1PHTA

Phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain, residues 1-85
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
AEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of P13K SH3 domain at 20 angstroms resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphotransferase
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1995-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1phtA00
2EYXA 2BZXA 4A63B 2KXCA 4HVWA 1N5ZA 1X27A 2J6OA 3QWXX 2J6FA 2CT3A 3EGUA 1VYVA 1QKWA 4J9GA 4CC7A 1YNZA 2FPFA 1T3SA 1WXBA 4GLMA 2OI3A 4LUEA 2EBPA 2FPDA 1WYXA 2AKLA 4RTVA 2O31A 2YUNA 1JXOA 1WXTA 1ZBJA 3UA6A 2AK5A 2LQWA 1YWPA 2GNCA 2KXDA 1IO6A 2F2XA 1JO8A 4JJBA 2VKNA 3UATA 1RUWA 2P4RA 5FW9A 2YDLA 2KRMA 2DX1A 2JTEA 1OEBA 3EHRA 4J9HA 3VS7A 2EKHA 1VYUA 2NUZA 4LUDA 5HCKA 5I11A 1H3HA 2EGAA 5GJVB 2CSIA 4DEXA 1WI7A 2D8JA 4HVUA 2OAWA 2W10A 2MOXA 2JT4A 2KT1A 1WXUA 1NG2A 1OOTA 1OPLA 2ESWA 2KBTA 3NGPA 4AG1C 2CREA 1UJYA 1X43A 5GJWB 1B3QA 2B86A 2EQIA 1XOVA 2O9VA 2RQUA 2KYBA 1WFWA 1AWOA 2RQWA 1E6GA 1UGVA 1PKSA 2A08A 2JMCA 2KEAA 2W0ZA 2CT4A 3VRZA 3VS6A 1AOJA 4JJCA 2V1QA 1K9AA 1MV0B 4RTYA 2GQIA 2EGCA 2HDAA 2J06A 4RTWA 4Z8AA 4LN2A 2K6DA 1AWWA 5FWCA 2JW4A 2ED0A 4IIOA 1JU5C 1UFFA 3UA7A 1UECA 2DILA 1M30A 3NPFA 3NMZC 2HBWA 2GTJA 2EW3A 1GBRA 1AEYA 2K3BA 4HCKA 1SHFA 2L2PA 2LX7A 3VS0A 2GGRA 1SPKA 3VS3A 1GFCA 1ZSGA 1K0XA 1BK2A 3UF4A 3LH5A 1T0HA 4F16A 1H92A 1NYGA 2AZVA 2K79A 1ZUYA 2O9SA 1JQQA 1TUCA 4QT7A 1M3AA 4ESRA 2QDLA 1QCFA 1ABOA 2AZSA 2DL5A 3I9QA 1V1CA 3IQLA 2F2WA 2DLPA 2BTTA 2RQRA 2KR3A 4AFQC 3VS4A 2ABLA 3VS2A 1UTIA 1SRMA 2NWMA 3M0TA 2GBQA 5L23A 1UUEA 2DNUA 4AFUC 3M0SA 2O2OA 2DMOA 1ABQA 2LJ1A 1T3LA 5I22A 2CUDA 2YUOA 2BZ8A 1UJ0A 2LP5A 1M27C 1Y0MA 2ECZA 1NEGA 1AVZC 2DE0X 2JM8A 2YUPA 1ARKA 3M0PA 2AKKA 1I0CA 1K76A 2MCNA 1JEGA 3M0RA 2X3WD 1VA7A 4Z88A 4DEYA 2RN8A 4RTTA 2LCSA 3U23A 3CQTA 2D0NA 1UDLA 5EC7A 3I5RA 1AWXA 3VS1A 1GCQC 2C0OA 1K1ZA 2FO0A 1G2BA 1Y57A 2CDTA 1K4US 1Z9QA 2K9GA 1Z9ZA 3REBB 3PVLA 4OMOA 2V1RA 4Y92A 1PNJA 2HCKA 1U06A 2M51A 2CH4W 3M0UA 2E5KA 2OJ2A 2EVRA 4GBQA 4K11A 2DL4A 1BB9A 2DVJA 3THKA 4JZ3A 3EG1A 3I5SA 5IH2A 1HSQA 2LJ0A 2MIOA 3QWYA 3H41A 1MV3A 1W6XA 4J9IA 1NLPC 4OMMA 2FPEA 1SEMA 1NYFA 1CSKA 1T0JA 1YCSB 2A36A 1PRLC 1ZUUA 3TVTA 2H8HA 4EIKA 2HSPA 2LZ6B 3RBBB 1YN8A 3KFVA 2JM9A 4HXJA 2CUBA 2KGTA 1X2QA 5IHNA 3M0QA 1E7OA 1SHGA 4J9DA 1B07A 1WX6A 2EPDA 1PWTA 2RNAA 2VVKA 4RTUA 1X6BA 4J9FA 1GL5A 4WCIA 1A0NB 3A98A 1NM7A 2DJQA 2PNIA 2YT6A 2KE9A 1SRLA 2DBMA 2YUQA 1K0SA 2SRCA 1J3TA 2X3XD 1MUZA 2HEQA 1BU1A 1HJDA 1W70A 4AFSC 3I35A 1TG0A 1M8MA 1OV3A 2JXBA 1UHCA 3PVQA 1SSHA 2KYMA 4OMQA 1TUDA 1PKTA 1ZLMA 4F17A 2KNBB 2YSQA 1LCKA 2ROLA 2RPNA 2LQNA 1H8KA 2A37A 2EYZA 1UE9A 2DL3A 1ZX6A 4OMLA 3ULRB 1AD5A 1X2KA 1NLOC 4J9BA 2EYYA 2K2MA 4IIMA 2G6FX 2DL8A 2CSQA 2DRMA 2EGEA 4OMPA 5IHIA 3SEMA 1FMKA 1CKAA 4CC3A 1AZGB 1UHFA 2XMFA 1KFZA 2EYWA 1GBQA 2K7AA 2RF0A 3EG0A 2A28A 2LMJA 3H0IA 2KROA 3GBQA 2JS0A 2L0AA 3C0CA 2D1XA 3TSWA 1BBZA 4JPBW 4Z89A 2ROTA 2FG0A 4E6RA 3VRYA 2F2VA 4R0KA 1QLYA 2DYBA 3REAB 1E6HA 4M4ZA 3NHNA 2C0TA 2JS2A 2KT8A 1GFDA 1HD3A 4JJDA 2SEMA 1NEBA 5IHKA 1U5SA 2D8HA 4ORZA 4CC4B 1VYTA 3EHQA 3JV3A 1M3BA 1EFNA 2ED1A 2GTOA 2VWFA 3EG2A 4RUGA 4AG2C 2C0IA 2I0NA 4D8KA 4J9EA 1KJWA 2CH4A 2J05A 4KRTA 3TSZA 1W1FA 1G83A 1I07A 1I1JA 1X6GA 2PTKA 5ECAA 3H0HA 3RNJA 3FJ5A 1PHTA 2L3SA 4X1VA 4CC2A 3ZL7C 5FWBA 2RQTA 2DA9A 1KIKA 1RLPC 2JMAA 3VS5A 1OPKA 2L3PA 1U3OA 5IXFA 2FRWA 4J9CA 1GCQA 1QKXA 1QWFA 1X69A 2O88A 2L3QA 4JZ4A 4HVVA 2FEIA 2RQVA 1YWOA 1YP5A 2LNHB 1CKBA 1GRIA 1S1NA 2IIMA 1FYNA 5IXBA 4D8DA 1PRMC 2KRSA 2DL7A 2J6KA 2M0YA 2ENMA 1WA7A 1WDXA 2BZYA 3SHWA 2DM1A 1JXMA 1RLQC 2FRYA 4LNPA 1ZUKA 3PE0A 2LJ3A 1UG1A 2DF6A 4RTXA 2DRKA 4AFZC 3H0FA 2RMOA 2DBKA 2J7IA 1GCPA 4RTZA 4F14A 1AZEA 1QWEA 4LE9A 1WLPB 1RI9A 3R6NA 2PZ1A 1KSWA 4ZNXA 1M3CA 3EG3A 1WIEA 2KRNA 4FSSA 3O5ZA 4OMNA 1AWJA
chains in the Genus database with same CATH superfamily
5KCHA 3L2QA 2EYXA 2Y4XA 3CC7T 2B8AA 2VXFA 3CCRT 2HMAA 4A63B 2KXCA 4HVWA 4M75A 2CT3A 4J9GA 1QKWA 4CC7A 4KBMB 5A0GA 3CCVT 4ZGJB 4C8QG 3OW2S 4MMKA 2H3EB 4V2SA 4VUBA 3Q1JA 1UGPB 4OB3B 4EMHA 1VQ9Q 4KULA 1BI0A 4RTVA 2XICA 2O31A 2QTXA 2M1HA 1WXTA 5FLXE 3SWNB 3S3MA 2LQWA 1YWPA 2GNCA 1JO8A 3DLMA 4XK8E 1BI2A 2VKNA 4FT4A 3UATA 2RK2A 4XU0A 1VQ7A 3QJYA 2JTEA 1OEBA 3EHRA 2PQWA 5CIUA 2EKHA 1VQ4Q 2NUZA 5A0DA 1VQ5A 4B9XA 2RI5A 2XG8D 1W2BS 1H3HA 1Y71A 5GJVB 1O75A 4HVUA 3MEAA 1ZQ1A 2XKOC 2MOXA 2JT4A 1KC8C 1NG2A 4B9WA 3OYYA 2I2LA 2KDSA 4AG1C 1X43A 1B3QA 5IT9E 3VKIA 1QVGA 4QVCA 3LX7A 4FIBA 1KC8R 4IUUA 1RI0A 2KYBA 2HL5C 5GAOr 2CS7A 3LWIA 4Z02A 1PKSA 2A08A 2JMCA 2OX7A 5CKFA 3OYGA 4GY5A 1NZ9A 3V7CA 4M75D 1AOJA 2OTJT 2EJFA 1YHQQ 3JB9I 4RTYA 1QVFP 2GQIA 5CK9A 1M8VA 1VQ7Q 2FL7A 1NBEB 3MHXA 3EFOB 1JU5C 5DLOA 1UECA 3META 2DILA 3NPFA 5GAOq 3CC2T 4MZMA 5GAOp 2L2PA 3M55A 2YRDA 2HL3A 1GFCA 1BI1A 1ZSGA 2RO0A 1K0XA 2F69A 3JB9J 3UF4A 1T0HA 3PNWC 4EPCA 1QP3A 2K79A 1ZUYA 1JBMA 1JQQA 1TUCA 1VUBA 1QVPA 4QQDA 3GNFB 4OB1B 1FXXA 4RMOA 1FX7A 2XDBA 2RH2A 1WGSA 1V1CA 2M9UA 2L3RA 1H3ZA 1QW1A 1TXQA 3VS4A 2JUFA 2GBQA 1UUEA 2QQSA 1VQ5T 2DNUA 2DMOA 2K5LA 3WVEB 3OYIA 5FU7C 1P92A 4QQ6A 2EAYA 2AHJB 1XQHA 2M02A 3LGFA 4OGEA 2ECZA 4M7AA 1I4K1 1WHGA 2YUPA 4ZN1A 2HQHA 2MK5A 4C5GA 2AKKA 1M1KC 3EFRA 3CCLA 1VA7A 4A4EA 2RN8A 2OTLA 1XTDA 3FC3A 2QEXA 3U23A 4N4IA 1UDLA 5EC7A 5LJ5d 3BFMA 1AWXA 3MO8A 4L5GA 3C95A 1GCQC 4XQ3A 5I21A 1MGQA 2CDTA 1K4US 3QSUA 1WHKA 2K9GA 4JLIA 4OMOA 2R5AA 2DD4A 2HCKA 1Q82U 2M51A 3OBYA 2L8DA 3EGDB 2E5KA 2OJ2A 4BUGA 3H9NA 4GBQA 3BDLA 3I56Q 1BB9A 2DVJA 3THKA 3EG1A 2QAZA 3OYBA 3NTKA 3CCEQ 3HPWA 2MIOA 1K8AU 1OX9A 3H41A 1W6XA 3HRTA 2D0QB 4J9IA 1SSFA 3CPWA 1TU0B 2FPEA 2QYZA 3MEVA 3CCLQ 5GAN5 1CSKA 1RADB 1PRLC 2H8HA 1R8OB 2VXEA 1VQPA 2O4XA 3QIIA 2JM9A 3OYMA 2BUDA 2V8JA 1NPRA 3JCMf 5LJ3e 1E7OA 4XTYA 2QQBA 1KQSS 1D0YA 1TUGB 3C12A 4FCYA 4J9FA 1N8RC 1GL5A 3A98A 5CKHA 4A4FA 5GANg 4FU6A 2YT6A 2E12A 4EMKB 1Q81U 5D6XA 1K0SA 2HKNA 2XI9A 1J3TA 2RHIA 1Q7YC 1BU1A 2COYA 5DY9A 4C8QD 4KGZB 1C1AA 3I35A 1QVGP 3CD6Q 1B34B 2ZPHB 3LWHA 5IN1A 2HSEB 2RI2A 1ZLMA 2KNBB 1QMCA 3RMQA 2RPNA 4FM4B 3I55Q 2E10A 3MP1A 2KI7A 5DM7R 4P5NA 1X2KA 4J9BA 2EYYA 2JVVA 2K2MA 2DL8A 2EGEA 3SEMA 1IB8A 4M7AC 2Y90A 3CCQT 2AT1B 4J7FA 2E1HA 1V29B 4M75E 1EX4A 2K7AA 9ATCB 1D09B 4BACA 1UGQB 2A28A 2RHUA 2EJ9A 1AHJB 2JS0A 2Z0WA 2HZYA 1M4ZA 4ELZC 4JPBW 1VQOQ 3UPUA 2FG0A 2F2VA 1QLYA 3QBYA 2HQEA 1E6HA 1Q95G 2LTOA 2C0TA 2JS2A 1RAHB 4KH1B 3VJPA 3QPHA 5IHKA 1U5SA 2E64A 2D8HA 2FYKA 5HKCA 3UDCA 3LYIA 2GTOA 2I0NA 2EQKA 3PFSA 1YIJA 4XU3A 3TSZA 1I07A 4M78C 3CCUT 3X28B 5ECAA 5FU6C 3H0HA 1EZZB 5IAYA 1VQ5Q 2DZ9A 4M7AD 3VS5A 1QCNA 2DFUA 3CCMQ 2KQWA 2MWPA 1OPKA 4M75F 1WJQA 2L3PA 2FRWA 2K2VA 3HHTB 5KYXB 3URGA 1QWFA 2FVUA 3M54A 2L3QA 4A4KA 4FYWB 2RD1A 4MMLA 1PM3A 3M4GA 2D9TA 4QVZA 5GMKj 3J80E 2PVOB 1CKBA 2E70A 1S1NA 4A4HA 2E3HA 4CRIA 1VQMQ 2DL7A 4M78F 3CXCS 2DYIA 2JNGA 3CC4A 1IXDA 3RIRA 4DBFA 1WDXA 2X9HA 3SHWA 2DM1A 2FRYA 1RAGB 2QXFA 4KGVB 2DRKA 4RTZA 4LXCA 3OQ5A 3R6NA 2PZ1A 2LT1A 1KD1R 3G6EA 1BKBA 4M75C 4DQ2A 4OMNA 4XTXA 3QO3A 1Y07A 4XTVA 2BZXA 1N5ZA 2HKQB 1YNZA 2FPFA 4XTZA 3VV0A 1T3SA 4GLMA 1YFNA 3MP6A 4M78G 3SFMA 3FJPA 2DO3A 1YITA 2FPDA 2QGFB 3V7SA 2CZ7B 1BIBA 1RAEB 3WXMB 1JXOA 2RB6A 1RAFB 3DLLA 2E5QA 1QQJA 2YHTA 3OYFA 1RUWA 5FW9A 2KRMA 4OVAA 3VS7A 5HCKA 3TQ7P 5HK0A 1NJIU 2DJZA 2EGAA 4M7DA 2HD0A 2CSIA 3QDRB 2P0KA 4DEXA 1K73C 1V76A 1X6OA 2HQXA 4JJNK 3S6WA 5KYNA 2KT1A 4E7LA 2KAFA 2QQ9A 3OS0A 1OOTA 4A53A 1OPLA 2KBTA 1G3TA 2R58A 3A5ZB 3TCJA 2O9VA 2JTMA 2KY9A 2X51A 4JUVA 4E7HA 1G3SA 3CEYA 2KEAA 5GANf 2W0ZA 5LJ5g 5GMKh 4HT8A 1ZHIA 1K9AA 2DXTA 4N4GA 3GF5A 3RMSA 3CMAT 3LH0A 3JB9H 4BDZA 4Z8AA 4LN2A 4C5EA 2K6DA 3OBWA 3A8MB 3A1PA 1UFFA 2DERA 2ZPIB 3UA7A 4LDXA 1N8RU 1M30A 5CQXA 3NMZC 2HBWA 3BY7A 1Q81C 1SHFA 2LX7A 3JRZA 2GGRA 4M77G 1YI2T 4F7UE 1BCOA 4BI8B 1BK2A 1OI1A 3LH5A 3S3OA 3P8DA 5FU7B 1NYGA 2AZVA 4J83A 1PCXA 3L2RA 2O9SA 8ATCB 1MMAA 1TWBA 4QT7A 1M3AA 4ESRA 4HKEA 3RDVA 3PMIA 1ABOA 3DB3A 3I9QA 3PGGA 2RHXA 2F2WA 3T9NA 4E7SA 2BTTA 4O5VA 4JRPA 1MMGA 2A7YA 2ABLA 5LL6S 3M0SA 1KQ1A 1ZBXA 2RM4A 2K5FA 5I22A 2BZ8A 4QVDA 1KD1C 2H3JA 2LP5A 1S72A 1M27C 2X4YA 1FWZA 2E65A 4A54A 1GXIE 1NEGA 1B34A 3CCVA 1XJWB 3M0PA 1K76A 4PJOG 3EH1A 1JEGA 5A2QE 4XU2A 4PKCC 3G71A 4Z88A 4DEYA 4ZTJA 2OAUA 2PVDB 4GLKA 2LCCA 4PNOA 3VS1A 4DBQA 1K1ZA 3CMAA 1G2BA 3VYGA 1OZ3A 2P0PA 3D7SB 1RL2A 1ZSZA 5LJ3d 4X9CA 4PFOA 7AT1B 1YJ9T 2CZ0B 1Q86C 1VIFA 2V1RA 4E47A 1PNJA 1U06A 3M0UA 2CH4W 3QUIA 3BDUA 1VQ9A 1Q7YR 5GMKi 1MMNA 1OU8A 4M78A 3CCJA 3PIPA 3JCMJ 2LJ0A 3P8BB 2FZCB 4MZTA 2EFIA 1NLPC 4PFPA 4OMMA 4F7UB 5FU6B 1SEMA 4PJOA 2DAQA 1NYFA 1T0JA 2A36A 1ZUUA 4MDWA 3OYJA 3E9FA 4FYVB 3LLRA 1I81A 3RBBB 1YN8A 2MYSA 3E9GA 5GMKl 4XTWA 3G6ET 4BE2A 1VOMA 3OSVA 2MPXC 4PJOB 2EPDA 1NJIR 2VVKA 4RTUA 3I55A 1NM7A 2HBPA 1EIFA 4Q5WA 1YJWQ 3GIBA 2DBMA 2RA2A 3ZEHA 2YUQA 1KQSA 2SRCA 2X3XD 1OQKA 1HJDA 1W70A 3QZ5B 4KUIA 1YBYA 1TG0A 1JJ2P 1OV3A 3JSCA 2YRCA 1UHCA 3H6ZA 2NUPA 2QDYB 1VQNA 3M57A 1HXDA 1SSHA 2KYMA 3NTHA 4PJOC 2R5MA 4YTLA 1YJNQ 3ZBDA 3HKSA 3QG1A 3CC7A 5M9OA 4F17A 1LCKA 3QJ6A 2A37A 4IUTA 4M75B 4X34A 4ELYC 5GAOn 1G3WA 1MMDA 5C6SA 3I55T 1AD5A 1PD1A 1NLOC 2G6FX 1VQ7T 5GAMf 4OMPA 4EDUA 5IHIA 2QGGA 2IVWA 4NL2A 1NE8A 2RHYA 3SWNA 1AZGB 4E7JA 3RESA 3HRSA 1JB0E 5LJ3j 1D1CA 3X20B 2LMJA 1WHHA 1IZ6A 4ZGEB 2L0AA 4BI4A 3G71Q 4J6XA 1BBZA 4Z89A 2K57A 2RJEA 1G8XA 2PUKB 1K73U 4QW2A 1VQNQ 2DYBA 1VQLA 2LQ8A 4M4ZA 4BB7A 3CCST 2X35A 3UT1A 1WHLA 4JJDA 2DPPB 3G4SA 2HAXA 3O8VA 3CCMA 1WJSA 1U1SA 2ED1A 3EG2A 4AG2C 2C0IA 3PMTA 1Q86R 4KRTA 3OYLA 1MNDA 2OTJQ 3OA6A 3MEUA 2VGMA 5C0MA 3RNJA 2LC4A 2OTJA 1PHTA 2A3LA 1VQKA 2X4XA 5FWBA 2DA9A 2K3YA 4OGCA 3JCMg 5GAMe 4AT1B 3QYGB 3CXCP 1U3OA 5LJ3g 1GCQA 3CD6A 1QKXA 1BCMA 1X69A 2O88A 2RQVA 1VQMT 1M1GA 1QP2A 1WQWA 1GRIA 3OSSC 3JCMd 3CCRQ 3QZ9B 5KYYB 3OS1A 5IXBA 4C5HA 1PG5B 3JCMb 5KYWA 1U8RA 5LJ3h 3OS5A 3CBOA 1ZUKA 3M53A 2F1LA 1UG1A 4RTXA 3X25B 3H0FA 3ZFJA 4F14A 1AZEA 1W4SA 1YJWT 4ME7A 2P84A 1WHMA 3MCAB 1KHCA 3OB9A 4E7ZA 1AWJA 5LJ3f 2QEXT 3N5BB 2BKDN 5J3BA 4DBRA 1X27A 2J6OA 3QWXX 2J6FA 2EKOA 1VYVA 3EGUA 5L8RE 3FB9A 1WXBA 2OI3A 1M2VA 2EBPA 2MMPA 2VYTA 3UA6A 2AK5A 2DEQA 5CCAA 1IO6A 2F2XA 3HSBA 2ZPBB 4JJBA 5I2MA 3NTIA 2P4RA 5LJ5f 4B6MA 2FB7A 5GMKe 1X01A 4J9HA 1VYUA 1C0MA 2GCXA 4LUDA 4M77F 4JRKA 5FRMA 2EJGA 4C92B 5I11A 4C92C 1Q86U 1WJRA 3JB9G 1Q82C 2D8JA 5D6YA 3J7AF 3FIFA 4J6WA 2OAWA 2W10A 3CBMA 4C0DC 3CPWP 3E1SA 4C0DB 1WXUA 2DTOA 2ESWA 2RJDA 2CREA 4C92A 1UJYA 5GJWB 2P4TA 2GFUA 2B86A 1K8AC 1XOVA 1UGRB 1WFWA 4RG8A 1AWOA 1QCOA 3CPFA 1UGVA 4BDYA 3QYHB 3HL8A 5GAN2 2VC8A 2C06A 1FMWA 2CP2A 2NUTA 2CT4A 2GQVA 3VRZA 3CMAQ 5GANh 3VS6A 4JJCA 2V1QA 1MV0B 2J06A 3ASKA 4RTWA 2MI6A 1AWWA 5FWCA 4LD9K 3EGDA 2NLUA 5GAMh 1Q81R 2CP0A 2EIFA 4EMKA 4XU1A 2GTJA 2EW3A 4FYYB 5GANd 1GBRA 4MDXA 3VS0A 3MPUB 2LX9A 3M4YA 1Q7YU 4KUDK 5KE2A 4C0ZA 1DJ7B 2EQUA 3MP8A 4TVRA 1YI2Q 2WSEE 4DOWA 1H92A 4PJOF 1SG5A 3G71T 3E2UA 1VQLQ 5GAMg 1Y96A 1I5LA 2VGNA 1QCFA 4KGXB 2DL5A 3A8OB 5A0LA 2DLPA 3J81E 2KR3A 4AFQC 3VS2A 3JCMV 1KQSP 2NWMA 3CC2Q 5L23A 1AT1B 4M77A 2PU9B 1OZ2A 2O2OA 4FSXA 1ABQA 2LJ1A 4C92D 1JJ2A 4FT2A 3VYHB 3NFCA 3MJXA 4ZGDB 3CCMT 2COZA 1M2OA 4PJMA 1UJ0A 1Y0MA 2BE9B 1KHIA 5CAIA 3QHSA 2YWWA 3BE3A 3CC4Q 3C94A 3G1JA 2KMTA 2DE0X 2D6FA 1VQLT 2GF7A 1VQPT 2E41A 4J8OA 1I0CA 3PIOA 3JCMX 1LOJA 3GPLA 1M1FA 3WVDB 3M0RA 2X3WD 4RTTA 2LRQA 3M59A 3CQTA 2XHCA 1YI2A 3L2VA 1W2BA 1OULA 1Z9QA 1Z9ZA 2OTLQ 4PJOE 4JRQA 3PT9A 3RKYA 2DXCA 2FZKB 5KYUB 2QTVA 1YJ9Q 3EFOA 4M75G 1IGUA 1TSFA 2DL4A 2LCLA 2NYSA 1KC8U 3SDZA 5IH2A 1HSQA 3TREA 3QXEB 3KXTA 3RERA 2MWOA 3OW2A 4PJOD 2P0QA 3QWYA 3LGLA 3KBGA 2JN0A 1RAAB 1MV3A 4NL3A 5FRNA 3EAEA 5LJ5e 2XDDA 2VV5A 1UGSB 3CC7Q 4M7DG 2DTIA 1YCSB 3TVTA 3EGXA 4JDSA 1G3YA 3RR6A 2CUBA 4WTOB 5KH6A 2E6NA 3EG9A 3M0QA 2VUBA 4M77E 4HCZA 1S72T 2HNIA 2QK0A 2ZCFB 1B07A 4L6V5 2X4WA 1X6BA 2ZGWA 1BI3A 1NPPA 2PNIA 2ZAEA 2KE9A 1SRLA 4KT0E 3CCLT 1MUZA 4AFSC 3L42A 1HK9A 3L1AA 1SKUB 1TS9A 4E7KA 4R56A 4C8QF 2E4HA 3PVQA 2RJFA 1LNXA 4ANJA 5GAMd 4OMQA 1OYXA 1TUDA 4F7UF 1VQ8Q 2K4YA 5KYXA 1YIJQ 2ROLA 4UC4A 5GAMj 1LJOA 2EYZA 4PL6A 2DKGA 1R0BG 4ZN3A 1UE9A 2DL3A 1ZX6A 4OMLA 4D6WA 4DOVA 1IRXA 2O01E 2DRMA 3JB9D 2DIQA 2MAMA 1CKAA 2XD0A 4CC3A 2XMFA 1KFZA 2EYWA 4J5YA 2RF0A 1M1KU 4M7DD 4RKUE 3CC4T 2GFAA 2KROA 4M77C 3GBQA 4EMGA 3C0CA 1VQPQ 4C92F 3A8GB 1HYOA 3TSWA 1B7TA 1KK7A 5HY6A 5LJ5h 4E6RA 4R55A 4J7IA 2BIVA 4R0KA 3V7RA 3V8KA 5GAN7 4CI0C 3NHNA 2O4XB 1UEBA 1JRIA 1VQNT 1G5VA 2DZCA 1N9SA 1SF9A 1HD3A 1UB4A 4ORZA 4CC4B 1VYTA 3EHQA 2YLBA 3JV3A 2JTFA 3VUZA 4RUGA 4C0GA 3L2UA 3GP8A 1WHJA 3RKWA 4BE1A 2PUOB 2J05A 4A4GA 4M77D 1W1FA 1PC0A 3HP9A 3X26B 1VQOT 4Y28E 3V8JA 3G4SQ 3INZA 3HRUA 2V8KA 3I56T 2L3SA 3JCMe 2RJCA 1W2BP 2X4JA 1RLPC 1ZSZC 1F1BB 2VASA 3OYEA 5IXFA 4J9CA 5LJ5j 2VB6A 1PSFA 1BIAA 3CMEQ 2YXYA 4FW1A 5J39A 4HVVA 1MHNA 2FEIA 4XTUA 5J26A 2QASA 1YP5A 4HCBA 4M7AE 1IHWA 1VQOA 3OW2P 4D8DA 2KRSA 2E3IA 2ENMA 4DBHA 1M90U 1WA7A 2BZYA 2CP3A 4LNPA 4J6YA 2LJ3A 2DF6A 4C5IA 1VQ6A 4AFZC 2Y4YA 2RMOA 2DBKA 1GCPA 4JRIA 2AIRB 4LE9A 3CXCA 1WLPB 3CMET 1D1AA 1M3CA 5KE3A 4OB0B 2EYQA 2KRNA 1M2VB 3O5ZA 4JS5A 4DA4A 1Y7XA 5KYUA 1M9SA 4RCCA 1WNLA 3GLXA 5GANe 3V8LA 3M5AA 4BI3A 2BE7D 4LUEA 1M5Q1 4QQGA 3G6EQ 2XU8A 4PJJA 1VQ8A 3A8HB 3CCVQ 1WYXA 2IG0A 2AKLA 3DB4A 3ER0A 3JB9F 1YCYA 3M58A 2YUNA 3LW5E 4LDUA 2LQKA 2NUTB 4IURA 1ZBJA 2A0FB 2LDMA 1N8RR 4M77B 2KXDA 5FROA 1I8FA 5GAOm 3AHUA 1WPYA 3CCEA 3R6OA 2YDLA 2DX1A 3TU4K 3HTRA 2DXBA 3EGXB 3FLGA 1Q82R 4N0AA 5CKDA 5GAN6 5CKBA 1XNIA 2LVMA 1YJNT 4Y91A 1WI7A 3ME9A 1QVGS 3L2WA 4LDWA 1YITT 4C92E 5AT1B 3H8ZA 4C8QC 4IUVA 1R77A 3A8LB 3NGPA 1IHVA 1D3BA 3TEEA 4FL6A 4PJLA 2MF2A 3S3NA 4ATOA 1R0CB 1OU9A 4C0FA 2EQIA 2QI2A 4NOYA 4F7UA 8AT1B 3CD6T 2RQUA 2FHDA 3QKJA 2RQWA 4C8QA 1K9MU 1E6GA 3JCMh 3OYDA 4FW2A 1VQKT 1M1KR 2ZPFB 1VQ4A 1PD0A 1YITQ 2LT4A 2EGCA 2HDAA 3JCMc 5GAN3 3CCQA 4M7AG 4IKFA 2EQMA 4L59A 4F04B 2ATCB 4C8QB 2DVEA 1FMVA 2JW4A 2ED0A 4IIOA 4LDYA 3CCQQ 4E7IA 1KG1A 2RHZA 1U1TA 2JZ2A 2K3BA 1AEYA 2ZPEB 1K73R 5CQYA 4HCKA 3MKDA 3VUBA 1VQMA 1SPKA 3VS3A 4XAXB 2K3XA 4OMFB 3HFOA 4BY6C 4F16A 3JAME 1VQKQ 4OB2B 3OS2A 2V8IA 2CYZB 2CZ1B 4KH0B 1N9RA 2QDLA 4M78D 2AZSA 1D0ZA 1OX8A 3IQLA 2RQRA 2F5TX 2QQAA 2CZ6B 4M7DF 4PLLA 1UTIA 1YHQA 1SRMA 3M0TA 1MNEA 4F7UG 4AFUC 3HFNA 1T3LA 4PJNA 2CUDA 4OF1A 4QKUA 4M7DB 2YUOA 1RABB 1PSEA 2CP7A 3JCMQ 3SWNC 1AVZC 2JM8A 2F5KA 3G4ST 1ARKA 4O6JA 2MCNA 2JOYA 4MZPA 5KYYA 5GAOl 1ACMB 2V26A 5KYWB 5GMKm 2CKKA 2WSFE 2LCSA 3RKXA 2D0NA 3CCSQ 5D7UA 4M7AB 1JJ2S 4HA8A 3I5RA 3VU3C 2C0OA 2FO0A 1YJWA 3CCUA 1IREB 2OTLT 3F70A 2E6ZA 1Y57A 2L5QA 2YLCA 5CR2A 4M7AF 1H641 3REBB 1NJIC 3PVLA 5I2SA 1KQ2A 3OYCA 4Y92A 2ZZDA 1K9MR 2EVRA 2WSCE 4FYXB 4K11A 1WQ7A 4JZ3A 3CCET 3I5SA 4ZTFA 4HCCA 4PLIA 5CVIA 1N27A 5GAN4 2JJ9A 2RK1A 4WF2A 4BE0A 2QA4Q 3EG9B 1QVFA 6AT1B 2KSSA 3FEOA 4EIKA 4NS5A 3FDRA 4RCBA 1I5OB 3CCSA 3BW1A 3I56A 2HSPA 2LZ6B 3KFVA 4M78E 4HXJA 1S72Q 1TTHB 2KGTA 1X2QA 3OMGA 5DLQE 5IHNA 4HT9A 2DD5A 1SHGA 3CCJT 4IUPA 2DIGA 4J9DA 1WX6A 1PWTA 2RNAA 2DXUA 4LD6A 2LNVA 3CC2A 4WCIA 1A0NB 2WACA 2DJQA 3PTAA 2R57A 1D1BA 2M0OA 1M90C 3JCMW 3X24B 2RI3A 2DEUA 3AT1B 4LDVA 2HEQA 4OP0A 2G3RA 4AMCA 5EG2A 1M8MA 2XIDA 3E19A 2QEXQ 2JXBA 1VQ8T 2QG9B 4IUQA 3OY9A 3SD4A 1PKTA 3CCJQ 2YSQA 3MEWA 2QA4A 4RG2A 2LQNA 1D0XA 1H8KA 3EFSA 2CGHA 1YIJT 4EMKC 1X75C 3OMCA 1YHQT 3ULRB 1VQ9T 3P8HA 3OYNA 3OYHA 4IIMA 2COWA 3JCMP 2CSQA 1C6VX 1FMKA 1KD1U 3EH2A 1D3BB 3GOXA 3OYKA 2YRVA 1UHFA 1VQ4T 2DTHA 2EQJA 1GBQA 1YJ9A 1VQ6Q 3EG0A 4BD3A 3H0IA 2QQRA 4M7DE 2CP6A 2D1XA 2XK0A 4PFZA 5KCOA 2ROTA 1RACB 4JLGA 3VRYA 2KK4A 5GANj 3REAB 4JS4A 3RUXA 4E2FB 2KT8A 1GFDA 1RAIB 2SEMA 1NEBA 4PK4A 4C8QE 1N6AA 3L2ZA 3M56A 1ZSZB 3DKMA 1M3BA 1EFNA 1VQ6T 1TH7A 2EWNA 2VWFA 1YJNA 1O9SA 2CP5A 5HK3A 4D8KA 4J9EA 1KJWA 1IGQA 3CCUQ 2CH4A 5D6WA 1BYMA 1G83A 1K9MC 1I1JA 4M78B 4X9DA 1X6GA 2PVGB 2PTKA 3GNGA 3FJ5A 4X1VA 3UWNA 3CBPA 4CC2A 3ZL7C 2RQTA 1KIKA 3SB2A 2JMAA 2M16A 1ZA2B 3M9QA 1LPLA 5GAN8 1M90R 2IPOB 2QA4T 4BY6B 5AYFA 2FZGB 4JZ4A 1TOVA 4C92G 1QVFS 2L89A 4N0AC 1WZOA 2XDPA 2DETA 1YWOA 2ZPGB 2LNHB 3C4SA 2IIMA 4N4HA 5CKEA 1FYNA 1LVKA 1PRMC 2J6KA 2M0YA 1Y96B 1VIEA 3CMEA 1JXMA 1K8AR 1RLQC 3PE0A 4M7DC 2K5IA 5CO7A 2J7IA 3FRNA 1QWEA 1ZA1B 1RI9A 1KSWA 4II1A 3CCRA 3G7ZA 4ZNXA 3EG3A 3CPWS 2DK3A 1WIEA 2NUPB 3KUFA 4FSSA 3OYAA 3QDFA 2KVQG
chains in the Genus database with same CATH topology
2EYXA 2BZXA 4A63B 2KXCA 4HVWA 1N5ZA 1X27A 2J6OA 3QWXX 2J6FA 2CT3A 3EGUA 1VYVA 1QKWA 4J9GA 4CC7A 1YNZA 2FPFA 1T3SA 1WXBA 4GLMA 2OI3A 4LUEA 2EBPA 2FPDA 1WYXA 2AKLA 4RTVA 2O31A 2YUNA 1JXOA 1WXTA 1ZBJA 3UA6A 2AK5A 2LQWA 1YWPA 2GNCA 2KXDA 1IO6A 2F2XA 1JO8A 4JJBA 2VKNA 3UATA 1RUWA 2P4RA 5FW9A 2YDLA 2KRMA 2DX1A 2JTEA 1OEBA 3EHRA 4J9HA 3VS7A 2EKHA 1VYUA 2NUZA 4LUDA 5HCKA 5I11A 1H3HA 2EGAA 5GJVB 2CSIA 4DEXA 1WI7A 2D8JA 4HVUA 2OAWA 2W10A 2MOXA 2JT4A 2KT1A 1WXUA 1NG2A 1OOTA 1OPLA 2ESWA 2KBTA 3NGPA 4AG1C 2CREA 1UJYA 1X43A 5GJWB 1B3QA 2B86A 2EQIA 1XOVA 2O9VA 2RQUA 2KYBA 1WFWA 1AWOA 2RQWA 1E6GA 1UGVA 1PKSA 2A08A 2JMCA 2KEAA 2W0ZA 2CT4A 3VRZA 3VS6A 1AOJA 4JJCA 2V1QA 1K9AA 1MV0B 4RTYA 2GQIA 2EGCA 2HDAA 2J06A 4RTWA 4Z8AA 4LN2A 2K6DA 1AWWA 5FWCA 2JW4A 2ED0A 4IIOA 1JU5C 1UFFA 3UA7A 1UECA 2DILA 1M30A 3NPFA 3NMZC 2HBWA 2GTJA 2EW3A 1GBRA 1AEYA 2K3BA 4HCKA 1SHFA 2L2PA 2LX7A 3VS0A 2GGRA 1SPKA 3VS3A 1GFCA 1ZSGA 1K0XA 1BK2A 3UF4A 3LH5A 1T0HA 4F16A 1H92A 1NYGA 2AZVA 2K79A 1ZUYA 2O9SA 1JQQA 1TUCA 4QT7A 1M3AA 4ESRA 2QDLA 1QCFA 1ABOA 2AZSA 2DL5A 3I9QA 1V1CA 3IQLA 2F2WA 2DLPA 2BTTA 2RQRA 2KR3A 4AFQC 3VS4A 2ABLA 3VS2A 1UTIA 1SRMA 2NWMA 3M0TA 2GBQA 5L23A 1UUEA 2DNUA 4AFUC 3M0SA 2O2OA 2DMOA 1ABQA 2LJ1A 1T3LA 5I22A 2CUDA 2YUOA 2BZ8A 1UJ0A 2LP5A 1M27C 1Y0MA 2ECZA 1NEGA 1AVZC 2DE0X 2JM8A 2YUPA 1ARKA 3M0PA 2AKKA 1I0CA 1K76A 2MCNA 1JEGA 3M0RA 2X3WD 1VA7A 4Z88A 4DEYA 2RN8A 4RTTA 2LCSA 3U23A 3CQTA 2D0NA 1UDLA 5EC7A 3I5RA 1AWXA 3VS1A 1GCQC 2C0OA 1K1ZA 2FO0A 1G2BA 1Y57A 2CDTA 1K4US 1Z9QA 2K9GA 1Z9ZA 3REBB 3PVLA 4OMOA 2V1RA 4Y92A 1PNJA 2HCKA 1U06A 2M51A 2CH4W 3M0UA 2E5KA 2OJ2A 2EVRA 4GBQA 4K11A 2DL4A 1BB9A 2DVJA 3THKA 4JZ3A 3EG1A 3I5SA 5IH2A 1HSQA 2LJ0A 2MIOA 3QWYA 3H41A 1MV3A 1W6XA 4J9IA 1NLPC 4OMMA 2FPEA 1SEMA 1NYFA 1CSKA 1T0JA 1YCSB 2A36A 1PRLC 1ZUUA 3TVTA 2H8HA 4EIKA 2HSPA 2LZ6B 3RBBB 1YN8A 3KFVA 2JM9A 4HXJA 2CUBA 2KGTA 1X2QA 5IHNA 3M0QA 1E7OA 1SHGA 4J9DA 1B07A 1WX6A 2EPDA 1PWTA 2RNAA 2VVKA 4RTUA 1X6BA 4J9FA 1GL5A 4WCIA 1A0NB 3A98A 1NM7A 2DJQA 2PNIA 2YT6A 2KE9A 1SRLA 2DBMA 2YUQA 1K0SA 2SRCA 1J3TA 2X3XD 1MUZA 2HEQA 1BU1A 1HJDA 1W70A 4AFSC 3I35A 1TG0A 1M8MA 1OV3A 2JXBA 1UHCA 3PVQA 1SSHA 2KYMA 4OMQA 1TUDA 1PKTA 1ZLMA 4F17A 2KNBB 2YSQA 1LCKA 2ROLA 2RPNA 2LQNA 1H8KA 2A37A 2EYZA 1UE9A 2DL3A 1ZX6A 4OMLA 3ULRB 1AD5A 1X2KA 1NLOC 4J9BA 2EYYA 2K2MA 4IIMA 2G6FX 2DL8A 2CSQA 2DRMA 2EGEA 4OMPA 5IHIA 3SEMA 1FMKA 1CKAA 4CC3A 1AZGB 1UHFA 2XMFA 1KFZA 2EYWA 1GBQA 2K7AA 2RF0A 3EG0A 2A28A 2LMJA 3H0IA 2KROA 3GBQA 2JS0A 2L0AA 3C0CA 2D1XA 3TSWA 1BBZA 4JPBW 4Z89A 2ROTA 2FG0A 4E6RA 3VRYA 2F2VA 4R0KA 1QLYA 2DYBA 3REAB 1E6HA 4M4ZA 3NHNA 2C0TA 2JS2A 2KT8A 1GFDA 1HD3A 4JJDA 2SEMA 1NEBA 5IHKA 1U5SA 2D8HA 4ORZA 4CC4B 1VYTA 3EHQA 3JV3A 1M3BA 1EFNA 2ED1A 2GTOA 2VWFA 3EG2A 4RUGA 4AG2C 2C0IA 2I0NA 4D8KA 4J9EA 1KJWA 2CH4A 2J05A 4KRTA 3TSZA 1W1FA 1G83A 1I07A 1I1JA 1X6GA 2PTKA 5ECAA 3H0HA 3RNJA 3FJ5A 1PHTA 2L3SA 4X1VA 4CC2A 3ZL7C 5FWBA 2RQTA 2DA9A 1KIKA 1RLPC 2JMAA 3VS5A 1OPKA 2L3PA 1U3OA 5IXFA 2FRWA 4J9CA 1GCQA 1QKXA 1QWFA 1X69A 2O88A 2L3QA 4JZ4A 4HVVA 2FEIA 2RQVA 1YWOA 1YP5A 2LNHB 1CKBA 1GRIA 1S1NA 2IIMA 1FYNA 5IXBA 4D8DA 1PRMC 2KRSA 2DL7A 2J6KA 2M0YA 2ENMA 1WA7A 1WDXA 2BZYA 3SHWA 2DM1A 1JXMA 1RLQC 2FRYA 4LNPA 1ZUKA 3PE0A 2LJ3A 1UG1A 2DF6A 4RTXA 2DRKA 4AFZC 3H0FA 2RMOA 2DBKA 2J7IA 1GCPA 4RTZA 4F14A 1AZEA 1QWEA 4LE9A 1WLPB 1RI9A 3R6NA 2PZ1A 1KSWA 4ZNXA 1M3CA 3EG3A 1WIEA 2KRNA 4FSSA 3O5ZA 4OMNA 1AWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYX A;  2BZX A;  4A63 B;  2KXC A;  4HVW A;  1N5Z A;  1X27 A;  2J6O A;  3QWX X;  2J6F A;  2CT3 A;  3EGU A;  1VYV A;  1QKW A;  4J9G A;  4CC7 A;  1YNZ A;  2FPF A;  1T3S A;  1WXB A;  4GLM A;  2OI3 A;  4LUE A;  2EBP A;  2FPD A;  1WYX A;  2AKL A;  4RTV A;  2O31 A;  2YUN A;  1JXO A;  1WXT A;  1ZBJ A;  3UA6 A;  2AK5 A;  2LQW A;  1YWP A;  2GNC A;  2KXD A;  1IO6 A;  2F2X A;  1JO8 A;  4JJB A;  2VKN A;  3UAT A;  1RUW A;  2P4R A;  5FW9 A;  2YDL A;  2KRM A;  2DX1 A;  2JTE A;  1OEB A;  3EHR A;  4J9H A;  3VS7 A;  2EKH A;  1VYU A;  2NUZ A;  4LUD A;  5HCK A;  5I11 A;  1H3H A;  2EGA A;  5GJV B;  2CSI A;  4DEX A;  1WI7 A;  2D8J A;  4HVU A;  2OAW A;  2W10 A;  2MOX A;  2JT4 A;  2KT1 A;  1WXU A;  1NG2 A;  1OOT A;  1OPL A;  2ESW A;  2KBT A;  3NGP A;  4AG1 C;  2CRE A;  1UJY A;  1X43 A;  5GJW B;  1B3Q A;  2B86 A;  2EQI A;  1XOV A;  2O9V A;  2RQU A;  2KYB A;  1WFW A;  1AWO A;  2RQW A;  1E6G A;  1UGV A;  1PKS A;  2A08 A;  2JMC A;  2KEA A;  2W0Z A;  2CT4 A;  3VRZ A;  3VS6 A;  1AOJ A;  4JJC A;  2V1Q A;  1K9A A;  1MV0 B;  4RTY A;  2GQI A;  2EGC A;  2HDA A;  2J06 A;  4RTW A;  4Z8A A;  4LN2 A;  2K6D A;  1AWW A;  5FWC A;  2JW4 A;  2ED0 A;  4IIO A;  1JU5 C;  1UFF A;  3UA7 A;  1UEC A;  2DIL A;  1M30 A;  3NPF A;  3NMZ C;  2HBW A;  2GTJ A;  2EW3 A;  1GBR A;  1AEY A;  2K3B A;  4HCK A;  1SHF A;  2L2P A;  2LX7 A;  3VS0 A;  2GGR A;  1SPK A;  3VS3 A;  1GFC A;  1ZSG A;  1K0X A;  1BK2 A;  3UF4 A;  3LH5 A;  1T0H A;  4F16 A;  1H92 A;  1NYG A;  2AZV A;  2K79 A;  1ZUY A;  2O9S A;  1JQQ A;  1TUC A;  4QT7 A;  1M3A A;  4ESR A;  2QDL A;  1QCF A;  1ABO A;  2AZS A;  2DL5 A;  3I9Q A;  1V1C A;  3IQL A;  2F2W A;  2DLP A;  2BTT A;  2RQR A;  2KR3 A;  4AFQ C;  3VS4 A;  2ABL A;  3VS2 A;  1UTI A;  1SRM A;  2NWM A;  3M0T A;  2GBQ A;  5L23 A;  1UUE A;  2DNU A;  4AFU C;  3M0S A;  2O2O A;  2DMO A;  1ABQ A;  2LJ1 A;  1T3L A;  5I22 A;  2CUD A;  2YUO A;  2BZ8 A;  1UJ0 A;  2LP5 A;  1M27 C;  1Y0M A;  2ECZ A;  1NEG A;  1AVZ C;  2DE0 X;  2JM8 A;  2YUP A;  1ARK A;  3M0P A;  2AKK A;  1I0C A;  1K76 A;  2MCN A;  1JEG A;  3M0R A;  2X3W D;  1VA7 A;  4Z88 A;  4DEY A;  2RN8 A;  4RTT A;  2LCS A;  3U23 A;  3CQT A;  2D0N A;  1UDL A;  5EC7 A;  3I5R A;  1AWX A;  3VS1 A;  1GCQ C;  2C0O A;  1K1Z A;  2FO0 A;  1G2B A;  1Y57 A;  2CDT A;  1K4U S;  1Z9Q A;  2K9G A;  1Z9Z A;  3REB B;  3PVL A;  4OMO A;  2V1R A;  4Y92 A;  1PNJ A;  2HCK A;  1U06 A;  2M51 A;  2CH4 W;  3M0U A;  2E5K A;  2OJ2 A;  2EVR A;  4GBQ A;  4K11 A;  2DL4 A;  1BB9 A;  2DVJ A;  3THK A;  4JZ3 A;  3EG1 A;  3I5S A;  5IH2 A;  1HSQ A;  2LJ0 A;  2MIO A;  3QWY A;  3H41 A;  1MV3 A;  1W6X A;  4J9I A;  1NLP C;  4OMM A;  2FPE A;  1SEM A;  1NYF A;  1CSK A;  1T0J A;  1YCS B;  2A36 A;  1PRL C;  1ZUU A;  3TVT A;  2H8H A;  4EIK A;  2HSP A;  2LZ6 B;  3RBB B;  1YN8 A;  3KFV A;  2JM9 A;  4HXJ A;  2CUB A;  2KGT A;  1X2Q A;  5IHN A;  3M0Q A;  1E7O A;  1SHG A;  4J9D A;  1B07 A;  1WX6 A;  2EPD A;  1PWT A;  2RNA A;  2VVK A;  4RTU A;  1X6B A;  4J9F A;  1GL5 A;  4WCI A;  1A0N B;  3A98 A;  1NM7 A;  2DJQ A;  2PNI A;  2YT6 A;  2KE9 A;  1SRL A;  2DBM A;  2YUQ A;  1K0S A;  2SRC A;  1J3T A;  2X3X D;  1MUZ A;  2HEQ A;  1BU1 A;  1HJD A;  1W70 A;  4AFS C;  3I35 A;  1TG0 A;  1M8M A;  1OV3 A;  2JXB A;  1UHC A;  3PVQ A;  1SSH A;  2KYM A;  4OMQ A;  1TUD A;  1PKT A;  1ZLM A;  4F17 A;  2KNB B;  2YSQ A;  1LCK A;  2ROL A;  2RPN A;  2LQN A;  1H8K A;  2A37 A;  2EYZ A;  1UE9 A;  2DL3 A;  1ZX6 A;  4OML A;  3ULR B;  1AD5 A;  1X2K A;  1NLO C;  4J9B A;  2EYY A;  2K2M A;  4IIM A;  2G6F X;  2DL8 A;  2CSQ A;  2DRM A;  2EGE A;  4OMP A;  5IHI A;  3SEM A;  1FMK A;  1CKA A;  4CC3 A;  1AZG B;  1UHF A;  2XMF A;  1KFZ A;  2EYW A;  1GBQ A;  2K7A A;  2RF0 A;  3EG0 A;  2A28 A;  2LMJ A;  3H0I A;  2KRO A;  3GBQ A;  2JS0 A;  2L0A A;  3C0C A;  2D1X A;  3TSW A;  1BBZ A;  4JPB W;  4Z89 A;  2ROT A;  2FG0 A;  4E6R A;  3VRY A;  2F2V A;  4R0K A;  1QLY A;  2DYB A;  3REA B;  1E6H A;  4M4Z A;  3NHN A;  2C0T A;  2JS2 A;  2KT8 A;  1GFD A;  1HD3 A;  4JJD A;  2SEM A;  1NEB A;  5IHK A;  1U5S A;  2D8H A;  4ORZ A;  4CC4 B;  1VYT A;  3EHQ A;  3JV3 A;  1M3B A;  1EFN A;  2ED1 A;  2GTO A;  2VWF A;  3EG2 A;  4RUG A;  4AG2 C;  2C0I A;  2I0N A;  4D8K A;  4J9E A;  1KJW A;  2CH4 A;  2J05 A;  4KRT A;  3TSZ A;  1W1F A;  1G83 A;  1I07 A;  1I1J A;  1X6G A;  2PTK A;  5ECA A;  3H0H A;  3RNJ A;  3FJ5 A;  1PHT A;  2L3S A;  4X1V A;  4CC2 A;  3ZL7 C;  5FWB A;  2RQT A;  2DA9 A;  1KIK A;  1RLP C;  2JMA A;  3VS5 A;  1OPK A;  2L3P A;  1U3O A;  5IXF A;  2FRW A;  4J9C A;  1GCQ A;  1QKX A;  1QWF A;  1X69 A;  2O88 A;  2L3Q A;  4JZ4 A;  4HVV A;  2FEI A;  2RQV A;  1YWO A;  1YP5 A;  2LNH B;  1CKB A;  1GRI A;  1S1N A;  2IIM A;  1FYN A;  5IXB A;  4D8D A;  1PRM C;  2KRS A;  2DL7 A;  2J6K A;  2M0Y A;  2ENM A;  1WA7 A;  1WDX A;  2BZY A;  3SHW A;  2DM1 A;  1JXM A;  1RLQ C;  2FRY A;  4LNP A;  1ZUK A;  3PE0 A;  2LJ3 A;  1UG1 A;  2DF6 A;  4RTX A;  2DRK A;  4AFZ C;  3H0F A;  2RMO A;  2DBK A;  2J7I A;  1GCP A;  4RTZ A;  4F14 A;  1AZE A;  1QWE A;  4LE9 A;  1WLP B;  1RI9 A;  3R6N A;  2PZ1 A;  1KSW A;  4ZNX A;  1M3C A;  3EG3 A;  1WIE A;  2KRN A;  4FSS A;  3O5Z A;  4OMN A;  1AWJ A; 
#chains in the Genus database with same CATH topology
 5KCH A;  3L2Q A;  2EYX A;  2Y4X A;  3CC7 T;  2B8A A;  2VXF A;  3CCR T;  2HMA A;  4A63 B;  2KXC A;  4HVW A;  4M75 A;  2CT3 A;  4J9G A;  1QKW A;  4CC7 A;  4KBM B;  5A0G A;  3CCV T;  4ZGJ B;  4C8Q G;  3OW2 S;  4MMK A;  2H3E B;  4V2S A;  4VUB A;  3Q1J A;  1UGP B;  4OB3 B;  4EMH A;  1VQ9 Q;  4KUL A;  1BI0 A;  4RTV A;  2XIC A;  2O31 A;  2QTX A;  2M1H A;  1WXT A;  5FLX E;  3SWN B;  3S3M A;  2LQW A;  1YWP A;  2GNC A;  1JO8 A;  3DLM A;  4XK8 E;  1BI2 A;  2VKN A;  4FT4 A;  3UAT A;  2RK2 A;  4XU0 A;  1VQ7 A;  3QJY A;  2JTE A;  1OEB A;  3EHR A;  2PQW A;  5CIU A;  2EKH A;  1VQ4 Q;  2NUZ A;  5A0D A;  1VQ5 A;  4B9X A;  2RI5 A;  2XG8 D;  1W2B S;  1H3H A;  1Y71 A;  5GJV B;  1O75 A;  4HVU A;  3MEA A;  1ZQ1 A;  2XKO C;  2MOX A;  2JT4 A;  1KC8 C;  1NG2 A;  4B9W A;  3OYY A;  2I2L A;  2KDS A;  4AG1 C;  1X43 A;  1B3Q A;  5IT9 E;  3VKI A;  1QVG A;  4QVC A;  3LX7 A;  4FIB A;  1KC8 R;  4IUU A;  1RI0 A;  2KYB A;  2HL5 C;  5GAO r;  2CS7 A;  3LWI A;  4Z02 A;  1PKS A;  2A08 A;  2JMC A;  2OX7 A;  5CKF A;  3OYG A;  4GY5 A;  1NZ9 A;  3V7C A;  4M75 D;  1AOJ A;  2OTJ T;  2EJF A;  1YHQ Q;  3JB9 I;  4RTY A;  1QVF P;  2GQI A;  5CK9 A;  1M8V A;  1VQ7 Q;  2FL7 A;  1NBE B;  3MHX A;  3EFO B;  1JU5 C;  5DLO A;  1UEC A;  3MET A;  2DIL A;  3NPF A;  5GAO q;  3CC2 T;  4MZM A;  5GAO p;  2L2P A;  3M55 A;  2YRD A;  2HL3 A;  1GFC A;  1BI1 A;  1ZSG A;  2RO0 A;  1K0X A;  2F69 A;  3JB9 J;  3UF4 A;  1T0H A;  3PNW C;  4EPC A;  1QP3 A;  2K79 A;  1ZUY A;  1JBM A;  1JQQ A;  1TUC A;  1VUB A;  1QVP A;  4QQD A;  3GNF B;  4OB1 B;  1FXX A;  4RMO A;  1FX7 A;  2XDB A;  2RH2 A;  1WGS A;  1V1C A;  2M9U A;  2L3R A;  1H3Z A;  1QW1 A;  1TXQ A;  3VS4 A;  2JUF A;  2GBQ A;  1UUE A;  2QQS A;  1VQ5 T;  2DNU A;  2DMO A;  2K5L A;  3WVE B;  3OYI A;  5FU7 C;  1P92 A;  4QQ6 A;  2EAY A;  2AHJ B;  1XQH A;  2M02 A;  3LGF A;  4OGE A;  2ECZ A;  4M7A A;  1I4K 1;  1WHG A;  2YUP A;  4ZN1 A;  2HQH A;  2MK5 A;  4C5G A;  2AKK A;  1M1K C;  3EFR A;  3CCL A;  1VA7 A;  4A4E A;  2RN8 A;  2OTL A;  1XTD A;  3FC3 A;  2QEX A;  3U23 A;  4N4I A;  1UDL A;  5EC7 A;  5LJ5 d;  3BFM A;  1AWX A;  3MO8 A;  4L5G A;  3C95 A;  1GCQ C;  4XQ3 A;  5I21 A;  1MGQ A;  2CDT A;  1K4U S;  3QSU A;  1WHK A;  2K9G A;  4JLI A;  4OMO A;  2R5A A;  2DD4 A;  2HCK A;  1Q82 U;  2M51 A;  3OBY A;  2L8D A;  3EGD B;  2E5K A;  2OJ2 A;  4BUG A;  3H9N A;  4GBQ A;  3BDL A;  3I56 Q;  1BB9 A;  2DVJ A;  3THK A;  3EG1 A;  2QAZ A;  3OYB A;  3NTK A;  3CCE Q;  3HPW A;  2MIO A;  1K8A U;  1OX9 A;  3H41 A;  1W6X A;  3HRT A;  2D0Q B;  4J9I A;  1SSF A;  3CPW A;  1TU0 B;  2FPE A;  2QYZ A;  3MEV A;  3CCL Q;  5GAN 5;  1CSK A;  1RAD B;  1PRL C;  2H8H A;  1R8O B;  2VXE A;  1VQP A;  2O4X A;  3QII A;  2JM9 A;  3OYM A;  2BUD A;  2V8J A;  1NPR A;  3JCM f;  5LJ3 e;  1E7O A;  4XTY A;  2QQB A;  1KQS S;  1D0Y A;  1TUG B;  3C12 A;  4FCY A;  4J9F A;  1N8R C;  1GL5 A;  3A98 A;  5CKH A;  4A4F A;  5GAN g;  4FU6 A;  2YT6 A;  2E12 A;  4EMK B;  1Q81 U;  5D6X A;  1K0S A;  2HKN A;  2XI9 A;  1J3T A;  2RHI A;  1Q7Y C;  1BU1 A;  2COY A;  5DY9 A;  4C8Q D;  4KGZ B;  1C1A A;  3I35 A;  1QVG P;  3CD6 Q;  1B34 B;  2ZPH B;  3LWH A;  5IN1 A;  2HSE B;  2RI2 A;  1ZLM A;  2KNB B;  1QMC A;  3RMQ A;  2RPN A;  4FM4 B;  3I55 Q;  2E10 A;  3MP1 A;  2KI7 A;  5DM7 R;  4P5N A;  1X2K A;  4J9B A;  2EYY A;  2JVV A;  2K2M A;  2DL8 A;  2EGE A;  3SEM A;  1IB8 A;  4M7A C;  2Y90 A;  3CCQ T;  2AT1 B;  4J7F A;  2E1H A;  1V29 B;  4M75 E;  1EX4 A;  2K7A A;  9ATC B;  1D09 B;  4BAC A;  1UGQ B;  2A28 A;  2RHU A;  2EJ9 A;  1AHJ B;  2JS0 A;  2Z0W A;  2HZY A;  1M4Z A;  4ELZ C;  4JPB W;  1VQO Q;  3UPU A;  2FG0 A;  2F2V A;  1QLY A;  3QBY A;  2HQE A;  1E6H A;  1Q95 G;  2LTO A;  2C0T A;  2JS2 A;  1RAH B;  4KH1 B;  3VJP A;  3QPH A;  5IHK A;  1U5S A;  2E64 A;  2D8H A;  2FYK A;  5HKC A;  3UDC A;  3LYI A;  2GTO A;  2I0N A;  2EQK A;  3PFS A;  1YIJ A;  4XU3 A;  3TSZ A;  1I07 A;  4M78 C;  3CCU T;  3X28 B;  5ECA A;  5FU6 C;  3H0H A;  1EZZ B;  5IAY A;  1VQ5 Q;  2DZ9 A;  4M7A D;  3VS5 A;  1QCN A;  2DFU A;  3CCM Q;  2KQW A;  2MWP A;  1OPK A;  4M75 F;  1WJQ A;  2L3P A;  2FRW A;  2K2V A;  3HHT B;  5KYX B;  3URG A;  1QWF A;  2FVU A;  3M54 A;  2L3Q A;  4A4K A;  4FYW B;  2RD1 A;  4MML A;  1PM3 A;  3M4G A;  2D9T A;  4QVZ A;  5GMK j;  3J80 E;  2PVO B;  1CKB A;  2E70 A;  1S1N A;  4A4H A;  2E3H A;  4CRI A;  1VQM Q;  2DL7 A;  4M78 F;  3CXC S;  2DYI A;  2JNG A;  3CC4 A;  1IXD A;  3RIR A;  4DBF A;  1WDX A;  2X9H A;  3SHW A;  2DM1 A;  2FRY A;  1RAG B;  2QXF A;  4KGV B;  2DRK A;  4RTZ A;  4LXC A;  3OQ5 A;  3R6N A;  2PZ1 A;  2LT1 A;  1KD1 R;  3G6E A;  1BKB A;  4M75 C;  4DQ2 A;  4OMN A;  4XTX A;  3QO3 A;  1Y07 A;  4XTV A;  2BZX A;  1N5Z A;  2HKQ B;  1YNZ A;  2FPF A;  4XTZ A;  3VV0 A;  1T3S A;  4GLM A;  1YFN A;  3MP6 A;  4M78 G;  3SFM A;  3FJP A;  2DO3 A;  1YIT A;  2FPD A;  2QGF B;  3V7S A;  2CZ7 B;  1BIB A;  1RAE B;  3WXM B;  1JXO A;  2RB6 A;  1RAF B;  3DLL A;  2E5Q A;  1QQJ A;  2YHT A;  3OYF A;  1RUW A;  5FW9 A;  2KRM A;  4OVA A;  3VS7 A;  5HCK A;  3TQ7 P;  5HK0 A;  1NJI U;  2DJZ A;  2EGA A;  4M7D A;  2HD0 A;  2CSI A;  3QDR B;  2P0K A;  4DEX A;  1K73 C;  1V76 A;  1X6O A;  2HQX A;  4JJN K;  3S6W A;  5KYN A;  2KT1 A;  4E7L A;  2KAF A;  2QQ9 A;  3OS0 A;  1OOT A;  4A53 A;  1OPL A;  2KBT A;  1G3T A;  2R58 A;  3A5Z B;  3TCJ A;  2O9V A;  2JTM A;  2KY9 A;  2X51 A;  4JUV A;  4E7H A;  1G3S A;  3CEY A;  2KEA A;  5GAN f;  2W0Z A;  5LJ5 g;  5GMK h;  4HT8 A;  1ZHI A;  1K9A A;  2DXT A;  4N4G A;  3GF5 A;  3RMS A;  3CMA T;  3LH0 A;  3JB9 H;  4BDZ A;  4Z8A A;  4LN2 A;  4C5E A;  2K6D A;  3OBW A;  3A8M B;  3A1P A;  1UFF A;  2DER A;  2ZPI B;  3UA7 A;  4LDX A;  1N8R U;  1M30 A;  5CQX A;  3NMZ C;  2HBW A;  3BY7 A;  1Q81 C;  1SHF A;  2LX7 A;  3JRZ A;  2GGR A;  4M77 G;  1YI2 T;  4F7U E;  1BCO A;  4BI8 B;  1BK2 A;  1OI1 A;  3LH5 A;  3S3O A;  3P8D A;  5FU7 B;  1NYG A;  2AZV A;  4J83 A;  1PCX A;  3L2R A;  2O9S A;  8ATC B;  1MMA A;  1TWB A;  4QT7 A;  1M3A A;  4ESR A;  4HKE A;  3RDV A;  3PMI A;  1ABO A;  3DB3 A;  3I9Q A;  3PGG A;  2RHX A;  2F2W A;  3T9N A;  4E7S A;  2BTT A;  4O5V A;  4JRP A;  1MMG A;  2A7Y A;  2ABL A;  5LL6 S;  3M0S A;  1KQ1 A;  1ZBX A;  2RM4 A;  2K5F A;  5I22 A;  2BZ8 A;  4QVD A;  1KD1 C;  2H3J A;  2LP5 A;  1S72 A;  1M27 C;  2X4Y A;  1FWZ A;  2E65 A;  4A54 A;  1GXI E;  1NEG A;  1B34 A;  3CCV A;  1XJW B;  3M0P A;  1K76 A;  4PJO G;  3EH1 A;  1JEG A;  5A2Q E;  4XU2 A;  4PKC C;  3G71 A;  4Z88 A;  4DEY A;  4ZTJ A;  2OAU A;  2PVD B;  4GLK A;  2LCC A;  4PNO A;  3VS1 A;  4DBQ A;  1K1Z A;  3CMA A;  1G2B A;  3VYG A;  1OZ3 A;  2P0P A;  3D7S B;  1RL2 A;  1ZSZ A;  5LJ3 d;  4X9C A;  4PFO A;  7AT1 B;  1YJ9 T;  2CZ0 B;  1Q86 C;  1VIF A;  2V1R A;  4E47 A;  1PNJ A;  1U06 A;  3M0U A;  2CH4 W;  3QUI A;  3BDU A;  1VQ9 A;  1Q7Y R;  5GMK i;  1MMN A;  1OU8 A;  4M78 A;  3CCJ A;  3PIP A;  3JCM J;  2LJ0 A;  3P8B B;  2FZC B;  4MZT A;  2EFI A;  1NLP C;  4PFP A;  4OMM A;  4F7U B;  5FU6 B;  1SEM A;  4PJO A;  2DAQ A;  1NYF A;  1T0J A;  2A36 A;  1ZUU A;  4MDW A;  3OYJ A;  3E9F A;  4FYV B;  3LLR A;  1I81 A;  3RBB B;  1YN8 A;  2MYS A;  3E9G A;  5GMK l;  4XTW A;  3G6E T;  4BE2 A;  1VOM A;  3OSV A;  2MPX C;  4PJO B;  2EPD A;  1NJI R;  2VVK A;  4RTU A;  3I55 A;  1NM7 A;  2HBP A;  1EIF A;  4Q5W A;  1YJW Q;  3GIB A;  2DBM A;  2RA2 A;  3ZEH A;  2YUQ A;  1KQS A;  2SRC A;  2X3X D;  1OQK A;  1HJD A;  1W70 A;  3QZ5 B;  4KUI A;  1YBY A;  1TG0 A;  1JJ2 P;  1OV3 A;  3JSC A;  2YRC A;  1UHC A;  3H6Z A;  2NUP A;  2QDY B;  1VQN A;  3M57 A;  1HXD A;  1SSH A;  2KYM A;  3NTH A;  4PJO C;  2R5M A;  4YTL A;  1YJN Q;  3ZBD A;  3HKS A;  3QG1 A;  3CC7 A;  5M9O A;  4F17 A;  1LCK A;  3QJ6 A;  2A37 A;  4IUT A;  4M75 B;  4X34 A;  4ELY C;  5GAO n;  1G3W A;  1MMD A;  5C6S A;  3I55 T;  1AD5 A;  1PD1 A;  1NLO C;  2G6F X;  1VQ7 T;  5GAM f;  4OMP A;  4EDU A;  5IHI A;  2QGG A;  2IVW A;  4NL2 A;  1NE8 A;  2RHY A;  3SWN A;  1AZG B;  4E7J A;  3RES A;  3HRS A;  1JB0 E;  5LJ3 j;  1D1C A;  3X20 B;  2LMJ A;  1WHH A;  1IZ6 A;  4ZGE B;  2L0A A;  4BI4 A;  3G71 Q;  4J6X A;  1BBZ A;  4Z89 A;  2K57 A;  2RJE A;  1G8X A;  2PUK B;  1K73 U;  4QW2 A;  1VQN Q;  2DYB A;  1VQL A;  2LQ8 A;  4M4Z A;  4BB7 A;  3CCS T;  2X35 A;  3UT1 A;  1WHL A;  4JJD A;  2DPP B;  3G4S A;  2HAX A;  3O8V A;  3CCM A;  1WJS A;  1U1S A;  2ED1 A;  3EG2 A;  4AG2 C;  2C0I A;  3PMT A;  1Q86 R;  4KRT A;  3OYL A;  1MND A;  2OTJ Q;  3OA6 A;  3MEU A;  2VGM A;  5C0M A;  3RNJ A;  2LC4 A;  2OTJ A;  1PHT A;  2A3L A;  1VQK A;  2X4X A;  5FWB A;  2DA9 A;  2K3Y A;  4OGC A;  3JCM g;  5GAM e;  4AT1 B;  3QYG B;  3CXC P;  1U3O A;  5LJ3 g;  1GCQ A;  3CD6 A;  1QKX A;  1BCM A;  1X69 A;  2O88 A;  2RQV A;  1VQM T;  1M1G A;  1QP2 A;  1WQW A;  1GRI A;  3OSS C;  3JCM d;  3CCR Q;  3QZ9 B;  5KYY B;  3OS1 A;  5IXB A;  4C5H A;  1PG5 B;  3JCM b;  5KYW A;  1U8R A;  5LJ3 h;  3OS5 A;  3CBO A;  1ZUK A;  3M53 A;  2F1L A;  1UG1 A;  4RTX A;  3X25 B;  3H0F A;  3ZFJ A;  4F14 A;  1AZE A;  1W4S A;  1YJW T;  4ME7 A;  2P84 A;  1WHM A;  3MCA B;  1KHC A;  3OB9 A;  4E7Z A;  1AWJ A;  5LJ3 f;  2QEX T;  3N5B B;  2BKD N;  5J3B A;  4DBR A;  1X27 A;  2J6O A;  3QWX X;  2J6F A;  2EKO A;  1VYV A;  3EGU A;  5L8R E;  3FB9 A;  1WXB A;  2OI3 A;  1M2V A;  2EBP A;  2MMP A;  2VYT A;  3UA6 A;  2AK5 A;  2DEQ A;  5CCA A;  1IO6 A;  2F2X A;  3HSB A;  2ZPB B;  4JJB A;  5I2M A;  3NTI A;  2P4R A;  5LJ5 f;  4B6M A;  2FB7 A;  5GMK e;  1X01 A;  4J9H A;  1VYU A;  1C0M A;  2GCX A;  4LUD A;  4M77 F;  4JRK A;  5FRM A;  2EJG A;  4C92 B;  5I11 A;  4C92 C;  1Q86 U;  1WJR A;  3JB9 G;  1Q82 C;  2D8J A;  5D6Y A;  3J7A F;  3FIF A;  4J6W A;  2OAW A;  2W10 A;  3CBM A;  4C0D C;  3CPW P;  3E1S A;  4C0D B;  1WXU A;  2DTO A;  2ESW A;  2RJD A;  2CRE A;  4C92 A;  1UJY A;  5GJW B;  2P4T A;  2GFU A;  2B86 A;  1K8A C;  1XOV A;  1UGR B;  1WFW A;  4RG8 A;  1AWO A;  1QCO A;  3CPF A;  1UGV A;  4BDY A;  3QYH B;  3HL8 A;  5GAN 2;  2VC8 A;  2C06 A;  1FMW A;  2CP2 A;  2NUT A;  2CT4 A;  2GQV A;  3VRZ A;  3CMA Q;  5GAN h;  3VS6 A;  4JJC A;  2V1Q A;  1MV0 B;  2J06 A;  3ASK A;  4RTW A;  2MI6 A;  1AWW A;  5FWC A;  4LD9 K;  3EGD A;  2NLU A;  5GAM h;  1Q81 R;  2CP0 A;  2EIF A;  4EMK A;  4XU1 A;  2GTJ A;  2EW3 A;  4FYY B;  5GAN d;  1GBR A;  4MDX A;  3VS0 A;  3MPU B;  2LX9 A;  3M4Y A;  1Q7Y U;  4KUD K;  5KE2 A;  4C0Z A;  1DJ7 B;  2EQU A;  3MP8 A;  4TVR A;  1YI2 Q;  2WSE E;  4DOW A;  1H92 A;  4PJO F;  1SG5 A;  3G71 T;  3E2U A;  1VQL Q;  5GAM g;  1Y96 A;  1I5L A;  2VGN A;  1QCF A;  4KGX B;  2DL5 A;  3A8O B;  5A0L A;  2DLP A;  3J81 E;  2KR3 A;  4AFQ C;  3VS2 A;  3JCM V;  1KQS P;  2NWM A;  3CC2 Q;  5L23 A;  1AT1 B;  4M77 A;  2PU9 B;  1OZ2 A;  2O2O A;  4FSX A;  1ABQ A;  2LJ1 A;  4C92 D;  1JJ2 A;  4FT2 A;  3VYH B;  3NFC A;  3MJX A;  4ZGD B;  3CCM T;  2COZ A;  1M2O A;  4PJM A;  1UJ0 A;  1Y0M A;  2BE9 B;  1KHI A;  5CAI A;  3QHS A;  2YWW A;  3BE3 A;  3CC4 Q;  3C94 A;  3G1J A;  2KMT A;  2DE0 X;  2D6F A;  1VQL T;  2GF7 A;  1VQP T;  2E41 A;  4J8O A;  1I0C A;  3PIO A;  3JCM X;  1LOJ A;  3GPL A;  1M1F A;  3WVD B;  3M0R A;  2X3W D;  4RTT A;  2LRQ A;  3M59 A;  3CQT A;  2XHC A;  1YI2 A;  3L2V A;  1W2B A;  1OUL A;  1Z9Q A;  1Z9Z A;  2OTL Q;  4PJO E;  4JRQ A;  3PT9 A;  3RKY A;  2DXC A;  2FZK B;  5KYU B;  2QTV A;  1YJ9 Q;  3EFO A;  4M75 G;  1IGU A;  1TSF A;  2DL4 A;  2LCL A;  2NYS A;  1KC8 U;  3SDZ A;  5IH2 A;  1HSQ A;  3TRE A;  3QXE B;  3KXT A;  3RER A;  2MWO A;  3OW2 A;  4PJO D;  2P0Q A;  3QWY A;  3LGL A;  3KBG A;  2JN0 A;  1RAA B;  1MV3 A;  4NL3 A;  5FRN A;  3EAE A;  5LJ5 e;  2XDD A;  2VV5 A;  1UGS B;  3CC7 Q;  4M7D G;  2DTI A;  1YCS B;  3TVT A;  3EGX A;  4JDS A;  1G3Y A;  3RR6 A;  2CUB A;  4WTO B;  5KH6 A;  2E6N A;  3EG9 A;  3M0Q A;  2VUB A;  4M77 E;  4HCZ A;  1S72 T;  2HNI A;  2QK0 A;  2ZCF B;  1B07 A;  4L6V 5;  2X4W A;  1X6B A;  2ZGW A;  1BI3 A;  1NPP A;  2PNI A;  2ZAE A;  2KE9 A;  1SRL A;  4KT0 E;  3CCL T;  1MUZ A;  4AFS C;  3L42 A;  1HK9 A;  3L1A A;  1SKU B;  1TS9 A;  4E7K A;  4R56 A;  4C8Q F;  2E4H A;  3PVQ A;  2RJF A;  1LNX A;  4ANJ A;  5GAM d;  4OMQ A;  1OYX A;  1TUD A;  4F7U F;  1VQ8 Q;  2K4Y A;  5KYX A;  1YIJ Q;  2ROL A;  4UC4 A;  5GAM j;  1LJO A;  2EYZ A;  4PL6 A;  2DKG A;  1R0B G;  4ZN3 A;  1UE9 A;  2DL3 A;  1ZX6 A;  4OML A;  4D6W A;  4DOV A;  1IRX A;  2O01 E;  2DRM A;  3JB9 D;  2DIQ A;  2MAM A;  1CKA A;  2XD0 A;  4CC3 A;  2XMF A;  1KFZ A;  2EYW A;  4J5Y A;  2RF0 A;  1M1K U;  4M7D D;  4RKU E;  3CC4 T;  2GFA A;  2KRO A;  4M77 C;  3GBQ A;  4EMG A;  3C0C A;  1VQP Q;  4C92 F;  3A8G B;  1HYO A;  3TSW A;  1B7T A;  1KK7 A;  5HY6 A;  5LJ5 h;  4E6R A;  4R55 A;  4J7I A;  2BIV A;  4R0K A;  3V7R A;  3V8K A;  5GAN 7;  4CI0 C;  3NHN A;  2O4X B;  1UEB A;  1JRI A;  1VQN T;  1G5V A;  2DZC A;  1N9S A;  1SF9 A;  1HD3 A;  1UB4 A;  4ORZ A;  4CC4 B;  1VYT A;  3EHQ A;  2YLB A;  3JV3 A;  2JTF A;  3VUZ A;  4RUG A;  4C0G A;  3L2U A;  3GP8 A;  1WHJ A;  3RKW A;  4BE1 A;  2PUO B;  2J05 A;  4A4G A;  4M77 D;  1W1F A;  1PC0 A;  3HP9 A;  3X26 B;  1VQO T;  4Y28 E;  3V8J A;  3G4S Q;  3INZ A;  3HRU A;  2V8K A;  3I56 T;  2L3S A;  3JCM e;  2RJC A;  1W2B P;  2X4J A;  1RLP C;  1ZSZ C;  1F1B B;  2VAS A;  3OYE A;  5IXF A;  4J9C A;  5LJ5 j;  2VB6 A;  1PSF A;  1BIA A;  3CME Q;  2YXY A;  4FW1 A;  5J39 A;  4HVV A;  1MHN A;  2FEI A;  4XTU A;  5J26 A;  2QAS A;  1YP5 A;  4HCB A;  4M7A E;  1IHW A;  1VQO A;  3OW2 P;  4D8D A;  2KRS A;  2E3I A;  2ENM A;  4DBH A;  1M90 U;  1WA7 A;  2BZY A;  2CP3 A;  4LNP A;  4J6Y A;  2LJ3 A;  2DF6 A;  4C5I A;  1VQ6 A;  4AFZ C;  2Y4Y A;  2RMO A;  2DBK A;  1GCP A;  4JRI A;  2AIR B;  4LE9 A;  3CXC A;  1WLP B;  3CME T;  1D1A A;  1M3C A;  5KE3 A;  4OB0 B;  2EYQ A;  2KRN A;  1M2V B;  3O5Z A;  4JS5 A;  4DA4 A;  1Y7X A;  5KYU A;  1M9S A;  4RCC A;  1WNL A;  3GLX A;  5GAN e;  3V8L A;  3M5A A;  4BI3 A;  2BE7 D;  4LUE A;  1M5Q 1;  4QQG A;  3G6E Q;  2XU8 A;  4PJJ A;  1VQ8 A;  3A8H B;  3CCV Q;  1WYX A;  2IG0 A;  2AKL A;  3DB4 A;  3ER0 A;  3JB9 F;  1YCY A;  3M58 A;  2YUN A;  3LW5 E;  4LDU A;  2LQK A;  2NUT B;  4IUR A;  1ZBJ A;  2A0F B;  2LDM A;  1N8R R;  4M77 B;  2KXD A;  5FRO A;  1I8F A;  5GAO m;  3AHU A;  1WPY A;  3CCE A;  3R6O A;  2YDL A;  2DX1 A;  3TU4 K;  3HTR A;  2DXB A;  3EGX B;  3FLG A;  1Q82 R;  4N0A A;  5CKD A;  5GAN 6;  5CKB A;  1XNI A;  2LVM A;  1YJN T;  4Y91 A;  1WI7 A;  3ME9 A;  1QVG S;  3L2W A;  4LDW A;  1YIT T;  4C92 E;  5AT1 B;  3H8Z A;  4C8Q C;  4IUV A;  1R77 A;  3A8L B;  3NGP A;  1IHV A;  1D3B A;  3TEE A;  4FL6 A;  4PJL A;  2MF2 A;  3S3N A;  4ATO A;  1R0C B;  1OU9 A;  4C0F A;  2EQI A;  2QI2 A;  4NOY A;  4F7U A;  8AT1 B;  3CD6 T;  2RQU A;  2FHD A;  3QKJ A;  2RQW A;  4C8Q A;  1K9M U;  1E6G A;  3JCM h;  3OYD A;  4FW2 A;  1VQK T;  1M1K R;  2ZPF B;  1VQ4 A;  1PD0 A;  1YIT Q;  2LT4 A;  2EGC A;  2HDA A;  3JCM c;  5GAN 3;  3CCQ A;  4M7A G;  4IKF A;  2EQM A;  4L59 A;  4F04 B;  2ATC B;  4C8Q B;  2DVE A;  1FMV A;  2JW4 A;  2ED0 A;  4IIO A;  4LDY A;  3CCQ Q;  4E7I A;  1KG1 A;  2RHZ A;  1U1T A;  2JZ2 A;  2K3B A;  1AEY A;  2ZPE B;  1K73 R;  5CQY A;  4HCK A;  3MKD A;  3VUB A;  1VQM A;  1SPK A;  3VS3 A;  4XAX B;  2K3X A;  4OMF B;  3HFO A;  4BY6 C;  4F16 A;  3JAM E;  1VQK Q;  4OB2 B;  3OS2 A;  2V8I A;  2CYZ B;  2CZ1 B;  4KH0 B;  1N9R A;  2QDL A;  4M78 D;  2AZS A;  1D0Z A;  1OX8 A;  3IQL A;  2RQR A;  2F5T X;  2QQA A;  2CZ6 B;  4M7D F;  4PLL A;  1UTI A;  1YHQ A;  1SRM A;  3M0T A;  1MNE A;  4F7U G;  4AFU C;  3HFN A;  1T3L A;  4PJN A;  2CUD A;  4OF1 A;  4QKU A;  4M7D B;  2YUO A;  1RAB B;  1PSE A;  2CP7 A;  3JCM Q;  3SWN C;  1AVZ C;  2JM8 A;  2F5K A;  3G4S T;  1ARK A;  4O6J A;  2MCN A;  2JOY A;  4MZP A;  5KYY A;  5GAO l;  1ACM B;  2V26 A;  5KYW B;  5GMK m;  2CKK A;  2WSF E;  2LCS A;  3RKX A;  2D0N A;  3CCS Q;  5D7U A;  4M7A B;  1JJ2 S;  4HA8 A;  3I5R A;  3VU3 C;  2C0O A;  2FO0 A;  1YJW A;  3CCU A;  1IRE B;  2OTL T;  3F70 A;  2E6Z A;  1Y57 A;  2L5Q A;  2YLC A;  5CR2 A;  4M7A F;  1H64 1;  3REB B;  1NJI C;  3PVL A;  5I2S A;  1KQ2 A;  3OYC A;  4Y92 A;  2ZZD A;  1K9M R;  2EVR A;  2WSC E;  4FYX B;  4K11 A;  1WQ7 A;  4JZ3 A;  3CCE T;  3I5S A;  4ZTF A;  4HCC A;  4PLI A;  5CVI A;  1N27 A;  5GAN 4;  2JJ9 A;  2RK1 A;  4WF2 A;  4BE0 A;  2QA4 Q;  3EG9 B;  1QVF A;  6AT1 B;  2KSS A;  3FEO A;  4EIK A;  4NS5 A;  3FDR A;  4RCB A;  1I5O B;  3CCS A;  3BW1 A;  3I56 A;  2HSP A;  2LZ6 B;  3KFV A;  4M78 E;  4HXJ A;  1S72 Q;  1TTH B;  2KGT A;  1X2Q A;  3OMG A;  5DLQ E;  5IHN A;  4HT9 A;  2DD5 A;  1SHG A;  3CCJ T;  4IUP A;  2DIG A;  4J9D A;  1WX6 A;  1PWT A;  2RNA A;  2DXU A;  4LD6 A;  2LNV A;  3CC2 A;  4WCI A;  1A0N B;  2WAC A;  2DJQ A;  3PTA A;  2R57 A;  1D1B A;  2M0O A;  1M90 C;  3JCM W;  3X24 B;  2RI3 A;  2DEU A;  3AT1 B;  4LDV A;  2HEQ A;  4OP0 A;  2G3R A;  4AMC A;  5EG2 A;  1M8M A;  2XID A;  3E19 A;  2QEX Q;  2JXB A;  1VQ8 T;  2QG9 B;  4IUQ A;  3OY9 A;  3SD4 A;  1PKT A;  3CCJ Q;  2YSQ A;  3MEW A;  2QA4 A;  4RG2 A;  2LQN A;  1D0X A;  1H8K A;  3EFS A;  2CGH A;  1YIJ T;  4EMK C;  1X75 C;  3OMC A;  1YHQ T;  3ULR B;  1VQ9 T;  3P8H A;  3OYN A;  3OYH A;  4IIM A;  2COW A;  3JCM P;  2CSQ A;  1C6V X;  1FMK A;  1KD1 U;  3EH2 A;  1D3B B;  3GOX A;  3OYK A;  2YRV A;  1UHF A;  1VQ4 T;  2DTH A;  2EQJ A;  1GBQ A;  1YJ9 A;  1VQ6 Q;  3EG0 A;  4BD3 A;  3H0I A;  2QQR A;  4M7D E;  2CP6 A;  2D1X A;  2XK0 A;  4PFZ A;  5KCO A;  2ROT A;  1RAC B;  4JLG A;  3VRY A;  2KK4 A;  5GAN j;  3REA B;  4JS4 A;  3RUX A;  4E2F B;  2KT8 A;  1GFD A;  1RAI B;  2SEM A;  1NEB A;  4PK4 A;  4C8Q E;  1N6A A;  3L2Z A;  3M56 A;  1ZSZ B;  3DKM A;  1M3B A;  1EFN A;  1VQ6 T;  1TH7 A;  2EWN A;  2VWF A;  1YJN A;  1O9S A;  2CP5 A;  5HK3 A;  4D8K A;  4J9E A;  1KJW A;  1IGQ A;  3CCU Q;  2CH4 A;  5D6W A;  1BYM A;  1G83 A;  1K9M C;  1I1J A;  4M78 B;  4X9D A;  1X6G A;  2PVG B;  2PTK A;  3GNG A;  3FJ5 A;  4X1V A;  3UWN A;  3CBP A;  4CC2 A;  3ZL7 C;  2RQT A;  1KIK A;  3SB2 A;  2JMA A;  2M16 A;  1ZA2 B;  3M9Q A;  1LPL A;  5GAN 8;  1M90 R;  2IPO B;  2QA4 T;  4BY6 B;  5AYF A;  2FZG B;  4JZ4 A;  1TOV A;  4C92 G;  1QVF S;  2L89 A;  4N0A C;  1WZO A;  2XDP A;  2DET A;  1YWO A;  2ZPG B;  2LNH B;  3C4S A;  2IIM A;  4N4H A;  5CKE A;  1FYN A;  1LVK A;  1PRM C;  2J6K A;  2M0Y A;  1Y96 B;  1VIE A;  3CME A;  1JXM A;  1K8A R;  1RLQ C;  3PE0 A;  4M7D C;  2K5I A;  5CO7 A;  2J7I A;  3FRN A;  1QWE A;  1ZA1 B;  1RI9 A;  1KSW A;  4II1 A;  3CCR A;  3G7Z A;  4ZNX A;  3EG3 A;  3CPW S;  2DK3 A;  1WIE A;  2NUP B;  3KUF A;  4FSS A;  3OYA A;  3QDF A;  2KVQ G; 
#chains in the Genus database with same CATH homology
 2EYX A;  2BZX A;  4A63 B;  2KXC A;  4HVW A;  1N5Z A;  1X27 A;  2J6O A;  3QWX X;  2J6F A;  2CT3 A;  3EGU A;  1VYV A;  1QKW A;  4J9G A;  4CC7 A;  1YNZ A;  2FPF A;  1T3S A;  1WXB A;  4GLM A;  2OI3 A;  4LUE A;  2EBP A;  2FPD A;  1WYX A;  2AKL A;  4RTV A;  2O31 A;  2YUN A;  1JXO A;  1WXT A;  1ZBJ A;  3UA6 A;  2AK5 A;  2LQW A;  1YWP A;  2GNC A;  2KXD A;  1IO6 A;  2F2X A;  1JO8 A;  4JJB A;  2VKN A;  3UAT A;  1RUW A;  2P4R A;  5FW9 A;  2YDL A;  2KRM A;  2DX1 A;  2JTE A;  1OEB A;  3EHR A;  4J9H A;  3VS7 A;  2EKH A;  1VYU A;  2NUZ A;  4LUD A;  5HCK A;  5I11 A;  1H3H A;  2EGA A;  5GJV B;  2CSI A;  4DEX A;  1WI7 A;  2D8J A;  4HVU A;  2OAW A;  2W10 A;  2MOX A;  2JT4 A;  2KT1 A;  1WXU A;  1NG2 A;  1OOT A;  1OPL A;  2ESW A;  2KBT A;  3NGP A;  4AG1 C;  2CRE A;  1UJY A;  1X43 A;  5GJW B;  1B3Q A;  2B86 A;  2EQI A;  1XOV A;  2O9V A;  2RQU A;  2KYB A;  1WFW A;  1AWO A;  2RQW A;  1E6G A;  1UGV A;  1PKS A;  2A08 A;  2JMC A;  2KEA A;  2W0Z A;  2CT4 A;  3VRZ A;  3VS6 A;  1AOJ A;  4JJC A;  2V1Q A;  1K9A A;  1MV0 B;  4RTY A;  2GQI A;  2EGC A;  2HDA A;  2J06 A;  4RTW A;  4Z8A A;  4LN2 A;  2K6D A;  1AWW A;  5FWC A;  2JW4 A;  2ED0 A;  4IIO A;  1JU5 C;  1UFF A;  3UA7 A;  1UEC A;  2DIL A;  1M30 A;  3NPF A;  3NMZ C;  2HBW A;  2GTJ A;  2EW3 A;  1GBR A;  1AEY A;  2K3B A;  4HCK A;  1SHF A;  2L2P A;  2LX7 A;  3VS0 A;  2GGR A;  1SPK A;  3VS3 A;  1GFC A;  1ZSG A;  1K0X A;  1BK2 A;  3UF4 A;  3LH5 A;  1T0H A;  4F16 A;  1H92 A;  1NYG A;  2AZV A;  2K79 A;  1ZUY A;  2O9S A;  1JQQ A;  1TUC A;  4QT7 A;  1M3A A;  4ESR A;  2QDL A;  1QCF A;  1ABO A;  2AZS A;  2DL5 A;  3I9Q A;  1V1C A;  3IQL A;  2F2W A;  2DLP A;  2BTT A;  2RQR A;  2KR3 A;  4AFQ C;  3VS4 A;  2ABL A;  3VS2 A;  1UTI A;  1SRM A;  2NWM A;  3M0T A;  2GBQ A;  5L23 A;  1UUE A;  2DNU A;  4AFU C;  3M0S A;  2O2O A;  2DMO A;  1ABQ A;  2LJ1 A;  1T3L A;  5I22 A;  2CUD A;  2YUO A;  2BZ8 A;  1UJ0 A;  2LP5 A;  1M27 C;  1Y0M A;  2ECZ A;  1NEG A;  1AVZ C;  2DE0 X;  2JM8 A;  2YUP A;  1ARK A;  3M0P A;  2AKK A;  1I0C A;  1K76 A;  2MCN A;  1JEG A;  3M0R A;  2X3W D;  1VA7 A;  4Z88 A;  4DEY A;  2RN8 A;  4RTT A;  2LCS A;  3U23 A;  3CQT A;  2D0N A;  1UDL A;  5EC7 A;  3I5R A;  1AWX A;  3VS1 A;  1GCQ C;  2C0O A;  1K1Z A;  2FO0 A;  1G2B A;  1Y57 A;  2CDT A;  1K4U S;  1Z9Q A;  2K9G A;  1Z9Z A;  3REB B;  3PVL A;  4OMO A;  2V1R A;  4Y92 A;  1PNJ A;  2HCK A;  1U06 A;  2M51 A;  2CH4 W;  3M0U A;  2E5K A;  2OJ2 A;  2EVR A;  4GBQ A;  4K11 A;  2DL4 A;  1BB9 A;  2DVJ A;  3THK A;  4JZ3 A;  3EG1 A;  3I5S A;  5IH2 A;  1HSQ A;  2LJ0 A;  2MIO A;  3QWY A;  3H41 A;  1MV3 A;  1W6X A;  4J9I A;  1NLP C;  4OMM A;  2FPE A;  1SEM A;  1NYF A;  1CSK A;  1T0J A;  1YCS B;  2A36 A;  1PRL C;  1ZUU A;  3TVT A;  2H8H A;  4EIK A;  2HSP A;  2LZ6 B;  3RBB B;  1YN8 A;  3KFV A;  2JM9 A;  4HXJ A;  2CUB A;  2KGT A;  1X2Q A;  5IHN A;  3M0Q A;  1E7O A;  1SHG A;  4J9D A;  1B07 A;  1WX6 A;  2EPD A;  1PWT A;  2RNA A;  2VVK A;  4RTU A;  1X6B A;  4J9F A;  1GL5 A;  4WCI A;  1A0N B;  3A98 A;  1NM7 A;  2DJQ A;  2PNI A;  2YT6 A;  2KE9 A;  1SRL A;  2DBM A;  2YUQ A;  1K0S A;  2SRC A;  1J3T A;  2X3X D;  1MUZ A;  2HEQ A;  1BU1 A;  1HJD A;  1W70 A;  4AFS C;  3I35 A;  1TG0 A;  1M8M A;  1OV3 A;  2JXB A;  1UHC A;  3PVQ A;  1SSH A;  2KYM A;  4OMQ A;  1TUD A;  1PKT A;  1ZLM A;  4F17 A;  2KNB B;  2YSQ A;  1LCK A;  2ROL A;  2RPN A;  2LQN A;  1H8K A;  2A37 A;  2EYZ A;  1UE9 A;  2DL3 A;  1ZX6 A;  4OML A;  3ULR B;  1AD5 A;  1X2K A;  1NLO C;  4J9B A;  2EYY A;  2K2M A;  4IIM A;  2G6F X;  2DL8 A;  2CSQ A;  2DRM A;  2EGE A;  4OMP A;  5IHI A;  3SEM A;  1FMK A;  1CKA A;  4CC3 A;  1AZG B;  1UHF A;  2XMF A;  1KFZ A;  2EYW A;  1GBQ A;  2K7A A;  2RF0 A;  3EG0 A;  2A28 A;  2LMJ A;  3H0I A;  2KRO A;  3GBQ A;  2JS0 A;  2L0A A;  3C0C A;  2D1X A;  3TSW A;  1BBZ A;  4JPB W;  4Z89 A;  2ROT A;  2FG0 A;  4E6R A;  3VRY A;  2F2V A;  4R0K A;  1QLY A;  2DYB A;  3REA B;  1E6H A;  4M4Z A;  3NHN A;  2C0T A;  2JS2 A;  2KT8 A;  1GFD A;  1HD3 A;  4JJD A;  2SEM A;  1NEB A;  5IHK A;  1U5S A;  2D8H A;  4ORZ A;  4CC4 B;  1VYT A;  3EHQ A;  3JV3 A;  1M3B A;  1EFN A;  2ED1 A;  2GTO A;  2VWF A;  3EG2 A;  4RUG A;  4AG2 C;  2C0I A;  2I0N A;  4D8K A;  4J9E A;  1KJW A;  2CH4 A;  2J05 A;  4KRT A;  3TSZ A;  1W1F A;  1G83 A;  1I07 A;  1I1J A;  1X6G A;  2PTK A;  5ECA A;  3H0H A;  3RNJ A;  3FJ5 A;  1PHT A;  2L3S A;  4X1V A;  4CC2 A;  3ZL7 C;  5FWB A;  2RQT A;  2DA9 A;  1KIK A;  1RLP C;  2JMA A;  3VS5 A;  1OPK A;  2L3P A;  1U3O A;  5IXF A;  2FRW A;  4J9C A;  1GCQ A;  1QKX A;  1QWF A;  1X69 A;  2O88 A;  2L3Q A;  4JZ4 A;  4HVV A;  2FEI A;  2RQV A;  1YWO A;  1YP5 A;  2LNH B;  1CKB A;  1GRI A;  1S1N A;  2IIM A;  1FYN A;  5IXB A;  4D8D A;  1PRM C;  2KRS A;  2DL7 A;  2J6K A;  2M0Y A;  2ENM A;  1WA7 A;  1WDX A;  2BZY A;  3SHW A;  2DM1 A;  1JXM A;  1RLQ C;  2FRY A;  4LNP A;  1ZUK A;  3PE0 A;  2LJ3 A;  1UG1 A;  2DF6 A;  4RTX A;  2DRK A;  4AFZ C;  3H0F A;  2RMO A;  2DBK A;  2J7I A;  1GCP A;  4RTZ A;  4F14 A;  1AZE A;  1QWE A;  4LE9 A;  1WLP B;  1RI9 A;  3R6N A;  2PZ1 A;  1KSW A;  4ZNX A;  1M3C A;  3EG3 A;  1WIE A;  2KRN A;  4FSS A;  3O5Z A;  4OMN A;  1AWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...