3CXCP

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cxcP00
1Q86R 3G71Q 1JJ2P 1W2BP 1YHQQ 1K8AR 1QVFP 3CD6Q 1QVGP 3CCSQ 3G6EQ 1VQKQ 3OW2P 1YJWQ 1VQMQ 1VQNQ 1M1KR 2OTLQ 3G4SQ 3CPWP 1YJ9Q 1VQ9Q 1VQ6Q 1Q7YR 3CCRQ 1VQ4Q 1KC8R 1K9MR 3I56Q 1VQ5Q 1VQOQ 1N8RR 3CC2Q 2OTJQ 3CCJQ 3CXCP 1K73R 1M90R 1KQSP 1YITQ 3CCLQ 3CCUQ 1YJNQ 3CMEQ 3CC4Q 1VQ7Q 1YIJQ 3CMAQ 1VQPQ 1YI2Q 2QEXQ 3CC7Q 1S72Q 1VQ8Q 3I55Q 3CCMQ 3CCVQ 2QA4Q 1Q81R 3CCEQ 1Q82R 3CCQQ 1KD1R 1VQLQ 1NJIR
chains in the Genus database with same CATH superfamily
1WX6A 4XTUA 4C0DB 1U8RA 1GFDA 3WXMB 1G3WA 1VQ9Q 1BKBA 2L3RA 5CKEA 4J7IA 2L8DA 2L3SA 3BDUA 1IGUA 4E7SA 1V1CA 3I56A 3HSBA 2JUFA 4DQ2A 2V26A 4M7DA 3SWNA 2COWA 1LCKA 2DMOA 2GFUA 2YSQA 1OX9A 2O01E 2PU9B 3GIBA 4HXJA 1XNIA 1GCQA 4PJLA 2DD5A 3SB2A 5KE3A 5LJ3f 1M2VA 4JDSA 2RI2A 4CI0C 2EYQA 5HY6A 3OQ5A 4YTLA 3JCMg 1X01A 3X26B 4XU2A 4KGXB 4PJOG 2KQWA 1OPKA 1KHIA 4E7KA 4AG2C 4C5HA 3REBB 2COYA 3CCQT 1HSQA 1K9MR 2RQTA 4IIOA 3OS1A 2DRKA 1BB9A 4QVZA 1HXDA 2LNHB 4BUGA 1M3BA 2DYIA 5J26A 4E2FB 4CC3A 2JW4A 3HP9A 5CKDA 2HSEB 3EG1A 3OMGA 3ULRB 4ELZC 3QJYA 1VQKQ 3HTRA 3ASKA 4NL2A 4E7LA 4C92F 1M8MA 2DZCA 4M75G 2DILA 3HHTB 3LH5A 2LCSA 5LJ5d 2YLCA 2EYZA 4RTUA 5LJ3j 2QGFB 2VASA 4N4GA 5FWBA 5I21A 3CCRT 3GP8A 3TREA 2HBPA 1Q86R 4AG1C 5IHNA 1TUDA 2CKKA 4C92C 2HSPA 4LDUA 2D6FA 1WJRA 1QP3A 2P0PA 1WJSA 4PFZA 2ZPHB 3RKYA 5AT1B 1DJ7B 1VQLT 4AMCA 3JAME 2DNUA 3CQTA 1NE8A 2RQUA 2E6ZA 4JLIA 1JQQA 3BY7A 1N5ZA 4X1VA 1TUCA 2KXDA 4NOYA 4ANJA 4C8QF 3D7SB 1NG2A 3RESA 5FLXE 4CC2A 4RTWA 4BE2A 4A4HA 4RTZA 4RG8A 1MMAA 1VQ5Q 4P5NA 4JRPA 3GOXA 2VKNA 2DAQA 1WZOA 4C8QC 4PJOD 3QXEB 1AHJB 1MV3A 5KE2A 5KYWB 1Q81R 2CGHA 4JS4A 2AZSA 3PMTA 1NJIR 2K5IA 2M02A 1SKUB 1PNJA 3OYMA 2RQRA 5D6XA 1PD0A 3CBOA 2K9GA 1YJ9Q 4QW2A 1U5SA 1RADB 4QKUA 1N27A 3A1PA 1YJ9A 2GTOA 4TVRA 3CC7Q 1AZEA 1KSWA 3OYNA 4KGZB 2HCKA 5GANd 3OSVA 3VS4A 2LQWA 1NEBA 4M75D 3CC7A 1X43A 2O4XA 1M1FA 2M1HA 3ME9A 3LGFA 3QYHB 2O9VA 3H0FA 3CCJQ 1OX8A 2JJ9A 1RAEB 1X75C 1QKWA 4HA8A 1O9SA 4WCIA 4J6XA 2A28A 5FROA 1UJYA 1Q82U 2QA4Q 2RK2A 2D8JA 1NEGA 4M7AC 2XK0A 4X34A 3CCLT 4M78F 2EWNA 3FC3A 3RUXA 1G3SA 3M4YA 2EQMA 3R6NA 1D1AA 2QQBA 2RJDA 1VQOQ 2HL5C 3BDLA 1K9AA 4FL6A 1UHFA 1OU9A 1UGQB 2YHTA 2R5AA 2CREA 1YJWT 1VQOA 3JCMc 3DB4A 3JB9H 4M78C 5GMKe 2SRCA 4BI3A 1G2BA 2HDAA 4VUBA 2D8HA 3WVDB 2OAUA 2RD1A 4EDUA 5DY9A 1YHQA 1M90U 1X6OA 1G8XA 2KT1A 3OYGA 5I22A 2BZYA 3KFVA 2F2XA 1PSEA 1VQMT 2DJQA 1PKSA 2DL7A 1I4K1 1HJDA 3P8DA 4R0KA 1SHGA 1UGVA 2YDLA 5EG2A 1MGQA 2DXBA 5KYXB 1JBMA 3CCET 3FEOA 1BBZA 4IUPA 4OGCA 2LRQA 1Y0MA 4J9BA 4PJMA 1IRXA 1QQJA 5CO7A 3L2UA 1VQ4A 1AEYA 2QXFA 4HKEA 1UG1A 5A0LA 2BZ8A 3DLMA 3S3NA 4J9GA 4PJOB 2FHDA 3OYDA 2ATCB 1OZ3A 4J9HA 1Q82C 2PVGB 4FCYA 1KQ2A 2C0TA 3JCMd 2YRDA 2YUOA 1QP2A 1BK2A 2RQVA 5LJ5e 2LC4A 1WHKA 2E6NA 5LJ3g 2MYSA 1KQSA 3UWNA 3M0RA 4M77F 4XTVA 1UGPB 1E6GA 1UHCA 2QEXA 4BY6C 1CSKA 2DTHA 2L3PA 3ZEHA 1VQ8T 1ZA2B 4BI4A 1WHHA 3V7CA 3QWYA 1GBRA 4M75B 4IUTA 2CP5A 2YUNA 1BI1A 5CKHA 2PVOB 5J39A 3QZ9B 1JEGA 4M77C 3QDRB 1UTIA 5L23A 2QAZA 5GAOl 3CCQQ 4CC4B 2KT8A 2C0IA 1M90C 1D0XA 1PD1A 4WF2A 1T0HA 4M7DD 5GAOr 4BB7A 3QHSA 4F14A 1K73R 3G6ET 2V1QA 3H8ZA 4FYXB 3M9QA 1SPKA 4RTYA 5D7UA 1IHWA 1PRMC 2E5QA 1VA7A 5IH2A 1RAFB 1SSFA 1O75A 3ER0A 3L2ZA 3NGPA 1K0SA 2DIGA 1FMWA 2VUBA 5L8RE 3CCRQ 3QYGB 2QQAA 2MMPA 3M5AA 3RERA 2BIVA 3A8MB 2JNGA 3OYHA 3CCRA 1LJOA 3G1JA 1VYTA 3PMIA 1SG5A 4E6RA 4PL6A 1D0YA 2JTMA 2RHIA 1VQLQ 5GANe 4K11A 1D0ZA 1IB8A 2QK0A 3UDCA 1I5OB 3QG1A 1ARKA 3M0TA 3M53A 2A3LA 2O2OA 3EGDB 3VYHB 4C92A 1M1KR 2WSEE 2RHYA 3G7ZA 3FJPA 4HCCA 1N8RR 1MHNA 3H41A 1I5LA 2HQHA 1WDXA 1KQ1A 3RMSA 4HVUA 4L6V5 4F7UG 2Z0WA 3QJ6A 4GLKA 4JLGA 3I35A 2MCNA 4QQGA 4DBFA 3JCMb 1JB0E 1EZZB 1KHCA 1VIFA 5CCAA 2DBMA 1YCSB 4L5GA 2V8IA 4AFSC 2V1RA 1KQSP 3PVLA 3C12A 4C8QA 1NJIU 2XHCA 3VRYA 2FVUA 4XQ3A 4N0AC 4O5VA 1R0CB 1WHMA 4OMOA 5KYYA 3OS0A 2X4XA 3KUFA 1W1FA 1WXUA 1OEBA 2K5FA 3RIRA 1KIKA 2JXBA 3MEAA 2CYZB 2I0NA 3L1AA 1G3YA 4R56A 1MNDA 3OYCA 3OMCA 1U3OA 2KBTA 1ZHIA 3O8VA 2EYYA 3H0IA 2FO0A 3CCUA 3VS0A 2A7YA 3QBYA 4J83A 5GMKh 5IT9E 1B3QA 3LYIA 3SDZA 1KJWA 3JCMQ 2CZ0B 2X35A 1RI9A 4E7IA 1W6XA 1TTHB 4F17A 8AT1B 3E9GA 1MMGA 4FYWB 3CCLQ 2DTOA 2EQIA 3C95A 4M4ZA 5GAOn 1YBYA 3SWNB 4M7DB 1OPLA 1NM7A 3MEWA 2RJEA 1RLPC 4KH1B 3CCLA 2OTJT 2AHJB 1KD1R 1R77A 5C0MA 2ECZA 3IQLA 3L2RA 1LOJA 2CS7A 2EKHA 2HNIA 1Y07A 2CUDA 3FB9A 1YJWQ 4J8OA 1B7TA 2AT1B 2NYSA 1UFFA 2K4YA 3CD6A 3A8GB 3NTIA 2AK5A 3JCMe 3LWHA 2QDLA 1T3SA 3META 4QT7A 2FPDA 2JS0A 1YWPA 1M8VA 2LT4A 3TCJA 3G71Q 2ESWA 2CDTA 4M78A 3DLLA 3LWIA 2LCLA 2O9SA 2E3HA 1S72T 1VQMQ 2E70A 2YLBA 3G71A 1NJIC 3SEMA 2DO3A 3JB9G 2NUZA 1H3HA 2DKGA 1XJWB 5FU7B 2RJFA 1KQSS 2DXTA 4JJBA 5LJ5h 1IZ6A 2VV5A 3VRZA 2KI7A 4II1A 3CCEQ 1PKTA 1QKXA 2DD4A 4Q5WA 1NPPA 2DFUA 1D09B 1OYXA 2YT6A 4J6WA 2DE0X 3H9NA 2MF2A 3H6ZA 2JVVA 4FU6A 1KG1A 1VQ9A 2LX9A 2DL5A 2FZKB 3EG0A 3QZ5B 5KYUB 1IREB 2YWWA 2HMAA 3OYEA 2KGTA 1E6HA 2X4YA 5KH6A 1WYXA 3CCVT 3HPWA 4OVAA 5ECAA 3QUIA 5KCOA 2VYTA 2JTEA 1XOVA 1J3TA 1ZUYA 4E7JA 2DF6A 4RTTA 2D9TA 2OTLT 1MNEA 3EH2A 2DEUA 1VQ8Q 3A8LB 2KY9A 4FT2A 1YITT 2CZ6B 1TS9A 2JMCA 1WXTA 5CQYA 1K8AR 1VQ8A 1OI1A 2NUPA 4J5YA 2Y4YA 1D3BA 3VU3C 1UGRB 4MZPA 1QVFS 3JCMP 3CCMT 1GRIA 4M77E 4C5IA 4LUEA 1KC8R 2ZPEB 1M3AA 3CPWA 4FIBA 3JCMV 1ZQ1A 2ROTA 1SRMA 3HRTA 3LH0A 4M77A 1YWOA 1WHGA 3HRUA 2KRSA 4MZMA 5FRNA 1VQ7T 2FRYA 4JRQA 2ED1A 2HZYA 1AD5A 2IG0A 1UDLA 3JB9D 3G6EQ 1VQNQ 4PJOF 2F2WA 1WJQA 2KYMA 1K73U 1QVGA 3G6EA 1VQNA 1VQKA 4E7HA 2LTOA 3ZL7C 2H3JA 3MJXA 2K2MA 4A4GA 2K6DA 4F7UB 2ENMA 2HD0A 4FW2A 4J9FA 3JSCA 1Y96A 4RTVA 2RNAA 3SHWA 1AWOA 2XIDA 2XKOC 2WSFE 5IXFA 1T3LA 3I55T 3UA7A 2RHXA 4GLMA 1LPLA 2W10A 1YNZA 4O6JA 3P8HA 4M75F 1D1BA 2YRVA 5CIUA 1I0CA 2LQKA 4X9CA 2X4WA 4RCCA 1WGSA 2X3XD 2F2VA 2DXUA 3LW5E 3CEYA 2A37A 5GMKj 4HCBA 5I2MA 2KROA 5GAMd 4QVDA 3E2UA 5HK3A 1BI3A 1N8RU 4XU1A 1Q7YR 3EFRA 1ZUKA 3EFOA 2E1HA 3RDVA 1NBEB 4J9CA 2EJGA 1FMVA 1VQ5A 2KDSA 1ZX6A 2KNBB 3V8JA 2H3EB 3QDFA 4E7ZA 5FWCA 5AYFA 4DOWA 2KVQG 2XU8A 3T9NA 1ACMB 1I1JA 2GGRA 4C92D 2FYKA 4CC7A 4M7AG 2XMFA 2OAWA 1WFWA 1K73C 1CKAA 1ZBXA 3CC4T 2CUBA 3CMAT 4N0AA 2VXFA 6AT1B 4ZNXA 3CPWP 2PUKB 2NLUA 2KRMA 1WNLA 1X27A 3TEEA 2A0FB 2AIRB 5LJ5j 3JCMh 1PG5B 1PWTA 4EMKC 4M78G 3CCJA 2EVRA 2ZAEA 1VQPT 4ZTFA 4C8QD 2QA4A 1QVGP 3C0CA 5FU6C 3OW2P 3HRSA 1I81A 2C0OA 4JJCA 2ED0A 4FYVB 4PJNA 2ZZDA 2XI9A 2J6OA 1PCXA 4C0ZA 3X28B 1A0NB 1N8RC 3MEUA 4BACA 1HYOA 1Z9QA 2HQXA 1YP5A 3THKA 5M9OA 4JPBW 3V8LA 1U1TA 1YI2T 1D1CA 3VS6A 2O88A 1VQ6Q 5GJVB 4XAXB 4LDXA 2DYBA 3EGXB 2YXYA 1PHTA 1PC0A 2PUOB 2EGEA 1VQ6A 4M7DG 2FRWA 1S72Q 5C6SA 3CC2T 2EIFA 2PNIA 2QQSA 1G83A 4LNPA 1H641 1GBQA 1U1SA 5FRMA 4HCZA 2LP5A 2DLPA 2CH4W 4M7AD 2ZGWA 4ATOA 4DEYA 5CR2A 3A98A 4RTXA 4DBHA 1TUGB 4KBMB 4OMQA 2OJ2A 2JZ2A 4XTXA 3GPLA 1BCMA 1Y7XA 2E5KA 3DKMA 2RH2A 3CBPA 5IAYA 3CPWS 4M78D 2KXCA 1N9RA 1W70A 3E19A 1ZLMA 2FG0A 4HT8A 3RR6A 2J6KA 3CCVQ 3I56T 1ZSZC 1AWXA 2FPEA 3TVTA 4KRTA 3CCVA 3GLXA 1MV0B 3V7RA 4C92B 3A8HB 2C06A 1QCOA 2OTLQ 1WPYA 1QVGS 3PIPA 2P0QA 4FT4A 3OW2S 1PM3A 2F5TX 3R6OA 4JS5A 3CXCP 1YITQ 1BYMA 1RAGB 3CCMQ 1WI7A 2W0ZA 1M27C 4D6WA 2HKQB 1JJ2P 2CP7A 2FPFA 3CCMA 2O31A 1K0XA 3OYIA 5GAMe 3CCQA 1K9MU 1B34A 1X2QA 3EG9A 1SEMA 1YN8A 5FU7C 3DB3A 1VUBA 3FJ5A 4C8QB 1VQ7Q 1T0JA 4ZN3A 3OYJA 2EGAA 4EIKA 3NMZC 1VQ7A 4LDWA 1FX7A 4C0GA 3M4GA 4XTWA 4C0DC 5KYYB 2CP0A 5IXBA 1VYVA 3M55A 2MK5A 1JU5C 5GJWB 4BDZA 1QVFA 4DBRA 2GFAA 2J05A 4X9DA 3PFSA 4GY5A 4PJOE 1NPRA 3HKSA 2VC8A 2IIMA 2E41A 3I55Q 2VGNA 3NHNA 1Q86U 4MMLA 4OB1B 3OY9A 2D1XA 3I55A 1TWBA 3V8KA 2JT4A 4IUQA 1VQLA 2IVWA 2I2LA 2DL3A 2LT1A 1TH7A 2PTKA 3EAEA 4J6YA 2RN8A 4WTOB 5EC7A 3OA6A 2DL4A 3MCAB 3PE0A 2EW3A 4M7AB 2JMAA 4FM4B 3S3MA 8ATCB 2CT3A 3OYLA 4M75E 3HL8A 1UUEA 2P84A 3KBGA 2R58A 2QQRA 2FZCB 5CK9A 4LD6A 1M2OA 4ZN1A 2HKNA 4A4EA 1TSFA 3CXCS 2OX7A 1Q81U 2BZXA 3GNGA 1K9MC 2EYXA 3EG3A 1WQWA 4M78B 2P0KA 1R0BG 4F7UF 1YFNA 2ZPGB 1JJ2S 4IURA 1R8OB 9ATCB 1W2BA 3C94A 2LJ1A 1RLQC 5LL6S 1X69A 2FB7A 1M30A 3CC4Q 3VS5A 3CMAQ 2YUPA 4J9IA 5HK0A 2ZPIB 4JRIA 3O5ZA 4IUVA 3CC4A 1FWZA 1RI0A 2PQWA 3OYYA 3J80E 4MMKA 1WHJA 4BI8B 3QKJA 4V2SA 4EPCA 4AFQC 1Q86C 2L5QA 2VXEA 1K4US 3PT9A 2DEQA 2NUTA 2EQUA 1VQPQ 2K5LA 1Q82R 2CZ1B 3U23A 2MIOA 3M58A 4EMKA 3M0SA 1AWJA 1QVFP 3MP8A 2KE9A 1JO8A 2BE9B 3M56A 2QGGA 3H0HA 1W4SA 2ZCFB 2BE7D 2DA9A 2K57A 1M2VB 4DEXA 1UECA 1K1ZA 1AT1B 1VYUA 1YJWA 1QMCA 2KMTA 1AOJA 3UPUA 1QLYA 5A0DA 3P8BB 1YI2Q 3QWXX 4L59A 2M51A 1BCOA 2G6FX 2L89A 2VVKA 2NUPB 3VJPA 4ZGDB 2QQ9A 2A36A 2RJCA 3AT1B 4BY6B 1UB4A 3QPHA 4OMFB 3L2VA 2DL8A 2XG8D 1P92A 1Q81C 2LDMA 3S6WA 3OB9A 3PGGA 3J81E 1QCNA 2VGMA 3CC2Q 2G3RA 1M90R 1YHQT 2LVMA 4A54A 3FIFA 1VQMA 5KYNA 1SRLA 4RUGA 3GBQA 4ZGJB 2VB6A 3Q1JA 2DTIA 4C5GA 4ZGEB 1YIJT 4JZ3A 3CCEA 4ME7A 1WIEA 4OMPA 1ZSGA 2M9UA 1U06A 5LJ3d 4R55A 2V8KA 2COZA 3JB9F 1Z9ZA 4KUIA 3RKXA 3JB9J 1VQ4T 1BIAA 3V7SA 4OB0B 2LNVA 3GNFB 1Y96B 3OYFA 3VV0A 2KRNA 1W2BP 3A8OB 4D8KA 2E4HA 4M7DE 5GAMh 4ORZA 4XU0A 2E10A 3I56Q 2HL3A 1PRLC 2DJZA 3N5BB 2FEIA 3M57A 2DPPB 4KULA 2KAFA 5CVIA 2NWMA 1ZSZA 2KEAA 1X6GA 2QEXT 2LCCA 2XDDA 3EFOB 5GAN7 1QVPA 2ZPFB 4FSXA 1Y57A 2DERA 2RK1A 3J7AF 2MOXA 4LE9A 2BKDN 2R57A 3L42A 2KYBA 3LGLA 5GAN2 1Q95G 3EH1A 4C5EA 4F04B 4LDYA 4C0FA 2LQNA 1N6AA 5GANh 4C92G 1MUZA 1G3TA 3EFSA 3MKDA 2RM4A 3OW2A 3LX7A 4QQDA 3REAB 3NFCA 4JJDA 3CBMA 3E1SA 2JM8A 4MDWA 2O4XB 3M54A 1TU0B 1JRIA 2ROLA 3HFOA 4IUUA 4PJOC 2CSQA 2DRMA 1EX4A 2FL7A 3WVEB 3TQ7P 3VS2A 3NTHA 2AZVA 3BE3A 1V29B 4C8QG 4PK4A 2Y90A 5GAOq 3L2QA 1IHVA 2MI6A 3MHXA 4HVVA 4XK8E 4OB3B 5KYUA 1SSHA 3OS5A 3CMET 2KK4A 4EMHA 1W2BS 4XU3A 1M1KU 2GQVA 1OV3A 2WACA 2SEMA 1QW1A 2E3IA 4IIMA 1RUWA 2JOYA 4M75C 4J9EA 2RB6A 4BE1A 4PJJA 5CKBA 4NL3A 2JTFA 3VS1A 5LJ5f 2MAMA 2CSIA 3MP6A 1KFZA 4Y92A 1AVZC 4Y28E 4LN2A 2M16A 1N9SA 2HEQA 3VUBA 1OOTA 3OS2A 1LNXA 1C0MA 4RCBA 4GBQA 2LMJA 5GAOp 3G4ST 1BIBA 3NTKA 2QTXA 2DETA 5DM7R 3BW1A 1TXQA 4AT1B 1ZBJA 3S3OA 3MEVA 3PTAA 2A08A 5GAN3 1OU8A 1KK7A 2E64A 5GAMf 4HVWA 2XDPA 1H8KA 2CP3A 4MDXA 2MWPA 1M3CA 1FXXA 2QG9B 4F7UE 1OULA 1NZ9A 1XTDA 1HD3A 4Z88A 3JCMJ 2R5MA 2K79A 2MPXC 4RMOA 4Z02A 3VS7A 2H8HA 3CCST 1H92A 3QIIA 2KSSA 3OBYA 1C6VX 3CXCA 4PKCC 1XQHA 4F7UA 4M7AF 3CCUT 2E12A 4OB2B 2LZ6B 1NLPC 1X2KA 3M0QA 2RI3A 1JJ2A 1WA7A 2OTJQ 3FRNA 2RHUA 3JV3A 1RACB 5LJ3e 1RL2A 5HCKA 1M1KC 2OTJA 1YCYA 1KD1U 2JN0A 2RPNA 2RMOA 4B9XA 5GANf 3EGUA 3ZFJA 5DLOA 2B8AA 4CRIA 5J3BA 4PFOA 5GAMj 1RABB 3GF5A 2K2VA 2QDYB 2GF7A 2X4JA 5IHKA 4HCKA 4ELYC 3CD6T 2RF0A 4KH0B 3RMQA 3JCMW 2EYWA 2RQWA 5KYWA 2DVEA 4F16A 1YJNT 1YHQQ 3AHUA 4Z8AA 2J06A 1S72A 1B34B 2L3QA 2Y4XA 1RAAB 3EG9B 2K3XA 1EIFA 2HBWA 2DBKA 3URGA 3G71T 5GAOm 2V8JA 3TU4K 7AT1B 1YIJQ 4B6MA 2QTVA 2KR3A 4LXCA 2EGCA 2LX7A 4M7DF 5IN1A 4QQ6A 1YIJA 2F1LA 5GANj 5D6YA 3FDRA 5HKCA 1VQ4Q 1HK9A 3E9FA 3A5ZB 5CQXA 3QSUA 3BFMA 2CT4A 4EMGA 4M77G 4A53A 3VKIA 4M7DC 3SWNC 1VQ9T 3FLGA 1NYGA 3M0UA 1LVKA 5I11A 3NPFA 1PSFA 1E7OA 2J7IA 5A2QE 1GCQC 3PIOA 4DOVA 1H3ZA 3ZBDA 1KD1C 2HAXA 3OSSC 4OMLA 4BD3A 1CKBA 1QWEA 4N4IA 4KGVB 1VIEA 2OTLA 2GTJA 2QEXQ 3M0PA 1WHLA 4E47A 3LLRA 1YITA 2WSCE 4Y91A 1K8AU 4PNOA 3I5SA 4XTZA 3EHRA 1I8FA 3HFNA 4OMNA 2X51A 4JJNK 1KC8U 3OBWA 5IHIA 2X3WD 4BE0A 2BTTA 5CKFA 2RI5A 2EJ9A 3EGXA 4UC4A 2HQEA 4DBQA 1BU1A 2QI2A 3JCMf 1WLPB 3OYAA 5KCHA 2YUQA 3EG2A 4B9WA 4D8DA 4QVCA 1GCPA 2EFIA 2GBQA 2OI3A 3MP1A 2GQIA 4HT9A 3INZA 1GL5A 4DA4A 5FW9A 4RKUE 3JB9I 4J9DA 3PNWC 5KYXA 1IGQA 1WQ7A 3UT1A 3CPFA 1VQNT 1VQKT 2DZ9A 4LDVA 2EAYA 4KUDK 2LJ3A 2PZ1A 3VUZA 5GAN5 3JRZA 2K3BA 3QO3A 3UA6A 2EQJA 4PJOA 3X24B 2DXCA 4M77D 2L2PA 2FZGB 1ABOA 2NUTB 2AKLA 1S1NA 2DK3A 3CMEQ 1C1AA 4JZ4A 3JCMX 4C92E 2CZ7B 4A4KA 2AKKA 4OMMA 4EMKB 4LD9K 5LJ5g 3CMEA 4PLIA 1JXMA 2D0QB 2ZPBB 1ZA1B 2P4TA 4N4HA 2P4RA 5FU6B 4PLLA 1Q7YU 1TG0A 5I2SA 1FMKA 5GAN4 2RO0A 1UGSB 3RKWA 5A0GA 2EKOA 1M4ZA 1K8AC 5GAN6 2LJ0A 4M75A 2J6FA 5GMKm 3OYBA 2DX1A 1VQ5T 1KC8C 1UEBA 4BDYA 3I5RA 3SFMA 1SF9A 2EQKA 2LQ8A 5GMKi 2D0NA 4C8QE 4ESRA 3VYGA 5CAIA 3G4SQ 1QWFA 4IKFA 5GAMg 1ABQA 4A4FA 2X9HA 3KXTA 1G5VA 1FYNA 5D6WA 2MWOA 4AFUC 3G4SA 2PVDB 5LJ3h 3TSZA 2F5KA 1YJ9T 1WXBA 3VS3A 3UATA 1IXDA 3M59A 3CMAA 1JXOA 1AWWA 1K76A 3X20B 3CCSQ 3CC7T 1OZ2A 2QYZA 2M0YA 1I07A 2VWFA 1GXIE 2M0OA 4J7FA 1GFCA 3CCSA 4RG2A 2XD0A 3CCUQ 4AFZC 2EJFA 3I9QA 3X25B 1EFNA 1UJ0A 1NYFA 4JUVA 4NS5A 3CCJT 2RHZA 1QCFA 1BI2A 3OYKA 2GCXA 1VQPA 4FW1A 2RA2A 1TOVA 3RNJA 3PVQA 4JRKA 1Y71A 5GANg 2QA4T 1AZGB 2IPOB 2JM9A 4MZTA 4M7AE 2B86A 3EGDA 1V76A 4LUDA 2XICA 4KT0E 1VOMA 2F69A 1OQKA 2QASA 1MMDA 3MPUB 2GNCA 4A63B 1Q7YC 1M1GA 1VQOT 3C4SA 2CP2A 1ZSZB 4M7AA 1X6BA 2L0AA 4OGEA 2CH4A 1M9SA 1D3BB 1YI2A 3SD4A 3CD6Q 1ZUUA 5GMKl 4XTYA 5DLQE 3EHQA 3L2WA 3F70A 3TSWA 2K3YA 3RBBB 2JS2A 4M78E 1RAHB 1SHFA 1UE9A 2DVJA 2XDBA 2DM1A 1YJNQ 3UF4A 2BUDA 4FYYB 1VQ6T 1B07A 4M77B 3CC2A 1NLOC 1YJNA 1BI0A 1IO6A 4Z89A 2EBPA 2YRCA 1M5Q1 3MO8A 1RAIB 2CP6A 1MMNA 1F1BB 2K7AA 4OF1A 4FSSA 4PFPA 2E65A 5GAN8 2ABLA 2DIQA 4ZTJA 2EPDA 4OP0A
chains in the Genus database with same CATH topology
1Q86R 3G71Q 1JJ2P 1W2BP 1YHQQ 1K8AR 1QVFP 3CD6Q 1QVGP 3CCSQ 3G6EQ 1VQKQ 3OW2P 1YJWQ 1VQMQ 1VQNQ 1M1KR 2OTLQ 3G4SQ 3CPWP 1YJ9Q 1VQ9Q 1VQ6Q 1Q7YR 3CCRQ 1VQ4Q 1KC8R 1K9MR 3I56Q 1VQ5Q 1VQOQ 1N8RR 3CC2Q 2OTJQ 3CCJQ 3CXCP 1K73R 1M90R 1KQSP 1YITQ 3CCLQ 3CCUQ 1YJNQ 3CMEQ 3CC4Q 1VQ7Q 1YIJQ 3CMAQ 1VQPQ 1YI2Q 2QEXQ 3CC7Q 1S72Q 1VQ8Q 3I55Q 3CCMQ 3CCVQ 2QA4Q 1Q81R 3CCEQ 1Q82R 3CCQQ 1KD1R 1VQLQ 1NJIR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 R;  3G71 Q;  1JJ2 P;  1W2B P;  1YHQ Q;  1K8A R;  1QVF P;  3CD6 Q;  1QVG P;  3CCS Q;  3G6E Q;  1VQK Q;  3OW2 P;  1YJW Q;  1VQM Q;  1VQN Q;  1M1K R;  2OTL Q;  3G4S Q;  3CPW P;  1YJ9 Q;  1VQ9 Q;  1VQ6 Q;  1Q7Y R;  3CCR Q;  1VQ4 Q;  1KC8 R;  1K9M R;  3I56 Q;  1VQ5 Q;  1VQO Q;  1N8R R;  3CC2 Q;  2OTJ Q;  3CCJ Q;  3CXC P;  1K73 R;  1M90 R;  1KQS P;  1YIT Q;  3CCL Q;  3CCU Q;  1YJN Q;  3CME Q;  3CC4 Q;  1VQ7 Q;  1YIJ Q;  3CMA Q;  1VQP Q;  1YI2 Q;  2QEX Q;  3CC7 Q;  1S72 Q;  1VQ8 Q;  3I55 Q;  3CCM Q;  3CCV Q;  2QA4 Q;  1Q81 R;  3CCE Q;  1Q82 R;  3CCQ Q;  1KD1 R;  1VQL Q;  1NJI R; 
#chains in the Genus database with same CATH topology
 1WX6 A;  4XTU A;  4C0D B;  1U8R A;  1GFD A;  3WXM B;  1G3W A;  1VQ9 Q;  1BKB A;  2L3R A;  5CKE A;  4J7I A;  2L8D A;  2L3S A;  3BDU A;  1IGU A;  4E7S A;  1V1C A;  3I56 A;  3HSB A;  2JUF A;  4DQ2 A;  2V26 A;  4M7D A;  3SWN A;  2COW A;  1LCK A;  2DMO A;  2GFU A;  2YSQ A;  1OX9 A;  2O01 E;  2PU9 B;  3GIB A;  4HXJ A;  1XNI A;  1GCQ A;  4PJL A;  2DD5 A;  3SB2 A;  5KE3 A;  5LJ3 f;  1M2V A;  4JDS A;  2RI2 A;  4CI0 C;  2EYQ A;  5HY6 A;  3OQ5 A;  4YTL A;  3JCM g;  1X01 A;  3X26 B;  4XU2 A;  4KGX B;  4PJO G;  2KQW A;  1OPK A;  1KHI A;  4E7K A;  4AG2 C;  4C5H A;  3REB B;  2COY A;  3CCQ T;  1HSQ A;  1K9M R;  2RQT A;  4IIO A;  3OS1 A;  2DRK A;  1BB9 A;  4QVZ A;  1HXD A;  2LNH B;  4BUG A;  1M3B A;  2DYI A;  5J26 A;  4E2F B;  4CC3 A;  2JW4 A;  3HP9 A;  5CKD A;  2HSE B;  3EG1 A;  3OMG A;  3ULR B;  4ELZ C;  3QJY A;  1VQK Q;  3HTR A;  3ASK A;  4NL2 A;  4E7L A;  4C92 F;  1M8M A;  2DZC A;  4M75 G;  2DIL A;  3HHT B;  3LH5 A;  2LCS A;  5LJ5 d;  2YLC A;  2EYZ A;  4RTU A;  5LJ3 j;  2QGF B;  2VAS A;  4N4G A;  5FWB A;  5I21 A;  3CCR T;  3GP8 A;  3TRE A;  2HBP A;  1Q86 R;  4AG1 C;  5IHN A;  1TUD A;  2CKK A;  4C92 C;  2HSP A;  4LDU A;  2D6F A;  1WJR A;  1QP3 A;  2P0P A;  1WJS A;  4PFZ A;  2ZPH B;  3RKY A;  5AT1 B;  1DJ7 B;  1VQL T;  4AMC A;  3JAM E;  2DNU A;  3CQT A;  1NE8 A;  2RQU A;  2E6Z A;  4JLI A;  1JQQ A;  3BY7 A;  1N5Z A;  4X1V A;  1TUC A;  2KXD A;  4NOY A;  4ANJ A;  4C8Q F;  3D7S B;  1NG2 A;  3RES A;  5FLX E;  4CC2 A;  4RTW A;  4BE2 A;  4A4H A;  4RTZ A;  4RG8 A;  1MMA A;  1VQ5 Q;  4P5N A;  4JRP A;  3GOX A;  2VKN A;  2DAQ A;  1WZO A;  4C8Q C;  4PJO D;  3QXE B;  1AHJ B;  1MV3 A;  5KE2 A;  5KYW B;  1Q81 R;  2CGH A;  4JS4 A;  2AZS A;  3PMT A;  1NJI R;  2K5I A;  2M02 A;  1SKU B;  1PNJ A;  3OYM A;  2RQR A;  5D6X A;  1PD0 A;  3CBO A;  2K9G A;  1YJ9 Q;  4QW2 A;  1U5S A;  1RAD B;  4QKU A;  1N27 A;  3A1P A;  1YJ9 A;  2GTO A;  4TVR A;  3CC7 Q;  1AZE A;  1KSW A;  3OYN A;  4KGZ B;  2HCK A;  5GAN d;  3OSV A;  3VS4 A;  2LQW A;  1NEB A;  4M75 D;  3CC7 A;  1X43 A;  2O4X A;  1M1F A;  2M1H A;  3ME9 A;  3LGF A;  3QYH B;  2O9V A;  3H0F A;  3CCJ Q;  1OX8 A;  2JJ9 A;  1RAE B;  1X75 C;  1QKW A;  4HA8 A;  1O9S A;  4WCI A;  4J6X A;  2A28 A;  5FRO A;  1UJY A;  1Q82 U;  2QA4 Q;  2RK2 A;  2D8J A;  1NEG A;  4M7A C;  2XK0 A;  4X34 A;  3CCL T;  4M78 F;  2EWN A;  3FC3 A;  3RUX A;  1G3S A;  3M4Y A;  2EQM A;  3R6N A;  1D1A A;  2QQB A;  2RJD A;  1VQO Q;  2HL5 C;  3BDL A;  1K9A A;  4FL6 A;  1UHF A;  1OU9 A;  1UGQ B;  2YHT A;  2R5A A;  2CRE A;  1YJW T;  1VQO A;  3JCM c;  3DB4 A;  3JB9 H;  4M78 C;  5GMK e;  2SRC A;  4BI3 A;  1G2B A;  2HDA A;  4VUB A;  2D8H A;  3WVD B;  2OAU A;  2RD1 A;  4EDU A;  5DY9 A;  1YHQ A;  1M90 U;  1X6O A;  1G8X A;  2KT1 A;  3OYG A;  5I22 A;  2BZY A;  3KFV A;  2F2X A;  1PSE A;  1VQM T;  2DJQ A;  1PKS A;  2DL7 A;  1I4K 1;  1HJD A;  3P8D A;  4R0K A;  1SHG A;  1UGV A;  2YDL A;  5EG2 A;  1MGQ A;  2DXB A;  5KYX B;  1JBM A;  3CCE T;  3FEO A;  1BBZ A;  4IUP A;  4OGC A;  2LRQ A;  1Y0M A;  4J9B A;  4PJM A;  1IRX A;  1QQJ A;  5CO7 A;  3L2U A;  1VQ4 A;  1AEY A;  2QXF A;  4HKE A;  1UG1 A;  5A0L A;  2BZ8 A;  3DLM A;  3S3N A;  4J9G A;  4PJO B;  2FHD A;  3OYD A;  2ATC B;  1OZ3 A;  4J9H A;  1Q82 C;  2PVG B;  4FCY A;  1KQ2 A;  2C0T A;  3JCM d;  2YRD A;  2YUO A;  1QP2 A;  1BK2 A;  2RQV A;  5LJ5 e;  2LC4 A;  1WHK A;  2E6N A;  5LJ3 g;  2MYS A;  1KQS A;  3UWN A;  3M0R A;  4M77 F;  4XTV A;  1UGP B;  1E6G A;  1UHC A;  2QEX A;  4BY6 C;  1CSK A;  2DTH A;  2L3P A;  3ZEH A;  1VQ8 T;  1ZA2 B;  4BI4 A;  1WHH A;  3V7C A;  3QWY A;  1GBR A;  4M75 B;  4IUT A;  2CP5 A;  2YUN A;  1BI1 A;  5CKH A;  2PVO B;  5J39 A;  3QZ9 B;  1JEG A;  4M77 C;  3QDR B;  1UTI A;  5L23 A;  2QAZ A;  5GAO l;  3CCQ Q;  4CC4 B;  2KT8 A;  2C0I A;  1M90 C;  1D0X A;  1PD1 A;  4WF2 A;  1T0H A;  4M7D D;  5GAO r;  4BB7 A;  3QHS A;  4F14 A;  1K73 R;  3G6E T;  2V1Q A;  3H8Z A;  4FYX B;  3M9Q A;  1SPK A;  4RTY A;  5D7U A;  1IHW A;  1PRM C;  2E5Q A;  1VA7 A;  5IH2 A;  1RAF B;  1SSF A;  1O75 A;  3ER0 A;  3L2Z A;  3NGP A;  1K0S A;  2DIG A;  1FMW A;  2VUB A;  5L8R E;  3CCR Q;  3QYG B;  2QQA A;  2MMP A;  3M5A A;  3RER A;  2BIV A;  3A8M B;  2JNG A;  3OYH A;  3CCR A;  1LJO A;  3G1J A;  1VYT A;  3PMI A;  1SG5 A;  4E6R A;  4PL6 A;  1D0Y A;  2JTM A;  2RHI A;  1VQL Q;  5GAN e;  4K11 A;  1D0Z A;  1IB8 A;  2QK0 A;  3UDC A;  1I5O B;  3QG1 A;  1ARK A;  3M0T A;  3M53 A;  2A3L A;  2O2O A;  3EGD B;  3VYH B;  4C92 A;  1M1K R;  2WSE E;  2RHY A;  3G7Z A;  3FJP A;  4HCC A;  1N8R R;  1MHN A;  3H41 A;  1I5L A;  2HQH A;  1WDX A;  1KQ1 A;  3RMS A;  4HVU A;  4L6V 5;  4F7U G;  2Z0W A;  3QJ6 A;  4GLK A;  4JLG A;  3I35 A;  2MCN A;  4QQG A;  4DBF A;  3JCM b;  1JB0 E;  1EZZ B;  1KHC A;  1VIF A;  5CCA A;  2DBM A;  1YCS B;  4L5G A;  2V8I A;  4AFS C;  2V1R A;  1KQS P;  3PVL A;  3C12 A;  4C8Q A;  1NJI U;  2XHC A;  3VRY A;  2FVU A;  4XQ3 A;  4N0A C;  4O5V A;  1R0C B;  1WHM A;  4OMO A;  5KYY A;  3OS0 A;  2X4X A;  3KUF A;  1W1F A;  1WXU A;  1OEB A;  2K5F A;  3RIR A;  1KIK A;  2JXB A;  3MEA A;  2CYZ B;  2I0N A;  3L1A A;  1G3Y A;  4R56 A;  1MND A;  3OYC A;  3OMC A;  1U3O A;  2KBT A;  1ZHI A;  3O8V A;  2EYY A;  3H0I A;  2FO0 A;  3CCU A;  3VS0 A;  2A7Y A;  3QBY A;  4J83 A;  5GMK h;  5IT9 E;  1B3Q A;  3LYI A;  3SDZ A;  1KJW A;  3JCM Q;  2CZ0 B;  2X35 A;  1RI9 A;  4E7I A;  1W6X A;  1TTH B;  4F17 A;  8AT1 B;  3E9G A;  1MMG A;  4FYW B;  3CCL Q;  2DTO A;  2EQI A;  3C95 A;  4M4Z A;  5GAO n;  1YBY A;  3SWN B;  4M7D B;  1OPL A;  1NM7 A;  3MEW A;  2RJE A;  1RLP C;  4KH1 B;  3CCL A;  2OTJ T;  2AHJ B;  1KD1 R;  1R77 A;  5C0M A;  2ECZ A;  3IQL A;  3L2R A;  1LOJ A;  2CS7 A;  2EKH A;  2HNI A;  1Y07 A;  2CUD A;  3FB9 A;  1YJW Q;  4J8O A;  1B7T A;  2AT1 B;  2NYS A;  1UFF A;  2K4Y A;  3CD6 A;  3A8G B;  3NTI A;  2AK5 A;  3JCM e;  3LWH A;  2QDL A;  1T3S A;  3MET A;  4QT7 A;  2FPD A;  2JS0 A;  1YWP A;  1M8V A;  2LT4 A;  3TCJ A;  3G71 Q;  2ESW A;  2CDT A;  4M78 A;  3DLL A;  3LWI A;  2LCL A;  2O9S A;  2E3H A;  1S72 T;  1VQM Q;  2E70 A;  2YLB A;  3G71 A;  1NJI C;  3SEM A;  2DO3 A;  3JB9 G;  2NUZ A;  1H3H A;  2DKG A;  1XJW B;  5FU7 B;  2RJF A;  1KQS S;  2DXT A;  4JJB A;  5LJ5 h;  1IZ6 A;  2VV5 A;  3VRZ A;  2KI7 A;  4II1 A;  3CCE Q;  1PKT A;  1QKX A;  2DD4 A;  4Q5W A;  1NPP A;  2DFU A;  1D09 B;  1OYX A;  2YT6 A;  4J6W A;  2DE0 X;  3H9N A;  2MF2 A;  3H6Z A;  2JVV A;  4FU6 A;  1KG1 A;  1VQ9 A;  2LX9 A;  2DL5 A;  2FZK B;  3EG0 A;  3QZ5 B;  5KYU B;  1IRE B;  2YWW A;  2HMA A;  3OYE A;  2KGT A;  1E6H A;  2X4Y A;  5KH6 A;  1WYX A;  3CCV T;  3HPW A;  4OVA A;  5ECA A;  3QUI A;  5KCO A;  2VYT A;  2JTE A;  1XOV A;  1J3T A;  1ZUY A;  4E7J A;  2DF6 A;  4RTT A;  2D9T A;  2OTL T;  1MNE A;  3EH2 A;  2DEU A;  1VQ8 Q;  3A8L B;  2KY9 A;  4FT2 A;  1YIT T;  2CZ6 B;  1TS9 A;  2JMC A;  1WXT A;  5CQY A;  1K8A R;  1VQ8 A;  1OI1 A;  2NUP A;  4J5Y A;  2Y4Y A;  1D3B A;  3VU3 C;  1UGR B;  4MZP A;  1QVF S;  3JCM P;  3CCM T;  1GRI A;  4M77 E;  4C5I A;  4LUE A;  1KC8 R;  2ZPE B;  1M3A A;  3CPW A;  4FIB A;  3JCM V;  1ZQ1 A;  2ROT A;  1SRM A;  3HRT A;  3LH0 A;  4M77 A;  1YWO A;  1WHG A;  3HRU A;  2KRS A;  4MZM A;  5FRN A;  1VQ7 T;  2FRY A;  4JRQ A;  2ED1 A;  2HZY A;  1AD5 A;  2IG0 A;  1UDL A;  3JB9 D;  3G6E Q;  1VQN Q;  4PJO F;  2F2W A;  1WJQ A;  2KYM A;  1K73 U;  1QVG A;  3G6E A;  1VQN A;  1VQK A;  4E7H A;  2LTO A;  3ZL7 C;  2H3J A;  3MJX A;  2K2M A;  4A4G A;  2K6D A;  4F7U B;  2ENM A;  2HD0 A;  4FW2 A;  4J9F A;  3JSC A;  1Y96 A;  4RTV A;  2RNA A;  3SHW A;  1AWO A;  2XID A;  2XKO C;  2WSF E;  5IXF A;  1T3L A;  3I55 T;  3UA7 A;  2RHX A;  4GLM A;  1LPL A;  2W10 A;  1YNZ A;  4O6J A;  3P8H A;  4M75 F;  1D1B A;  2YRV A;  5CIU A;  1I0C A;  2LQK A;  4X9C A;  2X4W A;  4RCC A;  1WGS A;  2X3X D;  2F2V A;  2DXU A;  3LW5 E;  3CEY A;  2A37 A;  5GMK j;  4HCB A;  5I2M A;  2KRO A;  5GAM d;  4QVD A;  3E2U A;  5HK3 A;  1BI3 A;  1N8R U;  4XU1 A;  1Q7Y R;  3EFR A;  1ZUK A;  3EFO A;  2E1H A;  3RDV A;  1NBE B;  4J9C A;  2EJG A;  1FMV A;  1VQ5 A;  2KDS A;  1ZX6 A;  2KNB B;  3V8J A;  2H3E B;  3QDF A;  4E7Z A;  5FWC A;  5AYF A;  4DOW A;  2KVQ G;  2XU8 A;  3T9N A;  1ACM B;  1I1J A;  2GGR A;  4C92 D;  2FYK A;  4CC7 A;  4M7A G;  2XMF A;  2OAW A;  1WFW A;  1K73 C;  1CKA A;  1ZBX A;  3CC4 T;  2CUB A;  3CMA T;  4N0A A;  2VXF A;  6AT1 B;  4ZNX A;  3CPW P;  2PUK B;  2NLU A;  2KRM A;  1WNL A;  1X27 A;  3TEE A;  2A0F B;  2AIR B;  5LJ5 j;  3JCM h;  1PG5 B;  1PWT A;  4EMK C;  4M78 G;  3CCJ A;  2EVR A;  2ZAE A;  1VQP T;  4ZTF A;  4C8Q D;  2QA4 A;  1QVG P;  3C0C A;  5FU6 C;  3OW2 P;  3HRS A;  1I81 A;  2C0O A;  4JJC A;  2ED0 A;  4FYV B;  4PJN A;  2ZZD A;  2XI9 A;  2J6O A;  1PCX A;  4C0Z A;  3X28 B;  1A0N B;  1N8R C;  3MEU A;  4BAC A;  1HYO A;  1Z9Q A;  2HQX A;  1YP5 A;  3THK A;  5M9O A;  4JPB W;  3V8L A;  1U1T A;  1YI2 T;  1D1C A;  3VS6 A;  2O88 A;  1VQ6 Q;  5GJV B;  4XAX B;  4LDX A;  2DYB A;  3EGX B;  2YXY A;  1PHT A;  1PC0 A;  2PUO B;  2EGE A;  1VQ6 A;  4M7D G;  2FRW A;  1S72 Q;  5C6S A;  3CC2 T;  2EIF A;  2PNI A;  2QQS A;  1G83 A;  4LNP A;  1H64 1;  1GBQ A;  1U1S A;  5FRM A;  4HCZ A;  2LP5 A;  2DLP A;  2CH4 W;  4M7A D;  2ZGW A;  4ATO A;  4DEY A;  5CR2 A;  3A98 A;  4RTX A;  4DBH A;  1TUG B;  4KBM B;  4OMQ A;  2OJ2 A;  2JZ2 A;  4XTX A;  3GPL A;  1BCM A;  1Y7X A;  2E5K A;  3DKM A;  2RH2 A;  3CBP A;  5IAY A;  3CPW S;  4M78 D;  2KXC A;  1N9R A;  1W70 A;  3E19 A;  1ZLM A;  2FG0 A;  4HT8 A;  3RR6 A;  2J6K A;  3CCV Q;  3I56 T;  1ZSZ C;  1AWX A;  2FPE A;  3TVT A;  4KRT A;  3CCV A;  3GLX A;  1MV0 B;  3V7R A;  4C92 B;  3A8H B;  2C06 A;  1QCO A;  2OTL Q;  1WPY A;  1QVG S;  3PIP A;  2P0Q A;  4FT4 A;  3OW2 S;  1PM3 A;  2F5T X;  3R6O A;  4JS5 A;  3CXC P;  1YIT Q;  1BYM A;  1RAG B;  3CCM Q;  1WI7 A;  2W0Z A;  1M27 C;  4D6W A;  2HKQ B;  1JJ2 P;  2CP7 A;  2FPF A;  3CCM A;  2O31 A;  1K0X A;  3OYI A;  5GAM e;  3CCQ A;  1K9M U;  1B34 A;  1X2Q A;  3EG9 A;  1SEM A;  1YN8 A;  5FU7 C;  3DB3 A;  1VUB A;  3FJ5 A;  4C8Q B;  1VQ7 Q;  1T0J A;  4ZN3 A;  3OYJ A;  2EGA A;  4EIK A;  3NMZ C;  1VQ7 A;  4LDW A;  1FX7 A;  4C0G A;  3M4G A;  4XTW A;  4C0D C;  5KYY B;  2CP0 A;  5IXB A;  1VYV A;  3M55 A;  2MK5 A;  1JU5 C;  5GJW B;  4BDZ A;  1QVF A;  4DBR A;  2GFA A;  2J05 A;  4X9D A;  3PFS A;  4GY5 A;  4PJO E;  1NPR A;  3HKS A;  2VC8 A;  2IIM A;  2E41 A;  3I55 Q;  2VGN A;  3NHN A;  1Q86 U;  4MML A;  4OB1 B;  3OY9 A;  2D1X A;  3I55 A;  1TWB A;  3V8K A;  2JT4 A;  4IUQ A;  1VQL A;  2IVW A;  2I2L A;  2DL3 A;  2LT1 A;  1TH7 A;  2PTK A;  3EAE A;  4J6Y A;  2RN8 A;  4WTO B;  5EC7 A;  3OA6 A;  2DL4 A;  3MCA B;  3PE0 A;  2EW3 A;  4M7A B;  2JMA A;  4FM4 B;  3S3M A;  8ATC B;  2CT3 A;  3OYL A;  4M75 E;  3HL8 A;  1UUE A;  2P84 A;  3KBG A;  2R58 A;  2QQR A;  2FZC B;  5CK9 A;  4LD6 A;  1M2O A;  4ZN1 A;  2HKN A;  4A4E A;  1TSF A;  3CXC S;  2OX7 A;  1Q81 U;  2BZX A;  3GNG A;  1K9M C;  2EYX A;  3EG3 A;  1WQW A;  4M78 B;  2P0K A;  1R0B G;  4F7U F;  1YFN A;  2ZPG B;  1JJ2 S;  4IUR A;  1R8O B;  9ATC B;  1W2B A;  3C94 A;  2LJ1 A;  1RLQ C;  5LL6 S;  1X69 A;  2FB7 A;  1M30 A;  3CC4 Q;  3VS5 A;  3CMA Q;  2YUP A;  4J9I A;  5HK0 A;  2ZPI B;  4JRI A;  3O5Z A;  4IUV A;  3CC4 A;  1FWZ A;  1RI0 A;  2PQW A;  3OYY A;  3J80 E;  4MMK A;  1WHJ A;  4BI8 B;  3QKJ A;  4V2S A;  4EPC A;  4AFQ C;  1Q86 C;  2L5Q A;  2VXE A;  1K4U S;  3PT9 A;  2DEQ A;  2NUT A;  2EQU A;  1VQP Q;  2K5L A;  1Q82 R;  2CZ1 B;  3U23 A;  2MIO A;  3M58 A;  4EMK A;  3M0S A;  1AWJ A;  1QVF P;  3MP8 A;  2KE9 A;  1JO8 A;  2BE9 B;  3M56 A;  2QGG A;  3H0H A;  1W4S A;  2ZCF B;  2BE7 D;  2DA9 A;  2K57 A;  1M2V B;  4DEX A;  1UEC A;  1K1Z A;  1AT1 B;  1VYU A;  1YJW A;  1QMC A;  2KMT A;  1AOJ A;  3UPU A;  1QLY A;  5A0D A;  3P8B B;  1YI2 Q;  3QWX X;  4L59 A;  2M51 A;  1BCO A;  2G6F X;  2L89 A;  2VVK A;  2NUP B;  3VJP A;  4ZGD B;  2QQ9 A;  2A36 A;  2RJC A;  3AT1 B;  4BY6 B;  1UB4 A;  3QPH A;  4OMF B;  3L2V A;  2DL8 A;  2XG8 D;  1P92 A;  1Q81 C;  2LDM A;  3S6W A;  3OB9 A;  3PGG A;  3J81 E;  1QCN A;  2VGM A;  3CC2 Q;  2G3R A;  1M90 R;  1YHQ T;  2LVM A;  4A54 A;  3FIF A;  1VQM A;  5KYN A;  1SRL A;  4RUG A;  3GBQ A;  4ZGJ B;  2VB6 A;  3Q1J A;  2DTI A;  4C5G A;  4ZGE B;  1YIJ T;  4JZ3 A;  3CCE A;  4ME7 A;  1WIE A;  4OMP A;  1ZSG A;  2M9U A;  1U06 A;  5LJ3 d;  4R55 A;  2V8K A;  2COZ A;  3JB9 F;  1Z9Z A;  4KUI A;  3RKX A;  3JB9 J;  1VQ4 T;  1BIA A;  3V7S A;  4OB0 B;  2LNV A;  3GNF B;  1Y96 B;  3OYF A;  3VV0 A;  2KRN A;  1W2B P;  3A8O B;  4D8K A;  2E4H A;  4M7D E;  5GAM h;  4ORZ A;  4XU0 A;  2E10 A;  3I56 Q;  2HL3 A;  1PRL C;  2DJZ A;  3N5B B;  2FEI A;  3M57 A;  2DPP B;  4KUL A;  2KAF A;  5CVI A;  2NWM A;  1ZSZ A;  2KEA A;  1X6G A;  2QEX T;  2LCC A;  2XDD A;  3EFO B;  5GAN 7;  1QVP A;  2ZPF B;  4FSX A;  1Y57 A;  2DER A;  2RK1 A;  3J7A F;  2MOX A;  4LE9 A;  2BKD N;  2R57 A;  3L42 A;  2KYB A;  3LGL A;  5GAN 2;  1Q95 G;  3EH1 A;  4C5E A;  4F04 B;  4LDY A;  4C0F A;  2LQN A;  1N6A A;  5GAN h;  4C92 G;  1MUZ A;  1G3T A;  3EFS A;  3MKD A;  2RM4 A;  3OW2 A;  3LX7 A;  4QQD A;  3REA B;  3NFC A;  4JJD A;  3CBM A;  3E1S A;  2JM8 A;  4MDW A;  2O4X B;  3M54 A;  1TU0 B;  1JRI A;  2ROL A;  3HFO A;  4IUU A;  4PJO C;  2CSQ A;  2DRM A;  1EX4 A;  2FL7 A;  3WVE B;  3TQ7 P;  3VS2 A;  3NTH A;  2AZV A;  3BE3 A;  1V29 B;  4C8Q G;  4PK4 A;  2Y90 A;  5GAO q;  3L2Q A;  1IHV A;  2MI6 A;  3MHX A;  4HVV A;  4XK8 E;  4OB3 B;  5KYU A;  1SSH A;  3OS5 A;  3CME T;  2KK4 A;  4EMH A;  1W2B S;  4XU3 A;  1M1K U;  2GQV A;  1OV3 A;  2WAC A;  2SEM A;  1QW1 A;  2E3I A;  4IIM A;  1RUW A;  2JOY A;  4M75 C;  4J9E A;  2RB6 A;  4BE1 A;  4PJJ A;  5CKB A;  4NL3 A;  2JTF A;  3VS1 A;  5LJ5 f;  2MAM A;  2CSI A;  3MP6 A;  1KFZ A;  4Y92 A;  1AVZ C;  4Y28 E;  4LN2 A;  2M16 A;  1N9S A;  2HEQ A;  3VUB A;  1OOT A;  3OS2 A;  1LNX A;  1C0M A;  4RCB A;  4GBQ A;  2LMJ A;  5GAO p;  3G4S T;  1BIB A;  3NTK A;  2QTX A;  2DET A;  5DM7 R;  3BW1 A;  1TXQ A;  4AT1 B;  1ZBJ A;  3S3O A;  3MEV A;  3PTA A;  2A08 A;  5GAN 3;  1OU8 A;  1KK7 A;  2E64 A;  5GAM f;  4HVW A;  2XDP A;  1H8K A;  2CP3 A;  4MDX A;  2MWP A;  1M3C A;  1FXX A;  2QG9 B;  4F7U E;  1OUL A;  1NZ9 A;  1XTD A;  1HD3 A;  4Z88 A;  3JCM J;  2R5M A;  2K79 A;  2MPX C;  4RMO A;  4Z02 A;  3VS7 A;  2H8H A;  3CCS T;  1H92 A;  3QII A;  2KSS A;  3OBY A;  1C6V X;  3CXC A;  4PKC C;  1XQH A;  4F7U A;  4M7A F;  3CCU T;  2E12 A;  4OB2 B;  2LZ6 B;  1NLP C;  1X2K A;  3M0Q A;  2RI3 A;  1JJ2 A;  1WA7 A;  2OTJ Q;  3FRN A;  2RHU A;  3JV3 A;  1RAC B;  5LJ3 e;  1RL2 A;  5HCK A;  1M1K C;  2OTJ A;  1YCY A;  1KD1 U;  2JN0 A;  2RPN A;  2RMO A;  4B9X A;  5GAN f;  3EGU A;  3ZFJ A;  5DLO A;  2B8A A;  4CRI A;  5J3B A;  4PFO A;  5GAM j;  1RAB B;  3GF5 A;  2K2V A;  2QDY B;  2GF7 A;  2X4J A;  5IHK A;  4HCK A;  4ELY C;  3CD6 T;  2RF0 A;  4KH0 B;  3RMQ A;  3JCM W;  2EYW A;  2RQW A;  5KYW A;  2DVE A;  4F16 A;  1YJN T;  1YHQ Q;  3AHU A;  4Z8A A;  2J06 A;  1S72 A;  1B34 B;  2L3Q A;  2Y4X A;  1RAA B;  3EG9 B;  2K3X A;  1EIF A;  2HBW A;  2DBK A;  3URG A;  3G71 T;  5GAO m;  2V8J A;  3TU4 K;  7AT1 B;  1YIJ Q;  4B6M A;  2QTV A;  2KR3 A;  4LXC A;  2EGC A;  2LX7 A;  4M7D F;  5IN1 A;  4QQ6 A;  1YIJ A;  2F1L A;  5GAN j;  5D6Y A;  3FDR A;  5HKC A;  1VQ4 Q;  1HK9 A;  3E9F A;  3A5Z B;  5CQX A;  3QSU A;  3BFM A;  2CT4 A;  4EMG A;  4M77 G;  4A53 A;  3VKI A;  4M7D C;  3SWN C;  1VQ9 T;  3FLG A;  1NYG A;  3M0U A;  1LVK A;  5I11 A;  3NPF A;  1PSF A;  1E7O A;  2J7I A;  5A2Q E;  1GCQ C;  3PIO A;  4DOV A;  1H3Z A;  3ZBD A;  1KD1 C;  2HAX A;  3OSS C;  4OML A;  4BD3 A;  1CKB A;  1QWE A;  4N4I A;  4KGV B;  1VIE A;  2OTL A;  2GTJ A;  2QEX Q;  3M0P A;  1WHL A;  4E47 A;  3LLR A;  1YIT A;  2WSC E;  4Y91 A;  1K8A U;  4PNO A;  3I5S A;  4XTZ A;  3EHR A;  1I8F A;  3HFN A;  4OMN A;  2X51 A;  4JJN K;  1KC8 U;  3OBW A;  5IHI A;  2X3W D;  4BE0 A;  2BTT A;  5CKF A;  2RI5 A;  2EJ9 A;  3EGX A;  4UC4 A;  2HQE A;  4DBQ A;  1BU1 A;  2QI2 A;  3JCM f;  1WLP B;  3OYA A;  5KCH A;  2YUQ A;  3EG2 A;  4B9W A;  4D8D A;  4QVC A;  1GCP A;  2EFI A;  2GBQ A;  2OI3 A;  3MP1 A;  2GQI A;  4HT9 A;  3INZ A;  1GL5 A;  4DA4 A;  5FW9 A;  4RKU E;  3JB9 I;  4J9D A;  3PNW C;  5KYX A;  1IGQ A;  1WQ7 A;  3UT1 A;  3CPF A;  1VQN T;  1VQK T;  2DZ9 A;  4LDV A;  2EAY A;  4KUD K;  2LJ3 A;  2PZ1 A;  3VUZ A;  5GAN 5;  3JRZ A;  2K3B A;  3QO3 A;  3UA6 A;  2EQJ A;  4PJO A;  3X24 B;  2DXC A;  4M77 D;  2L2P A;  2FZG B;  1ABO A;  2NUT B;  2AKL A;  1S1N A;  2DK3 A;  3CME Q;  1C1A A;  4JZ4 A;  3JCM X;  4C92 E;  2CZ7 B;  4A4K A;  2AKK A;  4OMM A;  4EMK B;  4LD9 K;  5LJ5 g;  3CME A;  4PLI A;  1JXM A;  2D0Q B;  2ZPB B;  1ZA1 B;  2P4T A;  4N4H A;  2P4R A;  5FU6 B;  4PLL A;  1Q7Y U;  1TG0 A;  5I2S A;  1FMK A;  5GAN 4;  2RO0 A;  1UGS B;  3RKW A;  5A0G A;  2EKO A;  1M4Z A;  1K8A C;  5GAN 6;  2LJ0 A;  4M75 A;  2J6F A;  5GMK m;  3OYB A;  2DX1 A;  1VQ5 T;  1KC8 C;  1UEB A;  4BDY A;  3I5R A;  3SFM A;  1SF9 A;  2EQK A;  2LQ8 A;  5GMK i;  2D0N A;  4C8Q E;  4ESR A;  3VYG A;  5CAI A;  3G4S Q;  1QWF A;  4IKF A;  5GAM g;  1ABQ A;  4A4F A;  2X9H A;  3KXT A;  1G5V A;  1FYN A;  5D6W A;  2MWO A;  4AFU C;  3G4S A;  2PVD B;  5LJ3 h;  3TSZ A;  2F5K A;  1YJ9 T;  1WXB A;  3VS3 A;  3UAT A;  1IXD A;  3M59 A;  3CMA A;  1JXO A;  1AWW A;  1K76 A;  3X20 B;  3CCS Q;  3CC7 T;  1OZ2 A;  2QYZ A;  2M0Y A;  1I07 A;  2VWF A;  1GXI E;  2M0O A;  4J7F A;  1GFC A;  3CCS A;  4RG2 A;  2XD0 A;  3CCU Q;  4AFZ C;  2EJF A;  3I9Q A;  3X25 B;  1EFN A;  1UJ0 A;  1NYF A;  4JUV A;  4NS5 A;  3CCJ T;  2RHZ A;  1QCF A;  1BI2 A;  3OYK A;  2GCX A;  1VQP A;  4FW1 A;  2RA2 A;  1TOV A;  3RNJ A;  3PVQ A;  4JRK A;  1Y71 A;  5GAN g;  2QA4 T;  1AZG B;  2IPO B;  2JM9 A;  4MZT A;  4M7A E;  2B86 A;  3EGD A;  1V76 A;  4LUD A;  2XIC A;  4KT0 E;  1VOM A;  2F69 A;  1OQK A;  2QAS A;  1MMD A;  3MPU B;  2GNC A;  4A63 B;  1Q7Y C;  1M1G A;  1VQO T;  3C4S A;  2CP2 A;  1ZSZ B;  4M7A A;  1X6B A;  2L0A A;  4OGE A;  2CH4 A;  1M9S A;  1D3B B;  1YI2 A;  3SD4 A;  3CD6 Q;  1ZUU A;  5GMK l;  4XTY A;  5DLQ E;  3EHQ A;  3L2W A;  3F70 A;  3TSW A;  2K3Y A;  3RBB B;  2JS2 A;  4M78 E;  1RAH B;  1SHF A;  1UE9 A;  2DVJ A;  2XDB A;  2DM1 A;  1YJN Q;  3UF4 A;  2BUD A;  4FYY B;  1VQ6 T;  1B07 A;  4M77 B;  3CC2 A;  1NLO C;  1YJN A;  1BI0 A;  1IO6 A;  4Z89 A;  2EBP A;  2YRC A;  1M5Q 1;  3MO8 A;  1RAI B;  2CP6 A;  1MMN A;  1F1B B;  2K7A A;  4OF1 A;  4FSS A;  4PFP A;  2E65 A;  5GAN 8;  2ABL A;  2DIQ A;  4ZTJ A;  2EPD A;  4OP0 A; 
#chains in the Genus database with same CATH homology
 1Q86 R;  3G71 Q;  1JJ2 P;  1W2B P;  1YHQ Q;  1K8A R;  1QVF P;  3CD6 Q;  1QVG P;  3CCS Q;  3G6E Q;  1VQK Q;  3OW2 P;  1YJW Q;  1VQM Q;  1VQN Q;  1M1K R;  2OTL Q;  3G4S Q;  3CPW P;  1YJ9 Q;  1VQ9 Q;  1VQ6 Q;  1Q7Y R;  3CCR Q;  1VQ4 Q;  1KC8 R;  1K9M R;  3I56 Q;  1VQ5 Q;  1VQO Q;  1N8R R;  3CC2 Q;  2OTJ Q;  3CCJ Q;  3CXC P;  1K73 R;  1M90 R;  1KQS P;  1YIT Q;  3CCL Q;  3CCU Q;  1YJN Q;  3CME Q;  3CC4 Q;  1VQ7 Q;  1YIJ Q;  3CMA Q;  1VQP Q;  1YI2 Q;  2QEX Q;  3CC7 Q;  1S72 Q;  1VQ8 Q;  3I55 Q;  3CCM Q;  3CCV Q;  2QA4 Q;  1Q81 R;  3CCE Q;  1Q82 R;  3CCQ Q;  1KD1 R;  1VQL Q;  1NJI R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...