2RPNA

A crucial role for high intrinsic specificity in the function of yeast sh3 domains
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
APWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-binding protein
publication title Structural, functional, and bioinformatic studies demonstrate the crucial role of an extended peptide binding site for the SH3 domain of yeast Abp1p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rpnA00
2PNIA 2EGCA 4AFUC 1JXMA 1U5SA 3EG3A 1T3SA 2EGAA 1AEYA 4AFSC 3M0TA 1EFNA 3QWYA 4OMMA 1OV3A 4JJCA 2O88A 1W6XA 3NHNA 1OPLA 3O5ZA 2M0YA 1WX6A 2J6KA 4HVVA 3VRYA 1GBQA 2FO0A 2YDLA 3UF4A 4OMNA 4X1VA 1K76A 2LJ3A 1VYTA 1PHTA 1QWFA 1TG0A 1K1ZA 2DBMA 2DRKA 1LCKA 3C0CA 2FRWA 1SPKA 2A37A 2K3BA 1CSKA 2MIOA 2E5KA 4HXJA 1XOVA 4A63B 4CC4B 2A36A 4Y92A 3H41A 2JT4A 4J9DA 2EYWA 2JTEA 2YUNA 1E6GA 4DEYA 2J05A 1X6GA 1PWTA 2C0IA 3VS7A 2C0OA 2RF0A 1AZEA 2O9VA 1GL5A 2AK5A 3GBQA 1GCQA 4ZNXA 1UHCA 1HSQA 2AKLA 2FG0A 1ZUKA 1YP5A 4CC3A 3EHRA 5IXFA 1PNJA 2JS0A 2D8JA 2ROTA 2DM1A 2RNAA 2CUBA 1GCPA 2VWFA 1UG1A 4J9CA 4JPBW 1M3AA 1BK2A 1BBZA 2PTKA 1UECA 2CSIA 2W10A 2DILA 3VS4A 3REAB 1GBRA 3ULRB 3M0SA 4KRTA 2FPFA 2GNCA 2O31A 1E7OA 3H0FA 2I0NA 4J9BA 1ABOA 1K0SA 1AWXA 5I22A 1JXOA 2RQWA 2KYBA 2EQIA 2L0AA 4HVWA 2DYBA 4AFQC 2GGRA 2DJQA 1PRMC 2JXBA 3EG1A 4J9GA 2KRNA 2BZ8A 5FWCA 2H8HA 4LUEA 2VVKA 4E6RA 5HCKA 4QT7A 1M8MA 3EG0A 3KFVA 1H3HA 3VS2A 3PE0A 4AG1C 1X69A 2A08A 2DL4A 4DEXA 4OMPA 1WXBA 2DF6A 4JZ4A 1UHFA 5IHKA 2KT8A 2LJ0A 2F2WA 2M51A 1WLPB 2KYMA 2X3XD 1OPKA 3RBBB 3NGPA 4WCIA 1AOJA 2L2PA 1KJWA 4LNPA 1SHFA 2L3PA 2VKNA 1K4US 1UJ0A 1T0JA 1QLYA 2JM8A 2J6OA 2EPDA 2KXDA 1NM7A 1SSHA 2F2XA 4EIKA 1FMKA 2XMFA 2MCNA 2RN8A 1T3LA 1X27A 1ZLMA 3VS0A 1A0NB 1PRLC 1NEBA 2K9GA 2W0ZA 4AFZC 4ESRA 2L3QA 1WXUA 1X6BA 3A98A 2CDTA 4F16A 2BZXA 2LCSA 2J06A 2ROLA 3VS5A 4K11A 2EVRA 2HDAA 4JZ3A 1WA7A 2DBKA 1I07A 1PKSA 2HSPA 2ED1A 1GCQC 1QCFA 2OAWA 1B07A 1NLPC 3NPFA 2YUPA 3M0PA 1SRMA 2SEMA 2DL3A 2RQUA 1M27C 3M0RA 5GJWB 1HD3A 2GTJA 2OJ2A 2RQVA 1Y0MA 3PVLA 2LP5A 1UGVA 2OI3A 1UUEA 1TUDA 1NYFA 5FW9A 2O2OA 1RLQC 2KXCA 1UJYA 4RTYA 2GTOA 1UDLA 2JMAA 3EHQA 3TVTA 2LMJA 1BU1A 2HCKA 1PKTA 5ECAA 1SHGA 4OMOA 1YCSB 4HVUA 1M30A 2KT1A 2DL8A 2HBWA 1KIKA 2C0TA 1CKBA 1QWEA 2K79A 4LE9A 1VA7A 4OMQA 1W1FA 1RUWA 2FRYA 1U06A 4D8KA 4CC7A 4J9IA 1ZUUA 2ECZA 2FPEA 1KFZA 1WYXA 1X43A 2K2MA 2B86A 1N5ZA 3VS1A 2V1QA 3REBB 2A28A 1ZSGA 1JQQA 4F17A 2CH4W 2JMCA 4M4ZA 2KRMA 4GBQA 2KNBB 5IHNA 1UTIA 1I0CA 3VS6A 1AWJA 5FWBA 1JU5C 4IIMA 1QKWA 2YUQA 1TUCA 2YT6A 2MOXA 1K9AA 4RTXA 2EW3A 2O9SA 2DL5A 1HJDA 3I5SA 1E6HA 2LQWA 1WIEA 1IO6A 1I1JA 2CSQA 4F14A 2AZSA 1VYUA 1GFDA 1NYGA 1X2KA 2ENMA 2D8HA 2G6FX 2LQNA 5IHIA 2K7AA 2DL7A 2DX1A 3NMZC 1M3BA 4LUDA 1GRIA 2K6DA 2ABLA 2ESWA 2LZ6B 1X2QA 1NEGA 2RQRA 3JV3A 4OMLA 3TSZA 5EC7A 2HEQA 2J7IA 2JS2A 2NWMA 2CH4A 3LH5A 2D0NA 2GBQA 2P4RA 4LN2A 4ORZA 2F2VA 1Z9QA 2JM9A 2KBTA 4JJBA 2KRSA 1AWOA 1CKAA 1NG2A 2DLPA 5L23A 4R0KA 2L3SA 2GQIA 1SRLA 1T0HA 1WFWA 4GLMA 3PVQA 1FYNA 4JJDA 2CT4A 4Z88A 1JEGA 1WXTA 2KR3A 3IQLA 3VRZA 2KEAA 2EYZA 1MV3A 3CQTA 2LNHB 2CT3A 2SRCA 1RI9A 2FEIA 3EG2A 1OEBA 1ARKA 2RPNA 2KE9A 3UATA 3ZL7C 4J9FA 1UE9A 2FPDA 1WDXA 1AVZC 3M0QA 2D1XA 5IXBA 4RTZA 3I5RA 2PZ1A 3TSWA 4HCKA 3VS3A 2NUZA 1Y57A 1NLOC 2EYXA 1S1NA 1YWPA 1G2BA 1V1CA 2ED0A 4RTVA 1AZGB 1WI7A 2CUDA 2EBPA 2RMOA 1G83A 3SEMA 2RQTA 2DMOA 3I9QA 1MV0B 2DRMA 3R6NA 1JO8A 2JW4A 1ZX6A 5I11A 4AG2C 1BB9A 1GFCA 4FSSA 2EYYA 2BZYA 3QWXX 2YUOA 3SHWA 2IIMA 1B3QA 1W70A 1UFFA 1H92A 2DNUA 1ZUYA 4CC2A 1SEMA 2LJ1A 1AD5A 4Z89A 1QKXA 3UA7A 1MUZA 2YSQA 4D8DA 3H0HA 1ABQA 3FJ5A 1K0XA 5IH2A 2DE0X 3U23A 4RUGA 2BTTA 3H0IA 3RNJA 1H8KA 2QDLA 4RTWA 1ZBJA 2LX7A 4IIOA 2KGTA 2DVJA 3UA6A 2EGEA 4Z8AA 1YWOA 1VYVA 2X3WD 2CREA 1RLPC 3EGUA 4J9HA 1OOTA 4RTUA 1KSWA 5GJVB 1Z9ZA 2AKKA 2AZVA 2KROA 3I35A 1YNZA 2J6FA 1AWWA 1J3TA 4RTTA 2EKHA 2V1RA 2DA9A 1U3OA 3M0UA 4J9EA 3THKA 1M3CA 1YN8A
chains in the Genus database with same CATH superfamily
2EQKA 4ZN1A 3OYBA 1YI2T 1Q95G 3TEEA 2F69A 3CCUT 2PVDB 3M0TA 3QWYA 4FSXA 4OMMA 3RUXA 2PU9B 1W6XA 1VQ4T 1OPLA 4KT0E 2M0YA 3CPWS 3CCEQ 3OSVA 1YJ9A 2RI3A 2FO0A 1KQ1A 5KYUB 1Y71A 4MZTA 3UF4A 2RA2A 2QA4A 2M9UA 2QQBA 3OS2A 1QWFA 1K1ZA 3A8MB 4XU3A 4EMKB 2V8IA 2ZPIB 3E19A 4ZGEB 4DOWA 1CSKA 2MIOA 2Y4XA 5GMKi 1D3BB 1QCOA 4Y92A 4J9DA 4M75B 3JB9G 2FB7A 5GAN6 5KYYB 3L2QA 4N0AA 2VGMA 1X6GA 2BIVA 1X6OA 2I2LA 3ZFJA 2C0OA 5IAYA 3QO3A 2AK5A 1GCQA 2ZPEB 4ZNXA 3V8KA 1UHCA 2LDMA 5LJ5h 1OU8A 4ZTFA 1FWZA 2A0FB 1VOMA 4CC3A 5GANf 5IXFA 1VQ6Q 1C6VX 2D8JA 3FB9A 2P0KA 5M9OA 2DFUA 2OTLT 2VWFA 1TS9A 4JPBW 3MP6A 1VIEA 1BK2A 2QTXA 2PTKA 2CSIA 2QDYB 5GAMe 3LLRA 3M0SA 4KRTA 2K2VA 4X34A 4F7UG 4OF1A 2DIQA 3QHSA 2D9TA 5I22A 5KYWA 3KXTA 2KYBA 2XG8D 4FU6A 2DYBA 2GGRA 2JTMA 2NUPA 3EG1A 5KE3A 3A8HB 3C95A 5FWCA 4LUEA 4C5GA 4E6RA 4YTLA 2DK3A 3VS2A 4AG1C 1X69A 4C8QG 3R6OA 5DM7R 4OMPA 1WXBA 2EIFA 2KQWA 3FDRA 2GFAA 3MHXA 1RADB 4M7AF 2CZ7B 2M51A 2DKGA 2IVWA 3CCJQ 2L5QA 2QQAA 4QKUA 3PIPA 4WCIA 3QXEB 2RH2A 2K57A 3JB9J 2L2PA 5IN1A 1VQPQ 4C0DC 5C0MA 5J3BA 4E7HA 4M7DC 4C92E 1T0JA 2J6OA 1VQ5Q 2KXDA 1NM7A 2F2XA 2ZCFB 1FMKA 2XMFA 2HZYA 1MMDA 5KCOA 3JCMQ 1K9MU 3CPWP 4BI3A 2LC4A 1ZLMA 3VS0A 1NEBA 5GANe 1WXUA 1YJ9T 4ELYC 3CC2Q 2BZXA 4PFOA 4JLIA 1H3ZA 3H8ZA 3QUIA 4M77B 4OMFB 2HD0A 2O01E 4FW1A 2ED1A 4PJOG 3I56Q 4LDVA 4XK8E 4B9WA 1R8OB 1SRMA 2SEMA 2RQUA 3OBWA 3ASKA 2DO3A 4ZGJB 3A1PA 1Y0MA 1KHIA 3GP8A 3CCQQ 1UGVA 2EQMA 1B34B 1TUDA 2HL3A 4OVAA 5LJ3f 1Q81C 2GTOA 1UDLA 4ME7A 4OB3B 1VQKA 4M75G 1PKTA 2P4TA 1SG5A 4FYWB 5CO7A 1SHGA 3P8HA 4OMOA 1YCSB 4E7ZA 1KIKA 2C0TA 2EJ9A 4MMLA 2K79A 3E1SA 4FYVB 4LE9A 4OMQA 3EAEA 1W1FA 1AT1B 2E70A 5EG2A 2LNVA 2FRYA 1U06A 4D8KA 1ZQ1A 1ZUUA 4PK4A 3RERA 3OYFA 1Q82C 2GCXA 3L2UA 1KFZA 1VQNQ 1X43A 1OX9A 1N5ZA 1M5Q1 2V1QA 3RDVA 5GAOp 3X25B 2A28A 3PTAA 1ZSGA 1IB8A 2RK2A 2V26A 1JQQA 1WHHA 3CCLQ 2CH4W 2KRMA 4TVRA 5IHNA 2HL5C 4LDYA 4IUPA 1I0CA 3VS6A 5FWBA 1D1AA 1QKWA 2YUQA 2WSCE 3CMAA 4RG8A 2MOXA 2JUFA 1ZSZA 2KK4A 2ZZDA 2LT1A 2XICA 1YHQQ 3GNFB 1K73U 1E6HA 4F14A 1WIEA 1N9SA 1Q86R 1M1KU 2R5MA 1U8RA 2F5KA 1VYUA 3LW5E 4C8QC 4M78G 1VQLT 2CS7A 2D8HA 2LQNA 5IHIA 1N8RR 4XTUA 3HRSA 3BDLA 4OB0B 5LJ3e 7AT1B 2COYA 2ESWA 1VQMQ 1NEGA 2PQWA 3JV3A 2FZGB 3CD6A 5EC7A 2JS2A 3GLXA 4AMCA 2K5LA 4BB7A 4LN2A 4JJBA 1AWOA 3M4YA 5LJ5f 5L23A 4P5NA 3QPHA 1SRLA 1FYNA 2CT4A 1KD1R 2DTHA 2QQSA 1WXTA 1YIJQ 3J80E 3VUZA 1Q7YR 4QQDA 2CT3A 2SRCA 2DTOA 1TUGB 3FJPA 4XU1A 3LX7A 1AVZC 5FU6C 4C5EA 5LJ5g 2F1LA 4PJOC 2LX9A 3OYEA 2K3XA 3QYGB 4HCKA 1WHLA 1XJWB 3VS3A 2NUZA 4QVDA 4XTYA 1S1NA 1ZA1B 1YWPA 3CMEA 1K8AR 2CP0A 4C92G 1IZ6A 3VJPA 3CC4T 1OX8A 2CUDA 2EBPA 4JRPA 2RMOA 1M2OA 2MWOA 2DMOA 3CBOA 1MV0B 3R6NA 3X26B 1JO8A 1ZX6A 5CKFA 3SDZA 3BY7A 4FSSA 2EYYA 2YUOA 3SHWA 1KQSA 2COZA 1H92A 4IKFA 4CC2A 1SEMA 2V8JA 1AHJB 4Z89A 3M56A 1WHMA 2DJZA 5CKDA 3JAME 1YCYA 3HHTB 1O75A 4C0DB 3CMAT 1FX7A 4M7DB 5GAOl 3PIOA 3J81E 3BW1A 3M53A 3INZA 2HAXA 3KUFA 4RUGA 1VQ7Q 1VQ8T 1R0CB 4FT4A 1H8KA 1ZBJA 2LX7A 3WVDB 2JOYA 3CCRA 3OYMA 3RKYA 5J39A 2O4XB 5FRNA 3OMCA 3ZEHA 2IG0A 4ANJA 1RLPC 2RD1A 3VYHB 4BE0A 4J9HA 1KSWA 3MEVA 2AKKA 5HK3A 1PSEA 1JJ2A 3HKSA 3NTHA 1J3TA 2X4WA 4RTTA 3OYJA 3A8GB 4J9EA 3G4SA 2CZ6B 1M3CA 1S72T 2PNIA 4DOVA 3M9QA 1M1KC 4M78C 2EGCA 1K8AC 5KYNA 1U5SA 3EG3A 2X35A 1VQOQ 3CCUA 4FT2A 1I81A 1OV3A 3M5AA 3NHNA 1M2VB 3O5ZA 4VUBA 1WQ7A 2QXFA 2J6KA 1GBQA 3SWNA 2ZPBB 4LDWA 2XK0A 1MNDA 1W2BA 2XIDA 1TG0A 1LCKA 4BE2A 5DY9A 3VV0A 1SPKA 2K3BA 2RO0A 2YHTA 1EIFA 4M7AD 1PCXA 1XOVA 5FROA 1IHVA 9ATCB 2CP7A 2JTEA 3FEOA 1E6GA 1QVGS 3RMQA 1KK7A 1AZEA 1GL5A 2YXYA 4M7AE 3GBQA 3S6WA 6AT1B 2FVUA 1ZUKA 3QIIA 4F7UB 3OS0A 4KGZB 3L2RA 1YJWQ 1PNJA 1IXDA 2JS0A 2DD5A 1NPPA 2QEXA 2RNAA 5CQXA 1QVFA 5HK0A 1UG1A 1M3AA 3I55Q 1BBZA 2DILA 2MF2A 3VS4A 1GBRA 3UWNA 3ULRB 3ZBDA 1I5OB 4NL3A 2GNCA 4C92C 1YI2Q 4J9BA 1DJ7B 1N9RA 3C12A 4QVZA 2RQWA 2L0AA 4C8QB 4HVWA 4AFQC 1KC8C 3CPFA 4QW2A 2E1HA 1PRMC 3ER0A 4J9GA 3CCEA 2KRNA 4NL2A 2XKOC 3OYIA 2JN0A 4QT7A 3CCRT 4C5IA 3KFVA 1QVFS 1H3HA 2LCLA 1BYMA 2A08A 3A8OB 2DL4A 3JCMc 4DEXA 4JZ4A 2X9HA 5A2QE 2EQUA 2KT8A 2ZPHB 1JRIA 3HFOA 3QBYA 3H6ZA 5C6SA 5I2MA 4FYXB 1LJOA 3RBBB 4M75D 4PLLA 1BKBA 2NUTB 3OYDA 3G4ST 5GAOm 2XI9A 3V7SA 1OU9A 2R5AA 1U1TA 2RJCA 1K4US 1UJ0A 1LVKA 1QLYA 4XTZA 4RG2A 4N4IA 4EIKA 3OYAA 1BI3A 1VQ6A 3VUBA 5GAN2 1A0NB 2E6NA 2W0ZA 1YJNQ 4ESRA 4PJOB 3HFNA 1X6BA 1XTDA 4NS5A 5GAMg 3TREA 4F16A 4DQ2A 4N0AC 2LCSA 1OQKA 1Q81U 3P8DA 2QK0A 1FMVA 2DBKA 3HRTA 1I07A 3CC7Q 8ATCB 1NJIC 1LPLA 3MEUA 5D6WA 1GCQC 2DXBA 3NPFA 2R57A 1UGRB 2DL3A 1QVGP 5GJWB 4XTWA 1MMAA 4BE1A 1WNLA 2RQVA 2LP5A 1Q82U 2DETA 3C4SA 2XHCA 2O2OA 3CBPA 2KXCA 1QW1A 2RJFA 3TVTA 2LTOA 1BU1A 1PM3A 1ACMB 2HCKA 1P92A 2QEXT 3CCJA 4E7LA 4A53A 2DL8A 2LQKA 2M1HA 5GAN8 4A4KA 4J7FA 4XQ3A 3EH2A 2X4XA 1VQ5A 4J9IA 2E65A 3FIFA 1Y96B 2FL7A 4F7UF 3JCMh 4IUVA 2B86A 2DZ9A 3JCMV 3EFRA 5GANg 3EG9A 3MP1A 3DKMA 3CCET 4OB2B 3X28B 5GMKm 1UTIA 1WZOA 5L8RE 3OYHA 2QA4Q 1AWJA 5CQYA 4M77D 2GF7A 3SB2A 2IPOB 2KSSA 4C8QF 2DZCA 3CXCP 1JU5C 5KYXA 3I56A 4M78B 1MMGA 4RTXA 4E7SA 5IT9E 2DL5A 2RI5A 2LQWA 2RK1A 1IO6A 1I1JA 4BACA 2BKDN 5CKBA 3L42A 3CCQA 2AZSA 4N4HA 1V29B 1D1BA 1X2KA 2ENMA 3V7RA 1VQLA 3NMZC 1VQ6T 3G71A 3JCMX 1RACB 1GRIA 4LDUA 2LT4A 3LYIA 4D6WA 4BDYA 2G3RA 4J8OA 2HEQA 2J7IA 2ZPFB 3MEWA 2WACA 3DB4A 2JM9A 2DLPA 4L59A 2L3SA 1IHWA 4PJOF 3IQLA 3VRZA 1M1GA 1TOVA 4E47A 3EG2A 2BE7D 2RPNA 2FPDA 1WDXA 2D1XA 2RJEA 4C92B 1Y07A 3V7CA 2EFIA 3I5RA 1BCOA 4JRKA 3CCJT 5AT1B 1JBMA 4R55A 1Y57A 4M75F 1G2BA 1V1CA 3LWHA 4RTVA 5GAMd 2VV5A 1QMCA 1VQ5T 3EGDA 3CC4A 5FU7C 1WQWA 5LJ3g 2FHDA 2DRMA 4J6WA 4AG2C 1ZSZC 2X4YA 1BB9A 1GFCA 5CCAA 4JS5A 3CC2T 1B3QA 1EZZB 1W70A 3CCSA 3CCMQ 2CZ1B 2DNUA 2DXCA 3UA7A 1MUZA 2HKNA 4D8DA 1QVPA 3I56T 1K9MR 2OAUA 4BY6C 4ELZC 1X01A 2HSEB 3EGXA 1M90R 1RABB 2BTTA 3H0IA 2QDLA 1VQ8A 1K8AU 3E9GA 3QDRB 2C06A 2DVEA 1XQHA 3CCQT 1TWBA 3UA6A 3WVEB 2EGEA 4II1A 2CP3A 3M57A 2X3WD 4M78F 1VQKQ 3G71T 2DAQA 4RTUA 5GAMj 1Z9ZA 2CP2A 2YRDA 4LD9K 3OA6A 4E7KA 5GANd 3QG1A 3OW2A 1G8XA 2L8DA 1U1SA 4C0FA 3M0UA 3G6EQ 4BI8B 2Z0WA 1TXQA 1S72A 1JXMA 3BE3A 1AEYA 1YITQ 4RCCA 3EFOA 3CCVQ 1C1AA 4BD3A 5CAIA 2RHYA 2O88A 4E7JA 4KH1B 1WX6A 3PGGA 3CCLT 5KYWB 3VRYA 5GMKj 3DLMA 2CGHA 2NUPB 4X1VA 4M77F 4M7AA 3MP8A 4C5HA 3OYGA 1VYTA 1PHTA 2DBMA 2AHJB 3C0CA 3TU4K 1PG5B 3O8VA 2NYSA 2DXUA 3CMAQ 3JCMf 1BIAA 2MMPA 2A37A 4M7DD 4HXJA 4A63B 1N27A 2DEUA 2A36A 1YHQT 4EPCA 3H41A 4QVCA 2DEQA 4O5VA 1VQ7A 2E6ZA 2EYWA 2K5IA 2YUNA 1VQ9Q 2E10A 1M90C 1PWTA 2C0IA 1M8VA 1Q86C 3X24B 1KC8U 2AKLA 1HSQA 1YP5A 3P8BB 2WSFE 3PMIA 3EHRA 1BI0A 1UEBA 4LDXA 2ATCB 3WXMB 3OB9A 1VQMT 1K73R 4X9DA 4PLIA 1IGQA 1N8RC 4J9CA 3CD6Q 4ATOA 1UECA 2E12A 3CCST 4ZN3A 3GOXA 4XTXA 2FPFA 1M1FA 2I0NA 4KGVB 2CZ0B 1K0SA 2B8AA 1AWXA 1VQOA 1JXOA 2HQHA 2KVQG 5KYUA 2QI2A 1YIJT 2JXBA 2AIRB 2BZ8A 4QQ6A 2VVKA 3RESA 1KD1C 4EMKA 4UC4A 3EG0A 1D0YA 3PE0A 2OTJQ 2XDPA 3PT9A 1BCMA 3JB9D 1OZ2A 1Q7YC 1UHFA 4IURA 1KQSS 1D3BA 3L2ZA 4MZPA 5IHKA 4M75A 5KYYA 2F2WA 5LJ3d 1WLPB 2X3XD 1SKUB 3G7ZA 5KE2A 1OPKA 4EMGA 3JCMe 1MNEA 3CMEQ 3NGPA 1AOJA 1M9SA 3QDFA 1ZHIA 1NJIU 1KJWA 3SWNC 1M4ZA 5CK9A 2VKNA 2JM8A 1BI1A 2CKKA 2RN8A 1T3LA 1X27A 4JS4A 3AT1B 3H9NA 2CYZB 4IUQA 2K9GA 4AFZC 4OGEA 1HYOA 2CDTA 1WJQA 2PVGB 3M58A 2ROLA 3VS5A 4K11A 4J7IA 1R0BG 1JJ2S 2EVRA 3OYLA 4F7UE 1IRXA 4A54A 4HT9A 2RM4A 2HSPA 4L6V5 1B07A 1MHNA 5LL6S 4J5YA 4C8QD 1TTHB 2EAYA 3M0PA 4N4GA 5FU7B 1M27C 1VQ7T 3M0RA 2AT1B 2GTJA 1ZSZB 3CCRQ 1PD0A 1UUEA 5LJ3j 2QAZA 1NYFA 5FW9A 4PNOA 4C8QE 4RCBA 1RLQC 4RTYA 3LWIA 2JMAA 3EHQA 4PL6A 2LMJA 2P0PA 3PNWC 3QZ9B 1W2BS 2KAFA 4IUTA 5ECAA 5HKCA 4PFPA 3OSSC 2R58A 1M30A 2KT1A 3QJ6A 2GQVA 2HBWA 2QQ9A 3TQ7P 4BY6B 4PFZA 2ZPGB 5CVIA 2DYIA 2RI2A 3OYCA 4FIBA 2ECZA 1VQOT 2FPEA 3CCUQ 2JJ9A 3FRNA 1WYXA 2CP6A 3VS1A 5FLXE 1VQ4Q 3REBB 4A4GA 5LJ5d 1YJNA 4M77A 2JMCA 4M4ZA 4PJOD 1OULA 4CI0C 2D0QB 2KNBB 3MCAB 4XU0A 5A0GA 3TCJA 4HCBA 1KQSP 1H641 3CC7A 3D7SB 4OGCA 4OP0A 2V8KA 4IIMA 1NE8A 4M7DF 2YT6A 3A5ZB 2VASA 2DD4A 2EW3A 2E41A 3FC3A 2O9SA 5CKHA 1B34A 2CSQA 2LQ8A 3OS1A 1IGUA 3OMGA 2EKOA 1GFDA 1RAHB 4AT1B 2VUBA 2QASA 3UPUA 2MI6A 3CPWA 2DL7A 4KGXB 2DX1A 1YJWT 2ZGWA 4Q5WA 2KI7A 3OY9A 4HT8A 4M75E 5CIUA 2K6DA 2ABLA 3BDUA 5FU6B 2RB6A 2OTLQ 4FM4B 3I55T 2RQRA 1JJ2P 3PMTA 3LH0A 3LH5A 3BFMA 3JCMb 2D0NA 3MJXA 2JVVA 2KBTA 2PUOB 3ME9A 5LJ5j 1NZ9A 3GNGA 3HPWA 4R0KA 5GAN3 4JJDA 4GLMA 4Z88A 3PVQA 5I21A 1BI2A 1MGQA 3CEYA 2KDSA 2KEAA 3QZ5B 2QQRA 2A3LA 2EYZA 1MV3A 3UT1A 1RI9A 1G3YA 2FEIA 1FXXA 3JB9F 2E5QA 1UGQB 1G3SA 1HXDA 2MWPA 3M0QA 1W2BP 4RTZA 3RKWA 4DBHA 5FRMA 3G1JA 3LGLA 4M78D 4F04B 4MMKA 3TSWA 4ZTJA 2KY9A 2EYXA 4O6JA 2JTFA 3X20B 2ED0A 3OYNA 4PJNA 2E3HA 1VQPA 2EYQA 3SFMA 3QSUA 4M78E 2E4HA 2MAMA 1G83A 4Y28E 3AHUA 2COWA 3I9QA 4KUDK 1RAEB 2VB6A 3M59A 5I11A 1YJNT 1PSFA 4FW2A 2BZYA 4PJJA 3QWXX 4PJLA 1YJ9Q 4RMOA 3L1AA 4PJMA 1QVFP 3CC2A 2D6FA 1ZUYA 1AD5A 3CC7T 4Z02A 3MKDA 1ZA2B 2YSQA 3SWNB 4HCCA 1RAGB 1QP2A 1ABQA 1G5VA 3HP9A 3FJ5A 5HY6A 1VUBA 1K0XA 2DE0X 4HA8A 2VXEA 3RNJA 4JLGA 4M77E 1UB4A 3NFCA 1Q81R 1UGPB 4IIOA 2KGTA 4L5GA 4FCYA 3PFSA 4M7AG 5GMKe 1QP3A 3UDCA 1R77A 2CREA 4GLKA 4C92D 1OOTA 5GJVB 2AZVA 5GAN5 2J6FA 2Y4YA 1AWWA 1WJSA 2EKHA 1Q82R 1U3OA 3QKJA 3OYYA 2P84A 4AFUC 3VU3C 1T3SA 2EGAA 4AFSC 1EFNA 4GY5A 2RHZA 1VQNA 2E64A 4JJCA 3JRZA 1FMWA 4A4FA 1TH7A 4A4HA 2LVMA 1M90U 4MDWA 4HVVA 3CCLA 3F70A 5CR2A 1Q86U 2YDLA 3CCMA 3HSBA 2HMAA 2QA4T 4OMNA 4M7DA 2XDBA 1K76A 4IUUA 2LJ3A 2DRKA 5DLOA 2FRWA 2BE9B 3URGA 1N8RU 3T9NA 3DB3A 2E5KA 4CC4B 2JT4A 3EH1A 1YHQA 3RR6A 1I5LA 4DEYA 2O4XA 2F5TX 2J05A 1RAAB 1VQPT 1G3TA 3VS7A 2RF0A 2O9VA 1I8FA 3EFSA 1VQLQ 2ZAEA 5GAN4 1D09B 2FG0A 1O9SA 4DA4A 4A4EA 2QGGA 4XU2A 3G71Q 2YLCA 2ROTA 2DM1A 1KD1U 2CUBA 1GCPA 1B7TA 1VQMA 4MZMA 4J6YA 2RJDA 1X75C 2W10A 2Y90A 3REAB 1Q7YU 4MDXA 3JB9I 3G6EA 2VC8A 2O31A 3OBYA 1E7OA 3H0FA 2P0QA 5GAOr 1ABOA 1M2VA 2LCCA 2VGNA 1YITA 4EMHA 2EQIA 3CCVA 4JDSA 2DJQA 3RMSA 3JCMP 1YIJA 1LOJA 2WSEE 1C0MA 2H8HA 3QYHB 5KH6A 5HCKA 1M8MA 2FYKA 2HKQB 1V76A 2DF6A 3OYKA 4ZGDB 1OYXA 3M55A 1WJRA 3GPLA 1OI1A 2YRVA 2L3RA 2LJ0A 4QQGA 2KYMA 2DTIA 2X4JA 2L89A 1ZBXA 2DXTA 4OB1B 3OS5A 1VQ9A 3RIRA 2NLUA 3L2WA 2E3IA 4LNPA 1SHFA 2L3PA 4F7UA 1W4SA 4M7AC 3CC4Q 2EPDA 1SSHA 2MCNA 1VQNT 2M16A 1D1CA 4BI4A 4JJNK 1I4K1 2X51A 2EJGA 1PRLC 2RHIA 2L3QA 5D7UA 3A98A 3VKIA 3CCSQ 3CCMT 2RHXA 4KBMB 2J06A 3EG9B 1WGSA 4C8QA 2HDAA 2EWNA 5GAOq 2OX7A 4JZ3A 1WA7A 3OW2S 1PKSA 3FLGA 3CBMA 5GAOn 1RAFB 1QCFA 2OAWA 4E2FB 1NLPC 4LXCA 2YUPA 3A8LB 2YLBA 3META 5GAMh 2FZCB 5KYXB 1K9MC 4M77G 1HD3A 1VQ8Q 2OJ2A 3PVLA 4PKCC 2JZ2A 2MK5A 2OI3A 2OTJA 1PC0A 3NTIA 1F1BB 3MPUB 4M7DE 4V2SA 4C92F 1UJYA 5GANj 3N5BB 1VQKT 1VIFA 1GXIE 5CKEA 1KHCA 1YBYA 3JCMg 2NUTA 4BUGA 4Y91A 4HVUA 1M1KR 1WPYA 5GMKh 1CKBA 1QWEA 3G6ET 4EMKC 1VA7A 4KUIA 2GFUA 1RUWA 4JRIA 4X9CA 1S72Q 3S3MA 4KH0B 4CC7A 1YITT 3CCVT 4PJOA 3L2VA 3V8JA 2K2MA 2XD0A 4M75C 4B9XA 4J83A 2H3JA 4F17A 4GBQA 1TU0B 2QGFB 1NBEB 4WTOB 1WHJA 2PVOB 5D6YA 3M4GA 5A0LA 2XDDA 3Q1JA 2EQJA 5GANh 4RKUE 1TUCA 3GIBA 3SD4A 2H3EB 1BIBA 5LJ5e 1K9AA 1NPRA 1RAIB 2M02A 4KULA 1HJDA 3I5SA 4E7IA 4B6MA 2LRQA 1VQ9T 2YWWA 3DLLA 1XNIA 1NYGA 1RI0A 2G6FX 2QTVA 2K7AA 3NTKA 4BDZA 1M3BA 4LUDA 3JSCA 1YJWA 2K5FA 4HKEA 3EGDB 2LZ6B 1X2QA 4J6XA 4NOYA 3CD6T 3KBGA 4OMLA 3I55A 3TSZA 3V8LA 1LNXA 1Y96A 2PUKB 2NWMA 2CH4A 1KQ2A 3OW2P 2DPPB 1K73C 2GBQA 2P4RA 2HNIA 4ORZA 2QYZA 1OZ3A 2F2VA 3E9FA 1Z9QA 1KC8R 1YI2A 3JCMW 2KRSA 2RHUA 3HRUA 4C0ZA 1CKAA 1NG2A 1YFNA 4FL6A 2GQIA 1T0HA 1WFWA 1QVGA 1JEGA 1VQ4A 2KR3A 3QJYA 1HK9A 2FZKB 4WF2A 1UGSB 1SSFA 1WHKA 3CQTA 2LNHB 3HTRA 4XTVA 2OTJT 1PD1A 3EGXB 3OQ5A 2M0OA 4CRIA 1TSFA 2VXFA 1OEBA 4M78A 1ARKA 2KE9A 3UATA 3ZL7C 4J9FA 1UE9A 2EJFA 5IXBA 3LGFA 2PZ1A 1NLOC 3CMET 1EX4A 4M77C 3J7AF 1N6AA 3G4SQ 2JNGA 1AZGB 4JRQA 3MO8A 1SF9A 3JB9H 2QG9B 1WI7A 5GMKl 3SEMA 2MPXC 2RQTA 5AYFA 2HBPA 1JB0E 4R56A 3C94A 1IREB 2JW4A 4LD6A 2DIGA 4JUVA 3S3NA 3EFOB 2OTLA 2K3YA 2IIMA 1NJIR 4DBFA 3GF5A 1UFFA 8AT1B 2DERA 5A0DA 3VYGA 2LJ1A 3CXCA 5LJ3h 1QKXA 4HCZA 2YRCA 3MEAA 3H0HA 4C0GA 2BUDA 4M7AB 4PJOE 2VYTA 2HQEA 3JCMJ 4DBRA 5IH2A 3U23A 5GAN7 3E2UA 3JCMd 2XU8A 4RTWA 3RKXA 4EDUA 3S3OA 1G3WA 5KCHA 4C92A 2DVJA 3HL8A 2A7YA 4Z8AA 2CP5A 3M54A 4M7DG 1QQJA 2MYSA 1YWOA 1VYVA 5DLQE 5I2SA 4DBQA 3EGUA 3CXCS 1WHGA 1D0XA 4FYYB 2HQXA 3I35A 2KROA 2QEXQ 1YNZA 1KG1A 1RL2A 5GAMf 2KMTA 5D6XA 2V1RA 1QCNA 1D0ZA 2DA9A 5J26A 3THKA 2K4YA 4XAXB 1Y7XA 1YN8A 1MMNA
chains in the Genus database with same CATH topology
2PNIA 2EGCA 4AFUC 1JXMA 1U5SA 3EG3A 1T3SA 2EGAA 1AEYA 4AFSC 3M0TA 1EFNA 3QWYA 4OMMA 1OV3A 4JJCA 2O88A 1W6XA 3NHNA 1OPLA 3O5ZA 2M0YA 1WX6A 2J6KA 4HVVA 3VRYA 1GBQA 2FO0A 2YDLA 3UF4A 4OMNA 4X1VA 1K76A 2LJ3A 1VYTA 1PHTA 1QWFA 1TG0A 1K1ZA 2DBMA 2DRKA 1LCKA 3C0CA 2FRWA 1SPKA 2A37A 2K3BA 1CSKA 2MIOA 2E5KA 4HXJA 1XOVA 4A63B 4CC4B 2A36A 4Y92A 3H41A 2JT4A 4J9DA 2EYWA 2JTEA 2YUNA 1E6GA 4DEYA 2J05A 1X6GA 1PWTA 2C0IA 3VS7A 2C0OA 2RF0A 1AZEA 2O9VA 1GL5A 2AK5A 3GBQA 1GCQA 4ZNXA 1UHCA 1HSQA 2AKLA 2FG0A 1ZUKA 1YP5A 4CC3A 3EHRA 5IXFA 1PNJA 2JS0A 2D8JA 2ROTA 2DM1A 2RNAA 2CUBA 1GCPA 2VWFA 1UG1A 4J9CA 4JPBW 1M3AA 1BK2A 1BBZA 2PTKA 1UECA 2CSIA 2W10A 2DILA 3VS4A 3REAB 1GBRA 3ULRB 3M0SA 4KRTA 2FPFA 2GNCA 2O31A 1E7OA 3H0FA 2I0NA 4J9BA 1ABOA 1K0SA 1AWXA 5I22A 1JXOA 2RQWA 2KYBA 2EQIA 2L0AA 4HVWA 2DYBA 4AFQC 2GGRA 2DJQA 1PRMC 2JXBA 3EG1A 4J9GA 2KRNA 2BZ8A 5FWCA 2H8HA 4LUEA 2VVKA 4E6RA 5HCKA 4QT7A 1M8MA 3EG0A 3KFVA 1H3HA 3VS2A 3PE0A 4AG1C 1X69A 2A08A 2DL4A 4DEXA 4OMPA 1WXBA 2DF6A 4JZ4A 1UHFA 5IHKA 2KT8A 2LJ0A 2F2WA 2M51A 1WLPB 2KYMA 2X3XD 1OPKA 3RBBB 3NGPA 4WCIA 1AOJA 2L2PA 1KJWA 4LNPA 1SHFA 2L3PA 2VKNA 1K4US 1UJ0A 1T0JA 1QLYA 2JM8A 2J6OA 2EPDA 2KXDA 1NM7A 1SSHA 2F2XA 4EIKA 1FMKA 2XMFA 2MCNA 2RN8A 1T3LA 1X27A 1ZLMA 3VS0A 1A0NB 1PRLC 1NEBA 2K9GA 2W0ZA 4AFZC 4ESRA 2L3QA 1WXUA 1X6BA 3A98A 2CDTA 4F16A 2BZXA 2LCSA 2J06A 2ROLA 3VS5A 4K11A 2EVRA 2HDAA 4JZ3A 1WA7A 2DBKA 1I07A 1PKSA 2HSPA 2ED1A 1GCQC 1QCFA 2OAWA 1B07A 1NLPC 3NPFA 2YUPA 3M0PA 1SRMA 2SEMA 2DL3A 2RQUA 1M27C 3M0RA 5GJWB 1HD3A 2GTJA 2OJ2A 2RQVA 1Y0MA 3PVLA 2LP5A 1UGVA 2OI3A 1UUEA 1TUDA 1NYFA 5FW9A 2O2OA 1RLQC 2KXCA 1UJYA 4RTYA 2GTOA 1UDLA 2JMAA 3EHQA 3TVTA 2LMJA 1BU1A 2HCKA 1PKTA 5ECAA 1SHGA 4OMOA 1YCSB 4HVUA 1M30A 2KT1A 2DL8A 2HBWA 1KIKA 2C0TA 1CKBA 1QWEA 2K79A 4LE9A 1VA7A 4OMQA 1W1FA 1RUWA 2FRYA 1U06A 4D8KA 4CC7A 4J9IA 1ZUUA 2ECZA 2FPEA 1KFZA 1WYXA 1X43A 2K2MA 2B86A 1N5ZA 3VS1A 2V1QA 3REBB 2A28A 1ZSGA 1JQQA 4F17A 2CH4W 2JMCA 4M4ZA 2KRMA 4GBQA 2KNBB 5IHNA 1UTIA 1I0CA 3VS6A 1AWJA 5FWBA 1JU5C 4IIMA 1QKWA 2YUQA 1TUCA 2YT6A 2MOXA 1K9AA 4RTXA 2EW3A 2O9SA 2DL5A 1HJDA 3I5SA 1E6HA 2LQWA 1WIEA 1IO6A 1I1JA 2CSQA 4F14A 2AZSA 1VYUA 1GFDA 1NYGA 1X2KA 2ENMA 2D8HA 2G6FX 2LQNA 5IHIA 2K7AA 2DL7A 2DX1A 3NMZC 1M3BA 4LUDA 1GRIA 2K6DA 2ABLA 2ESWA 2LZ6B 1X2QA 1NEGA 2RQRA 3JV3A 4OMLA 3TSZA 5EC7A 2HEQA 2J7IA 2JS2A 2NWMA 2CH4A 3LH5A 2D0NA 2GBQA 2P4RA 4LN2A 4ORZA 2F2VA 1Z9QA 2JM9A 2KBTA 4JJBA 2KRSA 1AWOA 1CKAA 1NG2A 2DLPA 5L23A 4R0KA 2L3SA 2GQIA 1SRLA 1T0HA 1WFWA 4GLMA 3PVQA 1FYNA 4JJDA 2CT4A 4Z88A 1JEGA 1WXTA 2KR3A 3IQLA 3VRZA 2KEAA 2EYZA 1MV3A 3CQTA 2LNHB 2CT3A 2SRCA 1RI9A 2FEIA 3EG2A 1OEBA 1ARKA 2RPNA 2KE9A 3UATA 3ZL7C 4J9FA 1UE9A 2FPDA 1WDXA 1AVZC 3M0QA 2D1XA 5IXBA 4RTZA 3I5RA 2PZ1A 3TSWA 4HCKA 3VS3A 2NUZA 1Y57A 1NLOC 2EYXA 1S1NA 1YWPA 1G2BA 1V1CA 2ED0A 4RTVA 1AZGB 1WI7A 2CUDA 2EBPA 2RMOA 1G83A 3SEMA 2RQTA 2DMOA 3I9QA 1MV0B 2DRMA 3R6NA 1JO8A 2JW4A 1ZX6A 5I11A 4AG2C 1BB9A 1GFCA 4FSSA 2EYYA 2BZYA 3QWXX 2YUOA 3SHWA 2IIMA 1B3QA 1W70A 1UFFA 1H92A 2DNUA 1ZUYA 4CC2A 1SEMA 2LJ1A 1AD5A 4Z89A 1QKXA 3UA7A 1MUZA 2YSQA 4D8DA 3H0HA 1ABQA 3FJ5A 1K0XA 5IH2A 2DE0X 3U23A 4RUGA 2BTTA 3H0IA 3RNJA 1H8KA 2QDLA 4RTWA 1ZBJA 2LX7A 4IIOA 2KGTA 2DVJA 3UA6A 2EGEA 4Z8AA 1YWOA 1VYVA 2X3WD 2CREA 1RLPC 3EGUA 4J9HA 1OOTA 4RTUA 1KSWA 5GJVB 1Z9ZA 2AKKA 2AZVA 2KROA 3I35A 1YNZA 2J6FA 1AWWA 1J3TA 4RTTA 2EKHA 2V1RA 2DA9A 1U3OA 3M0UA 4J9EA 3THKA 1M3CA 1YN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNI A;  2EGC A;  4AFU C;  1JXM A;  1U5S A;  3EG3 A;  1T3S A;  2EGA A;  1AEY A;  4AFS C;  3M0T A;  1EFN A;  3QWY A;  4OMM A;  1OV3 A;  4JJC A;  2O88 A;  1W6X A;  3NHN A;  1OPL A;  3O5Z A;  2M0Y A;  1WX6 A;  2J6K A;  4HVV A;  3VRY A;  1GBQ A;  2FO0 A;  2YDL A;  3UF4 A;  4OMN A;  4X1V A;  1K76 A;  2LJ3 A;  1VYT A;  1PHT A;  1QWF A;  1TG0 A;  1K1Z A;  2DBM A;  2DRK A;  1LCK A;  3C0C A;  2FRW A;  1SPK A;  2A37 A;  2K3B A;  1CSK A;  2MIO A;  2E5K A;  4HXJ A;  1XOV A;  4A63 B;  4CC4 B;  2A36 A;  4Y92 A;  3H41 A;  2JT4 A;  4J9D A;  2EYW A;  2JTE A;  2YUN A;  1E6G A;  4DEY A;  2J05 A;  1X6G A;  1PWT A;  2C0I A;  3VS7 A;  2C0O A;  2RF0 A;  1AZE A;  2O9V A;  1GL5 A;  2AK5 A;  3GBQ A;  1GCQ A;  4ZNX A;  1UHC A;  1HSQ A;  2AKL A;  2FG0 A;  1ZUK A;  1YP5 A;  4CC3 A;  3EHR A;  5IXF A;  1PNJ A;  2JS0 A;  2D8J A;  2ROT A;  2DM1 A;  2RNA A;  2CUB A;  1GCP A;  2VWF A;  1UG1 A;  4J9C A;  4JPB W;  1M3A A;  1BK2 A;  1BBZ A;  2PTK A;  1UEC A;  2CSI A;  2W10 A;  2DIL A;  3VS4 A;  3REA B;  1GBR A;  3ULR B;  3M0S A;  4KRT A;  2FPF A;  2GNC A;  2O31 A;  1E7O A;  3H0F A;  2I0N A;  4J9B A;  1ABO A;  1K0S A;  1AWX A;  5I22 A;  1JXO A;  2RQW A;  2KYB A;  2EQI A;  2L0A A;  4HVW A;  2DYB A;  4AFQ C;  2GGR A;  2DJQ A;  1PRM C;  2JXB A;  3EG1 A;  4J9G A;  2KRN A;  2BZ8 A;  5FWC A;  2H8H A;  4LUE A;  2VVK A;  4E6R A;  5HCK A;  4QT7 A;  1M8M A;  3EG0 A;  3KFV A;  1H3H A;  3VS2 A;  3PE0 A;  4AG1 C;  1X69 A;  2A08 A;  2DL4 A;  4DEX A;  4OMP A;  1WXB A;  2DF6 A;  4JZ4 A;  1UHF A;  5IHK A;  2KT8 A;  2LJ0 A;  2F2W A;  2M51 A;  1WLP B;  2KYM A;  2X3X D;  1OPK A;  3RBB B;  3NGP A;  4WCI A;  1AOJ A;  2L2P A;  1KJW A;  4LNP A;  1SHF A;  2L3P A;  2VKN A;  1K4U S;  1UJ0 A;  1T0J A;  1QLY A;  2JM8 A;  2J6O A;  2EPD A;  2KXD A;  1NM7 A;  1SSH A;  2F2X A;  4EIK A;  1FMK A;  2XMF A;  2MCN A;  2RN8 A;  1T3L A;  1X27 A;  1ZLM A;  3VS0 A;  1A0N B;  1PRL C;  1NEB A;  2K9G A;  2W0Z A;  4AFZ C;  4ESR A;  2L3Q A;  1WXU A;  1X6B A;  3A98 A;  2CDT A;  4F16 A;  2BZX A;  2LCS A;  2J06 A;  2ROL A;  3VS5 A;  4K11 A;  2EVR A;  2HDA A;  4JZ3 A;  1WA7 A;  2DBK A;  1I07 A;  1PKS A;  2HSP A;  2ED1 A;  1GCQ C;  1QCF A;  2OAW A;  1B07 A;  1NLP C;  3NPF A;  2YUP A;  3M0P A;  1SRM A;  2SEM A;  2DL3 A;  2RQU A;  1M27 C;  3M0R A;  5GJW B;  1HD3 A;  2GTJ A;  2OJ2 A;  2RQV A;  1Y0M A;  3PVL A;  2LP5 A;  1UGV A;  2OI3 A;  1UUE A;  1TUD A;  1NYF A;  5FW9 A;  2O2O A;  1RLQ C;  2KXC A;  1UJY A;  4RTY A;  2GTO A;  1UDL A;  2JMA A;  3EHQ A;  3TVT A;  2LMJ A;  1BU1 A;  2HCK A;  1PKT A;  5ECA A;  1SHG A;  4OMO A;  1YCS B;  4HVU A;  1M30 A;  2KT1 A;  2DL8 A;  2HBW A;  1KIK A;  2C0T A;  1CKB A;  1QWE A;  2K79 A;  4LE9 A;  1VA7 A;  4OMQ A;  1W1F A;  1RUW A;  2FRY A;  1U06 A;  4D8K A;  4CC7 A;  4J9I A;  1ZUU A;  2ECZ A;  2FPE A;  1KFZ A;  1WYX A;  1X43 A;  2K2M A;  2B86 A;  1N5Z A;  3VS1 A;  2V1Q A;  3REB B;  2A28 A;  1ZSG A;  1JQQ A;  4F17 A;  2CH4 W;  2JMC A;  4M4Z A;  2KRM A;  4GBQ A;  2KNB B;  5IHN A;  1UTI A;  1I0C A;  3VS6 A;  1AWJ A;  5FWB A;  1JU5 C;  4IIM A;  1QKW A;  2YUQ A;  1TUC A;  2YT6 A;  2MOX A;  1K9A A;  4RTX A;  2EW3 A;  2O9S A;  2DL5 A;  1HJD A;  3I5S A;  1E6H A;  2LQW A;  1WIE A;  1IO6 A;  1I1J A;  2CSQ A;  4F14 A;  2AZS A;  1VYU A;  1GFD A;  1NYG A;  1X2K A;  2ENM A;  2D8H A;  2G6F X;  2LQN A;  5IHI A;  2K7A A;  2DL7 A;  2DX1 A;  3NMZ C;  1M3B A;  4LUD A;  1GRI A;  2K6D A;  2ABL A;  2ESW A;  2LZ6 B;  1X2Q A;  1NEG A;  2RQR A;  3JV3 A;  4OML A;  3TSZ A;  5EC7 A;  2HEQ A;  2J7I A;  2JS2 A;  2NWM A;  2CH4 A;  3LH5 A;  2D0N A;  2GBQ A;  2P4R A;  4LN2 A;  4ORZ A;  2F2V A;  1Z9Q A;  2JM9 A;  2KBT A;  4JJB A;  2KRS A;  1AWO A;  1CKA A;  1NG2 A;  2DLP A;  5L23 A;  4R0K A;  2L3S A;  2GQI A;  1SRL A;  1T0H A;  1WFW A;  4GLM A;  3PVQ A;  1FYN A;  4JJD A;  2CT4 A;  4Z88 A;  1JEG A;  1WXT A;  2KR3 A;  3IQL A;  3VRZ A;  2KEA A;  2EYZ A;  1MV3 A;  3CQT A;  2LNH B;  2CT3 A;  2SRC A;  1RI9 A;  2FEI A;  3EG2 A;  1OEB A;  1ARK A;  2RPN A;  2KE9 A;  3UAT A;  3ZL7 C;  4J9F A;  1UE9 A;  2FPD A;  1WDX A;  1AVZ C;  3M0Q A;  2D1X A;  5IXB A;  4RTZ A;  3I5R A;  2PZ1 A;  3TSW A;  4HCK A;  3VS3 A;  2NUZ A;  1Y57 A;  1NLO C;  2EYX A;  1S1N A;  1YWP A;  1G2B A;  1V1C A;  2ED0 A;  4RTV A;  1AZG B;  1WI7 A;  2CUD A;  2EBP A;  2RMO A;  1G83 A;  3SEM A;  2RQT A;  2DMO A;  3I9Q A;  1MV0 B;  2DRM A;  3R6N A;  1JO8 A;  2JW4 A;  1ZX6 A;  5I11 A;  4AG2 C;  1BB9 A;  1GFC A;  4FSS A;  2EYY A;  2BZY A;  3QWX X;  2YUO A;  3SHW A;  2IIM A;  1B3Q A;  1W70 A;  1UFF A;  1H92 A;  2DNU A;  1ZUY A;  4CC2 A;  1SEM A;  2LJ1 A;  1AD5 A;  4Z89 A;  1QKX A;  3UA7 A;  1MUZ A;  2YSQ A;  4D8D A;  3H0H A;  1ABQ A;  3FJ5 A;  1K0X A;  5IH2 A;  2DE0 X;  3U23 A;  4RUG A;  2BTT A;  3H0I A;  3RNJ A;  1H8K A;  2QDL A;  4RTW A;  1ZBJ A;  2LX7 A;  4IIO A;  2KGT A;  2DVJ A;  3UA6 A;  2EGE A;  4Z8A A;  1YWO A;  1VYV A;  2X3W D;  2CRE A;  1RLP C;  3EGU A;  4J9H A;  1OOT A;  4RTU A;  1KSW A;  5GJV B;  1Z9Z A;  2AKK A;  2AZV A;  2KRO A;  3I35 A;  1YNZ A;  2J6F A;  1AWW A;  1J3T A;  4RTT A;  2EKH A;  2V1R A;  2DA9 A;  1U3O A;  3M0U A;  4J9E A;  3THK A;  1M3C A;  1YN8 A; 
#chains in the Genus database with same CATH topology
 2EQK A;  4ZN1 A;  3OYB A;  1YI2 T;  1Q95 G;  3TEE A;  2F69 A;  3CCU T;  2PVD B;  3M0T A;  3QWY A;  4FSX A;  4OMM A;  3RUX A;  2PU9 B;  1W6X A;  1VQ4 T;  1OPL A;  4KT0 E;  2M0Y A;  3CPW S;  3CCE Q;  3OSV A;  1YJ9 A;  2RI3 A;  2FO0 A;  1KQ1 A;  5KYU B;  1Y71 A;  4MZT A;  3UF4 A;  2RA2 A;  2QA4 A;  2M9U A;  2QQB A;  3OS2 A;  1QWF A;  1K1Z A;  3A8M B;  4XU3 A;  4EMK B;  2V8I A;  2ZPI B;  3E19 A;  4ZGE B;  4DOW A;  1CSK A;  2MIO A;  2Y4X A;  5GMK i;  1D3B B;  1QCO A;  4Y92 A;  4J9D A;  4M75 B;  3JB9 G;  2FB7 A;  5GAN 6;  5KYY B;  3L2Q A;  4N0A A;  2VGM A;  1X6G A;  2BIV A;  1X6O A;  2I2L A;  3ZFJ A;  2C0O A;  5IAY A;  3QO3 A;  2AK5 A;  1GCQ A;  2ZPE B;  4ZNX A;  3V8K A;  1UHC A;  2LDM A;  5LJ5 h;  1OU8 A;  4ZTF A;  1FWZ A;  2A0F B;  1VOM A;  4CC3 A;  5GAN f;  5IXF A;  1VQ6 Q;  1C6V X;  2D8J A;  3FB9 A;  2P0K A;  5M9O A;  2DFU A;  2OTL T;  2VWF A;  1TS9 A;  4JPB W;  3MP6 A;  1VIE A;  1BK2 A;  2QTX A;  2PTK A;  2CSI A;  2QDY B;  5GAM e;  3LLR A;  3M0S A;  4KRT A;  2K2V A;  4X34 A;  4F7U G;  4OF1 A;  2DIQ A;  3QHS A;  2D9T A;  5I22 A;  5KYW A;  3KXT A;  2KYB A;  2XG8 D;  4FU6 A;  2DYB A;  2GGR A;  2JTM A;  2NUP A;  3EG1 A;  5KE3 A;  3A8H B;  3C95 A;  5FWC A;  4LUE A;  4C5G A;  4E6R A;  4YTL A;  2DK3 A;  3VS2 A;  4AG1 C;  1X69 A;  4C8Q G;  3R6O A;  5DM7 R;  4OMP A;  1WXB A;  2EIF A;  2KQW A;  3FDR A;  2GFA A;  3MHX A;  1RAD B;  4M7A F;  2CZ7 B;  2M51 A;  2DKG A;  2IVW A;  3CCJ Q;  2L5Q A;  2QQA A;  4QKU A;  3PIP A;  4WCI A;  3QXE B;  2RH2 A;  2K57 A;  3JB9 J;  2L2P A;  5IN1 A;  1VQP Q;  4C0D C;  5C0M A;  5J3B A;  4E7H A;  4M7D C;  4C92 E;  1T0J A;  2J6O A;  1VQ5 Q;  2KXD A;  1NM7 A;  2F2X A;  2ZCF B;  1FMK A;  2XMF A;  2HZY A;  1MMD A;  5KCO A;  3JCM Q;  1K9M U;  3CPW P;  4BI3 A;  2LC4 A;  1ZLM A;  3VS0 A;  1NEB A;  5GAN e;  1WXU A;  1YJ9 T;  4ELY C;  3CC2 Q;  2BZX A;  4PFO A;  4JLI A;  1H3Z A;  3H8Z A;  3QUI A;  4M77 B;  4OMF B;  2HD0 A;  2O01 E;  4FW1 A;  2ED1 A;  4PJO G;  3I56 Q;  4LDV A;  4XK8 E;  4B9W A;  1R8O B;  1SRM A;  2SEM A;  2RQU A;  3OBW A;  3ASK A;  2DO3 A;  4ZGJ B;  3A1P A;  1Y0M A;  1KHI A;  3GP8 A;  3CCQ Q;  1UGV A;  2EQM A;  1B34 B;  1TUD A;  2HL3 A;  4OVA A;  5LJ3 f;  1Q81 C;  2GTO A;  1UDL A;  4ME7 A;  4OB3 B;  1VQK A;  4M75 G;  1PKT A;  2P4T A;  1SG5 A;  4FYW B;  5CO7 A;  1SHG A;  3P8H A;  4OMO A;  1YCS B;  4E7Z A;  1KIK A;  2C0T A;  2EJ9 A;  4MML A;  2K79 A;  3E1S A;  4FYV B;  4LE9 A;  4OMQ A;  3EAE A;  1W1F A;  1AT1 B;  2E70 A;  5EG2 A;  2LNV A;  2FRY A;  1U06 A;  4D8K A;  1ZQ1 A;  1ZUU A;  4PK4 A;  3RER A;  3OYF A;  1Q82 C;  2GCX A;  3L2U A;  1KFZ A;  1VQN Q;  1X43 A;  1OX9 A;  1N5Z A;  1M5Q 1;  2V1Q A;  3RDV A;  5GAO p;  3X25 B;  2A28 A;  3PTA A;  1ZSG A;  1IB8 A;  2RK2 A;  2V26 A;  1JQQ A;  1WHH A;  3CCL Q;  2CH4 W;  2KRM A;  4TVR A;  5IHN A;  2HL5 C;  4LDY A;  4IUP A;  1I0C A;  3VS6 A;  5FWB A;  1D1A A;  1QKW A;  2YUQ A;  2WSC E;  3CMA A;  4RG8 A;  2MOX A;  2JUF A;  1ZSZ A;  2KK4 A;  2ZZD A;  2LT1 A;  2XIC A;  1YHQ Q;  3GNF B;  1K73 U;  1E6H A;  4F14 A;  1WIE A;  1N9S A;  1Q86 R;  1M1K U;  2R5M A;  1U8R A;  2F5K A;  1VYU A;  3LW5 E;  4C8Q C;  4M78 G;  1VQL T;  2CS7 A;  2D8H A;  2LQN A;  5IHI A;  1N8R R;  4XTU A;  3HRS A;  3BDL A;  4OB0 B;  5LJ3 e;  7AT1 B;  2COY A;  2ESW A;  1VQM Q;  1NEG A;  2PQW A;  3JV3 A;  2FZG B;  3CD6 A;  5EC7 A;  2JS2 A;  3GLX A;  4AMC A;  2K5L A;  4BB7 A;  4LN2 A;  4JJB A;  1AWO A;  3M4Y A;  5LJ5 f;  5L23 A;  4P5N A;  3QPH A;  1SRL A;  1FYN A;  2CT4 A;  1KD1 R;  2DTH A;  2QQS A;  1WXT A;  1YIJ Q;  3J80 E;  3VUZ A;  1Q7Y R;  4QQD A;  2CT3 A;  2SRC A;  2DTO A;  1TUG B;  3FJP A;  4XU1 A;  3LX7 A;  1AVZ C;  5FU6 C;  4C5E A;  5LJ5 g;  2F1L A;  4PJO C;  2LX9 A;  3OYE A;  2K3X A;  3QYG B;  4HCK A;  1WHL A;  1XJW B;  3VS3 A;  2NUZ A;  4QVD A;  4XTY A;  1S1N A;  1ZA1 B;  1YWP A;  3CME A;  1K8A R;  2CP0 A;  4C92 G;  1IZ6 A;  3VJP A;  3CC4 T;  1OX8 A;  2CUD A;  2EBP A;  4JRP A;  2RMO A;  1M2O A;  2MWO A;  2DMO A;  3CBO A;  1MV0 B;  3R6N A;  3X26 B;  1JO8 A;  1ZX6 A;  5CKF A;  3SDZ A;  3BY7 A;  4FSS A;  2EYY A;  2YUO A;  3SHW A;  1KQS A;  2COZ A;  1H92 A;  4IKF A;  4CC2 A;  1SEM A;  2V8J A;  1AHJ B;  4Z89 A;  3M56 A;  1WHM A;  2DJZ A;  5CKD A;  3JAM E;  1YCY A;  3HHT B;  1O75 A;  4C0D B;  3CMA T;  1FX7 A;  4M7D B;  5GAO l;  3PIO A;  3J81 E;  3BW1 A;  3M53 A;  3INZ A;  2HAX A;  3KUF A;  4RUG A;  1VQ7 Q;  1VQ8 T;  1R0C B;  4FT4 A;  1H8K A;  1ZBJ A;  2LX7 A;  3WVD B;  2JOY A;  3CCR A;  3OYM A;  3RKY A;  5J39 A;  2O4X B;  5FRN A;  3OMC A;  3ZEH A;  2IG0 A;  4ANJ A;  1RLP C;  2RD1 A;  3VYH B;  4BE0 A;  4J9H A;  1KSW A;  3MEV A;  2AKK A;  5HK3 A;  1PSE A;  1JJ2 A;  3HKS A;  3NTH A;  1J3T A;  2X4W A;  4RTT A;  3OYJ A;  3A8G B;  4J9E A;  3G4S A;  2CZ6 B;  1M3C A;  1S72 T;  2PNI A;  4DOV A;  3M9Q A;  1M1K C;  4M78 C;  2EGC A;  1K8A C;  5KYN A;  1U5S A;  3EG3 A;  2X35 A;  1VQO Q;  3CCU A;  4FT2 A;  1I81 A;  1OV3 A;  3M5A A;  3NHN A;  1M2V B;  3O5Z A;  4VUB A;  1WQ7 A;  2QXF A;  2J6K A;  1GBQ A;  3SWN A;  2ZPB B;  4LDW A;  2XK0 A;  1MND A;  1W2B A;  2XID A;  1TG0 A;  1LCK A;  4BE2 A;  5DY9 A;  3VV0 A;  1SPK A;  2K3B A;  2RO0 A;  2YHT A;  1EIF A;  4M7A D;  1PCX A;  1XOV A;  5FRO A;  1IHV A;  9ATC B;  2CP7 A;  2JTE A;  3FEO A;  1E6G A;  1QVG S;  3RMQ A;  1KK7 A;  1AZE A;  1GL5 A;  2YXY A;  4M7A E;  3GBQ A;  3S6W A;  6AT1 B;  2FVU A;  1ZUK A;  3QII A;  4F7U B;  3OS0 A;  4KGZ B;  3L2R A;  1YJW Q;  1PNJ A;  1IXD A;  2JS0 A;  2DD5 A;  1NPP A;  2QEX A;  2RNA A;  5CQX A;  1QVF A;  5HK0 A;  1UG1 A;  1M3A A;  3I55 Q;  1BBZ A;  2DIL A;  2MF2 A;  3VS4 A;  1GBR A;  3UWN A;  3ULR B;  3ZBD A;  1I5O B;  4NL3 A;  2GNC A;  4C92 C;  1YI2 Q;  4J9B A;  1DJ7 B;  1N9R A;  3C12 A;  4QVZ A;  2RQW A;  2L0A A;  4C8Q B;  4HVW A;  4AFQ C;  1KC8 C;  3CPF A;  4QW2 A;  2E1H A;  1PRM C;  3ER0 A;  4J9G A;  3CCE A;  2KRN A;  4NL2 A;  2XKO C;  3OYI A;  2JN0 A;  4QT7 A;  3CCR T;  4C5I A;  3KFV A;  1QVF S;  1H3H A;  2LCL A;  1BYM A;  2A08 A;  3A8O B;  2DL4 A;  3JCM c;  4DEX A;  4JZ4 A;  2X9H A;  5A2Q E;  2EQU A;  2KT8 A;  2ZPH B;  1JRI A;  3HFO A;  3QBY A;  3H6Z A;  5C6S A;  5I2M A;  4FYX B;  1LJO A;  3RBB B;  4M75 D;  4PLL A;  1BKB A;  2NUT B;  3OYD A;  3G4S T;  5GAO m;  2XI9 A;  3V7S A;  1OU9 A;  2R5A A;  1U1T A;  2RJC A;  1K4U S;  1UJ0 A;  1LVK A;  1QLY A;  4XTZ A;  4RG2 A;  4N4I A;  4EIK A;  3OYA A;  1BI3 A;  1VQ6 A;  3VUB A;  5GAN 2;  1A0N B;  2E6N A;  2W0Z A;  1YJN Q;  4ESR A;  4PJO B;  3HFN A;  1X6B A;  1XTD A;  4NS5 A;  5GAM g;  3TRE A;  4F16 A;  4DQ2 A;  4N0A C;  2LCS A;  1OQK A;  1Q81 U;  3P8D A;  2QK0 A;  1FMV A;  2DBK A;  3HRT A;  1I07 A;  3CC7 Q;  8ATC B;  1NJI C;  1LPL A;  3MEU A;  5D6W A;  1GCQ C;  2DXB A;  3NPF A;  2R57 A;  1UGR B;  2DL3 A;  1QVG P;  5GJW B;  4XTW A;  1MMA A;  4BE1 A;  1WNL A;  2RQV A;  2LP5 A;  1Q82 U;  2DET A;  3C4S A;  2XHC A;  2O2O A;  3CBP A;  2KXC A;  1QW1 A;  2RJF A;  3TVT A;  2LTO A;  1BU1 A;  1PM3 A;  1ACM B;  2HCK A;  1P92 A;  2QEX T;  3CCJ A;  4E7L A;  4A53 A;  2DL8 A;  2LQK A;  2M1H A;  5GAN 8;  4A4K A;  4J7F A;  4XQ3 A;  3EH2 A;  2X4X A;  1VQ5 A;  4J9I A;  2E65 A;  3FIF A;  1Y96 B;  2FL7 A;  4F7U F;  3JCM h;  4IUV A;  2B86 A;  2DZ9 A;  3JCM V;  3EFR A;  5GAN g;  3EG9 A;  3MP1 A;  3DKM A;  3CCE T;  4OB2 B;  3X28 B;  5GMK m;  1UTI A;  1WZO A;  5L8R E;  3OYH A;  2QA4 Q;  1AWJ A;  5CQY A;  4M77 D;  2GF7 A;  3SB2 A;  2IPO B;  2KSS A;  4C8Q F;  2DZC A;  3CXC P;  1JU5 C;  5KYX A;  3I56 A;  4M78 B;  1MMG A;  4RTX A;  4E7S A;  5IT9 E;  2DL5 A;  2RI5 A;  2LQW A;  2RK1 A;  1IO6 A;  1I1J A;  4BAC A;  2BKD N;  5CKB A;  3L42 A;  3CCQ A;  2AZS A;  4N4H A;  1V29 B;  1D1B A;  1X2K A;  2ENM A;  3V7R A;  1VQL A;  3NMZ C;  1VQ6 T;  3G71 A;  3JCM X;  1RAC B;  1GRI A;  4LDU A;  2LT4 A;  3LYI A;  4D6W A;  4BDY A;  2G3R A;  4J8O A;  2HEQ A;  2J7I A;  2ZPF B;  3MEW A;  2WAC A;  3DB4 A;  2JM9 A;  2DLP A;  4L59 A;  2L3S A;  1IHW A;  4PJO F;  3IQL A;  3VRZ A;  1M1G A;  1TOV A;  4E47 A;  3EG2 A;  2BE7 D;  2RPN A;  2FPD A;  1WDX A;  2D1X A;  2RJE A;  4C92 B;  1Y07 A;  3V7C A;  2EFI A;  3I5R A;  1BCO A;  4JRK A;  3CCJ T;  5AT1 B;  1JBM A;  4R55 A;  1Y57 A;  4M75 F;  1G2B A;  1V1C A;  3LWH A;  4RTV A;  5GAM d;  2VV5 A;  1QMC A;  1VQ5 T;  3EGD A;  3CC4 A;  5FU7 C;  1WQW A;  5LJ3 g;  2FHD A;  2DRM A;  4J6W A;  4AG2 C;  1ZSZ C;  2X4Y A;  1BB9 A;  1GFC A;  5CCA A;  4JS5 A;  3CC2 T;  1B3Q A;  1EZZ B;  1W70 A;  3CCS A;  3CCM Q;  2CZ1 B;  2DNU A;  2DXC A;  3UA7 A;  1MUZ A;  2HKN A;  4D8D A;  1QVP A;  3I56 T;  1K9M R;  2OAU A;  4BY6 C;  4ELZ C;  1X01 A;  2HSE B;  3EGX A;  1M90 R;  1RAB B;  2BTT A;  3H0I A;  2QDL A;  1VQ8 A;  1K8A U;  3E9G A;  3QDR B;  2C06 A;  2DVE A;  1XQH A;  3CCQ T;  1TWB A;  3UA6 A;  3WVE B;  2EGE A;  4II1 A;  2CP3 A;  3M57 A;  2X3W D;  4M78 F;  1VQK Q;  3G71 T;  2DAQ A;  4RTU A;  5GAM j;  1Z9Z A;  2CP2 A;  2YRD A;  4LD9 K;  3OA6 A;  4E7K A;  5GAN d;  3QG1 A;  3OW2 A;  1G8X A;  2L8D A;  1U1S A;  4C0F A;  3M0U A;  3G6E Q;  4BI8 B;  2Z0W A;  1TXQ A;  1S72 A;  1JXM A;  3BE3 A;  1AEY A;  1YIT Q;  4RCC A;  3EFO A;  3CCV Q;  1C1A A;  4BD3 A;  5CAI A;  2RHY A;  2O88 A;  4E7J A;  4KH1 B;  1WX6 A;  3PGG A;  3CCL T;  5KYW B;  3VRY A;  5GMK j;  3DLM A;  2CGH A;  2NUP B;  4X1V A;  4M77 F;  4M7A A;  3MP8 A;  4C5H A;  3OYG A;  1VYT A;  1PHT A;  2DBM A;  2AHJ B;  3C0C A;  3TU4 K;  1PG5 B;  3O8V A;  2NYS A;  2DXU A;  3CMA Q;  3JCM f;  1BIA A;  2MMP A;  2A37 A;  4M7D D;  4HXJ A;  4A63 B;  1N27 A;  2DEU A;  2A36 A;  1YHQ T;  4EPC A;  3H41 A;  4QVC A;  2DEQ A;  4O5V A;  1VQ7 A;  2E6Z A;  2EYW A;  2K5I A;  2YUN A;  1VQ9 Q;  2E10 A;  1M90 C;  1PWT A;  2C0I A;  1M8V A;  1Q86 C;  3X24 B;  1KC8 U;  2AKL A;  1HSQ A;  1YP5 A;  3P8B B;  2WSF E;  3PMI A;  3EHR A;  1BI0 A;  1UEB A;  4LDX A;  2ATC B;  3WXM B;  3OB9 A;  1VQM T;  1K73 R;  4X9D A;  4PLI A;  1IGQ A;  1N8R C;  4J9C A;  3CD6 Q;  4ATO A;  1UEC A;  2E12 A;  3CCS T;  4ZN3 A;  3GOX A;  4XTX A;  2FPF A;  1M1F A;  2I0N A;  4KGV B;  2CZ0 B;  1K0S A;  2B8A A;  1AWX A;  1VQO A;  1JXO A;  2HQH A;  2KVQ G;  5KYU A;  2QI2 A;  1YIJ T;  2JXB A;  2AIR B;  2BZ8 A;  4QQ6 A;  2VVK A;  3RES A;  1KD1 C;  4EMK A;  4UC4 A;  3EG0 A;  1D0Y A;  3PE0 A;  2OTJ Q;  2XDP A;  3PT9 A;  1BCM A;  3JB9 D;  1OZ2 A;  1Q7Y C;  1UHF A;  4IUR A;  1KQS S;  1D3B A;  3L2Z A;  4MZP A;  5IHK A;  4M75 A;  5KYY A;  2F2W A;  5LJ3 d;  1WLP B;  2X3X D;  1SKU B;  3G7Z A;  5KE2 A;  1OPK A;  4EMG A;  3JCM e;  1MNE A;  3CME Q;  3NGP A;  1AOJ A;  1M9S A;  3QDF A;  1ZHI A;  1NJI U;  1KJW A;  3SWN C;  1M4Z A;  5CK9 A;  2VKN A;  2JM8 A;  1BI1 A;  2CKK A;  2RN8 A;  1T3L A;  1X27 A;  4JS4 A;  3AT1 B;  3H9N A;  2CYZ B;  4IUQ A;  2K9G A;  4AFZ C;  4OGE A;  1HYO A;  2CDT A;  1WJQ A;  2PVG B;  3M58 A;  2ROL A;  3VS5 A;  4K11 A;  4J7I A;  1R0B G;  1JJ2 S;  2EVR A;  3OYL A;  4F7U E;  1IRX A;  4A54 A;  4HT9 A;  2RM4 A;  2HSP A;  4L6V 5;  1B07 A;  1MHN A;  5LL6 S;  4J5Y A;  4C8Q D;  1TTH B;  2EAY A;  3M0P A;  4N4G A;  5FU7 B;  1M27 C;  1VQ7 T;  3M0R A;  2AT1 B;  2GTJ A;  1ZSZ B;  3CCR Q;  1PD0 A;  1UUE A;  5LJ3 j;  2QAZ A;  1NYF A;  5FW9 A;  4PNO A;  4C8Q E;  4RCB A;  1RLQ C;  4RTY A;  3LWI A;  2JMA A;  3EHQ A;  4PL6 A;  2LMJ A;  2P0P A;  3PNW C;  3QZ9 B;  1W2B S;  2KAF A;  4IUT A;  5ECA A;  5HKC A;  4PFP A;  3OSS C;  2R58 A;  1M30 A;  2KT1 A;  3QJ6 A;  2GQV A;  2HBW A;  2QQ9 A;  3TQ7 P;  4BY6 B;  4PFZ A;  2ZPG B;  5CVI A;  2DYI A;  2RI2 A;  3OYC A;  4FIB A;  2ECZ A;  1VQO T;  2FPE A;  3CCU Q;  2JJ9 A;  3FRN A;  1WYX A;  2CP6 A;  3VS1 A;  5FLX E;  1VQ4 Q;  3REB B;  4A4G A;  5LJ5 d;  1YJN A;  4M77 A;  2JMC A;  4M4Z A;  4PJO D;  1OUL A;  4CI0 C;  2D0Q B;  2KNB B;  3MCA B;  4XU0 A;  5A0G A;  3TCJ A;  4HCB A;  1KQS P;  1H64 1;  3CC7 A;  3D7S B;  4OGC A;  4OP0 A;  2V8K A;  4IIM A;  1NE8 A;  4M7D F;  2YT6 A;  3A5Z B;  2VAS A;  2DD4 A;  2EW3 A;  2E41 A;  3FC3 A;  2O9S A;  5CKH A;  1B34 A;  2CSQ A;  2LQ8 A;  3OS1 A;  1IGU A;  3OMG A;  2EKO A;  1GFD A;  1RAH B;  4AT1 B;  2VUB A;  2QAS A;  3UPU A;  2MI6 A;  3CPW A;  2DL7 A;  4KGX B;  2DX1 A;  1YJW T;  2ZGW A;  4Q5W A;  2KI7 A;  3OY9 A;  4HT8 A;  4M75 E;  5CIU A;  2K6D A;  2ABL A;  3BDU A;  5FU6 B;  2RB6 A;  2OTL Q;  4FM4 B;  3I55 T;  2RQR A;  1JJ2 P;  3PMT A;  3LH0 A;  3LH5 A;  3BFM A;  3JCM b;  2D0N A;  3MJX A;  2JVV A;  2KBT A;  2PUO B;  3ME9 A;  5LJ5 j;  1NZ9 A;  3GNG A;  3HPW A;  4R0K A;  5GAN 3;  4JJD A;  4GLM A;  4Z88 A;  3PVQ A;  5I21 A;  1BI2 A;  1MGQ A;  3CEY A;  2KDS A;  2KEA A;  3QZ5 B;  2QQR A;  2A3L A;  2EYZ A;  1MV3 A;  3UT1 A;  1RI9 A;  1G3Y A;  2FEI A;  1FXX A;  3JB9 F;  2E5Q A;  1UGQ B;  1G3S A;  1HXD A;  2MWP A;  3M0Q A;  1W2B P;  4RTZ A;  3RKW A;  4DBH A;  5FRM A;  3G1J A;  3LGL A;  4M78 D;  4F04 B;  4MMK A;  3TSW A;  4ZTJ A;  2KY9 A;  2EYX A;  4O6J A;  2JTF A;  3X20 B;  2ED0 A;  3OYN A;  4PJN A;  2E3H A;  1VQP A;  2EYQ A;  3SFM A;  3QSU A;  4M78 E;  2E4H A;  2MAM A;  1G83 A;  4Y28 E;  3AHU A;  2COW A;  3I9Q A;  4KUD K;  1RAE B;  2VB6 A;  3M59 A;  5I11 A;  1YJN T;  1PSF A;  4FW2 A;  2BZY A;  4PJJ A;  3QWX X;  4PJL A;  1YJ9 Q;  4RMO A;  3L1A A;  4PJM A;  1QVF P;  3CC2 A;  2D6F A;  1ZUY A;  1AD5 A;  3CC7 T;  4Z02 A;  3MKD A;  1ZA2 B;  2YSQ A;  3SWN B;  4HCC A;  1RAG B;  1QP2 A;  1ABQ A;  1G5V A;  3HP9 A;  3FJ5 A;  5HY6 A;  1VUB A;  1K0X A;  2DE0 X;  4HA8 A;  2VXE A;  3RNJ A;  4JLG A;  4M77 E;  1UB4 A;  3NFC A;  1Q81 R;  1UGP B;  4IIO A;  2KGT A;  4L5G A;  4FCY A;  3PFS A;  4M7A G;  5GMK e;  1QP3 A;  3UDC A;  1R77 A;  2CRE A;  4GLK A;  4C92 D;  1OOT A;  5GJV B;  2AZV A;  5GAN 5;  2J6F A;  2Y4Y A;  1AWW A;  1WJS A;  2EKH A;  1Q82 R;  1U3O A;  3QKJ A;  3OYY A;  2P84 A;  4AFU C;  3VU3 C;  1T3S A;  2EGA A;  4AFS C;  1EFN A;  4GY5 A;  2RHZ A;  1VQN A;  2E64 A;  4JJC A;  3JRZ A;  1FMW A;  4A4F A;  1TH7 A;  4A4H A;  2LVM A;  1M90 U;  4MDW A;  4HVV A;  3CCL A;  3F70 A;  5CR2 A;  1Q86 U;  2YDL A;  3CCM A;  3HSB A;  2HMA A;  2QA4 T;  4OMN A;  4M7D A;  2XDB A;  1K76 A;  4IUU A;  2LJ3 A;  2DRK A;  5DLO A;  2FRW A;  2BE9 B;  3URG A;  1N8R U;  3T9N A;  3DB3 A;  2E5K A;  4CC4 B;  2JT4 A;  3EH1 A;  1YHQ A;  3RR6 A;  1I5L A;  4DEY A;  2O4X A;  2F5T X;  2J05 A;  1RAA B;  1VQP T;  1G3T A;  3VS7 A;  2RF0 A;  2O9V A;  1I8F A;  3EFS A;  1VQL Q;  2ZAE A;  5GAN 4;  1D09 B;  2FG0 A;  1O9S A;  4DA4 A;  4A4E A;  2QGG A;  4XU2 A;  3G71 Q;  2YLC A;  2ROT A;  2DM1 A;  1KD1 U;  2CUB A;  1GCP A;  1B7T A;  1VQM A;  4MZM A;  4J6Y A;  2RJD A;  1X75 C;  2W10 A;  2Y90 A;  3REA B;  1Q7Y U;  4MDX A;  3JB9 I;  3G6E A;  2VC8 A;  2O31 A;  3OBY A;  1E7O A;  3H0F A;  2P0Q A;  5GAO r;  1ABO A;  1M2V A;  2LCC A;  2VGN A;  1YIT A;  4EMH A;  2EQI A;  3CCV A;  4JDS A;  2DJQ A;  3RMS A;  3JCM P;  1YIJ A;  1LOJ A;  2WSE E;  1C0M A;  2H8H A;  3QYH B;  5KH6 A;  5HCK A;  1M8M A;  2FYK A;  2HKQ B;  1V76 A;  2DF6 A;  3OYK A;  4ZGD B;  1OYX A;  3M55 A;  1WJR A;  3GPL A;  1OI1 A;  2YRV A;  2L3R A;  2LJ0 A;  4QQG A;  2KYM A;  2DTI A;  2X4J A;  2L89 A;  1ZBX A;  2DXT A;  4OB1 B;  3OS5 A;  1VQ9 A;  3RIR A;  2NLU A;  3L2W A;  2E3I A;  4LNP A;  1SHF A;  2L3P A;  4F7U A;  1W4S A;  4M7A C;  3CC4 Q;  2EPD A;  1SSH A;  2MCN A;  1VQN T;  2M16 A;  1D1C A;  4BI4 A;  4JJN K;  1I4K 1;  2X51 A;  2EJG A;  1PRL C;  2RHI A;  2L3Q A;  5D7U A;  3A98 A;  3VKI A;  3CCS Q;  3CCM T;  2RHX A;  4KBM B;  2J06 A;  3EG9 B;  1WGS A;  4C8Q A;  2HDA A;  2EWN A;  5GAO q;  2OX7 A;  4JZ3 A;  1WA7 A;  3OW2 S;  1PKS A;  3FLG A;  3CBM A;  5GAO n;  1RAF B;  1QCF A;  2OAW A;  4E2F B;  1NLP C;  4LXC A;  2YUP A;  3A8L B;  2YLB A;  3MET A;  5GAM h;  2FZC B;  5KYX B;  1K9M C;  4M77 G;  1HD3 A;  1VQ8 Q;  2OJ2 A;  3PVL A;  4PKC C;  2JZ2 A;  2MK5 A;  2OI3 A;  2OTJ A;  1PC0 A;  3NTI A;  1F1B B;  3MPU B;  4M7D E;  4V2S A;  4C92 F;  1UJY A;  5GAN j;  3N5B B;  1VQK T;  1VIF A;  1GXI E;  5CKE A;  1KHC A;  1YBY A;  3JCM g;  2NUT A;  4BUG A;  4Y91 A;  4HVU A;  1M1K R;  1WPY A;  5GMK h;  1CKB A;  1QWE A;  3G6E T;  4EMK C;  1VA7 A;  4KUI A;  2GFU A;  1RUW A;  4JRI A;  4X9C A;  1S72 Q;  3S3M A;  4KH0 B;  4CC7 A;  1YIT T;  3CCV T;  4PJO A;  3L2V A;  3V8J A;  2K2M A;  2XD0 A;  4M75 C;  4B9X A;  4J83 A;  2H3J A;  4F17 A;  4GBQ A;  1TU0 B;  2QGF B;  1NBE B;  4WTO B;  1WHJ A;  2PVO B;  5D6Y A;  3M4G A;  5A0L A;  2XDD A;  3Q1J A;  2EQJ A;  5GAN h;  4RKU E;  1TUC A;  3GIB A;  3SD4 A;  2H3E B;  1BIB A;  5LJ5 e;  1K9A A;  1NPR A;  1RAI B;  2M02 A;  4KUL A;  1HJD A;  3I5S A;  4E7I A;  4B6M A;  2LRQ A;  1VQ9 T;  2YWW A;  3DLL A;  1XNI A;  1NYG A;  1RI0 A;  2G6F X;  2QTV A;  2K7A A;  3NTK A;  4BDZ A;  1M3B A;  4LUD A;  3JSC A;  1YJW A;  2K5F A;  4HKE A;  3EGD B;  2LZ6 B;  1X2Q A;  4J6X A;  4NOY A;  3CD6 T;  3KBG A;  4OML A;  3I55 A;  3TSZ A;  3V8L A;  1LNX A;  1Y96 A;  2PUK B;  2NWM A;  2CH4 A;  1KQ2 A;  3OW2 P;  2DPP B;  1K73 C;  2GBQ A;  2P4R A;  2HNI A;  4ORZ A;  2QYZ A;  1OZ3 A;  2F2V A;  3E9F A;  1Z9Q A;  1KC8 R;  1YI2 A;  3JCM W;  2KRS A;  2RHU A;  3HRU A;  4C0Z A;  1CKA A;  1NG2 A;  1YFN A;  4FL6 A;  2GQI A;  1T0H A;  1WFW A;  1QVG A;  1JEG A;  1VQ4 A;  2KR3 A;  3QJY A;  1HK9 A;  2FZK B;  4WF2 A;  1UGS B;  1SSF A;  1WHK A;  3CQT A;  2LNH B;  3HTR A;  4XTV A;  2OTJ T;  1PD1 A;  3EGX B;  3OQ5 A;  2M0O A;  4CRI A;  1TSF A;  2VXF A;  1OEB A;  4M78 A;  1ARK A;  2KE9 A;  3UAT A;  3ZL7 C;  4J9F A;  1UE9 A;  2EJF A;  5IXB A;  3LGF A;  2PZ1 A;  1NLO C;  3CME T;  1EX4 A;  4M77 C;  3J7A F;  1N6A A;  3G4S Q;  2JNG A;  1AZG B;  4JRQ A;  3MO8 A;  1SF9 A;  3JB9 H;  2QG9 B;  1WI7 A;  5GMK l;  3SEM A;  2MPX C;  2RQT A;  5AYF A;  2HBP A;  1JB0 E;  4R56 A;  3C94 A;  1IRE B;  2JW4 A;  4LD6 A;  2DIG A;  4JUV A;  3S3N A;  3EFO B;  2OTL A;  2K3Y A;  2IIM A;  1NJI R;  4DBF A;  3GF5 A;  1UFF A;  8AT1 B;  2DER A;  5A0D A;  3VYG A;  2LJ1 A;  3CXC A;  5LJ3 h;  1QKX A;  4HCZ A;  2YRC A;  3MEA A;  3H0H A;  4C0G A;  2BUD A;  4M7A B;  4PJO E;  2VYT A;  2HQE A;  3JCM J;  4DBR A;  5IH2 A;  3U23 A;  5GAN 7;  3E2U A;  3JCM d;  2XU8 A;  4RTW A;  3RKX A;  4EDU A;  3S3O A;  1G3W A;  5KCH A;  4C92 A;  2DVJ A;  3HL8 A;  2A7Y A;  4Z8A A;  2CP5 A;  3M54 A;  4M7D G;  1QQJ A;  2MYS A;  1YWO A;  1VYV A;  5DLQ E;  5I2S A;  4DBQ A;  3EGU A;  3CXC S;  1WHG A;  1D0X A;  4FYY B;  2HQX A;  3I35 A;  2KRO A;  2QEX Q;  1YNZ A;  1KG1 A;  1RL2 A;  5GAM f;  2KMT A;  5D6X A;  2V1R A;  1QCN A;  1D0Z A;  2DA9 A;  5J26 A;  3THK A;  2K4Y A;  4XAX B;  1Y7X A;  1YN8 A;  1MMN A; 
#chains in the Genus database with same CATH homology
 2PNI A;  2EGC A;  4AFU C;  1JXM A;  1U5S A;  3EG3 A;  1T3S A;  2EGA A;  1AEY A;  4AFS C;  3M0T A;  1EFN A;  3QWY A;  4OMM A;  1OV3 A;  4JJC A;  2O88 A;  1W6X A;  3NHN A;  1OPL A;  3O5Z A;  2M0Y A;  1WX6 A;  2J6K A;  4HVV A;  3VRY A;  1GBQ A;  2FO0 A;  2YDL A;  3UF4 A;  4OMN A;  4X1V A;  1K76 A;  2LJ3 A;  1VYT A;  1PHT A;  1QWF A;  1TG0 A;  1K1Z A;  2DBM A;  2DRK A;  1LCK A;  3C0C A;  2FRW A;  1SPK A;  2A37 A;  2K3B A;  1CSK A;  2MIO A;  2E5K A;  4HXJ A;  1XOV A;  4A63 B;  4CC4 B;  2A36 A;  4Y92 A;  3H41 A;  2JT4 A;  4J9D A;  2EYW A;  2JTE A;  2YUN A;  1E6G A;  4DEY A;  2J05 A;  1X6G A;  1PWT A;  2C0I A;  3VS7 A;  2C0O A;  2RF0 A;  1AZE A;  2O9V A;  1GL5 A;  2AK5 A;  3GBQ A;  1GCQ A;  4ZNX A;  1UHC A;  1HSQ A;  2AKL A;  2FG0 A;  1ZUK A;  1YP5 A;  4CC3 A;  3EHR A;  5IXF A;  1PNJ A;  2JS0 A;  2D8J A;  2ROT A;  2DM1 A;  2RNA A;  2CUB A;  1GCP A;  2VWF A;  1UG1 A;  4J9C A;  4JPB W;  1M3A A;  1BK2 A;  1BBZ A;  2PTK A;  1UEC A;  2CSI A;  2W10 A;  2DIL A;  3VS4 A;  3REA B;  1GBR A;  3ULR B;  3M0S A;  4KRT A;  2FPF A;  2GNC A;  2O31 A;  1E7O A;  3H0F A;  2I0N A;  4J9B A;  1ABO A;  1K0S A;  1AWX A;  5I22 A;  1JXO A;  2RQW A;  2KYB A;  2EQI A;  2L0A A;  4HVW A;  2DYB A;  4AFQ C;  2GGR A;  2DJQ A;  1PRM C;  2JXB A;  3EG1 A;  4J9G A;  2KRN A;  2BZ8 A;  5FWC A;  2H8H A;  4LUE A;  2VVK A;  4E6R A;  5HCK A;  4QT7 A;  1M8M A;  3EG0 A;  3KFV A;  1H3H A;  3VS2 A;  3PE0 A;  4AG1 C;  1X69 A;  2A08 A;  2DL4 A;  4DEX A;  4OMP A;  1WXB A;  2DF6 A;  4JZ4 A;  1UHF A;  5IHK A;  2KT8 A;  2LJ0 A;  2F2W A;  2M51 A;  1WLP B;  2KYM A;  2X3X D;  1OPK A;  3RBB B;  3NGP A;  4WCI A;  1AOJ A;  2L2P A;  1KJW A;  4LNP A;  1SHF A;  2L3P A;  2VKN A;  1K4U S;  1UJ0 A;  1T0J A;  1QLY A;  2JM8 A;  2J6O A;  2EPD A;  2KXD A;  1NM7 A;  1SSH A;  2F2X A;  4EIK A;  1FMK A;  2XMF A;  2MCN A;  2RN8 A;  1T3L A;  1X27 A;  1ZLM A;  3VS0 A;  1A0N B;  1PRL C;  1NEB A;  2K9G A;  2W0Z A;  4AFZ C;  4ESR A;  2L3Q A;  1WXU A;  1X6B A;  3A98 A;  2CDT A;  4F16 A;  2BZX A;  2LCS A;  2J06 A;  2ROL A;  3VS5 A;  4K11 A;  2EVR A;  2HDA A;  4JZ3 A;  1WA7 A;  2DBK A;  1I07 A;  1PKS A;  2HSP A;  2ED1 A;  1GCQ C;  1QCF A;  2OAW A;  1B07 A;  1NLP C;  3NPF A;  2YUP A;  3M0P A;  1SRM A;  2SEM A;  2DL3 A;  2RQU A;  1M27 C;  3M0R A;  5GJW B;  1HD3 A;  2GTJ A;  2OJ2 A;  2RQV A;  1Y0M A;  3PVL A;  2LP5 A;  1UGV A;  2OI3 A;  1UUE A;  1TUD A;  1NYF A;  5FW9 A;  2O2O A;  1RLQ C;  2KXC A;  1UJY A;  4RTY A;  2GTO A;  1UDL A;  2JMA A;  3EHQ A;  3TVT A;  2LMJ A;  1BU1 A;  2HCK A;  1PKT A;  5ECA A;  1SHG A;  4OMO A;  1YCS B;  4HVU A;  1M30 A;  2KT1 A;  2DL8 A;  2HBW A;  1KIK A;  2C0T A;  1CKB A;  1QWE A;  2K79 A;  4LE9 A;  1VA7 A;  4OMQ A;  1W1F A;  1RUW A;  2FRY A;  1U06 A;  4D8K A;  4CC7 A;  4J9I A;  1ZUU A;  2ECZ A;  2FPE A;  1KFZ A;  1WYX A;  1X43 A;  2K2M A;  2B86 A;  1N5Z A;  3VS1 A;  2V1Q A;  3REB B;  2A28 A;  1ZSG A;  1JQQ A;  4F17 A;  2CH4 W;  2JMC A;  4M4Z A;  2KRM A;  4GBQ A;  2KNB B;  5IHN A;  1UTI A;  1I0C A;  3VS6 A;  1AWJ A;  5FWB A;  1JU5 C;  4IIM A;  1QKW A;  2YUQ A;  1TUC A;  2YT6 A;  2MOX A;  1K9A A;  4RTX A;  2EW3 A;  2O9S A;  2DL5 A;  1HJD A;  3I5S A;  1E6H A;  2LQW A;  1WIE A;  1IO6 A;  1I1J A;  2CSQ A;  4F14 A;  2AZS A;  1VYU A;  1GFD A;  1NYG A;  1X2K A;  2ENM A;  2D8H A;  2G6F X;  2LQN A;  5IHI A;  2K7A A;  2DL7 A;  2DX1 A;  3NMZ C;  1M3B A;  4LUD A;  1GRI A;  2K6D A;  2ABL A;  2ESW A;  2LZ6 B;  1X2Q A;  1NEG A;  2RQR A;  3JV3 A;  4OML A;  3TSZ A;  5EC7 A;  2HEQ A;  2J7I A;  2JS2 A;  2NWM A;  2CH4 A;  3LH5 A;  2D0N A;  2GBQ A;  2P4R A;  4LN2 A;  4ORZ A;  2F2V A;  1Z9Q A;  2JM9 A;  2KBT A;  4JJB A;  2KRS A;  1AWO A;  1CKA A;  1NG2 A;  2DLP A;  5L23 A;  4R0K A;  2L3S A;  2GQI A;  1SRL A;  1T0H A;  1WFW A;  4GLM A;  3PVQ A;  1FYN A;  4JJD A;  2CT4 A;  4Z88 A;  1JEG A;  1WXT A;  2KR3 A;  3IQL A;  3VRZ A;  2KEA A;  2EYZ A;  1MV3 A;  3CQT A;  2LNH B;  2CT3 A;  2SRC A;  1RI9 A;  2FEI A;  3EG2 A;  1OEB A;  1ARK A;  2RPN A;  2KE9 A;  3UAT A;  3ZL7 C;  4J9F A;  1UE9 A;  2FPD A;  1WDX A;  1AVZ C;  3M0Q A;  2D1X A;  5IXB A;  4RTZ A;  3I5R A;  2PZ1 A;  3TSW A;  4HCK A;  3VS3 A;  2NUZ A;  1Y57 A;  1NLO C;  2EYX A;  1S1N A;  1YWP A;  1G2B A;  1V1C A;  2ED0 A;  4RTV A;  1AZG B;  1WI7 A;  2CUD A;  2EBP A;  2RMO A;  1G83 A;  3SEM A;  2RQT A;  2DMO A;  3I9Q A;  1MV0 B;  2DRM A;  3R6N A;  1JO8 A;  2JW4 A;  1ZX6 A;  5I11 A;  4AG2 C;  1BB9 A;  1GFC A;  4FSS A;  2EYY A;  2BZY A;  3QWX X;  2YUO A;  3SHW A;  2IIM A;  1B3Q A;  1W70 A;  1UFF A;  1H92 A;  2DNU A;  1ZUY A;  4CC2 A;  1SEM A;  2LJ1 A;  1AD5 A;  4Z89 A;  1QKX A;  3UA7 A;  1MUZ A;  2YSQ A;  4D8D A;  3H0H A;  1ABQ A;  3FJ5 A;  1K0X A;  5IH2 A;  2DE0 X;  3U23 A;  4RUG A;  2BTT A;  3H0I A;  3RNJ A;  1H8K A;  2QDL A;  4RTW A;  1ZBJ A;  2LX7 A;  4IIO A;  2KGT A;  2DVJ A;  3UA6 A;  2EGE A;  4Z8A A;  1YWO A;  1VYV A;  2X3W D;  2CRE A;  1RLP C;  3EGU A;  4J9H A;  1OOT A;  4RTU A;  1KSW A;  5GJV B;  1Z9Z A;  2AKK A;  2AZV A;  2KRO A;  3I35 A;  1YNZ A;  2J6F A;  1AWW A;  1J3T A;  4RTT A;  2EKH A;  2V1R A;  2DA9 A;  1U3O A;  3M0U A;  4J9E A;  3THK A;  1M3C A;  1YN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...