2ROLA

Structural basis of pxxdy motif recognition in sh3 binding
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
GSMGTAGKWVLCNYDFQARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of PxxDY motif recognition in SH3 binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/signaling protein
molecule keywords Epidermal growth factor receptor kinase substrate 8-like pro
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rolA00
3H41A 2O88A 2L3SA 3M0TA 2DM1A 1QLYA 2K2MA 1ZSGA 2LX7A 2LNHB 4J9EA 2RNAA 1PKTA 1NYFA 1RI9A 2JM9A 1WA7A 4ORZA 2O9VA 2M0YA 3QWYA 1Z9ZA 1X2QA 2PNIA 1SSHA 1HSQA 2A08A 4DEYA 4K11A 1CKAA 4KRTA 1WYXA 2RN8A 1W70A 1GL5A 2EYYA 3THKA 2CSQA 2W10A 1BBZA 1M3BA 2MIOA 3UATA 1T0HA 2CREA 2KEAA 2SRCA 3NMZC 1ABOA 1UE9A 2K6DA 2JTEA 1B3QA 4JZ3A 4Y92A 4CC7A 4J9BA 4LN2A 1AOJA 2LQWA 3SEMA 2HBWA 2KRSA 1NEBA 2DYBA 1OEBA 2EBPA 4QT7A 2EPDA 2M51A 1LCKA 1OPKA 1ABQA 1AWJA 3RBBB 1QWFA 2QDLA 2CH4A 2EKHA 3U23A 1B07A 1U06A 5ECAA 4IIOA 5GJWB 2RPNA 1I0CA 2KXCA 1AZGB 2J6FA 4M4ZA 2E5KA 1RLPC 4AG2C 1ZX6A 3IQLA 2KROA 2KBTA 1X69A 1X2KA 2K7AA 1UFFA 5I22A 4DEXA 2VWFA 2O31A 2HSPA 3FJ5A 2L3QA 1SEMA 2VVKA 3M0UA 2JM8A 2EYXA 1PKSA 3H0IA 1OPLA 1SRMA 1KSWA 1UG1A 1VA7A 2NUZA 4AFZC 2G6FX 1QKWA 4LUEA 3VS7A 1X27A 4GBQA 5IHKA 2DBMA 1S1NA 2ROTA 1E6GA 2DBKA 2D8JA 2EYZA 2X3WD 2XMFA 2BZXA 2ROLA 1T3SA 5FW9A 1WIEA 2J6KA 3EG3A 1GCQA 1TUCA 2JT4A 2FRWA 3O5ZA 2CH4W 1OV3A 2DLPA 1YNZA 4LNPA 4OMQA 2O2OA 2RQWA 1UECA 1GFCA 1M30A 3VS3A 4F16A 2EGAA 2J06A 1FMKA 2CUBA 1BK2A 4AG1C 2LZ6B 1WX6A 1NYGA 3I35A 1MV3A 4JJBA 1GBQA 2H8HA 5IH2A 2RQTA 2FPEA 1G83A 1Y0MA 1A0NB 1OOTA 2HDAA 2FG0A 2DL7A 4RTZA 1PNJA 3EG2A 2JS2A 1K0SA 4EIKA 2J6OA 1NLOC 2SEMA 2EQIA 2GBQA 2FEIA 4F14A 2O9SA 1MV0B 3R6NA 3NHNA 1HJDA 1YCSB 1PRLC 5IHIA 4A63B 1WLPB 1U3OA 1I1JA 2A28A 1GBRA 2ED1A 2I0NA 2EYWA 4AFSC 2DL5A 2FRYA 2PZ1A 2DRMA 2X3XD 2DL3A 1T0JA 2LQNA 4RUGA 2JW4A 1Z9QA 2FPFA 4JJCA 4Z8AA 5FWBA 3QWXX 4D8KA 2GQIA 2LJ3A 4OMNA 1QCFA 5IHNA 3M0RA 1TUDA 1AD5A 3NGPA 4AFUC 1X43A 1I07A 4CC2A 2LJ0A 1WXUA 2DL4A 2YUQA 2OI3A 1UJYA 4E6RA 2DJQA 2YT6A 2LJ1A 2K3BA 3RNJA 4OMMA 4JJDA 3A98A 4J9GA 1ZUKA 1RUWA 2YUNA 1W6XA 4J9CA 2DVJA 2ECZA 3I5RA 2AZVA 2KRNA 1GFDA 4OMLA 4J9DA 3ZL7C 2LMJA 4WCIA 1AWOA 1WXBA 2MCNA 2EGEA 1VYTA 1JQQA 2ABLA 1SHFA 1G2BA 1NLPC 2GTJA 1VYVA 4HVWA 3UA6A 4RTVA 1T3LA 2V1QA 4IIMA 2JMAA 1GCPA 3M0SA 1BU1A 3VS5A 2PTKA 1PRMC 2CT4A 2GGRA 4RTTA 1SHGA 2DE0X 3PVLA 3H0HA 2CDTA 2FO0A 2DL8A 1ZLMA 4JZ4A 5HCKA 1FYNA 2KGTA 2C0TA 2RF0A 4Z88A 1YP5A 1M8MA 1K4US 1YWOA 1GRIA 1M3CA 2AK5A 1CSKA 2B86A 1E6HA 4LE9A 2EVRA 3KFVA 1GCQC 4LUDA 2BTTA 4X1VA 2KYBA 2KYMA 2KR3A 1Y57A 4ZNXA 1K76A 2CSIA 2BZYA 3TVTA 2GNCA 4HVUA 2YUOA 1ZUYA 2ENMA 1U5SA 1UTIA 4RTXA 2C0OA 2CT3A 2KXDA 3I5SA 5EC7A 1EFNA 2D1XA 2DNUA 2ED0A 2AKLA 1M27C 1JU5C 2F2XA 1PHTA 2DILA 1AZEA 1WXTA 1K9AA 2K79A 4GLMA 1N5ZA 2VKNA 3VS2A 1PWTA 4D8DA 4FSSA 3TSZA 3VRYA 3H0FA 2F2WA 4AFQC 2OJ2A 4OMPA 1YWPA 4Z89A 3VS6A 1ARKA 1MUZA 1X6BA 1X6GA 2DA9A 3EG0A 3ULRB 4HCKA 4CC3A 4HXJA 2EW3A 4JPBW 1QKXA 1H92A 2A36A 2NWMA 5IXFA 2YSQA 2MOXA 3NPFA 3LH5A 2V1RA 1SRLA 3SHWA 2CUDA 3EGUA 4HVVA 2IIMA 1H3HA 1WFWA 2DF6A 4J9IA 3VS4A 4RTWA 2P4RA 1KFZA 2JXBA 1JO8A 4J9FA 2DX1A 1SPKA 2DMOA 2HCKA 1ZUUA 2JS0A 3REAB 5I11A 3VS0A 1AWWA 3REBB 2KT8A 4F17A 2RQUA 5GJVB 1KJWA 4CC4B 2RQVA 1J3TA 3TSWA 1YN8A 2C0IA 2GTOA 1K1ZA 3EHQA 1JXMA 2ESWA 2RMOA 2DRKA 2J7IA 1AWXA 1UHFA 3EG1A 3PVQA 1XOVA 1VYUA 1QWEA 2OAWA 3GBQA 1UJ0A 1UHCA 2AZSA 2KNBB 3M0QA 1BB9A 1NG2A 1NM7A 5IXBA 2FPDA 3VRZA 1E7OA 1WDXA 3M0PA 1NEGA 1KIKA 1AVZC 1V1CA 1W1FA 2BZ8A 1UUEA 2J05A 1JEGA 1UGVA 4R0KA 2JMCA 3EHRA 1TG0A 2L2PA 2D8HA 1RLQC 1UDLA 2D0NA 2F2VA 2L0AA 2AKKA 2K9GA 2KRMA 3C0CA 2KE9A 2KT1A 1K0XA 4ESRA 1M3AA 4RTYA 1H8KA 3I9QA 2LCSA 4OMOA 2LP5A 5FWCA 5L23A 3PE0A 3UA7A 3VS1A 1ZBJA 2YUPA 2RQRA 3UF4A 2A37A 2EGCA 2HEQA 1WI7A 1HD3A 1AEYA 2YDLA 4RTUA 1IO6A 3CQTA 3JV3A 4J9HA 2L3PA 1CKBA 2W0ZA 1JXOA
chains in the Genus database with same CATH superfamily
5EG2A 4C0DB 3OS5A 1N8RR 5KCOA 3E9GA 1B34B 3CCQA 1IGQA 3RKWA 4HA8A 3ER0A 2LX7A 1MNEA 2XDDA 4PLIA 5FU6C 1ZSZC 2YXYA 1WA7A 4ORZA 2MMPA 9ATCB 1W2BS 3A5ZB 1R0CB 2PNIA 2PU9B 1ZA1B 4BI3A 3EG9B 1VQ6A 3UT1A 3CCRT 2RHYA 3TU4K 2MIOA 5GAN3 1D1CA 1YJWA 1R0BG 4O5VA 2CREA 1YCYA 1ABOA 4L5GA 1D1BA 4LN2A 3RDVA 3SEMA 4QQ6A 2NUTB 1NEBA 1KD1U 1OEBA 2EBPA 2EPDA 3OYJA 1VQ8A 3G4ST 1ABQA 4M75A 1AWJA 1G3WA 1D0YA 3QDFA 1I5OB 1QWFA 4HCBA 2QQSA 2EKHA 3JCMJ 2NYSA 2Y4XA 1RLPC 3T9NA 1WHKA 1X2KA 2K7AA 3M55A 2JN0A 2VWFA 2O31A 1V76A 2DERA 2YRDA 3M0UA 3VYGA 2JM8A 2EYXA 3CCUQ 5KYYA 1PKSA 1OPLA 4J5YA 1UG1A 4M75F 8ATCB 2RO0A 2KI7A 3C4SA 1UGQB 4J7IA 1WPYA 4LUEA 4BI4A 1ZA2B 4C92F 2EJ9A 5GAMg 4PJOF 3GNFB 4E7HA 1MMAA 2DBKA 2EQMA 5I21A 4FW1A 2EJGA 1VQ5Q 2FYKA 1BI3A 2CKKA 3EH1A 3MEAA 1YHQA 3OYEA 2LVMA 2JT4A 3M4GA 4F04B 5GAMf 2MWOA 2MF2A 1D1AA 2RK2A 1MGQA 1YNZA 4LNPA 4OMQA 1TU0B 4M7DF 1PC0A 2J06A 2WSFE 1D0ZA 1JRIA 1M1GA 2M9UA 1VQOT 4OB1B 2CZ6B 4C92B 2M0OA 5CKDA 3OYBA 4DOVA 3CMEA 1Y0MA 4M78F 5LJ3f 1WQWA 4HKEA 1RAFB 1I4K1 2FG0A 4KGVB 4J6WA 4QQDA 2JS2A 1K0SA 4EIKA 1W4SA 3CMAT 2J6OA 3VYHB 5GANe 2SEMA 1YJWT 2D9TA 4CRIA 3CC7A 1FX7A 1WJSA 3PNWC 1RABB 1IHWA 3BDLA 5LJ3g 1YJNT 2O9SA 4PJLA 4C8QA 1KD1C 5FRNA 1M90R 3NHNA 1HJDA 1RAHB 3CCEA 5IHIA 4A63B 3TQ7P 2JZ2A 3PIOA 2RHZA 4JRIA 4IUQA 4DA4A 2DL3A 2PUOB 2LQNA 1BYMA 4JJCA 1YITA 1DJ7B 5M9OA 4J7FA 5GANh 2X4XA 4OMNA 5IHNA 1S72Q 1KD1R 4PJOA 3M54A 3VUBA 1TUDA 4AFUC 1I07A 2YUQA 4KT0E 2OI3A 3BY7A 1RAEB 2DXUA 4E6RA 4JJNK 2LJ1A 3L42A 1BIBA 1VQPT 1ZUKA 3DB4A 4OGEA 4ATOA 2YRVA 2ECZA 3I5RA 5A0GA 2AHJB 3WVDB 4OMLA 2O01E 1VQKA 2QDYB 3NTKA 1N9RA 2DXCA 4KGZB 3A8LB 3HHTB 1QVGS 3L2WA 4ZN1A 1SHFA 4PFOA 2ZPBB 6AT1B 1VYVA 4M75B 2R57A 2QGGA 1UEBA 2DVEA 1T3LA 2GQVA 2Z0WA 1SSFA 4BD3A 4N4GA 4X9DA 1C1AA 1KQ2A 3VKIA 2IG0A 4BDYA 4L59A 2GGRA 1Y96B 2LT1A 3HFOA 1U1SA 1VQ7A 1SHGA 2QQ9A 3A8MB 3QKJA 3C12A 4CI0C 1ZLMA 4DOWA 1RAAB 3X20B 2C0TA 1VQ7T 2RA2A 4C0DC 4Z88A 1M3CA 5A2QE 5KCHA 3CD6Q 2AK5A 4JLIA 1OZ2A 2YHTA 1G3TA 1E6HA 4LUDA 3M53A 4PJOC 3OW2S 4C8QE 2HBPA 2WSCE 4HVUA 3N5BB 2ENMA 1UTIA 4J6YA 3EH2A 4J6XA 2HQXA 2KXDA 2QG9B 2NUPA 2D1XA 3CC7T 3NFCA 1R8OB 2MAMA 2AKLA 1YJNA 4NS5A 2F2XA 1RAGB 1AZEA 3M57A 3CCSA 4M7AG 4D8DA 3CD6T 4RMOA 1M90U 3VRYA 1O75A 4OMPA 4B9XA 3VS6A 2DA9A 3EG0A 3ULRB 3TREA 3LGLA 4HXJA 2QAZA 2EW3A 4M7AB 1JJ2S 2IVWA 4M78A 5IXFA 2DETA 2MOXA 3I55T 2YRCA 2BKDN 3QO3A 1BCOA 3CCVA 1H3HA 2F5KA 5FU7C 4BY6C 1VQKT 4A54A 3E9FA 2P4RA 3L2VA 3JCMP 2JXBA 3EAEA 3QDRB 3QSUA 2DMOA 3UDCA 2JS0A 5KYYB 4FT4A 3VJPA 4C92D 4CC4B 2RQVA 3OA6A 1J3TA 5FLXE 3TSWA 1EIFA 1QVPA 1K73R 4BDZA 1K1ZA 3EHQA 2PUKB 2DFUA 1N8RC 1AWXA 1UHFA 3EG1A 3OSSC 3HRUA 5GAN5 2QGFB 4RG8A 3JCMh 4RKUE 1VQKQ 3M0QA 2QA4Q 3CBMA 1BB9A 4C5HA 2AT1B 1QVFA 2CP7A 1U1TA 2FPDA 1NEGA 2E6ZA 2XDBA 1YI2T 1VQLQ 1IRXA 1UUEA 2J05A 4A4GA 1QVGP 3MP1A 1UGVA 4E7SA 2D8HA 3PMTA 4XAXB 2AKKA 3C0CA 2K5LA 1Y71A 3OS0A 3I9QA 2R5AA 2LCSA 3LGFA 2COWA 5L23A 3UA7A 1BIAA 2D0QB 4LDUA 3VS1A 1OX8A 3DB3A 5CKBA 4KBMB 1JJ2P 2A37A 1O9SA 1VQLT 2VV5A 1GXIE 4LDWA 1VQ6Q 1CKBA 4C0FA 1JXOA 4N4HA 2V8KA 3JB9I 4F7UF 2DM1A 1LNXA 4X34A 4KUDK 2K2MA 3PMIA 4F7UB 3MPUB 2E10A 2RNAA 1PKTA 2I2LA 3BFMA 1NYFA 1RI9A 3P8DA 3CCLQ 3MEVA 1VQ5A 1VQNT 2O9VA 3CEYA 4QW2A 3QWYA 3OYFA 2D6FA 1HSQA 1WHHA 4K11A 1OQKA 4M7AF 3G71T 1W70A 1GL5A 3THKA 2XKOC 1BBZA 2RHUA 3NTHA 1Q86C 3UATA 1NZ9A 2KMTA 2KEAA 2KY9A 3NMZC 4M78E 2E12A 3L2UA 2K6DA 2JTEA 2RJCA 3EFSA 5GAN8 2DZCA 4QVDA 1ACMB 2LRQA 2HBWA 2KRSA 3CPFA 3CCVT 3I56Q 4JS4A 1PCXA 2DZ9A 2M51A 3MCAB 2XK0A 1OU8A 2ZCFB 3CC2A 2C06A 5LJ5h 2QDLA 2CS7A 3S3NA 1U06A 3KBGA 5ECAA 4IIOA 1I0CA 4VUBA 2KXCA 3OYKA 1K73U 4BB7A 2KROA 2KBTA 3EFOA 5J39A 1X69A 2DD5A 2QXFA 1VQPQ 4DEXA 1Y7XA 2EKOA 1IGUA 1SEMA 2PVGB 3JB9H 3J81E 1TWBA 3H0IA 3CCVQ 1SRMA 3WXMB 2FL7A 4PJJA 1WHGA 2A7YA 1QKWA 3VS7A 1Q81C 4FU6A 5IHKA 1S1NA 2ROTA 4MZPA 4PFZA 4EMKC 1VIEA 1M90C 3M59A 2D8JA 1PSFA 4LDYA 5GANj 4JUVA 2ZZDA 2BZXA 2NLUA 5FW9A 3S6WA 4C92C 4Z02A 1GCQA 2H3EB 3LYIA 3OS2A 5LJ3h 2FRWA 2X4JA 2RI2A 4QVZA 2QQRA 3CCET 2RQWA 1UECA 2P0KA 3BDUA 1WHJA 5IN1A 2MPXC 5GANd 2EGAA 3GLXA 2HL5C 2GFUA 1FMKA 2CUBA 4NOYA 4FSXA 2L3RA 4C0ZA 2OTLQ 2XI9A 2H8HA 4F7UE 3G7ZA 1VQLA 2EQJA 5GAOq 1PSEA 1TH7A 1WHMA 3H9NA 2OTJT 4A53A 3OYCA 4NL3A 3NTIA 4E47A 1NLOC 5LJ5f 2EAYA 1U8RA 4A4HA 1M4ZA 2ZPEB 5CQXA 2EJFA 2BE9B 2RI3A 2JJ9A 5LJ3j 1PRLC 1UGSB 1MHNA 1NJIC 1C6VX 1I1JA 1GBRA 4OB2B 4AFSC 2FRYA 2PZ1A 2X3XD 1WZOA 1T0JA 5DLQE 3CC4Q 4RUGA 3TEEA 1Z9QA 2FPFA 4QVCA 4Z8AA 3QHSA 3QWXX 2GQIA 1QP2A 1QCFA 2X9HA 3DKMA 2K5IA 3NGPA 1AD5A 3RIRA 2DL4A 1NPRA 3CC2T 2K2VA 2V8JA 4J9GA 1YI2A 1RUWA 3RERA 1N8RU 2VXFA 1W6XA 2YUNA 5GMKm 2CP2A 2VGNA 3RMQA 4PJOE 3QPHA 3CCUT 2KRNA 5KYUB 3GIBA 4J9DA 2LMJA 3FRNA 4WCIA 1S72A 3E2UA 5GMKj 3CCMT 4OF1A 3GF5A 2MCNA 1VYTA 4II1A 1OYXA 1JQQA 2ABLA 2HNIA 1G2BA 2EFIA 1PD1A 1XQHA 4HVWA 3UA6A 4RTVA 4LXCA 2O4XB 2GFAA 3C94A 2RB6A 3VS5A 2RHXA 2PTKA 1PRMC 3L2ZA 2CT4A 2X4YA 3OYLA 3HFNA 3UWNA 1VOMA 3OYMA 3MHXA 3KXTA 1MMNA 1Q81U 2KDSA 3PVLA 4IURA 1M5Q1 3META 4ME7A 2P0QA 2XDPA 5HCKA 4EMKA 2KGTA 2RF0A 4JRKA 1GRIA 3JCMb 3RMSA 3DLLA 1MMDA 3SD4A 4LE9A 2EVRA 4O6JA 3OMCA 2V26A 2QYZA 3OMGA 1Y57A 4M7AD 1KG1A 4PJOG 4KUIA 3CMAQ 2DEUA 5AT1B 1YJWQ 4RTXA 3ASKA 1VQMT 5LL6S 3MP6A 4BE0A 1VQ6T 1YJNQ 5EC7A 1EFNA 1BCMA 2ED0A 1JU5C 1Y07A 1WXTA 1K9AA 5GAMj 3FIFA 2O4XA 1N5ZA 4KH1B 4OVAA 3CCLA 4M7DA 2LCCA 1N9SA 4JS5A 1LJOA 2HMAA 2QTVA 4Z89A 3CCLT 3HRTA 1MUZA 2JUFA 5D6WA 3X24B 4JPBW 1QKXA 1VQMQ 1KHIA 2JVVA 4FL6A 2NWMA 3G71Q 1H641 1X01A 2YSQA 3NPFA 1TXQA 3LH5A 2CUDA 3MKDA 1F1BB 2A0FB 4ZTJA 3VS4A 1N27A 2L8DA 4RTWA 5HK0A 1K8AU 4ZGDB 2XICA 2DIGA 4IUUA 1JO8A 2DX1A 3EGDA 3REAB 5I11A 3VS0A 4MZTA 2RQUA 5CIUA 2PQWA 3CMET 4BE2A 4PJOD 3G6EA 1YN8A 2GTOA 4FW2A 3SWNA 4M78C 2CP3A 4GY5A 1JXMA 2ESWA 3M5AA 3QYGB 4QKUA 3OY9A 4PL6A 3CCMA 1OI1A 2RJEA 3I56A 1QWEA 2OAWA 1UJ0A 2MWPA 5CQYA 2KNBB 1NM7A 5GAOl 4JRQA 5FU6B 3WVEB 3M0PA 4JRPA 1M1KU 2LT4A 1AVZC 2DD4A 2FHDA 1W1FA 2RD1A 4OP0A 3CMEQ 3CCRA 2BIVA 5AYFA 3EHRA 3H6ZA 2LDMA 1XJWB 3GOXA 2V8IA 3MEWA 1Q86R 2D0NA 2DIQA 1VQNA 4LD9K 2L0AA 1Q81R 2K9GA 2KRMA 2HSEB 2KT1A 1K0XA 3M9QA 4EMGA 4BY6B 2FZKB 4OMOA 3OYIA 4BE1A 4C92A 4Q5WA 4R55A 3OBWA 1ZBJA 2YUPA 2DXBA 2RQRA 4J83A 4FYWB 3UF4A 3BE3A 2DTIA 4UC4A 3Q1JA 1AEYA 2QI2A 2LCLA 2YDLA 4DBFA 1IO6A 2F1LA 3CQTA 3I55A 2L3PA 3JCMQ 3CCJQ 3CXCS 3M0TA 2E3HA 1QVFS 2HQEA 2HAXA 4ZGJB 3EFOB 4J9EA 2QQAA 2CGHA 4M7DE 2M0YA 3DLMA 1Z9ZA 1X2QA 4FYYB 1SSHA 1CKAA 2RN8A 3I55Q 2W10A 3QIIA 3JB9J 1M3BA 1BI2A 2G3RA 4OB0B 4C92E 2RJDA 2P0PA 3G6ET 2K3XA 4C5IA 2XG8D 3E19A 2LQWA 5GAN7 2DAQA 1D0XA 3L1AA 4LD6A 4N0AC 1LCKA 1OPKA 5GMKh 2HQHA 3E1SA 3LW5E 1YIJA 3V8JA 1R77A 4DQ2A 1B07A 1KQSS 2RPNA 3A8HB 1ZX6A 1QCNA 5CR2A 4E7JA 3QXEB 5KYUA 4E7KA 2FVUA 2L3QA 2VVKA 2P84A 4PNOA 2DPPB 1UB4A 5GAMe 1KSWA 1VA7A 1I81A 2HL3A 2NUZA 4L6V5 3X28B 4AFZC 1M1KR 1P92A 5HK3A 5GMKe 1X27A 1RL2A 1E6GA 3JAME 3JB9F 2EYZA 2X3WD 2RK1A 1IB8A 1T3SA 1Q86U 4C92G 1WJRA 1WIEA 1ZBXA 3MEUA 1TUCA 3JCMf 3CMAA 4C8QF 3O5ZA 4EPCA 3EGXA 1OV3A 2OAUA 4M77A 2DLPA 4BI8B 2B8AA 3JCMW 2MK5A 2ZPIB 2K5FA 4V2SA 3M4YA 2CP0A 3HRSA 1NYGA 1MV3A 4JJBA 3JCMe 2HKQB 4ELYC 2RQTA 2FPEA 3URGA 1G83A 1RAIB 3M58A 3CD6A 2HDAA 1XTDA 4RTZA 1PNJA 1VUBA 3EG2A 4XTZA 1HYOA 4R56A 3L2QA 3L2RA 2EQIA 4XTWA 5L8RE 2QTXA 2LTOA 2FEIA 4F14A 2DXTA 5KYNA 4D6WA 1TOVA 1VQOQ 1Q82R 1MV0B 2RI5A 4HT9A 3R6NA 1YCSB 4EDUA 5GAMd 1WLPB 1M2VA 4KULA 2XD0A 3SWNC 2L5QA 2QEXT 3JCMX 2DL5A 1QP3A 2F69A 1NPPA 1Y96A 2E64A 5LJ5j 3CCJA 4KGXB 3PIPA 3HP9A 4F7UA 2X51A 2RHIA 5FWBA 4D8KA 1B7TA 4M7AE 4BUGA 5CKFA 2RH2A 5J3BA 3EFRA 4C8QC 2LJ0A 1WXUA 5D6YA 1UJYA 1FXXA 2K3BA 3RNJA 4M77C 4OMMA 3A98A 2VB6A 1D09B 3CPWS 3OYHA 4XU0A 4LDXA 3RESA 4J9CA 2QEXQ 3CC4A 4C8QB 2DVJA 5I2SA 2AZVA 2XIDA 4GLKA 3X26B 4HCZA 2R58A 3ZL7C 1KC8R 2E70A 2EYQA 1IHVA 4XTYA 1OX9A 2EGEA 2ATCB 3TCJA 3OSVA 3CBPA 4OGCA 2PVOB 4IIMA 8AT1B 4HCCA 1VQPA 3A1PA 2JMAA 1I5LA 1GCPA 2XU8A 3M0SA 2MI6A 4MMKA 4RTTA 2DE0X 3BW1A 5GAOn 3CC7Q 3H0HA 2CDTA 2FO0A 2DL8A 4XTUA 5HKCA 4JZ4A 4ZGEB 1D3BB 1K9MR 4E7IA 1K4US 1YWOA 3LX7A 1X6OA 4FT2A 1AT1B 1B34A 2K3YA 2BTTA 5GAN6 2KYBA 2KR3A 4ZNXA 2CSIA 3TVTA 2GNCA 1MNDA 2YUOA 3VV0A 5A0LA 2COZA 2DYIA 3PFSA 2HKNA 2CT3A 5GANf 3I5SA 1VQMA 1W2BP 2DNUA 1K9MC 2ZPFB 1PHTA 3CCJT 4GLMA 1VQ7Q 1JBMA 2KK4A 2VKNA 4M75C 3VS2A 1Q82U 4RCCA 3P8HA 4FSSA 1SKUB 4M75E 4FYXB 4AFQC 1YWPA 4ZTFA 1BI0A 3FJPA 4LDVA 3GPLA 4M78D 1X6BA 1X6GA 5C0MA 4C5EA 3SB2A 2X35A 3FLGA 2ZAEA 3JCMg 4MMLA 1H92A 1M8VA 3CCRQ 1TS9A 4XTVA 4M77B 3PTAA 3EGUA 4A4FA 1LOJA 2IIMA 3OQ5A 1JB0E 1WFWA 4M7DC 2DF6A 3CC2Q 1YHQT 3CXCP 3CCSQ 1KFZA 2QA4T 2E3IA 3J7AF 1RADB 1SPKA 2HCKA 1ZUUA 2VGMA 2FZGB 1AHJB 1OZ3A 1YI2Q 3REBB 2KT8A 4F17A 1KJWA 4IUTA 3LH0A 2C0IA 3JB9D 4M78G 4E2FB 3FEOA 2K57A 1PG5B 3CCMQ 2M1HA 2RMOA 2DRKA 2J7IA 5GMKl 4AT1B 1KC8U 1Q95G 4XK8E 3PGGA 2NUPB 4EMKB 1VYUA 4HT8A 2E1HA 2E5QA 1YITQ 2ZPGB 1KQ1A 1NE8A 2LX9A 3GBQA 5GAMh 1YHQQ 2AZSA 1NG2A 2CYZB 1QCOA 1I8FA 3CBOA 5IXBA 1IZ6A 5LJ3d 5C6SA 1ZSZB 3ME9A 1V1CA 3OYGA 3HTRA 3HPWA 1M9SA 2JMCA 1RLQC 2F2VA 3CPWP 2KE9A 4ESRA 1H8KA 3VU3C 3OYDA 5KE2A 2R5MA 2LP5A 3A8OB 3PE0A 1K9MU 2YWWA 4OB3B 1WI7A 3LWIA 1HD3A 4M7DB 5GAN2 5KYWB 2Y4YA 3RR6A 1PM3A 3JV3A 1ZHIA 3H41A 3ZEHA 4AMCA 3S3MA 2O88A 2L3SA 2PVDB 3RKYA 1M2OA 1QLYA 3HKSA 4XU3A 1ZSGA 2E4HA 3A8GB 2JTFA 2LNHB 4XTXA 4A4EA 4ZN3A 4PJOB 3JB9G 2JM9A 3OS1A 3I56T 4M77F 1H3ZA 3QUIA 2A08A 4DEYA 4F7UG 3CPWA 4MDXA 3AT1B 4KRTA 1WYXA 4QQGA 5KYWA 3OW2P 2MYSA 2EYYA 2CSQA 1WGSA 1WQ7A 2JTMA 3RUXA 1EZZB 3V8KA 2QK0A 2H3JA 3RKXA 1OU9A 1T0HA 1SF9A 1G3YA 2SRCA 4ELZC 4OMFB 1UE9A 5LJ5g 4E7ZA 1JJ2A 1B3QA 4JZ3A 4Y92A 2RJFA 1D3BA 4CC7A 4J9BA 1AOJA 2DK3A 2DYBA 1VQNQ 4QT7A 3V7CA 4M7AA 2KAFA 3RBBB 2CH4A 3U23A 1S72T 2EQUA 3JSCA 5GJWB 3G71A 4JLGA 1G8XA 1AZGB 2J6FA 2DEQA 4M4ZA 2E5KA 4AG2C 3IQLA 2QQBA 2EIFA 3X25B 2BUDA 1UFFA 5I22A 3FJ5A 2HSPA 3OW2A 5CO7A 3CCEQ 1Q7YC 2VXEA 1WHLA 1BKBA 4MDWA 1QQJA 2G6FX 1WNLA 2BE7D 5DY9A 5GAOp 4GBQA 1OULA 4YTLA 2DBMA 3OYAA 4B9WA 2WACA 2EWNA 2XMFA 4E7LA 3JRZA 2ROLA 5A0DA 5HY6A 1YJ9T 3JCMV 2OX7A 3AHUA 2F5TX 3V7RA 2J6KA 3EG3A 4Y28E 4P5NA 2JOYA 2CH4W 3V7SA 1K8AR 1YJ9A 2X4WA 1M1FA 2E41A 2O2OA 1G3SA 1YIJQ 1GFCA 1M30A 3VS3A 4F16A 3UPUA 5GAOm 1BK2A 4AG1C 2K4YA 2LZ6B 4J8OA 5LJ5e 3FC3A 1WX6A 3I35A 4M77E 4NL2A 1GBQA 4MZMA 1VIFA 5IH2A 4IKFA 3JCMd 4FIBA 1NJIR 1A0NB 1OOTA 3J80E 3CCUA 1C0MA 5CCAA 2DL7A 1ZSZA 4RG2A 1TUGB 3QJYA 2DKGA 5D7UA 5KYXB 1KC8C 3OYYA 1G5VA 1YIJT 3KUFA 4N0AA 1VQOA 2GBQA 1M1KC 2ZPHB 1QVFP 1KK7A 2OTLT 1KQSA 3H8ZA 7AT1B 2LQKA 3OBYA 4A4KA 1U3OA 3G6EQ 2A28A 2ED1A 2I0NA 2EYWA 2VC8A 1QVGA 2DRMA 2NUTA 1KHCA 3OYNA 2OTJQ 5DLOA 2LNVA 5GAN4 2JW4A 1HXDA 5LJ3e 3GNGA 1WJQA 1VQ4A 1X75C 2JNGA 3G4SQ 3SWNB 2IPOB 3HL8A 2KSSA 4JDSA 5CKEA 5FRMA 2LJ3A 4DBQA 2HZYA 3M0RA 2FB7A 4C8QG 5IT9E 1X43A 1VQ8Q 4CC2A 3LLRA 2DTOA 2DJQA 1FMWA 2YT6A 3QYHB 2GCXA 4PJMA 4M77G 4JJDA 1M2VB 2CP5A 1UGRB 3QZ9B 3CCST 4PFPA 5CKHA 5GANg 5FROA 3CC4T 1TTHB 4X9CA 2OTJA 1GFDA 1LPLA 2Y90A 1KQSP 1AWOA 2CZ1B 1WXBA 2EQKA 1ZQ1A 4IUPA 3CXCA 3EGXB 1K73C 1UGPB 1VQ8T 4PKCC 4DBRA 1VQ5T 1NLPC 2GTJA 1YITT 2DJZA 4TVRA 2V1QA 1NBEB 1V29B 4BACA 1BU1A 1Q7YU 5FU7B 4FYVB 2HD0A 4M75D 3SFMA 4KH0B 1FYNA 2CP6A 5KH6A 1YP5A 1M8MA 3ZFJA 1VQ9Q 2CZ0B 2QEXA 1CSKA 5D6XA 4M77D 3M56A 3QJ6A 2B86A 4XU2A 3KFVA 3R6OA 1GCQC 4C5GA 4PLLA 5KYXA 4X1VA 2KYMA 2M02A 5GMKi 1K76A 2BZYA 1PD0A 5J26A 1ZUYA 5I2MA 1NJIU 1U5SA 2VYTA 2E6NA 2WSEE 4PK4A 1Q82C 2C0OA 1FWZA 1VQ4Q 5GAOr 2KVQG 1TSFA 1M27C 4FCYA 3FB9A 4M7DD 2LQ8A 2DILA 2K79A 4M75G 5IAYA 3SDZA 1VQ9T 1HK9A 2P4TA 4M7AC 2VASA 1PWTA 1YBYA 4PJNA 3TSZA 2E65A 3H0FA 2F2WA 2OJ2A 1VQ9A 2YLCA 1IREB 1ARKA 1IXDA 4HCKA 4CC3A 4FM4B 5CVIA 1VQ4T 2A36A 3QBYA 2V1RA 1SRLA 3P8BB 3SHWA 2CZ7B 3V8LA 4HVVA 3MO8A 4IUVA 4RCBA 4M7DG 4J9IA 1SG5A 3QG1A 4J9FA 4WTOB 1QW1A 2QA4A 1W2BA 2DO3A 1XNIA 3OB9A 2DTHA 2KQWA 3MP8A 1AWWA 3EGDB 5GJVB 1MMGA 3O8VA 3EG9A 2XHCA 4EMHA 5KE3A 2FZCB 4ANJA 3S3OA 3PVQA 4N4IA 5CK9A 1XOVA 1BI1A 4XQ3A 3G4SA 1YFNA 4C8QD 2COYA 4XU1A 4Y91A 1RACB 2A3LA 1UHCA 2QASA 3C95A 3ZBDA 3VRZA 1E7OA 3VUZA 1WDXA 1KIKA 2M16A 2L89A 3LWHA 2BZ8A 3INZA 2AIRB 3F70A 1JEGA 3CCQQ 1N6AA 1Q7YR 2LC4A 1FMVA 4B6MA 4C0GA 4R0KA 1TG0A 5CAIA 3HSBA 2L2PA 5LJ5d 3FDRA 1UDLA 2YLBA 4DBHA 4M78B 2RM4A 3JCMc 1M3AA 4RTYA 5DM7R 1YJ9Q 3PT9A 5FWCA 2VUBA 1QMCA 3MJXA 4WF2A 1RI0A 2EGCA 2HEQA 2GF7A 3GP8A 2OTLA 1EX4A 2ZGWA 4RTUA 3CCQT 1K8AC 3G1JA 3QZ5B 3D7SB 1LVKA 4J9HA 2W0ZA
chains in the Genus database with same CATH topology
3H41A 2O88A 2L3SA 3M0TA 2DM1A 1QLYA 2K2MA 1ZSGA 2LX7A 2LNHB 4J9EA 2RNAA 1PKTA 1NYFA 1RI9A 2JM9A 1WA7A 4ORZA 2O9VA 2M0YA 3QWYA 1Z9ZA 1X2QA 2PNIA 1SSHA 1HSQA 2A08A 4DEYA 4K11A 1CKAA 4KRTA 1WYXA 2RN8A 1W70A 1GL5A 2EYYA 3THKA 2CSQA 2W10A 1BBZA 1M3BA 2MIOA 3UATA 1T0HA 2CREA 2KEAA 2SRCA 3NMZC 1ABOA 1UE9A 2K6DA 2JTEA 1B3QA 4JZ3A 4Y92A 4CC7A 4J9BA 4LN2A 1AOJA 2LQWA 3SEMA 2HBWA 2KRSA 1NEBA 2DYBA 1OEBA 2EBPA 4QT7A 2EPDA 2M51A 1LCKA 1OPKA 1ABQA 1AWJA 3RBBB 1QWFA 2QDLA 2CH4A 2EKHA 3U23A 1B07A 1U06A 5ECAA 4IIOA 5GJWB 2RPNA 1I0CA 2KXCA 1AZGB 2J6FA 4M4ZA 2E5KA 1RLPC 4AG2C 1ZX6A 3IQLA 2KROA 2KBTA 1X69A 1X2KA 2K7AA 1UFFA 5I22A 4DEXA 2VWFA 2O31A 2HSPA 3FJ5A 2L3QA 1SEMA 2VVKA 3M0UA 2JM8A 2EYXA 1PKSA 3H0IA 1OPLA 1SRMA 1KSWA 1UG1A 1VA7A 2NUZA 4AFZC 2G6FX 1QKWA 4LUEA 3VS7A 1X27A 4GBQA 5IHKA 2DBMA 1S1NA 2ROTA 1E6GA 2DBKA 2D8JA 2EYZA 2X3WD 2XMFA 2BZXA 2ROLA 1T3SA 5FW9A 1WIEA 2J6KA 3EG3A 1GCQA 1TUCA 2JT4A 2FRWA 3O5ZA 2CH4W 1OV3A 2DLPA 1YNZA 4LNPA 4OMQA 2O2OA 2RQWA 1UECA 1GFCA 1M30A 3VS3A 4F16A 2EGAA 2J06A 1FMKA 2CUBA 1BK2A 4AG1C 2LZ6B 1WX6A 1NYGA 3I35A 1MV3A 4JJBA 1GBQA 2H8HA 5IH2A 2RQTA 2FPEA 1G83A 1Y0MA 1A0NB 1OOTA 2HDAA 2FG0A 2DL7A 4RTZA 1PNJA 3EG2A 2JS2A 1K0SA 4EIKA 2J6OA 1NLOC 2SEMA 2EQIA 2GBQA 2FEIA 4F14A 2O9SA 1MV0B 3R6NA 3NHNA 1HJDA 1YCSB 1PRLC 5IHIA 4A63B 1WLPB 1U3OA 1I1JA 2A28A 1GBRA 2ED1A 2I0NA 2EYWA 4AFSC 2DL5A 2FRYA 2PZ1A 2DRMA 2X3XD 2DL3A 1T0JA 2LQNA 4RUGA 2JW4A 1Z9QA 2FPFA 4JJCA 4Z8AA 5FWBA 3QWXX 4D8KA 2GQIA 2LJ3A 4OMNA 1QCFA 5IHNA 3M0RA 1TUDA 1AD5A 3NGPA 4AFUC 1X43A 1I07A 4CC2A 2LJ0A 1WXUA 2DL4A 2YUQA 2OI3A 1UJYA 4E6RA 2DJQA 2YT6A 2LJ1A 2K3BA 3RNJA 4OMMA 4JJDA 3A98A 4J9GA 1ZUKA 1RUWA 2YUNA 1W6XA 4J9CA 2DVJA 2ECZA 3I5RA 2AZVA 2KRNA 1GFDA 4OMLA 4J9DA 3ZL7C 2LMJA 4WCIA 1AWOA 1WXBA 2MCNA 2EGEA 1VYTA 1JQQA 2ABLA 1SHFA 1G2BA 1NLPC 2GTJA 1VYVA 4HVWA 3UA6A 4RTVA 1T3LA 2V1QA 4IIMA 2JMAA 1GCPA 3M0SA 1BU1A 3VS5A 2PTKA 1PRMC 2CT4A 2GGRA 4RTTA 1SHGA 2DE0X 3PVLA 3H0HA 2CDTA 2FO0A 2DL8A 1ZLMA 4JZ4A 5HCKA 1FYNA 2KGTA 2C0TA 2RF0A 4Z88A 1YP5A 1M8MA 1K4US 1YWOA 1GRIA 1M3CA 2AK5A 1CSKA 2B86A 1E6HA 4LE9A 2EVRA 3KFVA 1GCQC 4LUDA 2BTTA 4X1VA 2KYBA 2KYMA 2KR3A 1Y57A 4ZNXA 1K76A 2CSIA 2BZYA 3TVTA 2GNCA 4HVUA 2YUOA 1ZUYA 2ENMA 1U5SA 1UTIA 4RTXA 2C0OA 2CT3A 2KXDA 3I5SA 5EC7A 1EFNA 2D1XA 2DNUA 2ED0A 2AKLA 1M27C 1JU5C 2F2XA 1PHTA 2DILA 1AZEA 1WXTA 1K9AA 2K79A 4GLMA 1N5ZA 2VKNA 3VS2A 1PWTA 4D8DA 4FSSA 3TSZA 3VRYA 3H0FA 2F2WA 4AFQC 2OJ2A 4OMPA 1YWPA 4Z89A 3VS6A 1ARKA 1MUZA 1X6BA 1X6GA 2DA9A 3EG0A 3ULRB 4HCKA 4CC3A 4HXJA 2EW3A 4JPBW 1QKXA 1H92A 2A36A 2NWMA 5IXFA 2YSQA 2MOXA 3NPFA 3LH5A 2V1RA 1SRLA 3SHWA 2CUDA 3EGUA 4HVVA 2IIMA 1H3HA 1WFWA 2DF6A 4J9IA 3VS4A 4RTWA 2P4RA 1KFZA 2JXBA 1JO8A 4J9FA 2DX1A 1SPKA 2DMOA 2HCKA 1ZUUA 2JS0A 3REAB 5I11A 3VS0A 1AWWA 3REBB 2KT8A 4F17A 2RQUA 5GJVB 1KJWA 4CC4B 2RQVA 1J3TA 3TSWA 1YN8A 2C0IA 2GTOA 1K1ZA 3EHQA 1JXMA 2ESWA 2RMOA 2DRKA 2J7IA 1AWXA 1UHFA 3EG1A 3PVQA 1XOVA 1VYUA 1QWEA 2OAWA 3GBQA 1UJ0A 1UHCA 2AZSA 2KNBB 3M0QA 1BB9A 1NG2A 1NM7A 5IXBA 2FPDA 3VRZA 1E7OA 1WDXA 3M0PA 1NEGA 1KIKA 1AVZC 1V1CA 1W1FA 2BZ8A 1UUEA 2J05A 1JEGA 1UGVA 4R0KA 2JMCA 3EHRA 1TG0A 2L2PA 2D8HA 1RLQC 1UDLA 2D0NA 2F2VA 2L0AA 2AKKA 2K9GA 2KRMA 3C0CA 2KE9A 2KT1A 1K0XA 4ESRA 1M3AA 4RTYA 1H8KA 3I9QA 2LCSA 4OMOA 2LP5A 5FWCA 5L23A 3PE0A 3UA7A 3VS1A 1ZBJA 2YUPA 2RQRA 3UF4A 2A37A 2EGCA 2HEQA 1WI7A 1HD3A 1AEYA 2YDLA 4RTUA 1IO6A 3CQTA 3JV3A 4J9HA 2L3PA 1CKBA 2W0ZA 1JXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H41 A;  2O88 A;  2L3S A;  3M0T A;  2DM1 A;  1QLY A;  2K2M A;  1ZSG A;  2LX7 A;  2LNH B;  4J9E A;  2RNA A;  1PKT A;  1NYF A;  1RI9 A;  2JM9 A;  1WA7 A;  4ORZ A;  2O9V A;  2M0Y A;  3QWY A;  1Z9Z A;  1X2Q A;  2PNI A;  1SSH A;  1HSQ A;  2A08 A;  4DEY A;  4K11 A;  1CKA A;  4KRT A;  1WYX A;  2RN8 A;  1W70 A;  1GL5 A;  2EYY A;  3THK A;  2CSQ A;  2W10 A;  1BBZ A;  1M3B A;  2MIO A;  3UAT A;  1T0H A;  2CRE A;  2KEA A;  2SRC A;  3NMZ C;  1ABO A;  1UE9 A;  2K6D A;  2JTE A;  1B3Q A;  4JZ3 A;  4Y92 A;  4CC7 A;  4J9B A;  4LN2 A;  1AOJ A;  2LQW A;  3SEM A;  2HBW A;  2KRS A;  1NEB A;  2DYB A;  1OEB A;  2EBP A;  4QT7 A;  2EPD A;  2M51 A;  1LCK A;  1OPK A;  1ABQ A;  1AWJ A;  3RBB B;  1QWF A;  2QDL A;  2CH4 A;  2EKH A;  3U23 A;  1B07 A;  1U06 A;  5ECA A;  4IIO A;  5GJW B;  2RPN A;  1I0C A;  2KXC A;  1AZG B;  2J6F A;  4M4Z A;  2E5K A;  1RLP C;  4AG2 C;  1ZX6 A;  3IQL A;  2KRO A;  2KBT A;  1X69 A;  1X2K A;  2K7A A;  1UFF A;  5I22 A;  4DEX A;  2VWF A;  2O31 A;  2HSP A;  3FJ5 A;  2L3Q A;  1SEM A;  2VVK A;  3M0U A;  2JM8 A;  2EYX A;  1PKS A;  3H0I A;  1OPL A;  1SRM A;  1KSW A;  1UG1 A;  1VA7 A;  2NUZ A;  4AFZ C;  2G6F X;  1QKW A;  4LUE A;  3VS7 A;  1X27 A;  4GBQ A;  5IHK A;  2DBM A;  1S1N A;  2ROT A;  1E6G A;  2DBK A;  2D8J A;  2EYZ A;  2X3W D;  2XMF A;  2BZX A;  2ROL A;  1T3S A;  5FW9 A;  1WIE A;  2J6K A;  3EG3 A;  1GCQ A;  1TUC A;  2JT4 A;  2FRW A;  3O5Z A;  2CH4 W;  1OV3 A;  2DLP A;  1YNZ A;  4LNP A;  4OMQ A;  2O2O A;  2RQW A;  1UEC A;  1GFC A;  1M30 A;  3VS3 A;  4F16 A;  2EGA A;  2J06 A;  1FMK A;  2CUB A;  1BK2 A;  4AG1 C;  2LZ6 B;  1WX6 A;  1NYG A;  3I35 A;  1MV3 A;  4JJB A;  1GBQ A;  2H8H A;  5IH2 A;  2RQT A;  2FPE A;  1G83 A;  1Y0M A;  1A0N B;  1OOT A;  2HDA A;  2FG0 A;  2DL7 A;  4RTZ A;  1PNJ A;  3EG2 A;  2JS2 A;  1K0S A;  4EIK A;  2J6O A;  1NLO C;  2SEM A;  2EQI A;  2GBQ A;  2FEI A;  4F14 A;  2O9S A;  1MV0 B;  3R6N A;  3NHN A;  1HJD A;  1YCS B;  1PRL C;  5IHI A;  4A63 B;  1WLP B;  1U3O A;  1I1J A;  2A28 A;  1GBR A;  2ED1 A;  2I0N A;  2EYW A;  4AFS C;  2DL5 A;  2FRY A;  2PZ1 A;  2DRM A;  2X3X D;  2DL3 A;  1T0J A;  2LQN A;  4RUG A;  2JW4 A;  1Z9Q A;  2FPF A;  4JJC A;  4Z8A A;  5FWB A;  3QWX X;  4D8K A;  2GQI A;  2LJ3 A;  4OMN A;  1QCF A;  5IHN A;  3M0R A;  1TUD A;  1AD5 A;  3NGP A;  4AFU C;  1X43 A;  1I07 A;  4CC2 A;  2LJ0 A;  1WXU A;  2DL4 A;  2YUQ A;  2OI3 A;  1UJY A;  4E6R A;  2DJQ A;  2YT6 A;  2LJ1 A;  2K3B A;  3RNJ A;  4OMM A;  4JJD A;  3A98 A;  4J9G A;  1ZUK A;  1RUW A;  2YUN A;  1W6X A;  4J9C A;  2DVJ A;  2ECZ A;  3I5R A;  2AZV A;  2KRN A;  1GFD A;  4OML A;  4J9D A;  3ZL7 C;  2LMJ A;  4WCI A;  1AWO A;  1WXB A;  2MCN A;  2EGE A;  1VYT A;  1JQQ A;  2ABL A;  1SHF A;  1G2B A;  1NLP C;  2GTJ A;  1VYV A;  4HVW A;  3UA6 A;  4RTV A;  1T3L A;  2V1Q A;  4IIM A;  2JMA A;  1GCP A;  3M0S A;  1BU1 A;  3VS5 A;  2PTK A;  1PRM C;  2CT4 A;  2GGR A;  4RTT A;  1SHG A;  2DE0 X;  3PVL A;  3H0H A;  2CDT A;  2FO0 A;  2DL8 A;  1ZLM A;  4JZ4 A;  5HCK A;  1FYN A;  2KGT A;  2C0T A;  2RF0 A;  4Z88 A;  1YP5 A;  1M8M A;  1K4U S;  1YWO A;  1GRI A;  1M3C A;  2AK5 A;  1CSK A;  2B86 A;  1E6H A;  4LE9 A;  2EVR A;  3KFV A;  1GCQ C;  4LUD A;  2BTT A;  4X1V A;  2KYB A;  2KYM A;  2KR3 A;  1Y57 A;  4ZNX A;  1K76 A;  2CSI A;  2BZY A;  3TVT A;  2GNC A;  4HVU A;  2YUO A;  1ZUY A;  2ENM A;  1U5S A;  1UTI A;  4RTX A;  2C0O A;  2CT3 A;  2KXD A;  3I5S A;  5EC7 A;  1EFN A;  2D1X A;  2DNU A;  2ED0 A;  2AKL A;  1M27 C;  1JU5 C;  2F2X A;  1PHT A;  2DIL A;  1AZE A;  1WXT A;  1K9A A;  2K79 A;  4GLM A;  1N5Z A;  2VKN A;  3VS2 A;  1PWT A;  4D8D A;  4FSS A;  3TSZ A;  3VRY A;  3H0F A;  2F2W A;  4AFQ C;  2OJ2 A;  4OMP A;  1YWP A;  4Z89 A;  3VS6 A;  1ARK A;  1MUZ A;  1X6B A;  1X6G A;  2DA9 A;  3EG0 A;  3ULR B;  4HCK A;  4CC3 A;  4HXJ A;  2EW3 A;  4JPB W;  1QKX A;  1H92 A;  2A36 A;  2NWM A;  5IXF A;  2YSQ A;  2MOX A;  3NPF A;  3LH5 A;  2V1R A;  1SRL A;  3SHW A;  2CUD A;  3EGU A;  4HVV A;  2IIM A;  1H3H A;  1WFW A;  2DF6 A;  4J9I A;  3VS4 A;  4RTW A;  2P4R A;  1KFZ A;  2JXB A;  1JO8 A;  4J9F A;  2DX1 A;  1SPK A;  2DMO A;  2HCK A;  1ZUU A;  2JS0 A;  3REA B;  5I11 A;  3VS0 A;  1AWW A;  3REB B;  2KT8 A;  4F17 A;  2RQU A;  5GJV B;  1KJW A;  4CC4 B;  2RQV A;  1J3T A;  3TSW A;  1YN8 A;  2C0I A;  2GTO A;  1K1Z A;  3EHQ A;  1JXM A;  2ESW A;  2RMO A;  2DRK A;  2J7I A;  1AWX A;  1UHF A;  3EG1 A;  3PVQ A;  1XOV A;  1VYU A;  1QWE A;  2OAW A;  3GBQ A;  1UJ0 A;  1UHC A;  2AZS A;  2KNB B;  3M0Q A;  1BB9 A;  1NG2 A;  1NM7 A;  5IXB A;  2FPD A;  3VRZ A;  1E7O A;  1WDX A;  3M0P A;  1NEG A;  1KIK A;  1AVZ C;  1V1C A;  1W1F A;  2BZ8 A;  1UUE A;  2J05 A;  1JEG A;  1UGV A;  4R0K A;  2JMC A;  3EHR A;  1TG0 A;  2L2P A;  2D8H A;  1RLQ C;  1UDL A;  2D0N A;  2F2V A;  2L0A A;  2AKK A;  2K9G A;  2KRM A;  3C0C A;  2KE9 A;  2KT1 A;  1K0X A;  4ESR A;  1M3A A;  4RTY A;  1H8K A;  3I9Q A;  2LCS A;  4OMO A;  2LP5 A;  5FWC A;  5L23 A;  3PE0 A;  3UA7 A;  3VS1 A;  1ZBJ A;  2YUP A;  2RQR A;  3UF4 A;  2A37 A;  2EGC A;  2HEQ A;  1WI7 A;  1HD3 A;  1AEY A;  2YDL A;  4RTU A;  1IO6 A;  3CQT A;  3JV3 A;  4J9H A;  2L3P A;  1CKB A;  2W0Z A;  1JXO A; 
#chains in the Genus database with same CATH topology
 5EG2 A;  4C0D B;  3OS5 A;  1N8R R;  5KCO A;  3E9G A;  1B34 B;  3CCQ A;  1IGQ A;  3RKW A;  4HA8 A;  3ER0 A;  2LX7 A;  1MNE A;  2XDD A;  4PLI A;  5FU6 C;  1ZSZ C;  2YXY A;  1WA7 A;  4ORZ A;  2MMP A;  9ATC B;  1W2B S;  3A5Z B;  1R0C B;  2PNI A;  2PU9 B;  1ZA1 B;  4BI3 A;  3EG9 B;  1VQ6 A;  3UT1 A;  3CCR T;  2RHY A;  3TU4 K;  2MIO A;  5GAN 3;  1D1C A;  1YJW A;  1R0B G;  4O5V A;  2CRE A;  1YCY A;  1ABO A;  4L5G A;  1D1B A;  4LN2 A;  3RDV A;  3SEM A;  4QQ6 A;  2NUT B;  1NEB A;  1KD1 U;  1OEB A;  2EBP A;  2EPD A;  3OYJ A;  1VQ8 A;  3G4S T;  1ABQ A;  4M75 A;  1AWJ A;  1G3W A;  1D0Y A;  3QDF A;  1I5O B;  1QWF A;  4HCB A;  2QQS A;  2EKH A;  3JCM J;  2NYS A;  2Y4X A;  1RLP C;  3T9N A;  1WHK A;  1X2K A;  2K7A A;  3M55 A;  2JN0 A;  2VWF A;  2O31 A;  1V76 A;  2DER A;  2YRD A;  3M0U A;  3VYG A;  2JM8 A;  2EYX A;  3CCU Q;  5KYY A;  1PKS A;  1OPL A;  4J5Y A;  1UG1 A;  4M75 F;  8ATC B;  2RO0 A;  2KI7 A;  3C4S A;  1UGQ B;  4J7I A;  1WPY A;  4LUE A;  4BI4 A;  1ZA2 B;  4C92 F;  2EJ9 A;  5GAM g;  4PJO F;  3GNF B;  4E7H A;  1MMA A;  2DBK A;  2EQM A;  5I21 A;  4FW1 A;  2EJG A;  1VQ5 Q;  2FYK A;  1BI3 A;  2CKK A;  3EH1 A;  3MEA A;  1YHQ A;  3OYE A;  2LVM A;  2JT4 A;  3M4G A;  4F04 B;  5GAM f;  2MWO A;  2MF2 A;  1D1A A;  2RK2 A;  1MGQ A;  1YNZ A;  4LNP A;  4OMQ A;  1TU0 B;  4M7D F;  1PC0 A;  2J06 A;  2WSF E;  1D0Z A;  1JRI A;  1M1G A;  2M9U A;  1VQO T;  4OB1 B;  2CZ6 B;  4C92 B;  2M0O A;  5CKD A;  3OYB A;  4DOV A;  3CME A;  1Y0M A;  4M78 F;  5LJ3 f;  1WQW A;  4HKE A;  1RAF B;  1I4K 1;  2FG0 A;  4KGV B;  4J6W A;  4QQD A;  2JS2 A;  1K0S A;  4EIK A;  1W4S A;  3CMA T;  2J6O A;  3VYH B;  5GAN e;  2SEM A;  1YJW T;  2D9T A;  4CRI A;  3CC7 A;  1FX7 A;  1WJS A;  3PNW C;  1RAB B;  1IHW A;  3BDL A;  5LJ3 g;  1YJN T;  2O9S A;  4PJL A;  4C8Q A;  1KD1 C;  5FRN A;  1M90 R;  3NHN A;  1HJD A;  1RAH B;  3CCE A;  5IHI A;  4A63 B;  3TQ7 P;  2JZ2 A;  3PIO A;  2RHZ A;  4JRI A;  4IUQ A;  4DA4 A;  2DL3 A;  2PUO B;  2LQN A;  1BYM A;  4JJC A;  1YIT A;  1DJ7 B;  5M9O A;  4J7F A;  5GAN h;  2X4X A;  4OMN A;  5IHN A;  1S72 Q;  1KD1 R;  4PJO A;  3M54 A;  3VUB A;  1TUD A;  4AFU C;  1I07 A;  2YUQ A;  4KT0 E;  2OI3 A;  3BY7 A;  1RAE B;  2DXU A;  4E6R A;  4JJN K;  2LJ1 A;  3L42 A;  1BIB A;  1VQP T;  1ZUK A;  3DB4 A;  4OGE A;  4ATO A;  2YRV A;  2ECZ A;  3I5R A;  5A0G A;  2AHJ B;  3WVD B;  4OML A;  2O01 E;  1VQK A;  2QDY B;  3NTK A;  1N9R A;  2DXC A;  4KGZ B;  3A8L B;  3HHT B;  1QVG S;  3L2W A;  4ZN1 A;  1SHF A;  4PFO A;  2ZPB B;  6AT1 B;  1VYV A;  4M75 B;  2R57 A;  2QGG A;  1UEB A;  2DVE A;  1T3L A;  2GQV A;  2Z0W A;  1SSF A;  4BD3 A;  4N4G A;  4X9D A;  1C1A A;  1KQ2 A;  3VKI A;  2IG0 A;  4BDY A;  4L59 A;  2GGR A;  1Y96 B;  2LT1 A;  3HFO A;  1U1S A;  1VQ7 A;  1SHG A;  2QQ9 A;  3A8M B;  3QKJ A;  3C12 A;  4CI0 C;  1ZLM A;  4DOW A;  1RAA B;  3X20 B;  2C0T A;  1VQ7 T;  2RA2 A;  4C0D C;  4Z88 A;  1M3C A;  5A2Q E;  5KCH A;  3CD6 Q;  2AK5 A;  4JLI A;  1OZ2 A;  2YHT A;  1G3T A;  1E6H A;  4LUD A;  3M53 A;  4PJO C;  3OW2 S;  4C8Q E;  2HBP A;  2WSC E;  4HVU A;  3N5B B;  2ENM A;  1UTI A;  4J6Y A;  3EH2 A;  4J6X A;  2HQX A;  2KXD A;  2QG9 B;  2NUP A;  2D1X A;  3CC7 T;  3NFC A;  1R8O B;  2MAM A;  2AKL A;  1YJN A;  4NS5 A;  2F2X A;  1RAG B;  1AZE A;  3M57 A;  3CCS A;  4M7A G;  4D8D A;  3CD6 T;  4RMO A;  1M90 U;  3VRY A;  1O75 A;  4OMP A;  4B9X A;  3VS6 A;  2DA9 A;  3EG0 A;  3ULR B;  3TRE A;  3LGL A;  4HXJ A;  2QAZ A;  2EW3 A;  4M7A B;  1JJ2 S;  2IVW A;  4M78 A;  5IXF A;  2DET A;  2MOX A;  3I55 T;  2YRC A;  2BKD N;  3QO3 A;  1BCO A;  3CCV A;  1H3H A;  2F5K A;  5FU7 C;  4BY6 C;  1VQK T;  4A54 A;  3E9F A;  2P4R A;  3L2V A;  3JCM P;  2JXB A;  3EAE A;  3QDR B;  3QSU A;  2DMO A;  3UDC A;  2JS0 A;  5KYY B;  4FT4 A;  3VJP A;  4C92 D;  4CC4 B;  2RQV A;  3OA6 A;  1J3T A;  5FLX E;  3TSW A;  1EIF A;  1QVP A;  1K73 R;  4BDZ A;  1K1Z A;  3EHQ A;  2PUK B;  2DFU A;  1N8R C;  1AWX A;  1UHF A;  3EG1 A;  3OSS C;  3HRU A;  5GAN 5;  2QGF B;  4RG8 A;  3JCM h;  4RKU E;  1VQK Q;  3M0Q A;  2QA4 Q;  3CBM A;  1BB9 A;  4C5H A;  2AT1 B;  1QVF A;  2CP7 A;  1U1T A;  2FPD A;  1NEG A;  2E6Z A;  2XDB A;  1YI2 T;  1VQL Q;  1IRX A;  1UUE A;  2J05 A;  4A4G A;  1QVG P;  3MP1 A;  1UGV A;  4E7S A;  2D8H A;  3PMT A;  4XAX B;  2AKK A;  3C0C A;  2K5L A;  1Y71 A;  3OS0 A;  3I9Q A;  2R5A A;  2LCS A;  3LGF A;  2COW A;  5L23 A;  3UA7 A;  1BIA A;  2D0Q B;  4LDU A;  3VS1 A;  1OX8 A;  3DB3 A;  5CKB A;  4KBM B;  1JJ2 P;  2A37 A;  1O9S A;  1VQL T;  2VV5 A;  1GXI E;  4LDW A;  1VQ6 Q;  1CKB A;  4C0F A;  1JXO A;  4N4H A;  2V8K A;  3JB9 I;  4F7U F;  2DM1 A;  1LNX A;  4X34 A;  4KUD K;  2K2M A;  3PMI A;  4F7U B;  3MPU B;  2E10 A;  2RNA A;  1PKT A;  2I2L A;  3BFM A;  1NYF A;  1RI9 A;  3P8D A;  3CCL Q;  3MEV A;  1VQ5 A;  1VQN T;  2O9V A;  3CEY A;  4QW2 A;  3QWY A;  3OYF A;  2D6F A;  1HSQ A;  1WHH A;  4K11 A;  1OQK A;  4M7A F;  3G71 T;  1W70 A;  1GL5 A;  3THK A;  2XKO C;  1BBZ A;  2RHU A;  3NTH A;  1Q86 C;  3UAT A;  1NZ9 A;  2KMT A;  2KEA A;  2KY9 A;  3NMZ C;  4M78 E;  2E12 A;  3L2U A;  2K6D A;  2JTE A;  2RJC A;  3EFS A;  5GAN 8;  2DZC A;  4QVD A;  1ACM B;  2LRQ A;  2HBW A;  2KRS A;  3CPF A;  3CCV T;  3I56 Q;  4JS4 A;  1PCX A;  2DZ9 A;  2M51 A;  3MCA B;  2XK0 A;  1OU8 A;  2ZCF B;  3CC2 A;  2C06 A;  5LJ5 h;  2QDL A;  2CS7 A;  3S3N A;  1U06 A;  3KBG A;  5ECA A;  4IIO A;  1I0C A;  4VUB A;  2KXC A;  3OYK A;  1K73 U;  4BB7 A;  2KRO A;  2KBT A;  3EFO A;  5J39 A;  1X69 A;  2DD5 A;  2QXF A;  1VQP Q;  4DEX A;  1Y7X A;  2EKO A;  1IGU A;  1SEM A;  2PVG B;  3JB9 H;  3J81 E;  1TWB A;  3H0I A;  3CCV Q;  1SRM A;  3WXM B;  2FL7 A;  4PJJ A;  1WHG A;  2A7Y A;  1QKW A;  3VS7 A;  1Q81 C;  4FU6 A;  5IHK A;  1S1N A;  2ROT A;  4MZP A;  4PFZ A;  4EMK C;  1VIE A;  1M90 C;  3M59 A;  2D8J A;  1PSF A;  4LDY A;  5GAN j;  4JUV A;  2ZZD A;  2BZX A;  2NLU A;  5FW9 A;  3S6W A;  4C92 C;  4Z02 A;  1GCQ A;  2H3E B;  3LYI A;  3OS2 A;  5LJ3 h;  2FRW A;  2X4J A;  2RI2 A;  4QVZ A;  2QQR A;  3CCE T;  2RQW A;  1UEC A;  2P0K A;  3BDU A;  1WHJ A;  5IN1 A;  2MPX C;  5GAN d;  2EGA A;  3GLX A;  2HL5 C;  2GFU A;  1FMK A;  2CUB A;  4NOY A;  4FSX A;  2L3R A;  4C0Z A;  2OTL Q;  2XI9 A;  2H8H A;  4F7U E;  3G7Z A;  1VQL A;  2EQJ A;  5GAO q;  1PSE A;  1TH7 A;  1WHM A;  3H9N A;  2OTJ T;  4A53 A;  3OYC A;  4NL3 A;  3NTI A;  4E47 A;  1NLO C;  5LJ5 f;  2EAY A;  1U8R A;  4A4H A;  1M4Z A;  2ZPE B;  5CQX A;  2EJF A;  2BE9 B;  2RI3 A;  2JJ9 A;  5LJ3 j;  1PRL C;  1UGS B;  1MHN A;  1NJI C;  1C6V X;  1I1J A;  1GBR A;  4OB2 B;  4AFS C;  2FRY A;  2PZ1 A;  2X3X D;  1WZO A;  1T0J A;  5DLQ E;  3CC4 Q;  4RUG A;  3TEE A;  1Z9Q A;  2FPF A;  4QVC A;  4Z8A A;  3QHS A;  3QWX X;  2GQI A;  1QP2 A;  1QCF A;  2X9H A;  3DKM A;  2K5I A;  3NGP A;  1AD5 A;  3RIR A;  2DL4 A;  1NPR A;  3CC2 T;  2K2V A;  2V8J A;  4J9G A;  1YI2 A;  1RUW A;  3RER A;  1N8R U;  2VXF A;  1W6X A;  2YUN A;  5GMK m;  2CP2 A;  2VGN A;  3RMQ A;  4PJO E;  3QPH A;  3CCU T;  2KRN A;  5KYU B;  3GIB A;  4J9D A;  2LMJ A;  3FRN A;  4WCI A;  1S72 A;  3E2U A;  5GMK j;  3CCM T;  4OF1 A;  3GF5 A;  2MCN A;  1VYT A;  4II1 A;  1OYX A;  1JQQ A;  2ABL A;  2HNI A;  1G2B A;  2EFI A;  1PD1 A;  1XQH A;  4HVW A;  3UA6 A;  4RTV A;  4LXC A;  2O4X B;  2GFA A;  3C94 A;  2RB6 A;  3VS5 A;  2RHX A;  2PTK A;  1PRM C;  3L2Z A;  2CT4 A;  2X4Y A;  3OYL A;  3HFN A;  3UWN A;  1VOM A;  3OYM A;  3MHX A;  3KXT A;  1MMN A;  1Q81 U;  2KDS A;  3PVL A;  4IUR A;  1M5Q 1;  3MET A;  4ME7 A;  2P0Q A;  2XDP A;  5HCK A;  4EMK A;  2KGT A;  2RF0 A;  4JRK A;  1GRI A;  3JCM b;  3RMS A;  3DLL A;  1MMD A;  3SD4 A;  4LE9 A;  2EVR A;  4O6J A;  3OMC A;  2V26 A;  2QYZ A;  3OMG A;  1Y57 A;  4M7A D;  1KG1 A;  4PJO G;  4KUI A;  3CMA Q;  2DEU A;  5AT1 B;  1YJW Q;  4RTX A;  3ASK A;  1VQM T;  5LL6 S;  3MP6 A;  4BE0 A;  1VQ6 T;  1YJN Q;  5EC7 A;  1EFN A;  1BCM A;  2ED0 A;  1JU5 C;  1Y07 A;  1WXT A;  1K9A A;  5GAM j;  3FIF A;  2O4X A;  1N5Z A;  4KH1 B;  4OVA A;  3CCL A;  4M7D A;  2LCC A;  1N9S A;  4JS5 A;  1LJO A;  2HMA A;  2QTV A;  4Z89 A;  3CCL T;  3HRT A;  1MUZ A;  2JUF A;  5D6W A;  3X24 B;  4JPB W;  1QKX A;  1VQM Q;  1KHI A;  2JVV A;  4FL6 A;  2NWM A;  3G71 Q;  1H64 1;  1X01 A;  2YSQ A;  3NPF A;  1TXQ A;  3LH5 A;  2CUD A;  3MKD A;  1F1B B;  2A0F B;  4ZTJ A;  3VS4 A;  1N27 A;  2L8D A;  4RTW A;  5HK0 A;  1K8A U;  4ZGD B;  2XIC A;  2DIG A;  4IUU A;  1JO8 A;  2DX1 A;  3EGD A;  3REA B;  5I11 A;  3VS0 A;  4MZT A;  2RQU A;  5CIU A;  2PQW A;  3CME T;  4BE2 A;  4PJO D;  3G6E A;  1YN8 A;  2GTO A;  4FW2 A;  3SWN A;  4M78 C;  2CP3 A;  4GY5 A;  1JXM A;  2ESW A;  3M5A A;  3QYG B;  4QKU A;  3OY9 A;  4PL6 A;  3CCM A;  1OI1 A;  2RJE A;  3I56 A;  1QWE A;  2OAW A;  1UJ0 A;  2MWP A;  5CQY A;  2KNB B;  1NM7 A;  5GAO l;  4JRQ A;  5FU6 B;  3WVE B;  3M0P A;  4JRP A;  1M1K U;  2LT4 A;  1AVZ C;  2DD4 A;  2FHD A;  1W1F A;  2RD1 A;  4OP0 A;  3CME Q;  3CCR A;  2BIV A;  5AYF A;  3EHR A;  3H6Z A;  2LDM A;  1XJW B;  3GOX A;  2V8I A;  3MEW A;  1Q86 R;  2D0N A;  2DIQ A;  1VQN A;  4LD9 K;  2L0A A;  1Q81 R;  2K9G A;  2KRM A;  2HSE B;  2KT1 A;  1K0X A;  3M9Q A;  4EMG A;  4BY6 B;  2FZK B;  4OMO A;  3OYI A;  4BE1 A;  4C92 A;  4Q5W A;  4R55 A;  3OBW A;  1ZBJ A;  2YUP A;  2DXB A;  2RQR A;  4J83 A;  4FYW B;  3UF4 A;  3BE3 A;  2DTI A;  4UC4 A;  3Q1J A;  1AEY A;  2QI2 A;  2LCL A;  2YDL A;  4DBF A;  1IO6 A;  2F1L A;  3CQT A;  3I55 A;  2L3P A;  3JCM Q;  3CCJ Q;  3CXC S;  3M0T A;  2E3H A;  1QVF S;  2HQE A;  2HAX A;  4ZGJ B;  3EFO B;  4J9E A;  2QQA A;  2CGH A;  4M7D E;  2M0Y A;  3DLM A;  1Z9Z A;  1X2Q A;  4FYY B;  1SSH A;  1CKA A;  2RN8 A;  3I55 Q;  2W10 A;  3QII A;  3JB9 J;  1M3B A;  1BI2 A;  2G3R A;  4OB0 B;  4C92 E;  2RJD A;  2P0P A;  3G6E T;  2K3X A;  4C5I A;  2XG8 D;  3E19 A;  2LQW A;  5GAN 7;  2DAQ A;  1D0X A;  3L1A A;  4LD6 A;  4N0A C;  1LCK A;  1OPK A;  5GMK h;  2HQH A;  3E1S A;  3LW5 E;  1YIJ A;  3V8J A;  1R77 A;  4DQ2 A;  1B07 A;  1KQS S;  2RPN A;  3A8H B;  1ZX6 A;  1QCN A;  5CR2 A;  4E7J A;  3QXE B;  5KYU A;  4E7K A;  2FVU A;  2L3Q A;  2VVK A;  2P84 A;  4PNO A;  2DPP B;  1UB4 A;  5GAM e;  1KSW A;  1VA7 A;  1I81 A;  2HL3 A;  2NUZ A;  4L6V 5;  3X28 B;  4AFZ C;  1M1K R;  1P92 A;  5HK3 A;  5GMK e;  1X27 A;  1RL2 A;  1E6G A;  3JAM E;  3JB9 F;  2EYZ A;  2X3W D;  2RK1 A;  1IB8 A;  1T3S A;  1Q86 U;  4C92 G;  1WJR A;  1WIE A;  1ZBX A;  3MEU A;  1TUC A;  3JCM f;  3CMA A;  4C8Q F;  3O5Z A;  4EPC A;  3EGX A;  1OV3 A;  2OAU A;  4M77 A;  2DLP A;  4BI8 B;  2B8A A;  3JCM W;  2MK5 A;  2ZPI B;  2K5F A;  4V2S A;  3M4Y A;  2CP0 A;  3HRS A;  1NYG A;  1MV3 A;  4JJB A;  3JCM e;  2HKQ B;  4ELY C;  2RQT A;  2FPE A;  3URG A;  1G83 A;  1RAI B;  3M58 A;  3CD6 A;  2HDA A;  1XTD A;  4RTZ A;  1PNJ A;  1VUB A;  3EG2 A;  4XTZ A;  1HYO A;  4R56 A;  3L2Q A;  3L2R A;  2EQI A;  4XTW A;  5L8R E;  2QTX A;  2LTO A;  2FEI A;  4F14 A;  2DXT A;  5KYN A;  4D6W A;  1TOV A;  1VQO Q;  1Q82 R;  1MV0 B;  2RI5 A;  4HT9 A;  3R6N A;  1YCS B;  4EDU A;  5GAM d;  1WLP B;  1M2V A;  4KUL A;  2XD0 A;  3SWN C;  2L5Q A;  2QEX T;  3JCM X;  2DL5 A;  1QP3 A;  2F69 A;  1NPP A;  1Y96 A;  2E64 A;  5LJ5 j;  3CCJ A;  4KGX B;  3PIP A;  3HP9 A;  4F7U A;  2X51 A;  2RHI A;  5FWB A;  4D8K A;  1B7T A;  4M7A E;  4BUG A;  5CKF A;  2RH2 A;  5J3B A;  3EFR A;  4C8Q C;  2LJ0 A;  1WXU A;  5D6Y A;  1UJY A;  1FXX A;  2K3B A;  3RNJ A;  4M77 C;  4OMM A;  3A98 A;  2VB6 A;  1D09 B;  3CPW S;  3OYH A;  4XU0 A;  4LDX A;  3RES A;  4J9C A;  2QEX Q;  3CC4 A;  4C8Q B;  2DVJ A;  5I2S A;  2AZV A;  2XID A;  4GLK A;  3X26 B;  4HCZ A;  2R58 A;  3ZL7 C;  1KC8 R;  2E70 A;  2EYQ A;  1IHV A;  4XTY A;  1OX9 A;  2EGE A;  2ATC B;  3TCJ A;  3OSV A;  3CBP A;  4OGC A;  2PVO B;  4IIM A;  8AT1 B;  4HCC A;  1VQP A;  3A1P A;  2JMA A;  1I5L A;  1GCP A;  2XU8 A;  3M0S A;  2MI6 A;  4MMK A;  4RTT A;  2DE0 X;  3BW1 A;  5GAO n;  3CC7 Q;  3H0H A;  2CDT A;  2FO0 A;  2DL8 A;  4XTU A;  5HKC A;  4JZ4 A;  4ZGE B;  1D3B B;  1K9M R;  4E7I A;  1K4U S;  1YWO A;  3LX7 A;  1X6O A;  4FT2 A;  1AT1 B;  1B34 A;  2K3Y A;  2BTT A;  5GAN 6;  2KYB A;  2KR3 A;  4ZNX A;  2CSI A;  3TVT A;  2GNC A;  1MND A;  2YUO A;  3VV0 A;  5A0L A;  2COZ A;  2DYI A;  3PFS A;  2HKN A;  2CT3 A;  5GAN f;  3I5S A;  1VQM A;  1W2B P;  2DNU A;  1K9M C;  2ZPF B;  1PHT A;  3CCJ T;  4GLM A;  1VQ7 Q;  1JBM A;  2KK4 A;  2VKN A;  4M75 C;  3VS2 A;  1Q82 U;  4RCC A;  3P8H A;  4FSS A;  1SKU B;  4M75 E;  4FYX B;  4AFQ C;  1YWP A;  4ZTF A;  1BI0 A;  3FJP A;  4LDV A;  3GPL A;  4M78 D;  1X6B A;  1X6G A;  5C0M A;  4C5E A;  3SB2 A;  2X35 A;  3FLG A;  2ZAE A;  3JCM g;  4MML A;  1H92 A;  1M8V A;  3CCR Q;  1TS9 A;  4XTV A;  4M77 B;  3PTA A;  3EGU A;  4A4F A;  1LOJ A;  2IIM A;  3OQ5 A;  1JB0 E;  1WFW A;  4M7D C;  2DF6 A;  3CC2 Q;  1YHQ T;  3CXC P;  3CCS Q;  1KFZ A;  2QA4 T;  2E3I A;  3J7A F;  1RAD B;  1SPK A;  2HCK A;  1ZUU A;  2VGM A;  2FZG B;  1AHJ B;  1OZ3 A;  1YI2 Q;  3REB B;  2KT8 A;  4F17 A;  1KJW A;  4IUT A;  3LH0 A;  2C0I A;  3JB9 D;  4M78 G;  4E2F B;  3FEO A;  2K57 A;  1PG5 B;  3CCM Q;  2M1H A;  2RMO A;  2DRK A;  2J7I A;  5GMK l;  4AT1 B;  1KC8 U;  1Q95 G;  4XK8 E;  3PGG A;  2NUP B;  4EMK B;  1VYU A;  4HT8 A;  2E1H A;  2E5Q A;  1YIT Q;  2ZPG B;  1KQ1 A;  1NE8 A;  2LX9 A;  3GBQ A;  5GAM h;  1YHQ Q;  2AZS A;  1NG2 A;  2CYZ B;  1QCO A;  1I8F A;  3CBO A;  5IXB A;  1IZ6 A;  5LJ3 d;  5C6S A;  1ZSZ B;  3ME9 A;  1V1C A;  3OYG A;  3HTR A;  3HPW A;  1M9S A;  2JMC A;  1RLQ C;  2F2V A;  3CPW P;  2KE9 A;  4ESR A;  1H8K A;  3VU3 C;  3OYD A;  5KE2 A;  2R5M A;  2LP5 A;  3A8O B;  3PE0 A;  1K9M U;  2YWW A;  4OB3 B;  1WI7 A;  3LWI A;  1HD3 A;  4M7D B;  5GAN 2;  5KYW B;  2Y4Y A;  3RR6 A;  1PM3 A;  3JV3 A;  1ZHI A;  3H41 A;  3ZEH A;  4AMC A;  3S3M A;  2O88 A;  2L3S A;  2PVD B;  3RKY A;  1M2O A;  1QLY A;  3HKS A;  4XU3 A;  1ZSG A;  2E4H A;  3A8G B;  2JTF A;  2LNH B;  4XTX A;  4A4E A;  4ZN3 A;  4PJO B;  3JB9 G;  2JM9 A;  3OS1 A;  3I56 T;  4M77 F;  1H3Z A;  3QUI A;  2A08 A;  4DEY A;  4F7U G;  3CPW A;  4MDX A;  3AT1 B;  4KRT A;  1WYX A;  4QQG A;  5KYW A;  3OW2 P;  2MYS A;  2EYY A;  2CSQ A;  1WGS A;  1WQ7 A;  2JTM A;  3RUX A;  1EZZ B;  3V8K A;  2QK0 A;  2H3J A;  3RKX A;  1OU9 A;  1T0H A;  1SF9 A;  1G3Y A;  2SRC A;  4ELZ C;  4OMF B;  1UE9 A;  5LJ5 g;  4E7Z A;  1JJ2 A;  1B3Q A;  4JZ3 A;  4Y92 A;  2RJF A;  1D3B A;  4CC7 A;  4J9B A;  1AOJ A;  2DK3 A;  2DYB A;  1VQN Q;  4QT7 A;  3V7C A;  4M7A A;  2KAF A;  3RBB B;  2CH4 A;  3U23 A;  1S72 T;  2EQU A;  3JSC A;  5GJW B;  3G71 A;  4JLG A;  1G8X A;  1AZG B;  2J6F A;  2DEQ A;  4M4Z A;  2E5K A;  4AG2 C;  3IQL A;  2QQB A;  2EIF A;  3X25 B;  2BUD A;  1UFF A;  5I22 A;  3FJ5 A;  2HSP A;  3OW2 A;  5CO7 A;  3CCE Q;  1Q7Y C;  2VXE A;  1WHL A;  1BKB A;  4MDW A;  1QQJ A;  2G6F X;  1WNL A;  2BE7 D;  5DY9 A;  5GAO p;  4GBQ A;  1OUL A;  4YTL A;  2DBM A;  3OYA A;  4B9W A;  2WAC A;  2EWN A;  2XMF A;  4E7L A;  3JRZ A;  2ROL A;  5A0D A;  5HY6 A;  1YJ9 T;  3JCM V;  2OX7 A;  3AHU A;  2F5T X;  3V7R A;  2J6K A;  3EG3 A;  4Y28 E;  4P5N A;  2JOY A;  2CH4 W;  3V7S A;  1K8A R;  1YJ9 A;  2X4W A;  1M1F A;  2E41 A;  2O2O A;  1G3S A;  1YIJ Q;  1GFC A;  1M30 A;  3VS3 A;  4F16 A;  3UPU A;  5GAO m;  1BK2 A;  4AG1 C;  2K4Y A;  2LZ6 B;  4J8O A;  5LJ5 e;  3FC3 A;  1WX6 A;  3I35 A;  4M77 E;  4NL2 A;  1GBQ A;  4MZM A;  1VIF A;  5IH2 A;  4IKF A;  3JCM d;  4FIB A;  1NJI R;  1A0N B;  1OOT A;  3J80 E;  3CCU A;  1C0M A;  5CCA A;  2DL7 A;  1ZSZ A;  4RG2 A;  1TUG B;  3QJY A;  2DKG A;  5D7U A;  5KYX B;  1KC8 C;  3OYY A;  1G5V A;  1YIJ T;  3KUF A;  4N0A A;  1VQO A;  2GBQ A;  1M1K C;  2ZPH B;  1QVF P;  1KK7 A;  2OTL T;  1KQS A;  3H8Z A;  7AT1 B;  2LQK A;  3OBY A;  4A4K A;  1U3O A;  3G6E Q;  2A28 A;  2ED1 A;  2I0N A;  2EYW A;  2VC8 A;  1QVG A;  2DRM A;  2NUT A;  1KHC A;  3OYN A;  2OTJ Q;  5DLO A;  2LNV A;  5GAN 4;  2JW4 A;  1HXD A;  5LJ3 e;  3GNG A;  1WJQ A;  1VQ4 A;  1X75 C;  2JNG A;  3G4S Q;  3SWN B;  2IPO B;  3HL8 A;  2KSS A;  4JDS A;  5CKE A;  5FRM A;  2LJ3 A;  4DBQ A;  2HZY A;  3M0R A;  2FB7 A;  4C8Q G;  5IT9 E;  1X43 A;  1VQ8 Q;  4CC2 A;  3LLR A;  2DTO A;  2DJQ A;  1FMW A;  2YT6 A;  3QYH B;  2GCX A;  4PJM A;  4M77 G;  4JJD A;  1M2V B;  2CP5 A;  1UGR B;  3QZ9 B;  3CCS T;  4PFP A;  5CKH A;  5GAN g;  5FRO A;  3CC4 T;  1TTH B;  4X9C A;  2OTJ A;  1GFD A;  1LPL A;  2Y90 A;  1KQS P;  1AWO A;  2CZ1 B;  1WXB A;  2EQK A;  1ZQ1 A;  4IUP A;  3CXC A;  3EGX B;  1K73 C;  1UGP B;  1VQ8 T;  4PKC C;  4DBR A;  1VQ5 T;  1NLP C;  2GTJ A;  1YIT T;  2DJZ A;  4TVR A;  2V1Q A;  1NBE B;  1V29 B;  4BAC A;  1BU1 A;  1Q7Y U;  5FU7 B;  4FYV B;  2HD0 A;  4M75 D;  3SFM A;  4KH0 B;  1FYN A;  2CP6 A;  5KH6 A;  1YP5 A;  1M8M A;  3ZFJ A;  1VQ9 Q;  2CZ0 B;  2QEX A;  1CSK A;  5D6X A;  4M77 D;  3M56 A;  3QJ6 A;  2B86 A;  4XU2 A;  3KFV A;  3R6O A;  1GCQ C;  4C5G A;  4PLL A;  5KYX A;  4X1V A;  2KYM A;  2M02 A;  5GMK i;  1K76 A;  2BZY A;  1PD0 A;  5J26 A;  1ZUY A;  5I2M A;  1NJI U;  1U5S A;  2VYT A;  2E6N A;  2WSE E;  4PK4 A;  1Q82 C;  2C0O A;  1FWZ A;  1VQ4 Q;  5GAO r;  2KVQ G;  1TSF A;  1M27 C;  4FCY A;  3FB9 A;  4M7D D;  2LQ8 A;  2DIL A;  2K79 A;  4M75 G;  5IAY A;  3SDZ A;  1VQ9 T;  1HK9 A;  2P4T A;  4M7A C;  2VAS A;  1PWT A;  1YBY A;  4PJN A;  3TSZ A;  2E65 A;  3H0F A;  2F2W A;  2OJ2 A;  1VQ9 A;  2YLC A;  1IRE B;  1ARK A;  1IXD A;  4HCK A;  4CC3 A;  4FM4 B;  5CVI A;  1VQ4 T;  2A36 A;  3QBY A;  2V1R A;  1SRL A;  3P8B B;  3SHW A;  2CZ7 B;  3V8L A;  4HVV A;  3MO8 A;  4IUV A;  4RCB A;  4M7D G;  4J9I A;  1SG5 A;  3QG1 A;  4J9F A;  4WTO B;  1QW1 A;  2QA4 A;  1W2B A;  2DO3 A;  1XNI A;  3OB9 A;  2DTH A;  2KQW A;  3MP8 A;  1AWW A;  3EGD B;  5GJV B;  1MMG A;  3O8V A;  3EG9 A;  2XHC A;  4EMH A;  5KE3 A;  2FZC B;  4ANJ A;  3S3O A;  3PVQ A;  4N4I A;  5CK9 A;  1XOV A;  1BI1 A;  4XQ3 A;  3G4S A;  1YFN A;  4C8Q D;  2COY A;  4XU1 A;  4Y91 A;  1RAC B;  2A3L A;  1UHC A;  2QAS A;  3C95 A;  3ZBD A;  3VRZ A;  1E7O A;  3VUZ A;  1WDX A;  1KIK A;  2M16 A;  2L89 A;  3LWH A;  2BZ8 A;  3INZ A;  2AIR B;  3F70 A;  1JEG A;  3CCQ Q;  1N6A A;  1Q7Y R;  2LC4 A;  1FMV A;  4B6M A;  4C0G A;  4R0K A;  1TG0 A;  5CAI A;  3HSB A;  2L2P A;  5LJ5 d;  3FDR A;  1UDL A;  2YLB A;  4DBH A;  4M78 B;  2RM4 A;  3JCM c;  1M3A A;  4RTY A;  5DM7 R;  1YJ9 Q;  3PT9 A;  5FWC A;  2VUB A;  1QMC A;  3MJX A;  4WF2 A;  1RI0 A;  2EGC A;  2HEQ A;  2GF7 A;  3GP8 A;  2OTL A;  1EX4 A;  2ZGW A;  4RTU A;  3CCQ T;  1K8A C;  3G1J A;  3QZ5 B;  3D7S B;  1LVK A;  4J9H A;  2W0Z A; 
#chains in the Genus database with same CATH homology
 3H41 A;  2O88 A;  2L3S A;  3M0T A;  2DM1 A;  1QLY A;  2K2M A;  1ZSG A;  2LX7 A;  2LNH B;  4J9E A;  2RNA A;  1PKT A;  1NYF A;  1RI9 A;  2JM9 A;  1WA7 A;  4ORZ A;  2O9V A;  2M0Y A;  3QWY A;  1Z9Z A;  1X2Q A;  2PNI A;  1SSH A;  1HSQ A;  2A08 A;  4DEY A;  4K11 A;  1CKA A;  4KRT A;  1WYX A;  2RN8 A;  1W70 A;  1GL5 A;  2EYY A;  3THK A;  2CSQ A;  2W10 A;  1BBZ A;  1M3B A;  2MIO A;  3UAT A;  1T0H A;  2CRE A;  2KEA A;  2SRC A;  3NMZ C;  1ABO A;  1UE9 A;  2K6D A;  2JTE A;  1B3Q A;  4JZ3 A;  4Y92 A;  4CC7 A;  4J9B A;  4LN2 A;  1AOJ A;  2LQW A;  3SEM A;  2HBW A;  2KRS A;  1NEB A;  2DYB A;  1OEB A;  2EBP A;  4QT7 A;  2EPD A;  2M51 A;  1LCK A;  1OPK A;  1ABQ A;  1AWJ A;  3RBB B;  1QWF A;  2QDL A;  2CH4 A;  2EKH A;  3U23 A;  1B07 A;  1U06 A;  5ECA A;  4IIO A;  5GJW B;  2RPN A;  1I0C A;  2KXC A;  1AZG B;  2J6F A;  4M4Z A;  2E5K A;  1RLP C;  4AG2 C;  1ZX6 A;  3IQL A;  2KRO A;  2KBT A;  1X69 A;  1X2K A;  2K7A A;  1UFF A;  5I22 A;  4DEX A;  2VWF A;  2O31 A;  2HSP A;  3FJ5 A;  2L3Q A;  1SEM A;  2VVK A;  3M0U A;  2JM8 A;  2EYX A;  1PKS A;  3H0I A;  1OPL A;  1SRM A;  1KSW A;  1UG1 A;  1VA7 A;  2NUZ A;  4AFZ C;  2G6F X;  1QKW A;  4LUE A;  3VS7 A;  1X27 A;  4GBQ A;  5IHK A;  2DBM A;  1S1N A;  2ROT A;  1E6G A;  2DBK A;  2D8J A;  2EYZ A;  2X3W D;  2XMF A;  2BZX A;  2ROL A;  1T3S A;  5FW9 A;  1WIE A;  2J6K A;  3EG3 A;  1GCQ A;  1TUC A;  2JT4 A;  2FRW A;  3O5Z A;  2CH4 W;  1OV3 A;  2DLP A;  1YNZ A;  4LNP A;  4OMQ A;  2O2O A;  2RQW A;  1UEC A;  1GFC A;  1M30 A;  3VS3 A;  4F16 A;  2EGA A;  2J06 A;  1FMK A;  2CUB A;  1BK2 A;  4AG1 C;  2LZ6 B;  1WX6 A;  1NYG A;  3I35 A;  1MV3 A;  4JJB A;  1GBQ A;  2H8H A;  5IH2 A;  2RQT A;  2FPE A;  1G83 A;  1Y0M A;  1A0N B;  1OOT A;  2HDA A;  2FG0 A;  2DL7 A;  4RTZ A;  1PNJ A;  3EG2 A;  2JS2 A;  1K0S A;  4EIK A;  2J6O A;  1NLO C;  2SEM A;  2EQI A;  2GBQ A;  2FEI A;  4F14 A;  2O9S A;  1MV0 B;  3R6N A;  3NHN A;  1HJD A;  1YCS B;  1PRL C;  5IHI A;  4A63 B;  1WLP B;  1U3O A;  1I1J A;  2A28 A;  1GBR A;  2ED1 A;  2I0N A;  2EYW A;  4AFS C;  2DL5 A;  2FRY A;  2PZ1 A;  2DRM A;  2X3X D;  2DL3 A;  1T0J A;  2LQN A;  4RUG A;  2JW4 A;  1Z9Q A;  2FPF A;  4JJC A;  4Z8A A;  5FWB A;  3QWX X;  4D8K A;  2GQI A;  2LJ3 A;  4OMN A;  1QCF A;  5IHN A;  3M0R A;  1TUD A;  1AD5 A;  3NGP A;  4AFU C;  1X43 A;  1I07 A;  4CC2 A;  2LJ0 A;  1WXU A;  2DL4 A;  2YUQ A;  2OI3 A;  1UJY A;  4E6R A;  2DJQ A;  2YT6 A;  2LJ1 A;  2K3B A;  3RNJ A;  4OMM A;  4JJD A;  3A98 A;  4J9G A;  1ZUK A;  1RUW A;  2YUN A;  1W6X A;  4J9C A;  2DVJ A;  2ECZ A;  3I5R A;  2AZV A;  2KRN A;  1GFD A;  4OML A;  4J9D A;  3ZL7 C;  2LMJ A;  4WCI A;  1AWO A;  1WXB A;  2MCN A;  2EGE A;  1VYT A;  1JQQ A;  2ABL A;  1SHF A;  1G2B A;  1NLP C;  2GTJ A;  1VYV A;  4HVW A;  3UA6 A;  4RTV A;  1T3L A;  2V1Q A;  4IIM A;  2JMA A;  1GCP A;  3M0S A;  1BU1 A;  3VS5 A;  2PTK A;  1PRM C;  2CT4 A;  2GGR A;  4RTT A;  1SHG A;  2DE0 X;  3PVL A;  3H0H A;  2CDT A;  2FO0 A;  2DL8 A;  1ZLM A;  4JZ4 A;  5HCK A;  1FYN A;  2KGT A;  2C0T A;  2RF0 A;  4Z88 A;  1YP5 A;  1M8M A;  1K4U S;  1YWO A;  1GRI A;  1M3C A;  2AK5 A;  1CSK A;  2B86 A;  1E6H A;  4LE9 A;  2EVR A;  3KFV A;  1GCQ C;  4LUD A;  2BTT A;  4X1V A;  2KYB A;  2KYM A;  2KR3 A;  1Y57 A;  4ZNX A;  1K76 A;  2CSI A;  2BZY A;  3TVT A;  2GNC A;  4HVU A;  2YUO A;  1ZUY A;  2ENM A;  1U5S A;  1UTI A;  4RTX A;  2C0O A;  2CT3 A;  2KXD A;  3I5S A;  5EC7 A;  1EFN A;  2D1X A;  2DNU A;  2ED0 A;  2AKL A;  1M27 C;  1JU5 C;  2F2X A;  1PHT A;  2DIL A;  1AZE A;  1WXT A;  1K9A A;  2K79 A;  4GLM A;  1N5Z A;  2VKN A;  3VS2 A;  1PWT A;  4D8D A;  4FSS A;  3TSZ A;  3VRY A;  3H0F A;  2F2W A;  4AFQ C;  2OJ2 A;  4OMP A;  1YWP A;  4Z89 A;  3VS6 A;  1ARK A;  1MUZ A;  1X6B A;  1X6G A;  2DA9 A;  3EG0 A;  3ULR B;  4HCK A;  4CC3 A;  4HXJ A;  2EW3 A;  4JPB W;  1QKX A;  1H92 A;  2A36 A;  2NWM A;  5IXF A;  2YSQ A;  2MOX A;  3NPF A;  3LH5 A;  2V1R A;  1SRL A;  3SHW A;  2CUD A;  3EGU A;  4HVV A;  2IIM A;  1H3H A;  1WFW A;  2DF6 A;  4J9I A;  3VS4 A;  4RTW A;  2P4R A;  1KFZ A;  2JXB A;  1JO8 A;  4J9F A;  2DX1 A;  1SPK A;  2DMO A;  2HCK A;  1ZUU A;  2JS0 A;  3REA B;  5I11 A;  3VS0 A;  1AWW A;  3REB B;  2KT8 A;  4F17 A;  2RQU A;  5GJV B;  1KJW A;  4CC4 B;  2RQV A;  1J3T A;  3TSW A;  1YN8 A;  2C0I A;  2GTO A;  1K1Z A;  3EHQ A;  1JXM A;  2ESW A;  2RMO A;  2DRK A;  2J7I A;  1AWX A;  1UHF A;  3EG1 A;  3PVQ A;  1XOV A;  1VYU A;  1QWE A;  2OAW A;  3GBQ A;  1UJ0 A;  1UHC A;  2AZS A;  2KNB B;  3M0Q A;  1BB9 A;  1NG2 A;  1NM7 A;  5IXB A;  2FPD A;  3VRZ A;  1E7O A;  1WDX A;  3M0P A;  1NEG A;  1KIK A;  1AVZ C;  1V1C A;  1W1F A;  2BZ8 A;  1UUE A;  2J05 A;  1JEG A;  1UGV A;  4R0K A;  2JMC A;  3EHR A;  1TG0 A;  2L2P A;  2D8H A;  1RLQ C;  1UDL A;  2D0N A;  2F2V A;  2L0A A;  2AKK A;  2K9G A;  2KRM A;  3C0C A;  2KE9 A;  2KT1 A;  1K0X A;  4ESR A;  1M3A A;  4RTY A;  1H8K A;  3I9Q A;  2LCS A;  4OMO A;  2LP5 A;  5FWC A;  5L23 A;  3PE0 A;  3UA7 A;  3VS1 A;  1ZBJ A;  2YUP A;  2RQR A;  3UF4 A;  2A37 A;  2EGC A;  2HEQ A;  1WI7 A;  1HD3 A;  1AEY A;  2YDL A;  4RTU A;  1IO6 A;  3CQT A;  3JV3 A;  4J9H A;  2L3P A;  1CKB A;  2W0Z A;  1JXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...