3CXCP

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cxcP00
1QVGP 1VQPQ 1JJ2P 3I56Q 1K9MR 3OW2P 1KD1R 3CCRQ 1M1KR 3CC2Q 3CCEQ 1Q82R 3CCVQ 3CXCP 1K73R 3G71Q 1VQMQ 1KQSP 1VQLQ 3G4SQ 2QA4Q 1VQ4Q 1VQ5Q 3CCQQ 3CMEQ 1YITQ 3I55Q 3CD6Q 1VQ8Q 3CCJQ 1QVFP 3CPWP 3CCSQ 3CC7Q 1M90R 3CCMQ 1VQ9Q 2OTLQ 1Q86R 3CC4Q 1VQKQ 1VQNQ 2QEXQ 1YJWQ 1W2BP 1K8AR 3G6EQ 1Q81R 1KC8R 1YHQQ 1YI2Q 1NJIR 1VQ6Q 3CMAQ 2OTJQ 3CCLQ 1S72Q 1YJ9Q 1YJNQ 1Q7YR 3CCUQ 1VQOQ 1VQ7Q 1YIJQ 1N8RR
chains in the Genus database with same CATH superfamily
3OMCA 1PWTA 2QK0A 4E7HA 5IXBA 3D7SB 2CZ7B 4IUUA 1N8RC 1BIBA 3MHXA 3PIOA 4JS4A 2LDMA 3A98A 2LCSA 5KCHA 2KRSA 1KC8R 2GF7A 4M77A 1QP2A 2ENMA 1S72Q 2L3QA 1R8OB 1WGSA 1YCSB 3LX7A 3M56A 3LYIA 2JVVA 3HRTA 2CKKA 1WHHA 1BI1A 3X28B 2E6NA 1QVPA 2KT1A 5D6XA 2AKLA 1K73U 1SSFA 3CCSA 4YTLA 1UHFA 3LH5A 2QQ9A 1NEGA 2YHTA 2LT4A 4QVZA 3CCLQ 4HCBA 4FYWB 4FYYB 4JJDA 1TH7A 4X1VA 3GOXA 1WJSA 1U1SA 4M78D 3JCMW 1ABQA 2L8DA 2YLBA 3QZ5B 2KY9A 3G4ST 4FT4A 4J5YA 5FRNA 3CCJA 2XDPA 4M4ZA 1YWOA 1UFFA 2R5MA 3EGDB 5D6YA 1WYXA 3CCMA 4ZTFA 1LVKA 2QEXT 2RPNA 4M7DC 4E2FB 1RAAB 2K7AA 2RN8A 5LL6S 4BB7A 2O88A 1W6XA 2BZYA 4AFZC 4RCCA 3CCEA 2DD5A 4KGVB 1M2VA 2DF6A 3CCQQ 4XK8E 3CXCS 3A8LB 3C94A 1I1JA 2CP3A 4FSSA 1W2BP 1VQ9A 3H6ZA 5LJ3g 5IT9E 4XU3A 2LVMA 1T3LA 2CH4A 2GQIA 4M77C 3NPFA 5IH2A 3H0FA 4WCIA 1VQ7A 1JJ2P 4OGEA 3NTIA 4M75C 4M78F 1QVGS 3JB9I 1PNJA 4KH0B 1ZSZC 3OYLA 5CKFA 3I55A 2XU8A 3Q1JA 5L8RE 4N4GA 2E6ZA 4TVRA 2NLUA 5IHIA 1RAIB 4BACA 3HPWA 1VQOT 1WHGA 4M7AB 3SEMA 3UA6A 1CKAA 1AT1B 4V2SA 3UDCA 3CCVA 3DLLA 5KE2A 2LX7A 4ZGEB 5GANj 4IUPA 3M53A 1M1KU 3M57A 3QHSA 4C8QB 3EFSA 3RKXA 2MIOA 1V29B 3JB9H 4M78G 2WSCE 4A63B 2OTJQ 1YJNA 3SD4A 3CCUA 1N5ZA 3CPWA 1OYXA 1JB0E 5HK0A 2VC8A 3G71Q 3PMTA 2CUDA 4JJBA 1VQ5Q 1FMKA 2K5FA 2O9VA 4X9CA 2KGTA 4D6WA 3QBYA 3OQ5A 4EMKB 3LLRA 5ECAA 4QQGA 1X2KA 4RTXA 5GAOn 4AT1B 1VQPA 1Y71A 3E9GA 2EKOA 4LUDA 2YSQA 2A08A 2KEAA 5CKEA 4HCZA 2CZ1B 2DL7A 5IHKA 1Q7YC 3BY7A 3L2RA 3A5ZB 3CD6Q 4R0KA 4UC4A 1U5SA 2ZPIB 1I4K1 4J9FA 2DBKA 5HCKA 2K5IA 1O75A 5FROA 1VQKT 1GCQA 3S6WA 2DJZA 2FVUA 1NPPA 1UDLA 4C5GA 4PJNA 1WFWA 1GBRA 1YI2T 1N8RR 1RI0A 2BZXA 1Q81U 2E12A 1E6GA 3I9QA 5LJ5j 2F2XA 1VQLQ 2YUNA 3EGXB 5KYUA 1KQ2A 4C0DC 1EFNA 3G6EA 3FDRA 1C0MA 4NL3A 2M1HA 2DRKA 3JCMd 2VXEA 1KD1R 1TTHB 2KRMA 4O6JA 3OYJA 1JBMA 1X27A 2OI3A 1QKWA 1VA7A 2JUFA 3UT1A 2C0OA 2Y4XA 5GMKl 4XAXB 3R6NA 4OP0A 1VQ4T 2X9HA 2HQHA 3OYYA 1TUGB 2GGRA 3QYGB 3OBWA 4QQDA 1AOJA 3RKYA 2O31A 2W0ZA 2KQWA 5FU7C 1T3SA 1W2BS 5I21A 1M90C 4FW1A 4DEXA 1KC8U 1Q86C 2FG0A 4HVWA 5GANg 1D09B 4L6V5 2QASA 1KG1A 4XU0A 4Q5WA 1JJ2S 1NE8A 4J9GA 5GAMd 2DBMA 3V7SA 4C5HA 1VUBA 2C0TA 4BDZA 2A7YA 1UJYA 3OSVA 3C12A 3NTHA 3S3OA 3PTAA 4FU6A 4Z8AA 2FL7A 4ZTJA 1EZZB 5C6SA 1RUWA 2LQNA 1GCQC 4ZN1A 1NLOC 5GMKh 4PJOB 1K4US 2FPFA 2K3XA 1S1NA 4AMCA 2E5KA 4KULA 3QSUA 1UTIA 4M78C 1WHMA 2FYKA 1LPLA 1RAFB 3V7CA 4BDYA 4OB3B 3GNGA 3QUIA 1GBQA 1UGSB 3RR6A 4RTYA 2DYBA 2DXUA 1VQNT 1RABB 2MAMA 3VV0A 2CUBA 3G4SQ 2M51A 2CSIA 4IKFA 4IUVA 3M0RA 3RERA 1LNXA 4LDVA 5LJ5g 1KHCA 2P0PA 2EQIA 4J9HA 4C92B 5I2MA 2L3RA 1TU0B 2ROTA 1AEYA 4DBFA 2QGGA 4L59A 2CYZB 1AVZC 3G1JA 3F70A 4OB0B 2K3YA 4LDYA 4VUBA 2A37A 1G2BA 2LJ0A 4C0FA 2KXDA 1PD1A 1EIFA 2QTXA 3PVQA 3OYGA 2RM4A 4OMOA 2V8IA 5KYYA 2DZ9A 1PG5B 3EHQA 3TQ7P 3CPWP 3CCST 2KBTA 2PVGB 1RAHB 1NG2A 2QXFA 1Q7YR 1KHIA 4O5VA 2KDSA 5LJ3f 1X75C 1Y7XA 1G83A 3VS1A 2E3HA 3M0SA 2HSEB 3A8MB 8ATCB 3VS6A 3CCJT 3P8HA 2OTLT 1AHJB 5IHNA 3CCMT 2ATCB 5I22A 1H3ZA 3X20B 2ZPEB 2EBPA 2V8KA 3MEAA 3I56A 4FW2A 3CCET 2K3BA 3EH1A 5LJ3e 3FJPA 1WPYA 5GMKe 1YCYA 4M7DE 4J9IA 1WJRA 2P4RA 3TEEA 1VQ9T 4JRQA 4OF1A 4Y28E 5GAOr 5CO7A 4XTZA 1J3TA 3VS5A 3JCMX 4BE2A 1VQ7T 3A8GB 3M0UA 1RLPC 3CPFA 1B7TA 1IGQA 3L2ZA 5DLOA 1D3BA 1N8RU 1PSEA 2E41A 1E7OA 4EMHA 1K0XA 1Q95G 2COZA 1XJWB 2JM9A 1OPKA 1QP3A 1TG0A 1Q86R 1VQKQ 3I55T 4JRPA 4M77E 1XQHA 1WHKA 1IB8A 1YI2Q 4F7UE 4M75E 1YIJQ 3OS1A 1OULA 5C0MA 1ZQ1A 3BDLA 1BIAA 4A4HA 4EMGA 2DVJA 4QW2A 1MV3A 3GBQA 2D8HA 2H3EB 2RI5A 4CRIA 1C1AA 3SWNC 3HP9A 1TUCA 2XHCA 3HSBA 2DL3A 2P0KA 2XG8D 3LWIA 3CCVT 1KD1U 2L5QA 3VS2A 2YDLA 2F69A 2DL4A 1RAEB 2H3JA 3CC7A 4J83A 3NHNA 5J3BA 3A1PA 2Y90A 3M55A 2FRWA 1VQ6A 1OZ3A 1PHTA 3VS3A 2V1QA 5GAN6 2RH2A 4FYVB 4PKCC 1YJNT 3EFOB 3M0PA 3VRYA 3CCUT 1ARKA 2EYYA 3H0IA 5GAN5 1K8AC 2X51A 1PM3A 1VQ4Q 2QA4A 3EG9A 3M58A 3T9NA 2D9TA 1G3TA 5GAN7 2KK4A 4PFOA 2KSSA 2LNHB 2DEQA 3THKA 5CR2A 2DXBA 3OYHA 1JEGA 2HCKA 1YJ9A 3L2WA 4XQ3A 2QAZA 2L0AA 3ER0A 4MDWA 1QVFA 2HZYA 5GMKj 2COYA 1OX8A 2MPXC 2HBPA 1VQPT 2ZPGB 4RG2A 3RNJA 1Y96A 2DMOA 1M30A 1QWFA 2HQXA 5KYWB 2AT1B 1IO6A 4QT7A 3OYEA 3CPWS 2K57A 4M7DA 2LCLA 1X43A 1ZA1B 1BK2A 1B3QA 4L5GA 3BFMA 2MK5A 4C8QD 2DIGA 3CCRA 1MNEA 1CKBA 1BYMA 3WVEB 5GANf 3GF5A 5GAN8 2CZ0B 2OX7A 2RNAA 5FU6C 1BCOA 1U8RA 1QMCA 3A8HB 4HA8A 4RTVA 2XICA 4X9DA 4II1A 4M77B 1IZ6A 2DX1A 2QDLA 3G6ET 1WZOA 1VQNQ 1H3HA 4F7UA 4M75A 4J9EA 3JCMc 2EGCA 2ESWA 2RQTA 1M1GA 2XI9A 1ZSZA 2RB6A 3NGPA 1VQMA 3EHRA 2G3RA 1U3OA 5KYXA 2GQVA 4CI0C 1YITA 1TSFA 4HKEA 1SHGA 2DRMA 4M7AF 1IXDA 2EFIA 3EG1A 2K4YA 1V76A 1FXXA 5GANe 1EX4A 3VUBA 2DAQA 1Z9ZA 4C8QF 1U1TA 3OS2A 2ZZDA 1ZA2B 5HKCA 5CKHA 5GAN2 1ZLMA 3FRNA 3CCQA 1MGQA 3UPUA 1T0HA 2HL5C 2X3WD 1M3AA 3CMET 1P92A 2DERA 2CREA 1Y0MA 2HBWA 2DXTA 2OTLA 2JS0A 1ZSGA 4EPCA 4XTWA 1ZX6A 2F5KA 1N6AA 2OAUA 4M7AG 2K5LA 5LJ5f 1Q7YU 3VYGA 4J8OA 2IVWA 1D1AA 1M2VB 2EYQA 3TSWA 3CCSQ 3NTKA 1F1BB 3EGDA 3G7ZA 4AG1C 4C8QG 1B34A 1K9AA 1PD0A 3CC4A 2DNUA 1X69A 1WHLA 4PJMA 1U06A 2NUPA 3EGUA 3KXTA 2QDYB 3JRZA 3CC2T 4DQ2A 4RTZA 2QI2A 4M78E 2EWNA 3CCJQ 3OS5A 1DJ7B 3CCMQ 5LJ5e 2EKHA 2QTVA 3QJ6A 1X6GA 2ABLA 2EYWA 2RJCA 3S3MA 2OTJA 1FMWA 4LN2A 2E4HA 3OSSC 4OMQA 3CCEQ 2IPOB 1OOTA 1N27A 1K0SA 3H8ZA 1AZEA 3J81E 4XU1A 2QQAA 1WDXA 1HD3A 4IIOA 4LE9A 2JNGA 1VQ9Q 2EYZA 1K8AR 1VYUA 4RMOA 1UUEA 4PJOD 1VYVA 2FRYA 1Q86U 2BZ8A 4IIMA 2LZ6B 3RKWA 2RD1A 3OMGA 3ZEHA 5LJ3d 3I55Q 3FIFA 3JV3A 2AIRB 4J6YA 2D6FA 2FEIA 2K79A 1K73C 4AFUC 3BE3A 4ANJA 3KBGA 2LRQA 1UGVA 1NZ9A 1M3BA 3ME9A 4E7SA 3CCVQ 3GNFB 2ZAEA 4OMNA 3M4GA 3MO8A 5KH6A 2CP0A 1QVFP 2EVRA 2RA2A 3OBYA 2R57A 1XTDA 2JT4A 4N0AA 2E65A 4ZGJB 2KXCA 4PJOF 4C92D 1IHVA 3UA7A 3JSCA 2DL5A 2CS7A 2EGAA 3SDZA 1YJNQ 1NBEB 3CCUQ 1LJOA 2KMTA 1VYTA 2A28A 5D7UA 3M4YA 4J6XA 2WACA 3I56T 4R56A 1D1CA 4CC7A 2AZVA 4HT9A 1K9MC 5KYUB 3URGA 4M78A 1WX6A 2X4YA 2COWA 3OY9A 2XIDA 3ZFJA 1NLPC 1BKBA 3NMZC 3PVLA 4EIKA 4DBQA 2JMAA 1CSKA 1WIEA 1VQPQ 2AZSA 4J9DA 4M7AC 1H92A 2RHIA 4PJOG 2VXFA 3X26B 2VGNA 4QVCA 2FB7A 3EGXA 1LCKA 2DD4A 5KYNA 4C0ZA 2KYBA 2OAWA 4C8QC 2GFAA 2M02A 3EG2A 4C92F 7AT1B 4MMLA 1SHFA 1W1FA 2HKNA 2KAFA 2MWPA 3TSZA 1NYGA 1G3YA 5IXFA 4MZTA 5CKBA 2PUOB 1XNIA 2LC4A 4JLGA 2PQWA 1Z9QA 2ZPHB 2GCXA 4OMMA 1SG5A 3M9QA 2C0IA 3CMEA 3EFRA 5CIUA 1M1KC 1SKUB 2RHXA 1AD5A 1WNLA 3CC7T 5CCAA 3G6EQ 4EMKC 2I2LA 1X2QA 4N0AC 1BU1A 3PMIA 1VQ6T 1UECA 3HHTB 2IG0A 2GTJA 4C92G 1RADB 2DM1A 5DM7R 3VRZA 4ELZC 2QA4T 3INZA 1ABOA 1GFDA 2MWOA 1ACMB 1WJQA 3C0CA 3SHWA 2DA9A 3EG0A 1G5VA 2H8HA 1TOVA 4PJOA 3UF4A 3PE0A 1YJ9T 1FX7A 3SFMA 3CC2A 4FL6A 1QQJA 4J9BA 2BE9B 2CT3A 5GAOm 4CC4B 1UE9A 2NUTA 3QPHA 4JS5A 4HVUA 2QEXQ 1Q82C 4FM4B 2DKGA 5GANd 3DKMA 3JB9G 2JOYA 5DLQE 1MV0B 2CP5A 1BBZA 1KJWA 3P8DA 2M0YA 4LDXA 1Q81C 3CCRT 2JN0A 5CQXA 4HVVA 4Z02A 3OYBA 2RHZA 4PNOA 4LDUA 1AZGB 4PLLA 1QVFS 2YT6A 1YJWA 2CDTA 4R55A 1YP5A 3SB2A 1KQSA 3CMAA 4C92A 3DB3A 2QYZA 3PT9A 2DYIA 1K73R 1OZ2A 2J6KA 5KYYB 1H641 2ROLA 1VQMT 2J7IA 1LOJA 3VS7A 4WTOB 1UG1A 1YITT 3JCMh 3MJXA 3QWYA 3AT1B 1H8KA 3H0HA 4IURA 2G6FX 1VQOQ 2B86A 4RCBA 2YLCA 3OYFA 3I5SA 1K8AU 1JU5C 4E7IA 1YWPA 1NYFA 2KE9A 4PJOC 2J6OA 4QKUA 3MP1A 1ZBXA 3RUXA 3SWNA 1FMVA 4XTUA 2EQUA 2YRVA 4GBQA 2SRCA 1E6HA 3CCQT 2HAXA 1VQ8A 5LJ5d 3JCMJ 1PCXA 2JMCA 3ZL7C 2RI2A 1SPKA 1I07A 2GTOA 4IUQA 1YHQA 3OA6A 1M5Q1 2O4XA 2A36A 5GAMh 2FZCB 2A0FB 1K9MR 2M16A 3M0QA 2LCCA 1MNDA 4RTWA 2EQMA 2EYXA 3VS4A 3M59A 1NPRA 4CC2A 4RTTA 2CH4W 5GAN3 3CC4T 4E7LA 2F2VA 3U23A 4E7ZA 4HCCA 2DL8A 1YIJA 2M0OA 4C92C 3TU4K 4PJLA 2E5QA 2EW3A 2XKOC 4Z88A 4KRTA 1D3BB 3MCAB 2DLPA 4BY6C 1QCNA 3MPUB 4RUGA 1M90R 2RI3A 2VV5A 9ATCB 1WXUA 3PFSA 5GJWB 1PC0A 4LDWA 2O9SA 3CBOA 2L2PA 3QDFA 5AT1B 1SF9A 3I56Q 2OTJT 2DFUA 2RHYA 5D6WA 3C4SA 1Y57A 3V8KA 2NWMA 1KK7A 1G8XA 2KT8A 4M77F 5FU6B 5KE3A 1W70A 1OI1A 3DLMA 4ESRA 4XTYA 4J6WA 1ZUUA 3UATA 2KNBB 1M9SA 3HFOA 4LNPA 1R0BG 2RHUA 3V8JA 2QGFB 1AWOA 5J26A 3EG9B 2LNVA 2HNIA 4EDUA 1SEMA 3OW2A 4KT0E 3OB9A 4FIBA 1TWBA 4M77G 4PJJA 3GIBA 3JCMe 4MDXA 1Q82R 4GLKA 3REBB 2OJ2A 1X6OA 4JUVA 4A53A 4Y91A 1QLYA 4E6RA 3GPLA 1G3WA 3CC7Q 1Y96B 2FPDA 3NFCA 4ORZA 2Y4YA 3M5AA 3FB9A 1Q81R 4M7AD 4PFZA 1VQ6Q 4ZGDB 4M7DB 2P4TA 5FWBA 1S72A 3JAME 4B9WA 4OB2B 2HSPA 4JPBW 2HL3A 2MCNA 3MKDA 2DVEA 2ZPFB 2VVKA 2ED0A 2WSEE 5FW9A 3FLGA 1BI2A 2D8JA 2L3PA 1YNZA 2ECZA 2XDDA 1T0JA 1MHNA 3KFVA 1ZUYA 2LTOA 1YJ9Q 2V26A 2X4XA 3CCLA 1D0ZA 1KIKA 3ASKA 3QDRB 2EJGA 1GL5A 1MUZA 4F7UB 4M75B 3N5BB 2DK3A 1M8MA 5M9OA 4JRIA 1NJIC 1KQSP 1ZSZB 4P5NA 1B07A 2LX9A 2DTIA 2QQSA 5KYXB 3TCJA 1FYNA 2MYSA 3FJ5A 5A0LA 1RLQC 2RF0A 2J06A 4RKUE 3CQTA 4M7AE 4KUIA 2DETA 3FC3A 1K76A 2RQRA 4GY5A 4BI8B 5CK9A 3CCRQ 1QWEA 1N9SA 4BUGA 4C8QE 4DEYA 2VUBA 1KSWA 2SEMA 4J7IA 2MF2A 1AWJA 3MP8A 3UWNA 1KD1C 5HY6A 4MMKA 4ZNXA 3DB4A 2VB6A 2EPDA 4A4FA 2ZGWA 2RK2A 4FCYA 4RTUA 2KI7A 1RACB 2PTKA 2JM8A 1PRLC 1VQMQ 3L1AA 2LJ1A 3OYMA 1YITQ 3V7RA 5GAOl 4QVDA 4LXCA 1AWWA 4C0GA 5CKDA 2YUOA 2CGHA 1B34B 2FZKB 3RDVA 2W10A 1IHWA 2D0NA 3RESA 1OQKA 1XOVA 5GAMj 3QJYA 2O2OA 3QKJA 8AT1B 1Y07A 1OX9A 2EJ9A 1OU9A 1RL2A 2NUPB 2RJFA 2RQVA 5CQYA 1A0NB 2F2WA 1WHJA 3ZBDA 1G3SA 1MMNA 1K9MU 1OV3A 3C95A 2LP5A 2OTLQ 3TVTA 3O5ZA 2HD0A 1GXIE 3GLXA 5GJVB 4BE0A 2RQUA 1YFNA 2X4JA 2KRNA 2E10A 2B8AA 2CP6A 3RMSA 2RJDA 2XK0A 3VJPA 1N9RA 2RQWA 5CAIA 3G71A 2YUPA 2DIQA 2DO3A 5GAOq 1VQ5A 2ZCFB 2XMFA 1YBYA 4FYXB 4C0DB 3CC4Q 4ZN3A 5KCOA 4BD3A 2C06A 4HXJA 1M90U 1YJWT 1QCOA 1R77A 2LQKA 1VQ7Q 2F5TX 3LGFA 3BDUA 4M7AA 3CMAT 4PLIA 2J6FA 3X24B 4C8QA 3J80E 4QQ6A 4F04B 3CD6A 1BI0A 4AFQC 1AWXA 3CEYA 2NYSA 4J7FA 2JTEA 1HXDA 2ZPBB 5FU7B 4JZ3A 2E3IA 1M4ZA 5J39A 4C5EA 3OW2P 1D1BA 1JO8A 2EAYA 4A4EA 3RIRA 3JCMg 5GAN4 4AFSC 1OU8A 5IN1A 1VQLA 2PVDB 2Z0WA 4KUDK 1KQSS 4OMPA 1VQ8T 1UJ0A 2YRDA 2DZCA 4EMKA 1GRIA 5HK3A 2YWWA 1YHQT 4PJOE 1UHCA 2DTHA 3QO3A 2DTOA 4HCKA 3M54A 3EH2A 2BUDA 2P0QA 1Q82U 4KH1B 3VYHB 4M78B 5GAMg 3MEWA 2HMAA 1NJIR 3L2UA 4F14A 5A0DA 1M8VA 2DJQA 1VOMA 4BI4A 2JTMA 1W4SA 2ED1A 1YIJT 4E47A 4ATOA 1QCFA 1PRMC 1VIFA 3EG3A 2JJ9A 3JB9D 3E2UA 1SRMA 3HTRA 1I8FA 2KVQG 3BW1A 4C92E 1ZBJA 1TUDA 4RG8A 1IREB 4OMFB 4XU2A 3ULRB 2BIVA 4ELYC 2QQRA 2VYTA 2E64A 3OYIA 1NM7A 3WVDB 4DBRA 1UGRB 4JRKA 1ZHIA 1JXOA 1M27C 1X01A 3JCMb 3CXCA 1UB4A 3VU3C 1BCMA 2X3XD 2K2MA 2KR3A 2PUKB 2BE7D 4NS5A 4XTVA 1SRLA 1M2OA 3JB9F 1MMAA 2EIFA 4LD6A 2YUQA 3MEUA 3RMQA 1IRXA 2V8JA 4PFPA 3WXMB 3G4SA 2VGMA 4B6MA 1QVGA 1JRIA 1PKSA 2QEXA 2E70A 2WSFE 2QQBA 3R6OA 2NUZA 2LQ8A 3OYNA 2DXCA 5AYFA 4DOWA 1WI7A 2AK5A 1ZUKA 1QKXA 1UGQB 5LJ3h 2YXYA 2JW4A 5I11A 4XTXA 2GFUA 3CMEQ 4OB1B 4A54A 5GMKi 2RJEA 4PK4A 3IQLA 1UGPB 3OYCA 1IGUA 2NUTB 3OYKA 2LT1A 4DA4A 2PU9B 1JXMA 2HEQA 4NL2A 3MP6A 3JCMV 4D8KA 3J7AF 3HFNA 1S72T 4CC3A 1X6BA 1JQQA 5EG2A 2V1RA 5DY9A 2A3LA 3CBMA 3OS0A 3OW2S 2VWFA 2VKNA 1I5OB 3P8BB 2MMPA 2JTFA 1BB9A 4DBHA 3JCMQ 1M3CA 2XD0A 1R0CB 3A8OB 2JXBA 4B9XA 2DEUA 5GAOp 1HJDA 3QYHB 3E19A 2DE0X 1OEBA 1WA7A 1HSQA 4BE1A 4KGZB 1VQOA 2EGEA 2GNCA 2GBQA 3CCLT 2HDAA 2FPEA 1I0CA 4C5IA 3CC2Q 2MOXA 1QW1A 4Y92A 1YN8A 4BY6B 3CBPA 3PGGA 1RI9A 1PSFA 3VS0A 2AKKA 2VASA 6AT1B 1TS9A 2AHJB 1SSHA 1C6VX 2LJ3A 1MMGA 2RO0A 4N4IA 1OPLA 4A4KA 1D0XA 3VKIA 1KC8C 1I81A 2XDBA 3SWNB 4D8DA 2BKDN 4JLIA 1I5LA 2EJFA 2PVOB 4M7DD 3H41A 3LGLA 3HRSA 3FEOA 1YJWQ 1WXBA 4Z89A 4E7KA 2O01E 3L2QA 3CMAQ 4FSXA 4A4GA 2O4XB 2X4WA 3HL8A 4X34A 2CZ6B 2IIMA 3QG1A 2R58A 3TREA 5I2SA 4M77D 4F16A 3REAB 3LW5E 3O8VA 1VQKA 3QWXX 3L42A 1WQ7A 2MI6A 4M75D 4KBMB 2EQJA 2LMJA 1YI2A 2CP7A 3V8LA 1WQWA 3HKSA 1W2BA 2L3SA 1D0YA 4M7DF 2JS2A 4MZPA 5L23A 1VQ8Q 2YRCA 4GLMA 3H9NA 1JJ2A 3X25B 4HT8A 1WXTA 4N4HA 5FWCA 2P84A 1YHQQ 4NOYA 1HK9A 1KFZA 2J05A 1WLPB 1M1FA 2FHDA 4WF2A 1NJIU 1M1KR 1GCPA 3LH0A 2CT4A 4FT2A 2PZ1A 4DOVA 5GANh 4PL6A 3PNWC 1UEBA 3G71T 4E7JA 1VQ4A 4JZ4A 1NEBA 1FWZA 2FZGB 3AHUA 1VQ5T 1O9SA 4F7UF 3JCMf 5FLXE 4M75F 3M0TA 5IAYA 1V1CA 1VIEA 3OYDA 4J9CA 4JJNK 4M7DG 3MEVA 4JDSA 4F17A 2HQEA 2RK1A 3EAEA 2E1HA 2KROA 4JJCA 1K1ZA 3VUZA 2DPPB 3CXCP 2KYMA 4OVAA 1KQ1A 3OYAA 3QXEB 2K6DA 1PKTA 4OGCA 4MZMA 5GMKm 5CVIA 2X35A 3QIIA 3CD6T 2D0QB 5A0GA 2CSQA 2M9UA 3I35A 3JB9J 3I5RA 3PIPA 2HKQB 4AG2C 4KGXB 5GAMf 5FRMA 1BI3A 1QVGP 3EFOA 3JCMP 4K11A 2QG9B 3S3NA 2L89A 2RMOA 3E9FA 4F7UG 4M75G 2LQWA 4ME7A 5EC7A 4OMLA 2F1LA 2CP2A 1VQLT 2BTTA 2K2VA 2K9GA 3HRUA 3QZ9B 1TXQA 5A2QE 3LWHA 2D1XA 2EQKA 4LD9K 2DILA 5LJ3j 1VQNA 2R5AA 5LJ5h 1HYOA 1MMDA 2JZ2A 3META 3L2VA 2QA4Q 5GAMe 3KUFA 3E1SA 5KYWA 2FO0A 1GFCA 1RAGB 3RBBB 2PNIA 4IUTA 2I0NA 4LUEA 3GP8A 4BI3A
chains in the Genus database with same CATH topology
1QVGP 1VQPQ 1JJ2P 3I56Q 1K9MR 3OW2P 1KD1R 3CCRQ 1M1KR 3CC2Q 3CCEQ 1Q82R 3CCVQ 3CXCP 1K73R 3G71Q 1VQMQ 1KQSP 1VQLQ 3G4SQ 2QA4Q 1VQ4Q 1VQ5Q 3CCQQ 3CMEQ 1YITQ 3I55Q 3CD6Q 1VQ8Q 3CCJQ 1QVFP 3CPWP 3CCSQ 3CC7Q 1M90R 3CCMQ 1VQ9Q 2OTLQ 1Q86R 3CC4Q 1VQKQ 1VQNQ 2QEXQ 1YJWQ 1W2BP 1K8AR 3G6EQ 1Q81R 1KC8R 1YHQQ 1YI2Q 1NJIR 1VQ6Q 3CMAQ 2OTJQ 3CCLQ 1S72Q 1YJ9Q 1YJNQ 1Q7YR 3CCUQ 1VQOQ 1VQ7Q 1YIJQ 1N8RR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG P;  1VQP Q;  1JJ2 P;  3I56 Q;  1K9M R;  3OW2 P;  1KD1 R;  3CCR Q;  1M1K R;  3CC2 Q;  3CCE Q;  1Q82 R;  3CCV Q;  3CXC P;  1K73 R;  3G71 Q;  1VQM Q;  1KQS P;  1VQL Q;  3G4S Q;  2QA4 Q;  1VQ4 Q;  1VQ5 Q;  3CCQ Q;  3CME Q;  1YIT Q;  3I55 Q;  3CD6 Q;  1VQ8 Q;  3CCJ Q;  1QVF P;  3CPW P;  3CCS Q;  3CC7 Q;  1M90 R;  3CCM Q;  1VQ9 Q;  2OTL Q;  1Q86 R;  3CC4 Q;  1VQK Q;  1VQN Q;  2QEX Q;  1YJW Q;  1W2B P;  1K8A R;  3G6E Q;  1Q81 R;  1KC8 R;  1YHQ Q;  1YI2 Q;  1NJI R;  1VQ6 Q;  3CMA Q;  2OTJ Q;  3CCL Q;  1S72 Q;  1YJ9 Q;  1YJN Q;  1Q7Y R;  3CCU Q;  1VQO Q;  1VQ7 Q;  1YIJ Q;  1N8R R; 
#chains in the Genus database with same CATH topology
 3OMC A;  1PWT A;  2QK0 A;  4E7H A;  5IXB A;  3D7S B;  2CZ7 B;  4IUU A;  1N8R C;  1BIB A;  3MHX A;  3PIO A;  4JS4 A;  2LDM A;  3A98 A;  2LCS A;  5KCH A;  2KRS A;  1KC8 R;  2GF7 A;  4M77 A;  1QP2 A;  2ENM A;  1S72 Q;  2L3Q A;  1R8O B;  1WGS A;  1YCS B;  3LX7 A;  3M56 A;  3LYI A;  2JVV A;  3HRT A;  2CKK A;  1WHH A;  1BI1 A;  3X28 B;  2E6N A;  1QVP A;  2KT1 A;  5D6X A;  2AKL A;  1K73 U;  1SSF A;  3CCS A;  4YTL A;  1UHF A;  3LH5 A;  2QQ9 A;  1NEG A;  2YHT A;  2LT4 A;  4QVZ A;  3CCL Q;  4HCB A;  4FYW B;  4FYY B;  4JJD A;  1TH7 A;  4X1V A;  3GOX A;  1WJS A;  1U1S A;  4M78 D;  3JCM W;  1ABQ A;  2L8D A;  2YLB A;  3QZ5 B;  2KY9 A;  3G4S T;  4FT4 A;  4J5Y A;  5FRN A;  3CCJ A;  2XDP A;  4M4Z A;  1YWO A;  1UFF A;  2R5M A;  3EGD B;  5D6Y A;  1WYX A;  3CCM A;  4ZTF A;  1LVK A;  2QEX T;  2RPN A;  4M7D C;  4E2F B;  1RAA B;  2K7A A;  2RN8 A;  5LL6 S;  4BB7 A;  2O88 A;  1W6X A;  2BZY A;  4AFZ C;  4RCC A;  3CCE A;  2DD5 A;  4KGV B;  1M2V A;  2DF6 A;  3CCQ Q;  4XK8 E;  3CXC S;  3A8L B;  3C94 A;  1I1J A;  2CP3 A;  4FSS A;  1W2B P;  1VQ9 A;  3H6Z A;  5LJ3 g;  5IT9 E;  4XU3 A;  2LVM A;  1T3L A;  2CH4 A;  2GQI A;  4M77 C;  3NPF A;  5IH2 A;  3H0F A;  4WCI A;  1VQ7 A;  1JJ2 P;  4OGE A;  3NTI A;  4M75 C;  4M78 F;  1QVG S;  3JB9 I;  1PNJ A;  4KH0 B;  1ZSZ C;  3OYL A;  5CKF A;  3I55 A;  2XU8 A;  3Q1J A;  5L8R E;  4N4G A;  2E6Z A;  4TVR A;  2NLU A;  5IHI A;  1RAI B;  4BAC A;  3HPW A;  1VQO T;  1WHG A;  4M7A B;  3SEM A;  3UA6 A;  1CKA A;  1AT1 B;  4V2S A;  3UDC A;  3CCV A;  3DLL A;  5KE2 A;  2LX7 A;  4ZGE B;  5GAN j;  4IUP A;  3M53 A;  1M1K U;  3M57 A;  3QHS A;  4C8Q B;  3EFS A;  3RKX A;  2MIO A;  1V29 B;  3JB9 H;  4M78 G;  2WSC E;  4A63 B;  2OTJ Q;  1YJN A;  3SD4 A;  3CCU A;  1N5Z A;  3CPW A;  1OYX A;  1JB0 E;  5HK0 A;  2VC8 A;  3G71 Q;  3PMT A;  2CUD A;  4JJB A;  1VQ5 Q;  1FMK A;  2K5F A;  2O9V A;  4X9C A;  2KGT A;  4D6W A;  3QBY A;  3OQ5 A;  4EMK B;  3LLR A;  5ECA A;  4QQG A;  1X2K A;  4RTX A;  5GAO n;  4AT1 B;  1VQP A;  1Y71 A;  3E9G A;  2EKO A;  4LUD A;  2YSQ A;  2A08 A;  2KEA A;  5CKE A;  4HCZ A;  2CZ1 B;  2DL7 A;  5IHK A;  1Q7Y C;  3BY7 A;  3L2R A;  3A5Z B;  3CD6 Q;  4R0K A;  4UC4 A;  1U5S A;  2ZPI B;  1I4K 1;  4J9F A;  2DBK A;  5HCK A;  2K5I A;  1O75 A;  5FRO A;  1VQK T;  1GCQ A;  3S6W A;  2DJZ A;  2FVU A;  1NPP A;  1UDL A;  4C5G A;  4PJN A;  1WFW A;  1GBR A;  1YI2 T;  1N8R R;  1RI0 A;  2BZX A;  1Q81 U;  2E12 A;  1E6G A;  3I9Q A;  5LJ5 j;  2F2X A;  1VQL Q;  2YUN A;  3EGX B;  5KYU A;  1KQ2 A;  4C0D C;  1EFN A;  3G6E A;  3FDR A;  1C0M A;  4NL3 A;  2M1H A;  2DRK A;  3JCM d;  2VXE A;  1KD1 R;  1TTH B;  2KRM A;  4O6J A;  3OYJ A;  1JBM A;  1X27 A;  2OI3 A;  1QKW A;  1VA7 A;  2JUF A;  3UT1 A;  2C0O A;  2Y4X A;  5GMK l;  4XAX B;  3R6N A;  4OP0 A;  1VQ4 T;  2X9H A;  2HQH A;  3OYY A;  1TUG B;  2GGR A;  3QYG B;  3OBW A;  4QQD A;  1AOJ A;  3RKY A;  2O31 A;  2W0Z A;  2KQW A;  5FU7 C;  1T3S A;  1W2B S;  5I21 A;  1M90 C;  4FW1 A;  4DEX A;  1KC8 U;  1Q86 C;  2FG0 A;  4HVW A;  5GAN g;  1D09 B;  4L6V 5;  2QAS A;  1KG1 A;  4XU0 A;  4Q5W A;  1JJ2 S;  1NE8 A;  4J9G A;  5GAM d;  2DBM A;  3V7S A;  4C5H A;  1VUB A;  2C0T A;  4BDZ A;  2A7Y A;  1UJY A;  3OSV A;  3C12 A;  3NTH A;  3S3O A;  3PTA A;  4FU6 A;  4Z8A A;  2FL7 A;  4ZTJ A;  1EZZ B;  5C6S A;  1RUW A;  2LQN A;  1GCQ C;  4ZN1 A;  1NLO C;  5GMK h;  4PJO B;  1K4U S;  2FPF A;  2K3X A;  1S1N A;  4AMC A;  2E5K A;  4KUL A;  3QSU A;  1UTI A;  4M78 C;  1WHM A;  2FYK A;  1LPL A;  1RAF B;  3V7C A;  4BDY A;  4OB3 B;  3GNG A;  3QUI A;  1GBQ A;  1UGS B;  3RR6 A;  4RTY A;  2DYB A;  2DXU A;  1VQN T;  1RAB B;  2MAM A;  3VV0 A;  2CUB A;  3G4S Q;  2M51 A;  2CSI A;  4IKF A;  4IUV A;  3M0R A;  3RER A;  1LNX A;  4LDV A;  5LJ5 g;  1KHC A;  2P0P A;  2EQI A;  4J9H A;  4C92 B;  5I2M A;  2L3R A;  1TU0 B;  2ROT A;  1AEY A;  4DBF A;  2QGG A;  4L59 A;  2CYZ B;  1AVZ C;  3G1J A;  3F70 A;  4OB0 B;  2K3Y A;  4LDY A;  4VUB A;  2A37 A;  1G2B A;  2LJ0 A;  4C0F A;  2KXD A;  1PD1 A;  1EIF A;  2QTX A;  3PVQ A;  3OYG A;  2RM4 A;  4OMO A;  2V8I A;  5KYY A;  2DZ9 A;  1PG5 B;  3EHQ A;  3TQ7 P;  3CPW P;  3CCS T;  2KBT A;  2PVG B;  1RAH B;  1NG2 A;  2QXF A;  1Q7Y R;  1KHI A;  4O5V A;  2KDS A;  5LJ3 f;  1X75 C;  1Y7X A;  1G83 A;  3VS1 A;  2E3H A;  3M0S A;  2HSE B;  3A8M B;  8ATC B;  3VS6 A;  3CCJ T;  3P8H A;  2OTL T;  1AHJ B;  5IHN A;  3CCM T;  2ATC B;  5I22 A;  1H3Z A;  3X20 B;  2ZPE B;  2EBP A;  2V8K A;  3MEA A;  3I56 A;  4FW2 A;  3CCE T;  2K3B A;  3EH1 A;  5LJ3 e;  3FJP A;  1WPY A;  5GMK e;  1YCY A;  4M7D E;  4J9I A;  1WJR A;  2P4R A;  3TEE A;  1VQ9 T;  4JRQ A;  4OF1 A;  4Y28 E;  5GAO r;  5CO7 A;  4XTZ A;  1J3T A;  3VS5 A;  3JCM X;  4BE2 A;  1VQ7 T;  3A8G B;  3M0U A;  1RLP C;  3CPF A;  1B7T A;  1IGQ A;  3L2Z A;  5DLO A;  1D3B A;  1N8R U;  1PSE A;  2E41 A;  1E7O A;  4EMH A;  1K0X A;  1Q95 G;  2COZ A;  1XJW B;  2JM9 A;  1OPK A;  1QP3 A;  1TG0 A;  1Q86 R;  1VQK Q;  3I55 T;  4JRP A;  4M77 E;  1XQH A;  1WHK A;  1IB8 A;  1YI2 Q;  4F7U E;  4M75 E;  1YIJ Q;  3OS1 A;  1OUL A;  5C0M A;  1ZQ1 A;  3BDL A;  1BIA A;  4A4H A;  4EMG A;  2DVJ A;  4QW2 A;  1MV3 A;  3GBQ A;  2D8H A;  2H3E B;  2RI5 A;  4CRI A;  1C1A A;  3SWN C;  3HP9 A;  1TUC A;  2XHC A;  3HSB A;  2DL3 A;  2P0K A;  2XG8 D;  3LWI A;  3CCV T;  1KD1 U;  2L5Q A;  3VS2 A;  2YDL A;  2F69 A;  2DL4 A;  1RAE B;  2H3J A;  3CC7 A;  4J83 A;  3NHN A;  5J3B A;  3A1P A;  2Y90 A;  3M55 A;  2FRW A;  1VQ6 A;  1OZ3 A;  1PHT A;  3VS3 A;  2V1Q A;  5GAN 6;  2RH2 A;  4FYV B;  4PKC C;  1YJN T;  3EFO B;  3M0P A;  3VRY A;  3CCU T;  1ARK A;  2EYY A;  3H0I A;  5GAN 5;  1K8A C;  2X51 A;  1PM3 A;  1VQ4 Q;  2QA4 A;  3EG9 A;  3M58 A;  3T9N A;  2D9T A;  1G3T A;  5GAN 7;  2KK4 A;  4PFO A;  2KSS A;  2LNH B;  2DEQ A;  3THK A;  5CR2 A;  2DXB A;  3OYH A;  1JEG A;  2HCK A;  1YJ9 A;  3L2W A;  4XQ3 A;  2QAZ A;  2L0A A;  3ER0 A;  4MDW A;  1QVF A;  2HZY A;  5GMK j;  2COY A;  1OX8 A;  2MPX C;  2HBP A;  1VQP T;  2ZPG B;  4RG2 A;  3RNJ A;  1Y96 A;  2DMO A;  1M30 A;  1QWF A;  2HQX A;  5KYW B;  2AT1 B;  1IO6 A;  4QT7 A;  3OYE A;  3CPW S;  2K57 A;  4M7D A;  2LCL A;  1X43 A;  1ZA1 B;  1BK2 A;  1B3Q A;  4L5G A;  3BFM A;  2MK5 A;  4C8Q D;  2DIG A;  3CCR A;  1MNE A;  1CKB A;  1BYM A;  3WVE B;  5GAN f;  3GF5 A;  5GAN 8;  2CZ0 B;  2OX7 A;  2RNA A;  5FU6 C;  1BCO A;  1U8R A;  1QMC A;  3A8H B;  4HA8 A;  4RTV A;  2XIC A;  4X9D A;  4II1 A;  4M77 B;  1IZ6 A;  2DX1 A;  2QDL A;  3G6E T;  1WZO A;  1VQN Q;  1H3H A;  4F7U A;  4M75 A;  4J9E A;  3JCM c;  2EGC A;  2ESW A;  2RQT A;  1M1G A;  2XI9 A;  1ZSZ A;  2RB6 A;  3NGP A;  1VQM A;  3EHR A;  2G3R A;  1U3O A;  5KYX A;  2GQV A;  4CI0 C;  1YIT A;  1TSF A;  4HKE A;  1SHG A;  2DRM A;  4M7A F;  1IXD A;  2EFI A;  3EG1 A;  2K4Y A;  1V76 A;  1FXX A;  5GAN e;  1EX4 A;  3VUB A;  2DAQ A;  1Z9Z A;  4C8Q F;  1U1T A;  3OS2 A;  2ZZD A;  1ZA2 B;  5HKC A;  5CKH A;  5GAN 2;  1ZLM A;  3FRN A;  3CCQ A;  1MGQ A;  3UPU A;  1T0H A;  2HL5 C;  2X3W D;  1M3A A;  3CME T;  1P92 A;  2DER A;  2CRE A;  1Y0M A;  2HBW A;  2DXT A;  2OTL A;  2JS0 A;  1ZSG A;  4EPC A;  4XTW A;  1ZX6 A;  2F5K A;  1N6A A;  2OAU A;  4M7A G;  2K5L A;  5LJ5 f;  1Q7Y U;  3VYG A;  4J8O A;  2IVW A;  1D1A A;  1M2V B;  2EYQ A;  3TSW A;  3CCS Q;  3NTK A;  1F1B B;  3EGD A;  3G7Z A;  4AG1 C;  4C8Q G;  1B34 A;  1K9A A;  1PD0 A;  3CC4 A;  2DNU A;  1X69 A;  1WHL A;  4PJM A;  1U06 A;  2NUP A;  3EGU A;  3KXT A;  2QDY B;  3JRZ A;  3CC2 T;  4DQ2 A;  4RTZ A;  2QI2 A;  4M78 E;  2EWN A;  3CCJ Q;  3OS5 A;  1DJ7 B;  3CCM Q;  5LJ5 e;  2EKH A;  2QTV A;  3QJ6 A;  1X6G A;  2ABL A;  2EYW A;  2RJC A;  3S3M A;  2OTJ A;  1FMW A;  4LN2 A;  2E4H A;  3OSS C;  4OMQ A;  3CCE Q;  2IPO B;  1OOT A;  1N27 A;  1K0S A;  3H8Z A;  1AZE A;  3J81 E;  4XU1 A;  2QQA A;  1WDX A;  1HD3 A;  4IIO A;  4LE9 A;  2JNG A;  1VQ9 Q;  2EYZ A;  1K8A R;  1VYU A;  4RMO A;  1UUE A;  4PJO D;  1VYV A;  2FRY A;  1Q86 U;  2BZ8 A;  4IIM A;  2LZ6 B;  3RKW A;  2RD1 A;  3OMG A;  3ZEH A;  5LJ3 d;  3I55 Q;  3FIF A;  3JV3 A;  2AIR B;  4J6Y A;  2D6F A;  2FEI A;  2K79 A;  1K73 C;  4AFU C;  3BE3 A;  4ANJ A;  3KBG A;  2LRQ A;  1UGV A;  1NZ9 A;  1M3B A;  3ME9 A;  4E7S A;  3CCV Q;  3GNF B;  2ZAE A;  4OMN A;  3M4G A;  3MO8 A;  5KH6 A;  2CP0 A;  1QVF P;  2EVR A;  2RA2 A;  3OBY A;  2R57 A;  1XTD A;  2JT4 A;  4N0A A;  2E65 A;  4ZGJ B;  2KXC A;  4PJO F;  4C92 D;  1IHV A;  3UA7 A;  3JSC A;  2DL5 A;  2CS7 A;  2EGA A;  3SDZ A;  1YJN Q;  1NBE B;  3CCU Q;  1LJO A;  2KMT A;  1VYT A;  2A28 A;  5D7U A;  3M4Y A;  4J6X A;  2WAC A;  3I56 T;  4R56 A;  1D1C A;  4CC7 A;  2AZV A;  4HT9 A;  1K9M C;  5KYU B;  3URG A;  4M78 A;  1WX6 A;  2X4Y A;  2COW A;  3OY9 A;  2XID A;  3ZFJ A;  1NLP C;  1BKB A;  3NMZ C;  3PVL A;  4EIK A;  4DBQ A;  2JMA A;  1CSK A;  1WIE A;  1VQP Q;  2AZS A;  4J9D A;  4M7A C;  1H92 A;  2RHI A;  4PJO G;  2VXF A;  3X26 B;  2VGN A;  4QVC A;  2FB7 A;  3EGX A;  1LCK A;  2DD4 A;  5KYN A;  4C0Z A;  2KYB A;  2OAW A;  4C8Q C;  2GFA A;  2M02 A;  3EG2 A;  4C92 F;  7AT1 B;  4MML A;  1SHF A;  1W1F A;  2HKN A;  2KAF A;  2MWP A;  3TSZ A;  1NYG A;  1G3Y A;  5IXF A;  4MZT A;  5CKB A;  2PUO B;  1XNI A;  2LC4 A;  4JLG A;  2PQW A;  1Z9Q A;  2ZPH B;  2GCX A;  4OMM A;  1SG5 A;  3M9Q A;  2C0I A;  3CME A;  3EFR A;  5CIU A;  1M1K C;  1SKU B;  2RHX A;  1AD5 A;  1WNL A;  3CC7 T;  5CCA A;  3G6E Q;  4EMK C;  2I2L A;  1X2Q A;  4N0A C;  1BU1 A;  3PMI A;  1VQ6 T;  1UEC A;  3HHT B;  2IG0 A;  2GTJ A;  4C92 G;  1RAD B;  2DM1 A;  5DM7 R;  3VRZ A;  4ELZ C;  2QA4 T;  3INZ A;  1ABO A;  1GFD A;  2MWO A;  1ACM B;  1WJQ A;  3C0C A;  3SHW A;  2DA9 A;  3EG0 A;  1G5V A;  2H8H A;  1TOV A;  4PJO A;  3UF4 A;  3PE0 A;  1YJ9 T;  1FX7 A;  3SFM A;  3CC2 A;  4FL6 A;  1QQJ A;  4J9B A;  2BE9 B;  2CT3 A;  5GAO m;  4CC4 B;  1UE9 A;  2NUT A;  3QPH A;  4JS5 A;  4HVU A;  2QEX Q;  1Q82 C;  4FM4 B;  2DKG A;  5GAN d;  3DKM A;  3JB9 G;  2JOY A;  5DLQ E;  1MV0 B;  2CP5 A;  1BBZ A;  1KJW A;  3P8D A;  2M0Y A;  4LDX A;  1Q81 C;  3CCR T;  2JN0 A;  5CQX A;  4HVV A;  4Z02 A;  3OYB A;  2RHZ A;  4PNO A;  4LDU A;  1AZG B;  4PLL A;  1QVF S;  2YT6 A;  1YJW A;  2CDT A;  4R55 A;  1YP5 A;  3SB2 A;  1KQS A;  3CMA A;  4C92 A;  3DB3 A;  2QYZ A;  3PT9 A;  2DYI A;  1K73 R;  1OZ2 A;  2J6K A;  5KYY B;  1H64 1;  2ROL A;  1VQM T;  2J7I A;  1LOJ A;  3VS7 A;  4WTO B;  1UG1 A;  1YIT T;  3JCM h;  3MJX A;  3QWY A;  3AT1 B;  1H8K A;  3H0H A;  4IUR A;  2G6F X;  1VQO Q;  2B86 A;  4RCB A;  2YLC A;  3OYF A;  3I5S A;  1K8A U;  1JU5 C;  4E7I A;  1YWP A;  1NYF A;  2KE9 A;  4PJO C;  2J6O A;  4QKU A;  3MP1 A;  1ZBX A;  3RUX A;  3SWN A;  1FMV A;  4XTU A;  2EQU A;  2YRV A;  4GBQ A;  2SRC A;  1E6H A;  3CCQ T;  2HAX A;  1VQ8 A;  5LJ5 d;  3JCM J;  1PCX A;  2JMC A;  3ZL7 C;  2RI2 A;  1SPK A;  1I07 A;  2GTO A;  4IUQ A;  1YHQ A;  3OA6 A;  1M5Q 1;  2O4X A;  2A36 A;  5GAM h;  2FZC B;  2A0F B;  1K9M R;  2M16 A;  3M0Q A;  2LCC A;  1MND A;  4RTW A;  2EQM A;  2EYX A;  3VS4 A;  3M59 A;  1NPR A;  4CC2 A;  4RTT A;  2CH4 W;  5GAN 3;  3CC4 T;  4E7L A;  2F2V A;  3U23 A;  4E7Z A;  4HCC A;  2DL8 A;  1YIJ A;  2M0O A;  4C92 C;  3TU4 K;  4PJL A;  2E5Q A;  2EW3 A;  2XKO C;  4Z88 A;  4KRT A;  1D3B B;  3MCA B;  2DLP A;  4BY6 C;  1QCN A;  3MPU B;  4RUG A;  1M90 R;  2RI3 A;  2VV5 A;  9ATC B;  1WXU A;  3PFS A;  5GJW B;  1PC0 A;  4LDW A;  2O9S A;  3CBO A;  2L2P A;  3QDF A;  5AT1 B;  1SF9 A;  3I56 Q;  2OTJ T;  2DFU A;  2RHY A;  5D6W A;  3C4S A;  1Y57 A;  3V8K A;  2NWM A;  1KK7 A;  1G8X A;  2KT8 A;  4M77 F;  5FU6 B;  5KE3 A;  1W70 A;  1OI1 A;  3DLM A;  4ESR A;  4XTY A;  4J6W A;  1ZUU A;  3UAT A;  2KNB B;  1M9S A;  3HFO A;  4LNP A;  1R0B G;  2RHU A;  3V8J A;  2QGF B;  1AWO A;  5J26 A;  3EG9 B;  2LNV A;  2HNI A;  4EDU A;  1SEM A;  3OW2 A;  4KT0 E;  3OB9 A;  4FIB A;  1TWB A;  4M77 G;  4PJJ A;  3GIB A;  3JCM e;  4MDX A;  1Q82 R;  4GLK A;  3REB B;  2OJ2 A;  1X6O A;  4JUV A;  4A53 A;  4Y91 A;  1QLY A;  4E6R A;  3GPL A;  1G3W A;  3CC7 Q;  1Y96 B;  2FPD A;  3NFC A;  4ORZ A;  2Y4Y A;  3M5A A;  3FB9 A;  1Q81 R;  4M7A D;  4PFZ A;  1VQ6 Q;  4ZGD B;  4M7D B;  2P4T A;  5FWB A;  1S72 A;  3JAM E;  4B9W A;  4OB2 B;  2HSP A;  4JPB W;  2HL3 A;  2MCN A;  3MKD A;  2DVE A;  2ZPF B;  2VVK A;  2ED0 A;  2WSE E;  5FW9 A;  3FLG A;  1BI2 A;  2D8J A;  2L3P A;  1YNZ A;  2ECZ A;  2XDD A;  1T0J A;  1MHN A;  3KFV A;  1ZUY A;  2LTO A;  1YJ9 Q;  2V26 A;  2X4X A;  3CCL A;  1D0Z A;  1KIK A;  3ASK A;  3QDR B;  2EJG A;  1GL5 A;  1MUZ A;  4F7U B;  4M75 B;  3N5B B;  2DK3 A;  1M8M A;  5M9O A;  4JRI A;  1NJI C;  1KQS P;  1ZSZ B;  4P5N A;  1B07 A;  2LX9 A;  2DTI A;  2QQS A;  5KYX B;  3TCJ A;  1FYN A;  2MYS A;  3FJ5 A;  5A0L A;  1RLQ C;  2RF0 A;  2J06 A;  4RKU E;  3CQT A;  4M7A E;  4KUI A;  2DET A;  3FC3 A;  1K76 A;  2RQR A;  4GY5 A;  4BI8 B;  5CK9 A;  3CCR Q;  1QWE A;  1N9S A;  4BUG A;  4C8Q E;  4DEY A;  2VUB A;  1KSW A;  2SEM A;  4J7I A;  2MF2 A;  1AWJ A;  3MP8 A;  3UWN A;  1KD1 C;  5HY6 A;  4MMK A;  4ZNX A;  3DB4 A;  2VB6 A;  2EPD A;  4A4F A;  2ZGW A;  2RK2 A;  4FCY A;  4RTU A;  2KI7 A;  1RAC B;  2PTK A;  2JM8 A;  1PRL C;  1VQM Q;  3L1A A;  2LJ1 A;  3OYM A;  1YIT Q;  3V7R A;  5GAO l;  4QVD A;  4LXC A;  1AWW A;  4C0G A;  5CKD A;  2YUO A;  2CGH A;  1B34 B;  2FZK B;  3RDV A;  2W10 A;  1IHW A;  2D0N A;  3RES A;  1OQK A;  1XOV A;  5GAM j;  3QJY A;  2O2O A;  3QKJ A;  8AT1 B;  1Y07 A;  1OX9 A;  2EJ9 A;  1OU9 A;  1RL2 A;  2NUP B;  2RJF A;  2RQV A;  5CQY A;  1A0N B;  2F2W A;  1WHJ A;  3ZBD A;  1G3S A;  1MMN A;  1K9M U;  1OV3 A;  3C95 A;  2LP5 A;  2OTL Q;  3TVT A;  3O5Z A;  2HD0 A;  1GXI E;  3GLX A;  5GJV B;  4BE0 A;  2RQU A;  1YFN A;  2X4J A;  2KRN A;  2E10 A;  2B8A A;  2CP6 A;  3RMS A;  2RJD A;  2XK0 A;  3VJP A;  1N9R A;  2RQW A;  5CAI A;  3G71 A;  2YUP A;  2DIQ A;  2DO3 A;  5GAO q;  1VQ5 A;  2ZCF B;  2XMF A;  1YBY A;  4FYX B;  4C0D B;  3CC4 Q;  4ZN3 A;  5KCO A;  4BD3 A;  2C06 A;  4HXJ A;  1M90 U;  1YJW T;  1QCO A;  1R77 A;  2LQK A;  1VQ7 Q;  2F5T X;  3LGF A;  3BDU A;  4M7A A;  3CMA T;  4PLI A;  2J6F A;  3X24 B;  4C8Q A;  3J80 E;  4QQ6 A;  4F04 B;  3CD6 A;  1BI0 A;  4AFQ C;  1AWX A;  3CEY A;  2NYS A;  4J7F A;  2JTE A;  1HXD A;  2ZPB B;  5FU7 B;  4JZ3 A;  2E3I A;  1M4Z A;  5J39 A;  4C5E A;  3OW2 P;  1D1B A;  1JO8 A;  2EAY A;  4A4E A;  3RIR A;  3JCM g;  5GAN 4;  4AFS C;  1OU8 A;  5IN1 A;  1VQL A;  2PVD B;  2Z0W A;  4KUD K;  1KQS S;  4OMP A;  1VQ8 T;  1UJ0 A;  2YRD A;  2DZC A;  4EMK A;  1GRI A;  5HK3 A;  2YWW A;  1YHQ T;  4PJO E;  1UHC A;  2DTH A;  3QO3 A;  2DTO A;  4HCK A;  3M54 A;  3EH2 A;  2BUD A;  2P0Q A;  1Q82 U;  4KH1 B;  3VYH B;  4M78 B;  5GAM g;  3MEW A;  2HMA A;  1NJI R;  3L2U A;  4F14 A;  5A0D A;  1M8V A;  2DJQ A;  1VOM A;  4BI4 A;  2JTM A;  1W4S A;  2ED1 A;  1YIJ T;  4E47 A;  4ATO A;  1QCF A;  1PRM C;  1VIF A;  3EG3 A;  2JJ9 A;  3JB9 D;  3E2U A;  1SRM A;  3HTR A;  1I8F A;  2KVQ G;  3BW1 A;  4C92 E;  1ZBJ A;  1TUD A;  4RG8 A;  1IRE B;  4OMF B;  4XU2 A;  3ULR B;  2BIV A;  4ELY C;  2QQR A;  2VYT A;  2E64 A;  3OYI A;  1NM7 A;  3WVD B;  4DBR A;  1UGR B;  4JRK A;  1ZHI A;  1JXO A;  1M27 C;  1X01 A;  3JCM b;  3CXC A;  1UB4 A;  3VU3 C;  1BCM A;  2X3X D;  2K2M A;  2KR3 A;  2PUK B;  2BE7 D;  4NS5 A;  4XTV A;  1SRL A;  1M2O A;  3JB9 F;  1MMA A;  2EIF A;  4LD6 A;  2YUQ A;  3MEU A;  3RMQ A;  1IRX A;  2V8J A;  4PFP A;  3WXM B;  3G4S A;  2VGM A;  4B6M A;  1QVG A;  1JRI A;  1PKS A;  2QEX A;  2E70 A;  2WSF E;  2QQB A;  3R6O A;  2NUZ A;  2LQ8 A;  3OYN A;  2DXC A;  5AYF A;  4DOW A;  1WI7 A;  2AK5 A;  1ZUK A;  1QKX A;  1UGQ B;  5LJ3 h;  2YXY A;  2JW4 A;  5I11 A;  4XTX A;  2GFU A;  3CME Q;  4OB1 B;  4A54 A;  5GMK i;  2RJE A;  4PK4 A;  3IQL A;  1UGP B;  3OYC A;  1IGU A;  2NUT B;  3OYK A;  2LT1 A;  4DA4 A;  2PU9 B;  1JXM A;  2HEQ A;  4NL2 A;  3MP6 A;  3JCM V;  4D8K A;  3J7A F;  3HFN A;  1S72 T;  4CC3 A;  1X6B A;  1JQQ A;  5EG2 A;  2V1R A;  5DY9 A;  2A3L A;  3CBM A;  3OS0 A;  3OW2 S;  2VWF A;  2VKN A;  1I5O B;  3P8B B;  2MMP A;  2JTF A;  1BB9 A;  4DBH A;  3JCM Q;  1M3C A;  2XD0 A;  1R0C B;  3A8O B;  2JXB A;  4B9X A;  2DEU A;  5GAO p;  1HJD A;  3QYH B;  3E19 A;  2DE0 X;  1OEB A;  1WA7 A;  1HSQ A;  4BE1 A;  4KGZ B;  1VQO A;  2EGE A;  2GNC A;  2GBQ A;  3CCL T;  2HDA A;  2FPE A;  1I0C A;  4C5I A;  3CC2 Q;  2MOX A;  1QW1 A;  4Y92 A;  1YN8 A;  4BY6 B;  3CBP A;  3PGG A;  1RI9 A;  1PSF A;  3VS0 A;  2AKK A;  2VAS A;  6AT1 B;  1TS9 A;  2AHJ B;  1SSH A;  1C6V X;  2LJ3 A;  1MMG A;  2RO0 A;  4N4I A;  1OPL A;  4A4K A;  1D0X A;  3VKI A;  1KC8 C;  1I81 A;  2XDB A;  3SWN B;  4D8D A;  2BKD N;  4JLI A;  1I5L A;  2EJF A;  2PVO B;  4M7D D;  3H41 A;  3LGL A;  3HRS A;  3FEO A;  1YJW Q;  1WXB A;  4Z89 A;  4E7K A;  2O01 E;  3L2Q A;  3CMA Q;  4FSX A;  4A4G A;  2O4X B;  2X4W A;  3HL8 A;  4X34 A;  2CZ6 B;  2IIM A;  3QG1 A;  2R58 A;  3TRE A;  5I2S A;  4M77 D;  4F16 A;  3REA B;  3LW5 E;  3O8V A;  1VQK A;  3QWX X;  3L42 A;  1WQ7 A;  2MI6 A;  4M75 D;  4KBM B;  2EQJ A;  2LMJ A;  1YI2 A;  2CP7 A;  3V8L A;  1WQW A;  3HKS A;  1W2B A;  2L3S A;  1D0Y A;  4M7D F;  2JS2 A;  4MZP A;  5L23 A;  1VQ8 Q;  2YRC A;  4GLM A;  3H9N A;  1JJ2 A;  3X25 B;  4HT8 A;  1WXT A;  4N4H A;  5FWC A;  2P84 A;  1YHQ Q;  4NOY A;  1HK9 A;  1KFZ A;  2J05 A;  1WLP B;  1M1F A;  2FHD A;  4WF2 A;  1NJI U;  1M1K R;  1GCP A;  3LH0 A;  2CT4 A;  4FT2 A;  2PZ1 A;  4DOV A;  5GAN h;  4PL6 A;  3PNW C;  1UEB A;  3G71 T;  4E7J A;  1VQ4 A;  4JZ4 A;  1NEB A;  1FWZ A;  2FZG B;  3AHU A;  1VQ5 T;  1O9S A;  4F7U F;  3JCM f;  5FLX E;  4M75 F;  3M0T A;  5IAY A;  1V1C A;  1VIE A;  3OYD A;  4J9C A;  4JJN K;  4M7D G;  3MEV A;  4JDS A;  4F17 A;  2HQE A;  2RK1 A;  3EAE A;  2E1H A;  2KRO A;  4JJC A;  1K1Z A;  3VUZ A;  2DPP B;  3CXC P;  2KYM A;  4OVA A;  1KQ1 A;  3OYA A;  3QXE B;  2K6D A;  1PKT A;  4OGC A;  4MZM A;  5GMK m;  5CVI A;  2X35 A;  3QII A;  3CD6 T;  2D0Q B;  5A0G A;  2CSQ A;  2M9U A;  3I35 A;  3JB9 J;  3I5R A;  3PIP A;  2HKQ B;  4AG2 C;  4KGX B;  5GAM f;  5FRM A;  1BI3 A;  1QVG P;  3EFO A;  3JCM P;  4K11 A;  2QG9 B;  3S3N A;  2L89 A;  2RMO A;  3E9F A;  4F7U G;  4M75 G;  2LQW A;  4ME7 A;  5EC7 A;  4OML A;  2F1L A;  2CP2 A;  1VQL T;  2BTT A;  2K2V A;  2K9G A;  3HRU A;  3QZ9 B;  1TXQ A;  5A2Q E;  3LWH A;  2D1X A;  2EQK A;  4LD9 K;  2DIL A;  5LJ3 j;  1VQN A;  2R5A A;  5LJ5 h;  1HYO A;  1MMD A;  2JZ2 A;  3MET A;  3L2V A;  2QA4 Q;  5GAM e;  3KUF A;  3E1S A;  5KYW A;  2FO0 A;  1GFC A;  1RAG B;  3RBB B;  2PNI A;  4IUT A;  2I0N A;  4LUE A;  3GP8 A;  4BI3 A; 
#chains in the Genus database with same CATH homology
 1QVG P;  1VQP Q;  1JJ2 P;  3I56 Q;  1K9M R;  3OW2 P;  1KD1 R;  3CCR Q;  1M1K R;  3CC2 Q;  3CCE Q;  1Q82 R;  3CCV Q;  3CXC P;  1K73 R;  3G71 Q;  1VQM Q;  1KQS P;  1VQL Q;  3G4S Q;  2QA4 Q;  1VQ4 Q;  1VQ5 Q;  3CCQ Q;  3CME Q;  1YIT Q;  3I55 Q;  3CD6 Q;  1VQ8 Q;  3CCJ Q;  1QVF P;  3CPW P;  3CCS Q;  3CC7 Q;  1M90 R;  3CCM Q;  1VQ9 Q;  2OTL Q;  1Q86 R;  3CC4 Q;  1VQK Q;  1VQN Q;  2QEX Q;  1YJW Q;  1W2B P;  1K8A R;  3G6E Q;  1Q81 R;  1KC8 R;  1YHQ Q;  1YI2 Q;  1NJI R;  1VQ6 Q;  3CMA Q;  2OTJ Q;  3CCL Q;  1S72 Q;  1YJ9 Q;  1YJN Q;  1Q7Y R;  3CCU Q;  1VQO Q;  1VQ7 Q;  1YIJ Q;  1N8R R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...