1VQMQ

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqmQ00
1S72Q 1KD1R 1QVGP 3CCQQ 1KQSP 3CCRQ 1VQ7Q 1YI2Q 1Q7YR 1W2BP 1VQMQ 1VQ8Q 1K9MR 1Q81R 1VQ5Q 1NJIR 1VQLQ 3CC2Q 1YITQ 3CC7Q 3G6EQ 3CCVQ 1YHQQ 1VQ4Q 2QA4Q 1QVFP 3CC4Q 1YJNQ 1Q82R 2QEXQ 3CPWP 3CMAQ 2OTLQ 2OTJQ 3CXCP 1JJ2P 1VQ9Q 3CCEQ 3CCSQ 3I56Q 3CCMQ 3G71Q 3CCLQ 1YIJQ 1M90R 1VQOQ 1N8RR 1K8AR 1VQNQ 1VQKQ 3CCJQ 3CCUQ 1YJWQ 3CD6Q 3G4SQ 3I55Q 1KC8R 1Q86R 1VQ6Q 1K73R 1VQPQ 3CMEQ 1YJ9Q 3OW2P 1M1KR
chains in the Genus database with same CATH superfamily
3OQ5A 2KE9A 4D6WA 3AHUA 3JB9I 1YITQ 3OYAA 4OB2B 4MMLA 2HNIA 1YJ9T 4IUTA 2VB6A 3INZA 2X4JA 1I5OB 3X28B 3CC2T 4M7DB 2LQ8A 1T3LA 2ZZDA 2DYIA 5GAN8 3G71T 4FU6A 3QJ6A 3VUZA 1NEBA 2DZ9A 1SRMA 2DTIA 3EG9B 3LWIA 3EGXB 2RPNA 1IREB 5FWCA 3JRZA 2L5QA 2FL7A 1N8RU 1PKSA 1SPKA 1PM3A 4AFUC 2ED1A 3M59A 2DLPA 3IQLA 2YHTA 3THKA 4J9EA 2ECZA 1Q86U 1VIFA 4C8QE 2YDLA 2K6DA 3H6ZA 2CP5A 3M0SA 1NG2A 2VV5A 1FWZA 1OULA 3GIBA 3FJPA 2XDBA 1UGQB 3LX7A 2OAWA 3QDFA 3G7ZA 1JEGA 3RR6A 3JCMf 4KH0B 5LJ5g 1BCMA 1YIJT 2RNAA 3SHWA 1ZBJA 1BU1A 3M58A 3CCET 5LJ3j 5GMKh 3J80E 2QTXA 1U1SA 2MI6A 4OMOA 1JU5C 4Y92A 2QA4Q 1TTHB 1AWOA 3PT9A 4EMKA 5HK0A 1ABQA 3EFRA 1Y71A 1QQJA 3PFSA 2QGGA 2I2LA 1YCSB 1H3HA 4J8OA 2J6FA 5LJ5e 1N9RA 3PNWC 1UJYA 2R58A 2LC4A 3CXCA 2YSQA 5GAMh 3EG0A 2W0ZA 2O88A 1VOMA 1K4US 1E6GA 1ZSZA 2FPDA 4LDWA 2M1HA 3S6WA 4M78C 5LJ5j 1JO8A 2HBPA 1VUBA 2X51A 5LJ3g 1Q95G 5FWBA 2DE0X 3CCUQ 3DKMA 4J9FA 4A4HA 4JRIA 1RACB 5KCOA 5HK3A 2HKQB 1Q7YC 1E7OA 3OYYA 1PRMC 1GCQC 1VQKA 5LJ3f 1V76A 4JLGA 4ZGDB 1GXIE 2FZGB 1M4ZA 4WF2A 4OMLA 2ABLA 3CC4Q 2CZ0B 2DL4A 3VYGA 3JCMQ 1CKAA 3PIPA 1XQHA 2RQTA 4XTXA 3QZ5B 4ATOA 4XTUA 2K3YA 4JLIA 3OS5A 1QVFS 3QWXX 5L23A 2CUDA 4OMFB 2LVMA 1RL2A 2OTJT 3R6OA 1OZ3A 1H3ZA 3HPWA 4IUPA 2PU9B 4FYWB 2RHYA 3CCSA 4EPCA 4E7SA 4BACA 2O4XB 3SD4A 1WHLA 5GANd 4PNOA 1YJWQ 3UDCA 4Q5WA 4J9DA 2ZAEA 2A36A 2YRCA 2LX7A 2XMFA 1I5LA 1RABB 1BCOA 2ZPGB 2KY9A 1TUGB 4E7ZA 3HFOA 1BB9A 4LXCA 3A1PA 5L8RE 2DBKA 3OW2S 1Y96A 4F7UA 1EFNA 4M75C 1NZ9A 2E65A 2EPDA 5D6YA 3M0PA 2QQSA 1VYVA 2M0YA 4M7AD 2MMPA 2AKLA 2Y4YA 3I9QA 3SFMA 1UG1A 2RI3A 3ASKA 4M77C 4RTTA 5GAMg 1PWTA 2KMTA 1FX7A 4O6JA 4C0ZA 1OU9A 3RMQA 1JB0E 3CCUA 2VYTA 2QXFA 1ZA2B 3QBYA 1KK7A 1KJWA 2DM1A 4F14A 1D3BB 4N0AC 1NE8A 3QHSA 1VQOT 4AFQC 2EJFA 2OTLA 2RQVA 1UGRB 1ZSZC 4RTXA 2HL3A 1TOVA 3VUBA 1K0XA 3EG3A 1YITA 2YWWA 2RJDA 2JT4A 3F70A 1O75A 2R5MA 4OGCA 4OVAA 4FM4B 3TSZA 5C6SA 4PJOD 1WHHA 1AWWA 4FYVB 3E1SA 3JCMb 2CREA 1Q81U 4M7DD 1G83A 2QYZA 2GNCA 1YHQQ 2BE7D 4MMKA 5FLXE 4BDYA 4C92C 3V7CA 2OTJQ 2EBPA 1YIJQ 2DJQA 4BB7A 4M7DE 3FIFA 1YI2T 2WSFE 1PCXA 4F16A 1XTDA 2HQHA 5A0LA 3SB2A 3U23A 4C8QF 2X3WD 2R57A 1Q82C 4C0DB 4LD9K 1GFDA 2Y4XA 1YJNT 2KYMA 3JCMd 3G6ET 2YUPA 4PJLA 5KE2A 2JJ9A 1YWPA 4M75F 4FYYB 4HVUA 4HCCA 5GAN7 4FCYA 3CMAA 3CMEQ 1Y07A 2KR3A 3N5BB 4M7DG 5DLOA 1QVGP 3VS2A 3JV3A 1M27C 4PJMA 4BI4A 3PIOA 5IAYA 3UA7A 2MAMA 1WDXA 4F7UB 5GAOq 1TU0B 1V1CA 1AVZC 4C0DC 3G71Q 2W10A 2K5IA 1WJRA 1NPRA 4N4GA 2KXDA 2EYYA 1VIEA 2ROTA 2FRWA 2QASA 1FXXA 2NLUA 4MZMA 4NS5A 3A8OB 3JCMX 5CKHA 4HXJA 2X4WA 2KRMA 1G8XA 1GBRA 3EG9A 1ZLMA 3I5SA 2SRCA 5IXFA 3QO3A 4J9IA 5CAIA 2VC8A 3OMCA 5GAN2 4VUBA 2ED0A 1Q7YR 3C4SA 1VQ5Q 4CC3A 5FRNA 2DBMA 2L3SA 2JTFA 1WHMA 3HL8A 3V8KA 3VS7A 1QKXA 1JJ2P 1R0BG 4OP0A 3P8HA 1WQ7A 1I0CA 5FW9A 1K8AU 4QW2A 2XK0A 2EYXA 1OX9A 1WLPB 1F1BB 4FT2A 2A7YA 3CBMA 3A8MB 3MP1A 2MK5A 4PLIA 1T0HA 2FVUA 1RAGB 1PC0A 3JCMJ 1XNIA 2QGFB 2IIMA 3L2WA 2IPOB 2CDTA 1FMKA 2KROA 4M4ZA 3S3MA 2CS7A 2KBTA 3CMAT 3CXCP 3MEWA 4XTZA 1D1CA 2HDAA 2E4HA 1M3BA 1K8AR 2NYSA 5GAMf 2KXCA 1M9SA 4TVRA 3I55Q 1GFCA 2ENMA 2OJ2A 2DAQA 2EGEA 2E5QA 2VGNA 1GBQA 1JXOA 5KH6A 2CSQA 3L1AA 3HKSA 2D8HA 4J9BA 4EDUA 5EC7A 2K2MA 3LWHA 1QVPA 4XU2A 3CCVQ 1D09B 1WHKA 3GF5A 2RO0A 2V26A 2QEXQ 4PFPA 5IHIA 3I56Q 2D0QB 3DB3A 2PTKA 3T9NA 4Y91A 3KXTA 4E7LA 3JCMg 3SWNA 2AHJB 2HEQA 2NUPB 1RLPC 2L8DA 1H8KA 3OYKA 1YWOA 1QVGA 2QG9B 2CKKA 4E6RA 2V8JA 3VU3C 4NL3A 2COWA 3C12A 1KIKA 3CCSQ 1M90R 1CKBA 3RKXA 2DFUA 4F7UF 3JB9H 3O8VA 2K3XA 3X20B 3A8HB 4DQ2A 1RUWA 5I22A 1D1BA 4A63B 5KYXB 3CC7Q 3VS1A 2ZPEB 1BI0A 5DM7R 2X9HA 2BE9B 1B7TA 3VS6A 2HAXA 1VQ6Q 4JRPA 2DF6A 1VQPQ 4PJOB 2P0QA 3HRSA 4BY6B 3P8DA 3TQ7P 4FT4A 1XJWB 4LUEA 1YJ9A 2M9UA 2COYA 5GAOm 2FPEA 2JZ2A 3VS3A 3H9NA 1K1ZA 2JN0A 2RA2A 3BDUA 1KQ2A 2HQXA 1T0JA 3CC7T 3CCJT 4OB3B 3HRUA 2ZPIB 4M7DF 4N0AA 1UDLA 3I35A 4PFOA 1OYXA 2RH2A 2L89A 2EQMA 3D7SB 3ER0A 1OOTA 4NL2A 3KBGA 1UHCA 4C8QA 1QCNA 2D1XA 3OYEA 1X2KA 2DRMA 3URGA 3JB9G 2LCCA 2JS0A 1D0XA 1FMWA 5HKCA 2F2XA 4RCCA 5CQYA 3BDLA 2R5AA 3EG2A 3GOXA 2LT4A 1S72Q 4M75E 2DX1A 2AZVA 1WXTA 3M0RA 4XU3A 2D6FA 3FJ5A 2DTOA 2X4XA 2VASA 1S72T 3OS0A 1S1NA 2DVEA 4KH1B 3M4GA 3NGPA 4FSXA 2LRQA 1B3QA 1B34A 4EMGA 1PNJA 5FU6B 1N8RC 4CI0C 3CCMA 2KT8A 5FU7C 1N27A 4M7AC 4ZGEB 2AT1B 2O01E 3WVDB 3NTIA 2PVGB 2OTLT 3E19A 2PQWA 4M7AE 1C6VX 1X6OA 4GY5A 5GAOr 4ME7A 3VS4A 3I55A 3TU4K 3LGLA 1VQMT 4QQDA 2J7IA 2A28A 2CH4A 3JCMc 4F04B 4DOVA 4E47A 5FU6C 1KQ1A 5KYYB 4BDZA 4HT8A 2J6OA 2PVOB 1VQ8Q 1K9MR 1Y96B 2QA4A 1VQ4T 1SHFA 5GAMd 3JCMW 3G6EQ 4C5EA 3DLMA 1SRLA 1HYOA 4FL6A 4QVCA 1GCQA 2XI9A 4M75D 5LJ3d 2G6FX 2KAFA 1VQKT 2CP0A 1U3OA 2YLBA 1VQPT 3EHQA 2MF2A 5GAN5 1W2BS 3I55T 2QAZA 1YNZA 3OSVA 3EFOA 3KFVA 1VQMA 1C1AA 3V8JA 5EG2A 3RIRA 1TUDA 1K9MU 1U06A 4M77B 2DL8A 4HVWA 3M5AA 3M56A 5GJWB 1AWXA 3EFSA 3MP8A 4V2SA 2F69A 2YLCA 3WVEB 2XHCA 2HZYA 4KULA 3G6EA 3CCQQ 2DXUA 1KG1A 2WACA 1VQ8T 3RKWA 2PVDB 3REAB 5A2QE 1NM7A 3OW2A 1UECA 2LQKA 4JS4A 4BE2A 1Q82U 1VQNT 1KHCA 2V8KA 4KBMB 2EJ9A 1D0ZA 3H0HA 1AWJA 1YHQA 4DBHA 4RG8A 3L2QA 1QVGS 1WQWA 2J05A 2HSPA 1VQLT 2CGHA 5DLQE 1I81A 5CKEA 3I56T 2COZA 3NTHA 2E6ZA 1ZSZB 2F5KA 3NPFA 4DA4A 4LDXA 1BI1A 1WI7A 2BZYA 2E70A 3ULRB 4LN2A 5AT1B 1PSEA 3RERA 3RESA 2DXTA 5IN1A 2LQWA 4RMOA 4E7KA 5IHNA 4XK8E 3OBYA 1U8RA 3CCLT 4C5IA 4LUDA 2ZGWA 2EWNA 4F7UE 4II1A 1U5SA 1WXBA 5KYWA 3CCUT 2EFIA 4IUUA 5A0GA 4NOYA 3OMGA 1OEBA 2A3LA 2NUTB 3RKYA 2EAYA 1LOJA 1X01A 2LNVA 5DY9A 5GAOl 2XD0A 1M30A 1RADB 2V1RA 5IHKA 1M90C 1PD1A 1GCPA 3CCJA 1GRIA 2CT3A 3MKDA 1VQ4Q 3V7RA 3VYHB 1B34B 1X6BA 5IH2A 4PKCC 2RHZA 4F7UG 3E9FA 3M9QA 1ZA1B 3PMIA 1VQ6T 2KYBA 2QK0A 3BFMA 2RM4A 2RQUA 3RNJA 5GANj 2JMCA 4BY6C 1G3TA 1JJ2A 1PHTA 5CIUA 1JQQA 1K8AC 1IO6A 1EZZB 2QQAA 2EYWA 2YRDA 1AD5A 2LCSA 2JTEA 4JJDA 1OPKA 1R8OB 3VRZA 3TVTA 4QKUA 3EGDA 2CZ7B 2K9GA 1A0NB 4DBRA 5ECAA 3X25B 4Z88A 4M78D 4M7AG 2CUBA 1M1KR 4Z89A 1OQKA 5KYUB 4LNPA 1YJNA 1H641 2CP7A 3GPLA 2CP2A 3CCRA 2QQBA 1I1JA 1VA7A 2FB7A 5GANg 5KYUA 2KQWA 1G3SA 1KFZA 2JMAA 1G2BA 1QCOA 2RK2A 1RAFB 1UE9A 1IRXA 2PUKB 1Y0MA 4OB0B 1VQ9T 3M4YA 1JRIA 2RJEA 4N4HA 3QSUA 3MEAA 2BUDA 4M78F 1AOJA 2LT1A 4RTZA 1KD1U 1PKTA 1OX8A 2LCLA 4CC4B 3CPWP 2JS2A 3OS2A 4AMCA 1GL5A 3GNFB 2DIQA 4EMKC 2HMAA 2VWFA 2Z0WA 2K79A 2IG0A 4M7AF 1HXDA 1HJDA 3FLGA 4JZ3A 4HKEA 1NJIU 1X75C 1UEBA 2JUFA 4FIBA 4HT9A 1QWFA 2RN8A 2LZ6B 3NHNA 3META 3C0CA 1SSFA 3V7SA 4GLMA 5KCHA 3CXCS 2A08A 2AKKA 1EIFA 1OI1A 4ANJA 2DXBA 2RQWA 2F1LA 3CCVA 2EW3A 4M75B 1Q86C 5KYXA 1TS9A 1WPYA 2QDLA 2B86A 3QXEB 4Y28E 1ZHIA 3RDVA 4J9HA 4KT0E 1SF9A 1R77A 3UA6A 4M7DA 1DJ7B 2DTHA 2JOYA 1O9SA 3CD6A 1VQOQ 4M77D 3CQTA 4X1VA 4DBFA 1K73R 4RTUA 4A4EA 4AT1B 3OYDA 3JSCA 2IVWA 3FEOA 3RUXA 4ELZC 2AK5A 4JZ4A 3CCVT 5GAN6 2NUPA 2DL7A 3TCJA 4IUVA 1D0YA 4RTYA 2K2VA 1VQ7T 1Y7XA 2LDMA 2NUZA 3EGDB 4J7FA 1I4K1 2L3PA 4OMQA 4JJBA 1FYNA 4JPBW 1VQ5A 2VUBA 3DLLA 4JRKA 4DEYA 5A0DA 4AG1C 3NTKA 3CCRQ 2EIFA 4DOWA 1UB4A 1RAEB 4M78A 2E3IA 1IHWA 2DKGA 1U1TA 1TSFA 4FW2A 1YP5A 1NYFA 2QQRA 1ZUYA 4OB1B 4PJOF 2HCKA 2E3HA 2CSIA 3CBOA 4M7AA 2E41A 5CQXA 1TH7A 4OF1A 4WTOB 2OX7A 2K57A 2DEQA 4IUQA 4EMKB 1RI9A 4JJCA 2KRNA 3P8BB 3MEVA 1AT1B 4HCZA 2LQNA 1N6AA 1NLOC 5CK9A 1UGVA 4ESRA 1YIJA 3X26B 4E7JA 1YN8A 4LE9A 6AT1B 2EJGA 3CCQA 1G3WA 1IHVA 4M77E 1I07A 2LX9A 1VQ4A 3QYGB 3QZ9B 1RI0A 4FW1A 1H92A 4LDYA 4XQ3A 3C94A 4IKFA 2LNHB 4LDUA 3L42A 4C92F 4M75A 5GAN3 4J9CA 3BY7A 3CD6T 3OSSC 2VGMA 1IXDA 3FRNA 1AHJB 1JXMA 3G1JA 4OMMA 3TREA 2O9SA 4ELYC 3AT1B 1N8RR 1OZ2A 2JXBA 2MWPA 2ESWA 3VS5A 2ZPHB 4DEXA 1YITT 4XTVA 3UPUA 2RHXA 1E6HA 2HQEA 4R0KA 4M77G 1KQSA 2KSSA 3M54A 2PUOB 3PGGA 1QMCA 3H8ZA 4A4FA 1B07A 3V8LA 5GANf 3M55A 4E7IA 1NPPA 1X2QA 1PD0A 1X43A 3JCMP 2EVRA 3M0TA 3CCEA 4MZPA 5LJ5h 4QVZA 2JW4A 2C0TA 3EH1A 3FDRA 1UGPB 3TSWA 3OBWA 4KGVB 3M0UA 2DETA 1UGSB 4M78B 2L3RA 2FZCB 1NEGA 3I5RA 3CC2Q 4PJJA 4C5HA 4A4KA 1MNDA 5GMKi 1SEMA 1I8FA 1KC8U 2RHIA 1Z9QA 4PJNA 4J5YA 1MMNA 1W4SA 2P0PA 4F17A 1AEYA 1C0MA 1Q81C 4EIKA 3EFOB 3MJXA 1QW1A 5CKBA 2RF0A 2XDPA 2DK3A 3RBBB 2GTJA 5KE3A 3VJPA 2JNGA 3GBQA 4M78E 1TWBA 3R6NA 3A98A 1KC8C 5LJ3h 3GP8A 3E2UA 3OY9A 1QKWA 3OYMA 2RD1A 3MPUB 1NLPC 2RMOA 4A4GA 1K76A 1N5ZA 2K3BA 1WHGA 4ZN3A 4J83A 3JB9D 2E5KA 3LH0A 1QVFP 2BIVA 3CC4A 1BI2A 2DRKA 1SKUB 4AFZC 2PZ1A 2YUQA 5GAMj 3JAME 3G4SA 3LH5A 4KRTA 3EHRA 2P4RA 3UF4A 3RMSA 2V8IA 3QJYA 3M53A 4DBQA 3CEYA 2DERA 2DXCA 2CZ1B 3HHTB 2JM9A 3QKJA 4WCIA 1R0CB 5CVIA 3QUIA 1LPLA 3BE3A 4JS5A 2HKNA 1ZQ1A 4XTWA 1BI3A 1HSQA 4YTLA 3TEEA 4OGEA 3FC3A 4CC7A 4C8QG 1M90U 1VQPA 1MMGA 1UUEA 1KD1C 1X6GA 2RHUA 3NFCA 2XDDA 4GLKA 4BE1A 1XOVA 2EYZA 5FRMA 3HRTA 2ZPBB 3MEUA 4QQGA 4RTVA 3CC7A 3QPHA 2BKDN 2LJ1A 3EGXA 3PTAA 1M8MA 1QP3A 1ZUUA 4O5VA 4PFZA 2FHDA 5D6WA 4C8QB 2QQ9A 3MO8A 4IIOA 5HCKA 1D1AA 1J3TA 3ME9A 4XTYA 4HA8A 1RAHB 5J39A 2BZ8A 2F2VA 2KI7A 1BIBA 4B9XA 2KVQG 4M75G 1M1FA 2I0NA 2L2PA 3OYIA 2SEMA 1M1KU 4PJOE 2YUNA 2EQKA 1W1FA 5GMKj 4BD3A 3PMTA 3Q1JA 3OW2P 1BK2A 1HD3A 1WIEA 3CC4T 2DZCA 1TUCA 1IGUA 5FROA 3EG1A 1MV0B 2J6KA 5CKDA 5FU7B 3CCMQ 2EQUA 4OMNA 3A8LB 5D7UA 1WZOA 1M1KC 1YBYA 4BUGA 4M77F 5CKFA 2WSEE 4RUGA 2F5TX 2DEUA 3VS0A 4ZGJB 2LJ3A 3JB9J 4M7DC 1VQ7Q 2X4YA 2D0NA 1X69A 3REBB 3L2RA 4C92A 2Y90A 4C92E 3SWNC 3G71A 3QIIA 5GAOn 3OB9A 2F2WA 2OTLQ 2D8JA 5GANh 3JCMe 2CP3A 2MWOA 3CBPA 2DVJA 2NWMA 4UC4A 2RB6A 2BZXA 1RAIB 4LDVA 2DYBA 2FRYA 4L59A 1VQMQ 3SWNB 2E10A 2O9VA 2GBQA 1K73C 3JB9F 2CT4A 2O2OA 2ATCB 4AG2C 1W2BA 2FZKB 2X3XD 2LTOA 1N9SA 5GANe 1MMAA 4C0GA 1Y57A 4M78G 4ZTJA 4C5GA 1JBMA 1VQ7A 3QYHB 4HCBA 4C92D 1BKBA 2VKNA 4BE0A 2ROLA 4EMHA 3SEMA 8ATCB 4N4IA 4E2FB 2GQVA 3A8GB 4XAXB 4IURA 3M0QA 3QDRB 2G3RA 2GFUA 4J6WA 1EX4A 2FEIA 4CRIA 1ARKA 1PRLC 2O31A 3FB9A 3G4SQ 1SHGA 2O4XA 5I2SA 2QEXA 1VQ8A 2JM8A 5LJ3e 3CPWA 3CPFA 2MPXC 1PSFA 3A5ZB 3ZBDA 1K73U 2VXFA 1W70A 1NJIC 2DO3A 4J6YA 2XIDA 4JRQA 4HVVA 1AZEA 2RI5A 1WX6A 3CCQT 3NMZC 3EH2A 2GGRA 4XU1A 4ZNXA 4L6V5 4FSSA 1WGSA 3BW1A 4M77A 3EGUA 4KUIA 1TG0A 2DD4A 3G4ST 1NJIR 2EGAA 3HTRA 3OYGA 4PJOA 3CPWS 1M3AA 2X35A 2EKHA 4FYXB 8AT1B 2FYKA 3CCLQ 2ZCFB 4X34A 2DA9A 1VYTA 1G5VA 4E7HA 1AZGB 2C06A 3PE0A 2AZSA 3OYCA 1BIAA 2EQJA 4R56A 4KUDK 3KUFA 2GFAA 1OV3A 2E12A 1YI2A 2MOXA 2VXEA 3CC2A 5IXBA 5GAN4 2E1HA 1QVFA 4ORZA 2OI3A 2CP6A 2LJ0A 1Q86R 2M16A 2HL5C 1K0SA 2DPPB 1LNXA 2HD0A 4PJOG 5D6XA 3PVLA 1HK9A 2CZ6B 4L5GA 2QEXT 1WJSA 3C95A 4B6MA 3EAEA 3JCMh 3J7AF 1UTIA 2RJCA 1WJQA 2D9TA 5CR2A 2P0KA 1WA7A 2YT6A 1YJ9Q 4C8QD 4Z02A 5LJ5f 5M9OA 2AIRB 4QVDA 9ATCB 1WYXA 1YCYA 5CCAA 2FO0A 5I21A 3MP6A 5LL6S 3ZL7C 1CSKA 4C92G 2KNBB 1VQKQ 1T3SA 4RTWA 2XG8D 2P4TA 2V1QA 2DJZA 3OYFA 2K7AA 1FMVA 1ZSGA 2CH4W 5GAOp 2E6NA 1RAAB 3LW5E 1VQOA 4JUVA 4PLLA 1YJNQ 2VVKA 5GAMe 2XU8A 4KGXB 3DB4A 1TXQA 1Q7YU 4XU0A 1IZ6A 2ZPFB 3OS1A 1V29B 5AYFA 4C8QC 2DIGA 2YXYA 2HBWA 1S72A 4BI3A 1QLYA 1WNLA 1Q82R 1ABOA 1IB8A 2E64A 1KQSP 1YI2Q 1ZX6A 1KSWA 3E9GA 3CCMT 1MGQA 1X27A 2K5LA 5GMKm 2EKOA 2KT1A 4K11A 2LP5A 3UT1A 4MDWA 4B9WA 3L2VA 2L0AA 1MUZA 2GQIA 1KQSS 4GBQA 2P84A 3L2UA 2EYQA 1UJ0A 2XKOC 1VQNA 4OMPA 1MNEA 3VV0A 2MYSA 2RI2A 2GTOA 1VQNQ 2C0OA 2KRSA 1SSHA 7AT1B 1VQLA 3X24B 3L2ZA 4BI8B 1M2VA 3JCMV 1K9AA 2BTTA 3I56A 4C92B 1UHFA 4QQ6A 1MHNA 2DL5A 2K5FA 3QG1A 3OA6A 1YJWT 2QI2A 3HFNA 1M2VB 2XICA 5LJ5d 4LD6A 1VQ9Q 1JJ2S 1SG5A 2WSCE 4RKUE 3J81E 1KHIA 3S3NA 1LVKA 1OU8A 4CC2A 4P5NA 3CCEQ 2H8HA 1MV3A 5KYWB 3CMET 4RCBA 1UFFA 3WXMB 2RK1A 4IIMA 4QT7A 4PK4A 2HSEB 1K9MC 5HY6A 1YJWA 2PNIA 2LMJA 1NBEB 4Z8AA 5GMKl 2QDYB 2DNUA 3ZFJA 4PL6A 1IGQA 3UWNA 1VQ6A 2A0FB 3O5ZA 3MCAB 3OYBA 3CMAQ 1M2OA 2DMOA 3CMEA 5IT9E 3ZEHA 3H0FA 3LLRA 3CCJQ 2K4YA 4X9DA 3MHXA 3VRYA 1QP2A 2JVVA 4MZTA 1M1GA 2MCNA 4J6XA 3SDZA 3S3OA 4C0FA 4R55A 1LJOA 2KDSA 1PG5B 2M51A 2C0IA 2L3QA 2DILA 2KGTA 3CCLA 3UATA 3H41A 4JDSA 4ZTFA 3OYLA 2CYZB 2OAUA 2YRVA 5I2MA 1YFNA 3CD6Q 1KC8R 1OPLA 4X9CA 4A53A 3CCRT 1ZBXA 5I11A 4RG2A 1P92A 3OYNA 3VKIA 3H0IA 2EGCA 4AFSC 2NUTA 3HP9A 2KEAA 1M5Q1 2B8AA 5J26A 5C0MA 2A37A 1MMDA 4D8KA 1YHQT 1VQ9A 2OTJA 1QCFA 3HSBA 2YUOA 3PVQA 2M0OA 4KGZB 5CO7A 2J06A 3CCST 5KYNA 4JJNK 1D3BA 1WHJA 1VYUA 3M57A 4MDXA 2DD5A 5KYYA 1VQLQ 1M3CA 1Z9ZA 4ZN1A 1BYMA 2H3EB 3QWYA 2DL3A 5J3BA 2RQRA 1WFWA 4M7AB 2MIOA 4A54A 1WXUA 2QTVA 3OYHA 1G3YA 1LCKA 4HCKA 2GF7A 2GCXA 3GLXA 1NYGA 3LYIA 4D8DA 5GMKe 1KD1R 1ACMB 1W2BP 4J7IA 1Q81R 3GNGA 2H3JA 1QWEA 1RLQC 1VQ5T 2KK4A 3OYJA 1ZUKA 1W6XA 5GJVB 2QA4T 2M02A 2FG0A 1M8VA 2JTMA 2EQIA 2FPFA 4J9GA 1BBZA 4PJOC 2RJFA 3LGFA
chains in the Genus database with same CATH topology
1S72Q 1KD1R 1QVGP 3CCQQ 1KQSP 3CCRQ 1VQ7Q 1YI2Q 1Q7YR 1W2BP 1VQMQ 1VQ8Q 1K9MR 1Q81R 1VQ5Q 1NJIR 1VQLQ 3CC2Q 1YITQ 3CC7Q 3G6EQ 3CCVQ 1YHQQ 1VQ4Q 2QA4Q 1QVFP 3CC4Q 1YJNQ 1Q82R 2QEXQ 3CPWP 3CMAQ 2OTLQ 2OTJQ 3CXCP 1JJ2P 1VQ9Q 3CCEQ 3CCSQ 3I56Q 3CCMQ 3G71Q 3CCLQ 1YIJQ 1M90R 1VQOQ 1N8RR 1K8AR 1VQNQ 1VQKQ 3CCJQ 3CCUQ 1YJWQ 3CD6Q 3G4SQ 3I55Q 1KC8R 1Q86R 1VQ6Q 1K73R 1VQPQ 3CMEQ 1YJ9Q 3OW2P 1M1KR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 Q;  1KD1 R;  1QVG P;  3CCQ Q;  1KQS P;  3CCR Q;  1VQ7 Q;  1YI2 Q;  1Q7Y R;  1W2B P;  1VQM Q;  1VQ8 Q;  1K9M R;  1Q81 R;  1VQ5 Q;  1NJI R;  1VQL Q;  3CC2 Q;  1YIT Q;  3CC7 Q;  3G6E Q;  3CCV Q;  1YHQ Q;  1VQ4 Q;  2QA4 Q;  1QVF P;  3CC4 Q;  1YJN Q;  1Q82 R;  2QEX Q;  3CPW P;  3CMA Q;  2OTL Q;  2OTJ Q;  3CXC P;  1JJ2 P;  1VQ9 Q;  3CCE Q;  3CCS Q;  3I56 Q;  3CCM Q;  3G71 Q;  3CCL Q;  1YIJ Q;  1M90 R;  1VQO Q;  1N8R R;  1K8A R;  1VQN Q;  1VQK Q;  3CCJ Q;  3CCU Q;  1YJW Q;  3CD6 Q;  3G4S Q;  3I55 Q;  1KC8 R;  1Q86 R;  1VQ6 Q;  1K73 R;  1VQP Q;  3CME Q;  1YJ9 Q;  3OW2 P;  1M1K R; 
#chains in the Genus database with same CATH topology
 3OQ5 A;  2KE9 A;  4D6W A;  3AHU A;  3JB9 I;  1YIT Q;  3OYA A;  4OB2 B;  4MML A;  2HNI A;  1YJ9 T;  4IUT A;  2VB6 A;  3INZ A;  2X4J A;  1I5O B;  3X28 B;  3CC2 T;  4M7D B;  2LQ8 A;  1T3L A;  2ZZD A;  2DYI A;  5GAN 8;  3G71 T;  4FU6 A;  3QJ6 A;  3VUZ A;  1NEB A;  2DZ9 A;  1SRM A;  2DTI A;  3EG9 B;  3LWI A;  3EGX B;  2RPN A;  1IRE B;  5FWC A;  3JRZ A;  2L5Q A;  2FL7 A;  1N8R U;  1PKS A;  1SPK A;  1PM3 A;  4AFU C;  2ED1 A;  3M59 A;  2DLP A;  3IQL A;  2YHT A;  3THK A;  4J9E A;  2ECZ A;  1Q86 U;  1VIF A;  4C8Q E;  2YDL A;  2K6D A;  3H6Z A;  2CP5 A;  3M0S A;  1NG2 A;  2VV5 A;  1FWZ A;  1OUL A;  3GIB A;  3FJP A;  2XDB A;  1UGQ B;  3LX7 A;  2OAW A;  3QDF A;  3G7Z A;  1JEG A;  3RR6 A;  3JCM f;  4KH0 B;  5LJ5 g;  1BCM A;  1YIJ T;  2RNA A;  3SHW A;  1ZBJ A;  1BU1 A;  3M58 A;  3CCE T;  5LJ3 j;  5GMK h;  3J80 E;  2QTX A;  1U1S A;  2MI6 A;  4OMO A;  1JU5 C;  4Y92 A;  2QA4 Q;  1TTH B;  1AWO A;  3PT9 A;  4EMK A;  5HK0 A;  1ABQ A;  3EFR A;  1Y71 A;  1QQJ A;  3PFS A;  2QGG A;  2I2L A;  1YCS B;  1H3H A;  4J8O A;  2J6F A;  5LJ5 e;  1N9R A;  3PNW C;  1UJY A;  2R58 A;  2LC4 A;  3CXC A;  2YSQ A;  5GAM h;  3EG0 A;  2W0Z A;  2O88 A;  1VOM A;  1K4U S;  1E6G A;  1ZSZ A;  2FPD A;  4LDW A;  2M1H A;  3S6W A;  4M78 C;  5LJ5 j;  1JO8 A;  2HBP A;  1VUB A;  2X51 A;  5LJ3 g;  1Q95 G;  5FWB A;  2DE0 X;  3CCU Q;  3DKM A;  4J9F A;  4A4H A;  4JRI A;  1RAC B;  5KCO A;  5HK3 A;  2HKQ B;  1Q7Y C;  1E7O A;  3OYY A;  1PRM C;  1GCQ C;  1VQK A;  5LJ3 f;  1V76 A;  4JLG A;  4ZGD B;  1GXI E;  2FZG B;  1M4Z A;  4WF2 A;  4OML A;  2ABL A;  3CC4 Q;  2CZ0 B;  2DL4 A;  3VYG A;  3JCM Q;  1CKA A;  3PIP A;  1XQH A;  2RQT A;  4XTX A;  3QZ5 B;  4ATO A;  4XTU A;  2K3Y A;  4JLI A;  3OS5 A;  1QVF S;  3QWX X;  5L23 A;  2CUD A;  4OMF B;  2LVM A;  1RL2 A;  2OTJ T;  3R6O A;  1OZ3 A;  1H3Z A;  3HPW A;  4IUP A;  2PU9 B;  4FYW B;  2RHY A;  3CCS A;  4EPC A;  4E7S A;  4BAC A;  2O4X B;  3SD4 A;  1WHL A;  5GAN d;  4PNO A;  1YJW Q;  3UDC A;  4Q5W A;  4J9D A;  2ZAE A;  2A36 A;  2YRC A;  2LX7 A;  2XMF A;  1I5L A;  1RAB B;  1BCO A;  2ZPG B;  2KY9 A;  1TUG B;  4E7Z A;  3HFO A;  1BB9 A;  4LXC A;  3A1P A;  5L8R E;  2DBK A;  3OW2 S;  1Y96 A;  4F7U A;  1EFN A;  4M75 C;  1NZ9 A;  2E65 A;  2EPD A;  5D6Y A;  3M0P A;  2QQS A;  1VYV A;  2M0Y A;  4M7A D;  2MMP A;  2AKL A;  2Y4Y A;  3I9Q A;  3SFM A;  1UG1 A;  2RI3 A;  3ASK A;  4M77 C;  4RTT A;  5GAM g;  1PWT A;  2KMT A;  1FX7 A;  4O6J A;  4C0Z A;  1OU9 A;  3RMQ A;  1JB0 E;  3CCU A;  2VYT A;  2QXF A;  1ZA2 B;  3QBY A;  1KK7 A;  1KJW A;  2DM1 A;  4F14 A;  1D3B B;  4N0A C;  1NE8 A;  3QHS A;  1VQO T;  4AFQ C;  2EJF A;  2OTL A;  2RQV A;  1UGR B;  1ZSZ C;  4RTX A;  2HL3 A;  1TOV A;  3VUB A;  1K0X A;  3EG3 A;  1YIT A;  2YWW A;  2RJD A;  2JT4 A;  3F70 A;  1O75 A;  2R5M A;  4OGC A;  4OVA A;  4FM4 B;  3TSZ A;  5C6S A;  4PJO D;  1WHH A;  1AWW A;  4FYV B;  3E1S A;  3JCM b;  2CRE A;  1Q81 U;  4M7D D;  1G83 A;  2QYZ A;  2GNC A;  1YHQ Q;  2BE7 D;  4MMK A;  5FLX E;  4BDY A;  4C92 C;  3V7C A;  2OTJ Q;  2EBP A;  1YIJ Q;  2DJQ A;  4BB7 A;  4M7D E;  3FIF A;  1YI2 T;  2WSF E;  1PCX A;  4F16 A;  1XTD A;  2HQH A;  5A0L A;  3SB2 A;  3U23 A;  4C8Q F;  2X3W D;  2R57 A;  1Q82 C;  4C0D B;  4LD9 K;  1GFD A;  2Y4X A;  1YJN T;  2KYM A;  3JCM d;  3G6E T;  2YUP A;  4PJL A;  5KE2 A;  2JJ9 A;  1YWP A;  4M75 F;  4FYY B;  4HVU A;  4HCC A;  5GAN 7;  4FCY A;  3CMA A;  3CME Q;  1Y07 A;  2KR3 A;  3N5B B;  4M7D G;  5DLO A;  1QVG P;  3VS2 A;  3JV3 A;  1M27 C;  4PJM A;  4BI4 A;  3PIO A;  5IAY A;  3UA7 A;  2MAM A;  1WDX A;  4F7U B;  5GAO q;  1TU0 B;  1V1C A;  1AVZ C;  4C0D C;  3G71 Q;  2W10 A;  2K5I A;  1WJR A;  1NPR A;  4N4G A;  2KXD A;  2EYY A;  1VIE A;  2ROT A;  2FRW A;  2QAS A;  1FXX A;  2NLU A;  4MZM A;  4NS5 A;  3A8O B;  3JCM X;  5CKH A;  4HXJ A;  2X4W A;  2KRM A;  1G8X A;  1GBR A;  3EG9 A;  1ZLM A;  3I5S A;  2SRC A;  5IXF A;  3QO3 A;  4J9I A;  5CAI A;  2VC8 A;  3OMC A;  5GAN 2;  4VUB A;  2ED0 A;  1Q7Y R;  3C4S A;  1VQ5 Q;  4CC3 A;  5FRN A;  2DBM A;  2L3S A;  2JTF A;  1WHM A;  3HL8 A;  3V8K A;  3VS7 A;  1QKX A;  1JJ2 P;  1R0B G;  4OP0 A;  3P8H A;  1WQ7 A;  1I0C A;  5FW9 A;  1K8A U;  4QW2 A;  2XK0 A;  2EYX A;  1OX9 A;  1WLP B;  1F1B B;  4FT2 A;  2A7Y A;  3CBM A;  3A8M B;  3MP1 A;  2MK5 A;  4PLI A;  1T0H A;  2FVU A;  1RAG B;  1PC0 A;  3JCM J;  1XNI A;  2QGF B;  2IIM A;  3L2W A;  2IPO B;  2CDT A;  1FMK A;  2KRO A;  4M4Z A;  3S3M A;  2CS7 A;  2KBT A;  3CMA T;  3CXC P;  3MEW A;  4XTZ A;  1D1C A;  2HDA A;  2E4H A;  1M3B A;  1K8A R;  2NYS A;  5GAM f;  2KXC A;  1M9S A;  4TVR A;  3I55 Q;  1GFC A;  2ENM A;  2OJ2 A;  2DAQ A;  2EGE A;  2E5Q A;  2VGN A;  1GBQ A;  1JXO A;  5KH6 A;  2CSQ A;  3L1A A;  3HKS A;  2D8H A;  4J9B A;  4EDU A;  5EC7 A;  2K2M A;  3LWH A;  1QVP A;  4XU2 A;  3CCV Q;  1D09 B;  1WHK A;  3GF5 A;  2RO0 A;  2V26 A;  2QEX Q;  4PFP A;  5IHI A;  3I56 Q;  2D0Q B;  3DB3 A;  2PTK A;  3T9N A;  4Y91 A;  3KXT A;  4E7L A;  3JCM g;  3SWN A;  2AHJ B;  2HEQ A;  2NUP B;  1RLP C;  2L8D A;  1H8K A;  3OYK A;  1YWO A;  1QVG A;  2QG9 B;  2CKK A;  4E6R A;  2V8J A;  3VU3 C;  4NL3 A;  2COW A;  3C12 A;  1KIK A;  3CCS Q;  1M90 R;  1CKB A;  3RKX A;  2DFU A;  4F7U F;  3JB9 H;  3O8V A;  2K3X A;  3X20 B;  3A8H B;  4DQ2 A;  1RUW A;  5I22 A;  1D1B A;  4A63 B;  5KYX B;  3CC7 Q;  3VS1 A;  2ZPE B;  1BI0 A;  5DM7 R;  2X9H A;  2BE9 B;  1B7T A;  3VS6 A;  2HAX A;  1VQ6 Q;  4JRP A;  2DF6 A;  1VQP Q;  4PJO B;  2P0Q A;  3HRS A;  4BY6 B;  3P8D A;  3TQ7 P;  4FT4 A;  1XJW B;  4LUE A;  1YJ9 A;  2M9U A;  2COY A;  5GAO m;  2FPE A;  2JZ2 A;  3VS3 A;  3H9N A;  1K1Z A;  2JN0 A;  2RA2 A;  3BDU A;  1KQ2 A;  2HQX A;  1T0J A;  3CC7 T;  3CCJ T;  4OB3 B;  3HRU A;  2ZPI B;  4M7D F;  4N0A A;  1UDL A;  3I35 A;  4PFO A;  1OYX A;  2RH2 A;  2L89 A;  2EQM A;  3D7S B;  3ER0 A;  1OOT A;  4NL2 A;  3KBG A;  1UHC A;  4C8Q A;  1QCN A;  2D1X A;  3OYE A;  1X2K A;  2DRM A;  3URG A;  3JB9 G;  2LCC A;  2JS0 A;  1D0X A;  1FMW A;  5HKC A;  2F2X A;  4RCC A;  5CQY A;  3BDL A;  2R5A A;  3EG2 A;  3GOX A;  2LT4 A;  1S72 Q;  4M75 E;  2DX1 A;  2AZV A;  1WXT A;  3M0R A;  4XU3 A;  2D6F A;  3FJ5 A;  2DTO A;  2X4X A;  2VAS A;  1S72 T;  3OS0 A;  1S1N A;  2DVE A;  4KH1 B;  3M4G A;  3NGP A;  4FSX A;  2LRQ A;  1B3Q A;  1B34 A;  4EMG A;  1PNJ A;  5FU6 B;  1N8R C;  4CI0 C;  3CCM A;  2KT8 A;  5FU7 C;  1N27 A;  4M7A C;  4ZGE B;  2AT1 B;  2O01 E;  3WVD B;  3NTI A;  2PVG B;  2OTL T;  3E19 A;  2PQW A;  4M7A E;  1C6V X;  1X6O A;  4GY5 A;  5GAO r;  4ME7 A;  3VS4 A;  3I55 A;  3TU4 K;  3LGL A;  1VQM T;  4QQD A;  2J7I A;  2A28 A;  2CH4 A;  3JCM c;  4F04 B;  4DOV A;  4E47 A;  5FU6 C;  1KQ1 A;  5KYY B;  4BDZ A;  4HT8 A;  2J6O A;  2PVO B;  1VQ8 Q;  1K9M R;  1Y96 B;  2QA4 A;  1VQ4 T;  1SHF A;  5GAM d;  3JCM W;  3G6E Q;  4C5E A;  3DLM A;  1SRL A;  1HYO A;  4FL6 A;  4QVC A;  1GCQ A;  2XI9 A;  4M75 D;  5LJ3 d;  2G6F X;  2KAF A;  1VQK T;  2CP0 A;  1U3O A;  2YLB A;  1VQP T;  3EHQ A;  2MF2 A;  5GAN 5;  1W2B S;  3I55 T;  2QAZ A;  1YNZ A;  3OSV A;  3EFO A;  3KFV A;  1VQM A;  1C1A A;  3V8J A;  5EG2 A;  3RIR A;  1TUD A;  1K9M U;  1U06 A;  4M77 B;  2DL8 A;  4HVW A;  3M5A A;  3M56 A;  5GJW B;  1AWX A;  3EFS A;  3MP8 A;  4V2S A;  2F69 A;  2YLC A;  3WVE B;  2XHC A;  2HZY A;  4KUL A;  3G6E A;  3CCQ Q;  2DXU A;  1KG1 A;  2WAC A;  1VQ8 T;  3RKW A;  2PVD B;  3REA B;  5A2Q E;  1NM7 A;  3OW2 A;  1UEC A;  2LQK A;  4JS4 A;  4BE2 A;  1Q82 U;  1VQN T;  1KHC A;  2V8K A;  4KBM B;  2EJ9 A;  1D0Z A;  3H0H A;  1AWJ A;  1YHQ A;  4DBH A;  4RG8 A;  3L2Q A;  1QVG S;  1WQW A;  2J05 A;  2HSP A;  1VQL T;  2CGH A;  5DLQ E;  1I81 A;  5CKE A;  3I56 T;  2COZ A;  3NTH A;  2E6Z A;  1ZSZ B;  2F5K A;  3NPF A;  4DA4 A;  4LDX A;  1BI1 A;  1WI7 A;  2BZY A;  2E70 A;  3ULR B;  4LN2 A;  5AT1 B;  1PSE A;  3RER A;  3RES A;  2DXT A;  5IN1 A;  2LQW A;  4RMO A;  4E7K A;  5IHN A;  4XK8 E;  3OBY A;  1U8R A;  3CCL T;  4C5I A;  4LUD A;  2ZGW A;  2EWN A;  4F7U E;  4II1 A;  1U5S A;  1WXB A;  5KYW A;  3CCU T;  2EFI A;  4IUU A;  5A0G A;  4NOY A;  3OMG A;  1OEB A;  2A3L A;  2NUT B;  3RKY A;  2EAY A;  1LOJ A;  1X01 A;  2LNV A;  5DY9 A;  5GAO l;  2XD0 A;  1M30 A;  1RAD B;  2V1R A;  5IHK A;  1M90 C;  1PD1 A;  1GCP A;  3CCJ A;  1GRI A;  2CT3 A;  3MKD A;  1VQ4 Q;  3V7R A;  3VYH B;  1B34 B;  1X6B A;  5IH2 A;  4PKC C;  2RHZ A;  4F7U G;  3E9F A;  3M9Q A;  1ZA1 B;  3PMI A;  1VQ6 T;  2KYB A;  2QK0 A;  3BFM A;  2RM4 A;  2RQU A;  3RNJ A;  5GAN j;  2JMC A;  4BY6 C;  1G3T A;  1JJ2 A;  1PHT A;  5CIU A;  1JQQ A;  1K8A C;  1IO6 A;  1EZZ B;  2QQA A;  2EYW A;  2YRD A;  1AD5 A;  2LCS A;  2JTE A;  4JJD A;  1OPK A;  1R8O B;  3VRZ A;  3TVT A;  4QKU A;  3EGD A;  2CZ7 B;  2K9G A;  1A0N B;  4DBR A;  5ECA A;  3X25 B;  4Z88 A;  4M78 D;  4M7A G;  2CUB A;  1M1K R;  4Z89 A;  1OQK A;  5KYU B;  4LNP A;  1YJN A;  1H64 1;  2CP7 A;  3GPL A;  2CP2 A;  3CCR A;  2QQB A;  1I1J A;  1VA7 A;  2FB7 A;  5GAN g;  5KYU A;  2KQW A;  1G3S A;  1KFZ A;  2JMA A;  1G2B A;  1QCO A;  2RK2 A;  1RAF B;  1UE9 A;  1IRX A;  2PUK B;  1Y0M A;  4OB0 B;  1VQ9 T;  3M4Y A;  1JRI A;  2RJE A;  4N4H A;  3QSU A;  3MEA A;  2BUD A;  4M78 F;  1AOJ A;  2LT1 A;  4RTZ A;  1KD1 U;  1PKT A;  1OX8 A;  2LCL A;  4CC4 B;  3CPW P;  2JS2 A;  3OS2 A;  4AMC A;  1GL5 A;  3GNF B;  2DIQ A;  4EMK C;  2HMA A;  2VWF A;  2Z0W A;  2K79 A;  2IG0 A;  4M7A F;  1HXD A;  1HJD A;  3FLG A;  4JZ3 A;  4HKE A;  1NJI U;  1X75 C;  1UEB A;  2JUF A;  4FIB A;  4HT9 A;  1QWF A;  2RN8 A;  2LZ6 B;  3NHN A;  3MET A;  3C0C A;  1SSF A;  3V7S A;  4GLM A;  5KCH A;  3CXC S;  2A08 A;  2AKK A;  1EIF A;  1OI1 A;  4ANJ A;  2DXB A;  2RQW A;  2F1L A;  3CCV A;  2EW3 A;  4M75 B;  1Q86 C;  5KYX A;  1TS9 A;  1WPY A;  2QDL A;  2B86 A;  3QXE B;  4Y28 E;  1ZHI A;  3RDV A;  4J9H A;  4KT0 E;  1SF9 A;  1R77 A;  3UA6 A;  4M7D A;  1DJ7 B;  2DTH A;  2JOY A;  1O9S A;  3CD6 A;  1VQO Q;  4M77 D;  3CQT A;  4X1V A;  4DBF A;  1K73 R;  4RTU A;  4A4E A;  4AT1 B;  3OYD A;  3JSC A;  2IVW A;  3FEO A;  3RUX A;  4ELZ C;  2AK5 A;  4JZ4 A;  3CCV T;  5GAN 6;  2NUP A;  2DL7 A;  3TCJ A;  4IUV A;  1D0Y A;  4RTY A;  2K2V A;  1VQ7 T;  1Y7X A;  2LDM A;  2NUZ A;  3EGD B;  4J7F A;  1I4K 1;  2L3P A;  4OMQ A;  4JJB A;  1FYN A;  4JPB W;  1VQ5 A;  2VUB A;  3DLL A;  4JRK A;  4DEY A;  5A0D A;  4AG1 C;  3NTK A;  3CCR Q;  2EIF A;  4DOW A;  1UB4 A;  1RAE B;  4M78 A;  2E3I A;  1IHW A;  2DKG A;  1U1T A;  1TSF A;  4FW2 A;  1YP5 A;  1NYF A;  2QQR A;  1ZUY A;  4OB1 B;  4PJO F;  2HCK A;  2E3H A;  2CSI A;  3CBO A;  4M7A A;  2E41 A;  5CQX A;  1TH7 A;  4OF1 A;  4WTO B;  2OX7 A;  2K57 A;  2DEQ A;  4IUQ A;  4EMK B;  1RI9 A;  4JJC A;  2KRN A;  3P8B B;  3MEV A;  1AT1 B;  4HCZ A;  2LQN A;  1N6A A;  1NLO C;  5CK9 A;  1UGV A;  4ESR A;  1YIJ A;  3X26 B;  4E7J A;  1YN8 A;  4LE9 A;  6AT1 B;  2EJG A;  3CCQ A;  1G3W A;  1IHV A;  4M77 E;  1I07 A;  2LX9 A;  1VQ4 A;  3QYG B;  3QZ9 B;  1RI0 A;  4FW1 A;  1H92 A;  4LDY A;  4XQ3 A;  3C94 A;  4IKF A;  2LNH B;  4LDU A;  3L42 A;  4C92 F;  4M75 A;  5GAN 3;  4J9C A;  3BY7 A;  3CD6 T;  3OSS C;  2VGM A;  1IXD A;  3FRN A;  1AHJ B;  1JXM A;  3G1J A;  4OMM A;  3TRE A;  2O9S A;  4ELY C;  3AT1 B;  1N8R R;  1OZ2 A;  2JXB A;  2MWP A;  2ESW A;  3VS5 A;  2ZPH B;  4DEX A;  1YIT T;  4XTV A;  3UPU A;  2RHX A;  1E6H A;  2HQE A;  4R0K A;  4M77 G;  1KQS A;  2KSS A;  3M54 A;  2PUO B;  3PGG A;  1QMC A;  3H8Z A;  4A4F A;  1B07 A;  3V8L A;  5GAN f;  3M55 A;  4E7I A;  1NPP A;  1X2Q A;  1PD0 A;  1X43 A;  3JCM P;  2EVR A;  3M0T A;  3CCE A;  4MZP A;  5LJ5 h;  4QVZ A;  2JW4 A;  2C0T A;  3EH1 A;  3FDR A;  1UGP B;  3TSW A;  3OBW A;  4KGV B;  3M0U A;  2DET A;  1UGS B;  4M78 B;  2L3R A;  2FZC B;  1NEG A;  3I5R A;  3CC2 Q;  4PJJ A;  4C5H A;  4A4K A;  1MND A;  5GMK i;  1SEM A;  1I8F A;  1KC8 U;  2RHI A;  1Z9Q A;  4PJN A;  4J5Y A;  1MMN A;  1W4S A;  2P0P A;  4F17 A;  1AEY A;  1C0M A;  1Q81 C;  4EIK A;  3EFO B;  3MJX A;  1QW1 A;  5CKB A;  2RF0 A;  2XDP A;  2DK3 A;  3RBB B;  2GTJ A;  5KE3 A;  3VJP A;  2JNG A;  3GBQ A;  4M78 E;  1TWB A;  3R6N A;  3A98 A;  1KC8 C;  5LJ3 h;  3GP8 A;  3E2U A;  3OY9 A;  1QKW A;  3OYM A;  2RD1 A;  3MPU B;  1NLP C;  2RMO A;  4A4G A;  1K76 A;  1N5Z A;  2K3B A;  1WHG A;  4ZN3 A;  4J83 A;  3JB9 D;  2E5K A;  3LH0 A;  1QVF P;  2BIV A;  3CC4 A;  1BI2 A;  2DRK A;  1SKU B;  4AFZ C;  2PZ1 A;  2YUQ A;  5GAM j;  3JAM E;  3G4S A;  3LH5 A;  4KRT A;  3EHR A;  2P4R A;  3UF4 A;  3RMS A;  2V8I A;  3QJY A;  3M53 A;  4DBQ A;  3CEY A;  2DER A;  2DXC A;  2CZ1 B;  3HHT B;  2JM9 A;  3QKJ A;  4WCI A;  1R0C B;  5CVI A;  3QUI A;  1LPL A;  3BE3 A;  4JS5 A;  2HKN A;  1ZQ1 A;  4XTW A;  1BI3 A;  1HSQ A;  4YTL A;  3TEE A;  4OGE A;  3FC3 A;  4CC7 A;  4C8Q G;  1M90 U;  1VQP A;  1MMG A;  1UUE A;  1KD1 C;  1X6G A;  2RHU A;  3NFC A;  2XDD A;  4GLK A;  4BE1 A;  1XOV A;  2EYZ A;  5FRM A;  3HRT A;  2ZPB B;  3MEU A;  4QQG A;  4RTV A;  3CC7 A;  3QPH A;  2BKD N;  2LJ1 A;  3EGX A;  3PTA A;  1M8M A;  1QP3 A;  1ZUU A;  4O5V A;  4PFZ A;  2FHD A;  5D6W A;  4C8Q B;  2QQ9 A;  3MO8 A;  4IIO A;  5HCK A;  1D1A A;  1J3T A;  3ME9 A;  4XTY A;  4HA8 A;  1RAH B;  5J39 A;  2BZ8 A;  2F2V A;  2KI7 A;  1BIB A;  4B9X A;  2KVQ G;  4M75 G;  1M1F A;  2I0N A;  2L2P A;  3OYI A;  2SEM A;  1M1K U;  4PJO E;  2YUN A;  2EQK A;  1W1F A;  5GMK j;  4BD3 A;  3PMT A;  3Q1J A;  3OW2 P;  1BK2 A;  1HD3 A;  1WIE A;  3CC4 T;  2DZC A;  1TUC A;  1IGU A;  5FRO A;  3EG1 A;  1MV0 B;  2J6K A;  5CKD A;  5FU7 B;  3CCM Q;  2EQU A;  4OMN A;  3A8L B;  5D7U A;  1WZO A;  1M1K C;  1YBY A;  4BUG A;  4M77 F;  5CKF A;  2WSE E;  4RUG A;  2F5T X;  2DEU A;  3VS0 A;  4ZGJ B;  2LJ3 A;  3JB9 J;  4M7D C;  1VQ7 Q;  2X4Y A;  2D0N A;  1X69 A;  3REB B;  3L2R A;  4C92 A;  2Y90 A;  4C92 E;  3SWN C;  3G71 A;  3QII A;  5GAO n;  3OB9 A;  2F2W A;  2OTL Q;  2D8J A;  5GAN h;  3JCM e;  2CP3 A;  2MWO A;  3CBP A;  2DVJ A;  2NWM A;  4UC4 A;  2RB6 A;  2BZX A;  1RAI B;  4LDV A;  2DYB A;  2FRY A;  4L59 A;  1VQM Q;  3SWN B;  2E10 A;  2O9V A;  2GBQ A;  1K73 C;  3JB9 F;  2CT4 A;  2O2O A;  2ATC B;  4AG2 C;  1W2B A;  2FZK B;  2X3X D;  2LTO A;  1N9S A;  5GAN e;  1MMA A;  4C0G A;  1Y57 A;  4M78 G;  4ZTJ A;  4C5G A;  1JBM A;  1VQ7 A;  3QYH B;  4HCB A;  4C92 D;  1BKB A;  2VKN A;  4BE0 A;  2ROL A;  4EMH A;  3SEM A;  8ATC B;  4N4I A;  4E2F B;  2GQV A;  3A8G B;  4XAX B;  4IUR A;  3M0Q A;  3QDR B;  2G3R A;  2GFU A;  4J6W A;  1EX4 A;  2FEI A;  4CRI A;  1ARK A;  1PRL C;  2O31 A;  3FB9 A;  3G4S Q;  1SHG A;  2O4X A;  5I2S A;  2QEX A;  1VQ8 A;  2JM8 A;  5LJ3 e;  3CPW A;  3CPF A;  2MPX C;  1PSF A;  3A5Z B;  3ZBD A;  1K73 U;  2VXF A;  1W70 A;  1NJI C;  2DO3 A;  4J6Y A;  2XID A;  4JRQ A;  4HVV A;  1AZE A;  2RI5 A;  1WX6 A;  3CCQ T;  3NMZ C;  3EH2 A;  2GGR A;  4XU1 A;  4ZNX A;  4L6V 5;  4FSS A;  1WGS A;  3BW1 A;  4M77 A;  3EGU A;  4KUI A;  1TG0 A;  2DD4 A;  3G4S T;  1NJI R;  2EGA A;  3HTR A;  3OYG A;  4PJO A;  3CPW S;  1M3A A;  2X35 A;  2EKH A;  4FYX B;  8AT1 B;  2FYK A;  3CCL Q;  2ZCF B;  4X34 A;  2DA9 A;  1VYT A;  1G5V A;  4E7H A;  1AZG B;  2C06 A;  3PE0 A;  2AZS A;  3OYC A;  1BIA A;  2EQJ A;  4R56 A;  4KUD K;  3KUF A;  2GFA A;  1OV3 A;  2E12 A;  1YI2 A;  2MOX A;  2VXE A;  3CC2 A;  5IXB A;  5GAN 4;  2E1H A;  1QVF A;  4ORZ A;  2OI3 A;  2CP6 A;  2LJ0 A;  1Q86 R;  2M16 A;  2HL5 C;  1K0S A;  2DPP B;  1LNX A;  2HD0 A;  4PJO G;  5D6X A;  3PVL A;  1HK9 A;  2CZ6 B;  4L5G A;  2QEX T;  1WJS A;  3C95 A;  4B6M A;  3EAE A;  3JCM h;  3J7A F;  1UTI A;  2RJC A;  1WJQ A;  2D9T A;  5CR2 A;  2P0K A;  1WA7 A;  2YT6 A;  1YJ9 Q;  4C8Q D;  4Z02 A;  5LJ5 f;  5M9O A;  2AIR B;  4QVD A;  9ATC B;  1WYX A;  1YCY A;  5CCA A;  2FO0 A;  5I21 A;  3MP6 A;  5LL6 S;  3ZL7 C;  1CSK A;  4C92 G;  2KNB B;  1VQK Q;  1T3S A;  4RTW A;  2XG8 D;  2P4T A;  2V1Q A;  2DJZ A;  3OYF A;  2K7A A;  1FMV A;  1ZSG A;  2CH4 W;  5GAO p;  2E6N A;  1RAA B;  3LW5 E;  1VQO A;  4JUV A;  4PLL A;  1YJN Q;  2VVK A;  5GAM e;  2XU8 A;  4KGX B;  3DB4 A;  1TXQ A;  1Q7Y U;  4XU0 A;  1IZ6 A;  2ZPF B;  3OS1 A;  1V29 B;  5AYF A;  4C8Q C;  2DIG A;  2YXY A;  2HBW A;  1S72 A;  4BI3 A;  1QLY A;  1WNL A;  1Q82 R;  1ABO A;  1IB8 A;  2E64 A;  1KQS P;  1YI2 Q;  1ZX6 A;  1KSW A;  3E9G A;  3CCM T;  1MGQ A;  1X27 A;  2K5L A;  5GMK m;  2EKO A;  2KT1 A;  4K11 A;  2LP5 A;  3UT1 A;  4MDW A;  4B9W A;  3L2V A;  2L0A A;  1MUZ A;  2GQI A;  1KQS S;  4GBQ A;  2P84 A;  3L2U A;  2EYQ A;  1UJ0 A;  2XKO C;  1VQN A;  4OMP A;  1MNE A;  3VV0 A;  2MYS A;  2RI2 A;  2GTO A;  1VQN Q;  2C0O A;  2KRS A;  1SSH A;  7AT1 B;  1VQL A;  3X24 B;  3L2Z A;  4BI8 B;  1M2V A;  3JCM V;  1K9A A;  2BTT A;  3I56 A;  4C92 B;  1UHF A;  4QQ6 A;  1MHN A;  2DL5 A;  2K5F A;  3QG1 A;  3OA6 A;  1YJW T;  2QI2 A;  3HFN A;  1M2V B;  2XIC A;  5LJ5 d;  4LD6 A;  1VQ9 Q;  1JJ2 S;  1SG5 A;  2WSC E;  4RKU E;  3J81 E;  1KHI A;  3S3N A;  1LVK A;  1OU8 A;  4CC2 A;  4P5N A;  3CCE Q;  2H8H A;  1MV3 A;  5KYW B;  3CME T;  4RCB A;  1UFF A;  3WXM B;  2RK1 A;  4IIM A;  4QT7 A;  4PK4 A;  2HSE B;  1K9M C;  5HY6 A;  1YJW A;  2PNI A;  2LMJ A;  1NBE B;  4Z8A A;  5GMK l;  2QDY B;  2DNU A;  3ZFJ A;  4PL6 A;  1IGQ A;  3UWN A;  1VQ6 A;  2A0F B;  3O5Z A;  3MCA B;  3OYB A;  3CMA Q;  1M2O A;  2DMO A;  3CME A;  5IT9 E;  3ZEH A;  3H0F A;  3LLR A;  3CCJ Q;  2K4Y A;  4X9D A;  3MHX A;  3VRY A;  1QP2 A;  2JVV A;  4MZT A;  1M1G A;  2MCN A;  4J6X A;  3SDZ A;  3S3O A;  4C0F A;  4R55 A;  1LJO A;  2KDS A;  1PG5 B;  2M51 A;  2C0I A;  2L3Q A;  2DIL A;  2KGT A;  3CCL A;  3UAT A;  3H41 A;  4JDS A;  4ZTF A;  3OYL A;  2CYZ B;  2OAU A;  2YRV A;  5I2M A;  1YFN A;  3CD6 Q;  1KC8 R;  1OPL A;  4X9C A;  4A53 A;  3CCR T;  1ZBX A;  5I11 A;  4RG2 A;  1P92 A;  3OYN A;  3VKI A;  3H0I A;  2EGC A;  4AFS C;  2NUT A;  3HP9 A;  2KEA A;  1M5Q 1;  2B8A A;  5J26 A;  5C0M A;  2A37 A;  1MMD A;  4D8K A;  1YHQ T;  1VQ9 A;  2OTJ A;  1QCF A;  3HSB A;  2YUO A;  3PVQ A;  2M0O A;  4KGZ B;  5CO7 A;  2J06 A;  3CCS T;  5KYN A;  4JJN K;  1D3B A;  1WHJ A;  1VYU A;  3M57 A;  4MDX A;  2DD5 A;  5KYY A;  1VQL Q;  1M3C A;  1Z9Z A;  4ZN1 A;  1BYM A;  2H3E B;  3QWY A;  2DL3 A;  5J3B A;  2RQR A;  1WFW A;  4M7A B;  2MIO A;  4A54 A;  1WXU A;  2QTV A;  3OYH A;  1G3Y A;  1LCK A;  4HCK A;  2GF7 A;  2GCX A;  3GLX A;  1NYG A;  3LYI A;  4D8D A;  5GMK e;  1KD1 R;  1ACM B;  1W2B P;  4J7I A;  1Q81 R;  3GNG A;  2H3J A;  1QWE A;  1RLQ C;  1VQ5 T;  2KK4 A;  3OYJ A;  1ZUK A;  1W6X A;  5GJV B;  2QA4 T;  2M02 A;  2FG0 A;  1M8V A;  2JTM A;  2EQI A;  2FPF A;  4J9G A;  1BBZ A;  4PJO C;  2RJF A;  3LGF A; 
#chains in the Genus database with same CATH homology
 1S72 Q;  1KD1 R;  1QVG P;  3CCQ Q;  1KQS P;  3CCR Q;  1VQ7 Q;  1YI2 Q;  1Q7Y R;  1W2B P;  1VQM Q;  1VQ8 Q;  1K9M R;  1Q81 R;  1VQ5 Q;  1NJI R;  1VQL Q;  3CC2 Q;  1YIT Q;  3CC7 Q;  3G6E Q;  3CCV Q;  1YHQ Q;  1VQ4 Q;  2QA4 Q;  1QVF P;  3CC4 Q;  1YJN Q;  1Q82 R;  2QEX Q;  3CPW P;  3CMA Q;  2OTL Q;  2OTJ Q;  3CXC P;  1JJ2 P;  1VQ9 Q;  3CCE Q;  3CCS Q;  3I56 Q;  3CCM Q;  3G71 Q;  3CCL Q;  1YIJ Q;  1M90 R;  1VQO Q;  1N8R R;  1K8A R;  1VQN Q;  1VQK Q;  3CCJ Q;  3CCU Q;  1YJW Q;  3CD6 Q;  3G4S Q;  3I55 Q;  1KC8 R;  1Q86 R;  1VQ6 Q;  1K73 R;  1VQP Q;  3CME Q;  1YJ9 Q;  3OW2 P;  1M1K R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...