2RPNA

A crucial role for high intrinsic specificity in the function of yeast sh3 domains
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
APWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-binding protein
publication title Structural, functional, and bioinformatic studies demonstrate the crucial role of an extended peptide binding site for the SH3 domain of yeast Abp1p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rpnA00
1E6HA 5GJWB 3M0QA 1T0JA 2DVJA 1NLPC 3M0RA 3SEMA 1K0XA 2JM9A 2ROLA 2SRCA 1UTIA 2CH4W 1JEGA 4KRTA 1K1ZA 3TSZA 4J9HA 1UHFA 2DL5A 2BZYA 2EVRA 2EYXA 4D8KA 4DEYA 1G83A 1OEBA 1RI9A 4JJBA 2DL8A 2KYMA 1BB9A 4QT7A 1X69A 4RTYA 2GNCA 2KBTA 2F2VA 2K79A 1UE9A 4OMMA 1GBQA 1NEGA 2OAWA 1RLPC 2DYBA 2FO0A 2L3SA 4J9EA 1ZUUA 2EYYA 1QLYA 1OV3A 2YUQA 3H41A 2DL7A 2JMCA 3VRYA 1YNZA 4RTZA 1YWPA 3RNJA 4CC4B 1JO8A 2V1QA 2EGEA 2YUOA 1AWJA 2CT4A 2C0IA 1KSWA 1WIEA 3THKA 1K76A 2CSIA 2YDLA 3FJ5A 5IXBA 1GL5A 1PKSA 2ESWA 2KRMA 5IH2A 2PTKA 1E7OA 2K3BA 1ABQA 1WXUA 2I0NA 4HCKA 1CSKA 3EHQA 1A0NB 2LZ6B 1HJDA 3CQTA 2C0OA 3EHRA 5FWBA 2KEAA 3EGUA 1AEYA 2DM1A 2RQRA 2V1RA 4AG1C 4JJDA 2CUDA 3LH5A 2LCSA 4J9GA 2YSQA 4ORZA 4J9FA 2BZXA 1V1CA 4WCIA 1BU1A 2GBQA 3A98A 1RLQC 2IIMA 3H0HA 1U06A 1OPKA 1NYFA 2DBMA 2KT1A 1M8MA 2AK5A 3EG0A 1B07A 1YCSB 4Z88A 4RTWA 1BK2A 3TSWA 1X6BA 2L3PA 1ZLMA 2JW4A 4LN2A 1UG1A 2A28A 1GCPA 2DE0X 1PWTA 2D8JA 2EGAA 4OMLA 1JXMA 1RUWA 1Y0MA 2JMAA 3M0TA 2LP5A 2A37A 2X3WD 1M30A 1Y57A 4RTXA 3NPFA 1SHGA 1CKBA 2DJQA 1IO6A 2K7AA 2W0ZA 4J9BA 4GBQA 2GTOA 3VS3A 4JPBW 2KR3A 1SPKA 1VYVA 1ZX6A 2LJ0A 5IHKA 4LUEA 3UA7A 4E6RA 2L3QA 4RUGA 3R6NA 2SEMA 5FWCA 1T3SA 2CH4A 4HVWA 4CC7A 2G6FX 2D8HA 1X43A 2J6KA 2KXCA 2D0NA 1NEBA 2KGTA 4IIOA 1TUCA 3I5SA 5HCKA 2YUPA 2VWFA 4CC3A 1SRLA 2JXBA 1WDXA 1X2KA 3PVLA 2F2WA 1W70A 2O31A 2RQUA 1W1FA 2L2PA 4JJCA 2AZVA 1WX6A 2EQIA 2EW3A 4R0KA 1GBRA 4M4ZA 3NGPA 2D1XA 2J6FA 2RQWA 2K6DA 1U3OA 1ZUYA 4D8DA 1OPLA 1PKTA 1NYGA 4J9DA 2GQIA 2LMJA 2KXDA 1SHFA 4GLMA 1GFDA 4EIKA 1TG0A 3RBBB 2LJ1A 3VS6A 2M0YA 2HDAA 1VYUA 1WYXA 4Y92A 1YWOA 3VRZA 2RQVA 2P4RA 3REBB 4LE9A 4AFUC 2KE9A 1KJWA 1YP5A 4ESRA 5IHNA 2VKNA 1M3AA 2FPEA 4A63B 2FRWA 2EKHA 1MV3A 1LCKA 5I22A 2RQTA 3QWXX 2EYWA 2MIOA 2H8HA 1KFZA 4J9IA 1VA7A 3VS7A 2XMFA 2RMOA 2ED1A 1UJYA 2KNBB 4RTTA 3SHWA 2KRSA 1CKAA 2EBPA 2HCKA 2ROTA 2GGRA 1M27C 1VYTA 1QWEA 1WFWA 1ARKA 1K0SA 1GRIA 1T3LA 2CT3A 2EYZA 1I0CA 4HVVA 3IQLA 4HXJA 2E5KA 3M0UA 2DL4A 1BBZA 5IHIA 2J06A 1UUEA 1NM7A 3TVTA 2FRYA 1GCQC 1X6GA 2J7IA 4OMOA 3U23A 4OMQA 4LUDA 2FPFA 2DMOA 1E6GA 3NMZC 1S1NA 1X27A 1FMKA 2L0AA 2DRKA 2DX1A 2DF6A 2B86A 2RF0A 2AKKA 1M3CA 1UECA 2KROA 4RTVA 4AFZC 2ABLA 2KT8A 5ECAA 2AKLA 2MOXA 3C0CA 2JS0A 2MCNA 1ZBJA 3PE0A 1JQQA 1AWXA 2K2MA 4FSSA 2DRMA 2OI3A 1SEMA 2CUBA 2LJ3A 3JV3A 1YN8A 2C0TA 2FG0A 4Z89A 2O9VA 2DILA 2RNAA 2OJ2A 2RN8A 4F17A 1PNJA 1UHCA 4JZ3A 5FW9A 2NWMA 2JTEA 1PRLC 1GCQA 1I1JA 4F16A 1AWWA 1UDLA 1AZEA 3ULRB 5EC7A 3EG2A 2EGCA 1TUDA 4K11A 2W10A 2LX7A 2FPDA 4F14A 2JM8A 2CREA 1B3QA 2YUNA 2JT4A 1T0HA 1Z9QA 1H92A 2F2XA 1X2QA 1NG2A 1QCFA 1UFFA 2GTJA 2JS2A 2DNUA 3M0PA 4IIMA 5L23A 5I11A 2X3XD 1WXTA 1H8KA 1WLPB 3VS1A 2QDLA 2FEIA 3QWYA 1K4US 3ZL7C 2KYBA 3KFVA 2J6OA 3UA6A 3NHNA 3M0SA 2PZ1A 1G2BA 1AZGB 1QWFA 1JU5C 1SSHA 2O9SA 2LQWA 2DLPA 1QKWA 4AFSC 4OMNA 4JZ4A 1FYNA 3H0FA 1MUZA 2NUZA 3I35A 4DEXA 5IXFA 1J3TA 1WXBA 2M51A 4AG2C 2A08A 1UJ0A 3UF4A 2CSQA 1AWOA 1NLOC 4ZNXA 3O5ZA 1WA7A 4LNPA 1ZUKA 1KIKA 1K9AA 1MV0B 2BTTA 3GBQA 4RTUA 3VS5A 1EFNA 1XOVA 3PVQA 2LNHB 4AFQC 2J05A 1ZSGA 2O88A 3I9QA 1H3HA 4CC2A 2KRNA 1AVZC 2ECZA 2LQNA 1OOTA 2RPNA 3EG3A 5GJVB 2DBKA 2HBWA 4HVUA 1HSQA 3UATA 1WI7A 1N5ZA 3VS2A 2ENMA 1AOJA 3EG1A 1GFCA 2O2OA 1QKXA 4J9CA 2BZ8A 1Z9ZA 2VVKA 4Z8AA 2CDTA 3I5RA 1W6XA 2A36A 4OMPA 3H0IA 2DA9A 1PHTA 1UGVA 1JXOA 2EPDA 2HEQA 2DL3A 4X1VA 1U5SA 3VS4A 1HD3A 1I07A 2YT6A 2HSPA 1AD5A 3REAB 1SRMA 1M3BA 2AZSA 3VS0A 2PNIA 2ED0A 1PRMC 1ABOA 2K9GA
chains in the Genus database with same CATH superfamily
4M7AF 3CD6T 4XU2A 1T0JA 1NLPC 4NS5A 2JM9A 3DLLA 3GLXA 2D6FA 1OYXA 2NUPB 4C8QB 2BE7D 4BDYA 3CCQQ 1JEGA 4QVCA 2M02A 2WACA 2EYQA 1K1ZA 3TSZA 3R6OA 4E47A 5KYUB 1PSEA 4D8KA 4A4FA 1OEBA 2JTFA 2R57A 3PIOA 4C5EA 4F7UG 2GQVA 2GNCA 5GMKi 2F2VA 2Y4XA 2K79A 3A5ZB 1LVKA 1UE9A 1PG5B 2O4XA 3OSVA 3JB9D 2XG8D 1GBQA 1NEGA 2OAWA 4OVAA 1IB8A 4M7AE 1ZUUA 2DTOA 4RG8A 3WXMB 1QLYA 1YJ9Q 2CP2A 4AT1B 3JCMd 4KBMB 4CC4B 1TSFA 3MKDA 1F1BB 1I4K1 3M56A 3OYDA 1AWJA 2CT4A 2C0IA 3CC7T 4MMLA 1WIEA 1VQLT 4FYVB 2CSIA 1LOJA 1B34A 1XJWB 2PTKA 2RI3A 2K3BA 1WXUA 4HCKA 2I0NA 1X75C 2RJCA 2DJZA 3MP8A 3QJYA 1U8RA 2MWOA 1R8OB 4AG1C 3LH5A 3L2RA 2YSQA 3HP9A 1K8AR 3LWHA 2BKDN 2FB7A 1Q82R 1VIFA 2H3JA 1U06A 1OPKA 2DTHA 4BI4A 1D09B 2M16A 2CKKA 2IG0A 4C0ZA 2KT1A 3S3OA 2AK5A 5KE3A 5CR2A 2CGHA 3JB9J 1B07A 1I8FA 1YCSB 1JJ2P 4X34A 1KHCA 4OB1B 3TSWA 4ZGDB 4RKUE 3VYGA 3VUZA 3TU4K 1ZLMA 3OYHA 5GANh 2XICA 2EGAA 4C8QC 1Y0MA 3FIFA 4LDXA 1C0MA 3M0TA 2LP5A 4M78D 4O5VA 4J6YA 1D1BA 2RB6A 1M30A 3M4GA 1Y57A 2QQBA 2W0ZA 1RABB 2CZ6B 4GBQA 2GTOA 4M75D 3VS3A 3S6WA 1VYVA 2KVQG 3GNFB 4QQ6A 3JCMQ 4LD9K 2KY9A 3UA7A 3QG1A 5HK0A 4FL6A 1T3SA 2CH4A 2DAQA 2X35A 5LJ5d 3S3MA 4X9DA 4CC7A 3SWNB 2KGTA 4IIOA 5HCKA 2VWFA 1VUBA 4BACA 1M8VA 1X2KA 1LJOA 3JCMe 2F2WA 1W1FA 2NUPA 4JLIA 1BIBA 4KH1B 4C8QA 4JJCA 1C6VX 2AZVA 2XK0A 4M4ZA 2D1XA 5KYUA 3CCRQ 2AT1B 2K6DA 5GAN5 2L5QA 3CCQA 2MPXC 4J8OA 2QA4Q 4DBFA 4C0DB 3A8LB 2GQIA 2HL5C 5KYYB 1OU8A 1YBYA 5GAMg 3CCQT 1SHFA 1IZ6A 2NUTB 1M1KC 3KUFA 4EIKA 2RHUA 2DO3A 1TG0A 1R77A 2RK1A 1V29B 2DETA 2M0YA 2HDAA 5KYWB 4OMFB 3OS2A 3CC4Q 1WYXA 2RQVA 3G4SA 5C0MA 1YJ9A 1YCYA 4ESRA 2FZCB 5IHNA 1QCNA 3G4ST 1SKUB 3ME9A 3E9FA 2COZA 1LPLA 2RQTA 3QWXX 1YJ9T 4C5IA 5A0DA 1UB4A 1KFZA 3VS7A 3L2WA 4IUVA 2H3EB 2RMOA 3LH0A 4PNOA 4XTVA 5CK9A 1CKAA 4XTXA 3CXCA 5GMKe 2GGRA 2E41A 3C12A 1QWEA 1MHNA 2CP3A 1K0SA 1OU9A 2DD5A 3LYIA 3QJ6A 4M77G 1I0CA 1NJIC 1KQSP 1M1FA 3M0UA 2CZ1B 1TH7A 2KMTA 2O01E 2J06A 4ZTFA 1UUEA 3TVTA 1X6GA 3H8ZA 2LCCA 4LUDA 3VU3C 2YXYA 3NMZC 1S1NA 4JDSA 1RI0A 1QVFS 1S72Q 2LTOA 4D6WA 3BE3A 3SWNC 2AKKA 1VQ9Q 1OX8A 4PJLA 4XQ3A 1WJSA 4BE0A 5LJ5e 2MOXA 4C8QG 2JS0A 2MCNA 5LJ3d 3CCSQ 1ZBJA 3CCVQ 1SEMA 2CUBA 3OYIA 4BI8B 2ZPHB 3JV3A 1BI2A 3HTRA 1UGRB 3M58A 5CKFA 5GANg 3QHSA 3CCEQ 4C0DC 2V8KA 2OJ2A 4EDUA 1M90R 3C4SA 4KH0B 4CI0C 1UHCA 2P4TA 4PKCC 5LJ5f 5FU6B 4F16A 7AT1B 1UDLA 2EWNA 2K5IA 4GY5A 4XTZA 4KGZB 2F5KA 5DM7R 4K11A 1KHIA 2FPDA 2ZPFB 3CCMQ 3SWNA 2CREA 3RIRA 2LVMA 4FCYA 2RI2A 1Z9QA 1YJNT 2BE9B 5EG2A 2F2XA 1NG2A 2GTJA 2DNUA 4X9CA 3G7ZA 4J6XA 2X3XD 1WXTA 1WLPB 5FRNA 2QYZA 2EJFA 3QWYA 1Q81U 4Y91A 5I21A 3KFVA 1KC8R 2PZ1A 2YRCA 2BUDA 3CCRA 4VUBA 2CZ0B 2MK5A 2C06A 3PMIA 5KYYA 4OMNA 4JZ4A 4OF1A 3E19A 2NUTA 1UGQB 2QA4A 4DEXA 2K57A 1J3TA 3CCRT 3CBMA 4R56A 3FRNA 1VQ8Q 4AG2C 1Q86U 2A08A 1UJ0A 5KYWA 2CP0A 2QA4T 3I55T 2CSQA 1KG1A 1K73C 3CCUQ 4C92B 4LNPA 3GBQA 2OX7A 4RTUA 3CMEQ 3PVQA 2J05A 4QQGA 3PIPA 1M9SA 3I9QA 3L2UA 2ECZA 1OOTA 4A4EA 3MP6A 1HYOA 4HVUA 1HSQA 3NTKA 3UATA 2KI7A 1Q7YC 8AT1B 3TCJA 2I2LA 1N5ZA 1QKXA 4J9CA 2RHIA 1RADB 2P0KA 5J39A 2WSCE 2KQWA 3PNWC 2OTLA 2WSEE 3OW2S 2JNGA 4ELYC 2HEQA 1U5SA 1HD3A 2OTLT 2MYSA 5FU6C 1Q95G 1W2BS 1WGSA 3HFNA 4V2SA 2K2VA 4C8QD 1M2OA 5LJ3f 3HSBA 2K9GA 1E6HA 1S72A 3ASKA 1Y7XA 2D0QB 2NYSA 1VQ9A 5FRMA 2LT1A 2ROLA 2SRCA 1O9SA 4ZGJB 3AHUA 1VQ9T 3TEEA 3CCSA 3CCVA 2XDBA 4KRTA 3CC7Q 2COWA 4J9HA 4M7DG 2DL5A 2EYXA 1VQLQ 3HRUA 4L6V5 3CCST 1RI9A 4JJBA 3CCVT 1BB9A 2HNIA 3V7SA 3OBWA 3EFOB 2Z0WA 2KBTA 3CCEA 4PJOB 1QMCA 1O75A 2RHXA 5FU7B 2DYBA 2FO0A 2L3SA 5GANj 1PSFA 1NBEB 1AHJB 4C92C 1YNZA 4RTZA 1YWPA 4JRPA 2DD4A 1PD0A 2RD1A 1MMNA 3RNJA 2YRDA 1JO8A 1RAAB 4QVZA 4JJNK 3CCMA 2YUOA 2KK4A 4RG2A 3QYHB 5HY6A 1TUGB 3CEYA 1K76A 3OBYA 3CCMT 3J7AF 2HSEB 2YRVA 3OQ5A 4HA8A 4ZGEB 5IXBA 2ESWA 3LW5E 2KRMA 3M4YA 5IH2A 4C0FA 3O8VA 3UDCA 1SSFA 1ABQA 4QVDA 2RO0A 5GAOq 2HQHA 5D6WA 5J3BA 4XK8E 4QW2A 4IUQA 5FWBA 2PUKB 2V1RA 2DYIA 4PJNA 2B8AA 1VQ5A 4J9GA 4B9XA 3CPWP 4EMGA 2ZAEA 2VGMA 5LJ3g 1IREB 3OYEA 2HKNA 3H6ZA 3A98A 1VQ5T 2IIMA 1VQ8A 2RM4A 4BE1A 2RHZA 2A0FB 5GAN8 3FB9A 4KULA 4JRQA 3CCUA 2LRQA 1VQPA 3CC2Q 1QVFA 3A8HB 1VQ8T 1NE8A 4M77F 1OULA 2NLUA 2VXFA 3X28B 3CMEA 2MF2A 2XDPA 1VQPT 3SB2A 2CP6A 1X6BA 3QUIA 4PFZA 3WVDB 1UG1A 3CMET 2A28A 4OGEA 3LX7A 1RUWA 1PCXA 1N9SA 4PJMA 3T9NA 3MEWA 2A37A 2CS7A 4N4HA 5D6YA 1CKBA 5DLQE 1OQKA 2K4YA 2M0OA 4E7IA 3PMTA 4PJOC 2LJ0A 2E65A 5FU7C 4M77E 2CP7A 3INZA 5FWCA 3MJXA 5GAMh 2FHDA 2G6FX 2D8HA 1X43A 3M54A 4WF2A 1WHHA 2J6KA 2D0NA 2KSSA 3I5SA 3JRZA 1G5VA 1WDXA 1M2VB 5HKCA 5CAIA 3BY7A 4M7AB 2VXEA 4M7DD 1W70A 2RQUA 3A8OB 3RMQA 3OS5A 5CKDA 1M1KU 2EQIA 3G4SQ 4R0KA 1FMVA 1X6OA 3JSCA 3M5AA 1U3OA 1ZUYA 4D8DA 4MZMA 3EH1A 3CC7A 1UGSB 4MZPA 2ZPBB 1VQLA 3EFOA 1I81A 2KXDA 4PJOA 1GFDA 2M9UA 1K8AC 3RKXA 3RBBB 4JRIA 3TQ7P 2JUFA 4C92G 1LNXA 3VS6A 1Q82C 3GNGA 9ATCB 3MO8A 2JTMA 2E1HA 4DBRA 2JZ2A 1HXDA 3UWNA 3JCMJ 4LE9A 4MMKA 1MMGA 1WNLA 3HHTB 1N8RU 2FPEA 2FRWA 4II1A 3EFSA 2IPOB 2EYWA 1QVGP 1NJIU 3OYKA 2ED1A 1UJYA 2KNBB 2E3HA 4LXCA 4ANJA 1M27C 1RAEB 2CT3A 1T3LA 4BUGA 4ZTJA 1UGPB 4HVVA 5I2MA 2R5AA 5CKHA 3FLGA 3OW2A 1BBZA 1XQHA 2V26A 2YLCA 1Y07A 1GCQC 4IUTA 2J7IA 2K3XA 1WHGA 4QKUA 2LNVA 2MMPA 1VQMQ 2FPFA 3JB9I 1W2BA 2DMOA 3HFOA 2KAFA 4RCBA 3DB4A 3OMGA 4C0GA 2DF6A 2LCLA 4JUVA 2DPPB 4L59A 3CCJQ 1MGQA 3CC2A 3C0CA 2DVEA 4M7AC 3S3NA 1YJNQ 2XDDA 3CC2T 1AWXA 3M59A 2PVOB 2OI3A 1M5Q1 2E5QA 2RHYA 1YN8A 2C0TA 2QK0A 2A3LA 4PJOG 2DILA 1GXIE 3JCMV 1VQNQ 2RJDA 4JZ3A 2XI9A 2NWMA 2JTEA 4J7FA 1GCQA 1I1JA 1AZEA 4KUDK 3EG2A 2DTIA 3VUBA 1TTHB 2LX7A 3SDZA 3OB9A 3TREA 2XHCA 2YUNA 3JB9F 2FZGB 3SD4A 3I55Q 1M2VA 1QCFA 1UFFA 4M7AA 1N9RA 4FSXA 1H8KA 2QI2A 3VS1A 4DOWA 3JCMf 2LQ8A 2BIVA 1TXQA 2V8JA 1WHLA 4LD6A 3UA6A 1W4SA 4DA4A 3MHXA 2K5FA 3CCLA 1K73U 2E6ZA 1QWFA 4C92D 2O9SA 2LQWA 2KDSA 4KT0E 3X20B 1FYNA 3CCLT 1MUZA 4IUUA 2NUZA 5IT9E 3I35A 1BI0A 4J5YA 5L8RE 2EQJA 3VV0A 3UF4A 1AWOA 1NLOC 1Q7YU 3DKMA 4ZNXA 3OSSC 1OZ3A 1WA7A 1K9AA 2BTTA 2OTLQ 2Y4YA 1PD1A 3V8LA 3VS5A 3X24B 1XOVA 2L89A 2JJ9A 1KD1C 2QEXT 1DJ7B 4CC2A 1AVZC 4ME7A 2HBWA 4OGCA 5DY9A 4BI3A 1WI7A 2ENMA 2EQKA 1AOJA 1GFCA 1D3BB 3RMSA 2BZ8A 2VVKA 4E7LA 4DBQA 1Y71A 4JLGA 4XTUA 5GAN7 4HKEA 2CDTA 1W6XA 2A36A 3BDUA 3H0IA 2FL7A 2QQRA 1UGVA 3CXCP 1M90C 2R5MA 1KD1R 3L1AA 4M78F 3GOXA 1I07A 1TU0B 3DB3A 2HQXA 4N0AC 1M3BA 1JBMA 1YITT 2QTXA 2EJ9A 1ABOA 1I5LA 4OP0A 4M75F 1VQMA 1R0BG 4M7AG 3ZEHA 1QQJA 3JCMg 1VQMT 4FU6A 4LDWA 3M57A 5CO7A 1OI1A 3CCJA 2JVVA 1UTIA 1VQ4Q 2QASA 2CH4W 1D0XA 4PJOD 4HT8A 1KC8C 3CCJT 1YJNA 3HRTA 4XU1A 1UHFA 2BZYA 4M78E 1U1TA 1G83A 4M75B 1FWZA 2LC4A 2AHJB 4QT7A 1X69A 3VYHB 4PJJA 1YJWT 1RL2A 4M75E 4F7UF 4A4GA 4N0AA 3QZ9B 5I2SA 1RLPC 1VQNA 4PL6A 5KCHA 3G6EQ 4J9EA 3JCMX 5CKBA 1N6AA 2YUQA 1VQOQ 2DL7A 3QDRB 2PVDB 3D7SB 5GMKm 1VQNT 3OS0A 3QZ5B 2HL3A 1VQ5Q 3JCMP 3QPHA 5LJ3h 5IN1A 4HCCA 3I55A 3THKA 2HZYA 4F7UB 2YDLA 5LL6S 1GL5A 1PKSA 2MI6A 4HT9A 5GMKl 4OB2B 1VQPQ 2R58A 4F7UE 2DXTA 1CSKA 5GAMj 3EHQA 1A0NB 2LZ6B 1HJDA 3LGLA 2ATCB 1ZBXA 3EHRA 5KCOA 4R55A 2DM1A 4FYXB 2RQRA 2MAMA 3HRSA 4HCBA 2LCSA 3QDFA 4Q5WA 3GP8A 4ORZA 4PFOA 4J9FA 2BZXA 1WHMA 1V1CA 1YI2A 2GBQA 2RI5A 1JJ2S 3H0HA 4JRKA 2X9HA 4E7SA 4EMHA 3N5BB 1YI2T 3PT9A 2DBMA 2F69A 1M8MA 3X25B 3JB9H 5M9OA 5LJ5g 2EIFA 3EG0A 4RTWA 1BK2A 1R0CB 1G3WA 3WVEB 5CKEA 4E7JA 1D3BA 1GCPA 4OMLA 1PWTA 4PK4A 3E1SA 4BY6B 2JMAA 2X3WD 4N4IA 1WPYA 1QP3A 3QXEB 4FT2A 4M75C 2VASA 1IGQA 4RTXA 1YIJA 1SHGA 1VQ7Q 2DIQA 2HAXA 4QQDA 1MMAA 4E7HA 2E3IA 2COYA 1ZX6A 5CIUA 1YIJT 1IXDA 4CRIA 5KYNA 4LUEA 3ZFJA 4E6RA 4M7AD 1ZHIA 3R6NA 2SEMA 1VOMA 4HVWA 2VV5A 3OYAA 1NEBA 4DQ2A 5GAN4 2YUPA 2JOYA 2RJEA 4XAXB 2E6NA 2JXBA 2M1HA 1WQWA 3KBGA 2RH2A 3JCMW 2QGFB 2ZZDA 3RR6A 2ZPEB 1K8AU 1WX6A 2EW3A 3VKIA 1VQ4A 2P0QA 1D1CA 1Q82U 3NGPA 2RQWA 2J6FA 1B7TA 4M75A 1PKTA 3OYLA 2EKOA 1NYGA 1VQ4T 3G1JA 2QTVA 4PLLA 4RMOA 4ATOA 2PU9B 1VYUA 3AT1B 1SG5A 4MDWA 3V7CA 4PLIA 1YWOA 3VRZA 6AT1B 3G6EA 3REBB 1WQ7A 2CZ7B 2K3YA 4AFUC 2KE9A 4MDXA 1YP5A 3I56A 1VQOA 1M3AA 3NTHA 4A63B 1D0ZA 3G6ET 1QVPA 1I5OB 1MV3A 3FJPA 5I22A 3I56T 2MIOA 1VQOT 4F7UA 4J9IA 1VA7A 2XMFA 1KQSS 3V8JA 4RTTA 3SHWA 3H9NA 4BY6C 2EBPA 2HCKA 2ROTA 1YHQT 2GFAA 3EGDB 5GAN6 3J81E 3BFMA 5GAMd 1ARKA 2EYZA 3IQLA 4HXJA 2E5KA 2DL4A 4DOVA 5IHIA 1N27A 3OYCA 2LQKA 1NM7A 2QQSA 2RA2A 4OMOA 3U23A 4OMQA 4RCCA 2E4HA 2GFUA 1FMKA 3QIIA 2DX1A 2B86A 1M3CA 2VB6A 1MNDA 4RTVA 3ZBDA 2ABLA 4L5GA 2KT8A 3G71A 5GAOr 5D7UA 4NOYA 1V76A 5GAOm 4EMKB 1Q86R 4M77B 4P5NA 1QVFP 1BKBA 1H3ZA 2HKQB 5GAN3 4C8QF 3G71T 2GF7A 3EGXB 3FEOA 2K2MA 4FSSA 1NPPA 4MZTA 1HK9A 2LJ3A 2VC8A 4JS4A 1EIFA 1EX4A 3MPUB 3RKYA 4Z89A 5GAOl 2O9VA 2OTJQ 2RN8A 4F17A 1PNJA 3M55A 1VQ7A 1PRLC 4A54A 5EC7A 3MCAB 3NTIA 1VQ7T 4NL2A 3CCLQ 3CPFA 2JM8A 4C8QE 2FZKB 2IVWA 2JT4A 3URGA 1H92A 2DXUA 5GAOp 1X2QA 1RAIB 4FYYB 4IIMA 5L23A 3QSUA 2EJGA 5I11A 1PM3A 2FVUA 2QAZA 2DKGA 4ZN3A 2L3RA 1K4US 3BW1A 3ZL7C 4IKFA 2KYBA 2QEXQ 5GANd 3M0SA 2ZPGB 5KYXB 1AZGB 1QVGA 3QBYA 2V8IA 1JU5C 1SSHA 2DLPA 1QKWA 4AFSC 4J83A 3L2VA 3VJPA 1MNEA 5IXFA 1WXBA 5GAMe 2LT4A 1KD1U 1M1GA 2D9TA 1BYMA 2QXFA 3OYYA 1JRIA 1JJ2A 3O5ZA 3OMCA 2QG9B 1K9MC 1ZUKA 1KIKA 1MV0B 2LX9A 1QCOA 4XU3A 4FIBA 1YITQ 4AFQC 2KRNA 3EG3A 4EMKC 4M77C 5A0LA 2DXBA 1M90U 4Z02A 4FW1A 4E7KA 1ZSZB 1VQ6Q 5GAMf 2HD0A 2EQMA 2O2OA 3JCMh 1WHKA 2HQEA 3EGDA 1UEBA 3I5RA 2DERA 1VQKA 5AT1B 1IHVA 1K9MR 2QDYB 2QQ9A 1XNIA 2CP5A 5LJ3j 4E7ZA 1VQKT 5A0GA 4X1VA 3VS4A 4BE2A 2YT6A 1C1AA 2HSPA 2AZSA 3VS0A 1KK7A 2PNIA 4LDYA 2ED0A 1PRMC 3OW2P 1YJWQ 3PTAA 2PUOB 5KE2A 3GF5A 2YLBA 1KC8U 2P84A 3EAEA 5GJWB 1W2BP 4A53A 3M0QA 1AT1B 3FDRA 4EMKA 2DVJA 4M77A 3M0RA 4A4HA 3OYGA 2RK2A 4LDUA 3SEMA 1K0XA 1G3SA 1ZA2B 3EGXA 2DK3A 3OYFA 3LWIA 3V7RA 3RUXA 4WTOB 2LDMA 3JCMc 2EVRA 5DLOA 1IHWA 3V8KA 4M7DF 4DEYA 2FYKA 2DL8A 2KYMA 3E9GA 4ZN1A 4TVRA 4RTYA 5GANe 5GMKh 2OTJA 4OMMA 1TWBA 5FROA 4B9WA 3EG9B 3P8HA 2EYYA 3OY9A 2OTJT 1G3TA 3ER0A 1OV3A 3H41A 2JMCA 3VRYA 2HBPA 3MEUA 2V1QA 4M7DB 2EGEA 4XTWA 3KXTA 3FC3A 3A8GB 4NL3A 1KSWA 1EZZB 1YI2Q 4M7DE 5GANf 1ZSZC 3FJ5A 1WHJA 5LJ5h 1M4ZA 1E7OA 1KQSA 3QKJA 5KYXA 2P0PA 3CPWS 1WJRA 3CQTA 2VYTA 2MWPA 2C0OA 2QEXA 1RACB 2KEAA 3EGUA 1AEYA 4B6MA 3E2UA 4JJDA 2DXCA 1NPRA 2CUDA 3CMAQ 1M1KR 4HCZA 3P8DA 4WCIA 1BU1A 1NZ9A 3OYJA 1RLQC 1N8RC 4OB3B 1NYFA 1IRXA 1YIJQ 1Y96B 2X4JA 3META 4A4KA 4FYWB 5GAN2 3L2ZA 3CBOA 4Z88A 2EAYA 1U1SA 5CVIA 1YITA 2EQUA 4JS5A 3Q1JA 1ZSZA 2L3PA 2JW4A 4LN2A 3A8MB 2DE0X 2D8JA 1RAGB 1JXMA 1VQ6A 1QW1A 5A2QE 5KH6A 1N8RR 1QP2A 1BIAA 4Y28E 3NPFA 2DJQA 1NJIR 1VQ6T 1IO6A 2K7AA 2VUBA 2AIRB 2WSFE 4J9BA 2PVGB 4JPBW 2KR3A 4C5GA 1SPKA 2VGNA 5IHKA 4M78B 2L3QA 4RUGA 4O6JA 4KUIA 3PGGA 1OX9A 1H641 1YJWA 3EH2A 2KXCA 2ZGWA 4M7DC 1TUCA 3HKSA 1IGUA 1FX7A 4CC3A 1SRLA 2ZCFB 4C5HA 1D1AA 3PVLA 2OAUA 2CYZB 2O31A 2L2PA 1OZ2A 4FW2A 1TOVA 1BCMA 1GBRA 3I56Q 2E10A 3GPLA 1OPLA 2DFUA 2F5TX 2YHTA 4J9DA 3RERA 2LMJA 1YHQQ 4GLMA 2XKOC 1SF9A 2E12A 2K5LA 4BD3A 2LJ1A 3EG9A 4C92F 4Y92A 1QVGS 2P4RA 4J7IA 1KJWA 2PQWA 5HK3A 4M7DA 3MEAA 8ATCB 2Y90A 2VKNA 2EKHA 1LCKA 2DIGA 2H8HA 2QQAA 2E64A 5AYFA 2KRSA 1YFNA 1MMDA 3RKWA 3CC4A 2X4WA 3F70A 1VYTA 4PFPA 1RAFB 1WFWA 3G71Q 3SFMA 1GRIA 4FM4B 4C92E 3RDVA 5IAYA 2DEQA 3CC4T 4XTYA 5CCAA 1D0YA 2X4YA 3RESA 2FRYA 4M78C 3CMAA 4M77D 3CD6Q 2GCXA 1K73R 1E6GA 5LJ3e 1X27A 4IUPA 1XTDA 2L0AA 1Y96A 2DRKA 3CMAT 2RF0A 5C6SA 1UECA 2KROA 4AFZC 4J6WA 2RJFA 5ECAA 4BB7A 2AKLA 3OYNA 3QYGB 3PE0A 1Q7YR 3JCMb 3BDLA 3M9QA 1JQQA 2YWWA 3PFSA 2DRMA 4UC4A 2DZ9A 3L2QA 4IURA 3HPWA 3JAME 2FG0A 4KGXB 3OYBA 4PJOF 2RNAA 1KQ1A 3L42A 5FW9A 1S72T 3UT1A 2JN0A 2X4XA 2O4XB 4M78A 1AWWA 3ULRB 1TS9A 2EGCA 5D6XA 2EFIA 1TUDA 3DLMA 3LGFA 1ZQ1A 2W10A 4F14A 4DBHA 3JB9G 1B3QA 1T0HA 3OA6A 3C95A 1PC0A 1P92A 1BI3A 2X51A 2JS2A 3HL8A 3M0PA 3J80E 1BI1A 2QDLA 1FXXA 2FEIA 3OS1A 4F04B 3GIBA 4YTLA 3CCET 4PJOE 1KQ2A 1B34B 3C94A 4KGVB 2J6OA 3NHNA 2HMAA 2E70A 1ZA1B 4OB0B 1G2BA 3CPWA 1G8XA 1WJQA 3A1PA 1K9MU 3LLRA 3EFRA 3H0FA 4N4GA 5CQXA 1Q81C 3MEVA 3P8BB 4AMCA 2M51A 1YHQA 3NFCA 2G3RA 1VQKQ 2L8DA 3X26B 3UPUA 5J26A 2DZCA 2XU8A 4FT4A 1EFNA 1G3YA 2LNHB 1ZSGA 2O88A 5GMKj 1Q86C 2ZPIB 1H3HA 2LQNA 5GJVB 2RPNA 2DEUA 2DBKA 1RAHB 1VIEA 1Q81R 5FLXE 3CXCS 3VS2A 4C92A 3OYMA 5GAOn 3EG1A 4Z8AA 1Z9ZA 4LDVA 1ACMB 1X01A 4BDZA 2XIDA 4GLKA 4OMPA 1BCOA 2DA9A 4E2FB 1PHTA 1JXOA 2EPDA 4ELZC 2F1LA 1JB0E 3CCUT 3QO3A 2DL3A 4M78G 4XU0A 3MP1A 1AD5A 4EPCA 3REAB 1SRMA 3CBPA 5CQYA 2XD0A 3M53A 2A7YA 5LJ5j 1FMWA 1WZOA 4M75G 3CD6A 2QGGA
chains in the Genus database with same CATH topology
1E6HA 5GJWB 3M0QA 1T0JA 2DVJA 1NLPC 3M0RA 3SEMA 1K0XA 2JM9A 2ROLA 2SRCA 1UTIA 2CH4W 1JEGA 4KRTA 1K1ZA 3TSZA 4J9HA 1UHFA 2DL5A 2BZYA 2EVRA 2EYXA 4D8KA 4DEYA 1G83A 1OEBA 1RI9A 4JJBA 2DL8A 2KYMA 1BB9A 4QT7A 1X69A 4RTYA 2GNCA 2KBTA 2F2VA 2K79A 1UE9A 4OMMA 1GBQA 1NEGA 2OAWA 1RLPC 2DYBA 2FO0A 2L3SA 4J9EA 1ZUUA 2EYYA 1QLYA 1OV3A 2YUQA 3H41A 2DL7A 2JMCA 3VRYA 1YNZA 4RTZA 1YWPA 3RNJA 4CC4B 1JO8A 2V1QA 2EGEA 2YUOA 1AWJA 2CT4A 2C0IA 1KSWA 1WIEA 3THKA 1K76A 2CSIA 2YDLA 3FJ5A 5IXBA 1GL5A 1PKSA 2ESWA 2KRMA 5IH2A 2PTKA 1E7OA 2K3BA 1ABQA 1WXUA 2I0NA 4HCKA 1CSKA 3EHQA 1A0NB 2LZ6B 1HJDA 3CQTA 2C0OA 3EHRA 5FWBA 2KEAA 3EGUA 1AEYA 2DM1A 2RQRA 2V1RA 4AG1C 4JJDA 2CUDA 3LH5A 2LCSA 4J9GA 2YSQA 4ORZA 4J9FA 2BZXA 1V1CA 4WCIA 1BU1A 2GBQA 3A98A 1RLQC 2IIMA 3H0HA 1U06A 1OPKA 1NYFA 2DBMA 2KT1A 1M8MA 2AK5A 3EG0A 1B07A 1YCSB 4Z88A 4RTWA 1BK2A 3TSWA 1X6BA 2L3PA 1ZLMA 2JW4A 4LN2A 1UG1A 2A28A 1GCPA 2DE0X 1PWTA 2D8JA 2EGAA 4OMLA 1JXMA 1RUWA 1Y0MA 2JMAA 3M0TA 2LP5A 2A37A 2X3WD 1M30A 1Y57A 4RTXA 3NPFA 1SHGA 1CKBA 2DJQA 1IO6A 2K7AA 2W0ZA 4J9BA 4GBQA 2GTOA 3VS3A 4JPBW 2KR3A 1SPKA 1VYVA 1ZX6A 2LJ0A 5IHKA 4LUEA 3UA7A 4E6RA 2L3QA 4RUGA 3R6NA 2SEMA 5FWCA 1T3SA 2CH4A 4HVWA 4CC7A 2G6FX 2D8HA 1X43A 2J6KA 2KXCA 2D0NA 1NEBA 2KGTA 4IIOA 1TUCA 3I5SA 5HCKA 2YUPA 2VWFA 4CC3A 1SRLA 2JXBA 1WDXA 1X2KA 3PVLA 2F2WA 1W70A 2O31A 2RQUA 1W1FA 2L2PA 4JJCA 2AZVA 1WX6A 2EQIA 2EW3A 4R0KA 1GBRA 4M4ZA 3NGPA 2D1XA 2J6FA 2RQWA 2K6DA 1U3OA 1ZUYA 4D8DA 1OPLA 1PKTA 1NYGA 4J9DA 2GQIA 2LMJA 2KXDA 1SHFA 4GLMA 1GFDA 4EIKA 1TG0A 3RBBB 2LJ1A 3VS6A 2M0YA 2HDAA 1VYUA 1WYXA 4Y92A 1YWOA 3VRZA 2RQVA 2P4RA 3REBB 4LE9A 4AFUC 2KE9A 1KJWA 1YP5A 4ESRA 5IHNA 2VKNA 1M3AA 2FPEA 4A63B 2FRWA 2EKHA 1MV3A 1LCKA 5I22A 2RQTA 3QWXX 2EYWA 2MIOA 2H8HA 1KFZA 4J9IA 1VA7A 3VS7A 2XMFA 2RMOA 2ED1A 1UJYA 2KNBB 4RTTA 3SHWA 2KRSA 1CKAA 2EBPA 2HCKA 2ROTA 2GGRA 1M27C 1VYTA 1QWEA 1WFWA 1ARKA 1K0SA 1GRIA 1T3LA 2CT3A 2EYZA 1I0CA 4HVVA 3IQLA 4HXJA 2E5KA 3M0UA 2DL4A 1BBZA 5IHIA 2J06A 1UUEA 1NM7A 3TVTA 2FRYA 1GCQC 1X6GA 2J7IA 4OMOA 3U23A 4OMQA 4LUDA 2FPFA 2DMOA 1E6GA 3NMZC 1S1NA 1X27A 1FMKA 2L0AA 2DRKA 2DX1A 2DF6A 2B86A 2RF0A 2AKKA 1M3CA 1UECA 2KROA 4RTVA 4AFZC 2ABLA 2KT8A 5ECAA 2AKLA 2MOXA 3C0CA 2JS0A 2MCNA 1ZBJA 3PE0A 1JQQA 1AWXA 2K2MA 4FSSA 2DRMA 2OI3A 1SEMA 2CUBA 2LJ3A 3JV3A 1YN8A 2C0TA 2FG0A 4Z89A 2O9VA 2DILA 2RNAA 2OJ2A 2RN8A 4F17A 1PNJA 1UHCA 4JZ3A 5FW9A 2NWMA 2JTEA 1PRLC 1GCQA 1I1JA 4F16A 1AWWA 1UDLA 1AZEA 3ULRB 5EC7A 3EG2A 2EGCA 1TUDA 4K11A 2W10A 2LX7A 2FPDA 4F14A 2JM8A 2CREA 1B3QA 2YUNA 2JT4A 1T0HA 1Z9QA 1H92A 2F2XA 1X2QA 1NG2A 1QCFA 1UFFA 2GTJA 2JS2A 2DNUA 3M0PA 4IIMA 5L23A 5I11A 2X3XD 1WXTA 1H8KA 1WLPB 3VS1A 2QDLA 2FEIA 3QWYA 1K4US 3ZL7C 2KYBA 3KFVA 2J6OA 3UA6A 3NHNA 3M0SA 2PZ1A 1G2BA 1AZGB 1QWFA 1JU5C 1SSHA 2O9SA 2LQWA 2DLPA 1QKWA 4AFSC 4OMNA 4JZ4A 1FYNA 3H0FA 1MUZA 2NUZA 3I35A 4DEXA 5IXFA 1J3TA 1WXBA 2M51A 4AG2C 2A08A 1UJ0A 3UF4A 2CSQA 1AWOA 1NLOC 4ZNXA 3O5ZA 1WA7A 4LNPA 1ZUKA 1KIKA 1K9AA 1MV0B 2BTTA 3GBQA 4RTUA 3VS5A 1EFNA 1XOVA 3PVQA 2LNHB 4AFQC 2J05A 1ZSGA 2O88A 3I9QA 1H3HA 4CC2A 2KRNA 1AVZC 2ECZA 2LQNA 1OOTA 2RPNA 3EG3A 5GJVB 2DBKA 2HBWA 4HVUA 1HSQA 3UATA 1WI7A 1N5ZA 3VS2A 2ENMA 1AOJA 3EG1A 1GFCA 2O2OA 1QKXA 4J9CA 2BZ8A 1Z9ZA 2VVKA 4Z8AA 2CDTA 3I5RA 1W6XA 2A36A 4OMPA 3H0IA 2DA9A 1PHTA 1UGVA 1JXOA 2EPDA 2HEQA 2DL3A 4X1VA 1U5SA 3VS4A 1HD3A 1I07A 2YT6A 2HSPA 1AD5A 3REAB 1SRMA 1M3BA 2AZSA 3VS0A 2PNIA 2ED0A 1PRMC 1ABOA 2K9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6H A;  5GJW B;  3M0Q A;  1T0J A;  2DVJ A;  1NLP C;  3M0R A;  3SEM A;  1K0X A;  2JM9 A;  2ROL A;  2SRC A;  1UTI A;  2CH4 W;  1JEG A;  4KRT A;  1K1Z A;  3TSZ A;  4J9H A;  1UHF A;  2DL5 A;  2BZY A;  2EVR A;  2EYX A;  4D8K A;  4DEY A;  1G83 A;  1OEB A;  1RI9 A;  4JJB A;  2DL8 A;  2KYM A;  1BB9 A;  4QT7 A;  1X69 A;  4RTY A;  2GNC A;  2KBT A;  2F2V A;  2K79 A;  1UE9 A;  4OMM A;  1GBQ A;  1NEG A;  2OAW A;  1RLP C;  2DYB A;  2FO0 A;  2L3S A;  4J9E A;  1ZUU A;  2EYY A;  1QLY A;  1OV3 A;  2YUQ A;  3H41 A;  2DL7 A;  2JMC A;  3VRY A;  1YNZ A;  4RTZ A;  1YWP A;  3RNJ A;  4CC4 B;  1JO8 A;  2V1Q A;  2EGE A;  2YUO A;  1AWJ A;  2CT4 A;  2C0I A;  1KSW A;  1WIE A;  3THK A;  1K76 A;  2CSI A;  2YDL A;  3FJ5 A;  5IXB A;  1GL5 A;  1PKS A;  2ESW A;  2KRM A;  5IH2 A;  2PTK A;  1E7O A;  2K3B A;  1ABQ A;  1WXU A;  2I0N A;  4HCK A;  1CSK A;  3EHQ A;  1A0N B;  2LZ6 B;  1HJD A;  3CQT A;  2C0O A;  3EHR A;  5FWB A;  2KEA A;  3EGU A;  1AEY A;  2DM1 A;  2RQR A;  2V1R A;  4AG1 C;  4JJD A;  2CUD A;  3LH5 A;  2LCS A;  4J9G A;  2YSQ A;  4ORZ A;  4J9F A;  2BZX A;  1V1C A;  4WCI A;  1BU1 A;  2GBQ A;  3A98 A;  1RLQ C;  2IIM A;  3H0H A;  1U06 A;  1OPK A;  1NYF A;  2DBM A;  2KT1 A;  1M8M A;  2AK5 A;  3EG0 A;  1B07 A;  1YCS B;  4Z88 A;  4RTW A;  1BK2 A;  3TSW A;  1X6B A;  2L3P A;  1ZLM A;  2JW4 A;  4LN2 A;  1UG1 A;  2A28 A;  1GCP A;  2DE0 X;  1PWT A;  2D8J A;  2EGA A;  4OML A;  1JXM A;  1RUW A;  1Y0M A;  2JMA A;  3M0T A;  2LP5 A;  2A37 A;  2X3W D;  1M30 A;  1Y57 A;  4RTX A;  3NPF A;  1SHG A;  1CKB A;  2DJQ A;  1IO6 A;  2K7A A;  2W0Z A;  4J9B A;  4GBQ A;  2GTO A;  3VS3 A;  4JPB W;  2KR3 A;  1SPK A;  1VYV A;  1ZX6 A;  2LJ0 A;  5IHK A;  4LUE A;  3UA7 A;  4E6R A;  2L3Q A;  4RUG A;  3R6N A;  2SEM A;  5FWC A;  1T3S A;  2CH4 A;  4HVW A;  4CC7 A;  2G6F X;  2D8H A;  1X43 A;  2J6K A;  2KXC A;  2D0N A;  1NEB A;  2KGT A;  4IIO A;  1TUC A;  3I5S A;  5HCK A;  2YUP A;  2VWF A;  4CC3 A;  1SRL A;  2JXB A;  1WDX A;  1X2K A;  3PVL A;  2F2W A;  1W70 A;  2O31 A;  2RQU A;  1W1F A;  2L2P A;  4JJC A;  2AZV A;  1WX6 A;  2EQI A;  2EW3 A;  4R0K A;  1GBR A;  4M4Z A;  3NGP A;  2D1X A;  2J6F A;  2RQW A;  2K6D A;  1U3O A;  1ZUY A;  4D8D A;  1OPL A;  1PKT A;  1NYG A;  4J9D A;  2GQI A;  2LMJ A;  2KXD A;  1SHF A;  4GLM A;  1GFD A;  4EIK A;  1TG0 A;  3RBB B;  2LJ1 A;  3VS6 A;  2M0Y A;  2HDA A;  1VYU A;  1WYX A;  4Y92 A;  1YWO A;  3VRZ A;  2RQV A;  2P4R A;  3REB B;  4LE9 A;  4AFU C;  2KE9 A;  1KJW A;  1YP5 A;  4ESR A;  5IHN A;  2VKN A;  1M3A A;  2FPE A;  4A63 B;  2FRW A;  2EKH A;  1MV3 A;  1LCK A;  5I22 A;  2RQT A;  3QWX X;  2EYW A;  2MIO A;  2H8H A;  1KFZ A;  4J9I A;  1VA7 A;  3VS7 A;  2XMF A;  2RMO A;  2ED1 A;  1UJY A;  2KNB B;  4RTT A;  3SHW A;  2KRS A;  1CKA A;  2EBP A;  2HCK A;  2ROT A;  2GGR A;  1M27 C;  1VYT A;  1QWE A;  1WFW A;  1ARK A;  1K0S A;  1GRI A;  1T3L A;  2CT3 A;  2EYZ A;  1I0C A;  4HVV A;  3IQL A;  4HXJ A;  2E5K A;  3M0U A;  2DL4 A;  1BBZ A;  5IHI A;  2J06 A;  1UUE A;  1NM7 A;  3TVT A;  2FRY A;  1GCQ C;  1X6G A;  2J7I A;  4OMO A;  3U23 A;  4OMQ A;  4LUD A;  2FPF A;  2DMO A;  1E6G A;  3NMZ C;  1S1N A;  1X27 A;  1FMK A;  2L0A A;  2DRK A;  2DX1 A;  2DF6 A;  2B86 A;  2RF0 A;  2AKK A;  1M3C A;  1UEC A;  2KRO A;  4RTV A;  4AFZ C;  2ABL A;  2KT8 A;  5ECA A;  2AKL A;  2MOX A;  3C0C A;  2JS0 A;  2MCN A;  1ZBJ A;  3PE0 A;  1JQQ A;  1AWX A;  2K2M A;  4FSS A;  2DRM A;  2OI3 A;  1SEM A;  2CUB A;  2LJ3 A;  3JV3 A;  1YN8 A;  2C0T A;  2FG0 A;  4Z89 A;  2O9V A;  2DIL A;  2RNA A;  2OJ2 A;  2RN8 A;  4F17 A;  1PNJ A;  1UHC A;  4JZ3 A;  5FW9 A;  2NWM A;  2JTE A;  1PRL C;  1GCQ A;  1I1J A;  4F16 A;  1AWW A;  1UDL A;  1AZE A;  3ULR B;  5EC7 A;  3EG2 A;  2EGC A;  1TUD A;  4K11 A;  2W10 A;  2LX7 A;  2FPD A;  4F14 A;  2JM8 A;  2CRE A;  1B3Q A;  2YUN A;  2JT4 A;  1T0H A;  1Z9Q A;  1H92 A;  2F2X A;  1X2Q A;  1NG2 A;  1QCF A;  1UFF A;  2GTJ A;  2JS2 A;  2DNU A;  3M0P A;  4IIM A;  5L23 A;  5I11 A;  2X3X D;  1WXT A;  1H8K A;  1WLP B;  3VS1 A;  2QDL A;  2FEI A;  3QWY A;  1K4U S;  3ZL7 C;  2KYB A;  3KFV A;  2J6O A;  3UA6 A;  3NHN A;  3M0S A;  2PZ1 A;  1G2B A;  1AZG B;  1QWF A;  1JU5 C;  1SSH A;  2O9S A;  2LQW A;  2DLP A;  1QKW A;  4AFS C;  4OMN A;  4JZ4 A;  1FYN A;  3H0F A;  1MUZ A;  2NUZ A;  3I35 A;  4DEX A;  5IXF A;  1J3T A;  1WXB A;  2M51 A;  4AG2 C;  2A08 A;  1UJ0 A;  3UF4 A;  2CSQ A;  1AWO A;  1NLO C;  4ZNX A;  3O5Z A;  1WA7 A;  4LNP A;  1ZUK A;  1KIK A;  1K9A A;  1MV0 B;  2BTT A;  3GBQ A;  4RTU A;  3VS5 A;  1EFN A;  1XOV A;  3PVQ A;  2LNH B;  4AFQ C;  2J05 A;  1ZSG A;  2O88 A;  3I9Q A;  1H3H A;  4CC2 A;  2KRN A;  1AVZ C;  2ECZ A;  2LQN A;  1OOT A;  2RPN A;  3EG3 A;  5GJV B;  2DBK A;  2HBW A;  4HVU A;  1HSQ A;  3UAT A;  1WI7 A;  1N5Z A;  3VS2 A;  2ENM A;  1AOJ A;  3EG1 A;  1GFC A;  2O2O A;  1QKX A;  4J9C A;  2BZ8 A;  1Z9Z A;  2VVK A;  4Z8A A;  2CDT A;  3I5R A;  1W6X A;  2A36 A;  4OMP A;  3H0I A;  2DA9 A;  1PHT A;  1UGV A;  1JXO A;  2EPD A;  2HEQ A;  2DL3 A;  4X1V A;  1U5S A;  3VS4 A;  1HD3 A;  1I07 A;  2YT6 A;  2HSP A;  1AD5 A;  3REA B;  1SRM A;  1M3B A;  2AZS A;  3VS0 A;  2PNI A;  2ED0 A;  1PRM C;  1ABO A;  2K9G A; 
#chains in the Genus database with same CATH topology
 4M7A F;  3CD6 T;  4XU2 A;  1T0J A;  1NLP C;  4NS5 A;  2JM9 A;  3DLL A;  3GLX A;  2D6F A;  1OYX A;  2NUP B;  4C8Q B;  2BE7 D;  4BDY A;  3CCQ Q;  1JEG A;  4QVC A;  2M02 A;  2WAC A;  2EYQ A;  1K1Z A;  3TSZ A;  3R6O A;  4E47 A;  5KYU B;  1PSE A;  4D8K A;  4A4F A;  1OEB A;  2JTF A;  2R57 A;  3PIO A;  4C5E A;  4F7U G;  2GQV A;  2GNC A;  5GMK i;  2F2V A;  2Y4X A;  2K79 A;  3A5Z B;  1LVK A;  1UE9 A;  1PG5 B;  2O4X A;  3OSV A;  3JB9 D;  2XG8 D;  1GBQ A;  1NEG A;  2OAW A;  4OVA A;  1IB8 A;  4M7A E;  1ZUU A;  2DTO A;  4RG8 A;  3WXM B;  1QLY A;  1YJ9 Q;  2CP2 A;  4AT1 B;  3JCM d;  4KBM B;  4CC4 B;  1TSF A;  3MKD A;  1F1B B;  1I4K 1;  3M56 A;  3OYD A;  1AWJ A;  2CT4 A;  2C0I A;  3CC7 T;  4MML A;  1WIE A;  1VQL T;  4FYV B;  2CSI A;  1LOJ A;  1B34 A;  1XJW B;  2PTK A;  2RI3 A;  2K3B A;  1WXU A;  4HCK A;  2I0N A;  1X75 C;  2RJC A;  2DJZ A;  3MP8 A;  3QJY A;  1U8R A;  2MWO A;  1R8O B;  4AG1 C;  3LH5 A;  3L2R A;  2YSQ A;  3HP9 A;  1K8A R;  3LWH A;  2BKD N;  2FB7 A;  1Q82 R;  1VIF A;  2H3J A;  1U06 A;  1OPK A;  2DTH A;  4BI4 A;  1D09 B;  2M16 A;  2CKK A;  2IG0 A;  4C0Z A;  2KT1 A;  3S3O A;  2AK5 A;  5KE3 A;  5CR2 A;  2CGH A;  3JB9 J;  1B07 A;  1I8F A;  1YCS B;  1JJ2 P;  4X34 A;  1KHC A;  4OB1 B;  3TSW A;  4ZGD B;  4RKU E;  3VYG A;  3VUZ A;  3TU4 K;  1ZLM A;  3OYH A;  5GAN h;  2XIC A;  2EGA A;  4C8Q C;  1Y0M A;  3FIF A;  4LDX A;  1C0M A;  3M0T A;  2LP5 A;  4M78 D;  4O5V A;  4J6Y A;  1D1B A;  2RB6 A;  1M30 A;  3M4G A;  1Y57 A;  2QQB A;  2W0Z A;  1RAB B;  2CZ6 B;  4GBQ A;  2GTO A;  4M75 D;  3VS3 A;  3S6W A;  1VYV A;  2KVQ G;  3GNF B;  4QQ6 A;  3JCM Q;  4LD9 K;  2KY9 A;  3UA7 A;  3QG1 A;  5HK0 A;  4FL6 A;  1T3S A;  2CH4 A;  2DAQ A;  2X35 A;  5LJ5 d;  3S3M A;  4X9D A;  4CC7 A;  3SWN B;  2KGT A;  4IIO A;  5HCK A;  2VWF A;  1VUB A;  4BAC A;  1M8V A;  1X2K A;  1LJO A;  3JCM e;  2F2W A;  1W1F A;  2NUP A;  4JLI A;  1BIB A;  4KH1 B;  4C8Q A;  4JJC A;  1C6V X;  2AZV A;  2XK0 A;  4M4Z A;  2D1X A;  5KYU A;  3CCR Q;  2AT1 B;  2K6D A;  5GAN 5;  2L5Q A;  3CCQ A;  2MPX C;  4J8O A;  2QA4 Q;  4DBF A;  4C0D B;  3A8L B;  2GQI A;  2HL5 C;  5KYY B;  1OU8 A;  1YBY A;  5GAM g;  3CCQ T;  1SHF A;  1IZ6 A;  2NUT B;  1M1K C;  3KUF A;  4EIK A;  2RHU A;  2DO3 A;  1TG0 A;  1R77 A;  2RK1 A;  1V29 B;  2DET A;  2M0Y A;  2HDA A;  5KYW B;  4OMF B;  3OS2 A;  3CC4 Q;  1WYX A;  2RQV A;  3G4S A;  5C0M A;  1YJ9 A;  1YCY A;  4ESR A;  2FZC B;  5IHN A;  1QCN A;  3G4S T;  1SKU B;  3ME9 A;  3E9F A;  2COZ A;  1LPL A;  2RQT A;  3QWX X;  1YJ9 T;  4C5I A;  5A0D A;  1UB4 A;  1KFZ A;  3VS7 A;  3L2W A;  4IUV A;  2H3E B;  2RMO A;  3LH0 A;  4PNO A;  4XTV A;  5CK9 A;  1CKA A;  4XTX A;  3CXC A;  5GMK e;  2GGR A;  2E41 A;  3C12 A;  1QWE A;  1MHN A;  2CP3 A;  1K0S A;  1OU9 A;  2DD5 A;  3LYI A;  3QJ6 A;  4M77 G;  1I0C A;  1NJI C;  1KQS P;  1M1F A;  3M0U A;  2CZ1 B;  1TH7 A;  2KMT A;  2O01 E;  2J06 A;  4ZTF A;  1UUE A;  3TVT A;  1X6G A;  3H8Z A;  2LCC A;  4LUD A;  3VU3 C;  2YXY A;  3NMZ C;  1S1N A;  4JDS A;  1RI0 A;  1QVF S;  1S72 Q;  2LTO A;  4D6W A;  3BE3 A;  3SWN C;  2AKK A;  1VQ9 Q;  1OX8 A;  4PJL A;  4XQ3 A;  1WJS A;  4BE0 A;  5LJ5 e;  2MOX A;  4C8Q G;  2JS0 A;  2MCN A;  5LJ3 d;  3CCS Q;  1ZBJ A;  3CCV Q;  1SEM A;  2CUB A;  3OYI A;  4BI8 B;  2ZPH B;  3JV3 A;  1BI2 A;  3HTR A;  1UGR B;  3M58 A;  5CKF A;  5GAN g;  3QHS A;  3CCE Q;  4C0D C;  2V8K A;  2OJ2 A;  4EDU A;  1M90 R;  3C4S A;  4KH0 B;  4CI0 C;  1UHC A;  2P4T A;  4PKC C;  5LJ5 f;  5FU6 B;  4F16 A;  7AT1 B;  1UDL A;  2EWN A;  2K5I A;  4GY5 A;  4XTZ A;  4KGZ B;  2F5K A;  5DM7 R;  4K11 A;  1KHI A;  2FPD A;  2ZPF B;  3CCM Q;  3SWN A;  2CRE A;  3RIR A;  2LVM A;  4FCY A;  2RI2 A;  1Z9Q A;  1YJN T;  2BE9 B;  5EG2 A;  2F2X A;  1NG2 A;  2GTJ A;  2DNU A;  4X9C A;  3G7Z A;  4J6X A;  2X3X D;  1WXT A;  1WLP B;  5FRN A;  2QYZ A;  2EJF A;  3QWY A;  1Q81 U;  4Y91 A;  5I21 A;  3KFV A;  1KC8 R;  2PZ1 A;  2YRC A;  2BUD A;  3CCR A;  4VUB A;  2CZ0 B;  2MK5 A;  2C06 A;  3PMI A;  5KYY A;  4OMN A;  4JZ4 A;  4OF1 A;  3E19 A;  2NUT A;  1UGQ B;  2QA4 A;  4DEX A;  2K57 A;  1J3T A;  3CCR T;  3CBM A;  4R56 A;  3FRN A;  1VQ8 Q;  4AG2 C;  1Q86 U;  2A08 A;  1UJ0 A;  5KYW A;  2CP0 A;  2QA4 T;  3I55 T;  2CSQ A;  1KG1 A;  1K73 C;  3CCU Q;  4C92 B;  4LNP A;  3GBQ A;  2OX7 A;  4RTU A;  3CME Q;  3PVQ A;  2J05 A;  4QQG A;  3PIP A;  1M9S A;  3I9Q A;  3L2U A;  2ECZ A;  1OOT A;  4A4E A;  3MP6 A;  1HYO A;  4HVU A;  1HSQ A;  3NTK A;  3UAT A;  2KI7 A;  1Q7Y C;  8AT1 B;  3TCJ A;  2I2L A;  1N5Z A;  1QKX A;  4J9C A;  2RHI A;  1RAD B;  2P0K A;  5J39 A;  2WSC E;  2KQW A;  3PNW C;  2OTL A;  2WSE E;  3OW2 S;  2JNG A;  4ELY C;  2HEQ A;  1U5S A;  1HD3 A;  2OTL T;  2MYS A;  5FU6 C;  1Q95 G;  1W2B S;  1WGS A;  3HFN A;  4V2S A;  2K2V A;  4C8Q D;  1M2O A;  5LJ3 f;  3HSB A;  2K9G A;  1E6H A;  1S72 A;  3ASK A;  1Y7X A;  2D0Q B;  2NYS A;  1VQ9 A;  5FRM A;  2LT1 A;  2ROL A;  2SRC A;  1O9S A;  4ZGJ B;  3AHU A;  1VQ9 T;  3TEE A;  3CCS A;  3CCV A;  2XDB A;  4KRT A;  3CC7 Q;  2COW A;  4J9H A;  4M7D G;  2DL5 A;  2EYX A;  1VQL Q;  3HRU A;  4L6V 5;  3CCS T;  1RI9 A;  4JJB A;  3CCV T;  1BB9 A;  2HNI A;  3V7S A;  3OBW A;  3EFO B;  2Z0W A;  2KBT A;  3CCE A;  4PJO B;  1QMC A;  1O75 A;  2RHX A;  5FU7 B;  2DYB A;  2FO0 A;  2L3S A;  5GAN j;  1PSF A;  1NBE B;  1AHJ B;  4C92 C;  1YNZ A;  4RTZ A;  1YWP A;  4JRP A;  2DD4 A;  1PD0 A;  2RD1 A;  1MMN A;  3RNJ A;  2YRD A;  1JO8 A;  1RAA B;  4QVZ A;  4JJN K;  3CCM A;  2YUO A;  2KK4 A;  4RG2 A;  3QYH B;  5HY6 A;  1TUG B;  3CEY A;  1K76 A;  3OBY A;  3CCM T;  3J7A F;  2HSE B;  2YRV A;  3OQ5 A;  4HA8 A;  4ZGE B;  5IXB A;  2ESW A;  3LW5 E;  2KRM A;  3M4Y A;  5IH2 A;  4C0F A;  3O8V A;  3UDC A;  1SSF A;  1ABQ A;  4QVD A;  2RO0 A;  5GAO q;  2HQH A;  5D6W A;  5J3B A;  4XK8 E;  4QW2 A;  4IUQ A;  5FWB A;  2PUK B;  2V1R A;  2DYI A;  4PJN A;  2B8A A;  1VQ5 A;  4J9G A;  4B9X A;  3CPW P;  4EMG A;  2ZAE A;  2VGM A;  5LJ3 g;  1IRE B;  3OYE A;  2HKN A;  3H6Z A;  3A98 A;  1VQ5 T;  2IIM A;  1VQ8 A;  2RM4 A;  4BE1 A;  2RHZ A;  2A0F B;  5GAN 8;  3FB9 A;  4KUL A;  4JRQ A;  3CCU A;  2LRQ A;  1VQP A;  3CC2 Q;  1QVF A;  3A8H B;  1VQ8 T;  1NE8 A;  4M77 F;  1OUL A;  2NLU A;  2VXF A;  3X28 B;  3CME A;  2MF2 A;  2XDP A;  1VQP T;  3SB2 A;  2CP6 A;  1X6B A;  3QUI A;  4PFZ A;  3WVD B;  1UG1 A;  3CME T;  2A28 A;  4OGE A;  3LX7 A;  1RUW A;  1PCX A;  1N9S A;  4PJM A;  3T9N A;  3MEW A;  2A37 A;  2CS7 A;  4N4H A;  5D6Y A;  1CKB A;  5DLQ E;  1OQK A;  2K4Y A;  2M0O A;  4E7I A;  3PMT A;  4PJO C;  2LJ0 A;  2E65 A;  5FU7 C;  4M77 E;  2CP7 A;  3INZ A;  5FWC A;  3MJX A;  5GAM h;  2FHD A;  2G6F X;  2D8H A;  1X43 A;  3M54 A;  4WF2 A;  1WHH A;  2J6K A;  2D0N A;  2KSS A;  3I5S A;  3JRZ A;  1G5V A;  1WDX A;  1M2V B;  5HKC A;  5CAI A;  3BY7 A;  4M7A B;  2VXE A;  4M7D D;  1W70 A;  2RQU A;  3A8O B;  3RMQ A;  3OS5 A;  5CKD A;  1M1K U;  2EQI A;  3G4S Q;  4R0K A;  1FMV A;  1X6O A;  3JSC A;  3M5A A;  1U3O A;  1ZUY A;  4D8D A;  4MZM A;  3EH1 A;  3CC7 A;  1UGS B;  4MZP A;  2ZPB B;  1VQL A;  3EFO A;  1I81 A;  2KXD A;  4PJO A;  1GFD A;  2M9U A;  1K8A C;  3RKX A;  3RBB B;  4JRI A;  3TQ7 P;  2JUF A;  4C92 G;  1LNX A;  3VS6 A;  1Q82 C;  3GNG A;  9ATC B;  3MO8 A;  2JTM A;  2E1H A;  4DBR A;  2JZ2 A;  1HXD A;  3UWN A;  3JCM J;  4LE9 A;  4MMK A;  1MMG A;  1WNL A;  3HHT B;  1N8R U;  2FPE A;  2FRW A;  4II1 A;  3EFS A;  2IPO B;  2EYW A;  1QVG P;  1NJI U;  3OYK A;  2ED1 A;  1UJY A;  2KNB B;  2E3H A;  4LXC A;  4ANJ A;  1M27 C;  1RAE B;  2CT3 A;  1T3L A;  4BUG A;  4ZTJ A;  1UGP B;  4HVV A;  5I2M A;  2R5A A;  5CKH A;  3FLG A;  3OW2 A;  1BBZ A;  1XQH A;  2V26 A;  2YLC A;  1Y07 A;  1GCQ C;  4IUT A;  2J7I A;  2K3X A;  1WHG A;  4QKU A;  2LNV A;  2MMP A;  1VQM Q;  2FPF A;  3JB9 I;  1W2B A;  2DMO A;  3HFO A;  2KAF A;  4RCB A;  3DB4 A;  3OMG A;  4C0G A;  2DF6 A;  2LCL A;  4JUV A;  2DPP B;  4L59 A;  3CCJ Q;  1MGQ A;  3CC2 A;  3C0C A;  2DVE A;  4M7A C;  3S3N A;  1YJN Q;  2XDD A;  3CC2 T;  1AWX A;  3M59 A;  2PVO B;  2OI3 A;  1M5Q 1;  2E5Q A;  2RHY A;  1YN8 A;  2C0T A;  2QK0 A;  2A3L A;  4PJO G;  2DIL A;  1GXI E;  3JCM V;  1VQN Q;  2RJD A;  4JZ3 A;  2XI9 A;  2NWM A;  2JTE A;  4J7F A;  1GCQ A;  1I1J A;  1AZE A;  4KUD K;  3EG2 A;  2DTI A;  3VUB A;  1TTH B;  2LX7 A;  3SDZ A;  3OB9 A;  3TRE A;  2XHC A;  2YUN A;  3JB9 F;  2FZG B;  3SD4 A;  3I55 Q;  1M2V A;  1QCF A;  1UFF A;  4M7A A;  1N9R A;  4FSX A;  1H8K A;  2QI2 A;  3VS1 A;  4DOW A;  3JCM f;  2LQ8 A;  2BIV A;  1TXQ A;  2V8J A;  1WHL A;  4LD6 A;  3UA6 A;  1W4S A;  4DA4 A;  3MHX A;  2K5F A;  3CCL A;  1K73 U;  2E6Z A;  1QWF A;  4C92 D;  2O9S A;  2LQW A;  2KDS A;  4KT0 E;  3X20 B;  1FYN A;  3CCL T;  1MUZ A;  4IUU A;  2NUZ A;  5IT9 E;  3I35 A;  1BI0 A;  4J5Y A;  5L8R E;  2EQJ A;  3VV0 A;  3UF4 A;  1AWO A;  1NLO C;  1Q7Y U;  3DKM A;  4ZNX A;  3OSS C;  1OZ3 A;  1WA7 A;  1K9A A;  2BTT A;  2OTL Q;  2Y4Y A;  1PD1 A;  3V8L A;  3VS5 A;  3X24 B;  1XOV A;  2L89 A;  2JJ9 A;  1KD1 C;  2QEX T;  1DJ7 B;  4CC2 A;  1AVZ C;  4ME7 A;  2HBW A;  4OGC A;  5DY9 A;  4BI3 A;  1WI7 A;  2ENM A;  2EQK A;  1AOJ A;  1GFC A;  1D3B B;  3RMS A;  2BZ8 A;  2VVK A;  4E7L A;  4DBQ A;  1Y71 A;  4JLG A;  4XTU A;  5GAN 7;  4HKE A;  2CDT A;  1W6X A;  2A36 A;  3BDU A;  3H0I A;  2FL7 A;  2QQR A;  1UGV A;  3CXC P;  1M90 C;  2R5M A;  1KD1 R;  3L1A A;  4M78 F;  3GOX A;  1I07 A;  1TU0 B;  3DB3 A;  2HQX A;  4N0A C;  1M3B A;  1JBM A;  1YIT T;  2QTX A;  2EJ9 A;  1ABO A;  1I5L A;  4OP0 A;  4M75 F;  1VQM A;  1R0B G;  4M7A G;  3ZEH A;  1QQJ A;  3JCM g;  1VQM T;  4FU6 A;  4LDW A;  3M57 A;  5CO7 A;  1OI1 A;  3CCJ A;  2JVV A;  1UTI A;  1VQ4 Q;  2QAS A;  2CH4 W;  1D0X A;  4PJO D;  4HT8 A;  1KC8 C;  3CCJ T;  1YJN A;  3HRT A;  4XU1 A;  1UHF A;  2BZY A;  4M78 E;  1U1T A;  1G83 A;  4M75 B;  1FWZ A;  2LC4 A;  2AHJ B;  4QT7 A;  1X69 A;  3VYH B;  4PJJ A;  1YJW T;  1RL2 A;  4M75 E;  4F7U F;  4A4G A;  4N0A A;  3QZ9 B;  5I2S A;  1RLP C;  1VQN A;  4PL6 A;  5KCH A;  3G6E Q;  4J9E A;  3JCM X;  5CKB A;  1N6A A;  2YUQ A;  1VQO Q;  2DL7 A;  3QDR B;  2PVD B;  3D7S B;  5GMK m;  1VQN T;  3OS0 A;  3QZ5 B;  2HL3 A;  1VQ5 Q;  3JCM P;  3QPH A;  5LJ3 h;  5IN1 A;  4HCC A;  3I55 A;  3THK A;  2HZY A;  4F7U B;  2YDL A;  5LL6 S;  1GL5 A;  1PKS A;  2MI6 A;  4HT9 A;  5GMK l;  4OB2 B;  1VQP Q;  2R58 A;  4F7U E;  2DXT A;  1CSK A;  5GAM j;  3EHQ A;  1A0N B;  2LZ6 B;  1HJD A;  3LGL A;  2ATC B;  1ZBX A;  3EHR A;  5KCO A;  4R55 A;  2DM1 A;  4FYX B;  2RQR A;  2MAM A;  3HRS A;  4HCB A;  2LCS A;  3QDF A;  4Q5W A;  3GP8 A;  4ORZ A;  4PFO A;  4J9F A;  2BZX A;  1WHM A;  1V1C A;  1YI2 A;  2GBQ A;  2RI5 A;  1JJ2 S;  3H0H A;  4JRK A;  2X9H A;  4E7S A;  4EMH A;  3N5B B;  1YI2 T;  3PT9 A;  2DBM A;  2F69 A;  1M8M A;  3X25 B;  3JB9 H;  5M9O A;  5LJ5 g;  2EIF A;  3EG0 A;  4RTW A;  1BK2 A;  1R0C B;  1G3W A;  3WVE B;  5CKE A;  4E7J A;  1D3B A;  1GCP A;  4OML A;  1PWT A;  4PK4 A;  3E1S A;  4BY6 B;  2JMA A;  2X3W D;  4N4I A;  1WPY A;  1QP3 A;  3QXE B;  4FT2 A;  4M75 C;  2VAS A;  1IGQ A;  4RTX A;  1YIJ A;  1SHG A;  1VQ7 Q;  2DIQ A;  2HAX A;  4QQD A;  1MMA A;  4E7H A;  2E3I A;  2COY A;  1ZX6 A;  5CIU A;  1YIJ T;  1IXD A;  4CRI A;  5KYN A;  4LUE A;  3ZFJ A;  4E6R A;  4M7A D;  1ZHI A;  3R6N A;  2SEM A;  1VOM A;  4HVW A;  2VV5 A;  3OYA A;  1NEB A;  4DQ2 A;  5GAN 4;  2YUP A;  2JOY A;  2RJE A;  4XAX B;  2E6N A;  2JXB A;  2M1H A;  1WQW A;  3KBG A;  2RH2 A;  3JCM W;  2QGF B;  2ZZD A;  3RR6 A;  2ZPE B;  1K8A U;  1WX6 A;  2EW3 A;  3VKI A;  1VQ4 A;  2P0Q A;  1D1C A;  1Q82 U;  3NGP A;  2RQW A;  2J6F A;  1B7T A;  4M75 A;  1PKT A;  3OYL A;  2EKO A;  1NYG A;  1VQ4 T;  3G1J A;  2QTV A;  4PLL A;  4RMO A;  4ATO A;  2PU9 B;  1VYU A;  3AT1 B;  1SG5 A;  4MDW A;  3V7C A;  4PLI A;  1YWO A;  3VRZ A;  6AT1 B;  3G6E A;  3REB B;  1WQ7 A;  2CZ7 B;  2K3Y A;  4AFU C;  2KE9 A;  4MDX A;  1YP5 A;  3I56 A;  1VQO A;  1M3A A;  3NTH A;  4A63 B;  1D0Z A;  3G6E T;  1QVP A;  1I5O B;  1MV3 A;  3FJP A;  5I22 A;  3I56 T;  2MIO A;  1VQO T;  4F7U A;  4J9I A;  1VA7 A;  2XMF A;  1KQS S;  3V8J A;  4RTT A;  3SHW A;  3H9N A;  4BY6 C;  2EBP A;  2HCK A;  2ROT A;  1YHQ T;  2GFA A;  3EGD B;  5GAN 6;  3J81 E;  3BFM A;  5GAM d;  1ARK A;  2EYZ A;  3IQL A;  4HXJ A;  2E5K A;  2DL4 A;  4DOV A;  5IHI A;  1N27 A;  3OYC A;  2LQK A;  1NM7 A;  2QQS A;  2RA2 A;  4OMO A;  3U23 A;  4OMQ A;  4RCC A;  2E4H A;  2GFU A;  1FMK A;  3QII A;  2DX1 A;  2B86 A;  1M3C A;  2VB6 A;  1MND A;  4RTV A;  3ZBD A;  2ABL A;  4L5G A;  2KT8 A;  3G71 A;  5GAO r;  5D7U A;  4NOY A;  1V76 A;  5GAO m;  4EMK B;  1Q86 R;  4M77 B;  4P5N A;  1QVF P;  1BKB A;  1H3Z A;  2HKQ B;  5GAN 3;  4C8Q F;  3G71 T;  2GF7 A;  3EGX B;  3FEO A;  2K2M A;  4FSS A;  1NPP A;  4MZT A;  1HK9 A;  2LJ3 A;  2VC8 A;  4JS4 A;  1EIF A;  1EX4 A;  3MPU B;  3RKY A;  4Z89 A;  5GAO l;  2O9V A;  2OTJ Q;  2RN8 A;  4F17 A;  1PNJ A;  3M55 A;  1VQ7 A;  1PRL C;  4A54 A;  5EC7 A;  3MCA B;  3NTI A;  1VQ7 T;  4NL2 A;  3CCL Q;  3CPF A;  2JM8 A;  4C8Q E;  2FZK B;  2IVW A;  2JT4 A;  3URG A;  1H92 A;  2DXU A;  5GAO p;  1X2Q A;  1RAI B;  4FYY B;  4IIM A;  5L23 A;  3QSU A;  2EJG A;  5I11 A;  1PM3 A;  2FVU A;  2QAZ A;  2DKG A;  4ZN3 A;  2L3R A;  1K4U S;  3BW1 A;  3ZL7 C;  4IKF A;  2KYB A;  2QEX Q;  5GAN d;  3M0S A;  2ZPG B;  5KYX B;  1AZG B;  1QVG A;  3QBY A;  2V8I A;  1JU5 C;  1SSH A;  2DLP A;  1QKW A;  4AFS C;  4J83 A;  3L2V A;  3VJP A;  1MNE A;  5IXF A;  1WXB A;  5GAM e;  2LT4 A;  1KD1 U;  1M1G A;  2D9T A;  1BYM A;  2QXF A;  3OYY A;  1JRI A;  1JJ2 A;  3O5Z A;  3OMC A;  2QG9 B;  1K9M C;  1ZUK A;  1KIK A;  1MV0 B;  2LX9 A;  1QCO A;  4XU3 A;  4FIB A;  1YIT Q;  4AFQ C;  2KRN A;  3EG3 A;  4EMK C;  4M77 C;  5A0L A;  2DXB A;  1M90 U;  4Z02 A;  4FW1 A;  4E7K A;  1ZSZ B;  1VQ6 Q;  5GAM f;  2HD0 A;  2EQM A;  2O2O A;  3JCM h;  1WHK A;  2HQE A;  3EGD A;  1UEB A;  3I5R A;  2DER A;  1VQK A;  5AT1 B;  1IHV A;  1K9M R;  2QDY B;  2QQ9 A;  1XNI A;  2CP5 A;  5LJ3 j;  4E7Z A;  1VQK T;  5A0G A;  4X1V A;  3VS4 A;  4BE2 A;  2YT6 A;  1C1A A;  2HSP A;  2AZS A;  3VS0 A;  1KK7 A;  2PNI A;  4LDY A;  2ED0 A;  1PRM C;  3OW2 P;  1YJW Q;  3PTA A;  2PUO B;  5KE2 A;  3GF5 A;  2YLB A;  1KC8 U;  2P84 A;  3EAE A;  5GJW B;  1W2B P;  4A53 A;  3M0Q A;  1AT1 B;  3FDR A;  4EMK A;  2DVJ A;  4M77 A;  3M0R A;  4A4H A;  3OYG A;  2RK2 A;  4LDU A;  3SEM A;  1K0X A;  1G3S A;  1ZA2 B;  3EGX A;  2DK3 A;  3OYF A;  3LWI A;  3V7R A;  3RUX A;  4WTO B;  2LDM A;  3JCM c;  2EVR A;  5DLO A;  1IHW A;  3V8K A;  4M7D F;  4DEY A;  2FYK A;  2DL8 A;  2KYM A;  3E9G A;  4ZN1 A;  4TVR A;  4RTY A;  5GAN e;  5GMK h;  2OTJ A;  4OMM A;  1TWB A;  5FRO A;  4B9W A;  3EG9 B;  3P8H A;  2EYY A;  3OY9 A;  2OTJ T;  1G3T A;  3ER0 A;  1OV3 A;  3H41 A;  2JMC A;  3VRY A;  2HBP A;  3MEU A;  2V1Q A;  4M7D B;  2EGE A;  4XTW A;  3KXT A;  3FC3 A;  3A8G B;  4NL3 A;  1KSW A;  1EZZ B;  1YI2 Q;  4M7D E;  5GAN f;  1ZSZ C;  3FJ5 A;  1WHJ A;  5LJ5 h;  1M4Z A;  1E7O A;  1KQS A;  3QKJ A;  5KYX A;  2P0P A;  3CPW S;  1WJR A;  3CQT A;  2VYT A;  2MWP A;  2C0O A;  2QEX A;  1RAC B;  2KEA A;  3EGU A;  1AEY A;  4B6M A;  3E2U A;  4JJD A;  2DXC A;  1NPR A;  2CUD A;  3CMA Q;  1M1K R;  4HCZ A;  3P8D A;  4WCI A;  1BU1 A;  1NZ9 A;  3OYJ A;  1RLQ C;  1N8R C;  4OB3 B;  1NYF A;  1IRX A;  1YIJ Q;  1Y96 B;  2X4J A;  3MET A;  4A4K A;  4FYW B;  5GAN 2;  3L2Z A;  3CBO A;  4Z88 A;  2EAY A;  1U1S A;  5CVI A;  1YIT A;  2EQU A;  4JS5 A;  3Q1J A;  1ZSZ A;  2L3P A;  2JW4 A;  4LN2 A;  3A8M B;  2DE0 X;  2D8J A;  1RAG B;  1JXM A;  1VQ6 A;  1QW1 A;  5A2Q E;  5KH6 A;  1N8R R;  1QP2 A;  1BIA A;  4Y28 E;  3NPF A;  2DJQ A;  1NJI R;  1VQ6 T;  1IO6 A;  2K7A A;  2VUB A;  2AIR B;  2WSF E;  4J9B A;  2PVG B;  4JPB W;  2KR3 A;  4C5G A;  1SPK A;  2VGN A;  5IHK A;  4M78 B;  2L3Q A;  4RUG A;  4O6J A;  4KUI A;  3PGG A;  1OX9 A;  1H64 1;  1YJW A;  3EH2 A;  2KXC A;  2ZGW A;  4M7D C;  1TUC A;  3HKS A;  1IGU A;  1FX7 A;  4CC3 A;  1SRL A;  2ZCF B;  4C5H A;  1D1A A;  3PVL A;  2OAU A;  2CYZ B;  2O31 A;  2L2P A;  1OZ2 A;  4FW2 A;  1TOV A;  1BCM A;  1GBR A;  3I56 Q;  2E10 A;  3GPL A;  1OPL A;  2DFU A;  2F5T X;  2YHT A;  4J9D A;  3RER A;  2LMJ A;  1YHQ Q;  4GLM A;  2XKO C;  1SF9 A;  2E12 A;  2K5L A;  4BD3 A;  2LJ1 A;  3EG9 A;  4C92 F;  4Y92 A;  1QVG S;  2P4R A;  4J7I A;  1KJW A;  2PQW A;  5HK3 A;  4M7D A;  3MEA A;  8ATC B;  2Y90 A;  2VKN A;  2EKH A;  1LCK A;  2DIG A;  2H8H A;  2QQA A;  2E64 A;  5AYF A;  2KRS A;  1YFN A;  1MMD A;  3RKW A;  3CC4 A;  2X4W A;  3F70 A;  1VYT A;  4PFP A;  1RAF B;  1WFW A;  3G71 Q;  3SFM A;  1GRI A;  4FM4 B;  4C92 E;  3RDV A;  5IAY A;  2DEQ A;  3CC4 T;  4XTY A;  5CCA A;  1D0Y A;  2X4Y A;  3RES A;  2FRY A;  4M78 C;  3CMA A;  4M77 D;  3CD6 Q;  2GCX A;  1K73 R;  1E6G A;  5LJ3 e;  1X27 A;  4IUP A;  1XTD A;  2L0A A;  1Y96 A;  2DRK A;  3CMA T;  2RF0 A;  5C6S A;  1UEC A;  2KRO A;  4AFZ C;  4J6W A;  2RJF A;  5ECA A;  4BB7 A;  2AKL A;  3OYN A;  3QYG B;  3PE0 A;  1Q7Y R;  3JCM b;  3BDL A;  3M9Q A;  1JQQ A;  2YWW A;  3PFS A;  2DRM A;  4UC4 A;  2DZ9 A;  3L2Q A;  4IUR A;  3HPW A;  3JAM E;  2FG0 A;  4KGX B;  3OYB A;  4PJO F;  2RNA A;  1KQ1 A;  3L42 A;  5FW9 A;  1S72 T;  3UT1 A;  2JN0 A;  2X4X A;  2O4X B;  4M78 A;  1AWW A;  3ULR B;  1TS9 A;  2EGC A;  5D6X A;  2EFI A;  1TUD A;  3DLM A;  3LGF A;  1ZQ1 A;  2W10 A;  4F14 A;  4DBH A;  3JB9 G;  1B3Q A;  1T0H A;  3OA6 A;  3C95 A;  1PC0 A;  1P92 A;  1BI3 A;  2X51 A;  2JS2 A;  3HL8 A;  3M0P A;  3J80 E;  1BI1 A;  2QDL A;  1FXX A;  2FEI A;  3OS1 A;  4F04 B;  3GIB A;  4YTL A;  3CCE T;  4PJO E;  1KQ2 A;  1B34 B;  3C94 A;  4KGV B;  2J6O A;  3NHN A;  2HMA A;  2E70 A;  1ZA1 B;  4OB0 B;  1G2B A;  3CPW A;  1G8X A;  1WJQ A;  3A1P A;  1K9M U;  3LLR A;  3EFR A;  3H0F A;  4N4G A;  5CQX A;  1Q81 C;  3MEV A;  3P8B B;  4AMC A;  2M51 A;  1YHQ A;  3NFC A;  2G3R A;  1VQK Q;  2L8D A;  3X26 B;  3UPU A;  5J26 A;  2DZC A;  2XU8 A;  4FT4 A;  1EFN A;  1G3Y A;  2LNH B;  1ZSG A;  2O88 A;  5GMK j;  1Q86 C;  2ZPI B;  1H3H A;  2LQN A;  5GJV B;  2RPN A;  2DEU A;  2DBK A;  1RAH B;  1VIE A;  1Q81 R;  5FLX E;  3CXC S;  3VS2 A;  4C92 A;  3OYM A;  5GAO n;  3EG1 A;  4Z8A A;  1Z9Z A;  4LDV A;  1ACM B;  1X01 A;  4BDZ A;  2XID A;  4GLK A;  4OMP A;  1BCO A;  2DA9 A;  4E2F B;  1PHT A;  1JXO A;  2EPD A;  4ELZ C;  2F1L A;  1JB0 E;  3CCU T;  3QO3 A;  2DL3 A;  4M78 G;  4XU0 A;  3MP1 A;  1AD5 A;  4EPC A;  3REA B;  1SRM A;  3CBP A;  5CQY A;  2XD0 A;  3M53 A;  2A7Y A;  5LJ5 j;  1FMW A;  1WZO A;  4M75 G;  3CD6 A;  2QGG A; 
#chains in the Genus database with same CATH homology
 1E6H A;  5GJW B;  3M0Q A;  1T0J A;  2DVJ A;  1NLP C;  3M0R A;  3SEM A;  1K0X A;  2JM9 A;  2ROL A;  2SRC A;  1UTI A;  2CH4 W;  1JEG A;  4KRT A;  1K1Z A;  3TSZ A;  4J9H A;  1UHF A;  2DL5 A;  2BZY A;  2EVR A;  2EYX A;  4D8K A;  4DEY A;  1G83 A;  1OEB A;  1RI9 A;  4JJB A;  2DL8 A;  2KYM A;  1BB9 A;  4QT7 A;  1X69 A;  4RTY A;  2GNC A;  2KBT A;  2F2V A;  2K79 A;  1UE9 A;  4OMM A;  1GBQ A;  1NEG A;  2OAW A;  1RLP C;  2DYB A;  2FO0 A;  2L3S A;  4J9E A;  1ZUU A;  2EYY A;  1QLY A;  1OV3 A;  2YUQ A;  3H41 A;  2DL7 A;  2JMC A;  3VRY A;  1YNZ A;  4RTZ A;  1YWP A;  3RNJ A;  4CC4 B;  1JO8 A;  2V1Q A;  2EGE A;  2YUO A;  1AWJ A;  2CT4 A;  2C0I A;  1KSW A;  1WIE A;  3THK A;  1K76 A;  2CSI A;  2YDL A;  3FJ5 A;  5IXB A;  1GL5 A;  1PKS A;  2ESW A;  2KRM A;  5IH2 A;  2PTK A;  1E7O A;  2K3B A;  1ABQ A;  1WXU A;  2I0N A;  4HCK A;  1CSK A;  3EHQ A;  1A0N B;  2LZ6 B;  1HJD A;  3CQT A;  2C0O A;  3EHR A;  5FWB A;  2KEA A;  3EGU A;  1AEY A;  2DM1 A;  2RQR A;  2V1R A;  4AG1 C;  4JJD A;  2CUD A;  3LH5 A;  2LCS A;  4J9G A;  2YSQ A;  4ORZ A;  4J9F A;  2BZX A;  1V1C A;  4WCI A;  1BU1 A;  2GBQ A;  3A98 A;  1RLQ C;  2IIM A;  3H0H A;  1U06 A;  1OPK A;  1NYF A;  2DBM A;  2KT1 A;  1M8M A;  2AK5 A;  3EG0 A;  1B07 A;  1YCS B;  4Z88 A;  4RTW A;  1BK2 A;  3TSW A;  1X6B A;  2L3P A;  1ZLM A;  2JW4 A;  4LN2 A;  1UG1 A;  2A28 A;  1GCP A;  2DE0 X;  1PWT A;  2D8J A;  2EGA A;  4OML A;  1JXM A;  1RUW A;  1Y0M A;  2JMA A;  3M0T A;  2LP5 A;  2A37 A;  2X3W D;  1M30 A;  1Y57 A;  4RTX A;  3NPF A;  1SHG A;  1CKB A;  2DJQ A;  1IO6 A;  2K7A A;  2W0Z A;  4J9B A;  4GBQ A;  2GTO A;  3VS3 A;  4JPB W;  2KR3 A;  1SPK A;  1VYV A;  1ZX6 A;  2LJ0 A;  5IHK A;  4LUE A;  3UA7 A;  4E6R A;  2L3Q A;  4RUG A;  3R6N A;  2SEM A;  5FWC A;  1T3S A;  2CH4 A;  4HVW A;  4CC7 A;  2G6F X;  2D8H A;  1X43 A;  2J6K A;  2KXC A;  2D0N A;  1NEB A;  2KGT A;  4IIO A;  1TUC A;  3I5S A;  5HCK A;  2YUP A;  2VWF A;  4CC3 A;  1SRL A;  2JXB A;  1WDX A;  1X2K A;  3PVL A;  2F2W A;  1W70 A;  2O31 A;  2RQU A;  1W1F A;  2L2P A;  4JJC A;  2AZV A;  1WX6 A;  2EQI A;  2EW3 A;  4R0K A;  1GBR A;  4M4Z A;  3NGP A;  2D1X A;  2J6F A;  2RQW A;  2K6D A;  1U3O A;  1ZUY A;  4D8D A;  1OPL A;  1PKT A;  1NYG A;  4J9D A;  2GQI A;  2LMJ A;  2KXD A;  1SHF A;  4GLM A;  1GFD A;  4EIK A;  1TG0 A;  3RBB B;  2LJ1 A;  3VS6 A;  2M0Y A;  2HDA A;  1VYU A;  1WYX A;  4Y92 A;  1YWO A;  3VRZ A;  2RQV A;  2P4R A;  3REB B;  4LE9 A;  4AFU C;  2KE9 A;  1KJW A;  1YP5 A;  4ESR A;  5IHN A;  2VKN A;  1M3A A;  2FPE A;  4A63 B;  2FRW A;  2EKH A;  1MV3 A;  1LCK A;  5I22 A;  2RQT A;  3QWX X;  2EYW A;  2MIO A;  2H8H A;  1KFZ A;  4J9I A;  1VA7 A;  3VS7 A;  2XMF A;  2RMO A;  2ED1 A;  1UJY A;  2KNB B;  4RTT A;  3SHW A;  2KRS A;  1CKA A;  2EBP A;  2HCK A;  2ROT A;  2GGR A;  1M27 C;  1VYT A;  1QWE A;  1WFW A;  1ARK A;  1K0S A;  1GRI A;  1T3L A;  2CT3 A;  2EYZ A;  1I0C A;  4HVV A;  3IQL A;  4HXJ A;  2E5K A;  3M0U A;  2DL4 A;  1BBZ A;  5IHI A;  2J06 A;  1UUE A;  1NM7 A;  3TVT A;  2FRY A;  1GCQ C;  1X6G A;  2J7I A;  4OMO A;  3U23 A;  4OMQ A;  4LUD A;  2FPF A;  2DMO A;  1E6G A;  3NMZ C;  1S1N A;  1X27 A;  1FMK A;  2L0A A;  2DRK A;  2DX1 A;  2DF6 A;  2B86 A;  2RF0 A;  2AKK A;  1M3C A;  1UEC A;  2KRO A;  4RTV A;  4AFZ C;  2ABL A;  2KT8 A;  5ECA A;  2AKL A;  2MOX A;  3C0C A;  2JS0 A;  2MCN A;  1ZBJ A;  3PE0 A;  1JQQ A;  1AWX A;  2K2M A;  4FSS A;  2DRM A;  2OI3 A;  1SEM A;  2CUB A;  2LJ3 A;  3JV3 A;  1YN8 A;  2C0T A;  2FG0 A;  4Z89 A;  2O9V A;  2DIL A;  2RNA A;  2OJ2 A;  2RN8 A;  4F17 A;  1PNJ A;  1UHC A;  4JZ3 A;  5FW9 A;  2NWM A;  2JTE A;  1PRL C;  1GCQ A;  1I1J A;  4F16 A;  1AWW A;  1UDL A;  1AZE A;  3ULR B;  5EC7 A;  3EG2 A;  2EGC A;  1TUD A;  4K11 A;  2W10 A;  2LX7 A;  2FPD A;  4F14 A;  2JM8 A;  2CRE A;  1B3Q A;  2YUN A;  2JT4 A;  1T0H A;  1Z9Q A;  1H92 A;  2F2X A;  1X2Q A;  1NG2 A;  1QCF A;  1UFF A;  2GTJ A;  2JS2 A;  2DNU A;  3M0P A;  4IIM A;  5L23 A;  5I11 A;  2X3X D;  1WXT A;  1H8K A;  1WLP B;  3VS1 A;  2QDL A;  2FEI A;  3QWY A;  1K4U S;  3ZL7 C;  2KYB A;  3KFV A;  2J6O A;  3UA6 A;  3NHN A;  3M0S A;  2PZ1 A;  1G2B A;  1AZG B;  1QWF A;  1JU5 C;  1SSH A;  2O9S A;  2LQW A;  2DLP A;  1QKW A;  4AFS C;  4OMN A;  4JZ4 A;  1FYN A;  3H0F A;  1MUZ A;  2NUZ A;  3I35 A;  4DEX A;  5IXF A;  1J3T A;  1WXB A;  2M51 A;  4AG2 C;  2A08 A;  1UJ0 A;  3UF4 A;  2CSQ A;  1AWO A;  1NLO C;  4ZNX A;  3O5Z A;  1WA7 A;  4LNP A;  1ZUK A;  1KIK A;  1K9A A;  1MV0 B;  2BTT A;  3GBQ A;  4RTU A;  3VS5 A;  1EFN A;  1XOV A;  3PVQ A;  2LNH B;  4AFQ C;  2J05 A;  1ZSG A;  2O88 A;  3I9Q A;  1H3H A;  4CC2 A;  2KRN A;  1AVZ C;  2ECZ A;  2LQN A;  1OOT A;  2RPN A;  3EG3 A;  5GJV B;  2DBK A;  2HBW A;  4HVU A;  1HSQ A;  3UAT A;  1WI7 A;  1N5Z A;  3VS2 A;  2ENM A;  1AOJ A;  3EG1 A;  1GFC A;  2O2O A;  1QKX A;  4J9C A;  2BZ8 A;  1Z9Z A;  2VVK A;  4Z8A A;  2CDT A;  3I5R A;  1W6X A;  2A36 A;  4OMP A;  3H0I A;  2DA9 A;  1PHT A;  1UGV A;  1JXO A;  2EPD A;  2HEQ A;  2DL3 A;  4X1V A;  1U5S A;  3VS4 A;  1HD3 A;  1I07 A;  2YT6 A;  2HSP A;  1AD5 A;  3REA B;  1SRM A;  1M3B A;  2AZS A;  3VS0 A;  2PNI A;  2ED0 A;  1PRM C;  1ABO A;  2K9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...