1PHTA

Phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain, residues 1-85
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
b'AEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT
publication title Crystal structure of P13K SH3 domain at 20 angstroms resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphotransferase
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1995-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1phtA00
1Z9QA 3NGPA 4AFUC 4HVWA 3C0CA 1U06A 1WDXA 1VYTA 2KGTA 3RBBB 1WI7A 3M0RA 3THKA 1YCSB 2RQRA 4RTVA 3REAB 5IHNA 2JW4A 1N5ZA 3VS2A 2DA9A 1OV3A 3R6NA 2EYZA 1AWXA 1UTIA 1G2BA 2KRNA 1X43A 1I0CA 1UUEA 2EW3A 2OJ2A 3PVLA 1ZUKA 2YT6A 4J9EA 2LQNA 2C0TA 3GBQA 1JXOA 4Z8AA 2KR3A 1K0XA 4RTUA 5IHKA 4K11A 1MV3A 4HXJA 3PVQA 1OPLA 1JO8A 1YP5A 4Z88A 2ROTA 2SEMA 1KFZA 4A63B 1M3AA 4CC3A 1AEYA 1QLYA 4RTWA 4F17A 1ZLMA 2KBTA 2C0IA 2KROA 2KXCA 2LQWA 2EPDA 3EHRA 1VYUA 2YDLA 1VA7A 2DYBA 5IXFA 4HVUA 1PRLC 1QKWA 2HCKA 2RQWA 2LMJA 1OEBA 4Z89A 3I35A 2CT3A 1W6XA 3TSZA 2J6KA 1AZEA 1TUDA 2VWFA 4OMOA 1QKXA 1UE9A 3VS4A 2HBWA 1FYNA 1RLPC 2DLPA 2DF6A 1AWJA 1NLOC 2IIMA 2FPEA 2ED1A 3EGUA 2JXBA 4GLMA 3UF4A 3M0PA 2W10A 1K9AA 1SHGA 2LP5A 3SEMA 1GFDA 3VRYA 2G6FX 2CH4W 3NPFA 3RNJA 2HSPA 2HDAA 4DEYA 4RTZA 4JJBA 1K4US 1U5SA 4J9HA 2EYWA 1M3BA 4F14A 2YSQA 4J9DA 2AKKA 5FWBA 2F2VA 4LNPA 1PRMC 2AZVA 1B3QA 4E6RA 1LCKA 4ORZA 4HCKA 2GBQA 1YWOA 2O9VA 2NUZA 1SHFA 1M3CA 2I0NA 3ULRB 3VS1A 2YUPA 2GNCA 1M27C 4GBQA 2KT8A 2ENMA 3O5ZA 4EIKA 2BZYA 1T3SA 2DRMA 1GBQA 1TUCA 1E6HA 1WLPB 1MV0B 2LZ6B 3VS3A 2F2WA 5GJVB 3H0FA 2V1QA 4M4ZA 2J7IA 2KYBA 3TSWA 4JJDA 1ZSGA 2JTEA 2J6FA 3EG1A 2AK5A 2ESWA 2EYXA 1MUZA 2DE0X 1X27A 2D8HA 3H0IA 1I07A 4J9FA 1HJDA 2DRKA 2JM9A 1NYGA 2GTJA 2YUQA 1SEMA 3U23A 3NHNA 1YNZA 2O31A 2DILA 1B07A 4JPBW 1NG2A 3I9QA 5GJWB 1IO6A 2K2MA 1KIKA 2L2PA 1GBRA 2D1XA 1AZGB 4RTTA 2CT4A 1PKSA 1KSWA 1AWOA 1X6GA 5IHIA 4ESRA 1CSKA 2DNUA 1A0NB 1BBZA 2EBPA 2V1RA 4JZ4A 2EGEA 2LJ0A 4CC2A 1T0HA 4LE9A 5L23A 2K9GA 1E6GA 1X6BA 4OMQA 1E7OA 1UGVA 2RPNA 1JXMA 1GL5A 2E5KA 4AG2C 1SSHA 4OMMA 1NM7A 3VS0A 3VS7A 2DL5A 4QT7A 2AKLA 2KEAA 1SRLA 2D0NA 3VS6A 2FRYA 1H8KA 3EG3A 2BZXA 2A28A 1QWEA 1NEBA 3UA7A 1SPKA 1FMKA 2H8HA 2JS0A 2RMOA 3H0HA 1ABQA 3TVTA 2LCSA 1AD5A 1G83A 1UDLA 1CKAA 1I1JA 2K6DA 4D8KA 1Y0MA 4J9BA 3ZL7C 4OMLA 1BK2A 2CDTA 2KXDA 1UHCA 1WXTA 2ROLA 4R0KA 2EVRA 2RN8A 1K76A 2VKNA 2FG0A 2LJ3A 4RTXA 2M0YA 1OOTA 1NEGA 2K79A 5IXBA 2RQVA 2CUDA 2DM1A 1YWPA 4D8DA 2JMCA 2ABLA 2L0AA 2GGRA 1JQQA 2BZ8A 3UATA 2KYMA 2JS2A 2DL3A 2X3XD 3LH5A 2DL4A 2RNAA 1VYVA 5ECAA 2J05A 1WXBA 2MIOA 5FWCA 5HCKA 2F2XA 4F16A 5EC7A 2O9SA 1JU5C 3REBB 1WXUA 1WA7A 2MCNA 2YUOA 1NYFA 2CSIA 4AFQC 1PWTA 1W70A 2ED0A 3M0QA 2LX7A 2CH4A 1K0SA 4J9IA 2DL8A 2PTKA 1GCQC 1ZUYA 4JJCA 2CSQA 1CKBA 1PKTA 1QCFA 1M8MA 1UJYA 2NWMA 1T3LA 1X2QA 2A37A 3IQLA 1H3HA 5FW9A 1JEGA 1AWWA 2JT4A 2FRWA 1GCQA 1UG1A 1AOJA 1PNJA 4J9CA 4IIOA 3QWXX 2ECZA 2L3PA 2GQIA 2XMFA 3I5SA 2EGAA 2K7AA 2M51A 2JMAA 4KRTA 2RQUA 2MOXA 3CQTA 4AFSC 1WYXA 4IIMA 1WFWA 2A08A 1XOVA 1PHTA 2X3WD 1UECA 1ZBJA 4CC4B 2YUNA 3UA6A 4J9GA 2EGCA 2CREA 1M30A 2RQTA 1RI9A 3EHQA 1AVZC 1X69A 2OAWA 4X1VA 4FSSA 3H41A 2KE9A 2W0ZA 2L3QA 2EQIA 4CC7A 4OMPA 2VVKA 4RUGA 1K1ZA 1GFCA 3JV3A 1EFNA 2DL7A 3EG0A 4LN2A 2C0OA 1BB9A 2FO0A 2JM8A 4AFZC 2A36A 1TG0A 2GTOA 1Y57A 2KNBB 4OMNA 1OPKA 1NLPC 4LUDA 2LNHB 4LUEA 1S1NA 2DJQA 2OI3A 3QWYA 2P4RA 2AZSA 2BTTA 2LJ1A 1HD3A 2EYYA 1UJ0A 2PNIA 1U3OA 2DBMA 1GRIA 2PZ1A 3M0UA 2DX1A 4RTYA 1W1FA 1WIEA 2DVJA 1UFFA 1GCPA 5I11A 2RF0A 4HVVA 3NMZC 1KJWA 1RUWA 2J6OA 2D8JA 1Z9ZA 1QWFA 2FPDA 2DBKA 2FEIA 5IH2A 1X2KA 1J3TA 1RLQC 2J06A 1SRMA 3SHWA 1ARKA 3KFVA 4Y92A 3I5RA 1ZUUA 1ABOA 3A98A 2O88A 1H92A 1BU1A 3M0TA 2KRMA 1ZX6A 2CUBA 3VRZA 4WCIA 2O2OA 3FJ5A 2KRSA 2B86A 2EKHA 2HEQA 3PE0A 2FPFA 3VS5A 2SRCA 1HSQA 1YN8A 4AG1C 2QDLA 1WX6A 2L3SA 1UHFA 1T0JA 4DEXA 4ZNXA 3M0SA 1V1CA 2K3BA 2DMOA 4JZ3A 5I22A 2KT1A 3EG2A
chains in the Genus database with same CATH superfamily
3NGPA 2ZZDA 2QGFB 3Q1JA 5A0GA 2DETA 4HVWA 3C0CA 1UGPB 3I55Q 4AT1B 4FU6A 1WDXA 2KGTA 1C0MA 3M0RA 5IT9E 1WHJA 1G3TA 2JW4A 2LC4A 3FB9A 3VS2A 3KBGA 3M53A 1KQSS 1OV3A 3LGLA 4CRIA 1YCYA 3CCUT 3VJPA 3V8JA 5GANf 1VQKT 1VQLQ 5LJ3d 2HQHA 3I56T 2LT1A 1R8OB 2JTMA 4L6V5 1IHVA 3OYBA 2LQNA 2QQBA 1SSFA 3CCMQ 1NJIC 4RTUA 1MV3A 4HXJA 3PVQA 4Z88A 4PJOD 1V76A 2SEMA 3MJXA 2WACA 1S72T 4MMKA 1UB4A 4M7DB 1QLYA 4F17A 1KD1U 5GAN5 5KYUA 2O01E 2HSEB 1TH7A 1VA7A 2DPPB 1OI1A 5GAN3 2QEXA 3A1PA 5KYYB 4OMFB 4X9CA 2RQWA 1O9SA 1OEBA 5FROA 3A8LB 1PD0A 2VWFA 2JZ2A 2RO0A 4ZN1A 1BIBA 2OTJQ 4DOWA 3DB3A 1N27A 1RLPC 1RADB 1TXQA 2XK0A 3CCVQ 1AWJA 1NLOC 4PFPA 5GAOm 3OSVA 5A2QE 2FPEA 2ED1A 4EMGA 2DD4A 3EGUA 1PM3A 2RHXA 2JXBA 4XQ3A 3LWHA 2W10A 1K9AA 1WHGA 1MNEA 1RAAB 3VU3C 5CQYA 2QEXQ 2E1HA 3EG9A 1VQ5A 1H3ZA 1WZOA 1B34A 1ZBXA 2HSPA 1RAFB 1Q82C 4A4KA 2E64A 4XU2A 4JJBA 5CO7A 4J9HA 2EYWA 1M3BA 1M2OA 3HPWA 1QVGA 1ZQ1A 5GAMj 5HKCA 3I56Q 4M78F 3A5ZB 3P8HA 4M7DE 2XU8A 2RHZA 1FX7A 2CP2A 1YJWA 3RDVA 4ORZA 4HCKA 1YWOA 1N6AA 1SHFA 3HHTB 2YUPA 1S72Q 2GNCA 1M27C 4GBQA 3J81E 4PLLA 3J7AF 3TQ7P 4JUVA 5D6WA 1Q86R 4EIKA 3HFNA 3JCMW 4NL3A 2DXCA 4ME7A 2DRMA 4ZN3A 1IREB 1PC0A 4M77B 1B7TA 2LZ6B 2V1QA 5DM7R 3E19A 3LX7A 4PJOG 1BI2A 2JTEA 2F5TX 2HL5C 2J6FA 3EG1A 1YJ9A 2ESWA 3JCMJ 3OYGA 2DE0X 1QP3A 2ATCB 1X27A 3H0IA 1VQ9T 4J9FA 2JM9A 1Q81U 1OU9A 1Y7XA 4PJLA 1VOMA 4C8QC 1Y07A 2O31A 1WQWA 1Q82U 1B07A 1NG2A 2HBPA 2K2MA 1KIKA 4C8QA 2M02A 2L8DA 2D1XA 1AZGB 4E2FB 4RTTA 3G4SQ 1M90U 4C0FA 4GLKA 1KSWA 5IHIA 1A0NB 2X4XA 2LJ0A 1YJ9Q 4M75C 1E6GA 4OMQA 2RPNA 2E5QA 2I2LA 2E5KA 1M2VA 1UGSB 4FYXB 4OMMA 4FL6A 3JB9I 1VQ6Q 1OZ3A 2DL5A 4M75A 2KEAA 2RM4A 3ZEHA 3QDRB 3CCJT 1WGSA 4HA8A 3G6ET 3VS6A 3JB9D 3VYGA 2FRYA 5GANh 2Y4XA 3RMSA 2DKGA 1UGRB 3BFMA 2M16A 3JCMQ 1VIEA 1VQMA 5KCOA 1SPKA 1IHWA 1FMKA 3R6OA 3H0HA 2X4WA 1AD5A 1CKAA 1I1JA 2QI2A 3OS2A 3CD6Q 4OMLA 5GAOq 4M78A 4J6WA 4R0KA 2EQKA 2M0OA 3CCQA 1YFNA 1VQ9Q 1WNLA 4RTXA 5C6SA 1NEGA 4FT4A 2DM1A 2VXEA 4LDYA 1VQOA 4D8DA 2JMCA 3RKWA 5KYWB 2GGRA 4MMLA 2EQJA 1KQSP 5FU6B 1JJ2S 3UATA 5KE2A 3V7RA 3LH5A 2E6NA 5ECAA 2VB6A 5C0MA 2NUTB 3X26B 4F16A 3META 3REBB 1WXUA 1WA7A 2YUOA 4AFQC 3HSBA 2ED0A 2CH4A 2PTKA 4M7AG 1GCQC 1ZUYA 4JJCA 1IGUA 2XKOC 1CKBA 4Q5WA 1M8MA 2BKDN 1UJYA 3CCLT 3CCQQ 3OMGA 4BD3A 2B8AA 3IQLA 2RJCA 2JT4A 5FU7C 1GCQA 4C8QE 2L3PA 2PU9B 2COWA 2E12A 3JCMP 2XMFA 3CCSA 2EGAA 1YJNA 3CMAT 2RQUA 4MZMA 4PJOB 1FMWA 1O75A 2R58A 2FHDA 1WFWA 3JCMX 4ELZC 1RI0A 1TOVA 2A08A 2BUDA 4JLGA 2OTLT 4PFOA 3X25B 3HRTA 4DBRA 3MHXA 4J9GA 3NTHA 5LJ5f 4BI3A 2RQTA 3KXTA 4BI4A 2EKOA 2RJDA 4P5NA 3OBYA 5D7UA 5I21A 2L3QA 2ZPBB 4M7DD 4OMPA 1OU8A 5LL6S 3JB9F 4RUGA 1K1ZA 1GFCA 1EFNA 2DL7A 3EG0A 2VUBA 3A8OB 3CPFA 4AFZC 1M1FA 2GTOA 2KNBB 3CCSQ 4ZGEB 1OPKA 1NLPC 5A0LA 4LUDA 3FEOA 4BDZA 4GY5A 4BACA 4MZPA 2DJQA 3QSUA 1OZ2A 2K5FA 2DEQA 2CP6A 2HZYA 2BTTA 2LJ1A 2EYYA 1UJ0A 3LYIA 1W4SA 2M9UA 3F70A 5CKDA 2DIGA 2LCCA 1QQJA 1WIEA 3CC4T 4DBHA 1UEBA 3RERA 1RUWA 3L42A 3HFOA 2C06A 3KFVA 4C0ZA 1ABOA 1X01A 5HY6A 4HT8A 2VXFA 4E7HA 2MMPA 4XK8E 3TU4K 1BU1A 3OS5A 3VRZA 1PD1A 1BI3A 5GAOn 2EKHA 3FLGA 2RI5A 3V7CA 4D6WA 2OTLQ 1YN8A 1WHMA 3SWNC 4BE1A 1WX6A 2L3SA 4C5IA 1JBMA 1OYXA 2AHJB 1Z9QA 5GMKh 4F7UA 5GAOl 4WTOB 1VYTA 3RBBB 1WI7A 3QIIA 3JB9J 2XD0A 2HD0A 4M77D 4XAXB 3E9FA 1D0ZA 3R6NA 1UTIA 5GANd 4KT0E 1M5Q1 2G3RA 4QVCA 4LDWA 2WSCE 2EW3A 2OJ2A 2LRQA 4JRIA 3PVLA 5CK9A 2CP5A 2C0TA 2CYZB 3JCMe 1KC8R 3N5BB 1VQ4Q 4M7DF 3EFRA 1ZSZC 1U1TA 3CC4Q 1JO8A 2OAUA 2ROTA 2EIFA 3JCMV 1MHNA 4DBFA 1Y96B 1ZLMA 2C0IA 5CR2A 2LQWA 2EPDA 1ZSZA 3J80E 4F04B 4PJJA 5HK0A 1LJOA 5IXFA 4HVUA 2FB7A 1PRLC 3M54A 4BY6C 4BUGA 1M1KC 2LMJA 5A0DA 2CT3A 2HKQB 3CC7A 1W6XA 4XU1A 2J6KA 1SKUB 1TUDA 2QQAA 1MGQA 4E7JA 4FCYA 1JJ2P 2DLPA 1KHIA 3CBMA 2DXUA 4IUPA 1MMDA 3CMEQ 4QVZA 1IZ6A 4AMCA 4M7AE 4GLMA 3M0PA 5GAN6 4C8QD 3H6ZA 5GAMe 1SHGA 5LJ5h 3SEMA 3I55A 1XTDA 2RK2A 5GAN2 4C92C 4NOYA 3VRYA 1GFDA 2G6FX 2MK5A 2YRVA 3UDCA 3RNJA 4QVDA 3X24B 2X9HA 3OMCA 1N8RU 2AT1B 4RTZA 3CEYA 4ELYC 4R56A 4C92A 1BKBA 2YSQA 4J9DA 2CP7A 2E10A 3OYMA 4B6MA 2X4YA 1KD1C 1VQLA 5KH6A 2QAZA 4HKEA 1YHQT 4F7UE 3CCMA 3C4SA 2QA4T 2DEUA 2O9VA 2I0NA 3PGGA 3UPUA 4PFZA 2CZ0B 5IN1A 4EMKC 4M77F 2DO3A 5KYXB 2QG9B 1RAGB 4ZGJB 2BZYA 1T3SA 2E65A 1GBQA 5KYNA 3MO8A 1WPYA 1WLPB 2F2WA 5GJVB 4M4ZA 4EMKA 3HL8A 2E41A 4QQGA 1ZSGA 3LH0A 5KE3A 3JB9H 2CKKA 1YITQ 4PLIA 2ZPGB 3QYHB 2YUQA 4KGZB 3U23A 2DILA 2EJ9A 2OTJA 2XDPA 1BI1A 1K8AU 3V8LA 1NJIR 3CCVA 1IO6A 5CKHA 3M55A 5GANj 2F1LA 4II1A 2XHCA 3OYFA 2WSFE 2CT4A 2ZGWA 1KK7A 2K5LA 3JCMf 3H8ZA 2E3IA 2F5KA 3FDRA 1AWOA 1CSKA 2X51A 1BBZA 2DZ9A 4JZ4A 4CC2A 3MP1A 2K9GA 2DZCA 4LD9K 1E7OA 3CCUA 4C8QG 3EFOA 3M5AA 4AG2C 3VKIA 1VQKA 2LQ8A 3OYYA 3QKJA 3I56A 1TTHB 2RA2A 4QT7A 1ACMB 1OX9A 2D0NA 2L3RA 2GCXA 3JCMc 1H8KA 3S3MA 2ZPEB 2XICA 1S72A 2JJ9A 1NEBA 3C94A 1M9SA 3DLLA 1ABQA 4C92E 3OYAA 1UDLA 1Q81C 4M75G 1Q7YR 2Y90A 2DERA 1YJWT 3ZL7C 1MMAA 3A8HB 2CDTA 2KXDA 3ER0A 4N4HA 1WXTA 5CKBA 4E7KA 3CCUQ 2EVRA 2RN8A 1VQKQ 2RD1A 4EDUA 2VKNA 2FG0A 2LJ3A 2M0YA 1OOTA 1D0YA 5GAMf 2K79A 2RQVA 5GMKl 3SB2A 3H9NA 2ABLA 2L0AA 1JQQA 2BZ8A 1M90C 3WXMB 2V8IA 2DL3A 2X3XD 2A7YA 1VYVA 2R57A 2MIOA 5FWCA 5EC7A 1JU5C 4OB0B 1KQSA 1D1CA 3UWNA 1NYFA 2CSIA 1W2BS 1B34B 2LX7A 3G4SA 4PK4A 1VIFA 5J39A 2MI6A 1X6OA 2O4XB 4J9IA 1I8FA 1PKTA 1MMGA 4PL6A 2NWMA 2A37A 5FW9A 3GF5A 1YBYA 3VUBA 2KK4A 3L2UA 4IIOA 4PJOF 3GP8A 1HXDA 2E6ZA 1VQ6A 4IUUA 4ZGDB 4M7AD 1ZHIA 2K7AA 3NTKA 2JMAA 3P8DA 2MOXA 4JLIA 1RABB 3RKYA 3M9QA 2VV5A 5DLOA 5LJ3j 5LJ5d 2JVVA 3UA6A 2EGCA 3EH2A 1RI9A 1YI2T 3BW1A 3CD6A 3OA6A 4X1VA 1I5LA 4XU0A 2P84A 1VQMT 2LDMA 4BI8B 1VQ9A 3QZ5B 3OYIA 1BB9A 2A36A 2IVWA 4E7LA 4OMNA 3CC2T 2VGMA 5D6XA 3L2WA 2QQSA 2E4HA 1Q86U 2LNHB 3UT1A 2R5MA 1K73R 6AT1B 1K9MR 1D1AA 4QQ6A 3QWYA 4C8QB 1HD3A 4M78C 2PNIA 2DBMA 3QJ6A 1GRIA 2XG8D 3LW5E 4RTYA 4KH0B 2DVJA 1GCPA 3NMZC 1M2VB 2NUTA 2D8JA 3JCMh 1XJWB 1G8XA 3CCRT 3RKXA 3M59A 1ARKA 3OW2S 2NUPA 3I5RA 5GMKj 1ZUUA 5J3BA 3CCJA 2JOYA 2P4TA 4JDSA 3CPWS 2LTOA 2HKNA 2O2OA 3QZ9B 3JCMg 2B86A 2HEQA 3PE0A 3GIBA 2DK3A 2SRCA 1HK9A 2QDLA 3CBOA 3FIFA 2NYSA 4J5YA 4JRQA 4ZNXA 3P8BB 3M0SA 1V1CA 2V8JA 1YI2Q 3QBYA 4PJOA 2KT1A 1PCXA 3EGXA 4FYWB 2JNGA 2KSSA 3GNFB 4AFUC 4M7AF 2K3XA 2FL7A 1U06A 1R0BG 2RHYA 3THKA 1YCSB 2RQRA 2GFUA 3QPHA 3REAB 5IHNA 3G6EQ 3CCJQ 4JRPA 1N5ZA 3RMQA 5GAMh 2EYZA 1LNXA 1G2BA 2RJEA 1X43A 2KI7A 4DBQA 2Z0WA 4F7UG 4NS5A 1UUEA 3PMTA 2Y4YA 2PUKB 1ZUKA 4XU3A 4J9EA 2XI9A 1BYMA 1C6VX 2KR3A 1XNIA 1K0XA 1OPLA 4L5GA 5GAMg 2EJGA 1YP5A 3AT1B 4M75E 2A0FB 1NPPA 1KFZA 4A63B 1M3AA 2FYKA 4CC3A 1AEYA 2VYTA 2FZGB 2KBTA 2L89A 3CCRQ 1VQPT 2KXCA 3CXCS 3S6WA 1VQ8T 4Y28E 3NFCA 5LJ5j 4Z02A 3QJYA 2IPOB 1VQ7T 1QKWA 1KHCA 3CMAA 1ZA2B 5FU7B 2YXYA 3BDUA 4M78E 1EIFA 2PVOB 3TSZA 5J26A 1TUGB 2DXTA 3MEAA 2IG0A 1UE9A 2OTLA 4YTLA 1RAIB 2HMAA 8AT1B 2DF6A 4KULA 3CCLQ 1I81A 2LX9A 2RH2A 3G1JA 4LXCA 1JJ2A 3FC3A 2LP5A 1W2BP 2HAXA 4CI0C 3NPFA 3QYGB 3CMAQ 4ZTFA 4DEYA 4J7FA 1K4US 1U5SA 5FRNA 4F14A 4V2SA 3CBPA 2EQUA 2K2VA 4C0DC 2DXBA 2F2VA 1D0XA 2AZVA 1B3QA 1G3SA 3RESA 4E6RA 1VQ4A 3EAEA 1JB0E 5DY9A 3VS1A 3CC4A 2ENMA 1D3BA 2DTOA 4C92G 1VQPQ 2A3LA 1WJQA 5CAIA 1IGQA 4L59A 3LGFA 3OSSC 4M7AB 1MV0B 1VQ7Q 3VS3A 3H0FA 1QP2A 3TCJA 2AK5A 2EYXA 1MUZA 5GANe 1Y96A 5L8RE 2D8HA 3CCET 1QVFS 3RUXA 4EMHA 1SEMA 3MCAB 3PNWC 4XTZA 1YNZA 3JAME 5FLXE 3WVDB 2KDSA 1I5OB 1Q95G 3I9QA 3MPUB 3CMEA 2QXFA 5GJWB 3OYEA 4KGXB 3SWNB 1QCOA 2L2PA 4N0AA 1N8RC 1YIJT 3QO3A 4F7UB 1GBRA 4B9WA 1KC8C 3JCMd 4A4HA 4LDUA 1PKSA 1GXIE 2RJFA 4J6YA 1F1BB 4C5HA 4R55A 1G5VA 2EGEA 2D9TA 1X6BA 1UGVA 2QGGA 2LQKA 1M1KR 2RB6A 4C5EA 1GL5A 3L1AA 1XQHA 1SSHA 2MWOA 1LVKA 1KQ1A 4DQ2A 1KG1A 2QTXA 3VS7A 3OW2P 1HYOA 2CZ7B 2AKLA 4QW2A 2LT4A 3G71T 1SRLA 3CPWP 4DA4A 4OB3B 1IRXA 2MF2A 3EG3A 1SG5A 4LDXA 2GQVA 2A28A 3EGDA 2K4YA 4IUVA 2MWPA 2VASA 3OQ5A 1LPLA 1ZSZB 4IURA 2RMOA 5IAYA 1G83A 3PIPA 4D8KA 2DTIA 4J9BA 4JRKA 1BK2A 3MP8A 1UHCA 1VQNT 1UGQB 1K8AC 4EPCA 1K76A 8ATCB 5GAMd 3OYLA 1KC8U 4MDXA 5KYXA 1YITA 5IXBA 4RMOA 4ANJA 1YWPA 1QCNA 4M75D 3DB4A 2DYIA 1KD1R 2KYMA 5GAN7 3EH1A 4ZTJA 2RNAA 2J05A 3OYJA 2CZ1B 1MMNA 2F2XA 1YIJQ 2EJFA 2MCNA 1W70A 4M7DC 3L2RA 1K0SA 2V8KA 2OTJT 1QVGS 2CSQA 4PNOA 3BE3A 1QCFA 2HL3A 3CCVT 4M78D 2X35A 3BY7A 1H3HA 4UC4A 1EX4A 4C92B 2COZA 4M7DA 4A54A 1JEGA 2JUFA 3CXCP 2FRWA 2K57A 1AOJA 3E1SA 3QWXX 2ECZA 5LJ3e 3ZBDA 1YHQA 3G71Q 2QEXT 4RKUE 1D1BA 3OYNA 3I5SA 2EFIA 2FZKB 2QA4A 5KYYA 1KQ2A 2KVQG 4WF2A 3OBWA 4E7IA 3CQTA 1WYXA 4IIMA 3A8GB 4FT2A 2DFUA 3MEUA 2K5IA 2X3WD 2QTVA 3OYDA 2YUNA 4OP0A 2RHUA 3HTRA 1BI0A 2CREA 4EMKB 1M30A 1VQNQ 3EHQA 2OAWA 2DJZA 4FSSA 3H41A 3L2VA 2W0ZA 3WVEB 4B9XA 1EZZB 1IB8A 1RAEB 3OS1A 2VVKA 3FRNA 2C0OA 2JM8A 3MKDA 4FW2A 1YHQQ 1VQ5T 1Y57A 4C8QF 2QA4Q 1RACB 4OGEA 4X9DA 4LUEA 3MEWA 3KUFA 2OI3A 2QYZA 3SD4A 3TEEA 1QW1A 2AZSA 5KYUB 2EAYA 2RI3A 1R77A 1U3OA 4HCZA 5GMKe 1OQKA 2PZ1A 3M0UA 2QASA 1D09B 2D0QB 1Q81R 1SF9A 3DKMA 1W1FA 4MZTA 4M77C 1UFFA 2RF0A 4HVVA 2XDDA 3M4YA 4RCCA 1Q82R 3EFOB 4M75F 1N9SA 2J6OA 1Z9ZA 1QWFA 2FPDA 2DBKA 1WHHA 4DOVA 1X2KA 1Q7YC 1V29B 3HRSA 4KH1B 4N4GA 3VYHB 1NJIU 1Y71A 3G4ST 4O5VA 4M77A 3DLMA 2O4XA 3A98A 2O88A 1RL2A 1H92A 5GAOp 4QKUA 4M78G 2H3EB 4WCIA 1M90R 1YJ9T 3FJ5A 1C1AA 4OB2B 2YHTA 4E7ZA 3INZA 1QVFP 2FPFA 1HSQA 3MEVA 5CKFA 3EG9B 2MAMA 1VQ6T 2KMTA 4XTYA 1UHFA 1T0JA 4DEXA 4BDYA 2K3BA 2AIRB 4JZ3A 1G3YA 3X20B 5I22A 3EFSA 1Q86C 3L2ZA 2NLUA 4O6JA 1G3WA 3D7SB 3ZFJA 5HK3A 1VQ5Q 1VUBA 4A4GA 4RTVA 2DAQA 2JTFA 4BE0A 2DA9A 4J7IA 3CD6T 3PMIA 1P92A 1AWXA 2KRNA 4KGVB 1PSEA 1Q7YU 1I0CA 4KBMB 3S3NA 1M4ZA 4FSXA 2HNIA 1IXDA 2FZCB 2KQWA 2YT6A 5LJ3f 1YJWQ 2XDBA 3GBQA 1JXOA 2CP3A 4LDVA 4Z8AA 5LJ5e 3VV0A 2P0PA 3GNGA 5IHKA 1PSFA 4K11A 2MYSA 1U1SA 4RTWA 4PJMA 4JS4A 2KROA 3EHRA 1VYUA 2YDLA 2FVUA 2DYBA 3ASKA 3TREA 2HCKA 2RK1A 2QDYB 3PTAA 4Z89A 4IUQA 4JS5A 3I35A 2ZPFB 3CCQT 5FU6C 2GF7A 3PT9A 4XTUA 1M1GA 1AZEA 4RCBA 4OMOA 1QKXA 1VQOT 2BIVA 2CS7A 3VS4A 2HBWA 1FYNA 2E70A 5KYWA 5I2MA 5EG2A 1K73C 4QQDA 2IIMA 1K9MC 1YI2A 4M77E 2LNVA 1NZ9A 3URGA 1OULA 2JN0A 3UF4A 4OF1A 2WSEE 2EYQA 5GMKi 4LD6A 4M75B 1QVGP 2CH4W 3CC2A 3AHUA 5GANg 1R0CB 3G6EA 2HDAA 3RR6A 3E2UA 5GAN4 1W2BA 1WQ7A 1WJRA 2AKKA 4PJOC 1TWBA 4C0GA 4X34A 2D6FA 3T9NA 5FWBA 5D6YA 3C95A 4TVRA 4LNPA 1PRMC 3SDZA 3CCST 1YJNT 1LCKA 3FJPA 4XTWA 4M78B 2GBQA 2NUZA 1MNDA 1M3CA 3ULRB 2CP0A 2KT8A 1VQMQ 3O5ZA 2ZAEA 3RIRA 2P0QA 5CQXA 4C5GA 4FIBA 1QVPA 3BDLA 3CCRA 2NUPB 1TUCA 1K73U 1WJSA 4ATOA 1E6HA 3CC2Q 1K9MU 3S3OA 3C12A 4RG8A 2YWWA 2J7IA 2KYBA 3TSWA 4JJDA 3LLRA 3ME9A 1N9RA 4C92D 5CIUA 3HKSA 3OY9A 1I07A 4A4FA 1VQOQ 2DRKA 5GAOr 3PIOA 5FRMA 2RI2A 1HJDA 1NYGA 2GTJA 3NHNA 3L2QA 4F7UF 4OGCA 4JPBW 3M56A 4HCBA 3CCLA 3LWIA 3EGXB 1FWZA 3G7ZA 2ZCFB 2L5QA 2BE7D 4J6XA 3OYCA 1TSFA 1FMVA 1X6GA 4ESRA 2DNUA 3JB9G 2EBPA 2V1RA 5GMKm 1T0HA 4LE9A 4IUTA 5L23A 4PKCC 2PQWA 2V26A 1JXMA 2COYA 4E47A 3OYHA 1FXXA 1NM7A 3VS0A 3M58A 3V7SA 1YJNQ 4XTXA 2BZXA 4RG2A 3OW2A 1QWEA 5LJ3h 3UA7A 4NL2A 1WHLA 1VQPA 2H8HA 2JS0A 3CPWA 3TVTA 1DJ7B 1VQ8A 5AYFA 1AT1B 2LCSA 4FYYB 2K6DA 1Y0MA 2HQXA 2GFAA 1VQ4T 1VQ7A 4Y91A 2ROLA 2DD5A 2M1HA 2VGNA 4M7AC 5LJ3g 1H641 1X75C 4PJOE 2R5AA 2E3HA 4OVAA 2CUDA 2CZ6B 2PVDB 2PVGB 2QQRA 4M7AA 1JRIA 2JS2A 7AT1B 3E9GA 2DL4A 2YRCA 4A4EA 4N4IA 1WXBA 2DIQA 4FYVB 5HCKA 1TS9A 4PJNA 1AHJB 2O9SA 1RAHB 5CVIA 2YRDA 1VQ8Q 1PWTA 3M0QA 4A53A 4IKFA 2QK0A 2DL8A 4C92F 2KAFA 3QDFA 4FW1A 3SFMA 4J83A 4VUBA 5I2SA 3CMET 3OB9A 1T3LA 1X2QA 3SWNA 3M57A 2OX7A 1AWWA 2F69A 3JRZA 4J8OA 1UG1A 1PNJA 4J9CA 4N0AC 9ATCB 3A8MB 2GQIA 2XIDA 5CCAA 2M51A 4KRTA 4XTVA 4C0DB 3GOXA 3CXCA 4AFSC 4BE2A 1D3BB 3CC7T 5AT1B 4M7DG 4FM4B 1XOVA 1N8RR 1PHTA 3VUZA 1UECA 2QQ9A 2LCLA 1ZBJA 3X28B 4CC4B 1LOJA 2ZPIB 4HCCA 3PFSA 1AVZC 1X69A 2MPXC 3QG1A 1WHKA 2KE9A 2HQEA 3GLXA 2EQIA 3JSCA 4CC7A 3OYKA 3CCEA 3OS0A 4LN2A 2LVMA 3JV3A 3M4GA 1NBEB 5KCHA 3I55T 5GAN8 1M8VA 2FO0A 1TG0A 1ZA1B 2RHIA 2H3JA 2X4JA 1S1NA 3MP6A 3HRUA 3JCMb 2P4RA 1NPRA 1YIJA 2DTHA 2PUOB 1YITT 2KY9A 1NE8A 1VQLT 4KUDK 1QMCA 2DX1A 3CCMT 3QXEB 2CGHA 2ZPHB 1OX8A 5I11A 1KJWA 2BE9B 3CCEQ 4JJNK 4BB7A 1K8AR 4OB1B 3HP9A 5M9OA 2FEIA 5IH2A 1J3TA 3O8VA 5DLQE 1RLQC 4BY6B 2J06A 1SRMA 3SHWA 4MDWA 4Y92A 4E7SA 3NTIA 3G71A 2DVEA 1BCOA 3M0TA 2KRMA 1ZX6A 2YLCA 2CUBA 3EGDB 3CC7Q 2KRSA 2EWNA 2K3YA 3QHSA 1U8RA 3QUIA 5LJ5g 3VS5A 2VC8A 2YLBA 3V8KA 1I4K1 1BCMA 4AG1C 2P0KA 1PG5B 1BIAA 4M77G 4HT9A 1M1KU 4KUIA 5CKEA 1QVFA 2DMOA 2EQMA 1TU0B 1VQNA 3EG2A 3GPLA
chains in the Genus database with same CATH topology
1Z9QA 3NGPA 4AFUC 4HVWA 3C0CA 1U06A 1WDXA 1VYTA 2KGTA 3RBBB 1WI7A 3M0RA 3THKA 1YCSB 2RQRA 4RTVA 3REAB 5IHNA 2JW4A 1N5ZA 3VS2A 2DA9A 1OV3A 3R6NA 2EYZA 1AWXA 1UTIA 1G2BA 2KRNA 1X43A 1I0CA 1UUEA 2EW3A 2OJ2A 3PVLA 1ZUKA 2YT6A 4J9EA 2LQNA 2C0TA 3GBQA 1JXOA 4Z8AA 2KR3A 1K0XA 4RTUA 5IHKA 4K11A 1MV3A 4HXJA 3PVQA 1OPLA 1JO8A 1YP5A 4Z88A 2ROTA 2SEMA 1KFZA 4A63B 1M3AA 4CC3A 1AEYA 1QLYA 4RTWA 4F17A 1ZLMA 2KBTA 2C0IA 2KROA 2KXCA 2LQWA 2EPDA 3EHRA 1VYUA 2YDLA 1VA7A 2DYBA 5IXFA 4HVUA 1PRLC 1QKWA 2HCKA 2RQWA 2LMJA 1OEBA 4Z89A 3I35A 2CT3A 1W6XA 3TSZA 2J6KA 1AZEA 1TUDA 2VWFA 4OMOA 1QKXA 1UE9A 3VS4A 2HBWA 1FYNA 1RLPC 2DLPA 2DF6A 1AWJA 1NLOC 2IIMA 2FPEA 2ED1A 3EGUA 2JXBA 4GLMA 3UF4A 3M0PA 2W10A 1K9AA 1SHGA 2LP5A 3SEMA 1GFDA 3VRYA 2G6FX 2CH4W 3NPFA 3RNJA 2HSPA 2HDAA 4DEYA 4RTZA 4JJBA 1K4US 1U5SA 4J9HA 2EYWA 1M3BA 4F14A 2YSQA 4J9DA 2AKKA 5FWBA 2F2VA 4LNPA 1PRMC 2AZVA 1B3QA 4E6RA 1LCKA 4ORZA 4HCKA 2GBQA 1YWOA 2O9VA 2NUZA 1SHFA 1M3CA 2I0NA 3ULRB 3VS1A 2YUPA 2GNCA 1M27C 4GBQA 2KT8A 2ENMA 3O5ZA 4EIKA 2BZYA 1T3SA 2DRMA 1GBQA 1TUCA 1E6HA 1WLPB 1MV0B 2LZ6B 3VS3A 2F2WA 5GJVB 3H0FA 2V1QA 4M4ZA 2J7IA 2KYBA 3TSWA 4JJDA 1ZSGA 2JTEA 2J6FA 3EG1A 2AK5A 2ESWA 2EYXA 1MUZA 2DE0X 1X27A 2D8HA 3H0IA 1I07A 4J9FA 1HJDA 2DRKA 2JM9A 1NYGA 2GTJA 2YUQA 1SEMA 3U23A 3NHNA 1YNZA 2O31A 2DILA 1B07A 4JPBW 1NG2A 3I9QA 5GJWB 1IO6A 2K2MA 1KIKA 2L2PA 1GBRA 2D1XA 1AZGB 4RTTA 2CT4A 1PKSA 1KSWA 1AWOA 1X6GA 5IHIA 4ESRA 1CSKA 2DNUA 1A0NB 1BBZA 2EBPA 2V1RA 4JZ4A 2EGEA 2LJ0A 4CC2A 1T0HA 4LE9A 5L23A 2K9GA 1E6GA 1X6BA 4OMQA 1E7OA 1UGVA 2RPNA 1JXMA 1GL5A 2E5KA 4AG2C 1SSHA 4OMMA 1NM7A 3VS0A 3VS7A 2DL5A 4QT7A 2AKLA 2KEAA 1SRLA 2D0NA 3VS6A 2FRYA 1H8KA 3EG3A 2BZXA 2A28A 1QWEA 1NEBA 3UA7A 1SPKA 1FMKA 2H8HA 2JS0A 2RMOA 3H0HA 1ABQA 3TVTA 2LCSA 1AD5A 1G83A 1UDLA 1CKAA 1I1JA 2K6DA 4D8KA 1Y0MA 4J9BA 3ZL7C 4OMLA 1BK2A 2CDTA 2KXDA 1UHCA 1WXTA 2ROLA 4R0KA 2EVRA 2RN8A 1K76A 2VKNA 2FG0A 2LJ3A 4RTXA 2M0YA 1OOTA 1NEGA 2K79A 5IXBA 2RQVA 2CUDA 2DM1A 1YWPA 4D8DA 2JMCA 2ABLA 2L0AA 2GGRA 1JQQA 2BZ8A 3UATA 2KYMA 2JS2A 2DL3A 2X3XD 3LH5A 2DL4A 2RNAA 1VYVA 5ECAA 2J05A 1WXBA 2MIOA 5FWCA 5HCKA 2F2XA 4F16A 5EC7A 2O9SA 1JU5C 3REBB 1WXUA 1WA7A 2MCNA 2YUOA 1NYFA 2CSIA 4AFQC 1PWTA 1W70A 2ED0A 3M0QA 2LX7A 2CH4A 1K0SA 4J9IA 2DL8A 2PTKA 1GCQC 1ZUYA 4JJCA 2CSQA 1CKBA 1PKTA 1QCFA 1M8MA 1UJYA 2NWMA 1T3LA 1X2QA 2A37A 3IQLA 1H3HA 5FW9A 1JEGA 1AWWA 2JT4A 2FRWA 1GCQA 1UG1A 1AOJA 1PNJA 4J9CA 4IIOA 3QWXX 2ECZA 2L3PA 2GQIA 2XMFA 3I5SA 2EGAA 2K7AA 2M51A 2JMAA 4KRTA 2RQUA 2MOXA 3CQTA 4AFSC 1WYXA 4IIMA 1WFWA 2A08A 1XOVA 1PHTA 2X3WD 1UECA 1ZBJA 4CC4B 2YUNA 3UA6A 4J9GA 2EGCA 2CREA 1M30A 2RQTA 1RI9A 3EHQA 1AVZC 1X69A 2OAWA 4X1VA 4FSSA 3H41A 2KE9A 2W0ZA 2L3QA 2EQIA 4CC7A 4OMPA 2VVKA 4RUGA 1K1ZA 1GFCA 3JV3A 1EFNA 2DL7A 3EG0A 4LN2A 2C0OA 1BB9A 2FO0A 2JM8A 4AFZC 2A36A 1TG0A 2GTOA 1Y57A 2KNBB 4OMNA 1OPKA 1NLPC 4LUDA 2LNHB 4LUEA 1S1NA 2DJQA 2OI3A 3QWYA 2P4RA 2AZSA 2BTTA 2LJ1A 1HD3A 2EYYA 1UJ0A 2PNIA 1U3OA 2DBMA 1GRIA 2PZ1A 3M0UA 2DX1A 4RTYA 1W1FA 1WIEA 2DVJA 1UFFA 1GCPA 5I11A 2RF0A 4HVVA 3NMZC 1KJWA 1RUWA 2J6OA 2D8JA 1Z9ZA 1QWFA 2FPDA 2DBKA 2FEIA 5IH2A 1X2KA 1J3TA 1RLQC 2J06A 1SRMA 3SHWA 1ARKA 3KFVA 4Y92A 3I5RA 1ZUUA 1ABOA 3A98A 2O88A 1H92A 1BU1A 3M0TA 2KRMA 1ZX6A 2CUBA 3VRZA 4WCIA 2O2OA 3FJ5A 2KRSA 2B86A 2EKHA 2HEQA 3PE0A 2FPFA 3VS5A 2SRCA 1HSQA 1YN8A 4AG1C 2QDLA 1WX6A 2L3SA 1UHFA 1T0JA 4DEXA 4ZNXA 3M0SA 1V1CA 2K3BA 2DMOA 4JZ3A 5I22A 2KT1A 3EG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9Q A;  3NGP A;  4AFU C;  4HVW A;  3C0C A;  1U06 A;  1WDX A;  1VYT A;  2KGT A;  3RBB B;  1WI7 A;  3M0R A;  3THK A;  1YCS B;  2RQR A;  4RTV A;  3REA B;  5IHN A;  2JW4 A;  1N5Z A;  3VS2 A;  2DA9 A;  1OV3 A;  3R6N A;  2EYZ A;  1AWX A;  1UTI A;  1G2B A;  2KRN A;  1X43 A;  1I0C A;  1UUE A;  2EW3 A;  2OJ2 A;  3PVL A;  1ZUK A;  2YT6 A;  4J9E A;  2LQN A;  2C0T A;  3GBQ A;  1JXO A;  4Z8A A;  2KR3 A;  1K0X A;  4RTU A;  5IHK A;  4K11 A;  1MV3 A;  4HXJ A;  3PVQ A;  1OPL A;  1JO8 A;  1YP5 A;  4Z88 A;  2ROT A;  2SEM A;  1KFZ A;  4A63 B;  1M3A A;  4CC3 A;  1AEY A;  1QLY A;  4RTW A;  4F17 A;  1ZLM A;  2KBT A;  2C0I A;  2KRO A;  2KXC A;  2LQW A;  2EPD A;  3EHR A;  1VYU A;  2YDL A;  1VA7 A;  2DYB A;  5IXF A;  4HVU A;  1PRL C;  1QKW A;  2HCK A;  2RQW A;  2LMJ A;  1OEB A;  4Z89 A;  3I35 A;  2CT3 A;  1W6X A;  3TSZ A;  2J6K A;  1AZE A;  1TUD A;  2VWF A;  4OMO A;  1QKX A;  1UE9 A;  3VS4 A;  2HBW A;  1FYN A;  1RLP C;  2DLP A;  2DF6 A;  1AWJ A;  1NLO C;  2IIM A;  2FPE A;  2ED1 A;  3EGU A;  2JXB A;  4GLM A;  3UF4 A;  3M0P A;  2W10 A;  1K9A A;  1SHG A;  2LP5 A;  3SEM A;  1GFD A;  3VRY A;  2G6F X;  2CH4 W;  3NPF A;  3RNJ A;  2HSP A;  2HDA A;  4DEY A;  4RTZ A;  4JJB A;  1K4U S;  1U5S A;  4J9H A;  2EYW A;  1M3B A;  4F14 A;  2YSQ A;  4J9D A;  2AKK A;  5FWB A;  2F2V A;  4LNP A;  1PRM C;  2AZV A;  1B3Q A;  4E6R A;  1LCK A;  4ORZ A;  4HCK A;  2GBQ A;  1YWO A;  2O9V A;  2NUZ A;  1SHF A;  1M3C A;  2I0N A;  3ULR B;  3VS1 A;  2YUP A;  2GNC A;  1M27 C;  4GBQ A;  2KT8 A;  2ENM A;  3O5Z A;  4EIK A;  2BZY A;  1T3S A;  2DRM A;  1GBQ A;  1TUC A;  1E6H A;  1WLP B;  1MV0 B;  2LZ6 B;  3VS3 A;  2F2W A;  5GJV B;  3H0F A;  2V1Q A;  4M4Z A;  2J7I A;  2KYB A;  3TSW A;  4JJD A;  1ZSG A;  2JTE A;  2J6F A;  3EG1 A;  2AK5 A;  2ESW A;  2EYX A;  1MUZ A;  2DE0 X;  1X27 A;  2D8H A;  3H0I A;  1I07 A;  4J9F A;  1HJD A;  2DRK A;  2JM9 A;  1NYG A;  2GTJ A;  2YUQ A;  1SEM A;  3U23 A;  3NHN A;  1YNZ A;  2O31 A;  2DIL A;  1B07 A;  4JPB W;  1NG2 A;  3I9Q A;  5GJW B;  1IO6 A;  2K2M A;  1KIK A;  2L2P A;  1GBR A;  2D1X A;  1AZG B;  4RTT A;  2CT4 A;  1PKS A;  1KSW A;  1AWO A;  1X6G A;  5IHI A;  4ESR A;  1CSK A;  2DNU A;  1A0N B;  1BBZ A;  2EBP A;  2V1R A;  4JZ4 A;  2EGE A;  2LJ0 A;  4CC2 A;  1T0H A;  4LE9 A;  5L23 A;  2K9G A;  1E6G A;  1X6B A;  4OMQ A;  1E7O A;  1UGV A;  2RPN A;  1JXM A;  1GL5 A;  2E5K A;  4AG2 C;  1SSH A;  4OMM A;  1NM7 A;  3VS0 A;  3VS7 A;  2DL5 A;  4QT7 A;  2AKL A;  2KEA A;  1SRL A;  2D0N A;  3VS6 A;  2FRY A;  1H8K A;  3EG3 A;  2BZX A;  2A28 A;  1QWE A;  1NEB A;  3UA7 A;  1SPK A;  1FMK A;  2H8H A;  2JS0 A;  2RMO A;  3H0H A;  1ABQ A;  3TVT A;  2LCS A;  1AD5 A;  1G83 A;  1UDL A;  1CKA A;  1I1J A;  2K6D A;  4D8K A;  1Y0M A;  4J9B A;  3ZL7 C;  4OML A;  1BK2 A;  2CDT A;  2KXD A;  1UHC A;  1WXT A;  2ROL A;  4R0K A;  2EVR A;  2RN8 A;  1K76 A;  2VKN A;  2FG0 A;  2LJ3 A;  4RTX A;  2M0Y A;  1OOT A;  1NEG A;  2K79 A;  5IXB A;  2RQV A;  2CUD A;  2DM1 A;  1YWP A;  4D8D A;  2JMC A;  2ABL A;  2L0A A;  2GGR A;  1JQQ A;  2BZ8 A;  3UAT A;  2KYM A;  2JS2 A;  2DL3 A;  2X3X D;  3LH5 A;  2DL4 A;  2RNA A;  1VYV A;  5ECA A;  2J05 A;  1WXB A;  2MIO A;  5FWC A;  5HCK A;  2F2X A;  4F16 A;  5EC7 A;  2O9S A;  1JU5 C;  3REB B;  1WXU A;  1WA7 A;  2MCN A;  2YUO A;  1NYF A;  2CSI A;  4AFQ C;  1PWT A;  1W70 A;  2ED0 A;  3M0Q A;  2LX7 A;  2CH4 A;  1K0S A;  4J9I A;  2DL8 A;  2PTK A;  1GCQ C;  1ZUY A;  4JJC A;  2CSQ A;  1CKB A;  1PKT A;  1QCF A;  1M8M A;  1UJY A;  2NWM A;  1T3L A;  1X2Q A;  2A37 A;  3IQL A;  1H3H A;  5FW9 A;  1JEG A;  1AWW A;  2JT4 A;  2FRW A;  1GCQ A;  1UG1 A;  1AOJ A;  1PNJ A;  4J9C A;  4IIO A;  3QWX X;  2ECZ A;  2L3P A;  2GQI A;  2XMF A;  3I5S A;  2EGA A;  2K7A A;  2M51 A;  2JMA A;  4KRT A;  2RQU A;  2MOX A;  3CQT A;  4AFS C;  1WYX A;  4IIM A;  1WFW A;  2A08 A;  1XOV A;  1PHT A;  2X3W D;  1UEC A;  1ZBJ A;  4CC4 B;  2YUN A;  3UA6 A;  4J9G A;  2EGC A;  2CRE A;  1M30 A;  2RQT A;  1RI9 A;  3EHQ A;  1AVZ C;  1X69 A;  2OAW A;  4X1V A;  4FSS A;  3H41 A;  2KE9 A;  2W0Z A;  2L3Q A;  2EQI A;  4CC7 A;  4OMP A;  2VVK A;  4RUG A;  1K1Z A;  1GFC A;  3JV3 A;  1EFN A;  2DL7 A;  3EG0 A;  4LN2 A;  2C0O A;  1BB9 A;  2FO0 A;  2JM8 A;  4AFZ C;  2A36 A;  1TG0 A;  2GTO A;  1Y57 A;  2KNB B;  4OMN A;  1OPK A;  1NLP C;  4LUD A;  2LNH B;  4LUE A;  1S1N A;  2DJQ A;  2OI3 A;  3QWY A;  2P4R A;  2AZS A;  2BTT A;  2LJ1 A;  1HD3 A;  2EYY A;  1UJ0 A;  2PNI A;  1U3O A;  2DBM A;  1GRI A;  2PZ1 A;  3M0U A;  2DX1 A;  4RTY A;  1W1F A;  1WIE A;  2DVJ A;  1UFF A;  1GCP A;  5I11 A;  2RF0 A;  4HVV A;  3NMZ C;  1KJW A;  1RUW A;  2J6O A;  2D8J A;  1Z9Z A;  1QWF A;  2FPD A;  2DBK A;  2FEI A;  5IH2 A;  1X2K A;  1J3T A;  1RLQ C;  2J06 A;  1SRM A;  3SHW A;  1ARK A;  3KFV A;  4Y92 A;  3I5R A;  1ZUU A;  1ABO A;  3A98 A;  2O88 A;  1H92 A;  1BU1 A;  3M0T A;  2KRM A;  1ZX6 A;  2CUB A;  3VRZ A;  4WCI A;  2O2O A;  3FJ5 A;  2KRS A;  2B86 A;  2EKH A;  2HEQ A;  3PE0 A;  2FPF A;  3VS5 A;  2SRC A;  1HSQ A;  1YN8 A;  4AG1 C;  2QDL A;  1WX6 A;  2L3S A;  1UHF A;  1T0J A;  4DEX A;  4ZNX A;  3M0S A;  1V1C A;  2K3B A;  2DMO A;  4JZ3 A;  5I22 A;  2KT1 A;  3EG2 A; 
#chains in the Genus database with same CATH topology
 3NGP A;  2ZZD A;  2QGF B;  3Q1J A;  5A0G A;  2DET A;  4HVW A;  3C0C A;  1UGP B;  3I55 Q;  4AT1 B;  4FU6 A;  1WDX A;  2KGT A;  1C0M A;  3M0R A;  5IT9 E;  1WHJ A;  1G3T A;  2JW4 A;  2LC4 A;  3FB9 A;  3VS2 A;  3KBG A;  3M53 A;  1KQS S;  1OV3 A;  3LGL A;  4CRI A;  1YCY A;  3CCU T;  3VJP A;  3V8J A;  5GAN f;  1VQK T;  1VQL Q;  5LJ3 d;  2HQH A;  3I56 T;  2LT1 A;  1R8O B;  2JTM A;  4L6V 5;  1IHV A;  3OYB A;  2LQN A;  2QQB A;  1SSF A;  3CCM Q;  1NJI C;  4RTU A;  1MV3 A;  4HXJ A;  3PVQ A;  4Z88 A;  4PJO D;  1V76 A;  2SEM A;  3MJX A;  2WAC A;  1S72 T;  4MMK A;  1UB4 A;  4M7D B;  1QLY A;  4F17 A;  1KD1 U;  5GAN 5;  5KYU A;  2O01 E;  2HSE B;  1TH7 A;  1VA7 A;  2DPP B;  1OI1 A;  5GAN 3;  2QEX A;  3A1P A;  5KYY B;  4OMF B;  4X9C A;  2RQW A;  1O9S A;  1OEB A;  5FRO A;  3A8L B;  1PD0 A;  2VWF A;  2JZ2 A;  2RO0 A;  4ZN1 A;  1BIB A;  2OTJ Q;  4DOW A;  3DB3 A;  1N27 A;  1RLP C;  1RAD B;  1TXQ A;  2XK0 A;  3CCV Q;  1AWJ A;  1NLO C;  4PFP A;  5GAO m;  3OSV A;  5A2Q E;  2FPE A;  2ED1 A;  4EMG A;  2DD4 A;  3EGU A;  1PM3 A;  2RHX A;  2JXB A;  4XQ3 A;  3LWH A;  2W10 A;  1K9A A;  1WHG A;  1MNE A;  1RAA B;  3VU3 C;  5CQY A;  2QEX Q;  2E1H A;  3EG9 A;  1VQ5 A;  1H3Z A;  1WZO A;  1B34 A;  1ZBX A;  2HSP A;  1RAF B;  1Q82 C;  4A4K A;  2E64 A;  4XU2 A;  4JJB A;  5CO7 A;  4J9H A;  2EYW A;  1M3B A;  1M2O A;  3HPW A;  1QVG A;  1ZQ1 A;  5GAM j;  5HKC A;  3I56 Q;  4M78 F;  3A5Z B;  3P8H A;  4M7D E;  2XU8 A;  2RHZ A;  1FX7 A;  2CP2 A;  1YJW A;  3RDV A;  4ORZ A;  4HCK A;  1YWO A;  1N6A A;  1SHF A;  3HHT B;  2YUP A;  1S72 Q;  2GNC A;  1M27 C;  4GBQ A;  3J81 E;  4PLL A;  3J7A F;  3TQ7 P;  4JUV A;  5D6W A;  1Q86 R;  4EIK A;  3HFN A;  3JCM W;  4NL3 A;  2DXC A;  4ME7 A;  2DRM A;  4ZN3 A;  1IRE B;  1PC0 A;  4M77 B;  1B7T A;  2LZ6 B;  2V1Q A;  5DM7 R;  3E19 A;  3LX7 A;  4PJO G;  1BI2 A;  2JTE A;  2F5T X;  2HL5 C;  2J6F A;  3EG1 A;  1YJ9 A;  2ESW A;  3JCM J;  3OYG A;  2DE0 X;  1QP3 A;  2ATC B;  1X27 A;  3H0I A;  1VQ9 T;  4J9F A;  2JM9 A;  1Q81 U;  1OU9 A;  1Y7X A;  4PJL A;  1VOM A;  4C8Q C;  1Y07 A;  2O31 A;  1WQW A;  1Q82 U;  1B07 A;  1NG2 A;  2HBP A;  2K2M A;  1KIK A;  4C8Q A;  2M02 A;  2L8D A;  2D1X A;  1AZG B;  4E2F B;  4RTT A;  3G4S Q;  1M90 U;  4C0F A;  4GLK A;  1KSW A;  5IHI A;  1A0N B;  2X4X A;  2LJ0 A;  1YJ9 Q;  4M75 C;  1E6G A;  4OMQ A;  2RPN A;  2E5Q A;  2I2L A;  2E5K A;  1M2V A;  1UGS B;  4FYX B;  4OMM A;  4FL6 A;  3JB9 I;  1VQ6 Q;  1OZ3 A;  2DL5 A;  4M75 A;  2KEA A;  2RM4 A;  3ZEH A;  3QDR B;  3CCJ T;  1WGS A;  4HA8 A;  3G6E T;  3VS6 A;  3JB9 D;  3VYG A;  2FRY A;  5GAN h;  2Y4X A;  3RMS A;  2DKG A;  1UGR B;  3BFM A;  2M16 A;  3JCM Q;  1VIE A;  1VQM A;  5KCO A;  1SPK A;  1IHW A;  1FMK A;  3R6O A;  3H0H A;  2X4W A;  1AD5 A;  1CKA A;  1I1J A;  2QI2 A;  3OS2 A;  3CD6 Q;  4OML A;  5GAO q;  4M78 A;  4J6W A;  4R0K A;  2EQK A;  2M0O A;  3CCQ A;  1YFN A;  1VQ9 Q;  1WNL A;  4RTX A;  5C6S A;  1NEG A;  4FT4 A;  2DM1 A;  2VXE A;  4LDY A;  1VQO A;  4D8D A;  2JMC A;  3RKW A;  5KYW B;  2GGR A;  4MML A;  2EQJ A;  1KQS P;  5FU6 B;  1JJ2 S;  3UAT A;  5KE2 A;  3V7R A;  3LH5 A;  2E6N A;  5ECA A;  2VB6 A;  5C0M A;  2NUT B;  3X26 B;  4F16 A;  3MET A;  3REB B;  1WXU A;  1WA7 A;  2YUO A;  4AFQ C;  3HSB A;  2ED0 A;  2CH4 A;  2PTK A;  4M7A G;  1GCQ C;  1ZUY A;  4JJC A;  1IGU A;  2XKO C;  1CKB A;  4Q5W A;  1M8M A;  2BKD N;  1UJY A;  3CCL T;  3CCQ Q;  3OMG A;  4BD3 A;  2B8A A;  3IQL A;  2RJC A;  2JT4 A;  5FU7 C;  1GCQ A;  4C8Q E;  2L3P A;  2PU9 B;  2COW A;  2E12 A;  3JCM P;  2XMF A;  3CCS A;  2EGA A;  1YJN A;  3CMA T;  2RQU A;  4MZM A;  4PJO B;  1FMW A;  1O75 A;  2R58 A;  2FHD A;  1WFW A;  3JCM X;  4ELZ C;  1RI0 A;  1TOV A;  2A08 A;  2BUD A;  4JLG A;  2OTL T;  4PFO A;  3X25 B;  3HRT A;  4DBR A;  3MHX A;  4J9G A;  3NTH A;  5LJ5 f;  4BI3 A;  2RQT A;  3KXT A;  4BI4 A;  2EKO A;  2RJD A;  4P5N A;  3OBY A;  5D7U A;  5I21 A;  2L3Q A;  2ZPB B;  4M7D D;  4OMP A;  1OU8 A;  5LL6 S;  3JB9 F;  4RUG A;  1K1Z A;  1GFC A;  1EFN A;  2DL7 A;  3EG0 A;  2VUB A;  3A8O B;  3CPF A;  4AFZ C;  1M1F A;  2GTO A;  2KNB B;  3CCS Q;  4ZGE B;  1OPK A;  1NLP C;  5A0L A;  4LUD A;  3FEO A;  4BDZ A;  4GY5 A;  4BAC A;  4MZP A;  2DJQ A;  3QSU A;  1OZ2 A;  2K5F A;  2DEQ A;  2CP6 A;  2HZY A;  2BTT A;  2LJ1 A;  2EYY A;  1UJ0 A;  3LYI A;  1W4S A;  2M9U A;  3F70 A;  5CKD A;  2DIG A;  2LCC A;  1QQJ A;  1WIE A;  3CC4 T;  4DBH A;  1UEB A;  3RER A;  1RUW A;  3L42 A;  3HFO A;  2C06 A;  3KFV A;  4C0Z A;  1ABO A;  1X01 A;  5HY6 A;  4HT8 A;  2VXF A;  4E7H A;  2MMP A;  4XK8 E;  3TU4 K;  1BU1 A;  3OS5 A;  3VRZ A;  1PD1 A;  1BI3 A;  5GAO n;  2EKH A;  3FLG A;  2RI5 A;  3V7C A;  4D6W A;  2OTL Q;  1YN8 A;  1WHM A;  3SWN C;  4BE1 A;  1WX6 A;  2L3S A;  4C5I A;  1JBM A;  1OYX A;  2AHJ B;  1Z9Q A;  5GMK h;  4F7U A;  5GAO l;  4WTO B;  1VYT A;  3RBB B;  1WI7 A;  3QII A;  3JB9 J;  2XD0 A;  2HD0 A;  4M77 D;  4XAX B;  3E9F A;  1D0Z A;  3R6N A;  1UTI A;  5GAN d;  4KT0 E;  1M5Q 1;  2G3R A;  4QVC A;  4LDW A;  2WSC E;  2EW3 A;  2OJ2 A;  2LRQ A;  4JRI A;  3PVL A;  5CK9 A;  2CP5 A;  2C0T A;  2CYZ B;  3JCM e;  1KC8 R;  3N5B B;  1VQ4 Q;  4M7D F;  3EFR A;  1ZSZ C;  1U1T A;  3CC4 Q;  1JO8 A;  2OAU A;  2ROT A;  2EIF A;  3JCM V;  1MHN A;  4DBF A;  1Y96 B;  1ZLM A;  2C0I A;  5CR2 A;  2LQW A;  2EPD A;  1ZSZ A;  3J80 E;  4F04 B;  4PJJ A;  5HK0 A;  1LJO A;  5IXF A;  4HVU A;  2FB7 A;  1PRL C;  3M54 A;  4BY6 C;  4BUG A;  1M1K C;  2LMJ A;  5A0D A;  2CT3 A;  2HKQ B;  3CC7 A;  1W6X A;  4XU1 A;  2J6K A;  1SKU B;  1TUD A;  2QQA A;  1MGQ A;  4E7J A;  4FCY A;  1JJ2 P;  2DLP A;  1KHI A;  3CBM A;  2DXU A;  4IUP A;  1MMD A;  3CME Q;  4QVZ A;  1IZ6 A;  4AMC A;  4M7A E;  4GLM A;  3M0P A;  5GAN 6;  4C8Q D;  3H6Z A;  5GAM e;  1SHG A;  5LJ5 h;  3SEM A;  3I55 A;  1XTD A;  2RK2 A;  5GAN 2;  4C92 C;  4NOY A;  3VRY A;  1GFD A;  2G6F X;  2MK5 A;  2YRV A;  3UDC A;  3RNJ A;  4QVD A;  3X24 B;  2X9H A;  3OMC A;  1N8R U;  2AT1 B;  4RTZ A;  3CEY A;  4ELY C;  4R56 A;  4C92 A;  1BKB A;  2YSQ A;  4J9D A;  2CP7 A;  2E10 A;  3OYM A;  4B6M A;  2X4Y A;  1KD1 C;  1VQL A;  5KH6 A;  2QAZ A;  4HKE A;  1YHQ T;  4F7U E;  3CCM A;  3C4S A;  2QA4 T;  2DEU A;  2O9V A;  2I0N A;  3PGG A;  3UPU A;  4PFZ A;  2CZ0 B;  5IN1 A;  4EMK C;  4M77 F;  2DO3 A;  5KYX B;  2QG9 B;  1RAG B;  4ZGJ B;  2BZY A;  1T3S A;  2E65 A;  1GBQ A;  5KYN A;  3MO8 A;  1WPY A;  1WLP B;  2F2W A;  5GJV B;  4M4Z A;  4EMK A;  3HL8 A;  2E41 A;  4QQG A;  1ZSG A;  3LH0 A;  5KE3 A;  3JB9 H;  2CKK A;  1YIT Q;  4PLI A;  2ZPG B;  3QYH B;  2YUQ A;  4KGZ B;  3U23 A;  2DIL A;  2EJ9 A;  2OTJ A;  2XDP A;  1BI1 A;  1K8A U;  3V8L A;  1NJI R;  3CCV A;  1IO6 A;  5CKH A;  3M55 A;  5GAN j;  2F1L A;  4II1 A;  2XHC A;  3OYF A;  2WSF E;  2CT4 A;  2ZGW A;  1KK7 A;  2K5L A;  3JCM f;  3H8Z A;  2E3I A;  2F5K A;  3FDR A;  1AWO A;  1CSK A;  2X51 A;  1BBZ A;  2DZ9 A;  4JZ4 A;  4CC2 A;  3MP1 A;  2K9G A;  2DZC A;  4LD9 K;  1E7O A;  3CCU A;  4C8Q G;  3EFO A;  3M5A A;  4AG2 C;  3VKI A;  1VQK A;  2LQ8 A;  3OYY A;  3QKJ A;  3I56 A;  1TTH B;  2RA2 A;  4QT7 A;  1ACM B;  1OX9 A;  2D0N A;  2L3R A;  2GCX A;  3JCM c;  1H8K A;  3S3M A;  2ZPE B;  2XIC A;  1S72 A;  2JJ9 A;  1NEB A;  3C94 A;  1M9S A;  3DLL A;  1ABQ A;  4C92 E;  3OYA A;  1UDL A;  1Q81 C;  4M75 G;  1Q7Y R;  2Y90 A;  2DER A;  1YJW T;  3ZL7 C;  1MMA A;  3A8H B;  2CDT A;  2KXD A;  3ER0 A;  4N4H A;  1WXT A;  5CKB A;  4E7K A;  3CCU Q;  2EVR A;  2RN8 A;  1VQK Q;  2RD1 A;  4EDU A;  2VKN A;  2FG0 A;  2LJ3 A;  2M0Y A;  1OOT A;  1D0Y A;  5GAM f;  2K79 A;  2RQV A;  5GMK l;  3SB2 A;  3H9N A;  2ABL A;  2L0A A;  1JQQ A;  2BZ8 A;  1M90 C;  3WXM B;  2V8I A;  2DL3 A;  2X3X D;  2A7Y A;  1VYV A;  2R57 A;  2MIO A;  5FWC A;  5EC7 A;  1JU5 C;  4OB0 B;  1KQS A;  1D1C A;  3UWN A;  1NYF A;  2CSI A;  1W2B S;  1B34 B;  2LX7 A;  3G4S A;  4PK4 A;  1VIF A;  5J39 A;  2MI6 A;  1X6O A;  2O4X B;  4J9I A;  1I8F A;  1PKT A;  1MMG A;  4PL6 A;  2NWM A;  2A37 A;  5FW9 A;  3GF5 A;  1YBY A;  3VUB A;  2KK4 A;  3L2U A;  4IIO A;  4PJO F;  3GP8 A;  1HXD A;  2E6Z A;  1VQ6 A;  4IUU A;  4ZGD B;  4M7A D;  1ZHI A;  2K7A A;  3NTK A;  2JMA A;  3P8D A;  2MOX A;  4JLI A;  1RAB B;  3RKY A;  3M9Q A;  2VV5 A;  5DLO A;  5LJ3 j;  5LJ5 d;  2JVV A;  3UA6 A;  2EGC A;  3EH2 A;  1RI9 A;  1YI2 T;  3BW1 A;  3CD6 A;  3OA6 A;  4X1V A;  1I5L A;  4XU0 A;  2P84 A;  1VQM T;  2LDM A;  4BI8 B;  1VQ9 A;  3QZ5 B;  3OYI A;  1BB9 A;  2A36 A;  2IVW A;  4E7L A;  4OMN A;  3CC2 T;  2VGM A;  5D6X A;  3L2W A;  2QQS A;  2E4H A;  1Q86 U;  2LNH B;  3UT1 A;  2R5M A;  1K73 R;  6AT1 B;  1K9M R;  1D1A A;  4QQ6 A;  3QWY A;  4C8Q B;  1HD3 A;  4M78 C;  2PNI A;  2DBM A;  3QJ6 A;  1GRI A;  2XG8 D;  3LW5 E;  4RTY A;  4KH0 B;  2DVJ A;  1GCP A;  3NMZ C;  1M2V B;  2NUT A;  2D8J A;  3JCM h;  1XJW B;  1G8X A;  3CCR T;  3RKX A;  3M59 A;  1ARK A;  3OW2 S;  2NUP A;  3I5R A;  5GMK j;  1ZUU A;  5J3B A;  3CCJ A;  2JOY A;  2P4T A;  4JDS A;  3CPW S;  2LTO A;  2HKN A;  2O2O A;  3QZ9 B;  3JCM g;  2B86 A;  2HEQ A;  3PE0 A;  3GIB A;  2DK3 A;  2SRC A;  1HK9 A;  2QDL A;  3CBO A;  3FIF A;  2NYS A;  4J5Y A;  4JRQ A;  4ZNX A;  3P8B B;  3M0S A;  1V1C A;  2V8J A;  1YI2 Q;  3QBY A;  4PJO A;  2KT1 A;  1PCX A;  3EGX A;  4FYW B;  2JNG A;  2KSS A;  3GNF B;  4AFU C;  4M7A F;  2K3X A;  2FL7 A;  1U06 A;  1R0B G;  2RHY A;  3THK A;  1YCS B;  2RQR A;  2GFU A;  3QPH A;  3REA B;  5IHN A;  3G6E Q;  3CCJ Q;  4JRP A;  1N5Z A;  3RMQ A;  5GAM h;  2EYZ A;  1LNX A;  1G2B A;  2RJE A;  1X43 A;  2KI7 A;  4DBQ A;  2Z0W A;  4F7U G;  4NS5 A;  1UUE A;  3PMT A;  2Y4Y A;  2PUK B;  1ZUK A;  4XU3 A;  4J9E A;  2XI9 A;  1BYM A;  1C6V X;  2KR3 A;  1XNI A;  1K0X A;  1OPL A;  4L5G A;  5GAM g;  2EJG A;  1YP5 A;  3AT1 B;  4M75 E;  2A0F B;  1NPP A;  1KFZ A;  4A63 B;  1M3A A;  2FYK A;  4CC3 A;  1AEY A;  2VYT A;  2FZG B;  2KBT A;  2L89 A;  3CCR Q;  1VQP T;  2KXC A;  3CXC S;  3S6W A;  1VQ8 T;  4Y28 E;  3NFC A;  5LJ5 j;  4Z02 A;  3QJY A;  2IPO B;  1VQ7 T;  1QKW A;  1KHC A;  3CMA A;  1ZA2 B;  5FU7 B;  2YXY A;  3BDU A;  4M78 E;  1EIF A;  2PVO B;  3TSZ A;  5J26 A;  1TUG B;  2DXT A;  3MEA A;  2IG0 A;  1UE9 A;  2OTL A;  4YTL A;  1RAI B;  2HMA A;  8AT1 B;  2DF6 A;  4KUL A;  3CCL Q;  1I81 A;  2LX9 A;  2RH2 A;  3G1J A;  4LXC A;  1JJ2 A;  3FC3 A;  2LP5 A;  1W2B P;  2HAX A;  4CI0 C;  3NPF A;  3QYG B;  3CMA Q;  4ZTF A;  4DEY A;  4J7F A;  1K4U S;  1U5S A;  5FRN A;  4F14 A;  4V2S A;  3CBP A;  2EQU A;  2K2V A;  4C0D C;  2DXB A;  2F2V A;  1D0X A;  2AZV A;  1B3Q A;  1G3S A;  3RES A;  4E6R A;  1VQ4 A;  3EAE A;  1JB0 E;  5DY9 A;  3VS1 A;  3CC4 A;  2ENM A;  1D3B A;  2DTO A;  4C92 G;  1VQP Q;  2A3L A;  1WJQ A;  5CAI A;  1IGQ A;  4L59 A;  3LGF A;  3OSS C;  4M7A B;  1MV0 B;  1VQ7 Q;  3VS3 A;  3H0F A;  1QP2 A;  3TCJ A;  2AK5 A;  2EYX A;  1MUZ A;  5GAN e;  1Y96 A;  5L8R E;  2D8H A;  3CCE T;  1QVF S;  3RUX A;  4EMH A;  1SEM A;  3MCA B;  3PNW C;  4XTZ A;  1YNZ A;  3JAM E;  5FLX E;  3WVD B;  2KDS A;  1I5O B;  1Q95 G;  3I9Q A;  3MPU B;  3CME A;  2QXF A;  5GJW B;  3OYE A;  4KGX B;  3SWN B;  1QCO A;  2L2P A;  4N0A A;  1N8R C;  1YIJ T;  3QO3 A;  4F7U B;  1GBR A;  4B9W A;  1KC8 C;  3JCM d;  4A4H A;  4LDU A;  1PKS A;  1GXI E;  2RJF A;  4J6Y A;  1F1B B;  4C5H A;  4R55 A;  1G5V A;  2EGE A;  2D9T A;  1X6B A;  1UGV A;  2QGG A;  2LQK A;  1M1K R;  2RB6 A;  4C5E A;  1GL5 A;  3L1A A;  1XQH A;  1SSH A;  2MWO A;  1LVK A;  1KQ1 A;  4DQ2 A;  1KG1 A;  2QTX A;  3VS7 A;  3OW2 P;  1HYO A;  2CZ7 B;  2AKL A;  4QW2 A;  2LT4 A;  3G71 T;  1SRL A;  3CPW P;  4DA4 A;  4OB3 B;  1IRX A;  2MF2 A;  3EG3 A;  1SG5 A;  4LDX A;  2GQV A;  2A28 A;  3EGD A;  2K4Y A;  4IUV A;  2MWP A;  2VAS A;  3OQ5 A;  1LPL A;  1ZSZ B;  4IUR A;  2RMO A;  5IAY A;  1G83 A;  3PIP A;  4D8K A;  2DTI A;  4J9B A;  4JRK A;  1BK2 A;  3MP8 A;  1UHC A;  1VQN T;  1UGQ B;  1K8A C;  4EPC A;  1K76 A;  8ATC B;  5GAM d;  3OYL A;  1KC8 U;  4MDX A;  5KYX A;  1YIT A;  5IXB A;  4RMO A;  4ANJ A;  1YWP A;  1QCN A;  4M75 D;  3DB4 A;  2DYI A;  1KD1 R;  2KYM A;  5GAN 7;  3EH1 A;  4ZTJ A;  2RNA A;  2J05 A;  3OYJ A;  2CZ1 B;  1MMN A;  2F2X A;  1YIJ Q;  2EJF A;  2MCN A;  1W70 A;  4M7D C;  3L2R A;  1K0S A;  2V8K A;  2OTJ T;  1QVG S;  2CSQ A;  4PNO A;  3BE3 A;  1QCF A;  2HL3 A;  3CCV T;  4M78 D;  2X35 A;  3BY7 A;  1H3H A;  4UC4 A;  1EX4 A;  4C92 B;  2COZ A;  4M7D A;  4A54 A;  1JEG A;  2JUF A;  3CXC P;  2FRW A;  2K57 A;  1AOJ A;  3E1S A;  3QWX X;  2ECZ A;  5LJ3 e;  3ZBD A;  1YHQ A;  3G71 Q;  2QEX T;  4RKU E;  1D1B A;  3OYN A;  3I5S A;  2EFI A;  2FZK B;  2QA4 A;  5KYY A;  1KQ2 A;  2KVQ G;  4WF2 A;  3OBW A;  4E7I A;  3CQT A;  1WYX A;  4IIM A;  3A8G B;  4FT2 A;  2DFU A;  3MEU A;  2K5I A;  2X3W D;  2QTV A;  3OYD A;  2YUN A;  4OP0 A;  2RHU A;  3HTR A;  1BI0 A;  2CRE A;  4EMK B;  1M30 A;  1VQN Q;  3EHQ A;  2OAW A;  2DJZ A;  4FSS A;  3H41 A;  3L2V A;  2W0Z A;  3WVE B;  4B9X A;  1EZZ B;  1IB8 A;  1RAE B;  3OS1 A;  2VVK A;  3FRN A;  2C0O A;  2JM8 A;  3MKD A;  4FW2 A;  1YHQ Q;  1VQ5 T;  1Y57 A;  4C8Q F;  2QA4 Q;  1RAC B;  4OGE A;  4X9D A;  4LUE A;  3MEW A;  3KUF A;  2OI3 A;  2QYZ A;  3SD4 A;  3TEE A;  1QW1 A;  2AZS A;  5KYU B;  2EAY A;  2RI3 A;  1R77 A;  1U3O A;  4HCZ A;  5GMK e;  1OQK A;  2PZ1 A;  3M0U A;  2QAS A;  1D09 B;  2D0Q B;  1Q81 R;  1SF9 A;  3DKM A;  1W1F A;  4MZT A;  4M77 C;  1UFF A;  2RF0 A;  4HVV A;  2XDD A;  3M4Y A;  4RCC A;  1Q82 R;  3EFO B;  4M75 F;  1N9S A;  2J6O A;  1Z9Z A;  1QWF A;  2FPD A;  2DBK A;  1WHH A;  4DOV A;  1X2K A;  1Q7Y C;  1V29 B;  3HRS A;  4KH1 B;  4N4G A;  3VYH B;  1NJI U;  1Y71 A;  3G4S T;  4O5V A;  4M77 A;  3DLM A;  2O4X A;  3A98 A;  2O88 A;  1RL2 A;  1H92 A;  5GAO p;  4QKU A;  4M78 G;  2H3E B;  4WCI A;  1M90 R;  1YJ9 T;  3FJ5 A;  1C1A A;  4OB2 B;  2YHT A;  4E7Z A;  3INZ A;  1QVF P;  2FPF A;  1HSQ A;  3MEV A;  5CKF A;  3EG9 B;  2MAM A;  1VQ6 T;  2KMT A;  4XTY A;  1UHF A;  1T0J A;  4DEX A;  4BDY A;  2K3B A;  2AIR B;  4JZ3 A;  1G3Y A;  3X20 B;  5I22 A;  3EFS A;  1Q86 C;  3L2Z A;  2NLU A;  4O6J A;  1G3W A;  3D7S B;  3ZFJ A;  5HK3 A;  1VQ5 Q;  1VUB A;  4A4G A;  4RTV A;  2DAQ A;  2JTF A;  4BE0 A;  2DA9 A;  4J7I A;  3CD6 T;  3PMI A;  1P92 A;  1AWX A;  2KRN A;  4KGV B;  1PSE A;  1Q7Y U;  1I0C A;  4KBM B;  3S3N A;  1M4Z A;  4FSX A;  2HNI A;  1IXD A;  2FZC B;  2KQW A;  2YT6 A;  5LJ3 f;  1YJW Q;  2XDB A;  3GBQ A;  1JXO A;  2CP3 A;  4LDV A;  4Z8A A;  5LJ5 e;  3VV0 A;  2P0P A;  3GNG A;  5IHK A;  1PSF A;  4K11 A;  2MYS A;  1U1S A;  4RTW A;  4PJM A;  4JS4 A;  2KRO A;  3EHR A;  1VYU A;  2YDL A;  2FVU A;  2DYB A;  3ASK A;  3TRE A;  2HCK A;  2RK1 A;  2QDY B;  3PTA A;  4Z89 A;  4IUQ A;  4JS5 A;  3I35 A;  2ZPF B;  3CCQ T;  5FU6 C;  2GF7 A;  3PT9 A;  4XTU A;  1M1G A;  1AZE A;  4RCB A;  4OMO A;  1QKX A;  1VQO T;  2BIV A;  2CS7 A;  3VS4 A;  2HBW A;  1FYN A;  2E70 A;  5KYW A;  5I2M A;  5EG2 A;  1K73 C;  4QQD A;  2IIM A;  1K9M C;  1YI2 A;  4M77 E;  2LNV A;  1NZ9 A;  3URG A;  1OUL A;  2JN0 A;  3UF4 A;  4OF1 A;  2WSE E;  2EYQ A;  5GMK i;  4LD6 A;  4M75 B;  1QVG P;  2CH4 W;  3CC2 A;  3AHU A;  5GAN g;  1R0C B;  3G6E A;  2HDA A;  3RR6 A;  3E2U A;  5GAN 4;  1W2B A;  1WQ7 A;  1WJR A;  2AKK A;  4PJO C;  1TWB A;  4C0G A;  4X34 A;  2D6F A;  3T9N A;  5FWB A;  5D6Y A;  3C95 A;  4TVR A;  4LNP A;  1PRM C;  3SDZ A;  3CCS T;  1YJN T;  1LCK A;  3FJP A;  4XTW A;  4M78 B;  2GBQ A;  2NUZ A;  1MND A;  1M3C A;  3ULR B;  2CP0 A;  2KT8 A;  1VQM Q;  3O5Z A;  2ZAE A;  3RIR A;  2P0Q A;  5CQX A;  4C5G A;  4FIB A;  1QVP A;  3BDL A;  3CCR A;  2NUP B;  1TUC A;  1K73 U;  1WJS A;  4ATO A;  1E6H A;  3CC2 Q;  1K9M U;  3S3O A;  3C12 A;  4RG8 A;  2YWW A;  2J7I A;  2KYB A;  3TSW A;  4JJD A;  3LLR A;  3ME9 A;  1N9R A;  4C92 D;  5CIU A;  3HKS A;  3OY9 A;  1I07 A;  4A4F A;  1VQO Q;  2DRK A;  5GAO r;  3PIO A;  5FRM A;  2RI2 A;  1HJD A;  1NYG A;  2GTJ A;  3NHN A;  3L2Q A;  4F7U F;  4OGC A;  4JPB W;  3M56 A;  4HCB A;  3CCL A;  3LWI A;  3EGX B;  1FWZ A;  3G7Z A;  2ZCF B;  2L5Q A;  2BE7 D;  4J6X A;  3OYC A;  1TSF A;  1FMV A;  1X6G A;  4ESR A;  2DNU A;  3JB9 G;  2EBP A;  2V1R A;  5GMK m;  1T0H A;  4LE9 A;  4IUT A;  5L23 A;  4PKC C;  2PQW A;  2V26 A;  1JXM A;  2COY A;  4E47 A;  3OYH A;  1FXX A;  1NM7 A;  3VS0 A;  3M58 A;  3V7S A;  1YJN Q;  4XTX A;  2BZX A;  4RG2 A;  3OW2 A;  1QWE A;  5LJ3 h;  3UA7 A;  4NL2 A;  1WHL A;  1VQP A;  2H8H A;  2JS0 A;  3CPW A;  3TVT A;  1DJ7 B;  1VQ8 A;  5AYF A;  1AT1 B;  2LCS A;  4FYY B;  2K6D A;  1Y0M A;  2HQX A;  2GFA A;  1VQ4 T;  1VQ7 A;  4Y91 A;  2ROL A;  2DD5 A;  2M1H A;  2VGN A;  4M7A C;  5LJ3 g;  1H64 1;  1X75 C;  4PJO E;  2R5A A;  2E3H A;  4OVA A;  2CUD A;  2CZ6 B;  2PVD B;  2PVG B;  2QQR A;  4M7A A;  1JRI A;  2JS2 A;  7AT1 B;  3E9G A;  2DL4 A;  2YRC A;  4A4E A;  4N4I A;  1WXB A;  2DIQ A;  4FYV B;  5HCK A;  1TS9 A;  4PJN A;  1AHJ B;  2O9S A;  1RAH B;  5CVI A;  2YRD A;  1VQ8 Q;  1PWT A;  3M0Q A;  4A53 A;  4IKF A;  2QK0 A;  2DL8 A;  4C92 F;  2KAF A;  3QDF A;  4FW1 A;  3SFM A;  4J83 A;  4VUB A;  5I2S A;  3CME T;  3OB9 A;  1T3L A;  1X2Q A;  3SWN A;  3M57 A;  2OX7 A;  1AWW A;  2F69 A;  3JRZ A;  4J8O A;  1UG1 A;  1PNJ A;  4J9C A;  4N0A C;  9ATC B;  3A8M B;  2GQI A;  2XID A;  5CCA A;  2M51 A;  4KRT A;  4XTV A;  4C0D B;  3GOX A;  3CXC A;  4AFS C;  4BE2 A;  1D3B B;  3CC7 T;  5AT1 B;  4M7D G;  4FM4 B;  1XOV A;  1N8R R;  1PHT A;  3VUZ A;  1UEC A;  2QQ9 A;  2LCL A;  1ZBJ A;  3X28 B;  4CC4 B;  1LOJ A;  2ZPI B;  4HCC A;  3PFS A;  1AVZ C;  1X69 A;  2MPX C;  3QG1 A;  1WHK A;  2KE9 A;  2HQE A;  3GLX A;  2EQI A;  3JSC A;  4CC7 A;  3OYK A;  3CCE A;  3OS0 A;  4LN2 A;  2LVM A;  3JV3 A;  3M4G A;  1NBE B;  5KCH A;  3I55 T;  5GAN 8;  1M8V A;  2FO0 A;  1TG0 A;  1ZA1 B;  2RHI A;  2H3J A;  2X4J A;  1S1N A;  3MP6 A;  3HRU A;  3JCM b;  2P4R A;  1NPR A;  1YIJ A;  2DTH A;  2PUO B;  1YIT T;  2KY9 A;  1NE8 A;  1VQL T;  4KUD K;  1QMC A;  2DX1 A;  3CCM T;  3QXE B;  2CGH A;  2ZPH B;  1OX8 A;  5I11 A;  1KJW A;  2BE9 B;  3CCE Q;  4JJN K;  4BB7 A;  1K8A R;  4OB1 B;  3HP9 A;  5M9O A;  2FEI A;  5IH2 A;  1J3T A;  3O8V A;  5DLQ E;  1RLQ C;  4BY6 B;  2J06 A;  1SRM A;  3SHW A;  4MDW A;  4Y92 A;  4E7S A;  3NTI A;  3G71 A;  2DVE A;  1BCO A;  3M0T A;  2KRM A;  1ZX6 A;  2YLC A;  2CUB A;  3EGD B;  3CC7 Q;  2KRS A;  2EWN A;  2K3Y A;  3QHS A;  1U8R A;  3QUI A;  5LJ5 g;  3VS5 A;  2VC8 A;  2YLB A;  3V8K A;  1I4K 1;  1BCM A;  4AG1 C;  2P0K A;  1PG5 B;  1BIA A;  4M77 G;  4HT9 A;  1M1K U;  4KUI A;  5CKE A;  1QVF A;  2DMO A;  2EQM A;  1TU0 B;  1VQN A;  3EG2 A;  3GPL A; 
#chains in the Genus database with same CATH homology
 1Z9Q A;  3NGP A;  4AFU C;  4HVW A;  3C0C A;  1U06 A;  1WDX A;  1VYT A;  2KGT A;  3RBB B;  1WI7 A;  3M0R A;  3THK A;  1YCS B;  2RQR A;  4RTV A;  3REA B;  5IHN A;  2JW4 A;  1N5Z A;  3VS2 A;  2DA9 A;  1OV3 A;  3R6N A;  2EYZ A;  1AWX A;  1UTI A;  1G2B A;  2KRN A;  1X43 A;  1I0C A;  1UUE A;  2EW3 A;  2OJ2 A;  3PVL A;  1ZUK A;  2YT6 A;  4J9E A;  2LQN A;  2C0T A;  3GBQ A;  1JXO A;  4Z8A A;  2KR3 A;  1K0X A;  4RTU A;  5IHK A;  4K11 A;  1MV3 A;  4HXJ A;  3PVQ A;  1OPL A;  1JO8 A;  1YP5 A;  4Z88 A;  2ROT A;  2SEM A;  1KFZ A;  4A63 B;  1M3A A;  4CC3 A;  1AEY A;  1QLY A;  4RTW A;  4F17 A;  1ZLM A;  2KBT A;  2C0I A;  2KRO A;  2KXC A;  2LQW A;  2EPD A;  3EHR A;  1VYU A;  2YDL A;  1VA7 A;  2DYB A;  5IXF A;  4HVU A;  1PRL C;  1QKW A;  2HCK A;  2RQW A;  2LMJ A;  1OEB A;  4Z89 A;  3I35 A;  2CT3 A;  1W6X A;  3TSZ A;  2J6K A;  1AZE A;  1TUD A;  2VWF A;  4OMO A;  1QKX A;  1UE9 A;  3VS4 A;  2HBW A;  1FYN A;  1RLP C;  2DLP A;  2DF6 A;  1AWJ A;  1NLO C;  2IIM A;  2FPE A;  2ED1 A;  3EGU A;  2JXB A;  4GLM A;  3UF4 A;  3M0P A;  2W10 A;  1K9A A;  1SHG A;  2LP5 A;  3SEM A;  1GFD A;  3VRY A;  2G6F X;  2CH4 W;  3NPF A;  3RNJ A;  2HSP A;  2HDA A;  4DEY A;  4RTZ A;  4JJB A;  1K4U S;  1U5S A;  4J9H A;  2EYW A;  1M3B A;  4F14 A;  2YSQ A;  4J9D A;  2AKK A;  5FWB A;  2F2V A;  4LNP A;  1PRM C;  2AZV A;  1B3Q A;  4E6R A;  1LCK A;  4ORZ A;  4HCK A;  2GBQ A;  1YWO A;  2O9V A;  2NUZ A;  1SHF A;  1M3C A;  2I0N A;  3ULR B;  3VS1 A;  2YUP A;  2GNC A;  1M27 C;  4GBQ A;  2KT8 A;  2ENM A;  3O5Z A;  4EIK A;  2BZY A;  1T3S A;  2DRM A;  1GBQ A;  1TUC A;  1E6H A;  1WLP B;  1MV0 B;  2LZ6 B;  3VS3 A;  2F2W A;  5GJV B;  3H0F A;  2V1Q A;  4M4Z A;  2J7I A;  2KYB A;  3TSW A;  4JJD A;  1ZSG A;  2JTE A;  2J6F A;  3EG1 A;  2AK5 A;  2ESW A;  2EYX A;  1MUZ A;  2DE0 X;  1X27 A;  2D8H A;  3H0I A;  1I07 A;  4J9F A;  1HJD A;  2DRK A;  2JM9 A;  1NYG A;  2GTJ A;  2YUQ A;  1SEM A;  3U23 A;  3NHN A;  1YNZ A;  2O31 A;  2DIL A;  1B07 A;  4JPB W;  1NG2 A;  3I9Q A;  5GJW B;  1IO6 A;  2K2M A;  1KIK A;  2L2P A;  1GBR A;  2D1X A;  1AZG B;  4RTT A;  2CT4 A;  1PKS A;  1KSW A;  1AWO A;  1X6G A;  5IHI A;  4ESR A;  1CSK A;  2DNU A;  1A0N B;  1BBZ A;  2EBP A;  2V1R A;  4JZ4 A;  2EGE A;  2LJ0 A;  4CC2 A;  1T0H A;  4LE9 A;  5L23 A;  2K9G A;  1E6G A;  1X6B A;  4OMQ A;  1E7O A;  1UGV A;  2RPN A;  1JXM A;  1GL5 A;  2E5K A;  4AG2 C;  1SSH A;  4OMM A;  1NM7 A;  3VS0 A;  3VS7 A;  2DL5 A;  4QT7 A;  2AKL A;  2KEA A;  1SRL A;  2D0N A;  3VS6 A;  2FRY A;  1H8K A;  3EG3 A;  2BZX A;  2A28 A;  1QWE A;  1NEB A;  3UA7 A;  1SPK A;  1FMK A;  2H8H A;  2JS0 A;  2RMO A;  3H0H A;  1ABQ A;  3TVT A;  2LCS A;  1AD5 A;  1G83 A;  1UDL A;  1CKA A;  1I1J A;  2K6D A;  4D8K A;  1Y0M A;  4J9B A;  3ZL7 C;  4OML A;  1BK2 A;  2CDT A;  2KXD A;  1UHC A;  1WXT A;  2ROL A;  4R0K A;  2EVR A;  2RN8 A;  1K76 A;  2VKN A;  2FG0 A;  2LJ3 A;  4RTX A;  2M0Y A;  1OOT A;  1NEG A;  2K79 A;  5IXB A;  2RQV A;  2CUD A;  2DM1 A;  1YWP A;  4D8D A;  2JMC A;  2ABL A;  2L0A A;  2GGR A;  1JQQ A;  2BZ8 A;  3UAT A;  2KYM A;  2JS2 A;  2DL3 A;  2X3X D;  3LH5 A;  2DL4 A;  2RNA A;  1VYV A;  5ECA A;  2J05 A;  1WXB A;  2MIO A;  5FWC A;  5HCK A;  2F2X A;  4F16 A;  5EC7 A;  2O9S A;  1JU5 C;  3REB B;  1WXU A;  1WA7 A;  2MCN A;  2YUO A;  1NYF A;  2CSI A;  4AFQ C;  1PWT A;  1W70 A;  2ED0 A;  3M0Q A;  2LX7 A;  2CH4 A;  1K0S A;  4J9I A;  2DL8 A;  2PTK A;  1GCQ C;  1ZUY A;  4JJC A;  2CSQ A;  1CKB A;  1PKT A;  1QCF A;  1M8M A;  1UJY A;  2NWM A;  1T3L A;  1X2Q A;  2A37 A;  3IQL A;  1H3H A;  5FW9 A;  1JEG A;  1AWW A;  2JT4 A;  2FRW A;  1GCQ A;  1UG1 A;  1AOJ A;  1PNJ A;  4J9C A;  4IIO A;  3QWX X;  2ECZ A;  2L3P A;  2GQI A;  2XMF A;  3I5S A;  2EGA A;  2K7A A;  2M51 A;  2JMA A;  4KRT A;  2RQU A;  2MOX A;  3CQT A;  4AFS C;  1WYX A;  4IIM A;  1WFW A;  2A08 A;  1XOV A;  1PHT A;  2X3W D;  1UEC A;  1ZBJ A;  4CC4 B;  2YUN A;  3UA6 A;  4J9G A;  2EGC A;  2CRE A;  1M30 A;  2RQT A;  1RI9 A;  3EHQ A;  1AVZ C;  1X69 A;  2OAW A;  4X1V A;  4FSS A;  3H41 A;  2KE9 A;  2W0Z A;  2L3Q A;  2EQI A;  4CC7 A;  4OMP A;  2VVK A;  4RUG A;  1K1Z A;  1GFC A;  3JV3 A;  1EFN A;  2DL7 A;  3EG0 A;  4LN2 A;  2C0O A;  1BB9 A;  2FO0 A;  2JM8 A;  4AFZ C;  2A36 A;  1TG0 A;  2GTO A;  1Y57 A;  2KNB B;  4OMN A;  1OPK A;  1NLP C;  4LUD A;  2LNH B;  4LUE A;  1S1N A;  2DJQ A;  2OI3 A;  3QWY A;  2P4R A;  2AZS A;  2BTT A;  2LJ1 A;  1HD3 A;  2EYY A;  1UJ0 A;  2PNI A;  1U3O A;  2DBM A;  1GRI A;  2PZ1 A;  3M0U A;  2DX1 A;  4RTY A;  1W1F A;  1WIE A;  2DVJ A;  1UFF A;  1GCP A;  5I11 A;  2RF0 A;  4HVV A;  3NMZ C;  1KJW A;  1RUW A;  2J6O A;  2D8J A;  1Z9Z A;  1QWF A;  2FPD A;  2DBK A;  2FEI A;  5IH2 A;  1X2K A;  1J3T A;  1RLQ C;  2J06 A;  1SRM A;  3SHW A;  1ARK A;  3KFV A;  4Y92 A;  3I5R A;  1ZUU A;  1ABO A;  3A98 A;  2O88 A;  1H92 A;  1BU1 A;  3M0T A;  2KRM A;  1ZX6 A;  2CUB A;  3VRZ A;  4WCI A;  2O2O A;  3FJ5 A;  2KRS A;  2B86 A;  2EKH A;  2HEQ A;  3PE0 A;  2FPF A;  3VS5 A;  2SRC A;  1HSQ A;  1YN8 A;  4AG1 C;  2QDL A;  1WX6 A;  2L3S A;  1UHF A;  1T0J A;  4DEX A;  4ZNX A;  3M0S A;  1V1C A;  2K3B A;  2DMO A;  4JZ3 A;  5I22 A;  2KT1 A;  3EG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...