2RPNA

A crucial role for high intrinsic specificity in the function of yeast sh3 domains
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
APWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, functional, and bioinformatic studies demonstrate the crucial role of an extended peptide binding site for the SH3 domain of yeast Abp1p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords Actin-binding protein
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rpnA00
2VVKA 1T0JA 1SRLA 2KXCA 2JW4A 4JPBW 2LQWA 2YSQA 1ZUKA 2JM9A 4QT7A 4RTUA 1UE9A 2J6KA 2DVJA 3H0IA 3EHRA 1WI7A 4KRTA 3SHWA 4J9CA 1UFFA 1GBQA 2LJ3A 4HCKA 2FPFA 1S1NA 3VRZA 2GQIA 1MUZA 4RTTA 1KIKA 4IIMA 2DBKA 1AWXA 2L3QA 2YUQA 2DX1A 4OMLA 2MOXA 2DLPA 2KGTA 1Y57A 1QCFA 1T3LA 1YP5A 1AWJA 4J9IA 2HCKA 3VS6A 1HJDA 2RN8A 1UTIA 1ZUUA 2LP5A 4CC7A 2H8HA 2DBMA 4M4ZA 2P4RA 2JTEA 2KRNA 2LMJA 2KRMA 2EQIA 2SEMA 2KEAA 2ABLA 5EC7A 1JU5C 1E6GA 2K9GA 2YDLA 1WFWA 2X3WD 2VKNA 3REAB 4K11A 2RQWA 1GRIA 2B86A 1ZSGA 2AKKA 1NYFA 3A98A 1X27A 5IXBA 4CC3A 1VA7A 3QWYA 2FRWA 3NGPA 4RUGA 3M0QA 4IIOA 2CSIA 1OOTA 1BK2A 3REBB 2RF0A 3KFVA 3I5RA 1RLPC 1M3BA 4HVWA 2IIMA 2DMOA 1OPKA 4AFUC 2ESWA 2RNAA 2LJ0A 1UG1A 2L3PA 1GFCA 1OV3A 2DL4A 1MV0B 3M0RA 5GJWB 2K6DA 3ULRB 1SHGA 2FPEA 1I0CA 1K0SA 5IH2A 1ARKA 2V1RA 4X1VA 2J6FA 2JT4A 4ESRA 2LZ6B 3JV3A 2G6FX 3FJ5A 4RTZA 1YN8A 2CSQA 2KYMA 1LCKA 1BB9A 2NUZA 4DEXA 1SRMA 2EW3A 1GL5A 4AFSC 2W0ZA 2AZSA 2O2OA 1G2BA 2JS0A 2KNBB 2DE0X 2DL8A 1UJYA 1PHTA 2A28A 1QWFA 1CKBA 2NWMA 4JJCA 1E7OA 1K9AA 1X2KA 1Z9ZA 4J9EA 1M8MA 2J7IA 3ZL7C 3PE0A 1RLQC 1PRMC 3RNJA 2EGAA 2O9SA 1AVZC 4J9BA 3TSZA 2HDAA 2DYBA 1VYUA 1PKTA 1UGVA 4AFZC 1X2QA 1U06A 2D1XA 4RTVA 1RUWA 1E6HA 5I11A 3VS3A 4J9HA 2JS2A 3M0PA 2CREA 2I0NA 2DRKA 1W70A 1EFNA 3R6NA 2FPDA 2KE9A 2OAWA 2A36A 3EG2A 3VS4A 1XOVA 2MCNA 2GNCA 2QDLA 3O5ZA 4CC4B 2J06A 2RQRA 1NEBA 2JM8A 1NM7A 2GTOA 2EBPA 2D8HA 2DJQA 2C0OA 2LNHB 1W1FA 1J3TA 1JXOA 2M51A 1M3AA 2L3SA 2FEIA 3TSWA 4HVVA 2YUNA 4OMMA 1A0NB 1RI9A 1BU1A 1MV3A 2CH4W 1OEBA 2A08A 2CDTA 1ABQA 1X6BA 4HVUA 4LN2A 2SRCA 3UF4A 2O31A 2LCSA 1HSQA 1ZX6A 2L2PA 2ED0A 5FW9A 4RTYA 1CKAA 3LH5A 3CQTA 1G83A 2XMFA 1QLYA 2W10A 2FRYA 2HSPA 1ABOA 2YT6A 3IQLA 4ZNXA 4LE9A 1OPLA 3C0CA 4JJBA 4OMPA 4EIKA 1V1CA 4WCIA 5IHIA 1WDXA 1H92A 3EG1A 1UHCA 2EYZA 3THKA 1CSKA 2CT4A 4F16A 1JXMA 1AD5A 2J05A 4AG1C 1FMKA 4R0KA 1VYTA 2CH4A 3VS7A 1JQQA 2EYYA 2EYWA 1UJ0A 3SEMA 2J6OA 2DNUA 1GFDA 1I1JA 1TG0A 2K3BA 1NEGA 4LUEA 3UA7A 5L23A 3NHNA 1SSHA 2D8JA 2LX7A 2O9VA 4F17A 1WX6A 1U3OA 2ROLA 1NLPC 3RBBB 2K79A 2C0TA 5I22A 3VS1A 2E5KA 4CC2A 4AFQC 2BZXA 3UATA 2YUOA 3TVTA 1X6GA 3H0FA 2KR3A 5IHNA 2K2MA 2M0YA 1UUEA 5HCKA 1VYVA 2KT8A 1GBRA 3M0UA 2DM1A 2O88A 1WYXA 2ECZA 2GGRA 1QKWA 1H3HA 3EGUA 2EYXA 2KBTA 2L0AA 1YNZA 1WXBA 2F2WA 3M0SA 3I9QA 4Y92A 4F14A 1TUDA 2ENMA 1B07A 2KROA 2JXBA 2KYBA 2MIOA 4JZ4A 3UA6A 2DL5A 1YWOA 2KRSA 1TUCA 1WXUA 4HXJA 1NLOC 2AKLA 3GBQA 1JEGA 4AG2C 2PTKA 1X43A 2DA9A 4E6RA 2A37A 1BBZA 5IHKA 2K7AA 2LQNA 3H41A 4FSSA 2RQUA 2PNIA 4JZ3A 5FWBA 1QWEA 4RTWA 1M30A 1WXTA 4GLMA 2YUPA 1T0HA 2AK5A 4RTXA 2ROTA 4OMNA 4J9DA 4D8DA 1WIEA 4JJDA 5FWCA 3VS2A 2EKHA 2ED1A 1KSWA 3M0TA 2KXDA 2V1QA 1JO8A 2KT1A 1K4US 1QKXA 2VWFA 3NMZC 1KJWA 4Z88A 3PVQA 3EG3A 2F2XA 2CUDA 1ZUYA 3I5SA 2EPDA 4LNPA 2DILA 2RMOA 1Y0MA 1AZEA 1GCQC 1NG2A 1SPKA 1GCQA 1AOJA 3H0HA 1PKSA 1H8KA 1PNJA 4D8KA 5GJVB 1YCSB 2BTTA 1K0XA 2DL3A 1UDLA 2DRMA 1HD3A 4OMQA 1AWOA 1SEMA 2HBWA 1PRLC 1ZLMA 1KFZA 2FG0A 1YWPA 4GBQA 1K76A 3NPFA 1AEYA 2C0IA 3U23A 2RQVA 2OJ2A 3VS0A 1WLPB 1AWWA 2OI3A 2GTJA 2DF6A 2RPNA 4DEYA 1GCPA 1NYGA 2JMAA 1UHFA 3VS5A 4A63B 2PZ1A 1N5ZA 1SHFA 5ECAA 3VRYA 1B3QA 1AZGB 4ORZA 1UECA 2AZVA 1T3SA 1U5SA 1X69A 1PWTA 4J9GA 1W6XA 3EG0A 3I35A 2CT3A 1K1ZA 2EVRA 1M3CA 4LUDA 4J9FA 1Z9QA 4Z8AA 2BZ8A 2CUBA 1IO6A 2F2VA 2RQTA 2HEQA 1FYNA 2BZYA 2DL7A 2LJ1A 1WA7A 4Z89A 2FO0A 2EGCA 2X3XD 2EGEA 3PVLA 3QWXX 2GBQA 5IXFA 1I07A 1M27C 2D0NA 3EHQA 1ZBJA 4OMOA 2JMCA
chains in the Genus database with same CATH superfamily
2XU8A 4BY6B 3JCMP 1WHLA 5CQXA 1MMAA 3VYHB 3OYJA 4WF2A 1OZ3A 4JPBW 1AHJB 4M7DD 1H641 4N0AA 2E10A 4RTUA 4M75G 2J6KA 1BIBA 1MNDA 2LT4A 1QVFA 4KRTA 4OB0B 2E41A 3SHWA 1WNLA 4ELYC 4II1A 1PSEA 4JJNK 3VRZA 2DEUA 4C8QD 2JZ2A 4BE1A 4A4FA 1Q81R 3OY9A 2OTJQ 3SWNA 3KBGA 4V2SA 2DX1A 4IUQA 2MOXA 1YP5A 2ATCB 3L2QA 1WQWA 2F69A 2COYA 5LJ3f 1XNIA 4OGEA 2M0OA 2DBMA 2LCCA 2KK4A 4M4ZA 1WHGA 1TOVA 3I56T 3HFNA 1ZSZB 2ABLA 5EC7A 2K57A 3CBMA 3BY7A 3E9FA 1E6GA 3VV0A 2K9GA 4ZGEB 5C6SA 2X3WD 3REAB 2RI5A 1D09B 2RQWA 3TEEA 3OYHA 3QO3A 4PJJA 1K9MC 1VQ9Q 3WVEB 1ZSGA 2AKKA 2K5IA 2DIGA 3M56A 2E6ZA 5A0LA 2PVDB 1M9SA 1VA7A 3OW2A 2HL5C 4F7UF 3G6ET 3BDUA 2L8DA 4QQ6A 1V76A 1YJNA 2CP3A 1OPKA 4AFUC 1NPPA 1GFCA 2Y4XA 3M0RA 1RADB 2EAYA 4FT2A 3VU3C 2QA4T 5DM7R 2DIQA 4C8QC 3UDCA 3A1PA 1PSFA 4PJOE 3HRUA 4ESRA 3JV3A 3FJ5A 1QCOA 2G3RA 4C8QE 4DEXA 1SRMA 2JUFA 1Y96B 2CS7A 3FC3A 1IGQA 5A0GA 3CCET 3CCUQ 2O2OA 2LC4A 2DE0X 2DL8A 4M7DG 3X24B 1QWFA 3QG1A 3UT1A 2K5LA 4EDUA 1M8MA 2J7IA 1Q7YR 1YJ9T 1PRMC 1JJ2P 4M77E 4LDVA 3A8LB 1GXIE 3G6EA 4BE0A 1VYUA 3JB9F 1UGVA 2D1XA 1RUWA 2E3IA 2RI2A 4ZN1A 2I0NA 2DRKA 4MMKA 3R6NA 1XQHA 2FPDA 5GANg 3C95A 2OAWA 3EG2A 3VS4A 2HQEA 1XOVA 2MYSA 1R8OB 1M1GA 1NEBA 5KE3A 4PJOD 1ZA2B 2FL7A 5HY6A 1M2OA 1W1FA 1YITA 1J3TA 4HKEA 1M3AA 1VQNT 1WHKA 3RMQA 1VQKQ 1YJ9Q 1MV3A 4IURA 1KD1C 1NJIC 1YBYA 3J7AF 2A08A 1PD0A 3M59A 4LN2A 3RKYA 5GANf 2SRCA 1Q7YC 2L2PA 2COZA 2O01E 3CBPA 2L89A 3JCMe 2BKDN 4M7AE 2E3HA 3OS5A 1CKAA 2X51A 9ATCB 3QKJA 1WGSA 4BI4A 2JTFA 4M77B 3HPWA 3JAME 2XKOC 3NTKA 2YT6A 4OF1A 1VQ4Q 3PMTA 4LE9A 1OPLA 2C06A 2LCLA 3CPFA 3G71T 3P8HA 4M75C 5IHIA 2A3LA 1WDXA 1G8XA 1UHCA 2FVUA 1CSKA 1QP3A 4A4GA 1JXMA 2J05A 1C0MA 4B6MA 5J39A 3CPWS 1I1JA 3L42A 2E1HA 3NHNA 4L5GA 1SSHA 3H8ZA 2MK5A 4FYVB 2O9VA 3OYAA 1KD1U 2KSSA 2DTIA 2K79A 4C92B 2C0TA 1WHMA 4CC2A 1TSFA 4JRKA 1KC8R 2WSCE 2LVMA 3X20B 2YLCA 1K8AR 1G3WA 5IHNA 5KYYB 1YIJT 4ZGJB 5HCKA 3QJYA 1VQ4T 3CEYA 2KT8A 1GBRA 2DM1A 2O88A 1BYMA 4ZTFA 1H3HA 1WXBA 2F2WA 2V8IA 4LXCA 1N27A 3LLRA 4F14A 2ENMA 4FIBA 1JB0E 3GP8A 6AT1B 2LNVA 4JZ4A 1NBEB 1ZSZA 1W2BS 3SWNC 1VQLQ 3CCQQ 3HL8A 3JB9H 5AYFA 1QVFP 3EFSA 4Q5WA 3OYGA 3DKMA 1X43A 5LJ5g 2DA9A 3GNFB 1HYOA 3R6OA 1D1CA 3RDVA 3QXEB 4C8QG 2K2VA 2K7AA 2RQUA 2L5QA 1QVGP 3GNGA 5FWBA 1M8VA 2VXFA 3BW1A 4RTXA 5CKHA 2AK5A 3MO8A 1LJOA 4OMNA 3PIOA 1ZBXA 4J9DA 3CCLQ 1VQPQ 1YJWA 3VS2A 1VQ8Q 1KSWA 5CQYA 3JCMV 2KT1A 2DPPB 1QKXA 2VWFA 3RESA 5J26A 2VGMA 2MWPA 5GAOn 3LWIA 4M7DA 3OB9A 1KJWA 3E9GA 4Z88A 1VQKA 5GAMg 1QCNA 2RMOA 1AZEA 4DBFA 2AT1B 1B34B 5GAN8 1NZ9A 5D7UA 3OW2P 2JJ9A 5GJVB 2YXYA 5KYWA 4C0DC 1KQSP 2WSEE 2QA4Q 2DL3A 3QDFA 2DRMA 1KC8C 1HD3A 1SEMA 2HBWA 1KFZA 4QVCA 2QDYB 2C0IA 5KYXB 2OJ2A 2X4JA 1AWWA 3M4GA 4EMGA 3OYBA 4DEYA 1GCPA 3EAEA 1VQOA 4M7AD 1I4K1 4XTXA 3OS2A 3EG9B 1OX9A 1M1KR 1VQ7A 3RKWA 3JCMd 1K1ZA 2CP5A 5GAOr 4M7AF 3VJPA 3G4SQ 2BZ8A 2HEQA 2BZYA 4ZN3A 2H3EB 2EJGA 3PIPA 3FDRA 3LGFA 2CGHA 5GAN7 3TREA 5IXFA 3EHQA 2QA4A 2DERA 4OB1B 2HZYA 2RD1A 2VVKA 4B9XA 1SRLA 4MZTA 2Z0WA 2KDSA 2LQWA 1ZUKA 2IG0A 1VQ9T 2DVJA 4L6V5 3JCMX 3EHRA 3GLXA 1QMCA 4NL3A 2YLBA 2LJ3A 2R5AA 4M78B 3I55T 4IIMA 2E70A 1VQ6T 3EGXA 2DBKA 3HSBA 4PJOF 1Y57A 2RJFA 1NJIU 2DKGA 1T3LA 3CPWP 3V8KA 2HCKA 3KUFA 4A54A 4F7UB 2CYZB 4JUVA 2H8HA 4LD6A 2Y4YA 4KUDK 2SEMA 2DEQA 2NLUA 5CAIA 3MEAA 1OULA 3EH1A 2PVGB 5GAOm 1GRIA 4PJMA 5AT1B 1ZQ1A 3SFMA 2B86A 3EFOB 3A98A 5IXBA 4IIOA 2CSIA 4M77F 3QUIA 4E7KA 4E7HA 1JRIA 2ZPBB 3KFVA 1M3BA 2IIMA 2DMOA 4AMCA 3JB9J 1MHNA 2ESWA 3ZEHA 3CCMQ 1YIJA 3VKIA 1UG1A 2DL4A 1MV0B 4C0GA 1XJWB 1UB4A 1Q86R 2BE7D 1QP2A 2FPEA 2PUKB 1K0SA 3QIIA 2NUPA 2V1RA 1S72A 4FU6A 2EFIA 2JT4A 1VQNQ 5GAOq 4C5EA 2O4XA 2CSQA 1LCKA 2E12A 1BB9A 2F1LA 2ZCFB 4UC4A 4BACA 3DLLA 4E7ZA 4BI8B 1ZHIA 3RERA 2AZSA 4XTZA 2HD0A 3C94A 3CCMA 2XDPA 4KBMB 1Q81C 1PHTA 5HKCA 3CC4Q 4JJCA 2NYSA 1YJNQ 1E7OA 1VQ6A 1X2KA 1G3TA 4J9EA 4M77A 1W4SA 3CCRA 3DLMA 1FX7A 1RLQC 4ANJA 1PM3A 3ZFJA 4PJOC 2O9SA 1IXDA 1BI0A 1RI0A 2HKQB 5KYNA 1VQ4A 2EJ9A 1B34A 1X2QA 4RTVA 4JS4A 1E6HA 2ZPFB 5LJ5j 2M9UA 1YI2A 1FXXA 4X9DA 1W70A 1FMVA 2K3XA 2A36A 3I55Q 4PJNA 5CR2A 4M75E 2GNCA 3JB9I 3O5ZA 4J7IA 2J06A 2RQRA 4PJLA 2D0QB 2DJQA 4M78G 2M51A 2PQWA 3BE3A 2X4YA 2L3SA 3TSWA 4HVVA 3JCMc 2OTJA 3OBWA 2GFAA 3TQ7P 2P4TA 4J83A 1ABQA 4RG8A 2BUDA 4M75A 3UF4A 2O31A 1HSQA 1X75C 2LQ8A 2X35A 4M7DF 4KH1B 4DOVA 4RTYA 4BD3A 3LH5A 3CQTA 2MWOA 5KE2A 3CXCP 5GANd 2W10A 5EG2A 1TUGB 4E7LA 2M1HA 4M78F 5CCAA 3UPUA 3SDZA 4M7AA 4ZNXA 3C0CA 4JJBA 3PT9A 1WQ7A 3A8HB 4LDWA 3CD6Q 3A8OB 3MPUB 3PMIA 1XTDA 2CT4A 3UWNA 2QAZA 1TU0B 4A53A 2MAMA 2LT1A 4AG1C 4IUTA 2EYYA 2E4HA 1UJ0A 3E1SA 3I56Q 1VQKT 2J6OA 1GFDA 2K3BA 4LUEA 5GAOl 4BI3A 1KQSS 3MKDA 4O5VA 1VOMA 4F17A 1M1KC 2ROLA 1VQOQ 2MI6A 4M77C 3RUXA 5I22A 4NL2A 3OYFA 2E5KA 2HSEB 3PFSA 5L8RE 2BZXA 1N6AA 2YUOA 3JSCA 1X6GA 4KGVB 2KR3A 5GAN6 3QBYA 2M0YA 5CO7A 1IRXA 1VYVA 4E7SA 1W2BA 3MEUA 1QKWA 2B8AA 3EGUA 1TXQA 2EYXA 3MP1A 3AT1B 1YNZA 5LL6S 2RH2A 2E5QA 3I9QA 4Y92A 1B07A 3LWHA 3CMEQ 4EMKB 1FMWA 1NLOC 3LH0A 3MCAB 2BIVA 3OW2S 4JRQA 3X25B 5FU6B 2X9HA 1M90C 5CKFA 3J81E 2A37A 1N8RC 5IHKA 1KC8U 4M78D 4OP0A 5FU7C 4DBQA 3RKXA 2EQKA 1M30A 1YI2T 4PLLA 2DO3A 5GAN4 3GIBA 3QYHB 4D8DA 5GAN5 1RAIB 1Q81U 4KH0B 2KXDA 1LNXA 2RHYA 2V1QA 4DBHA 3L2RA 1K9MR 1X01A 2LRQA 3OYMA 2QGGA 4QVZA 3NMZC 3PVQA 4R56A 1YHQA 4PFPA 5J3BA 2F2XA 1UGRB 2CUDA 3OS1A 1I81A 3CCUA 3S6WA 1RAFB 2R57A 2QQAA 3JCMf 1Y71A 4PJOG 4KGXB 1GCQC 2RHXA 4PFOA 1GCQA 4XU1A 3CC2Q 3CD6T 4PNOA 4C5IA 2M02A 1MNEA 2MMPA 3SD4A 1YHQT 1WPYA 2MF2A 4FYYB 1BI3A 1D0ZA 3JCMh 1AWOA 1ZLMA 4E2FB 2FG0A 1YWPA 4M7AB 3OQ5A 3NPFA 2VYTA 1AEYA 3OYYA 4GLKA 1WLPB 2DF6A 3G6EQ 3JCMJ 1VQMT 3G4SA 2JMAA 5LJ3j 2CP7A 3VS5A 4M78C 1Y96A 2GFUA 2VASA 1N5ZA 1SHFA 3VRYA 4ELZC 4M7DB 1SSFA 1U5SA 1X69A 1PWTA 4J9GA 4MMLA 4XU3A 2F5TX 3A5ZB 3V7RA 3CC4A 3HKSA 1I5LA 1YITT 1VQ9A 4VUBA 1IO6A 2F2VA 1FYNA 2DL7A 1RAEB 5A0DA 4C92D 1WA7A 4Z89A 2FO0A 3CCST 3JB9D 3SB2A 4XTYA 3CCJT 1I07A 4J5YA 1MGQA 2KQWA 1WJSA 4ORZA 2JMCA 5IAYA 2EQJA 2KXCA 2VUBA 2YSQA 1D3BB 2JM9A 3H0IA 3CC7A 1WI7A 1UFFA 1GBQA 4HA8A 3HRSA 2V26A 3E19A 2HBPA 1S1NA 2GQIA 3QDRB 1MMGA 1U8RA 2D9TA 3CBOA 2L3QA 4E7IA 3QHSA 2YUQA 4OMLA 5CKDA 2HNIA 2KGTA 3BFMA 3P8DA 4M77G 4A4EA 3CC7Q 2XK0A 2HQXA 2RHUA 3CCEA 1RAAB 1WHJA 2RN8A 1UTIA 2YWWA 1ZUUA 2EYQA 2LP5A 4CC7A 5KYYA 5FROA 2P4RA 2JTEA 4C0DB 1G3YA 1B7TA 4FYXB 2KEAA 3MHXA 3M58A 3CCLT 2Y90A 2P0QA 1WFWA 2XICA 5HK0A 2P0KA 4ME7A 3OMGA 8ATCB 1X27A 1TS9A 2XDBA 2RHIA 4CC3A 3QWYA 2FRWA 2QQRA 3NGPA 2DZ9A 2YHTA 2ZPIB 4ZGDB 1EIFA 1OOTA 1BK2A 3V8LA 4BUGA 1UGPB 2RF0A 3I5RA 3RMSA 3PGGA 2QEXA 2RNAA 3LX7A 2XG8D 3MP8A 3CCRT 1ZSZC 4JRPA 1YJWT 1VQ8T 1OV3A 2K4YA 5CKEA 1Q95G 4BY6C 1Q82U 1VQOT 2RO0A 1W2BP 1ARKA 3X28B 2FZCB 2LZ6B 3X26B 4M75D 4L59A 1LVKA 5LJ3d 2KYMA 4R55A 3MEVA 3VUBA 4N4GA 4N0AC 4CI0C 2EW3A 5GANe 1GL5A 3A8MB 2EQUA 4RKUE 3D7SB 1OI1A 4EMHA 4F7UA 1PCXA 1U1SA 2JS0A 3HHTB 2P84A 2KNBB 2NWMA 3CMAT 1CKBA 1BIAA 4RCCA 1Z9ZA 4M75B 5M9OA 5I2MA 2RJCA 1VQ5Q 4C5HA 4LD9K 1IHWA 4X34A 2EGAA 3FIFA 1KHIA 1AVZC 4J9BA 3TSZA 2DYBA 4MDWA 3N5BB 3MP6A 4F7UG 3VS3A 1N8RU 2OTLT 4FW1A 4J9HA 4C92A 2CREA 1UGSB 1KHCA 3CCMT 3OYKA 1EFNA 1M5Q1 2VC8A 4PJOB 2KE9A 3NTIA 5GMKm 2QDLA 3OYLA 3CCEQ 2XIDA 1NM7A 2EBPA 2D8HA 3JB9G 4KUIA 2C0OA 1KG1A 2VXEA 2GCXA 4XQ3A 3DB3A 3H9NA 4C8QF 2FEIA 4XTVA 4OMMA 2DD5A 1A0NB 4QW2A 5GAMj 1RACB 4C92E 3M5AA 3KXTA 2RI3A 2DTHA 2CDTA 4FYWB 4A4HA 2RK2A 2LCSA 4XTWA 1UGQB 3META 4OMFB 2V8KA 5FU7B 4FT4A 1Y07A 3OYIA 4N4IA 5CVIA 2QTXA 1VUBA 4KULA 5KYWB 4ATOA 1D1BA 4Z02A 1G83A 1Q82R 4WTOB 2AIRB 1O9SA 3CC7T 2FRYA 2CP6A 2GF7A 3QJ6A 1PD1A 3M53A 4EIKA 4WCIA 4EMKC 1H92A 3S3NA 3LW5E 3EG1A 2QQSA 4QKUA 3OYCA 1AD5A 1TH7A 2AHJB 4R0KA 2CH4A 2FB7A 3VS7A 2EYWA 2IVWA 3SEMA 5KCHA 3CCJQ 1M2VB 2QQ9A 2DNUA 5GAMf 3CMEA 1G5VA 1TG0A 4LDXA 1NEGA 2YRDA 2HMAA 1RAGB 3CCQT 4DA4A 2D8JA 2OAUA 3CCVA 4MZPA 1TTHB 3VS1A 1M1KU 1DJ7B 3RR6A 2K5FA 4XK8E 1D0YA 4ZTJA 4J7FA 3EH2A 4BB7A 1OQKA 3TVTA 3H0FA 2ZPEB 2K2MA 5I21A 3G4ST 3L2VA 3EGDB 5D6WA 3M0UA 4M7AC 1M2VA 4KGZB 4FL6A 2KBTA 5KYUB 1ACMB 3JCMb 2CZ0B 1VQLT 4IUVA 2JXBA 2RB6A 2KYBA 4Y28E 4JS5A 2MIOA 1YHQQ 2E64A 1NE8A 2DL5A 3UA6A 3CCJA 2QASA 1WXUA 2E6NA 4HXJA 3AHUA 2AKLA 3CCSA 2A0FB 3CCUT 3GBQA 1Q86U 4AG2C 5GAMe 2PTKA 5DLOA 3GOXA 2EWNA 4MZMA 4RCBA 1Y7XA 2VB6A 1BBZA 4NOYA 2RM4A 1UEBA 1M90U 1O75A 3H41A 4FSSA 3M55A 4JZ3A 2XI9A 4RTWA 1N9SA 1WXTA 4GLMA 2YUPA 4GY5A 1T0HA 1YFNA 4KT0E 3QSUA 1OX8A 1WIEA 4JJDA 1MMDA 4IUPA 5FWCA 5GAN2 2EKHA 2JVVA 4C0ZA 3ME9A 1K4US 3QZ5B 5LJ5h 2QI2A 5I2SA 2WSFE 5FRMA 2X4WA 1BI2A 1YJ9A 4P5NA 3E2UA 5FRNA 4FW2A 4FSXA 5DLQE 4PL6A 4PJOA 1ZUYA 4OB2B 2H3JA 4LNPA 2DZCA 2NUTB 1Y0MA 4C8QA 3HRTA 3QZ9B 1QVGA 1NG2A 1AOJA 3H0HA 4EMKA 1H8KA 2ZAEA 2LQKA 1D0XA 1Q82C 3FRNA 2FZKB 2DJZA 3P8BB 3WXMB 1UDLA 4OMQA 1FWZA 1PRLC 4D6WA 3CC4T 2HKNA 3FEOA 3U23A 5GANj 1JJ2A 3OMCA 3SWNB 2L3RA 2GTJA 2X4XA 2O4XB 2RPNA 1R0BG 4OVAA 4M77D 5D6YA 3A8GB 4O6JA 1UHFA 4A63B 2FHDA 5ECAA 1B3QA 1AZGB 1UECA 2AZVA 5GMKe 1VQ7Q 1T3SA 4XU0A 4HT9A 1W6XA 3EG0A 3I35A 2CT3A 1K8AU 1QVPA 1M3CA 2CZ6B 2DETA 1NJIR 2HL3A 2RQTA 3DB4A 3OSSC 5GANh 3S3MA 2LJ1A 2EGCA 2PU9B 3PTAA 3PVLA 3EFRA 2DD4A 2D0NA 1ZBJA 1QVFS 3G7ZA 4OMOA 4JRIA 4B9WA 2HQHA 1T0JA 2KI7A 4NS5A 2JW4A 1VIEA 1SF9A 1R77A 4JDSA 2QEXT 4QT7A 3OS0A 1UE9A 1WZOA 3J80E 1IZ6A 4J9CA 1QVGS 2DXCA 4HCKA 3FJPA 1KK7A 2FPFA 2EJFA 4EPCA 5KH6A 2DXBA 3EFOA 1HK9A 1MUZA 4HCCA 4DBRA 2MPXC 4RTTA 5DY9A 1KIKA 1X6OA 1M90R 1R0CB 4CRIA 1AWXA 4C0FA 2DLPA 3L2WA 1QCFA 1AWJA 4J9IA 3CCLA 1RL2A 3VS6A 1HJDA 1IB8A 2V8JA 1OU9A 3C4SA 3CCVT 2DK3A 4X9CA 8AT1B 2KRNA 2I2LA 3OSVA 1YI2Q 2LMJA 2KRMA 2EQMA 3CMET 2CP0A 2EQIA 1JU5C 2YDLA 1ZA1B 2R5MA 2VKNA 4K11A 4M7AG 4M78A 2RJDA 1NYFA 3G71A 2KAFA 1KQ2A 2EKOA 1QW1A 2JNGA 4A4KA 5GAMd 3V7SA 4RUGA 4J6YA 3M0QA 3EGDA 4FCYA 1VQMQ 2LDMA 3FLGA 3URGA 3REBB 3ASKA 1YJNT 2QTVA 2NUTA 1RLPC 4J6WA 3JCMQ 1IGUA 2P0PA 3HTRA 4HVWA 1D1AA 3WVDB 2XDDA 2DYIA 2LJ0A 4J8OA 3HP9A 3OYEA 2L3PA 1QQJA 2KVQG 5GAN3 5GJWB 1AT1B 2K6DA 3ULRB 3GPLA 1PG5B 1SHGA 1WJQA 1RAHB 1I0CA 4YTLA 5IH2A 4M75F 4OB3B 4FM4B 4X1VA 2OTJT 2J6FA 1VQNA 2G6FX 3ZBDA 5GMKl 2R58A 1F1BB 4RTZA 1YN8A 2ZPGB 4J6XA 1BI1A 2YRVA 1IHVA 3VYGA 2NUZA 3L2ZA 4AFSC 1M4ZA 2W0ZA 4XAXB 3INZA 2QQBA 2VV5A 3O8VA 1G2BA 3JRZA 3PNWC 4C92F 2F5KA 4C92C 1UJYA 2A28A 1OYXA 4PLIA 4N4HA 3MEWA 2RJEA 3V7CA 1K9AA 2KY9A 4DQ2A 1K73C 3OBYA 4QQGA 5KYXA 3CPWA 1EX4A 3L1AA 3ZL7C 1VQMA 2ZGWA 1OZ2A 3PE0A 4M7DE 3BDLA 3CC2T 2CZ1B 3RNJA 1IREB 1YJWQ 3G71Q 2HDAA 4MDXA 4C8QB 1PKTA 4AFZC 1U06A 2XHCA 5A2QE 2KMTA 5I11A 5LJ3g 5LJ5d 2JS2A 5HK3A 3M0PA 1G3SA 3H6ZA 4PK4A 2MCNA 4JLGA 2OTLQ 4CC4B 3JCMW 2JM8A 2GTOA 5GAMh 2ZZDA 4DOWA 2QK0A 2LNHB 1VIFA 1JXOA 5C0MA 1I8FA 2YUNA 1S72T 3TU4K 1RI9A 1BU1A 1H3ZA 2CH4W 1YITQ 1JJ2S 1OEBA 3T9NA 3Q1JA 1K8AC 2OTLA 1X6BA 4HVUA 5GAOp 3I55A 4RMOA 3QYGB 1BKBA 4LDYA 1ZX6A 1VQ8A 2ED0A 1VQPA 5FW9A 3QPHA 1I5OB 3ER0A 3M57A 2K3YA 4PKCC 2EIFA 2DXUA 4C5GA 1N8RR 2XMFA 2QGFB 4IUUA 1QLYA 3G1JA 3EGXB 2HSPA 1ABOA 1VQPT 2JOYA 5CKBA 3OA6A 3IQLA 1K9MU 3LYIA 4OMPA 5IT9E 1V1CA 2QXFA 1V29B 5KYUA 3M54A 1N9RA 2EYZA 3THKA 3OYNA 1C6VX 4F16A 1VQ5A 4QQDA 3NFCA 1FMKA 1VYTA 1JQQA 1VQLA 3C12A 1KD1R 3I56A 2LX9A 1Q86C 3UA7A 5L23A 3CMAQ 5IN1A 2LX7A 2LTOA 1WX6A 1U3OA 1NLPC 3RBBB 2DFUA 2A7YA 3JCMg 2HAXA 4AFQC 3UATA 3EG9A 1S72Q 2M16A 4E47A 1UUEA 5GMKi 4XU2A 1SG5A 1WYXA 2ECZA 2GGRA 3CC2A 2CKKA 1YIJQ 2L0AA 3LGLA 1LOJA 2PUOB 2QEXQ 3M0SA 2RA2A 4QVDA 4M78E 1K73R 3VUZA 3CCVQ 1TUDA 1KQ1A 2PVOB 4BDZA 2DTOA 2KROA 1BCMA 3OYDA 4OGCA 2QG9B 2KRSA 1YWOA 1TUCA 4BDYA 1WHHA 3CXCS 1JEGA 4HT8A 4F7UE 1M1FA 7AT1B 2OX7A 2BE9B 4E6RA 5GMKj 1JBMA 2ZPHB 1NPRA 2LQNA 1LPLA 2FZGB 1WJRA 2PNIA 1QWEA 2WACA 1VQ7T 2CP2A 1RABB 1MMNA 2ROTA 3M9QA 2JTMA 3GF5A 5GMKh 3CXCA 2ED1A 3M0TA 1JO8A 1TWBA 3CCRQ 4M7DC 4C92G 5LJ3e 3CCSQ 3V8JA 1OU8A 3CCQA 1VQ6Q 4XTUA 1HXDA 3EG3A 3MJXA 3I5SA 4PFZA 5D6XA 2EPDA 3S3OA 1PC0A 3FB9A 3HFOA 2YRCA 5CK9A 2DILA 3F70A 3L2UA 5LJ5e 2GQVA 3TCJA 1SKUB 1SPKA 4LDUA 3RIRA 1PKSA 1PNJA 4D8KA 4TVRA 2DXTA 1YCSB 1C1AA 2VGNA 2BTTA 2XD0A 1K0XA 4JLIA 2E65A 3NTHA 4Y91A 5FU6C 4E7JA 4GBQA 1K76A 2RQVA 3M4YA 2RK1A 3VS0A 2OI3A 2FYKA 2JN0A 1P92A 4AT1B 4IKFA 4RG2A 1NYGA 5FLXE 2RHZA 1EZZB 1KQSA 4HCZA 4F04B 2PZ1A 2NUPB 1YCYA 2IPOB 2DAQA 2QYZA 3CMAA 5KCOA 5CIUA 2COWA 1BCOA 2EVRA 1D3BA 5LJ3h 1K73U 4LUDA 4J9FA 1Z9QA 4Z8AA 2CUBA 1U1TA 2CZ7B 3CD6A 2X3XD 5LJ5f 2EGEA 2D6FA 1Q7YU 1VQ5T 4BE2A 3QWXX 2GBQA 1M27C 2DVEA 4HCBA
chains in the Genus database with same CATH topology
2VVKA 1T0JA 1SRLA 2KXCA 2JW4A 4JPBW 2LQWA 2YSQA 1ZUKA 2JM9A 4QT7A 4RTUA 1UE9A 2J6KA 2DVJA 3H0IA 3EHRA 1WI7A 4KRTA 3SHWA 4J9CA 1UFFA 1GBQA 2LJ3A 4HCKA 2FPFA 1S1NA 3VRZA 2GQIA 1MUZA 4RTTA 1KIKA 4IIMA 2DBKA 1AWXA 2L3QA 2YUQA 2DX1A 4OMLA 2MOXA 2DLPA 2KGTA 1Y57A 1QCFA 1T3LA 1YP5A 1AWJA 4J9IA 2HCKA 3VS6A 1HJDA 2RN8A 1UTIA 1ZUUA 2LP5A 4CC7A 2H8HA 2DBMA 4M4ZA 2P4RA 2JTEA 2KRNA 2LMJA 2KRMA 2EQIA 2SEMA 2KEAA 2ABLA 5EC7A 1JU5C 1E6GA 2K9GA 2YDLA 1WFWA 2X3WD 2VKNA 3REAB 4K11A 2RQWA 1GRIA 2B86A 1ZSGA 2AKKA 1NYFA 3A98A 1X27A 5IXBA 4CC3A 1VA7A 3QWYA 2FRWA 3NGPA 4RUGA 3M0QA 4IIOA 2CSIA 1OOTA 1BK2A 3REBB 2RF0A 3KFVA 3I5RA 1RLPC 1M3BA 4HVWA 2IIMA 2DMOA 1OPKA 4AFUC 2ESWA 2RNAA 2LJ0A 1UG1A 2L3PA 1GFCA 1OV3A 2DL4A 1MV0B 3M0RA 5GJWB 2K6DA 3ULRB 1SHGA 2FPEA 1I0CA 1K0SA 5IH2A 1ARKA 2V1RA 4X1VA 2J6FA 2JT4A 4ESRA 2LZ6B 3JV3A 2G6FX 3FJ5A 4RTZA 1YN8A 2CSQA 2KYMA 1LCKA 1BB9A 2NUZA 4DEXA 1SRMA 2EW3A 1GL5A 4AFSC 2W0ZA 2AZSA 2O2OA 1G2BA 2JS0A 2KNBB 2DE0X 2DL8A 1UJYA 1PHTA 2A28A 1QWFA 1CKBA 2NWMA 4JJCA 1E7OA 1K9AA 1X2KA 1Z9ZA 4J9EA 1M8MA 2J7IA 3ZL7C 3PE0A 1RLQC 1PRMC 3RNJA 2EGAA 2O9SA 1AVZC 4J9BA 3TSZA 2HDAA 2DYBA 1VYUA 1PKTA 1UGVA 4AFZC 1X2QA 1U06A 2D1XA 4RTVA 1RUWA 1E6HA 5I11A 3VS3A 4J9HA 2JS2A 3M0PA 2CREA 2I0NA 2DRKA 1W70A 1EFNA 3R6NA 2FPDA 2KE9A 2OAWA 2A36A 3EG2A 3VS4A 1XOVA 2MCNA 2GNCA 2QDLA 3O5ZA 4CC4B 2J06A 2RQRA 1NEBA 2JM8A 1NM7A 2GTOA 2EBPA 2D8HA 2DJQA 2C0OA 2LNHB 1W1FA 1J3TA 1JXOA 2M51A 1M3AA 2L3SA 2FEIA 3TSWA 4HVVA 2YUNA 4OMMA 1A0NB 1RI9A 1BU1A 1MV3A 2CH4W 1OEBA 2A08A 2CDTA 1ABQA 1X6BA 4HVUA 4LN2A 2SRCA 3UF4A 2O31A 2LCSA 1HSQA 1ZX6A 2L2PA 2ED0A 5FW9A 4RTYA 1CKAA 3LH5A 3CQTA 1G83A 2XMFA 1QLYA 2W10A 2FRYA 2HSPA 1ABOA 2YT6A 3IQLA 4ZNXA 4LE9A 1OPLA 3C0CA 4JJBA 4OMPA 4EIKA 1V1CA 4WCIA 5IHIA 1WDXA 1H92A 3EG1A 1UHCA 2EYZA 3THKA 1CSKA 2CT4A 4F16A 1JXMA 1AD5A 2J05A 4AG1C 1FMKA 4R0KA 1VYTA 2CH4A 3VS7A 1JQQA 2EYYA 2EYWA 1UJ0A 3SEMA 2J6OA 2DNUA 1GFDA 1I1JA 1TG0A 2K3BA 1NEGA 4LUEA 3UA7A 5L23A 3NHNA 1SSHA 2D8JA 2LX7A 2O9VA 4F17A 1WX6A 1U3OA 2ROLA 1NLPC 3RBBB 2K79A 2C0TA 5I22A 3VS1A 2E5KA 4CC2A 4AFQC 2BZXA 3UATA 2YUOA 3TVTA 1X6GA 3H0FA 2KR3A 5IHNA 2K2MA 2M0YA 1UUEA 5HCKA 1VYVA 2KT8A 1GBRA 3M0UA 2DM1A 2O88A 1WYXA 2ECZA 2GGRA 1QKWA 1H3HA 3EGUA 2EYXA 2KBTA 2L0AA 1YNZA 1WXBA 2F2WA 3M0SA 3I9QA 4Y92A 4F14A 1TUDA 2ENMA 1B07A 2KROA 2JXBA 2KYBA 2MIOA 4JZ4A 3UA6A 2DL5A 1YWOA 2KRSA 1TUCA 1WXUA 4HXJA 1NLOC 2AKLA 3GBQA 1JEGA 4AG2C 2PTKA 1X43A 2DA9A 4E6RA 2A37A 1BBZA 5IHKA 2K7AA 2LQNA 3H41A 4FSSA 2RQUA 2PNIA 4JZ3A 5FWBA 1QWEA 4RTWA 1M30A 1WXTA 4GLMA 2YUPA 1T0HA 2AK5A 4RTXA 2ROTA 4OMNA 4J9DA 4D8DA 1WIEA 4JJDA 5FWCA 3VS2A 2EKHA 2ED1A 1KSWA 3M0TA 2KXDA 2V1QA 1JO8A 2KT1A 1K4US 1QKXA 2VWFA 3NMZC 1KJWA 4Z88A 3PVQA 3EG3A 2F2XA 2CUDA 1ZUYA 3I5SA 2EPDA 4LNPA 2DILA 2RMOA 1Y0MA 1AZEA 1GCQC 1NG2A 1SPKA 1GCQA 1AOJA 3H0HA 1PKSA 1H8KA 1PNJA 4D8KA 5GJVB 1YCSB 2BTTA 1K0XA 2DL3A 1UDLA 2DRMA 1HD3A 4OMQA 1AWOA 1SEMA 2HBWA 1PRLC 1ZLMA 1KFZA 2FG0A 1YWPA 4GBQA 1K76A 3NPFA 1AEYA 2C0IA 3U23A 2RQVA 2OJ2A 3VS0A 1WLPB 1AWWA 2OI3A 2GTJA 2DF6A 2RPNA 4DEYA 1GCPA 1NYGA 2JMAA 1UHFA 3VS5A 4A63B 2PZ1A 1N5ZA 1SHFA 5ECAA 3VRYA 1B3QA 1AZGB 4ORZA 1UECA 2AZVA 1T3SA 1U5SA 1X69A 1PWTA 4J9GA 1W6XA 3EG0A 3I35A 2CT3A 1K1ZA 2EVRA 1M3CA 4LUDA 4J9FA 1Z9QA 4Z8AA 2BZ8A 2CUBA 1IO6A 2F2VA 2RQTA 2HEQA 1FYNA 2BZYA 2DL7A 2LJ1A 1WA7A 4Z89A 2FO0A 2EGCA 2X3XD 2EGEA 3PVLA 3QWXX 2GBQA 5IXFA 1I07A 1M27C 2D0NA 3EHQA 1ZBJA 4OMOA 2JMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VVK A;  1T0J A;  1SRL A;  2KXC A;  2JW4 A;  4JPB W;  2LQW A;  2YSQ A;  1ZUK A;  2JM9 A;  4QT7 A;  4RTU A;  1UE9 A;  2J6K A;  2DVJ A;  3H0I A;  3EHR A;  1WI7 A;  4KRT A;  3SHW A;  4J9C A;  1UFF A;  1GBQ A;  2LJ3 A;  4HCK A;  2FPF A;  1S1N A;  3VRZ A;  2GQI A;  1MUZ A;  4RTT A;  1KIK A;  4IIM A;  2DBK A;  1AWX A;  2L3Q A;  2YUQ A;  2DX1 A;  4OML A;  2MOX A;  2DLP A;  2KGT A;  1Y57 A;  1QCF A;  1T3L A;  1YP5 A;  1AWJ A;  4J9I A;  2HCK A;  3VS6 A;  1HJD A;  2RN8 A;  1UTI A;  1ZUU A;  2LP5 A;  4CC7 A;  2H8H A;  2DBM A;  4M4Z A;  2P4R A;  2JTE A;  2KRN A;  2LMJ A;  2KRM A;  2EQI A;  2SEM A;  2KEA A;  2ABL A;  5EC7 A;  1JU5 C;  1E6G A;  2K9G A;  2YDL A;  1WFW A;  2X3W D;  2VKN A;  3REA B;  4K11 A;  2RQW A;  1GRI A;  2B86 A;  1ZSG A;  2AKK A;  1NYF A;  3A98 A;  1X27 A;  5IXB A;  4CC3 A;  1VA7 A;  3QWY A;  2FRW A;  3NGP A;  4RUG A;  3M0Q A;  4IIO A;  2CSI A;  1OOT A;  1BK2 A;  3REB B;  2RF0 A;  3KFV A;  3I5R A;  1RLP C;  1M3B A;  4HVW A;  2IIM A;  2DMO A;  1OPK A;  4AFU C;  2ESW A;  2RNA A;  2LJ0 A;  1UG1 A;  2L3P A;  1GFC A;  1OV3 A;  2DL4 A;  1MV0 B;  3M0R A;  5GJW B;  2K6D A;  3ULR B;  1SHG A;  2FPE A;  1I0C A;  1K0S A;  5IH2 A;  1ARK A;  2V1R A;  4X1V A;  2J6F A;  2JT4 A;  4ESR A;  2LZ6 B;  3JV3 A;  2G6F X;  3FJ5 A;  4RTZ A;  1YN8 A;  2CSQ A;  2KYM A;  1LCK A;  1BB9 A;  2NUZ A;  4DEX A;  1SRM A;  2EW3 A;  1GL5 A;  4AFS C;  2W0Z A;  2AZS A;  2O2O A;  1G2B A;  2JS0 A;  2KNB B;  2DE0 X;  2DL8 A;  1UJY A;  1PHT A;  2A28 A;  1QWF A;  1CKB A;  2NWM A;  4JJC A;  1E7O A;  1K9A A;  1X2K A;  1Z9Z A;  4J9E A;  1M8M A;  2J7I A;  3ZL7 C;  3PE0 A;  1RLQ C;  1PRM C;  3RNJ A;  2EGA A;  2O9S A;  1AVZ C;  4J9B A;  3TSZ A;  2HDA A;  2DYB A;  1VYU A;  1PKT A;  1UGV A;  4AFZ C;  1X2Q A;  1U06 A;  2D1X A;  4RTV A;  1RUW A;  1E6H A;  5I11 A;  3VS3 A;  4J9H A;  2JS2 A;  3M0P A;  2CRE A;  2I0N A;  2DRK A;  1W70 A;  1EFN A;  3R6N A;  2FPD A;  2KE9 A;  2OAW A;  2A36 A;  3EG2 A;  3VS4 A;  1XOV A;  2MCN A;  2GNC A;  2QDL A;  3O5Z A;  4CC4 B;  2J06 A;  2RQR A;  1NEB A;  2JM8 A;  1NM7 A;  2GTO A;  2EBP A;  2D8H A;  2DJQ A;  2C0O A;  2LNH B;  1W1F A;  1J3T A;  1JXO A;  2M51 A;  1M3A A;  2L3S A;  2FEI A;  3TSW A;  4HVV A;  2YUN A;  4OMM A;  1A0N B;  1RI9 A;  1BU1 A;  1MV3 A;  2CH4 W;  1OEB A;  2A08 A;  2CDT A;  1ABQ A;  1X6B A;  4HVU A;  4LN2 A;  2SRC A;  3UF4 A;  2O31 A;  2LCS A;  1HSQ A;  1ZX6 A;  2L2P A;  2ED0 A;  5FW9 A;  4RTY A;  1CKA A;  3LH5 A;  3CQT A;  1G83 A;  2XMF A;  1QLY A;  2W10 A;  2FRY A;  2HSP A;  1ABO A;  2YT6 A;  3IQL A;  4ZNX A;  4LE9 A;  1OPL A;  3C0C A;  4JJB A;  4OMP A;  4EIK A;  1V1C A;  4WCI A;  5IHI A;  1WDX A;  1H92 A;  3EG1 A;  1UHC A;  2EYZ A;  3THK A;  1CSK A;  2CT4 A;  4F16 A;  1JXM A;  1AD5 A;  2J05 A;  4AG1 C;  1FMK A;  4R0K A;  1VYT A;  2CH4 A;  3VS7 A;  1JQQ A;  2EYY A;  2EYW A;  1UJ0 A;  3SEM A;  2J6O A;  2DNU A;  1GFD A;  1I1J A;  1TG0 A;  2K3B A;  1NEG A;  4LUE A;  3UA7 A;  5L23 A;  3NHN A;  1SSH A;  2D8J A;  2LX7 A;  2O9V A;  4F17 A;  1WX6 A;  1U3O A;  2ROL A;  1NLP C;  3RBB B;  2K79 A;  2C0T A;  5I22 A;  3VS1 A;  2E5K A;  4CC2 A;  4AFQ C;  2BZX A;  3UAT A;  2YUO A;  3TVT A;  1X6G A;  3H0F A;  2KR3 A;  5IHN A;  2K2M A;  2M0Y A;  1UUE A;  5HCK A;  1VYV A;  2KT8 A;  1GBR A;  3M0U A;  2DM1 A;  2O88 A;  1WYX A;  2ECZ A;  2GGR A;  1QKW A;  1H3H A;  3EGU A;  2EYX A;  2KBT A;  2L0A A;  1YNZ A;  1WXB A;  2F2W A;  3M0S A;  3I9Q A;  4Y92 A;  4F14 A;  1TUD A;  2ENM A;  1B07 A;  2KRO A;  2JXB A;  2KYB A;  2MIO A;  4JZ4 A;  3UA6 A;  2DL5 A;  1YWO A;  2KRS A;  1TUC A;  1WXU A;  4HXJ A;  1NLO C;  2AKL A;  3GBQ A;  1JEG A;  4AG2 C;  2PTK A;  1X43 A;  2DA9 A;  4E6R A;  2A37 A;  1BBZ A;  5IHK A;  2K7A A;  2LQN A;  3H41 A;  4FSS A;  2RQU A;  2PNI A;  4JZ3 A;  5FWB A;  1QWE A;  4RTW A;  1M30 A;  1WXT A;  4GLM A;  2YUP A;  1T0H A;  2AK5 A;  4RTX A;  2ROT A;  4OMN A;  4J9D A;  4D8D A;  1WIE A;  4JJD A;  5FWC A;  3VS2 A;  2EKH A;  2ED1 A;  1KSW A;  3M0T A;  2KXD A;  2V1Q A;  1JO8 A;  2KT1 A;  1K4U S;  1QKX A;  2VWF A;  3NMZ C;  1KJW A;  4Z88 A;  3PVQ A;  3EG3 A;  2F2X A;  2CUD A;  1ZUY A;  3I5S A;  2EPD A;  4LNP A;  2DIL A;  2RMO A;  1Y0M A;  1AZE A;  1GCQ C;  1NG2 A;  1SPK A;  1GCQ A;  1AOJ A;  3H0H A;  1PKS A;  1H8K A;  1PNJ A;  4D8K A;  5GJV B;  1YCS B;  2BTT A;  1K0X A;  2DL3 A;  1UDL A;  2DRM A;  1HD3 A;  4OMQ A;  1AWO A;  1SEM A;  2HBW A;  1PRL C;  1ZLM A;  1KFZ A;  2FG0 A;  1YWP A;  4GBQ A;  1K76 A;  3NPF A;  1AEY A;  2C0I A;  3U23 A;  2RQV A;  2OJ2 A;  3VS0 A;  1WLP B;  1AWW A;  2OI3 A;  2GTJ A;  2DF6 A;  2RPN A;  4DEY A;  1GCP A;  1NYG A;  2JMA A;  1UHF A;  3VS5 A;  4A63 B;  2PZ1 A;  1N5Z A;  1SHF A;  5ECA A;  3VRY A;  1B3Q A;  1AZG B;  4ORZ A;  1UEC A;  2AZV A;  1T3S A;  1U5S A;  1X69 A;  1PWT A;  4J9G A;  1W6X A;  3EG0 A;  3I35 A;  2CT3 A;  1K1Z A;  2EVR A;  1M3C A;  4LUD A;  4J9F A;  1Z9Q A;  4Z8A A;  2BZ8 A;  2CUB A;  1IO6 A;  2F2V A;  2RQT A;  2HEQ A;  1FYN A;  2BZY A;  2DL7 A;  2LJ1 A;  1WA7 A;  4Z89 A;  2FO0 A;  2EGC A;  2X3X D;  2EGE A;  3PVL A;  3QWX X;  2GBQ A;  5IXF A;  1I07 A;  1M27 C;  2D0N A;  3EHQ A;  1ZBJ A;  4OMO A;  2JMC A; 
#chains in the Genus database with same CATH topology
 2XU8 A;  4BY6 B;  3JCM P;  1WHL A;  5CQX A;  1MMA A;  3VYH B;  3OYJ A;  4WF2 A;  1OZ3 A;  4JPB W;  1AHJ B;  4M7D D;  1H64 1;  4N0A A;  2E10 A;  4RTU A;  4M75 G;  2J6K A;  1BIB A;  1MND A;  2LT4 A;  1QVF A;  4KRT A;  4OB0 B;  2E41 A;  3SHW A;  1WNL A;  4ELY C;  4II1 A;  1PSE A;  4JJN K;  3VRZ A;  2DEU A;  4C8Q D;  2JZ2 A;  4BE1 A;  4A4F A;  1Q81 R;  3OY9 A;  2OTJ Q;  3SWN A;  3KBG A;  4V2S A;  2DX1 A;  4IUQ A;  2MOX A;  1YP5 A;  2ATC B;  3L2Q A;  1WQW A;  2F69 A;  2COY A;  5LJ3 f;  1XNI A;  4OGE A;  2M0O A;  2DBM A;  2LCC A;  2KK4 A;  4M4Z A;  1WHG A;  1TOV A;  3I56 T;  3HFN A;  1ZSZ B;  2ABL A;  5EC7 A;  2K57 A;  3CBM A;  3BY7 A;  3E9F A;  1E6G A;  3VV0 A;  2K9G A;  4ZGE B;  5C6S A;  2X3W D;  3REA B;  2RI5 A;  1D09 B;  2RQW A;  3TEE A;  3OYH A;  3QO3 A;  4PJJ A;  1K9M C;  1VQ9 Q;  3WVE B;  1ZSG A;  2AKK A;  2K5I A;  2DIG A;  3M56 A;  2E6Z A;  5A0L A;  2PVD B;  1M9S A;  1VA7 A;  3OW2 A;  2HL5 C;  4F7U F;  3G6E T;  3BDU A;  2L8D A;  4QQ6 A;  1V76 A;  1YJN A;  2CP3 A;  1OPK A;  4AFU C;  1NPP A;  1GFC A;  2Y4X A;  3M0R A;  1RAD B;  2EAY A;  4FT2 A;  3VU3 C;  2QA4 T;  5DM7 R;  2DIQ A;  4C8Q C;  3UDC A;  3A1P A;  1PSF A;  4PJO E;  3HRU A;  4ESR A;  3JV3 A;  3FJ5 A;  1QCO A;  2G3R A;  4C8Q E;  4DEX A;  1SRM A;  2JUF A;  1Y96 B;  2CS7 A;  3FC3 A;  1IGQ A;  5A0G A;  3CCE T;  3CCU Q;  2O2O A;  2LC4 A;  2DE0 X;  2DL8 A;  4M7D G;  3X24 B;  1QWF A;  3QG1 A;  3UT1 A;  2K5L A;  4EDU A;  1M8M A;  2J7I A;  1Q7Y R;  1YJ9 T;  1PRM C;  1JJ2 P;  4M77 E;  4LDV A;  3A8L B;  1GXI E;  3G6E A;  4BE0 A;  1VYU A;  3JB9 F;  1UGV A;  2D1X A;  1RUW A;  2E3I A;  2RI2 A;  4ZN1 A;  2I0N A;  2DRK A;  4MMK A;  3R6N A;  1XQH A;  2FPD A;  5GAN g;  3C95 A;  2OAW A;  3EG2 A;  3VS4 A;  2HQE A;  1XOV A;  2MYS A;  1R8O B;  1M1G A;  1NEB A;  5KE3 A;  4PJO D;  1ZA2 B;  2FL7 A;  5HY6 A;  1M2O A;  1W1F A;  1YIT A;  1J3T A;  4HKE A;  1M3A A;  1VQN T;  1WHK A;  3RMQ A;  1VQK Q;  1YJ9 Q;  1MV3 A;  4IUR A;  1KD1 C;  1NJI C;  1YBY A;  3J7A F;  2A08 A;  1PD0 A;  3M59 A;  4LN2 A;  3RKY A;  5GAN f;  2SRC A;  1Q7Y C;  2L2P A;  2COZ A;  2O01 E;  3CBP A;  2L89 A;  3JCM e;  2BKD N;  4M7A E;  2E3H A;  3OS5 A;  1CKA A;  2X51 A;  9ATC B;  3QKJ A;  1WGS A;  4BI4 A;  2JTF A;  4M77 B;  3HPW A;  3JAM E;  2XKO C;  3NTK A;  2YT6 A;  4OF1 A;  1VQ4 Q;  3PMT A;  4LE9 A;  1OPL A;  2C06 A;  2LCL A;  3CPF A;  3G71 T;  3P8H A;  4M75 C;  5IHI A;  2A3L A;  1WDX A;  1G8X A;  1UHC A;  2FVU A;  1CSK A;  1QP3 A;  4A4G A;  1JXM A;  2J05 A;  1C0M A;  4B6M A;  5J39 A;  3CPW S;  1I1J A;  3L42 A;  2E1H A;  3NHN A;  4L5G A;  1SSH A;  3H8Z A;  2MK5 A;  4FYV B;  2O9V A;  3OYA A;  1KD1 U;  2KSS A;  2DTI A;  2K79 A;  4C92 B;  2C0T A;  1WHM A;  4CC2 A;  1TSF A;  4JRK A;  1KC8 R;  2WSC E;  2LVM A;  3X20 B;  2YLC A;  1K8A R;  1G3W A;  5IHN A;  5KYY B;  1YIJ T;  4ZGJ B;  5HCK A;  3QJY A;  1VQ4 T;  3CEY A;  2KT8 A;  1GBR A;  2DM1 A;  2O88 A;  1BYM A;  4ZTF A;  1H3H A;  1WXB A;  2F2W A;  2V8I A;  4LXC A;  1N27 A;  3LLR A;  4F14 A;  2ENM A;  4FIB A;  1JB0 E;  3GP8 A;  6AT1 B;  2LNV A;  4JZ4 A;  1NBE B;  1ZSZ A;  1W2B S;  3SWN C;  1VQL Q;  3CCQ Q;  3HL8 A;  3JB9 H;  5AYF A;  1QVF P;  3EFS A;  4Q5W A;  3OYG A;  3DKM A;  1X43 A;  5LJ5 g;  2DA9 A;  3GNF B;  1HYO A;  3R6O A;  1D1C A;  3RDV A;  3QXE B;  4C8Q G;  2K2V A;  2K7A A;  2RQU A;  2L5Q A;  1QVG P;  3GNG A;  5FWB A;  1M8V A;  2VXF A;  3BW1 A;  4RTX A;  5CKH A;  2AK5 A;  3MO8 A;  1LJO A;  4OMN A;  3PIO A;  1ZBX A;  4J9D A;  3CCL Q;  1VQP Q;  1YJW A;  3VS2 A;  1VQ8 Q;  1KSW A;  5CQY A;  3JCM V;  2KT1 A;  2DPP B;  1QKX A;  2VWF A;  3RES A;  5J26 A;  2VGM A;  2MWP A;  5GAO n;  3LWI A;  4M7D A;  3OB9 A;  1KJW A;  3E9G A;  4Z88 A;  1VQK A;  5GAM g;  1QCN A;  2RMO A;  1AZE A;  4DBF A;  2AT1 B;  1B34 B;  5GAN 8;  1NZ9 A;  5D7U A;  3OW2 P;  2JJ9 A;  5GJV B;  2YXY A;  5KYW A;  4C0D C;  1KQS P;  2WSE E;  2QA4 Q;  2DL3 A;  3QDF A;  2DRM A;  1KC8 C;  1HD3 A;  1SEM A;  2HBW A;  1KFZ A;  4QVC A;  2QDY B;  2C0I A;  5KYX B;  2OJ2 A;  2X4J A;  1AWW A;  3M4G A;  4EMG A;  3OYB A;  4DEY A;  1GCP A;  3EAE A;  1VQO A;  4M7A D;  1I4K 1;  4XTX A;  3OS2 A;  3EG9 B;  1OX9 A;  1M1K R;  1VQ7 A;  3RKW A;  3JCM d;  1K1Z A;  2CP5 A;  5GAO r;  4M7A F;  3VJP A;  3G4S Q;  2BZ8 A;  2HEQ A;  2BZY A;  4ZN3 A;  2H3E B;  2EJG A;  3PIP A;  3FDR A;  3LGF A;  2CGH A;  5GAN 7;  3TRE A;  5IXF A;  3EHQ A;  2QA4 A;  2DER A;  4OB1 B;  2HZY A;  2RD1 A;  2VVK A;  4B9X A;  1SRL A;  4MZT A;  2Z0W A;  2KDS A;  2LQW A;  1ZUK A;  2IG0 A;  1VQ9 T;  2DVJ A;  4L6V 5;  3JCM X;  3EHR A;  3GLX A;  1QMC A;  4NL3 A;  2YLB A;  2LJ3 A;  2R5A A;  4M78 B;  3I55 T;  4IIM A;  2E70 A;  1VQ6 T;  3EGX A;  2DBK A;  3HSB A;  4PJO F;  1Y57 A;  2RJF A;  1NJI U;  2DKG A;  1T3L A;  3CPW P;  3V8K A;  2HCK A;  3KUF A;  4A54 A;  4F7U B;  2CYZ B;  4JUV A;  2H8H A;  4LD6 A;  2Y4Y A;  4KUD K;  2SEM A;  2DEQ A;  2NLU A;  5CAI A;  3MEA A;  1OUL A;  3EH1 A;  2PVG B;  5GAO m;  1GRI A;  4PJM A;  5AT1 B;  1ZQ1 A;  3SFM A;  2B86 A;  3EFO B;  3A98 A;  5IXB A;  4IIO A;  2CSI A;  4M77 F;  3QUI A;  4E7K A;  4E7H A;  1JRI A;  2ZPB B;  3KFV A;  1M3B A;  2IIM A;  2DMO A;  4AMC A;  3JB9 J;  1MHN A;  2ESW A;  3ZEH A;  3CCM Q;  1YIJ A;  3VKI A;  1UG1 A;  2DL4 A;  1MV0 B;  4C0G A;  1XJW B;  1UB4 A;  1Q86 R;  2BE7 D;  1QP2 A;  2FPE A;  2PUK B;  1K0S A;  3QII A;  2NUP A;  2V1R A;  1S72 A;  4FU6 A;  2EFI A;  2JT4 A;  1VQN Q;  5GAO q;  4C5E A;  2O4X A;  2CSQ A;  1LCK A;  2E12 A;  1BB9 A;  2F1L A;  2ZCF B;  4UC4 A;  4BAC A;  3DLL A;  4E7Z A;  4BI8 B;  1ZHI A;  3RER A;  2AZS A;  4XTZ A;  2HD0 A;  3C94 A;  3CCM A;  2XDP A;  4KBM B;  1Q81 C;  1PHT A;  5HKC A;  3CC4 Q;  4JJC A;  2NYS A;  1YJN Q;  1E7O A;  1VQ6 A;  1X2K A;  1G3T A;  4J9E A;  4M77 A;  1W4S A;  3CCR A;  3DLM A;  1FX7 A;  1RLQ C;  4ANJ A;  1PM3 A;  3ZFJ A;  4PJO C;  2O9S A;  1IXD A;  1BI0 A;  1RI0 A;  2HKQ B;  5KYN A;  1VQ4 A;  2EJ9 A;  1B34 A;  1X2Q A;  4RTV A;  4JS4 A;  1E6H A;  2ZPF B;  5LJ5 j;  2M9U A;  1YI2 A;  1FXX A;  4X9D A;  1W70 A;  1FMV A;  2K3X A;  2A36 A;  3I55 Q;  4PJN A;  5CR2 A;  4M75 E;  2GNC A;  3JB9 I;  3O5Z A;  4J7I A;  2J06 A;  2RQR A;  4PJL A;  2D0Q B;  2DJQ A;  4M78 G;  2M51 A;  2PQW A;  3BE3 A;  2X4Y A;  2L3S A;  3TSW A;  4HVV A;  3JCM c;  2OTJ A;  3OBW A;  2GFA A;  3TQ7 P;  2P4T A;  4J83 A;  1ABQ A;  4RG8 A;  2BUD A;  4M75 A;  3UF4 A;  2O31 A;  1HSQ A;  1X75 C;  2LQ8 A;  2X35 A;  4M7D F;  4KH1 B;  4DOV A;  4RTY A;  4BD3 A;  3LH5 A;  3CQT A;  2MWO A;  5KE2 A;  3CXC P;  5GAN d;  2W10 A;  5EG2 A;  1TUG B;  4E7L A;  2M1H A;  4M78 F;  5CCA A;  3UPU A;  3SDZ A;  4M7A A;  4ZNX A;  3C0C A;  4JJB A;  3PT9 A;  1WQ7 A;  3A8H B;  4LDW A;  3CD6 Q;  3A8O B;  3MPU B;  3PMI A;  1XTD A;  2CT4 A;  3UWN A;  2QAZ A;  1TU0 B;  4A53 A;  2MAM A;  2LT1 A;  4AG1 C;  4IUT A;  2EYY A;  2E4H A;  1UJ0 A;  3E1S A;  3I56 Q;  1VQK T;  2J6O A;  1GFD A;  2K3B A;  4LUE A;  5GAO l;  4BI3 A;  1KQS S;  3MKD A;  4O5V A;  1VOM A;  4F17 A;  1M1K C;  2ROL A;  1VQO Q;  2MI6 A;  4M77 C;  3RUX A;  5I22 A;  4NL2 A;  3OYF A;  2E5K A;  2HSE B;  3PFS A;  5L8R E;  2BZX A;  1N6A A;  2YUO A;  3JSC A;  1X6G A;  4KGV B;  2KR3 A;  5GAN 6;  3QBY A;  2M0Y A;  5CO7 A;  1IRX A;  1VYV A;  4E7S A;  1W2B A;  3MEU A;  1QKW A;  2B8A A;  3EGU A;  1TXQ A;  2EYX A;  3MP1 A;  3AT1 B;  1YNZ A;  5LL6 S;  2RH2 A;  2E5Q A;  3I9Q A;  4Y92 A;  1B07 A;  3LWH A;  3CME Q;  4EMK B;  1FMW A;  1NLO C;  3LH0 A;  3MCA B;  2BIV A;  3OW2 S;  4JRQ A;  3X25 B;  5FU6 B;  2X9H A;  1M90 C;  5CKF A;  3J81 E;  2A37 A;  1N8R C;  5IHK A;  1KC8 U;  4M78 D;  4OP0 A;  5FU7 C;  4DBQ A;  3RKX A;  2EQK A;  1M30 A;  1YI2 T;  4PLL A;  2DO3 A;  5GAN 4;  3GIB A;  3QYH B;  4D8D A;  5GAN 5;  1RAI B;  1Q81 U;  4KH0 B;  2KXD A;  1LNX A;  2RHY A;  2V1Q A;  4DBH A;  3L2R A;  1K9M R;  1X01 A;  2LRQ A;  3OYM A;  2QGG A;  4QVZ A;  3NMZ C;  3PVQ A;  4R56 A;  1YHQ A;  4PFP A;  5J3B A;  2F2X A;  1UGR B;  2CUD A;  3OS1 A;  1I81 A;  3CCU A;  3S6W A;  1RAF B;  2R57 A;  2QQA A;  3JCM f;  1Y71 A;  4PJO G;  4KGX B;  1GCQ C;  2RHX A;  4PFO A;  1GCQ A;  4XU1 A;  3CC2 Q;  3CD6 T;  4PNO A;  4C5I A;  2M02 A;  1MNE A;  2MMP A;  3SD4 A;  1YHQ T;  1WPY A;  2MF2 A;  4FYY B;  1BI3 A;  1D0Z A;  3JCM h;  1AWO A;  1ZLM A;  4E2F B;  2FG0 A;  1YWP A;  4M7A B;  3OQ5 A;  3NPF A;  2VYT A;  1AEY A;  3OYY A;  4GLK A;  1WLP B;  2DF6 A;  3G6E Q;  3JCM J;  1VQM T;  3G4S A;  2JMA A;  5LJ3 j;  2CP7 A;  3VS5 A;  4M78 C;  1Y96 A;  2GFU A;  2VAS A;  1N5Z A;  1SHF A;  3VRY A;  4ELZ C;  4M7D B;  1SSF A;  1U5S A;  1X69 A;  1PWT A;  4J9G A;  4MML A;  4XU3 A;  2F5T X;  3A5Z B;  3V7R A;  3CC4 A;  3HKS A;  1I5L A;  1YIT T;  1VQ9 A;  4VUB A;  1IO6 A;  2F2V A;  1FYN A;  2DL7 A;  1RAE B;  5A0D A;  4C92 D;  1WA7 A;  4Z89 A;  2FO0 A;  3CCS T;  3JB9 D;  3SB2 A;  4XTY A;  3CCJ T;  1I07 A;  4J5Y A;  1MGQ A;  2KQW A;  1WJS A;  4ORZ A;  2JMC A;  5IAY A;  2EQJ A;  2KXC A;  2VUB A;  2YSQ A;  1D3B B;  2JM9 A;  3H0I A;  3CC7 A;  1WI7 A;  1UFF A;  1GBQ A;  4HA8 A;  3HRS A;  2V26 A;  3E19 A;  2HBP A;  1S1N A;  2GQI A;  3QDR B;  1MMG A;  1U8R A;  2D9T A;  3CBO A;  2L3Q A;  4E7I A;  3QHS A;  2YUQ A;  4OML A;  5CKD A;  2HNI A;  2KGT A;  3BFM A;  3P8D A;  4M77 G;  4A4E A;  3CC7 Q;  2XK0 A;  2HQX A;  2RHU A;  3CCE A;  1RAA B;  1WHJ A;  2RN8 A;  1UTI A;  2YWW A;  1ZUU A;  2EYQ A;  2LP5 A;  4CC7 A;  5KYY A;  5FRO A;  2P4R A;  2JTE A;  4C0D B;  1G3Y A;  1B7T A;  4FYX B;  2KEA A;  3MHX A;  3M58 A;  3CCL T;  2Y90 A;  2P0Q A;  1WFW A;  2XIC A;  5HK0 A;  2P0K A;  4ME7 A;  3OMG A;  8ATC B;  1X27 A;  1TS9 A;  2XDB A;  2RHI A;  4CC3 A;  3QWY A;  2FRW A;  2QQR A;  3NGP A;  2DZ9 A;  2YHT A;  2ZPI B;  4ZGD B;  1EIF A;  1OOT A;  1BK2 A;  3V8L A;  4BUG A;  1UGP B;  2RF0 A;  3I5R A;  3RMS A;  3PGG A;  2QEX A;  2RNA A;  3LX7 A;  2XG8 D;  3MP8 A;  3CCR T;  1ZSZ C;  4JRP A;  1YJW T;  1VQ8 T;  1OV3 A;  2K4Y A;  5CKE A;  1Q95 G;  4BY6 C;  1Q82 U;  1VQO T;  2RO0 A;  1W2B P;  1ARK A;  3X28 B;  2FZC B;  2LZ6 B;  3X26 B;  4M75 D;  4L59 A;  1LVK A;  5LJ3 d;  2KYM A;  4R55 A;  3MEV A;  3VUB A;  4N4G A;  4N0A C;  4CI0 C;  2EW3 A;  5GAN e;  1GL5 A;  3A8M B;  2EQU A;  4RKU E;  3D7S B;  1OI1 A;  4EMH A;  4F7U A;  1PCX A;  1U1S A;  2JS0 A;  3HHT B;  2P84 A;  2KNB B;  2NWM A;  3CMA T;  1CKB A;  1BIA A;  4RCC A;  1Z9Z A;  4M75 B;  5M9O A;  5I2M A;  2RJC A;  1VQ5 Q;  4C5H A;  4LD9 K;  1IHW A;  4X34 A;  2EGA A;  3FIF A;  1KHI A;  1AVZ C;  4J9B A;  3TSZ A;  2DYB A;  4MDW A;  3N5B B;  3MP6 A;  4F7U G;  3VS3 A;  1N8R U;  2OTL T;  4FW1 A;  4J9H A;  4C92 A;  2CRE A;  1UGS B;  1KHC A;  3CCM T;  3OYK A;  1EFN A;  1M5Q 1;  2VC8 A;  4PJO B;  2KE9 A;  3NTI A;  5GMK m;  2QDL A;  3OYL A;  3CCE Q;  2XID A;  1NM7 A;  2EBP A;  2D8H A;  3JB9 G;  4KUI A;  2C0O A;  1KG1 A;  2VXE A;  2GCX A;  4XQ3 A;  3DB3 A;  3H9N A;  4C8Q F;  2FEI A;  4XTV A;  4OMM A;  2DD5 A;  1A0N B;  4QW2 A;  5GAM j;  1RAC B;  4C92 E;  3M5A A;  3KXT A;  2RI3 A;  2DTH A;  2CDT A;  4FYW B;  4A4H A;  2RK2 A;  2LCS A;  4XTW A;  1UGQ B;  3MET A;  4OMF B;  2V8K A;  5FU7 B;  4FT4 A;  1Y07 A;  3OYI A;  4N4I A;  5CVI A;  2QTX A;  1VUB A;  4KUL A;  5KYW B;  4ATO A;  1D1B A;  4Z02 A;  1G83 A;  1Q82 R;  4WTO B;  2AIR B;  1O9S A;  3CC7 T;  2FRY A;  2CP6 A;  2GF7 A;  3QJ6 A;  1PD1 A;  3M53 A;  4EIK A;  4WCI A;  4EMK C;  1H92 A;  3S3N A;  3LW5 E;  3EG1 A;  2QQS A;  4QKU A;  3OYC A;  1AD5 A;  1TH7 A;  2AHJ B;  4R0K A;  2CH4 A;  2FB7 A;  3VS7 A;  2EYW A;  2IVW A;  3SEM A;  5KCH A;  3CCJ Q;  1M2V B;  2QQ9 A;  2DNU A;  5GAM f;  3CME A;  1G5V A;  1TG0 A;  4LDX A;  1NEG A;  2YRD A;  2HMA A;  1RAG B;  3CCQ T;  4DA4 A;  2D8J A;  2OAU A;  3CCV A;  4MZP A;  1TTH B;  3VS1 A;  1M1K U;  1DJ7 B;  3RR6 A;  2K5F A;  4XK8 E;  1D0Y A;  4ZTJ A;  4J7F A;  3EH2 A;  4BB7 A;  1OQK A;  3TVT A;  3H0F A;  2ZPE B;  2K2M A;  5I21 A;  3G4S T;  3L2V A;  3EGD B;  5D6W A;  3M0U A;  4M7A C;  1M2V A;  4KGZ B;  4FL6 A;  2KBT A;  5KYU B;  1ACM B;  3JCM b;  2CZ0 B;  1VQL T;  4IUV A;  2JXB A;  2RB6 A;  2KYB A;  4Y28 E;  4JS5 A;  2MIO A;  1YHQ Q;  2E64 A;  1NE8 A;  2DL5 A;  3UA6 A;  3CCJ A;  2QAS A;  1WXU A;  2E6N A;  4HXJ A;  3AHU A;  2AKL A;  3CCS A;  2A0F B;  3CCU T;  3GBQ A;  1Q86 U;  4AG2 C;  5GAM e;  2PTK A;  5DLO A;  3GOX A;  2EWN A;  4MZM A;  4RCB A;  1Y7X A;  2VB6 A;  1BBZ A;  4NOY A;  2RM4 A;  1UEB A;  1M90 U;  1O75 A;  3H41 A;  4FSS A;  3M55 A;  4JZ3 A;  2XI9 A;  4RTW A;  1N9S A;  1WXT A;  4GLM A;  2YUP A;  4GY5 A;  1T0H A;  1YFN A;  4KT0 E;  3QSU A;  1OX8 A;  1WIE A;  4JJD A;  1MMD A;  4IUP A;  5FWC A;  5GAN 2;  2EKH A;  2JVV A;  4C0Z A;  3ME9 A;  1K4U S;  3QZ5 B;  5LJ5 h;  2QI2 A;  5I2S A;  2WSF E;  5FRM A;  2X4W A;  1BI2 A;  1YJ9 A;  4P5N A;  3E2U A;  5FRN A;  4FW2 A;  4FSX A;  5DLQ E;  4PL6 A;  4PJO A;  1ZUY A;  4OB2 B;  2H3J A;  4LNP A;  2DZC A;  2NUT B;  1Y0M A;  4C8Q A;  3HRT A;  3QZ9 B;  1QVG A;  1NG2 A;  1AOJ A;  3H0H A;  4EMK A;  1H8K A;  2ZAE A;  2LQK A;  1D0X A;  1Q82 C;  3FRN A;  2FZK B;  2DJZ A;  3P8B B;  3WXM B;  1UDL A;  4OMQ A;  1FWZ A;  1PRL C;  4D6W A;  3CC4 T;  2HKN A;  3FEO A;  3U23 A;  5GAN j;  1JJ2 A;  3OMC A;  3SWN B;  2L3R A;  2GTJ A;  2X4X A;  2O4X B;  2RPN A;  1R0B G;  4OVA A;  4M77 D;  5D6Y A;  3A8G B;  4O6J A;  1UHF A;  4A63 B;  2FHD A;  5ECA A;  1B3Q A;  1AZG B;  1UEC A;  2AZV A;  5GMK e;  1VQ7 Q;  1T3S A;  4XU0 A;  4HT9 A;  1W6X A;  3EG0 A;  3I35 A;  2CT3 A;  1K8A U;  1QVP A;  1M3C A;  2CZ6 B;  2DET A;  1NJI R;  2HL3 A;  2RQT A;  3DB4 A;  3OSS C;  5GAN h;  3S3M A;  2LJ1 A;  2EGC A;  2PU9 B;  3PTA A;  3PVL A;  3EFR A;  2DD4 A;  2D0N A;  1ZBJ A;  1QVF S;  3G7Z A;  4OMO A;  4JRI A;  4B9W A;  2HQH A;  1T0J A;  2KI7 A;  4NS5 A;  2JW4 A;  1VIE A;  1SF9 A;  1R77 A;  4JDS A;  2QEX T;  4QT7 A;  3OS0 A;  1UE9 A;  1WZO A;  3J80 E;  1IZ6 A;  4J9C A;  1QVG S;  2DXC A;  4HCK A;  3FJP A;  1KK7 A;  2FPF A;  2EJF A;  4EPC A;  5KH6 A;  2DXB A;  3EFO A;  1HK9 A;  1MUZ A;  4HCC A;  4DBR A;  2MPX C;  4RTT A;  5DY9 A;  1KIK A;  1X6O A;  1M90 R;  1R0C B;  4CRI A;  1AWX A;  4C0F A;  2DLP A;  3L2W A;  1QCF A;  1AWJ A;  4J9I A;  3CCL A;  1RL2 A;  3VS6 A;  1HJD A;  1IB8 A;  2V8J A;  1OU9 A;  3C4S A;  3CCV T;  2DK3 A;  4X9C A;  8AT1 B;  2KRN A;  2I2L A;  3OSV A;  1YI2 Q;  2LMJ A;  2KRM A;  2EQM A;  3CME T;  2CP0 A;  2EQI A;  1JU5 C;  2YDL A;  1ZA1 B;  2R5M A;  2VKN A;  4K11 A;  4M7A G;  4M78 A;  2RJD A;  1NYF A;  3G71 A;  2KAF A;  1KQ2 A;  2EKO A;  1QW1 A;  2JNG A;  4A4K A;  5GAM d;  3V7S A;  4RUG A;  4J6Y A;  3M0Q A;  3EGD A;  4FCY A;  1VQM Q;  2LDM A;  3FLG A;  3URG A;  3REB B;  3ASK A;  1YJN T;  2QTV A;  2NUT A;  1RLP C;  4J6W A;  3JCM Q;  1IGU A;  2P0P A;  3HTR A;  4HVW A;  1D1A A;  3WVD B;  2XDD A;  2DYI A;  2LJ0 A;  4J8O A;  3HP9 A;  3OYE A;  2L3P A;  1QQJ A;  2KVQ G;  5GAN 3;  5GJW B;  1AT1 B;  2K6D A;  3ULR B;  3GPL A;  1PG5 B;  1SHG A;  1WJQ A;  1RAH B;  1I0C A;  4YTL A;  5IH2 A;  4M75 F;  4OB3 B;  4FM4 B;  4X1V A;  2OTJ T;  2J6F A;  1VQN A;  2G6F X;  3ZBD A;  5GMK l;  2R58 A;  1F1B B;  4RTZ A;  1YN8 A;  2ZPG B;  4J6X A;  1BI1 A;  2YRV A;  1IHV A;  3VYG A;  2NUZ A;  3L2Z A;  4AFS C;  1M4Z A;  2W0Z A;  4XAX B;  3INZ A;  2QQB A;  2VV5 A;  3O8V A;  1G2B A;  3JRZ A;  3PNW C;  4C92 F;  2F5K A;  4C92 C;  1UJY A;  2A28 A;  1OYX A;  4PLI A;  4N4H A;  3MEW A;  2RJE A;  3V7C A;  1K9A A;  2KY9 A;  4DQ2 A;  1K73 C;  3OBY A;  4QQG A;  5KYX A;  3CPW A;  1EX4 A;  3L1A A;  3ZL7 C;  1VQM A;  2ZGW A;  1OZ2 A;  3PE0 A;  4M7D E;  3BDL A;  3CC2 T;  2CZ1 B;  3RNJ A;  1IRE B;  1YJW Q;  3G71 Q;  2HDA A;  4MDX A;  4C8Q B;  1PKT A;  4AFZ C;  1U06 A;  2XHC A;  5A2Q E;  2KMT A;  5I11 A;  5LJ3 g;  5LJ5 d;  2JS2 A;  5HK3 A;  3M0P A;  1G3S A;  3H6Z A;  4PK4 A;  2MCN A;  4JLG A;  2OTL Q;  4CC4 B;  3JCM W;  2JM8 A;  2GTO A;  5GAM h;  2ZZD A;  4DOW A;  2QK0 A;  2LNH B;  1VIF A;  1JXO A;  5C0M A;  1I8F A;  2YUN A;  1S72 T;  3TU4 K;  1RI9 A;  1BU1 A;  1H3Z A;  2CH4 W;  1YIT Q;  1JJ2 S;  1OEB A;  3T9N A;  3Q1J A;  1K8A C;  2OTL A;  1X6B A;  4HVU A;  5GAO p;  3I55 A;  4RMO A;  3QYG B;  1BKB A;  4LDY A;  1ZX6 A;  1VQ8 A;  2ED0 A;  1VQP A;  5FW9 A;  3QPH A;  1I5O B;  3ER0 A;  3M57 A;  2K3Y A;  4PKC C;  2EIF A;  2DXU A;  4C5G A;  1N8R R;  2XMF A;  2QGF B;  4IUU A;  1QLY A;  3G1J A;  3EGX B;  2HSP A;  1ABO A;  1VQP T;  2JOY A;  5CKB A;  3OA6 A;  3IQL A;  1K9M U;  3LYI A;  4OMP A;  5IT9 E;  1V1C A;  2QXF A;  1V29 B;  5KYU A;  3M54 A;  1N9R A;  2EYZ A;  3THK A;  3OYN A;  1C6V X;  4F16 A;  1VQ5 A;  4QQD A;  3NFC A;  1FMK A;  1VYT A;  1JQQ A;  1VQL A;  3C12 A;  1KD1 R;  3I56 A;  2LX9 A;  1Q86 C;  3UA7 A;  5L23 A;  3CMA Q;  5IN1 A;  2LX7 A;  2LTO A;  1WX6 A;  1U3O A;  1NLP C;  3RBB B;  2DFU A;  2A7Y A;  3JCM g;  2HAX A;  4AFQ C;  3UAT A;  3EG9 A;  1S72 Q;  2M16 A;  4E47 A;  1UUE A;  5GMK i;  4XU2 A;  1SG5 A;  1WYX A;  2ECZ A;  2GGR A;  3CC2 A;  2CKK A;  1YIJ Q;  2L0A A;  3LGL A;  1LOJ A;  2PUO B;  2QEX Q;  3M0S A;  2RA2 A;  4QVD A;  4M78 E;  1K73 R;  3VUZ A;  3CCV Q;  1TUD A;  1KQ1 A;  2PVO B;  4BDZ A;  2DTO A;  2KRO A;  1BCM A;  3OYD A;  4OGC A;  2QG9 B;  2KRS A;  1YWO A;  1TUC A;  4BDY A;  1WHH A;  3CXC S;  1JEG A;  4HT8 A;  4F7U E;  1M1F A;  7AT1 B;  2OX7 A;  2BE9 B;  4E6R A;  5GMK j;  1JBM A;  2ZPH B;  1NPR A;  2LQN A;  1LPL A;  2FZG B;  1WJR A;  2PNI A;  1QWE A;  2WAC A;  1VQ7 T;  2CP2 A;  1RAB B;  1MMN A;  2ROT A;  3M9Q A;  2JTM A;  3GF5 A;  5GMK h;  3CXC A;  2ED1 A;  3M0T A;  1JO8 A;  1TWB A;  3CCR Q;  4M7D C;  4C92 G;  5LJ3 e;  3CCS Q;  3V8J A;  1OU8 A;  3CCQ A;  1VQ6 Q;  4XTU A;  1HXD A;  3EG3 A;  3MJX A;  3I5S A;  4PFZ A;  5D6X A;  2EPD A;  3S3O A;  1PC0 A;  3FB9 A;  3HFO A;  2YRC A;  5CK9 A;  2DIL A;  3F70 A;  3L2U A;  5LJ5 e;  2GQV A;  3TCJ A;  1SKU B;  1SPK A;  4LDU A;  3RIR A;  1PKS A;  1PNJ A;  4D8K A;  4TVR A;  2DXT A;  1YCS B;  1C1A A;  2VGN A;  2BTT A;  2XD0 A;  1K0X A;  4JLI A;  2E65 A;  3NTH A;  4Y91 A;  5FU6 C;  4E7J A;  4GBQ A;  1K76 A;  2RQV A;  3M4Y A;  2RK1 A;  3VS0 A;  2OI3 A;  2FYK A;  2JN0 A;  1P92 A;  4AT1 B;  4IKF A;  4RG2 A;  1NYG A;  5FLX E;  2RHZ A;  1EZZ B;  1KQS A;  4HCZ A;  4F04 B;  2PZ1 A;  2NUP B;  1YCY A;  2IPO B;  2DAQ A;  2QYZ A;  3CMA A;  5KCO A;  5CIU A;  2COW A;  1BCO A;  2EVR A;  1D3B A;  5LJ3 h;  1K73 U;  4LUD A;  4J9F A;  1Z9Q A;  4Z8A A;  2CUB A;  1U1T A;  2CZ7 B;  3CD6 A;  2X3X D;  5LJ5 f;  2EGE A;  2D6F A;  1Q7Y U;  1VQ5 T;  4BE2 A;  3QWX X;  2GBQ A;  1M27 C;  2DVE A;  4HCB A; 
#chains in the Genus database with same CATH homology
 2VVK A;  1T0J A;  1SRL A;  2KXC A;  2JW4 A;  4JPB W;  2LQW A;  2YSQ A;  1ZUK A;  2JM9 A;  4QT7 A;  4RTU A;  1UE9 A;  2J6K A;  2DVJ A;  3H0I A;  3EHR A;  1WI7 A;  4KRT A;  3SHW A;  4J9C A;  1UFF A;  1GBQ A;  2LJ3 A;  4HCK A;  2FPF A;  1S1N A;  3VRZ A;  2GQI A;  1MUZ A;  4RTT A;  1KIK A;  4IIM A;  2DBK A;  1AWX A;  2L3Q A;  2YUQ A;  2DX1 A;  4OML A;  2MOX A;  2DLP A;  2KGT A;  1Y57 A;  1QCF A;  1T3L A;  1YP5 A;  1AWJ A;  4J9I A;  2HCK A;  3VS6 A;  1HJD A;  2RN8 A;  1UTI A;  1ZUU A;  2LP5 A;  4CC7 A;  2H8H A;  2DBM A;  4M4Z A;  2P4R A;  2JTE A;  2KRN A;  2LMJ A;  2KRM A;  2EQI A;  2SEM A;  2KEA A;  2ABL A;  5EC7 A;  1JU5 C;  1E6G A;  2K9G A;  2YDL A;  1WFW A;  2X3W D;  2VKN A;  3REA B;  4K11 A;  2RQW A;  1GRI A;  2B86 A;  1ZSG A;  2AKK A;  1NYF A;  3A98 A;  1X27 A;  5IXB A;  4CC3 A;  1VA7 A;  3QWY A;  2FRW A;  3NGP A;  4RUG A;  3M0Q A;  4IIO A;  2CSI A;  1OOT A;  1BK2 A;  3REB B;  2RF0 A;  3KFV A;  3I5R A;  1RLP C;  1M3B A;  4HVW A;  2IIM A;  2DMO A;  1OPK A;  4AFU C;  2ESW A;  2RNA A;  2LJ0 A;  1UG1 A;  2L3P A;  1GFC A;  1OV3 A;  2DL4 A;  1MV0 B;  3M0R A;  5GJW B;  2K6D A;  3ULR B;  1SHG A;  2FPE A;  1I0C A;  1K0S A;  5IH2 A;  1ARK A;  2V1R A;  4X1V A;  2J6F A;  2JT4 A;  4ESR A;  2LZ6 B;  3JV3 A;  2G6F X;  3FJ5 A;  4RTZ A;  1YN8 A;  2CSQ A;  2KYM A;  1LCK A;  1BB9 A;  2NUZ A;  4DEX A;  1SRM A;  2EW3 A;  1GL5 A;  4AFS C;  2W0Z A;  2AZS A;  2O2O A;  1G2B A;  2JS0 A;  2KNB B;  2DE0 X;  2DL8 A;  1UJY A;  1PHT A;  2A28 A;  1QWF A;  1CKB A;  2NWM A;  4JJC A;  1E7O A;  1K9A A;  1X2K A;  1Z9Z A;  4J9E A;  1M8M A;  2J7I A;  3ZL7 C;  3PE0 A;  1RLQ C;  1PRM C;  3RNJ A;  2EGA A;  2O9S A;  1AVZ C;  4J9B A;  3TSZ A;  2HDA A;  2DYB A;  1VYU A;  1PKT A;  1UGV A;  4AFZ C;  1X2Q A;  1U06 A;  2D1X A;  4RTV A;  1RUW A;  1E6H A;  5I11 A;  3VS3 A;  4J9H A;  2JS2 A;  3M0P A;  2CRE A;  2I0N A;  2DRK A;  1W70 A;  1EFN A;  3R6N A;  2FPD A;  2KE9 A;  2OAW A;  2A36 A;  3EG2 A;  3VS4 A;  1XOV A;  2MCN A;  2GNC A;  2QDL A;  3O5Z A;  4CC4 B;  2J06 A;  2RQR A;  1NEB A;  2JM8 A;  1NM7 A;  2GTO A;  2EBP A;  2D8H A;  2DJQ A;  2C0O A;  2LNH B;  1W1F A;  1J3T A;  1JXO A;  2M51 A;  1M3A A;  2L3S A;  2FEI A;  3TSW A;  4HVV A;  2YUN A;  4OMM A;  1A0N B;  1RI9 A;  1BU1 A;  1MV3 A;  2CH4 W;  1OEB A;  2A08 A;  2CDT A;  1ABQ A;  1X6B A;  4HVU A;  4LN2 A;  2SRC A;  3UF4 A;  2O31 A;  2LCS A;  1HSQ A;  1ZX6 A;  2L2P A;  2ED0 A;  5FW9 A;  4RTY A;  1CKA A;  3LH5 A;  3CQT A;  1G83 A;  2XMF A;  1QLY A;  2W10 A;  2FRY A;  2HSP A;  1ABO A;  2YT6 A;  3IQL A;  4ZNX A;  4LE9 A;  1OPL A;  3C0C A;  4JJB A;  4OMP A;  4EIK A;  1V1C A;  4WCI A;  5IHI A;  1WDX A;  1H92 A;  3EG1 A;  1UHC A;  2EYZ A;  3THK A;  1CSK A;  2CT4 A;  4F16 A;  1JXM A;  1AD5 A;  2J05 A;  4AG1 C;  1FMK A;  4R0K A;  1VYT A;  2CH4 A;  3VS7 A;  1JQQ A;  2EYY A;  2EYW A;  1UJ0 A;  3SEM A;  2J6O A;  2DNU A;  1GFD A;  1I1J A;  1TG0 A;  2K3B A;  1NEG A;  4LUE A;  3UA7 A;  5L23 A;  3NHN A;  1SSH A;  2D8J A;  2LX7 A;  2O9V A;  4F17 A;  1WX6 A;  1U3O A;  2ROL A;  1NLP C;  3RBB B;  2K79 A;  2C0T A;  5I22 A;  3VS1 A;  2E5K A;  4CC2 A;  4AFQ C;  2BZX A;  3UAT A;  2YUO A;  3TVT A;  1X6G A;  3H0F A;  2KR3 A;  5IHN A;  2K2M A;  2M0Y A;  1UUE A;  5HCK A;  1VYV A;  2KT8 A;  1GBR A;  3M0U A;  2DM1 A;  2O88 A;  1WYX A;  2ECZ A;  2GGR A;  1QKW A;  1H3H A;  3EGU A;  2EYX A;  2KBT A;  2L0A A;  1YNZ A;  1WXB A;  2F2W A;  3M0S A;  3I9Q A;  4Y92 A;  4F14 A;  1TUD A;  2ENM A;  1B07 A;  2KRO A;  2JXB A;  2KYB A;  2MIO A;  4JZ4 A;  3UA6 A;  2DL5 A;  1YWO A;  2KRS A;  1TUC A;  1WXU A;  4HXJ A;  1NLO C;  2AKL A;  3GBQ A;  1JEG A;  4AG2 C;  2PTK A;  1X43 A;  2DA9 A;  4E6R A;  2A37 A;  1BBZ A;  5IHK A;  2K7A A;  2LQN A;  3H41 A;  4FSS A;  2RQU A;  2PNI A;  4JZ3 A;  5FWB A;  1QWE A;  4RTW A;  1M30 A;  1WXT A;  4GLM A;  2YUP A;  1T0H A;  2AK5 A;  4RTX A;  2ROT A;  4OMN A;  4J9D A;  4D8D A;  1WIE A;  4JJD A;  5FWC A;  3VS2 A;  2EKH A;  2ED1 A;  1KSW A;  3M0T A;  2KXD A;  2V1Q A;  1JO8 A;  2KT1 A;  1K4U S;  1QKX A;  2VWF A;  3NMZ C;  1KJW A;  4Z88 A;  3PVQ A;  3EG3 A;  2F2X A;  2CUD A;  1ZUY A;  3I5S A;  2EPD A;  4LNP A;  2DIL A;  2RMO A;  1Y0M A;  1AZE A;  1GCQ C;  1NG2 A;  1SPK A;  1GCQ A;  1AOJ A;  3H0H A;  1PKS A;  1H8K A;  1PNJ A;  4D8K A;  5GJV B;  1YCS B;  2BTT A;  1K0X A;  2DL3 A;  1UDL A;  2DRM A;  1HD3 A;  4OMQ A;  1AWO A;  1SEM A;  2HBW A;  1PRL C;  1ZLM A;  1KFZ A;  2FG0 A;  1YWP A;  4GBQ A;  1K76 A;  3NPF A;  1AEY A;  2C0I A;  3U23 A;  2RQV A;  2OJ2 A;  3VS0 A;  1WLP B;  1AWW A;  2OI3 A;  2GTJ A;  2DF6 A;  2RPN A;  4DEY A;  1GCP A;  1NYG A;  2JMA A;  1UHF A;  3VS5 A;  4A63 B;  2PZ1 A;  1N5Z A;  1SHF A;  5ECA A;  3VRY A;  1B3Q A;  1AZG B;  4ORZ A;  1UEC A;  2AZV A;  1T3S A;  1U5S A;  1X69 A;  1PWT A;  4J9G A;  1W6X A;  3EG0 A;  3I35 A;  2CT3 A;  1K1Z A;  2EVR A;  1M3C A;  4LUD A;  4J9F A;  1Z9Q A;  4Z8A A;  2BZ8 A;  2CUB A;  1IO6 A;  2F2V A;  2RQT A;  2HEQ A;  1FYN A;  2BZY A;  2DL7 A;  2LJ1 A;  1WA7 A;  4Z89 A;  2FO0 A;  2EGC A;  2X3X D;  2EGE A;  3PVL A;  3QWX X;  2GBQ A;  5IXF A;  1I07 A;  1M27 C;  2D0N A;  3EHQ A;  1ZBJ A;  4OMO A;  2JMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...