1VQMQ

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqmQ00
2OTLQ 3G71Q 1VQ4Q 3CCVQ 1YJNQ 1M90R 1VQ9Q 2QEXQ 3CCEQ 3CD6Q 1K9MR 3CCLQ 3CPWP 1KQSP 1VQ8Q 1K73R 1N8RR 1KD1R 2OTJQ 1YITQ 1YIJQ 2QA4Q 3I55Q 3G6EQ 3I56Q 1W2BP 1QVFP 1VQKQ 1Q7YR 3CMEQ 1YJ9Q 1VQLQ 1VQNQ 1K8AR 3CCJQ 3CCRQ 3G4SQ 3CC7Q 3CCUQ 1VQOQ 1S72Q 1YI2Q 1Q81R 1M1KR 1Q86R 1NJIR 1KC8R 1QVGP 3CCMQ 1VQ5Q 3CC2Q 1JJ2P 3CCSQ 1YJWQ 1Q82R 3CCQQ 3OW2P 3CC4Q 1VQ7Q 1VQMQ 3CMAQ 1YHQQ 3CXCP 1VQPQ 1VQ6Q
chains in the Genus database with same CATH superfamily
1M1KU 3HRSA 1X69A 2A0FB 5GAN6 4M77C 5GAMe 1YITT 1W4SA 3X24B 1W70A 1M5Q1 1RADB 3M59A 1RAFB 2DNUA 4DBQA 2BE9B 3WXMB 2FZGB 3PMIA 2QA4T 4PJOF 4XTYA 4HCZA 4XTUA 3VYGA 1KG1A 3EFOA 5CKEA 4OMFB 1WZOA 5LJ5e 3BW1A 5I2MA 1BIAA 1UGQB 5GAOl 3X20B 4E7LA 2XD0A 2F2VA 3OBYA 3J80E 3L2QA 3PVLA 1NLPC 1SRMA 3M5AA 3L2VA 4XTWA 2FL7A 3QJYA 2RI5A 4BY6C 3OS1A 3QG1A 1X2QA 1PD0A 4HXJA 3TEEA 2ZPIB 2FO0A 1HD3A 1M1KC 1OU9A 3H0FA 2NUPA 1GBQA 2KEAA 2QI2A 2RQRA 5KCOA 5GMKi 2E70A 1ZBJA 1ZBXA 5FU7C 4KUDK 4FSXA 4Z8AA 4R0KA 2MCNA 2KR3A 3HL8A 1QWEA 1N8RU 2J6KA 1VQ7A 4EMGA 2NUZA 1NJIR 3BY7A 4TVRA 3NGPA 4LDXA 2CSIA 4K11A 3EFOB 3CMEA 1VQLA 1YHQT 1AWWA 2MPXC 4BI8B 3EG9A 3I55A 5J39A 1ZSZA 2DL8A 1F1BB 1QQJA 2V1QA 2QTXA 3SEMA 3M58A 4LNPA 4M78E 4CC7A 3HSBA 1JRIA 3CCMA 1OOTA 1PKSA 4N4IA 2VUBA 5GAOp 4C5EA 1MMDA 1XQHA 3OYGA 2JUFA 1TU0B 3HP9A 3ER0A 3QZ9B 5J3BA 3VUZA 1WXTA 5DY9A 2VYTA 4CI0C 5KYYA 1GBRA 1PSEA 1BYMA 2K9GA 1VQ5A 5IXFA 2C0TA 4O5VA 5IT9E 2E3HA 5CKFA 1I5OB 3UF4A 4DA4A 3UT1A 3I9QA 1RI0A 4BB7A 4PLIA 2QASA 2K5IA 1WPYA 2JZ2A 5CKDA 3KUFA 1SF9A 2QEXQ 3BDLA 1QCOA 2XICA 5CAIA 4O6JA 2CSQA 2LQWA 3HHTB 1HK9A 2CZ6B 4BDZA 3G1JA 3OB9A 1QCNA 4EMKB 3FIFA 3LW5E 1KD1C 5GAOr 1UFFA 3KBGA 1N9SA 2E5KA 1ZSZC 1YIJA 1KQSA 3NTIA 4Z89A 4D6WA 3BE3A 3OYLA 2LDMA 4C0DB 1CKBA 2KDSA 1D3BB 5GMKj 1SKUB 1T0JA 3C12A 3JCMP 1WJSA 4J83A 4HKEA 1YITA 2BZ8A 4FL6A 2VASA 1QMCA 4JZ3A 4RUGA 2OTJT 4C8QE 1JU5C 5C0MA 5KYUA 2HQEA 1QKWA 4FSSA 4AFQC 3EAEA 3TCJA 2JJ9A 4M7AA 4IKFA 1V76A 3QJ6A 4PJOE 2I2LA 2FVUA 4ZGEB 1ARKA 1RI9A 3EG1A 2GTJA 4E7IA 3CCST 1TXQA 4KT0E 3SWNB 3TSZA 3MO8A 1BCOA 4XTXA 4LUDA 1K8AU 4MMLA 3JAME 2ZAEA 1TSFA 3RNJA 1S1NA 1SHGA 1Q86C 3CQTA 3JB9H 4M7AE 4PFZA 3ULRB 3OSSC 3JCMJ 1SSFA 2CP7A 3EFSA 3CMAQ 4OMPA 5GAMd 2XHCA 3FJPA 4M77F 2O31A 1DJ7B 4LDVA 2P0KA 2K3YA 2QEXT 1AVZC 3E9GA 1YFNA 1UEBA 3X25B 2ESWA 1AZEA 2GNCA 1H92A 2AK5A 2J7IA 3RUXA 4C92B 2P4TA 5DLQE 4FYXB 3R6NA 1NJIC 1QLYA 3VS5A 1MNEA 3CCLQ 1I8FA 4RTVA 2PU9B 1TOVA 4C0ZA 1VQ6T 4C92C 3CCJT 4L6V5 2CP0A 2J6FA 2ZPBB 3P8BB 4DEXA 3CCSQ 3T9NA 4IUUA 2AKLA 2CZ1B 5LJ5d 2L2PA 2HNIA 4PJOA 2V8KA 1ZLMA 4BI3A 2FPDA 2CUDA 1UGRB 2K3XA 5GAN8 1RAGB 4DBHA 5FU7B 5CVIA 1BI3A 3EGDA 5IHIA 4HCBA 3V8LA 2OTLT 2FYKA 2K79A 3HPWA 4FM4B 4M7DB 4WTOB 3VJPA 1KHCA 1OEBA 4BUGA 5LJ5f 3RKWA 3M0PA 3FJ5A 4F7UA 3TSWA 2J05A 1M2VB 1D0XA 1ZSGA 2COZA 2WSCE 1K0SA 3JCMg 3JCMd 2M51A 3S3NA 3QYHB 3JCMQ 2QG9B 4PK4A 3CXCA 3QDRB 1RUWA 2KI7A 3Q1JA 1VQ5T 2EGCA 2LP5A 4DBRA 1WHKA 4IUVA 1PWTA 3H6ZA 4A53A 1WA7A 2AKKA 2E1HA 1VQPQ 1I1JA 2BZYA 3L1AA 2JOYA 2X3WD 3FEOA 1VQOT 4FYYB 1PHTA 1XNIA 2OTJQ 1W2BP 1S72A 2P0QA 2RMOA 1BB9A 1WHHA 2ROLA 1KD1U 2KRSA 1BBZA 3CCLT 4XU0A 2DA9A 1X2KA 2NUTB 2RNAA 3L2WA 5GMKh 1AHJB 2QYZA 2CYZB 2O4XA 3D7SB 3QZ5B 5IAYA 3PMTA 3MP1A 1QWFA 3WVDB 2KBTA 1N8RR 1C0MA 1M3AA 5DLOA 1YJNA 1K73U 3CMEQ 1VQLQ 1X43A 2RHIA 1IRXA 3NHNA 1T3LA 2QQRA 2PUKB 3DB3A 3H9NA 4M7DD 1YJWQ 4EMHA 3CCUT 4M75C 4L59A 2QQAA 1BI1A 4JLIA 2HSPA 2IIMA 4AFUC 2KVQG 2NUTA 3CCUA 2LNVA 2LJ3A 1UHCA 5C6SA 3OS0A 4JLGA 4PLLA 5KE3A 1I07A 3OS5A 1UGSB 5CIUA 4DOWA 1M1FA 5CO7A 3OYFA 2RO0A 4J6YA 2M0OA 5GAMj 4ZTJA 2LMJA 3TVTA 4J9GA 1I5LA 5LJ5h 1U1TA 5GJVB 2QGGA 7AT1B 4C92A 1VQPA 2X3XD 2DMOA 2W0ZA 2GBQA 1VQNA 1FWZA 2EYQA 3JCMh 2K6DA 4JRPA 3JCMV 3G71T 1Q86U 3EH1A 5CQXA 1V29B 2HSEB 2RA2A 3CC2Q 4D8KA 3RESA 2HMAA 1TUGB 2C0OA 4OB2B 2D6FA 1MNDA 2LTOA 2OTLQ 4J7FA 4M77G 4ZGJB 1JEGA 4OF1A 2KYMA 2ATCB 1PKTA 2OX7A 5LL6S 3PFSA 2XMFA 2BE7D 4II1A 5IHNA 8ATCB 5KE2A 3OYCA 1Q95G 3OW2A 1ZA2B 4F7UE 3A8LB 4F7UF 1JXMA 1W2BS 3CC7A 3G4SA 2DF6A 4EPCA 3VRZA 1UDLA 5D6XA 3CD6Q 3GIBA 2G6FX 4OB3B 3NPFA 3CC7T 3I55Q 3CCEA 1X6OA 3VU3C 2XI9A 3A8HB 1GFDA 5CCAA 1GRIA 1NM7A 1BI0A 2FPFA 4QQDA 1C1AA 2CKKA 4QVCA 4E7SA 3FC3A 4FCYA 2PVDB 3OYJA 4N0AC 1K8AC 2RHZA 5KYUB 2G3RA 3BDUA 1YJWT 1VQ4A 1QVGA 4M75E 1M3BA 2JT4A 1R8OB 3CCLA 5IXBA 3M0SA 2VVKA 2EJFA 3EHRA 2F2XA 3UA7A 2YDLA 1KHIA 2GQVA 3QBYA 1KC8R 5D6YA 4F7UG 3LWIA 1B07A 1SRLA 2RQVA 4J9FA 2LQKA 1G83A 2B86A 2KROA 4E7KA 2LRQA 3A8OB 3SD4A 2KAFA 4L5GA 2D8HA 3M53A 1SG5A 3INZA 4HT8A 3LWHA 2K7AA 5FW9A 3V7SA 4ELZC 4FYWB 4HA8A 2M1HA 3ZL7C 4JS4A 1K9MC 3IQLA 5GAN2 1MMGA 1PCXA 1M4ZA 1K76A 3G6EQ 4A63B 5D7UA 1H641 3MEAA 2JMAA 2DXTA 2GFAA 5FWBA 4E7HA 4FIBA 2O4XB 1AEYA 2W10A 1NJIU 3UATA 3JCMf 2RH2A 2CP2A 3M9QA 2MYSA 2OAWA 3MEVA 2EKHA 3VKIA 2H8HA 1UGPB 2RHUA 2PZ1A 2RPNA 1HXDA 4CRIA 2DFUA 2VWFA 2AIRB 2EIFA 2HCKA 4A4EA 1EFNA 3I5SA 3M0RA 4XK8E 3G71A 3A8GB 2CDTA 3CCVT 2SRCA 1IGQA 2YLCA 2K57A 1I0CA 4ZNXA 4BE2A 3QDFA 1EIFA 1BKBA 2O88A 1OQKA 4OGCA 4RCBA 4PJOB 2YUQA 2E6NA 1YJ9A 4M75A 5KYXA 1M30A 4P5NA 1YCSB 2DZCA 5M9OA 2AT1B 1LNXA 1UJ0A 3L42A 5KCHA 3CMAT 4XAXB 2COWA 1D0YA 2NWMA 3E9FA 5LJ3d 1X6GA 3PGGA 3KFVA 3CCMQ 1MGQA 4M77A 4EMKC 2RK2A 2EKOA 1S72T 3EHQA 2YUOA 1PNJA 3RMQA 4M7AB 4BI4A 3ZEHA 3EFRA 4M75D 1ZQ1A 3X28B 1OV3A 2A36A 2E41A 2DO3A 5KH6A 2DEQA 4C8QB 2RQUA 2YRCA 2L5QA 3MEUA 4M75B 4IIOA 4QKUA 1X27A 2XDPA 4RTYA 5CQYA 1YIJT 1YWPA 2JNGA 5GAOq 3SWNA 2M0YA 4C92E 4JS5A 1GCQC 3LGFA 3P8HA 2OAUA 2SEMA 5LJ3f 4MMKA 2LZ6B 1NEBA 3JB9G 4HVVA 1YITQ 4M77E 4J8OA 3MHXA 4XU2A 2X4JA 2DRMA 2IVWA 3RMSA 3I56A 2EQIA 2XDDA 5GAOn 1U06A 1G5VA 4KH1B 2ZPEB 2PVGB 5HY6A 2XIDA 4RTTA 1B7TA 1VIEA 4F04B 3A1PA 2VB6A 1XTDA 5LJ3j 1VQ8Q 4C92G 4MDWA 2I0NA 2CH4A 1FMWA 2DKGA 2DBMA 2GCXA 4BD3A 3OYDA 3LLRA 1QVFA 3CCMT 2L3SA 1U5SA 1IHVA 3C0CA 2LT1A 2ECZA 2A3LA 4BE1A 1Y57A 4RTUA 1YHQA 2V8IA 3LH0A 2RJDA 3CPWP 1VQMA 2RQTA 3CC2A 1T0HA 1QP3A 1KQ1A 3L2UA 4FT4A 3MPUB 2HDAA 3AT1B 3ASKA 3V7CA 4DBFA 1OU8A 2CP6A 3H41A 3NTKA 4RMOA 2YSQA 4J5YA 1KIKA 1NPPA 2B8AA 2YRDA 4IIMA 1Q82U 1H3HA 3OMCA 4C0DC 4KULA 4BY6B 3HFOA 4C0FA 2DXUA 4LD9K 1VUBA 2RM4A 1QVFP 5GMKe 2ROTA 1YJ9Q 3EG9B 1VQ9T 2YUPA 2KXCA 4RTWA 2CZ0B 5A2QE 5FROA 1QW1A 2J06A 1M90C 1GCPA 4ELYC 2EFIA 2HKQB 2HD0A 2LX7A 1VQ9A 4OP0A 1UE9A 3BFMA 3A5ZB 2FRWA 4DEYA 4A4FA 4LDUA 1VQ7T 4CC3A 2KK4A 1AWJA 2JXBA 1VQ6A 4J9EA 1YJWA 1VQ8T 1HJDA 3LX7A 3P8DA 5KYYB 3OS2A 1UB4A 1WYXA 1AWXA 4PJOG 5KYXB 5IN1A 1Q82C 1OZ2A 3JV3A 2FEIA 2FG0A 3G6EA 1TS9A 2K5FA 2DM1A 2RF0A 4EDUA 2QQ9A 1E6GA 1MUZA 1QP2A 4M7AF 4PFPA 1K9MU 2D0QB 1M90U 3CBMA 5CR2A 2GGRA 2HAXA 2DL4A 5J26A 5CKHA 4X1VA 4RKUE 3E1SA 2LCCA 3NTHA 4WF2A 3CD6T 2RK1A 3JCMe 2LCSA 4C5HA 4ME7A 3OA6A 2QA4Q 3PTAA 3OYNA 3CMAA 1WHJA 1K9AA 2GTOA 1VQOQ 2K4YA 4AG1C 1M8VA 5HK0A 5CKBA 3CCQQ 2DEUA 3OYKA 3QSUA 1Y07A 1FMKA 1ABOA 3CBPA 1ZX6A 1J3TA 1X01A 2YXYA 3PVQA 3UA6A 1RAEB 1Q81U 3R6OA 2QGFB 2LQ8A 4Y92A 1KD1R 1X75C 1NLOC 1OULA 4RTXA 1N6AA 4LXCA 3AHUA 2EJ9A 2YRVA 2MAMA 2QDYB 5GMKm 3M56A 4PJNA 1QVFS 2PUOB 2EBPA 1UHFA 3VS3A 1IHWA 1EX4A 2MI6A 2DTHA 1I4K1 1KQSS 2DL5A 1R0CB 1YJNQ 2EAYA 2X4YA 3CCEQ 3FLGA 2JTMA 2Y4YA 1SHFA 3RERA 4MZTA 2E3IA 3THKA 1WDXA 4KRTA 5FWCA 1O75A 3FRNA 1VYVA 1TTHB 3SWNC 1IXDA 4JJCA 4M7AG 2HKNA 4M7DG 1IGUA 3NFCA 3VS2A 3LYIA 1VQNT 3GF5A 4HT9A 4FU6A 4KGXB 4N4GA 1IREB 2MF2A 2ABLA 3FDRA 2LT4A 2KNBB 1VQ9Q 1BK2A 4C8QG 4C0GA 4GBQA 5HCKA 2KE9A 2ZPGB 2DTOA 2QEXA 2QK0A 1K8AR 1VQPT 3CC4A 3DB4A 1YBYA 1Q86R 3OYEA 2GFUA 5A0DA 1GL5A 2YUNA 4RCCA 3JRZA 1K73C 4ESRA 3QO3A 2RQWA 4PL6A 3CC4T 1TUCA 3META 2ZCFB 4B9XA 4LDWA 1U3OA 2M16A 4BE0A 2X51A 3CCJQ 3A98A 2Z0WA 2FZKB 3MEWA 4RG8A 1RAAB 1PC0A 1R77A 1D0ZA 2EVRA 2CT4A 1Q7YC 4JJBA 2ZPFB 2HBPA 4BDYA 4M78F 3OYBA 4EMKA 3EGUA 4A54A 2QA4A 1M90R 2PQWA 2IPOB 3GPLA 1RAIB 2LCLA 4GLMA 4CC2A 3C4SA 2XU8A 4IUTA 2JN0A 1B34B 2DL7A 3G6ET 4VUBA 1AWOA 3QIIA 1YHQQ 1QVGP 1KSWA 1JB0E 1JO8A 4OGEA 1ZUUA 4FT2A 3A8MB 2VGMA 4A4HA 3I56T 1N27A 2EYWA 4OB0B 4ORZA 4OMOA 1W6XA 2XDBA 1UTIA 1G3WA 4ZTFA 1LJOA 4JUVA 3V7RA 3UDCA 2CS7A 1CKAA 1UUEA 3GLXA 3HFNA 1FMVA 4X9DA 1NE8A 1QVGS 1O9SA 5GAN4 3DKMA 4FW1A 3QXEB 2E4HA 1VQ4T 1KQ2A 4J9IA 2DERA 1N9RA 2RB6A 2LJ1A 4D8DA 2ENMA 1SEMA 2LNHB 2L3RA 2HQHA 1AT1B 5AYFA 2KMTA 1BI2A 3L2ZA 2ZZDA 3HRUA 1KC8U 5KYNA 4OB1B 2A08A 2O9VA 3RIRA 2XG8D 4IURA 2O01E 3QKJA 2M02A 4XU1A 3QPHA 3QHSA 5FU6B 2KXDA 1W1FA 4F14A 1VQNQ 3NMZC 5LJ3g 1OX8A 3VS4A 1UGVA 3JB9F 2JMCA 1YWOA 2DLPA 4MZPA 1PRLC 1GCQA 2FRYA 1EZZB 1H8KA 3I55T 5LJ3h 3M57A 3URGA 2AHJB 4KBMB 2Y4XA 1ABQA 2LX9A 1HSQA 4DOVA 1WGSA 1UJYA 4AFZC 2RJEA 4XQ3A 4J6XA 4NOYA 2DX1A 4N4HA 1VQ6Q 4LN2A 3SFMA 5GANg 2E65A 2EWNA 3JCMc 3DLLA 1VQ8A 1K4US 1VYUA 2R57A 1VQMT 4IUQA 3VS7A 3I56Q 1VA7A 3N5BB 2DXBA 2KQWA 2R58A 2JM9A 4M75G 1NZ9A 3GNFB 2E64A 1NBEB 4M77B 1BIBA 1JJ2P 3JCMX 1TUDA 3PE0A 4ZN3A 4QVZA 2K2MA 1JBMA 4C8QF 2OTJA 1K73R 3I35A 1FYNA 4NS5A 1RACB 1P92A 3M4GA 1UG1A 1AOJA 5DM7R 4C8QA 2DJQA 3JCMW 2V1RA 1M2VA 2L8DA 4KGZB 1W2BA 2X35A 1YCYA 1Q81C 3VS1A 2K3BA 4J9DA 3OW2P 3JB9I 4M7DA 4KUIA 3J81E 5A0LA 1D1CA 1M9SA 3HKSA 4NL2A 2O9SA 3TQ7P 3EH2A 2MWPA 2HZYA 2EGEA 4JPBW 3GP8A 2OJ2A 5HKCA 2CT3A 2D0NA 2P4RA 4GY5A 1A0NB 3EGXB 2DILA 3JB9D 1ACMB 1OPLA 3S6WA 1UECA 3H0IA 1Y96B 2CREA 4OMNA 4C5GA 1ZUYA 3MKDA 1Z9QA 1B34A 3OQ5A 2YHTA 4PNOA 2D1XA 1PD1A 1WQWA 2FB7A 1YNZA 3M54A 3MJXA 2DIGA 2BUDA 2VGNA 4JDSA 4LDYA 9ATCB 3JB9J 4M7AD 3RBBB 1SPKA 2HL3A 4QVDA 3PIOA 3ZFJA 4Y91A 1FXXA 3TU4K 1N8RC 1NYGA 4FYVB 3PT9A 2DYBA 3OYAA 5GAMh 1E7OA 2H3JA 3S3MA 3RKXA 1WXBA 4PJOC 1M3CA 2LQNA 3CCSA 2X9HA 1Q81R 3VYHB 5L23A 1G2BA 4HVUA 4M7DC 1WQ7A 2A7YA 3ZBDA 3QYGB 2M9UA 4OMLA 2KY9A 2P0PA 3V8JA 4KGVB 4M78A 4M7DE 4UC4A 4BACA 1WNLA 2PVOB 1U8RA 5AT1B 3CCVA 3UWNA 2DXCA 2F69A 4C5IA 4NL3A 1WFWA 3CC7Q 1S72Q 3OYYA 1YI2Q 1WJRA 4R56A 5GMKl 2JS0A 3OY9A 1TG0A 4J7IA 1VQMQ 2GQIA 4A4KA 1OZ3A 4E6RA 1YJNT 5FRMA 3CCQA 4PJOD 4IUPA 1WXUA 3CC2T 1SSHA 1V1CA 1Q7YU 1U1SA 4M78G 3CCRA 2JVVA 2DL3A 5LJ3e 1OYXA 4XU3A 4M78B 2DAQA 2JS2A 3SB2A 2KGTA 3CC4Q 1ZHIA 4HCKA 4J9HA 1GFCA 4MZMA 1D1BA 5GAN7 1OPKA 4A4GA 2EQUA 1H3ZA 2D9TA 2DYIA 3VS6A 3QWYA 4E2FB 2F2WA 2KSSA 1JJ2A 2MK5A 2EJGA 2C0IA 5GANd 2KT8A 2ZGWA 3CCET 4QQGA 3CCUQ 1MMNA 1T3SA 2HBWA 1X6BA 3GOXA 1TWBA 5FU6C 1VYTA 1G3SA 2L3PA 4OMQA 4RTZA 4X34A 2VKNA 1VOMA 1TH7A 3KXTA 1RAHB 3CXCS 2E6ZA 2L89A 5IH2A 5HK3A 2KRNA 3FB9A 5GAMg 4ZN1A 2QDLA 3MP8A 4WCIA 1LPLA 4E7ZA 1C6VX 2X4WA 3VV0A 1WLPB 2OTLA 1NYFA 1XOVA 1Y71A 2LVMA 3HTRA 3MCAB 2A37A 3JSCA 1WHMA 5GAOm 2DZ9A 3G4SQ 1KC8C 5LJ5g 3S3OA 5GANf 2AZVA 4GLKA 3V8KA 2V8JA 4E47A 1VQOA 3G7ZA 3QUIA 2VXEA 3EG3A 1VQKA 1GXIE 4C8QC 4KH0B 3RKYA 2DVJA 3VRYA 5I11A 2RI2A 4M7DF 2COYA 1AD5A 1AZGB 5KYWB 2KYBA 1N5ZA 3RDVA 2L3QA 2DRKA 1G3YA 3GBQA 2DPPB 4F16A 2F5KA 4CC4B 1ZUKA 1NEGA 3DLMA 2RHYA 2XKOC 1YI2A 4Z88A 1M2OA 3WVEB 2V26A 1D1AA 3RR6A 4PFOA 1VQ4Q 2DJZA 1Y7XA 1K9MR 3PNWC 1YI2T 2J6OA 3E19A 2CP5A 1Q7YR 5L8RE 5GAN5 3CPWA 2BIVA 2P84A 2WSFE 3SDZA 1QKXA 2VV5A 2RJFA 1PM3A 1R0BG 2DE0X 5I21A 2YT6A 3J7AF 1WHGA 4Y28E 1WI7A 2R5AA 4JJDA 3F70A 1KFZA 3JCMb 1K0XA 4JRQA 4V2SA 4PJLA 1ZSZB 2DBKA 4C92D 2KRMA 4JZ4A 2O2OA 2NLUA 1WHLA 4PJJA 5GANh 1RL2A 2GF7A 4RG2A 1WX6A 4J9BA 5LJ5j 4AMCA 2CGHA 1IB8A 4Z02A 2JM8A 2DETA 2JTFA 1WIEA 2DK3A 2LC4A 4LD6A 1WJQA 2E12A 4EIKA 3OYIA 1MHNA 5GANe 3OBWA 3G4ST 2HL5C 1QCFA 2BTTA 4C8QD 4HCCA 3REBB 2A28A 3OSVA 4C92F 2EQMA 2CH4W 4R55A 1BCMA 2AZSA 2CP3A 1MV0B 4ZGDB 2LJ0A 2EYXA 2EPDA 2MMPA 2DD5A 1CSKA 3I5RA 2RJCA 1KK7A 2HEQA 2QTVA 4JRIA 4OMMA 3O5ZA 2EQJA 5EG2A 2QQBA 4LUEA 2F1LA 1Y96A 1RLPC 1YP5A 1Y0MA 3H0HA 4QT7A 3M0TA 3OW2S 3REAB 3L2RA 2H3EB 4ATOA 2PTKA 3C94A 3CPWS 3O8VA 1JXOA 4QW2A 4AT1B 2DVEA 2WSEE 3M0UA 1RLQC 4X9CA 1B3QA 1XJWB 2EGAA 4M78C 3M4YA 1RABB 1LCKA 2FZCB 3H8ZA 1M8MA 3C95A 3CXCP 3CBOA 4DQ2A 4M75F 1E6HA 1PRMC 1YN8A 1LOJA 2RHXA 3M55A 1YIJQ 3HRTA 2NUPB 4B6MA 5A0GA 2IG0A 2WACA 1VQKT 2RN8A 2JTEA 1HYOA 8AT1B 1M1GA 1M1KR 1ZA1B 2XK0A 2EYYA 2ZPHB 1IZ6A 2C06A 4F17A 4QQ6A 3CMET 1VQLT 1OI1A 2VXFA 4LE9A 3U23A 3E2UA 1JJ2S 5KYWA 4JRKA 4AFSC 1NG2A 4M78D 3EG2A 3ME9A 3TREA 4YTLA 4J9CA 5IHKA 2EW3A 2KT1A 4ANJA 1G3TA 1KJWA 3SHWA 1I81A 1MV3A 4HVWA 3X26B 2MOXA 2NYSA 3CCRT 2RD1A 5GAMf 2ED0A 2E10A 2EQKA 2FHDA 2RI3A 4M77D 2R5MA 2JW4A 1M27C 3CCJA 1FX7A 2K2VA 2OI3A 2F5TX 5FLXE 5GJWB 3GNGA 2DIQA 4N0AA 5CK9A 3UPUA 2YWWA 4AG2C 2K5LA 3G71Q 3CCVQ 1BU1A 4XTZA 4OVAA 1IO6A 3QWXX 2L0AA 2MIOA 5GANj 1VQKQ 2E5QA 2MWOA 5ECAA 5I2SA 4Q5WA 4J6WA 6AT1B 3LGLA 1VQ7Q 1YJ9T 2HQXA 2YLBA 1Z9ZA 5I22A 4XTVA 2FPEA 3LH5A 2BZXA 2QXFA 2VC8A 3CCQT 2D8JA 3CPFA 2DD4A 3CD6A 2CZ7B 2BKDN 4JJNK 4MDXA 4FW2A 4PJMA 1G8XA 3OYMA 1LVKA 5GAN3 4M7AC 3EGXA 3EG0A 3M0QA 2PNIA 1Q82R 4E7JA 5EC7A 1VIFA 3PIPA 4F7UB 1PG5B 3MP6A 1QVPA 3VUBA 2QQSA 1KQSP 2DTIA 1D09B 1OX9A 3EGDB 2ED1A 4PKCC 1NPRA 3OMGA 1D3BA 3CCRQ 2Y90A 1MMAA 1VQ5Q 4M4ZA 1K1ZA 5D6WA 5FRNA 2EYZA 3OYHA 3CEYA 1PSFA 2X4XA 4B9WA 1JQQA 2CUBA 3VS0A 2QAZA
chains in the Genus database with same CATH topology
2OTLQ 3G71Q 1VQ4Q 3CCVQ 1YJNQ 1M90R 1VQ9Q 2QEXQ 3CCEQ 3CD6Q 1K9MR 3CCLQ 3CPWP 1KQSP 1VQ8Q 1K73R 1N8RR 1KD1R 2OTJQ 1YITQ 1YIJQ 2QA4Q 3I55Q 3G6EQ 3I56Q 1W2BP 1QVFP 1VQKQ 1Q7YR 3CMEQ 1YJ9Q 1VQLQ 1VQNQ 1K8AR 3CCJQ 3CCRQ 3G4SQ 3CC7Q 3CCUQ 1VQOQ 1S72Q 1YI2Q 1Q81R 1M1KR 1Q86R 1NJIR 1KC8R 1QVGP 3CCMQ 1VQ5Q 3CC2Q 1JJ2P 3CCSQ 1YJWQ 1Q82R 3CCQQ 3OW2P 3CC4Q 1VQ7Q 1VQMQ 3CMAQ 1YHQQ 3CXCP 1VQPQ 1VQ6Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL Q;  3G71 Q;  1VQ4 Q;  3CCV Q;  1YJN Q;  1M90 R;  1VQ9 Q;  2QEX Q;  3CCE Q;  3CD6 Q;  1K9M R;  3CCL Q;  3CPW P;  1KQS P;  1VQ8 Q;  1K73 R;  1N8R R;  1KD1 R;  2OTJ Q;  1YIT Q;  1YIJ Q;  2QA4 Q;  3I55 Q;  3G6E Q;  3I56 Q;  1W2B P;  1QVF P;  1VQK Q;  1Q7Y R;  3CME Q;  1YJ9 Q;  1VQL Q;  1VQN Q;  1K8A R;  3CCJ Q;  3CCR Q;  3G4S Q;  3CC7 Q;  3CCU Q;  1VQO Q;  1S72 Q;  1YI2 Q;  1Q81 R;  1M1K R;  1Q86 R;  1NJI R;  1KC8 R;  1QVG P;  3CCM Q;  1VQ5 Q;  3CC2 Q;  1JJ2 P;  3CCS Q;  1YJW Q;  1Q82 R;  3CCQ Q;  3OW2 P;  3CC4 Q;  1VQ7 Q;  1VQM Q;  3CMA Q;  1YHQ Q;  3CXC P;  1VQP Q;  1VQ6 Q; 
#chains in the Genus database with same CATH topology
 1M1K U;  3HRS A;  1X69 A;  2A0F B;  5GAN 6;  4M77 C;  5GAM e;  1YIT T;  1W4S A;  3X24 B;  1W70 A;  1M5Q 1;  1RAD B;  3M59 A;  1RAF B;  2DNU A;  4DBQ A;  2BE9 B;  3WXM B;  2FZG B;  3PMI A;  2QA4 T;  4PJO F;  4XTY A;  4HCZ A;  4XTU A;  3VYG A;  1KG1 A;  3EFO A;  5CKE A;  4OMF B;  1WZO A;  5LJ5 e;  3BW1 A;  5I2M A;  1BIA A;  1UGQ B;  5GAO l;  3X20 B;  4E7L A;  2XD0 A;  2F2V A;  3OBY A;  3J80 E;  3L2Q A;  3PVL A;  1NLP C;  1SRM A;  3M5A A;  3L2V A;  4XTW A;  2FL7 A;  3QJY A;  2RI5 A;  4BY6 C;  3OS1 A;  3QG1 A;  1X2Q A;  1PD0 A;  4HXJ A;  3TEE A;  2ZPI B;  2FO0 A;  1HD3 A;  1M1K C;  1OU9 A;  3H0F A;  2NUP A;  1GBQ A;  2KEA A;  2QI2 A;  2RQR A;  5KCO A;  5GMK i;  2E70 A;  1ZBJ A;  1ZBX A;  5FU7 C;  4KUD K;  4FSX A;  4Z8A A;  4R0K A;  2MCN A;  2KR3 A;  3HL8 A;  1QWE A;  1N8R U;  2J6K A;  1VQ7 A;  4EMG A;  2NUZ A;  1NJI R;  3BY7 A;  4TVR A;  3NGP A;  4LDX A;  2CSI A;  4K11 A;  3EFO B;  3CME A;  1VQL A;  1YHQ T;  1AWW A;  2MPX C;  4BI8 B;  3EG9 A;  3I55 A;  5J39 A;  1ZSZ A;  2DL8 A;  1F1B B;  1QQJ A;  2V1Q A;  2QTX A;  3SEM A;  3M58 A;  4LNP A;  4M78 E;  4CC7 A;  3HSB A;  1JRI A;  3CCM A;  1OOT A;  1PKS A;  4N4I A;  2VUB A;  5GAO p;  4C5E A;  1MMD A;  1XQH A;  3OYG A;  2JUF A;  1TU0 B;  3HP9 A;  3ER0 A;  3QZ9 B;  5J3B A;  3VUZ A;  1WXT A;  5DY9 A;  2VYT A;  4CI0 C;  5KYY A;  1GBR A;  1PSE A;  1BYM A;  2K9G A;  1VQ5 A;  5IXF A;  2C0T A;  4O5V A;  5IT9 E;  2E3H A;  5CKF A;  1I5O B;  3UF4 A;  4DA4 A;  3UT1 A;  3I9Q A;  1RI0 A;  4BB7 A;  4PLI A;  2QAS A;  2K5I A;  1WPY A;  2JZ2 A;  5CKD A;  3KUF A;  1SF9 A;  2QEX Q;  3BDL A;  1QCO A;  2XIC A;  5CAI A;  4O6J A;  2CSQ A;  2LQW A;  3HHT B;  1HK9 A;  2CZ6 B;  4BDZ A;  3G1J A;  3OB9 A;  1QCN A;  4EMK B;  3FIF A;  3LW5 E;  1KD1 C;  5GAO r;  1UFF A;  3KBG A;  1N9S A;  2E5K A;  1ZSZ C;  1YIJ A;  1KQS A;  3NTI A;  4Z89 A;  4D6W A;  3BE3 A;  3OYL A;  2LDM A;  4C0D B;  1CKB A;  2KDS A;  1D3B B;  5GMK j;  1SKU B;  1T0J A;  3C12 A;  3JCM P;  1WJS A;  4J83 A;  4HKE A;  1YIT A;  2BZ8 A;  4FL6 A;  2VAS A;  1QMC A;  4JZ3 A;  4RUG A;  2OTJ T;  4C8Q E;  1JU5 C;  5C0M A;  5KYU A;  2HQE A;  1QKW A;  4FSS A;  4AFQ C;  3EAE A;  3TCJ A;  2JJ9 A;  4M7A A;  4IKF A;  1V76 A;  3QJ6 A;  4PJO E;  2I2L A;  2FVU A;  4ZGE B;  1ARK A;  1RI9 A;  3EG1 A;  2GTJ A;  4E7I A;  3CCS T;  1TXQ A;  4KT0 E;  3SWN B;  3TSZ A;  3MO8 A;  1BCO A;  4XTX A;  4LUD A;  1K8A U;  4MML A;  3JAM E;  2ZAE A;  1TSF A;  3RNJ A;  1S1N A;  1SHG A;  1Q86 C;  3CQT A;  3JB9 H;  4M7A E;  4PFZ A;  3ULR B;  3OSS C;  3JCM J;  1SSF A;  2CP7 A;  3EFS A;  3CMA Q;  4OMP A;  5GAM d;  2XHC A;  3FJP A;  4M77 F;  2O31 A;  1DJ7 B;  4LDV A;  2P0K A;  2K3Y A;  2QEX T;  1AVZ C;  3E9G A;  1YFN A;  1UEB A;  3X25 B;  2ESW A;  1AZE A;  2GNC A;  1H92 A;  2AK5 A;  2J7I A;  3RUX A;  4C92 B;  2P4T A;  5DLQ E;  4FYX B;  3R6N A;  1NJI C;  1QLY A;  3VS5 A;  1MNE A;  3CCL Q;  1I8F A;  4RTV A;  2PU9 B;  1TOV A;  4C0Z A;  1VQ6 T;  4C92 C;  3CCJ T;  4L6V 5;  2CP0 A;  2J6F A;  2ZPB B;  3P8B B;  4DEX A;  3CCS Q;  3T9N A;  4IUU A;  2AKL A;  2CZ1 B;  5LJ5 d;  2L2P A;  2HNI A;  4PJO A;  2V8K A;  1ZLM A;  4BI3 A;  2FPD A;  2CUD A;  1UGR B;  2K3X A;  5GAN 8;  1RAG B;  4DBH A;  5FU7 B;  5CVI A;  1BI3 A;  3EGD A;  5IHI A;  4HCB A;  3V8L A;  2OTL T;  2FYK A;  2K79 A;  3HPW A;  4FM4 B;  4M7D B;  4WTO B;  3VJP A;  1KHC A;  1OEB A;  4BUG A;  5LJ5 f;  3RKW A;  3M0P A;  3FJ5 A;  4F7U A;  3TSW A;  2J05 A;  1M2V B;  1D0X A;  1ZSG A;  2COZ A;  2WSC E;  1K0S A;  3JCM g;  3JCM d;  2M51 A;  3S3N A;  3QYH B;  3JCM Q;  2QG9 B;  4PK4 A;  3CXC A;  3QDR B;  1RUW A;  2KI7 A;  3Q1J A;  1VQ5 T;  2EGC A;  2LP5 A;  4DBR A;  1WHK A;  4IUV A;  1PWT A;  3H6Z A;  4A53 A;  1WA7 A;  2AKK A;  2E1H A;  1VQP Q;  1I1J A;  2BZY A;  3L1A A;  2JOY A;  2X3W D;  3FEO A;  1VQO T;  4FYY B;  1PHT A;  1XNI A;  2OTJ Q;  1W2B P;  1S72 A;  2P0Q A;  2RMO A;  1BB9 A;  1WHH A;  2ROL A;  1KD1 U;  2KRS A;  1BBZ A;  3CCL T;  4XU0 A;  2DA9 A;  1X2K A;  2NUT B;  2RNA A;  3L2W A;  5GMK h;  1AHJ B;  2QYZ A;  2CYZ B;  2O4X A;  3D7S B;  3QZ5 B;  5IAY A;  3PMT A;  3MP1 A;  1QWF A;  3WVD B;  2KBT A;  1N8R R;  1C0M A;  1M3A A;  5DLO A;  1YJN A;  1K73 U;  3CME Q;  1VQL Q;  1X43 A;  2RHI A;  1IRX A;  3NHN A;  1T3L A;  2QQR A;  2PUK B;  3DB3 A;  3H9N A;  4M7D D;  1YJW Q;  4EMH A;  3CCU T;  4M75 C;  4L59 A;  2QQA A;  1BI1 A;  4JLI A;  2HSP A;  2IIM A;  4AFU C;  2KVQ G;  2NUT A;  3CCU A;  2LNV A;  2LJ3 A;  1UHC A;  5C6S A;  3OS0 A;  4JLG A;  4PLL A;  5KE3 A;  1I07 A;  3OS5 A;  1UGS B;  5CIU A;  4DOW A;  1M1F A;  5CO7 A;  3OYF A;  2RO0 A;  4J6Y A;  2M0O A;  5GAM j;  4ZTJ A;  2LMJ A;  3TVT A;  4J9G A;  1I5L A;  5LJ5 h;  1U1T A;  5GJV B;  2QGG A;  7AT1 B;  4C92 A;  1VQP A;  2X3X D;  2DMO A;  2W0Z A;  2GBQ A;  1VQN A;  1FWZ A;  2EYQ A;  3JCM h;  2K6D A;  4JRP A;  3JCM V;  3G71 T;  1Q86 U;  3EH1 A;  5CQX A;  1V29 B;  2HSE B;  2RA2 A;  3CC2 Q;  4D8K A;  3RES A;  2HMA A;  1TUG B;  2C0O A;  4OB2 B;  2D6F A;  1MND A;  2LTO A;  2OTL Q;  4J7F A;  4M77 G;  4ZGJ B;  1JEG A;  4OF1 A;  2KYM A;  2ATC B;  1PKT A;  2OX7 A;  5LL6 S;  3PFS A;  2XMF A;  2BE7 D;  4II1 A;  5IHN A;  8ATC B;  5KE2 A;  3OYC A;  1Q95 G;  3OW2 A;  1ZA2 B;  4F7U E;  3A8L B;  4F7U F;  1JXM A;  1W2B S;  3CC7 A;  3G4S A;  2DF6 A;  4EPC A;  3VRZ A;  1UDL A;  5D6X A;  3CD6 Q;  3GIB A;  2G6F X;  4OB3 B;  3NPF A;  3CC7 T;  3I55 Q;  3CCE A;  1X6O A;  3VU3 C;  2XI9 A;  3A8H B;  1GFD A;  5CCA A;  1GRI A;  1NM7 A;  1BI0 A;  2FPF A;  4QQD A;  1C1A A;  2CKK A;  4QVC A;  4E7S A;  3FC3 A;  4FCY A;  2PVD B;  3OYJ A;  4N0A C;  1K8A C;  2RHZ A;  5KYU B;  2G3R A;  3BDU A;  1YJW T;  1VQ4 A;  1QVG A;  4M75 E;  1M3B A;  2JT4 A;  1R8O B;  3CCL A;  5IXB A;  3M0S A;  2VVK A;  2EJF A;  3EHR A;  2F2X A;  3UA7 A;  2YDL A;  1KHI A;  2GQV A;  3QBY A;  1KC8 R;  5D6Y A;  4F7U G;  3LWI A;  1B07 A;  1SRL A;  2RQV A;  4J9F A;  2LQK A;  1G83 A;  2B86 A;  2KRO A;  4E7K A;  2LRQ A;  3A8O B;  3SD4 A;  2KAF A;  4L5G A;  2D8H A;  3M53 A;  1SG5 A;  3INZ A;  4HT8 A;  3LWH A;  2K7A A;  5FW9 A;  3V7S A;  4ELZ C;  4FYW B;  4HA8 A;  2M1H A;  3ZL7 C;  4JS4 A;  1K9M C;  3IQL A;  5GAN 2;  1MMG A;  1PCX A;  1M4Z A;  1K76 A;  3G6E Q;  4A63 B;  5D7U A;  1H64 1;  3MEA A;  2JMA A;  2DXT A;  2GFA A;  5FWB A;  4E7H A;  4FIB A;  2O4X B;  1AEY A;  2W10 A;  1NJI U;  3UAT A;  3JCM f;  2RH2 A;  2CP2 A;  3M9Q A;  2MYS A;  2OAW A;  3MEV A;  2EKH A;  3VKI A;  2H8H A;  1UGP B;  2RHU A;  2PZ1 A;  2RPN A;  1HXD A;  4CRI A;  2DFU A;  2VWF A;  2AIR B;  2EIF A;  2HCK A;  4A4E A;  1EFN A;  3I5S A;  3M0R A;  4XK8 E;  3G71 A;  3A8G B;  2CDT A;  3CCV T;  2SRC A;  1IGQ A;  2YLC A;  2K57 A;  1I0C A;  4ZNX A;  4BE2 A;  3QDF A;  1EIF A;  1BKB A;  2O88 A;  1OQK A;  4OGC A;  4RCB A;  4PJO B;  2YUQ A;  2E6N A;  1YJ9 A;  4M75 A;  5KYX A;  1M30 A;  4P5N A;  1YCS B;  2DZC A;  5M9O A;  2AT1 B;  1LNX A;  1UJ0 A;  3L42 A;  5KCH A;  3CMA T;  4XAX B;  2COW A;  1D0Y A;  2NWM A;  3E9F A;  5LJ3 d;  1X6G A;  3PGG A;  3KFV A;  3CCM Q;  1MGQ A;  4M77 A;  4EMK C;  2RK2 A;  2EKO A;  1S72 T;  3EHQ A;  2YUO A;  1PNJ A;  3RMQ A;  4M7A B;  4BI4 A;  3ZEH A;  3EFR A;  4M75 D;  1ZQ1 A;  3X28 B;  1OV3 A;  2A36 A;  2E41 A;  2DO3 A;  5KH6 A;  2DEQ A;  4C8Q B;  2RQU A;  2YRC A;  2L5Q A;  3MEU A;  4M75 B;  4IIO A;  4QKU A;  1X27 A;  2XDP A;  4RTY A;  5CQY A;  1YIJ T;  1YWP A;  2JNG A;  5GAO q;  3SWN A;  2M0Y A;  4C92 E;  4JS5 A;  1GCQ C;  3LGF A;  3P8H A;  2OAU A;  2SEM A;  5LJ3 f;  4MMK A;  2LZ6 B;  1NEB A;  3JB9 G;  4HVV A;  1YIT Q;  4M77 E;  4J8O A;  3MHX A;  4XU2 A;  2X4J A;  2DRM A;  2IVW A;  3RMS A;  3I56 A;  2EQI A;  2XDD A;  5GAO n;  1U06 A;  1G5V A;  4KH1 B;  2ZPE B;  2PVG B;  5HY6 A;  2XID A;  4RTT A;  1B7T A;  1VIE A;  4F04 B;  3A1P A;  2VB6 A;  1XTD A;  5LJ3 j;  1VQ8 Q;  4C92 G;  4MDW A;  2I0N A;  2CH4 A;  1FMW A;  2DKG A;  2DBM A;  2GCX A;  4BD3 A;  3OYD A;  3LLR A;  1QVF A;  3CCM T;  2L3S A;  1U5S A;  1IHV A;  3C0C A;  2LT1 A;  2ECZ A;  2A3L A;  4BE1 A;  1Y57 A;  4RTU A;  1YHQ A;  2V8I A;  3LH0 A;  2RJD A;  3CPW P;  1VQM A;  2RQT A;  3CC2 A;  1T0H A;  1QP3 A;  1KQ1 A;  3L2U A;  4FT4 A;  3MPU B;  2HDA A;  3AT1 B;  3ASK A;  3V7C A;  4DBF A;  1OU8 A;  2CP6 A;  3H41 A;  3NTK A;  4RMO A;  2YSQ A;  4J5Y A;  1KIK A;  1NPP A;  2B8A A;  2YRD A;  4IIM A;  1Q82 U;  1H3H A;  3OMC A;  4C0D C;  4KUL A;  4BY6 B;  3HFO A;  4C0F A;  2DXU A;  4LD9 K;  1VUB A;  2RM4 A;  1QVF P;  5GMK e;  2ROT A;  1YJ9 Q;  3EG9 B;  1VQ9 T;  2YUP A;  2KXC A;  4RTW A;  2CZ0 B;  5A2Q E;  5FRO A;  1QW1 A;  2J06 A;  1M90 C;  1GCP A;  4ELY C;  2EFI A;  2HKQ B;  2HD0 A;  2LX7 A;  1VQ9 A;  4OP0 A;  1UE9 A;  3BFM A;  3A5Z B;  2FRW A;  4DEY A;  4A4F A;  4LDU A;  1VQ7 T;  4CC3 A;  2KK4 A;  1AWJ A;  2JXB A;  1VQ6 A;  4J9E A;  1YJW A;  1VQ8 T;  1HJD A;  3LX7 A;  3P8D A;  5KYY B;  3OS2 A;  1UB4 A;  1WYX A;  1AWX A;  4PJO G;  5KYX B;  5IN1 A;  1Q82 C;  1OZ2 A;  3JV3 A;  2FEI A;  2FG0 A;  3G6E A;  1TS9 A;  2K5F A;  2DM1 A;  2RF0 A;  4EDU A;  2QQ9 A;  1E6G A;  1MUZ A;  1QP2 A;  4M7A F;  4PFP A;  1K9M U;  2D0Q B;  1M90 U;  3CBM A;  5CR2 A;  2GGR A;  2HAX A;  2DL4 A;  5J26 A;  5CKH A;  4X1V A;  4RKU E;  3E1S A;  2LCC A;  3NTH A;  4WF2 A;  3CD6 T;  2RK1 A;  3JCM e;  2LCS A;  4C5H A;  4ME7 A;  3OA6 A;  2QA4 Q;  3PTA A;  3OYN A;  3CMA A;  1WHJ A;  1K9A A;  2GTO A;  1VQO Q;  2K4Y A;  4AG1 C;  1M8V A;  5HK0 A;  5CKB A;  3CCQ Q;  2DEU A;  3OYK A;  3QSU A;  1Y07 A;  1FMK A;  1ABO A;  3CBP A;  1ZX6 A;  1J3T A;  1X01 A;  2YXY A;  3PVQ A;  3UA6 A;  1RAE B;  1Q81 U;  3R6O A;  2QGF B;  2LQ8 A;  4Y92 A;  1KD1 R;  1X75 C;  1NLO C;  1OUL A;  4RTX A;  1N6A A;  4LXC A;  3AHU A;  2EJ9 A;  2YRV A;  2MAM A;  2QDY B;  5GMK m;  3M56 A;  4PJN A;  1QVF S;  2PUO B;  2EBP A;  1UHF A;  3VS3 A;  1IHW A;  1EX4 A;  2MI6 A;  2DTH A;  1I4K 1;  1KQS S;  2DL5 A;  1R0C B;  1YJN Q;  2EAY A;  2X4Y A;  3CCE Q;  3FLG A;  2JTM A;  2Y4Y A;  1SHF A;  3RER A;  4MZT A;  2E3I A;  3THK A;  1WDX A;  4KRT A;  5FWC A;  1O75 A;  3FRN A;  1VYV A;  1TTH B;  3SWN C;  1IXD A;  4JJC A;  4M7A G;  2HKN A;  4M7D G;  1IGU A;  3NFC A;  3VS2 A;  3LYI A;  1VQN T;  3GF5 A;  4HT9 A;  4FU6 A;  4KGX B;  4N4G A;  1IRE B;  2MF2 A;  2ABL A;  3FDR A;  2LT4 A;  2KNB B;  1VQ9 Q;  1BK2 A;  4C8Q G;  4C0G A;  4GBQ A;  5HCK A;  2KE9 A;  2ZPG B;  2DTO A;  2QEX A;  2QK0 A;  1K8A R;  1VQP T;  3CC4 A;  3DB4 A;  1YBY A;  1Q86 R;  3OYE A;  2GFU A;  5A0D A;  1GL5 A;  2YUN A;  4RCC A;  3JRZ A;  1K73 C;  4ESR A;  3QO3 A;  2RQW A;  4PL6 A;  3CC4 T;  1TUC A;  3MET A;  2ZCF B;  4B9X A;  4LDW A;  1U3O A;  2M16 A;  4BE0 A;  2X51 A;  3CCJ Q;  3A98 A;  2Z0W A;  2FZK B;  3MEW A;  4RG8 A;  1RAA B;  1PC0 A;  1R77 A;  1D0Z A;  2EVR A;  2CT4 A;  1Q7Y C;  4JJB A;  2ZPF B;  2HBP A;  4BDY A;  4M78 F;  3OYB A;  4EMK A;  3EGU A;  4A54 A;  2QA4 A;  1M90 R;  2PQW A;  2IPO B;  3GPL A;  1RAI B;  2LCL A;  4GLM A;  4CC2 A;  3C4S A;  2XU8 A;  4IUT A;  2JN0 A;  1B34 B;  2DL7 A;  3G6E T;  4VUB A;  1AWO A;  3QII A;  1YHQ Q;  1QVG P;  1KSW A;  1JB0 E;  1JO8 A;  4OGE A;  1ZUU A;  4FT2 A;  3A8M B;  2VGM A;  4A4H A;  3I56 T;  1N27 A;  2EYW A;  4OB0 B;  4ORZ A;  4OMO A;  1W6X A;  2XDB A;  1UTI A;  1G3W A;  4ZTF A;  1LJO A;  4JUV A;  3V7R A;  3UDC A;  2CS7 A;  1CKA A;  1UUE A;  3GLX A;  3HFN A;  1FMV A;  4X9D A;  1NE8 A;  1QVG S;  1O9S A;  5GAN 4;  3DKM A;  4FW1 A;  3QXE B;  2E4H A;  1VQ4 T;  1KQ2 A;  4J9I A;  2DER A;  1N9R A;  2RB6 A;  2LJ1 A;  4D8D A;  2ENM A;  1SEM A;  2LNH B;  2L3R A;  2HQH A;  1AT1 B;  5AYF A;  2KMT A;  1BI2 A;  3L2Z A;  2ZZD A;  3HRU A;  1KC8 U;  5KYN A;  4OB1 B;  2A08 A;  2O9V A;  3RIR A;  2XG8 D;  4IUR A;  2O01 E;  3QKJ A;  2M02 A;  4XU1 A;  3QPH A;  3QHS A;  5FU6 B;  2KXD A;  1W1F A;  4F14 A;  1VQN Q;  3NMZ C;  5LJ3 g;  1OX8 A;  3VS4 A;  1UGV A;  3JB9 F;  2JMC A;  1YWO A;  2DLP A;  4MZP A;  1PRL C;  1GCQ A;  2FRY A;  1EZZ B;  1H8K A;  3I55 T;  5LJ3 h;  3M57 A;  3URG A;  2AHJ B;  4KBM B;  2Y4X A;  1ABQ A;  2LX9 A;  1HSQ A;  4DOV A;  1WGS A;  1UJY A;  4AFZ C;  2RJE A;  4XQ3 A;  4J6X A;  4NOY A;  2DX1 A;  4N4H A;  1VQ6 Q;  4LN2 A;  3SFM A;  5GAN g;  2E65 A;  2EWN A;  3JCM c;  3DLL A;  1VQ8 A;  1K4U S;  1VYU A;  2R57 A;  1VQM T;  4IUQ A;  3VS7 A;  3I56 Q;  1VA7 A;  3N5B B;  2DXB A;  2KQW A;  2R58 A;  2JM9 A;  4M75 G;  1NZ9 A;  3GNF B;  2E64 A;  1NBE B;  4M77 B;  1BIB A;  1JJ2 P;  3JCM X;  1TUD A;  3PE0 A;  4ZN3 A;  4QVZ A;  2K2M A;  1JBM A;  4C8Q F;  2OTJ A;  1K73 R;  3I35 A;  1FYN A;  4NS5 A;  1RAC B;  1P92 A;  3M4G A;  1UG1 A;  1AOJ A;  5DM7 R;  4C8Q A;  2DJQ A;  3JCM W;  2V1R A;  1M2V A;  2L8D A;  4KGZ B;  1W2B A;  2X35 A;  1YCY A;  1Q81 C;  3VS1 A;  2K3B A;  4J9D A;  3OW2 P;  3JB9 I;  4M7D A;  4KUI A;  3J81 E;  5A0L A;  1D1C A;  1M9S A;  3HKS A;  4NL2 A;  2O9S A;  3TQ7 P;  3EH2 A;  2MWP A;  2HZY A;  2EGE A;  4JPB W;  3GP8 A;  2OJ2 A;  5HKC A;  2CT3 A;  2D0N A;  2P4R A;  4GY5 A;  1A0N B;  3EGX B;  2DIL A;  3JB9 D;  1ACM B;  1OPL A;  3S6W A;  1UEC A;  3H0I A;  1Y96 B;  2CRE A;  4OMN A;  4C5G A;  1ZUY A;  3MKD A;  1Z9Q A;  1B34 A;  3OQ5 A;  2YHT A;  4PNO A;  2D1X A;  1PD1 A;  1WQW A;  2FB7 A;  1YNZ A;  3M54 A;  3MJX A;  2DIG A;  2BUD A;  2VGN A;  4JDS A;  4LDY A;  9ATC B;  3JB9 J;  4M7A D;  3RBB B;  1SPK A;  2HL3 A;  4QVD A;  3PIO A;  3ZFJ A;  4Y91 A;  1FXX A;  3TU4 K;  1N8R C;  1NYG A;  4FYV B;  3PT9 A;  2DYB A;  3OYA A;  5GAM h;  1E7O A;  2H3J A;  3S3M A;  3RKX A;  1WXB A;  4PJO C;  1M3C A;  2LQN A;  3CCS A;  2X9H A;  1Q81 R;  3VYH B;  5L23 A;  1G2B A;  4HVU A;  4M7D C;  1WQ7 A;  2A7Y A;  3ZBD A;  3QYG B;  2M9U A;  4OML A;  2KY9 A;  2P0P A;  3V8J A;  4KGV B;  4M78 A;  4M7D E;  4UC4 A;  4BAC A;  1WNL A;  2PVO B;  1U8R A;  5AT1 B;  3CCV A;  3UWN A;  2DXC A;  2F69 A;  4C5I A;  4NL3 A;  1WFW A;  3CC7 Q;  1S72 Q;  3OYY A;  1YI2 Q;  1WJR A;  4R56 A;  5GMK l;  2JS0 A;  3OY9 A;  1TG0 A;  4J7I A;  1VQM Q;  2GQI A;  4A4K A;  1OZ3 A;  4E6R A;  1YJN T;  5FRM A;  3CCQ A;  4PJO D;  4IUP A;  1WXU A;  3CC2 T;  1SSH A;  1V1C A;  1Q7Y U;  1U1S A;  4M78 G;  3CCR A;  2JVV A;  2DL3 A;  5LJ3 e;  1OYX A;  4XU3 A;  4M78 B;  2DAQ A;  2JS2 A;  3SB2 A;  2KGT A;  3CC4 Q;  1ZHI A;  4HCK A;  4J9H A;  1GFC A;  4MZM A;  1D1B A;  5GAN 7;  1OPK A;  4A4G A;  2EQU A;  1H3Z A;  2D9T A;  2DYI A;  3VS6 A;  3QWY A;  4E2F B;  2F2W A;  2KSS A;  1JJ2 A;  2MK5 A;  2EJG A;  2C0I A;  5GAN d;  2KT8 A;  2ZGW A;  3CCE T;  4QQG A;  3CCU Q;  1MMN A;  1T3S A;  2HBW A;  1X6B A;  3GOX A;  1TWB A;  5FU6 C;  1VYT A;  1G3S A;  2L3P A;  4OMQ A;  4RTZ A;  4X34 A;  2VKN A;  1VOM A;  1TH7 A;  3KXT A;  1RAH B;  3CXC S;  2E6Z A;  2L89 A;  5IH2 A;  5HK3 A;  2KRN A;  3FB9 A;  5GAM g;  4ZN1 A;  2QDL A;  3MP8 A;  4WCI A;  1LPL A;  4E7Z A;  1C6V X;  2X4W A;  3VV0 A;  1WLP B;  2OTL A;  1NYF A;  1XOV A;  1Y71 A;  2LVM A;  3HTR A;  3MCA B;  2A37 A;  3JSC A;  1WHM A;  5GAO m;  2DZ9 A;  3G4S Q;  1KC8 C;  5LJ5 g;  3S3O A;  5GAN f;  2AZV A;  4GLK A;  3V8K A;  2V8J A;  4E47 A;  1VQO A;  3G7Z A;  3QUI A;  2VXE A;  3EG3 A;  1VQK A;  1GXI E;  4C8Q C;  4KH0 B;  3RKY A;  2DVJ A;  3VRY A;  5I11 A;  2RI2 A;  4M7D F;  2COY A;  1AD5 A;  1AZG B;  5KYW B;  2KYB A;  1N5Z A;  3RDV A;  2L3Q A;  2DRK A;  1G3Y A;  3GBQ A;  2DPP B;  4F16 A;  2F5K A;  4CC4 B;  1ZUK A;  1NEG A;  3DLM A;  2RHY A;  2XKO C;  1YI2 A;  4Z88 A;  1M2O A;  3WVE B;  2V26 A;  1D1A A;  3RR6 A;  4PFO A;  1VQ4 Q;  2DJZ A;  1Y7X A;  1K9M R;  3PNW C;  1YI2 T;  2J6O A;  3E19 A;  2CP5 A;  1Q7Y R;  5L8R E;  5GAN 5;  3CPW A;  2BIV A;  2P84 A;  2WSF E;  3SDZ A;  1QKX A;  2VV5 A;  2RJF A;  1PM3 A;  1R0B G;  2DE0 X;  5I21 A;  2YT6 A;  3J7A F;  1WHG A;  4Y28 E;  1WI7 A;  2R5A A;  4JJD A;  3F70 A;  1KFZ A;  3JCM b;  1K0X A;  4JRQ A;  4V2S A;  4PJL A;  1ZSZ B;  2DBK A;  4C92 D;  2KRM A;  4JZ4 A;  2O2O A;  2NLU A;  1WHL A;  4PJJ A;  5GAN h;  1RL2 A;  2GF7 A;  4RG2 A;  1WX6 A;  4J9B A;  5LJ5 j;  4AMC A;  2CGH A;  1IB8 A;  4Z02 A;  2JM8 A;  2DET A;  2JTF A;  1WIE A;  2DK3 A;  2LC4 A;  4LD6 A;  1WJQ A;  2E12 A;  4EIK A;  3OYI A;  1MHN A;  5GAN e;  3OBW A;  3G4S T;  2HL5 C;  1QCF A;  2BTT A;  4C8Q D;  4HCC A;  3REB B;  2A28 A;  3OSV A;  4C92 F;  2EQM A;  2CH4 W;  4R55 A;  1BCM A;  2AZS A;  2CP3 A;  1MV0 B;  4ZGD B;  2LJ0 A;  2EYX A;  2EPD A;  2MMP A;  2DD5 A;  1CSK A;  3I5R A;  2RJC A;  1KK7 A;  2HEQ A;  2QTV A;  4JRI A;  4OMM A;  3O5Z A;  2EQJ A;  5EG2 A;  2QQB A;  4LUE A;  2F1L A;  1Y96 A;  1RLP C;  1YP5 A;  1Y0M A;  3H0H A;  4QT7 A;  3M0T A;  3OW2 S;  3REA B;  3L2R A;  2H3E B;  4ATO A;  2PTK A;  3C94 A;  3CPW S;  3O8V A;  1JXO A;  4QW2 A;  4AT1 B;  2DVE A;  2WSE E;  3M0U A;  1RLQ C;  4X9C A;  1B3Q A;  1XJW B;  2EGA A;  4M78 C;  3M4Y A;  1RAB B;  1LCK A;  2FZC B;  3H8Z A;  1M8M A;  3C95 A;  3CXC P;  3CBO A;  4DQ2 A;  4M75 F;  1E6H A;  1PRM C;  1YN8 A;  1LOJ A;  2RHX A;  3M55 A;  1YIJ Q;  3HRT A;  2NUP B;  4B6M A;  5A0G A;  2IG0 A;  2WAC A;  1VQK T;  2RN8 A;  2JTE A;  1HYO A;  8AT1 B;  1M1G A;  1M1K R;  1ZA1 B;  2XK0 A;  2EYY A;  2ZPH B;  1IZ6 A;  2C06 A;  4F17 A;  4QQ6 A;  3CME T;  1VQL T;  1OI1 A;  2VXF A;  4LE9 A;  3U23 A;  3E2U A;  1JJ2 S;  5KYW A;  4JRK A;  4AFS C;  1NG2 A;  4M78 D;  3EG2 A;  3ME9 A;  3TRE A;  4YTL A;  4J9C A;  5IHK A;  2EW3 A;  2KT1 A;  4ANJ A;  1G3T A;  1KJW A;  3SHW A;  1I81 A;  1MV3 A;  4HVW A;  3X26 B;  2MOX A;  2NYS A;  3CCR T;  2RD1 A;  5GAM f;  2ED0 A;  2E10 A;  2EQK A;  2FHD A;  2RI3 A;  4M77 D;  2R5M A;  2JW4 A;  1M27 C;  3CCJ A;  1FX7 A;  2K2V A;  2OI3 A;  2F5T X;  5FLX E;  5GJW B;  3GNG A;  2DIQ A;  4N0A A;  5CK9 A;  3UPU A;  2YWW A;  4AG2 C;  2K5L A;  3G71 Q;  3CCV Q;  1BU1 A;  4XTZ A;  4OVA A;  1IO6 A;  3QWX X;  2L0A A;  2MIO A;  5GAN j;  1VQK Q;  2E5Q A;  2MWO A;  5ECA A;  5I2S A;  4Q5W A;  4J6W A;  6AT1 B;  3LGL A;  1VQ7 Q;  1YJ9 T;  2HQX A;  2YLB A;  1Z9Z A;  5I22 A;  4XTV A;  2FPE A;  3LH5 A;  2BZX A;  2QXF A;  2VC8 A;  3CCQ T;  2D8J A;  3CPF A;  2DD4 A;  3CD6 A;  2CZ7 B;  2BKD N;  4JJN K;  4MDX A;  4FW2 A;  4PJM A;  1G8X A;  3OYM A;  1LVK A;  5GAN 3;  4M7A C;  3EGX A;  3EG0 A;  3M0Q A;  2PNI A;  1Q82 R;  4E7J A;  5EC7 A;  1VIF A;  3PIP A;  4F7U B;  1PG5 B;  3MP6 A;  1QVP A;  3VUB A;  2QQS A;  1KQS P;  2DTI A;  1D09 B;  1OX9 A;  3EGD B;  2ED1 A;  4PKC C;  1NPR A;  3OMG A;  1D3B A;  3CCR Q;  2Y90 A;  1MMA A;  1VQ5 Q;  4M4Z A;  1K1Z A;  5D6W A;  5FRN A;  2EYZ A;  3OYH A;  3CEY A;  1PSF A;  2X4X A;  4B9W A;  1JQQ A;  2CUB A;  3VS0 A;  2QAZ A; 
#chains in the Genus database with same CATH homology
 2OTL Q;  3G71 Q;  1VQ4 Q;  3CCV Q;  1YJN Q;  1M90 R;  1VQ9 Q;  2QEX Q;  3CCE Q;  3CD6 Q;  1K9M R;  3CCL Q;  3CPW P;  1KQS P;  1VQ8 Q;  1K73 R;  1N8R R;  1KD1 R;  2OTJ Q;  1YIT Q;  1YIJ Q;  2QA4 Q;  3I55 Q;  3G6E Q;  3I56 Q;  1W2B P;  1QVF P;  1VQK Q;  1Q7Y R;  3CME Q;  1YJ9 Q;  1VQL Q;  1VQN Q;  1K8A R;  3CCJ Q;  3CCR Q;  3G4S Q;  3CC7 Q;  3CCU Q;  1VQO Q;  1S72 Q;  1YI2 Q;  1Q81 R;  1M1K R;  1Q86 R;  1NJI R;  1KC8 R;  1QVG P;  3CCM Q;  1VQ5 Q;  3CC2 Q;  1JJ2 P;  3CCS Q;  1YJW Q;  1Q82 R;  3CCQ Q;  3OW2 P;  3CC4 Q;  1VQ7 Q;  1VQM Q;  3CMA Q;  1YHQ Q;  3CXC P;  1VQP Q;  1VQ6 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...