1QVGP

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1qvgP00
3OW2P 3G71Q 1VQ6Q 3CCUQ 3CCJQ 3CCRQ 3CCQQ 3CXCP 1M90R 3G4SQ 1Q81R 1VQ4Q 1VQ5Q 1S72Q 1K8AR 3CC7Q 1KQSP 2OTLQ 2QA4Q 1KD1R 1QVFP 1YJWQ 3CCEQ 1VQNQ 2QEXQ 1M1KR 1VQMQ 1VQ7Q 1N8RR 3CC2Q 1QVGP 3CD6Q 2OTJQ 1Q86R 1JJ2P 3G6EQ 1VQLQ 1VQOQ 1VQPQ 1K73R 3CCLQ 1K9MR 1YJ9Q 1VQKQ 3CMEQ 1YJNQ 1YIJQ 1Q82R 1YHQQ 1W2BP 1NJIR 3CCSQ 3CMAQ 1KC8R 1VQ9Q 3I55Q 3CCMQ 3CPWP 3CCVQ 3CC4Q 1Q7YR 1VQ8Q 3I56Q 1YI2Q 1YITQ
chains in the Genus database with same CATH superfamily
2B86A 2OTLT 2DZ9A 4LUDA 4J9HA 3ZL7C 3HRUA 3E2UA 3JRZA 2M0OA 3TCJA 1VQ5Q 3C94A 3ER0A 3CCEQ 1G3YA 5J39A 2K3XA 2XU8A 1RACB 1XOVA 1OULA 2OTJQ 3S3NA 3MP6A 5CIUA 4C0FA 4BB7A 3PMTA 2KR3A 2RK1A 1Q81C 1BI3A 3OW2P 2CT4A 4OB1B 1M5Q1 3RUXA 1MNDA 4RTZA 4M7DG 2A08A 1MHNA 2QTVA 3X26B 4F04B 1N9RA 4OGCA 1AHJB 4J6WA 4M77E 5FU6C 1M9SA 3TEEA 5C6SA 1LNXA 2M51A 4JJCA 3CCQA 2C06A 1K9MR 1R77A 4E7SA 1M8VA 5CK9A 5D6WA 1NYGA 3NPFA 1VQ8Q 1Q81U 2COWA 3H6ZA 4BE1A 2F2VA 4M7DA 2RHXA 2NUPB 4GLKA 5CKFA 2EBPA 3EGDA 1D1CA 4PJLA 4FIBA 1PRLC 3M54A 1KIKA 2O88A 1K76A 2DL4A 4M78B 3OSSC 1MMGA 4L5GA 2FO0A 4Y92A 4PLIA 4DQ2A 2CYZB 5LJ3d 1Q7YC 2JNGA 1Q86R 2O2OA 2FZKB 4JJNK 2PNIA 4JZ3A 1KC8R 3OYCA 1YI2Q 3CCUQ 2L3QA 3OSVA 1NM7A 3UATA 4FYYB 1D09B 1C6VX 2RHYA 3V8JA 2XHCA 3FIFA 2DL3A 2CZ7B 2KGTA 3O5ZA 1FWZA 1Q7YU 1VA7A 4VUBA 2BE7D 3VUBA 3OMCA 2DERA 2EKHA 1PWTA 2XMFA 3D7SB 1AWOA 2IPOB 1VYUA 1WA7A 1AZGB 2AK5A 3HRSA 2COYA 4HVVA 2QYZA 2J6OA 4M75A 3UWNA 2JTEA 8AT1B 1TTHB 4FCYA 3G6EQ 2EYZA 2KRNA 5IH2A 1B7TA 4M7AE 2KEAA 3WXMB 1U1SA 3QBYA 4HT8A 7AT1B 2V8KA 2PU9B 1WGSA 3M56A 3RKYA 3VYGA 2E65A 4A63B 4C8QD 4C0ZA 3GP8A 1M3CA 1M8MA 3HTRA 3T9NA 1M30A 3AT1B 2L5QA 4CC2A 4N0AA 5D6YA 2E5QA 2AHJB 3TU4K 2FRWA 1X2KA 1UGVA 2ZPGB 2ZPEB 2XIDA 1YITQ 1WYXA 2A3LA 1ZUKA 1G83A 2CZ6B 1G2BA 3SB2A 2YRCA 4XQ3A 1BKBA 4RTYA 5L23A 1D1AA 2BUDA 2JUFA 3PT9A 5GJVB 3CCLT 4JZ4A 4C8QC 1UEBA 3MP1A 3L42A 2A36A 2DVEA 3EAEA 5I21A 2XG8D 1VYVA 2L89A 1VQ7A 2FPDA 2K3BA 2ESWA 5LL6S 4HCZA 1QVFA 1VQ7T 1E6HA 5IXBA 3ZFJA 4OB3B 3NTIA 1HYOA 2XDPA 3OYEA 2HL5C 2DJQA 1UB4A 4PJMA 4AFSC 3L2WA 3CD6Q 5GAMh 2R58A 2DXCA 2KT1A 2X3WD 2AT1B 2J6KA 2EYYA 4M77G 3RDVA 2DYBA 2ZCFB 1XQHA 3P8BB 4ZGDB 3PGGA 3CCQQ 2V26A 1VQ4Q 3WVDB 2YSQA 2LP5A 5CKDA 2LNVA 1BIBA 4KBMB 3M0PA 1K1ZA 2AZSA 1LVKA 2YRVA 4J9IA 3SFMA 1OU8A 2KY9A 1O75A 3GIBA 5LJ5d 3OY9A 5ECAA 2RMOA 2VUBA 4BE2A 4E7IA 4M77A 1I4K1 3QXEB 2D8JA 5CR2A 2AKLA 5GMKi 2RI5A 2E41A 2EVRA 3JB9I 1YN8A 3REBB 2QGGA 1UHFA 4HA8A 1M90C 3CC7T 1K8AC 1ZUUA 1IB8A 5KCHA 2D9TA 5CKBA 4CC7A 4E7ZA 3PIOA 1IO6A 1MV0B 5GAN4 4EMGA 5HCKA 3J7AF 2K7AA 2EGEA 1N9SA 4WTOB 5FU7C 4IIMA 3JB9H 2GFAA 1JJ2S 1RAAB 4C5GA 2CDTA 2LC4A 3EGXB 3PTAA 3CPWA 1S72A 2DD4A 3EHQA 1VYTA 1VQNA 3QO3A 1W4SA 1M90U 2L3PA 2K79A 2DLPA 2DRMA 3R6NA 1K8AU 4DBQA 4ZN3A 1VQNT 2JTMA 2FHDA 3OYHA 1KQSP 3SD4A 4E7JA 2RA2A 1U5SA 2E64A 1SHFA 5A0GA 2EGAA 2NUTA 1JXMA 4LDYA 1KFZA 4DBFA 3FC3A 2ZPBB 1BK2A 1VIFA 3I55Q 2L3RA 1VQ6Q 1OPLA 3JCMg 3I56Q 5GAOl 1KSWA 2VKNA 5LJ3f 3J80E 5L8RE 4JS4A 2DIGA 4OB0B 2GF7A 2QQBA 4Q5WA 4BUGA 1CKAA 1Y57A 1SPKA 2RH2A 2DM1A 3M0UA 2JM8A 5KYXB 1ZSGA 4M78E 1VQ5A 2F5KA 2I0NA 3CCEA 1WLPB 4ELYC 1VQ5T 2QAZA 3A8HB 2CGHA 2OTJA 3CCET 4OF1A 4M7AA 5KYYB 2JXBA 3LW5E 1X75C 1CKBA 2E5KA 4J83A 4PJOF 1T3SA 2KYMA 4PJOG 5GMKl 1PKTA 4X9DA 2LQ8A 4QVZA 5FLXE 4XTWA 2O9SA 2ENMA 1P92A 2CH4A 2YHTA 4JRQA 1YJWQ 2D6FA 2KMTA 3E9FA 1M1KR 1VQ8A 3TSZA 3VS4A 5IHIA 4KT0E 5GAN6 1VQ8T 4F7UG 3BY7A 3E9GA 1YJ9Q 5M9OA 5KYUB 5A0DA 1I8FA 1W70A 1QCOA 1WXUA 5CQYA 1G5VA 1U3OA 5GAMf 2OX7A 1KHCA 4C92F 2EQMA 4PLLA 3NFCA 2C0TA 3CEYA 5HK3A 3UA6A 3JCMQ 3BFMA 1PRMC 4C8QB 4RUGA 4MDXA 5HK0A 1BI1A 1IGQA 1VQPT 4LNPA 2DFUA 3X25B 1QLYA 3HFOA 1NPRA 2DA9A 4XTZA 1SSHA 1NJIR 4F7UA 3EG1A 4NOYA 2P84A 1G8XA 2E4HA 2RJEA 1G3TA 3PFSA 2H3EB 3Q1JA 4II1A 1ZA1B 1PD1A 2EQKA 3HP9A 4KRTA 4N4IA 1YI2A 3A5ZB 1VQKT 3VU3C 3OYBA 1OYXA 2DXTA 3CCUA 4LDXA 2MYSA 1YI2T 2HSPA 2FRYA 1C0MA 3THKA 1QP2A 3L2ZA 1EFNA 1N5ZA 2RHIA 4ANJA 2DIQA 1J3TA 4RCCA 3ME9A 1RI9A 1BCMA 3OYIA 2X4XA 3KXTA 1QVFS 1UJYA 1QKXA 2KXDA 3OYYA 4PNOA 3ZBDA 3JB9F 2CP2A 3L1AA 1BU1A 3TSWA 1W2BA 3SHWA 1RADB 1I07A 3DLMA 3NMZC 2O4XB 3V8KA 3A8OB 3REAB 3QYHB 4FM4B 1UFFA 1KD1C 2ZPFB 4IUPA 3UPUA 5CQXA 2Z0WA 5I11A 4X1VA 3G6ET 3QG1A 1VQOT 3KBGA 2BKDN 2QQAA 3QJYA 3PNWC 1JJ2P 2DXBA 5IXFA 4Z8AA 1E7OA 1H92A 1U06A 2PVOB 2YUQA 2X35A 1WIEA 3OYFA 1D3BB 1WNLA 1FXXA 4C92B 3M0SA 1AWJA 3LH5A 5GAN8 1KD1U 5GANe 5HKCA 3QWXX 1B3QA 1H3HA 5KYWB 5FU7B 1RAFB 4MZTA 4JRPA 2QEXQ 1QVGA 5DY9A 1YITA 3H8ZA 5GAMg 4C5HA 3LYIA 2YT6A 3FRNA 1YITT 2CUDA 1WHKA 3A1PA 1ZBXA 1SRMA 1ARKA 2DBKA 1Y0MA 2QA4T 1OEBA 3MEVA 4ZTJA 1V29B 2M02A 3P8DA 1JO8A 1D0XA 1RI0A 3JSCA 4HCKA 1EX4A 1D1BA 3A8MB 1JRIA 2KVQG 3CBMA 2KSSA 4QT7A 4X9CA 2NUPA 2F2XA 1VQLQ 4AT1B 1YIJQ 1O9SA 5J3BA 4D8DA 1VUBA 4JJBA 3CPWS 2RQUA 2VXFA 2ROTA 2IIMA 3JCMh 3CD6A 4M7DF 3CMEA 4M78A 3OB9A 4M4ZA 3CD6T 1YWOA 4RKUE 1UDLA 5GMKe 4FYXB 2L2PA 4B9WA 4QVCA 1HJDA 2DEUA 2CREA 1ZSZB 3OYNA 1NZ9A 2DETA 1N6AA 3G4SA 1K73R 1VQ4A 1YJNQ 1IRXA 3META 3X20B 4EIKA 3CCQT 1TOVA 4KGZB 1VQ4T 2F2WA 2GQVA 4HCBA 1TU0B 4A4KA 4HT9A 1R0CB 2OAUA 3TVTA 2HKQB 2VGMA 4E47A 5A2QE 1AOJA 4BY6B 2JT4A 3EFRA 4OP0A 2DVJA 2DL7A 4KGXB 4XAXB 3JCMc 3MJXA 3J81E 4L59A 2HQEA 4A4EA 2VB6A 4OMNA 2JJ9A 4KUDK 3CCJQ 2GGRA 2CP0A 3I5SA 1X6GA 2CP7A 1RAHB 4KGVB 3EG0A 2VASA 1LOJA 5LJ3e 2DL8A 1Q82C 4B6MA 5FWBA 1WJRA 1AT1B 2M1HA 3PE0A 3QDFA 5GAOm 1TG0A 2VV5A 4XTUA 4BI4A 3MEUA 4LDVA 3PMIA 4EMKA 4BDYA 2BTTA 2CS7A 3BDUA 4ME7A 1PD0A 1W6XA 4A53A 4M75G 1KQSS 1VQMQ 2G6FX 3S3MA 1N8RR 1MUZA 2EQIA 1Q82U 2EYXA 2W10A 1KQ2A 3M9QA 5GANj 2DILA 3OYLA 1K9AA 3EFSA 4E7LA 2GBQA 4J9GA 4V2SA 3OYMA 4M7DB 1YWPA 4OMQA 2V8JA 2D8HA 3VS1A 3EGDB 1XTDA 1QVFP 3BDLA 4XTVA 4AFZC 3M58A 3I55A 2ZAEA 1T0JA 4A4GA 1VQ6A 2PVGB 3I56A 5GMKm 3ULRB 1VQ6T 3I56T 2CH4W 2HAXA 2R5AA 2DK3A 1OX9A 3FLGA 5KYNA 1M2OA 3JCMJ 1YBYA 4C8QE 3CXCA 1N27A 1WDXA 2ABLA 1AVZC 2O31A 3G7ZA 1QP3A 2DO3A 1GCQA 2BZXA 1K9MC 1T3LA 4LE9A 4FSXA 3OQ5A 4E6RA 1W1FA 1Y71A 2RO0A 5GAMd 2F5TX 4RTUA 4N4GA 1OI1A 2LJ3A 3VS2A 2KNBB 3OYGA 5GMKj 3LH0A 3S6WA 1PHTA 2K2VA 1KQ1A 2RQTA 2YRDA 2ED0A 4FT2A 1M4ZA 3EFOB 2EJ9A 4IUVA 1K9MU 2F1LA 2HNIA 3H41A 4IIOA 4QVDA 2HQHA 2KBTA 1W2BS 2F69A 1YJWA 1ACMB 1WHMA 5IT9E 1YJWT 5AT1B 3NTHA 2DYIA 1YJ9A 4PJOD 4RCBA 2LQWA 4JUVA 1Q86C 2X4JA 2DBMA 1YJ9T 2B8AA 1KC8C 3JCMf 2QI2A 2RI2A 3JAME 4DEXA 3CMEQ 4RTXA 1VQ9Q 1WXBA 2DX1A 2MK5A 3CPWP 3PIPA 4XU1A 4M77F 4J9FA 3G71Q 2LRQA 2EQUA 3G4SQ 2HCKA 4ORZA 3QZ5B 2JM9A 1Q86U 4HXJA 1QVGS 1KC8U 3CPFA 2KROA 4C92E 1WPYA 4PJOC 3RKWA 4C92D 5LJ5e 3CCVQ 2J05A 1M2VB 2FPEA 4YTLA 1BCOA 3ZEHA 3CCRQ 2JS2A 1PSEA 2A37A 1GXIE 3NGPA 1U1TA 4PFPA 2CSQA 2XD0A 1QWFA 2HZYA 4OMPA 2LT4A 1K0XA 4K11A 2DE0X 1YCYA 3WVEB 3MCAB 1TXQA 3OBYA 2RD1A 5FROA 2MWPA 2J6FA 4C92C 4BI3A 4ESRA 2DTIA 4JLIA 2EKOA 1H3ZA 4MZMA 3EG9A 3SDZA 2YDLA 4F16A 4PJJA 3MKDA 2JTFA 4CC4B 3LGLA 4XTYA 5AYFA 1S72T 3JB9D 4OMOA 1T0HA 4C0DB 3PVQA 1WHJA 1I1JA 4E7KA 2YLCA 3KUFA 3RNJA 1IGUA 4O6JA 4J6XA 1NEGA 5GAOq 2COZA 2V1QA 1NBEB 2DXUA 4J7FA 2QEXA 2K2MA 1M1GA 2QEXT 4M7AF 1WHLA 2OJ2A 4M7AG 1KK7A 2HL3A 3RESA 1X27A 4TVRA 2LQNA 5I22A 3OS0A 2GNCA 1IZ6A 1PG5B 1TUCA 1PC0A 2FVUA 3L2VA 3NTKA 1ZSZC 1UGPB 3LLRA 3VJPA 1R8OB 5KYUA 2R5MA 4FYWB 1WFWA 4FW2A 1VQLA 3OYKA 4F14A 2E3IA 2CZ0B 1YIJA 2OTJT 5KH6A 3HKSA 1VQLT 4AG1C 3UF4A 1YIJT 1AZEA 2LCLA 2ZZDA 4BY6C 3CC2Q 1OX8A 4C8QA 2MWOA 1DJ7B 2QK0A 3MHXA 4FT4A 2M16A 4ZTFA 3V8LA 2EYQA 3JV3A 1Y07A 3M0QA 4RG8A 2NUTB 2ROLA 3RERA 1YJNA 2IVWA 4BI8B 1A0NB 1BYMA 1H641 4WCIA 1YJNT 5LJ5j 4LDUA 1WI7A 1MV3A 2QDLA 3EG2A 4F7UF 1LCKA 1AEYA 3CCLQ 5GAN3 4M7DE 1OV3A 1BI2A 1W2BP 1B34A 3HSBA 3C95A 2DRKA 4M7DD 3VV0A 3M4GA 4ZGJB 5CCAA 4J6YA 3QDRB 3MP8A 3U23A 1JEGA 3CXCS 5DLQE 2EGCA 2X4WA 4IUQA 2HQXA 3ASKA 1SEMA 2VC8A 2EFIA 2QTXA 4ZN1A 5EC7A 2NLUA 3CCJA 1Y96A 2YUNA 4JRKA 4A54A 5GAOp 3CCJT 3CCMQ 1YFNA 3RR6A 1XJWB 4OMMA 2QXFA 2JMCA 3L2RA 1MGQA 1NE8A 2QG9B 4KUIA 3VRYA 4JRIA 5GAN7 1I5OB 2C0OA 4MMKA 2H8HA 3FEOA 4M7DC 2KAFA 2KT8A 1MMNA 3M53A 3EH2A 2HBWA 4PFZA 1QVGP 2SRCA 1Y7XA 3CBPA 1ABOA 1M3BA 1X69A 3CCSQ 1ZA2B 2GTJA 3CCUT 3RIRA 4X34A 3FJPA 1RAEB 1VQMA 4BD3A 3GNFB 4PL6A 1D3BA 1OU9A 1Q81R 2RQRA 4OVAA 1VQMT 3RKXA 2DTHA 2RM4A 2P0PA 1QWEA 1QCNA 4XU2A 1SG5A 1M27C 3GPLA 3P8HA 1X01A 4PJOB 5KYWA 1S1NA 1BBZA 1GL5A 1QKWA 1B07A 2ATCB 3FJ5A 1KG1A 3QYGB 2EIFA 3SWNA 1M3AA 4XTXA 3VS6A 5KE3A 2LX7A 2HKNA 3HHTB 2XDBA 4IUTA 3OYAA 3C0CA 4F7UB 2MOXA 4QQDA 2GFUA 2XI9A 2P0QA 3EH1A 2D1XA 3VS7A 2E6ZA 5FWCA 1EZZB 1QVPA 2RJFA 4PFOA 4CC3A 1GCPA 3JCMd 4HKEA 3JCMW 2PUOB 3LWHA 1RLPC 1UECA 2RN8A 2DKGA 4M75C 2RPNA 1C1AA 3EG3A 4LXCA 2KK4A 3SEMA 4DEYA 1MMDA 2CSIA 4EMHA 2FL7A 1WZOA 1Q7YR 2DEQA 2YWWA 1RABB 1R0BG 1UUEA 2JW4A 2NYSA 1MNEA 4M78F 3DB4A 4M78G 1M1KU 4MDWA 3G1JA 1X2QA 4XU0A 1NJIC 2PZ1A 2MAMA 1JBMA 1SKUB 2AIRB 1QQJA 1HXDA 4N0AC 2FEIA 2J7IA 3CC4Q 3TREA 4P5NA 2PUKB 1NEBA 3LGFA 1AWXA 3M57A 1VQ9A 1JXOA 5HY6A 3CMET 4J9CA 5GAOr 1VQ9T 2FZGB 3G71A 1NJIU 1U8RA 1GRIA 1H8KA 2KYBA 1OZ3A 3G71T 3X28B 1YHQQ 1JU5C 3BE3A 4R55A 2O01E 1WHGA 3BW1A 1E6GA 1V76A 3G4ST 2LJ1A 2LZ6B 2KRSA 2K4YA 5GANh 2XK0A 4E2FB 4DBHA 1CSKA 2FZCB 1HSQA 2E70A 4GY5A 2RB6A 3CCVA 4FSSA 1JJ2A 3CCVT 4LN2A 4M77D 3CCRA 1OOTA 3CCRT 4ATOA 4UC4A 2A0FB 2OAWA 1TH7A 3CXCP 4ELZC 4Z02A 2ZGWA 4C0DC 3DKMA 5LJ5g 1VQPQ 1I0CA 5GAN5 4FU6A 1YP5A 2JOYA 1AD5A 1PKSA 1MMAA 4M77C 1WJQA 1ZUYA 2RHZA 2QDYB 4C5IA 5GAN2 4JLGA 4OMLA 1UGQB 4D6WA 1IREB 4B9XA 4ZNXA 1ZQ1A 4M75F 3AHUA 4J9BA 4GLMA 3OS5A 5GMKh 1VOMA 5D6XA 1YNZA 4BE0A 3OS2A 4LD9K 5DLOA 1VQKQ 1WJSA 3E19A 2KE9A 2RI3A 1UGRB 2OI3A 3OW2A 2K57A 1X6BA 2KXCA 3UA7A 2GCXA 2QQRA 1UHCA 2M9UA 3M0TA 3H0HA 4D8KA 2LCCA 4LUEA 2DZCA 2VWFA 4Y28E 4DA4A 3EGUA 1QCFA 2ZPIB 1X6OA 3EFOA 3I55T 1WQ7A 4AFQC 4NS5A 3V7RA 3L2UA 3I35A 3PVLA 2IG0A 1ZBJA 3CMAQ 4EPCA 3JCMP 2AKKA 3JCMX 4ZGEB 1QW1A 4J8OA 2MMPA 2A28A 3QSUA 1IXDA 5LJ3h 1K73C 2CUBA 4L6V5 3LX7A 2WSFE 3A8LB 3GLXA 2L3SA 1Z9QA 2RNAA 5GAMe 1VQOQ 4EMKB 5IAYA 1PNJA 2VVKA 4KH0B 4M7AD 5CKEA 4JDSA 1PM3A 5J26A 3CC2A 1RUWA 2EPDA 1M90R 8ATCB 1K8AR 4MZPA 2RQVA 3CC2T 1NLPC 5FW9A 4MMLA 1K0SA 1OQKA 4QW2A 5GJWB 5I2SA 4JJDA 1K73U 3E1SA 5IN1A 2V8IA 3S3OA 2HEQA 2LQKA 3OYJA 5FRMA 4OMFB 3QPHA 2K3YA 4AMCA 4HCCA 2VGNA 3URGA 9ATCB 1M2VA 3GBQA 2JS0A 4PJOE 4M75B 3V7SA 3CCLA 2OTLQ 2QA4Q 3VS3A 3LWIA 4M7AC 3DB3A 2VYTA 2DTOA 3A98A 2Y4XA 1KJWA 2PQWA 2QASA 1HD3A 2EYWA 4AFUC 4FYVB 2JZ2A 3FB9A 2MIOA 4GBQA 5KE2A 1JQQA 1TS9A 3F70A 5LJ3j 2VXEA 4F7UE 2GTOA 1N8RC 3CCMA 4QQGA 5GANf 3CCMT 3TQ7P 2DL5A 3OBWA 3VUZA 2CKKA 5A0LA 1WX6A 3OA6A 4R56A 2M0YA 3EGXA 2K5FA 2KDSA 3OS1A 2FPFA 1G3WA 3QZ9B 5CAIA 3L2QA 3CCSA 2EQJA 3UT1A 3QIIA 2KI7A 1N8RU 2E12A 2ED1A 3CCST 4Y91A 4NL2A 2E10A 2LT1A 2CT3A 2HSEB 3MPUB 2DD5A 4OGEA 2R57A 5KCOA 2Y90A 1UJ0A 3M4YA 4RTVA 2CP6A 2LNHB 2RJCA 5FU6B 2A7YA 5C0MA 2J06A 2LX9A 1ZLMA 4BDZA 3GF5A 4RMOA 5CVIA 1TWBA 2DF6A 3CC7A 2EJFA 2HBPA 4IUUA 2RQWA 2LCSA 5KYXA 3VYHB 1UTIA 3MEWA 2E6NA 2X3XD 2HD0A 2QQSA 5GAOn 1G3SA 3QJ6A 1GBRA 3V7CA 2DPPB 2DAQA 1FMVA 2I2LA 5GAMj 3UDCA 1WXTA 2XDDA 2Y4YA 4RG2A 3X24B 5KYYA 3QHSA 4DOWA 5LJ5h 2YXYA 3SWNC 4M77B 2D0QB 2LDMA 3HRTA 2WSCE 5EG2A 2H3JA 4IKFA 4E7HA 2NWMA 2G3RA 2CZ1B 4C8QF 4C8QG 1XNIA 1QMCA 3H9NA 1EIFA 3A8GB 1TUGB 2P0KA 2K5IA 4J9EA 3N5BB 6AT1B 2MCNA 3KFVA 5GANg 2L8DA 2DMOA 2MF2A 5CKHA 1NG2A 3FDRA 2QGFB 3IQLA 2YLBA 3MO8A 5D7UA 3OMGA 2PTKA 4NL3A 4RTWA 3CC4A 4HVUA 1F1BB 4PK4A 1KHIA 2L0AA 3EG9B 4O5VA 3CC4T 2CP5A 4J5YA 4A4HA 4C0GA 2SEMA 4OB2B 4M78D 1OPKA 1VIEA 2C0IA 2WSEE 5DM7R 3OW2S 3HPWA 4RTTA 2DJZA 4WF2A 1KD1R 1YHQA 4IURA 2E3HA 1D0YA 1D0ZA 1YHQT 3R6OA 1V1CA 3INZA 3JCMV 2YUOA 2V1RA 1I5LA 2BZ8A 4FL6A 4N4HA 1FMKA 1X43A 3HL8A 1YCSB 4R0KA 1KQSA 4XU3A 1AWWA 4PKCC 1ABQA 4M78C 1Z9ZA 4LDWA 4CI0C 2ZPHB 1RAIB 2EAYA 1SHGA 1VQ7Q 1RLQC 2ECZA 2HDAA 3O8VA 3H0FA 4PJOA 2KQWA 4DOVA 2XICA 2O9VA 2EJGA 1I81A 1Q95G 1NPPA 4FW1A 2MPXC 3M59A 1FYNA 1GFCA 2O4XA 2E1HA 4M7AB 4C92G 3JCMb 1VQPA 2RJDA 2RK2A 2X9HA 2X4YA 4QQ6A 3RBBB 2FB7A 3H0IA 4EDUA 2DNUA 2EW3A 1OZ2A 3JB9J 1FX7A 2XKOC 1GBQA 3QUIA 4JPBW 2JN0A 1BI0A 3CBOA 3OYDA 1BIAA 4DBRA 2K5LA 1UGSB 4A4FA 1JB0E 4JS5A 2FYKA 3EHRA 3VS0A 1NYFA 4C92A 1VQKA 3RMSA 5LJ3g 4Z89A 1SF9A 2BIVA 1B34B 2JMAA 1IHVA 4LD6A 2LJ0A 1ZHIA 4M75E 4EMKC 1BB9A 4M75D 2LVMA 2BE9B 1WQWA 4HVWA 2K9GA 1IHWA 2RF0A 4F17A 3M55A 3I9QA 3CC7Q 2NUZA 3CMAA 3JB9G 4J9DA 3VKIA 3CQTA 1Y96B 2JVVA 3NHNA 1RAGB 4J7IA 4CRIA 2EWNA 3CMAT 3QWYA 2P4RA 3GOXA 3HFNA 1UG1A 1TSFA 2QQ9A 1LJOA 3I5RA 3M0RA 3DLLA 2YUPA 1PCXA 1UE9A 3JCMe 3G6EA 5CO7A 1VQOA 1S72Q 1WHHA 1M1KC 2RHUA 1FMWA 1TUDA 2K6DA 2WACA 4C5EA 5LJ5f 5I2MA 5IHKA 1VQNQ 2P4TA 4AG2C 1GFDA 3MEAA 2X51A 3VS5A 2BZYA 5FRNA 2D0NA 2PVDB 4KULA 3RMQA 4Z88A 1Q82R 3QKJA 1ZX6A 4PJNA 1K4US 1ZSZA 2W0ZA 4XK8E 3VRZA 2HMAA 4BACA 1SRLA 5GANd 2FG0A 5IHNA 2GQIA 1GCQC 1NLOC 1PSFA 3GNGA 3C12A 1LPLA 1RL2A 1M1FA 2LMJA 1HK9A 2CP3A 2LTOA 3C4SA 3SWNB 1SSFA 3M5AA 2MI6A 4QKUA 2OTLA 2QA4A 2AZVA 2KRMA 4KH1B
chains in the Genus database with same CATH topology
3OW2P 3G71Q 1VQ6Q 3CCUQ 3CCJQ 3CCRQ 3CCQQ 3CXCP 1M90R 3G4SQ 1Q81R 1VQ4Q 1VQ5Q 1S72Q 1K8AR 3CC7Q 1KQSP 2OTLQ 2QA4Q 1KD1R 1QVFP 1YJWQ 3CCEQ 1VQNQ 2QEXQ 1M1KR 1VQMQ 1VQ7Q 1N8RR 3CC2Q 1QVGP 3CD6Q 2OTJQ 1Q86R 1JJ2P 3G6EQ 1VQLQ 1VQOQ 1VQPQ 1K73R 3CCLQ 1K9MR 1YJ9Q 1VQKQ 3CMEQ 1YJNQ 1YIJQ 1Q82R 1YHQQ 1W2BP 1NJIR 3CCSQ 3CMAQ 1KC8R 1VQ9Q 3I55Q 3CCMQ 3CPWP 3CCVQ 3CC4Q 1Q7YR 1VQ8Q 3I56Q 1YI2Q 1YITQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 P;  3G71 Q;  1VQ6 Q;  3CCU Q;  3CCJ Q;  3CCR Q;  3CCQ Q;  3CXC P;  1M90 R;  3G4S Q;  1Q81 R;  1VQ4 Q;  1VQ5 Q;  1S72 Q;  1K8A R;  3CC7 Q;  1KQS P;  2OTL Q;  2QA4 Q;  1KD1 R;  1QVF P;  1YJW Q;  3CCE Q;  1VQN Q;  2QEX Q;  1M1K R;  1VQM Q;  1VQ7 Q;  1N8R R;  3CC2 Q;  1QVG P;  3CD6 Q;  2OTJ Q;  1Q86 R;  1JJ2 P;  3G6E Q;  1VQL Q;  1VQO Q;  1VQP Q;  1K73 R;  3CCL Q;  1K9M R;  1YJ9 Q;  1VQK Q;  3CME Q;  1YJN Q;  1YIJ Q;  1Q82 R;  1YHQ Q;  1W2B P;  1NJI R;  3CCS Q;  3CMA Q;  1KC8 R;  1VQ9 Q;  3I55 Q;  3CCM Q;  3CPW P;  3CCV Q;  3CC4 Q;  1Q7Y R;  1VQ8 Q;  3I56 Q;  1YI2 Q;  1YIT Q; 
#chains in the Genus database with same CATH topology
 2B86 A;  2OTL T;  2DZ9 A;  4LUD A;  4J9H A;  3ZL7 C;  3HRU A;  3E2U A;  3JRZ A;  2M0O A;  3TCJ A;  1VQ5 Q;  3C94 A;  3ER0 A;  3CCE Q;  1G3Y A;  5J39 A;  2K3X A;  2XU8 A;  1RAC B;  1XOV A;  1OUL A;  2OTJ Q;  3S3N A;  3MP6 A;  5CIU A;  4C0F A;  4BB7 A;  3PMT A;  2KR3 A;  2RK1 A;  1Q81 C;  1BI3 A;  3OW2 P;  2CT4 A;  4OB1 B;  1M5Q 1;  3RUX A;  1MND A;  4RTZ A;  4M7D G;  2A08 A;  1MHN A;  2QTV A;  3X26 B;  4F04 B;  1N9R A;  4OGC A;  1AHJ B;  4J6W A;  4M77 E;  5FU6 C;  1M9S A;  3TEE A;  5C6S A;  1LNX A;  2M51 A;  4JJC A;  3CCQ A;  2C06 A;  1K9M R;  1R77 A;  4E7S A;  1M8V A;  5CK9 A;  5D6W A;  1NYG A;  3NPF A;  1VQ8 Q;  1Q81 U;  2COW A;  3H6Z A;  4BE1 A;  2F2V A;  4M7D A;  2RHX A;  2NUP B;  4GLK A;  5CKF A;  2EBP A;  3EGD A;  1D1C A;  4PJL A;  4FIB A;  1PRL C;  3M54 A;  1KIK A;  2O88 A;  1K76 A;  2DL4 A;  4M78 B;  3OSS C;  1MMG A;  4L5G A;  2FO0 A;  4Y92 A;  4PLI A;  4DQ2 A;  2CYZ B;  5LJ3 d;  1Q7Y C;  2JNG A;  1Q86 R;  2O2O A;  2FZK B;  4JJN K;  2PNI A;  4JZ3 A;  1KC8 R;  3OYC A;  1YI2 Q;  3CCU Q;  2L3Q A;  3OSV A;  1NM7 A;  3UAT A;  4FYY B;  1D09 B;  1C6V X;  2RHY A;  3V8J A;  2XHC A;  3FIF A;  2DL3 A;  2CZ7 B;  2KGT A;  3O5Z A;  1FWZ A;  1Q7Y U;  1VA7 A;  4VUB A;  2BE7 D;  3VUB A;  3OMC A;  2DER A;  2EKH A;  1PWT A;  2XMF A;  3D7S B;  1AWO A;  2IPO B;  1VYU A;  1WA7 A;  1AZG B;  2AK5 A;  3HRS A;  2COY A;  4HVV A;  2QYZ A;  2J6O A;  4M75 A;  3UWN A;  2JTE A;  8AT1 B;  1TTH B;  4FCY A;  3G6E Q;  2EYZ A;  2KRN A;  5IH2 A;  1B7T A;  4M7A E;  2KEA A;  3WXM B;  1U1S A;  3QBY A;  4HT8 A;  7AT1 B;  2V8K A;  2PU9 B;  1WGS A;  3M56 A;  3RKY A;  3VYG A;  2E65 A;  4A63 B;  4C8Q D;  4C0Z A;  3GP8 A;  1M3C A;  1M8M A;  3HTR A;  3T9N A;  1M30 A;  3AT1 B;  2L5Q A;  4CC2 A;  4N0A A;  5D6Y A;  2E5Q A;  2AHJ B;  3TU4 K;  2FRW A;  1X2K A;  1UGV A;  2ZPG B;  2ZPE B;  2XID A;  1YIT Q;  1WYX A;  2A3L A;  1ZUK A;  1G83 A;  2CZ6 B;  1G2B A;  3SB2 A;  2YRC A;  4XQ3 A;  1BKB A;  4RTY A;  5L23 A;  1D1A A;  2BUD A;  2JUF A;  3PT9 A;  5GJV B;  3CCL T;  4JZ4 A;  4C8Q C;  1UEB A;  3MP1 A;  3L42 A;  2A36 A;  2DVE A;  3EAE A;  5I21 A;  2XG8 D;  1VYV A;  2L89 A;  1VQ7 A;  2FPD A;  2K3B A;  2ESW A;  5LL6 S;  4HCZ A;  1QVF A;  1VQ7 T;  1E6H A;  5IXB A;  3ZFJ A;  4OB3 B;  3NTI A;  1HYO A;  2XDP A;  3OYE A;  2HL5 C;  2DJQ A;  1UB4 A;  4PJM A;  4AFS C;  3L2W A;  3CD6 Q;  5GAM h;  2R58 A;  2DXC A;  2KT1 A;  2X3W D;  2AT1 B;  2J6K A;  2EYY A;  4M77 G;  3RDV A;  2DYB A;  2ZCF B;  1XQH A;  3P8B B;  4ZGD B;  3PGG A;  3CCQ Q;  2V26 A;  1VQ4 Q;  3WVD B;  2YSQ A;  2LP5 A;  5CKD A;  2LNV A;  1BIB A;  4KBM B;  3M0P A;  1K1Z A;  2AZS A;  1LVK A;  2YRV A;  4J9I A;  3SFM A;  1OU8 A;  2KY9 A;  1O75 A;  3GIB A;  5LJ5 d;  3OY9 A;  5ECA A;  2RMO A;  2VUB A;  4BE2 A;  4E7I A;  4M77 A;  1I4K 1;  3QXE B;  2D8J A;  5CR2 A;  2AKL A;  5GMK i;  2RI5 A;  2E41 A;  2EVR A;  3JB9 I;  1YN8 A;  3REB B;  2QGG A;  1UHF A;  4HA8 A;  1M90 C;  3CC7 T;  1K8A C;  1ZUU A;  1IB8 A;  5KCH A;  2D9T A;  5CKB A;  4CC7 A;  4E7Z A;  3PIO A;  1IO6 A;  1MV0 B;  5GAN 4;  4EMG A;  5HCK A;  3J7A F;  2K7A A;  2EGE A;  1N9S A;  4WTO B;  5FU7 C;  4IIM A;  3JB9 H;  2GFA A;  1JJ2 S;  1RAA B;  4C5G A;  2CDT A;  2LC4 A;  3EGX B;  3PTA A;  3CPW A;  1S72 A;  2DD4 A;  3EHQ A;  1VYT A;  1VQN A;  3QO3 A;  1W4S A;  1M90 U;  2L3P A;  2K79 A;  2DLP A;  2DRM A;  3R6N A;  1K8A U;  4DBQ A;  4ZN3 A;  1VQN T;  2JTM A;  2FHD A;  3OYH A;  1KQS P;  3SD4 A;  4E7J A;  2RA2 A;  1U5S A;  2E64 A;  1SHF A;  5A0G A;  2EGA A;  2NUT A;  1JXM A;  4LDY A;  1KFZ A;  4DBF A;  3FC3 A;  2ZPB B;  1BK2 A;  1VIF A;  3I55 Q;  2L3R A;  1VQ6 Q;  1OPL A;  3JCM g;  3I56 Q;  5GAO l;  1KSW A;  2VKN A;  5LJ3 f;  3J80 E;  5L8R E;  4JS4 A;  2DIG A;  4OB0 B;  2GF7 A;  2QQB A;  4Q5W A;  4BUG A;  1CKA A;  1Y57 A;  1SPK A;  2RH2 A;  2DM1 A;  3M0U A;  2JM8 A;  5KYX B;  1ZSG A;  4M78 E;  1VQ5 A;  2F5K A;  2I0N A;  3CCE A;  1WLP B;  4ELY C;  1VQ5 T;  2QAZ A;  3A8H B;  2CGH A;  2OTJ A;  3CCE T;  4OF1 A;  4M7A A;  5KYY B;  2JXB A;  3LW5 E;  1X75 C;  1CKB A;  2E5K A;  4J83 A;  4PJO F;  1T3S A;  2KYM A;  4PJO G;  5GMK l;  1PKT A;  4X9D A;  2LQ8 A;  4QVZ A;  5FLX E;  4XTW A;  2O9S A;  2ENM A;  1P92 A;  2CH4 A;  2YHT A;  4JRQ A;  1YJW Q;  2D6F A;  2KMT A;  3E9F A;  1M1K R;  1VQ8 A;  3TSZ A;  3VS4 A;  5IHI A;  4KT0 E;  5GAN 6;  1VQ8 T;  4F7U G;  3BY7 A;  3E9G A;  1YJ9 Q;  5M9O A;  5KYU B;  5A0D A;  1I8F A;  1W70 A;  1QCO A;  1WXU A;  5CQY A;  1G5V A;  1U3O A;  5GAM f;  2OX7 A;  1KHC A;  4C92 F;  2EQM A;  4PLL A;  3NFC A;  2C0T A;  3CEY A;  5HK3 A;  3UA6 A;  3JCM Q;  3BFM A;  1PRM C;  4C8Q B;  4RUG A;  4MDX A;  5HK0 A;  1BI1 A;  1IGQ A;  1VQP T;  4LNP A;  2DFU A;  3X25 B;  1QLY A;  3HFO A;  1NPR A;  2DA9 A;  4XTZ A;  1SSH A;  1NJI R;  4F7U A;  3EG1 A;  4NOY A;  2P84 A;  1G8X A;  2E4H A;  2RJE A;  1G3T A;  3PFS A;  2H3E B;  3Q1J A;  4II1 A;  1ZA1 B;  1PD1 A;  2EQK A;  3HP9 A;  4KRT A;  4N4I A;  1YI2 A;  3A5Z B;  1VQK T;  3VU3 C;  3OYB A;  1OYX A;  2DXT A;  3CCU A;  4LDX A;  2MYS A;  1YI2 T;  2HSP A;  2FRY A;  1C0M A;  3THK A;  1QP2 A;  3L2Z A;  1EFN A;  1N5Z A;  2RHI A;  4ANJ A;  2DIQ A;  1J3T A;  4RCC A;  3ME9 A;  1RI9 A;  1BCM A;  3OYI A;  2X4X A;  3KXT A;  1QVF S;  1UJY A;  1QKX A;  2KXD A;  3OYY A;  4PNO A;  3ZBD A;  3JB9 F;  2CP2 A;  3L1A A;  1BU1 A;  3TSW A;  1W2B A;  3SHW A;  1RAD B;  1I07 A;  3DLM A;  3NMZ C;  2O4X B;  3V8K A;  3A8O B;  3REA B;  3QYH B;  4FM4 B;  1UFF A;  1KD1 C;  2ZPF B;  4IUP A;  3UPU A;  5CQX A;  2Z0W A;  5I11 A;  4X1V A;  3G6E T;  3QG1 A;  1VQO T;  3KBG A;  2BKD N;  2QQA A;  3QJY A;  3PNW C;  1JJ2 P;  2DXB A;  5IXF A;  4Z8A A;  1E7O A;  1H92 A;  1U06 A;  2PVO B;  2YUQ A;  2X35 A;  1WIE A;  3OYF A;  1D3B B;  1WNL A;  1FXX A;  4C92 B;  3M0S A;  1AWJ A;  3LH5 A;  5GAN 8;  1KD1 U;  5GAN e;  5HKC A;  3QWX X;  1B3Q A;  1H3H A;  5KYW B;  5FU7 B;  1RAF B;  4MZT A;  4JRP A;  2QEX Q;  1QVG A;  5DY9 A;  1YIT A;  3H8Z A;  5GAM g;  4C5H A;  3LYI A;  2YT6 A;  3FRN A;  1YIT T;  2CUD A;  1WHK A;  3A1P A;  1ZBX A;  1SRM A;  1ARK A;  2DBK A;  1Y0M A;  2QA4 T;  1OEB A;  3MEV A;  4ZTJ A;  1V29 B;  2M02 A;  3P8D A;  1JO8 A;  1D0X A;  1RI0 A;  3JSC A;  4HCK A;  1EX4 A;  1D1B A;  3A8M B;  1JRI A;  2KVQ G;  3CBM A;  2KSS A;  4QT7 A;  4X9C A;  2NUP A;  2F2X A;  1VQL Q;  4AT1 B;  1YIJ Q;  1O9S A;  5J3B A;  4D8D A;  1VUB A;  4JJB A;  3CPW S;  2RQU A;  2VXF A;  2ROT A;  2IIM A;  3JCM h;  3CD6 A;  4M7D F;  3CME A;  4M78 A;  3OB9 A;  4M4Z A;  3CD6 T;  1YWO A;  4RKU E;  1UDL A;  5GMK e;  4FYX B;  2L2P A;  4B9W A;  4QVC A;  1HJD A;  2DEU A;  2CRE A;  1ZSZ B;  3OYN A;  1NZ9 A;  2DET A;  1N6A A;  3G4S A;  1K73 R;  1VQ4 A;  1YJN Q;  1IRX A;  3MET A;  3X20 B;  4EIK A;  3CCQ T;  1TOV A;  4KGZ B;  1VQ4 T;  2F2W A;  2GQV A;  4HCB A;  1TU0 B;  4A4K A;  4HT9 A;  1R0C B;  2OAU A;  3TVT A;  2HKQ B;  2VGM A;  4E47 A;  5A2Q E;  1AOJ A;  4BY6 B;  2JT4 A;  3EFR A;  4OP0 A;  2DVJ A;  2DL7 A;  4KGX B;  4XAX B;  3JCM c;  3MJX A;  3J81 E;  4L59 A;  2HQE A;  4A4E A;  2VB6 A;  4OMN A;  2JJ9 A;  4KUD K;  3CCJ Q;  2GGR A;  2CP0 A;  3I5S A;  1X6G A;  2CP7 A;  1RAH B;  4KGV B;  3EG0 A;  2VAS A;  1LOJ A;  5LJ3 e;  2DL8 A;  1Q82 C;  4B6M A;  5FWB A;  1WJR A;  1AT1 B;  2M1H A;  3PE0 A;  3QDF A;  5GAO m;  1TG0 A;  2VV5 A;  4XTU A;  4BI4 A;  3MEU A;  4LDV A;  3PMI A;  4EMK A;  4BDY A;  2BTT A;  2CS7 A;  3BDU A;  4ME7 A;  1PD0 A;  1W6X A;  4A53 A;  4M75 G;  1KQS S;  1VQM Q;  2G6F X;  3S3M A;  1N8R R;  1MUZ A;  2EQI A;  1Q82 U;  2EYX A;  2W10 A;  1KQ2 A;  3M9Q A;  5GAN j;  2DIL A;  3OYL A;  1K9A A;  3EFS A;  4E7L A;  2GBQ A;  4J9G A;  4V2S A;  3OYM A;  4M7D B;  1YWP A;  4OMQ A;  2V8J A;  2D8H A;  3VS1 A;  3EGD B;  1XTD A;  1QVF P;  3BDL A;  4XTV A;  4AFZ C;  3M58 A;  3I55 A;  2ZAE A;  1T0J A;  4A4G A;  1VQ6 A;  2PVG B;  3I56 A;  5GMK m;  3ULR B;  1VQ6 T;  3I56 T;  2CH4 W;  2HAX A;  2R5A A;  2DK3 A;  1OX9 A;  3FLG A;  5KYN A;  1M2O A;  3JCM J;  1YBY A;  4C8Q E;  3CXC A;  1N27 A;  1WDX A;  2ABL A;  1AVZ C;  2O31 A;  3G7Z A;  1QP3 A;  2DO3 A;  1GCQ A;  2BZX A;  1K9M C;  1T3L A;  4LE9 A;  4FSX A;  3OQ5 A;  4E6R A;  1W1F A;  1Y71 A;  2RO0 A;  5GAM d;  2F5T X;  4RTU A;  4N4G A;  1OI1 A;  2LJ3 A;  3VS2 A;  2KNB B;  3OYG A;  5GMK j;  3LH0 A;  3S6W A;  1PHT A;  2K2V A;  1KQ1 A;  2RQT A;  2YRD A;  2ED0 A;  4FT2 A;  1M4Z A;  3EFO B;  2EJ9 A;  4IUV A;  1K9M U;  2F1L A;  2HNI A;  3H41 A;  4IIO A;  4QVD A;  2HQH A;  2KBT A;  1W2B S;  2F69 A;  1YJW A;  1ACM B;  1WHM A;  5IT9 E;  1YJW T;  5AT1 B;  3NTH A;  2DYI A;  1YJ9 A;  4PJO D;  4RCB A;  2LQW A;  4JUV A;  1Q86 C;  2X4J A;  2DBM A;  1YJ9 T;  2B8A A;  1KC8 C;  3JCM f;  2QI2 A;  2RI2 A;  3JAM E;  4DEX A;  3CME Q;  4RTX A;  1VQ9 Q;  1WXB A;  2DX1 A;  2MK5 A;  3CPW P;  3PIP A;  4XU1 A;  4M77 F;  4J9F A;  3G71 Q;  2LRQ A;  2EQU A;  3G4S Q;  2HCK A;  4ORZ A;  3QZ5 B;  2JM9 A;  1Q86 U;  4HXJ A;  1QVG S;  1KC8 U;  3CPF A;  2KRO A;  4C92 E;  1WPY A;  4PJO C;  3RKW A;  4C92 D;  5LJ5 e;  3CCV Q;  2J05 A;  1M2V B;  2FPE A;  4YTL A;  1BCO A;  3ZEH A;  3CCR Q;  2JS2 A;  1PSE A;  2A37 A;  1GXI E;  3NGP A;  1U1T A;  4PFP A;  2CSQ A;  2XD0 A;  1QWF A;  2HZY A;  4OMP A;  2LT4 A;  1K0X A;  4K11 A;  2DE0 X;  1YCY A;  3WVE B;  3MCA B;  1TXQ A;  3OBY A;  2RD1 A;  5FRO A;  2MWP A;  2J6F A;  4C92 C;  4BI3 A;  4ESR A;  2DTI A;  4JLI A;  2EKO A;  1H3Z A;  4MZM A;  3EG9 A;  3SDZ A;  2YDL A;  4F16 A;  4PJJ A;  3MKD A;  2JTF A;  4CC4 B;  3LGL A;  4XTY A;  5AYF A;  1S72 T;  3JB9 D;  4OMO A;  1T0H A;  4C0D B;  3PVQ A;  1WHJ A;  1I1J A;  4E7K A;  2YLC A;  3KUF A;  3RNJ A;  1IGU A;  4O6J A;  4J6X A;  1NEG A;  5GAO q;  2COZ A;  2V1Q A;  1NBE B;  2DXU A;  4J7F A;  2QEX A;  2K2M A;  1M1G A;  2QEX T;  4M7A F;  1WHL A;  2OJ2 A;  4M7A G;  1KK7 A;  2HL3 A;  3RES A;  1X27 A;  4TVR A;  2LQN A;  5I22 A;  3OS0 A;  2GNC A;  1IZ6 A;  1PG5 B;  1TUC A;  1PC0 A;  2FVU A;  3L2V A;  3NTK A;  1ZSZ C;  1UGP B;  3LLR A;  3VJP A;  1R8O B;  5KYU A;  2R5M A;  4FYW B;  1WFW A;  4FW2 A;  1VQL A;  3OYK A;  4F14 A;  2E3I A;  2CZ0 B;  1YIJ A;  2OTJ T;  5KH6 A;  3HKS A;  1VQL T;  4AG1 C;  3UF4 A;  1YIJ T;  1AZE A;  2LCL A;  2ZZD A;  4BY6 C;  3CC2 Q;  1OX8 A;  4C8Q A;  2MWO A;  1DJ7 B;  2QK0 A;  3MHX A;  4FT4 A;  2M16 A;  4ZTF A;  3V8L A;  2EYQ A;  3JV3 A;  1Y07 A;  3M0Q A;  4RG8 A;  2NUT B;  2ROL A;  3RER A;  1YJN A;  2IVW A;  4BI8 B;  1A0N B;  1BYM A;  1H64 1;  4WCI A;  1YJN T;  5LJ5 j;  4LDU A;  1WI7 A;  1MV3 A;  2QDL A;  3EG2 A;  4F7U F;  1LCK A;  1AEY A;  3CCL Q;  5GAN 3;  4M7D E;  1OV3 A;  1BI2 A;  1W2B P;  1B34 A;  3HSB A;  3C95 A;  2DRK A;  4M7D D;  3VV0 A;  3M4G A;  4ZGJ B;  5CCA A;  4J6Y A;  3QDR B;  3MP8 A;  3U23 A;  1JEG A;  3CXC S;  5DLQ E;  2EGC A;  2X4W A;  4IUQ A;  2HQX A;  3ASK A;  1SEM A;  2VC8 A;  2EFI A;  2QTX A;  4ZN1 A;  5EC7 A;  2NLU A;  3CCJ A;  1Y96 A;  2YUN A;  4JRK A;  4A54 A;  5GAO p;  3CCJ T;  3CCM Q;  1YFN A;  3RR6 A;  1XJW B;  4OMM A;  2QXF A;  2JMC A;  3L2R A;  1MGQ A;  1NE8 A;  2QG9 B;  4KUI A;  3VRY A;  4JRI A;  5GAN 7;  1I5O B;  2C0O A;  4MMK A;  2H8H A;  3FEO A;  4M7D C;  2KAF A;  2KT8 A;  1MMN A;  3M53 A;  3EH2 A;  2HBW A;  4PFZ A;  1QVG P;  2SRC A;  1Y7X A;  3CBP A;  1ABO A;  1M3B A;  1X69 A;  3CCS Q;  1ZA2 B;  2GTJ A;  3CCU T;  3RIR A;  4X34 A;  3FJP A;  1RAE B;  1VQM A;  4BD3 A;  3GNF B;  4PL6 A;  1D3B A;  1OU9 A;  1Q81 R;  2RQR A;  4OVA A;  1VQM T;  3RKX A;  2DTH A;  2RM4 A;  2P0P A;  1QWE A;  1QCN A;  4XU2 A;  1SG5 A;  1M27 C;  3GPL A;  3P8H A;  1X01 A;  4PJO B;  5KYW A;  1S1N A;  1BBZ A;  1GL5 A;  1QKW A;  1B07 A;  2ATC B;  3FJ5 A;  1KG1 A;  3QYG B;  2EIF A;  3SWN A;  1M3A A;  4XTX A;  3VS6 A;  5KE3 A;  2LX7 A;  2HKN A;  3HHT B;  2XDB A;  4IUT A;  3OYA A;  3C0C A;  4F7U B;  2MOX A;  4QQD A;  2GFU A;  2XI9 A;  2P0Q A;  3EH1 A;  2D1X A;  3VS7 A;  2E6Z A;  5FWC A;  1EZZ B;  1QVP A;  2RJF A;  4PFO A;  4CC3 A;  1GCP A;  3JCM d;  4HKE A;  3JCM W;  2PUO B;  3LWH A;  1RLP C;  1UEC A;  2RN8 A;  2DKG A;  4M75 C;  2RPN A;  1C1A A;  3EG3 A;  4LXC A;  2KK4 A;  3SEM A;  4DEY A;  1MMD A;  2CSI A;  4EMH A;  2FL7 A;  1WZO A;  1Q7Y R;  2DEQ A;  2YWW A;  1RAB B;  1R0B G;  1UUE A;  2JW4 A;  2NYS A;  1MNE A;  4M78 F;  3DB4 A;  4M78 G;  1M1K U;  4MDW A;  3G1J A;  1X2Q A;  4XU0 A;  1NJI C;  2PZ1 A;  2MAM A;  1JBM A;  1SKU B;  2AIR B;  1QQJ A;  1HXD A;  4N0A C;  2FEI A;  2J7I A;  3CC4 Q;  3TRE A;  4P5N A;  2PUK B;  1NEB A;  3LGF A;  1AWX A;  3M57 A;  1VQ9 A;  1JXO A;  5HY6 A;  3CME T;  4J9C A;  5GAO r;  1VQ9 T;  2FZG B;  3G71 A;  1NJI U;  1U8R A;  1GRI A;  1H8K A;  2KYB A;  1OZ3 A;  3G71 T;  3X28 B;  1YHQ Q;  1JU5 C;  3BE3 A;  4R55 A;  2O01 E;  1WHG A;  3BW1 A;  1E6G A;  1V76 A;  3G4S T;  2LJ1 A;  2LZ6 B;  2KRS A;  2K4Y A;  5GAN h;  2XK0 A;  4E2F B;  4DBH A;  1CSK A;  2FZC B;  1HSQ A;  2E70 A;  4GY5 A;  2RB6 A;  3CCV A;  4FSS A;  1JJ2 A;  3CCV T;  4LN2 A;  4M77 D;  3CCR A;  1OOT A;  3CCR T;  4ATO A;  4UC4 A;  2A0F B;  2OAW A;  1TH7 A;  3CXC P;  4ELZ C;  4Z02 A;  2ZGW A;  4C0D C;  3DKM A;  5LJ5 g;  1VQP Q;  1I0C A;  5GAN 5;  4FU6 A;  1YP5 A;  2JOY A;  1AD5 A;  1PKS A;  1MMA A;  4M77 C;  1WJQ A;  1ZUY A;  2RHZ A;  2QDY B;  4C5I A;  5GAN 2;  4JLG A;  4OML A;  1UGQ B;  4D6W A;  1IRE B;  4B9X A;  4ZNX A;  1ZQ1 A;  4M75 F;  3AHU A;  4J9B A;  4GLM A;  3OS5 A;  5GMK h;  1VOM A;  5D6X A;  1YNZ A;  4BE0 A;  3OS2 A;  4LD9 K;  5DLO A;  1VQK Q;  1WJS A;  3E19 A;  2KE9 A;  2RI3 A;  1UGR B;  2OI3 A;  3OW2 A;  2K57 A;  1X6B A;  2KXC A;  3UA7 A;  2GCX A;  2QQR A;  1UHC A;  2M9U A;  3M0T A;  3H0H A;  4D8K A;  2LCC A;  4LUE A;  2DZC A;  2VWF A;  4Y28 E;  4DA4 A;  3EGU A;  1QCF A;  2ZPI B;  1X6O A;  3EFO A;  3I55 T;  1WQ7 A;  4AFQ C;  4NS5 A;  3V7R A;  3L2U A;  3I35 A;  3PVL A;  2IG0 A;  1ZBJ A;  3CMA Q;  4EPC A;  3JCM P;  2AKK A;  3JCM X;  4ZGE B;  1QW1 A;  4J8O A;  2MMP A;  2A28 A;  3QSU A;  1IXD A;  5LJ3 h;  1K73 C;  2CUB A;  4L6V 5;  3LX7 A;  2WSF E;  3A8L B;  3GLX A;  2L3S A;  1Z9Q A;  2RNA A;  5GAM e;  1VQO Q;  4EMK B;  5IAY A;  1PNJ A;  2VVK A;  4KH0 B;  4M7A D;  5CKE A;  4JDS A;  1PM3 A;  5J26 A;  3CC2 A;  1RUW A;  2EPD A;  1M90 R;  8ATC B;  1K8A R;  4MZP A;  2RQV A;  3CC2 T;  1NLP C;  5FW9 A;  4MML A;  1K0S A;  1OQK A;  4QW2 A;  5GJW B;  5I2S A;  4JJD A;  1K73 U;  3E1S A;  5IN1 A;  2V8I A;  3S3O A;  2HEQ A;  2LQK A;  3OYJ A;  5FRM A;  4OMF B;  3QPH A;  2K3Y A;  4AMC A;  4HCC A;  2VGN A;  3URG A;  9ATC B;  1M2V A;  3GBQ A;  2JS0 A;  4PJO E;  4M75 B;  3V7S A;  3CCL A;  2OTL Q;  2QA4 Q;  3VS3 A;  3LWI A;  4M7A C;  3DB3 A;  2VYT A;  2DTO A;  3A98 A;  2Y4X A;  1KJW A;  2PQW A;  2QAS A;  1HD3 A;  2EYW A;  4AFU C;  4FYV B;  2JZ2 A;  3FB9 A;  2MIO A;  4GBQ A;  5KE2 A;  1JQQ A;  1TS9 A;  3F70 A;  5LJ3 j;  2VXE A;  4F7U E;  2GTO A;  1N8R C;  3CCM A;  4QQG A;  5GAN f;  3CCM T;  3TQ7 P;  2DL5 A;  3OBW A;  3VUZ A;  2CKK A;  5A0L A;  1WX6 A;  3OA6 A;  4R56 A;  2M0Y A;  3EGX A;  2K5F A;  2KDS A;  3OS1 A;  2FPF A;  1G3W A;  3QZ9 B;  5CAI A;  3L2Q A;  3CCS A;  2EQJ A;  3UT1 A;  3QII A;  2KI7 A;  1N8R U;  2E12 A;  2ED1 A;  3CCS T;  4Y91 A;  4NL2 A;  2E10 A;  2LT1 A;  2CT3 A;  2HSE B;  3MPU B;  2DD5 A;  4OGE A;  2R57 A;  5KCO A;  2Y90 A;  1UJ0 A;  3M4Y A;  4RTV A;  2CP6 A;  2LNH B;  2RJC A;  5FU6 B;  2A7Y A;  5C0M A;  2J06 A;  2LX9 A;  1ZLM A;  4BDZ A;  3GF5 A;  4RMO A;  5CVI A;  1TWB A;  2DF6 A;  3CC7 A;  2EJF A;  2HBP A;  4IUU A;  2RQW A;  2LCS A;  5KYX A;  3VYH B;  1UTI A;  3MEW A;  2E6N A;  2X3X D;  2HD0 A;  2QQS A;  5GAO n;  1G3S A;  3QJ6 A;  1GBR A;  3V7C A;  2DPP B;  2DAQ A;  1FMV A;  2I2L A;  5GAM j;  3UDC A;  1WXT A;  2XDD A;  2Y4Y A;  4RG2 A;  3X24 B;  5KYY A;  3QHS A;  4DOW A;  5LJ5 h;  2YXY A;  3SWN C;  4M77 B;  2D0Q B;  2LDM A;  3HRT A;  2WSC E;  5EG2 A;  2H3J A;  4IKF A;  4E7H A;  2NWM A;  2G3R A;  2CZ1 B;  4C8Q F;  4C8Q G;  1XNI A;  1QMC A;  3H9N A;  1EIF A;  3A8G B;  1TUG B;  2P0K A;  2K5I A;  4J9E A;  3N5B B;  6AT1 B;  2MCN A;  3KFV A;  5GAN g;  2L8D A;  2DMO A;  2MF2 A;  5CKH A;  1NG2 A;  3FDR A;  2QGF B;  3IQL A;  2YLB A;  3MO8 A;  5D7U A;  3OMG A;  2PTK A;  4NL3 A;  4RTW A;  3CC4 A;  4HVU A;  1F1B B;  4PK4 A;  1KHI A;  2L0A A;  3EG9 B;  4O5V A;  3CC4 T;  2CP5 A;  4J5Y A;  4A4H A;  4C0G A;  2SEM A;  4OB2 B;  4M78 D;  1OPK A;  1VIE A;  2C0I A;  2WSE E;  5DM7 R;  3OW2 S;  3HPW A;  4RTT A;  2DJZ A;  4WF2 A;  1KD1 R;  1YHQ A;  4IUR A;  2E3H A;  1D0Y A;  1D0Z A;  1YHQ T;  3R6O A;  1V1C A;  3INZ A;  3JCM V;  2YUO A;  2V1R A;  1I5L A;  2BZ8 A;  4FL6 A;  4N4H A;  1FMK A;  1X43 A;  3HL8 A;  1YCS B;  4R0K A;  1KQS A;  4XU3 A;  1AWW A;  4PKC C;  1ABQ A;  4M78 C;  1Z9Z A;  4LDW A;  4CI0 C;  2ZPH B;  1RAI B;  2EAY A;  1SHG A;  1VQ7 Q;  1RLQ C;  2ECZ A;  2HDA A;  3O8V A;  3H0F A;  4PJO A;  2KQW A;  4DOV A;  2XIC A;  2O9V A;  2EJG A;  1I81 A;  1Q95 G;  1NPP A;  4FW1 A;  2MPX C;  3M59 A;  1FYN A;  1GFC A;  2O4X A;  2E1H A;  4M7A B;  4C92 G;  3JCM b;  1VQP A;  2RJD A;  2RK2 A;  2X9H A;  2X4Y A;  4QQ6 A;  3RBB B;  2FB7 A;  3H0I A;  4EDU A;  2DNU A;  2EW3 A;  1OZ2 A;  3JB9 J;  1FX7 A;  2XKO C;  1GBQ A;  3QUI A;  4JPB W;  2JN0 A;  1BI0 A;  3CBO A;  3OYD A;  1BIA A;  4DBR A;  2K5L A;  1UGS B;  4A4F A;  1JB0 E;  4JS5 A;  2FYK A;  3EHR A;  3VS0 A;  1NYF A;  4C92 A;  1VQK A;  3RMS A;  5LJ3 g;  4Z89 A;  1SF9 A;  2BIV A;  1B34 B;  2JMA A;  1IHV A;  4LD6 A;  2LJ0 A;  1ZHI A;  4M75 E;  4EMK C;  1BB9 A;  4M75 D;  2LVM A;  2BE9 B;  1WQW A;  4HVW A;  2K9G A;  1IHW A;  2RF0 A;  4F17 A;  3M55 A;  3I9Q A;  3CC7 Q;  2NUZ A;  3CMA A;  3JB9 G;  4J9D A;  3VKI A;  3CQT A;  1Y96 B;  2JVV A;  3NHN A;  1RAG B;  4J7I A;  4CRI A;  2EWN A;  3CMA T;  3QWY A;  2P4R A;  3GOX A;  3HFN A;  1UG1 A;  1TSF A;  2QQ9 A;  1LJO A;  3I5R A;  3M0R A;  3DLL A;  2YUP A;  1PCX A;  1UE9 A;  3JCM e;  3G6E A;  5CO7 A;  1VQO A;  1S72 Q;  1WHH A;  1M1K C;  2RHU A;  1FMW A;  1TUD A;  2K6D A;  2WAC A;  4C5E A;  5LJ5 f;  5I2M A;  5IHK A;  1VQN Q;  2P4T A;  4AG2 C;  1GFD A;  3MEA A;  2X51 A;  3VS5 A;  2BZY A;  5FRN A;  2D0N A;  2PVD B;  4KUL A;  3RMQ A;  4Z88 A;  1Q82 R;  3QKJ A;  1ZX6 A;  4PJN A;  1K4U S;  1ZSZ A;  2W0Z A;  4XK8 E;  3VRZ A;  2HMA A;  4BAC A;  1SRL A;  5GAN d;  2FG0 A;  5IHN A;  2GQI A;  1GCQ C;  1NLO C;  1PSF A;  3GNG A;  3C12 A;  1LPL A;  1RL2 A;  1M1F A;  2LMJ A;  1HK9 A;  2CP3 A;  2LTO A;  3C4S A;  3SWN B;  1SSF A;  3M5A A;  2MI6 A;  4QKU A;  2OTL A;  2QA4 A;  2AZV A;  2KRM A;  4KH1 B; 
#chains in the Genus database with same CATH homology
 3OW2 P;  3G71 Q;  1VQ6 Q;  3CCU Q;  3CCJ Q;  3CCR Q;  3CCQ Q;  3CXC P;  1M90 R;  3G4S Q;  1Q81 R;  1VQ4 Q;  1VQ5 Q;  1S72 Q;  1K8A R;  3CC7 Q;  1KQS P;  2OTL Q;  2QA4 Q;  1KD1 R;  1QVF P;  1YJW Q;  3CCE Q;  1VQN Q;  2QEX Q;  1M1K R;  1VQM Q;  1VQ7 Q;  1N8R R;  3CC2 Q;  1QVG P;  3CD6 Q;  2OTJ Q;  1Q86 R;  1JJ2 P;  3G6E Q;  1VQL Q;  1VQO Q;  1VQP Q;  1K73 R;  3CCL Q;  1K9M R;  1YJ9 Q;  1VQK Q;  3CME Q;  1YJN Q;  1YIJ Q;  1Q82 R;  1YHQ Q;  1W2B P;  1NJI R;  3CCS Q;  3CMA Q;  1KC8 R;  1VQ9 Q;  3I55 Q;  3CCM Q;  3CPW P;  3CCV Q;  3CC4 Q;  1Q7Y R;  1VQ8 Q;  3I56 Q;  1YI2 Q;  1YIT Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...