3G1JA

Structure from the mobile metagenome of vibrio cholerae. integron cassette protein vch_cass4.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
GVDRDYLQSEYGVLKAGQCYKVVRSFRDYRNINYERGDVMRFLGSNFVPYESGLSLFFDKNGSERQIMLCVRPEFQMEIAHHLDSYFCKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Integron cassette protein
publication title Structure from the mobile metagenome of Vibrio cholerae. Integron cassette protein VCH_CASS4.
rcsb
source organism Vibrio cholerae
total genus 20
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12208 DUF3601 Domain of unknown function (DUF3601)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.350 Mainly Beta Roll SH3 type barrels. mobile metagenome of vibrio cholerae. Integron cassette protein vch_cass4. 3g1jA00
3G1JA
chains in the Genus database with same CATH superfamily
5GAOn 3JCMW 3CCET 2O4XA 2VASA 3SWNA 2J7IA 3CCST 2F69A 4KULA 2DRKA 1CSKA 2J05A 4OMQA 2P4TA 5CQYA 1BCMA 2A0FB 1XTDA 2HAXA 1Y96A 1YP5A 2GF7A 3SWNC 2E1HA 2DXBA 2KYMA 2FG0A 2OTLQ 2X4YA 3UDCA 4F7UG 3JCMP 5GMKm 1R0BG 4HVVA 2O2OA 2RA2A 1AWWA 2LQ8A 2QTVA 3SFMA 4DOVA 5CKDA 2V8KA 2XK0A 3QDFA 1WGSA 2QI2A 4OGCA 4L5GA 1SKUB 1Q81R 2DA9A 1KD1U 3M0SA 2X9HA 2HCKA 1B34A 1K73U 3X28B 2G3RA 4WF2A 1MMDA 2HNIA 1M1KR 4FYYB 1QVGP 2KVQG 2KXDA 3OBYA 5LJ5g 1K8AR 3E19A 2G6FX 3CCVT 2X4XA 4N4IA 1FWZA 3L2UA 4LD9K 3OMGA 5KYNA 3CD6Q 3JB9G 2YUQA 4OMLA 2JN0A 1Q82R 3UATA 1PCXA 1M90R 2DEQA 1MMAA 1JRIA 2QQAA 3M4GA 2PUOB 3LWIA 2GFAA 4KUIA 3CCUA 3J81E 1YJWQ 2E10A 3JCMV 2DMOA 1H92A 2NYSA 3L2RA 1GL5A 3JCMg 1OYXA 1H8KA 1BI1A 2M9UA 1VQ7Q 3NHNA 2X3WD 5GMKe 2HQXA 2NLUA 1IRXA 1BI3A 1UB4A 4PJOG 1T3SA 2CP0A 3OYIA 2ZPFB 1D1AA 1X01A 2KEAA 3H6ZA 2YT6A 1SSFA 3PGGA 2W10A 2RK2A 1LNXA 1AT1B 1M2VA 2QTXA 5D6XA 2FO0A 2M1HA 2QG9B 3OS0A 2L3RA 3L2WA 3GOXA 3M5AA 4ME7A 4RTYA 1W2BA 5KYWA 1PC0A 4GY5A 1KIKA 1YITA 1OOTA 1T3LA 3L2VA 3HPWA 2GQIA 1RAHB 4XAXB 1UE9A 2XDPA 1K9MC 4X1VA 2LX7A 3OYBA 1Q81U 3CPWS 1KFZA 4JDSA 1G3WA 4E7HA 3C12A 4E7JA 2FZKB 2M0OA 2ECZA 3FEOA 4LUEA 4IURA 3CMEA 4XTVA 3G6ET 3CPFA 1M1KU 4GBQA 1VQNQ 1EIFA 5GMKi 4Z88A 2EQUA 3MO8A 4JUVA 2DILA 3CBMA 3HFOA 3PVQA 1WJSA 3JB9J 1NZ9A 3SDZA 2L0AA 5KCOA 3M57A 2B86A 2Z0WA 3A8HB 5CKHA 1Q82U 2RHYA 2OTLT 1FYNA 2P4RA 2YSQA 4J9DA 1W70A 2RQWA 3LGFA 3GBQA 3KFVA 3VS4A 1QKXA 3M58A 1X2QA 2RNAA 3PTAA 4JJCA 1TH7A 1QWFA 5GAMj 1UHFA 1ARKA 4JJDA 4Z89A 1F1BB 2P0PA 1PSEA 1UG1A 2RPNA 1Y57A 3QO3A 4D6WA 3ZBDA 1PD0A 3HTRA 4BI4A 4L6V5 4KGVB 1QQJA 1ABOA 1JB0E 1NLOC 2JT4A 2KBTA 2BE9B 1ZSZC 2DXCA 2VVKA 3HRTA 3P8DA 4DA4A 2J6KA 3CC2T 3CD6T 8AT1B 2O4XB 1YI2A 3SWNB 1KG1A 4AMCA 4F7UE 1Q95G 2LDMA 3L2QA 1UFFA 4M7AG 3PMIA 3JCMQ 1WXUA 5GJVB 4BDYA 2X35A 1YJWT 3BFMA 3QZ5B 1PRMC 3TCJA 1Y96B 4LDVA 3P8BB 5LJ3j 2RMOA 2NUPA 3RESA 4M7DE 1HD3A 1PHTA 4MZPA 3WXMB 2L3QA 2PVDB 3EFOA 4XU2A 1VQ7T 2CKKA 2DTHA 2NUZA 5GMKl 2MI6A 3M0TA 1S72T 5CAIA 1KHIA 2FVUA 1YJ9Q 5I11A 4XU1A 4EPCA 1UJ0A 3Q1JA 3OYAA 1C6VX 3OA6A 2PU9B 3OSSC 4EMKC 3H0HA 1Z9QA 2DL3A 1B34B 1IHWA 4LDYA 8ATCB 4PFOA 1G3TA 3KUFA 5HKCA 2R5AA 3VS7A 3G71Q 1AVZC 3CCJA 3META 1VA7A 2K79A 1VQPT 4L59A 2EVRA 1VQ9A 3JCMX 4EMHA 1N8RC 2CH4A 3M0UA 1VQ4Q 1UTIA 2ZCFB 1V29B 3I56T 3QZ9B 4RCCA 1YCSB 4JRIA 2LCLA 2E4HA 3D7SB 3KXTA 4AFZC 2YLBA 2J6OA 3CC4Q 2LNHB 5KH6A 1W2BP 2EJFA 1QCNA 4CC7A 1ZX6A 3HFNA 1JJ2A 1QKWA 1YJNA 4X34A 2V8IA 3LYIA 1NJIR 2BZYA 4HT9A 1QMCA 3A1PA 1VQ6A 4M75G 1VQ5A 1YBYA 4C92A 1RAGB 4XTYA 2RJDA 3S6WA 2EGCA 2RI2A 4QQ6A 4A4HA 3CCLQ 4C92C 3CC7Q 2OI3A 4PFZA 1M2VB 5FWCA 3FJPA 4FYXB 2E3HA 5AT1B 5KYWB 2WSFE 2LX9A 5KYYA 2RJCA 2GFUA 2B8AA 1VQ8Q 3WVDB 3VRZA 4KUDK 3TVTA 1WXTA 3UT1A 1IGQA 1MNEA 2K2VA 5FU6C 2CP2A 1X6BA 4BE1A 4C8QD 3G4ST 2EPDA 3OYJA 3V7SA 3AT1B 5FU7C 1HSQA 2MOXA 3M53A 3QWXX 1PG5B 1YN8A 2RB6A 5GAOr 2VGMA 4XTXA 3UWNA 2YUPA 4IIOA 1HYOA 1QLYA 3REAB 4Z02A 2F5KA 2HDAA 2CDTA 2R58A 3MKDA 3I9QA 3TEEA 3J7AF 3HRUA 1SEMA 2JTEA 1LPLA 4OMFB 5D6WA 4KH0B 2JTMA 4RCBA 5GAOm 2DL8A 1X6OA 1NJIU 2JNGA 1FX7A 1WHJA 4M77D 5FLXE 3LX7A 3NGPA 1D0XA 5KE2A 1TU0B 2YRCA 4C8QC 2CZ1B 1RI9A 2EQMA 2A3LA 1N6AA 2K3BA 4JJBA 2MMPA 1PKSA 2RQVA 3VYHB 4IUTA 4C5EA 3G71T 1TS9A 1YHQT 3BW1A 3A8OB 2R5MA 3OS5A 1VQ4T 1X27A 2GBQA 4LDUA 3OS2A 4P5NA 3O5ZA 4JJNK 2E5QA 1M5Q1 2DPPB 4CC2A 1VQLQ 4MDXA 5C0MA 1YIJA 5GANh 3QBYA 2NUPB 2KMTA 3EGXB 4HXJA 3QYHB 4E47A 4FIBA 1RAEB 4M77C 2O88A 1VYVA 3EFOB 4QKUA 4EMKB 3CCUQ 4ZGEB 2EJGA 5L23A 3FRNA 4BY6C 2MCNA 1D1BA 3NTIA 2PVOB 3CCLT 1JJ2P 2RQTA 3LH5A 2QQSA 3V8JA 2KRSA 2DD4A 4DOWA 3RNJA 3QWYA 1PD1A 3TSWA 2OJ2A 3CBPA 2V8JA 3CC7A 1UGVA 1M30A 3KBGA 4FSSA 2FYKA 1B3QA 2I2LA 1FXXA 2RI5A 3R6NA 2ZGWA 1U1TA 5A0DA 2DVEA 3JB9D 1M3BA 1WLPB 4KGXB 2ATCB 4PJNA 2HD0A 5CO7A 1YITQ 3OYYA 2KAFA 3CCRA 3E9GA 1VQOA 2M0YA 2VXFA 1G83A 4J9FA 4FYWB 1M4ZA 4RG8A 3GF5A 4N0AA 2JXBA 5CCAA 2BUDA 2ZPHB 4N4HA 2A28A 4XK8E 3EG1A 1KQSS 2YLCA 1AWJA 4C92B 2I0NA 3HKSA 4IKFA 5CIUA 3CMEQ 1RI0A 1G5VA 1KC8C 4PJOD 4N0AC 3C0CA 1CKAA 2CS7A 1WQWA 4F16A 5KYXA 2D8JA 1O9SA 2FZGB 3CBOA 2E6ZA 4DEYA 1RACB 4XTWA 1GXIE 2D1XA 2BTTA 5LJ5j 2MAMA 5FU6B 1SHGA 5KYYB 1Q7YC 4OP0A 4PNOA 4PJMA 3TU4K 4M78A 2DJQA 5CKBA 3PNWC 1QVPA 5FU7B 2E64A 3X24B 4IUPA 6AT1B 4AFSC 2PUKB 1QVFA 2H3EB 3MEVA 4M78C 3UA7A 3JV3A 2BIVA 3C94A 1UECA 1H641 3JRZA 4R55A 2EJ9A 2C06A 2XIDA 1KSWA 5GAMh 3CCMA 2K3XA 4M7DG 3CXCA 3CCSA 3M4YA 1UGSB 4PJOC 1UGRB 3SB2A 4DBRA 4FM4B 1AWOA 4CRIA 4XTUA 2EGEA 1ZLMA 5GAMf 2GNCA 1X75C 2V1QA 1TXQA 2J06A 5GANj 1YWOA 1YI2Q 2QA4A 4IUQA 2LQKA 4RTWA 4ZTFA 2XU8A 1AZEA 1VQLA 2QAZA 2DJZA 2IIMA 1O75A 1JQQA 2V1RA 2WSEE 4FYVB 3L42A 2E41A 4RTUA 5GAOl 3OYMA 2AK5A 2DEUA 2VB6A 4AG2C 4ANJA 2K5FA 1W1FA 4II1A 4FW2A 2GCXA 5LJ3h 2K4YA 1HXDA 2F2XA 4OF1A 2FEIA 4DQ2A 5LJ3f 4OGEA 1OPLA 3LGLA 4A53A 1SG5A 1I8FA 2DRMA 3CCJQ 2EGAA 4M7AD 5HK3A 2HKNA 4KGZB 1VQ9Q 1SHFA 4J83A 1I07A 5HK0A 4B6MA 4KBMB 1KK7A 2KY9A 3HL8A 3R6OA 3G1JA 5DLQE 1Z9ZA 1U5SA 2E6NA 2MF2A 1RADB 5FRMA 2XD0A 5GJWB 4JLGA 4DEXA 1D0ZA 2CUBA 4IUVA 3CMET 2JTFA 3MEAA 2LJ1A 2KRNA 2QEXQ 1YJNQ 1BI0A 1VUBA 3A8MB 3MP8A 1VQ6Q 2HSPA 1VQ5Q 1Q86R 2DL4A 4FSXA 1VQKA 4JZ4A 2RHUA 3QHSA 2DTOA 1K8AU 4OB0B 4C0ZA 4ZN1A 5DY9A 2LNVA 4ZN3A 1H3HA 1Y0MA 4M7AC 2DXTA 5GANd 5KYUA 1JU5C 4LNPA 1WI7A 2EYWA 1M90U 3A8LB 4O6JA 1IO6A 2DYBA 4JS5A 3EG9A 4KH1B 2M16A 3LW5E 5IHNA 5GAN6 2JJ9A 3NTKA 2XG8D 2VKNA 4JS4A 3FB9A 2HQEA 2CSIA 1ZSZA 2LQNA 3LWHA 4Y92A 3VS5A 3RIRA 1IXDA 2YRDA 3F70A 1ZUYA 4M75D 2AIRB 2OTJQ 4Z8AA 2XKOC 2JM8A 1CKBA 2LJ3A 2M51A 4C5HA 2RH2A 3FIFA 3VS1A 2O9SA 1YI2T 1ZUUA 1QVFP 4R0KA 1TOVA 5FRNA 3M9QA 5KYXB 1MMGA 4JRPA 2O31A 1WPYA 4LE9A 5GAMe 3CXCP 3MHXA 2EQKA 5GAN2 1TG0A 3VS3A 1TUCA 2C0IA 3UPUA 2COZA 2A08A 2IG0A 4ESRA 4M78B 2ZAEA 3A8GB 1KD1C 3X26B 3EG0A 1U3OA 1K73C 2QQ9A 4ELZC 3EGXA 1WA7A 3PE0A 2RF0A 4C0DC 4D8DA 1G3SA 1MV0B 4EMKA 1Q86U 5GAN4 4FT2A 4NS5A 1W2BS 4M75C 1OPKA 5EG2A 1SPKA 1GRIA 1E6GA 4FW1A 4WTOB 2HZYA 1GBRA 2F1LA 4BE2A 3CC2A 2E3IA 5J3BA 1K9AA 1NPRA 4QVZA 3CCJT 3PIPA 2MPXC 5GAMg 2RM4A 1VQ9T 4LDXA 1MMNA 3OB9A 1AZGB 3MEWA 5LJ3e 2K5IA 2O01E 1X43A 5C6SA 1KC8R 5FW9A 4E7SA 1U8RA 2GTJA 2YUOA 2ESWA 1N9RA 3T9NA 3EAEA 4OMNA 2FPFA 4J6YA 4ELYC 1Y7XA 3X25B 1S72A 1YIJQ 4PK4A 3V7RA 3GIBA 3DB4A 5LL6S 3OW2A 1VQ5T 2A36A 5GAMd 2AZVA 2EQJA 2QEXA 1VQNT 4X9DA 2LT1A 1VQPA 5J26A 1NE8A 5ECAA 5DM7R 5LJ3g 1W4SA 1M27C 3C4SA 4AFUC 1I5LA 4MMLA 2EQIA 2C0OA 2PTKA 1TUGB 2ZZDA 1LJOA 1Q81C 2CREA 2EIFA 2X3XD 4A4EA 5IT9E 4J9EA 4E7LA 3CCQA 1M9SA 1SRLA 5GAN3 1M1KC 3RKWA 2YWWA 2C0TA 2DXUA 4KT0E 4LXCA 2COWA 5FWBA 3REBB 5A0LA 1K8AC 3VV0A 2ED1A 3QXEB 3CCRQ 4JPBW 2LC4A 1VQMA 4CC3A 2CGHA 1VQOQ 1BIAA 1N27A 2XHCA 5LJ3d 1JXOA 4TVRA 2D6FA 2L8DA 3SHWA 1XOVA 1Q82C 1M90C 4C92F 2OTJA 5HCKA 3HHTB 1JO8A 3S3NA 1GCQC 1LVKA 2RHZA 4Q5WA 2JM9A 1TUDA 3UF4A 3OY9A 1LOJA 2D0QB 1QWEA 1X6GA 1RLQC 3QPHA 2ENMA 1PWTA 1OU9A 3INZA 5IH2A 2EAYA 4A4GA 3J80E 4RTZA 5KYUB 2DX1A 3CMAA 1WNLA 4Y28E 2CT3A 1RAIB 3DB3A 3EG9B 3M0PA 2EKHA 4J8OA 4C8QA 2K5LA 5LJ5h 2E12A 1YJ9T 1I4K1 2EFIA 1ZSZB 2FRYA 1ZSGA 5I21A 3H41A 4C92G 2OAUA 5A0GA 1K9MR 2FB7A 2ED0A 1KQSA 3CCEQ 2ZPBB 3CCMQ 2YXYA 3CCSQ 4OMOA 1BB9A 5J39A 3OS1A 1GFCA 4DBQA 3EFRA 3JCMh 1JJ2S 1D0YA 2DIGA 2YUNA 1ZBXA 3E1SA 2LZ6B 2LQWA 4RTXA 3SEMA 4F14A 2KR3A 4D8KA 2GTOA 3A5ZB 2QA4Q 1Y07A 4C8QF 1YFNA 1OEBA 4M77A 1ZBJA 1LCKA 3CC4T 2CZ6B 4IIMA 1EFNA 3QJYA 1K0XA 4XTZA 2W0ZA 4OB1B 2MK5A 2JMCA 5GANf 1QW1A 3THKA 2KRMA 2DIQA 2FL7A 1WHGA 3RMSA 1AHJB 1VIFA 2L5QA 4DBHA 2PQWA 4M7DD 4AFQC 1I0CA 4OMPA 4A4KA 1WZOA 3OW2P 1BU1A 3CC7T 4RKUE 2HKQB 2RHIA 1G3YA 3RKYA 2VYTA 2MYSA 1K0SA 2LCCA 4M77F 2CZ7B 3GPLA 2FHDA 4F7UA 1VQ8T 2DF6A 3TQ7P 2PVGB 3CCRT 2COYA 1NLPC 1M1GA 2CP6A 3JB9H 3QYGB 4OB3B 4BACA 1VQOT 2ZPEB 4QVDA 3V8KA 5FROA 1V76A 2KT1A 2KT8A 1MHNA 1BBZA 2QYZA 2CYZB 3DLMA 2XMFA 2LTOA 1KJWA 2K6DA 3FLGA 1PM3A 1K9MU 3V8LA 4NL3A 3I55A 3PMTA 4KRTA 1SSHA 4LN2A 2Y90A 1MGQA 2XDBA 2OX7A 3N5BB 2F2WA 4RUGA 2QXFA 4M7DC 2E70A 4QVCA 3JCMb 3PVLA 3EG2A 1GBQA 2K3YA 3P8HA 1VQKQ 2Y4YA 3QKJA 3X20B 4A4FA 1OI1A 3OYNA 2IVWA 2VGNA 4ZGJB 1M8VA 3VKIA 2LP5A 2LJ0A 5GAN7 2K7AA 3BDLA 4QQGA 4WCIA 4J9IA 2KDSA 2LRQA 3VS6A 4HCBA 5IHIA 1QP2A 3ULRB 1FMWA 2VUBA 4E7ZA 1QVGS 3JCMc 3L1AA 3E9FA 2L2PA 2H3JA 5CKFA 3QSUA 2D0NA 1N8RR 1ZA2B 2HBWA 3OYEA 3G6EQ 2EYXA 2P0KA 5A2QE 3CCMT 2PNIA 3GNFB 4PJOA 1UEBA 2MWPA 2JUFA 2RQRA 2JVVA 3MPUB 2E65A 3VUBA 3CPWA 2QQRA 4FCYA 1GFDA 2KROA 1KHCA 3CCEA 3JCMJ 5LJ5e 1NEBA 4C0GA 4PFPA 3JB9F 4EDUA 1WHLA 1NJIC 2QA4T 2RN8A 4B9WA 1U06A 2XI9A 1NEGA 2AKLA 1KQSP 1VQLT 3RKXA 1G2BA 2L3PA 1ZQ1A 1JEGA 1WQ7A 4J9CA 3ZL7C 2DM1A 2DFUA 1D1CA 5D7UA 3FJ5A 5GAOp 4M78F 4HA8A 3RBBB 3H8ZA 2RO0A 2PZ1A 3JCMe 4YTLA 4C8QB 4RTTA 1WHKA 1AD5A 1WJQA 4C92E 3CCUT 3HRSA 1R0CB 3S3MA 4HCKA 1IGUA 4C0FA 4ZGDB 4NOYA 4PJOF 1MNDA 1OULA 1UGQB 3MJXA 1XNIA 4LDWA 3EGUA 3MCAB 4N4GA 3VU3C 2DZ9A 2AKKA 5GANe 3QUIA 5GMKj 1B07A 3EH2A 1M3CA 4QT7A 3CC2Q 2LT4A 5CR2A 3VYGA 1SF9A 4PL6A 4FT4A 3CCVA 1OV3A 4NL2A 2NUTA 5CK9A 1AOJA 2YDLA 3TSZA 3VJPA 2DD5A 4FL6A 1YITT 4M78G 1FMKA 4M77B 1N8RU 2DKGA 3VRYA 4J5YA 5LJ5d 1AWXA 1RAFB 4HVWA 1KQ1A 2BE7D 4BY6B 1S72Q 2KYBA 2P84A 1B7TA 2QDLA 1PSFA 2KXCA 2CP7A 1OZ2A 1XQHA 5GANg 4FU6A 2R57A 4A63B 1ZA1B 2KQWA 1PKTA 3C95A 1VQKT 2CT4A 1WJRA 3I35A 2SEMA 4BUGA 3UA6A 3BY7A 4Y91A 3JCMd 1VQPQ 2JS2A 1ZHIA 4ORZA 4C8QE 4M7AA 4J6XA 1I81A 3DKMA 3I56Q 1QVFS 4BB7A 4C5IA 1OQKA 2EW3A 4BI8B 1IB8A 1S1NA 4PJLA 4F7UB 3OYKA 4BD3A 3O8VA 2GQVA 5IXBA 3CCQQ 3CXCS 3NFCA 1G8XA 1BYMA 1J3TA 1EZZB 1JBMA 2KE9A 2RK1A 4M7DB 2FZCB 1VQMQ 3G6EA 3QDRB 2BZ8A 2QGGA 1D3BA 2KI7A 2EYYA 4BDZA 3A98A 4E7KA 1UJYA 4M7AF 1UGPB 4QW2A 4ZNXA 4M77E 2KGTA 2X4JA 1RLPC 2KK4A 2RD1A 2DVJA 2X4WA 2O9VA 1M8MA 2OTLA 2M02A 2V26A 3BE3A 3CPWP 1K4US 3M54A 3OYFA 1YCYA 2BKDN 2DO3A 3EH1A 4C5GA 3ZEHA 1C1AA 3QIIA 4J9BA 3VS0A 3ZFJA 3VS2A 2EYZA 5IN1A 3JB9I 1ABQA 3CMAQ 3MP1A 3CQTA 1TTHB 4J7FA 3OYGA 1M1FA 1NYFA 4E7IA 2DERA 1FMVA 2RJFA 4HT8A 3G4SQ 3HSBA 1I5OB 1M2OA 4M75A 2ABLA 2QDYB 5EC7A 1VOMA 1WDXA 4MDWA 4A54A 1T0JA 3H0IA 5CVIA 4PJOB 4RMOA 3TREA 2DZCA 1HJDA 1K76A 1IHVA 1WHMA 3NTHA 3CD6A 4JLIA 1NM7A 1BI2A 3SD4A 5IXFA 1DJ7B 2CP3A 3M56A 3QG1A 1YJWA 3M59A 2VC8A 1D09B 5AYFA 4JRQA 1E6HA 2DL7A 3EGDA 2MIOA 2EYQA 4GLMA 1VQ7A 4ATOA 3M55A 4M75F 3RMQA 1VYTA 3H0FA 2XICA 2E5KA 3RR6A 3OYCA 1Y71A 2QEXT 1YJNT 1IREB 1M3AA 4DBFA 2XDDA 1RABB 2F2VA 2DL5A 1YHQQ 2QASA 1Q7YR 4C92D 2JZ2A 1VQ6T 1C0MA 4F04B 3GNGA 2OAWA 1BCOA 1E7OA 2HQHA 4J9HA 3EHQA 1RAAB 1QP3A 3PFSA 2RQUA 4M78E 4MMKA 1VIEA 4J9GA 1BKBA 3CCQT 3I56A 3FDRA 4J6WA 2DETA 2NUTB 4CI0C 3I5SA 2KSSA 2HSEB 4PJOE 4UC4A 1VYUA 4OVAA 2DNUA 1RL2A 4LUDA 2RI3A 4PLIA 2DBMA 1ACMB 1YWPA 1VQMT 2JS0A 4PJJA 1OX8A 4E6RA 1VQNA 5GAN8 3GP8A 3MP6A 2AHJB 2VWFA 3PT9A 4X9CA 2HEQA 3BDUA 3OYLA 2OTJT 2ROTA 1GCQA 3EHRA 3I55Q 3PIOA 1R77A 3GLXA 2CUDA 3VUZA 2RJEA 2WSCE 3M0RA 3EG3A 5L8RE 2ROLA 2K2MA 1X2KA 5I2SA 2F5TX 4M7AB 1PNJA 1KC8U 2L89A 3HP9A 2DYIA 4K11A 2EKOA 2L3SA 3CMAT 3OYHA 3ER0A 1QCOA 2LVMA 1BIBA 2YRVA 3V7CA 2LCSA 2D9TA 2DLPA 2DAQA 3WVEB 2HL3A 3CEYA 2ZPGB 1AEYA 1W6XA 1N9SA 2DBKA 5IHKA 5M9OA 1WFWA 4M4ZA 2HMAA 4B9XA 1Q7YU 3OQ5A 1RUWA 2IPOB 3G4SA 5GAOq 2KNBB 2A7YA 2ZPIB 2MWOA 2BZXA 1P92A 2H8HA 4XQ3A 4OMMA 2GGRA 5CQXA 1D3BB 1GCPA 4RG2A 2P0QA 1NBEB 1OZ3A 2HBPA 5LJ5f 1X69A 4OB2B 1WX6A 4BI3A 4HCZA 2VXEA 3ME9A 3OW2S 1N5ZA 2JOYA 4MZMA 4RTVA 1UHCA 5D6YA 1WYXA 1QCFA 1Q86C 5IAYA 1YIJT 4IUUA 1H3ZA 1U1SA 1YJ9A 4BE0A 1BK2A 3JAME 1UUEA 3RDVA 4C0DB 2CSQA 2HL5C 3JCMf 4EIKA 2EBPA 4AG1C 2FPEA 1QVGA 4CC4B 4JZ3A 3NMZC 1OU8A 4HVUA 4M7AE 4M75B 4EMGA 5I22A 4V2SA 3E2UA 3RUXA 1ZUKA 1PRLC 2DTIA 3I5RA 4MZTA 3FC3A 5DLOA 2CH4W 3G71A 1YHQA 2D8HA 4XU0A 2FRWA 4JRKA 1K1ZA 2LMJA 4LD6A 1VQ4A 3URGA 1SRMA 1TSFA 1WXBA 3AHUA 1EX4A 3OBWA 1KQ2A 3OMCA 3CCVQ 1XJWB 2CZ0B 3S3OA 2WACA 3CC4A 5GMKh 2AT1B 1R8OB 1NPPA 1T0HA 3EGDB 1OX9A 3G7ZA 4C8QG 5HY6A 1I1JA 4J7IA 2J6FA 1WHHA 3I55T 4VUBA 1NG2A 2FPDA 2CP5A 2DE0X 1YNZA 4F17A 4R56A 4M7DA 3CCLA 2Y4XA 2DK3A 4AT1B 3DLLA 2K9GA 7AT1B 1KD1R 2RHXA 1MUZA 1V1CA 3ASKA 1K73R 2JMAA 3OSVA 2AZSA 2K57A 3H9NA 4O5VA 5KE3A 3QJ6A 1VQ8A 2SRCA 4HCCA 4E2FB 3RERA 1JXMA 1UDLA 3JSCA 4PKCC 4M75E 3LLRA 1IZ6A 5GAN5 4F7UF 1A0NB 5I2MA 4HKEA 4M77G 3EFSA 5CKEA 1MV3A 2A37A 1HK9A 3U23A 3IQLA 4M78D 3OYDA 9ATCB 2QK0A 3NPFA 2QGFB 2QQBA 4GLKA 4XU3A 3MEUA 2YHTA 3L2ZA 2EWNA 2JW4A 3LH0A 1WIEA 4ZTJA 4M7DF 1TWBA 2NWMA 2X51A 4PLLA 5KCHA 1NYGA 4QQDA 3M0QA 2VV5A
chains in the Genus database with same CATH topology
3G1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1J A; 
#chains in the Genus database with same CATH topology
 5GAO n;  3JCM W;  3CCE T;  2O4X A;  2VAS A;  3SWN A;  2J7I A;  3CCS T;  2F69 A;  4KUL A;  2DRK A;  1CSK A;  2J05 A;  4OMQ A;  2P4T A;  5CQY A;  1BCM A;  2A0F B;  1XTD A;  2HAX A;  1Y96 A;  1YP5 A;  2GF7 A;  3SWN C;  2E1H A;  2DXB A;  2KYM A;  2FG0 A;  2OTL Q;  2X4Y A;  3UDC A;  4F7U G;  3JCM P;  5GMK m;  1R0B G;  4HVV A;  2O2O A;  2RA2 A;  1AWW A;  2LQ8 A;  2QTV A;  3SFM A;  4DOV A;  5CKD A;  2V8K A;  2XK0 A;  3QDF A;  1WGS A;  2QI2 A;  4OGC A;  4L5G A;  1SKU B;  1Q81 R;  2DA9 A;  1KD1 U;  3M0S A;  2X9H A;  2HCK A;  1B34 A;  1K73 U;  3X28 B;  2G3R A;  4WF2 A;  1MMD A;  2HNI A;  1M1K R;  4FYY B;  1QVG P;  2KVQ G;  2KXD A;  3OBY A;  5LJ5 g;  1K8A R;  3E19 A;  2G6F X;  3CCV T;  2X4X A;  4N4I A;  1FWZ A;  3L2U A;  4LD9 K;  3OMG A;  5KYN A;  3CD6 Q;  3JB9 G;  2YUQ A;  4OML A;  2JN0 A;  1Q82 R;  3UAT A;  1PCX A;  1M90 R;  2DEQ A;  1MMA A;  1JRI A;  2QQA A;  3M4G A;  2PUO B;  3LWI A;  2GFA A;  4KUI A;  3CCU A;  3J81 E;  1YJW Q;  2E10 A;  3JCM V;  2DMO A;  1H92 A;  2NYS A;  3L2R A;  1GL5 A;  3JCM g;  1OYX A;  1H8K A;  1BI1 A;  2M9U A;  1VQ7 Q;  3NHN A;  2X3W D;  5GMK e;  2HQX A;  2NLU A;  1IRX A;  1BI3 A;  1UB4 A;  4PJO G;  1T3S A;  2CP0 A;  3OYI A;  2ZPF B;  1D1A A;  1X01 A;  2KEA A;  3H6Z A;  2YT6 A;  1SSF A;  3PGG A;  2W10 A;  2RK2 A;  1LNX A;  1AT1 B;  1M2V A;  2QTX A;  5D6X A;  2FO0 A;  2M1H A;  2QG9 B;  3OS0 A;  2L3R A;  3L2W A;  3GOX A;  3M5A A;  4ME7 A;  4RTY A;  1W2B A;  5KYW A;  1PC0 A;  4GY5 A;  1KIK A;  1YIT A;  1OOT A;  1T3L A;  3L2V A;  3HPW A;  2GQI A;  1RAH B;  4XAX B;  1UE9 A;  2XDP A;  1K9M C;  4X1V A;  2LX7 A;  3OYB A;  1Q81 U;  3CPW S;  1KFZ A;  4JDS A;  1G3W A;  4E7H A;  3C12 A;  4E7J A;  2FZK B;  2M0O A;  2ECZ A;  3FEO A;  4LUE A;  4IUR A;  3CME A;  4XTV A;  3G6E T;  3CPF A;  1M1K U;  4GBQ A;  1VQN Q;  1EIF A;  5GMK i;  4Z88 A;  2EQU A;  3MO8 A;  4JUV A;  2DIL A;  3CBM A;  3HFO A;  3PVQ A;  1WJS A;  3JB9 J;  1NZ9 A;  3SDZ A;  2L0A A;  5KCO A;  3M57 A;  2B86 A;  2Z0W A;  3A8H B;  5CKH A;  1Q82 U;  2RHY A;  2OTL T;  1FYN A;  2P4R A;  2YSQ A;  4J9D A;  1W70 A;  2RQW A;  3LGF A;  3GBQ A;  3KFV A;  3VS4 A;  1QKX A;  3M58 A;  1X2Q A;  2RNA A;  3PTA A;  4JJC A;  1TH7 A;  1QWF A;  5GAM j;  1UHF A;  1ARK A;  4JJD A;  4Z89 A;  1F1B B;  2P0P A;  1PSE A;  1UG1 A;  2RPN A;  1Y57 A;  3QO3 A;  4D6W A;  3ZBD A;  1PD0 A;  3HTR A;  4BI4 A;  4L6V 5;  4KGV B;  1QQJ A;  1ABO A;  1JB0 E;  1NLO C;  2JT4 A;  2KBT A;  2BE9 B;  1ZSZ C;  2DXC A;  2VVK A;  3HRT A;  3P8D A;  4DA4 A;  2J6K A;  3CC2 T;  3CD6 T;  8AT1 B;  2O4X B;  1YI2 A;  3SWN B;  1KG1 A;  4AMC A;  4F7U E;  1Q95 G;  2LDM A;  3L2Q A;  1UFF A;  4M7A G;  3PMI A;  3JCM Q;  1WXU A;  5GJV B;  4BDY A;  2X35 A;  1YJW T;  3BFM A;  3QZ5 B;  1PRM C;  3TCJ A;  1Y96 B;  4LDV A;  3P8B B;  5LJ3 j;  2RMO A;  2NUP A;  3RES A;  4M7D E;  1HD3 A;  1PHT A;  4MZP A;  3WXM B;  2L3Q A;  2PVD B;  3EFO A;  4XU2 A;  1VQ7 T;  2CKK A;  2DTH A;  2NUZ A;  5GMK l;  2MI6 A;  3M0T A;  1S72 T;  5CAI A;  1KHI A;  2FVU A;  1YJ9 Q;  5I11 A;  4XU1 A;  4EPC A;  1UJ0 A;  3Q1J A;  3OYA A;  1C6V X;  3OA6 A;  2PU9 B;  3OSS C;  4EMK C;  3H0H A;  1Z9Q A;  2DL3 A;  1B34 B;  1IHW A;  4LDY A;  8ATC B;  4PFO A;  1G3T A;  3KUF A;  5HKC A;  2R5A A;  3VS7 A;  3G71 Q;  1AVZ C;  3CCJ A;  3MET A;  1VA7 A;  2K79 A;  1VQP T;  4L59 A;  2EVR A;  1VQ9 A;  3JCM X;  4EMH A;  1N8R C;  2CH4 A;  3M0U A;  1VQ4 Q;  1UTI A;  2ZCF B;  1V29 B;  3I56 T;  3QZ9 B;  4RCC A;  1YCS B;  4JRI A;  2LCL A;  2E4H A;  3D7S B;  3KXT A;  4AFZ C;  2YLB A;  2J6O A;  3CC4 Q;  2LNH B;  5KH6 A;  1W2B P;  2EJF A;  1QCN A;  4CC7 A;  1ZX6 A;  3HFN A;  1JJ2 A;  1QKW A;  1YJN A;  4X34 A;  2V8I A;  3LYI A;  1NJI R;  2BZY A;  4HT9 A;  1QMC A;  3A1P A;  1VQ6 A;  4M75 G;  1VQ5 A;  1YBY A;  4C92 A;  1RAG B;  4XTY A;  2RJD A;  3S6W A;  2EGC A;  2RI2 A;  4QQ6 A;  4A4H A;  3CCL Q;  4C92 C;  3CC7 Q;  2OI3 A;  4PFZ A;  1M2V B;  5FWC A;  3FJP A;  4FYX B;  2E3H A;  5AT1 B;  5KYW B;  2WSF E;  2LX9 A;  5KYY A;  2RJC A;  2GFU A;  2B8A A;  1VQ8 Q;  3WVD B;  3VRZ A;  4KUD K;  3TVT A;  1WXT A;  3UT1 A;  1IGQ A;  1MNE A;  2K2V A;  5FU6 C;  2CP2 A;  1X6B A;  4BE1 A;  4C8Q D;  3G4S T;  2EPD A;  3OYJ A;  3V7S A;  3AT1 B;  5FU7 C;  1HSQ A;  2MOX A;  3M53 A;  3QWX X;  1PG5 B;  1YN8 A;  2RB6 A;  5GAO r;  2VGM A;  4XTX A;  3UWN A;  2YUP A;  4IIO A;  1HYO A;  1QLY A;  3REA B;  4Z02 A;  2F5K A;  2HDA A;  2CDT A;  2R58 A;  3MKD A;  3I9Q A;  3TEE A;  3J7A F;  3HRU A;  1SEM A;  2JTE A;  1LPL A;  4OMF B;  5D6W A;  4KH0 B;  2JTM A;  4RCB A;  5GAO m;  2DL8 A;  1X6O A;  1NJI U;  2JNG A;  1FX7 A;  1WHJ A;  4M77 D;  5FLX E;  3LX7 A;  3NGP A;  1D0X A;  5KE2 A;  1TU0 B;  2YRC A;  4C8Q C;  2CZ1 B;  1RI9 A;  2EQM A;  2A3L A;  1N6A A;  2K3B A;  4JJB A;  2MMP A;  1PKS A;  2RQV A;  3VYH B;  4IUT A;  4C5E A;  3G71 T;  1TS9 A;  1YHQ T;  3BW1 A;  3A8O B;  2R5M A;  3OS5 A;  1VQ4 T;  1X27 A;  2GBQ A;  4LDU A;  3OS2 A;  4P5N A;  3O5Z A;  4JJN K;  2E5Q A;  1M5Q 1;  2DPP B;  4CC2 A;  1VQL Q;  4MDX A;  5C0M A;  1YIJ A;  5GAN h;  3QBY A;  2NUP B;  2KMT A;  3EGX B;  4HXJ A;  3QYH B;  4E47 A;  4FIB A;  1RAE B;  4M77 C;  2O88 A;  1VYV A;  3EFO B;  4QKU A;  4EMK B;  3CCU Q;  4ZGE B;  2EJG A;  5L23 A;  3FRN A;  4BY6 C;  2MCN A;  1D1B A;  3NTI A;  2PVO B;  3CCL T;  1JJ2 P;  2RQT A;  3LH5 A;  2QQS A;  3V8J A;  2KRS A;  2DD4 A;  4DOW A;  3RNJ A;  3QWY A;  1PD1 A;  3TSW A;  2OJ2 A;  3CBP A;  2V8J A;  3CC7 A;  1UGV A;  1M30 A;  3KBG A;  4FSS A;  2FYK A;  1B3Q A;  2I2L A;  1FXX A;  2RI5 A;  3R6N A;  2ZGW A;  1U1T A;  5A0D A;  2DVE A;  3JB9 D;  1M3B A;  1WLP B;  4KGX B;  2ATC B;  4PJN A;  2HD0 A;  5CO7 A;  1YIT Q;  3OYY A;  2KAF A;  3CCR A;  3E9G A;  1VQO A;  2M0Y A;  2VXF A;  1G83 A;  4J9F A;  4FYW B;  1M4Z A;  4RG8 A;  3GF5 A;  4N0A A;  2JXB A;  5CCA A;  2BUD A;  2ZPH B;  4N4H A;  2A28 A;  4XK8 E;  3EG1 A;  1KQS S;  2YLC A;  1AWJ A;  4C92 B;  2I0N A;  3HKS A;  4IKF A;  5CIU A;  3CME Q;  1RI0 A;  1G5V A;  1KC8 C;  4PJO D;  4N0A C;  3C0C A;  1CKA A;  2CS7 A;  1WQW A;  4F16 A;  5KYX A;  2D8J A;  1O9S A;  2FZG B;  3CBO A;  2E6Z A;  4DEY A;  1RAC B;  4XTW A;  1GXI E;  2D1X A;  2BTT A;  5LJ5 j;  2MAM A;  5FU6 B;  1SHG A;  5KYY B;  1Q7Y C;  4OP0 A;  4PNO A;  4PJM A;  3TU4 K;  4M78 A;  2DJQ A;  5CKB A;  3PNW C;  1QVP A;  5FU7 B;  2E64 A;  3X24 B;  4IUP A;  6AT1 B;  4AFS C;  2PUK B;  1QVF A;  2H3E B;  3MEV A;  4M78 C;  3UA7 A;  3JV3 A;  2BIV A;  3C94 A;  1UEC A;  1H64 1;  3JRZ A;  4R55 A;  2EJ9 A;  2C06 A;  2XID A;  1KSW A;  5GAM h;  3CCM A;  2K3X A;  4M7D G;  3CXC A;  3CCS A;  3M4Y A;  1UGS B;  4PJO C;  1UGR B;  3SB2 A;  4DBR A;  4FM4 B;  1AWO A;  4CRI A;  4XTU A;  2EGE A;  1ZLM A;  5GAM f;  2GNC A;  1X75 C;  2V1Q A;  1TXQ A;  2J06 A;  5GAN j;  1YWO A;  1YI2 Q;  2QA4 A;  4IUQ A;  2LQK A;  4RTW A;  4ZTF A;  2XU8 A;  1AZE A;  1VQL A;  2QAZ A;  2DJZ A;  2IIM A;  1O75 A;  1JQQ A;  2V1R A;  2WSE E;  4FYV B;  3L42 A;  2E41 A;  4RTU A;  5GAO l;  3OYM A;  2AK5 A;  2DEU A;  2VB6 A;  4AG2 C;  4ANJ A;  2K5F A;  1W1F A;  4II1 A;  4FW2 A;  2GCX A;  5LJ3 h;  2K4Y A;  1HXD A;  2F2X A;  4OF1 A;  2FEI A;  4DQ2 A;  5LJ3 f;  4OGE A;  1OPL A;  3LGL A;  4A53 A;  1SG5 A;  1I8F A;  2DRM A;  3CCJ Q;  2EGA A;  4M7A D;  5HK3 A;  2HKN A;  4KGZ B;  1VQ9 Q;  1SHF A;  4J83 A;  1I07 A;  5HK0 A;  4B6M A;  4KBM B;  1KK7 A;  2KY9 A;  3HL8 A;  3R6O A;  3G1J A;  5DLQ E;  1Z9Z A;  1U5S A;  2E6N A;  2MF2 A;  1RAD B;  5FRM A;  2XD0 A;  5GJW B;  4JLG A;  4DEX A;  1D0Z A;  2CUB A;  4IUV A;  3CME T;  2JTF A;  3MEA A;  2LJ1 A;  2KRN A;  2QEX Q;  1YJN Q;  1BI0 A;  1VUB A;  3A8M B;  3MP8 A;  1VQ6 Q;  2HSP A;  1VQ5 Q;  1Q86 R;  2DL4 A;  4FSX A;  1VQK A;  4JZ4 A;  2RHU A;  3QHS A;  2DTO A;  1K8A U;  4OB0 B;  4C0Z A;  4ZN1 A;  5DY9 A;  2LNV A;  4ZN3 A;  1H3H A;  1Y0M A;  4M7A C;  2DXT A;  5GAN d;  5KYU A;  1JU5 C;  4LNP A;  1WI7 A;  2EYW A;  1M90 U;  3A8L B;  4O6J A;  1IO6 A;  2DYB A;  4JS5 A;  3EG9 A;  4KH1 B;  2M16 A;  3LW5 E;  5IHN A;  5GAN 6;  2JJ9 A;  3NTK A;  2XG8 D;  2VKN A;  4JS4 A;  3FB9 A;  2HQE A;  2CSI A;  1ZSZ A;  2LQN A;  3LWH A;  4Y92 A;  3VS5 A;  3RIR A;  1IXD A;  2YRD A;  3F70 A;  1ZUY A;  4M75 D;  2AIR B;  2OTJ Q;  4Z8A A;  2XKO C;  2JM8 A;  1CKB A;  2LJ3 A;  2M51 A;  4C5H A;  2RH2 A;  3FIF A;  3VS1 A;  2O9S A;  1YI2 T;  1ZUU A;  1QVF P;  4R0K A;  1TOV A;  5FRN A;  3M9Q A;  5KYX B;  1MMG A;  4JRP A;  2O31 A;  1WPY A;  4LE9 A;  5GAM e;  3CXC P;  3MHX A;  2EQK A;  5GAN 2;  1TG0 A;  3VS3 A;  1TUC A;  2C0I A;  3UPU A;  2COZ A;  2A08 A;  2IG0 A;  4ESR A;  4M78 B;  2ZAE A;  3A8G B;  1KD1 C;  3X26 B;  3EG0 A;  1U3O A;  1K73 C;  2QQ9 A;  4ELZ C;  3EGX A;  1WA7 A;  3PE0 A;  2RF0 A;  4C0D C;  4D8D A;  1G3S A;  1MV0 B;  4EMK A;  1Q86 U;  5GAN 4;  4FT2 A;  4NS5 A;  1W2B S;  4M75 C;  1OPK A;  5EG2 A;  1SPK A;  1GRI A;  1E6G A;  4FW1 A;  4WTO B;  2HZY A;  1GBR A;  2F1L A;  4BE2 A;  3CC2 A;  2E3I A;  5J3B A;  1K9A A;  1NPR A;  4QVZ A;  3CCJ T;  3PIP A;  2MPX C;  5GAM g;  2RM4 A;  1VQ9 T;  4LDX A;  1MMN A;  3OB9 A;  1AZG B;  3MEW A;  5LJ3 e;  2K5I A;  2O01 E;  1X43 A;  5C6S A;  1KC8 R;  5FW9 A;  4E7S A;  1U8R A;  2GTJ A;  2YUO A;  2ESW A;  1N9R A;  3T9N A;  3EAE A;  4OMN A;  2FPF A;  4J6Y A;  4ELY C;  1Y7X A;  3X25 B;  1S72 A;  1YIJ Q;  4PK4 A;  3V7R A;  3GIB A;  3DB4 A;  5LL6 S;  3OW2 A;  1VQ5 T;  2A36 A;  5GAM d;  2AZV A;  2EQJ A;  2QEX A;  1VQN T;  4X9D A;  2LT1 A;  1VQP A;  5J26 A;  1NE8 A;  5ECA A;  5DM7 R;  5LJ3 g;  1W4S A;  1M27 C;  3C4S A;  4AFU C;  1I5L A;  4MML A;  2EQI A;  2C0O A;  2PTK A;  1TUG B;  2ZZD A;  1LJO A;  1Q81 C;  2CRE A;  2EIF A;  2X3X D;  4A4E A;  5IT9 E;  4J9E A;  4E7L A;  3CCQ A;  1M9S A;  1SRL A;  5GAN 3;  1M1K C;  3RKW A;  2YWW A;  2C0T A;  2DXU A;  4KT0 E;  4LXC A;  2COW A;  5FWB A;  3REB B;  5A0L A;  1K8A C;  3VV0 A;  2ED1 A;  3QXE B;  3CCR Q;  4JPB W;  2LC4 A;  1VQM A;  4CC3 A;  2CGH A;  1VQO Q;  1BIA A;  1N27 A;  2XHC A;  5LJ3 d;  1JXO A;  4TVR A;  2D6F A;  2L8D A;  3SHW A;  1XOV A;  1Q82 C;  1M90 C;  4C92 F;  2OTJ A;  5HCK A;  3HHT B;  1JO8 A;  3S3N A;  1GCQ C;  1LVK A;  2RHZ A;  4Q5W A;  2JM9 A;  1TUD A;  3UF4 A;  3OY9 A;  1LOJ A;  2D0Q B;  1QWE A;  1X6G A;  1RLQ C;  3QPH A;  2ENM A;  1PWT A;  1OU9 A;  3INZ A;  5IH2 A;  2EAY A;  4A4G A;  3J80 E;  4RTZ A;  5KYU B;  2DX1 A;  3CMA A;  1WNL A;  4Y28 E;  2CT3 A;  1RAI B;  3DB3 A;  3EG9 B;  3M0P A;  2EKH A;  4J8O A;  4C8Q A;  2K5L A;  5LJ5 h;  2E12 A;  1YJ9 T;  1I4K 1;  2EFI A;  1ZSZ B;  2FRY A;  1ZSG A;  5I21 A;  3H41 A;  4C92 G;  2OAU A;  5A0G A;  1K9M R;  2FB7 A;  2ED0 A;  1KQS A;  3CCE Q;  2ZPB B;  3CCM Q;  2YXY A;  3CCS Q;  4OMO A;  1BB9 A;  5J39 A;  3OS1 A;  1GFC A;  4DBQ A;  3EFR A;  3JCM h;  1JJ2 S;  1D0Y A;  2DIG A;  2YUN A;  1ZBX A;  3E1S A;  2LZ6 B;  2LQW A;  4RTX A;  3SEM A;  4F14 A;  2KR3 A;  4D8K A;  2GTO A;  3A5Z B;  2QA4 Q;  1Y07 A;  4C8Q F;  1YFN A;  1OEB A;  4M77 A;  1ZBJ A;  1LCK A;  3CC4 T;  2CZ6 B;  4IIM A;  1EFN A;  3QJY A;  1K0X A;  4XTZ A;  2W0Z A;  4OB1 B;  2MK5 A;  2JMC A;  5GAN f;  1QW1 A;  3THK A;  2KRM A;  2DIQ A;  2FL7 A;  1WHG A;  3RMS A;  1AHJ B;  1VIF A;  2L5Q A;  4DBH A;  2PQW A;  4M7D D;  4AFQ C;  1I0C A;  4OMP A;  4A4K A;  1WZO A;  3OW2 P;  1BU1 A;  3CC7 T;  4RKU E;  2HKQ B;  2RHI A;  1G3Y A;  3RKY A;  2VYT A;  2MYS A;  1K0S A;  2LCC A;  4M77 F;  2CZ7 B;  3GPL A;  2FHD A;  4F7U A;  1VQ8 T;  2DF6 A;  3TQ7 P;  2PVG B;  3CCR T;  2COY A;  1NLP C;  1M1G A;  2CP6 A;  3JB9 H;  3QYG B;  4OB3 B;  4BAC A;  1VQO T;  2ZPE B;  4QVD A;  3V8K A;  5FRO A;  1V76 A;  2KT1 A;  2KT8 A;  1MHN A;  1BBZ A;  2QYZ A;  2CYZ B;  3DLM A;  2XMF A;  2LTO A;  1KJW A;  2K6D A;  3FLG A;  1PM3 A;  1K9M U;  3V8L A;  4NL3 A;  3I55 A;  3PMT A;  4KRT A;  1SSH A;  4LN2 A;  2Y90 A;  1MGQ A;  2XDB A;  2OX7 A;  3N5B B;  2F2W A;  4RUG A;  2QXF A;  4M7D C;  2E70 A;  4QVC A;  3JCM b;  3PVL A;  3EG2 A;  1GBQ A;  2K3Y A;  3P8H A;  1VQK Q;  2Y4Y A;  3QKJ A;  3X20 B;  4A4F A;  1OI1 A;  3OYN A;  2IVW A;  2VGN A;  4ZGJ B;  1M8V A;  3VKI A;  2LP5 A;  2LJ0 A;  5GAN 7;  2K7A A;  3BDL A;  4QQG A;  4WCI A;  4J9I A;  2KDS A;  2LRQ A;  3VS6 A;  4HCB A;  5IHI A;  1QP2 A;  3ULR B;  1FMW A;  2VUB A;  4E7Z A;  1QVG S;  3JCM c;  3L1A A;  3E9F A;  2L2P A;  2H3J A;  5CKF A;  3QSU A;  2D0N A;  1N8R R;  1ZA2 B;  2HBW A;  3OYE A;  3G6E Q;  2EYX A;  2P0K A;  5A2Q E;  3CCM T;  2PNI A;  3GNF B;  4PJO A;  1UEB A;  2MWP A;  2JUF A;  2RQR A;  2JVV A;  3MPU B;  2E65 A;  3VUB A;  3CPW A;  2QQR A;  4FCY A;  1GFD A;  2KRO A;  1KHC A;  3CCE A;  3JCM J;  5LJ5 e;  1NEB A;  4C0G A;  4PFP A;  3JB9 F;  4EDU A;  1WHL A;  1NJI C;  2QA4 T;  2RN8 A;  4B9W A;  1U06 A;  2XI9 A;  1NEG A;  2AKL A;  1KQS P;  1VQL T;  3RKX A;  1G2B A;  2L3P A;  1ZQ1 A;  1JEG A;  1WQ7 A;  4J9C A;  3ZL7 C;  2DM1 A;  2DFU A;  1D1C A;  5D7U A;  3FJ5 A;  5GAO p;  4M78 F;  4HA8 A;  3RBB B;  3H8Z A;  2RO0 A;  2PZ1 A;  3JCM e;  4YTL A;  4C8Q B;  4RTT A;  1WHK A;  1AD5 A;  1WJQ A;  4C92 E;  3CCU T;  3HRS A;  1R0C B;  3S3M A;  4HCK A;  1IGU A;  4C0F A;  4ZGD B;  4NOY A;  4PJO F;  1MND A;  1OUL A;  1UGQ B;  3MJX A;  1XNI A;  4LDW A;  3EGU A;  3MCA B;  4N4G A;  3VU3 C;  2DZ9 A;  2AKK A;  5GAN e;  3QUI A;  5GMK j;  1B07 A;  3EH2 A;  1M3C A;  4QT7 A;  3CC2 Q;  2LT4 A;  5CR2 A;  3VYG A;  1SF9 A;  4PL6 A;  4FT4 A;  3CCV A;  1OV3 A;  4NL2 A;  2NUT A;  5CK9 A;  1AOJ A;  2YDL A;  3TSZ A;  3VJP A;  2DD5 A;  4FL6 A;  1YIT T;  4M78 G;  1FMK A;  4M77 B;  1N8R U;  2DKG A;  3VRY A;  4J5Y A;  5LJ5 d;  1AWX A;  1RAF B;  4HVW A;  1KQ1 A;  2BE7 D;  4BY6 B;  1S72 Q;  2KYB A;  2P84 A;  1B7T A;  2QDL A;  1PSF A;  2KXC A;  2CP7 A;  1OZ2 A;  1XQH A;  5GAN g;  4FU6 A;  2R57 A;  4A63 B;  1ZA1 B;  2KQW A;  1PKT A;  3C95 A;  1VQK T;  2CT4 A;  1WJR A;  3I35 A;  2SEM A;  4BUG A;  3UA6 A;  3BY7 A;  4Y91 A;  3JCM d;  1VQP Q;  2JS2 A;  1ZHI A;  4ORZ A;  4C8Q E;  4M7A A;  4J6X A;  1I81 A;  3DKM A;  3I56 Q;  1QVF S;  4BB7 A;  4C5I A;  1OQK A;  2EW3 A;  4BI8 B;  1IB8 A;  1S1N A;  4PJL A;  4F7U B;  3OYK A;  4BD3 A;  3O8V A;  2GQV A;  5IXB A;  3CCQ Q;  3CXC S;  3NFC A;  1G8X A;  1BYM A;  1J3T A;  1EZZ B;  1JBM A;  2KE9 A;  2RK1 A;  4M7D B;  2FZC B;  1VQM Q;  3G6E A;  3QDR B;  2BZ8 A;  2QGG A;  1D3B A;  2KI7 A;  2EYY A;  4BDZ A;  3A98 A;  4E7K A;  1UJY A;  4M7A F;  1UGP B;  4QW2 A;  4ZNX A;  4M77 E;  2KGT A;  2X4J A;  1RLP C;  2KK4 A;  2RD1 A;  2DVJ A;  2X4W A;  2O9V A;  1M8M A;  2OTL A;  2M02 A;  2V26 A;  3BE3 A;  3CPW P;  1K4U S;  3M54 A;  3OYF A;  1YCY A;  2BKD N;  2DO3 A;  3EH1 A;  4C5G A;  3ZEH A;  1C1A A;  3QII A;  4J9B A;  3VS0 A;  3ZFJ A;  3VS2 A;  2EYZ A;  5IN1 A;  3JB9 I;  1ABQ A;  3CMA Q;  3MP1 A;  3CQT A;  1TTH B;  4J7F A;  3OYG A;  1M1F A;  1NYF A;  4E7I A;  2DER A;  1FMV A;  2RJF A;  4HT8 A;  3G4S Q;  3HSB A;  1I5O B;  1M2O A;  4M75 A;  2ABL A;  2QDY B;  5EC7 A;  1VOM A;  1WDX A;  4MDW A;  4A54 A;  1T0J A;  3H0I A;  5CVI A;  4PJO B;  4RMO A;  3TRE A;  2DZC A;  1HJD A;  1K76 A;  1IHV A;  1WHM A;  3NTH A;  3CD6 A;  4JLI A;  1NM7 A;  1BI2 A;  3SD4 A;  5IXF A;  1DJ7 B;  2CP3 A;  3M56 A;  3QG1 A;  1YJW A;  3M59 A;  2VC8 A;  1D09 B;  5AYF A;  4JRQ A;  1E6H A;  2DL7 A;  3EGD A;  2MIO A;  2EYQ A;  4GLM A;  1VQ7 A;  4ATO A;  3M55 A;  4M75 F;  3RMQ A;  1VYT A;  3H0F A;  2XIC A;  2E5K A;  3RR6 A;  3OYC A;  1Y71 A;  2QEX T;  1YJN T;  1IRE B;  1M3A A;  4DBF A;  2XDD A;  1RAB B;  2F2V A;  2DL5 A;  1YHQ Q;  2QAS A;  1Q7Y R;  4C92 D;  2JZ2 A;  1VQ6 T;  1C0M A;  4F04 B;  3GNG A;  2OAW A;  1BCO A;  1E7O A;  2HQH A;  4J9H A;  3EHQ A;  1RAA B;  1QP3 A;  3PFS A;  2RQU A;  4M78 E;  4MMK A;  1VIE A;  4J9G A;  1BKB A;  3CCQ T;  3I56 A;  3FDR A;  4J6W A;  2DET A;  2NUT B;  4CI0 C;  3I5S A;  2KSS A;  2HSE B;  4PJO E;  4UC4 A;  1VYU A;  4OVA A;  2DNU A;  1RL2 A;  4LUD A;  2RI3 A;  4PLI A;  2DBM A;  1ACM B;  1YWP A;  1VQM T;  2JS0 A;  4PJJ A;  1OX8 A;  4E6R A;  1VQN A;  5GAN 8;  3GP8 A;  3MP6 A;  2AHJ B;  2VWF A;  3PT9 A;  4X9C A;  2HEQ A;  3BDU A;  3OYL A;  2OTJ T;  2ROT A;  1GCQ A;  3EHR A;  3I55 Q;  3PIO A;  1R77 A;  3GLX A;  2CUD A;  3VUZ A;  2RJE A;  2WSC E;  3M0R A;  3EG3 A;  5L8R E;  2ROL A;  2K2M A;  1X2K A;  5I2S A;  2F5T X;  4M7A B;  1PNJ A;  1KC8 U;  2L89 A;  3HP9 A;  2DYI A;  4K11 A;  2EKO A;  2L3S A;  3CMA T;  3OYH A;  3ER0 A;  1QCO A;  2LVM A;  1BIB A;  2YRV A;  3V7C A;  2LCS A;  2D9T A;  2DLP A;  2DAQ A;  3WVE B;  2HL3 A;  3CEY A;  2ZPG B;  1AEY A;  1W6X A;  1N9S A;  2DBK A;  5IHK A;  5M9O A;  1WFW A;  4M4Z A;  2HMA A;  4B9X A;  1Q7Y U;  3OQ5 A;  1RUW A;  2IPO B;  3G4S A;  5GAO q;  2KNB B;  2A7Y A;  2ZPI B;  2MWO A;  2BZX A;  1P92 A;  2H8H A;  4XQ3 A;  4OMM A;  2GGR A;  5CQX A;  1D3B B;  1GCP A;  4RG2 A;  2P0Q A;  1NBE B;  1OZ3 A;  2HBP A;  5LJ5 f;  1X69 A;  4OB2 B;  1WX6 A;  4BI3 A;  4HCZ A;  2VXE A;  3ME9 A;  3OW2 S;  1N5Z A;  2JOY A;  4MZM A;  4RTV A;  1UHC A;  5D6Y A;  1WYX A;  1QCF A;  1Q86 C;  5IAY A;  1YIJ T;  4IUU A;  1H3Z A;  1U1S A;  1YJ9 A;  4BE0 A;  1BK2 A;  3JAM E;  1UUE A;  3RDV A;  4C0D B;  2CSQ A;  2HL5 C;  3JCM f;  4EIK A;  2EBP A;  4AG1 C;  2FPE A;  1QVG A;  4CC4 B;  4JZ3 A;  3NMZ C;  1OU8 A;  4HVU A;  4M7A E;  4M75 B;  4EMG A;  5I22 A;  4V2S A;  3E2U A;  3RUX A;  1ZUK A;  1PRL C;  2DTI A;  3I5R A;  4MZT A;  3FC3 A;  5DLO A;  2CH4 W;  3G71 A;  1YHQ A;  2D8H A;  4XU0 A;  2FRW A;  4JRK A;  1K1Z A;  2LMJ A;  4LD6 A;  1VQ4 A;  3URG A;  1SRM A;  1TSF A;  1WXB A;  3AHU A;  1EX4 A;  3OBW A;  1KQ2 A;  3OMC A;  3CCV Q;  1XJW B;  2CZ0 B;  3S3O A;  2WAC A;  3CC4 A;  5GMK h;  2AT1 B;  1R8O B;  1NPP A;  1T0H A;  3EGD B;  1OX9 A;  3G7Z A;  4C8Q G;  5HY6 A;  1I1J A;  4J7I A;  2J6F A;  1WHH A;  3I55 T;  4VUB A;  1NG2 A;  2FPD A;  2CP5 A;  2DE0 X;  1YNZ A;  4F17 A;  4R56 A;  4M7D A;  3CCL A;  2Y4X A;  2DK3 A;  4AT1 B;  3DLL A;  2K9G A;  7AT1 B;  1KD1 R;  2RHX A;  1MUZ A;  1V1C A;  3ASK A;  1K73 R;  2JMA A;  3OSV A;  2AZS A;  2K57 A;  3H9N A;  4O5V A;  5KE3 A;  3QJ6 A;  1VQ8 A;  2SRC A;  4HCC A;  4E2F B;  3RER A;  1JXM A;  1UDL A;  3JSC A;  4PKC C;  4M75 E;  3LLR A;  1IZ6 A;  5GAN 5;  4F7U F;  1A0N B;  5I2M A;  4HKE A;  4M77 G;  3EFS A;  5CKE A;  1MV3 A;  2A37 A;  1HK9 A;  3U23 A;  3IQL A;  4M78 D;  3OYD A;  9ATC B;  2QK0 A;  3NPF A;  2QGF B;  2QQB A;  4GLK A;  4XU3 A;  3MEU A;  2YHT A;  3L2Z A;  2EWN A;  2JW4 A;  3LH0 A;  1WIE A;  4ZTJ A;  4M7D F;  1TWB A;  2NWM A;  2X51 A;  4PLL A;  5KCH A;  1NYG A;  4QQD A;  3M0Q A;  2VV5 A; 
#chains in the Genus database with same CATH homology
 3G1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...