1QVGP

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1qvgP00
3CCSQ 1VQ5Q 1Q86R 3CCEQ 1VQ6Q 1VQ9Q 3CCMQ 1YHQQ 1W2BP 3CCRQ 1VQ7Q 3OW2P 3CMEQ 3CXCP 3CCUQ 3CC7Q 3CPWP 1NJIR 2QEXQ 1QVFP 3I56Q 1K73R 3CCLQ 2OTLQ 3I55Q 1VQPQ 3CCJQ 1KC8R 3CCQQ 3CC4Q 1YJNQ 3G6EQ 1Q82R 1KD1R 2QA4Q 1VQ8Q 1VQLQ 2OTJQ 1VQMQ 1VQNQ 1N8RR 1VQKQ 1K9MR 3G4SQ 1Q81R 3CD6Q 1YIJQ 3CCVQ 3G71Q 1VQOQ 1Q7YR 1QVGP 1YITQ 1M1KR 1YI2Q 1S72Q 1KQSP 1VQ4Q 1YJWQ 3CC2Q 3CMAQ 1K8AR 1YJ9Q 1M90R 1JJ2P
chains in the Genus database with same CATH superfamily
1NEBA 1J3TA 5EC7A 1WA7A 1VYUA 5IN1A 3PT9A 4DA4A 1E6HA 2ZCFB 2FRWA 4P5NA 4MZMA 1BIBA 2YUNA 2CS7A 1X43A 2W10A 4QVCA 1YHQA 1ZX6A 5D7UA 2LJ3A 2K4YA 6AT1B 3CCLA 4F7UB 3QZ5B 4M75A 5KYYB 3SFMA 5CAIA 4JS5A 1GL5A 2MK5A 3MPUB 2P84A 1Y0MA 5CKBA 2MI6A 2HDAA 2VYTA 3RERA 2BE9B 2LX9A 3PGGA 4PL6A 4DQ2A 1XOVA 4HCKA 2ECZA 1HK9A 4D8DA 1MMNA 2KEAA 4V2SA 1PRLC 4JRKA 4ZGEB 2ZPGB 2EYWA 2O9SA 3FC3A 1ZUYA 4E2FB 2QQBA 2LX7A 1YJWQ 2QTVA 1I07A 2DKGA 1OOTA 2FO0A 4PNOA 5KYWA 3REAB 4BI8B 1VQKA 1NM7A 1UGRB 2DVEA 2VXFA 1YITT 5LJ5h 4N0AC 1SF9A 4DBRA 4QQGA 2K5LA 4X34A 1TS9A 2CYZB 2KY9A 4O5VA 2KR3A 1JRIA 3U23A 2LCLA 1KC8U 4OB3B 3EGXB 2QDYB 2CP5A 2LDMA 5C6SA 3CD6A 3L2UA 2CZ6B 3C12A 1Q82C 3S3NA 1QMCA 3FLGA 3INZA 3KBGA 2BZ8A 3CCMT 3JB9H 1KHCA 1OZ2A 4M75C 4PLLA 1Y71A 1Q7YC 1X2KA 4VUBA 3OYDA 1WHGA 3V7RA 3OSVA 5IHIA 3ZFJA 2QYZA 2QQSA 3T9NA 2EQJA 3MKDA 1M3BA 1VQMT 5J26A 1WXUA 1TSFA 3PVQA 1R0CB 1T3LA 5GAMj 3VS4A 1PHTA 3EHQA 1G3TA 1JXOA 3HRSA 1W2BA 2C0OA 1AZEA 1SG5A 3PVLA 1N5ZA 2JTEA 3QDRB 2DLPA 3OS2A 2CP2A 4TVRA 5GAN5 1IGQA 5FU7B 3GNGA 3PMTA 5LJ3d 2PTKA 1K73U 2RB6A 2YDLA 2EKHA 1YFNA 5D6WA 2FZKB 2KYMA 2OJ2A 2AHJB 3GF5A 3JCMJ 3KFVA 4M7DA 2E1HA 1UGPB 3J7AF 2X4JA 1HXDA 2JJ9A 5KCOA 4BB7A 1OULA 3EFSA 1ZSGA 4M7AA 3HL8A 4Y91A 3OMGA 4RTUA 1YJNA 4FSSA 1SRLA 1WIEA 1BIAA 1KG1A 3CCMQ 1G3WA 1RAAB 1K9AA 2COZA 3M9QA 1V29B 1B7TA 2O4XB 1BI1A 4IUUA 2GTJA 3CC4T 5GJWB 2PNIA 4OGEA 4E47A 4AFSC 2NUTA 5GMKj 2DVJA 1W2BP 1WNLA 2EQMA 3TQ7P 2HL5C 2YRCA 1ZHIA 3CC2A 3JCMQ 4C92D 1VQ9T 4QT7A 3VV0A 5GAOn 1WHMA 1VQ9A 2E5KA 2RQUA 4ELZC 1GBQA 1M1KC 3RESA 1N8RR 1K9MR 2FPEA 3S6WA 4JZ4A 4RMOA 4OP0A 2R57A 2K7AA 3CBMA 1F1BB 3QBYA 2FPDA 4LUDA 4J6YA 2DYIA 1O9SA 4GBQA 4Y28E 2LNHB 4M7AC 3ER0A 1KQ2A 1Q86U 3MEVA 3CBOA 3BDUA 4F04B 2ZPHB 2CZ7B 5IHKA 1UGQB 3M0SA 4ORZA 1R8OB 2CP6A 4PJOA 5GAMf 2RI3A 2L3SA 1D0XA 3J81E 5GJVB 3CMAA 2MWPA 1NLOC 1SSHA 1FMVA 3EHRA 1EX4A 1VQ6A 4HCBA 3CC4Q 4XTUA 5KYXA 2KMTA 4BE2A 2KRNA 1CSKA 2L8DA 2ZPEB 2RJEA 1H3HA 4UC4A 4HVVA 1U8RA 1VQ9Q 2BZXA 3URGA 2BKDN 8ATCB 1VQ4A 4FYVB 1IXDA 3UA6A 1Y07A 2HKQB 3ULRB 5DM7R 3CC7T 5CKDA 1KD1R 1Z9QA 2DZ9A 5I2MA 5FU6B 4D6WA 2LNVA 1PCXA 1I0CA 2EWNA 2DD4A 2HCKA 4BI4A 4JRIA 4M7AD 4FSXA 3CCST 2BUDA 4FM4B 3GIBA 4LDWA 3CCSA 1GBRA 2CUBA 2PVGB 4RTZA 3MP6A 2QEXT 4PJOC 1Y96B 1GCPA 2XI9A 1M9SA 3OYNA 1XJWB 2VWFA 3CPWS 1D0YA 2CH4A 3I55A 4Y92A 2OTJT 3JB9G 2EYYA 3JV3A 2CREA 2EYZA 2HNIA 3QKJA 4NS5A 1LOJA 1QP3A 1BU1A 4BY6B 3QYHB 3TVTA 4F7UE 2LT1A 3PNWC 5I21A 1VQ4Q 4C92F 4GLKA 2ZZDA 1PD1A 1UGSB 2EQUA 4MMLA 4BE1A 2LP5A 1IGUA 3CC7Q 1IHWA 2RF0A 4OMPA 3M4GA 2ZPFB 2DXTA 3GOXA 4HT9A 1PD0A 2DJZA 1IZ6A 3VRZA 4ESRA 3NMZC 1G8XA 2HAXA 1LVKA 1PSFA 2FYKA 8AT1B 3JCMf 4WF2A 2OTLA 2DL4A 4RCCA 1MUZA 5CKHA 3H0FA 3CCSQ 2CT3A 1QCOA 3RR6A 2JTMA 2CZ1B 4RTXA 4JPBW 5HKCA 2QEXQ 3M5AA 4KGZB 1KK7A 3MP8A 1OX9A 1IRXA 3OYKA 1S1NA 3CMEA 2OTJQ 2P4RA 3MJXA 3VS6A 3HKSA 4OMQA 2HZYA 1M90C 1M8VA 1G2BA 3CBPA 4GLMA 3JCMb 2QI2A 2QGGA 4EMGA 2M1HA 1H641 3G1JA 3LX7A 2NUZA 2KRMA 1QLYA 2L0AA 5C0MA 5EG2A 5GANg 3RIRA 2DTHA 2RQRA 5L8RE 3VS2A 5L23A 4F7UG 5IH2A 5I2SA 1NYGA 2ENMA 4PJNA 3OS5A 2ABLA 3QIIA 4LDVA 2J6FA 1N6AA 1UFFA 2LQWA 4M78B 2DX1A 2E64A 2DRKA 1OPKA 3JCMW 3HRUA 4E7ZA 4M4ZA 2DF6A 4KGXB 3H0IA 2VGMA 3LW5E 3PE0A 1SHFA 2KYBA 1P92A 4KH0B 2D9TA 2EIFA 2H8HA 3MP1A 1AZGB 2LCCA 3L2QA 3SDZA 2XU8A 4MMKA 2RHYA 3BFMA 3DB4A 2V1RA 4CC7A 5FLXE 1VYTA 3JRZA 4HKEA 5GANj 1BYMA 4BI3A 3L2WA 3GBQA 3QWXX 3P8DA 2L3QA 2CDTA 2G6FX 3DLLA 1U06A 3EG1A 3LLRA 1U1SA 4LE9A 3MEAA 2I2LA 2X4YA 1BKBA 5IHNA 1QW1A 3QPHA 3EFOB 1OPLA 2LC4A 3G4SA 1BI2A 4C8QE 1YIJA 3GNFB 1YCYA 3OYAA 1RAGB 1KC8C 2VVKA 1ZSZB 5GAMd 3A8HB 1Q82R 4N4GA 2IVWA 2XD0A 1AT1B 3BE3A 1Q7YR 2MOXA 4DBHA 4EPCA 1GRIA 2KGTA 2RPNA 3GLXA 5FRMA 2OAUA 5FWBA 4ME7A 2DFUA 2YUOA 2RHIA 3RKYA 1Q81U 3A98A 1WHJA 3TU4K 1K8AU 3DKMA 3ZEHA 1QWFA 2EGCA 4IURA 1WGSA 1NE8A 4RTTA 5CQYA 4ZGDB 1JEGA 3UT1A 4E7SA 2J05A 3RKXA 2AZSA 2HQEA 2C0IA 3VJPA 2E3IA 1VQ8T 4RTYA 1K73C 1KQ1A 4B9WA 2DBKA 2YRDA 4HA8A 3OW2A 5HCKA 2LVMA 1QQJA 2YHTA 2KK4A 3F70A 1WZOA 2L89A 5GAOr 2LJ1A 1X2QA 5GAOl 4C8QG 1G3YA 4EDUA 1AD5A 2GGRA 2MCNA 2GNCA 5KYYA 2O2OA 1YHQT 2CGHA 3QWYA 1MGQA 4KH1B 2KT8A 2M9UA 2QG9B 3CCLT 1V76A 3HRTA 4C0ZA 4XK8E 2DXCA 3OYIA 4JJDA 1QKWA 3JCMe 5GAOm 2RJFA 2B86A 2DM1A 2ESWA 3M0UA 1X6GA 1DJ7B 4DEYA 1H8KA 3OYBA 1WQ7A 2JMAA 2E3HA 3PIOA 4EMHA 4J9BA 1VQ8Q 5LJ5g 1UHFA 2KQWA 2LT4A 1M1KR 1B3QA 1NJIU 1WXTA 2KI7A 3SEMA 3X20B 2PUKB 4KUIA 3I5RA 2LQNA 1W70A 3EG3A 3NHNA 4C92A 1VQKT 4AFZC 3ASKA 4J83A 4FL6A 3JCMd 3JB9D 1OU9A 4A53A 7AT1B 2MWOA 2V8IA 4XAXB 1PNJA 1KJWA 4M75B 5KYNA 1SEMA 1LPLA 3VKIA 3SWNA 4JRQA 1Q86C 1NPRA 2EQKA 5FW9A 1UB4A 2XICA 3CD6T 2P0QA 1YHQQ 5DLOA 4E7LA 4L59A 2AT1B 1D3BA 1K76A 2DXBA 2XIDA 3CCLQ 4MZPA 2E4HA 5CKFA 5KE3A 5KYWB 4E7HA 4QKUA 5LJ5j 5GAMh 3OQ5A 3TCJA 2DTOA 2K3BA 3G6ET 4QW2A 5LJ3e 2ROTA 3G6EA 4NL3A 2FZCB 1ZA1B 1EIFA 3FB9A 3QYGB 1JB0E 3JAME 3VYGA 2E41A 1YJ9A 2B8AA 1I1JA 1I8FA 1WDXA 1ACMB 2GBQA 2VASA 1QVFA 2A36A 4C92C 1WXBA 1E7OA 3S3MA 4FW2A 1VQKQ 4CC4B 3M55A 1D1CA 1M3AA 2QQ9A 2RJCA 2RHUA 3CPFA 2WSFE 3ME9A 3META 3OSSC 4ZN1A 3G71A 3SWNC 1FMKA 4AFQC 1TUGB 1RL2A 5CK9A 4M78F 3CCRA 5GAN4 1GFDA 1OEBA 2KAFA 4KGVB 3CD6Q 2KBTA 4PK4A 3X25B 1YJNT 3OYFA 1TUCA 3QHSA 1K0XA 1I4K1 5IAYA 4M77E 1G3SA 2X35A 1BCOA 2R5MA 1JJ2A 1WYXA 4RTWA 2XHCA 3GPLA 5IT9E 2MYSA 2EAYA 3CCEA 5FROA 2A08A 5HY6A 4C8QB 4ZN3A 2FRYA 3G6EQ 1NG2A 4FYXB 4K11A 5A0DA 4JDSA 5FU7C 4M7DB 4M78E 2DILA 2H3JA 4FT4A 5GMKi 1RLPC 3VUBA 1NLPC 3HFOA 1HJDA 1AWXA 2P0KA 2E6ZA 2PU9B 2F1LA 1C0MA 3CC2T 1QVFP 2FL7A 1MNDA 1WJQA 2GFUA 1C1AA 2YUPA 4ZNXA 4A4HA 3JB9F 5J39A 2KDSA 2RJDA 3G71Q 3CQTA 2XDBA 2XDPA 1KQSA 3UATA 2AKLA 2DRMA 3UA7A 3CCVT 2DL8A 4LD9K 1RAFB 1M4ZA 3CCVA 3JCMh 2DA9A 2PVDB 1YJNQ 2NUTB 4C5EA 4PJMA 1TUDA 2KROA 2YLCA 4LUEA 3UWNA 3REBB 5GAOq 3M4YA 4DOVA 3TEEA 1WHLA 2YLBA 1M90R 2OI3A 1JJ2P 4M77G 2F2XA 3QJYA 1JO8A 2DIQA 3RKWA 4DOWA 3OYCA 3CMAT 4LN2A 1VQ6T 2HQHA 2YXYA 4DEXA 1UJYA 1TU0B 2K79A 1YWPA 3RMSA 4J6XA 1KSWA 2V1QA 3H9NA 5I22A 2GF7A 4J8OA 1ZBXA 3EGDA 4M78G 4F14A 2NYSA 3CC2Q 2MAMA 1VQNA 3WXMB 2IPOB 3HTRA 3JCMX 3SB2A 5D6YA 1ZUUA 1VQ4T 2A28A 2JM9A 4OMMA 3OB9A 4RTVA 4L5GA 2HBPA 1ZUKA 5AYFA 4J7IA 5LJ3g 4PJOB 2EJ9A 2FEIA 2VXEA 5A0LA 1SRMA 5IXBA 3CCVQ 1KQSP 1M1GA 2DJQA 4HVWA 2QTXA 5KYXB 1D1BA 1MNEA 3LGFA 3M59A 4DBFA 1RABB 5LJ3h 4C0DC 3DLMA 2RK2A 2CSIA 2BZYA 2FB7A 4RUGA 4F7UF 4R56A 2YRVA 3M58A 3RMQA 4EMKA 5CKEA 4Z8AA 4KRTA 3I55T 3JSCA 5KYUA 5GAN6 1D0ZA 1UEBA 4RCBA 3CMAQ 1ARKA 3H8ZA 1LNXA 1VQ6Q 4RKUE 4AFUC 2WSCE 2JOYA 1Y7XA 4BUGA 2E5QA 1QVGS 2Y4YA 2K57A 2LQ8A 3EGUA 1KC8R 2GQIA 2X51A 1VQ7A 3CCUA 4ATOA 1VQNQ 3I56A 2PZ1A 5CVIA 1YNZA 1NEGA 1WJRA 4J9FA 5FU6C 2K2VA 2IG0A 5CCAA 2KXCA 2QAZA 4A63B 3OYJA 4CI0C 1YI2A 1S72A 4KT0E 1UHCA 4C5GA 1YP5A 3EH2A 1Q81C 1NPPA 1LJOA 1K8AC 2OTLT 2JUFA 1UTIA 2QA4T 1AWJA 3HFNA 5KH6A 2F5TX 4PLIA 2X4XA 2QA4A 2Y90A 4EMKC 1HYOA 4M75E 3QDFA 2CP3A 1K73R 4HCCA 3I35A 3I55Q 3CMET 1OU8A 2D1XA 1AWOA 3THKA 2JNGA 2D8JA 2ROLA 2O01E 2M02A 3C94A 3H6ZA 2JZ2A 3EAEA 3UPUA 2DO3A 3MEWA 1MMGA 4PJJA 1BK2A 2HD0A 3JCMc 2SEMA 1K0SA 4M77B 2VV5A 4OGCA 4M78A 4E7IA 1QVPA 3MO8A 4JJBA 4MZTA 2CP7A 1GXIE 3J80E 2RHXA 2D0QB 1VUBA 4YTLA 1ABOA 3DB3A 3C95A 4IKFA 2QGFB 3VYHB 2LCSA 1RUWA 2DK3A 3L2VA 2OTLQ 2RD1A 1AVZC 3SD4A 2QA4Q 2A7YA 1M2VA 2LTOA 2NLUA 4A4GA 2DD5A 4C8QF 1Z9ZA 2K2MA 3E9GA 1NJIC 4M75G 1U1TA 3CMEQ 3MCAB 1EFNA 1B34B 1QKXA 3NPFA 2HEQA 5HK0A 2KSSA 3CXCA 5GAMe 4OB0B 1TWBA 5GAOp 2F69A 2FHDA 1D1AA 4OMNA 3KXTA 2AKKA 3CCJA 2DAQA 2EJGA 3OYYA 1NYFA 2X3WD 3I5SA 3G4ST 1Q86R 3TSWA 1YIJT 3EG9A 3V7SA 4M78C 2ED1A 3CPWA 1IREB 4FYWB 2D0NA 4M7DE 2JS2A 1K4US 2LQKA 2R58A 2EQIA 2DBMA 4AT1B 4LDUA 2QASA 4ZTFA 1SHGA 3GP8A 1X27A 1VQLT 1PWTA 3LYIA 4XTXA 1VQLA 3RBBB 1BB9A 3M56A 2QQAA 4OB1B 4PJLA 1VQOA 1OX8A 2GCXA 3QO3A 2RA2A 2XG8D 2P0PA 2EKOA 2DPPB 4LDYA 2NWMA 2AK5A 2GQVA 2SRCA 2XMFA 1W2BS 1A0NB 1QVFS 2NUPA 4MDXA 2RM4A 3O8VA 4II1A 4J9GA 2PQWA 3CXCP 4AG2C 1N8RU 4WTOB 2ZAEA 4M77D 1K9MU 3MHXA 5GMKe 3QJ6A 2F2WA 3M0PA 2ATCB 1HSQA 2EW3A 4NL2A 3CEYA 2QQRA 4JS4A 1RAHB 3LH5A 3G4SQ 2I0NA 3EFRA 4C5HA 1YIJQ 1WQWA 3HPWA 2E70A 4QQ6A 2EJFA 2RK1A 4OMOA 2E10A 2EPDA 3S3OA 1WPYA 5I11A 2QK0A 4M78D 1H92A 4IUTA 2L5QA 1YJWA 4F7UA 2C0TA 1TTHB 5FWCA 1QP2A 2F5KA 3E2UA 1UGVA 4JJNK 1JJ2S 4M7DG 4A54A 1VQLQ 1M27C 3FJ5A 2Y4XA 4C0GA 2LJ0A 1WHHA 1VQOQ 2V26A 3X28B 3EG0A 2E6NA 4D8KA 2JN0A 3FJPA 4M7AG 1ZQ1A 2JXBA 3O5ZA 4FW1A 1GCQA 1O75A 1TOVA 4MDWA 3WVDB 1OV3A 3H0HA 4PJOE 5GANf 2OX7A 2KRSA 4Z88A 1AHJB 1WHKA 4IUPA 4GY5A 1KFZA 3LWHA 4IUQA 5CR2A 3PFSA 2DL3A 4R0KA 4LXCA 3TREA 3QUIA 1TH7A 1UUEA 2X9HA 5D6XA 1KD1U 3OW2P 2HSPA 4EIKA 1KQSS 2CH4W 4E6RA 3A8MB 3AHUA 4J9HA 2MPXC 3EGXA 1T3SA 3M0RA 1PG5B 2ED0A 3VU3C 4FYYB 3SHWA 1UJ0A 1T0HA 2P4TA 2JM8A 5GAMg 3L2ZA 3OBYA 4BD3A 2DIGA 1R77A 1FYNA 1YITA 2RHZA 1U5SA 3NTIA 4C92B 2VC8A 3E9FA 2LMJA 2EFIA 5GMKl 4E7JA 3NFCA 1K1ZA 1X75C 1GCQC 2AZVA 3RUXA 3VS7A 5KCHA 2M0YA 3HHTB 4FT2A 2K3YA 1W6XA 4PKCC 1JQQA 2FVUA 1JXMA 4BACA 2O9VA 4IIOA 3V7CA 4HT8A 3SWNB 5CQXA 4PJOG 1YJ9T 1Y57A 3VRYA 1ZBJA 2XK0A 3CCMA 5GMKm 3P8BB 2D8HA 2YWWA 1PRMC 1D3BB 4M77F 1NBEB 3FEOA 4A4EA 1OI1A 4OMLA 4Z89A 1VQMA 3TSZA 3QG1A 3G71T 4XU3A 2RNAA 1IHVA 2CT4A 2CZ0B 2COYA 1VQ5T 3R6NA 3D7SB 3CCRT 2HMAA 1VQ5A 4O6JA 2V8JA 4CC3A 4ANJA 3QXEB 1YITQ 3WVEB 4PFZA 4C8QA 4JZ3A 3OYLA 1UECA 2COWA 2O4XA 1MV0B 1WI7A 3OMCA 3CCET 3FRNA 3FDRA 2DMOA 5ECAA 4WCIA 3M0QA 5GMKh 2RH2A 2BE7D 4N4IA 2M0OA 5AT1B 2F2VA 1WFWA 2OAWA 2DEUA 1YJ9Q 1MHNA 1VYVA 4LDXA 2M51A 1XQHA 1UDLA 1BI0A 2ZPBB 3E1SA 4HXJA 3X24B 4IUVA 4PFPA 3VS1A 4M75D 4M7AB 1KHIA 3OA6A 2JS0A 1G83A 4RG8A 4RG2A 2H3EB 3VUZA 9ATCB 1X6BA 4B9XA 1VQMQ 1D09B 4OMFB 3JCMg 1Q81R 4DBQA 2K5IA 2MMPA 2X3XD 3CC4A 4C5IA 1K8AR 3BW1A 1VQ5Q 1PSEA 3IQLA 1SKUB 3CCRQ 2VUBA 5GAN2 1YCSB 5DLQE 3RNJA 2K3XA 1OQKA 3M53A 4E7KA 2KT1A 4C8QC 1ZLMA 3JCMP 1UE9A 1RADB 1MMDA 3NTHA 2DEQA 5LJ5f 1ZA2B 3QSUA 3NTKA 3C0CA 2EGEA 4M7DC 3ZL7C 2L3PA 3CCEQ 3BY7A 2RI2A 2M16A 1M3CA 2YT6A 2ZGWA 4PFOA 4AMCA 5LL6S 3LWIA 5GANe 2V8KA 2FZGB 4CC2A 2L3RA 1VQPT 2X4WA 4F16A 1VQPA 1XNIA 1VQNT 4A4FA 4C0DB 2A37A 1Q82U 1RI0A 3X26B 4R55A 3A8LB 1OZ3A 1B07A 1Q7YU 3G7ZA 4X9CA 2BIVA 2YSQA 4HVUA 5GANd 1BI3A 1W1FA 1PKSA 1M2OA 3AT1B 1VA7A 2ZPIB 4XTYA 2EYQA 1XTDA 1OYXA 2JVVA 4XTZA 1Y96A 2HL3A 3KUFA 1N27A 3EGDB 1NJIR 3V8KA 1AEYA 1R0BG 4C8QD 1HD3A 3V8LA 5CO7A 3CC7A 1N9SA 2WSEE 4M7DD 3CXCS 1KIKA 2K9GA 2HBWA 3OYEA 3MEUA 3L42A 2J6OA 4ZGJB 3UDCA 2GTOA 3M0TA 4BDZA 2LZ6B 3JCMV 4AG1C 1VQPQ 1VQ7T 2C06A 1AWWA 3CCUT 1FX7A 5A0GA 2VB6A 4BDYA 4QVZA 1U3OA 3I56T 5LJ3j 2QEXA 2DL5A 2EVRA 2CKKA 2DXUA 3R6OA 4M75F 1BBZA 4EMKB 2OTJA 2VGNA 1YWOA 2J7IA 1YI2T 1S72T 1M5Q1 5KYUB 3PTAA 1FXXA 1E6GA 1YN8A 2L2PA 1X6OA 3Q1JA 5IXFA 1T0JA 3EH1A 3OY9A 1UG1A 1I5OB 1M8MA 4Q5WA 3BDLA 4J7FA 4QVDA 1I5LA 2G3RA 4JUVA 2A0FB 1GFCA 5GAN3 1YBYA 1PC0A 2J06A 4Z02A 2K5FA 4KBMB 1WLPB 1V1CA 1M1KU 1MMAA 1N8RC 2J6KA 3OS1A 1K9MC 4BY6C 4XTVA 4X9DA 3OW2S 2FG0A 4X1VA 1TG0A 4OF1A 4J9IA 2Z0WA 4M77A 3OBWA 2DERA 3M54A 2FPFA 2BTTA 2VKNA 1VQ7Q 3CCUQ 4C92E 4JJCA 3I56Q 1NZ9A 4PJOD 3VS3A 3VS0A 1JU5C 3RDVA 1BCMA 1RLQC 2RQTA 4LD6A 4A4KA 1PKTA 2E65A 1YI2Q 3P8HA 1S72Q 1X69A 2E12A 2HSEB 2JTFA 3I9QA 4JLIA 4C0FA 4OVAA 5M9OA 3QZ9B 1QWEA 1JBMA 3ZBDA 2DZCA 1M30A 1TXQA 4KULA 3N5BB 1RAEB 1C6VX 2KVQG 1VOMA 4B6MA 4CRIA 1N9RA 1B34A 2RQWA 2RO0A 4XTWA 1FWZA 5DY9A 2LRQA 5GANh 4J9DA 5LJ5e 4OB2B 1CKAA 2DNUA 3PMIA 1WJSA 4J6WA 4XU2A 5GAN7 2O31A 4M7DF 5CIUA 5J3BA 1KD1C 1WX6A 2RN8A 2XDDA 5HK3A 3NGPA 4N4HA 4M77C 4ZTJA 5FRNA 3LGLA 1QCFA 5LJ3f 3EFOA 4FIBA 1IO6A 1ABQA 4M7AF 2DYBA 5KE2A 4FCYA 3L2RA 3CCJT 3OYMA 2D6FA 1ZSZA 5LJ5d 4BE0A 2RQVA 2JT4A 1M2VB 2MF2A 4J5YA 1I81A 4C92G 3JB9J 2QDLA 2K6DA 1MV3A 2CSQA 2HQXA 2YUQA 4L6V5 3JB9I 3VS5A 2A3LA 1RACB 4XQ3A 3CCQT 2AIRB 1LCKA 3CCQA 4JRPA 2DTIA 1QVGA 3UF4A 4M7AE 1EZZB 1PM3A 1VQOT 3H41A 2EYXA 3A8GB 4JLGA 1H3ZA 3A5ZB 2PVOB 3OYHA 2EGAA 2KE9A 1IB8A 1X01A 2W0ZA 2JW4A 2CUDA 2GFAA 2O88A 3EG9B 3FIFA 2DL7A 2XKOC 3OS0A 1RI9A 4XU1A 2KXDA 4IIMA 2RMOA 3OYGA 1VIEA 1SPKA 5A2QE 1QCNA 2RI5A 5GAN8 3L1AA 4ELYC 4QQDA 1SSFA 4LNPA 4NOYA 1FMWA 1RAIB 3CCJQ 1W4SA 2DETA 1ZSZC 1VIFA 2EBPA 1CKBA 3LH0A 3EG2A 4XU0A 2MIOA 2HKNA 2R5AA 4HCZA 3PIPA 2JMCA 4PJOF 1VQ8A 3A8OB 2CP0A 2DE0X 2QXFA 1Q95G 4FU6A 1YJWT 3A1PA 4KUDK 3C4SA 3E19A 1M1FA 3CPWP 3HP9A 2NUPB 3V8JA 3CCQQ 4F17A 1M90U 1G5VA 3HSBA 4J9EA 4N0AA 2WACA 2IIMA 3M57A 1AOJA 2PUOB 1QVGP 4J9CA 2KNBB
chains in the Genus database with same CATH topology
3CCSQ 1VQ5Q 1Q86R 3CCEQ 1VQ6Q 1VQ9Q 3CCMQ 1YHQQ 1W2BP 3CCRQ 1VQ7Q 3OW2P 3CMEQ 3CXCP 3CCUQ 3CC7Q 3CPWP 1NJIR 2QEXQ 1QVFP 3I56Q 1K73R 3CCLQ 2OTLQ 3I55Q 1VQPQ 3CCJQ 1KC8R 3CCQQ 3CC4Q 1YJNQ 3G6EQ 1Q82R 1KD1R 2QA4Q 1VQ8Q 1VQLQ 2OTJQ 1VQMQ 1VQNQ 1N8RR 1VQKQ 1K9MR 3G4SQ 1Q81R 3CD6Q 1YIJQ 3CCVQ 3G71Q 1VQOQ 1Q7YR 1QVGP 1YITQ 1M1KR 1YI2Q 1S72Q 1KQSP 1VQ4Q 1YJWQ 3CC2Q 3CMAQ 1K8AR 1YJ9Q 1M90R 1JJ2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS Q;  1VQ5 Q;  1Q86 R;  3CCE Q;  1VQ6 Q;  1VQ9 Q;  3CCM Q;  1YHQ Q;  1W2B P;  3CCR Q;  1VQ7 Q;  3OW2 P;  3CME Q;  3CXC P;  3CCU Q;  3CC7 Q;  3CPW P;  1NJI R;  2QEX Q;  1QVF P;  3I56 Q;  1K73 R;  3CCL Q;  2OTL Q;  3I55 Q;  1VQP Q;  3CCJ Q;  1KC8 R;  3CCQ Q;  3CC4 Q;  1YJN Q;  3G6E Q;  1Q82 R;  1KD1 R;  2QA4 Q;  1VQ8 Q;  1VQL Q;  2OTJ Q;  1VQM Q;  1VQN Q;  1N8R R;  1VQK Q;  1K9M R;  3G4S Q;  1Q81 R;  3CD6 Q;  1YIJ Q;  3CCV Q;  3G71 Q;  1VQO Q;  1Q7Y R;  1QVG P;  1YIT Q;  1M1K R;  1YI2 Q;  1S72 Q;  1KQS P;  1VQ4 Q;  1YJW Q;  3CC2 Q;  3CMA Q;  1K8A R;  1YJ9 Q;  1M90 R;  1JJ2 P; 
#chains in the Genus database with same CATH topology
 1NEB A;  1J3T A;  5EC7 A;  1WA7 A;  1VYU A;  5IN1 A;  3PT9 A;  4DA4 A;  1E6H A;  2ZCF B;  2FRW A;  4P5N A;  4MZM A;  1BIB A;  2YUN A;  2CS7 A;  1X43 A;  2W10 A;  4QVC A;  1YHQ A;  1ZX6 A;  5D7U A;  2LJ3 A;  2K4Y A;  6AT1 B;  3CCL A;  4F7U B;  3QZ5 B;  4M75 A;  5KYY B;  3SFM A;  5CAI A;  4JS5 A;  1GL5 A;  2MK5 A;  3MPU B;  2P84 A;  1Y0M A;  5CKB A;  2MI6 A;  2HDA A;  2VYT A;  3RER A;  2BE9 B;  2LX9 A;  3PGG A;  4PL6 A;  4DQ2 A;  1XOV A;  4HCK A;  2ECZ A;  1HK9 A;  4D8D A;  1MMN A;  2KEA A;  4V2S A;  1PRL C;  4JRK A;  4ZGE B;  2ZPG B;  2EYW A;  2O9S A;  3FC3 A;  1ZUY A;  4E2F B;  2QQB A;  2LX7 A;  1YJW Q;  2QTV A;  1I07 A;  2DKG A;  1OOT A;  2FO0 A;  4PNO A;  5KYW A;  3REA B;  4BI8 B;  1VQK A;  1NM7 A;  1UGR B;  2DVE A;  2VXF A;  1YIT T;  5LJ5 h;  4N0A C;  1SF9 A;  4DBR A;  4QQG A;  2K5L A;  4X34 A;  1TS9 A;  2CYZ B;  2KY9 A;  4O5V A;  2KR3 A;  1JRI A;  3U23 A;  2LCL A;  1KC8 U;  4OB3 B;  3EGX B;  2QDY B;  2CP5 A;  2LDM A;  5C6S A;  3CD6 A;  3L2U A;  2CZ6 B;  3C12 A;  1Q82 C;  3S3N A;  1QMC A;  3FLG A;  3INZ A;  3KBG A;  2BZ8 A;  3CCM T;  3JB9 H;  1KHC A;  1OZ2 A;  4M75 C;  4PLL A;  1Y71 A;  1Q7Y C;  1X2K A;  4VUB A;  3OYD A;  1WHG A;  3V7R A;  3OSV A;  5IHI A;  3ZFJ A;  2QYZ A;  2QQS A;  3T9N A;  2EQJ A;  3MKD A;  1M3B A;  1VQM T;  5J26 A;  1WXU A;  1TSF A;  3PVQ A;  1R0C B;  1T3L A;  5GAM j;  3VS4 A;  1PHT A;  3EHQ A;  1G3T A;  1JXO A;  3HRS A;  1W2B A;  2C0O A;  1AZE A;  1SG5 A;  3PVL A;  1N5Z A;  2JTE A;  3QDR B;  2DLP A;  3OS2 A;  2CP2 A;  4TVR A;  5GAN 5;  1IGQ A;  5FU7 B;  3GNG A;  3PMT A;  5LJ3 d;  2PTK A;  1K73 U;  2RB6 A;  2YDL A;  2EKH A;  1YFN A;  5D6W A;  2FZK B;  2KYM A;  2OJ2 A;  2AHJ B;  3GF5 A;  3JCM J;  3KFV A;  4M7D A;  2E1H A;  1UGP B;  3J7A F;  2X4J A;  1HXD A;  2JJ9 A;  5KCO A;  4BB7 A;  1OUL A;  3EFS A;  1ZSG A;  4M7A A;  3HL8 A;  4Y91 A;  3OMG A;  4RTU A;  1YJN A;  4FSS A;  1SRL A;  1WIE A;  1BIA A;  1KG1 A;  3CCM Q;  1G3W A;  1RAA B;  1K9A A;  2COZ A;  3M9Q A;  1V29 B;  1B7T A;  2O4X B;  1BI1 A;  4IUU A;  2GTJ A;  3CC4 T;  5GJW B;  2PNI A;  4OGE A;  4E47 A;  4AFS C;  2NUT A;  5GMK j;  2DVJ A;  1W2B P;  1WNL A;  2EQM A;  3TQ7 P;  2HL5 C;  2YRC A;  1ZHI A;  3CC2 A;  3JCM Q;  4C92 D;  1VQ9 T;  4QT7 A;  3VV0 A;  5GAO n;  1WHM A;  1VQ9 A;  2E5K A;  2RQU A;  4ELZ C;  1GBQ A;  1M1K C;  3RES A;  1N8R R;  1K9M R;  2FPE A;  3S6W A;  4JZ4 A;  4RMO A;  4OP0 A;  2R57 A;  2K7A A;  3CBM A;  1F1B B;  3QBY A;  2FPD A;  4LUD A;  4J6Y A;  2DYI A;  1O9S A;  4GBQ A;  4Y28 E;  2LNH B;  4M7A C;  3ER0 A;  1KQ2 A;  1Q86 U;  3MEV A;  3CBO A;  3BDU A;  4F04 B;  2ZPH B;  2CZ7 B;  5IHK A;  1UGQ B;  3M0S A;  4ORZ A;  1R8O B;  2CP6 A;  4PJO A;  5GAM f;  2RI3 A;  2L3S A;  1D0X A;  3J81 E;  5GJV B;  3CMA A;  2MWP A;  1NLO C;  1SSH A;  1FMV A;  3EHR A;  1EX4 A;  1VQ6 A;  4HCB A;  3CC4 Q;  4XTU A;  5KYX A;  2KMT A;  4BE2 A;  2KRN A;  1CSK A;  2L8D A;  2ZPE B;  2RJE A;  1H3H A;  4UC4 A;  4HVV A;  1U8R A;  1VQ9 Q;  2BZX A;  3URG A;  2BKD N;  8ATC B;  1VQ4 A;  4FYV B;  1IXD A;  3UA6 A;  1Y07 A;  2HKQ B;  3ULR B;  5DM7 R;  3CC7 T;  5CKD A;  1KD1 R;  1Z9Q A;  2DZ9 A;  5I2M A;  5FU6 B;  4D6W A;  2LNV A;  1PCX A;  1I0C A;  2EWN A;  2DD4 A;  2HCK A;  4BI4 A;  4JRI A;  4M7A D;  4FSX A;  3CCS T;  2BUD A;  4FM4 B;  3GIB A;  4LDW A;  3CCS A;  1GBR A;  2CUB A;  2PVG B;  4RTZ A;  3MP6 A;  2QEX T;  4PJO C;  1Y96 B;  1GCP A;  2XI9 A;  1M9S A;  3OYN A;  1XJW B;  2VWF A;  3CPW S;  1D0Y A;  2CH4 A;  3I55 A;  4Y92 A;  2OTJ T;  3JB9 G;  2EYY A;  3JV3 A;  2CRE A;  2EYZ A;  2HNI A;  3QKJ A;  4NS5 A;  1LOJ A;  1QP3 A;  1BU1 A;  4BY6 B;  3QYH B;  3TVT A;  4F7U E;  2LT1 A;  3PNW C;  5I21 A;  1VQ4 Q;  4C92 F;  4GLK A;  2ZZD A;  1PD1 A;  1UGS B;  2EQU A;  4MML A;  4BE1 A;  2LP5 A;  1IGU A;  3CC7 Q;  1IHW A;  2RF0 A;  4OMP A;  3M4G A;  2ZPF B;  2DXT A;  3GOX A;  4HT9 A;  1PD0 A;  2DJZ A;  1IZ6 A;  3VRZ A;  4ESR A;  3NMZ C;  1G8X A;  2HAX A;  1LVK A;  1PSF A;  2FYK A;  8AT1 B;  3JCM f;  4WF2 A;  2OTL A;  2DL4 A;  4RCC A;  1MUZ A;  5CKH A;  3H0F A;  3CCS Q;  2CT3 A;  1QCO A;  3RR6 A;  2JTM A;  2CZ1 B;  4RTX A;  4JPB W;  5HKC A;  2QEX Q;  3M5A A;  4KGZ B;  1KK7 A;  3MP8 A;  1OX9 A;  1IRX A;  3OYK A;  1S1N A;  3CME A;  2OTJ Q;  2P4R A;  3MJX A;  3VS6 A;  3HKS A;  4OMQ A;  2HZY A;  1M90 C;  1M8V A;  1G2B A;  3CBP A;  4GLM A;  3JCM b;  2QI2 A;  2QGG A;  4EMG A;  2M1H A;  1H64 1;  3G1J A;  3LX7 A;  2NUZ A;  2KRM A;  1QLY A;  2L0A A;  5C0M A;  5EG2 A;  5GAN g;  3RIR A;  2DTH A;  2RQR A;  5L8R E;  3VS2 A;  5L23 A;  4F7U G;  5IH2 A;  5I2S A;  1NYG A;  2ENM A;  4PJN A;  3OS5 A;  2ABL A;  3QII A;  4LDV A;  2J6F A;  1N6A A;  1UFF A;  2LQW A;  4M78 B;  2DX1 A;  2E64 A;  2DRK A;  1OPK A;  3JCM W;  3HRU A;  4E7Z A;  4M4Z A;  2DF6 A;  4KGX B;  3H0I A;  2VGM A;  3LW5 E;  3PE0 A;  1SHF A;  2KYB A;  1P92 A;  4KH0 B;  2D9T A;  2EIF A;  2H8H A;  3MP1 A;  1AZG B;  2LCC A;  3L2Q A;  3SDZ A;  2XU8 A;  4MMK A;  2RHY A;  3BFM A;  3DB4 A;  2V1R A;  4CC7 A;  5FLX E;  1VYT A;  3JRZ A;  4HKE A;  5GAN j;  1BYM A;  4BI3 A;  3L2W A;  3GBQ A;  3QWX X;  3P8D A;  2L3Q A;  2CDT A;  2G6F X;  3DLL A;  1U06 A;  3EG1 A;  3LLR A;  1U1S A;  4LE9 A;  3MEA A;  2I2L A;  2X4Y A;  1BKB A;  5IHN A;  1QW1 A;  3QPH A;  3EFO B;  1OPL A;  2LC4 A;  3G4S A;  1BI2 A;  4C8Q E;  1YIJ A;  3GNF B;  1YCY A;  3OYA A;  1RAG B;  1KC8 C;  2VVK A;  1ZSZ B;  5GAM d;  3A8H B;  1Q82 R;  4N4G A;  2IVW A;  2XD0 A;  1AT1 B;  3BE3 A;  1Q7Y R;  2MOX A;  4DBH A;  4EPC A;  1GRI A;  2KGT A;  2RPN A;  3GLX A;  5FRM A;  2OAU A;  5FWB A;  4ME7 A;  2DFU A;  2YUO A;  2RHI A;  3RKY A;  1Q81 U;  3A98 A;  1WHJ A;  3TU4 K;  1K8A U;  3DKM A;  3ZEH A;  1QWF A;  2EGC A;  4IUR A;  1WGS A;  1NE8 A;  4RTT A;  5CQY A;  4ZGD B;  1JEG A;  3UT1 A;  4E7S A;  2J05 A;  3RKX A;  2AZS A;  2HQE A;  2C0I A;  3VJP A;  2E3I A;  1VQ8 T;  4RTY A;  1K73 C;  1KQ1 A;  4B9W A;  2DBK A;  2YRD A;  4HA8 A;  3OW2 A;  5HCK A;  2LVM A;  1QQJ A;  2YHT A;  2KK4 A;  3F70 A;  1WZO A;  2L89 A;  5GAO r;  2LJ1 A;  1X2Q A;  5GAO l;  4C8Q G;  1G3Y A;  4EDU A;  1AD5 A;  2GGR A;  2MCN A;  2GNC A;  5KYY A;  2O2O A;  1YHQ T;  2CGH A;  3QWY A;  1MGQ A;  4KH1 B;  2KT8 A;  2M9U A;  2QG9 B;  3CCL T;  1V76 A;  3HRT A;  4C0Z A;  4XK8 E;  2DXC A;  3OYI A;  4JJD A;  1QKW A;  3JCM e;  5GAO m;  2RJF A;  2B86 A;  2DM1 A;  2ESW A;  3M0U A;  1X6G A;  1DJ7 B;  4DEY A;  1H8K A;  3OYB A;  1WQ7 A;  2JMA A;  2E3H A;  3PIO A;  4EMH A;  4J9B A;  1VQ8 Q;  5LJ5 g;  1UHF A;  2KQW A;  2LT4 A;  1M1K R;  1B3Q A;  1NJI U;  1WXT A;  2KI7 A;  3SEM A;  3X20 B;  2PUK B;  4KUI A;  3I5R A;  2LQN A;  1W70 A;  3EG3 A;  3NHN A;  4C92 A;  1VQK T;  4AFZ C;  3ASK A;  4J83 A;  4FL6 A;  3JCM d;  3JB9 D;  1OU9 A;  4A53 A;  7AT1 B;  2MWO A;  2V8I A;  4XAX B;  1PNJ A;  1KJW A;  4M75 B;  5KYN A;  1SEM A;  1LPL A;  3VKI A;  3SWN A;  4JRQ A;  1Q86 C;  1NPR A;  2EQK A;  5FW9 A;  1UB4 A;  2XIC A;  3CD6 T;  2P0Q A;  1YHQ Q;  5DLO A;  4E7L A;  4L59 A;  2AT1 B;  1D3B A;  1K76 A;  2DXB A;  2XID A;  3CCL Q;  4MZP A;  2E4H A;  5CKF A;  5KE3 A;  5KYW B;  4E7H A;  4QKU A;  5LJ5 j;  5GAM h;  3OQ5 A;  3TCJ A;  2DTO A;  2K3B A;  3G6E T;  4QW2 A;  5LJ3 e;  2ROT A;  3G6E A;  4NL3 A;  2FZC B;  1ZA1 B;  1EIF A;  3FB9 A;  3QYG B;  1JB0 E;  3JAM E;  3VYG A;  2E41 A;  1YJ9 A;  2B8A A;  1I1J A;  1I8F A;  1WDX A;  1ACM B;  2GBQ A;  2VAS A;  1QVF A;  2A36 A;  4C92 C;  1WXB A;  1E7O A;  3S3M A;  4FW2 A;  1VQK Q;  4CC4 B;  3M55 A;  1D1C A;  1M3A A;  2QQ9 A;  2RJC A;  2RHU A;  3CPF A;  2WSF E;  3ME9 A;  3MET A;  3OSS C;  4ZN1 A;  3G71 A;  3SWN C;  1FMK A;  4AFQ C;  1TUG B;  1RL2 A;  5CK9 A;  4M78 F;  3CCR A;  5GAN 4;  1GFD A;  1OEB A;  2KAF A;  4KGV B;  3CD6 Q;  2KBT A;  4PK4 A;  3X25 B;  1YJN T;  3OYF A;  1TUC A;  3QHS A;  1K0X A;  1I4K 1;  5IAY A;  4M77 E;  1G3S A;  2X35 A;  1BCO A;  2R5M A;  1JJ2 A;  1WYX A;  4RTW A;  2XHC A;  3GPL A;  5IT9 E;  2MYS A;  2EAY A;  3CCE A;  5FRO A;  2A08 A;  5HY6 A;  4C8Q B;  4ZN3 A;  2FRY A;  3G6E Q;  1NG2 A;  4FYX B;  4K11 A;  5A0D A;  4JDS A;  5FU7 C;  4M7D B;  4M78 E;  2DIL A;  2H3J A;  4FT4 A;  5GMK i;  1RLP C;  3VUB A;  1NLP C;  3HFO A;  1HJD A;  1AWX A;  2P0K A;  2E6Z A;  2PU9 B;  2F1L A;  1C0M A;  3CC2 T;  1QVF P;  2FL7 A;  1MND A;  1WJQ A;  2GFU A;  1C1A A;  2YUP A;  4ZNX A;  4A4H A;  3JB9 F;  5J39 A;  2KDS A;  2RJD A;  3G71 Q;  3CQT A;  2XDB A;  2XDP A;  1KQS A;  3UAT A;  2AKL A;  2DRM A;  3UA7 A;  3CCV T;  2DL8 A;  4LD9 K;  1RAF B;  1M4Z A;  3CCV A;  3JCM h;  2DA9 A;  2PVD B;  1YJN Q;  2NUT B;  4C5E A;  4PJM A;  1TUD A;  2KRO A;  2YLC A;  4LUE A;  3UWN A;  3REB B;  5GAO q;  3M4Y A;  4DOV A;  3TEE A;  1WHL A;  2YLB A;  1M90 R;  2OI3 A;  1JJ2 P;  4M77 G;  2F2X A;  3QJY A;  1JO8 A;  2DIQ A;  3RKW A;  4DOW A;  3OYC A;  3CMA T;  4LN2 A;  1VQ6 T;  2HQH A;  2YXY A;  4DEX A;  1UJY A;  1TU0 B;  2K79 A;  1YWP A;  3RMS A;  4J6X A;  1KSW A;  2V1Q A;  3H9N A;  5I22 A;  2GF7 A;  4J8O A;  1ZBX A;  3EGD A;  4M78 G;  4F14 A;  2NYS A;  3CC2 Q;  2MAM A;  1VQN A;  3WXM B;  2IPO B;  3HTR A;  3JCM X;  3SB2 A;  5D6Y A;  1ZUU A;  1VQ4 T;  2A28 A;  2JM9 A;  4OMM A;  3OB9 A;  4RTV A;  4L5G A;  2HBP A;  1ZUK A;  5AYF A;  4J7I A;  5LJ3 g;  4PJO B;  2EJ9 A;  2FEI A;  2VXE A;  5A0L A;  1SRM A;  5IXB A;  3CCV Q;  1KQS P;  1M1G A;  2DJQ A;  4HVW A;  2QTX A;  5KYX B;  1D1B A;  1MNE A;  3LGF A;  3M59 A;  4DBF A;  1RAB B;  5LJ3 h;  4C0D C;  3DLM A;  2RK2 A;  2CSI A;  2BZY A;  2FB7 A;  4RUG A;  4F7U F;  4R56 A;  2YRV A;  3M58 A;  3RMQ A;  4EMK A;  5CKE A;  4Z8A A;  4KRT A;  3I55 T;  3JSC A;  5KYU A;  5GAN 6;  1D0Z A;  1UEB A;  4RCB A;  3CMA Q;  1ARK A;  3H8Z A;  1LNX A;  1VQ6 Q;  4RKU E;  4AFU C;  2WSC E;  2JOY A;  1Y7X A;  4BUG A;  2E5Q A;  1QVG S;  2Y4Y A;  2K57 A;  2LQ8 A;  3EGU A;  1KC8 R;  2GQI A;  2X51 A;  1VQ7 A;  3CCU A;  4ATO A;  1VQN Q;  3I56 A;  2PZ1 A;  5CVI A;  1YNZ A;  1NEG A;  1WJR A;  4J9F A;  5FU6 C;  2K2V A;  2IG0 A;  5CCA A;  2KXC A;  2QAZ A;  4A63 B;  3OYJ A;  4CI0 C;  1YI2 A;  1S72 A;  4KT0 E;  1UHC A;  4C5G A;  1YP5 A;  3EH2 A;  1Q81 C;  1NPP A;  1LJO A;  1K8A C;  2OTL T;  2JUF A;  1UTI A;  2QA4 T;  1AWJ A;  3HFN A;  5KH6 A;  2F5T X;  4PLI A;  2X4X A;  2QA4 A;  2Y90 A;  4EMK C;  1HYO A;  4M75 E;  3QDF A;  2CP3 A;  1K73 R;  4HCC A;  3I35 A;  3I55 Q;  3CME T;  1OU8 A;  2D1X A;  1AWO A;  3THK A;  2JNG A;  2D8J A;  2ROL A;  2O01 E;  2M02 A;  3C94 A;  3H6Z A;  2JZ2 A;  3EAE A;  3UPU A;  2DO3 A;  3MEW A;  1MMG A;  4PJJ A;  1BK2 A;  2HD0 A;  3JCM c;  2SEM A;  1K0S A;  4M77 B;  2VV5 A;  4OGC A;  4M78 A;  4E7I A;  1QVP A;  3MO8 A;  4JJB A;  4MZT A;  2CP7 A;  1GXI E;  3J80 E;  2RHX A;  2D0Q B;  1VUB A;  4YTL A;  1ABO A;  3DB3 A;  3C95 A;  4IKF A;  2QGF B;  3VYH B;  2LCS A;  1RUW A;  2DK3 A;  3L2V A;  2OTL Q;  2RD1 A;  1AVZ C;  3SD4 A;  2QA4 Q;  2A7Y A;  1M2V A;  2LTO A;  2NLU A;  4A4G A;  2DD5 A;  4C8Q F;  1Z9Z A;  2K2M A;  3E9G A;  1NJI C;  4M75 G;  1U1T A;  3CME Q;  3MCA B;  1EFN A;  1B34 B;  1QKX A;  3NPF A;  2HEQ A;  5HK0 A;  2KSS A;  3CXC A;  5GAM e;  4OB0 B;  1TWB A;  5GAO p;  2F69 A;  2FHD A;  1D1A A;  4OMN A;  3KXT A;  2AKK A;  3CCJ A;  2DAQ A;  2EJG A;  3OYY A;  1NYF A;  2X3W D;  3I5S A;  3G4S T;  1Q86 R;  3TSW A;  1YIJ T;  3EG9 A;  3V7S A;  4M78 C;  2ED1 A;  3CPW A;  1IRE B;  4FYW B;  2D0N A;  4M7D E;  2JS2 A;  1K4U S;  2LQK A;  2R58 A;  2EQI A;  2DBM A;  4AT1 B;  4LDU A;  2QAS A;  4ZTF A;  1SHG A;  3GP8 A;  1X27 A;  1VQL T;  1PWT A;  3LYI A;  4XTX A;  1VQL A;  3RBB B;  1BB9 A;  3M56 A;  2QQA A;  4OB1 B;  4PJL A;  1VQO A;  1OX8 A;  2GCX A;  3QO3 A;  2RA2 A;  2XG8 D;  2P0P A;  2EKO A;  2DPP B;  4LDY A;  2NWM A;  2AK5 A;  2GQV A;  2SRC A;  2XMF A;  1W2B S;  1A0N B;  1QVF S;  2NUP A;  4MDX A;  2RM4 A;  3O8V A;  4II1 A;  4J9G A;  2PQW A;  3CXC P;  4AG2 C;  1N8R U;  4WTO B;  2ZAE A;  4M77 D;  1K9M U;  3MHX A;  5GMK e;  3QJ6 A;  2F2W A;  3M0P A;  2ATC B;  1HSQ A;  2EW3 A;  4NL2 A;  3CEY A;  2QQR A;  4JS4 A;  1RAH B;  3LH5 A;  3G4S Q;  2I0N A;  3EFR A;  4C5H A;  1YIJ Q;  1WQW A;  3HPW A;  2E70 A;  4QQ6 A;  2EJF A;  2RK1 A;  4OMO A;  2E10 A;  2EPD A;  3S3O A;  1WPY A;  5I11 A;  2QK0 A;  4M78 D;  1H92 A;  4IUT A;  2L5Q A;  1YJW A;  4F7U A;  2C0T A;  1TTH B;  5FWC A;  1QP2 A;  2F5K A;  3E2U A;  1UGV A;  4JJN K;  1JJ2 S;  4M7D G;  4A54 A;  1VQL Q;  1M27 C;  3FJ5 A;  2Y4X A;  4C0G A;  2LJ0 A;  1WHH A;  1VQO Q;  2V26 A;  3X28 B;  3EG0 A;  2E6N A;  4D8K A;  2JN0 A;  3FJP A;  4M7A G;  1ZQ1 A;  2JXB A;  3O5Z A;  4FW1 A;  1GCQ A;  1O75 A;  1TOV A;  4MDW A;  3WVD B;  1OV3 A;  3H0H A;  4PJO E;  5GAN f;  2OX7 A;  2KRS A;  4Z88 A;  1AHJ B;  1WHK A;  4IUP A;  4GY5 A;  1KFZ A;  3LWH A;  4IUQ A;  5CR2 A;  3PFS A;  2DL3 A;  4R0K A;  4LXC A;  3TRE A;  3QUI A;  1TH7 A;  1UUE A;  2X9H A;  5D6X A;  1KD1 U;  3OW2 P;  2HSP A;  4EIK A;  1KQS S;  2CH4 W;  4E6R A;  3A8M B;  3AHU A;  4J9H A;  2MPX C;  3EGX A;  1T3S A;  3M0R A;  1PG5 B;  2ED0 A;  3VU3 C;  4FYY B;  3SHW A;  1UJ0 A;  1T0H A;  2P4T A;  2JM8 A;  5GAM g;  3L2Z A;  3OBY A;  4BD3 A;  2DIG A;  1R77 A;  1FYN A;  1YIT A;  2RHZ A;  1U5S A;  3NTI A;  4C92 B;  2VC8 A;  3E9F A;  2LMJ A;  2EFI A;  5GMK l;  4E7J A;  3NFC A;  1K1Z A;  1X75 C;  1GCQ C;  2AZV A;  3RUX A;  3VS7 A;  5KCH A;  2M0Y A;  3HHT B;  4FT2 A;  2K3Y A;  1W6X A;  4PKC C;  1JQQ A;  2FVU A;  1JXM A;  4BAC A;  2O9V A;  4IIO A;  3V7C A;  4HT8 A;  3SWN B;  5CQX A;  4PJO G;  1YJ9 T;  1Y57 A;  3VRY A;  1ZBJ A;  2XK0 A;  3CCM A;  5GMK m;  3P8B B;  2D8H A;  2YWW A;  1PRM C;  1D3B B;  4M77 F;  1NBE B;  3FEO A;  4A4E A;  1OI1 A;  4OML A;  4Z89 A;  1VQM A;  3TSZ A;  3QG1 A;  3G71 T;  4XU3 A;  2RNA A;  1IHV A;  2CT4 A;  2CZ0 B;  2COY A;  1VQ5 T;  3R6N A;  3D7S B;  3CCR T;  2HMA A;  1VQ5 A;  4O6J A;  2V8J A;  4CC3 A;  4ANJ A;  3QXE B;  1YIT Q;  3WVE B;  4PFZ A;  4C8Q A;  4JZ3 A;  3OYL A;  1UEC A;  2COW A;  2O4X A;  1MV0 B;  1WI7 A;  3OMC A;  3CCE T;  3FRN A;  3FDR A;  2DMO A;  5ECA A;  4WCI A;  3M0Q A;  5GMK h;  2RH2 A;  2BE7 D;  4N4I A;  2M0O A;  5AT1 B;  2F2V A;  1WFW A;  2OAW A;  2DEU A;  1YJ9 Q;  1MHN A;  1VYV A;  4LDX A;  2M51 A;  1XQH A;  1UDL A;  1BI0 A;  2ZPB B;  3E1S A;  4HXJ A;  3X24 B;  4IUV A;  4PFP A;  3VS1 A;  4M75 D;  4M7A B;  1KHI A;  3OA6 A;  2JS0 A;  1G83 A;  4RG8 A;  4RG2 A;  2H3E B;  3VUZ A;  9ATC B;  1X6B A;  4B9X A;  1VQM Q;  1D09 B;  4OMF B;  3JCM g;  1Q81 R;  4DBQ A;  2K5I A;  2MMP A;  2X3X D;  3CC4 A;  4C5I A;  1K8A R;  3BW1 A;  1VQ5 Q;  1PSE A;  3IQL A;  1SKU B;  3CCR Q;  2VUB A;  5GAN 2;  1YCS B;  5DLQ E;  3RNJ A;  2K3X A;  1OQK A;  3M53 A;  4E7K A;  2KT1 A;  4C8Q C;  1ZLM A;  3JCM P;  1UE9 A;  1RAD B;  1MMD A;  3NTH A;  2DEQ A;  5LJ5 f;  1ZA2 B;  3QSU A;  3NTK A;  3C0C A;  2EGE A;  4M7D C;  3ZL7 C;  2L3P A;  3CCE Q;  3BY7 A;  2RI2 A;  2M16 A;  1M3C A;  2YT6 A;  2ZGW A;  4PFO A;  4AMC A;  5LL6 S;  3LWI A;  5GAN e;  2V8K A;  2FZG B;  4CC2 A;  2L3R A;  1VQP T;  2X4W A;  4F16 A;  1VQP A;  1XNI A;  1VQN T;  4A4F A;  4C0D B;  2A37 A;  1Q82 U;  1RI0 A;  3X26 B;  4R55 A;  3A8L B;  1OZ3 A;  1B07 A;  1Q7Y U;  3G7Z A;  4X9C A;  2BIV A;  2YSQ A;  4HVU A;  5GAN d;  1BI3 A;  1W1F A;  1PKS A;  1M2O A;  3AT1 B;  1VA7 A;  2ZPI B;  4XTY A;  2EYQ A;  1XTD A;  1OYX A;  2JVV A;  4XTZ A;  1Y96 A;  2HL3 A;  3KUF A;  1N27 A;  3EGD B;  1NJI R;  3V8K A;  1AEY A;  1R0B G;  4C8Q D;  1HD3 A;  3V8L A;  5CO7 A;  3CC7 A;  1N9S A;  2WSE E;  4M7D D;  3CXC S;  1KIK A;  2K9G A;  2HBW A;  3OYE A;  3MEU A;  3L42 A;  2J6O A;  4ZGJ B;  3UDC A;  2GTO A;  3M0T A;  4BDZ A;  2LZ6 B;  3JCM V;  4AG1 C;  1VQP Q;  1VQ7 T;  2C06 A;  1AWW A;  3CCU T;  1FX7 A;  5A0G A;  2VB6 A;  4BDY A;  4QVZ A;  1U3O A;  3I56 T;  5LJ3 j;  2QEX A;  2DL5 A;  2EVR A;  2CKK A;  2DXU A;  3R6O A;  4M75 F;  1BBZ A;  4EMK B;  2OTJ A;  2VGN A;  1YWO A;  2J7I A;  1YI2 T;  1S72 T;  1M5Q 1;  5KYU B;  3PTA A;  1FXX A;  1E6G A;  1YN8 A;  2L2P A;  1X6O A;  3Q1J A;  5IXF A;  1T0J A;  3EH1 A;  3OY9 A;  1UG1 A;  1I5O B;  1M8M A;  4Q5W A;  3BDL A;  4J7F A;  4QVD A;  1I5L A;  2G3R A;  4JUV A;  2A0F B;  1GFC A;  5GAN 3;  1YBY A;  1PC0 A;  2J06 A;  4Z02 A;  2K5F A;  4KBM B;  1WLP B;  1V1C A;  1M1K U;  1MMA A;  1N8R C;  2J6K A;  3OS1 A;  1K9M C;  4BY6 C;  4XTV A;  4X9D A;  3OW2 S;  2FG0 A;  4X1V A;  1TG0 A;  4OF1 A;  4J9I A;  2Z0W A;  4M77 A;  3OBW A;  2DER A;  3M54 A;  2FPF A;  2BTT A;  2VKN A;  1VQ7 Q;  3CCU Q;  4C92 E;  4JJC A;  3I56 Q;  1NZ9 A;  4PJO D;  3VS3 A;  3VS0 A;  1JU5 C;  3RDV A;  1BCM A;  1RLQ C;  2RQT A;  4LD6 A;  4A4K A;  1PKT A;  2E65 A;  1YI2 Q;  3P8H A;  1S72 Q;  1X69 A;  2E12 A;  2HSE B;  2JTF A;  3I9Q A;  4JLI A;  4C0F A;  4OVA A;  5M9O A;  3QZ9 B;  1QWE A;  1JBM A;  3ZBD A;  2DZC A;  1M30 A;  1TXQ A;  4KUL A;  3N5B B;  1RAE B;  1C6V X;  2KVQ G;  1VOM A;  4B6M A;  4CRI A;  1N9R A;  1B34 A;  2RQW A;  2RO0 A;  4XTW A;  1FWZ A;  5DY9 A;  2LRQ A;  5GAN h;  4J9D A;  5LJ5 e;  4OB2 B;  1CKA A;  2DNU A;  3PMI A;  1WJS A;  4J6W A;  4XU2 A;  5GAN 7;  2O31 A;  4M7D F;  5CIU A;  5J3B A;  1KD1 C;  1WX6 A;  2RN8 A;  2XDD A;  5HK3 A;  3NGP A;  4N4H A;  4M77 C;  4ZTJ A;  5FRN A;  3LGL A;  1QCF A;  5LJ3 f;  3EFO A;  4FIB A;  1IO6 A;  1ABQ A;  4M7A F;  2DYB A;  5KE2 A;  4FCY A;  3L2R A;  3CCJ T;  3OYM A;  2D6F A;  1ZSZ A;  5LJ5 d;  4BE0 A;  2RQV A;  2JT4 A;  1M2V B;  2MF2 A;  4J5Y A;  1I81 A;  4C92 G;  3JB9 J;  2QDL A;  2K6D A;  1MV3 A;  2CSQ A;  2HQX A;  2YUQ A;  4L6V 5;  3JB9 I;  3VS5 A;  2A3L A;  1RAC B;  4XQ3 A;  3CCQ T;  2AIR B;  1LCK A;  3CCQ A;  4JRP A;  2DTI A;  1QVG A;  3UF4 A;  4M7A E;  1EZZ B;  1PM3 A;  1VQO T;  3H41 A;  2EYX A;  3A8G B;  4JLG A;  1H3Z A;  3A5Z B;  2PVO B;  3OYH A;  2EGA A;  2KE9 A;  1IB8 A;  1X01 A;  2W0Z A;  2JW4 A;  2CUD A;  2GFA A;  2O88 A;  3EG9 B;  3FIF A;  2DL7 A;  2XKO C;  3OS0 A;  1RI9 A;  4XU1 A;  2KXD A;  4IIM A;  2RMO A;  3OYG A;  1VIE A;  1SPK A;  5A2Q E;  1QCN A;  2RI5 A;  5GAN 8;  3L1A A;  4ELY C;  4QQD A;  1SSF A;  4LNP A;  4NOY A;  1FMW A;  1RAI B;  3CCJ Q;  1W4S A;  2DET A;  1ZSZ C;  1VIF A;  2EBP A;  1CKB A;  3LH0 A;  3EG2 A;  4XU0 A;  2MIO A;  2HKN A;  2R5A A;  4HCZ A;  3PIP A;  2JMC A;  4PJO F;  1VQ8 A;  3A8O B;  2CP0 A;  2DE0 X;  2QXF A;  1Q95 G;  4FU6 A;  1YJW T;  3A1P A;  4KUD K;  3C4S A;  3E19 A;  1M1F A;  3CPW P;  3HP9 A;  2NUP B;  3V8J A;  3CCQ Q;  4F17 A;  1M90 U;  1G5V A;  3HSB A;  4J9E A;  4N0A A;  2WAC A;  2IIM A;  3M57 A;  1AOJ A;  2PUO B;  1QVG P;  4J9C A;  2KNB B; 
#chains in the Genus database with same CATH homology
 3CCS Q;  1VQ5 Q;  1Q86 R;  3CCE Q;  1VQ6 Q;  1VQ9 Q;  3CCM Q;  1YHQ Q;  1W2B P;  3CCR Q;  1VQ7 Q;  3OW2 P;  3CME Q;  3CXC P;  3CCU Q;  3CC7 Q;  3CPW P;  1NJI R;  2QEX Q;  1QVF P;  3I56 Q;  1K73 R;  3CCL Q;  2OTL Q;  3I55 Q;  1VQP Q;  3CCJ Q;  1KC8 R;  3CCQ Q;  3CC4 Q;  1YJN Q;  3G6E Q;  1Q82 R;  1KD1 R;  2QA4 Q;  1VQ8 Q;  1VQL Q;  2OTJ Q;  1VQM Q;  1VQN Q;  1N8R R;  1VQK Q;  1K9M R;  3G4S Q;  1Q81 R;  3CD6 Q;  1YIJ Q;  3CCV Q;  3G71 Q;  1VQO Q;  1Q7Y R;  1QVG P;  1YIT Q;  1M1K R;  1YI2 Q;  1S72 Q;  1KQS P;  1VQ4 Q;  1YJW Q;  3CC2 Q;  3CMA Q;  1K8A R;  1YJ9 Q;  1M90 R;  1JJ2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...