2ROLA

Structural basis of pxxdy motif recognition in sh3 binding
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
GSMGTAGKWVLCNYDFQARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of PxxDY motif recognition in SH3 binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/signaling protein
molecule keywords Epidermal growth factor receptor kinase substrate 8-like pro
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rolA00
5GJVB 2DNUA 5IH2A 2BZ8A 2LJ1A 2OAWA 1MUZA 4GBQA 3I35A 1SRLA 2DBMA 4IIMA 2A36A 1X43A 2RF0A 1WFWA 1IO6A 2DX1A 2GTJA 4RUGA 2PTKA 1X6GA 5IXFA 2DL3A 1PNJA 2JS2A 3ULRB 3RBBB 1JXOA 3VS3A 1BK2A 1NYGA 2YUNA 4J9FA 2D8HA 4KRTA 2ESWA 2EGCA 1K0XA 1YN8A 1X27A 1MV0B 2AZSA 4CC2A 3EG2A 3UATA 2O9SA 2L3QA 1RLPC 4AFUC 2DJQA 2AK5A 2CSQA 1G2BA 1E6GA 2KYBA 1SPKA 3M0PA 2DVJA 2GTOA 1WI7A 2JTEA 1GL5A 1BB9A 3NGPA 1LCKA 1T0JA 4WCIA 1NLOC 3JV3A 2CT4A 2PNIA 4HVWA 2DE0X 4J9IA 1M27C 1U06A 5IHKA 1Z9ZA 2LMJA 1VYTA 3VRZA 2ENMA 4LN2A 4DEYA 1ARKA 4JZ4A 2LJ0A 2OI3A 4ZNXA 3SEMA 2SEMA 2JXBA 2C0TA 2CDTA 1KFZA 2CREA 2RQTA 4GLMA 2MIOA 3R6NA 3LH5A 1GFCA 2FPEA 1UJYA 2RQRA 1JU5C 1Y0MA 2O2OA 3U23A 2G6FX 3VS1A 2YUQA 2FG0A 2CUDA 1WX6A 1YCSB 2LCSA 1X6BA 3C0CA 4Y92A 2EKHA 1Y57A 1PWTA 2E5KA 2L0AA 2DYBA 1SEMA 1I0CA 2X3WD 1PRMC 2LP5A 1PKSA 2KRSA 2FPFA 1ZBJA 4AG1C 1M3AA 4D8KA 1ZUYA 1QCFA 3KFVA 2C0OA 1G83A 1QLYA 1BBZA 2F2VA 1RUWA 4J9GA 5IXBA 2L2PA 4K11A 1AZGB 2CH4A 4HVUA 4R0KA 2DILA 3H41A 4EIKA 2KBTA 1M3CA 2DRMA 2K9GA 2MCNA 3UA6A 2CH4W 3EGUA 2V1QA 4AFSC 1B07A 3QWXX 2YUPA 4FSSA 1UFFA 2DL8A 1K0SA 1AVZC 4J9EA 4M4ZA 5L23A 2ROLA 2ROTA 3UF4A 2JMAA 2M0YA 5FW9A 1AEYA 2J7IA 3M0UA 2RQVA 2V1RA 3TSWA 1OPKA 2FO0A 5FWCA 1M8MA 2LX7A 1AOJA 2EVRA 3I9QA 2K3BA 2AKLA 2KE9A 1SRMA 3NMZC 2DRKA 4JJBA 4X1VA 2KR3A 4RTTA 4RTVA 2AZVA 1NM7A 2EW3A 3EHQA 1K4US 2L3SA 4HVVA 2CSIA 1ZUUA 1XOVA 4JPBW 4Z88A 1WA7A 1TUCA 2DL7A 5HCKA 3VRYA 1SHGA 1NYFA 2K7AA 3M0QA 2KRNA 1GCQC 3THKA 1Z9QA 2W10A 4F17A 4E6RA 1OOTA 2QDLA 2EGEA 2J6KA 2JS0A 4JJDA 3H0FA 2J6OA 1GRIA 2EPDA 5I22A 3TSZA 3VS2A 1UTIA 1HSQA 1U3OA 2AKKA 1KSWA 1H92A 2YDLA 3M0TA 1FMKA 1GCPA 1AWOA 2YT6A 2A28A 2F2WA 1K76A 1ABOA 4LNPA 1H3HA 1BU1A 1E6HA 1VYVA 1AD5A 2X3XD 1YWPA 5FWBA 3PE0A 4Z8AA 3VS7A 1X2KA 2BTTA 1T3SA 1VA7A 4LUDA 2BZYA 1HJDA 2HCKA 2KXDA 1QKWA 1UGVA 5GJWB 2JT4A 2MOXA 1WXUA 1W70A 4A63B 1T3LA 2XMFA 4CC7A 2CUBA 2KEAA 3VS4A 2I0NA 2K6DA 3H0IA 3VS0A 1NG2A 1WDXA 1MV3A 1JEGA 3VS6A 1SHFA 2DMOA 1GBQA 1SSHA 2P4RA 3A98A 2KROA 2BZXA 2LNHB 2VVKA 4RTYA 1VYUA 2ECZA 3IQLA 2LQNA 3PVQA 1UECA 2DBKA 2HSPA 1UHFA 5EC7A 2KRMA 2SRCA 2RPNA 4OMMA 2LZ6B 1EFNA 4RTZA 2OJ2A 2HDAA 4CC3A 4LUEA 1B3QA 3M0RA 2GNCA 3QWYA 1AWJA 1RLQC 1NEGA 2ABLA 2J6FA 3O5ZA 2NUZA 2RN8A 3GBQA 1NLPC 4OMNA 4RTWA 2FRYA 2RNAA 2O31A 2VKNA 3EG0A 3I5SA 4IIOA 4J9DA 4D8DA 3VS5A 1UDLA 1PHTA 1WXBA 3PVLA 2GBQA 2YSQA 1UE9A 3SHWA 1QKXA 1W1FA 1QWFA 1ZUKA 2YUOA 1OPLA 2VWFA 2L3PA 4J9BA 2CT3A 2B86A 3ZL7C 2JM9A 1YWOA 1ZLMA 2EYZA 3NHNA 1CSKA 4OMOA 2JMCA 2KT8A 2RMOA 2RQUA 1OEBA 1WLPB 3REBB 2W0ZA 1UJ0A 4HCKA 1K9AA 2D0NA 1H8KA 2ED1A 4F16A 1GBRA 1JXMA 2JM8A 1I1JA 1KIKA 1UHCA 2NWMA 5ECAA 2PZ1A 4DEXA 2FRWA 5IHNA 1J3TA 2DLPA 1ZX6A 4RTXA 2EGAA 4AG2C 2J06A 1CKAA 1X69A 1E7OA 1TG0A 1JQQA 3H0HA 4F14A 1UG1A 2RQWA 1U5SA 2FEIA 2DM1A 2D1XA 2EYXA 3REAB 4LE9A 1NEBA 1WYXA 3EG3A 1M30A 4Z89A 3EHRA 1YP5A 1RI9A 2EBPA 2HBWA 2HEQA 4AFZC 2A08A 1AWXA 2O9VA 3UA7A 3TVTA 1CKBA 2JW4A 2M51A 1ABQA 2K2MA 2KNBB 2DA9A 3FJ5A 1PRLC 4J9HA 2A37A 2EQIA 4OMQA 1GFDA 1PKTA 3EG1A 2KT1A 1K1ZA 2H8HA 2KXCA 1FYNA 1YNZA 1AWWA 1KJWA 2IIMA 1N5ZA 4HXJA 4QT7A 1X2QA 3M0SA 1M3BA 4JJCA 2GQIA 2LQWA 5I11A 2EYYA 2DL5A 2F2XA 2KGTA 2O88A 1ZSGA 4RTUA 1OV3A 1I07A 1W6XA 2LJ3A 5IHIA 2ED0A 3NPFA 4ORZA 1JO8A 1TUDA 3CQTA 1GCQA 1WIEA 1V1CA 1AZEA 1UUEA 4J9CA 2GGRA 1T0HA 4OMPA 3RNJA 1HD3A 1A0NB 4OMLA 4CC4B 1WXTA 1QWEA 2J05A 2DF6A 4ESRA 2D8JA 1S1NA 4JZ3A 2FPDA 3I5RA 2EYWA 2DL4A 2K79A 2C0IA 2KYMA 4AFQC
chains in the Genus database with same CATH superfamily
5GJVB 2DNUA 2E70A 2RA2A 5I2MA 4IUVA 1LVKA 3RKWA 3I35A 1SRLA 2DTOA 3OS1A 3M55A 4E2FB 2QGGA 2A36A 1X43A 2DZCA 4EPCA 5IXFA 3MCAB 1ZSZC 2EKOA 3EGDA 3E19A 5HK3A 3QYHB 1NYGA 2YUNA 2JJ9A 4PFZA 2OX7A 1K0XA 1YN8A 1X27A 4BUGA 2V8IA 4CC2A 4XTZA 4AFUC 2QQAA 4DQ2A 3OBYA 1E6GA 2DK3A 3GNFB 3FC3A 2GTOA 4DBRA 4C8QC 5GAOr 2E3HA 4QQ6A 1QCOA 1KQSS 2WSEE 2K2VA 1KHIA 1RAIB 2RB6A 2YRDA 4FIBA 4KGXB 4C0ZA 2LJ0A 4OF1A 2OI3A 4ZNXA 3SEMA 3JCMV 4BE0A 1VQ6A 2ZZDA 4M77A 1KFZA 3LH5A 3BW1A 1LPLA 2O01E 1YJ9T 2YRCA 2K3YA 1M1GA 5IAYA 2FG0A 2M16A 1YCSB 2LCSA 3EGXA 4C8QD 3C0CA 4Y92A 2P0QA 1Y57A 1PWTA 4MMLA 4N4HA 1Y07A 4M7AD 1NPPA 3CD6T 2LP5A 4KH1B 1PKSA 3WVDB 5LJ5h 1ZBJA 1Q95G 3KFVA 4QW2A 5LJ3e 4MMKA 2HD0A 4A4FA 2C0OA 1FMWA 3V8LA 3FLGA 2LT1A 4J9GA 2BE9B 3X20B 5GAMd 4DOWA 4R0KA 1K8AC 2P84A 4M7DD 4JDSA 4C92A 2COZA 3L42A 2L89A 2RHXA 4XTUA 4C92C 2DRMA 2K9GA 2YLBA 3RESA 3M56A 4C5GA 3UA6A 2X4XA 4KBMB 2OTJQ 2EQJA 3EGUA 2BKDN 4PJOC 3CCJA 2YUPA 2DL8A 2NYSA 4OMFB 4C92D 3LLRA 3QZ5B 1RI0A 1VQOQ 2M0YA 5FW9A 1VQ4T 3CCEQ 1AEYA 1JBMA 1VQ9Q 2KAFA 4QKUA 2RQVA 1RADB 2LQ8A 3FRNA 3R6OA 2KR3A 2EQMA 4FYYB 4FW2A 2CP2A 2HQXA 2XK0A 2M0OA 1F1BB 3EG9B 1VIEA 2YXYA 1D3BB 1ZUUA 1KQ2A 1VQ4Q 2AIRB 2RI2A 1VQMT 4M77C 3A8LB 4PLIA 2CGHA 4HCCA 1MMGA 1YBYA 4M7DA 2HKQB 5LJ3f 5CR2A 2W10A 3P8HA 1OOTA 3CC4Q 2LX9A 2J6OA 3RUXA 2XD0A 2KY9A 1QQJA 1KHCA 2DEUA 1H92A 2YDLA 3C95A 2GCXA 2JUFA 1BI2A 2K5LA 3MEVA 2F2WA 4LNPA 1BU1A 2CYZB 1VYVA 5GAOq 2MYSA 3PE0A 4Z8AA 1X2KA 1QVFS 3FB9A 5A0DA 4FT2A 1HJDA 2HCKA 2KXDA 3OYNA 3CCLA 1UGVA 2JT4A 3WXMB 1IREB 1ZA2B 2MOXA 2LNVA 4PFOA 1WHLA 1M2OA 3JCMW 1W70A 1T3LA 2WSFE 3C94A 2KEAA 2MWPA 4DA4A 5FU7B 4JRKA 4M78A 3VS6A 2P4RA 1IRXA 2QQSA 2LNHB 2EIFA 3HKSA 2RHYA 2LQNA 3PVQA 2R58A 2RPNA 3M58A 4OMMA 4LDXA 5FU6C 2LZ6B 1EFNA 2ZPFB 3X25B 3VUBA 5GAMe 2OJ2A 1YJ9A 2I2LA 4LUEA 3M0RA 3V7SA 4C0DB 4E7HA 3QWYA 1NEGA 2ABLA 2NUZA 1WQ7A 2F5KA 4C92F 2BUDA 4M78E 3GBQA 4OMNA 1YITA 4IKFA 3JB9H 5GMKm 4J9DA 4IIOA 3I5SA 2HSEB 3CCMQ 3OBWA 1UDLA 3BDLA 4FM4B 4C92B 2GBQA 1OU8A 5GMKi 5GAOl 1VQ8T 4MDXA 1X01A 1NZ9A 1ZUKA 1VIFA 4C5IA 5CO7A 3JB9D 4CI0C 3O8VA 1YWOA 1JJ2P 2VC8A 1QCNA 3CMAQ 1VUBA 3G6EA 2JMCA 1VQLT 2KT8A 3MHXA 2RMOA 3PT9A 2RQUA 3FDRA 1WLPB 2HKNA 1K9AA 3OYEA 1I1JA 3BY7A 2K4YA 1WZOA 5ECAA 2PZ1A 1VQ8A 5CQYA 2FRWA 1J3TA 1IGQA 3SFMA 3DB4A 4KT0E 2DETA 1R8OB 1RACB 1JQQA 4PK4A 3V8JA 1U5SA 4A4EA 3HHTB 4M78D 3REAB 1C1AA 4NL3A 1M30A 1ACMB 3CC4A 4Z89A 2XDPA 3EHRA 1RI9A 2HL3A 4PJOA 4QVZA 1FX7A 2O9VA 2P4TA 1YI2T 2IG0A 4HA8A 3EFSA 4XTYA 2JW4A 2FYKA 2M51A 8AT1B 1PKTA 3EG1A 4ZN1A 1R0BG 3F70A 4PJNA 2FB7A 1M2VA 3CCJQ 4C8QB 2KT1A 3E9FA 2H8HA 2K5IA 2KXCA 1FYNA 1WNLA 1KJWA 3JAME 2LVMA 2NUPA 3JCMe 3BE3A 3A8MB 3M0SA 3OW2P 3QKJA 5FRNA 3DLLA 2VYTA 2GQIA 3CCVA 1H3ZA 2DVEA 3CCLT 4LDWA 2E12A 2LQWA 2EYYA 2A0FB 4RTUA 4OB3B 2QK0A 5IHIA 2ED0A 4C0DC 5IN1A 3CC7Q 3DB3A 4M7DB 1GCQA 5D6XA 1WIEA 1AZEA 3CC7A 5GAMf 4J9CA 2XDDA 4PJOF 1T0HA 4Z02A 4DBHA 3I56Q 1NPRA 4CC4B 4ELZC 2XG8D 4ESRA 2D8JA 1S1NA 4JZ3A 5GAMj 3I56A 2FPDA 4BE2A 2JTMA 3OB9A 3PIPA 1MMAA 4BACA 2VXFA 4J7FA 1LJOA 1FMVA 3J80E 4J6XA 2RF0A 1WFWA 3FIFA 1IO6A 2DX1A 4RUGA 4C92E 3TQ7P 3OW2A 1G3YA 3RBBB 4BI8B 2R5MA 4XTWA 1KD1R 1VQ5T 3TREA 5GAN6 2EGCA 1QVGA 2JVVA 2OTLT 3CCMT 4F7UE 1NBEB 3A5ZB 1RLPC 2LTOA 2CSQA 4TVRA 3CMAA 4RG8A 2KYBA 2QEXQ 2QQBA 3JB9J 1KD1U 2RHIA 4II1A 4ATOA 1WI7A 1Y71A 2EFIA 3OMGA 4BDYA 2Y4XA 3QUIA 1BB9A 1V76A 2F5TX 4L59A 1M90U 1OU9A 1JRIA 2CT4A 2CP5A 1M9SA 3EFOB 4FYVB 3OYYA 1M27C 5GMKj 4JRPA 1U06A 1GXIE 2YWWA 1Q81U 2LMJA 1VYTA 4OP0A 1D1AA 2ENMA 1ZHIA 2GF7A 4DEYA 3ZEHA 4JZ4A 3OYCA 4FYWB 1W2BS 5CVIA 1EIFA 5KYWA 4L5GA 2LQKA 2C0TA 2RQTA 3CXCA 1YJ9Q 3R6NA 4M77G 3OYKA 1GFCA 1Q7YR 1UJYA 1JU5C 1RAFB 1Y0MA 4PJJA 3UWNA 5CKFA 1D1CA 3QDFA 3OYLA 2YUQA 2OTJT 4X34A 4RCCA 1U1SA 2L0AA 1SEMA 5HKCA 1KD1C 1JJ2A 1SF9A 1I0CA 3MP8A 2CS7A 4OVAA 1MNEA 3JCMJ 4QQDA 1M3AA 4D8KA 3CCQT 1ZUYA 1QCFA 4QQGA 3LW5E 1UGQB 1N6AA 1Q86U 5KYUA 2F2VA 5IXBA 2L2PA 1PCXA 4K11A 1TSFA 4XQ3A 3V7RA 2NUPB 4N4IA 2DILA 3H41A 3UT1A 5J39A 3J81E 3JCMg 4C92G 3ZFJA 2CH4W 1M8VA 3Q1JA 2C06A 1UB4A 2L3RA 1VQNT 2AHJB 4M7DC 1K0SA 2QQRA 2MWOA 5KYNA 5GAN5 4J9EA 3WVEB 1D1BA 3CCUQ 1R77A 2LC4A 3UF4A 1TTHB 5GAN7 2LCLA 1YHQQ 3M0UA 3TSWA 3CBOA 1IXDA 1M8MA 3CCET 4FCYA 1AOJA 2EVRA 2QTVA 2K3BA 1SRMA 4JJBA 4M78C 2WACA 3CCVT 4RTVA 4B9WA 1MMNA 1RL2A 2CZ0B 4N4GA 3QXEB 2XHCA 2HAXA 1XOVA 3A8OB 1WA7A 1BIBA 3S3NA 5HCKA 2K7AA 1MGQA 2KRNA 1GCQC 4B9XA 3AHUA 2V8KA 1Z9QA 4OGEA 4F17A 2NUTB 2JS0A 4JJDA 3VJPA 4ZN3A 1GRIA 5KYXB 3KBGA 3L2ZA 3N5BB 2PVDB 3VS2A 5KYXA 3HP9A 1YIJQ 2DEQA 5KE3A 3OYMA 4A54A 1IHWA 4ZTJA 3PNWC 1GCPA 2QA4A 1AWOA 4ZTFA 2A28A 3X28B 4MDWA 2KQWA 3CCLQ 1WPYA 1YI2A 1YWPA 2KSSA 5FWBA 3M54A 3VS7A 1T3SA 1VA7A 2VXEA 1HYOA 3DKMA 4XU0A 1YIJT 1NE8A 2RJCA 1K9MR 3QO3A 5IT9E 3E1SA 1WXUA 4HCZA 4LDYA 4C5HA 3I55T 2DIGA 2OAUA 2XMFA 2F1LA 3OYDA 3G6ET 2K6DA 3H0IA 2MPXC 5FRMA 2XI9A 1O75A 2DMOA 1GBQA 1SSHA 2EQUA 4AMCA 1OQKA 4PJOD 3OY9A 1WHMA 1IZ6A 4BDZA 1VYUA 2LRQA 1UECA 3CCSQ 5EC7A 2E1HA 3RDVA 3BDUA 2SRCA 1PC0A 3E9GA 4NOYA 3CXCP 3OYFA 1YJNT 2D9TA 4RTZA 4JLGA 4UC4A 5GAN2 1VQMA 5I2SA 2GNCA 5I21A 1QVPA 1RLQC 2J6FA 3HTRA 3O5ZA 2RN8A 1NLPC 5GANe 2PVOB 1XNIA 4A4HA 5CCAA 3HFNA 3VS5A 2DFUA 4IURA 2O4XA 4Y28E 2RO0A 4VUBA 2D6FA 4M78B 1W1FA 4M75F 3SDZA 1OPLA 2ZAEA 2VWFA 2HL5C 2CT3A 3OSVA 2KK4A 1ZLMA 5D6YA 1WHKA 1KK7A 1ZSZA 4OMOA 2HQHA 5CKHA 4KUIA 4EMGA 4HT8A 2W0ZA 4HCKA 1UJ0A 4X9DA 1Q82U 1H8KA 2GQVA 1GBRA 2PUOB 1KIKA 1UHCA 3SWNC 1Q82R 1S72T 3QHSA 3H8ZA 3CMET 1K73R 4RCBA 1ZX6A 1M5Q1 3X24B 4RTXA 4AG2C 2BE7D 1CKAA 1X69A 2Y4YA 4XU3A 1TWBA 3GIBA 1RAAB 3H0HA 3LGLA 3JCMd 3M57A 4NL2A 3QJ6A 2FL7A 2DM1A 4XU2A 4LE9A 2DIQA 4HKEA 3EG3A 2RJDA 5AYFA 2HEQA 2COWA 3RIRA 3QJYA 1BYMA 3UDCA 2X35A 4BY6B 2PU9B 1PD1A 2OTLA 1MNDA 1ABQA 5A0LA 2KNBB 4JRIA 3EFRA 1UEBA 4J9HA 2EQIA 4OMQA 4MZTA 3HRUA 2DXTA 3MO8A 4OB2B 2DD4A 1M1KR 5GAMh 3CPWP 3G71A 1KG1A 2K5FA 4E7KA 1N5ZA 1BI1A 2FZCB 3OYHA 4QT7A 1V29B 1I5OB 1AHJB 4EMHA 4BI4A 2QXFA 1XJWB 2O88A 4PJOB 1OV3A 4IUTA 2YRVA 1JO8A 3JCMh 2HQEA 2M1HA 3QYGB 3FEOA 4PJMA 3HPWA 2VB6A 2NUTA 1VQKT 1A0NB 1VQLA 1YJWT 1WXTA 3G71T 2J05A 4GLKA 2DF6A 1WHGA 3G1JA 3PFSA 2DL4A 3CCQA 2VGNA 2E10A 3ZBDA 3ASKA 1S72Q 3UPUA 1FXXA 2YLCA 4IIMA 2P0KA 5CKDA 1VQ9A 1X6GA 1OYXA 2NLUA 1K8AU 1PNJA 2JS2A 4LDUA 4RG2A 1JXOA 3VS3A 4BD3A 1XTDA 3M4YA 1HXDA 2ESWA 4M77E 2KI7A 3EG2A 3UATA 2L3QA 2FZKB 2DJQA 1G2BA 1M90R 4M7AA 1B34B 2DVJA 4C8QF 2ZGWA 2R5AA 3CD6Q 1M1KC 2DXCA 3OA6A 1GL5A 3MEWA 1T0JA 2PVGB 5CAIA 3G4SQ 4J9IA 3OS2A 2PQWA 3QDRB 4E7JA 2RI3A 2ZPIB 2RJEA 3VYGA 5IHKA 2JNGA 5GANj 1OX8A 4BY6C 3D7SB 3PMIA 2F69A 2SEMA 4E47A 1W2BA 2CREA 2MIOA 2CP6A 4XU1A 1VQ7A 2FPEA 2RQRA 1D0YA 3LGFA 2O2OA 1X75C 3U23A 2G6FX 1KQSA 2DTHA 3VS1A 4N0AC 1WX6A 3SWNA 2VUBA 2H3EB 1X6BA 4M78G 2ATCB 3SWNB 3EFOA 2M9UA 1S72A 1VQ6T 2ZPGB 3V8KA 3CMAT 1VQ8Q 1PRMC 3T9NA 4ZGEB 4GY5A 2DERA 2KRSA 4AG1C 3L2WA 4A4GA 4XTXA 5GAOp 5LJ5d 5KYWB 1NJIU 5CKEA 2CH4A 2CKKA 4HVUA 2CP7A 3GOXA 1QP2A 2KBTA 1M3CA 3L2VA 4EDUA 2E6ZA 2RI5A 1BI0A 2V1QA 1B07A 5GANd 4YTLA 3E2UA 3QWXX 2COYA 3I55A 3OQ5A 3PTAA 2FVUA 3MP6A 5GANh 2VGMA 3MKDA 5L23A 3HSBA 2ROLA 1C0MA 2JMAA 4DOVA 1SG5A 4F7UF 2J7IA 2V1RA 1YFNA 5FWCA 3S3MA 1YJNQ 4HCBA 2RHUA 3CPWS 3I9QA 3G71Q 3VV0A 4JLIA 2AKLA 2KE9A 2RK2A 2DRKA 1VQNQ 1NM7A 3JCMf 1D3BA 1W2BP 2L3SA 2XDBA 4HVVA 1TXQA 2CSIA 4M7AG 2Y90A 4JPBW 2R57A 4Z88A 4M7DG 1Q7YC 1TUCA 2DL7A 2QQ9A 3VRYA 1SHGA 3M53A 2VV5A 1NYFA 2V8JA 1NJIR 2L8DA 3THKA 3GLXA 4J5YA 4BE1A 3CCVQ 3CCRQ 4C0GA 2QDLA 2EGEA 2J6KA 4RKUE 1R0CB 3CEYA 2DZ9A 4C8QE 2EPDA 1BCOA 5I22A 5LJ3j 2DPPB 1U3OA 4V2SA 1OX9A 1UGSB 2DYIA 1I5LA 3HRSA 3MEUA 2XU8A 2YT6A 5FU7C 1K76A 1VQ9T 1E6HA 1U1TA 4M75C 3CC4T 1NJIC 5C0MA 1AD5A 2X3XD 3OYBA 1IGUA 2BTTA 2L5QA 4LUDA 3X26B 1K73C 2BZYA 4XK8E 3M4GA 1Q82C 1X6OA 3ME9A 4M7AF 1G3WA 2LDMA 1SKUB 2AT1B 3EGDB 1MHNA 1TU0B 4A63B 4PL6A 3HL8A 3VS4A 1AT1B 2RD1A 3EH2A 2I0NA 3VS0A 1WDXA 4BI3A 1MV3A 1JEGA 1PG5B 1SHFA 1TS9A 3OYJA 3A98A 2KROA 2RHZA 1G3SA 2EAYA 3INZA 2QTXA 1BIAA 4DBQA 3OYGA 2ZCFB 3IQLA 3EGXB 5LJ5e 2DBKA 4DBFA 1KQ1A 3URGA 9ATCB 1TOVA 1B7TA 5LJ5j 3OYAA 4CC3A 1B3QA 1VQOA 1WJRA 4J6YA 2HNIA 2HZYA 1AWJA 2Z0WA 3H6ZA 1KC8C 4RTWA 1Y96B 2RNAA 5L8RE 3S6WA 5GAN4 1QVGS 4WF2A 3EG0A 3CCRA 4Y91A 5EG2A 4JRQA 2PUKB 1QMCA 1UE9A 1QKXA 2QEXT 1QWFA 2YUOA 5GAOm 2ZPBB 3CCUA 4HT9A 2IVWA 4J9BA 1P92A 2A7YA 1LOJA 2QA4T 2EYZA 3NHNA 1CSKA 3V7CA 3JCMc 2DO3A 3C12A 4NS5A 1OEBA 4F16A 2D0NA 4PFPA 4RMOA 4CRIA 1JXMA 4X9CA 3TEEA 2IPOB 2NWMA 3QBYA 4XAXB 5IHNA 1D0ZA 4M75D 1IHVA 1E7OA 3RMSA 1TG0A 5J3BA 2RQWA 2FEIA 2KMTA 2D1XA 3P8BB 4FL6A 1NEBA 2K57A 4OB1B 4LD6A 1YP5A 2EBPA 2HBWA 1YJWA 2A08A 1PD0A 1AWXA 4FYXB 3OS0A 3UA7A 2X4JA 4OB0B 2QDYB 3A8GB 1VQPA 3FJ5A 1VQPT 5KH6A 4AT1B 4C8QA 2QGFB 1GFDA 4IUQA 4M75E 1YJNA 5KYUB 2ZPHB 1VQNA 1YNZA 1D0XA 3CC7T 2IIMA 2RM4A 2RJFA 4C5EA 4HXJA 1Q7YU 2CP0A 3OMCA 3KUFA 3CPWA 5GAOn 1M3BA 4JJCA 2DKGA 2WSCE 5I11A 1QVFA 1EZZB 2DL5A 2YHTA 5C6SA 1I07A 3JRZA 4ELYC 3NPFA 4ORZA 4N0AA 3JCMb 1TUDA 1U8RA 2JOYA 1OULA 4KH0B 1K8AR 4ME7A 1VQ7T 1BKBA 2LCCA 3I55Q 2K3XA 5HY6A 5A0GA 1HD3A 3CC2A 1H641 5GAN3 1VQLQ 1I4K1 3QG1A 2MAMA 2X51A 1OI1A 4LDVA 2HMAA 5GANf 2QYZA 3L1AA 2C0IA 2KYMA 2H3JA 2DD5A 5IH2A 2BZ8A 2LJ1A 2OAWA 1MUZA 4GBQA 3CD6A 2DBMA 4E7IA 1QVFP 2GTJA 3JB9F 2PTKA 2CZ7B 4C8QG 3GP8A 4C0FA 2DL3A 2E3IA 3CCRT 2E41A 1RAHB 3ULRB 4O6JA 3GF5A 5LJ3d 1BK2A 1IB8A 1VQ7Q 4J9FA 2D8HA 3L2RA 4KRTA 1YIJA 1MV0B 2AZSA 2O9SA 2E64A 1YJWQ 2AK5A 1UGRB 3CMEA 1SPKA 3M0PA 4M75G 2JTEA 3CCUT 1VQPQ 3NGPA 1LCKA 3VKIA 3CCQQ 1K9MU 2DXUA 1NLOC 4WCIA 3JV3A 2PNIA 3M59A 4BB7A 4HVWA 2DE0X 1KC8U 1Y7XA 1G5VA 1Z9ZA 4FW1A 3CCMA 1QP3A 1WGSA 4M7AE 3VRZA 3LWHA 4LN2A 5GMKe 1ARKA 1JJ2S 1EX4A 1N27A 3JB9G 3CCST 2JXBA 1M90C 2EWNA 2CDTA 4GLMA 4EMKA 1I81A 2QAZA 4XTVA 4EMKB 4QVDA 1B34A 3MEAA 1DJ7B 4LD9K 2CUDA 5AT1B 3G7ZA 4E7ZA 1YHQT 1PSFA 5D7UA 2EKHA 2E5KA 3LYIA 3JCMX 2DYBA 2E5QA 1N8RU 5M9OA 2VASA 2X3WD 5KCOA 2FPFA 1HK9A 3QIIA 3VYHB 4IUUA 4R55A 5D6WA 1G83A 1M2VB 1QLYA 3NFCA 4PKCC 1BBZA 3JCMQ 3BFMA 1RUWA 4PJOG 4L6V5 3OW2S 4JS5A 7AT1B 1AZGB 3TU4K 1WQWA 1N9RA 3A1PA 1VQ6Q 1TH7A 3EG9A 4EIKA 5CIUA 2MCNA 6AT1B 8ATCB 4P5NA 4M77D 3LX7A 1O9SA 4AFSC 2QI2A 2FZGB 5A2QE 4F7UB 4FSSA 1UFFA 5GAN8 3EH1A 1AVZC 4MZMA 2XKOC 4M4ZA 4F7UA 2ZPEB 2ROTA 5GMKh 5CKBA 1VQMQ 4J7IA 2EJ9A 3G4ST 2QEXA 2RH2A 1OPKA 2FO0A 2LX7A 1WHJA 2EYQA 4X1VA 3NMZC 4RTTA 3EAEA 2AZVA 1Q81C 2M02A 2GFAA 4JS4A 2B8AA 2X4WA 4Q5WA 5CQXA 2EW3A 3EHQA 5LJ3h 4F7UG 1K4US 4J83A 4O5VA 4PLLA 1G8XA 3H9NA 1VQOT 1WHHA 2EQKA 1UGPB 3VU3C 4KUDK 1RAGB 3M0QA 1SSFA 3CCEA 4E6RA 2DTIA 3H0FA 2LT4A 5LL6S 3TSZA 1UTIA 5FU6B 1HSQA 2AKKA 5KCHA 5KE2A 1KSWA 3G6EQ 4E7LA 3M0TA 2RK1A 1FMKA 1XQHA 3CBPA 1VQKA 4M7AC 1K73U 1ABOA 4FSXA 4KGVB 4KGZB 1H3HA 1W4SA 4LXCA 1BI3A 3S3OA 2HBPA 2OTLQ 4JUVA 1Q86C 2QG9B 3LH0A 4FU6A 5GANg 4OGCA 3PIOA 5LJ3g 1QKWA 5GJWB 5KYYA 3SD4A 4A4KA 1Y96A 4PJLA 2MK5A 5DLQE 4CC7A 3HFOA 2CUBA 4M7AB 3MPUB 1NG2A 2MMPA 2DJZA 2BIVA 1VQ4A 3CCJT 1G3TA 3J7AF 1OZ3A 4J6WA 4EMKC 3NTKA 3KXTA 2BZXA 1N8RC 2DAQA 4PJOE 2VVKA 4B6MA 4RTYA 2ECZA 3L2UA 3RERA 2HSPA 1UHFA 2KRMA 1YCYA 2MF2A 4QVCA 1VQ5Q 2E65A 4M77F 3L2QA 2P0PA 3RMQA 5FROA 2GFUA 3ER0A 2HDAA 1KC8R 3C4SA 3PMTA 4M75A 5DY9A 2DXBA 1RAEB 1ZBXA 2EJGA 4M77B 4ZGDB 2KDSA 3META 2FRYA 1D09B 4M75B 2O4XB 2O31A 4R56A 1BCMA 4A53A 2VKNA 4D8DA 4FT4A 3JB9I 1PHTA 1WXBA 5GAMg 3PVLA 2OTJA 2YSQA 3SHWA 1VOMA 2E6NA 4MZPA 4M7DE 1YHQA 2L3PA 3HRTA 2B86A 3OSSC 3ZL7C 5CK9A 3MJXA 2JM9A 4ANJA 2QASA 1VQKQ 1K9MC 1PSEA 2FHDA 2E4HA 3CBMA 2XICA 5LJ5f 1QVGP 3CC2T 1Q86R 3REBB 1YITQ 1FWZA 1ZSZB 4JJNK 2ED1A 3M5AA 2JM8A 1KQSP 3SB2A 2MI6A 5J26A 1PM3A 4DEXA 1ZA1B 3JCMP 3TCJA 2DLPA 3I56T 3NTIA 2EGAA 5GMKl 3CPFA 2J06A 2QA4Q 3M9QA 1N9SA 3P8DA 2V26A 3OS5A 3RR6A 3OYIA 1WJSA 4F14A 1UG1A 5DLOA 4IUPA 2JTFA 3RKYA 4ZGJB 3RKXA 3VUZA 2EYXA 3QPHA 5DM7R 1WYXA 3CMEQ 3QSUA 3LWIA 4AFZC 1WJQA 3TVTA 2A3LA 2D0QB 3FJPA 1VQ5A 4KULA 3NTHA 3G4SA 3CCSA 1CKBA 2XIDA 2CZ6B 3QZ9B 4J8OA 1YI2Q 1I8FA 2K2MA 3PGGA 2DA9A 3GNGA 1PRLC 2JN0A 5HK0A 1Q81R 3AT1B 2A37A 3CXCS 4E7SA 1K1ZA 1YITT 1AWWA 1C6VX 3GPLA 5FLXE 4PNOA 1M4ZA 1X2QA 4M78F 1QW1A 2G3RA 2F2XA 2KGTA 1JB0E 1ZSGA 1TUGB 1W6XA 1M1FA 1OZ2A 2LJ3A 3JSCA 5KYYB 4D6WA 1RABB 1LNXA 3CQTA 2CP3A 2CZ1B 1V1CA 4F04B 2KVQG 3DLMA 1UUEA 2GGRA 2EJFA 4OMPA 3RNJA 2X9HA 5LJ5g 1N8RR 4OMLA 1M1KU 2JZ2A 2X4YA 4M7DF 1QWEA 3CC2Q 3I5RA 3MP1A 2EYWA 1ZQ1A 4WTOB 2K79A 3A8HB 1MMDA 4AFQC
chains in the Genus database with same CATH topology
5GJVB 2DNUA 5IH2A 2BZ8A 2LJ1A 2OAWA 1MUZA 4GBQA 3I35A 1SRLA 2DBMA 4IIMA 2A36A 1X43A 2RF0A 1WFWA 1IO6A 2DX1A 2GTJA 4RUGA 2PTKA 1X6GA 5IXFA 2DL3A 1PNJA 2JS2A 3ULRB 3RBBB 1JXOA 3VS3A 1BK2A 1NYGA 2YUNA 4J9FA 2D8HA 4KRTA 2ESWA 2EGCA 1K0XA 1YN8A 1X27A 1MV0B 2AZSA 4CC2A 3EG2A 3UATA 2O9SA 2L3QA 1RLPC 4AFUC 2DJQA 2AK5A 2CSQA 1G2BA 1E6GA 2KYBA 1SPKA 3M0PA 2DVJA 2GTOA 1WI7A 2JTEA 1GL5A 1BB9A 3NGPA 1LCKA 1T0JA 4WCIA 1NLOC 3JV3A 2CT4A 2PNIA 4HVWA 2DE0X 4J9IA 1M27C 1U06A 5IHKA 1Z9ZA 2LMJA 1VYTA 3VRZA 2ENMA 4LN2A 4DEYA 1ARKA 4JZ4A 2LJ0A 2OI3A 4ZNXA 3SEMA 2SEMA 2JXBA 2C0TA 2CDTA 1KFZA 2CREA 2RQTA 4GLMA 2MIOA 3R6NA 3LH5A 1GFCA 2FPEA 1UJYA 2RQRA 1JU5C 1Y0MA 2O2OA 3U23A 2G6FX 3VS1A 2YUQA 2FG0A 2CUDA 1WX6A 1YCSB 2LCSA 1X6BA 3C0CA 4Y92A 2EKHA 1Y57A 1PWTA 2E5KA 2L0AA 2DYBA 1SEMA 1I0CA 2X3WD 1PRMC 2LP5A 1PKSA 2KRSA 2FPFA 1ZBJA 4AG1C 1M3AA 4D8KA 1ZUYA 1QCFA 3KFVA 2C0OA 1G83A 1QLYA 1BBZA 2F2VA 1RUWA 4J9GA 5IXBA 2L2PA 4K11A 1AZGB 2CH4A 4HVUA 4R0KA 2DILA 3H41A 4EIKA 2KBTA 1M3CA 2DRMA 2K9GA 2MCNA 3UA6A 2CH4W 3EGUA 2V1QA 4AFSC 1B07A 3QWXX 2YUPA 4FSSA 1UFFA 2DL8A 1K0SA 1AVZC 4J9EA 4M4ZA 5L23A 2ROLA 2ROTA 3UF4A 2JMAA 2M0YA 5FW9A 1AEYA 2J7IA 3M0UA 2RQVA 2V1RA 3TSWA 1OPKA 2FO0A 5FWCA 1M8MA 2LX7A 1AOJA 2EVRA 3I9QA 2K3BA 2AKLA 2KE9A 1SRMA 3NMZC 2DRKA 4JJBA 4X1VA 2KR3A 4RTTA 4RTVA 2AZVA 1NM7A 2EW3A 3EHQA 1K4US 2L3SA 4HVVA 2CSIA 1ZUUA 1XOVA 4JPBW 4Z88A 1WA7A 1TUCA 2DL7A 5HCKA 3VRYA 1SHGA 1NYFA 2K7AA 3M0QA 2KRNA 1GCQC 3THKA 1Z9QA 2W10A 4F17A 4E6RA 1OOTA 2QDLA 2EGEA 2J6KA 2JS0A 4JJDA 3H0FA 2J6OA 1GRIA 2EPDA 5I22A 3TSZA 3VS2A 1UTIA 1HSQA 1U3OA 2AKKA 1KSWA 1H92A 2YDLA 3M0TA 1FMKA 1GCPA 1AWOA 2YT6A 2A28A 2F2WA 1K76A 1ABOA 4LNPA 1H3HA 1BU1A 1E6HA 1VYVA 1AD5A 2X3XD 1YWPA 5FWBA 3PE0A 4Z8AA 3VS7A 1X2KA 2BTTA 1T3SA 1VA7A 4LUDA 2BZYA 1HJDA 2HCKA 2KXDA 1QKWA 1UGVA 5GJWB 2JT4A 2MOXA 1WXUA 1W70A 4A63B 1T3LA 2XMFA 4CC7A 2CUBA 2KEAA 3VS4A 2I0NA 2K6DA 3H0IA 3VS0A 1NG2A 1WDXA 1MV3A 1JEGA 3VS6A 1SHFA 2DMOA 1GBQA 1SSHA 2P4RA 3A98A 2KROA 2BZXA 2LNHB 2VVKA 4RTYA 1VYUA 2ECZA 3IQLA 2LQNA 3PVQA 1UECA 2DBKA 2HSPA 1UHFA 5EC7A 2KRMA 2SRCA 2RPNA 4OMMA 2LZ6B 1EFNA 4RTZA 2OJ2A 2HDAA 4CC3A 4LUEA 1B3QA 3M0RA 2GNCA 3QWYA 1AWJA 1RLQC 1NEGA 2ABLA 2J6FA 3O5ZA 2NUZA 2RN8A 3GBQA 1NLPC 4OMNA 4RTWA 2FRYA 2RNAA 2O31A 2VKNA 3EG0A 3I5SA 4IIOA 4J9DA 4D8DA 3VS5A 1UDLA 1PHTA 1WXBA 3PVLA 2GBQA 2YSQA 1UE9A 3SHWA 1QKXA 1W1FA 1QWFA 1ZUKA 2YUOA 1OPLA 2VWFA 2L3PA 4J9BA 2CT3A 2B86A 3ZL7C 2JM9A 1YWOA 1ZLMA 2EYZA 3NHNA 1CSKA 4OMOA 2JMCA 2KT8A 2RMOA 2RQUA 1OEBA 1WLPB 3REBB 2W0ZA 1UJ0A 4HCKA 1K9AA 2D0NA 1H8KA 2ED1A 4F16A 1GBRA 1JXMA 2JM8A 1I1JA 1KIKA 1UHCA 2NWMA 5ECAA 2PZ1A 4DEXA 2FRWA 5IHNA 1J3TA 2DLPA 1ZX6A 4RTXA 2EGAA 4AG2C 2J06A 1CKAA 1X69A 1E7OA 1TG0A 1JQQA 3H0HA 4F14A 1UG1A 2RQWA 1U5SA 2FEIA 2DM1A 2D1XA 2EYXA 3REAB 4LE9A 1NEBA 1WYXA 3EG3A 1M30A 4Z89A 3EHRA 1YP5A 1RI9A 2EBPA 2HBWA 2HEQA 4AFZC 2A08A 1AWXA 2O9VA 3UA7A 3TVTA 1CKBA 2JW4A 2M51A 1ABQA 2K2MA 2KNBB 2DA9A 3FJ5A 1PRLC 4J9HA 2A37A 2EQIA 4OMQA 1GFDA 1PKTA 3EG1A 2KT1A 1K1ZA 2H8HA 2KXCA 1FYNA 1YNZA 1AWWA 1KJWA 2IIMA 1N5ZA 4HXJA 4QT7A 1X2QA 3M0SA 1M3BA 4JJCA 2GQIA 2LQWA 5I11A 2EYYA 2DL5A 2F2XA 2KGTA 2O88A 1ZSGA 4RTUA 1OV3A 1I07A 1W6XA 2LJ3A 5IHIA 2ED0A 3NPFA 4ORZA 1JO8A 1TUDA 3CQTA 1GCQA 1WIEA 1V1CA 1AZEA 1UUEA 4J9CA 2GGRA 1T0HA 4OMPA 3RNJA 1HD3A 1A0NB 4OMLA 4CC4B 1WXTA 1QWEA 2J05A 2DF6A 4ESRA 2D8JA 1S1NA 4JZ3A 2FPDA 3I5RA 2EYWA 2DL4A 2K79A 2C0IA 2KYMA 4AFQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJV B;  2DNU A;  5IH2 A;  2BZ8 A;  2LJ1 A;  2OAW A;  1MUZ A;  4GBQ A;  3I35 A;  1SRL A;  2DBM A;  4IIM A;  2A36 A;  1X43 A;  2RF0 A;  1WFW A;  1IO6 A;  2DX1 A;  2GTJ A;  4RUG A;  2PTK A;  1X6G A;  5IXF A;  2DL3 A;  1PNJ A;  2JS2 A;  3ULR B;  3RBB B;  1JXO A;  3VS3 A;  1BK2 A;  1NYG A;  2YUN A;  4J9F A;  2D8H A;  4KRT A;  2ESW A;  2EGC A;  1K0X A;  1YN8 A;  1X27 A;  1MV0 B;  2AZS A;  4CC2 A;  3EG2 A;  3UAT A;  2O9S A;  2L3Q A;  1RLP C;  4AFU C;  2DJQ A;  2AK5 A;  2CSQ A;  1G2B A;  1E6G A;  2KYB A;  1SPK A;  3M0P A;  2DVJ A;  2GTO A;  1WI7 A;  2JTE A;  1GL5 A;  1BB9 A;  3NGP A;  1LCK A;  1T0J A;  4WCI A;  1NLO C;  3JV3 A;  2CT4 A;  2PNI A;  4HVW A;  2DE0 X;  4J9I A;  1M27 C;  1U06 A;  5IHK A;  1Z9Z A;  2LMJ A;  1VYT A;  3VRZ A;  2ENM A;  4LN2 A;  4DEY A;  1ARK A;  4JZ4 A;  2LJ0 A;  2OI3 A;  4ZNX A;  3SEM A;  2SEM A;  2JXB A;  2C0T A;  2CDT A;  1KFZ A;  2CRE A;  2RQT A;  4GLM A;  2MIO A;  3R6N A;  3LH5 A;  1GFC A;  2FPE A;  1UJY A;  2RQR A;  1JU5 C;  1Y0M A;  2O2O A;  3U23 A;  2G6F X;  3VS1 A;  2YUQ A;  2FG0 A;  2CUD A;  1WX6 A;  1YCS B;  2LCS A;  1X6B A;  3C0C A;  4Y92 A;  2EKH A;  1Y57 A;  1PWT A;  2E5K A;  2L0A A;  2DYB A;  1SEM A;  1I0C A;  2X3W D;  1PRM C;  2LP5 A;  1PKS A;  2KRS A;  2FPF A;  1ZBJ A;  4AG1 C;  1M3A A;  4D8K A;  1ZUY A;  1QCF A;  3KFV A;  2C0O A;  1G83 A;  1QLY A;  1BBZ A;  2F2V A;  1RUW A;  4J9G A;  5IXB A;  2L2P A;  4K11 A;  1AZG B;  2CH4 A;  4HVU A;  4R0K A;  2DIL A;  3H41 A;  4EIK A;  2KBT A;  1M3C A;  2DRM A;  2K9G A;  2MCN A;  3UA6 A;  2CH4 W;  3EGU A;  2V1Q A;  4AFS C;  1B07 A;  3QWX X;  2YUP A;  4FSS A;  1UFF A;  2DL8 A;  1K0S A;  1AVZ C;  4J9E A;  4M4Z A;  5L23 A;  2ROL A;  2ROT A;  3UF4 A;  2JMA A;  2M0Y A;  5FW9 A;  1AEY A;  2J7I A;  3M0U A;  2RQV A;  2V1R A;  3TSW A;  1OPK A;  2FO0 A;  5FWC A;  1M8M A;  2LX7 A;  1AOJ A;  2EVR A;  3I9Q A;  2K3B A;  2AKL A;  2KE9 A;  1SRM A;  3NMZ C;  2DRK A;  4JJB A;  4X1V A;  2KR3 A;  4RTT A;  4RTV A;  2AZV A;  1NM7 A;  2EW3 A;  3EHQ A;  1K4U S;  2L3S A;  4HVV A;  2CSI A;  1ZUU A;  1XOV A;  4JPB W;  4Z88 A;  1WA7 A;  1TUC A;  2DL7 A;  5HCK A;  3VRY A;  1SHG A;  1NYF A;  2K7A A;  3M0Q A;  2KRN A;  1GCQ C;  3THK A;  1Z9Q A;  2W10 A;  4F17 A;  4E6R A;  1OOT A;  2QDL A;  2EGE A;  2J6K A;  2JS0 A;  4JJD A;  3H0F A;  2J6O A;  1GRI A;  2EPD A;  5I22 A;  3TSZ A;  3VS2 A;  1UTI A;  1HSQ A;  1U3O A;  2AKK A;  1KSW A;  1H92 A;  2YDL A;  3M0T A;  1FMK A;  1GCP A;  1AWO A;  2YT6 A;  2A28 A;  2F2W A;  1K76 A;  1ABO A;  4LNP A;  1H3H A;  1BU1 A;  1E6H A;  1VYV A;  1AD5 A;  2X3X D;  1YWP A;  5FWB A;  3PE0 A;  4Z8A A;  3VS7 A;  1X2K A;  2BTT A;  1T3S A;  1VA7 A;  4LUD A;  2BZY A;  1HJD A;  2HCK A;  2KXD A;  1QKW A;  1UGV A;  5GJW B;  2JT4 A;  2MOX A;  1WXU A;  1W70 A;  4A63 B;  1T3L A;  2XMF A;  4CC7 A;  2CUB A;  2KEA A;  3VS4 A;  2I0N A;  2K6D A;  3H0I A;  3VS0 A;  1NG2 A;  1WDX A;  1MV3 A;  1JEG A;  3VS6 A;  1SHF A;  2DMO A;  1GBQ A;  1SSH A;  2P4R A;  3A98 A;  2KRO A;  2BZX A;  2LNH B;  2VVK A;  4RTY A;  1VYU A;  2ECZ A;  3IQL A;  2LQN A;  3PVQ A;  1UEC A;  2DBK A;  2HSP A;  1UHF A;  5EC7 A;  2KRM A;  2SRC A;  2RPN A;  4OMM A;  2LZ6 B;  1EFN A;  4RTZ A;  2OJ2 A;  2HDA A;  4CC3 A;  4LUE A;  1B3Q A;  3M0R A;  2GNC A;  3QWY A;  1AWJ A;  1RLQ C;  1NEG A;  2ABL A;  2J6F A;  3O5Z A;  2NUZ A;  2RN8 A;  3GBQ A;  1NLP C;  4OMN A;  4RTW A;  2FRY A;  2RNA A;  2O31 A;  2VKN A;  3EG0 A;  3I5S A;  4IIO A;  4J9D A;  4D8D A;  3VS5 A;  1UDL A;  1PHT A;  1WXB A;  3PVL A;  2GBQ A;  2YSQ A;  1UE9 A;  3SHW A;  1QKX A;  1W1F A;  1QWF A;  1ZUK A;  2YUO A;  1OPL A;  2VWF A;  2L3P A;  4J9B A;  2CT3 A;  2B86 A;  3ZL7 C;  2JM9 A;  1YWO A;  1ZLM A;  2EYZ A;  3NHN A;  1CSK A;  4OMO A;  2JMC A;  2KT8 A;  2RMO A;  2RQU A;  1OEB A;  1WLP B;  3REB B;  2W0Z A;  1UJ0 A;  4HCK A;  1K9A A;  2D0N A;  1H8K A;  2ED1 A;  4F16 A;  1GBR A;  1JXM A;  2JM8 A;  1I1J A;  1KIK A;  1UHC A;  2NWM A;  5ECA A;  2PZ1 A;  4DEX A;  2FRW A;  5IHN A;  1J3T A;  2DLP A;  1ZX6 A;  4RTX A;  2EGA A;  4AG2 C;  2J06 A;  1CKA A;  1X69 A;  1E7O A;  1TG0 A;  1JQQ A;  3H0H A;  4F14 A;  1UG1 A;  2RQW A;  1U5S A;  2FEI A;  2DM1 A;  2D1X A;  2EYX A;  3REA B;  4LE9 A;  1NEB A;  1WYX A;  3EG3 A;  1M30 A;  4Z89 A;  3EHR A;  1YP5 A;  1RI9 A;  2EBP A;  2HBW A;  2HEQ A;  4AFZ C;  2A08 A;  1AWX A;  2O9V A;  3UA7 A;  3TVT A;  1CKB A;  2JW4 A;  2M51 A;  1ABQ A;  2K2M A;  2KNB B;  2DA9 A;  3FJ5 A;  1PRL C;  4J9H A;  2A37 A;  2EQI A;  4OMQ A;  1GFD A;  1PKT A;  3EG1 A;  2KT1 A;  1K1Z A;  2H8H A;  2KXC A;  1FYN A;  1YNZ A;  1AWW A;  1KJW A;  2IIM A;  1N5Z A;  4HXJ A;  4QT7 A;  1X2Q A;  3M0S A;  1M3B A;  4JJC A;  2GQI A;  2LQW A;  5I11 A;  2EYY A;  2DL5 A;  2F2X A;  2KGT A;  2O88 A;  1ZSG A;  4RTU A;  1OV3 A;  1I07 A;  1W6X A;  2LJ3 A;  5IHI A;  2ED0 A;  3NPF A;  4ORZ A;  1JO8 A;  1TUD A;  3CQT A;  1GCQ A;  1WIE A;  1V1C A;  1AZE A;  1UUE A;  4J9C A;  2GGR A;  1T0H A;  4OMP A;  3RNJ A;  1HD3 A;  1A0N B;  4OML A;  4CC4 B;  1WXT A;  1QWE A;  2J05 A;  2DF6 A;  4ESR A;  2D8J A;  1S1N A;  4JZ3 A;  2FPD A;  3I5R A;  2EYW A;  2DL4 A;  2K79 A;  2C0I A;  2KYM A;  4AFQ C; 
#chains in the Genus database with same CATH topology
 5GJV B;  2DNU A;  2E70 A;  2RA2 A;  5I2M A;  4IUV A;  1LVK A;  3RKW A;  3I35 A;  1SRL A;  2DTO A;  3OS1 A;  3M55 A;  4E2F B;  2QGG A;  2A36 A;  1X43 A;  2DZC A;  4EPC A;  5IXF A;  3MCA B;  1ZSZ C;  2EKO A;  3EGD A;  3E19 A;  5HK3 A;  3QYH B;  1NYG A;  2YUN A;  2JJ9 A;  4PFZ A;  2OX7 A;  1K0X A;  1YN8 A;  1X27 A;  4BUG A;  2V8I A;  4CC2 A;  4XTZ A;  4AFU C;  2QQA A;  4DQ2 A;  3OBY A;  1E6G A;  2DK3 A;  3GNF B;  3FC3 A;  2GTO A;  4DBR A;  4C8Q C;  5GAO r;  2E3H A;  4QQ6 A;  1QCO A;  1KQS S;  2WSE E;  2K2V A;  1KHI A;  1RAI B;  2RB6 A;  2YRD A;  4FIB A;  4KGX B;  4C0Z A;  2LJ0 A;  4OF1 A;  2OI3 A;  4ZNX A;  3SEM A;  3JCM V;  4BE0 A;  1VQ6 A;  2ZZD A;  4M77 A;  1KFZ A;  3LH5 A;  3BW1 A;  1LPL A;  2O01 E;  1YJ9 T;  2YRC A;  2K3Y A;  1M1G A;  5IAY A;  2FG0 A;  2M16 A;  1YCS B;  2LCS A;  3EGX A;  4C8Q D;  3C0C A;  4Y92 A;  2P0Q A;  1Y57 A;  1PWT A;  4MML A;  4N4H A;  1Y07 A;  4M7A D;  1NPP A;  3CD6 T;  2LP5 A;  4KH1 B;  1PKS A;  3WVD B;  5LJ5 h;  1ZBJ A;  1Q95 G;  3KFV A;  4QW2 A;  5LJ3 e;  4MMK A;  2HD0 A;  4A4F A;  2C0O A;  1FMW A;  3V8L A;  3FLG A;  2LT1 A;  4J9G A;  2BE9 B;  3X20 B;  5GAM d;  4DOW A;  4R0K A;  1K8A C;  2P84 A;  4M7D D;  4JDS A;  4C92 A;  2COZ A;  3L42 A;  2L89 A;  2RHX A;  4XTU A;  4C92 C;  2DRM A;  2K9G A;  2YLB A;  3RES A;  3M56 A;  4C5G A;  3UA6 A;  2X4X A;  4KBM B;  2OTJ Q;  2EQJ A;  3EGU A;  2BKD N;  4PJO C;  3CCJ A;  2YUP A;  2DL8 A;  2NYS A;  4OMF B;  4C92 D;  3LLR A;  3QZ5 B;  1RI0 A;  1VQO Q;  2M0Y A;  5FW9 A;  1VQ4 T;  3CCE Q;  1AEY A;  1JBM A;  1VQ9 Q;  2KAF A;  4QKU A;  2RQV A;  1RAD B;  2LQ8 A;  3FRN A;  3R6O A;  2KR3 A;  2EQM A;  4FYY B;  4FW2 A;  2CP2 A;  2HQX A;  2XK0 A;  2M0O A;  1F1B B;  3EG9 B;  1VIE A;  2YXY A;  1D3B B;  1ZUU A;  1KQ2 A;  1VQ4 Q;  2AIR B;  2RI2 A;  1VQM T;  4M77 C;  3A8L B;  4PLI A;  2CGH A;  4HCC A;  1MMG A;  1YBY A;  4M7D A;  2HKQ B;  5LJ3 f;  5CR2 A;  2W10 A;  3P8H A;  1OOT A;  3CC4 Q;  2LX9 A;  2J6O A;  3RUX A;  2XD0 A;  2KY9 A;  1QQJ A;  1KHC A;  2DEU A;  1H92 A;  2YDL A;  3C95 A;  2GCX A;  2JUF A;  1BI2 A;  2K5L A;  3MEV A;  2F2W A;  4LNP A;  1BU1 A;  2CYZ B;  1VYV A;  5GAO q;  2MYS A;  3PE0 A;  4Z8A A;  1X2K A;  1QVF S;  3FB9 A;  5A0D A;  4FT2 A;  1HJD A;  2HCK A;  2KXD A;  3OYN A;  3CCL A;  1UGV A;  2JT4 A;  3WXM B;  1IRE B;  1ZA2 B;  2MOX A;  2LNV A;  4PFO A;  1WHL A;  1M2O A;  3JCM W;  1W70 A;  1T3L A;  2WSF E;  3C94 A;  2KEA A;  2MWP A;  4DA4 A;  5FU7 B;  4JRK A;  4M78 A;  3VS6 A;  2P4R A;  1IRX A;  2QQS A;  2LNH B;  2EIF A;  3HKS A;  2RHY A;  2LQN A;  3PVQ A;  2R58 A;  2RPN A;  3M58 A;  4OMM A;  4LDX A;  5FU6 C;  2LZ6 B;  1EFN A;  2ZPF B;  3X25 B;  3VUB A;  5GAM e;  2OJ2 A;  1YJ9 A;  2I2L A;  4LUE A;  3M0R A;  3V7S A;  4C0D B;  4E7H A;  3QWY A;  1NEG A;  2ABL A;  2NUZ A;  1WQ7 A;  2F5K A;  4C92 F;  2BUD A;  4M78 E;  3GBQ A;  4OMN A;  1YIT A;  4IKF A;  3JB9 H;  5GMK m;  4J9D A;  4IIO A;  3I5S A;  2HSE B;  3CCM Q;  3OBW A;  1UDL A;  3BDL A;  4FM4 B;  4C92 B;  2GBQ A;  1OU8 A;  5GMK i;  5GAO l;  1VQ8 T;  4MDX A;  1X01 A;  1NZ9 A;  1ZUK A;  1VIF A;  4C5I A;  5CO7 A;  3JB9 D;  4CI0 C;  3O8V A;  1YWO A;  1JJ2 P;  2VC8 A;  1QCN A;  3CMA Q;  1VUB A;  3G6E A;  2JMC A;  1VQL T;  2KT8 A;  3MHX A;  2RMO A;  3PT9 A;  2RQU A;  3FDR A;  1WLP B;  2HKN A;  1K9A A;  3OYE A;  1I1J A;  3BY7 A;  2K4Y A;  1WZO A;  5ECA A;  2PZ1 A;  1VQ8 A;  5CQY A;  2FRW A;  1J3T A;  1IGQ A;  3SFM A;  3DB4 A;  4KT0 E;  2DET A;  1R8O B;  1RAC B;  1JQQ A;  4PK4 A;  3V8J A;  1U5S A;  4A4E A;  3HHT B;  4M78 D;  3REA B;  1C1A A;  4NL3 A;  1M30 A;  1ACM B;  3CC4 A;  4Z89 A;  2XDP A;  3EHR A;  1RI9 A;  2HL3 A;  4PJO A;  4QVZ A;  1FX7 A;  2O9V A;  2P4T A;  1YI2 T;  2IG0 A;  4HA8 A;  3EFS A;  4XTY A;  2JW4 A;  2FYK A;  2M51 A;  8AT1 B;  1PKT A;  3EG1 A;  4ZN1 A;  1R0B G;  3F70 A;  4PJN A;  2FB7 A;  1M2V A;  3CCJ Q;  4C8Q B;  2KT1 A;  3E9F A;  2H8H A;  2K5I A;  2KXC A;  1FYN A;  1WNL A;  1KJW A;  3JAM E;  2LVM A;  2NUP A;  3JCM e;  3BE3 A;  3A8M B;  3M0S A;  3OW2 P;  3QKJ A;  5FRN A;  3DLL A;  2VYT A;  2GQI A;  3CCV A;  1H3Z A;  2DVE A;  3CCL T;  4LDW A;  2E12 A;  2LQW A;  2EYY A;  2A0F B;  4RTU A;  4OB3 B;  2QK0 A;  5IHI A;  2ED0 A;  4C0D C;  5IN1 A;  3CC7 Q;  3DB3 A;  4M7D B;  1GCQ A;  5D6X A;  1WIE A;  1AZE A;  3CC7 A;  5GAM f;  4J9C A;  2XDD A;  4PJO F;  1T0H A;  4Z02 A;  4DBH A;  3I56 Q;  1NPR A;  4CC4 B;  4ELZ C;  2XG8 D;  4ESR A;  2D8J A;  1S1N A;  4JZ3 A;  5GAM j;  3I56 A;  2FPD A;  4BE2 A;  2JTM A;  3OB9 A;  3PIP A;  1MMA A;  4BAC A;  2VXF A;  4J7F A;  1LJO A;  1FMV A;  3J80 E;  4J6X A;  2RF0 A;  1WFW A;  3FIF A;  1IO6 A;  2DX1 A;  4RUG A;  4C92 E;  3TQ7 P;  3OW2 A;  1G3Y A;  3RBB B;  4BI8 B;  2R5M A;  4XTW A;  1KD1 R;  1VQ5 T;  3TRE A;  5GAN 6;  2EGC A;  1QVG A;  2JVV A;  2OTL T;  3CCM T;  4F7U E;  1NBE B;  3A5Z B;  1RLP C;  2LTO A;  2CSQ A;  4TVR A;  3CMA A;  4RG8 A;  2KYB A;  2QEX Q;  2QQB A;  3JB9 J;  1KD1 U;  2RHI A;  4II1 A;  4ATO A;  1WI7 A;  1Y71 A;  2EFI A;  3OMG A;  4BDY A;  2Y4X A;  3QUI A;  1BB9 A;  1V76 A;  2F5T X;  4L59 A;  1M90 U;  1OU9 A;  1JRI A;  2CT4 A;  2CP5 A;  1M9S A;  3EFO B;  4FYV B;  3OYY A;  1M27 C;  5GMK j;  4JRP A;  1U06 A;  1GXI E;  2YWW A;  1Q81 U;  2LMJ A;  1VYT A;  4OP0 A;  1D1A A;  2ENM A;  1ZHI A;  2GF7 A;  4DEY A;  3ZEH A;  4JZ4 A;  3OYC A;  4FYW B;  1W2B S;  5CVI A;  1EIF A;  5KYW A;  4L5G A;  2LQK A;  2C0T A;  2RQT A;  3CXC A;  1YJ9 Q;  3R6N A;  4M77 G;  3OYK A;  1GFC A;  1Q7Y R;  1UJY A;  1JU5 C;  1RAF B;  1Y0M A;  4PJJ A;  3UWN A;  5CKF A;  1D1C A;  3QDF A;  3OYL A;  2YUQ A;  2OTJ T;  4X34 A;  4RCC A;  1U1S A;  2L0A A;  1SEM A;  5HKC A;  1KD1 C;  1JJ2 A;  1SF9 A;  1I0C A;  3MP8 A;  2CS7 A;  4OVA A;  1MNE A;  3JCM J;  4QQD A;  1M3A A;  4D8K A;  3CCQ T;  1ZUY A;  1QCF A;  4QQG A;  3LW5 E;  1UGQ B;  1N6A A;  1Q86 U;  5KYU A;  2F2V A;  5IXB A;  2L2P A;  1PCX A;  4K11 A;  1TSF A;  4XQ3 A;  3V7R A;  2NUP B;  4N4I A;  2DIL A;  3H41 A;  3UT1 A;  5J39 A;  3J81 E;  3JCM g;  4C92 G;  3ZFJ A;  2CH4 W;  1M8V A;  3Q1J A;  2C06 A;  1UB4 A;  2L3R A;  1VQN T;  2AHJ B;  4M7D C;  1K0S A;  2QQR A;  2MWO A;  5KYN A;  5GAN 5;  4J9E A;  3WVE B;  1D1B A;  3CCU Q;  1R77 A;  2LC4 A;  3UF4 A;  1TTH B;  5GAN 7;  2LCL A;  1YHQ Q;  3M0U A;  3TSW A;  3CBO A;  1IXD A;  1M8M A;  3CCE T;  4FCY A;  1AOJ A;  2EVR A;  2QTV A;  2K3B A;  1SRM A;  4JJB A;  4M78 C;  2WAC A;  3CCV T;  4RTV A;  4B9W A;  1MMN A;  1RL2 A;  2CZ0 B;  4N4G A;  3QXE B;  2XHC A;  2HAX A;  1XOV A;  3A8O B;  1WA7 A;  1BIB A;  3S3N A;  5HCK A;  2K7A A;  1MGQ A;  2KRN A;  1GCQ C;  4B9X A;  3AHU A;  2V8K A;  1Z9Q A;  4OGE A;  4F17 A;  2NUT B;  2JS0 A;  4JJD A;  3VJP A;  4ZN3 A;  1GRI A;  5KYX B;  3KBG A;  3L2Z A;  3N5B B;  2PVD B;  3VS2 A;  5KYX A;  3HP9 A;  1YIJ Q;  2DEQ A;  5KE3 A;  3OYM A;  4A54 A;  1IHW A;  4ZTJ A;  3PNW C;  1GCP A;  2QA4 A;  1AWO A;  4ZTF A;  2A28 A;  3X28 B;  4MDW A;  2KQW A;  3CCL Q;  1WPY A;  1YI2 A;  1YWP A;  2KSS A;  5FWB A;  3M54 A;  3VS7 A;  1T3S A;  1VA7 A;  2VXE A;  1HYO A;  3DKM A;  4XU0 A;  1YIJ T;  1NE8 A;  2RJC A;  1K9M R;  3QO3 A;  5IT9 E;  3E1S A;  1WXU A;  4HCZ A;  4LDY A;  4C5H A;  3I55 T;  2DIG A;  2OAU A;  2XMF A;  2F1L A;  3OYD A;  3G6E T;  2K6D A;  3H0I A;  2MPX C;  5FRM A;  2XI9 A;  1O75 A;  2DMO A;  1GBQ A;  1SSH A;  2EQU A;  4AMC A;  1OQK A;  4PJO D;  3OY9 A;  1WHM A;  1IZ6 A;  4BDZ A;  1VYU A;  2LRQ A;  1UEC A;  3CCS Q;  5EC7 A;  2E1H A;  3RDV A;  3BDU A;  2SRC A;  1PC0 A;  3E9G A;  4NOY A;  3CXC P;  3OYF A;  1YJN T;  2D9T A;  4RTZ A;  4JLG A;  4UC4 A;  5GAN 2;  1VQM A;  5I2S A;  2GNC A;  5I21 A;  1QVP A;  1RLQ C;  2J6F A;  3HTR A;  3O5Z A;  2RN8 A;  1NLP C;  5GAN e;  2PVO B;  1XNI A;  4A4H A;  5CCA A;  3HFN A;  3VS5 A;  2DFU A;  4IUR A;  2O4X A;  4Y28 E;  2RO0 A;  4VUB A;  2D6F A;  4M78 B;  1W1F A;  4M75 F;  3SDZ A;  1OPL A;  2ZAE A;  2VWF A;  2HL5 C;  2CT3 A;  3OSV A;  2KK4 A;  1ZLM A;  5D6Y A;  1WHK A;  1KK7 A;  1ZSZ A;  4OMO A;  2HQH A;  5CKH A;  4KUI A;  4EMG A;  4HT8 A;  2W0Z A;  4HCK A;  1UJ0 A;  4X9D A;  1Q82 U;  1H8K A;  2GQV A;  1GBR A;  2PUO B;  1KIK A;  1UHC A;  3SWN C;  1Q82 R;  1S72 T;  3QHS A;  3H8Z A;  3CME T;  1K73 R;  4RCB A;  1ZX6 A;  1M5Q 1;  3X24 B;  4RTX A;  4AG2 C;  2BE7 D;  1CKA A;  1X69 A;  2Y4Y A;  4XU3 A;  1TWB A;  3GIB A;  1RAA B;  3H0H A;  3LGL A;  3JCM d;  3M57 A;  4NL2 A;  3QJ6 A;  2FL7 A;  2DM1 A;  4XU2 A;  4LE9 A;  2DIQ A;  4HKE A;  3EG3 A;  2RJD A;  5AYF A;  2HEQ A;  2COW A;  3RIR A;  3QJY A;  1BYM A;  3UDC A;  2X35 A;  4BY6 B;  2PU9 B;  1PD1 A;  2OTL A;  1MND A;  1ABQ A;  5A0L A;  2KNB B;  4JRI A;  3EFR A;  1UEB A;  4J9H A;  2EQI A;  4OMQ A;  4MZT A;  3HRU A;  2DXT A;  3MO8 A;  4OB2 B;  2DD4 A;  1M1K R;  5GAM h;  3CPW P;  3G71 A;  1KG1 A;  2K5F A;  4E7K A;  1N5Z A;  1BI1 A;  2FZC B;  3OYH A;  4QT7 A;  1V29 B;  1I5O B;  1AHJ B;  4EMH A;  4BI4 A;  2QXF A;  1XJW B;  2O88 A;  4PJO B;  1OV3 A;  4IUT A;  2YRV A;  1JO8 A;  3JCM h;  2HQE A;  2M1H A;  3QYG B;  3FEO A;  4PJM A;  3HPW A;  2VB6 A;  2NUT A;  1VQK T;  1A0N B;  1VQL A;  1YJW T;  1WXT A;  3G71 T;  2J05 A;  4GLK A;  2DF6 A;  1WHG A;  3G1J A;  3PFS A;  2DL4 A;  3CCQ A;  2VGN A;  2E10 A;  3ZBD A;  3ASK A;  1S72 Q;  3UPU A;  1FXX A;  2YLC A;  4IIM A;  2P0K A;  5CKD A;  1VQ9 A;  1X6G A;  1OYX A;  2NLU A;  1K8A U;  1PNJ A;  2JS2 A;  4LDU A;  4RG2 A;  1JXO A;  3VS3 A;  4BD3 A;  1XTD A;  3M4Y A;  1HXD A;  2ESW A;  4M77 E;  2KI7 A;  3EG2 A;  3UAT A;  2L3Q A;  2FZK B;  2DJQ A;  1G2B A;  1M90 R;  4M7A A;  1B34 B;  2DVJ A;  4C8Q F;  2ZGW A;  2R5A A;  3CD6 Q;  1M1K C;  2DXC A;  3OA6 A;  1GL5 A;  3MEW A;  1T0J A;  2PVG B;  5CAI A;  3G4S Q;  4J9I A;  3OS2 A;  2PQW A;  3QDR B;  4E7J A;  2RI3 A;  2ZPI B;  2RJE A;  3VYG A;  5IHK A;  2JNG A;  5GAN j;  1OX8 A;  4BY6 C;  3D7S B;  3PMI A;  2F69 A;  2SEM A;  4E47 A;  1W2B A;  2CRE A;  2MIO A;  2CP6 A;  4XU1 A;  1VQ7 A;  2FPE A;  2RQR A;  1D0Y A;  3LGF A;  2O2O A;  1X75 C;  3U23 A;  2G6F X;  1KQS A;  2DTH A;  3VS1 A;  4N0A C;  1WX6 A;  3SWN A;  2VUB A;  2H3E B;  1X6B A;  4M78 G;  2ATC B;  3SWN B;  3EFO A;  2M9U A;  1S72 A;  1VQ6 T;  2ZPG B;  3V8K A;  3CMA T;  1VQ8 Q;  1PRM C;  3T9N A;  4ZGE B;  4GY5 A;  2DER A;  2KRS A;  4AG1 C;  3L2W A;  4A4G A;  4XTX A;  5GAO p;  5LJ5 d;  5KYW B;  1NJI U;  5CKE A;  2CH4 A;  2CKK A;  4HVU A;  2CP7 A;  3GOX A;  1QP2 A;  2KBT A;  1M3C A;  3L2V A;  4EDU A;  2E6Z A;  2RI5 A;  1BI0 A;  2V1Q A;  1B07 A;  5GAN d;  4YTL A;  3E2U A;  3QWX X;  2COY A;  3I55 A;  3OQ5 A;  3PTA A;  2FVU A;  3MP6 A;  5GAN h;  2VGM A;  3MKD A;  5L23 A;  3HSB A;  2ROL A;  1C0M A;  2JMA A;  4DOV A;  1SG5 A;  4F7U F;  2J7I A;  2V1R A;  1YFN A;  5FWC A;  3S3M A;  1YJN Q;  4HCB A;  2RHU A;  3CPW S;  3I9Q A;  3G71 Q;  3VV0 A;  4JLI A;  2AKL A;  2KE9 A;  2RK2 A;  2DRK A;  1VQN Q;  1NM7 A;  3JCM f;  1D3B A;  1W2B P;  2L3S A;  2XDB A;  4HVV A;  1TXQ A;  2CSI A;  4M7A G;  2Y90 A;  4JPB W;  2R57 A;  4Z88 A;  4M7D G;  1Q7Y C;  1TUC A;  2DL7 A;  2QQ9 A;  3VRY A;  1SHG A;  3M53 A;  2VV5 A;  1NYF A;  2V8J A;  1NJI R;  2L8D A;  3THK A;  3GLX A;  4J5Y A;  4BE1 A;  3CCV Q;  3CCR Q;  4C0G A;  2QDL A;  2EGE A;  2J6K A;  4RKU E;  1R0C B;  3CEY A;  2DZ9 A;  4C8Q E;  2EPD A;  1BCO A;  5I22 A;  5LJ3 j;  2DPP B;  1U3O A;  4V2S A;  1OX9 A;  1UGS B;  2DYI A;  1I5L A;  3HRS A;  3MEU A;  2XU8 A;  2YT6 A;  5FU7 C;  1K76 A;  1VQ9 T;  1E6H A;  1U1T A;  4M75 C;  3CC4 T;  1NJI C;  5C0M A;  1AD5 A;  2X3X D;  3OYB A;  1IGU A;  2BTT A;  2L5Q A;  4LUD A;  3X26 B;  1K73 C;  2BZY A;  4XK8 E;  3M4G A;  1Q82 C;  1X6O A;  3ME9 A;  4M7A F;  1G3W A;  2LDM A;  1SKU B;  2AT1 B;  3EGD B;  1MHN A;  1TU0 B;  4A63 B;  4PL6 A;  3HL8 A;  3VS4 A;  1AT1 B;  2RD1 A;  3EH2 A;  2I0N A;  3VS0 A;  1WDX A;  4BI3 A;  1MV3 A;  1JEG A;  1PG5 B;  1SHF A;  1TS9 A;  3OYJ A;  3A98 A;  2KRO A;  2RHZ A;  1G3S A;  2EAY A;  3INZ A;  2QTX A;  1BIA A;  4DBQ A;  3OYG A;  2ZCF B;  3IQL A;  3EGX B;  5LJ5 e;  2DBK A;  4DBF A;  1KQ1 A;  3URG A;  9ATC B;  1TOV A;  1B7T A;  5LJ5 j;  3OYA A;  4CC3 A;  1B3Q A;  1VQO A;  1WJR A;  4J6Y A;  2HNI A;  2HZY A;  1AWJ A;  2Z0W A;  3H6Z A;  1KC8 C;  4RTW A;  1Y96 B;  2RNA A;  5L8R E;  3S6W A;  5GAN 4;  1QVG S;  4WF2 A;  3EG0 A;  3CCR A;  4Y91 A;  5EG2 A;  4JRQ A;  2PUK B;  1QMC A;  1UE9 A;  1QKX A;  2QEX T;  1QWF A;  2YUO A;  5GAO m;  2ZPB B;  3CCU A;  4HT9 A;  2IVW A;  4J9B A;  1P92 A;  2A7Y A;  1LOJ A;  2QA4 T;  2EYZ A;  3NHN A;  1CSK A;  3V7C A;  3JCM c;  2DO3 A;  3C12 A;  4NS5 A;  1OEB A;  4F16 A;  2D0N A;  4PFP A;  4RMO A;  4CRI A;  1JXM A;  4X9C A;  3TEE A;  2IPO B;  2NWM A;  3QBY A;  4XAX B;  5IHN A;  1D0Z A;  4M75 D;  1IHV A;  1E7O A;  3RMS A;  1TG0 A;  5J3B A;  2RQW A;  2FEI A;  2KMT A;  2D1X A;  3P8B B;  4FL6 A;  1NEB A;  2K57 A;  4OB1 B;  4LD6 A;  1YP5 A;  2EBP A;  2HBW A;  1YJW A;  2A08 A;  1PD0 A;  1AWX A;  4FYX B;  3OS0 A;  3UA7 A;  2X4J A;  4OB0 B;  2QDY B;  3A8G B;  1VQP A;  3FJ5 A;  1VQP T;  5KH6 A;  4AT1 B;  4C8Q A;  2QGF B;  1GFD A;  4IUQ A;  4M75 E;  1YJN A;  5KYU B;  2ZPH B;  1VQN A;  1YNZ A;  1D0X A;  3CC7 T;  2IIM A;  2RM4 A;  2RJF A;  4C5E A;  4HXJ A;  1Q7Y U;  2CP0 A;  3OMC A;  3KUF A;  3CPW A;  5GAO n;  1M3B A;  4JJC A;  2DKG A;  2WSC E;  5I11 A;  1QVF A;  1EZZ B;  2DL5 A;  2YHT A;  5C6S A;  1I07 A;  3JRZ A;  4ELY C;  3NPF A;  4ORZ A;  4N0A A;  3JCM b;  1TUD A;  1U8R A;  2JOY A;  1OUL A;  4KH0 B;  1K8A R;  4ME7 A;  1VQ7 T;  1BKB A;  2LCC A;  3I55 Q;  2K3X A;  5HY6 A;  5A0G A;  1HD3 A;  3CC2 A;  1H64 1;  5GAN 3;  1VQL Q;  1I4K 1;  3QG1 A;  2MAM A;  2X51 A;  1OI1 A;  4LDV A;  2HMA A;  5GAN f;  2QYZ A;  3L1A A;  2C0I A;  2KYM A;  2H3J A;  2DD5 A;  5IH2 A;  2BZ8 A;  2LJ1 A;  2OAW A;  1MUZ A;  4GBQ A;  3CD6 A;  2DBM A;  4E7I A;  1QVF P;  2GTJ A;  3JB9 F;  2PTK A;  2CZ7 B;  4C8Q G;  3GP8 A;  4C0F A;  2DL3 A;  2E3I A;  3CCR T;  2E41 A;  1RAH B;  3ULR B;  4O6J A;  3GF5 A;  5LJ3 d;  1BK2 A;  1IB8 A;  1VQ7 Q;  4J9F A;  2D8H A;  3L2R A;  4KRT A;  1YIJ A;  1MV0 B;  2AZS A;  2O9S A;  2E64 A;  1YJW Q;  2AK5 A;  1UGR B;  3CME A;  1SPK A;  3M0P A;  4M75 G;  2JTE A;  3CCU T;  1VQP Q;  3NGP A;  1LCK A;  3VKI A;  3CCQ Q;  1K9M U;  2DXU A;  1NLO C;  4WCI A;  3JV3 A;  2PNI A;  3M59 A;  4BB7 A;  4HVW A;  2DE0 X;  1KC8 U;  1Y7X A;  1G5V A;  1Z9Z A;  4FW1 A;  3CCM A;  1QP3 A;  1WGS A;  4M7A E;  3VRZ A;  3LWH A;  4LN2 A;  5GMK e;  1ARK A;  1JJ2 S;  1EX4 A;  1N27 A;  3JB9 G;  3CCS T;  2JXB A;  1M90 C;  2EWN A;  2CDT A;  4GLM A;  4EMK A;  1I81 A;  2QAZ A;  4XTV A;  4EMK B;  4QVD A;  1B34 A;  3MEA A;  1DJ7 B;  4LD9 K;  2CUD A;  5AT1 B;  3G7Z A;  4E7Z A;  1YHQ T;  1PSF A;  5D7U A;  2EKH A;  2E5K A;  3LYI A;  3JCM X;  2DYB A;  2E5Q A;  1N8R U;  5M9O A;  2VAS A;  2X3W D;  5KCO A;  2FPF A;  1HK9 A;  3QII A;  3VYH B;  4IUU A;  4R55 A;  5D6W A;  1G83 A;  1M2V B;  1QLY A;  3NFC A;  4PKC C;  1BBZ A;  3JCM Q;  3BFM A;  1RUW A;  4PJO G;  4L6V 5;  3OW2 S;  4JS5 A;  7AT1 B;  1AZG B;  3TU4 K;  1WQW A;  1N9R A;  3A1P A;  1VQ6 Q;  1TH7 A;  3EG9 A;  4EIK A;  5CIU A;  2MCN A;  6AT1 B;  8ATC B;  4P5N A;  4M77 D;  3LX7 A;  1O9S A;  4AFS C;  2QI2 A;  2FZG B;  5A2Q E;  4F7U B;  4FSS A;  1UFF A;  5GAN 8;  3EH1 A;  1AVZ C;  4MZM A;  2XKO C;  4M4Z A;  4F7U A;  2ZPE B;  2ROT A;  5GMK h;  5CKB A;  1VQM Q;  4J7I A;  2EJ9 A;  3G4S T;  2QEX A;  2RH2 A;  1OPK A;  2FO0 A;  2LX7 A;  1WHJ A;  2EYQ A;  4X1V A;  3NMZ C;  4RTT A;  3EAE A;  2AZV A;  1Q81 C;  2M02 A;  2GFA A;  4JS4 A;  2B8A A;  2X4W A;  4Q5W A;  5CQX A;  2EW3 A;  3EHQ A;  5LJ3 h;  4F7U G;  1K4U S;  4J83 A;  4O5V A;  4PLL A;  1G8X A;  3H9N A;  1VQO T;  1WHH A;  2EQK A;  1UGP B;  3VU3 C;  4KUD K;  1RAG B;  3M0Q A;  1SSF A;  3CCE A;  4E6R A;  2DTI A;  3H0F A;  2LT4 A;  5LL6 S;  3TSZ A;  1UTI A;  5FU6 B;  1HSQ A;  2AKK A;  5KCH A;  5KE2 A;  1KSW A;  3G6E Q;  4E7L A;  3M0T A;  2RK1 A;  1FMK A;  1XQH A;  3CBP A;  1VQK A;  4M7A C;  1K73 U;  1ABO A;  4FSX A;  4KGV B;  4KGZ B;  1H3H A;  1W4S A;  4LXC A;  1BI3 A;  3S3O A;  2HBP A;  2OTL Q;  4JUV A;  1Q86 C;  2QG9 B;  3LH0 A;  4FU6 A;  5GAN g;  4OGC A;  3PIO A;  5LJ3 g;  1QKW A;  5GJW B;  5KYY A;  3SD4 A;  4A4K A;  1Y96 A;  4PJL A;  2MK5 A;  5DLQ E;  4CC7 A;  3HFO A;  2CUB A;  4M7A B;  3MPU B;  1NG2 A;  2MMP A;  2DJZ A;  2BIV A;  1VQ4 A;  3CCJ T;  1G3T A;  3J7A F;  1OZ3 A;  4J6W A;  4EMK C;  3NTK A;  3KXT A;  2BZX A;  1N8R C;  2DAQ A;  4PJO E;  2VVK A;  4B6M A;  4RTY A;  2ECZ A;  3L2U A;  3RER A;  2HSP A;  1UHF A;  2KRM A;  1YCY A;  2MF2 A;  4QVC A;  1VQ5 Q;  2E65 A;  4M77 F;  3L2Q A;  2P0P A;  3RMQ A;  5FRO A;  2GFU A;  3ER0 A;  2HDA A;  1KC8 R;  3C4S A;  3PMT A;  4M75 A;  5DY9 A;  2DXB A;  1RAE B;  1ZBX A;  2EJG A;  4M77 B;  4ZGD B;  2KDS A;  3MET A;  2FRY A;  1D09 B;  4M75 B;  2O4X B;  2O31 A;  4R56 A;  1BCM A;  4A53 A;  2VKN A;  4D8D A;  4FT4 A;  3JB9 I;  1PHT A;  1WXB A;  5GAM g;  3PVL A;  2OTJ A;  2YSQ A;  3SHW A;  1VOM A;  2E6N A;  4MZP A;  4M7D E;  1YHQ A;  2L3P A;  3HRT A;  2B86 A;  3OSS C;  3ZL7 C;  5CK9 A;  3MJX A;  2JM9 A;  4ANJ A;  2QAS A;  1VQK Q;  1K9M C;  1PSE A;  2FHD A;  2E4H A;  3CBM A;  2XIC A;  5LJ5 f;  1QVG P;  3CC2 T;  1Q86 R;  3REB B;  1YIT Q;  1FWZ A;  1ZSZ B;  4JJN K;  2ED1 A;  3M5A A;  2JM8 A;  1KQS P;  3SB2 A;  2MI6 A;  5J26 A;  1PM3 A;  4DEX A;  1ZA1 B;  3JCM P;  3TCJ A;  2DLP A;  3I56 T;  3NTI A;  2EGA A;  5GMK l;  3CPF A;  2J06 A;  2QA4 Q;  3M9Q A;  1N9S A;  3P8D A;  2V26 A;  3OS5 A;  3RR6 A;  3OYI A;  1WJS A;  4F14 A;  1UG1 A;  5DLO A;  4IUP A;  2JTF A;  3RKY A;  4ZGJ B;  3RKX A;  3VUZ A;  2EYX A;  3QPH A;  5DM7 R;  1WYX A;  3CME Q;  3QSU A;  3LWI A;  4AFZ C;  1WJQ A;  3TVT A;  2A3L A;  2D0Q B;  3FJP A;  1VQ5 A;  4KUL A;  3NTH A;  3G4S A;  3CCS A;  1CKB A;  2XID A;  2CZ6 B;  3QZ9 B;  4J8O A;  1YI2 Q;  1I8F A;  2K2M A;  3PGG A;  2DA9 A;  3GNG A;  1PRL C;  2JN0 A;  5HK0 A;  1Q81 R;  3AT1 B;  2A37 A;  3CXC S;  4E7S A;  1K1Z A;  1YIT T;  1AWW A;  1C6V X;  3GPL A;  5FLX E;  4PNO A;  1M4Z A;  1X2Q A;  4M78 F;  1QW1 A;  2G3R A;  2F2X A;  2KGT A;  1JB0 E;  1ZSG A;  1TUG B;  1W6X A;  1M1F A;  1OZ2 A;  2LJ3 A;  3JSC A;  5KYY B;  4D6W A;  1RAB B;  1LNX A;  3CQT A;  2CP3 A;  2CZ1 B;  1V1C A;  4F04 B;  2KVQ G;  3DLM A;  1UUE A;  2GGR A;  2EJF A;  4OMP A;  3RNJ A;  2X9H A;  5LJ5 g;  1N8R R;  4OML A;  1M1K U;  2JZ2 A;  2X4Y A;  4M7D F;  1QWE A;  3CC2 Q;  3I5R A;  3MP1 A;  2EYW A;  1ZQ1 A;  4WTO B;  2K79 A;  3A8H B;  1MMD A;  4AFQ C; 
#chains in the Genus database with same CATH homology
 5GJV B;  2DNU A;  5IH2 A;  2BZ8 A;  2LJ1 A;  2OAW A;  1MUZ A;  4GBQ A;  3I35 A;  1SRL A;  2DBM A;  4IIM A;  2A36 A;  1X43 A;  2RF0 A;  1WFW A;  1IO6 A;  2DX1 A;  2GTJ A;  4RUG A;  2PTK A;  1X6G A;  5IXF A;  2DL3 A;  1PNJ A;  2JS2 A;  3ULR B;  3RBB B;  1JXO A;  3VS3 A;  1BK2 A;  1NYG A;  2YUN A;  4J9F A;  2D8H A;  4KRT A;  2ESW A;  2EGC A;  1K0X A;  1YN8 A;  1X27 A;  1MV0 B;  2AZS A;  4CC2 A;  3EG2 A;  3UAT A;  2O9S A;  2L3Q A;  1RLP C;  4AFU C;  2DJQ A;  2AK5 A;  2CSQ A;  1G2B A;  1E6G A;  2KYB A;  1SPK A;  3M0P A;  2DVJ A;  2GTO A;  1WI7 A;  2JTE A;  1GL5 A;  1BB9 A;  3NGP A;  1LCK A;  1T0J A;  4WCI A;  1NLO C;  3JV3 A;  2CT4 A;  2PNI A;  4HVW A;  2DE0 X;  4J9I A;  1M27 C;  1U06 A;  5IHK A;  1Z9Z A;  2LMJ A;  1VYT A;  3VRZ A;  2ENM A;  4LN2 A;  4DEY A;  1ARK A;  4JZ4 A;  2LJ0 A;  2OI3 A;  4ZNX A;  3SEM A;  2SEM A;  2JXB A;  2C0T A;  2CDT A;  1KFZ A;  2CRE A;  2RQT A;  4GLM A;  2MIO A;  3R6N A;  3LH5 A;  1GFC A;  2FPE A;  1UJY A;  2RQR A;  1JU5 C;  1Y0M A;  2O2O A;  3U23 A;  2G6F X;  3VS1 A;  2YUQ A;  2FG0 A;  2CUD A;  1WX6 A;  1YCS B;  2LCS A;  1X6B A;  3C0C A;  4Y92 A;  2EKH A;  1Y57 A;  1PWT A;  2E5K A;  2L0A A;  2DYB A;  1SEM A;  1I0C A;  2X3W D;  1PRM C;  2LP5 A;  1PKS A;  2KRS A;  2FPF A;  1ZBJ A;  4AG1 C;  1M3A A;  4D8K A;  1ZUY A;  1QCF A;  3KFV A;  2C0O A;  1G83 A;  1QLY A;  1BBZ A;  2F2V A;  1RUW A;  4J9G A;  5IXB A;  2L2P A;  4K11 A;  1AZG B;  2CH4 A;  4HVU A;  4R0K A;  2DIL A;  3H41 A;  4EIK A;  2KBT A;  1M3C A;  2DRM A;  2K9G A;  2MCN A;  3UA6 A;  2CH4 W;  3EGU A;  2V1Q A;  4AFS C;  1B07 A;  3QWX X;  2YUP A;  4FSS A;  1UFF A;  2DL8 A;  1K0S A;  1AVZ C;  4J9E A;  4M4Z A;  5L23 A;  2ROL A;  2ROT A;  3UF4 A;  2JMA A;  2M0Y A;  5FW9 A;  1AEY A;  2J7I A;  3M0U A;  2RQV A;  2V1R A;  3TSW A;  1OPK A;  2FO0 A;  5FWC A;  1M8M A;  2LX7 A;  1AOJ A;  2EVR A;  3I9Q A;  2K3B A;  2AKL A;  2KE9 A;  1SRM A;  3NMZ C;  2DRK A;  4JJB A;  4X1V A;  2KR3 A;  4RTT A;  4RTV A;  2AZV A;  1NM7 A;  2EW3 A;  3EHQ A;  1K4U S;  2L3S A;  4HVV A;  2CSI A;  1ZUU A;  1XOV A;  4JPB W;  4Z88 A;  1WA7 A;  1TUC A;  2DL7 A;  5HCK A;  3VRY A;  1SHG A;  1NYF A;  2K7A A;  3M0Q A;  2KRN A;  1GCQ C;  3THK A;  1Z9Q A;  2W10 A;  4F17 A;  4E6R A;  1OOT A;  2QDL A;  2EGE A;  2J6K A;  2JS0 A;  4JJD A;  3H0F A;  2J6O A;  1GRI A;  2EPD A;  5I22 A;  3TSZ A;  3VS2 A;  1UTI A;  1HSQ A;  1U3O A;  2AKK A;  1KSW A;  1H92 A;  2YDL A;  3M0T A;  1FMK A;  1GCP A;  1AWO A;  2YT6 A;  2A28 A;  2F2W A;  1K76 A;  1ABO A;  4LNP A;  1H3H A;  1BU1 A;  1E6H A;  1VYV A;  1AD5 A;  2X3X D;  1YWP A;  5FWB A;  3PE0 A;  4Z8A A;  3VS7 A;  1X2K A;  2BTT A;  1T3S A;  1VA7 A;  4LUD A;  2BZY A;  1HJD A;  2HCK A;  2KXD A;  1QKW A;  1UGV A;  5GJW B;  2JT4 A;  2MOX A;  1WXU A;  1W70 A;  4A63 B;  1T3L A;  2XMF A;  4CC7 A;  2CUB A;  2KEA A;  3VS4 A;  2I0N A;  2K6D A;  3H0I A;  3VS0 A;  1NG2 A;  1WDX A;  1MV3 A;  1JEG A;  3VS6 A;  1SHF A;  2DMO A;  1GBQ A;  1SSH A;  2P4R A;  3A98 A;  2KRO A;  2BZX A;  2LNH B;  2VVK A;  4RTY A;  1VYU A;  2ECZ A;  3IQL A;  2LQN A;  3PVQ A;  1UEC A;  2DBK A;  2HSP A;  1UHF A;  5EC7 A;  2KRM A;  2SRC A;  2RPN A;  4OMM A;  2LZ6 B;  1EFN A;  4RTZ A;  2OJ2 A;  2HDA A;  4CC3 A;  4LUE A;  1B3Q A;  3M0R A;  2GNC A;  3QWY A;  1AWJ A;  1RLQ C;  1NEG A;  2ABL A;  2J6F A;  3O5Z A;  2NUZ A;  2RN8 A;  3GBQ A;  1NLP C;  4OMN A;  4RTW A;  2FRY A;  2RNA A;  2O31 A;  2VKN A;  3EG0 A;  3I5S A;  4IIO A;  4J9D A;  4D8D A;  3VS5 A;  1UDL A;  1PHT A;  1WXB A;  3PVL A;  2GBQ A;  2YSQ A;  1UE9 A;  3SHW A;  1QKX A;  1W1F A;  1QWF A;  1ZUK A;  2YUO A;  1OPL A;  2VWF A;  2L3P A;  4J9B A;  2CT3 A;  2B86 A;  3ZL7 C;  2JM9 A;  1YWO A;  1ZLM A;  2EYZ A;  3NHN A;  1CSK A;  4OMO A;  2JMC A;  2KT8 A;  2RMO A;  2RQU A;  1OEB A;  1WLP B;  3REB B;  2W0Z A;  1UJ0 A;  4HCK A;  1K9A A;  2D0N A;  1H8K A;  2ED1 A;  4F16 A;  1GBR A;  1JXM A;  2JM8 A;  1I1J A;  1KIK A;  1UHC A;  2NWM A;  5ECA A;  2PZ1 A;  4DEX A;  2FRW A;  5IHN A;  1J3T A;  2DLP A;  1ZX6 A;  4RTX A;  2EGA A;  4AG2 C;  2J06 A;  1CKA A;  1X69 A;  1E7O A;  1TG0 A;  1JQQ A;  3H0H A;  4F14 A;  1UG1 A;  2RQW A;  1U5S A;  2FEI A;  2DM1 A;  2D1X A;  2EYX A;  3REA B;  4LE9 A;  1NEB A;  1WYX A;  3EG3 A;  1M30 A;  4Z89 A;  3EHR A;  1YP5 A;  1RI9 A;  2EBP A;  2HBW A;  2HEQ A;  4AFZ C;  2A08 A;  1AWX A;  2O9V A;  3UA7 A;  3TVT A;  1CKB A;  2JW4 A;  2M51 A;  1ABQ A;  2K2M A;  2KNB B;  2DA9 A;  3FJ5 A;  1PRL C;  4J9H A;  2A37 A;  2EQI A;  4OMQ A;  1GFD A;  1PKT A;  3EG1 A;  2KT1 A;  1K1Z A;  2H8H A;  2KXC A;  1FYN A;  1YNZ A;  1AWW A;  1KJW A;  2IIM A;  1N5Z A;  4HXJ A;  4QT7 A;  1X2Q A;  3M0S A;  1M3B A;  4JJC A;  2GQI A;  2LQW A;  5I11 A;  2EYY A;  2DL5 A;  2F2X A;  2KGT A;  2O88 A;  1ZSG A;  4RTU A;  1OV3 A;  1I07 A;  1W6X A;  2LJ3 A;  5IHI A;  2ED0 A;  3NPF A;  4ORZ A;  1JO8 A;  1TUD A;  3CQT A;  1GCQ A;  1WIE A;  1V1C A;  1AZE A;  1UUE A;  4J9C A;  2GGR A;  1T0H A;  4OMP A;  3RNJ A;  1HD3 A;  1A0N B;  4OML A;  4CC4 B;  1WXT A;  1QWE A;  2J05 A;  2DF6 A;  4ESR A;  2D8J A;  1S1N A;  4JZ3 A;  2FPD A;  3I5R A;  2EYW A;  2DL4 A;  2K79 A;  2C0I A;  2KYM A;  4AFQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...