1PHTA

Phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain, residues 1-85
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
AEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT
publication title Crystal structure of P13K SH3 domain at 20 angstroms resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1995-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1phtA00
1W6XA 2KYMA 2YT6A 4IIMA 3M0SA 5FW9A 1Y57A 1H3HA 3EG0A 1WYXA 3EHQA 4HXJA 1WLPB 1UHCA 3UA6A 1JU5C 3NMZC 1M30A 4JZ3A 2GBQA 2CREA 3H0HA 3EHRA 4HVWA 2K2MA 1JO8A 1AOJA 2FPDA 2RF0A 2C0IA 3H0FA 1KIKA 2EYXA 1UECA 2J7IA 1WDXA 2D8JA 3VS3A 3VS7A 1RLPC 3M0QA 2KE9A 1NG2A 2NWMA 1UJ0A 5GJVB 4RUGA 4DEYA 2LJ3A 2HBWA 2ESWA 3O5ZA 3ULRB 2F2XA 1UE9A 3M0RA 4LN2A 2DL3A 2AZSA 1GCQC 2NUZA 2YUPA 5I22A 4OMPA 2FRWA 4J9DA 1QKXA 4RTZA 2SRCA 2KXCA 2KRMA 1X69A 1T0HA 4X1VA 3PVLA 2GTOA 3TVTA 5FWBA 4OMOA 3PE0A 1GFCA 3UF4A 1WXTA 2EKHA 4JJBA 1K1ZA 4RTVA 1XOVA 3TSZA 1K9AA 2V1RA 2LCSA 1ZUYA 2QDLA 4RTYA 2FPFA 2RMOA 1BB9A 5IHNA 2GQIA 4J9IA 2F2WA 1E7OA 2J05A 1WXUA 4J9BA 2DF6A 2HSPA 5ECAA 2RPNA 3CQTA 4EIKA 2ABLA 4GBQA 4ZNXA 2RQVA 2DBMA 3SEMA 2MIOA 4J9GA 1H92A 1QWFA 2LP5A 4AG1C 1QLYA 2K7AA 1QCFA 2P4RA 3EGUA 1HJDA 2E5KA 1YNZA 2GGRA 3M0PA 2C0OA 3I9QA 1AWOA 2L3PA 1SEMA 3I5RA 1YP5A 2CUBA 4CC4B 4LNPA 2FEIA 1SSHA 1GRIA 1GCPA 2K9GA 3TSWA 3M0TA 2DYBA 4RTUA 3VRZA 2YUQA 1WA7A 2KBTA 4FSSA 3NPFA 1HD3A 1KFZA 4F14A 2G6FX 2RQRA 1V1CA 1H8KA 2MCNA 4CC3A 1ZX6A 1UGVA 1K0XA 1BK2A 1X43A 2YDLA 2J6KA 1GBRA 2DVJA 1QKWA 2ROTA 2DL8A 2H8HA 2X3XD 1ABQA 1UDLA 1CSKA 2O88A 1OV3A 2DM1A 3REAB 1VYTA 1W70A 2X3WD 4AFZC 1WFWA 4Z89A 2DNUA 3PVQA 1WXBA 1CKBA 2KNBB 1OEBA 1WIEA 2PNIA 2EVRA 2CH4W 1UTIA 3NGPA 4J9EA 1GCQA 1JQQA 1E6HA 4AFQC 1UG1A 2CSQA 1NM7A 2EYWA 2AK5A 2FG0A 4ORZA 2J6FA 2KRSA 1AZEA 1HSQA 2EGAA 4CC7A 2HCKA 2DJQA 3EG3A 1AWXA 1M27C 3JV3A 3C0CA 5EC7A 1JEGA 4J9CA 1OPKA 2LJ0A 3GBQA 1JXMA 2PTKA 1VYVA 2JM9A 2OI3A 2DRMA 2DL4A 1M3CA 2K6DA 2EYZA 4Z8AA 2O2OA 1AWJA 1SHFA 1T3LA 5I11A 1X2QA 2V1QA 1I07A 1T0JA 2JMCA 3H41A 1NEBA 3VS0A 2JT4A 2LNHB 4AFSC 1N5ZA 3RBBB 5IXBA 1PHTA 2CSIA 2LJ1A 1ZSGA 1SRLA 3U23A 2I0NA 2SEMA 3R6NA 4DEXA 2LQWA 2PZ1A 1FMKA 1WI7A 1X6GA 1A0NB 3M0UA 1T3SA 4J9FA 3I5SA 1I0CA 2ECZA 3VS1A 1ZUUA 1PRLC 1G2BA 2L0AA 3LH5A 1IO6A 2DILA 1RUWA 2CH4A 2VKNA 1I1JA 3THKA 1M3BA 2LX7A 1AWWA 2ENMA 3H0IA 2DBKA 2ED1A 4JZ4A 1PNJA 1K76A 2KROA 1TUDA 1B07A 1MUZA 3UA7A 1PWTA 2LMJA 5FWCA 5IHKA 2KRNA 3RNJA 1U3OA 2IIMA 2A37A 2KYBA 2KT8A 1Y0MA 2B86A 5IXFA 4E6RA 4Y92A 2M0YA 3EG2A 4JPBW 3ZL7C 1SHGA 1UHFA 2L3QA 1BU1A 1ARKA 4HVUA 4OMQA 5GJWB 4JJCA 1UFFA 1K4US 4F17A 1TUCA 1VA7A 1WX6A 2CT3A 1K0SA 1NLPC 1PKSA 1ZLMA 2EW3A 2C0TA 2DRKA 2LQNA 2AKKA 2DX1A 1SPKA 1KSWA 1J3TA 1MV3A 2OJ2A 2HEQA 1GFDA 3VS6A 2YUNA 1EFNA 2BZYA 2A28A 4GLMA 2A08A 2ED0A 4D8KA 4D8DA 5IHIA 4LUDA 2CT4A 1X6BA 2EGEA 1OOTA 2JXBA 1U5SA 1YWOA 3QWXX 1X2KA 2D1XA 4ESRA 1GBQA 4OMNA 1OPLA 1NEGA 2A36A 2JS2A 4J9HA 4OMMA 3VS4A 4HCKA 1PKTA 2O9SA 1ZBJA 4A63B 1NLOC 2EQIA 3EG1A 2D8HA 2KGTA 4KRTA 2RQWA 1Z9QA 1ABOA 1BBZA 2ROLA 3I35A 2KEAA 2DL5A 2W10A 4JJDA 1JXOA 1AZGB 4CC2A 2DA9A 2FRYA 2D0NA 2JS0A 3VS2A 3SHWA 1W1FA 5IH2A 1AD5A 4LUEA 2DL7A 1G83A 2BZ8A 2K3BA 1PRMC 1X27A 2BZXA 2KT1A 1NYFA 1MV0B 2RQUA 2W0ZA 3KFVA 4QT7A 4AG2C 4HVVA 2VVKA 2CUDA 3A98A 2BTTA 1VYUA 1U06A 2EBPA 2XMFA 2O9VA 2EGCA 2CDTA 2KR3A 2YUOA 2OAWA 4RTTA 4Z88A 2YSQA 3QWYA 4AFUC 1AVZC 1UJYA 2JM8A 3REBB 1M8MA 4RTWA 1M3AA 5L23A 1S1NA 2DE0X 2FO0A 2JMAA 2J06A 1AEYA 1SRMA 2JW4A 3FJ5A 2GTJA 1ZUKA 2RN8A 1TG0A 1YCSB 2JTEA 1GL5A 5HCKA 1QWEA 2L3SA 1LCKA 1E6GA 4K11A 4LE9A 3VS5A 3UATA 4F16A 2DLPA 1KJWA 3IQLA 2O31A 1RI9A 2DMOA 3NHNA 3VRYA 1CKAA 2RQTA 1YWPA 2HDAA 2L2PA 4IIOA 2AKLA 1FYNA 2LZ6B 4M4ZA 2EYYA 2F2VA 4OMLA 2FPEA 2VWFA 4WCIA 1UUEA 2J6OA 1RLQC 1Z9ZA 2MOXA 1YN8A 2AZVA 4RTXA 1B3QA 2GNCA 2K79A 2M51A 4R0KA 1NYGA 2RNAA 2KXDA 2EPDA
chains in the Genus database with same CATH superfamily
2FHDA 4IIMA 3MHXA 2EJ9A 2LVMA 2KAFA 4TVRA 5FW9A 2X4WA 3P8HA 1Y57A 2HMAA 2JJ9A 3UWNA 5IAYA 1RACB 1WLPB 2GQVA 4BE1A 1X01A 2QA4T 4XU3A 3UA6A 1IRXA 1M30A 2GBQA 1BCMA 2ATCB 1D0ZA 2B8AA 3EHRA 5GANj 4JRPA 2PVGB 1KIKA 2EYXA 3RKWA 1UECA 2J7IA 1WDXA 3OS1A 1RLPC 2ZGWA 2XU8A 2KE9A 4ZN1A 4C8QE 3I56Q 4DEYA 2HBWA 4HT8A 2ESWA 1IHVA 4A4FA 2DVEA 2COZA 3M0RA 4ZGJB 2DL3A 3M53A 3QDRB 4FYWB 4QVDA 5I22A 4F7UA 4J9DA 2YRVA 2SRCA 1BI1A 1TU0B 4J6WA 5CQYA 5LL6S 4E2FB 1T0HA 5GAMj 3PVLA 1OX8A 4EPCA 4A4KA 4M75E 4Y28E 1OX9A 2DXCA 2EKHA 4C92E 2VYTA 2EAYA 4RTVA 4JLGA 1U1SA 4A54A 1XOVA 3I55Q 1NPRA 2YRDA 2QDLA 5A0GA 2RMOA 4FT2A 5J26A 3BFMA 2F2WA 1NE8A 4J9BA 2ABLA 3GNGA 1AT1B 4UC4A 4ZNXA 2DBMA 4ANJA 3QIIA 2ZPIB 1M90U 4PJJA 1YNZA 4O5VA 3M0PA 2HQHA 1BCOA 3MEUA 1X75C 2L3PA 1SEMA 1LJOA 3CCJQ 1Q95G 1GRIA 4C8QF 2DYBA 4PL6A 2RI3A 3L2QA 2RA2A 5LJ5j 2KBTA 2P0KA 2QQSA 1JB0E 4CC3A 2L8DA 2JVVA 2VB6A 3JB9F 2YDLA 1SSFA 3QG1A 3LGLA 3QYHB 5GMKh 2VASA 1VQ7Q 2DVJA 3QZ5B 1YI2T 2R5AA 2DL8A 2QQ9A 2H8HA 4XAXB 4KUDK 1S72A 2BIVA 2X3WD 3DB3A 4Z89A 1YJ9A 4M75F 2KNBB 1RL2A 1NBEB 2EVRA 1S72Q 5CKHA 4C92F 4B9XA 1GCQA 1WGSA 1YJ9Q 3RUXA 3S3MA 3BDLA 1Q7YU 3EG9A 2HCKA 2IPOB 1N6AA 1KQ2A 2PVOB 4BI8B 3D7SB 3JV3A 3C0CA 3OYJA 5EC7A 2DO3A 3G7ZA 4J9CA 1VQ9A 2LJ0A 4DQ2A 1M2OA 2DRMA 2DL4A 3UT1A 1AWJA 1TS9A 2CP6A 3CD6T 1X2QA 2V1QA 5GAN3 2RK2A 2XHCA 5GAN6 3EGDA 4JS4A 1VQMT 5I21A 2CP2A 2JT4A 5KCHA 3G4ST 3MEAA 1WJSA 2DPPB 3O8VA 1SRLA 4OF1A 3U23A 4M7DB 3LGFA 4X9CA 1D3BB 2CP5A 3HPWA 1MMNA 5DY9A 3M4YA 4J9FA 3MEVA 2BE7D 4N4IA 4M78D 2L0AA 2DILA 2VKNA 1I1JA 3MP1A 2E64A 1WPYA 1KQ1A 2ENMA 2ED1A 4JZ4A 4M78C 1K76A 1B07A 3OSVA 5AT1B 1WQWA 3QSUA 3CPFA 2IIMA 4OB0B 5J39A 1B7TA 1D09B 2B86A 3VUZA 5GMKe 2JZ2A 4E6RA 1ZBXA 2QGFB 5HK0A 3EFRA 3RDVA 3OYNA 4OMQA 4XTVA 5GJWB 2IG0A 4JJCA 1K4US 4J83A 3GNFB 1PG5B 2DETA 2DXUA 4KT0E 4C5GA 1KC8R 3EFOA 2CT3A 1SG5A 1PKSA 1VOMA 4D6WA 3HSBA 1WQ7A 5CQXA 3OYKA 3M55A 2H3JA 5GMKl 2PU9B 2DX1A 4B6MA 2YLBA 1JJ2S 1G3SA 1XJWB 2OJ2A 3X24B 1GFDA 4FW2A 3VS6A 2YUNA 2FYKA 2QGGA 4FT4A 3OW2P 2K2VA 3HP9A 1VQNA 1KC8C 1X6BA 2EGEA 3JB9H 1FMVA 3VS4A 2A36A 1Q82R 4E7IA 1O9SA 2BUDA 1ZBJA 2MF2A 2D8HA 1I5OB 3CCMA 2MAMA 2RJDA 1QVPA 1BBZA 2ROLA 4C0GA 5GAN7 3NFCA 2QTXA 4JJDA 2E6ZA 1VQ5A 2HNIA 2QK0A 5LJ3d 3URGA 3LW5E 1Q82C 3VS2A 5IH2A 4LUEA 1VQ5Q 1VQ4A 1G83A 1K8AU 1X27A 2BE9B 5C6SA 4GLKA 3MJXA 4JRIA 1UEBA 3KFVA 4QT7A 1NJIR 4HVVA 2I2LA 1VQ4Q 3H8ZA 2BTTA 3QO3A 4R55A 3FLGA 1VQOA 4M77B 4V2SA 2FZGB 3PFSA 2KR3A 3OW2A 5LJ3f 2YUOA 4DBHA 4M78E 3S3NA 1AVZC 4N4GA 4C8QG 1KHCA 1D1CA 1UJYA 4J6YA 1VQOQ 1M3AA 2RB6A 4EMHA 4BDYA 2DE0X 1NJIC 4E7HA 2JW4A 4BY6B 3FJ5A 3QBYA 3HHTB 2PUKB 2NYSA 3JB9G 4JJNK 3M59A 2ZPBB 3NTHA 1QWEA 2LNVA 3ZFJA 4PJOA 1LCKA 4MZTA 5DLQE 1WJQA 1YHQQ 5GANd 2DLPA 3CMAT 4FL6A 3IQLA 5KH6A 2X35A 2O31A 1CKAA 5DM7R 4IIOA 4M75G 4M4ZA 2EYYA 3L42A 1YBYA 4CRIA 4C92G 2EIFA 4OMLA 2FPEA 1Y96A 4WCIA 3L2UA 1B34A 1ZHIA 3OYDA 2M51A 1VQ8Q 4M7DE 1NYGA 1HYOA 1TTHB 2YT6A 1R77A 2KMTA 1RAIB 2QTVA 1H3HA 4M75B 5GAMd 3EG0A 3EHQA 3L2ZA 3GIBA 1LOJA 4C92B 1I81A 1UHCA 2ZPGB 2CZ7B 3NMZC 5M9OA 3JCMe 3R6OA 2EQMA 3JCMc 2M0OA 4KH1B 2RF0A 2C0IA 3CCST 2DEUA 2VXEA 2ZCFB 3G71A 3M0QA 1K73C 1I4K1 4M78F 2A3LA 4VUBA 4M7AB 3GLXA 3RMQA 5GAMf 3G71Q 4JS5A 3ULRB 2F2XA 4OP0A 3JAME 1M2VA 4LN2A 2NUZA 5I2MA 2FRWA 1QKXA 4RTZA 4ZTJA 3DKMA 2KXCA 2EWNA 3FB9A 4X1VA 2GTOA 2QEXA 8ATCB 5GAN4 2NUTB 3OYLA 4ATOA 2LDMA 3CC2T 4X34A 4FM4B 3OYAA 3RKYA 4PKCC 1WHMA 2QEXQ 1QVFS 3G6EA 1M1KR 1K1ZA 4C5EA 2EJFA 2WACA 1K9AA 2O4XB 2E10A 3A8GB 3PT9A 2H3EB 4XTUA 4M7DF 2KSSA 1WXUA 1YITT 1M5Q1 2RPNA 3CQTA 2RHXA 2RH2A 3CCQT 3CC7Q 4HCBA 3SEMA 1M1KC 1WHGA 4J9GA 3CCUT 3A8OB 2LP5A 3FJPA 2OTJQ 4AG1C 2E6NA 1KHIA 1MMAA 1HXDA 3LYIA 3EGUA 3JCMJ 1U1TA 3I9QA 4PJOD 1AWOA 1UGPB 3OA6A 5KYUA 1PD0A 3KUFA 1YP5A 2COYA 3QJYA 2HD0A 9ATCB 1SSHA 4FW1A 4PJOC 4M77E 2RM4A 2MWOA 1WA7A 3OB9A 3V7RA 1TSFA 1M4ZA 3NTKA 3CPWP 2F69A 4FYYB 2G6FX 1H8KA 2R5MA 3CCVT 3M56A 1K0XA 1WZOA 2XG8D 2J6KA 1GBRA 3LX7A 4N0AA 2LCLA 2LTOA 4IUTA 2VGNA 4AT1B 4DBFA 2F1LA 2QA4Q 2DIQA 1CSKA 3I56A 1OV3A 3PIPA 4QKUA 3L2RA 1VQ6A 1NZ9A 3PVQA 2RJEA 1Y71A 1OEBA 3M57A 1WIEA 2PNIA 3JB9I 1UTIA 5KE2A 2OAUA 1JQQA 1VQ6Q 1E6HA 4AFQC 4BUGA 1UG1A 2EYWA 2AK5A 2FG0A 2Z0WA 3PGGA 4FSXA 1C1AA 1HSQA 4PFOA 2M02A 3EG3A 2KQWA 3C12A 1XNIA 1JEGA 2P0PA 1BI0A 1OPKA 2K57A 3M5AA 1FWZA 3GBQA 2CYZB 3CPWA 1VYVA 5FU6B 2E5QA 2OI3A 1M3CA 2K6DA 2XIDA 2EYZA 4Z8AA 1OZ3A 1XQHA 5L8RE 3I55A 2JMCA 1V76A 1TWBA 1NEBA 2OTLA 2MWPA 4MMKA 3UDCA 2LQKA 1K9MC 4BI3A 1TXQA 1JJ2P 2OTLQ 1PM3A 2PZ1A 1EX4A 4M77F 3M0UA 1M8VA 2DERA 4HCZA 2ECZA 4FYXB 3VS1A 2WSCE 2RO0A 2M16A 4M7AE 3BE3A 4ZGEB 3OYEA 1G3YA 2VGMA 2M1HA 3H0IA 5GAOp 3CCJA 1PNJA 4J8OA 1TUDA 1W2BS 2XKOC 1KQSS 3J7AF 5IHKA 1PSFA 1U3OA 2DTIA 4OB1B 2A37A 4NL2A 2DD5A 1VQLA 4MZPA 5CKBA 4KULA 3FIFA 1VQPA 5GMKm 2M0YA 5LJ3h 4JPBW 3ZL7C 2AT1B 1VQLQ 1VQ7A 2L3QA 3PIOA 2QYZA 1ARKA 1JJ2A 1VQPQ 1TUCA 3PNWC 1VA7A 2R57A 2EQKA 3P8DA 1K0SA 3A8LB 2CGHA 2C0TA 1D0XA 4M7DA 4WF2A 1ZA2B 1YI2Q 2AKKA 1Q86R 1KSWA 1J3TA 1MV3A 2YRCA 2HEQA 4M78B 2O01E 4WTOB 1EFNA 2A28A 2A08A 3OYBA 2A7YA 4D8DA 5IHIA 4LUDA 4JRKA 1QW1A 2CT4A 2JXBA 5CKDA 1YIJT 1X2KA 2D1XA 2HAXA 3INZA 5D6YA 3ASKA 2IVWA 2JS2A 5CKFA 1TH7A 4BDZA 4N0AC 1Q86C 1S72T 2EQIA 3A8HB 2KGTA 1YJ9T 3AHUA 5GANh 4M7DG 2W10A 4A4EA 4M7AF 1OULA 1DJ7B 2NLUA 3CBOA 2FRYA 3FDRA 2RJCA 1YJNA 4XU1A 2D0NA 2JS0A 4MDWA 1W1FA 1AD5A 3HKSA 1PRMC 2K3XA 3S3OA 2E41A 1ZQ1A 1XTDA 2KT1A 1YJNQ 2W0ZA 3CPWS 1VQ9T 4AG2C 2L89A 2VVKA 3WVDB 1KC8U 1OYXA 2CUDA 1QQJA 1U06A 1M90C 2O9VA 1VIFA 1N9RA 2OAWA 3HFOA 3QWYA 3KXTA 3VV0A 4FIBA 4EMKB 2DEQA 3JCMg 5GAMh 5L23A 2E4HA 3P8BB 1X6OA 2PVDB 1P92A 1SRMA 4Q5WA 3QZ9B 3J80E 2RN8A 2XDPA 5CVIA 1G5VA 1YCSB 2JTEA 6AT1B 5LJ3e 2BKDN 1Q82U 5HCKA 1E6GA 3VS5A 4LE9A 3X26B 3UATA 4C0DC 2EKOA 4F16A 3V8LA 1IB8A 2XICA 4E7SA 1RI9A 2DMOA 4RKUE 3VRYA 1UGRB 2KI7A 2HBPA 2NUPA 2XD0A 3DLMA 3EG9B 1FYNA 2LZ6B 3ZBDA 4IUVA 2F2VA 2FZCB 2ZPEB 4BE0A 1OI1A 1RLQC 1Z9ZA 1G3WA 4RTXA 1B3QA 2GNCA 2QAZA 3F70A 3JCMP 1NJIU 3RKXA 2RNAA 1QCOA 2KXDA 2KYMA 3M0SA 2AIRB 1NPPA 2JUFA 1Q7YC 1QVFP 3OS2A 3CCET 3EGDB 1UGSB 1Q81R 2DZCA 1F1BB 1WYXA 4HXJA 1OU9A 4FU6A 5GANe 2K4YA 5LJ5h 5KYWB 1JU5C 5KYXB 2CREA 3MP8A 1G8XA 1JO8A 1V29B 2FPDA 3OYCA 3V8KA 2OX7A 1MNDA 4PK4A 1PCXA 3VS7A 1Q81C 3TCJA 2KK4A 2CP3A 2CP7A 4KGZB 2NWMA 1UJ0A 5GJVB 4LXCA 4RUGA 3DB4A 2LJ3A 4M77G 4C8QA 3TU4K 1VQNT 1H3ZA 3O5ZA 2JOYA 3V7CA 2DAQA 4DA4A 1WHHA 3QJ6A 4F7UE 1GCQC 4BB7A 4QVCA 4OMPA 1QVFA 3OMCA 5GAMe 4OMFB 3CCMT 3JCMQ 3OMGA 1X69A 5GMKi 1IHWA 3OQ5A 3TVTA 5FWBA 3PE0A 5CCAA 3CCLA 3NTIA 1GFCA 4QW2A 5KYYB 3UF4A 1WXTA 2DFUA 2YXYA 2QDYB 3MEWA 2DXBA 4IUPA 4M75A 5GAN8 1VQ4T 3CCLQ 3CBPA 2XDBA 3EFOB 4C92A 4HKEA 2CKKA 2C06A 2V1RA 2LCSA 3S6WA 1YHQA 3EH1A 4EMGA 4RTYA 2FPFA 5IHNA 2QQAA 3RIRA 2DK3A 3FRNA 3QDFA 4E7KA 2YLCA 1VQOT 1VQKA 2J05A 5ECAA 4EIKA 5FU7C 1H92A 1VQKQ 2K7AA 4PJNA 5GAOm 2F5TX 1QMCA 3X20B 1HJDA 2V8IA 2E5KA 1QCNA 2GGRA 4RG8A 1VQ8A 5GAN5 5A0DA 3GP8A 3FC3A 1WJRA 2X51A 1JBMA 3I5RA 4CC4B 4F04B 4LNPA 2FEIA 5LJ5e 3LH0A 1IREB 3CMEA 1D1AA 3MO8A 3NPFA 3JCMV 1HD3A 1IGUA 1KFZA 1EIFA 4F14A 3CC4A 3CMEQ 4M7AG 2RQRA 3L2VA 3EGXA 2CZ6B 1K73R 1UGVA 2RI5A 4F7UF 2X4XA 1M1KU 2F5KA 1FX7A 4HT9A 1EZZB 2P4TA 3CC4Q 2X3XD 1RAEB 2GF7A 3SWNA 4NL3A 3X25B 1ABQA 2O88A 2RHUA 3REAB 2D9TA 1W70A 4AFZC 2VC8A 3KBGA 1WXBA 3PMTA 1CKBA 3PTAA 3CCSQ 1AHJB 2KVQG 3TREA 4LD9K 1W2BP 4J9EA 1RABB 1KQSP 4A4HA 2CSQA 1NM7A 3OYFA 5GAOn 3LWIA 3BY7A 1QVGP 3M4GA 4PJOB 1OZ2A 5GAN2 2DJQA 3CCRA 4PLLA 2Y4XA 3G71T 4BY6C 2WSEE 3QKJA 1ZSZA 2PTKA 3HL8A 4C8QD 2JM9A 4IKFA 3CCRQ 2HKQB 3UPUA 1OQKA 3DLLA 4RMOA 1KG1A 1T3LA 5I11A 2DTHA 1KD1R 1Y96B 1I07A 4C8QC 1T0JA 3JB9D 3H41A 4XU2A 4AFSC 3RBBB 4ELYC 4HA8A 2CSIA 2LJ1A 1ZSGA 3VUBA 4XTYA 2FVUA 5I2SA 5FLXE 2I0NA 2SEMA 4PFPA 3CC7A 4RCBA 5CKEA 2QEXT 3C95A 1FMKA 2VV5A 2OTJA 1W2BA 1KD1C 1KQSA 2PUOB 3LWHA 4J6XA 1G2BA 1LVKA 1YJWT 5J3BA 1QVGA 1RUWA 3G6ET 2CH4A 1TOVA 1PD1A 3THKA 2JN0A 2QASA 1M3BA 2LX7A 1AWWA 4M75C 4KGXB 2KROA 4C92C 4E7ZA 3UA7A 1PWTA 5FWCA 2L3RA 2KYBA 3JCMd 2KT8A 1Y0MA 4LDUA 5DLOA 1JRIA 2DXTA 2CZ1B 4Y92A 1BI2A 1R0CB 2RK1A 1M2VB 5GMKj 5GAOl 5FRMA 4GY5A 1SHGA 1UHFA 4J7IA 1BU1A 1UGQB 4EDUA 1LNXA 4HVUA 3RERA 2QA4A 1UFFA 3HRTA 4KGVB 3M9QA 4E47A 1MHNA 1WX6A 2QG9B 1YCYA 3RMSA 1NLPC 1ZLMA 2EW3A 3JCMf 3MKDA 2DRKA 3A1PA 4BI4A 4QQDA 2R58A 1SPKA 2DKGA 2EYQA 2EFIA 2L5QA 4BD3A 3BDUA 4GLMA 1C0MA 2ED0A 4DOWA 4D8KA 3T9NA 4KBMB 1OOTA 5AYFA 4ZN3A 5LJ3g 1YWOA 4ESRA 4OMNA 1NEGA 3X28B 4HCKA 2P84A 3I56T 1VQ6T 1RI0A 3JRZA 3SWNC 4KRTA 2RQWA 1K9MR 3JCMX 3L2WA 3E19A 3I35A 2KEAA 4LDXA 3E9FA 1N8RR 2PQWA 2V26A 2V8JA 5KYUB 4PJLA 2YHTA 2DYIA 2BZ8A 2K3BA 1IZ6A 4CI0C 1NYFA 5D6WA 3VKIA 3GOXA 1N8RC 2RHZA 3A98A 1VYUA 2EBPA 2XMFA 2CDTA 1ZSZC 3PMIA 1Q86U 4RTTA 4JRQA 2YSQA 2A0FB 5GANg 3I55T 2JM8A 3REBB 1MNEA 3Q1JA 1M8MA 4RTWA 4M78A 2E1HA 5EG2A 2OTLT 2RD1A 2DTOA 1H641 2FO0A 5C0MA 2JMAA 2JTMA 3GF5A 2GTJA 2ZZDA 1ZUKA 3A8MB 1TG0A 4DOVA 4ELZC 2KY9A 2ZPHB 4PJOE 4F7UG 1IXDA 2P0QA 4K11A 3HRUA 1QVGS 1KJWA 4XTXA 2GFUA 2KDSA 4AMCA 3RR6A 3CEYA 2QQBA 1YWPA 2HDAA 2L2PA 1SF9A 3OS5A 3ER0A 4M78G 1D0YA 3CCJT 3JCMW 4PJMA 5GAMg 2HZYA 4F7UB 2EQJA 3QXEB 3SD4A 2CP0A 1YI2A 1IGQA 2K79A 1VQLT 4OB3B 2EPDA 1JXMA 1W6XA 3EFSA 1D3BA 1VQPT 4C5HA 3VYGA 3RESA 1RAAB 1VQ7T 4X9DA 5FU6C 2LT1A 5IT9E 4EMKA 4RG2A 2COWA 1YIJA 1WHLA 3V8JA 4C5IA 4C0DB 4JZ3A 2VUBA 3FEOA 4OGCA 2X4YA 3H0HA 2LRQA 2VXFA 4HVWA 1MGQA 2K2MA 1QP3A 1AOJA 1C6VX 3LLRA 3H0FA 4OB2B 1U8RA 1YIJQ 2D8JA 3VS3A 2CZ0B 3WVEB 1NG2A 4C0FA 4XU0A 1M90R 3CD6A 3OSSC 2FZKB 1BI3A 1UE9A 4OVAA 1VQMA 4L59A 2E70A 2AZSA 4PJOF 4PLIA 2YUPA 3G4SA 5LJ5g 1M1GA 5HKCA 3CD6Q 2HKNA 2FL7A 3EH2A 4FYVB 2MK5A 1VQMQ 2KRMA 2QXFA 5D7UA 3G4SQ 1R0BG 4OMOA 5CK9A 1VQ9Q 1M1FA 3QPHA 1YJNT 1SKUB 1Q81U 1N9SA 4PFZA 4JJBA 2LC4A 2ZAEA 2K5FA 3TSZA 5KYWA 3TQ7P 4N4HA 1ZUYA 5KYXA 1BB9A 3OYYA 2GQIA 4J9IA 4LDWA 5GAOr 1E7OA 2DF6A 4BACA 2HSPA 2AHJB 4GBQA 2RQVA 3MPUB 2MIOA 1OU8A 1QWFA 3CXCP 2D0QB 5HY6A 1QLYA 1QCFA 5FRNA 5HK3A 2P4RA 1WHKA 2FB7A 2E3IA 4NS5A 4OGEA 4YTLA 1Q7YR 1G3TA 3OYGA 2C0OA 2LX9A 1BYMA 2GFAA 2CUBA 3MP6A 2DZ9A 1GCPA 2K9GA 1BKBA 3M0TA 4MMLA 3TSWA 3E9GA 1PSEA 4RTUA 3VRZA 4LDVA 1BIAA 4DBQA 1W4SA 2YUQA 3JCMb 3CCEA 4KH0B 4FSSA 1FXXA 2YWWA 4M77A 3VYHB 5A2QE 4J5YA 5KYNA 1Y07A 5KYYA 2MCNA 1V1CA 1ZX6A 3AT1B 3CCEQ 3SDZA 1BK2A 1X43A 1QKWA 2ROTA 3META 5FU7B 4M7DD 1UDLA 2QI2A 2DM1A 2E65A 4MDXA 1VYTA 2LQ8A 3OYMA 3CXCA 5A0LA 1MMGA 4E7JA 1WFWA 3OY9A 4ME7A 2DNUA 4E7LA 3HFNA 2RJFA 4M7DC 4HCCA 1WNLA 3TEEA 2CH4W 3JSCA 1I8FA 3NGPA 1BIBA 2Y4YA 4NOYA 3C94A 1RAFB 4Z02A 2RI2A 4ORZA 2J6FA 2KRSA 4QQGA 1AZEA 5FROA 4EMKC 3WXMB 2EGAA 4CC7A 1VQNQ 4ZTFA 1AWXA 1M27C 2HQEA 3OYHA 4L6V5 4QVZA 2RHYA 4JLIA 4JUVA 3JCMh 1QP2A 2NUPB 2MYSA 1VQ5T 5CO7A 2GCXA 4ZGDB 2JNGA 4A53A 3CCMQ 2O2OA 1SHFA 3N5BB 1O75A 1RADB 3VS0A 1K73U 4J7FA 2LNHB 1N5ZA 5IN1A 5IXBA 4RCCA 1PHTA 4QQ6A 4LD6A 2MPXC 2JTFA 4A4GA 1MMDA 4R56A 3R6NA 4DEXA 2LQWA 1RAHB 3OBYA 1WI7A 1X6GA 3ME9A 1A0NB 1T3SA 4L5GA 3CCLT 3I5SA 2E12A 1I0CA 3CMAA 4XTWA 1ZUUA 1PRLC 3H6ZA 3LH5A 1IO6A 1TUGB 2XDDA 2RHIA 3EAEA 4M7AA 2HSEB 4XTZA 3SFMA 3CMAQ 1YHQT 2DBKA 2V8KA 1VUBA 4IURA 1MUZA 4C0ZA 1VQKT 2LMJA 3OS0A 2KRNA 1N27A 3RNJA 5KE3A 2G3RA 4C8QB 2X9HA 5IXFA 2D6FA 2K5IA 4KUIA 3EG2A 3QHSA 2NUTA 3M58A 3ZEHA 1KD1U 4XK8E 2X4JA 1FMWA 1K8AR 1VQ8T 3OYIA 4BE2A 1I5LA 4F17A 1LPLA 5GANf 3HTRA 5CR2A 2ZPFB 5KCOA 4PJOG 3CCSA 5GAOq 2O4XA 3A5ZB 3CMET 2QQRA 4M77D 2LQNA 2DIGA 1M9SA 1WHJA 1K8AC 3VJPA 3CC4T 2BZYA 3L1AA 2DD4A 5CAIA 4II1A 4IUQA 4M77C 4Y91A 3HRSA 1U5SA 3QWXX 1D1BA 1GBQA 1OPLA 4OMMA 4J9HA 4FCYA 3CXCS 1VIEA 3H9NA 1PKTA 2O9SA 3C4SA 4A63B 1NLOC 3EG1A 1ACMB 2EJGA 1Z9QA 1ABOA 2DL5A 1JXOA 1GXIE 1AZGB 1UB4A 3VU3C 4CC2A 3CC2A 2DA9A 3SHWA 2K5LA 2E3HA 2DL7A 2MI6A 2WSFE 1B34B 3CC2Q 3CCRT 3MCAB 2K3YA 2BZXA 3QUIA 1MV0B 1HK9A 2RQUA 4XQ3A 3V7SA 2LT4A 3G1JA 1KK7A 2MMPA 2EGCA 1YFNA 1YITA 4MZMA 5D6XA 4Z88A 3CCQA 3EGXB 3GPLA 1YJWA 3M54A 4M75D 4AFUC 2LCCA 3CCUA 5LJ5d 1PC0A 1S1NA 4C92D 1YITQ 2HQXA 2J06A 3CCQQ 4B9WA 1AEYA 3SWNB 1YJWQ 4DBRA 1R8OB 2CS7A 3CCUQ 3G6EQ 2XK0A 3OW2S 4PNOA 3CC7T 1GL5A 2HL3A 2DJZA 5CIUA 2HL5C 2L3SA 1RAGB 2OTJT 5LJ3j 4LDYA 4IUUA 3OBWA 1K9MU 2M9UA 4M7AD 3NHNA 1N8RU 5LJ5f 2RQTA 3CBMA 7AT1B 1ZA1B 2AKLA 2XI9A 3E2UA 2Y90A 4JDSA 4P5NA 3JB9J 3SB2A 4M7AC 3CCVA 2VWFA 1UUEA 2J6OA 2EQUA 3J81E 4O6JA 1ZSZB 3BW1A 2MOXA 1YN8A 2AZVA 1Y7XA 4R0KA 3E1SA 8AT1B 3CCVQ 3QYGB
chains in the Genus database with same CATH topology
1W6XA 2KYMA 2YT6A 4IIMA 3M0SA 5FW9A 1Y57A 1H3HA 3EG0A 1WYXA 3EHQA 4HXJA 1WLPB 1UHCA 3UA6A 1JU5C 3NMZC 1M30A 4JZ3A 2GBQA 2CREA 3H0HA 3EHRA 4HVWA 2K2MA 1JO8A 1AOJA 2FPDA 2RF0A 2C0IA 3H0FA 1KIKA 2EYXA 1UECA 2J7IA 1WDXA 2D8JA 3VS3A 3VS7A 1RLPC 3M0QA 2KE9A 1NG2A 2NWMA 1UJ0A 5GJVB 4RUGA 4DEYA 2LJ3A 2HBWA 2ESWA 3O5ZA 3ULRB 2F2XA 1UE9A 3M0RA 4LN2A 2DL3A 2AZSA 1GCQC 2NUZA 2YUPA 5I22A 4OMPA 2FRWA 4J9DA 1QKXA 4RTZA 2SRCA 2KXCA 2KRMA 1X69A 1T0HA 4X1VA 3PVLA 2GTOA 3TVTA 5FWBA 4OMOA 3PE0A 1GFCA 3UF4A 1WXTA 2EKHA 4JJBA 1K1ZA 4RTVA 1XOVA 3TSZA 1K9AA 2V1RA 2LCSA 1ZUYA 2QDLA 4RTYA 2FPFA 2RMOA 1BB9A 5IHNA 2GQIA 4J9IA 2F2WA 1E7OA 2J05A 1WXUA 4J9BA 2DF6A 2HSPA 5ECAA 2RPNA 3CQTA 4EIKA 2ABLA 4GBQA 4ZNXA 2RQVA 2DBMA 3SEMA 2MIOA 4J9GA 1H92A 1QWFA 2LP5A 4AG1C 1QLYA 2K7AA 1QCFA 2P4RA 3EGUA 1HJDA 2E5KA 1YNZA 2GGRA 3M0PA 2C0OA 3I9QA 1AWOA 2L3PA 1SEMA 3I5RA 1YP5A 2CUBA 4CC4B 4LNPA 2FEIA 1SSHA 1GRIA 1GCPA 2K9GA 3TSWA 3M0TA 2DYBA 4RTUA 3VRZA 2YUQA 1WA7A 2KBTA 4FSSA 3NPFA 1HD3A 1KFZA 4F14A 2G6FX 2RQRA 1V1CA 1H8KA 2MCNA 4CC3A 1ZX6A 1UGVA 1K0XA 1BK2A 1X43A 2YDLA 2J6KA 1GBRA 2DVJA 1QKWA 2ROTA 2DL8A 2H8HA 2X3XD 1ABQA 1UDLA 1CSKA 2O88A 1OV3A 2DM1A 3REAB 1VYTA 1W70A 2X3WD 4AFZC 1WFWA 4Z89A 2DNUA 3PVQA 1WXBA 1CKBA 2KNBB 1OEBA 1WIEA 2PNIA 2EVRA 2CH4W 1UTIA 3NGPA 4J9EA 1GCQA 1JQQA 1E6HA 4AFQC 1UG1A 2CSQA 1NM7A 2EYWA 2AK5A 2FG0A 4ORZA 2J6FA 2KRSA 1AZEA 1HSQA 2EGAA 4CC7A 2HCKA 2DJQA 3EG3A 1AWXA 1M27C 3JV3A 3C0CA 5EC7A 1JEGA 4J9CA 1OPKA 2LJ0A 3GBQA 1JXMA 2PTKA 1VYVA 2JM9A 2OI3A 2DRMA 2DL4A 1M3CA 2K6DA 2EYZA 4Z8AA 2O2OA 1AWJA 1SHFA 1T3LA 5I11A 1X2QA 2V1QA 1I07A 1T0JA 2JMCA 3H41A 1NEBA 3VS0A 2JT4A 2LNHB 4AFSC 1N5ZA 3RBBB 5IXBA 1PHTA 2CSIA 2LJ1A 1ZSGA 1SRLA 3U23A 2I0NA 2SEMA 3R6NA 4DEXA 2LQWA 2PZ1A 1FMKA 1WI7A 1X6GA 1A0NB 3M0UA 1T3SA 4J9FA 3I5SA 1I0CA 2ECZA 3VS1A 1ZUUA 1PRLC 1G2BA 2L0AA 3LH5A 1IO6A 2DILA 1RUWA 2CH4A 2VKNA 1I1JA 3THKA 1M3BA 2LX7A 1AWWA 2ENMA 3H0IA 2DBKA 2ED1A 4JZ4A 1PNJA 1K76A 2KROA 1TUDA 1B07A 1MUZA 3UA7A 1PWTA 2LMJA 5FWCA 5IHKA 2KRNA 3RNJA 1U3OA 2IIMA 2A37A 2KYBA 2KT8A 1Y0MA 2B86A 5IXFA 4E6RA 4Y92A 2M0YA 3EG2A 4JPBW 3ZL7C 1SHGA 1UHFA 2L3QA 1BU1A 1ARKA 4HVUA 4OMQA 5GJWB 4JJCA 1UFFA 1K4US 4F17A 1TUCA 1VA7A 1WX6A 2CT3A 1K0SA 1NLPC 1PKSA 1ZLMA 2EW3A 2C0TA 2DRKA 2LQNA 2AKKA 2DX1A 1SPKA 1KSWA 1J3TA 1MV3A 2OJ2A 2HEQA 1GFDA 3VS6A 2YUNA 1EFNA 2BZYA 2A28A 4GLMA 2A08A 2ED0A 4D8KA 4D8DA 5IHIA 4LUDA 2CT4A 1X6BA 2EGEA 1OOTA 2JXBA 1U5SA 1YWOA 3QWXX 1X2KA 2D1XA 4ESRA 1GBQA 4OMNA 1OPLA 1NEGA 2A36A 2JS2A 4J9HA 4OMMA 3VS4A 4HCKA 1PKTA 2O9SA 1ZBJA 4A63B 1NLOC 2EQIA 3EG1A 2D8HA 2KGTA 4KRTA 2RQWA 1Z9QA 1ABOA 1BBZA 2ROLA 3I35A 2KEAA 2DL5A 2W10A 4JJDA 1JXOA 1AZGB 4CC2A 2DA9A 2FRYA 2D0NA 2JS0A 3VS2A 3SHWA 1W1FA 5IH2A 1AD5A 4LUEA 2DL7A 1G83A 2BZ8A 2K3BA 1PRMC 1X27A 2BZXA 2KT1A 1NYFA 1MV0B 2RQUA 2W0ZA 3KFVA 4QT7A 4AG2C 4HVVA 2VVKA 2CUDA 3A98A 2BTTA 1VYUA 1U06A 2EBPA 2XMFA 2O9VA 2EGCA 2CDTA 2KR3A 2YUOA 2OAWA 4RTTA 4Z88A 2YSQA 3QWYA 4AFUC 1AVZC 1UJYA 2JM8A 3REBB 1M8MA 4RTWA 1M3AA 5L23A 1S1NA 2DE0X 2FO0A 2JMAA 2J06A 1AEYA 1SRMA 2JW4A 3FJ5A 2GTJA 1ZUKA 2RN8A 1TG0A 1YCSB 2JTEA 1GL5A 5HCKA 1QWEA 2L3SA 1LCKA 1E6GA 4K11A 4LE9A 3VS5A 3UATA 4F16A 2DLPA 1KJWA 3IQLA 2O31A 1RI9A 2DMOA 3NHNA 3VRYA 1CKAA 2RQTA 1YWPA 2HDAA 2L2PA 4IIOA 2AKLA 1FYNA 2LZ6B 4M4ZA 2EYYA 2F2VA 4OMLA 2FPEA 2VWFA 4WCIA 1UUEA 2J6OA 1RLQC 1Z9ZA 2MOXA 1YN8A 2AZVA 4RTXA 1B3QA 2GNCA 2K79A 2M51A 4R0KA 1NYGA 2RNAA 2KXDA 2EPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6X A;  2KYM A;  2YT6 A;  4IIM A;  3M0S A;  5FW9 A;  1Y57 A;  1H3H A;  3EG0 A;  1WYX A;  3EHQ A;  4HXJ A;  1WLP B;  1UHC A;  3UA6 A;  1JU5 C;  3NMZ C;  1M30 A;  4JZ3 A;  2GBQ A;  2CRE A;  3H0H A;  3EHR A;  4HVW A;  2K2M A;  1JO8 A;  1AOJ A;  2FPD A;  2RF0 A;  2C0I A;  3H0F A;  1KIK A;  2EYX A;  1UEC A;  2J7I A;  1WDX A;  2D8J A;  3VS3 A;  3VS7 A;  1RLP C;  3M0Q A;  2KE9 A;  1NG2 A;  2NWM A;  1UJ0 A;  5GJV B;  4RUG A;  4DEY A;  2LJ3 A;  2HBW A;  2ESW A;  3O5Z A;  3ULR B;  2F2X A;  1UE9 A;  3M0R A;  4LN2 A;  2DL3 A;  2AZS A;  1GCQ C;  2NUZ A;  2YUP A;  5I22 A;  4OMP A;  2FRW A;  4J9D A;  1QKX A;  4RTZ A;  2SRC A;  2KXC A;  2KRM A;  1X69 A;  1T0H A;  4X1V A;  3PVL A;  2GTO A;  3TVT A;  5FWB A;  4OMO A;  3PE0 A;  1GFC A;  3UF4 A;  1WXT A;  2EKH A;  4JJB A;  1K1Z A;  4RTV A;  1XOV A;  3TSZ A;  1K9A A;  2V1R A;  2LCS A;  1ZUY A;  2QDL A;  4RTY A;  2FPF A;  2RMO A;  1BB9 A;  5IHN A;  2GQI A;  4J9I A;  2F2W A;  1E7O A;  2J05 A;  1WXU A;  4J9B A;  2DF6 A;  2HSP A;  5ECA A;  2RPN A;  3CQT A;  4EIK A;  2ABL A;  4GBQ A;  4ZNX A;  2RQV A;  2DBM A;  3SEM A;  2MIO A;  4J9G A;  1H92 A;  1QWF A;  2LP5 A;  4AG1 C;  1QLY A;  2K7A A;  1QCF A;  2P4R A;  3EGU A;  1HJD A;  2E5K A;  1YNZ A;  2GGR A;  3M0P A;  2C0O A;  3I9Q A;  1AWO A;  2L3P A;  1SEM A;  3I5R A;  1YP5 A;  2CUB A;  4CC4 B;  4LNP A;  2FEI A;  1SSH A;  1GRI A;  1GCP A;  2K9G A;  3TSW A;  3M0T A;  2DYB A;  4RTU A;  3VRZ A;  2YUQ A;  1WA7 A;  2KBT A;  4FSS A;  3NPF A;  1HD3 A;  1KFZ A;  4F14 A;  2G6F X;  2RQR A;  1V1C A;  1H8K A;  2MCN A;  4CC3 A;  1ZX6 A;  1UGV A;  1K0X A;  1BK2 A;  1X43 A;  2YDL A;  2J6K A;  1GBR A;  2DVJ A;  1QKW A;  2ROT A;  2DL8 A;  2H8H A;  2X3X D;  1ABQ A;  1UDL A;  1CSK A;  2O88 A;  1OV3 A;  2DM1 A;  3REA B;  1VYT A;  1W70 A;  2X3W D;  4AFZ C;  1WFW A;  4Z89 A;  2DNU A;  3PVQ A;  1WXB A;  1CKB A;  2KNB B;  1OEB A;  1WIE A;  2PNI A;  2EVR A;  2CH4 W;  1UTI A;  3NGP A;  4J9E A;  1GCQ A;  1JQQ A;  1E6H A;  4AFQ C;  1UG1 A;  2CSQ A;  1NM7 A;  2EYW A;  2AK5 A;  2FG0 A;  4ORZ A;  2J6F A;  2KRS A;  1AZE A;  1HSQ A;  2EGA A;  4CC7 A;  2HCK A;  2DJQ A;  3EG3 A;  1AWX A;  1M27 C;  3JV3 A;  3C0C A;  5EC7 A;  1JEG A;  4J9C A;  1OPK A;  2LJ0 A;  3GBQ A;  1JXM A;  2PTK A;  1VYV A;  2JM9 A;  2OI3 A;  2DRM A;  2DL4 A;  1M3C A;  2K6D A;  2EYZ A;  4Z8A A;  2O2O A;  1AWJ A;  1SHF A;  1T3L A;  5I11 A;  1X2Q A;  2V1Q A;  1I07 A;  1T0J A;  2JMC A;  3H41 A;  1NEB A;  3VS0 A;  2JT4 A;  2LNH B;  4AFS C;  1N5Z A;  3RBB B;  5IXB A;  1PHT A;  2CSI A;  2LJ1 A;  1ZSG A;  1SRL A;  3U23 A;  2I0N A;  2SEM A;  3R6N A;  4DEX A;  2LQW A;  2PZ1 A;  1FMK A;  1WI7 A;  1X6G A;  1A0N B;  3M0U A;  1T3S A;  4J9F A;  3I5S A;  1I0C A;  2ECZ A;  3VS1 A;  1ZUU A;  1PRL C;  1G2B A;  2L0A A;  3LH5 A;  1IO6 A;  2DIL A;  1RUW A;  2CH4 A;  2VKN A;  1I1J A;  3THK A;  1M3B A;  2LX7 A;  1AWW A;  2ENM A;  3H0I A;  2DBK A;  2ED1 A;  4JZ4 A;  1PNJ A;  1K76 A;  2KRO A;  1TUD A;  1B07 A;  1MUZ A;  3UA7 A;  1PWT A;  2LMJ A;  5FWC A;  5IHK A;  2KRN A;  3RNJ A;  1U3O A;  2IIM A;  2A37 A;  2KYB A;  2KT8 A;  1Y0M A;  2B86 A;  5IXF A;  4E6R A;  4Y92 A;  2M0Y A;  3EG2 A;  4JPB W;  3ZL7 C;  1SHG A;  1UHF A;  2L3Q A;  1BU1 A;  1ARK A;  4HVU A;  4OMQ A;  5GJW B;  4JJC A;  1UFF A;  1K4U S;  4F17 A;  1TUC A;  1VA7 A;  1WX6 A;  2CT3 A;  1K0S A;  1NLP C;  1PKS A;  1ZLM A;  2EW3 A;  2C0T A;  2DRK A;  2LQN A;  2AKK A;  2DX1 A;  1SPK A;  1KSW A;  1J3T A;  1MV3 A;  2OJ2 A;  2HEQ A;  1GFD A;  3VS6 A;  2YUN A;  1EFN A;  2BZY A;  2A28 A;  4GLM A;  2A08 A;  2ED0 A;  4D8K A;  4D8D A;  5IHI A;  4LUD A;  2CT4 A;  1X6B A;  2EGE A;  1OOT A;  2JXB A;  1U5S A;  1YWO A;  3QWX X;  1X2K A;  2D1X A;  4ESR A;  1GBQ A;  4OMN A;  1OPL A;  1NEG A;  2A36 A;  2JS2 A;  4J9H A;  4OMM A;  3VS4 A;  4HCK A;  1PKT A;  2O9S A;  1ZBJ A;  4A63 B;  1NLO C;  2EQI A;  3EG1 A;  2D8H A;  2KGT A;  4KRT A;  2RQW A;  1Z9Q A;  1ABO A;  1BBZ A;  2ROL A;  3I35 A;  2KEA A;  2DL5 A;  2W10 A;  4JJD A;  1JXO A;  1AZG B;  4CC2 A;  2DA9 A;  2FRY A;  2D0N A;  2JS0 A;  3VS2 A;  3SHW A;  1W1F A;  5IH2 A;  1AD5 A;  4LUE A;  2DL7 A;  1G83 A;  2BZ8 A;  2K3B A;  1PRM C;  1X27 A;  2BZX A;  2KT1 A;  1NYF A;  1MV0 B;  2RQU A;  2W0Z A;  3KFV A;  4QT7 A;  4AG2 C;  4HVV A;  2VVK A;  2CUD A;  3A98 A;  2BTT A;  1VYU A;  1U06 A;  2EBP A;  2XMF A;  2O9V A;  2EGC A;  2CDT A;  2KR3 A;  2YUO A;  2OAW A;  4RTT A;  4Z88 A;  2YSQ A;  3QWY A;  4AFU C;  1AVZ C;  1UJY A;  2JM8 A;  3REB B;  1M8M A;  4RTW A;  1M3A A;  5L23 A;  1S1N A;  2DE0 X;  2FO0 A;  2JMA A;  2J06 A;  1AEY A;  1SRM A;  2JW4 A;  3FJ5 A;  2GTJ A;  1ZUK A;  2RN8 A;  1TG0 A;  1YCS B;  2JTE A;  1GL5 A;  5HCK A;  1QWE A;  2L3S A;  1LCK A;  1E6G A;  4K11 A;  4LE9 A;  3VS5 A;  3UAT A;  4F16 A;  2DLP A;  1KJW A;  3IQL A;  2O31 A;  1RI9 A;  2DMO A;  3NHN A;  3VRY A;  1CKA A;  2RQT A;  1YWP A;  2HDA A;  2L2P A;  4IIO A;  2AKL A;  1FYN A;  2LZ6 B;  4M4Z A;  2EYY A;  2F2V A;  4OML A;  2FPE A;  2VWF A;  4WCI A;  1UUE A;  2J6O A;  1RLQ C;  1Z9Z A;  2MOX A;  1YN8 A;  2AZV A;  4RTX A;  1B3Q A;  2GNC A;  2K79 A;  2M51 A;  4R0K A;  1NYG A;  2RNA A;  2KXD A;  2EPD A; 
#chains in the Genus database with same CATH topology
 2FHD A;  4IIM A;  3MHX A;  2EJ9 A;  2LVM A;  2KAF A;  4TVR A;  5FW9 A;  2X4W A;  3P8H A;  1Y57 A;  2HMA A;  2JJ9 A;  3UWN A;  5IAY A;  1RAC B;  1WLP B;  2GQV A;  4BE1 A;  1X01 A;  2QA4 T;  4XU3 A;  3UA6 A;  1IRX A;  1M30 A;  2GBQ A;  1BCM A;  2ATC B;  1D0Z A;  2B8A A;  3EHR A;  5GAN j;  4JRP A;  2PVG B;  1KIK A;  2EYX A;  3RKW A;  1UEC A;  2J7I A;  1WDX A;  3OS1 A;  1RLP C;  2ZGW A;  2XU8 A;  2KE9 A;  4ZN1 A;  4C8Q E;  3I56 Q;  4DEY A;  2HBW A;  4HT8 A;  2ESW A;  1IHV A;  4A4F A;  2DVE A;  2COZ A;  3M0R A;  4ZGJ B;  2DL3 A;  3M53 A;  3QDR B;  4FYW B;  4QVD A;  5I22 A;  4F7U A;  4J9D A;  2YRV A;  2SRC A;  1BI1 A;  1TU0 B;  4J6W A;  5CQY A;  5LL6 S;  4E2F B;  1T0H A;  5GAM j;  3PVL A;  1OX8 A;  4EPC A;  4A4K A;  4M75 E;  4Y28 E;  1OX9 A;  2DXC A;  2EKH A;  4C92 E;  2VYT A;  2EAY A;  4RTV A;  4JLG A;  1U1S A;  4A54 A;  1XOV A;  3I55 Q;  1NPR A;  2YRD A;  2QDL A;  5A0G A;  2RMO A;  4FT2 A;  5J26 A;  3BFM A;  2F2W A;  1NE8 A;  4J9B A;  2ABL A;  3GNG A;  1AT1 B;  4UC4 A;  4ZNX A;  2DBM A;  4ANJ A;  3QII A;  2ZPI B;  1M90 U;  4PJJ A;  1YNZ A;  4O5V A;  3M0P A;  2HQH A;  1BCO A;  3MEU A;  1X75 C;  2L3P A;  1SEM A;  1LJO A;  3CCJ Q;  1Q95 G;  1GRI A;  4C8Q F;  2DYB A;  4PL6 A;  2RI3 A;  3L2Q A;  2RA2 A;  5LJ5 j;  2KBT A;  2P0K A;  2QQS A;  1JB0 E;  4CC3 A;  2L8D A;  2JVV A;  2VB6 A;  3JB9 F;  2YDL A;  1SSF A;  3QG1 A;  3LGL A;  3QYH B;  5GMK h;  2VAS A;  1VQ7 Q;  2DVJ A;  3QZ5 B;  1YI2 T;  2R5A A;  2DL8 A;  2QQ9 A;  2H8H A;  4XAX B;  4KUD K;  1S72 A;  2BIV A;  2X3W D;  3DB3 A;  4Z89 A;  1YJ9 A;  4M75 F;  2KNB B;  1RL2 A;  1NBE B;  2EVR A;  1S72 Q;  5CKH A;  4C92 F;  4B9X A;  1GCQ A;  1WGS A;  1YJ9 Q;  3RUX A;  3S3M A;  3BDL A;  1Q7Y U;  3EG9 A;  2HCK A;  2IPO B;  1N6A A;  1KQ2 A;  2PVO B;  4BI8 B;  3D7S B;  3JV3 A;  3C0C A;  3OYJ A;  5EC7 A;  2DO3 A;  3G7Z A;  4J9C A;  1VQ9 A;  2LJ0 A;  4DQ2 A;  1M2O A;  2DRM A;  2DL4 A;  3UT1 A;  1AWJ A;  1TS9 A;  2CP6 A;  3CD6 T;  1X2Q A;  2V1Q A;  5GAN 3;  2RK2 A;  2XHC A;  5GAN 6;  3EGD A;  4JS4 A;  1VQM T;  5I21 A;  2CP2 A;  2JT4 A;  5KCH A;  3G4S T;  3MEA A;  1WJS A;  2DPP B;  3O8V A;  1SRL A;  4OF1 A;  3U23 A;  4M7D B;  3LGF A;  4X9C A;  1D3B B;  2CP5 A;  3HPW A;  1MMN A;  5DY9 A;  3M4Y A;  4J9F A;  3MEV A;  2BE7 D;  4N4I A;  4M78 D;  2L0A A;  2DIL A;  2VKN A;  1I1J A;  3MP1 A;  2E64 A;  1WPY A;  1KQ1 A;  2ENM A;  2ED1 A;  4JZ4 A;  4M78 C;  1K76 A;  1B07 A;  3OSV A;  5AT1 B;  1WQW A;  3QSU A;  3CPF A;  2IIM A;  4OB0 B;  5J39 A;  1B7T A;  1D09 B;  2B86 A;  3VUZ A;  5GMK e;  2JZ2 A;  4E6R A;  1ZBX A;  2QGF B;  5HK0 A;  3EFR A;  3RDV A;  3OYN A;  4OMQ A;  4XTV A;  5GJW B;  2IG0 A;  4JJC A;  1K4U S;  4J83 A;  3GNF B;  1PG5 B;  2DET A;  2DXU A;  4KT0 E;  4C5G A;  1KC8 R;  3EFO A;  2CT3 A;  1SG5 A;  1PKS A;  1VOM A;  4D6W A;  3HSB A;  1WQ7 A;  5CQX A;  3OYK A;  3M55 A;  2H3J A;  5GMK l;  2PU9 B;  2DX1 A;  4B6M A;  2YLB A;  1JJ2 S;  1G3S A;  1XJW B;  2OJ2 A;  3X24 B;  1GFD A;  4FW2 A;  3VS6 A;  2YUN A;  2FYK A;  2QGG A;  4FT4 A;  3OW2 P;  2K2V A;  3HP9 A;  1VQN A;  1KC8 C;  1X6B A;  2EGE A;  3JB9 H;  1FMV A;  3VS4 A;  2A36 A;  1Q82 R;  4E7I A;  1O9S A;  2BUD A;  1ZBJ A;  2MF2 A;  2D8H A;  1I5O B;  3CCM A;  2MAM A;  2RJD A;  1QVP A;  1BBZ A;  2ROL A;  4C0G A;  5GAN 7;  3NFC A;  2QTX A;  4JJD A;  2E6Z A;  1VQ5 A;  2HNI A;  2QK0 A;  5LJ3 d;  3URG A;  3LW5 E;  1Q82 C;  3VS2 A;  5IH2 A;  4LUE A;  1VQ5 Q;  1VQ4 A;  1G83 A;  1K8A U;  1X27 A;  2BE9 B;  5C6S A;  4GLK A;  3MJX A;  4JRI A;  1UEB A;  3KFV A;  4QT7 A;  1NJI R;  4HVV A;  2I2L A;  1VQ4 Q;  3H8Z A;  2BTT A;  3QO3 A;  4R55 A;  3FLG A;  1VQO A;  4M77 B;  4V2S A;  2FZG B;  3PFS A;  2KR3 A;  3OW2 A;  5LJ3 f;  2YUO A;  4DBH A;  4M78 E;  3S3N A;  1AVZ C;  4N4G A;  4C8Q G;  1KHC A;  1D1C A;  1UJY A;  4J6Y A;  1VQO Q;  1M3A A;  2RB6 A;  4EMH A;  4BDY A;  2DE0 X;  1NJI C;  4E7H A;  2JW4 A;  4BY6 B;  3FJ5 A;  3QBY A;  3HHT B;  2PUK B;  2NYS A;  3JB9 G;  4JJN K;  3M59 A;  2ZPB B;  3NTH A;  1QWE A;  2LNV A;  3ZFJ A;  4PJO A;  1LCK A;  4MZT A;  5DLQ E;  1WJQ A;  1YHQ Q;  5GAN d;  2DLP A;  3CMA T;  4FL6 A;  3IQL A;  5KH6 A;  2X35 A;  2O31 A;  1CKA A;  5DM7 R;  4IIO A;  4M75 G;  4M4Z A;  2EYY A;  3L42 A;  1YBY A;  4CRI A;  4C92 G;  2EIF A;  4OML A;  2FPE A;  1Y96 A;  4WCI A;  3L2U A;  1B34 A;  1ZHI A;  3OYD A;  2M51 A;  1VQ8 Q;  4M7D E;  1NYG A;  1HYO A;  1TTH B;  2YT6 A;  1R77 A;  2KMT A;  1RAI B;  2QTV A;  1H3H A;  4M75 B;  5GAM d;  3EG0 A;  3EHQ A;  3L2Z A;  3GIB A;  1LOJ A;  4C92 B;  1I81 A;  1UHC A;  2ZPG B;  2CZ7 B;  3NMZ C;  5M9O A;  3JCM e;  3R6O A;  2EQM A;  3JCM c;  2M0O A;  4KH1 B;  2RF0 A;  2C0I A;  3CCS T;  2DEU A;  2VXE A;  2ZCF B;  3G71 A;  3M0Q A;  1K73 C;  1I4K 1;  4M78 F;  2A3L A;  4VUB A;  4M7A B;  3GLX A;  3RMQ A;  5GAM f;  3G71 Q;  4JS5 A;  3ULR B;  2F2X A;  4OP0 A;  3JAM E;  1M2V A;  4LN2 A;  2NUZ A;  5I2M A;  2FRW A;  1QKX A;  4RTZ A;  4ZTJ A;  3DKM A;  2KXC A;  2EWN A;  3FB9 A;  4X1V A;  2GTO A;  2QEX A;  8ATC B;  5GAN 4;  2NUT B;  3OYL A;  4ATO A;  2LDM A;  3CC2 T;  4X34 A;  4FM4 B;  3OYA A;  3RKY A;  4PKC C;  1WHM A;  2QEX Q;  1QVF S;  3G6E A;  1M1K R;  1K1Z A;  4C5E A;  2EJF A;  2WAC A;  1K9A A;  2O4X B;  2E10 A;  3A8G B;  3PT9 A;  2H3E B;  4XTU A;  4M7D F;  2KSS A;  1WXU A;  1YIT T;  1M5Q 1;  2RPN A;  3CQT A;  2RHX A;  2RH2 A;  3CCQ T;  3CC7 Q;  4HCB A;  3SEM A;  1M1K C;  1WHG A;  4J9G A;  3CCU T;  3A8O B;  2LP5 A;  3FJP A;  2OTJ Q;  4AG1 C;  2E6N A;  1KHI A;  1MMA A;  1HXD A;  3LYI A;  3EGU A;  3JCM J;  1U1T A;  3I9Q A;  4PJO D;  1AWO A;  1UGP B;  3OA6 A;  5KYU A;  1PD0 A;  3KUF A;  1YP5 A;  2COY A;  3QJY A;  2HD0 A;  9ATC B;  1SSH A;  4FW1 A;  4PJO C;  4M77 E;  2RM4 A;  2MWO A;  1WA7 A;  3OB9 A;  3V7R A;  1TSF A;  1M4Z A;  3NTK A;  3CPW P;  2F69 A;  4FYY B;  2G6F X;  1H8K A;  2R5M A;  3CCV T;  3M56 A;  1K0X A;  1WZO A;  2XG8 D;  2J6K A;  1GBR A;  3LX7 A;  4N0A A;  2LCL A;  2LTO A;  4IUT A;  2VGN A;  4AT1 B;  4DBF A;  2F1L A;  2QA4 Q;  2DIQ A;  1CSK A;  3I56 A;  1OV3 A;  3PIP A;  4QKU A;  3L2R A;  1VQ6 A;  1NZ9 A;  3PVQ A;  2RJE A;  1Y71 A;  1OEB A;  3M57 A;  1WIE A;  2PNI A;  3JB9 I;  1UTI A;  5KE2 A;  2OAU A;  1JQQ A;  1VQ6 Q;  1E6H A;  4AFQ C;  4BUG A;  1UG1 A;  2EYW A;  2AK5 A;  2FG0 A;  2Z0W A;  3PGG A;  4FSX A;  1C1A A;  1HSQ A;  4PFO A;  2M02 A;  3EG3 A;  2KQW A;  3C12 A;  1XNI A;  1JEG A;  2P0P A;  1BI0 A;  1OPK A;  2K57 A;  3M5A A;  1FWZ A;  3GBQ A;  2CYZ B;  3CPW A;  1VYV A;  5FU6 B;  2E5Q A;  2OI3 A;  1M3C A;  2K6D A;  2XID A;  2EYZ A;  4Z8A A;  1OZ3 A;  1XQH A;  5L8R E;  3I55 A;  2JMC A;  1V76 A;  1TWB A;  1NEB A;  2OTL A;  2MWP A;  4MMK A;  3UDC A;  2LQK A;  1K9M C;  4BI3 A;  1TXQ A;  1JJ2 P;  2OTL Q;  1PM3 A;  2PZ1 A;  1EX4 A;  4M77 F;  3M0U A;  1M8V A;  2DER A;  4HCZ A;  2ECZ A;  4FYX B;  3VS1 A;  2WSC E;  2RO0 A;  2M16 A;  4M7A E;  3BE3 A;  4ZGE B;  3OYE A;  1G3Y A;  2VGM A;  2M1H A;  3H0I A;  5GAO p;  3CCJ A;  1PNJ A;  4J8O A;  1TUD A;  1W2B S;  2XKO C;  1KQS S;  3J7A F;  5IHK A;  1PSF A;  1U3O A;  2DTI A;  4OB1 B;  2A37 A;  4NL2 A;  2DD5 A;  1VQL A;  4MZP A;  5CKB A;  4KUL A;  3FIF A;  1VQP A;  5GMK m;  2M0Y A;  5LJ3 h;  4JPB W;  3ZL7 C;  2AT1 B;  1VQL Q;  1VQ7 A;  2L3Q A;  3PIO A;  2QYZ A;  1ARK A;  1JJ2 A;  1VQP Q;  1TUC A;  3PNW C;  1VA7 A;  2R57 A;  2EQK A;  3P8D A;  1K0S A;  3A8L B;  2CGH A;  2C0T A;  1D0X A;  4M7D A;  4WF2 A;  1ZA2 B;  1YI2 Q;  2AKK A;  1Q86 R;  1KSW A;  1J3T A;  1MV3 A;  2YRC A;  2HEQ A;  4M78 B;  2O01 E;  4WTO B;  1EFN A;  2A28 A;  2A08 A;  3OYB A;  2A7Y A;  4D8D A;  5IHI A;  4LUD A;  4JRK A;  1QW1 A;  2CT4 A;  2JXB A;  5CKD A;  1YIJ T;  1X2K A;  2D1X A;  2HAX A;  3INZ A;  5D6Y A;  3ASK A;  2IVW A;  2JS2 A;  5CKF A;  1TH7 A;  4BDZ A;  4N0A C;  1Q86 C;  1S72 T;  2EQI A;  3A8H B;  2KGT A;  1YJ9 T;  3AHU A;  5GAN h;  4M7D G;  2W10 A;  4A4E A;  4M7A F;  1OUL A;  1DJ7 B;  2NLU A;  3CBO A;  2FRY A;  3FDR A;  2RJC A;  1YJN A;  4XU1 A;  2D0N A;  2JS0 A;  4MDW A;  1W1F A;  1AD5 A;  3HKS A;  1PRM C;  2K3X A;  3S3O A;  2E41 A;  1ZQ1 A;  1XTD A;  2KT1 A;  1YJN Q;  2W0Z A;  3CPW S;  1VQ9 T;  4AG2 C;  2L89 A;  2VVK A;  3WVD B;  1KC8 U;  1OYX A;  2CUD A;  1QQJ A;  1U06 A;  1M90 C;  2O9V A;  1VIF A;  1N9R A;  2OAW A;  3HFO A;  3QWY A;  3KXT A;  3VV0 A;  4FIB A;  4EMK B;  2DEQ A;  3JCM g;  5GAM h;  5L23 A;  2E4H A;  3P8B B;  1X6O A;  2PVD B;  1P92 A;  1SRM A;  4Q5W A;  3QZ9 B;  3J80 E;  2RN8 A;  2XDP A;  5CVI A;  1G5V A;  1YCS B;  2JTE A;  6AT1 B;  5LJ3 e;  2BKD N;  1Q82 U;  5HCK A;  1E6G A;  3VS5 A;  4LE9 A;  3X26 B;  3UAT A;  4C0D C;  2EKO A;  4F16 A;  3V8L A;  1IB8 A;  2XIC A;  4E7S A;  1RI9 A;  2DMO A;  4RKU E;  3VRY A;  1UGR B;  2KI7 A;  2HBP A;  2NUP A;  2XD0 A;  3DLM A;  3EG9 B;  1FYN A;  2LZ6 B;  3ZBD A;  4IUV A;  2F2V A;  2FZC B;  2ZPE B;  4BE0 A;  1OI1 A;  1RLQ C;  1Z9Z A;  1G3W A;  4RTX A;  1B3Q A;  2GNC A;  2QAZ A;  3F70 A;  3JCM P;  1NJI U;  3RKX A;  2RNA A;  1QCO A;  2KXD A;  2KYM A;  3M0S A;  2AIR B;  1NPP A;  2JUF A;  1Q7Y C;  1QVF P;  3OS2 A;  3CCE T;  3EGD B;  1UGS B;  1Q81 R;  2DZC A;  1F1B B;  1WYX A;  4HXJ A;  1OU9 A;  4FU6 A;  5GAN e;  2K4Y A;  5LJ5 h;  5KYW B;  1JU5 C;  5KYX B;  2CRE A;  3MP8 A;  1G8X A;  1JO8 A;  1V29 B;  2FPD A;  3OYC A;  3V8K A;  2OX7 A;  1MND A;  4PK4 A;  1PCX A;  3VS7 A;  1Q81 C;  3TCJ A;  2KK4 A;  2CP3 A;  2CP7 A;  4KGZ B;  2NWM A;  1UJ0 A;  5GJV B;  4LXC A;  4RUG A;  3DB4 A;  2LJ3 A;  4M77 G;  4C8Q A;  3TU4 K;  1VQN T;  1H3Z A;  3O5Z A;  2JOY A;  3V7C A;  2DAQ A;  4DA4 A;  1WHH A;  3QJ6 A;  4F7U E;  1GCQ C;  4BB7 A;  4QVC A;  4OMP A;  1QVF A;  3OMC A;  5GAM e;  4OMF B;  3CCM T;  3JCM Q;  3OMG A;  1X69 A;  5GMK i;  1IHW A;  3OQ5 A;  3TVT A;  5FWB A;  3PE0 A;  5CCA A;  3CCL A;  3NTI A;  1GFC A;  4QW2 A;  5KYY B;  3UF4 A;  1WXT A;  2DFU A;  2YXY A;  2QDY B;  3MEW A;  2DXB A;  4IUP A;  4M75 A;  5GAN 8;  1VQ4 T;  3CCL Q;  3CBP A;  2XDB A;  3EFO B;  4C92 A;  4HKE A;  2CKK A;  2C06 A;  2V1R A;  2LCS A;  3S6W A;  1YHQ A;  3EH1 A;  4EMG A;  4RTY A;  2FPF A;  5IHN A;  2QQA A;  3RIR A;  2DK3 A;  3FRN A;  3QDF A;  4E7K A;  2YLC A;  1VQO T;  1VQK A;  2J05 A;  5ECA A;  4EIK A;  5FU7 C;  1H92 A;  1VQK Q;  2K7A A;  4PJN A;  5GAO m;  2F5T X;  1QMC A;  3X20 B;  1HJD A;  2V8I A;  2E5K A;  1QCN A;  2GGR A;  4RG8 A;  1VQ8 A;  5GAN 5;  5A0D A;  3GP8 A;  3FC3 A;  1WJR A;  2X51 A;  1JBM A;  3I5R A;  4CC4 B;  4F04 B;  4LNP A;  2FEI A;  5LJ5 e;  3LH0 A;  1IRE B;  3CME A;  1D1A A;  3MO8 A;  3NPF A;  3JCM V;  1HD3 A;  1IGU A;  1KFZ A;  1EIF A;  4F14 A;  3CC4 A;  3CME Q;  4M7A G;  2RQR A;  3L2V A;  3EGX A;  2CZ6 B;  1K73 R;  1UGV A;  2RI5 A;  4F7U F;  2X4X A;  1M1K U;  2F5K A;  1FX7 A;  4HT9 A;  1EZZ B;  2P4T A;  3CC4 Q;  2X3X D;  1RAE B;  2GF7 A;  3SWN A;  4NL3 A;  3X25 B;  1ABQ A;  2O88 A;  2RHU A;  3REA B;  2D9T A;  1W70 A;  4AFZ C;  2VC8 A;  3KBG A;  1WXB A;  3PMT A;  1CKB A;  3PTA A;  3CCS Q;  1AHJ B;  2KVQ G;  3TRE A;  4LD9 K;  1W2B P;  4J9E A;  1RAB B;  1KQS P;  4A4H A;  2CSQ A;  1NM7 A;  3OYF A;  5GAO n;  3LWI A;  3BY7 A;  1QVG P;  3M4G A;  4PJO B;  1OZ2 A;  5GAN 2;  2DJQ A;  3CCR A;  4PLL A;  2Y4X A;  3G71 T;  4BY6 C;  2WSE E;  3QKJ A;  1ZSZ A;  2PTK A;  3HL8 A;  4C8Q D;  2JM9 A;  4IKF A;  3CCR Q;  2HKQ B;  3UPU A;  1OQK A;  3DLL A;  4RMO A;  1KG1 A;  1T3L A;  5I11 A;  2DTH A;  1KD1 R;  1Y96 B;  1I07 A;  4C8Q C;  1T0J A;  3JB9 D;  3H41 A;  4XU2 A;  4AFS C;  3RBB B;  4ELY C;  4HA8 A;  2CSI A;  2LJ1 A;  1ZSG A;  3VUB A;  4XTY A;  2FVU A;  5I2S A;  5FLX E;  2I0N A;  2SEM A;  4PFP A;  3CC7 A;  4RCB A;  5CKE A;  2QEX T;  3C95 A;  1FMK A;  2VV5 A;  2OTJ A;  1W2B A;  1KD1 C;  1KQS A;  2PUO B;  3LWH A;  4J6X A;  1G2B A;  1LVK A;  1YJW T;  5J3B A;  1QVG A;  1RUW A;  3G6E T;  2CH4 A;  1TOV A;  1PD1 A;  3THK A;  2JN0 A;  2QAS A;  1M3B A;  2LX7 A;  1AWW A;  4M75 C;  4KGX B;  2KRO A;  4C92 C;  4E7Z A;  3UA7 A;  1PWT A;  5FWC A;  2L3R A;  2KYB A;  3JCM d;  2KT8 A;  1Y0M A;  4LDU A;  5DLO A;  1JRI A;  2DXT A;  2CZ1 B;  4Y92 A;  1BI2 A;  1R0C B;  2RK1 A;  1M2V B;  5GMK j;  5GAO l;  5FRM A;  4GY5 A;  1SHG A;  1UHF A;  4J7I A;  1BU1 A;  1UGQ B;  4EDU A;  1LNX A;  4HVU A;  3RER A;  2QA4 A;  1UFF A;  3HRT A;  4KGV B;  3M9Q A;  4E47 A;  1MHN A;  1WX6 A;  2QG9 B;  1YCY A;  3RMS A;  1NLP C;  1ZLM A;  2EW3 A;  3JCM f;  3MKD A;  2DRK A;  3A1P A;  4BI4 A;  4QQD A;  2R58 A;  1SPK A;  2DKG A;  2EYQ A;  2EFI A;  2L5Q A;  4BD3 A;  3BDU A;  4GLM A;  1C0M A;  2ED0 A;  4DOW A;  4D8K A;  3T9N A;  4KBM B;  1OOT A;  5AYF A;  4ZN3 A;  5LJ3 g;  1YWO A;  4ESR A;  4OMN A;  1NEG A;  3X28 B;  4HCK A;  2P84 A;  3I56 T;  1VQ6 T;  1RI0 A;  3JRZ A;  3SWN C;  4KRT A;  2RQW A;  1K9M R;  3JCM X;  3L2W A;  3E19 A;  3I35 A;  2KEA A;  4LDX A;  3E9F A;  1N8R R;  2PQW A;  2V26 A;  2V8J A;  5KYU B;  4PJL A;  2YHT A;  2DYI A;  2BZ8 A;  2K3B A;  1IZ6 A;  4CI0 C;  1NYF A;  5D6W A;  3VKI A;  3GOX A;  1N8R C;  2RHZ A;  3A98 A;  1VYU A;  2EBP A;  2XMF A;  2CDT A;  1ZSZ C;  3PMI A;  1Q86 U;  4RTT A;  4JRQ A;  2YSQ A;  2A0F B;  5GAN g;  3I55 T;  2JM8 A;  3REB B;  1MNE A;  3Q1J A;  1M8M A;  4RTW A;  4M78 A;  2E1H A;  5EG2 A;  2OTL T;  2RD1 A;  2DTO A;  1H64 1;  2FO0 A;  5C0M A;  2JMA A;  2JTM A;  3GF5 A;  2GTJ A;  2ZZD A;  1ZUK A;  3A8M B;  1TG0 A;  4DOV A;  4ELZ C;  2KY9 A;  2ZPH B;  4PJO E;  4F7U G;  1IXD A;  2P0Q A;  4K11 A;  3HRU A;  1QVG S;  1KJW A;  4XTX A;  2GFU A;  2KDS A;  4AMC A;  3RR6 A;  3CEY A;  2QQB A;  1YWP A;  2HDA A;  2L2P A;  1SF9 A;  3OS5 A;  3ER0 A;  4M78 G;  1D0Y A;  3CCJ T;  3JCM W;  4PJM A;  5GAM g;  2HZY A;  4F7U B;  2EQJ A;  3QXE B;  3SD4 A;  2CP0 A;  1YI2 A;  1IGQ A;  2K79 A;  1VQL T;  4OB3 B;  2EPD A;  1JXM A;  1W6X A;  3EFS A;  1D3B A;  1VQP T;  4C5H A;  3VYG A;  3RES A;  1RAA B;  1VQ7 T;  4X9D A;  5FU6 C;  2LT1 A;  5IT9 E;  4EMK A;  4RG2 A;  2COW A;  1YIJ A;  1WHL A;  3V8J A;  4C5I A;  4C0D B;  4JZ3 A;  2VUB A;  3FEO A;  4OGC A;  2X4Y A;  3H0H A;  2LRQ A;  2VXF A;  4HVW A;  1MGQ A;  2K2M A;  1QP3 A;  1AOJ A;  1C6V X;  3LLR A;  3H0F A;  4OB2 B;  1U8R A;  1YIJ Q;  2D8J A;  3VS3 A;  2CZ0 B;  3WVE B;  1NG2 A;  4C0F A;  4XU0 A;  1M90 R;  3CD6 A;  3OSS C;  2FZK B;  1BI3 A;  1UE9 A;  4OVA A;  1VQM A;  4L59 A;  2E70 A;  2AZS A;  4PJO F;  4PLI A;  2YUP A;  3G4S A;  5LJ5 g;  1M1G A;  5HKC A;  3CD6 Q;  2HKN A;  2FL7 A;  3EH2 A;  4FYV B;  2MK5 A;  1VQM Q;  2KRM A;  2QXF A;  5D7U A;  3G4S Q;  1R0B G;  4OMO A;  5CK9 A;  1VQ9 Q;  1M1F A;  3QPH A;  1YJN T;  1SKU B;  1Q81 U;  1N9S A;  4PFZ A;  4JJB A;  2LC4 A;  2ZAE A;  2K5F A;  3TSZ A;  5KYW A;  3TQ7 P;  4N4H A;  1ZUY A;  5KYX A;  1BB9 A;  3OYY A;  2GQI A;  4J9I A;  4LDW A;  5GAO r;  1E7O A;  2DF6 A;  4BAC A;  2HSP A;  2AHJ B;  4GBQ A;  2RQV A;  3MPU B;  2MIO A;  1OU8 A;  1QWF A;  3CXC P;  2D0Q B;  5HY6 A;  1QLY A;  1QCF A;  5FRN A;  5HK3 A;  2P4R A;  1WHK A;  2FB7 A;  2E3I A;  4NS5 A;  4OGE A;  4YTL A;  1Q7Y R;  1G3T A;  3OYG A;  2C0O A;  2LX9 A;  1BYM A;  2GFA A;  2CUB A;  3MP6 A;  2DZ9 A;  1GCP A;  2K9G A;  1BKB A;  3M0T A;  4MML A;  3TSW A;  3E9G A;  1PSE A;  4RTU A;  3VRZ A;  4LDV A;  1BIA A;  4DBQ A;  1W4S A;  2YUQ A;  3JCM b;  3CCE A;  4KH0 B;  4FSS A;  1FXX A;  2YWW A;  4M77 A;  3VYH B;  5A2Q E;  4J5Y A;  5KYN A;  1Y07 A;  5KYY A;  2MCN A;  1V1C A;  1ZX6 A;  3AT1 B;  3CCE Q;  3SDZ A;  1BK2 A;  1X43 A;  1QKW A;  2ROT A;  3MET A;  5FU7 B;  4M7D D;  1UDL A;  2QI2 A;  2DM1 A;  2E65 A;  4MDX A;  1VYT A;  2LQ8 A;  3OYM A;  3CXC A;  5A0L A;  1MMG A;  4E7J A;  1WFW A;  3OY9 A;  4ME7 A;  2DNU A;  4E7L A;  3HFN A;  2RJF A;  4M7D C;  4HCC A;  1WNL A;  3TEE A;  2CH4 W;  3JSC A;  1I8F A;  3NGP A;  1BIB A;  2Y4Y A;  4NOY A;  3C94 A;  1RAF B;  4Z02 A;  2RI2 A;  4ORZ A;  2J6F A;  2KRS A;  4QQG A;  1AZE A;  5FRO A;  4EMK C;  3WXM B;  2EGA A;  4CC7 A;  1VQN Q;  4ZTF A;  1AWX A;  1M27 C;  2HQE A;  3OYH A;  4L6V 5;  4QVZ A;  2RHY A;  4JLI A;  4JUV A;  3JCM h;  1QP2 A;  2NUP B;  2MYS A;  1VQ5 T;  5CO7 A;  2GCX A;  4ZGD B;  2JNG A;  4A53 A;  3CCM Q;  2O2O A;  1SHF A;  3N5B B;  1O75 A;  1RAD B;  3VS0 A;  1K73 U;  4J7F A;  2LNH B;  1N5Z A;  5IN1 A;  5IXB A;  4RCC A;  1PHT A;  4QQ6 A;  4LD6 A;  2MPX C;  2JTF A;  4A4G A;  1MMD A;  4R56 A;  3R6N A;  4DEX A;  2LQW A;  1RAH B;  3OBY A;  1WI7 A;  1X6G A;  3ME9 A;  1A0N B;  1T3S A;  4L5G A;  3CCL T;  3I5S A;  2E12 A;  1I0C A;  3CMA A;  4XTW A;  1ZUU A;  1PRL C;  3H6Z A;  3LH5 A;  1IO6 A;  1TUG B;  2XDD A;  2RHI A;  3EAE A;  4M7A A;  2HSE B;  4XTZ A;  3SFM A;  3CMA Q;  1YHQ T;  2DBK A;  2V8K A;  1VUB A;  4IUR A;  1MUZ A;  4C0Z A;  1VQK T;  2LMJ A;  3OS0 A;  2KRN A;  1N27 A;  3RNJ A;  5KE3 A;  2G3R A;  4C8Q B;  2X9H A;  5IXF A;  2D6F A;  2K5I A;  4KUI A;  3EG2 A;  3QHS A;  2NUT A;  3M58 A;  3ZEH A;  1KD1 U;  4XK8 E;  2X4J A;  1FMW A;  1K8A R;  1VQ8 T;  3OYI A;  4BE2 A;  1I5L A;  4F17 A;  1LPL A;  5GAN f;  3HTR A;  5CR2 A;  2ZPF B;  5KCO A;  4PJO G;  3CCS A;  5GAO q;  2O4X A;  3A5Z B;  3CME T;  2QQR A;  4M77 D;  2LQN A;  2DIG A;  1M9S A;  1WHJ A;  1K8A C;  3VJP A;  3CC4 T;  2BZY A;  3L1A A;  2DD4 A;  5CAI A;  4II1 A;  4IUQ A;  4M77 C;  4Y91 A;  3HRS A;  1U5S A;  3QWX X;  1D1B A;  1GBQ A;  1OPL A;  4OMM A;  4J9H A;  4FCY A;  3CXC S;  1VIE A;  3H9N A;  1PKT A;  2O9S A;  3C4S A;  4A63 B;  1NLO C;  3EG1 A;  1ACM B;  2EJG A;  1Z9Q A;  1ABO A;  2DL5 A;  1JXO A;  1GXI E;  1AZG B;  1UB4 A;  3VU3 C;  4CC2 A;  3CC2 A;  2DA9 A;  3SHW A;  2K5L A;  2E3H A;  2DL7 A;  2MI6 A;  2WSF E;  1B34 B;  3CC2 Q;  3CCR T;  3MCA B;  2K3Y A;  2BZX A;  3QUI A;  1MV0 B;  1HK9 A;  2RQU A;  4XQ3 A;  3V7S A;  2LT4 A;  3G1J A;  1KK7 A;  2MMP A;  2EGC A;  1YFN A;  1YIT A;  4MZM A;  5D6X A;  4Z88 A;  3CCQ A;  3EGX B;  3GPL A;  1YJW A;  3M54 A;  4M75 D;  4AFU C;  2LCC A;  3CCU A;  5LJ5 d;  1PC0 A;  1S1N A;  4C92 D;  1YIT Q;  2HQX A;  2J06 A;  3CCQ Q;  4B9W A;  1AEY A;  3SWN B;  1YJW Q;  4DBR A;  1R8O B;  2CS7 A;  3CCU Q;  3G6E Q;  2XK0 A;  3OW2 S;  4PNO A;  3CC7 T;  1GL5 A;  2HL3 A;  2DJZ A;  5CIU A;  2HL5 C;  2L3S A;  1RAG B;  2OTJ T;  5LJ3 j;  4LDY A;  4IUU A;  3OBW A;  1K9M U;  2M9U A;  4M7A D;  3NHN A;  1N8R U;  5LJ5 f;  2RQT A;  3CBM A;  7AT1 B;  1ZA1 B;  2AKL A;  2XI9 A;  3E2U A;  2Y90 A;  4JDS A;  4P5N A;  3JB9 J;  3SB2 A;  4M7A C;  3CCV A;  2VWF A;  1UUE A;  2J6O A;  2EQU A;  3J81 E;  4O6J A;  1ZSZ B;  3BW1 A;  2MOX A;  1YN8 A;  2AZV A;  1Y7X A;  4R0K A;  3E1S A;  8AT1 B;  3CCV Q;  3QYG B; 
#chains in the Genus database with same CATH homology
 1W6X A;  2KYM A;  2YT6 A;  4IIM A;  3M0S A;  5FW9 A;  1Y57 A;  1H3H A;  3EG0 A;  1WYX A;  3EHQ A;  4HXJ A;  1WLP B;  1UHC A;  3UA6 A;  1JU5 C;  3NMZ C;  1M30 A;  4JZ3 A;  2GBQ A;  2CRE A;  3H0H A;  3EHR A;  4HVW A;  2K2M A;  1JO8 A;  1AOJ A;  2FPD A;  2RF0 A;  2C0I A;  3H0F A;  1KIK A;  2EYX A;  1UEC A;  2J7I A;  1WDX A;  2D8J A;  3VS3 A;  3VS7 A;  1RLP C;  3M0Q A;  2KE9 A;  1NG2 A;  2NWM A;  1UJ0 A;  5GJV B;  4RUG A;  4DEY A;  2LJ3 A;  2HBW A;  2ESW A;  3O5Z A;  3ULR B;  2F2X A;  1UE9 A;  3M0R A;  4LN2 A;  2DL3 A;  2AZS A;  1GCQ C;  2NUZ A;  2YUP A;  5I22 A;  4OMP A;  2FRW A;  4J9D A;  1QKX A;  4RTZ A;  2SRC A;  2KXC A;  2KRM A;  1X69 A;  1T0H A;  4X1V A;  3PVL A;  2GTO A;  3TVT A;  5FWB A;  4OMO A;  3PE0 A;  1GFC A;  3UF4 A;  1WXT A;  2EKH A;  4JJB A;  1K1Z A;  4RTV A;  1XOV A;  3TSZ A;  1K9A A;  2V1R A;  2LCS A;  1ZUY A;  2QDL A;  4RTY A;  2FPF A;  2RMO A;  1BB9 A;  5IHN A;  2GQI A;  4J9I A;  2F2W A;  1E7O A;  2J05 A;  1WXU A;  4J9B A;  2DF6 A;  2HSP A;  5ECA A;  2RPN A;  3CQT A;  4EIK A;  2ABL A;  4GBQ A;  4ZNX A;  2RQV A;  2DBM A;  3SEM A;  2MIO A;  4J9G A;  1H92 A;  1QWF A;  2LP5 A;  4AG1 C;  1QLY A;  2K7A A;  1QCF A;  2P4R A;  3EGU A;  1HJD A;  2E5K A;  1YNZ A;  2GGR A;  3M0P A;  2C0O A;  3I9Q A;  1AWO A;  2L3P A;  1SEM A;  3I5R A;  1YP5 A;  2CUB A;  4CC4 B;  4LNP A;  2FEI A;  1SSH A;  1GRI A;  1GCP A;  2K9G A;  3TSW A;  3M0T A;  2DYB A;  4RTU A;  3VRZ A;  2YUQ A;  1WA7 A;  2KBT A;  4FSS A;  3NPF A;  1HD3 A;  1KFZ A;  4F14 A;  2G6F X;  2RQR A;  1V1C A;  1H8K A;  2MCN A;  4CC3 A;  1ZX6 A;  1UGV A;  1K0X A;  1BK2 A;  1X43 A;  2YDL A;  2J6K A;  1GBR A;  2DVJ A;  1QKW A;  2ROT A;  2DL8 A;  2H8H A;  2X3X D;  1ABQ A;  1UDL A;  1CSK A;  2O88 A;  1OV3 A;  2DM1 A;  3REA B;  1VYT A;  1W70 A;  2X3W D;  4AFZ C;  1WFW A;  4Z89 A;  2DNU A;  3PVQ A;  1WXB A;  1CKB A;  2KNB B;  1OEB A;  1WIE A;  2PNI A;  2EVR A;  2CH4 W;  1UTI A;  3NGP A;  4J9E A;  1GCQ A;  1JQQ A;  1E6H A;  4AFQ C;  1UG1 A;  2CSQ A;  1NM7 A;  2EYW A;  2AK5 A;  2FG0 A;  4ORZ A;  2J6F A;  2KRS A;  1AZE A;  1HSQ A;  2EGA A;  4CC7 A;  2HCK A;  2DJQ A;  3EG3 A;  1AWX A;  1M27 C;  3JV3 A;  3C0C A;  5EC7 A;  1JEG A;  4J9C A;  1OPK A;  2LJ0 A;  3GBQ A;  1JXM A;  2PTK A;  1VYV A;  2JM9 A;  2OI3 A;  2DRM A;  2DL4 A;  1M3C A;  2K6D A;  2EYZ A;  4Z8A A;  2O2O A;  1AWJ A;  1SHF A;  1T3L A;  5I11 A;  1X2Q A;  2V1Q A;  1I07 A;  1T0J A;  2JMC A;  3H41 A;  1NEB A;  3VS0 A;  2JT4 A;  2LNH B;  4AFS C;  1N5Z A;  3RBB B;  5IXB A;  1PHT A;  2CSI A;  2LJ1 A;  1ZSG A;  1SRL A;  3U23 A;  2I0N A;  2SEM A;  3R6N A;  4DEX A;  2LQW A;  2PZ1 A;  1FMK A;  1WI7 A;  1X6G A;  1A0N B;  3M0U A;  1T3S A;  4J9F A;  3I5S A;  1I0C A;  2ECZ A;  3VS1 A;  1ZUU A;  1PRL C;  1G2B A;  2L0A A;  3LH5 A;  1IO6 A;  2DIL A;  1RUW A;  2CH4 A;  2VKN A;  1I1J A;  3THK A;  1M3B A;  2LX7 A;  1AWW A;  2ENM A;  3H0I A;  2DBK A;  2ED1 A;  4JZ4 A;  1PNJ A;  1K76 A;  2KRO A;  1TUD A;  1B07 A;  1MUZ A;  3UA7 A;  1PWT A;  2LMJ A;  5FWC A;  5IHK A;  2KRN A;  3RNJ A;  1U3O A;  2IIM A;  2A37 A;  2KYB A;  2KT8 A;  1Y0M A;  2B86 A;  5IXF A;  4E6R A;  4Y92 A;  2M0Y A;  3EG2 A;  4JPB W;  3ZL7 C;  1SHG A;  1UHF A;  2L3Q A;  1BU1 A;  1ARK A;  4HVU A;  4OMQ A;  5GJW B;  4JJC A;  1UFF A;  1K4U S;  4F17 A;  1TUC A;  1VA7 A;  1WX6 A;  2CT3 A;  1K0S A;  1NLP C;  1PKS A;  1ZLM A;  2EW3 A;  2C0T A;  2DRK A;  2LQN A;  2AKK A;  2DX1 A;  1SPK A;  1KSW A;  1J3T A;  1MV3 A;  2OJ2 A;  2HEQ A;  1GFD A;  3VS6 A;  2YUN A;  1EFN A;  2BZY A;  2A28 A;  4GLM A;  2A08 A;  2ED0 A;  4D8K A;  4D8D A;  5IHI A;  4LUD A;  2CT4 A;  1X6B A;  2EGE A;  1OOT A;  2JXB A;  1U5S A;  1YWO A;  3QWX X;  1X2K A;  2D1X A;  4ESR A;  1GBQ A;  4OMN A;  1OPL A;  1NEG A;  2A36 A;  2JS2 A;  4J9H A;  4OMM A;  3VS4 A;  4HCK A;  1PKT A;  2O9S A;  1ZBJ A;  4A63 B;  1NLO C;  2EQI A;  3EG1 A;  2D8H A;  2KGT A;  4KRT A;  2RQW A;  1Z9Q A;  1ABO A;  1BBZ A;  2ROL A;  3I35 A;  2KEA A;  2DL5 A;  2W10 A;  4JJD A;  1JXO A;  1AZG B;  4CC2 A;  2DA9 A;  2FRY A;  2D0N A;  2JS0 A;  3VS2 A;  3SHW A;  1W1F A;  5IH2 A;  1AD5 A;  4LUE A;  2DL7 A;  1G83 A;  2BZ8 A;  2K3B A;  1PRM C;  1X27 A;  2BZX A;  2KT1 A;  1NYF A;  1MV0 B;  2RQU A;  2W0Z A;  3KFV A;  4QT7 A;  4AG2 C;  4HVV A;  2VVK A;  2CUD A;  3A98 A;  2BTT A;  1VYU A;  1U06 A;  2EBP A;  2XMF A;  2O9V A;  2EGC A;  2CDT A;  2KR3 A;  2YUO A;  2OAW A;  4RTT A;  4Z88 A;  2YSQ A;  3QWY A;  4AFU C;  1AVZ C;  1UJY A;  2JM8 A;  3REB B;  1M8M A;  4RTW A;  1M3A A;  5L23 A;  1S1N A;  2DE0 X;  2FO0 A;  2JMA A;  2J06 A;  1AEY A;  1SRM A;  2JW4 A;  3FJ5 A;  2GTJ A;  1ZUK A;  2RN8 A;  1TG0 A;  1YCS B;  2JTE A;  1GL5 A;  5HCK A;  1QWE A;  2L3S A;  1LCK A;  1E6G A;  4K11 A;  4LE9 A;  3VS5 A;  3UAT A;  4F16 A;  2DLP A;  1KJW A;  3IQL A;  2O31 A;  1RI9 A;  2DMO A;  3NHN A;  3VRY A;  1CKA A;  2RQT A;  1YWP A;  2HDA A;  2L2P A;  4IIO A;  2AKL A;  1FYN A;  2LZ6 B;  4M4Z A;  2EYY A;  2F2V A;  4OML A;  2FPE A;  2VWF A;  4WCI A;  1UUE A;  2J6O A;  1RLQ C;  1Z9Z A;  2MOX A;  1YN8 A;  2AZV A;  4RTX A;  1B3Q A;  2GNC A;  2K79 A;  2M51 A;  4R0K A;  1NYG A;  2RNA A;  2KXD A;  2EPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...