1VQMQ

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqmQ00
3OW2P 1KD1R 1KQSP 1Q81R 3CCLQ 1VQKQ 3CD6Q 1VQ4Q 1VQ7Q 1QVGP 3CCUQ 1YJNQ 1YIJQ 1M90R 3CMEQ 1QVFP 1K9MR 3CCQQ 1YITQ 1VQLQ 1N8RR 2OTLQ 1Q82R 1VQMQ 1K73R 1NJIR 1VQOQ 1M1KR 3CC7Q 3CMAQ 1VQ9Q 1YJ9Q 1S72Q 3CPWP 3G6EQ 3CCVQ 3CC4Q 1YHQQ 3CXCP 3I55Q 2QEXQ 2OTJQ 1YJWQ 1W2BP 1VQ6Q 1VQ5Q 3CCRQ 3I56Q 1VQPQ 1K8AR 3CCSQ 3CCEQ 3G71Q 3CCMQ 1VQNQ 1VQ8Q 1KC8R 3CC2Q 1Q7YR 3CCJQ 1Q86R 2QA4Q 1YI2Q 3G4SQ 1JJ2P
chains in the Genus database with same CATH superfamily
1LCKA 2J05A 2JMAA 4BE2A 2FG0A 1FX7A 3CCRT 3C12A 3CCMT 3L1AA 4E2FB 2ED1A 1K73C 1M1KR 3Q1JA 4M7DB 2HBPA 1QQJA 2E4HA 1YJNT 3KBGA 1SSHA 3OYNA 2VB6A 5I22A 1IXDA 2CZ1B 2F5KA 3QBYA 3VYGA 1N6AA 2CSIA 4JLGA 1AHJB 2GCXA 1D0XA 1X6GA 3X24B 3CD6Q 3JSCA 1W2BA 1JJ2S 3JCMd 4XTZA 1AOJA 3CCET 3FC3A 4KGXB 2BZ8A 5FRNA 1YIJA 1Y71A 3I35A 2DZ9A 3OBYA 3DLLA 2NYSA 3NMZC 1GRIA 3CPWS 1WYXA 2E70A 4CC7A 4HVVA 2F2XA 4A53A 5KYNA 2RJEA 1AZEA 4OB1B 3OYLA 4GLMA 2A08A 4KGVB 3OB9A 4OMMA 5GAOp 3JCMP 3RR6A 3CCST 1GCQC 2HZYA 2JMCA 2M02A 3V8KA 2LCCA 3CMEA 2VXFA 5GMKj 3V7CA 4M7DA 1CKBA 2K2VA 2D8JA 3LGLA 5GAN5 2CS7A 3CPWA 2CP2A 3X25B 4LDWA 4C92D 2GNCA 3A8LB 2J7IA 3LX7A 4C92G 3LLRA 1VQMQ 5CKEA 3OA6A 2RK1A 2DL3A 4PJNA 4J8OA 2QASA 3I55A 5GANg 3INZA 1KC8C 1YBYA 2HBWA 2DIQA 3MPUB 3A5ZB 2LQNA 2C0TA 3H41A 5FU7C 2PNIA 3OSSC 1YI2A 5GAMj 4CC3A 1VQKA 2VWFA 2JVVA 2RH2A 3M5AA 2E12A 3QYGB 5HK0A 4L5GA 3CC4A 1QVGA 4AFUC 1UJYA 3CXCS 2V8KA 4RTYA 3CC7T 4X9CA 4M7AD 2O2OA 4BY6C 1MUZA 4M7AG 2KVQG 4LDUA 1VQ6T 2JNGA 2LCSA 4JRPA 2MCNA 2CUBA 4J6XA 4LUDA 2K5LA 4M75E 2OJ2A 2A36A 1RADB 2R57A 4C0ZA 2YUNA 2VUBA 3QHSA 3DB4A 4J6YA 1RL2A 2K57A 4BI4A 4JJDA 3U23A 1ZX6A 2XIDA 1WJSA 5C0MA 1Q7YR 2ZPHB 4OMLA 3MHXA 4TVRA 4HKEA 3CQTA 1N8RC 4ZN1A 1GCQA 2HKQB 4FSSA 4KT0E 2QTVA 2JXBA 1WQ7A 4IIMA 4PJOF 1M30A 1OEBA 2CKKA 3PIOA 2RI5A 1WFWA 2GFAA 2EJGA 4BUGA 2XD0A 4C0GA 2LNVA 4QT7A 4OB3B 3QXEB 1YJWT 2ZGWA 3VRZA 3OSVA 1K9MU 4WF2A 1WXBA 4AFQC 4F17A 3FDRA 4HCBA 3G4ST 4LNPA 3CCVQ 4GLKA 4O5VA 2EQMA 1K9AA 1W4SA 4HCZA 1K8AR 1VQLT 3OYKA 3V8JA 1SHFA 1YI2Q 5GANe 2VYTA 2VGMA 1WX6A 1UDLA 1VQPT 2HQEA 3V7RA 3L42A 3META 3H9NA 2QQ9A 3LGFA 4C8QE 1MMNA 4PKCC 4JJCA 4ME7A 1G8XA 4LD6A 1B3QA 2D0QB 2DXCA 1PC0A 3CCVT 3JCMf 1S72T 2K5IA 4EIKA 3OYGA 3JB9J 2J6OA 1UECA 1KHIA 1G3TA 2WSCE 4Z89A 4HCKA 4N4HA 1WXUA 1YHQQ 2CP7A 4B9WA 2YUPA 2JOYA 3H0IA 3VS6A 4E7KA 2KR3A 2MAMA 1AWXA 2L3RA 1NYFA 4OMNA 1EIFA 2KY9A 1M27C 1WHHA 2FL7A 1M90U 2O9SA 1SRLA 2K79A 3CPFA 7AT1B 1M1KC 3QJYA 4CI0C 4M77E 3OMCA 1WNLA 2GF7A 1JXMA 3QO3A 2LCLA 2L2PA 2YLCA 4XTYA 2FRWA 1NZ9A 3L2QA 1B34B 2CZ6B 2HQXA 4B6MA 4JS4A 2MK5A 2M51A 3HHTB 2RQTA 2HKNA 3WVDB 1UTIA 1VUBA 5D7UA 2GQVA 3A1PA 3OBWA 2P4TA 5GAOq 4JPBW 1MMAA 3TVTA 1YJ9Q 2DVJA 1GFDA 1TTHB 4HXJA 2L3QA 2E5QA 3NHNA 2HDAA 1RAFB 5J26A 1PD1A 2SRCA 2YXYA 5GMKi 2LDMA 2JTFA 5CIUA 3EG3A 1Y96B 1D0YA 4XU3A 4ANJA 3M4GA 1XJWB 5ECAA 1TUDA 1I5OB 1HJDA 1K0XA 4M75F 1KHCA 1D1CA 3EHRA 2QGFB 1M4ZA 2KT1A 3GF5A 1D1AA 5M9OA 2RQWA 3TQ7P 3ZFJA 3O8VA 3JCMh 3BY7A 1XOVA 3GBQA 3JV3A 4PK4A 4IUUA 1BI2A 2E64A 3QG1A 5CAIA 3CC2Q 3NGPA 5FWBA 4E7LA 1KD1U 4AFZC 2YWWA 2DA9A 4WCIA 1K4US 3E1SA 5LJ5f 3HP9A 1IB8A 4FIBA 3PVLA 1QVFS 4FW2A 4J6WA 3LH5A 4WTOB 1SSFA 4BACA 4R0KA 1RUWA 2OTJA 1GCPA 1G2BA 3PVQA 2LRQA 4QKUA 1Y96A 4BE1A 1FMVA 1BI0A 2BE9B 5GAN6 3DKMA 4C92C 2D0NA 1SKUB 4PJMA 1OOTA 2LJ3A 2BTTA 4M4ZA 1QW1A 2LQ8A 2X4XA 4BI3A 4J9DA 2EJ9A 5KYYB 2WSFE 2PUOB 4LD9K 3JCMW 2NLUA 2C0IA 1AT1B 2E41A 4IIOA 1VQ4T 2CH4A 2ZAEA 1BBZA 1NPRA 2QQSA 2DEQA 2OX7A 1KC8U 4OMFB 3REBB 5GMKe 1Q7YC 4II1A 3M0PA 1AD5A 5GMKm 1GFCA 1GBRA 4ZGJB 2QDYB 1AVZC 2Y90A 5KCOA 2JS2A 4F7UF 3G1JA 8AT1B 4LXCA 4M7AC 2CUDA 5L23A 1X43A 5HY6A 1VQNT 3ZBDA 4MMKA 2K9GA 2PVDB 2ED0A 1EX4A 4M7DE 3A8MB 1YN8A 5LJ5h 4P5NA 3CCRA 1VQ8Q 4XTXA 3CCMA 1KK7A 2FYKA 1Z9ZA 4E7JA 2KROA 2HAXA 5KE2A 3JAME 4EMGA 1YJNA 1N8RR 2QA4T 2HL5C 3CMAQ 5IN1A 5GAMe 2ESWA 4M78B 3CCLT 1VQ7T 3EG2A 3KUFA 4XAXB 3UA6A 1K8AC 2D9TA 2MYSA 2F1LA 5GAN7 2R58A 3CCEA 3UPUA 1OU8A 4DOVA 1KQSP 4HVWA 2RB6A 3OW2S 4M7AB 2LC4A 1I0CA 1NG2A 2XI9A 2DRKA 2DXBA 3VS0A 3OYIA 4ZGEB 4DEXA 2A28A 2EYXA 1VQ5Q 5DM7R 3HRTA 3EGUA 3VS3A 2DO3A 1YWPA 4E6RA 1SPKA 5A0LA 1VQ9T 1JO8A 2P0PA 2E6NA 1E6GA 3OS2A 3VJPA 4JUVA 4MZTA 1KJWA 4Z02A 3C95A 4HVUA 1YITA 4R56A 1RABB 4J9HA 4MDWA 3OW2A 4M78A 2PTKA 5CQYA 4CC2A 2Y4YA 1EZZB 3THKA 1C1AA 4Z8AA 5A0DA 1LVKA 5CQXA 2JM9A 3EFOB 4RG2A 4M7AA 3CCUA 1G3WA 1D0ZA 2Z0WA 2PUKB 2YRCA 3NTKA 2P0KA 4XU0A 3E9GA 4BDYA 1W2BS 1NYGA 2KXDA 3G71Q 2AZVA 2L89A 2M16A 3G6ET 3FIFA 2KAFA 2MMPA 1JBMA 1KIKA 4C0FA 3IQLA 1JQQA 3HFOA 2X4YA 4Y28E 3RKWA 4IUVA 1JRIA 1M3BA 3CC7A 1UJ0A 1U8RA 4ELYC 1QWEA 1T0HA 2YUOA 1VQ6A 1WHKA 4QVDA 1JJ2P 2BZYA 5FWCA 2FZGB 3RERA 4EMKB 4OGEA 3EFOA 1M1KU 3VU3C 2RHUA 3JCMX 2JN0A 5GMKl 2LT1A 1I07A 2V26A 1X2KA 2RQVA 4NL3A 3OYDA 2C0OA 3OYBA 4F7UG 3OYMA 3ZEHA 3H8ZA 2X4WA 4FSXA 4XU1A 4A54A 2OTLA 4J9CA 5IH2A 1M3AA 5KYUB 4XTWA 4A4HA 4D8KA 2RM4A 1UHFA 3M53A 3KFVA 1N27A 4D6WA 1TSFA 1WQWA 3CD6T 1VQOA 4PJJA 2CP0A 2QEXQ 1P92A 4O6JA 1AZGB 1YJWA 4QVCA 1M2OA 2JZ2A 4ZN3A 2EWNA 2CP6A 2GQIA 2QAZA 3EG9B 2F2VA 3FLGA 3G4SA 5GAOr 3PIPA 3VS4A 3CCUQ 2E5KA 1ABOA 2ENMA 4JRIA 1QVGS 1Y07A 5KYXB 4KULA 4HT8A 5AT1B 1VOMA 1VQLA 3HL8A 1PKSA 2DRMA 2DPPB 1M5Q1 3HSBA 3PE0A 1MV3A 5HK3A 1WZOA 4F04B 4OB0B 4BI8B 5LJ3f 2DK3A 1QCNA 1VQPA 5HCKA 3N5BB 2AZSA 5KCHA 2CGHA 2J06A 4RKUE 1WHMA 3EGXB 3SFMA 1WXTA 3EH1A 1M8VA 3EGDB 3C94A 5KYUA 3RIRA 4JRQA 1TS9A 4M78D 1Q82R 3NTHA 2EKOA 4M78G 2QGGA 1PCXA 4OGCA 3CXCP 2JUFA 1S72A 1SG5A 2AHJB 2DYIA 4QQDA 3RMQA 2RO0A 3PGGA 3S3NA 2DZCA 3BFMA 3QSUA 1VQMT 1Q81C 3L2ZA 5CR2A 4E7SA 3EG9A 2DXUA 4OP0A 3TU4K 1YIJQ 3GNFB 4PJOB 2Y4XA 4JDSA 5IT9E 5KYXA 5LJ5d 5GANd 1JB0E 2XICA 5IHNA 4RTZA 4LDXA 3M56A 3JB9F 1HYOA 4PNOA 1O9SA 3QYHB 2X51A 1VIFA 3BW1A 2F2WA 2E3HA 8ATCB 3MEAA 4YTLA 1OZ3A 2ZPGB 4GBQA 3EGXA 3H0HA 3OY9A 1TU0B 2JS0A 3CMEQ 3EGDA 2AKLA 1VQOQ 1NBEB 2RMOA 2EVRA 1IO6A 1JXOA 2LNHB 1GBQA 2HSPA 1Q7YU 4A4EA 3GP8A 1JEGA 1UGRB 1JU5C 3CEYA 4L59A 2G3RA 4PFPA 1RAEB 1BI1A 1M9SA 4JZ4A 1UGQB 4JLIA 2DERA 2QXFA 4PJOA 2J6KA 2DE0X 5LJ3h 3LWHA 3A98A 4LN2A 1V1CA 3I55Q 4UC4A 3M4YA 2B86A 2VGNA 1O75A 3MEVA 2RI2A 2QI2A 1G5VA 1Q86R 2HMAA 1IZ6A 1WIEA 1VQKQ 2EGAA 2FPDA 3JCMV 3ASKA 3V7SA 4Y91A 4K11A 2XDBA 3CC4Q 1FXXA 4FT4A 2LTOA 1K8AU 2JJ9A 2V8IA 4CC4B 2JW4A 1C6VX 2KGTA 3REAB 2K7AA 3S3OA 4ESRA 2XG8D 3J7AF 2EYWA 3QPHA 4PLIA 1U06A 3TSWA 1PD0A 4LDYA 1YI2T 4CRIA 1AWJA 2H3JA 5GAN8 1NPPA 2P4RA 1E6HA 2O88A 2QG9B 3UATA 3H0FA 1G83A 1QKXA 2BUDA 5GJWB 5CKDA 3VUBA 1M90R 1TXQA 1YWOA 4LDVA 3R6OA 3A8HB 2KMTA 3CCQA 5KYWB 2NUPB 2XU8A 2EAYA 2NUTB 3SEMA 1G3SA 3QKJA 4FW1A 5CCAA 2JTMA 1I4K1 3HFNA 1UGPB 2CZ7B 4M75B 1YHQT 1RAGB 2ZPEB 2O4XB 1VQ4A 3M0RA 2P0QA 3OYYA 1RI0A 2DKGA 2RNAA 1M8MA 2KXCA 1OU9A 4FL6A 4DA4A 4QQGA 3ZL7C 5GAOn 4C92E 4J5YA 3KXTA 2CT4A 1BI3A 3M9QA 5AYFA 3L2VA 4OF1A 3C4SA 1ZBXA 1VQNA 2K6DA 5FW9A 2CT3A 4C5EA 2KSSA 2QDLA 2EGEA 3E9FA 2GGRA 1YP5A 3MEUA 2AIRB 2OAWA 1LPLA 1OQKA 2RA2A 1IHWA 3JB9G 1K73U 1NJIR 2A0FB 3QDRB 2A3LA 2EQIA 2CSQA 1M1FA 3BDLA 5KYWA 2FPFA 3OS5A 3EFSA 2NUPA 2F69A 1FMKA 3HRSA 1WGSA 2NUTA 3I56A 2EQUA 1YJ9T 2RHXA 1ZSGA 4C5GA 2ZPIB 3OYAA 1B34A 2QA4A 1TG0A 4M75A 4PJOD 2KDSA 5GANf 1UUEA 3MP6A 4NS5A 4PJOG 2LVMA 1QVFP 2O4XA 5GAMg 3QZ5B 1QWFA 2L5QA 4M7AE 1SF9A 2L0AA 3RKYA 2PVOB 5KH6A 5GAN2 2DL8A 2YSQA 1D09B 1U1SA 3VUZA 1IHVA 2K3YA 4KH0B 2L3SA 2VV5A 3LW5E 2X4JA 2YRVA 1D3BB 3CCQQ 1R0BG 1Q82C 3CC2T 1PRMC 4J9EA 3VV0A 2CREA 4RTTA 1RI9A 1X2QA 1A0NB 3F70A 2EQKA 2DL4A 1MV0B 1HSQA 4IUPA 3MEWA 3PMIA 4DBFA 4F7UB 3R6NA 5J3BA 4XTUA 3CCJA 1YNZA 3QWXX 4A4FA 2ECZA 2KRMA 3GLXA 1F1BB 4C8QF 2VXEA 3OMGA 4QQ6A 2DFUA 4OMOA 3UA7A 4M78C 1R8OB 2V8JA 2RHZA 2VASA 2M0YA 1Q81R 1NLOC 1KG1A 2OAUA 2DLPA 1TUCA 1IGQA 4E7ZA 3VS5A 2DX1A 2ROLA 3A8GB 5CKHA 1CSKA 3T9NA 2LZ6B 5LJ5j 2PVGB 1X01A 3G6EA 3L2RA 3PMTA 3NFCA 1ZUUA 4AT1B 5GANh 3G7ZA 4ZGDB 1HK9A 2DVEA 4BD3A 2RHYA 4F7UA 5LJ3d 1OPKA 2HNIA 3QIIA 5D6YA 2B8AA 1IGUA 4C5IA 5KYYA 1K9MC 1H3ZA 3JCMc 1WI7A 2DTOA 2DNUA 4J9IA 4M77F 1V29B 2OTJQ 3M57A 2EYYA 3TSZA 5D6XA 5KE3A 3I5SA 4X1VA 4IURA 4RUGA 3QJ6A 1Q86C 3BDUA 4PFZA 4MDXA 5I2MA 2KT8A 1ZUYA 1Y0MA 2RN8A 2X3XD 1LOJA 2O31A 3MCAB 1N8RU 4RCBA 2XDDA 1VQ8T 4X9DA 4ATOA 1VIEA 3CBPA 1N5ZA 4C92F 4AG1C 2DM1A 5C6SA 2ZCFB 1OYXA 2DD5A 4RG8A 1X6BA 1BKBA 4M75D 3J81E 3CMAT 3CCSA 1QKWA 1BU1A 3M59A 4M75G 4L6V5 2JM8A 1KQSS 2KK4A 3FJPA 3CD6A 1OX9A 1IRXA 2PU9B 4A4KA 3MP1A 5FLXE 1H3HA 5LL6S 1H8KA 2VVKA 1HD3A 1R77A 3MP8A 2XMFA 3VYHB 3RBBB 2LT4A 3M54A 4FT2A 1M90C 1VQ5T 3UWNA 2YLBA 4DBRA 4EMKC 1UB4A 3D7SB 1QVPA 1KQSA 4OB2B 1K76A 2CZ0B 3CCRQ 1KFZA 2X3WD 2DJZA 4NOYA 2CP5A 3CCMQ 4MZMA 1BB9A 1ZQ1A 1FMWA 3CBMA 4DBHA 4KUIA 4Z88A 1I81A 1TWBA 2LJ1A 5GAOm 1YJNQ 2EQJA 3M0TA 1NE8A 1NEGA 3M0SA 5CKBA 3X26B 2FO0A 3JCMg 4LE9A 1TUGB 2EGCA 4C5HA 1M2VB 3EFRA 4KH1B 3VS1A 1EFNA 3CCEQ 4B9XA 4ELZC 1LJOA 2E1HA 4C8QD 1PM3A 1QCFA 4C8QG 4DEYA 1NEBA 3G71T 1NJIC 4DQ2A 2BZXA 1ABQA 3SWNC 4J9FA 1Y7XA 4OVAA 3CPWP 3GOXA 1ZSZC 3UT1A 3PTAA 4RMOA 5GAMf 2RK2A 3CCSQ 3SB2A 1KD1C 1M3CA 3GPLA 2LX9A 2KI7A 2HCKA 3I9QA 2FZKB 3OS0A 2MOXA 2AKKA 1YITQ 4N4GA 4M7DF 5IAYA 2K4YA 1M2VA 5DY9A 1PWTA 4AFSC 3DB3A 2W10A 3OYJA 3M58A 2QTXA 2L3PA 4M77D 4E47A 3E19A 4RTXA 1QVGP 4M77G 3S3MA 2ROTA 3VS7A 5CKFA 1ZHIA 3QZ9B 4EMKA 4PJOC 3SWNB 2E65A 1ZSZB 1JJ2A 2CP3A 3EH2A 1QLYA 4FYVB 1AEYA 1ZBJA 4FYWB 5GMKh 1YITT 1FYNA 4F14A 2FPEA 1QP2A 4NL2A 2CDTA 2QEXT 1NM7A 4JJBA 2DF6A 3DLMA 1WHGA 2LP5A 3MJXA 3QUIA 5CK9A 4OMQA 3CC7Q 4V2SA 2KQWA 3HRUA 2ZPBB 1MNDA 3CCUT 3CCVA 1VQ6Q 2JTEA 5LJ5g 1U1TA 4PLLA 3JCMe 2WACA 1PHTA 2FVUA 2RQUA 2K5FA 5IXBA 1Y57A 1T3SA 1LNXA 2O9VA 2DTHA 2P84A 2LQKA 4FYXB 2FEIA 3PNWC 2RJCA 1C0MA 1OPLA 1W70A 4ZTJA 3UF4A 1G3YA 1Q82U 3A8OB 2BKDN 5GAMh 3OYCA 2FZCB 3SWNA 1ZSZA 3RNJA 3ULRB 3V8LA 1BK2A 2DETA 2DIGA 2MF2A 2ZPFB 2OTLQ 2EYQA 3H6ZA 2DILA 2CH4W 2NUZA 2BIVA 3MO8A 5D6WA 4DBQA 2H3EB 2GTOA 3GNGA 4KUDK 1WHJA 3J80E 2GTJA 3E2UA 1BIAA 1KQ2A 4J7FA 1YIJT 1YJWQ 1PSEA 1YHQA 5GAOl 2H8HA 2DJQA 2FHDA 3RESA 5FU7B 2K2MA 3G4SQ 3CXCA 2RD1A 5A2QE 1MNEA 5LJ3j 1RAIB 3LYIA 1K9MR 1VQLQ 1WPYA 2OTLT 1OI1A 3TCJA 2DYBA 3EAEA 1WA7A 3CMET 3P8DA 1X75C 3EG1A 1VQPQ 2KBTA 3UDCA 4BY6B 4D8DA 4Q5WA 1OX8A 1VQOT 2D1XA 3PT9A 4FYYB 2IG0A 2RI3A 4KGZB 2C06A 2JT4A 2XK0A 3JCMJ 2DL7A 4IUTA 1T0JA 4J9GA 4HCCA 3OYEA 2EJFA 1S72Q 1W6XA 1YJ9A 3JCMQ 2GFUA 3FEOA 1UFFA 4QVZA 1Q86U 2EPDA 1UE9A 5FU6C 5LJ5e 3I55T 2E10A 1MGQA 4R55A 4C0DC 3X20B 4M75C 3P8HA 3P8BB 1PSFA 4EDUA 4M7DD 5CO7A 2BE7D 4M7DG 3M0UA 2COZA 4DOWA 4AMCA 1Q95G 2KEAA 2DBKA 1VQKT 1V76A 2QQBA 1R0CB 1BIBA 4JZ3A 1WJQA 1S1NA 1KSWA 5EG2A 3GIBA 4Y92A 3CC4T 3CC2A 3VRYA 2HD0A 2V1QA 4F7UE 2LMJA 1I8FA 1I1JA 2V1RA 3PFSA 4JRKA 1RLQC 5CVIA 2QQAA 5L8RE 3JB9H 3RUXA 1K1ZA 1H92A 2R5MA 2DTIA 1AWWA 2I0NA 5FU6B 3FJ5A 3JCMb 1SHGA 1VYVA 5FRMA 2E3IA 1U5SA 1PRLC 4RTVA 4C0DB 9ATCB 1Z9QA 1UGVA 1H641 3ER0A 2LJ0A 2YHTA 1WHLA 2W0ZA 2XHCA 1HXDA 4J83A 2X9HA 1SRMA 1TH7A 2DXTA 2IPOB 2AK5A 3L2WA 2RJFA 3OQ5A 3URGA 1ZA1B 4N4IA 1UGSB 1XTDA 4ORZA 4C8QC 3JB9D 1QCOA 1PG5B 2G6FX 1K73R 4KRTA 1GXIE 4PFOA 4KBMB 1VA7A 2IIMA 1ACMB 2K3BA 2MWOA 5A0GA 4M78E 1T3LA 2EBPA 2RJDA 2RQRA 4PL6A 3BE3A 1KD1R 4IKFA 3I5RA 1NLPC 4MMLA 1FWZA 1VYUA 3EHQA 2XDPA 1NJIU 1SEMA 1VQ7A 3CCLA 2KRSA 5IXFA 1U3OA 2EYZA 2K3XA 1MMGA 4AG2C 2CYZB 2IVWA 2QYZA 3S6WA 2DEUA 3VS2A 5GJVB 1VYTA 2OI3A 3OYHA 1VQ8A 2DBMA 3M55A 4JS5A 5I2SA 3L2UA 2PQWA 4C8QB 4RTWA 3O5ZA 3RKXA 4M77C 3HTRA 2RF0A 3JRZA 2KYMA 1RACB 3OYFA 2VKNA 2F5TX 3CMAA 1PKTA 1BCOA 3CBOA 1VQ9A 1K0SA 1DJ7B 1ZLMA 2WSEE 2LX7A 3WXMB 2J6FA 1WLPB 4A4GA 1BYMA 1OV3A 5GAMd 1WDXA 3NTIA 1ZA2B 5I21A 1VQ4Q 1D1BA 1QP3A 4EPCA 4FU6A 3OS1A 2KRNA 1GL5A 2ATCB 1UHCA 4FCYA 2KYBA 4MZPA 2MI6A 4J9BA 3CCQT 1VQ5A 5FROA 1QVFA 1VQNQ 1KC8R 4BDZA 1RLPC 3EG0A 1YFNA 1E7OA 2KE9A 4BB7A 3HPWA 4C8QA 4M77B 2D6FA 1AWOA 4HA8A 5LJ3g 4BE0A 5J39A 1D3BA 2VC8A 2HEQA 2M1HA 3M0QA 2M0OA 5IHKA 3WVEB 5GANj 2KNBB 4ZNXA 1XQHA 3I56Q 2COYA 1X6OA 3SDZA 3HKSA 1Q81U 2EKHA 2DMOA 4EMHA 2QA4Q 2D8HA 1MMDA 3CCLQ 4XTVA 2NWMA 1VQ7Q 1YCYA 2DL5A 3X28B 2X35A 2PZ1A 4C92B 1B07A 1MHNA 2EW3A 5IHIA 1QMCA 1WJRA 2DAQA 1YCSB 4IUQA 5GAN4 1XNIA 4N0AC 3ME9A 2YRDA 3G71A 3LWIA 1CKAA 3OW2P 2A37A 1OZ2A 4HT9A 2MWPA 3I56T 4F16A 2AT1B 1TOVA 2HSEB 3LH0A 3SHWA 4M77A 4XU2A 2EFIA 1I5LA 2EIFA 1VQ9Q 1IREB 3QWYA 4FM4B 4J7IA 2A7YA 3CCJQ 2MPXC 2YUQA 1OULA 3VKIA 2OTJT 4E7HA 5DLQE 2GBQA 3JB9I 4ZTFA 5DLOA 2I2LA 6AT1B 5HKCA 4C92A 2RPNA 4LUEA 2O01E 1X69A 4GY5A 3RMSA 2MIOA 5GAN3 3SD4A 4M78F 2FRYA 2L8DA 1B7TA 1UEBA 4VUBA 2YT6A 2YDLA 3RDVA 2M9UA 3QDFA 4OMPA 3TEEA 3TREA 4PJLA 3CCJT 4QW2A 4RCCA 4M7AF 2R5AA 2XKOC 1W1FA 1UG1A 3NPFA 1PNJA 3G6EQ 4M7DC 5LJ3e 1BCMA 2ABLA 2E6ZA 1X27A 2RHIA 1W2BP 2QEXA 1N9RA 5I11A 3MKDA 2QK0A 3FB9A 3FRNA 1ZUKA 2ZZDA 4XK8E 5EC7A 3AHUA 3C0CA 2COWA 3AT1B 1RAHB 2DD4A 4X34A 4E7IA 4A63B 1VQMA 4PJOE 4JJNK 1N9SA 1M1GA 2HQHA 2SEMA 4XQ3A 2FB7A 2LQWA 4N0AA 4RTUA 1KQ1A 2QQRA 1ARKA 1J3TA 2HL3A 1RAAB
chains in the Genus database with same CATH topology
3OW2P 1KD1R 1KQSP 1Q81R 3CCLQ 1VQKQ 3CD6Q 1VQ4Q 1VQ7Q 1QVGP 3CCUQ 1YJNQ 1YIJQ 1M90R 3CMEQ 1QVFP 1K9MR 3CCQQ 1YITQ 1VQLQ 1N8RR 2OTLQ 1Q82R 1VQMQ 1K73R 1NJIR 1VQOQ 1M1KR 3CC7Q 3CMAQ 1VQ9Q 1YJ9Q 1S72Q 3CPWP 3G6EQ 3CCVQ 3CC4Q 1YHQQ 3CXCP 3I55Q 2QEXQ 2OTJQ 1YJWQ 1W2BP 1VQ6Q 1VQ5Q 3CCRQ 3I56Q 1VQPQ 1K8AR 3CCSQ 3CCEQ 3G71Q 3CCMQ 1VQNQ 1VQ8Q 1KC8R 3CC2Q 1Q7YR 3CCJQ 1Q86R 2QA4Q 1YI2Q 3G4SQ 1JJ2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 P;  1KD1 R;  1KQS P;  1Q81 R;  3CCL Q;  1VQK Q;  3CD6 Q;  1VQ4 Q;  1VQ7 Q;  1QVG P;  3CCU Q;  1YJN Q;  1YIJ Q;  1M90 R;  3CME Q;  1QVF P;  1K9M R;  3CCQ Q;  1YIT Q;  1VQL Q;  1N8R R;  2OTL Q;  1Q82 R;  1VQM Q;  1K73 R;  1NJI R;  1VQO Q;  1M1K R;  3CC7 Q;  3CMA Q;  1VQ9 Q;  1YJ9 Q;  1S72 Q;  3CPW P;  3G6E Q;  3CCV Q;  3CC4 Q;  1YHQ Q;  3CXC P;  3I55 Q;  2QEX Q;  2OTJ Q;  1YJW Q;  1W2B P;  1VQ6 Q;  1VQ5 Q;  3CCR Q;  3I56 Q;  1VQP Q;  1K8A R;  3CCS Q;  3CCE Q;  3G71 Q;  3CCM Q;  1VQN Q;  1VQ8 Q;  1KC8 R;  3CC2 Q;  1Q7Y R;  3CCJ Q;  1Q86 R;  2QA4 Q;  1YI2 Q;  3G4S Q;  1JJ2 P; 
#chains in the Genus database with same CATH topology
 1LCK A;  2J05 A;  2JMA A;  4BE2 A;  2FG0 A;  1FX7 A;  3CCR T;  3C12 A;  3CCM T;  3L1A A;  4E2F B;  2ED1 A;  1K73 C;  1M1K R;  3Q1J A;  4M7D B;  2HBP A;  1QQJ A;  2E4H A;  1YJN T;  3KBG A;  1SSH A;  3OYN A;  2VB6 A;  5I22 A;  1IXD A;  2CZ1 B;  2F5K A;  3QBY A;  3VYG A;  1N6A A;  2CSI A;  4JLG A;  1AHJ B;  2GCX A;  1D0X A;  1X6G A;  3X24 B;  3CD6 Q;  3JSC A;  1W2B A;  1JJ2 S;  3JCM d;  4XTZ A;  1AOJ A;  3CCE T;  3FC3 A;  4KGX B;  2BZ8 A;  5FRN A;  1YIJ A;  1Y71 A;  3I35 A;  2DZ9 A;  3OBY A;  3DLL A;  2NYS A;  3NMZ C;  1GRI A;  3CPW S;  1WYX A;  2E70 A;  4CC7 A;  4HVV A;  2F2X A;  4A53 A;  5KYN A;  2RJE A;  1AZE A;  4OB1 B;  3OYL A;  4GLM A;  2A08 A;  4KGV B;  3OB9 A;  4OMM A;  5GAO p;  3JCM P;  3RR6 A;  3CCS T;  1GCQ C;  2HZY A;  2JMC A;  2M02 A;  3V8K A;  2LCC A;  3CME A;  2VXF A;  5GMK j;  3V7C A;  4M7D A;  1CKB A;  2K2V A;  2D8J A;  3LGL A;  5GAN 5;  2CS7 A;  3CPW A;  2CP2 A;  3X25 B;  4LDW A;  4C92 D;  2GNC A;  3A8L B;  2J7I A;  3LX7 A;  4C92 G;  3LLR A;  1VQM Q;  5CKE A;  3OA6 A;  2RK1 A;  2DL3 A;  4PJN A;  4J8O A;  2QAS A;  3I55 A;  5GAN g;  3INZ A;  1KC8 C;  1YBY A;  2HBW A;  2DIQ A;  3MPU B;  3A5Z B;  2LQN A;  2C0T A;  3H41 A;  5FU7 C;  2PNI A;  3OSS C;  1YI2 A;  5GAM j;  4CC3 A;  1VQK A;  2VWF A;  2JVV A;  2RH2 A;  3M5A A;  2E12 A;  3QYG B;  5HK0 A;  4L5G A;  3CC4 A;  1QVG A;  4AFU C;  1UJY A;  3CXC S;  2V8K A;  4RTY A;  3CC7 T;  4X9C A;  4M7A D;  2O2O A;  4BY6 C;  1MUZ A;  4M7A G;  2KVQ G;  4LDU A;  1VQ6 T;  2JNG A;  2LCS A;  4JRP A;  2MCN A;  2CUB A;  4J6X A;  4LUD A;  2K5L A;  4M75 E;  2OJ2 A;  2A36 A;  1RAD B;  2R57 A;  4C0Z A;  2YUN A;  2VUB A;  3QHS A;  3DB4 A;  4J6Y A;  1RL2 A;  2K57 A;  4BI4 A;  4JJD A;  3U23 A;  1ZX6 A;  2XID A;  1WJS A;  5C0M A;  1Q7Y R;  2ZPH B;  4OML A;  3MHX A;  4TVR A;  4HKE A;  3CQT A;  1N8R C;  4ZN1 A;  1GCQ A;  2HKQ B;  4FSS A;  4KT0 E;  2QTV A;  2JXB A;  1WQ7 A;  4IIM A;  4PJO F;  1M30 A;  1OEB A;  2CKK A;  3PIO A;  2RI5 A;  1WFW A;  2GFA A;  2EJG A;  4BUG A;  2XD0 A;  4C0G A;  2LNV A;  4QT7 A;  4OB3 B;  3QXE B;  1YJW T;  2ZGW A;  3VRZ A;  3OSV A;  1K9M U;  4WF2 A;  1WXB A;  4AFQ C;  4F17 A;  3FDR A;  4HCB A;  3G4S T;  4LNP A;  3CCV Q;  4GLK A;  4O5V A;  2EQM A;  1K9A A;  1W4S A;  4HCZ A;  1K8A R;  1VQL T;  3OYK A;  3V8J A;  1SHF A;  1YI2 Q;  5GAN e;  2VYT A;  2VGM A;  1WX6 A;  1UDL A;  1VQP T;  2HQE A;  3V7R A;  3L42 A;  3MET A;  3H9N A;  2QQ9 A;  3LGF A;  4C8Q E;  1MMN A;  4PKC C;  4JJC A;  4ME7 A;  1G8X A;  4LD6 A;  1B3Q A;  2D0Q B;  2DXC A;  1PC0 A;  3CCV T;  3JCM f;  1S72 T;  2K5I A;  4EIK A;  3OYG A;  3JB9 J;  2J6O A;  1UEC A;  1KHI A;  1G3T A;  2WSC E;  4Z89 A;  4HCK A;  4N4H A;  1WXU A;  1YHQ Q;  2CP7 A;  4B9W A;  2YUP A;  2JOY A;  3H0I A;  3VS6 A;  4E7K A;  2KR3 A;  2MAM A;  1AWX A;  2L3R A;  1NYF A;  4OMN A;  1EIF A;  2KY9 A;  1M27 C;  1WHH A;  2FL7 A;  1M90 U;  2O9S A;  1SRL A;  2K79 A;  3CPF A;  7AT1 B;  1M1K C;  3QJY A;  4CI0 C;  4M77 E;  3OMC A;  1WNL A;  2GF7 A;  1JXM A;  3QO3 A;  2LCL A;  2L2P A;  2YLC A;  4XTY A;  2FRW A;  1NZ9 A;  3L2Q A;  1B34 B;  2CZ6 B;  2HQX A;  4B6M A;  4JS4 A;  2MK5 A;  2M51 A;  3HHT B;  2RQT A;  2HKN A;  3WVD B;  1UTI A;  1VUB A;  5D7U A;  2GQV A;  3A1P A;  3OBW A;  2P4T A;  5GAO q;  4JPB W;  1MMA A;  3TVT A;  1YJ9 Q;  2DVJ A;  1GFD A;  1TTH B;  4HXJ A;  2L3Q A;  2E5Q A;  3NHN A;  2HDA A;  1RAF B;  5J26 A;  1PD1 A;  2SRC A;  2YXY A;  5GMK i;  2LDM A;  2JTF A;  5CIU A;  3EG3 A;  1Y96 B;  1D0Y A;  4XU3 A;  4ANJ A;  3M4G A;  1XJW B;  5ECA A;  1TUD A;  1I5O B;  1HJD A;  1K0X A;  4M75 F;  1KHC A;  1D1C A;  3EHR A;  2QGF B;  1M4Z A;  2KT1 A;  3GF5 A;  1D1A A;  5M9O A;  2RQW A;  3TQ7 P;  3ZFJ A;  3O8V A;  3JCM h;  3BY7 A;  1XOV A;  3GBQ A;  3JV3 A;  4PK4 A;  4IUU A;  1BI2 A;  2E64 A;  3QG1 A;  5CAI A;  3CC2 Q;  3NGP A;  5FWB A;  4E7L A;  1KD1 U;  4AFZ C;  2YWW A;  2DA9 A;  4WCI A;  1K4U S;  3E1S A;  5LJ5 f;  3HP9 A;  1IB8 A;  4FIB A;  3PVL A;  1QVF S;  4FW2 A;  4J6W A;  3LH5 A;  4WTO B;  1SSF A;  4BAC A;  4R0K A;  1RUW A;  2OTJ A;  1GCP A;  1G2B A;  3PVQ A;  2LRQ A;  4QKU A;  1Y96 A;  4BE1 A;  1FMV A;  1BI0 A;  2BE9 B;  5GAN 6;  3DKM A;  4C92 C;  2D0N A;  1SKU B;  4PJM A;  1OOT A;  2LJ3 A;  2BTT A;  4M4Z A;  1QW1 A;  2LQ8 A;  2X4X A;  4BI3 A;  4J9D A;  2EJ9 A;  5KYY B;  2WSF E;  2PUO B;  4LD9 K;  3JCM W;  2NLU A;  2C0I A;  1AT1 B;  2E41 A;  4IIO A;  1VQ4 T;  2CH4 A;  2ZAE A;  1BBZ A;  1NPR A;  2QQS A;  2DEQ A;  2OX7 A;  1KC8 U;  4OMF B;  3REB B;  5GMK e;  1Q7Y C;  4II1 A;  3M0P A;  1AD5 A;  5GMK m;  1GFC A;  1GBR A;  4ZGJ B;  2QDY B;  1AVZ C;  2Y90 A;  5KCO A;  2JS2 A;  4F7U F;  3G1J A;  8AT1 B;  4LXC A;  4M7A C;  2CUD A;  5L23 A;  1X43 A;  5HY6 A;  1VQN T;  3ZBD A;  4MMK A;  2K9G A;  2PVD B;  2ED0 A;  1EX4 A;  4M7D E;  3A8M B;  1YN8 A;  5LJ5 h;  4P5N A;  3CCR A;  1VQ8 Q;  4XTX A;  3CCM A;  1KK7 A;  2FYK A;  1Z9Z A;  4E7J A;  2KRO A;  2HAX A;  5KE2 A;  3JAM E;  4EMG A;  1YJN A;  1N8R R;  2QA4 T;  2HL5 C;  3CMA Q;  5IN1 A;  5GAM e;  2ESW A;  4M78 B;  3CCL T;  1VQ7 T;  3EG2 A;  3KUF A;  4XAX B;  3UA6 A;  1K8A C;  2D9T A;  2MYS A;  2F1L A;  5GAN 7;  2R58 A;  3CCE A;  3UPU A;  1OU8 A;  4DOV A;  1KQS P;  4HVW A;  2RB6 A;  3OW2 S;  4M7A B;  2LC4 A;  1I0C A;  1NG2 A;  2XI9 A;  2DRK A;  2DXB A;  3VS0 A;  3OYI A;  4ZGE B;  4DEX A;  2A28 A;  2EYX A;  1VQ5 Q;  5DM7 R;  3HRT A;  3EGU A;  3VS3 A;  2DO3 A;  1YWP A;  4E6R A;  1SPK A;  5A0L A;  1VQ9 T;  1JO8 A;  2P0P A;  2E6N A;  1E6G A;  3OS2 A;  3VJP A;  4JUV A;  4MZT A;  1KJW A;  4Z02 A;  3C95 A;  4HVU A;  1YIT A;  4R56 A;  1RAB B;  4J9H A;  4MDW A;  3OW2 A;  4M78 A;  2PTK A;  5CQY A;  4CC2 A;  2Y4Y A;  1EZZ B;  3THK A;  1C1A A;  4Z8A A;  5A0D A;  1LVK A;  5CQX A;  2JM9 A;  3EFO B;  4RG2 A;  4M7A A;  3CCU A;  1G3W A;  1D0Z A;  2Z0W A;  2PUK B;  2YRC A;  3NTK A;  2P0K A;  4XU0 A;  3E9G A;  4BDY A;  1W2B S;  1NYG A;  2KXD A;  3G71 Q;  2AZV A;  2L89 A;  2M16 A;  3G6E T;  3FIF A;  2KAF A;  2MMP A;  1JBM A;  1KIK A;  4C0F A;  3IQL A;  1JQQ A;  3HFO A;  2X4Y A;  4Y28 E;  3RKW A;  4IUV A;  1JRI A;  1M3B A;  3CC7 A;  1UJ0 A;  1U8R A;  4ELY C;  1QWE A;  1T0H A;  2YUO A;  1VQ6 A;  1WHK A;  4QVD A;  1JJ2 P;  2BZY A;  5FWC A;  2FZG B;  3RER A;  4EMK B;  4OGE A;  3EFO A;  1M1K U;  3VU3 C;  2RHU A;  3JCM X;  2JN0 A;  5GMK l;  2LT1 A;  1I07 A;  2V26 A;  1X2K A;  2RQV A;  4NL3 A;  3OYD A;  2C0O A;  3OYB A;  4F7U G;  3OYM A;  3ZEH A;  3H8Z A;  2X4W A;  4FSX A;  4XU1 A;  4A54 A;  2OTL A;  4J9C A;  5IH2 A;  1M3A A;  5KYU B;  4XTW A;  4A4H A;  4D8K A;  2RM4 A;  1UHF A;  3M53 A;  3KFV A;  1N27 A;  4D6W A;  1TSF A;  1WQW A;  3CD6 T;  1VQO A;  4PJJ A;  2CP0 A;  2QEX Q;  1P92 A;  4O6J A;  1AZG B;  1YJW A;  4QVC A;  1M2O A;  2JZ2 A;  4ZN3 A;  2EWN A;  2CP6 A;  2GQI A;  2QAZ A;  3EG9 B;  2F2V A;  3FLG A;  3G4S A;  5GAO r;  3PIP A;  3VS4 A;  3CCU Q;  2E5K A;  1ABO A;  2ENM A;  4JRI A;  1QVG S;  1Y07 A;  5KYX B;  4KUL A;  4HT8 A;  5AT1 B;  1VOM A;  1VQL A;  3HL8 A;  1PKS A;  2DRM A;  2DPP B;  1M5Q 1;  3HSB A;  3PE0 A;  1MV3 A;  5HK3 A;  1WZO A;  4F04 B;  4OB0 B;  4BI8 B;  5LJ3 f;  2DK3 A;  1QCN A;  1VQP A;  5HCK A;  3N5B B;  2AZS A;  5KCH A;  2CGH A;  2J06 A;  4RKU E;  1WHM A;  3EGX B;  3SFM A;  1WXT A;  3EH1 A;  1M8V A;  3EGD B;  3C94 A;  5KYU A;  3RIR A;  4JRQ A;  1TS9 A;  4M78 D;  1Q82 R;  3NTH A;  2EKO A;  4M78 G;  2QGG A;  1PCX A;  4OGC A;  3CXC P;  2JUF A;  1S72 A;  1SG5 A;  2AHJ B;  2DYI A;  4QQD A;  3RMQ A;  2RO0 A;  3PGG A;  3S3N A;  2DZC A;  3BFM A;  3QSU A;  1VQM T;  1Q81 C;  3L2Z A;  5CR2 A;  4E7S A;  3EG9 A;  2DXU A;  4OP0 A;  3TU4 K;  1YIJ Q;  3GNF B;  4PJO B;  2Y4X A;  4JDS A;  5IT9 E;  5KYX A;  5LJ5 d;  5GAN d;  1JB0 E;  2XIC A;  5IHN A;  4RTZ A;  4LDX A;  3M56 A;  3JB9 F;  1HYO A;  4PNO A;  1O9S A;  3QYH B;  2X51 A;  1VIF A;  3BW1 A;  2F2W A;  2E3H A;  8ATC B;  3MEA A;  4YTL A;  1OZ3 A;  2ZPG B;  4GBQ A;  3EGX A;  3H0H A;  3OY9 A;  1TU0 B;  2JS0 A;  3CME Q;  3EGD A;  2AKL A;  1VQO Q;  1NBE B;  2RMO A;  2EVR A;  1IO6 A;  1JXO A;  2LNH B;  1GBQ A;  2HSP A;  1Q7Y U;  4A4E A;  3GP8 A;  1JEG A;  1UGR B;  1JU5 C;  3CEY A;  4L59 A;  2G3R A;  4PFP A;  1RAE B;  1BI1 A;  1M9S A;  4JZ4 A;  1UGQ B;  4JLI A;  2DER A;  2QXF A;  4PJO A;  2J6K A;  2DE0 X;  5LJ3 h;  3LWH A;  3A98 A;  4LN2 A;  1V1C A;  3I55 Q;  4UC4 A;  3M4Y A;  2B86 A;  2VGN A;  1O75 A;  3MEV A;  2RI2 A;  2QI2 A;  1G5V A;  1Q86 R;  2HMA A;  1IZ6 A;  1WIE A;  1VQK Q;  2EGA A;  2FPD A;  3JCM V;  3ASK A;  3V7S A;  4Y91 A;  4K11 A;  2XDB A;  3CC4 Q;  1FXX A;  4FT4 A;  2LTO A;  1K8A U;  2JJ9 A;  2V8I A;  4CC4 B;  2JW4 A;  1C6V X;  2KGT A;  3REA B;  2K7A A;  3S3O A;  4ESR A;  2XG8 D;  3J7A F;  2EYW A;  3QPH A;  4PLI A;  1U06 A;  3TSW A;  1PD0 A;  4LDY A;  1YI2 T;  4CRI A;  1AWJ A;  2H3J A;  5GAN 8;  1NPP A;  2P4R A;  1E6H A;  2O88 A;  2QG9 B;  3UAT A;  3H0F A;  1G83 A;  1QKX A;  2BUD A;  5GJW B;  5CKD A;  3VUB A;  1M90 R;  1TXQ A;  1YWO A;  4LDV A;  3R6O A;  3A8H B;  2KMT A;  3CCQ A;  5KYW B;  2NUP B;  2XU8 A;  2EAY A;  2NUT B;  3SEM A;  1G3S A;  3QKJ A;  4FW1 A;  5CCA A;  2JTM A;  1I4K 1;  3HFN A;  1UGP B;  2CZ7 B;  4M75 B;  1YHQ T;  1RAG B;  2ZPE B;  2O4X B;  1VQ4 A;  3M0R A;  2P0Q A;  3OYY A;  1RI0 A;  2DKG A;  2RNA A;  1M8M A;  2KXC A;  1OU9 A;  4FL6 A;  4DA4 A;  4QQG A;  3ZL7 C;  5GAO n;  4C92 E;  4J5Y A;  3KXT A;  2CT4 A;  1BI3 A;  3M9Q A;  5AYF A;  3L2V A;  4OF1 A;  3C4S A;  1ZBX A;  1VQN A;  2K6D A;  5FW9 A;  2CT3 A;  4C5E A;  2KSS A;  2QDL A;  2EGE A;  3E9F A;  2GGR A;  1YP5 A;  3MEU A;  2AIR B;  2OAW A;  1LPL A;  1OQK A;  2RA2 A;  1IHW A;  3JB9 G;  1K73 U;  1NJI R;  2A0F B;  3QDR B;  2A3L A;  2EQI A;  2CSQ A;  1M1F A;  3BDL A;  5KYW A;  2FPF A;  3OS5 A;  3EFS A;  2NUP A;  2F69 A;  1FMK A;  3HRS A;  1WGS A;  2NUT A;  3I56 A;  2EQU A;  1YJ9 T;  2RHX A;  1ZSG A;  4C5G A;  2ZPI B;  3OYA A;  1B34 A;  2QA4 A;  1TG0 A;  4M75 A;  4PJO D;  2KDS A;  5GAN f;  1UUE A;  3MP6 A;  4NS5 A;  4PJO G;  2LVM A;  1QVF P;  2O4X A;  5GAM g;  3QZ5 B;  1QWF A;  2L5Q A;  4M7A E;  1SF9 A;  2L0A A;  3RKY A;  2PVO B;  5KH6 A;  5GAN 2;  2DL8 A;  2YSQ A;  1D09 B;  1U1S A;  3VUZ A;  1IHV A;  2K3Y A;  4KH0 B;  2L3S A;  2VV5 A;  3LW5 E;  2X4J A;  2YRV A;  1D3B B;  3CCQ Q;  1R0B G;  1Q82 C;  3CC2 T;  1PRM C;  4J9E A;  3VV0 A;  2CRE A;  4RTT A;  1RI9 A;  1X2Q A;  1A0N B;  3F70 A;  2EQK A;  2DL4 A;  1MV0 B;  1HSQ A;  4IUP A;  3MEW A;  3PMI A;  4DBF A;  4F7U B;  3R6N A;  5J3B A;  4XTU A;  3CCJ A;  1YNZ A;  3QWX X;  4A4F A;  2ECZ A;  2KRM A;  3GLX A;  1F1B B;  4C8Q F;  2VXE A;  3OMG A;  4QQ6 A;  2DFU A;  4OMO A;  3UA7 A;  4M78 C;  1R8O B;  2V8J A;  2RHZ A;  2VAS A;  2M0Y A;  1Q81 R;  1NLO C;  1KG1 A;  2OAU A;  2DLP A;  1TUC A;  1IGQ A;  4E7Z A;  3VS5 A;  2DX1 A;  2ROL A;  3A8G B;  5CKH A;  1CSK A;  3T9N A;  2LZ6 B;  5LJ5 j;  2PVG B;  1X01 A;  3G6E A;  3L2R A;  3PMT A;  3NFC A;  1ZUU A;  4AT1 B;  5GAN h;  3G7Z A;  4ZGD B;  1HK9 A;  2DVE A;  4BD3 A;  2RHY A;  4F7U A;  5LJ3 d;  1OPK A;  2HNI A;  3QII A;  5D6Y A;  2B8A A;  1IGU A;  4C5I A;  5KYY A;  1K9M C;  1H3Z A;  3JCM c;  1WI7 A;  2DTO A;  2DNU A;  4J9I A;  4M77 F;  1V29 B;  2OTJ Q;  3M57 A;  2EYY A;  3TSZ A;  5D6X A;  5KE3 A;  3I5S A;  4X1V A;  4IUR A;  4RUG A;  3QJ6 A;  1Q86 C;  3BDU A;  4PFZ A;  4MDX A;  5I2M A;  2KT8 A;  1ZUY A;  1Y0M A;  2RN8 A;  2X3X D;  1LOJ A;  2O31 A;  3MCA B;  1N8R U;  4RCB A;  2XDD A;  1VQ8 T;  4X9D A;  4ATO A;  1VIE A;  3CBP A;  1N5Z A;  4C92 F;  4AG1 C;  2DM1 A;  5C6S A;  2ZCF B;  1OYX A;  2DD5 A;  4RG8 A;  1X6B A;  1BKB A;  4M75 D;  3J81 E;  3CMA T;  3CCS A;  1QKW A;  1BU1 A;  3M59 A;  4M75 G;  4L6V 5;  2JM8 A;  1KQS S;  2KK4 A;  3FJP A;  3CD6 A;  1OX9 A;  1IRX A;  2PU9 B;  4A4K A;  3MP1 A;  5FLX E;  1H3H A;  5LL6 S;  1H8K A;  2VVK A;  1HD3 A;  1R77 A;  3MP8 A;  2XMF A;  3VYH B;  3RBB B;  2LT4 A;  3M54 A;  4FT2 A;  1M90 C;  1VQ5 T;  3UWN A;  2YLB A;  4DBR A;  4EMK C;  1UB4 A;  3D7S B;  1QVP A;  1KQS A;  4OB2 B;  1K76 A;  2CZ0 B;  3CCR Q;  1KFZ A;  2X3W D;  2DJZ A;  4NOY A;  2CP5 A;  3CCM Q;  4MZM A;  1BB9 A;  1ZQ1 A;  1FMW A;  3CBM A;  4DBH A;  4KUI A;  4Z88 A;  1I81 A;  1TWB A;  2LJ1 A;  5GAO m;  1YJN Q;  2EQJ A;  3M0T A;  1NE8 A;  1NEG A;  3M0S A;  5CKB A;  3X26 B;  2FO0 A;  3JCM g;  4LE9 A;  1TUG B;  2EGC A;  4C5H A;  1M2V B;  3EFR A;  4KH1 B;  3VS1 A;  1EFN A;  3CCE Q;  4B9X A;  4ELZ C;  1LJO A;  2E1H A;  4C8Q D;  1PM3 A;  1QCF A;  4C8Q G;  4DEY A;  1NEB A;  3G71 T;  1NJI C;  4DQ2 A;  2BZX A;  1ABQ A;  3SWN C;  4J9F A;  1Y7X A;  4OVA A;  3CPW P;  3GOX A;  1ZSZ C;  3UT1 A;  3PTA A;  4RMO A;  5GAM f;  2RK2 A;  3CCS Q;  3SB2 A;  1KD1 C;  1M3C A;  3GPL A;  2LX9 A;  2KI7 A;  2HCK A;  3I9Q A;  2FZK B;  3OS0 A;  2MOX A;  2AKK A;  1YIT Q;  4N4G A;  4M7D F;  5IAY A;  2K4Y A;  1M2V A;  5DY9 A;  1PWT A;  4AFS C;  3DB3 A;  2W10 A;  3OYJ A;  3M58 A;  2QTX A;  2L3P A;  4M77 D;  4E47 A;  3E19 A;  4RTX A;  1QVG P;  4M77 G;  3S3M A;  2ROT A;  3VS7 A;  5CKF A;  1ZHI A;  3QZ9 B;  4EMK A;  4PJO C;  3SWN B;  2E65 A;  1ZSZ B;  1JJ2 A;  2CP3 A;  3EH2 A;  1QLY A;  4FYV B;  1AEY A;  1ZBJ A;  4FYW B;  5GMK h;  1YIT T;  1FYN A;  4F14 A;  2FPE A;  1QP2 A;  4NL2 A;  2CDT A;  2QEX T;  1NM7 A;  4JJB A;  2DF6 A;  3DLM A;  1WHG A;  2LP5 A;  3MJX A;  3QUI A;  5CK9 A;  4OMQ A;  3CC7 Q;  4V2S A;  2KQW A;  3HRU A;  2ZPB B;  1MND A;  3CCU T;  3CCV A;  1VQ6 Q;  2JTE A;  5LJ5 g;  1U1T A;  4PLL A;  3JCM e;  2WAC A;  1PHT A;  2FVU A;  2RQU A;  2K5F A;  5IXB A;  1Y57 A;  1T3S A;  1LNX A;  2O9V A;  2DTH A;  2P84 A;  2LQK A;  4FYX B;  2FEI A;  3PNW C;  2RJC A;  1C0M A;  1OPL A;  1W70 A;  4ZTJ A;  3UF4 A;  1G3Y A;  1Q82 U;  3A8O B;  2BKD N;  5GAM h;  3OYC A;  2FZC B;  3SWN A;  1ZSZ A;  3RNJ A;  3ULR B;  3V8L A;  1BK2 A;  2DET A;  2DIG A;  2MF2 A;  2ZPF B;  2OTL Q;  2EYQ A;  3H6Z A;  2DIL A;  2CH4 W;  2NUZ A;  2BIV A;  3MO8 A;  5D6W A;  4DBQ A;  2H3E B;  2GTO A;  3GNG A;  4KUD K;  1WHJ A;  3J80 E;  2GTJ A;  3E2U A;  1BIA A;  1KQ2 A;  4J7F A;  1YIJ T;  1YJW Q;  1PSE A;  1YHQ A;  5GAO l;  2H8H A;  2DJQ A;  2FHD A;  3RES A;  5FU7 B;  2K2M A;  3G4S Q;  3CXC A;  2RD1 A;  5A2Q E;  1MNE A;  5LJ3 j;  1RAI B;  3LYI A;  1K9M R;  1VQL Q;  1WPY A;  2OTL T;  1OI1 A;  3TCJ A;  2DYB A;  3EAE A;  1WA7 A;  3CME T;  3P8D A;  1X75 C;  3EG1 A;  1VQP Q;  2KBT A;  3UDC A;  4BY6 B;  4D8D A;  4Q5W A;  1OX8 A;  1VQO T;  2D1X A;  3PT9 A;  4FYY B;  2IG0 A;  2RI3 A;  4KGZ B;  2C06 A;  2JT4 A;  2XK0 A;  3JCM J;  2DL7 A;  4IUT A;  1T0J A;  4J9G A;  4HCC A;  3OYE A;  2EJF A;  1S72 Q;  1W6X A;  1YJ9 A;  3JCM Q;  2GFU A;  3FEO A;  1UFF A;  4QVZ A;  1Q86 U;  2EPD A;  1UE9 A;  5FU6 C;  5LJ5 e;  3I55 T;  2E10 A;  1MGQ A;  4R55 A;  4C0D C;  3X20 B;  4M75 C;  3P8H A;  3P8B B;  1PSF A;  4EDU A;  4M7D D;  5CO7 A;  2BE7 D;  4M7D G;  3M0U A;  2COZ A;  4DOW A;  4AMC A;  1Q95 G;  2KEA A;  2DBK A;  1VQK T;  1V76 A;  2QQB A;  1R0C B;  1BIB A;  4JZ3 A;  1WJQ A;  1S1N A;  1KSW A;  5EG2 A;  3GIB A;  4Y92 A;  3CC4 T;  3CC2 A;  3VRY A;  2HD0 A;  2V1Q A;  4F7U E;  2LMJ A;  1I8F A;  1I1J A;  2V1R A;  3PFS A;  4JRK A;  1RLQ C;  5CVI A;  2QQA A;  5L8R E;  3JB9 H;  3RUX A;  1K1Z A;  1H92 A;  2R5M A;  2DTI A;  1AWW A;  2I0N A;  5FU6 B;  3FJ5 A;  3JCM b;  1SHG A;  1VYV A;  5FRM A;  2E3I A;  1U5S A;  1PRL C;  4RTV A;  4C0D B;  9ATC B;  1Z9Q A;  1UGV A;  1H64 1;  3ER0 A;  2LJ0 A;  2YHT A;  1WHL A;  2W0Z A;  2XHC A;  1HXD A;  4J83 A;  2X9H A;  1SRM A;  1TH7 A;  2DXT A;  2IPO B;  2AK5 A;  3L2W A;  2RJF A;  3OQ5 A;  3URG A;  1ZA1 B;  4N4I A;  1UGS B;  1XTD A;  4ORZ A;  4C8Q C;  3JB9 D;  1QCO A;  1PG5 B;  2G6F X;  1K73 R;  4KRT A;  1GXI E;  4PFO A;  4KBM B;  1VA7 A;  2IIM A;  1ACM B;  2K3B A;  2MWO A;  5A0G A;  4M78 E;  1T3L A;  2EBP A;  2RJD A;  2RQR A;  4PL6 A;  3BE3 A;  1KD1 R;  4IKF A;  3I5R A;  1NLP C;  4MML A;  1FWZ A;  1VYU A;  3EHQ A;  2XDP A;  1NJI U;  1SEM A;  1VQ7 A;  3CCL A;  2KRS A;  5IXF A;  1U3O A;  2EYZ A;  2K3X A;  1MMG A;  4AG2 C;  2CYZ B;  2IVW A;  2QYZ A;  3S6W A;  2DEU A;  3VS2 A;  5GJV B;  1VYT A;  2OI3 A;  3OYH A;  1VQ8 A;  2DBM A;  3M55 A;  4JS5 A;  5I2S A;  3L2U A;  2PQW A;  4C8Q B;  4RTW A;  3O5Z A;  3RKX A;  4M77 C;  3HTR A;  2RF0 A;  3JRZ A;  2KYM A;  1RAC B;  3OYF A;  2VKN A;  2F5T X;  3CMA A;  1PKT A;  1BCO A;  3CBO A;  1VQ9 A;  1K0S A;  1DJ7 B;  1ZLM A;  2WSE E;  2LX7 A;  3WXM B;  2J6F A;  1WLP B;  4A4G A;  1BYM A;  1OV3 A;  5GAM d;  1WDX A;  3NTI A;  1ZA2 B;  5I21 A;  1VQ4 Q;  1D1B A;  1QP3 A;  4EPC A;  4FU6 A;  3OS1 A;  2KRN A;  1GL5 A;  2ATC B;  1UHC A;  4FCY A;  2KYB A;  4MZP A;  2MI6 A;  4J9B A;  3CCQ T;  1VQ5 A;  5FRO A;  1QVF A;  1VQN Q;  1KC8 R;  4BDZ A;  1RLP C;  3EG0 A;  1YFN A;  1E7O A;  2KE9 A;  4BB7 A;  3HPW A;  4C8Q A;  4M77 B;  2D6F A;  1AWO A;  4HA8 A;  5LJ3 g;  4BE0 A;  5J39 A;  1D3B A;  2VC8 A;  2HEQ A;  2M1H A;  3M0Q A;  2M0O A;  5IHK A;  3WVE B;  5GAN j;  2KNB B;  4ZNX A;  1XQH A;  3I56 Q;  2COY A;  1X6O A;  3SDZ A;  3HKS A;  1Q81 U;  2EKH A;  2DMO A;  4EMH A;  2QA4 Q;  2D8H A;  1MMD A;  3CCL Q;  4XTV A;  2NWM A;  1VQ7 Q;  1YCY A;  2DL5 A;  3X28 B;  2X35 A;  2PZ1 A;  4C92 B;  1B07 A;  1MHN A;  2EW3 A;  5IHI A;  1QMC A;  1WJR A;  2DAQ A;  1YCS B;  4IUQ A;  5GAN 4;  1XNI A;  4N0A C;  3ME9 A;  2YRD A;  3G71 A;  3LWI A;  1CKA A;  3OW2 P;  2A37 A;  1OZ2 A;  4HT9 A;  2MWP A;  3I56 T;  4F16 A;  2AT1 B;  1TOV A;  2HSE B;  3LH0 A;  3SHW A;  4M77 A;  4XU2 A;  2EFI A;  1I5L A;  2EIF A;  1VQ9 Q;  1IRE B;  3QWY A;  4FM4 B;  4J7I A;  2A7Y A;  3CCJ Q;  2MPX C;  2YUQ A;  1OUL A;  3VKI A;  2OTJ T;  4E7H A;  5DLQ E;  2GBQ A;  3JB9 I;  4ZTF A;  5DLO A;  2I2L A;  6AT1 B;  5HKC A;  4C92 A;  2RPN A;  4LUE A;  2O01 E;  1X69 A;  4GY5 A;  3RMS A;  2MIO A;  5GAN 3;  3SD4 A;  4M78 F;  2FRY A;  2L8D A;  1B7T A;  1UEB A;  4VUB A;  2YT6 A;  2YDL A;  3RDV A;  2M9U A;  3QDF A;  4OMP A;  3TEE A;  3TRE A;  4PJL A;  3CCJ T;  4QW2 A;  4RCC A;  4M7A F;  2R5A A;  2XKO C;  1W1F A;  1UG1 A;  3NPF A;  1PNJ A;  3G6E Q;  4M7D C;  5LJ3 e;  1BCM A;  2ABL A;  2E6Z A;  1X27 A;  2RHI A;  1W2B P;  2QEX A;  1N9R A;  5I11 A;  3MKD A;  2QK0 A;  3FB9 A;  3FRN A;  1ZUK A;  2ZZD A;  4XK8 E;  5EC7 A;  3AHU A;  3C0C A;  2COW A;  3AT1 B;  1RAH B;  2DD4 A;  4X34 A;  4E7I A;  4A63 B;  1VQM A;  4PJO E;  4JJN K;  1N9S A;  1M1G A;  2HQH A;  2SEM A;  4XQ3 A;  2FB7 A;  2LQW A;  4N0A A;  4RTU A;  1KQ1 A;  2QQR A;  1ARK A;  1J3T A;  2HL3 A;  1RAA B; 
#chains in the Genus database with same CATH homology
 3OW2 P;  1KD1 R;  1KQS P;  1Q81 R;  3CCL Q;  1VQK Q;  3CD6 Q;  1VQ4 Q;  1VQ7 Q;  1QVG P;  3CCU Q;  1YJN Q;  1YIJ Q;  1M90 R;  3CME Q;  1QVF P;  1K9M R;  3CCQ Q;  1YIT Q;  1VQL Q;  1N8R R;  2OTL Q;  1Q82 R;  1VQM Q;  1K73 R;  1NJI R;  1VQO Q;  1M1K R;  3CC7 Q;  3CMA Q;  1VQ9 Q;  1YJ9 Q;  1S72 Q;  3CPW P;  3G6E Q;  3CCV Q;  3CC4 Q;  1YHQ Q;  3CXC P;  3I55 Q;  2QEX Q;  2OTJ Q;  1YJW Q;  1W2B P;  1VQ6 Q;  1VQ5 Q;  3CCR Q;  3I56 Q;  1VQP Q;  1K8A R;  3CCS Q;  3CCE Q;  3G71 Q;  3CCM Q;  1VQN Q;  1VQ8 Q;  1KC8 R;  3CC2 Q;  1Q7Y R;  3CCJ Q;  1Q86 R;  2QA4 Q;  1YI2 Q;  3G4S Q;  1JJ2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...