1QVGP

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1qvgP00
1KQSP 1VQ5Q 1Q7YR 1YITQ 3CCQQ 3CC7Q 1Q81R 3CCSQ 1VQKQ 3CCRQ 1YJNQ 3G4SQ 3CC2Q 3CCEQ 1N8RR 1S72Q 1KC8R 3CMAQ 1YJWQ 3I55Q 3CMEQ 3CC4Q 1VQ9Q 1VQLQ 1VQ6Q 1YJ9Q 1K9MR 3G6EQ 1VQ8Q 1VQ7Q 1VQNQ 2QA4Q 1YIJQ 1VQ4Q 1YI2Q 2OTJQ 3CCVQ 3CCMQ 2OTLQ 1W2BP 3CD6Q 3CPWP 1K73R 1VQMQ 1M1KR 1QVFP 3I56Q 3CCUQ 3OW2P 1NJIR 1M90R 1Q86R 3CXCP 1QVGP 1K8AR 2QEXQ 1VQOQ 1YHQQ 1Q82R 1KD1R 3CCLQ 1VQPQ 1JJ2P 3CCJQ 3G71Q
chains in the Genus database with same CATH superfamily
4QQDA 2DL5A 4A4GA 5IXBA 3L2QA 1T0HA 5GMKi 3VS6A 2O9SA 5CKBA 5C0MA 2A37A 2HL5C 4O6JA 1QKXA 2LCLA 2JZ2A 4XU2A 1GFCA 3CCET 2DEUA 1ZA1B 1X6BA 2JTEA 1RAGB 1VQ8A 1VQ7T 2DYBA 3HTRA 1IREB 2AIRB 4XAXB 5LJ5e 3LGFA 2OTLT 2V8KA 5KYWB 3JCMP 5IHNA 2RQVA 3EHRA 4HT8A 2FRYA 1E6HA 4J9CA 3T9NA 2ENMA 4XTZA 1D0XA 1N27A 4IUPA 3FRNA 1OZ3A 4DBFA 3REBB 2FHDA 2QTXA 5IHIA 1IGUA 3OYNA 4LDVA 3EAEA 2EQUA 4FU6A 2ZCFB 3CD6A 1Q81C 1SEMA 2LC4A 3CCLA 3PVQA 4AFUC 4M78D 4LE9A 5FU6B 5FU7C 4F17A 1X27A 4FM4B 3G6EA 3RMSA 4KT0E 1AT1B 2HL3A 1M1FA 1LJOA 1JJ2P 1N9SA 2DL4A 3OW2A 3CC7Q 2EVRA 1VQPA 1HK9A 2C0OA 3G71T 2GNCA 4E7HA 2AK5A 1RAFB 1YCYA 3N5BB 2EKOA 2VGNA 2QG9B 4ZTJA 1BU1A 1C1AA 2GTJA 5LJ3h 3H0IA 4LDUA 1Q82U 1KIKA 2FG0A 1TUCA 5LL6S 4EMGA 4V2SA 2RHZA 2YUOA 1J3TA 2HEQA 3OYDA 1QMCA 3VS2A 1ZQ1A 2RQWA 2MIOA 1VQ5A 2FYKA 3CBPA 1GCQC 3G4SA 1JXMA 1Y71A 3AT1B 5D6WA 2D0QB 3MP8A 4IUQA 5GAMh 2VXEA 2FVUA 2ABLA 2DNUA 3I5SA 2EQKA 4XU1A 2VB6A 4OB3B 2R57A 5IN1A 4OVAA 4C92F 5KCHA 3CCQQ 2CP5A 1NLPC 1YJNQ 5A0DA 3PIPA 4F7UG 1YNZA 3SWNA 1PWTA 3MKDA 1FMWA 1WNLA 2I0NA 4M75A 2BIVA 4E7SA 1WXTA 4X9CA 1N6AA 2DTHA 2OTLA 2DZ9A 4C0DB 2V8IA 1MMNA 1D3BA 1G8XA 1BI0A 4OB0B 1XOVA 4A4EA 1RAIB 1I0CA 4F04B 4HA8A 4VUBA 1VQLA 3G7ZA 2DRKA 4M7AE 1H3HA 3H0FA 1BI3A 2F69A 3SWNC 3QHSA 1TH7A 5FROA 4BD3A 1M3AA 1I8FA 4M75C 1NE8A 3ULRB 1X01A 1YITQ 4E7JA 3AHUA 3EG9A 1K0SA 4QQGA 5HKCA 5D6YA 1OPKA 3GLXA 1I4K1 4WCIA 1IB8A 1UGVA 4FYWB 4BI3A 3OW2S 4QQ6A 1JEGA 1I5LA 2DTIA 2XHCA 2CUDA 2ROTA 1LVKA 4XTVA 5GANg 1ZBXA 2QGGA 2HD0A 4LDYA 5D7UA 1JRIA 1RL2A 2A0FB 1XTDA 5I22A 5I2MA 3G71A 3VS1A 4DQ2A 1PSFA 1Z9ZA 3EFOA 1S72Q 2O01E 3H41A 3V7CA 4BE0A 4RTTA 1QVFS 1BK2A 1ZX6A 2KVQG 2L0AA 4MMLA 1TUGB 3X24B 2RHIA 2KNBB 3EFSA 4IKFA 2PVOB 1G3YA 1RI9A 1P92A 2RH2A 3V8LA 1XJWB 1YJ9T 1KHIA 2LRQA 2VASA 4RMOA 3VS5A 5LJ3d 1AWWA 4PJOG 1HSQA 4QVCA 4ZN1A 1OYXA 1TXQA 3V8KA 2FO0A 4M75G 3QXEB 3OA6A 2J7IA 3SDZA 1ABQA 2ZPHB 5GAN6 1GBRA 4OB2B 1XNIA 3I9QA 3OQ5A 3H6ZA 4FW1A 3CCEQ 1PC0A 2HAXA 3RKXA 5GAN4 2HQXA 3TREA 1W2BS 2DE0X 4PJJA 3SEMA 2OAWA 3JB9G 1VQ7Q 1KG1A 5GAMd 4EPCA 2H3EB 5GAOl 2EFIA 2MK5A 4A63B 3QPHA 5A2QE 1VQNT 2M51A 3CBMA 1RI0A 3JCMh 1BI2A 5I21A 2MWPA 3QKJA 4MZPA 3M0TA 3FC3A 4PKCC 1QVGA 3CPFA 4KH0B 3JAME 3GNGA 2DJZA 3JB9I 2X4JA 3HRTA 4ATOA 4EMKB 2R5MA 2FZCB 4Y91A 1I07A 2VWFA 1MMAA 1QW1A 3OMGA 3RMQA 2QA4T 1U06A 2EGCA 2P84A 4JRIA 1T3LA 2KT1A 1D1AA 4JPBW 5LJ3f 2FPDA 5CCAA 1LOJA 2DTOA 2QXFA 4J8OA 2RHUA 4JRPA 2C0IA 1HXDA 1U3OA 4BY6B 4BACA 1BIAA 2LCCA 1Q82C 3CXCP 4JLIA 2LT4A 2ZPBB 4MDWA 1HJDA 1ZA2B 5GAMf 2DL7A 1TSFA 3LX7A 1KC8R 4M7AA 1OU8A 5L8RE 1M8MA 2ED1A 1V1CA 3H0HA 3CCRA 2DXTA 3LW5E 3P8HA 2MMPA 1BCOA 4LNPA 1VYVA 5IT9E 1FWZA 2VV5A 1NJIR 4BDZA 2MWOA 1RACB 4HCKA 3CCVT 4GLMA 3REAB 2JVVA 1AZEA 1JQQA 4FT2A 2GFAA 2KDSA 2XDDA 4OMOA 3CCST 3CC2T 2CP7A 3L2WA 2ZGWA 2HSPA 2QK0A 5LJ5h 4M7AC 3GIBA 2AKLA 4LD6A 2QEXQ 2JTMA 5M9OA 3OSSC 3QUIA 3TEEA 3CCUA 3JCMV 4B6MA 4CC7A 3GPLA 1KFZA 1NBEB 1N5ZA 3HL8A 1V29B 2VGMA 1QWEA 3ZEHA 2IVWA 2JM8A 3CC4T 2KI7A 3M57A 1K73R 2RK1A 2DRMA 1UUEA 2DBMA 4HT9A 3CCMA 4FYYB 2EYYA 1C0MA 3FB9A 2JXBA 2X51A 2NUPB 3EG0A 1YWPA 3PT9A 1TUDA 2EBPA 4M78F 2YDLA 2GBQA 3KXTA 4BE1A 4OP0A 2LTOA 4F7UB 1VQ8T 4CRIA 5FU7B 4EMKA 2EYWA 3JCMd 4A54A 5IH2A 4C8QE 3L2VA 3PGGA 2CYZB 1UGSB 4PJMA 2OX7A 1KC8U 2KROA 2ZPGB 3VJPA 2O4XB 2XKOC 2IIMA 1H92A 3J80E 2KAFA 3C95A 3OYFA 2RJCA 4M7AG 4KBMB 2QYZA 2CSQA 1NJIU 1OV3A 1VQMQ 1TWBA 1UG1A 2DA9A 2QTVA 4EIKA 3TSZA 4CC4B 1TTHB 2JMCA 4QKUA 3RR6A 2DEQA 2P4RA 3G1JA 3A8MB 4M7DE 3L42A 4RG8A 1WJQA 5GMKj 1CKAA 2LT1A 2LDMA 4FYXB 4FSXA 3G6ET 3FDRA 1Q86R 1QVGP 3CCVA 1WXUA 2XD0A 1YJ9Q 3DKMA 3JCMQ 1KK7A 5KE2A 3JCMJ 3QG1A 1VQPT 4BY6C 1Q95G 1NEGA 3JCMf 1LNXA 2DM1A 2M0OA 1K73U 2KMTA 3BW1A 2RHXA 4NL3A 4MMKA 3E9GA 3GP8A 2YRDA 4JS4A 3I56A 3LGLA 1GRIA 4C5HA 1OULA 1I81A 3VYGA 2JJ9A 2XMFA 1Y07A 3M5AA 2P0PA 2VVKA 2DL3A 1M2VB 2QQRA 1VQ5T 2KYMA 3X26B 1ZHIA 1VQNQ 4A4FA 5LJ5d 3M4YA 5I11A 3CC4A 3M53A 1SHFA 3QJYA 5C6SA 1JJ2S 5GMKe 5CKFA 2ZAEA 2W10A 2GF7A 3M54A 3GBQA 3C94A 5KYXB 4J9BA 2E64A 3SWNB 2XU8A 1YHQA 1ZSGA 2HQEA 5CO7A 1YN8A 3L2ZA 2CUBA 5J26A 3SD4A 4M75B 3V7RA 5FW9A 3WVEB 2QA4Q 1ACMB 4M77E 2NUPA 2LX7A 3O8VA 4X34A 2MCNA 3QDFA 2OJ2A 2K9GA 2CGHA 2RPNA 2KBTA 3RUXA 5GMKl 1X43A 4JRKA 1PHTA 1D3BB 4KUDK 1VQOT 3M59A 1WXBA 4JUVA 4F7UA 1MV0B 2EIFA 3RIRA 3P8BB 2M16A 3NMZC 1JBMA 2LX9A 2EPDA 4AMCA 3JV3A 1VQLT 1UGRB 1Q86U 4NL2A 2DF6A 2O4XA 3EG9B 4BI8B 4BUGA 2K5FA 3SB2A 2QQ9A 3EHQA 5A0LA 1WHGA 3EG2A 5LJ5f 1JU5C 1K9AA 1VQ6Q 1VA7A 4ME7A 4LDXA 2FPFA 2DL8A 2LNVA 1S1NA 1VQ9A 1ARKA 2A7YA 3QBYA 4PFPA 4FCYA 2RQUA 3VS7A 2DJQA 3A98A 3CQTA 2LJ0A 1PKTA 2X4YA 1GL5A 3S6WA 3EFOB 5GAOq 3QWXX 2JOYA 1Y96A 2IPOB 4ZTFA 2DD5A 3CCSQ 3CC2Q 1GCQA 5J3BA 1Z9QA 2VXFA 4HVWA 1AD5A 1QCOA 2L3PA 5CKEA 3DB3A 1YIJQ 2DIQA 2KK4A 1Y57A 1N9RA 2XG8D 1VYTA 3UWNA 1KSWA 1GCPA 4HCZA 2J6FA 2CS7A 2PVDB 3I55A 3A1PA 2DK3A 1M2VA 5HCKA 4JJNK 5DLOA 4D6WA 2D8JA 2DVEA 1D0YA 4M7DC 3CXCA 4J7IA 4E6RA 1KC8C 2DETA 4PJOD 2WACA 5GAOr 3MP1A 2R5AA 2X9HA 1VQKT 4PJOA 1VQ8Q 1SKUB 5KYXA 4M75D 1RLQC 1MV3A 1UEBA 3EG3A 1NJIC 1TU0B 3JRZA 3MJXA 2JNGA 5CKDA 1M90R 1M5Q1 4J9IA 2KEAA 2RD1A 5GANj 2K5IA 3CPWA 2CP6A 1IHVA 2O9VA 3UA6A 1UDLA 1AOJA 3A8GB 2NLUA 1R77A 3JB9D 1VQOA 3VKIA 2COWA 4PLLA 4C92E 3OS5A 4DBRA 1MMDA 4AG2C 1YBYA 2CP3A 3RBBB 4BE2A 1NPRA 3CD6Q 3TU4K 2K3XA 2B86A 2NYSA 3NGPA 4PJOC 2GQVA 4OGEA 4E7LA 4C8QG 2KY9A 1FX7A 3CCLQ 1UJYA 1D09B 1DJ7B 3INZA 3UA7A 1UJ0A 3JCMb 2KQWA 2E10A 4HVUA 4AFQC 3CCJA 2BUDA 4GLKA 1WHLA 1WQ7A 4C0ZA 2VKNA 3G6EQ 1VYUA 1IO6A 2QAZA 1K73C 1UFFA 1PD0A 4R0KA 1M1KR 4LUDA 2LQ8A 4A4HA 5CR2A 4LXCA 3SHWA 1VQPQ 1VIEA 4M7AB 5GAN8 4M7DG 1M3BA 5GANe 3BY7A 1JXOA 3V8JA 3OBWA 3QDRB 2NUTA 2X4XA 2HDAA 4FSSA 5FWBA 3L2UA 3OB9A 2Y4XA 4M77C 3CCRT 1RADB 1X69A 2CP0A 5CAIA 4PLIA 1VQ4A 3R6OA 2K3BA 1PRMC 4XTUA 3M9QA 2JT4A 1MNDA 3EGUA 1VQ5Q 4ZGDB 3OYMA 2MI6A 2RI5A 3G4SQ 1AZGB 1WPYA 4DOWA 2FRWA 2VC8A 2YUQA 1ZUUA 3FIFA 3UT1A 2L3QA 2HKNA 3CXCS 1VIFA 2EGAA 1YWOA 1M90U 4IUVA 3WXMB 3JCMX 2JMAA 2IG0A 2BZYA 3M4GA 3FJ5A 1PG5B 2MF2A 3CCUT 4OMLA 5GAN7 3A8HB 4KGXB 1KQ1A 3X20B 2G6FX 1VQKA 4E7ZA 4AFSC 3HHTB 2OTLQ 1Q86C 2JW4A 4WTOB 2M02A 3PNWC 1WJSA 5GJVB 3VS3A 3PMTA 3CCMT 2A3LA 3JCMW 4XTXA 4CI0C 4UC4A 1VQLQ 4M77G 1QP2A 4P5NA 3CMAA 2K57A 1YJWA 3OYJA 2PUKB 1M1KU 1Y7XA 5LJ3g 3C12A 1ZBJA 1YI2T 2LCSA 3BE3A 4IUTA 2O88A 2RI3A 1B07A 2XDBA 4XTWA 3PE0A 1H8KA 1KQSA 2EJGA 4OMFB 1ZSZA 2CH4W 3MEWA 4ZGJB 1MMGA 5GAMg 1IHWA 1LPLA 1UB4A 2E41A 2XDPA 3E19A 3QO3A 1K0XA 4C5IA 2V1RA 1KD1R 3UPUA 4C92A 1X2KA 1W70A 3NTKA 4X9DA 3G71Q 1NPPA 2KSSA 3QYHB 4M7AD 2HBPA 1D0ZA 3FJPA 3JB9H 5GMKh 2HBWA 1AWXA 1WHHA 4HXJA 1ZSZC 2ZPFB 3TCJA 3LH0A 3CPWP 4B9XA 1OI1A 5GJWB 1HD3A 3PMIA 1QVPA 1HYOA 1Q7YR 1QLYA 4IIOA 2D8HA 2ESWA 4C92C 1KJWA 3LYIA 3U23A 4RG2A 2KXCA 2E65A 2HMAA 2J06A 1AWJA 1BCMA 1FMKA 3CMEA 5GAOp 4J9FA 2E5KA 4Z8AA 3UATA 3H9NA 4EMHA 2OTJA 2CKKA 2CZ6B 2YLCA 5GAOn 3I56T 3OYYA 4JZ3A 2JM9A 4F7UF 3OYCA 4K11A 4ZGEB 1UECA 4PJNA 4RKUE 2QGFB 3M55A 2CZ1B 2LMJA 4RCCA 1G3SA 4Y92A 1QVGS 3HRSA 5CK9A 4J83A 2H8HA 4HCBA 2P0KA 1H641 3MCAB 3I35A 4YTLA 3HPWA 2K6DA 1B34B 3BFMA 3GNFB 2RI2A 1ZLMA 3OYIA 4Y28E 2AZSA 4KULA 3LWHA 1YHQT 4N4GA 1ZUKA 2WSEE 4A53A 2DD4A 2YT6A 2DERA 1U1SA 1KQ2A 1MUZA 3I5RA 4IUUA 2FEIA 1QWFA 3OYBA 3NTHA 4Z89A 1KD1U 4DEYA 1YI2A 2ZPEB 2ZZDA 1IGQA 4JJBA 2K2MA 5D6XA 2OI3A 4C92G 3ZBDA 2RNAA 4C5EA 1ZUYA 2FZGB 2DBKA 2K5LA 1M27C 2HQHA 3ER0A 4DBQA 3FEOA 1GBQA 3RKWA 1PRLC 1SRLA 2QQSA 3ME9A 3CEYA 1BYMA 3MPUB 4M78E 3VS4A 2CT4A 3QJ6A 2YXYA 4RTZA 3NPFA 3OSVA 4XK8E 2EKHA 2J6OA 5FWCA 2EQIA 1F1BB 3CCRQ 4RTWA 2H3JA 3FLGA 5GAN3 1M8VA 3D7SB 4CC2A 3NHNA 2VUBA 3DLMA 2YHTA 3E2UA 3OYAA 1VQ9T 1M90C 4OB1B 1SPKA 1WA7A 1Y96B 2EJFA 1WQWA 1AVZC 1UTIA 2W0ZA 1NG2A 3JCMg 4J7FA 2DPPB 2EGEA 2EW3A 2L8DA 1YITT 2E12A 4MDXA 4M7DB 3M0SA 1AWOA 4PJOF 5FLXE 2RMOA 3DLLA 4FL6A 2F1LA 4ELZC 3CCUQ 4M75F 3X25B 1EFNA 1NZ9A 2PVGB 1TS9A 2KXDA 1KQSP 1EX4A 3OYEA 3TVTA 3LH5A 4F16A 3H8ZA 1BIBA 3KFVA 5CQYA 2QDYB 1WFWA 2RQTA 3CC7A 2DKGA 3JB9F 2E3IA 2L3SA 3OYLA 4OF1A 1M1KC 1U8RA 1FXXA 4GY5A 3I55T 3CCMQ 1B7TA 4J9GA 2F5TX 1WIEA 1YIJA 1R0BG 5DM7R 2HZYA 3P8DA 2JS2A 1UHCA 1UE9A 4PJOB 2QDLA 1G3WA 3QYGB 1ABOA 3EH2A 1B34A 2F5KA 3EFRA 3EG1A 3MP6A 1WHMA 1AHJB 4ELYC 3J7AF 4PJLA 2P4TA 5GANh 4M4ZA 1PNJA 3C0CA 1OX8A 4PK4A 4OMQA 2EJ9A 2E6ZA 1OPLA 2DFUA 2CT3A 5KYUA 4MZMA 3CBOA 3CCQA 5KCOA 1RAAB 1YJNA 3S3MA 3O5ZA 5CVIA 2V8JA 2NWMA 3F70A 5EG2A 5LJ5g 3DB4A 4M77B 2DO3A 2COYA 3VUZA 8ATCB 1UGPB 4RTUA 4R55A 3BDLA 2GCXA 4PFZA 2CZ0B 4Z88A 3CCJT 5ECAA 1K9MR 2VYTA 3EGDB 4C8QD 2FB7A 3IQLA 3CCVQ 2HSEB 1H3ZA 4C8QA 1R0CB 2O31A 3RKYA 1D1BA 2KRMA 9ATCB 2NUTB 3JCMc 1SSHA 2GTOA 2LJ3A 1BBZA 2K79A 2V1QA 1YITA 3M0QA 5GAOm 2EYQA 4M78A 4J6XA 7AT1B 4E47A 1WLPB 4LUEA 4DA4A 2SEMA 2PNIA 4M7DD 1MHNA 3I56Q 2BTTA 4XTYA 4M7DA 1VQ4T 2WSFE 4C8QC 1R8OB 2RJEA 1OEBA 1UHFA 3RDVA 1QP3A 1N8RR 3CC4Q 4N0AA 1X2QA 1S72A 3OMCA 5KYYB 1QQJA 2K2VA 4M78C 1KD1C 4J6WA 2DVJA 1YHQQ 4RUGA 2E1HA 1QVFA 1PSEA 5DY9A 2K4YA 2KE9A 4E7KA 2YRVA 2PU9B 1GXIE 2L3RA 4RTVA 4BI4A 2KGTA 2A28A 1NM7A 4KGZB 6AT1B 5HK0A 2ED0A 3KBGA 4GBQA 5CQXA 1G2BA 3M0PA 4FW2A 4OGCA 3RESA 1VUBA 1K4US 2X3WD 4N0AC 3OY9A 2JUFA 2X3XD 2RO0A 2LJ1A 1Q7YC 4XU0A 5AYFA 2L89A 5FRNA 2JS0A 1RABB 4ESRA 2QEXT 2E5QA 1PCXA 3EGXB 1K9MU 1AEYA 2GQIA 4M7AF 4ZNXA 3CCEA 4QVZA 2DMOA 3CMAT 1YJWT 2EAYA 2XIDA 2PZ1A 5GANd 1WGSA 1VQ7A 2K7AA 2KT8A 1W2BA 1ZSZB 4M77D 4NOYA 1I1JA 2Y4YA 3RNJA 2PUOB 4M77A 2KRSA 3MEUA 4LD9K 4FIBA 1WHKA 2M9UA 1VQ9Q 4KGVB 5KYWA 1C6VX 4IIMA 1E6GA 1X6GA 4C92B 2CP2A 4M78G 1TG0A 4PNOA 1M1GA 2HKQB 2RK2A 3EGDA 1K8AR 2J05A 2MYSA 2LZ6B 3HFNA 2DIGA 4II1A 4FT4A 2K3YA 3NTIA 2DXUA 3S3OA 4JJCA 3VU3C 1N8RU 2ZPIB 3QZ9B 4AFZC 2YSQA 3TSWA 3M56A 4JLGA 2XI9A 1PD1A 2QASA 1D1CA 4MZTA 2YWWA 2L5QA 4Z02A 4BDYA 1M30A 3NFCA 1RAEB 3KUFA 4RTXA 2EWNA 1OQKA 1BI1A 2DXBA 4E7IA 2HCKA 1X75C 2FZKB 1VQMT 2YLBA 3GF5A 2ECZA 1WJRA 5GANf 1CKBA 3I55Q 4N4IA 1O9SA 3OS2A 4L6V5 3VS0A 5LJ3j 3VRZA 3CMET 1X6OA 4A4KA 3GOXA 2LVMA 4KUIA 2M0YA 3OYHA 2OTJT 3UF4A 4ANJA 2WSCE 4IURA 5KYYA 5FU6C 3URGA 2LP5A 1QCNA 2B8AA 3OS1A 5FRMA 2X35A 1GFDA 3M0RA 2KR3A 4JDSA 2AZVA 4FYVB 3CPWS 3VYHB 4F14A 3E1SA 5GAMj 5IXFA 1RUWA 4HKEA 1VQOQ 2YUNA 4DBHA 2SRCA 2QEXA 1Q81R 2D6FA 3JB9J 2RHYA 1IZ6A 4OMNA 2D1XA 4D8DA 2L2PA 2BZ8A 2D9TA 1OOTA 3VRYA 1UGQB 1MNEA 3EGXA 1K8AU 2EQMA 4C5GA 2O2OA 3OW2P 1O75A 5LJ3e 1VOMA 3C4SA 2AHJB 2ATCB 4O5VA 3CCJQ 1I5OB 2QI2A 1G83A 1FYNA 4KH1B 1CSKA 2MAMA 1QCFA 4L59A 1M9SA 5EC7A 4DEXA 3M0UA 4J9DA 1WZOA 4JJDA 1OX9A 5CIUA 1IRXA 1QVFP 4C92D 3M58A 4C0GA 2DILA 1OU9A 5GAMe 4WF2A 2CDTA 4E2FB 1WYXA 2LQWA 2X4WA 2HNIA 4RTYA 4XQ3A 1EIFA 4QW2A 2DXCA 2MOXA 1A0NB 2XK0A 4OMMA 3A8OB 5AT1B 1VQ4Q 2PQWA 3LLRA 2C06A 3OBYA 3VV0A 5KH6A 2D0NA 1NYFA 4ZN3A 4C0DC 3THKA 2E70A 1E7OA 1RLPC 1VQMA 1NYGA 3PTAA 1SRMA 2F2VA 2OAUA 4LDWA 5I2SA 3MEAA 4J9HA 4HVVA 5GMKm 1JB0E 1VQ6T 3JSCA 4D8KA 2RQRA 1W2BP 4LN2A 3UDCA 2C0TA 3VUBA 2Z0WA 4JZ4A 5A0GA 1YCSB 1RAHB 1FMVA 4R56A 1Q81U 2R58A 5DLQE 3E9FA 2PTKA 2P0QA 2QQBA 1VQKQ 1YP5A 2GGRA 1YJ9A 2LQNA 1OZ2A 1K9MC 4JRQA 4EDUA 3CC7T 3HSBA 4AG1C 4L5GA 3J81E 4B9WA 1PM3A 2E4HA 2E6NA 3QZ5B 3META 2DX1A 5HK3A 4JS5A 1LCKA 1BKBA 3R6NA 1SSFA 1YIJT 5GAN2 1W1FA 1W4SA 2CSIA 2EYZA 1T0JA 1V76A 2EQJA 2A08A 1U5SA 2I2LA 1IXDA 3CMAQ 1YJWQ 5IHKA 2LNHB 1WHJA 4Q5WA 3WVDB 4F7UE 2DLPA 3V7SA 1U1TA 2RJFA 4X1VA 2DAQA 4PL6A 2CH4A 4C8QF 2BKDN 1VQNA 1BB9A 2FL7A 1KQSS 3LWIA 4J6YA 5GAN5 5KYUB 3HRUA 2JN0A 2YRCA 2RA2A 3X28B 3OYKA 1N8RC 1JJ2A 1G5VA 3CCQT 2FPEA 2EYXA 1YJNT 2CREA 3HFOA 1M3CA 1EZZB 2JTFA 3PFSA 2QA4A 1K76A 5IAYA 2MPXC 3BDUA 4KRTA 2RB6A 4RCBA 4M7DF 2BZXA 4QT7A 1Q7YU 3MO8A 2CZ7B 2DYIA 3ZFJA 3PIOA 4AT1B 4C8QB 1K1ZA 4HCCA 4PFOA 3Q1JA 3EH1A 2GFUA 3L1AA 1QKWA 1W6XA 2F2WA 5KYNA 8AT1B 2QQAA 2BE7D 2BE9B 3MHXA 4CC3A 2KRNA 4OMPA 3CD6T 4J9EA 1G3TA 3SFMA 4QVDA 3OYGA 4M78B 4BB7A 4EMKC 3CCLT 3A8LB 3JCMe 2YUPA 3CMEQ 1SF9A 3MEVA 3TQ7P 3RERA 1MGQA 4XU3A 1VQ6A 2OTJQ 2RN8A 2NUZA 2G3RA 2ROLA 3HP9A 1B3QA 4DOVA 2AT1B 3A5ZB 2KYBA 2RJDA 3QWYA 4TVRA 3QIIA 1SG5A 4J5YA 2Y90A 2M1HA 3PVLA 3L2RA 1TOVA 2XICA 2J6KA 5J39A 3S3NA 1WDXA 2RF0A 2DZCA 1M4ZA 3CCSA 3CC2A 2RM4A 1NEBA 1NLOC 4C0FA 1WX6A 5CKHA 1S72T 5LJ5j 2AKKA 1K8AC 4PJOE 3QSUA 1KHCA 5KE3A 4ORZA 1M2OA 4NS5A 4M75E 5HY6A 1SHGA 2LQKA 4M77F 1PKSA 2A36A 4N4HA 1JO8A 3ASKA 3ZL7C 3G4ST 1Y0MA 2V26A 1T3SA 1YFNA 3HKSA 2E3HA 1YI2Q 3OS0A 5L23A 1WI7A 2F2XA 1XQHA 1Q82R 2COZA
chains in the Genus database with same CATH topology
1KQSP 1VQ5Q 1Q7YR 1YITQ 3CCQQ 3CC7Q 1Q81R 3CCSQ 1VQKQ 3CCRQ 1YJNQ 3G4SQ 3CC2Q 3CCEQ 1N8RR 1S72Q 1KC8R 3CMAQ 1YJWQ 3I55Q 3CMEQ 3CC4Q 1VQ9Q 1VQLQ 1VQ6Q 1YJ9Q 1K9MR 3G6EQ 1VQ8Q 1VQ7Q 1VQNQ 2QA4Q 1YIJQ 1VQ4Q 1YI2Q 2OTJQ 3CCVQ 3CCMQ 2OTLQ 1W2BP 3CD6Q 3CPWP 1K73R 1VQMQ 1M1KR 1QVFP 3I56Q 3CCUQ 3OW2P 1NJIR 1M90R 1Q86R 3CXCP 1QVGP 1K8AR 2QEXQ 1VQOQ 1YHQQ 1Q82R 1KD1R 3CCLQ 1VQPQ 1JJ2P 3CCJQ 3G71Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS P;  1VQ5 Q;  1Q7Y R;  1YIT Q;  3CCQ Q;  3CC7 Q;  1Q81 R;  3CCS Q;  1VQK Q;  3CCR Q;  1YJN Q;  3G4S Q;  3CC2 Q;  3CCE Q;  1N8R R;  1S72 Q;  1KC8 R;  3CMA Q;  1YJW Q;  3I55 Q;  3CME Q;  3CC4 Q;  1VQ9 Q;  1VQL Q;  1VQ6 Q;  1YJ9 Q;  1K9M R;  3G6E Q;  1VQ8 Q;  1VQ7 Q;  1VQN Q;  2QA4 Q;  1YIJ Q;  1VQ4 Q;  1YI2 Q;  2OTJ Q;  3CCV Q;  3CCM Q;  2OTL Q;  1W2B P;  3CD6 Q;  3CPW P;  1K73 R;  1VQM Q;  1M1K R;  1QVF P;  3I56 Q;  3CCU Q;  3OW2 P;  1NJI R;  1M90 R;  1Q86 R;  3CXC P;  1QVG P;  1K8A R;  2QEX Q;  1VQO Q;  1YHQ Q;  1Q82 R;  1KD1 R;  3CCL Q;  1VQP Q;  1JJ2 P;  3CCJ Q;  3G71 Q; 
#chains in the Genus database with same CATH topology
 4QQD A;  2DL5 A;  4A4G A;  5IXB A;  3L2Q A;  1T0H A;  5GMK i;  3VS6 A;  2O9S A;  5CKB A;  5C0M A;  2A37 A;  2HL5 C;  4O6J A;  1QKX A;  2LCL A;  2JZ2 A;  4XU2 A;  1GFC A;  3CCE T;  2DEU A;  1ZA1 B;  1X6B A;  2JTE A;  1RAG B;  1VQ8 A;  1VQ7 T;  2DYB A;  3HTR A;  1IRE B;  2AIR B;  4XAX B;  5LJ5 e;  3LGF A;  2OTL T;  2V8K A;  5KYW B;  3JCM P;  5IHN A;  2RQV A;  3EHR A;  4HT8 A;  2FRY A;  1E6H A;  4J9C A;  3T9N A;  2ENM A;  4XTZ A;  1D0X A;  1N27 A;  4IUP A;  3FRN A;  1OZ3 A;  4DBF A;  3REB B;  2FHD A;  2QTX A;  5IHI A;  1IGU A;  3OYN A;  4LDV A;  3EAE A;  2EQU A;  4FU6 A;  2ZCF B;  3CD6 A;  1Q81 C;  1SEM A;  2LC4 A;  3CCL A;  3PVQ A;  4AFU C;  4M78 D;  4LE9 A;  5FU6 B;  5FU7 C;  4F17 A;  1X27 A;  4FM4 B;  3G6E A;  3RMS A;  4KT0 E;  1AT1 B;  2HL3 A;  1M1F A;  1LJO A;  1JJ2 P;  1N9S A;  2DL4 A;  3OW2 A;  3CC7 Q;  2EVR A;  1VQP A;  1HK9 A;  2C0O A;  3G71 T;  2GNC A;  4E7H A;  2AK5 A;  1RAF B;  1YCY A;  3N5B B;  2EKO A;  2VGN A;  2QG9 B;  4ZTJ A;  1BU1 A;  1C1A A;  2GTJ A;  5LJ3 h;  3H0I A;  4LDU A;  1Q82 U;  1KIK A;  2FG0 A;  1TUC A;  5LL6 S;  4EMG A;  4V2S A;  2RHZ A;  2YUO A;  1J3T A;  2HEQ A;  3OYD A;  1QMC A;  3VS2 A;  1ZQ1 A;  2RQW A;  2MIO A;  1VQ5 A;  2FYK A;  3CBP A;  1GCQ C;  3G4S A;  1JXM A;  1Y71 A;  3AT1 B;  5D6W A;  2D0Q B;  3MP8 A;  4IUQ A;  5GAM h;  2VXE A;  2FVU A;  2ABL A;  2DNU A;  3I5S A;  2EQK A;  4XU1 A;  2VB6 A;  4OB3 B;  2R57 A;  5IN1 A;  4OVA A;  4C92 F;  5KCH A;  3CCQ Q;  2CP5 A;  1NLP C;  1YJN Q;  5A0D A;  3PIP A;  4F7U G;  1YNZ A;  3SWN A;  1PWT A;  3MKD A;  1FMW A;  1WNL A;  2I0N A;  4M75 A;  2BIV A;  4E7S A;  1WXT A;  4X9C A;  1N6A A;  2DTH A;  2OTL A;  2DZ9 A;  4C0D B;  2V8I A;  1MMN A;  1D3B A;  1G8X A;  1BI0 A;  4OB0 B;  1XOV A;  4A4E A;  1RAI B;  1I0C A;  4F04 B;  4HA8 A;  4VUB A;  1VQL A;  3G7Z A;  2DRK A;  4M7A E;  1H3H A;  3H0F A;  1BI3 A;  2F69 A;  3SWN C;  3QHS A;  1TH7 A;  5FRO A;  4BD3 A;  1M3A A;  1I8F A;  4M75 C;  1NE8 A;  3ULR B;  1X01 A;  1YIT Q;  4E7J A;  3AHU A;  3EG9 A;  1K0S A;  4QQG A;  5HKC A;  5D6Y A;  1OPK A;  3GLX A;  1I4K 1;  4WCI A;  1IB8 A;  1UGV A;  4FYW B;  4BI3 A;  3OW2 S;  4QQ6 A;  1JEG A;  1I5L A;  2DTI A;  2XHC A;  2CUD A;  2ROT A;  1LVK A;  4XTV A;  5GAN g;  1ZBX A;  2QGG A;  2HD0 A;  4LDY A;  5D7U A;  1JRI A;  1RL2 A;  2A0F B;  1XTD A;  5I22 A;  5I2M A;  3G71 A;  3VS1 A;  4DQ2 A;  1PSF A;  1Z9Z A;  3EFO A;  1S72 Q;  2O01 E;  3H41 A;  3V7C A;  4BE0 A;  4RTT A;  1QVF S;  1BK2 A;  1ZX6 A;  2KVQ G;  2L0A A;  4MML A;  1TUG B;  3X24 B;  2RHI A;  2KNB B;  3EFS A;  4IKF A;  2PVO B;  1G3Y A;  1RI9 A;  1P92 A;  2RH2 A;  3V8L A;  1XJW B;  1YJ9 T;  1KHI A;  2LRQ A;  2VAS A;  4RMO A;  3VS5 A;  5LJ3 d;  1AWW A;  4PJO G;  1HSQ A;  4QVC A;  4ZN1 A;  1OYX A;  1TXQ A;  3V8K A;  2FO0 A;  4M75 G;  3QXE B;  3OA6 A;  2J7I A;  3SDZ A;  1ABQ A;  2ZPH B;  5GAN 6;  1GBR A;  4OB2 B;  1XNI A;  3I9Q A;  3OQ5 A;  3H6Z A;  4FW1 A;  3CCE Q;  1PC0 A;  2HAX A;  3RKX A;  5GAN 4;  2HQX A;  3TRE A;  1W2B S;  2DE0 X;  4PJJ A;  3SEM A;  2OAW A;  3JB9 G;  1VQ7 Q;  1KG1 A;  5GAM d;  4EPC A;  2H3E B;  5GAO l;  2EFI A;  2MK5 A;  4A63 B;  3QPH A;  5A2Q E;  1VQN T;  2M51 A;  3CBM A;  1RI0 A;  3JCM h;  1BI2 A;  5I21 A;  2MWP A;  3QKJ A;  4MZP A;  3M0T A;  3FC3 A;  4PKC C;  1QVG A;  3CPF A;  4KH0 B;  3JAM E;  3GNG A;  2DJZ A;  3JB9 I;  2X4J A;  3HRT A;  4ATO A;  4EMK B;  2R5M A;  2FZC B;  4Y91 A;  1I07 A;  2VWF A;  1MMA A;  1QW1 A;  3OMG A;  3RMQ A;  2QA4 T;  1U06 A;  2EGC A;  2P84 A;  4JRI A;  1T3L A;  2KT1 A;  1D1A A;  4JPB W;  5LJ3 f;  2FPD A;  5CCA A;  1LOJ A;  2DTO A;  2QXF A;  4J8O A;  2RHU A;  4JRP A;  2C0I A;  1HXD A;  1U3O A;  4BY6 B;  4BAC A;  1BIA A;  2LCC A;  1Q82 C;  3CXC P;  4JLI A;  2LT4 A;  2ZPB B;  4MDW A;  1HJD A;  1ZA2 B;  5GAM f;  2DL7 A;  1TSF A;  3LX7 A;  1KC8 R;  4M7A A;  1OU8 A;  5L8R E;  1M8M A;  2ED1 A;  1V1C A;  3H0H A;  3CCR A;  2DXT A;  3LW5 E;  3P8H A;  2MMP A;  1BCO A;  4LNP A;  1VYV A;  5IT9 E;  1FWZ A;  2VV5 A;  1NJI R;  4BDZ A;  2MWO A;  1RAC B;  4HCK A;  3CCV T;  4GLM A;  3REA B;  2JVV A;  1AZE A;  1JQQ A;  4FT2 A;  2GFA A;  2KDS A;  2XDD A;  4OMO A;  3CCS T;  3CC2 T;  2CP7 A;  3L2W A;  2ZGW A;  2HSP A;  2QK0 A;  5LJ5 h;  4M7A C;  3GIB A;  2AKL A;  4LD6 A;  2QEX Q;  2JTM A;  5M9O A;  3OSS C;  3QUI A;  3TEE A;  3CCU A;  3JCM V;  4B6M A;  4CC7 A;  3GPL A;  1KFZ A;  1NBE B;  1N5Z A;  3HL8 A;  1V29 B;  2VGM A;  1QWE A;  3ZEH A;  2IVW A;  2JM8 A;  3CC4 T;  2KI7 A;  3M57 A;  1K73 R;  2RK1 A;  2DRM A;  1UUE A;  2DBM A;  4HT9 A;  3CCM A;  4FYY B;  2EYY A;  1C0M A;  3FB9 A;  2JXB A;  2X51 A;  2NUP B;  3EG0 A;  1YWP A;  3PT9 A;  1TUD A;  2EBP A;  4M78 F;  2YDL A;  2GBQ A;  3KXT A;  4BE1 A;  4OP0 A;  2LTO A;  4F7U B;  1VQ8 T;  4CRI A;  5FU7 B;  4EMK A;  2EYW A;  3JCM d;  4A54 A;  5IH2 A;  4C8Q E;  3L2V A;  3PGG A;  2CYZ B;  1UGS B;  4PJM A;  2OX7 A;  1KC8 U;  2KRO A;  2ZPG B;  3VJP A;  2O4X B;  2XKO C;  2IIM A;  1H92 A;  3J80 E;  2KAF A;  3C95 A;  3OYF A;  2RJC A;  4M7A G;  4KBM B;  2QYZ A;  2CSQ A;  1NJI U;  1OV3 A;  1VQM Q;  1TWB A;  1UG1 A;  2DA9 A;  2QTV A;  4EIK A;  3TSZ A;  4CC4 B;  1TTH B;  2JMC A;  4QKU A;  3RR6 A;  2DEQ A;  2P4R A;  3G1J A;  3A8M B;  4M7D E;  3L42 A;  4RG8 A;  1WJQ A;  5GMK j;  1CKA A;  2LT1 A;  2LDM A;  4FYX B;  4FSX A;  3G6E T;  3FDR A;  1Q86 R;  1QVG P;  3CCV A;  1WXU A;  2XD0 A;  1YJ9 Q;  3DKM A;  3JCM Q;  1KK7 A;  5KE2 A;  3JCM J;  3QG1 A;  1VQP T;  4BY6 C;  1Q95 G;  1NEG A;  3JCM f;  1LNX A;  2DM1 A;  2M0O A;  1K73 U;  2KMT A;  3BW1 A;  2RHX A;  4NL3 A;  4MMK A;  3E9G A;  3GP8 A;  2YRD A;  4JS4 A;  3I56 A;  3LGL A;  1GRI A;  4C5H A;  1OUL A;  1I81 A;  3VYG A;  2JJ9 A;  2XMF A;  1Y07 A;  3M5A A;  2P0P A;  2VVK A;  2DL3 A;  1M2V B;  2QQR A;  1VQ5 T;  2KYM A;  3X26 B;  1ZHI A;  1VQN Q;  4A4F A;  5LJ5 d;  3M4Y A;  5I11 A;  3CC4 A;  3M53 A;  1SHF A;  3QJY A;  5C6S A;  1JJ2 S;  5GMK e;  5CKF A;  2ZAE A;  2W10 A;  2GF7 A;  3M54 A;  3GBQ A;  3C94 A;  5KYX B;  4J9B A;  2E64 A;  3SWN B;  2XU8 A;  1YHQ A;  1ZSG A;  2HQE A;  5CO7 A;  1YN8 A;  3L2Z A;  2CUB A;  5J26 A;  3SD4 A;  4M75 B;  3V7R A;  5FW9 A;  3WVE B;  2QA4 Q;  1ACM B;  4M77 E;  2NUP A;  2LX7 A;  3O8V A;  4X34 A;  2MCN A;  3QDF A;  2OJ2 A;  2K9G A;  2CGH A;  2RPN A;  2KBT A;  3RUX A;  5GMK l;  1X43 A;  4JRK A;  1PHT A;  1D3B B;  4KUD K;  1VQO T;  3M59 A;  1WXB A;  4JUV A;  4F7U A;  1MV0 B;  2EIF A;  3RIR A;  3P8B B;  2M16 A;  3NMZ C;  1JBM A;  2LX9 A;  2EPD A;  4AMC A;  3JV3 A;  1VQL T;  1UGR B;  1Q86 U;  4NL2 A;  2DF6 A;  2O4X A;  3EG9 B;  4BI8 B;  4BUG A;  2K5F A;  3SB2 A;  2QQ9 A;  3EHQ A;  5A0L A;  1WHG A;  3EG2 A;  5LJ5 f;  1JU5 C;  1K9A A;  1VQ6 Q;  1VA7 A;  4ME7 A;  4LDX A;  2FPF A;  2DL8 A;  2LNV A;  1S1N A;  1VQ9 A;  1ARK A;  2A7Y A;  3QBY A;  4PFP A;  4FCY A;  2RQU A;  3VS7 A;  2DJQ A;  3A98 A;  3CQT A;  2LJ0 A;  1PKT A;  2X4Y A;  1GL5 A;  3S6W A;  3EFO B;  5GAO q;  3QWX X;  2JOY A;  1Y96 A;  2IPO B;  4ZTF A;  2DD5 A;  3CCS Q;  3CC2 Q;  1GCQ A;  5J3B A;  1Z9Q A;  2VXF A;  4HVW A;  1AD5 A;  1QCO A;  2L3P A;  5CKE A;  3DB3 A;  1YIJ Q;  2DIQ A;  2KK4 A;  1Y57 A;  1N9R A;  2XG8 D;  1VYT A;  3UWN A;  1KSW A;  1GCP A;  4HCZ A;  2J6F A;  2CS7 A;  2PVD B;  3I55 A;  3A1P A;  2DK3 A;  1M2V A;  5HCK A;  4JJN K;  5DLO A;  4D6W A;  2D8J A;  2DVE A;  1D0Y A;  4M7D C;  3CXC A;  4J7I A;  4E6R A;  1KC8 C;  2DET A;  4PJO D;  2WAC A;  5GAO r;  3MP1 A;  2R5A A;  2X9H A;  1VQK T;  4PJO A;  1VQ8 Q;  1SKU B;  5KYX A;  4M75 D;  1RLQ C;  1MV3 A;  1UEB A;  3EG3 A;  1NJI C;  1TU0 B;  3JRZ A;  3MJX A;  2JNG A;  5CKD A;  1M90 R;  1M5Q 1;  4J9I A;  2KEA A;  2RD1 A;  5GAN j;  2K5I A;  3CPW A;  2CP6 A;  1IHV A;  2O9V A;  3UA6 A;  1UDL A;  1AOJ A;  3A8G B;  2NLU A;  1R77 A;  3JB9 D;  1VQO A;  3VKI A;  2COW A;  4PLL A;  4C92 E;  3OS5 A;  4DBR A;  1MMD A;  4AG2 C;  1YBY A;  2CP3 A;  3RBB B;  4BE2 A;  1NPR A;  3CD6 Q;  3TU4 K;  2K3X A;  2B86 A;  2NYS A;  3NGP A;  4PJO C;  2GQV A;  4OGE A;  4E7L A;  4C8Q G;  2KY9 A;  1FX7 A;  3CCL Q;  1UJY A;  1D09 B;  1DJ7 B;  3INZ A;  3UA7 A;  1UJ0 A;  3JCM b;  2KQW A;  2E10 A;  4HVU A;  4AFQ C;  3CCJ A;  2BUD A;  4GLK A;  1WHL A;  1WQ7 A;  4C0Z A;  2VKN A;  3G6E Q;  1VYU A;  1IO6 A;  2QAZ A;  1K73 C;  1UFF A;  1PD0 A;  4R0K A;  1M1K R;  4LUD A;  2LQ8 A;  4A4H A;  5CR2 A;  4LXC A;  3SHW A;  1VQP Q;  1VIE A;  4M7A B;  5GAN 8;  4M7D G;  1M3B A;  5GAN e;  3BY7 A;  1JXO A;  3V8J A;  3OBW A;  3QDR B;  2NUT A;  2X4X A;  2HDA A;  4FSS A;  5FWB A;  3L2U A;  3OB9 A;  2Y4X A;  4M77 C;  3CCR T;  1RAD B;  1X69 A;  2CP0 A;  5CAI A;  4PLI A;  1VQ4 A;  3R6O A;  2K3B A;  1PRM C;  4XTU A;  3M9Q A;  2JT4 A;  1MND A;  3EGU A;  1VQ5 Q;  4ZGD B;  3OYM A;  2MI6 A;  2RI5 A;  3G4S Q;  1AZG B;  1WPY A;  4DOW A;  2FRW A;  2VC8 A;  2YUQ A;  1ZUU A;  3FIF A;  3UT1 A;  2L3Q A;  2HKN A;  3CXC S;  1VIF A;  2EGA A;  1YWO A;  1M90 U;  4IUV A;  3WXM B;  3JCM X;  2JMA A;  2IG0 A;  2BZY A;  3M4G A;  3FJ5 A;  1PG5 B;  2MF2 A;  3CCU T;  4OML A;  5GAN 7;  3A8H B;  4KGX B;  1KQ1 A;  3X20 B;  2G6F X;  1VQK A;  4E7Z A;  4AFS C;  3HHT B;  2OTL Q;  1Q86 C;  2JW4 A;  4WTO B;  2M02 A;  3PNW C;  1WJS A;  5GJV B;  3VS3 A;  3PMT A;  3CCM T;  2A3L A;  3JCM W;  4XTX A;  4CI0 C;  4UC4 A;  1VQL Q;  4M77 G;  1QP2 A;  4P5N A;  3CMA A;  2K57 A;  1YJW A;  3OYJ A;  2PUK B;  1M1K U;  1Y7X A;  5LJ3 g;  3C12 A;  1ZBJ A;  1YI2 T;  2LCS A;  3BE3 A;  4IUT A;  2O88 A;  2RI3 A;  1B07 A;  2XDB A;  4XTW A;  3PE0 A;  1H8K A;  1KQS A;  2EJG A;  4OMF B;  1ZSZ A;  2CH4 W;  3MEW A;  4ZGJ B;  1MMG A;  5GAM g;  1IHW A;  1LPL A;  1UB4 A;  2E41 A;  2XDP A;  3E19 A;  3QO3 A;  1K0X A;  4C5I A;  2V1R A;  1KD1 R;  3UPU A;  4C92 A;  1X2K A;  1W70 A;  3NTK A;  4X9D A;  3G71 Q;  1NPP A;  2KSS A;  3QYH B;  4M7A D;  2HBP A;  1D0Z A;  3FJP A;  3JB9 H;  5GMK h;  2HBW A;  1AWX A;  1WHH A;  4HXJ A;  1ZSZ C;  2ZPF B;  3TCJ A;  3LH0 A;  3CPW P;  4B9X A;  1OI1 A;  5GJW B;  1HD3 A;  3PMI A;  1QVP A;  1HYO A;  1Q7Y R;  1QLY A;  4IIO A;  2D8H A;  2ESW A;  4C92 C;  1KJW A;  3LYI A;  3U23 A;  4RG2 A;  2KXC A;  2E65 A;  2HMA A;  2J06 A;  1AWJ A;  1BCM A;  1FMK A;  3CME A;  5GAO p;  4J9F A;  2E5K A;  4Z8A A;  3UAT A;  3H9N A;  4EMH A;  2OTJ A;  2CKK A;  2CZ6 B;  2YLC A;  5GAO n;  3I56 T;  3OYY A;  4JZ3 A;  2JM9 A;  4F7U F;  3OYC A;  4K11 A;  4ZGE B;  1UEC A;  4PJN A;  4RKU E;  2QGF B;  3M55 A;  2CZ1 B;  2LMJ A;  4RCC A;  1G3S A;  4Y92 A;  1QVG S;  3HRS A;  5CK9 A;  4J83 A;  2H8H A;  4HCB A;  2P0K A;  1H64 1;  3MCA B;  3I35 A;  4YTL A;  3HPW A;  2K6D A;  1B34 B;  3BFM A;  3GNF B;  2RI2 A;  1ZLM A;  3OYI A;  4Y28 E;  2AZS A;  4KUL A;  3LWH A;  1YHQ T;  4N4G A;  1ZUK A;  2WSE E;  4A53 A;  2DD4 A;  2YT6 A;  2DER A;  1U1S A;  1KQ2 A;  1MUZ A;  3I5R A;  4IUU A;  2FEI A;  1QWF A;  3OYB A;  3NTH A;  4Z89 A;  1KD1 U;  4DEY A;  1YI2 A;  2ZPE B;  2ZZD A;  1IGQ A;  4JJB A;  2K2M A;  5D6X A;  2OI3 A;  4C92 G;  3ZBD A;  2RNA A;  4C5E A;  1ZUY A;  2FZG B;  2DBK A;  2K5L A;  1M27 C;  2HQH A;  3ER0 A;  4DBQ A;  3FEO A;  1GBQ A;  3RKW A;  1PRL C;  1SRL A;  2QQS A;  3ME9 A;  3CEY A;  1BYM A;  3MPU B;  4M78 E;  3VS4 A;  2CT4 A;  3QJ6 A;  2YXY A;  4RTZ A;  3NPF A;  3OSV A;  4XK8 E;  2EKH A;  2J6O A;  5FWC A;  2EQI A;  1F1B B;  3CCR Q;  4RTW A;  2H3J A;  3FLG A;  5GAN 3;  1M8V A;  3D7S B;  4CC2 A;  3NHN A;  2VUB A;  3DLM A;  2YHT A;  3E2U A;  3OYA A;  1VQ9 T;  1M90 C;  4OB1 B;  1SPK A;  1WA7 A;  1Y96 B;  2EJF A;  1WQW A;  1AVZ C;  1UTI A;  2W0Z A;  1NG2 A;  3JCM g;  4J7F A;  2DPP B;  2EGE A;  2EW3 A;  2L8D A;  1YIT T;  2E12 A;  4MDX A;  4M7D B;  3M0S A;  1AWO A;  4PJO F;  5FLX E;  2RMO A;  3DLL A;  4FL6 A;  2F1L A;  4ELZ C;  3CCU Q;  4M75 F;  3X25 B;  1EFN A;  1NZ9 A;  2PVG B;  1TS9 A;  2KXD A;  1KQS P;  1EX4 A;  3OYE A;  3TVT A;  3LH5 A;  4F16 A;  3H8Z A;  1BIB A;  3KFV A;  5CQY A;  2QDY B;  1WFW A;  2RQT A;  3CC7 A;  2DKG A;  3JB9 F;  2E3I A;  2L3S A;  3OYL A;  4OF1 A;  1M1K C;  1U8R A;  1FXX A;  4GY5 A;  3I55 T;  3CCM Q;  1B7T A;  4J9G A;  2F5T X;  1WIE A;  1YIJ A;  1R0B G;  5DM7 R;  2HZY A;  3P8D A;  2JS2 A;  1UHC A;  1UE9 A;  4PJO B;  2QDL A;  1G3W A;  3QYG B;  1ABO A;  3EH2 A;  1B34 A;  2F5K A;  3EFR A;  3EG1 A;  3MP6 A;  1WHM A;  1AHJ B;  4ELY C;  3J7A F;  4PJL A;  2P4T A;  5GAN h;  4M4Z A;  1PNJ A;  3C0C A;  1OX8 A;  4PK4 A;  4OMQ A;  2EJ9 A;  2E6Z A;  1OPL A;  2DFU A;  2CT3 A;  5KYU A;  4MZM A;  3CBO A;  3CCQ A;  5KCO A;  1RAA B;  1YJN A;  3S3M A;  3O5Z A;  5CVI A;  2V8J A;  2NWM A;  3F70 A;  5EG2 A;  5LJ5 g;  3DB4 A;  4M77 B;  2DO3 A;  2COY A;  3VUZ A;  8ATC B;  1UGP B;  4RTU A;  4R55 A;  3BDL A;  2GCX A;  4PFZ A;  2CZ0 B;  4Z88 A;  3CCJ T;  5ECA A;  1K9M R;  2VYT A;  3EGD B;  4C8Q D;  2FB7 A;  3IQL A;  3CCV Q;  2HSE B;  1H3Z A;  4C8Q A;  1R0C B;  2O31 A;  3RKY A;  1D1B A;  2KRM A;  9ATC B;  2NUT B;  3JCM c;  1SSH A;  2GTO A;  2LJ3 A;  1BBZ A;  2K79 A;  2V1Q A;  1YIT A;  3M0Q A;  5GAO m;  2EYQ A;  4M78 A;  4J6X A;  7AT1 B;  4E47 A;  1WLP B;  4LUE A;  4DA4 A;  2SEM A;  2PNI A;  4M7D D;  1MHN A;  3I56 Q;  2BTT A;  4XTY A;  4M7D A;  1VQ4 T;  2WSF E;  4C8Q C;  1R8O B;  2RJE A;  1OEB A;  1UHF A;  3RDV A;  1QP3 A;  1N8R R;  3CC4 Q;  4N0A A;  1X2Q A;  1S72 A;  3OMC A;  5KYY B;  1QQJ A;  2K2V A;  4M78 C;  1KD1 C;  4J6W A;  2DVJ A;  1YHQ Q;  4RUG A;  2E1H A;  1QVF A;  1PSE A;  5DY9 A;  2K4Y A;  2KE9 A;  4E7K A;  2YRV A;  2PU9 B;  1GXI E;  2L3R A;  4RTV A;  4BI4 A;  2KGT A;  2A28 A;  1NM7 A;  4KGZ B;  6AT1 B;  5HK0 A;  2ED0 A;  3KBG A;  4GBQ A;  5CQX A;  1G2B A;  3M0P A;  4FW2 A;  4OGC A;  3RES A;  1VUB A;  1K4U S;  2X3W D;  4N0A C;  3OY9 A;  2JUF A;  2X3X D;  2RO0 A;  2LJ1 A;  1Q7Y C;  4XU0 A;  5AYF A;  2L89 A;  5FRN A;  2JS0 A;  1RAB B;  4ESR A;  2QEX T;  2E5Q A;  1PCX A;  3EGX B;  1K9M U;  1AEY A;  2GQI A;  4M7A F;  4ZNX A;  3CCE A;  4QVZ A;  2DMO A;  3CMA T;  1YJW T;  2EAY A;  2XID A;  2PZ1 A;  5GAN d;  1WGS A;  1VQ7 A;  2K7A A;  2KT8 A;  1W2B A;  1ZSZ B;  4M77 D;  4NOY A;  1I1J A;  2Y4Y A;  3RNJ A;  2PUO B;  4M77 A;  2KRS A;  3MEU A;  4LD9 K;  4FIB A;  1WHK A;  2M9U A;  1VQ9 Q;  4KGV B;  5KYW A;  1C6V X;  4IIM A;  1E6G A;  1X6G A;  4C92 B;  2CP2 A;  4M78 G;  1TG0 A;  4PNO A;  1M1G A;  2HKQ B;  2RK2 A;  3EGD A;  1K8A R;  2J05 A;  2MYS A;  2LZ6 B;  3HFN A;  2DIG A;  4II1 A;  4FT4 A;  2K3Y A;  3NTI A;  2DXU A;  3S3O A;  4JJC A;  3VU3 C;  1N8R U;  2ZPI B;  3QZ9 B;  4AFZ C;  2YSQ A;  3TSW A;  3M56 A;  4JLG A;  2XI9 A;  1PD1 A;  2QAS A;  1D1C A;  4MZT A;  2YWW A;  2L5Q A;  4Z02 A;  4BDY A;  1M30 A;  3NFC A;  1RAE B;  3KUF A;  4RTX A;  2EWN A;  1OQK A;  1BI1 A;  2DXB A;  4E7I A;  2HCK A;  1X75 C;  2FZK B;  1VQM T;  2YLB A;  3GF5 A;  2ECZ A;  1WJR A;  5GAN f;  1CKB A;  3I55 Q;  4N4I A;  1O9S A;  3OS2 A;  4L6V 5;  3VS0 A;  5LJ3 j;  3VRZ A;  3CME T;  1X6O A;  4A4K A;  3GOX A;  2LVM A;  4KUI A;  2M0Y A;  3OYH A;  2OTJ T;  3UF4 A;  4ANJ A;  2WSC E;  4IUR A;  5KYY A;  5FU6 C;  3URG A;  2LP5 A;  1QCN A;  2B8A A;  3OS1 A;  5FRM A;  2X35 A;  1GFD A;  3M0R A;  2KR3 A;  4JDS A;  2AZV A;  4FYV B;  3CPW S;  3VYH B;  4F14 A;  3E1S A;  5GAM j;  5IXF A;  1RUW A;  4HKE A;  1VQO Q;  2YUN A;  4DBH A;  2SRC A;  2QEX A;  1Q81 R;  2D6F A;  3JB9 J;  2RHY A;  1IZ6 A;  4OMN A;  2D1X A;  4D8D A;  2L2P A;  2BZ8 A;  2D9T A;  1OOT A;  3VRY A;  1UGQ B;  1MNE A;  3EGX A;  1K8A U;  2EQM A;  4C5G A;  2O2O A;  3OW2 P;  1O75 A;  5LJ3 e;  1VOM A;  3C4S A;  2AHJ B;  2ATC B;  4O5V A;  3CCJ Q;  1I5O B;  2QI2 A;  1G83 A;  1FYN A;  4KH1 B;  1CSK A;  2MAM A;  1QCF A;  4L59 A;  1M9S A;  5EC7 A;  4DEX A;  3M0U A;  4J9D A;  1WZO A;  4JJD A;  1OX9 A;  5CIU A;  1IRX A;  1QVF P;  4C92 D;  3M58 A;  4C0G A;  2DIL A;  1OU9 A;  5GAM e;  4WF2 A;  2CDT A;  4E2F B;  1WYX A;  2LQW A;  2X4W A;  2HNI A;  4RTY A;  4XQ3 A;  1EIF A;  4QW2 A;  2DXC A;  2MOX A;  1A0N B;  2XK0 A;  4OMM A;  3A8O B;  5AT1 B;  1VQ4 Q;  2PQW A;  3LLR A;  2C06 A;  3OBY A;  3VV0 A;  5KH6 A;  2D0N A;  1NYF A;  4ZN3 A;  4C0D C;  3THK A;  2E70 A;  1E7O A;  1RLP C;  1VQM A;  1NYG A;  3PTA A;  1SRM A;  2F2V A;  2OAU A;  4LDW A;  5I2S A;  3MEA A;  4J9H A;  4HVV A;  5GMK m;  1JB0 E;  1VQ6 T;  3JSC A;  4D8K A;  2RQR A;  1W2B P;  4LN2 A;  3UDC A;  2C0T A;  3VUB A;  2Z0W A;  4JZ4 A;  5A0G A;  1YCS B;  1RAH B;  1FMV A;  4R56 A;  1Q81 U;  2R58 A;  5DLQ E;  3E9F A;  2PTK A;  2P0Q A;  2QQB A;  1VQK Q;  1YP5 A;  2GGR A;  1YJ9 A;  2LQN A;  1OZ2 A;  1K9M C;  4JRQ A;  4EDU A;  3CC7 T;  3HSB A;  4AG1 C;  4L5G A;  3J81 E;  4B9W A;  1PM3 A;  2E4H A;  2E6N A;  3QZ5 B;  3MET A;  2DX1 A;  5HK3 A;  4JS5 A;  1LCK A;  1BKB A;  3R6N A;  1SSF A;  1YIJ T;  5GAN 2;  1W1F A;  1W4S A;  2CSI A;  2EYZ A;  1T0J A;  1V76 A;  2EQJ A;  2A08 A;  1U5S A;  2I2L A;  1IXD A;  3CMA Q;  1YJW Q;  5IHK A;  2LNH B;  1WHJ A;  4Q5W A;  3WVD B;  4F7U E;  2DLP A;  3V7S A;  1U1T A;  2RJF A;  4X1V A;  2DAQ A;  4PL6 A;  2CH4 A;  4C8Q F;  2BKD N;  1VQN A;  1BB9 A;  2FL7 A;  1KQS S;  3LWI A;  4J6Y A;  5GAN 5;  5KYU B;  3HRU A;  2JN0 A;  2YRC A;  2RA2 A;  3X28 B;  3OYK A;  1N8R C;  1JJ2 A;  1G5V A;  3CCQ T;  2FPE A;  2EYX A;  1YJN T;  2CRE A;  3HFO A;  1M3C A;  1EZZ B;  2JTF A;  3PFS A;  2QA4 A;  1K76 A;  5IAY A;  2MPX C;  3BDU A;  4KRT A;  2RB6 A;  4RCB A;  4M7D F;  2BZX A;  4QT7 A;  1Q7Y U;  3MO8 A;  2CZ7 B;  2DYI A;  3ZFJ A;  3PIO A;  4AT1 B;  4C8Q B;  1K1Z A;  4HCC A;  4PFO A;  3Q1J A;  3EH1 A;  2GFU A;  3L1A A;  1QKW A;  1W6X A;  2F2W A;  5KYN A;  8AT1 B;  2QQA A;  2BE7 D;  2BE9 B;  3MHX A;  4CC3 A;  2KRN A;  4OMP A;  3CD6 T;  4J9E A;  1G3T A;  3SFM A;  4QVD A;  3OYG A;  4M78 B;  4BB7 A;  4EMK C;  3CCL T;  3A8L B;  3JCM e;  2YUP A;  3CME Q;  1SF9 A;  3MEV A;  3TQ7 P;  3RER A;  1MGQ A;  4XU3 A;  1VQ6 A;  2OTJ Q;  2RN8 A;  2NUZ A;  2G3R A;  2ROL A;  3HP9 A;  1B3Q A;  4DOV A;  2AT1 B;  3A5Z B;  2KYB A;  2RJD A;  3QWY A;  4TVR A;  3QII A;  1SG5 A;  4J5Y A;  2Y90 A;  2M1H A;  3PVL A;  3L2R A;  1TOV A;  2XIC A;  2J6K A;  5J39 A;  3S3N A;  1WDX A;  2RF0 A;  2DZC A;  1M4Z A;  3CCS A;  3CC2 A;  2RM4 A;  1NEB A;  1NLO C;  4C0F A;  1WX6 A;  5CKH A;  1S72 T;  5LJ5 j;  2AKK A;  1K8A C;  4PJO E;  3QSU A;  1KHC A;  5KE3 A;  4ORZ A;  1M2O A;  4NS5 A;  4M75 E;  5HY6 A;  1SHG A;  2LQK A;  4M77 F;  1PKS A;  2A36 A;  4N4H A;  1JO8 A;  3ASK A;  3ZL7 C;  3G4S T;  1Y0M A;  2V26 A;  1T3S A;  1YFN A;  3HKS A;  2E3H A;  1YI2 Q;  3OS0 A;  5L23 A;  1WI7 A;  2F2X A;  1XQH A;  1Q82 R;  2COZ A; 
#chains in the Genus database with same CATH homology
 1KQS P;  1VQ5 Q;  1Q7Y R;  1YIT Q;  3CCQ Q;  3CC7 Q;  1Q81 R;  3CCS Q;  1VQK Q;  3CCR Q;  1YJN Q;  3G4S Q;  3CC2 Q;  3CCE Q;  1N8R R;  1S72 Q;  1KC8 R;  3CMA Q;  1YJW Q;  3I55 Q;  3CME Q;  3CC4 Q;  1VQ9 Q;  1VQL Q;  1VQ6 Q;  1YJ9 Q;  1K9M R;  3G6E Q;  1VQ8 Q;  1VQ7 Q;  1VQN Q;  2QA4 Q;  1YIJ Q;  1VQ4 Q;  1YI2 Q;  2OTJ Q;  3CCV Q;  3CCM Q;  2OTL Q;  1W2B P;  3CD6 Q;  3CPW P;  1K73 R;  1VQM Q;  1M1K R;  1QVF P;  3I56 Q;  3CCU Q;  3OW2 P;  1NJI R;  1M90 R;  1Q86 R;  3CXC P;  1QVG P;  1K8A R;  2QEX Q;  1VQO Q;  1YHQ Q;  1Q82 R;  1KD1 R;  3CCL Q;  1VQP Q;  1JJ2 P;  3CCJ Q;  3G71 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...