1WYXA

The crystal structure of the p130cas sh3 domain at 1.1 a resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
LNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRK-associated substrate
publication title The 1.1 A resolution crystal structure of the p130cas SH3 domain and ramifications for ligand selectivity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 12
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wyxA00
2CUBA 1VYTA 1ARKA 4JJBA 1T0JA 2EGEA 4R0KA 1E6HA 1QLYA 2FO0A 4OMNA 1WLPB 2GTJA 1J3TA 2KBTA 1Y57A 4JZ4A 2EQIA 1JO8A 2LMJA 1PRLC 1NYFA 3ZL7C 1ABQA 1NLOC 4F17A 2OAWA 2F2WA 2CT3A 4J9EA 3QWYA 2L3PA 1SSHA 2JMAA 1QKWA 1W70A 1MV3A 2M51A 4AFQC 3EG3A 2KRMA 4LUDA 1OOTA 2DMOA 2YUNA 2GNCA 2H8HA 2CSQA 3GBQA 3VS3A 2K7AA 2DJQA 3O5ZA 4RTTA 2A37A 2JS2A 1CKBA 4AG1C 1RLPC 2M0YA 1AZGB 2J05A 1GFCA 1UE9A 1ZBJA 2ROLA 4EIKA 1WYXA 2DYBA 4Z8AA 3H0FA 2KXCA 1KJWA 4RTXA 3VRYA 1YP5A 2ED1A 3I5SA 1ZUYA 4OMOA 2DL3A 3IQLA 1NG2A 1X69A 1UFFA 2L0AA 4GBQA 4Y92A 1GBRA 2DA9A 2PNIA 1BU1A 2I0NA 2B86A 3UATA 2F2VA 1RLQC 1JXOA 1T0HA 2ROTA 2KXDA 1HD3A 5IHNA 1MUZA 2K6DA 2LZ6B 4J9HA 1SRMA 5EC7A 3NPFA 5IXBA 2JM9A 4CC7A 2FPFA 1GCPA 1YWPA 3M0SA 1OPKA 2ECZA 3REAB 2A36A 1ZUKA 1VA7A 3QWXX 4F14A 2L3SA 2X3WD 4J9CA 1PHTA 5FW9A 5GJWB 1VYUA 1SHGA 2KEAA 4J9GA 5IXFA 3H0HA 1LCKA 4JZ3A 3M0RA 2JW4A 2LCSA 3VS2A 4OMQA 1K76A 3EHRA 1XOVA 1SRLA 1UECA 2K9GA 2RPNA 2AZVA 1UG1A 1I0CA 1TG0A 5I11A 1JEGA 4CC3A 2EYWA 2FPEA 2KGTA 2KNBB 2DL4A 3VS5A 4X1VA 4RTVA 1VYVA 2L2PA 3PVQA 3I35A 4Z89A 3M0QA 2PZ1A 1CKAA 1PWTA 2ED0A 4CC4B 2F2XA 2V1QA 3EGUA 1BK2A 1I07A 2RF0A 4J9DA 1E7OA 1AOJA 1NEGA 1HJDA 3LH5A 2CDTA 1QWFA 1GL5A 3THKA 1K4US 1Z9QA 2W10A 3EG1A 4LNPA 3I9QA 2JS0A 1MV0B 2LQWA 2DBMA 2W0ZA 3REBB 2DBKA 1Z9ZA 2HDAA 1X2QA 4AFUC 4DEXA 2QDLA 2O9SA 1ABOA 1UUEA 3VS7A 2BTTA 1W1FA 3NHNA 1AD5A 4D8DA 1JU5C 1G2BA 2J6OA 1T3SA 2LQNA 1UHCA 1UHFA 4RTUA 3UA6A 2EBPA 4ORZA 2O31A 2FRYA 1NEBA 2GTOA 3PE0A 5GJVB 1PNJA 1WX6A 1B3QA 1X6GA 2DILA 4J9IA 2LX7A 1OEBA 2DF6A 2JXBA 3KFVA 2DM1A 1IO6A 2FRWA 2NUZA 2HBWA 2O9VA 5FWCA 2CSIA 2K2MA 2DL5A 2FEIA 2KE9A 4FSSA 2DRKA 5ECAA 1N5ZA 4RTYA 1U3OA 1JXMA 2EYZA 1NM7A 1M30A 2CH4A 4ESRA 2EYXA 2RQUA 2YUOA 2LNHB 1AWWA 4KRTA 2MOXA 1K1ZA 4LUEA 1BB9A 2AK5A 4RUGA 2DLPA 2YUPA 1ZUUA 3FJ5A 1CSKA 3H41A 2EPDA 5IHKA 2AKLA 3VS4A 2RN8A 1G83A 2MIOA 2DL7A 2LP5A 2CREA 4AFZC 2OI3A 2HCKA 1GRIA 2P4RA 1B07A 2HSPA 4HVUA 3TSZA 3TVTA 2RMOA 1M3BA 1SHFA 2HEQA 2AKKA 2LJ0A 5L23A 1AWXA 3JV3A 1PRMC 2RNAA 1H3HA 2L3QA 2E5KA 2CT4A 2EGCA 1AEYA 3EHQA 1RI9A 2JMCA 4E6RA 4RTWA 1WDXA 2YUQA 2EW3A 1X6BA 2D8HA 3EG0A 2IIMA 1QWEA 4ZNXA 2VKNA 2J7IA 3CQTA 3M0UA 1T3LA 2KROA 2OJ2A 1WA7A 4DEYA 5IH2A 2PTKA 4J9BA 2BZ8A 2DL8A 3RBBB 3VRZA 2MCNA 1M8MA 2GQIA 3NGPA 4K11A 2AZSA 2SRCA 3ULRB 2KRSA 1K0SA 2LJ3A 1YN8A 3VS6A 1ZSGA 2O2OA 3A98A 4CC2A 3H0IA 1WIEA 3VS0A 1YWOA 2KR3A 1M3AA 4IIMA 1H92A 1TUDA 2CUDA 4JJDA 2VVKA 1U06A 2FG0A 2JM8A 4HCKA 1S1NA 1U5SA 4GLMA 1UTIA 2NWMA 4HVWA 1WFWA 3U23A 2G6FX 1GFDA 2KT1A 2JTEA 2DX1A 1Y0MA 2EVRA 3C0CA 3R6NA 1GCQA 2KRNA 4WCIA 2ENMA 1H8KA 3TSWA 2C0OA 1EFNA 1OV3A 1AVZC 1GCQC 3M0TA 1TUCA 2VWFA 2RQVA 1SEMA 2BZYA 1RUWA 4AG2C 1JQQA 4IIOA 1AWOA 1AWJA 2XMFA 1M27C 1WXUA 1KFZA 1UJYA 1WI7A 4JJCA 2C0TA 4LE9A 2KYMA 3I5RA 1GBQA 1YNZA 4A63B 2YDLA 2FPDA 2GBQA 2X3XD 2DVJA 2LJ1A 1OPLA 3VS1A 2D0NA 1QKXA 3EG2A 3M0PA 2ABLA 1A0NB 1UJ0A 1W6XA 2V1RA 2EYYA 3PVLA 3UA7A 1K0XA 4RTZA 1M3CA 4OMMA 4JPBW 2C0IA 2J6KA 4D8KA 1KIKA 2DNUA 1BBZA 4J9FA 2RQTA 2A08A 2J06A 1PKTA 2EKHA 3UF4A 2K3BA 1I1JA 2YSQA 1X27A 5FWBA 2J6FA 1QCFA 2DRMA 2KYBA 3NMZC 4Z88A 2RQRA 5HCKA 2DE0X 4OMLA 2A28A 4AFSC 2YT6A 2SEMA 1FMKA 2KT8A 5I22A 2CH4W 5IHIA 1NYGA 1YCSB 4LN2A 1UDLA 1PKSA 4F16A 1V1CA 1WXTA 1NLPC 3RNJA 1WXBA 2D8JA 4M4ZA 1UGVA 2O88A 3SHWA 2K79A 1KSWA 2GGRA 4QT7A 3SEMA 1X43A 2BZXA 1SPKA 1E6GA 1HSQA 2EGAA 2RQWA 4OMPA 1ZLMA 1K9AA 2D1XA 2JT4A 1FYNA 1ZX6A 4HXJA 4HVVA 1AZEA 1X2KA 2ESWA
chains in the Genus database with same CATH superfamily
3PTAA 4C0DC 1T0JA 4EDUA 2EGEA 2FVUA 1E6HA 1WLPB 2GFAA 2GTJA 2KBTA 2NYSA 3EFOA 3HRSA 4JZ4A 3FC3A 3V8LA 2O4XB 2V8KA 5J39A 1ABQA 4DOWA 5KYXA 3JCMW 3CEYA 4J9EA 4AFQC 1MV3A 1KQSP 2DETA 4LUDA 3UWNA 2VUBA 2GNCA 2V8JA 3JCMV 2E3IA 1OX8A 1WHGA 2HQEA 2YLBA 1M1GA 4RTTA 2A37A 2GF7A 3AHUA 1CKBA 2FB7A 4AG1C 4HKEA 1AZGB 2J05A 1GFCA 1QVFS 2COWA 2ROLA 3DLLA 2XU8A 4OB0B 4Z8AA 5A2QE 2CZ1B 4J6XA 1JB0E 3H0FA 1D1CA 3VRYA 4PJOG 4M75G 3QO3A 4BE1A 3CCQQ 4KGVB 2DXTA 3IQLA 1VQKQ 1UFFA 2L0AA 4O5VA 1WJRA 1N9RA 1WQ7A 4FIBA 4XTVA 2I0NA 5KE3A 5GAMe 2ZCFB 1U1TA 2H3EB 2NUTA 1OYXA 3GNFB 1Q82C 1YJWT 3OS0A 4J9HA 3MCAB 4XTXA 2M02A 1GCPA 1YWPA 4X9CA 4XQ3A 3REAB 2A36A 2LX9A 3QIIA 5GJWB 1SHGA 2HQHA 5LJ3j 3OYLA 5GMKi 4JZ3A 4PJOC 4M75C 3M0RA 5J3BA 4AMCA 3J81E 3S3NA 2K9GA 2OTLT 1VQ5T 2DXBA 1I0CA 2QK0A 4OP0A 1VQNA 1WHMA 3S3OA 1VQ6T 1RAGB 2EJ9A 1NPRA 2L2PA 2ED0A 5GAN5 1VQLT 1BK2A 1I07A 2RF0A 4M75F 3GLXA 3CCSA 3OW2S 5GAMh 1GL5A 3P8DA 1VQNT 1Y71A 4TVRA 4II1A 1YITQ 3EG1A 1QMCA 3CMAA 3C4SA 2M9UA 2LQWA 2W0ZA 1UB4A 3MP1A 1XNIA 3ER0A 3MPUB 2B8AA 5GAN8 1IB8A 3BE3A 1K8AR 4CRIA 2E1HA 2RJCA 1VQ8T 1AD5A 1BCOA 1JU5C 4JLIA 2CKKA 1G2BA 2QTVA 2J6OA 1H3ZA 1G5VA 1OU9A 1X01A 4MDXA 1TOVA 4ORZA 2FRYA 1VQOA 2OTJA 2DILA 2LX7A 5GAOr 4N4GA 1MNEA 1K9MR 3CC7A 2HBWA 2CSIA 2K2MA 1VQOT 2RI2A 2P0PA 4FSSA 3LWHA 3OYEA 2JVVA 2R5MA 2F1LA 1JXMA 3E9FA 5I2SA 1IXDA 3OA6A 5CR2A 1WJSA 1P92A 4PFZA 4BY6B 3CCJA 3WVEB 1AWWA 1K1ZA 2AK5A 1ACMB 4V2SA 1BCMA 3S3MA 3FJ5A 2HKQB 4WF2A 5IHKA 2K5IA 3CCUA 5LJ5e 4FYYB 1M1KU 2HCKA 4FW2A 3JCMg 4FM4B 3TSZA 3TVTA 2RD1A 2RMOA 3CCJT 4RCCA 1JRIA 2LJ0A 5LJ3g 3JV3A 4JRIA 1PRMC 4M78A 3OSSC 1H3HA 4EMGA 2CT4A 1KC8R 1K8AC 3RR6A 4ZGEB 1AEYA 3CCUT 1M8VA 5GANd 5J26A 2DAQA 5DM7R 1VIEA 2R5AA 4BB7A 1PSFA 5LJ3f 4OB3B 3EG0A 1MMAA 4E47A 1JJ2P 3OYDA 1QWEA 4C0GA 5D6YA 5KCHA 3CMEA 1IHWA 1KQ2A 2VB6A 2RHXA 1WGSA 2L3RA 2DL8A 3VRZA 2ZPIB 3QZ9B 3NGPA 2AZSA 2MK5A 4F7UA 1Q86R 1WQWA 3CMET 9ATCB 5DLQE 3CCRA 2O2OA 1AHJB 1RI0A 4KGXB 2E10A 5GANh 3I55T 3NTIA 5HY6A 1X6OA 4M77B 3PNWC 2FG0A 4PNOA 4HCKA 1S1NA 4GLMA 1UTIA 4HVWA 1XQHA 4KBMB 2P0QA 3CCMT 4QQDA 3A8HB 3R6NA 2KRNA 2YHTA 4LDYA 4QW2A 2C0OA 3GP8A 1YIJT 1H641 1I4K1 1TUCA 1KC8C 1SEMA 4A4HA 2LRQA 1Q82U 1AWJA 4M7DB 4PJOE 2EFIA 2C0TA 3VUBA 4XTWA 4M78E 5EG2A 3L2VA 4A63B 1YJWQ 2YDLA 2GBQA 2DVJA 5KH6A 4KUDK 1D3BB 1IZ6A 1B34B 2DTHA 2LJ1A 3QDRB 3VV0A 2EJGA 3VS1A 3HRTA 4VUBA 2FZGB 1R0CB 2ABLA 1UJ0A 1Q86C 4A4GA 1WZOA 5M9OA 3LYIA 2LDMA 1U8RA 1N9SA 3ME9A 4OMMA 4JPBW 3GOXA 4D8KA 3DB3A 4J9FA 5KYUA 1KQ1A 1PKTA 2K3BA 2EQUA 2DTOA 1VQ5Q 2YSQA 2X4JA 3E2UA 1Q7YC 2KYBA 4Z88A 3RUXA 1BKBA 1BI1A 1VQ6Q 2RM4A 4FU6A 2DE0X 5GAMg 2CP6A 2KT8A 3V7SA 5IHIA 3TQ7P 1NYGA 1VQNQ 4A54A 1YCSB 5LJ5j 4LN2A 5D6XA 1WXTA 5FU7B 3RNJA 2K79A 3ZEHA 3OYFA 2EQJA 2HL5C 4QT7A 1X43A 2BZXA 2MMPA 1SPKA 4PLLA 4YTLA 1E6GA 1RL2A 2EGAA 2NLUA 1R0BG 1QW1A 4F7UB 2E65A 2FHDA 1WHLA 2D1XA 2VASA 1VQ8Q 4HXJA 2QASA 1AZEA 4PJLA 2CUBA 2XDPA 3RIRA 4RCBA 2BE7D 2EAYA 4R0KA 4DBFA 1QLYA 2FO0A 4CI0C 1YITA 1F1BB 2QEXA 4JDSA 2X9HA 1J3TA 4C8QB 3UDCA 2O4XA 2EQIA 3OY9A 2ZZDA 4JS4A 2LMJA 3SD4A 1NJIC 3ZL7C 3EFRA 2OAWA 1VQOQ 3QWYA 2L3PA 4A4KA 1QKWA 1YCYA 2QEXT 4IUPA 3EG3A 1LVKA 4N4IA 4XU2A 2KRMA 5FU6B 1OOTA 4JJNK 2DMOA 2YUNA 3MEUA 2AT1B 4QKUA 1TSFA 2FL7A 2LVMA 2DPPB 1G3WA 3EGDB 3X26B 3J80E 4PJNA 1RLPC 2E3HA 2D0QB 1UE9A 3V7CA 4C8QD 1WYXA 1VQMA 5IT9E 1K8AU 3CCJQ 5CK9A 1KJWA 4RTXA 2OX7A 2QG9B 1YJNT 3L2RA 1ZUYA 4OMOA 3RERA 3CCUQ 1X69A 4GBQA 2PNIA 2CP0A 2B86A 3H9NA 3JCMd 1Q81R 1JXOA 4BY6C 2XICA 1T0HA 4J6YA 5IHNA 3V8JA 1K9MU 4GY5A 5EC7A 2JM9A 3M0SA 4KULA 1W2BP 1M90U 2V26A 1JBMA 3QWXX 4F14A 2L3SA 2X3WD 4J9CA 4OB2B 2KEAA 5LJ5g 3CMEQ 2LCSA 3CPWP 5GMKh 3VS2A 1K76A 5KCOA 1XOVA 1SRLA 2K5LA 3NTHA 3MJXA 2RPNA 3I55Q 2AZVA 3SB2A 1TG0A 3JCMh 2X51A 2ZPEB 2CP3A 4CC3A 4FYVB 5LJ3h 2PZ1A 4LDXA 3O8VA 3FIFA 2XIDA 4LDVA 3CCMQ 5D6WA 1SSFA 1E7OA 1AOJA 3LH5A 1KC8U 2CDTA 1Q82R 1QWFA 3NTKA 3KBGA 3QHSA 2RHIA 3WXMB 1Z9QA 1KQSA 3EH1A 1DJ7B 4HVVA 3CBOA 4LXCA 4LD9K 1MMNA 3A8LB 3M56A 3GNGA 4B6MA 2HDAA 3CD6T 4C92B 4PKCC 1PCXA 4AFUC 2G3RA 1Q81C 2QDLA 2O9SA 2RA2A 1UUEA 4FYXB 2D6FA 2DKGA 2E5QA 2ZGWA 2VXEA 1JJ2S 3OYNA 1QVPA 4ELYC 3CCEA 2LQNA 1TTHB 4RG2A 4XU3A 4DBRA 3HL8A 4RTUA 2MPXC 1Q86U 5GAN2 1G8XA 5I21A 4GLKA 1NEBA 3JB9D 2AIRB 3CPFA 3VUZA 4L6V5 4ATOA 3CC2T 1NZ9A 3CCET 3KFVA 5A0GA 2DM1A 1VQ4T 2Y4XA 2FRWA 2NUZA 2O9VA 3N5BB 2DFUA 1KHCA 3LX7A 3SFMA 3DB4A 1YJWA 4ANJA 4M78G 1U3OA 1OQKA 1NM7A 4ZN1A 2YUOA 4JS5A 3M53A 3FEOA 3PIOA 4LUEA 1QCOA 4M7AB 1ZUUA 1CSKA 5FRNA 3H41A 4UC4A 1AT1B 3MP8A 3OYAA 1G83A 2MIOA 2LP5A 1VQPA 3ASKA 5GAMd 1RAHB 2X4WA 1GRIA 4A4FA 2OTLA 2LT1A 1VQ5A 3EG9B 2XDDA 1M3BA 1AWXA 1VQ6A 4F7UG 4XK8E 3MKDA 4M78C 2K5FA 2LCCA 4E6RA 4RTWA 1D1AA 1WDXA 1VQLA 1VQPT 2QQAA 1C6VX 5FROA 2DXUA 3EFSA 3L2WA 2VKNA 3OYMA 2J7IA 3CQTA 3M0UA 1T3LA 4M7AD 3QPHA 2F5KA 4DEYA 4XU1A 5IH2A 4HCCA 2PTKA 4PJOF 2BZ8A 1LOJA 4NS5A 3RBBB 4M78F 3A8OB 3P8BB 2MCNA 2DK3A 2MF2A 1M1FA 2JN0A 2I2LA 1IRXA 3L42A 4EPCA 2SRCA 5GAN6 2E6ZA 2KRSA 1K0SA 2HBPA 3LGFA 2QEXQ 1ZSZB 2YRCA 5HKCA 1VQ8A 1BI2A 1Y7XA 3VS6A 1ZSGA 3UPUA 3A98A 4XTUA 1UGQB 1SKUB 1WIEA 3VS0A 3VJPA 4J7IA 1YWOA 4M77A 3MEAA 5KYWA 2CUDA 5KYNA 2DO3A 2VVKA 1U06A 3RMSA 3KUFA 3JAME 1U5SA 4R55A 4R56A 4C8QC 1QVGP 5A0LA 2PUOB 2G6FX 2RJFA 1GFDA 2DX1A 2ZPBB 1GCQA 4WCIA 1QP2A 2LQKA 2WSFE 4MDWA 1EFNA 2LTOA 2Z0WA 1AVZC 4FL6A 3CXCP 2WACA 4IIOA 4JRKA 1HXDA 4NL2A 1YBYA 2XMFA 3HFOA 1WXUA 1VQMQ 4M7DA 1KFZA 1WJQA 4OB1B 1UJYA 1WI7A 2XK0A 4QQ6A 3OMCA 1D3BA 1B34A 1WHJA 3FB9A 1MGQA 3M4GA 1EZZB 1ZBXA 2D0NA 1FWZA 2EQKA 1UGRB 1YFNA 3CCVT 4JRPA 5GAOl 3UA7A 2X4YA 1K0XA 4RTZA 3MHXA 4C5HA 1TU0B 2DVEA 1KIKA 1M9SA 1VUBA 1I81A 2J06A 3OYKA 4PK4A 1NE8A 1JJ2A 3M9QA 3FRNA 2MAMA 8ATCB 1QCFA 2DRMA 2RQRA 2RHUA 4FSXA 1D0YA 4OMLA 4ZGDB 3QDFA 3MO8A 3OYBA 2SEMA 3QXEB 5I22A 4XTZA 2COYA 2EIFA 3C95A 4M77E 5GAN7 2XD0A 3MEVA 3JB9G 3NFCA 3G6ET 1PKSA 1NLPC 1WXBA 1Q81U 2EQMA 2O01E 4IKFA 1KSWA 3I55A 2GGRA 3CD6Q 2DZCA 3T9NA 4C0FA 4E2FB 1RAIB 2DERA 1K9AA 1PC0A 2LT4A 5LJ5h 4C0DB 3QSUA 3CCMA 2KVQG 3QUIA 1VYTA 3L2UA 3F70A 1ARKA 4JJBA 2DJZA 4M7DE 1Q7YR 4BI3A 5KYWB 2LNVA 1YHQA 1QVFP 1YIJA 2BE9B 2WSEE 4C8QA 1SF9A 3URGA 4MZTA 4DQ2A 1YI2T 4IUQA 3CC2Q 4D6WA 3CCEQ 4B9WA 1PRLC 1BIAA 3OS5A 1NYFA 1VQ4Q 2QGGA 1NLOC 4PJMA 1BYMA 1NBEB 2A3LA 1YHQT 1HYOA 4KT0E 2XI9A 1SSHA 1W70A 2RHYA 5GMKm 2E64A 2PVDB 1FMWA 2IG0A 3JB9F 4EMHA 1VQ9T 3VS3A 3A8MB 2K7AA 3OYCA 3R6OA 3EGDA 4M77D 2JUFA 4C5GA 2JS2A 4J8OA 3G4SA 2R57A 4ELZC 1ZBJA 3SWNA 4J83A 2DYBA 2MYSA 2FZCB 3UT1A 2HZYA 2CS7A 2JTFA 1YP5A 4E7HA 3I5SA 3G4ST 2DL3A 1VQPQ 1NJIR 1BU1A 1M2VB 3G7ZA 2F2VA 1KQSS 1RLQC 2OTLQ 4MZPA 2LQ8A 1IGUA 4QQGA 3LW5E 4N0AA 4F7UE 4M7DD 2ROTA 1LNXA 1WNLA 2HD0A 1B7TA 2K6DA 3OW2P 1V29B 1SRMA 3LLRA 3NPFA 4M7AC 2FPFA 5CKEA 1VQLQ 1OPKA 3OS2A 5FW9A 5C0MA 2CP5A 4M75B 2E41A 3SDZA 4C8QE 3CC4A 1PG5B 2JW4A 4E7IA 4OMQA 1KD1R 1UECA 3META 1RADB 2E12A 1UG1A 4XTYA 5I11A 1S72T 2EYWA 2FPEA 1M4ZA 1G3SA 2CYZB 2E4HA 2DL4A 4X1VA 2CZ6B 4Y91A 3CC4T 3PVQA 3I35A 4Z89A 3M0QA 3HKSA 1CKAA 1PWTA 3JCMJ 4E7ZA 5GANj 2V1QA 3EGUA 2IVWA 3QJYA 2P0KA 1OU8A 1PSEA 2QA4T 5CKFA 3THKA 1K4US 5GAN4 4A4EA 2W10A 1D0ZA 3HRUA 2VV5A 2VGNA 4BE2A 3X28B 3REBB 2DBKA 2QQBA 1Z9ZA 4C92A 3LGLA 3PMIA 2K3XA 1ABOA 5CCAA 2CZ0B 1I5LA 5GAOm 3C94A 2ZPGB 1UHCA 1UHFA 2O31A 3EGXA 2GTOA 4HT9A 3PE0A 5GJVB 1YJNA 1PNJA 1WX6A 1B3QA 1X6GA 3OS1A 3CCVQ 1YJ9T 3QKJA 1QCNA 2DF6A 2JXBA 1IO6A 3SWNB 1N27A 1KD1C 3RESA 2GQVA 5FWCA 2DL5A 3QZ5B 4QVDA 3M57A 2RJEA 2EKOA 4RTYA 2EYZA 2ATCB 4HT8A 1M30A 1W2BA 4ESRA 2EYXA 2CZ7B 4N4HA 2VYTA 1G3TA 2MOXA 4OGCA 5LJ3d 1W4SA 4M7AA 4RUGA 2YUPA 4J6WA 3G6EQ 3CPWA 3E1SA 1RAFB 3G71A 3VS4A 5KE2A 2K3YA 2DL7A 1OZ2A 2QGFB 4LDWA 2R58A 4BACA 1B07A 2D9TA 2HSPA 3EG9A 2DZ9A 2HEQA 2AKKA 2Y4YA 4BE0A 2RNAA 3H6ZA 2E5KA 4KH0B 4BUGA 3G71T 3EHQA 1RI9A 2JMCA 1FX7A 2JZ2A 4KH1B 4C92E 3ZFJA 1VIFA 4BI4A 2IIMA 4E7KA 1NPPA 4HCBA 4M77G 2BIVA 4OMFB 4Y28E 2KROA 2HKNA 2OJ2A 3RKWA 3HSBA 2DEUA 1YI2Q 4J9BA 1VQ7A 4X9DA 3CD6A 2GQIA 4K11A 2KK4A 1YHQQ 4E7SA 1OI1A 1ZSZA 4BI8B 5GANf 1YIJQ 4B9XA 3CCLT 1YN8A 2HQXA 2HAXA 4BD3A 3L2ZA 4CC2A 3H0IA 1R8OB 5D7UA 1KG1A 3JB9J 1VQ7T 4P5NA 2EYQA 2KR3A 1M3AA 1VQ9Q 5FRMA 1H92A 4WTOB 1TUDA 3CBMA 4JLGA 4M7DG 3LH0A 3BDUA 4M77C 1N8RR 3TREA 1Y96B 1Q95G 1RAEB 1WFWA 3CC2A 1KHIA 1VQ4A 1I5OB 2KT1A 1SG5A 1Y0MA 2EVRA 3C0CA 4ZTFA 5CQYA 2RI3A 3M59A 2ENMA 2K4YA 1OV3A 1D0XA 4M7AE 3EGXB 3JSCA 1GCQC 3CBPA 2F5TX 6AT1B 2RQVA 4PLIA 4EMKB 3JCMc 3G4SQ 2QXFA 2P4TA 3OB9A 5IN1A 1ZA1B 4M77F 1RUWA 1QP3A 1Q7YU 1JQQA 2DEQA 1AWOA 3VKIA 1M27C 2KI7A 4JJCA 4FW1A 4C92D 3I5RA 1GBQA 4M7DC 1YNZA 3Q1JA 2X4XA 1MNDA 2M16A 2FPDA 2RO0A 2Y90A 3M4YA 3X20B 2HSEB 2XHCA 2CP2A 1OPLA 4FCYA 2M0OA 2QTXA 3RMQA 4ZGJB 2BUDA 1TWBA 1QKXA 3EG2A 1A0NB 3JCMb 4E7JA 5GMKl 4QVCA 3BDLA 4X34A 4M7DF 3M5AA 1BBZA 2RQTA 2A08A 3OSVA 4OVAA 3UF4A 1K73R 1X27A 2J6FA 1S72Q 5GMKj 1N8RC 4DBHA 3CC4Q 4C5EA 5CVIA 2A28A 4OF1A 4AFSC 2YT6A 3FJPA 5CKBA 2A0FB 2JTMA 2CH4W 1FXXA 3HHTB 2HMAA 2QA4Q 2IPOB 2QYZA 1UDLA 4JRQA 1V1CA 1ZA2B 5CKDA 1OULA 4C8QG 1NJIU 5KYYB 2D8JA 3PGGA 3QJ6A 4M4ZA 3S6WA 5FU7C 2O88A 2DIGA 3VYHB 2C06A 3OYYA 1ZLMA 3HTRA 3OBYA 2JT4A 1ZX6A 1X2KA 1QVGA 1EX4A 2GFUA 3DKMA 1TUGB 2E70A 4OMNA 3X24B 1YJ9Q 3CXCA 3E19A 4C0ZA 5I2MA 1KD1U 3M55A 1Y57A 1JO8A 3EFOB 4F7UF 2K2VA 3CCST 4F17A 1K73C 2F2WA 2P84A 5KYXB 3HPWA 2CT3A 2JMAA 1YJNQ 2M51A 3V7RA 1RAAB 2PUKB 3CMAT 5C6SA 1MMGA 2QAZA 5CAIA 1XJWB 5FU6C 3RKYA 2V8IA 2H8HA 2WSCE 2CSQA 2E6NA 3GBQA 2M1HA 3OYGA 4ZTJA 4C8QF 2DJQA 2GCXA 3CCVA 2XG8D 3O5ZA 1Y07A 1N6AA 4FT2A 2M0YA 4EIKA 2DIQA 4LDUA 2L89A 3SWNC 1V76A 1R77A 4IUUA 2KXCA 4O6JA 2OTJT 2RHZA 2ED1A 7AT1B 2KY9A 3G71Q 1NG2A 2PU9B 1M2VA 4Y92A 3QBYA 1GBRA 2DA9A 1X75C 2BKDN 3UATA 4J5YA 2YWWA 3CC7T 4IURA 2RJDA 4FT4A 5LJ5d 2KXDA 1HD3A 2NUTB 3G6EA 1MUZA 2LZ6B 4N0AC 8AT1B 5IXBA 4CC7A 1RABB 2XDBA 2ECZA 4IUVA 5CQXA 1ZUKA 5GANe 1M90R 2L8DA 1VA7A 1PHTA 4PJOA 1VYUA 3VYGA 3M54A 1MHNA 4J9GA 4M75A 1G3YA 5IXFA 2RB6A 3H0HA 1LCKA 3HP9A 3CCLQ 2L5QA 3E9GA 2DXCA 1UGPB 3JCMf 3QYGB 1U1SA 1FMVA 3EHRA 2JOYA 5GAMj 1VQ7Q 4KUIA 5GAOn 1QVFA 4C92G 2LCLA 3PFSA 1JEGA 3DLMA 2KGTA 2KNBB 5AT1B 2RK1A 3VS5A 4RTVA 1VYVA 3D7SB 1D1BA 4CC4B 3WVDB 1M2OA 1YI2A 3I56A 2F2XA 3RDVA 4J9DA 3G1JA 4XU0A 4A53A 4JUVA 4IUTA 1NEGA 1HJDA 1K9MC 4LNPA 1W2BS 4J7FA 5L8RE 3BFMA 2RI5A 3I9QA 2JS0A 2NUPA 1ZQ1A 1MV0B 3I56T 4MMLA 2DBMA 1VQ9A 1M5Q1 1X2QA 3JCMP 3JRZA 4DEXA 3CPWS 4C92C 1WPYA 3J7AF 3VS7A 2BTTA 1W1FA 3NHNA 1RACB 2K57A 4D8DA 3CCRT 3EAEA 1PD1A 1T3SA 5CO7A 2JJ9A 1EIFA 4L59A 4PJJA 3UA6A 2EBPA 2PVGB 1ZHIA 1M90C 5HK3A 3OBWA 2ZPFB 4BDZA 5FLXE 4J9IA 4M7AG 3VU3C 4HCZA 4C92F 3GPLA 2LC4A 1OEBA 4EMKC 4ZN3A 1PM3A 3L1AA 2MI6A 1QQJA 2KMTA 4PFOA 2FEIA 1N8RU 2KE9A 4M75E 2DRKA 5GAN3 2H3JA 2QI2A 3OW2A 5ECAA 4DBQA 1N5ZA 5CIUA 2KSSA 3TCJA 3OYIA 3M58A 2CH4A 3KXTA 3EH2A 5AYFA 1TXQA 2RQUA 3JCMX 2LNHB 4KRTA 1BB9A 4HA8A 2DLPA 3CCQA 1TS9A 2EPDA 1VQKA 2AKLA 2RN8A 3GF5A 4NOYA 1WHHA 2JNGA 2CREA 4AFZC 2OI3A 2P4RA 4HVUA 2YLCA 2F69A 1SHFA 1S72A 5L23A 4PJOB 2L3QA 3C12A 3CCQT 3TU4K 4M78B 5GAOp 2EGCA 1VQKT 1IGQA 2CP7A 1XTDA 2QQRA 2YUQA 2EW3A 1X6BA 4AT1B 5HK0A 2D8HA 4M7AF 5DLOA 2YRDA 3RKXA 4C5IA 2QA4A 4XAXB 4LD6A 4ZNXA 4F04B 2VGMA 1UGSB 2PVOB 5GAMf 1D09B 3A5ZB 4OGEA 4NL3A 1WA7A 1PD0A 3V8KA 2AHJB 1LPLA 1K73U 1OZ3A 2A7YA 2KAFA 3OYJA 1M8MA 3CCSQ 2YXYA 2HL3A 1O75A 1I8FA 3ULRB 3P8HA 2LJ3A 4PJOD 4M75D 2VC8A 3CMAQ 4M78D 5IAYA 2NUPB 1ZSZC 4IIMA 2FYKA 4JJDA 2EJFA 1IHVA 4MZMA 2QQ9A 1YJ9A 2JM8A 1Y96A 4L5GA 4ME7A 2NWMA 1UEBA 4MMKA 1TH7A 3U23A 2COZA 2FZKB 1C1AA 3MP6A 2KDSA 3JB9H 2JTEA 2EWNA 4DOVA 1H8KA 4E7LA 1O9SA 3TSWA 1GXIE 1YITT 2OTJQ 3OMGA 3M0TA 4EMKA 4BDYA 4PL6A 2VWFA 3L2QA 2XKOC 2BZYA 2DD4A 1OX9A 2DTIA 2QDYB 4AG2C 1BI3A 2OAUA 4QVZA 3AT1B 4RKUE 1M1KR 3CC7Q 1C0MA 4LE9A 2KYMA 2ZAEA 5LL6S 3QG1A 3LWIA 3HFNA 5CKHA 2X3XD 4PFPA 5GMKe 3JB9I 5DY9A 3BW1A 3GIBA 3M0PA 3JCMe 1QVGS 1W6XA 2RH2A 1HK9A 2EYYA 2V1RA 3PVLA 1BIBA 5GAOq 5LJ3e 1M3CA 3MEWA 4RMOA 2C0IA 2J6KA 4FYWB 2DNUA 1VQMT 2EKHA 5KYUB 3INZA 1I1JA 3CXCS 5FWBA 4Q5WA 3FDRA 3NMZC 2DYIA 4DA4A 2CGHA 3A1PA 5HCKA 3H8ZA 1MMDA 2YRVA 4RG8A 4Z02A 3FLGA 1FMKA 2RK2A 3TEEA 2KQWA 3BY7A 2MWPA 2ZPHB 3PT9A 5A0DA 3PMTA 3CCLA 3PIPA 4F16A 2HNIA 5KYYA 5GANg 3OYHA 3I56Q 1UGVA 3SHWA 1VOMA 2DD5A 3SEMA 3JCMQ 1IREB 3OQ5A 1LJOA 3QYHB 5LJ5f 3X25B 1HSQA 2RQWA 4OMPA 1M1KC 2QQSA 3A8GB 1FYNA 1KK7A 2PQWA 2MWOA 3ZBDA 2X35A 1WHKA 3CCRQ 2VXFA 1BI0A 4KGZB 2ESWA
chains in the Genus database with same CATH topology
2CUBA 1VYTA 1ARKA 4JJBA 1T0JA 2EGEA 4R0KA 1E6HA 1QLYA 2FO0A 4OMNA 1WLPB 2GTJA 1J3TA 2KBTA 1Y57A 4JZ4A 2EQIA 1JO8A 2LMJA 1PRLC 1NYFA 3ZL7C 1ABQA 1NLOC 4F17A 2OAWA 2F2WA 2CT3A 4J9EA 3QWYA 2L3PA 1SSHA 2JMAA 1QKWA 1W70A 1MV3A 2M51A 4AFQC 3EG3A 2KRMA 4LUDA 1OOTA 2DMOA 2YUNA 2GNCA 2H8HA 2CSQA 3GBQA 3VS3A 2K7AA 2DJQA 3O5ZA 4RTTA 2A37A 2JS2A 1CKBA 4AG1C 1RLPC 2M0YA 1AZGB 2J05A 1GFCA 1UE9A 1ZBJA 2ROLA 4EIKA 1WYXA 2DYBA 4Z8AA 3H0FA 2KXCA 1KJWA 4RTXA 3VRYA 1YP5A 2ED1A 3I5SA 1ZUYA 4OMOA 2DL3A 3IQLA 1NG2A 1X69A 1UFFA 2L0AA 4GBQA 4Y92A 1GBRA 2DA9A 2PNIA 1BU1A 2I0NA 2B86A 3UATA 2F2VA 1RLQC 1JXOA 1T0HA 2ROTA 2KXDA 1HD3A 5IHNA 1MUZA 2K6DA 2LZ6B 4J9HA 1SRMA 5EC7A 3NPFA 5IXBA 2JM9A 4CC7A 2FPFA 1GCPA 1YWPA 3M0SA 1OPKA 2ECZA 3REAB 2A36A 1ZUKA 1VA7A 3QWXX 4F14A 2L3SA 2X3WD 4J9CA 1PHTA 5FW9A 5GJWB 1VYUA 1SHGA 2KEAA 4J9GA 5IXFA 3H0HA 1LCKA 4JZ3A 3M0RA 2JW4A 2LCSA 3VS2A 4OMQA 1K76A 3EHRA 1XOVA 1SRLA 1UECA 2K9GA 2RPNA 2AZVA 1UG1A 1I0CA 1TG0A 5I11A 1JEGA 4CC3A 2EYWA 2FPEA 2KGTA 2KNBB 2DL4A 3VS5A 4X1VA 4RTVA 1VYVA 2L2PA 3PVQA 3I35A 4Z89A 3M0QA 2PZ1A 1CKAA 1PWTA 2ED0A 4CC4B 2F2XA 2V1QA 3EGUA 1BK2A 1I07A 2RF0A 4J9DA 1E7OA 1AOJA 1NEGA 1HJDA 3LH5A 2CDTA 1QWFA 1GL5A 3THKA 1K4US 1Z9QA 2W10A 3EG1A 4LNPA 3I9QA 2JS0A 1MV0B 2LQWA 2DBMA 2W0ZA 3REBB 2DBKA 1Z9ZA 2HDAA 1X2QA 4AFUC 4DEXA 2QDLA 2O9SA 1ABOA 1UUEA 3VS7A 2BTTA 1W1FA 3NHNA 1AD5A 4D8DA 1JU5C 1G2BA 2J6OA 1T3SA 2LQNA 1UHCA 1UHFA 4RTUA 3UA6A 2EBPA 4ORZA 2O31A 2FRYA 1NEBA 2GTOA 3PE0A 5GJVB 1PNJA 1WX6A 1B3QA 1X6GA 2DILA 4J9IA 2LX7A 1OEBA 2DF6A 2JXBA 3KFVA 2DM1A 1IO6A 2FRWA 2NUZA 2HBWA 2O9VA 5FWCA 2CSIA 2K2MA 2DL5A 2FEIA 2KE9A 4FSSA 2DRKA 5ECAA 1N5ZA 4RTYA 1U3OA 1JXMA 2EYZA 1NM7A 1M30A 2CH4A 4ESRA 2EYXA 2RQUA 2YUOA 2LNHB 1AWWA 4KRTA 2MOXA 1K1ZA 4LUEA 1BB9A 2AK5A 4RUGA 2DLPA 2YUPA 1ZUUA 3FJ5A 1CSKA 3H41A 2EPDA 5IHKA 2AKLA 3VS4A 2RN8A 1G83A 2MIOA 2DL7A 2LP5A 2CREA 4AFZC 2OI3A 2HCKA 1GRIA 2P4RA 1B07A 2HSPA 4HVUA 3TSZA 3TVTA 2RMOA 1M3BA 1SHFA 2HEQA 2AKKA 2LJ0A 5L23A 1AWXA 3JV3A 1PRMC 2RNAA 1H3HA 2L3QA 2E5KA 2CT4A 2EGCA 1AEYA 3EHQA 1RI9A 2JMCA 4E6RA 4RTWA 1WDXA 2YUQA 2EW3A 1X6BA 2D8HA 3EG0A 2IIMA 1QWEA 4ZNXA 2VKNA 2J7IA 3CQTA 3M0UA 1T3LA 2KROA 2OJ2A 1WA7A 4DEYA 5IH2A 2PTKA 4J9BA 2BZ8A 2DL8A 3RBBB 3VRZA 2MCNA 1M8MA 2GQIA 3NGPA 4K11A 2AZSA 2SRCA 3ULRB 2KRSA 1K0SA 2LJ3A 1YN8A 3VS6A 1ZSGA 2O2OA 3A98A 4CC2A 3H0IA 1WIEA 3VS0A 1YWOA 2KR3A 1M3AA 4IIMA 1H92A 1TUDA 2CUDA 4JJDA 2VVKA 1U06A 2FG0A 2JM8A 4HCKA 1S1NA 1U5SA 4GLMA 1UTIA 2NWMA 4HVWA 1WFWA 3U23A 2G6FX 1GFDA 2KT1A 2JTEA 2DX1A 1Y0MA 2EVRA 3C0CA 3R6NA 1GCQA 2KRNA 4WCIA 2ENMA 1H8KA 3TSWA 2C0OA 1EFNA 1OV3A 1AVZC 1GCQC 3M0TA 1TUCA 2VWFA 2RQVA 1SEMA 2BZYA 1RUWA 4AG2C 1JQQA 4IIOA 1AWOA 1AWJA 2XMFA 1M27C 1WXUA 1KFZA 1UJYA 1WI7A 4JJCA 2C0TA 4LE9A 2KYMA 3I5RA 1GBQA 1YNZA 4A63B 2YDLA 2FPDA 2GBQA 2X3XD 2DVJA 2LJ1A 1OPLA 3VS1A 2D0NA 1QKXA 3EG2A 3M0PA 2ABLA 1A0NB 1UJ0A 1W6XA 2V1RA 2EYYA 3PVLA 3UA7A 1K0XA 4RTZA 1M3CA 4OMMA 4JPBW 2C0IA 2J6KA 4D8KA 1KIKA 2DNUA 1BBZA 4J9FA 2RQTA 2A08A 2J06A 1PKTA 2EKHA 3UF4A 2K3BA 1I1JA 2YSQA 1X27A 5FWBA 2J6FA 1QCFA 2DRMA 2KYBA 3NMZC 4Z88A 2RQRA 5HCKA 2DE0X 4OMLA 2A28A 4AFSC 2YT6A 2SEMA 1FMKA 2KT8A 5I22A 2CH4W 5IHIA 1NYGA 1YCSB 4LN2A 1UDLA 1PKSA 4F16A 1V1CA 1WXTA 1NLPC 3RNJA 1WXBA 2D8JA 4M4ZA 1UGVA 2O88A 3SHWA 2K79A 1KSWA 2GGRA 4QT7A 3SEMA 1X43A 2BZXA 1SPKA 1E6GA 1HSQA 2EGAA 2RQWA 4OMPA 1ZLMA 1K9AA 2D1XA 2JT4A 1FYNA 1ZX6A 4HXJA 4HVVA 1AZEA 1X2KA 2ESWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUB A;  1VYT A;  1ARK A;  4JJB A;  1T0J A;  2EGE A;  4R0K A;  1E6H A;  1QLY A;  2FO0 A;  4OMN A;  1WLP B;  2GTJ A;  1J3T A;  2KBT A;  1Y57 A;  4JZ4 A;  2EQI A;  1JO8 A;  2LMJ A;  1PRL C;  1NYF A;  3ZL7 C;  1ABQ A;  1NLO C;  4F17 A;  2OAW A;  2F2W A;  2CT3 A;  4J9E A;  3QWY A;  2L3P A;  1SSH A;  2JMA A;  1QKW A;  1W70 A;  1MV3 A;  2M51 A;  4AFQ C;  3EG3 A;  2KRM A;  4LUD A;  1OOT A;  2DMO A;  2YUN A;  2GNC A;  2H8H A;  2CSQ A;  3GBQ A;  3VS3 A;  2K7A A;  2DJQ A;  3O5Z A;  4RTT A;  2A37 A;  2JS2 A;  1CKB A;  4AG1 C;  1RLP C;  2M0Y A;  1AZG B;  2J05 A;  1GFC A;  1UE9 A;  1ZBJ A;  2ROL A;  4EIK A;  1WYX A;  2DYB A;  4Z8A A;  3H0F A;  2KXC A;  1KJW A;  4RTX A;  3VRY A;  1YP5 A;  2ED1 A;  3I5S A;  1ZUY A;  4OMO A;  2DL3 A;  3IQL A;  1NG2 A;  1X69 A;  1UFF A;  2L0A A;  4GBQ A;  4Y92 A;  1GBR A;  2DA9 A;  2PNI A;  1BU1 A;  2I0N A;  2B86 A;  3UAT A;  2F2V A;  1RLQ C;  1JXO A;  1T0H A;  2ROT A;  2KXD A;  1HD3 A;  5IHN A;  1MUZ A;  2K6D A;  2LZ6 B;  4J9H A;  1SRM A;  5EC7 A;  3NPF A;  5IXB A;  2JM9 A;  4CC7 A;  2FPF A;  1GCP A;  1YWP A;  3M0S A;  1OPK A;  2ECZ A;  3REA B;  2A36 A;  1ZUK A;  1VA7 A;  3QWX X;  4F14 A;  2L3S A;  2X3W D;  4J9C A;  1PHT A;  5FW9 A;  5GJW B;  1VYU A;  1SHG A;  2KEA A;  4J9G A;  5IXF A;  3H0H A;  1LCK A;  4JZ3 A;  3M0R A;  2JW4 A;  2LCS A;  3VS2 A;  4OMQ A;  1K76 A;  3EHR A;  1XOV A;  1SRL A;  1UEC A;  2K9G A;  2RPN A;  2AZV A;  1UG1 A;  1I0C A;  1TG0 A;  5I11 A;  1JEG A;  4CC3 A;  2EYW A;  2FPE A;  2KGT A;  2KNB B;  2DL4 A;  3VS5 A;  4X1V A;  4RTV A;  1VYV A;  2L2P A;  3PVQ A;  3I35 A;  4Z89 A;  3M0Q A;  2PZ1 A;  1CKA A;  1PWT A;  2ED0 A;  4CC4 B;  2F2X A;  2V1Q A;  3EGU A;  1BK2 A;  1I07 A;  2RF0 A;  4J9D A;  1E7O A;  1AOJ A;  1NEG A;  1HJD A;  3LH5 A;  2CDT A;  1QWF A;  1GL5 A;  3THK A;  1K4U S;  1Z9Q A;  2W10 A;  3EG1 A;  4LNP A;  3I9Q A;  2JS0 A;  1MV0 B;  2LQW A;  2DBM A;  2W0Z A;  3REB B;  2DBK A;  1Z9Z A;  2HDA A;  1X2Q A;  4AFU C;  4DEX A;  2QDL A;  2O9S A;  1ABO A;  1UUE A;  3VS7 A;  2BTT A;  1W1F A;  3NHN A;  1AD5 A;  4D8D A;  1JU5 C;  1G2B A;  2J6O A;  1T3S A;  2LQN A;  1UHC A;  1UHF A;  4RTU A;  3UA6 A;  2EBP A;  4ORZ A;  2O31 A;  2FRY A;  1NEB A;  2GTO A;  3PE0 A;  5GJV B;  1PNJ A;  1WX6 A;  1B3Q A;  1X6G A;  2DIL A;  4J9I A;  2LX7 A;  1OEB A;  2DF6 A;  2JXB A;  3KFV A;  2DM1 A;  1IO6 A;  2FRW A;  2NUZ A;  2HBW A;  2O9V A;  5FWC A;  2CSI A;  2K2M A;  2DL5 A;  2FEI A;  2KE9 A;  4FSS A;  2DRK A;  5ECA A;  1N5Z A;  4RTY A;  1U3O A;  1JXM A;  2EYZ A;  1NM7 A;  1M30 A;  2CH4 A;  4ESR A;  2EYX A;  2RQU A;  2YUO A;  2LNH B;  1AWW A;  4KRT A;  2MOX A;  1K1Z A;  4LUE A;  1BB9 A;  2AK5 A;  4RUG A;  2DLP A;  2YUP A;  1ZUU A;  3FJ5 A;  1CSK A;  3H41 A;  2EPD A;  5IHK A;  2AKL A;  3VS4 A;  2RN8 A;  1G83 A;  2MIO A;  2DL7 A;  2LP5 A;  2CRE A;  4AFZ C;  2OI3 A;  2HCK A;  1GRI A;  2P4R A;  1B07 A;  2HSP A;  4HVU A;  3TSZ A;  3TVT A;  2RMO A;  1M3B A;  1SHF A;  2HEQ A;  2AKK A;  2LJ0 A;  5L23 A;  1AWX A;  3JV3 A;  1PRM C;  2RNA A;  1H3H A;  2L3Q A;  2E5K A;  2CT4 A;  2EGC A;  1AEY A;  3EHQ A;  1RI9 A;  2JMC A;  4E6R A;  4RTW A;  1WDX A;  2YUQ A;  2EW3 A;  1X6B A;  2D8H A;  3EG0 A;  2IIM A;  1QWE A;  4ZNX A;  2VKN A;  2J7I A;  3CQT A;  3M0U A;  1T3L A;  2KRO A;  2OJ2 A;  1WA7 A;  4DEY A;  5IH2 A;  2PTK A;  4J9B A;  2BZ8 A;  2DL8 A;  3RBB B;  3VRZ A;  2MCN A;  1M8M A;  2GQI A;  3NGP A;  4K11 A;  2AZS A;  2SRC A;  3ULR B;  2KRS A;  1K0S A;  2LJ3 A;  1YN8 A;  3VS6 A;  1ZSG A;  2O2O A;  3A98 A;  4CC2 A;  3H0I A;  1WIE A;  3VS0 A;  1YWO A;  2KR3 A;  1M3A A;  4IIM A;  1H92 A;  1TUD A;  2CUD A;  4JJD A;  2VVK A;  1U06 A;  2FG0 A;  2JM8 A;  4HCK A;  1S1N A;  1U5S A;  4GLM A;  1UTI A;  2NWM A;  4HVW A;  1WFW A;  3U23 A;  2G6F X;  1GFD A;  2KT1 A;  2JTE A;  2DX1 A;  1Y0M A;  2EVR A;  3C0C A;  3R6N A;  1GCQ A;  2KRN A;  4WCI A;  2ENM A;  1H8K A;  3TSW A;  2C0O A;  1EFN A;  1OV3 A;  1AVZ C;  1GCQ C;  3M0T A;  1TUC A;  2VWF A;  2RQV A;  1SEM A;  2BZY A;  1RUW A;  4AG2 C;  1JQQ A;  4IIO A;  1AWO A;  1AWJ A;  2XMF A;  1M27 C;  1WXU A;  1KFZ A;  1UJY A;  1WI7 A;  4JJC A;  2C0T A;  4LE9 A;  2KYM A;  3I5R A;  1GBQ A;  1YNZ A;  4A63 B;  2YDL A;  2FPD A;  2GBQ A;  2X3X D;  2DVJ A;  2LJ1 A;  1OPL A;  3VS1 A;  2D0N A;  1QKX A;  3EG2 A;  3M0P A;  2ABL A;  1A0N B;  1UJ0 A;  1W6X A;  2V1R A;  2EYY A;  3PVL A;  3UA7 A;  1K0X A;  4RTZ A;  1M3C A;  4OMM A;  4JPB W;  2C0I A;  2J6K A;  4D8K A;  1KIK A;  2DNU A;  1BBZ A;  4J9F A;  2RQT A;  2A08 A;  2J06 A;  1PKT A;  2EKH A;  3UF4 A;  2K3B A;  1I1J A;  2YSQ A;  1X27 A;  5FWB A;  2J6F A;  1QCF A;  2DRM A;  2KYB A;  3NMZ C;  4Z88 A;  2RQR A;  5HCK A;  2DE0 X;  4OML A;  2A28 A;  4AFS C;  2YT6 A;  2SEM A;  1FMK A;  2KT8 A;  5I22 A;  2CH4 W;  5IHI A;  1NYG A;  1YCS B;  4LN2 A;  1UDL A;  1PKS A;  4F16 A;  1V1C A;  1WXT A;  1NLP C;  3RNJ A;  1WXB A;  2D8J A;  4M4Z A;  1UGV A;  2O88 A;  3SHW A;  2K79 A;  1KSW A;  2GGR A;  4QT7 A;  3SEM A;  1X43 A;  2BZX A;  1SPK A;  1E6G A;  1HSQ A;  2EGA A;  2RQW A;  4OMP A;  1ZLM A;  1K9A A;  2D1X A;  2JT4 A;  1FYN A;  1ZX6 A;  4HXJ A;  4HVV A;  1AZE A;  1X2K A;  2ESW A; 
#chains in the Genus database with same CATH topology
 3PTA A;  4C0D C;  1T0J A;  4EDU A;  2EGE A;  2FVU A;  1E6H A;  1WLP B;  2GFA A;  2GTJ A;  2KBT A;  2NYS A;  3EFO A;  3HRS A;  4JZ4 A;  3FC3 A;  3V8L A;  2O4X B;  2V8K A;  5J39 A;  1ABQ A;  4DOW A;  5KYX A;  3JCM W;  3CEY A;  4J9E A;  4AFQ C;  1MV3 A;  1KQS P;  2DET A;  4LUD A;  3UWN A;  2VUB A;  2GNC A;  2V8J A;  3JCM V;  2E3I A;  1OX8 A;  1WHG A;  2HQE A;  2YLB A;  1M1G A;  4RTT A;  2A37 A;  2GF7 A;  3AHU A;  1CKB A;  2FB7 A;  4AG1 C;  4HKE A;  1AZG B;  2J05 A;  1GFC A;  1QVF S;  2COW A;  2ROL A;  3DLL A;  2XU8 A;  4OB0 B;  4Z8A A;  5A2Q E;  2CZ1 B;  4J6X A;  1JB0 E;  3H0F A;  1D1C A;  3VRY A;  4PJO G;  4M75 G;  3QO3 A;  4BE1 A;  3CCQ Q;  4KGV B;  2DXT A;  3IQL A;  1VQK Q;  1UFF A;  2L0A A;  4O5V A;  1WJR A;  1N9R A;  1WQ7 A;  4FIB A;  4XTV A;  2I0N A;  5KE3 A;  5GAM e;  2ZCF B;  1U1T A;  2H3E B;  2NUT A;  1OYX A;  3GNF B;  1Q82 C;  1YJW T;  3OS0 A;  4J9H A;  3MCA B;  4XTX A;  2M02 A;  1GCP A;  1YWP A;  4X9C A;  4XQ3 A;  3REA B;  2A36 A;  2LX9 A;  3QII A;  5GJW B;  1SHG A;  2HQH A;  5LJ3 j;  3OYL A;  5GMK i;  4JZ3 A;  4PJO C;  4M75 C;  3M0R A;  5J3B A;  4AMC A;  3J81 E;  3S3N A;  2K9G A;  2OTL T;  1VQ5 T;  2DXB A;  1I0C A;  2QK0 A;  4OP0 A;  1VQN A;  1WHM A;  3S3O A;  1VQ6 T;  1RAG B;  2EJ9 A;  1NPR A;  2L2P A;  2ED0 A;  5GAN 5;  1VQL T;  1BK2 A;  1I07 A;  2RF0 A;  4M75 F;  3GLX A;  3CCS A;  3OW2 S;  5GAM h;  1GL5 A;  3P8D A;  1VQN T;  1Y71 A;  4TVR A;  4II1 A;  1YIT Q;  3EG1 A;  1QMC A;  3CMA A;  3C4S A;  2M9U A;  2LQW A;  2W0Z A;  1UB4 A;  3MP1 A;  1XNI A;  3ER0 A;  3MPU B;  2B8A A;  5GAN 8;  1IB8 A;  3BE3 A;  1K8A R;  4CRI A;  2E1H A;  2RJC A;  1VQ8 T;  1AD5 A;  1BCO A;  1JU5 C;  4JLI A;  2CKK A;  1G2B A;  2QTV A;  2J6O A;  1H3Z A;  1G5V A;  1OU9 A;  1X01 A;  4MDX A;  1TOV A;  4ORZ A;  2FRY A;  1VQO A;  2OTJ A;  2DIL A;  2LX7 A;  5GAO r;  4N4G A;  1MNE A;  1K9M R;  3CC7 A;  2HBW A;  2CSI A;  2K2M A;  1VQO T;  2RI2 A;  2P0P A;  4FSS A;  3LWH A;  3OYE A;  2JVV A;  2R5M A;  2F1L A;  1JXM A;  3E9F A;  5I2S A;  1IXD A;  3OA6 A;  5CR2 A;  1WJS A;  1P92 A;  4PFZ A;  4BY6 B;  3CCJ A;  3WVE B;  1AWW A;  1K1Z A;  2AK5 A;  1ACM B;  4V2S A;  1BCM A;  3S3M A;  3FJ5 A;  2HKQ B;  4WF2 A;  5IHK A;  2K5I A;  3CCU A;  5LJ5 e;  4FYY B;  1M1K U;  2HCK A;  4FW2 A;  3JCM g;  4FM4 B;  3TSZ A;  3TVT A;  2RD1 A;  2RMO A;  3CCJ T;  4RCC A;  1JRI A;  2LJ0 A;  5LJ3 g;  3JV3 A;  4JRI A;  1PRM C;  4M78 A;  3OSS C;  1H3H A;  4EMG A;  2CT4 A;  1KC8 R;  1K8A C;  3RR6 A;  4ZGE B;  1AEY A;  3CCU T;  1M8V A;  5GAN d;  5J26 A;  2DAQ A;  5DM7 R;  1VIE A;  2R5A A;  4BB7 A;  1PSF A;  5LJ3 f;  4OB3 B;  3EG0 A;  1MMA A;  4E47 A;  1JJ2 P;  3OYD A;  1QWE A;  4C0G A;  5D6Y A;  5KCH A;  3CME A;  1IHW A;  1KQ2 A;  2VB6 A;  2RHX A;  1WGS A;  2L3R A;  2DL8 A;  3VRZ A;  2ZPI B;  3QZ9 B;  3NGP A;  2AZS A;  2MK5 A;  4F7U A;  1Q86 R;  1WQW A;  3CME T;  9ATC B;  5DLQ E;  3CCR A;  2O2O A;  1AHJ B;  1RI0 A;  4KGX B;  2E10 A;  5GAN h;  3I55 T;  3NTI A;  5HY6 A;  1X6O A;  4M77 B;  3PNW C;  2FG0 A;  4PNO A;  4HCK A;  1S1N A;  4GLM A;  1UTI A;  4HVW A;  1XQH A;  4KBM B;  2P0Q A;  3CCM T;  4QQD A;  3A8H B;  3R6N A;  2KRN A;  2YHT A;  4LDY A;  4QW2 A;  2C0O A;  3GP8 A;  1YIJ T;  1H64 1;  1I4K 1;  1TUC A;  1KC8 C;  1SEM A;  4A4H A;  2LRQ A;  1Q82 U;  1AWJ A;  4M7D B;  4PJO E;  2EFI A;  2C0T A;  3VUB A;  4XTW A;  4M78 E;  5EG2 A;  3L2V A;  4A63 B;  1YJW Q;  2YDL A;  2GBQ A;  2DVJ A;  5KH6 A;  4KUD K;  1D3B B;  1IZ6 A;  1B34 B;  2DTH A;  2LJ1 A;  3QDR B;  3VV0 A;  2EJG A;  3VS1 A;  3HRT A;  4VUB A;  2FZG B;  1R0C B;  2ABL A;  1UJ0 A;  1Q86 C;  4A4G A;  1WZO A;  5M9O A;  3LYI A;  2LDM A;  1U8R A;  1N9S A;  3ME9 A;  4OMM A;  4JPB W;  3GOX A;  4D8K A;  3DB3 A;  4J9F A;  5KYU A;  1KQ1 A;  1PKT A;  2K3B A;  2EQU A;  2DTO A;  1VQ5 Q;  2YSQ A;  2X4J A;  3E2U A;  1Q7Y C;  2KYB A;  4Z88 A;  3RUX A;  1BKB A;  1BI1 A;  1VQ6 Q;  2RM4 A;  4FU6 A;  2DE0 X;  5GAM g;  2CP6 A;  2KT8 A;  3V7S A;  5IHI A;  3TQ7 P;  1NYG A;  1VQN Q;  4A54 A;  1YCS B;  5LJ5 j;  4LN2 A;  5D6X A;  1WXT A;  5FU7 B;  3RNJ A;  2K79 A;  3ZEH A;  3OYF A;  2EQJ A;  2HL5 C;  4QT7 A;  1X43 A;  2BZX A;  2MMP A;  1SPK A;  4PLL A;  4YTL A;  1E6G A;  1RL2 A;  2EGA A;  2NLU A;  1R0B G;  1QW1 A;  4F7U B;  2E65 A;  2FHD A;  1WHL A;  2D1X A;  2VAS A;  1VQ8 Q;  4HXJ A;  2QAS A;  1AZE A;  4PJL A;  2CUB A;  2XDP A;  3RIR A;  4RCB A;  2BE7 D;  2EAY A;  4R0K A;  4DBF A;  1QLY A;  2FO0 A;  4CI0 C;  1YIT A;  1F1B B;  2QEX A;  4JDS A;  2X9H A;  1J3T A;  4C8Q B;  3UDC A;  2O4X A;  2EQI A;  3OY9 A;  2ZZD A;  4JS4 A;  2LMJ A;  3SD4 A;  1NJI C;  3ZL7 C;  3EFR A;  2OAW A;  1VQO Q;  3QWY A;  2L3P A;  4A4K A;  1QKW A;  1YCY A;  2QEX T;  4IUP A;  3EG3 A;  1LVK A;  4N4I A;  4XU2 A;  2KRM A;  5FU6 B;  1OOT A;  4JJN K;  2DMO A;  2YUN A;  3MEU A;  2AT1 B;  4QKU A;  1TSF A;  2FL7 A;  2LVM A;  2DPP B;  1G3W A;  3EGD B;  3X26 B;  3J80 E;  4PJN A;  1RLP C;  2E3H A;  2D0Q B;  1UE9 A;  3V7C A;  4C8Q D;  1WYX A;  1VQM A;  5IT9 E;  1K8A U;  3CCJ Q;  5CK9 A;  1KJW A;  4RTX A;  2OX7 A;  2QG9 B;  1YJN T;  3L2R A;  1ZUY A;  4OMO A;  3RER A;  3CCU Q;  1X69 A;  4GBQ A;  2PNI A;  2CP0 A;  2B86 A;  3H9N A;  3JCM d;  1Q81 R;  1JXO A;  4BY6 C;  2XIC A;  1T0H A;  4J6Y A;  5IHN A;  3V8J A;  1K9M U;  4GY5 A;  5EC7 A;  2JM9 A;  3M0S A;  4KUL A;  1W2B P;  1M90 U;  2V26 A;  1JBM A;  3QWX X;  4F14 A;  2L3S A;  2X3W D;  4J9C A;  4OB2 B;  2KEA A;  5LJ5 g;  3CME Q;  2LCS A;  3CPW P;  5GMK h;  3VS2 A;  1K76 A;  5KCO A;  1XOV A;  1SRL A;  2K5L A;  3NTH A;  3MJX A;  2RPN A;  3I55 Q;  2AZV A;  3SB2 A;  1TG0 A;  3JCM h;  2X51 A;  2ZPE B;  2CP3 A;  4CC3 A;  4FYV B;  5LJ3 h;  2PZ1 A;  4LDX A;  3O8V A;  3FIF A;  2XID A;  4LDV A;  3CCM Q;  5D6W A;  1SSF A;  1E7O A;  1AOJ A;  3LH5 A;  1KC8 U;  2CDT A;  1Q82 R;  1QWF A;  3NTK A;  3KBG A;  3QHS A;  2RHI A;  3WXM B;  1Z9Q A;  1KQS A;  3EH1 A;  1DJ7 B;  4HVV A;  3CBO A;  4LXC A;  4LD9 K;  1MMN A;  3A8L B;  3M56 A;  3GNG A;  4B6M A;  2HDA A;  3CD6 T;  4C92 B;  4PKC C;  1PCX A;  4AFU C;  2G3R A;  1Q81 C;  2QDL A;  2O9S A;  2RA2 A;  1UUE A;  4FYX B;  2D6F A;  2DKG A;  2E5Q A;  2ZGW A;  2VXE A;  1JJ2 S;  3OYN A;  1QVP A;  4ELY C;  3CCE A;  2LQN A;  1TTH B;  4RG2 A;  4XU3 A;  4DBR A;  3HL8 A;  4RTU A;  2MPX C;  1Q86 U;  5GAN 2;  1G8X A;  5I21 A;  4GLK A;  1NEB A;  3JB9 D;  2AIR B;  3CPF A;  3VUZ A;  4L6V 5;  4ATO A;  3CC2 T;  1NZ9 A;  3CCE T;  3KFV A;  5A0G A;  2DM1 A;  1VQ4 T;  2Y4X A;  2FRW A;  2NUZ A;  2O9V A;  3N5B B;  2DFU A;  1KHC A;  3LX7 A;  3SFM A;  3DB4 A;  1YJW A;  4ANJ A;  4M78 G;  1U3O A;  1OQK A;  1NM7 A;  4ZN1 A;  2YUO A;  4JS5 A;  3M53 A;  3FEO A;  3PIO A;  4LUE A;  1QCO A;  4M7A B;  1ZUU A;  1CSK A;  5FRN A;  3H41 A;  4UC4 A;  1AT1 B;  3MP8 A;  3OYA A;  1G83 A;  2MIO A;  2LP5 A;  1VQP A;  3ASK A;  5GAM d;  1RAH B;  2X4W A;  1GRI A;  4A4F A;  2OTL A;  2LT1 A;  1VQ5 A;  3EG9 B;  2XDD A;  1M3B A;  1AWX A;  1VQ6 A;  4F7U G;  4XK8 E;  3MKD A;  4M78 C;  2K5F A;  2LCC A;  4E6R A;  4RTW A;  1D1A A;  1WDX A;  1VQL A;  1VQP T;  2QQA A;  1C6V X;  5FRO A;  2DXU A;  3EFS A;  3L2W A;  2VKN A;  3OYM A;  2J7I A;  3CQT A;  3M0U A;  1T3L A;  4M7A D;  3QPH A;  2F5K A;  4DEY A;  4XU1 A;  5IH2 A;  4HCC A;  2PTK A;  4PJO F;  2BZ8 A;  1LOJ A;  4NS5 A;  3RBB B;  4M78 F;  3A8O B;  3P8B B;  2MCN A;  2DK3 A;  2MF2 A;  1M1F A;  2JN0 A;  2I2L A;  1IRX A;  3L42 A;  4EPC A;  2SRC A;  5GAN 6;  2E6Z A;  2KRS A;  1K0S A;  2HBP A;  3LGF A;  2QEX Q;  1ZSZ B;  2YRC A;  5HKC A;  1VQ8 A;  1BI2 A;  1Y7X A;  3VS6 A;  1ZSG A;  3UPU A;  3A98 A;  4XTU A;  1UGQ B;  1SKU B;  1WIE A;  3VS0 A;  3VJP A;  4J7I A;  1YWO A;  4M77 A;  3MEA A;  5KYW A;  2CUD A;  5KYN A;  2DO3 A;  2VVK A;  1U06 A;  3RMS A;  3KUF A;  3JAM E;  1U5S A;  4R55 A;  4R56 A;  4C8Q C;  1QVG P;  5A0L A;  2PUO B;  2G6F X;  2RJF A;  1GFD A;  2DX1 A;  2ZPB B;  1GCQ A;  4WCI A;  1QP2 A;  2LQK A;  2WSF E;  4MDW A;  1EFN A;  2LTO A;  2Z0W A;  1AVZ C;  4FL6 A;  3CXC P;  2WAC A;  4IIO A;  4JRK A;  1HXD A;  4NL2 A;  1YBY A;  2XMF A;  3HFO A;  1WXU A;  1VQM Q;  4M7D A;  1KFZ A;  1WJQ A;  4OB1 B;  1UJY A;  1WI7 A;  2XK0 A;  4QQ6 A;  3OMC A;  1D3B A;  1B34 A;  1WHJ A;  3FB9 A;  1MGQ A;  3M4G A;  1EZZ B;  1ZBX A;  2D0N A;  1FWZ A;  2EQK A;  1UGR B;  1YFN A;  3CCV T;  4JRP A;  5GAO l;  3UA7 A;  2X4Y A;  1K0X A;  4RTZ A;  3MHX A;  4C5H A;  1TU0 B;  2DVE A;  1KIK A;  1M9S A;  1VUB A;  1I81 A;  2J06 A;  3OYK A;  4PK4 A;  1NE8 A;  1JJ2 A;  3M9Q A;  3FRN A;  2MAM A;  8ATC B;  1QCF A;  2DRM A;  2RQR A;  2RHU A;  4FSX A;  1D0Y A;  4OML A;  4ZGD B;  3QDF A;  3MO8 A;  3OYB A;  2SEM A;  3QXE B;  5I22 A;  4XTZ A;  2COY A;  2EIF A;  3C95 A;  4M77 E;  5GAN 7;  2XD0 A;  3MEV A;  3JB9 G;  3NFC A;  3G6E T;  1PKS A;  1NLP C;  1WXB A;  1Q81 U;  2EQM A;  2O01 E;  4IKF A;  1KSW A;  3I55 A;  2GGR A;  3CD6 Q;  2DZC A;  3T9N A;  4C0F A;  4E2F B;  1RAI B;  2DER A;  1K9A A;  1PC0 A;  2LT4 A;  5LJ5 h;  4C0D B;  3QSU A;  3CCM A;  2KVQ G;  3QUI A;  1VYT A;  3L2U A;  3F70 A;  1ARK A;  4JJB A;  2DJZ A;  4M7D E;  1Q7Y R;  4BI3 A;  5KYW B;  2LNV A;  1YHQ A;  1QVF P;  1YIJ A;  2BE9 B;  2WSE E;  4C8Q A;  1SF9 A;  3URG A;  4MZT A;  4DQ2 A;  1YI2 T;  4IUQ A;  3CC2 Q;  4D6W A;  3CCE Q;  4B9W A;  1PRL C;  1BIA A;  3OS5 A;  1NYF A;  1VQ4 Q;  2QGG A;  1NLO C;  4PJM A;  1BYM A;  1NBE B;  2A3L A;  1YHQ T;  1HYO A;  4KT0 E;  2XI9 A;  1SSH A;  1W70 A;  2RHY A;  5GMK m;  2E64 A;  2PVD B;  1FMW A;  2IG0 A;  3JB9 F;  4EMH A;  1VQ9 T;  3VS3 A;  3A8M B;  2K7A A;  3OYC A;  3R6O A;  3EGD A;  4M77 D;  2JUF A;  4C5G A;  2JS2 A;  4J8O A;  3G4S A;  2R57 A;  4ELZ C;  1ZBJ A;  3SWN A;  4J83 A;  2DYB A;  2MYS A;  2FZC B;  3UT1 A;  2HZY A;  2CS7 A;  2JTF A;  1YP5 A;  4E7H A;  3I5S A;  3G4S T;  2DL3 A;  1VQP Q;  1NJI R;  1BU1 A;  1M2V B;  3G7Z A;  2F2V A;  1KQS S;  1RLQ C;  2OTL Q;  4MZP A;  2LQ8 A;  1IGU A;  4QQG A;  3LW5 E;  4N0A A;  4F7U E;  4M7D D;  2ROT A;  1LNX A;  1WNL A;  2HD0 A;  1B7T A;  2K6D A;  3OW2 P;  1V29 B;  1SRM A;  3LLR A;  3NPF A;  4M7A C;  2FPF A;  5CKE A;  1VQL Q;  1OPK A;  3OS2 A;  5FW9 A;  5C0M A;  2CP5 A;  4M75 B;  2E41 A;  3SDZ A;  4C8Q E;  3CC4 A;  1PG5 B;  2JW4 A;  4E7I A;  4OMQ A;  1KD1 R;  1UEC A;  3MET A;  1RAD B;  2E12 A;  1UG1 A;  4XTY A;  5I11 A;  1S72 T;  2EYW A;  2FPE A;  1M4Z A;  1G3S A;  2CYZ B;  2E4H A;  2DL4 A;  4X1V A;  2CZ6 B;  4Y91 A;  3CC4 T;  3PVQ A;  3I35 A;  4Z89 A;  3M0Q A;  3HKS A;  1CKA A;  1PWT A;  3JCM J;  4E7Z A;  5GAN j;  2V1Q A;  3EGU A;  2IVW A;  3QJY A;  2P0K A;  1OU8 A;  1PSE A;  2QA4 T;  5CKF A;  3THK A;  1K4U S;  5GAN 4;  4A4E A;  2W10 A;  1D0Z A;  3HRU A;  2VV5 A;  2VGN A;  4BE2 A;  3X28 B;  3REB B;  2DBK A;  2QQB A;  1Z9Z A;  4C92 A;  3LGL A;  3PMI A;  2K3X A;  1ABO A;  5CCA A;  2CZ0 B;  1I5L A;  5GAO m;  3C94 A;  2ZPG B;  1UHC A;  1UHF A;  2O31 A;  3EGX A;  2GTO A;  4HT9 A;  3PE0 A;  5GJV B;  1YJN A;  1PNJ A;  1WX6 A;  1B3Q A;  1X6G A;  3OS1 A;  3CCV Q;  1YJ9 T;  3QKJ A;  1QCN A;  2DF6 A;  2JXB A;  1IO6 A;  3SWN B;  1N27 A;  1KD1 C;  3RES A;  2GQV A;  5FWC A;  2DL5 A;  3QZ5 B;  4QVD A;  3M57 A;  2RJE A;  2EKO A;  4RTY A;  2EYZ A;  2ATC B;  4HT8 A;  1M30 A;  1W2B A;  4ESR A;  2EYX A;  2CZ7 B;  4N4H A;  2VYT A;  1G3T A;  2MOX A;  4OGC A;  5LJ3 d;  1W4S A;  4M7A A;  4RUG A;  2YUP A;  4J6W A;  3G6E Q;  3CPW A;  3E1S A;  1RAF B;  3G71 A;  3VS4 A;  5KE2 A;  2K3Y A;  2DL7 A;  1OZ2 A;  2QGF B;  4LDW A;  2R58 A;  4BAC A;  1B07 A;  2D9T A;  2HSP A;  3EG9 A;  2DZ9 A;  2HEQ A;  2AKK A;  2Y4Y A;  4BE0 A;  2RNA A;  3H6Z A;  2E5K A;  4KH0 B;  4BUG A;  3G71 T;  3EHQ A;  1RI9 A;  2JMC A;  1FX7 A;  2JZ2 A;  4KH1 B;  4C92 E;  3ZFJ A;  1VIF A;  4BI4 A;  2IIM A;  4E7K A;  1NPP A;  4HCB A;  4M77 G;  2BIV A;  4OMF B;  4Y28 E;  2KRO A;  2HKN A;  2OJ2 A;  3RKW A;  3HSB A;  2DEU A;  1YI2 Q;  4J9B A;  1VQ7 A;  4X9D A;  3CD6 A;  2GQI A;  4K11 A;  2KK4 A;  1YHQ Q;  4E7S A;  1OI1 A;  1ZSZ A;  4BI8 B;  5GAN f;  1YIJ Q;  4B9X A;  3CCL T;  1YN8 A;  2HQX A;  2HAX A;  4BD3 A;  3L2Z A;  4CC2 A;  3H0I A;  1R8O B;  5D7U A;  1KG1 A;  3JB9 J;  1VQ7 T;  4P5N A;  2EYQ A;  2KR3 A;  1M3A A;  1VQ9 Q;  5FRM A;  1H92 A;  4WTO B;  1TUD A;  3CBM A;  4JLG A;  4M7D G;  3LH0 A;  3BDU A;  4M77 C;  1N8R R;  3TRE A;  1Y96 B;  1Q95 G;  1RAE B;  1WFW A;  3CC2 A;  1KHI A;  1VQ4 A;  1I5O B;  2KT1 A;  1SG5 A;  1Y0M A;  2EVR A;  3C0C A;  4ZTF A;  5CQY A;  2RI3 A;  3M59 A;  2ENM A;  2K4Y A;  1OV3 A;  1D0X A;  4M7A E;  3EGX B;  3JSC A;  1GCQ C;  3CBP A;  2F5T X;  6AT1 B;  2RQV A;  4PLI A;  4EMK B;  3JCM c;  3G4S Q;  2QXF A;  2P4T A;  3OB9 A;  5IN1 A;  1ZA1 B;  4M77 F;  1RUW A;  1QP3 A;  1Q7Y U;  1JQQ A;  2DEQ A;  1AWO A;  3VKI A;  1M27 C;  2KI7 A;  4JJC A;  4FW1 A;  4C92 D;  3I5R A;  1GBQ A;  4M7D C;  1YNZ A;  3Q1J A;  2X4X A;  1MND A;  2M16 A;  2FPD A;  2RO0 A;  2Y90 A;  3M4Y A;  3X20 B;  2HSE B;  2XHC A;  2CP2 A;  1OPL A;  4FCY A;  2M0O A;  2QTX A;  3RMQ A;  4ZGJ B;  2BUD A;  1TWB A;  1QKX A;  3EG2 A;  1A0N B;  3JCM b;  4E7J A;  5GMK l;  4QVC A;  3BDL A;  4X34 A;  4M7D F;  3M5A A;  1BBZ A;  2RQT A;  2A08 A;  3OSV A;  4OVA A;  3UF4 A;  1K73 R;  1X27 A;  2J6F A;  1S72 Q;  5GMK j;  1N8R C;  4DBH A;  3CC4 Q;  4C5E A;  5CVI A;  2A28 A;  4OF1 A;  4AFS C;  2YT6 A;  3FJP A;  5CKB A;  2A0F B;  2JTM A;  2CH4 W;  1FXX A;  3HHT B;  2HMA A;  2QA4 Q;  2IPO B;  2QYZ A;  1UDL A;  4JRQ A;  1V1C A;  1ZA2 B;  5CKD A;  1OUL A;  4C8Q G;  1NJI U;  5KYY B;  2D8J A;  3PGG A;  3QJ6 A;  4M4Z A;  3S6W A;  5FU7 C;  2O88 A;  2DIG A;  3VYH B;  2C06 A;  3OYY A;  1ZLM A;  3HTR A;  3OBY A;  2JT4 A;  1ZX6 A;  1X2K A;  1QVG A;  1EX4 A;  2GFU A;  3DKM A;  1TUG B;  2E70 A;  4OMN A;  3X24 B;  1YJ9 Q;  3CXC A;  3E19 A;  4C0Z A;  5I2M A;  1KD1 U;  3M55 A;  1Y57 A;  1JO8 A;  3EFO B;  4F7U F;  2K2V A;  3CCS T;  4F17 A;  1K73 C;  2F2W A;  2P84 A;  5KYX B;  3HPW A;  2CT3 A;  2JMA A;  1YJN Q;  2M51 A;  3V7R A;  1RAA B;  2PUK B;  3CMA T;  5C6S A;  1MMG A;  2QAZ A;  5CAI A;  1XJW B;  5FU6 C;  3RKY A;  2V8I A;  2H8H A;  2WSC E;  2CSQ A;  2E6N A;  3GBQ A;  2M1H A;  3OYG A;  4ZTJ A;  4C8Q F;  2DJQ A;  2GCX A;  3CCV A;  2XG8 D;  3O5Z A;  1Y07 A;  1N6A A;  4FT2 A;  2M0Y A;  4EIK A;  2DIQ A;  4LDU A;  2L89 A;  3SWN C;  1V76 A;  1R77 A;  4IUU A;  2KXC A;  4O6J A;  2OTJ T;  2RHZ A;  2ED1 A;  7AT1 B;  2KY9 A;  3G71 Q;  1NG2 A;  2PU9 B;  1M2V A;  4Y92 A;  3QBY A;  1GBR A;  2DA9 A;  1X75 C;  2BKD N;  3UAT A;  4J5Y A;  2YWW A;  3CC7 T;  4IUR A;  2RJD A;  4FT4 A;  5LJ5 d;  2KXD A;  1HD3 A;  2NUT B;  3G6E A;  1MUZ A;  2LZ6 B;  4N0A C;  8AT1 B;  5IXB A;  4CC7 A;  1RAB B;  2XDB A;  2ECZ A;  4IUV A;  5CQX A;  1ZUK A;  5GAN e;  1M90 R;  2L8D A;  1VA7 A;  1PHT A;  4PJO A;  1VYU A;  3VYG A;  3M54 A;  1MHN A;  4J9G A;  4M75 A;  1G3Y A;  5IXF A;  2RB6 A;  3H0H A;  1LCK A;  3HP9 A;  3CCL Q;  2L5Q A;  3E9G A;  2DXC A;  1UGP B;  3JCM f;  3QYG B;  1U1S A;  1FMV A;  3EHR A;  2JOY A;  5GAM j;  1VQ7 Q;  4KUI A;  5GAO n;  1QVF A;  4C92 G;  2LCL A;  3PFS A;  1JEG A;  3DLM A;  2KGT A;  2KNB B;  5AT1 B;  2RK1 A;  3VS5 A;  4RTV A;  1VYV A;  3D7S B;  1D1B A;  4CC4 B;  3WVD B;  1M2O A;  1YI2 A;  3I56 A;  2F2X A;  3RDV A;  4J9D A;  3G1J A;  4XU0 A;  4A53 A;  4JUV A;  4IUT A;  1NEG A;  1HJD A;  1K9M C;  4LNP A;  1W2B S;  4J7F A;  5L8R E;  3BFM A;  2RI5 A;  3I9Q A;  2JS0 A;  2NUP A;  1ZQ1 A;  1MV0 B;  3I56 T;  4MML A;  2DBM A;  1VQ9 A;  1M5Q 1;  1X2Q A;  3JCM P;  3JRZ A;  4DEX A;  3CPW S;  4C92 C;  1WPY A;  3J7A F;  3VS7 A;  2BTT A;  1W1F A;  3NHN A;  1RAC B;  2K57 A;  4D8D A;  3CCR T;  3EAE A;  1PD1 A;  1T3S A;  5CO7 A;  2JJ9 A;  1EIF A;  4L59 A;  4PJJ A;  3UA6 A;  2EBP A;  2PVG B;  1ZHI A;  1M90 C;  5HK3 A;  3OBW A;  2ZPF B;  4BDZ A;  5FLX E;  4J9I A;  4M7A G;  3VU3 C;  4HCZ A;  4C92 F;  3GPL A;  2LC4 A;  1OEB A;  4EMK C;  4ZN3 A;  1PM3 A;  3L1A A;  2MI6 A;  1QQJ A;  2KMT A;  4PFO A;  2FEI A;  1N8R U;  2KE9 A;  4M75 E;  2DRK A;  5GAN 3;  2H3J A;  2QI2 A;  3OW2 A;  5ECA A;  4DBQ A;  1N5Z A;  5CIU A;  2KSS A;  3TCJ A;  3OYI A;  3M58 A;  2CH4 A;  3KXT A;  3EH2 A;  5AYF A;  1TXQ A;  2RQU A;  3JCM X;  2LNH B;  4KRT A;  1BB9 A;  4HA8 A;  2DLP A;  3CCQ A;  1TS9 A;  2EPD A;  1VQK A;  2AKL A;  2RN8 A;  3GF5 A;  4NOY A;  1WHH A;  2JNG A;  2CRE A;  4AFZ C;  2OI3 A;  2P4R A;  4HVU A;  2YLC A;  2F69 A;  1SHF A;  1S72 A;  5L23 A;  4PJO B;  2L3Q A;  3C12 A;  3CCQ T;  3TU4 K;  4M78 B;  5GAO p;  2EGC A;  1VQK T;  1IGQ A;  2CP7 A;  1XTD A;  2QQR A;  2YUQ A;  2EW3 A;  1X6B A;  4AT1 B;  5HK0 A;  2D8H A;  4M7A F;  5DLO A;  2YRD A;  3RKX A;  4C5I A;  2QA4 A;  4XAX B;  4LD6 A;  4ZNX A;  4F04 B;  2VGM A;  1UGS B;  2PVO B;  5GAM f;  1D09 B;  3A5Z B;  4OGE A;  4NL3 A;  1WA7 A;  1PD0 A;  3V8K A;  2AHJ B;  1LPL A;  1K73 U;  1OZ3 A;  2A7Y A;  2KAF A;  3OYJ A;  1M8M A;  3CCS Q;  2YXY A;  2HL3 A;  1O75 A;  1I8F A;  3ULR B;  3P8H A;  2LJ3 A;  4PJO D;  4M75 D;  2VC8 A;  3CMA Q;  4M78 D;  5IAY A;  2NUP B;  1ZSZ C;  4IIM A;  2FYK A;  4JJD A;  2EJF A;  1IHV A;  4MZM A;  2QQ9 A;  1YJ9 A;  2JM8 A;  1Y96 A;  4L5G A;  4ME7 A;  2NWM A;  1UEB A;  4MMK A;  1TH7 A;  3U23 A;  2COZ A;  2FZK B;  1C1A A;  3MP6 A;  2KDS A;  3JB9 H;  2JTE A;  2EWN A;  4DOV A;  1H8K A;  4E7L A;  1O9S A;  3TSW A;  1GXI E;  1YIT T;  2OTJ Q;  3OMG A;  3M0T A;  4EMK A;  4BDY A;  4PL6 A;  2VWF A;  3L2Q A;  2XKO C;  2BZY A;  2DD4 A;  1OX9 A;  2DTI A;  2QDY B;  4AG2 C;  1BI3 A;  2OAU A;  4QVZ A;  3AT1 B;  4RKU E;  1M1K R;  3CC7 Q;  1C0M A;  4LE9 A;  2KYM A;  2ZAE A;  5LL6 S;  3QG1 A;  3LWI A;  3HFN A;  5CKH A;  2X3X D;  4PFP A;  5GMK e;  3JB9 I;  5DY9 A;  3BW1 A;  3GIB A;  3M0P A;  3JCM e;  1QVG S;  1W6X A;  2RH2 A;  1HK9 A;  2EYY A;  2V1R A;  3PVL A;  1BIB A;  5GAO q;  5LJ3 e;  1M3C A;  3MEW A;  4RMO A;  2C0I A;  2J6K A;  4FYW B;  2DNU A;  1VQM T;  2EKH A;  5KYU B;  3INZ A;  1I1J A;  3CXC S;  5FWB A;  4Q5W A;  3FDR A;  3NMZ C;  2DYI A;  4DA4 A;  2CGH A;  3A1P A;  5HCK A;  3H8Z A;  1MMD A;  2YRV A;  4RG8 A;  4Z02 A;  3FLG A;  1FMK A;  2RK2 A;  3TEE A;  2KQW A;  3BY7 A;  2MWP A;  2ZPH B;  3PT9 A;  5A0D A;  3PMT A;  3CCL A;  3PIP A;  4F16 A;  2HNI A;  5KYY A;  5GAN g;  3OYH A;  3I56 Q;  1UGV A;  3SHW A;  1VOM A;  2DD5 A;  3SEM A;  3JCM Q;  1IRE B;  3OQ5 A;  1LJO A;  3QYH B;  5LJ5 f;  3X25 B;  1HSQ A;  2RQW A;  4OMP A;  1M1K C;  2QQS A;  3A8G B;  1FYN A;  1KK7 A;  2PQW A;  2MWO A;  3ZBD A;  2X35 A;  1WHK A;  3CCR Q;  2VXF A;  1BI0 A;  4KGZ B;  2ESW A; 
#chains in the Genus database with same CATH homology
 2CUB A;  1VYT A;  1ARK A;  4JJB A;  1T0J A;  2EGE A;  4R0K A;  1E6H A;  1QLY A;  2FO0 A;  4OMN A;  1WLP B;  2GTJ A;  1J3T A;  2KBT A;  1Y57 A;  4JZ4 A;  2EQI A;  1JO8 A;  2LMJ A;  1PRL C;  1NYF A;  3ZL7 C;  1ABQ A;  1NLO C;  4F17 A;  2OAW A;  2F2W A;  2CT3 A;  4J9E A;  3QWY A;  2L3P A;  1SSH A;  2JMA A;  1QKW A;  1W70 A;  1MV3 A;  2M51 A;  4AFQ C;  3EG3 A;  2KRM A;  4LUD A;  1OOT A;  2DMO A;  2YUN A;  2GNC A;  2H8H A;  2CSQ A;  3GBQ A;  3VS3 A;  2K7A A;  2DJQ A;  3O5Z A;  4RTT A;  2A37 A;  2JS2 A;  1CKB A;  4AG1 C;  1RLP C;  2M0Y A;  1AZG B;  2J05 A;  1GFC A;  1UE9 A;  1ZBJ A;  2ROL A;  4EIK A;  1WYX A;  2DYB A;  4Z8A A;  3H0F A;  2KXC A;  1KJW A;  4RTX A;  3VRY A;  1YP5 A;  2ED1 A;  3I5S A;  1ZUY A;  4OMO A;  2DL3 A;  3IQL A;  1NG2 A;  1X69 A;  1UFF A;  2L0A A;  4GBQ A;  4Y92 A;  1GBR A;  2DA9 A;  2PNI A;  1BU1 A;  2I0N A;  2B86 A;  3UAT A;  2F2V A;  1RLQ C;  1JXO A;  1T0H A;  2ROT A;  2KXD A;  1HD3 A;  5IHN A;  1MUZ A;  2K6D A;  2LZ6 B;  4J9H A;  1SRM A;  5EC7 A;  3NPF A;  5IXB A;  2JM9 A;  4CC7 A;  2FPF A;  1GCP A;  1YWP A;  3M0S A;  1OPK A;  2ECZ A;  3REA B;  2A36 A;  1ZUK A;  1VA7 A;  3QWX X;  4F14 A;  2L3S A;  2X3W D;  4J9C A;  1PHT A;  5FW9 A;  5GJW B;  1VYU A;  1SHG A;  2KEA A;  4J9G A;  5IXF A;  3H0H A;  1LCK A;  4JZ3 A;  3M0R A;  2JW4 A;  2LCS A;  3VS2 A;  4OMQ A;  1K76 A;  3EHR A;  1XOV A;  1SRL A;  1UEC A;  2K9G A;  2RPN A;  2AZV A;  1UG1 A;  1I0C A;  1TG0 A;  5I11 A;  1JEG A;  4CC3 A;  2EYW A;  2FPE A;  2KGT A;  2KNB B;  2DL4 A;  3VS5 A;  4X1V A;  4RTV A;  1VYV A;  2L2P A;  3PVQ A;  3I35 A;  4Z89 A;  3M0Q A;  2PZ1 A;  1CKA A;  1PWT A;  2ED0 A;  4CC4 B;  2F2X A;  2V1Q A;  3EGU A;  1BK2 A;  1I07 A;  2RF0 A;  4J9D A;  1E7O A;  1AOJ A;  1NEG A;  1HJD A;  3LH5 A;  2CDT A;  1QWF A;  1GL5 A;  3THK A;  1K4U S;  1Z9Q A;  2W10 A;  3EG1 A;  4LNP A;  3I9Q A;  2JS0 A;  1MV0 B;  2LQW A;  2DBM A;  2W0Z A;  3REB B;  2DBK A;  1Z9Z A;  2HDA A;  1X2Q A;  4AFU C;  4DEX A;  2QDL A;  2O9S A;  1ABO A;  1UUE A;  3VS7 A;  2BTT A;  1W1F A;  3NHN A;  1AD5 A;  4D8D A;  1JU5 C;  1G2B A;  2J6O A;  1T3S A;  2LQN A;  1UHC A;  1UHF A;  4RTU A;  3UA6 A;  2EBP A;  4ORZ A;  2O31 A;  2FRY A;  1NEB A;  2GTO A;  3PE0 A;  5GJV B;  1PNJ A;  1WX6 A;  1B3Q A;  1X6G A;  2DIL A;  4J9I A;  2LX7 A;  1OEB A;  2DF6 A;  2JXB A;  3KFV A;  2DM1 A;  1IO6 A;  2FRW A;  2NUZ A;  2HBW A;  2O9V A;  5FWC A;  2CSI A;  2K2M A;  2DL5 A;  2FEI A;  2KE9 A;  4FSS A;  2DRK A;  5ECA A;  1N5Z A;  4RTY A;  1U3O A;  1JXM A;  2EYZ A;  1NM7 A;  1M30 A;  2CH4 A;  4ESR A;  2EYX A;  2RQU A;  2YUO A;  2LNH B;  1AWW A;  4KRT A;  2MOX A;  1K1Z A;  4LUE A;  1BB9 A;  2AK5 A;  4RUG A;  2DLP A;  2YUP A;  1ZUU A;  3FJ5 A;  1CSK A;  3H41 A;  2EPD A;  5IHK A;  2AKL A;  3VS4 A;  2RN8 A;  1G83 A;  2MIO A;  2DL7 A;  2LP5 A;  2CRE A;  4AFZ C;  2OI3 A;  2HCK A;  1GRI A;  2P4R A;  1B07 A;  2HSP A;  4HVU A;  3TSZ A;  3TVT A;  2RMO A;  1M3B A;  1SHF A;  2HEQ A;  2AKK A;  2LJ0 A;  5L23 A;  1AWX A;  3JV3 A;  1PRM C;  2RNA A;  1H3H A;  2L3Q A;  2E5K A;  2CT4 A;  2EGC A;  1AEY A;  3EHQ A;  1RI9 A;  2JMC A;  4E6R A;  4RTW A;  1WDX A;  2YUQ A;  2EW3 A;  1X6B A;  2D8H A;  3EG0 A;  2IIM A;  1QWE A;  4ZNX A;  2VKN A;  2J7I A;  3CQT A;  3M0U A;  1T3L A;  2KRO A;  2OJ2 A;  1WA7 A;  4DEY A;  5IH2 A;  2PTK A;  4J9B A;  2BZ8 A;  2DL8 A;  3RBB B;  3VRZ A;  2MCN A;  1M8M A;  2GQI A;  3NGP A;  4K11 A;  2AZS A;  2SRC A;  3ULR B;  2KRS A;  1K0S A;  2LJ3 A;  1YN8 A;  3VS6 A;  1ZSG A;  2O2O A;  3A98 A;  4CC2 A;  3H0I A;  1WIE A;  3VS0 A;  1YWO A;  2KR3 A;  1M3A A;  4IIM A;  1H92 A;  1TUD A;  2CUD A;  4JJD A;  2VVK A;  1U06 A;  2FG0 A;  2JM8 A;  4HCK A;  1S1N A;  1U5S A;  4GLM A;  1UTI A;  2NWM A;  4HVW A;  1WFW A;  3U23 A;  2G6F X;  1GFD A;  2KT1 A;  2JTE A;  2DX1 A;  1Y0M A;  2EVR A;  3C0C A;  3R6N A;  1GCQ A;  2KRN A;  4WCI A;  2ENM A;  1H8K A;  3TSW A;  2C0O A;  1EFN A;  1OV3 A;  1AVZ C;  1GCQ C;  3M0T A;  1TUC A;  2VWF A;  2RQV A;  1SEM A;  2BZY A;  1RUW A;  4AG2 C;  1JQQ A;  4IIO A;  1AWO A;  1AWJ A;  2XMF A;  1M27 C;  1WXU A;  1KFZ A;  1UJY A;  1WI7 A;  4JJC A;  2C0T A;  4LE9 A;  2KYM A;  3I5R A;  1GBQ A;  1YNZ A;  4A63 B;  2YDL A;  2FPD A;  2GBQ A;  2X3X D;  2DVJ A;  2LJ1 A;  1OPL A;  3VS1 A;  2D0N A;  1QKX A;  3EG2 A;  3M0P A;  2ABL A;  1A0N B;  1UJ0 A;  1W6X A;  2V1R A;  2EYY A;  3PVL A;  3UA7 A;  1K0X A;  4RTZ A;  1M3C A;  4OMM A;  4JPB W;  2C0I A;  2J6K A;  4D8K A;  1KIK A;  2DNU A;  1BBZ A;  4J9F A;  2RQT A;  2A08 A;  2J06 A;  1PKT A;  2EKH A;  3UF4 A;  2K3B A;  1I1J A;  2YSQ A;  1X27 A;  5FWB A;  2J6F A;  1QCF A;  2DRM A;  2KYB A;  3NMZ C;  4Z88 A;  2RQR A;  5HCK A;  2DE0 X;  4OML A;  2A28 A;  4AFS C;  2YT6 A;  2SEM A;  1FMK A;  2KT8 A;  5I22 A;  2CH4 W;  5IHI A;  1NYG A;  1YCS B;  4LN2 A;  1UDL A;  1PKS A;  4F16 A;  1V1C A;  1WXT A;  1NLP C;  3RNJ A;  1WXB A;  2D8J A;  4M4Z A;  1UGV A;  2O88 A;  3SHW A;  2K79 A;  1KSW A;  2GGR A;  4QT7 A;  3SEM A;  1X43 A;  2BZX A;  1SPK A;  1E6G A;  1HSQ A;  2EGA A;  2RQW A;  4OMP A;  1ZLM A;  1K9A A;  2D1X A;  2JT4 A;  1FYN A;  1ZX6 A;  4HXJ A;  4HVV A;  1AZE A;  1X2K A;  2ESW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...