2ROLA

Structural basis of pxxdy motif recognition in sh3 binding
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
b'GSMGTAGKWVLCNYDFQARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor kinase substrate 8-like pro
publication title Structural basis of PxxDY motif recognition in SH3 binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/signaling protein
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rolA00
1WIEA 1TUDA 2A36A 2J05A 1NYGA 2EYXA 1NYFA 2GNCA 2PZ1A 3QWYA 2JM9A 3PVLA 2LQNA 4K11A 2L0AA 1UG1A 1Z9ZA 2HCKA 2JMCA 3VRYA 3VS7A 2YUOA 1KIKA 2A37A 2RQTA 1QWFA 1WXUA 2CUBA 2FPFA 1X69A 1AVZC 1SHGA 1MV3A 3CQTA 2CH4A 1ABQA 1MUZA 1I1JA 2KT1A 2PNIA 2I0NA 1SSHA 1WLPB 1B3QA 3JV3A 1H8KA 2CUDA 1PKSA 1NM7A 1LCKA 1WDXA 4EIKA 2DM1A 2KRSA 1HSQA 3ULRB 1U3OA 3QWXX 3VRZA 2IIMA 1VYVA 2KNBB 3NHNA 4AG1C 2KBTA 2LNHB 4F17A 4DEXA 3VS5A 1QWEA 2PTKA 2MCNA 2ROLA 3UA6A 2KT8A 1BBZA 1ZUKA 3REBB 1AWXA 1PHTA 2EYWA 2KROA 4KRTA 2DL4A 1ZBJA 4OMOA 1M8MA 1KSWA 1PKTA 2EQIA 3TSZA 4JJCA 1GRIA 2O31A 2ROTA 3EG3A 3O5ZA 1EFNA 2ESWA 1JEGA 2FG0A 2KR3A 3A98A 2B86A 1OPLA 1MV0B 2BZXA 2AZVA 1KFZA 2OI3A 1YWPA 5IXFA 2KRNA 4J9CA 1JO8A 2J6OA 2CREA 2YDLA 3M0UA 1NEGA 2GGRA 1GBQA 1AD5A 1GBRA 2DL8A 2K9GA 5FWCA 2DL3A 2EGEA 2MIOA 2DL7A 2D0NA 4E6RA 4LN2A 1AZEA 3M0PA 2D8JA 2JMAA 4AG2C 2V1QA 4J9EA 1J3TA 1CKAA 1JXMA 3EG1A 1ZLMA 1JXOA 1M30A 1OPKA 1ARKA 2YUNA 1T0HA 1U5SA 4Z89A 1WI7A 1S1NA 1YCSB 1VYTA 2RNAA 1X2QA 2DILA 5ECAA 4AFZC 2K3BA 2K79A 3TVTA 3RBBB 4OMPA 4J9IA 1RI9A 3H0FA 2KXCA 4IIOA 4JPBW 1CKBA 2DE0X 1PRLC 2FRYA 1M3AA 1K0SA 1I07A 1FMKA 4LNPA 2LJ0A 2HDAA 2JS2A 3EG0A 3PVQA 2DRKA 4OMNA 1QCFA 2J06A 2FPDA 2J7IA 1AOJA 4GBQA 4HVUA 1VYUA 2CSQA 1W1FA 1BK2A 2LX7A 2HBWA 1OV3A 1V1CA 2X3WD 4J9DA 3RNJA 4AFUC 1UDLA 2O2OA 1H92A 1T3SA 1PWTA 5EC7A 2AZSA 4F14A 1K4US 1K0XA 3VS4A 2W10A 2SEMA 3IQLA 4A63B 2CSIA 1NEBA 1ZUYA 2F2VA 5I11A 2O88A 2YUQA 1QKXA 1E6HA 1U06A 5IHKA 4R0KA 3H41A 2BTTA 1WA7A 2KE9A 2OJ2A 2BZYA 2RQWA 1XOVA 1UTIA 1AWJA 4WCIA 4GLMA 1GCQA 1X27A 2KXDA 4ORZA 2A28A 1NLPC 2ABLA 2EVRA 1GFDA 2C0IA 2CT4A 2KGTA 2DVJA 2L2PA 2K7AA 2RMOA 2O9SA 3EHRA 1I0CA 4AFSC 1QLYA 5GJWB 1E6GA 4Z88A 2LJ3A 3NMZC 5HCKA 2EKHA 4DEYA 2JW4A 2JXBA 3I9QA 2ED1A 5GJVB 3I5RA 1T3LA 2JS0A 1UJYA 2CDTA 2GBQA 1W6XA 4JZ3A 3VS0A 2RN8A 3I5SA 2L3PA 3EHQA 1HD3A 1GCPA 1RUWA 1TUCA 2W0ZA 4ESRA 2SRCA 2C0OA 2KRMA 1WXBA 4RTTA 5IXBA 3SEMA 1UFFA 1T0JA 3VS3A 3VS6A 1AEYA 4IIMA 2VWFA 2YT6A 2DJQA 1VA7A 1YP5A 2DL5A 1CSKA 2F2WA 2DLPA 4LUDA 1BB9A 1K1ZA 2QDLA 1TG0A 1ABOA 1M3CA 1H3HA 4QT7A 3I35A 4ZNXA 2LCSA 3H0IA 1WXTA 3LH5A 3EG2A 2M0YA 2MOXA 3UATA 2CH4W 1SEMA 4RTYA 2KYBA 1SHFA 1K9AA 2LQWA 5IHIA 2G6FX 4RTWA 2O9VA 2K6DA 4LUEA 2V1RA 1JQQA 2BZ8A 4J9GA 2M51A 3EGUA 2C0TA 1YWOA 5FWBA 2F2XA 1UUEA 2D1XA 3UA7A 5L23A 2E5KA 2OAWA 2NUZA 2HSPA 3TSWA 4J9HA 2LP5A 1AZGB 4HVVA 2FPEA 4JZ4A 1GL5A 1UE9A 3SHWA 5IHNA 1NG2A 2D8HA 2DRMA 2K2MA 5I22A 3VS2A 1OOTA 3GBQA 1YNZA 2DBKA 2KEAA 3H0HA 2VVKA 1AWWA 2ED0A 2DNUA 2GTJA 2FO0A 2L3SA 1ZUUA 2RQUA 1Z9QA 4D8DA 4J9FA 4RTVA 3R6NA 2FEIA 4Z8AA 3UF4A 1FYNA 1G83A 2CT3A 2AKKA 1GCQC 1RLPC 1UECA 4HVWA 1Y0MA 1X6GA 2DA9A 2EYYA 1WYXA 1UHFA 1B07A 2H8HA 4AFQC 1M3BA 1RLQC 1M27C 1UHCA 2XMFA 4RUGA 3VS1A 3ZL7C 2LZ6B 3C0CA 2LJ1A 1G2BA 2J6KA 4HCKA 4F16A 1GFCA 3U23A 1JU5C 2X3XD 3M0RA 4OMQA 4FSSA 3THKA 2EBPA 4D8KA 1AWOA 2JM8A 1N5ZA 3NPFA 1WX6A 2EYZA 2EW3A 2RPNA 2GQIA 1OEBA 1KJWA 1A0NB 2ECZA 1NLOC 2DYBA 4CC3A 2KYMA 4OMMA 4RTZA 3KFVA 1SRMA 2L3QA 1BU1A 1UGVA 2GTOA 1WFWA 1X6BA 2RF0A 1X43A 2EGAA 1QKWA 1SPKA 4JJBA 2RQVA 1PNJA 1UJ0A 3M0QA 1SRLA 4J9BA 1W70A 3FJ5A 2HEQA 2JTEA 4CC4B 1PRMC 2VKNA 3NGPA 5IH2A 2DBMA 2DF6A 2J6FA 2RQRA 4X1VA 1ZSGA 4LE9A 2ENMA 2AK5A 3M0TA 1K76A 2FRWA 1Y57A 2AKLA 2DMOA 1HJDA 2YUPA 3M0SA 4CC7A 4M4ZA 4HXJA 1ZX6A 1E7OA 3PE0A 2EPDA 4Y92A 2DX1A 2YSQA 3REAB 2P4RA 2A08A 4RTXA 2LMJA 4OMLA 4JJDA 1IO6A 1YN8A 5FW9A 2JT4A 1X2KA 4CC2A 4RTUA 2EGCA 2NWMA
chains in the Genus database with same CATH superfamily
1WIEA 4IUVA 2EYXA 1NYFA 2GNCA 2PZ1A 3QSUA 3OS2A 2E3HA 6AT1B 2DXBA 2LCLA 3MEVA 3CCMA 2LQNA 5GANh 1BI0A 2HCKA 2DXTA 2MK5A 3VRYA 2F69A 1Q81C 2XDPA 3H8ZA 1PD1A 1U1SA 1WJRA 3X26B 1YITA 1KHCA 5FU6C 1I1JA 3BE3A 5GAMg 1B3QA 3JV3A 4MZTA 3CPWP 1PKSA 1NM7A 1WDXA 4AMCA 5FU7B 2DM1A 1KK7A 4C0FA 2ZZDA 4M77A 1U8RA 4C92C 1OX8A 3DLMA 2KNBB 3NHNA 3V8KA 2NUTA 4AG1C 1WHLA 3UA6A 1BBZA 3REBB 3L2ZA 5KYUB 4F04B 5KYWA 4M77B 2KROA 1VQ7T 1KC8R 2DL4A 1ZBJA 3HRTA 3PIPA 2ZAEA 2NUTB 4JLGA 1KSWA 1VQPT 2HSEB 2Y90A 4LDYA 2HL5C 2O31A 4D6WA 2ROTA 2Y4YA 1NPPA 1VQ5Q 3I55A 4OB3B 2B86A 4II1A 3M59A 5KYWB 3EFSA 1YJ9Q 2BZXA 3V7SA 2AZVA 3M57A 4ME7A 1YWPA 3OYGA 1JO8A 1VQ4T 4C0DB 1RAGB 3C12A 2CREA 2YDLA 4M7AB 2GGRA 1GBQA 3S3OA 1Q95G 1R77A 4EMKC 5FWCA 3CCST 2A0FB 5I2MA 3RESA 4F7UE 2D0QB 4ZGJB 2D0NA 1Q81R 4C92D 1ZSZC 2V1QA 4J9EA 3QJ6A 1ZLMA 2M1HA 1ARKA 4M7DF 1K8AR 1XNIA 3CBOA 3UDCA 4Z89A 2RI5A 1WI7A 2HBPA 5GAMe 2ZPEB 1S1NA 3CMAQ 1KD1C 3OS5A 5GAOr 1R0CB 5GANf 3LW5E 5GAOl 4OB0B 3D7SB 2EYQA 2K3BA 3TVTA 3FB9A 3RBBB 2KXCA 2E5QA 2G3RA 1K9MC 4PKCC 4ANJA 2DD4A 2JOYA 2DE0X 1K0SA 1I07A 1I4K1 3RDVA 4QW2A 2HDAA 3EG0A 2XU8A 4MMKA 1LPLA 2QQSA 3PVQA 4KULA 1QP2A 2FPDA 3EGXA 4C0ZA 5FRNA 2DIGA 1N9RA 5GAOq 3G4SQ 1YJWA 4M78C 1VQKA 1MMGA 4E7ZA 3M4YA 2HBWA 2QXFA 2X3WD 1WHGA 4AFUC 1H92A 5I2SA 4HA8A 1G8XA 3WXMB 5DLOA 4M77E 2LDMA 1K4US 1VQNT 2W10A 2IPOB 5L8RE 3EGXB 2P84A 2X4WA 3IQLA 1ZA2B 4PFOA 1KQSP 1Y71A 5I11A 2O88A 2VGNA 2PVOB 1U06A 4JS4A 2E70A 1YIJT 1RAFB 2BZYA 2RQWA 4NS5A 2VUBA 3V7RA 2KXDA 1VQ5T 4M7AE 2EVRA 2HZYA 1GFDA 2CT4A 4M77G 1YJ9T 2RMOA 5FU6B 2RB6A 5CR2A 1SF9A 2KDSA 1E6GA 4Z88A 3HFOA 1G3YA 2WACA 3MCAB 2JW4A 5GJVB 2EQJA 2R5AA 3G1JA 2H3EB 3I5RA 4BY6C 1UJYA 4C92B 4M78D 1W6XA 1K9MR 3VS0A 2RN8A 3BFMA 3M5AA 1MGQA 5GAN8 3SB2A 3F70A 1MNEA 4A54A 2QGGA 3VS3A 3H6ZA 3JCMW 1OZ2A 4IIMA 2E12A 3SWNC 2VWFA 2YT6A 2ZCFB 3URGA 2RHUA 3CMAT 1Q86U 1YP5A 2DZCA 5FLXE 2X4JA 4PL6A 3WVDB 3GNFB 2F2WA 5GAOp 2DLPA 2QDLA 3HP9A 4J6WA 2MYSA 1V76A 3PGGA 5LJ3h 3JRZA 3I35A 4ZNXA 1KG1A 2LCSA 3CC4Q 2HKNA 5CKHA 1ZSZA 3EFOA 2CH4W 1K73U 1R8OB 1WJSA 1C6VX 2DIQA 1G3SA 1SHFA 3AT1B 3LGLA 4ZN3A 2G6FX 4EMKB 3CCEQ 3G4ST 1M9SA 2V1RA 1JQQA 2X9HA 4FW1A 4A4HA 3JAME 1VQ9A 4X9DA 3CCJA 1M1FA 1ZSZB 2M51A 2JJ9A 2COWA 3EGUA 1M4ZA 4QVDA 1YJNQ 1UUEA 2D1XA 3NTHA 1NBEB 3Q1JA 3L2VA 5L23A 3PMIA 3HHTB 3FRNA 3ZBDA 2JZ2A 4J9HA 1VQ8A 3CCRA 5CQXA 3LX7A 4J5YA 2DRMA 4LXCA 3VS2A 3GBQA 1IREB 3PMTA 2DNUA 1D3BA 3CC2A 3FIFA 2JUFA 4M78A 1BI2A 2RQUA 4M7DC 2K3YA 3A8MB 4J9FA 4EPCA 3OMCA 3R6NA 2QQAA 3UF4A 4R56A 2QQBA 1FYNA 4XQ3A 4C8QF 2AKKA 2RO0A 5GANd 2D9TA 4C92E 4M75F 2EYYA 4AFQC 2H8HA 1M3BA 1UHCA 1N8RC 3PTAA 1BCOA 3CMET 2B8AA 4OVAA 3ZL7C 4M78B 2RI2A 2X35A 1GFCA 3L42A 1BIBA 2HQXA 4A4KA 2CP0A 3M0RA 4FSSA 4FCYA 2EBPA 2EIFA 5CIUA 1N5ZA 3V7CA 2YRVA 2EYZA 1PM3A 4OMFB 5I21A 4PFPA 1KJWA 3M56A 2CGHA 1NLOC 2WSEE 2DYBA 1VQ9Q 3JB9J 1RL2A 4FT2A 4NOYA 2E10A 1UGVA 5LJ5h 2K4YA 5CQYA 2EFIA 4JJBA 1UJ0A 4M7DD 4GLKA 4J9BA 1W70A 3G71T 1FWZA 3FJ5A 1M2VA 3CC4T 1PRMC 1UGSB 2VKNA 3M4GA 1XJWB 2DF6A 4FM4B 2MF2A 2AKLA 4Q5WA 4E7IA 4RG8A 4BY6B 2Y4XA 3SWNA 1E7OA 2M16A 4E7LA 3CCET 4XTXA 2YSQA 3REAB 2QA4Q 3OYJA 1VQ7A 3DB3A 4FU6A 1EIFA 1OZ3A 4OMLA 1QVGS 1YJNT 3KBGA 1VQPA 3PNWC 5FW9A 3C4SA 3V8JA 2NWMA 2KSSA 3QUIA 4OB1B 2JM9A 5DLQE 3PVLA 4K11A 4OB2B 3L1AA 1SKUB 2JMCA 1WHHA 3R6OA 5GAOn 3VS7A 1O75A 1VQ4A 2A37A 1QWFA 2GQVA 4DA4A 4KGZB 3UPUA 4C0GA 1MV3A 3CQTA 3OYIA 2CKKA 4M78E 1MUZA 3CCSA 2KT1A 2PNIA 2X4XA 1SSHA 1H8KA 1LCKA 1YI2Q 1JJ2S 1HSQA 2QTXA 4MDXA 4RCCA 4GY5A 3HSBA 5A0LA 1VIEA 1I8FA 4M7AC 1Q7YC 1NJIU 1QVPA 2KBTA 5C0MA 1KHIA 4BI3A 1QWEA 4XU0A 4DBRA 2MCNA 4KH1B 2K2VA 2VXFA 4A4EA 1HYOA 4BUGA 2KMTA 2M0OA 4KRTA 2QASA 3P8BB 4B9WA 1MMNA 3SD4A 1N27A 5J26A 3JB9H 5GAN5 3OYBA 2CP6A 5D6YA 3CXCS 5GMKm 1YHQQ 2ZGWA 3EG3A 1EFNA 2ESWA 3LWIA 1JEGA 4M7DB 3CCLT 3MEAA 2RJCA 2QG9B 4N0AC 2KRNA 1IZ6A 1D0ZA 1QCOA 4J9CA 2LT1A 3DKMA 2LQKA 1K73R 2XK0A 1W2BP 2DL8A 2YRCA 4XK8E 2K9GA 1VQ4Q 1UGRB 1VQNA 3NTKA 3HFNA 2EGEA 2DERA 3CC7Q 3VUBA 4E6RA 2D6FA 3S3MA 3OSVA 4R55A 5CKDA 3X25B 4MMLA 1KC8C 1QVGA 4C8QC 1OPKA 4XTYA 3RUXA 2QA4T 4M75C 1T0HA 1U5SA 1YIJA 2L3RA 1LNXA 2F5TX 3ASKA 4N4GA 4J83A 4PJOF 3X28B 1Y7XA 2DILA 5ECAA 3OB9A 4E7SA 1VQ5A 3QDRB 2HD0A 3TQ7P 5GANj 1YJ9A 1WHMA 3FJPA 1CKBA 4B6MA 2FRYA 3FEOA 3RR6A 2JS2A 2L89A 4OMNA 5CCAA 3RMQA 1JJ2A 2K5IA 1IHWA 2DZ9A 1B7TA 5LJ3d 2COYA 1VYUA 1D09B 1H641 2V8IA 3CCQQ 2CSQA 1W1FA 1BK2A 1YI2T 1V1CA 3ER0A 3RNJA 1K8AC 4OP0A 2O2OA 2K3XA 1T3SA 1PWTA 3JCMd 2FZCB 5EC7A 4JRKA 4F14A 5KH6A 4HCZA 4LDXA 5KYUA 3VS4A 2SEMA 3CMAA 3CCUT 4C8QD 5GMKh 1VQNQ 4M75D 2RD1A 5KCHA 1ZUYA 2L8DA 4C5GA 5J3BA 2ZPFB 4M7DE 5IHKA 4BE0A 1M90U 1WA7A 2JN0A 3CXCA 4QVZA 4C5HA 1D1BA 1XOVA 1UTIA 3A1PA 3GNGA 1YHQT 1GCQA 1YIJQ 2BE9B 4M7AA 4JDSA 2DVJA 2R5MA 2L2PA 2ZPGB 3QDFA 2O9SA 4KGXB 1I0CA 3G4SA 5GJWB 1BYMA 2IVWA 1ZQ1A 3NMZC 1M5Q1 4J7IA 5KE2A 4XTWA 4FW2A 2E3IA 2H3JA 1T3LA 2JS0A 5IAYA 2GBQA 4PLIA 1GXIE 1S72T 3CC7T 1TXQA 3NFCA 2W0ZA 1NZ9A 2C0OA 2XICA 1WXBA 2DTHA 5AT1B 5IXBA 1SG5A 1T0JA 2O01E 4P5NA 1AEYA 2PQWA 4E47A 3JCMV 4N0AA 2DL5A 2E6NA 4DBQA 2YLBA 1NPRA 1K1ZA 3C95A 1ABOA 1M1KR 3MP6A 1X01A 4QQGA 3CMEA 3X20B 1WXTA 3LH5A 2M0YA 3CPWS 2E65A 3M55A 3UATA 3OS1A 2YWWA 5LJ5d 4C8QA 2QI2A 1PSFA 4F7UG 4M75A 2KYBA 4ELZC 2LQWA 5IHIA 5HK3A 2RJEA 4RTWA 3JCMb 4IUTA 3CCQT 2LCCA 5M9OA 2BZ8A 3RKXA 4LDVA 4C8QB 2KK4A 1NE8A 2AT1B 4M75B 1HK9A 2L5QA 3GPLA 2OAWA 2LP5A 2QK0A 5HY6A 2FPEA 3CPFA 1NG2A 1N9SA 1R0BG 1RI0A 3G71A 2DBKA 1QMCA 3H0HA 4MZPA 3P8DA 3CC4A 2ED0A 3QBYA 3EAEA 4J6XA 1PSEA 4A4FA 1IGUA 4D8DA 1WGSA 4KUIA 3BY7A 4RTVA 4Z8AA 1G83A 1Y96A 2YXYA 3OY9A 3FDRA 4PJOC 4BACA 2DA9A 1X6GA 1WYXA 1VQOT 1B07A 2XMFA 4C92A 3CCEA 3OW2A 3JB9G 4RUGA 3KXTA 2E4HA 5EG2A 1G2BA 2J6KA 1VIFA 3CMEQ 1YJNA 1JU5C 2X3XD 3O8VA 1TOVA 5GANe 1Y96B 2BE7D 4D8KA 1BI1A 3QYGB 2V8KA 3NPFA 1WX6A 1WPYA 3HTRA 2VV5A 2RPNA 2MMPA 1OEBA 2PVDB 1M8VA 2KYMA 2V8JA 4HCCA 3E2UA 3QHSA 4FSXA 4FYWB 3KFVA 3JCMQ 3T9NA 4M7AG 1WFWA 3QO3A 1X43A 3G7ZA 4CI0C 3A8GB 1PNJA 3CPWA 1SRLA 3GOXA 2VASA 2WSFE 2EWNA 1D0XA 2RK1A 4EMKA 3OYMA 2J6FA 4PJOD 4X1VA 3G71Q 1X75C 2ENMA 2AK5A 3RMSA 4C8QE 1WZOA 3JCMh 4E7JA 4M4ZA 4M75E 3BW1A 2EPDA 3A8LB 2DX1A 2EJ9A 3LWHA 4RTXA 1QVFS 1RAAB 2DPPB 2C06A 1UGPB 3A5ZB 3S3NA 1YN8A 2QAZA 1B34A 2CP7A 2JT4A 2K5FA 4DOWA 5GAN2 2J05A 3QWYA 3JCMc 3CCLA 2BUDA 4J8OA 1WJQA 1UG1A 3OSSC 2YUOA 1KIKA 4M75G 1VQMQ 1B34B 4NL3A 2MPXC 3TEEA 1WXUA 2FHDA 2PUOB 4O6JA 1IB8A 1ABQA 1ZHIA 2I0NA 1WHJA 4MZMA 2CZ1B 2XIDA 2LT4A 4FYYB 2NYSA 2EQMA 1Q82U 1VQ6Q 1OYXA 1U3OA 3VRZA 3MP1A 7AT1B 2QA4A 2P0KA 2IIMA 1VYVA 3EH1A 3LGFA 2LNHB 4DEXA 3VS5A 3UWNA 5GAN6 1PG5B 1FMWA 3ME9A 3INZA 2ZPIB 4Z02A 1U1TA 4BI8B 4OMOA 1M8MA 4PJOA 3NTIA 2EQIA 3TSZA 2QQ9A 3J7AF 4XU1A 3VV0A 2DTOA 2CS7A 4C92G 2QEXQ 4LD9K 5LJ3f 1OPLA 1MV0B 1KFZA 1YI2A 5IXFA 2IG0A 3E9GA 3CCLQ 4PJOB 5LL6S 2XG8D 4XU2A 4PJNA 3JCMf 3M0UA 1UB4A 4X9CA 1GBRA 5GMKi 1LOJA 2DL3A 2KAFA 4KGVB 3DLLA 2DL7A 2XKOC 4PK4A 1OULA 3CCUA 4QVCA 1AZEA 3M0PA 2D8JA 1TUGB 2QTVA 4LDUA 2JMAA 3QXEB 2OTLT 1J3TA 1QVFA 1KQSA 4IUPA 5KCOA 2CP5A 1JXOA 5FRMA 2BKDN 4V2SA 1YCSB 2RNAA 1YHQA 2ZPBB 4BDZA 1PD0A 4BI4A 4OMPA 5CVIA 2WSCE 4J9IA 1RI9A 3H0FA 3QZ9B 2RH2A 4IIOA 4JPBW 1QP3A 3OYKA 1PRLC 1K73C 1M3AA 1I5OB 4LNPA 2LJ0A 1VQMT 1Q81U 1PCXA 3LH0A 3QG1A 2DRKA 1QCFA 5KYYA 3A8OB 2J7IA 1AOJA 1IHVA 1S72A 2DO3A 3CC7A 2JVVA 4GBQA 5CKEA 4HVUA 2R57A 3MHXA 4J9DA 1OV3A 1VQ6T 2EQUA 4HT9A 5LJ3e 1K0XA 3M54A 3JCMX 5KYYB 3PIOA 1BIAA 4XTUA 2CSIA 3JB9I 2QDYB 1NEBA 3L2UA 2F2VA 1VUBA 1AHJB 4J6YA 1TS9A 3CCUQ 3V8LA 4R0KA 3H41A 2BTTA 4M7DA 4J7FA 1EX4A 1MMDA 3MJXA 4C5EA 4TVRA 4EMHA 2KE9A 5LJ5f 4M78G 4PJOE 1AWJA 1IRXA 3FLGA 4WCIA 3JCMJ 2CP2A 2X51A 1W4SA 1NLPC 3M9QA 2ABLA 3E19A 2LRQA 2QEXT 2C0IA 1Q86R 1OU8A 5GAMh 4BE1A 3L2QA 2K7AA 3AHUA 3PFSA 3G6EQ 3CCQA 3VUZA 3VYGA 2A3LA 2KI7A 5HCKA 3GF5A 2ZPHB 2JXBA 2ED1A 2FYKA 4HCBA 3RKWA 3OS0A 5FROA 4BB7A 3SFMA 1HD3A 3RERA 2F5KA 4ESRA 1X6OA 1S72Q 2KRMA 2EQKA 1JBMA 4RTTA 4FL6A 3VJPA 1VQ8T 3LLRA 4OF1A 3CCVT 2DJQA 4PJMA 1KD1U 2P4TA 2RJFA 5IT9E 5A0DA 1BB9A 3GIBA 1VQLQ 1TG0A 2YHTA 2LNVA 4QT7A 1VQOA 1D1AA 5GAN7 4FIBA 4DOVA 2VB6A 8ATCB 4LDWA 3EG2A 5GAN3 1Y07A 3CBPA 2MOXA 1WQ7A 1K9MU 1SEMA 4RTYA 2MWOA 4XTVA 1Q82R 3EGDA 5GAOm 5CKFA 2DFUA 5LJ5e 4J9GA 4HKEA 2C0TA 5FWBA 4EDUA 2F2XA 3LYIA 2XI9A 1SSFA 1VOMA 2JNGA 3OYYA 5GMKj 4ELYC 2NUZA 3TREA 1UGQB 3EGDB 3TSWA 4ZGDB 4RMOA 1M1KC 1AZGB 4HVVA 1UE9A 3SHWA 2HNIA 3S6WA 5IHNA 3CEYA 1O9SA 2D8HA 3L2RA 2K2MA 5I22A 1OOTA 1YNZA 2KEAA 4VUBA 3UT1A 4BDYA 4A53A 5GAMf 2RA2A 1ZUUA 1Z9QA 2LQ8A 2JTFA 1M2OA 2K5LA 2KY9A 2VYTA 3JSCA 2OTJQ 4QQ6A 4E2FB 1FXXA 2FEIA 2E41A 1JRIA 4Y91A 3I56Q 3QIIA 1W2BS 3CD6Q 3MO8A 4DBHA 2DJZA 1I5LA 2RHZA 1G3WA 4FYXB 5GMKl 3G6ET 2RJDA 1OI1A 3C0CA 2DAQA 1VQOQ 5DY9A 1NJIC 4JRQA 4LD6A 4HCKA 2PVGB 2COZA 2GF7A 2RI3A 3U23A 1TSFA 4OMQA 2GFUA 3THKA 1FX7A 3OW2S 2PU9B 3RIRA 1IXDA 2JM8A 1F1BB 5A2QE 4M7DG 2GQIA 3BDLA 1UEBA 3OYNA 2ECZA 4RTZA 1G3TA 4OMMA 2XD0A 4QQDA 2YLCA 1BU1A 3ZEHA 2GTOA 4RKUE 1OU9A 1H3ZA 2K57A 2I2LA 3PT9A 2RHXA 3CCMQ 1VQLT 4IUQA 4KUDK 3M0QA 4XU3A 4ZTFA 4L5GA 4AT1B 3OYFA 4OGCA 4CC4B 2MI6A 2LTOA 1AT1B 4DQ2A 2LX9A 2DYIA 5GANg 5GAN4 4MDWA 1HXDA 1TTHB 1YITQ 4JRPA 1ZA1B 1Y57A 5D6WA 1HJDA 4HXJA 2OAUA 4DBFA 1ZX6A 4WTOB 2E6ZA 2HKQB 1C1AA 2A08A 2LMJA 1EZZB 4JJDA 2NUPA 1XTDA 1IO6A 3QZ5B 4IURA 5D7UA 2FL7A 5HKCA 1IGQA 4UC4A 4CC2A 1MHNA 1MNDA 2RM4A 1RADB 1TUDA 2A36A 1NJIR 1NYGA 3OBWA 2X4YA 1KQ2A 4IKFA 2L0AA 1QW1A 2LC4A 1Z9ZA 4JUVA 4FYVB 2VGMA 2DK3A 2NUPB 1M1GA 2RQTA 2CUBA 4FT4A 2FPFA 1X69A 1AVZC 3DB4A 1SHGA 1W2BA 3I55Q 2CH4A 2OTJT 1MMAA 2F1LA 3J81E 5J39A 1XQHA 4KH0B 4F7UF 1WLPB 3I56T 2CUDA 3CD6T 1WHKA 4EIKA 2KRSA 4E7KA 2OTLA 3ULRB 4ZTJA 3QWXX 3OYHA 1N8RU 4KT0E 2RK2A 3OYCA 1QVFP 1KQ1A 4F17A 4X34A 2PTKA 3M53A 2ROLA 2KT8A 3QJYA 1ZUKA 1AWXA 3TU4K 1PHTA 4EMGA 1LVKA 2EYWA 4HT8A 1M90C 3VKIA 3HL8A 1WNLA 4O5VA 1PKTA 2FVUA 5D6XA 4JJCA 1GRIA 1VQMA 1KD1R 3O5ZA 3EFRA 2CYZB 2FG0A 2KR3A 3A98A 3OYLA 4BD3A 1TH7A 3CCMT 2OI3A 3OYAA 1G5VA 5GMKe 1VQ6A 3JB9F 2J6OA 3MKDA 1NEGA 2DTIA 1RACB 5LJ3j 1AD5A 1YBYA 4M77F 1YITT 2AIRB 2MWPA 3META 2MIOA 3VYHB 1YCYA 3SDZA 4PNOA 5GAMd 4LN2A 2M02A 1YJWQ 1VQKQ 4AG2C 1CKAA 1JXMA 3EG1A 3QYHB 2DXCA 1M30A 2YUNA 4N4IA 2OTLQ 2DVEA 4IUUA 1JB0E 2JTMA 1VYTA 2CZ0B 1X2QA 1KQSS 1TU0B 1OQKA 4M7AF 4AFZC 8AT1B 1P92A 2K79A 1ZBXA 2HMAA 2QEXA 2EKOA 2CZ7B 3WVEB 4E7HA 2RHIA 2FZGB 1FMKA 4JLIA 5KE3A 2LVMA 3MP8A 3J80E 1M90R 5A0GA 1YFNA 4C8QG 3I55T 2J06A 3BDUA 2DXUA 2HL3A 5CKBA 3EFOB 3EH2A 3A8HB 4PJJA 3E9FA 2LX7A 1UDLA 2M9UA 2KQWA 3E1SA 2AZSA 3H9NA 4RCBA 3OBYA 1QQJA 4A4GA 5CO7A 4PLLA 3CCVA 3MEUA 4C5IA 3MEWA 1Q7YU 4A63B 3HPWA 3L2WA 1QVGP 2YUQA 1QKXA 1D0YA 1E6HA 1QCNA 2DEUA 2OJ2A 3QPHA 3N5BB 4JJNK 4YTLA 4GLMA 4N4HA 1X27A 4ORZA 2A28A 4ZGEB 1D3BB 2KGTA 1RAHB 3OQ5A 9ATCB 5DM7R 5LJ5j 3EHRA 4AFSC 1QLYA 2LJ3A 4QKUA 1BCMA 5LJ3g 3X24B 2EJFA 2EKHA 4DEYA 1I81A 3I9QA 2DD5A 1JJ2P 2CDTA 4NL2A 4JZ3A 3JCMg 3I5SA 2L3PA 3EHQA 4ZN1A 3GLXA 1YJWT 1GCPA 1VQKT 1RUWA 1PC0A 1TUCA 1V29B 2SRCA 3CCJQ 5KYNA 1KC8U 3SEMA 1UFFA 3VS6A 2DETA 2GFAA 5KYXA 1WQWA 4OGEA 1VA7A 2O4XA 3FC3A 1TWBA 1VQ8Q 1CSKA 1Q86C 2V26A 4PFZA 3CCRQ 3CCVQ 4LUDA 4C92F 1M3CA 1H3HA 4KBMB 3CXCP 3H0IA 3CC2Q 3G6EA 3QKJA 5KYXB 2E1HA 2KVQG 2Z0WA 2DKGA 2O4XB 2HQEA 1ACMB 5FU7C 4XAXB 1M2VB 3HRUA 1K9AA 4ATOA 1RAEB 1C0MA 5CK9A 2O9VA 2K6DA 4LUEA 2GCXA 2A7YA 1N8RR 2QQRA 1YWOA 1K8AU 2PUKB 2XHCA 2MAMA 3P8HA 3VU3C 1RAIB 3SWNB 3HKSA 1BKBA 3UA7A 2NLUA 2XDBA 2E64A 1M1KU 2E5KA 4M77C 3HRSA 3OYDA 2HSPA 2ATCB 2P0PA 1GL5A 4JZ4A 1VQLA 2VXEA 3EG9A 3TCJA 2QYZA 1OX9A 2FZKB 3JCMe 2VVKA 2CP3A 1AWWA 2GTJA 2L3SA 1RABB 2FO0A 5CAIA 3M58A 2BIVA 2EJGA 3GP8A 2CT3A 1FMVA 1GCQC 1Q82C 5AYFA 2RHYA 1RLPC 4C0DC 5GAMj 1UECA 4HVWA 1Y0MA 4Y28E 5LJ5g 1UHFA 3EG9B 1RLQC 1M27C 4BE2A 2CZ6B 3OMGA 3VS1A 2HAXA 3RKYA 2P0QA 3OYEA 2LZ6B 2LJ1A 5IN1A 4F16A 4JS5A 2DEQA 3C94A 4WF2A 1AWOA 4RG2A 2VC8A 4JRIA 2EW3A 1VQ9T 3JCMP 3MPUB 3CCJT 1A0NB 1VQ7Q 3JB9D 3ZFJA 4CC3A 2FB7A 2R58A 1VQPQ 4M77D 4PJOG 1D1CA 1SRMA 2L3QA 2QGFB 2XDDA 2HQHA 4CRIA 2EAYA 1X6BA 2RF0A 4M78F 2OTJA 2EGAA 1QKWA 3CCRT 3I56A 1SPKA 4L59A 4L6V5 2RQVA 3CD6A 5C6SA 1N6AA 2HEQA 2JTEA 3KUFA 3CC2T 5HK0A 3NGPA 1BI3A 5IH2A 2DBMA 2RQRA 1ZSGA 4F7UA 4LE9A 4B9XA 4XTZA 3M0TA 1K76A 3CCSQ 2FRWA 4M7AD 2YRDA 2DMOA 2YUPA 3M0SA 4CC7A 3OW2P 3PE0A 4Y92A 1LJOA 2AHJB 2OX7A 2P4RA 1DJ7B 4F7UB 3CBMA 3OA6A 4PJLA 1X2KA 4RTUA 1Q7YR 2EGCA
chains in the Genus database with same CATH topology
1WIEA 1TUDA 2A36A 2J05A 1NYGA 2EYXA 1NYFA 2GNCA 2PZ1A 3QWYA 2JM9A 3PVLA 2LQNA 4K11A 2L0AA 1UG1A 1Z9ZA 2HCKA 2JMCA 3VRYA 3VS7A 2YUOA 1KIKA 2A37A 2RQTA 1QWFA 1WXUA 2CUBA 2FPFA 1X69A 1AVZC 1SHGA 1MV3A 3CQTA 2CH4A 1ABQA 1MUZA 1I1JA 2KT1A 2PNIA 2I0NA 1SSHA 1WLPB 1B3QA 3JV3A 1H8KA 2CUDA 1PKSA 1NM7A 1LCKA 1WDXA 4EIKA 2DM1A 2KRSA 1HSQA 3ULRB 1U3OA 3QWXX 3VRZA 2IIMA 1VYVA 2KNBB 3NHNA 4AG1C 2KBTA 2LNHB 4F17A 4DEXA 3VS5A 1QWEA 2PTKA 2MCNA 2ROLA 3UA6A 2KT8A 1BBZA 1ZUKA 3REBB 1AWXA 1PHTA 2EYWA 2KROA 4KRTA 2DL4A 1ZBJA 4OMOA 1M8MA 1KSWA 1PKTA 2EQIA 3TSZA 4JJCA 1GRIA 2O31A 2ROTA 3EG3A 3O5ZA 1EFNA 2ESWA 1JEGA 2FG0A 2KR3A 3A98A 2B86A 1OPLA 1MV0B 2BZXA 2AZVA 1KFZA 2OI3A 1YWPA 5IXFA 2KRNA 4J9CA 1JO8A 2J6OA 2CREA 2YDLA 3M0UA 1NEGA 2GGRA 1GBQA 1AD5A 1GBRA 2DL8A 2K9GA 5FWCA 2DL3A 2EGEA 2MIOA 2DL7A 2D0NA 4E6RA 4LN2A 1AZEA 3M0PA 2D8JA 2JMAA 4AG2C 2V1QA 4J9EA 1J3TA 1CKAA 1JXMA 3EG1A 1ZLMA 1JXOA 1M30A 1OPKA 1ARKA 2YUNA 1T0HA 1U5SA 4Z89A 1WI7A 1S1NA 1YCSB 1VYTA 2RNAA 1X2QA 2DILA 5ECAA 4AFZC 2K3BA 2K79A 3TVTA 3RBBB 4OMPA 4J9IA 1RI9A 3H0FA 2KXCA 4IIOA 4JPBW 1CKBA 2DE0X 1PRLC 2FRYA 1M3AA 1K0SA 1I07A 1FMKA 4LNPA 2LJ0A 2HDAA 2JS2A 3EG0A 3PVQA 2DRKA 4OMNA 1QCFA 2J06A 2FPDA 2J7IA 1AOJA 4GBQA 4HVUA 1VYUA 2CSQA 1W1FA 1BK2A 2LX7A 2HBWA 1OV3A 1V1CA 2X3WD 4J9DA 3RNJA 4AFUC 1UDLA 2O2OA 1H92A 1T3SA 1PWTA 5EC7A 2AZSA 4F14A 1K4US 1K0XA 3VS4A 2W10A 2SEMA 3IQLA 4A63B 2CSIA 1NEBA 1ZUYA 2F2VA 5I11A 2O88A 2YUQA 1QKXA 1E6HA 1U06A 5IHKA 4R0KA 3H41A 2BTTA 1WA7A 2KE9A 2OJ2A 2BZYA 2RQWA 1XOVA 1UTIA 1AWJA 4WCIA 4GLMA 1GCQA 1X27A 2KXDA 4ORZA 2A28A 1NLPC 2ABLA 2EVRA 1GFDA 2C0IA 2CT4A 2KGTA 2DVJA 2L2PA 2K7AA 2RMOA 2O9SA 3EHRA 1I0CA 4AFSC 1QLYA 5GJWB 1E6GA 4Z88A 2LJ3A 3NMZC 5HCKA 2EKHA 4DEYA 2JW4A 2JXBA 3I9QA 2ED1A 5GJVB 3I5RA 1T3LA 2JS0A 1UJYA 2CDTA 2GBQA 1W6XA 4JZ3A 3VS0A 2RN8A 3I5SA 2L3PA 3EHQA 1HD3A 1GCPA 1RUWA 1TUCA 2W0ZA 4ESRA 2SRCA 2C0OA 2KRMA 1WXBA 4RTTA 5IXBA 3SEMA 1UFFA 1T0JA 3VS3A 3VS6A 1AEYA 4IIMA 2VWFA 2YT6A 2DJQA 1VA7A 1YP5A 2DL5A 1CSKA 2F2WA 2DLPA 4LUDA 1BB9A 1K1ZA 2QDLA 1TG0A 1ABOA 1M3CA 1H3HA 4QT7A 3I35A 4ZNXA 2LCSA 3H0IA 1WXTA 3LH5A 3EG2A 2M0YA 2MOXA 3UATA 2CH4W 1SEMA 4RTYA 2KYBA 1SHFA 1K9AA 2LQWA 5IHIA 2G6FX 4RTWA 2O9VA 2K6DA 4LUEA 2V1RA 1JQQA 2BZ8A 4J9GA 2M51A 3EGUA 2C0TA 1YWOA 5FWBA 2F2XA 1UUEA 2D1XA 3UA7A 5L23A 2E5KA 2OAWA 2NUZA 2HSPA 3TSWA 4J9HA 2LP5A 1AZGB 4HVVA 2FPEA 4JZ4A 1GL5A 1UE9A 3SHWA 5IHNA 1NG2A 2D8HA 2DRMA 2K2MA 5I22A 3VS2A 1OOTA 3GBQA 1YNZA 2DBKA 2KEAA 3H0HA 2VVKA 1AWWA 2ED0A 2DNUA 2GTJA 2FO0A 2L3SA 1ZUUA 2RQUA 1Z9QA 4D8DA 4J9FA 4RTVA 3R6NA 2FEIA 4Z8AA 3UF4A 1FYNA 1G83A 2CT3A 2AKKA 1GCQC 1RLPC 1UECA 4HVWA 1Y0MA 1X6GA 2DA9A 2EYYA 1WYXA 1UHFA 1B07A 2H8HA 4AFQC 1M3BA 1RLQC 1M27C 1UHCA 2XMFA 4RUGA 3VS1A 3ZL7C 2LZ6B 3C0CA 2LJ1A 1G2BA 2J6KA 4HCKA 4F16A 1GFCA 3U23A 1JU5C 2X3XD 3M0RA 4OMQA 4FSSA 3THKA 2EBPA 4D8KA 1AWOA 2JM8A 1N5ZA 3NPFA 1WX6A 2EYZA 2EW3A 2RPNA 2GQIA 1OEBA 1KJWA 1A0NB 2ECZA 1NLOC 2DYBA 4CC3A 2KYMA 4OMMA 4RTZA 3KFVA 1SRMA 2L3QA 1BU1A 1UGVA 2GTOA 1WFWA 1X6BA 2RF0A 1X43A 2EGAA 1QKWA 1SPKA 4JJBA 2RQVA 1PNJA 1UJ0A 3M0QA 1SRLA 4J9BA 1W70A 3FJ5A 2HEQA 2JTEA 4CC4B 1PRMC 2VKNA 3NGPA 5IH2A 2DBMA 2DF6A 2J6FA 2RQRA 4X1VA 1ZSGA 4LE9A 2ENMA 2AK5A 3M0TA 1K76A 2FRWA 1Y57A 2AKLA 2DMOA 1HJDA 2YUPA 3M0SA 4CC7A 4M4ZA 4HXJA 1ZX6A 1E7OA 3PE0A 2EPDA 4Y92A 2DX1A 2YSQA 3REAB 2P4RA 2A08A 4RTXA 2LMJA 4OMLA 4JJDA 1IO6A 1YN8A 5FW9A 2JT4A 1X2KA 4CC2A 4RTUA 2EGCA 2NWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIE A;  1TUD A;  2A36 A;  2J05 A;  1NYG A;  2EYX A;  1NYF A;  2GNC A;  2PZ1 A;  3QWY A;  2JM9 A;  3PVL A;  2LQN A;  4K11 A;  2L0A A;  1UG1 A;  1Z9Z A;  2HCK A;  2JMC A;  3VRY A;  3VS7 A;  2YUO A;  1KIK A;  2A37 A;  2RQT A;  1QWF A;  1WXU A;  2CUB A;  2FPF A;  1X69 A;  1AVZ C;  1SHG A;  1MV3 A;  3CQT A;  2CH4 A;  1ABQ A;  1MUZ A;  1I1J A;  2KT1 A;  2PNI A;  2I0N A;  1SSH A;  1WLP B;  1B3Q A;  3JV3 A;  1H8K A;  2CUD A;  1PKS A;  1NM7 A;  1LCK A;  1WDX A;  4EIK A;  2DM1 A;  2KRS A;  1HSQ A;  3ULR B;  1U3O A;  3QWX X;  3VRZ A;  2IIM A;  1VYV A;  2KNB B;  3NHN A;  4AG1 C;  2KBT A;  2LNH B;  4F17 A;  4DEX A;  3VS5 A;  1QWE A;  2PTK A;  2MCN A;  2ROL A;  3UA6 A;  2KT8 A;  1BBZ A;  1ZUK A;  3REB B;  1AWX A;  1PHT A;  2EYW A;  2KRO A;  4KRT A;  2DL4 A;  1ZBJ A;  4OMO A;  1M8M A;  1KSW A;  1PKT A;  2EQI A;  3TSZ A;  4JJC A;  1GRI A;  2O31 A;  2ROT A;  3EG3 A;  3O5Z A;  1EFN A;  2ESW A;  1JEG A;  2FG0 A;  2KR3 A;  3A98 A;  2B86 A;  1OPL A;  1MV0 B;  2BZX A;  2AZV A;  1KFZ A;  2OI3 A;  1YWP A;  5IXF A;  2KRN A;  4J9C A;  1JO8 A;  2J6O A;  2CRE A;  2YDL A;  3M0U A;  1NEG A;  2GGR A;  1GBQ A;  1AD5 A;  1GBR A;  2DL8 A;  2K9G A;  5FWC A;  2DL3 A;  2EGE A;  2MIO A;  2DL7 A;  2D0N A;  4E6R A;  4LN2 A;  1AZE A;  3M0P A;  2D8J A;  2JMA A;  4AG2 C;  2V1Q A;  4J9E A;  1J3T A;  1CKA A;  1JXM A;  3EG1 A;  1ZLM A;  1JXO A;  1M30 A;  1OPK A;  1ARK A;  2YUN A;  1T0H A;  1U5S A;  4Z89 A;  1WI7 A;  1S1N A;  1YCS B;  1VYT A;  2RNA A;  1X2Q A;  2DIL A;  5ECA A;  4AFZ C;  2K3B A;  2K79 A;  3TVT A;  3RBB B;  4OMP A;  4J9I A;  1RI9 A;  3H0F A;  2KXC A;  4IIO A;  4JPB W;  1CKB A;  2DE0 X;  1PRL C;  2FRY A;  1M3A A;  1K0S A;  1I07 A;  1FMK A;  4LNP A;  2LJ0 A;  2HDA A;  2JS2 A;  3EG0 A;  3PVQ A;  2DRK A;  4OMN A;  1QCF A;  2J06 A;  2FPD A;  2J7I A;  1AOJ A;  4GBQ A;  4HVU A;  1VYU A;  2CSQ A;  1W1F A;  1BK2 A;  2LX7 A;  2HBW A;  1OV3 A;  1V1C A;  2X3W D;  4J9D A;  3RNJ A;  4AFU C;  1UDL A;  2O2O A;  1H92 A;  1T3S A;  1PWT A;  5EC7 A;  2AZS A;  4F14 A;  1K4U S;  1K0X A;  3VS4 A;  2W10 A;  2SEM A;  3IQL A;  4A63 B;  2CSI A;  1NEB A;  1ZUY A;  2F2V A;  5I11 A;  2O88 A;  2YUQ A;  1QKX A;  1E6H A;  1U06 A;  5IHK A;  4R0K A;  3H41 A;  2BTT A;  1WA7 A;  2KE9 A;  2OJ2 A;  2BZY A;  2RQW A;  1XOV A;  1UTI A;  1AWJ A;  4WCI A;  4GLM A;  1GCQ A;  1X27 A;  2KXD A;  4ORZ A;  2A28 A;  1NLP C;  2ABL A;  2EVR A;  1GFD A;  2C0I A;  2CT4 A;  2KGT A;  2DVJ A;  2L2P A;  2K7A A;  2RMO A;  2O9S A;  3EHR A;  1I0C A;  4AFS C;  1QLY A;  5GJW B;  1E6G A;  4Z88 A;  2LJ3 A;  3NMZ C;  5HCK A;  2EKH A;  4DEY A;  2JW4 A;  2JXB A;  3I9Q A;  2ED1 A;  5GJV B;  3I5R A;  1T3L A;  2JS0 A;  1UJY A;  2CDT A;  2GBQ A;  1W6X A;  4JZ3 A;  3VS0 A;  2RN8 A;  3I5S A;  2L3P A;  3EHQ A;  1HD3 A;  1GCP A;  1RUW A;  1TUC A;  2W0Z A;  4ESR A;  2SRC A;  2C0O A;  2KRM A;  1WXB A;  4RTT A;  5IXB A;  3SEM A;  1UFF A;  1T0J A;  3VS3 A;  3VS6 A;  1AEY A;  4IIM A;  2VWF A;  2YT6 A;  2DJQ A;  1VA7 A;  1YP5 A;  2DL5 A;  1CSK A;  2F2W A;  2DLP A;  4LUD A;  1BB9 A;  1K1Z A;  2QDL A;  1TG0 A;  1ABO A;  1M3C A;  1H3H A;  4QT7 A;  3I35 A;  4ZNX A;  2LCS A;  3H0I A;  1WXT A;  3LH5 A;  3EG2 A;  2M0Y A;  2MOX A;  3UAT A;  2CH4 W;  1SEM A;  4RTY A;  2KYB A;  1SHF A;  1K9A A;  2LQW A;  5IHI A;  2G6F X;  4RTW A;  2O9V A;  2K6D A;  4LUE A;  2V1R A;  1JQQ A;  2BZ8 A;  4J9G A;  2M51 A;  3EGU A;  2C0T A;  1YWO A;  5FWB A;  2F2X A;  1UUE A;  2D1X A;  3UA7 A;  5L23 A;  2E5K A;  2OAW A;  2NUZ A;  2HSP A;  3TSW A;  4J9H A;  2LP5 A;  1AZG B;  4HVV A;  2FPE A;  4JZ4 A;  1GL5 A;  1UE9 A;  3SHW A;  5IHN A;  1NG2 A;  2D8H A;  2DRM A;  2K2M A;  5I22 A;  3VS2 A;  1OOT A;  3GBQ A;  1YNZ A;  2DBK A;  2KEA A;  3H0H A;  2VVK A;  1AWW A;  2ED0 A;  2DNU A;  2GTJ A;  2FO0 A;  2L3S A;  1ZUU A;  2RQU A;  1Z9Q A;  4D8D A;  4J9F A;  4RTV A;  3R6N A;  2FEI A;  4Z8A A;  3UF4 A;  1FYN A;  1G83 A;  2CT3 A;  2AKK A;  1GCQ C;  1RLP C;  1UEC A;  4HVW A;  1Y0M A;  1X6G A;  2DA9 A;  2EYY A;  1WYX A;  1UHF A;  1B07 A;  2H8H A;  4AFQ C;  1M3B A;  1RLQ C;  1M27 C;  1UHC A;  2XMF A;  4RUG A;  3VS1 A;  3ZL7 C;  2LZ6 B;  3C0C A;  2LJ1 A;  1G2B A;  2J6K A;  4HCK A;  4F16 A;  1GFC A;  3U23 A;  1JU5 C;  2X3X D;  3M0R A;  4OMQ A;  4FSS A;  3THK A;  2EBP A;  4D8K A;  1AWO A;  2JM8 A;  1N5Z A;  3NPF A;  1WX6 A;  2EYZ A;  2EW3 A;  2RPN A;  2GQI A;  1OEB A;  1KJW A;  1A0N B;  2ECZ A;  1NLO C;  2DYB A;  4CC3 A;  2KYM A;  4OMM A;  4RTZ A;  3KFV A;  1SRM A;  2L3Q A;  1BU1 A;  1UGV A;  2GTO A;  1WFW A;  1X6B A;  2RF0 A;  1X43 A;  2EGA A;  1QKW A;  1SPK A;  4JJB A;  2RQV A;  1PNJ A;  1UJ0 A;  3M0Q A;  1SRL A;  4J9B A;  1W70 A;  3FJ5 A;  2HEQ A;  2JTE A;  4CC4 B;  1PRM C;  2VKN A;  3NGP A;  5IH2 A;  2DBM A;  2DF6 A;  2J6F A;  2RQR A;  4X1V A;  1ZSG A;  4LE9 A;  2ENM A;  2AK5 A;  3M0T A;  1K76 A;  2FRW A;  1Y57 A;  2AKL A;  2DMO A;  1HJD A;  2YUP A;  3M0S A;  4CC7 A;  4M4Z A;  4HXJ A;  1ZX6 A;  1E7O A;  3PE0 A;  2EPD A;  4Y92 A;  2DX1 A;  2YSQ A;  3REA B;  2P4R A;  2A08 A;  4RTX A;  2LMJ A;  4OML A;  4JJD A;  1IO6 A;  1YN8 A;  5FW9 A;  2JT4 A;  1X2K A;  4CC2 A;  4RTU A;  2EGC A;  2NWM A; 
#chains in the Genus database with same CATH topology
 1WIE A;  4IUV A;  2EYX A;  1NYF A;  2GNC A;  2PZ1 A;  3QSU A;  3OS2 A;  2E3H A;  6AT1 B;  2DXB A;  2LCL A;  3MEV A;  3CCM A;  2LQN A;  5GAN h;  1BI0 A;  2HCK A;  2DXT A;  2MK5 A;  3VRY A;  2F69 A;  1Q81 C;  2XDP A;  3H8Z A;  1PD1 A;  1U1S A;  1WJR A;  3X26 B;  1YIT A;  1KHC A;  5FU6 C;  1I1J A;  3BE3 A;  5GAM g;  1B3Q A;  3JV3 A;  4MZT A;  3CPW P;  1PKS A;  1NM7 A;  1WDX A;  4AMC A;  5FU7 B;  2DM1 A;  1KK7 A;  4C0F A;  2ZZD A;  4M77 A;  1U8R A;  4C92 C;  1OX8 A;  3DLM A;  2KNB B;  3NHN A;  3V8K A;  2NUT A;  4AG1 C;  1WHL A;  3UA6 A;  1BBZ A;  3REB B;  3L2Z A;  5KYU B;  4F04 B;  5KYW A;  4M77 B;  2KRO A;  1VQ7 T;  1KC8 R;  2DL4 A;  1ZBJ A;  3HRT A;  3PIP A;  2ZAE A;  2NUT B;  4JLG A;  1KSW A;  1VQP T;  2HSE B;  2Y90 A;  4LDY A;  2HL5 C;  2O31 A;  4D6W A;  2ROT A;  2Y4Y A;  1NPP A;  1VQ5 Q;  3I55 A;  4OB3 B;  2B86 A;  4II1 A;  3M59 A;  5KYW B;  3EFS A;  1YJ9 Q;  2BZX A;  3V7S A;  2AZV A;  3M57 A;  4ME7 A;  1YWP A;  3OYG A;  1JO8 A;  1VQ4 T;  4C0D B;  1RAG B;  3C12 A;  2CRE A;  2YDL A;  4M7A B;  2GGR A;  1GBQ A;  3S3O A;  1Q95 G;  1R77 A;  4EMK C;  5FWC A;  3CCS T;  2A0F B;  5I2M A;  3RES A;  4F7U E;  2D0Q B;  4ZGJ B;  2D0N A;  1Q81 R;  4C92 D;  1ZSZ C;  2V1Q A;  4J9E A;  3QJ6 A;  1ZLM A;  2M1H A;  1ARK A;  4M7D F;  1K8A R;  1XNI A;  3CBO A;  3UDC A;  4Z89 A;  2RI5 A;  1WI7 A;  2HBP A;  5GAM e;  2ZPE B;  1S1N A;  3CMA Q;  1KD1 C;  3OS5 A;  5GAO r;  1R0C B;  5GAN f;  3LW5 E;  5GAO l;  4OB0 B;  3D7S B;  2EYQ A;  2K3B A;  3TVT A;  3FB9 A;  3RBB B;  2KXC A;  2E5Q A;  2G3R A;  1K9M C;  4PKC C;  4ANJ A;  2DD4 A;  2JOY A;  2DE0 X;  1K0S A;  1I07 A;  1I4K 1;  3RDV A;  4QW2 A;  2HDA A;  3EG0 A;  2XU8 A;  4MMK A;  1LPL A;  2QQS A;  3PVQ A;  4KUL A;  1QP2 A;  2FPD A;  3EGX A;  4C0Z A;  5FRN A;  2DIG A;  1N9R A;  5GAO q;  3G4S Q;  1YJW A;  4M78 C;  1VQK A;  1MMG A;  4E7Z A;  3M4Y A;  2HBW A;  2QXF A;  2X3W D;  1WHG A;  4AFU C;  1H92 A;  5I2S A;  4HA8 A;  1G8X A;  3WXM B;  5DLO A;  4M77 E;  2LDM A;  1K4U S;  1VQN T;  2W10 A;  2IPO B;  5L8R E;  3EGX B;  2P84 A;  2X4W A;  3IQL A;  1ZA2 B;  4PFO A;  1KQS P;  1Y71 A;  5I11 A;  2O88 A;  2VGN A;  2PVO B;  1U06 A;  4JS4 A;  2E70 A;  1YIJ T;  1RAF B;  2BZY A;  2RQW A;  4NS5 A;  2VUB A;  3V7R A;  2KXD A;  1VQ5 T;  4M7A E;  2EVR A;  2HZY A;  1GFD A;  2CT4 A;  4M77 G;  1YJ9 T;  2RMO A;  5FU6 B;  2RB6 A;  5CR2 A;  1SF9 A;  2KDS A;  1E6G A;  4Z88 A;  3HFO A;  1G3Y A;  2WAC A;  3MCA B;  2JW4 A;  5GJV B;  2EQJ A;  2R5A A;  3G1J A;  2H3E B;  3I5R A;  4BY6 C;  1UJY A;  4C92 B;  4M78 D;  1W6X A;  1K9M R;  3VS0 A;  2RN8 A;  3BFM A;  3M5A A;  1MGQ A;  5GAN 8;  3SB2 A;  3F70 A;  1MNE A;  4A54 A;  2QGG A;  3VS3 A;  3H6Z A;  3JCM W;  1OZ2 A;  4IIM A;  2E12 A;  3SWN C;  2VWF A;  2YT6 A;  2ZCF B;  3URG A;  2RHU A;  3CMA T;  1Q86 U;  1YP5 A;  2DZC A;  5FLX E;  2X4J A;  4PL6 A;  3WVD B;  3GNF B;  2F2W A;  5GAO p;  2DLP A;  2QDL A;  3HP9 A;  4J6W A;  2MYS A;  1V76 A;  3PGG A;  5LJ3 h;  3JRZ A;  3I35 A;  4ZNX A;  1KG1 A;  2LCS A;  3CC4 Q;  2HKN A;  5CKH A;  1ZSZ A;  3EFO A;  2CH4 W;  1K73 U;  1R8O B;  1WJS A;  1C6V X;  2DIQ A;  1G3S A;  1SHF A;  3AT1 B;  3LGL A;  4ZN3 A;  2G6F X;  4EMK B;  3CCE Q;  3G4S T;  1M9S A;  2V1R A;  1JQQ A;  2X9H A;  4FW1 A;  4A4H A;  3JAM E;  1VQ9 A;  4X9D A;  3CCJ A;  1M1F A;  1ZSZ B;  2M51 A;  2JJ9 A;  2COW A;  3EGU A;  1M4Z A;  4QVD A;  1YJN Q;  1UUE A;  2D1X A;  3NTH A;  1NBE B;  3Q1J A;  3L2V A;  5L23 A;  3PMI A;  3HHT B;  3FRN A;  3ZBD A;  2JZ2 A;  4J9H A;  1VQ8 A;  3CCR A;  5CQX A;  3LX7 A;  4J5Y A;  2DRM A;  4LXC A;  3VS2 A;  3GBQ A;  1IRE B;  3PMT A;  2DNU A;  1D3B A;  3CC2 A;  3FIF A;  2JUF A;  4M78 A;  1BI2 A;  2RQU A;  4M7D C;  2K3Y A;  3A8M B;  4J9F A;  4EPC A;  3OMC A;  3R6N A;  2QQA A;  3UF4 A;  4R56 A;  2QQB A;  1FYN A;  4XQ3 A;  4C8Q F;  2AKK A;  2RO0 A;  5GAN d;  2D9T A;  4C92 E;  4M75 F;  2EYY A;  4AFQ C;  2H8H A;  1M3B A;  1UHC A;  1N8R C;  3PTA A;  1BCO A;  3CME T;  2B8A A;  4OVA A;  3ZL7 C;  4M78 B;  2RI2 A;  2X35 A;  1GFC A;  3L42 A;  1BIB A;  2HQX A;  4A4K A;  2CP0 A;  3M0R A;  4FSS A;  4FCY A;  2EBP A;  2EIF A;  5CIU A;  1N5Z A;  3V7C A;  2YRV A;  2EYZ A;  1PM3 A;  4OMF B;  5I21 A;  4PFP A;  1KJW A;  3M56 A;  2CGH A;  1NLO C;  2WSE E;  2DYB A;  1VQ9 Q;  3JB9 J;  1RL2 A;  4FT2 A;  4NOY A;  2E10 A;  1UGV A;  5LJ5 h;  2K4Y A;  5CQY A;  2EFI A;  4JJB A;  1UJ0 A;  4M7D D;  4GLK A;  4J9B A;  1W70 A;  3G71 T;  1FWZ A;  3FJ5 A;  1M2V A;  3CC4 T;  1PRM C;  1UGS B;  2VKN A;  3M4G A;  1XJW B;  2DF6 A;  4FM4 B;  2MF2 A;  2AKL A;  4Q5W A;  4E7I A;  4RG8 A;  4BY6 B;  2Y4X A;  3SWN A;  1E7O A;  2M16 A;  4E7L A;  3CCE T;  4XTX A;  2YSQ A;  3REA B;  2QA4 Q;  3OYJ A;  1VQ7 A;  3DB3 A;  4FU6 A;  1EIF A;  1OZ3 A;  4OML A;  1QVG S;  1YJN T;  3KBG A;  1VQP A;  3PNW C;  5FW9 A;  3C4S A;  3V8J A;  2NWM A;  2KSS A;  3QUI A;  4OB1 B;  2JM9 A;  5DLQ E;  3PVL A;  4K11 A;  4OB2 B;  3L1A A;  1SKU B;  2JMC A;  1WHH A;  3R6O A;  5GAO n;  3VS7 A;  1O75 A;  1VQ4 A;  2A37 A;  1QWF A;  2GQV A;  4DA4 A;  4KGZ B;  3UPU A;  4C0G A;  1MV3 A;  3CQT A;  3OYI A;  2CKK A;  4M78 E;  1MUZ A;  3CCS A;  2KT1 A;  2PNI A;  2X4X A;  1SSH A;  1H8K A;  1LCK A;  1YI2 Q;  1JJ2 S;  1HSQ A;  2QTX A;  4MDX A;  4RCC A;  4GY5 A;  3HSB A;  5A0L A;  1VIE A;  1I8F A;  4M7A C;  1Q7Y C;  1NJI U;  1QVP A;  2KBT A;  5C0M A;  1KHI A;  4BI3 A;  1QWE A;  4XU0 A;  4DBR A;  2MCN A;  4KH1 B;  2K2V A;  2VXF A;  4A4E A;  1HYO A;  4BUG A;  2KMT A;  2M0O A;  4KRT A;  2QAS A;  3P8B B;  4B9W A;  1MMN A;  3SD4 A;  1N27 A;  5J26 A;  3JB9 H;  5GAN 5;  3OYB A;  2CP6 A;  5D6Y A;  3CXC S;  5GMK m;  1YHQ Q;  2ZGW A;  3EG3 A;  1EFN A;  2ESW A;  3LWI A;  1JEG A;  4M7D B;  3CCL T;  3MEA A;  2RJC A;  2QG9 B;  4N0A C;  2KRN A;  1IZ6 A;  1D0Z A;  1QCO A;  4J9C A;  2LT1 A;  3DKM A;  2LQK A;  1K73 R;  2XK0 A;  1W2B P;  2DL8 A;  2YRC A;  4XK8 E;  2K9G A;  1VQ4 Q;  1UGR B;  1VQN A;  3NTK A;  3HFN A;  2EGE A;  2DER A;  3CC7 Q;  3VUB A;  4E6R A;  2D6F A;  3S3M A;  3OSV A;  4R55 A;  5CKD A;  3X25 B;  4MML A;  1KC8 C;  1QVG A;  4C8Q C;  1OPK A;  4XTY A;  3RUX A;  2QA4 T;  4M75 C;  1T0H A;  1U5S A;  1YIJ A;  2L3R A;  1LNX A;  2F5T X;  3ASK A;  4N4G A;  4J83 A;  4PJO F;  3X28 B;  1Y7X A;  2DIL A;  5ECA A;  3OB9 A;  4E7S A;  1VQ5 A;  3QDR B;  2HD0 A;  3TQ7 P;  5GAN j;  1YJ9 A;  1WHM A;  3FJP A;  1CKB A;  4B6M A;  2FRY A;  3FEO A;  3RR6 A;  2JS2 A;  2L89 A;  4OMN A;  5CCA A;  3RMQ A;  1JJ2 A;  2K5I A;  1IHW A;  2DZ9 A;  1B7T A;  5LJ3 d;  2COY A;  1VYU A;  1D09 B;  1H64 1;  2V8I A;  3CCQ Q;  2CSQ A;  1W1F A;  1BK2 A;  1YI2 T;  1V1C A;  3ER0 A;  3RNJ A;  1K8A C;  4OP0 A;  2O2O A;  2K3X A;  1T3S A;  1PWT A;  3JCM d;  2FZC B;  5EC7 A;  4JRK A;  4F14 A;  5KH6 A;  4HCZ A;  4LDX A;  5KYU A;  3VS4 A;  2SEM A;  3CMA A;  3CCU T;  4C8Q D;  5GMK h;  1VQN Q;  4M75 D;  2RD1 A;  5KCH A;  1ZUY A;  2L8D A;  4C5G A;  5J3B A;  2ZPF B;  4M7D E;  5IHK A;  4BE0 A;  1M90 U;  1WA7 A;  2JN0 A;  3CXC A;  4QVZ A;  4C5H A;  1D1B A;  1XOV A;  1UTI A;  3A1P A;  3GNG A;  1YHQ T;  1GCQ A;  1YIJ Q;  2BE9 B;  4M7A A;  4JDS A;  2DVJ A;  2R5M A;  2L2P A;  2ZPG B;  3QDF A;  2O9S A;  4KGX B;  1I0C A;  3G4S A;  5GJW B;  1BYM A;  2IVW A;  1ZQ1 A;  3NMZ C;  1M5Q 1;  4J7I A;  5KE2 A;  4XTW A;  4FW2 A;  2E3I A;  2H3J A;  1T3L A;  2JS0 A;  5IAY A;  2GBQ A;  4PLI A;  1GXI E;  1S72 T;  3CC7 T;  1TXQ A;  3NFC A;  2W0Z A;  1NZ9 A;  2C0O A;  2XIC A;  1WXB A;  2DTH A;  5AT1 B;  5IXB A;  1SG5 A;  1T0J A;  2O01 E;  4P5N A;  1AEY A;  2PQW A;  4E47 A;  3JCM V;  4N0A A;  2DL5 A;  2E6N A;  4DBQ A;  2YLB A;  1NPR A;  1K1Z A;  3C95 A;  1ABO A;  1M1K R;  3MP6 A;  1X01 A;  4QQG A;  3CME A;  3X20 B;  1WXT A;  3LH5 A;  2M0Y A;  3CPW S;  2E65 A;  3M55 A;  3UAT A;  3OS1 A;  2YWW A;  5LJ5 d;  4C8Q A;  2QI2 A;  1PSF A;  4F7U G;  4M75 A;  2KYB A;  4ELZ C;  2LQW A;  5IHI A;  5HK3 A;  2RJE A;  4RTW A;  3JCM b;  4IUT A;  3CCQ T;  2LCC A;  5M9O A;  2BZ8 A;  3RKX A;  4LDV A;  4C8Q B;  2KK4 A;  1NE8 A;  2AT1 B;  4M75 B;  1HK9 A;  2L5Q A;  3GPL A;  2OAW A;  2LP5 A;  2QK0 A;  5HY6 A;  2FPE A;  3CPF A;  1NG2 A;  1N9S A;  1R0B G;  1RI0 A;  3G71 A;  2DBK A;  1QMC A;  3H0H A;  4MZP A;  3P8D A;  3CC4 A;  2ED0 A;  3QBY A;  3EAE A;  4J6X A;  1PSE A;  4A4F A;  1IGU A;  4D8D A;  1WGS A;  4KUI A;  3BY7 A;  4RTV A;  4Z8A A;  1G83 A;  1Y96 A;  2YXY A;  3OY9 A;  3FDR A;  4PJO C;  4BAC A;  2DA9 A;  1X6G A;  1WYX A;  1VQO T;  1B07 A;  2XMF A;  4C92 A;  3CCE A;  3OW2 A;  3JB9 G;  4RUG A;  3KXT A;  2E4H A;  5EG2 A;  1G2B A;  2J6K A;  1VIF A;  3CME Q;  1YJN A;  1JU5 C;  2X3X D;  3O8V A;  1TOV A;  5GAN e;  1Y96 B;  2BE7 D;  4D8K A;  1BI1 A;  3QYG B;  2V8K A;  3NPF A;  1WX6 A;  1WPY A;  3HTR A;  2VV5 A;  2RPN A;  2MMP A;  1OEB A;  2PVD B;  1M8V A;  2KYM A;  2V8J A;  4HCC A;  3E2U A;  3QHS A;  4FSX A;  4FYW B;  3KFV A;  3JCM Q;  3T9N A;  4M7A G;  1WFW A;  3QO3 A;  1X43 A;  3G7Z A;  4CI0 C;  3A8G B;  1PNJ A;  3CPW A;  1SRL A;  3GOX A;  2VAS A;  2WSF E;  2EWN A;  1D0X A;  2RK1 A;  4EMK A;  3OYM A;  2J6F A;  4PJO D;  4X1V A;  3G71 Q;  1X75 C;  2ENM A;  2AK5 A;  3RMS A;  4C8Q E;  1WZO A;  3JCM h;  4E7J A;  4M4Z A;  4M75 E;  3BW1 A;  2EPD A;  3A8L B;  2DX1 A;  2EJ9 A;  3LWH A;  4RTX A;  1QVF S;  1RAA B;  2DPP B;  2C06 A;  1UGP B;  3A5Z B;  3S3N A;  1YN8 A;  2QAZ A;  1B34 A;  2CP7 A;  2JT4 A;  2K5F A;  4DOW A;  5GAN 2;  2J05 A;  3QWY A;  3JCM c;  3CCL A;  2BUD A;  4J8O A;  1WJQ A;  1UG1 A;  3OSS C;  2YUO A;  1KIK A;  4M75 G;  1VQM Q;  1B34 B;  4NL3 A;  2MPX C;  3TEE A;  1WXU A;  2FHD A;  2PUO B;  4O6J A;  1IB8 A;  1ABQ A;  1ZHI A;  2I0N A;  1WHJ A;  4MZM A;  2CZ1 B;  2XID A;  2LT4 A;  4FYY B;  2NYS A;  2EQM A;  1Q82 U;  1VQ6 Q;  1OYX A;  1U3O A;  3VRZ A;  3MP1 A;  7AT1 B;  2QA4 A;  2P0K A;  2IIM A;  1VYV A;  3EH1 A;  3LGF A;  2LNH B;  4DEX A;  3VS5 A;  3UWN A;  5GAN 6;  1PG5 B;  1FMW A;  3ME9 A;  3INZ A;  2ZPI B;  4Z02 A;  1U1T A;  4BI8 B;  4OMO A;  1M8M A;  4PJO A;  3NTI A;  2EQI A;  3TSZ A;  2QQ9 A;  3J7A F;  4XU1 A;  3VV0 A;  2DTO A;  2CS7 A;  4C92 G;  2QEX Q;  4LD9 K;  5LJ3 f;  1OPL A;  1MV0 B;  1KFZ A;  1YI2 A;  5IXF A;  2IG0 A;  3E9G A;  3CCL Q;  4PJO B;  5LL6 S;  2XG8 D;  4XU2 A;  4PJN A;  3JCM f;  3M0U A;  1UB4 A;  4X9C A;  1GBR A;  5GMK i;  1LOJ A;  2DL3 A;  2KAF A;  4KGV B;  3DLL A;  2DL7 A;  2XKO C;  4PK4 A;  1OUL A;  3CCU A;  4QVC A;  1AZE A;  3M0P A;  2D8J A;  1TUG B;  2QTV A;  4LDU A;  2JMA A;  3QXE B;  2OTL T;  1J3T A;  1QVF A;  1KQS A;  4IUP A;  5KCO A;  2CP5 A;  1JXO A;  5FRM A;  2BKD N;  4V2S A;  1YCS B;  2RNA A;  1YHQ A;  2ZPB B;  4BDZ A;  1PD0 A;  4BI4 A;  4OMP A;  5CVI A;  2WSC E;  4J9I A;  1RI9 A;  3H0F A;  3QZ9 B;  2RH2 A;  4IIO A;  4JPB W;  1QP3 A;  3OYK A;  1PRL C;  1K73 C;  1M3A A;  1I5O B;  4LNP A;  2LJ0 A;  1VQM T;  1Q81 U;  1PCX A;  3LH0 A;  3QG1 A;  2DRK A;  1QCF A;  5KYY A;  3A8O B;  2J7I A;  1AOJ A;  1IHV A;  1S72 A;  2DO3 A;  3CC7 A;  2JVV A;  4GBQ A;  5CKE A;  4HVU A;  2R57 A;  3MHX A;  4J9D A;  1OV3 A;  1VQ6 T;  2EQU A;  4HT9 A;  5LJ3 e;  1K0X A;  3M54 A;  3JCM X;  5KYY B;  3PIO A;  1BIA A;  4XTU A;  2CSI A;  3JB9 I;  2QDY B;  1NEB A;  3L2U A;  2F2V A;  1VUB A;  1AHJ B;  4J6Y A;  1TS9 A;  3CCU Q;  3V8L A;  4R0K A;  3H41 A;  2BTT A;  4M7D A;  4J7F A;  1EX4 A;  1MMD A;  3MJX A;  4C5E A;  4TVR A;  4EMH A;  2KE9 A;  5LJ5 f;  4M78 G;  4PJO E;  1AWJ A;  1IRX A;  3FLG A;  4WCI A;  3JCM J;  2CP2 A;  2X51 A;  1W4S A;  1NLP C;  3M9Q A;  2ABL A;  3E19 A;  2LRQ A;  2QEX T;  2C0I A;  1Q86 R;  1OU8 A;  5GAM h;  4BE1 A;  3L2Q A;  2K7A A;  3AHU A;  3PFS A;  3G6E Q;  3CCQ A;  3VUZ A;  3VYG A;  2A3L A;  2KI7 A;  5HCK A;  3GF5 A;  2ZPH B;  2JXB A;  2ED1 A;  2FYK A;  4HCB A;  3RKW A;  3OS0 A;  5FRO A;  4BB7 A;  3SFM A;  1HD3 A;  3RER A;  2F5K A;  4ESR A;  1X6O A;  1S72 Q;  2KRM A;  2EQK A;  1JBM A;  4RTT A;  4FL6 A;  3VJP A;  1VQ8 T;  3LLR A;  4OF1 A;  3CCV T;  2DJQ A;  4PJM A;  1KD1 U;  2P4T A;  2RJF A;  5IT9 E;  5A0D A;  1BB9 A;  3GIB A;  1VQL Q;  1TG0 A;  2YHT A;  2LNV A;  4QT7 A;  1VQO A;  1D1A A;  5GAN 7;  4FIB A;  4DOV A;  2VB6 A;  8ATC B;  4LDW A;  3EG2 A;  5GAN 3;  1Y07 A;  3CBP A;  2MOX A;  1WQ7 A;  1K9M U;  1SEM A;  4RTY A;  2MWO A;  4XTV A;  1Q82 R;  3EGD A;  5GAO m;  5CKF A;  2DFU A;  5LJ5 e;  4J9G A;  4HKE A;  2C0T A;  5FWB A;  4EDU A;  2F2X A;  3LYI A;  2XI9 A;  1SSF A;  1VOM A;  2JNG A;  3OYY A;  5GMK j;  4ELY C;  2NUZ A;  3TRE A;  1UGQ B;  3EGD B;  3TSW A;  4ZGD B;  4RMO A;  1M1K C;  1AZG B;  4HVV A;  1UE9 A;  3SHW A;  2HNI A;  3S6W A;  5IHN A;  3CEY A;  1O9S A;  2D8H A;  3L2R A;  2K2M A;  5I22 A;  1OOT A;  1YNZ A;  2KEA A;  4VUB A;  3UT1 A;  4BDY A;  4A53 A;  5GAM f;  2RA2 A;  1ZUU A;  1Z9Q A;  2LQ8 A;  2JTF A;  1M2O A;  2K5L A;  2KY9 A;  2VYT A;  3JSC A;  2OTJ Q;  4QQ6 A;  4E2F B;  1FXX A;  2FEI A;  2E41 A;  1JRI A;  4Y91 A;  3I56 Q;  3QII A;  1W2B S;  3CD6 Q;  3MO8 A;  4DBH A;  2DJZ A;  1I5L A;  2RHZ A;  1G3W A;  4FYX B;  5GMK l;  3G6E T;  2RJD A;  1OI1 A;  3C0C A;  2DAQ A;  1VQO Q;  5DY9 A;  1NJI C;  4JRQ A;  4LD6 A;  4HCK A;  2PVG B;  2COZ A;  2GF7 A;  2RI3 A;  3U23 A;  1TSF A;  4OMQ A;  2GFU A;  3THK A;  1FX7 A;  3OW2 S;  2PU9 B;  3RIR A;  1IXD A;  2JM8 A;  1F1B B;  5A2Q E;  4M7D G;  2GQI A;  3BDL A;  1UEB A;  3OYN A;  2ECZ A;  4RTZ A;  1G3T A;  4OMM A;  2XD0 A;  4QQD A;  2YLC A;  1BU1 A;  3ZEH A;  2GTO A;  4RKU E;  1OU9 A;  1H3Z A;  2K57 A;  2I2L A;  3PT9 A;  2RHX A;  3CCM Q;  1VQL T;  4IUQ A;  4KUD K;  3M0Q A;  4XU3 A;  4ZTF A;  4L5G A;  4AT1 B;  3OYF A;  4OGC A;  4CC4 B;  2MI6 A;  2LTO A;  1AT1 B;  4DQ2 A;  2LX9 A;  2DYI A;  5GAN g;  5GAN 4;  4MDW A;  1HXD A;  1TTH B;  1YIT Q;  4JRP A;  1ZA1 B;  1Y57 A;  5D6W A;  1HJD A;  4HXJ A;  2OAU A;  4DBF A;  1ZX6 A;  4WTO B;  2E6Z A;  2HKQ B;  1C1A A;  2A08 A;  2LMJ A;  1EZZ B;  4JJD A;  2NUP A;  1XTD A;  1IO6 A;  3QZ5 B;  4IUR A;  5D7U A;  2FL7 A;  5HKC A;  1IGQ A;  4UC4 A;  4CC2 A;  1MHN A;  1MND A;  2RM4 A;  1RAD B;  1TUD A;  2A36 A;  1NJI R;  1NYG A;  3OBW A;  2X4Y A;  1KQ2 A;  4IKF A;  2L0A A;  1QW1 A;  2LC4 A;  1Z9Z A;  4JUV A;  4FYV B;  2VGM A;  2DK3 A;  2NUP B;  1M1G A;  2RQT A;  2CUB A;  4FT4 A;  2FPF A;  1X69 A;  1AVZ C;  3DB4 A;  1SHG A;  1W2B A;  3I55 Q;  2CH4 A;  2OTJ T;  1MMA A;  2F1L A;  3J81 E;  5J39 A;  1XQH A;  4KH0 B;  4F7U F;  1WLP B;  3I56 T;  2CUD A;  3CD6 T;  1WHK A;  4EIK A;  2KRS A;  4E7K A;  2OTL A;  3ULR B;  4ZTJ A;  3QWX X;  3OYH A;  1N8R U;  4KT0 E;  2RK2 A;  3OYC A;  1QVF P;  1KQ1 A;  4F17 A;  4X34 A;  2PTK A;  3M53 A;  2ROL A;  2KT8 A;  3QJY A;  1ZUK A;  1AWX A;  3TU4 K;  1PHT A;  4EMG A;  1LVK A;  2EYW A;  4HT8 A;  1M90 C;  3VKI A;  3HL8 A;  1WNL A;  4O5V A;  1PKT A;  2FVU A;  5D6X A;  4JJC A;  1GRI A;  1VQM A;  1KD1 R;  3O5Z A;  3EFR A;  2CYZ B;  2FG0 A;  2KR3 A;  3A98 A;  3OYL A;  4BD3 A;  1TH7 A;  3CCM T;  2OI3 A;  3OYA A;  1G5V A;  5GMK e;  1VQ6 A;  3JB9 F;  2J6O A;  3MKD A;  1NEG A;  2DTI A;  1RAC B;  5LJ3 j;  1AD5 A;  1YBY A;  4M77 F;  1YIT T;  2AIR B;  2MWP A;  3MET A;  2MIO A;  3VYH B;  1YCY A;  3SDZ A;  4PNO A;  5GAM d;  4LN2 A;  2M02 A;  1YJW Q;  1VQK Q;  4AG2 C;  1CKA A;  1JXM A;  3EG1 A;  3QYH B;  2DXC A;  1M30 A;  2YUN A;  4N4I A;  2OTL Q;  2DVE A;  4IUU A;  1JB0 E;  2JTM A;  1VYT A;  2CZ0 B;  1X2Q A;  1KQS S;  1TU0 B;  1OQK A;  4M7A F;  4AFZ C;  8AT1 B;  1P92 A;  2K79 A;  1ZBX A;  2HMA A;  2QEX A;  2EKO A;  2CZ7 B;  3WVE B;  4E7H A;  2RHI A;  2FZG B;  1FMK A;  4JLI A;  5KE3 A;  2LVM A;  3MP8 A;  3J80 E;  1M90 R;  5A0G A;  1YFN A;  4C8Q G;  3I55 T;  2J06 A;  3BDU A;  2DXU A;  2HL3 A;  5CKB A;  3EFO B;  3EH2 A;  3A8H B;  4PJJ A;  3E9F A;  2LX7 A;  1UDL A;  2M9U A;  2KQW A;  3E1S A;  2AZS A;  3H9N A;  4RCB A;  3OBY A;  1QQJ A;  4A4G A;  5CO7 A;  4PLL A;  3CCV A;  3MEU A;  4C5I A;  3MEW A;  1Q7Y U;  4A63 B;  3HPW A;  3L2W A;  1QVG P;  2YUQ A;  1QKX A;  1D0Y A;  1E6H A;  1QCN A;  2DEU A;  2OJ2 A;  3QPH A;  3N5B B;  4JJN K;  4YTL A;  4GLM A;  4N4H A;  1X27 A;  4ORZ A;  2A28 A;  4ZGE B;  1D3B B;  2KGT A;  1RAH B;  3OQ5 A;  9ATC B;  5DM7 R;  5LJ5 j;  3EHR A;  4AFS C;  1QLY A;  2LJ3 A;  4QKU A;  1BCM A;  5LJ3 g;  3X24 B;  2EJF A;  2EKH A;  4DEY A;  1I81 A;  3I9Q A;  2DD5 A;  1JJ2 P;  2CDT A;  4NL2 A;  4JZ3 A;  3JCM g;  3I5S A;  2L3P A;  3EHQ A;  4ZN1 A;  3GLX A;  1YJW T;  1GCP A;  1VQK T;  1RUW A;  1PC0 A;  1TUC A;  1V29 B;  2SRC A;  3CCJ Q;  5KYN A;  1KC8 U;  3SEM A;  1UFF A;  3VS6 A;  2DET A;  2GFA A;  5KYX A;  1WQW A;  4OGE A;  1VA7 A;  2O4X A;  3FC3 A;  1TWB A;  1VQ8 Q;  1CSK A;  1Q86 C;  2V26 A;  4PFZ A;  3CCR Q;  3CCV Q;  4LUD A;  4C92 F;  1M3C A;  1H3H A;  4KBM B;  3CXC P;  3H0I A;  3CC2 Q;  3G6E A;  3QKJ A;  5KYX B;  2E1H A;  2KVQ G;  2Z0W A;  2DKG A;  2O4X B;  2HQE A;  1ACM B;  5FU7 C;  4XAX B;  1M2V B;  3HRU A;  1K9A A;  4ATO A;  1RAE B;  1C0M A;  5CK9 A;  2O9V A;  2K6D A;  4LUE A;  2GCX A;  2A7Y A;  1N8R R;  2QQR A;  1YWO A;  1K8A U;  2PUK B;  2XHC A;  2MAM A;  3P8H A;  3VU3 C;  1RAI B;  3SWN B;  3HKS A;  1BKB A;  3UA7 A;  2NLU A;  2XDB A;  2E64 A;  1M1K U;  2E5K A;  4M77 C;  3HRS A;  3OYD A;  2HSP A;  2ATC B;  2P0P A;  1GL5 A;  4JZ4 A;  1VQL A;  2VXE A;  3EG9 A;  3TCJ A;  2QYZ A;  1OX9 A;  2FZK B;  3JCM e;  2VVK A;  2CP3 A;  1AWW A;  2GTJ A;  2L3S A;  1RAB B;  2FO0 A;  5CAI A;  3M58 A;  2BIV A;  2EJG A;  3GP8 A;  2CT3 A;  1FMV A;  1GCQ C;  1Q82 C;  5AYF A;  2RHY A;  1RLP C;  4C0D C;  5GAM j;  1UEC A;  4HVW A;  1Y0M A;  4Y28 E;  5LJ5 g;  1UHF A;  3EG9 B;  1RLQ C;  1M27 C;  4BE2 A;  2CZ6 B;  3OMG A;  3VS1 A;  2HAX A;  3RKY A;  2P0Q A;  3OYE A;  2LZ6 B;  2LJ1 A;  5IN1 A;  4F16 A;  4JS5 A;  2DEQ A;  3C94 A;  4WF2 A;  1AWO A;  4RG2 A;  2VC8 A;  4JRI A;  2EW3 A;  1VQ9 T;  3JCM P;  3MPU B;  3CCJ T;  1A0N B;  1VQ7 Q;  3JB9 D;  3ZFJ A;  4CC3 A;  2FB7 A;  2R58 A;  1VQP Q;  4M77 D;  4PJO G;  1D1C A;  1SRM A;  2L3Q A;  2QGF B;  2XDD A;  2HQH A;  4CRI A;  2EAY A;  1X6B A;  2RF0 A;  4M78 F;  2OTJ A;  2EGA A;  1QKW A;  3CCR T;  3I56 A;  1SPK A;  4L59 A;  4L6V 5;  2RQV A;  3CD6 A;  5C6S A;  1N6A A;  2HEQ A;  2JTE A;  3KUF A;  3CC2 T;  5HK0 A;  3NGP A;  1BI3 A;  5IH2 A;  2DBM A;  2RQR A;  1ZSG A;  4F7U A;  4LE9 A;  4B9X A;  4XTZ A;  3M0T A;  1K76 A;  3CCS Q;  2FRW A;  4M7A D;  2YRD A;  2DMO A;  2YUP A;  3M0S A;  4CC7 A;  3OW2 P;  3PE0 A;  4Y92 A;  1LJO A;  2AHJ B;  2OX7 A;  2P4R A;  1DJ7 B;  4F7U B;  3CBM A;  3OA6 A;  4PJL A;  1X2K A;  4RTU A;  1Q7Y R;  2EGC A; 
#chains in the Genus database with same CATH homology
 1WIE A;  1TUD A;  2A36 A;  2J05 A;  1NYG A;  2EYX A;  1NYF A;  2GNC A;  2PZ1 A;  3QWY A;  2JM9 A;  3PVL A;  2LQN A;  4K11 A;  2L0A A;  1UG1 A;  1Z9Z A;  2HCK A;  2JMC A;  3VRY A;  3VS7 A;  2YUO A;  1KIK A;  2A37 A;  2RQT A;  1QWF A;  1WXU A;  2CUB A;  2FPF A;  1X69 A;  1AVZ C;  1SHG A;  1MV3 A;  3CQT A;  2CH4 A;  1ABQ A;  1MUZ A;  1I1J A;  2KT1 A;  2PNI A;  2I0N A;  1SSH A;  1WLP B;  1B3Q A;  3JV3 A;  1H8K A;  2CUD A;  1PKS A;  1NM7 A;  1LCK A;  1WDX A;  4EIK A;  2DM1 A;  2KRS A;  1HSQ A;  3ULR B;  1U3O A;  3QWX X;  3VRZ A;  2IIM A;  1VYV A;  2KNB B;  3NHN A;  4AG1 C;  2KBT A;  2LNH B;  4F17 A;  4DEX A;  3VS5 A;  1QWE A;  2PTK A;  2MCN A;  2ROL A;  3UA6 A;  2KT8 A;  1BBZ A;  1ZUK A;  3REB B;  1AWX A;  1PHT A;  2EYW A;  2KRO A;  4KRT A;  2DL4 A;  1ZBJ A;  4OMO A;  1M8M A;  1KSW A;  1PKT A;  2EQI A;  3TSZ A;  4JJC A;  1GRI A;  2O31 A;  2ROT A;  3EG3 A;  3O5Z A;  1EFN A;  2ESW A;  1JEG A;  2FG0 A;  2KR3 A;  3A98 A;  2B86 A;  1OPL A;  1MV0 B;  2BZX A;  2AZV A;  1KFZ A;  2OI3 A;  1YWP A;  5IXF A;  2KRN A;  4J9C A;  1JO8 A;  2J6O A;  2CRE A;  2YDL A;  3M0U A;  1NEG A;  2GGR A;  1GBQ A;  1AD5 A;  1GBR A;  2DL8 A;  2K9G A;  5FWC A;  2DL3 A;  2EGE A;  2MIO A;  2DL7 A;  2D0N A;  4E6R A;  4LN2 A;  1AZE A;  3M0P A;  2D8J A;  2JMA A;  4AG2 C;  2V1Q A;  4J9E A;  1J3T A;  1CKA A;  1JXM A;  3EG1 A;  1ZLM A;  1JXO A;  1M30 A;  1OPK A;  1ARK A;  2YUN A;  1T0H A;  1U5S A;  4Z89 A;  1WI7 A;  1S1N A;  1YCS B;  1VYT A;  2RNA A;  1X2Q A;  2DIL A;  5ECA A;  4AFZ C;  2K3B A;  2K79 A;  3TVT A;  3RBB B;  4OMP A;  4J9I A;  1RI9 A;  3H0F A;  2KXC A;  4IIO A;  4JPB W;  1CKB A;  2DE0 X;  1PRL C;  2FRY A;  1M3A A;  1K0S A;  1I07 A;  1FMK A;  4LNP A;  2LJ0 A;  2HDA A;  2JS2 A;  3EG0 A;  3PVQ A;  2DRK A;  4OMN A;  1QCF A;  2J06 A;  2FPD A;  2J7I A;  1AOJ A;  4GBQ A;  4HVU A;  1VYU A;  2CSQ A;  1W1F A;  1BK2 A;  2LX7 A;  2HBW A;  1OV3 A;  1V1C A;  2X3W D;  4J9D A;  3RNJ A;  4AFU C;  1UDL A;  2O2O A;  1H92 A;  1T3S A;  1PWT A;  5EC7 A;  2AZS A;  4F14 A;  1K4U S;  1K0X A;  3VS4 A;  2W10 A;  2SEM A;  3IQL A;  4A63 B;  2CSI A;  1NEB A;  1ZUY A;  2F2V A;  5I11 A;  2O88 A;  2YUQ A;  1QKX A;  1E6H A;  1U06 A;  5IHK A;  4R0K A;  3H41 A;  2BTT A;  1WA7 A;  2KE9 A;  2OJ2 A;  2BZY A;  2RQW A;  1XOV A;  1UTI A;  1AWJ A;  4WCI A;  4GLM A;  1GCQ A;  1X27 A;  2KXD A;  4ORZ A;  2A28 A;  1NLP C;  2ABL A;  2EVR A;  1GFD A;  2C0I A;  2CT4 A;  2KGT A;  2DVJ A;  2L2P A;  2K7A A;  2RMO A;  2O9S A;  3EHR A;  1I0C A;  4AFS C;  1QLY A;  5GJW B;  1E6G A;  4Z88 A;  2LJ3 A;  3NMZ C;  5HCK A;  2EKH A;  4DEY A;  2JW4 A;  2JXB A;  3I9Q A;  2ED1 A;  5GJV B;  3I5R A;  1T3L A;  2JS0 A;  1UJY A;  2CDT A;  2GBQ A;  1W6X A;  4JZ3 A;  3VS0 A;  2RN8 A;  3I5S A;  2L3P A;  3EHQ A;  1HD3 A;  1GCP A;  1RUW A;  1TUC A;  2W0Z A;  4ESR A;  2SRC A;  2C0O A;  2KRM A;  1WXB A;  4RTT A;  5IXB A;  3SEM A;  1UFF A;  1T0J A;  3VS3 A;  3VS6 A;  1AEY A;  4IIM A;  2VWF A;  2YT6 A;  2DJQ A;  1VA7 A;  1YP5 A;  2DL5 A;  1CSK A;  2F2W A;  2DLP A;  4LUD A;  1BB9 A;  1K1Z A;  2QDL A;  1TG0 A;  1ABO A;  1M3C A;  1H3H A;  4QT7 A;  3I35 A;  4ZNX A;  2LCS A;  3H0I A;  1WXT A;  3LH5 A;  3EG2 A;  2M0Y A;  2MOX A;  3UAT A;  2CH4 W;  1SEM A;  4RTY A;  2KYB A;  1SHF A;  1K9A A;  2LQW A;  5IHI A;  2G6F X;  4RTW A;  2O9V A;  2K6D A;  4LUE A;  2V1R A;  1JQQ A;  2BZ8 A;  4J9G A;  2M51 A;  3EGU A;  2C0T A;  1YWO A;  5FWB A;  2F2X A;  1UUE A;  2D1X A;  3UA7 A;  5L23 A;  2E5K A;  2OAW A;  2NUZ A;  2HSP A;  3TSW A;  4J9H A;  2LP5 A;  1AZG B;  4HVV A;  2FPE A;  4JZ4 A;  1GL5 A;  1UE9 A;  3SHW A;  5IHN A;  1NG2 A;  2D8H A;  2DRM A;  2K2M A;  5I22 A;  3VS2 A;  1OOT A;  3GBQ A;  1YNZ A;  2DBK A;  2KEA A;  3H0H A;  2VVK A;  1AWW A;  2ED0 A;  2DNU A;  2GTJ A;  2FO0 A;  2L3S A;  1ZUU A;  2RQU A;  1Z9Q A;  4D8D A;  4J9F A;  4RTV A;  3R6N A;  2FEI A;  4Z8A A;  3UF4 A;  1FYN A;  1G83 A;  2CT3 A;  2AKK A;  1GCQ C;  1RLP C;  1UEC A;  4HVW A;  1Y0M A;  1X6G A;  2DA9 A;  2EYY A;  1WYX A;  1UHF A;  1B07 A;  2H8H A;  4AFQ C;  1M3B A;  1RLQ C;  1M27 C;  1UHC A;  2XMF A;  4RUG A;  3VS1 A;  3ZL7 C;  2LZ6 B;  3C0C A;  2LJ1 A;  1G2B A;  2J6K A;  4HCK A;  4F16 A;  1GFC A;  3U23 A;  1JU5 C;  2X3X D;  3M0R A;  4OMQ A;  4FSS A;  3THK A;  2EBP A;  4D8K A;  1AWO A;  2JM8 A;  1N5Z A;  3NPF A;  1WX6 A;  2EYZ A;  2EW3 A;  2RPN A;  2GQI A;  1OEB A;  1KJW A;  1A0N B;  2ECZ A;  1NLO C;  2DYB A;  4CC3 A;  2KYM A;  4OMM A;  4RTZ A;  3KFV A;  1SRM A;  2L3Q A;  1BU1 A;  1UGV A;  2GTO A;  1WFW A;  1X6B A;  2RF0 A;  1X43 A;  2EGA A;  1QKW A;  1SPK A;  4JJB A;  2RQV A;  1PNJ A;  1UJ0 A;  3M0Q A;  1SRL A;  4J9B A;  1W70 A;  3FJ5 A;  2HEQ A;  2JTE A;  4CC4 B;  1PRM C;  2VKN A;  3NGP A;  5IH2 A;  2DBM A;  2DF6 A;  2J6F A;  2RQR A;  4X1V A;  1ZSG A;  4LE9 A;  2ENM A;  2AK5 A;  3M0T A;  1K76 A;  2FRW A;  1Y57 A;  2AKL A;  2DMO A;  1HJD A;  2YUP A;  3M0S A;  4CC7 A;  4M4Z A;  4HXJ A;  1ZX6 A;  1E7O A;  3PE0 A;  2EPD A;  4Y92 A;  2DX1 A;  2YSQ A;  3REA B;  2P4R A;  2A08 A;  4RTX A;  2LMJ A;  4OML A;  4JJD A;  1IO6 A;  1YN8 A;  5FW9 A;  2JT4 A;  1X2K A;  4CC2 A;  4RTU A;  2EGC A;  2NWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...