1WHJA

Solution structure of the 1st cap-gly domain in mouse 1700024k14rik hypothetical protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
GSSGSSGLPNSDHTTSRAMLTSLGLKLGDRVVIAGQKVGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGRVQYFKCAPKYGIFAPLSKISKLKDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 1700024K14
publication title Solution structure of the 1st CAP-Gly domain in mouse 1700024K14Rik hypothetical protein
rcsb
source organism Mus musculus
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whjA00
2COZA 1LPLA 2COWA 2CP7A 1WHHA 2CP6A 2CP5A 2E4HA 2MPXC 1WHJA 2QK0A 1TXQA 2HL5C 2E3HA 1WHKA 2Z0WA 1IXDA 1WHLA 1WHMA 2CP2A 2E3IA 1WHGA 2COYA 2HKNA 2HL3A 4B6MA 3E2UA 1TOVA 2CP3A 2HQHA 3TQ7P 3RDVA 2M02A 2HKQB 2CP0A
chains in the Genus database with same CATH superfamily
4MZTA 1KQSS 2JS2A 1QW1A 4M7DE 2HSPA 1WJQA 3EH1A 5GMKi 4XU3A 4CC4B 3FC3A 5KE2A 4RTYA 2RN8A 2ECZA 5GAMh 2AZVA 3E9GA 3OBWA 2DBMA 2O01E 1M2OA 1K73U 1Y7XA 2DIGA 2QDYB 2C0OA 1RAFB 4C5EA 1WXUA 1UFFA 4PJLA 2LQWA 1QMCA 5KYYA 5LJ3j 1N5ZA 3EFOA 1BI0A 4OVAA 2SEMA 1YI2T 1OULA 3CMAT 4PNOA 1NLPC 2O4XB 4LDXA 1WX6A 2V8KA 4F14A 1WFWA 2DF6A 4FM4B 3Q1JA 4KGZB 2DL7A 4JRPA 2RQVA 2MWPA 1X6OA 2DEUA 3I5SA 4LE9A 2YRCA 2RF0A 4AT1B 1AEYA 3PTAA 1D09B 2FZCB 4BACA 1AWOA 1FMWA 2GQIA 3T9NA 1T3LA 3QZ9B 3VJPA 4HCZA 3C0CA 2ESWA 2ENMA 4F04B 3RMSA 3OYHA 3OSVA 4M78E 3EFSA 4ZNXA 5LJ5f 3OYFA 3MEWA 4YTLA 1M8MA 2F5KA 3CCLA 3QSUA 2A3LA 1YWPA 2HKQB 2K2MA 1YJNT 5L8RE 1VQ9Q 1G3YA 3MO8A 1AWWA 2V26A 2DTHA 2HMAA 2J6KA 4NOYA 4L6V5 5KCOA 3CCMA 2ZPGB 1K4US 1OU9A 2PQWA 2RQRA 2ZPEB 4V2SA 1A0NB 2E10A 4BB7A 2L3PA 4XTZA 2CREA 2FG0A 2HBWA 4ELZC 3H6ZA 3L1AA 3E2UA 3L2VA 4E6RA 1VQLT 4C92E 3RBBB 2D9TA 1VQPA 2DEQA 1UTIA 1Y57A 1YN8A 1YJWA 1OV3A 2LQ8A 3G6ET 3JCMf 2L3RA 2J6FA 4FYWB 3OW2A 5GANf 3UA6A 4QW2A 1OX8A 2QQBA 3I5RA 2XU8A 1FWZA 1VQKQ 3A8HB 3FIFA 4M7AB 4E7ZA 2FB7A 1EZZB 1B34A 4HVWA 2YUQA 2RI3A 3CXCS 3G7ZA 1GL5A 1W1FA 2EW3A 1UGVA 3G4SA 2V8IA 2K57A 2YDLA 1ZX6A 3WVEB 1R0BG 2H8HA 4ATOA 4LDUA 2DD5A 1M1GA 2LZ6B 5KYXB 4X1VA 3JCMJ 2GTJA 3AT1B 4O5VA 3L2WA 2BKDN 5IHKA 2VKNA 2AHJB 2K5IA 2LTOA 4JRQA 2JN0A 3CD6A 1K0XA 1KK7A 5CQYA 4F7UF 1W70A 2DRMA 4JZ3A 3H8ZA 2DPPB 2E5KA 2E3IA 1JXOA 4HXJA 3AHUA 2J06A 3ER0A 3OYYA 1M1FA 5GMKj 1RACB 2F2WA 1I1JA 4F7UA 4BDZA 5A2QE 3CCST 4HCCA 2NUPB 1QVGS 3TREA 4JRKA 1NYGA 4AFQC 2DL5A 4J7FA 3X20B 3OYIA 1JRIA 1NYFA 2QQAA 1HYOA 4OB1B 1O9SA 3M0PA 4Z02A 1ZBJA 2DNUA 2RQWA 1MGQA 1WA7A 2DZ9A 3VS7A 2DERA 1K76A 4RTVA 3CCJQ 3LYIA 3CPWP 3CCUQ 5KYUB 2D8HA 3KFVA 2ED1A 3BDLA 1NE8A 1VQ7A 1G3WA 4TVRA 4WCIA 3VS1A 2DJZA 1WQWA 4QQ6A 1QWEA 2A36A 2KROA 1I5OB 2DAQA 2DVEA 1VQ6A 2X35A 4PJOE 5AYFA 3TCJA 3HP9A 2A08A 3VV0A 3X28B 5FRMA 2VXEA 1RAAB 3L2UA 4XTVA 1MV0B 2EYZA 5D6YA 2CS7A 4FYVB 3CMET 2KT1A 1WLPB 2EYWA 2MI6A 2HNIA 4M75B 1KC8C 1RAEB 3EG1A 2FEIA 4E7HA 1NJIU 1BBZA 2KDSA 3DLLA 4HT8A 1QVPA 1UGSB 2P4RA 1NEBA 1UGRB 1JJ2P 3LWHA 4C0DB 2GQVA 3EHRA 4C8QE 2YUOA 2LQNA 4LNPA 2DYBA 1VQ8T 3LX7A 1MMAA 1JO8A 3M5AA 3QBYA 1S72A 2COWA 3M59A 1AWXA 4BI8B 3L42A 1VYVA 1NZ9A 4PJNA 5D7UA 3FJ5A 3CCQA 2D8JA 1M27C 2XK0A 4OB0B 1PG5B 1Q82U 4M77A 1I07A 2K9GA 1WZOA 2P0KA 4C5IA 4IUUA 4P5NA 5LJ3g 4PK4A 1X6BA 3CC7T 1YITA 3JB9H 1VQOA 2RMOA 1FX7A 2CKKA 3QJ6A 2FL7A 1Q86U 2QQ9A 2Z0WA 4E7KA 2ATCB 2COYA 2WSCE 5FU7C 1D1BA 2K3BA 4AG2C 2VXFA 2E5QA 2QA4A 1YHQQ 4RG8A 1KD1C 4M4ZA 3MCAB 1SRMA 4GLKA 3OYCA 3CCET 4LD9K 1UJYA 4QVZA 2O4XA 3CCVT 3QDFA 1V29B 2A28A 2DFUA 3FLGA 3KUFA 1E6GA 4M77C 2L3SA 4HVVA 1FMVA 4JRIA 4M7DB 2NYSA 1MUZA 2HZYA 3G71Q 2QEXQ 5A0LA 1M1KU 2DK3A 3CBPA 5IHNA 1QWFA 1OI1A 2V1RA 2RNAA 2QTVA 2KVQG 2RB6A 2A37A 1KQSA 4MDWA 2YLCA 4IUVA 2LQKA 4LUEA 3CBMA 5CKHA 4DBQA 1AOJA 2CUDA 3I56T 4BD3A 1OPLA 4PFPA 4J6XA 3H41A 2EQMA 4HKEA 1PHTA 3C4SA 3SB2A 2PTKA 2KGTA 2F2XA 1S72Q 1WJSA 5C6SA 1BCOA 4LDYA 3JAME 1M30A 1J3TA 4RTXA 4XTYA 2AT1B 1YJ9A 2RI5A 3CCQQ 5L23A 3MPUB 2OTJA 2AKKA 4M78B 5CKDA 5GAN8 4Z89A 4M7AA 3HFOA 1UB4A 3R6OA 1I5LA 4A63B 4ZN1A 2L8DA 2JVVA 1CKAA 5GJVB 1SF9A 4B9XA 2JW4A 4DEYA 1OZ3A 3NTIA 1M5Q1 1AZEA 4DBRA 2BTTA 2XMFA 1JQQA 1BKBA 4UC4A 4CRIA 1Z9ZA 5KYWB 1TG0A 2DMOA 1RI0A 2ZPFB 3KBGA 1NG2A 1XTDA 5KYXA 4C92B 3PIOA 1K9MU 1QKWA 2LJ3A 2QA4Q 3EGXB 1TUGB 3REBB 2LRQA 1Y71A 1VQ9T 1MNEA 1Q81U 2E1HA 1VQ4Q 3META 3H0IA 4RMOA 4KUDK 3OYGA 3CCRA 1K8AC 1NJIR 4RTTA 4C5HA 1KHIA 1LOJA 2QAZA 4OGEA 2NUZA 2FO0A 2EJFA 5FLXE 3RKXA 4DOVA 2HD0A 4WTOB 3VUZA 2L89A 3OYKA 3HRTA 2NUPA 1WXTA 1SHFA 4RKUE 1U1SA 4HT9A 3I55A 2HSEB 2RA2A 4B6MA 1N27A 1CSKA 3C12A 1OZ2A 2RHXA 1TTHB 5J26A 3GNFB 4IUTA 1VQKT 2OTLT 1Q82R 1D0XA 4ZGDB 2GFUA 1TU0B 2DO3A 4DBHA 1F1BB 2HQXA 4EIKA 1WPYA 1VQMA 5KYUA 3C95A 4GBQA 3CXCA 2JTFA 3EGUA 4LUDA 2J05A 1WI7A 2CP2A 2DYIA 1SSFA 4F16A 4FT4A 2YRVA 3A8OB 2LMJA 1G83A 1SRLA 1D1CA 3QUIA 3V7RA 2BZ8A 1VQ5Q 5DLOA 3LW5E 5CIUA 4ORZA 4L59A 2DXCA 3BFMA 3SWNB 1UDLA 3CC4A 3JRZA 1WHGA 2KAFA 1RL2A 5CR2A 4PLLA 1YJ9Q 2QXFA 1X75C 2XDBA 1PD1A 2EKOA 1HD3A 3A8LB 3MEAA 4PJMA 2P4TA 1Y96B 2X3XD 1QVGA 1GCQA 4M75A 4J9IA 3JCMg 5IXFA 2JT4A 5GANg 3TU4K 2QGGA 4KH1B 4DQ2A 4JS4A 4MDXA 4J7IA 4J6WA 1C0MA 3SEMA 2HAXA 2EPDA 2LT1A 2EIFA 2ED0A 2JMAA 4PJOB 1ABOA 2HL5C 2O31A 3CCJT 1M1KR 2XIDA 3ZFJA 3CCUT 1YNZA 3UWNA 4RTUA 1YI2A 3CMAA 4MZPA 1YBYA 3GNGA 1M8VA 1QVFP 2AK5A 2XI9A 1I81A 1YIJQ 1N8RR 2KE9A 2MYSA 4LN2A 1HXDA 2W0ZA 1H92A 2KI7A 4OGCA 4E2FB 4AFUC 2DXUA 1JJ2S 1QCFA 2EGEA 1P92A 1U1TA 1OOTA 4FIBA 5GAOp 4NL2A 4C8QB 3HSBA 3VYHB 5GAN3 4PFOA 4NL3A 1RI9A 1GCQC 4E7IA 4M75C 2X9HA 1EX4A 4Z88A 1YJNA 1NM7A 3OYAA 2MF2A 3S3NA 3UDCA 3TSZA 3M54A 2VVKA 3MJXA 4DA4A 3TVTA 1MMNA 4C0DC 1DJ7B 2DIQA 5IAYA 3RKYA 5LJ3h 3SDZA 3E19A 1N9SA 4IIMA 2WACA 2CP3A 2CH4A 4MMLA 1WYXA 4M7DF 4OF1A 1VQLA 1ZHIA 2KBTA 4J8OA 2DL4A 1YCYA 5GAMd 3CC2T 2IG0A 3G6EA 2DTIA 3JCMb 4M7DA 1BI2A 5D6XA 1K9MR 4KBMB 1VQNT 1M90C 3M0SA 5GAMe 2KRNA 2XDDA 2LX9A 2PUKB 2QTXA 2D0NA 4OB3B 4CC3A 2EJGA 1WHKA 3E1SA 1W2BP 3EAEA 4RTZA 1ZBXA 2GTOA 4FYYB 2EQJA 2W10A 3HPWA 4NS5A 4OMQA 2CYZB 3VUBA 4QQDA 1X2QA 2D6FA 1VQNA 5IN1A 1WHJA 4OB2B 4WF2A 3BY7A 2QK0A 4QT7A 4M78F 4RUGA 3JB9F 2QG9B 2PVGB 4D8DA 4IUPA 1D1AA 2L3QA 2ZCFB 3RUXA 2RHZA 1YHQT 3QJYA 1GBRA 4Q5WA 2YSQA 5CKBA 1VUBA 2V1QA 1KQSP 4J9DA 5GAN2 2HQEA 4M78A 4IIOA 2LNVA 3CCLQ 2MPXC 2X4XA 1BI3A 3OQ5A 3S3OA 2HCKA 1D3BB 4LD6A 5CCAA 3JCMV 1I4K1 4M7DC 1M2VB 1RLQC 2ZPHB 2QYZA 3CCSA 4CC7A 4FU6A 1WHMA 3CCMQ 1ABQA 4IURA 3NFCA 4C92F 1QP3A 2EFIA 3O5ZA 2HQHA 3SD4A 1NLOC 1VOMA 1O75A 4PL6A 3G71T 2QEXT 1E7OA 1OPKA 3DKMA 5KCHA 3QDRB 3GF5A 2K4YA 4FYXB 5KYWA 3CPFA 1PNJA 1BYMA 1K73R 1VQPQ 4BE1A 4MZMA 1YJWQ 4C92A 4XU2A 4EMKB 3EGXA 4A4HA 5LJ3d 5KYNA 2HKNA 5IHIA 3H0FA 1KC8U 2ROTA 1GCPA 4F7UG 2PU9B 3PNWC 5LJ3e 4J9EA 2CP7A 3M4YA 3V7SA 1GBQA 3OMCA 2FRYA 2F69A 2LT4A 4HCKA 2MOXA 2E3HA 5LJ5j 2DTOA 2D0QB 1Q7YU 4JLIA 4JS5A 3URGA 4E7JA 2K3XA 2DD4A 3G4SQ 3GIBA 5GMKh 2ZGWA 4M78C 3UT1A 3G6EQ 2CT3A 2DXBA 3EH2A 3CQTA 5KE3A 3FB9A 5LL6S 4M77F 1VYTA 1Q7YC 1IREB 3MEUA 4IUQA 1NPPA 2EGAA 2RHIA 4FSXA 1BI1A 5GAMf 2K7AA 2DETA 2KEAA 3LGLA 3CMEA 4E7LA 1G3SA 1G5VA 2Y90A 1G2BA 3CD6Q 2DL3A 4M7DD 3PFSA 1PKTA 1CKBA 4JPBW 1TUCA 1YWOA 4X34A 5GANj 5FU6B 3PE0A 1VQ8A 5IH2A 4C92C 3OS5A 1VYUA 2MCNA 2Y4XA 3JCMX 3THKA 1Q95G 2JMCA 3EG9B 4XAXB 1PM3A 2VUBA 1KD1U 3ULRB 2IVWA 1TWBA 2BE9B 3SWNA 1TH7A 3M53A 3HL8A 1UE9A 2OX7A 2KK4A 4KT0E 1VQ4T 2CH4W 3CC7A 2RM4A 4ZTJA 2VGNA 1ACMB 1GFCA 4JZ4A 1G3TA 3CCSQ 1K0SA 1VQ7Q 1H8KA 1Y96A 5A0GA 1XNIA 4HA8A 4PJOF 5LJ5h 1BIAA 3JB9D 4CC2A 1M9SA 4BUGA 5FWCA 3HRUA 2Y4YA 1VQ6Q 2YWWA 2MIOA 3OYNA 2E41A 3P8HA 4M77G 2J7IA 1WIEA 2GNCA 2PVOB 3OSSC 1X6GA 1ZLMA 2LC4A 3GLXA 4FW1A 3ZBDA 4PJOA 4DOWA 3OA6A 1VIFA 4OMNA 3QO3A 3RIRA 5FRNA 3CCEA 3OYBA 2COZA 1QVGP 3CCVA 2M0OA 1JB0E 2CP6A 3L2RA 5DLQE 2YUPA 4F17A 2SRCA 4EMGA 3A8GB 6AT1B 5LJ3f 3VKIA 3RNJA 5GAN7 1ZA1B 5HKCA 3RKWA 2RPNA 2CZ1B 3P8DA 4C8QF 2K5FA 3SWNC 2B86A 3JCMh 5GANh 3J80E 1VQ5T 1TOVA 3N5BB 5GMKe 4AFZC 2FPDA 2BE7D 3HRSA 1UHCA 1U8RA 4N0AA 3U23A 2RJCA 2EYYA 4HCBA 4C8QA 5I21A 3MHXA 2CZ6B 3VS2A 4M7AF 5M9OA 2YT6A 2MMPA 4LDWA 3EGDB 2P0PA 3EG3A 3S3MA 1MV3A 1QKXA 4A4GA 4LXCA 2A0FB 3A1PA 1PKSA 3QYGB 3ZL7C 1QVFS 1N8RC 3I56A 2CP5A 1QQJA 1YITQ 1T0JA 3VS3A 1QP2A 4PJOC 1XJWB 1KFZA 1VQ8Q 1VQOQ 3JV3A 2KYMA 4M77D 1IZ6A 1GFDA 2HL3A 2M51A 1PSFA 4BE2A 4IKFA 1R77A 3OW2P 5GAN6 1MMGA 3QWXX 2M16A 3I9QA 2VYTA 3UA7A 3OBYA 1IHWA 3ZEHA 2KSSA 2C0IA 2XDPA 1KC8R 1RLPC 1B7TA 1K8AU 1UGQB 2YHTA 2FRWA 1UECA 2JM8A 1YIJT 4X9DA 1KJWA 3KXTA 4C0ZA 1T3SA 3L2ZA 4XU1A 1RUWA 2E6ZA 2K6DA 5AT1B 1C1AA 2R57A 4N0AC 1BCMA 2I0NA 3D7SB 4C8QC 2CP0A 1JJ2A 3GP8A 3JB9I 3A5ZB 1TSFA 4ZN3A 3MP8A 4XQ3A 2WSEE 1IRXA 1QCNA 2XD0A 2JJ9A 2DJQA 3NTHA 4JJBA 1M3AA 4M7AC 2B8AA 2LX7A 3LLRA 4M7AG 1I8FA 3ME9A 4JDSA 2DZCA 2YUNA 2KNBB 3P8BB 1VQ9A 5GAN4 4R55A 1FYNA 1LVKA 3OYDA 4QQGA 3CCEQ 3ASKA 2RJFA 2QASA 3CCVQ 1HJDA 2R58A 4L5GA 3M9QA 2EAYA 5HK0A 1D3BA 1WXBA 2AZSA 1M2VA 3O8VA 3PMTA 1VIEA 4EMHA 1W2BS 4Y91A 2KY9A 4XTWA 4PFZA 3QKJA 4VUBA 2PUOB 3A8MB 1Q86R 2EGCA 5LJ5g 1Y07A 2RHYA 9ATCB 2HDAA 3HKSA 4ME7A 1KD1R 3OYEA 2LCLA 1X01A 5FROA 3MP6A 1VQKA 2OTLA 3R6NA 4BI4A 2JTMA 1UJ0A 3MP1A 3I35A 3VYGA 4EMKA 4M75F 3RDVA 1R0CB 1IHVA 1SG5A 2OTJQ 2X4JA 2IPOB 1PSEA 2QQRA 1X27A 2KT8A 4C8QD 2C06A 2ZPBB 4E47A 1PCXA 1PRLC 3CPWS 3I56Q 3FRNA 2JNGA 2XG8D 3MEVA 4OMOA 2MK5A 2CSIA 2K5LA 2O2OA 1YCSB 2K3YA 1FMKA 1Y0MA 4JJDA 1PWTA 5CVIA 4M7AD 2RK2A 5IT9E 1K1ZA 3NPFA 1KHCA 1H641 3QXEB 2GCXA 3PVQA 3DB3A 3F70A 2ROLA 1K73C 1SPKA 1W6XA 4ELYC 2GF7A 4PKCC 1NBEB 4A4FA 2K2VA 3CCLT 4F7UE 1KG1A 4J9CA 3NTKA 3PT9A 2PZ1A 2DVJA 2KXDA 3CCMT 1LPLA 3UATA 2VWFA 3CCRQ 3OYJA 3TSWA 3RMQA 2NLUA 1IGQA 4FCYA 7AT1B 2PNIA 4C5GA 1IGUA 2XHCA 4KGXB 4EMKC 1YP5A 4KULA 1QCOA 3V8KA 3CCJA 1VQPT 3V8JA 2JZ2A 3CCUA 3OS0A 2QI2A 3I55Q 1YJWT 2CGHA 3EG9A 2FYKA 3UPUA 3SFMA 2DBKA 5CKFA 3X24B 1I0CA 2HBPA 2O9SA 3VRZA 3M0TA 1W4SA 4BY6B 3QIIA 3EFRA 4M75G 2EBPA 2FZGB 3M56A 2DKGA 2E6NA 4JUVA 1VQMQ 2JTEA 2G6FX 4A53A 1X2KA 1KQ1A 5GAOn 3G4ST 2FPEA 1U3OA 2MWOA 3J81E 2H3EB 3L2QA 4QKUA 1XQHA 4GY5A 2M9UA 8ATCB 2E12A 1OYXA 3M58A 4N4GA 4J9HA 1M90U 1WDXA 4EDUA 4A54A 2RHUA 3JSCA 5CAIA 2HEQA 2KQWA 3S6WA 2OTLQ 4RCBA 4PLIA 2X4WA 1SHGA 1T0HA 3CC4Q 3TQ7P 1K8AR 1ZUKA 3CD6T 1OU8A 4HVUA 2CZ7B 2X51A 5FU6C 2XICA 4D8KA 1ZSZB 1Q81R 1V1CA 4XU0A 4ZTFA 3HTRA 5J3BA 2D1XA 2VB6A 2X3WD 1K9AA 2ZPIB 2A7YA 1RAHB 5GMKm 1WGSA 3INZA 3CC2A 3V7CA 2R5MA 3QPHA 2G3RA 3G1JA 4M77E 1X69A 2VC8A 2CDTA 4BDYA 2RJDA 1SEMA 2EKHA 1M3BA 2L5QA 2RK1A 3EHQA 2CUBA 4PJJA 1B3QA 3DB4A 4M75D 2EYQA 3PMIA 3LH0A 4J5YA 1M4ZA 2FVUA 3EGDA 1YI2Q 2GFAA 3VS4A 3CMAQ 5CO7A 4DBFA 1R8OB 3LH5A 1VQ7T 5HY6A 2RQUA 5IXBA 1AWJA 2BZYA 4A4KA 2OI3A 4OMLA 4ZGJB 1Z9QA 4M7DG 4LDVA 1NPRA 5GAMg 4Z8AA 5EC7A 1VQ6T 3PIPA 2K79A 1YHQA 3SHWA 3UF4A 5GAOm 3VU3C 4ZGEB 1EFNA 1GXIE 1ZQ1A 2R5AA 3CEYA 2VV5A 3FJPA 2E4HA 4J9GA 1PC0A 2NUTB 1U5SA 3FDRA 2KRSA 4A4EA 4KRTA 2VASA 1IXDA 5GMKl 1LNXA 1BU1A 1JEGA 1YJNQ 2KR3A 2DXTA 4FSSA 1BB9A 2J6OA 5GJWB 2LJ1A 4OMMA 3BDUA 1LJOA 4JJCA 1WQ7A 5I11A 3NMZC 3JCMQ 3H0HA 3M0QA 4KGVB 1IB8A 3WVDB 1WJRA 4XK8E 4C0FA 1SKUB 2JOYA 1AT1B 4EPCA 3M55A 3GPLA 1PD0A 3G71A 2QEXA 2DL8A 1VQLQ 4J9BA 3JB9J 5FWBA 1OX9A 3OYMA 2KRMA 2RH2A 1S72T 1ZUYA 5KYYB 2WSFE 1HK9A 2BUDA 3EFOB 4M78G 3JB9G 4MMKA 3OW2S 2DM1A 2F1LA 3OYLA 3BW1A 3CCQT 1JBMA 1OQKA 1BK2A 2DRKA 1QVFA 1UGPB 2FZKB 3EG0A 2I2LA 2LCSA 1UEBA 1YITT 3NGPA 1VQOT 5GAOr 4GLMA 5GAOl 3M57A 1NJIC 2JUFA 2LCCA 3M4GA 3PVLA 2LNHB 2F5TX 2GGRA 2DA9A 2JXBA 2RD1A 3CC2Q 4B9WA 2ABLA 3PGGA 1D0YA 2H3JA 1TS9A 2DILA 4C92G 1VQNQ 4M7AE 3M0UA 1AVZC 3RR6A 3QZ5B 2LDMA 3NHNA 1FXXA 3CBOA 2QA4T 1BIBA 2EQIA 1U06A 1HSQA 3CXCP 3JCMW 1Q82C 2ZZDA 1RADB 5I22A 1AHJB 1IO6A 2JM9A 2QDLA 2KXCA 4XTXA 1D0ZA 3VS5A 3EG2A 3OB9A 4OP0A 2AIRB 5EG2A 4FW2A 5CQXA 2DX1A 1Q86C 1M90R 1N9RA 1E6HA 2ZAEA 3OY9A 1G8XA 1M3CA 4M78D 5J39A 1SSHA 2EJ9A 3J7AF 2RQTA 3DLMA 1S1NA 1JU5C 4N4HA 4Y28E 3QHSA 1VQ4A 1OEBA 3VS6A 1B34B 4C0GA 2YLBA 2GBQA 3MKDA 1H3HA 1JXMA 2YRDA 3FEOA 5GAN5 2M1HA 1W2BA 2MAMA 4CI0C 1QLYA 1EIFA 1C6VX 4QVDA 1MMDA 1AD5A 1TUDA 2CT4A 3GBQA 3LGFA 4E7SA 4RTWA 4J6YA 4C92D 2O9VA 2KYBA 1WHLA 2OAWA 4ANJA 4J83A 4KUIA 2CSQA 2QQSA 2L2PA 4N4IA 2RI2A 3QYHB 5I2SA 3A98A 5I2MA 3WXMB 3C94A 3HHTB 1XOVA 1YJ9T 1UUEA 1M1KC 2OTJT 4DEXA 4R56A 1GRIA 3REAB 4JJNK 1N8RU 5CKEA 3GOXA 3HFNA 3CPWA 3CMEQ 3V8LA 1AZGB 2LVMA 2OAUA 4F7UB 2FHDA 1B07A 4O6JA 3IQLA 2M0YA 2QGFB 5HK3A 1VQ5A 2KMTA 1V76A 4K11A 3TEEA 4OMFB 5CK9A 4X9CA 2BZXA 5FW9A 4PJOG 1WNLA 3BE3A 4KH0B 5KH6A 4BE0A 3QG1A 2AKLA 4II1A 2FPFA 3E9FA 2NWMA 2EQUA 1PRMC 4XTUA 1MHNA 3OS2A 2IIMA 4M75E 3JCMP 5C0MA 4BI3A 2C0TA 2P84A 4RG2A 4J9FA 3CC7Q 1ZSZA 1KSWA 3CCRT 1N6AA 4QVCA 2P0QA 5D6WA 4R0KA 2E65A 5DM7R 2E64A 4OMPA 1ZSGA 5LJ5d 5GAMj 1Q7YR 2LJ0A 4C8QG 5DY9A 1WHHA 4JLGA 3RERA 3H9NA 3I55T 5LJ5e 1ZUUA 4BY6C 5ECAA 2PVDB 1ARKA 4Y92A 4FL6A 1RAIB 4FT2A 2F2VA 1UHFA 2LP5A 1K9MC 5FU7B 1X43A 1KIKA 1YIJA 3OMGA 3M0RA 4ESRA 1RAGB 2M02A 1H3ZA 5A0DA 1RABB 3X25B 1NEGA 2E70A 1VQMT 5HCKA 2OJ2A 4RCCA 1Q81C 4D6WA 1LCKA 1VA7A 2JS0A 1TXQA 3LWIA 2VGMA 1UG1A 2L0AA 2RO0A 4AFSC 3JCMd 4PJOD 4AMCA 5GANd 5GAOq 3QWYA 1ZA2B 3VRYA 2DLPA 3X26B 3JCMe 2O88A 5GANe 2EVRA 3RESA 1MNDA 2RJEA 2V8JA 4AG1C 1ZSZC 2XKOC 3CC4T 4M77B 2BIVA 3JCMc 2X4YA 2CZ0B 2EQKA 3VS0A 2DE0X 8AT1B 2YXYA 1KQ2A 2NUTA 3OS1A 1YFNA 2EYXA 2EWNA
chains in the Genus database with same CATH topology
2COZA 1LPLA 2COWA 2CP7A 1WHHA 2CP6A 2CP5A 2E4HA 2MPXC 1WHJA 2QK0A 1TXQA 2HL5C 2E3HA 1WHKA 2Z0WA 1IXDA 1WHLA 1WHMA 2CP2A 2E3IA 1WHGA 2COYA 2HKNA 2HL3A 4B6MA 3E2UA 1TOVA 2CP3A 2HQHA 3TQ7P 3RDVA 2M02A 2HKQB 2CP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COZ A;  1LPL A;  2COW A;  2CP7 A;  1WHH A;  2CP6 A;  2CP5 A;  2E4H A;  2MPX C;  1WHJ A;  2QK0 A;  1TXQ A;  2HL5 C;  2E3H A;  1WHK A;  2Z0W A;  1IXD A;  1WHL A;  1WHM A;  2CP2 A;  2E3I A;  1WHG A;  2COY A;  2HKN A;  2HL3 A;  4B6M A;  3E2U A;  1TOV A;  2CP3 A;  2HQH A;  3TQ7 P;  3RDV A;  2M02 A;  2HKQ B;  2CP0 A; 
#chains in the Genus database with same CATH topology
 4MZT A;  1KQS S;  2JS2 A;  1QW1 A;  4M7D E;  2HSP A;  1WJQ A;  3EH1 A;  5GMK i;  4XU3 A;  4CC4 B;  3FC3 A;  5KE2 A;  4RTY A;  2RN8 A;  2ECZ A;  5GAM h;  2AZV A;  3E9G A;  3OBW A;  2DBM A;  2O01 E;  1M2O A;  1K73 U;  1Y7X A;  2DIG A;  2QDY B;  2C0O A;  1RAF B;  4C5E A;  1WXU A;  1UFF A;  4PJL A;  2LQW A;  1QMC A;  5KYY A;  5LJ3 j;  1N5Z A;  3EFO A;  1BI0 A;  4OVA A;  2SEM A;  1YI2 T;  1OUL A;  3CMA T;  4PNO A;  1NLP C;  2O4X B;  4LDX A;  1WX6 A;  2V8K A;  4F14 A;  1WFW A;  2DF6 A;  4FM4 B;  3Q1J A;  4KGZ B;  2DL7 A;  4JRP A;  2RQV A;  2MWP A;  1X6O A;  2DEU A;  3I5S A;  4LE9 A;  2YRC A;  2RF0 A;  4AT1 B;  1AEY A;  3PTA A;  1D09 B;  2FZC B;  4BAC A;  1AWO A;  1FMW A;  2GQI A;  3T9N A;  1T3L A;  3QZ9 B;  3VJP A;  4HCZ A;  3C0C A;  2ESW A;  2ENM A;  4F04 B;  3RMS A;  3OYH A;  3OSV A;  4M78 E;  3EFS A;  4ZNX A;  5LJ5 f;  3OYF A;  3MEW A;  4YTL A;  1M8M A;  2F5K A;  3CCL A;  3QSU A;  2A3L A;  1YWP A;  2HKQ B;  2K2M A;  1YJN T;  5L8R E;  1VQ9 Q;  1G3Y A;  3MO8 A;  1AWW A;  2V26 A;  2DTH A;  2HMA A;  2J6K A;  4NOY A;  4L6V 5;  5KCO A;  3CCM A;  2ZPG B;  1K4U S;  1OU9 A;  2PQW A;  2RQR A;  2ZPE B;  4V2S A;  1A0N B;  2E10 A;  4BB7 A;  2L3P A;  4XTZ A;  2CRE A;  2FG0 A;  2HBW A;  4ELZ C;  3H6Z A;  3L1A A;  3E2U A;  3L2V A;  4E6R A;  1VQL T;  4C92 E;  3RBB B;  2D9T A;  1VQP A;  2DEQ A;  1UTI A;  1Y57 A;  1YN8 A;  1YJW A;  1OV3 A;  2LQ8 A;  3G6E T;  3JCM f;  2L3R A;  2J6F A;  4FYW B;  3OW2 A;  5GAN f;  3UA6 A;  4QW2 A;  1OX8 A;  2QQB A;  3I5R A;  2XU8 A;  1FWZ A;  1VQK Q;  3A8H B;  3FIF A;  4M7A B;  4E7Z A;  2FB7 A;  1EZZ B;  1B34 A;  4HVW A;  2YUQ A;  2RI3 A;  3CXC S;  3G7Z A;  1GL5 A;  1W1F A;  2EW3 A;  1UGV A;  3G4S A;  2V8I A;  2K57 A;  2YDL A;  1ZX6 A;  3WVE B;  1R0B G;  2H8H A;  4ATO A;  4LDU A;  2DD5 A;  1M1G A;  2LZ6 B;  5KYX B;  4X1V A;  3JCM J;  2GTJ A;  3AT1 B;  4O5V A;  3L2W A;  2BKD N;  5IHK A;  2VKN A;  2AHJ B;  2K5I A;  2LTO A;  4JRQ A;  2JN0 A;  3CD6 A;  1K0X A;  1KK7 A;  5CQY A;  4F7U F;  1W70 A;  2DRM A;  4JZ3 A;  3H8Z A;  2DPP B;  2E5K A;  2E3I A;  1JXO A;  4HXJ A;  3AHU A;  2J06 A;  3ER0 A;  3OYY A;  1M1F A;  5GMK j;  1RAC B;  2F2W A;  1I1J A;  4F7U A;  4BDZ A;  5A2Q E;  3CCS T;  4HCC A;  2NUP B;  1QVG S;  3TRE A;  4JRK A;  1NYG A;  4AFQ C;  2DL5 A;  4J7F A;  3X20 B;  3OYI A;  1JRI A;  1NYF A;  2QQA A;  1HYO A;  4OB1 B;  1O9S A;  3M0P A;  4Z02 A;  1ZBJ A;  2DNU A;  2RQW A;  1MGQ A;  1WA7 A;  2DZ9 A;  3VS7 A;  2DER A;  1K76 A;  4RTV A;  3CCJ Q;  3LYI A;  3CPW P;  3CCU Q;  5KYU B;  2D8H A;  3KFV A;  2ED1 A;  3BDL A;  1NE8 A;  1VQ7 A;  1G3W A;  4TVR A;  4WCI A;  3VS1 A;  2DJZ A;  1WQW A;  4QQ6 A;  1QWE A;  2A36 A;  2KRO A;  1I5O B;  2DAQ A;  2DVE A;  1VQ6 A;  2X35 A;  4PJO E;  5AYF A;  3TCJ A;  3HP9 A;  2A08 A;  3VV0 A;  3X28 B;  5FRM A;  2VXE A;  1RAA B;  3L2U A;  4XTV A;  1MV0 B;  2EYZ A;  5D6Y A;  2CS7 A;  4FYV B;  3CME T;  2KT1 A;  1WLP B;  2EYW A;  2MI6 A;  2HNI A;  4M75 B;  1KC8 C;  1RAE B;  3EG1 A;  2FEI A;  4E7H A;  1NJI U;  1BBZ A;  2KDS A;  3DLL A;  4HT8 A;  1QVP A;  1UGS B;  2P4R A;  1NEB A;  1UGR B;  1JJ2 P;  3LWH A;  4C0D B;  2GQV A;  3EHR A;  4C8Q E;  2YUO A;  2LQN A;  4LNP A;  2DYB A;  1VQ8 T;  3LX7 A;  1MMA A;  1JO8 A;  3M5A A;  3QBY A;  1S72 A;  2COW A;  3M59 A;  1AWX A;  4BI8 B;  3L42 A;  1VYV A;  1NZ9 A;  4PJN A;  5D7U A;  3FJ5 A;  3CCQ A;  2D8J A;  1M27 C;  2XK0 A;  4OB0 B;  1PG5 B;  1Q82 U;  4M77 A;  1I07 A;  2K9G A;  1WZO A;  2P0K A;  4C5I A;  4IUU A;  4P5N A;  5LJ3 g;  4PK4 A;  1X6B A;  3CC7 T;  1YIT A;  3JB9 H;  1VQO A;  2RMO A;  1FX7 A;  2CKK A;  3QJ6 A;  2FL7 A;  1Q86 U;  2QQ9 A;  2Z0W A;  4E7K A;  2ATC B;  2COY A;  2WSC E;  5FU7 C;  1D1B A;  2K3B A;  4AG2 C;  2VXF A;  2E5Q A;  2QA4 A;  1YHQ Q;  4RG8 A;  1KD1 C;  4M4Z A;  3MCA B;  1SRM A;  4GLK A;  3OYC A;  3CCE T;  4LD9 K;  1UJY A;  4QVZ A;  2O4X A;  3CCV T;  3QDF A;  1V29 B;  2A28 A;  2DFU A;  3FLG A;  3KUF A;  1E6G A;  4M77 C;  2L3S A;  4HVV A;  1FMV A;  4JRI A;  4M7D B;  2NYS A;  1MUZ A;  2HZY A;  3G71 Q;  2QEX Q;  5A0L A;  1M1K U;  2DK3 A;  3CBP A;  5IHN A;  1QWF A;  1OI1 A;  2V1R A;  2RNA A;  2QTV A;  2KVQ G;  2RB6 A;  2A37 A;  1KQS A;  4MDW A;  2YLC A;  4IUV A;  2LQK A;  4LUE A;  3CBM A;  5CKH A;  4DBQ A;  1AOJ A;  2CUD A;  3I56 T;  4BD3 A;  1OPL A;  4PFP A;  4J6X A;  3H41 A;  2EQM A;  4HKE A;  1PHT A;  3C4S A;  3SB2 A;  2PTK A;  2KGT A;  2F2X A;  1S72 Q;  1WJS A;  5C6S A;  1BCO A;  4LDY A;  3JAM E;  1M30 A;  1J3T A;  4RTX A;  4XTY A;  2AT1 B;  1YJ9 A;  2RI5 A;  3CCQ Q;  5L23 A;  3MPU B;  2OTJ A;  2AKK A;  4M78 B;  5CKD A;  5GAN 8;  4Z89 A;  4M7A A;  3HFO A;  1UB4 A;  3R6O A;  1I5L A;  4A63 B;  4ZN1 A;  2L8D A;  2JVV A;  1CKA A;  5GJV B;  1SF9 A;  4B9X A;  2JW4 A;  4DEY A;  1OZ3 A;  3NTI A;  1M5Q 1;  1AZE A;  4DBR A;  2BTT A;  2XMF A;  1JQQ A;  1BKB A;  4UC4 A;  4CRI A;  1Z9Z A;  5KYW B;  1TG0 A;  2DMO A;  1RI0 A;  2ZPF B;  3KBG A;  1NG2 A;  1XTD A;  5KYX A;  4C92 B;  3PIO A;  1K9M U;  1QKW A;  2LJ3 A;  2QA4 Q;  3EGX B;  1TUG B;  3REB B;  2LRQ A;  1Y71 A;  1VQ9 T;  1MNE A;  1Q81 U;  2E1H A;  1VQ4 Q;  3MET A;  3H0I A;  4RMO A;  4KUD K;  3OYG A;  3CCR A;  1K8A C;  1NJI R;  4RTT A;  4C5H A;  1KHI A;  1LOJ A;  2QAZ A;  4OGE A;  2NUZ A;  2FO0 A;  2EJF A;  5FLX E;  3RKX A;  4DOV A;  2HD0 A;  4WTO B;  3VUZ A;  2L89 A;  3OYK A;  3HRT A;  2NUP A;  1WXT A;  1SHF A;  4RKU E;  1U1S A;  4HT9 A;  3I55 A;  2HSE B;  2RA2 A;  4B6M A;  1N27 A;  1CSK A;  3C12 A;  1OZ2 A;  2RHX A;  1TTH B;  5J26 A;  3GNF B;  4IUT A;  1VQK T;  2OTL T;  1Q82 R;  1D0X A;  4ZGD B;  2GFU A;  1TU0 B;  2DO3 A;  4DBH A;  1F1B B;  2HQX A;  4EIK A;  1WPY A;  1VQM A;  5KYU A;  3C95 A;  4GBQ A;  3CXC A;  2JTF A;  3EGU A;  4LUD A;  2J05 A;  1WI7 A;  2CP2 A;  2DYI A;  1SSF A;  4F16 A;  4FT4 A;  2YRV A;  3A8O B;  2LMJ A;  1G83 A;  1SRL A;  1D1C A;  3QUI A;  3V7R A;  2BZ8 A;  1VQ5 Q;  5DLO A;  3LW5 E;  5CIU A;  4ORZ A;  4L59 A;  2DXC A;  3BFM A;  3SWN B;  1UDL A;  3CC4 A;  3JRZ A;  1WHG A;  2KAF A;  1RL2 A;  5CR2 A;  4PLL A;  1YJ9 Q;  2QXF A;  1X75 C;  2XDB A;  1PD1 A;  2EKO A;  1HD3 A;  3A8L B;  3MEA A;  4PJM A;  2P4T A;  1Y96 B;  2X3X D;  1QVG A;  1GCQ A;  4M75 A;  4J9I A;  3JCM g;  5IXF A;  2JT4 A;  5GAN g;  3TU4 K;  2QGG A;  4KH1 B;  4DQ2 A;  4JS4 A;  4MDX A;  4J7I A;  4J6W A;  1C0M A;  3SEM A;  2HAX A;  2EPD A;  2LT1 A;  2EIF A;  2ED0 A;  2JMA A;  4PJO B;  1ABO A;  2HL5 C;  2O31 A;  3CCJ T;  1M1K R;  2XID A;  3ZFJ A;  3CCU T;  1YNZ A;  3UWN A;  4RTU A;  1YI2 A;  3CMA A;  4MZP A;  1YBY A;  3GNG A;  1M8V A;  1QVF P;  2AK5 A;  2XI9 A;  1I81 A;  1YIJ Q;  1N8R R;  2KE9 A;  2MYS A;  4LN2 A;  1HXD A;  2W0Z A;  1H92 A;  2KI7 A;  4OGC A;  4E2F B;  4AFU C;  2DXU A;  1JJ2 S;  1QCF A;  2EGE A;  1P92 A;  1U1T A;  1OOT A;  4FIB A;  5GAO p;  4NL2 A;  4C8Q B;  3HSB A;  3VYH B;  5GAN 3;  4PFO A;  4NL3 A;  1RI9 A;  1GCQ C;  4E7I A;  4M75 C;  2X9H A;  1EX4 A;  4Z88 A;  1YJN A;  1NM7 A;  3OYA A;  2MF2 A;  3S3N A;  3UDC A;  3TSZ A;  3M54 A;  2VVK A;  3MJX A;  4DA4 A;  3TVT A;  1MMN A;  4C0D C;  1DJ7 B;  2DIQ A;  5IAY A;  3RKY A;  5LJ3 h;  3SDZ A;  3E19 A;  1N9S A;  4IIM A;  2WAC A;  2CP3 A;  2CH4 A;  4MML A;  1WYX A;  4M7D F;  4OF1 A;  1VQL A;  1ZHI A;  2KBT A;  4J8O A;  2DL4 A;  1YCY A;  5GAM d;  3CC2 T;  2IG0 A;  3G6E A;  2DTI A;  3JCM b;  4M7D A;  1BI2 A;  5D6X A;  1K9M R;  4KBM B;  1VQN T;  1M90 C;  3M0S A;  5GAM e;  2KRN A;  2XDD A;  2LX9 A;  2PUK B;  2QTX A;  2D0N A;  4OB3 B;  4CC3 A;  2EJG A;  1WHK A;  3E1S A;  1W2B P;  3EAE A;  4RTZ A;  1ZBX A;  2GTO A;  4FYY B;  2EQJ A;  2W10 A;  3HPW A;  4NS5 A;  4OMQ A;  2CYZ B;  3VUB A;  4QQD A;  1X2Q A;  2D6F A;  1VQN A;  5IN1 A;  1WHJ A;  4OB2 B;  4WF2 A;  3BY7 A;  2QK0 A;  4QT7 A;  4M78 F;  4RUG A;  3JB9 F;  2QG9 B;  2PVG B;  4D8D A;  4IUP A;  1D1A A;  2L3Q A;  2ZCF B;  3RUX A;  2RHZ A;  1YHQ T;  3QJY A;  1GBR A;  4Q5W A;  2YSQ A;  5CKB A;  1VUB A;  2V1Q A;  1KQS P;  4J9D A;  5GAN 2;  2HQE A;  4M78 A;  4IIO A;  2LNV A;  3CCL Q;  2MPX C;  2X4X A;  1BI3 A;  3OQ5 A;  3S3O A;  2HCK A;  1D3B B;  4LD6 A;  5CCA A;  3JCM V;  1I4K 1;  4M7D C;  1M2V B;  1RLQ C;  2ZPH B;  2QYZ A;  3CCS A;  4CC7 A;  4FU6 A;  1WHM A;  3CCM Q;  1ABQ A;  4IUR A;  3NFC A;  4C92 F;  1QP3 A;  2EFI A;  3O5Z A;  2HQH A;  3SD4 A;  1NLO C;  1VOM A;  1O75 A;  4PL6 A;  3G71 T;  2QEX T;  1E7O A;  1OPK A;  3DKM A;  5KCH A;  3QDR B;  3GF5 A;  2K4Y A;  4FYX B;  5KYW A;  3CPF A;  1PNJ A;  1BYM A;  1K73 R;  1VQP Q;  4BE1 A;  4MZM A;  1YJW Q;  4C92 A;  4XU2 A;  4EMK B;  3EGX A;  4A4H A;  5LJ3 d;  5KYN A;  2HKN A;  5IHI A;  3H0F A;  1KC8 U;  2ROT A;  1GCP A;  4F7U G;  2PU9 B;  3PNW C;  5LJ3 e;  4J9E A;  2CP7 A;  3M4Y A;  3V7S A;  1GBQ A;  3OMC A;  2FRY A;  2F69 A;  2LT4 A;  4HCK A;  2MOX A;  2E3H A;  5LJ5 j;  2DTO A;  2D0Q B;  1Q7Y U;  4JLI A;  4JS5 A;  3URG A;  4E7J A;  2K3X A;  2DD4 A;  3G4S Q;  3GIB A;  5GMK h;  2ZGW A;  4M78 C;  3UT1 A;  3G6E Q;  2CT3 A;  2DXB A;  3EH2 A;  3CQT A;  5KE3 A;  3FB9 A;  5LL6 S;  4M77 F;  1VYT A;  1Q7Y C;  1IRE B;  3MEU A;  4IUQ A;  1NPP A;  2EGA A;  2RHI A;  4FSX A;  1BI1 A;  5GAM f;  2K7A A;  2DET A;  2KEA A;  3LGL A;  3CME A;  4E7L A;  1G3S A;  1G5V A;  2Y90 A;  1G2B A;  3CD6 Q;  2DL3 A;  4M7D D;  3PFS A;  1PKT A;  1CKB A;  4JPB W;  1TUC A;  1YWO A;  4X34 A;  5GAN j;  5FU6 B;  3PE0 A;  1VQ8 A;  5IH2 A;  4C92 C;  3OS5 A;  1VYU A;  2MCN A;  2Y4X A;  3JCM X;  3THK A;  1Q95 G;  2JMC A;  3EG9 B;  4XAX B;  1PM3 A;  2VUB A;  1KD1 U;  3ULR B;  2IVW A;  1TWB A;  2BE9 B;  3SWN A;  1TH7 A;  3M53 A;  3HL8 A;  1UE9 A;  2OX7 A;  2KK4 A;  4KT0 E;  1VQ4 T;  2CH4 W;  3CC7 A;  2RM4 A;  4ZTJ A;  2VGN A;  1ACM B;  1GFC A;  4JZ4 A;  1G3T A;  3CCS Q;  1K0S A;  1VQ7 Q;  1H8K A;  1Y96 A;  5A0G A;  1XNI A;  4HA8 A;  4PJO F;  5LJ5 h;  1BIA A;  3JB9 D;  4CC2 A;  1M9S A;  4BUG A;  5FWC A;  3HRU A;  2Y4Y A;  1VQ6 Q;  2YWW A;  2MIO A;  3OYN A;  2E41 A;  3P8H A;  4M77 G;  2J7I A;  1WIE A;  2GNC A;  2PVO B;  3OSS C;  1X6G A;  1ZLM A;  2LC4 A;  3GLX A;  4FW1 A;  3ZBD A;  4PJO A;  4DOW A;  3OA6 A;  1VIF A;  4OMN A;  3QO3 A;  3RIR A;  5FRN A;  3CCE A;  3OYB A;  2COZ A;  1QVG P;  3CCV A;  2M0O A;  1JB0 E;  2CP6 A;  3L2R A;  5DLQ E;  2YUP A;  4F17 A;  2SRC A;  4EMG A;  3A8G B;  6AT1 B;  5LJ3 f;  3VKI A;  3RNJ A;  5GAN 7;  1ZA1 B;  5HKC A;  3RKW A;  2RPN A;  2CZ1 B;  3P8D A;  4C8Q F;  2K5F A;  3SWN C;  2B86 A;  3JCM h;  5GAN h;  3J80 E;  1VQ5 T;  1TOV A;  3N5B B;  5GMK e;  4AFZ C;  2FPD A;  2BE7 D;  3HRS A;  1UHC A;  1U8R A;  4N0A A;  3U23 A;  2RJC A;  2EYY A;  4HCB A;  4C8Q A;  5I21 A;  3MHX A;  2CZ6 B;  3VS2 A;  4M7A F;  5M9O A;  2YT6 A;  2MMP A;  4LDW A;  3EGD B;  2P0P A;  3EG3 A;  3S3M A;  1MV3 A;  1QKX A;  4A4G A;  4LXC A;  2A0F B;  3A1P A;  1PKS A;  3QYG B;  3ZL7 C;  1QVF S;  1N8R C;  3I56 A;  2CP5 A;  1QQJ A;  1YIT Q;  1T0J A;  3VS3 A;  1QP2 A;  4PJO C;  1XJW B;  1KFZ A;  1VQ8 Q;  1VQO Q;  3JV3 A;  2KYM A;  4M77 D;  1IZ6 A;  1GFD A;  2HL3 A;  2M51 A;  1PSF A;  4BE2 A;  4IKF A;  1R77 A;  3OW2 P;  5GAN 6;  1MMG A;  3QWX X;  2M16 A;  3I9Q A;  2VYT A;  3UA7 A;  3OBY A;  1IHW A;  3ZEH A;  2KSS A;  2C0I A;  2XDP A;  1KC8 R;  1RLP C;  1B7T A;  1K8A U;  1UGQ B;  2YHT A;  2FRW A;  1UEC A;  2JM8 A;  1YIJ T;  4X9D A;  1KJW A;  3KXT A;  4C0Z A;  1T3S A;  3L2Z A;  4XU1 A;  1RUW A;  2E6Z A;  2K6D A;  5AT1 B;  1C1A A;  2R57 A;  4N0A C;  1BCM A;  2I0N A;  3D7S B;  4C8Q C;  2CP0 A;  1JJ2 A;  3GP8 A;  3JB9 I;  3A5Z B;  1TSF A;  4ZN3 A;  3MP8 A;  4XQ3 A;  2WSE E;  1IRX A;  1QCN A;  2XD0 A;  2JJ9 A;  2DJQ A;  3NTH A;  4JJB A;  1M3A A;  4M7A C;  2B8A A;  2LX7 A;  3LLR A;  4M7A G;  1I8F A;  3ME9 A;  4JDS A;  2DZC A;  2YUN A;  2KNB B;  3P8B B;  1VQ9 A;  5GAN 4;  4R55 A;  1FYN A;  1LVK A;  3OYD A;  4QQG A;  3CCE Q;  3ASK A;  2RJF A;  2QAS A;  3CCV Q;  1HJD A;  2R58 A;  4L5G A;  3M9Q A;  2EAY A;  5HK0 A;  1D3B A;  1WXB A;  2AZS A;  1M2V A;  3O8V A;  3PMT A;  1VIE A;  4EMH A;  1W2B S;  4Y91 A;  2KY9 A;  4XTW A;  4PFZ A;  3QKJ A;  4VUB A;  2PUO B;  3A8M B;  1Q86 R;  2EGC A;  5LJ5 g;  1Y07 A;  2RHY A;  9ATC B;  2HDA A;  3HKS A;  4ME7 A;  1KD1 R;  3OYE A;  2LCL A;  1X01 A;  5FRO A;  3MP6 A;  1VQK A;  2OTL A;  3R6N A;  4BI4 A;  2JTM A;  1UJ0 A;  3MP1 A;  3I35 A;  3VYG A;  4EMK A;  4M75 F;  3RDV A;  1R0C B;  1IHV A;  1SG5 A;  2OTJ Q;  2X4J A;  2IPO B;  1PSE A;  2QQR A;  1X27 A;  2KT8 A;  4C8Q D;  2C06 A;  2ZPB B;  4E47 A;  1PCX A;  1PRL C;  3CPW S;  3I56 Q;  3FRN A;  2JNG A;  2XG8 D;  3MEV A;  4OMO A;  2MK5 A;  2CSI A;  2K5L A;  2O2O A;  1YCS B;  2K3Y A;  1FMK A;  1Y0M A;  4JJD A;  1PWT A;  5CVI A;  4M7A D;  2RK2 A;  5IT9 E;  1K1Z A;  3NPF A;  1KHC A;  1H64 1;  3QXE B;  2GCX A;  3PVQ A;  3DB3 A;  3F70 A;  2ROL A;  1K73 C;  1SPK A;  1W6X A;  4ELY C;  2GF7 A;  4PKC C;  1NBE B;  4A4F A;  2K2V A;  3CCL T;  4F7U E;  1KG1 A;  4J9C A;  3NTK A;  3PT9 A;  2PZ1 A;  2DVJ A;  2KXD A;  3CCM T;  1LPL A;  3UAT A;  2VWF A;  3CCR Q;  3OYJ A;  3TSW A;  3RMQ A;  2NLU A;  1IGQ A;  4FCY A;  7AT1 B;  2PNI A;  4C5G A;  1IGU A;  2XHC A;  4KGX B;  4EMK C;  1YP5 A;  4KUL A;  1QCO A;  3V8K A;  3CCJ A;  1VQP T;  3V8J A;  2JZ2 A;  3CCU A;  3OS0 A;  2QI2 A;  3I55 Q;  1YJW T;  2CGH A;  3EG9 A;  2FYK A;  3UPU A;  3SFM A;  2DBK A;  5CKF A;  3X24 B;  1I0C A;  2HBP A;  2O9S A;  3VRZ A;  3M0T A;  1W4S A;  4BY6 B;  3QII A;  3EFR A;  4M75 G;  2EBP A;  2FZG B;  3M56 A;  2DKG A;  2E6N A;  4JUV A;  1VQM Q;  2JTE A;  2G6F X;  4A53 A;  1X2K A;  1KQ1 A;  5GAO n;  3G4S T;  2FPE A;  1U3O A;  2MWO A;  3J81 E;  2H3E B;  3L2Q A;  4QKU A;  1XQH A;  4GY5 A;  2M9U A;  8ATC B;  2E12 A;  1OYX A;  3M58 A;  4N4G A;  4J9H A;  1M90 U;  1WDX A;  4EDU A;  4A54 A;  2RHU A;  3JSC A;  5CAI A;  2HEQ A;  2KQW A;  3S6W A;  2OTL Q;  4RCB A;  4PLI A;  2X4W A;  1SHG A;  1T0H A;  3CC4 Q;  3TQ7 P;  1K8A R;  1ZUK A;  3CD6 T;  1OU8 A;  4HVU A;  2CZ7 B;  2X51 A;  5FU6 C;  2XIC A;  4D8K A;  1ZSZ B;  1Q81 R;  1V1C A;  4XU0 A;  4ZTF A;  3HTR A;  5J3B A;  2D1X A;  2VB6 A;  2X3W D;  1K9A A;  2ZPI B;  2A7Y A;  1RAH B;  5GMK m;  1WGS A;  3INZ A;  3CC2 A;  3V7C A;  2R5M A;  3QPH A;  2G3R A;  3G1J A;  4M77 E;  1X69 A;  2VC8 A;  2CDT A;  4BDY A;  2RJD A;  1SEM A;  2EKH A;  1M3B A;  2L5Q A;  2RK1 A;  3EHQ A;  2CUB A;  4PJJ A;  1B3Q A;  3DB4 A;  4M75 D;  2EYQ A;  3PMI A;  3LH0 A;  4J5Y A;  1M4Z A;  2FVU A;  3EGD A;  1YI2 Q;  2GFA A;  3VS4 A;  3CMA Q;  5CO7 A;  4DBF A;  1R8O B;  3LH5 A;  1VQ7 T;  5HY6 A;  2RQU A;  5IXB A;  1AWJ A;  2BZY A;  4A4K A;  2OI3 A;  4OML A;  4ZGJ B;  1Z9Q A;  4M7D G;  4LDV A;  1NPR A;  5GAM g;  4Z8A A;  5EC7 A;  1VQ6 T;  3PIP A;  2K79 A;  1YHQ A;  3SHW A;  3UF4 A;  5GAO m;  3VU3 C;  4ZGE B;  1EFN A;  1GXI E;  1ZQ1 A;  2R5A A;  3CEY A;  2VV5 A;  3FJP A;  2E4H A;  4J9G A;  1PC0 A;  2NUT B;  1U5S A;  3FDR A;  2KRS A;  4A4E A;  4KRT A;  2VAS A;  1IXD A;  5GMK l;  1LNX A;  1BU1 A;  1JEG A;  1YJN Q;  2KR3 A;  2DXT A;  4FSS A;  1BB9 A;  2J6O A;  5GJW B;  2LJ1 A;  4OMM A;  3BDU A;  1LJO A;  4JJC A;  1WQ7 A;  5I11 A;  3NMZ C;  3JCM Q;  3H0H A;  3M0Q A;  4KGV B;  1IB8 A;  3WVD B;  1WJR A;  4XK8 E;  4C0F A;  1SKU B;  2JOY A;  1AT1 B;  4EPC A;  3M55 A;  3GPL A;  1PD0 A;  3G71 A;  2QEX A;  2DL8 A;  1VQL Q;  4J9B A;  3JB9 J;  5FWB A;  1OX9 A;  3OYM A;  2KRM A;  2RH2 A;  1S72 T;  1ZUY A;  5KYY B;  2WSF E;  1HK9 A;  2BUD A;  3EFO B;  4M78 G;  3JB9 G;  4MMK A;  3OW2 S;  2DM1 A;  2F1L A;  3OYL A;  3BW1 A;  3CCQ T;  1JBM A;  1OQK A;  1BK2 A;  2DRK A;  1QVF A;  1UGP B;  2FZK B;  3EG0 A;  2I2L A;  2LCS A;  1UEB A;  1YIT T;  3NGP A;  1VQO T;  5GAO r;  4GLM A;  5GAO l;  3M57 A;  1NJI C;  2JUF A;  2LCC A;  3M4G A;  3PVL A;  2LNH B;  2F5T X;  2GGR A;  2DA9 A;  2JXB A;  2RD1 A;  3CC2 Q;  4B9W A;  2ABL A;  3PGG A;  1D0Y A;  2H3J A;  1TS9 A;  2DIL A;  4C92 G;  1VQN Q;  4M7A E;  3M0U A;  1AVZ C;  3RR6 A;  3QZ5 B;  2LDM A;  3NHN A;  1FXX A;  3CBO A;  2QA4 T;  1BIB A;  2EQI A;  1U06 A;  1HSQ A;  3CXC P;  3JCM W;  1Q82 C;  2ZZD A;  1RAD B;  5I22 A;  1AHJ B;  1IO6 A;  2JM9 A;  2QDL A;  2KXC A;  4XTX A;  1D0Z A;  3VS5 A;  3EG2 A;  3OB9 A;  4OP0 A;  2AIR B;  5EG2 A;  4FW2 A;  5CQX A;  2DX1 A;  1Q86 C;  1M90 R;  1N9R A;  1E6H A;  2ZAE A;  3OY9 A;  1G8X A;  1M3C A;  4M78 D;  5J39 A;  1SSH A;  2EJ9 A;  3J7A F;  2RQT A;  3DLM A;  1S1N A;  1JU5 C;  4N4H A;  4Y28 E;  3QHS A;  1VQ4 A;  1OEB A;  3VS6 A;  1B34 B;  4C0G A;  2YLB A;  2GBQ A;  3MKD A;  1H3H A;  1JXM A;  2YRD A;  3FEO A;  5GAN 5;  2M1H A;  1W2B A;  2MAM A;  4CI0 C;  1QLY A;  1EIF A;  1C6V X;  4QVD A;  1MMD A;  1AD5 A;  1TUD A;  2CT4 A;  3GBQ A;  3LGF A;  4E7S A;  4RTW A;  4J6Y A;  4C92 D;  2O9V A;  2KYB A;  1WHL A;  2OAW A;  4ANJ A;  4J83 A;  4KUI A;  2CSQ A;  2QQS A;  2L2P A;  4N4I A;  2RI2 A;  3QYH B;  5I2S A;  3A98 A;  5I2M A;  3WXM B;  3C94 A;  3HHT B;  1XOV A;  1YJ9 T;  1UUE A;  1M1K C;  2OTJ T;  4DEX A;  4R56 A;  1GRI A;  3REA B;  4JJN K;  1N8R U;  5CKE A;  3GOX A;  3HFN A;  3CPW A;  3CME Q;  3V8L A;  1AZG B;  2LVM A;  2OAU A;  4F7U B;  2FHD A;  1B07 A;  4O6J A;  3IQL A;  2M0Y A;  2QGF B;  5HK3 A;  1VQ5 A;  2KMT A;  1V76 A;  4K11 A;  3TEE A;  4OMF B;  5CK9 A;  4X9C A;  2BZX A;  5FW9 A;  4PJO G;  1WNL A;  3BE3 A;  4KH0 B;  5KH6 A;  4BE0 A;  3QG1 A;  2AKL A;  4II1 A;  2FPF A;  3E9F A;  2NWM A;  2EQU A;  1PRM C;  4XTU A;  1MHN A;  3OS2 A;  2IIM A;  4M75 E;  3JCM P;  5C0M A;  4BI3 A;  2C0T A;  2P84 A;  4RG2 A;  4J9F A;  3CC7 Q;  1ZSZ A;  1KSW A;  3CCR T;  1N6A A;  4QVC A;  2P0Q A;  5D6W A;  4R0K A;  2E65 A;  5DM7 R;  2E64 A;  4OMP A;  1ZSG A;  5LJ5 d;  5GAM j;  1Q7Y R;  2LJ0 A;  4C8Q G;  5DY9 A;  1WHH A;  4JLG A;  3RER A;  3H9N A;  3I55 T;  5LJ5 e;  1ZUU A;  4BY6 C;  5ECA A;  2PVD B;  1ARK A;  4Y92 A;  4FL6 A;  1RAI B;  4FT2 A;  2F2V A;  1UHF A;  2LP5 A;  1K9M C;  5FU7 B;  1X43 A;  1KIK A;  1YIJ A;  3OMG A;  3M0R A;  4ESR A;  1RAG B;  2M02 A;  1H3Z A;  5A0D A;  1RAB B;  3X25 B;  1NEG A;  2E70 A;  1VQM T;  5HCK A;  2OJ2 A;  4RCC A;  1Q81 C;  4D6W A;  1LCK A;  1VA7 A;  2JS0 A;  1TXQ A;  3LWI A;  2VGM A;  1UG1 A;  2L0A A;  2RO0 A;  4AFS C;  3JCM d;  4PJO D;  4AMC A;  5GAN d;  5GAO q;  3QWY A;  1ZA2 B;  3VRY A;  2DLP A;  3X26 B;  3JCM e;  2O88 A;  5GAN e;  2EVR A;  3RES A;  1MND A;  2RJE A;  2V8J A;  4AG1 C;  1ZSZ C;  2XKO C;  3CC4 T;  4M77 B;  2BIV A;  3JCM c;  2X4Y A;  2CZ0 B;  2EQK A;  3VS0 A;  2DE0 X;  8AT1 B;  2YXY A;  1KQ2 A;  2NUT A;  3OS1 A;  1YFN A;  2EYX A;  2EWN A; 
#chains in the Genus database with same CATH homology
 2COZ A;  1LPL A;  2COW A;  2CP7 A;  1WHH A;  2CP6 A;  2CP5 A;  2E4H A;  2MPX C;  1WHJ A;  2QK0 A;  1TXQ A;  2HL5 C;  2E3H A;  1WHK A;  2Z0W A;  1IXD A;  1WHL A;  1WHM A;  2CP2 A;  2E3I A;  1WHG A;  2COY A;  2HKN A;  2HL3 A;  4B6M A;  3E2U A;  1TOV A;  2CP3 A;  2HQH A;  3TQ7 P;  3RDV A;  2M02 A;  2HKQ B;  2CP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...