1WYXA

The crystal structure of the p130cas sh3 domain at 1.1 a resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
LNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords CRK-associated substrate
publication title The 1.1 A resolution crystal structure of the p130cas SH3 domain and ramifications for ligand selectivity
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wyxA00
2V1RA 1KIKA 1CKAA 1QKWA 3KFVA 4RTUA 2BZXA 1AZGB 1K1ZA 2JM9A 3TSZA 2K6DA 1GBQA 2LMJA 4AFZC 1HD3A 1UHFA 1OV3A 4QT7A 2X3WD 3I9QA 2LP5A 2KROA 1PRMC 1K0SA 4R0KA 1BU1A 2EPDA 2OAWA 4J9CA 2DVJA 1B3QA 2KT1A 2LJ1A 1OEBA 3M0QA 2DBMA 3QWYA 3THKA 3IQLA 3SEMA 3FJ5A 1JEGA 3LH5A 2LQWA 4F17A 2F2VA 2EBPA 4JZ4A 1ZX6A 1SSHA 5GJVB 1WIEA 1UUEA 1H92A 1E6HA 4LN2A 3H41A 1K76A 3QWXX 3TVTA 2LJ0A 3VS4A 4Z89A 1PKTA 1YWPA 2JM8A 5HCKA 2KXCA 5IHKA 2DILA 1QCFA 2EQIA 3C0CA 2AK5A 1BBZA 2RQTA 4J9BA 2OJ2A 4AFUC 5IHIA 2JMAA 2FPEA 3PVLA 1AWJA 4J9FA 2GGRA 1UHCA 2O31A 1MV3A 3EG3A 4CC2A 3EG1A 1PKSA 1UECA 4OMNA 2E5KA 1A0NB 2J05A 2YT6A 1NLOC 2O2OA 2K9GA 2RQWA 3PVQA 1GL5A 1NG2A 2LQNA 3NMZC 4OMMA 1WYXA 4GBQA 2RQUA 3VS5A 2KNBB 2EYZA 2DL8A 2EGAA 2W0ZA 2FO0A 3NPFA 3UA7A 1UJ0A 2YSQA 2J7IA 2BZYA 1ARKA 1T3SA 5I11A 2KBTA 1U06A 3VS0A 3ULRB 5IXBA 2QDLA 1UJYA 2JS0A 4JJDA 2DF6A 2OI3A 2A08A 2I0NA 1QLYA 4JZ3A 5L23A 4A63B 2JW4A 2RPNA 3EGUA 1X6GA 4D8KA 1TUDA 1OPKA 2XMFA 4OMPA 1K0XA 3VS1A 1U3OA 5IH2A 1X2QA 1YCSB 2LNHB 2EKHA 2EW3A 1M8MA 2KGTA 1W1FA 2YUOA 4DEYA 1VYUA 1GRIA 1Y57A 4RTTA 2DRKA 1FYNA 2RMOA 3M0SA 1M30A 2DNUA 2MOXA 2DA9A 2O9SA 2L3PA 2A36A 4FSSA 2HBWA 1CKBA 2DRMA 4F16A 4JPBW 2ED1A 3U23A 4HCKA 2DL4A 2AKLA 2FRYA 4CC4B 4IIOA 5GJWB 2VKNA 2CDTA 4RTWA 1X27A 2C0IA 2YDLA 4JJBA 1S1NA 2HCKA 1JXMA 2V1QA 2KE9A 1AZEA 1WA7A 2FPFA 1G2BA 1UTIA 1VA7A 2C0OA 2CH4W 1LCKA 3I5SA 2O88A 2KRMA 2RNAA 1SHFA 2L2PA 2BZ8A 1JO8A 1MV0B 4LUEA 2EVRA 2JS2A 2DM1A 1X69A 1H8KA 2ABLA 1WXBA 1Z9QA 2X3XD 2RQVA 2FG0A 1FMKA 2P4RA 1E6GA 2DLPA 4CC7A 4Z88A 1WDXA 1M3AA 1N5ZA 3EG0A 4M4ZA 4Z8AA 2ECZA 1WI7A 1M27C 3SHWA 4ESRA 1W6XA 1BK2A 1RLPC 3H0IA 1ZLMA 1UGVA 1VYTA 2G6FX 2RQRA 1GFCA 1UFFA 1JXOA 2SRCA 2HEQA 2CSIA 1UE9A 1WXTA 2DYBA 5IXFA 1JU5C 5I22A 1JQQA 1NLPC 4J9HA 2EYWA 4ZNXA 1RI9A 2C0TA 4HVWA 2KEAA 3H0HA 1K9AA 1ABOA 4JJCA 1AWXA 1U5SA 3VRZA 1ZUUA 1X43A 2M0YA 4J9IA 1GFDA 2B86A 2ENMA 1SEMA 1PRLC 3JV3A 2PTKA 1GCPA 1HSQA 1H3HA 2CT4A 4D8DA 2YUPA 1UG1A 2K79A 2CUBA 2FPDA 4AFSC 4WCIA 3VS7A 2JTEA 4J9DA 1AOJA 3VS6A 2CUDA 4ORZA 1NYFA 1B07A 1BB9A 1SHGA 3REAB 1CSKA 1NEGA 1QWEA 1I07A 2KT8A 2GQIA 2A37A 1YNZA 1ZUYA 4RTYA 2JT4A 3H0FA 1GCQA 2KYMA 2D0NA 1W70A 2GNCA 5ECAA 2VVKA 1T3LA 1TUCA 2KRNA 3NGPA 2ED0A 2SEMA 1HJDA 1UDLA 3EG2A 2DL7A 2HDAA 4X1VA 1NYGA 2CH4A 2DX1A 4RTXA 2EGCA 2HSPA 5IHNA 4HXJA 5FW9A 1VYVA 2PZ1A 1AWOA 1Y0MA 4LNPA 1E7OA 2ROLA 2K3BA 1GBRA 2NWMA 3RNJA 3R6NA 1SRLA 3M0TA 2AKKA 2PNIA 1YP5A 2LZ6B 2DE0X 1G83A 2ESWA 2J6OA 3GBQA 1SPKA 2D8JA 2KYBA 2K7AA 3EHRA 1QKXA 2YUNA 1PHTA 3NHNA 1AD5A 4CC3A 4HVUA 2D1XA 2LX7A 3I35A 2CSQA 2A28A 1I1JA 1AWWA 1EFNA 4RTZA 3VS2A 3O5ZA 2AZVA 2D8HA 1OOTA 1PWTA 2KR3A 1KFZA 1V1CA 2F2WA 3VS3A 2O9VA 1KJWA 1RLQC 2MIOA 2BTTA 2AZSA 2F2XA 1I0CA 1RUWA 3M0PA 4LE9A 1TG0A 4EIKA 2DBKA 1NM7A 1YN8A 1WFWA 1PNJA 3UATA 2DJQA 4AFQC 4F14A 5FWBA 2GTOA 1QWFA 2M51A 1YWOA 2L0AA 1SRMA 2IIMA 2CT3A 2CREA 3M0UA 1K4US 1NEBA 1KSWA 2KXDA 1WLPB 3CQTA 2FRWA 1AEYA 4E6RA 2NUZA 4OMOA 2LJ3A 2J06A 1Z9ZA 4Y92A 3RBBB 1T0HA 4GLMA 5FWCA 1ZSGA 4IIMA 1GCQC 3UF4A 1WXUA 1ZBJA 2YUQA 1WX6A 2RN8A 3M0RA 4K11A 4AG1C 1X2KA 3UA6A 1M3CA 2JMCA 2VWFA 2DL3A 2GTJA 1J3TA 2MCNA 4J9GA 2EGEA 3PE0A 1OPLA 1XOVA 2ROTA 3REBB 3VRYA 3I5RA 1MUZA 3TSWA 2DMOA 4RUGA 2H8HA 4KRTA 2K2MA 2L3QA 2KRSA 2DL5A 4LUDA 4OMLA 4DEXA 2J6FA 2J6KA 4AG2C 4J9EA 2W10A 1M3BA 4OMQA 1AVZC 3ZL7C 1ABQA 1T0JA 2LCSA 1ZUKA 4HVVA 4RTVA 3EHQA 2JXBA 1IO6A 3A98A 2EYXA 2RF0A 2L3SA 2EYYA 2GBQA 2FEIA 5EC7A 1X6BA
chains in the Genus database with same CATH superfamily
2V1RA 1NJIR 1CKAA 4RTUA 3META 1K1ZA 5IAYA 3A5ZB 4WTOB 1C0MA 4A54A 3GLXA 5GANd 3S6WA 2X3WD 3L2QA 2ZPEB 1K0SA 4R0KA 2OTJT 2DPPB 2LJ1A 4GLKA 4QVDA 2C06A 4F04B 3QWYA 1NE8A 5J3BA 1VQ7T 2EBPA 2EJFA 2K2VA 3LLRA 3HL8A 1ZX6A 1KQSP 2IG0A 1G8XA 5D6XA 1MMGA 3CCQT 3OYNA 3QWXX 2LJ0A 2HQXA 5GAN7 4Z89A 3EFOA 1YWPA 3HPWA 5HCKA 3OW2P 5GAN6 5GMKe 2DILA 2K5FA 3V7RA 2EQIA 4J9BA 2OJ2A 2ZPHB 3N5BB 1Q81R 4M77F 5GAOr 5IHIA 5GAN3 3QDFA 3CCSA 1VQOQ 2ZCFB 2P0QA 4LDWA 5CR2A 1N6AA 3EG9B 4XAXB 4RMOA 3LWHA 1PKSA 3CCUT 4OMNA 3CCLA 1A0NB 5CQYA 5GAMh 1FX7A 2WACA 2O2OA 3PVQA 5CCAA 1NG2A 3SWNA 2D6FA 3CPWA 1X01A 1VQ9Q 1NJIU 5AT1B 3CMAQ 1VUBA 2W0ZA 3CCMQ 5KYNA 4MMLA 1S72Q 2CZ7B 2A3LA 3MPUB 2BZYA 1UGSB 4N4IA 1VQ4Q 1U06A 5LJ3g 3PT9A 1AT1B 5KE3A 2E3HA 1UJYA 4JJDA 1C1AA 1R0BG 4XTYA 3CC7A 5C6SA 4M75A 4A63B 1D09B 2JW4A 1ZA2B 1RL2A 1X6GA 2VGNA 4OMPA 1WHKA 2YHTA 4FCYA 3CC2T 2DJZA 3VS1A 1MNDA 1EZZB 1BCMA 5DM7R 5GAOl 1M8MA 3RR6A 4CI0C 1OX8A 1BI3A 1YHQT 2V8JA 2QQAA 2XIDA 1Q81U 5GAOm 1HK9A 7AT1B 3JCMc 2MOXA 2DA9A 3NTIA 4C92F 2L3PA 1FWZA 5GMKh 4PFPA 3GOXA 3CCRT 4HCCA 3M59A 1IB8A 3G4SQ 2DL4A 2NUTB 1VQ8T 5GJWB 5J39A 1X27A 2YDLA 4JJBA 4MMKA 2HCKA 2V1QA 2VASA 1N8RR 2KE9A 3PGGA 4J83A 4ZN1A 1VA7A 2C0OA 4FT2A 3CCJQ 4JRQA 3UPUA 3BW1A 3OYLA 1B7TA 1M2OA 1SSFA 4BUGA 5LJ5g 4OGEA 1ZSZC 4OF1A 2ABLA 2X3XD 4HKEA 2FG0A 1FMKA 4PLLA 4F7UG 2QXFA 4Z88A 1WDXA 1M3AA 2ECZA 1M27C 3X28B 2G3RA 2HL3A 2OAUA 3JSCA 1RLPC 3C95A 4HA8A 1M90U 1ZLMA 1Y7XA 3MEWA 2RQRA 4CRIA 1O9SA 3G6ET 3OQ5A 4Q5WA 1VQNQ 2OTLQ 1UE9A 1WXTA 2EWNA 1NLPC 1M90C 4HVWA 4TVRA 3H0HA 2MPXC 1VQLT 1AWXA 1U5SA 1TU0B 2WSEE 3CMET 1PRLC 5FRNA 3JV3A 2HAXA 2PTKA 2DXUA 2M9UA 1XNIA 2K79A 1K8AU 1K9MC 4A53A 3VS7A 3CXCA 4HT8A 3H6ZA 4JJNK 2NYSA 1BIBA 3M5AA 1CSKA 1IXDA 1K8AC 4C5EA 4BDYA 4C8QE 1SKUB 3X24B 1HYOA 4PJLA 3M9QA 4A4FA 5ECAA 4LD6A 1T3LA 3CD6A 2KRNA 1G3YA 1YJ9Q 2SEMA 1UDLA 4A4HA 2E64A 3OY9A 3H8ZA 3JCMJ 1KD1R 3JRZA 2EGCA 3WVDB 4FSXA 2PZ1A 2XG8D 2ROLA 1ZHIA 2EQKA 3GF5A 1UB4A 1ZQ1A 5FROA 2EJGA 3CPWS 1UEBA 1MHNA 1GBRA 4JRKA 3DB4A 1YIJT 4QQGA 2QA4A 3M0TA 5KYXB 2LZ6B 3A8GB 1YCYA 4M78G 1KQSA 3V7SA 3I56T 4GY5A 2OX7A 2K7AA 2LX9A 1X75C 1N27A 3OW2A 1AD5A 4KGVB 4HVUA 4XU3A 2PUKB 2D1XA 3QPHA 2A28A 3CCEQ 1WGSA 1AWWA 5KYWA 2CP7A 1VQMA 3O5ZA 2AZVA 1PWTA 3ZEHA 3O8VA 1YI2Q 1BYMA 3UWNA 3GIBA 2I2LA 2RJEA 3QSUA 4PFZA 2FZKB 1LVKA 2ZPIB 3LGFA 2RK2A 2F2XA 1I0CA 4F7UB 3PMTA 3X26B 4MZMA 5GANj 4EIKA 1NM7A 4NL3A 5A0GA 4AT1B 5GMKj 5CO7A 2GTOA 2M51A 1YWOA 2L3RA 3FDRA 2JVVA 2RD1A 3L1AA 3M0UA 5LJ3f 1NEBA 1KHIA 3M4YA 4M7DG 2NUZA 2XDDA 4LDUA 1F1BB 1T0HA 5FWCA 1IGUA 1YITQ 1GXIE 2OTJA 3UA6A 3JB9F 1M3CA 4A4KA 2DL3A 3LYIA 1LOJA 2LT4A 2GTJA 4ANJA 5CK9A 3QZ9B 4C8QA 3VYGA 1DJ7B 1VQ7A 1YJWQ 4PJOG 5I2MA 4B9WA 4X9CA 3L2ZA 3CCQA 2L3QA 2DL5A 4LUDA 4OMLA 5J26A 4DEXA 3CBPA 4N4GA 4AG2C 3I55T 5KYUB 2HKNA 1T0JA 3EHQA 1IO6A 1S72T 3A98A 2EAYA 2JN0A 1OYXA 3BY7A 4PNOA 2M16A 4FM4B 3G71T 1M1GA 5LJ5f 2BZXA 2X35A 4FYVB 3CCUA 4E7JA 3T9NA 4AFZC 1HD3A 1UHFA 1OV3A 4HCZA 4EMGA 2QEXQ 3EGDA 4C5IA 1K73U 4QQDA 1XJWB 1PRMC 2RHUA 3JAME 4FIBA 4J9CA 1B3QA 3CPFA 1H641 1BI1A 1LPLA 1M2VB 1R77A 4M77E 1OEBA 3M0QA 3NTKA 4ZTJA 4KUIA 3CXCS 4M78B 3SEMA 4F17A 4KUDK 1RAFB 5GJVB 5GMKl 3JCMg 1NPRA 3PIPA 1H92A 2CP2A 4LN2A 3H41A 1YJNT 3VS4A 5GMKm 2QTXA 2JM8A 2KXCA 5IHKA 3FJPA 4M7AG 2HNIA 3C0CA 2PQWA 3JCMP 1BI2A 2AK5A 2RQTA 1QMCA 4M78D 3CC2A 4AFUC 2HQEA 1AWJA 3FIFA 1WNLA 2O31A 1UHCA 2NUPB 1PC0A 2XICA 1YHQA 1QP3A 2KDSA 2MMPA 5GAMd 4R56A 1OU8A 3TCJA 1KQSS 1GL5A 5GAN8 4XQ3A 3F70A 4II1A 4GBQA 3CCRA 4M7DB 5EG2A 2EYZA 4M75C 1I5LA 2EGAA 1ZA1B 3OW2S 3LH0A 3NPFA 1VQ8A 2BIVA 3CCSQ 2J7IA 3L2WA 1T3SA 5GANg 2E41A 1VQNT 3L42A 3VS0A 5GAN4 5KCHA 2RJFA 4DOVA 2JS0A 3HKSA 1I4K1 4O5VA 4M7DD 3M57A 5FU7B 2RPNA 2CP5A 3EGDB 4PJOB 1JB0E 3SD4A 1X2QA 3CC4T 2EKHA 2EW3A 3HP9A 2EJ9A 2KGTA 3G6EA 4IUTA 3QO3A 1VYUA 5I21A 3M0SA 2DNUA 3P8HA 1VQLA 4JUVA 4PJOD 2DD5A 2K3XA 1IREB 1WJSA 4M77A 4JPBW 4C5HA 4F16A 2P4TA 3CMEA 2KY9A 1JJ2P 2FRYA 4XK8E 3FB9A 1RAIB 2CDTA 2C0IA 1S1NA 3BFMA 1JXMA 5FU6C 4KULA 1M1KU 2FPFA 1IZ6A 4ELYC 1UTIA 3MEVA 2LQKA 3CBOA 3I5SA 2KRMA 3MEAA 2BZ8A 1UGPB 2EVRA 2JS2A 1D1BA 1Z9QA 1M1KC 2CZ1B 4CC7A 4E2FB 1N5ZA 2HD0A 1RAAB 3AHUA 1W2BP 1VIEA 4RG2A 3H0IA 4J6WA 1UGVA 2G6FX 3Q1JA 4C92G 1TH7A 2ATCB 4M75G 4M7AB 2DEQA 2LDMA 2SRCA 2CSIA 3HHTB 1Q95G 2RK1A 1EIFA 3L2UA 5I22A 4A4EA 2EYWA 2LC4A 4BY6B 2C0TA 3QZ5B 4DBQA 4EMKA 4JJCA 4ZTFA 1KC8R 1OU9A 1YIJA 2E6ZA 2M0YA 2Z0WA 2B86A 2GFAA 3MP6A 4V2SA 1HSQA 1PSEA 4M7AD 1H3HA 4E47A 3I56A 2CT4A 1NJIC 2KQWA 2YUPA 1UG1A 2CUBA 1WHHA 1VQ5T 1G3TA 3GNGA 4J9DA 1AOJA 4C92A 4UC4A 4ORZA 2DEUA 2LT1A 2K57A 3OYDA 2VC8A 4N0AC 3REAB 3PIOA 1FMWA 4J8OA 1ZUYA 1RADB 3H0FA 1GCQA 4XU2A 4BACA 1W70A 2GNCA 1RAHB 2VVKA 1TUCA 5M9OA 1VQPT 3OS1A 3HFNA 4EMHA 2ZPBB 2ED0A 4JS5A 2DL7A 3VYHB 1VIFA 1UGQB 2CH4A 2DX1A 4RTXA 1H3ZA 1Y0MA 5CIUA 1B34A 3JCMf 2RHZA 5A0LA 3EFOB 3OYHA 1Q81C 3LX7A 4BE2A 2PNIA 2ESWA 2DTHA 3QYGB 3E9GA 2VXFA 2E1HA 1G5VA 4CC3A 2RI3A 6AT1B 1EX4A 2LX7A 5CKHA 2CP6A 4M78C 4NS5A 1I1JA 3M55A 2X51A 1KHCA 4RTZA 3VS2A 3NTHA 3E19A 3SWNB 4NL2A 2KR3A 2DETA 4FYXB 3V8KA 3VUBA 1V1CA 4JRPA 4BDZA 3QJ6A 2QEXT 2F2WA 3VS3A 2VUBA 5KYYA 2QA4Q 2QQBA 3I55A 3OYIA 1KJWA 2CKKA 5LJ3e 4IUPA 1RI0A 3M0PA 3OMGA 3OB9A 3UATA 2E5QA 4F14A 3CCVQ 2LCLA 1S72A 5FWBA 2E3IA 5GANf 3OYBA 1SRMA 3A8OB 3VKIA 4LDYA 2KXDA 4LDVA 2JOYA 5CVIA 1YBYA 4C92B 3G71A 4DOWA 2FRWA 2IPOB 4M75B 3P8DA 1AEYA 4E6RA 1VQMQ 2QTVA 2QASA 2J06A 1Z9ZA 2DO3A 2LJ3A 2QI2A 4J6YA 3RBBB 5CKEA 1VQKT 4DBFA 2O4XA 4BI4A 1ZBJA 2EYQA 2L5QA 4E7SA 2RN8A 4K11A 4M7DC 4AG1C 1X2KA 4L6V5 3OYMA 3M54A 1XTDA 2MCNA 4J9GA 3M4GA 4C92D 4KT0E 4M75D 1N8RU 4OP0A 3VRYA 2MWOA 3I5RA 1MUZA 3TSWA 3QKJA 2FHDA 3MP1A 2DXTA 1IHWA 2J6FA 1YJNA 3NFCA 4MDWA 4QVZA 4C0ZA 1N8RC 1M3BA 5FU7C 3ZBDA 1AVZC 5GAMj 2DVEA 3ZL7C 1ABQA 4PJOC 3M58A 1ZUKA 5LJ5e 4RTVA 2EYXA 3J7AF 2GBQA 2FEIA 1X6BA 1GFDA 5CKFA 1JJ2A 2YWWA 1NPPA 4F7UF 2O01E 5IT9E 8ATCB 3TQ7P 1VQ7Q 1PD1A 1GBQA 3RKXA 2LMJA 2F1LA 3VV0A 2CP3A 2CZ0B 3KXTA 2X4JA 5FU6B 4XTWA 3CCQQ 1KK7A 3I9QA 5LJ3h 4MDXA 2KROA 3EGXA 1R8OB 3TU4K 4BE1A 2HMAA 2DVJA 1P92A 2HSEB 2QQ9A 1VQ6Q 3LH5A 1W2BA 2LRQA 4IURA 2FZCB 1SSHA 1VQNA 1WIEA 3JB9I 1KQ1A 2R57A 3A1PA 2QK0A 5C0MA 4ZGDB 3GP8A 1PKTA 1D0ZA 2RA2A 4KGZB 4J7IA 2CYZB 3DB3A 4C8QG 4FL6A 1QVPA 4XTVA 3RMQA 4LDXA 2JMAA 1JBMA 2YLBA 3E9FA 3CC4A 2GGRA 2VB6A 3EG3A 2PVOB 4CC2A 4M7AC 1Y96A 3EG1A 3JCMV 1KD1U 5KE2A 2RI2A 2RJCA 1UECA 1ZSZA 4FT4A 3V8JA 3QXEB 2YXYA 2YT6A 1NLOC 2K9GA 4BY6C 1IGQA 1WYXA 2RQUA 4XTUA 2KNBB 1M4ZA 3OBWA 1KD1C 5LJ5h 1VQOT 2ZGWA 1Q86R 4A4GA 2XDBA 3VJPA 3CC2Q 3GPLA 5DLOA 2BUDA 1UJ0A 3P8BB 2RHIA 3AT1B 1ARKA 2BE7D 5I11A 2KBTA 1Q82R 2PVGB 2RHYA 1RAEB 3ULRB 2QDLA 5IXBA 1TSFA 4M78F 1YHQQ 2RB6A 3RMSA 3ZFJA 2A08A 1QLYA 1VQ9T 2DERA 3CMAT 3CCMT 2F5KA 4C0FA 1U1TA 3EGUA 4D8KA 3CCRQ 1PCXA 3EGXB 1K0XA 4PJNA 1U3OA 5IH2A 2V8IA 2BE9B 1YCSB 1VQ4T 2LNHB 1Q7YR 2X4XA 3X20B 1TUGB 3FEOA 3DLLA 1MMNA 2YUOA 3QG1A 5KYWB 2DXCA 4XU0A 1Y57A 4RTTA 2DRKA 3EAEA 2FB7A 3JB9J 4QVCA 4X9DA 1RAGB 2O9SA 2FL7A 2A36A 5D6YA 3OYGA 1CKBA 2RI5A 4HCKA 4OGCA 2XU8A 1G3SA 4IIOA 4FW2A 4KGXB 3CEYA 4E7LA 5GAMg 1TOVA 1K73C 1AZEA 4M7DF 3SDZA 5D6WA 3S3NA 1VQ5A 2MF2A 5I2SA 3E2UA 3MHXA 1MV0B 1Q86U 3BE3A 4LUEA 3RKYA 2DM1A 1X69A 1H8KA 1WXBA 3L2VA 2WSFE 3G4ST 1E6GA 2DLPA 1Q82U 3HRSA 1I81A 5AYFA 3SWNC 1VQLQ 3EG0A 4M4ZA 3QUIA 4Z8AA 1WI7A 1D3BA 3SHWA 2KAFA 1BK2A 1VQPA 1JRIA 4IUVA 1QQJA 3CCJT 2YRVA 2JUFA 4ZGJB 3BDUA 3OYJA 3HSBA 1JJ2S 4EPCA 1GFCA 4PJOF 1JXOA 2JTMA 4BE0A 4C8QB 2HEQA 1XQHA 2DYBA 4KH1B 5IXFA 1JU5C 4QW2A 1JQQA 4J9HA 4E7KA 4ZNXA 1RI9A 2KEAA 4C92C 3D7SB 3VRZA 1TWBA 1QCOA 1HXDA 1MMDA 4EDUA 4PL6A 3URGA 1OZ3A 4J9IA 3A8HB 2ENMA 4PLIA 1SEMA 3MKDA 4BD3A 5CQXA 1GCPA 4NOYA 1IHVA 4C8QD 2OTLT 1W2BS 1WHLA 4AFSC 3C12A 1OQKA 2AHJB 2B8AA 2IVWA 3KBGA 2RJDA 3VS6A 2D0QB 4M77G 3CCLQ 3EG9A 2VV5A 1NYFA 2EQMA 2MWPA 4JDSA 2DZ9A 4L5GA 1BB9A 5LL6S 3X25B 5GAOp 4OB3B 2GQIA 3PNWC 5KCOA 2KYMA 2RH2A 2D0NA 2NLUA 1YIJQ 2QEXA 3QIIA 3NGPA 1ACMB 3QJYA 2AIRB 1AHJB 2YRCA 3EG2A 4X1VA 4M75E 3A8LB 3JCMe 1NYGA 5HY6A 3I56Q 4C5GA 1M8VA 2HSPA 5IHNA 4HXJA 5FW9A 1VYVA 3V8LA 2E6NA 1E7OA 2QGFB 2VXEA 2XK0A 4J7FA 3CC7Q 4M7AF 3RERA 1QVGP 1LNXA 2NWMA 3HFOA 1IRXA 3R6NA 1YJ9T 2AKKA 4JS4A 1VQKA 1YP5A 2LVMA 5GMKi 2DE0X 1G83A 2HBPA 2D8JA 1WJQA 1D3BB 3MCAB 3A8MB 1QKXA 1PHTA 2X4YA 3EH1A 2HL5C 3DLMA 1NBEB 4ATOA 3I35A 4MZPA 1EFNA 2X9HA 1OOTA 4XTXA 2DTIA 3RESA 3LW5E 2LCCA 3HRUA 1V76A 5GANe 2P84A 2BTTA 2AZSA 4LE9A 2NUTA 4AMCA 1YN8A 1PNJA 3CCET 1VQ6T 4PJJA 4RCCA 1QWFA 2E12A 2A0FB 2L0AA 2IIMA 2CREA 1K4US 3JCMQ 1KSWA 1R0CB 4FYYB 1V29B 1WLPB 2MK5A 1YI2T 1ZBXA 1QVFP 4OMOA 2XDPA 3J81E 1MGQA 4GLMA 1M9SA 1U8RA 4IIMA 3UF4A 3HTRA 1WXUA 3EFSA 3JCMh 3I55Q 2XKOC 4E7IA 2VWFA 2DIQA 1J3TA 3G7ZA 3PE0A 4RCBA 3OSSC 1X6OA 4F7UE 1MNEA 4IKFA 4C0GA 3G71Q 5CAIA 4JLGA 1WPYA 2E4HA 5GAN2 2K2MA 4QQ6A 2KRSA 4M77B 2COWA 1YITT 2GQVA 3OS5A 1M90R 4J9EA 4OMQA 4O6JA 1WQWA 4HVVA 5GAMf 1UGRB 2E70A 4R55A 1OX9A 2RF0A 2L3SA 2EYYA 4C0DB 2QGGA 2CS7A 4BI3A 1YJWT 5EC7A 3EH2A 3KUFA 2Y90A 1KIKA 1QKWA 3KFVA 2KI7A 1AZGB 1K9MR 1PSFA 1QW1A 2JM9A 2K3YA 3ME9A 4M77D 3TSZA 2K6DA 3OYCA 2YRDA 3OMCA 4KH0B 5LJ3d 2QDYB 5GANh 4QT7A 3CD6Q 2LP5A 4M75F 1YJNQ 1BU1A 1KC8U 1WHMA 2EPDA 1K8AR 1VQOA 2OAWA 2YLCA 2H3JA 2KT1A 3MJXA 2DBMA 3THKA 3IQLA 3FJ5A 1JEGA 2JTFA 4FW1A 1MMAA 1O75A 2LQWA 2F2VA 4JZ4A 4RG8A 3ASKA 3G1JA 1KC8C 4EMKB 5GAN5 1UUEA 1RACB 2ZAEA 3QBYA 1E6HA 1KQ2A 1K76A 1BCOA 1VQ9A 3TVTA 2ZPGB 3CMAA 4B6MA 2A7YA 3CCMA 1QCFA 1BBZA 5KYXA 2QAZA 1RABB 2L8DA 2JZ2A 3MEUA 2FPEA 3PVLA 2COZA 2F69A 3RDVA 1VQ4A 4J9FA 2E65A 3OBYA 1MV3A 2LTOA 2KMTA 2JNGA 2WSCE 4C8QC 2E5KA 4YTLA 3QDRB 2J05A 4M78E 2E10A 2RQWA 2BKDN 2VGMA 2EQUA 2LQNA 2FZGB 3NMZC 1LJOA 4OMMA 3VS5A 2PUOB 2M02A 5LJ5d 5A2QE 1K9MU 2DL8A 4J6XA 2FO0A 3TREA 2ZPFB 1TXQA 2CP0A 1SG5A 3OYFA 2KSSA 4BB7A 3UA7A 4F7UA 1QP2A 2YSQA 2Y4XA 2Y4YA 2QYZA 3CC4Q 2R5AA 1B34B 4P5NA 3ER0A 4DQ2A 1WJRA 4FYWB 4E7HA 3GNFB 4ZN3A 2DIGA 2DF6A 2OI3A 3WXMB 1YFNA 2I0NA 3PFSA 4D6WA 4JZ3A 5L23A 2XD0A 4OMFB 3JCMb 3LGLA 3PTAA 4B9XA 3G4SA 5HK0A 1TUDA 1OPKA 2XMFA 2OTJQ 1QVGA 2V8KA 4HCBA 3CCST 1G3WA 4XU1A 3JB9H 3OS0A 2RM4A 3CCJA 3OYEA 2F5TX 4M7DE 1W1FA 4DEYA 3JB9G 3CBMA 3VUZA 1BKBA 1GRIA 3CCLT 1TS9A 4N0AA 1FYNA 2RMOA 1M30A 2KK4A 4IUUA 5A0DA 3V7CA 5KYYB 5FLXE 4FSSA 2DD4A 2HBWA 2DRMA 1U1SA 2MYSA 5GAOn 2ED1A 2RHXA 4FU6A 5D7UA 3U23A 1PG5B 4PKCC 3M53A 2AKLA 3VU3C 2R5MA 4CC4B 2QG9B 1D0YA 4J5YA 5KYUA 4QKUA 2VKNA 4RTWA 3RKWA 4DA4A 3C94A 1WA7A 1Y07A 2FVUA 2OTLA 1G2BA 4PJOE 2CH4W 1LCKA 1M5Q1 2O88A 3CCVA 2RNAA 1SHFA 2L2PA 4ZGEB 3JCMX 3CCUQ 2P0PA 1JO8A 3E1SA 4E7ZA 3CC7T 2QQRA 2O4XB 2RQVA 1N9SA 1PD0A 2P4RA 3INZA 4PJMA 1W4SA 4Z02A 5CKBA 2GF7A 4X34A 4ESRA 1W6XA 1QVFA 5DLQE 2DZCA 3MO8A 1VYTA 8AT1B 1FMVA 3OS2A 4LXCA 1M2VA 1UFFA 1WQ7A 4M78A 1OULA 1D1AA 2KVQG 3JCMW 3DKMA 4ME7A 1VQ5Q 2DYIA 1TTHB 4XTZA 4N4HA 1K9AA 1ABOA 1NZ9A 2K5LA 1K73R 1ZUUA 5HK3A 2M0OA 4KBMB 1X43A 3LWIA 1QCNA 5L8RE 1YJ9A 3UDCA 3FRNA 2L89A 4D8DA 1VQPQ 2FPDA 1N9RA 3R6OA 4ELZC 4IUQA 4WCIA 5GAOq 4OB0B 2PVDB 2X4WA 2JTEA 2CUDA 2NUPA 3CPWP 2DFUA 2HQHA 2AT1B 1B07A 2CZ6B 2GCXA 2DK3A 4DBHA 3SB2A 1SHGA 3OYKA 5KH6A 1I8FA 4M7AE 1BIAA 5DY9A 1NEGA 1QWEA 1I07A 2KT8A 2A37A 1YNZA 4RTYA 3L2RA 2JT4A 4M77C 4M7DA 1VQ8Q 3BDLA 2EQJA 1HJDA 4JLIA 2HDAA 3HRTA 4DBRA 2HKQB 3CCEA 1VQ6A 3WVEB 1AWOA 4LNPA 4C0DC 2R58A 3S3OA 4RKUE 4HT9A 1SF9A 1OI1A 2K3BA 3FLGA 1YI2A 4C8QF 4PFOA 4Y91A 2DAQA 3RNJA 2COYA 1SRLA 3TEEA 2QQSA 1FXXA 1BI0A 2J6OA 3GBQA 1SPKA 1WHJA 3PMIA 4PJOA 2KYBA 4OB1B 3EHRA 2YUNA 2H3EB 2EIFA 3C4SA 3NHNA 9ATCB 2GFUA 3G6EQ 5HKCA 1Y96B 2CSQA 1ZSZB 4MZTA 2EKOA 2FYKA 2HZYA 2DKGA 1WHGA 2DXBA 3JB9D 1WZOA 2D8HA 3SFMA 2K5IA 4EMKC 2LQ8A 1KFZA 1Q86C 1QVGS 4OB2B 3CMEQ 3CD6T 3UT1A 1YITA 2O9VA 1VQKQ 4JRIA 3QHSA 4Y28E 5IN1A 1RLQC 2MIOA 3OA6A 1Q82C 1VOMA 1RUWA 1TG0A 2DBKA 1WFWA 2JJ9A 5LJ3j 2DJQA 4AFQC 3M56A 3RUXA 3MP8A 2CT3A 1Q7YU 1YJWA 3OYYA 4PK4A 3CQTA 1PM3A 2EFIA 4L59A 5FRMA 2D9TA 4Y92A 2QA4T 4LD9K 2M1HA 4WF2A 1I5OB 1ZSGA 4VUBA 2PU9B 1GCQC 3OYAA 4BI8B 3FC3A 1Q7YC 2ZZDA 4OVAA 2YUQA 3JCMd 1WX6A 1M1KR 1D1CA 3M0RA 2V26A 2JMCA 3CCVT 1Y71A 3RIRA 2LNVA 2EGEA 2DTOA 1OPLA 1XOVA 2ROTA 5CKDA 4M7AA 2MI6A 3REBB 1OZ2A 1VQMT 3OSVA 2DMOA 3J80E 2K4YA 2RO0A 2MAMA 4RUGA 2H8HA 4KRTA 1C6VX 3H9NA 1M1FA 2XHCA 2CGHA 1KG1A 2XI9A 5GAMe 1D0XA 2J6KA 3QYHB 1QVFS 4C92E 2W10A 3EFRA 2P0KA 3CXCP 2VYTA 2LCSA 2JXBA 5LJ5j 3S3MA
chains in the Genus database with same CATH topology
2V1RA 1KIKA 1CKAA 1QKWA 3KFVA 4RTUA 2BZXA 1AZGB 1K1ZA 2JM9A 3TSZA 2K6DA 1GBQA 2LMJA 4AFZC 1HD3A 1UHFA 1OV3A 4QT7A 2X3WD 3I9QA 2LP5A 2KROA 1PRMC 1K0SA 4R0KA 1BU1A 2EPDA 2OAWA 4J9CA 2DVJA 1B3QA 2KT1A 2LJ1A 1OEBA 3M0QA 2DBMA 3QWYA 3THKA 3IQLA 3SEMA 3FJ5A 1JEGA 3LH5A 2LQWA 4F17A 2F2VA 2EBPA 4JZ4A 1ZX6A 1SSHA 5GJVB 1WIEA 1UUEA 1H92A 1E6HA 4LN2A 3H41A 1K76A 3QWXX 3TVTA 2LJ0A 3VS4A 4Z89A 1PKTA 1YWPA 2JM8A 5HCKA 2KXCA 5IHKA 2DILA 1QCFA 2EQIA 3C0CA 2AK5A 1BBZA 2RQTA 4J9BA 2OJ2A 4AFUC 5IHIA 2JMAA 2FPEA 3PVLA 1AWJA 4J9FA 2GGRA 1UHCA 2O31A 1MV3A 3EG3A 4CC2A 3EG1A 1PKSA 1UECA 4OMNA 2E5KA 1A0NB 2J05A 2YT6A 1NLOC 2O2OA 2K9GA 2RQWA 3PVQA 1GL5A 1NG2A 2LQNA 3NMZC 4OMMA 1WYXA 4GBQA 2RQUA 3VS5A 2KNBB 2EYZA 2DL8A 2EGAA 2W0ZA 2FO0A 3NPFA 3UA7A 1UJ0A 2YSQA 2J7IA 2BZYA 1ARKA 1T3SA 5I11A 2KBTA 1U06A 3VS0A 3ULRB 5IXBA 2QDLA 1UJYA 2JS0A 4JJDA 2DF6A 2OI3A 2A08A 2I0NA 1QLYA 4JZ3A 5L23A 4A63B 2JW4A 2RPNA 3EGUA 1X6GA 4D8KA 1TUDA 1OPKA 2XMFA 4OMPA 1K0XA 3VS1A 1U3OA 5IH2A 1X2QA 1YCSB 2LNHB 2EKHA 2EW3A 1M8MA 2KGTA 1W1FA 2YUOA 4DEYA 1VYUA 1GRIA 1Y57A 4RTTA 2DRKA 1FYNA 2RMOA 3M0SA 1M30A 2DNUA 2MOXA 2DA9A 2O9SA 2L3PA 2A36A 4FSSA 2HBWA 1CKBA 2DRMA 4F16A 4JPBW 2ED1A 3U23A 4HCKA 2DL4A 2AKLA 2FRYA 4CC4B 4IIOA 5GJWB 2VKNA 2CDTA 4RTWA 1X27A 2C0IA 2YDLA 4JJBA 1S1NA 2HCKA 1JXMA 2V1QA 2KE9A 1AZEA 1WA7A 2FPFA 1G2BA 1UTIA 1VA7A 2C0OA 2CH4W 1LCKA 3I5SA 2O88A 2KRMA 2RNAA 1SHFA 2L2PA 2BZ8A 1JO8A 1MV0B 4LUEA 2EVRA 2JS2A 2DM1A 1X69A 1H8KA 2ABLA 1WXBA 1Z9QA 2X3XD 2RQVA 2FG0A 1FMKA 2P4RA 1E6GA 2DLPA 4CC7A 4Z88A 1WDXA 1M3AA 1N5ZA 3EG0A 4M4ZA 4Z8AA 2ECZA 1WI7A 1M27C 3SHWA 4ESRA 1W6XA 1BK2A 1RLPC 3H0IA 1ZLMA 1UGVA 1VYTA 2G6FX 2RQRA 1GFCA 1UFFA 1JXOA 2SRCA 2HEQA 2CSIA 1UE9A 1WXTA 2DYBA 5IXFA 1JU5C 5I22A 1JQQA 1NLPC 4J9HA 2EYWA 4ZNXA 1RI9A 2C0TA 4HVWA 2KEAA 3H0HA 1K9AA 1ABOA 4JJCA 1AWXA 1U5SA 3VRZA 1ZUUA 1X43A 2M0YA 4J9IA 1GFDA 2B86A 2ENMA 1SEMA 1PRLC 3JV3A 2PTKA 1GCPA 1HSQA 1H3HA 2CT4A 4D8DA 2YUPA 1UG1A 2K79A 2CUBA 2FPDA 4AFSC 4WCIA 3VS7A 2JTEA 4J9DA 1AOJA 3VS6A 2CUDA 4ORZA 1NYFA 1B07A 1BB9A 1SHGA 3REAB 1CSKA 1NEGA 1QWEA 1I07A 2KT8A 2GQIA 2A37A 1YNZA 1ZUYA 4RTYA 2JT4A 3H0FA 1GCQA 2KYMA 2D0NA 1W70A 2GNCA 5ECAA 2VVKA 1T3LA 1TUCA 2KRNA 3NGPA 2ED0A 2SEMA 1HJDA 1UDLA 3EG2A 2DL7A 2HDAA 4X1VA 1NYGA 2CH4A 2DX1A 4RTXA 2EGCA 2HSPA 5IHNA 4HXJA 5FW9A 1VYVA 2PZ1A 1AWOA 1Y0MA 4LNPA 1E7OA 2ROLA 2K3BA 1GBRA 2NWMA 3RNJA 3R6NA 1SRLA 3M0TA 2AKKA 2PNIA 1YP5A 2LZ6B 2DE0X 1G83A 2ESWA 2J6OA 3GBQA 1SPKA 2D8JA 2KYBA 2K7AA 3EHRA 1QKXA 2YUNA 1PHTA 3NHNA 1AD5A 4CC3A 4HVUA 2D1XA 2LX7A 3I35A 2CSQA 2A28A 1I1JA 1AWWA 1EFNA 4RTZA 3VS2A 3O5ZA 2AZVA 2D8HA 1OOTA 1PWTA 2KR3A 1KFZA 1V1CA 2F2WA 3VS3A 2O9VA 1KJWA 1RLQC 2MIOA 2BTTA 2AZSA 2F2XA 1I0CA 1RUWA 3M0PA 4LE9A 1TG0A 4EIKA 2DBKA 1NM7A 1YN8A 1WFWA 1PNJA 3UATA 2DJQA 4AFQC 4F14A 5FWBA 2GTOA 1QWFA 2M51A 1YWOA 2L0AA 1SRMA 2IIMA 2CT3A 2CREA 3M0UA 1K4US 1NEBA 1KSWA 2KXDA 1WLPB 3CQTA 2FRWA 1AEYA 4E6RA 2NUZA 4OMOA 2LJ3A 2J06A 1Z9ZA 4Y92A 3RBBB 1T0HA 4GLMA 5FWCA 1ZSGA 4IIMA 1GCQC 3UF4A 1WXUA 1ZBJA 2YUQA 1WX6A 2RN8A 3M0RA 4K11A 4AG1C 1X2KA 3UA6A 1M3CA 2JMCA 2VWFA 2DL3A 2GTJA 1J3TA 2MCNA 4J9GA 2EGEA 3PE0A 1OPLA 1XOVA 2ROTA 3REBB 3VRYA 3I5RA 1MUZA 3TSWA 2DMOA 4RUGA 2H8HA 4KRTA 2K2MA 2L3QA 2KRSA 2DL5A 4LUDA 4OMLA 4DEXA 2J6FA 2J6KA 4AG2C 4J9EA 2W10A 1M3BA 4OMQA 1AVZC 3ZL7C 1ABQA 1T0JA 2LCSA 1ZUKA 4HVVA 4RTVA 3EHQA 2JXBA 1IO6A 3A98A 2EYXA 2RF0A 2L3SA 2EYYA 2GBQA 2FEIA 5EC7A 1X6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1R A;  1KIK A;  1CKA A;  1QKW A;  3KFV A;  4RTU A;  2BZX A;  1AZG B;  1K1Z A;  2JM9 A;  3TSZ A;  2K6D A;  1GBQ A;  2LMJ A;  4AFZ C;  1HD3 A;  1UHF A;  1OV3 A;  4QT7 A;  2X3W D;  3I9Q A;  2LP5 A;  2KRO A;  1PRM C;  1K0S A;  4R0K A;  1BU1 A;  2EPD A;  2OAW A;  4J9C A;  2DVJ A;  1B3Q A;  2KT1 A;  2LJ1 A;  1OEB A;  3M0Q A;  2DBM A;  3QWY A;  3THK A;  3IQL A;  3SEM A;  3FJ5 A;  1JEG A;  3LH5 A;  2LQW A;  4F17 A;  2F2V A;  2EBP A;  4JZ4 A;  1ZX6 A;  1SSH A;  5GJV B;  1WIE A;  1UUE A;  1H92 A;  1E6H A;  4LN2 A;  3H41 A;  1K76 A;  3QWX X;  3TVT A;  2LJ0 A;  3VS4 A;  4Z89 A;  1PKT A;  1YWP A;  2JM8 A;  5HCK A;  2KXC A;  5IHK A;  2DIL A;  1QCF A;  2EQI A;  3C0C A;  2AK5 A;  1BBZ A;  2RQT A;  4J9B A;  2OJ2 A;  4AFU C;  5IHI A;  2JMA A;  2FPE A;  3PVL A;  1AWJ A;  4J9F A;  2GGR A;  1UHC A;  2O31 A;  1MV3 A;  3EG3 A;  4CC2 A;  3EG1 A;  1PKS A;  1UEC A;  4OMN A;  2E5K A;  1A0N B;  2J05 A;  2YT6 A;  1NLO C;  2O2O A;  2K9G A;  2RQW A;  3PVQ A;  1GL5 A;  1NG2 A;  2LQN A;  3NMZ C;  4OMM A;  1WYX A;  4GBQ A;  2RQU A;  3VS5 A;  2KNB B;  2EYZ A;  2DL8 A;  2EGA A;  2W0Z A;  2FO0 A;  3NPF A;  3UA7 A;  1UJ0 A;  2YSQ A;  2J7I A;  2BZY A;  1ARK A;  1T3S A;  5I11 A;  2KBT A;  1U06 A;  3VS0 A;  3ULR B;  5IXB A;  2QDL A;  1UJY A;  2JS0 A;  4JJD A;  2DF6 A;  2OI3 A;  2A08 A;  2I0N A;  1QLY A;  4JZ3 A;  5L23 A;  4A63 B;  2JW4 A;  2RPN A;  3EGU A;  1X6G A;  4D8K A;  1TUD A;  1OPK A;  2XMF A;  4OMP A;  1K0X A;  3VS1 A;  1U3O A;  5IH2 A;  1X2Q A;  1YCS B;  2LNH B;  2EKH A;  2EW3 A;  1M8M A;  2KGT A;  1W1F A;  2YUO A;  4DEY A;  1VYU A;  1GRI A;  1Y57 A;  4RTT A;  2DRK A;  1FYN A;  2RMO A;  3M0S A;  1M30 A;  2DNU A;  2MOX A;  2DA9 A;  2O9S A;  2L3P A;  2A36 A;  4FSS A;  2HBW A;  1CKB A;  2DRM A;  4F16 A;  4JPB W;  2ED1 A;  3U23 A;  4HCK A;  2DL4 A;  2AKL A;  2FRY A;  4CC4 B;  4IIO A;  5GJW B;  2VKN A;  2CDT A;  4RTW A;  1X27 A;  2C0I A;  2YDL A;  4JJB A;  1S1N A;  2HCK A;  1JXM A;  2V1Q A;  2KE9 A;  1AZE A;  1WA7 A;  2FPF A;  1G2B A;  1UTI A;  1VA7 A;  2C0O A;  2CH4 W;  1LCK A;  3I5S A;  2O88 A;  2KRM A;  2RNA A;  1SHF A;  2L2P A;  2BZ8 A;  1JO8 A;  1MV0 B;  4LUE A;  2EVR A;  2JS2 A;  2DM1 A;  1X69 A;  1H8K A;  2ABL A;  1WXB A;  1Z9Q A;  2X3X D;  2RQV A;  2FG0 A;  1FMK A;  2P4R A;  1E6G A;  2DLP A;  4CC7 A;  4Z88 A;  1WDX A;  1M3A A;  1N5Z A;  3EG0 A;  4M4Z A;  4Z8A A;  2ECZ A;  1WI7 A;  1M27 C;  3SHW A;  4ESR A;  1W6X A;  1BK2 A;  1RLP C;  3H0I A;  1ZLM A;  1UGV A;  1VYT A;  2G6F X;  2RQR A;  1GFC A;  1UFF A;  1JXO A;  2SRC A;  2HEQ A;  2CSI A;  1UE9 A;  1WXT A;  2DYB A;  5IXF A;  1JU5 C;  5I22 A;  1JQQ A;  1NLP C;  4J9H A;  2EYW A;  4ZNX A;  1RI9 A;  2C0T A;  4HVW A;  2KEA A;  3H0H A;  1K9A A;  1ABO A;  4JJC A;  1AWX A;  1U5S A;  3VRZ A;  1ZUU A;  1X43 A;  2M0Y A;  4J9I A;  1GFD A;  2B86 A;  2ENM A;  1SEM A;  1PRL C;  3JV3 A;  2PTK A;  1GCP A;  1HSQ A;  1H3H A;  2CT4 A;  4D8D A;  2YUP A;  1UG1 A;  2K79 A;  2CUB A;  2FPD A;  4AFS C;  4WCI A;  3VS7 A;  2JTE A;  4J9D A;  1AOJ A;  3VS6 A;  2CUD A;  4ORZ A;  1NYF A;  1B07 A;  1BB9 A;  1SHG A;  3REA B;  1CSK A;  1NEG A;  1QWE A;  1I07 A;  2KT8 A;  2GQI A;  2A37 A;  1YNZ A;  1ZUY A;  4RTY A;  2JT4 A;  3H0F A;  1GCQ A;  2KYM A;  2D0N A;  1W70 A;  2GNC A;  5ECA A;  2VVK A;  1T3L A;  1TUC A;  2KRN A;  3NGP A;  2ED0 A;  2SEM A;  1HJD A;  1UDL A;  3EG2 A;  2DL7 A;  2HDA A;  4X1V A;  1NYG A;  2CH4 A;  2DX1 A;  4RTX A;  2EGC A;  2HSP A;  5IHN A;  4HXJ A;  5FW9 A;  1VYV A;  2PZ1 A;  1AWO A;  1Y0M A;  4LNP A;  1E7O A;  2ROL A;  2K3B A;  1GBR A;  2NWM A;  3RNJ A;  3R6N A;  1SRL A;  3M0T A;  2AKK A;  2PNI A;  1YP5 A;  2LZ6 B;  2DE0 X;  1G83 A;  2ESW A;  2J6O A;  3GBQ A;  1SPK A;  2D8J A;  2KYB A;  2K7A A;  3EHR A;  1QKX A;  2YUN A;  1PHT A;  3NHN A;  1AD5 A;  4CC3 A;  4HVU A;  2D1X A;  2LX7 A;  3I35 A;  2CSQ A;  2A28 A;  1I1J A;  1AWW A;  1EFN A;  4RTZ A;  3VS2 A;  3O5Z A;  2AZV A;  2D8H A;  1OOT A;  1PWT A;  2KR3 A;  1KFZ A;  1V1C A;  2F2W A;  3VS3 A;  2O9V A;  1KJW A;  1RLQ C;  2MIO A;  2BTT A;  2AZS A;  2F2X A;  1I0C A;  1RUW A;  3M0P A;  4LE9 A;  1TG0 A;  4EIK A;  2DBK A;  1NM7 A;  1YN8 A;  1WFW A;  1PNJ A;  3UAT A;  2DJQ A;  4AFQ C;  4F14 A;  5FWB A;  2GTO A;  1QWF A;  2M51 A;  1YWO A;  2L0A A;  1SRM A;  2IIM A;  2CT3 A;  2CRE A;  3M0U A;  1K4U S;  1NEB A;  1KSW A;  2KXD A;  1WLP B;  3CQT A;  2FRW A;  1AEY A;  4E6R A;  2NUZ A;  4OMO A;  2LJ3 A;  2J06 A;  1Z9Z A;  4Y92 A;  3RBB B;  1T0H A;  4GLM A;  5FWC A;  1ZSG A;  4IIM A;  1GCQ C;  3UF4 A;  1WXU A;  1ZBJ A;  2YUQ A;  1WX6 A;  2RN8 A;  3M0R A;  4K11 A;  4AG1 C;  1X2K A;  3UA6 A;  1M3C A;  2JMC A;  2VWF A;  2DL3 A;  2GTJ A;  1J3T A;  2MCN A;  4J9G A;  2EGE A;  3PE0 A;  1OPL A;  1XOV A;  2ROT A;  3REB B;  3VRY A;  3I5R A;  1MUZ A;  3TSW A;  2DMO A;  4RUG A;  2H8H A;  4KRT A;  2K2M A;  2L3Q A;  2KRS A;  2DL5 A;  4LUD A;  4OML A;  4DEX A;  2J6F A;  2J6K A;  4AG2 C;  4J9E A;  2W10 A;  1M3B A;  4OMQ A;  1AVZ C;  3ZL7 C;  1ABQ A;  1T0J A;  2LCS A;  1ZUK A;  4HVV A;  4RTV A;  3EHQ A;  2JXB A;  1IO6 A;  3A98 A;  2EYX A;  2RF0 A;  2L3S A;  2EYY A;  2GBQ A;  2FEI A;  5EC7 A;  1X6B A; 
#chains in the Genus database with same CATH topology
 2V1R A;  1NJI R;  1CKA A;  4RTU A;  3MET A;  1K1Z A;  5IAY A;  3A5Z B;  4WTO B;  1C0M A;  4A54 A;  3GLX A;  5GAN d;  3S6W A;  2X3W D;  3L2Q A;  2ZPE B;  1K0S A;  4R0K A;  2OTJ T;  2DPP B;  2LJ1 A;  4GLK A;  4QVD A;  2C06 A;  4F04 B;  3QWY A;  1NE8 A;  5J3B A;  1VQ7 T;  2EBP A;  2EJF A;  2K2V A;  3LLR A;  3HL8 A;  1ZX6 A;  1KQS P;  2IG0 A;  1G8X A;  5D6X A;  1MMG A;  3CCQ T;  3OYN A;  3QWX X;  2LJ0 A;  2HQX A;  5GAN 7;  4Z89 A;  3EFO A;  1YWP A;  3HPW A;  5HCK A;  3OW2 P;  5GAN 6;  5GMK e;  2DIL A;  2K5F A;  3V7R A;  2EQI A;  4J9B A;  2OJ2 A;  2ZPH B;  3N5B B;  1Q81 R;  4M77 F;  5GAO r;  5IHI A;  5GAN 3;  3QDF A;  3CCS A;  1VQO Q;  2ZCF B;  2P0Q A;  4LDW A;  5CR2 A;  1N6A A;  3EG9 B;  4XAX B;  4RMO A;  3LWH A;  1PKS A;  3CCU T;  4OMN A;  3CCL A;  1A0N B;  5CQY A;  5GAM h;  1FX7 A;  2WAC A;  2O2O A;  3PVQ A;  5CCA A;  1NG2 A;  3SWN A;  2D6F A;  3CPW A;  1X01 A;  1VQ9 Q;  1NJI U;  5AT1 B;  3CMA Q;  1VUB A;  2W0Z A;  3CCM Q;  5KYN A;  4MML A;  1S72 Q;  2CZ7 B;  2A3L A;  3MPU B;  2BZY A;  1UGS B;  4N4I A;  1VQ4 Q;  1U06 A;  5LJ3 g;  3PT9 A;  1AT1 B;  5KE3 A;  2E3H A;  1UJY A;  4JJD A;  1C1A A;  1R0B G;  4XTY A;  3CC7 A;  5C6S A;  4M75 A;  4A63 B;  1D09 B;  2JW4 A;  1ZA2 B;  1RL2 A;  1X6G A;  2VGN A;  4OMP A;  1WHK A;  2YHT A;  4FCY A;  3CC2 T;  2DJZ A;  3VS1 A;  1MND A;  1EZZ B;  1BCM A;  5DM7 R;  5GAO l;  1M8M A;  3RR6 A;  4CI0 C;  1OX8 A;  1BI3 A;  1YHQ T;  2V8J A;  2QQA A;  2XID A;  1Q81 U;  5GAO m;  1HK9 A;  7AT1 B;  3JCM c;  2MOX A;  2DA9 A;  3NTI A;  4C92 F;  2L3P A;  1FWZ A;  5GMK h;  4PFP A;  3GOX A;  3CCR T;  4HCC A;  3M59 A;  1IB8 A;  3G4S Q;  2DL4 A;  2NUT B;  1VQ8 T;  5GJW B;  5J39 A;  1X27 A;  2YDL A;  4JJB A;  4MMK A;  2HCK A;  2V1Q A;  2VAS A;  1N8R R;  2KE9 A;  3PGG A;  4J83 A;  4ZN1 A;  1VA7 A;  2C0O A;  4FT2 A;  3CCJ Q;  4JRQ A;  3UPU A;  3BW1 A;  3OYL A;  1B7T A;  1M2O A;  1SSF A;  4BUG A;  5LJ5 g;  4OGE A;  1ZSZ C;  4OF1 A;  2ABL A;  2X3X D;  4HKE A;  2FG0 A;  1FMK A;  4PLL A;  4F7U G;  2QXF A;  4Z88 A;  1WDX A;  1M3A A;  2ECZ A;  1M27 C;  3X28 B;  2G3R A;  2HL3 A;  2OAU A;  3JSC A;  1RLP C;  3C95 A;  4HA8 A;  1M90 U;  1ZLM A;  1Y7X A;  3MEW A;  2RQR A;  4CRI A;  1O9S A;  3G6E T;  3OQ5 A;  4Q5W A;  1VQN Q;  2OTL Q;  1UE9 A;  1WXT A;  2EWN A;  1NLP C;  1M90 C;  4HVW A;  4TVR A;  3H0H A;  2MPX C;  1VQL T;  1AWX A;  1U5S A;  1TU0 B;  2WSE E;  3CME T;  1PRL C;  5FRN A;  3JV3 A;  2HAX A;  2PTK A;  2DXU A;  2M9U A;  1XNI A;  2K79 A;  1K8A U;  1K9M C;  4A53 A;  3VS7 A;  3CXC A;  4HT8 A;  3H6Z A;  4JJN K;  2NYS A;  1BIB A;  3M5A A;  1CSK A;  1IXD A;  1K8A C;  4C5E A;  4BDY A;  4C8Q E;  1SKU B;  3X24 B;  1HYO A;  4PJL A;  3M9Q A;  4A4F A;  5ECA A;  4LD6 A;  1T3L A;  3CD6 A;  2KRN A;  1G3Y A;  1YJ9 Q;  2SEM A;  1UDL A;  4A4H A;  2E64 A;  3OY9 A;  3H8Z A;  3JCM J;  1KD1 R;  3JRZ A;  2EGC A;  3WVD B;  4FSX A;  2PZ1 A;  2XG8 D;  2ROL A;  1ZHI A;  2EQK A;  3GF5 A;  1UB4 A;  1ZQ1 A;  5FRO A;  2EJG A;  3CPW S;  1UEB A;  1MHN A;  1GBR A;  4JRK A;  3DB4 A;  1YIJ T;  4QQG A;  2QA4 A;  3M0T A;  5KYX B;  2LZ6 B;  3A8G B;  1YCY A;  4M78 G;  1KQS A;  3V7S A;  3I56 T;  4GY5 A;  2OX7 A;  2K7A A;  2LX9 A;  1X75 C;  1N27 A;  3OW2 A;  1AD5 A;  4KGV B;  4HVU A;  4XU3 A;  2PUK B;  2D1X A;  3QPH A;  2A28 A;  3CCE Q;  1WGS A;  1AWW A;  5KYW A;  2CP7 A;  1VQM A;  3O5Z A;  2AZV A;  1PWT A;  3ZEH A;  3O8V A;  1YI2 Q;  1BYM A;  3UWN A;  3GIB A;  2I2L A;  2RJE A;  3QSU A;  4PFZ A;  2FZK B;  1LVK A;  2ZPI B;  3LGF A;  2RK2 A;  2F2X A;  1I0C A;  4F7U B;  3PMT A;  3X26 B;  4MZM A;  5GAN j;  4EIK A;  1NM7 A;  4NL3 A;  5A0G A;  4AT1 B;  5GMK j;  5CO7 A;  2GTO A;  2M51 A;  1YWO A;  2L3R A;  3FDR A;  2JVV A;  2RD1 A;  3L1A A;  3M0U A;  5LJ3 f;  1NEB A;  1KHI A;  3M4Y A;  4M7D G;  2NUZ A;  2XDD A;  4LDU A;  1F1B B;  1T0H A;  5FWC A;  1IGU A;  1YIT Q;  1GXI E;  2OTJ A;  3UA6 A;  3JB9 F;  1M3C A;  4A4K A;  2DL3 A;  3LYI A;  1LOJ A;  2LT4 A;  2GTJ A;  4ANJ A;  5CK9 A;  3QZ9 B;  4C8Q A;  3VYG A;  1DJ7 B;  1VQ7 A;  1YJW Q;  4PJO G;  5I2M A;  4B9W A;  4X9C A;  3L2Z A;  3CCQ A;  2L3Q A;  2DL5 A;  4LUD A;  4OML A;  5J26 A;  4DEX A;  3CBP A;  4N4G A;  4AG2 C;  3I55 T;  5KYU B;  2HKN A;  1T0J A;  3EHQ A;  1IO6 A;  1S72 T;  3A98 A;  2EAY A;  2JN0 A;  1OYX A;  3BY7 A;  4PNO A;  2M16 A;  4FM4 B;  3G71 T;  1M1G A;  5LJ5 f;  2BZX A;  2X35 A;  4FYV B;  3CCU A;  4E7J A;  3T9N A;  4AFZ C;  1HD3 A;  1UHF A;  1OV3 A;  4HCZ A;  4EMG A;  2QEX Q;  3EGD A;  4C5I A;  1K73 U;  4QQD A;  1XJW B;  1PRM C;  2RHU A;  3JAM E;  4FIB A;  4J9C A;  1B3Q A;  3CPF A;  1H64 1;  1BI1 A;  1LPL A;  1M2V B;  1R77 A;  4M77 E;  1OEB A;  3M0Q A;  3NTK A;  4ZTJ A;  4KUI A;  3CXC S;  4M78 B;  3SEM A;  4F17 A;  4KUD K;  1RAF B;  5GJV B;  5GMK l;  3JCM g;  1NPR A;  3PIP A;  1H92 A;  2CP2 A;  4LN2 A;  3H41 A;  1YJN T;  3VS4 A;  5GMK m;  2QTX A;  2JM8 A;  2KXC A;  5IHK A;  3FJP A;  4M7A G;  2HNI A;  3C0C A;  2PQW A;  3JCM P;  1BI2 A;  2AK5 A;  2RQT A;  1QMC A;  4M78 D;  3CC2 A;  4AFU C;  2HQE A;  1AWJ A;  3FIF A;  1WNL A;  2O31 A;  1UHC A;  2NUP B;  1PC0 A;  2XIC A;  1YHQ A;  1QP3 A;  2KDS A;  2MMP A;  5GAM d;  4R56 A;  1OU8 A;  3TCJ A;  1KQS S;  1GL5 A;  5GAN 8;  4XQ3 A;  3F70 A;  4II1 A;  4GBQ A;  3CCR A;  4M7D B;  5EG2 A;  2EYZ A;  4M75 C;  1I5L A;  2EGA A;  1ZA1 B;  3OW2 S;  3LH0 A;  3NPF A;  1VQ8 A;  2BIV A;  3CCS Q;  2J7I A;  3L2W A;  1T3S A;  5GAN g;  2E41 A;  1VQN T;  3L42 A;  3VS0 A;  5GAN 4;  5KCH A;  2RJF A;  4DOV A;  2JS0 A;  3HKS A;  1I4K 1;  4O5V A;  4M7D D;  3M57 A;  5FU7 B;  2RPN A;  2CP5 A;  3EGD B;  4PJO B;  1JB0 E;  3SD4 A;  1X2Q A;  3CC4 T;  2EKH A;  2EW3 A;  3HP9 A;  2EJ9 A;  2KGT A;  3G6E A;  4IUT A;  3QO3 A;  1VYU A;  5I21 A;  3M0S A;  2DNU A;  3P8H A;  1VQL A;  4JUV A;  4PJO D;  2DD5 A;  2K3X A;  1IRE B;  1WJS A;  4M77 A;  4JPB W;  4C5H A;  4F16 A;  2P4T A;  3CME A;  2KY9 A;  1JJ2 P;  2FRY A;  4XK8 E;  3FB9 A;  1RAI B;  2CDT A;  2C0I A;  1S1N A;  3BFM A;  1JXM A;  5FU6 C;  4KUL A;  1M1K U;  2FPF A;  1IZ6 A;  4ELY C;  1UTI A;  3MEV A;  2LQK A;  3CBO A;  3I5S A;  2KRM A;  3MEA A;  2BZ8 A;  1UGP B;  2EVR A;  2JS2 A;  1D1B A;  1Z9Q A;  1M1K C;  2CZ1 B;  4CC7 A;  4E2F B;  1N5Z A;  2HD0 A;  1RAA B;  3AHU A;  1W2B P;  1VIE A;  4RG2 A;  3H0I A;  4J6W A;  1UGV A;  2G6F X;  3Q1J A;  4C92 G;  1TH7 A;  2ATC B;  4M75 G;  4M7A B;  2DEQ A;  2LDM A;  2SRC A;  2CSI A;  3HHT B;  1Q95 G;  2RK1 A;  1EIF A;  3L2U A;  5I22 A;  4A4E A;  2EYW A;  2LC4 A;  4BY6 B;  2C0T A;  3QZ5 B;  4DBQ A;  4EMK A;  4JJC A;  4ZTF A;  1KC8 R;  1OU9 A;  1YIJ A;  2E6Z A;  2M0Y A;  2Z0W A;  2B86 A;  2GFA A;  3MP6 A;  4V2S A;  1HSQ A;  1PSE A;  4M7A D;  1H3H A;  4E47 A;  3I56 A;  2CT4 A;  1NJI C;  2KQW A;  2YUP A;  1UG1 A;  2CUB A;  1WHH A;  1VQ5 T;  1G3T A;  3GNG A;  4J9D A;  1AOJ A;  4C92 A;  4UC4 A;  4ORZ A;  2DEU A;  2LT1 A;  2K57 A;  3OYD A;  2VC8 A;  4N0A C;  3REA B;  3PIO A;  1FMW A;  4J8O A;  1ZUY A;  1RAD B;  3H0F A;  1GCQ A;  4XU2 A;  4BAC A;  1W70 A;  2GNC A;  1RAH B;  2VVK A;  1TUC A;  5M9O A;  1VQP T;  3OS1 A;  3HFN A;  4EMH A;  2ZPB B;  2ED0 A;  4JS5 A;  2DL7 A;  3VYH B;  1VIF A;  1UGQ B;  2CH4 A;  2DX1 A;  4RTX A;  1H3Z A;  1Y0M A;  5CIU A;  1B34 A;  3JCM f;  2RHZ A;  5A0L A;  3EFO B;  3OYH A;  1Q81 C;  3LX7 A;  4BE2 A;  2PNI A;  2ESW A;  2DTH A;  3QYG B;  3E9G A;  2VXF A;  2E1H A;  1G5V A;  4CC3 A;  2RI3 A;  6AT1 B;  1EX4 A;  2LX7 A;  5CKH A;  2CP6 A;  4M78 C;  4NS5 A;  1I1J A;  3M55 A;  2X51 A;  1KHC A;  4RTZ A;  3VS2 A;  3NTH A;  3E19 A;  3SWN B;  4NL2 A;  2KR3 A;  2DET A;  4FYX B;  3V8K A;  3VUB A;  1V1C A;  4JRP A;  4BDZ A;  3QJ6 A;  2QEX T;  2F2W A;  3VS3 A;  2VUB A;  5KYY A;  2QA4 Q;  2QQB A;  3I55 A;  3OYI A;  1KJW A;  2CKK A;  5LJ3 e;  4IUP A;  1RI0 A;  3M0P A;  3OMG A;  3OB9 A;  3UAT A;  2E5Q A;  4F14 A;  3CCV Q;  2LCL A;  1S72 A;  5FWB A;  2E3I A;  5GAN f;  3OYB A;  1SRM A;  3A8O B;  3VKI A;  4LDY A;  2KXD A;  4LDV A;  2JOY A;  5CVI A;  1YBY A;  4C92 B;  3G71 A;  4DOW A;  2FRW A;  2IPO B;  4M75 B;  3P8D A;  1AEY A;  4E6R A;  1VQM Q;  2QTV A;  2QAS A;  2J06 A;  1Z9Z A;  2DO3 A;  2LJ3 A;  2QI2 A;  4J6Y A;  3RBB B;  5CKE A;  1VQK T;  4DBF A;  2O4X A;  4BI4 A;  1ZBJ A;  2EYQ A;  2L5Q A;  4E7S A;  2RN8 A;  4K11 A;  4M7D C;  4AG1 C;  1X2K A;  4L6V 5;  3OYM A;  3M54 A;  1XTD A;  2MCN A;  4J9G A;  3M4G A;  4C92 D;  4KT0 E;  4M75 D;  1N8R U;  4OP0 A;  3VRY A;  2MWO A;  3I5R A;  1MUZ A;  3TSW A;  3QKJ A;  2FHD A;  3MP1 A;  2DXT A;  1IHW A;  2J6F A;  1YJN A;  3NFC A;  4MDW A;  4QVZ A;  4C0Z A;  1N8R C;  1M3B A;  5FU7 C;  3ZBD A;  1AVZ C;  5GAM j;  2DVE A;  3ZL7 C;  1ABQ A;  4PJO C;  3M58 A;  1ZUK A;  5LJ5 e;  4RTV A;  2EYX A;  3J7A F;  2GBQ A;  2FEI A;  1X6B A;  1GFD A;  5CKF A;  1JJ2 A;  2YWW A;  1NPP A;  4F7U F;  2O01 E;  5IT9 E;  8ATC B;  3TQ7 P;  1VQ7 Q;  1PD1 A;  1GBQ A;  3RKX A;  2LMJ A;  2F1L A;  3VV0 A;  2CP3 A;  2CZ0 B;  3KXT A;  2X4J A;  5FU6 B;  4XTW A;  3CCQ Q;  1KK7 A;  3I9Q A;  5LJ3 h;  4MDX A;  2KRO A;  3EGX A;  1R8O B;  3TU4 K;  4BE1 A;  2HMA A;  2DVJ A;  1P92 A;  2HSE B;  2QQ9 A;  1VQ6 Q;  3LH5 A;  1W2B A;  2LRQ A;  4IUR A;  2FZC B;  1SSH A;  1VQN A;  1WIE A;  3JB9 I;  1KQ1 A;  2R57 A;  3A1P A;  2QK0 A;  5C0M A;  4ZGD B;  3GP8 A;  1PKT A;  1D0Z A;  2RA2 A;  4KGZ B;  4J7I A;  2CYZ B;  3DB3 A;  4C8Q G;  4FL6 A;  1QVP A;  4XTV A;  3RMQ A;  4LDX A;  2JMA A;  1JBM A;  2YLB A;  3E9F A;  3CC4 A;  2GGR A;  2VB6 A;  3EG3 A;  2PVO B;  4CC2 A;  4M7A C;  1Y96 A;  3EG1 A;  3JCM V;  1KD1 U;  5KE2 A;  2RI2 A;  2RJC A;  1UEC A;  1ZSZ A;  4FT4 A;  3V8J A;  3QXE B;  2YXY A;  2YT6 A;  1NLO C;  2K9G A;  4BY6 C;  1IGQ A;  1WYX A;  2RQU A;  4XTU A;  2KNB B;  1M4Z A;  3OBW A;  1KD1 C;  5LJ5 h;  1VQO T;  2ZGW A;  1Q86 R;  4A4G A;  2XDB A;  3VJP A;  3CC2 Q;  3GPL A;  5DLO A;  2BUD A;  1UJ0 A;  3P8B B;  2RHI A;  3AT1 B;  1ARK A;  2BE7 D;  5I11 A;  2KBT A;  1Q82 R;  2PVG B;  2RHY A;  1RAE B;  3ULR B;  2QDL A;  5IXB A;  1TSF A;  4M78 F;  1YHQ Q;  2RB6 A;  3RMS A;  3ZFJ A;  2A08 A;  1QLY A;  1VQ9 T;  2DER A;  3CMA T;  3CCM T;  2F5K A;  4C0F A;  1U1T A;  3EGU A;  4D8K A;  3CCR Q;  1PCX A;  3EGX B;  1K0X A;  4PJN A;  1U3O A;  5IH2 A;  2V8I A;  2BE9 B;  1YCS B;  1VQ4 T;  2LNH B;  1Q7Y R;  2X4X A;  3X20 B;  1TUG B;  3FEO A;  3DLL A;  1MMN A;  2YUO A;  3QG1 A;  5KYW B;  2DXC A;  4XU0 A;  1Y57 A;  4RTT A;  2DRK A;  3EAE A;  2FB7 A;  3JB9 J;  4QVC A;  4X9D A;  1RAG B;  2O9S A;  2FL7 A;  2A36 A;  5D6Y A;  3OYG A;  1CKB A;  2RI5 A;  4HCK A;  4OGC A;  2XU8 A;  1G3S A;  4IIO A;  4FW2 A;  4KGX B;  3CEY A;  4E7L A;  5GAM g;  1TOV A;  1K73 C;  1AZE A;  4M7D F;  3SDZ A;  5D6W A;  3S3N A;  1VQ5 A;  2MF2 A;  5I2S A;  3E2U A;  3MHX A;  1MV0 B;  1Q86 U;  3BE3 A;  4LUE A;  3RKY A;  2DM1 A;  1X69 A;  1H8K A;  1WXB A;  3L2V A;  2WSF E;  3G4S T;  1E6G A;  2DLP A;  1Q82 U;  3HRS A;  1I81 A;  5AYF A;  3SWN C;  1VQL Q;  3EG0 A;  4M4Z A;  3QUI A;  4Z8A A;  1WI7 A;  1D3B A;  3SHW A;  2KAF A;  1BK2 A;  1VQP A;  1JRI A;  4IUV A;  1QQJ A;  3CCJ T;  2YRV A;  2JUF A;  4ZGJ B;  3BDU A;  3OYJ A;  3HSB A;  1JJ2 S;  4EPC A;  1GFC A;  4PJO F;  1JXO A;  2JTM A;  4BE0 A;  4C8Q B;  2HEQ A;  1XQH A;  2DYB A;  4KH1 B;  5IXF A;  1JU5 C;  4QW2 A;  1JQQ A;  4J9H A;  4E7K A;  4ZNX A;  1RI9 A;  2KEA A;  4C92 C;  3D7S B;  3VRZ A;  1TWB A;  1QCO A;  1HXD A;  1MMD A;  4EDU A;  4PL6 A;  3URG A;  1OZ3 A;  4J9I A;  3A8H B;  2ENM A;  4PLI A;  1SEM A;  3MKD A;  4BD3 A;  5CQX A;  1GCP A;  4NOY A;  1IHV A;  4C8Q D;  2OTL T;  1W2B S;  1WHL A;  4AFS C;  3C12 A;  1OQK A;  2AHJ B;  2B8A A;  2IVW A;  3KBG A;  2RJD A;  3VS6 A;  2D0Q B;  4M77 G;  3CCL Q;  3EG9 A;  2VV5 A;  1NYF A;  2EQM A;  2MWP A;  4JDS A;  2DZ9 A;  4L5G A;  1BB9 A;  5LL6 S;  3X25 B;  5GAO p;  4OB3 B;  2GQI A;  3PNW C;  5KCO A;  2KYM A;  2RH2 A;  2D0N A;  2NLU A;  1YIJ Q;  2QEX A;  3QII A;  3NGP A;  1ACM B;  3QJY A;  2AIR B;  1AHJ B;  2YRC A;  3EG2 A;  4X1V A;  4M75 E;  3A8L B;  3JCM e;  1NYG A;  5HY6 A;  3I56 Q;  4C5G A;  1M8V A;  2HSP A;  5IHN A;  4HXJ A;  5FW9 A;  1VYV A;  3V8L A;  2E6N A;  1E7O A;  2QGF B;  2VXE A;  2XK0 A;  4J7F A;  3CC7 Q;  4M7A F;  3RER A;  1QVG P;  1LNX A;  2NWM A;  3HFO A;  1IRX A;  3R6N A;  1YJ9 T;  2AKK A;  4JS4 A;  1VQK A;  1YP5 A;  2LVM A;  5GMK i;  2DE0 X;  1G83 A;  2HBP A;  2D8J A;  1WJQ A;  1D3B B;  3MCA B;  3A8M B;  1QKX A;  1PHT A;  2X4Y A;  3EH1 A;  2HL5 C;  3DLM A;  1NBE B;  4ATO A;  3I35 A;  4MZP A;  1EFN A;  2X9H A;  1OOT A;  4XTX A;  2DTI A;  3RES A;  3LW5 E;  2LCC A;  3HRU A;  1V76 A;  5GAN e;  2P84 A;  2BTT A;  2AZS A;  4LE9 A;  2NUT A;  4AMC A;  1YN8 A;  1PNJ A;  3CCE T;  1VQ6 T;  4PJJ A;  4RCC A;  1QWF A;  2E12 A;  2A0F B;  2L0A A;  2IIM A;  2CRE A;  1K4U S;  3JCM Q;  1KSW A;  1R0C B;  4FYY B;  1V29 B;  1WLP B;  2MK5 A;  1YI2 T;  1ZBX A;  1QVF P;  4OMO A;  2XDP A;  3J81 E;  1MGQ A;  4GLM A;  1M9S A;  1U8R A;  4IIM A;  3UF4 A;  3HTR A;  1WXU A;  3EFS A;  3JCM h;  3I55 Q;  2XKO C;  4E7I A;  2VWF A;  2DIQ A;  1J3T A;  3G7Z A;  3PE0 A;  4RCB A;  3OSS C;  1X6O A;  4F7U E;  1MNE A;  4IKF A;  4C0G A;  3G71 Q;  5CAI A;  4JLG A;  1WPY A;  2E4H A;  5GAN 2;  2K2M A;  4QQ6 A;  2KRS A;  4M77 B;  2COW A;  1YIT T;  2GQV A;  3OS5 A;  1M90 R;  4J9E A;  4OMQ A;  4O6J A;  1WQW A;  4HVV A;  5GAM f;  1UGR B;  2E70 A;  4R55 A;  1OX9 A;  2RF0 A;  2L3S A;  2EYY A;  4C0D B;  2QGG A;  2CS7 A;  4BI3 A;  1YJW T;  5EC7 A;  3EH2 A;  3KUF A;  2Y90 A;  1KIK A;  1QKW A;  3KFV A;  2KI7 A;  1AZG B;  1K9M R;  1PSF A;  1QW1 A;  2JM9 A;  2K3Y A;  3ME9 A;  4M77 D;  3TSZ A;  2K6D A;  3OYC A;  2YRD A;  3OMC A;  4KH0 B;  5LJ3 d;  2QDY B;  5GAN h;  4QT7 A;  3CD6 Q;  2LP5 A;  4M75 F;  1YJN Q;  1BU1 A;  1KC8 U;  1WHM A;  2EPD A;  1K8A R;  1VQO A;  2OAW A;  2YLC A;  2H3J A;  2KT1 A;  3MJX A;  2DBM A;  3THK A;  3IQL A;  3FJ5 A;  1JEG A;  2JTF A;  4FW1 A;  1MMA A;  1O75 A;  2LQW A;  2F2V A;  4JZ4 A;  4RG8 A;  3ASK A;  3G1J A;  1KC8 C;  4EMK B;  5GAN 5;  1UUE A;  1RAC B;  2ZAE A;  3QBY A;  1E6H A;  1KQ2 A;  1K76 A;  1BCO A;  1VQ9 A;  3TVT A;  2ZPG B;  3CMA A;  4B6M A;  2A7Y A;  3CCM A;  1QCF A;  1BBZ A;  5KYX A;  2QAZ A;  1RAB B;  2L8D A;  2JZ2 A;  3MEU A;  2FPE A;  3PVL A;  2COZ A;  2F69 A;  3RDV A;  1VQ4 A;  4J9F A;  2E65 A;  3OBY A;  1MV3 A;  2LTO A;  2KMT A;  2JNG A;  2WSC E;  4C8Q C;  2E5K A;  4YTL A;  3QDR B;  2J05 A;  4M78 E;  2E10 A;  2RQW A;  2BKD N;  2VGM A;  2EQU A;  2LQN A;  2FZG B;  3NMZ C;  1LJO A;  4OMM A;  3VS5 A;  2PUO B;  2M02 A;  5LJ5 d;  5A2Q E;  1K9M U;  2DL8 A;  4J6X A;  2FO0 A;  3TRE A;  2ZPF B;  1TXQ A;  2CP0 A;  1SG5 A;  3OYF A;  2KSS A;  4BB7 A;  3UA7 A;  4F7U A;  1QP2 A;  2YSQ A;  2Y4X A;  2Y4Y A;  2QYZ A;  3CC4 Q;  2R5A A;  1B34 B;  4P5N A;  3ER0 A;  4DQ2 A;  1WJR A;  4FYW B;  4E7H A;  3GNF B;  4ZN3 A;  2DIG A;  2DF6 A;  2OI3 A;  3WXM B;  1YFN A;  2I0N A;  3PFS A;  4D6W A;  4JZ3 A;  5L23 A;  2XD0 A;  4OMF B;  3JCM b;  3LGL A;  3PTA A;  4B9X A;  3G4S A;  5HK0 A;  1TUD A;  1OPK A;  2XMF A;  2OTJ Q;  1QVG A;  2V8K A;  4HCB A;  3CCS T;  1G3W A;  4XU1 A;  3JB9 H;  3OS0 A;  2RM4 A;  3CCJ A;  3OYE A;  2F5T X;  4M7D E;  1W1F A;  4DEY A;  3JB9 G;  3CBM A;  3VUZ A;  1BKB A;  1GRI A;  3CCL T;  1TS9 A;  4N0A A;  1FYN A;  2RMO A;  1M30 A;  2KK4 A;  4IUU A;  5A0D A;  3V7C A;  5KYY B;  5FLX E;  4FSS A;  2DD4 A;  2HBW A;  2DRM A;  1U1S A;  2MYS A;  5GAO n;  2ED1 A;  2RHX A;  4FU6 A;  5D7U A;  3U23 A;  1PG5 B;  4PKC C;  3M53 A;  2AKL A;  3VU3 C;  2R5M A;  4CC4 B;  2QG9 B;  1D0Y A;  4J5Y A;  5KYU A;  4QKU A;  2VKN A;  4RTW A;  3RKW A;  4DA4 A;  3C94 A;  1WA7 A;  1Y07 A;  2FVU A;  2OTL A;  1G2B A;  4PJO E;  2CH4 W;  1LCK A;  1M5Q 1;  2O88 A;  3CCV A;  2RNA A;  1SHF A;  2L2P A;  4ZGE B;  3JCM X;  3CCU Q;  2P0P A;  1JO8 A;  3E1S A;  4E7Z A;  3CC7 T;  2QQR A;  2O4X B;  2RQV A;  1N9S A;  1PD0 A;  2P4R A;  3INZ A;  4PJM A;  1W4S A;  4Z02 A;  5CKB A;  2GF7 A;  4X34 A;  4ESR A;  1W6X A;  1QVF A;  5DLQ E;  2DZC A;  3MO8 A;  1VYT A;  8AT1 B;  1FMV A;  3OS2 A;  4LXC A;  1M2V A;  1UFF A;  1WQ7 A;  4M78 A;  1OUL A;  1D1A A;  2KVQ G;  3JCM W;  3DKM A;  4ME7 A;  1VQ5 Q;  2DYI A;  1TTH B;  4XTZ A;  4N4H A;  1K9A A;  1ABO A;  1NZ9 A;  2K5L A;  1K73 R;  1ZUU A;  5HK3 A;  2M0O A;  4KBM B;  1X43 A;  3LWI A;  1QCN A;  5L8R E;  1YJ9 A;  3UDC A;  3FRN A;  2L89 A;  4D8D A;  1VQP Q;  2FPD A;  1N9R A;  3R6O A;  4ELZ C;  4IUQ A;  4WCI A;  5GAO q;  4OB0 B;  2PVD B;  2X4W A;  2JTE A;  2CUD A;  2NUP A;  3CPW P;  2DFU A;  2HQH A;  2AT1 B;  1B07 A;  2CZ6 B;  2GCX A;  2DK3 A;  4DBH A;  3SB2 A;  1SHG A;  3OYK A;  5KH6 A;  1I8F A;  4M7A E;  1BIA A;  5DY9 A;  1NEG A;  1QWE A;  1I07 A;  2KT8 A;  2A37 A;  1YNZ A;  4RTY A;  3L2R A;  2JT4 A;  4M77 C;  4M7D A;  1VQ8 Q;  3BDL A;  2EQJ A;  1HJD A;  4JLI A;  2HDA A;  3HRT A;  4DBR A;  2HKQ B;  3CCE A;  1VQ6 A;  3WVE B;  1AWO A;  4LNP A;  4C0D C;  2R58 A;  3S3O A;  4RKU E;  4HT9 A;  1SF9 A;  1OI1 A;  2K3B A;  3FLG A;  1YI2 A;  4C8Q F;  4PFO A;  4Y91 A;  2DAQ A;  3RNJ A;  2COY A;  1SRL A;  3TEE A;  2QQS A;  1FXX A;  1BI0 A;  2J6O A;  3GBQ A;  1SPK A;  1WHJ A;  3PMI A;  4PJO A;  2KYB A;  4OB1 B;  3EHR A;  2YUN A;  2H3E B;  2EIF A;  3C4S A;  3NHN A;  9ATC B;  2GFU A;  3G6E Q;  5HKC A;  1Y96 B;  2CSQ A;  1ZSZ B;  4MZT A;  2EKO A;  2FYK A;  2HZY A;  2DKG A;  1WHG A;  2DXB A;  3JB9 D;  1WZO A;  2D8H A;  3SFM A;  2K5I A;  4EMK C;  2LQ8 A;  1KFZ A;  1Q86 C;  1QVG S;  4OB2 B;  3CME Q;  3CD6 T;  3UT1 A;  1YIT A;  2O9V A;  1VQK Q;  4JRI A;  3QHS A;  4Y28 E;  5IN1 A;  1RLQ C;  2MIO A;  3OA6 A;  1Q82 C;  1VOM A;  1RUW A;  1TG0 A;  2DBK A;  1WFW A;  2JJ9 A;  5LJ3 j;  2DJQ A;  4AFQ C;  3M56 A;  3RUX A;  3MP8 A;  2CT3 A;  1Q7Y U;  1YJW A;  3OYY A;  4PK4 A;  3CQT A;  1PM3 A;  2EFI A;  4L59 A;  5FRM A;  2D9T A;  4Y92 A;  2QA4 T;  4LD9 K;  2M1H A;  4WF2 A;  1I5O B;  1ZSG A;  4VUB A;  2PU9 B;  1GCQ C;  3OYA A;  4BI8 B;  3FC3 A;  1Q7Y C;  2ZZD A;  4OVA A;  2YUQ A;  3JCM d;  1WX6 A;  1M1K R;  1D1C A;  3M0R A;  2V26 A;  2JMC A;  3CCV T;  1Y71 A;  3RIR A;  2LNV A;  2EGE A;  2DTO A;  1OPL A;  1XOV A;  2ROT A;  5CKD A;  4M7A A;  2MI6 A;  3REB B;  1OZ2 A;  1VQM T;  3OSV A;  2DMO A;  3J80 E;  2K4Y A;  2RO0 A;  2MAM A;  4RUG A;  2H8H A;  4KRT A;  1C6V X;  3H9N A;  1M1F A;  2XHC A;  2CGH A;  1KG1 A;  2XI9 A;  5GAM e;  1D0X A;  2J6K A;  3QYH B;  1QVF S;  4C92 E;  2W10 A;  3EFR A;  2P0K A;  3CXC P;  2VYT A;  2LCS A;  2JXB A;  5LJ5 j;  3S3M A; 
#chains in the Genus database with same CATH homology
 2V1R A;  1KIK A;  1CKA A;  1QKW A;  3KFV A;  4RTU A;  2BZX A;  1AZG B;  1K1Z A;  2JM9 A;  3TSZ A;  2K6D A;  1GBQ A;  2LMJ A;  4AFZ C;  1HD3 A;  1UHF A;  1OV3 A;  4QT7 A;  2X3W D;  3I9Q A;  2LP5 A;  2KRO A;  1PRM C;  1K0S A;  4R0K A;  1BU1 A;  2EPD A;  2OAW A;  4J9C A;  2DVJ A;  1B3Q A;  2KT1 A;  2LJ1 A;  1OEB A;  3M0Q A;  2DBM A;  3QWY A;  3THK A;  3IQL A;  3SEM A;  3FJ5 A;  1JEG A;  3LH5 A;  2LQW A;  4F17 A;  2F2V A;  2EBP A;  4JZ4 A;  1ZX6 A;  1SSH A;  5GJV B;  1WIE A;  1UUE A;  1H92 A;  1E6H A;  4LN2 A;  3H41 A;  1K76 A;  3QWX X;  3TVT A;  2LJ0 A;  3VS4 A;  4Z89 A;  1PKT A;  1YWP A;  2JM8 A;  5HCK A;  2KXC A;  5IHK A;  2DIL A;  1QCF A;  2EQI A;  3C0C A;  2AK5 A;  1BBZ A;  2RQT A;  4J9B A;  2OJ2 A;  4AFU C;  5IHI A;  2JMA A;  2FPE A;  3PVL A;  1AWJ A;  4J9F A;  2GGR A;  1UHC A;  2O31 A;  1MV3 A;  3EG3 A;  4CC2 A;  3EG1 A;  1PKS A;  1UEC A;  4OMN A;  2E5K A;  1A0N B;  2J05 A;  2YT6 A;  1NLO C;  2O2O A;  2K9G A;  2RQW A;  3PVQ A;  1GL5 A;  1NG2 A;  2LQN A;  3NMZ C;  4OMM A;  1WYX A;  4GBQ A;  2RQU A;  3VS5 A;  2KNB B;  2EYZ A;  2DL8 A;  2EGA A;  2W0Z A;  2FO0 A;  3NPF A;  3UA7 A;  1UJ0 A;  2YSQ A;  2J7I A;  2BZY A;  1ARK A;  1T3S A;  5I11 A;  2KBT A;  1U06 A;  3VS0 A;  3ULR B;  5IXB A;  2QDL A;  1UJY A;  2JS0 A;  4JJD A;  2DF6 A;  2OI3 A;  2A08 A;  2I0N A;  1QLY A;  4JZ3 A;  5L23 A;  4A63 B;  2JW4 A;  2RPN A;  3EGU A;  1X6G A;  4D8K A;  1TUD A;  1OPK A;  2XMF A;  4OMP A;  1K0X A;  3VS1 A;  1U3O A;  5IH2 A;  1X2Q A;  1YCS B;  2LNH B;  2EKH A;  2EW3 A;  1M8M A;  2KGT A;  1W1F A;  2YUO A;  4DEY A;  1VYU A;  1GRI A;  1Y57 A;  4RTT A;  2DRK A;  1FYN A;  2RMO A;  3M0S A;  1M30 A;  2DNU A;  2MOX A;  2DA9 A;  2O9S A;  2L3P A;  2A36 A;  4FSS A;  2HBW A;  1CKB A;  2DRM A;  4F16 A;  4JPB W;  2ED1 A;  3U23 A;  4HCK A;  2DL4 A;  2AKL A;  2FRY A;  4CC4 B;  4IIO A;  5GJW B;  2VKN A;  2CDT A;  4RTW A;  1X27 A;  2C0I A;  2YDL A;  4JJB A;  1S1N A;  2HCK A;  1JXM A;  2V1Q A;  2KE9 A;  1AZE A;  1WA7 A;  2FPF A;  1G2B A;  1UTI A;  1VA7 A;  2C0O A;  2CH4 W;  1LCK A;  3I5S A;  2O88 A;  2KRM A;  2RNA A;  1SHF A;  2L2P A;  2BZ8 A;  1JO8 A;  1MV0 B;  4LUE A;  2EVR A;  2JS2 A;  2DM1 A;  1X69 A;  1H8K A;  2ABL A;  1WXB A;  1Z9Q A;  2X3X D;  2RQV A;  2FG0 A;  1FMK A;  2P4R A;  1E6G A;  2DLP A;  4CC7 A;  4Z88 A;  1WDX A;  1M3A A;  1N5Z A;  3EG0 A;  4M4Z A;  4Z8A A;  2ECZ A;  1WI7 A;  1M27 C;  3SHW A;  4ESR A;  1W6X A;  1BK2 A;  1RLP C;  3H0I A;  1ZLM A;  1UGV A;  1VYT A;  2G6F X;  2RQR A;  1GFC A;  1UFF A;  1JXO A;  2SRC A;  2HEQ A;  2CSI A;  1UE9 A;  1WXT A;  2DYB A;  5IXF A;  1JU5 C;  5I22 A;  1JQQ A;  1NLP C;  4J9H A;  2EYW A;  4ZNX A;  1RI9 A;  2C0T A;  4HVW A;  2KEA A;  3H0H A;  1K9A A;  1ABO A;  4JJC A;  1AWX A;  1U5S A;  3VRZ A;  1ZUU A;  1X43 A;  2M0Y A;  4J9I A;  1GFD A;  2B86 A;  2ENM A;  1SEM A;  1PRL C;  3JV3 A;  2PTK A;  1GCP A;  1HSQ A;  1H3H A;  2CT4 A;  4D8D A;  2YUP A;  1UG1 A;  2K79 A;  2CUB A;  2FPD A;  4AFS C;  4WCI A;  3VS7 A;  2JTE A;  4J9D A;  1AOJ A;  3VS6 A;  2CUD A;  4ORZ A;  1NYF A;  1B07 A;  1BB9 A;  1SHG A;  3REA B;  1CSK A;  1NEG A;  1QWE A;  1I07 A;  2KT8 A;  2GQI A;  2A37 A;  1YNZ A;  1ZUY A;  4RTY A;  2JT4 A;  3H0F A;  1GCQ A;  2KYM A;  2D0N A;  1W70 A;  2GNC A;  5ECA A;  2VVK A;  1T3L A;  1TUC A;  2KRN A;  3NGP A;  2ED0 A;  2SEM A;  1HJD A;  1UDL A;  3EG2 A;  2DL7 A;  2HDA A;  4X1V A;  1NYG A;  2CH4 A;  2DX1 A;  4RTX A;  2EGC A;  2HSP A;  5IHN A;  4HXJ A;  5FW9 A;  1VYV A;  2PZ1 A;  1AWO A;  1Y0M A;  4LNP A;  1E7O A;  2ROL A;  2K3B A;  1GBR A;  2NWM A;  3RNJ A;  3R6N A;  1SRL A;  3M0T A;  2AKK A;  2PNI A;  1YP5 A;  2LZ6 B;  2DE0 X;  1G83 A;  2ESW A;  2J6O A;  3GBQ A;  1SPK A;  2D8J A;  2KYB A;  2K7A A;  3EHR A;  1QKX A;  2YUN A;  1PHT A;  3NHN A;  1AD5 A;  4CC3 A;  4HVU A;  2D1X A;  2LX7 A;  3I35 A;  2CSQ A;  2A28 A;  1I1J A;  1AWW A;  1EFN A;  4RTZ A;  3VS2 A;  3O5Z A;  2AZV A;  2D8H A;  1OOT A;  1PWT A;  2KR3 A;  1KFZ A;  1V1C A;  2F2W A;  3VS3 A;  2O9V A;  1KJW A;  1RLQ C;  2MIO A;  2BTT A;  2AZS A;  2F2X A;  1I0C A;  1RUW A;  3M0P A;  4LE9 A;  1TG0 A;  4EIK A;  2DBK A;  1NM7 A;  1YN8 A;  1WFW A;  1PNJ A;  3UAT A;  2DJQ A;  4AFQ C;  4F14 A;  5FWB A;  2GTO A;  1QWF A;  2M51 A;  1YWO A;  2L0A A;  1SRM A;  2IIM A;  2CT3 A;  2CRE A;  3M0U A;  1K4U S;  1NEB A;  1KSW A;  2KXD A;  1WLP B;  3CQT A;  2FRW A;  1AEY A;  4E6R A;  2NUZ A;  4OMO A;  2LJ3 A;  2J06 A;  1Z9Z A;  4Y92 A;  3RBB B;  1T0H A;  4GLM A;  5FWC A;  1ZSG A;  4IIM A;  1GCQ C;  3UF4 A;  1WXU A;  1ZBJ A;  2YUQ A;  1WX6 A;  2RN8 A;  3M0R A;  4K11 A;  4AG1 C;  1X2K A;  3UA6 A;  1M3C A;  2JMC A;  2VWF A;  2DL3 A;  2GTJ A;  1J3T A;  2MCN A;  4J9G A;  2EGE A;  3PE0 A;  1OPL A;  1XOV A;  2ROT A;  3REB B;  3VRY A;  3I5R A;  1MUZ A;  3TSW A;  2DMO A;  4RUG A;  2H8H A;  4KRT A;  2K2M A;  2L3Q A;  2KRS A;  2DL5 A;  4LUD A;  4OML A;  4DEX A;  2J6F A;  2J6K A;  4AG2 C;  4J9E A;  2W10 A;  1M3B A;  4OMQ A;  1AVZ C;  3ZL7 C;  1ABQ A;  1T0J A;  2LCS A;  1ZUK A;  4HVV A;  4RTV A;  3EHQ A;  2JXB A;  1IO6 A;  3A98 A;  2EYX A;  2RF0 A;  2L3S A;  2EYY A;  2GBQ A;  2FEI A;  5EC7 A;  1X6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...