2ROLA

Structural basis of pxxdy motif recognition in sh3 binding
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
GSMGTAGKWVLCNYDFQARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor kinase substrate 8-like pro
publication title Structural basis of PxxDY motif recognition in SH3 binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/signaling protein
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rolA00
2FO0A 4EIKA 2DBMA 2EYWA 2OJ2A 1RUWA 4AFUC 4CC7A 1IO6A 1Z9QA 2RQUA 1AWWA 2EGCA 1PHTA 2LP5A 1ZLMA 2ESWA 2VWFA 3SHWA 2MCNA 2FRWA 4JJBA 2OI3A 1OOTA 2OAWA 1M8MA 3R6NA 2O9VA 5GJVB 2JM8A 3I9QA 1B3QA 1B07A 1RLQC 1K4US 2K3BA 2K6DA 1GL5A 3THKA 1PNJA 2BZXA 1GRIA 3UA6A 1E6GA 2DBKA 2YSQA 4RTZA 2C0TA 4JZ3A 2CSQA 1W6XA 3M0RA 2O31A 2EW3A 4J9DA 1YCSB 4QT7A 2A28A 2DRKA 1W1FA 1M3AA 1WX6A 1K0XA 4J9FA 2EKHA 4R0KA 1X69A 1I1JA 2CT3A 3UA7A 2M0YA 1GCQC 2FEIA 2YUNA 5IHIA 2CUBA 2LJ3A 1WXTA 2B86A 4CC4B 1K0SA 2E5KA 3VS1A 4Y92A 5ECAA 1PWTA 2K79A 2LMJA 2DL3A 2RQRA 4J9BA 1UGVA 2LZ6B 2ED1A 1M3BA 1SSHA 1YNZA 2ROLA 3H0HA 1J3TA 2J6OA 3ZL7C 2YUOA 2FRYA 2RQWA 3EG0A 5IHNA 4D8DA 4F14A 2JS0A 1H3HA 4LNPA 4J9CA 1ZUYA 2L3SA 4OMNA 2VVKA 2EGEA 4JPBW 2LQNA 2JMCA 5FWCA 1H92A 3VS6A 1AVZC 2FPEA 1CKAA 1FMKA 1K9AA 2BZYA 1U06A 1WI7A 1AZEA 2K2MA 4X1VA 2DA9A 3I5RA 3VS0A 1HD3A 1GCQA 2C0IA 3REAB 1UE9A 3A98A 1QKXA 3M0TA 1JXMA 2BZ8A 2QDLA 1WIEA 2K7AA 2DF6A 1AWXA 3UF4A 4FSSA 2FPDA 1QCFA 1ZUKA 2HBWA 1UDLA 2AZVA 2KXDA 3VS3A 1BB9A 2W10A 2GBQA 2KNBB 3H0IA 2LJ0A 2J06A 4F16A 1GFCA 2CT4A 3NPFA 3QWXX 2YDLA 1I0CA 1NG2A 4RTTA 4LN2A 2J6FA 2MOXA 2EVRA 5GJWB 4J9GA 2CUDA 1KFZA 3EHRA 3CQTA 2JT4A 4JJCA 1WYXA 2AKLA 5L23A 2AZSA 1ARKA 3VRYA 2W0ZA 1Y0MA 3VS5A 2CREA 1XOVA 1PKTA 2ED0A 3EG2A 3U23A 4HVWA 1X2QA 2NWMA 1NLOC 1JU5C 2JW4A 3VS7A 1UHCA 1EFNA 4KRTA 2F2WA 2GGRA 2ROTA 1AWJA 2DL4A 3PVLA 1ZBJA 1I07A 4Z89A 1KIKA 1QWEA 1NEGA 2KT8A 1PRLC 3GBQA 1TG0A 2DL5A 1U5SA 2RMOA 3NHNA 3UATA 1GFDA 1K1ZA 2H8HA 3ULRB 2VKNA 4J9IA 2ECZA 2NUZA 1RLPC 2KRMA 3PVQA 1UFFA 2KYBA 2FG0A 2D8JA 3TSWA 2GTJA 1V1CA 2FPFA 1T0HA 1UUEA 2KRSA 2GTOA 2KT1A 2DILA 1VYTA 2JM9A 2PNIA 4GBQA 4AG1C 3EG3A 3QWYA 2DNUA 2P4RA 4J9EA 1Y57A 5IH2A 2HSPA 1FYNA 2XMFA 1UJYA 3TVTA 1BU1A 3M0SA 5I22A 1OEBA 4AG2C 1M3CA 1U3OA 2J05A 2HEQA 2JXBA 1NEBA 2JTEA 2K9GA 2A36A 1OPLA 1KSWA 1VYUA 2DYBA 1BK2A 4RTXA 4M4ZA 3TSZA 1M27C 1ZX6A 4ORZA 3VS2A 1CKBA 2I0NA 4A63B 2DX1A 1PKSA 4OMQA 2EYYA 1OPKA 2LJ1A 2KROA 4OMOA 1K76A 2L3PA 4AFZC 2AKKA 2EYXA 2AK5A 2X3XD 2O2OA 2DE0X 2J7IA 4HVVA 1AWOA 1E7OA 4HVUA 2CH4A 1TUCA 1VA7A 1X43A 4E6RA 4IIMA 1UECA 1YN8A 1TUDA 4JJDA 2KEAA 3H0FA 3NMZC 1WFWA 2DRMA 4F17A 4AFQC 1MUZA 3O5ZA 2CH4W 3M0UA 2G6FX 1BBZA 2YUPA 1SEMA 2L0AA 1MV3A 1NYGA 2M51A 4CC2A 2F2XA 4Z8AA 5IXBA 2JS2A 1YWPA 2JMAA 1WXBA 4RTUA 1T0JA 2O9SA 1GBQA 2V1RA 3EG1A 2RQTA 2GNCA 4ESRA 1LCKA 2O88A 1ABQA 2D1XA 3EGUA 2L3QA 1X6BA 1JXOA 2RQVA 2DMOA 4DEXA 2LX7A 2ABLA 3SEMA 1JO8A 2RPNA 1OV3A 1M30A 1QWFA 1KJWA 3REBB 1G83A 2C0OA 2EBPA 2YT6A 1RI9A 1WLPB 1NYFA 1AD5A 2KBTA 2RN8A 2SEMA 2KYMA 5IHKA 1S1NA 1YWOA 1SRLA 2DL8A 3PE0A 4RUGA 2CSIA 1X27A 3I35A 1X6GA 1HSQA 2L2PA 4LE9A 1ZUUA 2YUQA 1T3SA 2BTTA 2RNAA 1H8KA 2EPDA 1WA7A 1AOJA 2DM1A 4HCKA 2DJQA 2KGTA 2EYZA 2LCSA 4OMMA 4RTVA 2MIOA 3H41A 1NM7A 2PTKA 4K11A 2CDTA 2J6KA 5FWBA 2IIMA 4JZ4A 3NGPA 4RTYA 3RNJA 1GCPA 1WXUA 5EC7A 1VYVA 2GQIA 1UG1A 1AEYA 2D0NA 1MV0B 1QKWA 1ZSGA 4LUDA 4IIOA 4WCIA 4LUEA 4J9HA 5FW9A 1GBRA 1HJDA 4GLMA 1UHFA 1JEGA 2EGAA 4HXJA 1SRMA 2A08A 2DLPA 3EHQA 4ZNXA 2DL7A 3M0QA 5I11A 3JV3A 4OMPA 3VRZA 1Z9ZA 4RTWA 1SPKA 2KXCA 1PRMC 1SHFA 1WDXA 2HDAA 2KE9A 2V1QA 3VS4A 4DEYA 2SRCA 1CSKA 2ENMA 1JQQA 3KFVA 2PZ1A 3M0PA 1E6HA 1X2KA 2DVJA 3RBBB 2X3WD 4CC3A 3LH5A 1QLYA 1ABOA 1W70A 1AZGB 1G2BA 3I5SA 1N5ZA 5IXFA 2A37A 2RF0A 1UJ0A 3C0CA 4Z88A 2KR3A 2LQWA 1YP5A 2EQIA 2LNHB 1A0NB 4OMLA 1SHGA 2F2VA 2HCKA 4D8KA 2D8HA 2KRNA 3FJ5A 1NLPC 5HCKA 1T3LA 1UTIA 4AFSC 3IQLA
chains in the Genus database with same CATH superfamily
4EIKA 2PVOB 1VQ8Q 1BCMA 2RQUA 1VQ8A 1PHTA 1VQ4Q 3J7AF 4OF1A 1YITT 3CCMQ 5LJ3h 1VQ4A 3SHWA 4C0GA 3CCMA 2K57A 4E7IA 2OAWA 3V7CA 3CXCS 1JBMA 2E65A 4XU0A 1YFNA 1BI2A 1B07A 4UC4A 2DXTA 4BY6B 3JB9H 3JCMf 4LXCA 4M75D 1GL5A 2DTHA 1YI2T 4LD6A 4IKFA 3MJXA 2YSQA 4RTZA 3ASKA 3E19A 3V8LA 3OYJA 4LDXA 1W6XA 4B9XA 2O4XB 1M1KC 3HL8A 4QT7A 2A28A 2DRKA 1MMGA 2X9HA 3LGFA 1ACMB 1RAGB 4J9FA 2EKHA 2NLUA 4DBFA 1RAIB 3CD6T 1OU9A 2CUBA 1WXTA 2B86A 4C5HA 3GNGA 1WPYA 5GMKi 3EGDA 3QHSA 2EFIA 5GAOm 1PWTA 2MWPA 2LC4A 2DL3A 3R6OA 2VGNA 3GLXA 3RKWA 2ED1A 1M3BA 1KD1R 1SSHA 3H0HA 3SB2A 3CPFA 4MZTA 3ZL7C 2YUOA 2FRYA 5IHNA 4D8DA 4F14A 2JS0A 1K9MC 1VQMT 5GANh 3L2WA 2L3SA 2G3RA 3VS6A 4EMKC 2FPEA 4BE1A 2K2MA 1SF9A 2HKNA 3VS0A 1W4SA 2LTOA 3REAB 3VUZA 1KQSP 1UE9A 2DZ9A 3M0TA 1JXMA 2BZ8A 2QDLA 2COWA 1QCFA 3OYGA 1UDLA 4QKUA 2K5IA 1Q82C 4PKCC 2GBQA 4M7AG 2KNBB 1JJ2S 4NOYA 4C92F 4EMKB 5GMKl 4RTTA 5GAN7 1UB4A 4ANJA 4YTLA 2EVRA 4C92A 1KC8U 2HNIA 1WNLA 1WYXA 2DTOA 2AZSA 3OS5A 3VRYA 4KUDK 4C8QD 3VS5A 1XOVA 3EG2A 4ZTJA 3JCMh 1YI2Q 3V8KA 3I55Q 3FC3A 4JS5A 1YI2A 2CKKA 3FRNA 2BIVA 1G8XA 1EFNA 1LVKA 3I55A 4JRIA 1KQSA 3M53A 3LH0A 1Q86C 1G3TA 1MGQA 1QWEA 2VXEA 1NEGA 4C5GA 4TVRA 2XDBA 1TG0A 5D6XA 1YJWT 3NHNA 1GFDA 5GAOl 4RCCA 5CK9A 2BE7D 4LDVA 3OMCA 1IHWA 1RABB 2H8HA 3ULRB 3CD6Q 3C94A 1TTHB 3LX7A 2L3RA 3CD6A 2MK5A 2NUZA 2Y90A 3OQ5A 1QVFS 1UFFA 5CAIA 2GTJA 3OY9A 3EGDB 4O6JA 1V1CA 1T0HA 2LNVA 4QQGA 4DBRA 1VQMQ 3OBWA 4XU3A 1VYTA 2DNUA 1VQMA 1Y57A 1FYNA 5LJ3d 4C8QC 4C8QE 4XAXB 2HQHA 2JTEA 2K9GA 2JTMA 5GAN3 5FROA 2COYA 2PVDB 2X4XA 3RIRA 1VYUA 4XQ3A 5LJ5e 4GY5A 3S3MA 2I0NA 1VUBA 4C92C 1PKSA 2YXYA 4OMQA 2CZ0B 4XTVA 4NL3A 1YJNT 4EMHA 2AIRB 3HPWA 2RK1A 1K76A 3E9GA 4M75G 4AFZC 2DERA 3M4GA 2AKKA 3S6WA 2AK5A 2X3XD 2VYTA 3UDCA 2Y4XA 5GMKe 2RHYA 4C8QB 2QAZA 5A0GA 2A0FB 4FIBA 4XK8E 5KYWB 1B34A 1XTDA 1YN8A 4JJDA 4RG8A 3M55A 3G7ZA 4XTUA 3VKIA 4C92B 1MNEA 1UGSB 3VYHB 5KYYB 2RI2A 3KUFA 1TWBA 4M77D 1V29B 4IUUA 1NYGA 2M51A 4KUIA 4MDWA 2E3IA 2JS2A 1YWPA 1WXBA 3PGGA 1T0JA 2O9SA 3EG1A 3EG9A 1LCKA 3D7SB 1MMDA 1YJWQ 4BE0A 3A8OB 2NUTA 3BDLA 1YJWA 1BYMA 3FIFA 3EH1A 1FX7A 3VYGA 1RAHB 2LX7A 1OV3A 3GF5A 2QTVA 1G83A 2C0OA 2HD0A 4KT0E 3C12A 1AD5A 4LDUA 3HRSA 4N4GA 1UEBA 4J6WA 1VQ7Q 3CCRT 3GP8A 1VQ7A 2DL8A 3UT1A 4QVZA 1SKUB 2KVQG 3HRTA 2DPPB 2EQKA 3S3OA 2XK0A 1X27A 1X6GA 1HSQA 4XU1A 1T3SA 2RNAA 4QQDA 2FZKB 1QQJA 2L8DA 3CCQT 4M77E 4EPCA 2DJQA 2LCSA 1KC8R 2J6KA 2E64A 3J81E 2M0OA 1AT1B 2RJDA 3NGPA 1HK9A 4RTYA 3RNJA 4B9WA 1ZSZC 1WXUA 1QP2A 4HCCA 1FWZA 3C95A 2WSFE 1MNDA 2CYZB 1QKWA 2B8AA 3P8DA 4IIOA 4LUDA 3G6ET 3HKSA 1JEGA 4OP0A 1SRMA 2DLPA 2CP7A 4HKEA 2CS7A 5I11A 2LT1A 4OMPA 3L42A 1Q81C 4JUVA 3VRZA 4OVAA 5GAN4 4PL6A 2V1QA 2HDAA 2KE9A 4MMKA 4ZGDB 1ZSZB 3H6ZA 1JQQA 2DVJA 3RBBB 1TH7A 2X3WD 4ZTFA 2DKGA 3OS1A 1N8RU 1ABOA 3JAME 5J39A 1N5ZA 1NE8A 3CMET 2RF0A 3C0CA 5KYXA 4OGCA 2DFUA 1VIFA 3FEOA 2HCKA 4DBQA 3OYHA 3EG9B 1T3LA 1UTIA 2HQEA 2QASA 3IQLA 2EAYA 3CBPA 2FO0A 2NUTB 2OTLQ 1Z9QA 2OTLA 1KD1U 1SG5A 3JB9D 5KE3A 3OYMA 4M7AF 1ZHIA 2LP5A 1ZLMA 3A8HB 2MCNA 4N0AC 3BFMA 2DEUA 4JJBA 1D0ZA 2OI3A 1M8MA 2DZCA 2E70A 1Y7XA 3R6NA 4ELZC 2WACA 2DXBA 1VQ4T 4M7AA 3CCMT 3CC4Q 1I5OB 3CC4A 2K3BA 4A54A 1IXDA 3ZBDA 4HA8A 3CC2Q 2VC8A 2WSEE 3EFSA 1VQ9Q 1KG1A 3CC2A 1N6AA 1E6GA 1VQ9A 2DBKA 3TCJA 2C0TA 4LDYA 4PFZA 3M0RA 2ZPHB 3TREA 2EW3A 2XKOC 4D6WA 1M3AA 2QQ9A 3MKDA 4A4EA 1X69A 1YJ9Q 1RL2A 4DOVA 5D6YA 5I21A 1GCQC 4M77G 2FEIA 2YRCA 2YUNA 2E41A 3RMQA 3HFOA 8ATCB 1YJ9A 4CC4B 4E47A 1K0SA 4E2FB 1RAEB 1M1KU 3VS1A 4PJOD 4Y92A 2H3EB 3TQ7P 4J9BA 3H9NA 1WHGA 5KYUA 3EAEA 1YNZA 1J3TA 2J6OA 1H3HA 1VQKQ 4OMNA 2EGEA 4JPBW 1RADB 1VQKA 5FWCA 1H92A 1CKAA 1JB0E 2GFUA 1I81A 1K9AA 3MP6A 5HK3A 2BZYA 2F69A 4X1VA 4GLKA 3MHXA 3JB9J 3CMEQ 1BIAA 1K9MU 3CMEA 1IREB 5CQYA 4LD9K 3A98A 3EH2A 4L59A 3I56Q 4M7AC 2DF6A 2V26A 1BCOA 3I56A 4LDWA 1M2OA 3P8BB 1YCYA 1ZUKA 2HBWA 5LJ5f 1D1BA 1R0BG 3VS3A 1QP3A 2VASA 2W10A 2HL5C 2J06A 2CP3A 4BDYA 4M75F 3QWXX 2YDLA 1UGPB 3ZFJA 2Y4YA 3OYFA 1BIBA 1I0CA 4EMKA 4HCZA 4LN2A 2J6FA 3MEWA 5LJ5j 4EMGA 2CZ6B 1HXDA 4M75A 2CUDA 3OW2P 1W2BS 3F70A 1Q82U 3PT9A 3OYEA 2AKLA 2H3JA 5L23A 1ARKA 2BKDN 2W0ZA 4HT9A 2CREA 2VXFA 2P0PA 4M7AB 2IVWA 5HKCA 1X2QA 1NLOC 2JW4A 2LT4A 5GMKm 2F2WA 3GIBA 3A1PA 2GGRA 2ROTA 3E1SA 2DL4A 2QGFB 2X4YA 4BE2A 1I07A 2QQAA 4PJJA 4QVDA 4RMOA 3I55T 1XQHA 2DL5A 1VQ6T 1N8RR 1K1ZA 2D6FA 4RG2A 2FB7A 3E2UA 3X20B 2ECZA 4PJNA 2P0KA 2XICA 3QO3A 3CC7T 4FM4B 2RH2A 1Q86U 1RLPC 4M78D 3JRZA 4M7DD 2MWOA 2FPFA 1UUEA 3OW2A 4QVCA 2KT1A 1OX9A 2XDPA 5KYUB 3QWYA 2R5MA 5IH2A 4ELYC 3JCMb 2IG0A 2DIQA 1OEBA 5I22A 5DLOA 5GAOq 3OYAA 2JXBA 3JB9G 2FYKA 1OPLA 3SWNC 2K5LA 2DYBA 3CCLA 3M5AA 3P8HA 4C5EA 1M27C 1ZX6A 1QMCA 3CBOA 3VS2A 4Y91A 4A63B 2KDSA 2DX1A 4M75E 4M75C 3TU4K 1TU0B 2FVUA 1KHIA 1R8OB 1O9SA 7AT1B 5GAMd 2EYXA 4C8QF 2MPXC 2O2OA 2K3YA 1VQOT 1AWOA 1E7OA 4HVUA 1UGRB 3CCJT 4C8QA 2YRDA 1S72T 3SWNB 4E6RA 3JCMJ 1UECA 4M78E 5KYWA 1WFWA 2DRMA 4F17A 1MUZA 4M75B 2RM4A 4A4KA 3M0UA 1C6VX 1QCOA 1M1KR 2G6FX 2YUPA 2RB6A 4XU2A 1MV3A 4PNOA 5KYYA 2DYIA 4F7UG 4CC2A 3FJPA 2F2XA 5D6WA 4PJOG 1G3YA 1U8RA 3CCET 5IAYA 4Z02A 1GBQA 2RQTA 5LJ3e 4MZPA 2O88A 2EYQA 2D1XA 3EGUA 3HHTB 4FW2A 4RCBA 1VQ6Q 4M78B 1VQ6A 2DMOA 2CP2A 2LVMA 3LW5E 2R57A 1M30A 1QWFA 1KJWA 2A3LA 1WQWA 4X9DA 1DJ7B 1RI9A 1K9MR 3CC7Q 2RJCA 3LGLA 5CIUA 2RN8A 3Q1JA 5DM7R 3CC7A 2SEMA 4KH1B 2KQWA 1FMVA 5IHKA 1RACB 1S1NA 1TUGB 1I4K1 1YWOA 1SRLA 3JCMX 4E7JA 1N9SA 5HK0A 3VU3C 1VQ7T 3AT1B 1K73C 3HRUA 4JRQA 1ZUUA 5GAN5 2YUQA 1WGSA 2BTTA 2KI7A 2RI5A 2HSEB 3QPHA 4HCKA 2DD5A 4PLIA 4OMMA 2F1LA 1NM7A 4K11A 4XTWA 1Q82R 1WJRA 2ATCB 2VUBA 3WXMB 1VYVA 1X75C 2GQIA 2E10A 1UG1A 4C0FA 1I5LA 4E7HA 2ZPBB 3E9FA 4WCIA 3QJ6A 4LUEA 5FW9A 3PNWC 2QGGA 1VQOQ 4M77F 2A08A 3X24B 3CCJQ 4E7LA 1VQOA 4RTWA 1SPKA 3CCJA 3UPUA 1S72Q 4Q5WA 2KXCA 4KULA 5CR2A 1S72A 4IUPA 1SHFA 4M77A 4XTXA 3VS4A 1R0CB 3CEYA 2M16A 3KFVA 2PZ1A 3M0PA 5A2QE 1K8AC 2F5TX 2XHCA 1NPRA 1M5Q1 4CRIA 1ZSZA 3LH5A 1Q86R 2ZAEA 1Q81U 1W70A 3MCAB 1G2BA 2OX7A 3I5SA 2OTJT 2DVEA 3CPWP 2A37A 4M78G 3CCEQ 4Z88A 2KAFA 1YP5A 4M7DG 1G3WA 3CCEA 4OMLA 2QA4T 2F2VA 5CKHA 1M1GA 5EG2A 2D8HA 2KRNA 2Z0WA 4IUVA 4BI4A 3BY7A 5GANd 3C4SA 1KK7A 2XG8D 2DBMA 2EYWA 4CC7A 2EJ9A 1IO6A 2P0QA 2YWWA 1AWWA 3EGXA 2CZ1B 2CGHA 3RESA 3CCUQ 3CCUA 2MAMA 3QZ9B 2FRWA 3GNFB 2OTLT 1C1AA 1OOTA 4KBMB 1WJSA 4BUGA 5GAOp 3CXCP 2O9VA 2JM8A 1RLQC 1K4US 4E7KA 2K6DA 4PFOA 4FYXB 3QG1A 1PNJA 3UA6A 2E6ZA 3CC4T 2HAXA 3CPWA 5GAN8 1VQ5Q 3EFOB 4JZ3A 1VQ5A 3MEAA 3URGA 3OBYA 3CC2T 2FL7A 1VQ9T 5FRNA 1EZZB 3PIPA 4M77C 1W1FA 2V8KA 1WX6A 2XIDA 5D7UA 1K0XA 5I2SA 4N0AA 2DXUA 4R0KA 1I1JA 4J7IA 2MMPA 3J80E 1OX8A 2M0YA 2QYZA 2JVVA 1OQKA 2X35A 3JCMd 2D0QB 3WVDB 3RR6A 3QBYA 1G3SA 2E5KA 2L5QA 1YJ9T 4FW1A 1RAFB 4JRPA 3OYCA 2K79A 3JSCA 1UGVA 1B7TA 2LZ6B 2ROLA 5J3BA 5A0LA 1D1AA 2X4JA 2RQWA 3CXCA 3M4YA 4RKUE 3NTKA 4LNPA 2LRQA 2VVKA 2M9UA 4M77B 3QDFA 1FMKA 3CBMA 3QXEB 4OMFB 1WI7A 1VQKT 2OTJQ 5KYNA 5DY9A 2OTJA 1KQSS 1HD3A 1GCQA 2C0IA 3JB9F 2KK4A 3KXTA 4FT4A 2QA4Q 1QKXA 3OSVA 1TOVA 4JS4A 2CP5A 2RHXA 2QA4A 1WIEA 1FXXA 3MP8A 5KE2A 1AWXA 3UF4A 4FSSA 3SDZA 2FPDA 1XNIA 3DLLA 2QXFA 2AZVA 1ZA2B 2RHIA 1BB9A 4N4HA 3I56T 3H0IA 1HYOA 2LJ0A 1WJQA 3X28B 1O75A 4F16A 1JJ2P 1GFCA 2CT4A 3G71Q 4PJLA 3BDUA 1RI0A 3QDRB 1NPPA 3NFCA 4J6XA 3G71A 2ZCFB 3EGXB 2MOXA 1NBEB 4ME7A 4J9GA 1KFZA 4OB1B 3EHRA 3QZ5B 4JJCA 1M2VA 4HT8A 4L5GA 1Y0MA 3U23A 1M90U 2DETA 1GXIE 1N9RA 2NWMA 2M02A 1JU5C 3JCMW 2RHUA 3VS7A 1UHCA 2LQ8A 3LWHA 4KRTA 4A4HA 1AWJA 4FYWB 3PVLA 1ZBJA 2JUFA 2EQMA 4F7UF 4L6V5 4AT1B 2BUDA 4PJMA 4PJOF 5LJ5g 4IUTA 1MMAA 1OI1A 4X9CA 2KT8A 4F04B 3G4SQ 3GBQA 1U5SA 2RMOA 3UATA 3G4SA 2K2VA 5HY6A 4F7UA 1Q81R 1SSFA 4PJOA 1PD0A 2VB6A 1JJ2A 3MPUB 3OB9A 4IUQA 2KRMA 2FG0A 3TSWA 4DBHA 2JZ2A 4QQ6A 4R56A 4V2SA 3CCST 2GTOA 4DOWA 5CQXA 2DILA 2JM9A 2PNIA 4AG1C 3EG3A 1U1TA 2P4RA 4J8OA 1QVGP 1D3BB 2HSPA 2XMFA 1UJYA 3TVTA 3M0SA 3X25B 3V7SA 4AG2C 2J05A 3CCVQ 3JCMP 5CKBA 1NEBA 3ER0A 2A36A 3CCVA 4BD3A 1NZ9A 4RTXA 4M4ZA 1PCXA 4PFPA 1CKBA 2YLBA 2HQXA 1WHMA 3M57A 2EYYA 1VQNT 1OPKA 4E7ZA 3CCLT 3RUXA 3OS0A 2ZPFB 3MEVA 3N5BB 3SFMA 3OSSC 2E12A 2HKQB 1D0YA 1YBYA 4B6MA 1BKBA 2J7IA 2CH4A 3RMSA 1TUCA 1X43A 2L89A 3M9QA 2V8JA 3WVEB 1TUDA 2KEAA 3NMZC 3LLRA 3SWNA 1M90C 1EX4A 3VUBA 4AFQC 1QVGA 3AHUA 2E1HA 3CPWS 3BE3A 4F7UE 3QYGB 1VQLQ 4PJOC 3JCMQ 5IN1A 4PJOE 1M2VB 3HP9A 4EDUA 1VQLA 2DTIA 2C06A 2L0AA 2K3XA 5IXBA 3PMIA 2JMAA 4RTUA 2V1RA 3QSUA 2LDMA 2GNCA 4ESRA 2XDDA 3OYYA 4M78F 4XTYA 4M7DF 5GMKj 2L3QA 2PUKB 2RO0A 2MF2A 1X6BA 1KQ2A 2YHTA 1JXOA 2ZPGB 4DEXA 2ABLA 3SEMA 2RPNA 2ZZDA 5GAN2 4M78A 3REBB 2YRVA 1PM3A 2EBPA 3NTIA 4M7DA 4F7UB 3OA6A 1EIFA 4PJOB 5KCHA 1NYFA 2LCCA 3O8VA 2KBTA 2QQRA 2ZGWA 3L2UA 2PU9B 4FU6A 1X01A 3QKJA 2ZPEB 3H8ZA 3X26B 5GAMe 5A0DA 1U1SA 3PE0A 3CCSQ 1RAAB 2MYSA 2JN0A 4RUGA 4WF2A 3CCSA 1JRIA 4BACA 4C5IA 3I35A 2O01E 2L2PA 2VGMA 4LE9A 2NYSA 2RJEA 3META 2JOYA 1MMNA 2EPDA 1M9SA 3M56A 1AOJA 4JLGA 5KH6A 2KGTA 4RTVA 1QVPA 1BI0A 2PTKA 2CDTA 5FWBA 2IIMA 4NS5A 4JZ4A 3DB3A 1QCNA 3NTHA 1K73U 2NUPA 1IGQA 1OU8A 2KMTA 3VJPA 1VQNQ 1IGUA 4KGZB 3M59A 3CCLQ 1M90R 4MZMA 1VQNA 1AEYA 3EFRA 1MV0B 1ZSGA 4JDSA 1LOJA 2HZYA 1VQPQ 1M4ZA 4N4IA 4GLMA 1VQPA 3A5ZB 1XJWB 2EGAA 4HXJA 5LJ5h 3EHQA 4ZNXA 3OYDA 3M0QA 2DO3A 1Z9ZA 1PC0A 1F1BB 8AT1B 2CP6A 3CMAT 3T9NA 1PRMC 4FYYB 5C0MA 1Y96A 2SRCA 1CSKA 5FU7C 3RKXA 4CC3A 4M78C 1IZ6A 3DB4A 5GMKh 2ZPIB 4M7DC 4M7DE 5GAOr 4OB3B 2EWNA 5GAN6 5IXFA 1ZQ1A 1UGQB 1UJ0A 2K5FA 2XU8A 1Q95G 1A0NB 3GOXA 1Q7YU 1K8AU 1SHGA 1G5VA 3FJ5A 2PUOB 1NLPC 3MO8A 4FL6A 1YITQ 4A4GA 1YITA 4AFUC 2OJ2A 1RUWA 2JJ9A 4ATOA 2RK2A 3BW1A 5FU7B 3G1JA 3PTAA 2EGCA 3V8JA 3OYIA 4M7DB 2FZCB 1WQ7A 2ESWA 1D0XA 2VWFA 4J5YA 1PSEA 3JB9I 4MDXA 4E7SA 2JNGA 3CCUT 2FHDA 5GJVB 3I9QA 1B3QA 3S3NA 2QG9B 2R58A 4C92D 3INZA 3THKA 1LPLA 2RD1A 2BZXA 1GRIA 2V8IA 1YHQT 3HFNA 2BE9B 2CSQA 4PK4A 1LJOA 2O31A 3EFOA 4IURA 4J9DA 1YCSB 2AT1B 1VQ5T 1IHVA 2NUPB 2CT3A 3HTRA 3UA7A 5IHIA 3PFSA 2LJ3A 2P4TA 2JTFA 4II1A 5GANe 5ECAA 4QW2A 1OZ3A 1QVGS 1P92A 2LMJA 2RQRA 2EJFA 5FLXE 2RA2A 2QQSA 1YIJT 3CMAQ 3A8LB 2HL3A 3EG0A 3CMAA 3OYLA 4J9CA 1ZUYA 2WSCE 1IRXA 2LQNA 2LX9A 2JMCA 1OYXA 1Y96B 1AVZC 2DIGA 2MI6A 1TXQA 4J6YA 2EQJA 2QTXA 3V7RA 1U06A 1AZEA 4C92E 2DXCA 1Q7YC 3VV0A 1KQ1A 2DA9A 4Y28E 4ZGJB 3I5RA 4JJNK 1MHNA 1H641 5AYFA 4FSXA 3M54A 1OULA 2K7AA 2QDYB 5CVIA 3QIIA 1QW1A 5KCOA 1KC8C 2KXDA 4FT2A 2QEXT 3LWIA 4P5NA 2RHZA 4AMCA 3RKYA 4OB2B 1IB8A 3NPFA 5GAMg 1Y07A 1K73R 4HCBA 1D1CA 1NG2A 1I8FA 3L2RA 5GJWB 3JCMe 4XTZA 3OW2S 3CQTA 3G71T 2JT4A 3UWNA 1W2BP 4O5VA 4A53A 5LJ5d 3MP1A 1PKTA 2ED0A 2DD4A 3OMGA 4HVWA 1NJIU 5CKFA 1YHQQ 4KGXB 4MMLA 2X4WA 4Z89A 1KIKA 1YHQA 3TEEA 5CO7A 1PRLC 1PSFA 2VKNA 4J9IA 4J7FA 3G4ST 3PMTA 1N27A 1Q7YR 1K8AR 2RJFA 5CCAA 3PVQA 2KYBA 2GFAA 2D8JA 2COZA 4C0DC 5L8RE 1YIJQ 2KRSA 2GCXA 4A4FA 1W2BA 1YIJA 2KY9A 1WZOA 1ZBXA 4GBQA 2LQKA 3DKMA 4J9EA 3QJYA 1BU1A 2EKOA 5GAMf 1H3ZA 3GPLA 1FMWA 1D3BA 1M3CA 2YLCA 1U3OA 1LNXA 2DAQA 2HEQA 4X34A 2M1HA 2D9TA 2VV5A 2QK0A 1KSWA 4C8QG 1YJNQ 4C0ZA 1BK2A 3A8GB 3RDVA 1YJNA 3TSZA 4ORZA 2XI9A 3ME9A 4DA4A 3CCVT 5GAMj 5LJ3g 1BI3A 4NL2A 4C0DB 2LJ1A 2GQVA 2KROA 4OMOA 2L3PA 4C92G 6AT1B 2QEXQ 4JRKA 4JLIA 2QEXA 2DE0X 3FB9A 1X6OA 4HVVA 1B34B 2E6NA 2QI2A 1VA7A 1PG5B 1WHLA 2AHJB 5LL6S 4ZN3A 4IIMA 1VIEA 3H0FA 2DJZA 1NJIC 3O5ZA 2CH4W 5CKEA 2I2LA 1BBZA 1SEMA 2KSSA 1TSFA 3ZEHA 3LYIA 4Z8AA 5GAOn 2CP0A 2QQBA 1VQLT 1PD1A 1WHJA 2HMAA 4BDZA 3KBGA 5FU6C 2PQWA 2OAUA 5J26A 4ZN1A 1ABQA 3PIOA 4ZGEB 2RI3A 4FCYA 2GF7A 1WHHA 2RQVA 1AHJB 3QYHB 1JO8A 3CCRQ 3JCMc 5GANg 1VQ8T 2YT6A 3CCRA 1TS9A 1WLPB 5I2MA 3MEUA 2EIFA 3JCMV 1M8VA 5AT1B 5LJ3f 4WTOB 1C0MA 3L2QA 2KYMA 1V76A 3HSBA 3OS2A 2EQUA 3OYNA 5FU6B 1KHCA 1QVFP 2CSIA 1OZ2A 3CCQQ 5FRMA 4FYVB 5LJ3j 3CCQA 2XD0A 5GAMh 3FLGA 3A8MB 3M58A 1H8KA 4VUBA 4BI3A 1WA7A 5IT9E 4M7AD 2DK3A 2A7YA 3L1AA 2E3HA 2DM1A 2O4XA 2HBPA 2EYZA 4BI8B 2MIOA 3H41A 2FZGB 4BB7A 1R77A 4OGEA 3OYBA 1GCPA 4DQ2A 3G6EQ 1M1FA 5EC7A 2CZ7B 1Y71A 3G6EA 4R55A 1NJIR 2D0NA 9ATCB 4CI0C 3OYKA 2X51A 3QUIA 4J9HA 1GBRA 1HJDA 2EJGA 1UHFA 4PLLA 4J83A 2PVGB 3JCMg 2DL7A 1N8RC 3JV3A 1VOMA 1VQPT 2IPOB 2DEQA 2E4HA 3SD4A 1QVFA 1WDXA 4DEYA 1D09B 2LCLA 2P84A 3DLMA 5GANf 2ENMA 2R5AA 1E6HA 1X2KA 5CKDA 1QLYA 2K4YA 1AZGB 1BI1A 4OB0B 5KYXB 5C6SA 4M7AE 3RERA 5DLQE 5GANj 2KR3A 2LQWA 2EQIA 2F5KA 2LNHB 2E5QA 1ZA1B 4KGVB 1KD1C 3L2ZA 1WHKA 4D8KA 3FDRA 4BY6C 4KH0B 5HCKA 5M9OA 4AFSC 3L2VA
chains in the Genus database with same CATH topology
2FO0A 4EIKA 2DBMA 2EYWA 2OJ2A 1RUWA 4AFUC 4CC7A 1IO6A 1Z9QA 2RQUA 1AWWA 2EGCA 1PHTA 2LP5A 1ZLMA 2ESWA 2VWFA 3SHWA 2MCNA 2FRWA 4JJBA 2OI3A 1OOTA 2OAWA 1M8MA 3R6NA 2O9VA 5GJVB 2JM8A 3I9QA 1B3QA 1B07A 1RLQC 1K4US 2K3BA 2K6DA 1GL5A 3THKA 1PNJA 2BZXA 1GRIA 3UA6A 1E6GA 2DBKA 2YSQA 4RTZA 2C0TA 4JZ3A 2CSQA 1W6XA 3M0RA 2O31A 2EW3A 4J9DA 1YCSB 4QT7A 2A28A 2DRKA 1W1FA 1M3AA 1WX6A 1K0XA 4J9FA 2EKHA 4R0KA 1X69A 1I1JA 2CT3A 3UA7A 2M0YA 1GCQC 2FEIA 2YUNA 5IHIA 2CUBA 2LJ3A 1WXTA 2B86A 4CC4B 1K0SA 2E5KA 3VS1A 4Y92A 5ECAA 1PWTA 2K79A 2LMJA 2DL3A 2RQRA 4J9BA 1UGVA 2LZ6B 2ED1A 1M3BA 1SSHA 1YNZA 2ROLA 3H0HA 1J3TA 2J6OA 3ZL7C 2YUOA 2FRYA 2RQWA 3EG0A 5IHNA 4D8DA 4F14A 2JS0A 1H3HA 4LNPA 4J9CA 1ZUYA 2L3SA 4OMNA 2VVKA 2EGEA 4JPBW 2LQNA 2JMCA 5FWCA 1H92A 3VS6A 1AVZC 2FPEA 1CKAA 1FMKA 1K9AA 2BZYA 1U06A 1WI7A 1AZEA 2K2MA 4X1VA 2DA9A 3I5RA 3VS0A 1HD3A 1GCQA 2C0IA 3REAB 1UE9A 3A98A 1QKXA 3M0TA 1JXMA 2BZ8A 2QDLA 1WIEA 2K7AA 2DF6A 1AWXA 3UF4A 4FSSA 2FPDA 1QCFA 1ZUKA 2HBWA 1UDLA 2AZVA 2KXDA 3VS3A 1BB9A 2W10A 2GBQA 2KNBB 3H0IA 2LJ0A 2J06A 4F16A 1GFCA 2CT4A 3NPFA 3QWXX 2YDLA 1I0CA 1NG2A 4RTTA 4LN2A 2J6FA 2MOXA 2EVRA 5GJWB 4J9GA 2CUDA 1KFZA 3EHRA 3CQTA 2JT4A 4JJCA 1WYXA 2AKLA 5L23A 2AZSA 1ARKA 3VRYA 2W0ZA 1Y0MA 3VS5A 2CREA 1XOVA 1PKTA 2ED0A 3EG2A 3U23A 4HVWA 1X2QA 2NWMA 1NLOC 1JU5C 2JW4A 3VS7A 1UHCA 1EFNA 4KRTA 2F2WA 2GGRA 2ROTA 1AWJA 2DL4A 3PVLA 1ZBJA 1I07A 4Z89A 1KIKA 1QWEA 1NEGA 2KT8A 1PRLC 3GBQA 1TG0A 2DL5A 1U5SA 2RMOA 3NHNA 3UATA 1GFDA 1K1ZA 2H8HA 3ULRB 2VKNA 4J9IA 2ECZA 2NUZA 1RLPC 2KRMA 3PVQA 1UFFA 2KYBA 2FG0A 2D8JA 3TSWA 2GTJA 1V1CA 2FPFA 1T0HA 1UUEA 2KRSA 2GTOA 2KT1A 2DILA 1VYTA 2JM9A 2PNIA 4GBQA 4AG1C 3EG3A 3QWYA 2DNUA 2P4RA 4J9EA 1Y57A 5IH2A 2HSPA 1FYNA 2XMFA 1UJYA 3TVTA 1BU1A 3M0SA 5I22A 1OEBA 4AG2C 1M3CA 1U3OA 2J05A 2HEQA 2JXBA 1NEBA 2JTEA 2K9GA 2A36A 1OPLA 1KSWA 1VYUA 2DYBA 1BK2A 4RTXA 4M4ZA 3TSZA 1M27C 1ZX6A 4ORZA 3VS2A 1CKBA 2I0NA 4A63B 2DX1A 1PKSA 4OMQA 2EYYA 1OPKA 2LJ1A 2KROA 4OMOA 1K76A 2L3PA 4AFZC 2AKKA 2EYXA 2AK5A 2X3XD 2O2OA 2DE0X 2J7IA 4HVVA 1AWOA 1E7OA 4HVUA 2CH4A 1TUCA 1VA7A 1X43A 4E6RA 4IIMA 1UECA 1YN8A 1TUDA 4JJDA 2KEAA 3H0FA 3NMZC 1WFWA 2DRMA 4F17A 4AFQC 1MUZA 3O5ZA 2CH4W 3M0UA 2G6FX 1BBZA 2YUPA 1SEMA 2L0AA 1MV3A 1NYGA 2M51A 4CC2A 2F2XA 4Z8AA 5IXBA 2JS2A 1YWPA 2JMAA 1WXBA 4RTUA 1T0JA 2O9SA 1GBQA 2V1RA 3EG1A 2RQTA 2GNCA 4ESRA 1LCKA 2O88A 1ABQA 2D1XA 3EGUA 2L3QA 1X6BA 1JXOA 2RQVA 2DMOA 4DEXA 2LX7A 2ABLA 3SEMA 1JO8A 2RPNA 1OV3A 1M30A 1QWFA 1KJWA 3REBB 1G83A 2C0OA 2EBPA 2YT6A 1RI9A 1WLPB 1NYFA 1AD5A 2KBTA 2RN8A 2SEMA 2KYMA 5IHKA 1S1NA 1YWOA 1SRLA 2DL8A 3PE0A 4RUGA 2CSIA 1X27A 3I35A 1X6GA 1HSQA 2L2PA 4LE9A 1ZUUA 2YUQA 1T3SA 2BTTA 2RNAA 1H8KA 2EPDA 1WA7A 1AOJA 2DM1A 4HCKA 2DJQA 2KGTA 2EYZA 2LCSA 4OMMA 4RTVA 2MIOA 3H41A 1NM7A 2PTKA 4K11A 2CDTA 2J6KA 5FWBA 2IIMA 4JZ4A 3NGPA 4RTYA 3RNJA 1GCPA 1WXUA 5EC7A 1VYVA 2GQIA 1UG1A 1AEYA 2D0NA 1MV0B 1QKWA 1ZSGA 4LUDA 4IIOA 4WCIA 4LUEA 4J9HA 5FW9A 1GBRA 1HJDA 4GLMA 1UHFA 1JEGA 2EGAA 4HXJA 1SRMA 2A08A 2DLPA 3EHQA 4ZNXA 2DL7A 3M0QA 5I11A 3JV3A 4OMPA 3VRZA 1Z9ZA 4RTWA 1SPKA 2KXCA 1PRMC 1SHFA 1WDXA 2HDAA 2KE9A 2V1QA 3VS4A 4DEYA 2SRCA 1CSKA 2ENMA 1JQQA 3KFVA 2PZ1A 3M0PA 1E6HA 1X2KA 2DVJA 3RBBB 2X3WD 4CC3A 3LH5A 1QLYA 1ABOA 1W70A 1AZGB 1G2BA 3I5SA 1N5ZA 5IXFA 2A37A 2RF0A 1UJ0A 3C0CA 4Z88A 2KR3A 2LQWA 1YP5A 2EQIA 2LNHB 1A0NB 4OMLA 1SHGA 2F2VA 2HCKA 4D8KA 2D8HA 2KRNA 3FJ5A 1NLPC 5HCKA 1T3LA 1UTIA 4AFSC 3IQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FO0 A;  4EIK A;  2DBM A;  2EYW A;  2OJ2 A;  1RUW A;  4AFU C;  4CC7 A;  1IO6 A;  1Z9Q A;  2RQU A;  1AWW A;  2EGC A;  1PHT A;  2LP5 A;  1ZLM A;  2ESW A;  2VWF A;  3SHW A;  2MCN A;  2FRW A;  4JJB A;  2OI3 A;  1OOT A;  2OAW A;  1M8M A;  3R6N A;  2O9V A;  5GJV B;  2JM8 A;  3I9Q A;  1B3Q A;  1B07 A;  1RLQ C;  1K4U S;  2K3B A;  2K6D A;  1GL5 A;  3THK A;  1PNJ A;  2BZX A;  1GRI A;  3UA6 A;  1E6G A;  2DBK A;  2YSQ A;  4RTZ A;  2C0T A;  4JZ3 A;  2CSQ A;  1W6X A;  3M0R A;  2O31 A;  2EW3 A;  4J9D A;  1YCS B;  4QT7 A;  2A28 A;  2DRK A;  1W1F A;  1M3A A;  1WX6 A;  1K0X A;  4J9F A;  2EKH A;  4R0K A;  1X69 A;  1I1J A;  2CT3 A;  3UA7 A;  2M0Y A;  1GCQ C;  2FEI A;  2YUN A;  5IHI A;  2CUB A;  2LJ3 A;  1WXT A;  2B86 A;  4CC4 B;  1K0S A;  2E5K A;  3VS1 A;  4Y92 A;  5ECA A;  1PWT A;  2K79 A;  2LMJ A;  2DL3 A;  2RQR A;  4J9B A;  1UGV A;  2LZ6 B;  2ED1 A;  1M3B A;  1SSH A;  1YNZ A;  2ROL A;  3H0H A;  1J3T A;  2J6O A;  3ZL7 C;  2YUO A;  2FRY A;  2RQW A;  3EG0 A;  5IHN A;  4D8D A;  4F14 A;  2JS0 A;  1H3H A;  4LNP A;  4J9C A;  1ZUY A;  2L3S A;  4OMN A;  2VVK A;  2EGE A;  4JPB W;  2LQN A;  2JMC A;  5FWC A;  1H92 A;  3VS6 A;  1AVZ C;  2FPE A;  1CKA A;  1FMK A;  1K9A A;  2BZY A;  1U06 A;  1WI7 A;  1AZE A;  2K2M A;  4X1V A;  2DA9 A;  3I5R A;  3VS0 A;  1HD3 A;  1GCQ A;  2C0I A;  3REA B;  1UE9 A;  3A98 A;  1QKX A;  3M0T A;  1JXM A;  2BZ8 A;  2QDL A;  1WIE A;  2K7A A;  2DF6 A;  1AWX A;  3UF4 A;  4FSS A;  2FPD A;  1QCF A;  1ZUK A;  2HBW A;  1UDL A;  2AZV A;  2KXD A;  3VS3 A;  1BB9 A;  2W10 A;  2GBQ A;  2KNB B;  3H0I A;  2LJ0 A;  2J06 A;  4F16 A;  1GFC A;  2CT4 A;  3NPF A;  3QWX X;  2YDL A;  1I0C A;  1NG2 A;  4RTT A;  4LN2 A;  2J6F A;  2MOX A;  2EVR A;  5GJW B;  4J9G A;  2CUD A;  1KFZ A;  3EHR A;  3CQT A;  2JT4 A;  4JJC A;  1WYX A;  2AKL A;  5L23 A;  2AZS A;  1ARK A;  3VRY A;  2W0Z A;  1Y0M A;  3VS5 A;  2CRE A;  1XOV A;  1PKT A;  2ED0 A;  3EG2 A;  3U23 A;  4HVW A;  1X2Q A;  2NWM A;  1NLO C;  1JU5 C;  2JW4 A;  3VS7 A;  1UHC A;  1EFN A;  4KRT A;  2F2W A;  2GGR A;  2ROT A;  1AWJ A;  2DL4 A;  3PVL A;  1ZBJ A;  1I07 A;  4Z89 A;  1KIK A;  1QWE A;  1NEG A;  2KT8 A;  1PRL C;  3GBQ A;  1TG0 A;  2DL5 A;  1U5S A;  2RMO A;  3NHN A;  3UAT A;  1GFD A;  1K1Z A;  2H8H A;  3ULR B;  2VKN A;  4J9I A;  2ECZ A;  2NUZ A;  1RLP C;  2KRM A;  3PVQ A;  1UFF A;  2KYB A;  2FG0 A;  2D8J A;  3TSW A;  2GTJ A;  1V1C A;  2FPF A;  1T0H A;  1UUE A;  2KRS A;  2GTO A;  2KT1 A;  2DIL A;  1VYT A;  2JM9 A;  2PNI A;  4GBQ A;  4AG1 C;  3EG3 A;  3QWY A;  2DNU A;  2P4R A;  4J9E A;  1Y57 A;  5IH2 A;  2HSP A;  1FYN A;  2XMF A;  1UJY A;  3TVT A;  1BU1 A;  3M0S A;  5I22 A;  1OEB A;  4AG2 C;  1M3C A;  1U3O A;  2J05 A;  2HEQ A;  2JXB A;  1NEB A;  2JTE A;  2K9G A;  2A36 A;  1OPL A;  1KSW A;  1VYU A;  2DYB A;  1BK2 A;  4RTX A;  4M4Z A;  3TSZ A;  1M27 C;  1ZX6 A;  4ORZ A;  3VS2 A;  1CKB A;  2I0N A;  4A63 B;  2DX1 A;  1PKS A;  4OMQ A;  2EYY A;  1OPK A;  2LJ1 A;  2KRO A;  4OMO A;  1K76 A;  2L3P A;  4AFZ C;  2AKK A;  2EYX A;  2AK5 A;  2X3X D;  2O2O A;  2DE0 X;  2J7I A;  4HVV A;  1AWO A;  1E7O A;  4HVU A;  2CH4 A;  1TUC A;  1VA7 A;  1X43 A;  4E6R A;  4IIM A;  1UEC A;  1YN8 A;  1TUD A;  4JJD A;  2KEA A;  3H0F A;  3NMZ C;  1WFW A;  2DRM A;  4F17 A;  4AFQ C;  1MUZ A;  3O5Z A;  2CH4 W;  3M0U A;  2G6F X;  1BBZ A;  2YUP A;  1SEM A;  2L0A A;  1MV3 A;  1NYG A;  2M51 A;  4CC2 A;  2F2X A;  4Z8A A;  5IXB A;  2JS2 A;  1YWP A;  2JMA A;  1WXB A;  4RTU A;  1T0J A;  2O9S A;  1GBQ A;  2V1R A;  3EG1 A;  2RQT A;  2GNC A;  4ESR A;  1LCK A;  2O88 A;  1ABQ A;  2D1X A;  3EGU A;  2L3Q A;  1X6B A;  1JXO A;  2RQV A;  2DMO A;  4DEX A;  2LX7 A;  2ABL A;  3SEM A;  1JO8 A;  2RPN A;  1OV3 A;  1M30 A;  1QWF A;  1KJW A;  3REB B;  1G83 A;  2C0O A;  2EBP A;  2YT6 A;  1RI9 A;  1WLP B;  1NYF A;  1AD5 A;  2KBT A;  2RN8 A;  2SEM A;  2KYM A;  5IHK A;  1S1N A;  1YWO A;  1SRL A;  2DL8 A;  3PE0 A;  4RUG A;  2CSI A;  1X27 A;  3I35 A;  1X6G A;  1HSQ A;  2L2P A;  4LE9 A;  1ZUU A;  2YUQ A;  1T3S A;  2BTT A;  2RNA A;  1H8K A;  2EPD A;  1WA7 A;  1AOJ A;  2DM1 A;  4HCK A;  2DJQ A;  2KGT A;  2EYZ A;  2LCS A;  4OMM A;  4RTV A;  2MIO A;  3H41 A;  1NM7 A;  2PTK A;  4K11 A;  2CDT A;  2J6K A;  5FWB A;  2IIM A;  4JZ4 A;  3NGP A;  4RTY A;  3RNJ A;  1GCP A;  1WXU A;  5EC7 A;  1VYV A;  2GQI A;  1UG1 A;  1AEY A;  2D0N A;  1MV0 B;  1QKW A;  1ZSG A;  4LUD A;  4IIO A;  4WCI A;  4LUE A;  4J9H A;  5FW9 A;  1GBR A;  1HJD A;  4GLM A;  1UHF A;  1JEG A;  2EGA A;  4HXJ A;  1SRM A;  2A08 A;  2DLP A;  3EHQ A;  4ZNX A;  2DL7 A;  3M0Q A;  5I11 A;  3JV3 A;  4OMP A;  3VRZ A;  1Z9Z A;  4RTW A;  1SPK A;  2KXC A;  1PRM C;  1SHF A;  1WDX A;  2HDA A;  2KE9 A;  2V1Q A;  3VS4 A;  4DEY A;  2SRC A;  1CSK A;  2ENM A;  1JQQ A;  3KFV A;  2PZ1 A;  3M0P A;  1E6H A;  1X2K A;  2DVJ A;  3RBB B;  2X3W D;  4CC3 A;  3LH5 A;  1QLY A;  1ABO A;  1W70 A;  1AZG B;  1G2B A;  3I5S A;  1N5Z A;  5IXF A;  2A37 A;  2RF0 A;  1UJ0 A;  3C0C A;  4Z88 A;  2KR3 A;  2LQW A;  1YP5 A;  2EQI A;  2LNH B;  1A0N B;  4OML A;  1SHG A;  2F2V A;  2HCK A;  4D8K A;  2D8H A;  2KRN A;  3FJ5 A;  1NLP C;  5HCK A;  1T3L A;  1UTI A;  4AFS C;  3IQL A; 
#chains in the Genus database with same CATH topology
 4EIK A;  2PVO B;  1VQ8 Q;  1BCM A;  2RQU A;  1VQ8 A;  1PHT A;  1VQ4 Q;  3J7A F;  4OF1 A;  1YIT T;  3CCM Q;  5LJ3 h;  1VQ4 A;  3SHW A;  4C0G A;  3CCM A;  2K57 A;  4E7I A;  2OAW A;  3V7C A;  3CXC S;  1JBM A;  2E65 A;  4XU0 A;  1YFN A;  1BI2 A;  1B07 A;  4UC4 A;  2DXT A;  4BY6 B;  3JB9 H;  3JCM f;  4LXC A;  4M75 D;  1GL5 A;  2DTH A;  1YI2 T;  4LD6 A;  4IKF A;  3MJX A;  2YSQ A;  4RTZ A;  3ASK A;  3E19 A;  3V8L A;  3OYJ A;  4LDX A;  1W6X A;  4B9X A;  2O4X B;  1M1K C;  3HL8 A;  4QT7 A;  2A28 A;  2DRK A;  1MMG A;  2X9H A;  3LGF A;  1ACM B;  1RAG B;  4J9F A;  2EKH A;  2NLU A;  4DBF A;  1RAI B;  3CD6 T;  1OU9 A;  2CUB A;  1WXT A;  2B86 A;  4C5H A;  3GNG A;  1WPY A;  5GMK i;  3EGD A;  3QHS A;  2EFI A;  5GAO m;  1PWT A;  2MWP A;  2LC4 A;  2DL3 A;  3R6O A;  2VGN A;  3GLX A;  3RKW A;  2ED1 A;  1M3B A;  1KD1 R;  1SSH A;  3H0H A;  3SB2 A;  3CPF A;  4MZT A;  3ZL7 C;  2YUO A;  2FRY A;  5IHN A;  4D8D A;  4F14 A;  2JS0 A;  1K9M C;  1VQM T;  5GAN h;  3L2W A;  2L3S A;  2G3R A;  3VS6 A;  4EMK C;  2FPE A;  4BE1 A;  2K2M A;  1SF9 A;  2HKN A;  3VS0 A;  1W4S A;  2LTO A;  3REA B;  3VUZ A;  1KQS P;  1UE9 A;  2DZ9 A;  3M0T A;  1JXM A;  2BZ8 A;  2QDL A;  2COW A;  1QCF A;  3OYG A;  1UDL A;  4QKU A;  2K5I A;  1Q82 C;  4PKC C;  2GBQ A;  4M7A G;  2KNB B;  1JJ2 S;  4NOY A;  4C92 F;  4EMK B;  5GMK l;  4RTT A;  5GAN 7;  1UB4 A;  4ANJ A;  4YTL A;  2EVR A;  4C92 A;  1KC8 U;  2HNI A;  1WNL A;  1WYX A;  2DTO A;  2AZS A;  3OS5 A;  3VRY A;  4KUD K;  4C8Q D;  3VS5 A;  1XOV A;  3EG2 A;  4ZTJ A;  3JCM h;  1YI2 Q;  3V8K A;  3I55 Q;  3FC3 A;  4JS5 A;  1YI2 A;  2CKK A;  3FRN A;  2BIV A;  1G8X A;  1EFN A;  1LVK A;  3I55 A;  4JRI A;  1KQS A;  3M53 A;  3LH0 A;  1Q86 C;  1G3T A;  1MGQ A;  1QWE A;  2VXE A;  1NEG A;  4C5G A;  4TVR A;  2XDB A;  1TG0 A;  5D6X A;  1YJW T;  3NHN A;  1GFD A;  5GAO l;  4RCC A;  5CK9 A;  2BE7 D;  4LDV A;  3OMC A;  1IHW A;  1RAB B;  2H8H A;  3ULR B;  3CD6 Q;  3C94 A;  1TTH B;  3LX7 A;  2L3R A;  3CD6 A;  2MK5 A;  2NUZ A;  2Y90 A;  3OQ5 A;  1QVF S;  1UFF A;  5CAI A;  2GTJ A;  3OY9 A;  3EGD B;  4O6J A;  1V1C A;  1T0H A;  2LNV A;  4QQG A;  4DBR A;  1VQM Q;  3OBW A;  4XU3 A;  1VYT A;  2DNU A;  1VQM A;  1Y57 A;  1FYN A;  5LJ3 d;  4C8Q C;  4C8Q E;  4XAX B;  2HQH A;  2JTE A;  2K9G A;  2JTM A;  5GAN 3;  5FRO A;  2COY A;  2PVD B;  2X4X A;  3RIR A;  1VYU A;  4XQ3 A;  5LJ5 e;  4GY5 A;  3S3M A;  2I0N A;  1VUB A;  4C92 C;  1PKS A;  2YXY A;  4OMQ A;  2CZ0 B;  4XTV A;  4NL3 A;  1YJN T;  4EMH A;  2AIR B;  3HPW A;  2RK1 A;  1K76 A;  3E9G A;  4M75 G;  4AFZ C;  2DER A;  3M4G A;  2AKK A;  3S6W A;  2AK5 A;  2X3X D;  2VYT A;  3UDC A;  2Y4X A;  5GMK e;  2RHY A;  4C8Q B;  2QAZ A;  5A0G A;  2A0F B;  4FIB A;  4XK8 E;  5KYW B;  1B34 A;  1XTD A;  1YN8 A;  4JJD A;  4RG8 A;  3M55 A;  3G7Z A;  4XTU A;  3VKI A;  4C92 B;  1MNE A;  1UGS B;  3VYH B;  5KYY B;  2RI2 A;  3KUF A;  1TWB A;  4M77 D;  1V29 B;  4IUU A;  1NYG A;  2M51 A;  4KUI A;  4MDW A;  2E3I A;  2JS2 A;  1YWP A;  1WXB A;  3PGG A;  1T0J A;  2O9S A;  3EG1 A;  3EG9 A;  1LCK A;  3D7S B;  1MMD A;  1YJW Q;  4BE0 A;  3A8O B;  2NUT A;  3BDL A;  1YJW A;  1BYM A;  3FIF A;  3EH1 A;  1FX7 A;  3VYG A;  1RAH B;  2LX7 A;  1OV3 A;  3GF5 A;  2QTV A;  1G83 A;  2C0O A;  2HD0 A;  4KT0 E;  3C12 A;  1AD5 A;  4LDU A;  3HRS A;  4N4G A;  1UEB A;  4J6W A;  1VQ7 Q;  3CCR T;  3GP8 A;  1VQ7 A;  2DL8 A;  3UT1 A;  4QVZ A;  1SKU B;  2KVQ G;  3HRT A;  2DPP B;  2EQK A;  3S3O A;  2XK0 A;  1X27 A;  1X6G A;  1HSQ A;  4XU1 A;  1T3S A;  2RNA A;  4QQD A;  2FZK B;  1QQJ A;  2L8D A;  3CCQ T;  4M77 E;  4EPC A;  2DJQ A;  2LCS A;  1KC8 R;  2J6K A;  2E64 A;  3J81 E;  2M0O A;  1AT1 B;  2RJD A;  3NGP A;  1HK9 A;  4RTY A;  3RNJ A;  4B9W A;  1ZSZ C;  1WXU A;  1QP2 A;  4HCC A;  1FWZ A;  3C95 A;  2WSF E;  1MND A;  2CYZ B;  1QKW A;  2B8A A;  3P8D A;  4IIO A;  4LUD A;  3G6E T;  3HKS A;  1JEG A;  4OP0 A;  1SRM A;  2DLP A;  2CP7 A;  4HKE A;  2CS7 A;  5I11 A;  2LT1 A;  4OMP A;  3L42 A;  1Q81 C;  4JUV A;  3VRZ A;  4OVA A;  5GAN 4;  4PL6 A;  2V1Q A;  2HDA A;  2KE9 A;  4MMK A;  4ZGD B;  1ZSZ B;  3H6Z A;  1JQQ A;  2DVJ A;  3RBB B;  1TH7 A;  2X3W D;  4ZTF A;  2DKG A;  3OS1 A;  1N8R U;  1ABO A;  3JAM E;  5J39 A;  1N5Z A;  1NE8 A;  3CME T;  2RF0 A;  3C0C A;  5KYX A;  4OGC A;  2DFU A;  1VIF A;  3FEO A;  2HCK A;  4DBQ A;  3OYH A;  3EG9 B;  1T3L A;  1UTI A;  2HQE A;  2QAS A;  3IQL A;  2EAY A;  3CBP A;  2FO0 A;  2NUT B;  2OTL Q;  1Z9Q A;  2OTL A;  1KD1 U;  1SG5 A;  3JB9 D;  5KE3 A;  3OYM A;  4M7A F;  1ZHI A;  2LP5 A;  1ZLM A;  3A8H B;  2MCN A;  4N0A C;  3BFM A;  2DEU A;  4JJB A;  1D0Z A;  2OI3 A;  1M8M A;  2DZC A;  2E70 A;  1Y7X A;  3R6N A;  4ELZ C;  2WAC A;  2DXB A;  1VQ4 T;  4M7A A;  3CCM T;  3CC4 Q;  1I5O B;  3CC4 A;  2K3B A;  4A54 A;  1IXD A;  3ZBD A;  4HA8 A;  3CC2 Q;  2VC8 A;  2WSE E;  3EFS A;  1VQ9 Q;  1KG1 A;  3CC2 A;  1N6A A;  1E6G A;  1VQ9 A;  2DBK A;  3TCJ A;  2C0T A;  4LDY A;  4PFZ A;  3M0R A;  2ZPH B;  3TRE A;  2EW3 A;  2XKO C;  4D6W A;  1M3A A;  2QQ9 A;  3MKD A;  4A4E A;  1X69 A;  1YJ9 Q;  1RL2 A;  4DOV A;  5D6Y A;  5I21 A;  1GCQ C;  4M77 G;  2FEI A;  2YRC A;  2YUN A;  2E41 A;  3RMQ A;  3HFO A;  8ATC B;  1YJ9 A;  4CC4 B;  4E47 A;  1K0S A;  4E2F B;  1RAE B;  1M1K U;  3VS1 A;  4PJO D;  4Y92 A;  2H3E B;  3TQ7 P;  4J9B A;  3H9N A;  1WHG A;  5KYU A;  3EAE A;  1YNZ A;  1J3T A;  2J6O A;  1H3H A;  1VQK Q;  4OMN A;  2EGE A;  4JPB W;  1RAD B;  1VQK A;  5FWC A;  1H92 A;  1CKA A;  1JB0 E;  2GFU A;  1I81 A;  1K9A A;  3MP6 A;  5HK3 A;  2BZY A;  2F69 A;  4X1V A;  4GLK A;  3MHX A;  3JB9 J;  3CME Q;  1BIA A;  1K9M U;  3CME A;  1IRE B;  5CQY A;  4LD9 K;  3A98 A;  3EH2 A;  4L59 A;  3I56 Q;  4M7A C;  2DF6 A;  2V26 A;  1BCO A;  3I56 A;  4LDW A;  1M2O A;  3P8B B;  1YCY A;  1ZUK A;  2HBW A;  5LJ5 f;  1D1B A;  1R0B G;  3VS3 A;  1QP3 A;  2VAS A;  2W10 A;  2HL5 C;  2J06 A;  2CP3 A;  4BDY A;  4M75 F;  3QWX X;  2YDL A;  1UGP B;  3ZFJ A;  2Y4Y A;  3OYF A;  1BIB A;  1I0C A;  4EMK A;  4HCZ A;  4LN2 A;  2J6F A;  3MEW A;  5LJ5 j;  4EMG A;  2CZ6 B;  1HXD A;  4M75 A;  2CUD A;  3OW2 P;  1W2B S;  3F70 A;  1Q82 U;  3PT9 A;  3OYE A;  2AKL A;  2H3J A;  5L23 A;  1ARK A;  2BKD N;  2W0Z A;  4HT9 A;  2CRE A;  2VXF A;  2P0P A;  4M7A B;  2IVW A;  5HKC A;  1X2Q A;  1NLO C;  2JW4 A;  2LT4 A;  5GMK m;  2F2W A;  3GIB A;  3A1P A;  2GGR A;  2ROT A;  3E1S A;  2DL4 A;  2QGF B;  2X4Y A;  4BE2 A;  1I07 A;  2QQA A;  4PJJ A;  4QVD A;  4RMO A;  3I55 T;  1XQH A;  2DL5 A;  1VQ6 T;  1N8R R;  1K1Z A;  2D6F A;  4RG2 A;  2FB7 A;  3E2U A;  3X20 B;  2ECZ A;  4PJN A;  2P0K A;  2XIC A;  3QO3 A;  3CC7 T;  4FM4 B;  2RH2 A;  1Q86 U;  1RLP C;  4M78 D;  3JRZ A;  4M7D D;  2MWO A;  2FPF A;  1UUE A;  3OW2 A;  4QVC A;  2KT1 A;  1OX9 A;  2XDP A;  5KYU B;  3QWY A;  2R5M A;  5IH2 A;  4ELY C;  3JCM b;  2IG0 A;  2DIQ A;  1OEB A;  5I22 A;  5DLO A;  5GAO q;  3OYA A;  2JXB A;  3JB9 G;  2FYK A;  1OPL A;  3SWN C;  2K5L A;  2DYB A;  3CCL A;  3M5A A;  3P8H A;  4C5E A;  1M27 C;  1ZX6 A;  1QMC A;  3CBO A;  3VS2 A;  4Y91 A;  4A63 B;  2KDS A;  2DX1 A;  4M75 E;  4M75 C;  3TU4 K;  1TU0 B;  2FVU A;  1KHI A;  1R8O B;  1O9S A;  7AT1 B;  5GAM d;  2EYX A;  4C8Q F;  2MPX C;  2O2O A;  2K3Y A;  1VQO T;  1AWO A;  1E7O A;  4HVU A;  1UGR B;  3CCJ T;  4C8Q A;  2YRD A;  1S72 T;  3SWN B;  4E6R A;  3JCM J;  1UEC A;  4M78 E;  5KYW A;  1WFW A;  2DRM A;  4F17 A;  1MUZ A;  4M75 B;  2RM4 A;  4A4K A;  3M0U A;  1C6V X;  1QCO A;  1M1K R;  2G6F X;  2YUP A;  2RB6 A;  4XU2 A;  1MV3 A;  4PNO A;  5KYY A;  2DYI A;  4F7U G;  4CC2 A;  3FJP A;  2F2X A;  5D6W A;  4PJO G;  1G3Y A;  1U8R A;  3CCE T;  5IAY A;  4Z02 A;  1GBQ A;  2RQT A;  5LJ3 e;  4MZP A;  2O88 A;  2EYQ A;  2D1X A;  3EGU A;  3HHT B;  4FW2 A;  4RCB A;  1VQ6 Q;  4M78 B;  1VQ6 A;  2DMO A;  2CP2 A;  2LVM A;  3LW5 E;  2R57 A;  1M30 A;  1QWF A;  1KJW A;  2A3L A;  1WQW A;  4X9D A;  1DJ7 B;  1RI9 A;  1K9M R;  3CC7 Q;  2RJC A;  3LGL A;  5CIU A;  2RN8 A;  3Q1J A;  5DM7 R;  3CC7 A;  2SEM A;  4KH1 B;  2KQW A;  1FMV A;  5IHK A;  1RAC B;  1S1N A;  1TUG B;  1I4K 1;  1YWO A;  1SRL A;  3JCM X;  4E7J A;  1N9S A;  5HK0 A;  3VU3 C;  1VQ7 T;  3AT1 B;  1K73 C;  3HRU A;  4JRQ A;  1ZUU A;  5GAN 5;  2YUQ A;  1WGS A;  2BTT A;  2KI7 A;  2RI5 A;  2HSE B;  3QPH A;  4HCK A;  2DD5 A;  4PLI A;  4OMM A;  2F1L A;  1NM7 A;  4K11 A;  4XTW A;  1Q82 R;  1WJR A;  2ATC B;  2VUB A;  3WXM B;  1VYV A;  1X75 C;  2GQI A;  2E10 A;  1UG1 A;  4C0F A;  1I5L A;  4E7H A;  2ZPB B;  3E9F A;  4WCI A;  3QJ6 A;  4LUE A;  5FW9 A;  3PNW C;  2QGG A;  1VQO Q;  4M77 F;  2A08 A;  3X24 B;  3CCJ Q;  4E7L A;  1VQO A;  4RTW A;  1SPK A;  3CCJ A;  3UPU A;  1S72 Q;  4Q5W A;  2KXC A;  4KUL A;  5CR2 A;  1S72 A;  4IUP A;  1SHF A;  4M77 A;  4XTX A;  3VS4 A;  1R0C B;  3CEY A;  2M16 A;  3KFV A;  2PZ1 A;  3M0P A;  5A2Q E;  1K8A C;  2F5T X;  2XHC A;  1NPR A;  1M5Q 1;  4CRI A;  1ZSZ A;  3LH5 A;  1Q86 R;  2ZAE A;  1Q81 U;  1W70 A;  3MCA B;  1G2B A;  2OX7 A;  3I5S A;  2OTJ T;  2DVE A;  3CPW P;  2A37 A;  4M78 G;  3CCE Q;  4Z88 A;  2KAF A;  1YP5 A;  4M7D G;  1G3W A;  3CCE A;  4OML A;  2QA4 T;  2F2V A;  5CKH A;  1M1G A;  5EG2 A;  2D8H A;  2KRN A;  2Z0W A;  4IUV A;  4BI4 A;  3BY7 A;  5GAN d;  3C4S A;  1KK7 A;  2XG8 D;  2DBM A;  2EYW A;  4CC7 A;  2EJ9 A;  1IO6 A;  2P0Q A;  2YWW A;  1AWW A;  3EGX A;  2CZ1 B;  2CGH A;  3RES A;  3CCU Q;  3CCU A;  2MAM A;  3QZ9 B;  2FRW A;  3GNF B;  2OTL T;  1C1A A;  1OOT A;  4KBM B;  1WJS A;  4BUG A;  5GAO p;  3CXC P;  2O9V A;  2JM8 A;  1RLQ C;  1K4U S;  4E7K A;  2K6D A;  4PFO A;  4FYX B;  3QG1 A;  1PNJ A;  3UA6 A;  2E6Z A;  3CC4 T;  2HAX A;  3CPW A;  5GAN 8;  1VQ5 Q;  3EFO B;  4JZ3 A;  1VQ5 A;  3MEA A;  3URG A;  3OBY A;  3CC2 T;  2FL7 A;  1VQ9 T;  5FRN A;  1EZZ B;  3PIP A;  4M77 C;  1W1F A;  2V8K A;  1WX6 A;  2XID A;  5D7U A;  1K0X A;  5I2S A;  4N0A A;  2DXU A;  4R0K A;  1I1J A;  4J7I A;  2MMP A;  3J80 E;  1OX8 A;  2M0Y A;  2QYZ A;  2JVV A;  1OQK A;  2X35 A;  3JCM d;  2D0Q B;  3WVD B;  3RR6 A;  3QBY A;  1G3S A;  2E5K A;  2L5Q A;  1YJ9 T;  4FW1 A;  1RAF B;  4JRP A;  3OYC A;  2K79 A;  3JSC A;  1UGV A;  1B7T A;  2LZ6 B;  2ROL A;  5J3B A;  5A0L A;  1D1A A;  2X4J A;  2RQW A;  3CXC A;  3M4Y A;  4RKU E;  3NTK A;  4LNP A;  2LRQ A;  2VVK A;  2M9U A;  4M77 B;  3QDF A;  1FMK A;  3CBM A;  3QXE B;  4OMF B;  1WI7 A;  1VQK T;  2OTJ Q;  5KYN A;  5DY9 A;  2OTJ A;  1KQS S;  1HD3 A;  1GCQ A;  2C0I A;  3JB9 F;  2KK4 A;  3KXT A;  4FT4 A;  2QA4 Q;  1QKX A;  3OSV A;  1TOV A;  4JS4 A;  2CP5 A;  2RHX A;  2QA4 A;  1WIE A;  1FXX A;  3MP8 A;  5KE2 A;  1AWX A;  3UF4 A;  4FSS A;  3SDZ A;  2FPD A;  1XNI A;  3DLL A;  2QXF A;  2AZV A;  1ZA2 B;  2RHI A;  1BB9 A;  4N4H A;  3I56 T;  3H0I A;  1HYO A;  2LJ0 A;  1WJQ A;  3X28 B;  1O75 A;  4F16 A;  1JJ2 P;  1GFC A;  2CT4 A;  3G71 Q;  4PJL A;  3BDU A;  1RI0 A;  3QDR B;  1NPP A;  3NFC A;  4J6X A;  3G71 A;  2ZCF B;  3EGX B;  2MOX A;  1NBE B;  4ME7 A;  4J9G A;  1KFZ A;  4OB1 B;  3EHR A;  3QZ5 B;  4JJC A;  1M2V A;  4HT8 A;  4L5G A;  1Y0M A;  3U23 A;  1M90 U;  2DET A;  1GXI E;  1N9R A;  2NWM A;  2M02 A;  1JU5 C;  3JCM W;  2RHU A;  3VS7 A;  1UHC A;  2LQ8 A;  3LWH A;  4KRT A;  4A4H A;  1AWJ A;  4FYW B;  3PVL A;  1ZBJ A;  2JUF A;  2EQM A;  4F7U F;  4L6V 5;  4AT1 B;  2BUD A;  4PJM A;  4PJO F;  5LJ5 g;  4IUT A;  1MMA A;  1OI1 A;  4X9C A;  2KT8 A;  4F04 B;  3G4S Q;  3GBQ A;  1U5S A;  2RMO A;  3UAT A;  3G4S A;  2K2V A;  5HY6 A;  4F7U A;  1Q81 R;  1SSF A;  4PJO A;  1PD0 A;  2VB6 A;  1JJ2 A;  3MPU B;  3OB9 A;  4IUQ A;  2KRM A;  2FG0 A;  3TSW A;  4DBH A;  2JZ2 A;  4QQ6 A;  4R56 A;  4V2S A;  3CCS T;  2GTO A;  4DOW A;  5CQX A;  2DIL A;  2JM9 A;  2PNI A;  4AG1 C;  3EG3 A;  1U1T A;  2P4R A;  4J8O A;  1QVG P;  1D3B B;  2HSP A;  2XMF A;  1UJY A;  3TVT A;  3M0S A;  3X25 B;  3V7S A;  4AG2 C;  2J05 A;  3CCV Q;  3JCM P;  5CKB A;  1NEB A;  3ER0 A;  2A36 A;  3CCV A;  4BD3 A;  1NZ9 A;  4RTX A;  4M4Z A;  1PCX A;  4PFP A;  1CKB A;  2YLB A;  2HQX A;  1WHM A;  3M57 A;  2EYY A;  1VQN T;  1OPK A;  4E7Z A;  3CCL T;  3RUX A;  3OS0 A;  2ZPF B;  3MEV A;  3N5B B;  3SFM A;  3OSS C;  2E12 A;  2HKQ B;  1D0Y A;  1YBY A;  4B6M A;  1BKB A;  2J7I A;  2CH4 A;  3RMS A;  1TUC A;  1X43 A;  2L89 A;  3M9Q A;  2V8J A;  3WVE B;  1TUD A;  2KEA A;  3NMZ C;  3LLR A;  3SWN A;  1M90 C;  1EX4 A;  3VUB A;  4AFQ C;  1QVG A;  3AHU A;  2E1H A;  3CPW S;  3BE3 A;  4F7U E;  3QYG B;  1VQL Q;  4PJO C;  3JCM Q;  5IN1 A;  4PJO E;  1M2V B;  3HP9 A;  4EDU A;  1VQL A;  2DTI A;  2C06 A;  2L0A A;  2K3X A;  5IXB A;  3PMI A;  2JMA A;  4RTU A;  2V1R A;  3QSU A;  2LDM A;  2GNC A;  4ESR A;  2XDD A;  3OYY A;  4M78 F;  4XTY A;  4M7D F;  5GMK j;  2L3Q A;  2PUK B;  2RO0 A;  2MF2 A;  1X6B A;  1KQ2 A;  2YHT A;  1JXO A;  2ZPG B;  4DEX A;  2ABL A;  3SEM A;  2RPN A;  2ZZD A;  5GAN 2;  4M78 A;  3REB B;  2YRV A;  1PM3 A;  2EBP A;  3NTI A;  4M7D A;  4F7U B;  3OA6 A;  1EIF A;  4PJO B;  5KCH A;  1NYF A;  2LCC A;  3O8V A;  2KBT A;  2QQR A;  2ZGW A;  3L2U A;  2PU9 B;  4FU6 A;  1X01 A;  3QKJ A;  2ZPE B;  3H8Z A;  3X26 B;  5GAM e;  5A0D A;  1U1S A;  3PE0 A;  3CCS Q;  1RAA B;  2MYS A;  2JN0 A;  4RUG A;  4WF2 A;  3CCS A;  1JRI A;  4BAC A;  4C5I A;  3I35 A;  2O01 E;  2L2P A;  2VGM A;  4LE9 A;  2NYS A;  2RJE A;  3MET A;  2JOY A;  1MMN A;  2EPD A;  1M9S A;  3M56 A;  1AOJ A;  4JLG A;  5KH6 A;  2KGT A;  4RTV A;  1QVP A;  1BI0 A;  2PTK A;  2CDT A;  5FWB A;  2IIM A;  4NS5 A;  4JZ4 A;  3DB3 A;  1QCN A;  3NTH A;  1K73 U;  2NUP A;  1IGQ A;  1OU8 A;  2KMT A;  3VJP A;  1VQN Q;  1IGU A;  4KGZ B;  3M59 A;  3CCL Q;  1M90 R;  4MZM A;  1VQN A;  1AEY A;  3EFR A;  1MV0 B;  1ZSG A;  4JDS A;  1LOJ A;  2HZY A;  1VQP Q;  1M4Z A;  4N4I A;  4GLM A;  1VQP A;  3A5Z B;  1XJW B;  2EGA A;  4HXJ A;  5LJ5 h;  3EHQ A;  4ZNX A;  3OYD A;  3M0Q A;  2DO3 A;  1Z9Z A;  1PC0 A;  1F1B B;  8AT1 B;  2CP6 A;  3CMA T;  3T9N A;  1PRM C;  4FYY B;  5C0M A;  1Y96 A;  2SRC A;  1CSK A;  5FU7 C;  3RKX A;  4CC3 A;  4M78 C;  1IZ6 A;  3DB4 A;  5GMK h;  2ZPI B;  4M7D C;  4M7D E;  5GAO r;  4OB3 B;  2EWN A;  5GAN 6;  5IXF A;  1ZQ1 A;  1UGQ B;  1UJ0 A;  2K5F A;  2XU8 A;  1Q95 G;  1A0N B;  3GOX A;  1Q7Y U;  1K8A U;  1SHG A;  1G5V A;  3FJ5 A;  2PUO B;  1NLP C;  3MO8 A;  4FL6 A;  1YIT Q;  4A4G A;  1YIT A;  4AFU C;  2OJ2 A;  1RUW A;  2JJ9 A;  4ATO A;  2RK2 A;  3BW1 A;  5FU7 B;  3G1J A;  3PTA A;  2EGC A;  3V8J A;  3OYI A;  4M7D B;  2FZC B;  1WQ7 A;  2ESW A;  1D0X A;  2VWF A;  4J5Y A;  1PSE A;  3JB9 I;  4MDX A;  4E7S A;  2JNG A;  3CCU T;  2FHD A;  5GJV B;  3I9Q A;  1B3Q A;  3S3N A;  2QG9 B;  2R58 A;  4C92 D;  3INZ A;  3THK A;  1LPL A;  2RD1 A;  2BZX A;  1GRI A;  2V8I A;  1YHQ T;  3HFN A;  2BE9 B;  2CSQ A;  4PK4 A;  1LJO A;  2O31 A;  3EFO A;  4IUR A;  4J9D A;  1YCS B;  2AT1 B;  1VQ5 T;  1IHV A;  2NUP B;  2CT3 A;  3HTR A;  3UA7 A;  5IHI A;  3PFS A;  2LJ3 A;  2P4T A;  2JTF A;  4II1 A;  5GAN e;  5ECA A;  4QW2 A;  1OZ3 A;  1QVG S;  1P92 A;  2LMJ A;  2RQR A;  2EJF A;  5FLX E;  2RA2 A;  2QQS A;  1YIJ T;  3CMA Q;  3A8L B;  2HL3 A;  3EG0 A;  3CMA A;  3OYL A;  4J9C A;  1ZUY A;  2WSC E;  1IRX A;  2LQN A;  2LX9 A;  2JMC A;  1OYX A;  1Y96 B;  1AVZ C;  2DIG A;  2MI6 A;  1TXQ A;  4J6Y A;  2EQJ A;  2QTX A;  3V7R A;  1U06 A;  1AZE A;  4C92 E;  2DXC A;  1Q7Y C;  3VV0 A;  1KQ1 A;  2DA9 A;  4Y28 E;  4ZGJ B;  3I5R A;  4JJN K;  1MHN A;  1H64 1;  5AYF A;  4FSX A;  3M54 A;  1OUL A;  2K7A A;  2QDY B;  5CVI A;  3QII A;  1QW1 A;  5KCO A;  1KC8 C;  2KXD A;  4FT2 A;  2QEX T;  3LWI A;  4P5N A;  2RHZ A;  4AMC A;  3RKY A;  4OB2 B;  1IB8 A;  3NPF A;  5GAM g;  1Y07 A;  1K73 R;  4HCB A;  1D1C A;  1NG2 A;  1I8F A;  3L2R A;  5GJW B;  3JCM e;  4XTZ A;  3OW2 S;  3CQT A;  3G71 T;  2JT4 A;  3UWN A;  1W2B P;  4O5V A;  4A53 A;  5LJ5 d;  3MP1 A;  1PKT A;  2ED0 A;  2DD4 A;  3OMG A;  4HVW A;  1NJI U;  5CKF A;  1YHQ Q;  4KGX B;  4MML A;  2X4W A;  4Z89 A;  1KIK A;  1YHQ A;  3TEE A;  5CO7 A;  1PRL C;  1PSF A;  2VKN A;  4J9I A;  4J7F A;  3G4S T;  3PMT A;  1N27 A;  1Q7Y R;  1K8A R;  2RJF A;  5CCA A;  3PVQ A;  2KYB A;  2GFA A;  2D8J A;  2COZ A;  4C0D C;  5L8R E;  1YIJ Q;  2KRS A;  2GCX A;  4A4F A;  1W2B A;  1YIJ A;  2KY9 A;  1WZO A;  1ZBX A;  4GBQ A;  2LQK A;  3DKM A;  4J9E A;  3QJY A;  1BU1 A;  2EKO A;  5GAM f;  1H3Z A;  3GPL A;  1FMW A;  1D3B A;  1M3C A;  2YLC A;  1U3O A;  1LNX A;  2DAQ A;  2HEQ A;  4X34 A;  2M1H A;  2D9T A;  2VV5 A;  2QK0 A;  1KSW A;  4C8Q G;  1YJN Q;  4C0Z A;  1BK2 A;  3A8G B;  3RDV A;  1YJN A;  3TSZ A;  4ORZ A;  2XI9 A;  3ME9 A;  4DA4 A;  3CCV T;  5GAM j;  5LJ3 g;  1BI3 A;  4NL2 A;  4C0D B;  2LJ1 A;  2GQV A;  2KRO A;  4OMO A;  2L3P A;  4C92 G;  6AT1 B;  2QEX Q;  4JRK A;  4JLI A;  2QEX A;  2DE0 X;  3FB9 A;  1X6O A;  4HVV A;  1B34 B;  2E6N A;  2QI2 A;  1VA7 A;  1PG5 B;  1WHL A;  2AHJ B;  5LL6 S;  4ZN3 A;  4IIM A;  1VIE A;  3H0F A;  2DJZ A;  1NJI C;  3O5Z A;  2CH4 W;  5CKE A;  2I2L A;  1BBZ A;  1SEM A;  2KSS A;  1TSF A;  3ZEH A;  3LYI A;  4Z8A A;  5GAO n;  2CP0 A;  2QQB A;  1VQL T;  1PD1 A;  1WHJ A;  2HMA A;  4BDZ A;  3KBG A;  5FU6 C;  2PQW A;  2OAU A;  5J26 A;  4ZN1 A;  1ABQ A;  3PIO A;  4ZGE B;  2RI3 A;  4FCY A;  2GF7 A;  1WHH A;  2RQV A;  1AHJ B;  3QYH B;  1JO8 A;  3CCR Q;  3JCM c;  5GAN g;  1VQ8 T;  2YT6 A;  3CCR A;  1TS9 A;  1WLP B;  5I2M A;  3MEU A;  2EIF A;  3JCM V;  1M8V A;  5AT1 B;  5LJ3 f;  4WTO B;  1C0M A;  3L2Q A;  2KYM A;  1V76 A;  3HSB A;  3OS2 A;  2EQU A;  3OYN A;  5FU6 B;  1KHC A;  1QVF P;  2CSI A;  1OZ2 A;  3CCQ Q;  5FRM A;  4FYV B;  5LJ3 j;  3CCQ A;  2XD0 A;  5GAM h;  3FLG A;  3A8M B;  3M58 A;  1H8K A;  4VUB A;  4BI3 A;  1WA7 A;  5IT9 E;  4M7A D;  2DK3 A;  2A7Y A;  3L1A A;  2E3H A;  2DM1 A;  2O4X A;  2HBP A;  2EYZ A;  4BI8 B;  2MIO A;  3H41 A;  2FZG B;  4BB7 A;  1R77 A;  4OGE A;  3OYB A;  1GCP A;  4DQ2 A;  3G6E Q;  1M1F A;  5EC7 A;  2CZ7 B;  1Y71 A;  3G6E A;  4R55 A;  1NJI R;  2D0N A;  9ATC B;  4CI0 C;  3OYK A;  2X51 A;  3QUI A;  4J9H A;  1GBR A;  1HJD A;  2EJG A;  1UHF A;  4PLL A;  4J83 A;  2PVG B;  3JCM g;  2DL7 A;  1N8R C;  3JV3 A;  1VOM A;  1VQP T;  2IPO B;  2DEQ A;  2E4H A;  3SD4 A;  1QVF A;  1WDX A;  4DEY A;  1D09 B;  2LCL A;  2P84 A;  3DLM A;  5GAN f;  2ENM A;  2R5A A;  1E6H A;  1X2K A;  5CKD A;  1QLY A;  2K4Y A;  1AZG B;  1BI1 A;  4OB0 B;  5KYX B;  5C6S A;  4M7A E;  3RER A;  5DLQ E;  5GAN j;  2KR3 A;  2LQW A;  2EQI A;  2F5K A;  2LNH B;  2E5Q A;  1ZA1 B;  4KGV B;  1KD1 C;  3L2Z A;  1WHK A;  4D8K A;  3FDR A;  4BY6 C;  4KH0 B;  5HCK A;  5M9O A;  4AFS C;  3L2V A; 
#chains in the Genus database with same CATH homology
 2FO0 A;  4EIK A;  2DBM A;  2EYW A;  2OJ2 A;  1RUW A;  4AFU C;  4CC7 A;  1IO6 A;  1Z9Q A;  2RQU A;  1AWW A;  2EGC A;  1PHT A;  2LP5 A;  1ZLM A;  2ESW A;  2VWF A;  3SHW A;  2MCN A;  2FRW A;  4JJB A;  2OI3 A;  1OOT A;  2OAW A;  1M8M A;  3R6N A;  2O9V A;  5GJV B;  2JM8 A;  3I9Q A;  1B3Q A;  1B07 A;  1RLQ C;  1K4U S;  2K3B A;  2K6D A;  1GL5 A;  3THK A;  1PNJ A;  2BZX A;  1GRI A;  3UA6 A;  1E6G A;  2DBK A;  2YSQ A;  4RTZ A;  2C0T A;  4JZ3 A;  2CSQ A;  1W6X A;  3M0R A;  2O31 A;  2EW3 A;  4J9D A;  1YCS B;  4QT7 A;  2A28 A;  2DRK A;  1W1F A;  1M3A A;  1WX6 A;  1K0X A;  4J9F A;  2EKH A;  4R0K A;  1X69 A;  1I1J A;  2CT3 A;  3UA7 A;  2M0Y A;  1GCQ C;  2FEI A;  2YUN A;  5IHI A;  2CUB A;  2LJ3 A;  1WXT A;  2B86 A;  4CC4 B;  1K0S A;  2E5K A;  3VS1 A;  4Y92 A;  5ECA A;  1PWT A;  2K79 A;  2LMJ A;  2DL3 A;  2RQR A;  4J9B A;  1UGV A;  2LZ6 B;  2ED1 A;  1M3B A;  1SSH A;  1YNZ A;  2ROL A;  3H0H A;  1J3T A;  2J6O A;  3ZL7 C;  2YUO A;  2FRY A;  2RQW A;  3EG0 A;  5IHN A;  4D8D A;  4F14 A;  2JS0 A;  1H3H A;  4LNP A;  4J9C A;  1ZUY A;  2L3S A;  4OMN A;  2VVK A;  2EGE A;  4JPB W;  2LQN A;  2JMC A;  5FWC A;  1H92 A;  3VS6 A;  1AVZ C;  2FPE A;  1CKA A;  1FMK A;  1K9A A;  2BZY A;  1U06 A;  1WI7 A;  1AZE A;  2K2M A;  4X1V A;  2DA9 A;  3I5R A;  3VS0 A;  1HD3 A;  1GCQ A;  2C0I A;  3REA B;  1UE9 A;  3A98 A;  1QKX A;  3M0T A;  1JXM A;  2BZ8 A;  2QDL A;  1WIE A;  2K7A A;  2DF6 A;  1AWX A;  3UF4 A;  4FSS A;  2FPD A;  1QCF A;  1ZUK A;  2HBW A;  1UDL A;  2AZV A;  2KXD A;  3VS3 A;  1BB9 A;  2W10 A;  2GBQ A;  2KNB B;  3H0I A;  2LJ0 A;  2J06 A;  4F16 A;  1GFC A;  2CT4 A;  3NPF A;  3QWX X;  2YDL A;  1I0C A;  1NG2 A;  4RTT A;  4LN2 A;  2J6F A;  2MOX A;  2EVR A;  5GJW B;  4J9G A;  2CUD A;  1KFZ A;  3EHR A;  3CQT A;  2JT4 A;  4JJC A;  1WYX A;  2AKL A;  5L23 A;  2AZS A;  1ARK A;  3VRY A;  2W0Z A;  1Y0M A;  3VS5 A;  2CRE A;  1XOV A;  1PKT A;  2ED0 A;  3EG2 A;  3U23 A;  4HVW A;  1X2Q A;  2NWM A;  1NLO C;  1JU5 C;  2JW4 A;  3VS7 A;  1UHC A;  1EFN A;  4KRT A;  2F2W A;  2GGR A;  2ROT A;  1AWJ A;  2DL4 A;  3PVL A;  1ZBJ A;  1I07 A;  4Z89 A;  1KIK A;  1QWE A;  1NEG A;  2KT8 A;  1PRL C;  3GBQ A;  1TG0 A;  2DL5 A;  1U5S A;  2RMO A;  3NHN A;  3UAT A;  1GFD A;  1K1Z A;  2H8H A;  3ULR B;  2VKN A;  4J9I A;  2ECZ A;  2NUZ A;  1RLP C;  2KRM A;  3PVQ A;  1UFF A;  2KYB A;  2FG0 A;  2D8J A;  3TSW A;  2GTJ A;  1V1C A;  2FPF A;  1T0H A;  1UUE A;  2KRS A;  2GTO A;  2KT1 A;  2DIL A;  1VYT A;  2JM9 A;  2PNI A;  4GBQ A;  4AG1 C;  3EG3 A;  3QWY A;  2DNU A;  2P4R A;  4J9E A;  1Y57 A;  5IH2 A;  2HSP A;  1FYN A;  2XMF A;  1UJY A;  3TVT A;  1BU1 A;  3M0S A;  5I22 A;  1OEB A;  4AG2 C;  1M3C A;  1U3O A;  2J05 A;  2HEQ A;  2JXB A;  1NEB A;  2JTE A;  2K9G A;  2A36 A;  1OPL A;  1KSW A;  1VYU A;  2DYB A;  1BK2 A;  4RTX A;  4M4Z A;  3TSZ A;  1M27 C;  1ZX6 A;  4ORZ A;  3VS2 A;  1CKB A;  2I0N A;  4A63 B;  2DX1 A;  1PKS A;  4OMQ A;  2EYY A;  1OPK A;  2LJ1 A;  2KRO A;  4OMO A;  1K76 A;  2L3P A;  4AFZ C;  2AKK A;  2EYX A;  2AK5 A;  2X3X D;  2O2O A;  2DE0 X;  2J7I A;  4HVV A;  1AWO A;  1E7O A;  4HVU A;  2CH4 A;  1TUC A;  1VA7 A;  1X43 A;  4E6R A;  4IIM A;  1UEC A;  1YN8 A;  1TUD A;  4JJD A;  2KEA A;  3H0F A;  3NMZ C;  1WFW A;  2DRM A;  4F17 A;  4AFQ C;  1MUZ A;  3O5Z A;  2CH4 W;  3M0U A;  2G6F X;  1BBZ A;  2YUP A;  1SEM A;  2L0A A;  1MV3 A;  1NYG A;  2M51 A;  4CC2 A;  2F2X A;  4Z8A A;  5IXB A;  2JS2 A;  1YWP A;  2JMA A;  1WXB A;  4RTU A;  1T0J A;  2O9S A;  1GBQ A;  2V1R A;  3EG1 A;  2RQT A;  2GNC A;  4ESR A;  1LCK A;  2O88 A;  1ABQ A;  2D1X A;  3EGU A;  2L3Q A;  1X6B A;  1JXO A;  2RQV A;  2DMO A;  4DEX A;  2LX7 A;  2ABL A;  3SEM A;  1JO8 A;  2RPN A;  1OV3 A;  1M30 A;  1QWF A;  1KJW A;  3REB B;  1G83 A;  2C0O A;  2EBP A;  2YT6 A;  1RI9 A;  1WLP B;  1NYF A;  1AD5 A;  2KBT A;  2RN8 A;  2SEM A;  2KYM A;  5IHK A;  1S1N A;  1YWO A;  1SRL A;  2DL8 A;  3PE0 A;  4RUG A;  2CSI A;  1X27 A;  3I35 A;  1X6G A;  1HSQ A;  2L2P A;  4LE9 A;  1ZUU A;  2YUQ A;  1T3S A;  2BTT A;  2RNA A;  1H8K A;  2EPD A;  1WA7 A;  1AOJ A;  2DM1 A;  4HCK A;  2DJQ A;  2KGT A;  2EYZ A;  2LCS A;  4OMM A;  4RTV A;  2MIO A;  3H41 A;  1NM7 A;  2PTK A;  4K11 A;  2CDT A;  2J6K A;  5FWB A;  2IIM A;  4JZ4 A;  3NGP A;  4RTY A;  3RNJ A;  1GCP A;  1WXU A;  5EC7 A;  1VYV A;  2GQI A;  1UG1 A;  1AEY A;  2D0N A;  1MV0 B;  1QKW A;  1ZSG A;  4LUD A;  4IIO A;  4WCI A;  4LUE A;  4J9H A;  5FW9 A;  1GBR A;  1HJD A;  4GLM A;  1UHF A;  1JEG A;  2EGA A;  4HXJ A;  1SRM A;  2A08 A;  2DLP A;  3EHQ A;  4ZNX A;  2DL7 A;  3M0Q A;  5I11 A;  3JV3 A;  4OMP A;  3VRZ A;  1Z9Z A;  4RTW A;  1SPK A;  2KXC A;  1PRM C;  1SHF A;  1WDX A;  2HDA A;  2KE9 A;  2V1Q A;  3VS4 A;  4DEY A;  2SRC A;  1CSK A;  2ENM A;  1JQQ A;  3KFV A;  2PZ1 A;  3M0P A;  1E6H A;  1X2K A;  2DVJ A;  3RBB B;  2X3W D;  4CC3 A;  3LH5 A;  1QLY A;  1ABO A;  1W70 A;  1AZG B;  1G2B A;  3I5S A;  1N5Z A;  5IXF A;  2A37 A;  2RF0 A;  1UJ0 A;  3C0C A;  4Z88 A;  2KR3 A;  2LQW A;  1YP5 A;  2EQI A;  2LNH B;  1A0N B;  4OML A;  1SHG A;  2F2V A;  2HCK A;  4D8K A;  2D8H A;  2KRN A;  3FJ5 A;  1NLP C;  5HCK A;  1T3L A;  1UTI A;  4AFS C;  3IQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...