1WHJA

Solution structure of the 1st cap-gly domain in mouse 1700024k14rik hypothetical protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
b'GSSGSSGLPNSDHTTSRAMLTSLGLKLGDRVVIAGQKVGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGRVQYFKCAPKYGIFAPLSKISKLKDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 1700024K14
molecule tags Structural genomics, unknown function
source organism Mus musculus
publication title Solution structure of the 1st CAP-Gly domain in mouse 1700024K14Rik hypothetical protein
rcsb
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1whjA00
3TQ7P 2CP0A 2M02A 2E3IA 2HQHA 1TXQA 2HL5C 3RDVA 4B6MA 2HL3A 2Z0WA 2CP5A 2E3HA 3E2UA 2COZA 2CP7A 1LPLA 1WHJA 2COYA 2COWA 2MPXC 1WHGA 1TOVA 2CP6A 1IXDA 2QK0A 2CP2A 2HKQB 1WHHA 1WHLA 2CP3A 2E4HA 2HKNA 1WHKA 1WHMA
chains in the Genus database with same CATH superfamily
2NUTA 3TVTA 4E7LA 1HJDA 1NZ9A 2L2PA 2LJ0A 1UDLA 3RUXA 4Y92A 5KE2A 1VQ7A 1SSFA 5AYFA 1M90R 1Q86R 1Q81R 4JJBA 1MNEA 1IGUA 3SFMA 3JCMJ 1X27A 1YJNA 3I56A 3CCSQ 2E64A 5GAN5 3BDLA 1UG1A 1M8VA 2KY9A 1D1AA 1PD1A 4XAXB 3NPFA 3E19A 2MCNA 3TSWA 1R77A 2HD0A 5LJ3g 3CCRT 2C0TA 2HNIA 2RN8A 3KUFA 3QSUA 1ZHIA 1AWJA 1U06A 4V2SA 1VQKQ 3T9NA 4ZGJB 5FWBA 4KUIA 3MHXA 1M2VA 3UATA 2M0YA 2QEXT 2QEXA 2DIGA 1CKBA 2YT6A 1KJWA 5FWCA 2EGCA 2JS2A 2BE7D 1YI2Q 3I9QA 1BB9A 2DZCA 4M7AC 4B9XA 1I0CA 2BIVA 1K8AC 2VXEA 2FPEA 3GBQA 2EYWA 4PLIA 4PLLA 1Q81C 2BUDA 4GBQA 1ZA2B 2RJEA 2EYYA 2EW3A 2O4XB 3MCAB 1E7OA 2GF7A 1OU9A 5IHIA 3QJYA 5IAYA 2LJ1A 1VQ4T 4RUGA 2YUOA 3LH5A 4JZ4A 2D0QB 4OMLA 1RAFB 2KBTA 3L2VA 2VKNA 3O5ZA 2GTOA 3SD4A 1BCOA 2VXFA 2EYXA 3CMAT 5IN1A 1PKTA 3RR6A 5GMKl 1KC8U 1VQLA 4J8OA 4E7JA 3JCMf 1NEBA 1JQQA 3EHQA 2AKKA 2QTXA 2XMFA 4M78G 4OMOA 2HQXA 1TSFA 3M0TA 1Y7XA 3CCVT 1SRLA 1KHIA 1YNZA 2HQHA 2DYIA 2DX1A 2A3LA 3CMET 1PM3A 2L0AA 4DEXA 1VQOT 4F16A 1G3SA 2KI7A 2YUPA 2KRSA 3CC4Q 1XOVA 2CP2A 5CKHA 3VS6A 4D8KA 1YJ9T 3GPLA 2K3YA 2W0ZA 1PC0A 4LUEA 1X6OA 2K4YA 3E1SA 3CD6A 1OPKA 3HL8A 2ROTA 3OYLA 4B9WA 3MEUA 4NL2A 4A4HA 2D1XA 1FMWA 4EMKA 3CMAQ 3VYGA 3EGDB 2W10A 1Y96A 2LT1A 3OYNA 2HAXA 4IUPA 1RLPC 4HCBA 2E6NA 4AT1B 4XTVA 5KYWA 3QJ6A 4JJCA 1I8FA 4LN2A 4PKCC 3TSZA 2R57A 4M78D 4OB2B 5I21A 1K8AR 3EAEA 2E4HA 1UGSB 3I55T 3CBOA 2WACA 3M0UA 2HBWA 2BZXA 1I1JA 3CC2Q 4M75F 1WA7A 3CCQA 3C95A 4NOYA 2ED1A 4RTXA 4BI8B 1G3WA 5GAOm 3OYYA 3CCVQ 2VGNA 3VU3C 3M0QA 2E41A 3UPUA 2DVEA 3PVLA 2HDAA 3EFOB 4F04B 1K9MC 2PNIA 3FRNA 4IUVA 2AT1B 4JDSA 1WNLA 1GCQA 1WXBA 3CC4A 1XTDA 5LJ3h 3L2UA 1KQ2A 2YHTA 3OS0A 3HTRA 4C5EA 1O75A 2A37A 2YXYA 4WCIA 2CREA 2MMPA 4J9HA 3LYIA 1H3HA 2XU8A 1VQLQ 2VWFA 4OMPA 3JCMh 8ATCB 3CBPA 1RLQC 1QVGA 4IUUA 2R5AA 2ZPHB 4DQ2A 3OYAA 4AFSC 3RDVA 1QKWA 3ULRB 4ZTFA 2KR3A 2X9HA 3SHWA 4DA4A 4J6XA 3OYHA 4TVRA 4BY6C 3JCMd 3M59A 1PSEA 1OEBA 3TREA 1QW1A 1ZLMA 1TUGB 4RTYA 4C8QG 1C0MA 1FMVA 3GNGA 4JRIA 4R56A 3OMCA 4MMKA 2ESWA 1YI2A 3QYGB 4MDWA 1TTHB 3NHNA 5GAN4 1C1AA 3I5SA 8AT1B 1QVPA 5GMKh 4BDZA 3OYEA 3UWNA 3HKSA 2D6FA 2GQVA 5GAMe 5IXFA 1M90C 1EIFA 2P84A 1R0BG 3OBWA 2RQVA 4J9CA 1JO8A 4MZMA 4RMOA 1KQSP 3OMGA 1NM7A 3CXCS 1T3LA 3JCMX 2KNBB 2M16A 1TOVA 4XTZA 3MEVA 4BE0A 2M02A 2P0KA 2KDSA 3DB3A 3CCJQ 1VQ7Q 3EGDA 3VKIA 3H41A 4C0DB 4HT9A 3QO3A 1N9SA 5LL6S 4M77A 2X4JA 1K4US 4HXJA 1I4K1 2EKHA 1KC8R 2M0OA 3OW2A 1NJIR 2GBQA 2WSCE 1I5OB 2I2LA 1NE8A 2MAMA 4N0AC 1Q7YU 4L6V5 2BZYA 1VUBA 1N8RU 2RQUA 2O9VA 1B34A 1Y96B 4C5HA 4LUDA 1X69A 4K11A 3X25B 3QHSA 3FLGA 2E70A 1VIEA 4E7SA 4FYYB 4XK8E 3LWIA 3LWHA 2M1HA 4J9EA 2RJFA 2RK2A 4JLIA 3WVEB 2RM4A 3JB9G 4M77E 4ATOA 4PJJA 1JRIA 2RJCA 4CC4B 5GAMf 2HL3A 2FZCB 3JCMc 1RADB 2CSIA 2EJFA 1BI3A 4QQDA 1VQ6A 1AWXA 2CP7A 1YIJA 2RHXA 2FVUA 2ECZA 4DOWA 2QK0A 4M7AG 2RI2A 1K0SA 1A0NB 3JCMV 5GAN3 2L3QA 3S3MA 2CP3A 4CC2A 2GFAA 3FJPA 2DTHA 2K5FA 1TUCA 2LJ3A 1G2BA 2OTJQ 1Z9QA 1VYVA 4P5NA 4JZ3A 2DL7A 4M77G 1ZUUA 3RKWA 2EAYA 1VQPA 1NPPA 2P0QA 4A63B 4C0FA 3G4SA 1WHMA 4A54A 1D0XA 4JS4A 1K9MU 1WIEA 2DM1A 2XIDA 4II1A 1RL2A 5KYXB 4PJOC 3J7AF 1I81A 1Y71A 4BY6B 3CCST 4RTZA 3M57A 2VV5A 4LDWA 4JRKA 3JSCA 2KT1A 3CCVA 2HEQA 2B8AA 4KGZB 3CCUT 4EPCA 3PE0A 1JJ2A 1M27C 2H3JA 2E10A 1JJ2S 4ZTJA 1SKUB 2MYSA 2DTIA 5M9OA 4OB1B 2CSQA 3G7ZA 4ME7A 5CKFA 2QA4A 1JXMA 3OYKA 1AZEA 2GCXA 3S3OA 3X20B 3I5RA 1JJ2P 1D0ZA 1MMAA 1M2OA 3FEOA 1RABB 1KD1C 1IXDA 1MHNA 1G3YA 3OYMA 1KQSS 5D6WA 4J5YA 4J9GA 3UA7A 1VQ5Q 3HSBA 2FZKB 2K5IA 4PFOA 3EGUA 1YITA 5D6XA 2V1RA 1OX8A 1IHVA 4FW1A 2F69A 2CH4W 4JJNK 3I55Q 3CMAA 1LNXA 1T0JA 4E7ZA 3A8HB 2OJ2A 4LDYA 4DBHA 3HRUA 4C92F 3RESA 2P4TA 3EHRA 3OQ5A 2KGTA 4EMKC 1RI0A 2K2VA 3CD6Q 2XG8D 5GAOr 2YRCA 2GNCA 3PFSA 1SHFA 2JZ2A 4PNOA 4PJOG 1C6VX 3CCQQ 1UB4A 3A8OB 3VS7A 4BACA 1VQOA 3I55A 1K73U 1B07A 4C92D 1H8KA 4Y28E 3CC2A 2DF6A 2LNVA 4RG2A 2QQ9A 2X35A 1B7TA 3E9FA 2E6ZA 3JB9F 2ZZDA 2NUZA 1N5ZA 1SPKA 3NTKA 2HL5C 3CEYA 3H0HA 1N6AA 9ATCB 3VUBA 4KULA 4JPBW 2PUOB 7AT1B 3TEEA 4LD6A 1NYFA 3FB9A 2ATCB 4DBRA 1YFNA 4DEYA 2YSQA 3JCMb 4CRIA 2O88A 3NMZC 2JS0A 3JB9D 4XU2A 3R6NA 3UDCA 2DA9A 3UF4A 2KT8A 5GAMh 2XDPA 1SSHA 2EWNA 2E3IA 3VYHB 2CT4A 4XTUA 2RNAA 2LX9A 1X6BA 1IREB 1M9SA 2RMOA 2DJZA 1FX7A 3EG3A 1M8MA 4OMFB 2NLUA 2LQNA 3CPFA 1WXTA 5KYWB 4IUQA 2MIOA 1YIJT 3EG9A 5C0MA 1D3BA 1QVFS 4PJOE 3M53A 1YWPA 3OB9A 3PIPA 3G1JA 1BBZA 2ZAEA 3X24B 4M77F 4KH0B 2L5QA 2H3EB 1VA7A 1UEBA 4F7UF 4M7AA 1VQ7T 2DL4A 3OW2S 2QAZA 1GCPA 1WJQA 1T3SA 1P92A 3JCMQ 4JUVA 1VQKA 3PMIA 3OYCA 1RUWA 3CXCP 3FC3A 2RI3A 3FDRA 2CDTA 3VS2A 3AT1B 4OGEA 5IHKA 4QQ6A 2E5QA 1OZ3A 2EQJA 2OX7A 3M0PA 1KC8C 4M75B 1AEYA 5GANf 2RH2A 1IRXA 1WQ7A 2RHYA 2V26A 4HVUA 5FROA 3CCSA 4ESRA 1YJNQ 3BFMA 3OA6A 2AHJB 6AT1B 2CT3A 2AKLA 2VVKA 4QW2A 4M7DA 3THKA 5I22A 5J39A 4BE2A 2Z0WA 3JCMg 1WPYA 1UTIA 5EC7A 2RJDA 3CPWS 1UHFA 1Y0MA 4XTWA 4PJOB 5D6YA 2M51A 2ENMA 2D0NA 2DEQA 5DY9A 3CQTA 1U1SA 1UUEA 1MGQA 4E47A 1ZBJA 4N0AA 1QCOA 4LDXA 3TQ7P 3EG9B 2F5TX 4M7DB 1YHQQ 2JTMA 1FMKA 2YUQA 3UT1A 2YLBA 1QVGP 4J6WA 4LNPA 4A4FA 2RPNA 1JEGA 4EMHA 2O01E 2RQRA 3OYBA 3SEMA 1FYNA 3QWXX 1UGPB 2OI3A 4PJMA 4FYXB 3CC7Q 1U3OA 1WHHA 3CCJA 4PFPA 2F2XA 2DERA 4F7UA 5GANg 2GGRA 2AK5A 3JCMP 5GAOl 1VQ9T 4AFZC 3EGXA 3I56Q 3GOXA 2XDDA 2DXBA 4J7IA 4FT4A 2H8HA 4J83A 4KGVB 4FIBA 1UGRB 3PGGA 2L3PA 3A1PA 3DKMA 5GAOn 2ABLA 4WF2A 3HHTB 1ZSZC 4E7HA 5KYUB 1YCYA 2OAWA 1VQ9Q 1RI9A 3DLMA 2XKOC 1YN8A 1TWBA 1S72Q 1GRIA 1KK7A 1BKBA 2PU9B 2X4YA 4PJOA 4X9DA 2LQWA 3CCET 2KXDA 2LX7A 3HRTA 1AOJA 1OULA 4BD3A 2MI6A 3J81E 1NLPC 1NJIU 5GMKe 1VQ8A 4OMNA 5CKBA 1EZZB 2XICA 3EG2A 4IKFA 2QQAA 2CZ7B 1NYGA 1Q86U 3CCUA 1VQPQ 1LVKA 2LT4A 5I2SA 1W2BP 1R8OB 3O8VA 2FB7A 5AT1B 1UJ0A 2C06A 1AZGB 1S72A 3FIFA 1E6GA 5CQXA 2DO3A 1VQ9A 4FM4B 1PNJA 3ZL7C 2EIFA 1K9MR 3OYJA 5KCHA 1HSQA 1ARKA 2DTOA 4PFZA 3M4GA 1IB8A 4C92A 4JS5A 1YIJQ 2PZ1A 1VQ6Q 1D1BA 3EG0A 1ABOA 5CKDA 3Q1JA 4M7DC 2O4XA 1ZX6A 2C0IA 2NUPA 5HK0A 5LJ5j 4FSSA 2LC4A 2QG9B 3EFSA 2COYA 3U23A 3EG1A 1LJOA 4OGCA 1OU8A 3QKJA 1KQSA 2DNUA 2IPOB 4M75E 5GAMj 4UC4A 4M78A 3QBYA 3LW5E 2JM8A 2RHUA 1M1KC 1KHCA 2KRNA 3ME9A 3BDUA 3P8HA 1VQ8Q 4D6WA 4MZPA 4JRPA 4FCYA 5IH2A 5GANh 4PJOF 2BTTA 2FHDA 1BIBA 3A8LB 2EKOA 2M9UA 2OTLT 4FW2A 2J6FA 4E7IA 2GFUA 3JCMW 3VS1A 3M0RA 4M7AF 3VS3A 1XQHA 4F7UE 1AHJB 2HSEB 3H9NA 2LMJA 2DZ9A 1OOTA 1BCMA 4M75G 1HK9A 3V7CA 5GMKi 2YLCA 1Q7YC 2DK3A 1VQ4A 1VQKT 2DRKA 2FYKA 3MJXA 1K8AU 3GIBA 2CZ6B 5LJ3e 1YHQT 4M7AD 1WHKA 2A0FB 2RF0A 4E6RA 2VGMA 1UGQB 1M3BA 2DVJA 5GANj 1U1TA 2RHIA 2O9SA 1OX9A 1DJ7B 3MP8A 3CCMT 2A7YA 1VQ6T 3BY7A 3MKDA 3D7SB 2Y4XA 4C0ZA 4J9IA 2HKNA 1PRLC 1GBQA 4OVAA 5ECAA 3M4YA 1Q82R 4ZNXA 1QP3A 1WJRA 3RKXA 1VYTA 4E7KA 2LDMA 3G6ET 1LPLA 1Q7YR 2HZYA 1X6GA 1VQMT 2EYZA 1RAGB 4XU1A 2E12A 1WZOA 1N8RC 5A0GA 1FXXA 1VYUA 2PUKB 3MEWA 4NL3A 4O6JA 1QVFA 2CGHA 2RK1A 2RD1A 2ZPGB 3V8LA 2BKDN 1ZA1B 4A4GA 2OAUA 1O9SA 2COZA 2O2OA 3TCJA 3P8DA 4M7DF 1IHWA 2OTLQ 2JMCA 2QQRA 4C5GA 3H0FA 3NTHA 4BI4A 4A53A 5GANd 1WXUA 4X9CA 4M78F 3CC4T 1M1FA 1YP5A 2PTKA 2DLPA 2HCKA 5CQYA 1Q81U 4PJOD 1GXIE 4N4GA 2E1HA 4A4KA 4C92B 1VQNT 2MK5A 3L2ZA 2LQ8A 3QDFA 2R5MA 4M77C 2RQWA 3ZBDA 3F70A 2OTJT 1S72T 2EQKA 4R0KA 3RKYA 3A8MB 1MMGA 2VC8A 4C8QB 3L2QA 2VYTA 1B34B 2RB6A 4HA8A 4HKEA 4JJDA 1BIAA 2XHCA 1KD1U 3ASKA 1SF9A 2G3RA 2L3RA 2QDYB 1SG5A 2CP5A 3RMQA 3E2UA 3VRZA 4GLKA 3VS5A 1YITT 2ZCFB 4OP0A 5GANe 1Q86C 3X28B 5GAOp 3JV3A 2PVOB 2QI2A 3H8ZA 2MWPA 2CUDA 1AT1B 4MZTA 3MEAA 2K6DA 2CYZB 5FU6C 5GMKj 4ELZC 3PTAA 4ELYC 2KXCA 2F2VA 2K3XA 3G71A 5KYNA 1MNDA 2YRDA 4YTLA 1M3CA 5I2MA 2PQWA 2COWA 2MPXC 4LE9A 3IQLA 5FLXE 1MMDA 4FU6A 1I5LA 3C12A 5FU7C 1X75C 5IHNA 5CKEA 2CS7A 2F2WA 2CZ1B 2QA4Q 5HKCA 2PVDB 1VQ4Q 2X51A 3KBGA 2D8HA 2E3HA 3OSSC 2GTJA 4RCCA 4WTOB 3CBMA 1PG5B 1YBYA 4OF1A 1H3ZA 2JXBA 4ORZA 4OMMA 1ZBXA 1YCSB 4MMLA 3QZ5B 1XJWB 3VS4A 4C0GA 1KFZA 2JNGA 2CZ0B 3FJ5A 4R55A 2O31A 2J06A 1Y07A 1GFDA 4BE1A 4M77B 3RMSA 5GJVB 4FSXA 2LNHB 1JB0E 5A0DA 3C94A 4XTYA 5LJ3j 2EYQA 1WGSA 2A28A 2QGGA 4IIMA 1OI1A 5FRNA 3GLXA 4J9DA 1WJSA 2LTOA 2SRCA 3CCMA 1TU0B 1K73R 1GL5A 1IZ6A 3A98A 4ANJA 3CMEA 2XD0A 4L5GA 1K73C 2JOYA 2DJQA 3BW1A 5GAN2 3ER0A 4ZGEB 1N8RR 4F7UB 3QG1A 1B3QA 2HBPA 3QWYA 1OV3A 3G6EA 1U5SA 1YJ9A 4BUGA 2FG0A 1Y57A 3CCEA 3V8KA 1UJYA 3QYHB 3VJPA 1BI0A 1NG2A 1D0YA 2FRWA 4PL6A 3OS2A 3LLRA 2AZVA 1V1CA 3QUIA 4C5IA 2CUBA 2V1QA 1OPLA 4N4HA 4QKUA 2FRYA 2KYBA 5CIUA 4ZGDB 3CCUQ 2DXTA 2X4XA 3HFOA 1QVFP 1CKAA 3BE3A 5CCAA 4C92E 5CO7A 2K9GA 1WQWA 1Q82U 4C8QC 1H92A 4Z02A 3HFNA 4RKUE 1QCFA 4C8QD 1VQNA 1EFNA 4OB0B 1OYXA 2QEXQ 3OS1A 5LJ5e 5IT9E 2HQEA 1RAAB 3URGA 2CH4A 2P0PA 1LCKA 5KYXA 4M7DE 1MMNA 1UGVA 5FRMA 3EFOA 2KE9A 3GNFB 3CCRA 1D3BB 2FEIA 5KE3A 4KH1B 3A5ZB 3JRZA 4EMGA 1TG0A 1YJWT 5GAMg 3H0IA 2QASA 1W4SA 1VQ8T 3A8GB 2DL5A 4C92C 2JJ9A 2JW4A 5KYYB 1WLPB 1PD0A 3CC7T 2MF2A 1OQKA 2QTVA 2NYSA 3CC7A 5L23A 5LJ5g 1VOMA 2K57A 2CKKA 3DLLA 2YRVA 3SB2A 1T0HA 2GQIA 3SWNB 4QVDA 2ZPIB 3LH0A 1WDXA 2X3XD 2JN0A 2JT4A 3L2WA 3WVDB 5J26A 4LDVA 1M4ZA 4M77D 1VQNQ 2BZ8A 3JB9I 2C0OA 4D8DA 1ABQA 2PVGB 4HVVA 2XK0A 3KFVA 1N9RA 4C8QF 1X43A 1M5Q1 3M55A 4OMQA 4EMKB 1ZSZA 5DM7R 2DAQA 2DRMA 1CSKA 4Z88A 3CCQT 1AWOA 3WXMB 4AG1C 2KAFA 2LP5A 2Y90A 3G71T 2NUPB 3QDRB 1UHCA 2CP0A 2XI9A 2EBPA 4RTVA 2R58A 2J6OA 4Z8AA 4Y91A 4B6MA 2JTFA 2LCLA 1ZUKA 4CI0C 1G83A 4BDYA 4HVWA 1K0XA 4DOVA 3MP6A 1ZQ1A 1H641 2NUTB 2V8IA 4HCZA 5GAN8 3CCJT 4LXCA 3M56A 1D09B 2JVVA 4RTTA 3CC2T 3HRSA 1HD3A 3OS5A 2FPDA 2QDLA 4DBQA 4KRTA 2DYBA 1EX4A 2EQMA 1RAEB 5FU6B 1MV0B 1VQ5T 2DBKA 2L3SA 4MDXA 2DD4A 4O5VA 4VUBA 2MWOA 5C6SA 1M30A 4A4EA 3JB9J 2F5KA 1BYMA 1PRMC 3S3NA 3V8JA 4C0DC 2DFUA 2LCSA 3KXTA 1PHTA 2EVRA 4KBMB 3VV0A 2DETA 2RA2A 4JRQA 1YWOA 1TH7A 4Q5WA 4RCBA 1YJWA 1BU1A 2E65A 1WHGA 3VRYA 1HYOA 2EGEA 3H6ZA 1ZUYA 3EH2A 4FYVB 5GAN7 4M4ZA 4KT0E 4HT8A 1RAHB 2DEUA 2X3WD 5LJ5d 2DIQA 4FT2A 3CCLQ 4ZN3A 3TU4K 4J6YA 3C4SA 2LCCA 1G8XA 1KQ1A 1U8RA 3CPWP 5HK3A 5LJ5f 1GCQC 2MOXA 4CC7A 4Z89A 1K1ZA 1YJNT 3G71Q 4QT7A 2E5KA 3HP9A 4C8QA 4BB7A 1YHQA 1M1KR 4OB3B 2LZ6B 2Y4YA 3EFRA 2DXUA 1QKXA 3RBBB 1WYXA 3RNJA 1M1KU 3PNWC 2DE0X 2RQTA 1QLYA 4XTXA 1W1FA 3L2RA 1J3TA 2KK4A 4X1VA 2DL3A 3MO8A 4M75C 3EGXB 4NS5A 4JLGA 4XU0A 1TS9A 2J6KA 4PJNA 2RO0A 1UFFA 1WI7A 1AD5A 1Z9ZA 2AIRB 1YITQ 3OYIA 1G3TA 3PIOA 1K76A 3L42A 5KYYA 5KYUA 1VQ5A 3LX7A 2I0NA 2KQWA 2ZPFB 2LQKA 3OSVA 4N4IA 1NBEB 2BE9B 2KYMA 1RAIB 1I07A 4LD9K 3ZFJA 2DBMA 3JAME 3QZ9B 2CP6A 4QQGA 2IIMA 3M58A 3V7RA 3J80E 3M0SA 2ROLA 4FL6A 4C92G 3OW2P 5FU7B 2KRMA 2ZPBB 4M7AE 2DPPB 2EJGA 1VQLT 1G5VA 3V7SA 2XDBA 2RI5A 5LJ5h 2VASA 3CCLT 1QQJA 1PKSA 5D7UA 3LGFA 2KEAA 4HCCA 1W2BA 3DB4A 1PSFA 1QP2A 4C8QE 5L8RE 1WHLA 3N5BB 3NFCA 3RIRA 2ZGWA 4AG2C 1V76A 1OZ2A 3M9QA 1ZSZB 1BI2A 3QPHA 3G4SQ 2EQIA 2J7IA 2YWWA 1AWWA 2YUNA 3SWNC 1KSWA 3RERA 1ZSGA 2DXCA 1IGQA 1M1GA 2DMOA 2DL8A 4LDUA 3L1AA 4GLMA 5LJ3d 5J3BA 1KG1A 1LOJA 5GAOq 4IIOA 4EDUA 4PJLA 3NTIA 1RACB 3CD6T 1K9AA 4ZN1A 2NWMA 1ACMB 2K3BA 2L89A 1X01A 1E6HA 5HCKA 2B86A 1QCNA 5CR2A 2ED0A 2OTLA 1MV3A 3CPWA 1SHGA 4M7DD 3OYFA 2YDLA 3VUZA 4AFQC 2JMAA 1VQOQ 3LGLA 1D1CA 4RG8A 2ZPEB 3VS0A 3GP8A 2DILA 1VQPT 1W70A 1IO6A 2J05A 2V8KA 4HCKA 3OYGA 1PWTA 3PVQA 3R6OA 3I56T 1NEGA 1M90U 3EH1A 2KSSA 2EGAA 1NPRA 3CXCA 3G4ST 3JCMe 1Q95G 1JXOA 2X4WA 1KD1R 2FZGB 3MP1A 1W6XA 1N27A 4QVCA 1BK2A 3QIIA 3PT9A 4KUDK 2P4RA 1X2KA 5DLOA 4X34A 2L8DA 2FO0A 1X2QA 4M7AB 1JBMA 3X26B 3INZA 5KCOA 2D8JA 3REBB 2KMTA 3AHUA 5EG2A 2EFIA 4M78C 2EPDA 4DBFA 2KVQG 3E9GA 2HKQB 4BI3A 4FYWB 5GAMd 2DKGA 3MPUB 1NJIC 3CCLA 3NGPA 1FWZA 4XQ3A 4M78E 4QVZA 1UECA 3P8BB 1QWEA 1M2VB 2AZSA 5GAN6 3CCRQ 4L59A 2D9TA 1GBRA 1VQMQ 1UE9A 5FW9A 4F17A 1YJWQ 1QVGS 5CAIA 4AFUC 2IVWA 2EJ9A 2F1LA 1BI1A 3GF5A 4AMCA 4F14A 5GMKm 1WX6A 2JUFA 4IURA 1WHJA 2EQUA 3OYDA 5HY6A 2HMAA 2G6FX 1TUDA 2K7AA 2WSEE 1JU5C 4J7FA 5CVIA 4KGXB 1HXDA 1R0CB 4GY5A 3JB9H 2V8JA 1NLOC 1TXQA 2QQBA 4RTWA 2DD5A 2OTJA 2LVMA 2A36A 4M75A 3C0CA 3HPWA 1VIFA 2QA4T 5GJWB 1SEMA 2VUBA 1QWFA 3ZEHA 4CC3A 3S6WA 1SRMA 1PCXA 2QXFA 4PK4A 4EIKA 5IXBA 1VQMA 2QGFB 1Q82C 1YI2T 2IG0A 4J9FA 1S1NA 4M75D 4E2FB 4F7UG 4RTUA 2K2MA 2JM9A 3CCEQ 2RHZA 4M7DG 1YJ9Q 2FL7A 3G6EQ 4M78B 2QQSA 5I11A 3M5AA 1XNIA 3M54A 1AVZC 2A08A 2JTEA 3OBYA 4IUTA 5LJ3f 1QMCA 3CMEQ 2VB6A 1KIKA 1W2BS 1M3AA 2WSFE 3CCMQ 2K5LA 4J9BA 1WFWA 2FPFA 5DLQE 1GFCA 1MUZA 2KROA 2HSPA 3OY9A 3REAB 1F1BB 2K79A 2SEMA 3I35A 5A2QE 3SDZA 2LRQA 1V29B 5A0LA 5CK9A 4XU3A 3SWNA 3PMTA 5KH6A 3UA6A 2QYZA 3META 3QXEB
chains in the Genus database with same CATH topology
3TQ7P 2CP0A 2M02A 2E3IA 2HQHA 1TXQA 2HL5C 3RDVA 4B6MA 2HL3A 2Z0WA 2CP5A 2E3HA 3E2UA 2COZA 2CP7A 1LPLA 1WHJA 2COYA 2COWA 2MPXC 1WHGA 1TOVA 2CP6A 1IXDA 2QK0A 2CP2A 2HKQB 1WHHA 1WHLA 2CP3A 2E4HA 2HKNA 1WHKA 1WHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQ7 P;  2CP0 A;  2M02 A;  2E3I A;  2HQH A;  1TXQ A;  2HL5 C;  3RDV A;  4B6M A;  2HL3 A;  2Z0W A;  2CP5 A;  2E3H A;  3E2U A;  2COZ A;  2CP7 A;  1LPL A;  1WHJ A;  2COY A;  2COW A;  2MPX C;  1WHG A;  1TOV A;  2CP6 A;  1IXD A;  2QK0 A;  2CP2 A;  2HKQ B;  1WHH A;  1WHL A;  2CP3 A;  2E4H A;  2HKN A;  1WHK A;  1WHM A; 
#chains in the Genus database with same CATH topology
 2NUT A;  3TVT A;  4E7L A;  1HJD A;  1NZ9 A;  2L2P A;  2LJ0 A;  1UDL A;  3RUX A;  4Y92 A;  5KE2 A;  1VQ7 A;  1SSF A;  5AYF A;  1M90 R;  1Q86 R;  1Q81 R;  4JJB A;  1MNE A;  1IGU A;  3SFM A;  3JCM J;  1X27 A;  1YJN A;  3I56 A;  3CCS Q;  2E64 A;  5GAN 5;  3BDL A;  1UG1 A;  1M8V A;  2KY9 A;  1D1A A;  1PD1 A;  4XAX B;  3NPF A;  3E19 A;  2MCN A;  3TSW A;  1R77 A;  2HD0 A;  5LJ3 g;  3CCR T;  2C0T A;  2HNI A;  2RN8 A;  3KUF A;  3QSU A;  1ZHI A;  1AWJ A;  1U06 A;  4V2S A;  1VQK Q;  3T9N A;  4ZGJ B;  5FWB A;  4KUI A;  3MHX A;  1M2V A;  3UAT A;  2M0Y A;  2QEX T;  2QEX A;  2DIG A;  1CKB A;  2YT6 A;  1KJW A;  5FWC A;  2EGC A;  2JS2 A;  2BE7 D;  1YI2 Q;  3I9Q A;  1BB9 A;  2DZC A;  4M7A C;  4B9X A;  1I0C A;  2BIV A;  1K8A C;  2VXE A;  2FPE A;  3GBQ A;  2EYW A;  4PLI A;  4PLL A;  1Q81 C;  2BUD A;  4GBQ A;  1ZA2 B;  2RJE A;  2EYY A;  2EW3 A;  2O4X B;  3MCA B;  1E7O A;  2GF7 A;  1OU9 A;  5IHI A;  3QJY A;  5IAY A;  2LJ1 A;  1VQ4 T;  4RUG A;  2YUO A;  3LH5 A;  4JZ4 A;  2D0Q B;  4OML A;  1RAF B;  2KBT A;  3L2V A;  2VKN A;  3O5Z A;  2GTO A;  3SD4 A;  1BCO A;  2VXF A;  2EYX A;  3CMA T;  5IN1 A;  1PKT A;  3RR6 A;  5GMK l;  1KC8 U;  1VQL A;  4J8O A;  4E7J A;  3JCM f;  1NEB A;  1JQQ A;  3EHQ A;  2AKK A;  2QTX A;  2XMF A;  4M78 G;  4OMO A;  2HQX A;  1TSF A;  3M0T A;  1Y7X A;  3CCV T;  1SRL A;  1KHI A;  1YNZ A;  2HQH A;  2DYI A;  2DX1 A;  2A3L A;  3CME T;  1PM3 A;  2L0A A;  4DEX A;  1VQO T;  4F16 A;  1G3S A;  2KI7 A;  2YUP A;  2KRS A;  3CC4 Q;  1XOV A;  2CP2 A;  5CKH A;  3VS6 A;  4D8K A;  1YJ9 T;  3GPL A;  2K3Y A;  2W0Z A;  1PC0 A;  4LUE A;  1X6O A;  2K4Y A;  3E1S A;  3CD6 A;  1OPK A;  3HL8 A;  2ROT A;  3OYL A;  4B9W A;  3MEU A;  4NL2 A;  4A4H A;  2D1X A;  1FMW A;  4EMK A;  3CMA Q;  3VYG A;  3EGD B;  2W10 A;  1Y96 A;  2LT1 A;  3OYN A;  2HAX A;  4IUP A;  1RLP C;  4HCB A;  2E6N A;  4AT1 B;  4XTV A;  5KYW A;  3QJ6 A;  4JJC A;  1I8F A;  4LN2 A;  4PKC C;  3TSZ A;  2R57 A;  4M78 D;  4OB2 B;  5I21 A;  1K8A R;  3EAE A;  2E4H A;  1UGS B;  3I55 T;  3CBO A;  2WAC A;  3M0U A;  2HBW A;  2BZX A;  1I1J A;  3CC2 Q;  4M75 F;  1WA7 A;  3CCQ A;  3C95 A;  4NOY A;  2ED1 A;  4RTX A;  4BI8 B;  1G3W A;  5GAO m;  3OYY A;  3CCV Q;  2VGN A;  3VU3 C;  3M0Q A;  2E41 A;  3UPU A;  2DVE A;  3PVL A;  2HDA A;  3EFO B;  4F04 B;  1K9M C;  2PNI A;  3FRN A;  4IUV A;  2AT1 B;  4JDS A;  1WNL A;  1GCQ A;  1WXB A;  3CC4 A;  1XTD A;  5LJ3 h;  3L2U A;  1KQ2 A;  2YHT A;  3OS0 A;  3HTR A;  4C5E A;  1O75 A;  2A37 A;  2YXY A;  4WCI A;  2CRE A;  2MMP A;  4J9H A;  3LYI A;  1H3H A;  2XU8 A;  1VQL Q;  2VWF A;  4OMP A;  3JCM h;  8ATC B;  3CBP A;  1RLQ C;  1QVG A;  4IUU A;  2R5A A;  2ZPH B;  4DQ2 A;  3OYA A;  4AFS C;  3RDV A;  1QKW A;  3ULR B;  4ZTF A;  2KR3 A;  2X9H A;  3SHW A;  4DA4 A;  4J6X A;  3OYH A;  4TVR A;  4BY6 C;  3JCM d;  3M59 A;  1PSE A;  1OEB A;  3TRE A;  1QW1 A;  1ZLM A;  1TUG B;  4RTY A;  4C8Q G;  1C0M A;  1FMV A;  3GNG A;  4JRI A;  4R56 A;  3OMC A;  4MMK A;  2ESW A;  1YI2 A;  3QYG B;  4MDW A;  1TTH B;  3NHN A;  5GAN 4;  1C1A A;  3I5S A;  8AT1 B;  1QVP A;  5GMK h;  4BDZ A;  3OYE A;  3UWN A;  3HKS A;  2D6F A;  2GQV A;  5GAM e;  5IXF A;  1M90 C;  1EIF A;  2P84 A;  1R0B G;  3OBW A;  2RQV A;  4J9C A;  1JO8 A;  4MZM A;  4RMO A;  1KQS P;  3OMG A;  1NM7 A;  3CXC S;  1T3L A;  3JCM X;  2KNB B;  2M16 A;  1TOV A;  4XTZ A;  3MEV A;  4BE0 A;  2M02 A;  2P0K A;  2KDS A;  3DB3 A;  3CCJ Q;  1VQ7 Q;  3EGD A;  3VKI A;  3H41 A;  4C0D B;  4HT9 A;  3QO3 A;  1N9S A;  5LL6 S;  4M77 A;  2X4J A;  1K4U S;  4HXJ A;  1I4K 1;  2EKH A;  1KC8 R;  2M0O A;  3OW2 A;  1NJI R;  2GBQ A;  2WSC E;  1I5O B;  2I2L A;  1NE8 A;  2MAM A;  4N0A C;  1Q7Y U;  4L6V 5;  2BZY A;  1VUB A;  1N8R U;  2RQU A;  2O9V A;  1B34 A;  1Y96 B;  4C5H A;  4LUD A;  1X69 A;  4K11 A;  3X25 B;  3QHS A;  3FLG A;  2E70 A;  1VIE A;  4E7S A;  4FYY B;  4XK8 E;  3LWI A;  3LWH A;  2M1H A;  4J9E A;  2RJF A;  2RK2 A;  4JLI A;  3WVE B;  2RM4 A;  3JB9 G;  4M77 E;  4ATO A;  4PJJ A;  1JRI A;  2RJC A;  4CC4 B;  5GAM f;  2HL3 A;  2FZC B;  3JCM c;  1RAD B;  2CSI A;  2EJF A;  1BI3 A;  4QQD A;  1VQ6 A;  1AWX A;  2CP7 A;  1YIJ A;  2RHX A;  2FVU A;  2ECZ A;  4DOW A;  2QK0 A;  4M7A G;  2RI2 A;  1K0S A;  1A0N B;  3JCM V;  5GAN 3;  2L3Q A;  3S3M A;  2CP3 A;  4CC2 A;  2GFA A;  3FJP A;  2DTH A;  2K5F A;  1TUC A;  2LJ3 A;  1G2B A;  2OTJ Q;  1Z9Q A;  1VYV A;  4P5N A;  4JZ3 A;  2DL7 A;  4M77 G;  1ZUU A;  3RKW A;  2EAY A;  1VQP A;  1NPP A;  2P0Q A;  4A63 B;  4C0F A;  3G4S A;  1WHM A;  4A54 A;  1D0X A;  4JS4 A;  1K9M U;  1WIE A;  2DM1 A;  2XID A;  4II1 A;  1RL2 A;  5KYX B;  4PJO C;  3J7A F;  1I81 A;  1Y71 A;  4BY6 B;  3CCS T;  4RTZ A;  3M57 A;  2VV5 A;  4LDW A;  4JRK A;  3JSC A;  2KT1 A;  3CCV A;  2HEQ A;  2B8A A;  4KGZ B;  3CCU T;  4EPC A;  3PE0 A;  1JJ2 A;  1M27 C;  2H3J A;  2E10 A;  1JJ2 S;  4ZTJ A;  1SKU B;  2MYS A;  2DTI A;  5M9O A;  4OB1 B;  2CSQ A;  3G7Z A;  4ME7 A;  5CKF A;  2QA4 A;  1JXM A;  3OYK A;  1AZE A;  2GCX A;  3S3O A;  3X20 B;  3I5R A;  1JJ2 P;  1D0Z A;  1MMA A;  1M2O A;  3FEO A;  1RAB B;  1KD1 C;  1IXD A;  1MHN A;  1G3Y A;  3OYM A;  1KQS S;  5D6W A;  4J5Y A;  4J9G A;  3UA7 A;  1VQ5 Q;  3HSB A;  2FZK B;  2K5I A;  4PFO A;  3EGU A;  1YIT A;  5D6X A;  2V1R A;  1OX8 A;  1IHV A;  4FW1 A;  2F69 A;  2CH4 W;  4JJN K;  3I55 Q;  3CMA A;  1LNX A;  1T0J A;  4E7Z A;  3A8H B;  2OJ2 A;  4LDY A;  4DBH A;  3HRU A;  4C92 F;  3RES A;  2P4T A;  3EHR A;  3OQ5 A;  2KGT A;  4EMK C;  1RI0 A;  2K2V A;  3CD6 Q;  2XG8 D;  5GAO r;  2YRC A;  2GNC A;  3PFS A;  1SHF A;  2JZ2 A;  4PNO A;  4PJO G;  1C6V X;  3CCQ Q;  1UB4 A;  3A8O B;  3VS7 A;  4BAC A;  1VQO A;  3I55 A;  1K73 U;  1B07 A;  4C92 D;  1H8K A;  4Y28 E;  3CC2 A;  2DF6 A;  2LNV A;  4RG2 A;  2QQ9 A;  2X35 A;  1B7T A;  3E9F A;  2E6Z A;  3JB9 F;  2ZZD A;  2NUZ A;  1N5Z A;  1SPK A;  3NTK A;  2HL5 C;  3CEY A;  3H0H A;  1N6A A;  9ATC B;  3VUB A;  4KUL A;  4JPB W;  2PUO B;  7AT1 B;  3TEE A;  4LD6 A;  1NYF A;  3FB9 A;  2ATC B;  4DBR A;  1YFN A;  4DEY A;  2YSQ A;  3JCM b;  4CRI A;  2O88 A;  3NMZ C;  2JS0 A;  3JB9 D;  4XU2 A;  3R6N A;  3UDC A;  2DA9 A;  3UF4 A;  2KT8 A;  5GAM h;  2XDP A;  1SSH A;  2EWN A;  2E3I A;  3VYH B;  2CT4 A;  4XTU A;  2RNA A;  2LX9 A;  1X6B A;  1IRE B;  1M9S A;  2RMO A;  2DJZ A;  1FX7 A;  3EG3 A;  1M8M A;  4OMF B;  2NLU A;  2LQN A;  3CPF A;  1WXT A;  5KYW B;  4IUQ A;  2MIO A;  1YIJ T;  3EG9 A;  5C0M A;  1D3B A;  1QVF S;  4PJO E;  3M53 A;  1YWP A;  3OB9 A;  3PIP A;  3G1J A;  1BBZ A;  2ZAE A;  3X24 B;  4M77 F;  4KH0 B;  2L5Q A;  2H3E B;  1VA7 A;  1UEB A;  4F7U F;  4M7A A;  1VQ7 T;  2DL4 A;  3OW2 S;  2QAZ A;  1GCP A;  1WJQ A;  1T3S A;  1P92 A;  3JCM Q;  4JUV A;  1VQK A;  3PMI A;  3OYC A;  1RUW A;  3CXC P;  3FC3 A;  2RI3 A;  3FDR A;  2CDT A;  3VS2 A;  3AT1 B;  4OGE A;  5IHK A;  4QQ6 A;  2E5Q A;  1OZ3 A;  2EQJ A;  2OX7 A;  3M0P A;  1KC8 C;  4M75 B;  1AEY A;  5GAN f;  2RH2 A;  1IRX A;  1WQ7 A;  2RHY A;  2V26 A;  4HVU A;  5FRO A;  3CCS A;  4ESR A;  1YJN Q;  3BFM A;  3OA6 A;  2AHJ B;  6AT1 B;  2CT3 A;  2AKL A;  2VVK A;  4QW2 A;  4M7D A;  3THK A;  5I22 A;  5J39 A;  4BE2 A;  2Z0W A;  3JCM g;  1WPY A;  1UTI A;  5EC7 A;  2RJD A;  3CPW S;  1UHF A;  1Y0M A;  4XTW A;  4PJO B;  5D6Y A;  2M51 A;  2ENM A;  2D0N A;  2DEQ A;  5DY9 A;  3CQT A;  1U1S A;  1UUE A;  1MGQ A;  4E47 A;  1ZBJ A;  4N0A A;  1QCO A;  4LDX A;  3TQ7 P;  3EG9 B;  2F5T X;  4M7D B;  1YHQ Q;  2JTM A;  1FMK A;  2YUQ A;  3UT1 A;  2YLB A;  1QVG P;  4J6W A;  4LNP A;  4A4F A;  2RPN A;  1JEG A;  4EMH A;  2O01 E;  2RQR A;  3OYB A;  3SEM A;  1FYN A;  3QWX X;  1UGP B;  2OI3 A;  4PJM A;  4FYX B;  3CC7 Q;  1U3O A;  1WHH A;  3CCJ A;  4PFP A;  2F2X A;  2DER A;  4F7U A;  5GAN g;  2GGR A;  2AK5 A;  3JCM P;  5GAO l;  1VQ9 T;  4AFZ C;  3EGX A;  3I56 Q;  3GOX A;  2XDD A;  2DXB A;  4J7I A;  4FT4 A;  2H8H A;  4J83 A;  4KGV B;  4FIB A;  1UGR B;  3PGG A;  2L3P A;  3A1P A;  3DKM A;  5GAO n;  2ABL A;  4WF2 A;  3HHT B;  1ZSZ C;  4E7H A;  5KYU B;  1YCY A;  2OAW A;  1VQ9 Q;  1RI9 A;  3DLM A;  2XKO C;  1YN8 A;  1TWB A;  1S72 Q;  1GRI A;  1KK7 A;  1BKB A;  2PU9 B;  2X4Y A;  4PJO A;  4X9D A;  2LQW A;  3CCE T;  2KXD A;  2LX7 A;  3HRT A;  1AOJ A;  1OUL A;  4BD3 A;  2MI6 A;  3J81 E;  1NLP C;  1NJI U;  5GMK e;  1VQ8 A;  4OMN A;  5CKB A;  1EZZ B;  2XIC A;  3EG2 A;  4IKF A;  2QQA A;  2CZ7 B;  1NYG A;  1Q86 U;  3CCU A;  1VQP Q;  1LVK A;  2LT4 A;  5I2S A;  1W2B P;  1R8O B;  3O8V A;  2FB7 A;  5AT1 B;  1UJ0 A;  2C06 A;  1AZG B;  1S72 A;  3FIF A;  1E6G A;  5CQX A;  2DO3 A;  1VQ9 A;  4FM4 B;  1PNJ A;  3ZL7 C;  2EIF A;  1K9M R;  3OYJ A;  5KCH A;  1HSQ A;  1ARK A;  2DTO A;  4PFZ A;  3M4G A;  1IB8 A;  4C92 A;  4JS5 A;  1YIJ Q;  2PZ1 A;  1VQ6 Q;  1D1B A;  3EG0 A;  1ABO A;  5CKD A;  3Q1J A;  4M7D C;  2O4X A;  1ZX6 A;  2C0I A;  2NUP A;  5HK0 A;  5LJ5 j;  4FSS A;  2LC4 A;  2QG9 B;  3EFS A;  2COY A;  3U23 A;  3EG1 A;  1LJO A;  4OGC A;  1OU8 A;  3QKJ A;  1KQS A;  2DNU A;  2IPO B;  4M75 E;  5GAM j;  4UC4 A;  4M78 A;  3QBY A;  3LW5 E;  2JM8 A;  2RHU A;  1M1K C;  1KHC A;  2KRN A;  3ME9 A;  3BDU A;  3P8H A;  1VQ8 Q;  4D6W A;  4MZP A;  4JRP A;  4FCY A;  5IH2 A;  5GAN h;  4PJO F;  2BTT A;  2FHD A;  1BIB A;  3A8L B;  2EKO A;  2M9U A;  2OTL T;  4FW2 A;  2J6F A;  4E7I A;  2GFU A;  3JCM W;  3VS1 A;  3M0R A;  4M7A F;  3VS3 A;  1XQH A;  4F7U E;  1AHJ B;  2HSE B;  3H9N A;  2LMJ A;  2DZ9 A;  1OOT A;  1BCM A;  4M75 G;  1HK9 A;  3V7C A;  5GMK i;  2YLC A;  1Q7Y C;  2DK3 A;  1VQ4 A;  1VQK T;  2DRK A;  2FYK A;  3MJX A;  1K8A U;  3GIB A;  2CZ6 B;  5LJ3 e;  1YHQ T;  4M7A D;  1WHK A;  2A0F B;  2RF0 A;  4E6R A;  2VGM A;  1UGQ B;  1M3B A;  2DVJ A;  5GAN j;  1U1T A;  2RHI A;  2O9S A;  1OX9 A;  1DJ7 B;  3MP8 A;  3CCM T;  2A7Y A;  1VQ6 T;  3BY7 A;  3MKD A;  3D7S B;  2Y4X A;  4C0Z A;  4J9I A;  2HKN A;  1PRL C;  1GBQ A;  4OVA A;  5ECA A;  3M4Y A;  1Q82 R;  4ZNX A;  1QP3 A;  1WJR A;  3RKX A;  1VYT A;  4E7K A;  2LDM A;  3G6E T;  1LPL A;  1Q7Y R;  2HZY A;  1X6G A;  1VQM T;  2EYZ A;  1RAG B;  4XU1 A;  2E12 A;  1WZO A;  1N8R C;  5A0G A;  1FXX A;  1VYU A;  2PUK B;  3MEW A;  4NL3 A;  4O6J A;  1QVF A;  2CGH A;  2RK1 A;  2RD1 A;  2ZPG B;  3V8L A;  2BKD N;  1ZA1 B;  4A4G A;  2OAU A;  1O9S A;  2COZ A;  2O2O A;  3TCJ A;  3P8D A;  4M7D F;  1IHW A;  2OTL Q;  2JMC A;  2QQR A;  4C5G A;  3H0F A;  3NTH A;  4BI4 A;  4A53 A;  5GAN d;  1WXU A;  4X9C A;  4M78 F;  3CC4 T;  1M1F A;  1YP5 A;  2PTK A;  2DLP A;  2HCK A;  5CQY A;  1Q81 U;  4PJO D;  1GXI E;  4N4G A;  2E1H A;  4A4K A;  4C92 B;  1VQN T;  2MK5 A;  3L2Z A;  2LQ8 A;  3QDF A;  2R5M A;  4M77 C;  2RQW A;  3ZBD A;  3F70 A;  2OTJ T;  1S72 T;  2EQK A;  4R0K A;  3RKY A;  3A8M B;  1MMG A;  2VC8 A;  4C8Q B;  3L2Q A;  2VYT A;  1B34 B;  2RB6 A;  4HA8 A;  4HKE A;  4JJD A;  1BIA A;  2XHC A;  1KD1 U;  3ASK A;  1SF9 A;  2G3R A;  2L3R A;  2QDY B;  1SG5 A;  2CP5 A;  3RMQ A;  3E2U A;  3VRZ A;  4GLK A;  3VS5 A;  1YIT T;  2ZCF B;  4OP0 A;  5GAN e;  1Q86 C;  3X28 B;  5GAO p;  3JV3 A;  2PVO B;  2QI2 A;  3H8Z A;  2MWP A;  2CUD A;  1AT1 B;  4MZT A;  3MEA A;  2K6D A;  2CYZ B;  5FU6 C;  5GMK j;  4ELZ C;  3PTA A;  4ELY C;  2KXC A;  2F2V A;  2K3X A;  3G71 A;  5KYN A;  1MND A;  2YRD A;  4YTL A;  1M3C A;  5I2M A;  2PQW A;  2COW A;  2MPX C;  4LE9 A;  3IQL A;  5FLX E;  1MMD A;  4FU6 A;  1I5L A;  3C12 A;  5FU7 C;  1X75 C;  5IHN A;  5CKE A;  2CS7 A;  2F2W A;  2CZ1 B;  2QA4 Q;  5HKC A;  2PVD B;  1VQ4 Q;  2X51 A;  3KBG A;  2D8H A;  2E3H A;  3OSS C;  2GTJ A;  4RCC A;  4WTO B;  3CBM A;  1PG5 B;  1YBY A;  4OF1 A;  1H3Z A;  2JXB A;  4ORZ A;  4OMM A;  1ZBX A;  1YCS B;  4MML A;  3QZ5 B;  1XJW B;  3VS4 A;  4C0G A;  1KFZ A;  2JNG A;  2CZ0 B;  3FJ5 A;  4R55 A;  2O31 A;  2J06 A;  1Y07 A;  1GFD A;  4BE1 A;  4M77 B;  3RMS A;  5GJV B;  4FSX A;  2LNH B;  1JB0 E;  5A0D A;  3C94 A;  4XTY A;  5LJ3 j;  2EYQ A;  1WGS A;  2A28 A;  2QGG A;  4IIM A;  1OI1 A;  5FRN A;  3GLX A;  4J9D A;  1WJS A;  2LTO A;  2SRC A;  3CCM A;  1TU0 B;  1K73 R;  1GL5 A;  1IZ6 A;  3A98 A;  4ANJ A;  3CME A;  2XD0 A;  4L5G A;  1K73 C;  2JOY A;  2DJQ A;  3BW1 A;  5GAN 2;  3ER0 A;  4ZGE B;  1N8R R;  4F7U B;  3QG1 A;  1B3Q A;  2HBP A;  3QWY A;  1OV3 A;  3G6E A;  1U5S A;  1YJ9 A;  4BUG A;  2FG0 A;  1Y57 A;  3CCE A;  3V8K A;  1UJY A;  3QYH B;  3VJP A;  1BI0 A;  1NG2 A;  1D0Y A;  2FRW A;  4PL6 A;  3OS2 A;  3LLR A;  2AZV A;  1V1C A;  3QUI A;  4C5I A;  2CUB A;  2V1Q A;  1OPL A;  4N4H A;  4QKU A;  2FRY A;  2KYB A;  5CIU A;  4ZGD B;  3CCU Q;  2DXT A;  2X4X A;  3HFO A;  1QVF P;  1CKA A;  3BE3 A;  5CCA A;  4C92 E;  5CO7 A;  2K9G A;  1WQW A;  1Q82 U;  4C8Q C;  1H92 A;  4Z02 A;  3HFN A;  4RKU E;  1QCF A;  4C8Q D;  1VQN A;  1EFN A;  4OB0 B;  1OYX A;  2QEX Q;  3OS1 A;  5LJ5 e;  5IT9 E;  2HQE A;  1RAA B;  3URG A;  2CH4 A;  2P0P A;  1LCK A;  5KYX A;  4M7D E;  1MMN A;  1UGV A;  5FRM A;  3EFO A;  2KE9 A;  3GNF B;  3CCR A;  1D3B B;  2FEI A;  5KE3 A;  4KH1 B;  3A5Z B;  3JRZ A;  4EMG A;  1TG0 A;  1YJW T;  5GAM g;  3H0I A;  2QAS A;  1W4S A;  1VQ8 T;  3A8G B;  2DL5 A;  4C92 C;  2JJ9 A;  2JW4 A;  5KYY B;  1WLP B;  1PD0 A;  3CC7 T;  2MF2 A;  1OQK A;  2QTV A;  2NYS A;  3CC7 A;  5L23 A;  5LJ5 g;  1VOM A;  2K57 A;  2CKK A;  3DLL A;  2YRV A;  3SB2 A;  1T0H A;  2GQI A;  3SWN B;  4QVD A;  2ZPI B;  3LH0 A;  1WDX A;  2X3X D;  2JN0 A;  2JT4 A;  3L2W A;  3WVD B;  5J26 A;  4LDV A;  1M4Z A;  4M77 D;  1VQN Q;  2BZ8 A;  3JB9 I;  2C0O A;  4D8D A;  1ABQ A;  2PVG B;  4HVV A;  2XK0 A;  3KFV A;  1N9R A;  4C8Q F;  1X43 A;  1M5Q 1;  3M55 A;  4OMQ A;  4EMK B;  1ZSZ A;  5DM7 R;  2DAQ A;  2DRM A;  1CSK A;  4Z88 A;  3CCQ T;  1AWO A;  3WXM B;  4AG1 C;  2KAF A;  2LP5 A;  2Y90 A;  3G71 T;  2NUP B;  3QDR B;  1UHC A;  2CP0 A;  2XI9 A;  2EBP A;  4RTV A;  2R58 A;  2J6O A;  4Z8A A;  4Y91 A;  4B6M A;  2JTF A;  2LCL A;  1ZUK A;  4CI0 C;  1G83 A;  4BDY A;  4HVW A;  1K0X A;  4DOV A;  3MP6 A;  1ZQ1 A;  1H64 1;  2NUT B;  2V8I A;  4HCZ A;  5GAN 8;  3CCJ T;  4LXC A;  3M56 A;  1D09 B;  2JVV A;  4RTT A;  3CC2 T;  3HRS A;  1HD3 A;  3OS5 A;  2FPD A;  2QDL A;  4DBQ A;  4KRT A;  2DYB A;  1EX4 A;  2EQM A;  1RAE B;  5FU6 B;  1MV0 B;  1VQ5 T;  2DBK A;  2L3S A;  4MDX A;  2DD4 A;  4O5V A;  4VUB A;  2MWO A;  5C6S A;  1M30 A;  4A4E A;  3JB9 J;  2F5K A;  1BYM A;  1PRM C;  3S3N A;  3V8J A;  4C0D C;  2DFU A;  2LCS A;  3KXT A;  1PHT A;  2EVR A;  4KBM B;  3VV0 A;  2DET A;  2RA2 A;  4JRQ A;  1YWO A;  1TH7 A;  4Q5W A;  4RCB A;  1YJW A;  1BU1 A;  2E65 A;  1WHG A;  3VRY A;  1HYO A;  2EGE A;  3H6Z A;  1ZUY A;  3EH2 A;  4FYV B;  5GAN 7;  4M4Z A;  4KT0 E;  4HT8 A;  1RAH B;  2DEU A;  2X3W D;  5LJ5 d;  2DIQ A;  4FT2 A;  3CCL Q;  4ZN3 A;  3TU4 K;  4J6Y A;  3C4S A;  2LCC A;  1G8X A;  1KQ1 A;  1U8R A;  3CPW P;  5HK3 A;  5LJ5 f;  1GCQ C;  2MOX A;  4CC7 A;  4Z89 A;  1K1Z A;  1YJN T;  3G71 Q;  4QT7 A;  2E5K A;  3HP9 A;  4C8Q A;  4BB7 A;  1YHQ A;  1M1K R;  4OB3 B;  2LZ6 B;  2Y4Y A;  3EFR A;  2DXU A;  1QKX A;  3RBB B;  1WYX A;  3RNJ A;  1M1K U;  3PNW C;  2DE0 X;  2RQT A;  1QLY A;  4XTX A;  1W1F A;  3L2R A;  1J3T A;  2KK4 A;  4X1V A;  2DL3 A;  3MO8 A;  4M75 C;  3EGX B;  4NS5 A;  4JLG A;  4XU0 A;  1TS9 A;  2J6K A;  4PJN A;  2RO0 A;  1UFF A;  1WI7 A;  1AD5 A;  1Z9Z A;  2AIR B;  1YIT Q;  3OYI A;  1G3T A;  3PIO A;  1K76 A;  3L42 A;  5KYY A;  5KYU A;  1VQ5 A;  3LX7 A;  2I0N A;  2KQW A;  2ZPF B;  2LQK A;  3OSV A;  4N4I A;  1NBE B;  2BE9 B;  2KYM A;  1RAI B;  1I07 A;  4LD9 K;  3ZFJ A;  2DBM A;  3JAM E;  3QZ9 B;  2CP6 A;  4QQG A;  2IIM A;  3M58 A;  3V7R A;  3J80 E;  3M0S A;  2ROL A;  4FL6 A;  4C92 G;  3OW2 P;  5FU7 B;  2KRM A;  2ZPB B;  4M7A E;  2DPP B;  2EJG A;  1VQL T;  1G5V A;  3V7S A;  2XDB A;  2RI5 A;  5LJ5 h;  2VAS A;  3CCL T;  1QQJ A;  1PKS A;  5D7U A;  3LGF A;  2KEA A;  4HCC A;  1W2B A;  3DB4 A;  1PSF A;  1QP2 A;  4C8Q E;  5L8R E;  1WHL A;  3N5B B;  3NFC A;  3RIR A;  2ZGW A;  4AG2 C;  1V76 A;  1OZ2 A;  3M9Q A;  1ZSZ B;  1BI2 A;  3QPH A;  3G4S Q;  2EQI A;  2J7I A;  2YWW A;  1AWW A;  2YUN A;  3SWN C;  1KSW A;  3RER A;  1ZSG A;  2DXC A;  1IGQ A;  1M1G A;  2DMO A;  2DL8 A;  4LDU A;  3L1A A;  4GLM A;  5LJ3 d;  5J3B A;  1KG1 A;  1LOJ A;  5GAO q;  4IIO A;  4EDU A;  4PJL A;  3NTI A;  1RAC B;  3CD6 T;  1K9A A;  4ZN1 A;  2NWM A;  1ACM B;  2K3B A;  2L89 A;  1X01 A;  1E6H A;  5HCK A;  2B86 A;  1QCN A;  5CR2 A;  2ED0 A;  2OTL A;  1MV3 A;  3CPW A;  1SHG A;  4M7D D;  3OYF A;  2YDL A;  3VUZ A;  4AFQ C;  2JMA A;  1VQO Q;  3LGL A;  1D1C A;  4RG8 A;  2ZPE B;  3VS0 A;  3GP8 A;  2DIL A;  1VQP T;  1W70 A;  1IO6 A;  2J05 A;  2V8K A;  4HCK A;  3OYG A;  1PWT A;  3PVQ A;  3R6O A;  3I56 T;  1NEG A;  1M90 U;  3EH1 A;  2KSS A;  2EGA A;  1NPR A;  3CXC A;  3G4S T;  3JCM e;  1Q95 G;  1JXO A;  2X4W A;  1KD1 R;  2FZG B;  3MP1 A;  1W6X A;  1N27 A;  4QVC A;  1BK2 A;  3QII A;  3PT9 A;  4KUD K;  2P4R A;  1X2K A;  5DLO A;  4X34 A;  2L8D A;  2FO0 A;  1X2Q A;  4M7A B;  1JBM A;  3X26 B;  3INZ A;  5KCO A;  2D8J A;  3REB B;  2KMT A;  3AHU A;  5EG2 A;  2EFI A;  4M78 C;  2EPD A;  4DBF A;  2KVQ G;  3E9G A;  2HKQ B;  4BI3 A;  4FYW B;  5GAM d;  2DKG A;  3MPU B;  1NJI C;  3CCL A;  3NGP A;  1FWZ A;  4XQ3 A;  4M78 E;  4QVZ A;  1UEC A;  3P8B B;  1QWE A;  1M2V B;  2AZS A;  5GAN 6;  3CCR Q;  4L59 A;  2D9T A;  1GBR A;  1VQM Q;  1UE9 A;  5FW9 A;  4F17 A;  1YJW Q;  1QVG S;  5CAI A;  4AFU C;  2IVW A;  2EJ9 A;  2F1L A;  1BI1 A;  3GF5 A;  4AMC A;  4F14 A;  5GMK m;  1WX6 A;  2JUF A;  4IUR A;  1WHJ A;  2EQU A;  3OYD A;  5HY6 A;  2HMA A;  2G6F X;  1TUD A;  2K7A A;  2WSE E;  1JU5 C;  4J7F A;  5CVI A;  4KGX B;  1HXD A;  1R0C B;  4GY5 A;  3JB9 H;  2V8J A;  1NLO C;  1TXQ A;  2QQB A;  4RTW A;  2DD5 A;  2OTJ A;  2LVM A;  2A36 A;  4M75 A;  3C0C A;  3HPW A;  1VIF A;  2QA4 T;  5GJW B;  1SEM A;  2VUB A;  1QWF A;  3ZEH A;  4CC3 A;  3S6W A;  1SRM A;  1PCX A;  2QXF A;  4PK4 A;  4EIK A;  5IXB A;  1VQM A;  2QGF B;  1Q82 C;  1YI2 T;  2IG0 A;  4J9F A;  1S1N A;  4M75 D;  4E2F B;  4F7U G;  4RTU A;  2K2M A;  2JM9 A;  3CCE Q;  2RHZ A;  4M7D G;  1YJ9 Q;  2FL7 A;  3G6E Q;  4M78 B;  2QQS A;  5I11 A;  3M5A A;  1XNI A;  3M54 A;  1AVZ C;  2A08 A;  2JTE A;  3OBY A;  4IUT A;  5LJ3 f;  1QMC A;  3CME Q;  2VB6 A;  1KIK A;  1W2B S;  1M3A A;  2WSF E;  3CCM Q;  2K5L A;  4J9B A;  1WFW A;  2FPF A;  5DLQ E;  1GFC A;  1MUZ A;  2KRO A;  2HSP A;  3OY9 A;  3REA B;  1F1B B;  2K79 A;  2SEM A;  3I35 A;  5A2Q E;  3SDZ A;  2LRQ A;  1V29 B;  5A0L A;  5CK9 A;  4XU3 A;  3SWN A;  3PMT A;  5KH6 A;  3UA6 A;  2QYZ A;  3MET A;  3QXE B; 
#chains in the Genus database with same CATH homology
 3TQ7 P;  2CP0 A;  2M02 A;  2E3I A;  2HQH A;  1TXQ A;  2HL5 C;  3RDV A;  4B6M A;  2HL3 A;  2Z0W A;  2CP5 A;  2E3H A;  3E2U A;  2COZ A;  2CP7 A;  1LPL A;  1WHJ A;  2COY A;  2COW A;  2MPX C;  1WHG A;  1TOV A;  2CP6 A;  1IXD A;  2QK0 A;  2CP2 A;  2HKQ B;  1WHH A;  1WHL A;  2CP3 A;  2E4H A;  2HKN A;  1WHK A;  1WHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...