe 1YJNA 1YI2Q 2M0OA 2YXYA 3CBMA 1OPKA 5FWBA 2J6FA 4C0DC 2QXFA 2CZ1B 4X9CA 2QDLA 1S72T 1MUZA 2LC4A 1ZSZB 2ZPGB 2RD1A 3X25B 3FRNA 5KYNA 1TU0B 8AT1B 1WPYA 4J6XA 1N27A 2AKKA 2W0ZA 4MMKA 2MI6A 1WNLA 2RNAA 4J9FA 4BD3A 2NYSA 3QIIA 3VS6A 3OYBA 1X01A 4M75D 1TUGB 4PJJA 5GANg 3URGA 2HKQB 3OB9A 2KE9A 2DNUA 2DEQA 4LE9A 3F70A 1SKUB 2RO0A 2RI3A 3FC3A 4EMKB 3H9NA 3CCLQ 1VQOQ 2L89A 1UG1A 4QQDA 4IUVA 2VB6A 5LJ3e 4HVVA 5GAOl 3CCUQ 3NTIA 1T3SA 5GANe 2K5FA 3G71Q 4OB0B 4OMQA 4M7AG 3THKA 5CK9A 4QW2A 4M77A 4NL2A 2HD0A 2QAZA 2GBQA 3OYMA 3CC7Q 2Y4XA 2V26A 3NTKA 3I5RA 2FEIA 5GJVB 1LOJA 2E3HA 2YLBA 2CSIA 5GMKj 1PD0A 1VQ4A 2P4RA 2DBKA 1E7OA 1NYGA 4M77C 3S3NA 5GAMd 5AT1B 2MMPA 1M2OA 1S72A 5IHIA 1JXMA 3M0PA 2HBWA 4D6WA 1UUEA 5KYWA 2JXBA 1UEBA 3PT9A 2JTEA 3P8DA 1I0CA 4PJOG 2E41A 2DETA 2HL5C 4XAXB 1YITT 2YUNA 2JS2A 4CC3A 2O88A 3OSSC 3CCJA 2XI9A 1N9RA 3LGLA 4BE0A 1K9MU 4IURA 3V7RA 3M56A 1OX9A 3CC2A 1D0ZA 4M78E 2H3EB 3CCVQ 3UPUA 4FM4B 1HYOA 1YI2T 5LJ3j 1WZOA 2QTVA 2VKNA 1PKTA 2ATCB 2K2VA 3CEYA 4XU0A 3H6ZA 2QK0A 2LCLA 1JJ2A 1BB9A 3HPWA 2EIFA 3JCMh 2ZPHB 1Y07A 5GAMf 5GANj 2I2LA 2R57A 4WCIA 2KK4A 3L2QA 1BI3A 3KFVA 1BYMA 5KYUA 4Y91A 1WIEA 2CP6A 4A4GA 2O9VA 3MEWA 2L3SA 5LJ5h 3R6NA 4KGZB 3RDVA 3SEMA 2CP0A 5I11A 3CC4Q 2AT1B 4EIKA 2HL3A 3DB4A 4E7JA 2P0PA 3CD6A 4GBQA 5GAN5 2FPEA 3HFNA 2RK2A 1ARKA 2V8KA 3CCLT 1VQOT 2QEXA 2ED0A 2AIRB 4C8QE 1W2BA 5GMKi 4O5VA 4C5IA 3CCSA 1M2VB 4PK4A 3TQ7P 2CREA 2MF2A 3CCUT 1TH7A 1TOVA 3CXCA 2QASA 1G3SA 2FPDA 4M7AF 2RN8A 1V76A 4ZTFA 3G71T 4RUGA 4JRPA 4XQ3A 3VS3A 1I5LA 1V29B 2FRYA 1QVGS 1I1JA 2L5QA 3QBYA 2JM9A 3VS2A 1SRMA 2DAQA 2NWMA 3LGFA 4A63B 2WSFE 3I55A 1VQMQ 3VS5A 2PNIA 3EG0A 4JDSA 3JCMJ 4J6YA 2OAUA 1YI2A 4EDUA 1WJSA 3PVLA 4CRIA 4PKCC 5KYUB 4JRKA 1MNEA 2RHXA 2DIQA 4R55A 2GNCA 3V7SA 4CI0C 3FDRA 3VUBA 4PJOF 1GFDA 1O9SA 2HBPA 6AT1B 2DERA 4XTUA 1RABB 4HT8A 1M1GA 4M7DC 2EQMA 4DBQA 1JO8A 4PFOA 3UT1A 1I81A 1QLYA 1QWEA 3C12A 2DLPA 1ZUUA 2MWPA 1JXOA 2NUPB 3BFMA 3C4SA 5FU6C 3WVDB 2E65A 5GAOr 4M77D 1AVZC 3KBGA 3P8BB 4N4HA 3HRSA 2XHCA 4RTUA 3CCLA 1MMNA 5HKCA 3AHUA 1K4US 2QYZA 2GTJA 2MIOA 1WYXA 3CPFA 3TSWA 4ZN1A 2CKKA 1PWTA 3CPWS 2ZGWA 3EGXA 1K73U 1KD1U 1UTIA 3JCMV 1UGPB 5CQYA 1NPPA 2HQXA 4C92A 1PHTA 5GAN6 2E5QA 4JRQA 3G71A 2F2XA 4ZNXA 1K73R 2DJZA 1RADB 2KRSA 4VUBA 1KD1R 1GL5A 2OAWA 2O31A 2ROLA 1AOJA 1WXUA 3CC7A 1VUBA 4N4IA 1C6VX 1OU8A 3O5ZA 4XU3A 1TTHB 1SSHA 3G7ZA 2VGMA 4PLLA 1IREB 3I9QA 1OQKA 2JT4A 3OW2P 4C92C 2WSCE 5GAN4 3Q1JA 3PNWC 4DBHA 4B9XA 2JTMA 1Q95G 4Z89A 1MMAA 1UECA 1BI0A 1QVPA 2JS0A 4M7AB 2EQUA 3CMEQ 2DVJA 1YCSB 4EMGA 1OU9A 1YFNA 2F5TX 2V8JA 3HHTB 1X2KA 1OOTA 5FRNA 2FG0A 2J06A 3GLXA 2DFUA 3DKMA 2OJ2A 4ZGDB 2E10A 2JVVA 1XJWB 4FT4A 2C0OA 3GIBA 1U1TA 4M75A 4FL6A 1GRIA 5A2QE 4DEYA 1JRIA 1K9MC 1TG0A 1NBEB 2C0TA 2L0AA 2EW3A 5KYXB 3JB9D 4ELZC 3OBYA 1LVKA 2YDLA 5AYFA 2DL4A 5HCKA 3J7AF 4A53A 2LJ1A 3SWNB 1YJ9Q 1U8RA 4WTOB 1VQMT 1AWOA 2HQHA 1YJWQ 3CCVA 4PJOB 3BDLA 4M75C 4FYYB 1X75C 3KUFA 2XIDA 1BBZA 2DL5A 3M0SA 3X24B 3M53A 1PSFA 5FWCA 3GNGA 1JBMA 1U5SA 2VGNA 1X27A 3MEAA 2DZ9A 3G6EA 4R0KA 4PFZA 4XTYA 2BUDA 2J05A 1I4K1 1NLOC 1NJIU 2EYYA 3L42A 3ZBDA 2DF6A 1QP3A 3P8HA 1D0YA 3CC4A 1KQSA 2DTIA 2DBMA 1NJIR 2VC8A 1XQHA 3RNJA 4GLKA 3H41A 2F5KA 5KE2A 1VQKT 1M30A 2G6FX 4IUQA 1PNJA 2DIGA 5L23A 1YWOA 2HMAA 2L3RA 1BCOA 3J80E 3OA6A 1UGVA 1VQPT 4LN2A 4KGXB 4LDWA 3X20B 3QPHA 3TEEA 5GAOn 3PVQA 3H0HA 4C0GA 3JCMc 4FYWB 1WJRA 5LL6S 1WHLA 1G2BA 1SRLA 2LTOA 1UFFA 1VQ5Q 4BI3A 1K8AU 3SHWA 1Z9QA 2X51A 1AT1B 4M7AD 2EKHA 2GFAA 2VUBA 5KYYB 5GAMe 1QVFA 4XU2A 1VYVA 1ZSZA 3MEVA 4C5EA 1K8AR 1RI9A 2K6DA 2EPDA 3UATA 3E9GA 2KXDA 3MKDA 4J9GA 4JJBA 2LNVA 4LUDA 4M78G 1R0CB 3CMET 1OPLA 4OF1A 2A36A 4OB2B 2IPOB 1ZSZC 4F7UG 2PUOB 1S1NA 5D6XA 3GOXA 4DBFA 2X3XD 2YRVA 4QT7A 2DXUA 3X28B 1RUWA 1UE9A 2VXEA 2X3WD 1YIJT 4EMKA 1FXXA 1IHVA 3EFOB 2G3RA 1Y57A 1B3QA 3QJYA 2L2PA 2ROTA 4C0ZA 4PJOD 2IIMA 4AMCA 3OYLA 1NEBA 2QA4Q 4B6MA 1VQLQ 4OGEA 3C0CA 1WA7A 1M27C 1WFWA 3M0RA 4WF2A 1YJ9T 3M5AA 1BIBA 4L5GA 5C6SA 1QCNA 2EQJA 4J9EA 1YJWT 1VQNQ 1OULA 1B7TA 4GLMA 4EMKC 2P0QA 1B34B 2JM8A 4FW2A 1E6GA 1HXDA 4C8QG 4NS5A 2RM4A 3TU4K 1H641 4IUPA 3OYHA 5FRMA 1J3TA 3FJ5A 1K73C 2LQ8A 4J83A 1KD1C 3OW2A
chains in the Genus database with same CATH topology
3G1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1J A; 
#chains in the Genus database with same CATH topology
 1TWB A;  3A8M B;  1M4Z A;  2VYT A;  5CKE A;  2IG0 A;  1NZ9 A;  2COW A;  4X1V A;  2K3X A;  4CC7 A;  2FPF A;  2RH2 A;  1D0X A;  3TRE A;  2DO3 A;  5LJ3 g;  1MHN A;  2DM1 A;  4BDY A;  2Y4Y A;  4B9W A;  2KT8 A;  2YWW A;  2M0Y A;  1IXD A;  5FU7 C;  2DL8 A;  4DA4 A;  2WAC A;  3CCM Q;  4AFU C;  5EG2 A;  1QKX A;  2OX7 A;  3CME A;  1YHQ A;  3M4Y A;  3OYC A;  3RR6 A;  1Y71 A;  2JNG A;  1VQ7 A;  2RI5 A;  2F2W A;  3JRZ A;  2LQK A;  3MP1 A;  4J9D A;  3I56 A;  2XDD A;  3OYF A;  2BZ8 A;  3M4G A;  3CMA Q;  2P0K A;  2D9T A;  3JCM X;  1AZE A;  1ZX6 A;  4DOW A;  2KQW A;  2R5A A;  2K4Y A;  4AFS C;  4J9I A;  1M8M A;  4BUG A;  2DA9 A;  5IH2 A;  1VQ5 T;  2OTJ Q;  4ORZ A;  1U1S A;  2J7I A;  5KE3 A;  2KR3 A;  2DL7 A;  3WXM B;  4FT2 A;  1MND A;  3OYE A;  1W4S A;  2KAF A;  4M78 F;  3JCM d;  2HAX A;  3JB9 J;  1M3B A;  4KH0 B;  3UDC A;  2DYB A;  1GXI E;  5J39 A;  2CGH A;  4OGC A;  5GAN 7;  1QMC A;  3QKJ A;  3L2Z A;  1FMK A;  2PZ1 A;  4RMO A;  4F7U F;  1KIK A;  4V2S A;  5LJ5 d;  1TUC A;  1WX6 A;  1WGS A;  4F17 A;  3OYD A;  4A4H A;  2SEM A;  4OB1 B;  1K0S A;  3JCM Q;  2DTO A;  3CPW P;  2E64 A;  2K2M A;  3V8J A;  2RQV A;  4JRI A;  1AWX A;  3HSB A;  2A08 A;  3M0Q A;  4HVW A;  2QA4 T;  1VQL T;  3EHQ A;  2LQN A;  1M2V A;  4KH1 B;  1SPK A;  3A8G B;  3OS0 A;  3NMZ C;  1X6G A;  1HJD A;  4PNO A;  2CYZ B;  1VQN T;  1Q81 U;  3JCM P;  4C8Q F;  3JCM f;  1K1Z A;  4EMH A;  3QXE B;  2OI3 A;  1VQ6 Q;  4LDY A;  3GP8 A;  2FRW A;  4BE1 A;  4AFQ C;  5M9O A;  1Q81 R;  2VWF A;  1VQ8 Q;  1JJ2 S;  2KYM A;  2YUO A;  4K11 A;  1LPL A;  2JMC A;  3PIO A;  4AFZ C;  5LJ5 f;  1RI0 A;  3G4S Q;  4F7U E;  1X6B A;  2HEQ A;  5CQX A;  1IB8 A;  4JJN K;  3S3O A;  2PVG B;  2D8H A;  1K8A C;  1UGR B;  3VJP A;  3DB3 A;  2KDS A;  3L2W A;  1R0B G;  2E70 A;  3RMQ A;  3N5B B;  1RAI B;  3CCQ T;  1VYT A;  2LJ3 A;  1VA7 A;  1WLP B;  5HK3 A;  2OTL Q;  2D6F A;  3CCM T;  1V1C A;  4J8O A;  1M9S A;  3LWH A;  4A4F A;  3L2R A;  1W2B S;  3DLL A;  1T3L A;  3OSV A;  4ESR A;  2BE9 B;  1IGQ A;  2NUP A;  1N8R U;  3CMA T;  2KRM A;  1MV0 B;  3CXC S;  3VV0 A;  1KHC A;  1WDX A;  1N8R R;  4M78 B;  5FRO A;  4AT1 B;  2OTJ T;  3I35 A;  2LX7 A;  1YIT A;  3LWI A;  4KRT A;  1RAF B;  1VQ9 Q;  2DE0 X;  4F7U B;  5DLO A;  1VQN A;  2DD5 A;  2XMF A;  3HFO A;  2VV5 A;  4A4E A;  1M3C A;  2LT1 A;  1OYX A;  2FB7 A;  1RL2 A;  3L2V A;  2K5L A;  4J7F A;  3GNF B;  1EX4 A;  1UGQ B;  3V8L A;  2X4J A;  1X43 A;  1AHJ B;  4Q5W A;  1MMG A;  3T9N A;  2D1X A;  4HXJ A;  4II1 A;  2ZPF B;  1U06 A;  1OX8 A;  2GGR A;  2GCX A;  4DOV A;  2FYK A;  4JZ4 A;  1WHM A;  2L3P A;  4M7A A;  5GMK h;  4C8Q B;  4RTX A;  1D1A A;  1BK2 A;  4M7D E;  5D6Y A;  5CKD A;  3CCE Q;  2RK1 A;  2BZY A;  2O9S A;  2YHT A;  3GBQ A;  3A8L B;  4X34 A;  1YP5 A;  1VQ6 T;  2JW4 A;  5D7U A;  4N0A A;  2MK5 A;  2M9U A;  4M7A C;  2KI7 A;  4QKU A;  1VQO A;  1VQ8 T;  2ZPB B;  1VQK Q;  2CZ7 B;  2BZX A;  2LZ6 B;  2O4X B;  1A0N B;  1G3T A;  3CMA A;  1G83 A;  2EYW A;  4NOY A;  3QZ9 B;  5KYX A;  3G4S T;  1KSW A;  3SWN A;  1VQP Q;  3NGP A;  3CCU A;  3J81 E;  3MP6 A;  1EZZ B;  1GBQ A;  4RCC A;  2FVU A;  4PJO A;  1UGS B;  2HDA A;  3CCR Q;  2JN0 A;  5A0G A;  2DL3 A;  2LCS A;  1QWF A;  2PTK A;  2JOY A;  4E7Z A;  2BIV A;  1Y7X A;  1RAH B;  1W70 A;  2HNI A;  2HKN A;  2E3I A;  2KBT A;  2DIL A;  2OTL T;  5LJ3 h;  3HKS A;  1YJN Q;  1XNI A;  3SWN C;  4HCZ A;  1PC0 A;  3MEU A;  3A98 A;  2L8D A;  4PJO C;  5GAN h;  2H3J A;  2EWN A;  4C92 E;  2DYI A;  3FEO A;  2RHU A;  1KG1 A;  2VVK A;  1WXB A;  2QI2 A;  2DRK A;  3QO3 A;  4JJC A;  3OYI A;  3O8V A;  2YRD A;  1TSF A;  2LMJ A;  3L2U A;  4MZT A;  1YNZ A;  1G5V A;  3OS2 A;  3CBO A;  1GCQ A;  3FIF A;  1YIJ Q;  3RUX A;  2D0Q B;  1VQ9 T;  7AT1 B;  3LX7 A;  4KBM B;  1ZA2 B;  1OV3 A;  5EC7 A;  2LNH B;  2RQR A;  2EJG A;  1GBR A;  3VKI A;  2LX9 A;  3QWY A;  2BKD N;  1NE8 A;  5KCH A;  2CZ0 B;  4O6J A;  3INZ A;  1F1B B;  1CKA A;  1GCQ C;  1MMD A;  2CP2 A;  3RKY A;  2YSQ A;  2PVO B;  1DJ7 B;  4M75 E;  4HKE A;  5GMK l;  2KGT A;  4C8Q D;  3JSC A;  5KYY A;  1IHW A;  1M5Q 1;  1SF9 A;  2XKO C;  2CZ6 B;  3TVT A;  1D1B A;  1VQ4 Q;  3SD4 A;  2FZC B;  1KQS S;  2K79 A;  3RKX A;  3CCE T;  5IHN A;  1GCP A;  2KXC A;  1SEM A;  1D1C A;  4BI8 B;  3AT1 B;  3OYN A;  1IGU A;  2FHD A;  2EGC A;  3EFO A;  1ZA1 B;  2EYX A;  5GAM g;  2M51 A;  4OMM A;  4DBR A;  1O75 A;  3OYG A;  1EIF A;  2COZ A;  2V8I A;  2H8H A;  2XIC A;  4M77 G;  3CCJ Q;  2CUB A;  2R58 A;  4PFP A;  3R6O A;  1H8K A;  3JCM e;  2A0F B;  3CCR T;  1D3B B;  1AWW A;  2EBP A;  2RHI A;  1PG5 B;  5CCA A;  1B34 A;  3EH1 A;  2NUT B;  2DD4 A;  3OBW A;  3CC2 Q;  3MCA B;  4HCB A;  1MV3 A;  1VQ9 A;  1NEG A;  2EQI A;  2RQU A;  1KJW A;  4CC2 A;  3FJP A;  1SHG A;  3X26 B;  1YJN T;  4QVZ A;  2WSE E;  1QVF S;  3OS1 A;  4RKU E;  4L6V 5;  2KRO A;  5LJ5 e;  1OEB A;  1Z9Z A;  5HY6 A;  4UC4 A;  2KSS A;  4PL6 A;  5IXF A;  3V7C A;  1VQM A;  4C5G A;  4ATO A;  2YUQ A;  3CBP A;  3EFR A;  4DQ2 A;  2JZ2 A;  3JAM E;  1WHG A;  1E6H A;  3REA B;  3ZFJ A;  2O01 E;  3QSU A;  1Y0M A;  5CO7 A;  4JS5 A;  2YRC A;  2AKL A;  1JJ2 P;  3HRT A;  3RER A;  1M3A A;  1UJ0 A;  4PJN A;  1VYU A;  2LCC A;  3LYI A;  4FYV B;  1Q82 U;  2MWO A;  3QDR B;  3ME9 A;  2EVR A;  2X35 A;  3H0F A;  2QEX Q;  2ZAE A;  3A8O B;  4FIB A;  3EFS A;  1Q82 R;  4DEX A;  2I0N A;  4HCK A;  1K76 A;  4OB3 B;  3CCS Q;  1LCK A;  2L3Q A;  2DVE A;  4E47 A;  4OMN A;  2ED1 A;  2CH4 A;  1VQK A;  3LH5 A;  4HVU A;  4Y28 E;  2CP7 A;  4ELY C;  4JLI A;  4ZTJ A;  3JB9 G;  3OW2 S;  2EGA A;  1VQP A;  8ATC B;  1WQW A;  4KT0 E;  3JB9 H;  2HSE B;  4RG8 A;  5CIU A;  1KQ2 A;  2GQV A;  3MP8 A;  1RAE B;  2RF0 A;  1GFC A;  4LNP A;  1VQ4 T;  3CXC P;  2K3Y A;  1K9A A;  4LD6 A;  3ULR B;  2EKO A;  3FLG A;  4JPB W;  2LDM A;  3I55 Q;  3M58 A;  5A0D A;  5GAM j;  2DEU A;  3E9F A;  1IZ6 A;  3EG2 A;  1BI1 A;  4JS4 A;  3CCQ Q;  3E1S A;  2ZPE B;  4BY6 B;  2CDT A;  3HP9 A;  3MJX A;  5GAO p;  1QVG P;  3OMC A;  1I8F A;  3VS7 A;  2RHZ A;  4M77 F;  2W10 A;  3ER0 A;  1KQ1 A;  2QG9 B;  3M57 A;  2EFI A;  3E2U A;  2DXC A;  3QYH B;  3CCJ T;  3MET A;  2F69 A;  3VRZ A;  3RBB B;  1H3Z A;  3EGD B;  4M4Z A;  2QQB A;  2RHY A;  5CVI A;  1U3O A;  3A8H B;  1N6A A;  4ANJ A;  2DXB A;  2K5I A;  3CC2 T;  2FZG B;  1YIJ A;  5GAN 3;  2GFU A;  3ZEH A;  1X69 A;  2RJE A;  2R5M A;  4QVD A;  4M7D G;  4A54 A;  5GAN 2;  1D09 B;  4ZN3 A;  3QUI A;  1WHH A;  1JEG A;  2V1R A;  2VAS A;  1N9S A;  2AHJ B;  4J7I A;  1HK9 A;  1YJ9 A;  4C0D B;  3U23 A;  4BAC A;  5GAO q;  2P4T A;  1YJW A;  2SRC A;  1Y96 B;  2X4X A;  3NTH A;  3RKW A;  4X9D A;  2XDB A;  3REB B;  1RLP C;  4PJL A;  1M90 U;  2EJF A;  3I5S A;  1BI2 A;  4ME7 A;  1QP2 A;  1Q86 U;  2ZZD A;  4OML A;  5I22 A;  4M77 E;  3TSZ A;  4RTV A;  1M90 R;  4MZP A;  5FU7 B;  3HL8 A;  1Q86 R;  1PRM C;  3CD6 T;  2RQW A;  3FB9 A;  2QDY B;  1NJI C;  1P92 A;  3BE3 A;  4ZGE B;  2QQA A;  2QEX T;  3E19 A;  1M8V A;  3OY9 A;  1QW1 A;  1FMW A;  3CCS T;  3OQ5 A;  2BTT A;  2P84 A;  2KVQ G;  5DY9 A;  3NFC A;  3CQT A;  1AD5 A;  5I21 A;  2QQ9 A;  4M78 A;  3QZ5 B;  4NL3 A;  2LRQ A;  3JB9 F;  4C92 G;  2QTX A;  2E5K A;  1YWP A;  5FLX E;  2KMT A;  2YT6 A;  1NM7 A;  3L1A A;  3UA6 A;  1SHF A;  4J5Y A;  2DJQ A;  2ZCF B;  1NG2 A;  3DLM A;  4F7U A;  3LW5 E;  1M1K U;  1BU1 A;  1WQ7 A;  2LT4 A;  2NLU A;  2CH4 W;  4D8D A;  1G3Y A;  4M78 C;  3QDF A;  1Q7Y U;  1WHK A;  4QQG A;  1H3H A;  1RAG B;  5CR2 A;  3I55 T;  1M1K R;  2XD0 A;  1K9M R;  1VQ5 A;  1UB4 A;  3RES A;  1CKB A;  3H0I A;  1Q7Y R;  1EFN A;  5IN1 A;  1VOM A;  2AK5 A;  4M77 B;  2FL7 A;  1UHF A;  4L59 A;  5I2S A;  1KFZ A;  1NPR A;  1LJO A;  4PLI A;  5GAN 8;  4C8Q A;  3G6E Q;  1HD3 A;  1ZSG A;  2CSQ A;  3PE0 A;  2QQS A;  4E7K A;  4HCC A;  1ZBJ A;  3RIR A;  4M75 G;  2E1H A;  3EG1 A;  3QHS A;  4FW1 A;  4TVR A;  5GAM h;  4BDZ A;  3PFS A;  4IIO A;  5J26 A;  2LJ0 A;  3BY7 A;  3M55 A;  5DLQ E;  1AWJ A;  4Z02 A;  3OYK A;  5KYW B;  2A28 A;  4M7D F;  4ZGJ B;  1Q82 C;  4C8Q C;  2ESW A;  4RTY A;  2KY9 A;  2O4X A;  2PQW A;  1T0J A;  1C1A A;  3OMG A;  2QA4 A;  1VQL A;  1PM3 A;  2J6O A;  1N5Z A;  1KK7 A;  1PD1 A;  1KQS P;  1WJQ A;  4BB7 A;  4E7S A;  2KRN A;  4J9B A;  1NLP C;  3EH2 A;  1RAC B;  2HCK A;  1BKB A;  1WHJ A;  2ABL A;  3SDZ A;  2EQK A;  2PUK B;  3CC7 T;  4C5H A;  5LJ3 d;  2RQT A;  3C94 A;  5IT9 E;  1QVG A;  3ZL7 C;  4RTT A;  1UHC A;  3EHR A;  1KHI A;  5GMK m;  3PMT A;  5GAN d;  1SSF A;  2M1H A;  4RCB A;  4E7H A;  2RPN A;  1ZUY A;  1ACM B;  4M7D A;  4D8K A;  4OMF B;  2D8J A;  4F04 B;  2MYS A;  3PIP A;  2EYZ A;  3IQL A;  1KC8 U;  1PSE A;  2BE7 D;  1PCX A;  2CUD A;  3M0T A;  3CCQ A;  3GF5 A;  2DRM A;  2X4Y A;  5IXB A;  2DMO A;  1TXQ A;  2AZS A;  4C92 F;  2JUF A;  4J9H A;  1MGQ A;  1YN8 A;  3LLR A;  2DTH A;  3CCM A;  1QVF P;  2J6K A;  1KC8 R;  5GJW B;  2COY A;  2Y90 A;  2VXF A;  4IKF A;  2KT1 A;  4OMP A;  4KUD K;  3EGU A;  1NYF A;  4HT9 A;  1CSK A;  1IO6 A;  3VS0 A;  4MML A;  4KUL A;  4M7A E;  2B8A A;  1OI1 A;  4E7L A;  2HQE A;  3JV3 A;  2E4H A;  2CS7 A;  3VU3 C;  2XG8 D;  4LXC A;  2F1L A;  5LJ3 f;  2RI2 A;  2MAM A;  2RJD A;  1TS9 A;  3RMS A;  4N0A C;  3CCV T;  2OTJ A;  4LD9 K;  3VRY A;  3QJ6 A;  5GAN f;  2CP5 A;  3A1P A;  2HSP A;  5FW9 A;  5L8R E;  1YCY A;  3OYY A;  3TCJ A;  3M54 A;  2ECZ A;  1QKW A;  4BI4 A;  3PGG A;  1QQJ A;  4XTZ A;  3CPW A;  2RMO A;  1I5O B;  1ZBX A;  4M75 F;  3G6E T;  3JB9 I;  2F2V A;  1JB0 E;  1M90 C;  4PJO E;  1R8O B;  1Q86 C;  4M7D B;  4LDX A;  4M78 D;  1HSQ A;  3CC4 T;  3EG9 A;  2HZY A;  3UWN A;  5D6W A;  3OS5 A;  2X4W A;  4FCY A;  2XU8 A;  5HK0 A;  4EPC A;  5FU6 B;  5KH6 A;  4Z88 A;  1G3W A;  4JLG A;  1H92 A;  3VS1 A;  2K57 A;  4Z8A A;  1XOV A;  2KYB A;  3S3M A;  4IUT A;  1YHQ Q;  1YBY A;  1VQ7 Q;  3M0U A;  1SG5 A;  2M02 A;  3A5Z B;  1AZG B;  3KXT A;  3I56 Q;  4QQ6 A;  1Q81 C;  2XK0 A;  2YUP A;  5C0M A;  1D3B A;  3MO8 A;  3V8K A;  2ENM A;  1VQ6 A;  4N4G A;  3LH0 A;  2NUT A;  4FYX B;  1AEY A;  1T0H A;  2XDP A;  2DXT A;  4KUI A;  1VQ8 A;  4A4K A;  3QWX X;  4IUU A;  4JUV A;  2EYQ A;  2LQW A;  3OYA A;  1XTD A;  2FO0 A;  3S6W A;  3PTA A;  1QCF A;  1M1K C;  4LDU A;  2DKG A;  2RA2 A;  3MPU B;  3G4S A;  2E12 A;  3NHN A;  4BE2 A;  3EGX B;  4XU1 A;  1Q7Y C;  1PRL C;  1VIF A;  2JTF A;  4C92 B;  2JMA A;  2GQI A;  4PJM A;  2B86 A;  1ZHI A;  2ZPI B;  1FWZ A;  3VUZ A;  3C95 A;  3SFM A;  4MDX A;  4XTV A;  4FSS A;  3JCM g;  2DX1 A;  2RB6 A;  2OTL A;  3EG9 B;  4CC4 B;  2DK3 A;  2GF7 A;  4JJD A;  3PMI A;  1S72 Q;  1W6X A;  4RTZ A;  2LVM A;  4RG2 A;  4MDW A;  4C0F A;  1ZQ1 A;  5DM7 R;  4XK8 E;  1JQQ A;  5LJ5 g;  5ECA A;  4OVA A;  2AZV A;  1N8R C;  3MHX A;  1LNX A;  2MCN A;  3OYJ A;  2QGG A;  4GY5 A;  1WXT A;  2EGE A;  2QQR A;  2A37 A;  2MOX A;  4XTW A;  2FZK B;  1FMV A;  5CKH A;  2K3B A;  4RTW A;  5A0L A;  2X9H A;  3GPL A;  2RJF A;  1TUD A;  4XTX A;  2IVW A;  3M59 A;  2GTO A;  2O2O A;  5KCO A;  1QCO A;  4OP0 A;  1ZUK A;  4M75 B;  2PU9 B;  2DZC A;  1VIE A;  3NPF A;  2A7Y A;  1PKS A;  4LUE A;  4IIM A;  4JZ3 A;  1R77 A;  1B07 A;  3VS4 A;  9ATC B;  4M7D D;  4R56 A;  1BCM A;  5J3B A;  2QGF B;  4J9C A;  4Y92 A;  2KNB B;  4P5N A;  2MPX C;  2KEA A;  3H8Z A;  3EAE A;  1WI7 A;  2LP5 A;  4OMO A;  5GAO m;  4YTL A;  1RLQ C;  4QVC A;  4FSX A;  1X2Q A;  4KGV B;  2CT3 A;  4F16 A;  3VYG A;  1BIA A;  4J6W A;  3WVE B;  2RJC A;  1OZ3 A;  3SB2 A;  2E6Z A;  2YLC A;  3JCM b;  3HRU A;  1OZ2 A;  1JU5 C;  2C0I A;  3CD6 Q;  1YHQ T;  1FYN A;  1VQ7 T;  3VYH B;  1KC8 C;  4MZM A;  3CCE A;  4E2F B;  4AG2 C;  2EJ9 A;  3I56 T;  3JCM W;  2NUZ A;  4BY6 C;  3EGD A;  4FU6 A;  1X6O A;  1G8X A;  4F14 A;  1UDL A;  2Z0W A;  3D7S B;  1ABO A;  1I07 A;  3ASK A;  3G1J A;  5CKB A;  4E7I A;  2EAY A;  3QYG B;  2M16 A;  3HTR A;  2C06 A;  4C92 D;  2K9G A;  1YIT Q;  2DPP B;  1FX7 A;  3M9Q A;  1IRX A;  3EG3 A;  4HA8 A;  2K7A A;  3BDU A;  1W2B P;  3QG1 A;  5IAY A;  1ABQ A;  5I2M A;  2JJ9 A;  3BW1 A;  2V1Q A;  2D0N A;  1ZLM A;  2PVD B;  1C0M A;  5IHK A;  1K0X A;  1M1F A;  1Y96 A;  3CCR A;  3UA7 A;  5CAI A;  4E6R A;  1RAA B;  3UF4 A;  2A3L A;  2E6N A;  5LJ5 j;  1UJY A;  2CT4 A;  5CKF A;  4LDV A;  4AG1 C;  2CP3 A;  1W1F A;  5GMK e;  1YJN A;  1YI2 Q;  2M0O A;  2YXY A;  3CBM A;  1OPK A;  5FWB A;  2J6F A;  4C0D C;  2QXF A;  2CZ1 B;  4X9C A;  2QDL A;  1S72 T;  1MUZ A;  2LC4 A;  1ZSZ B;  2ZPG B;  2RD1 A;  3X25 B;  3FRN A;  5KYN A;  1TU0 B;  8AT1 B;  1WPY A;  4J6X A;  1N27 A;  2AKK A;  2W0Z A;  4MMK A;  2MI6 A;  1WNL A;  2RNA A;  4J9F A;  4BD3 A;  2NYS A;  3QII A;  3VS6 A;  3OYB A;  1X01 A;  4M75 D;  1TUG B;  4PJJ A;  5GAN g;  3URG A;  2HKQ B;  3OB9 A;  2KE9 A;  2DNU A;  2DEQ A;  4LE9 A;  3F70 A;  1SKU B;  2RO0 A;  2RI3 A;  3FC3 A;  4EMK B;  3H9N A;  3CCL Q;  1VQO Q;  2L89 A;  1UG1 A;  4QQD A;  4IUV A;  2VB6 A;  5LJ3 e;  4HVV A;  5GAO l;  3CCU Q;  3NTI A;  1T3S A;  5GAN e;  2K5F A;  3G71 Q;  4OB0 B;  4OMQ A;  4M7A G;  3THK A;  5CK9 A;  4QW2 A;  4M77 A;  4NL2 A;  2HD0 A;  2QAZ A;  2GBQ A;  3OYM A;  3CC7 Q;  2Y4X A;  2V26 A;  3NTK A;  3I5R A;  2FEI A;  5GJV B;  1LOJ A;  2E3H A;  2YLB A;  2CSI A;  5GMK j;  1PD0 A;  1VQ4 A;  2P4R A;  2DBK A;  1E7O A;  1NYG A;  4M77 C;  3S3N A;  5GAM d;  5AT1 B;  2MMP A;  1M2O A;  1S72 A;  5IHI A;  1JXM A;  3M0P A;  2HBW A;  4D6W A;  1UUE A;  5KYW A;  2JXB A;  1UEB A;  3PT9 A;  2JTE A;  3P8D A;  1I0C A;  4PJO G;  2E41 A;  2DET A;  2HL5 C;  4XAX B;  1YIT T;  2YUN A;  2JS2 A;  4CC3 A;  2O88 A;  3OSS C;  3CCJ A;  2XI9 A;  1N9R A;  3LGL A;  4BE0 A;  1K9M U;  4IUR A;  3V7R A;  3M56 A;  1OX9 A;  3CC2 A;  1D0Z A;  4M78 E;  2H3E B;  3CCV Q;  3UPU A;  4FM4 B;  1HYO A;  1YI2 T;  5LJ3 j;  1WZO A;  2QTV A;  2VKN A;  1PKT A;  2ATC B;  2K2V A;  3CEY A;  4XU0 A;  3H6Z A;  2QK0 A;  2LCL A;  1JJ2 A;  1BB9 A;  3HPW A;  2EIF A;  3JCM h;  2ZPH B;  1Y07 A;  5GAM f;  5GAN j;  2I2L A;  2R57 A;  4WCI A;  2KK4 A;  3L2Q A;  1BI3 A;  3KFV A;  1BYM A;  5KYU A;  4Y91 A;  1WIE A;  2CP6 A;  4A4G A;  2O9V A;  3MEW A;  2L3S A;  5LJ5 h;  3R6N A;  4KGZ B;  3RDV A;  3SEM A;  2CP0 A;  5I11 A;  3CC4 Q;  2AT1 B;  4EIK A;  2HL3 A;  3DB4 A;  4E7J A;  2P0P A;  3CD6 A;  4GBQ A;  5GAN 5;  2FPE A;  3HFN A;  2RK2 A;  1ARK A;  2V8K A;  3CCL T;  1VQO T;  2QEX A;  2ED0 A;  2AIR B;  4C8Q E;  1W2B A;  5GMK i;  4O5V A;  4C5I A;  3CCS A;  1M2V B;  4PK4 A;  3TQ7 P;  2CRE A;  2MF2 A;  3CCU T;  1TH7 A;  1TOV A;  3CXC A;  2QAS A;  1G3S A;  2FPD A;  4M7A F;  2RN8 A;  1V76 A;  4ZTF A;  3G71 T;  4RUG A;  4JRP A;  4XQ3 A;  3VS3 A;  1I5L A;  1V29 B;  2FRY A;  1QVG S;  1I1J A;  2L5Q A;  3QBY A;  2JM9 A;  3VS2 A;  1SRM A;  2DAQ A;  2NWM A;  3LGF A;  4A63 B;  2WSF E;  3I55 A;  1VQM Q;  3VS5 A;  2PNI A;  3EG0 A;  4JDS A;  3JCM J;  4J6Y A;  2OAU A;  1YI2 A;  4EDU A;  1WJS A;  3PVL A;  4CRI A;  4PKC C;  5KYU B;  4JRK A;  1MNE A;  2RHX A;  2DIQ A;  4R55 A;  2GNC A;  3V7S A;  4CI0 C;  3FDR A;  3VUB A;  4PJO F;  1GFD A;  1O9S A;  2HBP A;  6AT1 B;  2DER A;  4XTU A;  1RAB B;  4HT8 A;  1M1G A;  4M7D C;  2EQM A;  4DBQ A;  1JO8 A;  4PFO A;  3UT1 A;  1I81 A;  1QLY A;  1QWE A;  3C12 A;  2DLP A;  1ZUU A;  2MWP A;  1JXO A;  2NUP B;  3BFM A;  3C4S A;  5FU6 C;  3WVD B;  2E65 A;  5GAO r;  4M77 D;  1AVZ C;  3KBG A;  3P8B B;  4N4H A;  3HRS A;  2XHC A;  4RTU A;  3CCL A;  1MMN A;  5HKC A;  3AHU A;  1K4U S;  2QYZ A;  2GTJ A;  2MIO A;  1WYX A;  3CPF A;  3TSW A;  4ZN1 A;  2CKK A;  1PWT A;  3CPW S;  2ZGW A;  3EGX A;  1K73 U;  1KD1 U;  1UTI A;  3JCM V;  1UGP B;  5CQY A;  1NPP A;  2HQX A;  4C92 A;  1PHT A;  5GAN 6;  2E5Q A;  4JRQ A;  3G71 A;  2F2X A;  4ZNX A;  1K73 R;  2DJZ A;  1RAD B;  2KRS A;  4VUB A;  1KD1 R;  1GL5 A;  2OAW A;  2O31 A;  2ROL A;  1AOJ A;  1WXU A;  3CC7 A;  1VUB A;  4N4I A;  1C6V X;  1OU8 A;  3O5Z A;  4XU3 A;  1TTH B;  1SSH A;  3G7Z A;  2VGM A;  4PLL A;  1IRE B;  3I9Q A;  1OQK A;  2JT4 A;  3OW2 P;  4C92 C;  2WSC E;  5GAN 4;  3Q1J A;  3PNW C;  4DBH A;  4B9X A;  2JTM A;  1Q95 G;  4Z89 A;  1MMA A;  1UEC A;  1BI0 A;  1QVP A;  2JS0 A;  4M7A B;  2EQU A;  3CME Q;  2DVJ A;  1YCS B;  4EMG A;  1OU9 A;  1YFN A;  2F5T X;  2V8J A;  3HHT B;  1X2K A;  1OOT A;  5FRN A;  2FG0 A;  2J06 A;  3GLX A;  2DFU A;  3DKM A;  2OJ2 A;  4ZGD B;  2E10 A;  2JVV A;  1XJW B;  4FT4 A;  2C0O A;  3GIB A;  1U1T A;  4M75 A;  4FL6 A;  1GRI A;  5A2Q E;  4DEY A;  1JRI A;  1K9M C;  1TG0 A;  1NBE B;  2C0T A;  2L0A A;  2EW3 A;  5KYX B;  3JB9 D;  4ELZ C;  3OBY A;  1LVK A;  2YDL A;  5AYF A;  2DL4 A;  5HCK A;  3J7A F;  4A53 A;  2LJ1 A;  3SWN B;  1YJ9 Q;  1U8R A;  4WTO B;  1VQM T;  1AWO A;  2HQH A;  1YJW Q;  3CCV A;  4PJO B;  3BDL A;  4M75 C;  4FYY B;  1X75 C;  3KUF A;  2XID A;  1BBZ A;  2DL5 A;  3M0S A;  3X24 B;  3M53 A;  1PSF A;  5FWC A;  3GNG A;  1JBM A;  1U5S A;  2VGN A;  1X27 A;  3MEA A;  2DZ9 A;  3G6E A;  4R0K A;  4PFZ A;  4XTY A;  2BUD A;  2J05 A;  1I4K 1;  1NLO C;  1NJI U;  2EYY A;  3L42 A;  3ZBD A;  2DF6 A;  1QP3 A;  3P8H A;  1D0Y A;  3CC4 A;  1KQS A;  2DTI A;  2DBM A;  1NJI R;  2VC8 A;  1XQH A;  3RNJ A;  4GLK A;  3H41 A;  2F5K A;  5KE2 A;  1VQK T;  1M30 A;  2G6F X;  4IUQ A;  1PNJ A;  2DIG A;  5L23 A;  1YWO A;  2HMA A;  2L3R A;  1BCO A;  3J80 E;  3OA6 A;  1UGV A;  1VQP T;  4LN2 A;  4KGX B;  4LDW A;  3X20 B;  3QPH A;  3TEE A;  5GAO n;  3PVQ A;  3H0H A;  4C0G A;  3JCM c;  4FYW B;  1WJR A;  5LL6 S;  1WHL A;  1G2B A;  1SRL A;  2LTO A;  1UFF A;  1VQ5 Q;  4BI3 A;  1K8A U;  3SHW A;  1Z9Q A;  2X51 A;  1AT1 B;  4M7A D;  2EKH A;  2GFA A;  2VUB A;  5KYY B;  5GAM e;  1QVF A;  4XU2 A;  1VYV A;  1ZSZ A;  3MEV A;  4C5E A;  1K8A R;  1RI9 A;  2K6D A;  2EPD A;  3UAT A;  3E9G A;  2KXD A;  3MKD A;  4J9G A;  4JJB A;  2LNV A;  4LUD A;  4M78 G;  1R0C B;  3CME T;  1OPL A;  4OF1 A;  2A36 A;  4OB2 B;  2IPO B;  1ZSZ C;  4F7U G;  2PUO B;  1S1N A;  5D6X A;  3GOX A;  4DBF A;  2X3X D;  2YRV A;  4QT7 A;  2DXU A;  3X28 B;  1RUW A;  1UE9 A;  2VXE A;  2X3W D;  1YIJ T;  4EMK A;  1FXX A;  1IHV A;  3EFO B;  2G3R A;  1Y57 A;  1B3Q A;  3QJY A;  2L2P A;  2ROT A;  4C0Z A;  4PJO D;  2IIM A;  4AMC A;  3OYL A;  1NEB A;  2QA4 Q;  4B6M A;  1VQL Q;  4OGE A;  3C0C A;  1WA7 A;  1M27 C;  1WFW A;  3M0R A;  4WF2 A;  1YJ9 T;  3M5A A;  1BIB A;  4L5G A;  5C6S A;  1QCN A;  2EQJ A;  4J9E A;  1YJW T;  1VQN Q;  1OUL A;  1B7T A;  4GLM A;  4EMK C;  2P0Q A;  1B34 B;  2JM8 A;  4FW2 A;  1E6G A;  1HXD A;  4C8Q G;  4NS5 A;  2RM4 A;  3TU4 K;  1H64 1;  4IUP A;  3OYH A;  5FRM A;  1J3T A;  3FJ5 A;  1K73 C;  2LQ8 A;  4J83 A;  1KD1 C;  3OW2 A; 
#chains in the Genus database with same CATH homology
 3G1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...