1WHJA

Solution structure of the 1st cap-gly domain in mouse 1700024k14rik hypothetical protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
GSSGSSGLPNSDHTTSRAMLTSLGLKLGDRVVIAGQKVGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGRVQYFKCAPKYGIFAPLSKISKLKDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 1700024K14
publication title Solution structure of the 1st CAP-Gly domain in mouse 1700024K14Rik hypothetical protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whjA00
3RDVA 1LPLA 2E3IA 2HKQB 3E2UA 1WHHA 2E4HA 1TOVA 2HQHA 2CP7A 2COYA 2CP0A 2CP6A 2COZA 1WHKA 4B6MA 1WHJA 1IXDA 2HL5C 2Z0WA 2MPXC 1WHMA 2HL3A 2QK0A 3TQ7P 2E3HA 2CP2A 2CP5A 2M02A 1TXQA 2CP3A 2COWA 1WHLA 1WHGA 2HKNA
chains in the Genus database with same CATH superfamily
1PD1A 3CCEA 3TREA 1PHTA 2QDLA 4KH0B 1BKBA 2QAZA 4MDWA 2DL8A 5GAMd 3LH5A 1AD5A 1KD1R 3I55T 2AK5A 1T3LA 5A2QE 3UWNA 1K73R 3X26B 4M77B 1Z9QA 2QTXA 1AWJA 1H641 1VQOQ 4M75F 1VQ4Q 1SG5A 3NPFA 3CCSA 3CC7T 1NZ9A 5KYXA 1AZEA 2J6KA 2FRWA 2VGMA 3CEYA 1MV0B 2PQWA 4ESRA 3L2RA 4F17A 3INZA 5GAN4 1ZSZA 4M7AF 4ZTFA 1YWOA 5KYUB 1VQ7A 2CKKA 2JN0A 2DERA 4HVUA 1KJWA 2KE9A 3CD6A 4HT9A 3OBYA 2HBPA 1X2QA 1WJSA 1PRMC 1VQOT 5EG2A 2A36A 3HRTA 3CCVT 2KROA 2DF6A 1K0SA 2NUZA 3LWIA 2FL7A 1I0CA 1VQKT 2PVGB 1M3CA 3CC2A 4OVAA 2RQWA 3CMAT 4F14A 1OOTA 2RJFA 1VQPA 4K11A 3VS7A 3JCMX 2F1LA 1W4SA 2LRQA 2BE7D 2YUQA 1GCQA 1Q82C 2D9TA 2YWWA 2V8IA 1K1ZA 3CPWS 1NEBA 5J26A 4E7JA 4GBQA 1OX8A 1UGRB 1IHWA 1AEYA 4ORZA 2HAXA 1MNDA 3PT9A 2RO0A 4F7UA 6AT1B 2CT4A 1Y71A 2HL3A 2M02A 2HD0A 4XTWA 3BE3A 3JB9I 1NPRA 1G8XA 3RR6A 1QKWA 1YJ9A 4OMLA 1QVFS 4F04B 3QG1A 4C0GA 2K5FA 5AYFA 1AWWA 4DBHA 2CP7A 5GANd 2QA4A 1SKUB 1KHCA 5CKHA 1DJ7B 2E41A 1YFNA 1TTHB 3I55A 3OW2P 2E3HA 5GAN8 1FXXA 4IUTA 4RTZA 2X35A 2E5QA 2ZPIB 2WSFE 1BIBA 2QTVA 2K57A 4BACA 2JMAA 2LZ6B 5KCHA 4WTOB 3JCMW 3HRUA 4ME7A 2EJ9A 4KRTA 4M78G 5KE2A 3PVQA 1M30A 1MUZA 1OV3A 2R58A 5ECAA 2J6FA 2EQUA 5DY9A 1BI3A 4GLKA 5GAMh 3BFMA 1MGQA 1Q82R 3RKYA 3QBYA 3TEEA 4ATOA 2YLCA 2VC8A 4M7DG 2DXTA 3VS4A 2E6ZA 1Q81U 1W2BA 1D3BB 3V7CA 4E7IA 1PG5B 2EIFA 1G3SA 4XTUA 5CAIA 4PJOG 4J6WA 1H3ZA 3CCVA 1WHJA 2ABLA 2DLPA 1AWOA 3EFOA 3L2UA 1VQKA 1LCKA 3T9NA 3CMAA 2LJ0A 2OTLQ 5GAN5 2VGNA 2MI6A 4Z89A 2X4YA 1M1GA 3OB9A 3I56Q 5IT9E 1WXTA 2EKOA 4X1VA 2EAYA 5A0GA 1BU1A 4J7IA 4IUPA 4BY6C 1Q86C 5IH2A 2D8HA 2DM1A 1NJIU 2H3JA 1B07A 1U1SA 4FL6A 4KT0E 3VYHB 4NL3A 5HK0A 3M0QA 3GBQA 3UA6A 1RAGB 5CCAA 3VS6A 2DAQA 3H41A 3G6EQ 3X24B 4ZTJA 2CREA 1VQNT 2BIVA 2OTLT 2PVDB 3HHTB 1TG0A 3TU4K 3JSCA 2F2WA 2K5LA 5C0MA 1M2VB 1BCMA 4XTZA 3OYIA 2FPDA 2RM4A 2ZPFB 1PM3A 2DK3A 1S72T 1B34B 4JJCA 2GFAA 3M5AA 4E6RA 1JQQA 1R0CB 2ECZA 2E65A 2YRCA 1QVGP 1SHFA 2CP6A 3G6ET 2DRMA 1B7TA 3CPFA 2F5TX 4AFZC 2YT6A 5CVIA 2BZYA 2DX1A 1BCOA 2EW3A 1K9AA 5GANh 2EGAA 1BI1A 4DBQA 4RTWA 8ATCB 1V76A 4UC4A 4N0AA 1TOVA 5IHIA 5GAMe 4E7LA 5KYYB 4FT2A 1I5LA 1IGQA 2L0AA 1Q86R 5FW9A 3CCLQ 1Y96A 2DIGA 4N4GA 4PK4A 3QWYA 4J9EA 4OB2B 3J80E 1X6BA 1YHQA 1NYFA 1UEBA 2MF2A 2CDTA 2DFUA 2RHYA 2X3WD 4RTTA 2VWFA 2DL4A 4XU2A 3BW1A 2GNCA 9ATCB 4V2SA 2A08A 1I8FA 4C92A 2RNAA 5LJ5d 3JCMg 1UGPB 3CXCP 4JLIA 2DETA 1WNLA 1M5Q1 3H6ZA 3U23A 4EMKB 1WHGA 2H3EB 2RHXA 1MMDA 2E12A 3H8ZA 2E3IA 4DEXA 3OYGA 2QG9B 1K8AU 1OU9A 3MKDA 1CKBA 1SRLA 2NUTB 4J9FA 4LN2A 3A8LB 1QVFP 2AKLA 2VV5A 3H0FA 2FB7A 1VQNA 3M55A 2OTLA 1N9RA 2KRNA 1QWEA 3EG9A 4A4KA 2PVOB 1BIAA 3CCMT 3NTIA 1K9MU 2KNBB 3G71T 2QQ9A 1HXDA 3M56A 1S72A 2KVQG 4A4HA 2KYBA 3A8OB 4ZN3A 2OTJA 4GY5A 1UG1A 2VVKA 3RESA 2AZVA 4BE2A 2RK2A 4DBRA 1WYXA 1K0XA 1N8RC 3J81E 1SEMA 3RBBB 4M75G 3OYLA 1U3OA 4N4HA 1VQ8T 2L5QA 4AT1B 5D6YA 2XU8A 5GANe 1C1AA 2O9VA 5GMKi 2HSEB 2AT1B 4X9DA 4ZGJB 2NWMA 3QPHA 4EPCA 5GAN6 2XDDA 3RKXA 3OBWA 3EGUA 2F2VA 2M0OA 2DEQA 2ATCB 3P8BB 5CKFA 2DRKA 4J8OA 2ESWA 1GCPA 4AFSC 1D0ZA 1N9SA 5LJ3g 1IXDA 4JJDA 5CIUA 1OZ2A 2QK0A 4GLMA 4HCCA 3LYIA 1TXQA 2YUNA 2QGGA 2DD4A 3EGDB 4FSSA 2DBMA 3VKIA 2K3BA 3RMQA 3HSBA 1VA7A 3LH0A 4E7ZA 1MNEA 1UE9A 1BYMA 4JRQA 3RNJA 4ZGEB 2QXFA 3A98A 4M78E 4HXJA 1O75A 2MAMA 1UJYA 4LUDA 1CSKA 2J05A 2DTOA 1X75C 2YRVA 5GMKh 4R56A 1N8RR 1TH7A 5L23A 2ED1A 4BDYA 5CKEA 1K76A 2P4TA 2L8DA 4C8QA 3CCJQ 3UF4A 5FRNA 2DIQA 4Z02A 2RJEA 3CBMA 1VQLQ 4M7DE 5LJ5h 1Y0MA 1PKSA 3MP8A 1R77A 4PJOE 4C0DB 5LJ3h 4M77C 3EHRA 4B6MA 3IQLA 2A3LA 4E2FB 2LT4A 3CCMA 4XU1A 3EG1A 1WQWA 4F7UG 3G71A 2O4XB 4M78D 2P0QA 4RG8A 3RERA 3DLMA 2CUBA 3OSSC 2M1HA 3OQ5A 1QLYA 1KD1C 3CCJT 1IRXA 4J9GA 1ZA2B 1VQMQ 2AZSA 1K73C 4M7DD 4PFZA 2OAUA 4CC3A 2DVJA 4MZPA 4M7DC 5I22A 3CC4A 3OYEA 3NFCA 1VQ8A 4PJOD 5GAOn 5IHKA 4OB1B 2JW4A 2ZPEB 4Z88A 3NMZC 1KG1A 2X3XD 4E47A 2DKGA 4JZ3A 1QWFA 1U5SA 5GAOp 3OS1A 1UGQB 2RHUA 5GANj 2GGRA 3C4SA 1NEGA 1VUBA 2V1QA 3ZBDA 2ZCFB 3UPUA 1Q82U 3FJPA 4A4EA 2L3RA 1WZOA 1MMAA 2CSQA 1VYUA 4C5IA 1X6OA 3E1SA 5A0LA 2BZ8A 4RG2A 2K2VA 5I11A 3QHSA 1NYGA 2B86A 1XQHA 3CCQT 4FYVB 2KRMA 3V8JA 2KY9A 3OS5A 4J9DA 3I5SA 3MP6A 2QQAA 3ZL7C 1M90C 1TSFA 4M75A 2EBPA 3PIPA 4XTYA 4QVDA 1D1AA 3EAEA 4CC4B 4XTVA 4QQ6A 2E6NA 4ELZC 5J39A 4M7AA 3M0TA 3QKJA 1P92A 1VQ6Q 2COYA 1H8KA 1ZUYA 2OJ2A 3OYNA 1D1BA 1VIFA 5LJ5e 3GP8A 3EG2A 1M27C 3PNWC 4M78B 4JRPA 4E7SA 2HKQB 2K4YA 1VQ5T 2X51A 2IIMA 1QVGS 1KQSP 1IREB 1YJWT 2PNIA 2EJGA 2OAWA 1HK9A 3X28B 1Y07A 4M7DB 2BE9B 1VQ6T 1EZZB 3PVLA 2X4JA 5CR2A 1S1NA 4PJOB 2CGHA 1SRMA 2OX7A 1VQ4T 3NGPA 1WHHA 3UATA 1SSFA 2EQIA 3HPWA 5FWCA 3CMEA 1KFZA 4EMGA 2DE0X 1ZQ1A 4R0KA 2MPXC 1OQKA 4DOVA 1M90R 2BTTA 3OW2A 3RIRA 3J7AF 4FYYB 2CP2A 2CSIA 1YIJQ 2KR3A 4MMLA 3HFNA 3VS0A 2EYXA 3G4SQ 1T3SA 5C6SA 2EPDA 3E2UA 1I07A 2XG8D 3JV3A 4RUGA 2ROTA 3I35A 2HCKA 4BE1A 2YUOA 1Q86U 2GBQA 3E9FA 3CXCS 5DM7R 1UUEA 2FO0A 1OZ3A 1RAFB 3JCMc 2DXCA 1RAHB 3CCQA 4KGVB 4BI4A 2DYBA 1FWZA 4M75E 1WPYA 4KGZB 3TSWA 3S3NA 2DPPB 2RN8A 5D7UA 3G4ST 4XQ3A 1PKTA 4OF1A 2EGEA 4C0FA 4PLLA 4OB3B 5KH6A 1LJOA 1PSFA 2XDBA 5FU7C 4C92G 2VXFA 5I2SA 5D6XA 1Y7XA 5D6WA 1RUWA 1YBYA 3M53A 4LE9A 2YLBA 4RTUA 5FRMA 3FDRA 1X69A 2KI7A 4QKUA 1ZBJA 3CC7A 2R5AA 3OS0A 5GMKj 1Q7YR 1VQ5A 2Z0WA 1QQJA 1YJWA 1JRIA 4FW2A 5LJ5j 2K2MA 2EYQA 4OMNA 4ZN1A 1TS9A 3KBGA 3OMCA 3GIBA 3EH1A 3QXEB 2PU9B 5LJ3j 2JT4A 2RK1A 4Y91A 2DXUA 2JTMA 2JVVA 2RI5A 1FYNA 1VQOA 1VQ4A 4J9BA 2HBWA 3PIOA 3DB3A 2CZ1B 4QVCA 3EHQA 1UFFA 5HKCA 2RQTA 2QQRA 3PGGA 1BBZA 1JB0E 3QUIA 3JB9G 4AFQC 1YJNQ 1KC8C 4HA8A 1YWPA 2L3SA 5HK3A 1ZSZC 2J06A 2E70A 3CCRQ 3A5ZB 4A53A 2R5MA 3RKWA 4E7KA 3PTAA 1WQ7A 5KE3A 3C94A 4MZTA 4NL2A 4F7UE 2DTIA 3M4GA 2YDLA 1R8OB 2VYTA 5FLXE 4EMKC 2AIRB 4D8KA 3QDRB 3JCMd 3C95A 2DA9A 3FIFA 2H8HA 3V7RA 1MHNA 1X27A 3I56T 1SPKA 3JCMP 4L6V5 1YI2Q 3QIIA 3P8DA 2P84A 3VJPA 4PJJA 1GFCA 4ELYC 1WA7A 5FU7B 4J5YA 2XDPA 3OYKA 3CPWA 1W2BP 4FIBA 2XK0A 3HRSA 3L2WA 3E19A 2VKNA 2FVUA 3EGXA 2LCCA 3KFVA 1XNIA 4FT4A 3LX7A 1Q95G 1HYOA 3VRZA 4AG2C 4M75B 1N8RU 3EH2A 3SFMA 5GAN3 4J6XA 1KC8R 1BK2A 1EX4A 1FMKA 3OYBA 2QEXQ 3OS2A 3SWNA 1TUGB 1WGSA 3DLLA 5IXFA 4VUBA 2A7YA 4LNPA 4TVRA 2L3QA 4C8QG 3V7SA 2HZYA 3S3OA 4A63B 2P0KA 3EG3A 5J3BA 1UHCA 2RHIA 3A8MB 5KYXB 2J7IA 2JZ2A 2EKHA 1H3HA 1WIEA 1ZSZB 1BI2A 2DZ9A 2RJDA 1QKXA 2K6DA 2QEXT 1WHKA 4HCKA 2GCXA 2O88A 2RF0A 4J83A 1WHMA 4RCCA 1AZGB 3CCUQ 3REAB 2DL7A 1KQ1A 3L1AA 3VS5A 3CCLT 4PJMA 1M4ZA 5LJ3d 3MP1A 2DJZA 4ANJA 2KRSA 5GAMf 1R0BG 4DA4A 1HJDA 2KT1A 4C5GA 1I4K1 4M77A 4BD3A 4O6JA 2W10A 5M9OA 1NJIC 1VOMA 3MEWA 2MYSA 3P8HA 1N6AA 2O2OA 1ZX6A 1NE8A 2XIDA 2OI3A 2E1HA 2HDAA 1KSWA 1N27A 3I56A 1CKAA 3E9GA 2WACA 3QO3A 1YNZA 5KYUA 4M77F 1H92A 2G3RA 4F7UB 4C0DC 3JCMh 2ZAEA 2P4RA 2CP3A 1KQ2A 4M78F 2KDSA 3G6EA 3X25B 4J9CA 3QDFA 3LGFA 3ULRB 1Q81R 1KQSS 1VQ9Q 1UDLA 3H9NA 1KD1U 4JS5A 1ACMB 2RD1A 4JRIA 3WVDB 1OULA 1K73U 1UHFA 4JPBW 4M7DF 3JRZA 3M9QA 4EMHA 3OYDA 2C0OA 2BKDN 4M7AG 2DD5A 1EFNA 4PJOF 3DB4A 1TWBA 3UA7A 1NLOC 2W0ZA 2LCSA 1JJ2A 1M2OA 4OGEA 4C5EA 7AT1B 4ZNXA 1PNJA 1VQ9T 1YITQ 1NJIR 4PNOA 5GAN7 8AT1B 4QVZA 3C12A 2ZZDA 1SHGA 2LP5A 4LD6A 1AVZC 1UGSB 4C92E 3QJ6A 5KYWA 1UJ0A 3CCEQ 2GFUA 1OPLA 2KSSA 5GANf 3CCLA 3LLRA 4IURA 1LOJA 1M3AA 3EFOB 1QCOA 3VUBA 4R55A 3CCSQ 1D1CA 1G5VA 3R6OA 5KYNA 1OU8A 2SRCA 3QZ9B 2LQ8A 5FROA 1IHVA 2D6FA 2LQNA 3FC3A 4C92D 3X20B 4FCYA 4JUVA 3CCET 2D0NA 1VQ7Q 1WFWA 4C92C 1WX6A 3FB9A 1E6HA 2K7AA 2LCLA 3CD6Q 2YXYA 2EVRA 1KK7A 1ZBXA 2G6FX 2X4XA 3M0UA 4KGXB 2D8JA 2V8JA 1RADB 4M78C 2FYKA 3FEOA 4FSXA 1D3BA 3JCMe 1K9MC 1G83A 2PZ1A 3OSVA 1VQLT 1TUDA 2QASA 4IUVA 3M4YA 3CC2Q 1JU5C 2E5KA 2V26A 2K9GA 4Y28E 1IZ6A 3MJXA 4AFUC 1VQPQ 3Q1JA 2LT1A 3JCMJ 2XKOC 3MEUA 1VYVA 1A0NB 4PJOC 4OMOA 3CBOA 2Y4XA 2M0YA 5EC7A 2GQIA 2RA2A 1NPPA 1JO8A 1YN8A 3EGXB 3OYYA 1M8MA 3QJYA 4B9WA 3JB9D 1LVKA 5LL6S 4MZMA 3OYHA 3WVEB 2NUPA 3NTKA 1GBQA 2DO3A 1VQMT 3TSZA 4A54A 1NG2A 2ZGWA 1WHLA 3VS2A 1K8AR 2LDMA 2EFIA 4C0ZA 1VQPT 2HEQA 3CQTA 2FEIA 1UTIA 2HSPA 3SEMA 2QGFB 3SWNB 1FX7A 5KCOA 4KUDK 2L2PA 3I5RA 4DQ2A 1YJ9Q 4PJNA 3G7ZA 2CP0A 5CKDA 1QMCA 3N5BB 1VIEA 3QYHB 4Z8AA 1Y96B 2QA4Q 2LQKA 2KXDA 4PFOA 5CKBA 2E64A 1BB9A 3RMSA 3I55Q 4BUGA 1RAAB 5IAYA 4LUEA 2VUBA 1B34A 5IXBA 1ZUUA 5HCKA 3ME9A 2XICA 1K9MR 2EYYA 1I81A 1OI1A 2MWOA 4LDUA 2M51A 2HQHA 2IPOB 4JJBA 2EGCA 4HCZA 1TU0B 2QQBA 2X4WA 5GMKe 3LGLA 2JMCA 5I2MA 4BB7A 4C8QE 4IUUA 2LMJA 3QSUA 3JAME 4C92B 3BY7A 3SDZA 2CZ6B 3JCMQ 1IB8A 1UECA 1BI0A 2HKNA 2JS2A 1QW1A 4HVVA 1W2BS 2P0PA 3THKA 5LJ3e 2RB6A 5FWBA 1V1CA 1ZLMA 3M58A 5KYYA 3OYAA 4HKEA 1ZA1B 1XOVA 2L89A 1OX9A 2RHZA 4BI3A 2ENMA 2HQXA 2RPNA 3AHUA 1M1KC 2BZXA 4PKCC 1EIFA 1G2BA 3CCVQ 4XTXA 4RCBA 1N5ZA 3CCJA 4OB0B 4HT8A 1VQLA 4C8QD 1VQKQ 4LDVA 1E6GA 3EG9B 4C8QC 2XHCA 4F16A 2AKKA 3CMAQ 2C0TA 3SD4A 1M8VA 2C0IA 1AWXA 3S6WA 2RQRA 1OEBA 2FG0A 3EFSA 1GL5A 5LJ5f 5CQXA 2QDYB 4EDUA 1Q7YC 3PE0A 1TUCA 2KMTA 3EFRA 4RTVA 5LJ3f 4EMKA 1XJWB 3HKSA 1KC8U 1VQMA 1RI9A 2NUTA 1G3YA 3LW5E 4PFPA 3O5ZA 2LJ3A 5AT1B 4JRKA 5GAOm 1MV3A 4RTYA 5CO7A 2IG0A 2YHTA 4JZ4A 4XU3A 1D09B 2DYIA 2QI2A 3ZFJA 3QZ5B 2LX7A 4OMPA 5DLQE 1YIJT 2E10A 4QT7A 4B9XA 4XK8E 4Y92A 1I5OB 2LNHB 2PTKA 4M4ZA 4CC7A 3KUFA 1RLQC 5FU6B 1M1KR 2JM9A 4QW2A 1PWTA 5GAMg 2DNUA 2JM8A 4M7AE 4LXCA 2YSQA 4JLGA 3RDVA 2SEMA 2QQSA 3SB2A 2PUOB 5KYWB 1T0HA 4F7UF 2V8KA 2YUPA 1XTDA 2ZPHB 3MEAA 3JCMb 1KHIA 2O9SA 1QCFA 4M75D 1NM7A 1ARKA 1U1TA 3ZEHA 4M77G 4M75C 5DLOA 3JCMV 3JB9J 1YHQQ 2MWPA 2F5KA 1ABOA 4C8QB 3EG0A 3VS1A 1AOJA 2DTHA 2Y4YA 3GNFB 3HFOA 4C5HA 4M7AD 2ROLA 2RI3A 2CUDA 3S3MA 1VQ6A 2JNGA 4M7AC 2JS0A 3HTRA 4XU0A 1YCYA 4YTLA 2GQVA 2MK5A 4IKFA 2V1RA 1RLPC 3L2VA 5CK9A 3JB9H 2A0FB 2ZPBB 3EGDA 1RACB 1PCXA 1YHQT 1WDXA 4L5GA 1QVGA 2FPEA 3KXTA 4PLIA 3VUZA 4HVWA 4ZGDB 3I9QA 1ZSGA 2KBTA 1RAEB 3BDLA 1VQNQ 3WXMB 2LC4A 2IVWA 3L2QA 2DL5A 2WSEE 2FHDA 2JXBA 2VXEA 2KYMA 1GRIA 4II1A 4XAXB 4DEYA 3GPLA 4J9IA 2MMPA 2DEUA 4IIMA 1YJNT 3CBPA 2LQWA 1SSHA 1YIJA 4BDZA 3TVTA 4RKUE 1ABQA 2NUPB 1S72Q 2OTJQ 3CCRT 2O4XA 5GAOr 3G4SA 1T0JA 5GANg 1GCQC 3OYMA 1JBMA 3PFSA 2O31A 1U8RA 4OGCA 2I2LA 1IGUA 2LTOA 2E4HA 3GLXA 3MCAB 3VYGA 4D8DA 1D0YA 2DVEA 1UGVA 3L42A 3G1JA 4CC2A 3V8KA 2JJ9A 3FLGA 3M0PA 4KULA 2CZ0B 3CXCA 1OYXA 1JJ2S 2OTJT 1M9SA 3HL8A 1YI2T 1ZUKA 3OY9A 1MMGA 5CQYA 1RABB 5GAOl 4M7AB 4QQDA 3M0RA 2KAFA 1QVFA 4IIOA 2DXBA 1B3QA 3TQ7P 4CRIA 2O01E 1D0XA 1MMNA 1WI7A 4J7FA 2KGTA 4LDXA 2MCNA 2LX9A 1VYTA 4OP0A 2KXCA 5GJVB 1Q81C 1X6GA 4O5VA 4A4FA 5GMKm 2LJ1A 4NOYA 4X34A 2J6OA 2CH4W 2D0QB 1KIKA 1YP5A 1F1BB 1W1FA 3ASKA 5IN1A 1SF9A 2CH4A 3OA6A 1WLPB 2QYZA 2XI9A 3REBB 2A28A 3OMGA 2GTOA 3TCJA 3CPWP 1JEGA 4J6YA 2F2XA 3L2ZA 4BY6B 2RQVA 3URGA 4MMKA 2M16A 4FM4B 1OPKA 3VV0A 4KH1B 4BE0A 1J3TA 2X9HA 2DJQA 1GBRA 1PRLC 4OMMA 3CCMQ 1YJNA 4M78A 3G71Q 3MEVA 1LPLA 2CZ7B 3CCUT 2FZCB 4FW1A 3V8LA 1FMVA 2R57A 3CCRA 3H0HA 4LDWA 1WXUA 1QP2A 2K3YA 4EIKA 2EQJA 2Y90A 3QWXX 1E7OA 4C92F 1RI0A 4AG1C 4M7DA 3OYCA 1M3BA 3BDUA 3MPUB 4FYXB 4RTXA 4AMCA 2CP5A 5GJWB 3VRYA 1NLPC 1ZHIA 3CC4Q 3MO8A 4PJOA 3LWHA 1VQ8Q 3NHNA 3R6NA 1V29B 3QYGB 2HQEA 2KT8A 1M1FA 2EQKA 3GF5A 4WF2A 2XMFA 1AT1B 2DZCA 1YI2A 4FYWB 1X43A 1LNXA 2DL3A 2KQWA 1W70A 4LDYA 2RMOA 3A1PA 2XD0A 1I1JA 4KUIA 3CC4T 4QQGA 4P5NA 2MIOA 2L3PA 2NYSA 2DMOA 3JB9F 2D1XA 2C06A 1X2KA 1FMWA 2EJFA 3MHXA 4KBMB 2COWA 3GOXA 1PD0A 1PSEA 2QEXA 2K5IA 5L8RE 5GAOq 5LJ5g 2MOXA 3DKMA 3UT1A 4N0AC 2FPFA 3SWNC 5GAMj 4L59A 2AHJB 2COZA 2LVMA 1U06A 1HD3A 1QCNA 4DOWA 4HCBA 1M90U 2EYWA 1JXMA 2DBKA 4M77E 1YITT 1NBEB 1QP3A 1O9SA 5HY6A 5A0DA 1K8AC 2RQUA 2YRDA 1C6VX 2EWNA 4N4IA 2A37A 1IO6A 2B8AA 3CCUA 2HL5C 2CS7A 4DBFA 3PMTA 4OMFB 3A8HB 4IUQA 1GFDA 2PUKB 2DILA 5GAN2 2JUFA 2JTFA 5GMKl 1K4US 2EYZA 3META 2BUDA 1JJ2P 2GTJA 4M77D 1RL2A 4X9CA 2CT3A 1X01A 3D7SB 3CCST 3AT1B 3NTHA 4NS5A 3OW2S 3H0IA 4A4GA 1WJRA 1M1KU 3CMEQ 2HMAA 3HP9A 3M0SA 1WXBA 4J9HA 3OYFA 4JDSA 3RUXA 2VB6A 2KK4A 4C8QF 1YCSB 1VQ7T 4D6WA 1JXOA 3SHWA 3CD6T 3UDCA 2VASA 1W6XA 3FJ5A 2NLUA 2LNVA 3M54A 3M59A 2GF7A 1PC0A 1QVPA 3GNGA 4PJLA 1Q7YU 3OYJA 3M57A 3F70A 3CC2T 3CMET 2KEAA 3A8GB 3VS3A 1VQ9A 2WSCE 3JCMf 2CYZB 2FZGB 3CCQQ 1WJQA 3FRNA 1G3WA 2ED0A 5I21A 4LD9K 1KQSA 2FRYA 2FZKB 4Q5WA 4PL6A 1C0MA 1HSQA 3O8VA 4WCIA 2EQMA 2RJCA 2I0NA 4CI0C 1M2VA 1RAIB 4BI8B 3PMIA 2F69A 3ER0A 3C0CA 1UB4A 2JOYA 4JS4A 4FU6A 2HNIA 2ZPGB 4RMOA 4JJNK 1Z9ZA 1GXIE 1AHJB 1YITA 4OMQA 2JTEA 3VU3C 2K3XA 4E7HA 3CC7Q 5FU6C 4MDXA 2RH2A 1G3TA 1Y57A 1YJ9T 1VQ5Q 5IHNA 2RI2A 2K79A 2M9UA 1YJWQ 2QA4T
chains in the Genus database with same CATH topology
3RDVA 1LPLA 2E3IA 2HKQB 3E2UA 1WHHA 2E4HA 1TOVA 2HQHA 2CP7A 2COYA 2CP0A 2CP6A 2COZA 1WHKA 4B6MA 1WHJA 1IXDA 2HL5C 2Z0WA 2MPXC 1WHMA 2HL3A 2QK0A 3TQ7P 2E3HA 2CP2A 2CP5A 2M02A 1TXQA 2CP3A 2COWA 1WHLA 1WHGA 2HKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RDV A;  1LPL A;  2E3I A;  2HKQ B;  3E2U A;  1WHH A;  2E4H A;  1TOV A;  2HQH A;  2CP7 A;  2COY A;  2CP0 A;  2CP6 A;  2COZ A;  1WHK A;  4B6M A;  1WHJ A;  1IXD A;  2HL5 C;  2Z0W A;  2MPX C;  1WHM A;  2HL3 A;  2QK0 A;  3TQ7 P;  2E3H A;  2CP2 A;  2CP5 A;  2M02 A;  1TXQ A;  2CP3 A;  2COW A;  1WHL A;  1WHG A;  2HKN A; 
#chains in the Genus database with same CATH topology
 1PD1 A;  3CCE A;  3TRE A;  1PHT A;  2QDL A;  4KH0 B;  1BKB A;  2QAZ A;  4MDW A;  2DL8 A;  5GAM d;  3LH5 A;  1AD5 A;  1KD1 R;  3I55 T;  2AK5 A;  1T3L A;  5A2Q E;  3UWN A;  1K73 R;  3X26 B;  4M77 B;  1Z9Q A;  2QTX A;  1AWJ A;  1H64 1;  1VQO Q;  4M75 F;  1VQ4 Q;  1SG5 A;  3NPF A;  3CCS A;  3CC7 T;  1NZ9 A;  5KYX A;  1AZE A;  2J6K A;  2FRW A;  2VGM A;  3CEY A;  1MV0 B;  2PQW A;  4ESR A;  3L2R A;  4F17 A;  3INZ A;  5GAN 4;  1ZSZ A;  4M7A F;  4ZTF A;  1YWO A;  5KYU B;  1VQ7 A;  2CKK A;  2JN0 A;  2DER A;  4HVU A;  1KJW A;  2KE9 A;  3CD6 A;  4HT9 A;  3OBY A;  2HBP A;  1X2Q A;  1WJS A;  1PRM C;  1VQO T;  5EG2 A;  2A36 A;  3HRT A;  3CCV T;  2KRO A;  2DF6 A;  1K0S A;  2NUZ A;  3LWI A;  2FL7 A;  1I0C A;  1VQK T;  2PVG B;  1M3C A;  3CC2 A;  4OVA A;  2RQW A;  3CMA T;  4F14 A;  1OOT A;  2RJF A;  1VQP A;  4K11 A;  3VS7 A;  3JCM X;  2F1L A;  1W4S A;  2LRQ A;  2BE7 D;  2YUQ A;  1GCQ A;  1Q82 C;  2D9T A;  2YWW A;  2V8I A;  1K1Z A;  3CPW S;  1NEB A;  5J26 A;  4E7J A;  4GBQ A;  1OX8 A;  1UGR B;  1IHW A;  1AEY A;  4ORZ A;  2HAX A;  1MND A;  3PT9 A;  2RO0 A;  4F7U A;  6AT1 B;  2CT4 A;  1Y71 A;  2HL3 A;  2M02 A;  2HD0 A;  4XTW A;  3BE3 A;  3JB9 I;  1NPR A;  1G8X A;  3RR6 A;  1QKW A;  1YJ9 A;  4OML A;  1QVF S;  4F04 B;  3QG1 A;  4C0G A;  2K5F A;  5AYF A;  1AWW A;  4DBH A;  2CP7 A;  5GAN d;  2QA4 A;  1SKU B;  1KHC A;  5CKH A;  1DJ7 B;  2E41 A;  1YFN A;  1TTH B;  3I55 A;  3OW2 P;  2E3H A;  5GAN 8;  1FXX A;  4IUT A;  4RTZ A;  2X35 A;  2E5Q A;  2ZPI B;  2WSF E;  1BIB A;  2QTV A;  2K57 A;  4BAC A;  2JMA A;  2LZ6 B;  5KCH A;  4WTO B;  3JCM W;  3HRU A;  4ME7 A;  2EJ9 A;  4KRT A;  4M78 G;  5KE2 A;  3PVQ A;  1M30 A;  1MUZ A;  1OV3 A;  2R58 A;  5ECA A;  2J6F A;  2EQU A;  5DY9 A;  1BI3 A;  4GLK A;  5GAM h;  3BFM A;  1MGQ A;  1Q82 R;  3RKY A;  3QBY A;  3TEE A;  4ATO A;  2YLC A;  2VC8 A;  4M7D G;  2DXT A;  3VS4 A;  2E6Z A;  1Q81 U;  1W2B A;  1D3B B;  3V7C A;  4E7I A;  1PG5 B;  2EIF A;  1G3S A;  4XTU A;  5CAI A;  4PJO G;  4J6W A;  1H3Z A;  3CCV A;  1WHJ A;  2ABL A;  2DLP A;  1AWO A;  3EFO A;  3L2U A;  1VQK A;  1LCK A;  3T9N A;  3CMA A;  2LJ0 A;  2OTL Q;  5GAN 5;  2VGN A;  2MI6 A;  4Z89 A;  2X4Y A;  1M1G A;  3OB9 A;  3I56 Q;  5IT9 E;  1WXT A;  2EKO A;  4X1V A;  2EAY A;  5A0G A;  1BU1 A;  4J7I A;  4IUP A;  4BY6 C;  1Q86 C;  5IH2 A;  2D8H A;  2DM1 A;  1NJI U;  2H3J A;  1B07 A;  1U1S A;  4FL6 A;  4KT0 E;  3VYH B;  4NL3 A;  5HK0 A;  3M0Q A;  3GBQ A;  3UA6 A;  1RAG B;  5CCA A;  3VS6 A;  2DAQ A;  3H41 A;  3G6E Q;  3X24 B;  4ZTJ A;  2CRE A;  1VQN T;  2BIV A;  2OTL T;  2PVD B;  3HHT B;  1TG0 A;  3TU4 K;  3JSC A;  2F2W A;  2K5L A;  5C0M A;  1M2V B;  1BCM A;  4XTZ A;  3OYI A;  2FPD A;  2RM4 A;  2ZPF B;  1PM3 A;  2DK3 A;  1S72 T;  1B34 B;  4JJC A;  2GFA A;  3M5A A;  4E6R A;  1JQQ A;  1R0C B;  2ECZ A;  2E65 A;  2YRC A;  1QVG P;  1SHF A;  2CP6 A;  3G6E T;  2DRM A;  1B7T A;  3CPF A;  2F5T X;  4AFZ C;  2YT6 A;  5CVI A;  2BZY A;  2DX1 A;  1BCO A;  2EW3 A;  1K9A A;  5GAN h;  2EGA A;  1BI1 A;  4DBQ A;  4RTW A;  8ATC B;  1V76 A;  4UC4 A;  4N0A A;  1TOV A;  5IHI A;  5GAM e;  4E7L A;  5KYY B;  4FT2 A;  1I5L A;  1IGQ A;  2L0A A;  1Q86 R;  5FW9 A;  3CCL Q;  1Y96 A;  2DIG A;  4N4G A;  4PK4 A;  3QWY A;  4J9E A;  4OB2 B;  3J80 E;  1X6B A;  1YHQ A;  1NYF A;  1UEB A;  2MF2 A;  2CDT A;  2DFU A;  2RHY A;  2X3W D;  4RTT A;  2VWF A;  2DL4 A;  4XU2 A;  3BW1 A;  2GNC A;  9ATC B;  4V2S A;  2A08 A;  1I8F A;  4C92 A;  2RNA A;  5LJ5 d;  3JCM g;  1UGP B;  3CXC P;  4JLI A;  2DET A;  1WNL A;  1M5Q 1;  3H6Z A;  3U23 A;  4EMK B;  1WHG A;  2H3E B;  2RHX A;  1MMD A;  2E12 A;  3H8Z A;  2E3I A;  4DEX A;  3OYG A;  2QG9 B;  1K8A U;  1OU9 A;  3MKD A;  1CKB A;  1SRL A;  2NUT B;  4J9F A;  4LN2 A;  3A8L B;  1QVF P;  2AKL A;  2VV5 A;  3H0F A;  2FB7 A;  1VQN A;  3M55 A;  2OTL A;  1N9R A;  2KRN A;  1QWE A;  3EG9 A;  4A4K A;  2PVO B;  1BIA A;  3CCM T;  3NTI A;  1K9M U;  2KNB B;  3G71 T;  2QQ9 A;  1HXD A;  3M56 A;  1S72 A;  2KVQ G;  4A4H A;  2KYB A;  3A8O B;  4ZN3 A;  2OTJ A;  4GY5 A;  1UG1 A;  2VVK A;  3RES A;  2AZV A;  4BE2 A;  2RK2 A;  4DBR A;  1WYX A;  1K0X A;  1N8R C;  3J81 E;  1SEM A;  3RBB B;  4M75 G;  3OYL A;  1U3O A;  4N4H A;  1VQ8 T;  2L5Q A;  4AT1 B;  5D6Y A;  2XU8 A;  5GAN e;  1C1A A;  2O9V A;  5GMK i;  2HSE B;  2AT1 B;  4X9D A;  4ZGJ B;  2NWM A;  3QPH A;  4EPC A;  5GAN 6;  2XDD A;  3RKX A;  3OBW A;  3EGU A;  2F2V A;  2M0O A;  2DEQ A;  2ATC B;  3P8B B;  5CKF A;  2DRK A;  4J8O A;  2ESW A;  1GCP A;  4AFS C;  1D0Z A;  1N9S A;  5LJ3 g;  1IXD A;  4JJD A;  5CIU A;  1OZ2 A;  2QK0 A;  4GLM A;  4HCC A;  3LYI A;  1TXQ A;  2YUN A;  2QGG A;  2DD4 A;  3EGD B;  4FSS A;  2DBM A;  3VKI A;  2K3B A;  3RMQ A;  3HSB A;  1VA7 A;  3LH0 A;  4E7Z A;  1MNE A;  1UE9 A;  1BYM A;  4JRQ A;  3RNJ A;  4ZGE B;  2QXF A;  3A98 A;  4M78 E;  4HXJ A;  1O75 A;  2MAM A;  1UJY A;  4LUD A;  1CSK A;  2J05 A;  2DTO A;  1X75 C;  2YRV A;  5GMK h;  4R56 A;  1N8R R;  1TH7 A;  5L23 A;  2ED1 A;  4BDY A;  5CKE A;  1K76 A;  2P4T A;  2L8D A;  4C8Q A;  3CCJ Q;  3UF4 A;  5FRN A;  2DIQ A;  4Z02 A;  2RJE A;  3CBM A;  1VQL Q;  4M7D E;  5LJ5 h;  1Y0M A;  1PKS A;  3MP8 A;  1R77 A;  4PJO E;  4C0D B;  5LJ3 h;  4M77 C;  3EHR A;  4B6M A;  3IQL A;  2A3L A;  4E2F B;  2LT4 A;  3CCM A;  4XU1 A;  3EG1 A;  1WQW A;  4F7U G;  3G71 A;  2O4X B;  4M78 D;  2P0Q A;  4RG8 A;  3RER A;  3DLM A;  2CUB A;  3OSS C;  2M1H A;  3OQ5 A;  1QLY A;  1KD1 C;  3CCJ T;  1IRX A;  4J9G A;  1ZA2 B;  1VQM Q;  2AZS A;  1K73 C;  4M7D D;  4PFZ A;  2OAU A;  4CC3 A;  2DVJ A;  4MZP A;  4M7D C;  5I22 A;  3CC4 A;  3OYE A;  3NFC A;  1VQ8 A;  4PJO D;  5GAO n;  5IHK A;  4OB1 B;  2JW4 A;  2ZPE B;  4Z88 A;  3NMZ C;  1KG1 A;  2X3X D;  4E47 A;  2DKG A;  4JZ3 A;  1QWF A;  1U5S A;  5GAO p;  3OS1 A;  1UGQ B;  2RHU A;  5GAN j;  2GGR A;  3C4S A;  1NEG A;  1VUB A;  2V1Q A;  3ZBD A;  2ZCF B;  3UPU A;  1Q82 U;  3FJP A;  4A4E A;  2L3R A;  1WZO A;  1MMA A;  2CSQ A;  1VYU A;  4C5I A;  1X6O A;  3E1S A;  5A0L A;  2BZ8 A;  4RG2 A;  2K2V A;  5I11 A;  3QHS A;  1NYG A;  2B86 A;  1XQH A;  3CCQ T;  4FYV B;  2KRM A;  3V8J A;  2KY9 A;  3OS5 A;  4J9D A;  3I5S A;  3MP6 A;  2QQA A;  3ZL7 C;  1M90 C;  1TSF A;  4M75 A;  2EBP A;  3PIP A;  4XTY A;  4QVD A;  1D1A A;  3EAE A;  4CC4 B;  4XTV A;  4QQ6 A;  2E6N A;  4ELZ C;  5J39 A;  4M7A A;  3M0T A;  3QKJ A;  1P92 A;  1VQ6 Q;  2COY A;  1H8K A;  1ZUY A;  2OJ2 A;  3OYN A;  1D1B A;  1VIF A;  5LJ5 e;  3GP8 A;  3EG2 A;  1M27 C;  3PNW C;  4M78 B;  4JRP A;  4E7S A;  2HKQ B;  2K4Y A;  1VQ5 T;  2X51 A;  2IIM A;  1QVG S;  1KQS P;  1IRE B;  1YJW T;  2PNI A;  2EJG A;  2OAW A;  1HK9 A;  3X28 B;  1Y07 A;  4M7D B;  2BE9 B;  1VQ6 T;  1EZZ B;  3PVL A;  2X4J A;  5CR2 A;  1S1N A;  4PJO B;  2CGH A;  1SRM A;  2OX7 A;  1VQ4 T;  3NGP A;  1WHH A;  3UAT A;  1SSF A;  2EQI A;  3HPW A;  5FWC A;  3CME A;  1KFZ A;  4EMG A;  2DE0 X;  1ZQ1 A;  4R0K A;  2MPX C;  1OQK A;  4DOV A;  1M90 R;  2BTT A;  3OW2 A;  3RIR A;  3J7A F;  4FYY B;  2CP2 A;  2CSI A;  1YIJ Q;  2KR3 A;  4MML A;  3HFN A;  3VS0 A;  2EYX A;  3G4S Q;  1T3S A;  5C6S A;  2EPD A;  3E2U A;  1I07 A;  2XG8 D;  3JV3 A;  4RUG A;  2ROT A;  3I35 A;  2HCK A;  4BE1 A;  2YUO A;  1Q86 U;  2GBQ A;  3E9F A;  3CXC S;  5DM7 R;  1UUE A;  2FO0 A;  1OZ3 A;  1RAF B;  3JCM c;  2DXC A;  1RAH B;  3CCQ A;  4KGV B;  4BI4 A;  2DYB A;  1FWZ A;  4M75 E;  1WPY A;  4KGZ B;  3TSW A;  3S3N A;  2DPP B;  2RN8 A;  5D7U A;  3G4S T;  4XQ3 A;  1PKT A;  4OF1 A;  2EGE A;  4C0F A;  4PLL A;  4OB3 B;  5KH6 A;  1LJO A;  1PSF A;  2XDB A;  5FU7 C;  4C92 G;  2VXF A;  5I2S A;  5D6X A;  1Y7X A;  5D6W A;  1RUW A;  1YBY A;  3M53 A;  4LE9 A;  2YLB A;  4RTU A;  5FRM A;  3FDR A;  1X69 A;  2KI7 A;  4QKU A;  1ZBJ A;  3CC7 A;  2R5A A;  3OS0 A;  5GMK j;  1Q7Y R;  1VQ5 A;  2Z0W A;  1QQJ A;  1YJW A;  1JRI A;  4FW2 A;  5LJ5 j;  2K2M A;  2EYQ A;  4OMN A;  4ZN1 A;  1TS9 A;  3KBG A;  3OMC A;  3GIB A;  3EH1 A;  3QXE B;  2PU9 B;  5LJ3 j;  2JT4 A;  2RK1 A;  4Y91 A;  2DXU A;  2JTM A;  2JVV A;  2RI5 A;  1FYN A;  1VQO A;  1VQ4 A;  4J9B A;  2HBW A;  3PIO A;  3DB3 A;  2CZ1 B;  4QVC A;  3EHQ A;  1UFF A;  5HKC A;  2RQT A;  2QQR A;  3PGG A;  1BBZ A;  1JB0 E;  3QUI A;  3JB9 G;  4AFQ C;  1YJN Q;  1KC8 C;  4HA8 A;  1YWP A;  2L3S A;  5HK3 A;  1ZSZ C;  2J06 A;  2E70 A;  3CCR Q;  3A5Z B;  4A53 A;  2R5M A;  3RKW A;  4E7K A;  3PTA A;  1WQ7 A;  5KE3 A;  3C94 A;  4MZT A;  4NL2 A;  4F7U E;  2DTI A;  3M4G A;  2YDL A;  1R8O B;  2VYT A;  5FLX E;  4EMK C;  2AIR B;  4D8K A;  3QDR B;  3JCM d;  3C95 A;  2DA9 A;  3FIF A;  2H8H A;  3V7R A;  1MHN A;  1X27 A;  3I56 T;  1SPK A;  3JCM P;  4L6V 5;  1YI2 Q;  3QII A;  3P8D A;  2P84 A;  3VJP A;  4PJJ A;  1GFC A;  4ELY C;  1WA7 A;  5FU7 B;  4J5Y A;  2XDP A;  3OYK A;  3CPW A;  1W2B P;  4FIB A;  2XK0 A;  3HRS A;  3L2W A;  3E19 A;  2VKN A;  2FVU A;  3EGX A;  2LCC A;  3KFV A;  1XNI A;  4FT4 A;  3LX7 A;  1Q95 G;  1HYO A;  3VRZ A;  4AG2 C;  4M75 B;  1N8R U;  3EH2 A;  3SFM A;  5GAN 3;  4J6X A;  1KC8 R;  1BK2 A;  1EX4 A;  1FMK A;  3OYB A;  2QEX Q;  3OS2 A;  3SWN A;  1TUG B;  1WGS A;  3DLL A;  5IXF A;  4VUB A;  2A7Y A;  4LNP A;  4TVR A;  2L3Q A;  4C8Q G;  3V7S A;  2HZY A;  3S3O A;  4A63 B;  2P0K A;  3EG3 A;  5J3B A;  1UHC A;  2RHI A;  3A8M B;  5KYX B;  2J7I A;  2JZ2 A;  2EKH A;  1H3H A;  1WIE A;  1ZSZ B;  1BI2 A;  2DZ9 A;  2RJD A;  1QKX A;  2K6D A;  2QEX T;  1WHK A;  4HCK A;  2GCX A;  2O88 A;  2RF0 A;  4J83 A;  1WHM A;  4RCC A;  1AZG B;  3CCU Q;  3REA B;  2DL7 A;  1KQ1 A;  3L1A A;  3VS5 A;  3CCL T;  4PJM A;  1M4Z A;  5LJ3 d;  3MP1 A;  2DJZ A;  4ANJ A;  2KRS A;  5GAM f;  1R0B G;  4DA4 A;  1HJD A;  2KT1 A;  4C5G A;  1I4K 1;  4M77 A;  4BD3 A;  4O6J A;  2W10 A;  5M9O A;  1NJI C;  1VOM A;  3MEW A;  2MYS A;  3P8H A;  1N6A A;  2O2O A;  1ZX6 A;  1NE8 A;  2XID A;  2OI3 A;  2E1H A;  2HDA A;  1KSW A;  1N27 A;  3I56 A;  1CKA A;  3E9G A;  2WAC A;  3QO3 A;  1YNZ A;  5KYU A;  4M77 F;  1H92 A;  2G3R A;  4F7U B;  4C0D C;  3JCM h;  2ZAE A;  2P4R A;  2CP3 A;  1KQ2 A;  4M78 F;  2KDS A;  3G6E A;  3X25 B;  4J9C A;  3QDF A;  3LGF A;  3ULR B;  1Q81 R;  1KQS S;  1VQ9 Q;  1UDL A;  3H9N A;  1KD1 U;  4JS5 A;  1ACM B;  2RD1 A;  4JRI A;  3WVD B;  1OUL A;  1K73 U;  1UHF A;  4JPB W;  4M7D F;  3JRZ A;  3M9Q A;  4EMH A;  3OYD A;  2C0O A;  2BKD N;  4M7A G;  2DD5 A;  1EFN A;  4PJO F;  3DB4 A;  1TWB A;  3UA7 A;  1NLO C;  2W0Z A;  2LCS A;  1JJ2 A;  1M2O A;  4OGE A;  4C5E A;  7AT1 B;  4ZNX A;  1PNJ A;  1VQ9 T;  1YIT Q;  1NJI R;  4PNO A;  5GAN 7;  8AT1 B;  4QVZ A;  3C12 A;  2ZZD A;  1SHG A;  2LP5 A;  4LD6 A;  1AVZ C;  1UGS B;  4C92 E;  3QJ6 A;  5KYW A;  1UJ0 A;  3CCE Q;  2GFU A;  1OPL A;  2KSS A;  5GAN f;  3CCL A;  3LLR A;  4IUR A;  1LOJ A;  1M3A A;  3EFO B;  1QCO A;  3VUB A;  4R55 A;  3CCS Q;  1D1C A;  1G5V A;  3R6O A;  5KYN A;  1OU8 A;  2SRC A;  3QZ9 B;  2LQ8 A;  5FRO A;  1IHV A;  2D6F A;  2LQN A;  3FC3 A;  4C92 D;  3X20 B;  4FCY A;  4JUV A;  3CCE T;  2D0N A;  1VQ7 Q;  1WFW A;  4C92 C;  1WX6 A;  3FB9 A;  1E6H A;  2K7A A;  2LCL A;  3CD6 Q;  2YXY A;  2EVR A;  1KK7 A;  1ZBX A;  2G6F X;  2X4X A;  3M0U A;  4KGX B;  2D8J A;  2V8J A;  1RAD B;  4M78 C;  2FYK A;  3FEO A;  4FSX A;  1D3B A;  3JCM e;  1K9M C;  1G83 A;  2PZ1 A;  3OSV A;  1VQL T;  1TUD A;  2QAS A;  4IUV A;  3M4Y A;  3CC2 Q;  1JU5 C;  2E5K A;  2V26 A;  2K9G A;  4Y28 E;  1IZ6 A;  3MJX A;  4AFU C;  1VQP Q;  3Q1J A;  2LT1 A;  3JCM J;  2XKO C;  3MEU A;  1VYV A;  1A0N B;  4PJO C;  4OMO A;  3CBO A;  2Y4X A;  2M0Y A;  5EC7 A;  2GQI A;  2RA2 A;  1NPP A;  1JO8 A;  1YN8 A;  3EGX B;  3OYY A;  1M8M A;  3QJY A;  4B9W A;  3JB9 D;  1LVK A;  5LL6 S;  4MZM A;  3OYH A;  3WVE B;  2NUP A;  3NTK A;  1GBQ A;  2DO3 A;  1VQM T;  3TSZ A;  4A54 A;  1NG2 A;  2ZGW A;  1WHL A;  3VS2 A;  1K8A R;  2LDM A;  2EFI A;  4C0Z A;  1VQP T;  2HEQ A;  3CQT A;  2FEI A;  1UTI A;  2HSP A;  3SEM A;  2QGF B;  3SWN B;  1FX7 A;  5KCO A;  4KUD K;  2L2P A;  3I5R A;  4DQ2 A;  1YJ9 Q;  4PJN A;  3G7Z A;  2CP0 A;  5CKD A;  1QMC A;  3N5B B;  1VIE A;  3QYH B;  4Z8A A;  1Y96 B;  2QA4 Q;  2LQK A;  2KXD A;  4PFO A;  5CKB A;  2E64 A;  1BB9 A;  3RMS A;  3I55 Q;  4BUG A;  1RAA B;  5IAY A;  4LUE A;  2VUB A;  1B34 A;  5IXB A;  1ZUU A;  5HCK A;  3ME9 A;  2XIC A;  1K9M R;  2EYY A;  1I81 A;  1OI1 A;  2MWO A;  4LDU A;  2M51 A;  2HQH A;  2IPO B;  4JJB A;  2EGC A;  4HCZ A;  1TU0 B;  2QQB A;  2X4W A;  5GMK e;  3LGL A;  2JMC A;  5I2M A;  4BB7 A;  4C8Q E;  4IUU A;  2LMJ A;  3QSU A;  3JAM E;  4C92 B;  3BY7 A;  3SDZ A;  2CZ6 B;  3JCM Q;  1IB8 A;  1UEC A;  1BI0 A;  2HKN A;  2JS2 A;  1QW1 A;  4HVV A;  1W2B S;  2P0P A;  3THK A;  5LJ3 e;  2RB6 A;  5FWB A;  1V1C A;  1ZLM A;  3M58 A;  5KYY A;  3OYA A;  4HKE A;  1ZA1 B;  1XOV A;  2L89 A;  1OX9 A;  2RHZ A;  4BI3 A;  2ENM A;  2HQX A;  2RPN A;  3AHU A;  1M1K C;  2BZX A;  4PKC C;  1EIF A;  1G2B A;  3CCV Q;  4XTX A;  4RCB A;  1N5Z A;  3CCJ A;  4OB0 B;  4HT8 A;  1VQL A;  4C8Q D;  1VQK Q;  4LDV A;  1E6G A;  3EG9 B;  4C8Q C;  2XHC A;  4F16 A;  2AKK A;  3CMA Q;  2C0T A;  3SD4 A;  1M8V A;  2C0I A;  1AWX A;  3S6W A;  2RQR A;  1OEB A;  2FG0 A;  3EFS A;  1GL5 A;  5LJ5 f;  5CQX A;  2QDY B;  4EDU A;  1Q7Y C;  3PE0 A;  1TUC A;  2KMT A;  3EFR A;  4RTV A;  5LJ3 f;  4EMK A;  1XJW B;  3HKS A;  1KC8 U;  1VQM A;  1RI9 A;  2NUT A;  1G3Y A;  3LW5 E;  4PFP A;  3O5Z A;  2LJ3 A;  5AT1 B;  4JRK A;  5GAO m;  1MV3 A;  4RTY A;  5CO7 A;  2IG0 A;  2YHT A;  4JZ4 A;  4XU3 A;  1D09 B;  2DYI A;  2QI2 A;  3ZFJ A;  3QZ5 B;  2LX7 A;  4OMP A;  5DLQ E;  1YIJ T;  2E10 A;  4QT7 A;  4B9X A;  4XK8 E;  4Y92 A;  1I5O B;  2LNH B;  2PTK A;  4M4Z A;  4CC7 A;  3KUF A;  1RLQ C;  5FU6 B;  1M1K R;  2JM9 A;  4QW2 A;  1PWT A;  5GAM g;  2DNU A;  2JM8 A;  4M7A E;  4LXC A;  2YSQ A;  4JLG A;  3RDV A;  2SEM A;  2QQS A;  3SB2 A;  2PUO B;  5KYW B;  1T0H A;  4F7U F;  2V8K A;  2YUP A;  1XTD A;  2ZPH B;  3MEA A;  3JCM b;  1KHI A;  2O9S A;  1QCF A;  4M75 D;  1NM7 A;  1ARK A;  1U1T A;  3ZEH A;  4M77 G;  4M75 C;  5DLO A;  3JCM V;  3JB9 J;  1YHQ Q;  2MWP A;  2F5K A;  1ABO A;  4C8Q B;  3EG0 A;  3VS1 A;  1AOJ A;  2DTH A;  2Y4Y A;  3GNF B;  3HFO A;  4C5H A;  4M7A D;  2ROL A;  2RI3 A;  2CUD A;  3S3M A;  1VQ6 A;  2JNG A;  4M7A C;  2JS0 A;  3HTR A;  4XU0 A;  1YCY A;  4YTL A;  2GQV A;  2MK5 A;  4IKF A;  2V1R A;  1RLP C;  3L2V A;  5CK9 A;  3JB9 H;  2A0F B;  2ZPB B;  3EGD A;  1RAC B;  1PCX A;  1YHQ T;  1WDX A;  4L5G A;  1QVG A;  2FPE A;  3KXT A;  4PLI A;  3VUZ A;  4HVW A;  4ZGD B;  3I9Q A;  1ZSG A;  2KBT A;  1RAE B;  3BDL A;  1VQN Q;  3WXM B;  2LC4 A;  2IVW A;  3L2Q A;  2DL5 A;  2WSE E;  2FHD A;  2JXB A;  2VXE A;  2KYM A;  1GRI A;  4II1 A;  4XAX B;  4DEY A;  3GPL A;  4J9I A;  2MMP A;  2DEU A;  4IIM A;  1YJN T;  3CBP A;  2LQW A;  1SSH A;  1YIJ A;  4BDZ A;  3TVT A;  4RKU E;  1ABQ A;  2NUP B;  1S72 Q;  2OTJ Q;  3CCR T;  2O4X A;  5GAO r;  3G4S A;  1T0J A;  5GAN g;  1GCQ C;  3OYM A;  1JBM A;  3PFS A;  2O31 A;  1U8R A;  4OGC A;  2I2L A;  1IGU A;  2LTO A;  2E4H A;  3GLX A;  3MCA B;  3VYG A;  4D8D A;  1D0Y A;  2DVE A;  1UGV A;  3L42 A;  3G1J A;  4CC2 A;  3V8K A;  2JJ9 A;  3FLG A;  3M0P A;  4KUL A;  2CZ0 B;  3CXC A;  1OYX A;  1JJ2 S;  2OTJ T;  1M9S A;  3HL8 A;  1YI2 T;  1ZUK A;  3OY9 A;  1MMG A;  5CQY A;  1RAB B;  5GAO l;  4M7A B;  4QQD A;  3M0R A;  2KAF A;  1QVF A;  4IIO A;  2DXB A;  1B3Q A;  3TQ7 P;  4CRI A;  2O01 E;  1D0X A;  1MMN A;  1WI7 A;  4J7F A;  2KGT A;  4LDX A;  2MCN A;  2LX9 A;  1VYT A;  4OP0 A;  2KXC A;  5GJV B;  1Q81 C;  1X6G A;  4O5V A;  4A4F A;  5GMK m;  2LJ1 A;  4NOY A;  4X34 A;  2J6O A;  2CH4 W;  2D0Q B;  1KIK A;  1YP5 A;  1F1B B;  1W1F A;  3ASK A;  5IN1 A;  1SF9 A;  2CH4 A;  3OA6 A;  1WLP B;  2QYZ A;  2XI9 A;  3REB B;  2A28 A;  3OMG A;  2GTO A;  3TCJ A;  3CPW P;  1JEG A;  4J6Y A;  2F2X A;  3L2Z A;  4BY6 B;  2RQV A;  3URG A;  4MMK A;  2M16 A;  4FM4 B;  1OPK A;  3VV0 A;  4KH1 B;  4BE0 A;  1J3T A;  2X9H A;  2DJQ A;  1GBR A;  1PRL C;  4OMM A;  3CCM Q;  1YJN A;  4M78 A;  3G71 Q;  3MEV A;  1LPL A;  2CZ7 B;  3CCU T;  2FZC B;  4FW1 A;  3V8L A;  1FMV A;  2R57 A;  3CCR A;  3H0H A;  4LDW A;  1WXU A;  1QP2 A;  2K3Y A;  4EIK A;  2EQJ A;  2Y90 A;  3QWX X;  1E7O A;  4C92 F;  1RI0 A;  4AG1 C;  4M7D A;  3OYC A;  1M3B A;  3BDU A;  3MPU B;  4FYX B;  4RTX A;  4AMC A;  2CP5 A;  5GJW B;  3VRY A;  1NLP C;  1ZHI A;  3CC4 Q;  3MO8 A;  4PJO A;  3LWH A;  1VQ8 Q;  3NHN A;  3R6N A;  1V29 B;  3QYG B;  2HQE A;  2KT8 A;  1M1F A;  2EQK A;  3GF5 A;  4WF2 A;  2XMF A;  1AT1 B;  2DZC A;  1YI2 A;  4FYW B;  1X43 A;  1LNX A;  2DL3 A;  2KQW A;  1W70 A;  4LDY A;  2RMO A;  3A1P A;  2XD0 A;  1I1J A;  4KUI A;  3CC4 T;  4QQG A;  4P5N A;  2MIO A;  2L3P A;  2NYS A;  2DMO A;  3JB9 F;  2D1X A;  2C06 A;  1X2K A;  1FMW A;  2EJF A;  3MHX A;  4KBM B;  2COW A;  3GOX A;  1PD0 A;  1PSE A;  2QEX A;  2K5I A;  5L8R E;  5GAO q;  5LJ5 g;  2MOX A;  3DKM A;  3UT1 A;  4N0A C;  2FPF A;  3SWN C;  5GAM j;  4L59 A;  2AHJ B;  2COZ A;  2LVM A;  1U06 A;  1HD3 A;  1QCN A;  4DOW A;  4HCB A;  1M90 U;  2EYW A;  1JXM A;  2DBK A;  4M77 E;  1YIT T;  1NBE B;  1QP3 A;  1O9S A;  5HY6 A;  5A0D A;  1K8A C;  2RQU A;  2YRD A;  1C6V X;  2EWN A;  4N4I A;  2A37 A;  1IO6 A;  2B8A A;  3CCU A;  2HL5 C;  2CS7 A;  4DBF A;  3PMT A;  4OMF B;  3A8H B;  4IUQ A;  1GFD A;  2PUK B;  2DIL A;  5GAN 2;  2JUF A;  2JTF A;  5GMK l;  1K4U S;  2EYZ A;  3MET A;  2BUD A;  1JJ2 P;  2GTJ A;  4M77 D;  1RL2 A;  4X9C A;  2CT3 A;  1X01 A;  3D7S B;  3CCS T;  3AT1 B;  3NTH A;  4NS5 A;  3OW2 S;  3H0I A;  4A4G A;  1WJR A;  1M1K U;  3CME Q;  2HMA A;  3HP9 A;  3M0S A;  1WXB A;  4J9H A;  3OYF A;  4JDS A;  3RUX A;  2VB6 A;  2KK4 A;  4C8Q F;  1YCS B;  1VQ7 T;  4D6W A;  1JXO A;  3SHW A;  3CD6 T;  3UDC A;  2VAS A;  1W6X A;  3FJ5 A;  2NLU A;  2LNV A;  3M54 A;  3M59 A;  2GF7 A;  1PC0 A;  1QVP A;  3GNG A;  4PJL A;  1Q7Y U;  3OYJ A;  3M57 A;  3F70 A;  3CC2 T;  3CME T;  2KEA A;  3A8G B;  3VS3 A;  1VQ9 A;  2WSC E;  3JCM f;  2CYZ B;  2FZG B;  3CCQ Q;  1WJQ A;  3FRN A;  1G3W A;  2ED0 A;  5I21 A;  4LD9 K;  1KQS A;  2FRY A;  2FZK B;  4Q5W A;  4PL6 A;  1C0M A;  1HSQ A;  3O8V A;  4WCI A;  2EQM A;  2RJC A;  2I0N A;  4CI0 C;  1M2V A;  1RAI B;  4BI8 B;  3PMI A;  2F69 A;  3ER0 A;  3C0C A;  1UB4 A;  2JOY A;  4JS4 A;  4FU6 A;  2HNI A;  2ZPG B;  4RMO A;  4JJN K;  1Z9Z A;  1GXI E;  1AHJ B;  1YIT A;  4OMQ A;  2JTE A;  3VU3 C;  2K3X A;  4E7H A;  3CC7 Q;  5FU6 C;  4MDX A;  2RH2 A;  1G3T A;  1Y57 A;  1YJ9 T;  1VQ5 Q;  5IHN A;  2RI2 A;  2K79 A;  2M9U A;  1YJW Q;  2QA4 T; 
#chains in the Genus database with same CATH homology
 3RDV A;  1LPL A;  2E3I A;  2HKQ B;  3E2U A;  1WHH A;  2E4H A;  1TOV A;  2HQH A;  2CP7 A;  2COY A;  2CP0 A;  2CP6 A;  2COZ A;  1WHK A;  4B6M A;  1WHJ A;  1IXD A;  2HL5 C;  2Z0W A;  2MPX C;  1WHM A;  2HL3 A;  2QK0 A;  3TQ7 P;  2E3H A;  2CP2 A;  2CP5 A;  2M02 A;  1TXQ A;  2CP3 A;  2COW A;  1WHL A;  1WHG A;  2HKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...