3G1JA

Structure from the mobile metagenome of vibrio cholerae. integron cassette protein vch_cass4.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
b'GVDRDYLQSEYGVLKAGQCYKVVRSFRDYRNINYERGDVMRFLGSNFVPYESGLSLFFDKNGSERQIMLCVRPEFQMEIAHHLDSYFCKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integron cassette protein
publication title Structure from the mobile metagenome of Vibrio cholerae. Integron cassette protein VCH_CASS4.
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 20
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12208 DUF3601 Domain of unknown function (DUF3601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.350 Mainly Beta Roll SH3 type barrels. mobile metagenome of vibrio cholerae. Integron cassette protein vch_cass4. 3g1jA00
3G1JA
chains in the Genus database with same CATH superfamily
1YHQQ 2HBWA 3SHWA 1KC8U 2O88A 4EMKA 4C92C 2EYYA 1D0YA 4PJOD 1EX4A 3M0RA 2PVGB 4ORZA 3QYGB 2ZPIB 3SDZA 4DOVA 1Q81U 4M7DB 1M8VA 2EGCA 2DXBA 3I55A 2VGMA 4BD3A 3CCUQ 2QDLA 2DXTA 4PLIA 1WPYA 3PE0A 5FU7B 2LJ3A 2L3SA 4FCYA 2NUPA 1VQPA 2JM8A 2XIDA 2FZKB 4PFOA 1UE9A 1Y07A 5FWCA 3EFOB 4RTWA 5GAMj 1EFNA 1M1KU 2KRSA 1OEBA 3E2UA 2ZPBB 3C0CA 2QI2A 2KI7A 1YJWA 1V1CA 5GAOn 1O9SA 2B86A 1WXBA 3O8VA 3UF4A 2EQMA 4QW2A 1X43A 4RTZA 1QVFA 2G3RA 2QG9B 2E70A 2G6FX 1M1GA 4IUTA 1YWOA 2K3YA 4J9FA 3H8ZA 1P92A 2RI5A 3NGPA 5GJWB 4JRQA 3I55Q 1KC8R 4QVCA 4WCIA 1IO6A 4RTYA 3WXMB 3VS0A 1Y7XA 2KMTA 4A54A 1V29B 4KRTA 4FYYB 2X9HA 2M02A 2NUTB 2L89A 1VQPQ 1XQHA 4M7DC 2HAXA 1VQNA 1GCQC 3OYDA 1M1FA 4J6WA 1K8AR 4JJCA 3L2ZA 3V8KA 5I2MA 5FU7C 5L23A 5GANj 2ZZDA 4AFUC 1UGSB 2A7YA 3JCMb 4N4GA 1YJWQ 4BDZA 3QJ6A 2MCNA 1M1KR 4LDUA 4MZMA 4MDXA 2QQSA 3VYGA 1XTDA 2AK5A 1IZ6A 1ZSGA 4ZTJA 1D0ZA 1OYXA 5GJVB 3G4SA 1QMCA 3MP8A 2K5IA 4FT4A 1PKSA 2L5QA 3M0PA 2LX9A 1VQ5T 4X9CA 2X4JA 2CSIA 3LH5A 4J7IA 1QWEA 2KR3A 3CPWS 1NYFA 3RMSA 5LJ3e 3CQTA 1K9MC 1E6GA 3PMIA 1D1CA 3TSWA 1N9RA 1NJIR 2YRVA 1X6OA 4EMGA 1N9SA 5CKHA 4A4KA 4NS5A 1VQNQ 1EIFA 3HHTB 3CD6A 1UTIA 4AG1C 3CCQT 2D0NA 3JSCA 2E64A 4J7FA 3RERA 1GBRA 2LCSA 2KRNA 3EGUA 3PNWC 2KK4A 3BFMA 1W4SA 2K79A 4HCKA 2EW3A 4ZGEB 2DXUA 3A98A 2BZXA 3G4SQ 3OA6A 5GAMe 2VVKA 2KXDA 4M75E 2LC4A 4XTZA 3GP8A 4PJLA 2I0NA 1OZ3A 1OULA 3TVTA 3CPWA 3GF5A 1O75A 2CSQA 4HKEA 4MMKA 1VQLA 3E19A 1ZA1B 2PTKA 1S72T 3L42A 1SHFA 1PHTA 2CP3A 3PVQA 2JW4A 1VQ7T 4IKFA 4M75A 4XTWA 1ZA2B 2EKOA 1QCOA 2ECZA 2EGAA 3ZEHA 2O2OA 3D7SB 3EHRA 3CCLA 2M1HA 3CD6Q 1RAIB 1PNJA 1VA7A 2CUBA 4DA4A 1X2KA 5GAOq 1Y96B 4M78E 1MMNA 4JZ3A 4JS4A 3JCMV 4AFZC 4M7AD 4JJNK 4M4ZA 2YLBA 1I07A 5LJ5f 4HVWA 1PCXA 4J83A 1Q86U 4A4EA 5GAOp 3N5BB 2DVEA 1D09B 5KYWA 3OYNA 4LXCA 4M78A 1ZUKA 1YITA 5DY9A 2V8JA 3VS7A 2DMOA 3JCMf 3P8DA 3I5RA 3QZ5B 3JB9D 1VQLQ 3OYMA 3OYJA 1YJ9T 1YJNT 5CCAA 4FL6A 2OI3A 4KH1B 2BE7D 5J39A 4K11A 1QVFP 5DLQE 3OYGA 3M0TA 2LQWA 2NLUA 3CCLQ 3CCJT 5LJ5g 3QDFA 1BIAA 1MGQA 1QVGS 3RESA 4XTXA 5LJ3d 2VXEA 5CKBA 4BACA 4PJOF 1VIEA 2R5AA 4F14A 2YUPA 1W70A 1SEMA 1Q7YC 1B34A 4D6WA 5FLXE 2L3RA 4IUPA 2KYMA 1N8RU 1BI3A 2QXFA 4C8QG 3PIPA 4ZNXA 2QAZA 3EFSA 2HSPA 2QEXA 1QCFA 4E7IA 3NTHA 3I35A 2IPOB 2F5KA 2F1LA 2RN8A 1YITQ 1ZUYA 3VU3C 2EJFA 3X24B 1Q86R 4E7LA 2DFUA 4VUBA 5DLOA 5EG2A 5CKFA 1PKTA 2LZ6B 1H8KA 3CCMA 5D6WA 1KHIA 3ZBDA 5KCOA 2F2VA 2EQIA 1K73U 2RB6A 1U8RA 2KRMA 2VB6A 1B3QA 2QGFB 4A4FA 5FU6B 5GAN4 1S1NA 1QVGA 3KFVA 3CC7A 1ZLMA 3MKDA 1UHCA 1M3AA 4J9BA 2J6OA 4RMOA 3G71T 5LJ3h 1G8XA 2DL4A 1ZHIA 2HNIA 3L2WA 1KD1C 1VQ6A 2DTHA 3FIFA 2ED1A 2CH4A 4L5GA 2K5LA 2SRCA 4X9DA 3O5ZA 4OGCA 8ATCB 1N8RR 2QEXQ 5GAN6 2KNBB 4EIKA 4HA8A 1ZSZB 2GTOA 5HKCA 4FW1A 2HMAA 4BY6B 1JEGA 3QBYA 1G3TA 4OMNA 3FDRA 2PQWA 3CCMQ 2GCXA 1WI7A 2XG8D 1TH7A 3EGDB 1M2VA 2DNUA 3UA7A 2X3XD 2CP0A 5GAMh 2GTJA 2M0YA 1HSQA 2ZPFB 5CIUA 1QP3A 2JTEA 2EWNA 3NTKA 1Q7YU 3CC7Q 2CZ7B 1K73R 2CZ6B 2GF7A 2LQ8A 1BU1A 3OYBA 1OU8A 2F69A 4D8KA 4QQDA 3E9GA 5KYXB 3S3MA 4LDYA 1YIJA 4Y91A 3CPWP 1WZOA 1KQ1A 3M53A 2D6FA 1VIFA 1M27C 1M2OA 1UFFA 4A4GA 5FU6C 3L1AA 2HDAA 1VQ6Q 1WQWA 3CXCS 4M7AB 2RI2A 5IHIA 2BTTA 3M5AA 4XK8E 5GANf 4C0DB 2CKKA 2EQKA 3CCUT 4F04B 1WNLA 2KSSA 4P5NA 3G6ET 3NMZC 4II1A 2MAMA 4M77B 5LJ5j 5CAIA 3VV0A 4J6YA 1WHKA 2CUDA 1CKBA 3EG0A 4A4HA 1UECA 1PSEA 4N0AA 4HCZA 3OYLA 1VQMT 3C12A 4IIMA 2Y4XA 1D1BA 2P4TA 3CMEA 4R55A 4PK4A 4KGVB 2NYSA 1NPPA 3EG3A 1ZSZC 4BY6C 5GANh 4C92G 3JB9G 4GLMA 1OOTA 3BW1A 1WQ7A 4M77E 4EMKB 2KYBA 2DZ9A 1Q7YR 1IB8A 1PSFA 3RBBB 4E7SA 3X25B 2YT6A 2LT1A 2X4WA 3CXCA 1J3TA 3C94A 4GLKA 1IGUA 4JJDA 1DJ7B 2DEQA 4M75D 2A28A 4MZPA 2EBPA 4LD9K 1WHJA 3VRYA 2NUPB 1JO8A 1D3BB 2COWA 1VQ9A 2OAWA 4M7AC 3QYHB 3OS5A 2DBKA 1VQPT 2IIMA 4C0DC 4C5IA 3JV3A 3IQLA 3QXEB 2RA2A 2C06A 3CMEQ 1SG5A 1M8MA 4M7AF 2KT8A 2LNHB 2RJFA 3FLGA 1I1JA 4M77C 2DL8A 3H0IA 4F7UF 1V76A 3FJ5A 4PKCC 2FO0A 2CGHA 2JT4A 2MK5A 1YJWT 1AZEA 2DK3A 2K57A 4RTUA 1RAGB 1MHNA 2ZPHB 2YUQA 4C92F 2DEUA 4M78D 3JB9F 2JM9A 1RL2A 2YRCA 2FHDA 3GLXA 3ZL7C 2BIVA 1WHGA 1K8AU 5FRMA 1M90C 1Y57A 1YCYA 1D3BA 2E10A 4M7DG 1H3ZA 4EMKC 1GFDA 5HY6A 2P0QA 1X2QA 2QK0A 4CRIA 1QVGP 1F1BB 1MMDA 1VOMA 1VQ9Q 5GAN3 2PUOB 1I5LA 1M5Q1 2F2WA 3KUFA 2QYZA 1JQQA 2XMFA 2YUNA 3QDRB 2M9UA 2QQBA 4J9GA 4Y92A 3JCMQ 3VRZA 1AT1B 1QVPA 4LD6A 5GAOl 2DO3A 1M30A 2LJ1A 4KULA 4QT7A 5LJ5e 1WA7A 4XQ3A 1ABOA 3OSSC 5I2SA 5KYUA 2L3PA 3OMGA 2EGEA 2GFAA 3C4SA 1NYGA 3CCVQ 4PNOA 4KUDK 1NJIU 1BCMA 1Q95G 3JCMe 4DBFA 3RDVA 2X4XA 3CBPA 3RKWA 1WHMA 2WSEE 2ZPEB 2VASA 2KROA 2IVWA 4FIBA 2QDYB 2DM1A 2R58A 3S3NA 2JZ2A 3OYIA 1PD1A 2RI3A 2LJ0A 1SKUB 2DL5A 2E1HA 3JB9H 5CQYA 5L8RE 2VGNA 2DTOA 1VQ8T 3V7SA 4M7DF 5GAOm 3GPLA 5GAN8 1KJWA 3ULRB 3FC3A 2FB7A 3JCMc 4V2SA 3KXTA 1IHWA 2X4YA 3RNJA 3CD6T 2CDTA 2RHIA 1RACB 5GAOr 1AWOA 4BB7A 2LMJA 1VYVA 1WX6A 4QQGA 3X20B 8AT1B 4BE0A 3CC4T 2FRYA 3RUXA 2E5KA 2LVMA 1KQ2A 1VQKA 4ESRA 2RK2A 2RJDA 2RK1A 2EJGA 2DE0X 4PJJA 1UG1A 2VUBA 1JXMA 4B9XA 5A0LA 5FRNA 2GQIA 2VXFA 4XU0A 1D1AA 3X26B 2E41A 2DLPA 4FYVB 4RKUE 5GMKj 2H3JA 3V7RA 4M75B 1TG0A 3EG1A 2CP2A 1AHJB 4PFPA 2OTLA 3J81E 2ED0A 2RHXA 2Y90A 3OYKA 4C0ZA 2R5MA 4EDUA 1UB4A 1SHGA 2GBQA 3T9NA 3FB9A 2E3HA 4QVDA 4F17A 3VS5A 3CXCP 3CBOA 3M58A 2CZ1B 3A5ZB 4JUVA 4PLLA 1XOVA 3MO8A 2E6NA 4HCCA 2MOXA 3BY7A 1JRIA 2K7AA 1VQKQ 2DF6A 2HKQB 2HQHA 3EH2A 3VS1A 1MMAA 2EYZA 1TWBA 1RUWA 2J6KA 1MNEA 2BZYA 5KYWB 5A2QE 2ABLA 1LCKA 4M78B 4ZN3A 2OAUA 3A8LB 1R77A 4FW2A 4RTXA 2BZ8A 1X69A 1I8FA 3JCMJ 3JCMP 3OY9A 4PJOG 1HXDA 2C0IA 2EPDA 1YITT 1ABQA 3GBQA 4BI8B 3URGA 1JXOA 2YRDA 1VQ4A 3CEYA 4Y28E 2HQXA 4O5VA 2WSFE 1RLQC 3RKXA 3CCQA 2FG0A 4XTVA 1K0SA 3PGGA 2H8HA 1SRMA 1WXUA 1YBYA 3OBYA 1PM3A 2OTLQ 2HCKA 4ELYC 4XU3A 4ELZC 4HCBA 4CI0C 3UT1A 4CC2A 3MEVA 3VS2A 1C0MA 1PRMC 1LPLA 5EC7A 6AT1B 4M75C 3CCET 1UGRB 1OU9A 1ACMB 1B34B 1M3BA 2CREA 4FYWB 1U1TA 5GANe 3OW2S 2HL5C 2X3WD 2VWFA 3QKJA 5GMKm 1SRLA 2DBMA 3VYHB 2OX7A 1VQ5Q 1WJSA 4M77D 1K9MU 2MF2A 2Y4YA 1HYOA 3F70A 1I81A 2IG0A 1NPRA 4HXJA 3M54A 3OYYA 1D0XA 3ME9A 2H3EB 4O6JA 3P8BB 4CC4B 3S3OA 4TVRA 4FU6A 3MEAA 1VQ7A 3M4YA 1RADB 1MNDA 3EG9A 5CKDA 5LJ5h 2AKLA 4MMLA 3V8JA 1VQ4Q 3OQ5A 4FSSA 4M78C 3CCQQ 2DIGA 3M0UA 1KK7A 2CYZB 2RO0A 3CCMT 2QQ9A 3OB9A 4XU2A 1BYMA 2JTFA 3I56T 2FEIA 4HT9A 3LWHA 3JCMh 2V26A 2YWWA 1RI9A 2I2LA 3QPHA 1NM7A 2AKKA 1NBEB 3X28B 2O9SA 4C0GA 5GMKe 3ER0A 4E47A 4C8QB 1T3LA 1Q82C 3CC7T 2L2PA 1KG1A 1TU0B 2QGGA 2EAYA 2P84A 1NZ9A 2GGRA 3OW2A 3OS1A 1AZGB 3H0FA 3RIRA 3CC2T 3GNFB 5CKEA 1GRIA 1YI2A 1X6GA 2WACA 5D7UA 5IN1A 2XDDA 1X27A 2LQNA 2NWMA 2A37A 1M9SA 2RH2A 1PRLC 1M3CA 2E65A 4HVVA 2RQUA 3QWXX 4J9HA 3DB4A 1A0NB 3E1SA 2JS2A 1K9MR 4Z02A 2MWOA 5GAMd 2W0ZA 3CMAA 1YJ9A 1MUZA 3TREA 1YJNA 4XTUA 1VQ7Q 4C8QE 4OB0B 3H41A 2F2XA 4KUIA 3CCRT 5CVIA 1PWTA 1M2VB 2EVRA 3OSVA 4C5HA 3CCJA 1W1FA 1AVZC 3BDLA 4E7KA 2V1QA 2RPNA 4KH0B 1YP5A 1VQOA 1LVKA 3J80E 4C8QA 2DJZA 2QA4T 1QQJA 1IREB 4DQ2A 2FVUA 1U1SA 4E7ZA 3J7AF 2QASA 1JBMA 2A08A 5AT1B 2EQJA 3TSZA 3H0HA 2EKHA 5FROA 5KCHA 1YIJT 1SF9A 3A1PA 4R56A 1YI2Q 1N27A 5LJ3g 4MDWA 3CCST 3TCJA 3META 4C8QC 4BE2A 2O01E 4KBMB 1YCSB 3EHQA 1QCNA 5I22A 4JS5A 4OB1B 1B7TA 4J9DA 4JRPA 1BI0A 1HD3A 2F5TX 5GANd 2DERA 1NEGA 3CMAQ 1WJRA 4LDVA 1YJ9Q 1YJNQ 2LCLA 1RAHB 4JPBW 2K2MA 2RQVA 3DB3A 4JLIA 1H92A 3CCJQ 4X1VA 3MEUA 4ZGJB 5ECAA 1G3SA 1YFNA 3FRNA 3LLRA 2LT4A 3QO3A 5GMKi 4QVZA 1VQOQ 3KBGA 3CMET 3UWNA 3M55A 3G71A 4IIOA 1YHQT 3WVDB 3MHXA 1QLYA 1Z9QA 3TQ7P 1BI2A 5GAMg 3OS2A 4JJBA 3HP9A 4IUUA 1G83A 4ZN1A 1KC8C 1BIBA 4J9EA 1SSHA 2GQVA 5KYYA 2C0TA 1FXXA 1I5OB 4GBQA 4AG2C 4RTTA 3GOXA 3UDCA 3JAME 1Q81C 2YSQA 4B9WA 4M7AG 3NHNA 1JJ2S 3ASKA 2HD0A 2DRKA 5DM7R 2MI6A 4F7UG 2P0PA 3NPFA 4NOYA 2C0OA 1ZQ1A 3R6OA 2K3BA 2AZSA 2HSEB 1VYUA 2KGTA 1VQ9T 4CC7A 4KGZB 4DEYA 2BKDN 1W2BP 2YLCA 3MP6A 1M1KC 1FX7A 3OYCA 1KD1U 1CKAA 4J5YA 3G71Q 2LP5A 4N0AC 2V1RA 3LWIA 1XJWB 5KE2A 1GCPA 2OTJA 2CP7A 2JUFA 3WVEB 3U23A 1X75C 4LNPA 4PJNA 1BK2A 3UPUA 3I55T 2XU8A 1QKXA 4C92E 5IHNA 2KQWA 3VS4A 2V8IA 3G6EA 2RM4A 2E12A 1JJ2A 2FRWA 4ATOA 2RF0A 2B8AA 3MPUB 2O31A 1OQKA 2W10A 4NL2A 5HK3A 4Z8AA 5GMKh 1BBZA 4C92A 2LQKA 1BCOA 1GBQA 2MYSA 1KIKA 5D6XA 3OW2P 2K6DA 1WDXA 5HK0A 3CCVA 2COYA 1OZ2A 2GFUA 1SPKA 1YNZA 4OB2B 1TOVA 4HVUA 3PFSA 4M77F 3OYAA 5KYUB 2KEAA 4N4IA 1X6BA 1AWJA 4D8DA 2D0QB 2NUZA 4JLGA 3EAEA 1KD1R 2OTJQ 2K5FA 4IUVA 3P8HA 1R8OB 3UATA 3REAB 4DBHA 5J3BA 2DJQA 4N4HA 4DBRA 4RG2A 1U5SA 3G6EQ 4A63B 2D8HA 3LYIA 4E7JA 2KT1A 1AOJA 2CP5A 4ZGDB 3HSBA 3OYEA 2RMOA 1K1ZA 5IHKA 2L3QA 1WXTA 1VQMQ 1VQNT 2ZAEA 3M9QA 4FM4B 4MZTA 2EIFA 2KDSA 2VC8A 5IXFA 4WF2A 2YXYA 5A0GA 1NLPC 4J9IA 3HKSA 1CSKA 4M7DE 3AT1B 2RHYA 4FSXA 3E9FA 1H3HA 2DTIA 2P0KA 2MPXC 5AYFA 1GFCA 1GL5A 2P4RA 1FWZA 3VS6A 2JTMA 1YN8A 3G4ST 3LH0A 2X51A 1ZBXA 4M7DA 5IAYA 1GCQA 3EFRA 1VQKT 4B6MA 2KVQG 4AMCA 2E6ZA 2K4YA 2XDPA 1KFZA 2L0AA 2LRQA 4C5EA 4OVAA 4OMOA 2HBPA 1X01A 3MCAB 1Z9ZA 1Q81R 2DD4A 2E5QA 1KQSS 3V7CA 3INZA 2DILA 2JVVA 3EFOA 3EG2A 3QSUA 4JDSA 2HZYA 4PL6A 4XU1A 3VUZA 4C8QD 4LUDA 5KH6A 1KHCA 2DYIA 3QZ9B 2BE9B 3A8OB 5CQXA 4BUGA 1VUBA 2J7IA 1K76A 3SFMA 1G5VA 2OTLT 2FYKA 2JMCA 3SB2A 1HJDA 4YTLA 3VUBA 3V8LA 4R0KA 4JRIA 1LNXA 1C1AA 1OPKA 3A8HB 1TTHB 1Y0MA 4KGXB 1M90U 2K2VA 2COZA 2CT4A 2DRMA 3GIBA 2FPFA 2KAFA 3LW5E 1MV3A 3M0SA 1Q86C 2RJEA 4HT8A 1RAEB 3DLMA 2NUTA 2XD0A 1VQLT 4UC4A 2L8DA 2HQEA 1KQSA 1VQ8A 4A53A 1W6XA 2HEQA 4GY5A 2YHTA 4QKUA 4BDYA 2DL7A 3CCLT 1VQ4T 4M75G 2FZCB 3NTIA 2KBTA 4QQ6A 2ROLA 3QUIA 5KE3A 4OMFB 1W2BS 2YUOA 3HFOA 2RHZA 3CC4A 5GAN7 4RUGA 3Q1JA 2FPEA 2PUKB 1VQ5A 4JRKA 1K4US 2D1XA 5A0DA 4OMPA 1K9AA 2DXCA 1JJ2P 2XHCA 2DKGA 3CPFA 5C6SA 4LUEA 1UDLA 4LDXA 2WSCE 5GMKl 5LJ5d 1N8RC 2AHJB 4BE1A 1T3SA 3JCMX 2E4HA 3MJXA 4ME7A 4PJOB 3BE3A 1BI1A 3JB9J 1M90R 2GNCA 1E6HA 2XI9A 2ZPGB 3PT9A 1FMWA 3VJPA 2XK0A 1LOJA 4M78G 1OI1A 1ZBJA 3JCMd 3MEWA 1R0BG 4AFQC 3EG9B 2K3XA 2PU9B 2JXBA 1VQ8Q 1HK9A 2RD1A 2PZ1A 2KE9A 3EGXB 4OF1A 4F16A 2LCCA 1UEBA 1AEYA 4Q5WA 1E7OA 3LGLA 3H6ZA 4OP0A 3G7ZA 4OMMA 1K73C 1RLPC 2KXCA 4BI4A 4ZTFA 4DEXA 2O9VA 2RHUA 2SEMA 2VYTA 4PJOE 3S6WA 1BKBA 1W2BA 3M4GA 1H641 1FMVA 1TSFA 3CC4Q 1U3OA 4M75F 4C0FA 1RABB 1AD5A 5HCKA 1GXIE 4Z88A 4C5GA 4WTOB 2V8KA 3OBWA 1N6AA 1WGSA 1FMKA 2CH4W 4PJOA 2JNGA 5FWBA 2LDMA 1S72A 5IXBA 2QEXT 2XKOC 1YI2T 4L6V5 4ANJA 3M59A 4J9CA 1WLPB 2D8JA 3TEEA 4C92D 1PC0A 1ZX6A 5CK9A 3EGXA 3JRZA 2M16A 1G3YA 3CMAT 2A36A 4EMHA 3EH1A 4PJOC 2AIRB 4JZ4A 3L2UA 2AT1B 2RQWA 3OYFA 4M78F 2JS0A 2DIQA 3CCEA 2CP6A 1Y96A 2QTVA 1R0CB 2DZCA 2ESWA 3RR6A 1VQOT 4OB3B 3C95A 2RJCA 1U06A 2EJ9A 2M51A 1QW1A 2YDLA 3JCMg 1SSFA 4E7HA 1B07A 1VQ6T 1WFWA 3HRUA 2AZVA 5GAN2 1Y71A 4AT1B 2J6FA 1K0XA 1NE8A 4OMQA 3OS0A 3L2RA 1S72Q 1I4K1 1T0JA 1IGQA 2X35A 1G3WA 2BUDA 2ZCFB 1WIEA 2J06A 4KT0E 1OPLA 3QWYA 2FZGB 1G2BA 5LJ3f 4PFZA 1WHLA 3HFNA 1UGVA 3G1JA 1UHFA 4RTVA 4RCCA 5FW9A 3M57A 3I56A 4XTYA 4X34A 3QHSA 2DAQA 4PJMA 3VS3A 4CC3A 1TXQA 2D9TA 3HTRA 2M0OA 4Z89A 2DPPB 1OX9A 4LDWA 2E3IA 3PIOA 4J8OA 3CCEQ 2OJ2A 3SWNB 3H9NA 3RKYA 5IT9E 4IUQA 4E2FB 1T0HA 4M7DD 3DLLA 3M56A 1EZZB 2A0FB 3CC2A 5CO7A 1WYXA 1QP2A 2EYQA 4E6RA 2MWPA 1UGPB 3PMTA 4NL3A 1KQSP 5KYYB 4OMLA 1NG2A 4LN2A 5GAMf 1JU5C 2JMAA 4RCBA 4FYXB 1MMGA 2MMPA 3QG1A 9ATCB 1UUEA 4C8QF 2RQTA 2LNVA 2DD5A 2ZGWA 5KYNA 3CCRA 1BB9A 3QIIA 3SD4A 3A8MB 3LX7A 3SEMA 2EYXA 3JCMW 4J6XA 3L2QA 2DL3A 3I56Q 1ARKA 1I0CA 2RQRA 3THKA 2QA4A 1Q82U 1WHHA 1QWFA 3SWNA 4DBQA 2PVDB 2LTOA 3QJYA 2O4XB 4BI3A 2DVJA 2A3LA 2MIOA 1QKWA 2ROTA 2XDBA 3CC2Q 1MV0B 2QQRA 3LGFA 1VYTA 1TUCA 2VKNA 5I21A 3CBMA 2RNAA 1FYNA 3OMCA 3JB9I 3FEOA 2DX1A 3NFCA 2OTJT 3CCSA 5J26A 2R57A 3SWNC 3HRSA 4F7UB 1ZSZA 4AFSC 3A8GB 4DOWA 1K8AC 2K9GA 2HL3A 3I9QA 3R6NA 2LX7A 4M77G 4IURA 1IRXA 3OYHA 1OV3A 2CT3A 3REBB 3CCRQ 3EGDA 2DYBA 1NEBA 4C92B 3RMQA 3ZFJA 5GAN5 5I11A 3TU4K 2O4XA 2JJ9A 4M7AE 1NLOC 2XICA 1AWWA 1KSWA 2QA4Q 2JN0A 3DKMA 1TUDA 3BDUA 1JB0E 1YHQA 3GNGA 4F7UE 3M0QA 1IHVA 5GANg 4FT2A 5KYXA 4OGEA 2ENMA 1N5ZA 2DA9A 3CCVT 1Q82R 2KY9A 2VV5A 2ATCB 4L59A 7AT1B 2Z0WA 2EYWA 3AHUA 3PVLA 3MP1A 3UA6A 3CCUA 4M7AA 3I5SA 1YIJQ 1TS9A 1UJYA 2DETA 4F7UA 2J05A 1C6VX 1RAFB 1NJIC 3CCSQ 2FPDA 2PVOB 1UJ0A 1RAAB 1OX8A 2HKNA 3L2VA 3HPWA 1PG5B 2CZ0B 1VQMA 1M4ZA 5M9OA 4M77A 2CS7A 5D6YA 5IH2A 1PD0A 5LL6S 3HRTA 2PNIA 1TUGB 1RI0A 4LE9A 2QTXA 4EPCA 2EFIA 3VKIA 3FJPA 5C0MA 1LJOA 5CR2A 3PTAA 3HL8A 4XAXB 1AWXA 2EQUA 1XNIA 2FL7A 4RG8A 1WJQA 1YWPA 1IXDA 5LJ3j 1UGQB 2QQAA 1QVFS 2JOYA 1ZUUA
chains in the Genus database with same CATH topology
3G1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1J A; 
#chains in the Genus database with same CATH topology
 1YHQ Q;  2HBW A;  3SHW A;  1KC8 U;  2O88 A;  4EMK A;  4C92 C;  2EYY A;  1D0Y A;  4PJO D;  1EX4 A;  3M0R A;  2PVG B;  4ORZ A;  3QYG B;  2ZPI B;  3SDZ A;  4DOV A;  1Q81 U;  4M7D B;  1M8V A;  2EGC A;  2DXB A;  3I55 A;  2VGM A;  4BD3 A;  3CCU Q;  2QDL A;  2DXT A;  4PLI A;  1WPY A;  3PE0 A;  5FU7 B;  2LJ3 A;  2L3S A;  4FCY A;  2NUP A;  1VQP A;  2JM8 A;  2XID A;  2FZK B;  4PFO A;  1UE9 A;  1Y07 A;  5FWC A;  3EFO B;  4RTW A;  5GAM j;  1EFN A;  1M1K U;  2KRS A;  1OEB A;  3E2U A;  2ZPB B;  3C0C A;  2QI2 A;  2KI7 A;  1YJW A;  1V1C A;  5GAO n;  1O9S A;  2B86 A;  1WXB A;  3O8V A;  3UF4 A;  2EQM A;  4QW2 A;  1X43 A;  4RTZ A;  1QVF A;  2G3R A;  2QG9 B;  2E70 A;  2G6F X;  1M1G A;  4IUT A;  1YWO A;  2K3Y A;  4J9F A;  3H8Z A;  1P92 A;  2RI5 A;  3NGP A;  5GJW B;  4JRQ A;  3I55 Q;  1KC8 R;  4QVC A;  4WCI A;  1IO6 A;  4RTY A;  3WXM B;  3VS0 A;  1Y7X A;  2KMT A;  4A54 A;  1V29 B;  4KRT A;  4FYY B;  2X9H A;  2M02 A;  2NUT B;  2L89 A;  1VQP Q;  1XQH A;  4M7D C;  2HAX A;  1VQN A;  1GCQ C;  3OYD A;  1M1F A;  4J6W A;  1K8A R;  4JJC A;  3L2Z A;  3V8K A;  5I2M A;  5FU7 C;  5L23 A;  5GAN j;  2ZZD A;  4AFU C;  1UGS B;  2A7Y A;  3JCM b;  4N4G A;  1YJW Q;  4BDZ A;  3QJ6 A;  2MCN A;  1M1K R;  4LDU A;  4MZM A;  4MDX A;  2QQS A;  3VYG A;  1XTD A;  2AK5 A;  1IZ6 A;  1ZSG A;  4ZTJ A;  1D0Z A;  1OYX A;  5GJV B;  3G4S A;  1QMC A;  3MP8 A;  2K5I A;  4FT4 A;  1PKS A;  2L5Q A;  3M0P A;  2LX9 A;  1VQ5 T;  4X9C A;  2X4J A;  2CSI A;  3LH5 A;  4J7I A;  1QWE A;  2KR3 A;  3CPW S;  1NYF A;  3RMS A;  5LJ3 e;  3CQT A;  1K9M C;  1E6G A;  3PMI A;  1D1C A;  3TSW A;  1N9R A;  1NJI R;  2YRV A;  1X6O A;  4EMG A;  1N9S A;  5CKH A;  4A4K A;  4NS5 A;  1VQN Q;  1EIF A;  3HHT B;  3CD6 A;  1UTI A;  4AG1 C;  3CCQ T;  2D0N A;  3JSC A;  2E64 A;  4J7F A;  3RER A;  1GBR A;  2LCS A;  2KRN A;  3EGU A;  3PNW C;  2KK4 A;  3BFM A;  1W4S A;  2K79 A;  4HCK A;  2EW3 A;  4ZGE B;  2DXU A;  3A98 A;  2BZX A;  3G4S Q;  3OA6 A;  5GAM e;  2VVK A;  2KXD A;  4M75 E;  2LC4 A;  4XTZ A;  3GP8 A;  4PJL A;  2I0N A;  1OZ3 A;  1OUL A;  3TVT A;  3CPW A;  3GF5 A;  1O75 A;  2CSQ A;  4HKE A;  4MMK A;  1VQL A;  3E19 A;  1ZA1 B;  2PTK A;  1S72 T;  3L42 A;  1SHF A;  1PHT A;  2CP3 A;  3PVQ A;  2JW4 A;  1VQ7 T;  4IKF A;  4M75 A;  4XTW A;  1ZA2 B;  2EKO A;  1QCO A;  2ECZ A;  2EGA A;  3ZEH A;  2O2O A;  3D7S B;  3EHR A;  3CCL A;  2M1H A;  3CD6 Q;  1RAI B;  1PNJ A;  1VA7 A;  2CUB A;  4DA4 A;  1X2K A;  5GAO q;  1Y96 B;  4M78 E;  1MMN A;  4JZ3 A;  4JS4 A;  3JCM V;  4AFZ C;  4M7A D;  4JJN K;  4M4Z A;  2YLB A;  1I07 A;  5LJ5 f;  4HVW A;  1PCX A;  4J83 A;  1Q86 U;  4A4E A;  5GAO p;  3N5B B;  2DVE A;  1D09 B;  5KYW A;  3OYN A;  4LXC A;  4M78 A;  1ZUK A;  1YIT A;  5DY9 A;  2V8J A;  3VS7 A;  2DMO A;  3JCM f;  3P8D A;  3I5R A;  3QZ5 B;  3JB9 D;  1VQL Q;  3OYM A;  3OYJ A;  1YJ9 T;  1YJN T;  5CCA A;  4FL6 A;  2OI3 A;  4KH1 B;  2BE7 D;  5J39 A;  4K11 A;  1QVF P;  5DLQ E;  3OYG A;  3M0T A;  2LQW A;  2NLU A;  3CCL Q;  3CCJ T;  5LJ5 g;  3QDF A;  1BIA A;  1MGQ A;  1QVG S;  3RES A;  4XTX A;  5LJ3 d;  2VXE A;  5CKB A;  4BAC A;  4PJO F;  1VIE A;  2R5A A;  4F14 A;  2YUP A;  1W70 A;  1SEM A;  1Q7Y C;  1B34 A;  4D6W A;  5FLX E;  2L3R A;  4IUP A;  2KYM A;  1N8R U;  1BI3 A;  2QXF A;  4C8Q G;  3PIP A;  4ZNX A;  2QAZ A;  3EFS A;  2HSP A;  2QEX A;  1QCF A;  4E7I A;  3NTH A;  3I35 A;  2IPO B;  2F5K A;  2F1L A;  2RN8 A;  1YIT Q;  1ZUY A;  3VU3 C;  2EJF A;  3X24 B;  1Q86 R;  4E7L A;  2DFU A;  4VUB A;  5DLO A;  5EG2 A;  5CKF A;  1PKT A;  2LZ6 B;  1H8K A;  3CCM A;  5D6W A;  1KHI A;  3ZBD A;  5KCO A;  2F2V A;  2EQI A;  1K73 U;  2RB6 A;  1U8R A;  2KRM A;  2VB6 A;  1B3Q A;  2QGF B;  4A4F A;  5FU6 B;  5GAN 4;  1S1N A;  1QVG A;  3KFV A;  3CC7 A;  1ZLM A;  3MKD A;  1UHC A;  1M3A A;  4J9B A;  2J6O A;  4RMO A;  3G71 T;  5LJ3 h;  1G8X A;  2DL4 A;  1ZHI A;  2HNI A;  3L2W A;  1KD1 C;  1VQ6 A;  2DTH A;  3FIF A;  2ED1 A;  2CH4 A;  4L5G A;  2K5L A;  2SRC A;  4X9D A;  3O5Z A;  4OGC A;  8ATC B;  1N8R R;  2QEX Q;  5GAN 6;  2KNB B;  4EIK A;  4HA8 A;  1ZSZ B;  2GTO A;  5HKC A;  4FW1 A;  2HMA A;  4BY6 B;  1JEG A;  3QBY A;  1G3T A;  4OMN A;  3FDR A;  2PQW A;  3CCM Q;  2GCX A;  1WI7 A;  2XG8 D;  1TH7 A;  3EGD B;  1M2V A;  2DNU A;  3UA7 A;  2X3X D;  2CP0 A;  5GAM h;  2GTJ A;  2M0Y A;  1HSQ A;  2ZPF B;  5CIU A;  1QP3 A;  2JTE A;  2EWN A;  3NTK A;  1Q7Y U;  3CC7 Q;  2CZ7 B;  1K73 R;  2CZ6 B;  2GF7 A;  2LQ8 A;  1BU1 A;  3OYB A;  1OU8 A;  2F69 A;  4D8K A;  4QQD A;  3E9G A;  5KYX B;  3S3M A;  4LDY A;  1YIJ A;  4Y91 A;  3CPW P;  1WZO A;  1KQ1 A;  3M53 A;  2D6F A;  1VIF A;  1M27 C;  1M2O A;  1UFF A;  4A4G A;  5FU6 C;  3L1A A;  2HDA A;  1VQ6 Q;  1WQW A;  3CXC S;  4M7A B;  2RI2 A;  5IHI A;  2BTT A;  3M5A A;  4XK8 E;  5GAN f;  4C0D B;  2CKK A;  2EQK A;  3CCU T;  4F04 B;  1WNL A;  2KSS A;  4P5N A;  3G6E T;  3NMZ C;  4II1 A;  2MAM A;  4M77 B;  5LJ5 j;  5CAI A;  3VV0 A;  4J6Y A;  1WHK A;  2CUD A;  1CKB A;  3EG0 A;  4A4H A;  1UEC A;  1PSE A;  4N0A A;  4HCZ A;  3OYL A;  1VQM T;  3C12 A;  4IIM A;  2Y4X A;  1D1B A;  2P4T A;  3CME A;  4R55 A;  4PK4 A;  4KGV B;  2NYS A;  1NPP A;  3EG3 A;  1ZSZ C;  4BY6 C;  5GAN h;  4C92 G;  3JB9 G;  4GLM A;  1OOT A;  3BW1 A;  1WQ7 A;  4M77 E;  4EMK B;  2KYB A;  2DZ9 A;  1Q7Y R;  1IB8 A;  1PSF A;  3RBB B;  4E7S A;  3X25 B;  2YT6 A;  2LT1 A;  2X4W A;  3CXC A;  1J3T A;  3C94 A;  4GLK A;  1IGU A;  4JJD A;  1DJ7 B;  2DEQ A;  4M75 D;  2A28 A;  4MZP A;  2EBP A;  4LD9 K;  1WHJ A;  3VRY A;  2NUP B;  1JO8 A;  1D3B B;  2COW A;  1VQ9 A;  2OAW A;  4M7A C;  3QYH B;  3OS5 A;  2DBK A;  1VQP T;  2IIM A;  4C0D C;  4C5I A;  3JV3 A;  3IQL A;  3QXE B;  2RA2 A;  2C06 A;  3CME Q;  1SG5 A;  1M8M A;  4M7A F;  2KT8 A;  2LNH B;  2RJF A;  3FLG A;  1I1J A;  4M77 C;  2DL8 A;  3H0I A;  4F7U F;  1V76 A;  3FJ5 A;  4PKC C;  2FO0 A;  2CGH A;  2JT4 A;  2MK5 A;  1YJW T;  1AZE A;  2DK3 A;  2K57 A;  4RTU A;  1RAG B;  1MHN A;  2ZPH B;  2YUQ A;  4C92 F;  2DEU A;  4M78 D;  3JB9 F;  2JM9 A;  1RL2 A;  2YRC A;  2FHD A;  3GLX A;  3ZL7 C;  2BIV A;  1WHG A;  1K8A U;  5FRM A;  1M90 C;  1Y57 A;  1YCY A;  1D3B A;  2E10 A;  4M7D G;  1H3Z A;  4EMK C;  1GFD A;  5HY6 A;  2P0Q A;  1X2Q A;  2QK0 A;  4CRI A;  1QVG P;  1F1B B;  1MMD A;  1VOM A;  1VQ9 Q;  5GAN 3;  2PUO B;  1I5L A;  1M5Q 1;  2F2W A;  3KUF A;  2QYZ A;  1JQQ A;  2XMF A;  2YUN A;  3QDR B;  2M9U A;  2QQB A;  4J9G A;  4Y92 A;  3JCM Q;  3VRZ A;  1AT1 B;  1QVP A;  4LD6 A;  5GAO l;  2DO3 A;  1M30 A;  2LJ1 A;  4KUL A;  4QT7 A;  5LJ5 e;  1WA7 A;  4XQ3 A;  1ABO A;  3OSS C;  5I2S A;  5KYU A;  2L3P A;  3OMG A;  2EGE A;  2GFA A;  3C4S A;  1NYG A;  3CCV Q;  4PNO A;  4KUD K;  1NJI U;  1BCM A;  1Q95 G;  3JCM e;  4DBF A;  3RDV A;  2X4X A;  3CBP A;  3RKW A;  1WHM A;  2WSE E;  2ZPE B;  2VAS A;  2KRO A;  2IVW A;  4FIB A;  2QDY B;  2DM1 A;  2R58 A;  3S3N A;  2JZ2 A;  3OYI A;  1PD1 A;  2RI3 A;  2LJ0 A;  1SKU B;  2DL5 A;  2E1H A;  3JB9 H;  5CQY A;  5L8R E;  2VGN A;  2DTO A;  1VQ8 T;  3V7S A;  4M7D F;  5GAO m;  3GPL A;  5GAN 8;  1KJW A;  3ULR B;  3FC3 A;  2FB7 A;  3JCM c;  4V2S A;  3KXT A;  1IHW A;  2X4Y A;  3RNJ A;  3CD6 T;  2CDT A;  2RHI A;  1RAC B;  5GAO r;  1AWO A;  4BB7 A;  2LMJ A;  1VYV A;  1WX6 A;  4QQG A;  3X20 B;  8AT1 B;  4BE0 A;  3CC4 T;  2FRY A;  3RUX A;  2E5K A;  2LVM A;  1KQ2 A;  1VQK A;  4ESR A;  2RK2 A;  2RJD A;  2RK1 A;  2EJG A;  2DE0 X;  4PJJ A;  1UG1 A;  2VUB A;  1JXM A;  4B9X A;  5A0L A;  5FRN A;  2GQI A;  2VXF A;  4XU0 A;  1D1A A;  3X26 B;  2E41 A;  2DLP A;  4FYV B;  4RKU E;  5GMK j;  2H3J A;  3V7R A;  4M75 B;  1TG0 A;  3EG1 A;  2CP2 A;  1AHJ B;  4PFP A;  2OTL A;  3J81 E;  2ED0 A;  2RHX A;  2Y90 A;  3OYK A;  4C0Z A;  2R5M A;  4EDU A;  1UB4 A;  1SHG A;  2GBQ A;  3T9N A;  3FB9 A;  2E3H A;  4QVD A;  4F17 A;  3VS5 A;  3CXC P;  3CBO A;  3M58 A;  2CZ1 B;  3A5Z B;  4JUV A;  4PLL A;  1XOV A;  3MO8 A;  2E6N A;  4HCC A;  2MOX A;  3BY7 A;  1JRI A;  2K7A A;  1VQK Q;  2DF6 A;  2HKQ B;  2HQH A;  3EH2 A;  3VS1 A;  1MMA A;  2EYZ A;  1TWB A;  1RUW A;  2J6K A;  1MNE A;  2BZY A;  5KYW B;  5A2Q E;  2ABL A;  1LCK A;  4M78 B;  4ZN3 A;  2OAU A;  3A8L B;  1R77 A;  4FW2 A;  4RTX A;  2BZ8 A;  1X69 A;  1I8F A;  3JCM J;  3JCM P;  3OY9 A;  4PJO G;  1HXD A;  2C0I A;  2EPD A;  1YIT T;  1ABQ A;  3GBQ A;  4BI8 B;  3URG A;  1JXO A;  2YRD A;  1VQ4 A;  3CEY A;  4Y28 E;  2HQX A;  4O5V A;  2WSF E;  1RLQ C;  3RKX A;  3CCQ A;  2FG0 A;  4XTV A;  1K0S A;  3PGG A;  2H8H A;  1SRM A;  1WXU A;  1YBY A;  3OBY A;  1PM3 A;  2OTL Q;  2HCK A;  4ELY C;  4XU3 A;  4ELZ C;  4HCB A;  4CI0 C;  3UT1 A;  4CC2 A;  3MEV A;  3VS2 A;  1C0M A;  1PRM C;  1LPL A;  5EC7 A;  6AT1 B;  4M75 C;  3CCE T;  1UGR B;  1OU9 A;  1ACM B;  1B34 B;  1M3B A;  2CRE A;  4FYW B;  1U1T A;  5GAN e;  3OW2 S;  2HL5 C;  2X3W D;  2VWF A;  3QKJ A;  5GMK m;  1SRL A;  2DBM A;  3VYH B;  2OX7 A;  1VQ5 Q;  1WJS A;  4M77 D;  1K9M U;  2MF2 A;  2Y4Y A;  1HYO A;  3F70 A;  1I81 A;  2IG0 A;  1NPR A;  4HXJ A;  3M54 A;  3OYY A;  1D0X A;  3ME9 A;  2H3E B;  4O6J A;  3P8B B;  4CC4 B;  3S3O A;  4TVR A;  4FU6 A;  3MEA A;  1VQ7 A;  3M4Y A;  1RAD B;  1MND A;  3EG9 A;  5CKD A;  5LJ5 h;  2AKL A;  4MML A;  3V8J A;  1VQ4 Q;  3OQ5 A;  4FSS A;  4M78 C;  3CCQ Q;  2DIG A;  3M0U A;  1KK7 A;  2CYZ B;  2RO0 A;  3CCM T;  2QQ9 A;  3OB9 A;  4XU2 A;  1BYM A;  2JTF A;  3I56 T;  2FEI A;  4HT9 A;  3LWH A;  3JCM h;  2V26 A;  2YWW A;  1RI9 A;  2I2L A;  3QPH A;  1NM7 A;  2AKK A;  1NBE B;  3X28 B;  2O9S A;  4C0G A;  5GMK e;  3ER0 A;  4E47 A;  4C8Q B;  1T3L A;  1Q82 C;  3CC7 T;  2L2P A;  1KG1 A;  1TU0 B;  2QGG A;  2EAY A;  2P84 A;  1NZ9 A;  2GGR A;  3OW2 A;  3OS1 A;  1AZG B;  3H0F A;  3RIR A;  3CC2 T;  3GNF B;  5CKE A;  1GRI A;  1YI2 A;  1X6G A;  2WAC A;  5D7U A;  5IN1 A;  2XDD A;  1X27 A;  2LQN A;  2NWM A;  2A37 A;  1M9S A;  2RH2 A;  1PRL C;  1M3C A;  2E65 A;  4HVV A;  2RQU A;  3QWX X;  4J9H A;  3DB4 A;  1A0N B;  3E1S A;  2JS2 A;  1K9M R;  4Z02 A;  2MWO A;  5GAM d;  2W0Z A;  3CMA A;  1YJ9 A;  1MUZ A;  3TRE A;  1YJN A;  4XTU A;  1VQ7 Q;  4C8Q E;  4OB0 B;  3H41 A;  2F2X A;  4KUI A;  3CCR T;  5CVI A;  1PWT A;  1M2V B;  2EVR A;  3OSV A;  4C5H A;  3CCJ A;  1W1F A;  1AVZ C;  3BDL A;  4E7K A;  2V1Q A;  2RPN A;  4KH0 B;  1YP5 A;  1VQO A;  1LVK A;  3J80 E;  4C8Q A;  2DJZ A;  2QA4 T;  1QQJ A;  1IRE B;  4DQ2 A;  2FVU A;  1U1S A;  4E7Z A;  3J7A F;  2QAS A;  1JBM A;  2A08 A;  5AT1 B;  2EQJ A;  3TSZ A;  3H0H A;  2EKH A;  5FRO A;  5KCH A;  1YIJ T;  1SF9 A;  3A1P A;  4R56 A;  1YI2 Q;  1N27 A;  5LJ3 g;  4MDW A;  3CCS T;  3TCJ A;  3MET A;  4C8Q C;  4BE2 A;  2O01 E;  4KBM B;  1YCS B;  3EHQ A;  1QCN A;  5I22 A;  4JS5 A;  4OB1 B;  1B7T A;  4J9D A;  4JRP A;  1BI0 A;  1HD3 A;  2F5T X;  5GAN d;  2DER A;  1NEG A;  3CMA Q;  1WJR A;  4LDV A;  1YJ9 Q;  1YJN Q;  2LCL A;  1RAH B;  4JPB W;  2K2M A;  2RQV A;  3DB3 A;  4JLI A;  1H92 A;  3CCJ Q;  4X1V A;  3MEU A;  4ZGJ B;  5ECA A;  1G3S A;  1YFN A;  3FRN A;  3LLR A;  2LT4 A;  3QO3 A;  5GMK i;  4QVZ A;  1VQO Q;  3KBG A;  3CME T;  3UWN A;  3M55 A;  3G71 A;  4IIO A;  1YHQ T;  3WVD B;  3MHX A;  1QLY A;  1Z9Q A;  3TQ7 P;  1BI2 A;  5GAM g;  3OS2 A;  4JJB A;  3HP9 A;  4IUU A;  1G83 A;  4ZN1 A;  1KC8 C;  1BIB A;  4J9E A;  1SSH A;  2GQV A;  5KYY A;  2C0T A;  1FXX A;  1I5O B;  4GBQ A;  4AG2 C;  4RTT A;  3GOX A;  3UDC A;  3JAM E;  1Q81 C;  2YSQ A;  4B9W A;  4M7A G;  3NHN A;  1JJ2 S;  3ASK A;  2HD0 A;  2DRK A;  5DM7 R;  2MI6 A;  4F7U G;  2P0P A;  3NPF A;  4NOY A;  2C0O A;  1ZQ1 A;  3R6O A;  2K3B A;  2AZS A;  2HSE B;  1VYU A;  2KGT A;  1VQ9 T;  4CC7 A;  4KGZ B;  4DEY A;  2BKD N;  1W2B P;  2YLC A;  3MP6 A;  1M1K C;  1FX7 A;  3OYC A;  1KD1 U;  1CKA A;  4J5Y A;  3G71 Q;  2LP5 A;  4N0A C;  2V1R A;  3LWI A;  1XJW B;  5KE2 A;  1GCP A;  2OTJ A;  2CP7 A;  2JUF A;  3WVE B;  3U23 A;  1X75 C;  4LNP A;  4PJN A;  1BK2 A;  3UPU A;  3I55 T;  2XU8 A;  1QKX A;  4C92 E;  5IHN A;  2KQW A;  3VS4 A;  2V8I A;  3G6E A;  2RM4 A;  2E12 A;  1JJ2 A;  2FRW A;  4ATO A;  2RF0 A;  2B8A A;  3MPU B;  2O31 A;  1OQK A;  2W10 A;  4NL2 A;  5HK3 A;  4Z8A A;  5GMK h;  1BBZ A;  4C92 A;  2LQK A;  1BCO A;  1GBQ A;  2MYS A;  1KIK A;  5D6X A;  3OW2 P;  2K6D A;  1WDX A;  5HK0 A;  3CCV A;  2COY A;  1OZ2 A;  2GFU A;  1SPK A;  1YNZ A;  4OB2 B;  1TOV A;  4HVU A;  3PFS A;  4M77 F;  3OYA A;  5KYU B;  2KEA A;  4N4I A;  1X6B A;  1AWJ A;  4D8D A;  2D0Q B;  2NUZ A;  4JLG A;  3EAE A;  1KD1 R;  2OTJ Q;  2K5F A;  4IUV A;  3P8H A;  1R8O B;  3UAT A;  3REA B;  4DBH A;  5J3B A;  2DJQ A;  4N4H A;  4DBR A;  4RG2 A;  1U5S A;  3G6E Q;  4A63 B;  2D8H A;  3LYI A;  4E7J A;  2KT1 A;  1AOJ A;  2CP5 A;  4ZGD B;  3HSB A;  3OYE A;  2RMO A;  1K1Z A;  5IHK A;  2L3Q A;  1WXT A;  1VQM Q;  1VQN T;  2ZAE A;  3M9Q A;  4FM4 B;  4MZT A;  2EIF A;  2KDS A;  2VC8 A;  5IXF A;  4WF2 A;  2YXY A;  5A0G A;  1NLP C;  4J9I A;  3HKS A;  1CSK A;  4M7D E;  3AT1 B;  2RHY A;  4FSX A;  3E9F A;  1H3H A;  2DTI A;  2P0K A;  2MPX C;  5AYF A;  1GFC A;  1GL5 A;  2P4R A;  1FWZ A;  3VS6 A;  2JTM A;  1YN8 A;  3G4S T;  3LH0 A;  2X51 A;  1ZBX A;  4M7D A;  5IAY A;  1GCQ A;  3EFR A;  1VQK T;  4B6M A;  2KVQ G;  4AMC A;  2E6Z A;  2K4Y A;  2XDP A;  1KFZ A;  2L0A A;  2LRQ A;  4C5E A;  4OVA A;  4OMO A;  2HBP A;  1X01 A;  3MCA B;  1Z9Z A;  1Q81 R;  2DD4 A;  2E5Q A;  1KQS S;  3V7C A;  3INZ A;  2DIL A;  2JVV A;  3EFO A;  3EG2 A;  3QSU A;  4JDS A;  2HZY A;  4PL6 A;  4XU1 A;  3VUZ A;  4C8Q D;  4LUD A;  5KH6 A;  1KHC A;  2DYI A;  3QZ9 B;  2BE9 B;  3A8O B;  5CQX A;  4BUG A;  1VUB A;  2J7I A;  1K76 A;  3SFM A;  1G5V A;  2OTL T;  2FYK A;  2JMC A;  3SB2 A;  1HJD A;  4YTL A;  3VUB A;  3V8L A;  4R0K A;  4JRI A;  1LNX A;  1C1A A;  1OPK A;  3A8H B;  1TTH B;  1Y0M A;  4KGX B;  1M90 U;  2K2V A;  2COZ A;  2CT4 A;  2DRM A;  3GIB A;  2FPF A;  2KAF A;  3LW5 E;  1MV3 A;  3M0S A;  1Q86 C;  2RJE A;  4HT8 A;  1RAE B;  3DLM A;  2NUT A;  2XD0 A;  1VQL T;  4UC4 A;  2L8D A;  2HQE A;  1KQS A;  1VQ8 A;  4A53 A;  1W6X A;  2HEQ A;  4GY5 A;  2YHT A;  4QKU A;  4BDY A;  2DL7 A;  3CCL T;  1VQ4 T;  4M75 G;  2FZC B;  3NTI A;  2KBT A;  4QQ6 A;  2ROL A;  3QUI A;  5KE3 A;  4OMF B;  1W2B S;  2YUO A;  3HFO A;  2RHZ A;  3CC4 A;  5GAN 7;  4RUG A;  3Q1J A;  2FPE A;  2PUK B;  1VQ5 A;  4JRK A;  1K4U S;  2D1X A;  5A0D A;  4OMP A;  1K9A A;  2DXC A;  1JJ2 P;  2XHC A;  2DKG A;  3CPF A;  5C6S A;  4LUE A;  1UDL A;  4LDX A;  2WSC E;  5GMK l;  5LJ5 d;  1N8R C;  2AHJ B;  4BE1 A;  1T3S A;  3JCM X;  2E4H A;  3MJX A;  4ME7 A;  4PJO B;  3BE3 A;  1BI1 A;  3JB9 J;  1M90 R;  2GNC A;  1E6H A;  2XI9 A;  2ZPG B;  3PT9 A;  1FMW A;  3VJP A;  2XK0 A;  1LOJ A;  4M78 G;  1OI1 A;  1ZBJ A;  3JCM d;  3MEW A;  1R0B G;  4AFQ C;  3EG9 B;  2K3X A;  2PU9 B;  2JXB A;  1VQ8 Q;  1HK9 A;  2RD1 A;  2PZ1 A;  2KE9 A;  3EGX B;  4OF1 A;  4F16 A;  2LCC A;  1UEB A;  1AEY A;  4Q5W A;  1E7O A;  3LGL A;  3H6Z A;  4OP0 A;  3G7Z A;  4OMM A;  1K73 C;  1RLP C;  2KXC A;  4BI4 A;  4ZTF A;  4DEX A;  2O9V A;  2RHU A;  2SEM A;  2VYT A;  4PJO E;  3S6W A;  1BKB A;  1W2B A;  3M4G A;  1H64 1;  1FMV A;  1TSF A;  3CC4 Q;  1U3O A;  4M75 F;  4C0F A;  1RAB B;  1AD5 A;  5HCK A;  1GXI E;  4Z88 A;  4C5G A;  4WTO B;  2V8K A;  3OBW A;  1N6A A;  1WGS A;  1FMK A;  2CH4 W;  4PJO A;  2JNG A;  5FWB A;  2LDM A;  1S72 A;  5IXB A;  2QEX T;  2XKO C;  1YI2 T;  4L6V 5;  4ANJ A;  3M59 A;  4J9C A;  1WLP B;  2D8J A;  3TEE A;  4C92 D;  1PC0 A;  1ZX6 A;  5CK9 A;  3EGX A;  3JRZ A;  2M16 A;  1G3Y A;  3CMA T;  2A36 A;  4EMH A;  3EH1 A;  4PJO C;  2AIR B;  4JZ4 A;  3L2U A;  2AT1 B;  2RQW A;  3OYF A;  4M78 F;  2JS0 A;  2DIQ A;  3CCE A;  2CP6 A;  1Y96 A;  2QTV A;  1R0C B;  2DZC A;  2ESW A;  3RR6 A;  1VQO T;  4OB3 B;  3C95 A;  2RJC A;  1U06 A;  2EJ9 A;  2M51 A;  1QW1 A;  2YDL A;  3JCM g;  1SSF A;  4E7H A;  1B07 A;  1VQ6 T;  1WFW A;  3HRU A;  2AZV A;  5GAN 2;  1Y71 A;  4AT1 B;  2J6F A;  1K0X A;  1NE8 A;  4OMQ A;  3OS0 A;  3L2R A;  1S72 Q;  1I4K 1;  1T0J A;  1IGQ A;  2X35 A;  1G3W A;  2BUD A;  2ZCF B;  1WIE A;  2J06 A;  4KT0 E;  1OPL A;  3QWY A;  2FZG B;  1G2B A;  5LJ3 f;  4PFZ A;  1WHL A;  3HFN A;  1UGV A;  3G1J A;  1UHF A;  4RTV A;  4RCC A;  5FW9 A;  3M57 A;  3I56 A;  4XTY A;  4X34 A;  3QHS A;  2DAQ A;  4PJM A;  3VS3 A;  4CC3 A;  1TXQ A;  2D9T A;  3HTR A;  2M0O A;  4Z89 A;  2DPP B;  1OX9 A;  4LDW A;  2E3I A;  3PIO A;  4J8O A;  3CCE Q;  2OJ2 A;  3SWN B;  3H9N A;  3RKY A;  5IT9 E;  4IUQ A;  4E2F B;  1T0H A;  4M7D D;  3DLL A;  3M56 A;  1EZZ B;  2A0F B;  3CC2 A;  5CO7 A;  1WYX A;  1QP2 A;  2EYQ A;  4E6R A;  2MWP A;  1UGP B;  3PMT A;  4NL3 A;  1KQS P;  5KYY B;  4OML A;  1NG2 A;  4LN2 A;  5GAM f;  1JU5 C;  2JMA A;  4RCB A;  4FYX B;  1MMG A;  2MMP A;  3QG1 A;  9ATC B;  1UUE A;  4C8Q F;  2RQT A;  2LNV A;  2DD5 A;  2ZGW A;  5KYN A;  3CCR A;  1BB9 A;  3QII A;  3SD4 A;  3A8M B;  3LX7 A;  3SEM A;  2EYX A;  3JCM W;  4J6X A;  3L2Q A;  2DL3 A;  3I56 Q;  1ARK A;  1I0C A;  2RQR A;  3THK A;  2QA4 A;  1Q82 U;  1WHH A;  1QWF A;  3SWN A;  4DBQ A;  2PVD B;  2LTO A;  3QJY A;  2O4X B;  4BI3 A;  2DVJ A;  2A3L A;  2MIO A;  1QKW A;  2ROT A;  2XDB A;  3CC2 Q;  1MV0 B;  2QQR A;  3LGF A;  1VYT A;  1TUC A;  2VKN A;  5I21 A;  3CBM A;  2RNA A;  1FYN A;  3OMC A;  3JB9 I;  3FEO A;  2DX1 A;  3NFC A;  2OTJ T;  3CCS A;  5J26 A;  2R57 A;  3SWN C;  3HRS A;  4F7U B;  1ZSZ A;  4AFS C;  3A8G B;  4DOW A;  1K8A C;  2K9G A;  2HL3 A;  3I9Q A;  3R6N A;  2LX7 A;  4M77 G;  4IUR A;  1IRX A;  3OYH A;  1OV3 A;  2CT3 A;  3REB B;  3CCR Q;  3EGD A;  2DYB A;  1NEB A;  4C92 B;  3RMQ A;  3ZFJ A;  5GAN 5;  5I11 A;  3TU4 K;  2O4X A;  2JJ9 A;  4M7A E;  1NLO C;  2XIC A;  1AWW A;  1KSW A;  2QA4 Q;  2JN0 A;  3DKM A;  1TUD A;  3BDU A;  1JB0 E;  1YHQ A;  3GNG A;  4F7U E;  3M0Q A;  1IHV A;  5GAN g;  4FT2 A;  5KYX A;  4OGE A;  2ENM A;  1N5Z A;  2DA9 A;  3CCV T;  1Q82 R;  2KY9 A;  2VV5 A;  2ATC B;  4L59 A;  7AT1 B;  2Z0W A;  2EYW A;  3AHU A;  3PVL A;  3MP1 A;  3UA6 A;  3CCU A;  4M7A A;  3I5S A;  1YIJ Q;  1TS9 A;  1UJY A;  2DET A;  4F7U A;  2J05 A;  1C6V X;  1RAF B;  1NJI C;  3CCS Q;  2FPD A;  2PVO B;  1UJ0 A;  1RAA B;  1OX8 A;  2HKN A;  3L2V A;  3HPW A;  1PG5 B;  2CZ0 B;  1VQM A;  1M4Z A;  5M9O A;  4M77 A;  2CS7 A;  5D6Y A;  5IH2 A;  1PD0 A;  5LL6 S;  3HRT A;  2PNI A;  1TUG B;  1RI0 A;  4LE9 A;  2QTX A;  4EPC A;  2EFI A;  3VKI A;  3FJP A;  5C0M A;  1LJO A;  5CR2 A;  3PTA A;  3HL8 A;  4XAX B;  1AWX A;  2EQU A;  1XNI A;  2FL7 A;  4RG8 A;  1WJQ A;  1YWP A;  1IXD A;  5LJ3 j;  1UGQ B;  2QQA A;  1QVF S;  2JOY A;  1ZUU A; 
#chains in the Genus database with same CATH homology
 3G1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...