2F2XA

Alpha-spectrin sh3 domain r21g mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
ELVLALYDYQEKSPGEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Cooperative propagation of local stability changes from low-stability and high-stability regions in a SH3 domain
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2f2xA00
2EGEA 1YP5A 1U5SA 1WXUA 2KT8A 1W1FA 1V1CA 4JZ3A 4IIMA 2L3PA 2EW3A 2E5KA 1G83A 3R6NA 4HCKA 4CC2A 2JW4A 2LX7A 2DYBA 5EC7A 4A63B 2DL3A 1VYUA 1ABOA 1WXTA 4LUDA 1PRMC 2VVKA 3H0HA 2CH4W 4CC3A 2M51A 2XMFA 1NM7A 2EGCA 2K6DA 4QT7A 2BZXA 3RNJA 2DRMA 2I0NA 1RLQC 4JJBA 1I07A 1M3BA 2A28A 3FJ5A 3REAB 2YSQA 1BK2A 1K0SA 2RQVA 1AVZC 1YWOA 3EG2A 1JEGA 4M4ZA 1M27C 2AK5A 1M3CA 1AWXA 1ABQA 4RUGA 2LJ3A 2CT3A 2OAWA 3IQLA 2EVRA 3THKA 1ZX6A 2CUDA 1AZEA 4D8DA 4KRTA 2GGRA 2V1RA 1K0XA 1K4US 3EG1A 1ZBJA 1PKSA 1ZUKA 4D8KA 2G6FX 2D8JA 4AFQC 4RTWA 2JMCA 2LP5A 1QLYA 1LCKA 1GBRA 4Y92A 2JXBA 1AOJA 4DEXA 5I22A 1W6XA 3PVLA 4AG1C 2NUZA 4JPBW 1QKWA 2DA9A 1NYFA 3NHNA 1JO8A 2RQTA 3M0QA 2YUNA 4GBQA 3SHWA 1GFDA 3VS3A 4RTYA 4J9CA 4IIOA 4CC7A 2RN8A 1WIEA 2FPFA 1UFFA 2L3SA 3REBB 4AG2C 1FMKA 2AKKA 2KYMA 2ROTA 2JS0A 3ZL7C 1NEGA 1M8MA 4HVVA 2K7AA 4LE9A 1NLOC 2O9VA 2FRYA 1PKTA 5IXFA 2DE0X 2L2PA 1KSWA 4Z89A 4J9EA 4OMPA 1VYVA 4JJDA 1TUDA 2C0TA 2RQWA 4J9BA 2BZYA 4AFUC 3EG3A 1ZSGA 4JJCA 2ABLA 5L23A 2J6OA 3SEMA 3VRZA 3M0UA 3H41A 1KFZA 1RLPC 3VS2A 2CH4A 1NEBA 2EYXA 2LMJA 2SRCA 3NGPA 2J05A 1GCQC 1PWTA 3M0PA 4RTVA 1Z9ZA 2AZSA 3QWYA 1T0HA 2GTOA 2O9SA 2FRWA 3RBBB 1XOVA 1WXBA 4RTTA 1GBQA 5FW9A 4LN2A 1QWFA 2O2OA 2OI3A 1WYXA 2CSQA 1RUWA 2A36A 1UE9A 1MV3A 3I5SA 2GNCA 2HCKA 1WDXA 2M0YA 1NYGA 2ED1A 2KEAA 1X2KA 2KRMA 3UF4A 2HBWA 1K9AA 5HCKA 3TSWA 1BB9A 2D0NA 2BTTA 1I0CA 2K9GA 2LQNA 2KRNA 5FWBA 1FYNA 1KIKA 3CQTA 2DL5A 4LNPA 1X6BA 2CUBA 2ECZA 3KFVA 2AZVA 4OMLA 4JZ4A 1KJWA 2CSIA 1S1NA 2KXCA 4HVWA 1CKBA 2DJQA 2EKHA 4HXJA 2O31A 2K2MA 1UTIA 1ARKA 1QKXA 2X3XD 2JM9A 2ED0A 2DM1A 1AWOA 2X3WD 4J9IA 1SRMA 4RTXA 2W0ZA 2YUQA 2EQIA 2RNAA 1WLPB 2GQIA 2J06A 3QWXX 2KXDA 2IIMA 1NG2A 4J9FA 2CT4A 3VS0A 1GCQA 2NWMA 2EYYA 2LJ1A 1UG1A 1OOTA 2MIOA 5GJWB 2HSPA 2H8HA 2LJ0A 4K11A 3C0CA 1YNZA 1UJYA 2D1XA 3EGUA 2GBQA 2C0IA 2DL7A 3EHQA 1AWJA 4DEYA 2RF0A 4CC4B 2JT4A 3VS4A 1H3HA 1AD5A 2YDLA 1J3TA 3JV3A 2YUOA 2HDAA 2J6FA 2DRKA 2ENMA 1U3OA 4ORZA 3M0SA 1T3LA 4J9GA 2VKNA 2EGAA 2KYBA 1HD3A 2OJ2A 5IH2A 2DILA 2C0OA 3H0IA 2EYZA 3VRYA 1OV3A 2QDLA 2RMOA 1K76A 2B86A 2V1QA 5I11A 2KE9A 2VWFA 1SPKA 2LZ6B 1NLPC 2FO0A 1JXOA 4OMMA 2KT1A 1UECA 3PE0A 2MCNA 3VS6A 1Y0MA 2DX1A 2DLPA 2LNHB 1WX6A 4J9HA 2KNBB 4AFZC 2DNUA 2FG0A 1JQQA 1E7OA 3UA6A 1SHFA 2DL8A 1UHFA 1HSQA 2K79A 1X2QA 1QCFA 2F2XA 1B3QA 4LUEA 1U06A 2DL4A 4F16A 1EFNA 1UUEA 1I1JA 1X43A 2CDTA 1G2BA 2MOXA 2D8HA 1GFCA 3EG0A 5IHKA 2GTJA 1ZUUA 5GJVB 3UA7A 2DF6A 1UHCA 1T0JA 3VS1A 1OPKA 3UATA 4ZNXA 5IXBA 2DVJA 3U23A 2HEQA 4FSSA 1E6HA 2A37A 2RPNA 1IO6A 1MV0B 1OPLA 1ZUYA 1VA7A 4GLMA 2O88A 1YWPA 2RQRA 1WI7A 2ESWA 2LQWA 2ROLA 3NPFA 3VS7A 2W10A 4X1VA 1N5ZA 1OEBA 3M0RA 1ZLMA 4F14A 2LCSA 1H92A 4HVUA 2FPDA 2YUPA 2JMAA 1UGVA 5IHIA 2JTEA 2K3BA 4ESRA 1BBZA 2RQUA 1YCSB 1H8KA 1TG0A 1WFWA 2KR3A 2L0AA 2DBKA 1GCPA 1B07A 3H0FA 3LH5A 4RTUA 2KGTA 4OMQA 2A08A 2F2VA 4Z88A 2FEIA 4F17A 1T3SA 2DBMA 3PVQA 2PNIA 4Z8AA 2F2WA 4OMNA 4RTZA 2DMOA 1AZGB 2CREA 1X69A 2EPDA 1A0NB 3ULRB 3EHRA 1JXMA 4EIKA 1GL5A 1HJDA 2KBTA 5ECAA 1PHTA 1SHGA 2KROA 5IHNA 2JM8A 4OMOA 3I5RA 3I9QA 2P4RA 3TVTA 1E6GA 2SEMA 1UDLA 2KRSA 1CKAA 1SEMA 1Y57A 1W70A 1JU5C 1RI9A 2EYWA 1BU1A 1YN8A 3A98A 3M0TA 4J9DA 4R0KA 2L3QA 1CSKA 3O5ZA 1WA7A 1PNJA 5FWCA 3I35A 2FPEA 1X6GA 1PRLC 4E6RA 2J7IA 3GBQA 1TUCA 1X27A 2AKLA 2YT6A 1K1ZA 2EBPA 1AWWA 1M3AA 3NMZC 3VS5A 1GRIA 1QWEA 2J6KA 4WCIA 2PTKA 1SRLA 1SSHA 1AEYA 2BZ8A 1Z9QA 3TSZA 1VYTA 4AFSC 2PZ1A 1M30A 1UJ0A 2JS2A 1MUZA
chains in the Genus database with same CATH superfamily
1W2BS 2VYTA 4HT8A 4OB0B 1PSEA 5D6WA 4GLKA 5D7UA 4M78C 1G83A 5LJ3d 1RAHB 4M77G 3MEAA 2QA4T 1Q82U 1ABOA 3MCAB 1Q95G 1Q82R 3QSUA 4N4HA 2M51A 1UGRB 2DZCA 4QT7A 4RCBA 2BZXA 2DRMA 4J8OA 3G4SA 1D0YA 2RQVA 4ANJA 4M4ZA 1M27C 1D0XA 2K4YA 3VYHB 4E7KA 3CCUT 3P8HA 2LT1A 5GAN4 4RUGA 2LJ3A 4M7DB 2OAWA 2H3JA 3JB9H 3GOXA 1ZX6A 2CUDA 2H3EB 1M90C 3BW1A 3MHXA 5IN1A 4KRTA 4PJOA 2V1RA 2KK4A 3CD6A 1K0XA 2BKDN 4IUUA 1ZBJA 2P0PA 2G6FX 3CCVT 2D8JA 5I2SA 4AT1B 2FYKA 1AOJA 3EFSA 1RACB 1OX8A 4BDZA 2QEXT 1QW1A 1JO8A 3SWNA 4OVAA 4N0AC 3HP9A 3PFSA 1TSFA 3CC4T 1NJIU 1IXDA 4LD9K 1NEGA 1M8MA 1NJIR 3PTAA 3CMAA 5GMKm 2FRYA 1PKTA 5IXFA 1LOJA 3NTHA 3UDCA 3HRTA 3OMGA 4L5GA 4Z89A 5LJ3h 4IKFA 1KQSS 4EMKC 3G6EA 2C0TA 2BZYA 4EPCA 2JN0A 3MP1A 1ZSGA 5L23A 2JOYA 5J3BA 3SEMA 3VRZA 1TH7A 3M0UA 3GLXA 1KFZA 4BI3A 3S3OA 2CH4A 1FMVA 1ZSZA 4A53A 4M78G 3HRSA 1RAIB 5GAOm 4A54A 4M7DC 2GTOA 1RI0A 4M77D 3M55A 1R0CB 2V8JA 3CCMT 1KK7A 3PIOA 4RMOA 5CVIA 3RBBB 5A2QE 1M2VA 4R56A 1VQ5T 4A4KA 4PL6A 4DBFA 5GAMh 3OS1A 2OI3A 2M16A 1UE9A 3I5SA 2HCKA 3CPFA 2NUPB 5CO7A 2YRDA 1VQNA 3JCMc 2DXCA 2R58A 5HCKA 3TSWA 2D0NA 2ZPGB 1HYOA 5GAOl 1VQKA 5M9OA 3META 4LD6A 1K9MC 4QQDA 3CC7Q 2B8AA 3JCMP 4PJOB 2COWA 2ECZA 5GMKj 2KDSA 4HVWA 3CCQQ 1CKBA 1TOVA 2X4JA 5GANf 3LX7A 2EKHA 4HXJA 2O31A 1NPPA 1WJSA 5KYWA 2X3XD 5CKEA 3ZFJA 2JM9A 2ED0A 2R57A 1SSFA 2HL5C 2DM1A 4XTZA 3OW2P 2OTJT 1D3BB 2EQUA 3X20B 3I55Q 3TQ7P 5CIUA 2GQIA 3QDFA 2KXDA 1YJ9Q 2CT4A 2VB6A 3SWNB 3VS0A 2EYYA 3H6ZA 3QZ9B 2LJ1A 4FYXB 1OOTA 5GJWB 3HFOA 3CEYA 3JCMW 4K11A 1QVFS 3C0CA 1ZA1B 3GF5A 2O4XA 4FW1A 2D1XA 1MNEA 3PIPA 1KQSP 4DEYA 1JB0E 2QGFB 5CKFA 3OY9A 2F5TX 1H3HA 2YDLA 3PMIA 3JV3A 2DEUA 3UWNA 2P4TA 2K57A 4VUBA 5KYYA 3G4ST 2YLCA 3M0SA 5AYFA 2CP6A 2E3HA 3QIIA 4M75E 2RK1A 2K2VA 3OYIA 1HD3A 3DB3A 2YLBA 4M7AA 3R6OA 3JB9I 2C0OA 3L2ZA 4KBMB 3AHUA 1VQLQ 1KG1A 3OBYA 5L8RE 4HT9A 4FM4B 5I11A 2MWPA 4M78D 1SPKA 5J26A 4M7DG 2LZ6B 2FO0A 1YITA 2KMTA 4DOVA 1JXOA 5HK3A 1JRIA 1M2VB 3I56A 1UECA 1VIFA 2RHXA 2MCNA 3HL8A 1Y0MA 3EG9B 2LNHB 4PJOC 3A8MB 1JQQA 1HSQA 4JRPA 1D0ZA 1QCFA 5GAMg 1B34B 4M77F 4CI0C 3LGFA 2FZKB 3SFMA 1Q82C 4PFOA 3RKWA 2VASA 4ZGJB 1WPYA 3C4SA 4QQ6A 2D8HA 3SWNC 4BE1A 2PQWA 3QJYA 3EG0A 4IUPA 5IHKA 2JZ2A 1RL2A 2GTJA 3E9FA 1ZUUA 3V7SA 4C5IA 2ZPEB 3FB9A 2QXFA 2DVJA 3U23A 5KYWB 3CCLA 3CMAT 3M9QA 1QVFA 2A37A 2OTLQ 4PK4A 2RPNA 1VQMA 4C8QD 4NS5A 4XTUA 1UB4A 1ZUYA 1VA7A 2RI5A 4GLMA 2O88A 1YWPA 2RQRA 1WI7A 2XKOC 2VV5A 1R77A 4X1VA 2PUOB 2JTFA 1VIEA 1VQ8Q 1OEBA 4XTVA 3ME9A 1VQ9A 2MAMA 2JMAA 2O4XB 5GMKh 2M1HA 2K3BA 2X51A 2X4YA 1YCSB 2YWWA 4FU6A 1M1FA 1UEBA 5CQXA 1OU9A 1GCPA 3EGDB 3CXCS 2ZAEA 1B07A 2A08A 1Y71A 2F2VA 2F69A 1IGQA 3MEWA 2DBMA 2PNIA 4DBHA 2D6FA 1YI2Q 2XK0A 2QA4A 2QTXA 3TCJA 2DEQA 2L89A 4ZN1A 1VQNT 3CCQT 4M7AB 1NJIC 1GL5A 1IZ6A 2HD0A 2EKOA 2JM8A 2P4RA 3TVTA 1IGUA 1E6GA 1Y57A 2A7YA 2HQHA 1M9SA 2RHIA 1QP2A 1RI9A 1LNXA 3CCUA 1YJ9T 3A98A 4M7DD 4J9DA 2HKQB 2L3QA 5FRMA 4XTXA 2LTOA 4PJOG 5LJ5g 3I35A 3CC2Q 1MNDA 3F70A 1OULA 3OB9A 1TUCA 1X27A 3HRUA 1VQ4Q 1M3AA 2O01E 4M78F 1QWEA 3V8KA 1Q7YU 1SRLA 4OP0A 1VQ7Q 2DD4A 1AEYA 2HNIA 1Z9QA 3UT1A 2EQKA 3TSZA 1Q7YR 1VYTA 2PZ1A 1IHVA 2QAZA 1D1BA 1UJ0A 2C06A 2JS2A 1OYXA 4Z02A 2EGEA 1YP5A 3A8HB 3T9NA 1WHKA 1WHJA 2AIRB 5EG2A 3HPWA 2EW3A 3R6NA 3CCRA 2LX7A 5EC7A 2DYBA 2CGHA 3EAEA 2DD5A 1VQLT 3M53A 2VVKA 3L2WA 3CC4A 2A3LA 4E2FB 2XMFA 2EGCA 1S72Q 2JUFA 3JSCA 1G3TA 5GANg 2A28A 3REAB 1BK2A 2CP5A 1YWOA 1EZZB 3EG2A 3X28B 1JEGA 1GXIE 2NUTB 3JCMb 3MPUB 4FYVB 1YIJQ 3IQLA 4QQGA 1YITT 3CBPA 2DTOA 4FYWB 5KCOA 3I56T 4D8DA 3CCEQ 2HAXA 3RESA 3MP6A 5GAN2 4OMFB 3P8BB 4XK8E 2JMCA 3M4GA 2IG0A 1I8FA 1GBRA 1G3YA 4XU1A 2PVOB 4DEXA 1QQJA 3QYGB 5I22A 1W6XA 5KE3A 4AG1C 5LL6S 4LDYA 1MHNA 1QKWA 2WSFE 3OMCA 4JS4A 3M0QA 2PU9B 3X24B 1JJ2A 2FZCB 5J39A 1PG5B 4J7IA 4IIOA 4CC7A 3OA6A 4KGZB 1M2OA 3GNFB 4P5NA 1OZ2A 1LPLA 4AG2C 1FMKA 4PJOD 4J6WA 2JTMA 3BDUA 3P8DA 4BE0A 4IUTA 4HVVA 4LDWA 4C8QB 1NLOC 4M7DF 1KSWA 4OMPA 2LRQA 4JJDA 2RQWA 2EJGA 2MK5A 4RKUE 1WQ7A 1F1BB 2ABLA 1BI0A 3H8ZA 1M8VA 1RABB 1TXQA 5GAMj 4M77E 1YI2T 3S3NA 2CP7A 2E3IA 2X35A 2ZPBB 3V7RA 1V76A 2EYXA 2LMJA 2K5FA 3L42A 1Z9ZA 2AZSA 3FRNA 1U8RA 3EH2A 2O9SA 2ZPHB 1EIFA 1XOVA 1M1KU 4JDSA 1GBQA 5FW9A 1QWFA 3AT1B 1JBMA 1WYXA 3X25B 1WJQA 3JCMe 1M1KR 1Y7XA 3DLLA 4IUVA 3OQ5A 2GNCA 3OYEA 1WGSA 1WDXA 2M0YA 4J6XA 3CC2T 2ED1A 2KEAA 1WQWA 3OS2A 1BB9A 3O8VA 3PNWC 6AT1B 2F1LA 2JJ9A 3OS5A 4XU0A 1KIKA 2DL5A 1AT1B 1VQ7T 2RI3A 5KYXA 4OMLA 5GAMd 3ASKA 1KJWA 3GPLA 1S1NA 2M9UA 3VYGA 1G3WA 2DJQA 3URGA 3CCSQ 4O5VA 2V8IA 2K2MA 1UTIA 1QKXA 2KY9A 1MGQA 3LH0A 1HK9A 3C95A 4N4GA 2DFUA 4IUQA 4ELZC 1AWOA 2LX9A 4RTXA 1Y96A 1VQPQ 2EFIA 2EQIA 2I2LA 4C8QC 2J06A 3QWXX 5DLOA 4J9FA 4J5YA 4E7SA 1GCQA 2XHCA 3QYHB 4C92A 1NZ9A 2MIOA 2Y90A 3RDVA 5IAYA 4L59A 2FVUA 3CCRT 1UJYA 2EAYA 3EGUA 4PJNA 4LDVA 2C0IA 3OYNA 3EHQA 2DKGA 2LCCA 3G71Q 4RCCA 1J3TA 2YUOA 1VQOQ 2HDAA 2ZCFB 3A8GB 4BUGA 2DRKA 2ENMA 1PD0A 1U3OA 1WHLA 1YCYA 5LJ5j 1T3LA 2V26A 1NBEB 2WACA 1YHQQ 2CKKA 2DERA 4PJOF 4FIBA 1W2BP 5IH2A 2DILA 4M78E 4OGEA 1BKBA 1WHHA 2ZPIB 3OYAA 1OU8A 2YRVA 3H0IA 2EYZA 1OV3A 4MZPA 3QZ5B 1K76A 2V1QA 1Q7YC 2KE9A 3M54A 2QQAA 3M56A 3A8LB 3LW5E 1SKUB 2RD1A 4OMMA 4BDYA 1TUGB 2Y4YA 3PE0A 2DX1A 2DLPA 1K73U 2M02A 4J9HA 4AFZC 5I21A 3QKJA 2FG0A 4X34A 1QVGA 1K73R 1E7OA 1SHFA 2DL8A 1IHWA 1X2QA 2F2XA 1B3QA 4PNOA 1P92A 3C94A 3C12A 2RJFA 4F16A 1U1TA 4BY6B 4NL3A 3CC7A 5GANj 2HBPA 4M7AD 4RG2A 4N4IA 4A4HA 5LJ5d 1X43A 3CCQA 4J6YA 3CCJQ 2PVGB 3J81E 4QW2A 1HXDA 4KH0B 3TREA 4C5EA 1KQ2A 5GJVB 3RIRA 3UA7A 3V7CA 2DF6A 2LC4A 3I55A 3OBWA 2MI6A 4ELYC 1YJ9A 1IO6A 4AMCA 1MV0B 2VXEA 4XAXB 4IURA 2BE9B 4C8QG 4OGCA 2ROLA 8ATCB 2W10A 3FLGA 4C92B 1N5ZA 2RHZA 3CBMA 8AT1B 2LCSA 1H92A 3HFNA 2IVWA 1XQHA 5CQYA 2VXFA 2JTEA 4ESRA 3JCMQ 2RQUA 4JRIA 5GANd 3M58A 2KR3A 2DBKA 3BFMA 3L2UA 2MPXC 4OMQA 2CZ0B 3PVQA 4Z8AA 4OMNA 2BUDA 2DMOA 4BACA 1AZGB 2RHUA 2CREA 3S6WA 2EPDA 1VQLA 2KAFA 4KUDK 2E5QA 4Q5WA 3HSBA 5FLXE 2KBTA 5ECAA 1PHTA 1TS9A 4M7DE 3QG1A 5IHNA 4F7UA 1WNLA 2RM4A 1UDLA 2KRSA 1MMAA 1RAGB 1SEMA 4BY6C 4M77A 1JU5C 2EYWA 5GMKi 1ZSZB 4FYYB 4QVZA 1CSKA 1FXXA 5LJ3e 1Q86U 5DY9A 3MP8A 1BI1A 5LJ5h 2FPEA 3PMTA 1PRLC 1Q86R 2J7IA 3PGGA 1X75C 3EGXA 5FRNA 1K1ZA 2EBPA 4Y91A 3E19A 1AWWA 1H3ZA 2PVDB 4WCIA 2PTKA 2CZ7B 1SSHA 4XTWA 2E12A 4E7LA 3FDRA 1N9SA 5HY6A 2JNGA 1M1KC 1I5OB 3RERA 1WHMA 4C92C 2RA2A 2KT8A 1V1CA 2OTLA 4JZ3A 3OYLA 2L3PA 3UPUA 2E5KA 4KUIA 2P84A 5A0LA 3DKMA 2JW4A 4A63B 3TU4K 2RI2A 2DL3A 4M7AF 1VYUA 1WXTA 4LUDA 1PRMC 2DXTA 1LJOA 3H0HA 1VQ8A 4B9WA 1NM7A 3GP8A 4WF2A 5GANh 4ZN3A 2I0NA 1RLQC 3CMEQ 2FB7A 1I07A 3JB9J 3FJ5A 2JVVA 3QO3A 4ZGEB 1K0SA 2DVEA 1QVFP 3JCMf 1I5LA 2AK5A 2QYZA 1M3CA 1AWXA 2DTHA 3G1JA 1YJNQ 4NOYA 3EFRA 2CT3A 3ER0A 4JUVA 4OF1A 1AZEA 2YXYA 1YI2A 1IB8A 1G3SA 1ZUKA 1ZSZC 3CCJT 1ZQ1A 4MZTA 2YRCA 2DPPB 4RTWA 5A0DA 3CCLQ 1QLYA 1LCKA 5KYYB 4KGXB 4OB3B 3PVLA 3CC7T 2NUZA 3Q1JA 1W4SA 4F7UB 4II1A 1NYFA 2YUNA 4GBQA 1BYMA 4PJOE 3VS3A 3NTKA 1K8AU 3CC2A 4MZMA 1WIEA 1VQ4A 1YJWQ 4XU3A 3I55T 1K8AR 1R8OB 1UFFA 2L3SA 1YBYA 2AKKA 2KYMA 3EGXB 2JS0A 3EFOA 1VQ7A 4LE9A 3OS0A 2RB6A 5GAN8 5GAOq 2L2PA 4J9EA 5DLQE 1VYVA 2QA4Q 5GAN7 4AFUC 3EG3A 2HKNA 1JJ2S 3JAME 2J6OA 1K73C 4C0GA 4PLLA 3GIBA 4C92G 4EMHA 1VQ6Q 2SRCA 3NGPA 2L5QA 2J05A 4RTVA 5GAN5 3EH1A 5KYUA 2RJCA 2EJ9A 1EX4A 1UGPB 2FRWA 1U1SA 1WXBA 5GAOp 4LN2A 4WTOB 1XJWB 2CSQA 5GAOr 3KXTA 2EWNA 1YIJA 4N0AA 1NYGA 2KRMA 3UF4A 3CCVQ 1X01A 3CCEA 4OB1B 2K9GA 2LQNA 3RKYA 5FWBA 3CXCP 3JCMX 2QQ9A 4C8QF 5CKDA 1FYNA 2KI7A 4M7AC 2QI2A 1D1CA 4LNPA 1X6BA 2OAUA 3KFVA 4JZ4A 2QEXQ 3ZEHA 4J83A 3RKXA 3KUFA 1ARKA 4EMKA 2EQMA 2A0FB 2XG8D 4PFZA 5GMKe 3J7AF 3QXEB 2X3WD 3G7ZA 1VUBA 1SRMA 2VC8A 2W0ZA 2LQ8A 1WLPB 4QKUA 4RG8A 2AHJB 3BDLA 1NG2A 3M5AA 3OYDA 1ACMB 4ZTJA 2HSEB 3WVEB 4M75A 1ZHIA 4M7DA 1KC8U 2OTLT 2H8HA 1QVPA 2X4WA 1YNZA 3HTRA 4L6V5 1SG5A 1KC8R 7AT1B 1H641 2GBQA 2EJFA 3VS4A 1VQ8T 1JJ2P 1AD5A 1YJNT 1C1AA 2BIVA 3LLRA 4LDUA 3FEOA 4J9GA 4JS5A 2VKNA 1PD1A 2EGAA 4YTLA 3LGLA 1Q86C 3CCMQ 1KD1U 4J7FA 1VQ5Q 4C92D 5CKHA 2QASA 1IREB 1KD1R 5KYUB 2VWFA 1NLPC 1TWBA 1QCOA 1XNIA 5CAIA 2Z0WA 5LJ3f 1WX6A 2RJEA 3QPHA 2KNBB 3OYYA 3RR6A 3CPWA 2DNUA 3A5ZB 2RO0A 3MJXA 1KQ1A 1U06A 3NFCA 4PJLA 5D6XA 2DL4A 4PKCC 1N6AA 1EFNA 2E64A 1PM3A 1UUEA 2XDPA 4ATOA 3E1SA 1I1JA 2CDTA 1G2BA 4B9XA 5GAN6 4F7UG 2OTJQ 1C6VX 3CCSA 2E1HA 4M7AG 3ZBDA 1VQ4T 3JCMg 2GFAA 2HL3A 2MYSA 3OSSC 1QCNA 5GAMf 1UHCA 3VS1A 1OPKA 3UATA 4EMKB 5IXBA 4QVCA 1VQPA 2HEQA 5KH6A 2L3RA 2R5AA 2YHTA 4FSSA 3RMSA 1QVGS 1VQ6T 2MWOA 1OPLA 3M4YA 4R55A 4C0ZA 3MO8A 3HKSA 2LQWA 2DTIA 4ZGDB 4JLIA 3NPFA 2AT1B 3VS7A 2XIDA 2XICA 2NUPA 4M75B 3M0RA 4F14A 3G4SQ 3QBYA 5IHIA 3G71A 4NL2A 1BCOA 3MKDA 2CP2A 4V2SA 1BBZA 1S72T 1VQOA 5CCAA 1BI2A 1O75A 2LT4A 3LH5A 4RTUA 4Z88A 1YHQA 1G5VA 4HCBA 2QGGA 4F17A 1T3SA 3L2VA 3SDZA 1K8AC 1D3BA 2F2WA 3JB9G 4B6MA 4RTZA 1YIJT 2K3YA 5AT1B 3CD6Q 4HA8A 1X69A 1A0NB 3ULRB 3EHRA 1JXMA 4EIKA 5I2MA 2EIFA 1HJDA 2VUBA 3CCET 3OW2S 1SHGA 2KROA 4OMOA 3I5RA 2QDYB 2SEMA 1BCMA 1W70A 4FL6A 3M0TA 4FW2A 2XDBA 1VOMA 1W2BA 2E4HA 4CRIA 2DETA 1PNJA 4C92F 4FCYA 2QTVA 2WSEE 2LDMA 2YT6A 2M0OA 2DXBA 4DBQA 3J80E 3NMZC 1GRIA 2J6KA 1FX7A 1DJ7B 3TEEA 3VU3C 2PUKB 3CCJA 3JRZA 3CMAQ 3PT9A 4XTYA 4AFSC 2D9TA 1M30A 4Y28E 5LJ5f 1QVGP 4LDXA 1U5SA 1WXUA 4M75C 3G6EQ 1W1FA 4A4FA 1M1GA 5GMKl 4IIMA 3OYFA 4PFPA 2QQBA 4HCKA 4CC2A 5KYXB 4C8QE 3EG9A 3RUXA 2CH4W 4CC3A 4C0FA 3S3MA 2K6DA 3RNJA 1B34A 4JJBA 1M3BA 1Y96B 2YSQA 2MMPA 1AVZC 1ZBXA 2DIQA 2LVMA 3VJPA 1ABQA 3JCMJ 1BIAA 1QP3A 2FZGB 2EVRA 3THKA 4PJJA 3WVDB 1VQNQ 4D6WA 2L8DA 3OW2A 3LYIA 2GGRA 1K4US 3EG1A 5CKBA 1PKSA 1VQKQ 4D8KA 4AFQC 4FT4A 1KC8C 2DAQA 2LP5A 3JB9D 4Y92A 2JXBA 2COYA 2GFUA 1RADB 4E47A 3V8JA 3V8LA 4LXCA 2X9HA 2EYQA 1QMCA 2E65A 4JPBW 1NE8A 2DA9A 1YFNA 3NHNA 4TVRA 1KQSA 1RAEB 3CCST 2RQTA 3SHWA 2KQWA 1I81A 4BB7A 3OYHA 2QK0A 1GFDA 3VUBA 4RTYA 4J9CA 2DO3A 3MEUA 2RN8A 2FPFA 4QVDA 2DXUA 3E2UA 2DK3A 1VQPT 1WHGA 3EGDA 3REBB 1KD1C 5HKCA 2ROTA 3ZL7C 4MMKA 4F04B 4XQ3A 1M4ZA 1MMDA 1N8RU 2K7AA 1RAFB 4BI4A 2O9VA 2K5LA 2DE0X 3X26B 2ZZDA 5CK9A 3L2QA 2E41A 1N8RR 4ZTFA 5LJ3g 3LWIA 1TUDA 2VGMA 1N27A 4J9BA 1IRXA 4JJCA 2COZA 4C5GA 3G71T 5KYNA 1OQKA 2KVQG 4M75G 5FU6B 2P0QA 2MF2A 3H41A 4KT0E 1VQOT 1RLPC 3VS2A 3CD6T 4A4EA 1NEBA 4OB2B 4JRQA 2XD0A 2BE7D 1GCQC 1PWTA 3M0PA 1Y07A 1Q81U 5GAMe 1FWZA 2E10A 4BE2A 2CYZB 3QWYA 3OSVA 1YHQT 1T0HA 2NLUA 2GCXA 3CMEA 1Q81R 1G8XA 5HK0A 1PC0A 4F7UF 2HQEA 4RTTA 2O2OA 1OI1A 4XU2A 4MMLA 1YITQ 3QHSA 4PJMA 1RUWA 4JRKA 4E7JA 2A36A 3I56Q 4MDWA 1MV3A 1YJNA 2E6ZA 3SB2A 1X2KA 2HBWA 3INZA 4X9CA 1K9AA 2BTTA 1I0CA 2KRNA 3H9NA 5C0MA 4DOWA 3M59A 3CQTA 5D6YA 1PCXA 2GF7A 2CUBA 2AZVA 1SF9A 1KHCA 2CSIA 2KXCA 4DA4A 4UC4A 4A4GA 3VUZA 2KSSA 3G6ET 2RJDA 4HCZA 4O6JA 1X6OA 4J9IA 3JCMd 1M5Q1 2YUQA 1M90U 2RNAA 4KULA 2CP0A 1VQMQ 2IIMA 4ME7A 2NUTA 2NWMA 3QUIA 1M90R 1YJWA 3QJ6A 1UG1A 3JB9F 3JCMV 2HSPA 3VKIA 1LVKA 5GAN3 2LJ0A 1WZOA 4EMGA 4M78A 4C0DB 4M77B 3FIFA 1O9SA 1RAAB 5FU6C 1VQ9Q 3FJPA 2ATCB 2DL7A 1BI3A 1AWJA 1MMNA 2RF0A 5DM7R 3OYKA 5FU7B 4CC4B 2JT4A 1R0BG 2CZ6B 2J6FA 4HCCA 4ORZA 4DQ2A 4DBRA 1XTDA 4C92E 2K3XA 2XU8A 1D09B 1UGQB 1VQ6A 2KYBA 2OJ2A 1VQKT 3MEVA 3OYMA 2FL7A 1ZA2B 5LJ5e 2LNVA 4MDXA 4M75D 3WXMB 3VRYA 2QQRA 4HKEA 2QDLA 2RMOA 2XDDA 2B86A 2LCLA 3A8OB 2CS7A 2IPOB 3DLMA 2DJZA 3BY7A 2KT1A 1PSFA 2LQKA 2QQSA 3VS6A 3L1AA 1S72A 4C8QA 3CCUQ 4JLGA 3SD4A 2F5KA 3GNGA 4PLIA 2DZ9A 3CCVA 2E6NA 1KHIA 3UA6A 1UHFA 2K79A 3A1PA 2RHYA 4LUEA 3D7SB 1NPRA 2X4XA 2RH2A 2CP3A 1B7TA 3M57A 2MOXA 4FT2A 2QEXA 1FMWA 1GFCA 3JCMh 5GANe 2ZGWA 1TU0B 4E7ZA 1T0JA 3VV0A 2K5IA 2E70A 4ZNXA 4C0DC 4M77C 3CPWS 2RK2A 3QDRB 4FSXA 1E6HA 2XI9A 4BD3A 4GY5A 2QG9B 3CXCA 1D1AA 5FU7C 3CCRQ 2ESWA 2HMAA 3KBGA 1K9MU 2OX7A 3LWHA 3CC4Q 2VGNA 1K9MR 1ZLMA 3BE3A 4HVUA 2FPDA 2YUPA 2HZYA 4JJNK 1UGVA 4M78B 5KE2A 2V8KA 9ATCB 1UGSB 5A0GA 4KGVB 1C0MA 1TTHB 4EDUA 1H8KA 1TG0A 1WFWA 1V29B 3OYCA 3CMET 3E9GA 2L0AA 3HHTB 3OYJA 1OX9A 3H0FA 2KGTA 3N5BB 2R5MA 3CBOA 3EFOB 2FEIA 3CCMA 3DB4A 2EQJA 4E7HA 3FC3A 2HQXA 1VQ5A 2DIGA 2D0QB 3L2RA 2NYSA 1AHJB 5KCHA 4X9DA 1BIBA 1OZ3A 5GAOn 3I9QA 1N8RC 5LJ3j 1CKAA 3CCLT 3OYBA 1BU1A 4E7IA 1YN8A 2CZ1B 2WSCE 2P0KA 1VQMT 1WJRA 2Y4XA 4R0KA 1I4K1 4KH1B 3O5ZA 5IT9E 1WA7A 4C5HA 5FWCA 4M75F 1X6GA 2G3RA 4E6RA 2ZPFB 3GBQA 5C6SA 1MMGA 3RMQA 2AKLA 3VS5A 1VQ9T 1Q81C 4F7UE 2OTJA 3OYGA 4M7AE 2FHDA 4BI8B 2BZ8A 1YJWT 2DYIA 1N9RA 5FROA 2GQVA 3CPWP 3NTIA 5CR2A 1MUZA
chains in the Genus database with same CATH topology
2EGEA 1YP5A 1U5SA 1WXUA 2KT8A 1W1FA 1V1CA 4JZ3A 4IIMA 2L3PA 2EW3A 2E5KA 1G83A 3R6NA 4HCKA 4CC2A 2JW4A 2LX7A 2DYBA 5EC7A 4A63B 2DL3A 1VYUA 1ABOA 1WXTA 4LUDA 1PRMC 2VVKA 3H0HA 2CH4W 4CC3A 2M51A 2XMFA 1NM7A 2EGCA 2K6DA 4QT7A 2BZXA 3RNJA 2DRMA 2I0NA 1RLQC 4JJBA 1I07A 1M3BA 2A28A 3FJ5A 3REAB 2YSQA 1BK2A 1K0SA 2RQVA 1AVZC 1YWOA 3EG2A 1JEGA 4M4ZA 1M27C 2AK5A 1M3CA 1AWXA 1ABQA 4RUGA 2LJ3A 2CT3A 2OAWA 3IQLA 2EVRA 3THKA 1ZX6A 2CUDA 1AZEA 4D8DA 4KRTA 2GGRA 2V1RA 1K0XA 1K4US 3EG1A 1ZBJA 1PKSA 1ZUKA 4D8KA 2G6FX 2D8JA 4AFQC 4RTWA 2JMCA 2LP5A 1QLYA 1LCKA 1GBRA 4Y92A 2JXBA 1AOJA 4DEXA 5I22A 1W6XA 3PVLA 4AG1C 2NUZA 4JPBW 1QKWA 2DA9A 1NYFA 3NHNA 1JO8A 2RQTA 3M0QA 2YUNA 4GBQA 3SHWA 1GFDA 3VS3A 4RTYA 4J9CA 4IIOA 4CC7A 2RN8A 1WIEA 2FPFA 1UFFA 2L3SA 3REBB 4AG2C 1FMKA 2AKKA 2KYMA 2ROTA 2JS0A 3ZL7C 1NEGA 1M8MA 4HVVA 2K7AA 4LE9A 1NLOC 2O9VA 2FRYA 1PKTA 5IXFA 2DE0X 2L2PA 1KSWA 4Z89A 4J9EA 4OMPA 1VYVA 4JJDA 1TUDA 2C0TA 2RQWA 4J9BA 2BZYA 4AFUC 3EG3A 1ZSGA 4JJCA 2ABLA 5L23A 2J6OA 3SEMA 3VRZA 3M0UA 3H41A 1KFZA 1RLPC 3VS2A 2CH4A 1NEBA 2EYXA 2LMJA 2SRCA 3NGPA 2J05A 1GCQC 1PWTA 3M0PA 4RTVA 1Z9ZA 2AZSA 3QWYA 1T0HA 2GTOA 2O9SA 2FRWA 3RBBB 1XOVA 1WXBA 4RTTA 1GBQA 5FW9A 4LN2A 1QWFA 2O2OA 2OI3A 1WYXA 2CSQA 1RUWA 2A36A 1UE9A 1MV3A 3I5SA 2GNCA 2HCKA 1WDXA 2M0YA 1NYGA 2ED1A 2KEAA 1X2KA 2KRMA 3UF4A 2HBWA 1K9AA 5HCKA 3TSWA 1BB9A 2D0NA 2BTTA 1I0CA 2K9GA 2LQNA 2KRNA 5FWBA 1FYNA 1KIKA 3CQTA 2DL5A 4LNPA 1X6BA 2CUBA 2ECZA 3KFVA 2AZVA 4OMLA 4JZ4A 1KJWA 2CSIA 1S1NA 2KXCA 4HVWA 1CKBA 2DJQA 2EKHA 4HXJA 2O31A 2K2MA 1UTIA 1ARKA 1QKXA 2X3XD 2JM9A 2ED0A 2DM1A 1AWOA 2X3WD 4J9IA 1SRMA 4RTXA 2W0ZA 2YUQA 2EQIA 2RNAA 1WLPB 2GQIA 2J06A 3QWXX 2KXDA 2IIMA 1NG2A 4J9FA 2CT4A 3VS0A 1GCQA 2NWMA 2EYYA 2LJ1A 1UG1A 1OOTA 2MIOA 5GJWB 2HSPA 2H8HA 2LJ0A 4K11A 3C0CA 1YNZA 1UJYA 2D1XA 3EGUA 2GBQA 2C0IA 2DL7A 3EHQA 1AWJA 4DEYA 2RF0A 4CC4B 2JT4A 3VS4A 1H3HA 1AD5A 2YDLA 1J3TA 3JV3A 2YUOA 2HDAA 2J6FA 2DRKA 2ENMA 1U3OA 4ORZA 3M0SA 1T3LA 4J9GA 2VKNA 2EGAA 2KYBA 1HD3A 2OJ2A 5IH2A 2DILA 2C0OA 3H0IA 2EYZA 3VRYA 1OV3A 2QDLA 2RMOA 1K76A 2B86A 2V1QA 5I11A 2KE9A 2VWFA 1SPKA 2LZ6B 1NLPC 2FO0A 1JXOA 4OMMA 2KT1A 1UECA 3PE0A 2MCNA 3VS6A 1Y0MA 2DX1A 2DLPA 2LNHB 1WX6A 4J9HA 2KNBB 4AFZC 2DNUA 2FG0A 1JQQA 1E7OA 3UA6A 1SHFA 2DL8A 1UHFA 1HSQA 2K79A 1X2QA 1QCFA 2F2XA 1B3QA 4LUEA 1U06A 2DL4A 4F16A 1EFNA 1UUEA 1I1JA 1X43A 2CDTA 1G2BA 2MOXA 2D8HA 1GFCA 3EG0A 5IHKA 2GTJA 1ZUUA 5GJVB 3UA7A 2DF6A 1UHCA 1T0JA 3VS1A 1OPKA 3UATA 4ZNXA 5IXBA 2DVJA 3U23A 2HEQA 4FSSA 1E6HA 2A37A 2RPNA 1IO6A 1MV0B 1OPLA 1ZUYA 1VA7A 4GLMA 2O88A 1YWPA 2RQRA 1WI7A 2ESWA 2LQWA 2ROLA 3NPFA 3VS7A 2W10A 4X1VA 1N5ZA 1OEBA 3M0RA 1ZLMA 4F14A 2LCSA 1H92A 4HVUA 2FPDA 2YUPA 2JMAA 1UGVA 5IHIA 2JTEA 2K3BA 4ESRA 1BBZA 2RQUA 1YCSB 1H8KA 1TG0A 1WFWA 2KR3A 2L0AA 2DBKA 1GCPA 1B07A 3H0FA 3LH5A 4RTUA 2KGTA 4OMQA 2A08A 2F2VA 4Z88A 2FEIA 4F17A 1T3SA 2DBMA 3PVQA 2PNIA 4Z8AA 2F2WA 4OMNA 4RTZA 2DMOA 1AZGB 2CREA 1X69A 2EPDA 1A0NB 3ULRB 3EHRA 1JXMA 4EIKA 1GL5A 1HJDA 2KBTA 5ECAA 1PHTA 1SHGA 2KROA 5IHNA 2JM8A 4OMOA 3I5RA 3I9QA 2P4RA 3TVTA 1E6GA 2SEMA 1UDLA 2KRSA 1CKAA 1SEMA 1Y57A 1W70A 1JU5C 1RI9A 2EYWA 1BU1A 1YN8A 3A98A 3M0TA 4J9DA 4R0KA 2L3QA 1CSKA 3O5ZA 1WA7A 1PNJA 5FWCA 3I35A 2FPEA 1X6GA 1PRLC 4E6RA 2J7IA 3GBQA 1TUCA 1X27A 2AKLA 2YT6A 1K1ZA 2EBPA 1AWWA 1M3AA 3NMZC 3VS5A 1GRIA 1QWEA 2J6KA 4WCIA 2PTKA 1SRLA 1SSHA 1AEYA 2BZ8A 1Z9QA 3TSZA 1VYTA 4AFSC 2PZ1A 1M30A 1UJ0A 2JS2A 1MUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGE A;  1YP5 A;  1U5S A;  1WXU A;  2KT8 A;  1W1F A;  1V1C A;  4JZ3 A;  4IIM A;  2L3P A;  2EW3 A;  2E5K A;  1G83 A;  3R6N A;  4HCK A;  4CC2 A;  2JW4 A;  2LX7 A;  2DYB A;  5EC7 A;  4A63 B;  2DL3 A;  1VYU A;  1ABO A;  1WXT A;  4LUD A;  1PRM C;  2VVK A;  3H0H A;  2CH4 W;  4CC3 A;  2M51 A;  2XMF A;  1NM7 A;  2EGC A;  2K6D A;  4QT7 A;  2BZX A;  3RNJ A;  2DRM A;  2I0N A;  1RLQ C;  4JJB A;  1I07 A;  1M3B A;  2A28 A;  3FJ5 A;  3REA B;  2YSQ A;  1BK2 A;  1K0S A;  2RQV A;  1AVZ C;  1YWO A;  3EG2 A;  1JEG A;  4M4Z A;  1M27 C;  2AK5 A;  1M3C A;  1AWX A;  1ABQ A;  4RUG A;  2LJ3 A;  2CT3 A;  2OAW A;  3IQL A;  2EVR A;  3THK A;  1ZX6 A;  2CUD A;  1AZE A;  4D8D A;  4KRT A;  2GGR A;  2V1R A;  1K0X A;  1K4U S;  3EG1 A;  1ZBJ A;  1PKS A;  1ZUK A;  4D8K A;  2G6F X;  2D8J A;  4AFQ C;  4RTW A;  2JMC A;  2LP5 A;  1QLY A;  1LCK A;  1GBR A;  4Y92 A;  2JXB A;  1AOJ A;  4DEX A;  5I22 A;  1W6X A;  3PVL A;  4AG1 C;  2NUZ A;  4JPB W;  1QKW A;  2DA9 A;  1NYF A;  3NHN A;  1JO8 A;  2RQT A;  3M0Q A;  2YUN A;  4GBQ A;  3SHW A;  1GFD A;  3VS3 A;  4RTY A;  4J9C A;  4IIO A;  4CC7 A;  2RN8 A;  1WIE A;  2FPF A;  1UFF A;  2L3S A;  3REB B;  4AG2 C;  1FMK A;  2AKK A;  2KYM A;  2ROT A;  2JS0 A;  3ZL7 C;  1NEG A;  1M8M A;  4HVV A;  2K7A A;  4LE9 A;  1NLO C;  2O9V A;  2FRY A;  1PKT A;  5IXF A;  2DE0 X;  2L2P A;  1KSW A;  4Z89 A;  4J9E A;  4OMP A;  1VYV A;  4JJD A;  1TUD A;  2C0T A;  2RQW A;  4J9B A;  2BZY A;  4AFU C;  3EG3 A;  1ZSG A;  4JJC A;  2ABL A;  5L23 A;  2J6O A;  3SEM A;  3VRZ A;  3M0U A;  3H41 A;  1KFZ A;  1RLP C;  3VS2 A;  2CH4 A;  1NEB A;  2EYX A;  2LMJ A;  2SRC A;  3NGP A;  2J05 A;  1GCQ C;  1PWT A;  3M0P A;  4RTV A;  1Z9Z A;  2AZS A;  3QWY A;  1T0H A;  2GTO A;  2O9S A;  2FRW A;  3RBB B;  1XOV A;  1WXB A;  4RTT A;  1GBQ A;  5FW9 A;  4LN2 A;  1QWF A;  2O2O A;  2OI3 A;  1WYX A;  2CSQ A;  1RUW A;  2A36 A;  1UE9 A;  1MV3 A;  3I5S A;  2GNC A;  2HCK A;  1WDX A;  2M0Y A;  1NYG A;  2ED1 A;  2KEA A;  1X2K A;  2KRM A;  3UF4 A;  2HBW A;  1K9A A;  5HCK A;  3TSW A;  1BB9 A;  2D0N A;  2BTT A;  1I0C A;  2K9G A;  2LQN A;  2KRN A;  5FWB A;  1FYN A;  1KIK A;  3CQT A;  2DL5 A;  4LNP A;  1X6B A;  2CUB A;  2ECZ A;  3KFV A;  2AZV A;  4OML A;  4JZ4 A;  1KJW A;  2CSI A;  1S1N A;  2KXC A;  4HVW A;  1CKB A;  2DJQ A;  2EKH A;  4HXJ A;  2O31 A;  2K2M A;  1UTI A;  1ARK A;  1QKX A;  2X3X D;  2JM9 A;  2ED0 A;  2DM1 A;  1AWO A;  2X3W D;  4J9I A;  1SRM A;  4RTX A;  2W0Z A;  2YUQ A;  2EQI A;  2RNA A;  1WLP B;  2GQI A;  2J06 A;  3QWX X;  2KXD A;  2IIM A;  1NG2 A;  4J9F A;  2CT4 A;  3VS0 A;  1GCQ A;  2NWM A;  2EYY A;  2LJ1 A;  1UG1 A;  1OOT A;  2MIO A;  5GJW B;  2HSP A;  2H8H A;  2LJ0 A;  4K11 A;  3C0C A;  1YNZ A;  1UJY A;  2D1X A;  3EGU A;  2GBQ A;  2C0I A;  2DL7 A;  3EHQ A;  1AWJ A;  4DEY A;  2RF0 A;  4CC4 B;  2JT4 A;  3VS4 A;  1H3H A;  1AD5 A;  2YDL A;  1J3T A;  3JV3 A;  2YUO A;  2HDA A;  2J6F A;  2DRK A;  2ENM A;  1U3O A;  4ORZ A;  3M0S A;  1T3L A;  4J9G A;  2VKN A;  2EGA A;  2KYB A;  1HD3 A;  2OJ2 A;  5IH2 A;  2DIL A;  2C0O A;  3H0I A;  2EYZ A;  3VRY A;  1OV3 A;  2QDL A;  2RMO A;  1K76 A;  2B86 A;  2V1Q A;  5I11 A;  2KE9 A;  2VWF A;  1SPK A;  2LZ6 B;  1NLP C;  2FO0 A;  1JXO A;  4OMM A;  2KT1 A;  1UEC A;  3PE0 A;  2MCN A;  3VS6 A;  1Y0M A;  2DX1 A;  2DLP A;  2LNH B;  1WX6 A;  4J9H A;  2KNB B;  4AFZ C;  2DNU A;  2FG0 A;  1JQQ A;  1E7O A;  3UA6 A;  1SHF A;  2DL8 A;  1UHF A;  1HSQ A;  2K79 A;  1X2Q A;  1QCF A;  2F2X A;  1B3Q A;  4LUE A;  1U06 A;  2DL4 A;  4F16 A;  1EFN A;  1UUE A;  1I1J A;  1X43 A;  2CDT A;  1G2B A;  2MOX A;  2D8H A;  1GFC A;  3EG0 A;  5IHK A;  2GTJ A;  1ZUU A;  5GJV B;  3UA7 A;  2DF6 A;  1UHC A;  1T0J A;  3VS1 A;  1OPK A;  3UAT A;  4ZNX A;  5IXB A;  2DVJ A;  3U23 A;  2HEQ A;  4FSS A;  1E6H A;  2A37 A;  2RPN A;  1IO6 A;  1MV0 B;  1OPL A;  1ZUY A;  1VA7 A;  4GLM A;  2O88 A;  1YWP A;  2RQR A;  1WI7 A;  2ESW A;  2LQW A;  2ROL A;  3NPF A;  3VS7 A;  2W10 A;  4X1V A;  1N5Z A;  1OEB A;  3M0R A;  1ZLM A;  4F14 A;  2LCS A;  1H92 A;  4HVU A;  2FPD A;  2YUP A;  2JMA A;  1UGV A;  5IHI A;  2JTE A;  2K3B A;  4ESR A;  1BBZ A;  2RQU A;  1YCS B;  1H8K A;  1TG0 A;  1WFW A;  2KR3 A;  2L0A A;  2DBK A;  1GCP A;  1B07 A;  3H0F A;  3LH5 A;  4RTU A;  2KGT A;  4OMQ A;  2A08 A;  2F2V A;  4Z88 A;  2FEI A;  4F17 A;  1T3S A;  2DBM A;  3PVQ A;  2PNI A;  4Z8A A;  2F2W A;  4OMN A;  4RTZ A;  2DMO A;  1AZG B;  2CRE A;  1X69 A;  2EPD A;  1A0N B;  3ULR B;  3EHR A;  1JXM A;  4EIK A;  1GL5 A;  1HJD A;  2KBT A;  5ECA A;  1PHT A;  1SHG A;  2KRO A;  5IHN A;  2JM8 A;  4OMO A;  3I5R A;  3I9Q A;  2P4R A;  3TVT A;  1E6G A;  2SEM A;  1UDL A;  2KRS A;  1CKA A;  1SEM A;  1Y57 A;  1W70 A;  1JU5 C;  1RI9 A;  2EYW A;  1BU1 A;  1YN8 A;  3A98 A;  3M0T A;  4J9D A;  4R0K A;  2L3Q A;  1CSK A;  3O5Z A;  1WA7 A;  1PNJ A;  5FWC A;  3I35 A;  2FPE A;  1X6G A;  1PRL C;  4E6R A;  2J7I A;  3GBQ A;  1TUC A;  1X27 A;  2AKL A;  2YT6 A;  1K1Z A;  2EBP A;  1AWW A;  1M3A A;  3NMZ C;  3VS5 A;  1GRI A;  1QWE A;  2J6K A;  4WCI A;  2PTK A;  1SRL A;  1SSH A;  1AEY A;  2BZ8 A;  1Z9Q A;  3TSZ A;  1VYT A;  4AFS C;  2PZ1 A;  1M30 A;  1UJ0 A;  2JS2 A;  1MUZ A; 
#chains in the Genus database with same CATH topology
 1W2B S;  2VYT A;  4HT8 A;  4OB0 B;  1PSE A;  5D6W A;  4GLK A;  5D7U A;  4M78 C;  1G83 A;  5LJ3 d;  1RAH B;  4M77 G;  3MEA A;  2QA4 T;  1Q82 U;  1ABO A;  3MCA B;  1Q95 G;  1Q82 R;  3QSU A;  4N4H A;  2M51 A;  1UGR B;  2DZC A;  4QT7 A;  4RCB A;  2BZX A;  2DRM A;  4J8O A;  3G4S A;  1D0Y A;  2RQV A;  4ANJ A;  4M4Z A;  1M27 C;  1D0X A;  2K4Y A;  3VYH B;  4E7K A;  3CCU T;  3P8H A;  2LT1 A;  5GAN 4;  4RUG A;  2LJ3 A;  4M7D B;  2OAW A;  2H3J A;  3JB9 H;  3GOX A;  1ZX6 A;  2CUD A;  2H3E B;  1M90 C;  3BW1 A;  3MHX A;  5IN1 A;  4KRT A;  4PJO A;  2V1R A;  2KK4 A;  3CD6 A;  1K0X A;  2BKD N;  4IUU A;  1ZBJ A;  2P0P A;  2G6F X;  3CCV T;  2D8J A;  5I2S A;  4AT1 B;  2FYK A;  1AOJ A;  3EFS A;  1RAC B;  1OX8 A;  4BDZ A;  2QEX T;  1QW1 A;  1JO8 A;  3SWN A;  4OVA A;  4N0A C;  3HP9 A;  3PFS A;  1TSF A;  3CC4 T;  1NJI U;  1IXD A;  4LD9 K;  1NEG A;  1M8M A;  1NJI R;  3PTA A;  3CMA A;  5GMK m;  2FRY A;  1PKT A;  5IXF A;  1LOJ A;  3NTH A;  3UDC A;  3HRT A;  3OMG A;  4L5G A;  4Z89 A;  5LJ3 h;  4IKF A;  1KQS S;  4EMK C;  3G6E A;  2C0T A;  2BZY A;  4EPC A;  2JN0 A;  3MP1 A;  1ZSG A;  5L23 A;  2JOY A;  5J3B A;  3SEM A;  3VRZ A;  1TH7 A;  3M0U A;  3GLX A;  1KFZ A;  4BI3 A;  3S3O A;  2CH4 A;  1FMV A;  1ZSZ A;  4A53 A;  4M78 G;  3HRS A;  1RAI B;  5GAO m;  4A54 A;  4M7D C;  2GTO A;  1RI0 A;  4M77 D;  3M55 A;  1R0C B;  2V8J A;  3CCM T;  1KK7 A;  3PIO A;  4RMO A;  5CVI A;  3RBB B;  5A2Q E;  1M2V A;  4R56 A;  1VQ5 T;  4A4K A;  4PL6 A;  4DBF A;  5GAM h;  3OS1 A;  2OI3 A;  2M16 A;  1UE9 A;  3I5S A;  2HCK A;  3CPF A;  2NUP B;  5CO7 A;  2YRD A;  1VQN A;  3JCM c;  2DXC A;  2R58 A;  5HCK A;  3TSW A;  2D0N A;  2ZPG B;  1HYO A;  5GAO l;  1VQK A;  5M9O A;  3MET A;  4LD6 A;  1K9M C;  4QQD A;  3CC7 Q;  2B8A A;  3JCM P;  4PJO B;  2COW A;  2ECZ A;  5GMK j;  2KDS A;  4HVW A;  3CCQ Q;  1CKB A;  1TOV A;  2X4J A;  5GAN f;  3LX7 A;  2EKH A;  4HXJ A;  2O31 A;  1NPP A;  1WJS A;  5KYW A;  2X3X D;  5CKE A;  3ZFJ A;  2JM9 A;  2ED0 A;  2R57 A;  1SSF A;  2HL5 C;  2DM1 A;  4XTZ A;  3OW2 P;  2OTJ T;  1D3B B;  2EQU A;  3X20 B;  3I55 Q;  3TQ7 P;  5CIU A;  2GQI A;  3QDF A;  2KXD A;  1YJ9 Q;  2CT4 A;  2VB6 A;  3SWN B;  3VS0 A;  2EYY A;  3H6Z A;  3QZ9 B;  2LJ1 A;  4FYX B;  1OOT A;  5GJW B;  3HFO A;  3CEY A;  3JCM W;  4K11 A;  1QVF S;  3C0C A;  1ZA1 B;  3GF5 A;  2O4X A;  4FW1 A;  2D1X A;  1MNE A;  3PIP A;  1KQS P;  4DEY A;  1JB0 E;  2QGF B;  5CKF A;  3OY9 A;  2F5T X;  1H3H A;  2YDL A;  3PMI A;  3JV3 A;  2DEU A;  3UWN A;  2P4T A;  2K57 A;  4VUB A;  5KYY A;  3G4S T;  2YLC A;  3M0S A;  5AYF A;  2CP6 A;  2E3H A;  3QII A;  4M75 E;  2RK1 A;  2K2V A;  3OYI A;  1HD3 A;  3DB3 A;  2YLB A;  4M7A A;  3R6O A;  3JB9 I;  2C0O A;  3L2Z A;  4KBM B;  3AHU A;  1VQL Q;  1KG1 A;  3OBY A;  5L8R E;  4HT9 A;  4FM4 B;  5I11 A;  2MWP A;  4M78 D;  1SPK A;  5J26 A;  4M7D G;  2LZ6 B;  2FO0 A;  1YIT A;  2KMT A;  4DOV A;  1JXO A;  5HK3 A;  1JRI A;  1M2V B;  3I56 A;  1UEC A;  1VIF A;  2RHX A;  2MCN A;  3HL8 A;  1Y0M A;  3EG9 B;  2LNH B;  4PJO C;  3A8M B;  1JQQ A;  1HSQ A;  4JRP A;  1D0Z A;  1QCF A;  5GAM g;  1B34 B;  4M77 F;  4CI0 C;  3LGF A;  2FZK B;  3SFM A;  1Q82 C;  4PFO A;  3RKW A;  2VAS A;  4ZGJ B;  1WPY A;  3C4S A;  4QQ6 A;  2D8H A;  3SWN C;  4BE1 A;  2PQW A;  3QJY A;  3EG0 A;  4IUP A;  5IHK A;  2JZ2 A;  1RL2 A;  2GTJ A;  3E9F A;  1ZUU A;  3V7S A;  4C5I A;  2ZPE B;  3FB9 A;  2QXF A;  2DVJ A;  3U23 A;  5KYW B;  3CCL A;  3CMA T;  3M9Q A;  1QVF A;  2A37 A;  2OTL Q;  4PK4 A;  2RPN A;  1VQM A;  4C8Q D;  4NS5 A;  4XTU A;  1UB4 A;  1ZUY A;  1VA7 A;  2RI5 A;  4GLM A;  2O88 A;  1YWP A;  2RQR A;  1WI7 A;  2XKO C;  2VV5 A;  1R77 A;  4X1V A;  2PUO B;  2JTF A;  1VIE A;  1VQ8 Q;  1OEB A;  4XTV A;  3ME9 A;  1VQ9 A;  2MAM A;  2JMA A;  2O4X B;  5GMK h;  2M1H A;  2K3B A;  2X51 A;  2X4Y A;  1YCS B;  2YWW A;  4FU6 A;  1M1F A;  1UEB A;  5CQX A;  1OU9 A;  1GCP A;  3EGD B;  3CXC S;  2ZAE A;  1B07 A;  2A08 A;  1Y71 A;  2F2V A;  2F69 A;  1IGQ A;  3MEW A;  2DBM A;  2PNI A;  4DBH A;  2D6F A;  1YI2 Q;  2XK0 A;  2QA4 A;  2QTX A;  3TCJ A;  2DEQ A;  2L89 A;  4ZN1 A;  1VQN T;  3CCQ T;  4M7A B;  1NJI C;  1GL5 A;  1IZ6 A;  2HD0 A;  2EKO A;  2JM8 A;  2P4R A;  3TVT A;  1IGU A;  1E6G A;  1Y57 A;  2A7Y A;  2HQH A;  1M9S A;  2RHI A;  1QP2 A;  1RI9 A;  1LNX A;  3CCU A;  1YJ9 T;  3A98 A;  4M7D D;  4J9D A;  2HKQ B;  2L3Q A;  5FRM A;  4XTX A;  2LTO A;  4PJO G;  5LJ5 g;  3I35 A;  3CC2 Q;  1MND A;  3F70 A;  1OUL A;  3OB9 A;  1TUC A;  1X27 A;  3HRU A;  1VQ4 Q;  1M3A A;  2O01 E;  4M78 F;  1QWE A;  3V8K A;  1Q7Y U;  1SRL A;  4OP0 A;  1VQ7 Q;  2DD4 A;  1AEY A;  2HNI A;  1Z9Q A;  3UT1 A;  2EQK A;  3TSZ A;  1Q7Y R;  1VYT A;  2PZ1 A;  1IHV A;  2QAZ A;  1D1B A;  1UJ0 A;  2C06 A;  2JS2 A;  1OYX A;  4Z02 A;  2EGE A;  1YP5 A;  3A8H B;  3T9N A;  1WHK A;  1WHJ A;  2AIR B;  5EG2 A;  3HPW A;  2EW3 A;  3R6N A;  3CCR A;  2LX7 A;  5EC7 A;  2DYB A;  2CGH A;  3EAE A;  2DD5 A;  1VQL T;  3M53 A;  2VVK A;  3L2W A;  3CC4 A;  2A3L A;  4E2F B;  2XMF A;  2EGC A;  1S72 Q;  2JUF A;  3JSC A;  1G3T A;  5GAN g;  2A28 A;  3REA B;  1BK2 A;  2CP5 A;  1YWO A;  1EZZ B;  3EG2 A;  3X28 B;  1JEG A;  1GXI E;  2NUT B;  3JCM b;  3MPU B;  4FYV B;  1YIJ Q;  3IQL A;  4QQG A;  1YIT T;  3CBP A;  2DTO A;  4FYW B;  5KCO A;  3I56 T;  4D8D A;  3CCE Q;  2HAX A;  3RES A;  3MP6 A;  5GAN 2;  4OMF B;  3P8B B;  4XK8 E;  2JMC A;  3M4G A;  2IG0 A;  1I8F A;  1GBR A;  1G3Y A;  4XU1 A;  2PVO B;  4DEX A;  1QQJ A;  3QYG B;  5I22 A;  1W6X A;  5KE3 A;  4AG1 C;  5LL6 S;  4LDY A;  1MHN A;  1QKW A;  2WSF E;  3OMC A;  4JS4 A;  3M0Q A;  2PU9 B;  3X24 B;  1JJ2 A;  2FZC B;  5J39 A;  1PG5 B;  4J7I A;  4IIO A;  4CC7 A;  3OA6 A;  4KGZ B;  1M2O A;  3GNF B;  4P5N A;  1OZ2 A;  1LPL A;  4AG2 C;  1FMK A;  4PJO D;  4J6W A;  2JTM A;  3BDU A;  3P8D A;  4BE0 A;  4IUT A;  4HVV A;  4LDW A;  4C8Q B;  1NLO C;  4M7D F;  1KSW A;  4OMP A;  2LRQ A;  4JJD A;  2RQW A;  2EJG A;  2MK5 A;  4RKU E;  1WQ7 A;  1F1B B;  2ABL A;  1BI0 A;  3H8Z A;  1M8V A;  1RAB B;  1TXQ A;  5GAM j;  4M77 E;  1YI2 T;  3S3N A;  2CP7 A;  2E3I A;  2X35 A;  2ZPB B;  3V7R A;  1V76 A;  2EYX A;  2LMJ A;  2K5F A;  3L42 A;  1Z9Z A;  2AZS A;  3FRN A;  1U8R A;  3EH2 A;  2O9S A;  2ZPH B;  1EIF A;  1XOV A;  1M1K U;  4JDS A;  1GBQ A;  5FW9 A;  1QWF A;  3AT1 B;  1JBM A;  1WYX A;  3X25 B;  1WJQ A;  3JCM e;  1M1K R;  1Y7X A;  3DLL A;  4IUV A;  3OQ5 A;  2GNC A;  3OYE A;  1WGS A;  1WDX A;  2M0Y A;  4J6X A;  3CC2 T;  2ED1 A;  2KEA A;  1WQW A;  3OS2 A;  1BB9 A;  3O8V A;  3PNW C;  6AT1 B;  2F1L A;  2JJ9 A;  3OS5 A;  4XU0 A;  1KIK A;  2DL5 A;  1AT1 B;  1VQ7 T;  2RI3 A;  5KYX A;  4OML A;  5GAM d;  3ASK A;  1KJW A;  3GPL A;  1S1N A;  2M9U A;  3VYG A;  1G3W A;  2DJQ A;  3URG A;  3CCS Q;  4O5V A;  2V8I A;  2K2M A;  1UTI A;  1QKX A;  2KY9 A;  1MGQ A;  3LH0 A;  1HK9 A;  3C95 A;  4N4G A;  2DFU A;  4IUQ A;  4ELZ C;  1AWO A;  2LX9 A;  4RTX A;  1Y96 A;  1VQP Q;  2EFI A;  2EQI A;  2I2L A;  4C8Q C;  2J06 A;  3QWX X;  5DLO A;  4J9F A;  4J5Y A;  4E7S A;  1GCQ A;  2XHC A;  3QYH B;  4C92 A;  1NZ9 A;  2MIO A;  2Y90 A;  3RDV A;  5IAY A;  4L59 A;  2FVU A;  3CCR T;  1UJY A;  2EAY A;  3EGU A;  4PJN A;  4LDV A;  2C0I A;  3OYN A;  3EHQ A;  2DKG A;  2LCC A;  3G71 Q;  4RCC A;  1J3T A;  2YUO A;  1VQO Q;  2HDA A;  2ZCF B;  3A8G B;  4BUG A;  2DRK A;  2ENM A;  1PD0 A;  1U3O A;  1WHL A;  1YCY A;  5LJ5 j;  1T3L A;  2V26 A;  1NBE B;  2WAC A;  1YHQ Q;  2CKK A;  2DER A;  4PJO F;  4FIB A;  1W2B P;  5IH2 A;  2DIL A;  4M78 E;  4OGE A;  1BKB A;  1WHH A;  2ZPI B;  3OYA A;  1OU8 A;  2YRV A;  3H0I A;  2EYZ A;  1OV3 A;  4MZP A;  3QZ5 B;  1K76 A;  2V1Q A;  1Q7Y C;  2KE9 A;  3M54 A;  2QQA A;  3M56 A;  3A8L B;  3LW5 E;  1SKU B;  2RD1 A;  4OMM A;  4BDY A;  1TUG B;  2Y4Y A;  3PE0 A;  2DX1 A;  2DLP A;  1K73 U;  2M02 A;  4J9H A;  4AFZ C;  5I21 A;  3QKJ A;  2FG0 A;  4X34 A;  1QVG A;  1K73 R;  1E7O A;  1SHF A;  2DL8 A;  1IHW A;  1X2Q A;  2F2X A;  1B3Q A;  4PNO A;  1P92 A;  3C94 A;  3C12 A;  2RJF A;  4F16 A;  1U1T A;  4BY6 B;  4NL3 A;  3CC7 A;  5GAN j;  2HBP A;  4M7A D;  4RG2 A;  4N4I A;  4A4H A;  5LJ5 d;  1X43 A;  3CCQ A;  4J6Y A;  3CCJ Q;  2PVG B;  3J81 E;  4QW2 A;  1HXD A;  4KH0 B;  3TRE A;  4C5E A;  1KQ2 A;  5GJV B;  3RIR A;  3UA7 A;  3V7C A;  2DF6 A;  2LC4 A;  3I55 A;  3OBW A;  2MI6 A;  4ELY C;  1YJ9 A;  1IO6 A;  4AMC A;  1MV0 B;  2VXE A;  4XAX B;  4IUR A;  2BE9 B;  4C8Q G;  4OGC A;  2ROL A;  8ATC B;  2W10 A;  3FLG A;  4C92 B;  1N5Z A;  2RHZ A;  3CBM A;  8AT1 B;  2LCS A;  1H92 A;  3HFN A;  2IVW A;  1XQH A;  5CQY A;  2VXF A;  2JTE A;  4ESR A;  3JCM Q;  2RQU A;  4JRI A;  5GAN d;  3M58 A;  2KR3 A;  2DBK A;  3BFM A;  3L2U A;  2MPX C;  4OMQ A;  2CZ0 B;  3PVQ A;  4Z8A A;  4OMN A;  2BUD A;  2DMO A;  4BAC A;  1AZG B;  2RHU A;  2CRE A;  3S6W A;  2EPD A;  1VQL A;  2KAF A;  4KUD K;  2E5Q A;  4Q5W A;  3HSB A;  5FLX E;  2KBT A;  5ECA A;  1PHT A;  1TS9 A;  4M7D E;  3QG1 A;  5IHN A;  4F7U A;  1WNL A;  2RM4 A;  1UDL A;  2KRS A;  1MMA A;  1RAG B;  1SEM A;  4BY6 C;  4M77 A;  1JU5 C;  2EYW A;  5GMK i;  1ZSZ B;  4FYY B;  4QVZ A;  1CSK A;  1FXX A;  5LJ3 e;  1Q86 U;  5DY9 A;  3MP8 A;  1BI1 A;  5LJ5 h;  2FPE A;  3PMT A;  1PRL C;  1Q86 R;  2J7I A;  3PGG A;  1X75 C;  3EGX A;  5FRN A;  1K1Z A;  2EBP A;  4Y91 A;  3E19 A;  1AWW A;  1H3Z A;  2PVD B;  4WCI A;  2PTK A;  2CZ7 B;  1SSH A;  4XTW A;  2E12 A;  4E7L A;  3FDR A;  1N9S A;  5HY6 A;  2JNG A;  1M1K C;  1I5O B;  3RER A;  1WHM A;  4C92 C;  2RA2 A;  2KT8 A;  1V1C A;  2OTL A;  4JZ3 A;  3OYL A;  2L3P A;  3UPU A;  2E5K A;  4KUI A;  2P84 A;  5A0L A;  3DKM A;  2JW4 A;  4A63 B;  3TU4 K;  2RI2 A;  2DL3 A;  4M7A F;  1VYU A;  1WXT A;  4LUD A;  1PRM C;  2DXT A;  1LJO A;  3H0H A;  1VQ8 A;  4B9W A;  1NM7 A;  3GP8 A;  4WF2 A;  5GAN h;  4ZN3 A;  2I0N A;  1RLQ C;  3CME Q;  2FB7 A;  1I07 A;  3JB9 J;  3FJ5 A;  2JVV A;  3QO3 A;  4ZGE B;  1K0S A;  2DVE A;  1QVF P;  3JCM f;  1I5L A;  2AK5 A;  2QYZ A;  1M3C A;  1AWX A;  2DTH A;  3G1J A;  1YJN Q;  4NOY A;  3EFR A;  2CT3 A;  3ER0 A;  4JUV A;  4OF1 A;  1AZE A;  2YXY A;  1YI2 A;  1IB8 A;  1G3S A;  1ZUK A;  1ZSZ C;  3CCJ T;  1ZQ1 A;  4MZT A;  2YRC A;  2DPP B;  4RTW A;  5A0D A;  3CCL Q;  1QLY A;  1LCK A;  5KYY B;  4KGX B;  4OB3 B;  3PVL A;  3CC7 T;  2NUZ A;  3Q1J A;  1W4S A;  4F7U B;  4II1 A;  1NYF A;  2YUN A;  4GBQ A;  1BYM A;  4PJO E;  3VS3 A;  3NTK A;  1K8A U;  3CC2 A;  4MZM A;  1WIE A;  1VQ4 A;  1YJW Q;  4XU3 A;  3I55 T;  1K8A R;  1R8O B;  1UFF A;  2L3S A;  1YBY A;  2AKK A;  2KYM A;  3EGX B;  2JS0 A;  3EFO A;  1VQ7 A;  4LE9 A;  3OS0 A;  2RB6 A;  5GAN 8;  5GAO q;  2L2P A;  4J9E A;  5DLQ E;  1VYV A;  2QA4 Q;  5GAN 7;  4AFU C;  3EG3 A;  2HKN A;  1JJ2 S;  3JAM E;  2J6O A;  1K73 C;  4C0G A;  4PLL A;  3GIB A;  4C92 G;  4EMH A;  1VQ6 Q;  2SRC A;  3NGP A;  2L5Q A;  2J05 A;  4RTV A;  5GAN 5;  3EH1 A;  5KYU A;  2RJC A;  2EJ9 A;  1EX4 A;  1UGP B;  2FRW A;  1U1S A;  1WXB A;  5GAO p;  4LN2 A;  4WTO B;  1XJW B;  2CSQ A;  5GAO r;  3KXT A;  2EWN A;  1YIJ A;  4N0A A;  1NYG A;  2KRM A;  3UF4 A;  3CCV Q;  1X01 A;  3CCE A;  4OB1 B;  2K9G A;  2LQN A;  3RKY A;  5FWB A;  3CXC P;  3JCM X;  2QQ9 A;  4C8Q F;  5CKD A;  1FYN A;  2KI7 A;  4M7A C;  2QI2 A;  1D1C A;  4LNP A;  1X6B A;  2OAU A;  3KFV A;  4JZ4 A;  2QEX Q;  3ZEH A;  4J83 A;  3RKX A;  3KUF A;  1ARK A;  4EMK A;  2EQM A;  2A0F B;  2XG8 D;  4PFZ A;  5GMK e;  3J7A F;  3QXE B;  2X3W D;  3G7Z A;  1VUB A;  1SRM A;  2VC8 A;  2W0Z A;  2LQ8 A;  1WLP B;  4QKU A;  4RG8 A;  2AHJ B;  3BDL A;  1NG2 A;  3M5A A;  3OYD A;  1ACM B;  4ZTJ A;  2HSE B;  3WVE B;  4M75 A;  1ZHI A;  4M7D A;  1KC8 U;  2OTL T;  2H8H A;  1QVP A;  2X4W A;  1YNZ A;  3HTR A;  4L6V 5;  1SG5 A;  1KC8 R;  7AT1 B;  1H64 1;  2GBQ A;  2EJF A;  3VS4 A;  1VQ8 T;  1JJ2 P;  1AD5 A;  1YJN T;  1C1A A;  2BIV A;  3LLR A;  4LDU A;  3FEO A;  4J9G A;  4JS5 A;  2VKN A;  1PD1 A;  2EGA A;  4YTL A;  3LGL A;  1Q86 C;  3CCM Q;  1KD1 U;  4J7F A;  1VQ5 Q;  4C92 D;  5CKH A;  2QAS A;  1IRE B;  1KD1 R;  5KYU B;  2VWF A;  1NLP C;  1TWB A;  1QCO A;  1XNI A;  5CAI A;  2Z0W A;  5LJ3 f;  1WX6 A;  2RJE A;  3QPH A;  2KNB B;  3OYY A;  3RR6 A;  3CPW A;  2DNU A;  3A5Z B;  2RO0 A;  3MJX A;  1KQ1 A;  1U06 A;  3NFC A;  4PJL A;  5D6X A;  2DL4 A;  4PKC C;  1N6A A;  1EFN A;  2E64 A;  1PM3 A;  1UUE A;  2XDP A;  4ATO A;  3E1S A;  1I1J A;  2CDT A;  1G2B A;  4B9X A;  5GAN 6;  4F7U G;  2OTJ Q;  1C6V X;  3CCS A;  2E1H A;  4M7A G;  3ZBD A;  1VQ4 T;  3JCM g;  2GFA A;  2HL3 A;  2MYS A;  3OSS C;  1QCN A;  5GAM f;  1UHC A;  3VS1 A;  1OPK A;  3UAT A;  4EMK B;  5IXB A;  4QVC A;  1VQP A;  2HEQ A;  5KH6 A;  2L3R A;  2R5A A;  2YHT A;  4FSS A;  3RMS A;  1QVG S;  1VQ6 T;  2MWO A;  1OPL A;  3M4Y A;  4R55 A;  4C0Z A;  3MO8 A;  3HKS A;  2LQW A;  2DTI A;  4ZGD B;  4JLI A;  3NPF A;  2AT1 B;  3VS7 A;  2XID A;  2XIC A;  2NUP A;  4M75 B;  3M0R A;  4F14 A;  3G4S Q;  3QBY A;  5IHI A;  3G71 A;  4NL2 A;  1BCO A;  3MKD A;  2CP2 A;  4V2S A;  1BBZ A;  1S72 T;  1VQO A;  5CCA A;  1BI2 A;  1O75 A;  2LT4 A;  3LH5 A;  4RTU A;  4Z88 A;  1YHQ A;  1G5V A;  4HCB A;  2QGG A;  4F17 A;  1T3S A;  3L2V A;  3SDZ A;  1K8A C;  1D3B A;  2F2W A;  3JB9 G;  4B6M A;  4RTZ A;  1YIJ T;  2K3Y A;  5AT1 B;  3CD6 Q;  4HA8 A;  1X69 A;  1A0N B;  3ULR B;  3EHR A;  1JXM A;  4EIK A;  5I2M A;  2EIF A;  1HJD A;  2VUB A;  3CCE T;  3OW2 S;  1SHG A;  2KRO A;  4OMO A;  3I5R A;  2QDY B;  2SEM A;  1BCM A;  1W70 A;  4FL6 A;  3M0T A;  4FW2 A;  2XDB A;  1VOM A;  1W2B A;  2E4H A;  4CRI A;  2DET A;  1PNJ A;  4C92 F;  4FCY A;  2QTV A;  2WSE E;  2LDM A;  2YT6 A;  2M0O A;  2DXB A;  4DBQ A;  3J80 E;  3NMZ C;  1GRI A;  2J6K A;  1FX7 A;  1DJ7 B;  3TEE A;  3VU3 C;  2PUK B;  3CCJ A;  3JRZ A;  3CMA Q;  3PT9 A;  4XTY A;  4AFS C;  2D9T A;  1M30 A;  4Y28 E;  5LJ5 f;  1QVG P;  4LDX A;  1U5S A;  1WXU A;  4M75 C;  3G6E Q;  1W1F A;  4A4F A;  1M1G A;  5GMK l;  4IIM A;  3OYF A;  4PFP A;  2QQB A;  4HCK A;  4CC2 A;  5KYX B;  4C8Q E;  3EG9 A;  3RUX A;  2CH4 W;  4CC3 A;  4C0F A;  3S3M A;  2K6D A;  3RNJ A;  1B34 A;  4JJB A;  1M3B A;  1Y96 B;  2YSQ A;  2MMP A;  1AVZ C;  1ZBX A;  2DIQ A;  2LVM A;  3VJP A;  1ABQ A;  3JCM J;  1BIA A;  1QP3 A;  2FZG B;  2EVR A;  3THK A;  4PJJ A;  3WVD B;  1VQN Q;  4D6W A;  2L8D A;  3OW2 A;  3LYI A;  2GGR A;  1K4U S;  3EG1 A;  5CKB A;  1PKS A;  1VQK Q;  4D8K A;  4AFQ C;  4FT4 A;  1KC8 C;  2DAQ A;  2LP5 A;  3JB9 D;  4Y92 A;  2JXB A;  2COY A;  2GFU A;  1RAD B;  4E47 A;  3V8J A;  3V8L A;  4LXC A;  2X9H A;  2EYQ A;  1QMC A;  2E65 A;  4JPB W;  1NE8 A;  2DA9 A;  1YFN A;  3NHN A;  4TVR A;  1KQS A;  1RAE B;  3CCS T;  2RQT A;  3SHW A;  2KQW A;  1I81 A;  4BB7 A;  3OYH A;  2QK0 A;  1GFD A;  3VUB A;  4RTY A;  4J9C A;  2DO3 A;  3MEU A;  2RN8 A;  2FPF A;  4QVD A;  2DXU A;  3E2U A;  2DK3 A;  1VQP T;  1WHG A;  3EGD A;  3REB B;  1KD1 C;  5HKC A;  2ROT A;  3ZL7 C;  4MMK A;  4F04 B;  4XQ3 A;  1M4Z A;  1MMD A;  1N8R U;  2K7A A;  1RAF B;  4BI4 A;  2O9V A;  2K5L A;  2DE0 X;  3X26 B;  2ZZD A;  5CK9 A;  3L2Q A;  2E41 A;  1N8R R;  4ZTF A;  5LJ3 g;  3LWI A;  1TUD A;  2VGM A;  1N27 A;  4J9B A;  1IRX A;  4JJC A;  2COZ A;  4C5G A;  3G71 T;  5KYN A;  1OQK A;  2KVQ G;  4M75 G;  5FU6 B;  2P0Q A;  2MF2 A;  3H41 A;  4KT0 E;  1VQO T;  1RLP C;  3VS2 A;  3CD6 T;  4A4E A;  1NEB A;  4OB2 B;  4JRQ A;  2XD0 A;  2BE7 D;  1GCQ C;  1PWT A;  3M0P A;  1Y07 A;  1Q81 U;  5GAM e;  1FWZ A;  2E10 A;  4BE2 A;  2CYZ B;  3QWY A;  3OSV A;  1YHQ T;  1T0H A;  2NLU A;  2GCX A;  3CME A;  1Q81 R;  1G8X A;  5HK0 A;  1PC0 A;  4F7U F;  2HQE A;  4RTT A;  2O2O A;  1OI1 A;  4XU2 A;  4MML A;  1YIT Q;  3QHS A;  4PJM A;  1RUW A;  4JRK A;  4E7J A;  2A36 A;  3I56 Q;  4MDW A;  1MV3 A;  1YJN A;  2E6Z A;  3SB2 A;  1X2K A;  2HBW A;  3INZ A;  4X9C A;  1K9A A;  2BTT A;  1I0C A;  2KRN A;  3H9N A;  5C0M A;  4DOW A;  3M59 A;  3CQT A;  5D6Y A;  1PCX A;  2GF7 A;  2CUB A;  2AZV A;  1SF9 A;  1KHC A;  2CSI A;  2KXC A;  4DA4 A;  4UC4 A;  4A4G A;  3VUZ A;  2KSS A;  3G6E T;  2RJD A;  4HCZ A;  4O6J A;  1X6O A;  4J9I A;  3JCM d;  1M5Q 1;  2YUQ A;  1M90 U;  2RNA A;  4KUL A;  2CP0 A;  1VQM Q;  2IIM A;  4ME7 A;  2NUT A;  2NWM A;  3QUI A;  1M90 R;  1YJW A;  3QJ6 A;  1UG1 A;  3JB9 F;  3JCM V;  2HSP A;  3VKI A;  1LVK A;  5GAN 3;  2LJ0 A;  1WZO A;  4EMG A;  4M78 A;  4C0D B;  4M77 B;  3FIF A;  1O9S A;  1RAA B;  5FU6 C;  1VQ9 Q;  3FJP A;  2ATC B;  2DL7 A;  1BI3 A;  1AWJ A;  1MMN A;  2RF0 A;  5DM7 R;  3OYK A;  5FU7 B;  4CC4 B;  2JT4 A;  1R0B G;  2CZ6 B;  2J6F A;  4HCC A;  4ORZ A;  4DQ2 A;  4DBR A;  1XTD A;  4C92 E;  2K3X A;  2XU8 A;  1D09 B;  1UGQ B;  1VQ6 A;  2KYB A;  2OJ2 A;  1VQK T;  3MEV A;  3OYM A;  2FL7 A;  1ZA2 B;  5LJ5 e;  2LNV A;  4MDX A;  4M75 D;  3WXM B;  3VRY A;  2QQR A;  4HKE A;  2QDL A;  2RMO A;  2XDD A;  2B86 A;  2LCL A;  3A8O B;  2CS7 A;  2IPO B;  3DLM A;  2DJZ A;  3BY7 A;  2KT1 A;  1PSF A;  2LQK A;  2QQS A;  3VS6 A;  3L1A A;  1S72 A;  4C8Q A;  3CCU Q;  4JLG A;  3SD4 A;  2F5K A;  3GNG A;  4PLI A;  2DZ9 A;  3CCV A;  2E6N A;  1KHI A;  3UA6 A;  1UHF A;  2K79 A;  3A1P A;  2RHY A;  4LUE A;  3D7S B;  1NPR A;  2X4X A;  2RH2 A;  2CP3 A;  1B7T A;  3M57 A;  2MOX A;  4FT2 A;  2QEX A;  1FMW A;  1GFC A;  3JCM h;  5GAN e;  2ZGW A;  1TU0 B;  4E7Z A;  1T0J A;  3VV0 A;  2K5I A;  2E70 A;  4ZNX A;  4C0D C;  4M77 C;  3CPW S;  2RK2 A;  3QDR B;  4FSX A;  1E6H A;  2XI9 A;  4BD3 A;  4GY5 A;  2QG9 B;  3CXC A;  1D1A A;  5FU7 C;  3CCR Q;  2ESW A;  2HMA A;  3KBG A;  1K9M U;  2OX7 A;  3LWH A;  3CC4 Q;  2VGN A;  1K9M R;  1ZLM A;  3BE3 A;  4HVU A;  2FPD A;  2YUP A;  2HZY A;  4JJN K;  1UGV A;  4M78 B;  5KE2 A;  2V8K A;  9ATC B;  1UGS B;  5A0G A;  4KGV B;  1C0M A;  1TTH B;  4EDU A;  1H8K A;  1TG0 A;  1WFW A;  1V29 B;  3OYC A;  3CME T;  3E9G A;  2L0A A;  3HHT B;  3OYJ A;  1OX9 A;  3H0F A;  2KGT A;  3N5B B;  2R5M A;  3CBO A;  3EFO B;  2FEI A;  3CCM A;  3DB4 A;  2EQJ A;  4E7H A;  3FC3 A;  2HQX A;  1VQ5 A;  2DIG A;  2D0Q B;  3L2R A;  2NYS A;  1AHJ B;  5KCH A;  4X9D A;  1BIB A;  1OZ3 A;  5GAO n;  3I9Q A;  1N8R C;  5LJ3 j;  1CKA A;  3CCL T;  3OYB A;  1BU1 A;  4E7I A;  1YN8 A;  2CZ1 B;  2WSC E;  2P0K A;  1VQM T;  1WJR A;  2Y4X A;  4R0K A;  1I4K 1;  4KH1 B;  3O5Z A;  5IT9 E;  1WA7 A;  4C5H A;  5FWC A;  4M75 F;  1X6G A;  2G3R A;  4E6R A;  2ZPF B;  3GBQ A;  5C6S A;  1MMG A;  3RMQ A;  2AKL A;  3VS5 A;  1VQ9 T;  1Q81 C;  4F7U E;  2OTJ A;  3OYG A;  4M7A E;  2FHD A;  4BI8 B;  2BZ8 A;  1YJW T;  2DYI A;  1N9R A;  5FRO A;  2GQV A;  3CPW P;  3NTI A;  5CR2 A;  1MUZ A; 
#chains in the Genus database with same CATH homology
 2EGE A;  1YP5 A;  1U5S A;  1WXU A;  2KT8 A;  1W1F A;  1V1C A;  4JZ3 A;  4IIM A;  2L3P A;  2EW3 A;  2E5K A;  1G83 A;  3R6N A;  4HCK A;  4CC2 A;  2JW4 A;  2LX7 A;  2DYB A;  5EC7 A;  4A63 B;  2DL3 A;  1VYU A;  1ABO A;  1WXT A;  4LUD A;  1PRM C;  2VVK A;  3H0H A;  2CH4 W;  4CC3 A;  2M51 A;  2XMF A;  1NM7 A;  2EGC A;  2K6D A;  4QT7 A;  2BZX A;  3RNJ A;  2DRM A;  2I0N A;  1RLQ C;  4JJB A;  1I07 A;  1M3B A;  2A28 A;  3FJ5 A;  3REA B;  2YSQ A;  1BK2 A;  1K0S A;  2RQV A;  1AVZ C;  1YWO A;  3EG2 A;  1JEG A;  4M4Z A;  1M27 C;  2AK5 A;  1M3C A;  1AWX A;  1ABQ A;  4RUG A;  2LJ3 A;  2CT3 A;  2OAW A;  3IQL A;  2EVR A;  3THK A;  1ZX6 A;  2CUD A;  1AZE A;  4D8D A;  4KRT A;  2GGR A;  2V1R A;  1K0X A;  1K4U S;  3EG1 A;  1ZBJ A;  1PKS A;  1ZUK A;  4D8K A;  2G6F X;  2D8J A;  4AFQ C;  4RTW A;  2JMC A;  2LP5 A;  1QLY A;  1LCK A;  1GBR A;  4Y92 A;  2JXB A;  1AOJ A;  4DEX A;  5I22 A;  1W6X A;  3PVL A;  4AG1 C;  2NUZ A;  4JPB W;  1QKW A;  2DA9 A;  1NYF A;  3NHN A;  1JO8 A;  2RQT A;  3M0Q A;  2YUN A;  4GBQ A;  3SHW A;  1GFD A;  3VS3 A;  4RTY A;  4J9C A;  4IIO A;  4CC7 A;  2RN8 A;  1WIE A;  2FPF A;  1UFF A;  2L3S A;  3REB B;  4AG2 C;  1FMK A;  2AKK A;  2KYM A;  2ROT A;  2JS0 A;  3ZL7 C;  1NEG A;  1M8M A;  4HVV A;  2K7A A;  4LE9 A;  1NLO C;  2O9V A;  2FRY A;  1PKT A;  5IXF A;  2DE0 X;  2L2P A;  1KSW A;  4Z89 A;  4J9E A;  4OMP A;  1VYV A;  4JJD A;  1TUD A;  2C0T A;  2RQW A;  4J9B A;  2BZY A;  4AFU C;  3EG3 A;  1ZSG A;  4JJC A;  2ABL A;  5L23 A;  2J6O A;  3SEM A;  3VRZ A;  3M0U A;  3H41 A;  1KFZ A;  1RLP C;  3VS2 A;  2CH4 A;  1NEB A;  2EYX A;  2LMJ A;  2SRC A;  3NGP A;  2J05 A;  1GCQ C;  1PWT A;  3M0P A;  4RTV A;  1Z9Z A;  2AZS A;  3QWY A;  1T0H A;  2GTO A;  2O9S A;  2FRW A;  3RBB B;  1XOV A;  1WXB A;  4RTT A;  1GBQ A;  5FW9 A;  4LN2 A;  1QWF A;  2O2O A;  2OI3 A;  1WYX A;  2CSQ A;  1RUW A;  2A36 A;  1UE9 A;  1MV3 A;  3I5S A;  2GNC A;  2HCK A;  1WDX A;  2M0Y A;  1NYG A;  2ED1 A;  2KEA A;  1X2K A;  2KRM A;  3UF4 A;  2HBW A;  1K9A A;  5HCK A;  3TSW A;  1BB9 A;  2D0N A;  2BTT A;  1I0C A;  2K9G A;  2LQN A;  2KRN A;  5FWB A;  1FYN A;  1KIK A;  3CQT A;  2DL5 A;  4LNP A;  1X6B A;  2CUB A;  2ECZ A;  3KFV A;  2AZV A;  4OML A;  4JZ4 A;  1KJW A;  2CSI A;  1S1N A;  2KXC A;  4HVW A;  1CKB A;  2DJQ A;  2EKH A;  4HXJ A;  2O31 A;  2K2M A;  1UTI A;  1ARK A;  1QKX A;  2X3X D;  2JM9 A;  2ED0 A;  2DM1 A;  1AWO A;  2X3W D;  4J9I A;  1SRM A;  4RTX A;  2W0Z A;  2YUQ A;  2EQI A;  2RNA A;  1WLP B;  2GQI A;  2J06 A;  3QWX X;  2KXD A;  2IIM A;  1NG2 A;  4J9F A;  2CT4 A;  3VS0 A;  1GCQ A;  2NWM A;  2EYY A;  2LJ1 A;  1UG1 A;  1OOT A;  2MIO A;  5GJW B;  2HSP A;  2H8H A;  2LJ0 A;  4K11 A;  3C0C A;  1YNZ A;  1UJY A;  2D1X A;  3EGU A;  2GBQ A;  2C0I A;  2DL7 A;  3EHQ A;  1AWJ A;  4DEY A;  2RF0 A;  4CC4 B;  2JT4 A;  3VS4 A;  1H3H A;  1AD5 A;  2YDL A;  1J3T A;  3JV3 A;  2YUO A;  2HDA A;  2J6F A;  2DRK A;  2ENM A;  1U3O A;  4ORZ A;  3M0S A;  1T3L A;  4J9G A;  2VKN A;  2EGA A;  2KYB A;  1HD3 A;  2OJ2 A;  5IH2 A;  2DIL A;  2C0O A;  3H0I A;  2EYZ A;  3VRY A;  1OV3 A;  2QDL A;  2RMO A;  1K76 A;  2B86 A;  2V1Q A;  5I11 A;  2KE9 A;  2VWF A;  1SPK A;  2LZ6 B;  1NLP C;  2FO0 A;  1JXO A;  4OMM A;  2KT1 A;  1UEC A;  3PE0 A;  2MCN A;  3VS6 A;  1Y0M A;  2DX1 A;  2DLP A;  2LNH B;  1WX6 A;  4J9H A;  2KNB B;  4AFZ C;  2DNU A;  2FG0 A;  1JQQ A;  1E7O A;  3UA6 A;  1SHF A;  2DL8 A;  1UHF A;  1HSQ A;  2K79 A;  1X2Q A;  1QCF A;  2F2X A;  1B3Q A;  4LUE A;  1U06 A;  2DL4 A;  4F16 A;  1EFN A;  1UUE A;  1I1J A;  1X43 A;  2CDT A;  1G2B A;  2MOX A;  2D8H A;  1GFC A;  3EG0 A;  5IHK A;  2GTJ A;  1ZUU A;  5GJV B;  3UA7 A;  2DF6 A;  1UHC A;  1T0J A;  3VS1 A;  1OPK A;  3UAT A;  4ZNX A;  5IXB A;  2DVJ A;  3U23 A;  2HEQ A;  4FSS A;  1E6H A;  2A37 A;  2RPN A;  1IO6 A;  1MV0 B;  1OPL A;  1ZUY A;  1VA7 A;  4GLM A;  2O88 A;  1YWP A;  2RQR A;  1WI7 A;  2ESW A;  2LQW A;  2ROL A;  3NPF A;  3VS7 A;  2W10 A;  4X1V A;  1N5Z A;  1OEB A;  3M0R A;  1ZLM A;  4F14 A;  2LCS A;  1H92 A;  4HVU A;  2FPD A;  2YUP A;  2JMA A;  1UGV A;  5IHI A;  2JTE A;  2K3B A;  4ESR A;  1BBZ A;  2RQU A;  1YCS B;  1H8K A;  1TG0 A;  1WFW A;  2KR3 A;  2L0A A;  2DBK A;  1GCP A;  1B07 A;  3H0F A;  3LH5 A;  4RTU A;  2KGT A;  4OMQ A;  2A08 A;  2F2V A;  4Z88 A;  2FEI A;  4F17 A;  1T3S A;  2DBM A;  3PVQ A;  2PNI A;  4Z8A A;  2F2W A;  4OMN A;  4RTZ A;  2DMO A;  1AZG B;  2CRE A;  1X69 A;  2EPD A;  1A0N B;  3ULR B;  3EHR A;  1JXM A;  4EIK A;  1GL5 A;  1HJD A;  2KBT A;  5ECA A;  1PHT A;  1SHG A;  2KRO A;  5IHN A;  2JM8 A;  4OMO A;  3I5R A;  3I9Q A;  2P4R A;  3TVT A;  1E6G A;  2SEM A;  1UDL A;  2KRS A;  1CKA A;  1SEM A;  1Y57 A;  1W70 A;  1JU5 C;  1RI9 A;  2EYW A;  1BU1 A;  1YN8 A;  3A98 A;  3M0T A;  4J9D A;  4R0K A;  2L3Q A;  1CSK A;  3O5Z A;  1WA7 A;  1PNJ A;  5FWC A;  3I35 A;  2FPE A;  1X6G A;  1PRL C;  4E6R A;  2J7I A;  3GBQ A;  1TUC A;  1X27 A;  2AKL A;  2YT6 A;  1K1Z A;  2EBP A;  1AWW A;  1M3A A;  3NMZ C;  3VS5 A;  1GRI A;  1QWE A;  2J6K A;  4WCI A;  2PTK A;  1SRL A;  1SSH A;  1AEY A;  2BZ8 A;  1Z9Q A;  3TSZ A;  1VYT A;  4AFS C;  2PZ1 A;  1M30 A;  1UJ0 A;  2JS2 A;  1MUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...