2F2XA

Alpha-spectrin sh3 domain r21g mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
b'ELVLALYDYQEKSPGEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
molecule tags Signaling protein
source organism Gallus gallus
publication title Cooperative propagation of local stability changes from low-stability and high-stability regions in a SH3 domain
pubmed doi rcsb
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2f2xA00
2KGTA 1RLQC 2X3WD 2FPDA 2RNAA 3I5SA 2M51A 2OI3A 1JQQA 3TVTA 4R0KA 2XMFA 4J9EA 4LE9A 1E7OA 2L3PA 1UJ0A 4JZ3A 2C0OA 5L23A 4OMPA 1YWPA 2YUOA 2CSIA 3I9QA 1X69A 2HEQA 2K79A 4K11A 4HVWA 3ZL7C 4F14A 1Y57A 2HBWA 3H0IA 4RTTA 3TSZA 4DEXA 2K2MA 1HJDA 1Y0MA 1OOTA 1X2KA 1BBZA 2ESWA 2ED1A 2EYYA 1WXUA 1S1NA 2JS2A 1K0XA 1JEGA 1W6XA 2C0IA 1T0HA 1YP5A 2LNHB 2FPFA 1H3HA 1WYXA 2KEAA 2EYWA 2EYZA 1K1ZA 4KRTA 1K76A 3VS4A 1ZUYA 4AG1C 1WLPB 2VWFA 2O9VA 2A37A 4JZ4A 2CREA 4J9FA 4OMMA 1B3QA 1UGVA 5IHNA 1A0NB 1E6GA 4RUGA 3NMZC 2A28A 3U23A 1OPKA 1JXMA 1KSWA 5IHKA 2KRNA 4JJDA 1YNZA 1AOJA 2KE9A 1V1CA 2RQTA 2YDLA 2SEMA 1T3LA 1ZLMA 3M0PA 1W1FA 3M0QA 1PHTA 3SEMA 5FWBA 1AEYA 1JU5C 2ABLA 1OPLA 1UE9A 3VRZA 2DBKA 3NHNA 4A63B 1SPKA 2ED0A 3A98A 2KROA 2FRYA 3FJ5A 2IIMA 2NWMA 1UHCA 3LH5A 2EGAA 5IHIA 2BZYA 1ARKA 1WA7A 1CKAA 2CUBA 2KYMA 1GCQA 1SEMA 3VS7A 2GGRA 2YSQA 3H0HA 3UF4A 2VKNA 1TUCA 3EG3A 1U06A 3PVLA 1YWOA 1JXOA 1H8KA 1I1JA 4OMOA 1FMKA 2GNCA 1QWFA 1GCPA 2RMOA 1Z9QA 1CKBA 4AFSC 1SHGA 1I0CA 2BZ8A 1K4US 1X2QA 4CC4B 1TUDA 2NUZA 2L3QA 1QKXA 2JTEA 4CC2A 1J3TA 4JJCA 1RI9A 2DL4A 1KFZA 3EHQA 2LMJA 3R6NA 3VS3A 3GBQA 2LQWA 1UHFA 2CSQA 2KNBB 1YCSB 2KRMA 1BB9A 5GJWB 3NPFA 1K0SA 2RPNA 2AK5A 1KIKA 2HCKA 2FRWA 1N5ZA 2DL8A 1JO8A 2JT4A 1NEGA 4Z88A 3JV3A 3PVQA 2KR3A 2CDTA 1U5SA 3EG1A 2OAWA 3NGPA 2EYXA 3ULRB 1AWWA 1UTIA 1RLPC 4HCKA 4Z89A 5I11A 2FPEA 1T0JA 1NM7A 1GFCA 2MIOA 1WDXA 2GTOA 2KXCA 1YN8A 1AZEA 1BU1A 3REAB 1AD5A 4LUDA 1ABQA 4J9CA 3VS0A 1LCKA 4CC7A 2ROLA 1UJYA 2LJ3A 4RTUA 2GBQA 1PWTA 1WX6A 2HDAA 2VVKA 1ZBJA 5I22A 2KRSA 3RNJA 2DL7A 4ZNXA 1HSQA 1MUZA 4OMQA 4X1VA 2J6OA 5EC7A 4HVUA 2DLPA 2KT8A 1ZSGA 3VS2A 1GRIA 4RTVA 1H92A 4J9GA 2A08A 4AFZC 2D0NA 2QDLA 1EFNA 1X6GA 1NEBA 2EQIA 3C0CA 2DRMA 2LQNA 3TSWA 2YUPA 1ZUUA 1AZGB 3QWYA 2OJ2A 3M0RA 3THKA 1AWJA 2HSPA 1OV3A 1M27C 2CT4A 4Z8AA 1QKWA 2D8HA 4CC3A 2LZ6B 4Y92A 4RTZA 3VS1A 2DNUA 2FEIA 1MV0B 4GBQA 1NYFA 2C0TA 2F2XA 2EW3A 2PNIA 2KT1A 4D8KA 1M3BA 2GQIA 2DVJA 2KYBA 1GBRA 1Z9ZA 2W10A 2D1XA 5ECAA 4AG2C 1VYUA 2L0AA 2J05A 4RTWA 2JM9A 4IIOA 2O31A 2L2PA 5IXBA 2EPDA 4WCIA 1ABOA 1M3AA 3KFVA 2LX7A 1M8MA 3REBB 2P4RA 2AZSA 1KJWA 2EVRA 3M0SA 1SRLA 5HCKA 1ZX6A 1E6HA 1U3OA 1WFWA 2DL3A 1VYVA 4GLMA 1I07A 4M4ZA 2CH4A 2EBPA 5FWCA 4JPBW 2RQUA 2YT6A 5GJVB 4DEYA 1UUEA 2J7IA 2MOXA 3VS5A 1SHFA 1T3SA 2FO0A 2YUQA 2CUDA 1OEBA 4LNPA 3UA7A 2D8JA 4LN2A 1WXTA 2O88A 1M3CA 2PZ1A 1X27A 2ECZA 4AFUC 2CT3A 1WXBA 2ROTA 5IH2A 2YUNA 4ESRA 1UECA 1QCFA 2RQVA 3PE0A 1UG1A 2EKHA 4HXJA 1X43A 3H41A 2JMCA 5FW9A 1FYNA 3M0TA 1SRMA 2SRCA 2K9GA 2DF6A 1NLOC 2A36A 1GBQA 1GFDA 1HD3A 2JS0A 2J6KA 2M0YA 3EGUA 2DILA 4QT7A 1AWOA 2BZXA 2RQRA 3I35A 4JJBA 2GTJA 1SSHA 2RF0A 2KBTA 2BTTA 2K7AA 1B07A 4J9HA 2DMOA 2MCNA 1G2BA 2F2WA 2PTKA 2O9SA 2RQWA 2LJ0A 4HVVA 1NYGA 3UA6A 4E6RA 1GCQC 1PRLC 2LCSA 2DYBA 3EG0A 2ENMA 2W0ZA 2E5KA 1PNJA 2AKKA 2K6DA 2DJQA 1PKSA 2RN8A 4OMNA 2L3SA 2G6FX 2K3BA 1XOVA 1NLPC 2JXBA 3VS6A 1PRMC 1X6BA 3M0UA 2DX1A 3H0FA 1GL5A 1UDLA 1WIEA 1MV3A 4J9BA 1W70A 4F17A 1ZUKA 1NG2A 5IXFA 4OMLA 2F2VA 3SHWA 1QWEA 4F16A 2DE0X 4FSSA 1VA7A 2DA9A 2H8HA 4IIMA 1WI7A 4D8DA 1M30A 4J9IA 3O5ZA 1QLYA 3CQTA 2B86A 2KXDA 4J9DA 4AFQC 2DBMA 4EIKA 2J6FA 3QWXX 2DL5A 2JM8A 3UATA 2JW4A 2CH4W 2X3XD 3IQLA 1IO6A 3RBBB 1K9AA 3I5RA 2LP5A 2I0NA 2DM1A 4LUEA 1PKTA 4RTYA 2FG0A 1G83A 2DRKA 1VYTA 1AWXA 3EG2A 1RUWA 2O2OA 2V1RA 2EGEA 2LJ1A 1TG0A 2JMAA 2AZVA 3EHRA 2AKLA 4RTXA 1CSKA 2J06A 1BK2A 4ORZA 1AVZC 3VRYA 2V1QA 1UFFA 2EGCA
chains in the Genus database with same CATH superfamily
5D6XA 1RLQC 3I56Q 3QG1A 5CK9A 2KAFA 3TVTA 4R0KA 2XMFA 3QO3A 4J9EA 1YHQA 1E7OA 3SWNA 1BIAA 3RMQA 3VYHB 1KD1C 4HVWA 3ZL7C 4Y91A 3H0IA 4IURA 3EAEA 1HJDA 1WHKA 5GAOn 2DEUA 2FVUA 1WGSA 2ESWA 3OB9A 2EYYA 5KH6A 1S1NA 2VV5A 1K0XA 1VIFA 2RH2A 2LNHB 3OA6A 2HL3A 4FIBA 4M7DB 3VS4A 1N6AA 2LRQA 1K76A 1YI2Q 4XTZA 4AG1C 1WLPB 2O9VA 2A37A 4PJNA 3OMCA 4M78C 4M77C 3M4YA 4BE0A 4OMMA 1UGVA 2DXUA 3QBYA 4C5IA 4E7SA 1VQOT 5DY9A 3U23A 5GAOm 4RCCA 2YRCA 5IHKA 4JJDA 2D6FA 1YNZA 3PT9A 1RAAB 2M16A 2E3HA 3CCQA 2OTLQ 2RQTA 2HD0A 2O01E 1PHTA 3S6WA 3L2VA 2DJZA 2H3EB 4C92E 2DBKA 3NHNA 1Q7YC 2QTVA 1MNDA 3G71A 3A98A 1M2VA 5J39A 2E6ZA 2EGAA 2Y90A 1VQ7A 1AHJB 1RAHB 1QCNA 1WA7A 4QVCA 4JS4A 4M7AE 3MP6A 2CUBA 4ZTFA 3LWIA 1M1KR 2QASA 1LOJA 3JCMV 2VKNA 3PVLA 3EG3A 2XDBA 3OYLA 1H8KA 3DLMA 1I1JA 1Q95G 3V7CA 1FMKA 5CCAA 3M4GA 2XHCA 4R55A 3FB9A 1Z9QA 1VQKQ 5J3BA 4AFSC 1EZZB 4C8QA 2BZ8A 2ZPIB 9ATCB 1TUDA 4MMKA 4X9CA 1ZA1B 3FDRA 2QEXQ 2NUZA 2P4TA 2MK5A 2DAQA 4JJCA 5I2MA 5AT1B 3A8GB 5GAOl 3VS3A 3A8MB 2DD5A 2CSQA 2HQEA 2KNBB 4XU1A 2YLBA 2VB6A 2M0OA 1OI1A 4GLKA 5GJWB 1MGQA 1P92A 2RPNA 2HCKA 3NTIA 2FRWA 2X9HA 1ZQ1A 2DL8A 1JO8A 5CO7A 1BI3A 4PJLA 3DKMA 4C92D 3NGPA 1WZOA 3JCMc 2HKNA 1JB0E 4XK8E 5I11A 4Z89A 4M77G 4M75A 1T0JA 1NM7A 2ZPBB 1KQSP 1R0BG 3CCVT 3CCJQ 1D0YA 1RI0A 4M7AG 3M56A 1ABQA 3CCJA 3X28B 3VS0A 1KQ1A 3Q1JA 2LCLA 2ROLA 1UJYA 3HL8A 4MDXA 3EH1A 1C1AA 1PWTA 3MP8A 5KYNA 2HDAA 1LNXA 2KRSA 4NL2A 3RNJA 1RACB 2DL7A 5D6YA 4BACA 1OU9A 2DD4A 4CRIA 3E9GA 1TOVA 2J6OA 4GY5A 4F7UA 4FU6A 4BDYA 4HVUA 2BE9B 2DLPA 3VS2A 3J7AF 1GRIA 1D1CA 2A08A 2WSFE 1VQ9Q 5GMKm 3AHUA 5FRNA 2L89A 1VQ9A 2LQNA 3QKJA 1Y07A 1YJNA 1ZUUA 3UDCA 3M0RA 4PLLA 4OGCA 2HSPA 1OV3A 2D8HA 2MYSA 3M58A 4RTZA 4JLGA 1M1FA 5LJ3e 1IREB 2JVVA 1OZ3A 2QAZA 4PJOE 5CR2A 3V8JA 4WTOB 4FW2A 2QG9B 2GQIA 2OTJT 3MKDA 1G3SA 2RHYA 3A8LB 1GBRA 2P0KA 2Y4YA 2CYZB 2RD1A 4AG2C 3LGFA 1LJOA 3HRTA 3CCMQ 4HCZA 1ZHIA 2FYKA 4RKUE 1RABB 4ATOA 3MO8A 4J7IA 1KC8C 4M77D 3V7SA 4XTYA 4OGEA 1WPYA 5KCOA 1M3AA 2K2VA 4KULA 3REBB 4J5YA 2DETA 4OB3B 2EVRA 2HNIA 3M0SA 5HCKA 4E7IA 4UC4A 4JRKA 4DBHA 1Y96B 4PJJA 1JJ2S 3I55T 2YT6A 1VQ4T 1R0CB 2MOXA 2LT4A 1OEBA 1VQ8A 1VQMQ 3T9NA 2FHDA 3DB4A 1QP2A 1ZSZB 1M3CA 4OF1A 1X27A 1NPRA 1I5OB 3E1SA 4BE1A 1M9SA 3GF5A 3CMEQ 3CC7Q 3ZEHA 3QUIA 4ESRA 4FCYA 3OBWA 3G6ET 3PE0A 4PJOD 1NPPA 3GLXA 2EKHA 3CCJT 4HXJA 3S3NA 4VUBA 4BB7A 2CP2A 4RG2A 3H41A 4JJNK 1FYNA 2QA4Q 3JB9D 1SRMA 2SRCA 2K9GA 1NLOC 2OTJA 2JS0A 1K73C 4C92G 3I35A 4JJBA 1SSHA 2RF0A 2DEQA 2C06A 2MCNA 4C5GA 2F2WA 2EJ9A 2RJCA 2O9SA 3OYFA 4E6RA 3UA6A 2LCSA 3EG9A 4M78E 2ENMA 5J26A 3LW5E 2EQKA 4E7HA 2DJQA 2X35A 2CZ7B 3CPWP 1WHLA 1XOVA 3M9QA 2JXBA 3VS6A 1PRMC 2MMPA 4C92C 3M0UA 2DX1A 2DXCA 3FIFA 4KT0E 3C94A 3TREA 1UDLA 2Z0WA 3OSVA 4PFPA 3GNFB 5IXFA 3JCMe 4OMLA 5KYYB 4F16A 4IIMA 1M30A 3P8DA 3SFMA 5FRMA 4PJOA 1MHNA 2X4XA 5GANf 2RI3A 3OW2A 1QLYA 1YJWT 2KXDA 4J9DA 5CQYA 3NTHA 4EIKA 4F7UE 4M75E 2DL5A 2JM8A 1EX4A 3D7SB 4EMKC 3CD6Q 2P0QA 4BUGA 3JCMW 4IUTA 1KD1R 2XIDA 3MHXA 2QQRA 3IQLA 3M57A 3CCUA 5FU6C 1Y96A 1PKTA 3RESA 1D1AA 2NUTA 4J6YA 2DZCA 3RMSA 2L3RA 2V1RA 2X4WA 3MPUB 4C5EA 3GP8A 1KG1A 3EHRA 1OYXA 2KVQG 2HBPA 1AVZC 4ORZA 3GOXA 1S72A 2QA4A 4FYVB 1WNLA 4PL6A 2X3WD 2JOYA 1WJQA 1PCXA 1N8RU 3BY7A 1WHJA 1YJNT 2VGMA 1Q81U 4DBFA 1UJ0A 2PUOB 3CMAT 4OMPA 3HRSA 2CSIA 2MI6A 4N4IA 5LJ3f 2HEQA 1BYMA 5GAMf 4F14A 1Y57A 4RTTA 4DEXA 3TSZA 4J6XA 2K2MA 4M7DC 2QEXA 2R5AA 1QW1A 1OOTA 4RCBA 2I2LA 2ED1A 3OYJA 4A4EA 1Q7YR 2RJDA 1JEGA 2G3RA 2KK4A 1T0HA 1YP5A 2FPFA 1WYXA 1I4K1 4A53A 4XU3A 2VWFA 2QQAA 1BCOA 2KI7A 4ME7A 1K9MR 1V29B 5IHNA 2V26A 3JB9G 4RUGA 3MEUA 3CC4A 3LX7A 3LH0A 3JAME 1KSWA 4QVZA 4PJOG 1PD0A 1V1CA 3OYYA 3CC2Q 4AT1B 3OYGA 2YDLA 4JS5A 3M0PA 3SDZA 5FLXE 2IVWA 5FWBA 1AEYA 2ABLA 3CCUQ 1UE9A 2RO0A 2VC8A 2ED0A 4O6JA 4F7UG 2ATCB 2KROA 3UT1A 3KUFA 1W2BP 2CZ6B 4MZTA 1C0MA 5IHIA 1ARKA 1UGSB 5KE2A 1CKAA 1S72Q 3MP1A 4PJOC 1YITA 2KYMA 2COZA 1N9SA 3UF4A 5GAN8 1N9RA 2QQSA 3G4SQ 1JXOA 4KH1B 5KYUA 4XTWA 2GNCA 1GCPA 3H8ZA 1FMVA 3OYHA 3GPLA 3RKWA 2XK0A 4C92A 3C4SA 1VQ9T 2XD0A 1SHGA 4HT9A 8ATCB 3CCEA 3M59A 5GAMh 2E64A 4J7FA 1IGUA 1J3TA 3OYBA 2LMJA 4KUDK 1O75A 3NFCA 1BB9A 1RAEB 1KK7A 4JRQA 5D6WA 1Y7XA 3BDUA 2RHIA 1UB4A 1N5ZA 2JT4A 4Z88A 2QXFA 4JRPA 1M90C 1NJIC 1UGQB 4IUQA 3PVQA 2KR3A 3SWNC 3CCLA 4M7AC 3PMTA 1VQPQ 4M7DE 2COWA 5L8RE 4C8QG 3OS0A 3CCLQ 2EYXA 4FW1A 1AWWA 4HCKA 4M75F 2FPEA 1Q82C 1BI2A 1VQPA 3CC4T 2RK2A 2MIOA 4QVDA 3HFOA 4ZN1A 1YN8A 2QDYB 3MEAA 1AD5A 4LUDA 1Q81C 1KQ2A 2CP5A 3JCMX 4M77E 2GBQA 2XU8A 5GAN2 1I5LA 5GMKh 4PJOB 4EMHA 2XICA 4E7ZA 2GFAA 4O5VA 1ZSGA 4RTVA 5KCHA 2D0NA 5GAN4 1X6GA 1EFNA 1OULA 3CMEA 3CC7A 4AMCA 3G4SA 3CCRA 2YLCA 2DIQA 3TSWA 2YUPA 4QQ6A 3CCQT 3CBOA 3THKA 1AWJA 1M27C 2V8JA 4Z8AA 3G6EQ 3BFMA 2R57A 2ZZDA 2LZ6B 3VS1A 5CKBA 2VUBA 1VOMA 1NJIR 5GANe 1R77A 3CXCP 2ZPHB 2DVJA 1U8RA 3OYAA 1VQ5T 2W10A 4ZGEB 2D1XA 2JTMA 1ZBXA 2J05A 1M1KC 2BE7D 4M7DG 2LQKA 1VQ8Q 4IIOA 2L2PA 2E41A 2LTOA 4X34A 1OX9A 1TUGB 5IXBA 4V2SA 2OX7A 2EPDA 1QVGA 1ABOA 2F1LA 1SRLA 1Y71A 1U3OA 2NUTB 2RJFA 3EGXB 2X4JA 2DPPB 1DJ7B 1X01A 2QYZA 1VYVA 4ZGJB 1I07A 3OW2P 4M4ZA 2EBPA 1MMGA 2RQUA 5GJVB 3EG9B 3HSBA 1TTHB 2ZAEA 3JB9I 3MJXA 1LVKA 1YBYA 2DO3A 3OMGA 3A5ZB 1RADB 1C6VX 1JJ2A 2ECZA 4A4FA 1M1GA 1TU0B 2CT3A 2K5IA 5IH2A 4EDUA 3CCRQ 1ZA2B 3N5BB 5FU6B 4FYWB 1UECA 3EFSA 1BKBA 3EH2A 1V76A 4KGVB 4QQDA 4EMKB 5LJ5e 4B9WA 4LDXA 2DERA 5CIUA 3CD6A 2YXYA 3CXCS 3JCMP 1TSFA 1D0XA 2DF6A 4LDYA 1GFDA 2DIGA 2M0YA 3META 3EGUA 1D3BB 3G71Q 2DILA 2BZXA 3VUBA 3UPUA 2GTJA 3CEYA 2BTTA 2IPOB 2E4HA 2K7AA 4J9HA 1XJWB 2DMOA 1G2BA 2KDSA 4PFOA 2PTKA 1BI0A 2LJ0A 2DYBA 3FLGA 3EG0A 5GAOq 4C92B 3ZBDA 2W0ZA 1WHGA 3CCQQ 1YJ9Q 3E19A 2E5KA 4J8OA 1Q86C 4LDUA 3PGGA 2K6DA 1PKSA 3FJPA 1FWZA 1TS9A 2L3SA 2K3BA 1YJ9A 2L8DA 2D0QB 1BIBA 1U1TA 3HTRA 4JUVA 3CD6T 4J9BA 4OB1B 2YRVA 2E6NA 2X51A 1YJWQ 3A8HB 3I55Q 1B7TA 4A4KA 2FZGB 1VQ6T 1VA7A 4ANJA 3BE3A 4HCCA 1M2VB 3OSSC 3CPWA 4YTLA 4E7LA 2DBMA 3EFOB 2J6FA 4NS5A 2MWOA 3JB9F 3UATA 2JW4A 3JRZA 2JZ2A 1IO6A 2MF2A 3RBBB 3TCJA 3I5RA 2HL5C 2LP5A 3NTKA 1IZ6A 2WACA 4M77F 1VQKA 3LYIA 2COYA 3OYEA 2DRKA 1VYTA 1Q86R 2PVGB 4DQ2A 3FC3A 2EGEA 4HA8A 1TG0A 4JLIA 2AKLA 2J06A 5CKDA 1UFFA 2EGCA 4OVAA 2KGTA 2FPDA 1HXDA 3CPWS 2EQJA 1AT1B 2KQWA 2RNAA 3I5SA 1XTDA 4BY6B 2M51A 2OI3A 1JQQA 1KD1U 4DBRA 5FU7B 4KGXB 1NE8A 2L3PA 4JDSA 4JZ3A 2C0OA 5L23A 4M7AA 4M7AF 2DZ9A 1F1BB 4M78G 2K79A 4FL6A 5GANh 2CP3A 4K11A 3OS5A 2QI2A 1G3WA 3F70A 4M75C 2RHUA 5GAMe 1X2KA 2EQUA 4BI8B 3EFOA 2K5LA 1YI2T 2XI9A 1W6XA 2C0IA 2DTHA 1YHQT 1H3HA 4C8QE 2KEAA 2EYWA 2EYZA 4KRTA 1ZUYA 3QZ5B 4BI4A 4B9XA 4JZ4A 1MMDA 5A0DA 1IB8A 4XAXB 4J9FA 1B3QA 1X75C 1K73R 1OQKA 3NMZC 2A28A 1UGRB 4PLIA 1ZSZA 2KRNA 1AOJA 4X9DA 5GAOr 2CKKA 1PD1A 1M90R 4NOYA 1ZLMA 2E70A 5DLQE 4LD9K 2MPXC 1VIEA 5CAIA 2DKGA 3LLRA 1EIFA 3VRZA 4A63B 1O9SA 3KBGA 1SPKA 3CMET 3CC7T 3QZ9B 1Q82R 1UGPB 4M7AB 2QQBA 3CCLT 3FJ5A 3SWNB 3QSUA 5FROA 1K8AC 2K4YA 1VQMA 3LH5A 1VQMT 1YJ9T 1GCQA 1SEMA 3VS7A 3JCMb 2F5TX 2YSQA 3H0HA 4N0AC 5LJ5h 4MMLA 5LJ5f 2X4YA 2FZCB 3HPWA 4LDWA 1JJ2P 1CKBA 3PNWC 3TU4K 1MMAA 1VQOQ 4CC4B 2AT1B 2XKOC 3S3OA 4FYYB 2L3QA 1QKXA 5HK3A 2HMAA 3URGA 4CC2A 1RI9A 2ZPFB 5GMKl 3EHQA 3GBQA 2LC4A 4QW2A 2NUPB 1YCSB 3G4ST 2KRMA 5LJ3g 2OAUA 1I8FA 2MAMA 5CKHA 3QYHB 3QJYA 4QQGA 4J83A 1VQ4A 1VQNT 1KIKA 1SF9A 3LWHA 5GANj 4XQ3A 1NEGA 2E10A 2O4XB 3G7ZA 1IRXA 3DB3A 3JV3A 1QVFS 1D09B 1N8RR 1UTIA 3QIIA 4IUUA 2O4XA 4M7DA 3CCET 3EGDA 4B6MA 4L59A 1K8AR 2GTOA 2KXCA 2M02A 2EQMA 1AZEA 1BU1A 3ER0A 1M4ZA 3REAB 4BI3A 4J9CA 2OTLA 3CXCA 3OBYA 2VASA 2LJ3A 3JCMJ 3A8OB 5GAOp 2VVKA 4M77A 2DXTA 4C8QB 1MUZA 2RK1A 2BIVA 5KYYA 5EC7A 5GMKi 2KT8A 4M78D 4XU0A 4RMOA 1H92A 8AT1B 1K9MU 1WQ7A 1QVGP 2DRMA 1QMCA 4ZN3A 3VYGA 1W2BS 1AZGB 2K3YA 3QWYA 4DOVA 1MMNA 3M5AA 4EMGA 1VQOA 2WSEE 4Y92A 2DNUA 3OYCA 3DLLA 4PJMA 1MV0B 4M77B 7AT1B 1VQ6A 4GBQA 2C0TA 2ZCFB 2F2XA 3X25B 3CCST 2EW3A 2PNIA 3TEEA 5IT9E 2EKOA 4FT2A 2KT1A 1G5VA 3OQ5A 4M78B 1ZSZC 4M7AD 2KYBA 5KE3A 2EYQA 2CZ0B 2V8KA 5D7UA 2L0AA 2OTJQ 4M75G 5KYUB 4RTWA 3OYIA 2VYTA 3OY9A 3CCSQ 1Q82U 2B8AA 1OZ2A 1UEBA 3CCSA 3TQ7P 4WCIA 3FRNA 4PNOA 4FT4A 2AZSA 5GAN6 4Z02A 1KJWA 3KXTA 1M8VA 1G3TA 1BCMA 2DXBA 4F7UB 1HYOA 1E6HA 3M54A 2HQXA 2NYSA 5GAN5 1WFWA 3PIPA 4PKCC 2BKDN 4LDVA 2CH4A 3PIOA 5FWCA 4JPBW 2YRDA 4BDZA 4L5GA 4FM4B 4IUPA 3VS5A 1WJRA 5A2QE 1T3SA 2FO0A 3G1JA 1VQLA 1K9MC 2QGFB 1TH7A 5CVIA 3UA7A 3SD4A 5LJ3d 4ZTJA 4LN2A 1WXTA 5LJ3j 2O88A 4RG8A 1YJWA 1D3BA 2ROTA 2DFUA 5GAMj 3CPFA 1PC0A 3I56A 1RAIB 5A0GA 3OS1A 4DA4A 5KYXA 5CKEA 2JMCA 4XU2A 2OTLT 5FW9A 3M0TA 3V8KA 1VQLQ 2A36A 3MCAB 4MZMA 3FEOA 1Q81R 1AWOA 2DTIA 5KYWA 5HY6A 2KBTA 1N8RC 2QTXA 4HKEA 4M78A 1YITT 1B07A 1HK9A 2PU9B 2QGGA 4LD6A 2QK0A 2EAYA 1NYGA 1GCQC 4E47A 3P8BB 3PMIA 5KYWB 1PSFA 2FZKB 3CC2A 2AKKA 2RN8A 3L2ZA 3L1AA 5LJ3h 1NLPC 1X6BA 4E7JA 3H0FA 1GL5A 2YHTA 4F17A 1WQWA 1NG2A 1VQ8T 3CCUT 1JBMA 2DE0X 4FSSA 3JB9H 5CKFA 2H8HA 3QHSA 1WI7A 1QVGS 1NJIU 3O5ZA 2RB6A 3CQTA 3ASKA 2B86A 1IHWA 3QYGB 2H3JA 4P5NA 4AFQC 3QWXX 3E9FA 1YJNQ 3J81E 3INZA 1OX8A 1QQJA 1K9AA 4C8QF 2JN0A 2NLUA 1SSFA 4LXCA 2I0NA 3X26B 1U1SA 2RHXA 3VV0A 5GANd 1QCOA 2HQHA 2V8IA 4XTXA 4RTYA 2FG0A 2GCXA 4OP0A 3CMAQ 1JRIA 2P0PA 1AWXA 1FXXA 3ZFJA 1RUWA 2EJGA 1YITQ 2HSEB 4BD3A 2AZVA 4RTXA 1CSKA 1BK2A 1VQNA 2V1QA 4ELYC 3SB2A 2PVOB 4PK4A 3M53A 4E2FB 2E12A 4PFZA 3JB9J 4LE9A 4C92F 3L2QA 2LX9A 1YWPA 4KH0B 2YUOA 3I9QA 1NZ9A 1X69A 2HBWA 3JCMg 3L2WA 3VU3C 1VQ7T 5DLOA 2MWPA 1Y0MA 1BBZA 2E1HA 1WXUA 2JS2A 4C0DB 2BUDA 4R56A 4Q5WA 3CC2T 1KQSS 5HK0A 1QVFA 1K1ZA 4M75B 3HP9A 5GMKj 2AHJB 2PVDB 2RI5A 3JCMf 2JUFA 3O8VA 2GQVA 1SKUB 1VUBA 2CREA 1YFNA 3BW1A 1A0NB 1QP3A 1E6GA 1X6OA 5FU7C 1VQ5A 1K8AU 3PTAA 1OPKA 1NBEB 1JXMA 1VQ5Q 1MNEA 2KE9A 2QQ9A 2SEMA 3OYMA 2P84A 1T3LA 1W1FA 2YWWA 4M7DD 3M0QA 4NL3A 3SEMA 1M5Q1 1JU5C 1YI2A 2CP7A 1OPLA 3UWNA 5C6SA 3C95A 3BDLA 2LVMA 3HHTB 4C8QD 1KC8U 2ZPEB 2FRYA 4CI0C 2IIMA 2NWMA 3AT1B 5I21A 4OB0B 1UHCA 2ZGWA 2K57A 1VQ6Q 2BZYA 2GF7A 1PG5B 4MDWA 2PUKB 4XTVA 4FSXA 4M7DF 4TVRA 5KYXB 3JCMd 2GGRA 1TUCA 1IXDA 1U06A 2RM4A 1LPLA 4EMKA 2PQWA 1YWOA 3QJ6A 1KHIA 4II1A 4WF2A 4OMOA 2M1HA 1QWFA 3RUXA 2RMOA 2KSSA 3P8HA 3OW2S 1WHHA 6AT1B 2KY9A 3QDFA 2DK3A 1IHVA 1I0CA 1K4US 1X2QA 2F69A 2JTEA 5LJ5j 4KUIA 2DL4A 4C5HA 2LDMA 1M2OA 5CQXA 1KFZA 4IKFA 3R6NA 2LQWA 1UHFA 1VQ4Q 1Q86U 2RJEA 2LT1A 2CP6A 4E7KA 4A4HA 3NPFA 1K0SA 2AK5A 5GANg 3EGXA 3X24B 4D6WA 3V7RA 3L2UA 2CDTA 1U5SA 2A0FB 2F5KA 3EG1A 2OAWA 4F7UF 2VXEA 2VGNA 1YIJA 1S72T 3ULRB 1RLPC 4QKUA 1RAFB 1GFCA 4FYXB 1WDXA 1FMWA 4PJOF 3VJPA 2RHZA 2HZYA 2CGHA 1SG5A 1YCYA 3CCRT 1LCKA 4CC7A 1VQKT 2EWNA 4RTUA 1BI1A 2QA4T 5GMKe 1G3YA 2CS7A 1WX6A 3VKIA 5I22A 1ZBJA 4M78F 3RKYA 4A4GA 3WVEB 1YIJQ 4ZNXA 1HSQA 3L42A 4OMQA 3CC4Q 4X1VA 1GXIE 3JSCA 3CMAA 3RERA 4J9GA 4AFZC 1PM3A 3QDRB 2QDLA 1NEBA 1K73U 2EQIA 3C0CA 1M1KU 5GAMg 5C0MA 2LNVA 2K5FA 3EFRA 2OJ2A 1FX7A 5DM7R 4KBMB 2CT4A 2M9UA 1QKWA 4CC3A 3LGLA 4OMFB 1TWBA 4A54A 1QVPA 2FEIA 5LJ5g 1NYFA 2WSCE 2HKQB 3J80E 3I55A 4D8KA 1IGQA 1M3BA 2KMTA 1OU8A 4J6WA 4N0AA 2K3XA 3MEWA 3I56T 1Z9ZA 1D1BA 5ECAA 3RKXA 1VYUA 4C0GA 4L6V5 2IG0A 3CCVQ 4C0DC 2JM9A 4C0ZA 3MEVA 1I81A 2O31A 2HAXA 3CCVA 4C8QC 2DYIA 3WVDB 3CCEQ 5A0LA 3RIRA 3C12A 2DTOA 5AYFA 3KFVA 3G71T 2LX7A 3OS2A 1M8MA 4BE2A 4M75D 5GAMd 2L5QA 2P4RA 1YIJT 5M9OA 3VUZA 1ZX6A 1KQSA 3CCMT 3HFNA 3ME9A 2DL3A 3M55A 4GLMA 5LL6S 4DEYA 1UUEA 2J7IA 2JTFA 3V8LA 1SHFA 2DVEA 5GAN3 2YUQA 2R5MA 3H9NA 2CUDA 4LNPA 3A1PA 2D8JA 3CBPA 5EG2A 4HCBA 2PZ1A 3E2UA 3JCMQ 4AFUC 1WXBA 3PFSA 1PSEA 3H6ZA 2YUNA 5IAYA 2JNGA 1QCFA 2RQVA 1UG1A 4KGZB 1X43A 3L2RA 4BY6C 4HT8A 2A3LA 2RA2A 1GBQA 3CCMA 1HD3A 2QEXT 2J6KA 2FB7A 4EPCA 1B34A 2E3IA 1VQPT 4QT7A 2CZ1B 2NUPA 2RQRA 2A7YA 1RAGB 1VQLT 3CBMA 2CP0A 1YHQQ 1H641 4MZPA 2RQWA 4ZGDB 1WJSA 4HVVA 3QPHA 1PRLC 4DOWA 4N4GA 4Y28E 2E5QA 2JJ9A 3RDVA 1B34B 2E65A 2AIRB 4N4HA 1PNJA 3S3MA 3GNGA 3WXMB 4OMNA 3G6EA 2G6FX 2EJFA 2XDPA 2LCCA 4F04B 3HRUA 3OYKA 1W4SA 1H3ZA 4IUVA 1WIEA 1MV3A 5I2SA 1W70A 1ZUKA 2F2VA 4DBQA 1RL2A 3JCMh 3SHWA 1KHCA 5HKCA 4XTUA 1QWEA 1R8OB 2FL7A 2EIFA 3RR6A 2DA9A 3HKSA 2D9TA 5GAN7 2ZPGB 4D8DA 4J9IA 1XQHA 1N27A 1XNIA 5LJ5d 2XDDA 1G8XA 2Y4XA 1VQNQ 2EFIA 1M90U 2VXFA 4C0FA 3OYDA 2CH4W 3GIBA 2X3XD 1WHMA 1KC8R 2DM1A 4LUEA 4ELZC 1D0ZA 3OYNA 1W2BA 1G83A 3EGDB 5IN1A 1TXQA 2LQ8A 4OB2B 1ACMB 3EG2A 2RI2A 1QVFP 2O2OA 3X20B 2LJ1A 2JMAA 1VQ7Q 2XG8D 1Q7YU 3R6OA 2GFUA 2R58A 3VRYA 4JRIA 3QXEB
chains in the Genus database with same CATH topology
2KGTA 1RLQC 2X3WD 2FPDA 2RNAA 3I5SA 2M51A 2OI3A 1JQQA 3TVTA 4R0KA 2XMFA 4J9EA 4LE9A 1E7OA 2L3PA 1UJ0A 4JZ3A 2C0OA 5L23A 4OMPA 1YWPA 2YUOA 2CSIA 3I9QA 1X69A 2HEQA 2K79A 4K11A 4HVWA 3ZL7C 4F14A 1Y57A 2HBWA 3H0IA 4RTTA 3TSZA 4DEXA 2K2MA 1HJDA 1Y0MA 1OOTA 1X2KA 1BBZA 2ESWA 2ED1A 2EYYA 1WXUA 1S1NA 2JS2A 1K0XA 1JEGA 1W6XA 2C0IA 1T0HA 1YP5A 2LNHB 2FPFA 1H3HA 1WYXA 2KEAA 2EYWA 2EYZA 1K1ZA 4KRTA 1K76A 3VS4A 1ZUYA 4AG1C 1WLPB 2VWFA 2O9VA 2A37A 4JZ4A 2CREA 4J9FA 4OMMA 1B3QA 1UGVA 5IHNA 1A0NB 1E6GA 4RUGA 3NMZC 2A28A 3U23A 1OPKA 1JXMA 1KSWA 5IHKA 2KRNA 4JJDA 1YNZA 1AOJA 2KE9A 1V1CA 2RQTA 2YDLA 2SEMA 1T3LA 1ZLMA 3M0PA 1W1FA 3M0QA 1PHTA 3SEMA 5FWBA 1AEYA 1JU5C 2ABLA 1OPLA 1UE9A 3VRZA 2DBKA 3NHNA 4A63B 1SPKA 2ED0A 3A98A 2KROA 2FRYA 3FJ5A 2IIMA 2NWMA 1UHCA 3LH5A 2EGAA 5IHIA 2BZYA 1ARKA 1WA7A 1CKAA 2CUBA 2KYMA 1GCQA 1SEMA 3VS7A 2GGRA 2YSQA 3H0HA 3UF4A 2VKNA 1TUCA 3EG3A 1U06A 3PVLA 1YWOA 1JXOA 1H8KA 1I1JA 4OMOA 1FMKA 2GNCA 1QWFA 1GCPA 2RMOA 1Z9QA 1CKBA 4AFSC 1SHGA 1I0CA 2BZ8A 1K4US 1X2QA 4CC4B 1TUDA 2NUZA 2L3QA 1QKXA 2JTEA 4CC2A 1J3TA 4JJCA 1RI9A 2DL4A 1KFZA 3EHQA 2LMJA 3R6NA 3VS3A 3GBQA 2LQWA 1UHFA 2CSQA 2KNBB 1YCSB 2KRMA 1BB9A 5GJWB 3NPFA 1K0SA 2RPNA 2AK5A 1KIKA 2HCKA 2FRWA 1N5ZA 2DL8A 1JO8A 2JT4A 1NEGA 4Z88A 3JV3A 3PVQA 2KR3A 2CDTA 1U5SA 3EG1A 2OAWA 3NGPA 2EYXA 3ULRB 1AWWA 1UTIA 1RLPC 4HCKA 4Z89A 5I11A 2FPEA 1T0JA 1NM7A 1GFCA 2MIOA 1WDXA 2GTOA 2KXCA 1YN8A 1AZEA 1BU1A 3REAB 1AD5A 4LUDA 1ABQA 4J9CA 3VS0A 1LCKA 4CC7A 2ROLA 1UJYA 2LJ3A 4RTUA 2GBQA 1PWTA 1WX6A 2HDAA 2VVKA 1ZBJA 5I22A 2KRSA 3RNJA 2DL7A 4ZNXA 1HSQA 1MUZA 4OMQA 4X1VA 2J6OA 5EC7A 4HVUA 2DLPA 2KT8A 1ZSGA 3VS2A 1GRIA 4RTVA 1H92A 4J9GA 2A08A 4AFZC 2D0NA 2QDLA 1EFNA 1X6GA 1NEBA 2EQIA 3C0CA 2DRMA 2LQNA 3TSWA 2YUPA 1ZUUA 1AZGB 3QWYA 2OJ2A 3M0RA 3THKA 1AWJA 2HSPA 1OV3A 1M27C 2CT4A 4Z8AA 1QKWA 2D8HA 4CC3A 2LZ6B 4Y92A 4RTZA 3VS1A 2DNUA 2FEIA 1MV0B 4GBQA 1NYFA 2C0TA 2F2XA 2EW3A 2PNIA 2KT1A 4D8KA 1M3BA 2GQIA 2DVJA 2KYBA 1GBRA 1Z9ZA 2W10A 2D1XA 5ECAA 4AG2C 1VYUA 2L0AA 2J05A 4RTWA 2JM9A 4IIOA 2O31A 2L2PA 5IXBA 2EPDA 4WCIA 1ABOA 1M3AA 3KFVA 2LX7A 1M8MA 3REBB 2P4RA 2AZSA 1KJWA 2EVRA 3M0SA 1SRLA 5HCKA 1ZX6A 1E6HA 1U3OA 1WFWA 2DL3A 1VYVA 4GLMA 1I07A 4M4ZA 2CH4A 2EBPA 5FWCA 4JPBW 2RQUA 2YT6A 5GJVB 4DEYA 1UUEA 2J7IA 2MOXA 3VS5A 1SHFA 1T3SA 2FO0A 2YUQA 2CUDA 1OEBA 4LNPA 3UA7A 2D8JA 4LN2A 1WXTA 2O88A 1M3CA 2PZ1A 1X27A 2ECZA 4AFUC 2CT3A 1WXBA 2ROTA 5IH2A 2YUNA 4ESRA 1UECA 1QCFA 2RQVA 3PE0A 1UG1A 2EKHA 4HXJA 1X43A 3H41A 2JMCA 5FW9A 1FYNA 3M0TA 1SRMA 2SRCA 2K9GA 2DF6A 1NLOC 2A36A 1GBQA 1GFDA 1HD3A 2JS0A 2J6KA 2M0YA 3EGUA 2DILA 4QT7A 1AWOA 2BZXA 2RQRA 3I35A 4JJBA 2GTJA 1SSHA 2RF0A 2KBTA 2BTTA 2K7AA 1B07A 4J9HA 2DMOA 2MCNA 1G2BA 2F2WA 2PTKA 2O9SA 2RQWA 2LJ0A 4HVVA 1NYGA 3UA6A 4E6RA 1GCQC 1PRLC 2LCSA 2DYBA 3EG0A 2ENMA 2W0ZA 2E5KA 1PNJA 2AKKA 2K6DA 2DJQA 1PKSA 2RN8A 4OMNA 2L3SA 2G6FX 2K3BA 1XOVA 1NLPC 2JXBA 3VS6A 1PRMC 1X6BA 3M0UA 2DX1A 3H0FA 1GL5A 1UDLA 1WIEA 1MV3A 4J9BA 1W70A 4F17A 1ZUKA 1NG2A 5IXFA 4OMLA 2F2VA 3SHWA 1QWEA 4F16A 2DE0X 4FSSA 1VA7A 2DA9A 2H8HA 4IIMA 1WI7A 4D8DA 1M30A 4J9IA 3O5ZA 1QLYA 3CQTA 2B86A 2KXDA 4J9DA 4AFQC 2DBMA 4EIKA 2J6FA 3QWXX 2DL5A 2JM8A 3UATA 2JW4A 2CH4W 2X3XD 3IQLA 1IO6A 3RBBB 1K9AA 3I5RA 2LP5A 2I0NA 2DM1A 4LUEA 1PKTA 4RTYA 2FG0A 1G83A 2DRKA 1VYTA 1AWXA 3EG2A 1RUWA 2O2OA 2V1RA 2EGEA 2LJ1A 1TG0A 2JMAA 2AZVA 3EHRA 2AKLA 4RTXA 1CSKA 2J06A 1BK2A 4ORZA 1AVZC 3VRYA 2V1QA 1UFFA 2EGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGT A;  1RLQ C;  2X3W D;  2FPD A;  2RNA A;  3I5S A;  2M51 A;  2OI3 A;  1JQQ A;  3TVT A;  4R0K A;  2XMF A;  4J9E A;  4LE9 A;  1E7O A;  2L3P A;  1UJ0 A;  4JZ3 A;  2C0O A;  5L23 A;  4OMP A;  1YWP A;  2YUO A;  2CSI A;  3I9Q A;  1X69 A;  2HEQ A;  2K79 A;  4K11 A;  4HVW A;  3ZL7 C;  4F14 A;  1Y57 A;  2HBW A;  3H0I A;  4RTT A;  3TSZ A;  4DEX A;  2K2M A;  1HJD A;  1Y0M A;  1OOT A;  1X2K A;  1BBZ A;  2ESW A;  2ED1 A;  2EYY A;  1WXU A;  1S1N A;  2JS2 A;  1K0X A;  1JEG A;  1W6X A;  2C0I A;  1T0H A;  1YP5 A;  2LNH B;  2FPF A;  1H3H A;  1WYX A;  2KEA A;  2EYW A;  2EYZ A;  1K1Z A;  4KRT A;  1K76 A;  3VS4 A;  1ZUY A;  4AG1 C;  1WLP B;  2VWF A;  2O9V A;  2A37 A;  4JZ4 A;  2CRE A;  4J9F A;  4OMM A;  1B3Q A;  1UGV A;  5IHN A;  1A0N B;  1E6G A;  4RUG A;  3NMZ C;  2A28 A;  3U23 A;  1OPK A;  1JXM A;  1KSW A;  5IHK A;  2KRN A;  4JJD A;  1YNZ A;  1AOJ A;  2KE9 A;  1V1C A;  2RQT A;  2YDL A;  2SEM A;  1T3L A;  1ZLM A;  3M0P A;  1W1F A;  3M0Q A;  1PHT A;  3SEM A;  5FWB A;  1AEY A;  1JU5 C;  2ABL A;  1OPL A;  1UE9 A;  3VRZ A;  2DBK A;  3NHN A;  4A63 B;  1SPK A;  2ED0 A;  3A98 A;  2KRO A;  2FRY A;  3FJ5 A;  2IIM A;  2NWM A;  1UHC A;  3LH5 A;  2EGA A;  5IHI A;  2BZY A;  1ARK A;  1WA7 A;  1CKA A;  2CUB A;  2KYM A;  1GCQ A;  1SEM A;  3VS7 A;  2GGR A;  2YSQ A;  3H0H A;  3UF4 A;  2VKN A;  1TUC A;  3EG3 A;  1U06 A;  3PVL A;  1YWO A;  1JXO A;  1H8K A;  1I1J A;  4OMO A;  1FMK A;  2GNC A;  1QWF A;  1GCP A;  2RMO A;  1Z9Q A;  1CKB A;  4AFS C;  1SHG A;  1I0C A;  2BZ8 A;  1K4U S;  1X2Q A;  4CC4 B;  1TUD A;  2NUZ A;  2L3Q A;  1QKX A;  2JTE A;  4CC2 A;  1J3T A;  4JJC A;  1RI9 A;  2DL4 A;  1KFZ A;  3EHQ A;  2LMJ A;  3R6N A;  3VS3 A;  3GBQ A;  2LQW A;  1UHF A;  2CSQ A;  2KNB B;  1YCS B;  2KRM A;  1BB9 A;  5GJW B;  3NPF A;  1K0S A;  2RPN A;  2AK5 A;  1KIK A;  2HCK A;  2FRW A;  1N5Z A;  2DL8 A;  1JO8 A;  2JT4 A;  1NEG A;  4Z88 A;  3JV3 A;  3PVQ A;  2KR3 A;  2CDT A;  1U5S A;  3EG1 A;  2OAW A;  3NGP A;  2EYX A;  3ULR B;  1AWW A;  1UTI A;  1RLP C;  4HCK A;  4Z89 A;  5I11 A;  2FPE A;  1T0J A;  1NM7 A;  1GFC A;  2MIO A;  1WDX A;  2GTO A;  2KXC A;  1YN8 A;  1AZE A;  1BU1 A;  3REA B;  1AD5 A;  4LUD A;  1ABQ A;  4J9C A;  3VS0 A;  1LCK A;  4CC7 A;  2ROL A;  1UJY A;  2LJ3 A;  4RTU A;  2GBQ A;  1PWT A;  1WX6 A;  2HDA A;  2VVK A;  1ZBJ A;  5I22 A;  2KRS A;  3RNJ A;  2DL7 A;  4ZNX A;  1HSQ A;  1MUZ A;  4OMQ A;  4X1V A;  2J6O A;  5EC7 A;  4HVU A;  2DLP A;  2KT8 A;  1ZSG A;  3VS2 A;  1GRI A;  4RTV A;  1H92 A;  4J9G A;  2A08 A;  4AFZ C;  2D0N A;  2QDL A;  1EFN A;  1X6G A;  1NEB A;  2EQI A;  3C0C A;  2DRM A;  2LQN A;  3TSW A;  2YUP A;  1ZUU A;  1AZG B;  3QWY A;  2OJ2 A;  3M0R A;  3THK A;  1AWJ A;  2HSP A;  1OV3 A;  1M27 C;  2CT4 A;  4Z8A A;  1QKW A;  2D8H A;  4CC3 A;  2LZ6 B;  4Y92 A;  4RTZ A;  3VS1 A;  2DNU A;  2FEI A;  1MV0 B;  4GBQ A;  1NYF A;  2C0T A;  2F2X A;  2EW3 A;  2PNI A;  2KT1 A;  4D8K A;  1M3B A;  2GQI A;  2DVJ A;  2KYB A;  1GBR A;  1Z9Z A;  2W10 A;  2D1X A;  5ECA A;  4AG2 C;  1VYU A;  2L0A A;  2J05 A;  4RTW A;  2JM9 A;  4IIO A;  2O31 A;  2L2P A;  5IXB A;  2EPD A;  4WCI A;  1ABO A;  1M3A A;  3KFV A;  2LX7 A;  1M8M A;  3REB B;  2P4R A;  2AZS A;  1KJW A;  2EVR A;  3M0S A;  1SRL A;  5HCK A;  1ZX6 A;  1E6H A;  1U3O A;  1WFW A;  2DL3 A;  1VYV A;  4GLM A;  1I07 A;  4M4Z A;  2CH4 A;  2EBP A;  5FWC A;  4JPB W;  2RQU A;  2YT6 A;  5GJV B;  4DEY A;  1UUE A;  2J7I A;  2MOX A;  3VS5 A;  1SHF A;  1T3S A;  2FO0 A;  2YUQ A;  2CUD A;  1OEB A;  4LNP A;  3UA7 A;  2D8J A;  4LN2 A;  1WXT A;  2O88 A;  1M3C A;  2PZ1 A;  1X27 A;  2ECZ A;  4AFU C;  2CT3 A;  1WXB A;  2ROT A;  5IH2 A;  2YUN A;  4ESR A;  1UEC A;  1QCF A;  2RQV A;  3PE0 A;  1UG1 A;  2EKH A;  4HXJ A;  1X43 A;  3H41 A;  2JMC A;  5FW9 A;  1FYN A;  3M0T A;  1SRM A;  2SRC A;  2K9G A;  2DF6 A;  1NLO C;  2A36 A;  1GBQ A;  1GFD A;  1HD3 A;  2JS0 A;  2J6K A;  2M0Y A;  3EGU A;  2DIL A;  4QT7 A;  1AWO A;  2BZX A;  2RQR A;  3I35 A;  4JJB A;  2GTJ A;  1SSH A;  2RF0 A;  2KBT A;  2BTT A;  2K7A A;  1B07 A;  4J9H A;  2DMO A;  2MCN A;  1G2B A;  2F2W A;  2PTK A;  2O9S A;  2RQW A;  2LJ0 A;  4HVV A;  1NYG A;  3UA6 A;  4E6R A;  1GCQ C;  1PRL C;  2LCS A;  2DYB A;  3EG0 A;  2ENM A;  2W0Z A;  2E5K A;  1PNJ A;  2AKK A;  2K6D A;  2DJQ A;  1PKS A;  2RN8 A;  4OMN A;  2L3S A;  2G6F X;  2K3B A;  1XOV A;  1NLP C;  2JXB A;  3VS6 A;  1PRM C;  1X6B A;  3M0U A;  2DX1 A;  3H0F A;  1GL5 A;  1UDL A;  1WIE A;  1MV3 A;  4J9B A;  1W70 A;  4F17 A;  1ZUK A;  1NG2 A;  5IXF A;  4OML A;  2F2V A;  3SHW A;  1QWE A;  4F16 A;  2DE0 X;  4FSS A;  1VA7 A;  2DA9 A;  2H8H A;  4IIM A;  1WI7 A;  4D8D A;  1M30 A;  4J9I A;  3O5Z A;  1QLY A;  3CQT A;  2B86 A;  2KXD A;  4J9D A;  4AFQ C;  2DBM A;  4EIK A;  2J6F A;  3QWX X;  2DL5 A;  2JM8 A;  3UAT A;  2JW4 A;  2CH4 W;  2X3X D;  3IQL A;  1IO6 A;  3RBB B;  1K9A A;  3I5R A;  2LP5 A;  2I0N A;  2DM1 A;  4LUE A;  1PKT A;  4RTY A;  2FG0 A;  1G83 A;  2DRK A;  1VYT A;  1AWX A;  3EG2 A;  1RUW A;  2O2O A;  2V1R A;  2EGE A;  2LJ1 A;  1TG0 A;  2JMA A;  2AZV A;  3EHR A;  2AKL A;  4RTX A;  1CSK A;  2J06 A;  1BK2 A;  4ORZ A;  1AVZ C;  3VRY A;  2V1Q A;  1UFF A;  2EGC A; 
#chains in the Genus database with same CATH topology
 5D6X A;  1RLQ C;  3I56 Q;  3QG1 A;  5CK9 A;  2KAF A;  3TVT A;  4R0K A;  2XMF A;  3QO3 A;  4J9E A;  1YHQ A;  1E7O A;  3SWN A;  1BIA A;  3RMQ A;  3VYH B;  1KD1 C;  4HVW A;  3ZL7 C;  4Y91 A;  3H0I A;  4IUR A;  3EAE A;  1HJD A;  1WHK A;  5GAO n;  2DEU A;  2FVU A;  1WGS A;  2ESW A;  3OB9 A;  2EYY A;  5KH6 A;  1S1N A;  2VV5 A;  1K0X A;  1VIF A;  2RH2 A;  2LNH B;  3OA6 A;  2HL3 A;  4FIB A;  4M7D B;  3VS4 A;  1N6A A;  2LRQ A;  1K76 A;  1YI2 Q;  4XTZ A;  4AG1 C;  1WLP B;  2O9V A;  2A37 A;  4PJN A;  3OMC A;  4M78 C;  4M77 C;  3M4Y A;  4BE0 A;  4OMM A;  1UGV A;  2DXU A;  3QBY A;  4C5I A;  4E7S A;  1VQO T;  5DY9 A;  3U23 A;  5GAO m;  4RCC A;  2YRC A;  5IHK A;  4JJD A;  2D6F A;  1YNZ A;  3PT9 A;  1RAA B;  2M16 A;  2E3H A;  3CCQ A;  2OTL Q;  2RQT A;  2HD0 A;  2O01 E;  1PHT A;  3S6W A;  3L2V A;  2DJZ A;  2H3E B;  4C92 E;  2DBK A;  3NHN A;  1Q7Y C;  2QTV A;  1MND A;  3G71 A;  3A98 A;  1M2V A;  5J39 A;  2E6Z A;  2EGA A;  2Y90 A;  1VQ7 A;  1AHJ B;  1RAH B;  1QCN A;  1WA7 A;  4QVC A;  4JS4 A;  4M7A E;  3MP6 A;  2CUB A;  4ZTF A;  3LWI A;  1M1K R;  2QAS A;  1LOJ A;  3JCM V;  2VKN A;  3PVL A;  3EG3 A;  2XDB A;  3OYL A;  1H8K A;  3DLM A;  1I1J A;  1Q95 G;  3V7C A;  1FMK A;  5CCA A;  3M4G A;  2XHC A;  4R55 A;  3FB9 A;  1Z9Q A;  1VQK Q;  5J3B A;  4AFS C;  1EZZ B;  4C8Q A;  2BZ8 A;  2ZPI B;  9ATC B;  1TUD A;  4MMK A;  4X9C A;  1ZA1 B;  3FDR A;  2QEX Q;  2NUZ A;  2P4T A;  2MK5 A;  2DAQ A;  4JJC A;  5I2M A;  5AT1 B;  3A8G B;  5GAO l;  3VS3 A;  3A8M B;  2DD5 A;  2CSQ A;  2HQE A;  2KNB B;  4XU1 A;  2YLB A;  2VB6 A;  2M0O A;  1OI1 A;  4GLK A;  5GJW B;  1MGQ A;  1P92 A;  2RPN A;  2HCK A;  3NTI A;  2FRW A;  2X9H A;  1ZQ1 A;  2DL8 A;  1JO8 A;  5CO7 A;  1BI3 A;  4PJL A;  3DKM A;  4C92 D;  3NGP A;  1WZO A;  3JCM c;  2HKN A;  1JB0 E;  4XK8 E;  5I11 A;  4Z89 A;  4M77 G;  4M75 A;  1T0J A;  1NM7 A;  2ZPB B;  1KQS P;  1R0B G;  3CCV T;  3CCJ Q;  1D0Y A;  1RI0 A;  4M7A G;  3M56 A;  1ABQ A;  3CCJ A;  3X28 B;  3VS0 A;  1KQ1 A;  3Q1J A;  2LCL A;  2ROL A;  1UJY A;  3HL8 A;  4MDX A;  3EH1 A;  1C1A A;  1PWT A;  3MP8 A;  5KYN A;  2HDA A;  1LNX A;  2KRS A;  4NL2 A;  3RNJ A;  1RAC B;  2DL7 A;  5D6Y A;  4BAC A;  1OU9 A;  2DD4 A;  4CRI A;  3E9G A;  1TOV A;  2J6O A;  4GY5 A;  4F7U A;  4FU6 A;  4BDY A;  4HVU A;  2BE9 B;  2DLP A;  3VS2 A;  3J7A F;  1GRI A;  1D1C A;  2A08 A;  2WSF E;  1VQ9 Q;  5GMK m;  3AHU A;  5FRN A;  2L89 A;  1VQ9 A;  2LQN A;  3QKJ A;  1Y07 A;  1YJN A;  1ZUU A;  3UDC A;  3M0R A;  4PLL A;  4OGC A;  2HSP A;  1OV3 A;  2D8H A;  2MYS A;  3M58 A;  4RTZ A;  4JLG A;  1M1F A;  5LJ3 e;  1IRE B;  2JVV A;  1OZ3 A;  2QAZ A;  4PJO E;  5CR2 A;  3V8J A;  4WTO B;  4FW2 A;  2QG9 B;  2GQI A;  2OTJ T;  3MKD A;  1G3S A;  2RHY A;  3A8L B;  1GBR A;  2P0K A;  2Y4Y A;  2CYZ B;  2RD1 A;  4AG2 C;  3LGF A;  1LJO A;  3HRT A;  3CCM Q;  4HCZ A;  1ZHI A;  2FYK A;  4RKU E;  1RAB B;  4ATO A;  3MO8 A;  4J7I A;  1KC8 C;  4M77 D;  3V7S A;  4XTY A;  4OGE A;  1WPY A;  5KCO A;  1M3A A;  2K2V A;  4KUL A;  3REB B;  4J5Y A;  2DET A;  4OB3 B;  2EVR A;  2HNI A;  3M0S A;  5HCK A;  4E7I A;  4UC4 A;  4JRK A;  4DBH A;  1Y96 B;  4PJJ A;  1JJ2 S;  3I55 T;  2YT6 A;  1VQ4 T;  1R0C B;  2MOX A;  2LT4 A;  1OEB A;  1VQ8 A;  1VQM Q;  3T9N A;  2FHD A;  3DB4 A;  1QP2 A;  1ZSZ B;  1M3C A;  4OF1 A;  1X27 A;  1NPR A;  1I5O B;  3E1S A;  4BE1 A;  1M9S A;  3GF5 A;  3CME Q;  3CC7 Q;  3ZEH A;  3QUI A;  4ESR A;  4FCY A;  3OBW A;  3G6E T;  3PE0 A;  4PJO D;  1NPP A;  3GLX A;  2EKH A;  3CCJ T;  4HXJ A;  3S3N A;  4VUB A;  4BB7 A;  2CP2 A;  4RG2 A;  3H41 A;  4JJN K;  1FYN A;  2QA4 Q;  3JB9 D;  1SRM A;  2SRC A;  2K9G A;  1NLO C;  2OTJ A;  2JS0 A;  1K73 C;  4C92 G;  3I35 A;  4JJB A;  1SSH A;  2RF0 A;  2DEQ A;  2C06 A;  2MCN A;  4C5G A;  2F2W A;  2EJ9 A;  2RJC A;  2O9S A;  3OYF A;  4E6R A;  3UA6 A;  2LCS A;  3EG9 A;  4M78 E;  2ENM A;  5J26 A;  3LW5 E;  2EQK A;  4E7H A;  2DJQ A;  2X35 A;  2CZ7 B;  3CPW P;  1WHL A;  1XOV A;  3M9Q A;  2JXB A;  3VS6 A;  1PRM C;  2MMP A;  4C92 C;  3M0U A;  2DX1 A;  2DXC A;  3FIF A;  4KT0 E;  3C94 A;  3TRE A;  1UDL A;  2Z0W A;  3OSV A;  4PFP A;  3GNF B;  5IXF A;  3JCM e;  4OML A;  5KYY B;  4F16 A;  4IIM A;  1M30 A;  3P8D A;  3SFM A;  5FRM A;  4PJO A;  1MHN A;  2X4X A;  5GAN f;  2RI3 A;  3OW2 A;  1QLY A;  1YJW T;  2KXD A;  4J9D A;  5CQY A;  3NTH A;  4EIK A;  4F7U E;  4M75 E;  2DL5 A;  2JM8 A;  1EX4 A;  3D7S B;  4EMK C;  3CD6 Q;  2P0Q A;  4BUG A;  3JCM W;  4IUT A;  1KD1 R;  2XID A;  3MHX A;  2QQR A;  3IQL A;  3M57 A;  3CCU A;  5FU6 C;  1Y96 A;  1PKT A;  3RES A;  1D1A A;  2NUT A;  4J6Y A;  2DZC A;  3RMS A;  2L3R A;  2V1R A;  2X4W A;  3MPU B;  4C5E A;  3GP8 A;  1KG1 A;  3EHR A;  1OYX A;  2KVQ G;  2HBP A;  1AVZ C;  4ORZ A;  3GOX A;  1S72 A;  2QA4 A;  4FYV B;  1WNL A;  4PL6 A;  2X3W D;  2JOY A;  1WJQ A;  1PCX A;  1N8R U;  3BY7 A;  1WHJ A;  1YJN T;  2VGM A;  1Q81 U;  4DBF A;  1UJ0 A;  2PUO B;  3CMA T;  4OMP A;  3HRS A;  2CSI A;  2MI6 A;  4N4I A;  5LJ3 f;  2HEQ A;  1BYM A;  5GAM f;  4F14 A;  1Y57 A;  4RTT A;  4DEX A;  3TSZ A;  4J6X A;  2K2M A;  4M7D C;  2QEX A;  2R5A A;  1QW1 A;  1OOT A;  4RCB A;  2I2L A;  2ED1 A;  3OYJ A;  4A4E A;  1Q7Y R;  2RJD A;  1JEG A;  2G3R A;  2KK4 A;  1T0H A;  1YP5 A;  2FPF A;  1WYX A;  1I4K 1;  4A53 A;  4XU3 A;  2VWF A;  2QQA A;  1BCO A;  2KI7 A;  4ME7 A;  1K9M R;  1V29 B;  5IHN A;  2V26 A;  3JB9 G;  4RUG A;  3MEU A;  3CC4 A;  3LX7 A;  3LH0 A;  3JAM E;  1KSW A;  4QVZ A;  4PJO G;  1PD0 A;  1V1C A;  3OYY A;  3CC2 Q;  4AT1 B;  3OYG A;  2YDL A;  4JS5 A;  3M0P A;  3SDZ A;  5FLX E;  2IVW A;  5FWB A;  1AEY A;  2ABL A;  3CCU Q;  1UE9 A;  2RO0 A;  2VC8 A;  2ED0 A;  4O6J A;  4F7U G;  2ATC B;  2KRO A;  3UT1 A;  3KUF A;  1W2B P;  2CZ6 B;  4MZT A;  1C0M A;  5IHI A;  1ARK A;  1UGS B;  5KE2 A;  1CKA A;  1S72 Q;  3MP1 A;  4PJO C;  1YIT A;  2KYM A;  2COZ A;  1N9S A;  3UF4 A;  5GAN 8;  1N9R A;  2QQS A;  3G4S Q;  1JXO A;  4KH1 B;  5KYU A;  4XTW A;  2GNC A;  1GCP A;  3H8Z A;  1FMV A;  3OYH A;  3GPL A;  3RKW A;  2XK0 A;  4C92 A;  3C4S A;  1VQ9 T;  2XD0 A;  1SHG A;  4HT9 A;  8ATC B;  3CCE A;  3M59 A;  5GAM h;  2E64 A;  4J7F A;  1IGU A;  1J3T A;  3OYB A;  2LMJ A;  4KUD K;  1O75 A;  3NFC A;  1BB9 A;  1RAE B;  1KK7 A;  4JRQ A;  5D6W A;  1Y7X A;  3BDU A;  2RHI A;  1UB4 A;  1N5Z A;  2JT4 A;  4Z88 A;  2QXF A;  4JRP A;  1M90 C;  1NJI C;  1UGQ B;  4IUQ A;  3PVQ A;  2KR3 A;  3SWN C;  3CCL A;  4M7A C;  3PMT A;  1VQP Q;  4M7D E;  2COW A;  5L8R E;  4C8Q G;  3OS0 A;  3CCL Q;  2EYX A;  4FW1 A;  1AWW A;  4HCK A;  4M75 F;  2FPE A;  1Q82 C;  1BI2 A;  1VQP A;  3CC4 T;  2RK2 A;  2MIO A;  4QVD A;  3HFO A;  4ZN1 A;  1YN8 A;  2QDY B;  3MEA A;  1AD5 A;  4LUD A;  1Q81 C;  1KQ2 A;  2CP5 A;  3JCM X;  4M77 E;  2GBQ A;  2XU8 A;  5GAN 2;  1I5L A;  5GMK h;  4PJO B;  4EMH A;  2XIC A;  4E7Z A;  2GFA A;  4O5V A;  1ZSG A;  4RTV A;  5KCH A;  2D0N A;  5GAN 4;  1X6G A;  1EFN A;  1OUL A;  3CME A;  3CC7 A;  4AMC A;  3G4S A;  3CCR A;  2YLC A;  2DIQ A;  3TSW A;  2YUP A;  4QQ6 A;  3CCQ T;  3CBO A;  3THK A;  1AWJ A;  1M27 C;  2V8J A;  4Z8A A;  3G6E Q;  3BFM A;  2R57 A;  2ZZD A;  2LZ6 B;  3VS1 A;  5CKB A;  2VUB A;  1VOM A;  1NJI R;  5GAN e;  1R77 A;  3CXC P;  2ZPH B;  2DVJ A;  1U8R A;  3OYA A;  1VQ5 T;  2W10 A;  4ZGE B;  2D1X A;  2JTM A;  1ZBX A;  2J05 A;  1M1K C;  2BE7 D;  4M7D G;  2LQK A;  1VQ8 Q;  4IIO A;  2L2P A;  2E41 A;  2LTO A;  4X34 A;  1OX9 A;  1TUG B;  5IXB A;  4V2S A;  2OX7 A;  2EPD A;  1QVG A;  1ABO A;  2F1L A;  1SRL A;  1Y71 A;  1U3O A;  2NUT B;  2RJF A;  3EGX B;  2X4J A;  2DPP B;  1DJ7 B;  1X01 A;  2QYZ A;  1VYV A;  4ZGJ B;  1I07 A;  3OW2 P;  4M4Z A;  2EBP A;  1MMG A;  2RQU A;  5GJV B;  3EG9 B;  3HSB A;  1TTH B;  2ZAE A;  3JB9 I;  3MJX A;  1LVK A;  1YBY A;  2DO3 A;  3OMG A;  3A5Z B;  1RAD B;  1C6V X;  1JJ2 A;  2ECZ A;  4A4F A;  1M1G A;  1TU0 B;  2CT3 A;  2K5I A;  5IH2 A;  4EDU A;  3CCR Q;  1ZA2 B;  3N5B B;  5FU6 B;  4FYW B;  1UEC A;  3EFS A;  1BKB A;  3EH2 A;  1V76 A;  4KGV B;  4QQD A;  4EMK B;  5LJ5 e;  4B9W A;  4LDX A;  2DER A;  5CIU A;  3CD6 A;  2YXY A;  3CXC S;  3JCM P;  1TSF A;  1D0X A;  2DF6 A;  4LDY A;  1GFD A;  2DIG A;  2M0Y A;  3MET A;  3EGU A;  1D3B B;  3G71 Q;  2DIL A;  2BZX A;  3VUB A;  3UPU A;  2GTJ A;  3CEY A;  2BTT A;  2IPO B;  2E4H A;  2K7A A;  4J9H A;  1XJW B;  2DMO A;  1G2B A;  2KDS A;  4PFO A;  2PTK A;  1BI0 A;  2LJ0 A;  2DYB A;  3FLG A;  3EG0 A;  5GAO q;  4C92 B;  3ZBD A;  2W0Z A;  1WHG A;  3CCQ Q;  1YJ9 Q;  3E19 A;  2E5K A;  4J8O A;  1Q86 C;  4LDU A;  3PGG A;  2K6D A;  1PKS A;  3FJP A;  1FWZ A;  1TS9 A;  2L3S A;  2K3B A;  1YJ9 A;  2L8D A;  2D0Q B;  1BIB A;  1U1T A;  3HTR A;  4JUV A;  3CD6 T;  4J9B A;  4OB1 B;  2YRV A;  2E6N A;  2X51 A;  1YJW Q;  3A8H B;  3I55 Q;  1B7T A;  4A4K A;  2FZG B;  1VQ6 T;  1VA7 A;  4ANJ A;  3BE3 A;  4HCC A;  1M2V B;  3OSS C;  3CPW A;  4YTL A;  4E7L A;  2DBM A;  3EFO B;  2J6F A;  4NS5 A;  2MWO A;  3JB9 F;  3UAT A;  2JW4 A;  3JRZ A;  2JZ2 A;  1IO6 A;  2MF2 A;  3RBB B;  3TCJ A;  3I5R A;  2HL5 C;  2LP5 A;  3NTK A;  1IZ6 A;  2WAC A;  4M77 F;  1VQK A;  3LYI A;  2COY A;  3OYE A;  2DRK A;  1VYT A;  1Q86 R;  2PVG B;  4DQ2 A;  3FC3 A;  2EGE A;  4HA8 A;  1TG0 A;  4JLI A;  2AKL A;  2J06 A;  5CKD A;  1UFF A;  2EGC A;  4OVA A;  2KGT A;  2FPD A;  1HXD A;  3CPW S;  2EQJ A;  1AT1 B;  2KQW A;  2RNA A;  3I5S A;  1XTD A;  4BY6 B;  2M51 A;  2OI3 A;  1JQQ A;  1KD1 U;  4DBR A;  5FU7 B;  4KGX B;  1NE8 A;  2L3P A;  4JDS A;  4JZ3 A;  2C0O A;  5L23 A;  4M7A A;  4M7A F;  2DZ9 A;  1F1B B;  4M78 G;  2K79 A;  4FL6 A;  5GAN h;  2CP3 A;  4K11 A;  3OS5 A;  2QI2 A;  1G3W A;  3F70 A;  4M75 C;  2RHU A;  5GAM e;  1X2K A;  2EQU A;  4BI8 B;  3EFO A;  2K5L A;  1YI2 T;  2XI9 A;  1W6X A;  2C0I A;  2DTH A;  1YHQ T;  1H3H A;  4C8Q E;  2KEA A;  2EYW A;  2EYZ A;  4KRT A;  1ZUY A;  3QZ5 B;  4BI4 A;  4B9X A;  4JZ4 A;  1MMD A;  5A0D A;  1IB8 A;  4XAX B;  4J9F A;  1B3Q A;  1X75 C;  1K73 R;  1OQK A;  3NMZ C;  2A28 A;  1UGR B;  4PLI A;  1ZSZ A;  2KRN A;  1AOJ A;  4X9D A;  5GAO r;  2CKK A;  1PD1 A;  1M90 R;  4NOY A;  1ZLM A;  2E70 A;  5DLQ E;  4LD9 K;  2MPX C;  1VIE A;  5CAI A;  2DKG A;  3LLR A;  1EIF A;  3VRZ A;  4A63 B;  1O9S A;  3KBG A;  1SPK A;  3CME T;  3CC7 T;  3QZ9 B;  1Q82 R;  1UGP B;  4M7A B;  2QQB A;  3CCL T;  3FJ5 A;  3SWN B;  3QSU A;  5FRO A;  1K8A C;  2K4Y A;  1VQM A;  3LH5 A;  1VQM T;  1YJ9 T;  1GCQ A;  1SEM A;  3VS7 A;  3JCM b;  2F5T X;  2YSQ A;  3H0H A;  4N0A C;  5LJ5 h;  4MML A;  5LJ5 f;  2X4Y A;  2FZC B;  3HPW A;  4LDW A;  1JJ2 P;  1CKB A;  3PNW C;  3TU4 K;  1MMA A;  1VQO Q;  4CC4 B;  2AT1 B;  2XKO C;  3S3O A;  4FYY B;  2L3Q A;  1QKX A;  5HK3 A;  2HMA A;  3URG A;  4CC2 A;  1RI9 A;  2ZPF B;  5GMK l;  3EHQ A;  3GBQ A;  2LC4 A;  4QW2 A;  2NUP B;  1YCS B;  3G4S T;  2KRM A;  5LJ3 g;  2OAU A;  1I8F A;  2MAM A;  5CKH A;  3QYH B;  3QJY A;  4QQG A;  4J83 A;  1VQ4 A;  1VQN T;  1KIK A;  1SF9 A;  3LWH A;  5GAN j;  4XQ3 A;  1NEG A;  2E10 A;  2O4X B;  3G7Z A;  1IRX A;  3DB3 A;  3JV3 A;  1QVF S;  1D09 B;  1N8R R;  1UTI A;  3QII A;  4IUU A;  2O4X A;  4M7D A;  3CCE T;  3EGD A;  4B6M A;  4L59 A;  1K8A R;  2GTO A;  2KXC A;  2M02 A;  2EQM A;  1AZE A;  1BU1 A;  3ER0 A;  1M4Z A;  3REA B;  4BI3 A;  4J9C A;  2OTL A;  3CXC A;  3OBY A;  2VAS A;  2LJ3 A;  3JCM J;  3A8O B;  5GAO p;  2VVK A;  4M77 A;  2DXT A;  4C8Q B;  1MUZ A;  2RK1 A;  2BIV A;  5KYY A;  5EC7 A;  5GMK i;  2KT8 A;  4M78 D;  4XU0 A;  4RMO A;  1H92 A;  8AT1 B;  1K9M U;  1WQ7 A;  1QVG P;  2DRM A;  1QMC A;  4ZN3 A;  3VYG A;  1W2B S;  1AZG B;  2K3Y A;  3QWY A;  4DOV A;  1MMN A;  3M5A A;  4EMG A;  1VQO A;  2WSE E;  4Y92 A;  2DNU A;  3OYC A;  3DLL A;  4PJM A;  1MV0 B;  4M77 B;  7AT1 B;  1VQ6 A;  4GBQ A;  2C0T A;  2ZCF B;  2F2X A;  3X25 B;  3CCS T;  2EW3 A;  2PNI A;  3TEE A;  5IT9 E;  2EKO A;  4FT2 A;  2KT1 A;  1G5V A;  3OQ5 A;  4M78 B;  1ZSZ C;  4M7A D;  2KYB A;  5KE3 A;  2EYQ A;  2CZ0 B;  2V8K A;  5D7U A;  2L0A A;  2OTJ Q;  4M75 G;  5KYU B;  4RTW A;  3OYI A;  2VYT A;  3OY9 A;  3CCS Q;  1Q82 U;  2B8A A;  1OZ2 A;  1UEB A;  3CCS A;  3TQ7 P;  4WCI A;  3FRN A;  4PNO A;  4FT4 A;  2AZS A;  5GAN 6;  4Z02 A;  1KJW A;  3KXT A;  1M8V A;  1G3T A;  1BCM A;  2DXB A;  4F7U B;  1HYO A;  1E6H A;  3M54 A;  2HQX A;  2NYS A;  5GAN 5;  1WFW A;  3PIP A;  4PKC C;  2BKD N;  4LDV A;  2CH4 A;  3PIO A;  5FWC A;  4JPB W;  2YRD A;  4BDZ A;  4L5G A;  4FM4 B;  4IUP A;  3VS5 A;  1WJR A;  5A2Q E;  1T3S A;  2FO0 A;  3G1J A;  1VQL A;  1K9M C;  2QGF B;  1TH7 A;  5CVI A;  3UA7 A;  3SD4 A;  5LJ3 d;  4ZTJ A;  4LN2 A;  1WXT A;  5LJ3 j;  2O88 A;  4RG8 A;  1YJW A;  1D3B A;  2ROT A;  2DFU A;  5GAM j;  3CPF A;  1PC0 A;  3I56 A;  1RAI B;  5A0G A;  3OS1 A;  4DA4 A;  5KYX A;  5CKE A;  2JMC A;  4XU2 A;  2OTL T;  5FW9 A;  3M0T A;  3V8K A;  1VQL Q;  2A36 A;  3MCA B;  4MZM A;  3FEO A;  1Q81 R;  1AWO A;  2DTI A;  5KYW A;  5HY6 A;  2KBT A;  1N8R C;  2QTX A;  4HKE A;  4M78 A;  1YIT T;  1B07 A;  1HK9 A;  2PU9 B;  2QGG A;  4LD6 A;  2QK0 A;  2EAY A;  1NYG A;  1GCQ C;  4E47 A;  3P8B B;  3PMI A;  5KYW B;  1PSF A;  2FZK B;  3CC2 A;  2AKK A;  2RN8 A;  3L2Z A;  3L1A A;  5LJ3 h;  1NLP C;  1X6B A;  4E7J A;  3H0F A;  1GL5 A;  2YHT A;  4F17 A;  1WQW A;  1NG2 A;  1VQ8 T;  3CCU T;  1JBM A;  2DE0 X;  4FSS A;  3JB9 H;  5CKF A;  2H8H A;  3QHS A;  1WI7 A;  1QVG S;  1NJI U;  3O5Z A;  2RB6 A;  3CQT A;  3ASK A;  2B86 A;  1IHW A;  3QYG B;  2H3J A;  4P5N A;  4AFQ C;  3QWX X;  3E9F A;  1YJN Q;  3J81 E;  3INZ A;  1OX8 A;  1QQJ A;  1K9A A;  4C8Q F;  2JN0 A;  2NLU A;  1SSF A;  4LXC A;  2I0N A;  3X26 B;  1U1S A;  2RHX A;  3VV0 A;  5GAN d;  1QCO A;  2HQH A;  2V8I A;  4XTX A;  4RTY A;  2FG0 A;  2GCX A;  4OP0 A;  3CMA Q;  1JRI A;  2P0P A;  1AWX A;  1FXX A;  3ZFJ A;  1RUW A;  2EJG A;  1YIT Q;  2HSE B;  4BD3 A;  2AZV A;  4RTX A;  1CSK A;  1BK2 A;  1VQN A;  2V1Q A;  4ELY C;  3SB2 A;  2PVO B;  4PK4 A;  3M53 A;  4E2F B;  2E12 A;  4PFZ A;  3JB9 J;  4LE9 A;  4C92 F;  3L2Q A;  2LX9 A;  1YWP A;  4KH0 B;  2YUO A;  3I9Q A;  1NZ9 A;  1X69 A;  2HBW A;  3JCM g;  3L2W A;  3VU3 C;  1VQ7 T;  5DLO A;  2MWP A;  1Y0M A;  1BBZ A;  2E1H A;  1WXU A;  2JS2 A;  4C0D B;  2BUD A;  4R56 A;  4Q5W A;  3CC2 T;  1KQS S;  5HK0 A;  1QVF A;  1K1Z A;  4M75 B;  3HP9 A;  5GMK j;  2AHJ B;  2PVD B;  2RI5 A;  3JCM f;  2JUF A;  3O8V A;  2GQV A;  1SKU B;  1VUB A;  2CRE A;  1YFN A;  3BW1 A;  1A0N B;  1QP3 A;  1E6G A;  1X6O A;  5FU7 C;  1VQ5 A;  1K8A U;  3PTA A;  1OPK A;  1NBE B;  1JXM A;  1VQ5 Q;  1MNE A;  2KE9 A;  2QQ9 A;  2SEM A;  3OYM A;  2P84 A;  1T3L A;  1W1F A;  2YWW A;  4M7D D;  3M0Q A;  4NL3 A;  3SEM A;  1M5Q 1;  1JU5 C;  1YI2 A;  2CP7 A;  1OPL A;  3UWN A;  5C6S A;  3C95 A;  3BDL A;  2LVM A;  3HHT B;  4C8Q D;  1KC8 U;  2ZPE B;  2FRY A;  4CI0 C;  2IIM A;  2NWM A;  3AT1 B;  5I21 A;  4OB0 B;  1UHC A;  2ZGW A;  2K57 A;  1VQ6 Q;  2BZY A;  2GF7 A;  1PG5 B;  4MDW A;  2PUK B;  4XTV A;  4FSX A;  4M7D F;  4TVR A;  5KYX B;  3JCM d;  2GGR A;  1TUC A;  1IXD A;  1U06 A;  2RM4 A;  1LPL A;  4EMK A;  2PQW A;  1YWO A;  3QJ6 A;  1KHI A;  4II1 A;  4WF2 A;  4OMO A;  2M1H A;  1QWF A;  3RUX A;  2RMO A;  2KSS A;  3P8H A;  3OW2 S;  1WHH A;  6AT1 B;  2KY9 A;  3QDF A;  2DK3 A;  1IHV A;  1I0C A;  1K4U S;  1X2Q A;  2F69 A;  2JTE A;  5LJ5 j;  4KUI A;  2DL4 A;  4C5H A;  2LDM A;  1M2O A;  5CQX A;  1KFZ A;  4IKF A;  3R6N A;  2LQW A;  1UHF A;  1VQ4 Q;  1Q86 U;  2RJE A;  2LT1 A;  2CP6 A;  4E7K A;  4A4H A;  3NPF A;  1K0S A;  2AK5 A;  5GAN g;  3EGX A;  3X24 B;  4D6W A;  3V7R A;  3L2U A;  2CDT A;  1U5S A;  2A0F B;  2F5K A;  3EG1 A;  2OAW A;  4F7U F;  2VXE A;  2VGN A;  1YIJ A;  1S72 T;  3ULR B;  1RLP C;  4QKU A;  1RAF B;  1GFC A;  4FYX B;  1WDX A;  1FMW A;  4PJO F;  3VJP A;  2RHZ A;  2HZY A;  2CGH A;  1SG5 A;  1YCY A;  3CCR T;  1LCK A;  4CC7 A;  1VQK T;  2EWN A;  4RTU A;  1BI1 A;  2QA4 T;  5GMK e;  1G3Y A;  2CS7 A;  1WX6 A;  3VKI A;  5I22 A;  1ZBJ A;  4M78 F;  3RKY A;  4A4G A;  3WVE B;  1YIJ Q;  4ZNX A;  1HSQ A;  3L42 A;  4OMQ A;  3CC4 Q;  4X1V A;  1GXI E;  3JSC A;  3CMA A;  3RER A;  4J9G A;  4AFZ C;  1PM3 A;  3QDR B;  2QDL A;  1NEB A;  1K73 U;  2EQI A;  3C0C A;  1M1K U;  5GAM g;  5C0M A;  2LNV A;  2K5F A;  3EFR A;  2OJ2 A;  1FX7 A;  5DM7 R;  4KBM B;  2CT4 A;  2M9U A;  1QKW A;  4CC3 A;  3LGL A;  4OMF B;  1TWB A;  4A54 A;  1QVP A;  2FEI A;  5LJ5 g;  1NYF A;  2WSC E;  2HKQ B;  3J80 E;  3I55 A;  4D8K A;  1IGQ A;  1M3B A;  2KMT A;  1OU8 A;  4J6W A;  4N0A A;  2K3X A;  3MEW A;  3I56 T;  1Z9Z A;  1D1B A;  5ECA A;  3RKX A;  1VYU A;  4C0G A;  4L6V 5;  2IG0 A;  3CCV Q;  4C0D C;  2JM9 A;  4C0Z A;  3MEV A;  1I81 A;  2O31 A;  2HAX A;  3CCV A;  4C8Q C;  2DYI A;  3WVD B;  3CCE Q;  5A0L A;  3RIR A;  3C12 A;  2DTO A;  5AYF A;  3KFV A;  3G71 T;  2LX7 A;  3OS2 A;  1M8M A;  4BE2 A;  4M75 D;  5GAM d;  2L5Q A;  2P4R A;  1YIJ T;  5M9O A;  3VUZ A;  1ZX6 A;  1KQS A;  3CCM T;  3HFN A;  3ME9 A;  2DL3 A;  3M55 A;  4GLM A;  5LL6 S;  4DEY A;  1UUE A;  2J7I A;  2JTF A;  3V8L A;  1SHF A;  2DVE A;  5GAN 3;  2YUQ A;  2R5M A;  3H9N A;  2CUD A;  4LNP A;  3A1P A;  2D8J A;  3CBP A;  5EG2 A;  4HCB A;  2PZ1 A;  3E2U A;  3JCM Q;  4AFU C;  1WXB A;  3PFS A;  1PSE A;  3H6Z A;  2YUN A;  5IAY A;  2JNG A;  1QCF A;  2RQV A;  1UG1 A;  4KGZ B;  1X43 A;  3L2R A;  4BY6 C;  4HT8 A;  2A3L A;  2RA2 A;  1GBQ A;  3CCM A;  1HD3 A;  2QEX T;  2J6K A;  2FB7 A;  4EPC A;  1B34 A;  2E3I A;  1VQP T;  4QT7 A;  2CZ1 B;  2NUP A;  2RQR A;  2A7Y A;  1RAG B;  1VQL T;  3CBM A;  2CP0 A;  1YHQ Q;  1H64 1;  4MZP A;  2RQW A;  4ZGD B;  1WJS A;  4HVV A;  3QPH A;  1PRL C;  4DOW A;  4N4G A;  4Y28 E;  2E5Q A;  2JJ9 A;  3RDV A;  1B34 B;  2E65 A;  2AIR B;  4N4H A;  1PNJ A;  3S3M A;  3GNG A;  3WXM B;  4OMN A;  3G6E A;  2G6F X;  2EJF A;  2XDP A;  2LCC A;  4F04 B;  3HRU A;  3OYK A;  1W4S A;  1H3Z A;  4IUV A;  1WIE A;  1MV3 A;  5I2S A;  1W70 A;  1ZUK A;  2F2V A;  4DBQ A;  1RL2 A;  3JCM h;  3SHW A;  1KHC A;  5HKC A;  4XTU A;  1QWE A;  1R8O B;  2FL7 A;  2EIF A;  3RR6 A;  2DA9 A;  3HKS A;  2D9T A;  5GAN 7;  2ZPG B;  4D8D A;  4J9I A;  1XQH A;  1N27 A;  1XNI A;  5LJ5 d;  2XDD A;  1G8X A;  2Y4X A;  1VQN Q;  2EFI A;  1M90 U;  2VXF A;  4C0F A;  3OYD A;  2CH4 W;  3GIB A;  2X3X D;  1WHM A;  1KC8 R;  2DM1 A;  4LUE A;  4ELZ C;  1D0Z A;  3OYN A;  1W2B A;  1G83 A;  3EGD B;  5IN1 A;  1TXQ A;  2LQ8 A;  4OB2 B;  1ACM B;  3EG2 A;  2RI2 A;  1QVF P;  2O2O A;  3X20 B;  2LJ1 A;  2JMA A;  1VQ7 Q;  2XG8 D;  1Q7Y U;  3R6O A;  2GFU A;  2R58 A;  3VRY A;  4JRI A;  3QXE B; 
#chains in the Genus database with same CATH homology
 2KGT A;  1RLQ C;  2X3W D;  2FPD A;  2RNA A;  3I5S A;  2M51 A;  2OI3 A;  1JQQ A;  3TVT A;  4R0K A;  2XMF A;  4J9E A;  4LE9 A;  1E7O A;  2L3P A;  1UJ0 A;  4JZ3 A;  2C0O A;  5L23 A;  4OMP A;  1YWP A;  2YUO A;  2CSI A;  3I9Q A;  1X69 A;  2HEQ A;  2K79 A;  4K11 A;  4HVW A;  3ZL7 C;  4F14 A;  1Y57 A;  2HBW A;  3H0I A;  4RTT A;  3TSZ A;  4DEX A;  2K2M A;  1HJD A;  1Y0M A;  1OOT A;  1X2K A;  1BBZ A;  2ESW A;  2ED1 A;  2EYY A;  1WXU A;  1S1N A;  2JS2 A;  1K0X A;  1JEG A;  1W6X A;  2C0I A;  1T0H A;  1YP5 A;  2LNH B;  2FPF A;  1H3H A;  1WYX A;  2KEA A;  2EYW A;  2EYZ A;  1K1Z A;  4KRT A;  1K76 A;  3VS4 A;  1ZUY A;  4AG1 C;  1WLP B;  2VWF A;  2O9V A;  2A37 A;  4JZ4 A;  2CRE A;  4J9F A;  4OMM A;  1B3Q A;  1UGV A;  5IHN A;  1A0N B;  1E6G A;  4RUG A;  3NMZ C;  2A28 A;  3U23 A;  1OPK A;  1JXM A;  1KSW A;  5IHK A;  2KRN A;  4JJD A;  1YNZ A;  1AOJ A;  2KE9 A;  1V1C A;  2RQT A;  2YDL A;  2SEM A;  1T3L A;  1ZLM A;  3M0P A;  1W1F A;  3M0Q A;  1PHT A;  3SEM A;  5FWB A;  1AEY A;  1JU5 C;  2ABL A;  1OPL A;  1UE9 A;  3VRZ A;  2DBK A;  3NHN A;  4A63 B;  1SPK A;  2ED0 A;  3A98 A;  2KRO A;  2FRY A;  3FJ5 A;  2IIM A;  2NWM A;  1UHC A;  3LH5 A;  2EGA A;  5IHI A;  2BZY A;  1ARK A;  1WA7 A;  1CKA A;  2CUB A;  2KYM A;  1GCQ A;  1SEM A;  3VS7 A;  2GGR A;  2YSQ A;  3H0H A;  3UF4 A;  2VKN A;  1TUC A;  3EG3 A;  1U06 A;  3PVL A;  1YWO A;  1JXO A;  1H8K A;  1I1J A;  4OMO A;  1FMK A;  2GNC A;  1QWF A;  1GCP A;  2RMO A;  1Z9Q A;  1CKB A;  4AFS C;  1SHG A;  1I0C A;  2BZ8 A;  1K4U S;  1X2Q A;  4CC4 B;  1TUD A;  2NUZ A;  2L3Q A;  1QKX A;  2JTE A;  4CC2 A;  1J3T A;  4JJC A;  1RI9 A;  2DL4 A;  1KFZ A;  3EHQ A;  2LMJ A;  3R6N A;  3VS3 A;  3GBQ A;  2LQW A;  1UHF A;  2CSQ A;  2KNB B;  1YCS B;  2KRM A;  1BB9 A;  5GJW B;  3NPF A;  1K0S A;  2RPN A;  2AK5 A;  1KIK A;  2HCK A;  2FRW A;  1N5Z A;  2DL8 A;  1JO8 A;  2JT4 A;  1NEG A;  4Z88 A;  3JV3 A;  3PVQ A;  2KR3 A;  2CDT A;  1U5S A;  3EG1 A;  2OAW A;  3NGP A;  2EYX A;  3ULR B;  1AWW A;  1UTI A;  1RLP C;  4HCK A;  4Z89 A;  5I11 A;  2FPE A;  1T0J A;  1NM7 A;  1GFC A;  2MIO A;  1WDX A;  2GTO A;  2KXC A;  1YN8 A;  1AZE A;  1BU1 A;  3REA B;  1AD5 A;  4LUD A;  1ABQ A;  4J9C A;  3VS0 A;  1LCK A;  4CC7 A;  2ROL A;  1UJY A;  2LJ3 A;  4RTU A;  2GBQ A;  1PWT A;  1WX6 A;  2HDA A;  2VVK A;  1ZBJ A;  5I22 A;  2KRS A;  3RNJ A;  2DL7 A;  4ZNX A;  1HSQ A;  1MUZ A;  4OMQ A;  4X1V A;  2J6O A;  5EC7 A;  4HVU A;  2DLP A;  2KT8 A;  1ZSG A;  3VS2 A;  1GRI A;  4RTV A;  1H92 A;  4J9G A;  2A08 A;  4AFZ C;  2D0N A;  2QDL A;  1EFN A;  1X6G A;  1NEB A;  2EQI A;  3C0C A;  2DRM A;  2LQN A;  3TSW A;  2YUP A;  1ZUU A;  1AZG B;  3QWY A;  2OJ2 A;  3M0R A;  3THK A;  1AWJ A;  2HSP A;  1OV3 A;  1M27 C;  2CT4 A;  4Z8A A;  1QKW A;  2D8H A;  4CC3 A;  2LZ6 B;  4Y92 A;  4RTZ A;  3VS1 A;  2DNU A;  2FEI A;  1MV0 B;  4GBQ A;  1NYF A;  2C0T A;  2F2X A;  2EW3 A;  2PNI A;  2KT1 A;  4D8K A;  1M3B A;  2GQI A;  2DVJ A;  2KYB A;  1GBR A;  1Z9Z A;  2W10 A;  2D1X A;  5ECA A;  4AG2 C;  1VYU A;  2L0A A;  2J05 A;  4RTW A;  2JM9 A;  4IIO A;  2O31 A;  2L2P A;  5IXB A;  2EPD A;  4WCI A;  1ABO A;  1M3A A;  3KFV A;  2LX7 A;  1M8M A;  3REB B;  2P4R A;  2AZS A;  1KJW A;  2EVR A;  3M0S A;  1SRL A;  5HCK A;  1ZX6 A;  1E6H A;  1U3O A;  1WFW A;  2DL3 A;  1VYV A;  4GLM A;  1I07 A;  4M4Z A;  2CH4 A;  2EBP A;  5FWC A;  4JPB W;  2RQU A;  2YT6 A;  5GJV B;  4DEY A;  1UUE A;  2J7I A;  2MOX A;  3VS5 A;  1SHF A;  1T3S A;  2FO0 A;  2YUQ A;  2CUD A;  1OEB A;  4LNP A;  3UA7 A;  2D8J A;  4LN2 A;  1WXT A;  2O88 A;  1M3C A;  2PZ1 A;  1X27 A;  2ECZ A;  4AFU C;  2CT3 A;  1WXB A;  2ROT A;  5IH2 A;  2YUN A;  4ESR A;  1UEC A;  1QCF A;  2RQV A;  3PE0 A;  1UG1 A;  2EKH A;  4HXJ A;  1X43 A;  3H41 A;  2JMC A;  5FW9 A;  1FYN A;  3M0T A;  1SRM A;  2SRC A;  2K9G A;  2DF6 A;  1NLO C;  2A36 A;  1GBQ A;  1GFD A;  1HD3 A;  2JS0 A;  2J6K A;  2M0Y A;  3EGU A;  2DIL A;  4QT7 A;  1AWO A;  2BZX A;  2RQR A;  3I35 A;  4JJB A;  2GTJ A;  1SSH A;  2RF0 A;  2KBT A;  2BTT A;  2K7A A;  1B07 A;  4J9H A;  2DMO A;  2MCN A;  1G2B A;  2F2W A;  2PTK A;  2O9S A;  2RQW A;  2LJ0 A;  4HVV A;  1NYG A;  3UA6 A;  4E6R A;  1GCQ C;  1PRL C;  2LCS A;  2DYB A;  3EG0 A;  2ENM A;  2W0Z A;  2E5K A;  1PNJ A;  2AKK A;  2K6D A;  2DJQ A;  1PKS A;  2RN8 A;  4OMN A;  2L3S A;  2G6F X;  2K3B A;  1XOV A;  1NLP C;  2JXB A;  3VS6 A;  1PRM C;  1X6B A;  3M0U A;  2DX1 A;  3H0F A;  1GL5 A;  1UDL A;  1WIE A;  1MV3 A;  4J9B A;  1W70 A;  4F17 A;  1ZUK A;  1NG2 A;  5IXF A;  4OML A;  2F2V A;  3SHW A;  1QWE A;  4F16 A;  2DE0 X;  4FSS A;  1VA7 A;  2DA9 A;  2H8H A;  4IIM A;  1WI7 A;  4D8D A;  1M30 A;  4J9I A;  3O5Z A;  1QLY A;  3CQT A;  2B86 A;  2KXD A;  4J9D A;  4AFQ C;  2DBM A;  4EIK A;  2J6F A;  3QWX X;  2DL5 A;  2JM8 A;  3UAT A;  2JW4 A;  2CH4 W;  2X3X D;  3IQL A;  1IO6 A;  3RBB B;  1K9A A;  3I5R A;  2LP5 A;  2I0N A;  2DM1 A;  4LUE A;  1PKT A;  4RTY A;  2FG0 A;  1G83 A;  2DRK A;  1VYT A;  1AWX A;  3EG2 A;  1RUW A;  2O2O A;  2V1R A;  2EGE A;  2LJ1 A;  1TG0 A;  2JMA A;  2AZV A;  3EHR A;  2AKL A;  4RTX A;  1CSK A;  2J06 A;  1BK2 A;  4ORZ A;  1AVZ C;  3VRY A;  2V1Q A;  1UFF A;  2EGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...