2RPNA

A crucial role for high intrinsic specificity in the function of yeast sh3 domains
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
APWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-binding protein
publication title Structural, functional, and bioinformatic studies demonstrate the crucial role of an extended peptide binding site for the SH3 domain of yeast Abp1p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rpnA00
2KYMA 2J7IA 4Z89A 2K6DA 1M3BA 1SPKA 1SEMA 1HJDA 1SRLA 2J06A 1YN8A 2LP5A 1GRIA 1X6GA 1WIEA 2EYWA 2KT1A 2EPDA 4JJDA 5IHNA 2FEIA 4JJBA 1UTIA 1PHTA 2CREA 2ROTA 2ECZA 1PKSA 1AWXA 2JMCA 1X69A 3UF4A 2X3WD 2AZSA 4X1VA 2OAWA 2DMOA 2YUNA 4HCKA 5GJVB 2NUZA 2KRNA 1V1CA 4OMLA 1B07A 3H41A 1GCQC 1MV3A 2GGRA 1FMKA 4AG1C 2RMOA 2YSQA 4F17A 2A37A 2P4RA 1E7OA 2JTEA 2J05A 1NLPC 3VS3A 5IHKA 2RPNA 4OMMA 4RTXA 2XMFA 2DILA 2W10A 4OMPA 2AZVA 4CC3A 4DEYA 2JMAA 4GBQA 4IIMA 1ZUUA 2EYYA 2EVRA 2K79A 4RTYA 1ZBJA 1UDLA 1UE9A 1CKBA 1BK2A 4FSSA 2ABLA 2ROLA 2VKNA 1GFCA 4ORZA 2G6FX 1GL5A 1WA7A 1YWOA 4AFSC 4J9GA 2F2WA 1AEYA 4Z8AA 1BBZA 1AWWA 2KYBA 1SHFA 2AKKA 1VA7A 1PRMC 2KEAA 2GNCA 1AWJA 2RQRA 2ED0A 4LUEA 4A63B 1Z9QA 2CUBA 3RBBB 2DM1A 1SSHA 3UA6A 2M51A 3M0QA 3M0PA 1BB9A 2KGTA 4RTTA 3TSWA 2DL8A 2DX1A 1QKXA 1UG1A 2BZYA 4Z88A 2W0ZA 1PKTA 3ZL7C 1G2BA 1TG0A 2DL5A 3M0TA 1AVZC 1B3QA 4HVVA 2F2XA 2MOXA 2YT6A 2YUPA 1M3AA 4R0KA 3PVQA 1NLOC 2CSQA 2RQUA 1JEGA 2PNIA 4ZNXA 1RLQC 2CT4A 2CH4A 3VRZA 1AOJA 2CH4W 2YUQA 4J9CA 1WDXA 1UJYA 5IXBA 4HVWA 2JXBA 3UA7A 2QDLA 3QWXX 4F14A 2KR3A 3FJ5A 3I5SA 2L3SA 1GCQA 1NYFA 1NG2A 1ZSGA 1WXTA 2KRSA 1KJWA 4OMQA 1I1JA 2K3BA 1T3SA 2D8HA 2L0AA 2LNHB 1E6HA 4GLMA 5IXFA 3CQTA 5HCKA 2GQIA 2K2MA 2HCKA 1VYTA 3SHWA 1K9AA 2RQTA 3EG0A 2HSPA 5I22A 2NWMA 2EYZA 2RQVA 3THKA 1E6GA 1G83A 1NYGA 2O2OA 1AD5A 2JS0A 2KBTA 3LH5A 1HD3A 2LCSA 2IIMA 3PE0A 1GFDA 1KFZA 1PRLC 2RQWA 1NM7A 1H92A 2FPEA 2DF6A 2EYXA 2J6OA 2DBMA 1QKWA 3H0IA 5IH2A 1EFNA 4JPBW 1X2KA 1A0NB 3PVLA 1FYNA 2DVJA 2EGAA 2V1RA 4M4ZA 4ESRA 1AWOA 4JZ3A 4RTUA 3R6NA 2J6KA 1JQQA 2KXDA 4AFZC 5I11A 1AZEA 1TUCA 1MUZA 2FRYA 1UHCA 2I0NA 1HSQA 1LCKA 2V1QA 1UHFA 2A08A 2SEMA 2CUDA 2HEQA 2RF0A 1WXUA 2VVKA 3C0CA 1RUWA 2EGCA 1ABQA 4J9DA 1OPLA 3EG3A 2KT8A 3M0UA 1K0SA 2JM8A 2K9GA 2ED1A 1OPKA 2EQIA 1X27A 1JU5C 3KFVA 4CC4B 1K1ZA 2L3PA 3I5RA 2FPDA 2FO0A 2EGEA 3O5ZA 5IHIA 2PZ1A 1ZUYA 3VS4A 5FWCA 3RNJA 1K4US 1T0JA 1WI7A 1YCSB 1ZUKA 1ZX6A 2DJQA 2HDAA 3VRYA 1PWTA 4J9HA 2PTKA 4HVUA 1M27C 3ULRB 5EC7A 1TUDA 3REBB 4Y92A 2JW4A 1VYVA 2E5KA 2LJ0A 2DL7A 3VS0A 2KE9A 4E6RA 1QWFA 3VS7A 1W1FA 1ARKA 2LMJA 3NGPA 1K0XA 4LN2A 2HBWA 4F16A 2BZXA 2DRMA 3M0SA 4RTWA 2ESWA 2CSIA 3UATA 4D8DA 1YNZA 2DA9A 2A36A 2DLPA 1U5SA 1XOVA 1W70A 1T3LA 1JXOA 2X3XD 1JO8A 4DEXA 2O9SA 2JS2A 2LJ1A 3VS2A 1Y0MA 1GCPA 3GBQA 1BU1A 2A28A 2EW3A 1H8KA 4AFQC 1U3OA 2DYBA 1I07A 1NEBA 1X6BA 1U06A 3QWYA 4JZ4A 4RTVA 2DE0X 2KNBB 4K11A 2GBQA 1M8MA 1T0HA 1CKAA 2O9VA 1OEBA 2DL4A 2JT4A 4J9BA 3EGUA 1M30A 2RNAA 2C0OA 1OV3A 1SHGA 2D0NA 3TVTA 5L23A 1WLPB 2LJ3A 4JJCA 4D8KA 2KRMA 2C0TA 2ENMA 2BTTA 4LUDA 1WXBA 2D1XA 1QLYA 2H8HA 4J9EA 1JXMA 2AKLA 3NPFA 1GBRA 2JM9A 1W6XA 3EHQA 1N5ZA 3U23A 2RN8A 4AG2C 2GTOA 1X2QA 2SRCA 3EHRA 1Y57A 2M0YA 3VS6A 2LX7A 3EG1A 2MCNA 3SEMA 4OMNA 1Z9ZA 3H0HA 1S1NA 3I9QA 3VS1A 1GBQA 2KROA 2CT3A 3I35A 1YP5A 2LQNA 4EIKA 1YWPA 2LQWA 2LZ6B 3NHNA 2B86A 2K7AA 1K76A 3EG2A 3NMZC 1MV0B 1RLPC 2FG0A 4RUGA 2DRKA 2DL3A 2D8JA 2DNUA 2L3QA 3M0RA 1UUEA 1WX6A 2O31A 2J6FA 1M3CA 4J9IA 1UECA 1CSKA 1UGVA 2EKHA 2F2VA 1ZLMA 1RI9A 5FW9A 1VYUA 5FWBA 2FPFA 2GTJA 5ECAA 2O88A 4LE9A 3IQLA 2BZ8A 2OJ2A 1I0CA 1ABOA 1UJ0A 3TSZA 1AZGB 1SRMA 1UFFA 1OOTA 4HXJA 2MIOA 2DBKA 2VWFA 4AFUC 1WFWA 4WCIA 3A98A 4OMOA 2AK5A 1NEGA 1WYXA 3H0FA 1IO6A 3VS5A 2L2PA 2YDLA 4IIOA 1X43A 2YUOA 2KXCA 4QT7A 2CDTA 2EBPA 4CC7A 4J9FA 2OI3A 1H3HA 1PNJA 4CC2A 1KIKA 2FRWA 1J3TA 1KSWA 3REAB 4RTZA 4LNPA 1QCFA 5GJWB 1QWEA 2C0IA 3JV3A 4KRTA
chains in the Genus database with same CATH superfamily
3V8JA 1QVFS 2LTOA 2J7IA 1VUBA 4J7IA 4ME7A 4Z89A 4X34A 4ZGDB 5CQYA 3JCMW 3N5BB 1SEMA 2LP5A 3CCUQ 1WIEA 1VQ7A 2EYWA 2KT1A 2ECZA 1PKSA 2BKDN 5GAN7 5GMKe 2EFIA 2OAWA 2DMOA 1U1SA 4EMGA 2NUZA 3GP8A 5CKHA 3QSUA 4OMLA 3A1PA 3G71Q 1TSFA 3H41A 2DTOA 2ZAEA 5CAIA 1YHQT 2RMOA 1PD1A 4M77B 2A37A 2P4RA 3HHTB 3HRSA 5KYWA 4M75B 1BYMA 1Q86U 2CP3A 2JTEA 1M9SA 2J05A 1WHKA 3CC2Q 1N8RC 2MK5A 2DJZA 2NUTB 2KI7A 1W2BP 2XMFA 5GANh 3PMIA 3EG9A 2XHCA 4X9CA 1YJWA 2AZVA 1AT1B 4M7DC 1ZUUA 1PSFA 1UDLA 1YJ9Q 1BK2A 2ABLA 3BE3A 1IRXA 2VKNA 2VXEA 1K8AC 3X20B 2MYSA 4M78B 3V8LA 1B34A 4LDWA 1GL5A 1WA7A 4A4EA 5LJ5g 2CZ1B 2LCCA 3WVEB 1SF9A 3JB9J 1D3BA 3LW5E 1OULA 4Y28E 2FZCB 2DYIA 3META 2ED0A 4XTVA 3SDZA 1LNXA 3RBBB 2FZGB 1SSHA 3I56T 1WZOA 3M0PA 4J6WA 5FLXE 2K5LA 2DX1A 5LJ5d 4M75D 3MP1A 2E64A 1YHQA 4PLLA 4PFOA 3ZL7C 6AT1B 3M0TA 1TG0A 1B3QA 2CZ0B 5GAMg 1YITQ 4HVVA 1KHIA 2F2XA 1M3AA 4R0KA 4XTUA 1BIBA 2CSQA 1JEGA 4ZNXA 2CH4A 3EGDB 1WDXA 3C95A 2GF7A 4HVWA 2HD0A 3PIOA 3QWXX 2QEXT 1VQ4T 1JRIA 4M78D 1JJ2P 1KJWA 1WJRA 4GLMA 5GAMd 5IXFA 2XDDA 3S3MA 2GQIA 2K2MA 4PJOC 4PJJA 3JCMP 1K9AA 3OB9A 3OBYA 3E1SA 2NWMA 2RQVA 1VQOT 3X24B 2O2OA 2JS0A 3JCMe 4EMHA 1HD3A 5KYUB 1S72Q 4BDYA 1M2VB 3OYYA 3QKJA 2YHTA 2EQJA 2K3YA 3I56A 3EGXB 4OF1A 2DBMA 4E7LA 4JRQA 2RH2A 1QKWA 1M1KC 4BI3A 1OX8A 1X2KA 3PVLA 4LXCA 2DVJA 4A4KA 2V1RA 4C0GA 2MF2A 3CPWS 2KQWA 4AFZC 2I0NA 3OA6A 2V1QA 4MDWA 2A08A 4QQGA 3CCSQ 3VU3C 2QEXA 3JCMV 1WHHA 1VQ4A 2PVOB 2QAZA 2WSEE 1K9MR 3UT1A 1ABQA 1ZSZC 4J9DA 3MCAB 4PLIA 3M0UA 1XNIA 3OYGA 2EQIA 5KE3A 3CC7Q 2VASA 2YLCA 5CKFA 4P5NA 3JAME 1BI0A 2L3PA 1VQOA 3O5ZA 2IPOB 2OTJT 1M90C 3VS4A 4PJOG 1WI7A 1YIJT 2DJQA 2HMAA 1TOVA 5GAOp 3JCMc 2PTKA 2EWNA 3FEOA 4PJOA 1VYVA 5CCAA 1D0YA 4PL6A 3JCMf 3JCMX 2L5QA 5D6WA 1KQ2A 3CCLQ 1ARKA 3SFMA 3EH2A 2NUPA 3VJPA 2K4YA 4C8QD 1X75C 1KQSP 1YNZA 2QASA 2M9UA 2DLPA 2CGHA 3CCRQ 1JO8A 3QO3A 1H3ZA 2D6FA 3M54A 1KD1U 3CXCS 3VS2A 1K9MU 4F7UG 4C92F 3CCJT 2LX9A 4B9WA 5FU6B 3URGA 2XICA 4M7AF 3C12A 1WHGA 4C5EA 2AT1B 2JUFA 2DPPB 4II1A 4F7UA 3CMET 4K11A 1N8RR 2G3RA 4FU6A 1T0HA 3HTRA 1VQ8Q 4RG2A 2GQVA 2OTJA 1U1TA 3TVTA 2RO0A 3OS5A 3CEYA 1WLPB 1IHVA 5CR2A 1UGSB 3QYGB 3QJYA 1TXQA 1I4K1 4M7DB 3OMGA 3QUIA 4BDZA 4R55A 5AYFA 2BTTA 4E7KA 3A8MB 4J9EA 3JB9F 1JXMA 2JM9A 1W6XA 3EHQA 2KDSA 1M1KR 2F5KA 7AT1B 2SRCA 1W2BA 1Y57A 4MZPA 3VS6A 3HRUA 1MMGA 3EG1A 3L2WA 2E5QA 1OU8A 1ACMB 3D7SB 3CCJA 1TU0B 4C92E 2BIVA 4M7AE 4AT1B 2P0KA 4M77C 4HKEA 4M75C 1N8RU 3A8OB 3ER0A 1K76A 3EG2A 3H8ZA 2VGMA 2LRQA 3MEAA 3DB3A 4JRPA 4OB0B 4M7DD 3M55A 1UECA 1CSKA 1UGVA 2F2VA 2YWWA 1PM3A 1VYUA 2VB6A 2GTJA 5ECAA 1JBMA 5KH6A 2CP0A 2BZ8A 2OTLT 4M78C 3E9FA 4OB1B 4OGEA 4EMKB 1OOTA 2MIOA 1VQKA 4AFUC 1M1KU 2QQBA 1X6OA 3C4SA 3A98A 3GLXA 3PTAA 3H0FA 2M16A 5GAN6 4FCYA 1VQ6T 2LT1A 4X9DA 2KXCA 3H6ZA 1ZA2B 1QVGS 2OI3A 1UGRB 1H3HA 4B9XA 3OYLA 1Y07A 4LDYA 4CC2A 2QTVA 2DD5A 2FRWA 1JJ2A 2QQ9A 5FRNA 4LNPA 5KYXB 2YRDA 4LDUA 2C0IA 4J8OA 1MNEA 2CYZB 1YI2Q 2GCXA 3ZBDA 3RMSA 3CCQQ 3G4ST 3CCMQ 1VIFA 2K6DA 1SPKA 1HJDA 4XU3A 8AT1B 1X6GA 3BW1A 2EPDA 1U8RA 4M75G 3L2ZA 1PHTA 2CREA 2ROTA 1VQ7Q 1YJNT 1RABB 2JMCA 3UF4A 3TQ7P 2PVDB 2KRNA 1UEBA 2GGRA 1QQJA 2NUTA 2KAFA 4AG1C 3CBOA 2YSQA 1M90R 2JN0A 4JDSA 4E7SA 5D6YA 2BE7D 1NLPC 4M78G 3VS3A 1VQ6A 2RPNA 5J39A 2W10A 1D1AA 3VYHB 4OMPA 2JMAA 4GBQA 3CC4A 3CCEQ 4FIBA 5GAOm 1YJWQ 1ZBJA 3MPUB 1UE9A 1K73R 3NFCA 1GXIE 4FSSA 1ZA1B 2RK1A 2ROLA 4QVZA 1WNLA 3G4SA 2MAMA 4BE2A 1YWOA 3MP8A 3RKXA 4AFSC 5IN1A 2X35A 5GAOn 2DD4A 1BBZA 2DXCA 3CMAQ 2RD1A 1G3SA 2AKKA 2HSEB 1VA7A 4A4HA 5GMKj 2O01E 1YJNA 2RQRA 3OYEA 2RK2A 5CVIA 3LH0A 2F1LA 2CUBA 2MWPA 2DZCA 3M0QA 1BB9A 1I81A 4RTTA 1G8XA 2DTHA 1UG1A 3CD6T 1M90U 4XU1A 1G2BA 5KCOA 1AVZC 1KQSA 3MJXA 2JZ2A 2GFUA 3RKWA 2BE9B 3DLMA 3NTHA 1QVFP 2R57A 5IT9E 3S3NA 1AOJA 5IXBA 4Q5WA 3UA7A 4XK8E 1WPYA 2KR3A 3H9NA 1IGUA 1NG2A 1WXTA 2KRSA 1I1JA 1T3SA 2LNHB 2O4XB 2E3IA 3CQTA 5HCKA 2HCKA 1VYTA 1M8VA 4PNOA 3SHWA 4UC4A 2RQTA 4L5GA 1M2VA 3J7AF 4QVDA 3WVDB 3RDVA 1G83A 1LJOA 3A8GB 4QQ6A 2M02A 2DIGA 2I2LA 2MMPA 2KBTA 3MEUA 8ATCB 3LH5A 3FC3A 5FU6C 2IIMA 3PE0A 4XU2A 3FRNA 2EJ9A 2EAYA 2PU9B 3QHSA 3SWNB 1NM7A 4BUGA 4C8QG 5GAN2 1H92A 2FPEA 2HQEA 2J6OA 2QTXA 4JPBW 4NL2A 4IURA 9ATCB 3CD6A 2EIFA 5GMKh 4C8QA 3LWIA 2EGAA 3VKIA 4RTUA 2J6KA 1JQQA 2ZPGB 2KXDA 1TUCA 3JCMg 2JNGA 4WTOB 5I2SA 2DTIA 4JLGA 2QK0A 4FW1A 3JB9I 2VVKA 2EGCA 3HRTA 3EG3A 2JM8A 2ED1A 1N9SA 1RAAB 1JU5C 1ZHIA 3DLLA 3JCMd 4CC4B 2FPDA 4N0AA 1IZ6A 2E65A 3RIRA 2FO0A 1OYXA 2EGEA 5IHIA 2PZ1A 4QQDA 2DZ9A 3J81E 1MGQA 3RKYA 3CCUT 4RCCA 3V7RA 3HPWA 3BFMA 4FYVB 4C8QE 4NOYA 2RJFA 1T0JA 1YCSB 3SB2A 3TCJA 3AHUA 1RAIB 4M77D 1WQ7A 5CK9A 1B7TA 1PWTA 5LJ5j 1OX9A 4Y92A 2E5KA 4OB2B 1RAGB 4MMKA 5FU7B 3G7ZA 3VS0A 3OYIA 3G71T 3LYIA 2GFAA 2EYQA 2LMJA 3GNGA 1K0XA 5GMKi 1NZ9A 4C0DB 4F16A 3M0SA 4RTWA 2K5FA 2ESWA 4PK4A 4DQ2A 4HT8A 2CSIA 2QQAA 1RACB 2XIDA 4LDXA 2XK0A 4IKFA 2A36A 4J83A 1U5SA 1W70A 1JXOA 4KGVB 2X4XA 4DEXA 2HBPA 2O9SA 1I8FA 3EFOB 3OW2S 1Y0MA 1MMNA 4EMKC 1Q81R 3PFSA 2DXUA 1U3OA 5GAMj 2E4HA 2VUBA 5D7UA 4J6YA 2JVVA 4M7DG 1X01A 2LCLA 4BI8B 4JZ4A 2DE0X 2MWOA 1M8MA 4D6WA 2JTMA 1R0CB 3JCMb 1YIJA 3CCUA 1SG5A 1N6AA 4M7DA 1VQNQ 2YRCA 2QQRA 1RAFB 1M30A 2QXFA 1F1BB 1TS9A 2NYSA 2D0NA 3JCMJ 1I5OB 2AIRB 2M0OA 4JJCA 2DFUA 3CPWP 1LOJA 4D8KA 2C0TA 3JSCA 5GAOl 5KYYB 2QG9B 3M4YA 3G71A 1WXBA 2D1XA 1QLYA 4JS4A 2AKLA 4QW2A 2QYZA 1MMAA 4C0FA 3L2RA 3OS0A 1X2QA 3EHRA 3C94A 5LJ5h 4KUDK 2LX7A 3HFNA 3LGFA 2MCNA 5I2MA 4M7DE 4C0ZA 4A53A 2OX7A 1IGQA 3H0HA 4DBQA 4IUTA 5KYWB 3CCJQ 3RESA 1TWBA 2CT3A 4PJOF 4EIKA 1M4ZA 4KUIA 2LQWA 2WACA 2L8DA 3NHNA 3QG1A 2H3EB 2K7AA 3R6OA 3EG9B 2HKNA 3NMZC 1MV0B 5CKDA 3I55T 4RUGA 1OU9A 3M0RA 1UUEA 1WX6A 2J6FA 4DBFA 4HCZA 5C0MA 5GAMh 4N4HA 4MZTA 3LX7A 1RI9A 3G1JA 2X51A 5FW9A 1B34B 1TH7A 4HA8A 4LE9A 1O75A 1K73C 2OJ2A 1OQKA 5GAN5 1UJ0A 3TSZA 2LVMA 3WXMB 1XTDA 3CXCP 1SRMA 2V8JA 4F7UF 3NTIA 3GNFB 4PJMA 4LD9K 3FB9A 2X4WA 5AT1B 1IO6A 1VQKQ 2L2PA 1VQLT 1BKBA 1QVFA 4QT7A 5A2QE 2E10A 4EDUA 4IUQA 4B6MA 4O5VA 3DB4A 1KSWA 4QVCA 1Y96B 5LL6S 1QWEA 2VGNA 4PJOE 3JV3A 4KRTA 1M2OA 3CC7T 2RHUA 3FIFA 2KYMA 2ZGWA 3I55A 3BDLA 1SRLA 1YN8A 2HL5C 3JCMQ 1WJSA 1ZSZA 2RJDA 4JJBA 3CBMA 1UTIA 3ME9A 1VOMA 2E6ZA 1Q7YR 1AWXA 4ZTFA 1X69A 2X3WD 1BCMA 1KQ1A 1VQMQ 2YUNA 4HCKA 5GJVB 1VQ9T 1V1CA 3F70A 2P4TA 1B07A 1MV3A 3PMTA 1FMKA 4BY6B 3CCLT 2EKOA 1EX4A 1VIEA 4F7UE 4KH1B 2P84A 2E12A 2COWA 1QCNA 4BE1A 1VQLA 3X26B 4OMMA 2PUKB 2DILA 2KMTA 3CCRT 1WQWA 3SWNC 2HQXA 1VQ6Q 3UPUA 2E1HA 2RHXA 4DEYA 4ATOA 1G3TA 5J26A 4CI0C 4XTWA 2EYYA 2EVRA 1WHJA 2K79A 4O6JA 4RTYA 3CMEA 1CKBA 4ZTJA 3CC4Q 3EH1A 4FSXA 2JJ9A 3CC7A 1GFCA 4ORZA 4J5YA 3INZA 2G6FX 4J9GA 1VQ8T 1AEYA 3TEEA 3MEWA 1AWWA 1SHFA 3EFRA 3OYDA 1PRMC 2YLBA 1NBEB 4OB3B 2KEAA 2GNCA 3OS2A 2EJFA 3A8HB 4LUEA 3OYMA 1RAHB 3QPHA 1Z9QA 5GAOr 2RI2A 1VQ9A 1YJNQ 3UA6A 1VQPT 4A54A 1QKXA 3OYHA 2FHDA 1QVGP 2LQ8A 3L1AA 2ZCFB 3CCLA 1PKTA 2D0QB 2HKQB 2YT6A 2YUPA 2RA2A 4TVRA 2RQUA 2PNIA 2E6NA 1RLQC 2CT4A 3MEVA 4WF2A 3CCRA 2YUQA 4OP0A 2AHJB 2O4XA 2FZKB 5HK3A 5FU7C 4F14A 3FJ5A 2NUPB 2V8IA 1NYFA 2LC4A 2L0AA 3ZEHA 4M75F 4C0DC 2HAXA 5DLOA 4DOVA 3E19A 4M77G 2QI2A 2HSPA 2D9TA 5I22A 4PJNA 1VQ5T 1NYGA 5M9OA 1RADB 4MZMA 2LCSA 4M77A 3G6ET 4M75A 2OTLA 1GFDA 3CPWA 1KFZA 1PRLC 2RQWA 1D09B 1XQHA 3FJPA 1Q81C 4J7FA 3QBYA 4M78F 3QJ6A 2DF6A 2EYXA 1VQPA 2CZ6B 3M9QA 3H0IA 4C92B 5IH2A 2V26A 4M7AB 1A0NB 1FYNA 1R8OB 4ESRA 4JZ3A 3HFOA 1O9SA 3R6NA 1FWZA 5HY6A 5GMKm 5I11A 1AZEA 3OS1A 4M78A 1UHFA 3MP6A 3EFSA 3OSSC 1IB8A 1WXUA 2ZPBB 1BI2A 2DO3A 3VUZA 2KT8A 1K0SA 2K9GA 4M77E 2PVGB 3MHXA 4M75E 1YCYA 1X27A 1NJIC 4V2SA 5HKCA 2RM4A 4BI4A 1VQ5A 3ASKA 1AHJB 2LT4A 1ZUYA 3L42A 5HK0A 5KCHA 4GY5A 2FB7A 4HCBA 3G6EA 2JOYA 1ZUKA 1ZX6A 2HDAA 3VRYA 1KG1A 4C92D 5LJ3e 4JS5A 4HVUA 3ULRB 3UWNA 4M7AD 1TUDA 2Z0WA 3O8VA 2JW4A 3KBGA 4Y91A 2ZPHB 3EGDA 4M78E 5A0DA 2DL7A 2KE9A 5DLQE 4E6RA 1QWFA 3VS7A 1W1FA 5CQXA 2FYKA 3CXCA 2HNIA 3NGPA 1YHQQ 4LN2A 3EFOA 2HBWA 3A5ZB 2DRMA 2CZ7B 4ZN3A 3UATA 4D8DA 1C0MA 1T3LA 3M56A 3GIBA 3M4GA 1HYOA 2RHZA 4RG8A 1Q86R 2JS2A 1K73U 1MMDA 1GCPA 4XAXB 2EW3A 3HL8A 3CCET 1V76A 2P0PA 1OI1A 3PIPA 5KYUA 1HK9A 1X6BA 1U06A 3JB9D 5FROA 4BB7A 1M1FA 1IHWA 3AT1B 2O9VA 1QP3A 1C1AA 4DA4A 3EGXA 4C8QF 3BDUA 1OEBA 2DL4A 3OY9A 4ELYC 3CMAT 2R58A 4NS5A 3EGUA 3PGGA 2C0OA 2K3XA 1YIJQ 2E70A 1SHGA 5KYYA 2MI6A 2CP2A 3HSBA 2LJ3A 1FXXA 2OAUA 3I56Q 3M5AA 2EQKA 1YBYA 3S3OA 2VV5A 1BCOA 1ZBXA 2ENMA 5DY9A 4LUDA 2DXTA 2H8HA 1OZ2A 5GANe 1PCXA 1G3WA 5LJ3f 3LLRA 2YRVA 2K2VA 4R56A 3MKDA 4DOWA 4AG2C 1ZQ1A 2M0YA 1EZZB 2DERA 1UGPB 4JRKA 2QA4T 2DKGA 3CCVT 1Q7YC 2QEXQ 1XJWB 1Q82R 1QMCA 4XTYA 4RMOA 1VQ4Q 4FM4B 4OMNA 3CCEA 1LPLA 4RKUE 1IREB 1S1NA 3OYJA 2ZPEB 3I9QA 4BY6C 4LDVA 1GBQA 2IG0A 4HCCA 2DIQA 1YWPA 1W2BS 4HT9A 3QYHB 3MO8A 4ZGJB 1VQOQ 2CKKA 4KH0B 2Y4XA 4L59A 3CMAA 2DL3A 3E2UA 2D8JA 2KVQG 2DNUA 3EAEA 2O31A 3RERA 4J9IA 2EKHA 1ZLMA 3LGLA 5FWBA 2FPFA 2K5IA 4FYXB 4E7ZA 4XTZA 3OYKA 2DEUA 3IQLA 1D1CA 5D6XA 1I0CA 2QGFB 4XU0A 4ZN1A 1QVGA 2ZPFB 3M53A 1ABOA 3OW2P 1UFFA 3DKMA 3CC2T 2VWFA 3NTKA 2VXFA 1QW1A 4OMOA 3VS5A 3BY7A 3J80E 4IUPA 2YDLA 1X43A 4M7DF 2CDTA 2EBPA 1Y96A 3OYAA 5GANf 4J9FA 2QA4A 3CCVA 1Q82U 5EG2A 1PNJA 2NLUA 1YJ9T 1KIKA 2KK4A 2X4JA 2L89A 4PFZA 4RTZA 1QCFA 4C5IA 1RL2A 1D0ZA 2BUDA 3PNWC 1SKUB 3V8KA 3HKSA 2PQWA 2QDYB 4E47A 1M3BA 3CBPA 2J06A 4E2FB 2QQSA 3PT9A 1GRIA 4J6XA 2OTJQ 5GMKl 3I55Q 1JJ2S 5IHNA 4JJDA 2FEIA 1KC8R 4AMCA 4E7IA 3GF5A 4CRIA 3OQ5A 3QDRB 3JCMh 2AZSA 3M57A 4X1VA 1NJIR 3OSVA 3Q1JA 2L3RA 2RHIA 1GCQC 2YXYA 1DJ7B 4LD6A 1EIFA 4N4IA 3FLGA 3OYBA 4Z02A 5FRMA 4JUVA 1YITT 5GAN8 3CC2A 2COYA 4F17A 2RHYA 1PSEA 3ZFJA 3L2UA 1E7OA 1WJQA 1Y7XA 4PKCC 5LJ5e 5A0LA 1BIAA 1LVKA 5IHKA 4RTXA 1Q81U 1I5LA 3RUXA 3P8HA 4PFPA 4KGXB 1VQLQ 1QP2A 1TUGB 3GOXA 4CC3A 1RAEB 1YJ9A 4IIMA 1TTHB 4A4GA 4C92C 4C8QB 2XI9A 5GAOq 2A0FB 1PG5B 1KD1R 4M7AC 2C06A 3CMEQ 1PC0A 5CIUA 2F2WA 4Z8AA 2WSFE 5GAMe 1JB0E 2ZZDA 4EMKA 2KYBA 1VQNT 1S72T 1RI0A 4KBMB 1KC8U 1M5Q1 1AWJA 1P92A 4A63B 1NJIU 2DM1A 3QXEB 2M51A 3T9NA 1C6VX 2FL7A 2KGTA 1D3BB 3TSWA 2DL8A 3GPLA 3FDRA 1VQ9Q 1NE8A 2BZYA 4VUBA 4Z88A 4IUUA 2W0ZA 1YITA 4EPCA 2DL5A 5KYXA 3CPFA 4E7HA 3JB9H 3UDCA 3RR6A 2MOXA 3PVQA 1NLOC 2V8KA 3CCST 1D1BA 3VRZA 2CH4W 5GAN4 4J9CA 1UJYA 3OYNA 2JXBA 4A4FA 2QDLA 2Y4YA 3I5SA 3E9GA 2L3SA 1GCQA 5LJ5f 2JTFA 2RJCA 1ZSGA 4OMQA 4L6V5 1KQSS 2K3BA 2D8HA 1E6HA 2HL3A 2X4YA 2LNVA 2DVEA 3TU4K 4C92G 3EG0A 4C5GA 2EYZA 3THKA 1E6GA 4M7AG 4E7JA 1VQNA 5CO7A 1S72A 1AD5A 4C92A 1Q86C 2HZYA 3L2QA 3L2VA 3QIIA 4M7AA 2Y90A 1UB4A 2HQHA 5L8RE 4YTLA 5GAMf 4N4GA 2EQUA 2OTLQ 2DAQA 1EFNA 1MHNA 1K8AR 4KGZB 2IVWA 1VQPQ 5J3BA 4M4ZA 1AWOA 4XTXA 2DK3A 1UGQB 1HXDA 4DBHA 3V7SA 1MUZA 2FRYA 1UHCA 3CCSA 4ANJA 1VQKT 1HSQA 1LCKA 1IXDA 3JB9G 2SEMA 2CUDA 2M1HA 3SD4A 2HEQA 2RF0A 1G5VA 4JRIA 3C0CA 4MDXA 2XG8D 1RUWA 1OPLA 1OPKA 4JLIA 1WGSA 2B8AA 5I21A 1N27A 4PJLA 3G4SQ 3KFVA 1R0BG 2CS7A 3LWHA 1K1ZA 3I5RA 3OBWA 2RI3A 4FL6A 1Q7YU 3P8DA 3X28B 1VQ5Q 5FWCA 1QCOA 3RNJA 2K57A 4XQ3A 1K4US 2DETA 3QZ9B 4FYYB 1Q82C 4J9HA 5DM7R 1M27C 3G6EQ 1VQMT 3P8BB 5EC7A 2RB6A 1FMVA 3REBB 5A0GA 2LJ0A 1K8AU 1H641 3OW2A 3M58A 2ZPIB 2KSSA 4KULA 2BZXA 4BE0A 4PJOB 1QVPA 2KY9A 4GLKA 2DA9A 1V29B 1XOVA 1D0XA 2CP7A 2X3XD 1KHCA 2R5MA 2LJ1A 5LJ3g 4M77F 1BI3A 2LDMA 5GAN3 3GBQA 1W4SA 1BU1A 2A28A 3QDFA 1H8KA 4AFQC 4QKUA 5KYNA 2XKOC 5CKEA 2WSCE 3S6WA 2DYBA 3CC4T 1I07A 2ATCB 1VQ8A 2RJEA 1NEBA 2XDPA 3QWYA 4RTVA 4OVAA 2KNBB 2GBQA 3V7CA 3SWNA 1MNDA 1CKAA 2E41A 1R77A 4RCBA 2JT4A 4KT0E 4FW2A 5LJ3d 3TREA 4BACA 4J9BA 2DXBA 5LJ3j 4MMLA 3QZ5B 2F69A 4F7UB 2RNAA 4ZGEB 1OV3A 2VC8A 1OZ3A 2X9HA 4FT4A 1NPRA 5L23A 5KE2A 5CKBA 1FMWA 1SSFA 2DEQA 1VQMA 2KRMA 3HP9A 2F5TX 4PJOD 2R5AA 1ZSZB 3CD6Q 3NPFA 3VYGA 1GBRA 1N5ZA 2MPXC 3U23A 2RN8A 2PUOB 2EJGA 2GTOA 5IAYA 1KC8C 1N9RA 2A3LA 4FYWB 4JJNK 3SEMA 1Z9ZA 3A8LB 3KUFA 1YI2T 3VS1A 3CCQT 2KROA 3I35A 3CCMT 1YP5A 2LQNA 3VV0A 3KXTA 5GANg 2LZ6B 5C6SA 2B86A 2H3JA 3JRZA 2XD0A 2CP5A 1WHMA 1RLPC 2FG0A 2FVUA 3X25B 2DRKA 1NPPA 3M59A 2L3QA 1VQ7T 2COZA 1M3CA 2P0QA 4BD3A 4OMFB 4C8QC 3OMCA 2CP6A 2LQKA 5GANd 1BI1A 2O88A 3RMQA 5GANj 2XU8A 4C5HA 1KD1C 2A7YA 1FX7A 1K9MC 4IUVA 2XDBA 1AZGB 3OYFA 5LJ3h 4HXJA 1KK7A 2QGGA 2DBKA 2VYTA 1WHLA 1WFWA 4WCIA 4F04B 2E3HA 2AK5A 1NEGA 1WYXA 1PD0A 4ELZC 4IIOA 1YFNA 2RI5A 2YUOA 1G3YA 4CC7A 4NL3A 1YJWT 4FT2A 4N0AC 1Q95G 1Y71A 1J3TA 2QA4Q 3CCVQ 3OYCA 4OGCA 3REAB 1YI2A 1M1GA 4DBRA 5GJWB 2EQMA 3CCQA 3CCMA 3VUBA
chains in the Genus database with same CATH topology
2KYMA 2J7IA 4Z89A 2K6DA 1M3BA 1SPKA 1SEMA 1HJDA 1SRLA 2J06A 1YN8A 2LP5A 1GRIA 1X6GA 1WIEA 2EYWA 2KT1A 2EPDA 4JJDA 5IHNA 2FEIA 4JJBA 1UTIA 1PHTA 2CREA 2ROTA 2ECZA 1PKSA 1AWXA 2JMCA 1X69A 3UF4A 2X3WD 2AZSA 4X1VA 2OAWA 2DMOA 2YUNA 4HCKA 5GJVB 2NUZA 2KRNA 1V1CA 4OMLA 1B07A 3H41A 1GCQC 1MV3A 2GGRA 1FMKA 4AG1C 2RMOA 2YSQA 4F17A 2A37A 2P4RA 1E7OA 2JTEA 2J05A 1NLPC 3VS3A 5IHKA 2RPNA 4OMMA 4RTXA 2XMFA 2DILA 2W10A 4OMPA 2AZVA 4CC3A 4DEYA 2JMAA 4GBQA 4IIMA 1ZUUA 2EYYA 2EVRA 2K79A 4RTYA 1ZBJA 1UDLA 1UE9A 1CKBA 1BK2A 4FSSA 2ABLA 2ROLA 2VKNA 1GFCA 4ORZA 2G6FX 1GL5A 1WA7A 1YWOA 4AFSC 4J9GA 2F2WA 1AEYA 4Z8AA 1BBZA 1AWWA 2KYBA 1SHFA 2AKKA 1VA7A 1PRMC 2KEAA 2GNCA 1AWJA 2RQRA 2ED0A 4LUEA 4A63B 1Z9QA 2CUBA 3RBBB 2DM1A 1SSHA 3UA6A 2M51A 3M0QA 3M0PA 1BB9A 2KGTA 4RTTA 3TSWA 2DL8A 2DX1A 1QKXA 1UG1A 2BZYA 4Z88A 2W0ZA 1PKTA 3ZL7C 1G2BA 1TG0A 2DL5A 3M0TA 1AVZC 1B3QA 4HVVA 2F2XA 2MOXA 2YT6A 2YUPA 1M3AA 4R0KA 3PVQA 1NLOC 2CSQA 2RQUA 1JEGA 2PNIA 4ZNXA 1RLQC 2CT4A 2CH4A 3VRZA 1AOJA 2CH4W 2YUQA 4J9CA 1WDXA 1UJYA 5IXBA 4HVWA 2JXBA 3UA7A 2QDLA 3QWXX 4F14A 2KR3A 3FJ5A 3I5SA 2L3SA 1GCQA 1NYFA 1NG2A 1ZSGA 1WXTA 2KRSA 1KJWA 4OMQA 1I1JA 2K3BA 1T3SA 2D8HA 2L0AA 2LNHB 1E6HA 4GLMA 5IXFA 3CQTA 5HCKA 2GQIA 2K2MA 2HCKA 1VYTA 3SHWA 1K9AA 2RQTA 3EG0A 2HSPA 5I22A 2NWMA 2EYZA 2RQVA 3THKA 1E6GA 1G83A 1NYGA 2O2OA 1AD5A 2JS0A 2KBTA 3LH5A 1HD3A 2LCSA 2IIMA 3PE0A 1GFDA 1KFZA 1PRLC 2RQWA 1NM7A 1H92A 2FPEA 2DF6A 2EYXA 2J6OA 2DBMA 1QKWA 3H0IA 5IH2A 1EFNA 4JPBW 1X2KA 1A0NB 3PVLA 1FYNA 2DVJA 2EGAA 2V1RA 4M4ZA 4ESRA 1AWOA 4JZ3A 4RTUA 3R6NA 2J6KA 1JQQA 2KXDA 4AFZC 5I11A 1AZEA 1TUCA 1MUZA 2FRYA 1UHCA 2I0NA 1HSQA 1LCKA 2V1QA 1UHFA 2A08A 2SEMA 2CUDA 2HEQA 2RF0A 1WXUA 2VVKA 3C0CA 1RUWA 2EGCA 1ABQA 4J9DA 1OPLA 3EG3A 2KT8A 3M0UA 1K0SA 2JM8A 2K9GA 2ED1A 1OPKA 2EQIA 1X27A 1JU5C 3KFVA 4CC4B 1K1ZA 2L3PA 3I5RA 2FPDA 2FO0A 2EGEA 3O5ZA 5IHIA 2PZ1A 1ZUYA 3VS4A 5FWCA 3RNJA 1K4US 1T0JA 1WI7A 1YCSB 1ZUKA 1ZX6A 2DJQA 2HDAA 3VRYA 1PWTA 4J9HA 2PTKA 4HVUA 1M27C 3ULRB 5EC7A 1TUDA 3REBB 4Y92A 2JW4A 1VYVA 2E5KA 2LJ0A 2DL7A 3VS0A 2KE9A 4E6RA 1QWFA 3VS7A 1W1FA 1ARKA 2LMJA 3NGPA 1K0XA 4LN2A 2HBWA 4F16A 2BZXA 2DRMA 3M0SA 4RTWA 2ESWA 2CSIA 3UATA 4D8DA 1YNZA 2DA9A 2A36A 2DLPA 1U5SA 1XOVA 1W70A 1T3LA 1JXOA 2X3XD 1JO8A 4DEXA 2O9SA 2JS2A 2LJ1A 3VS2A 1Y0MA 1GCPA 3GBQA 1BU1A 2A28A 2EW3A 1H8KA 4AFQC 1U3OA 2DYBA 1I07A 1NEBA 1X6BA 1U06A 3QWYA 4JZ4A 4RTVA 2DE0X 2KNBB 4K11A 2GBQA 1M8MA 1T0HA 1CKAA 2O9VA 1OEBA 2DL4A 2JT4A 4J9BA 3EGUA 1M30A 2RNAA 2C0OA 1OV3A 1SHGA 2D0NA 3TVTA 5L23A 1WLPB 2LJ3A 4JJCA 4D8KA 2KRMA 2C0TA 2ENMA 2BTTA 4LUDA 1WXBA 2D1XA 1QLYA 2H8HA 4J9EA 1JXMA 2AKLA 3NPFA 1GBRA 2JM9A 1W6XA 3EHQA 1N5ZA 3U23A 2RN8A 4AG2C 2GTOA 1X2QA 2SRCA 3EHRA 1Y57A 2M0YA 3VS6A 2LX7A 3EG1A 2MCNA 3SEMA 4OMNA 1Z9ZA 3H0HA 1S1NA 3I9QA 3VS1A 1GBQA 2KROA 2CT3A 3I35A 1YP5A 2LQNA 4EIKA 1YWPA 2LQWA 2LZ6B 3NHNA 2B86A 2K7AA 1K76A 3EG2A 3NMZC 1MV0B 1RLPC 2FG0A 4RUGA 2DRKA 2DL3A 2D8JA 2DNUA 2L3QA 3M0RA 1UUEA 1WX6A 2O31A 2J6FA 1M3CA 4J9IA 1UECA 1CSKA 1UGVA 2EKHA 2F2VA 1ZLMA 1RI9A 5FW9A 1VYUA 5FWBA 2FPFA 2GTJA 5ECAA 2O88A 4LE9A 3IQLA 2BZ8A 2OJ2A 1I0CA 1ABOA 1UJ0A 3TSZA 1AZGB 1SRMA 1UFFA 1OOTA 4HXJA 2MIOA 2DBKA 2VWFA 4AFUC 1WFWA 4WCIA 3A98A 4OMOA 2AK5A 1NEGA 1WYXA 3H0FA 1IO6A 3VS5A 2L2PA 2YDLA 4IIOA 1X43A 2YUOA 2KXCA 4QT7A 2CDTA 2EBPA 4CC7A 4J9FA 2OI3A 1H3HA 1PNJA 4CC2A 1KIKA 2FRWA 1J3TA 1KSWA 3REAB 4RTZA 4LNPA 1QCFA 5GJWB 1QWEA 2C0IA 3JV3A 4KRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYM A;  2J7I A;  4Z89 A;  2K6D A;  1M3B A;  1SPK A;  1SEM A;  1HJD A;  1SRL A;  2J06 A;  1YN8 A;  2LP5 A;  1GRI A;  1X6G A;  1WIE A;  2EYW A;  2KT1 A;  2EPD A;  4JJD A;  5IHN A;  2FEI A;  4JJB A;  1UTI A;  1PHT A;  2CRE A;  2ROT A;  2ECZ A;  1PKS A;  1AWX A;  2JMC A;  1X69 A;  3UF4 A;  2X3W D;  2AZS A;  4X1V A;  2OAW A;  2DMO A;  2YUN A;  4HCK A;  5GJV B;  2NUZ A;  2KRN A;  1V1C A;  4OML A;  1B07 A;  3H41 A;  1GCQ C;  1MV3 A;  2GGR A;  1FMK A;  4AG1 C;  2RMO A;  2YSQ A;  4F17 A;  2A37 A;  2P4R A;  1E7O A;  2JTE A;  2J05 A;  1NLP C;  3VS3 A;  5IHK A;  2RPN A;  4OMM A;  4RTX A;  2XMF A;  2DIL A;  2W10 A;  4OMP A;  2AZV A;  4CC3 A;  4DEY A;  2JMA A;  4GBQ A;  4IIM A;  1ZUU A;  2EYY A;  2EVR A;  2K79 A;  4RTY A;  1ZBJ A;  1UDL A;  1UE9 A;  1CKB A;  1BK2 A;  4FSS A;  2ABL A;  2ROL A;  2VKN A;  1GFC A;  4ORZ A;  2G6F X;  1GL5 A;  1WA7 A;  1YWO A;  4AFS C;  4J9G A;  2F2W A;  1AEY A;  4Z8A A;  1BBZ A;  1AWW A;  2KYB A;  1SHF A;  2AKK A;  1VA7 A;  1PRM C;  2KEA A;  2GNC A;  1AWJ A;  2RQR A;  2ED0 A;  4LUE A;  4A63 B;  1Z9Q A;  2CUB A;  3RBB B;  2DM1 A;  1SSH A;  3UA6 A;  2M51 A;  3M0Q A;  3M0P A;  1BB9 A;  2KGT A;  4RTT A;  3TSW A;  2DL8 A;  2DX1 A;  1QKX A;  1UG1 A;  2BZY A;  4Z88 A;  2W0Z A;  1PKT A;  3ZL7 C;  1G2B A;  1TG0 A;  2DL5 A;  3M0T A;  1AVZ C;  1B3Q A;  4HVV A;  2F2X A;  2MOX A;  2YT6 A;  2YUP A;  1M3A A;  4R0K A;  3PVQ A;  1NLO C;  2CSQ A;  2RQU A;  1JEG A;  2PNI A;  4ZNX A;  1RLQ C;  2CT4 A;  2CH4 A;  3VRZ A;  1AOJ A;  2CH4 W;  2YUQ A;  4J9C A;  1WDX A;  1UJY A;  5IXB A;  4HVW A;  2JXB A;  3UA7 A;  2QDL A;  3QWX X;  4F14 A;  2KR3 A;  3FJ5 A;  3I5S A;  2L3S A;  1GCQ A;  1NYF A;  1NG2 A;  1ZSG A;  1WXT A;  2KRS A;  1KJW A;  4OMQ A;  1I1J A;  2K3B A;  1T3S A;  2D8H A;  2L0A A;  2LNH B;  1E6H A;  4GLM A;  5IXF A;  3CQT A;  5HCK A;  2GQI A;  2K2M A;  2HCK A;  1VYT A;  3SHW A;  1K9A A;  2RQT A;  3EG0 A;  2HSP A;  5I22 A;  2NWM A;  2EYZ A;  2RQV A;  3THK A;  1E6G A;  1G83 A;  1NYG A;  2O2O A;  1AD5 A;  2JS0 A;  2KBT A;  3LH5 A;  1HD3 A;  2LCS A;  2IIM A;  3PE0 A;  1GFD A;  1KFZ A;  1PRL C;  2RQW A;  1NM7 A;  1H92 A;  2FPE A;  2DF6 A;  2EYX A;  2J6O A;  2DBM A;  1QKW A;  3H0I A;  5IH2 A;  1EFN A;  4JPB W;  1X2K A;  1A0N B;  3PVL A;  1FYN A;  2DVJ A;  2EGA A;  2V1R A;  4M4Z A;  4ESR A;  1AWO A;  4JZ3 A;  4RTU A;  3R6N A;  2J6K A;  1JQQ A;  2KXD A;  4AFZ C;  5I11 A;  1AZE A;  1TUC A;  1MUZ A;  2FRY A;  1UHC A;  2I0N A;  1HSQ A;  1LCK A;  2V1Q A;  1UHF A;  2A08 A;  2SEM A;  2CUD A;  2HEQ A;  2RF0 A;  1WXU A;  2VVK A;  3C0C A;  1RUW A;  2EGC A;  1ABQ A;  4J9D A;  1OPL A;  3EG3 A;  2KT8 A;  3M0U A;  1K0S A;  2JM8 A;  2K9G A;  2ED1 A;  1OPK A;  2EQI A;  1X27 A;  1JU5 C;  3KFV A;  4CC4 B;  1K1Z A;  2L3P A;  3I5R A;  2FPD A;  2FO0 A;  2EGE A;  3O5Z A;  5IHI A;  2PZ1 A;  1ZUY A;  3VS4 A;  5FWC A;  3RNJ A;  1K4U S;  1T0J A;  1WI7 A;  1YCS B;  1ZUK A;  1ZX6 A;  2DJQ A;  2HDA A;  3VRY A;  1PWT A;  4J9H A;  2PTK A;  4HVU A;  1M27 C;  3ULR B;  5EC7 A;  1TUD A;  3REB B;  4Y92 A;  2JW4 A;  1VYV A;  2E5K A;  2LJ0 A;  2DL7 A;  3VS0 A;  2KE9 A;  4E6R A;  1QWF A;  3VS7 A;  1W1F A;  1ARK A;  2LMJ A;  3NGP A;  1K0X A;  4LN2 A;  2HBW A;  4F16 A;  2BZX A;  2DRM A;  3M0S A;  4RTW A;  2ESW A;  2CSI A;  3UAT A;  4D8D A;  1YNZ A;  2DA9 A;  2A36 A;  2DLP A;  1U5S A;  1XOV A;  1W70 A;  1T3L A;  1JXO A;  2X3X D;  1JO8 A;  4DEX A;  2O9S A;  2JS2 A;  2LJ1 A;  3VS2 A;  1Y0M A;  1GCP A;  3GBQ A;  1BU1 A;  2A28 A;  2EW3 A;  1H8K A;  4AFQ C;  1U3O A;  2DYB A;  1I07 A;  1NEB A;  1X6B A;  1U06 A;  3QWY A;  4JZ4 A;  4RTV A;  2DE0 X;  2KNB B;  4K11 A;  2GBQ A;  1M8M A;  1T0H A;  1CKA A;  2O9V A;  1OEB A;  2DL4 A;  2JT4 A;  4J9B A;  3EGU A;  1M30 A;  2RNA A;  2C0O A;  1OV3 A;  1SHG A;  2D0N A;  3TVT A;  5L23 A;  1WLP B;  2LJ3 A;  4JJC A;  4D8K A;  2KRM A;  2C0T A;  2ENM A;  2BTT A;  4LUD A;  1WXB A;  2D1X A;  1QLY A;  2H8H A;  4J9E A;  1JXM A;  2AKL A;  3NPF A;  1GBR A;  2JM9 A;  1W6X A;  3EHQ A;  1N5Z A;  3U23 A;  2RN8 A;  4AG2 C;  2GTO A;  1X2Q A;  2SRC A;  3EHR A;  1Y57 A;  2M0Y A;  3VS6 A;  2LX7 A;  3EG1 A;  2MCN A;  3SEM A;  4OMN A;  1Z9Z A;  3H0H A;  1S1N A;  3I9Q A;  3VS1 A;  1GBQ A;  2KRO A;  2CT3 A;  3I35 A;  1YP5 A;  2LQN A;  4EIK A;  1YWP A;  2LQW A;  2LZ6 B;  3NHN A;  2B86 A;  2K7A A;  1K76 A;  3EG2 A;  3NMZ C;  1MV0 B;  1RLP C;  2FG0 A;  4RUG A;  2DRK A;  2DL3 A;  2D8J A;  2DNU A;  2L3Q A;  3M0R A;  1UUE A;  1WX6 A;  2O31 A;  2J6F A;  1M3C A;  4J9I A;  1UEC A;  1CSK A;  1UGV A;  2EKH A;  2F2V A;  1ZLM A;  1RI9 A;  5FW9 A;  1VYU A;  5FWB A;  2FPF A;  2GTJ A;  5ECA A;  2O88 A;  4LE9 A;  3IQL A;  2BZ8 A;  2OJ2 A;  1I0C A;  1ABO A;  1UJ0 A;  3TSZ A;  1AZG B;  1SRM A;  1UFF A;  1OOT A;  4HXJ A;  2MIO A;  2DBK A;  2VWF A;  4AFU C;  1WFW A;  4WCI A;  3A98 A;  4OMO A;  2AK5 A;  1NEG A;  1WYX A;  3H0F A;  1IO6 A;  3VS5 A;  2L2P A;  2YDL A;  4IIO A;  1X43 A;  2YUO A;  2KXC A;  4QT7 A;  2CDT A;  2EBP A;  4CC7 A;  4J9F A;  2OI3 A;  1H3H A;  1PNJ A;  4CC2 A;  1KIK A;  2FRW A;  1J3T A;  1KSW A;  3REA B;  4RTZ A;  4LNP A;  1QCF A;  5GJW B;  1QWE A;  2C0I A;  3JV3 A;  4KRT A; 
#chains in the Genus database with same CATH topology
 3V8J A;  1QVF S;  2LTO A;  2J7I A;  1VUB A;  4J7I A;  4ME7 A;  4Z89 A;  4X34 A;  4ZGD B;  5CQY A;  3JCM W;  3N5B B;  1SEM A;  2LP5 A;  3CCU Q;  1WIE A;  1VQ7 A;  2EYW A;  2KT1 A;  2ECZ A;  1PKS A;  2BKD N;  5GAN 7;  5GMK e;  2EFI A;  2OAW A;  2DMO A;  1U1S A;  4EMG A;  2NUZ A;  3GP8 A;  5CKH A;  3QSU A;  4OML A;  3A1P A;  3G71 Q;  1TSF A;  3H41 A;  2DTO A;  2ZAE A;  5CAI A;  1YHQ T;  2RMO A;  1PD1 A;  4M77 B;  2A37 A;  2P4R A;  3HHT B;  3HRS A;  5KYW A;  4M75 B;  1BYM A;  1Q86 U;  2CP3 A;  2JTE A;  1M9S A;  2J05 A;  1WHK A;  3CC2 Q;  1N8R C;  2MK5 A;  2DJZ A;  2NUT B;  2KI7 A;  1W2B P;  2XMF A;  5GAN h;  3PMI A;  3EG9 A;  2XHC A;  4X9C A;  1YJW A;  2AZV A;  1AT1 B;  4M7D C;  1ZUU A;  1PSF A;  1UDL A;  1YJ9 Q;  1BK2 A;  2ABL A;  3BE3 A;  1IRX A;  2VKN A;  2VXE A;  1K8A C;  3X20 B;  2MYS A;  4M78 B;  3V8L A;  1B34 A;  4LDW A;  1GL5 A;  1WA7 A;  4A4E A;  5LJ5 g;  2CZ1 B;  2LCC A;  3WVE B;  1SF9 A;  3JB9 J;  1D3B A;  3LW5 E;  1OUL A;  4Y28 E;  2FZC B;  2DYI A;  3MET A;  2ED0 A;  4XTV A;  3SDZ A;  1LNX A;  3RBB B;  2FZG B;  1SSH A;  3I56 T;  1WZO A;  3M0P A;  4J6W A;  5FLX E;  2K5L A;  2DX1 A;  5LJ5 d;  4M75 D;  3MP1 A;  2E64 A;  1YHQ A;  4PLL A;  4PFO A;  3ZL7 C;  6AT1 B;  3M0T A;  1TG0 A;  1B3Q A;  2CZ0 B;  5GAM g;  1YIT Q;  4HVV A;  1KHI A;  2F2X A;  1M3A A;  4R0K A;  4XTU A;  1BIB A;  2CSQ A;  1JEG A;  4ZNX A;  2CH4 A;  3EGD B;  1WDX A;  3C95 A;  2GF7 A;  4HVW A;  2HD0 A;  3PIO A;  3QWX X;  2QEX T;  1VQ4 T;  1JRI A;  4M78 D;  1JJ2 P;  1KJW A;  1WJR A;  4GLM A;  5GAM d;  5IXF A;  2XDD A;  3S3M A;  2GQI A;  2K2M A;  4PJO C;  4PJJ A;  3JCM P;  1K9A A;  3OB9 A;  3OBY A;  3E1S A;  2NWM A;  2RQV A;  1VQO T;  3X24 B;  2O2O A;  2JS0 A;  3JCM e;  4EMH A;  1HD3 A;  5KYU B;  1S72 Q;  4BDY A;  1M2V B;  3OYY A;  3QKJ A;  2YHT A;  2EQJ A;  2K3Y A;  3I56 A;  3EGX B;  4OF1 A;  2DBM A;  4E7L A;  4JRQ A;  2RH2 A;  1QKW A;  1M1K C;  4BI3 A;  1OX8 A;  1X2K A;  3PVL A;  4LXC A;  2DVJ A;  4A4K A;  2V1R A;  4C0G A;  2MF2 A;  3CPW S;  2KQW A;  4AFZ C;  2I0N A;  3OA6 A;  2V1Q A;  4MDW A;  2A08 A;  4QQG A;  3CCS Q;  3VU3 C;  2QEX A;  3JCM V;  1WHH A;  1VQ4 A;  2PVO B;  2QAZ A;  2WSE E;  1K9M R;  3UT1 A;  1ABQ A;  1ZSZ C;  4J9D A;  3MCA B;  4PLI A;  3M0U A;  1XNI A;  3OYG A;  2EQI A;  5KE3 A;  3CC7 Q;  2VAS A;  2YLC A;  5CKF A;  4P5N A;  3JAM E;  1BI0 A;  2L3P A;  1VQO A;  3O5Z A;  2IPO B;  2OTJ T;  1M90 C;  3VS4 A;  4PJO G;  1WI7 A;  1YIJ T;  2DJQ A;  2HMA A;  1TOV A;  5GAO p;  3JCM c;  2PTK A;  2EWN A;  3FEO A;  4PJO A;  1VYV A;  5CCA A;  1D0Y A;  4PL6 A;  3JCM f;  3JCM X;  2L5Q A;  5D6W A;  1KQ2 A;  3CCL Q;  1ARK A;  3SFM A;  3EH2 A;  2NUP A;  3VJP A;  2K4Y A;  4C8Q D;  1X75 C;  1KQS P;  1YNZ A;  2QAS A;  2M9U A;  2DLP A;  2CGH A;  3CCR Q;  1JO8 A;  3QO3 A;  1H3Z A;  2D6F A;  3M54 A;  1KD1 U;  3CXC S;  3VS2 A;  1K9M U;  4F7U G;  4C92 F;  3CCJ T;  2LX9 A;  4B9W A;  5FU6 B;  3URG A;  2XIC A;  4M7A F;  3C12 A;  1WHG A;  4C5E A;  2AT1 B;  2JUF A;  2DPP B;  4II1 A;  4F7U A;  3CME T;  4K11 A;  1N8R R;  2G3R A;  4FU6 A;  1T0H A;  3HTR A;  1VQ8 Q;  4RG2 A;  2GQV A;  2OTJ A;  1U1T A;  3TVT A;  2RO0 A;  3OS5 A;  3CEY A;  1WLP B;  1IHV A;  5CR2 A;  1UGS B;  3QYG B;  3QJY A;  1TXQ A;  1I4K 1;  4M7D B;  3OMG A;  3QUI A;  4BDZ A;  4R55 A;  5AYF A;  2BTT A;  4E7K A;  3A8M B;  4J9E A;  3JB9 F;  1JXM A;  2JM9 A;  1W6X A;  3EHQ A;  2KDS A;  1M1K R;  2F5K A;  7AT1 B;  2SRC A;  1W2B A;  1Y57 A;  4MZP A;  3VS6 A;  3HRU A;  1MMG A;  3EG1 A;  3L2W A;  2E5Q A;  1OU8 A;  1ACM B;  3D7S B;  3CCJ A;  1TU0 B;  4C92 E;  2BIV A;  4M7A E;  4AT1 B;  2P0K A;  4M77 C;  4HKE A;  4M75 C;  1N8R U;  3A8O B;  3ER0 A;  1K76 A;  3EG2 A;  3H8Z A;  2VGM A;  2LRQ A;  3MEA A;  3DB3 A;  4JRP A;  4OB0 B;  4M7D D;  3M55 A;  1UEC A;  1CSK A;  1UGV A;  2F2V A;  2YWW A;  1PM3 A;  1VYU A;  2VB6 A;  2GTJ A;  5ECA A;  1JBM A;  5KH6 A;  2CP0 A;  2BZ8 A;  2OTL T;  4M78 C;  3E9F A;  4OB1 B;  4OGE A;  4EMK B;  1OOT A;  2MIO A;  1VQK A;  4AFU C;  1M1K U;  2QQB A;  1X6O A;  3C4S A;  3A98 A;  3GLX A;  3PTA A;  3H0F A;  2M16 A;  5GAN 6;  4FCY A;  1VQ6 T;  2LT1 A;  4X9D A;  2KXC A;  3H6Z A;  1ZA2 B;  1QVG S;  2OI3 A;  1UGR B;  1H3H A;  4B9X A;  3OYL A;  1Y07 A;  4LDY A;  4CC2 A;  2QTV A;  2DD5 A;  2FRW A;  1JJ2 A;  2QQ9 A;  5FRN A;  4LNP A;  5KYX B;  2YRD A;  4LDU A;  2C0I A;  4J8O A;  1MNE A;  2CYZ B;  1YI2 Q;  2GCX A;  3ZBD A;  3RMS A;  3CCQ Q;  3G4S T;  3CCM Q;  1VIF A;  2K6D A;  1SPK A;  1HJD A;  4XU3 A;  8AT1 B;  1X6G A;  3BW1 A;  2EPD A;  1U8R A;  4M75 G;  3L2Z A;  1PHT A;  2CRE A;  2ROT A;  1VQ7 Q;  1YJN T;  1RAB B;  2JMC A;  3UF4 A;  3TQ7 P;  2PVD B;  2KRN A;  1UEB A;  2GGR A;  1QQJ A;  2NUT A;  2KAF A;  4AG1 C;  3CBO A;  2YSQ A;  1M90 R;  2JN0 A;  4JDS A;  4E7S A;  5D6Y A;  2BE7 D;  1NLP C;  4M78 G;  3VS3 A;  1VQ6 A;  2RPN A;  5J39 A;  2W10 A;  1D1A A;  3VYH B;  4OMP A;  2JMA A;  4GBQ A;  3CC4 A;  3CCE Q;  4FIB A;  5GAO m;  1YJW Q;  1ZBJ A;  3MPU B;  1UE9 A;  1K73 R;  3NFC A;  1GXI E;  4FSS A;  1ZA1 B;  2RK1 A;  2ROL A;  4QVZ A;  1WNL A;  3G4S A;  2MAM A;  4BE2 A;  1YWO A;  3MP8 A;  3RKX A;  4AFS C;  5IN1 A;  2X35 A;  5GAO n;  2DD4 A;  1BBZ A;  2DXC A;  3CMA Q;  2RD1 A;  1G3S A;  2AKK A;  2HSE B;  1VA7 A;  4A4H A;  5GMK j;  2O01 E;  1YJN A;  2RQR A;  3OYE A;  2RK2 A;  5CVI A;  3LH0 A;  2F1L A;  2CUB A;  2MWP A;  2DZC A;  3M0Q A;  1BB9 A;  1I81 A;  4RTT A;  1G8X A;  2DTH A;  1UG1 A;  3CD6 T;  1M90 U;  4XU1 A;  1G2B A;  5KCO A;  1AVZ C;  1KQS A;  3MJX A;  2JZ2 A;  2GFU A;  3RKW A;  2BE9 B;  3DLM A;  3NTH A;  1QVF P;  2R57 A;  5IT9 E;  3S3N A;  1AOJ A;  5IXB A;  4Q5W A;  3UA7 A;  4XK8 E;  1WPY A;  2KR3 A;  3H9N A;  1IGU A;  1NG2 A;  1WXT A;  2KRS A;  1I1J A;  1T3S A;  2LNH B;  2O4X B;  2E3I A;  3CQT A;  5HCK A;  2HCK A;  1VYT A;  1M8V A;  4PNO A;  3SHW A;  4UC4 A;  2RQT A;  4L5G A;  1M2V A;  3J7A F;  4QVD A;  3WVD B;  3RDV A;  1G83 A;  1LJO A;  3A8G B;  4QQ6 A;  2M02 A;  2DIG A;  2I2L A;  2MMP A;  2KBT A;  3MEU A;  8ATC B;  3LH5 A;  3FC3 A;  5FU6 C;  2IIM A;  3PE0 A;  4XU2 A;  3FRN A;  2EJ9 A;  2EAY A;  2PU9 B;  3QHS A;  3SWN B;  1NM7 A;  4BUG A;  4C8Q G;  5GAN 2;  1H92 A;  2FPE A;  2HQE A;  2J6O A;  2QTX A;  4JPB W;  4NL2 A;  4IUR A;  9ATC B;  3CD6 A;  2EIF A;  5GMK h;  4C8Q A;  3LWI A;  2EGA A;  3VKI A;  4RTU A;  2J6K A;  1JQQ A;  2ZPG B;  2KXD A;  1TUC A;  3JCM g;  2JNG A;  4WTO B;  5I2S A;  2DTI A;  4JLG A;  2QK0 A;  4FW1 A;  3JB9 I;  2VVK A;  2EGC A;  3HRT A;  3EG3 A;  2JM8 A;  2ED1 A;  1N9S A;  1RAA B;  1JU5 C;  1ZHI A;  3DLL A;  3JCM d;  4CC4 B;  2FPD A;  4N0A A;  1IZ6 A;  2E65 A;  3RIR A;  2FO0 A;  1OYX A;  2EGE A;  5IHI A;  2PZ1 A;  4QQD A;  2DZ9 A;  3J81 E;  1MGQ A;  3RKY A;  3CCU T;  4RCC A;  3V7R A;  3HPW A;  3BFM A;  4FYV B;  4C8Q E;  4NOY A;  2RJF A;  1T0J A;  1YCS B;  3SB2 A;  3TCJ A;  3AHU A;  1RAI B;  4M77 D;  1WQ7 A;  5CK9 A;  1B7T A;  1PWT A;  5LJ5 j;  1OX9 A;  4Y92 A;  2E5K A;  4OB2 B;  1RAG B;  4MMK A;  5FU7 B;  3G7Z A;  3VS0 A;  3OYI A;  3G71 T;  3LYI A;  2GFA A;  2EYQ A;  2LMJ A;  3GNG A;  1K0X A;  5GMK i;  1NZ9 A;  4C0D B;  4F16 A;  3M0S A;  4RTW A;  2K5F A;  2ESW A;  4PK4 A;  4DQ2 A;  4HT8 A;  2CSI A;  2QQA A;  1RAC B;  2XID A;  4LDX A;  2XK0 A;  4IKF A;  2A36 A;  4J83 A;  1U5S A;  1W70 A;  1JXO A;  4KGV B;  2X4X A;  4DEX A;  2HBP A;  2O9S A;  1I8F A;  3EFO B;  3OW2 S;  1Y0M A;  1MMN A;  4EMK C;  1Q81 R;  3PFS A;  2DXU A;  1U3O A;  5GAM j;  2E4H A;  2VUB A;  5D7U A;  4J6Y A;  2JVV A;  4M7D G;  1X01 A;  2LCL A;  4BI8 B;  4JZ4 A;  2DE0 X;  2MWO A;  1M8M A;  4D6W A;  2JTM A;  1R0C B;  3JCM b;  1YIJ A;  3CCU A;  1SG5 A;  1N6A A;  4M7D A;  1VQN Q;  2YRC A;  2QQR A;  1RAF B;  1M30 A;  2QXF A;  1F1B B;  1TS9 A;  2NYS A;  2D0N A;  3JCM J;  1I5O B;  2AIR B;  2M0O A;  4JJC A;  2DFU A;  3CPW P;  1LOJ A;  4D8K A;  2C0T A;  3JSC A;  5GAO l;  5KYY B;  2QG9 B;  3M4Y A;  3G71 A;  1WXB A;  2D1X A;  1QLY A;  4JS4 A;  2AKL A;  4QW2 A;  2QYZ A;  1MMA A;  4C0F A;  3L2R A;  3OS0 A;  1X2Q A;  3EHR A;  3C94 A;  5LJ5 h;  4KUD K;  2LX7 A;  3HFN A;  3LGF A;  2MCN A;  5I2M A;  4M7D E;  4C0Z A;  4A53 A;  2OX7 A;  1IGQ A;  3H0H A;  4DBQ A;  4IUT A;  5KYW B;  3CCJ Q;  3RES A;  1TWB A;  2CT3 A;  4PJO F;  4EIK A;  1M4Z A;  4KUI A;  2LQW A;  2WAC A;  2L8D A;  3NHN A;  3QG1 A;  2H3E B;  2K7A A;  3R6O A;  3EG9 B;  2HKN A;  3NMZ C;  1MV0 B;  5CKD A;  3I55 T;  4RUG A;  1OU9 A;  3M0R A;  1UUE A;  1WX6 A;  2J6F A;  4DBF A;  4HCZ A;  5C0M A;  5GAM h;  4N4H A;  4MZT A;  3LX7 A;  1RI9 A;  3G1J A;  2X51 A;  5FW9 A;  1B34 B;  1TH7 A;  4HA8 A;  4LE9 A;  1O75 A;  1K73 C;  2OJ2 A;  1OQK A;  5GAN 5;  1UJ0 A;  3TSZ A;  2LVM A;  3WXM B;  1XTD A;  3CXC P;  1SRM A;  2V8J A;  4F7U F;  3NTI A;  3GNF B;  4PJM A;  4LD9 K;  3FB9 A;  2X4W A;  5AT1 B;  1IO6 A;  1VQK Q;  2L2P A;  1VQL T;  1BKB A;  1QVF A;  4QT7 A;  5A2Q E;  2E10 A;  4EDU A;  4IUQ A;  4B6M A;  4O5V A;  3DB4 A;  1KSW A;  4QVC A;  1Y96 B;  5LL6 S;  1QWE A;  2VGN A;  4PJO E;  3JV3 A;  4KRT A;  1M2O A;  3CC7 T;  2RHU A;  3FIF A;  2KYM A;  2ZGW A;  3I55 A;  3BDL A;  1SRL A;  1YN8 A;  2HL5 C;  3JCM Q;  1WJS A;  1ZSZ A;  2RJD A;  4JJB A;  3CBM A;  1UTI A;  3ME9 A;  1VOM A;  2E6Z A;  1Q7Y R;  1AWX A;  4ZTF A;  1X69 A;  2X3W D;  1BCM A;  1KQ1 A;  1VQM Q;  2YUN A;  4HCK A;  5GJV B;  1VQ9 T;  1V1C A;  3F70 A;  2P4T A;  1B07 A;  1MV3 A;  3PMT A;  1FMK A;  4BY6 B;  3CCL T;  2EKO A;  1EX4 A;  1VIE A;  4F7U E;  4KH1 B;  2P84 A;  2E12 A;  2COW A;  1QCN A;  4BE1 A;  1VQL A;  3X26 B;  4OMM A;  2PUK B;  2DIL A;  2KMT A;  3CCR T;  1WQW A;  3SWN C;  2HQX A;  1VQ6 Q;  3UPU A;  2E1H A;  2RHX A;  4DEY A;  4ATO A;  1G3T A;  5J26 A;  4CI0 C;  4XTW A;  2EYY A;  2EVR A;  1WHJ A;  2K79 A;  4O6J A;  4RTY A;  3CME A;  1CKB A;  4ZTJ A;  3CC4 Q;  3EH1 A;  4FSX A;  2JJ9 A;  3CC7 A;  1GFC A;  4ORZ A;  4J5Y A;  3INZ A;  2G6F X;  4J9G A;  1VQ8 T;  1AEY A;  3TEE A;  3MEW A;  1AWW A;  1SHF A;  3EFR A;  3OYD A;  1PRM C;  2YLB A;  1NBE B;  4OB3 B;  2KEA A;  2GNC A;  3OS2 A;  2EJF A;  3A8H B;  4LUE A;  3OYM A;  1RAH B;  3QPH A;  1Z9Q A;  5GAO r;  2RI2 A;  1VQ9 A;  1YJN Q;  3UA6 A;  1VQP T;  4A54 A;  1QKX A;  3OYH A;  2FHD A;  1QVG P;  2LQ8 A;  3L1A A;  2ZCF B;  3CCL A;  1PKT A;  2D0Q B;  2HKQ B;  2YT6 A;  2YUP A;  2RA2 A;  4TVR A;  2RQU A;  2PNI A;  2E6N A;  1RLQ C;  2CT4 A;  3MEV A;  4WF2 A;  3CCR A;  2YUQ A;  4OP0 A;  2AHJ B;  2O4X A;  2FZK B;  5HK3 A;  5FU7 C;  4F14 A;  3FJ5 A;  2NUP B;  2V8I A;  1NYF A;  2LC4 A;  2L0A A;  3ZEH A;  4M75 F;  4C0D C;  2HAX A;  5DLO A;  4DOV A;  3E19 A;  4M77 G;  2QI2 A;  2HSP A;  2D9T A;  5I22 A;  4PJN A;  1VQ5 T;  1NYG A;  5M9O A;  1RAD B;  4MZM A;  2LCS A;  4M77 A;  3G6E T;  4M75 A;  2OTL A;  1GFD A;  3CPW A;  1KFZ A;  1PRL C;  2RQW A;  1D09 B;  1XQH A;  3FJP A;  1Q81 C;  4J7F A;  3QBY A;  4M78 F;  3QJ6 A;  2DF6 A;  2EYX A;  1VQP A;  2CZ6 B;  3M9Q A;  3H0I A;  4C92 B;  5IH2 A;  2V26 A;  4M7A B;  1A0N B;  1FYN A;  1R8O B;  4ESR A;  4JZ3 A;  3HFO A;  1O9S A;  3R6N A;  1FWZ A;  5HY6 A;  5GMK m;  5I11 A;  1AZE A;  3OS1 A;  4M78 A;  1UHF A;  3MP6 A;  3EFS A;  3OSS C;  1IB8 A;  1WXU A;  2ZPB B;  1BI2 A;  2DO3 A;  3VUZ A;  2KT8 A;  1K0S A;  2K9G A;  4M77 E;  2PVG B;  3MHX A;  4M75 E;  1YCY A;  1X27 A;  1NJI C;  4V2S A;  5HKC A;  2RM4 A;  4BI4 A;  1VQ5 A;  3ASK A;  1AHJ B;  2LT4 A;  1ZUY A;  3L42 A;  5HK0 A;  5KCH A;  4GY5 A;  2FB7 A;  4HCB A;  3G6E A;  2JOY A;  1ZUK A;  1ZX6 A;  2HDA A;  3VRY A;  1KG1 A;  4C92 D;  5LJ3 e;  4JS5 A;  4HVU A;  3ULR B;  3UWN A;  4M7A D;  1TUD A;  2Z0W A;  3O8V A;  2JW4 A;  3KBG A;  4Y91 A;  2ZPH B;  3EGD A;  4M78 E;  5A0D A;  2DL7 A;  2KE9 A;  5DLQ E;  4E6R A;  1QWF A;  3VS7 A;  1W1F A;  5CQX A;  2FYK A;  3CXC A;  2HNI A;  3NGP A;  1YHQ Q;  4LN2 A;  3EFO A;  2HBW A;  3A5Z B;  2DRM A;  2CZ7 B;  4ZN3 A;  3UAT A;  4D8D A;  1C0M A;  1T3L A;  3M56 A;  3GIB A;  3M4G A;  1HYO A;  2RHZ A;  4RG8 A;  1Q86 R;  2JS2 A;  1K73 U;  1MMD A;  1GCP A;  4XAX B;  2EW3 A;  3HL8 A;  3CCE T;  1V76 A;  2P0P A;  1OI1 A;  3PIP A;  5KYU A;  1HK9 A;  1X6B A;  1U06 A;  3JB9 D;  5FRO A;  4BB7 A;  1M1F A;  1IHW A;  3AT1 B;  2O9V A;  1QP3 A;  1C1A A;  4DA4 A;  3EGX A;  4C8Q F;  3BDU A;  1OEB A;  2DL4 A;  3OY9 A;  4ELY C;  3CMA T;  2R58 A;  4NS5 A;  3EGU A;  3PGG A;  2C0O A;  2K3X A;  1YIJ Q;  2E70 A;  1SHG A;  5KYY A;  2MI6 A;  2CP2 A;  3HSB A;  2LJ3 A;  1FXX A;  2OAU A;  3I56 Q;  3M5A A;  2EQK A;  1YBY A;  3S3O A;  2VV5 A;  1BCO A;  1ZBX A;  2ENM A;  5DY9 A;  4LUD A;  2DXT A;  2H8H A;  1OZ2 A;  5GAN e;  1PCX A;  1G3W A;  5LJ3 f;  3LLR A;  2YRV A;  2K2V A;  4R56 A;  3MKD A;  4DOW A;  4AG2 C;  1ZQ1 A;  2M0Y A;  1EZZ B;  2DER A;  1UGP B;  4JRK A;  2QA4 T;  2DKG A;  3CCV T;  1Q7Y C;  2QEX Q;  1XJW B;  1Q82 R;  1QMC A;  4XTY A;  4RMO A;  1VQ4 Q;  4FM4 B;  4OMN A;  3CCE A;  1LPL A;  4RKU E;  1IRE B;  1S1N A;  3OYJ A;  2ZPE B;  3I9Q A;  4BY6 C;  4LDV A;  1GBQ A;  2IG0 A;  4HCC A;  2DIQ A;  1YWP A;  1W2B S;  4HT9 A;  3QYH B;  3MO8 A;  4ZGJ B;  1VQO Q;  2CKK A;  4KH0 B;  2Y4X A;  4L59 A;  3CMA A;  2DL3 A;  3E2U A;  2D8J A;  2KVQ G;  2DNU A;  3EAE A;  2O31 A;  3RER A;  4J9I A;  2EKH A;  1ZLM A;  3LGL A;  5FWB A;  2FPF A;  2K5I A;  4FYX B;  4E7Z A;  4XTZ A;  3OYK A;  2DEU A;  3IQL A;  1D1C A;  5D6X A;  1I0C A;  2QGF B;  4XU0 A;  4ZN1 A;  1QVG A;  2ZPF B;  3M53 A;  1ABO A;  3OW2 P;  1UFF A;  3DKM A;  3CC2 T;  2VWF A;  3NTK A;  2VXF A;  1QW1 A;  4OMO A;  3VS5 A;  3BY7 A;  3J80 E;  4IUP A;  2YDL A;  1X43 A;  4M7D F;  2CDT A;  2EBP A;  1Y96 A;  3OYA A;  5GAN f;  4J9F A;  2QA4 A;  3CCV A;  1Q82 U;  5EG2 A;  1PNJ A;  2NLU A;  1YJ9 T;  1KIK A;  2KK4 A;  2X4J A;  2L89 A;  4PFZ A;  4RTZ A;  1QCF A;  4C5I A;  1RL2 A;  1D0Z A;  2BUD A;  3PNW C;  1SKU B;  3V8K A;  3HKS A;  2PQW A;  2QDY B;  4E47 A;  1M3B A;  3CBP A;  2J06 A;  4E2F B;  2QQS A;  3PT9 A;  1GRI A;  4J6X A;  2OTJ Q;  5GMK l;  3I55 Q;  1JJ2 S;  5IHN A;  4JJD A;  2FEI A;  1KC8 R;  4AMC A;  4E7I A;  3GF5 A;  4CRI A;  3OQ5 A;  3QDR B;  3JCM h;  2AZS A;  3M57 A;  4X1V A;  1NJI R;  3OSV A;  3Q1J A;  2L3R A;  2RHI A;  1GCQ C;  2YXY A;  1DJ7 B;  4LD6 A;  1EIF A;  4N4I A;  3FLG A;  3OYB A;  4Z02 A;  5FRM A;  4JUV A;  1YIT T;  5GAN 8;  3CC2 A;  2COY A;  4F17 A;  2RHY A;  1PSE A;  3ZFJ A;  3L2U A;  1E7O A;  1WJQ A;  1Y7X A;  4PKC C;  5LJ5 e;  5A0L A;  1BIA A;  1LVK A;  5IHK A;  4RTX A;  1Q81 U;  1I5L A;  3RUX A;  3P8H A;  4PFP A;  4KGX B;  1VQL Q;  1QP2 A;  1TUG B;  3GOX A;  4CC3 A;  1RAE B;  1YJ9 A;  4IIM A;  1TTH B;  4A4G A;  4C92 C;  4C8Q B;  2XI9 A;  5GAO q;  2A0F B;  1PG5 B;  1KD1 R;  4M7A C;  2C06 A;  3CME Q;  1PC0 A;  5CIU A;  2F2W A;  4Z8A A;  2WSF E;  5GAM e;  1JB0 E;  2ZZD A;  4EMK A;  2KYB A;  1VQN T;  1S72 T;  1RI0 A;  4KBM B;  1KC8 U;  1M5Q 1;  1AWJ A;  1P92 A;  4A63 B;  1NJI U;  2DM1 A;  3QXE B;  2M51 A;  3T9N A;  1C6V X;  2FL7 A;  2KGT A;  1D3B B;  3TSW A;  2DL8 A;  3GPL A;  3FDR A;  1VQ9 Q;  1NE8 A;  2BZY A;  4VUB A;  4Z88 A;  4IUU A;  2W0Z A;  1YIT A;  4EPC A;  2DL5 A;  5KYX A;  3CPF A;  4E7H A;  3JB9 H;  3UDC A;  3RR6 A;  2MOX A;  3PVQ A;  1NLO C;  2V8K A;  3CCS T;  1D1B A;  3VRZ A;  2CH4 W;  5GAN 4;  4J9C A;  1UJY A;  3OYN A;  2JXB A;  4A4F A;  2QDL A;  2Y4Y A;  3I5S A;  3E9G A;  2L3S A;  1GCQ A;  5LJ5 f;  2JTF A;  2RJC A;  1ZSG A;  4OMQ A;  4L6V 5;  1KQS S;  2K3B A;  2D8H A;  1E6H A;  2HL3 A;  2X4Y A;  2LNV A;  2DVE A;  3TU4 K;  4C92 G;  3EG0 A;  4C5G A;  2EYZ A;  3THK A;  1E6G A;  4M7A G;  4E7J A;  1VQN A;  5CO7 A;  1S72 A;  1AD5 A;  4C92 A;  1Q86 C;  2HZY A;  3L2Q A;  3L2V A;  3QII A;  4M7A A;  2Y90 A;  1UB4 A;  2HQH A;  5L8R E;  4YTL A;  5GAM f;  4N4G A;  2EQU A;  2OTL Q;  2DAQ A;  1EFN A;  1MHN A;  1K8A R;  4KGZ B;  2IVW A;  1VQP Q;  5J3B A;  4M4Z A;  1AWO A;  4XTX A;  2DK3 A;  1UGQ B;  1HXD A;  4DBH A;  3V7S A;  1MUZ A;  2FRY A;  1UHC A;  3CCS A;  4ANJ A;  1VQK T;  1HSQ A;  1LCK A;  1IXD A;  3JB9 G;  2SEM A;  2CUD A;  2M1H A;  3SD4 A;  2HEQ A;  2RF0 A;  1G5V A;  4JRI A;  3C0C A;  4MDX A;  2XG8 D;  1RUW A;  1OPL A;  1OPK A;  4JLI A;  1WGS A;  2B8A A;  5I21 A;  1N27 A;  4PJL A;  3G4S Q;  3KFV A;  1R0B G;  2CS7 A;  3LWH A;  1K1Z A;  3I5R A;  3OBW A;  2RI3 A;  4FL6 A;  1Q7Y U;  3P8D A;  3X28 B;  1VQ5 Q;  5FWC A;  1QCO A;  3RNJ A;  2K57 A;  4XQ3 A;  1K4U S;  2DET A;  3QZ9 B;  4FYY B;  1Q82 C;  4J9H A;  5DM7 R;  1M27 C;  3G6E Q;  1VQM T;  3P8B B;  5EC7 A;  2RB6 A;  1FMV A;  3REB B;  5A0G A;  2LJ0 A;  1K8A U;  1H64 1;  3OW2 A;  3M58 A;  2ZPI B;  2KSS A;  4KUL A;  2BZX A;  4BE0 A;  4PJO B;  1QVP A;  2KY9 A;  4GLK A;  2DA9 A;  1V29 B;  1XOV A;  1D0X A;  2CP7 A;  2X3X D;  1KHC A;  2R5M A;  2LJ1 A;  5LJ3 g;  4M77 F;  1BI3 A;  2LDM A;  5GAN 3;  3GBQ A;  1W4S A;  1BU1 A;  2A28 A;  3QDF A;  1H8K A;  4AFQ C;  4QKU A;  5KYN A;  2XKO C;  5CKE A;  2WSC E;  3S6W A;  2DYB A;  3CC4 T;  1I07 A;  2ATC B;  1VQ8 A;  2RJE A;  1NEB A;  2XDP A;  3QWY A;  4RTV A;  4OVA A;  2KNB B;  2GBQ A;  3V7C A;  3SWN A;  1MND A;  1CKA A;  2E41 A;  1R77 A;  4RCB A;  2JT4 A;  4KT0 E;  4FW2 A;  5LJ3 d;  3TRE A;  4BAC A;  4J9B A;  2DXB A;  5LJ3 j;  4MML A;  3QZ5 B;  2F69 A;  4F7U B;  2RNA A;  4ZGE B;  1OV3 A;  2VC8 A;  1OZ3 A;  2X9H A;  4FT4 A;  1NPR A;  5L23 A;  5KE2 A;  5CKB A;  1FMW A;  1SSF A;  2DEQ A;  1VQM A;  2KRM A;  3HP9 A;  2F5T X;  4PJO D;  2R5A A;  1ZSZ B;  3CD6 Q;  3NPF A;  3VYG A;  1GBR A;  1N5Z A;  2MPX C;  3U23 A;  2RN8 A;  2PUO B;  2EJG A;  2GTO A;  5IAY A;  1KC8 C;  1N9R A;  2A3L A;  4FYW B;  4JJN K;  3SEM A;  1Z9Z A;  3A8L B;  3KUF A;  1YI2 T;  3VS1 A;  3CCQ T;  2KRO A;  3I35 A;  3CCM T;  1YP5 A;  2LQN A;  3VV0 A;  3KXT A;  5GAN g;  2LZ6 B;  5C6S A;  2B86 A;  2H3J A;  3JRZ A;  2XD0 A;  2CP5 A;  1WHM A;  1RLP C;  2FG0 A;  2FVU A;  3X25 B;  2DRK A;  1NPP A;  3M59 A;  2L3Q A;  1VQ7 T;  2COZ A;  1M3C A;  2P0Q A;  4BD3 A;  4OMF B;  4C8Q C;  3OMC A;  2CP6 A;  2LQK A;  5GAN d;  1BI1 A;  2O88 A;  3RMQ A;  5GAN j;  2XU8 A;  4C5H A;  1KD1 C;  2A7Y A;  1FX7 A;  1K9M C;  4IUV A;  2XDB A;  1AZG B;  3OYF A;  5LJ3 h;  4HXJ A;  1KK7 A;  2QGG A;  2DBK A;  2VYT A;  1WHL A;  1WFW A;  4WCI A;  4F04 B;  2E3H A;  2AK5 A;  1NEG A;  1WYX A;  1PD0 A;  4ELZ C;  4IIO A;  1YFN A;  2RI5 A;  2YUO A;  1G3Y A;  4CC7 A;  4NL3 A;  1YJW T;  4FT2 A;  4N0A C;  1Q95 G;  1Y71 A;  1J3T A;  2QA4 Q;  3CCV Q;  3OYC A;  4OGC A;  3REA B;  1YI2 A;  1M1G A;  4DBR A;  5GJW B;  2EQM A;  3CCQ A;  3CCM A;  3VUB A; 
#chains in the Genus database with same CATH homology
 2KYM A;  2J7I A;  4Z89 A;  2K6D A;  1M3B A;  1SPK A;  1SEM A;  1HJD A;  1SRL A;  2J06 A;  1YN8 A;  2LP5 A;  1GRI A;  1X6G A;  1WIE A;  2EYW A;  2KT1 A;  2EPD A;  4JJD A;  5IHN A;  2FEI A;  4JJB A;  1UTI A;  1PHT A;  2CRE A;  2ROT A;  2ECZ A;  1PKS A;  1AWX A;  2JMC A;  1X69 A;  3UF4 A;  2X3W D;  2AZS A;  4X1V A;  2OAW A;  2DMO A;  2YUN A;  4HCK A;  5GJV B;  2NUZ A;  2KRN A;  1V1C A;  4OML A;  1B07 A;  3H41 A;  1GCQ C;  1MV3 A;  2GGR A;  1FMK A;  4AG1 C;  2RMO A;  2YSQ A;  4F17 A;  2A37 A;  2P4R A;  1E7O A;  2JTE A;  2J05 A;  1NLP C;  3VS3 A;  5IHK A;  2RPN A;  4OMM A;  4RTX A;  2XMF A;  2DIL A;  2W10 A;  4OMP A;  2AZV A;  4CC3 A;  4DEY A;  2JMA A;  4GBQ A;  4IIM A;  1ZUU A;  2EYY A;  2EVR A;  2K79 A;  4RTY A;  1ZBJ A;  1UDL A;  1UE9 A;  1CKB A;  1BK2 A;  4FSS A;  2ABL A;  2ROL A;  2VKN A;  1GFC A;  4ORZ A;  2G6F X;  1GL5 A;  1WA7 A;  1YWO A;  4AFS C;  4J9G A;  2F2W A;  1AEY A;  4Z8A A;  1BBZ A;  1AWW A;  2KYB A;  1SHF A;  2AKK A;  1VA7 A;  1PRM C;  2KEA A;  2GNC A;  1AWJ A;  2RQR A;  2ED0 A;  4LUE A;  4A63 B;  1Z9Q A;  2CUB A;  3RBB B;  2DM1 A;  1SSH A;  3UA6 A;  2M51 A;  3M0Q A;  3M0P A;  1BB9 A;  2KGT A;  4RTT A;  3TSW A;  2DL8 A;  2DX1 A;  1QKX A;  1UG1 A;  2BZY A;  4Z88 A;  2W0Z A;  1PKT A;  3ZL7 C;  1G2B A;  1TG0 A;  2DL5 A;  3M0T A;  1AVZ C;  1B3Q A;  4HVV A;  2F2X A;  2MOX A;  2YT6 A;  2YUP A;  1M3A A;  4R0K A;  3PVQ A;  1NLO C;  2CSQ A;  2RQU A;  1JEG A;  2PNI A;  4ZNX A;  1RLQ C;  2CT4 A;  2CH4 A;  3VRZ A;  1AOJ A;  2CH4 W;  2YUQ A;  4J9C A;  1WDX A;  1UJY A;  5IXB A;  4HVW A;  2JXB A;  3UA7 A;  2QDL A;  3QWX X;  4F14 A;  2KR3 A;  3FJ5 A;  3I5S A;  2L3S A;  1GCQ A;  1NYF A;  1NG2 A;  1ZSG A;  1WXT A;  2KRS A;  1KJW A;  4OMQ A;  1I1J A;  2K3B A;  1T3S A;  2D8H A;  2L0A A;  2LNH B;  1E6H A;  4GLM A;  5IXF A;  3CQT A;  5HCK A;  2GQI A;  2K2M A;  2HCK A;  1VYT A;  3SHW A;  1K9A A;  2RQT A;  3EG0 A;  2HSP A;  5I22 A;  2NWM A;  2EYZ A;  2RQV A;  3THK A;  1E6G A;  1G83 A;  1NYG A;  2O2O A;  1AD5 A;  2JS0 A;  2KBT A;  3LH5 A;  1HD3 A;  2LCS A;  2IIM A;  3PE0 A;  1GFD A;  1KFZ A;  1PRL C;  2RQW A;  1NM7 A;  1H92 A;  2FPE A;  2DF6 A;  2EYX A;  2J6O A;  2DBM A;  1QKW A;  3H0I A;  5IH2 A;  1EFN A;  4JPB W;  1X2K A;  1A0N B;  3PVL A;  1FYN A;  2DVJ A;  2EGA A;  2V1R A;  4M4Z A;  4ESR A;  1AWO A;  4JZ3 A;  4RTU A;  3R6N A;  2J6K A;  1JQQ A;  2KXD A;  4AFZ C;  5I11 A;  1AZE A;  1TUC A;  1MUZ A;  2FRY A;  1UHC A;  2I0N A;  1HSQ A;  1LCK A;  2V1Q A;  1UHF A;  2A08 A;  2SEM A;  2CUD A;  2HEQ A;  2RF0 A;  1WXU A;  2VVK A;  3C0C A;  1RUW A;  2EGC A;  1ABQ A;  4J9D A;  1OPL A;  3EG3 A;  2KT8 A;  3M0U A;  1K0S A;  2JM8 A;  2K9G A;  2ED1 A;  1OPK A;  2EQI A;  1X27 A;  1JU5 C;  3KFV A;  4CC4 B;  1K1Z A;  2L3P A;  3I5R A;  2FPD A;  2FO0 A;  2EGE A;  3O5Z A;  5IHI A;  2PZ1 A;  1ZUY A;  3VS4 A;  5FWC A;  3RNJ A;  1K4U S;  1T0J A;  1WI7 A;  1YCS B;  1ZUK A;  1ZX6 A;  2DJQ A;  2HDA A;  3VRY A;  1PWT A;  4J9H A;  2PTK A;  4HVU A;  1M27 C;  3ULR B;  5EC7 A;  1TUD A;  3REB B;  4Y92 A;  2JW4 A;  1VYV A;  2E5K A;  2LJ0 A;  2DL7 A;  3VS0 A;  2KE9 A;  4E6R A;  1QWF A;  3VS7 A;  1W1F A;  1ARK A;  2LMJ A;  3NGP A;  1K0X A;  4LN2 A;  2HBW A;  4F16 A;  2BZX A;  2DRM A;  3M0S A;  4RTW A;  2ESW A;  2CSI A;  3UAT A;  4D8D A;  1YNZ A;  2DA9 A;  2A36 A;  2DLP A;  1U5S A;  1XOV A;  1W70 A;  1T3L A;  1JXO A;  2X3X D;  1JO8 A;  4DEX A;  2O9S A;  2JS2 A;  2LJ1 A;  3VS2 A;  1Y0M A;  1GCP A;  3GBQ A;  1BU1 A;  2A28 A;  2EW3 A;  1H8K A;  4AFQ C;  1U3O A;  2DYB A;  1I07 A;  1NEB A;  1X6B A;  1U06 A;  3QWY A;  4JZ4 A;  4RTV A;  2DE0 X;  2KNB B;  4K11 A;  2GBQ A;  1M8M A;  1T0H A;  1CKA A;  2O9V A;  1OEB A;  2DL4 A;  2JT4 A;  4J9B A;  3EGU A;  1M30 A;  2RNA A;  2C0O A;  1OV3 A;  1SHG A;  2D0N A;  3TVT A;  5L23 A;  1WLP B;  2LJ3 A;  4JJC A;  4D8K A;  2KRM A;  2C0T A;  2ENM A;  2BTT A;  4LUD A;  1WXB A;  2D1X A;  1QLY A;  2H8H A;  4J9E A;  1JXM A;  2AKL A;  3NPF A;  1GBR A;  2JM9 A;  1W6X A;  3EHQ A;  1N5Z A;  3U23 A;  2RN8 A;  4AG2 C;  2GTO A;  1X2Q A;  2SRC A;  3EHR A;  1Y57 A;  2M0Y A;  3VS6 A;  2LX7 A;  3EG1 A;  2MCN A;  3SEM A;  4OMN A;  1Z9Z A;  3H0H A;  1S1N A;  3I9Q A;  3VS1 A;  1GBQ A;  2KRO A;  2CT3 A;  3I35 A;  1YP5 A;  2LQN A;  4EIK A;  1YWP A;  2LQW A;  2LZ6 B;  3NHN A;  2B86 A;  2K7A A;  1K76 A;  3EG2 A;  3NMZ C;  1MV0 B;  1RLP C;  2FG0 A;  4RUG A;  2DRK A;  2DL3 A;  2D8J A;  2DNU A;  2L3Q A;  3M0R A;  1UUE A;  1WX6 A;  2O31 A;  2J6F A;  1M3C A;  4J9I A;  1UEC A;  1CSK A;  1UGV A;  2EKH A;  2F2V A;  1ZLM A;  1RI9 A;  5FW9 A;  1VYU A;  5FWB A;  2FPF A;  2GTJ A;  5ECA A;  2O88 A;  4LE9 A;  3IQL A;  2BZ8 A;  2OJ2 A;  1I0C A;  1ABO A;  1UJ0 A;  3TSZ A;  1AZG B;  1SRM A;  1UFF A;  1OOT A;  4HXJ A;  2MIO A;  2DBK A;  2VWF A;  4AFU C;  1WFW A;  4WCI A;  3A98 A;  4OMO A;  2AK5 A;  1NEG A;  1WYX A;  3H0F A;  1IO6 A;  3VS5 A;  2L2P A;  2YDL A;  4IIO A;  1X43 A;  2YUO A;  2KXC A;  4QT7 A;  2CDT A;  2EBP A;  4CC7 A;  4J9F A;  2OI3 A;  1H3H A;  1PNJ A;  4CC2 A;  1KIK A;  2FRW A;  1J3T A;  1KSW A;  3REA B;  4RTZ A;  4LNP A;  1QCF A;  5GJW B;  1QWE A;  2C0I A;  3JV3 A;  4KRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...