1WYXA

The crystal structure of the p130cas sh3 domain at 1.1 a resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
LNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.1 A resolution crystal structure of the p130cas SH3 domain and ramifications for ligand selectivity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords CRK-associated substrate
total genus 12
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wyxA00
3EG0A 3ZL7C 1GCQC 1GRIA 2KNBB 1X6GA 3NMZC 4CC7A 2V1QA 2DX1A 1I1JA 4OMQA 4OMLA 1U3OA 1X69A 1UFFA 2JS0A 2YUOA 1NEGA 4D8DA 2BTTA 3PE0A 4ESRA 3EGUA 4JJDA 1N5ZA 2ROLA 2LJ3A 1Y0MA 3NHNA 4IIMA 2DBMA 5IHNA 1FMKA 2JMCA 4RTUA 1UJ0A 2J6KA 1S1NA 2CT3A 2F2WA 4RTWA 1ARKA 2ECZA 2D8HA 2DL4A 2O31A 4F16A 2ED1A 2LQNA 5HCKA 1H3HA 1WXTA 2RQRA 2A36A 2KXCA 4AG1C 4CC4B 4LNPA 1T3LA 2KEAA 4J9FA 3UF4A 2FEIA 2EYWA 3EG2A 3R6NA 4R0KA 1GCPA 2XMFA 1T0HA 3C0CA 2GQIA 1OEBA 2DMOA 1UTIA 2KBTA 1WX6A 5FWCA 2KYBA 5GJVB 2KT8A 4E6RA 2JM8A 4LE9A 1PHTA 2RNAA 2K9GA 1ABQA 2J06A 1H8KA 3H0HA 2HDAA 2HSPA 1XOVA 1WXBA 2L3QA 3FJ5A 2EQIA 4J9GA 4QT7A 1JXMA 3IQLA 2K3BA 4HCKA 4AFSC 1UDLA 1FYNA 2A37A 5I11A 2RQUA 4FSSA 1AZGB 1CKBA 1GBQA 2C0IA 2CT4A 2W10A 3A98A 2J6OA 4M4ZA 2EYYA 4HVVA 2JW4A 3EHQA 1KJWA 3U23A 4AG2C 4EIKA 2X3XD 3UA6A 1QLYA 1TG0A 2VWFA 4Y92A 3PVLA 2DE0X 1OPKA 2L0AA 2RN8A 1CSKA 2FPEA 4RTTA 1ZLMA 1A0NB 2CSIA 2RQTA 3VS3A 2W0ZA 2LMJA 2EGEA 1MUZA 1PRMC 1JO8A 2FPDA 4AFUC 2DNUA 2JXBA 2KR3A 2CH4A 2D1XA 3GBQA 1ZUYA 3CQTA 2FPFA 4J9EA 5IXFA 2E5KA 3I9QA 1W1FA 1PRLC 1WI7A 2RPNA 2ED0A 2K79A 2KRNA 2BZ8A 1JQQA 2JM9A 4JZ3A 1IO6A 2P4RA 2LQWA 4J9BA 4OMOA 1QKWA 1VA7A 1WXUA 4KRTA 1X27A 1B07A 3REBB 4A63B 2B86A 2M51A 1PWTA 2ABLA 2JMAA 1WA7A 2HCKA 1ZBJA 3LH5A 1H92A 2K6DA 4AFQC 3VRZA 2JT4A 3REAB 3JV3A 2GTJA 1W6XA 2YDLA 2L3SA 4K11A 1OPLA 4RUGA 2V1RA 1UECA 2YUQA 2EPDA 3NPFA 2GNCA 2KGTA 2GTOA 3M0QA 1AWJA 2OI3A 1JXOA 2DF6A 1BU1A 2D8JA 1UHCA 4IIOA 3VS7A 1G2BA 2MOXA 1PKTA 2LX7A 2VKNA 5GJWB 2ENMA 1GFCA 3VS5A 4LUDA 2KROA 1NYGA 5IHIA 4D8KA 1VYVA 1WYXA 2DBKA 2DL8A 1TUDA 4AFZC 1CKAA 2DM1A 2DRKA 2IIMA 3EHRA 3VS4A 2QDLA 2NUZA 4LUEA 1TUCA 1G83A 2KRSA 1UE9A 2KE9A 4HVUA 4WCIA 2CREA 2OJ2A 2X3WD 2RF0A 3VS6A 1K0SA 1YN8A 3M0PA 2CDTA 3RBBB 2PNIA 2YUNA 1JEGA 2YT6A 2ESWA 2KYMA 2LP5A 2DYBA 2LZ6B 1AOJA 1T3SA 4CC2A 2MCNA 4JJBA 3ULRB 1YCSB 2YUPA 1Y57A 4RTXA 3H0FA 1RUWA 1LCKA 1M3BA 3M0RA 2FRYA 1BB9A 2K2MA 1HSQA 1KSWA 2EYXA 1JU5C 2RQVA 1QCFA 2EW3A 1NEBA 4RTVA 2MIOA 1SPKA 5IXBA 4DEYA 1RLQC 2DA9A 1QKXA 4J9CA 4RTYA 2K7AA 1U5SA 2H8HA 5I22A 2AZSA 1ZSGA 1AWXA 2DVJA 1WDXA 3EG3A 1GFDA 2J6FA 1B3QA 1ABOA 2CSQA 1QWFA 3SHWA 1YWOA 1M3AA 4Z8AA 4CC3A 2EKHA 1E7OA 3TVTA 2EVRA 1VYUA 4J9IA 3TSZA 3QWYA 2CUDA 1K4US 1BBZA 1M3CA 2BZYA 1SSHA 1HD3A 1M8MA 1E6GA 1SRLA 2ROTA 1J3TA 1PKSA 2RQWA 2A08A 3H41A 1K0XA 3UA7A 2J05A 4JPBW 1T0JA 1UJYA 1YNZA 1AEYA 2F2VA 1AZEA 1WLPB 4GLMA 2AKLA 1OOTA 3I5SA 1NLOC 2HEQA 2EGCA 2M0YA 4X1VA 3TSWA 2G6FX 3VRYA 1X2KA 1YWPA 3H0IA 1GBRA 1W70A 1GL5A 2YSQA 2I0NA 4J9HA 2EBPA 2F2XA 1X43A 3VS1A 5IHKA 1UG1A 2LCSA 1GCQA 2O9VA 1WIEA 2LJ0A 2L3PA 5FW9A 2OAWA 2D0NA 4GBQA 1NM7A 2AK5A 3M0TA 1ZUKA 5L23A 2CH4W 2DLPA 3PVQA 1U06A 3M0UA 2J7IA 3THKA 2NWMA 1V1CA 1AWOA 1NLPC 1I07A 1WFWA 1PNJA 3O5ZA 3UATA 2GBQA 1SRMA 2DJQA 1X2QA 1UUEA 2PTKA 4HXJA 2DL5A 2LJ1A 4F14A 2KXDA 2FG0A 1SHFA 4DEXA 3EG1A 1AVZC 2CUBA 1HJDA 4JJCA 1X6BA 2PZ1A 4J9DA 4HVWA 4ZNXA 4OMPA 1KFZA 2KT1A 2O2OA 3NGPA 1UGVA 5EC7A 1QWEA 1MV0B 2A28A 2O9SA 2EGAA 2O88A 1YP5A 2SEMA 2VVKA 2KRMA 1SEMA 2HBWA 1ZX6A 3VS2A 2DILA 2FO0A 5FWBA 2JS2A 2BZXA 1I0CA 4OMMA 3QWXX 1M30A 3M0SA 1E6HA 4LN2A 3SEMA 2DL3A 2SRCA 3RNJA 4OMNA 1AWWA 1M27C 3I35A 1K9AA 2AZVA 2EYZA 1K76A 1VYTA 1KIKA 1UHFA 4Z89A 2DL7A 4F17A 1RI9A 4RTZA 4Z88A 5ECAA 2C0OA 2FRWA 4JZ4A 2RMOA 1AD5A 1Z9QA 1SHGA 1ZUUA 5IH2A 1BK2A 1NYFA 3I5RA 4ORZA 2L2PA 1RLPC 2C0TA 1EFNA 2JTEA 3VS0A 1MV3A 2DRMA 2GGRA 2LNHB 3KFVA 1OV3A 2AKKA 1K1ZA 1NG2A 1Z9ZA
chains in the Genus database with same CATH superfamily
2M02A 2KQWA 3HHTB 1VQLA 3O8VA 5GAOq 1KD1R 1D0ZA 1U3OA 2DTHA 1KG1A 2BE9B 3J7AF 2JS0A 2YUOA 2KI7A 3MEAA 4JJDA 1N5ZA 4C5GA 2JMCA 1UJ0A 3WVEB 1VQ8A 2CT3A 2F2WA 2QXFA 4KBMB 3GNFB 3OYJA 2KY9A 3A1PA 2HQEA 3H8ZA 3MP6A 1YCYA 2K2VA 2RQRA 2A36A 3AHUA 2KXCA 2JUFA 4LNPA 2JNGA 3OQ5A 5LJ3d 4BACA 2QQRA 3CCQA 3BY7A 3M57A 3CMAA 4HT9A 4FYWB 1NE8A 4DOWA 1UTIA 1BYMA 2CP6A 2E6NA 2RD1A 1VQOA 1YJNQ 1PHTA 5I2SA 4IUPA 1EX4A 3A8LB 2EQMA 3QO3A 2CYZB 4C92A 3H0HA 4M78C 4C8QB 1ZSZB 2L3QA 1VQ9Q 2RJDA 1OULA 3QPHA 1YIJQ 4AFSC 3JSCA 1OX8A 4XK8E 4IUTA 4M75C 3HRUA 1F1BB 3OYFA 4WTOB 4FSSA 1M90R 1YJNT 3OS2A 4HVVA 3CCSA 2HAXA 2HNIA 1KC8C 1LVKA 2X3XD 1KC8U 2V26A 2ZPGB 3ZEHA 3PVLA 4DA4A 1OPKA 2BIVA 4YTLA 4NS5A 2RN8A 1KD1C 4J6XA 1ZLMA 1A0NB 2CSIA 4N4GA 4WF2A 3CMEA 1NZ9A 1P92A 2YHTA 1JO8A 2FPDA 4AFUC 2DNUA 3QJ6A 2JXBA 3CCJT 2KR3A 5A0GA 4RG8A 4J9EA 2DIGA 4N0AC 5CQYA 4JRPA 1VQMT 2RPNA 3CD6A 1JQQA 4ZTJA 5A0DA 1I5OB 5IN1A 2JTMA 3T9NA 4J9BA 4OMOA 8AT1B 4KULA 5D6XA 2MWOA 4II1A 2B86A 2R57A 2CZ1B 8ATCB 2E3HA 2YWWA 1MNDA 1PWTA 2DJZA 1Y96A 1EZZB 4AFQC 1JJ2A 3VRZA 5GANd 2BE7D 2RHYA 4AT1B 3JV3A 1KHIA 2YDLA 2EJ9A 5D6WA 2E6ZA 1QVFP 2YUQA 2HL5C 2CGHA 4KGXB 1JXOA 2DF6A 2QQSA 4JLGA 1D1BA 4L5GA 4M77B 4BE2A 4IIOA 3UT1A 3VS7A 3V7SA 1R0CB 2LX7A 2VKNA 1QQJA 2COZA 2LC4A 2KROA 1ZHIA 4PKCC 2XDDA 1B34B 3HSBA 4M7DG 1WYXA 2DBKA 2DL8A 1TUDA 2QK0A 2DM1A 3EHRA 3VS4A 1YBYA 3OBYA 4KH0B 3G6EA 1UE9A 2D6FA 3ZFJA 2E5QA 4HVUA 1QVGS 2E65A 1VQMA 1K0SA 4RMOA 1C6VX 3DB4A 3RBBB 3OYIA 2PNIA 4M7DF 2XU8A 2V8KA 3MCAB 2MCNA 1JB0E 3SD4A 1TSFA 1YCSB 2HZYA 2YUPA 1Y57A 3M53A 3QDRB 1LCKA 3RMSA 3OW2P 3MO8A 1BB9A 2OTLA 2EYXA 5KYWB 2OTJA 2QG9B 2VXFA 1VQOT 3G4SA 1QKXA 4RTYA 2P84A 1VQKA 1U5SA 4LDYA 3QBYA 5CIUA 1AWXA 2DD4A 2DVJA 1GFDA 1ABOA 2CSQA 2E1HA 2NYSA 4M7AG 5C6SA 3OBWA 3A8HB 1OZ3A 5AYFA 3JB9D 3X24B 3OYKA 2WSCE 2KDSA 2EVRA 1NJIU 3V7CA 4J9IA 3QWYA 1BBZA 5J3BA 4LDUA 3V8KA 2NUTB 1VQNT 3FDRA 3BW1A 5DLOA 1SRLA 3I55A 1ZA1B 5A2QE 2EFIA 1K73U 2RO0A 2O01E 4C92E 3HFOA 5FRNA 2KVQG 4HKEA 2J05A 4JPBW 1T0JA 2CP2A 1GXIE 1AEYA 3RDVA 1WLPB 4C8QC 4M7DD 4BDZA 2RM4A 5GMKh 2HEQA 1Y07A 3TSWA 3VRYA 1YWPA 1GBRA 4PJMA 3EH1A 4J9HA 2PVOB 4BI8B 2QEXA 2O9VA 2E3IA 2QDYB 2D0NA 5GAMf 1N6AA 1ZA2B 3CCVA 2QQAA 1S72A 1PNJA 4OGCA 2X4XA 3E1SA 3UATA 3FC3A 3HRTA 1SRMA 2DJQA 4F7UA 2BUDA 1SHFA 2HSEB 1FMVA 5D6YA 2HKQB 2CUBA 2VXEA 5L8RE 2COYA 2PZ1A 2QTVA 4BI3A 1OI1A 1YHQQ 1KFZA 2KT1A 1KQ1A 2X4JA 1UGVA 1C1AA 3QZ5B 3EG9B 1QWEA 1MV0B 3ZBDA 2O9SA 5KYUB 2EGAA 3AT1B 4X9CA 2SEMA 2VVKA 1SEMA 1ZX6A 2M16A 2YXYA 2XI9A 2DEUA 1M30A 3M0SA 2QYZA 5GANj 3C94A 2SRCA 3C95A 1BIBA 1BCMA 5KYXA 3I35A 4B6MA 3SWNB 1VYTA 2V8JA 1KIKA 4M7AE 2LQ8A 1YJ9A 2DL7A 1B7TA 1OU9A 4PJNA 2WACA 4JDSA 3ASKA 1Z9QA 3A8MB 3CC4Q 5LJ3j 1SHGA 1M2VB 1M5Q1 2CP5A 1ZSZC 3OA6A 4ORZA 2L2PA 4PLLA 2C0TA 2JTEA 1VQLQ 1OV3A 1SSFA 4O5VA 5FWCA 2P0PA 1IB8A 2DD5A 1VQ9T 5KE3A 2E70A 3EG0A 5GAOm 1GCQC 2KNBB 1M1FA 4C92C 2RK1A 2OAUA 3OB9A 1JRIA 4OMLA 1VQ7A 1TS9A 2OX7A 4E7KA 1UB4A 4ESRA 1YFNA 1RACB 4BY6C 2ROLA 5DY9A 2VASA 2K4YA 3NHNA 4J8OA 5LJ5g 5KH6A 3OYHA 4Y28E 4OP0A 2J6KA 1S1NA 1ARKA 3INZA 4HCZA 2D8HA 3L2RA 4MZTA 2PUOB 5GAN2 1WZOA 1OX9A 1XJWB 3CMAQ 3JCMV 4E7SA 2QQ9A 2NUPB 2MWPA 4AG1C 1T3LA 3FLGA 3WXMB 4J9FA 4RG2A 2EYWA 1QP2A 4RCCA 1VQ8T 2CZ6B 1VQOQ 4R0KA 3CCMT 4GLKA 2X35A 4J6YA 1GCPA 3VUZA 3CC2T 3G7ZA 4LXCA 2GQVA 3FJPA 1WX6A 2JJ9A 1VQ9A 4PJJA 5GJVB 3EGXB 1WJQA 4E6RA 2GCXA 2ZAEA 4IKFA 3RKXA 4EMKB 3LLRA 5LJ5h 4M77A 4M78D 2EYQA 3LX7A 5CKBA 1M1KU 2ZPIB 4QT7A 4J9GA 4C0FA 3UDCA 1YITA 1I4K1 3HRSA 2K3BA 2AIRB 4QQ6A 3M55A 3PFSA 2K3YA 3PT9A 1I5LA 1AZGB 4BDYA 1NPPA 4PJOA 1GBQA 1PSEA 2CT4A 4FYXB 2GFUA 2DFUA 2DVEA 3EHQA 5CO7A 2AT1B 1QCOA 5GMKl 1Q7YU 1RADB 4Y92A 3LWHA 4M7DA 1RAAB 4C92B 1LOJA 4FCYA 3CC2A 2FPEA 1Q82R 2YRCA 3QXEB 4KT0E 2QI2A 1MUZA 3L1AA 2COWA 2K57A 4B9XA 1AHJB 3GBQA 2D1XA 1ZUYA 4A54A 3JCMP 4JRKA 2ZPHB 4ELYC 3I9QA 1W4SA 1PRLC 4N4IA 2K79A 2JM9A 4M77G 1VQ4Q 2XDBA 4PJOF 3JB9G 4M75B 2LQWA 2DETA 2CP7A 1YJWT 1JBMA 2QAZA 5GMKm 4JJNK 4PJOG 1WXUA 2GFAA 4KRTA 4A4FA 1B07A 1XQHA 1RABB 3REBB 4A63B 3CPWS 2JVVA 3H6ZA 3CCLA 2LQKA 3OMGA 1ZBJA 1Q7YR 2K6DA 1KQSA 2JT4A 1M4ZA 2LRQA 2GTJA 4LDVA 3F70A 2QQBA 2L3SA 5HY6A 1YIJT 1OPLA 2Y90A 2V1RA 1UECA 1XNIA 2M1HA 2EPDA 1KQ2A 5GAN3 5GAN7 1KQSS 2GTOA 1G3WA 1VQ8Q 2EQKA 1G2BA 3RMQA 2JTFA 5GJWB 2EQJA 4ZGJB 2ENMA 1GFCA 1EIFA 3G6EQ 1X6OA 2DXUA 2XG8D 4C8QG 5IHIA 3I56T 1Y96B 4JLIA 4AFZC 1VQMQ 4PK4A 1C0MA 1YI2Q 1G3SA 2KRSA 2O4XA 1IGUA 4DBQA 3QZ9B 2A0FB 1Q81U 5KCOA 2RF0A 3VS6A 4XTXA 2HL3A 3MP8A 1YN8A 1IGQA 1IHVA 4MDXA 1D3BA 3OMCA 1YJWA 4J5YA 2QA4Q 1YIJA 2YUNA 1JEGA 4C8QF 3LGLA 4M75A 3FB9A 1QVPA 1ZSZA 2LZ6B 2B8AA 4PNOA 3X26B 2F5KA 3CCUQ 1W2BP 3EGDB 3SFMA 4RTXA 2RH2A 4FSXA 2DXBA 4O6JA 4DBRA 4QVCA 3G4SQ 3JCMh 4IUUA 4Z02A 5IT9E 2IG0A 4F04B 1KSWA 4PLIA 1UGSB 5I21A 2RQVA 2HD0A 1B34A 4RTVA 2MIOA 4DEYA 4J9CA 3CMEQ 2LNVA 5I22A 2AZSA 1ZSGA 2XKOC 1IZ6A 2FB7A 3EG9A 1B3QA 3SHWA 1YWOA 3S6WA 1M3AA 3I56A 4C92D 3MJXA 1QMCA 4LD9K 2EKHA 2QGFB 1JJ2S 4M7AF 4F7UG 1VYUA 1DJ7B 3TSZA 2KAFA 4C0DB 1K4US 2D9TA 4MZMA 1BCOA 4TVRA 3JCMe 1M3CA 5LJ3e 2DZ9A 1VQ5Q 1HD3A 1M8MA 5GAOp 4ME7A 1PKSA 3X25B 2A08A 3H41A 4E7JA 1K0XA 3BDUA 3E9GA 3UA7A 3HPWA 4IUQA 2C06A 5IAYA 1MNEA 2RA2A 2E12A 2MMPA 4M77C 2FYKA 1BI1A 3EH2A 1OOTA 1W2BA 1WHMA 2MF2A 2XICA 2EGCA 2E10A 2M0YA 4X1VA 3HKSA 1X2KA 3H0IA 3CXCP 1W70A 1PG5B 2EBPA 1X43A 3BDLA 3M4YA 2RB6A 2LCSA 3MHXA 1D0XA 3CPFA 3OYBA 3OSVA 5FW9A 2OAWA 1U8RA 3JB9H 1BIAA 1D0YA 1Y7XA 4M78E 3M0TA 4Q5WA 2PUKB 2DLPA 3PVQA 1U06A 2J7IA 4ELZC 2NWMA 3OS0A 1V1CA 1M1KC 1NLPC 1TOVA 2HQXA 2R5MA 3OYDA 1I07A 1WFWA 3EFOB 2LVMA 2HKNA 3O5ZA 2MI6A 2GBQA 1X2QA 3LH0A 3RKYA 2K5LA 2PTKA 4HXJA 3OW2A 3NFCA 4ZN1A 2RHUA 3MEUA 2YLBA 2H3EB 3WVDB 4QVDA 4E7HA 4PFPA 5GMKe 3VU3C 2O2OA 3CCJQ 1HYOA 3NGPA 4EMGA 1MMNA 4C8QA 1M90C 2NLUA 4HCCA 3G6ET 2O88A 1VQPQ 4HT8A 1X75C 3CC7Q 1Q86U 2DILA 3GOXA 5GAMd 4X34A 3QWXX 4LN2A 2OTLQ 2K5FA 3RNJA 1K73C 1AWWA 2ZPEB 2AZVA 1VQ5T 1MHNA 1RI9A 4Z88A 1VQKQ 1AD5A 3CBOA 4PJOB 4FU6A 3EGDA 2DIQA 3QKJA 1ZUUA 1NYFA 4M75D 1RLPC 3FIFA 3VS0A 3HTRA 2AKKA 2GF7A 1VQ7Q 5GAOn 5CKEA 1BI0A 5GANf 1GRIA 5FU7B 1X6GA 3NMZC 4PL6A 3L42A 1I81A 4CC7A 1Q82C 1K9MU 2V1QA 2DX1A 2RJCA 1QVFA 4XAXB 2QTXA 2JZ2A 1N8RC 3L2ZA 1WPYA 2FVUA 5FU7C 3EGUA 3M5AA 2XIDA 1K8AR 4IIMA 2DBMA 1FMKA 3DLMA 4RTUA 3PIPA 5GAN5 2M9UA 4RTWA 4FYYB 3PTAA 2DL4A 3L2WA 1NJIR 2L3RA 3OYYA 4F16A 2ED1A 2LQNA 7AT1B 4M78G 5HCKA 1H3HA 1V76A 3I55T 4OB2B 5CAIA 2KEAA 3P8BB 2BKDN 1PD1A 3EG2A 3GP8A 3OSSC 3R6NA 1WHGA 4QQDA 3LW5E 4FL6A 2GQIA 4RKUE 1OEBA 3SWNC 1VUBA 1D1AA 1OU8A 2KBTA 2KYBA 3VYHB 1S72Q 4OB1B 2RNAA 1FWZA 1ABQA 5LL6S 4M7AB 5KYYA 2HSPA 1PM3A 1G3YA 1WXBA 3ME9A 3LWIA 5AT1B 4HCKA 1UDLA 1K8AC 2XDPA 1FYNA 3FRNA 2A37A 2QGGA 5I11A 2RQUA 1K9MC 1VQ4T 4XU1A 1N8RR 2ZPBB 2E64A 4PJLA 2W10A 2HBPA 3A98A 1S72T 2A7YA 2J6OA 3MP1A 2EYYA 5C0MA 2JW4A 5LJ3h 1KJWA 4XU3A 3UA6A 1QLYA 1TG0A 2VWFA 4OF1A 5KYUA 1D3BB 3R6OA 1CSKA 2OTLT 3CCET 4RTTA 2VV5A 3VS3A 3OYEA 4A4EA 2W0ZA 1PC0A 2EGEA 1NBEB 1YJ9Q 3OW2S 1IXDA 3JCMc 4EMKA 1Q86R 5A0LA 3NTIA 2P0QA 1YI2T 3RR6A 4FT2A 2FPFA 2E5KA 1W1FA 6AT1B 2ED0A 3LGFA 4JZ3A 4C92G 1KHCA 4FIBA 4GY5A 4DBFA 1IO6A 2P4RA 3JCMJ 4J7IA 1H641 4MDWA 2MYSA 1QKWA 3QUIA 3A8GB 1AT1B 1LPLA 1X27A 2F1LA 4M77D 1RAEB 4XTUA 1RI0A 2ABLA 2L5QA 4M7AD 1VQNA 1KC8R 1MMGA 2FZGB 2PVDB 3HFNA 5HK3A 4K11A 1WJSA 4RUGA 1MMAA 4ZN3A 4M7DB 3GPLA 5CKHA 2KGTA 3M0QA 2RI2A 5FROA 1BU1A 3CPWP 2D8JA 1UHCA 1UEBA 2F5TX 2JOYA 4ATOA 4MZPA 2MOXA 1PKTA 3P8DA 4NL2A 4JUVA 1MGQA 3KBGA 1YI2A 1I8FA 4JS4A 2CZ0B 1NYGA 5GAOr 3VV0A 1VYVA 3CCRQ 1WGSA 1CKAA 2LT1A 4RCBA 1OYXA 1Q95G 5GMKi 1NJIC 1TUCA 1LNXA 4FYVB 1G83A 3VUBA 4B9WA 4F7UF 1YJWQ 3RIRA 1VQ6Q 2K5IA 2CREA 4WCIA 2X3WD 3CCVT 1W2BS 2EJFA 1FX7A 1H3ZA 3KUFA 1WHLA 2CP0A 4DOVA 3CCUA 4JRIA 2YT6A 3PGGA 2ESWA 2KYMA 2LP5A 3JCMX 2VGMA 3A8OB 4LDXA 4QQGA 4C0DC 3CCST 4JJBA 4N0AA 2WSEE 3ULRB 3CBPA 1MMDA 3EFOA 3MKDA 3SDZA 3QJYA 1WQWA 1RUWA 3M58A 1M3BA 2FRYA 5GANh 2K2MA 3X28B 4EDUA 2LTOA 1HSQA 2XHCA 2L8DA 1YITT 1QCFA 2EW3A 4MMKA 3CC2Q 1SPKA 5GANg 5IXBA 1RLQC 4BE0A 4C8QE 2K7AA 3LYIA 4N4HA 4EPCA 3GIBA 2H8HA 2P4TA 4DBHA 2RHXA 1YJ9T 2J6FA 1QWFA 4D6WA 4ANJA 4Z8AA 1WJRA 4CC3A 5HKCA 3JCMf 3C4SA 5GAMe 1K8AU 1E7OA 1R0BG 3TVTA 5DLQE 1VQ4A 1PCXA 2CUDA 4EMKC 2LCLA 3M4GA 1FXXA 1SSHA 3S3OA 2ROTA 2DO3A 3CXCS 3OYNA 2ZPFB 3CCLQ 4M78A 1WQ7A 2YLCA 2EAYA 3CCRT 3CCEQ 3V8JA 2XD0A 1N9SA 1YNZA 2Y4YA 2FL7A 2F2VA 1OQKA 3M56A 5CKFA 4GLMA 2XK0A 1NLOC 1IREB 1RAGB 3URGA 1TU0B 2G6FX 3E19A 4DQ2A 2YSQA 3BFMA 1HK9A 3VS1A 2FZKB 1UG1A 1GCQA 2G3RA 1RAHB 5FLXE 4GBQA 1NM7A 4OB0B 2AK5A 2EQUA 1ZUKA 3CCMQ 2CH4W 3RERA 1U1SA 2P0KA 4NOYA 1Q86C 5LJ5f 4ZGEB 3TCJA 1YJNA 4M75F 4CRIA 3DB3A 1XTDA 5KE2A 3L2QA 3G71Q 2LJ1A 4F14A 2CS7A 3UWNA 2FG0A 4DEXA 3OYLA 2DYIA 4BB7A 1AVZC 3DKMA 4JJCA 2PVGB 1X6BA 3JB9J 3MEVA 4J9DA 4HVWA 4OMPA 4MMLA 2QA4A 2DPPB 2E4HA 2RK2A 5CKDA 3CC7A 1G5VA 2X4WA 1KK7A 3RKWA 4KUDK 4C8QD 4M7DC 5EC7A 2A28A 2RHIA 3CCSQ 1HXDA 2DTIA 3HL8A 1YP5A 2KRMA 2QASA 3EGXA 3GF5A 4M78B 3M9QA 2FO0A 2OTJT 3CMET 5FWBA 2JS2A 2BZXA 4J6WA 3X20B 1E6HA 3DLLA 3SB2A 4OMNA 1M27C 2EYZA 4HCBA 1K76A 1UHFA 3V8LA 4F17A 4RTZA 4JZ4A 2FRWA 3PNWC 4AMCA 3TREA 3P8HA 2RMOA 2ZGWA 1U1TA 4FM4B 1UGPB 2NUTA 3JCMb 3FEOA 3I5RA 2VB6A 5LJ3g 5GAN4 3I56Q 4PFOA 2R5AA 1M90U 1G3TA 1MV3A 2DRMA 2LNHB 3TU4K 2QA4T 3ZL7C 2WSFE 3Q1JA 4FW2A 1VQ5A 4OMQA 1I1JA 2AHJB 3CCQT 1X69A 2MK5A 1UFFA 1NEGA 5GAMg 1OZ2A 2VGNA 4D8DA 2BTTA 3PE0A 4C0GA 4M77F 2LJ3A 1Y0MA 1X01A 2KK4A 5IHNA 3UPUA 5KCHA 3NTHA 4X9DA 2DAQA 2ECZA 2O31A 4L6V5 4JRQA 1ACMB 3JRZA 1WXTA 4CC4B 4A53A 1VQPT 3S3NA 4BD3A 3UF4A 2FEIA 4A4GA 5CK9A 1QCNA 4QVZA 1ZQ1A 2DXCA 2XMFA 2CP3A 5DM7R 1T0HA 3EAEA 1BKBA 3C0CA 2LDMA 1D09B 2DMOA 2LX9A 5GMKj 5CR2A 2KT8A 2JM8A 4LE9A 3CCQQ 2K9GA 5HK0A 4XTZA 2J06A 1H8KA 3BE3A 3QG1A 2HDAA 1V29B 1XOVA 3PIOA 1RL2A 3FJ5A 2RHZA 1TWBA 2EQIA 2YRDA 1JXMA 3IQLA 1IRXA 2V8IA 4XTWA 2O4XB 3MEWA 2IVWA 3JCMg 3PMTA 3CCJA 4V2SA 1ZBXA 3L2VA 1CKBA 5GAN6 1M8VA 2LCCA 2C0IA 2HQHA 3CD6T 4M4ZA 5KYWA 3U23A 4AG2C 1Q7YC 4EIKA 3M59A 1M2OA 1UGRB 1VQPA 2I2LA 3OS1A 3G4ST 4KGVB 2DE0X 4L59A 2OTJQ 2L0AA 4OVAA 3EFRA 2K3XA 5CQXA 3OS5A 1BI3A 3E9FA 3C12A 4PJOE 1VQ6T 1O75A 2RQTA 5FU6B 3QYHB 3RUXA 4E47A 3OYMA 2LMJA 1R77A 1PRMC 2DK3A 4E2FB 3META 2CH4A 3CQTA 5IXFA 2X51A 1WI7A 1R8OB 4PJOD 2KRNA 2BZ8A 3N5BB 1K73R 4CI0C 1SF9A 2PU9B 4M75E 1VQNQ 1VA7A 3OY9A 1LJOA 2IPOB 2NUPA 5M9OA 3CD6Q 1TUGB 2M51A 4M7AC 1WHKA 2JMAA 1WA7A 2HCKA 2CKKA 5GAMj 3LH5A 1H92A 1WHHA 2L89A 3G1JA 3EFSA 2EJGA 3REAB 4A4HA 1W6XA 3QHSA 2MAMA 3QSUA 2EWNA 2R58A 1FMWA 3NPFA 2GNCA 5LJ5e 3MPUB 1AWJA 2OI3A 4E7LA 3J81E 4ZGDB 4QW2A 4M78F 2HMAA 3JCMd 2QEXQ 2JN0A 4Y91A 3VS5A 4LUDA 1VQ6A 4D8KA 4J7FA 1Y71A 2DRKA 2IIMA 4F7UB 2QDLA 4BY6B 2NUZA 4LUEA 2M0OA 4A4KA 2KE9A 4NL3A 3L2UA 2OJ2A 3J80E 1NPRA 5LJ5j 3M0PA 4KGZB 2CDTA 4XU2A 4EMHA 3VKIA 2DTOA 4XTYA 5LJ3f 2DYBA 3OYCA 4R56A 1AOJA 1T3SA 2FHDA 4CC2A 4QKUA 1QVGP 4J83A 4PFZA 3H0FA 2DERA 3M0RA 1VQKT 3SWNA 5KYNA 1N27A 2EKOA 2RI5A 4LDWA 1K9MR 1QW1A 1JU5C 3E2UA 3OYAA 5FRMA 4XQ3A 1NEBA 3D7SB 2VUBA 1D1CA 2FZCB 4M7DE 2DA9A 3CCUT 1M2VA 9ATCB 3JAME 1UGQB 3GLXA 1KD1U 5FU6C 2EIFA 4VUBA 1KQSP 3H9NA 4XU0A 3QDFA 1Q81C 1VQ7T 1WDXA 3EG3A 4E7IA 4BE1A 2KMTA 3KXTA 2X9HA 4LD6A 5D7UA 1TTHB 1VIFA 4F7UE 4C0ZA 3VYGA 2H3JA 3CMAT 3CPWA 4FW1A 4OMFB 3CCLT 3CCEA 2ATCB 2ZZDA 3JB9I 2BZYA 3M54A 4KUIA 5GAOl 1E6GA 1J3TA 2RQWA 4M77E 2Z0WA 3TQ7P 2YRVA 1UJYA 3QIIA 1TH7A 3GNGA 1N8RU 4R55A 3I55Q 1AZEA 3S3MA 2AKLA 2QEXT 3I5SA 4IUVA 2E41A 2DKGA 3CEYA 1GL5A 1WNLA 2Y4XA 2I0NA 2RJFA 3CCMA 4C5HA 2F2XA 1YHQT 5I2MA 2KSSA 1SG5A 5IHKA 3NTKA 3V7RA 1WIEA 2LJ0A 2L3PA 2RI3A 3HP9A 5L23A 5GAMh 2ZCFB 3G71A 3M0UA 4M75G 3CCRA 3THKA 1O9SA 4XTVA 1AWOA 3ER0A 3JB9F 3TEEA 2MPXC 1WHJA 2DZCA 4KH1B 1M9SA 2DXTA 2VC8A 3JCMW 2PQWA 4OGEA 1VOMA 1UUEA 3A5ZB 2DL5A 2KXDA 4FT4A 1VQLT 5KYXB 1QVFS 1RAFB 1N9RA 2RJEA 1IHWA 1VIEA 3PMIA 1YITQ 3EG1A 4E7ZA 3CCVQ 1Q82U 1HJDA 5CCAA 3CC4T 4HA8A 1QP3A 4ZNXA 5GANe 4BI4A 4P5NA 3OYGA 3CXCA 2A3LA 1TXQA 4OB3B 4IURA 1G8XA 4C92F 1YHQA 3VJPA 3JCMQ 2HBWA 3VS2A 4BUGA 3CC7T 1I0CA 4OMMA 5EG2A 3SEMA 5KYYB 4M7AA 2DL3A 4C5EA 2D0QB 5LJ5d 5GAN8 3G71T 1RAIB 1BI2A 1K9AA 1Q81R 4PJOC 1M1KR 1JJ2P 2DEQA 1SKUB 4Z89A 3CBMA 2X4YA 3QYGB 5J39A 5CVIA 5J26A 5ECAA 2C0OA 2VYTA 3RESA 4ZTFA 4UC4A 4C5IA 5IH2A 1BK2A 1PSFA 2CZ7B 1PD0A 1EFNA 1M1GA 1QVGA 2GGRA 3KFVA 3CC4A 2LT4A 1K1ZA 1NG2A 2F69A 4JS5A 1Z9ZA
chains in the Genus database with same CATH topology
3EG0A 3ZL7C 1GCQC 1GRIA 2KNBB 1X6GA 3NMZC 4CC7A 2V1QA 2DX1A 1I1JA 4OMQA 4OMLA 1U3OA 1X69A 1UFFA 2JS0A 2YUOA 1NEGA 4D8DA 2BTTA 3PE0A 4ESRA 3EGUA 4JJDA 1N5ZA 2ROLA 2LJ3A 1Y0MA 3NHNA 4IIMA 2DBMA 5IHNA 1FMKA 2JMCA 4RTUA 1UJ0A 2J6KA 1S1NA 2CT3A 2F2WA 4RTWA 1ARKA 2ECZA 2D8HA 2DL4A 2O31A 4F16A 2ED1A 2LQNA 5HCKA 1H3HA 1WXTA 2RQRA 2A36A 2KXCA 4AG1C 4CC4B 4LNPA 1T3LA 2KEAA 4J9FA 3UF4A 2FEIA 2EYWA 3EG2A 3R6NA 4R0KA 1GCPA 2XMFA 1T0HA 3C0CA 2GQIA 1OEBA 2DMOA 1UTIA 2KBTA 1WX6A 5FWCA 2KYBA 5GJVB 2KT8A 4E6RA 2JM8A 4LE9A 1PHTA 2RNAA 2K9GA 1ABQA 2J06A 1H8KA 3H0HA 2HDAA 2HSPA 1XOVA 1WXBA 2L3QA 3FJ5A 2EQIA 4J9GA 4QT7A 1JXMA 3IQLA 2K3BA 4HCKA 4AFSC 1UDLA 1FYNA 2A37A 5I11A 2RQUA 4FSSA 1AZGB 1CKBA 1GBQA 2C0IA 2CT4A 2W10A 3A98A 2J6OA 4M4ZA 2EYYA 4HVVA 2JW4A 3EHQA 1KJWA 3U23A 4AG2C 4EIKA 2X3XD 3UA6A 1QLYA 1TG0A 2VWFA 4Y92A 3PVLA 2DE0X 1OPKA 2L0AA 2RN8A 1CSKA 2FPEA 4RTTA 1ZLMA 1A0NB 2CSIA 2RQTA 3VS3A 2W0ZA 2LMJA 2EGEA 1MUZA 1PRMC 1JO8A 2FPDA 4AFUC 2DNUA 2JXBA 2KR3A 2CH4A 2D1XA 3GBQA 1ZUYA 3CQTA 2FPFA 4J9EA 5IXFA 2E5KA 3I9QA 1W1FA 1PRLC 1WI7A 2RPNA 2ED0A 2K79A 2KRNA 2BZ8A 1JQQA 2JM9A 4JZ3A 1IO6A 2P4RA 2LQWA 4J9BA 4OMOA 1QKWA 1VA7A 1WXUA 4KRTA 1X27A 1B07A 3REBB 4A63B 2B86A 2M51A 1PWTA 2ABLA 2JMAA 1WA7A 2HCKA 1ZBJA 3LH5A 1H92A 2K6DA 4AFQC 3VRZA 2JT4A 3REAB 3JV3A 2GTJA 1W6XA 2YDLA 2L3SA 4K11A 1OPLA 4RUGA 2V1RA 1UECA 2YUQA 2EPDA 3NPFA 2GNCA 2KGTA 2GTOA 3M0QA 1AWJA 2OI3A 1JXOA 2DF6A 1BU1A 2D8JA 1UHCA 4IIOA 3VS7A 1G2BA 2MOXA 1PKTA 2LX7A 2VKNA 5GJWB 2ENMA 1GFCA 3VS5A 4LUDA 2KROA 1NYGA 5IHIA 4D8KA 1VYVA 1WYXA 2DBKA 2DL8A 1TUDA 4AFZC 1CKAA 2DM1A 2DRKA 2IIMA 3EHRA 3VS4A 2QDLA 2NUZA 4LUEA 1TUCA 1G83A 2KRSA 1UE9A 2KE9A 4HVUA 4WCIA 2CREA 2OJ2A 2X3WD 2RF0A 3VS6A 1K0SA 1YN8A 3M0PA 2CDTA 3RBBB 2PNIA 2YUNA 1JEGA 2YT6A 2ESWA 2KYMA 2LP5A 2DYBA 2LZ6B 1AOJA 1T3SA 4CC2A 2MCNA 4JJBA 3ULRB 1YCSB 2YUPA 1Y57A 4RTXA 3H0FA 1RUWA 1LCKA 1M3BA 3M0RA 2FRYA 1BB9A 2K2MA 1HSQA 1KSWA 2EYXA 1JU5C 2RQVA 1QCFA 2EW3A 1NEBA 4RTVA 2MIOA 1SPKA 5IXBA 4DEYA 1RLQC 2DA9A 1QKXA 4J9CA 4RTYA 2K7AA 1U5SA 2H8HA 5I22A 2AZSA 1ZSGA 1AWXA 2DVJA 1WDXA 3EG3A 1GFDA 2J6FA 1B3QA 1ABOA 2CSQA 1QWFA 3SHWA 1YWOA 1M3AA 4Z8AA 4CC3A 2EKHA 1E7OA 3TVTA 2EVRA 1VYUA 4J9IA 3TSZA 3QWYA 2CUDA 1K4US 1BBZA 1M3CA 2BZYA 1SSHA 1HD3A 1M8MA 1E6GA 1SRLA 2ROTA 1J3TA 1PKSA 2RQWA 2A08A 3H41A 1K0XA 3UA7A 2J05A 4JPBW 1T0JA 1UJYA 1YNZA 1AEYA 2F2VA 1AZEA 1WLPB 4GLMA 2AKLA 1OOTA 3I5SA 1NLOC 2HEQA 2EGCA 2M0YA 4X1VA 3TSWA 2G6FX 3VRYA 1X2KA 1YWPA 3H0IA 1GBRA 1W70A 1GL5A 2YSQA 2I0NA 4J9HA 2EBPA 2F2XA 1X43A 3VS1A 5IHKA 1UG1A 2LCSA 1GCQA 2O9VA 1WIEA 2LJ0A 2L3PA 5FW9A 2OAWA 2D0NA 4GBQA 1NM7A 2AK5A 3M0TA 1ZUKA 5L23A 2CH4W 2DLPA 3PVQA 1U06A 3M0UA 2J7IA 3THKA 2NWMA 1V1CA 1AWOA 1NLPC 1I07A 1WFWA 1PNJA 3O5ZA 3UATA 2GBQA 1SRMA 2DJQA 1X2QA 1UUEA 2PTKA 4HXJA 2DL5A 2LJ1A 4F14A 2KXDA 2FG0A 1SHFA 4DEXA 3EG1A 1AVZC 2CUBA 1HJDA 4JJCA 1X6BA 2PZ1A 4J9DA 4HVWA 4ZNXA 4OMPA 1KFZA 2KT1A 2O2OA 3NGPA 1UGVA 5EC7A 1QWEA 1MV0B 2A28A 2O9SA 2EGAA 2O88A 1YP5A 2SEMA 2VVKA 2KRMA 1SEMA 2HBWA 1ZX6A 3VS2A 2DILA 2FO0A 5FWBA 2JS2A 2BZXA 1I0CA 4OMMA 3QWXX 1M30A 3M0SA 1E6HA 4LN2A 3SEMA 2DL3A 2SRCA 3RNJA 4OMNA 1AWWA 1M27C 3I35A 1K9AA 2AZVA 2EYZA 1K76A 1VYTA 1KIKA 1UHFA 4Z89A 2DL7A 4F17A 1RI9A 4RTZA 4Z88A 5ECAA 2C0OA 2FRWA 4JZ4A 2RMOA 1AD5A 1Z9QA 1SHGA 1ZUUA 5IH2A 1BK2A 1NYFA 3I5RA 4ORZA 2L2PA 1RLPC 2C0TA 1EFNA 2JTEA 3VS0A 1MV3A 2DRMA 2GGRA 2LNHB 3KFVA 1OV3A 2AKKA 1K1ZA 1NG2A 1Z9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG0 A;  3ZL7 C;  1GCQ C;  1GRI A;  2KNB B;  1X6G A;  3NMZ C;  4CC7 A;  2V1Q A;  2DX1 A;  1I1J A;  4OMQ A;  4OML A;  1U3O A;  1X69 A;  1UFF A;  2JS0 A;  2YUO A;  1NEG A;  4D8D A;  2BTT A;  3PE0 A;  4ESR A;  3EGU A;  4JJD A;  1N5Z A;  2ROL A;  2LJ3 A;  1Y0M A;  3NHN A;  4IIM A;  2DBM A;  5IHN A;  1FMK A;  2JMC A;  4RTU A;  1UJ0 A;  2J6K A;  1S1N A;  2CT3 A;  2F2W A;  4RTW A;  1ARK A;  2ECZ A;  2D8H A;  2DL4 A;  2O31 A;  4F16 A;  2ED1 A;  2LQN A;  5HCK A;  1H3H A;  1WXT A;  2RQR A;  2A36 A;  2KXC A;  4AG1 C;  4CC4 B;  4LNP A;  1T3L A;  2KEA A;  4J9F A;  3UF4 A;  2FEI A;  2EYW A;  3EG2 A;  3R6N A;  4R0K A;  1GCP A;  2XMF A;  1T0H A;  3C0C A;  2GQI A;  1OEB A;  2DMO A;  1UTI A;  2KBT A;  1WX6 A;  5FWC A;  2KYB A;  5GJV B;  2KT8 A;  4E6R A;  2JM8 A;  4LE9 A;  1PHT A;  2RNA A;  2K9G A;  1ABQ A;  2J06 A;  1H8K A;  3H0H A;  2HDA A;  2HSP A;  1XOV A;  1WXB A;  2L3Q A;  3FJ5 A;  2EQI A;  4J9G A;  4QT7 A;  1JXM A;  3IQL A;  2K3B A;  4HCK A;  4AFS C;  1UDL A;  1FYN A;  2A37 A;  5I11 A;  2RQU A;  4FSS A;  1AZG B;  1CKB A;  1GBQ A;  2C0I A;  2CT4 A;  2W10 A;  3A98 A;  2J6O A;  4M4Z A;  2EYY A;  4HVV A;  2JW4 A;  3EHQ A;  1KJW A;  3U23 A;  4AG2 C;  4EIK A;  2X3X D;  3UA6 A;  1QLY A;  1TG0 A;  2VWF A;  4Y92 A;  3PVL A;  2DE0 X;  1OPK A;  2L0A A;  2RN8 A;  1CSK A;  2FPE A;  4RTT A;  1ZLM A;  1A0N B;  2CSI A;  2RQT A;  3VS3 A;  2W0Z A;  2LMJ A;  2EGE A;  1MUZ A;  1PRM C;  1JO8 A;  2FPD A;  4AFU C;  2DNU A;  2JXB A;  2KR3 A;  2CH4 A;  2D1X A;  3GBQ A;  1ZUY A;  3CQT A;  2FPF A;  4J9E A;  5IXF A;  2E5K A;  3I9Q A;  1W1F A;  1PRL C;  1WI7 A;  2RPN A;  2ED0 A;  2K79 A;  2KRN A;  2BZ8 A;  1JQQ A;  2JM9 A;  4JZ3 A;  1IO6 A;  2P4R A;  2LQW A;  4J9B A;  4OMO A;  1QKW A;  1VA7 A;  1WXU A;  4KRT A;  1X27 A;  1B07 A;  3REB B;  4A63 B;  2B86 A;  2M51 A;  1PWT A;  2ABL A;  2JMA A;  1WA7 A;  2HCK A;  1ZBJ A;  3LH5 A;  1H92 A;  2K6D A;  4AFQ C;  3VRZ A;  2JT4 A;  3REA B;  3JV3 A;  2GTJ A;  1W6X A;  2YDL A;  2L3S A;  4K11 A;  1OPL A;  4RUG A;  2V1R A;  1UEC A;  2YUQ A;  2EPD A;  3NPF A;  2GNC A;  2KGT A;  2GTO A;  3M0Q A;  1AWJ A;  2OI3 A;  1JXO A;  2DF6 A;  1BU1 A;  2D8J A;  1UHC A;  4IIO A;  3VS7 A;  1G2B A;  2MOX A;  1PKT A;  2LX7 A;  2VKN A;  5GJW B;  2ENM A;  1GFC A;  3VS5 A;  4LUD A;  2KRO A;  1NYG A;  5IHI A;  4D8K A;  1VYV A;  1WYX A;  2DBK A;  2DL8 A;  1TUD A;  4AFZ C;  1CKA A;  2DM1 A;  2DRK A;  2IIM A;  3EHR A;  3VS4 A;  2QDL A;  2NUZ A;  4LUE A;  1TUC A;  1G83 A;  2KRS A;  1UE9 A;  2KE9 A;  4HVU A;  4WCI A;  2CRE A;  2OJ2 A;  2X3W D;  2RF0 A;  3VS6 A;  1K0S A;  1YN8 A;  3M0P A;  2CDT A;  3RBB B;  2PNI A;  2YUN A;  1JEG A;  2YT6 A;  2ESW A;  2KYM A;  2LP5 A;  2DYB A;  2LZ6 B;  1AOJ A;  1T3S A;  4CC2 A;  2MCN A;  4JJB A;  3ULR B;  1YCS B;  2YUP A;  1Y57 A;  4RTX A;  3H0F A;  1RUW A;  1LCK A;  1M3B A;  3M0R A;  2FRY A;  1BB9 A;  2K2M A;  1HSQ A;  1KSW A;  2EYX A;  1JU5 C;  2RQV A;  1QCF A;  2EW3 A;  1NEB A;  4RTV A;  2MIO A;  1SPK A;  5IXB A;  4DEY A;  1RLQ C;  2DA9 A;  1QKX A;  4J9C A;  4RTY A;  2K7A A;  1U5S A;  2H8H A;  5I22 A;  2AZS A;  1ZSG A;  1AWX A;  2DVJ A;  1WDX A;  3EG3 A;  1GFD A;  2J6F A;  1B3Q A;  1ABO A;  2CSQ A;  1QWF A;  3SHW A;  1YWO A;  1M3A A;  4Z8A A;  4CC3 A;  2EKH A;  1E7O A;  3TVT A;  2EVR A;  1VYU A;  4J9I A;  3TSZ A;  3QWY A;  2CUD A;  1K4U S;  1BBZ A;  1M3C A;  2BZY A;  1SSH A;  1HD3 A;  1M8M A;  1E6G A;  1SRL A;  2ROT A;  1J3T A;  1PKS A;  2RQW A;  2A08 A;  3H41 A;  1K0X A;  3UA7 A;  2J05 A;  4JPB W;  1T0J A;  1UJY A;  1YNZ A;  1AEY A;  2F2V A;  1AZE A;  1WLP B;  4GLM A;  2AKL A;  1OOT A;  3I5S A;  1NLO C;  2HEQ A;  2EGC A;  2M0Y A;  4X1V A;  3TSW A;  2G6F X;  3VRY A;  1X2K A;  1YWP A;  3H0I A;  1GBR A;  1W70 A;  1GL5 A;  2YSQ A;  2I0N A;  4J9H A;  2EBP A;  2F2X A;  1X43 A;  3VS1 A;  5IHK A;  1UG1 A;  2LCS A;  1GCQ A;  2O9V A;  1WIE A;  2LJ0 A;  2L3P A;  5FW9 A;  2OAW A;  2D0N A;  4GBQ A;  1NM7 A;  2AK5 A;  3M0T A;  1ZUK A;  5L23 A;  2CH4 W;  2DLP A;  3PVQ A;  1U06 A;  3M0U A;  2J7I A;  3THK A;  2NWM A;  1V1C A;  1AWO A;  1NLP C;  1I07 A;  1WFW A;  1PNJ A;  3O5Z A;  3UAT A;  2GBQ A;  1SRM A;  2DJQ A;  1X2Q A;  1UUE A;  2PTK A;  4HXJ A;  2DL5 A;  2LJ1 A;  4F14 A;  2KXD A;  2FG0 A;  1SHF A;  4DEX A;  3EG1 A;  1AVZ C;  2CUB A;  1HJD A;  4JJC A;  1X6B A;  2PZ1 A;  4J9D A;  4HVW A;  4ZNX A;  4OMP A;  1KFZ A;  2KT1 A;  2O2O A;  3NGP A;  1UGV A;  5EC7 A;  1QWE A;  1MV0 B;  2A28 A;  2O9S A;  2EGA A;  2O88 A;  1YP5 A;  2SEM A;  2VVK A;  2KRM A;  1SEM A;  2HBW A;  1ZX6 A;  3VS2 A;  2DIL A;  2FO0 A;  5FWB A;  2JS2 A;  2BZX A;  1I0C A;  4OMM A;  3QWX X;  1M30 A;  3M0S A;  1E6H A;  4LN2 A;  3SEM A;  2DL3 A;  2SRC A;  3RNJ A;  4OMN A;  1AWW A;  1M27 C;  3I35 A;  1K9A A;  2AZV A;  2EYZ A;  1K76 A;  1VYT A;  1KIK A;  1UHF A;  4Z89 A;  2DL7 A;  4F17 A;  1RI9 A;  4RTZ A;  4Z88 A;  5ECA A;  2C0O A;  2FRW A;  4JZ4 A;  2RMO A;  1AD5 A;  1Z9Q A;  1SHG A;  1ZUU A;  5IH2 A;  1BK2 A;  1NYF A;  3I5R A;  4ORZ A;  2L2P A;  1RLP C;  2C0T A;  1EFN A;  2JTE A;  3VS0 A;  1MV3 A;  2DRM A;  2GGR A;  2LNH B;  3KFV A;  1OV3 A;  2AKK A;  1K1Z A;  1NG2 A;  1Z9Z A; 
#chains in the Genus database with same CATH topology
 2M02 A;  2KQW A;  3HHT B;  1VQL A;  3O8V A;  5GAO q;  1KD1 R;  1D0Z A;  1U3O A;  2DTH A;  1KG1 A;  2BE9 B;  3J7A F;  2JS0 A;  2YUO A;  2KI7 A;  3MEA A;  4JJD A;  1N5Z A;  4C5G A;  2JMC A;  1UJ0 A;  3WVE B;  1VQ8 A;  2CT3 A;  2F2W A;  2QXF A;  4KBM B;  3GNF B;  3OYJ A;  2KY9 A;  3A1P A;  2HQE A;  3H8Z A;  3MP6 A;  1YCY A;  2K2V A;  2RQR A;  2A36 A;  3AHU A;  2KXC A;  2JUF A;  4LNP A;  2JNG A;  3OQ5 A;  5LJ3 d;  4BAC A;  2QQR A;  3CCQ A;  3BY7 A;  3M57 A;  3CMA A;  4HT9 A;  4FYW B;  1NE8 A;  4DOW A;  1UTI A;  1BYM A;  2CP6 A;  2E6N A;  2RD1 A;  1VQO A;  1YJN Q;  1PHT A;  5I2S A;  4IUP A;  1EX4 A;  3A8L B;  2EQM A;  3QO3 A;  2CYZ B;  4C92 A;  3H0H A;  4M78 C;  4C8Q B;  1ZSZ B;  2L3Q A;  1VQ9 Q;  2RJD A;  1OUL A;  3QPH A;  1YIJ Q;  4AFS C;  3JSC A;  1OX8 A;  4XK8 E;  4IUT A;  4M75 C;  3HRU A;  1F1B B;  3OYF A;  4WTO B;  4FSS A;  1M90 R;  1YJN T;  3OS2 A;  4HVV A;  3CCS A;  2HAX A;  2HNI A;  1KC8 C;  1LVK A;  2X3X D;  1KC8 U;  2V26 A;  2ZPG B;  3ZEH A;  3PVL A;  4DA4 A;  1OPK A;  2BIV A;  4YTL A;  4NS5 A;  2RN8 A;  1KD1 C;  4J6X A;  1ZLM A;  1A0N B;  2CSI A;  4N4G A;  4WF2 A;  3CME A;  1NZ9 A;  1P92 A;  2YHT A;  1JO8 A;  2FPD A;  4AFU C;  2DNU A;  3QJ6 A;  2JXB A;  3CCJ T;  2KR3 A;  5A0G A;  4RG8 A;  4J9E A;  2DIG A;  4N0A C;  5CQY A;  4JRP A;  1VQM T;  2RPN A;  3CD6 A;  1JQQ A;  4ZTJ A;  5A0D A;  1I5O B;  5IN1 A;  2JTM A;  3T9N A;  4J9B A;  4OMO A;  8AT1 B;  4KUL A;  5D6X A;  2MWO A;  4II1 A;  2B86 A;  2R57 A;  2CZ1 B;  8ATC B;  2E3H A;  2YWW A;  1MND A;  1PWT A;  2DJZ A;  1Y96 A;  1EZZ B;  4AFQ C;  1JJ2 A;  3VRZ A;  5GAN d;  2BE7 D;  2RHY A;  4AT1 B;  3JV3 A;  1KHI A;  2YDL A;  2EJ9 A;  5D6W A;  2E6Z A;  1QVF P;  2YUQ A;  2HL5 C;  2CGH A;  4KGX B;  1JXO A;  2DF6 A;  2QQS A;  4JLG A;  1D1B A;  4L5G A;  4M77 B;  4BE2 A;  4IIO A;  3UT1 A;  3VS7 A;  3V7S A;  1R0C B;  2LX7 A;  2VKN A;  1QQJ A;  2COZ A;  2LC4 A;  2KRO A;  1ZHI A;  4PKC C;  2XDD A;  1B34 B;  3HSB A;  4M7D G;  1WYX A;  2DBK A;  2DL8 A;  1TUD A;  2QK0 A;  2DM1 A;  3EHR A;  3VS4 A;  1YBY A;  3OBY A;  4KH0 B;  3G6E A;  1UE9 A;  2D6F A;  3ZFJ A;  2E5Q A;  4HVU A;  1QVG S;  2E65 A;  1VQM A;  1K0S A;  4RMO A;  1C6V X;  3DB4 A;  3RBB B;  3OYI A;  2PNI A;  4M7D F;  2XU8 A;  2V8K A;  3MCA B;  2MCN A;  1JB0 E;  3SD4 A;  1TSF A;  1YCS B;  2HZY A;  2YUP A;  1Y57 A;  3M53 A;  3QDR B;  1LCK A;  3RMS A;  3OW2 P;  3MO8 A;  1BB9 A;  2OTL A;  2EYX A;  5KYW B;  2OTJ A;  2QG9 B;  2VXF A;  1VQO T;  3G4S A;  1QKX A;  4RTY A;  2P84 A;  1VQK A;  1U5S A;  4LDY A;  3QBY A;  5CIU A;  1AWX A;  2DD4 A;  2DVJ A;  1GFD A;  1ABO A;  2CSQ A;  2E1H A;  2NYS A;  4M7A G;  5C6S A;  3OBW A;  3A8H B;  1OZ3 A;  5AYF A;  3JB9 D;  3X24 B;  3OYK A;  2WSC E;  2KDS A;  2EVR A;  1NJI U;  3V7C A;  4J9I A;  3QWY A;  1BBZ A;  5J3B A;  4LDU A;  3V8K A;  2NUT B;  1VQN T;  3FDR A;  3BW1 A;  5DLO A;  1SRL A;  3I55 A;  1ZA1 B;  5A2Q E;  2EFI A;  1K73 U;  2RO0 A;  2O01 E;  4C92 E;  3HFO A;  5FRN A;  2KVQ G;  4HKE A;  2J05 A;  4JPB W;  1T0J A;  2CP2 A;  1GXI E;  1AEY A;  3RDV A;  1WLP B;  4C8Q C;  4M7D D;  4BDZ A;  2RM4 A;  5GMK h;  2HEQ A;  1Y07 A;  3TSW A;  3VRY A;  1YWP A;  1GBR A;  4PJM A;  3EH1 A;  4J9H A;  2PVO B;  4BI8 B;  2QEX A;  2O9V A;  2E3I A;  2QDY B;  2D0N A;  5GAM f;  1N6A A;  1ZA2 B;  3CCV A;  2QQA A;  1S72 A;  1PNJ A;  4OGC A;  2X4X A;  3E1S A;  3UAT A;  3FC3 A;  3HRT A;  1SRM A;  2DJQ A;  4F7U A;  2BUD A;  1SHF A;  2HSE B;  1FMV A;  5D6Y A;  2HKQ B;  2CUB A;  2VXE A;  5L8R E;  2COY A;  2PZ1 A;  2QTV A;  4BI3 A;  1OI1 A;  1YHQ Q;  1KFZ A;  2KT1 A;  1KQ1 A;  2X4J A;  1UGV A;  1C1A A;  3QZ5 B;  3EG9 B;  1QWE A;  1MV0 B;  3ZBD A;  2O9S A;  5KYU B;  2EGA A;  3AT1 B;  4X9C A;  2SEM A;  2VVK A;  1SEM A;  1ZX6 A;  2M16 A;  2YXY A;  2XI9 A;  2DEU A;  1M30 A;  3M0S A;  2QYZ A;  5GAN j;  3C94 A;  2SRC A;  3C95 A;  1BIB A;  1BCM A;  5KYX A;  3I35 A;  4B6M A;  3SWN B;  1VYT A;  2V8J A;  1KIK A;  4M7A E;  2LQ8 A;  1YJ9 A;  2DL7 A;  1B7T A;  1OU9 A;  4PJN A;  2WAC A;  4JDS A;  3ASK A;  1Z9Q A;  3A8M B;  3CC4 Q;  5LJ3 j;  1SHG A;  1M2V B;  1M5Q 1;  2CP5 A;  1ZSZ C;  3OA6 A;  4ORZ A;  2L2P A;  4PLL A;  2C0T A;  2JTE A;  1VQL Q;  1OV3 A;  1SSF A;  4O5V A;  5FWC A;  2P0P A;  1IB8 A;  2DD5 A;  1VQ9 T;  5KE3 A;  2E70 A;  3EG0 A;  5GAO m;  1GCQ C;  2KNB B;  1M1F A;  4C92 C;  2RK1 A;  2OAU A;  3OB9 A;  1JRI A;  4OML A;  1VQ7 A;  1TS9 A;  2OX7 A;  4E7K A;  1UB4 A;  4ESR A;  1YFN A;  1RAC B;  4BY6 C;  2ROL A;  5DY9 A;  2VAS A;  2K4Y A;  3NHN A;  4J8O A;  5LJ5 g;  5KH6 A;  3OYH A;  4Y28 E;  4OP0 A;  2J6K A;  1S1N A;  1ARK A;  3INZ A;  4HCZ A;  2D8H A;  3L2R A;  4MZT A;  2PUO B;  5GAN 2;  1WZO A;  1OX9 A;  1XJW B;  3CMA Q;  3JCM V;  4E7S A;  2QQ9 A;  2NUP B;  2MWP A;  4AG1 C;  1T3L A;  3FLG A;  3WXM B;  4J9F A;  4RG2 A;  2EYW A;  1QP2 A;  4RCC A;  1VQ8 T;  2CZ6 B;  1VQO Q;  4R0K A;  3CCM T;  4GLK A;  2X35 A;  4J6Y A;  1GCP A;  3VUZ A;  3CC2 T;  3G7Z A;  4LXC A;  2GQV A;  3FJP A;  1WX6 A;  2JJ9 A;  1VQ9 A;  4PJJ A;  5GJV B;  3EGX B;  1WJQ A;  4E6R A;  2GCX A;  2ZAE A;  4IKF A;  3RKX A;  4EMK B;  3LLR A;  5LJ5 h;  4M77 A;  4M78 D;  2EYQ A;  3LX7 A;  5CKB A;  1M1K U;  2ZPI B;  4QT7 A;  4J9G A;  4C0F A;  3UDC A;  1YIT A;  1I4K 1;  3HRS A;  2K3B A;  2AIR B;  4QQ6 A;  3M55 A;  3PFS A;  2K3Y A;  3PT9 A;  1I5L A;  1AZG B;  4BDY A;  1NPP A;  4PJO A;  1GBQ A;  1PSE A;  2CT4 A;  4FYX B;  2GFU A;  2DFU A;  2DVE A;  3EHQ A;  5CO7 A;  2AT1 B;  1QCO A;  5GMK l;  1Q7Y U;  1RAD B;  4Y92 A;  3LWH A;  4M7D A;  1RAA B;  4C92 B;  1LOJ A;  4FCY A;  3CC2 A;  2FPE A;  1Q82 R;  2YRC A;  3QXE B;  4KT0 E;  2QI2 A;  1MUZ A;  3L1A A;  2COW A;  2K57 A;  4B9X A;  1AHJ B;  3GBQ A;  2D1X A;  1ZUY A;  4A54 A;  3JCM P;  4JRK A;  2ZPH B;  4ELY C;  3I9Q A;  1W4S A;  1PRL C;  4N4I A;  2K79 A;  2JM9 A;  4M77 G;  1VQ4 Q;  2XDB A;  4PJO F;  3JB9 G;  4M75 B;  2LQW A;  2DET A;  2CP7 A;  1YJW T;  1JBM A;  2QAZ A;  5GMK m;  4JJN K;  4PJO G;  1WXU A;  2GFA A;  4KRT A;  4A4F A;  1B07 A;  1XQH A;  1RAB B;  3REB B;  4A63 B;  3CPW S;  2JVV A;  3H6Z A;  3CCL A;  2LQK A;  3OMG A;  1ZBJ A;  1Q7Y R;  2K6D A;  1KQS A;  2JT4 A;  1M4Z A;  2LRQ A;  2GTJ A;  4LDV A;  3F70 A;  2QQB A;  2L3S A;  5HY6 A;  1YIJ T;  1OPL A;  2Y90 A;  2V1R A;  1UEC A;  1XNI A;  2M1H A;  2EPD A;  1KQ2 A;  5GAN 3;  5GAN 7;  1KQS S;  2GTO A;  1G3W A;  1VQ8 Q;  2EQK A;  1G2B A;  3RMQ A;  2JTF A;  5GJW B;  2EQJ A;  4ZGJ B;  2ENM A;  1GFC A;  1EIF A;  3G6E Q;  1X6O A;  2DXU A;  2XG8 D;  4C8Q G;  5IHI A;  3I56 T;  1Y96 B;  4JLI A;  4AFZ C;  1VQM Q;  4PK4 A;  1C0M A;  1YI2 Q;  1G3S A;  2KRS A;  2O4X A;  1IGU A;  4DBQ A;  3QZ9 B;  2A0F B;  1Q81 U;  5KCO A;  2RF0 A;  3VS6 A;  4XTX A;  2HL3 A;  3MP8 A;  1YN8 A;  1IGQ A;  1IHV A;  4MDX A;  1D3B A;  3OMC A;  1YJW A;  4J5Y A;  2QA4 Q;  1YIJ A;  2YUN A;  1JEG A;  4C8Q F;  3LGL A;  4M75 A;  3FB9 A;  1QVP A;  1ZSZ A;  2LZ6 B;  2B8A A;  4PNO A;  3X26 B;  2F5K A;  3CCU Q;  1W2B P;  3EGD B;  3SFM A;  4RTX A;  2RH2 A;  4FSX A;  2DXB A;  4O6J A;  4DBR A;  4QVC A;  3G4S Q;  3JCM h;  4IUU A;  4Z02 A;  5IT9 E;  2IG0 A;  4F04 B;  1KSW A;  4PLI A;  1UGS B;  5I21 A;  2RQV A;  2HD0 A;  1B34 A;  4RTV A;  2MIO A;  4DEY A;  4J9C A;  3CME Q;  2LNV A;  5I22 A;  2AZS A;  1ZSG A;  2XKO C;  1IZ6 A;  2FB7 A;  3EG9 A;  1B3Q A;  3SHW A;  1YWO A;  3S6W A;  1M3A A;  3I56 A;  4C92 D;  3MJX A;  1QMC A;  4LD9 K;  2EKH A;  2QGF B;  1JJ2 S;  4M7A F;  4F7U G;  1VYU A;  1DJ7 B;  3TSZ A;  2KAF A;  4C0D B;  1K4U S;  2D9T A;  4MZM A;  1BCO A;  4TVR A;  3JCM e;  1M3C A;  5LJ3 e;  2DZ9 A;  1VQ5 Q;  1HD3 A;  1M8M A;  5GAO p;  4ME7 A;  1PKS A;  3X25 B;  2A08 A;  3H41 A;  4E7J A;  1K0X A;  3BDU A;  3E9G A;  3UA7 A;  3HPW A;  4IUQ A;  2C06 A;  5IAY A;  1MNE A;  2RA2 A;  2E12 A;  2MMP A;  4M77 C;  2FYK A;  1BI1 A;  3EH2 A;  1OOT A;  1W2B A;  1WHM A;  2MF2 A;  2XIC A;  2EGC A;  2E10 A;  2M0Y A;  4X1V A;  3HKS A;  1X2K A;  3H0I A;  3CXC P;  1W70 A;  1PG5 B;  2EBP A;  1X43 A;  3BDL A;  3M4Y A;  2RB6 A;  2LCS A;  3MHX A;  1D0X A;  3CPF A;  3OYB A;  3OSV A;  5FW9 A;  2OAW A;  1U8R A;  3JB9 H;  1BIA A;  1D0Y A;  1Y7X A;  4M78 E;  3M0T A;  4Q5W A;  2PUK B;  2DLP A;  3PVQ A;  1U06 A;  2J7I A;  4ELZ C;  2NWM A;  3OS0 A;  1V1C A;  1M1K C;  1NLP C;  1TOV A;  2HQX A;  2R5M A;  3OYD A;  1I07 A;  1WFW A;  3EFO B;  2LVM A;  2HKN A;  3O5Z A;  2MI6 A;  2GBQ A;  1X2Q A;  3LH0 A;  3RKY A;  2K5L A;  2PTK A;  4HXJ A;  3OW2 A;  3NFC A;  4ZN1 A;  2RHU A;  3MEU A;  2YLB A;  2H3E B;  3WVD B;  4QVD A;  4E7H A;  4PFP A;  5GMK e;  3VU3 C;  2O2O A;  3CCJ Q;  1HYO A;  3NGP A;  4EMG A;  1MMN A;  4C8Q A;  1M90 C;  2NLU A;  4HCC A;  3G6E T;  2O88 A;  1VQP Q;  4HT8 A;  1X75 C;  3CC7 Q;  1Q86 U;  2DIL A;  3GOX A;  5GAM d;  4X34 A;  3QWX X;  4LN2 A;  2OTL Q;  2K5F A;  3RNJ A;  1K73 C;  1AWW A;  2ZPE B;  2AZV A;  1VQ5 T;  1MHN A;  1RI9 A;  4Z88 A;  1VQK Q;  1AD5 A;  3CBO A;  4PJO B;  4FU6 A;  3EGD A;  2DIQ A;  3QKJ A;  1ZUU A;  1NYF A;  4M75 D;  1RLP C;  3FIF A;  3VS0 A;  3HTR A;  2AKK A;  2GF7 A;  1VQ7 Q;  5GAO n;  5CKE A;  1BI0 A;  5GAN f;  1GRI A;  5FU7 B;  1X6G A;  3NMZ C;  4PL6 A;  3L42 A;  1I81 A;  4CC7 A;  1Q82 C;  1K9M U;  2V1Q A;  2DX1 A;  2RJC A;  1QVF A;  4XAX B;  2QTX A;  2JZ2 A;  1N8R C;  3L2Z A;  1WPY A;  2FVU A;  5FU7 C;  3EGU A;  3M5A A;  2XID A;  1K8A R;  4IIM A;  2DBM A;  1FMK A;  3DLM A;  4RTU A;  3PIP A;  5GAN 5;  2M9U A;  4RTW A;  4FYY B;  3PTA A;  2DL4 A;  3L2W A;  1NJI R;  2L3R A;  3OYY A;  4F16 A;  2ED1 A;  2LQN A;  7AT1 B;  4M78 G;  5HCK A;  1H3H A;  1V76 A;  3I55 T;  4OB2 B;  5CAI A;  2KEA A;  3P8B B;  2BKD N;  1PD1 A;  3EG2 A;  3GP8 A;  3OSS C;  3R6N A;  1WHG A;  4QQD A;  3LW5 E;  4FL6 A;  2GQI A;  4RKU E;  1OEB A;  3SWN C;  1VUB A;  1D1A A;  1OU8 A;  2KBT A;  2KYB A;  3VYH B;  1S72 Q;  4OB1 B;  2RNA A;  1FWZ A;  1ABQ A;  5LL6 S;  4M7A B;  5KYY A;  2HSP A;  1PM3 A;  1G3Y A;  1WXB A;  3ME9 A;  3LWI A;  5AT1 B;  4HCK A;  1UDL A;  1K8A C;  2XDP A;  1FYN A;  3FRN A;  2A37 A;  2QGG A;  5I11 A;  2RQU A;  1K9M C;  1VQ4 T;  4XU1 A;  1N8R R;  2ZPB B;  2E64 A;  4PJL A;  2W10 A;  2HBP A;  3A98 A;  1S72 T;  2A7Y A;  2J6O A;  3MP1 A;  2EYY A;  5C0M A;  2JW4 A;  5LJ3 h;  1KJW A;  4XU3 A;  3UA6 A;  1QLY A;  1TG0 A;  2VWF A;  4OF1 A;  5KYU A;  1D3B B;  3R6O A;  1CSK A;  2OTL T;  3CCE T;  4RTT A;  2VV5 A;  3VS3 A;  3OYE A;  4A4E A;  2W0Z A;  1PC0 A;  2EGE A;  1NBE B;  1YJ9 Q;  3OW2 S;  1IXD A;  3JCM c;  4EMK A;  1Q86 R;  5A0L A;  3NTI A;  2P0Q A;  1YI2 T;  3RR6 A;  4FT2 A;  2FPF A;  2E5K A;  1W1F A;  6AT1 B;  2ED0 A;  3LGF A;  4JZ3 A;  4C92 G;  1KHC A;  4FIB A;  4GY5 A;  4DBF A;  1IO6 A;  2P4R A;  3JCM J;  4J7I A;  1H64 1;  4MDW A;  2MYS A;  1QKW A;  3QUI A;  3A8G B;  1AT1 B;  1LPL A;  1X27 A;  2F1L A;  4M77 D;  1RAE B;  4XTU A;  1RI0 A;  2ABL A;  2L5Q A;  4M7A D;  1VQN A;  1KC8 R;  1MMG A;  2FZG B;  2PVD B;  3HFN A;  5HK3 A;  4K11 A;  1WJS A;  4RUG A;  1MMA A;  4ZN3 A;  4M7D B;  3GPL A;  5CKH A;  2KGT A;  3M0Q A;  2RI2 A;  5FRO A;  1BU1 A;  3CPW P;  2D8J A;  1UHC A;  1UEB A;  2F5T X;  2JOY A;  4ATO A;  4MZP A;  2MOX A;  1PKT A;  3P8D A;  4NL2 A;  4JUV A;  1MGQ A;  3KBG A;  1YI2 A;  1I8F A;  4JS4 A;  2CZ0 B;  1NYG A;  5GAO r;  3VV0 A;  1VYV A;  3CCR Q;  1WGS A;  1CKA A;  2LT1 A;  4RCB A;  1OYX A;  1Q95 G;  5GMK i;  1NJI C;  1TUC A;  1LNX A;  4FYV B;  1G83 A;  3VUB A;  4B9W A;  4F7U F;  1YJW Q;  3RIR A;  1VQ6 Q;  2K5I A;  2CRE A;  4WCI A;  2X3W D;  3CCV T;  1W2B S;  2EJF A;  1FX7 A;  1H3Z A;  3KUF A;  1WHL A;  2CP0 A;  4DOV A;  3CCU A;  4JRI A;  2YT6 A;  3PGG A;  2ESW A;  2KYM A;  2LP5 A;  3JCM X;  2VGM A;  3A8O B;  4LDX A;  4QQG A;  4C0D C;  3CCS T;  4JJB A;  4N0A A;  2WSE E;  3ULR B;  3CBP A;  1MMD A;  3EFO A;  3MKD A;  3SDZ A;  3QJY A;  1WQW A;  1RUW A;  3M58 A;  1M3B A;  2FRY A;  5GAN h;  2K2M A;  3X28 B;  4EDU A;  2LTO A;  1HSQ A;  2XHC A;  2L8D A;  1YIT T;  1QCF A;  2EW3 A;  4MMK A;  3CC2 Q;  1SPK A;  5GAN g;  5IXB A;  1RLQ C;  4BE0 A;  4C8Q E;  2K7A A;  3LYI A;  4N4H A;  4EPC A;  3GIB A;  2H8H A;  2P4T A;  4DBH A;  2RHX A;  1YJ9 T;  2J6F A;  1QWF A;  4D6W A;  4ANJ A;  4Z8A A;  1WJR A;  4CC3 A;  5HKC A;  3JCM f;  3C4S A;  5GAM e;  1K8A U;  1E7O A;  1R0B G;  3TVT A;  5DLQ E;  1VQ4 A;  1PCX A;  2CUD A;  4EMK C;  2LCL A;  3M4G A;  1FXX A;  1SSH A;  3S3O A;  2ROT A;  2DO3 A;  3CXC S;  3OYN A;  2ZPF B;  3CCL Q;  4M78 A;  1WQ7 A;  2YLC A;  2EAY A;  3CCR T;  3CCE Q;  3V8J A;  2XD0 A;  1N9S A;  1YNZ A;  2Y4Y A;  2FL7 A;  2F2V A;  1OQK A;  3M56 A;  5CKF A;  4GLM A;  2XK0 A;  1NLO C;  1IRE B;  1RAG B;  3URG A;  1TU0 B;  2G6F X;  3E19 A;  4DQ2 A;  2YSQ A;  3BFM A;  1HK9 A;  3VS1 A;  2FZK B;  1UG1 A;  1GCQ A;  2G3R A;  1RAH B;  5FLX E;  4GBQ A;  1NM7 A;  4OB0 B;  2AK5 A;  2EQU A;  1ZUK A;  3CCM Q;  2CH4 W;  3RER A;  1U1S A;  2P0K A;  4NOY A;  1Q86 C;  5LJ5 f;  4ZGE B;  3TCJ A;  1YJN A;  4M75 F;  4CRI A;  3DB3 A;  1XTD A;  5KE2 A;  3L2Q A;  3G71 Q;  2LJ1 A;  4F14 A;  2CS7 A;  3UWN A;  2FG0 A;  4DEX A;  3OYL A;  2DYI A;  4BB7 A;  1AVZ C;  3DKM A;  4JJC A;  2PVG B;  1X6B A;  3JB9 J;  3MEV A;  4J9D A;  4HVW A;  4OMP A;  4MML A;  2QA4 A;  2DPP B;  2E4H A;  2RK2 A;  5CKD A;  3CC7 A;  1G5V A;  2X4W A;  1KK7 A;  3RKW A;  4KUD K;  4C8Q D;  4M7D C;  5EC7 A;  2A28 A;  2RHI A;  3CCS Q;  1HXD A;  2DTI A;  3HL8 A;  1YP5 A;  2KRM A;  2QAS A;  3EGX A;  3GF5 A;  4M78 B;  3M9Q A;  2FO0 A;  2OTJ T;  3CME T;  5FWB A;  2JS2 A;  2BZX A;  4J6W A;  3X20 B;  1E6H A;  3DLL A;  3SB2 A;  4OMN A;  1M27 C;  2EYZ A;  4HCB A;  1K76 A;  1UHF A;  3V8L A;  4F17 A;  4RTZ A;  4JZ4 A;  2FRW A;  3PNW C;  4AMC A;  3TRE A;  3P8H A;  2RMO A;  2ZGW A;  1U1T A;  4FM4 B;  1UGP B;  2NUT A;  3JCM b;  3FEO A;  3I5R A;  2VB6 A;  5LJ3 g;  5GAN 4;  3I56 Q;  4PFO A;  2R5A A;  1M90 U;  1G3T A;  1MV3 A;  2DRM A;  2LNH B;  3TU4 K;  2QA4 T;  3ZL7 C;  2WSF E;  3Q1J A;  4FW2 A;  1VQ5 A;  4OMQ A;  1I1J A;  2AHJ B;  3CCQ T;  1X69 A;  2MK5 A;  1UFF A;  1NEG A;  5GAM g;  1OZ2 A;  2VGN A;  4D8D A;  2BTT A;  3PE0 A;  4C0G A;  4M77 F;  2LJ3 A;  1Y0M A;  1X01 A;  2KK4 A;  5IHN A;  3UPU A;  5KCH A;  3NTH A;  4X9D A;  2DAQ A;  2ECZ A;  2O31 A;  4L6V 5;  4JRQ A;  1ACM B;  3JRZ A;  1WXT A;  4CC4 B;  4A53 A;  1VQP T;  3S3N A;  4BD3 A;  3UF4 A;  2FEI A;  4A4G A;  5CK9 A;  1QCN A;  4QVZ A;  1ZQ1 A;  2DXC A;  2XMF A;  2CP3 A;  5DM7 R;  1T0H A;  3EAE A;  1BKB A;  3C0C A;  2LDM A;  1D09 B;  2DMO A;  2LX9 A;  5GMK j;  5CR2 A;  2KT8 A;  2JM8 A;  4LE9 A;  3CCQ Q;  2K9G A;  5HK0 A;  4XTZ A;  2J06 A;  1H8K A;  3BE3 A;  3QG1 A;  2HDA A;  1V29 B;  1XOV A;  3PIO A;  1RL2 A;  3FJ5 A;  2RHZ A;  1TWB A;  2EQI A;  2YRD A;  1JXM A;  3IQL A;  1IRX A;  2V8I A;  4XTW A;  2O4X B;  3MEW A;  2IVW A;  3JCM g;  3PMT A;  3CCJ A;  4V2S A;  1ZBX A;  3L2V A;  1CKB A;  5GAN 6;  1M8V A;  2LCC A;  2C0I A;  2HQH A;  3CD6 T;  4M4Z A;  5KYW A;  3U23 A;  4AG2 C;  1Q7Y C;  4EIK A;  3M59 A;  1M2O A;  1UGR B;  1VQP A;  2I2L A;  3OS1 A;  3G4S T;  4KGV B;  2DE0 X;  4L59 A;  2OTJ Q;  2L0A A;  4OVA A;  3EFR A;  2K3X A;  5CQX A;  3OS5 A;  1BI3 A;  3E9F A;  3C12 A;  4PJO E;  1VQ6 T;  1O75 A;  2RQT A;  5FU6 B;  3QYH B;  3RUX A;  4E47 A;  3OYM A;  2LMJ A;  1R77 A;  1PRM C;  2DK3 A;  4E2F B;  3MET A;  2CH4 A;  3CQT A;  5IXF A;  2X51 A;  1WI7 A;  1R8O B;  4PJO D;  2KRN A;  2BZ8 A;  3N5B B;  1K73 R;  4CI0 C;  1SF9 A;  2PU9 B;  4M75 E;  1VQN Q;  1VA7 A;  3OY9 A;  1LJO A;  2IPO B;  2NUP A;  5M9O A;  3CD6 Q;  1TUG B;  2M51 A;  4M7A C;  1WHK A;  2JMA A;  1WA7 A;  2HCK A;  2CKK A;  5GAM j;  3LH5 A;  1H92 A;  1WHH A;  2L89 A;  3G1J A;  3EFS A;  2EJG A;  3REA B;  4A4H A;  1W6X A;  3QHS A;  2MAM A;  3QSU A;  2EWN A;  2R58 A;  1FMW A;  3NPF A;  2GNC A;  5LJ5 e;  3MPU B;  1AWJ A;  2OI3 A;  4E7L A;  3J81 E;  4ZGD B;  4QW2 A;  4M78 F;  2HMA A;  3JCM d;  2QEX Q;  2JN0 A;  4Y91 A;  3VS5 A;  4LUD A;  1VQ6 A;  4D8K A;  4J7F A;  1Y71 A;  2DRK A;  2IIM A;  4F7U B;  2QDL A;  4BY6 B;  2NUZ A;  4LUE A;  2M0O A;  4A4K A;  2KE9 A;  4NL3 A;  3L2U A;  2OJ2 A;  3J80 E;  1NPR A;  5LJ5 j;  3M0P A;  4KGZ B;  2CDT A;  4XU2 A;  4EMH A;  3VKI A;  2DTO A;  4XTY A;  5LJ3 f;  2DYB A;  3OYC A;  4R56 A;  1AOJ A;  1T3S A;  2FHD A;  4CC2 A;  4QKU A;  1QVG P;  4J83 A;  4PFZ A;  3H0F A;  2DER A;  3M0R A;  1VQK T;  3SWN A;  5KYN A;  1N27 A;  2EKO A;  2RI5 A;  4LDW A;  1K9M R;  1QW1 A;  1JU5 C;  3E2U A;  3OYA A;  5FRM A;  4XQ3 A;  1NEB A;  3D7S B;  2VUB A;  1D1C A;  2FZC B;  4M7D E;  2DA9 A;  3CCU T;  1M2V A;  9ATC B;  3JAM E;  1UGQ B;  3GLX A;  1KD1 U;  5FU6 C;  2EIF A;  4VUB A;  1KQS P;  3H9N A;  4XU0 A;  3QDF A;  1Q81 C;  1VQ7 T;  1WDX A;  3EG3 A;  4E7I A;  4BE1 A;  2KMT A;  3KXT A;  2X9H A;  4LD6 A;  5D7U A;  1TTH B;  1VIF A;  4F7U E;  4C0Z A;  3VYG A;  2H3J A;  3CMA T;  3CPW A;  4FW1 A;  4OMF B;  3CCL T;  3CCE A;  2ATC B;  2ZZD A;  3JB9 I;  2BZY A;  3M54 A;  4KUI A;  5GAO l;  1E6G A;  1J3T A;  2RQW A;  4M77 E;  2Z0W A;  3TQ7 P;  2YRV A;  1UJY A;  3QII A;  1TH7 A;  3GNG A;  1N8R U;  4R55 A;  3I55 Q;  1AZE A;  3S3M A;  2AKL A;  2QEX T;  3I5S A;  4IUV A;  2E41 A;  2DKG A;  3CEY A;  1GL5 A;  1WNL A;  2Y4X A;  2I0N A;  2RJF A;  3CCM A;  4C5H A;  2F2X A;  1YHQ T;  5I2M A;  2KSS A;  1SG5 A;  5IHK A;  3NTK A;  3V7R A;  1WIE A;  2LJ0 A;  2L3P A;  2RI3 A;  3HP9 A;  5L23 A;  5GAM h;  2ZCF B;  3G71 A;  3M0U A;  4M75 G;  3CCR A;  3THK A;  1O9S A;  4XTV A;  1AWO A;  3ER0 A;  3JB9 F;  3TEE A;  2MPX C;  1WHJ A;  2DZC A;  4KH1 B;  1M9S A;  2DXT A;  2VC8 A;  3JCM W;  2PQW A;  4OGE A;  1VOM A;  1UUE A;  3A5Z B;  2DL5 A;  2KXD A;  4FT4 A;  1VQL T;  5KYX B;  1QVF S;  1RAF B;  1N9R A;  2RJE A;  1IHW A;  1VIE A;  3PMI A;  1YIT Q;  3EG1 A;  4E7Z A;  3CCV Q;  1Q82 U;  1HJD A;  5CCA A;  3CC4 T;  4HA8 A;  1QP3 A;  4ZNX A;  5GAN e;  4BI4 A;  4P5N A;  3OYG A;  3CXC A;  2A3L A;  1TXQ A;  4OB3 B;  4IUR A;  1G8X A;  4C92 F;  1YHQ A;  3VJP A;  3JCM Q;  2HBW A;  3VS2 A;  4BUG A;  3CC7 T;  1I0C A;  4OMM A;  5EG2 A;  3SEM A;  5KYY B;  4M7A A;  2DL3 A;  4C5E A;  2D0Q B;  5LJ5 d;  5GAN 8;  3G71 T;  1RAI B;  1BI2 A;  1K9A A;  1Q81 R;  4PJO C;  1M1K R;  1JJ2 P;  2DEQ A;  1SKU B;  4Z89 A;  3CBM A;  2X4Y A;  3QYG B;  5J39 A;  5CVI A;  5J26 A;  5ECA A;  2C0O A;  2VYT A;  3RES A;  4ZTF A;  4UC4 A;  4C5I A;  5IH2 A;  1BK2 A;  1PSF A;  2CZ7 B;  1PD0 A;  1EFN A;  1M1G A;  1QVG A;  2GGR A;  3KFV A;  3CC4 A;  2LT4 A;  1K1Z A;  1NG2 A;  2F69 A;  4JS5 A;  1Z9Z A; 
#chains in the Genus database with same CATH homology
 3EG0 A;  3ZL7 C;  1GCQ C;  1GRI A;  2KNB B;  1X6G A;  3NMZ C;  4CC7 A;  2V1Q A;  2DX1 A;  1I1J A;  4OMQ A;  4OML A;  1U3O A;  1X69 A;  1UFF A;  2JS0 A;  2YUO A;  1NEG A;  4D8D A;  2BTT A;  3PE0 A;  4ESR A;  3EGU A;  4JJD A;  1N5Z A;  2ROL A;  2LJ3 A;  1Y0M A;  3NHN A;  4IIM A;  2DBM A;  5IHN A;  1FMK A;  2JMC A;  4RTU A;  1UJ0 A;  2J6K A;  1S1N A;  2CT3 A;  2F2W A;  4RTW A;  1ARK A;  2ECZ A;  2D8H A;  2DL4 A;  2O31 A;  4F16 A;  2ED1 A;  2LQN A;  5HCK A;  1H3H A;  1WXT A;  2RQR A;  2A36 A;  2KXC A;  4AG1 C;  4CC4 B;  4LNP A;  1T3L A;  2KEA A;  4J9F A;  3UF4 A;  2FEI A;  2EYW A;  3EG2 A;  3R6N A;  4R0K A;  1GCP A;  2XMF A;  1T0H A;  3C0C A;  2GQI A;  1OEB A;  2DMO A;  1UTI A;  2KBT A;  1WX6 A;  5FWC A;  2KYB A;  5GJV B;  2KT8 A;  4E6R A;  2JM8 A;  4LE9 A;  1PHT A;  2RNA A;  2K9G A;  1ABQ A;  2J06 A;  1H8K A;  3H0H A;  2HDA A;  2HSP A;  1XOV A;  1WXB A;  2L3Q A;  3FJ5 A;  2EQI A;  4J9G A;  4QT7 A;  1JXM A;  3IQL A;  2K3B A;  4HCK A;  4AFS C;  1UDL A;  1FYN A;  2A37 A;  5I11 A;  2RQU A;  4FSS A;  1AZG B;  1CKB A;  1GBQ A;  2C0I A;  2CT4 A;  2W10 A;  3A98 A;  2J6O A;  4M4Z A;  2EYY A;  4HVV A;  2JW4 A;  3EHQ A;  1KJW A;  3U23 A;  4AG2 C;  4EIK A;  2X3X D;  3UA6 A;  1QLY A;  1TG0 A;  2VWF A;  4Y92 A;  3PVL A;  2DE0 X;  1OPK A;  2L0A A;  2RN8 A;  1CSK A;  2FPE A;  4RTT A;  1ZLM A;  1A0N B;  2CSI A;  2RQT A;  3VS3 A;  2W0Z A;  2LMJ A;  2EGE A;  1MUZ A;  1PRM C;  1JO8 A;  2FPD A;  4AFU C;  2DNU A;  2JXB A;  2KR3 A;  2CH4 A;  2D1X A;  3GBQ A;  1ZUY A;  3CQT A;  2FPF A;  4J9E A;  5IXF A;  2E5K A;  3I9Q A;  1W1F A;  1PRL C;  1WI7 A;  2RPN A;  2ED0 A;  2K79 A;  2KRN A;  2BZ8 A;  1JQQ A;  2JM9 A;  4JZ3 A;  1IO6 A;  2P4R A;  2LQW A;  4J9B A;  4OMO A;  1QKW A;  1VA7 A;  1WXU A;  4KRT A;  1X27 A;  1B07 A;  3REB B;  4A63 B;  2B86 A;  2M51 A;  1PWT A;  2ABL A;  2JMA A;  1WA7 A;  2HCK A;  1ZBJ A;  3LH5 A;  1H92 A;  2K6D A;  4AFQ C;  3VRZ A;  2JT4 A;  3REA B;  3JV3 A;  2GTJ A;  1W6X A;  2YDL A;  2L3S A;  4K11 A;  1OPL A;  4RUG A;  2V1R A;  1UEC A;  2YUQ A;  2EPD A;  3NPF A;  2GNC A;  2KGT A;  2GTO A;  3M0Q A;  1AWJ A;  2OI3 A;  1JXO A;  2DF6 A;  1BU1 A;  2D8J A;  1UHC A;  4IIO A;  3VS7 A;  1G2B A;  2MOX A;  1PKT A;  2LX7 A;  2VKN A;  5GJW B;  2ENM A;  1GFC A;  3VS5 A;  4LUD A;  2KRO A;  1NYG A;  5IHI A;  4D8K A;  1VYV A;  1WYX A;  2DBK A;  2DL8 A;  1TUD A;  4AFZ C;  1CKA A;  2DM1 A;  2DRK A;  2IIM A;  3EHR A;  3VS4 A;  2QDL A;  2NUZ A;  4LUE A;  1TUC A;  1G83 A;  2KRS A;  1UE9 A;  2KE9 A;  4HVU A;  4WCI A;  2CRE A;  2OJ2 A;  2X3W D;  2RF0 A;  3VS6 A;  1K0S A;  1YN8 A;  3M0P A;  2CDT A;  3RBB B;  2PNI A;  2YUN A;  1JEG A;  2YT6 A;  2ESW A;  2KYM A;  2LP5 A;  2DYB A;  2LZ6 B;  1AOJ A;  1T3S A;  4CC2 A;  2MCN A;  4JJB A;  3ULR B;  1YCS B;  2YUP A;  1Y57 A;  4RTX A;  3H0F A;  1RUW A;  1LCK A;  1M3B A;  3M0R A;  2FRY A;  1BB9 A;  2K2M A;  1HSQ A;  1KSW A;  2EYX A;  1JU5 C;  2RQV A;  1QCF A;  2EW3 A;  1NEB A;  4RTV A;  2MIO A;  1SPK A;  5IXB A;  4DEY A;  1RLQ C;  2DA9 A;  1QKX A;  4J9C A;  4RTY A;  2K7A A;  1U5S A;  2H8H A;  5I22 A;  2AZS A;  1ZSG A;  1AWX A;  2DVJ A;  1WDX A;  3EG3 A;  1GFD A;  2J6F A;  1B3Q A;  1ABO A;  2CSQ A;  1QWF A;  3SHW A;  1YWO A;  1M3A A;  4Z8A A;  4CC3 A;  2EKH A;  1E7O A;  3TVT A;  2EVR A;  1VYU A;  4J9I A;  3TSZ A;  3QWY A;  2CUD A;  1K4U S;  1BBZ A;  1M3C A;  2BZY A;  1SSH A;  1HD3 A;  1M8M A;  1E6G A;  1SRL A;  2ROT A;  1J3T A;  1PKS A;  2RQW A;  2A08 A;  3H41 A;  1K0X A;  3UA7 A;  2J05 A;  4JPB W;  1T0J A;  1UJY A;  1YNZ A;  1AEY A;  2F2V A;  1AZE A;  1WLP B;  4GLM A;  2AKL A;  1OOT A;  3I5S A;  1NLO C;  2HEQ A;  2EGC A;  2M0Y A;  4X1V A;  3TSW A;  2G6F X;  3VRY A;  1X2K A;  1YWP A;  3H0I A;  1GBR A;  1W70 A;  1GL5 A;  2YSQ A;  2I0N A;  4J9H A;  2EBP A;  2F2X A;  1X43 A;  3VS1 A;  5IHK A;  1UG1 A;  2LCS A;  1GCQ A;  2O9V A;  1WIE A;  2LJ0 A;  2L3P A;  5FW9 A;  2OAW A;  2D0N A;  4GBQ A;  1NM7 A;  2AK5 A;  3M0T A;  1ZUK A;  5L23 A;  2CH4 W;  2DLP A;  3PVQ A;  1U06 A;  3M0U A;  2J7I A;  3THK A;  2NWM A;  1V1C A;  1AWO A;  1NLP C;  1I07 A;  1WFW A;  1PNJ A;  3O5Z A;  3UAT A;  2GBQ A;  1SRM A;  2DJQ A;  1X2Q A;  1UUE A;  2PTK A;  4HXJ A;  2DL5 A;  2LJ1 A;  4F14 A;  2KXD A;  2FG0 A;  1SHF A;  4DEX A;  3EG1 A;  1AVZ C;  2CUB A;  1HJD A;  4JJC A;  1X6B A;  2PZ1 A;  4J9D A;  4HVW A;  4ZNX A;  4OMP A;  1KFZ A;  2KT1 A;  2O2O A;  3NGP A;  1UGV A;  5EC7 A;  1QWE A;  1MV0 B;  2A28 A;  2O9S A;  2EGA A;  2O88 A;  1YP5 A;  2SEM A;  2VVK A;  2KRM A;  1SEM A;  2HBW A;  1ZX6 A;  3VS2 A;  2DIL A;  2FO0 A;  5FWB A;  2JS2 A;  2BZX A;  1I0C A;  4OMM A;  3QWX X;  1M30 A;  3M0S A;  1E6H A;  4LN2 A;  3SEM A;  2DL3 A;  2SRC A;  3RNJ A;  4OMN A;  1AWW A;  1M27 C;  3I35 A;  1K9A A;  2AZV A;  2EYZ A;  1K76 A;  1VYT A;  1KIK A;  1UHF A;  4Z89 A;  2DL7 A;  4F17 A;  1RI9 A;  4RTZ A;  4Z88 A;  5ECA A;  2C0O A;  2FRW A;  4JZ4 A;  2RMO A;  1AD5 A;  1Z9Q A;  1SHG A;  1ZUU A;  5IH2 A;  1BK2 A;  1NYF A;  3I5R A;  4ORZ A;  2L2P A;  1RLP C;  2C0T A;  1EFN A;  2JTE A;  3VS0 A;  1MV3 A;  2DRM A;  2GGR A;  2LNH B;  3KFV A;  1OV3 A;  2AKK A;  1K1Z A;  1NG2 A;  1Z9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...