1QVGP

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1qvgP00
1NJIR 1Q82R 1Q86R 1Q81R 2OTJQ 1YI2Q 1VQKQ 3I56Q 1W2BP 1KD1R 1YITQ 2QEXQ 1KQSP 1K8AR 1VQ5Q 3CCMQ 3G71Q 3G6EQ 1VQ4Q 3CXCP 1Q7YR 3CC2Q 3CCUQ 1VQMQ 1YJWQ 1YHQQ 1N8RR 3CCJQ 3CCEQ 3CD6Q 1YIJQ 3CMEQ 1VQ7Q 1M1KR 2OTLQ 2QA4Q 1K9MR 1JJ2P 3OW2P 3CCLQ 3G4SQ 3CCSQ 3CCVQ 1VQ9Q 1M90R 3CC7Q 3CMAQ 1YJ9Q 1QVGP 1VQ8Q 1VQLQ 1QVFP 1S72Q 1YJNQ 3CPWP 1VQ6Q 1K73R 1VQNQ 1VQOQ 1KC8R 3I55Q 1VQPQ 3CCQQ 3CCRQ 3CC4Q
chains in the Genus database with same CATH superfamily
3HTRA 4FYXB 1ZUUA 1J3TA 2H3JA 3QJ6A 4E7ZA 2MI6A 3G71Q 3JB9F 2DE0X 4J9FA 1OZ3A 3OYIA 3VS0A 2L3SA 1U8RA 3L2UA 3L2WA 3CCVQ 4LDWA 2E70A 3EG2A 1W1FA 1PKSA 2EPDA 3MPUB 3OYHA 5LJ5h 2R57A 3S3NA 1SRMA 1X6GA 3CC7T 4J9CA 4OMQA 5CO7A 3VJPA 4M77F 3A8MB 5EC7A 4KGZB 1VQ7Q 3UDCA 3CCLQ 1QMCA 1X2KA 4M7DG 4ZNXA 3OS2A 3RMQA 1UGSB 1ZBXA 4OMPA 2COZA 5GANf 2CDTA 1S1NA 2EJ9A 2ROLA 4ZGJB 3NFCA 3OS0A 1Y0MA 3H8ZA 2FG0A 1IO6A 2BUDA 2HL3A 5FU6C 3M58A 3CCRT 5A0DA 2JTFA 4RG8A 2M0YA 2SEMA 4C92F 5DM7R 4QT7A 2QEXT 5D6YA 5LJ3d 2NWMA 5GMKi 3RMSA 3CCQQ 1OPKA 1ZA1B 1V1CA 4RCCA 1Q81U 4BACA 2GBQA 4AFSC 3JCMe 4PFPA 2DZCA 2KE9A 4DBQA 4CI0C 2K4YA 1UJYA 2XD0A 1N9SA 2D1XA 3CPWS 3DB4A 3DLLA 3QXEB 2F2WA 2K7AA 2XK0A 3QO3A 1YBYA 5FRMA 2K2VA 2I2LA 2CP2A 3CCEA 1VQ5T 1YIJA 5GAOq 4QVCA 1Q82R 4M78A 1UE9A 4BE0A 5LJ5d 3TREA 3LLRA 4M78B 1YWPA 3QYGB 2LP5A 4FU6A 2LNVA 2VXFA 2X3XD 3H41A 1EZZB 5I2MA 3BY7A 2QTXA 4E7KA 3UATA 1WX6A 1OV3A 3PFSA 3OS1A 1VQLA 1AVZC 2OAUA 1KD1R 1GCQA 3CCST 2JS0A 3X20B 2XDBA 5AYFA 1MMDA 2RA2A 1Y07A 3EGXA 2XDDA 2PVGB 4N4GA 3TVTA 3VS6A 1ZSZB 1VQKA 2RJCA 1X2QA 4C8QD 2M0OA 3EGXB 2PU9B 4BUGA 5EG2A 2BZXA 1D0YA 2AIRB 2GCXA 4XU0A 2FRYA 1K76A 1OX8A 1PC0A 3CMAA 3OA6A 1FXXA 1XNIA 2M16A 3JCMP 4F16A 1D0ZA 2ATCB 1D09B 1WFWA 1GL5A 1M27C 2K3YA 1M8MA 1PNJA 3NHNA 1YHQQ 2COYA 1E7OA 4BE2A 1N8RR 3I56A 2O2OA 4RTXA 3PE0A 3L1AA 4JDSA 4PJOG 4FCYA 2OTJT 4FIBA 1GRIA 2L0AA 1U3OA 2FVUA 2DMOA 2RQWA 2LC4A 5LJ5f 2ENMA 3IQLA 5GAOm 1VQOA 3OYYA 4ZGEB 4ZN3A 4RMOA 4M78F 4HCZA 4PFOA 1KJWA 1GXIE 2L89A 2DYBA 1K9MC 4KGVB 2A28A 1PD1A 2ABLA 2HL5C 3PIOA 3JCMX 4ZTFA 5IH2A 1QW1A 1VQPQ 2FL7A 4M7DB 1NBEB 4FL6A 2DIQA 5CQXA 1GFCA 1YFNA 2X35A 4Z88A 1RAAB 2BE9B 4E47A 2DJZA 5IHNA 4DBFA 2G6FX 1N5ZA 4J8OA 2ZPBB 5CK9A 2P4RA 3OBWA 1WHLA 2F5KA 3VRZA 3LGFA 4XU2A 2KEAA 2MWOA 2L3PA 4NOYA 2NUPB 2V1RA 1I81A 2VC8A 2V8JA 6AT1B 2IPOB 2E6NA 1XTDA 2XKOC 3SWNB 3G71T 2SRCA 4BB7A 2COWA 3BFMA 3REAB 5GAMg 1KQSS 1KD1U 4X34A 1YJNA 4E7IA 4C0FA 2DYIA 4DA4A 3H0IA 1QLYA 1QVGS 4XTWA 4LDYA 2KDSA 3OY9A 5GAN8 4BI3A 2HSEB 1KQ1A 4A54A 2CP3A 1MNEA 2ED0A 1HYOA 3M59A 5GJVB 3M0QA 4M7DF 4Z02A 1XQHA 3PGGA 1N27A 2XG8D 3CCLT 2VXEA 1KIKA 1N8RU 2E6ZA 4OP0A 1NYGA 1PWTA 3PVLA 2CP6A 4M75E 1Y7XA 2GFAA 2HBWA 2DZ9A 3TSWA 1KC8C 1H3ZA 1D1AA 3QDRB 1G3TA 1T3LA 1H8KA 3ULRB 2AHJB 1RUWA 4LDUA 4OMLA 2RI3A 1YN8A 3E1SA 4LE9A 2JZ2A 1KQ2A 2VUBA 2LQ8A 3CCQT 2P84A 1WI7A 3MKDA 4PJOA 3C94A 1K73C 3CPWA 3P8DA 4PJOB 2DLPA 3EFOA 3OB9A 1YJ9A 2MCNA 2RH2A 3EFOB 2QA4T 1M5Q1 3CCRA 2CP5A 2QDYB 2XHCA 2KT8A 2VYTA 3OMCA 4M4ZA 2C0IA 3FDRA 4QW2A 4PL6A 4ANJA 2LRQA 2PVDB 1M90R 3CPWP 5KYYA 5LJ3e 3CMEA 5DLOA 2DTHA 4M7AG 3QWYA 1SSFA 2CUDA 5KYYB 1UTIA 3M0TA 2YRDA 5HY6A 1XJWB 2JMCA 2D0NA 3NGPA 5J39A 4PJJA 5ECAA 1SSHA 4NL2A 5FU7C 5GAOl 1VQ5A 1KHIA 4RTUA 1S72Q 2EYZA 1VQ6Q 1UGQB 1OOTA 1IRXA 4KGXB 1LJOA 1WXTA 2VASA 3P8HA 2GGRA 4HVUA 3TCJA 4J6WA 1PRLC 2ZGWA 1VQNA 2MF2A 3A98A 2DL3A 3S3OA 5GAMj 1KHCA 4R0KA 1VQ4Q 2EW3A 2HEQA 2HMAA 2D8HA 1RL2A 1TUDA 2AKLA 1NLOC 2BKDN 1TUCA 4Z8AA 2RK2A 1OZ2A 1N6AA 3O5ZA 4PNOA 4BY6B 4EIKA 1QCOA 4PJOF 4J9DA 2LT4A 3JCMf 2QQ9A 2LNHB 1B07A 1VQMT 3JCMJ 5CAIA 5CVIA 2Y4YA 4DEXA 2XMFA 1WZOA 3JB9H 1UHFA 1X6OA 2KK4A 2DFUA 2DX1A 2X4XA 1O75A 1HSQA 1M2VA 3MJXA 8AT1B 2P0QA 1PCXA 1Z9ZA 2R5AA 2ECZA 3SHWA 4M77E 4XU1A 3RR6A 4C0DC 2QTVA 1VQ9A 2A37A 2DL5A 3UF4A 5IHKA 1YITQ 4N4IA 4PLIA 3RUXA 2OTJA 1VQPT 1KK7A 1VIEA 1OX9A 3EFSA 1VQ8Q 4DEYA 2RHUA 4MZPA 3PMTA 2GNCA 1NZ9A 3JCMV 2RQVA 1M30A 5GAN4 1M2OA 3CCUT 4C92E 4BDYA 3C0CA 3MP6A 1YI2A 3VYGA 1IGQA 2RN8A 4RTZA 1M90U 2KYBA 4A4HA 1Y71A 4Q5WA 1OU8A 1ZX6A 2FZCB 1SKUB 1UFFA 2OX7A 1QVPA 4KULA 3I55Q 5GANg 4IIOA 2DD5A 4A53A 2QI2A 5GAOr 1MUZA 3JSCA 1EIFA 1KQSA 4WCIA 5IXFA 1PRMC 4KRTA 2EQUA 1NPPA 1QVGA 2HKNA 4XU3A 2CSIA 1VUBA 1D0XA 3CC4Q 4M75C 1NJIR 3L2RA 4M7AA 3RBBB 4BD3A 2YRVA 1U5SA 4M7AB 2EGAA 1Q7YC 2OJ2A 2QQSA 4DOVA 1FX7A 1K9MU 3CBPA 1TTHB 4QVDA 3HSBA 3OYNA 1QVGP 2JMAA 1IGUA 4OVAA 3OYJA 5LJ3h 3R6NA 1YP5A 3QIIA 3QBYA 1HXDA 5C0MA 1PG5B 3MP1A 2DTIA 1ACMB 3CXCS 5I2SA 2NYSA 5KYWB 2JTMA 4EDUA 4FT4A 3WXMB 2CH4W 2DEUA 1M9SA 2D0QB 4D8DA 2EAYA 3M9QA 2M9UA 2YDLA 4PJNA 2DVJA 4J6XA 1TU0B 2CT3A 1QCNA 1OULA 1ZQ1A 4FW1A 3M54A 1AHJB 3JCMc 5CR2A 2E12A 4XTXA 2DBKA 4RCBA 4J9GA 2XDPA 3CCMQ 1JEGA 5GMKe 2O4XA 1R8OB 2LX7A 4LDXA 1RLPC 3LWHA 2KSSA 2O4XB 1FMWA 1AT1B 4M78E 5GAN3 3S3MA 1B7TA 3RNJA 3ME9A 3PIPA 3E19A 3ZBDA 2BIVA 2OI3A 2IVWA 2E3HA 3V7CA 4RUGA 2E41A 3NTIA 3JV3A 4M7AF 3NMZC 3V8JA 3M57A 4KH0B 4J7IA 1M1KC 2JM8A 3FIFA 1SHFA 4CC7A 1SPKA 5DY9A 3GOXA 3M0UA 4BDZA 2QA4A 2VB6A 4R55A 4K11A 1YJWT 5LJ5g 1IB8A 2GFUA 3E9FA 3ZL7C 5GANj 2EQMA 4OB0B 1K8AC 2MWPA 3G4ST 5CKEA 3L2VA 1S72T 3GNFB 1QQJA 2KXCA 2EKHA 2O9SA 1AWWA 1X6BA 2DO3A 1U06A 3G6EA 1KC8U 4GLMA 2EYQA 3AHUA 4NL3A 2LDMA 2A7YA 1NJIU 4IUVA 1QWEA 2LQWA 3CD6T 1NPRA 3INZA 1UDLA 3A8LB 4M77C 4BI8B 5FW9A 2K57A 4HT8A 2KVQG 4FM4B 2YT6A 1Y96A 2HCKA 2EIFA 4EMGA 3MP8A 2K3XA 2LMJA 1JBMA 1MV0B 2FB7A 1WHJA 1MGQA 1BIBA 1BU1A 2EJFA 3URGA 1ARKA 4Z89A 4TVRA 3OBYA 3VRYA 1RABB 5KCOA 5GMKm 2EYWA 4ME7A 2IG0A 2EJGA 3JB9I 3QZ5B 4M7DE 3CCEQ 1YIJQ 4QQDA 2C0TA 4C92C 2AT1B 5LJ3f 3OYFA 1VQMA 1YITT 1IREB 3M55A 1Q86C 1DJ7B 2O88A 2JM9A 4OMOA 2DTOA 2RJFA 4J5YA 1OI1A 4C8QG 1SG5A 1ZSGA 3LGLA 3HRTA 1VQLQ 1QKXA 4FYWB 3JCMQ 2ESWA 2DL4A 1WDXA 2EKOA 1RAEB 7AT1B 4A4FA 3LWIA 1VQKQ 3PMIA 3HFNA 4II1A 2ZPIB 3GPLA 3HPWA 4RTTA 1PHTA 5LL6S 3F70A 2K9GA 1MMAA 3CMAQ 3CCUA 3EG3A 1OU9A 4M75D 3CCJA 3JCMb 1K1ZA 3KFVA 2CS7A 1RI0A 3VS3A 4UC4A 5D6WA 3I56Q 1AOJA 3M4GA 5GMKh 4QQ6A 1OPLA 2LJ3A 3CC4T 2X51A 1BIAA 1M3AA 1ZA2B 3CC2A 3EG0A 2LJ1A 1VQOQ 2E4HA 1UEBA 1KSWA 5HCKA 2RHZA 4LUDA 1TUGB 1W2BS 2DAQA 2OTLT 2LCSA 8ATCB 3J81E 3RKYA 3CXCA 4LUEA 3HRSA 1F1BB 1M8VA 1WLPB 4HVVA 1BYMA 2X4WA 1FMKA 1UJ0A 2X9HA 3H6ZA 2LJ0A 2DL8A 2BE7D 2J06A 1XOVA 3TQ7P 1UECA 1D1CA 4Y92A 4M78C 4GLKA 3OS5A 4PJOE 3CCVT 3SB2A 3OYBA 4QKUA 3CXCP 2E10A 3NTHA 4EPCA 5A0GA 4X1VA 1M1KR 4A4GA 3QG1A 4VUBA 1Z9QA 2CZ1B 3H0HA 3CCMT 2W10A 4BE1A 1AZGB 2EYXA 3L2ZA 2XI9A 1G3YA 1VQ7T 1K8AR 3OYLA 2JT4A 1ZSZC 3REBB 2KRSA 2FPFA 3LH0A 2RPNA 3BE3A 2DL7A 4EMKA 1YJNQ 4J9BA 3JCMg 2B8AA 2P0PA 3JB9D 2KI7A 3U23A 2KROA 4EMKB 1Q81C 1A0NB 1MV3A 3CC7A 5GAMd 4C5GA 1Q7YU 1YCSB 3V8LA 3RIRA 1X27A 1KFZA 4F7UG 1UG1A 2YRCA 4ZGDB 1AEYA 5D7UA 1VYTA 1X43A 3M4YA 4IIMA 3QPHA 4C8QA 1D1BA 3UPUA 1AZEA 5GMKl 1K9AA 2E65A 4WF2A 4CC4B 2RHXA 3HKSA 3OQ5A 2CH4A 1TH7A 4C8QB 2Y90A 4L5GA 1UGPB 1WJQA 2CSQA 2JUFA 5CKFA 1QKWA 3DB3A 4M77D 1HD3A 3SEMA 2BTTA 3I9QA 1NYFA 3VS5A 2QGGA 1NEBA 2HNIA 2V8KA 2JW4A 2HKQB 2K6DA 2QEXA 1C6VX 3EFRA 1P92A 1YNZA 2ZPGB 4D8KA 3CC7Q 4A4KA 3ASKA 3FC3A 4N4HA 1YJWA 2HQHA 1W4SA 2XICA 1RACB 2JJ9A 4JJBA 4M7DC 2WACA 1ZUKA 2KY9A 2C06A 2YUQA 3EGDA 5HK3A 3G4SA 4XTYA 5GAN2 1PSEA 5IN1A 3J80E 3EGDB 3H0FA 2FZKB 5CKBA 4C92D 2KXDA 1FWZA 3D7SB 1YJ9Q 2LQKA 2J05A 1B34A 4PFZA 3CD6A 4M75A 3H9NA 3QHSA 3CCRQ 1UGVA 2YUNA 1I07A 3CCET 3OYKA 1I5OB 2LVMA 1YIJT 1UGRB 4D6WA 4OMMA 3OYGA 4JS5A 1M1KU 3A1PA 3CMEQ 5IAYA 1LNXA 1K9MR 3SWNC 2EQIA 2EYYA 4J83A 1GBQA 4IUQA 1LPLA 1QP3A 5FWCA 1TG0A 1AD5A 4JJCA 1K0XA 3G7ZA 3CCSA 1YHQT 4PLLA 4IUPA 1WNLA 5GAN7 2LZ6B 3SFMA 1K8AU 2AK5A 4IUUA 4JLIA 1VQ5Q 3NPFA 1VQLT 2QYZA 1RAFB 1VOMA 4XTVA 2FZGB 4JPBW 2KGTA 3X28B 1VQKT 2EBPA 4AMCA 1VQNQ 1M2VB 2WSFE 1WHMA 4LN2A 3C4SA 3CMAT 2JVVA 3JAME 3CBMA 1K4US 1VYVA 2MPXC 4M7AE 3M53A 1N9RA 3Q1JA 3FEOA 2X4JA 3OSVA 2EWNA 4PK4A 1Q82C 4YTLA 1B3QA 3VS7A 2YHTA 2PTKA 2HQEA 1W2BA 3UA7A 3E9GA 4E2FB 2H8HA 2CZ7B 2L8DA 3FLGA 5FRNA 1BB9A 5CCAA 2DXCA 1VQOT 4F7UA 3PT9A 2PQWA 3N5BB 4F14A 1JB0E 5FU6B 2RO0A 2NUZA 2BZ8A 2HSPA 4LDVA 1VQ9Q 4PJOC 2WSCE 4F7UB 4N0AC 3J7AF 4FYVB 1Q86U 2O31A 4M78D 3QZ9B 2FPEA 1QWFA 4E6RA 1G3WA 4X9CA 5FROA 2OTJQ 4PJMA 4E7LA 4AFQC 2XIDA 1W2BP 5I11A 4FT2A 3THKA 5KH6A 1WJSA 5FLXE 1NM7A 1QCFA 5KE2A 2CYZB 3VUZA 1Y57A 3X24B 2E1HA 4JRPA 1KC8R 2VWFA 4C0ZA 3CQTA 2OTLA 3VS1A 4XQ3A 2YSQA 3ER0A 1YI2Q 1WHKA 5GAOn 2F69A 2VKNA 3AT1B 3LH5A 1WGSA 1JQQA 4OB3B 2QXFA 4CRIA 1BI0A 3EG1A 3G71A 1PKTA 4J9EA 4JLGA 1K73R 2H3EB 2F2VA 2DEQA 3MEUA 2EGCA 3CCVA 2JNGA 3EH1A 3FB9A 2DXBA 5GAN5 1OQKA 3VU3C 2M51A 3EG9A 3RERA 3A8HB 4C92A 2IIMA 1WJRA 3FJPA 4BY6C 2X4YA 2X3WD 1M3BA 4DQ2A 4F7UF 4R56A 1LCKA 3LYIA 1VQ7A 1BBZA 1WA7A 3CCLA 1WHHA 3CBOA 2VVKA 3BDUA 1C0MA 3QSUA 2E5KA 2QGFB 4F04B 1SF9A 5J26A 5I22A 2MAMA 4JZ4A 4J6YA 2RHIA 4M7DD 5LJ3g 4E7HA 2DKGA 4AT1B 4HCBA 2K3BA 1E6GA 1I5LA 9ATCB 2ZPFB 1GBRA 1M1GA 2FHDA 2AZVA 1AWXA 5GAMe 5A2QE 4JZ3A 1HJDA 3OYEA 3CCQA 4AFUC 3TEEA 1RAGB 2DXTA 1NEGA 4MZTA 5CIUA 1U1TA 1M1FA 2LTOA 2QASA 5AT1B 2CP0A 3CEYA 1TXQA 2JS2A 4OGEA 2W0ZA 4LD6A 2J6OA 4RKUE 1R77A 3TU4K 4ATOA 5GJWB 1YJ9T 3CPFA 2VGNA 3QWXX 2JTEA 3LX7A 1VQ6T 2D8JA 1GFDA 1YCYA 1M4ZA 2K5IA 1C1AA 2DF6A 2PZ1A 2RNAA 3DKMA 4KUIA 2YLCA 3HFOA 2Z0WA 2FO0A 1VQ4T 2DBMA 4MMKA 3CMET 2KRNA 3WVEB 3RESA 4CC3A 2DJQA 3EGUA 4ELZC 1YWOA 4O6JA 1WXUA 2YXYA 3TSZA 2KBTA 4ZN1A 3VKIA 3X25B 3GF5A 2QA4Q 2J6FA 3A8OB 3C95A 1K73U 1H641 3SDZA 1Y96B 4XAXB 4OF1A 5A0LA 5GAOp 4HCKA 1MMGA 4M7AC 2RI2A 2RMOA 2QG9B 3BW1A 1NG2A 2HD0A 2G3RA 2PUKB 5CQYA 3G6EQ 2LX9A 1VQNT 1JJ2S 1V76A 4FSXA 1JRIA 4ESRA 3FJ5A 4B6MA 1G5VA 2PUOB 1BI1A 1NLPC 3HP9A 1I8FA 1YHQA 1IHWA 2DXUA 4Y91A 3DLMA 2RK1A 3FRNA 2GF7A 1PM3A 2F2XA 4GY5A 4E7SA 3V7SA 1ZSZA 3M56A 1VQ8T 2F1LA 2JXBA 4PJOD 2NLUA 1MNDA 3QUIA 3RKWA 4JRIA 1M90C 3GIBA 2CKKA 3VUBA 1H3HA 2L3RA 1UB4A 2FYKA 1WXBA 2LT1A 2QQAA 4C5IA 1QP2A 1UUEA 5LJ3j 4RTYA 2RM4A 1CKAA 2YUOA 3OYCA 4AFZC 2P0KA 1JO8A 1VQ9T 3UT1A 1VQPA 3QJYA 2MMPA 3KBGA 4ZTJA 4LXCA 1Q7YR 1VQMQ 2C0OA 4J9HA 3I55T 4AG2C 1BCMA 3P8BB 4KUDK 4P5NA 3GBQA 1G83A 3PVQA 3HRUA 2ZPEB 2ZCFB 5IXBA 1W70A 1W6XA 1ZLMA 3C12A 3RKXA 2JN0A 1WHGA 5LJ5j 2QK0A 3OW2S 2DA9A 2DILA 4IKFA 1EFNA 1T0HA 1GCPA 1PSFA 1YI2T 2A08A 4M7DA 2V8IA 3I5SA 4HT9A 2ED1A 4GBQA 4J9IA 1RI9A 1WYXA 3JB9J 4M75G 1ABOA 4BI4A 2RQUA 2DRKA 3KUFA 4RTWA 2R58A 4JRQA 1JXOA 5GAMh 5CKDA 2EVRA 5HKCA 3CCUQ 4OMFB 3CCJQ 2M1HA 5FU7B 4F17A 1IHVA 2DPPB 2LCLA 1BI2A 4PJLA 2MIOA 1Q82U 3L42A 5M9OA 2NUPA 3M0RA 1BCOA 2RJEA 3PTAA 4C8QE 1OEBA 2CZ0B 3CC2Q 2AKKA 2EQJA 2K2MA 4KH1B 4L59A 3SWNA 1QVFS 1WQ7A 1WIEA 3L2QA 3HL8A 2OAWA 3BDLA 2DK3A 2LCCA 5KE3A 3OYMA 1ZUYA 3SD4A 1R0BG 2HZYA 4OB1B 3T9NA 1I4K1 3JCMh 2O01E 3KXTA 5GANe 5KYUA 1TSFA 1SEMA 1GCQC 5KYUB 1ZBJA 5I21A 1RAHB 4L6V5 2BZYA 1FYNA 2HDAA 4HCCA 4FW2A 1TOVA 4XK8E 1BI3A 4OMNA 4RG2A 1V29B 2VGMA 4C0DB 5J3BA 2QAZA 4HKEA 1CSKA 4JUVA 2RQRA 3M0SA 1WQWA 4LNPA 3ZEHA 3MEVA 2WSEE 2FRWA 1SHGA 5C6SA 2DNUA 1R0CB 1VYUA 3META 3E2UA 3A8GB 3OMGA 1PD0A 4QVZA 1NJIC 3MO8A 4PKCC 2RQTA 3JB9G 1WPYA 2EGEA 3QYHB 4A4EA 2Y4XA 3OYDA 1JU5C 4FYYB 1UHCA 4HA8A 4C5HA 2KQWA 4N0AA 3EAEA 1TS9A 3R6OA 2KNBB 4B9WA 4JJNK 2RD1A 4C5EA 2R5MA 4CC2A 2P4TA 2RI5A 4M7AD 2CUBA 2CREA 2M02A 5KCHA 2O9VA 1Q86R 3LW5E 2DD4A 3JCMd 5GAN6 1S72A 1VQ6A 4M77G 5IT9E 4JS4A 2DM1A 2KAFA 1JJ2A 2YLBA 1VQ4A 4DOWA 1D3BA 2ZPHB 3JCMW 4Y28E 1H92A 1BK2A 3OSSC 2F5TX 2A3LA 5L23A 3G6ET 1D3BB 4J7FA 1TWBA 5GAMf 2CZ6B 2J7IA 2MYSA 4MDWA 3JRZA 1B34B 5FWBA 3EHRA 4M75B 4JJDA 2QEXQ 3A5ZB 2YWWA 4KBMB 4DBRA 2A36A 5GMKj 1YJWQ 4C92G 1CKBA 2A0FB 4MZMA 1JJ2P 3G4SQ 4KT0E 4B9XA 1X01A 4LD9K 2V26A 4QQGA 1T0JA 2V1QA 3G1JA 4C8QF 1LOJA 2CT4A 2FPDA 1BKBA 5IHIA 2QDLA 2RB6A 1K0SA 2DRMA 4F7UE 1RADB 3GLXA 1VIFA 2L3QA 5LJ5e 2KRMA 3VS4A 2HQXA 4OGCA 4O5VA 1RAIB 3EHQA 3V7RA 3CD6Q 2JOYA 2HBPA 1YITA 2MK5A 1Q95G 4HVWA 3EH2A 3UA6A 4AG1C 4IUTA 1MHNA 2DVEA 3MEAA 2K5FA 2ROTA 2CGHA 3RDVA 1G2BA 2PNIA 1FMVA 1VQ8A 1ZHIA 3NTKA 4MMLA 2KMTA 4V2SA 1O9SA 3MCAB 1X75C 4EMHA 3VV0A 1NE8A 2EQKA 3I5RA 2K5LA 4A63B 3OW2A 3CCSQ 3I56T 2MOXA 3M0PA 2RF0A 4EMKC 1JXMA 2NUTA 2RHYA 1AWJA 5GANh 2E64A 2GTOA 2L2PA 2YUPA 3VS2A 4M75F 2NUTB 1T3SA 1G8XA 4NS5A 3I55A 2E5QA 2XU8A 1E6HA 4XTZA 1I0CA 3OYAA 5KYNA 3UWNA 1ABQA 1MMNA 2FEIA 1AWOA 1VA7A 3OW2P 4WTOB 2K79A 2ZZDA 4C8QC 3V8KA 3WVDB 2CP7A 3X26B 2VV5A 2PVOB 3I35A 3MHXA 4RTVA 5KYXA 1KG1A 3CCJT 2I0NA 2GQVA 3M5AA 1KD1C 4E7JA 2D9TA 1X69A 2QQBA 1G3SA 5KYXB 5D6XA 4DBHA 2KYMA 4JRKA 3CC4A 2D6FA 2KR3A 2RJDA 3S6WA 1QVFA 2AZSA 1IZ6A 4FSSA 3CC2T 2ZAEA 3MEWA 2LQNA 4M78G 4X9DA 1Q81R 3GNGA 3HHTB 2EFIA 1I1JA 4M77A 1LVKA 2L5QA 5CKHA 4XTUA 4HXJA 2QQRA 3O8VA 2DERA 1N8RC 4OB2B 2KT1A 4M77B 1M3CA 5L8RE 3QKJA 4IURA 1OYXA 1RLQC 1QVFP 1HK9A 3GP8A 3ZFJA 2DETA 5GANd 1KQSP 5HK0A 3VYHB 4MDXA 2DIGA 5DLQE 4ORZA 2GQIA 1U1SA 4ELYC 3QDFA 1YJNT 1IXDA 1SRLA 2HAXA 2E3IA 2J6KA 2OTLQ 3CCMA 2B86A 1EX4A 4C0GA 3EG9B 3PNWC 4C92B 2GTJA 5KYWA
chains in the Genus database with same CATH topology
1NJIR 1Q82R 1Q86R 1Q81R 2OTJQ 1YI2Q 1VQKQ 3I56Q 1W2BP 1KD1R 1YITQ 2QEXQ 1KQSP 1K8AR 1VQ5Q 3CCMQ 3G71Q 3G6EQ 1VQ4Q 3CXCP 1Q7YR 3CC2Q 3CCUQ 1VQMQ 1YJWQ 1YHQQ 1N8RR 3CCJQ 3CCEQ 3CD6Q 1YIJQ 3CMEQ 1VQ7Q 1M1KR 2OTLQ 2QA4Q 1K9MR 1JJ2P 3OW2P 3CCLQ 3G4SQ 3CCSQ 3CCVQ 1VQ9Q 1M90R 3CC7Q 3CMAQ 1YJ9Q 1QVGP 1VQ8Q 1VQLQ 1QVFP 1S72Q 1YJNQ 3CPWP 1VQ6Q 1K73R 1VQNQ 1VQOQ 1KC8R 3I55Q 1VQPQ 3CCQQ 3CCRQ 3CC4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI R;  1Q82 R;  1Q86 R;  1Q81 R;  2OTJ Q;  1YI2 Q;  1VQK Q;  3I56 Q;  1W2B P;  1KD1 R;  1YIT Q;  2QEX Q;  1KQS P;  1K8A R;  1VQ5 Q;  3CCM Q;  3G71 Q;  3G6E Q;  1VQ4 Q;  3CXC P;  1Q7Y R;  3CC2 Q;  3CCU Q;  1VQM Q;  1YJW Q;  1YHQ Q;  1N8R R;  3CCJ Q;  3CCE Q;  3CD6 Q;  1YIJ Q;  3CME Q;  1VQ7 Q;  1M1K R;  2OTL Q;  2QA4 Q;  1K9M R;  1JJ2 P;  3OW2 P;  3CCL Q;  3G4S Q;  3CCS Q;  3CCV Q;  1VQ9 Q;  1M90 R;  3CC7 Q;  3CMA Q;  1YJ9 Q;  1QVG P;  1VQ8 Q;  1VQL Q;  1QVF P;  1S72 Q;  1YJN Q;  3CPW P;  1VQ6 Q;  1K73 R;  1VQN Q;  1VQO Q;  1KC8 R;  3I55 Q;  1VQP Q;  3CCQ Q;  3CCR Q;  3CC4 Q; 
#chains in the Genus database with same CATH topology
 3HTR A;  4FYX B;  1ZUU A;  1J3T A;  2H3J A;  3QJ6 A;  4E7Z A;  2MI6 A;  3G71 Q;  3JB9 F;  2DE0 X;  4J9F A;  1OZ3 A;  3OYI A;  3VS0 A;  2L3S A;  1U8R A;  3L2U A;  3L2W A;  3CCV Q;  4LDW A;  2E70 A;  3EG2 A;  1W1F A;  1PKS A;  2EPD A;  3MPU B;  3OYH A;  5LJ5 h;  2R57 A;  3S3N A;  1SRM A;  1X6G A;  3CC7 T;  4J9C A;  4OMQ A;  5CO7 A;  3VJP A;  4M77 F;  3A8M B;  5EC7 A;  4KGZ B;  1VQ7 Q;  3UDC A;  3CCL Q;  1QMC A;  1X2K A;  4M7D G;  4ZNX A;  3OS2 A;  3RMQ A;  1UGS B;  1ZBX A;  4OMP A;  2COZ A;  5GAN f;  2CDT A;  1S1N A;  2EJ9 A;  2ROL A;  4ZGJ B;  3NFC A;  3OS0 A;  1Y0M A;  3H8Z A;  2FG0 A;  1IO6 A;  2BUD A;  2HL3 A;  5FU6 C;  3M58 A;  3CCR T;  5A0D A;  2JTF A;  4RG8 A;  2M0Y A;  2SEM A;  4C92 F;  5DM7 R;  4QT7 A;  2QEX T;  5D6Y A;  5LJ3 d;  2NWM A;  5GMK i;  3RMS A;  3CCQ Q;  1OPK A;  1ZA1 B;  1V1C A;  4RCC A;  1Q81 U;  4BAC A;  2GBQ A;  4AFS C;  3JCM e;  4PFP A;  2DZC A;  2KE9 A;  4DBQ A;  4CI0 C;  2K4Y A;  1UJY A;  2XD0 A;  1N9S A;  2D1X A;  3CPW S;  3DB4 A;  3DLL A;  3QXE B;  2F2W A;  2K7A A;  2XK0 A;  3QO3 A;  1YBY A;  5FRM A;  2K2V A;  2I2L A;  2CP2 A;  3CCE A;  1VQ5 T;  1YIJ A;  5GAO q;  4QVC A;  1Q82 R;  4M78 A;  1UE9 A;  4BE0 A;  5LJ5 d;  3TRE A;  3LLR A;  4M78 B;  1YWP A;  3QYG B;  2LP5 A;  4FU6 A;  2LNV A;  2VXF A;  2X3X D;  3H41 A;  1EZZ B;  5I2M A;  3BY7 A;  2QTX A;  4E7K A;  3UAT A;  1WX6 A;  1OV3 A;  3PFS A;  3OS1 A;  1VQL A;  1AVZ C;  2OAU A;  1KD1 R;  1GCQ A;  3CCS T;  2JS0 A;  3X20 B;  2XDB A;  5AYF A;  1MMD A;  2RA2 A;  1Y07 A;  3EGX A;  2XDD A;  2PVG B;  4N4G A;  3TVT A;  3VS6 A;  1ZSZ B;  1VQK A;  2RJC A;  1X2Q A;  4C8Q D;  2M0O A;  3EGX B;  2PU9 B;  4BUG A;  5EG2 A;  2BZX A;  1D0Y A;  2AIR B;  2GCX A;  4XU0 A;  2FRY A;  1K76 A;  1OX8 A;  1PC0 A;  3CMA A;  3OA6 A;  1FXX A;  1XNI A;  2M16 A;  3JCM P;  4F16 A;  1D0Z A;  2ATC B;  1D09 B;  1WFW A;  1GL5 A;  1M27 C;  2K3Y A;  1M8M A;  1PNJ A;  3NHN A;  1YHQ Q;  2COY A;  1E7O A;  4BE2 A;  1N8R R;  3I56 A;  2O2O A;  4RTX A;  3PE0 A;  3L1A A;  4JDS A;  4PJO G;  4FCY A;  2OTJ T;  4FIB A;  1GRI A;  2L0A A;  1U3O A;  2FVU A;  2DMO A;  2RQW A;  2LC4 A;  5LJ5 f;  2ENM A;  3IQL A;  5GAO m;  1VQO A;  3OYY A;  4ZGE B;  4ZN3 A;  4RMO A;  4M78 F;  4HCZ A;  4PFO A;  1KJW A;  1GXI E;  2L89 A;  2DYB A;  1K9M C;  4KGV B;  2A28 A;  1PD1 A;  2ABL A;  2HL5 C;  3PIO A;  3JCM X;  4ZTF A;  5IH2 A;  1QW1 A;  1VQP Q;  2FL7 A;  4M7D B;  1NBE B;  4FL6 A;  2DIQ A;  5CQX A;  1GFC A;  1YFN A;  2X35 A;  4Z88 A;  1RAA B;  2BE9 B;  4E47 A;  2DJZ A;  5IHN A;  4DBF A;  2G6F X;  1N5Z A;  4J8O A;  2ZPB B;  5CK9 A;  2P4R A;  3OBW A;  1WHL A;  2F5K A;  3VRZ A;  3LGF A;  4XU2 A;  2KEA A;  2MWO A;  2L3P A;  4NOY A;  2NUP B;  2V1R A;  1I81 A;  2VC8 A;  2V8J A;  6AT1 B;  2IPO B;  2E6N A;  1XTD A;  2XKO C;  3SWN B;  3G71 T;  2SRC A;  4BB7 A;  2COW A;  3BFM A;  3REA B;  5GAM g;  1KQS S;  1KD1 U;  4X34 A;  1YJN A;  4E7I A;  4C0F A;  2DYI A;  4DA4 A;  3H0I A;  1QLY A;  1QVG S;  4XTW A;  4LDY A;  2KDS A;  3OY9 A;  5GAN 8;  4BI3 A;  2HSE B;  1KQ1 A;  4A54 A;  2CP3 A;  1MNE A;  2ED0 A;  1HYO A;  3M59 A;  5GJV B;  3M0Q A;  4M7D F;  4Z02 A;  1XQH A;  3PGG A;  1N27 A;  2XG8 D;  3CCL T;  2VXE A;  1KIK A;  1N8R U;  2E6Z A;  4OP0 A;  1NYG A;  1PWT A;  3PVL A;  2CP6 A;  4M75 E;  1Y7X A;  2GFA A;  2HBW A;  2DZ9 A;  3TSW A;  1KC8 C;  1H3Z A;  1D1A A;  3QDR B;  1G3T A;  1T3L A;  1H8K A;  3ULR B;  2AHJ B;  1RUW A;  4LDU A;  4OML A;  2RI3 A;  1YN8 A;  3E1S A;  4LE9 A;  2JZ2 A;  1KQ2 A;  2VUB A;  2LQ8 A;  3CCQ T;  2P84 A;  1WI7 A;  3MKD A;  4PJO A;  3C94 A;  1K73 C;  3CPW A;  3P8D A;  4PJO B;  2DLP A;  3EFO A;  3OB9 A;  1YJ9 A;  2MCN A;  2RH2 A;  3EFO B;  2QA4 T;  1M5Q 1;  3CCR A;  2CP5 A;  2QDY B;  2XHC A;  2KT8 A;  2VYT A;  3OMC A;  4M4Z A;  2C0I A;  3FDR A;  4QW2 A;  4PL6 A;  4ANJ A;  2LRQ A;  2PVD B;  1M90 R;  3CPW P;  5KYY A;  5LJ3 e;  3CME A;  5DLO A;  2DTH A;  4M7A G;  3QWY A;  1SSF A;  2CUD A;  5KYY B;  1UTI A;  3M0T A;  2YRD A;  5HY6 A;  1XJW B;  2JMC A;  2D0N A;  3NGP A;  5J39 A;  4PJJ A;  5ECA A;  1SSH A;  4NL2 A;  5FU7 C;  5GAO l;  1VQ5 A;  1KHI A;  4RTU A;  1S72 Q;  2EYZ A;  1VQ6 Q;  1UGQ B;  1OOT A;  1IRX A;  4KGX B;  1LJO A;  1WXT A;  2VAS A;  3P8H A;  2GGR A;  4HVU A;  3TCJ A;  4J6W A;  1PRL C;  2ZGW A;  1VQN A;  2MF2 A;  3A98 A;  2DL3 A;  3S3O A;  5GAM j;  1KHC A;  4R0K A;  1VQ4 Q;  2EW3 A;  2HEQ A;  2HMA A;  2D8H A;  1RL2 A;  1TUD A;  2AKL A;  1NLO C;  2BKD N;  1TUC A;  4Z8A A;  2RK2 A;  1OZ2 A;  1N6A A;  3O5Z A;  4PNO A;  4BY6 B;  4EIK A;  1QCO A;  4PJO F;  4J9D A;  2LT4 A;  3JCM f;  2QQ9 A;  2LNH B;  1B07 A;  1VQM T;  3JCM J;  5CAI A;  5CVI A;  2Y4Y A;  4DEX A;  2XMF A;  1WZO A;  3JB9 H;  1UHF A;  1X6O A;  2KK4 A;  2DFU A;  2DX1 A;  2X4X A;  1O75 A;  1HSQ A;  1M2V A;  3MJX A;  8AT1 B;  2P0Q A;  1PCX A;  1Z9Z A;  2R5A A;  2ECZ A;  3SHW A;  4M77 E;  4XU1 A;  3RR6 A;  4C0D C;  2QTV A;  1VQ9 A;  2A37 A;  2DL5 A;  3UF4 A;  5IHK A;  1YIT Q;  4N4I A;  4PLI A;  3RUX A;  2OTJ A;  1VQP T;  1KK7 A;  1VIE A;  1OX9 A;  3EFS A;  1VQ8 Q;  4DEY A;  2RHU A;  4MZP A;  3PMT A;  2GNC A;  1NZ9 A;  3JCM V;  2RQV A;  1M30 A;  5GAN 4;  1M2O A;  3CCU T;  4C92 E;  4BDY A;  3C0C A;  3MP6 A;  1YI2 A;  3VYG A;  1IGQ A;  2RN8 A;  4RTZ A;  1M90 U;  2KYB A;  4A4H A;  1Y71 A;  4Q5W A;  1OU8 A;  1ZX6 A;  2FZC B;  1SKU B;  1UFF A;  2OX7 A;  1QVP A;  4KUL A;  3I55 Q;  5GAN g;  4IIO A;  2DD5 A;  4A53 A;  2QI2 A;  5GAO r;  1MUZ A;  3JSC A;  1EIF A;  1KQS A;  4WCI A;  5IXF A;  1PRM C;  4KRT A;  2EQU A;  1NPP A;  1QVG A;  2HKN A;  4XU3 A;  2CSI A;  1VUB A;  1D0X A;  3CC4 Q;  4M75 C;  1NJI R;  3L2R A;  4M7A A;  3RBB B;  4BD3 A;  2YRV A;  1U5S A;  4M7A B;  2EGA A;  1Q7Y C;  2OJ2 A;  2QQS A;  4DOV A;  1FX7 A;  1K9M U;  3CBP A;  1TTH B;  4QVD A;  3HSB A;  3OYN A;  1QVG P;  2JMA A;  1IGU A;  4OVA A;  3OYJ A;  5LJ3 h;  3R6N A;  1YP5 A;  3QII A;  3QBY A;  1HXD A;  5C0M A;  1PG5 B;  3MP1 A;  2DTI A;  1ACM B;  3CXC S;  5I2S A;  2NYS A;  5KYW B;  2JTM A;  4EDU A;  4FT4 A;  3WXM B;  2CH4 W;  2DEU A;  1M9S A;  2D0Q B;  4D8D A;  2EAY A;  3M9Q A;  2M9U A;  2YDL A;  4PJN A;  2DVJ A;  4J6X A;  1TU0 B;  2CT3 A;  1QCN A;  1OUL A;  1ZQ1 A;  4FW1 A;  3M54 A;  1AHJ B;  3JCM c;  5CR2 A;  2E12 A;  4XTX A;  2DBK A;  4RCB A;  4J9G A;  2XDP A;  3CCM Q;  1JEG A;  5GMK e;  2O4X A;  1R8O B;  2LX7 A;  4LDX A;  1RLP C;  3LWH A;  2KSS A;  2O4X B;  1FMW A;  1AT1 B;  4M78 E;  5GAN 3;  3S3M A;  1B7T A;  3RNJ A;  3ME9 A;  3PIP A;  3E19 A;  3ZBD A;  2BIV A;  2OI3 A;  2IVW A;  2E3H A;  3V7C A;  4RUG A;  2E41 A;  3NTI A;  3JV3 A;  4M7A F;  3NMZ C;  3V8J A;  3M57 A;  4KH0 B;  4J7I A;  1M1K C;  2JM8 A;  3FIF A;  1SHF A;  4CC7 A;  1SPK A;  5DY9 A;  3GOX A;  3M0U A;  4BDZ A;  2QA4 A;  2VB6 A;  4R55 A;  4K11 A;  1YJW T;  5LJ5 g;  1IB8 A;  2GFU A;  3E9F A;  3ZL7 C;  5GAN j;  2EQM A;  4OB0 B;  1K8A C;  2MWP A;  3G4S T;  5CKE A;  3L2V A;  1S72 T;  3GNF B;  1QQJ A;  2KXC A;  2EKH A;  2O9S A;  1AWW A;  1X6B A;  2DO3 A;  1U06 A;  3G6E A;  1KC8 U;  4GLM A;  2EYQ A;  3AHU A;  4NL3 A;  2LDM A;  2A7Y A;  1NJI U;  4IUV A;  1QWE A;  2LQW A;  3CD6 T;  1NPR A;  3INZ A;  1UDL A;  3A8L B;  4M77 C;  4BI8 B;  5FW9 A;  2K57 A;  4HT8 A;  2KVQ G;  4FM4 B;  2YT6 A;  1Y96 A;  2HCK A;  2EIF A;  4EMG A;  3MP8 A;  2K3X A;  2LMJ A;  1JBM A;  1MV0 B;  2FB7 A;  1WHJ A;  1MGQ A;  1BIB A;  1BU1 A;  2EJF A;  3URG A;  1ARK A;  4Z89 A;  4TVR A;  3OBY A;  3VRY A;  1RAB B;  5KCO A;  5GMK m;  2EYW A;  4ME7 A;  2IG0 A;  2EJG A;  3JB9 I;  3QZ5 B;  4M7D E;  3CCE Q;  1YIJ Q;  4QQD A;  2C0T A;  4C92 C;  2AT1 B;  5LJ3 f;  3OYF A;  1VQM A;  1YIT T;  1IRE B;  3M55 A;  1Q86 C;  1DJ7 B;  2O88 A;  2JM9 A;  4OMO A;  2DTO A;  2RJF A;  4J5Y A;  1OI1 A;  4C8Q G;  1SG5 A;  1ZSG A;  3LGL A;  3HRT A;  1VQL Q;  1QKX A;  4FYW B;  3JCM Q;  2ESW A;  2DL4 A;  1WDX A;  2EKO A;  1RAE B;  7AT1 B;  4A4F A;  3LWI A;  1VQK Q;  3PMI A;  3HFN A;  4II1 A;  2ZPI B;  3GPL A;  3HPW A;  4RTT A;  1PHT A;  5LL6 S;  3F70 A;  2K9G A;  1MMA A;  3CMA Q;  3CCU A;  3EG3 A;  1OU9 A;  4M75 D;  3CCJ A;  3JCM b;  1K1Z A;  3KFV A;  2CS7 A;  1RI0 A;  3VS3 A;  4UC4 A;  5D6W A;  3I56 Q;  1AOJ A;  3M4G A;  5GMK h;  4QQ6 A;  1OPL A;  2LJ3 A;  3CC4 T;  2X51 A;  1BIA A;  1M3A A;  1ZA2 B;  3CC2 A;  3EG0 A;  2LJ1 A;  1VQO Q;  2E4H A;  1UEB A;  1KSW A;  5HCK A;  2RHZ A;  4LUD A;  1TUG B;  1W2B S;  2DAQ A;  2OTL T;  2LCS A;  8ATC B;  3J81 E;  3RKY A;  3CXC A;  4LUE A;  3HRS A;  1F1B B;  1M8V A;  1WLP B;  4HVV A;  1BYM A;  2X4W A;  1FMK A;  1UJ0 A;  2X9H A;  3H6Z A;  2LJ0 A;  2DL8 A;  2BE7 D;  2J06 A;  1XOV A;  3TQ7 P;  1UEC A;  1D1C A;  4Y92 A;  4M78 C;  4GLK A;  3OS5 A;  4PJO E;  3CCV T;  3SB2 A;  3OYB A;  4QKU A;  3CXC P;  2E10 A;  3NTH A;  4EPC A;  5A0G A;  4X1V A;  1M1K R;  4A4G A;  3QG1 A;  4VUB A;  1Z9Q A;  2CZ1 B;  3H0H A;  3CCM T;  2W10 A;  4BE1 A;  1AZG B;  2EYX A;  3L2Z A;  2XI9 A;  1G3Y A;  1VQ7 T;  1K8A R;  3OYL A;  2JT4 A;  1ZSZ C;  3REB B;  2KRS A;  2FPF A;  3LH0 A;  2RPN A;  3BE3 A;  2DL7 A;  4EMK A;  1YJN Q;  4J9B A;  3JCM g;  2B8A A;  2P0P A;  3JB9 D;  2KI7 A;  3U23 A;  2KRO A;  4EMK B;  1Q81 C;  1A0N B;  1MV3 A;  3CC7 A;  5GAM d;  4C5G A;  1Q7Y U;  1YCS B;  3V8L A;  3RIR A;  1X27 A;  1KFZ A;  4F7U G;  1UG1 A;  2YRC A;  4ZGD B;  1AEY A;  5D7U A;  1VYT A;  1X43 A;  3M4Y A;  4IIM A;  3QPH A;  4C8Q A;  1D1B A;  3UPU A;  1AZE A;  5GMK l;  1K9A A;  2E65 A;  4WF2 A;  4CC4 B;  2RHX A;  3HKS A;  3OQ5 A;  2CH4 A;  1TH7 A;  4C8Q B;  2Y90 A;  4L5G A;  1UGP B;  1WJQ A;  2CSQ A;  2JUF A;  5CKF A;  1QKW A;  3DB3 A;  4M77 D;  1HD3 A;  3SEM A;  2BTT A;  3I9Q A;  1NYF A;  3VS5 A;  2QGG A;  1NEB A;  2HNI A;  2V8K A;  2JW4 A;  2HKQ B;  2K6D A;  2QEX A;  1C6V X;  3EFR A;  1P92 A;  1YNZ A;  2ZPG B;  4D8K A;  3CC7 Q;  4A4K A;  3ASK A;  3FC3 A;  4N4H A;  1YJW A;  2HQH A;  1W4S A;  2XIC A;  1RAC B;  2JJ9 A;  4JJB A;  4M7D C;  2WAC A;  1ZUK A;  2KY9 A;  2C06 A;  2YUQ A;  3EGD A;  5HK3 A;  3G4S A;  4XTY A;  5GAN 2;  1PSE A;  5IN1 A;  3J80 E;  3EGD B;  3H0F A;  2FZK B;  5CKB A;  4C92 D;  2KXD A;  1FWZ A;  3D7S B;  1YJ9 Q;  2LQK A;  2J05 A;  1B34 A;  4PFZ A;  3CD6 A;  4M75 A;  3H9N A;  3QHS A;  3CCR Q;  1UGV A;  2YUN A;  1I07 A;  3CCE T;  3OYK A;  1I5O B;  2LVM A;  1YIJ T;  1UGR B;  4D6W A;  4OMM A;  3OYG A;  4JS5 A;  1M1K U;  3A1P A;  3CME Q;  5IAY A;  1LNX A;  1K9M R;  3SWN C;  2EQI A;  2EYY A;  4J83 A;  1GBQ A;  4IUQ A;  1LPL A;  1QP3 A;  5FWC A;  1TG0 A;  1AD5 A;  4JJC A;  1K0X A;  3G7Z A;  3CCS A;  1YHQ T;  4PLL A;  4IUP A;  1WNL A;  5GAN 7;  2LZ6 B;  3SFM A;  1K8A U;  2AK5 A;  4IUU A;  4JLI A;  1VQ5 Q;  3NPF A;  1VQL T;  2QYZ A;  1RAF B;  1VOM A;  4XTV A;  2FZG B;  4JPB W;  2KGT A;  3X28 B;  1VQK T;  2EBP A;  4AMC A;  1VQN Q;  1M2V B;  2WSF E;  1WHM A;  4LN2 A;  3C4S A;  3CMA T;  2JVV A;  3JAM E;  3CBM A;  1K4U S;  1VYV A;  2MPX C;  4M7A E;  3M53 A;  1N9R A;  3Q1J A;  3FEO A;  2X4J A;  3OSV A;  2EWN A;  4PK4 A;  1Q82 C;  4YTL A;  1B3Q A;  3VS7 A;  2YHT A;  2PTK A;  2HQE A;  1W2B A;  3UA7 A;  3E9G A;  4E2F B;  2H8H A;  2CZ7 B;  2L8D A;  3FLG A;  5FRN A;  1BB9 A;  5CCA A;  2DXC A;  1VQO T;  4F7U A;  3PT9 A;  2PQW A;  3N5B B;  4F14 A;  1JB0 E;  5FU6 B;  2RO0 A;  2NUZ A;  2BZ8 A;  2HSP A;  4LDV A;  1VQ9 Q;  4PJO C;  2WSC E;  4F7U B;  4N0A C;  3J7A F;  4FYV B;  1Q86 U;  2O31 A;  4M78 D;  3QZ9 B;  2FPE A;  1QWF A;  4E6R A;  1G3W A;  4X9C A;  5FRO A;  2OTJ Q;  4PJM A;  4E7L A;  4AFQ C;  2XID A;  1W2B P;  5I11 A;  4FT2 A;  3THK A;  5KH6 A;  1WJS A;  5FLX E;  1NM7 A;  1QCF A;  5KE2 A;  2CYZ B;  3VUZ A;  1Y57 A;  3X24 B;  2E1H A;  4JRP A;  1KC8 R;  2VWF A;  4C0Z A;  3CQT A;  2OTL A;  3VS1 A;  4XQ3 A;  2YSQ A;  3ER0 A;  1YI2 Q;  1WHK A;  5GAO n;  2F69 A;  2VKN A;  3AT1 B;  3LH5 A;  1WGS A;  1JQQ A;  4OB3 B;  2QXF A;  4CRI A;  1BI0 A;  3EG1 A;  3G71 A;  1PKT A;  4J9E A;  4JLG A;  1K73 R;  2H3E B;  2F2V A;  2DEQ A;  3MEU A;  2EGC A;  3CCV A;  2JNG A;  3EH1 A;  3FB9 A;  2DXB A;  5GAN 5;  1OQK A;  3VU3 C;  2M51 A;  3EG9 A;  3RER A;  3A8H B;  4C92 A;  2IIM A;  1WJR A;  3FJP A;  4BY6 C;  2X4Y A;  2X3W D;  1M3B A;  4DQ2 A;  4F7U F;  4R56 A;  1LCK A;  3LYI A;  1VQ7 A;  1BBZ A;  1WA7 A;  3CCL A;  1WHH A;  3CBO A;  2VVK A;  3BDU A;  1C0M A;  3QSU A;  2E5K A;  2QGF B;  4F04 B;  1SF9 A;  5J26 A;  5I22 A;  2MAM A;  4JZ4 A;  4J6Y A;  2RHI A;  4M7D D;  5LJ3 g;  4E7H A;  2DKG A;  4AT1 B;  4HCB A;  2K3B A;  1E6G A;  1I5L A;  9ATC B;  2ZPF B;  1GBR A;  1M1G A;  2FHD A;  2AZV A;  1AWX A;  5GAM e;  5A2Q E;  4JZ3 A;  1HJD A;  3OYE A;  3CCQ A;  4AFU C;  3TEE A;  1RAG B;  2DXT A;  1NEG A;  4MZT A;  5CIU A;  1U1T A;  1M1F A;  2LTO A;  2QAS A;  5AT1 B;  2CP0 A;  3CEY A;  1TXQ A;  2JS2 A;  4OGE A;  2W0Z A;  4LD6 A;  2J6O A;  4RKU E;  1R77 A;  3TU4 K;  4ATO A;  5GJW B;  1YJ9 T;  3CPF A;  2VGN A;  3QWX X;  2JTE A;  3LX7 A;  1VQ6 T;  2D8J A;  1GFD A;  1YCY A;  1M4Z A;  2K5I A;  1C1A A;  2DF6 A;  2PZ1 A;  2RNA A;  3DKM A;  4KUI A;  2YLC A;  3HFO A;  2Z0W A;  2FO0 A;  1VQ4 T;  2DBM A;  4MMK A;  3CME T;  2KRN A;  3WVE B;  3RES A;  4CC3 A;  2DJQ A;  3EGU A;  4ELZ C;  1YWO A;  4O6J A;  1WXU A;  2YXY A;  3TSZ A;  2KBT A;  4ZN1 A;  3VKI A;  3X25 B;  3GF5 A;  2QA4 Q;  2J6F A;  3A8O B;  3C95 A;  1K73 U;  1H64 1;  3SDZ A;  1Y96 B;  4XAX B;  4OF1 A;  5A0L A;  5GAO p;  4HCK A;  1MMG A;  4M7A C;  2RI2 A;  2RMO A;  2QG9 B;  3BW1 A;  1NG2 A;  2HD0 A;  2G3R A;  2PUK B;  5CQY A;  3G6E Q;  2LX9 A;  1VQN T;  1JJ2 S;  1V76 A;  4FSX A;  1JRI A;  4ESR A;  3FJ5 A;  4B6M A;  1G5V A;  2PUO B;  1BI1 A;  1NLP C;  3HP9 A;  1I8F A;  1YHQ A;  1IHW A;  2DXU A;  4Y91 A;  3DLM A;  2RK1 A;  3FRN A;  2GF7 A;  1PM3 A;  2F2X A;  4GY5 A;  4E7S A;  3V7S A;  1ZSZ A;  3M56 A;  1VQ8 T;  2F1L A;  2JXB A;  4PJO D;  2NLU A;  1MND A;  3QUI A;  3RKW A;  4JRI A;  1M90 C;  3GIB A;  2CKK A;  3VUB A;  1H3H A;  2L3R A;  1UB4 A;  2FYK A;  1WXB A;  2LT1 A;  2QQA A;  4C5I A;  1QP2 A;  1UUE A;  5LJ3 j;  4RTY A;  2RM4 A;  1CKA A;  2YUO A;  3OYC A;  4AFZ C;  2P0K A;  1JO8 A;  1VQ9 T;  3UT1 A;  1VQP A;  3QJY A;  2MMP A;  3KBG A;  4ZTJ A;  4LXC A;  1Q7Y R;  1VQM Q;  2C0O A;  4J9H A;  3I55 T;  4AG2 C;  1BCM A;  3P8B B;  4KUD K;  4P5N A;  3GBQ A;  1G83 A;  3PVQ A;  3HRU A;  2ZPE B;  2ZCF B;  5IXB A;  1W70 A;  1W6X A;  1ZLM A;  3C12 A;  3RKX A;  2JN0 A;  1WHG A;  5LJ5 j;  2QK0 A;  3OW2 S;  2DA9 A;  2DIL A;  4IKF A;  1EFN A;  1T0H A;  1GCP A;  1PSF A;  1YI2 T;  2A08 A;  4M7D A;  2V8I A;  3I5S A;  4HT9 A;  2ED1 A;  4GBQ A;  4J9I A;  1RI9 A;  1WYX A;  3JB9 J;  4M75 G;  1ABO A;  4BI4 A;  2RQU A;  2DRK A;  3KUF A;  4RTW A;  2R58 A;  4JRQ A;  1JXO A;  5GAM h;  5CKD A;  2EVR A;  5HKC A;  3CCU Q;  4OMF B;  3CCJ Q;  2M1H A;  5FU7 B;  4F17 A;  1IHV A;  2DPP B;  2LCL A;  1BI2 A;  4PJL A;  2MIO A;  1Q82 U;  3L42 A;  5M9O A;  2NUP A;  3M0R A;  1BCO A;  2RJE A;  3PTA A;  4C8Q E;  1OEB A;  2CZ0 B;  3CC2 Q;  2AKK A;  2EQJ A;  2K2M A;  4KH1 B;  4L59 A;  3SWN A;  1QVF S;  1WQ7 A;  1WIE A;  3L2Q A;  3HL8 A;  2OAW A;  3BDL A;  2DK3 A;  2LCC A;  5KE3 A;  3OYM A;  1ZUY A;  3SD4 A;  1R0B G;  2HZY A;  4OB1 B;  3T9N A;  1I4K 1;  3JCM h;  2O01 E;  3KXT A;  5GAN e;  5KYU A;  1TSF A;  1SEM A;  1GCQ C;  5KYU B;  1ZBJ A;  5I21 A;  1RAH B;  4L6V 5;  2BZY A;  1FYN A;  2HDA A;  4HCC A;  4FW2 A;  1TOV A;  4XK8 E;  1BI3 A;  4OMN A;  4RG2 A;  1V29 B;  2VGM A;  4C0D B;  5J3B A;  2QAZ A;  4HKE A;  1CSK A;  4JUV A;  2RQR A;  3M0S A;  1WQW A;  4LNP A;  3ZEH A;  3MEV A;  2WSE E;  2FRW A;  1SHG A;  5C6S A;  2DNU A;  1R0C B;  1VYU A;  3MET A;  3E2U A;  3A8G B;  3OMG A;  1PD0 A;  4QVZ A;  1NJI C;  3MO8 A;  4PKC C;  2RQT A;  3JB9 G;  1WPY A;  2EGE A;  3QYH B;  4A4E A;  2Y4X A;  3OYD A;  1JU5 C;  4FYY B;  1UHC A;  4HA8 A;  4C5H A;  2KQW A;  4N0A A;  3EAE A;  1TS9 A;  3R6O A;  2KNB B;  4B9W A;  4JJN K;  2RD1 A;  4C5E A;  2R5M A;  4CC2 A;  2P4T A;  2RI5 A;  4M7A D;  2CUB A;  2CRE A;  2M02 A;  5KCH A;  2O9V A;  1Q86 R;  3LW5 E;  2DD4 A;  3JCM d;  5GAN 6;  1S72 A;  1VQ6 A;  4M77 G;  5IT9 E;  4JS4 A;  2DM1 A;  2KAF A;  1JJ2 A;  2YLB A;  1VQ4 A;  4DOW A;  1D3B A;  2ZPH B;  3JCM W;  4Y28 E;  1H92 A;  1BK2 A;  3OSS C;  2F5T X;  2A3L A;  5L23 A;  3G6E T;  1D3B B;  4J7F A;  1TWB A;  5GAM f;  2CZ6 B;  2J7I A;  2MYS A;  4MDW A;  3JRZ A;  1B34 B;  5FWB A;  3EHR A;  4M75 B;  4JJD A;  2QEX Q;  3A5Z B;  2YWW A;  4KBM B;  4DBR A;  2A36 A;  5GMK j;  1YJW Q;  4C92 G;  1CKB A;  2A0F B;  4MZM A;  1JJ2 P;  3G4S Q;  4KT0 E;  4B9X A;  1X01 A;  4LD9 K;  2V26 A;  4QQG A;  1T0J A;  2V1Q A;  3G1J A;  4C8Q F;  1LOJ A;  2CT4 A;  2FPD A;  1BKB A;  5IHI A;  2QDL A;  2RB6 A;  1K0S A;  2DRM A;  4F7U E;  1RAD B;  3GLX A;  1VIF A;  2L3Q A;  5LJ5 e;  2KRM A;  3VS4 A;  2HQX A;  4OGC A;  4O5V A;  1RAI B;  3EHQ A;  3V7R A;  3CD6 Q;  2JOY A;  2HBP A;  1YIT A;  2MK5 A;  1Q95 G;  4HVW A;  3EH2 A;  3UA6 A;  4AG1 C;  4IUT A;  1MHN A;  2DVE A;  3MEA A;  2K5F A;  2ROT A;  2CGH A;  3RDV A;  1G2B A;  2PNI A;  1FMV A;  1VQ8 A;  1ZHI A;  3NTK A;  4MML A;  2KMT A;  4V2S A;  1O9S A;  3MCA B;  1X75 C;  4EMH A;  3VV0 A;  1NE8 A;  2EQK A;  3I5R A;  2K5L A;  4A63 B;  3OW2 A;  3CCS Q;  3I56 T;  2MOX A;  3M0P A;  2RF0 A;  4EMK C;  1JXM A;  2NUT A;  2RHY A;  1AWJ A;  5GAN h;  2E64 A;  2GTO A;  2L2P A;  2YUP A;  3VS2 A;  4M75 F;  2NUT B;  1T3S A;  1G8X A;  4NS5 A;  3I55 A;  2E5Q A;  2XU8 A;  1E6H A;  4XTZ A;  1I0C A;  3OYA A;  5KYN A;  3UWN A;  1ABQ A;  1MMN A;  2FEI A;  1AWO A;  1VA7 A;  3OW2 P;  4WTO B;  2K79 A;  2ZZD A;  4C8Q C;  3V8K A;  3WVD B;  2CP7 A;  3X26 B;  2VV5 A;  2PVO B;  3I35 A;  3MHX A;  4RTV A;  5KYX A;  1KG1 A;  3CCJ T;  2I0N A;  2GQV A;  3M5A A;  1KD1 C;  4E7J A;  2D9T A;  1X69 A;  2QQB A;  1G3S A;  5KYX B;  5D6X A;  4DBH A;  2KYM A;  4JRK A;  3CC4 A;  2D6F A;  2KR3 A;  2RJD A;  3S6W A;  1QVF A;  2AZS A;  1IZ6 A;  4FSS A;  3CC2 T;  2ZAE A;  3MEW A;  2LQN A;  4M78 G;  4X9D A;  1Q81 R;  3GNG A;  3HHT B;  2EFI A;  1I1J A;  4M77 A;  1LVK A;  2L5Q A;  5CKH A;  4XTU A;  4HXJ A;  2QQR A;  3O8V A;  2DER A;  1N8R C;  4OB2 B;  2KT1 A;  4M77 B;  1M3C A;  5L8R E;  3QKJ A;  4IUR A;  1OYX A;  1RLQ C;  1QVF P;  1HK9 A;  3GP8 A;  3ZFJ A;  2DET A;  5GAN d;  1KQS P;  5HK0 A;  3VYH B;  4MDX A;  2DIG A;  5DLQ E;  4ORZ A;  2GQI A;  1U1S A;  4ELY C;  3QDF A;  1YJN T;  1IXD A;  1SRL A;  2HAX A;  2E3I A;  2J6K A;  2OTL Q;  3CCM A;  2B86 A;  1EX4 A;  4C0G A;  3EG9 B;  3PNW C;  4C92 B;  2GTJ A;  5KYW A; 
#chains in the Genus database with same CATH homology
 1NJI R;  1Q82 R;  1Q86 R;  1Q81 R;  2OTJ Q;  1YI2 Q;  1VQK Q;  3I56 Q;  1W2B P;  1KD1 R;  1YIT Q;  2QEX Q;  1KQS P;  1K8A R;  1VQ5 Q;  3CCM Q;  3G71 Q;  3G6E Q;  1VQ4 Q;  3CXC P;  1Q7Y R;  3CC2 Q;  3CCU Q;  1VQM Q;  1YJW Q;  1YHQ Q;  1N8R R;  3CCJ Q;  3CCE Q;  3CD6 Q;  1YIJ Q;  3CME Q;  1VQ7 Q;  1M1K R;  2OTL Q;  2QA4 Q;  1K9M R;  1JJ2 P;  3OW2 P;  3CCL Q;  3G4S Q;  3CCS Q;  3CCV Q;  1VQ9 Q;  1M90 R;  3CC7 Q;  3CMA Q;  1YJ9 Q;  1QVG P;  1VQ8 Q;  1VQL Q;  1QVF P;  1S72 Q;  1YJN Q;  3CPW P;  1VQ6 Q;  1K73 R;  1VQN Q;  1VQO Q;  1KC8 R;  3I55 Q;  1VQP Q;  3CCQ Q;  3CCR Q;  3CC4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...