1VQMQ

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqmQ00
1K73R 3CCVQ 1VQKQ 3CCUQ 1YJNQ 3CC2Q 1QVFP 1S72Q 3G71Q 1VQMQ 1YJWQ 1VQOQ 1N8RR 1YIJQ 1M90R 2OTJQ 3CCMQ 3CCSQ 1YITQ 2QEXQ 1Q7YR 3I55Q 3I56Q 3CC4Q 1VQ8Q 3CCEQ 1Q81R 3CCLQ 3CD6Q 3CCQQ 1JJ2P 1QVGP 1VQLQ 1KQSP 1VQ4Q 1YJ9Q 3G4SQ 1W2BP 3CXCP 1M1KR 1VQ6Q 1YHQQ 1Q86R 1VQ7Q 3CCRQ 3G6EQ 1VQPQ 1VQ9Q 1VQNQ 2QA4Q 1K8AR 3CMEQ 1K9MR 1YI2Q 1KD1R 1VQ5Q 1KC8R 3CC7Q 3CMAQ 3CPWP 1NJIR 1Q82R 3OW2P 3CCJQ 2OTLQ
chains in the Genus database with same CATH superfamily
4FT2A 1NM7A 2BUDA 3OS2A 4FW1A 1X2QA 2CGHA 3OS5A 2QI2A 1YJ9Q 1VA7A 4LDYA 1Q86R 1WHKA 3FIFA 3H8ZA 1VQ4A 1SG5A 2O9VA 3FRNA 2ECZA 2JVVA 2RM4A 2QGFB 3KFVA 4M75G 3A8HB 2HMAA 1K76A 3WXMB 4DOWA 2DXCA 1ZBJA 5HK3A 1U5SA 2RK1A 4QW2A 2ZZDA 5KE3A 3MKDA 2CYZB 3QUIA 5HK0A 5GAOl 1UB4A 1M1KU 3R6OA 3QO3A 1QCNA 1YHQA 5I21A 1IREB 4Z8AA 4MDXA 2DA9A 2X4WA 3CMAQ 1OOTA 4JRIA 1TUDA 4BE2A 3OB9A 3OYDA 4M7DD 2DBMA 4PJOE 2OTLA 1NEGA 2DL8A 1XOVA 3VYGA 2DJZA 3UA6A 4J6YA 1J3TA 1ZBXA 3OYGA 2M9UA 4BDYA 4IIMA 4CC4B 1ZSZC 1VQ5A 4F7UE 1BK2A 3QXEB 2CS7A 4XU2A 3I5RA 3V7RA 2QGGA 5CKEA 1AZEA 1X27A 3UF4A 4B9XA 4J9HA 1WA7A 1UHCA 4M77C 2BZ8A 3CCVQ 3QJYA 2LC4A 1NG2A 1OU8A 5GAN6 2DERA 1QVGP 2JTFA 1M2VB 1WX6A 1QWFA 1NZ9A 1UGVA 1I5LA 2E65A 3JCMb 4QQ6A 4M7AA 2DL4A 2JTEA 4IIOA 4J9GA 2P4RA 4WF2A 2JW4A 4M7AC 3LX7A 4AMCA 1VQ4Q 4OMMA 2HQEA 4EMKB 3VV0A 4D8KA 2RQTA 3ZFJA 1N8RC 2EGAA 2J05A 2RH2A 2E6ZA 4IUUA 4XTYA 2QQBA 2BE9B 2ZPEB 2RD1A 3OW2P 4OF1A 3N5BB 4XTXA 4R0KA 1UUEA 5J3BA 5FU7C 4GLKA 2GTOA 4N0AA 4XTWA 2GQIA 1FYNA 3HFNA 4E7IA 2YLBA 2F5KA 3A8GB 2BIVA 4C5HA 1JBMA 1RAGB 1QP3A 5EG2A 2RI2A 1UG1A 2KEAA 2AK5A 5I2MA 1NJIR 2AZVA 8AT1B 2M0OA 2NUTA 1RL2A 1I8FA 5GMKh 3PE0A 4WCIA 3S3MA 2MAMA 4DBFA 4F7UB 2RI3A 3QBYA 4AFUC 2NUPB 3WVEB 4BI3A 3CCLQ 3O5ZA 3EG9B 1MV3A 1MNEA 2F2WA 2YSQA 1WJQA 3BDLA 3PMIA 4C92D 1Y07A 4KGVB 3NMZC 1Q95G 3O8VA 3FB9A 4OB2B 2OI3A 1PKTA 1FWZA 3OYAA 1PWTA 1WHMA 4XU3A 3QG1A 3MP1A 3ZEHA 2YT6A 4J7FA 3META 1ZHIA 2XG8D 5D6WA 2HNIA 2DO3A 4C92G 2PUOB 4QVZA 2KQWA 1ZX6A 4ESRA 4ATOA 4TVRA 1U8RA 1OPLA 1BI1A 2ZCFB 4RTWA 1JXMA 1M1GA 2EYZA 1T0HA 1UE9A 1VQKT 3JCMf 2YHTA 2QQ9A 3G4SQ 3LW5E 2K5LA 4PFZA 2P4TA 3I56T 3CC4T 3CCRQ 2LCSA 4Z88A 2GGRA 3M56A 4C0DB 1VQNQ 1R0BG 4PLLA 2CZ7B 4M7DC 1VQOA 4X34A 1E6GA 5FU6B 1QVFP 2YRVA 1O9SA 3V8LA 4KRTA 1VQ6T 4C5EA 1BCMA 2OTLT 2FVUA 1JQQA 3LWIA 4L6V5 3SWNC 2XI9A 1WDXA 3BE3A 5A0DA 3H0FA 3ZL7C 1K73U 5GAMf 3EGDB 3URGA 1IHVA 3FDRA 3CC2Q 3C95A 3J7AF 1WJRA 4QQDA 1WZOA 2AHJB 3CCQT 4M78B 4EMGA 3EFSA 3JB9D 1X01A 4OMFB 1YN8A 5CAIA 3OW2A 4M7DE 2L8DA 5LJ3f 3RR6A 1YJWA 4AFQC 1PC0A 5A0LA 3FLGA 3BDUA 1IRXA 2L3PA 2E3HA 4MDWA 1WQWA 1VQMT 2NWMA 1KD1U 2RF0A 3M0RA 2GBQA 5D6YA 3REAB 5KYUB 2QDLA 1OZ2A 1MGQA 2QDYB 4M7DA 2AIRB 2KRMA 3FJ5A 2VASA 3CCVA 3VJPA 1HSQA 2K57A 4J83A 2K2MA 2DILA 1LPLA 5IHNA 1M90R 4LN2A 1AWXA 4OMNA 2A08A 1JJ2A 4KULA 4RTYA 2XD0A 5CQXA 4YTLA 1PD0A 1RLPC 1FMKA 2DETA 2DXTA 1D0XA 1WHLA 1QCFA 2O01E 3DLMA 3OYEA 2EQUA 3UWNA 2L3RA 3OW2S 2LX7A 4A4HA 4MZPA 2IVWA 3HHTB 1MMDA 2CDTA 2XHCA 2HQHA 1PSFA 2EYWA 3EGXA 5IN1A 3HTRA 3FJPA 1LJOA 4HXJA 2EQKA 1X2KA 2KGTA 4ME7A 3OMCA 3EHRA 4AFZC 3JCMW 5FROA 4HCCA 3HSBA 2KXCA 2DYIA 2WSCE 2VKNA 5KCHA 3CCUA 4IURA 4AFSC 5DM7R 1F1BB 2WACA 4WTOB 2F2XA 2EGCA 4RTXA 3OYKA 2MK5A 3UDCA 4E7KA 1QVGA 4JLGA 1IZ6A 5A2QE 1KQ2A 3AT1B 3GBQA 4A4FA 3HRUA 2BZXA 2QYZA 4M77G 3OYCA 1VQ4T 2GFAA 1AWJA 5KYNA 1H3ZA 3OSSC 2OTJQ 4DEYA 1WXUA 4KGZB 3QDFA 4M78F 5I2SA 2NYSA 4AG1C 1Q86U 4HVVA 3MEAA 4ELYC 4LDXA 3M0TA 1Q81C 2ZPIB 1XJWB 4LDWA 2NUTB 3M0UA 2LQWA 3G7ZA 4DOVA 3BW1A 5GAN8 1SHGA 2OAUA 3L2QA 3G1JA 3QPHA 5J39A 2EQMA 3A8OB 4BD3A 5EC7A 4JZ3A 2FRYA 2D0QB 4JRKA 4FL6A 3M59A 1TUCA 7AT1B 1VQ7Q 2RHUA 2HAXA 3QWYA 5FLXE 2DAQA 2YLCA 1SPKA 4GBQA 1ZA2B 1FX7A 5LJ5j 1QW1A 4HKEA 3S6WA 4KT0E 3EHQA 2FRWA 4BUGA 2LDMA 1B34B 3VUZA 4C8QC 3CCEQ 1VQNA 4RTUA 2KT8A 3LGFA 5FRNA 2ZPGB 1Q82U 5CO7A 3LLRA 1H3HA 4M7AB 2JUFA 2LNHB 3OYMA 4C92B 2L2PA 2LQNA 2DTHA 2X4YA 3X24B 4C8QF 1D0YA 3ZBDA 3OYFA 4HVWA 2EPDA 1D1CA 4O5VA 5KYXA 2A3LA 5GAMj 2M51A 1RI9A 5HCKA 1EIFA 1YJ9T 3J80E 3CCSA 4PJOF 2YUNA 1KQ1A 3RNJA 1TXQA 1M27C 3MEUA 2NUZA 2PVOB 2Z0WA 3CQTA 1UECA 2A28A 4OMLA 1YFNA 3CCMA 5D6XA 1CKBA 1M2VA 2EBPA 2W10A 1VQMQ 1E7OA 1G2BA 4A4KA 4PL6A 1ZSZB 4HVUA 4BY6C 3CD6Q 5J26A 1YIJA 1MMGA 5GAOq 3EH2A 2ROTA 1WYXA 1YP5A 3X26B 5GANd 2J6OA 2NUPA 3GF5A 2DL7A 2KT1A 1CKAA 4PJOA 3I5SA 1K8AU 1KQSS 1S1NA 4PJNA 3FC3A 1B3QA 2EWNA 3ER0A 3MP8A 1U1SA 1K8AR 1AD5A 5I22A 3PT9A 3VS5A 1Q81U 3OYIA 3EH1A 1VQ5T 1DJ7B 4CI0C 1WHHA 4J9EA 2DTIA 1N5ZA 1YJNQ 3M4YA 1GFDA 5LJ3e 2R5AA 3M57A 1KJWA 2HZYA 2PU9B 2RB6A 1G5VA 5CKBA 2K5IA 2EW3A 2ZAEA 3CBOA 4E7JA 4J6WA 2HL5C 4RUGA 5DY9A 2A37A 2ESWA 2HL3A 3LGLA 2VVKA 1KHIA 3VYHB 4NL3A 2LCCA 2ROLA 3BFMA 1Q7YU 4JPBW 2X35A 2EJGA 1MNDA 3I55Q 4M7AG 1VYUA 2CH4W 4AT1B 2EYQA 1VQPQ 2NLUA 2EYXA 1I4K1 3M5AA 2P0PA 3PVQA 3G4ST 1I5OB 1W1FA 5HKCA 1N6AA 2D8JA 1KQSA 2K4YA 2LT4A 2X4XA 1I81A 5GAOr 3CC7A 1VYVA 2KK4A 2MIOA 1PRMC 1M90C 2QXFA 4LD6A 3JB9J 4JRPA 1JJ2P 4F7UG 3S3OA 5LJ3d 3CMAA 3OBWA 3EGXB 1YCSB 3SHWA 4XU0A 1Y57A 2OTLQ 1M1FA 2DXUA 3DB4A 4ELZC 3I9QA 4C0FA 2JM8A 3GIBA 3JCMh 2FPDA 2KY9A 2F69A 2PQWA 4A4GA 1YCYA 2VWFA 1AEYA 1SKUB 2MYSA 4PJOG 4RTTA 1QQJA 2M1HA 2KDSA 3G6EA 2FYKA 2YUQA 4JDSA 1KD1R 3E9FA 1ARKA 2GQVA 3HRSA 2YRCA 3E1SA 3INZA 1G3SA 1WLPB 2SRCA 2E64A 2V1RA 2DJQA 3NFCA 3CC7T 2CSQA 1KHCA 3V7CA 5LJ5d 4JS4A 5CQYA 2CT3A 3CD6A 4PJOD 2KYMA 4R56A 2A36A 1KSWA 1IXDA 2O31A 2ATCB 1WPYA 1GCPA 2EIFA 3CMAT 1TUGB 1VQKQ 2KR3A 3P8BB 2CP3A 3REBB 4RG2A 1SHFA 3NTHA 2QQAA 1M3AA 1HXDA 1M5Q1 2AKKA 1RACB 2HEQA 1M1KR 3CXCP 2QA4A 3RUXA 2L5QA 4J8OA 3VS2A 2E12A 1KFZA 5IHKA 1N9RA 3TSWA 4XU1A 5IAYA 3EFRA 5GAOn 2DVJA 4HCKA 4M7DB 1K8AC 4Y28E 2CSIA 2DVEA 1C1AA 2D8HA 4EMKC 4EIKA 1UGRB 2VXFA 3JAME 3UA7A 3CMEA 1VQ6Q 5IT9E 2FO0A 2YDLA 2JN0A 2KRNA 1WHJA 5GJWB 2YUOA 5GAN5 2DD4A 3EG1A 3CBPA 5D7UA 4DBQA 3CCET 3TREA 3JCMc 4LDVA 2EJFA 4M75E 4M77F 5LJ5e 1R8OB 2RI5A 3RKYA 2C0TA 1YHQT 2VC8A 2X9HA 2R58A 3EAEA 1WXBA 4RMOA 2XU8A 4M4ZA 1Q86C 4K11A 4GY5A 4BB7A 1K4US 2LJ3A 1IGUA 3M4GA 1VQ8T 1VQ5Q 1UJ0A 2JM9A 3X25B 4D8DA 1C6VX 1LVKA 3C4SA 4M78C 3H0IA 3VS6A 4A63B 1VYTA 1UEBA 2GTJA 2O4XB 1AWWA 2DL5A 4CC2A 1N8RU 2HDAA 4LNPA 3M9QA 2EJ9A 4M77A 4KH0B 1RI0A 3NHNA 3CD6T 1X6OA 1WJSA 1TTHB 2K3XA 4B9WA 2FB7A 1OU9A 1VQNT 2RQUA 4RG8A 4BY6B 2ZGWA 5CKDA 3SD4A 1QVFS 3SDZA 2K2VA 4LDUA 1YITT 3KBGA 2L0AA 2O2OA 4GLMA 2B86A 2H3EB 2XK0A 1VIEA 2DX1A 1FMWA 3ME9A 4FSXA 3GNGA 3OA6A 4QT7A 1U06A 2E4HA 5KYYA 1LOJA 1S72Q 2HSEB 3JCMP 1V76A 3QZ9B 1TU0B 3M0SA 2MCNA 4CC3A 5LJ3h 3R6NA 2P0QA 2FL7A 2CP2A 1AVZC 3JCMQ 5L8RE 3L2UA 2K9GA 3UT1A 2GFUA 3JCMg 3VS3A 2SEMA 1VQMA 3RESA 1E6HA 2MWOA 4E7ZA 3J81E 1G83A 2BE7D 2WSEE 1BKBA 2DEQA 4PJOC 1KG1A 1VQLQ 1YWPA 2BKDN 1FMVA 3I55A 2EGEA 5GAN3 1GRIA 3H9NA 3LH0A 1W2BS 1BI0A 4XQ3A 2DKGA 2C0OA 1PD1A 2X3WD 1X69A 2LP5A 4M7DG 1X75C 5IHIA 4B6MA 2ABLA 2CZ0B 4R55A 2QEXA 4DQ2A 4PLIA 2H3JA 4OB1B 2HBPA 1CSKA 3NTKA 3MPUB 4QVDA 2JOYA 3CCJA 2MOXA 3Q1JA 1YNZA 4FYXB 1RADB 5HY6A 2QASA 2QG9B 1IGQA 2F2VA 1JJ2S 1YJWQ 2DTOA 1JEGA 1Q81R 1RLQC 3CCQQ 2JMCA 4M7AE 3OYBA 5LL6S 2J06A 4Y91A 5LJ3g 2DZCA 3JCMd 2COZA 2LRQA 3QSUA 2R5MA 1VQKA 3NGPA 2I2LA 1Y96B 1YI2A 5KYWA 3I56A 1UHFA 3CC4A 2VB6A 3MO8A 4Y92A 4EPCA 3PGGA 1WHGA 4C8QG 5GAMg 2OX7A 5GAOm 2X3XD 3THKA 4RTZA 3GNFB 1PKSA 1M8MA 4E47A 4PJOB 4KBMB 2CUBA 3CXCA 4M7AD 4F7UA 3GPLA 2EFIA 2RHIA 2QQRA 4DBRA 1M8VA 3EG9A 4OGEA 1I0CA 1OYXA 1RABB 2H8HA 4ZNXA 3L2RA 1M2OA 3S3NA 2DF6A 1PRLC 2CZ1B 2F5TX 3L42A 4BI8B 4M7AF 1TS9A 4F04B 2IPOB 2AZSA 2JJ9A 4ZGJB 1WNLA 1ZUYA 4Z89A 1OEBA 2K7AA 2DRKA 3OS1A 1Q82R 5GAN4 1GXIE 2KE9A 4ANJA 3PTAA 5L23A 2DIQA 1NPPA 2LT1A 2IG0A 1RAEB 2PNIA 2JNGA 2K79A 2LJ0A 1RAAB 1KC8R 3V8JA 3DKMA 1ZUKA 2CP6A 3MEWA 1K73R 2OAWA 4PKCC 2DFUA 1HJDA 3TU4K 3M0PA 1MUZA 4E2FB 2RQVA 3HRTA 2B8AA 1HK9A 3H0HA 3QYHB 4QQGA 1X6BA 1QVFA 2O9SA 3HP9A 1PCXA 2EVRA 1PHTA 1NBEB 1W2BA 2MF2A 1YI2Q 1OV3A 1KC8U 5CIUA 2CREA 1G3WA 4OP0A 1UGSB 3RMQA 2CP0A 5I11A 2F1LA 1S72T 1X6GA 4C92C 3JB9H 3OYNA 1RAFB 4PFPA 5LJ5g 5CR2A 4LUDA 5IXBA 1YI2T 3T9NA 4BE0A 4O6JA 1AZGB 1NYFA 1NEBA 2MWPA 3CCJQ 1MHNA 5GMKl 1R77A 2PVGB 4P5NA 5GANj 2HQXA 5GMKe 2R57A 1VQ7T 2AT1B 4M77B 4JS5A 1M3CA 1ZLMA 2Y4YA 5AT1B 1I07A 2FPEA 2YRDA 1SF9A 3G4SA 3IQLA 4X9DA 5FU7B 4C0ZA 1NPRA 2RHZA 3VRZA 5GANf 2DL3A 5GAN7 1NLOC 1PSEA 4FYYB 4M7DF 4PNOA 2Y90A 1OQKA 4QKUA 2RPNA 2ED0A 3JCMV 4JZ4A 4OMPA 1U1TA 2KYBA 3RMSA 4OB0B 1M90U 3V7SA 4LE9A 3VUBA 2QEXQ 2RJDA 3SB2A 1BIBA 3OYYA 1YHQQ 4PK4A 5CCAA 3A98A 4HT8A 1YJNT 3MEVA 2GNCA 3CPWA 1KIKA 2XIDA 1P92A 3PMTA 3PVLA 1VOMA 3SEMA 2RJEA 1QVGS 1N8RR 3G71T 5GANe 2LX9A 1S72A 3OS0A 1AT1B 2V1QA 1W2BP 4DEXA 3BY7A 4HT9A 2RJFA 4N4HA 3GOXA 2M02A 1ZSZA 2DYBA 3TSZA 4F7UF 3RKWA 3EGDA 4EMKA 4FU6A 4IUVA 4PJLA 5LJ3j 1PM3A 3TVTA 2KVQG 1JU5C 3VKIA 1N27A 1AHJB 1LCKA 1ABQA 1KQSP 1BU1A 1IB8A 1ACMB 4RCCA 3G6EQ 4MMKA 4DBHA 2K5FA 1TOVA 3CCLA 2VV5A 4M78G 2BTTA 3CBMA 4M75B 2RQRA 1VQ9A 3P8HA 1D09B 3LH5A 2DLPA 1B07A 2EYYA 2K6DA 3SWNA 1YIJQ 3E19A 4LXCA 1TSFA 2DBKA 3HPWA 2CKKA 2V8KA 4FM4B 2DM1A 4C5GA 1ABOA 3G6ET 1NJIU 2E6NA 4F17A 3M58A 1BIAA 4J5YA 2E5KA 5KYWB 1N9SA 4L5GA 3C12A 1EX4A 1GBQA 3RERA 2RNAA 2VUBA 4FW2A 4M78D 2DE0X 3L2WA 3CMET 3DLLA 3DB3A 1B7TA 5KCOA 3M54A 4KUIA 3UPUA 4QVCA 2A7YA 4XTUA 1TWBA 2KMTA 4XTVA 1GL5A 5KYUA 2RQWA 2L3QA 2CH4A 2RJCA 3MJXA 2PVDB 2E3IA 4JJCA 3CMEQ 1BI2A 3CCRA 3CC7Q 3A1PA 2D9TA 4JJBA 2DMOA 2LZ6B 3P8DA 3CCSQ 3PIPA 3JB9F 3M55A 2RHXA 5CVIA 1Z9QA 3TEEA 4C8QE 3PIOA 1JB0E 4ORZA 4ZN3A 4N4GA 2JS2A 3QYGB 3L2VA 4OMQA 1RAIB 4IUPA 1G3TA 2CP7A 3CCST 3QWXX 1BCOA 3CXCS 4X9CA 2VYTA 2KSSA 2CT4A 2GCXA 2LTOA 5C6SA 3EGUA 1G8XA 2RN8A 2QK0A 2KI7A 3CPWS 1YITQ 2C06A 1QWEA 3LWHA 1QKWA 2XKOC 5FW9A 3PNWC 4EMHA 1OPKA 2O4XA 3VS4A 3KUFA 2M16A 2DNUA 2IIMA 5GAMe 4JJDA 4C8QD 3V8KA 1OX8A 2COYA 3OYLA 3CCLT 1SSFA 2LVMA 4JJNK 2K3BA 1K73C 2C0IA 3I35A 3NPFA 1QP2A 1WIEA 2G6FX 4XTZA 3CCVT 1RUWA 4NS5A 3CC2A 2JXBA 3PFSA 3VU3C 2FG0A 1C0MA 5CKHA 4E7LA 2HBWA 3CCQA 2KNBB 2MPXC 4HCZA 4ZTJA 2V26A 3VS1A 2JS0A 3MP6A 4KH1B 1UDLA 3QJ6A 3OBYA 4MZTA 3TQ7P 3OYJA 1G3YA 5IXFA 1WFWA 4JLIA 1NJIC 1I1JA 1VQ8Q 5LJ5f 2FZCB 1Y96A 4J9BA 9ATCB 1H641 2J6KA 4M75F 3JCMJ 3H41A 2PTKA 2QTVA 3HFOA 2EQJA 2E5QA 1PG5B 3M53A 4C92E 3M0QA 3F70A 4C5IA 2X4JA 2HKNA 4KGXB 3X28B 3CCRT 4OVAA 3QKJA 3G71Q 1JXOA 2G3RA 2DK3A 1PNJA 2QQSA 2ZPFB 4E6RA 2P84A 4M75D 1K9MC 2EKOA 4JRQA 3L1AA 4C92A 2ED1A 1WQ7A 4FT4A 3OYHA 3UATA 4J9CA 4X1VA 5GMKm 3X20B 2EKHA 1K9AA 5FWCA 2MI6A 4PFOA 1AOJA 1D3BA 1QMCA 1JRIA 4J9FA 2HKQB 3VRYA 1OX9A 1K1ZA 1VQOT 1VQ6A 4A53A 1T3SA 3C94A 1Y71A 1K9MU 4HCBA 2YXYA 1XNIA 3HL8A 4FIBA 4E7HA 2DEUA 3JCMX 3CCEA 2VGNA 3CC2T 1K0SA 4J9IA 4Q5WA 1M4ZA 4FYWB 2J6FA 1Q7YC 4VUBA 2QA4T 3RIRA 2E41A 1NE8A 1T0JA 2D1XA 3CCUT 1Z9ZA 5GAOp 2DPPB 2FZGB 2HCKA 2DRMA 4ZN1A 1VQ7A 1GCQC 1VQ8A 1VQ9Q 1BBZA 4UC4A 2QA4Q 5GAN2 4J9DA 4II1A 4EDUA 4DA4A 1UGQB 5CKFA 2LNVA 3EFOB 2I0NA 2D0NA 2ENMA 1XQHA 3SFMA 1GFCA 3MCAB 3CCJT 1RAHB 2FZKB 4NL2A 4E7SA 1H8KA 4CRIA 1W4SA 2E1HA 1AWOA 4LUEA 3OY9A 4OB3B 5KH6A 4RCBA 2FPFA 2RA2A 3JSCA 3I55T 4C8QA 1FXXA 1BB9A 2OTJT 1BI3A 2XDDA 5DLOA 1MV0B 4KUDK 3AHUA 4CC7A 3TCJA 8ATCB 1KK7A 2QTXA 2OJ2A 5KYYB 1WI7A 1GBRA 1UJYA 2DIGA 2GF7A 6AT1B 4BE1A 2KBTA 1YJ9A 1GCQA 1OI1A 3VS7A 3WVDB 4JUVA 5GAMh 2CUDA 1OULA 4J7IA 3RDVA 1SRMA 4BACA 4F16A 1VQLA 5CK9A 2E10A 3E2UA 3JB9I 4N4IA 3KXTA 1HYOA 2KAFA 1HD3A 2LMJA 4M77E 2AKLA 5A0GA 1QKXA 2D6FA 2RK2A 5C0MA 2KXDA 1QVPA 3GLXA 1QCOA 1MMNA 1W6XA 2DXBA 2VGMA 5LJ5h 2HSPA 1YITA 4N0AC 4NOYA 4XAXB 4C0GA 4ZTFA 1NLPC 5KE2A 2RO0A 4F14A 3RKXA 4HA8A 4IUTA 2DD5A 1UGPB 3L2ZA 2MMPA 3JV3A 5GANh 1R0CB 2K3YA 2V8JA 1YBYA 3U23A 2WSFE 1M9SA 1KC8C 4LD9K 1VQPA 2Y4XA 5GMKj 3C0CA 4OGCA 2V8IA 2DZ9A 2LJ1A 4M75C 1NYGA 4D6WA 1YJWT 2PZ1A 2XDPA 2BZYA 3I56Q 2M0YA 3CC4Q 1BYMA 4M75A 5IH2A 2E70A 3FEOA 3NTIA 5GJVB 4FSSA 4BDZA 2QAZA 3E9GA 3EFOA 2KROA 4IKFA 1QLYA 1V1CA 1IO6A 2X51A 3CPWP 3A5ZB 2XDBA 3ASKA 3MHXA 1V29B 4PJJA 2OTJA 4C0DC 2O88A 2JT4A 3EG3A 2LCLA 5GMKi 1VIFA 2XICA 1H92A 3QHSA 4V2SA 4C92F 1IHWA 1XTDA 1JO8A 1TH7A 1UFFA 2A0FB 5AYFA 2QEXT 2LQKA 1YWOA 3JRZA 2ZPBB 1VQOQ 2EAYA 3ULRB 4MMLA 1D1AA 1EZZB 3H6ZA 3LYIA 4M77D 2KRSA 2FHDA 4ZGDB 2L3SA 1MMAA 4MZMA 3JCMe 4A54A 3CCMT 1D3BB 1X43A 1M1KC 3SWNB 2FEIA 4AG2C 3QDRB 1W70A 2VXEA 4XK8E 1A0NB 2CZ6B 4FYVB 2LQ8A 3JB9G 1T3LA 2HD0A 3CCUQ 4L59A 1ZSGA 1WXTA 3CCMQ 1ZQ1A 1Q7YR 1O75A 1EFNA 1SSHA 1D0ZA 1VQ9T 5GAMd 4IUQA 1VUBA 2W0ZA 3CEYA 3OSVA 3RBBB 2JZ2A 1M3BA 2ZPHB 4ZGEB 5FWBA 1ZUUA 1UTIA 1SEMA 1K0XA 2EQIA 2YWWA 2J7IA 2JMAA 4BI4A 3HKSA 1B34A 2CP5A 2XMFA 1ZA1B 3QZ5B 1KD1C 2RHYA 3CPFA 4OMOA 1Y0MA 1Q82C 1U3OA 4A4EA 1Y7XA 1VQPT 3A8MB 3VS0A 5GANg 5FU6C 3OQ5A 5KYXB 1K9MR 3EG2A 4RTVA 4PJMA 1YJNA 5M9OA 3A8LB 1YIJT 2COWA 2JTMA 4Z02A 2PUKB 1OZ3A 3QIIA 4M78E 2P0KA 4FCYA 5FRMA 2YUPA 3EG0A 3D7SB 1D1BA 1M30A 1SRLA 1WGSA 4C8QB 2RMOA 3OMGA 2L89A 3GP8A 5DLQE 1VQLT 1LNXA 3G71A 4RKUE 1TG0A 4J6XA 5ECAA 4M78A
chains in the Genus database with same CATH topology
1K73R 3CCVQ 1VQKQ 3CCUQ 1YJNQ 3CC2Q 1QVFP 1S72Q 3G71Q 1VQMQ 1YJWQ 1VQOQ 1N8RR 1YIJQ 1M90R 2OTJQ 3CCMQ 3CCSQ 1YITQ 2QEXQ 1Q7YR 3I55Q 3I56Q 3CC4Q 1VQ8Q 3CCEQ 1Q81R 3CCLQ 3CD6Q 3CCQQ 1JJ2P 1QVGP 1VQLQ 1KQSP 1VQ4Q 1YJ9Q 3G4SQ 1W2BP 3CXCP 1M1KR 1VQ6Q 1YHQQ 1Q86R 1VQ7Q 3CCRQ 3G6EQ 1VQPQ 1VQ9Q 1VQNQ 2QA4Q 1K8AR 3CMEQ 1K9MR 1YI2Q 1KD1R 1VQ5Q 1KC8R 3CC7Q 3CMAQ 3CPWP 1NJIR 1Q82R 3OW2P 3CCJQ 2OTLQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 R;  3CCV Q;  1VQK Q;  3CCU Q;  1YJN Q;  3CC2 Q;  1QVF P;  1S72 Q;  3G71 Q;  1VQM Q;  1YJW Q;  1VQO Q;  1N8R R;  1YIJ Q;  1M90 R;  2OTJ Q;  3CCM Q;  3CCS Q;  1YIT Q;  2QEX Q;  1Q7Y R;  3I55 Q;  3I56 Q;  3CC4 Q;  1VQ8 Q;  3CCE Q;  1Q81 R;  3CCL Q;  3CD6 Q;  3CCQ Q;  1JJ2 P;  1QVG P;  1VQL Q;  1KQS P;  1VQ4 Q;  1YJ9 Q;  3G4S Q;  1W2B P;  3CXC P;  1M1K R;  1VQ6 Q;  1YHQ Q;  1Q86 R;  1VQ7 Q;  3CCR Q;  3G6E Q;  1VQP Q;  1VQ9 Q;  1VQN Q;  2QA4 Q;  1K8A R;  3CME Q;  1K9M R;  1YI2 Q;  1KD1 R;  1VQ5 Q;  1KC8 R;  3CC7 Q;  3CMA Q;  3CPW P;  1NJI R;  1Q82 R;  3OW2 P;  3CCJ Q;  2OTL Q; 
#chains in the Genus database with same CATH topology
 4FT2 A;  1NM7 A;  2BUD A;  3OS2 A;  4FW1 A;  1X2Q A;  2CGH A;  3OS5 A;  2QI2 A;  1YJ9 Q;  1VA7 A;  4LDY A;  1Q86 R;  1WHK A;  3FIF A;  3H8Z A;  1VQ4 A;  1SG5 A;  2O9V A;  3FRN A;  2ECZ A;  2JVV A;  2RM4 A;  2QGF B;  3KFV A;  4M75 G;  3A8H B;  2HMA A;  1K76 A;  3WXM B;  4DOW A;  2DXC A;  1ZBJ A;  5HK3 A;  1U5S A;  2RK1 A;  4QW2 A;  2ZZD A;  5KE3 A;  3MKD A;  2CYZ B;  3QUI A;  5HK0 A;  5GAO l;  1UB4 A;  1M1K U;  3R6O A;  3QO3 A;  1QCN A;  1YHQ A;  5I21 A;  1IRE B;  4Z8A A;  4MDX A;  2DA9 A;  2X4W A;  3CMA Q;  1OOT A;  4JRI A;  1TUD A;  4BE2 A;  3OB9 A;  3OYD A;  4M7D D;  2DBM A;  4PJO E;  2OTL A;  1NEG A;  2DL8 A;  1XOV A;  3VYG A;  2DJZ A;  3UA6 A;  4J6Y A;  1J3T A;  1ZBX A;  3OYG A;  2M9U A;  4BDY A;  4IIM A;  4CC4 B;  1ZSZ C;  1VQ5 A;  4F7U E;  1BK2 A;  3QXE B;  2CS7 A;  4XU2 A;  3I5R A;  3V7R A;  2QGG A;  5CKE A;  1AZE A;  1X27 A;  3UF4 A;  4B9X A;  4J9H A;  1WA7 A;  1UHC A;  4M77 C;  2BZ8 A;  3CCV Q;  3QJY A;  2LC4 A;  1NG2 A;  1OU8 A;  5GAN 6;  2DER A;  1QVG P;  2JTF A;  1M2V B;  1WX6 A;  1QWF A;  1NZ9 A;  1UGV A;  1I5L A;  2E65 A;  3JCM b;  4QQ6 A;  4M7A A;  2DL4 A;  2JTE A;  4IIO A;  4J9G A;  2P4R A;  4WF2 A;  2JW4 A;  4M7A C;  3LX7 A;  4AMC A;  1VQ4 Q;  4OMM A;  2HQE A;  4EMK B;  3VV0 A;  4D8K A;  2RQT A;  3ZFJ A;  1N8R C;  2EGA A;  2J05 A;  2RH2 A;  2E6Z A;  4IUU A;  4XTY A;  2QQB A;  2BE9 B;  2ZPE B;  2RD1 A;  3OW2 P;  4OF1 A;  3N5B B;  4XTX A;  4R0K A;  1UUE A;  5J3B A;  5FU7 C;  4GLK A;  2GTO A;  4N0A A;  4XTW A;  2GQI A;  1FYN A;  3HFN A;  4E7I A;  2YLB A;  2F5K A;  3A8G B;  2BIV A;  4C5H A;  1JBM A;  1RAG B;  1QP3 A;  5EG2 A;  2RI2 A;  1UG1 A;  2KEA A;  2AK5 A;  5I2M A;  1NJI R;  2AZV A;  8AT1 B;  2M0O A;  2NUT A;  1RL2 A;  1I8F A;  5GMK h;  3PE0 A;  4WCI A;  3S3M A;  2MAM A;  4DBF A;  4F7U B;  2RI3 A;  3QBY A;  4AFU C;  2NUP B;  3WVE B;  4BI3 A;  3CCL Q;  3O5Z A;  3EG9 B;  1MV3 A;  1MNE A;  2F2W A;  2YSQ A;  1WJQ A;  3BDL A;  3PMI A;  4C92 D;  1Y07 A;  4KGV B;  3NMZ C;  1Q95 G;  3O8V A;  3FB9 A;  4OB2 B;  2OI3 A;  1PKT A;  1FWZ A;  3OYA A;  1PWT A;  1WHM A;  4XU3 A;  3QG1 A;  3MP1 A;  3ZEH A;  2YT6 A;  4J7F A;  3MET A;  1ZHI A;  2XG8 D;  5D6W A;  2HNI A;  2DO3 A;  4C92 G;  2PUO B;  4QVZ A;  2KQW A;  1ZX6 A;  4ESR A;  4ATO A;  4TVR A;  1U8R A;  1OPL A;  1BI1 A;  2ZCF B;  4RTW A;  1JXM A;  1M1G A;  2EYZ A;  1T0H A;  1UE9 A;  1VQK T;  3JCM f;  2YHT A;  2QQ9 A;  3G4S Q;  3LW5 E;  2K5L A;  4PFZ A;  2P4T A;  3I56 T;  3CC4 T;  3CCR Q;  2LCS A;  4Z88 A;  2GGR A;  3M56 A;  4C0D B;  1VQN Q;  1R0B G;  4PLL A;  2CZ7 B;  4M7D C;  1VQO A;  4X34 A;  1E6G A;  5FU6 B;  1QVF P;  2YRV A;  1O9S A;  3V8L A;  4KRT A;  1VQ6 T;  4C5E A;  1BCM A;  2OTL T;  2FVU A;  1JQQ A;  3LWI A;  4L6V 5;  3SWN C;  2XI9 A;  1WDX A;  3BE3 A;  5A0D A;  3H0F A;  3ZL7 C;  1K73 U;  5GAM f;  3EGD B;  3URG A;  1IHV A;  3FDR A;  3CC2 Q;  3C95 A;  3J7A F;  1WJR A;  4QQD A;  1WZO A;  2AHJ B;  3CCQ T;  4M78 B;  4EMG A;  3EFS A;  3JB9 D;  1X01 A;  4OMF B;  1YN8 A;  5CAI A;  3OW2 A;  4M7D E;  2L8D A;  5LJ3 f;  3RR6 A;  1YJW A;  4AFQ C;  1PC0 A;  5A0L A;  3FLG A;  3BDU A;  1IRX A;  2L3P A;  2E3H A;  4MDW A;  1WQW A;  1VQM T;  2NWM A;  1KD1 U;  2RF0 A;  3M0R A;  2GBQ A;  5D6Y A;  3REA B;  5KYU B;  2QDL A;  1OZ2 A;  1MGQ A;  2QDY B;  4M7D A;  2AIR B;  2KRM A;  3FJ5 A;  2VAS A;  3CCV A;  3VJP A;  1HSQ A;  2K57 A;  4J83 A;  2K2M A;  2DIL A;  1LPL A;  5IHN A;  1M90 R;  4LN2 A;  1AWX A;  4OMN A;  2A08 A;  1JJ2 A;  4KUL A;  4RTY A;  2XD0 A;  5CQX A;  4YTL A;  1PD0 A;  1RLP C;  1FMK A;  2DET A;  2DXT A;  1D0X A;  1WHL A;  1QCF A;  2O01 E;  3DLM A;  3OYE A;  2EQU A;  3UWN A;  2L3R A;  3OW2 S;  2LX7 A;  4A4H A;  4MZP A;  2IVW A;  3HHT B;  1MMD A;  2CDT A;  2XHC A;  2HQH A;  1PSF A;  2EYW A;  3EGX A;  5IN1 A;  3HTR A;  3FJP A;  1LJO A;  4HXJ A;  2EQK A;  1X2K A;  2KGT A;  4ME7 A;  3OMC A;  3EHR A;  4AFZ C;  3JCM W;  5FRO A;  4HCC A;  3HSB A;  2KXC A;  2DYI A;  2WSC E;  2VKN A;  5KCH A;  3CCU A;  4IUR A;  4AFS C;  5DM7 R;  1F1B B;  2WAC A;  4WTO B;  2F2X A;  2EGC A;  4RTX A;  3OYK A;  2MK5 A;  3UDC A;  4E7K A;  1QVG A;  4JLG A;  1IZ6 A;  5A2Q E;  1KQ2 A;  3AT1 B;  3GBQ A;  4A4F A;  3HRU A;  2BZX A;  2QYZ A;  4M77 G;  3OYC A;  1VQ4 T;  2GFA A;  1AWJ A;  5KYN A;  1H3Z A;  3OSS C;  2OTJ Q;  4DEY A;  1WXU A;  4KGZ B;  3QDF A;  4M78 F;  5I2S A;  2NYS A;  4AG1 C;  1Q86 U;  4HVV A;  3MEA A;  4ELY C;  4LDX A;  3M0T A;  1Q81 C;  2ZPI B;  1XJW B;  4LDW A;  2NUT B;  3M0U A;  2LQW A;  3G7Z A;  4DOV A;  3BW1 A;  5GAN 8;  1SHG A;  2OAU A;  3L2Q A;  3G1J A;  3QPH A;  5J39 A;  2EQM A;  3A8O B;  4BD3 A;  5EC7 A;  4JZ3 A;  2FRY A;  2D0Q B;  4JRK A;  4FL6 A;  3M59 A;  1TUC A;  7AT1 B;  1VQ7 Q;  2RHU A;  2HAX A;  3QWY A;  5FLX E;  2DAQ A;  2YLC A;  1SPK A;  4GBQ A;  1ZA2 B;  1FX7 A;  5LJ5 j;  1QW1 A;  4HKE A;  3S6W A;  4KT0 E;  3EHQ A;  2FRW A;  4BUG A;  2LDM A;  1B34 B;  3VUZ A;  4C8Q C;  3CCE Q;  1VQN A;  4RTU A;  2KT8 A;  3LGF A;  5FRN A;  2ZPG B;  1Q82 U;  5CO7 A;  3LLR A;  1H3H A;  4M7A B;  2JUF A;  2LNH B;  3OYM A;  4C92 B;  2L2P A;  2LQN A;  2DTH A;  2X4Y A;  3X24 B;  4C8Q F;  1D0Y A;  3ZBD A;  3OYF A;  4HVW A;  2EPD A;  1D1C A;  4O5V A;  5KYX A;  2A3L A;  5GAM j;  2M51 A;  1RI9 A;  5HCK A;  1EIF A;  1YJ9 T;  3J80 E;  3CCS A;  4PJO F;  2YUN A;  1KQ1 A;  3RNJ A;  1TXQ A;  1M27 C;  3MEU A;  2NUZ A;  2PVO B;  2Z0W A;  3CQT A;  1UEC A;  2A28 A;  4OML A;  1YFN A;  3CCM A;  5D6X A;  1CKB A;  1M2V A;  2EBP A;  2W10 A;  1VQM Q;  1E7O A;  1G2B A;  4A4K A;  4PL6 A;  1ZSZ B;  4HVU A;  4BY6 C;  3CD6 Q;  5J26 A;  1YIJ A;  1MMG A;  5GAO q;  3EH2 A;  2ROT A;  1WYX A;  1YP5 A;  3X26 B;  5GAN d;  2J6O A;  2NUP A;  3GF5 A;  2DL7 A;  2KT1 A;  1CKA A;  4PJO A;  3I5S A;  1K8A U;  1KQS S;  1S1N A;  4PJN A;  3FC3 A;  1B3Q A;  2EWN A;  3ER0 A;  3MP8 A;  1U1S A;  1K8A R;  1AD5 A;  5I22 A;  3PT9 A;  3VS5 A;  1Q81 U;  3OYI A;  3EH1 A;  1VQ5 T;  1DJ7 B;  4CI0 C;  1WHH A;  4J9E A;  2DTI A;  1N5Z A;  1YJN Q;  3M4Y A;  1GFD A;  5LJ3 e;  2R5A A;  3M57 A;  1KJW A;  2HZY A;  2PU9 B;  2RB6 A;  1G5V A;  5CKB A;  2K5I A;  2EW3 A;  2ZAE A;  3CBO A;  4E7J A;  4J6W A;  2HL5 C;  4RUG A;  5DY9 A;  2A37 A;  2ESW A;  2HL3 A;  3LGL A;  2VVK A;  1KHI A;  3VYH B;  4NL3 A;  2LCC A;  2ROL A;  3BFM A;  1Q7Y U;  4JPB W;  2X35 A;  2EJG A;  1MND A;  3I55 Q;  4M7A G;  1VYU A;  2CH4 W;  4AT1 B;  2EYQ A;  1VQP Q;  2NLU A;  2EYX A;  1I4K 1;  3M5A A;  2P0P A;  3PVQ A;  3G4S T;  1I5O B;  1W1F A;  5HKC A;  1N6A A;  2D8J A;  1KQS A;  2K4Y A;  2LT4 A;  2X4X A;  1I81 A;  5GAO r;  3CC7 A;  1VYV A;  2KK4 A;  2MIO A;  1PRM C;  1M90 C;  2QXF A;  4LD6 A;  3JB9 J;  4JRP A;  1JJ2 P;  4F7U G;  3S3O A;  5LJ3 d;  3CMA A;  3OBW A;  3EGX B;  1YCS B;  3SHW A;  4XU0 A;  1Y57 A;  2OTL Q;  1M1F A;  2DXU A;  3DB4 A;  4ELZ C;  3I9Q A;  4C0F A;  2JM8 A;  3GIB A;  3JCM h;  2FPD A;  2KY9 A;  2F69 A;  2PQW A;  4A4G A;  1YCY A;  2VWF A;  1AEY A;  1SKU B;  2MYS A;  4PJO G;  4RTT A;  1QQJ A;  2M1H A;  2KDS A;  3G6E A;  2FYK A;  2YUQ A;  4JDS A;  1KD1 R;  3E9F A;  1ARK A;  2GQV A;  3HRS A;  2YRC A;  3E1S A;  3INZ A;  1G3S A;  1WLP B;  2SRC A;  2E64 A;  2V1R A;  2DJQ A;  3NFC A;  3CC7 T;  2CSQ A;  1KHC A;  3V7C A;  5LJ5 d;  4JS4 A;  5CQY A;  2CT3 A;  3CD6 A;  4PJO D;  2KYM A;  4R56 A;  2A36 A;  1KSW A;  1IXD A;  2O31 A;  2ATC B;  1WPY A;  1GCP A;  2EIF A;  3CMA T;  1TUG B;  1VQK Q;  2KR3 A;  3P8B B;  2CP3 A;  3REB B;  4RG2 A;  1SHF A;  3NTH A;  2QQA A;  1M3A A;  1HXD A;  1M5Q 1;  2AKK A;  1RAC B;  2HEQ A;  1M1K R;  3CXC P;  2QA4 A;  3RUX A;  2L5Q A;  4J8O A;  3VS2 A;  2E12 A;  1KFZ A;  5IHK A;  1N9R A;  3TSW A;  4XU1 A;  5IAY A;  3EFR A;  5GAO n;  2DVJ A;  4HCK A;  4M7D B;  1K8A C;  4Y28 E;  2CSI A;  2DVE A;  1C1A A;  2D8H A;  4EMK C;  4EIK A;  1UGR B;  2VXF A;  3JAM E;  3UA7 A;  3CME A;  1VQ6 Q;  5IT9 E;  2FO0 A;  2YDL A;  2JN0 A;  2KRN A;  1WHJ A;  5GJW B;  2YUO A;  5GAN 5;  2DD4 A;  3EG1 A;  3CBP A;  5D7U A;  4DBQ A;  3CCE T;  3TRE A;  3JCM c;  4LDV A;  2EJF A;  4M75 E;  4M77 F;  5LJ5 e;  1R8O B;  2RI5 A;  3RKY A;  2C0T A;  1YHQ T;  2VC8 A;  2X9H A;  2R58 A;  3EAE A;  1WXB A;  4RMO A;  2XU8 A;  4M4Z A;  1Q86 C;  4K11 A;  4GY5 A;  4BB7 A;  1K4U S;  2LJ3 A;  1IGU A;  3M4G A;  1VQ8 T;  1VQ5 Q;  1UJ0 A;  2JM9 A;  3X25 B;  4D8D A;  1C6V X;  1LVK A;  3C4S A;  4M78 C;  3H0I A;  3VS6 A;  4A63 B;  1VYT A;  1UEB A;  2GTJ A;  2O4X B;  1AWW A;  2DL5 A;  4CC2 A;  1N8R U;  2HDA A;  4LNP A;  3M9Q A;  2EJ9 A;  4M77 A;  4KH0 B;  1RI0 A;  3NHN A;  3CD6 T;  1X6O A;  1WJS A;  1TTH B;  2K3X A;  4B9W A;  2FB7 A;  1OU9 A;  1VQN T;  2RQU A;  4RG8 A;  4BY6 B;  2ZGW A;  5CKD A;  3SD4 A;  1QVF S;  3SDZ A;  2K2V A;  4LDU A;  1YIT T;  3KBG A;  2L0A A;  2O2O A;  4GLM A;  2B86 A;  2H3E B;  2XK0 A;  1VIE A;  2DX1 A;  1FMW A;  3ME9 A;  4FSX A;  3GNG A;  3OA6 A;  4QT7 A;  1U06 A;  2E4H A;  5KYY A;  1LOJ A;  1S72 Q;  2HSE B;  3JCM P;  1V76 A;  3QZ9 B;  1TU0 B;  3M0S A;  2MCN A;  4CC3 A;  5LJ3 h;  3R6N A;  2P0Q A;  2FL7 A;  2CP2 A;  1AVZ C;  3JCM Q;  5L8R E;  3L2U A;  2K9G A;  3UT1 A;  2GFU A;  3JCM g;  3VS3 A;  2SEM A;  1VQM A;  3RES A;  1E6H A;  2MWO A;  4E7Z A;  3J81 E;  1G83 A;  2BE7 D;  2WSE E;  1BKB A;  2DEQ A;  4PJO C;  1KG1 A;  1VQL Q;  1YWP A;  2BKD N;  1FMV A;  3I55 A;  2EGE A;  5GAN 3;  1GRI A;  3H9N A;  3LH0 A;  1W2B S;  1BI0 A;  4XQ3 A;  2DKG A;  2C0O A;  1PD1 A;  2X3W D;  1X69 A;  2LP5 A;  4M7D G;  1X75 C;  5IHI A;  4B6M A;  2ABL A;  2CZ0 B;  4R55 A;  2QEX A;  4DQ2 A;  4PLI A;  2H3J A;  4OB1 B;  2HBP A;  1CSK A;  3NTK A;  3MPU B;  4QVD A;  2JOY A;  3CCJ A;  2MOX A;  3Q1J A;  1YNZ A;  4FYX B;  1RAD B;  5HY6 A;  2QAS A;  2QG9 B;  1IGQ A;  2F2V A;  1JJ2 S;  1YJW Q;  2DTO A;  1JEG A;  1Q81 R;  1RLQ C;  3CCQ Q;  2JMC A;  4M7A E;  3OYB A;  5LL6 S;  2J06 A;  4Y91 A;  5LJ3 g;  2DZC A;  3JCM d;  2COZ A;  2LRQ A;  3QSU A;  2R5M A;  1VQK A;  3NGP A;  2I2L A;  1Y96 B;  1YI2 A;  5KYW A;  3I56 A;  1UHF A;  3CC4 A;  2VB6 A;  3MO8 A;  4Y92 A;  4EPC A;  3PGG A;  1WHG A;  4C8Q G;  5GAM g;  2OX7 A;  5GAO m;  2X3X D;  3THK A;  4RTZ A;  3GNF B;  1PKS A;  1M8M A;  4E47 A;  4PJO B;  4KBM B;  2CUB A;  3CXC A;  4M7A D;  4F7U A;  3GPL A;  2EFI A;  2RHI A;  2QQR A;  4DBR A;  1M8V A;  3EG9 A;  4OGE A;  1I0C A;  1OYX A;  1RAB B;  2H8H A;  4ZNX A;  3L2R A;  1M2O A;  3S3N A;  2DF6 A;  1PRL C;  2CZ1 B;  2F5T X;  3L42 A;  4BI8 B;  4M7A F;  1TS9 A;  4F04 B;  2IPO B;  2AZS A;  2JJ9 A;  4ZGJ B;  1WNL A;  1ZUY A;  4Z89 A;  1OEB A;  2K7A A;  2DRK A;  3OS1 A;  1Q82 R;  5GAN 4;  1GXI E;  2KE9 A;  4ANJ A;  3PTA A;  5L23 A;  2DIQ A;  1NPP A;  2LT1 A;  2IG0 A;  1RAE B;  2PNI A;  2JNG A;  2K79 A;  2LJ0 A;  1RAA B;  1KC8 R;  3V8J A;  3DKM A;  1ZUK A;  2CP6 A;  3MEW A;  1K73 R;  2OAW A;  4PKC C;  2DFU A;  1HJD A;  3TU4 K;  3M0P A;  1MUZ A;  4E2F B;  2RQV A;  3HRT A;  2B8A A;  1HK9 A;  3H0H A;  3QYH B;  4QQG A;  1X6B A;  1QVF A;  2O9S A;  3HP9 A;  1PCX A;  2EVR A;  1PHT A;  1NBE B;  1W2B A;  2MF2 A;  1YI2 Q;  1OV3 A;  1KC8 U;  5CIU A;  2CRE A;  1G3W A;  4OP0 A;  1UGS B;  3RMQ A;  2CP0 A;  5I11 A;  2F1L A;  1S72 T;  1X6G A;  4C92 C;  3JB9 H;  3OYN A;  1RAF B;  4PFP A;  5LJ5 g;  5CR2 A;  4LUD A;  5IXB A;  1YI2 T;  3T9N A;  4BE0 A;  4O6J A;  1AZG B;  1NYF A;  1NEB A;  2MWP A;  3CCJ Q;  1MHN A;  5GMK l;  1R77 A;  2PVG B;  4P5N A;  5GAN j;  2HQX A;  5GMK e;  2R57 A;  1VQ7 T;  2AT1 B;  4M77 B;  4JS5 A;  1M3C A;  1ZLM A;  2Y4Y A;  5AT1 B;  1I07 A;  2FPE A;  2YRD A;  1SF9 A;  3G4S A;  3IQL A;  4X9D A;  5FU7 B;  4C0Z A;  1NPR A;  2RHZ A;  3VRZ A;  5GAN f;  2DL3 A;  5GAN 7;  1NLO C;  1PSE A;  4FYY B;  4M7D F;  4PNO A;  2Y90 A;  1OQK A;  4QKU A;  2RPN A;  2ED0 A;  3JCM V;  4JZ4 A;  4OMP A;  1U1T A;  2KYB A;  3RMS A;  4OB0 B;  1M90 U;  3V7S A;  4LE9 A;  3VUB A;  2QEX Q;  2RJD A;  3SB2 A;  1BIB A;  3OYY A;  1YHQ Q;  4PK4 A;  5CCA A;  3A98 A;  4HT8 A;  1YJN T;  3MEV A;  2GNC A;  3CPW A;  1KIK A;  2XID A;  1P92 A;  3PMT A;  3PVL A;  1VOM A;  3SEM A;  2RJE A;  1QVG S;  1N8R R;  3G71 T;  5GAN e;  2LX9 A;  1S72 A;  3OS0 A;  1AT1 B;  2V1Q A;  1W2B P;  4DEX A;  3BY7 A;  4HT9 A;  2RJF A;  4N4H A;  3GOX A;  2M02 A;  1ZSZ A;  2DYB A;  3TSZ A;  4F7U F;  3RKW A;  3EGD A;  4EMK A;  4FU6 A;  4IUV A;  4PJL A;  5LJ3 j;  1PM3 A;  3TVT A;  2KVQ G;  1JU5 C;  3VKI A;  1N27 A;  1AHJ B;  1LCK A;  1ABQ A;  1KQS P;  1BU1 A;  1IB8 A;  1ACM B;  4RCC A;  3G6E Q;  4MMK A;  4DBH A;  2K5F A;  1TOV A;  3CCL A;  2VV5 A;  4M78 G;  2BTT A;  3CBM A;  4M75 B;  2RQR A;  1VQ9 A;  3P8H A;  1D09 B;  3LH5 A;  2DLP A;  1B07 A;  2EYY A;  2K6D A;  3SWN A;  1YIJ Q;  3E19 A;  4LXC A;  1TSF A;  2DBK A;  3HPW A;  2CKK A;  2V8K A;  4FM4 B;  2DM1 A;  4C5G A;  1ABO A;  3G6E T;  1NJI U;  2E6N A;  4F17 A;  3M58 A;  1BIA A;  4J5Y A;  2E5K A;  5KYW B;  1N9S A;  4L5G A;  3C12 A;  1EX4 A;  1GBQ A;  3RER A;  2RNA A;  2VUB A;  4FW2 A;  4M78 D;  2DE0 X;  3L2W A;  3CME T;  3DLL A;  3DB3 A;  1B7T A;  5KCO A;  3M54 A;  4KUI A;  3UPU A;  4QVC A;  2A7Y A;  4XTU A;  1TWB A;  2KMT A;  4XTV A;  1GL5 A;  5KYU A;  2RQW A;  2L3Q A;  2CH4 A;  2RJC A;  3MJX A;  2PVD B;  2E3I A;  4JJC A;  3CME Q;  1BI2 A;  3CCR A;  3CC7 Q;  3A1P A;  2D9T A;  4JJB A;  2DMO A;  2LZ6 B;  3P8D A;  3CCS Q;  3PIP A;  3JB9 F;  3M55 A;  2RHX A;  5CVI A;  1Z9Q A;  3TEE A;  4C8Q E;  3PIO A;  1JB0 E;  4ORZ A;  4ZN3 A;  4N4G A;  2JS2 A;  3QYG B;  3L2V A;  4OMQ A;  1RAI B;  4IUP A;  1G3T A;  2CP7 A;  3CCS T;  3QWX X;  1BCO A;  3CXC S;  4X9C A;  2VYT A;  2KSS A;  2CT4 A;  2GCX A;  2LTO A;  5C6S A;  3EGU A;  1G8X A;  2RN8 A;  2QK0 A;  2KI7 A;  3CPW S;  1YIT Q;  2C06 A;  1QWE A;  3LWH A;  1QKW A;  2XKO C;  5FW9 A;  3PNW C;  4EMH A;  1OPK A;  2O4X A;  3VS4 A;  3KUF A;  2M16 A;  2DNU A;  2IIM A;  5GAM e;  4JJD A;  4C8Q D;  3V8K A;  1OX8 A;  2COY A;  3OYL A;  3CCL T;  1SSF A;  2LVM A;  4JJN K;  2K3B A;  1K73 C;  2C0I A;  3I35 A;  3NPF A;  1QP2 A;  1WIE A;  2G6F X;  4XTZ A;  3CCV T;  1RUW A;  4NS5 A;  3CC2 A;  2JXB A;  3PFS A;  3VU3 C;  2FG0 A;  1C0M A;  5CKH A;  4E7L A;  2HBW A;  3CCQ A;  2KNB B;  2MPX C;  4HCZ A;  4ZTJ A;  2V26 A;  3VS1 A;  2JS0 A;  3MP6 A;  4KH1 B;  1UDL A;  3QJ6 A;  3OBY A;  4MZT A;  3TQ7 P;  3OYJ A;  1G3Y A;  5IXF A;  1WFW A;  4JLI A;  1NJI C;  1I1J A;  1VQ8 Q;  5LJ5 f;  2FZC B;  1Y96 A;  4J9B A;  9ATC B;  1H64 1;  2J6K A;  4M75 F;  3JCM J;  3H41 A;  2PTK A;  2QTV A;  3HFO A;  2EQJ A;  2E5Q A;  1PG5 B;  3M53 A;  4C92 E;  3M0Q A;  3F70 A;  4C5I A;  2X4J A;  2HKN A;  4KGX B;  3X28 B;  3CCR T;  4OVA A;  3QKJ A;  3G71 Q;  1JXO A;  2G3R A;  2DK3 A;  1PNJ A;  2QQS A;  2ZPF B;  4E6R A;  2P84 A;  4M75 D;  1K9M C;  2EKO A;  4JRQ A;  3L1A A;  4C92 A;  2ED1 A;  1WQ7 A;  4FT4 A;  3OYH A;  3UAT A;  4J9C A;  4X1V A;  5GMK m;  3X20 B;  2EKH A;  1K9A A;  5FWC A;  2MI6 A;  4PFO A;  1AOJ A;  1D3B A;  1QMC A;  1JRI A;  4J9F A;  2HKQ B;  3VRY A;  1OX9 A;  1K1Z A;  1VQO T;  1VQ6 A;  4A53 A;  1T3S A;  3C94 A;  1Y71 A;  1K9M U;  4HCB A;  2YXY A;  1XNI A;  3HL8 A;  4FIB A;  4E7H A;  2DEU A;  3JCM X;  3CCE A;  2VGN A;  3CC2 T;  1K0S A;  4J9I A;  4Q5W A;  1M4Z A;  4FYW B;  2J6F A;  1Q7Y C;  4VUB A;  2QA4 T;  3RIR A;  2E41 A;  1NE8 A;  1T0J A;  2D1X A;  3CCU T;  1Z9Z A;  5GAO p;  2DPP B;  2FZG B;  2HCK A;  2DRM A;  4ZN1 A;  1VQ7 A;  1GCQ C;  1VQ8 A;  1VQ9 Q;  1BBZ A;  4UC4 A;  2QA4 Q;  5GAN 2;  4J9D A;  4II1 A;  4EDU A;  4DA4 A;  1UGQ B;  5CKF A;  2LNV A;  3EFO B;  2I0N A;  2D0N A;  2ENM A;  1XQH A;  3SFM A;  1GFC A;  3MCA B;  3CCJ T;  1RAH B;  2FZK B;  4NL2 A;  4E7S A;  1H8K A;  4CRI A;  1W4S A;  2E1H A;  1AWO A;  4LUE A;  3OY9 A;  4OB3 B;  5KH6 A;  4RCB A;  2FPF A;  2RA2 A;  3JSC A;  3I55 T;  4C8Q A;  1FXX A;  1BB9 A;  2OTJ T;  1BI3 A;  2XDD A;  5DLO A;  1MV0 B;  4KUD K;  3AHU A;  4CC7 A;  3TCJ A;  8ATC B;  1KK7 A;  2QTX A;  2OJ2 A;  5KYY B;  1WI7 A;  1GBR A;  1UJY A;  2DIG A;  2GF7 A;  6AT1 B;  4BE1 A;  2KBT A;  1YJ9 A;  1GCQ A;  1OI1 A;  3VS7 A;  3WVD B;  4JUV A;  5GAM h;  2CUD A;  1OUL A;  4J7I A;  3RDV A;  1SRM A;  4BAC A;  4F16 A;  1VQL A;  5CK9 A;  2E10 A;  3E2U A;  3JB9 I;  4N4I A;  3KXT A;  1HYO A;  2KAF A;  1HD3 A;  2LMJ A;  4M77 E;  2AKL A;  5A0G A;  1QKX A;  2D6F A;  2RK2 A;  5C0M A;  2KXD A;  1QVP A;  3GLX A;  1QCO A;  1MMN A;  1W6X A;  2DXB A;  2VGM A;  5LJ5 h;  2HSP A;  1YIT A;  4N0A C;  4NOY A;  4XAX B;  4C0G A;  4ZTF A;  1NLP C;  5KE2 A;  2RO0 A;  4F14 A;  3RKX A;  4HA8 A;  4IUT A;  2DD5 A;  1UGP B;  3L2Z A;  2MMP A;  3JV3 A;  5GAN h;  1R0C B;  2K3Y A;  2V8J A;  1YBY A;  3U23 A;  2WSF E;  1M9S A;  1KC8 C;  4LD9 K;  1VQP A;  2Y4X A;  5GMK j;  3C0C A;  4OGC A;  2V8I A;  2DZ9 A;  2LJ1 A;  4M75 C;  1NYG A;  4D6W A;  1YJW T;  2PZ1 A;  2XDP A;  2BZY A;  3I56 Q;  2M0Y A;  3CC4 Q;  1BYM A;  4M75 A;  5IH2 A;  2E70 A;  3FEO A;  3NTI A;  5GJV B;  4FSS A;  4BDZ A;  2QAZ A;  3E9G A;  3EFO A;  2KRO A;  4IKF A;  1QLY A;  1V1C A;  1IO6 A;  2X51 A;  3CPW P;  3A5Z B;  2XDB A;  3ASK A;  3MHX A;  1V29 B;  4PJJ A;  2OTJ A;  4C0D C;  2O88 A;  2JT4 A;  3EG3 A;  2LCL A;  5GMK i;  1VIF A;  2XIC A;  1H92 A;  3QHS A;  4V2S A;  4C92 F;  1IHW A;  1XTD A;  1JO8 A;  1TH7 A;  1UFF A;  2A0F B;  5AYF A;  2QEX T;  2LQK A;  1YWO A;  3JRZ A;  2ZPB B;  1VQO Q;  2EAY A;  3ULR B;  4MML A;  1D1A A;  1EZZ B;  3H6Z A;  3LYI A;  4M77 D;  2KRS A;  2FHD A;  4ZGD B;  2L3S A;  1MMA A;  4MZM A;  3JCM e;  4A54 A;  3CCM T;  1D3B B;  1X43 A;  1M1K C;  3SWN B;  2FEI A;  4AG2 C;  3QDR B;  1W70 A;  2VXE A;  4XK8 E;  1A0N B;  2CZ6 B;  4FYV B;  2LQ8 A;  3JB9 G;  1T3L A;  2HD0 A;  3CCU Q;  4L59 A;  1ZSG A;  1WXT A;  3CCM Q;  1ZQ1 A;  1Q7Y R;  1O75 A;  1EFN A;  1SSH A;  1D0Z A;  1VQ9 T;  5GAM d;  4IUQ A;  1VUB A;  2W0Z A;  3CEY A;  3OSV A;  3RBB B;  2JZ2 A;  1M3B A;  2ZPH B;  4ZGE B;  5FWB A;  1ZUU A;  1UTI A;  1SEM A;  1K0X A;  2EQI A;  2YWW A;  2J7I A;  2JMA A;  4BI4 A;  3HKS A;  1B34 A;  2CP5 A;  2XMF A;  1ZA1 B;  3QZ5 B;  1KD1 C;  2RHY A;  3CPF A;  4OMO A;  1Y0M A;  1Q82 C;  1U3O A;  4A4E A;  1Y7X A;  1VQP T;  3A8M B;  3VS0 A;  5GAN g;  5FU6 C;  3OQ5 A;  5KYX B;  1K9M R;  3EG2 A;  4RTV A;  4PJM A;  1YJN A;  5M9O A;  3A8L B;  1YIJ T;  2COW A;  2JTM A;  4Z02 A;  2PUK B;  1OZ3 A;  3QII A;  4M78 E;  2P0K A;  4FCY A;  5FRM A;  2YUP A;  3EG0 A;  3D7S B;  1D1B A;  1M30 A;  1SRL A;  1WGS A;  4C8Q B;  2RMO A;  3OMG A;  2L89 A;  3GP8 A;  5DLQ E;  1VQL T;  1LNX A;  3G71 A;  4RKU E;  1TG0 A;  4J6X A;  5ECA A;  4M78 A; 
#chains in the Genus database with same CATH homology
 1K73 R;  3CCV Q;  1VQK Q;  3CCU Q;  1YJN Q;  3CC2 Q;  1QVF P;  1S72 Q;  3G71 Q;  1VQM Q;  1YJW Q;  1VQO Q;  1N8R R;  1YIJ Q;  1M90 R;  2OTJ Q;  3CCM Q;  3CCS Q;  1YIT Q;  2QEX Q;  1Q7Y R;  3I55 Q;  3I56 Q;  3CC4 Q;  1VQ8 Q;  3CCE Q;  1Q81 R;  3CCL Q;  3CD6 Q;  3CCQ Q;  1JJ2 P;  1QVG P;  1VQL Q;  1KQS P;  1VQ4 Q;  1YJ9 Q;  3G4S Q;  1W2B P;  3CXC P;  1M1K R;  1VQ6 Q;  1YHQ Q;  1Q86 R;  1VQ7 Q;  3CCR Q;  3G6E Q;  1VQP Q;  1VQ9 Q;  1VQN Q;  2QA4 Q;  1K8A R;  3CME Q;  1K9M R;  1YI2 Q;  1KD1 R;  1VQ5 Q;  1KC8 R;  3CC7 Q;  3CMA Q;  3CPW P;  1NJI R;  1Q82 R;  3OW2 P;  3CCJ Q;  2OTL Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...