3CXCP

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cxcP00
1YITQ 3G4SQ 3CCMQ 1YJWQ 1W2BP 1VQ8Q 3CC7Q 1YIJQ 1Q86R 1VQ9Q 3CCUQ 1VQ7Q 1YHQQ 1KQSP 1QVGP 1N8RR 3CCLQ 1VQOQ 2OTJQ 1KD1R 3CXCP 1Q7YR 1VQ4Q 1S72Q 3G6EQ 2QA4Q 1YJNQ 3CMEQ 1NJIR 1K8AR 2QEXQ 1M1KR 1K73R 3CPWP 3I56Q 3CCSQ 3I55Q 1VQMQ 1Q81R 1YJ9Q 1Q82R 1KC8R 1VQ5Q 3CC2Q 1VQLQ 2OTLQ 1QVFP 3CCQQ 3CC4Q 3OW2P 1VQPQ 1K9MR 1YI2Q 1VQKQ 3CMAQ 3CCRQ 1JJ2P 1VQ6Q 3CCVQ 1M90R 3CCJQ 3CCEQ 3CD6Q 3G71Q 1VQNQ
chains in the Genus database with same CATH superfamily
1TSFA 2QTXA 3A1PA 3META 1SHGA 2DXUA 4C8QC 3DLMA 3VS3A 4C0ZA 3E2UA 1B3QA 4F17A 4M75E 1SRMA 5KYXB 2QQRA 4X9DA 3OS0A 3LX7A 1VQOT 3HFNA 2XD0A 3CCRA 3M59A 2CUBA 1M90U 3VRYA 2NWMA 4F7UB 1RAFB 5GAOr 1W4SA 3QG1A 1MGQA 3QYHB 1G5VA 2DJZA 4WF2A 4KULA 2YLCA 1D3BA 2CH4A 5A0GA 2QTVA 2LQKA 4J83A 3FJ5A 4BACA 3LH5A 4NS5A 5D6YA 2QI2A 1HD3A 2DRKA 1R0CB 5IHIA 4P5NA 1QVGP 4M7AD 1X01A 3SWNB 1YJ9A 2VVKA 1U06A 4HCBA 1KC8R 1IREB 3TEEA 1M8VA 3LGLA 2J06A 3S3NA 3LWIA 2FL7A 2JTFA 3CD6Q 1PKSA 2GCXA 2LCSA 1VQNA 1UDLA 2RH2A 1YJWA 3C12A 4FL6A 1CKAA 4FW2A 1M2VA 4M78B 3OBWA 2VWFA 2ZGWA 1K1ZA 4PJOG 2D6FA 1RI9A 1BKBA 1MMNA 1TS9A 1C1AA 1PRMC 2BE9B 2K2MA 2VXEA 2FZCB 1QKXA 1U1SA 4A54A 1M2OA 4EPCA 4LUDA 4PKCC 3HRUA 2QEXT 2JMAA 3FIFA 4OF1A 1MMDA 4A53A 2CGHA 3MO8A 3LYIA 2M51A 2DM1A 3P8DA 1TUGB 4FT4A 2EFIA 2PQWA 3FLGA 4D8DA 4HVVA 3CCUT 1UB4A 2JS2A 4J5YA 4OMNA 3CCLT 3G6ET 2DL4A 1WI7A 2DYIA 2EJFA 2VB6A 1YN8A 2MK5A 2F2WA 3RDVA 4RMOA 1AT1B 1AOJA 1MMGA 3GLXA 2VYTA 1U1TA 2VKNA 3VV0A 2DFUA 5LJ5g 3R6OA 2FHDA 2HZYA 4LDYA 1XTDA 3QDRB 1VQ5A 2CSIA 2KSSA 2RB6A 1B34B 5J3BA 3JCMg 2IG0A 1IRXA 4J9FA 4X34A 4DBFA 2E3IA 1UUEA 2OI3A 3CC4A 5GJWB 2G6FX 3ULRB 1W1FA 3MCAB 2EW3A 2VXFA 4JRKA 2OTJA 4QVDA 4E47A 1ZSZB 1NYFA 3CCLQ 3TSZA 4A4KA 4JS5A 3A5ZB 1NBEB 4JJCA 3HL8A 3DLLA 3ZBDA 4KT0E 4KRTA 2IVWA 1TWBA 5GAMf 2R5AA 1OI1A 3VUBA 3G1JA 2OTLA 1K0SA 3QIIA 8AT1B 2E65A 1PHTA 4LDVA 2RJCA 2DMOA 1PC0A 1VQ8Q 2Y4XA 3N5BB 4ATOA 4F14A 2RHUA 2EGEA 4E7IA 3M0SA 5CAIA 2CZ6B 5FROA 5GAN8 5CKEA 1Q81C 1ZBXA 2LQ8A 8ATCB 3CPWP 2YRDA 3LWHA 2YHTA 1QCOA 1PKTA 3G4ST 4XTWA 3OYFA 4DOVA 1GRIA 2YLBA 1UGSB 3EGDB 1BBZA 1D1CA 2YRCA 2BIVA 1QVFA 1M3AA 2WSCE 4JDSA 2CH4W 2A7YA 5GAN4 1SKUB 1VQ9Q 1M2VB 2L3RA 4J9EA 1VQ7A 2JUFA 1JXMA 4C8QE 3HRSA 2RHXA 1M8MA 3CEYA 1QQJA 2YSQA 2J05A 3CC4Q 2XDDA 4JRPA 1S72T 3OYIA 4N0AA 2FZGB 1FYNA 5LJ5e 2VC8A 5J26A 4PJOA 2J6KA 4CC4B 4L59A 2PVOB 4NL2A 2E4HA 3M4YA 1VQ9T 2EGAA 2RQWA 2MAMA 4C92B 2K3BA 1WGSA 1VQKQ 1JJ2P 1BI3A 2DPPB 1AZGB 2BZXA 4FM4B 5CKBA 2D8HA 2HMAA 3SB2A 1A0NB 4C8QF 4JJBA 4BUGA 3CCQT 2YWWA 2AKKA 1T3LA 1VQMQ 5LJ5d 1MHNA 2H3EB 4OGCA 2NYSA 1I8FA 4QW2A 2JM9A 3THKA 4JJNK 2KYBA 2HCKA 2QDLA 4B9XA 3GP8A 5KE2A 1I4K1 2L8DA 1H8KA 1X6GA 1OEBA 3LGFA 4Y92A 1WFWA 9ATCB 3KUFA 1SSHA 3EG1A 1O9SA 5GAOn 1BU1A 1GFDA 1X6BA 1VQLA 2RHYA 3G71A 3CCQA 1PSEA 2A37A 4PLIA 2LQWA 3L2VA 1ZUYA 1FMVA 1VYTA 4GLKA 4BE2A 3QZ9B 4PJOF 1H92A 3TSWA 3UPUA 1VQ6T 3CBMA 5LJ5h 1VQNT 3QO3A 3MP1A 2PVGB 2HKQB 3A8MB 3EFRA 3OYDA 1K9MR 1KQ1A 2XDBA 2X3XD 2LP5A 3OMGA 1RAIB 1BB9A 1VQ8A 2IPOB 3M53A 1H3HA 1SSFA 2O9VA 4ZTJA 2P0KA 1YJ9T 1T0HA 4IUVA 1Q86R 3I35A 2CT4A 2RD1A 1YFNA 2O31A 1MNDA 4A4HA 3EG9A 4XQ3A 1C6VX 4FYYB 1MNEA 1R0BG 5C6SA 4KH1B 3JCMc 3A8GB 1XOVA 3HFOA 2LC4A 5I21A 1Q86U 2C0OA 1UECA 1Q95G 4ESRA 2MCNA 4C0DC 2JZ2A 4RTZA 1R8OB 3S3OA 4OMQA 1K9AA 4BI8B 1GCQC 4MMKA 1Y0MA 3PMIA 4HA8A 1YCYA 1G83A 2NLUA 2QYZA 1KIKA 3JB9F 1VQLQ 2DILA 3L2ZA 4PFZA 3DB4A 1RI0A 2HEQA 4OMFB 4J6WA 3X28B 1K9MU 3OYMA 5IH2A 1NM7A 4O5VA 3QYGB 2E5KA 2DX1A 2A0FB 3OYHA 3LH0A 2LT4A 2MWOA 4J6YA 2GTOA 2KI7A 3CMAT 2CKKA 5GANf 1AHJB 3H9NA 2K79A 4JZ3A 1QVFP 1TH7A 4BY6C 1UGVA 3NMZC 2EYZA 4M77E 5AYFA 3CD6A 4E7LA 1YP5A 2CUDA 2JTMA 3PNWC 2KBTA 4LDUA 4RG8A 2FPDA 1BYMA 1S72A 2NUTA 2K5IA 2OAUA 2DTHA 2WACA 1M4ZA 2K5FA 2DYBA 2RPNA 2K9GA 2VASA 3HHTB 4FSXA 3OYEA 1H641 1ZA2B 2XICA 1G3WA 3ZFJA 3C0CA 3PMTA 3QHSA 2QA4Q 1K8AR 3CCJT 2JJ9A 1Z9ZA 2MMPA 4FT2A 1UJ0A 2KVQG 3CCQQ 3PVQA 4RCBA 3V7CA 1G2BA 3CCJA 1YI2Q 1WIEA 3PTAA 2E6ZA 1OX8A 3L2UA 1I81A 4BE0A 4QT7A 1VQOQ 3AHUA 2K57A 1NEGA 4M77B 5LJ3f 1Q82R 3OA6A 3OYBA 1IHWA 2XHCA 1OZ2A 3OYKA 2MF2A 4JRIA 2J6FA 2DERA 2K3XA 2EGCA 3UDCA 4BB7A 2F5KA 2NUZA 3M4GA 4OMOA 2QGGA 2L0AA 3DB3A 3QBYA 3CPWA 1M5Q1 1AWXA 1Z9QA 2ZPGB 5FU6B 2WSFE 4KBMB 4JJDA 4GLMA 2DVJA 2JW4A 1V76A 5FU7B 4QQDA 1QWEA 5GMKh 1G8XA 2AZSA 2M16A 2VV5A 3JCMQ 2BTTA 5HK3A 2DIGA 2DO3A 2KGTA 3V7RA 2JTEA 2KT1A 3QWYA 3M56A 2HAXA 3E9GA 4FYXB 4GY5A 3UF4A 4RTWA 2QEXA 3VS6A 1NYGA 2DEQA 2J7IA 2V1RA 2DXCA 2DBKA 2EIFA 2ZAEA 2YUOA 3RUXA 2LDMA 2M0OA 1JRIA 3VS4A 2VGNA 4L5GA 2JXBA 2DETA 4OMMA 3CC7A 3RKYA 3GOXA 2WSEE 1WXUA 4C0FA 3RERA 4OMLA 4IUPA 3CCUA 4M78F 3CXCP 1KFZA 2L3SA 3GPLA 2YT6A 2CP3A 2LJ3A 3J81E 1QKWA 2KQWA 2GQVA 3BFMA 1UG1A 3VS0A 3G71Q 5LJ5j 1PCXA 3CC2T 2DE0X 4Q5WA 1UFFA 3FRNA 1MV0B 3SFMA 4O6JA 2L2PA 2DZ9A 4ZN1A 1JEGA 3CMEA 3ASKA 2HQXA 4ELYC 2KAFA 1AD5A 1VUBA 2E10A 3NTHA 3CCRQ 1X6OA 1P92A 2AKLA 2J6OA 3OB9A 4C92G 1ZSZC 4PFOA 4IIOA 3RIRA 2HL5C 3TREA 3PT9A 5CKDA 1G3SA 2LTOA 4AT1B 4F7UF 2X3WD 2QA4A 1VQKT 2D0QB 1WPYA 3JB9G 1VYVA 1AWWA 4D6WA 4X9CA 2LNVA 1LVKA 2PU9B 4LD6A 1VQPA 2DXTA 1I5LA 2MWPA 1TUCA 4M75B 4DEYA 3QXEB 4N4GA 2A28A 2DF6A 3CCUQ 3MEUA 1Q82U 5L8RE 3G7ZA 3CC7T 1QWFA 5M9OA 5CKFA 1UJYA 1MMAA 3UA7A 2V8KA 1FX7A 2HSEB 2A08A 3VS7A 5I2MA 1LOJA 2ROLA 1YJWQ 3G4SQ 1T3SA 2FZKB 2EQUA 3CCLA 2ZPBB 5KYXA 2HNIA 2M1HA 3MJXA 1QP2A 1W2BS 4N0AC 5A2QE 3SEMA 2DEUA 3JCMh 3QUIA 1WHGA 3SDZA 3CCMT 1WZOA 2OTLQ 4HT9A 1TU0B 5AT1B 4RCCA 4MMLA 2DKGA 2RQTA 3HTRA 3CCMA 2RO0A 1WXTA 1ABQA 4XTUA 1WJQA 1RAHB 2Z0WA 4EMHA 1BIBA 1BCMA 4PJLA 3WXMB 3FC3A 2B86A 1N8RC 4E2FB 1D0YA 1KJWA 2F2XA 1YJWT 2EQMA 1PM3A 4HCKA 1B34A 2I0NA 1PSFA 4C92C 1K0XA 3BE3A 5LJ3j 2Y90A 4IURA 4IUTA 3S3MA 5GMKl 5KCOA 3NTKA 2XMFA 3EFOB 4FYWB 5HK0A 4LDXA 1KG1A 1SHFA 4JLGA 5GAOq 1ZLMA 3ME9A 1T0JA 1Y07A 3OSVA 1RLPC 3PVLA 4QVZA 1D1AA 4DEXA 3RR6A 2RNAA 1SRLA 4F7UE 4OVAA 4MZMA 3QZ5B 4A4GA 3G4SA 3I56T 4OMPA 3HSBA 3OBYA 1Q86C 2P0QA 2X4JA 3OW2A 1KHCA 2ESWA 2ZPIB 3MP8A 1UGPB 3UATA 3M58A 2KT8A 4ZN3A 1KD1C 3HP9A 1ZX6A 4QQGA 2CP6A 4F16A 3CCSQ 2PTKA 2CT3A 2COZA 5GAMg 3EHQA 1UGRB 3EH1A 5GMKi 3BDUA 5CR2A 1F1BB 1MUZA 2JM8A 2O9SA 5CQYA 1OOTA 4KUIA 1Q7YR 4PJMA 1ZQ1A 2ROTA 1O75A 1W70A 4M7AE 1U8RA 1Y96A 2M02A 1ZSZA 3FEOA 5KYUA 1CSKA 3KXTA 1D1BA 4J7FA 5EC7A 1BI1A 5LJ3e 4HVWA 1IB8A 2DL8A 4EMGA 2V1QA 4PJOB 1KQSP 5CQXA 2DVEA 2FRWA 5CIUA 5GAOm 3QJ6A 3RMQA 1GFCA 1PWTA 4ZGJB 3PIPA 2CZ7B 2HL3A 4FU6A 2A36A 3H0IA 2C0IA 4PJOE 1J3TA 3T9NA 1BI2A 2BZ8A 2ZCFB 4A4FA 2ED0A 2E64A 2YUNA 2V26A 1UTIA 1X69A 2RJFA 5KH6A 2F1LA 4CC3A 3EH2A 1YI2T 3CPWS 3J7AF 4E7ZA 2CREA 1WHMA 1D0ZA 4JRQA 3VRZA 1ZBJA 1GXIE 5FWBA 2BKDN 3MKDA 4M77G 4NOYA 5CCAA 4AFZC 1X27A 4L6V5 1W2BA 4XU1A 1CKBA 4E7HA 1OULA 1NPPA 3R6NA 2OTJQ 2LJ0A 3RBBB 4JLIA 4M75C 2RHIA 4HKEA 5EG2A 4XTVA 2ENMA 2MYSA 2W10A 3OYCA 4C5GA 3JCMX 2VGMA 1YNZA 2B8AA 4J6XA 4M7AG 2XG8D 4DBQA 3CMAQ 2LCCA 2KE9A 2AZVA 2EQKA 3H6ZA 4AFQC 1E7OA 2OTLT 3REBB 1D09B 5ECAA 3X24B 2EQIA 2R5MA 2KYMA 4BY6B 3RKXA 4C8QG 1XNIA 1QP3A 4J9IA 1KQSS 2CP2A 4M78E 5KYWB 5LL6S 2D0NA 2OTJT 2KMTA 2SEMA 4DOWA 4M4ZA 1WYXA 3CXCS 1QVGS 2LNHB 1U5SA 1E6GA 5FRNA 2QK0A 5GAMd 3SHWA 4BI3A 1IGUA 1SPKA 5C0MA 3LLRA 4Z89A 1VQ5Q 5KYUB 3L1AA 2DBMA 3HRTA 3JSCA 3M0TA 3WVDB 2BE7D 3OW2P 5HKCA 4R55A 4M75D 1YBYA 2RK2A 2OJ2A 2P4TA 2GF7A 5CO7A 1QVFS 4M7DF 3TCJA 4RTVA 2X4WA 5KYNA 1KD1R 3CCVT 1QCNA 2EYQA 3F70A 2RHZA 2K6DA 2EYYA 1AVZC 1VQ8T 2HDAA 2LX7A 4J9BA 2DJQA 1RADB 4PL6A 2YXYA 3JRZA 4JS4A 1NLPC 2R57A 1AZEA 4EDUA 3OYJA 2DIQA 1LPLA 3A8LB 1YJNA 4LD9K 1U3OA 4XTXA 2V8JA 3I55A 1QCFA 1NE8A 2GFAA 4GBQA 4BD3A 1EZZB 1EFNA 3QSUA 1GL5A 3CCEQ 4DA4A 2DXBA 4II1A 4LN2A 3PGGA 1YIJQ 3RNJA 2FB7A 2OX7A 2ZZDA 2GTJA 1VQ4A 2RQUA 4C0DB 1M1KU 2K7AA 4Z88A 1WJSA 1XQHA 2KRMA 4J9HA 1FMWA 1UHCA 3E1SA 2MI6A 1EIFA 3CPFA 4UC4A 2KY9A 2A3LA 2PUKB 3LW5E 2DL5A 1HYOA 1WJRA 4M7AB 3FB9A 4KGVB 1VA7A 1M27C 1JQQA 1S72Q 2JT4A 2RK1A 4HCZA 3H0HA 1NZ9A 1X75C 2CSQA 4IUQA 1RABB 3X25B 1YJNT 2RI3A 3CCMQ 2DZCA 3I55T 2K5LA 1UEBA 1GBQA 1WHKA 2RF0A 4PK4A 3G71T 2QEXQ 3CBOA 4OP0A 2KK4A 5FW9A 1Y71A 1TOVA 3INZA 2L5QA 4AFSC 4LE9A 2NUTB 2X51A 2KXDA 2FYKA 2SRCA 2HQEA 4M7AC 1YHQA 2YUPA 4C92E 4C92D 2P4RA 3VJPA 2EJ9A 3CXCA 5KYYB 1WQWA 3RESA 4KUDK 2QXFA 1X2KA 3BDLA 2QQSA 3WVEB 1VQNQ 5IHKA 1TG0A 3D7SB 4C5IA 1PD1A 5FU7C 5FWCA 1K73C 3CMEQ 3JAME 4M7AF 3P8HA 5I22A 1ZUKA 3JCMV 1KSWA 1Y57A 4EMKA 2FEIA 1UGQB 1VQ7T 4ME7A 4CRIA 3SWNA 1IZ6A 2ZPFB 2MOXA 2I2LA 4M75F 4OB1B 1W2BP 1RAEB 4PFPA 1WQ7A 2HBPA 1N9RA 2EPDA 1Q81U 2O2OA 4V2SA 2C0TA 1K8AC 1KD1U 2X4YA 4MDXA 3ER0A 1SF9A 2EYXA 2LX9A 3EAEA 2XKOC 3CMET 1WHHA 1Y7XA 4C8QD 3CMAA 1YIJA 1N8RU 5GAN5 1K76A 5GMKj 3PIOA 1VQ7Q 1YHQQ 1JJ2S 3CD6T 2BUDA 5HY6A 2GQIA 3RKWA 5GAOp 3TQ7P 2JN0A 2RM4A 2KROA 1Q82C 3URGA 1FXXA 2EQJA 1KQ2A 1S1NA 5GAMj 4M7DG 4M78A 2ECZA 4NL3A 1WDXA 5HCKA 2E41A 3JB9I 4LUEA 1VQLT 1C0MA 3CC4T 1JU5C 4J9GA 4F7UA 2KDSA 2XDPA 1AEYA 4E6RA 3EGXA 5A0DA 2ZPHB 3OY9A 1ACMB 5FRMA 1Q81R 3VUZA 1ZHIA 1QW1A 3GNFB 3JCMe 2LJ1A 5GANj 5DLOA 4KGZB 1FMKA 1D3BB 4FCYA 1B7TA 3GF5A 4M75A 4M7DC 1M1FA 2LCLA 4M77C 5IXBA 4AG2C 5KCHA 1I1JA 4F04B 4C5EA 1UE9A 2JMCA 1JXOA 4XTYA 4R56A 1KQSA 1UHFA 1E6HA 3TU4K 2KR3A 3G6EA 1KHIA 2CS7A 2LT1A 1KK7A 1ZSGA 3OYGA 2P84A 1VQ9A 1G3TA 4M78D 4PJNA 4BDYA 4C92F 2LZ6B 3CQTA 3I56A 4MDWA 4RTUA 4F7UG 1K73R 4RUGA 4PJOD 1HXDA 3I55Q 4OGEA 4XAXB 3C4SA 2ABLA 4C8QB 3TVTA 2LMJA 3FJPA 1RAGB 2JOYA 3JCMb 2COYA 2FVUA 3CCJQ 5LJ3d 5GAN7 4B6MA 3H41A 1HK9A 3EGUA 5D7UA 2QASA 3QKJA 4PLLA 2DL7A 3JB9D 4WCIA 1N6AA 1YJ9Q 3L2RA 1BK2A 3M54A 4RTYA 1Q7YU 3E19A 5DLQE 2XIDA 4ZGEB 5DM7R 4DQ2A 4ZTFA 5GMKm 4EMKC 3JCMf 2NUPB 2QQBA 3PE0A 1GBRA 4X1VA 3SWNC 1VQMA 1AWJA 2HBWA 3C94A 2AT1B 2ED1A 1ZA1B 2DD4A 3MP6A 1VQ6A 5D6XA 1V1CA 3VYHB 5J39A 1VQ4T 4QQ6A 4J9CA 4IUUA 2EKHA 4C92A 2CP0A 6AT1B 2DTOA 1OPLA 1OU9A 3A98A 3UT1A 3PFSA 3EGXB 3QJYA 2GBQA 3UWNA 5GMKe 4KGXB 3DKMA 1ARKA 2CZ0B 2FG0A 4OB0B 2GNCA 2AK5A 1K9MC 4RKUE 4J8OA 2GFUA 2CP5A 4EIKA 4E7KA 2RJDA 1YWPA 3U23A 2PVDB 3MHXA 1VYUA 4YTLA 1K8AU 2HKNA 1WLPB 3OYYA 4QVCA 1VQ4Q 5KE3A 3X26B 3EFOA 2QDYB 4ANJA 3A8OB 4LNPA 5GANe 3QWXX 4CI0C 2L89A 2F5TX 3L2WA 3VU3C 4R0KA 2AHJB 4JPBW 1OQKA 3CCVA 4M75G 2LQNA 1NLOC 3EGDA 3BY7A 4HCCA 4D8KA 4XU0A 1JB0E 1VQMT 1RUWA 3NGPA 1VIFA 4E7JA 3OS1A 3M55A 3G6EQ 1KC8U 4Z02A 2O4XB 4IIMA 3CC2Q 4C8QA 1H3ZA 3V8KA 2FPEA 2HQHA 3VYGA 4BDZA 1PNJA 1G3YA 5GANh 5IT9E 4JUVA 2QA4T 1VQKA 1YCSB 3CCST 1JJ2A 3HKSA 1M3BA 1BCOA 2G3RA 5CKHA 4BE1A 3H8ZA 4FYVB 4RTTA 1M1KR 3JCMJ 2XI9A 3KBGA 4XU2A 1YI2A 4CC2A 4C0GA 5I11A 1ABOA 4N4IA 1RLQC 2M9UA 3Q1JA 2QG9B 1Y96B 2DL3A 1GCPA 1YITQ 1IGQA 3O8VA 2IIMA 1VQOA 3L42A 2EYWA 1WNLA 2EWNA 2NUPA 2O01E 2CYZB 3MEVA 4Y91A 1FWZA 4ZNXA 1TTHB 2JNGA 2RI5A 1M3CA 3V8LA 2QAZA 2RI2A 3OYAA 1N27A 2JS0A 3IQLA 2E6NA 3FDRA 1XJWB 1LNXA 1VQ5T 2KRNA 1WHJA 4KH0B 7AT1B 3M9QA 2DLPA 3ZEHA 2E1HA 3CCET 3BW1A 3QPHA 1WXBA 2LRQA 1I0CA 1IO6A 4Z8AA 1Q7YC 5GAN3 1YITT 4LDWA 3VS5A 5GAMh 4WTOB 1RACB 1X43A 2D8JA 4J7IA 4BI4A 2KNBB 4LXCA 5LJ5f 2X9HA 4M77F 4OB3B 1MV3A 1WHLA 3ZL7C 1YWOA 2RJEA 2PNIA 2E12A 2RN8A 2MPXC 4FW1A 4A4EA 1M1KC 1B07A 4JZ4A 3RMSA 3JB9H 1OYXA 2F2VA 1BIAA 5GJVB 2W0ZA 1WX6A 3CCEA 3V7SA 2EVRA 2EBPA 5L23A 3VS2A 3JB9J 1GCQA 1QMCA 2ZPEB 3EG3A 1HJDA 5LJ3g 1BI0A 2DD5A 3I5SA 3M0QA 4XK8E 1M1GA 1NEBA 4ORZA 5IAYA 1NJIR 1X2QA 4MZTA 2O4XA 3I56Q 1JBMA 3EG9B 3E9FA 1YIJT 4TVRA 2E70A 2E5QA 2DRMA 2L3QA 5I2SA 5GANg 4A63B 2D1XA 5FLXE 1M9SA 3VKIA 2M0YA 4MZPA 1IHVA 4XU3A 3VS1A 2KEAA 1NJIU 5LJ3h 5GAMe 3OYNA 3CCRT 2H3JA 4RTXA 2HD0A 4M7DA 4AFUC 3CCSA 1SG5A 2K3YA 3CBPA 2KXCA 3C95A 1M90R 3H0FA 4RG2A 1R77A 1WA7A 2CDTA 2COWA 3NHNA 4J9DA 3MEAA 2D9TA 2LVMA 1AWOA 5KYWA 4OB2B 3NTIA 1EX4A 1N9SA 1PRLC 2QQ9A 2Y4YA 1RAAB 3UA6A 4B9WA 2RA2A 3OQ5A 2BZYA 3HPWA 4FIBA 2XU8A 1VQ6Q 3NPFA 3OYLA 3CC7Q 5CVIA 4QKUA 3MEWA 4HXJA 3A8HB 3GIBA 1RL2A 1PG5B 4XTZA 1M30A 1NJIC 2E3HA 5FU6C 2L3PA 1W6XA 1D0XA 1TUDA 2K4YA 1ZUUA 1NPRA 3OS2A 1KC8C 2DA9A 1I5OB 2K2VA 3I5RA 3O5ZA 2YUQA 4AG1C 4PNOA 3EG2A 3M5AA 3I9QA 2YDLA 4DBRA 1LJOA 1DJ7B 1TXQA 1VQPT 4M78C 4E7SA 3M0UA 1I07A 5IHNA 2EKOA 4ELZC 3V8JA 2KRSA 1VIEA 1QVGA 4PJOC 5GAOl 1YHQT 2AIRB 2XK0A 1QLYA 1JO8A 3JCMP 2HSPA 1M90C 2O88A 3NFCA 2P0PA 3S6WA 3EG0A 3J80E 2F69A 2RQVA 3OSSC 5IN1A 3EFSA 5GAN6 3SD4A 2PZ1A 4PJJA 2PUOB 2C06A 2ATCB 1N8RR 4M77D 4FSSA 4Y28E 5GAN2 3KFVA 4M7DD 3OMCA 3M57A 1LCKA 4M77A 2H8HA 3OW2S 4CC7A 5IXFA 1K73U 3P8BB 3CC2A 1VQPQ 2CZ1B 3REAB 2X35A 1PD0A 3GBQA 5CK9A 1V29B 3MPUB 2CP7A 2QQAA 4M78G 3JCMW 5GANd 2DNUA 2RMOA 1QVPA 2V8IA 5D6WA 3QDFA 2YRVA 1YJNQ 5DY9A 4M7AA 4M7DB 1IXDA 4EMKB 2MIOA 2DTIA 2RQRA 3L2QA 2FPFA 2OAWA 2FRYA 1OPKA 4DBHA 2EAYA 2DK3A 3GNGA 3JV3A 3JCMd 1NG2A 1SEMA 2DAQA 4VUBA 1HSQA 1YITA 2R58A 2VUBA 1OU8A 4K11A 2EJGA 3OS5A 4N4HA 3AT1B 3X20B 4HT8A 1N5ZA 3EHRA 4AMCA 4IKFA 1K4US 4HVUA 4C5HA 1OZ3A 4ZGDB 2JVVA 1OV3A 2QGFB 5A0LA 2GGRA 3M0PA 3M0RA 3CCVQ 4M7DE 1VOMA 2X4XA 2FO0A 1OX9A 5KYYA
chains in the Genus database with same CATH topology
1YITQ 3G4SQ 3CCMQ 1YJWQ 1W2BP 1VQ8Q 3CC7Q 1YIJQ 1Q86R 1VQ9Q 3CCUQ 1VQ7Q 1YHQQ 1KQSP 1QVGP 1N8RR 3CCLQ 1VQOQ 2OTJQ 1KD1R 3CXCP 1Q7YR 1VQ4Q 1S72Q 3G6EQ 2QA4Q 1YJNQ 3CMEQ 1NJIR 1K8AR 2QEXQ 1M1KR 1K73R 3CPWP 3I56Q 3CCSQ 3I55Q 1VQMQ 1Q81R 1YJ9Q 1Q82R 1KC8R 1VQ5Q 3CC2Q 1VQLQ 2OTLQ 1QVFP 3CCQQ 3CC4Q 3OW2P 1VQPQ 1K9MR 1YI2Q 1VQKQ 3CMAQ 3CCRQ 1JJ2P 1VQ6Q 3CCVQ 1M90R 3CCJQ 3CCEQ 3CD6Q 3G71Q 1VQNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT Q;  3G4S Q;  3CCM Q;  1YJW Q;  1W2B P;  1VQ8 Q;  3CC7 Q;  1YIJ Q;  1Q86 R;  1VQ9 Q;  3CCU Q;  1VQ7 Q;  1YHQ Q;  1KQS P;  1QVG P;  1N8R R;  3CCL Q;  1VQO Q;  2OTJ Q;  1KD1 R;  3CXC P;  1Q7Y R;  1VQ4 Q;  1S72 Q;  3G6E Q;  2QA4 Q;  1YJN Q;  3CME Q;  1NJI R;  1K8A R;  2QEX Q;  1M1K R;  1K73 R;  3CPW P;  3I56 Q;  3CCS Q;  3I55 Q;  1VQM Q;  1Q81 R;  1YJ9 Q;  1Q82 R;  1KC8 R;  1VQ5 Q;  3CC2 Q;  1VQL Q;  2OTL Q;  1QVF P;  3CCQ Q;  3CC4 Q;  3OW2 P;  1VQP Q;  1K9M R;  1YI2 Q;  1VQK Q;  3CMA Q;  3CCR Q;  1JJ2 P;  1VQ6 Q;  3CCV Q;  1M90 R;  3CCJ Q;  3CCE Q;  3CD6 Q;  3G71 Q;  1VQN Q; 
#chains in the Genus database with same CATH topology
 1TSF A;  2QTX A;  3A1P A;  3MET A;  1SHG A;  2DXU A;  4C8Q C;  3DLM A;  3VS3 A;  4C0Z A;  3E2U A;  1B3Q A;  4F17 A;  4M75 E;  1SRM A;  5KYX B;  2QQR A;  4X9D A;  3OS0 A;  3LX7 A;  1VQO T;  3HFN A;  2XD0 A;  3CCR A;  3M59 A;  2CUB A;  1M90 U;  3VRY A;  2NWM A;  4F7U B;  1RAF B;  5GAO r;  1W4S A;  3QG1 A;  1MGQ A;  3QYH B;  1G5V A;  2DJZ A;  4WF2 A;  4KUL A;  2YLC A;  1D3B A;  2CH4 A;  5A0G A;  2QTV A;  2LQK A;  4J83 A;  3FJ5 A;  4BAC A;  3LH5 A;  4NS5 A;  5D6Y A;  2QI2 A;  1HD3 A;  2DRK A;  1R0C B;  5IHI A;  4P5N A;  1QVG P;  4M7A D;  1X01 A;  3SWN B;  1YJ9 A;  2VVK A;  1U06 A;  4HCB A;  1KC8 R;  1IRE B;  3TEE A;  1M8V A;  3LGL A;  2J06 A;  3S3N A;  3LWI A;  2FL7 A;  2JTF A;  3CD6 Q;  1PKS A;  2GCX A;  2LCS A;  1VQN A;  1UDL A;  2RH2 A;  1YJW A;  3C12 A;  4FL6 A;  1CKA A;  4FW2 A;  1M2V A;  4M78 B;  3OBW A;  2VWF A;  2ZGW A;  1K1Z A;  4PJO G;  2D6F A;  1RI9 A;  1BKB A;  1MMN A;  1TS9 A;  1C1A A;  1PRM C;  2BE9 B;  2K2M A;  2VXE A;  2FZC B;  1QKX A;  1U1S A;  4A54 A;  1M2O A;  4EPC A;  4LUD A;  4PKC C;  3HRU A;  2QEX T;  2JMA A;  3FIF A;  4OF1 A;  1MMD A;  4A53 A;  2CGH A;  3MO8 A;  3LYI A;  2M51 A;  2DM1 A;  3P8D A;  1TUG B;  4FT4 A;  2EFI A;  2PQW A;  3FLG A;  4D8D A;  4HVV A;  3CCU T;  1UB4 A;  2JS2 A;  4J5Y A;  4OMN A;  3CCL T;  3G6E T;  2DL4 A;  1WI7 A;  2DYI A;  2EJF A;  2VB6 A;  1YN8 A;  2MK5 A;  2F2W A;  3RDV A;  4RMO A;  1AT1 B;  1AOJ A;  1MMG A;  3GLX A;  2VYT A;  1U1T A;  2VKN A;  3VV0 A;  2DFU A;  5LJ5 g;  3R6O A;  2FHD A;  2HZY A;  4LDY A;  1XTD A;  3QDR B;  1VQ5 A;  2CSI A;  2KSS A;  2RB6 A;  1B34 B;  5J3B A;  3JCM g;  2IG0 A;  1IRX A;  4J9F A;  4X34 A;  4DBF A;  2E3I A;  1UUE A;  2OI3 A;  3CC4 A;  5GJW B;  2G6F X;  3ULR B;  1W1F A;  3MCA B;  2EW3 A;  2VXF A;  4JRK A;  2OTJ A;  4QVD A;  4E47 A;  1ZSZ B;  1NYF A;  3CCL Q;  3TSZ A;  4A4K A;  4JS5 A;  3A5Z B;  1NBE B;  4JJC A;  3HL8 A;  3DLL A;  3ZBD A;  4KT0 E;  4KRT A;  2IVW A;  1TWB A;  5GAM f;  2R5A A;  1OI1 A;  3VUB A;  3G1J A;  2OTL A;  1K0S A;  3QII A;  8AT1 B;  2E65 A;  1PHT A;  4LDV A;  2RJC A;  2DMO A;  1PC0 A;  1VQ8 Q;  2Y4X A;  3N5B B;  4ATO A;  4F14 A;  2RHU A;  2EGE A;  4E7I A;  3M0S A;  5CAI A;  2CZ6 B;  5FRO A;  5GAN 8;  5CKE A;  1Q81 C;  1ZBX A;  2LQ8 A;  8ATC B;  3CPW P;  2YRD A;  3LWH A;  2YHT A;  1QCO A;  1PKT A;  3G4S T;  4XTW A;  3OYF A;  4DOV A;  1GRI A;  2YLB A;  1UGS B;  3EGD B;  1BBZ A;  1D1C A;  2YRC A;  2BIV A;  1QVF A;  1M3A A;  2WSC E;  4JDS A;  2CH4 W;  2A7Y A;  5GAN 4;  1SKU B;  1VQ9 Q;  1M2V B;  2L3R A;  4J9E A;  1VQ7 A;  2JUF A;  1JXM A;  4C8Q E;  3HRS A;  2RHX A;  1M8M A;  3CEY A;  1QQJ A;  2YSQ A;  2J05 A;  3CC4 Q;  2XDD A;  4JRP A;  1S72 T;  3OYI A;  4N0A A;  2FZG B;  1FYN A;  5LJ5 e;  2VC8 A;  5J26 A;  4PJO A;  2J6K A;  4CC4 B;  4L59 A;  2PVO B;  4NL2 A;  2E4H A;  3M4Y A;  1VQ9 T;  2EGA A;  2RQW A;  2MAM A;  4C92 B;  2K3B A;  1WGS A;  1VQK Q;  1JJ2 P;  1BI3 A;  2DPP B;  1AZG B;  2BZX A;  4FM4 B;  5CKB A;  2D8H A;  2HMA A;  3SB2 A;  1A0N B;  4C8Q F;  4JJB A;  4BUG A;  3CCQ T;  2YWW A;  2AKK A;  1T3L A;  1VQM Q;  5LJ5 d;  1MHN A;  2H3E B;  4OGC A;  2NYS A;  1I8F A;  4QW2 A;  2JM9 A;  3THK A;  4JJN K;  2KYB A;  2HCK A;  2QDL A;  4B9X A;  3GP8 A;  5KE2 A;  1I4K 1;  2L8D A;  1H8K A;  1X6G A;  1OEB A;  3LGF A;  4Y92 A;  1WFW A;  9ATC B;  3KUF A;  1SSH A;  3EG1 A;  1O9S A;  5GAO n;  1BU1 A;  1GFD A;  1X6B A;  1VQL A;  2RHY A;  3G71 A;  3CCQ A;  1PSE A;  2A37 A;  4PLI A;  2LQW A;  3L2V A;  1ZUY A;  1FMV A;  1VYT A;  4GLK A;  4BE2 A;  3QZ9 B;  4PJO F;  1H92 A;  3TSW A;  3UPU A;  1VQ6 T;  3CBM A;  5LJ5 h;  1VQN T;  3QO3 A;  3MP1 A;  2PVG B;  2HKQ B;  3A8M B;  3EFR A;  3OYD A;  1K9M R;  1KQ1 A;  2XDB A;  2X3X D;  2LP5 A;  3OMG A;  1RAI B;  1BB9 A;  1VQ8 A;  2IPO B;  3M53 A;  1H3H A;  1SSF A;  2O9V A;  4ZTJ A;  2P0K A;  1YJ9 T;  1T0H A;  4IUV A;  1Q86 R;  3I35 A;  2CT4 A;  2RD1 A;  1YFN A;  2O31 A;  1MND A;  4A4H A;  3EG9 A;  4XQ3 A;  1C6V X;  4FYY B;  1MNE A;  1R0B G;  5C6S A;  4KH1 B;  3JCM c;  3A8G B;  1XOV A;  3HFO A;  2LC4 A;  5I21 A;  1Q86 U;  2C0O A;  1UEC A;  1Q95 G;  4ESR A;  2MCN A;  4C0D C;  2JZ2 A;  4RTZ A;  1R8O B;  3S3O A;  4OMQ A;  1K9A A;  4BI8 B;  1GCQ C;  4MMK A;  1Y0M A;  3PMI A;  4HA8 A;  1YCY A;  1G83 A;  2NLU A;  2QYZ A;  1KIK A;  3JB9 F;  1VQL Q;  2DIL A;  3L2Z A;  4PFZ A;  3DB4 A;  1RI0 A;  2HEQ A;  4OMF B;  4J6W A;  3X28 B;  1K9M U;  3OYM A;  5IH2 A;  1NM7 A;  4O5V A;  3QYG B;  2E5K A;  2DX1 A;  2A0F B;  3OYH A;  3LH0 A;  2LT4 A;  2MWO A;  4J6Y A;  2GTO A;  2KI7 A;  3CMA T;  2CKK A;  5GAN f;  1AHJ B;  3H9N A;  2K79 A;  4JZ3 A;  1QVF P;  1TH7 A;  4BY6 C;  1UGV A;  3NMZ C;  2EYZ A;  4M77 E;  5AYF A;  3CD6 A;  4E7L A;  1YP5 A;  2CUD A;  2JTM A;  3PNW C;  2KBT A;  4LDU A;  4RG8 A;  2FPD A;  1BYM A;  1S72 A;  2NUT A;  2K5I A;  2OAU A;  2DTH A;  2WAC A;  1M4Z A;  2K5F A;  2DYB A;  2RPN A;  2K9G A;  2VAS A;  3HHT B;  4FSX A;  3OYE A;  1H64 1;  1ZA2 B;  2XIC A;  1G3W A;  3ZFJ A;  3C0C A;  3PMT A;  3QHS A;  2QA4 Q;  1K8A R;  3CCJ T;  2JJ9 A;  1Z9Z A;  2MMP A;  4FT2 A;  1UJ0 A;  2KVQ G;  3CCQ Q;  3PVQ A;  4RCB A;  3V7C A;  1G2B A;  3CCJ A;  1YI2 Q;  1WIE A;  3PTA A;  2E6Z A;  1OX8 A;  3L2U A;  1I81 A;  4BE0 A;  4QT7 A;  1VQO Q;  3AHU A;  2K57 A;  1NEG A;  4M77 B;  5LJ3 f;  1Q82 R;  3OA6 A;  3OYB A;  1IHW A;  2XHC A;  1OZ2 A;  3OYK A;  2MF2 A;  4JRI A;  2J6F A;  2DER A;  2K3X A;  2EGC A;  3UDC A;  4BB7 A;  2F5K A;  2NUZ A;  3M4G A;  4OMO A;  2QGG A;  2L0A A;  3DB3 A;  3QBY A;  3CPW A;  1M5Q 1;  1AWX A;  1Z9Q A;  2ZPG B;  5FU6 B;  2WSF E;  4KBM B;  4JJD A;  4GLM A;  2DVJ A;  2JW4 A;  1V76 A;  5FU7 B;  4QQD A;  1QWE A;  5GMK h;  1G8X A;  2AZS A;  2M16 A;  2VV5 A;  3JCM Q;  2BTT A;  5HK3 A;  2DIG A;  2DO3 A;  2KGT A;  3V7R A;  2JTE A;  2KT1 A;  3QWY A;  3M56 A;  2HAX A;  3E9G A;  4FYX B;  4GY5 A;  3UF4 A;  4RTW A;  2QEX A;  3VS6 A;  1NYG A;  2DEQ A;  2J7I A;  2V1R A;  2DXC A;  2DBK A;  2EIF A;  2ZAE A;  2YUO A;  3RUX A;  2LDM A;  2M0O A;  1JRI A;  3VS4 A;  2VGN A;  4L5G A;  2JXB A;  2DET A;  4OMM A;  3CC7 A;  3RKY A;  3GOX A;  2WSE E;  1WXU A;  4C0F A;  3RER A;  4OML A;  4IUP A;  3CCU A;  4M78 F;  3CXC P;  1KFZ A;  2L3S A;  3GPL A;  2YT6 A;  2CP3 A;  2LJ3 A;  3J81 E;  1QKW A;  2KQW A;  2GQV A;  3BFM A;  1UG1 A;  3VS0 A;  3G71 Q;  5LJ5 j;  1PCX A;  3CC2 T;  2DE0 X;  4Q5W A;  1UFF A;  3FRN A;  1MV0 B;  3SFM A;  4O6J A;  2L2P A;  2DZ9 A;  4ZN1 A;  1JEG A;  3CME A;  3ASK A;  2HQX A;  4ELY C;  2KAF A;  1AD5 A;  1VUB A;  2E10 A;  3NTH A;  3CCR Q;  1X6O A;  1P92 A;  2AKL A;  2J6O A;  3OB9 A;  4C92 G;  1ZSZ C;  4PFO A;  4IIO A;  3RIR A;  2HL5 C;  3TRE A;  3PT9 A;  5CKD A;  1G3S A;  2LTO A;  4AT1 B;  4F7U F;  2X3W D;  2QA4 A;  1VQK T;  2D0Q B;  1WPY A;  3JB9 G;  1VYV A;  1AWW A;  4D6W A;  4X9C A;  2LNV A;  1LVK A;  2PU9 B;  4LD6 A;  1VQP A;  2DXT A;  1I5L A;  2MWP A;  1TUC A;  4M75 B;  4DEY A;  3QXE B;  4N4G A;  2A28 A;  2DF6 A;  3CCU Q;  3MEU A;  1Q82 U;  5L8R E;  3G7Z A;  3CC7 T;  1QWF A;  5M9O A;  5CKF A;  1UJY A;  1MMA A;  3UA7 A;  2V8K A;  1FX7 A;  2HSE B;  2A08 A;  3VS7 A;  5I2M A;  1LOJ A;  2ROL A;  1YJW Q;  3G4S Q;  1T3S A;  2FZK B;  2EQU A;  3CCL A;  2ZPB B;  5KYX A;  2HNI A;  2M1H A;  3MJX A;  1QP2 A;  1W2B S;  4N0A C;  5A2Q E;  3SEM A;  2DEU A;  3JCM h;  3QUI A;  1WHG A;  3SDZ A;  3CCM T;  1WZO A;  2OTL Q;  4HT9 A;  1TU0 B;  5AT1 B;  4RCC A;  4MML A;  2DKG A;  2RQT A;  3HTR A;  3CCM A;  2RO0 A;  1WXT A;  1ABQ A;  4XTU A;  1WJQ A;  1RAH B;  2Z0W A;  4EMH A;  1BIB A;  1BCM A;  4PJL A;  3WXM B;  3FC3 A;  2B86 A;  1N8R C;  4E2F B;  1D0Y A;  1KJW A;  2F2X A;  1YJW T;  2EQM A;  1PM3 A;  4HCK A;  1B34 A;  2I0N A;  1PSF A;  4C92 C;  1K0X A;  3BE3 A;  5LJ3 j;  2Y90 A;  4IUR A;  4IUT A;  3S3M A;  5GMK l;  5KCO A;  3NTK A;  2XMF A;  3EFO B;  4FYW B;  5HK0 A;  4LDX A;  1KG1 A;  1SHF A;  4JLG A;  5GAO q;  1ZLM A;  3ME9 A;  1T0J A;  1Y07 A;  3OSV A;  1RLP C;  3PVL A;  4QVZ A;  1D1A A;  4DEX A;  3RR6 A;  2RNA A;  1SRL A;  4F7U E;  4OVA A;  4MZM A;  3QZ5 B;  4A4G A;  3G4S A;  3I56 T;  4OMP A;  3HSB A;  3OBY A;  1Q86 C;  2P0Q A;  2X4J A;  3OW2 A;  1KHC A;  2ESW A;  2ZPI B;  3MP8 A;  1UGP B;  3UAT A;  3M58 A;  2KT8 A;  4ZN3 A;  1KD1 C;  3HP9 A;  1ZX6 A;  4QQG A;  2CP6 A;  4F16 A;  3CCS Q;  2PTK A;  2CT3 A;  2COZ A;  5GAM g;  3EHQ A;  1UGR B;  3EH1 A;  5GMK i;  3BDU A;  5CR2 A;  1F1B B;  1MUZ A;  2JM8 A;  2O9S A;  5CQY A;  1OOT A;  4KUI A;  1Q7Y R;  4PJM A;  1ZQ1 A;  2ROT A;  1O75 A;  1W70 A;  4M7A E;  1U8R A;  1Y96 A;  2M02 A;  1ZSZ A;  3FEO A;  5KYU A;  1CSK A;  3KXT A;  1D1B A;  4J7F A;  5EC7 A;  1BI1 A;  5LJ3 e;  4HVW A;  1IB8 A;  2DL8 A;  4EMG A;  2V1Q A;  4PJO B;  1KQS P;  5CQX A;  2DVE A;  2FRW A;  5CIU A;  5GAO m;  3QJ6 A;  3RMQ A;  1GFC A;  1PWT A;  4ZGJ B;  3PIP A;  2CZ7 B;  2HL3 A;  4FU6 A;  2A36 A;  3H0I A;  2C0I A;  4PJO E;  1J3T A;  3T9N A;  1BI2 A;  2BZ8 A;  2ZCF B;  4A4F A;  2ED0 A;  2E64 A;  2YUN A;  2V26 A;  1UTI A;  1X69 A;  2RJF A;  5KH6 A;  2F1L A;  4CC3 A;  3EH2 A;  1YI2 T;  3CPW S;  3J7A F;  4E7Z A;  2CRE A;  1WHM A;  1D0Z A;  4JRQ A;  3VRZ A;  1ZBJ A;  1GXI E;  5FWB A;  2BKD N;  3MKD A;  4M77 G;  4NOY A;  5CCA A;  4AFZ C;  1X27 A;  4L6V 5;  1W2B A;  4XU1 A;  1CKB A;  4E7H A;  1OUL A;  1NPP A;  3R6N A;  2OTJ Q;  2LJ0 A;  3RBB B;  4JLI A;  4M75 C;  2RHI A;  4HKE A;  5EG2 A;  4XTV A;  2ENM A;  2MYS A;  2W10 A;  3OYC A;  4C5G A;  3JCM X;  2VGM A;  1YNZ A;  2B8A A;  4J6X A;  4M7A G;  2XG8 D;  4DBQ A;  3CMA Q;  2LCC A;  2KE9 A;  2AZV A;  2EQK A;  3H6Z A;  4AFQ C;  1E7O A;  2OTL T;  3REB B;  1D09 B;  5ECA A;  3X24 B;  2EQI A;  2R5M A;  2KYM A;  4BY6 B;  3RKX A;  4C8Q G;  1XNI A;  1QP3 A;  4J9I A;  1KQS S;  2CP2 A;  4M78 E;  5KYW B;  5LL6 S;  2D0N A;  2OTJ T;  2KMT A;  2SEM A;  4DOW A;  4M4Z A;  1WYX A;  3CXC S;  1QVG S;  2LNH B;  1U5S A;  1E6G A;  5FRN A;  2QK0 A;  5GAM d;  3SHW A;  4BI3 A;  1IGU A;  1SPK A;  5C0M A;  3LLR A;  4Z89 A;  1VQ5 Q;  5KYU B;  3L1A A;  2DBM A;  3HRT A;  3JSC A;  3M0T A;  3WVD B;  2BE7 D;  3OW2 P;  5HKC A;  4R55 A;  4M75 D;  1YBY A;  2RK2 A;  2OJ2 A;  2P4T A;  2GF7 A;  5CO7 A;  1QVF S;  4M7D F;  3TCJ A;  4RTV A;  2X4W A;  5KYN A;  1KD1 R;  3CCV T;  1QCN A;  2EYQ A;  3F70 A;  2RHZ A;  2K6D A;  2EYY A;  1AVZ C;  1VQ8 T;  2HDA A;  2LX7 A;  4J9B A;  2DJQ A;  1RAD B;  4PL6 A;  2YXY A;  3JRZ A;  4JS4 A;  1NLP C;  2R57 A;  1AZE A;  4EDU A;  3OYJ A;  2DIQ A;  1LPL A;  3A8L B;  1YJN A;  4LD9 K;  1U3O A;  4XTX A;  2V8J A;  3I55 A;  1QCF A;  1NE8 A;  2GFA A;  4GBQ A;  4BD3 A;  1EZZ B;  1EFN A;  3QSU A;  1GL5 A;  3CCE Q;  4DA4 A;  2DXB A;  4II1 A;  4LN2 A;  3PGG A;  1YIJ Q;  3RNJ A;  2FB7 A;  2OX7 A;  2ZZD A;  2GTJ A;  1VQ4 A;  2RQU A;  4C0D B;  1M1K U;  2K7A A;  4Z88 A;  1WJS A;  1XQH A;  2KRM A;  4J9H A;  1FMW A;  1UHC A;  3E1S A;  2MI6 A;  1EIF A;  3CPF A;  4UC4 A;  2KY9 A;  2A3L A;  2PUK B;  3LW5 E;  2DL5 A;  1HYO A;  1WJR A;  4M7A B;  3FB9 A;  4KGV B;  1VA7 A;  1M27 C;  1JQQ A;  1S72 Q;  2JT4 A;  2RK1 A;  4HCZ A;  3H0H A;  1NZ9 A;  1X75 C;  2CSQ A;  4IUQ A;  1RAB B;  3X25 B;  1YJN T;  2RI3 A;  3CCM Q;  2DZC A;  3I55 T;  2K5L A;  1UEB A;  1GBQ A;  1WHK A;  2RF0 A;  4PK4 A;  3G71 T;  2QEX Q;  3CBO A;  4OP0 A;  2KK4 A;  5FW9 A;  1Y71 A;  1TOV A;  3INZ A;  2L5Q A;  4AFS C;  4LE9 A;  2NUT B;  2X51 A;  2KXD A;  2FYK A;  2SRC A;  2HQE A;  4M7A C;  1YHQ A;  2YUP A;  4C92 E;  4C92 D;  2P4R A;  3VJP A;  2EJ9 A;  3CXC A;  5KYY B;  1WQW A;  3RES A;  4KUD K;  2QXF A;  1X2K A;  3BDL A;  2QQS A;  3WVE B;  1VQN Q;  5IHK A;  1TG0 A;  3D7S B;  4C5I A;  1PD1 A;  5FU7 C;  5FWC A;  1K73 C;  3CME Q;  3JAM E;  4M7A F;  3P8H A;  5I22 A;  1ZUK A;  3JCM V;  1KSW A;  1Y57 A;  4EMK A;  2FEI A;  1UGQ B;  1VQ7 T;  4ME7 A;  4CRI A;  3SWN A;  1IZ6 A;  2ZPF B;  2MOX A;  2I2L A;  4M75 F;  4OB1 B;  1W2B P;  1RAE B;  4PFP A;  1WQ7 A;  2HBP A;  1N9R A;  2EPD A;  1Q81 U;  2O2O A;  4V2S A;  2C0T A;  1K8A C;  1KD1 U;  2X4Y A;  4MDX A;  3ER0 A;  1SF9 A;  2EYX A;  2LX9 A;  3EAE A;  2XKO C;  3CME T;  1WHH A;  1Y7X A;  4C8Q D;  3CMA A;  1YIJ A;  1N8R U;  5GAN 5;  1K76 A;  5GMK j;  3PIO A;  1VQ7 Q;  1YHQ Q;  1JJ2 S;  3CD6 T;  2BUD A;  5HY6 A;  2GQI A;  3RKW A;  5GAO p;  3TQ7 P;  2JN0 A;  2RM4 A;  2KRO A;  1Q82 C;  3URG A;  1FXX A;  2EQJ A;  1KQ2 A;  1S1N A;  5GAM j;  4M7D G;  4M78 A;  2ECZ A;  4NL3 A;  1WDX A;  5HCK A;  2E41 A;  3JB9 I;  4LUE A;  1VQL T;  1C0M A;  3CC4 T;  1JU5 C;  4J9G A;  4F7U A;  2KDS A;  2XDP A;  1AEY A;  4E6R A;  3EGX A;  5A0D A;  2ZPH B;  3OY9 A;  1ACM B;  5FRM A;  1Q81 R;  3VUZ A;  1ZHI A;  1QW1 A;  3GNF B;  3JCM e;  2LJ1 A;  5GAN j;  5DLO A;  4KGZ B;  1FMK A;  1D3B B;  4FCY A;  1B7T A;  3GF5 A;  4M75 A;  4M7D C;  1M1F A;  2LCL A;  4M77 C;  5IXB A;  4AG2 C;  5KCH A;  1I1J A;  4F04 B;  4C5E A;  1UE9 A;  2JMC A;  1JXO A;  4XTY A;  4R56 A;  1KQS A;  1UHF A;  1E6H A;  3TU4 K;  2KR3 A;  3G6E A;  1KHI A;  2CS7 A;  2LT1 A;  1KK7 A;  1ZSG A;  3OYG A;  2P84 A;  1VQ9 A;  1G3T A;  4M78 D;  4PJN A;  4BDY A;  4C92 F;  2LZ6 B;  3CQT A;  3I56 A;  4MDW A;  4RTU A;  4F7U G;  1K73 R;  4RUG A;  4PJO D;  1HXD A;  3I55 Q;  4OGE A;  4XAX B;  3C4S A;  2ABL A;  4C8Q B;  3TVT A;  2LMJ A;  3FJP A;  1RAG B;  2JOY A;  3JCM b;  2COY A;  2FVU A;  3CCJ Q;  5LJ3 d;  5GAN 7;  4B6M A;  3H41 A;  1HK9 A;  3EGU A;  5D7U A;  2QAS A;  3QKJ A;  4PLL A;  2DL7 A;  3JB9 D;  4WCI A;  1N6A A;  1YJ9 Q;  3L2R A;  1BK2 A;  3M54 A;  4RTY A;  1Q7Y U;  3E19 A;  5DLQ E;  2XID A;  4ZGE B;  5DM7 R;  4DQ2 A;  4ZTF A;  5GMK m;  4EMK C;  3JCM f;  2NUP B;  2QQB A;  3PE0 A;  1GBR A;  4X1V A;  3SWN C;  1VQM A;  1AWJ A;  2HBW A;  3C94 A;  2AT1 B;  2ED1 A;  1ZA1 B;  2DD4 A;  3MP6 A;  1VQ6 A;  5D6X A;  1V1C A;  3VYH B;  5J39 A;  1VQ4 T;  4QQ6 A;  4J9C A;  4IUU A;  2EKH A;  4C92 A;  2CP0 A;  6AT1 B;  2DTO A;  1OPL A;  1OU9 A;  3A98 A;  3UT1 A;  3PFS A;  3EGX B;  3QJY A;  2GBQ A;  3UWN A;  5GMK e;  4KGX B;  3DKM A;  1ARK A;  2CZ0 B;  2FG0 A;  4OB0 B;  2GNC A;  2AK5 A;  1K9M C;  4RKU E;  4J8O A;  2GFU A;  2CP5 A;  4EIK A;  4E7K A;  2RJD A;  1YWP A;  3U23 A;  2PVD B;  3MHX A;  1VYU A;  4YTL A;  1K8A U;  2HKN A;  1WLP B;  3OYY A;  4QVC A;  1VQ4 Q;  5KE3 A;  3X26 B;  3EFO A;  2QDY B;  4ANJ A;  3A8O B;  4LNP A;  5GAN e;  3QWX X;  4CI0 C;  2L89 A;  2F5T X;  3L2W A;  3VU3 C;  4R0K A;  2AHJ B;  4JPB W;  1OQK A;  3CCV A;  4M75 G;  2LQN A;  1NLO C;  3EGD A;  3BY7 A;  4HCC A;  4D8K A;  4XU0 A;  1JB0 E;  1VQM T;  1RUW A;  3NGP A;  1VIF A;  4E7J A;  3OS1 A;  3M55 A;  3G6E Q;  1KC8 U;  4Z02 A;  2O4X B;  4IIM A;  3CC2 Q;  4C8Q A;  1H3Z A;  3V8K A;  2FPE A;  2HQH A;  3VYG A;  4BDZ A;  1PNJ A;  1G3Y A;  5GAN h;  5IT9 E;  4JUV A;  2QA4 T;  1VQK A;  1YCS B;  3CCS T;  1JJ2 A;  3HKS A;  1M3B A;  1BCO A;  2G3R A;  5CKH A;  4BE1 A;  3H8Z A;  4FYV B;  4RTT A;  1M1K R;  3JCM J;  2XI9 A;  3KBG A;  4XU2 A;  1YI2 A;  4CC2 A;  4C0G A;  5I11 A;  1ABO A;  4N4I A;  1RLQ C;  2M9U A;  3Q1J A;  2QG9 B;  1Y96 B;  2DL3 A;  1GCP A;  1YIT Q;  1IGQ A;  3O8V A;  2IIM A;  1VQO A;  3L42 A;  2EYW A;  1WNL A;  2EWN A;  2NUP A;  2O01 E;  2CYZ B;  3MEV A;  4Y91 A;  1FWZ A;  4ZNX A;  1TTH B;  2JNG A;  2RI5 A;  1M3C A;  3V8L A;  2QAZ A;  2RI2 A;  3OYA A;  1N27 A;  2JS0 A;  3IQL A;  2E6N A;  3FDR A;  1XJW B;  1LNX A;  1VQ5 T;  2KRN A;  1WHJ A;  4KH0 B;  7AT1 B;  3M9Q A;  2DLP A;  3ZEH A;  2E1H A;  3CCE T;  3BW1 A;  3QPH A;  1WXB A;  2LRQ A;  1I0C A;  1IO6 A;  4Z8A A;  1Q7Y C;  5GAN 3;  1YIT T;  4LDW A;  3VS5 A;  5GAM h;  4WTO B;  1RAC B;  1X43 A;  2D8J A;  4J7I A;  4BI4 A;  2KNB B;  4LXC A;  5LJ5 f;  2X9H A;  4M77 F;  4OB3 B;  1MV3 A;  1WHL A;  3ZL7 C;  1YWO A;  2RJE A;  2PNI A;  2E12 A;  2RN8 A;  2MPX C;  4FW1 A;  4A4E A;  1M1K C;  1B07 A;  4JZ4 A;  3RMS A;  3JB9 H;  1OYX A;  2F2V A;  1BIA A;  5GJV B;  2W0Z A;  1WX6 A;  3CCE A;  3V7S A;  2EVR A;  2EBP A;  5L23 A;  3VS2 A;  3JB9 J;  1GCQ A;  1QMC A;  2ZPE B;  3EG3 A;  1HJD A;  5LJ3 g;  1BI0 A;  2DD5 A;  3I5S A;  3M0Q A;  4XK8 E;  1M1G A;  1NEB A;  4ORZ A;  5IAY A;  1NJI R;  1X2Q A;  4MZT A;  2O4X A;  3I56 Q;  1JBM A;  3EG9 B;  3E9F A;  1YIJ T;  4TVR A;  2E70 A;  2E5Q A;  2DRM A;  2L3Q A;  5I2S A;  5GAN g;  4A63 B;  2D1X A;  5FLX E;  1M9S A;  3VKI A;  2M0Y A;  4MZP A;  1IHV A;  4XU3 A;  3VS1 A;  2KEA A;  1NJI U;  5LJ3 h;  5GAM e;  3OYN A;  3CCR T;  2H3J A;  4RTX A;  2HD0 A;  4M7D A;  4AFU C;  3CCS A;  1SG5 A;  2K3Y A;  3CBP A;  2KXC A;  3C95 A;  1M90 R;  3H0F A;  4RG2 A;  1R77 A;  1WA7 A;  2CDT A;  2COW A;  3NHN A;  4J9D A;  3MEA A;  2D9T A;  2LVM A;  1AWO A;  5KYW A;  4OB2 B;  3NTI A;  1EX4 A;  1N9S A;  1PRL C;  2QQ9 A;  2Y4Y A;  1RAA B;  3UA6 A;  4B9W A;  2RA2 A;  3OQ5 A;  2BZY A;  3HPW A;  4FIB A;  2XU8 A;  1VQ6 Q;  3NPF A;  3OYL A;  3CC7 Q;  5CVI A;  4QKU A;  3MEW A;  4HXJ A;  3A8H B;  3GIB A;  1RL2 A;  1PG5 B;  4XTZ A;  1M30 A;  1NJI C;  2E3H A;  5FU6 C;  2L3P A;  1W6X A;  1D0X A;  1TUD A;  2K4Y A;  1ZUU A;  1NPR A;  3OS2 A;  1KC8 C;  2DA9 A;  1I5O B;  2K2V A;  3I5R A;  3O5Z A;  2YUQ A;  4AG1 C;  4PNO A;  3EG2 A;  3M5A A;  3I9Q A;  2YDL A;  4DBR A;  1LJO A;  1DJ7 B;  1TXQ A;  1VQP T;  4M78 C;  4E7S A;  3M0U A;  1I07 A;  5IHN A;  2EKO A;  4ELZ C;  3V8J A;  2KRS A;  1VIE A;  1QVG A;  4PJO C;  5GAO l;  1YHQ T;  2AIR B;  2XK0 A;  1QLY A;  1JO8 A;  3JCM P;  2HSP A;  1M90 C;  2O88 A;  3NFC A;  2P0P A;  3S6W A;  3EG0 A;  3J80 E;  2F69 A;  2RQV A;  3OSS C;  5IN1 A;  3EFS A;  5GAN 6;  3SD4 A;  2PZ1 A;  4PJJ A;  2PUO B;  2C06 A;  2ATC B;  1N8R R;  4M77 D;  4FSS A;  4Y28 E;  5GAN 2;  3KFV A;  4M7D D;  3OMC A;  3M57 A;  1LCK A;  4M77 A;  2H8H A;  3OW2 S;  4CC7 A;  5IXF A;  1K73 U;  3P8B B;  3CC2 A;  1VQP Q;  2CZ1 B;  3REA B;  2X35 A;  1PD0 A;  3GBQ A;  5CK9 A;  1V29 B;  3MPU B;  2CP7 A;  2QQA A;  4M78 G;  3JCM W;  5GAN d;  2DNU A;  2RMO A;  1QVP A;  2V8I A;  5D6W A;  3QDF A;  2YRV A;  1YJN Q;  5DY9 A;  4M7A A;  4M7D B;  1IXD A;  4EMK B;  2MIO A;  2DTI A;  2RQR A;  3L2Q A;  2FPF A;  2OAW A;  2FRY A;  1OPK A;  4DBH A;  2EAY A;  2DK3 A;  3GNG A;  3JV3 A;  3JCM d;  1NG2 A;  1SEM A;  2DAQ A;  4VUB A;  1HSQ A;  1YIT A;  2R58 A;  2VUB A;  1OU8 A;  4K11 A;  2EJG A;  3OS5 A;  4N4H A;  3AT1 B;  3X20 B;  4HT8 A;  1N5Z A;  3EHR A;  4AMC A;  4IKF A;  1K4U S;  4HVU A;  4C5H A;  1OZ3 A;  4ZGD B;  2JVV A;  1OV3 A;  2QGF B;  5A0L A;  2GGR A;  3M0P A;  3M0R A;  3CCV Q;  4M7D E;  1VOM A;  2X4X A;  2FO0 A;  1OX9 A;  5KYY A; 
#chains in the Genus database with same CATH homology
 1YIT Q;  3G4S Q;  3CCM Q;  1YJW Q;  1W2B P;  1VQ8 Q;  3CC7 Q;  1YIJ Q;  1Q86 R;  1VQ9 Q;  3CCU Q;  1VQ7 Q;  1YHQ Q;  1KQS P;  1QVG P;  1N8R R;  3CCL Q;  1VQO Q;  2OTJ Q;  1KD1 R;  3CXC P;  1Q7Y R;  1VQ4 Q;  1S72 Q;  3G6E Q;  2QA4 Q;  1YJN Q;  3CME Q;  1NJI R;  1K8A R;  2QEX Q;  1M1K R;  1K73 R;  3CPW P;  3I56 Q;  3CCS Q;  3I55 Q;  1VQM Q;  1Q81 R;  1YJ9 Q;  1Q82 R;  1KC8 R;  1VQ5 Q;  3CC2 Q;  1VQL Q;  2OTL Q;  1QVF P;  3CCQ Q;  3CC4 Q;  3OW2 P;  1VQP Q;  1K9M R;  1YI2 Q;  1VQK Q;  3CMA Q;  3CCR Q;  1JJ2 P;  1VQ6 Q;  3CCV Q;  1M90 R;  3CCJ Q;  3CCE Q;  3CD6 Q;  3G71 Q;  1VQN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...