1PHTA

Phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain, residues 1-85
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
AEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of P13K SH3 domain at 20 angstroms resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphotransferase
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1995-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1phtA00
3UA6A 1K4US 1UECA 2F2XA 1A0NB 2JMCA 1ZUKA 1J3TA 2P4RA 2EKHA 1HJDA 1RLPC 4JZ4A 2K79A 1M3AA 1QWFA 4OMQA 2D1XA 1Y57A 2KRNA 4RUGA 4AFSC 2FG0A 2QDLA 3H0FA 2DJQA 1TUDA 1UJ0A 2ED0A 2FRYA 3VS0A 5IXBA 2LQNA 1BB9A 1T0HA 3PVLA 3VS2A 2DVJA 2L0AA 1RLQC 1GL5A 2BZXA 1K0SA 1W1FA 1PHTA 1I1JA 3ZL7C 1MV3A 2DRKA 1ARKA 2C0OA 2ROLA 2LZ6B 4J9CA 1B3QA 1WXTA 3UA7A 2ECZA 3EG3A 1JO8A 1QLYA 2EPDA 4JJCA 1U06A 5I11A 3VS4A 2D0NA 2DE0X 2O9VA 2E5KA 2RQWA 1PWTA 2YT6A 1B07A 1NYGA 2CT3A 2MIOA 2EYZA 2V1RA 1AZGB 4F14A 1KJWA 1NLPC 2KE9A 1K9AA 2CREA 2JW4A 2SEMA 1X2KA 2YDLA 4D8DA 2JT4A 2CDTA 1VYVA 2KYMA 1YWOA 2F2VA 1X6BA 4OMNA 4A63B 3H0HA 3VS5A 2KROA 2YUOA 5FWBA 3EGUA 3M0TA 2YSQA 3SHWA 1QKWA 2CSQA 4RTVA 2EVRA 1AD5A 2PZ1A 1JXOA 1MV0B 4E6RA 1WX6A 4RTUA 1OOTA 1YWPA 1WLPB 3M0UA 2HDAA 2AKKA 3EG0A 1WXBA 1CKAA 2NUZA 1U3OA 1FYNA 2JMAA 2LJ0A 2YUNA 4RTYA 1X6GA 1X69A 1YN8A 3TVTA 1M8MA 1YP5A 4J9FA 2YUQA 3KFVA 2JM8A 4F16A 1Z9QA 2I0NA 1GCQA 1SRLA 2HEQA 2FPDA 2G6FX 1SRMA 1X43A 1JU5C 4EIKA 5IXFA 3VS1A 1RI9A 2IIMA 3FJ5A 2J6OA 1OEBA 1AOJA 3SEMA 1QKXA 2O31A 3NGPA 1W70A 4HVWA 3I5RA 1S1NA 1RUWA 1SEMA 1NYFA 2J6KA 3I9QA 3VS6A 2CUDA 1AWWA 1KSWA 1T0JA 2HSPA 2CUBA 2JS2A 1BBZA 1NM7A 1ZLMA 3NHNA 1AEYA 2K3BA 1VYUA 2FEIA 3JV3A 1Z9ZA 2X3XD 4LE9A 1CSKA 3EG2A 5GJVB 2M51A 1PNJA 4HCKA 4AFQC 2OAWA 3THKA 2EGAA 3O5ZA 4LN2A 1N5ZA 2A28A 1M3BA 1ZUUA 2A08A 2B86A 2J6FA 1AWXA 2KNBB 3I35A 3U23A 4RTZA 3GBQA 2FO0A 2EYXA 2H8HA 2PTKA 1UJYA 3IQLA 1SHGA 3LH5A 1SHFA 1SPKA 3M0RA 2DL4A 3VRZA 1SSHA 3NMZC 3QWYA 4IIMA 4JZ3A 2L3SA 1Y0MA 4AG2C 2KXCA 1M30A 2KXDA 4IIOA 2D8JA 2FPFA 2YUPA 2DRMA 4R0KA 1AWOA 3H41A 3M0PA 1M3CA 1VA7A 4GBQA 4J9DA 2JM9A 3RBBB 2LNHB 4J9EA 5FWCA 1AVZC 1PKSA 2AZSA 2W0ZA 1ZUYA 2RQVA 4GLMA 4DEXA 2MCNA 1G83A 4ESRA 3VRYA 2HBWA 3EG1A 3R6NA 2A37A 2KBTA 2JS0A 2K9GA 1K1ZA 4RTTA 3NPFA 4QT7A 2L3PA 1UHCA 2LMJA 4OMPA 1AWJA 2ABLA 1NEBA 2DL5A 2GBQA 1U5SA 1GRIA 1GBQA 2AKLA 1TUCA 2DILA 2J7IA 2KYBA 1UG1A 2DL3A 4AG1C 1GFDA 1OPKA 3REAB 1H8KA 2AZVA 1UUEA 3EHRA 4JJBA 2VWFA 4RTXA 4DEYA 1GFCA 4JJDA 1LCKA 2RNAA 1ABQA 2D8HA 2EYYA 2AK5A 1KFZA 4JPBW 2BTTA 1TG0A 1GBRA 2J06A 4OMLA 1K0XA 1K76A 1UE9A 2DBKA 4K11A 2K2MA 1E6HA 2F2WA 1T3SA 2M0YA 1H3HA 2KRMA 5IHIA 5L23A 2DA9A 1QCFA 2GNCA 4KRTA 2LJ3A 3REBB 1KIKA 1WXUA 1I0CA 2DF6A 4CC2A 5IHKA 1M27C 1V1CA 2KRSA 4LNPA 2DL8A 2RPNA 5HCKA 4AFUC 1JQQA 2L3QA 2DNUA 2MOXA 3I5SA 1UFFA 4HVVA 4WCIA 4D8KA 1GCPA 2J05A 1JEGA 2KR3A 2GTOA 2XMFA 4CC7A 1W6XA 2OJ2A 2EYWA 5I22A 2O88A 2FRWA 2RN8A 2RMOA 1UHFA 2DL7A 2LP5A 2LX7A 1I07A 2X3WD 4M4ZA 4LUEA 1AZEA 3PE0A 3TSZA 2EGEA 1UGVA 1PKTA 1HSQA 4J9GA 4OMOA 1FMKA 2CSIA 1JXMA 2CH4W 3H0IA 3RNJA 2EBPA 2VVKA 1CKBA 2DMOA 4RTWA 4OMMA 2O9SA 2ED1A 2FPEA 4ZNXA 1WFWA 2NWMA 4J9BA 2GTJA 2C0TA 5IH2A 2PNIA 1EFNA 3QWXX 1G2BA 2GGRA 2LJ1A 2LQWA 1VYTA 2DYBA 2RQRA 2ESWA 2RQTA 3EHQA 3TSWA 2A36A 1H92A 2KT1A 1YCSB 2KEAA 5EC7A 1ZX6A 2EW3A 2VKNA 3UF4A 1BU1A 1T3LA 1ABOA 2W10A 1BK2A 1PRMC 1PRLC 1UDLA 2BZ8A 1X2QA 1NG2A 2GQIA 2CT4A 2ENMA 2CH4A 2BZYA 4CC3A 4Z89A 1UTIA 2JTEA 1E6GA 2JXBA 2RQUA 1OPLA 2EQIA 1OV3A 2OI3A 2KT8A 5GJWB 5ECAA 1WA7A 4HVUA 2C0IA 2DX1A 4CC4B 2V1QA 3PVQA 4AFZC 4HXJA 1YNZA 4J9IA 3ULRB 3VS3A 1HD3A 2DLPA 1NEGA 4FSSA 3CQTA 3M0QA 4Y92A 5FW9A 2L2PA 1E7OA 1WIEA 1QWEA 4J9HA 1GCQC 4F17A 1ZSGA 2SRCA 2ROTA 3UATA 3M0SA 4ORZA 2RF0A 1IO6A 1WI7A 4X1VA 1MUZA 4Z88A 3VS7A 1X27A 2DBMA 2DM1A 2EGCA 2KGTA 4Z8AA 2HCKA 5IHNA 1NLOC 1ZBJA 4LUDA 2K6DA 3A98A 1WYXA 1WDXA 1XOVA 3C0CA 2K7AA 2O2OA 2LCSA
chains in the Genus database with same CATH superfamily
3UA6A 1K4US 3GNFB 1UGPB 3CCLA 1OX9A 3OBYA 2XD0A 1F1BB 1TUGB 2K79A 3RERA 1M3AA 3S3MA 3EFSA 4C0DB 4PLIA 2D1XA 1Y57A 1VQ7T 1M2VA 3LW5E 1SKUB 2QEXQ 4QKUA 2R57A 4L59A 3VS0A 4A4GA 3QJ6A 2LQNA 5FLXE 4NS5A 1RLQC 5GANf 4C0FA 5GAMd 1I1JA 1KQ1A 4BB7A 1IGQA 1ARKA 1R0CB 2YRDA 2ROLA 3FJPA 3JCMg 1YJNQ 3JCMe 2EPDA 2FVUA 2P4TA 4HA8A 2D0NA 1VQ7A 3OYFA 1VQNT 3L1AA 3OSVA 4XTYA 2RQWA 5FU6C 2E5KA 3AT1B 5LJ3j 3JAME 4M7DA 4PJOD 1B07A 3CCJQ 1VOMA 2EYZA 5C6SA 3E9FA 1K9AA 2BKDN 5AT1B 4D6WA 1YBYA 2K4YA 3ZEHA 1KD1C 3FC3A 3OS2A 2KK4A 2QTVA 5D7UA 2YUOA 3MCAB 5KCHA 1K8AU 1VIEA 2EVRA 1AD5A 4RMOA 1JXOA 1QP3A 2JTMA 1K9MC 3EG0A 1Q81R 2QDYB 1VQOT 3BDUA 2OTLQ 3HL8A 2VC8A 3A8LB 1JRIA 2E10A 1VQ6Q 1U3OA 1RAGB 2CP6A 2QQRA 2E65A 2GFUA 5GAOp 1JJ2P 4BUGA 2RJEA 3CMAT 2K5IA 1VQ4A 2PVOB 4PJOE 1YN8A 1YIJT 4J6YA 1R8OB 4B6MA 1YP5A 4KUDK 4M7DD 2IPOB 3KFVA 3M4YA 2L89A 4F16A 3OYMA 1KK7A 2RHZA 1SRLA 2HEQA 2PUOB 2VB6A 4EIKA 3OYBA 2AHJB 1RI9A 1OZ2A 3Q1JA 1PD1A 4Y91A 2V8JA 2DPPB 2O31A 2BE9B 3L2RA 3NGPA 2QGGA 3FRNA 1YHQQ 1RUWA 2R58A 3I9QA 4PFZA 4PKCC 2OTLT 2XICA 1M1KU 1YIJQ 4ZGJB 4OB0B 3GP8A 1BBZA 4E7HA 4LE9A 4PFPA 1RL2A 2QQ9A 3SWNB 2M51A 1VQ9T 4HCKA 3OYAA 3THKA 2G3RA 2EIFA 2KAFA 2M16A 2KNBB 4C8QE 5CK9A 3GBQA 2EYXA 1D3BB 3G6EQ 3CCQA 1M1KR 1SHFA 1SPKA 1YHQA 3CCJA 3C12A 2DL4A 3VRZA 3SB2A 1Y0MA 2JN0A 3CBPA 3CXCP 3VYHB 5GANd 3CCUQ 2X4JA 5CKHA 1P92A 1AWOA 3CPWP 1Q82C 2YXYA 1YITT 4A4FA 3G7ZA 4J9EA 3CCMT 2W0ZA 4DEXA 4BE2A 3OYGA 4ME7A 4J7IA 1FXXA 3VRYA 4M7DC 3EG1A 2A37A 2M02A 3OYDA 4KH0B 1VQ6A 2KBTA 3NPFA 1PCXA 1MGQA 2OX7A 5GAMg 3BW1A 2LMJA 2RB6A 1U1SA 3LGFA 3UPUA 1I8FA 2ABLA 2IVWA 1GRIA 4J7FA 4M7DF 5KYUB 1TUCA 1ZA2B 1BI1A 1NBEB 1D0YA 3O8VA 4M77C 1WPYA 4EPCA 3G71Q 3REAB 3BFMA 4M77B 5GAN6 2EJGA 1VQNQ 1SF9A 4NL3A 2MF2A 1OULA 4MMLA 2AK5A 4JPBW 3A8OB 2V8KA 1TG0A 4QVDA 2J06A 5GAMj 1K0XA 1K76A 3SD4A 1UE9A 4C5GA 3PTAA 2K3XA 3A8HB 4LDVA 1JJ2A 1WHLA 1KHCA 3QXEB 5IHIA 5L23A 1VQ4Q 1QVFP 1K73C 2QXFA 2LJ3A 4M75B 4AT1B 1NJIC 5LL6S 2OTJA 1I0CA 1XTDA 2CP7A 1BI3A 4CC2A 3BE3A 1VQKA 3R6OA 2HNIA 2MWOA 2RPNA 4BDZA 3MKDA 4AFUC 4EDUA 1JQQA 2MOXA 1G3TA 3QZ5B 3CCEA 4C8QA 4WCIA 1PC0A 1GCPA 2J05A 1JEGA 5GAN2 2XMFA 2QQAA 1BYMA 3H9NA 1U1TA 2DD5A 2LTOA 2RHUA 5I22A 2O88A 1QMCA 1VQ6T 1FMWA 3PMTA 2LNVA 4OB2B 4F04B 3T9NA 3CC4Q 1H641 4LUEA 3TSZA 4J9GA 1HSQA 5CR2A 2CSIA 3CEYA 4C92C 3H0IA 4PK4A 2HD0A 1LOJA 1W2BA 2P0PA 1QW1A 2LCLA 2EJFA 2ED1A 2EJ9A 2FPEA 2YLCA 2RJDA 4J9BA 1YJNA 2EQUA 2PNIA 5KYXB 1G2BA 2GGRA 4E7JA 2LQWA 2DXTA 1VYTA 5LJ3h 2E6NA 1Q86C 2ESWA 3TSWA 2A36A 5LJ5h 1JBMA 4F7UG 1N8RR 3EG9A 2GCXA 4JS4A 1UGQB 1ZQ1A 1ABOA 3CC2A 2W10A 1BK2A 4F7UE 1KD1U 1X2QA 2GQIA 2ENMA 3H8ZA 2CH4A 5CKDA 4Z89A 1Q81C 4OGCA 1VQ8Q 4M75E 3CD6A 3RIRA 1OPLA 3OYYA 1QVFA 3UWNA 1PSEA 5GAMe 4PFOA 2GFAA 5CIUA 2ZCFB 1X01A 4HVUA 3LWHA 4BY6C 3J81E 5J3BA 4PJMA 5L8RE 3QKJA 3P8BB 5FW9A 2HZYA 2F5TX 1WIEA 1GCQC 2SRCA 2ROTA 1YCYA 1VUBA 4M7AE 1IB8A 4BI3A 3CCLT 1RAIB 4X1VA 1WI7A 3RMSA 4LD6A 5LJ3d 1X27A 2EGCA 4ANJA 2KGTA 2HCKA 3TREA 3S3OA 3JCMf 2OTJT 2K6DA 3A98A 1OX8A 1WDXA 1YJ9Q 1VQPT 4ATOA 2O2OA 2RM4A 2DERA 1UECA 1FX7A 2JMCA 4IUQA 1ZUKA 4FYWB 1J3TA 2EKHA 5DY9A 3CD6Q 2EKOA 2MK5A 2QG9B 4OMQA 1LJOA 2KRNA 4RUGA 3V7RA 5KYWB 2DK3A 3V7SA 2FRYA 1ZHIA 4MZTA 4LXCA 1RAHB 5KE3A 2HL3A 5HKCA 1K73R 2L0AA 2P0QA 2BZXA 1K0SA 1YJ9A 3CCMQ 1PHTA 4F7UB 2C0OA 3TU4K 2ZPGB 4HCBA 3KBGA 4J9CA 3G1JA 1WXTA 2ECZA 1MNDA 4C5EA 4M7AC 4IUPA 3AHUA 3CC4T 2DE0X 4ZTJA 2HAXA 1WZOA 1M4ZA 3RMQA 2HSEB 1PWTA 2YT6A 4RG2A 3RKYA 4KUIA 2ZAEA 3NTHA 1D1AA 4JRQA 4F14A 2EQMA 2JW4A 2RJCA 4FT2A 4J5YA 4XU0A 4D8DA 4N4GA 4FW1A 1FMVA 5DLQE 2KYMA 2RH2A 1X6BA 3CCRA 2CGHA 5GMKi 3M0TA 1QKWA 2JTFA 4RTVA 1MV0B 3MHXA 1R77A 2B8AA 2HDAA 3CMEQ 2QYZA 1WXBA 4FM4B 2X51A 2NUZA 2CKKA 1D09B 1M8VA 2QA4Q 2MPXC 4C92B 1RABB 4OP0A 1C1AA 1VQ5A 1X6GA 4PJOA 4MDXA 3QBYA 1M8MA 1MMGA 2HQHA 5GMKh 2YUQA 2JUFA 3HKSA 1YJWT 2CZ0B 3OYEA 1RACB 3CMEA 5FU6B 3CCST 3QG1A 4FYYB 1N8RU 3RDVA 3CCLQ 5I2MA 3FJ5A 2YHTA 2J6OA 2Z0WA 2ZPEB 1OEBA 4M75D 3CC7T 3SEMA 3OMGA 1I5OB 4XK8E 3PIPA 3I5RA 1NYFA 2CUDA 2FZCB 1AWWA 1D1CA 4LDWA 1NJIR 2JS2A 4J8OA 3NHNA 1RADB 3V7CA 4OMFB 4J6XA 3M53A 1QVGS 3QIIA 2HMAA 1D3BA 1V76A 1PNJA 4AMCA 4L6V5 2OAWA 2XG8D 4C0ZA 2EGAA 1N5ZA 2H3EB 1M3BA 1ZUUA 4ZN3A 1R0BG 2B86A 4BY6B 1AWXA 3U23A 4CI0C 1WHGA 2PTKA 3LH5A 2ATCB 1GXIE 3CCJT 1NJIU 3M0RA 3I56Q 1SSHA 4IIMA 5GANe 4JZ3A 1MMNA 1M30A 2HBPA 4IIOA 2FPFA 2DRMA 1M3CA 4E2FB 2WACA 2JM9A 2LNHB 2K2VA 1AVZC 3JB9H 2NUTB 4VUBA 1Y07A 4M78D 1ZUYA 3MPUB 4JLIA 2LT1A 3RESA 2MCNA 1G83A 5C0MA 1VQ9Q 3INZA 4KULA 1KQSP 2KSSA 4FSXA 1YI2Q 3QZ9B 2VYTA 5CO7A 3PNWC 4IUTA 2FZGB 4QT7A 4XQ3A 5A0LA 4BE1A 4HCZA 1TOVA 3A8MB 1UHCA 3L2QA 4OMPA 4LDUA 4V2SA 1W2BP 1G8XA 3OY9A 2DL5A 3OQ5A 2RD1A 1QP2A 1MMDA 4JRPA 1C6VX 1GBQA 2AKLA 1G3WA 1VQLA 3LH0A 2QTXA 2JJ9A 3MP1A 3OA6A 9ATCB 1QCOA 2CP2A 4DEYA 1GFCA 2CP3A 2CYZB 3CPWA 3RR6A 3P8HA 2C06A 4JJDA 4M75A 2R5AA 1ABQA 3OYLA 1KFZA 3CCRQ 2FB7A 2DD4A 1V29B 5KYWA 3G6EA 1E6HA 2HL5C 4C0GA 2KRMA 2VV5A 2X4XA 2ZZDA 1JJ2S 4O5VA 1QCFA 4KRTA 4M75G 3G71T 3OYHA 1WXUA 3PT9A 2DF6A 2LDMA 5IHKA 2E12A 2WSEE 4ZGEB 2VUBA 2KRSA 2DL8A 4XTXA 2CZ7B 1YIJA 2L3QA 3I5SA 2VXFA 4HVVA 4R56A 3OW2A 3OYCA 3CMAA 1KC8C 4D8KA 1OYXA 3OBWA 5KCOA 2KR3A 1WJSA 2GTOA 1YJNT 1WQ7A 3FDRA 1W6XA 3CC4A 4M77G 2RN8A 4IUVA 2XHCA 2LX7A 1I07A 1AZEA 4RCCA 5GAN7 3JCMd 4OMOA 5DM7R 1FMKA 1JXMA 3FIFA 1A0NB 1VQ7Q 4QVCA 1BI2A 4OMMA 2R5MA 4XTUA 1DJ7B 1O9SA 2MYSA 1WFWA 3QHSA 2GTJA 2C0TA 1JB0E 1EFNA 3CCSQ 4QQGA 1D0ZA 3DB3A 2WSFE 4C8QD 3EHQA 1H92A 2JNGA 2LQ8A 2KT1A 1WQWA 2KEAA 4ZTFA 3UF4A 4PJNA 3OB9A 4NOYA 1NPPA 1WGSA 4RCBA 4FIBA 1WHKA 1KHIA 3CXCS 2QA4T 1VIFA 4M7DG 4XU3A 2JXBA 4MMKA 2RQUA 1K9MU 3CPWS 2VGMA 4KH1B 5KH6A 5GJWB 1WA7A 4JUVA 1TS9A 4CC4B 3TCJA 1XJWB 4HXJA 4QQ6A 1PSFA 4DOVA 1KQ2A 3VS3A 1HD3A 4HKEA 1NEGA 4XTWA 4PNOA 5IAYA 4EMGA 1E7OA 3HSBA 1M90C 2DKGA 2DJZA 4F17A 2RK1A 3LGLA 4ZN1A 2RF0A 4CRIA 3X28B 2DM1A 4IURA 1IHVA 1WYXA 1QQJA 1Q95G 1VQMA 3G4SA 1XNIA 1I5LA 1M9SA 1IRXA 2D6FA 2X9HA 5GMKl 2P4RA 5LJ5g 1RLPC 3TQ7P 4JZ4A 2NUPA 4C0DC 3L42A 5GMKe 4FYXB 7AT1B 4AFSC 2MI6A 3H0FA 3OYKA 1I81A 1TUDA 2GF7A 5DLOA 1Q7YR 2ED0A 4ZGDB 1BB9A 4Q5WA 3CC7Q 1C0MA 5LJ3f 2DVJA 1GL5A 1VQPQ 2RHYA 1W1FA 3M57A 2E1HA 2O4XA 2RO0A 1RAFB 2X4YA 3BY7A 2DRKA 4X9DA 3CCEQ 2LZ6B 1B3QA 1RAAB 2NLUA 2K5LA 4KGVB 4M78F 4XU1A 1JO8A 1QLYA 2ZGWA 1IXDA 2MMPA 3RKWA 1S72T 2D0QB 1NE8A 4M7DB 4M78B 2CT3A 3NTKA 3L2WA 1AZGB 2DEUA 1LNXA 2PU9B 4C92G 1Q81U 2CREA 1XQHA 1X2KA 4JRIA 2YDLA 2ZPHB 5M9OA 4KGXB 5LJ3g 3CCMA 3GIBA 3DKMA 2BIVA 3H0HA 3VS5A 2V26A 2KROA 3EG9B 5FWBA 2E5QA 2DXUA 2EFIA 4OF1A 2QGFB 4TVRA 1WJQA 3JCMJ 2COYA 3OSSC 4E6RA 2DTHA 1OOTA 4RTUA 1WLPB 2EWNA 2AKKA 3QJYA 1Q7YU 1NZ9A 2DIQA 1CKAA 1FYNA 1WHHA 2JMAA 2E70A 1MHNA 5D6YA 1KQSA 1ZSZB 4J9FA 3JCMV 4PJJA 1YJWA 2JM8A 4FU6A 2LRQA 1Z9QA 2I0NA 3OMCA 1D0XA 3ZBDA 3QPHA 3NFCA 2FPDA 4M78C 1LVKA 1X43A 5GAN4 2ZPBB 1OQKA 1BCOA 1O75A 3LX7A 4R55A 2DVEA 2IIMA 2VXEA 3X24B 3KUFA 1SG5A 2LQKA 4PL6A 2DTOA 1KG1A 1HYOA 5IT9E 1ZSZA 2HQXA 5GAMh 4O6JA 2DFUA 2P84A 2RI3A 1Y71A 2CUBA 1NM7A 1AEYA 2K3BA 5GAOq 1UEBA 4QW2A 1CSKA 3KXTA 5GJVB 1NPRA 1IHWA 4AFQC 1EX4A 4E7KA 4LN2A 3JCMQ 2A28A 4DBFA 2A08A 4KBMB 1N9RA 5GAN8 4RTZA 1PM3A 3OW2S 3C4SA 3OS0A 3IQLA 2H8HA 1UGSB 2NUTA 3MEAA 1VQOA 1Q7YC 1Y96A 3A8GB 3NMZC 3QWYA 4M7AG 2L3SA 1HXDA 3M56A 5LJ5f 4AG2C 2KXCA 2P0KA 2EAYA 1OI1A 2KMTA 3M54A 2XU8A 3VYGA 3H41A 3M0PA 5LJ3e 1VA7A 4GBQA 1Q82R 3GF5A 3E2UA 4Z02A 2M1HA 4M75C 1RI0A 5FWCA 1YJWQ 2LCCA 2XDPA 8AT1B 1S72Q 2MAMA 2RHXA 2WSCE 4M7AA 3WVEB 2RQVA 4GLMA 3JCMP 2XIDA 1KC8R 4ESRA 3GNGA 2OTLA 3N5BB 3S6WA 4LDYA 5KYYA 3QO3A 2K9GA 1K1ZA 4RTTA 2L3PA 5FRMA 2ZPIB 2DIGA 3I55Q 4FCYA 1AWJA 4JLGA 4OVAA 3CCVQ 1U5SA 3MO8A 3CC2Q 4MZPA 1I4K1 2HKNA 2LT4A 1UG1A 5LJ5e 1VQMQ 1GFDA 1ZBXA 1OPKA 1H8KA 4UC4A 2AZVA 4MDWA 4DQ2A 3EHRA 2HQEA 2V8IA 2VWFA 5D6WA 2PUKB 2AT1B 4XU2A 4BI4A 3M5AA 1BI0A 1LCKA 2AIRB 3E1SA 2QK0A 3L2VA 2EYYA 1K73U 2O01E 3X25B 1YITQ 4HT9A 1Q82U 4OMLA 2E41A 2DZ9A 4J83A 4E7ZA 2DXBA 1BKBA 2K2MA 3S3NA 2KY9A 2F2WA 2YRCA 3CCUT 1YI2A 2M0YA 1VQNA 1H3HA 1VQ9A 1W4SA 5IN1A 3EH2A 3GLXA 1N27A 2DA9A 3G71A 1U8RA 3REBB 5HK3A 1VQPA 1KIKA 2FZKB 1YITA 2BUDA 3VKIA 1M2VB 1V1CA 2QASA 3QDFA 5HCKA 4N4HA 4YTLA 5KYYB 1VQ4T 2XKOC 1YHQT 1H3ZA 4CC7A 2OJ2A 4PJOF 2RMOA 4MZMA 3J80E 2CP5A 2DL7A 2LP5A 3CCVA 3M59A 1YJ9T 2EGEA 1UGVA 1PKTA 4A4KA 1MMAA 3RNJA 2VGNA 2VASA 1CKBA 3C95A 3MP6A 1LPLA 5EG2A 4ZNXA 4DBQA 4C8QC 5FU7B 4EMKB 5IH2A 4M78E 2F69A 2XI9A 2CZ1B 4WF2A 3QWXX 4M78A 2XK0A 2PVGB 2LJ1A 1BIBA 2DYBA 2GQVA 1SSFA 2ZPFB 1TTHB 4HT8A 4M7AF 2RQTA 4PJLA 3LWIA 3CC7A 1ZX6A 2EW3A 4J6WA 3HPWA 4DOWA 2RJFA 3LYIA 2QI2A 5CAIA 4IUUA 1PRMC 1PRLC 1UDLA 1M1KC 2CT4A 4EMKA 2RK2A 2KQWA 3ER0A 2E4HA 2Y90A 4CC3A 4M78G 4OB3B 5GANg 1VQOQ 1WHJA 1E6GA 3CBOA 2EQIA 1PD0A 3EH1A 2OI3A 2EQKA 4DA4A 2F5KA 4HCCA 2K57A 5ECAA 1AT1B 1ZSZC 2E3HA 2C0IA 1K8AC 2DX1A 4BDYA 2V1QA 3EFOB 3PVQA 4AFZC 4ELYC 4J9IA 3ULRB 1IREB 4FSSA 3M0QA 3UT1A 1KQSS 1M1FA 4Y92A 2L2PA 2FYKA 2A7YA 2JZ2A 6AT1B 1ZSGA 3OS5A 1Y7XA 3UATA 3JCMc 2DO3A 4BE0A 3VV0A 4ORZA 4N0AA 4Z88A 3CPFA 1W2BS 5CKBA 2DBMA 4C8QG 5IHNA 4Z8AA 1NLOC 1ZBJA 2HKQB 2LC4A 2Y4XA 5GAN5 2PQWA 3CCRT 4WTOB 1TU0B 1XOVA 2K7AA 1ACMB 3CC2T 4Y28E 2F2XA 3ZFJA 2X4WA 2MWPA 2YWWA 2CP0A 4XTVA 2QEXT 3CCVT 4E7LA 4A4HA 3G6ET 4PLLA 4M75F 1HJDA 4RKUE 3JB9J 3HRUA 1QWFA 3MEUA 2DEQA 3J7AF 5GANj 2FG0A 2QDLA 3A5ZB 3EFRA 3RUXA 2DJQA 2IG0A 3A1PA 3D7SB 2Y4YA 1UJ0A 3FB9A 4E7SA 5IXBA 1X6OA 4XAXB 1T0HA 3PVLA 4B9WA 2L8DA 5A0GA 4XTZA 3VS2A 3MEVA 3JB9G 3QYHB 3ZL7C 4F7UA 1MV3A 2EYQA 4C92F 3E9GA 3UA7A 1OU9A 3EG3A 2DYIA 4C92D 4JJCA 1U06A 5I11A 3VS4A 4BD3A 3QDRB 3BDLA 1VQ8A 2O9VA 1K8AR 2E3IA 4C92E 1NYGA 2MIOA 2V1RA 1IGUA 1KJWA 1NLPC 1ZA1B 2KE9A 3GOXA 1EZZB 4F7UF 5GAOr 2COWA 2SEMA 4BI8B 3F70A 5AYFA 3RKXA 1TWBA 5HK0A 2JT4A 2CDTA 2QA4A 1VYVA 1YWOA 2F2VA 2XDDA 2E6ZA 4OMNA 4A63B 4KGZB 4M7AB 3EGUA 3CMAQ 1M90R 2YSQA 4GY5A 3SHWA 2CSQA 1Q86U 3PMIA 3L2ZA 3CCUA 2PZ1A 1YI2T 2DXCA 1WX6A 2QQBA 4BACA 1YWPA 4A53A 3M0UA 2JOYA 4JDSA 5GAOm 3SDZA 1G3YA 5GAOl 1OZ3A 1QVFS 2LJ0A 2FHDA 1Y96B 3QYGB 4M77F 1BIAA 2YUNA 4RTYA 2JVVA 1X69A 3HRTA 3TVTA 3M9QA 4FT4A 1BCMA 8ATCB 2NUPB 1GCQA 3I56T 2G6FX 1SRMA 2RHIA 1JU5C 1B34A 1RAEB 3M55A 5IXFA 3I55T 3VS1A 3HFNA 2A0FB 4DBRA 2XDBA 3OYJA 2RI2A 2CZ6B 3V8JA 1AOJA 5LJ5d 1VQ5Q 1QKXA 4A54A 3G4SQ 1W70A 4HVWA 1PG5B 3ASKA 5KE2A 1S1NA 1SEMA 1M2OA 2J6KA 1K9MR 3VS6A 3META 1B34B 3URGA 3OYIA 2E64A 4E47A 1TXQA 1KSWA 1T0JA 2HSPA 5CKEA 1M90U 3JB9F 4X34A 1VQMT 1ZLMA 3QSUA 1VYUA 2FEIA 3ME9A 3JV3A 3I55A 1M5Q1 1Z9ZA 2X3XD 4N0AC 3EG2A 2KVQG 2L3RA 2BE7D 5J26A 3EAEA 3O5ZA 4JS5A 2EQJA 3HRSA 2QQSA 3JCMW 2J6FA 3I35A 3TEEA 3JB9I 4LD9K 3PIOA 3VJPA 1KD1R 3VUBA 2FO0A 3M4GA 4FL6A 1UJYA 1SHGA 1S72A 2DTIA 4JRKA 4RG8A 3JB9D 2F1LA 3WXMB 4M7DE 2KXDA 3P8DA 3EGDA 2YLBA 2D8JA 2YUPA 4R0KA 4J9DA 1UGRB 3RBBB 1WJRA 1WNLA 3PGGA 3CMET 3CCSA 1PKSA 2PVDB 2H3JA 1G3SA 2M9UA 2AZSA 4PJOB 4PJOG 4E7IA 4PJOC 2HBWA 3R6NA 2KI7A 4DBHA 2JS0A 3SWNC 3SWNA 1M1GA 2DETA 3OYNA 1NEBA 2GBQA 3DLMA 2DILA 3NTIA 2RA2A 2J7IA 3WVDB 2KYBA 1KC8U 2DL3A 2KDSA 4AG1C 3DB4A 3E19A 5FU7C 5CVIA 4EMKC 3CXCA 1D1BA 3H6ZA 1TSFA 1UUEA 1VQLQ 4JJBA 4C5IA 4RTXA 1G5VA 4OB1B 2M0OA 4EMHA 1UB4A 4A4EA 3EGDB 2YRVA 2RNAA 4JJNK 2D8HA 2BTTA 3HFOA 2LX9A 1GBRA 2NYSA 5HY6A 2DBKA 4K11A 3X20B 1T3SA 1QCNA 4X9CA 1Q86R 2DZCA 3JCMX 3MP8A 2OAUA 1TH7A 2RI5A 3EFOA 3FLGA 5J39A 2GNCA 5FROA 4N4IA 1HK9A 3V8LA 3MJXA 5CQXA 3C94A 4KT0E 5KYNA 1M27C 4LNPA 5GAMf 4ELZC 5I2SA 1VQKQ 2DNUA 1UFFA 3MEWA 2LVMA 5GAN3 3VUZA 3LLRA 2K5FA 1VQ8T 2X35A 2OTJQ 2CS7A 1MNEA 1B7TA 3HP9A 2COZA 2EYWA 3CCQQ 3CCQT 3CCET 5CQYA 3UDCA 2FRWA 3JRZA 1UHFA 2D9TA 1YFNA 1N6AA 2X3WD 4M4ZA 3GPLA 5CCAA 1WHMA 3PE0A 3M58A 3OS1A 1VQKT 5I21A 4FW2A 2CH4W 3G4ST 2EBPA 2VVKA 1VQLT 4P5NA 1VQ5T 2DMOA 4RTWA 1OU8A 1FWZA 2O9SA 3JCMb 2I2LA 3PFSA 3QUIA 5KYUA 2NWMA 5GMKj 4C8QF 3SFMA 3HHTB 4M7AD 5FRNA 2RQRA 3CBMA 3OW2P 4GLKA 1EIFA 1N9SA 1YCSB 2FL7A 4QQDA 5EC7A 2VKNA 3VU3C 3EGXB 1BU1A 1T3LA 1IZ6A 2BZ8A 5GMKm 5GAOn 1NG2A 4FYVB 5A0DA 2BZYA 3DLLA 1X75C 1UTIA 3I56A 2JTEA 2QAZA 3FEOA 4NL2A 1OV3A 1AHJB 2KT8A 4B9XA 4C92A 5LJ5j 1QVPA 5D6XA 3EGXA 3JCMh 1YNZA 2DLPA 4QVZA 4II1A 3CQTA 1QVGA 2K3YA 1QWEA 4J9HA 5CKFA 3L2UA 4M77D 1QVGP 2DAQA 3M0SA 2QEXA 1IO6A 1MUZA 2L5QA 4OGEA 4LDXA 5A2QE 3VS7A 3CD6T 4C8QB 3HTRA 4IKFA 5KYXA 5GANh 4LUDA 3V8KA 4M77E 3JSCA 3C0CA 4M77A 3X26B 4C5HA 2LCSA 2O4XB 1N8RC 2A3LA 4L5GA
chains in the Genus database with same CATH topology
3UA6A 1K4US 1UECA 2F2XA 1A0NB 2JMCA 1ZUKA 1J3TA 2P4RA 2EKHA 1HJDA 1RLPC 4JZ4A 2K79A 1M3AA 1QWFA 4OMQA 2D1XA 1Y57A 2KRNA 4RUGA 4AFSC 2FG0A 2QDLA 3H0FA 2DJQA 1TUDA 1UJ0A 2ED0A 2FRYA 3VS0A 5IXBA 2LQNA 1BB9A 1T0HA 3PVLA 3VS2A 2DVJA 2L0AA 1RLQC 1GL5A 2BZXA 1K0SA 1W1FA 1PHTA 1I1JA 3ZL7C 1MV3A 2DRKA 1ARKA 2C0OA 2ROLA 2LZ6B 4J9CA 1B3QA 1WXTA 3UA7A 2ECZA 3EG3A 1JO8A 1QLYA 2EPDA 4JJCA 1U06A 5I11A 3VS4A 2D0NA 2DE0X 2O9VA 2E5KA 2RQWA 1PWTA 2YT6A 1B07A 1NYGA 2CT3A 2MIOA 2EYZA 2V1RA 1AZGB 4F14A 1KJWA 1NLPC 2KE9A 1K9AA 2CREA 2JW4A 2SEMA 1X2KA 2YDLA 4D8DA 2JT4A 2CDTA 1VYVA 2KYMA 1YWOA 2F2VA 1X6BA 4OMNA 4A63B 3H0HA 3VS5A 2KROA 2YUOA 5FWBA 3EGUA 3M0TA 2YSQA 3SHWA 1QKWA 2CSQA 4RTVA 2EVRA 1AD5A 2PZ1A 1JXOA 1MV0B 4E6RA 1WX6A 4RTUA 1OOTA 1YWPA 1WLPB 3M0UA 2HDAA 2AKKA 3EG0A 1WXBA 1CKAA 2NUZA 1U3OA 1FYNA 2JMAA 2LJ0A 2YUNA 4RTYA 1X6GA 1X69A 1YN8A 3TVTA 1M8MA 1YP5A 4J9FA 2YUQA 3KFVA 2JM8A 4F16A 1Z9QA 2I0NA 1GCQA 1SRLA 2HEQA 2FPDA 2G6FX 1SRMA 1X43A 1JU5C 4EIKA 5IXFA 3VS1A 1RI9A 2IIMA 3FJ5A 2J6OA 1OEBA 1AOJA 3SEMA 1QKXA 2O31A 3NGPA 1W70A 4HVWA 3I5RA 1S1NA 1RUWA 1SEMA 1NYFA 2J6KA 3I9QA 3VS6A 2CUDA 1AWWA 1KSWA 1T0JA 2HSPA 2CUBA 2JS2A 1BBZA 1NM7A 1ZLMA 3NHNA 1AEYA 2K3BA 1VYUA 2FEIA 3JV3A 1Z9ZA 2X3XD 4LE9A 1CSKA 3EG2A 5GJVB 2M51A 1PNJA 4HCKA 4AFQC 2OAWA 3THKA 2EGAA 3O5ZA 4LN2A 1N5ZA 2A28A 1M3BA 1ZUUA 2A08A 2B86A 2J6FA 1AWXA 2KNBB 3I35A 3U23A 4RTZA 3GBQA 2FO0A 2EYXA 2H8HA 2PTKA 1UJYA 3IQLA 1SHGA 3LH5A 1SHFA 1SPKA 3M0RA 2DL4A 3VRZA 1SSHA 3NMZC 3QWYA 4IIMA 4JZ3A 2L3SA 1Y0MA 4AG2C 2KXCA 1M30A 2KXDA 4IIOA 2D8JA 2FPFA 2YUPA 2DRMA 4R0KA 1AWOA 3H41A 3M0PA 1M3CA 1VA7A 4GBQA 4J9DA 2JM9A 3RBBB 2LNHB 4J9EA 5FWCA 1AVZC 1PKSA 2AZSA 2W0ZA 1ZUYA 2RQVA 4GLMA 4DEXA 2MCNA 1G83A 4ESRA 3VRYA 2HBWA 3EG1A 3R6NA 2A37A 2KBTA 2JS0A 2K9GA 1K1ZA 4RTTA 3NPFA 4QT7A 2L3PA 1UHCA 2LMJA 4OMPA 1AWJA 2ABLA 1NEBA 2DL5A 2GBQA 1U5SA 1GRIA 1GBQA 2AKLA 1TUCA 2DILA 2J7IA 2KYBA 1UG1A 2DL3A 4AG1C 1GFDA 1OPKA 3REAB 1H8KA 2AZVA 1UUEA 3EHRA 4JJBA 2VWFA 4RTXA 4DEYA 1GFCA 4JJDA 1LCKA 2RNAA 1ABQA 2D8HA 2EYYA 2AK5A 1KFZA 4JPBW 2BTTA 1TG0A 1GBRA 2J06A 4OMLA 1K0XA 1K76A 1UE9A 2DBKA 4K11A 2K2MA 1E6HA 2F2WA 1T3SA 2M0YA 1H3HA 2KRMA 5IHIA 5L23A 2DA9A 1QCFA 2GNCA 4KRTA 2LJ3A 3REBB 1KIKA 1WXUA 1I0CA 2DF6A 4CC2A 5IHKA 1M27C 1V1CA 2KRSA 4LNPA 2DL8A 2RPNA 5HCKA 4AFUC 1JQQA 2L3QA 2DNUA 2MOXA 3I5SA 1UFFA 4HVVA 4WCIA 4D8KA 1GCPA 2J05A 1JEGA 2KR3A 2GTOA 2XMFA 4CC7A 1W6XA 2OJ2A 2EYWA 5I22A 2O88A 2FRWA 2RN8A 2RMOA 1UHFA 2DL7A 2LP5A 2LX7A 1I07A 2X3WD 4M4ZA 4LUEA 1AZEA 3PE0A 3TSZA 2EGEA 1UGVA 1PKTA 1HSQA 4J9GA 4OMOA 1FMKA 2CSIA 1JXMA 2CH4W 3H0IA 3RNJA 2EBPA 2VVKA 1CKBA 2DMOA 4RTWA 4OMMA 2O9SA 2ED1A 2FPEA 4ZNXA 1WFWA 2NWMA 4J9BA 2GTJA 2C0TA 5IH2A 2PNIA 1EFNA 3QWXX 1G2BA 2GGRA 2LJ1A 2LQWA 1VYTA 2DYBA 2RQRA 2ESWA 2RQTA 3EHQA 3TSWA 2A36A 1H92A 2KT1A 1YCSB 2KEAA 5EC7A 1ZX6A 2EW3A 2VKNA 3UF4A 1BU1A 1T3LA 1ABOA 2W10A 1BK2A 1PRMC 1PRLC 1UDLA 2BZ8A 1X2QA 1NG2A 2GQIA 2CT4A 2ENMA 2CH4A 2BZYA 4CC3A 4Z89A 1UTIA 2JTEA 1E6GA 2JXBA 2RQUA 1OPLA 2EQIA 1OV3A 2OI3A 2KT8A 5GJWB 5ECAA 1WA7A 4HVUA 2C0IA 2DX1A 4CC4B 2V1QA 3PVQA 4AFZC 4HXJA 1YNZA 4J9IA 3ULRB 3VS3A 1HD3A 2DLPA 1NEGA 4FSSA 3CQTA 3M0QA 4Y92A 5FW9A 2L2PA 1E7OA 1WIEA 1QWEA 4J9HA 1GCQC 4F17A 1ZSGA 2SRCA 2ROTA 3UATA 3M0SA 4ORZA 2RF0A 1IO6A 1WI7A 4X1VA 1MUZA 4Z88A 3VS7A 1X27A 2DBMA 2DM1A 2EGCA 2KGTA 4Z8AA 2HCKA 5IHNA 1NLOC 1ZBJA 4LUDA 2K6DA 3A98A 1WYXA 1WDXA 1XOVA 3C0CA 2K7AA 2O2OA 2LCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UA6 A;  1K4U S;  1UEC A;  2F2X A;  1A0N B;  2JMC A;  1ZUK A;  1J3T A;  2P4R A;  2EKH A;  1HJD A;  1RLP C;  4JZ4 A;  2K79 A;  1M3A A;  1QWF A;  4OMQ A;  2D1X A;  1Y57 A;  2KRN A;  4RUG A;  4AFS C;  2FG0 A;  2QDL A;  3H0F A;  2DJQ A;  1TUD A;  1UJ0 A;  2ED0 A;  2FRY A;  3VS0 A;  5IXB A;  2LQN A;  1BB9 A;  1T0H A;  3PVL A;  3VS2 A;  2DVJ A;  2L0A A;  1RLQ C;  1GL5 A;  2BZX A;  1K0S A;  1W1F A;  1PHT A;  1I1J A;  3ZL7 C;  1MV3 A;  2DRK A;  1ARK A;  2C0O A;  2ROL A;  2LZ6 B;  4J9C A;  1B3Q A;  1WXT A;  3UA7 A;  2ECZ A;  3EG3 A;  1JO8 A;  1QLY A;  2EPD A;  4JJC A;  1U06 A;  5I11 A;  3VS4 A;  2D0N A;  2DE0 X;  2O9V A;  2E5K A;  2RQW A;  1PWT A;  2YT6 A;  1B07 A;  1NYG A;  2CT3 A;  2MIO A;  2EYZ A;  2V1R A;  1AZG B;  4F14 A;  1KJW A;  1NLP C;  2KE9 A;  1K9A A;  2CRE A;  2JW4 A;  2SEM A;  1X2K A;  2YDL A;  4D8D A;  2JT4 A;  2CDT A;  1VYV A;  2KYM A;  1YWO A;  2F2V A;  1X6B A;  4OMN A;  4A63 B;  3H0H A;  3VS5 A;  2KRO A;  2YUO A;  5FWB A;  3EGU A;  3M0T A;  2YSQ A;  3SHW A;  1QKW A;  2CSQ A;  4RTV A;  2EVR A;  1AD5 A;  2PZ1 A;  1JXO A;  1MV0 B;  4E6R A;  1WX6 A;  4RTU A;  1OOT A;  1YWP A;  1WLP B;  3M0U A;  2HDA A;  2AKK A;  3EG0 A;  1WXB A;  1CKA A;  2NUZ A;  1U3O A;  1FYN A;  2JMA A;  2LJ0 A;  2YUN A;  4RTY A;  1X6G A;  1X69 A;  1YN8 A;  3TVT A;  1M8M A;  1YP5 A;  4J9F A;  2YUQ A;  3KFV A;  2JM8 A;  4F16 A;  1Z9Q A;  2I0N A;  1GCQ A;  1SRL A;  2HEQ A;  2FPD A;  2G6F X;  1SRM A;  1X43 A;  1JU5 C;  4EIK A;  5IXF A;  3VS1 A;  1RI9 A;  2IIM A;  3FJ5 A;  2J6O A;  1OEB A;  1AOJ A;  3SEM A;  1QKX A;  2O31 A;  3NGP A;  1W70 A;  4HVW A;  3I5R A;  1S1N A;  1RUW A;  1SEM A;  1NYF A;  2J6K A;  3I9Q A;  3VS6 A;  2CUD A;  1AWW A;  1KSW A;  1T0J A;  2HSP A;  2CUB A;  2JS2 A;  1BBZ A;  1NM7 A;  1ZLM A;  3NHN A;  1AEY A;  2K3B A;  1VYU A;  2FEI A;  3JV3 A;  1Z9Z A;  2X3X D;  4LE9 A;  1CSK A;  3EG2 A;  5GJV B;  2M51 A;  1PNJ A;  4HCK A;  4AFQ C;  2OAW A;  3THK A;  2EGA A;  3O5Z A;  4LN2 A;  1N5Z A;  2A28 A;  1M3B A;  1ZUU A;  2A08 A;  2B86 A;  2J6F A;  1AWX A;  2KNB B;  3I35 A;  3U23 A;  4RTZ A;  3GBQ A;  2FO0 A;  2EYX A;  2H8H A;  2PTK A;  1UJY A;  3IQL A;  1SHG A;  3LH5 A;  1SHF A;  1SPK A;  3M0R A;  2DL4 A;  3VRZ A;  1SSH A;  3NMZ C;  3QWY A;  4IIM A;  4JZ3 A;  2L3S A;  1Y0M A;  4AG2 C;  2KXC A;  1M30 A;  2KXD A;  4IIO A;  2D8J A;  2FPF A;  2YUP A;  2DRM A;  4R0K A;  1AWO A;  3H41 A;  3M0P A;  1M3C A;  1VA7 A;  4GBQ A;  4J9D A;  2JM9 A;  3RBB B;  2LNH B;  4J9E A;  5FWC A;  1AVZ C;  1PKS A;  2AZS A;  2W0Z A;  1ZUY A;  2RQV A;  4GLM A;  4DEX A;  2MCN A;  1G83 A;  4ESR A;  3VRY A;  2HBW A;  3EG1 A;  3R6N A;  2A37 A;  2KBT A;  2JS0 A;  2K9G A;  1K1Z A;  4RTT A;  3NPF A;  4QT7 A;  2L3P A;  1UHC A;  2LMJ A;  4OMP A;  1AWJ A;  2ABL A;  1NEB A;  2DL5 A;  2GBQ A;  1U5S A;  1GRI A;  1GBQ A;  2AKL A;  1TUC A;  2DIL A;  2J7I A;  2KYB A;  1UG1 A;  2DL3 A;  4AG1 C;  1GFD A;  1OPK A;  3REA B;  1H8K A;  2AZV A;  1UUE A;  3EHR A;  4JJB A;  2VWF A;  4RTX A;  4DEY A;  1GFC A;  4JJD A;  1LCK A;  2RNA A;  1ABQ A;  2D8H A;  2EYY A;  2AK5 A;  1KFZ A;  4JPB W;  2BTT A;  1TG0 A;  1GBR A;  2J06 A;  4OML A;  1K0X A;  1K76 A;  1UE9 A;  2DBK A;  4K11 A;  2K2M A;  1E6H A;  2F2W A;  1T3S A;  2M0Y A;  1H3H A;  2KRM A;  5IHI A;  5L23 A;  2DA9 A;  1QCF A;  2GNC A;  4KRT A;  2LJ3 A;  3REB B;  1KIK A;  1WXU A;  1I0C A;  2DF6 A;  4CC2 A;  5IHK A;  1M27 C;  1V1C A;  2KRS A;  4LNP A;  2DL8 A;  2RPN A;  5HCK A;  4AFU C;  1JQQ A;  2L3Q A;  2DNU A;  2MOX A;  3I5S A;  1UFF A;  4HVV A;  4WCI A;  4D8K A;  1GCP A;  2J05 A;  1JEG A;  2KR3 A;  2GTO A;  2XMF A;  4CC7 A;  1W6X A;  2OJ2 A;  2EYW A;  5I22 A;  2O88 A;  2FRW A;  2RN8 A;  2RMO A;  1UHF A;  2DL7 A;  2LP5 A;  2LX7 A;  1I07 A;  2X3W D;  4M4Z A;  4LUE A;  1AZE A;  3PE0 A;  3TSZ A;  2EGE A;  1UGV A;  1PKT A;  1HSQ A;  4J9G A;  4OMO A;  1FMK A;  2CSI A;  1JXM A;  2CH4 W;  3H0I A;  3RNJ A;  2EBP A;  2VVK A;  1CKB A;  2DMO A;  4RTW A;  4OMM A;  2O9S A;  2ED1 A;  2FPE A;  4ZNX A;  1WFW A;  2NWM A;  4J9B A;  2GTJ A;  2C0T A;  5IH2 A;  2PNI A;  1EFN A;  3QWX X;  1G2B A;  2GGR A;  2LJ1 A;  2LQW A;  1VYT A;  2DYB A;  2RQR A;  2ESW A;  2RQT A;  3EHQ A;  3TSW A;  2A36 A;  1H92 A;  2KT1 A;  1YCS B;  2KEA A;  5EC7 A;  1ZX6 A;  2EW3 A;  2VKN A;  3UF4 A;  1BU1 A;  1T3L A;  1ABO A;  2W10 A;  1BK2 A;  1PRM C;  1PRL C;  1UDL A;  2BZ8 A;  1X2Q A;  1NG2 A;  2GQI A;  2CT4 A;  2ENM A;  2CH4 A;  2BZY A;  4CC3 A;  4Z89 A;  1UTI A;  2JTE A;  1E6G A;  2JXB A;  2RQU A;  1OPL A;  2EQI A;  1OV3 A;  2OI3 A;  2KT8 A;  5GJW B;  5ECA A;  1WA7 A;  4HVU A;  2C0I A;  2DX1 A;  4CC4 B;  2V1Q A;  3PVQ A;  4AFZ C;  4HXJ A;  1YNZ A;  4J9I A;  3ULR B;  3VS3 A;  1HD3 A;  2DLP A;  1NEG A;  4FSS A;  3CQT A;  3M0Q A;  4Y92 A;  5FW9 A;  2L2P A;  1E7O A;  1WIE A;  1QWE A;  4J9H A;  1GCQ C;  4F17 A;  1ZSG A;  2SRC A;  2ROT A;  3UAT A;  3M0S A;  4ORZ A;  2RF0 A;  1IO6 A;  1WI7 A;  4X1V A;  1MUZ A;  4Z88 A;  3VS7 A;  1X27 A;  2DBM A;  2DM1 A;  2EGC A;  2KGT A;  4Z8A A;  2HCK A;  5IHN A;  1NLO C;  1ZBJ A;  4LUD A;  2K6D A;  3A98 A;  1WYX A;  1WDX A;  1XOV A;  3C0C A;  2K7A A;  2O2O A;  2LCS A; 
#chains in the Genus database with same CATH topology
 3UA6 A;  1K4U S;  3GNF B;  1UGP B;  3CCL A;  1OX9 A;  3OBY A;  2XD0 A;  1F1B B;  1TUG B;  2K79 A;  3RER A;  1M3A A;  3S3M A;  3EFS A;  4C0D B;  4PLI A;  2D1X A;  1Y57 A;  1VQ7 T;  1M2V A;  3LW5 E;  1SKU B;  2QEX Q;  4QKU A;  2R57 A;  4L59 A;  3VS0 A;  4A4G A;  3QJ6 A;  2LQN A;  5FLX E;  4NS5 A;  1RLQ C;  5GAN f;  4C0F A;  5GAM d;  1I1J A;  1KQ1 A;  4BB7 A;  1IGQ A;  1ARK A;  1R0C B;  2YRD A;  2ROL A;  3FJP A;  3JCM g;  1YJN Q;  3JCM e;  2EPD A;  2FVU A;  2P4T A;  4HA8 A;  2D0N A;  1VQ7 A;  3OYF A;  1VQN T;  3L1A A;  3OSV A;  4XTY A;  2RQW A;  5FU6 C;  2E5K A;  3AT1 B;  5LJ3 j;  3JAM E;  4M7D A;  4PJO D;  1B07 A;  3CCJ Q;  1VOM A;  2EYZ A;  5C6S A;  3E9F A;  1K9A A;  2BKD N;  5AT1 B;  4D6W A;  1YBY A;  2K4Y A;  3ZEH A;  1KD1 C;  3FC3 A;  3OS2 A;  2KK4 A;  2QTV A;  5D7U A;  2YUO A;  3MCA B;  5KCH A;  1K8A U;  1VIE A;  2EVR A;  1AD5 A;  4RMO A;  1JXO A;  1QP3 A;  2JTM A;  1K9M C;  3EG0 A;  1Q81 R;  2QDY B;  1VQO T;  3BDU A;  2OTL Q;  3HL8 A;  2VC8 A;  3A8L B;  1JRI A;  2E10 A;  1VQ6 Q;  1U3O A;  1RAG B;  2CP6 A;  2QQR A;  2E65 A;  2GFU A;  5GAO p;  1JJ2 P;  4BUG A;  2RJE A;  3CMA T;  2K5I A;  1VQ4 A;  2PVO B;  4PJO E;  1YN8 A;  1YIJ T;  4J6Y A;  1R8O B;  4B6M A;  1YP5 A;  4KUD K;  4M7D D;  2IPO B;  3KFV A;  3M4Y A;  2L89 A;  4F16 A;  3OYM A;  1KK7 A;  2RHZ A;  1SRL A;  2HEQ A;  2PUO B;  2VB6 A;  4EIK A;  3OYB A;  2AHJ B;  1RI9 A;  1OZ2 A;  3Q1J A;  1PD1 A;  4Y91 A;  2V8J A;  2DPP B;  2O31 A;  2BE9 B;  3L2R A;  3NGP A;  2QGG A;  3FRN A;  1YHQ Q;  1RUW A;  2R58 A;  3I9Q A;  4PFZ A;  4PKC C;  2OTL T;  2XIC A;  1M1K U;  1YIJ Q;  4ZGJ B;  4OB0 B;  3GP8 A;  1BBZ A;  4E7H A;  4LE9 A;  4PFP A;  1RL2 A;  2QQ9 A;  3SWN B;  2M51 A;  1VQ9 T;  4HCK A;  3OYA A;  3THK A;  2G3R A;  2EIF A;  2KAF A;  2M16 A;  2KNB B;  4C8Q E;  5CK9 A;  3GBQ A;  2EYX A;  1D3B B;  3G6E Q;  3CCQ A;  1M1K R;  1SHF A;  1SPK A;  1YHQ A;  3CCJ A;  3C12 A;  2DL4 A;  3VRZ A;  3SB2 A;  1Y0M A;  2JN0 A;  3CBP A;  3CXC P;  3VYH B;  5GAN d;  3CCU Q;  2X4J A;  5CKH A;  1P92 A;  1AWO A;  3CPW P;  1Q82 C;  2YXY A;  1YIT T;  4A4F A;  3G7Z A;  4J9E A;  3CCM T;  2W0Z A;  4DEX A;  4BE2 A;  3OYG A;  4ME7 A;  4J7I A;  1FXX A;  3VRY A;  4M7D C;  3EG1 A;  2A37 A;  2M02 A;  3OYD A;  4KH0 B;  1VQ6 A;  2KBT A;  3NPF A;  1PCX A;  1MGQ A;  2OX7 A;  5GAM g;  3BW1 A;  2LMJ A;  2RB6 A;  1U1S A;  3LGF A;  3UPU A;  1I8F A;  2ABL A;  2IVW A;  1GRI A;  4J7F A;  4M7D F;  5KYU B;  1TUC A;  1ZA2 B;  1BI1 A;  1NBE B;  1D0Y A;  3O8V A;  4M77 C;  1WPY A;  4EPC A;  3G71 Q;  3REA B;  3BFM A;  4M77 B;  5GAN 6;  2EJG A;  1VQN Q;  1SF9 A;  4NL3 A;  2MF2 A;  1OUL A;  4MML A;  2AK5 A;  4JPB W;  3A8O B;  2V8K A;  1TG0 A;  4QVD A;  2J06 A;  5GAM j;  1K0X A;  1K76 A;  3SD4 A;  1UE9 A;  4C5G A;  3PTA A;  2K3X A;  3A8H B;  4LDV A;  1JJ2 A;  1WHL A;  1KHC A;  3QXE B;  5IHI A;  5L23 A;  1VQ4 Q;  1QVF P;  1K73 C;  2QXF A;  2LJ3 A;  4M75 B;  4AT1 B;  1NJI C;  5LL6 S;  2OTJ A;  1I0C A;  1XTD A;  2CP7 A;  1BI3 A;  4CC2 A;  3BE3 A;  1VQK A;  3R6O A;  2HNI A;  2MWO A;  2RPN A;  4BDZ A;  3MKD A;  4AFU C;  4EDU A;  1JQQ A;  2MOX A;  1G3T A;  3QZ5 B;  3CCE A;  4C8Q A;  4WCI A;  1PC0 A;  1GCP A;  2J05 A;  1JEG A;  5GAN 2;  2XMF A;  2QQA A;  1BYM A;  3H9N A;  1U1T A;  2DD5 A;  2LTO A;  2RHU A;  5I22 A;  2O88 A;  1QMC A;  1VQ6 T;  1FMW A;  3PMT A;  2LNV A;  4OB2 B;  4F04 B;  3T9N A;  3CC4 Q;  1H64 1;  4LUE A;  3TSZ A;  4J9G A;  1HSQ A;  5CR2 A;  2CSI A;  3CEY A;  4C92 C;  3H0I A;  4PK4 A;  2HD0 A;  1LOJ A;  1W2B A;  2P0P A;  1QW1 A;  2LCL A;  2EJF A;  2ED1 A;  2EJ9 A;  2FPE A;  2YLC A;  2RJD A;  4J9B A;  1YJN A;  2EQU A;  2PNI A;  5KYX B;  1G2B A;  2GGR A;  4E7J A;  2LQW A;  2DXT A;  1VYT A;  5LJ3 h;  2E6N A;  1Q86 C;  2ESW A;  3TSW A;  2A36 A;  5LJ5 h;  1JBM A;  4F7U G;  1N8R R;  3EG9 A;  2GCX A;  4JS4 A;  1UGQ B;  1ZQ1 A;  1ABO A;  3CC2 A;  2W10 A;  1BK2 A;  4F7U E;  1KD1 U;  1X2Q A;  2GQI A;  2ENM A;  3H8Z A;  2CH4 A;  5CKD A;  4Z89 A;  1Q81 C;  4OGC A;  1VQ8 Q;  4M75 E;  3CD6 A;  3RIR A;  1OPL A;  3OYY A;  1QVF A;  3UWN A;  1PSE A;  5GAM e;  4PFO A;  2GFA A;  5CIU A;  2ZCF B;  1X01 A;  4HVU A;  3LWH A;  4BY6 C;  3J81 E;  5J3B A;  4PJM A;  5L8R E;  3QKJ A;  3P8B B;  5FW9 A;  2HZY A;  2F5T X;  1WIE A;  1GCQ C;  2SRC A;  2ROT A;  1YCY A;  1VUB A;  4M7A E;  1IB8 A;  4BI3 A;  3CCL T;  1RAI B;  4X1V A;  1WI7 A;  3RMS A;  4LD6 A;  5LJ3 d;  1X27 A;  2EGC A;  4ANJ A;  2KGT A;  2HCK A;  3TRE A;  3S3O A;  3JCM f;  2OTJ T;  2K6D A;  3A98 A;  1OX8 A;  1WDX A;  1YJ9 Q;  1VQP T;  4ATO A;  2O2O A;  2RM4 A;  2DER A;  1UEC A;  1FX7 A;  2JMC A;  4IUQ A;  1ZUK A;  4FYW B;  1J3T A;  2EKH A;  5DY9 A;  3CD6 Q;  2EKO A;  2MK5 A;  2QG9 B;  4OMQ A;  1LJO A;  2KRN A;  4RUG A;  3V7R A;  5KYW B;  2DK3 A;  3V7S A;  2FRY A;  1ZHI A;  4MZT A;  4LXC A;  1RAH B;  5KE3 A;  2HL3 A;  5HKC A;  1K73 R;  2L0A A;  2P0Q A;  2BZX A;  1K0S A;  1YJ9 A;  3CCM Q;  1PHT A;  4F7U B;  2C0O A;  3TU4 K;  2ZPG B;  4HCB A;  3KBG A;  4J9C A;  3G1J A;  1WXT A;  2ECZ A;  1MND A;  4C5E A;  4M7A C;  4IUP A;  3AHU A;  3CC4 T;  2DE0 X;  4ZTJ A;  2HAX A;  1WZO A;  1M4Z A;  3RMQ A;  2HSE B;  1PWT A;  2YT6 A;  4RG2 A;  3RKY A;  4KUI A;  2ZAE A;  3NTH A;  1D1A A;  4JRQ A;  4F14 A;  2EQM A;  2JW4 A;  2RJC A;  4FT2 A;  4J5Y A;  4XU0 A;  4D8D A;  4N4G A;  4FW1 A;  1FMV A;  5DLQ E;  2KYM A;  2RH2 A;  1X6B A;  3CCR A;  2CGH A;  5GMK i;  3M0T A;  1QKW A;  2JTF A;  4RTV A;  1MV0 B;  3MHX A;  1R77 A;  2B8A A;  2HDA A;  3CME Q;  2QYZ A;  1WXB A;  4FM4 B;  2X51 A;  2NUZ A;  2CKK A;  1D09 B;  1M8V A;  2QA4 Q;  2MPX C;  4C92 B;  1RAB B;  4OP0 A;  1C1A A;  1VQ5 A;  1X6G A;  4PJO A;  4MDX A;  3QBY A;  1M8M A;  1MMG A;  2HQH A;  5GMK h;  2YUQ A;  2JUF A;  3HKS A;  1YJW T;  2CZ0 B;  3OYE A;  1RAC B;  3CME A;  5FU6 B;  3CCS T;  3QG1 A;  4FYY B;  1N8R U;  3RDV A;  3CCL Q;  5I2M A;  3FJ5 A;  2YHT A;  2J6O A;  2Z0W A;  2ZPE B;  1OEB A;  4M75 D;  3CC7 T;  3SEM A;  3OMG A;  1I5O B;  4XK8 E;  3PIP A;  3I5R A;  1NYF A;  2CUD A;  2FZC B;  1AWW A;  1D1C A;  4LDW A;  1NJI R;  2JS2 A;  4J8O A;  3NHN A;  1RAD B;  3V7C A;  4OMF B;  4J6X A;  3M53 A;  1QVG S;  3QII A;  2HMA A;  1D3B A;  1V76 A;  1PNJ A;  4AMC A;  4L6V 5;  2OAW A;  2XG8 D;  4C0Z A;  2EGA A;  1N5Z A;  2H3E B;  1M3B A;  1ZUU A;  4ZN3 A;  1R0B G;  2B86 A;  4BY6 B;  1AWX A;  3U23 A;  4CI0 C;  1WHG A;  2PTK A;  3LH5 A;  2ATC B;  1GXI E;  3CCJ T;  1NJI U;  3M0R A;  3I56 Q;  1SSH A;  4IIM A;  5GAN e;  4JZ3 A;  1MMN A;  1M30 A;  2HBP A;  4IIO A;  2FPF A;  2DRM A;  1M3C A;  4E2F B;  2WAC A;  2JM9 A;  2LNH B;  2K2V A;  1AVZ C;  3JB9 H;  2NUT B;  4VUB A;  1Y07 A;  4M78 D;  1ZUY A;  3MPU B;  4JLI A;  2LT1 A;  3RES A;  2MCN A;  1G83 A;  5C0M A;  1VQ9 Q;  3INZ A;  4KUL A;  1KQS P;  2KSS A;  4FSX A;  1YI2 Q;  3QZ9 B;  2VYT A;  5CO7 A;  3PNW C;  4IUT A;  2FZG B;  4QT7 A;  4XQ3 A;  5A0L A;  4BE1 A;  4HCZ A;  1TOV A;  3A8M B;  1UHC A;  3L2Q A;  4OMP A;  4LDU A;  4V2S A;  1W2B P;  1G8X A;  3OY9 A;  2DL5 A;  3OQ5 A;  2RD1 A;  1QP2 A;  1MMD A;  4JRP A;  1C6V X;  1GBQ A;  2AKL A;  1G3W A;  1VQL A;  3LH0 A;  2QTX A;  2JJ9 A;  3MP1 A;  3OA6 A;  9ATC B;  1QCO A;  2CP2 A;  4DEY A;  1GFC A;  2CP3 A;  2CYZ B;  3CPW A;  3RR6 A;  3P8H A;  2C06 A;  4JJD A;  4M75 A;  2R5A A;  1ABQ A;  3OYL A;  1KFZ A;  3CCR Q;  2FB7 A;  2DD4 A;  1V29 B;  5KYW A;  3G6E A;  1E6H A;  2HL5 C;  4C0G A;  2KRM A;  2VV5 A;  2X4X A;  2ZZD A;  1JJ2 S;  4O5V A;  1QCF A;  4KRT A;  4M75 G;  3G71 T;  3OYH A;  1WXU A;  3PT9 A;  2DF6 A;  2LDM A;  5IHK A;  2E12 A;  2WSE E;  4ZGE B;  2VUB A;  2KRS A;  2DL8 A;  4XTX A;  2CZ7 B;  1YIJ A;  2L3Q A;  3I5S A;  2VXF A;  4HVV A;  4R56 A;  3OW2 A;  3OYC A;  3CMA A;  1KC8 C;  4D8K A;  1OYX A;  3OBW A;  5KCO A;  2KR3 A;  1WJS A;  2GTO A;  1YJN T;  1WQ7 A;  3FDR A;  1W6X A;  3CC4 A;  4M77 G;  2RN8 A;  4IUV A;  2XHC A;  2LX7 A;  1I07 A;  1AZE A;  4RCC A;  5GAN 7;  3JCM d;  4OMO A;  5DM7 R;  1FMK A;  1JXM A;  3FIF A;  1A0N B;  1VQ7 Q;  4QVC A;  1BI2 A;  4OMM A;  2R5M A;  4XTU A;  1DJ7 B;  1O9S A;  2MYS A;  1WFW A;  3QHS A;  2GTJ A;  2C0T A;  1JB0 E;  1EFN A;  3CCS Q;  4QQG A;  1D0Z A;  3DB3 A;  2WSF E;  4C8Q D;  3EHQ A;  1H92 A;  2JNG A;  2LQ8 A;  2KT1 A;  1WQW A;  2KEA A;  4ZTF A;  3UF4 A;  4PJN A;  3OB9 A;  4NOY A;  1NPP A;  1WGS A;  4RCB A;  4FIB A;  1WHK A;  1KHI A;  3CXC S;  2QA4 T;  1VIF A;  4M7D G;  4XU3 A;  2JXB A;  4MMK A;  2RQU A;  1K9M U;  3CPW S;  2VGM A;  4KH1 B;  5KH6 A;  5GJW B;  1WA7 A;  4JUV A;  1TS9 A;  4CC4 B;  3TCJ A;  1XJW B;  4HXJ A;  4QQ6 A;  1PSF A;  4DOV A;  1KQ2 A;  3VS3 A;  1HD3 A;  4HKE A;  1NEG A;  4XTW A;  4PNO A;  5IAY A;  4EMG A;  1E7O A;  3HSB A;  1M90 C;  2DKG A;  2DJZ A;  4F17 A;  2RK1 A;  3LGL A;  4ZN1 A;  2RF0 A;  4CRI A;  3X28 B;  2DM1 A;  4IUR A;  1IHV A;  1WYX A;  1QQJ A;  1Q95 G;  1VQM A;  3G4S A;  1XNI A;  1I5L A;  1M9S A;  1IRX A;  2D6F A;  2X9H A;  5GMK l;  2P4R A;  5LJ5 g;  1RLP C;  3TQ7 P;  4JZ4 A;  2NUP A;  4C0D C;  3L42 A;  5GMK e;  4FYX B;  7AT1 B;  4AFS C;  2MI6 A;  3H0F A;  3OYK A;  1I81 A;  1TUD A;  2GF7 A;  5DLO A;  1Q7Y R;  2ED0 A;  4ZGD B;  1BB9 A;  4Q5W A;  3CC7 Q;  1C0M A;  5LJ3 f;  2DVJ A;  1GL5 A;  1VQP Q;  2RHY A;  1W1F A;  3M57 A;  2E1H A;  2O4X A;  2RO0 A;  1RAF B;  2X4Y A;  3BY7 A;  2DRK A;  4X9D A;  3CCE Q;  2LZ6 B;  1B3Q A;  1RAA B;  2NLU A;  2K5L A;  4KGV B;  4M78 F;  4XU1 A;  1JO8 A;  1QLY A;  2ZGW A;  1IXD A;  2MMP A;  3RKW A;  1S72 T;  2D0Q B;  1NE8 A;  4M7D B;  4M78 B;  2CT3 A;  3NTK A;  3L2W A;  1AZG B;  2DEU A;  1LNX A;  2PU9 B;  4C92 G;  1Q81 U;  2CRE A;  1XQH A;  1X2K A;  4JRI A;  2YDL A;  2ZPH B;  5M9O A;  4KGX B;  5LJ3 g;  3CCM A;  3GIB A;  3DKM A;  2BIV A;  3H0H A;  3VS5 A;  2V26 A;  2KRO A;  3EG9 B;  5FWB A;  2E5Q A;  2DXU A;  2EFI A;  4OF1 A;  2QGF B;  4TVR A;  1WJQ A;  3JCM J;  2COY A;  3OSS C;  4E6R A;  2DTH A;  1OOT A;  4RTU A;  1WLP B;  2EWN A;  2AKK A;  3QJY A;  1Q7Y U;  1NZ9 A;  2DIQ A;  1CKA A;  1FYN A;  1WHH A;  2JMA A;  2E70 A;  1MHN A;  5D6Y A;  1KQS A;  1ZSZ B;  4J9F A;  3JCM V;  4PJJ A;  1YJW A;  2JM8 A;  4FU6 A;  2LRQ A;  1Z9Q A;  2I0N A;  3OMC A;  1D0X A;  3ZBD A;  3QPH A;  3NFC A;  2FPD A;  4M78 C;  1LVK A;  1X43 A;  5GAN 4;  2ZPB B;  1OQK A;  1BCO A;  1O75 A;  3LX7 A;  4R55 A;  2DVE A;  2IIM A;  2VXE A;  3X24 B;  3KUF A;  1SG5 A;  2LQK A;  4PL6 A;  2DTO A;  1KG1 A;  1HYO A;  5IT9 E;  1ZSZ A;  2HQX A;  5GAM h;  4O6J A;  2DFU A;  2P84 A;  2RI3 A;  1Y71 A;  2CUB A;  1NM7 A;  1AEY A;  2K3B A;  5GAO q;  1UEB A;  4QW2 A;  1CSK A;  3KXT A;  5GJV B;  1NPR A;  1IHW A;  4AFQ C;  1EX4 A;  4E7K A;  4LN2 A;  3JCM Q;  2A28 A;  4DBF A;  2A08 A;  4KBM B;  1N9R A;  5GAN 8;  4RTZ A;  1PM3 A;  3OW2 S;  3C4S A;  3OS0 A;  3IQL A;  2H8H A;  1UGS B;  2NUT A;  3MEA A;  1VQO A;  1Q7Y C;  1Y96 A;  3A8G B;  3NMZ C;  3QWY A;  4M7A G;  2L3S A;  1HXD A;  3M56 A;  5LJ5 f;  4AG2 C;  2KXC A;  2P0K A;  2EAY A;  1OI1 A;  2KMT A;  3M54 A;  2XU8 A;  3VYG A;  3H41 A;  3M0P A;  5LJ3 e;  1VA7 A;  4GBQ A;  1Q82 R;  3GF5 A;  3E2U A;  4Z02 A;  2M1H A;  4M75 C;  1RI0 A;  5FWC A;  1YJW Q;  2LCC A;  2XDP A;  8AT1 B;  1S72 Q;  2MAM A;  2RHX A;  2WSC E;  4M7A A;  3WVE B;  2RQV A;  4GLM A;  3JCM P;  2XID A;  1KC8 R;  4ESR A;  3GNG A;  2OTL A;  3N5B B;  3S6W A;  4LDY A;  5KYY A;  3QO3 A;  2K9G A;  1K1Z A;  4RTT A;  2L3P A;  5FRM A;  2ZPI B;  2DIG A;  3I55 Q;  4FCY A;  1AWJ A;  4JLG A;  4OVA A;  3CCV Q;  1U5S A;  3MO8 A;  3CC2 Q;  4MZP A;  1I4K 1;  2HKN A;  2LT4 A;  1UG1 A;  5LJ5 e;  1VQM Q;  1GFD A;  1ZBX A;  1OPK A;  1H8K A;  4UC4 A;  2AZV A;  4MDW A;  4DQ2 A;  3EHR A;  2HQE A;  2V8I A;  2VWF A;  5D6W A;  2PUK B;  2AT1 B;  4XU2 A;  4BI4 A;  3M5A A;  1BI0 A;  1LCK A;  2AIR B;  3E1S A;  2QK0 A;  3L2V A;  2EYY A;  1K73 U;  2O01 E;  3X25 B;  1YIT Q;  4HT9 A;  1Q82 U;  4OML A;  2E41 A;  2DZ9 A;  4J83 A;  4E7Z A;  2DXB A;  1BKB A;  2K2M A;  3S3N A;  2KY9 A;  2F2W A;  2YRC A;  3CCU T;  1YI2 A;  2M0Y A;  1VQN A;  1H3H A;  1VQ9 A;  1W4S A;  5IN1 A;  3EH2 A;  3GLX A;  1N27 A;  2DA9 A;  3G71 A;  1U8R A;  3REB B;  5HK3 A;  1VQP A;  1KIK A;  2FZK B;  1YIT A;  2BUD A;  3VKI A;  1M2V B;  1V1C A;  2QAS A;  3QDF A;  5HCK A;  4N4H A;  4YTL A;  5KYY B;  1VQ4 T;  2XKO C;  1YHQ T;  1H3Z A;  4CC7 A;  2OJ2 A;  4PJO F;  2RMO A;  4MZM A;  3J80 E;  2CP5 A;  2DL7 A;  2LP5 A;  3CCV A;  3M59 A;  1YJ9 T;  2EGE A;  1UGV A;  1PKT A;  4A4K A;  1MMA A;  3RNJ A;  2VGN A;  2VAS A;  1CKB A;  3C95 A;  3MP6 A;  1LPL A;  5EG2 A;  4ZNX A;  4DBQ A;  4C8Q C;  5FU7 B;  4EMK B;  5IH2 A;  4M78 E;  2F69 A;  2XI9 A;  2CZ1 B;  4WF2 A;  3QWX X;  4M78 A;  2XK0 A;  2PVG B;  2LJ1 A;  1BIB A;  2DYB A;  2GQV A;  1SSF A;  2ZPF B;  1TTH B;  4HT8 A;  4M7A F;  2RQT A;  4PJL A;  3LWI A;  3CC7 A;  1ZX6 A;  2EW3 A;  4J6W A;  3HPW A;  4DOW A;  2RJF A;  3LYI A;  2QI2 A;  5CAI A;  4IUU A;  1PRM C;  1PRL C;  1UDL A;  1M1K C;  2CT4 A;  4EMK A;  2RK2 A;  2KQW A;  3ER0 A;  2E4H A;  2Y90 A;  4CC3 A;  4M78 G;  4OB3 B;  5GAN g;  1VQO Q;  1WHJ A;  1E6G A;  3CBO A;  2EQI A;  1PD0 A;  3EH1 A;  2OI3 A;  2EQK A;  4DA4 A;  2F5K A;  4HCC A;  2K57 A;  5ECA A;  1AT1 B;  1ZSZ C;  2E3H A;  2C0I A;  1K8A C;  2DX1 A;  4BDY A;  2V1Q A;  3EFO B;  3PVQ A;  4AFZ C;  4ELY C;  4J9I A;  3ULR B;  1IRE B;  4FSS A;  3M0Q A;  3UT1 A;  1KQS S;  1M1F A;  4Y92 A;  2L2P A;  2FYK A;  2A7Y A;  2JZ2 A;  6AT1 B;  1ZSG A;  3OS5 A;  1Y7X A;  3UAT A;  3JCM c;  2DO3 A;  4BE0 A;  3VV0 A;  4ORZ A;  4N0A A;  4Z88 A;  3CPF A;  1W2B S;  5CKB A;  2DBM A;  4C8Q G;  5IHN A;  4Z8A A;  1NLO C;  1ZBJ A;  2HKQ B;  2LC4 A;  2Y4X A;  5GAN 5;  2PQW A;  3CCR T;  4WTO B;  1TU0 B;  1XOV A;  2K7A A;  1ACM B;  3CC2 T;  4Y28 E;  2F2X A;  3ZFJ A;  2X4W A;  2MWP A;  2YWW A;  2CP0 A;  4XTV A;  2QEX T;  3CCV T;  4E7L A;  4A4H A;  3G6E T;  4PLL A;  4M75 F;  1HJD A;  4RKU E;  3JB9 J;  3HRU A;  1QWF A;  3MEU A;  2DEQ A;  3J7A F;  5GAN j;  2FG0 A;  2QDL A;  3A5Z B;  3EFR A;  3RUX A;  2DJQ A;  2IG0 A;  3A1P A;  3D7S B;  2Y4Y A;  1UJ0 A;  3FB9 A;  4E7S A;  5IXB A;  1X6O A;  4XAX B;  1T0H A;  3PVL A;  4B9W A;  2L8D A;  5A0G A;  4XTZ A;  3VS2 A;  3MEV A;  3JB9 G;  3QYH B;  3ZL7 C;  4F7U A;  1MV3 A;  2EYQ A;  4C92 F;  3E9G A;  3UA7 A;  1OU9 A;  3EG3 A;  2DYI A;  4C92 D;  4JJC A;  1U06 A;  5I11 A;  3VS4 A;  4BD3 A;  3QDR B;  3BDL A;  1VQ8 A;  2O9V A;  1K8A R;  2E3I A;  4C92 E;  1NYG A;  2MIO A;  2V1R A;  1IGU A;  1KJW A;  1NLP C;  1ZA1 B;  2KE9 A;  3GOX A;  1EZZ B;  4F7U F;  5GAO r;  2COW A;  2SEM A;  4BI8 B;  3F70 A;  5AYF A;  3RKX A;  1TWB A;  5HK0 A;  2JT4 A;  2CDT A;  2QA4 A;  1VYV A;  1YWO A;  2F2V A;  2XDD A;  2E6Z A;  4OMN A;  4A63 B;  4KGZ B;  4M7A B;  3EGU A;  3CMA Q;  1M90 R;  2YSQ A;  4GY5 A;  3SHW A;  2CSQ A;  1Q86 U;  3PMI A;  3L2Z A;  3CCU A;  2PZ1 A;  1YI2 T;  2DXC A;  1WX6 A;  2QQB A;  4BAC A;  1YWP A;  4A53 A;  3M0U A;  2JOY A;  4JDS A;  5GAO m;  3SDZ A;  1G3Y A;  5GAO l;  1OZ3 A;  1QVF S;  2LJ0 A;  2FHD A;  1Y96 B;  3QYG B;  4M77 F;  1BIA A;  2YUN A;  4RTY A;  2JVV A;  1X69 A;  3HRT A;  3TVT A;  3M9Q A;  4FT4 A;  1BCM A;  8ATC B;  2NUP B;  1GCQ A;  3I56 T;  2G6F X;  1SRM A;  2RHI A;  1JU5 C;  1B34 A;  1RAE B;  3M55 A;  5IXF A;  3I55 T;  3VS1 A;  3HFN A;  2A0F B;  4DBR A;  2XDB A;  3OYJ A;  2RI2 A;  2CZ6 B;  3V8J A;  1AOJ A;  5LJ5 d;  1VQ5 Q;  1QKX A;  4A54 A;  3G4S Q;  1W70 A;  4HVW A;  1PG5 B;  3ASK A;  5KE2 A;  1S1N A;  1SEM A;  1M2O A;  2J6K A;  1K9M R;  3VS6 A;  3MET A;  1B34 B;  3URG A;  3OYI A;  2E64 A;  4E47 A;  1TXQ A;  1KSW A;  1T0J A;  2HSP A;  5CKE A;  1M90 U;  3JB9 F;  4X34 A;  1VQM T;  1ZLM A;  3QSU A;  1VYU A;  2FEI A;  3ME9 A;  3JV3 A;  3I55 A;  1M5Q 1;  1Z9Z A;  2X3X D;  4N0A C;  3EG2 A;  2KVQ G;  2L3R A;  2BE7 D;  5J26 A;  3EAE A;  3O5Z A;  4JS5 A;  2EQJ A;  3HRS A;  2QQS A;  3JCM W;  2J6F A;  3I35 A;  3TEE A;  3JB9 I;  4LD9 K;  3PIO A;  3VJP A;  1KD1 R;  3VUB A;  2FO0 A;  3M4G A;  4FL6 A;  1UJY A;  1SHG A;  1S72 A;  2DTI A;  4JRK A;  4RG8 A;  3JB9 D;  2F1L A;  3WXM B;  4M7D E;  2KXD A;  3P8D A;  3EGD A;  2YLB A;  2D8J A;  2YUP A;  4R0K A;  4J9D A;  1UGR B;  3RBB B;  1WJR A;  1WNL A;  3PGG A;  3CME T;  3CCS A;  1PKS A;  2PVD B;  2H3J A;  1G3S A;  2M9U A;  2AZS A;  4PJO B;  4PJO G;  4E7I A;  4PJO C;  2HBW A;  3R6N A;  2KI7 A;  4DBH A;  2JS0 A;  3SWN C;  3SWN A;  1M1G A;  2DET A;  3OYN A;  1NEB A;  2GBQ A;  3DLM A;  2DIL A;  3NTI A;  2RA2 A;  2J7I A;  3WVD B;  2KYB A;  1KC8 U;  2DL3 A;  2KDS A;  4AG1 C;  3DB4 A;  3E19 A;  5FU7 C;  5CVI A;  4EMK C;  3CXC A;  1D1B A;  3H6Z A;  1TSF A;  1UUE A;  1VQL Q;  4JJB A;  4C5I A;  4RTX A;  1G5V A;  4OB1 B;  2M0O A;  4EMH A;  1UB4 A;  4A4E A;  3EGD B;  2YRV A;  2RNA A;  4JJN K;  2D8H A;  2BTT A;  3HFO A;  2LX9 A;  1GBR A;  2NYS A;  5HY6 A;  2DBK A;  4K11 A;  3X20 B;  1T3S A;  1QCN A;  4X9C A;  1Q86 R;  2DZC A;  3JCM X;  3MP8 A;  2OAU A;  1TH7 A;  2RI5 A;  3EFO A;  3FLG A;  5J39 A;  2GNC A;  5FRO A;  4N4I A;  1HK9 A;  3V8L A;  3MJX A;  5CQX A;  3C94 A;  4KT0 E;  5KYN A;  1M27 C;  4LNP A;  5GAM f;  4ELZ C;  5I2S A;  1VQK Q;  2DNU A;  1UFF A;  3MEW A;  2LVM A;  5GAN 3;  3VUZ A;  3LLR A;  2K5F A;  1VQ8 T;  2X35 A;  2OTJ Q;  2CS7 A;  1MNE A;  1B7T A;  3HP9 A;  2COZ A;  2EYW A;  3CCQ Q;  3CCQ T;  3CCE T;  5CQY A;  3UDC A;  2FRW A;  3JRZ A;  1UHF A;  2D9T A;  1YFN A;  1N6A A;  2X3W D;  4M4Z A;  3GPL A;  5CCA A;  1WHM A;  3PE0 A;  3M58 A;  3OS1 A;  1VQK T;  5I21 A;  4FW2 A;  2CH4 W;  3G4S T;  2EBP A;  2VVK A;  1VQL T;  4P5N A;  1VQ5 T;  2DMO A;  4RTW A;  1OU8 A;  1FWZ A;  2O9S A;  3JCM b;  2I2L A;  3PFS A;  3QUI A;  5KYU A;  2NWM A;  5GMK j;  4C8Q F;  3SFM A;  3HHT B;  4M7A D;  5FRN A;  2RQR A;  3CBM A;  3OW2 P;  4GLK A;  1EIF A;  1N9S A;  1YCS B;  2FL7 A;  4QQD A;  5EC7 A;  2VKN A;  3VU3 C;  3EGX B;  1BU1 A;  1T3L A;  1IZ6 A;  2BZ8 A;  5GMK m;  5GAO n;  1NG2 A;  4FYV B;  5A0D A;  2BZY A;  3DLL A;  1X75 C;  1UTI A;  3I56 A;  2JTE A;  2QAZ A;  3FEO A;  4NL2 A;  1OV3 A;  1AHJ B;  2KT8 A;  4B9X A;  4C92 A;  5LJ5 j;  1QVP A;  5D6X A;  3EGX A;  3JCM h;  1YNZ A;  2DLP A;  4QVZ A;  4II1 A;  3CQT A;  1QVG A;  2K3Y A;  1QWE A;  4J9H A;  5CKF A;  3L2U A;  4M77 D;  1QVG P;  2DAQ A;  3M0S A;  2QEX A;  1IO6 A;  1MUZ A;  2L5Q A;  4OGE A;  4LDX A;  5A2Q E;  3VS7 A;  3CD6 T;  4C8Q B;  3HTR A;  4IKF A;  5KYX A;  5GAN h;  4LUD A;  3V8K A;  4M77 E;  3JSC A;  3C0C A;  4M77 A;  3X26 B;  4C5H A;  2LCS A;  2O4X B;  1N8R C;  2A3L A;  4L5G A; 
#chains in the Genus database with same CATH homology
 3UA6 A;  1K4U S;  1UEC A;  2F2X A;  1A0N B;  2JMC A;  1ZUK A;  1J3T A;  2P4R A;  2EKH A;  1HJD A;  1RLP C;  4JZ4 A;  2K79 A;  1M3A A;  1QWF A;  4OMQ A;  2D1X A;  1Y57 A;  2KRN A;  4RUG A;  4AFS C;  2FG0 A;  2QDL A;  3H0F A;  2DJQ A;  1TUD A;  1UJ0 A;  2ED0 A;  2FRY A;  3VS0 A;  5IXB A;  2LQN A;  1BB9 A;  1T0H A;  3PVL A;  3VS2 A;  2DVJ A;  2L0A A;  1RLQ C;  1GL5 A;  2BZX A;  1K0S A;  1W1F A;  1PHT A;  1I1J A;  3ZL7 C;  1MV3 A;  2DRK A;  1ARK A;  2C0O A;  2ROL A;  2LZ6 B;  4J9C A;  1B3Q A;  1WXT A;  3UA7 A;  2ECZ A;  3EG3 A;  1JO8 A;  1QLY A;  2EPD A;  4JJC A;  1U06 A;  5I11 A;  3VS4 A;  2D0N A;  2DE0 X;  2O9V A;  2E5K A;  2RQW A;  1PWT A;  2YT6 A;  1B07 A;  1NYG A;  2CT3 A;  2MIO A;  2EYZ A;  2V1R A;  1AZG B;  4F14 A;  1KJW A;  1NLP C;  2KE9 A;  1K9A A;  2CRE A;  2JW4 A;  2SEM A;  1X2K A;  2YDL A;  4D8D A;  2JT4 A;  2CDT A;  1VYV A;  2KYM A;  1YWO A;  2F2V A;  1X6B A;  4OMN A;  4A63 B;  3H0H A;  3VS5 A;  2KRO A;  2YUO A;  5FWB A;  3EGU A;  3M0T A;  2YSQ A;  3SHW A;  1QKW A;  2CSQ A;  4RTV A;  2EVR A;  1AD5 A;  2PZ1 A;  1JXO A;  1MV0 B;  4E6R A;  1WX6 A;  4RTU A;  1OOT A;  1YWP A;  1WLP B;  3M0U A;  2HDA A;  2AKK A;  3EG0 A;  1WXB A;  1CKA A;  2NUZ A;  1U3O A;  1FYN A;  2JMA A;  2LJ0 A;  2YUN A;  4RTY A;  1X6G A;  1X69 A;  1YN8 A;  3TVT A;  1M8M A;  1YP5 A;  4J9F A;  2YUQ A;  3KFV A;  2JM8 A;  4F16 A;  1Z9Q A;  2I0N A;  1GCQ A;  1SRL A;  2HEQ A;  2FPD A;  2G6F X;  1SRM A;  1X43 A;  1JU5 C;  4EIK A;  5IXF A;  3VS1 A;  1RI9 A;  2IIM A;  3FJ5 A;  2J6O A;  1OEB A;  1AOJ A;  3SEM A;  1QKX A;  2O31 A;  3NGP A;  1W70 A;  4HVW A;  3I5R A;  1S1N A;  1RUW A;  1SEM A;  1NYF A;  2J6K A;  3I9Q A;  3VS6 A;  2CUD A;  1AWW A;  1KSW A;  1T0J A;  2HSP A;  2CUB A;  2JS2 A;  1BBZ A;  1NM7 A;  1ZLM A;  3NHN A;  1AEY A;  2K3B A;  1VYU A;  2FEI A;  3JV3 A;  1Z9Z A;  2X3X D;  4LE9 A;  1CSK A;  3EG2 A;  5GJV B;  2M51 A;  1PNJ A;  4HCK A;  4AFQ C;  2OAW A;  3THK A;  2EGA A;  3O5Z A;  4LN2 A;  1N5Z A;  2A28 A;  1M3B A;  1ZUU A;  2A08 A;  2B86 A;  2J6F A;  1AWX A;  2KNB B;  3I35 A;  3U23 A;  4RTZ A;  3GBQ A;  2FO0 A;  2EYX A;  2H8H A;  2PTK A;  1UJY A;  3IQL A;  1SHG A;  3LH5 A;  1SHF A;  1SPK A;  3M0R A;  2DL4 A;  3VRZ A;  1SSH A;  3NMZ C;  3QWY A;  4IIM A;  4JZ3 A;  2L3S A;  1Y0M A;  4AG2 C;  2KXC A;  1M30 A;  2KXD A;  4IIO A;  2D8J A;  2FPF A;  2YUP A;  2DRM A;  4R0K A;  1AWO A;  3H41 A;  3M0P A;  1M3C A;  1VA7 A;  4GBQ A;  4J9D A;  2JM9 A;  3RBB B;  2LNH B;  4J9E A;  5FWC A;  1AVZ C;  1PKS A;  2AZS A;  2W0Z A;  1ZUY A;  2RQV A;  4GLM A;  4DEX A;  2MCN A;  1G83 A;  4ESR A;  3VRY A;  2HBW A;  3EG1 A;  3R6N A;  2A37 A;  2KBT A;  2JS0 A;  2K9G A;  1K1Z A;  4RTT A;  3NPF A;  4QT7 A;  2L3P A;  1UHC A;  2LMJ A;  4OMP A;  1AWJ A;  2ABL A;  1NEB A;  2DL5 A;  2GBQ A;  1U5S A;  1GRI A;  1GBQ A;  2AKL A;  1TUC A;  2DIL A;  2J7I A;  2KYB A;  1UG1 A;  2DL3 A;  4AG1 C;  1GFD A;  1OPK A;  3REA B;  1H8K A;  2AZV A;  1UUE A;  3EHR A;  4JJB A;  2VWF A;  4RTX A;  4DEY A;  1GFC A;  4JJD A;  1LCK A;  2RNA A;  1ABQ A;  2D8H A;  2EYY A;  2AK5 A;  1KFZ A;  4JPB W;  2BTT A;  1TG0 A;  1GBR A;  2J06 A;  4OML A;  1K0X A;  1K76 A;  1UE9 A;  2DBK A;  4K11 A;  2K2M A;  1E6H A;  2F2W A;  1T3S A;  2M0Y A;  1H3H A;  2KRM A;  5IHI A;  5L23 A;  2DA9 A;  1QCF A;  2GNC A;  4KRT A;  2LJ3 A;  3REB B;  1KIK A;  1WXU A;  1I0C A;  2DF6 A;  4CC2 A;  5IHK A;  1M27 C;  1V1C A;  2KRS A;  4LNP A;  2DL8 A;  2RPN A;  5HCK A;  4AFU C;  1JQQ A;  2L3Q A;  2DNU A;  2MOX A;  3I5S A;  1UFF A;  4HVV A;  4WCI A;  4D8K A;  1GCP A;  2J05 A;  1JEG A;  2KR3 A;  2GTO A;  2XMF A;  4CC7 A;  1W6X A;  2OJ2 A;  2EYW A;  5I22 A;  2O88 A;  2FRW A;  2RN8 A;  2RMO A;  1UHF A;  2DL7 A;  2LP5 A;  2LX7 A;  1I07 A;  2X3W D;  4M4Z A;  4LUE A;  1AZE A;  3PE0 A;  3TSZ A;  2EGE A;  1UGV A;  1PKT A;  1HSQ A;  4J9G A;  4OMO A;  1FMK A;  2CSI A;  1JXM A;  2CH4 W;  3H0I A;  3RNJ A;  2EBP A;  2VVK A;  1CKB A;  2DMO A;  4RTW A;  4OMM A;  2O9S A;  2ED1 A;  2FPE A;  4ZNX A;  1WFW A;  2NWM A;  4J9B A;  2GTJ A;  2C0T A;  5IH2 A;  2PNI A;  1EFN A;  3QWX X;  1G2B A;  2GGR A;  2LJ1 A;  2LQW A;  1VYT A;  2DYB A;  2RQR A;  2ESW A;  2RQT A;  3EHQ A;  3TSW A;  2A36 A;  1H92 A;  2KT1 A;  1YCS B;  2KEA A;  5EC7 A;  1ZX6 A;  2EW3 A;  2VKN A;  3UF4 A;  1BU1 A;  1T3L A;  1ABO A;  2W10 A;  1BK2 A;  1PRM C;  1PRL C;  1UDL A;  2BZ8 A;  1X2Q A;  1NG2 A;  2GQI A;  2CT4 A;  2ENM A;  2CH4 A;  2BZY A;  4CC3 A;  4Z89 A;  1UTI A;  2JTE A;  1E6G A;  2JXB A;  2RQU A;  1OPL A;  2EQI A;  1OV3 A;  2OI3 A;  2KT8 A;  5GJW B;  5ECA A;  1WA7 A;  4HVU A;  2C0I A;  2DX1 A;  4CC4 B;  2V1Q A;  3PVQ A;  4AFZ C;  4HXJ A;  1YNZ A;  4J9I A;  3ULR B;  3VS3 A;  1HD3 A;  2DLP A;  1NEG A;  4FSS A;  3CQT A;  3M0Q A;  4Y92 A;  5FW9 A;  2L2P A;  1E7O A;  1WIE A;  1QWE A;  4J9H A;  1GCQ C;  4F17 A;  1ZSG A;  2SRC A;  2ROT A;  3UAT A;  3M0S A;  4ORZ A;  2RF0 A;  1IO6 A;  1WI7 A;  4X1V A;  1MUZ A;  4Z88 A;  3VS7 A;  1X27 A;  2DBM A;  2DM1 A;  2EGC A;  2KGT A;  4Z8A A;  2HCK A;  5IHN A;  1NLO C;  1ZBJ A;  4LUD A;  2K6D A;  3A98 A;  1WYX A;  1WDX A;  1XOV A;  3C0C A;  2K7A A;  2O2O A;  2LCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...