2RPNA

A crucial role for high intrinsic specificity in the function of yeast sh3 domains
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
APWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, functional, and bioinformatic studies demonstrate the crucial role of an extended peptide binding site for the SH3 domain of yeast Abp1p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords Actin-binding protein
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rpnA00
1AWXA 1CKBA 2VKNA 4LNPA 1JO8A 1JXOA 2KNBB 2FG0A 2PNIA 4AG1C 1T0JA 1I1JA 2J05A 2G6FX 2BTTA 2LJ3A 2K6DA 2KRNA 1WDXA 2RNAA 1OV3A 1OOTA 1VA7A 2EYZA 1H8KA 1I07A 2FPDA 1PWTA 1Y0MA 2K7AA 3CQTA 4Y92A 4JJBA 2CDTA 2DBMA 5I22A 4JJCA 3H0FA 2KT8A 2LP5A 4HCKA 2YUQA 1M8MA 1UFFA 3M0TA 4IIMA 2LCSA 4E6RA 1W70A 1UGVA 2L2PA 1UUEA 1WIEA 1PKSA 1OEBA 1NEBA 1TUDA 2EYYA 4JZ4A 2JM9A 2PTKA 4ESRA 1KIKA 2P4RA 2OI3A 4CC3A 1V1CA 2O9SA 1AZGB 3UA7A 2AKLA 2KYBA 1VYTA 1EFNA 4JPBW 1X2KA 1UJ0A 4J9EA 2D8HA 1K76A 1YWOA 3EHRA 3ZL7C 3UATA 1M3CA 2LQNA 2J6OA 2O31A 2ABLA 4HXJA 4GLMA 4D8DA 3VS4A 2CUDA 5HCKA 1I0CA 2JXBA 4RTZA 3QWXX 1SPKA 1U3OA 1UTIA 1GL5A 3THKA 3U23A 5IXFA 2AK5A 3VRZA 2JT4A 2DM1A 1GCQC 2RPNA 2CH4A 2LZ6B 2O2OA 1QKXA 1Z9ZA 2JW4A 3PVQA 1E6HA 3IQLA 4F14A 2PZ1A 2H8HA 4J9GA 2KR3A 4EIKA 1M27C 1H3HA 5IHNA 3M0RA 1HSQA 3PE0A 2BZ8A 4RTWA 1GCQA 4LE9A 2C0IA 1Z9QA 1BB9A 1JQQA 1VYVA 2DMOA 1PHTA 2CT3A 2K2MA 1K4US 1SRMA 1SEMA 2YDLA 1RLQC 1NLOC 3UF4A 1B3QA 1B07A 2AKKA 4HVUA 2DLPA 1PRMC 1NYGA 1T0HA 4ZNXA 2EGCA 4OMMA 1RLPC 4X1VA 3UA6A 2W0ZA 2EQIA 2QDLA 3KFVA 1QCFA 4F16A 3SEMA 2K3BA 5FWCA 1RUWA 1U06A 1WLPB 2RQRA 4Z88A 1M30A 3TSZA 1CSKA 2A28A 1G83A 3O5ZA 3M0UA 4RUGA 2D1XA 2C0OA 3EG1A 3JV3A 3A98A 2EGAA 1U5SA 2KT1A 4GBQA 1WXBA 2RQWA 1KSWA 2GGRA 1X6BA 3EG3A 1GFCA 4J9HA 1GBQA 2DE0X 2DL7A 4Z8AA 3EGUA 2ROLA 2YUPA 2YUNA 4Z89A 2LNHB 2DRKA 2O9VA 1WXTA 3I35A 2KYMA 2ENMA 3VS5A 4OMOA 1YWPA 2X3XD 4AG2C 2GQIA 3FJ5A 1WI7A 2JMAA 4R0KA 2KBTA 2CSQA 2MIOA 3RNJA 1UECA 2HEQA 1UDLA 3VS0A 2HCKA 2A36A 4RTUA 1W6XA 4ORZA 2EVRA 5GJWB 2FO0A 2I0NA 2AZVA 2KROA 2LQWA 1WXUA 4A63B 1TG0A 2VWFA 4AFZC 2DRMA 5IXBA 2O88A 1N5ZA 3GBQA 1GRIA 2B86A 3VS6A 2ECZA 5IH2A 4CC2A 1YCSB 1AD5A 4M4ZA 2JM8A 3I9QA 1ARKA 1OPKA 1ABOA 1UJYA 4JJDA 4F17A 3M0QA 4RTYA 3TVTA 1WYXA 2KEAA 1ZLMA 4WCIA 2FRWA 1X6GA 2J7IA 3H0HA 3VS3A 1SSHA 1QLYA 2HDAA 3PVLA 1K0SA 1AVZC 1K9AA 4J9IA 2NUZA 1ZUYA 1W1FA 2DF6A 4D8KA 2JS0A 2L3QA 1ZUKA 2KE9A 1E6GA 4HVWA 1T3SA 2NWMA 1Y57A 2BZXA 2LJ0A 2M51A 1BK2A 1ABQA 2DA9A 2F2VA 2HSPA 2MCNA 1G2BA 2DL5A 2CUBA 1H92A 2EYXA 2EKHA 4LUDA 4DEXA 4LN2A 1SHFA 2EYWA 2RMOA 2DL8A 5ECAA 1J3TA 4RTXA 1ZUUA 1UG1A 2JMCA 4OMQA 2D8JA 2ED1A 5FW9A 1JXMA 3NPFA 2J6FA 2KXCA 3M0SA 3VS7A 2M0YA 1BBZA 1XOVA 2HBWA 4KRTA 5EC7A 3EHQA 1QWEA 2ED0A 2DL3A 2OJ2A 1WA7A 1BU1A 2EW3A 2OAWA 5IHIA 2L3PA 1UHFA 2K79A 5IHKA 2RF0A 1MUZA 3NGPA 1M3BA 2DBKA 2L3SA 1KJWA 2DYBA 1JEGA 1UE9A 3R6NA 3C0CA 2CREA 2EBPA 4OMPA 4CC7A 2FRYA 2JS2A 1TUCA 2RQUA 4OMLA 4QT7A 4J9BA 1YNZA 2D0NA 2AZSA 3SHWA 2LJ1A 1A0NB 2GTOA 3VS2A 1E7OA 2GBQA 2MOXA 1PKTA 1NEGA 1AEYA 3VRYA 1CKAA 1FYNA 4AFQC 3LH5A 1GBRA 2EPDA 5GJVB 4OMNA 2IIMA 2V1QA 2GNCA 2YUOA 3I5SA 4IIOA 2JTEA 2KXDA 2RN8A 4FSSA 5I11A 1KFZA 2CSIA 1MV0B 1X69A 4J9CA 4AFSC 1AOJA 2DL4A 1QKWA 3RBBB 2C0TA 3ULRB 1NM7A 1X43A 3H41A 3VS1A 5FWBA 1K0XA 2DILA 2YSQA 2RQTA 1IO6A 1ZX6A 4RTVA 2W10A 4JZ3A 2LX7A 2BZYA 1YN8A 2RQVA 2K9GA 1PRLC 2X3WD 1LCKA 3NMZC 1UHCA 1PNJA 2A08A 1ZBJA 1NYFA 2FPFA 2EGEA 1NLPC 4LUEA 1X27A 1FMKA 2XMFA 1T3LA 1GCPA 2V1RA 2ROTA 4HVVA 4AFUC 3TSWA 3REAB 1MV3A 2DVJA 1QWFA 3EG0A 4DEYA 2SRCA 4RTTA 4J9FA 5L23A 2FPEA 2KRSA 3I5RA 1SRLA 1K1ZA 1M3AA 2KGTA 2KRMA 1NG2A 2DNUA 1JU5C 2CH4W 2GTJA 1X2QA 3EG2A 2FEIA 2CT4A 2LMJA 2J06A 1RI9A 2L0AA 2F2XA 3REBB 2A37A 1SHGA 1AWWA 1VYUA 3NHNA 1AWJA 1WFWA 1AZEA 2ESWA 4K11A 4CC4B 3H0IA 1OPLA 3M0PA 2YT6A 2SEMA 1HJDA 1HD3A 1WX6A 1AWOA 2DX1A 1GFDA 2J6KA 2DJQA 2VVKA 1YP5A 3QWYA 2F2WA 1S1NA 1ZSGA 2E5KA 4J9DA
chains in the Genus database with same CATH superfamily
2VKNA 1QVGS 1T0JA 2K5IA 2G6FX 1G3SA 2RB6A 5GAN5 3CPWS 4ZN3A 2KRNA 5GAN2 1VQ8A 4F7UG 1YJNA 5GAMd 4PJOB 1Y96A 1PWTA 1SKUB 2O4XB 3OYIA 1U1SA 4DOWA 4DQ2A 3QDRB 4JJBA 1NPRA 4M78E 1M1KU 2KT8A 4E7KA 4QKUA 1M8MA 1YIJT 3M0TA 4IIMA 4M77F 2F5TX 2L2PA 1PKSA 1OEBA 1TUDA 4C8QC 1YITQ 2JM9A 2PTKA 1KIKA 1QCOA 3UWNA 4E2FB 2XI9A 3CXCA 1V1CA 5GMKm 1AZGB 3UA7A 5KYWA 2AKLA 2HBPA 4NL2A 1FMVA 2DERA 2A3LA 1VQLQ 3CCLT 3UATA 5FRMA 2F1LA 2LQNA 3QYHB 2O31A 5HY6A 4M75F 4EMKC 2EQUA 4D8DA 3I55Q 1WJSA 4BD3A 2DVEA 2DD5A 1I0CA 3CMAQ 1U3OA 2P0PA 4LD9K 1QVFP 3O8VA 3PT9A 2PQWA 3HP9A 1Q7YC 4M7AG 3CC2A 2AK5A 5GAOp 3CMAT 3V8KA 3JCMb 2RO0A 4B9XA 1GCQC 4PK4A 1M1KR 2CKKA 2O2OA 1R77A 2JW4A 3MO8A 5CIUA 4J6YA 2DIQA 4PJOF 2PZ1A 2H8HA 1YHQQ 4J9GA 2KR3A 3FJPA 4B9WA 2QQBA 2ZPFB 4IUUA 4BDYA 2XK0A 3M0RA 1OZ2A 2BZ8A 3CCRA 1GCQA 5CKBA 4LE9A 1ZBXA 1JQQA 1PHTA 1WHHA 3SWNC 3CC7A 1K4US 1WHGA 3RKWA 2MWPA 1SEMA 2YDLA 3OYNA 3UF4A 2K3YA 2D9TA 2DLPA 2ZPBB 1X01A 3HL8A 2JZ2A 2F69A 4BE1A 2DXCA 1VQPT 1KHCA 4GY5A 4BDZA 4M7AF 2K3BA 3CCMT 4A4EA 3CCST 1N9RA 1U06A 4JJNK 1WLPB 3TSZA 3X25B 2JN0A 4XTWA 2A28A 3G4SA 2A0FB 1X75C 1O9SA 4MZPA 2CYZB 2C0OA 4C92A 3DLLA 4M78C 2DK3A 3SFMA 5GANf 3JV3A 2EGAA 1IGUA 1U5SA 3OYCA 3JCMJ 3G7ZA 2KT1A 2BIVA 2HNIA 3CC2Q 3RIRA 3JCMh 1WXBA 4ELZC 4A4FA 1X6BA 2K5LA 4C5EA 3CCUT 3EGUA 4M77A 1G5VA 3CCVQ 1G3TA 3M56A 1ZSZC 4L59A 3PTAA 1Y07A 1XJWB 4AG2C 3DKMA 2DETA 2G3RA 1WJQA 4HCCA 3RNJA 4J83A 5GAMj 1YJ9T 1UDLA 2E41A 1WHJA 3VS0A 2A36A 2EVRA 3JCMe 2FO0A 3GIBA 2QEXQ 2KROA 2F5KA 2DO3A 2DRMA 4CRIA 2O01E 3VS6A 2K57A 2K4YA 1AD5A 3WVDB 4N4GA 2RHXA 4M4ZA 1ARKA 3KUFA 4WTOB 3E1SA 3G71T 3VYGA 5KYYA 4OP0A 3M0QA 2V8JA 1WYXA 4M78G 2DXTA 3L2WA 1ZLMA 4RKUE 4QQ6A 4M78F 3JCMX 1RACB 3CMET 3QG1A 1AVZC 3FC3A 2V8IA 1KQSA 1G3WA 3JCMP 3DB4A 1Q7YU 2L3QA 1ZUKA 2KE9A 5GMKj 1B34A 3FIFA 2V8KA 2YRDA 5GMKh 2M51A 1ABQA 4QQGA 1TUGB 1WHLA 2DA9A 2QK0A 2HSPA 2CP2A 2RK2A 3OW2P 5LJ5h 4RTXA 3JB9G 5I21A 1UG1A 3QZ5B 4GLKA 2JMCA 3OYBA 1TSFA 2K3XA 1XTDA 4J6XA 1Q82R 4C8QF 1S72A 4ANJA 1K8AC 4XU1A 3M0SA 3LX7A 1KQSP 4BACA 4MZMA 2M0YA 4KRTA 2HBWA 2GCXA 3EHQA 4EPCA 2IPOB 4PLLA 2COZA 4JDSA 3CMAA 3QZ9B 3GPLA 1AHJB 2L3PA 1M2OA 1VIEA 2RF0A 3X20B 1VQ7A 4PFPA 1OQKA 2DBKA 2DYBA 3OYYA 1KC8R 2RJEA 4EMKA 2C06A 2CREA 1N8RR 2RQUA 4QT7A 4OMLA 4YTLA 4DBRA 3EAEA 1YNZA 1QQJA 4R56A 2D0NA 2AZSA 3SHWA 1M90R 6AT1B 3VS2A 2MOXA 1CKAA 1FYNA 4AFQC 2QGFB 3DLMA 2EPDA 4NS5A 5GJVB 5J39A 2YUOA 5GMKi 2KXDA 3EFOA 3OBYA 3I56A 3JB9J 1UB4A 1MV0B 4AFSC 3OS1A 2RHUA 2DL4A 2FHDA 1D1CA 3SWNB 2EQMA 1K9MU 3ULRB 1NM7A 3S3NA 1K0XA 3VJPA 1BYMA 2Y4XA 2PVDB 1VQLT 1IO6A 4II1A 4RTVA 3H9NA 4N4HA 3OYHA 2K9GA 2P0KA 1UGSB 3R6OA 1ZBJA 2M02A 5HKCA 3LWIA 3CC2T 1EIFA 2QTVA 1YITT 4M75A 4FU6A 1GCPA 2V1RA 4N4IA 2DYIA 3M58A 4AFUC 3REAB 1EZZB 2QG9B 4DEYA 1N8RC 2BE7D 1LJOA 4FYYB 3OW2A 5LJ3f 1KK7A 1K1ZA 2KGTA 4M75G 1YJWT 4KH1B 3M55A 2FEIA 2CT4A 3CCJT 3EFOB 2J06A 2LT1A 1RI9A 4TVRA 1ZQ1A 2A37A 2EJ9A 3C95A 3L2ZA 5LJ3e 2E65A 3MHXA 4Y91A 3MP6A 1Q95G 1BI0A 1K8AU 4C0GA 3M0PA 2YT6A 1HD3A 2PU9B 1UEBA 4CI0C 5FU7C 2DJQA 4BI8B 1W2BA 3QWYA 2F2WA 4PJMA 2XIDA 3VUZA 2VXEA 1VQMA 4N0AC 3L2UA 3JB9I 4LNPA 2LCLA 1JXOA 2PNIA 1I1JA 3LW5E 2J05A 5KYXA 4C0DC 2LCCA 2RHYA 2MMPA 2LJ3A 2K6DA 2RNAA 1OOTA 1VA7A 4QVCA 1PM3A 3FB9A 2E4HA 1I07A 3CPWA 5AT1B 2QQAA 1OX9A 3CQTA 4F7UF 4M7DA 2CZ1B 2QXFA 2CDTA 5I22A 3H0FA 2LP5A 2DFUA 2YUQA 3GLXA 1UFFA 5I2SA 5GANj 4X34A 4E6RA 1VQ6Q 5HK3A 1UUEA 1RABB 1NEBA 4JZ4A 3OY9A 4ESRA 1D0YA 1WPYA 4CC3A 1VQKQ 2O9SA 2OAUA 5KCOA 4DA4A 1M8VA 1EFNA 5GAN7 3S3MA 3PMIA 1N27A 3FRNA 3X24B 3PMTA 1ACMB 1M9SA 1K76A 1KD1R 1YWOA 1I8FA 3CBMA 4OMFB 1M3CA 1D3BA 3PIOA 1QP3A 2RJCA 2J6OA 5IAYA 2ABLA 2VC8A 3VS4A 2FB7A 2CUDA 4RTZA 2NUTB 3QWXX 1LVKA 1SPKA 2PUOB 3BY7A 2PVOB 1GL5A 3F70A 3ZEHA 1VQ6A 5IXFA 4PFZA 3OYJA 5DM7R 1P92A 2DM1A 1VQ5A 2CH4A 1VQ8Q 5LJ3j 3PVQA 4J6WA 1RAEB 3S3OA 1E6HA 3OYFA 2QDYB 2X51A 3IQLA 4UC4A 4F14A 1MNEA 3LWHA 4QQDA 3RERA 3A5ZB 3EH1A 1M27C 3CBPA 2DAQA 5IHNA 3CMEQ 2LRQA 2JTFA 4X9DA 3PE0A 3CEYA 4L6V5 2CZ0B 2CP3A 4J8OA 4RTWA 1NJIR 1VYVA 1R0CB 2CT3A 3VKIA 2X4WA 1K73R 1IREB 1SRMA 3I56Q 2MAMA 1RLQC 4LDVA 2QEXA 1VQKA 4EMKB 2VV5A 1OX8A 2AKKA 1RAIB 5A0LA 4PJLA 2VASA 1NYGA 1T0HA 3QO3A 1RLPC 1XQHA 2KVQG 4AMCA 4M7AA 2W0ZA 2LVMA 3JAME 3RMQA 4BI4A 5FWCA 2YRVA 3A1PA 5GANe 2EQKA 1VQ9T 4JRIA 3RESA 4OB1B 2YWWA 4M7DE 4RUGA 2D1XA 1G3YA 4XTZA 1MHNA 4AT1B 3EG1A 5D7UA 1IRXA 1G8XA 2LTOA 3GNGA 2E12A 3N5BB 3OS5A 4M75D 3E19A 5LL6S 4LDUA 2EWNA 5LJ5j 2IG0A 1Q7YR 3QUIA 2HZYA 1GFCA 4ZN1A 5GAOn 2QTXA 1PC0A 4Z8AA 1VQ7T 4E7ZA 1VQOQ 1NJIU 2XDBA 3TU4K 3HRTA 5CKEA 1TH7A 4DBQA 3EGDA 3CD6Q 4QVDA 2KYMA 3CD6A 2ENMA 3VS5A 4OMOA 1YWPA 3CCQA 1D0XA 2HAXA 2X3XD 2ZAEA 3FJ5A 3CCRQ 1LNXA 4M75B 4R0KA 2KBTA 1M2VA 1YJNT 1BIAA 2CSQA 2MIOA 4A53A 4XTYA 3A8GB 3OYMA 4FW1A 1I5LA 2DXUA 4ORZA 1OU9A 3SB2A 4N0AA 2LQWA 4PNOA 1VUBA 1N5ZA 5GAOq 2B86A 2ECZA 4KUIA 3HKSA 4ME7A 4Z02A 1TWBA 4KGZB 2CP5A 1OPKA 2CGHA 1MMAA 1NZ9A 2VUBA 5EG2A 3UDCA 2LX9A 2D6FA 2ZPEB 2FRWA 2J7IA 2AT1B 2MPXC 3H0HA 3J80E 2YLBA 2XG8D 2QA4T 3PIPA 1PSEA 1SSHA 2DZ9A 4WF2A 2HDAA 3PVLA 4F7UE 1K0SA 2NUZA 5FU6B 3G71A 1YBYA 2DF6A 2VGMA 3CCQQ 1TTHB 2NWMA 3RDVA 1HYOA 1Y57A 1B34B 3EGDB 1W2BS 2K2VA 2R57A 2JJ9A 4FM4B 2F2VA 2L5QA 2MCNA 1G2BA 1UGQB 2DL5A 4LUDA 1AT1B 3MEUA 3GP8A 2QYZA 4RMOA 4C0DB 3CCUA 1YJ9A 3RKYA 2RMOA 2JUFA 4JRQA 5GAN4 1JXMA 4A54A 3M54A 5GAMh 2J6FA 4P5NA 4KGXB 3QSUA 1VQMT 4NOYA 1BBZA 2BKDN 3RKXA 3EGXA 4MDWA 1WA7A 2FVUA 3L1AA 2OAWA 3MCAB 2K5FA 3VV0A 4E7SA 2HKQB 1UHFA 2QAZA 1KJWA 1KHIA 3NTHA 1N8RU 1JB0E 1WZOA 3RR6A 2EBPA 1MGQA 1O75A 3G1JA 4OMPA 3QXEB 3CCJA 1OULA 4J9BA 1TU0B 1F1BB 2E6ZA 2RJDA 4ZGJB 1QVFS 4KBMB 3OSSC 2ZGWA 1E7OA 3CC4A 1PKTA 3BDLA 3VRYA 5LJ5e 3LH5A 1GBRA 2NUTA 2P0QA 3META 3CCMA 2L3RA 3JCMg 3CCRT 2IIMA 4BY6B 2GNCA 4IIOA 2JTEA 2RN8A 2X4XA 4FSSA 3CD6T 3JSCA 1X69A 5FRNA 3FDRA 3RBBB 2MF2A 2EJFA 3H41A 2QGGA 2M0OA 2VXFA 5FWBA 3C12A 3MPUB 2DILA 2YSQA 3BDUA 1YI2T 2ZPIB 4JLIA 2E70A 4M7DD 2CP7A 1KQ2A 2E10A 5CQYA 4ZGEB 1PG5B 3JCMQ 3TSWA 4M7DF 1D3BB 1QWFA 2DZCA 4RTTA 3EG9B 1KD1U 1BI2A 3I5RA 2KRSA 1M3AA 2KQWA 2M16A 2DNUA 2CH4W 5GAOr 1M2VB 2GTJA 4JUVA 3URGA 4DBHA 3SD4A 1K9MC 1QW1A 2GFUA 4OGEA 4K11A 2DXBA 1FWZA 1K8AR 3EH2A 3P8DA 2QEXT 5GAOm 4BUGA 3HFOA 2J6KA 1IB8A 2FZCB 1M90C 3HRSA 4LDYA 2FL7A 4DOVA 1S1NA 1ZSGA 2E5KA 2VGNA 1AWXA 1JO8A 2RI3A 2KNBB 4XAXB 2BTTA 4A4GA 5KE3A 3JB9D 2H3JA 1WDXA 3UT1A 1OZ3A 3OYEA 3NTKA 4M77B 1YJWQ 2FPDA 4BE2A 1TOVA 4KT0E 1YIJA 3EFRA 2K7AA 4XTVA 4Y92A 1YIJQ 3L42A 4M77C 1Q81C 2DBMA 4JJCA 3CCEQ 4IUQA 2OTLQ 4HCKA 2E1HA 4M7AE 1W70A 1WIEA 1JRIA 3JB9H 2P4RA 2OI3A 5LJ5f 1V76A 1VYTA 1VQOT 1DJ7B 1OYXA 4J9EA 1H3ZA 1OU8A 2D8HA 4VUBA 2YXYA 3EHRA 1M1KC 4J7FA 3BW1A 2LC4A 4GLMA 2JOYA 2PVGB 3P8BB 5DLOA 2NUPB 5HCKA 4PJOD 4PJOE 2JXBA 3EFSA 4KH0B 3A8LB 1D09B 3J7AF 3THKA 3WVEB 3OA6A 2LZ6B 1PD0A 5KYUB 1KD1C 2AIRB 2ZZDA 5CKFA 2QASA 4BB7A 5KYNA 3ER0A 1HSQA 1QVPA 1ZA1B 1Z9QA 2DMOA 4LXCA 1K73U 1KC8C 4PJJA 3G6EA 2E64A 4BE0A 3OW2S 1B07A 3LYIA 4FCYA 2COYA 5LJ5g 3MEWA 1X6OA 2GFAA 1SG5A 1JJ2S 4RCCA 4KGVB 4X1VA 4O5VA 3KFVA 3ASKA 2Y4YA 1JJ2A 2EJGA 4F16A 2BE9B 2R5MA 3G4ST 3P8HA 3MEAA 1RUWA 4Z88A 1M30A 4RG2A 3V8LA 1G83A 3CCEA 3O5ZA 4FSXA 4M77E 4MZTA 1VQPA 3OBWA 2KK4A 3LGFA 1VQ7Q 2RI5A 4PKCC 1YITA 4M7AC 1MMNA 2YLCA 2KSSA 3RUXA 2RQWA 4XU2A 1KSWA 1OI1A 4R55A 2GGRA 4BI3A 2RD1A 3CC7T 3EG3A 8ATCB 1GBQA 2DE0X 3OYAA 2ROLA 3UPUA 2ATCB 2YUNA 1C1AA 4Z89A 2O9VA 1WXTA 1VQLA 4M75E 4PJNA 3I35A 5GAN8 2LQKA 2JVVA 2GQIA 1WI7A 1D0ZA 2JMAA 3E9FA 1BCOA 4RTUA 1W6XA 1VIFA 4JRPA 4A4KA 1QMCA 2AHJB 2I0NA 4M78A 2AZVA 3ZBDA 2PUKB 5KYYB 2BUDA 5LJ3g 1WXUA 4A63B 4C92C 3QPHA 4OVAA 4PJOG 5IXBA 3GOXA 4PJOC 3OQ5A 4C5HA 4CC2A 1YCSB 5D6YA 4E7IA 3JCMd 3CC4T 4FW2A 2MI6A 4HA8A 3I9QA 3I56T 2V26A 1ABOA 4JJDA 1S72Q 3OMCA 3TVTA 4ATOA 4WCIA 4FYXB 1W4SA 1WQWA 1VOMA 4J9IA 4MDXA 1ZUYA 2CP0A 3OS2A 1RADB 4D8KA 3M4GA 1VQPQ 2JS0A 5J26A 1NPPA 1VQ9A 4JRKA 2CP6A 4C0FA 3M57A 3VUBA 2LJ0A 1BK2A 4OGCA 5DLQE 4M7DC 2VB6A 3HRUA 5IT9E 2HQXA 1PCXA 1ZHIA 1BKBA 2FZKB 4B6MA 2EKOA 3PNWC 2CUBA 2DTOA 1H92A 4DEXA 2DKGA 5KYXB 2EYWA 3Q1JA 1MMGA 1U8RA 3JCMf 1ZUUA 2A7YA 3MP1A 2D8JA 1FMWA 3QJYA 1KG1A 2YRCA 3OMGA 2RI2A 2KXCA 3S6WA 1VQ6T 1XOVA 2YHTA 1QWEA 2ED0A 2DL3A 5GMKl 2OTJT 5CKHA 3T9NA 3V7RA 1VQNA 2HSEB 4EMHA 5C0MA 3NGPA 1KC8U 1JEGA 2HL5C 3L2VA 3CXCS 3C0CA 3SDZA 2E3IA 4CC7A 3OB9A 1MNDA 4J5YA 4OB3B 2DTHA 4LDXA 1IXDA 3PFSA 4C8QG 3OSVA 1VQNT 5CKDA 1TXQA 2LJ1A 2GTOA 1B7TA 4ELYC 4V2SA 3PGGA 2GBQA 5GMKe 2OTJA 1AEYA 1VQ9Q 4XU3A 2ZPGB 4M75C 1LPLA 5CR2A 1ZSZB 2RK1A 3QDFA 2V1QA 4C8QA 3JCMV 4M7DG 3I5SA 4J7IA 1VQNQ 2CSIA 4J9CA 1AOJA 1QKWA 4EMGA 1X43A 4C92E 1HXDA 4C5IA 1H641 2EFIA 3TEEA 3A8OB 4E7HA 4QW2A 3CXCP 2EAYA 2W10A 4DBFA 2LNVA 2LX7A 2BZYA 1YN8A 2RQVA 2MK5A 3QIIA 2X4JA 3LLRA 1PNJA 2A08A 5GAMe 2ZCFB 1RL2A 2FPFA 4LUEA 1X27A 2OTJQ 1UGRB 2P84A 1FMKA 1QP2A 1T3LA 4XQ3A 2ROTA 4HVVA 1M4ZA 3JB9F 2EIFA 2RHIA 1BI1A 1SF9A 1MV3A 3NFCA 2LQ8A 2SRCA 4J9FA 2HL3A 1VQ5Q 3M59A 1QVFA 1R8OB 2QA4A 2KRMA 1RAHB 1V29B 1NG2A 1FX7A 4L5GA 3EG2A 2EQJA 2LMJA 3LGLA 2L0AA 3CCVA 3REBB 3CBOA 2JNGA 4JS4A 5D6WA 2XD0A 3NHNA 1AWJA 1WFWA 1AZEA 2MYSA 1KQ1A 2QI2A 2ZPHB 1JBMA 1XNIA 4KUDK 1OPLA 1VQKT 5LJ3d 1AWOA 2B8AA 3ME9A 1RAFB 1GFDA 2XHCA 2NLUA 4OF1A 4F7UA 2O4XA 3M4YA 3QHSA 4XK8E 4J9DA 1WNLA 2KI7A 2DD4A 1CKBA 2FG0A 2WACA 4AG1C 5D6XA 5GANg 7AT1B 2XDPA 4M78D 2E3HA 1OV3A 5L8RE 1YHQT 2EYZA 1H8KA 5FROA 1BI3A 1QVGP 5LJ5d 1VQ4Q 1RAAB 1Y0MA 4IKFA 1I5OB 3M53A 4Q5WA 4NL3A 3RMSA 3MJXA 2CZ7B 3WXMB 4PL6A 4M78B 2LCSA 4HCBA 1UGVA 4BY6C 2WSCE 4IUTA 3MEVA 3C94A 2EYYA 4FYVB 1WHMA 3CCVT 3CCLA 1Q82C 3QKJA 4MMKA 2KYBA 4JPBW 4RCBA 1X2KA 1UJ0A 3FEOA 2DTIA 4JS5A 2X4YA 2EYQA 3ZL7C 5FLXE 5KCHA 2KDSA 2Y90A 2XDDA 1N9SA 2DEQA 2DIGA 4HXJA 3ZFJA 2LT4A 5GANh 3FLGA 2NUPA 3OS0A 5M9OA 4C92G 1Y7XA 1UTIA 1ZSZA 3JRZA 4HKEA 3U23A 3VU3C 1BIBA 1M5Q1 3KBGA 2NYSA 1S72T 3VRZA 2JT4A 2R5AA 1IHVA 3INZA 1YFNA 2QQSA 2RPNA 1QKXA 1Z9ZA 1RAGB 1VQ8T 4EIKA 3V7CA 1H3HA 1I81A 4LDWA 2RH2A 4HT9A 2C0IA 1BB9A 2RJFA 3JCMW 5FU7B 2H3EB 1Y96B 2K2MA 5J3BA 1NLOC 1B3QA 4HVUA 1NBEB 1PRMC 5KYWB 4ZGDB 4ZNXA 1Q81R 3HFNA 3X26B 2EGCA 4C92D 3CCUQ 4OMMA 5GAN6 3UA6A 1BCMA 2EQIA 2QDLA 1QCFA 3SEMA 1W2BP 3V7SA 3HTRA 1NJIC 4FT4A 5IN1A 4X9CA 2RQRA 3EG9A 4QVZA 5CCAA 2L89A 4M7DB 1CSKA 4PLIA 2RM4A 3SWNA 4XTUA 3M0UA 1I4K1 4A4HA 3CMEA 1SSFA 4E47A 3I55T 2DEUA 2I2LA 4D6WA 5I2MA 3A98A 1KQSS 3CCSQ 4EDUA 4GBQA 3CPWP 1Q86U 1QVGA 1ZA2B 1YI2Q 2QA4Q 4Y28E 5A0DA 3QJ6A 4J9HA 2DL7A 3EGXB 5CK9A 1K9MR 2RA2A 2YUPA 8AT1B 4IUPA 2LNHB 2DRKA 2HKNA 5KH6A 3CPFA 4ZTFA 3X28B 4O6JA 1K73C 2LDMA 2R58A 1WQ7A 1NE8A 1UECA 4IUVA 2HEQA 3HSBA 2HCKA 1PSFA 5FU6C 5GJWB 1Y71A 1TG0A 2VWFA 4AFZC 2O88A 3GBQA 1D1AA 1GRIA 3GNFB 3BE3A 2Z0WA 5IH2A 3CCSA 4FYWB 2JM8A 3H6ZA 1UJYA 4F17A 4M77D 2HMAA 3CCJQ 9ATCB 5CQXA 4RTYA 2KEAA 1VQ4A 1YJWA 5HK0A 3NTIA 2MWOA 1X6GA 1Q81U 1IGQA 3MP8A 3VS3A 1QLYA 1K9AA 3G71Q 1D1BA 2QQRA 4JLGA 4M7AB 1W1FA 3AHUA 2CZ6B 3TCJA 2COWA 3CC4Q 2OTLA 3KXTA 1E6GA 4HVWA 1T3SA 4F7UB 4FIBA 2BZXA 1IZ6A 2KY9A 3MKDA 3V8JA 1WGSA 1WJRA 1YI2A 2E6NA 2DJZA 5CO7A 3JCMc 2EYXA 2EKHA 1VQMQ 1YJ9Q 3BFMA 4LN2A 5GAN3 1SHFA 1YHQA 2CS7A 5GAMg 2DL8A 5ECAA 1J3TA 5GAOl 2X35A 3C4SA 1Q86R 4C92B 1C0MA 4HCZA 4OMQA 2P4TA 1Q82U 2ED1A 4E7LA 5FW9A 3NPFA 3VS7A 1R0BG 2KAFA 5EC7A 3DB3A 3CC7Q 3HPWA 2OJ2A 4MMLA 1BU1A 2OTLT 2EW3A 3TREA 2RHZA 2M9UA 2XU8A 3QYGB 5IHIA 4HT8A 3AT1B 2K79A 2HQEA 5IHKA 3HHTB 1MUZA 5AYFA 1M3BA 2L3SA 4M77G 1UE9A 3R6NA 5DY9A 3OYDA 4C5GA 2FRYA 2JS2A 1TUCA 1C6VX 3OYGA 2GQVA 1VQ4T 1UGPB 1M1FA 3G4SQ 2OX7A 4ZTJA 2VYTA 3CCET 1HK9A 2D0QB 2FYKA 5GANd 1A0NB 3A8MB 4OB2B 1M1GA 3TQ7P 1NEGA 2X9HA 2IVWA 2DPPB 4C8QE 2HQHA 3H8ZA 3D7SB 4OMNA 3CCMQ 2HD0A 2M1HA 5GAMf 1EX4A 3OYKA 3G6EQ 5I11A 1KFZA 5A0GA 3GF5A 1GXIE 1WHKA 4C8QD 2C0TA 3L2QA 4PFOA 3VS1A 5KE2A 3G6ET 1LOJA 2RQTA 1ZX6A 1MMDA 4JZ3A 1N6AA 1PD1A 3OYLA 1YJNQ 2XKOC 3M5AA 1PRLC 2X3WD 3M9QA 1QCNA 4LD6A 1LCKA 2L8DA 2KMTA 3I55A 3NMZC 1UHCA 1VQ5T 1NYFA 4C8QB 4OB0B 2EGEA 1NLPC 1U1TA 1IHWA 5KYUA 5CVIA 2XMFA 3LH0A 4FT2A 3J81E 4E7JA 3VYHB 4M7AD 2JTMA 2DVJA 4C0ZA 4F04B 3EG0A 2E5QA 1YCYA 5L23A 3CCLQ 2FPEA 4FL6A 1SRLA 4XTXA 1JU5C 1VQOA 1X2QA 2XICA 5C6SA 2FZGB 5LJ3h 4C92F 2F2XA 1SHGA 1RI0A 1AWWA 1FXXA 1VYUA 4KULA 3E2UA 4RG8A 2ESWA 5A2QE 3E9GA 4IURA 1TS9A 4CC4B 3H0IA 3CCQT 4XU0A 2SEMA 1HJDA 1M90U 1WX6A 3A8HB 2GF7A 2WSEE 2DX1A 1Q86C 3L2RA 3QBYA 4PJOA 2VVKA 1YP5A 2WSFE 1JJ2P 2QQ9A 5CAIA
chains in the Genus database with same CATH topology
1AWXA 1CKBA 2VKNA 4LNPA 1JO8A 1JXOA 2KNBB 2FG0A 2PNIA 4AG1C 1T0JA 1I1JA 2J05A 2G6FX 2BTTA 2LJ3A 2K6DA 2KRNA 1WDXA 2RNAA 1OV3A 1OOTA 1VA7A 2EYZA 1H8KA 1I07A 2FPDA 1PWTA 1Y0MA 2K7AA 3CQTA 4Y92A 4JJBA 2CDTA 2DBMA 5I22A 4JJCA 3H0FA 2KT8A 2LP5A 4HCKA 2YUQA 1M8MA 1UFFA 3M0TA 4IIMA 2LCSA 4E6RA 1W70A 1UGVA 2L2PA 1UUEA 1WIEA 1PKSA 1OEBA 1NEBA 1TUDA 2EYYA 4JZ4A 2JM9A 2PTKA 4ESRA 1KIKA 2P4RA 2OI3A 4CC3A 1V1CA 2O9SA 1AZGB 3UA7A 2AKLA 2KYBA 1VYTA 1EFNA 4JPBW 1X2KA 1UJ0A 4J9EA 2D8HA 1K76A 1YWOA 3EHRA 3ZL7C 3UATA 1M3CA 2LQNA 2J6OA 2O31A 2ABLA 4HXJA 4GLMA 4D8DA 3VS4A 2CUDA 5HCKA 1I0CA 2JXBA 4RTZA 3QWXX 1SPKA 1U3OA 1UTIA 1GL5A 3THKA 3U23A 5IXFA 2AK5A 3VRZA 2JT4A 2DM1A 1GCQC 2RPNA 2CH4A 2LZ6B 2O2OA 1QKXA 1Z9ZA 2JW4A 3PVQA 1E6HA 3IQLA 4F14A 2PZ1A 2H8HA 4J9GA 2KR3A 4EIKA 1M27C 1H3HA 5IHNA 3M0RA 1HSQA 3PE0A 2BZ8A 4RTWA 1GCQA 4LE9A 2C0IA 1Z9QA 1BB9A 1JQQA 1VYVA 2DMOA 1PHTA 2CT3A 2K2MA 1K4US 1SRMA 1SEMA 2YDLA 1RLQC 1NLOC 3UF4A 1B3QA 1B07A 2AKKA 4HVUA 2DLPA 1PRMC 1NYGA 1T0HA 4ZNXA 2EGCA 4OMMA 1RLPC 4X1VA 3UA6A 2W0ZA 2EQIA 2QDLA 3KFVA 1QCFA 4F16A 3SEMA 2K3BA 5FWCA 1RUWA 1U06A 1WLPB 2RQRA 4Z88A 1M30A 3TSZA 1CSKA 2A28A 1G83A 3O5ZA 3M0UA 4RUGA 2D1XA 2C0OA 3EG1A 3JV3A 3A98A 2EGAA 1U5SA 2KT1A 4GBQA 1WXBA 2RQWA 1KSWA 2GGRA 1X6BA 3EG3A 1GFCA 4J9HA 1GBQA 2DE0X 2DL7A 4Z8AA 3EGUA 2ROLA 2YUPA 2YUNA 4Z89A 2LNHB 2DRKA 2O9VA 1WXTA 3I35A 2KYMA 2ENMA 3VS5A 4OMOA 1YWPA 2X3XD 4AG2C 2GQIA 3FJ5A 1WI7A 2JMAA 4R0KA 2KBTA 2CSQA 2MIOA 3RNJA 1UECA 2HEQA 1UDLA 3VS0A 2HCKA 2A36A 4RTUA 1W6XA 4ORZA 2EVRA 5GJWB 2FO0A 2I0NA 2AZVA 2KROA 2LQWA 1WXUA 4A63B 1TG0A 2VWFA 4AFZC 2DRMA 5IXBA 2O88A 1N5ZA 3GBQA 1GRIA 2B86A 3VS6A 2ECZA 5IH2A 4CC2A 1YCSB 1AD5A 4M4ZA 2JM8A 3I9QA 1ARKA 1OPKA 1ABOA 1UJYA 4JJDA 4F17A 3M0QA 4RTYA 3TVTA 1WYXA 2KEAA 1ZLMA 4WCIA 2FRWA 1X6GA 2J7IA 3H0HA 3VS3A 1SSHA 1QLYA 2HDAA 3PVLA 1K0SA 1AVZC 1K9AA 4J9IA 2NUZA 1ZUYA 1W1FA 2DF6A 4D8KA 2JS0A 2L3QA 1ZUKA 2KE9A 1E6GA 4HVWA 1T3SA 2NWMA 1Y57A 2BZXA 2LJ0A 2M51A 1BK2A 1ABQA 2DA9A 2F2VA 2HSPA 2MCNA 1G2BA 2DL5A 2CUBA 1H92A 2EYXA 2EKHA 4LUDA 4DEXA 4LN2A 1SHFA 2EYWA 2RMOA 2DL8A 5ECAA 1J3TA 4RTXA 1ZUUA 1UG1A 2JMCA 4OMQA 2D8JA 2ED1A 5FW9A 1JXMA 3NPFA 2J6FA 2KXCA 3M0SA 3VS7A 2M0YA 1BBZA 1XOVA 2HBWA 4KRTA 5EC7A 3EHQA 1QWEA 2ED0A 2DL3A 2OJ2A 1WA7A 1BU1A 2EW3A 2OAWA 5IHIA 2L3PA 1UHFA 2K79A 5IHKA 2RF0A 1MUZA 3NGPA 1M3BA 2DBKA 2L3SA 1KJWA 2DYBA 1JEGA 1UE9A 3R6NA 3C0CA 2CREA 2EBPA 4OMPA 4CC7A 2FRYA 2JS2A 1TUCA 2RQUA 4OMLA 4QT7A 4J9BA 1YNZA 2D0NA 2AZSA 3SHWA 2LJ1A 1A0NB 2GTOA 3VS2A 1E7OA 2GBQA 2MOXA 1PKTA 1NEGA 1AEYA 3VRYA 1CKAA 1FYNA 4AFQC 3LH5A 1GBRA 2EPDA 5GJVB 4OMNA 2IIMA 2V1QA 2GNCA 2YUOA 3I5SA 4IIOA 2JTEA 2KXDA 2RN8A 4FSSA 5I11A 1KFZA 2CSIA 1MV0B 1X69A 4J9CA 4AFSC 1AOJA 2DL4A 1QKWA 3RBBB 2C0TA 3ULRB 1NM7A 1X43A 3H41A 3VS1A 5FWBA 1K0XA 2DILA 2YSQA 2RQTA 1IO6A 1ZX6A 4RTVA 2W10A 4JZ3A 2LX7A 2BZYA 1YN8A 2RQVA 2K9GA 1PRLC 2X3WD 1LCKA 3NMZC 1UHCA 1PNJA 2A08A 1ZBJA 1NYFA 2FPFA 2EGEA 1NLPC 4LUEA 1X27A 1FMKA 2XMFA 1T3LA 1GCPA 2V1RA 2ROTA 4HVVA 4AFUC 3TSWA 3REAB 1MV3A 2DVJA 1QWFA 3EG0A 4DEYA 2SRCA 4RTTA 4J9FA 5L23A 2FPEA 2KRSA 3I5RA 1SRLA 1K1ZA 1M3AA 2KGTA 2KRMA 1NG2A 2DNUA 1JU5C 2CH4W 2GTJA 1X2QA 3EG2A 2FEIA 2CT4A 2LMJA 2J06A 1RI9A 2L0AA 2F2XA 3REBB 2A37A 1SHGA 1AWWA 1VYUA 3NHNA 1AWJA 1WFWA 1AZEA 2ESWA 4K11A 4CC4B 3H0IA 1OPLA 3M0PA 2YT6A 2SEMA 1HJDA 1HD3A 1WX6A 1AWOA 2DX1A 1GFDA 2J6KA 2DJQA 2VVKA 1YP5A 3QWYA 2F2WA 1S1NA 1ZSGA 2E5KA 4J9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWX A;  1CKB A;  2VKN A;  4LNP A;  1JO8 A;  1JXO A;  2KNB B;  2FG0 A;  2PNI A;  4AG1 C;  1T0J A;  1I1J A;  2J05 A;  2G6F X;  2BTT A;  2LJ3 A;  2K6D A;  2KRN A;  1WDX A;  2RNA A;  1OV3 A;  1OOT A;  1VA7 A;  2EYZ A;  1H8K A;  1I07 A;  2FPD A;  1PWT A;  1Y0M A;  2K7A A;  3CQT A;  4Y92 A;  4JJB A;  2CDT A;  2DBM A;  5I22 A;  4JJC A;  3H0F A;  2KT8 A;  2LP5 A;  4HCK A;  2YUQ A;  1M8M A;  1UFF A;  3M0T A;  4IIM A;  2LCS A;  4E6R A;  1W70 A;  1UGV A;  2L2P A;  1UUE A;  1WIE A;  1PKS A;  1OEB A;  1NEB A;  1TUD A;  2EYY A;  4JZ4 A;  2JM9 A;  2PTK A;  4ESR A;  1KIK A;  2P4R A;  2OI3 A;  4CC3 A;  1V1C A;  2O9S A;  1AZG B;  3UA7 A;  2AKL A;  2KYB A;  1VYT A;  1EFN A;  4JPB W;  1X2K A;  1UJ0 A;  4J9E A;  2D8H A;  1K76 A;  1YWO A;  3EHR A;  3ZL7 C;  3UAT A;  1M3C A;  2LQN A;  2J6O A;  2O31 A;  2ABL A;  4HXJ A;  4GLM A;  4D8D A;  3VS4 A;  2CUD A;  5HCK A;  1I0C A;  2JXB A;  4RTZ A;  3QWX X;  1SPK A;  1U3O A;  1UTI A;  1GL5 A;  3THK A;  3U23 A;  5IXF A;  2AK5 A;  3VRZ A;  2JT4 A;  2DM1 A;  1GCQ C;  2RPN A;  2CH4 A;  2LZ6 B;  2O2O A;  1QKX A;  1Z9Z A;  2JW4 A;  3PVQ A;  1E6H A;  3IQL A;  4F14 A;  2PZ1 A;  2H8H A;  4J9G A;  2KR3 A;  4EIK A;  1M27 C;  1H3H A;  5IHN A;  3M0R A;  1HSQ A;  3PE0 A;  2BZ8 A;  4RTW A;  1GCQ A;  4LE9 A;  2C0I A;  1Z9Q A;  1BB9 A;  1JQQ A;  1VYV A;  2DMO A;  1PHT A;  2CT3 A;  2K2M A;  1K4U S;  1SRM A;  1SEM A;  2YDL A;  1RLQ C;  1NLO C;  3UF4 A;  1B3Q A;  1B07 A;  2AKK A;  4HVU A;  2DLP A;  1PRM C;  1NYG A;  1T0H A;  4ZNX A;  2EGC A;  4OMM A;  1RLP C;  4X1V A;  3UA6 A;  2W0Z A;  2EQI A;  2QDL A;  3KFV A;  1QCF A;  4F16 A;  3SEM A;  2K3B A;  5FWC A;  1RUW A;  1U06 A;  1WLP B;  2RQR A;  4Z88 A;  1M30 A;  3TSZ A;  1CSK A;  2A28 A;  1G83 A;  3O5Z A;  3M0U A;  4RUG A;  2D1X A;  2C0O A;  3EG1 A;  3JV3 A;  3A98 A;  2EGA A;  1U5S A;  2KT1 A;  4GBQ A;  1WXB A;  2RQW A;  1KSW A;  2GGR A;  1X6B A;  3EG3 A;  1GFC A;  4J9H A;  1GBQ A;  2DE0 X;  2DL7 A;  4Z8A A;  3EGU A;  2ROL A;  2YUP A;  2YUN A;  4Z89 A;  2LNH B;  2DRK A;  2O9V A;  1WXT A;  3I35 A;  2KYM A;  2ENM A;  3VS5 A;  4OMO A;  1YWP A;  2X3X D;  4AG2 C;  2GQI A;  3FJ5 A;  1WI7 A;  2JMA A;  4R0K A;  2KBT A;  2CSQ A;  2MIO A;  3RNJ A;  1UEC A;  2HEQ A;  1UDL A;  3VS0 A;  2HCK A;  2A36 A;  4RTU A;  1W6X A;  4ORZ A;  2EVR A;  5GJW B;  2FO0 A;  2I0N A;  2AZV A;  2KRO A;  2LQW A;  1WXU A;  4A63 B;  1TG0 A;  2VWF A;  4AFZ C;  2DRM A;  5IXB A;  2O88 A;  1N5Z A;  3GBQ A;  1GRI A;  2B86 A;  3VS6 A;  2ECZ A;  5IH2 A;  4CC2 A;  1YCS B;  1AD5 A;  4M4Z A;  2JM8 A;  3I9Q A;  1ARK A;  1OPK A;  1ABO A;  1UJY A;  4JJD A;  4F17 A;  3M0Q A;  4RTY A;  3TVT A;  1WYX A;  2KEA A;  1ZLM A;  4WCI A;  2FRW A;  1X6G A;  2J7I A;  3H0H A;  3VS3 A;  1SSH A;  1QLY A;  2HDA A;  3PVL A;  1K0S A;  1AVZ C;  1K9A A;  4J9I A;  2NUZ A;  1ZUY A;  1W1F A;  2DF6 A;  4D8K A;  2JS0 A;  2L3Q A;  1ZUK A;  2KE9 A;  1E6G A;  4HVW A;  1T3S A;  2NWM A;  1Y57 A;  2BZX A;  2LJ0 A;  2M51 A;  1BK2 A;  1ABQ A;  2DA9 A;  2F2V A;  2HSP A;  2MCN A;  1G2B A;  2DL5 A;  2CUB A;  1H92 A;  2EYX A;  2EKH A;  4LUD A;  4DEX A;  4LN2 A;  1SHF A;  2EYW A;  2RMO A;  2DL8 A;  5ECA A;  1J3T A;  4RTX A;  1ZUU A;  1UG1 A;  2JMC A;  4OMQ A;  2D8J A;  2ED1 A;  5FW9 A;  1JXM A;  3NPF A;  2J6F A;  2KXC A;  3M0S A;  3VS7 A;  2M0Y A;  1BBZ A;  1XOV A;  2HBW A;  4KRT A;  5EC7 A;  3EHQ A;  1QWE A;  2ED0 A;  2DL3 A;  2OJ2 A;  1WA7 A;  1BU1 A;  2EW3 A;  2OAW A;  5IHI A;  2L3P A;  1UHF A;  2K79 A;  5IHK A;  2RF0 A;  1MUZ A;  3NGP A;  1M3B A;  2DBK A;  2L3S A;  1KJW A;  2DYB A;  1JEG A;  1UE9 A;  3R6N A;  3C0C A;  2CRE A;  2EBP A;  4OMP A;  4CC7 A;  2FRY A;  2JS2 A;  1TUC A;  2RQU A;  4OML A;  4QT7 A;  4J9B A;  1YNZ A;  2D0N A;  2AZS A;  3SHW A;  2LJ1 A;  1A0N B;  2GTO A;  3VS2 A;  1E7O A;  2GBQ A;  2MOX A;  1PKT A;  1NEG A;  1AEY A;  3VRY A;  1CKA A;  1FYN A;  4AFQ C;  3LH5 A;  1GBR A;  2EPD A;  5GJV B;  4OMN A;  2IIM A;  2V1Q A;  2GNC A;  2YUO A;  3I5S A;  4IIO A;  2JTE A;  2KXD A;  2RN8 A;  4FSS A;  5I11 A;  1KFZ A;  2CSI A;  1MV0 B;  1X69 A;  4J9C A;  4AFS C;  1AOJ A;  2DL4 A;  1QKW A;  3RBB B;  2C0T A;  3ULR B;  1NM7 A;  1X43 A;  3H41 A;  3VS1 A;  5FWB A;  1K0X A;  2DIL A;  2YSQ A;  2RQT A;  1IO6 A;  1ZX6 A;  4RTV A;  2W10 A;  4JZ3 A;  2LX7 A;  2BZY A;  1YN8 A;  2RQV A;  2K9G A;  1PRL C;  2X3W D;  1LCK A;  3NMZ C;  1UHC A;  1PNJ A;  2A08 A;  1ZBJ A;  1NYF A;  2FPF A;  2EGE A;  1NLP C;  4LUE A;  1X27 A;  1FMK A;  2XMF A;  1T3L A;  1GCP A;  2V1R A;  2ROT A;  4HVV A;  4AFU C;  3TSW A;  3REA B;  1MV3 A;  2DVJ A;  1QWF A;  3EG0 A;  4DEY A;  2SRC A;  4RTT A;  4J9F A;  5L23 A;  2FPE A;  2KRS A;  3I5R A;  1SRL A;  1K1Z A;  1M3A A;  2KGT A;  2KRM A;  1NG2 A;  2DNU A;  1JU5 C;  2CH4 W;  2GTJ A;  1X2Q A;  3EG2 A;  2FEI A;  2CT4 A;  2LMJ A;  2J06 A;  1RI9 A;  2L0A A;  2F2X A;  3REB B;  2A37 A;  1SHG A;  1AWW A;  1VYU A;  3NHN A;  1AWJ A;  1WFW A;  1AZE A;  2ESW A;  4K11 A;  4CC4 B;  3H0I A;  1OPL A;  3M0P A;  2YT6 A;  2SEM A;  1HJD A;  1HD3 A;  1WX6 A;  1AWO A;  2DX1 A;  1GFD A;  2J6K A;  2DJQ A;  2VVK A;  1YP5 A;  3QWY A;  2F2W A;  1S1N A;  1ZSG A;  2E5K A;  4J9D A; 
#chains in the Genus database with same CATH topology
 2VKN A;  1QVG S;  1T0J A;  2K5I A;  2G6F X;  1G3S A;  2RB6 A;  5GAN 5;  3CPW S;  4ZN3 A;  2KRN A;  5GAN 2;  1VQ8 A;  4F7U G;  1YJN A;  5GAM d;  4PJO B;  1Y96 A;  1PWT A;  1SKU B;  2O4X B;  3OYI A;  1U1S A;  4DOW A;  4DQ2 A;  3QDR B;  4JJB A;  1NPR A;  4M78 E;  1M1K U;  2KT8 A;  4E7K A;  4QKU A;  1M8M A;  1YIJ T;  3M0T A;  4IIM A;  4M77 F;  2F5T X;  2L2P A;  1PKS A;  1OEB A;  1TUD A;  4C8Q C;  1YIT Q;  2JM9 A;  2PTK A;  1KIK A;  1QCO A;  3UWN A;  4E2F B;  2XI9 A;  3CXC A;  1V1C A;  5GMK m;  1AZG B;  3UA7 A;  5KYW A;  2AKL A;  2HBP A;  4NL2 A;  1FMV A;  2DER A;  2A3L A;  1VQL Q;  3CCL T;  3UAT A;  5FRM A;  2F1L A;  2LQN A;  3QYH B;  2O31 A;  5HY6 A;  4M75 F;  4EMK C;  2EQU A;  4D8D A;  3I55 Q;  1WJS A;  4BD3 A;  2DVE A;  2DD5 A;  1I0C A;  3CMA Q;  1U3O A;  2P0P A;  4LD9 K;  1QVF P;  3O8V A;  3PT9 A;  2PQW A;  3HP9 A;  1Q7Y C;  4M7A G;  3CC2 A;  2AK5 A;  5GAO p;  3CMA T;  3V8K A;  3JCM b;  2RO0 A;  4B9X A;  1GCQ C;  4PK4 A;  1M1K R;  2CKK A;  2O2O A;  1R77 A;  2JW4 A;  3MO8 A;  5CIU A;  4J6Y A;  2DIQ A;  4PJO F;  2PZ1 A;  2H8H A;  1YHQ Q;  4J9G A;  2KR3 A;  3FJP A;  4B9W A;  2QQB A;  2ZPF B;  4IUU A;  4BDY A;  2XK0 A;  3M0R A;  1OZ2 A;  2BZ8 A;  3CCR A;  1GCQ A;  5CKB A;  4LE9 A;  1ZBX A;  1JQQ A;  1PHT A;  1WHH A;  3SWN C;  3CC7 A;  1K4U S;  1WHG A;  3RKW A;  2MWP A;  1SEM A;  2YDL A;  3OYN A;  3UF4 A;  2K3Y A;  2D9T A;  2DLP A;  2ZPB B;  1X01 A;  3HL8 A;  2JZ2 A;  2F69 A;  4BE1 A;  2DXC A;  1VQP T;  1KHC A;  4GY5 A;  4BDZ A;  4M7A F;  2K3B A;  3CCM T;  4A4E A;  3CCS T;  1N9R A;  1U06 A;  4JJN K;  1WLP B;  3TSZ A;  3X25 B;  2JN0 A;  4XTW A;  2A28 A;  3G4S A;  2A0F B;  1X75 C;  1O9S A;  4MZP A;  2CYZ B;  2C0O A;  4C92 A;  3DLL A;  4M78 C;  2DK3 A;  3SFM A;  5GAN f;  3JV3 A;  2EGA A;  1IGU A;  1U5S A;  3OYC A;  3JCM J;  3G7Z A;  2KT1 A;  2BIV A;  2HNI A;  3CC2 Q;  3RIR A;  3JCM h;  1WXB A;  4ELZ C;  4A4F A;  1X6B A;  2K5L A;  4C5E A;  3CCU T;  3EGU A;  4M77 A;  1G5V A;  3CCV Q;  1G3T A;  3M56 A;  1ZSZ C;  4L59 A;  3PTA A;  1Y07 A;  1XJW B;  4AG2 C;  3DKM A;  2DET A;  2G3R A;  1WJQ A;  4HCC A;  3RNJ A;  4J83 A;  5GAM j;  1YJ9 T;  1UDL A;  2E41 A;  1WHJ A;  3VS0 A;  2A36 A;  2EVR A;  3JCM e;  2FO0 A;  3GIB A;  2QEX Q;  2KRO A;  2F5K A;  2DO3 A;  2DRM A;  4CRI A;  2O01 E;  3VS6 A;  2K57 A;  2K4Y A;  1AD5 A;  3WVD B;  4N4G A;  2RHX A;  4M4Z A;  1ARK A;  3KUF A;  4WTO B;  3E1S A;  3G71 T;  3VYG A;  5KYY A;  4OP0 A;  3M0Q A;  2V8J A;  1WYX A;  4M78 G;  2DXT A;  3L2W A;  1ZLM A;  4RKU E;  4QQ6 A;  4M78 F;  3JCM X;  1RAC B;  3CME T;  3QG1 A;  1AVZ C;  3FC3 A;  2V8I A;  1KQS A;  1G3W A;  3JCM P;  3DB4 A;  1Q7Y U;  2L3Q A;  1ZUK A;  2KE9 A;  5GMK j;  1B34 A;  3FIF A;  2V8K A;  2YRD A;  5GMK h;  2M51 A;  1ABQ A;  4QQG A;  1TUG B;  1WHL A;  2DA9 A;  2QK0 A;  2HSP A;  2CP2 A;  2RK2 A;  3OW2 P;  5LJ5 h;  4RTX A;  3JB9 G;  5I21 A;  1UG1 A;  3QZ5 B;  4GLK A;  2JMC A;  3OYB A;  1TSF A;  2K3X A;  1XTD A;  4J6X A;  1Q82 R;  4C8Q F;  1S72 A;  4ANJ A;  1K8A C;  4XU1 A;  3M0S A;  3LX7 A;  1KQS P;  4BAC A;  4MZM A;  2M0Y A;  4KRT A;  2HBW A;  2GCX A;  3EHQ A;  4EPC A;  2IPO B;  4PLL A;  2COZ A;  4JDS A;  3CMA A;  3QZ9 B;  3GPL A;  1AHJ B;  2L3P A;  1M2O A;  1VIE A;  2RF0 A;  3X20 B;  1VQ7 A;  4PFP A;  1OQK A;  2DBK A;  2DYB A;  3OYY A;  1KC8 R;  2RJE A;  4EMK A;  2C06 A;  2CRE A;  1N8R R;  2RQU A;  4QT7 A;  4OML A;  4YTL A;  4DBR A;  3EAE A;  1YNZ A;  1QQJ A;  4R56 A;  2D0N A;  2AZS A;  3SHW A;  1M90 R;  6AT1 B;  3VS2 A;  2MOX A;  1CKA A;  1FYN A;  4AFQ C;  2QGF B;  3DLM A;  2EPD A;  4NS5 A;  5GJV B;  5J39 A;  2YUO A;  5GMK i;  2KXD A;  3EFO A;  3OBY A;  3I56 A;  3JB9 J;  1UB4 A;  1MV0 B;  4AFS C;  3OS1 A;  2RHU A;  2DL4 A;  2FHD A;  1D1C A;  3SWN B;  2EQM A;  1K9M U;  3ULR B;  1NM7 A;  3S3N A;  1K0X A;  3VJP A;  1BYM A;  2Y4X A;  2PVD B;  1VQL T;  1IO6 A;  4II1 A;  4RTV A;  3H9N A;  4N4H A;  3OYH A;  2K9G A;  2P0K A;  1UGS B;  3R6O A;  1ZBJ A;  2M02 A;  5HKC A;  3LWI A;  3CC2 T;  1EIF A;  2QTV A;  1YIT T;  4M75 A;  4FU6 A;  1GCP A;  2V1R A;  4N4I A;  2DYI A;  3M58 A;  4AFU C;  3REA B;  1EZZ B;  2QG9 B;  4DEY A;  1N8R C;  2BE7 D;  1LJO A;  4FYY B;  3OW2 A;  5LJ3 f;  1KK7 A;  1K1Z A;  2KGT A;  4M75 G;  1YJW T;  4KH1 B;  3M55 A;  2FEI A;  2CT4 A;  3CCJ T;  3EFO B;  2J06 A;  2LT1 A;  1RI9 A;  4TVR A;  1ZQ1 A;  2A37 A;  2EJ9 A;  3C95 A;  3L2Z A;  5LJ3 e;  2E65 A;  3MHX A;  4Y91 A;  3MP6 A;  1Q95 G;  1BI0 A;  1K8A U;  4C0G A;  3M0P A;  2YT6 A;  1HD3 A;  2PU9 B;  1UEB A;  4CI0 C;  5FU7 C;  2DJQ A;  4BI8 B;  1W2B A;  3QWY A;  2F2W A;  4PJM A;  2XID A;  3VUZ A;  2VXE A;  1VQM A;  4N0A C;  3L2U A;  3JB9 I;  4LNP A;  2LCL A;  1JXO A;  2PNI A;  1I1J A;  3LW5 E;  2J05 A;  5KYX A;  4C0D C;  2LCC A;  2RHY A;  2MMP A;  2LJ3 A;  2K6D A;  2RNA A;  1OOT A;  1VA7 A;  4QVC A;  1PM3 A;  3FB9 A;  2E4H A;  1I07 A;  3CPW A;  5AT1 B;  2QQA A;  1OX9 A;  3CQT A;  4F7U F;  4M7D A;  2CZ1 B;  2QXF A;  2CDT A;  5I22 A;  3H0F A;  2LP5 A;  2DFU A;  2YUQ A;  3GLX A;  1UFF A;  5I2S A;  5GAN j;  4X34 A;  4E6R A;  1VQ6 Q;  5HK3 A;  1UUE A;  1RAB B;  1NEB A;  4JZ4 A;  3OY9 A;  4ESR A;  1D0Y A;  1WPY A;  4CC3 A;  1VQK Q;  2O9S A;  2OAU A;  5KCO A;  4DA4 A;  1M8V A;  1EFN A;  5GAN 7;  3S3M A;  3PMI A;  1N27 A;  3FRN A;  3X24 B;  3PMT A;  1ACM B;  1M9S A;  1K76 A;  1KD1 R;  1YWO A;  1I8F A;  3CBM A;  4OMF B;  1M3C A;  1D3B A;  3PIO A;  1QP3 A;  2RJC A;  2J6O A;  5IAY A;  2ABL A;  2VC8 A;  3VS4 A;  2FB7 A;  2CUD A;  4RTZ A;  2NUT B;  3QWX X;  1LVK A;  1SPK A;  2PUO B;  3BY7 A;  2PVO B;  1GL5 A;  3F70 A;  3ZEH A;  1VQ6 A;  5IXF A;  4PFZ A;  3OYJ A;  5DM7 R;  1P92 A;  2DM1 A;  1VQ5 A;  2CH4 A;  1VQ8 Q;  5LJ3 j;  3PVQ A;  4J6W A;  1RAE B;  3S3O A;  1E6H A;  3OYF A;  2QDY B;  2X51 A;  3IQL A;  4UC4 A;  4F14 A;  1MNE A;  3LWH A;  4QQD A;  3RER A;  3A5Z B;  3EH1 A;  1M27 C;  3CBP A;  2DAQ A;  5IHN A;  3CME Q;  2LRQ A;  2JTF A;  4X9D A;  3PE0 A;  3CEY A;  4L6V 5;  2CZ0 B;  2CP3 A;  4J8O A;  4RTW A;  1NJI R;  1VYV A;  1R0C B;  2CT3 A;  3VKI A;  2X4W A;  1K73 R;  1IRE B;  1SRM A;  3I56 Q;  2MAM A;  1RLQ C;  4LDV A;  2QEX A;  1VQK A;  4EMK B;  2VV5 A;  1OX8 A;  2AKK A;  1RAI B;  5A0L A;  4PJL A;  2VAS A;  1NYG A;  1T0H A;  3QO3 A;  1RLP C;  1XQH A;  2KVQ G;  4AMC A;  4M7A A;  2W0Z A;  2LVM A;  3JAM E;  3RMQ A;  4BI4 A;  5FWC A;  2YRV A;  3A1P A;  5GAN e;  2EQK A;  1VQ9 T;  4JRI A;  3RES A;  4OB1 B;  2YWW A;  4M7D E;  4RUG A;  2D1X A;  1G3Y A;  4XTZ A;  1MHN A;  4AT1 B;  3EG1 A;  5D7U A;  1IRX A;  1G8X A;  2LTO A;  3GNG A;  2E12 A;  3N5B B;  3OS5 A;  4M75 D;  3E19 A;  5LL6 S;  4LDU A;  2EWN A;  5LJ5 j;  2IG0 A;  1Q7Y R;  3QUI A;  2HZY A;  1GFC A;  4ZN1 A;  5GAO n;  2QTX A;  1PC0 A;  4Z8A A;  1VQ7 T;  4E7Z A;  1VQO Q;  1NJI U;  2XDB A;  3TU4 K;  3HRT A;  5CKE A;  1TH7 A;  4DBQ A;  3EGD A;  3CD6 Q;  4QVD A;  2KYM A;  3CD6 A;  2ENM A;  3VS5 A;  4OMO A;  1YWP A;  3CCQ A;  1D0X A;  2HAX A;  2X3X D;  2ZAE A;  3FJ5 A;  3CCR Q;  1LNX A;  4M75 B;  4R0K A;  2KBT A;  1M2V A;  1YJN T;  1BIA A;  2CSQ A;  2MIO A;  4A53 A;  4XTY A;  3A8G B;  3OYM A;  4FW1 A;  1I5L A;  2DXU A;  4ORZ A;  1OU9 A;  3SB2 A;  4N0A A;  2LQW A;  4PNO A;  1VUB A;  1N5Z A;  5GAO q;  2B86 A;  2ECZ A;  4KUI A;  3HKS A;  4ME7 A;  4Z02 A;  1TWB A;  4KGZ B;  2CP5 A;  1OPK A;  2CGH A;  1MMA A;  1NZ9 A;  2VUB A;  5EG2 A;  3UDC A;  2LX9 A;  2D6F A;  2ZPE B;  2FRW A;  2J7I A;  2AT1 B;  2MPX C;  3H0H A;  3J80 E;  2YLB A;  2XG8 D;  2QA4 T;  3PIP A;  1PSE A;  1SSH A;  2DZ9 A;  4WF2 A;  2HDA A;  3PVL A;  4F7U E;  1K0S A;  2NUZ A;  5FU6 B;  3G71 A;  1YBY A;  2DF6 A;  2VGM A;  3CCQ Q;  1TTH B;  2NWM A;  3RDV A;  1HYO A;  1Y57 A;  1B34 B;  3EGD B;  1W2B S;  2K2V A;  2R57 A;  2JJ9 A;  4FM4 B;  2F2V A;  2L5Q A;  2MCN A;  1G2B A;  1UGQ B;  2DL5 A;  4LUD A;  1AT1 B;  3MEU A;  3GP8 A;  2QYZ A;  4RMO A;  4C0D B;  3CCU A;  1YJ9 A;  3RKY A;  2RMO A;  2JUF A;  4JRQ A;  5GAN 4;  1JXM A;  4A54 A;  3M54 A;  5GAM h;  2J6F A;  4P5N A;  4KGX B;  3QSU A;  1VQM T;  4NOY A;  1BBZ A;  2BKD N;  3RKX A;  3EGX A;  4MDW A;  1WA7 A;  2FVU A;  3L1A A;  2OAW A;  3MCA B;  2K5F A;  3VV0 A;  4E7S A;  2HKQ B;  1UHF A;  2QAZ A;  1KJW A;  1KHI A;  3NTH A;  1N8R U;  1JB0 E;  1WZO A;  3RR6 A;  2EBP A;  1MGQ A;  1O75 A;  3G1J A;  4OMP A;  3QXE B;  3CCJ A;  1OUL A;  4J9B A;  1TU0 B;  1F1B B;  2E6Z A;  2RJD A;  4ZGJ B;  1QVF S;  4KBM B;  3OSS C;  2ZGW A;  1E7O A;  3CC4 A;  1PKT A;  3BDL A;  3VRY A;  5LJ5 e;  3LH5 A;  1GBR A;  2NUT A;  2P0Q A;  3MET A;  3CCM A;  2L3R A;  3JCM g;  3CCR T;  2IIM A;  4BY6 B;  2GNC A;  4IIO A;  2JTE A;  2RN8 A;  2X4X A;  4FSS A;  3CD6 T;  3JSC A;  1X69 A;  5FRN A;  3FDR A;  3RBB B;  2MF2 A;  2EJF A;  3H41 A;  2QGG A;  2M0O A;  2VXF A;  5FWB A;  3C12 A;  3MPU B;  2DIL A;  2YSQ A;  3BDU A;  1YI2 T;  2ZPI B;  4JLI A;  2E70 A;  4M7D D;  2CP7 A;  1KQ2 A;  2E10 A;  5CQY A;  4ZGE B;  1PG5 B;  3JCM Q;  3TSW A;  4M7D F;  1D3B B;  1QWF A;  2DZC A;  4RTT A;  3EG9 B;  1KD1 U;  1BI2 A;  3I5R A;  2KRS A;  1M3A A;  2KQW A;  2M16 A;  2DNU A;  2CH4 W;  5GAO r;  1M2V B;  2GTJ A;  4JUV A;  3URG A;  4DBH A;  3SD4 A;  1K9M C;  1QW1 A;  2GFU A;  4OGE A;  4K11 A;  2DXB A;  1FWZ A;  1K8A R;  3EH2 A;  3P8D A;  2QEX T;  5GAO m;  4BUG A;  3HFO A;  2J6K A;  1IB8 A;  2FZC B;  1M90 C;  3HRS A;  4LDY A;  2FL7 A;  4DOV A;  1S1N A;  1ZSG A;  2E5K A;  2VGN A;  1AWX A;  1JO8 A;  2RI3 A;  2KNB B;  4XAX B;  2BTT A;  4A4G A;  5KE3 A;  3JB9 D;  2H3J A;  1WDX A;  3UT1 A;  1OZ3 A;  3OYE A;  3NTK A;  4M77 B;  1YJW Q;  2FPD A;  4BE2 A;  1TOV A;  4KT0 E;  1YIJ A;  3EFR A;  2K7A A;  4XTV A;  4Y92 A;  1YIJ Q;  3L42 A;  4M77 C;  1Q81 C;  2DBM A;  4JJC A;  3CCE Q;  4IUQ A;  2OTL Q;  4HCK A;  2E1H A;  4M7A E;  1W70 A;  1WIE A;  1JRI A;  3JB9 H;  2P4R A;  2OI3 A;  5LJ5 f;  1V76 A;  1VYT A;  1VQO T;  1DJ7 B;  1OYX A;  4J9E A;  1H3Z A;  1OU8 A;  2D8H A;  4VUB A;  2YXY A;  3EHR A;  1M1K C;  4J7F A;  3BW1 A;  2LC4 A;  4GLM A;  2JOY A;  2PVG B;  3P8B B;  5DLO A;  2NUP B;  5HCK A;  4PJO D;  4PJO E;  2JXB A;  3EFS A;  4KH0 B;  3A8L B;  1D09 B;  3J7A F;  3THK A;  3WVE B;  3OA6 A;  2LZ6 B;  1PD0 A;  5KYU B;  1KD1 C;  2AIR B;  2ZZD A;  5CKF A;  2QAS A;  4BB7 A;  5KYN A;  3ER0 A;  1HSQ A;  1QVP A;  1ZA1 B;  1Z9Q A;  2DMO A;  4LXC A;  1K73 U;  1KC8 C;  4PJJ A;  3G6E A;  2E64 A;  4BE0 A;  3OW2 S;  1B07 A;  3LYI A;  4FCY A;  2COY A;  5LJ5 g;  3MEW A;  1X6O A;  2GFA A;  1SG5 A;  1JJ2 S;  4RCC A;  4KGV B;  4X1V A;  4O5V A;  3KFV A;  3ASK A;  2Y4Y A;  1JJ2 A;  2EJG A;  4F16 A;  2BE9 B;  2R5M A;  3G4S T;  3P8H A;  3MEA A;  1RUW A;  4Z88 A;  1M30 A;  4RG2 A;  3V8L A;  1G83 A;  3CCE A;  3O5Z A;  4FSX A;  4M77 E;  4MZT A;  1VQP A;  3OBW A;  2KK4 A;  3LGF A;  1VQ7 Q;  2RI5 A;  4PKC C;  1YIT A;  4M7A C;  1MMN A;  2YLC A;  2KSS A;  3RUX A;  2RQW A;  4XU2 A;  1KSW A;  1OI1 A;  4R55 A;  2GGR A;  4BI3 A;  2RD1 A;  3CC7 T;  3EG3 A;  8ATC B;  1GBQ A;  2DE0 X;  3OYA A;  2ROL A;  3UPU A;  2ATC B;  2YUN A;  1C1A A;  4Z89 A;  2O9V A;  1WXT A;  1VQL A;  4M75 E;  4PJN A;  3I35 A;  5GAN 8;  2LQK A;  2JVV A;  2GQI A;  1WI7 A;  1D0Z A;  2JMA A;  3E9F A;  1BCO A;  4RTU A;  1W6X A;  1VIF A;  4JRP A;  4A4K A;  1QMC A;  2AHJ B;  2I0N A;  4M78 A;  2AZV A;  3ZBD A;  2PUK B;  5KYY B;  2BUD A;  5LJ3 g;  1WXU A;  4A63 B;  4C92 C;  3QPH A;  4OVA A;  4PJO G;  5IXB A;  3GOX A;  4PJO C;  3OQ5 A;  4C5H A;  4CC2 A;  1YCS B;  5D6Y A;  4E7I A;  3JCM d;  3CC4 T;  4FW2 A;  2MI6 A;  4HA8 A;  3I9Q A;  3I56 T;  2V26 A;  1ABO A;  4JJD A;  1S72 Q;  3OMC A;  3TVT A;  4ATO A;  4WCI A;  4FYX B;  1W4S A;  1WQW A;  1VOM A;  4J9I A;  4MDX A;  1ZUY A;  2CP0 A;  3OS2 A;  1RAD B;  4D8K A;  3M4G A;  1VQP Q;  2JS0 A;  5J26 A;  1NPP A;  1VQ9 A;  4JRK A;  2CP6 A;  4C0F A;  3M57 A;  3VUB A;  2LJ0 A;  1BK2 A;  4OGC A;  5DLQ E;  4M7D C;  2VB6 A;  3HRU A;  5IT9 E;  2HQX A;  1PCX A;  1ZHI A;  1BKB A;  2FZK B;  4B6M A;  2EKO A;  3PNW C;  2CUB A;  2DTO A;  1H92 A;  4DEX A;  2DKG A;  5KYX B;  2EYW A;  3Q1J A;  1MMG A;  1U8R A;  3JCM f;  1ZUU A;  2A7Y A;  3MP1 A;  2D8J A;  1FMW A;  3QJY A;  1KG1 A;  2YRC A;  3OMG A;  2RI2 A;  2KXC A;  3S6W A;  1VQ6 T;  1XOV A;  2YHT A;  1QWE A;  2ED0 A;  2DL3 A;  5GMK l;  2OTJ T;  5CKH A;  3T9N A;  3V7R A;  1VQN A;  2HSE B;  4EMH A;  5C0M A;  3NGP A;  1KC8 U;  1JEG A;  2HL5 C;  3L2V A;  3CXC S;  3C0C A;  3SDZ A;  2E3I A;  4CC7 A;  3OB9 A;  1MND A;  4J5Y A;  4OB3 B;  2DTH A;  4LDX A;  1IXD A;  3PFS A;  4C8Q G;  3OSV A;  1VQN T;  5CKD A;  1TXQ A;  2LJ1 A;  2GTO A;  1B7T A;  4ELY C;  4V2S A;  3PGG A;  2GBQ A;  5GMK e;  2OTJ A;  1AEY A;  1VQ9 Q;  4XU3 A;  2ZPG B;  4M75 C;  1LPL A;  5CR2 A;  1ZSZ B;  2RK1 A;  3QDF A;  2V1Q A;  4C8Q A;  3JCM V;  4M7D G;  3I5S A;  4J7I A;  1VQN Q;  2CSI A;  4J9C A;  1AOJ A;  1QKW A;  4EMG A;  1X43 A;  4C92 E;  1HXD A;  4C5I A;  1H64 1;  2EFI A;  3TEE A;  3A8O B;  4E7H A;  4QW2 A;  3CXC P;  2EAY A;  2W10 A;  4DBF A;  2LNV A;  2LX7 A;  2BZY A;  1YN8 A;  2RQV A;  2MK5 A;  3QII A;  2X4J A;  3LLR A;  1PNJ A;  2A08 A;  5GAM e;  2ZCF B;  1RL2 A;  2FPF A;  4LUE A;  1X27 A;  2OTJ Q;  1UGR B;  2P84 A;  1FMK A;  1QP2 A;  1T3L A;  4XQ3 A;  2ROT A;  4HVV A;  1M4Z A;  3JB9 F;  2EIF A;  2RHI A;  1BI1 A;  1SF9 A;  1MV3 A;  3NFC A;  2LQ8 A;  2SRC A;  4J9F A;  2HL3 A;  1VQ5 Q;  3M59 A;  1QVF A;  1R8O B;  2QA4 A;  2KRM A;  1RAH B;  1V29 B;  1NG2 A;  1FX7 A;  4L5G A;  3EG2 A;  2EQJ A;  2LMJ A;  3LGL A;  2L0A A;  3CCV A;  3REB B;  3CBO A;  2JNG A;  4JS4 A;  5D6W A;  2XD0 A;  3NHN A;  1AWJ A;  1WFW A;  1AZE A;  2MYS A;  1KQ1 A;  2QI2 A;  2ZPH B;  1JBM A;  1XNI A;  4KUD K;  1OPL A;  1VQK T;  5LJ3 d;  1AWO A;  2B8A A;  3ME9 A;  1RAF B;  1GFD A;  2XHC A;  2NLU A;  4OF1 A;  4F7U A;  2O4X A;  3M4Y A;  3QHS A;  4XK8 E;  4J9D A;  1WNL A;  2KI7 A;  2DD4 A;  1CKB A;  2FG0 A;  2WAC A;  4AG1 C;  5D6X A;  5GAN g;  7AT1 B;  2XDP A;  4M78 D;  2E3H A;  1OV3 A;  5L8R E;  1YHQ T;  2EYZ A;  1H8K A;  5FRO A;  1BI3 A;  1QVG P;  5LJ5 d;  1VQ4 Q;  1RAA B;  1Y0M A;  4IKF A;  1I5O B;  3M53 A;  4Q5W A;  4NL3 A;  3RMS A;  3MJX A;  2CZ7 B;  3WXM B;  4PL6 A;  4M78 B;  2LCS A;  4HCB A;  1UGV A;  4BY6 C;  2WSC E;  4IUT A;  3MEV A;  3C94 A;  2EYY A;  4FYV B;  1WHM A;  3CCV T;  3CCL A;  1Q82 C;  3QKJ A;  4MMK A;  2KYB A;  4JPB W;  4RCB A;  1X2K A;  1UJ0 A;  3FEO A;  2DTI A;  4JS5 A;  2X4Y A;  2EYQ A;  3ZL7 C;  5FLX E;  5KCH A;  2KDS A;  2Y90 A;  2XDD A;  1N9S A;  2DEQ A;  2DIG A;  4HXJ A;  3ZFJ A;  2LT4 A;  5GAN h;  3FLG A;  2NUP A;  3OS0 A;  5M9O A;  4C92 G;  1Y7X A;  1UTI A;  1ZSZ A;  3JRZ A;  4HKE A;  3U23 A;  3VU3 C;  1BIB A;  1M5Q 1;  3KBG A;  2NYS A;  1S72 T;  3VRZ A;  2JT4 A;  2R5A A;  1IHV A;  3INZ A;  1YFN A;  2QQS A;  2RPN A;  1QKX A;  1Z9Z A;  1RAG B;  1VQ8 T;  4EIK A;  3V7C A;  1H3H A;  1I81 A;  4LDW A;  2RH2 A;  4HT9 A;  2C0I A;  1BB9 A;  2RJF A;  3JCM W;  5FU7 B;  2H3E B;  1Y96 B;  2K2M A;  5J3B A;  1NLO C;  1B3Q A;  4HVU A;  1NBE B;  1PRM C;  5KYW B;  4ZGD B;  4ZNX A;  1Q81 R;  3HFN A;  3X26 B;  2EGC A;  4C92 D;  3CCU Q;  4OMM A;  5GAN 6;  3UA6 A;  1BCM A;  2EQI A;  2QDL A;  1QCF A;  3SEM A;  1W2B P;  3V7S A;  3HTR A;  1NJI C;  4FT4 A;  5IN1 A;  4X9C A;  2RQR A;  3EG9 A;  4QVZ A;  5CCA A;  2L89 A;  4M7D B;  1CSK A;  4PLI A;  2RM4 A;  3SWN A;  4XTU A;  3M0U A;  1I4K 1;  4A4H A;  3CME A;  1SSF A;  4E47 A;  3I55 T;  2DEU A;  2I2L A;  4D6W A;  5I2M A;  3A98 A;  1KQS S;  3CCS Q;  4EDU A;  4GBQ A;  3CPW P;  1Q86 U;  1QVG A;  1ZA2 B;  1YI2 Q;  2QA4 Q;  4Y28 E;  5A0D A;  3QJ6 A;  4J9H A;  2DL7 A;  3EGX B;  5CK9 A;  1K9M R;  2RA2 A;  2YUP A;  8AT1 B;  4IUP A;  2LNH B;  2DRK A;  2HKN A;  5KH6 A;  3CPF A;  4ZTF A;  3X28 B;  4O6J A;  1K73 C;  2LDM A;  2R58 A;  1WQ7 A;  1NE8 A;  1UEC A;  4IUV A;  2HEQ A;  3HSB A;  2HCK A;  1PSF A;  5FU6 C;  5GJW B;  1Y71 A;  1TG0 A;  2VWF A;  4AFZ C;  2O88 A;  3GBQ A;  1D1A A;  1GRI A;  3GNF B;  3BE3 A;  2Z0W A;  5IH2 A;  3CCS A;  4FYW B;  2JM8 A;  3H6Z A;  1UJY A;  4F17 A;  4M77 D;  2HMA A;  3CCJ Q;  9ATC B;  5CQX A;  4RTY A;  2KEA A;  1VQ4 A;  1YJW A;  5HK0 A;  3NTI A;  2MWO A;  1X6G A;  1Q81 U;  1IGQ A;  3MP8 A;  3VS3 A;  1QLY A;  1K9A A;  3G71 Q;  1D1B A;  2QQR A;  4JLG A;  4M7A B;  1W1F A;  3AHU A;  2CZ6 B;  3TCJ A;  2COW A;  3CC4 Q;  2OTL A;  3KXT A;  1E6G A;  4HVW A;  1T3S A;  4F7U B;  4FIB A;  2BZX A;  1IZ6 A;  2KY9 A;  3MKD A;  3V8J A;  1WGS A;  1WJR A;  1YI2 A;  2E6N A;  2DJZ A;  5CO7 A;  3JCM c;  2EYX A;  2EKH A;  1VQM Q;  1YJ9 Q;  3BFM A;  4LN2 A;  5GAN 3;  1SHF A;  1YHQ A;  2CS7 A;  5GAM g;  2DL8 A;  5ECA A;  1J3T A;  5GAO l;  2X35 A;  3C4S A;  1Q86 R;  4C92 B;  1C0M A;  4HCZ A;  4OMQ A;  2P4T A;  1Q82 U;  2ED1 A;  4E7L A;  5FW9 A;  3NPF A;  3VS7 A;  1R0B G;  2KAF A;  5EC7 A;  3DB3 A;  3CC7 Q;  3HPW A;  2OJ2 A;  4MML A;  1BU1 A;  2OTL T;  2EW3 A;  3TRE A;  2RHZ A;  2M9U A;  2XU8 A;  3QYG B;  5IHI A;  4HT8 A;  3AT1 B;  2K79 A;  2HQE A;  5IHK A;  3HHT B;  1MUZ A;  5AYF A;  1M3B A;  2L3S A;  4M77 G;  1UE9 A;  3R6N A;  5DY9 A;  3OYD A;  4C5G A;  2FRY A;  2JS2 A;  1TUC A;  1C6V X;  3OYG A;  2GQV A;  1VQ4 T;  1UGP B;  1M1F A;  3G4S Q;  2OX7 A;  4ZTJ A;  2VYT A;  3CCE T;  1HK9 A;  2D0Q B;  2FYK A;  5GAN d;  1A0N B;  3A8M B;  4OB2 B;  1M1G A;  3TQ7 P;  1NEG A;  2X9H A;  2IVW A;  2DPP B;  4C8Q E;  2HQH A;  3H8Z A;  3D7S B;  4OMN A;  3CCM Q;  2HD0 A;  2M1H A;  5GAM f;  1EX4 A;  3OYK A;  3G6E Q;  5I11 A;  1KFZ A;  5A0G A;  3GF5 A;  1GXI E;  1WHK A;  4C8Q D;  2C0T A;  3L2Q A;  4PFO A;  3VS1 A;  5KE2 A;  3G6E T;  1LOJ A;  2RQT A;  1ZX6 A;  1MMD A;  4JZ3 A;  1N6A A;  1PD1 A;  3OYL A;  1YJN Q;  2XKO C;  3M5A A;  1PRL C;  2X3W D;  3M9Q A;  1QCN A;  4LD6 A;  1LCK A;  2L8D A;  2KMT A;  3I55 A;  3NMZ C;  1UHC A;  1VQ5 T;  1NYF A;  4C8Q B;  4OB0 B;  2EGE A;  1NLP C;  1U1T A;  1IHW A;  5KYU A;  5CVI A;  2XMF A;  3LH0 A;  4FT2 A;  3J81 E;  4E7J A;  3VYH B;  4M7A D;  2JTM A;  2DVJ A;  4C0Z A;  4F04 B;  3EG0 A;  2E5Q A;  1YCY A;  5L23 A;  3CCL Q;  2FPE A;  4FL6 A;  1SRL A;  4XTX A;  1JU5 C;  1VQO A;  1X2Q A;  2XIC A;  5C6S A;  2FZG B;  5LJ3 h;  4C92 F;  2F2X A;  1SHG A;  1RI0 A;  1AWW A;  1FXX A;  1VYU A;  4KUL A;  3E2U A;  4RG8 A;  2ESW A;  5A2Q E;  3E9G A;  4IUR A;  1TS9 A;  4CC4 B;  3H0I A;  3CCQ T;  4XU0 A;  2SEM A;  1HJD A;  1M90 U;  1WX6 A;  3A8H B;  2GF7 A;  2WSE E;  2DX1 A;  1Q86 C;  3L2R A;  3QBY A;  4PJO A;  2VVK A;  1YP5 A;  2WSF E;  1JJ2 P;  2QQ9 A;  5CAI A; 
#chains in the Genus database with same CATH homology
 1AWX A;  1CKB A;  2VKN A;  4LNP A;  1JO8 A;  1JXO A;  2KNB B;  2FG0 A;  2PNI A;  4AG1 C;  1T0J A;  1I1J A;  2J05 A;  2G6F X;  2BTT A;  2LJ3 A;  2K6D A;  2KRN A;  1WDX A;  2RNA A;  1OV3 A;  1OOT A;  1VA7 A;  2EYZ A;  1H8K A;  1I07 A;  2FPD A;  1PWT A;  1Y0M A;  2K7A A;  3CQT A;  4Y92 A;  4JJB A;  2CDT A;  2DBM A;  5I22 A;  4JJC A;  3H0F A;  2KT8 A;  2LP5 A;  4HCK A;  2YUQ A;  1M8M A;  1UFF A;  3M0T A;  4IIM A;  2LCS A;  4E6R A;  1W70 A;  1UGV A;  2L2P A;  1UUE A;  1WIE A;  1PKS A;  1OEB A;  1NEB A;  1TUD A;  2EYY A;  4JZ4 A;  2JM9 A;  2PTK A;  4ESR A;  1KIK A;  2P4R A;  2OI3 A;  4CC3 A;  1V1C A;  2O9S A;  1AZG B;  3UA7 A;  2AKL A;  2KYB A;  1VYT A;  1EFN A;  4JPB W;  1X2K A;  1UJ0 A;  4J9E A;  2D8H A;  1K76 A;  1YWO A;  3EHR A;  3ZL7 C;  3UAT A;  1M3C A;  2LQN A;  2J6O A;  2O31 A;  2ABL A;  4HXJ A;  4GLM A;  4D8D A;  3VS4 A;  2CUD A;  5HCK A;  1I0C A;  2JXB A;  4RTZ A;  3QWX X;  1SPK A;  1U3O A;  1UTI A;  1GL5 A;  3THK A;  3U23 A;  5IXF A;  2AK5 A;  3VRZ A;  2JT4 A;  2DM1 A;  1GCQ C;  2RPN A;  2CH4 A;  2LZ6 B;  2O2O A;  1QKX A;  1Z9Z A;  2JW4 A;  3PVQ A;  1E6H A;  3IQL A;  4F14 A;  2PZ1 A;  2H8H A;  4J9G A;  2KR3 A;  4EIK A;  1M27 C;  1H3H A;  5IHN A;  3M0R A;  1HSQ A;  3PE0 A;  2BZ8 A;  4RTW A;  1GCQ A;  4LE9 A;  2C0I A;  1Z9Q A;  1BB9 A;  1JQQ A;  1VYV A;  2DMO A;  1PHT A;  2CT3 A;  2K2M A;  1K4U S;  1SRM A;  1SEM A;  2YDL A;  1RLQ C;  1NLO C;  3UF4 A;  1B3Q A;  1B07 A;  2AKK A;  4HVU A;  2DLP A;  1PRM C;  1NYG A;  1T0H A;  4ZNX A;  2EGC A;  4OMM A;  1RLP C;  4X1V A;  3UA6 A;  2W0Z A;  2EQI A;  2QDL A;  3KFV A;  1QCF A;  4F16 A;  3SEM A;  2K3B A;  5FWC A;  1RUW A;  1U06 A;  1WLP B;  2RQR A;  4Z88 A;  1M30 A;  3TSZ A;  1CSK A;  2A28 A;  1G83 A;  3O5Z A;  3M0U A;  4RUG A;  2D1X A;  2C0O A;  3EG1 A;  3JV3 A;  3A98 A;  2EGA A;  1U5S A;  2KT1 A;  4GBQ A;  1WXB A;  2RQW A;  1KSW A;  2GGR A;  1X6B A;  3EG3 A;  1GFC A;  4J9H A;  1GBQ A;  2DE0 X;  2DL7 A;  4Z8A A;  3EGU A;  2ROL A;  2YUP A;  2YUN A;  4Z89 A;  2LNH B;  2DRK A;  2O9V A;  1WXT A;  3I35 A;  2KYM A;  2ENM A;  3VS5 A;  4OMO A;  1YWP A;  2X3X D;  4AG2 C;  2GQI A;  3FJ5 A;  1WI7 A;  2JMA A;  4R0K A;  2KBT A;  2CSQ A;  2MIO A;  3RNJ A;  1UEC A;  2HEQ A;  1UDL A;  3VS0 A;  2HCK A;  2A36 A;  4RTU A;  1W6X A;  4ORZ A;  2EVR A;  5GJW B;  2FO0 A;  2I0N A;  2AZV A;  2KRO A;  2LQW A;  1WXU A;  4A63 B;  1TG0 A;  2VWF A;  4AFZ C;  2DRM A;  5IXB A;  2O88 A;  1N5Z A;  3GBQ A;  1GRI A;  2B86 A;  3VS6 A;  2ECZ A;  5IH2 A;  4CC2 A;  1YCS B;  1AD5 A;  4M4Z A;  2JM8 A;  3I9Q A;  1ARK A;  1OPK A;  1ABO A;  1UJY A;  4JJD A;  4F17 A;  3M0Q A;  4RTY A;  3TVT A;  1WYX A;  2KEA A;  1ZLM A;  4WCI A;  2FRW A;  1X6G A;  2J7I A;  3H0H A;  3VS3 A;  1SSH A;  1QLY A;  2HDA A;  3PVL A;  1K0S A;  1AVZ C;  1K9A A;  4J9I A;  2NUZ A;  1ZUY A;  1W1F A;  2DF6 A;  4D8K A;  2JS0 A;  2L3Q A;  1ZUK A;  2KE9 A;  1E6G A;  4HVW A;  1T3S A;  2NWM A;  1Y57 A;  2BZX A;  2LJ0 A;  2M51 A;  1BK2 A;  1ABQ A;  2DA9 A;  2F2V A;  2HSP A;  2MCN A;  1G2B A;  2DL5 A;  2CUB A;  1H92 A;  2EYX A;  2EKH A;  4LUD A;  4DEX A;  4LN2 A;  1SHF A;  2EYW A;  2RMO A;  2DL8 A;  5ECA A;  1J3T A;  4RTX A;  1ZUU A;  1UG1 A;  2JMC A;  4OMQ A;  2D8J A;  2ED1 A;  5FW9 A;  1JXM A;  3NPF A;  2J6F A;  2KXC A;  3M0S A;  3VS7 A;  2M0Y A;  1BBZ A;  1XOV A;  2HBW A;  4KRT A;  5EC7 A;  3EHQ A;  1QWE A;  2ED0 A;  2DL3 A;  2OJ2 A;  1WA7 A;  1BU1 A;  2EW3 A;  2OAW A;  5IHI A;  2L3P A;  1UHF A;  2K79 A;  5IHK A;  2RF0 A;  1MUZ A;  3NGP A;  1M3B A;  2DBK A;  2L3S A;  1KJW A;  2DYB A;  1JEG A;  1UE9 A;  3R6N A;  3C0C A;  2CRE A;  2EBP A;  4OMP A;  4CC7 A;  2FRY A;  2JS2 A;  1TUC A;  2RQU A;  4OML A;  4QT7 A;  4J9B A;  1YNZ A;  2D0N A;  2AZS A;  3SHW A;  2LJ1 A;  1A0N B;  2GTO A;  3VS2 A;  1E7O A;  2GBQ A;  2MOX A;  1PKT A;  1NEG A;  1AEY A;  3VRY A;  1CKA A;  1FYN A;  4AFQ C;  3LH5 A;  1GBR A;  2EPD A;  5GJV B;  4OMN A;  2IIM A;  2V1Q A;  2GNC A;  2YUO A;  3I5S A;  4IIO A;  2JTE A;  2KXD A;  2RN8 A;  4FSS A;  5I11 A;  1KFZ A;  2CSI A;  1MV0 B;  1X69 A;  4J9C A;  4AFS C;  1AOJ A;  2DL4 A;  1QKW A;  3RBB B;  2C0T A;  3ULR B;  1NM7 A;  1X43 A;  3H41 A;  3VS1 A;  5FWB A;  1K0X A;  2DIL A;  2YSQ A;  2RQT A;  1IO6 A;  1ZX6 A;  4RTV A;  2W10 A;  4JZ3 A;  2LX7 A;  2BZY A;  1YN8 A;  2RQV A;  2K9G A;  1PRL C;  2X3W D;  1LCK A;  3NMZ C;  1UHC A;  1PNJ A;  2A08 A;  1ZBJ A;  1NYF A;  2FPF A;  2EGE A;  1NLP C;  4LUE A;  1X27 A;  1FMK A;  2XMF A;  1T3L A;  1GCP A;  2V1R A;  2ROT A;  4HVV A;  4AFU C;  3TSW A;  3REA B;  1MV3 A;  2DVJ A;  1QWF A;  3EG0 A;  4DEY A;  2SRC A;  4RTT A;  4J9F A;  5L23 A;  2FPE A;  2KRS A;  3I5R A;  1SRL A;  1K1Z A;  1M3A A;  2KGT A;  2KRM A;  1NG2 A;  2DNU A;  1JU5 C;  2CH4 W;  2GTJ A;  1X2Q A;  3EG2 A;  2FEI A;  2CT4 A;  2LMJ A;  2J06 A;  1RI9 A;  2L0A A;  2F2X A;  3REB B;  2A37 A;  1SHG A;  1AWW A;  1VYU A;  3NHN A;  1AWJ A;  1WFW A;  1AZE A;  2ESW A;  4K11 A;  4CC4 B;  3H0I A;  1OPL A;  3M0P A;  2YT6 A;  2SEM A;  1HJD A;  1HD3 A;  1WX6 A;  1AWO A;  2DX1 A;  1GFD A;  2J6K A;  2DJQ A;  2VVK A;  1YP5 A;  3QWY A;  2F2W A;  1S1N A;  1ZSG A;  2E5K A;  4J9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...