3CXCP

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cxcP00
1VQ9Q 3I55Q 1Q7YR 3CCQQ 3G6EQ 1K8AR 3CC4Q 1KQSP 1VQNQ 1YJNQ 1VQOQ 1S72Q 3OW2P 1YHQQ 1M90R 1VQ7Q 3CCUQ 3CCRQ 1VQPQ 1N8RR 3CC2Q 3CXCP 1Q81R 2QA4Q 3CCEQ 2QEXQ 1JJ2P 1QVGP 1YITQ 1W2BP 1M1KR 3CCSQ 1VQLQ 1K9MR 3CCLQ 1KD1R 3CMAQ 1VQ4Q 1YI2Q 2OTLQ 1YJ9Q 1VQMQ 1K73R 3CCVQ 3CMEQ 2OTJQ 3G4SQ 3G71Q 3I56Q 3CD6Q 3CCMQ 1YIJQ 3CCJQ 1VQ8Q 1KC8R 3CC7Q 1Q82R 1NJIR 1VQKQ 1QVFP 1YJWQ 1Q86R 1VQ5Q 3CPWP 1VQ6Q
chains in the Genus database with same CATH superfamily
1Q82U 4Z02A 2EQKA 1VA7A 3QYGB 3CCLA 1UE9A 5J3BA 1K4US 2P0KA 2PUKB 4JDSA 2K3BA 1MUZA 1QP2A 3ME9A 2K57A 4IUVA 8ATCB 4X34A 1XQHA 4X1VA 3G6ET 1PG5B 1ZSZB 5LJ3h 1QP3A 2DBMA 5CQXA 4JRPA 2F1LA 2FB7A 4J9BA 4KULA 2RO0A 2QA4Q 4AFSC 2EJFA 4C0DC 1OOTA 2KYBA 1ZQ1A 5GAOm 4AFZC 3URGA 3QXEB 4JJNK 1TUCA 3EFRA 3G6EA 1K1ZA 3UPUA 2QGGA 3EG0A 3MJXA 3CXCS 2PUOB 4ME7A 2JW4A 4QVCA 2ZPBB 4FCYA 1SEMA 1WIEA 4JLIA 3EGXA 1KHCA 1Q81U 1QKXA 2M0OA 1ZUYA 3QWYA 1VQMQ 4RUGA 1VQ6T 1AWXA 3CCQT 1M3CA 3UT1A 2YT6A 1JBMA 2HSEB 1VQOA 1K0XA 1XOVA 2V8JA 4RTZA 2DVEA 4FT4A 2R57A 4XTUA 1KQSP 1VQLT 3MP6A 2K9GA 2VGMA 4ZTJA 3X24B 2B86A 5EC7A 4IKFA 1XJWB 5LJ3d 2DXTA 1VQKT 5GANj 2K5IA 4EMKA 2CP0A 2QK0A 2RJDA 1K73U 4PFOA 1YHQT 3NTHA 2COWA 2O88A 3VS0A 1Q86R 3PVQA 1T3SA 2XU8A 1VQ7Q 2RHUA 4EMGA 1VQLA 2M0YA 4M75A 5I11A 3I5RA 2ATCB 1G2BA 3TVTA 4DOVA 4KGXB 2QDLA 2LQNA 4AG2C 4II1A 2F69A 4M7AB 3L2UA 2LC4A 5I2MA 2O9VA 3RIRA 3FLGA 1YJNA 2CS7A 1YN8A 4BE0A 4R56A 5GAN5 4LN2A 3VS4A 9ATCB 1UG1A 4ZGJB 1RAHB 4XU3A 2DVJA 2BZXA 3KFVA 1FYNA 1H92A 4M78C 2JXBA 2QTXA 2I2LA 3CMEA 4LUDA 2VXEA 4J9FA 2VC8A 2K2VA 1OX9A 3RBBB 2E70A 1WPYA 4LUEA 1GCQC 5KYXB 1BIBA 1Q82R 4M7AC 3EGUA 3M56A 3RMSA 2M1HA 3CCET 2QEXA 4CC3A 3M4GA 1YCSB 3JB9I 1WHHA 2K2MA 3HKSA 1N8RR 2ZZDA 3CCVA 2ZPGB 2AKLA 2RI3A 2AK5A 3CCMA 3UATA 3CMAQ 2M02A 4N4GA 1M27C 1NPRA 5GMKe 4IIOA 1YIJQ 3CCJQ 1PKSA 1WX6A 2L0AA 2GNCA 3EAEA 2PNIA 4FU6A 2JVVA 3WVEB 3CCEA 3M0TA 3L2WA 4J9IA 2L3PA 3HFOA 3MEUA 2RNAA 3PVLA 3CCSQ 2ZCFB 1VYUA 2E12A 3KUFA 1WQ7A 1QMCA 2RQTA 2RB6A 4HVUA 1BI0A 5GAOn 3CC2T 4E2FB 2EVRA 4RTVA 1JEGA 3IQLA 4M75E 3UWNA 2C0TA 2DD4A 5KH6A 5DM7R 1Q81R 5KCOA 2AZVA 5CVIA 3JCMV 5EG2A 2E6NA 1U5SA 3CPWA 2QDYB 1UDLA 1V76A 2ROLA 2EBPA 2D8HA 5KCHA 1N8RC 1QVPA 5D6XA 3QUIA 2O9SA 3X26B 2LVMA 3CC2A 2CGHA 2CP2A 1SF9A 2QA4A 5GANg 1NJIU 3EGXB 2MK5A 3M0PA 1MNEA 1JQQA 4QQDA 4J6WA 1KIKA 4WCIA 3SWNA 3CD6T 1H3ZA 3E9FA 2RI5A 2XDPA 4J5YA 3HSBA 2RD1A 1TWBA 1K73R 4VUBA 1SPKA 3DLLA 1M5Q1 2D0NA 4X9DA 4E7JA 2PVDB 1W2BA 4BI3A 1D0XA 2E4HA 4F7UE 1IXDA 1E7OA 3JCMc 4PL6A 1X2QA 3C95A 4L5GA 4PJNA 3PTAA 3VYGA 4QQ6A 4KGVB 3NPFA 1PNJA 1FMVA 2AZSA 3CBMA 3JCMf 3BE3A 2G3RA 3LGLA 3V8KA 3JB9G 2DA9A 4PJOA 1YI2T 3JB9F 4OB0B 2CZ7B 1PSFA 4IURA 2FYKA 5FRMA 1YFNA 2ZPFB 4FYVB 4XAXB 5GAOp 1NEGA 4QW2A 4MMLA 1QVFS 2GTJA 3EG9A 4A54A 1U1SA 1BBZA 3PMTA 1VQ7A 1DJ7B 3GPLA 1AWJA 1UGQB 3PNWC 2HEQA 2ZGWA 4C92C 2DNUA 3JCMg 5GANh 3PIOA 5KE2A 2BE7D 5CR2A 2DRKA 2GBQA 3QHSA 1SSHA 4B9XA 2RPNA 5GMKj 1E6GA 4RKUE 1AD5A 1UGRB 2V1QA 2P84A 2YDLA 3QO3A 2RK2A 1I07A 2E65A 4ZN1A 1I0CA 1SHFA 1D1CA 1QVGA 1VQNQ 1AEYA 2DK3A 1S72Q 4BE2A 4P5NA 2X51A 2JN0A 2RHIA 2X4JA 4PLIA 3EGDA 2X3XD 4JS5A 1UJ0A 4HVVA 3UA6A 4UC4A 1WXTA 3LLRA 3MHXA 3RKXA 2K79A 2BE9B 3NHNA 4FL6A 2K3YA 4RTYA 1B34B 2QXFA 3MP8A 2OI3A 4J7IA 5CO7A 2JM9A 2XMFA 2JT4A 2KNBB 2GF7A 1ZBXA 3CCUQ 2OTLT 1B07A 3X20B 1NYFA 4ZN3A 4RCCA 3I9QA 2M51A 2IG0A 1BCOA 5A0DA 1BI3A 1UGSB 4FYYB 5GAN2 1N27A 5GANd 3OW2S 5ECAA 1G3WA 1NJIR 1M2VB 2LCLA 4JZ3A 4PJOE 3RMQA 2R5AA 3CCSA 4C0ZA 2CP7A 4GBQA 3OS5A 1O9SA 4XU1A 4BUGA 3JCMb 3E19A 2DYIA 3VS6A 2SRCA 2EYYA 1WXBA 2EFIA 1G83A 3M0QA 1VQ5A 3ZBDA 1SRMA 3GLXA 1D3BA 3CPWP 1NPPA 4HCCA 3SWNB 3RKWA 3A8LB 4FSSA 1GL5A 2KGTA 1UEBA 2MIOA 2D1XA 4RTXA 3N5BB 5GAOl 2RJFA 3MP1A 5CKEA 1M1KU 1KQSA 3SB2A 3M9QA 1IO6A 4M77B 4KUDK 1KSWA 3FJPA 2B8AA 4M75G 5FWBA 2H3EB 6AT1B 4M75F 2F2VA 2EW3A 3JRZA 3QPHA 4X9CA 5LJ3f 4HT9A 4FYWB 4BE1A 4D6WA 2HNIA 4ORZA 4LE9A 3QDFA 1RLPC 1X6BA 4N0AC 4DBRA 2D0QB 3CXCA 4M75D 1YITT 2MCNA 2BUDA 1AHJB 2LZ6B 1VQ4T 4M78A 2FHDA 2KT8A 2KEAA 1VQ8T 2A08A 1PKTA 1W70A 2FRYA 1CKAA 5GMKm 3JCMP 2CUDA 2CT3A 2L3RA 1ACMB 5LJ3g 2QQSA 1GCQA 2EJGA 2MWPA 4M7AA 1BYMA 3DB4A 1RAIB 4AFQC 1YHQQ 1ZA1B 4OGCA 5A2QE 4F7UG 4PJJA 5D7UA 1JO8A 1WHLA 4KH1B 5A0LA 1AWOA 1JXOA 3P8DA 4M7DD 2J06A 4J9GA 1M1GA 4BI8B 2EGEA 2JTEA 2LJ1A 2LQWA 1QCFA 2LQKA 4BDZA 4Y28E 1VQ9Q 4J9EA 3HP9A 1RUWA 3CCLT 2DRMA 4F17A 1RI9A 1PCXA 3TSWA 2DZ9A 1GXIE 1WGSA 1QVGP 3CC7T 2A28A 1OX8A 4V2SA 5CQYA 2L3QA 1V29B 1JB0E 4C8QD 3R6NA 4LD9K 4KBMB 1S72A 2L2PA 1YWOA 2LCCA 4PJLA 5GMKh 1MMGA 2M9UA 2XICA 4XTZA 4DBFA 1Y0MA 4C0DB 4JZ4A 2Y90A 3BDLA 2AIRB 1SRLA 1IGUA 1T3LA 2NUPA 1X01A 5I22A 3CC7A 4D8DA 4E7SA 2FEIA 1BCMA 1E6HA 1V1CA 1MMDA 4OB2B 3CCUA 2ROTA 4D8KA 1U8RA 4K11A 4E7HA 3LWHA 4LDXA 5GAN8 4RTWA 1YBYA 1D1BA 2OJ2A 3M57A 4RTUA 3OYGA 4HCKA 3FEOA 1M1KR 1TXQA 3MEWA 1BK2A 2DXBA 1PM3A 4B9WA 2V1RA 2DZCA 1D3BB 1RL2A 3LH5A 5IH2A 1AWWA 4OMMA 4M7AE 3OYLA 1VQOT 4LXCA 4ESRA 1U3OA 1B7TA 1OQKA 2F5KA 3GP8A 2XI9A 5LJ5e 2PU9B 1JU5C 4BDYA 3GIBA 3M54A 2LNHB 2PVOB 5CAIA 4ATOA 1EZZB 2RK1A 2E41A 5CKBA 2KR3A 5GAN6 2E3IA 4RG2A 1VQPA 2YRVA 4PJOG 1KC8U 2XDDA 2G6FX 2RHZA 4PJOF 3SD4A 1LCKA 2QAZA 1UB4A 1RACB 2HL5C 2ZPIB 3I55T 2VVKA 1OEBA 1YJNT 3CD6Q 1ABOA 4PJOD 3Q1JA 1IHWA 1RAGB 1FMKA 4M78B 1BI1A 2DERA 4C92A 5FRNA 5KYNA 3OYAA 3CMET 1JRIA 3CXCP 1G5VA 1M90U 2EQMA 1BI2A 4OMNA 3I56A 1H3HA 3OYIA 1O75A 2KVQG 3OBWA 4Z88A 3FIFA 4LNPA 1AVZC 1LOJA 2DE0X 2EYZA 1M9SA 3I55A 3F70A 3OSVA 1HYOA 3MO8A 4FIBA 2QEXT 3INZA 2YUQA 3RR6A 2E10A 4EDUA 3CCVT 2W0ZA 1YJ9A 1UHCA 4CC4B 2OTJA 1H641 3CCMT 3OMCA 2ZPEB 2HMAA 4DBQA 3D7SB 5FU6C 1C6VX 2X4XA 2EQJA 3VS2A 1X43A 2GQIA 2KYMA 3NTIA 1TS9A 3G71Q 3L42A 2YUOA 3CC4Q 2KMTA 2KBTA 8AT1B 3VS7A 2X4YA 2HBPA 3M0RA 5GAOq 1Q86C 2WSEE 4KH0B 4DOWA 1J3TA 1VQ9A 1BB9A 2K6DA 4XQ3A 1WZOA 3LGFA 2LJ0A 1C1AA 2LQ8A 3UDCA 3OA6A 1K76A 1U06A 1B34A 2CUBA 2NUPB 2OAUA 3M0UA 2RQRA 1M1FA 2ED0A 2JZ2A 1T0HA 3EFSA 3I5SA 2MOXA 1N9SA 5KYWB 1K9MU 3BDUA 3EG1A 4HCZA 5GANf 5LJ5j 3HRSA 4E6RA 2QA4T 2H8HA 1PHTA 2Z0WA 1JJ2S 3VS3A 2XIDA 2DL3A 1UECA 1K8AU 1IZ6A 2K5LA 1M2VA 3CCRQ 1TSFA 2RHXA 3RUXA 1KG1A 5CKFA 1Q82C 1GBQA 2OTLQ 4JLGA 4MZPA 1RLQC 2ZAEA 4ZNXA 3M4YA 1M8VA 1KC8R 1X6GA 2HQHA 4OMLA 4M4ZA 1VQMT 1VUBA 2Y4XA 1ZUKA 2HBWA 2HQEA 2NWMA 3LH0A 2EGAA 4DQ2A 1NLPC 1FWZA 2FRWA 2FVUA 3A98A 5KE3A 3J80E 3OW2A 4J7FA 1MMNA 4N0AA 4F16A 5IN1A 3JCMX 1U1TA 5CK9A 2CP3A 1F1BB 3OB9A 4M77A 1M90R 2LMJA 1HK9A 1OZ3A 4M78F 1VQMA 3M55A 1QLYA 1NEBA 2A0FB 1D0ZA 4J6YA 5DLOA 1XNIA 2BZ8A 2FPDA 4M7AG 1VQ7T 3CEYA 4C92B 2E6ZA 1Q81C 4M7AF 1CKBA 3BFMA 4OF1A 2C06A 3V7SA 2LP5A 1XTDA 1W6XA 2X3WD 3EFOA 2CH4A 4C0GA 2DTOA 2DLPA 3EHQA 1ZX6A 2EKHA 3JB9D 1X27A 1UGPB 4Z89A 3QKJA 2HQXA 1FX7A 1G3TA 2MPXC 4NS5A 1G8XA 2COYA 2E64A 1K73C 4RG8A 1Q7YU 2EIFA 1Y96A 3MKDA 4J6XA 1YITQ 2YUNA 3GF5A 1VQ4Q 1NM7A 1WHKA 5GMKl 1KD1U 4DEYA 4BACA 4IUQA 1D1AA 1VQ8Q 1YJWQ 3ASKA 1ABQA 3BW1A 3L2VA 3ZEHA 2SEMA 3OQ5A 3SFMA 4N4IA 2CKKA 3ZL7C 4KT0E 1N6AA 2DXCA 1FMWA 2PQWA 3OYMA 2COZA 1K9MR 3GBQA 2JUFA 2J7IA 4M7DB 4HA8A 3G71A 4Y91A 3G4SQ 1M30A 2JMAA 3PE0A 3HFNA 4C5GA 3OYBA 1WNLA 4A4KA 3RKYA 1QVFP 2EYWA 3MPUB 4M77E 1N9RA 3CCST 2MWOA 3NFCA 2BIVA 5GAMe 3CMAA 2YSQA 1JXMA 1QKWA 3OYEA 2R5MA 2CZ6B 4JJDA 1BIAA 2GFAA 1YIJA 3CCJA 4C8QB 3A8OB 1VQ5T 3OBYA 2HCKA 3FRNA 3WVDB 4OMFB 4WF2A 1EX4A 1LNXA 1RABB 3DB3A 2DM1A 4M7DC 3P8BB 4JPBW 1ZLMA 2FZGB 5D6YA 4E7ZA 2DX1A 5KYUB 3C12A 4CC2A 1KJWA 1NG2A 2XD0A 3PMIA 3H9NA 1PD1A 3X28B 4RCBA 2DF6A 4R55A 3MEVA 1HD3A 2RM4A 4C8QC 3CCRA 3S3NA 2O2OA 2RQVA 1ARKA 3T9NA 4A53A 2EAYA 3G6EQ 3GOXA 1W2BS 1WI7A 4JRKA 2V26A 4J9CA 5DLQE 2DPPB 2HKNA 2W10A 3REAB 5LJ5h 1PD0A 1GRIA 1H8KA 3HL8A 1UHFA 2F5TX 1GCPA 3THKA 2VKNA 5GAN7 2LTOA 2XK0A 3L2QA 3PT9A 4C92G 2NYSA 4A4FA 2VUBA 3KBGA 4C92F 1VQOQ 2QYZA 1VYVA 3OW2P 2RJEA 1K9AA 2DL4A 2RF0A 5GAOr 3V8LA 3H8ZA 1NJIC 2KRSA 2WSCE 1FXXA 1OULA 2IPOB 2JMCA 2WACA 1OPKA 2KK4A 2CZ1B 2KDSA 3S3OA 3OYJA 1VQ6Q 2PZ1A 1Q7YR 3CCQQ 2D8JA 1UJYA 2I0NA 2M16A 1X6OA 2RJCA 3EFOB 4FW1A 3JCMW 4DBHA 3V7CA 4FM4B 3JAME 1I5OB 4R0KA 2KSSA 1VQLQ 1KD1R 1YWPA 3WXMB 3VRZA 2JM8A 2HSPA 2D9TA 5A0GA 2DIGA 2ECZA 2RQWA 1VQKQ 4WTOB 1Y96B 4JJCA 3P8HA 5LJ5d 5CIUA 3RDVA 3O5ZA 3AT1B 2ZPHB 4KGZB 2JNGA 5J39A 2R58A 2LT4A 4BY6C 1Z9QA 2XDBA 2JS0A 2YHTA 3CMEQ 1ZUUA 2DILA 2A7YA 3QJYA 3QYHB 1S72T 1VYTA 1KQ2A 4Y92A 2MF2A 3VJPA 4J9DA 4PJOC 3HRUA 5GAMj 3S3MA 2QEXQ 1Y7XA 1C0MA 2YLBA 4Z8AA 2J6KA 4XTYA 1YJWA 2EQUA 3CCVQ 1S1NA 1R77A 2K5FA 3CCMQ 2RI2A 1VQNA 3CCUT 2IVWA 3G1JA 4C5EA 2RH2A 2L5QA 2X4WA 2CSQA 2KT1A 4IUPA 2VXFA 1IREB 3C4SA 1Y71A 3CCEQ 2CT4A 3CBPA 5IHKA 3EH2A 3OMGA 1Z9ZA 2LX9A 2WSFE 2NUTA 3E1SA 3TCJA 5GMKi 1W4SA 4AG1C 2MMPA 1NYGA 2O31A 5KYWA 3O8VA 5HCKA 2QI2A 3VYHB 4M78E 3AHUA 2D6FA 3JB9J 4XU0A 1N8RU 3ZFJA 3E9GA 1NE8A 2J6OA 4LDVA 2F2WA 2JTMA 2E5QA 1TTHB 4BI4A 1KQSS 1YNZA 3M53A 4IUUA 3JCMe 2Y4YA 1WFWA 4JRIA 5FLXE 1VQPT 4NOYA 4M77G 3VKIA 4FSXA 4LD6A 3HTRA 5I21A 1WHGA 1ZHIA 4M77F 5AT1B 3A8GB 1IRXA 2DYBA 3CC2Q 1AOJA 4QVZA 4KRTA 1R0CB 4CC7A 1AT1B 2DKGA 4C5HA 3EG2A 4M77D 2HAXA 4QT7A 3TSZA 1TU0B 2H3JA 1TOVA 2NLUA 1JJ2A 2VV5A 3EHRA 2FZKB 1ZSZC 2J05A 2XG8D 7AT1B 1Y57A 3U23A 1RADB 3M5AA 1G3SA 5GAMf 4YTLA 5L23A 4DA4A 3I56T 3PGGA 3NMZC 5J26A 2ENMA 3OS1A 3TEEA 3FDRA 3OSSC 2LCSA 2LT1A 3A8MB 3SEMA 4NL3A 3QWXX 1LJOA 3PIPA 1WYXA 1M1KC 3JB9H 1UUEA 3LYIA 3TQ7P 2V8IA 1YJ9T 1UFFA 4J83A 2OTJT 5FROA 3MEAA 5FU6B 2LNVA 1CSKA 4PKCC 4OVAA 5GAMg 1VQ6A 3JCMQ 3CCQA 3G7ZA 1Y07A 1PWTA 4E47A 4MZTA 1M2OA 1TUDA 3JV3A 2DAQA 5D6WA 1NZ9A 2MI6A 2VASA 3M59A 1AZGB 5FU7B 5HY6A 1OI1A 4A4EA 4CI0C 3V8JA 3A5ZB 4ZGEB 3OYFA 1TH7A 1YCYA 1YI2Q 1VQKA 1VQ9T 2DJQA 1M4ZA 2HKQB 4FYXB 1LPLA 2VWFA 2A3LA 4MMKA 1YHQA 5GJWB 2K4YA 1MHNA 2P0QA 1IGQA 1R0BG 1WJSA 2K3XA 1EIFA 1KQ1A 2F2XA 4JJBA 1I1JA 1W1FA 1PRLC 3H6ZA 1PRMC 5FU7C 1VOMA 2KAFA 1WHJA 2QQ9A 3L2RA 5DY9A 1QVFA 4HT8A 4HCBA 2RA2A 1RAEB 2FPFA 4M7DA 4MDWA 2DFUA 3V7RA 2O4XB 2GTOA 1AZEA 3VV0A 4F7UA 5FWCA 2NUTB 2EWNA 1HSQA 1QWEA 5GAMh 4XK8E 3FC3A 3QIIA 3TU4K 4ANJA 3FJ5A 2GCXA 4C8QA 2YUPA 3FB9A 1SG5A 4C92E 2DJZA 2GFUA 3QG1A 4L6V5 4F04B 2E5KA 4PK4A 4ZTFA 4C5IA 1A0NB 4JUVA 2L3SA 5LJ3e 3VS1A 1LVKA 2DETA 1M8MA 4AMCA 5KYUA 3NTKA 1WQWA 3VRYA 4E7IA 3MCAB 1VQ5Q 4J8OA 4LDYA 3TREA 4ZGDB 1WDXA 4A4HA 4HKEA 3OS2A 2CDTA 4OB1B 1OPLA 2DIQA 1HXDA 3GNFB 1HJDA 2DL7A 4KUIA 4JRQA 3CPFA 3META 1P92A 3OYCA 5GJVB 2IIMA 2AT1B 1OYXA 1WXUA 4M78G 1QCNA 4N4HA 5GAN3 5GAMd 2O01E 1M3AA 1JJ2P 1Q95G 1UTIA 3ER0A 2DEQA 1WA7A 1KHIA 3HRTA 1SSFA 1GFDA 2NUZA 4M7DE 3R6OA 5HK3A 2EYQA 4E7LA 2PVGB 4M78D 3OYKA 2P0PA 1PSEA 3CQTA 2KRMA 4EMKB 4A4GA 1KC8C 3CD6A 2LJ3A 5IHNA 3QZ5B 2YRCA 1MV3A 4M7AD 3QJ6A 4BB7A 1TUGB 4OMPA 4C8QE 2YWWA 2CZ0B 3OYNA 2DBKA 1RAAB 3UF4A 4M75B 2RMOA 1R8OB 2EKOA 4AT1B 5LJ5f 4AFUC 3H41A 3KXTA 4PJMA 2ABLA 1N5ZA 2E3HA 2DXUA 5KYYA 2AKKA 1GFCA 4ELYC 5FW9A 3G71T 2CREA 4EMKC 2EGCA 2QQRA 3CC4T 5IHIA 1M90C 1VIEA 2DL8A 1G3YA 2E1HA 4EMHA 2LX7A 4NL2A 4GY5A 4EPCA 2OX7A 3CMAT 4PFPA 2ED1A 2XHCA 1YI2A 4M75C 1NBEB 2GQVA 4L59A 1QQJA 3VUBA 5LJ5g 4F14A 1YIJT 3CCJT 2A36A 3REBB 3L2ZA 4OB3B 5I2SA 1MMAA 1B3QA 2BTTA 5AYFA 3CC4A 3A1PA 5CKDA 2RHYA 5CKHA 2KXCA 2P4RA 4E7KA 3L1AA 3H0HA 1QCOA 2CP5A 1X2KA 2EYXA 1K8AR 3DLMA 5HKCA 1BKBA 4F7UB 5LL6S 4PFZA 5LJ3j 3LX7A 2DTHA 3J81E 2A37A 4QVDA 3CCLQ 1K0SA 3JCMJ 1MGQA 3CPWS 1VIFA 4OGEA 3SHWA 1D09B 3BY7A 3PFSA 4O6JA 4Q5WA 2FG0A 1IB8A 2CYZB 1OU9A 4IIMA 3CCRT 1ZSGA 3CC7Q 3CBOA 4FW2A 5IT9E 3VU3C 2C0OA 4QQGA 2DL5A 2PTKA 3J7AF 1QWFA 4IUTA 5HK0A 2QQBA 1X75C 2X9HA 1QW1A 2YXYA 3DKMA 1NLOC 2MAMA 1MNDA 2DTIA 1I4K1 4MDXA 4PLLA 2LDMA 3HPWA 2DEUA 2KI7A 4BD3A 4B6MA 1K9MC 1ZSZA 1I81A 3JCMh 2YLCA 4HVWA 2L8DA 2OTLA 1OU8A 1WHMA 4O5VA 2HL3A 2C0IA 4OMQA 5IAYA 4ELZC 1K8AC 2L89A 2KY9A 2AHJB 2JOYA 5C0MA 2EPDA 3H0FA 3A8HB 2JS2A 2K7AA 2XKOC 1PC0A 3VUZA 4RTTA 2BKDN 4OMOA 2P4TA 2QASA 2J6FA 2KE9A 3SDZA 1VQPQ 1KFZA 3OYDA 2LRQA 4QKUA 2KQWA 2JJ9A 2QG9B 1RAFB 1WJQA 5M9OA 3E2UA 2GGRA 2QQAA 1X69A 4EIKA 3OY9A 2RQUA 4XTXA 1BU1A 4C92D 1IHVA 2OAWA 4J9HA 1SHGA 1EFNA 3OS0A 3S6WA 2CP6A 3OYYA 3HHTB 4BY6B 3EH1A 4LDUA 4XTVA 3EG3A 1WJRA 3SWNC 2CH4W 1MV0B 1W2BP 1UGVA 4FT2A 1I5LA 2FL7A 3X25B 2KROA 3I56Q 2FZCB 4A63B 2FO0A 4PJOB 2VB6A 3JCMd 3OYHA 1TG0A 4XU2A 2FPEA 3I55Q 4M77C 1WLPB 4OP0A 3RNJA 2X35A 1YJNQ 1QVGS 2VYTA 2MYSA 5KYYB 3EG9B 4MZMA 1YJWT 1OV3A 5IXBA 1YJ9Q 4TVRA 2OTJQ 3M0SA 3ULRB 2EJ9A 5CCAA 1VQNT 4GLMA 1KK7A 3QSUA 5GANe 4M7DG 1ZBJA 4XTWA 4RMOA 1OZ2A 4M7DF 3RESA 2DMOA 1T0JA 1GBRA 3C0CA 1Q86U 1YITA 4CRIA 2CSIA 3NGPA 2EQIA 2BZYA 3C94A 2QGFB 1VQ4A 3G4ST 3H0IA 3LW5E 3VS5A 4F7UF 5L8RE 3QDRB 5GAN4 1VQ8A 4C0FA 3RERA 1Q7YC 3QZ9B 2V8KA 3JSCA 2DO3A 1M3BA 4C8QG 2YRDA 5C6SA 4DEXA 4C8QF 2HDAA 4LDWA 4PNOA 2QTVA 3LWIA 1YP5A 2RN8A 3EGDB 2ESWA 2KRNA 1KD1C 5KYXA 4HXJA 2KXDA 2O4XA 2VGNA 3QBYA 1I8FA 3G4SA 5IXFA 4JS4A 4GLKA 2JTFA 1RI0A 2DD5A 3I35A 1ZA2B 1SKUB 2HZYA 1D0YA 2HD0A 3GNGA 3UA7A 3M58A
chains in the Genus database with same CATH topology
1VQ9Q 3I55Q 1Q7YR 3CCQQ 3G6EQ 1K8AR 3CC4Q 1KQSP 1VQNQ 1YJNQ 1VQOQ 1S72Q 3OW2P 1YHQQ 1M90R 1VQ7Q 3CCUQ 3CCRQ 1VQPQ 1N8RR 3CC2Q 3CXCP 1Q81R 2QA4Q 3CCEQ 2QEXQ 1JJ2P 1QVGP 1YITQ 1W2BP 1M1KR 3CCSQ 1VQLQ 1K9MR 3CCLQ 1KD1R 3CMAQ 1VQ4Q 1YI2Q 2OTLQ 1YJ9Q 1VQMQ 1K73R 3CCVQ 3CMEQ 2OTJQ 3G4SQ 3G71Q 3I56Q 3CD6Q 3CCMQ 1YIJQ 3CCJQ 1VQ8Q 1KC8R 3CC7Q 1Q82R 1NJIR 1VQKQ 1QVFP 1YJWQ 1Q86R 1VQ5Q 3CPWP 1VQ6Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 Q;  3I55 Q;  1Q7Y R;  3CCQ Q;  3G6E Q;  1K8A R;  3CC4 Q;  1KQS P;  1VQN Q;  1YJN Q;  1VQO Q;  1S72 Q;  3OW2 P;  1YHQ Q;  1M90 R;  1VQ7 Q;  3CCU Q;  3CCR Q;  1VQP Q;  1N8R R;  3CC2 Q;  3CXC P;  1Q81 R;  2QA4 Q;  3CCE Q;  2QEX Q;  1JJ2 P;  1QVG P;  1YIT Q;  1W2B P;  1M1K R;  3CCS Q;  1VQL Q;  1K9M R;  3CCL Q;  1KD1 R;  3CMA Q;  1VQ4 Q;  1YI2 Q;  2OTL Q;  1YJ9 Q;  1VQM Q;  1K73 R;  3CCV Q;  3CME Q;  2OTJ Q;  3G4S Q;  3G71 Q;  3I56 Q;  3CD6 Q;  3CCM Q;  1YIJ Q;  3CCJ Q;  1VQ8 Q;  1KC8 R;  3CC7 Q;  1Q82 R;  1NJI R;  1VQK Q;  1QVF P;  1YJW Q;  1Q86 R;  1VQ5 Q;  3CPW P;  1VQ6 Q; 
#chains in the Genus database with same CATH topology
 1Q82 U;  4Z02 A;  2EQK A;  1VA7 A;  3QYG B;  3CCL A;  1UE9 A;  5J3B A;  1K4U S;  2P0K A;  2PUK B;  4JDS A;  2K3B A;  1MUZ A;  1QP2 A;  3ME9 A;  2K57 A;  4IUV A;  8ATC B;  4X34 A;  1XQH A;  4X1V A;  3G6E T;  1PG5 B;  1ZSZ B;  5LJ3 h;  1QP3 A;  2DBM A;  5CQX A;  4JRP A;  2F1L A;  2FB7 A;  4J9B A;  4KUL A;  2RO0 A;  2QA4 Q;  4AFS C;  2EJF A;  4C0D C;  1OOT A;  2KYB A;  1ZQ1 A;  5GAO m;  4AFZ C;  3URG A;  3QXE B;  4JJN K;  1TUC A;  3EFR A;  3G6E A;  1K1Z A;  3UPU A;  2QGG A;  3EG0 A;  3MJX A;  3CXC S;  2PUO B;  4ME7 A;  2JW4 A;  4QVC A;  2ZPB B;  4FCY A;  1SEM A;  1WIE A;  4JLI A;  3EGX A;  1KHC A;  1Q81 U;  1QKX A;  2M0O A;  1ZUY A;  3QWY A;  1VQM Q;  4RUG A;  1VQ6 T;  1AWX A;  3CCQ T;  1M3C A;  3UT1 A;  2YT6 A;  1JBM A;  2HSE B;  1VQO A;  1K0X A;  1XOV A;  2V8J A;  4RTZ A;  2DVE A;  4FT4 A;  2R57 A;  4XTU A;  1KQS P;  1VQL T;  3MP6 A;  2K9G A;  2VGM A;  4ZTJ A;  3X24 B;  2B86 A;  5EC7 A;  4IKF A;  1XJW B;  5LJ3 d;  2DXT A;  1VQK T;  5GAN j;  2K5I A;  4EMK A;  2CP0 A;  2QK0 A;  2RJD A;  1K73 U;  4PFO A;  1YHQ T;  3NTH A;  2COW A;  2O88 A;  3VS0 A;  1Q86 R;  3PVQ A;  1T3S A;  2XU8 A;  1VQ7 Q;  2RHU A;  4EMG A;  1VQL A;  2M0Y A;  4M75 A;  5I11 A;  3I5R A;  2ATC B;  1G2B A;  3TVT A;  4DOV A;  4KGX B;  2QDL A;  2LQN A;  4AG2 C;  4II1 A;  2F69 A;  4M7A B;  3L2U A;  2LC4 A;  5I2M A;  2O9V A;  3RIR A;  3FLG A;  1YJN A;  2CS7 A;  1YN8 A;  4BE0 A;  4R56 A;  5GAN 5;  4LN2 A;  3VS4 A;  9ATC B;  1UG1 A;  4ZGJ B;  1RAH B;  4XU3 A;  2DVJ A;  2BZX A;  3KFV A;  1FYN A;  1H92 A;  4M78 C;  2JXB A;  2QTX A;  2I2L A;  3CME A;  4LUD A;  2VXE A;  4J9F A;  2VC8 A;  2K2V A;  1OX9 A;  3RBB B;  2E70 A;  1WPY A;  4LUE A;  1GCQ C;  5KYX B;  1BIB A;  1Q82 R;  4M7A C;  3EGU A;  3M56 A;  3RMS A;  2M1H A;  3CCE T;  2QEX A;  4CC3 A;  3M4G A;  1YCS B;  3JB9 I;  1WHH A;  2K2M A;  3HKS A;  1N8R R;  2ZZD A;  3CCV A;  2ZPG B;  2AKL A;  2RI3 A;  2AK5 A;  3CCM A;  3UAT A;  3CMA Q;  2M02 A;  4N4G A;  1M27 C;  1NPR A;  5GMK e;  4IIO A;  1YIJ Q;  3CCJ Q;  1PKS A;  1WX6 A;  2L0A A;  2GNC A;  3EAE A;  2PNI A;  4FU6 A;  2JVV A;  3WVE B;  3CCE A;  3M0T A;  3L2W A;  4J9I A;  2L3P A;  3HFO A;  3MEU A;  2RNA A;  3PVL A;  3CCS Q;  2ZCF B;  1VYU A;  2E12 A;  3KUF A;  1WQ7 A;  1QMC A;  2RQT A;  2RB6 A;  4HVU A;  1BI0 A;  5GAO n;  3CC2 T;  4E2F B;  2EVR A;  4RTV A;  1JEG A;  3IQL A;  4M75 E;  3UWN A;  2C0T A;  2DD4 A;  5KH6 A;  5DM7 R;  1Q81 R;  5KCO A;  2AZV A;  5CVI A;  3JCM V;  5EG2 A;  2E6N A;  1U5S A;  3CPW A;  2QDY B;  1UDL A;  1V76 A;  2ROL A;  2EBP A;  2D8H A;  5KCH A;  1N8R C;  1QVP A;  5D6X A;  3QUI A;  2O9S A;  3X26 B;  2LVM A;  3CC2 A;  2CGH A;  2CP2 A;  1SF9 A;  2QA4 A;  5GAN g;  1NJI U;  3EGX B;  2MK5 A;  3M0P A;  1MNE A;  1JQQ A;  4QQD A;  4J6W A;  1KIK A;  4WCI A;  3SWN A;  3CD6 T;  1H3Z A;  3E9F A;  2RI5 A;  2XDP A;  4J5Y A;  3HSB A;  2RD1 A;  1TWB A;  1K73 R;  4VUB A;  1SPK A;  3DLL A;  1M5Q 1;  2D0N A;  4X9D A;  4E7J A;  2PVD B;  1W2B A;  4BI3 A;  1D0X A;  2E4H A;  4F7U E;  1IXD A;  1E7O A;  3JCM c;  4PL6 A;  1X2Q A;  3C95 A;  4L5G A;  4PJN A;  3PTA A;  3VYG A;  4QQ6 A;  4KGV B;  3NPF A;  1PNJ A;  1FMV A;  2AZS A;  3CBM A;  3JCM f;  3BE3 A;  2G3R A;  3LGL A;  3V8K A;  3JB9 G;  2DA9 A;  4PJO A;  1YI2 T;  3JB9 F;  4OB0 B;  2CZ7 B;  1PSF A;  4IUR A;  2FYK A;  5FRM A;  1YFN A;  2ZPF B;  4FYV B;  4XAX B;  5GAO p;  1NEG A;  4QW2 A;  4MML A;  1QVF S;  2GTJ A;  3EG9 A;  4A54 A;  1U1S A;  1BBZ A;  3PMT A;  1VQ7 A;  1DJ7 B;  3GPL A;  1AWJ A;  1UGQ B;  3PNW C;  2HEQ A;  2ZGW A;  4C92 C;  2DNU A;  3JCM g;  5GAN h;  3PIO A;  5KE2 A;  2BE7 D;  5CR2 A;  2DRK A;  2GBQ A;  3QHS A;  1SSH A;  4B9X A;  2RPN A;  5GMK j;  1E6G A;  4RKU E;  1AD5 A;  1UGR B;  2V1Q A;  2P84 A;  2YDL A;  3QO3 A;  2RK2 A;  1I07 A;  2E65 A;  4ZN1 A;  1I0C A;  1SHF A;  1D1C A;  1QVG A;  1VQN Q;  1AEY A;  2DK3 A;  1S72 Q;  4BE2 A;  4P5N A;  2X51 A;  2JN0 A;  2RHI A;  2X4J A;  4PLI A;  3EGD A;  2X3X D;  4JS5 A;  1UJ0 A;  4HVV A;  3UA6 A;  4UC4 A;  1WXT A;  3LLR A;  3MHX A;  3RKX A;  2K79 A;  2BE9 B;  3NHN A;  4FL6 A;  2K3Y A;  4RTY A;  1B34 B;  2QXF A;  3MP8 A;  2OI3 A;  4J7I A;  5CO7 A;  2JM9 A;  2XMF A;  2JT4 A;  2KNB B;  2GF7 A;  1ZBX A;  3CCU Q;  2OTL T;  1B07 A;  3X20 B;  1NYF A;  4ZN3 A;  4RCC A;  3I9Q A;  2M51 A;  2IG0 A;  1BCO A;  5A0D A;  1BI3 A;  1UGS B;  4FYY B;  5GAN 2;  1N27 A;  5GAN d;  3OW2 S;  5ECA A;  1G3W A;  1NJI R;  1M2V B;  2LCL A;  4JZ3 A;  4PJO E;  3RMQ A;  2R5A A;  3CCS A;  4C0Z A;  2CP7 A;  4GBQ A;  3OS5 A;  1O9S A;  4XU1 A;  4BUG A;  3JCM b;  3E19 A;  2DYI A;  3VS6 A;  2SRC A;  2EYY A;  1WXB A;  2EFI A;  1G83 A;  3M0Q A;  1VQ5 A;  3ZBD A;  1SRM A;  3GLX A;  1D3B A;  3CPW P;  1NPP A;  4HCC A;  3SWN B;  3RKW A;  3A8L B;  4FSS A;  1GL5 A;  2KGT A;  1UEB A;  2MIO A;  2D1X A;  4RTX A;  3N5B B;  5GAO l;  2RJF A;  3MP1 A;  5CKE A;  1M1K U;  1KQS A;  3SB2 A;  3M9Q A;  1IO6 A;  4M77 B;  4KUD K;  1KSW A;  3FJP A;  2B8A A;  4M75 G;  5FWB A;  2H3E B;  6AT1 B;  4M75 F;  2F2V A;  2EW3 A;  3JRZ A;  3QPH A;  4X9C A;  5LJ3 f;  4HT9 A;  4FYW B;  4BE1 A;  4D6W A;  2HNI A;  4ORZ A;  4LE9 A;  3QDF A;  1RLP C;  1X6B A;  4N0A C;  4DBR A;  2D0Q B;  3CXC A;  4M75 D;  1YIT T;  2MCN A;  2BUD A;  1AHJ B;  2LZ6 B;  1VQ4 T;  4M78 A;  2FHD A;  2KT8 A;  2KEA A;  1VQ8 T;  2A08 A;  1PKT A;  1W70 A;  2FRY A;  1CKA A;  5GMK m;  3JCM P;  2CUD A;  2CT3 A;  2L3R A;  1ACM B;  5LJ3 g;  2QQS A;  1GCQ A;  2EJG A;  2MWP A;  4M7A A;  1BYM A;  3DB4 A;  1RAI B;  4AFQ C;  1YHQ Q;  1ZA1 B;  4OGC A;  5A2Q E;  4F7U G;  4PJJ A;  5D7U A;  1JO8 A;  1WHL A;  4KH1 B;  5A0L A;  1AWO A;  1JXO A;  3P8D A;  4M7D D;  2J06 A;  4J9G A;  1M1G A;  4BI8 B;  2EGE A;  2JTE A;  2LJ1 A;  2LQW A;  1QCF A;  2LQK A;  4BDZ A;  4Y28 E;  1VQ9 Q;  4J9E A;  3HP9 A;  1RUW A;  3CCL T;  2DRM A;  4F17 A;  1RI9 A;  1PCX A;  3TSW A;  2DZ9 A;  1GXI E;  1WGS A;  1QVG P;  3CC7 T;  2A28 A;  1OX8 A;  4V2S A;  5CQY A;  2L3Q A;  1V29 B;  1JB0 E;  4C8Q D;  3R6N A;  4LD9 K;  4KBM B;  1S72 A;  2L2P A;  1YWO A;  2LCC A;  4PJL A;  5GMK h;  1MMG A;  2M9U A;  2XIC A;  4XTZ A;  4DBF A;  1Y0M A;  4C0D B;  4JZ4 A;  2Y90 A;  3BDL A;  2AIR B;  1SRL A;  1IGU A;  1T3L A;  2NUP A;  1X01 A;  5I22 A;  3CC7 A;  4D8D A;  4E7S A;  2FEI A;  1BCM A;  1E6H A;  1V1C A;  1MMD A;  4OB2 B;  3CCU A;  2ROT A;  4D8K A;  1U8R A;  4K11 A;  4E7H A;  3LWH A;  4LDX A;  5GAN 8;  4RTW A;  1YBY A;  1D1B A;  2OJ2 A;  3M57 A;  4RTU A;  3OYG A;  4HCK A;  3FEO A;  1M1K R;  1TXQ A;  3MEW A;  1BK2 A;  2DXB A;  1PM3 A;  4B9W A;  2V1R A;  2DZC A;  1D3B B;  1RL2 A;  3LH5 A;  5IH2 A;  1AWW A;  4OMM A;  4M7A E;  3OYL A;  1VQO T;  4LXC A;  4ESR A;  1U3O A;  1B7T A;  1OQK A;  2F5K A;  3GP8 A;  2XI9 A;  5LJ5 e;  2PU9 B;  1JU5 C;  4BDY A;  3GIB A;  3M54 A;  2LNH B;  2PVO B;  5CAI A;  4ATO A;  1EZZ B;  2RK1 A;  2E41 A;  5CKB A;  2KR3 A;  5GAN 6;  2E3I A;  4RG2 A;  1VQP A;  2YRV A;  4PJO G;  1KC8 U;  2XDD A;  2G6F X;  2RHZ A;  4PJO F;  3SD4 A;  1LCK A;  2QAZ A;  1UB4 A;  1RAC B;  2HL5 C;  2ZPI B;  3I55 T;  2VVK A;  1OEB A;  1YJN T;  3CD6 Q;  1ABO A;  4PJO D;  3Q1J A;  1IHW A;  1RAG B;  1FMK A;  4M78 B;  1BI1 A;  2DER A;  4C92 A;  5FRN A;  5KYN A;  3OYA A;  3CME T;  1JRI A;  3CXC P;  1G5V A;  1M90 U;  2EQM A;  1BI2 A;  4OMN A;  3I56 A;  1H3H A;  3OYI A;  1O75 A;  2KVQ G;  3OBW A;  4Z88 A;  3FIF A;  4LNP A;  1AVZ C;  1LOJ A;  2DE0 X;  2EYZ A;  1M9S A;  3I55 A;  3F70 A;  3OSV A;  1HYO A;  3MO8 A;  4FIB A;  2QEX T;  3INZ A;  2YUQ A;  3RR6 A;  2E10 A;  4EDU A;  3CCV T;  2W0Z A;  1YJ9 A;  1UHC A;  4CC4 B;  2OTJ A;  1H64 1;  3CCM T;  3OMC A;  2ZPE B;  2HMA A;  4DBQ A;  3D7S B;  5FU6 C;  1C6V X;  2X4X A;  2EQJ A;  3VS2 A;  1X43 A;  2GQI A;  2KYM A;  3NTI A;  1TS9 A;  3G71 Q;  3L42 A;  2YUO A;  3CC4 Q;  2KMT A;  2KBT A;  8AT1 B;  3VS7 A;  2X4Y A;  2HBP A;  3M0R A;  5GAO q;  1Q86 C;  2WSE E;  4KH0 B;  4DOW A;  1J3T A;  1VQ9 A;  1BB9 A;  2K6D A;  4XQ3 A;  1WZO A;  3LGF A;  2LJ0 A;  1C1A A;  2LQ8 A;  3UDC A;  3OA6 A;  1K76 A;  1U06 A;  1B34 A;  2CUB A;  2NUP B;  2OAU A;  3M0U A;  2RQR A;  1M1F A;  2ED0 A;  2JZ2 A;  1T0H A;  3EFS A;  3I5S A;  2MOX A;  1N9S A;  5KYW B;  1K9M U;  3BDU A;  3EG1 A;  4HCZ A;  5GAN f;  5LJ5 j;  3HRS A;  4E6R A;  2QA4 T;  2H8H A;  1PHT A;  2Z0W A;  1JJ2 S;  3VS3 A;  2XID A;  2DL3 A;  1UEC A;  1K8A U;  1IZ6 A;  2K5L A;  1M2V A;  3CCR Q;  1TSF A;  2RHX A;  3RUX A;  1KG1 A;  5CKF A;  1Q82 C;  1GBQ A;  2OTL Q;  4JLG A;  4MZP A;  1RLQ C;  2ZAE A;  4ZNX A;  3M4Y A;  1M8V A;  1KC8 R;  1X6G A;  2HQH A;  4OML A;  4M4Z A;  1VQM T;  1VUB A;  2Y4X A;  1ZUK A;  2HBW A;  2HQE A;  2NWM A;  3LH0 A;  2EGA A;  4DQ2 A;  1NLP C;  1FWZ A;  2FRW A;  2FVU A;  3A98 A;  5KE3 A;  3J80 E;  3OW2 A;  4J7F A;  1MMN A;  4N0A A;  4F16 A;  5IN1 A;  3JCM X;  1U1T A;  5CK9 A;  2CP3 A;  1F1B B;  3OB9 A;  4M77 A;  1M90 R;  2LMJ A;  1HK9 A;  1OZ3 A;  4M78 F;  1VQM A;  3M55 A;  1QLY A;  1NEB A;  2A0F B;  1D0Z A;  4J6Y A;  5DLO A;  1XNI A;  2BZ8 A;  2FPD A;  4M7A G;  1VQ7 T;  3CEY A;  4C92 B;  2E6Z A;  1Q81 C;  4M7A F;  1CKB A;  3BFM A;  4OF1 A;  2C06 A;  3V7S A;  2LP5 A;  1XTD A;  1W6X A;  2X3W D;  3EFO A;  2CH4 A;  4C0G A;  2DTO A;  2DLP A;  3EHQ A;  1ZX6 A;  2EKH A;  3JB9 D;  1X27 A;  1UGP B;  4Z89 A;  3QKJ A;  2HQX A;  1FX7 A;  1G3T A;  2MPX C;  4NS5 A;  1G8X A;  2COY A;  2E64 A;  1K73 C;  4RG8 A;  1Q7Y U;  2EIF A;  1Y96 A;  3MKD A;  4J6X A;  1YIT Q;  2YUN A;  3GF5 A;  1VQ4 Q;  1NM7 A;  1WHK A;  5GMK l;  1KD1 U;  4DEY A;  4BAC A;  4IUQ A;  1D1A A;  1VQ8 Q;  1YJW Q;  3ASK A;  1ABQ A;  3BW1 A;  3L2V A;  3ZEH A;  2SEM A;  3OQ5 A;  3SFM A;  4N4I A;  2CKK A;  3ZL7 C;  4KT0 E;  1N6A A;  2DXC A;  1FMW A;  2PQW A;  3OYM A;  2COZ A;  1K9M R;  3GBQ A;  2JUF A;  2J7I A;  4M7D B;  4HA8 A;  3G71 A;  4Y91 A;  3G4S Q;  1M30 A;  2JMA A;  3PE0 A;  3HFN A;  4C5G A;  3OYB A;  1WNL A;  4A4K A;  3RKY A;  1QVF P;  2EYW A;  3MPU B;  4M77 E;  1N9R A;  3CCS T;  2MWO A;  3NFC A;  2BIV A;  5GAM e;  3CMA A;  2YSQ A;  1JXM A;  1QKW A;  3OYE A;  2R5M A;  2CZ6 B;  4JJD A;  1BIA A;  2GFA A;  1YIJ A;  3CCJ A;  4C8Q B;  3A8O B;  1VQ5 T;  3OBY A;  2HCK A;  3FRN A;  3WVD B;  4OMF B;  4WF2 A;  1EX4 A;  1LNX A;  1RAB B;  3DB3 A;  2DM1 A;  4M7D C;  3P8B B;  4JPB W;  1ZLM A;  2FZG B;  5D6Y A;  4E7Z A;  2DX1 A;  5KYU B;  3C12 A;  4CC2 A;  1KJW A;  1NG2 A;  2XD0 A;  3PMI A;  3H9N A;  1PD1 A;  3X28 B;  4RCB A;  2DF6 A;  4R55 A;  3MEV A;  1HD3 A;  2RM4 A;  4C8Q C;  3CCR A;  3S3N A;  2O2O A;  2RQV A;  1ARK A;  3T9N A;  4A53 A;  2EAY A;  3G6E Q;  3GOX A;  1W2B S;  1WI7 A;  4JRK A;  2V26 A;  4J9C A;  5DLQ E;  2DPP B;  2HKN A;  2W10 A;  3REA B;  5LJ5 h;  1PD0 A;  1GRI A;  1H8K A;  3HL8 A;  1UHF A;  2F5T X;  1GCP A;  3THK A;  2VKN A;  5GAN 7;  2LTO A;  2XK0 A;  3L2Q A;  3PT9 A;  4C92 G;  2NYS A;  4A4F A;  2VUB A;  3KBG A;  4C92 F;  1VQO Q;  2QYZ A;  1VYV A;  3OW2 P;  2RJE A;  1K9A A;  2DL4 A;  2RF0 A;  5GAO r;  3V8L A;  3H8Z A;  1NJI C;  2KRS A;  2WSC E;  1FXX A;  1OUL A;  2IPO B;  2JMC A;  2WAC A;  1OPK A;  2KK4 A;  2CZ1 B;  2KDS A;  3S3O A;  3OYJ A;  1VQ6 Q;  2PZ1 A;  1Q7Y R;  3CCQ Q;  2D8J A;  1UJY A;  2I0N A;  2M16 A;  1X6O A;  2RJC A;  3EFO B;  4FW1 A;  3JCM W;  4DBH A;  3V7C A;  4FM4 B;  3JAM E;  1I5O B;  4R0K A;  2KSS A;  1VQL Q;  1KD1 R;  1YWP A;  3WXM B;  3VRZ A;  2JM8 A;  2HSP A;  2D9T A;  5A0G A;  2DIG A;  2ECZ A;  2RQW A;  1VQK Q;  4WTO B;  1Y96 B;  4JJC A;  3P8H A;  5LJ5 d;  5CIU A;  3RDV A;  3O5Z A;  3AT1 B;  2ZPH B;  4KGZ B;  2JNG A;  5J39 A;  2R58 A;  2LT4 A;  4BY6 C;  1Z9Q A;  2XDB A;  2JS0 A;  2YHT A;  3CME Q;  1ZUU A;  2DIL A;  2A7Y A;  3QJY A;  3QYH B;  1S72 T;  1VYT A;  1KQ2 A;  4Y92 A;  2MF2 A;  3VJP A;  4J9D A;  4PJO C;  3HRU A;  5GAM j;  3S3M A;  2QEX Q;  1Y7X A;  1C0M A;  2YLB A;  4Z8A A;  2J6K A;  4XTY A;  1YJW A;  2EQU A;  3CCV Q;  1S1N A;  1R77 A;  2K5F A;  3CCM Q;  2RI2 A;  1VQN A;  3CCU T;  2IVW A;  3G1J A;  4C5E A;  2RH2 A;  2L5Q A;  2X4W A;  2CSQ A;  2KT1 A;  4IUP A;  2VXF A;  1IRE B;  3C4S A;  1Y71 A;  3CCE Q;  2CT4 A;  3CBP A;  5IHK A;  3EH2 A;  3OMG A;  1Z9Z A;  2LX9 A;  2WSF E;  2NUT A;  3E1S A;  3TCJ A;  5GMK i;  1W4S A;  4AG1 C;  2MMP A;  1NYG A;  2O31 A;  5KYW A;  3O8V A;  5HCK A;  2QI2 A;  3VYH B;  4M78 E;  3AHU A;  2D6F A;  3JB9 J;  4XU0 A;  1N8R U;  3ZFJ A;  3E9G A;  1NE8 A;  2J6O A;  4LDV A;  2F2W A;  2JTM A;  2E5Q A;  1TTH B;  4BI4 A;  1KQS S;  1YNZ A;  3M53 A;  4IUU A;  3JCM e;  2Y4Y A;  1WFW A;  4JRI A;  5FLX E;  1VQP T;  4NOY A;  4M77 G;  3VKI A;  4FSX A;  4LD6 A;  3HTR A;  5I21 A;  1WHG A;  1ZHI A;  4M77 F;  5AT1 B;  3A8G B;  1IRX A;  2DYB A;  3CC2 Q;  1AOJ A;  4QVZ A;  4KRT A;  1R0C B;  4CC7 A;  1AT1 B;  2DKG A;  4C5H A;  3EG2 A;  4M77 D;  2HAX A;  4QT7 A;  3TSZ A;  1TU0 B;  2H3J A;  1TOV A;  2NLU A;  1JJ2 A;  2VV5 A;  3EHR A;  2FZK B;  1ZSZ C;  2J05 A;  2XG8 D;  7AT1 B;  1Y57 A;  3U23 A;  1RAD B;  3M5A A;  1G3S A;  5GAM f;  4YTL A;  5L23 A;  4DA4 A;  3I56 T;  3PGG A;  3NMZ C;  5J26 A;  2ENM A;  3OS1 A;  3TEE A;  3FDR A;  3OSS C;  2LCS A;  2LT1 A;  3A8M B;  3SEM A;  4NL3 A;  3QWX X;  1LJO A;  3PIP A;  1WYX A;  1M1K C;  3JB9 H;  1UUE A;  3LYI A;  3TQ7 P;  2V8I A;  1YJ9 T;  1UFF A;  4J83 A;  2OTJ T;  5FRO A;  3MEA A;  5FU6 B;  2LNV A;  1CSK A;  4PKC C;  4OVA A;  5GAM g;  1VQ6 A;  3JCM Q;  3CCQ A;  3G7Z A;  1Y07 A;  1PWT A;  4E47 A;  4MZT A;  1M2O A;  1TUD A;  3JV3 A;  2DAQ A;  5D6W A;  1NZ9 A;  2MI6 A;  2VAS A;  3M59 A;  1AZG B;  5FU7 B;  5HY6 A;  1OI1 A;  4A4E A;  4CI0 C;  3V8J A;  3A5Z B;  4ZGE B;  3OYF A;  1TH7 A;  1YCY A;  1YI2 Q;  1VQK A;  1VQ9 T;  2DJQ A;  1M4Z A;  2HKQ B;  4FYX B;  1LPL A;  2VWF A;  2A3L A;  4MMK A;  1YHQ A;  5GJW B;  2K4Y A;  1MHN A;  2P0Q A;  1IGQ A;  1R0B G;  1WJS A;  2K3X A;  1EIF A;  1KQ1 A;  2F2X A;  4JJB A;  1I1J A;  1W1F A;  1PRL C;  3H6Z A;  1PRM C;  5FU7 C;  1VOM A;  2KAF A;  1WHJ A;  2QQ9 A;  3L2R A;  5DY9 A;  1QVF A;  4HT8 A;  4HCB A;  2RA2 A;  1RAE B;  2FPF A;  4M7D A;  4MDW A;  2DFU A;  3V7R A;  2O4X B;  2GTO A;  1AZE A;  3VV0 A;  4F7U A;  5FWC A;  2NUT B;  2EWN A;  1HSQ A;  1QWE A;  5GAM h;  4XK8 E;  3FC3 A;  3QII A;  3TU4 K;  4ANJ A;  3FJ5 A;  2GCX A;  4C8Q A;  2YUP A;  3FB9 A;  1SG5 A;  4C92 E;  2DJZ A;  2GFU A;  3QG1 A;  4L6V 5;  4F04 B;  2E5K A;  4PK4 A;  4ZTF A;  4C5I A;  1A0N B;  4JUV A;  2L3S A;  5LJ3 e;  3VS1 A;  1LVK A;  2DET A;  1M8M A;  4AMC A;  5KYU A;  3NTK A;  1WQW A;  3VRY A;  4E7I A;  3MCA B;  1VQ5 Q;  4J8O A;  4LDY A;  3TRE A;  4ZGD B;  1WDX A;  4A4H A;  4HKE A;  3OS2 A;  2CDT A;  4OB1 B;  1OPL A;  2DIQ A;  1HXD A;  3GNF B;  1HJD A;  2DL7 A;  4KUI A;  4JRQ A;  3CPF A;  3MET A;  1P92 A;  3OYC A;  5GJV B;  2IIM A;  2AT1 B;  1OYX A;  1WXU A;  4M78 G;  1QCN A;  4N4H A;  5GAN 3;  5GAM d;  2O01 E;  1M3A A;  1JJ2 P;  1Q95 G;  1UTI A;  3ER0 A;  2DEQ A;  1WA7 A;  1KHI A;  3HRT A;  1SSF A;  1GFD A;  2NUZ A;  4M7D E;  3R6O A;  5HK3 A;  2EYQ A;  4E7L A;  2PVG B;  4M78 D;  3OYK A;  2P0P A;  1PSE A;  3CQT A;  2KRM A;  4EMK B;  4A4G A;  1KC8 C;  3CD6 A;  2LJ3 A;  5IHN A;  3QZ5 B;  2YRC A;  1MV3 A;  4M7A D;  3QJ6 A;  4BB7 A;  1TUG B;  4OMP A;  4C8Q E;  2YWW A;  2CZ0 B;  3OYN A;  2DBK A;  1RAA B;  3UF4 A;  4M75 B;  2RMO A;  1R8O B;  2EKO A;  4AT1 B;  5LJ5 f;  4AFU C;  3H41 A;  3KXT A;  4PJM A;  2ABL A;  1N5Z A;  2E3H A;  2DXU A;  5KYY A;  2AKK A;  1GFC A;  4ELY C;  5FW9 A;  3G71 T;  2CRE A;  4EMK C;  2EGC A;  2QQR A;  3CC4 T;  5IHI A;  1M90 C;  1VIE A;  2DL8 A;  1G3Y A;  2E1H A;  4EMH A;  2LX7 A;  4NL2 A;  4GY5 A;  4EPC A;  2OX7 A;  3CMA T;  4PFP A;  2ED1 A;  2XHC A;  1YI2 A;  4M75 C;  1NBE B;  2GQV A;  4L59 A;  1QQJ A;  3VUB A;  5LJ5 g;  4F14 A;  1YIJ T;  3CCJ T;  2A36 A;  3REB B;  3L2Z A;  4OB3 B;  5I2S A;  1MMA A;  1B3Q A;  2BTT A;  5AYF A;  3CC4 A;  3A1P A;  5CKD A;  2RHY A;  5CKH A;  2KXC A;  2P4R A;  4E7K A;  3L1A A;  3H0H A;  1QCO A;  2CP5 A;  1X2K A;  2EYX A;  1K8A R;  3DLM A;  5HKC A;  1BKB A;  4F7U B;  5LL6 S;  4PFZ A;  5LJ3 j;  3LX7 A;  2DTH A;  3J81 E;  2A37 A;  4QVD A;  3CCL Q;  1K0S A;  3JCM J;  1MGQ A;  3CPW S;  1VIF A;  4OGE A;  3SHW A;  1D09 B;  3BY7 A;  3PFS A;  4O6J A;  4Q5W A;  2FG0 A;  1IB8 A;  2CYZ B;  1OU9 A;  4IIM A;  3CCR T;  1ZSG A;  3CC7 Q;  3CBO A;  4FW2 A;  5IT9 E;  3VU3 C;  2C0O A;  4QQG A;  2DL5 A;  2PTK A;  3J7A F;  1QWF A;  4IUT A;  5HK0 A;  2QQB A;  1X75 C;  2X9H A;  1QW1 A;  2YXY A;  3DKM A;  1NLO C;  2MAM A;  1MND A;  2DTI A;  1I4K 1;  4MDX A;  4PLL A;  2LDM A;  3HPW A;  2DEU A;  2KI7 A;  4BD3 A;  4B6M A;  1K9M C;  1ZSZ A;  1I81 A;  3JCM h;  2YLC A;  4HVW A;  2L8D A;  2OTL A;  1OU8 A;  1WHM A;  4O5V A;  2HL3 A;  2C0I A;  4OMQ A;  5IAY A;  4ELZ C;  1K8A C;  2L89 A;  2KY9 A;  2AHJ B;  2JOY A;  5C0M A;  2EPD A;  3H0F A;  3A8H B;  2JS2 A;  2K7A A;  2XKO C;  1PC0 A;  3VUZ A;  4RTT A;  2BKD N;  4OMO A;  2P4T A;  2QAS A;  2J6F A;  2KE9 A;  3SDZ A;  1VQP Q;  1KFZ A;  3OYD A;  2LRQ A;  4QKU A;  2KQW A;  2JJ9 A;  2QG9 B;  1RAF B;  1WJQ A;  5M9O A;  3E2U A;  2GGR A;  2QQA A;  1X69 A;  4EIK A;  3OY9 A;  2RQU A;  4XTX A;  1BU1 A;  4C92 D;  1IHV A;  2OAW A;  4J9H A;  1SHG A;  1EFN A;  3OS0 A;  3S6W A;  2CP6 A;  3OYY A;  3HHT B;  4BY6 B;  3EH1 A;  4LDU A;  4XTV A;  3EG3 A;  1WJR A;  3SWN C;  2CH4 W;  1MV0 B;  1W2B P;  1UGV A;  4FT2 A;  1I5L A;  2FL7 A;  3X25 B;  2KRO A;  3I56 Q;  2FZC B;  4A63 B;  2FO0 A;  4PJO B;  2VB6 A;  3JCM d;  3OYH A;  1TG0 A;  4XU2 A;  2FPE A;  3I55 Q;  4M77 C;  1WLP B;  4OP0 A;  3RNJ A;  2X35 A;  1YJN Q;  1QVG S;  2VYT A;  2MYS A;  5KYY B;  3EG9 B;  4MZM A;  1YJW T;  1OV3 A;  5IXB A;  1YJ9 Q;  4TVR A;  2OTJ Q;  3M0S A;  3ULR B;  2EJ9 A;  5CCA A;  1VQN T;  4GLM A;  1KK7 A;  3QSU A;  5GAN e;  4M7D G;  1ZBJ A;  4XTW A;  4RMO A;  1OZ2 A;  4M7D F;  3RES A;  2DMO A;  1T0J A;  1GBR A;  3C0C A;  1Q86 U;  1YIT A;  4CRI A;  2CSI A;  3NGP A;  2EQI A;  2BZY A;  3C94 A;  2QGF B;  1VQ4 A;  3G4S T;  3H0I A;  3LW5 E;  3VS5 A;  4F7U F;  5L8R E;  3QDR B;  5GAN 4;  1VQ8 A;  4C0F A;  3RER A;  1Q7Y C;  3QZ9 B;  2V8K A;  3JSC A;  2DO3 A;  1M3B A;  4C8Q G;  2YRD A;  5C6S A;  4DEX A;  4C8Q F;  2HDA A;  4LDW A;  4PNO A;  2QTV A;  3LWI A;  1YP5 A;  2RN8 A;  3EGD B;  2ESW A;  2KRN A;  1KD1 C;  5KYX A;  4HXJ A;  2KXD A;  2O4X A;  2VGN A;  3QBY A;  1I8F A;  3G4S A;  5IXF A;  4JS4 A;  4GLK A;  2JTF A;  1RI0 A;  2DD5 A;  3I35 A;  1ZA2 B;  1SKU B;  2HZY A;  1D0Y A;  2HD0 A;  3GNG A;  3UA7 A;  3M58 A; 
#chains in the Genus database with same CATH homology
 1VQ9 Q;  3I55 Q;  1Q7Y R;  3CCQ Q;  3G6E Q;  1K8A R;  3CC4 Q;  1KQS P;  1VQN Q;  1YJN Q;  1VQO Q;  1S72 Q;  3OW2 P;  1YHQ Q;  1M90 R;  1VQ7 Q;  3CCU Q;  3CCR Q;  1VQP Q;  1N8R R;  3CC2 Q;  3CXC P;  1Q81 R;  2QA4 Q;  3CCE Q;  2QEX Q;  1JJ2 P;  1QVG P;  1YIT Q;  1W2B P;  1M1K R;  3CCS Q;  1VQL Q;  1K9M R;  3CCL Q;  1KD1 R;  3CMA Q;  1VQ4 Q;  1YI2 Q;  2OTL Q;  1YJ9 Q;  1VQM Q;  1K73 R;  3CCV Q;  3CME Q;  2OTJ Q;  3G4S Q;  3G71 Q;  3I56 Q;  3CD6 Q;  3CCM Q;  1YIJ Q;  3CCJ Q;  1VQ8 Q;  1KC8 R;  3CC7 Q;  1Q82 R;  1NJI R;  1VQK Q;  1QVF P;  1YJW Q;  1Q86 R;  1VQ5 Q;  3CPW P;  1VQ6 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...