2F2XA

Alpha-spectrin sh3 domain r21g mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
ELVLALYDYQEKSPGEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain
publication title Cooperative propagation of local stability changes from low-stability and high-stability regions in a SH3 domain
pubmed doi rcsb
source organism Gallus gallus
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2f2xA00
2KE9A 1X2QA 3VS4A 4J9DA 3UF4A 1GL5A 1NYFA 1NLPC 2GGRA 1RLQC 2L3PA 1TUCA 4ESRA 2J6OA 1Z9QA 4CC4B 4M4ZA 3TSWA 2K3BA 4RTUA 1UJYA 1NEBA 2L3SA 4J9CA 3LH5A 1WXBA 1BBZA 2BZYA 3H0FA 2EYXA 2B86A 1KIKA 2KRNA 4LN2A 1E6GA 2DILA 1M3CA 2C0TA 1N5ZA 2JTEA 5IXFA 2P4RA 2CSIA 2RF0A 1NM7A 4J9EA 3VS7A 2L2PA 1KFZA 2FG0A 2PNIA 2D1XA 1GRIA 1E6HA 2D8HA 1ARKA 3EG1A 1WYXA 4RTWA 2NUZA 4E6RA 2RMOA 2EYYA 1W1FA 1WLPB 1SHFA 2KROA 2CUBA 1FYNA 2EW3A 1SRLA 3EGUA 4AFQC 4F14A 4JJDA 1UTIA 2A37A 2OI3A 1K76A 4F16A 2CT4A 1AZGB 2VVKA 2J7IA 1ZUUA 2FRYA 2A08A 2LQWA 1M3BA 2JW4A 2EYZA 2LP5A 4JZ3A 3THKA 3PVLA 1NLOC 1JEGA 2EKHA 4OMLA 4AG1C 1HD3A 2K79A 4JZ4A 1X69A 4LE9A 1OOTA 2E5KA 2KNBB 4RTTA 3PE0A 2OJ2A 1CKBA 2J6KA 1MV3A 1Y57A 1X2KA 1I1JA 2LZ6B 1PRLC 2EGCA 2D0NA 2SRCA 1AWJA 4Z8AA 1AWWA 1ZX6A 1AZEA 1K1ZA 3TVTA 4AFZC 5IH2A 2KXCA 2DRMA 2MOXA 1GBQA 2OAWA 2KR3A 3QWYA 1SPKA 2GQIA 2EGEA 2DL4A 2LCSA 1KSWA 2SEMA 4HVUA 5FWCA 3A98A 3ZL7C 2DRKA 1CKAA 3PVQA 4GLMA 4OMNA 1YNZA 1PKTA 1T3LA 2LJ3A 3U23A 3KFVA 4LNPA 2M0YA 3VS5A 1WXUA 2MCNA 4AFSC 1ZSGA 2ROTA 2ED0A 4OMQA 2O9VA 1UHCA 2O9SA 2F2XA 1XOVA 4OMOA 2C0OA 1QKXA 2PZ1A 2A36A 5FWBA 2AK5A 1Z9ZA 1OEBA 4DEXA 1B3QA 4FSSA 1AWXA 4RTYA 1U06A 1X27A 4WCIA 1M30A 2H8HA 2KRMA 2RNAA 3VRZA 1WFWA 1VYTA 2YT6A 4ZNXA 4CC2A 2MIOA 2YUNA 2ESWA 2AKLA 4JJCA 1ZLMA 1M8MA 1MV0B 4OMMA 1K4US 3RBBB 1OPKA 1QKWA 1RUWA 1YN8A 4JJBA 4J9FA 2KYMA 1I07A 4HVVA 2AZSA 2ECZA 2KBTA 3UATA 2JMAA 1SHGA 3I35A 2LJ1A 2K6DA 1GCQC 2DLPA 2I0NA 2O2OA 1JU5C 2PTKA 1WX6A 2KT8A 2KRSA 2W0ZA 2ROLA 2DVJA 5IHIA 4AFUC 4KRTA 1GBRA 2K7AA 3I5SA 3EHQA 3FJ5A 2CT3A 1AOJA 3VS2A 5L23A 1ZUYA 1AEYA 1UGVA 1U5SA 1RI9A 3RNJA 1BB9A 2VKNA 5IHKA 2XMFA 5GJWB 2DNUA 2J6FA 1UUEA 2J06A 2LX7A 2GTJA 1VYUA 1A0NB 2CDTA 1FMKA 1QWFA 2RQTA 2KEAA 2CUDA 2L3QA 3O5ZA 2RPNA 1MUZA 1ABQA 2RQUA 1UE9A 1TUDA 2YSQA 1H8KA 1X6GA 4GBQA 3H0IA 4HXJA 5I11A 5IXBA 3NMZC 4Z88A 2JT4A 2ENMA 1YCSB 2ED1A 3VS6A 1GFDA 1BU1A 2DX1A 4LUDA 2IIMA 1GCPA 1PHTA 1HSQA 2JM8A 1V1CA 1QLYA 1UG1A 3VS3A 1YWOA 1X43A 1AWOA 5GJVB 4DEYA 3I9QA 2EVRA 1BK2A 2K2MA 2HDAA 3UA6A 2L0AA 1NYGA 1SSHA 1H3HA 5I22A 1AVZC 2VWFA 1T0JA 3SHWA 2A28A 4A63B 1S1NA 2EPDA 2C0IA 1TG0A 1SEMA 2FPDA 2DL8A 3NHNA 2BTTA 2HCKA 1ABOA 1ZBJA 3REBB 4QT7A 2K9GA 2O88A 2DE0X 2DM1A 2EGAA 3VRYA 4D8KA 1OPLA 2F2WA 4J9GA 2YUQA 1G2BA 1U3OA 3R6NA 4HCKA 2DYBA 1UJ0A 4X1VA 1W70A 2FPFA 2V1RA 1VA7A 4CC7A 2GNCA 1X6BA 1YWPA 4ORZA 2FEIA 3M0UA 5IHNA 3SEMA 2RQWA 4RTXA 3NGPA 4Y92A 4R0KA 1PNJA 2O31A 1KJWA 1UHFA 3M0PA 5ECAA 2JMCA 2YUPA 1T0HA 2HSPA 2CH4W 3H41A 2JS0A 4HVWA 2DL3A 1EFNA 1AD5A 2FPEA 2EYWA 1M27C 2RQRA 2JS2A 3NPFA 1QWEA 2QDLA 2CREA 1G83A 2FRWA 3H0HA 1SRMA 2DA9A 3EHRA 1VYVA 4LUEA 2LJ0A 5FW9A 3IQLA 4CC3A 2DMOA 3JV3A 1PKSA 1UDLA 2NWMA 1IO6A 1W6XA 4JPBW 3REAB 1J3TA 1B07A 1Y0MA 2BZ8A 3EG0A 3I5RA 2EQIA 1JXOA 3ULRB 1ZUKA 1T3SA 3M0QA 1JQQA 3EG2A 2D8JA 2FO0A 2KYBA 3VS1A 2X3XD 4RTVA 1YP5A 4J9BA 4K11A 2CSQA 4IIOA 1PRMC 2HEQA 1LCKA 1QCFA 2G6FX 2HBWA 2BZXA 1WI7A 1K0SA 2EBPA 1K9AA 2F2VA 2DL5A 3C0CA 3M0TA 2KXDA 2V1QA 2RQVA 5EC7A 2M51A 4AG2C 2CH4A 3UA7A 1JXMA 2DL7A 1UECA 2LMJA 1GFCA 1NG2A 4J9IA 1H92A 1PWTA 2YDLA 3VS0A 2GTOA 1E7OA 1UFFA 2DBKA 3GBQA 2JM9A 2GBQA 2LQNA 4IIMA 3M0SA 1JO8A 3QWXX 1WIEA 5HCKA 4RTZA 1M3AA 1OV3A 2DJQA 2RN8A 2ABLA 3EG3A 4Z89A 2DBMA 2X3WD 2DF6A 4F17A 2W10A 2LNHB 1HJDA 2KT1A 2J05A 1CSKA 4EIKA 4RUGA 4J9HA 3TSZA 1NEGA 1K0XA 2KGTA 1WXTA 4OMPA 3CQTA 4D8DA 3M0RA 2JXBA 1WDXA 2AZVA 1GCQA 1WA7A 2AKKA 1I0CA 1RLPC 2YUOA
chains in the Genus database with same CATH superfamily
1R0BG 3OYHA 1D1CA 4HCCA 3CCJA 3VJPA 1YFNA 2L3PA 2J6OA 2QI2A 2XD0A 3P8BB 3TSWA 1VQNA 2K3BA 3OA6A 1UGRB 1XTDA 5FU7B 2EJGA 2R5MA 2I2LA 2DVEA 3CCQA 1M1FA 2EYXA 1Q81C 1KIKA 2HQEA 2KRNA 3CCUT 4MDXA 4DBFA 3CC2A 3E1SA 3JB9H 3EAEA 2P4RA 1NM7A 4WTOB 3VS7A 3OYCA 4C92B 2L8DA 2D1XA 4ATOA 1GRIA 2COYA 1ARKA 3P8DA 2X51A 2RA2A 3OS1A 2K57A 1S72Q 5DLOA 2EYYA 3EG9A 1SHFA 2KROA 2CUBA 3G4SA 1FYNA 2X4XA 4C8QA 5I21A 2DXTA 3KUFA 1W2BP 3QPHA 4L6V5 4F16A 4XU3A 2CT4A 1K73U 2VVKA 1ZUUA 1I4K1 2FRYA 2A08A 2LQWA 3S6WA 1M3BA 2LP5A 3NFCA 3PMTA 4JZ3A 4M7AD 4NS5A 3QJ6A 3VV0A 2X35A 4AG1C 2V8KA 1X69A 1OOTA 4RTTA 1VQ4Q 5HY6A 3S3MA 3BFMA 4FW2A 2P4TA 1K9MC 4BDYA 2XHCA 3G4ST 4BUGA 3M9QA 3CXCS 2LZ6B 1IREB 3L1AA 2RI5A 1QVFP 5LJ5j 5GANd 1UGQB 2CP7A 1VUBA 3CCST 4OGEA 4C8QF 3CD6Q 3TVTA 2MWPA 3CBMA 4AFZC 3JCMJ 4Z02A 2KXCA 3V7CA 2OAWA 2CP3A 2VASA 4L5GA 4J5YA 3HRUA 2SEMA 1TU0B 3M5AA 3CPWP 1KC8U 3I55A 3M53A 2DRKA 2EQUA 3HSBA 5CQYA 1N6AA 1VQ6Q 3PVQA 5CIUA 2WSEE 2LJ3A 3LWIA 2E6ZA 4E7KA 3VS5A 2HD0A 2EFIA 3TQ7P 4OMQA 2O9VA 1UHCA 2O9SA 4EPCA 1VQOA 3DB3A 4X34A 4PJMA 2C0OA 4LD6A 3X28B 3I55T 5CAIA 4JUVA 5FWBA 3OYGA 2RH2A 2MWOA 1WHJA 3JCMX 1B3QA 3LWHA 1YJNA 1U06A 5DY9A 1NE8A 4BD3A 1M90U 4NL3A 2KRMA 2L5QA 3BE3A 5GANe 1YI2T 1D1BA 4LDWA 4FT4A 1DJ7B 1G3SA 3LYIA 4HCBA 1IHWA 4OMMA 1X01A 4E7HA 5CO7A 1RUWA 1YN8A 5GAMd 4M7AC 1RAAB 2CYZB 1I07A 3A8HB 4HVVA 4RKUE 2AZSA 1YJ9A 3AHUA 1KQ1A 1GCQC 1TOVA 2K6DA 4EMKA 2R5AA 1UEBA 1VQ5Q 2ZZDA 1R0CB 2EKOA 2KT8A 3X20B 2ROLA 3RIRA 4XU1A 4KRTA 2K7AA 1WHHA 2M1HA 2CT3A 4ELZC 3N5BB 4XTXA 4PJLA 1WZOA 3RNJA 5IHKA 2J6FA 4XQ3A 3EFOB 5GAN5 2GFAA 1YJWA 4JS5A 1VQ7A 3O5ZA 2QGFB 4LDYA 2RQUA 3H0IA 2CZ7B 2DIGA 3NMZC 1QCNA 2XDPA 2JT4A 5KCOA 2QGGA 2D0QB 3MP6A 1YCSB 1UGSB 2O4XB 3VS6A 1MMGA 1BU1A 4LUDA 2IIMA 3DLLA 2RHYA 1VQMQ 2RJDA 2OX7A 3CBOA 5GAMe 1X43A 5GJVB 3BW1A 4DEYA 3I9QA 1YJWT 1OX8A 3ZEHA 1WHLA 3J81E 5C6SA 1ZA1B 4OF1A 4M75D 1NYGA 2EQJA 1T0JA 3QXEB 4Y28E 5FU6B 1S1NA 3FIFA 4A4HA 2EPDA 4C8QD 1W2BS 3CCLQ 2DL8A 3NHNA 4ZGDB 3REBB 2DE0X 2DTIA 5KYYB 2YRCA 1Y07A 2E3HA 1OPLA 1S72T 2VGNA 4J9GA 5GAN2 3OY9A 1WQWA 1RAHB 1VA7A 2GNCA 4R55A 3M0UA 2M9UA 4E7LA 4Y92A 3NGPA 4ZGEB 1M8VA 2FZCB 4C0DB 4R0KA 1PNJA 3A8OB 2AIRB 1D1AA 3OYKA 2FL7A 4Q5WA 2CH4W 2JS0A 2EJFA 1WPYA 1RACB 1OZ3A 2AT1B 3H0HA 2FRWA 4HT9A 3VU3C 2LJ0A 2XI9A 5KE2A 1B07A 2PUKB 1Y0MA 2L89A 5KYNA 1VQ6A 1Q7YR 3AT1B 1KQSS 2X4JA 3PFSA 3JCMW 1OYXA 3EG2A 2F5KA 4KGXB 3L2VA 2KYBA 1LNXA 3CD6T 4M78B 4K11A 4IIOA 1TSFA 2K4YA 1PRMC 4A53A 4E7SA 2HBWA 2E4HA 2KMTA 1SSFA 1K0SA 3WVEB 2F2VA 1R8OB 1XQHA 4PKCC 1N8RU 1JXMA 2HKQB 1FX7A 1VQ6T 2R57A 1KQ2A 3NTIA 2X4WA 1E7OA 2K5FA 2DBKA 3GBQA 2K3XA 4B9WA 4M75C 2JM9A 9ATCB 1Q86R 2LQNA 4N0AC 1OULA 4IIMA 2PVDB 4C8QC 4LDVA 3QWXX 4CI0C 3V7RA 5HCKA 4RTZA 4X9DA 2RN8A 2CZ1B 5FLXE 1TTHB 3J80E 2BE7D 4MMKA 4X9CA 5CKFA 1KC8C 5CVIA 2RM4A 2KAFA 4RUGA 3VUBA 1NEGA 3CCVA 2QQRA 2JTFA 4FU6A 1B34A 2KGTA 1WXTA 3LGFA 4QVDA 2XK0A 3URGA 1D3BA 3OBWA 1VQ5A 2RHZA 1MMNA 1GCQA 2AZVA 2AKKA 3C12A 2KE9A 1X2QA 1U8RA 3VS4A 1Q7YU 3OBYA 3QIIA 5A2QE 2WSCE 3CC4Q 3OW2A 4EMKB 1NLPC 1K8AC 4ESRA 1TUCA 3EH1A 1Z9QA 4CC4B 2QQ9A 4RTUA 3C95A 2BIVA 4J9CA 3CCVT 3CMEQ 2IG0A 1BBZA 4QW2A 4N4IA 3H0FA 2B86A 5LJ3d 1VQ5T 2K5IA 2K5LA 1M90C 2DXCA 4C5HA 4L59A 1N5ZA 5IXFA 2RF0A 2OTLA 3HHTB 3JB9F 2L2PA 3H9NA 3RKWA 3JCMQ 1E6HA 1OU8A 3EG1A 2YWWA 1WYXA 4RTWA 4C5EA 4O6JA 4OB0B 7AT1B 2QQAA 1VQ9Q 1VIFA 2EW3A 3HKSA 3RUXA 3V7SA 2DETA 4PLLA 4DBRA 4BE1A 1UTIA 2A37A 1K76A 5IT9E 1M1GA 2P0PA 5D6YA 2J7IA 4XTUA 2OTLT 2EYZA 3THKA 2PUOB 1JEGA 1WNLA 1KD1R 4JDSA 2K79A 1JJ2A 4LE9A 1R77A 2KNBB 1VQMT 4AMCA 2OJ2A 2J6KA 2QA4A 2QASA 4FYWB 3MEAA 2EGCA 2VV5A 1N27A 2D0NA 3E9GA 5J26A 2RD1A 1NJIU 3QYGB 1SF9A 3QJYA 5DM7R 1K1ZA 3EGXA 3RMQA 4E2FB 2DRMA 2V26A 4M75E 3G6EQ 1GBQA 2IPOB 4EMHA 3CCLT 3L2RA 1U1TA 2DL4A 2CZ0B 1SG5A 2LCSA 3MEVA 5FWCA 2QA4T 1CKAA 4C5GA 3MCAB 3OYBA 3CCRQ 4DQ2A 4IUVA 1FMVA 5J39A 1T3LA 4XTWA 4MMLA 1I5LA 3CCUA 2FZKB 2CS7A 3L42A 2LQKA 4PJOG 1N9RA 2DKGA 3NTKA 3JCMb 4M7DG 3OS0A 2F2XA 1XOVA 1VQKQ 5GMKh 4ELYC 2XU8A 4C5IA 1QKXA 1V29B 2PZ1A 5GAN4 4QVZA 4XU2A 2A36A 2AK5A 3H8ZA 5KYXB 2E3IA 1M4ZA 4IUUA 1Z9ZA 1BIAA 1QCOA 1OEBA 4P5NA 2KSSA 4FSSA 4ME7A 2JVVA 4WCIA 1BI0A 2DK3A 3CXCA 4F04B 2RNAA 4F7UG 2VC8A 3OSSC 3VRZA 1VYTA 1YITQ 1Y96B 1QVGS 4M77C 2ESWA 2AKLA 3E19A 4JJCA 2HQXA 1ZLMA 2WACA 1QP3A 1ZSZA 1M8MA 4II1A 4RCCA 1QKWA 4JJBA 5D7UA 4M75A 3SD4A 3GLXA 4N0AA 2ECZA 2KBTA 1PD0A 4QQ6A 3CMAQ 3I35A 4OVAA 1G3WA 2DLPA 5LJ5g 2JJ9A 2ATCB 2O2OA 4N4HA 3CCSA 5KYUB 2EWNA 4C0ZA 1H3ZA 2PTKA 3X24B 1WX6A 2KRSA 1M2VB 1OU9A 1GBRA 5CQXA 3I5SA 1NPPA 3FJ5A 2P0QA 1VQ8A 5L23A 1ZUYA 3JB9D 1BCOA 4M7AB 1BB9A 2DNUA 4M75F 2OAUA 2GTJA 3INZA 3CCMQ 4FCYA 4DA4A 1QWFA 2RQTA 2CUDA 3EH2A 2RPNA 4FYXB 3G71A 3BY7A 2DZ9A 1N8RC 4GBQA 3ASKA 4HXJA 3BDUA 4GY5A 1TH7A 1EZZB 2X9HA 2A3LA 1VQ8T 4C92G 1KHIA 2LC4A 3JSCA 1UG1A 1YWOA 3CC4T 1AWOA 1P92A 3SWNB 3RESA 1ZA2B 2ZPEB 3FRNA 2K2MA 4IURA 2DPPB 2NUTB 3G71T 3UA6A 2ZPFB 5GMKi 1YI2A 5FU7C 4DBHA 3E2UA 2C06A 4A63B 1NZ9A 3M55A 1TG0A 3M4GA 2OTJQ 4BI4A 2E12A 3QDRB 5AT1B 2DM1A 4BE2A 2FYKA 1QP2A 3OYAA 3CC7Q 1U3OA 3HTRA 1VQ9T 4HCKA 2DYBA 4X1VA 1W70A 4BY6C 2CP2A 3M59A 2RQWA 3M58A 1OZ2A 1BCMA 2O31A 4M77E 3HRTA 1T0HA 2LNVA 4HVWA 1VQLQ 3ZFJA 1AD5A 3WXMB 1M27C 3OMCA 3RDVA 2JS2A 3NPFA 2KK4A 2QDLA 1FWZA 1M1KR 2DA9A 1VYVA 1MMAA 2Y90A 4CC3A 1WHKA 4XTVA 4JPBW 3REAB 1J3TA 2BZ8A 3EG0A 2NUPB 4BE0A 4B9XA 2EQIA 5CKBA 3ULRB 2VUBA 1JBMA 3M0QA 2FO0A 3TCJA 3VS1A 2X3XD 3PNWC 4RTVA 1YP5A 4J9BA 5GANj 1Y7XA 2E70A 1Q82C 3OS2A 2HL3A 2BZXA 1HK9A 1WI7A 1W2BA 1FMWA 1IZ6A 3JCMc 3G1JA 3PTAA 1Q81R 1K9AA 2DL5A 2KXDA 4J7IA 2V1QA 3VKIA 2RQVA 2YRDA 2M51A 4AG2C 4OB1B 1D0ZA 2ZPGB 2LMJA 5CKDA 2XDBA 1O75A 2HQHA 2DIQA 3UPUA 3KXTA 5KH6A 1H92A 1WHMA 4XAXB 2YDLA 1LJOA 3MHXA 1H641 4ZTFA 2GBQA 3QHSA 1NJIC 3GP8A 3M0SA 1JO8A 2HZYA 1VQKT 1PSFA 4M77A 4PJOA 1OV3A 2DJQA 4CRIA 2ABLA 1O9SA 4Z89A 1S72A 4M7DA 4FM4B 2FVUA 2X3WD 2DF6A 2W10A 3A8GB 3TREA 3EGDA 1RAFB 2EAYA 4KBMB 2J05A 1D0XA 1CSKA 3A8MB 3TU4K 3MPUB 3JB9I 1K9MR 4OMPA 3CQTA 1YITT 5GAMg 3I56Q 1M1KU 3M54A 3ME9A 2QQSA 3M0RA 3EG9B 4IUTA 2DFUA 1KQSA 2JXBA 3RMSA 1WDXA 2DZCA 1X75C 4ANJA 3VYGA 2E65A 4RG8A 4F7UA 4BDZA 3OW2P 4C8QB 4HCZA 3QKJA 1VQ4A 5CKHA 4O5VA 1GL5A 1PCXA 2GGRA 1RLQC 3GPLA 1BYMA 4KUDK 4M77F 4Y91A 2QEXQ 3Q1JA 1YHQQ 1IXDA 3R6OA 4B6MA 1NEBA 1QVFS 1JB0E 4AT1B 1BIBA 4PFOA 5GAMj 4XK8E 4A4EA 5LJ5h 1WJQA 1WXBA 1Q81U 2BZYA 5GMKe 3CD6A 3RERA 4A4GA 3FDRA 4RG2A 2C0TA 3OB9A 2CSIA 2PQWA 3PIPA 1VQ4T 1KFZA 3CPWS 2D8HA 4UC4A 2QG9B 2NUZA 4E6RA 2RMOA 1MNEA 1NPRA 2E5QA 2JNGA 1SRLA 3A5ZB 3CCMT 3LW5E 4LD9K 4F14A 4JJDA 4J8OA 3SDZA 1K73C 4FIBA 1PM3A 2ZAEA 2JW4A 4JJNK 3G7ZA 1NLOC 2EKHA 8ATCB 4JZ4A 3E9FA 1K9MU 3O8VA 2HSEB 1MGQA 1ZHIA 3PE0A 2DTHA 1CKBA 3CCJQ 5LJ5f 1ZSZC 1Y57A 1I1JA 2VGMA 3QDFA 1VQNQ 2DTOA 2SRCA 1AWJA 4C92A 2HMAA 1AWWA 4FT2A 1HYOA 1KG1A 3C94A 3CCQQ 1LPLA 1QQJA 5IH2A 2FHDA 5FU6C 2E6NA 2OTJT 4FSXA 3CC2Q 3OYYA 3QWYA 2RK2A 2EGEA 2L3RA 3CCEQ 2MAMA 1MNDA 3UDCA 3CBPA 4GLMA 3G4SQ 4OMNA 1YNZA 4MZMA 3KFVA 2DD4A 4JLGA 4RCBA 3META 1WXUA 4KUIA 2M16A 3A1PA 1VQPQ 3JCMg 4OMOA 4M78G 1OX9A 2EJ9A 1VQLT 1IGUA 2RK1A 2NYSA 4D6WA 1RAIB 4DEXA 3CXCP 5CCAA 4RTYA 2KY9A 1B7TA 2H8HA 4DOWA 1UGPB 2F69A 3FC3A 2E1HA 1WFWA 2YT6A 1WHGA 4ZNXA 3V8LA 2JUFA 1HXDA 1KK7A 2A0FB 1PSEA 2BUDA 3MJXA 1G3TA 2AHJB 1FXXA 3RBBB 1VQMA 4KGZB 4A54A 4YTLA 1Q86U 4BB7A 1RAGB 3I55Q 4KH0B 2A7YA 4N4GA 2VXFA 4M77D 4PJOD 3UATA 3LH0A 2JMAA 4M7DD 2Z0WA 5HKCA 2F5TX 1JU5C 3OYEA 4KH1B 5C0MA 3CCLA 2DVJA 2G3RA 1BI1A 1VQOQ 3H6ZA 4AFUC 3EHQA 5LL6S 1AOJA 5CK9A 3VS2A 1AEYA 1UGVA 1U5SA 1RI9A 2E41A 3EFRA 2XMFA 5GJWB 2ZPIB 2J06A 1YJNQ 1A0NB 3V8KA 3NTHA 1FMKA 2Y4XA 4FYYB 8AT1B 2HL5C 1YHQA 2YXYA 1ABQA 2YSQA 2HKNA 3VYHB 3PIOA 5I11A 4Z88A 3DKMA 5GAMh 3I56T 2ED1A 4MZTA 1GFDA 3MEWA 1QVGA 3OYIA 5LJ5d 2JM8A 2VYTA 1TWBA 3VS3A 2E10A 5KYWA 3PMIA 5LJ3g 2QEXT 2JTMA 4E7ZA 2CZ6B 1YHQT 4QVCA 5GAN8 1YJ9Q 2L0AA 2CKKA 4PJJA 4NOYA 5IN1A 3SHWA 5I22A 2A28A 2R58A 2QK0A 3LGLA 2C0IA 3EFOA 3V8JA 4R56A 3JAME 4WF2A 3OYLA 1ABOA 4JRKA 4PNOA 1AT1B 2RJCA 5I2MA 3C4SA 5LJ3j 3VRYA 4D8KA 3GF5A 1LVKA 2F2WA 2YLBA 3EFSA 3GIBA 1KD1U 2MYSA 2O4XA 3R6NA 1I81A 1UJ0A 2EQKA 2FPFA 2V1RA 5GAMf 1YJWQ 4CC7A 1X6BA 1YWPA 4ORZA 2FEIA 5IHNA 4E7IA 1VQ7Q 4PJOC 1BKBA 2JOYA 4M7DC 2K2VA 4RTXA 4PFPA 2GQVA 4C92D 1KJWA 1UHFA 3M0PA 2O01E 1KC8R 2PVGB 2YUPA 5KCHA 4PJNA 2HSPA 3H41A 2DL3A 1EFNA 3DB4A 4XTYA 4M78E 2EYWA 3PT9A 1VOMA 2CREA 3MKDA 5GAN3 4EDUA 1G83A 1QW1A 2EYQA 2RHIA 1BI3A 1SRMA 3CCEA 5LJ5e 2RI3A 5FW9A 3IQLA 3CCJT 2DMOA 1PKSA 1UDLA 2NWMA 1W6XA 2QYZA 2FZGB 1VQNT 1NBEB 3I5RA 4BY6B 3LX7A 4J6WA 1K8AR 5KYYA 2ZPHB 4DOVA 1T3SA 1OQKA 3CCQT 1M5Q1 3HPWA 4BI8B 2IVWA 3WVDB 1XNIA 3CC2T 1Q95G 1VQPA 4BI3A 3M56A 2ZPBB 4OGCA 3CCET 3J7AF 1B34B 3CC4A 3C0CA 4FL6A 1M90R 5EC7A 3RR6A 1D3BB 2CH4A 3QBYA 2DL7A 4HA8A 1UECA 1G3YA 2YRVA 4A4FA 3CMEA 4JRPA 2F1LA 1RI0A 4J9IA 1C1AA 3SFMA 1IRXA 1PWTA 1IHVA 2GTOA 1F1BB 1UFFA 2KQWA 2YLCA 5L8RE 3JRZA 1VQPT 3JCMh 5CKEA 1W4SA 1WIEA 1JRIA 2JN0A 3QYHB 3OYMA 2NLUA 4E47A 1VQ9A 2QXFA 4M78A 5D6WA 3CMET 3OQ5A 2KT1A 1VIEA 4HT8A 3HFNA 1KQSP 4EMGA 3QSUA 2LCCA 1K0XA 3KBGA 4J6XA 4A4KA 5AYFA 3L2UA 1WA7A 4C92C 2V8JA 1HJDA 3QZ9B 5A0GA 1TUGB 4E7JA 1Q7YC 4J9DA 1K8AU 3UF4A 1NYFA 4M7AG 4M4ZA 2BKDN 1UJYA 2L3SA 4MZPA 1U1SA 4TVRA 4M78F 1IGQA 2COWA 3LH5A 2D6FA 3M4YA 5GMKm 3JCMf 4PJOE 3JB9G 4M7DE 4PL6A 2RB6A 4LN2A 1E6GA 5GAOq 3G6EA 4FYVB 2DILA 1M3CA 2JTEA 5GANg 3PGGA 1VQOT 4J9EA 3CEYA 2XG8D 2FG0A 2PNIA 2VB6A 2MI6A 4QKUA 3X25B 4ZTJA 3EGXB 1W1FA 1WLPB 2RHUA 3CCRA 3A8LB 2CGHA 2DO3A 1Q86C 3EGUA 1YJNT 4F7UE 4AFQC 2MMPA 3CCVQ 2OI3A 3OYJA 1RAEB 1AZGB 2PU9B 3G6ET 3OYDA 1VQKA 3PVLA 5KYWB 4LDXA 1MHNA 4OMLA 1WJSA 3QO3A 3SB2A 2VXEA 5DLQE 1HD3A 2E5KA 3CCRT 1MV3A 1X2KA 2P84A 3T9NA 3CPFA 2XICA 1PRLC 5LJ3h 3SWNC 4DBQA 1PG5B 4Z8AA 2DD5A 1ZX6A 1YITA 1YJ9T 3GOXA 1AZEA 2P0KA 1WJRA 5D6XA 1QVFA 3OSVA 2MOXA 3RKYA 3HL8A 5M9OA 1WQ7A 2KR3A 4JS4A 1SPKA 2GQIA 2OTLQ 2LX9A 1KSWA 2DAQA 2RI2A 4HVUA 2XDDA 1QVPA 2WSFE 2YHTA 3A98A 3ZL7C 5GMKl 2DJZA 1C6VX 5GAOr 2EIFA 3CMAA 3CPWA 1ZSZB 4V2SA 1PKTA 3U23A 2CP5A 4OB2B 5HK3A 1BI2A 4LNPA 2M0YA 4GLKA 1VQ7T 1RABB 4M75B 5HK0A 3OYFA 2MCNA 4J6YA 4AFSC 1ZSGA 4KT0E 4XU0A 2ROTA 2ED0A 2BE9B 2KVQG 2QQBA 5A0LA 3QUIA 1EIFA 1N8RR 2E64A 4C92E 5KE3A 4PJOF 2GCXA 4JRQA 2ZCFB 4M7DF 5LJ3f 2PVOB 3OS5A 3CMAT 2QA4Q 3CCMA 1YIJQ 2QTVA 1AWXA 4PLIA 1X6OA 1X27A 1M30A 3ER0A 1RADB 1M9SA 4ZN1A 2QAZA 1ZQ1A 1KD1C 4LDUA 4CC2A 2MIOA 4MDWA 2YUNA 2QTXA 3D7SB 4KGVB 3FEOA 4F7UF 1MV0B 2DXBA 1I8FA 2H3JA 2LQ8A 1K4US 2H3EB 4J7FA 1OPKA 2JZ2A 5FRNA 1IB8A 2DYIA 4J9FA 1SKUB 2FB7A 2KYMA 3HFOA 1MMDA 6AT1B 1LOJA 1SHGA 4M7AE 2M0OA 3JCMd 2LJ1A 2I0NA 4M78D 3F70A 1JJ2P 3CCUQ 2DEQA 5KYXA 2COZA 2W0ZA 3FLGA 2OTJA 5IHIA 1ZBXA 3HP9A 5GMKj 1Y71A 3GNFB 4M75G 1D09B 5FROA 2ZGWA 4C8QG 2DEUA 1Y96A 2GF7A 4XTZA 2VKNA 1TS9A 3FJPA 3GNGA 3CC7A 1GXIE 1UUEA 2LX7A 1QMCA 1VYUA 2XIDA 1PC0A 2CDTA 3M57A 2D9TA 2KEAA 2L3QA 3P8HA 1MUZA 1UE9A 1TUDA 1H8KA 1X6GA 1YBYA 1RL2A 2CP6A 5IXBA 1QVGP 1M2OA 2ENMA 4ZN3A 5GAN6 2DX1A 1VQLA 3VUZA 5CR2A 1GCPA 1PHTA 5KYUA 1HSQA 4HKEA 1V1CA 1QLYA 3CC7T 2XKOC 5J3BA 2RJFA 1M2VA 1Q82R 3JB9J 2EVRA 1BK2A 3S3OA 4C92F 2MPXC 2HDAA 5I2SA 3S3NA 1N9SA 3CCSQ 3UWNA 1SSHA 4C0DC 1I5OB 1AVZC 2VWFA 3JCMe 4M7AA 1H3HA 1ACMB 1KHCA 5GAOm 2DERA 1SEMA 2FPDA 2B8AA 3MP8A 3TEEA 2BTTA 2HCKA 3OMGA 1ZBJA 5GANh 1G8XA 4JLIA 4QT7A 3FB9A 2K9GA 1VQ8Q 2O88A 3MEUA 2EGAA 1NJIR 2LRQA 1D0YA 1V76A 2CP0A 2YUQA 1G2BA 4ZGJB 3LLRA 4FW1A 4NL2A 4RMOA 3G71Q 3SEMA 3MP1A 2HNIA 4M78C 5GAOp 3SWNA 4OB3B 4M7AF 5ECAA 1AHJB 2JMCA 2NUTA 3DLMA 4C0FA 2FPEA 3X26B 2RQRA 1G5VA 1QWEA 1OI1A 3EHRA 4LUEA 3JV3A 2LTOA 1IO6A 3ZBDA 2LDMA 2LT4A 2V8IA 4IKFA 1EX4A 4M77B 1JXOA 1YI2Q 4PJOB 5GAOn 1ZUKA 4LXCA 5GANf 4M7DB 3I56A 1JQQA 2D8JA 2GFUA 2Y4YA 2CSQA 1C0MA 2EQMA 1Q82U 3EGDB 3L2QA 4PFZA 2HEQA 1LCKA 3OW2S 1QCFA 4VUBA 2G6FX 3HRSA 3BDLA 4OP0A 2HBPA 2EBPA 3JCMV 2HAXA 3OYNA 3M0TA 4QQGA 2QEXA 2DXUA 3UA7A 2RHXA 5GAOl 4PK4A 1GFCA 1NG2A 4C0GA 4F7UB 3QZ5B 1UB4A 2M02A 1YIJA 3UT1A 1XJWB 2QDYB 3VS0A 2KDSA 3MO8A 2RJEA 3JCMP 2MK5A 3RKXA 4IUQA 2K3YA 2KI7A 5GAN7 2X4YA 2NUPA 4QQDA 2LT1A 4EMKC 5EG2A 4IUPA 1M3AA 1PD1A 3EG3A 5LJ3e 2LCLA 2DBMA 5IAYA 3L2WA 1K73R 4C8QE 4F17A 2LVMA 2LNHB 4J83A 1YIJT 3L2ZA 4EIKA 1WGSA 4J9HA 4OMFB 2MF2A 3TSZA 4KULA 1TXQA 4JRIA 2RO0A 1YCYA 5FRMA 4D8DA 5A0DA 3QG1A 1M1KC 1JJ2S 4BACA 1I0CA 4M77G 1RLPC 2YUOA
chains in the Genus database with same CATH topology
2KE9A 1X2QA 3VS4A 4J9DA 3UF4A 1GL5A 1NYFA 1NLPC 2GGRA 1RLQC 2L3PA 1TUCA 4ESRA 2J6OA 1Z9QA 4CC4B 4M4ZA 3TSWA 2K3BA 4RTUA 1UJYA 1NEBA 2L3SA 4J9CA 3LH5A 1WXBA 1BBZA 2BZYA 3H0FA 2EYXA 2B86A 1KIKA 2KRNA 4LN2A 1E6GA 2DILA 1M3CA 2C0TA 1N5ZA 2JTEA 5IXFA 2P4RA 2CSIA 2RF0A 1NM7A 4J9EA 3VS7A 2L2PA 1KFZA 2FG0A 2PNIA 2D1XA 1GRIA 1E6HA 2D8HA 1ARKA 3EG1A 1WYXA 4RTWA 2NUZA 4E6RA 2RMOA 2EYYA 1W1FA 1WLPB 1SHFA 2KROA 2CUBA 1FYNA 2EW3A 1SRLA 3EGUA 4AFQC 4F14A 4JJDA 1UTIA 2A37A 2OI3A 1K76A 4F16A 2CT4A 1AZGB 2VVKA 2J7IA 1ZUUA 2FRYA 2A08A 2LQWA 1M3BA 2JW4A 2EYZA 2LP5A 4JZ3A 3THKA 3PVLA 1NLOC 1JEGA 2EKHA 4OMLA 4AG1C 1HD3A 2K79A 4JZ4A 1X69A 4LE9A 1OOTA 2E5KA 2KNBB 4RTTA 3PE0A 2OJ2A 1CKBA 2J6KA 1MV3A 1Y57A 1X2KA 1I1JA 2LZ6B 1PRLC 2EGCA 2D0NA 2SRCA 1AWJA 4Z8AA 1AWWA 1ZX6A 1AZEA 1K1ZA 3TVTA 4AFZC 5IH2A 2KXCA 2DRMA 2MOXA 1GBQA 2OAWA 2KR3A 3QWYA 1SPKA 2GQIA 2EGEA 2DL4A 2LCSA 1KSWA 2SEMA 4HVUA 5FWCA 3A98A 3ZL7C 2DRKA 1CKAA 3PVQA 4GLMA 4OMNA 1YNZA 1PKTA 1T3LA 2LJ3A 3U23A 3KFVA 4LNPA 2M0YA 3VS5A 1WXUA 2MCNA 4AFSC 1ZSGA 2ROTA 2ED0A 4OMQA 2O9VA 1UHCA 2O9SA 2F2XA 1XOVA 4OMOA 2C0OA 1QKXA 2PZ1A 2A36A 5FWBA 2AK5A 1Z9ZA 1OEBA 4DEXA 1B3QA 4FSSA 1AWXA 4RTYA 1U06A 1X27A 4WCIA 1M30A 2H8HA 2KRMA 2RNAA 3VRZA 1WFWA 1VYTA 2YT6A 4ZNXA 4CC2A 2MIOA 2YUNA 2ESWA 2AKLA 4JJCA 1ZLMA 1M8MA 1MV0B 4OMMA 1K4US 3RBBB 1OPKA 1QKWA 1RUWA 1YN8A 4JJBA 4J9FA 2KYMA 1I07A 4HVVA 2AZSA 2ECZA 2KBTA 3UATA 2JMAA 1SHGA 3I35A 2LJ1A 2K6DA 1GCQC 2DLPA 2I0NA 2O2OA 1JU5C 2PTKA 1WX6A 2KT8A 2KRSA 2W0ZA 2ROLA 2DVJA 5IHIA 4AFUC 4KRTA 1GBRA 2K7AA 3I5SA 3EHQA 3FJ5A 2CT3A 1AOJA 3VS2A 5L23A 1ZUYA 1AEYA 1UGVA 1U5SA 1RI9A 3RNJA 1BB9A 2VKNA 5IHKA 2XMFA 5GJWB 2DNUA 2J6FA 1UUEA 2J06A 2LX7A 2GTJA 1VYUA 1A0NB 2CDTA 1FMKA 1QWFA 2RQTA 2KEAA 2CUDA 2L3QA 3O5ZA 2RPNA 1MUZA 1ABQA 2RQUA 1UE9A 1TUDA 2YSQA 1H8KA 1X6GA 4GBQA 3H0IA 4HXJA 5I11A 5IXBA 3NMZC 4Z88A 2JT4A 2ENMA 1YCSB 2ED1A 3VS6A 1GFDA 1BU1A 2DX1A 4LUDA 2IIMA 1GCPA 1PHTA 1HSQA 2JM8A 1V1CA 1QLYA 1UG1A 3VS3A 1YWOA 1X43A 1AWOA 5GJVB 4DEYA 3I9QA 2EVRA 1BK2A 2K2MA 2HDAA 3UA6A 2L0AA 1NYGA 1SSHA 1H3HA 5I22A 1AVZC 2VWFA 1T0JA 3SHWA 2A28A 4A63B 1S1NA 2EPDA 2C0IA 1TG0A 1SEMA 2FPDA 2DL8A 3NHNA 2BTTA 2HCKA 1ABOA 1ZBJA 3REBB 4QT7A 2K9GA 2O88A 2DE0X 2DM1A 2EGAA 3VRYA 4D8KA 1OPLA 2F2WA 4J9GA 2YUQA 1G2BA 1U3OA 3R6NA 4HCKA 2DYBA 1UJ0A 4X1VA 1W70A 2FPFA 2V1RA 1VA7A 4CC7A 2GNCA 1X6BA 1YWPA 4ORZA 2FEIA 3M0UA 5IHNA 3SEMA 2RQWA 4RTXA 3NGPA 4Y92A 4R0KA 1PNJA 2O31A 1KJWA 1UHFA 3M0PA 5ECAA 2JMCA 2YUPA 1T0HA 2HSPA 2CH4W 3H41A 2JS0A 4HVWA 2DL3A 1EFNA 1AD5A 2FPEA 2EYWA 1M27C 2RQRA 2JS2A 3NPFA 1QWEA 2QDLA 2CREA 1G83A 2FRWA 3H0HA 1SRMA 2DA9A 3EHRA 1VYVA 4LUEA 2LJ0A 5FW9A 3IQLA 4CC3A 2DMOA 3JV3A 1PKSA 1UDLA 2NWMA 1IO6A 1W6XA 4JPBW 3REAB 1J3TA 1B07A 1Y0MA 2BZ8A 3EG0A 3I5RA 2EQIA 1JXOA 3ULRB 1ZUKA 1T3SA 3M0QA 1JQQA 3EG2A 2D8JA 2FO0A 2KYBA 3VS1A 2X3XD 4RTVA 1YP5A 4J9BA 4K11A 2CSQA 4IIOA 1PRMC 2HEQA 1LCKA 1QCFA 2G6FX 2HBWA 2BZXA 1WI7A 1K0SA 2EBPA 1K9AA 2F2VA 2DL5A 3C0CA 3M0TA 2KXDA 2V1QA 2RQVA 5EC7A 2M51A 4AG2C 2CH4A 3UA7A 1JXMA 2DL7A 1UECA 2LMJA 1GFCA 1NG2A 4J9IA 1H92A 1PWTA 2YDLA 3VS0A 2GTOA 1E7OA 1UFFA 2DBKA 3GBQA 2JM9A 2GBQA 2LQNA 4IIMA 3M0SA 1JO8A 3QWXX 1WIEA 5HCKA 4RTZA 1M3AA 1OV3A 2DJQA 2RN8A 2ABLA 3EG3A 4Z89A 2DBMA 2X3WD 2DF6A 4F17A 2W10A 2LNHB 1HJDA 2KT1A 2J05A 1CSKA 4EIKA 4RUGA 4J9HA 3TSZA 1NEGA 1K0XA 2KGTA 1WXTA 4OMPA 3CQTA 4D8DA 3M0RA 2JXBA 1WDXA 2AZVA 1GCQA 1WA7A 2AKKA 1I0CA 1RLPC 2YUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KE9 A;  1X2Q A;  3VS4 A;  4J9D A;  3UF4 A;  1GL5 A;  1NYF A;  1NLP C;  2GGR A;  1RLQ C;  2L3P A;  1TUC A;  4ESR A;  2J6O A;  1Z9Q A;  4CC4 B;  4M4Z A;  3TSW A;  2K3B A;  4RTU A;  1UJY A;  1NEB A;  2L3S A;  4J9C A;  3LH5 A;  1WXB A;  1BBZ A;  2BZY A;  3H0F A;  2EYX A;  2B86 A;  1KIK A;  2KRN A;  4LN2 A;  1E6G A;  2DIL A;  1M3C A;  2C0T A;  1N5Z A;  2JTE A;  5IXF A;  2P4R A;  2CSI A;  2RF0 A;  1NM7 A;  4J9E A;  3VS7 A;  2L2P A;  1KFZ A;  2FG0 A;  2PNI A;  2D1X A;  1GRI A;  1E6H A;  2D8H A;  1ARK A;  3EG1 A;  1WYX A;  4RTW A;  2NUZ A;  4E6R A;  2RMO A;  2EYY A;  1W1F A;  1WLP B;  1SHF A;  2KRO A;  2CUB A;  1FYN A;  2EW3 A;  1SRL A;  3EGU A;  4AFQ C;  4F14 A;  4JJD A;  1UTI A;  2A37 A;  2OI3 A;  1K76 A;  4F16 A;  2CT4 A;  1AZG B;  2VVK A;  2J7I A;  1ZUU A;  2FRY A;  2A08 A;  2LQW A;  1M3B A;  2JW4 A;  2EYZ A;  2LP5 A;  4JZ3 A;  3THK A;  3PVL A;  1NLO C;  1JEG A;  2EKH A;  4OML A;  4AG1 C;  1HD3 A;  2K79 A;  4JZ4 A;  1X69 A;  4LE9 A;  1OOT A;  2E5K A;  2KNB B;  4RTT A;  3PE0 A;  2OJ2 A;  1CKB A;  2J6K A;  1MV3 A;  1Y57 A;  1X2K A;  1I1J A;  2LZ6 B;  1PRL C;  2EGC A;  2D0N A;  2SRC A;  1AWJ A;  4Z8A A;  1AWW A;  1ZX6 A;  1AZE A;  1K1Z A;  3TVT A;  4AFZ C;  5IH2 A;  2KXC A;  2DRM A;  2MOX A;  1GBQ A;  2OAW A;  2KR3 A;  3QWY A;  1SPK A;  2GQI A;  2EGE A;  2DL4 A;  2LCS A;  1KSW A;  2SEM A;  4HVU A;  5FWC A;  3A98 A;  3ZL7 C;  2DRK A;  1CKA A;  3PVQ A;  4GLM A;  4OMN A;  1YNZ A;  1PKT A;  1T3L A;  2LJ3 A;  3U23 A;  3KFV A;  4LNP A;  2M0Y A;  3VS5 A;  1WXU A;  2MCN A;  4AFS C;  1ZSG A;  2ROT A;  2ED0 A;  4OMQ A;  2O9V A;  1UHC A;  2O9S A;  2F2X A;  1XOV A;  4OMO A;  2C0O A;  1QKX A;  2PZ1 A;  2A36 A;  5FWB A;  2AK5 A;  1Z9Z A;  1OEB A;  4DEX A;  1B3Q A;  4FSS A;  1AWX A;  4RTY A;  1U06 A;  1X27 A;  4WCI A;  1M30 A;  2H8H A;  2KRM A;  2RNA A;  3VRZ A;  1WFW A;  1VYT A;  2YT6 A;  4ZNX A;  4CC2 A;  2MIO A;  2YUN A;  2ESW A;  2AKL A;  4JJC A;  1ZLM A;  1M8M A;  1MV0 B;  4OMM A;  1K4U S;  3RBB B;  1OPK A;  1QKW A;  1RUW A;  1YN8 A;  4JJB A;  4J9F A;  2KYM A;  1I07 A;  4HVV A;  2AZS A;  2ECZ A;  2KBT A;  3UAT A;  2JMA A;  1SHG A;  3I35 A;  2LJ1 A;  2K6D A;  1GCQ C;  2DLP A;  2I0N A;  2O2O A;  1JU5 C;  2PTK A;  1WX6 A;  2KT8 A;  2KRS A;  2W0Z A;  2ROL A;  2DVJ A;  5IHI A;  4AFU C;  4KRT A;  1GBR A;  2K7A A;  3I5S A;  3EHQ A;  3FJ5 A;  2CT3 A;  1AOJ A;  3VS2 A;  5L23 A;  1ZUY A;  1AEY A;  1UGV A;  1U5S A;  1RI9 A;  3RNJ A;  1BB9 A;  2VKN A;  5IHK A;  2XMF A;  5GJW B;  2DNU A;  2J6F A;  1UUE A;  2J06 A;  2LX7 A;  2GTJ A;  1VYU A;  1A0N B;  2CDT A;  1FMK A;  1QWF A;  2RQT A;  2KEA A;  2CUD A;  2L3Q A;  3O5Z A;  2RPN A;  1MUZ A;  1ABQ A;  2RQU A;  1UE9 A;  1TUD A;  2YSQ A;  1H8K A;  1X6G A;  4GBQ A;  3H0I A;  4HXJ A;  5I11 A;  5IXB A;  3NMZ C;  4Z88 A;  2JT4 A;  2ENM A;  1YCS B;  2ED1 A;  3VS6 A;  1GFD A;  1BU1 A;  2DX1 A;  4LUD A;  2IIM A;  1GCP A;  1PHT A;  1HSQ A;  2JM8 A;  1V1C A;  1QLY A;  1UG1 A;  3VS3 A;  1YWO A;  1X43 A;  1AWO A;  5GJV B;  4DEY A;  3I9Q A;  2EVR A;  1BK2 A;  2K2M A;  2HDA A;  3UA6 A;  2L0A A;  1NYG A;  1SSH A;  1H3H A;  5I22 A;  1AVZ C;  2VWF A;  1T0J A;  3SHW A;  2A28 A;  4A63 B;  1S1N A;  2EPD A;  2C0I A;  1TG0 A;  1SEM A;  2FPD A;  2DL8 A;  3NHN A;  2BTT A;  2HCK A;  1ABO A;  1ZBJ A;  3REB B;  4QT7 A;  2K9G A;  2O88 A;  2DE0 X;  2DM1 A;  2EGA A;  3VRY A;  4D8K A;  1OPL A;  2F2W A;  4J9G A;  2YUQ A;  1G2B A;  1U3O A;  3R6N A;  4HCK A;  2DYB A;  1UJ0 A;  4X1V A;  1W70 A;  2FPF A;  2V1R A;  1VA7 A;  4CC7 A;  2GNC A;  1X6B A;  1YWP A;  4ORZ A;  2FEI A;  3M0U A;  5IHN A;  3SEM A;  2RQW A;  4RTX A;  3NGP A;  4Y92 A;  4R0K A;  1PNJ A;  2O31 A;  1KJW A;  1UHF A;  3M0P A;  5ECA A;  2JMC A;  2YUP A;  1T0H A;  2HSP A;  2CH4 W;  3H41 A;  2JS0 A;  4HVW A;  2DL3 A;  1EFN A;  1AD5 A;  2FPE A;  2EYW A;  1M27 C;  2RQR A;  2JS2 A;  3NPF A;  1QWE A;  2QDL A;  2CRE A;  1G83 A;  2FRW A;  3H0H A;  1SRM A;  2DA9 A;  3EHR A;  1VYV A;  4LUE A;  2LJ0 A;  5FW9 A;  3IQL A;  4CC3 A;  2DMO A;  3JV3 A;  1PKS A;  1UDL A;  2NWM A;  1IO6 A;  1W6X A;  4JPB W;  3REA B;  1J3T A;  1B07 A;  1Y0M A;  2BZ8 A;  3EG0 A;  3I5R A;  2EQI A;  1JXO A;  3ULR B;  1ZUK A;  1T3S A;  3M0Q A;  1JQQ A;  3EG2 A;  2D8J A;  2FO0 A;  2KYB A;  3VS1 A;  2X3X D;  4RTV A;  1YP5 A;  4J9B A;  4K11 A;  2CSQ A;  4IIO A;  1PRM C;  2HEQ A;  1LCK A;  1QCF A;  2G6F X;  2HBW A;  2BZX A;  1WI7 A;  1K0S A;  2EBP A;  1K9A A;  2F2V A;  2DL5 A;  3C0C A;  3M0T A;  2KXD A;  2V1Q A;  2RQV A;  5EC7 A;  2M51 A;  4AG2 C;  2CH4 A;  3UA7 A;  1JXM A;  2DL7 A;  1UEC A;  2LMJ A;  1GFC A;  1NG2 A;  4J9I A;  1H92 A;  1PWT A;  2YDL A;  3VS0 A;  2GTO A;  1E7O A;  1UFF A;  2DBK A;  3GBQ A;  2JM9 A;  2GBQ A;  2LQN A;  4IIM A;  3M0S A;  1JO8 A;  3QWX X;  1WIE A;  5HCK A;  4RTZ A;  1M3A A;  1OV3 A;  2DJQ A;  2RN8 A;  2ABL A;  3EG3 A;  4Z89 A;  2DBM A;  2X3W D;  2DF6 A;  4F17 A;  2W10 A;  2LNH B;  1HJD A;  2KT1 A;  2J05 A;  1CSK A;  4EIK A;  4RUG A;  4J9H A;  3TSZ A;  1NEG A;  1K0X A;  2KGT A;  1WXT A;  4OMP A;  3CQT A;  4D8D A;  3M0R A;  2JXB A;  1WDX A;  2AZV A;  1GCQ A;  1WA7 A;  2AKK A;  1I0C A;  1RLP C;  2YUO A; 
#chains in the Genus database with same CATH topology
 1R0B G;  3OYH A;  1D1C A;  4HCC A;  3CCJ A;  3VJP A;  1YFN A;  2L3P A;  2J6O A;  2QI2 A;  2XD0 A;  3P8B B;  3TSW A;  1VQN A;  2K3B A;  3OA6 A;  1UGR B;  1XTD A;  5FU7 B;  2EJG A;  2R5M A;  2I2L A;  2DVE A;  3CCQ A;  1M1F A;  2EYX A;  1Q81 C;  1KIK A;  2HQE A;  2KRN A;  3CCU T;  4MDX A;  4DBF A;  3CC2 A;  3E1S A;  3JB9 H;  3EAE A;  2P4R A;  1NM7 A;  4WTO B;  3VS7 A;  3OYC A;  4C92 B;  2L8D A;  2D1X A;  4ATO A;  1GRI A;  2COY A;  1ARK A;  3P8D A;  2X51 A;  2RA2 A;  3OS1 A;  2K57 A;  1S72 Q;  5DLO A;  2EYY A;  3EG9 A;  1SHF A;  2KRO A;  2CUB A;  3G4S A;  1FYN A;  2X4X A;  4C8Q A;  5I21 A;  2DXT A;  3KUF A;  1W2B P;  3QPH A;  4L6V 5;  4F16 A;  4XU3 A;  2CT4 A;  1K73 U;  2VVK A;  1ZUU A;  1I4K 1;  2FRY A;  2A08 A;  2LQW A;  3S6W A;  1M3B A;  2LP5 A;  3NFC A;  3PMT A;  4JZ3 A;  4M7A D;  4NS5 A;  3QJ6 A;  3VV0 A;  2X35 A;  4AG1 C;  2V8K A;  1X69 A;  1OOT A;  4RTT A;  1VQ4 Q;  5HY6 A;  3S3M A;  3BFM A;  4FW2 A;  2P4T A;  1K9M C;  4BDY A;  2XHC A;  3G4S T;  4BUG A;  3M9Q A;  3CXC S;  2LZ6 B;  1IRE B;  3L1A A;  2RI5 A;  1QVF P;  5LJ5 j;  5GAN d;  1UGQ B;  2CP7 A;  1VUB A;  3CCS T;  4OGE A;  4C8Q F;  3CD6 Q;  3TVT A;  2MWP A;  3CBM A;  4AFZ C;  3JCM J;  4Z02 A;  2KXC A;  3V7C A;  2OAW A;  2CP3 A;  2VAS A;  4L5G A;  4J5Y A;  3HRU A;  2SEM A;  1TU0 B;  3M5A A;  3CPW P;  1KC8 U;  3I55 A;  3M53 A;  2DRK A;  2EQU A;  3HSB A;  5CQY A;  1N6A A;  1VQ6 Q;  3PVQ A;  5CIU A;  2WSE E;  2LJ3 A;  3LWI A;  2E6Z A;  4E7K A;  3VS5 A;  2HD0 A;  2EFI A;  3TQ7 P;  4OMQ A;  2O9V A;  1UHC A;  2O9S A;  4EPC A;  1VQO A;  3DB3 A;  4X34 A;  4PJM A;  2C0O A;  4LD6 A;  3X28 B;  3I55 T;  5CAI A;  4JUV A;  5FWB A;  3OYG A;  2RH2 A;  2MWO A;  1WHJ A;  3JCM X;  1B3Q A;  3LWH A;  1YJN A;  1U06 A;  5DY9 A;  1NE8 A;  4BD3 A;  1M90 U;  4NL3 A;  2KRM A;  2L5Q A;  3BE3 A;  5GAN e;  1YI2 T;  1D1B A;  4LDW A;  4FT4 A;  1DJ7 B;  1G3S A;  3LYI A;  4HCB A;  1IHW A;  4OMM A;  1X01 A;  4E7H A;  5CO7 A;  1RUW A;  1YN8 A;  5GAM d;  4M7A C;  1RAA B;  2CYZ B;  1I07 A;  3A8H B;  4HVV A;  4RKU E;  2AZS A;  1YJ9 A;  3AHU A;  1KQ1 A;  1GCQ C;  1TOV A;  2K6D A;  4EMK A;  2R5A A;  1UEB A;  1VQ5 Q;  2ZZD A;  1R0C B;  2EKO A;  2KT8 A;  3X20 B;  2ROL A;  3RIR A;  4XU1 A;  4KRT A;  2K7A A;  1WHH A;  2M1H A;  2CT3 A;  4ELZ C;  3N5B B;  4XTX A;  4PJL A;  1WZO A;  3RNJ A;  5IHK A;  2J6F A;  4XQ3 A;  3EFO B;  5GAN 5;  2GFA A;  1YJW A;  4JS5 A;  1VQ7 A;  3O5Z A;  2QGF B;  4LDY A;  2RQU A;  3H0I A;  2CZ7 B;  2DIG A;  3NMZ C;  1QCN A;  2XDP A;  2JT4 A;  5KCO A;  2QGG A;  2D0Q B;  3MP6 A;  1YCS B;  1UGS B;  2O4X B;  3VS6 A;  1MMG A;  1BU1 A;  4LUD A;  2IIM A;  3DLL A;  2RHY A;  1VQM Q;  2RJD A;  2OX7 A;  3CBO A;  5GAM e;  1X43 A;  5GJV B;  3BW1 A;  4DEY A;  3I9Q A;  1YJW T;  1OX8 A;  3ZEH A;  1WHL A;  3J81 E;  5C6S A;  1ZA1 B;  4OF1 A;  4M75 D;  1NYG A;  2EQJ A;  1T0J A;  3QXE B;  4Y28 E;  5FU6 B;  1S1N A;  3FIF A;  4A4H A;  2EPD A;  4C8Q D;  1W2B S;  3CCL Q;  2DL8 A;  3NHN A;  4ZGD B;  3REB B;  2DE0 X;  2DTI A;  5KYY B;  2YRC A;  1Y07 A;  2E3H A;  1OPL A;  1S72 T;  2VGN A;  4J9G A;  5GAN 2;  3OY9 A;  1WQW A;  1RAH B;  1VA7 A;  2GNC A;  4R55 A;  3M0U A;  2M9U A;  4E7L A;  4Y92 A;  3NGP A;  4ZGE B;  1M8V A;  2FZC B;  4C0D B;  4R0K A;  1PNJ A;  3A8O B;  2AIR B;  1D1A A;  3OYK A;  2FL7 A;  4Q5W A;  2CH4 W;  2JS0 A;  2EJF A;  1WPY A;  1RAC B;  1OZ3 A;  2AT1 B;  3H0H A;  2FRW A;  4HT9 A;  3VU3 C;  2LJ0 A;  2XI9 A;  5KE2 A;  1B07 A;  2PUK B;  1Y0M A;  2L89 A;  5KYN A;  1VQ6 A;  1Q7Y R;  3AT1 B;  1KQS S;  2X4J A;  3PFS A;  3JCM W;  1OYX A;  3EG2 A;  2F5K A;  4KGX B;  3L2V A;  2KYB A;  1LNX A;  3CD6 T;  4M78 B;  4K11 A;  4IIO A;  1TSF A;  2K4Y A;  1PRM C;  4A53 A;  4E7S A;  2HBW A;  2E4H A;  2KMT A;  1SSF A;  1K0S A;  3WVE B;  2F2V A;  1R8O B;  1XQH A;  4PKC C;  1N8R U;  1JXM A;  2HKQ B;  1FX7 A;  1VQ6 T;  2R57 A;  1KQ2 A;  3NTI A;  2X4W A;  1E7O A;  2K5F A;  2DBK A;  3GBQ A;  2K3X A;  4B9W A;  4M75 C;  2JM9 A;  9ATC B;  1Q86 R;  2LQN A;  4N0A C;  1OUL A;  4IIM A;  2PVD B;  4C8Q C;  4LDV A;  3QWX X;  4CI0 C;  3V7R A;  5HCK A;  4RTZ A;  4X9D A;  2RN8 A;  2CZ1 B;  5FLX E;  1TTH B;  3J80 E;  2BE7 D;  4MMK A;  4X9C A;  5CKF A;  1KC8 C;  5CVI A;  2RM4 A;  2KAF A;  4RUG A;  3VUB A;  1NEG A;  3CCV A;  2QQR A;  2JTF A;  4FU6 A;  1B34 A;  2KGT A;  1WXT A;  3LGF A;  4QVD A;  2XK0 A;  3URG A;  1D3B A;  3OBW A;  1VQ5 A;  2RHZ A;  1MMN A;  1GCQ A;  2AZV A;  2AKK A;  3C12 A;  2KE9 A;  1X2Q A;  1U8R A;  3VS4 A;  1Q7Y U;  3OBY A;  3QII A;  5A2Q E;  2WSC E;  3CC4 Q;  3OW2 A;  4EMK B;  1NLP C;  1K8A C;  4ESR A;  1TUC A;  3EH1 A;  1Z9Q A;  4CC4 B;  2QQ9 A;  4RTU A;  3C95 A;  2BIV A;  4J9C A;  3CCV T;  3CME Q;  2IG0 A;  1BBZ A;  4QW2 A;  4N4I A;  3H0F A;  2B86 A;  5LJ3 d;  1VQ5 T;  2K5I A;  2K5L A;  1M90 C;  2DXC A;  4C5H A;  4L59 A;  1N5Z A;  5IXF A;  2RF0 A;  2OTL A;  3HHT B;  3JB9 F;  2L2P A;  3H9N A;  3RKW A;  3JCM Q;  1E6H A;  1OU8 A;  3EG1 A;  2YWW A;  1WYX A;  4RTW A;  4C5E A;  4O6J A;  4OB0 B;  7AT1 B;  2QQA A;  1VQ9 Q;  1VIF A;  2EW3 A;  3HKS A;  3RUX A;  3V7S A;  2DET A;  4PLL A;  4DBR A;  4BE1 A;  1UTI A;  2A37 A;  1K76 A;  5IT9 E;  1M1G A;  2P0P A;  5D6Y A;  2J7I A;  4XTU A;  2OTL T;  2EYZ A;  3THK A;  2PUO B;  1JEG A;  1WNL A;  1KD1 R;  4JDS A;  2K79 A;  1JJ2 A;  4LE9 A;  1R77 A;  2KNB B;  1VQM T;  4AMC A;  2OJ2 A;  2J6K A;  2QA4 A;  2QAS A;  4FYW B;  3MEA A;  2EGC A;  2VV5 A;  1N27 A;  2D0N A;  3E9G A;  5J26 A;  2RD1 A;  1NJI U;  3QYG B;  1SF9 A;  3QJY A;  5DM7 R;  1K1Z A;  3EGX A;  3RMQ A;  4E2F B;  2DRM A;  2V26 A;  4M75 E;  3G6E Q;  1GBQ A;  2IPO B;  4EMH A;  3CCL T;  3L2R A;  1U1T A;  2DL4 A;  2CZ0 B;  1SG5 A;  2LCS A;  3MEV A;  5FWC A;  2QA4 T;  1CKA A;  4C5G A;  3MCA B;  3OYB A;  3CCR Q;  4DQ2 A;  4IUV A;  1FMV A;  5J39 A;  1T3L A;  4XTW A;  4MML A;  1I5L A;  3CCU A;  2FZK B;  2CS7 A;  3L42 A;  2LQK A;  4PJO G;  1N9R A;  2DKG A;  3NTK A;  3JCM b;  4M7D G;  3OS0 A;  2F2X A;  1XOV A;  1VQK Q;  5GMK h;  4ELY C;  2XU8 A;  4C5I A;  1QKX A;  1V29 B;  2PZ1 A;  5GAN 4;  4QVZ A;  4XU2 A;  2A36 A;  2AK5 A;  3H8Z A;  5KYX B;  2E3I A;  1M4Z A;  4IUU A;  1Z9Z A;  1BIA A;  1QCO A;  1OEB A;  4P5N A;  2KSS A;  4FSS A;  4ME7 A;  2JVV A;  4WCI A;  1BI0 A;  2DK3 A;  3CXC A;  4F04 B;  2RNA A;  4F7U G;  2VC8 A;  3OSS C;  3VRZ A;  1VYT A;  1YIT Q;  1Y96 B;  1QVG S;  4M77 C;  2ESW A;  2AKL A;  3E19 A;  4JJC A;  2HQX A;  1ZLM A;  2WAC A;  1QP3 A;  1ZSZ A;  1M8M A;  4II1 A;  4RCC A;  1QKW A;  4JJB A;  5D7U A;  4M75 A;  3SD4 A;  3GLX A;  4N0A A;  2ECZ A;  2KBT A;  1PD0 A;  4QQ6 A;  3CMA Q;  3I35 A;  4OVA A;  1G3W A;  2DLP A;  5LJ5 g;  2JJ9 A;  2ATC B;  2O2O A;  4N4H A;  3CCS A;  5KYU B;  2EWN A;  4C0Z A;  1H3Z A;  2PTK A;  3X24 B;  1WX6 A;  2KRS A;  1M2V B;  1OU9 A;  1GBR A;  5CQX A;  3I5S A;  1NPP A;  3FJ5 A;  2P0Q A;  1VQ8 A;  5L23 A;  1ZUY A;  3JB9 D;  1BCO A;  4M7A B;  1BB9 A;  2DNU A;  4M75 F;  2OAU A;  2GTJ A;  3INZ A;  3CCM Q;  4FCY A;  4DA4 A;  1QWF A;  2RQT A;  2CUD A;  3EH2 A;  2RPN A;  4FYX B;  3G71 A;  3BY7 A;  2DZ9 A;  1N8R C;  4GBQ A;  3ASK A;  4HXJ A;  3BDU A;  4GY5 A;  1TH7 A;  1EZZ B;  2X9H A;  2A3L A;  1VQ8 T;  4C92 G;  1KHI A;  2LC4 A;  3JSC A;  1UG1 A;  1YWO A;  3CC4 T;  1AWO A;  1P92 A;  3SWN B;  3RES A;  1ZA2 B;  2ZPE B;  3FRN A;  2K2M A;  4IUR A;  2DPP B;  2NUT B;  3G71 T;  3UA6 A;  2ZPF B;  5GMK i;  1YI2 A;  5FU7 C;  4DBH A;  3E2U A;  2C06 A;  4A63 B;  1NZ9 A;  3M55 A;  1TG0 A;  3M4G A;  2OTJ Q;  4BI4 A;  2E12 A;  3QDR B;  5AT1 B;  2DM1 A;  4BE2 A;  2FYK A;  1QP2 A;  3OYA A;  3CC7 Q;  1U3O A;  3HTR A;  1VQ9 T;  4HCK A;  2DYB A;  4X1V A;  1W70 A;  4BY6 C;  2CP2 A;  3M59 A;  2RQW A;  3M58 A;  1OZ2 A;  1BCM A;  2O31 A;  4M77 E;  3HRT A;  1T0H A;  2LNV A;  4HVW A;  1VQL Q;  3ZFJ A;  1AD5 A;  3WXM B;  1M27 C;  3OMC A;  3RDV A;  2JS2 A;  3NPF A;  2KK4 A;  2QDL A;  1FWZ A;  1M1K R;  2DA9 A;  1VYV A;  1MMA A;  2Y90 A;  4CC3 A;  1WHK A;  4XTV A;  4JPB W;  3REA B;  1J3T A;  2BZ8 A;  3EG0 A;  2NUP B;  4BE0 A;  4B9X A;  2EQI A;  5CKB A;  3ULR B;  2VUB A;  1JBM A;  3M0Q A;  2FO0 A;  3TCJ A;  3VS1 A;  2X3X D;  3PNW C;  4RTV A;  1YP5 A;  4J9B A;  5GAN j;  1Y7X A;  2E70 A;  1Q82 C;  3OS2 A;  2HL3 A;  2BZX A;  1HK9 A;  1WI7 A;  1W2B A;  1FMW A;  1IZ6 A;  3JCM c;  3G1J A;  3PTA A;  1Q81 R;  1K9A A;  2DL5 A;  2KXD A;  4J7I A;  2V1Q A;  3VKI A;  2RQV A;  2YRD A;  2M51 A;  4AG2 C;  4OB1 B;  1D0Z A;  2ZPG B;  2LMJ A;  5CKD A;  2XDB A;  1O75 A;  2HQH A;  2DIQ A;  3UPU A;  3KXT A;  5KH6 A;  1H92 A;  1WHM A;  4XAX B;  2YDL A;  1LJO A;  3MHX A;  1H64 1;  4ZTF A;  2GBQ A;  3QHS A;  1NJI C;  3GP8 A;  3M0S A;  1JO8 A;  2HZY A;  1VQK T;  1PSF A;  4M77 A;  4PJO A;  1OV3 A;  2DJQ A;  4CRI A;  2ABL A;  1O9S A;  4Z89 A;  1S72 A;  4M7D A;  4FM4 B;  2FVU A;  2X3W D;  2DF6 A;  2W10 A;  3A8G B;  3TRE A;  3EGD A;  1RAF B;  2EAY A;  4KBM B;  2J05 A;  1D0X A;  1CSK A;  3A8M B;  3TU4 K;  3MPU B;  3JB9 I;  1K9M R;  4OMP A;  3CQT A;  1YIT T;  5GAM g;  3I56 Q;  1M1K U;  3M54 A;  3ME9 A;  2QQS A;  3M0R A;  3EG9 B;  4IUT A;  2DFU A;  1KQS A;  2JXB A;  3RMS A;  1WDX A;  2DZC A;  1X75 C;  4ANJ A;  3VYG A;  2E65 A;  4RG8 A;  4F7U A;  4BDZ A;  3OW2 P;  4C8Q B;  4HCZ A;  3QKJ A;  1VQ4 A;  5CKH A;  4O5V A;  1GL5 A;  1PCX A;  2GGR A;  1RLQ C;  3GPL A;  1BYM A;  4KUD K;  4M77 F;  4Y91 A;  2QEX Q;  3Q1J A;  1YHQ Q;  1IXD A;  3R6O A;  4B6M A;  1NEB A;  1QVF S;  1JB0 E;  4AT1 B;  1BIB A;  4PFO A;  5GAM j;  4XK8 E;  4A4E A;  5LJ5 h;  1WJQ A;  1WXB A;  1Q81 U;  2BZY A;  5GMK e;  3CD6 A;  3RER A;  4A4G A;  3FDR A;  4RG2 A;  2C0T A;  3OB9 A;  2CSI A;  2PQW A;  3PIP A;  1VQ4 T;  1KFZ A;  3CPW S;  2D8H A;  4UC4 A;  2QG9 B;  2NUZ A;  4E6R A;  2RMO A;  1MNE A;  1NPR A;  2E5Q A;  2JNG A;  1SRL A;  3A5Z B;  3CCM T;  3LW5 E;  4LD9 K;  4F14 A;  4JJD A;  4J8O A;  3SDZ A;  1K73 C;  4FIB A;  1PM3 A;  2ZAE A;  2JW4 A;  4JJN K;  3G7Z A;  1NLO C;  2EKH A;  8ATC B;  4JZ4 A;  3E9F A;  1K9M U;  3O8V A;  2HSE B;  1MGQ A;  1ZHI A;  3PE0 A;  2DTH A;  1CKB A;  3CCJ Q;  5LJ5 f;  1ZSZ C;  1Y57 A;  1I1J A;  2VGM A;  3QDF A;  1VQN Q;  2DTO A;  2SRC A;  1AWJ A;  4C92 A;  2HMA A;  1AWW A;  4FT2 A;  1HYO A;  1KG1 A;  3C94 A;  3CCQ Q;  1LPL A;  1QQJ A;  5IH2 A;  2FHD A;  5FU6 C;  2E6N A;  2OTJ T;  4FSX A;  3CC2 Q;  3OYY A;  3QWY A;  2RK2 A;  2EGE A;  2L3R A;  3CCE Q;  2MAM A;  1MND A;  3UDC A;  3CBP A;  4GLM A;  3G4S Q;  4OMN A;  1YNZ A;  4MZM A;  3KFV A;  2DD4 A;  4JLG A;  4RCB A;  3MET A;  1WXU A;  4KUI A;  2M16 A;  3A1P A;  1VQP Q;  3JCM g;  4OMO A;  4M78 G;  1OX9 A;  2EJ9 A;  1VQL T;  1IGU A;  2RK1 A;  2NYS A;  4D6W A;  1RAI B;  4DEX A;  3CXC P;  5CCA A;  4RTY A;  2KY9 A;  1B7T A;  2H8H A;  4DOW A;  1UGP B;  2F69 A;  3FC3 A;  2E1H A;  1WFW A;  2YT6 A;  1WHG A;  4ZNX A;  3V8L A;  2JUF A;  1HXD A;  1KK7 A;  2A0F B;  1PSE A;  2BUD A;  3MJX A;  1G3T A;  2AHJ B;  1FXX A;  3RBB B;  1VQM A;  4KGZ B;  4A54 A;  4YTL A;  1Q86 U;  4BB7 A;  1RAG B;  3I55 Q;  4KH0 B;  2A7Y A;  4N4G A;  2VXF A;  4M77 D;  4PJO D;  3UAT A;  3LH0 A;  2JMA A;  4M7D D;  2Z0W A;  5HKC A;  2F5T X;  1JU5 C;  3OYE A;  4KH1 B;  5C0M A;  3CCL A;  2DVJ A;  2G3R A;  1BI1 A;  1VQO Q;  3H6Z A;  4AFU C;  3EHQ A;  5LL6 S;  1AOJ A;  5CK9 A;  3VS2 A;  1AEY A;  1UGV A;  1U5S A;  1RI9 A;  2E41 A;  3EFR A;  2XMF A;  5GJW B;  2ZPI B;  2J06 A;  1YJN Q;  1A0N B;  3V8K A;  3NTH A;  1FMK A;  2Y4X A;  4FYY B;  8AT1 B;  2HL5 C;  1YHQ A;  2YXY A;  1ABQ A;  2YSQ A;  2HKN A;  3VYH B;  3PIO A;  5I11 A;  4Z88 A;  3DKM A;  5GAM h;  3I56 T;  2ED1 A;  4MZT A;  1GFD A;  3MEW A;  1QVG A;  3OYI A;  5LJ5 d;  2JM8 A;  2VYT A;  1TWB A;  3VS3 A;  2E10 A;  5KYW A;  3PMI A;  5LJ3 g;  2QEX T;  2JTM A;  4E7Z A;  2CZ6 B;  1YHQ T;  4QVC A;  5GAN 8;  1YJ9 Q;  2L0A A;  2CKK A;  4PJJ A;  4NOY A;  5IN1 A;  3SHW A;  5I22 A;  2A28 A;  2R58 A;  2QK0 A;  3LGL A;  2C0I A;  3EFO A;  3V8J A;  4R56 A;  3JAM E;  4WF2 A;  3OYL A;  1ABO A;  4JRK A;  4PNO A;  1AT1 B;  2RJC A;  5I2M A;  3C4S A;  5LJ3 j;  3VRY A;  4D8K A;  3GF5 A;  1LVK A;  2F2W A;  2YLB A;  3EFS A;  3GIB A;  1KD1 U;  2MYS A;  2O4X A;  3R6N A;  1I81 A;  1UJ0 A;  2EQK A;  2FPF A;  2V1R A;  5GAM f;  1YJW Q;  4CC7 A;  1X6B A;  1YWP A;  4ORZ A;  2FEI A;  5IHN A;  4E7I A;  1VQ7 Q;  4PJO C;  1BKB A;  2JOY A;  4M7D C;  2K2V A;  4RTX A;  4PFP A;  2GQV A;  4C92 D;  1KJW A;  1UHF A;  3M0P A;  2O01 E;  1KC8 R;  2PVG B;  2YUP A;  5KCH A;  4PJN A;  2HSP A;  3H41 A;  2DL3 A;  1EFN A;  3DB4 A;  4XTY A;  4M78 E;  2EYW A;  3PT9 A;  1VOM A;  2CRE A;  3MKD A;  5GAN 3;  4EDU A;  1G83 A;  1QW1 A;  2EYQ A;  2RHI A;  1BI3 A;  1SRM A;  3CCE A;  5LJ5 e;  2RI3 A;  5FW9 A;  3IQL A;  3CCJ T;  2DMO A;  1PKS A;  1UDL A;  2NWM A;  1W6X A;  2QYZ A;  2FZG B;  1VQN T;  1NBE B;  3I5R A;  4BY6 B;  3LX7 A;  4J6W A;  1K8A R;  5KYY A;  2ZPH B;  4DOV A;  1T3S A;  1OQK A;  3CCQ T;  1M5Q 1;  3HPW A;  4BI8 B;  2IVW A;  3WVD B;  1XNI A;  3CC2 T;  1Q95 G;  1VQP A;  4BI3 A;  3M56 A;  2ZPB B;  4OGC A;  3CCE T;  3J7A F;  1B34 B;  3CC4 A;  3C0C A;  4FL6 A;  1M90 R;  5EC7 A;  3RR6 A;  1D3B B;  2CH4 A;  3QBY A;  2DL7 A;  4HA8 A;  1UEC A;  1G3Y A;  2YRV A;  4A4F A;  3CME A;  4JRP A;  2F1L A;  1RI0 A;  4J9I A;  1C1A A;  3SFM A;  1IRX A;  1PWT A;  1IHV A;  2GTO A;  1F1B B;  1UFF A;  2KQW A;  2YLC A;  5L8R E;  3JRZ A;  1VQP T;  3JCM h;  5CKE A;  1W4S A;  1WIE A;  1JRI A;  2JN0 A;  3QYH B;  3OYM A;  2NLU A;  4E47 A;  1VQ9 A;  2QXF A;  4M78 A;  5D6W A;  3CME T;  3OQ5 A;  2KT1 A;  1VIE A;  4HT8 A;  3HFN A;  1KQS P;  4EMG A;  3QSU A;  2LCC A;  1K0X A;  3KBG A;  4J6X A;  4A4K A;  5AYF A;  3L2U A;  1WA7 A;  4C92 C;  2V8J A;  1HJD A;  3QZ9 B;  5A0G A;  1TUG B;  4E7J A;  1Q7Y C;  4J9D A;  1K8A U;  3UF4 A;  1NYF A;  4M7A G;  4M4Z A;  2BKD N;  1UJY A;  2L3S A;  4MZP A;  1U1S A;  4TVR A;  4M78 F;  1IGQ A;  2COW A;  3LH5 A;  2D6F A;  3M4Y A;  5GMK m;  3JCM f;  4PJO E;  3JB9 G;  4M7D E;  4PL6 A;  2RB6 A;  4LN2 A;  1E6G A;  5GAO q;  3G6E A;  4FYV B;  2DIL A;  1M3C A;  2JTE A;  5GAN g;  3PGG A;  1VQO T;  4J9E A;  3CEY A;  2XG8 D;  2FG0 A;  2PNI A;  2VB6 A;  2MI6 A;  4QKU A;  3X25 B;  4ZTJ A;  3EGX B;  1W1F A;  1WLP B;  2RHU A;  3CCR A;  3A8L B;  2CGH A;  2DO3 A;  1Q86 C;  3EGU A;  1YJN T;  4F7U E;  4AFQ C;  2MMP A;  3CCV Q;  2OI3 A;  3OYJ A;  1RAE B;  1AZG B;  2PU9 B;  3G6E T;  3OYD A;  1VQK A;  3PVL A;  5KYW B;  4LDX A;  1MHN A;  4OML A;  1WJS A;  3QO3 A;  3SB2 A;  2VXE A;  5DLQ E;  1HD3 A;  2E5K A;  3CCR T;  1MV3 A;  1X2K A;  2P84 A;  3T9N A;  3CPF A;  2XIC A;  1PRL C;  5LJ3 h;  3SWN C;  4DBQ A;  1PG5 B;  4Z8A A;  2DD5 A;  1ZX6 A;  1YIT A;  1YJ9 T;  3GOX A;  1AZE A;  2P0K A;  1WJR A;  5D6X A;  1QVF A;  3OSV A;  2MOX A;  3RKY A;  3HL8 A;  5M9O A;  1WQ7 A;  2KR3 A;  4JS4 A;  1SPK A;  2GQI A;  2OTL Q;  2LX9 A;  1KSW A;  2DAQ A;  2RI2 A;  4HVU A;  2XDD A;  1QVP A;  2WSF E;  2YHT A;  3A98 A;  3ZL7 C;  5GMK l;  2DJZ A;  1C6V X;  5GAO r;  2EIF A;  3CMA A;  3CPW A;  1ZSZ B;  4V2S A;  1PKT A;  3U23 A;  2CP5 A;  4OB2 B;  5HK3 A;  1BI2 A;  4LNP A;  2M0Y A;  4GLK A;  1VQ7 T;  1RAB B;  4M75 B;  5HK0 A;  3OYF A;  2MCN A;  4J6Y A;  4AFS C;  1ZSG A;  4KT0 E;  4XU0 A;  2ROT A;  2ED0 A;  2BE9 B;  2KVQ G;  2QQB A;  5A0L A;  3QUI A;  1EIF A;  1N8R R;  2E64 A;  4C92 E;  5KE3 A;  4PJO F;  2GCX A;  4JRQ A;  2ZCF B;  4M7D F;  5LJ3 f;  2PVO B;  3OS5 A;  3CMA T;  2QA4 Q;  3CCM A;  1YIJ Q;  2QTV A;  1AWX A;  4PLI A;  1X6O A;  1X27 A;  1M30 A;  3ER0 A;  1RAD B;  1M9S A;  4ZN1 A;  2QAZ A;  1ZQ1 A;  1KD1 C;  4LDU A;  4CC2 A;  2MIO A;  4MDW A;  2YUN A;  2QTX A;  3D7S B;  4KGV B;  3FEO A;  4F7U F;  1MV0 B;  2DXB A;  1I8F A;  2H3J A;  2LQ8 A;  1K4U S;  2H3E B;  4J7F A;  1OPK A;  2JZ2 A;  5FRN A;  1IB8 A;  2DYI A;  4J9F A;  1SKU B;  2FB7 A;  2KYM A;  3HFO A;  1MMD A;  6AT1 B;  1LOJ A;  1SHG A;  4M7A E;  2M0O A;  3JCM d;  2LJ1 A;  2I0N A;  4M78 D;  3F70 A;  1JJ2 P;  3CCU Q;  2DEQ A;  5KYX A;  2COZ A;  2W0Z A;  3FLG A;  2OTJ A;  5IHI A;  1ZBX A;  3HP9 A;  5GMK j;  1Y71 A;  3GNF B;  4M75 G;  1D09 B;  5FRO A;  2ZGW A;  4C8Q G;  2DEU A;  1Y96 A;  2GF7 A;  4XTZ A;  2VKN A;  1TS9 A;  3FJP A;  3GNG A;  3CC7 A;  1GXI E;  1UUE A;  2LX7 A;  1QMC A;  1VYU A;  2XID A;  1PC0 A;  2CDT A;  3M57 A;  2D9T A;  2KEA A;  2L3Q A;  3P8H A;  1MUZ A;  1UE9 A;  1TUD A;  1H8K A;  1X6G A;  1YBY A;  1RL2 A;  2CP6 A;  5IXB A;  1QVG P;  1M2O A;  2ENM A;  4ZN3 A;  5GAN 6;  2DX1 A;  1VQL A;  3VUZ A;  5CR2 A;  1GCP A;  1PHT A;  5KYU A;  1HSQ A;  4HKE A;  1V1C A;  1QLY A;  3CC7 T;  2XKO C;  5J3B A;  2RJF A;  1M2V A;  1Q82 R;  3JB9 J;  2EVR A;  1BK2 A;  3S3O A;  4C92 F;  2MPX C;  2HDA A;  5I2S A;  3S3N A;  1N9S A;  3CCS Q;  3UWN A;  1SSH A;  4C0D C;  1I5O B;  1AVZ C;  2VWF A;  3JCM e;  4M7A A;  1H3H A;  1ACM B;  1KHC A;  5GAO m;  2DER A;  1SEM A;  2FPD A;  2B8A A;  3MP8 A;  3TEE A;  2BTT A;  2HCK A;  3OMG A;  1ZBJ A;  5GAN h;  1G8X A;  4JLI A;  4QT7 A;  3FB9 A;  2K9G A;  1VQ8 Q;  2O88 A;  3MEU A;  2EGA A;  1NJI R;  2LRQ A;  1D0Y A;  1V76 A;  2CP0 A;  2YUQ A;  1G2B A;  4ZGJ B;  3LLR A;  4FW1 A;  4NL2 A;  4RMO A;  3G71 Q;  3SEM A;  3MP1 A;  2HNI A;  4M78 C;  5GAO p;  3SWN A;  4OB3 B;  4M7A F;  5ECA A;  1AHJ B;  2JMC A;  2NUT A;  3DLM A;  4C0F A;  2FPE A;  3X26 B;  2RQR A;  1G5V A;  1QWE A;  1OI1 A;  3EHR A;  4LUE A;  3JV3 A;  2LTO A;  1IO6 A;  3ZBD A;  2LDM A;  2LT4 A;  2V8I A;  4IKF A;  1EX4 A;  4M77 B;  1JXO A;  1YI2 Q;  4PJO B;  5GAO n;  1ZUK A;  4LXC A;  5GAN f;  4M7D B;  3I56 A;  1JQQ A;  2D8J A;  2GFU A;  2Y4Y A;  2CSQ A;  1C0M A;  2EQM A;  1Q82 U;  3EGD B;  3L2Q A;  4PFZ A;  2HEQ A;  1LCK A;  3OW2 S;  1QCF A;  4VUB A;  2G6F X;  3HRS A;  3BDL A;  4OP0 A;  2HBP A;  2EBP A;  3JCM V;  2HAX A;  3OYN A;  3M0T A;  4QQG A;  2QEX A;  2DXU A;  3UA7 A;  2RHX A;  5GAO l;  4PK4 A;  1GFC A;  1NG2 A;  4C0G A;  4F7U B;  3QZ5 B;  1UB4 A;  2M02 A;  1YIJ A;  3UT1 A;  1XJW B;  2QDY B;  3VS0 A;  2KDS A;  3MO8 A;  2RJE A;  3JCM P;  2MK5 A;  3RKX A;  4IUQ A;  2K3Y A;  2KI7 A;  5GAN 7;  2X4Y A;  2NUP A;  4QQD A;  2LT1 A;  4EMK C;  5EG2 A;  4IUP A;  1M3A A;  1PD1 A;  3EG3 A;  5LJ3 e;  2LCL A;  2DBM A;  5IAY A;  3L2W A;  1K73 R;  4C8Q E;  4F17 A;  2LVM A;  2LNH B;  4J83 A;  1YIJ T;  3L2Z A;  4EIK A;  1WGS A;  4J9H A;  4OMF B;  2MF2 A;  3TSZ A;  4KUL A;  1TXQ A;  4JRI A;  2RO0 A;  1YCY A;  5FRM A;  4D8D A;  5A0D A;  3QG1 A;  1M1K C;  1JJ2 S;  4BAC A;  1I0C A;  4M77 G;  1RLP C;  2YUO A; 
#chains in the Genus database with same CATH homology
 2KE9 A;  1X2Q A;  3VS4 A;  4J9D A;  3UF4 A;  1GL5 A;  1NYF A;  1NLP C;  2GGR A;  1RLQ C;  2L3P A;  1TUC A;  4ESR A;  2J6O A;  1Z9Q A;  4CC4 B;  4M4Z A;  3TSW A;  2K3B A;  4RTU A;  1UJY A;  1NEB A;  2L3S A;  4J9C A;  3LH5 A;  1WXB A;  1BBZ A;  2BZY A;  3H0F A;  2EYX A;  2B86 A;  1KIK A;  2KRN A;  4LN2 A;  1E6G A;  2DIL A;  1M3C A;  2C0T A;  1N5Z A;  2JTE A;  5IXF A;  2P4R A;  2CSI A;  2RF0 A;  1NM7 A;  4J9E A;  3VS7 A;  2L2P A;  1KFZ A;  2FG0 A;  2PNI A;  2D1X A;  1GRI A;  1E6H A;  2D8H A;  1ARK A;  3EG1 A;  1WYX A;  4RTW A;  2NUZ A;  4E6R A;  2RMO A;  2EYY A;  1W1F A;  1WLP B;  1SHF A;  2KRO A;  2CUB A;  1FYN A;  2EW3 A;  1SRL A;  3EGU A;  4AFQ C;  4F14 A;  4JJD A;  1UTI A;  2A37 A;  2OI3 A;  1K76 A;  4F16 A;  2CT4 A;  1AZG B;  2VVK A;  2J7I A;  1ZUU A;  2FRY A;  2A08 A;  2LQW A;  1M3B A;  2JW4 A;  2EYZ A;  2LP5 A;  4JZ3 A;  3THK A;  3PVL A;  1NLO C;  1JEG A;  2EKH A;  4OML A;  4AG1 C;  1HD3 A;  2K79 A;  4JZ4 A;  1X69 A;  4LE9 A;  1OOT A;  2E5K A;  2KNB B;  4RTT A;  3PE0 A;  2OJ2 A;  1CKB A;  2J6K A;  1MV3 A;  1Y57 A;  1X2K A;  1I1J A;  2LZ6 B;  1PRL C;  2EGC A;  2D0N A;  2SRC A;  1AWJ A;  4Z8A A;  1AWW A;  1ZX6 A;  1AZE A;  1K1Z A;  3TVT A;  4AFZ C;  5IH2 A;  2KXC A;  2DRM A;  2MOX A;  1GBQ A;  2OAW A;  2KR3 A;  3QWY A;  1SPK A;  2GQI A;  2EGE A;  2DL4 A;  2LCS A;  1KSW A;  2SEM A;  4HVU A;  5FWC A;  3A98 A;  3ZL7 C;  2DRK A;  1CKA A;  3PVQ A;  4GLM A;  4OMN A;  1YNZ A;  1PKT A;  1T3L A;  2LJ3 A;  3U23 A;  3KFV A;  4LNP A;  2M0Y A;  3VS5 A;  1WXU A;  2MCN A;  4AFS C;  1ZSG A;  2ROT A;  2ED0 A;  4OMQ A;  2O9V A;  1UHC A;  2O9S A;  2F2X A;  1XOV A;  4OMO A;  2C0O A;  1QKX A;  2PZ1 A;  2A36 A;  5FWB A;  2AK5 A;  1Z9Z A;  1OEB A;  4DEX A;  1B3Q A;  4FSS A;  1AWX A;  4RTY A;  1U06 A;  1X27 A;  4WCI A;  1M30 A;  2H8H A;  2KRM A;  2RNA A;  3VRZ A;  1WFW A;  1VYT A;  2YT6 A;  4ZNX A;  4CC2 A;  2MIO A;  2YUN A;  2ESW A;  2AKL A;  4JJC A;  1ZLM A;  1M8M A;  1MV0 B;  4OMM A;  1K4U S;  3RBB B;  1OPK A;  1QKW A;  1RUW A;  1YN8 A;  4JJB A;  4J9F A;  2KYM A;  1I07 A;  4HVV A;  2AZS A;  2ECZ A;  2KBT A;  3UAT A;  2JMA A;  1SHG A;  3I35 A;  2LJ1 A;  2K6D A;  1GCQ C;  2DLP A;  2I0N A;  2O2O A;  1JU5 C;  2PTK A;  1WX6 A;  2KT8 A;  2KRS A;  2W0Z A;  2ROL A;  2DVJ A;  5IHI A;  4AFU C;  4KRT A;  1GBR A;  2K7A A;  3I5S A;  3EHQ A;  3FJ5 A;  2CT3 A;  1AOJ A;  3VS2 A;  5L23 A;  1ZUY A;  1AEY A;  1UGV A;  1U5S A;  1RI9 A;  3RNJ A;  1BB9 A;  2VKN A;  5IHK A;  2XMF A;  5GJW B;  2DNU A;  2J6F A;  1UUE A;  2J06 A;  2LX7 A;  2GTJ A;  1VYU A;  1A0N B;  2CDT A;  1FMK A;  1QWF A;  2RQT A;  2KEA A;  2CUD A;  2L3Q A;  3O5Z A;  2RPN A;  1MUZ A;  1ABQ A;  2RQU A;  1UE9 A;  1TUD A;  2YSQ A;  1H8K A;  1X6G A;  4GBQ A;  3H0I A;  4HXJ A;  5I11 A;  5IXB A;  3NMZ C;  4Z88 A;  2JT4 A;  2ENM A;  1YCS B;  2ED1 A;  3VS6 A;  1GFD A;  1BU1 A;  2DX1 A;  4LUD A;  2IIM A;  1GCP A;  1PHT A;  1HSQ A;  2JM8 A;  1V1C A;  1QLY A;  1UG1 A;  3VS3 A;  1YWO A;  1X43 A;  1AWO A;  5GJV B;  4DEY A;  3I9Q A;  2EVR A;  1BK2 A;  2K2M A;  2HDA A;  3UA6 A;  2L0A A;  1NYG A;  1SSH A;  1H3H A;  5I22 A;  1AVZ C;  2VWF A;  1T0J A;  3SHW A;  2A28 A;  4A63 B;  1S1N A;  2EPD A;  2C0I A;  1TG0 A;  1SEM A;  2FPD A;  2DL8 A;  3NHN A;  2BTT A;  2HCK A;  1ABO A;  1ZBJ A;  3REB B;  4QT7 A;  2K9G A;  2O88 A;  2DE0 X;  2DM1 A;  2EGA A;  3VRY A;  4D8K A;  1OPL A;  2F2W A;  4J9G A;  2YUQ A;  1G2B A;  1U3O A;  3R6N A;  4HCK A;  2DYB A;  1UJ0 A;  4X1V A;  1W70 A;  2FPF A;  2V1R A;  1VA7 A;  4CC7 A;  2GNC A;  1X6B A;  1YWP A;  4ORZ A;  2FEI A;  3M0U A;  5IHN A;  3SEM A;  2RQW A;  4RTX A;  3NGP A;  4Y92 A;  4R0K A;  1PNJ A;  2O31 A;  1KJW A;  1UHF A;  3M0P A;  5ECA A;  2JMC A;  2YUP A;  1T0H A;  2HSP A;  2CH4 W;  3H41 A;  2JS0 A;  4HVW A;  2DL3 A;  1EFN A;  1AD5 A;  2FPE A;  2EYW A;  1M27 C;  2RQR A;  2JS2 A;  3NPF A;  1QWE A;  2QDL A;  2CRE A;  1G83 A;  2FRW A;  3H0H A;  1SRM A;  2DA9 A;  3EHR A;  1VYV A;  4LUE A;  2LJ0 A;  5FW9 A;  3IQL A;  4CC3 A;  2DMO A;  3JV3 A;  1PKS A;  1UDL A;  2NWM A;  1IO6 A;  1W6X A;  4JPB W;  3REA B;  1J3T A;  1B07 A;  1Y0M A;  2BZ8 A;  3EG0 A;  3I5R A;  2EQI A;  1JXO A;  3ULR B;  1ZUK A;  1T3S A;  3M0Q A;  1JQQ A;  3EG2 A;  2D8J A;  2FO0 A;  2KYB A;  3VS1 A;  2X3X D;  4RTV A;  1YP5 A;  4J9B A;  4K11 A;  2CSQ A;  4IIO A;  1PRM C;  2HEQ A;  1LCK A;  1QCF A;  2G6F X;  2HBW A;  2BZX A;  1WI7 A;  1K0S A;  2EBP A;  1K9A A;  2F2V A;  2DL5 A;  3C0C A;  3M0T A;  2KXD A;  2V1Q A;  2RQV A;  5EC7 A;  2M51 A;  4AG2 C;  2CH4 A;  3UA7 A;  1JXM A;  2DL7 A;  1UEC A;  2LMJ A;  1GFC A;  1NG2 A;  4J9I A;  1H92 A;  1PWT A;  2YDL A;  3VS0 A;  2GTO A;  1E7O A;  1UFF A;  2DBK A;  3GBQ A;  2JM9 A;  2GBQ A;  2LQN A;  4IIM A;  3M0S A;  1JO8 A;  3QWX X;  1WIE A;  5HCK A;  4RTZ A;  1M3A A;  1OV3 A;  2DJQ A;  2RN8 A;  2ABL A;  3EG3 A;  4Z89 A;  2DBM A;  2X3W D;  2DF6 A;  4F17 A;  2W10 A;  2LNH B;  1HJD A;  2KT1 A;  2J05 A;  1CSK A;  4EIK A;  4RUG A;  4J9H A;  3TSZ A;  1NEG A;  1K0X A;  2KGT A;  1WXT A;  4OMP A;  3CQT A;  4D8D A;  3M0R A;  2JXB A;  1WDX A;  2AZV A;  1GCQ A;  1WA7 A;  2AKK A;  1I0C A;  1RLP C;  2YUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...