3QSUA

Structure of staphylococcus aureus hfq in complex with a7 rna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA chaperone Hfq
publication title Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Chaperone/rna
total genus 18
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F, G, H, I, J, K, M, N, S
ec nomenclature
pdb deposition date 2011-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qsuA00
4XTYA 4XTZA 5GAOm 5GMKm 3L2ZA 3JCMQ 5GAOp 4M7AB 5GANf 4M7DC 1U1SA 1BIAA 3HFNA 1KQ1A 5GANd 2DTOA 5LJ3d 5GAN5 4PJOE 1TH7A 5GANj 3V7CA 5GANe 5GAOq 4C8QC 4M78C 4EMGA 3GIBA 4RCBA 3JCMh 2RM4A 4C92E 4J6YA 3QUIA 4M7AF 1B34A 4NOYA 5GMKh 3JCMf 4M75C 3JCMd 2EAYA 2E65A 3V7SA 4WF2A 3JCMe 4HT8A 4OP0A 5CAIA 1LOJA 2RA2A 4M7AG 1N9SA 5GMKj 4M7AD 4XTXA 2JN0A 4M77G 4Y91A 5GMKe 4PJOC 4M77A 4M7DA 5DY9A 1B34B 2DVEA 4QVCA 5GAOl 4HT9A 4HA8A 5LJ3g 2E10A 4XTUA 2FYKA 4C92C 2E64A 2I2LA 4M78A 5GAOr 3RUXA 4QVDA 1D3BA 4N0AC 1JRIA 3JB9H 1N9RA 4RCCA 3JCMP 2DTIA 2EJ9A 4M77B 4M7DB 3RKWA 1M8VA 5LJ5g 1WPYA 4M78B 3QSUA 4M7AE 4M77F 2CGHA 4J6WA 4M7DF 1D3BB 4PJOA 4EMHA 5GAMh 1Y96A 2DJZA 5GAN2 2DZ9A 4F7UA 3RKYA 3SWNA 5GAMf 1X01A 2ZGWA 5GAMd 1BIBA 3BDUA 4N0AA 4JLIA 4EMKC 5I21A 5GAMj 3M4GA 5GAMe 5GAN3 2RB6A 3JB9I 5GAN4 4M77D 4J5YA 2DTHA 4M7DD 4M7DG 2DXUA 3FIFA 1Y96B 1MGQA 1LNXA 5GANg 1I4K1 4F7UB 5GMKi 2E1HA 1JBMA 4M78G 3SWNB 4C8QG 1HK9A 4C8QA 4NL2A 4XU2A 5GAN6 2YLBA 5GMKl 3V8KA 1KQ2A 1LJOA 3V7RA 2Y90A 2VXFA 3EFRA 4F7UF 2YHTA 2YLCA 3HFOA 4M75G 4M75A 4MMLA 4XTWA 3JCMg 1HXDA 1WQ7A 2VXEA 2DXTA 2E41A 2DEQA 1I5LA 4C8QB 3INZA 4PNOA 4PJOG 4DQ2A 4M77E 4M7DE 5GAOn 1YCYA 3BW1A 3RIRA 4F7UG 4C92G 3JCMX 4M75B 3VU3C 4C8QF 4M78F 4C92A 2HNIA 3RESA 5GAN7 3JCMW 3JB9J 2VC8A 4M75F 4A54A 3FJPA 3RKXA 3JCMJ 3HSBA 1I8FA 4XU1A 4PJOB 1U1TA 3FB9A 4JRIA 5LJ3h 3BFMA 3V8LA 3JB9F 2QTXA 4C8QD 4M78D 3L1AA 4C92B 3JCMb 4M7AC 5LJ3f 4M77C 4NL3A 2EJFA 4PJOF 3JCMc 3RERA 3EFSA 4JRKA 3PGGA 1WQWA 2EJGA 2K57A 4M75D 4F7UE 5LJ3e 5LJ3j 4C92F 3AHUA 4V2SA 2DKGA 5LJ5h 3JCMV 4X9CA 3JB9G 3QO3A 4X9DA 5GAMg 4XU3A 5LJ5f 3JB9D 4MMKA 4EMKA 2RD1A 3QHSA 5LJ5d 4PJOD 4XTVA 1I81A 5LJ5j 1WNLA 5LJ5e 4JUVA 2FB7A 4XU0A 3SB2A 3V8JA 4C92D 5GAN8 4C8QE 4M78E 4M7AA 4XQ3A 2DZCA 4A53A 2EWNA 3BY7A 1H641 4J6XA 3SWNC 4EMKB 1M5Q1 4M75E 5GANh
chains in the Genus database with same CATH superfamily
1MMNA 3L2ZA 2BTTA 1BB9A 2HD0A 2D0NA 3CMEQ 2PVDB 2LC4A 3SEMA 3JV3A 2COYA 4M4ZA 1VQ5Q 3R6NA 5DY9A 3VKIA 1QCOA 1G8XA 4XTUA 2WSCE 4O5VA 2MWOA 5KYYB 3A8LB 1IHVA 2LZ6B 1MMAA 1D0XA 4PJJA 2AZSA 5L8RE 1AZGB 2DTIA 1M8VA 3RKWA 3I5RA 3PIOA 2RI5A 5IHNA 1X69A 2MMPA 3UF4A 4DOVA 2J06A 1WXTA 3TCJA 4BY6B 4BACA 1N8RR 3X24B 1UJ0A 4MDXA 1X01A 2V8KA 1JEGA 2DYBA 3MJXA 1ABOA 2ZAEA 4JLIA 4GLMA 4E7HA 3CCVT 5D6XA 1AWOA 4KGVB 2QAZA 1M2OA 5GMKi 1ZBJA 1MNEA 2OX7A 1UGQB 1VQ4T 4ORZA 2YLCA 2KYMA 2LJ1A 2GFUA 4LE9A 1S72T 2DBMA 2QQAA 4X1VA 1ZSZB 3OBYA 1YIJA 2KRSA 2E70A 1EIFA 1F1BB 3NHNA 3CCQQ 2XICA 1WHKA 2BIVA 1KSWA 1I8FA 3CBMA 3CCEQ 4PJOB 3CPWA 1M4ZA 4GLKA 2KROA 4C92B 2O31A 4M77C 1BK2A 1RAGB 4F7UE 1RL2A 3FDRA 2CREA 1N8RC 2V8IA 3NTKA 5I22A 4MMKA 1VIFA 2D8JA 3RMSA 4WTOB 2JUFA 1U06A 3HTRA 2XIDA 4ELYC 3LYIA 1JXMA 1YITQ 3MP8A 3MP1A 4LDUA 5I2SA 2CP0A 3BY7A 3QPHA 5IHKA 1EZZB 2YUPA 3OYCA 1KC8U 2PZ1A 1VYVA 1Q82R 1KQ2A 2X3WD 1GL5A 2LTOA 4GY5A 4XTZA 1MNDA 2M51A 1M1KU 3M0QA 2L5QA 2RM4A 2AZVA 1KK7A 5GMKh 2CZ7B 2DA9A 3CCLT 1QVPA 5KYYA 1S1NA 2MI6A 3NTHA 3VS3A 3HP9A 3M0SA 3LWHA 1HD3A 1XNIA 1WDXA 1OZ3A 3CCQT 3OMCA 2SEMA 3I9QA 2RMOA 4B9WA 3ME9A 1VQMT 3OYKA 4KT0E 2VGNA 4LUDA 4IIMA 4JJBA 4D6WA 1QWEA 1MV3A 3ZEHA 2FG0A 1Q82C 2VB6A 3FIFA 3PT9A 2JTEA 2E5KA 4M78G 4XU2A 1TUDA 4EPCA 1ZSZA 3V7RA 2VXFA 1YJNQ 1A0NB 4M75G 1RLPC 1HXDA 1WZOA 3X20B 1YHQQ 4EDUA 3CCMA 2ABLA 4C92A 1Q86U 1G5VA 3CCJA 4E6RA 1NYFA 3EH2A 1SG5A 5FW9A 3QJYA 3TREA 1VA7A 1VQLT 2EJGA 1IHWA 1M27C 2L2PA 4OMPA 2KRNA 3QO3A 5GAMg 5LJ5f 3EAEA 2LQNA 4PJOD 3M0PA 5IAYA 5LJ5j 5LJ5e 3SHWA 4C92D 2V1RA 1VQNT 2LCLA 5HCKA 3NTIA 3L2WA 1K73U 3RBBB 1ZBXA 5ECAA 1YI2Q 4M7DC 1M8MA 1QCNA 4RTTA 4QW2A 3GIBA 2DD4A 2JT4A 2C06A 1BCOA 1Q7YR 3PMTA 2DL8A 3E9FA 2YSQA 1OU9A 1YHQT 1NPPA 4ESRA 1TOVA 2FYKA 3CCVA 2E64A 2GTJA 1N9RA 4RCCA 2DIGA 4M7DB 2CUDA 1VQ4A 4M7AE 2FZCB 4C0ZA 1S72A 2FPDA 1U8RA 2R5AA 3J7AF 5GAN3 3FC3A 4RG8A 4Y92A 1QVFA 4C8QG 3CC7T 3L2RA 2YLBA 3V8KA 2KDSA 2LCCA 1RADB 1YJWT 3QXEB 1Q7YC 4LUEA 1VQ7T 4N4HA 2KMTA 5C6SA 1D1BA 2YXYA 1RLQC 1QW1A 4F7UG 3OB9A 2DETA 1VQ9Q 3CC2Q 2H3JA 3RESA 5IXFA 1UEBA 2CP5A 3RKXA 1X6GA 2D1XA 3CD6T 4OMNA 1Y0MA 1JXOA 3PGGA 1YJ9Q 5KE2A 2HSPA 7AT1B 1RABB 3G1JA 1K4US 3S6WA 3D7SB 2ROTA 1Q81C 2EYWA 3E19A 4IUQA 2NUTB 3CCLA 3VRZA 1U5SA 1V29B 2BZ8A 3M55A 5GANh 2QQBA 2C0TA 3EGXB 1XQHA 5A0LA 2PVGB 2E3IA 2FZKB 2JTMA 2EW3A 1M1KR 5LL6S 4JZ3A 1VQMA 2LRQA 4CC3A 2K6DA 2A36A 3QIIA 2HDAA 3SFMA 2I0NA 3V7SA 4WF2A 5KYNA 3TVTA 4M7DA 3MCAB 1B34B 4HT9A 2ESWA 4IUUA 2IG0A 1WHGA 1TU0B 1QKWA 1V76A 3GOXA 1JRIA 1YWPA 4PK4A 4FM4B 4AMCA 1SSHA 3A1PA 1TG0A 3CXCS 2HQHA 1JO8A 4M77F 3OYYA 3MP6A 2KNBB 1G3WA 5GAMd 1W2BA 2A37A 3URGA 4M7DD 2DK3A 2CP7A 4FW1A 4DBRA 3PNWC 2AKLA 1RI0A 5D6WA 1M1KC 2CYZB 2LMJA 2PTKA 3VUBA 1E7OA 1IRXA 1VQLA 5J26A 3META 3INZA 5IXBA 1NPRA 2KT8A 2QQ9A 1VQOQ 2E5QA 3OSVA 1Q86R 3JCMJ 3CCUT 3QG1A 1VQNA 4C5HA 3EG3A 3EG9B 2NUTA 3MEAA 3LGFA 4QQDA 2LP5A 3S3MA 1FMKA 2J6KA 3PVLA 3N5BB 3M56A 4EIKA 1K9MU 5FRMA 4NS5A 2QA4Q 2O88A 3EGXA 2DL3A 2HBWA 1QMCA 1M30A 1M9SA 2QG9B 2YRCA 4EMKB 2BUDA 2YDLA 5KYWB 1VQPQ 2R58A 2H3EB 3I55Q 2KR3A 1X27A 1LVKA 4KRTA 2JVVA 2M1HA 5GAOp 1OI1A 1U1SA 4L6V5 2DLPA 4C0DC 4HCBA 2KXCA 2RJFA 3G6EQ 1B34A 4NOYA 4XAXB 3TSWA 4JJNK 1RAIB 4Z88A 1Q86C 4LDVA 5CAIA 2NWMA 4M7AG 5GMKj 4XTXA 5GMKe 2MF2A 2P4TA 2QXFA 2F5TX 4DBFA 1W1FA 1YP5A 3CC7A 5IH2A 1G3SA 1VUBA 1I07A 3QYGB 1RAEB 1RUWA 5LJ5g 1YJWA 1H3HA 2ZPEB 4C0DB 2CGHA 1VQ7A 2OTLQ 4F04B 1G83A 2JS2A 4KH1B 2DRKA 4MZMA 1I4K1 3GLXA 2ZPFB 2VASA 2OTJT 3CXCP 3CD6A 3UATA 4ZTJA 4F7UF 3CMAQ 2ECZA 2RI2A 1ZHIA 2RQWA 3E1SA 1I0CA 1VQ6T 4ZGDB 2XKOC 1I5LA 2AKKA 2JM9A 1YCYA 3REAB 4BDYA 4OMMA 2QASA 4ZNXA 4O6JA 4A4GA 3EG9A 3HHTB 2O9VA 2OAUA 2R57A 3L1AA 2RI3A 1IGQA 1OX8A 3EFSA 4FCYA 1VOMA 3GNGA 3VS4A 2DKGA 1SKUB 4IKFA 1YBYA 3H8ZA 3CCSQ 1NM7A 1QCFA 2F1LA 4EMKA 3A98A 1B3QA 5KYWA 4D8DA 4A4FA 1GFDA 4IURA 5CKBA 3VS0A 3OYLA 4M78E 2DZCA 1PKSA 3VS7A 1LPLA 4ANJA 4M75E 1TUCA 5J39A 1D0YA 3PMIA 2EQIA 3C12A 4OB0B 2JW4A 5LJ3d 2FHDA 1DJ7B 1I5OB 4J9FA 4BI4A 1M90U 4JDSA 4QQGA 2RQRA 1X6BA 1P92A 2YRDA 1N9SA 2KEAA 2RQTA 1UTIA 5A0DA 9ATCB 4E7JA 3HRSA 1PSEA 3DB3A 1QVGA 2CS7A 5KCHA 5KYUB 3OMGA 3X28B 2PNIA 1EFNA 2DX1A 1Y71A 3S3OA 2DJZA 1SHFA 5GAN2 3DLLA 3LH0A 2RJEA 4Z89A 4JLGA 3C4SA 3QWYA 4DA4A 4AFZC 1UHFA 1MGQA 2DNUA 3CCUA 3LW5E 1K76A 1PNJA 3EFRA 2CP6A 1UDLA 3DB4A 4MMLA 2AK5A 1WQ7A 3LH5A 2E12A 1VQKT 3OYIA 2RPNA 4A4HA 3JCMX 4BDZA 1Q95G 3M0UA 2DERA 5FLXE 4RTVA 2RHYA 4HVVA 1D1AA 2GTOA 2ED0A 2QTXA 2QDLA 4BUGA 3CCRQ 3AHUA 5CQYA 2MOXA 4QQ6A 3J81E 1K9MR 5LJ5d 3CMET 2LQKA 3M53A 4C8QE 1X2KA 1ZLMA 3G4SQ 3SD4A 4J7IA 2D6FA 1H641 3GNFB 1BI3A 3M0TA 4J9HA 1VQ5T 4CC2A 1SF9A 5GANf 2GGRA 1KD1R 5GANj 5GANe 4HXJA 4M78C 4GBQA 4RCBA 1VQ8Q 1X43A 4M7AF 5DM7R 2RF0A 4M75C 1KIKA 5KYUA 3BE3A 3E2UA 2HEQA 3QZ9B 2EVRA 1GCQC 2JN0A 3VJPA 1MMGA 2BE7D 4J9IA 3CPWS 2BZXA 1AHJB 1K0SA 3H9NA 3RUXA 3H0FA 1WYXA 3OY9A 2OTJA 2F5KA 1UGVA 4M77B 1K9MC 4M78B 1VQ6A 2ZCFB 5CIUA 3M57A 4C5EA 2P84A 2JMAA 3M0RA 3BDUA 5I21A 3MO8A 1OPKA 3U23A 4J5YA 2DTHA 2GNCA 1N27A 3EG2A 5C0MA 1SSFA 5I11A 1KG1A 4KUIA 1KD1C 1XOVA 3CCET 1TXQA 2VXEA 1AWJA 2KQWA 5GJVB 4PJOG 3BW1A 3RIRA 4C92G 2X35A 3H41A 3O5ZA 2D9TA 2CP2A 3A5ZB 2CH4W 3P8BB 1K9AA 4JRIA 1YITT 2DEUA 3QJ6A 4NL3A 2YUQA 2EQJA 3NMZC 1BBZA 4Y28E 2IIMA 3X26B 1UG1A 3FEOA 1GBQA 1Y7XA 1YWOA 4D8KA 3DLMA 3ZFJA 5L23A 2CKKA 1WA7A 4J6XA 3SWNC 3CC4Q 4OGEA 3I56Q 4JJDA 1KQSA 1OULA 5AYFA 4R55A 3UPUA 3OYGA 1KQ1A 1BYMA 4C8QC 2QEXQ 3JCMh 5I2MA 1AOJA 2WACA 3G71Q 2KXDA 4ZN1A 1SRMA 1M90R 2O4XB 4J9BA 1B07A 2JMCA 4Z02A 2G3RA 3OS1A 1UUEA 2RHZA 3REBB 2LJ3A 1NJIU 4M77A 3OQ5A 4M78A 2EKOA 1UGPB 2IPOB 2M0YA 2C0OA 4F17A 1WGSA 5KCOA 5DLOA 4L59A 1GXIE 3H6ZA 2XMFA 2YUOA 4E2FB 1YJNT 2DF6A 3QBYA 1ZX6A 2LNHB 1VQKA 5KH6A 3CPWP 1PRLC 2X51A 3MEVA 4M77D 2AIRB 4LD9K 4F7UB 3ZL7C 2L3SA 1HK9A 2OI3A 4DBQA 2JTFA 4RKUE 3HFOA 4FT2A 4RG2A 4OMOA 3I56T 2Y4XA 5KE3A 2E41A 1RAHB 4HCKA 2HQEA 2GQIA 3C95A 3G71T 3EG0A 5GAN7 3VU3C 3CMEA 2FVUA 2RK1A 4AFUC 4FL6A 4DEYA 3VV0A 2VYTA 2YT6A 3MEUA 1UB4A 1UHCA 1VQ5A 1XJWB 1OX9A 3M58A 2K57A 4J8OA 5CKEA 3LLRA 4V2SA 4FIBA 3VYHB 2JJ9A 3JCMV 3PTAA 1YI2T 3JB9G 2RN8A 4LDWA 4QT7A 4PFOA 4BE1A 2JM8A 1QVFS 4PLIA 1C0MA 2O4XA 4KULA 1NEBA 1TH7A 4J7FA 4KBMB 4RTWA 4PL6A 5FWCA 1AT1B 2DVEA 3VS1A 3A8OB 3LGLA 2X4WA 1ZQ1A 4OGCA 1IGUA 2EKHA 3RDVA 1LCKA 1KC8R 5J3BA 1RACB 1BU1A 3CCQA 1NE8A 2B8AA 3CCEA 1QWFA 1W70A 4FYXB 4E7ZA 2HCKA 4EMHA 2VVKA 2NUPB 4F7UA 3RKYA 2KBTA 2XHCA 4C5GA 3E9GA 4UC4A 3JRZA 1YFNA 1T3LA 4PJNA 2P0KA 1B7TA 3VS5A 3CC2T 1VQ9T 5GANg 3OYBA 5GAOl 1QLYA 1JBMA 2JNGA 4NL2A 2DJQA 1YITA 2LQ8A 8AT1B 5CVIA 1WJQA 4L5GA 1XTDA 1YN8A 2DXTA 1IB8A 1UFFA 2V26A 3LWIA 3I5SA 5FU7C 1YJ9T 1CSKA 1AZEA 3KFVA 4M78F 2F2WA 3BDLA 4RTXA 4M75F 2W10A 2M02A 1KC8C 2NUZA 2EQUA 3X25B 5KYXB 5LJ3h 2E4HA 2LQWA 3A8HB 4M7AC 4JRKA 4LDYA 2QGFB 2QTVA 2DO3A 2RJDA 4MDWA 2H8HA 5FU7B 2CUBA 2XD0A 1K8AU 4A53A 2M0OA 5GAOm 3F70A 4M7AB 2EGAA 3VS6A 1YIJQ 3J80E 4IUPA 5GAN5 3GP8A 1ZA2B 1OOTA 1OPLA 1IXDA 1YJNA 1QVFP 2MWPA 3L42A 1PRMC 4BB7A 1UECA 1NJIR 2R5MA 3KXTA 2BE9B 4KGXB 1YHQA 1PSFA 2B86A 4IIOA 1ZUUA 2BKDN 2NUPA 5HY6A 3ER0A 1K73R 3S3NA 1MV0B 1PC0A 2AHJB 3EHQA 1WPYA 3QSUA 3FRNA 2FPFA 2P0PA 1WHJA 1V1CA 2X9HA 3NPFA 2QGGA 1Y96B 1KHCA 1VQOT 1WI7A 3OW2S 4KGZB 1T3SA 2KRMA 4J9DA 1ZSGA 1WHMA 2KYBA 2DEQA 2L8DA 5IT9E 2LJ0A 2A28A 4PNOA 1MMDA 5D7UA 1UGSB 1OZ2A 5KYXA 1YI2A 4E47A 4C8QF 1JB0E 3SDZA 1NJIC 1FMWA 4FYVB 2QA4T 2EYQA 2K7AA 2OAWA 4XU1A 1K73C 4ELZC 3JB9F 1D0ZA 4AFSC 1VQPT 3I55T 1IREB 4ZTFA 2YRVA 3IQLA 1YNZA 3OBWA 2RHUA 2SRCA 3PFSA 3EG1A 1TSFA 3QHSA 1C6VX 3M54A 2NYSA 4JUVA 3G6ET 4M7AA 3RR6A 3QYHB 4PFPA 2D8HA 2K2MA 4E7LA 5IN1A 4ZGEB 1NYGA 4ME7A 2DL4A 1JJ2S 4FT4A 5CCAA 2FL7A 2HKQB 3CCMQ 3Q1JA 5GANd 5HKCA 4PJOE 3VYGA 3V7CA 5GAOq 2LCSA 3L2UA 4JPBW 4C92E 4C0GA 4YTLA 2E3HA 3C94A 3JCMf 3CCJQ 4BE2A 1KJWA 3JCMe 4HT8A 2FRWA 1LOJA 4M7AD 2KY9A 2E6ZA 3WVEB 4CI0C 5DLQE 2OTLT 2MAMA 3OS5A 4HA8A 1OV3A 3CC2A 1VQ9A 1PG5B 1JU5C 2WSFE 4JZ4A 5CR2A 2A7YA 4TVRA 2L3PA 2EJ9A 2PUOB 4ZN3A 3DKMA 4DOWA 1D3BB 3CMAT 3HL8A 1Y96A 2CSIA 1GRIA 2ZGWA 4J9CA 1SPKA 2GQVA 1LNXA 1VYUA 1WFWA 3OS2A 4ATOA 1PWTA 3KBGA 3MHXA 2MCNA 2J05A 4P5NA 2YHTA 3PVQA 2DYIA 3HRUA 2QQRA 4QKUA 3A8GB 1X6OA 2ZPBB 5IHIA 3CCVQ 4B6MA 3NFCA 4PJLA 3CCST 2GCXA 3QKJA 1G3YA 3CCJT 1QP2A 1WHLA 3M59A 1VQ4Q 4BI3A 3OW2P 2C0IA 1QVGS 1PHTA 2KT1A 2MYSA 1S72Q 2EBPA 1N5ZA 1O75A 1HJDA 4QVZA 1N6AA 5GJWB 1Q7YU 3HPWA 4FYWB 1YCSB 3FLGA 3THKA 3QDRB 4RTZA 4X9DA 4BI8B 4BY6C 2VKNA 4HCZA 1I1JA 2PUKB 1K8AR 5D6YA 4XTYA 4XK8E 1VIEA 2LT1A 4A63B 3OYNA 1RAFB 1HYOA 2LDMA 4AT1B 2A08A 2ZPIB 2DTOA 2F2VA 4EMGA 1ZSZC 3QUIA 3I35A 1D1CA 5FROA 2DD5A 1Q81U 4B9XA 1TS9A 4VUBA 1NLOC 1R0BG 2ED1A 1JJ2P 1H92A 2MIOA 2GBQA 4PJOC 2COZA 3P8HA 2E10A 4C92C 1TWBA 4QVDA 1OU8A 1D3BA 4N0AC 2QQSA 2GFAA 1VQOA 3OA6A 4OVAA 3HKSA 4AG2C 3JCMP 3CCLQ 1GBRA 3CEYA 2FRYA 8ATCB 1QKXA 3G7ZA 1NEGA 1K8AC 1UGRB 3H0IA 3JB9I 3PIPA 5GAN4 2WSEE 2QA4A 3OYFA 5GMKl 1VQMQ 4X34A 1LJOA 3WVDB 3M4YA 1J3TA 2K5IA 4C0FA 1R0CB 3NGPA 2OJ2A 4RTYA 1VQPA 3OYHA 3I55A 2GF7A 2PQWA 1GFCA 2EYXA 2X3XD 3CCRT 4M7DE 1FMVA 4M75B 2EYYA 2JXBA 3VS2A 1M1GA 3G6EA 2VC8A 4ZGJB 1PCXA 2CDTA 3BFMA 3V8LA 2V8JA 2JOYA 4RTUA 5HK3A 2DL7A 2RQUA 3JCMb 2M16A 5LJ3f 4DBHA 3G4ST 3JCMc 5LJ3j 5LJ3e 1OYXA 3CBPA 5AT1B 4XU3A 1R77A 1VQ8T 2FB7A 4XU0A 2IVWA 1QVGP 2O2OA 1SEMA 2LNVA 2DPPB 5CQXA 2OTLA 2A3LA 1FYNA 4OMFB 1VQLQ 2DBKA 2ZZDA 2KAFA 5GMKm 4PJMA 4N4GA 1U3OA 1ABQA 2CT3A 1WLPB 2ENMA 1RI9A 1VQNQ 2E65A 3CMAA 5M9OA 2CP3A 3MKDA 2P0QA 4M77G 4K11A 4QVCA 5CKDA 3R6OA 4BE0A 2EFIA 2W0ZA 4PFZA 4FSSA 4KH0B 4J9EA 1BI1A 1TUGB 1PD1A 4J6WA 3GPLA 2EQKA 4PJOA 5GAMh 3ULRB 2KI7A 1BKBA 2CZ6B 2DILA 4JS5A 2RO0A 2K2VA 1BIBA 4N0AA 1T0JA 3CCSA 3JSCA 1PKTA 1HSQA 4OB1B 3SWNB 5GAN6 2DMOA 1KQSS 1KFZA 2Y4YA 3GF5A 4M75A 2YUNA 2E6NA 3KUFA 4LN2A 2VWFA 4XTWA 5EG2A 3JCMg 2KK4A 1K1ZA 5A2QE 4C8QB 1GCQA 4DQ2A 4JJCA 4J9GA 4AG1C 4BD3A 4HVUA 2HL5C 4C5IA 2HNIA 2RK2A 3CC7Q 3EGDB 3JB9J 2XI9A 3RNJA 4A54A 1YJWQ 2KSSA 2V1QA 4DEXA 3GBQA 4M78D 1VQ7Q 2DM1A 2NLUA 3CC4T 4M75D 2DAQA 1E6HA 3H0HA 1M90C 1NLPC 2J6FA 2XDPA 1AEYA 2RH2A 4XTVA 1I81A 3OYJA 3FJ5A 3QWXX 3WXMB 2QEXT 3V8JA 5GAN8 3CD6Q 2PVOB 1G2BA 1AWWA 1CKBA 3PE0A 3T9NA 2VGMA 4Z8AA 3OS0A 3JCMQ 2DRMA 2HMAA 2QYZA 4KUDK 1W4SA 2EIFA 1M1FA 1NBEB 2BZYA 3TQ7P 1WX6A 3AT1B 1WXUA 1Q81R 2ZPGB 1Z9QA 2RA2A 1SHGA 1BI2A 4MZPA 2J7IA 1CKAA 1RAAB 2KE9A 1H8KA 2K9GA 3UA7A 1ZUYA 3C0CA 1M2VB 1OEBA 1Z9ZA 2DZ9A 5EC7A 1OQKA 3SWNA 3CCRA 1E6GA 1QP3A 2LX7A 3JAME 4JS4A 2K5LA 1VYTA 1R8OB 4M7DG 1H3ZA 2L0AA 2ROLA 4Q5WA 1G3TA 2E1HA 1M3BA 4F16A 2VUBA 4C8QA 1FXXA 2CSQA 3UA6A 2Y90A 3CPFA 3G4SA 4LXCA 4WCIA 3MEWA 3EGDA 2Z0WA 2AT1B 5GAOn 2COWA 2K79A 4OMLA 3JCMW 1ACMB 4A4KA 2CH4A 4AFQC 1KQSP 1VQ8A 2JS0A 2DL5A 2CT4A 3EHRA 2HBPA 1U1TA 1C1AA 4C8QD 3UDCA 4PJOF 1BI0A 1WIEA 3RERA 3HRTA 1PD0A 4IUTA 2K5FA 2F69A 4C92F 2K3YA 2J6OA 2O01E 3CXCA 3JB9D 2XK0A 2FPEA 2RD1A 5CKHA 1ZA1B 3CCUQ 5FWBA 1Y57A 4PLLA 2F2XA 5HK0A 3QZ5B 1AD5A 2FO0A 5FRNA 2L3QA 3EH1A 2CZ0B 1AWXA 1BIAA 2DXCA 3CQTA 3EFOB 4FW2A 4J6YA 4OF1A 3QDFA 2ATCB 3JCMd 3L2VA 4F14A 2QDYB 1W2BS 4Y91A 1EX4A 3VUZA 4RMOA 5LJ3g 3OYMA 2MK5A 1M2VA 2KVQG 4MZTA 5GAOr 3JB9H 2K3XA 1BCMA 1NZ9A 3L2QA 2HL3A 2K4YA 2L3RA 2X4JA 1N8RU 3UT1A 3ASKA 3OYEA 2XG8D 2QI2A 3EGUA 2EPDA 1PM3A 4EMKC 1X2QA 2RB6A 1GCPA 2DXUA 1D09B 4JRQA 3RMQA 1M3CA 1UJYA 4CRIA 2DVJA 1O9SA 4E7KA 2HZYA 3CC4A 2EYZA 3M5AA 3I56A 2L89A 3O8VA 4R0KA 1JQQA 1T0HA 4RUGA 3OYAA 3M9QA 1WJRA 4OB3B 4FSXA 1KHIA 1QQJA 1X75C 1WJSA 2EQMA 4E7IA 2QEXA 1K0XA 1M3AA 2OTJQ 3G71A 3P8DA 2PU9B 2VV5A 3HSBA 1MHNA 2RNAA 1VQ6Q 1KD1U 2EJFA 3OW2A 5LJ5h 2XDBA 1Y07A 4HCCA 4A4EA 1WHHA 2EGCA 4IUVA 1YIJT 2RJCA 5CK9A 4JRPA 3SB2A 2MPXC 4FYYB 1Q82U 1M5Q1 3EFOA 2LVMA 2JZ2A 3HFNA 3LX7A 3CBOA 2FEIA 4OB2B 2EGEA 1FWZA 2EAYA 2FZGB 4OP0A 4LD6A 5CKFA 2DE0X 5CO7A 2I2LA 1JJ2A 2HQXA 1MUZA 2RHIA 2G6FX 4II1A 1WXBA 4N4IA 5A0GA 2P4RA 2O9SA 4M7DF 2D0QB 2M9UA 3OSSC 1W2BP 3TSZA 3ZBDA 5FU6C 5GAMf 2HAXA 2K3BA 4HVWA 4FU6A 2RQVA 4OMQA 2LT4A 5GAMj 3M4GA 5GAMe 2HSEB 4E7SA 2DIQA 3A8MB 2DXBA 2YWWA 2DFUA 1UE9A 1IO6A 1NG2A 2X4YA 1SRLA 3OYDA 2A0FB 4J83A 4M77E 2LX9A 4HKEA 1FX7A 1YJ9A 1AVZC 5FU6B 2HKNA 2X4XA 4CC4B 3FJPA 1TTHB 4CC7A 3FB9A 2QK0A 3UWNA 1IZ6A 1WQWA 1VQKQ 2RHXA 1ARKA 3TU4K 4X9CA 1W6XA 3CCMT 1WNLA 3VRYA 1ZUKA 4R56A 6AT1B 2CZ1B 2XDDA 4XQ3A 3MPUB 2EWNA 2XU8A 4PKCC 2KGTA 2ZPHB 4LNPA 3TEEA 4LDXA
chains in the Genus database with same CATH topology
2JVVA 2KAFA 2M1HA 3L2ZA 5GMKm 5GAOp 2O4XA 1OI1A 1U1SA 4L6V5 2HD0A 4N4GA 4KULA 1TH7A 4C0DC 4HCBA 2PVDB 4J7FA 2LC4A 4KBMB 2RJFA 1B34A 4NOYA 4PL6A 4XAXB 4JJNK 2E65A 3CMAA 5M9OA 1Q86C 4LDVA 5CAIA 2P0QA 4M7AG 5GMKj 4XTXA 4M77G 5GMKe 2MF2A 5DY9A 2DVEA 3VKIA 2P4TA 4QVCA 3A8OB 2QXFA 3LGLA 4XTUA 2F5TX 2WSCE 2X4WA 1ZQ1A 4O5VA 4OGCA 2MWOA 5CKDA 3A8LB 3R6OA 5J3BA 3CC7A 4BE0A 1G3SA 1VUBA 2EFIA 5L8RE 3CCQA 1NE8A 2B8AA 2DTIA 1M8VA 3QYGB 3RKWA 3PIOA 5LJ5g 1YJWA 2ZPEB 4C0DB 2RI5A 3CCEA 1BI1A 2MMPA 4DOVA 2CGHA 4J6WA 3GPLA 1VQ7A 2EQKA 4EMHA 5GAMh 4PJOA 3TCJA 4BY6B 4F7UA 4BACA 1BKBA 2CZ6B 2XHCA 3RKYA 3X24B 2RO0A 4C5GA 1X01A 3E9GA 4JS5A 2V8KA 4UC4A 4MDXA 3JRZA 2K2VA 1BIBA 4N0AA 4JLIA 4E7HA 3CCSA 3JSCA 2P0KA 3CCVT 5D6XA 3CC2T 1VQ9T 4MZMA 4OB1B 5GANg 3OYBA 1I4K1 3GLXA 5GMKi 1JBMA 3SWNB 5GAN6 2ZPFB 5GAOl 2JNGA 1KQSS 4NL2A 2OTJT 2Y4YA 4ZTJA 1YITA 1UGQB 2LQ8A 3CD6A 1VQ4T 5CVIA 2YLCA 2RI2A 4F7UF 1ZHIA 3GF5A 4M75A 1WJQA 2E6NA 2GFUA 3KUFA 3E1SA 4L5GA 4XTWA 5EG2A 3JCMg 1XTDA 2KK4A 4ZGDB 1VQ6T 2DXTA 5A2QE 2XKOC 1I5LA 4C8QB 3LWIA 1S72T 2QQAA 5FU7C 4DQ2A 1YJ9T 3OBYA 1YCYA 4BD3A 4BDYA 1YIJA 4M78F 4C5IA 2HNIA 2E70A 1EIFA 2RK2A 3BDLA 4O6JA 4A4GA 3JB9J 3HHTB 2XI9A 2XICA 4M75F 2BIVA 4A54A 1KC8C 2KSSA 2EQUA 1I8FA 3CBMA 3X25B 4PJOB 5LJ3h 2OAUA 3A8HB 3CPWA 2R57A 1M4ZA 4GLKA 4M78D 3L1AA 4C92B 4M7AC 2RI3A 4M77C 2NLUA 3CC4T 3EFSA 4JRKA 4F7UE 1RL2A 2DAQA 4M75D 3GNGA 4LDYA 2DKGA 4IKFA 1YBYA 3FDRA 3H8ZA 2DO3A 1N8RC 1M90C 2RJDA 2V8IA 3NTKA 4MDWA 4MMKA 1VIFA 4EMKA 3RMSA 2XDPA 5FU7B 2JUFA 2RH2A 1I81A 4XTVA 2XIDA 4A4FA 3OYJA 2QEXT 3WXMB 4ELYC 3LYIA 3V8JA 4IURA 5CKBA 5GAN8 3OYLA 2PVOB 4M78E 2XD0A 3MP8A 3MP1A 2DZCA 4A53A 1K8AU 4LDUA 5I2SA 3BY7A 3QPHA 3OYCA 4M75E 1KC8U 2M0OA 3T9NA 5J39A 1KQ2A 2VGMA 3OS0A 2LTOA 3F70A 3PMIA 4GY5A 4XTZA 3JCMQ 3C12A 5GAOm 4M7AB 4KUDK 1W4SA 2EIFA 4OB0B 3J80E 4IUPA 5LJ3d 5GAN5 1M1KU 1M1FA 3GP8A 2FHDA 2L5QA 2RM4A 1DJ7B 4BI4A 1M90U 5GMKh 2CZ7B 4JDSA 1QVPA 3CCLT 1YJNA 2MWPA 3L42A 4QQGA 2ZPGB 1P92A 4BB7A 2MI6A 2RA2A 3NTHA 1N9SA 5A0DA 3HP9A 4E7JA 3HRSA 3LWHA 2R5MA 1BI2A 3KXTA 4MZPA 1XNIA 1YHQA 1OZ3A 1PSEA 1PSFA 3DB3A 1QVGA 3CCQT 2CS7A 5KCHA 3OMCA 2BKDN 3OMGA 3X28B 5HY6A 3ER0A 4B9WA 3S3NA 3ME9A 1VQMT 3OYKA 2AHJB 4KT0E 1WPYA 2VGNA 3QSUA 1Y71A 3FRNA 3S3OA 2DJZA 5GAN2 2DZ9A 3SWNA 3CCRA 3DLLA 3LH0A 1QP3A 4D6WA 2RJEA 2P0PA 4JLGA 3C4SA 3JAME 4DA4A 4JS4A 3ZEHA 2K5LA 1Q82C 1R8OB 4M7DG 1H3ZA 3FIFA 1Y96B 1MGQA 3PT9A 1KHCA 4Q5WA 1G3TA 2E1HA 4M78G 3CCUA 2VUBA 4C8QA 4XU2A 4EPCA 1VQOT 1FXXA 3LW5E 3V7RA 2Y90A 2VXFA 3EFRA 3OW2S 4M75G 3CPFA 3G4SA 3DB4A 4MMLA 1HXDA 1WQ7A 3MEWA 2DEQA 2L8DA 3X20B 2E12A 5IT9E 4PNOA 1UGSB 1OZ2A 4EDUA 5GAOn 3OYIA 1YI2A 1VQKT 3CCMA 4A4HA 4E47A 3JCMX 4BDZA 3JCMW 4C8QF 1JB0E 4C92A 3SDZA 4A4KA 1NJIC 1Q86U 5FLXE 1VQ8A 1G5VA 2RHYA 2QA4T 2EYQA 2HBPA 4XU1A 3CCJA 1U1TA 1K73C 4ELZC 3JB9F 2QTXA 4C8QD 3UDCA 4PJOF 1BI0A 3RERA 3QJYA 3TREA 4BUGA 1VQLT 2EJGA 3HRTA 1VQPT 4IUTA 3I55T 5CQYA 2K5FA 2F69A 4C92F 2K3YA 3AHUA 1IREB 4ZTFA 2O01E 2YRVA 3OBWA 3PFSA 2RHUA 4QQ6A 3CXCA 3QO3A 5GAMg 2XK0A 3JB9D 5LJ5f 3J81E 3EAEA 2RD1A 3QHSA 5CKHA 5LJ5d 3CMET 5IAYA 1W2BS 4PJOD 3M54A 5LJ5j 5LJ5e 4JUVA 2LQKA 4PLLA 4C92D 3G6ET 3M53A 4C8QE 4M7AA 5HK0A 3QYHB 3QZ5B 3SD4A 4J7IA 2D6FA 1VQNT 1H641 3GNFB 1BI3A 4E7LA 5IN1A 2LCLA 4ZGEB 5FRNA 3NTIA 4ME7A 3L2WA 1K73U 1JJ2S 1VQ5T 4FT4A 2CZ0B 5CCAA 2FL7A 1ZBXA 5GANf 4M7DC 1BIAA 2DXCA 3Q1JA 5GANd 5HKCA 4PJOE 4QW2A 3VYGA 3V7CA 2DD4A 5GANe 5GAOq 4M78C 3L2UA 5GANj 4RCBA 4C92E 4M7AF 4J6YA 4C0GA 2C06A 5DM7R 4OF1A 3PMTA 3C94A 4YTLA 3JCMf 4M75C 4BE2A 3E9FA 3JCMd 3L2VA 3JCMe 4HT8A 1LOJA 1YHQT 4M7AD 3QZ9B 2QDYB 1NPPA 2JN0A 2KY9A 2E6ZA 4Y91A 3VJPA 5DLQE 3WVEB 2MAMA 3OS5A 4CI0C 2OTLT 4HA8A 3VUZA 4RMOA 5LJ3g 2FYKA 3CPWS 3CCVA 2E64A 1AHJB 3OYMA 4MZTA 2KVQG 3CC2A 5GAOr 3RUXA 1VQ9A 2WSFE 5CR2A 2A7YA 3JB9H 1N9RA 4RCCA 2F5KA 2DIGA 2K3XA 4TVRA 2EJ9A 2PUOB 4M77B 3OY9A 1NZ9A 3L2QA 4M7DB 1VQ4A 4ZN3A 1K9MC 4M78B 2K4YA 2L3RA 3DKMA 4C0ZA 4DOWA 1VQ6A 4M7AE 2X4JA 2ZCFB 1D3BB 3CMAT 1N8RU 3HL8A 1Y96A 5CIUA 3UT1A 1S72A 3ASKA 3OYEA 2XG8D 3M57A 2QI2A 4C5EA 2R5AA 1U8RA 3J7AF 2ZGWA 3BDUA 5I21A 3MO8A 2GQVA 4EMKC 5GAN3 3FC3A 4RG8A 2RB6A 4J5YA 2DTHA 1QVFA 2DXUA 4JRQA 1LNXA 1N27A 3OS2A 5C0MA 3RMQA 4ATOA 1SSFA 4C8QG 3CC7T 3L2RA 1KG1A 4KUIA 4CRIA 2YLBA 3V8KA 1KD1C 1XOVA 3KBGA 2KDSA 2LCCA 1O9SA 3MHXA 4P5NA 4E7KA 2YHTA 1YJWT 3QXEB 3CCET 3CC4A 3HRUA 1Q7YC 1VQ7T 2VXEA 4N4HA 2QQRA 3M5AA 3I56A 2L89A 1X6OA 2KMTA 2ZPBB 2KQWA 3A8GB 3O8VA 4PJOG 5C6SA 3BW1A 3RIRA 3NFCA 1QW1A 4F7UG 3OB9A 3OYAA 4C92G 3M9QA 2OTJA 2H3JA 1WJRA 2X35A 4OB3B 3RESA 1KHIA 2GCXA 1X75C 1G3YA 1WJSA 1UEBA 2D9TA 2EQMA 3QKJA 4FSXA 2QEXA 3CCJT 3G71A 1QP2A 3P8DA 3A5ZB 3M59A 3RKXA 2PU9B 3P8BB 2VV5A 4BI3A 3HSBA 1MHNA 1QVGS 4JRIA 3CD6T 1YITT 3QJ6A 4NL3A 1KD1U 2EQJA 2EJFA 3OW2A 3PGGA 1O75A 5KE2A 4QVZA 1N6AA 4Y28E 5LJ5h 1Q7YU 3HPWA 3X26B 3FLGA 3QDRB 2XDBA 1Y07A 3FEOA 4HCCA 4X9DA 1Y7XA 4BI8B 3S6WA 4A4EA 4IUVA 4BY6C 1YIJT 1Q81C 2RJCA 5CK9A 4JRPA 3E19A 4IUQA 3DLMA 3ZFJA 3SB2A 3CCLA 4HCZA 1V29B 2CKKA 2PUKB 4J6XA 5D6YA 3SWNC 1Q82U 1M5Q1 2LVMA 3M55A 4OGEA 5GANh 2QQBA 1XQHA 4XTYA 4XK8E 1KQSA 1VIEA 5A0LA 2LT1A 2PVGB 3OYNA 5AYFA 4R55A 3UPUA 2LDMA 2ZPIB 2JZ2A 3HFNA 1KQ1A 3OYGA 2DTOA 1BYMA 2JTMA 3LX7A 3CBOA 4C8QC 5LL6S 4EMGA 3JCMh 4OB2B 5I2MA 2WACA 3QUIA 1VQMA 2LRQA 1FWZA 4ZN1A 5FROA 2DD5A 3QIIA 2O4XB 1Q81U 3SFMA 4B9XA 2EAYA 4Z02A 2G3RA 4VUBA 4WF2A 3V7SA 3OS1A 2RHZA 4OP0A 4LD6A 1NJIU 4PJOC 4M77A 3MCAB 4M7DA 1B34B 4HT9A 3P8HA 4IUUA 2IG0A 2E10A 5CKFA 4C92C 5CO7A 2I2LA 3OQ5A 4M78A 1JJ2A 2EKOA 1UGPB 3GOXA 4QVDA 1D3BA 4N0AC 1JRIA 2HQXA 2QQSA 2GFAA 1WGSA 1VQOA 3OA6A 4OVAA 3HKSA 4FM4B 5KCOA 3JCMP 5DLOA 2RHIA 3CEYA 4II1A 3CXCS 4L59A 4N4IA 1GXIE 5A0GA 3H6ZA 4M77F 3OYYA 1YJNT 4M7DF 2D0QB 2M9UA 3OSSC 3MP6A 3QBYA 3G7ZA 3ZBDA 1G3WA 3GIBA 5FU6C 5GAMf 1VQKA 2HAXA 5KH6A 4FU6A 5GAMd 1K8AC 1UGRB 1W2BA 3JB9I 2LT4A 3PIPA 5GAMj 3M4GA 5GAMe 3MEVA 4M77D 3URGA 5GAN4 4M7DD 2DK3A 2WSEE 4LD9K 4F7UB 2QA4A 2DIQA 3A8MB 3OYFA 5GMKl 1HK9A 2DXBA 4X34A 3PNWC 1LJOA 1RI0A 5D6WA 1M1KC 3WVDB 2JTFA 2CYZB 3M4YA 2K5IA 3HFOA 4FT2A 4RG2A 4RKUE 3VUBA 4C0FA 3I56T 2X4YA 2Y4XA 1VQLA 5KE3A 2E41A 3OYHA 3I55A 2GF7A 5J26A 3META 3OYDA 1VQPA 3INZA 2PQWA 3CCRT 4J83A 4M77E 2LX9A 2HQEA 4M7DE 4HKEA 3C95A 3CCST 3G71T 5GAN7 1NPRA 4M75B 3VU3C 1FX7A 3CMEA 5FU6B 2RK1A 2FVUA 1YJ9A 2QQ9A 1M1GA 2E5QA 2X4XA 3OSVA 3G6EA 4FL6A 2VC8A 3JCMJ 3FJPA 3CCUT 4ZGJB 3VV0A 3QG1A 2VYTA 3FB9A 1VQNA 3BFMA 3V8LA 2V8JA 2JOYA 4C5HA 3MEUA 1IZ6A 3UWNA 5HK3A 1UB4A 2M16A 5LJ3f 3JCMb 3G4ST 3JCMc 1VQ5A 1WQWA 2K57A 3M58A 4J8OA 2RHXA 3LLRA 3MEAA 3LGFA 5CKEA 5LJ3e 5LJ3j 4QQDA 4E7IA 4V2SA 3S3MA 1OYXA 4FIBA 3CBPA 3VYHB 3TU4K 3JCMV 3N5BB 4X9CA 3PTAA 3JB9G 3M56A 1YI2T 1K9MU 4XU3A 5FRMA 3CCMT 4NS5A 4LDWA 1WNLA 1VQ8T 4R56A 2FB7A 2CZ1B 2IVWA 4XU0A 2XDDA 4XQ3A 2LNVA 4BE1A 1M9SA 2EWNA 1QVFS 2DPPB 2XU8A 4PLIA 4PKCC 5CQXA 2ZPHB 3TEEA 4EMKB 2BUDA 2OTLA 2A3LA 4OMFB 2R58A 2ZZDA 4LDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTY A;  4XTZ A;  5GAO m;  5GMK m;  3L2Z A;  3JCM Q;  5GAO p;  4M7A B;  5GAN f;  4M7D C;  1U1S A;  1BIA A;  3HFN A;  1KQ1 A;  5GAN d;  2DTO A;  5LJ3 d;  5GAN 5;  4PJO E;  1TH7 A;  5GAN j;  3V7C A;  5GAN e;  5GAO q;  4C8Q C;  4M78 C;  4EMG A;  3GIB A;  4RCB A;  3JCM h;  2RM4 A;  4C92 E;  4J6Y A;  3QUI A;  4M7A F;  1B34 A;  4NOY A;  5GMK h;  3JCM f;  4M75 C;  3JCM d;  2EAY A;  2E65 A;  3V7S A;  4WF2 A;  3JCM e;  4HT8 A;  4OP0 A;  5CAI A;  1LOJ A;  2RA2 A;  4M7A G;  1N9S A;  5GMK j;  4M7A D;  4XTX A;  2JN0 A;  4M77 G;  4Y91 A;  5GMK e;  4PJO C;  4M77 A;  4M7D A;  5DY9 A;  1B34 B;  2DVE A;  4QVC A;  5GAO l;  4HT9 A;  4HA8 A;  5LJ3 g;  2E10 A;  4XTU A;  2FYK A;  4C92 C;  2E64 A;  2I2L A;  4M78 A;  5GAO r;  3RUX A;  4QVD A;  1D3B A;  4N0A C;  1JRI A;  3JB9 H;  1N9R A;  4RCC A;  3JCM P;  2DTI A;  2EJ9 A;  4M77 B;  4M7D B;  3RKW A;  1M8V A;  5LJ5 g;  1WPY A;  4M78 B;  3QSU A;  4M7A E;  4M77 F;  2CGH A;  4J6W A;  4M7D F;  1D3B B;  4PJO A;  4EMH A;  5GAM h;  1Y96 A;  2DJZ A;  5GAN 2;  2DZ9 A;  4F7U A;  3RKY A;  3SWN A;  5GAM f;  1X01 A;  2ZGW A;  5GAM d;  1BIB A;  3BDU A;  4N0A A;  4JLI A;  4EMK C;  5I21 A;  5GAM j;  3M4G A;  5GAM e;  5GAN 3;  2RB6 A;  3JB9 I;  5GAN 4;  4M77 D;  4J5Y A;  2DTH A;  4M7D D;  4M7D G;  2DXU A;  3FIF A;  1Y96 B;  1MGQ A;  1LNX A;  5GAN g;  1I4K 1;  4F7U B;  5GMK i;  2E1H A;  1JBM A;  4M78 G;  3SWN B;  4C8Q G;  1HK9 A;  4C8Q A;  4NL2 A;  4XU2 A;  5GAN 6;  2YLB A;  5GMK l;  3V8K A;  1KQ2 A;  1LJO A;  3V7R A;  2Y90 A;  2VXF A;  3EFR A;  4F7U F;  2YHT A;  2YLC A;  3HFO A;  4M75 G;  4M75 A;  4MML A;  4XTW A;  3JCM g;  1HXD A;  1WQ7 A;  2VXE A;  2DXT A;  2E41 A;  2DEQ A;  1I5L A;  4C8Q B;  3INZ A;  4PNO A;  4PJO G;  4DQ2 A;  4M77 E;  4M7D E;  5GAO n;  1YCY A;  3BW1 A;  3RIR A;  4F7U G;  4C92 G;  3JCM X;  4M75 B;  3VU3 C;  4C8Q F;  4M78 F;  4C92 A;  2HNI A;  3RES A;  5GAN 7;  3JCM W;  3JB9 J;  2VC8 A;  4M75 F;  4A54 A;  3FJP A;  3RKX A;  3JCM J;  3HSB A;  1I8F A;  4XU1 A;  4PJO B;  1U1T A;  3FB9 A;  4JRI A;  5LJ3 h;  3BFM A;  3V8L A;  3JB9 F;  2QTX A;  4C8Q D;  4M78 D;  3L1A A;  4C92 B;  3JCM b;  4M7A C;  5LJ3 f;  4M77 C;  4NL3 A;  2EJF A;  4PJO F;  3JCM c;  3RER A;  3EFS A;  4JRK A;  3PGG A;  1WQW A;  2EJG A;  2K57 A;  4M75 D;  4F7U E;  5LJ3 e;  5LJ3 j;  4C92 F;  3AHU A;  4V2S A;  2DKG A;  5LJ5 h;  3JCM V;  4X9C A;  3JB9 G;  3QO3 A;  4X9D A;  5GAM g;  4XU3 A;  5LJ5 f;  3JB9 D;  4MMK A;  4EMK A;  2RD1 A;  3QHS A;  5LJ5 d;  4PJO D;  4XTV A;  1I81 A;  5LJ5 j;  1WNL A;  5LJ5 e;  4JUV A;  2FB7 A;  4XU0 A;  3SB2 A;  3V8J A;  4C92 D;  5GAN 8;  4C8Q E;  4M78 E;  4M7A A;  4XQ3 A;  2DZC A;  4A53 A;  2EWN A;  3BY7 A;  1H64 1;  4J6X A;  3SWN C;  4EMK B;  1M5Q 1;  4M75 E;  5GAN h; 
#chains in the Genus database with same CATH topology
 1MMN A;  3L2Z A;  2BTT A;  1BB9 A;  2HD0 A;  2D0N A;  3CME Q;  2PVD B;  2LC4 A;  3SEM A;  3JV3 A;  2COY A;  4M4Z A;  1VQ5 Q;  3R6N A;  5DY9 A;  3VKI A;  1QCO A;  1G8X A;  4XTU A;  2WSC E;  4O5V A;  2MWO A;  5KYY B;  3A8L B;  1IHV A;  2LZ6 B;  1MMA A;  1D0X A;  4PJJ A;  2AZS A;  5L8R E;  1AZG B;  2DTI A;  1M8V A;  3RKW A;  3I5R A;  3PIO A;  2RI5 A;  5IHN A;  1X69 A;  2MMP A;  3UF4 A;  4DOV A;  2J06 A;  1WXT A;  3TCJ A;  4BY6 B;  4BAC A;  1N8R R;  3X24 B;  1UJ0 A;  4MDX A;  1X01 A;  2V8K A;  1JEG A;  2DYB A;  3MJX A;  1ABO A;  2ZAE A;  4JLI A;  4GLM A;  4E7H A;  3CCV T;  5D6X A;  1AWO A;  4KGV B;  2QAZ A;  1M2O A;  5GMK i;  1ZBJ A;  1MNE A;  2OX7 A;  1UGQ B;  1VQ4 T;  4ORZ A;  2YLC A;  2KYM A;  2LJ1 A;  2GFU A;  4LE9 A;  1S72 T;  2DBM A;  2QQA A;  4X1V A;  1ZSZ B;  3OBY A;  1YIJ A;  2KRS A;  2E70 A;  1EIF A;  1F1B B;  3NHN A;  3CCQ Q;  2XIC A;  1WHK A;  2BIV A;  1KSW A;  1I8F A;  3CBM A;  3CCE Q;  4PJO B;  3CPW A;  1M4Z A;  4GLK A;  2KRO A;  4C92 B;  2O31 A;  4M77 C;  1BK2 A;  1RAG B;  4F7U E;  1RL2 A;  3FDR A;  2CRE A;  1N8R C;  2V8I A;  3NTK A;  5I22 A;  4MMK A;  1VIF A;  2D8J A;  3RMS A;  4WTO B;  2JUF A;  1U06 A;  3HTR A;  2XID A;  4ELY C;  3LYI A;  1JXM A;  1YIT Q;  3MP8 A;  3MP1 A;  4LDU A;  5I2S A;  2CP0 A;  3BY7 A;  3QPH A;  5IHK A;  1EZZ B;  2YUP A;  3OYC A;  1KC8 U;  2PZ1 A;  1VYV A;  1Q82 R;  1KQ2 A;  2X3W D;  1GL5 A;  2LTO A;  4GY5 A;  4XTZ A;  1MND A;  2M51 A;  1M1K U;  3M0Q A;  2L5Q A;  2RM4 A;  2AZV A;  1KK7 A;  5GMK h;  2CZ7 B;  2DA9 A;  3CCL T;  1QVP A;  5KYY A;  1S1N A;  2MI6 A;  3NTH A;  3VS3 A;  3HP9 A;  3M0S A;  3LWH A;  1HD3 A;  1XNI A;  1WDX A;  1OZ3 A;  3CCQ T;  3OMC A;  2SEM A;  3I9Q A;  2RMO A;  4B9W A;  3ME9 A;  1VQM T;  3OYK A;  4KT0 E;  2VGN A;  4LUD A;  4IIM A;  4JJB A;  4D6W A;  1QWE A;  1MV3 A;  3ZEH A;  2FG0 A;  1Q82 C;  2VB6 A;  3FIF A;  3PT9 A;  2JTE A;  2E5K A;  4M78 G;  4XU2 A;  1TUD A;  4EPC A;  1ZSZ A;  3V7R A;  2VXF A;  1YJN Q;  1A0N B;  4M75 G;  1RLP C;  1HXD A;  1WZO A;  3X20 B;  1YHQ Q;  4EDU A;  3CCM A;  2ABL A;  4C92 A;  1Q86 U;  1G5V A;  3CCJ A;  4E6R A;  1NYF A;  3EH2 A;  1SG5 A;  5FW9 A;  3QJY A;  3TRE A;  1VA7 A;  1VQL T;  2EJG A;  1IHW A;  1M27 C;  2L2P A;  4OMP A;  2KRN A;  3QO3 A;  5GAM g;  5LJ5 f;  3EAE A;  2LQN A;  4PJO D;  3M0P A;  5IAY A;  5LJ5 j;  5LJ5 e;  3SHW A;  4C92 D;  2V1R A;  1VQN T;  2LCL A;  5HCK A;  3NTI A;  3L2W A;  1K73 U;  3RBB B;  1ZBX A;  5ECA A;  1YI2 Q;  4M7D C;  1M8M A;  1QCN A;  4RTT A;  4QW2 A;  3GIB A;  2DD4 A;  2JT4 A;  2C06 A;  1BCO A;  1Q7Y R;  3PMT A;  2DL8 A;  3E9F A;  2YSQ A;  1OU9 A;  1YHQ T;  1NPP A;  4ESR A;  1TOV A;  2FYK A;  3CCV A;  2E64 A;  2GTJ A;  1N9R A;  4RCC A;  2DIG A;  4M7D B;  2CUD A;  1VQ4 A;  4M7A E;  2FZC B;  4C0Z A;  1S72 A;  2FPD A;  1U8R A;  2R5A A;  3J7A F;  5GAN 3;  3FC3 A;  4RG8 A;  4Y92 A;  1QVF A;  4C8Q G;  3CC7 T;  3L2R A;  2YLB A;  3V8K A;  2KDS A;  2LCC A;  1RAD B;  1YJW T;  3QXE B;  1Q7Y C;  4LUE A;  1VQ7 T;  4N4H A;  2KMT A;  5C6S A;  1D1B A;  2YXY A;  1RLQ C;  1QW1 A;  4F7U G;  3OB9 A;  2DET A;  1VQ9 Q;  3CC2 Q;  2H3J A;  3RES A;  5IXF A;  1UEB A;  2CP5 A;  3RKX A;  1X6G A;  2D1X A;  3CD6 T;  4OMN A;  1Y0M A;  1JXO A;  3PGG A;  1YJ9 Q;  5KE2 A;  2HSP A;  7AT1 B;  1RAB B;  3G1J A;  1K4U S;  3S6W A;  3D7S B;  2ROT A;  1Q81 C;  2EYW A;  3E19 A;  4IUQ A;  2NUT B;  3CCL A;  3VRZ A;  1U5S A;  1V29 B;  2BZ8 A;  3M55 A;  5GAN h;  2QQB A;  2C0T A;  3EGX B;  1XQH A;  5A0L A;  2PVG B;  2E3I A;  2FZK B;  2JTM A;  2EW3 A;  1M1K R;  5LL6 S;  4JZ3 A;  1VQM A;  2LRQ A;  4CC3 A;  2K6D A;  2A36 A;  3QII A;  2HDA A;  3SFM A;  2I0N A;  3V7S A;  4WF2 A;  5KYN A;  3TVT A;  4M7D A;  3MCA B;  1B34 B;  4HT9 A;  2ESW A;  4IUU A;  2IG0 A;  1WHG A;  1TU0 B;  1QKW A;  1V76 A;  3GOX A;  1JRI A;  1YWP A;  4PK4 A;  4FM4 B;  4AMC A;  1SSH A;  3A1P A;  1TG0 A;  3CXC S;  2HQH A;  1JO8 A;  4M77 F;  3OYY A;  3MP6 A;  2KNB B;  1G3W A;  5GAM d;  1W2B A;  2A37 A;  3URG A;  4M7D D;  2DK3 A;  2CP7 A;  4FW1 A;  4DBR A;  3PNW C;  2AKL A;  1RI0 A;  5D6W A;  1M1K C;  2CYZ B;  2LMJ A;  2PTK A;  3VUB A;  1E7O A;  1IRX A;  1VQL A;  5J26 A;  3MET A;  3INZ A;  5IXB A;  1NPR A;  2KT8 A;  2QQ9 A;  1VQO Q;  2E5Q A;  3OSV A;  1Q86 R;  3JCM J;  3CCU T;  3QG1 A;  1VQN A;  4C5H A;  3EG3 A;  3EG9 B;  2NUT A;  3MEA A;  3LGF A;  4QQD A;  2LP5 A;  3S3M A;  1FMK A;  2J6K A;  3PVL A;  3N5B B;  3M56 A;  4EIK A;  1K9M U;  5FRM A;  4NS5 A;  2QA4 Q;  2O88 A;  3EGX A;  2DL3 A;  2HBW A;  1QMC A;  1M30 A;  1M9S A;  2QG9 B;  2YRC A;  4EMK B;  2BUD A;  2YDL A;  5KYW B;  1VQP Q;  2R58 A;  2H3E B;  3I55 Q;  2KR3 A;  1X27 A;  1LVK A;  4KRT A;  2JVV A;  2M1H A;  5GAO p;  1OI1 A;  1U1S A;  4L6V 5;  2DLP A;  4C0D C;  4HCB A;  2KXC A;  2RJF A;  3G6E Q;  1B34 A;  4NOY A;  4XAX B;  3TSW A;  4JJN K;  1RAI B;  4Z88 A;  1Q86 C;  4LDV A;  5CAI A;  2NWM A;  4M7A G;  5GMK j;  4XTX A;  5GMK e;  2MF2 A;  2P4T A;  2QXF A;  2F5T X;  4DBF A;  1W1F A;  1YP5 A;  3CC7 A;  5IH2 A;  1G3S A;  1VUB A;  1I07 A;  3QYG B;  1RAE B;  1RUW A;  5LJ5 g;  1YJW A;  1H3H A;  2ZPE B;  4C0D B;  2CGH A;  1VQ7 A;  2OTL Q;  4F04 B;  1G83 A;  2JS2 A;  4KH1 B;  2DRK A;  4MZM A;  1I4K 1;  3GLX A;  2ZPF B;  2VAS A;  2OTJ T;  3CXC P;  3CD6 A;  3UAT A;  4ZTJ A;  4F7U F;  3CMA Q;  2ECZ A;  2RI2 A;  1ZHI A;  2RQW A;  3E1S A;  1I0C A;  1VQ6 T;  4ZGD B;  2XKO C;  1I5L A;  2AKK A;  2JM9 A;  1YCY A;  3REA B;  4BDY A;  4OMM A;  2QAS A;  4ZNX A;  4O6J A;  4A4G A;  3EG9 A;  3HHT B;  2O9V A;  2OAU A;  2R57 A;  3L1A A;  2RI3 A;  1IGQ A;  1OX8 A;  3EFS A;  4FCY A;  1VOM A;  3GNG A;  3VS4 A;  2DKG A;  1SKU B;  4IKF A;  1YBY A;  3H8Z A;  3CCS Q;  1NM7 A;  1QCF A;  2F1L A;  4EMK A;  3A98 A;  1B3Q A;  5KYW A;  4D8D A;  4A4F A;  1GFD A;  4IUR A;  5CKB A;  3VS0 A;  3OYL A;  4M78 E;  2DZC A;  1PKS A;  3VS7 A;  1LPL A;  4ANJ A;  4M75 E;  1TUC A;  5J39 A;  1D0Y A;  3PMI A;  2EQI A;  3C12 A;  4OB0 B;  2JW4 A;  5LJ3 d;  2FHD A;  1DJ7 B;  1I5O B;  4J9F A;  4BI4 A;  1M90 U;  4JDS A;  4QQG A;  2RQR A;  1X6B A;  1P92 A;  2YRD A;  1N9S A;  2KEA A;  2RQT A;  1UTI A;  5A0D A;  9ATC B;  4E7J A;  3HRS A;  1PSE A;  3DB3 A;  1QVG A;  2CS7 A;  5KCH A;  5KYU B;  3OMG A;  3X28 B;  2PNI A;  1EFN A;  2DX1 A;  1Y71 A;  3S3O A;  2DJZ A;  1SHF A;  5GAN 2;  3DLL A;  3LH0 A;  2RJE A;  4Z89 A;  4JLG A;  3C4S A;  3QWY A;  4DA4 A;  4AFZ C;  1UHF A;  1MGQ A;  2DNU A;  3CCU A;  3LW5 E;  1K76 A;  1PNJ A;  3EFR A;  2CP6 A;  1UDL A;  3DB4 A;  4MML A;  2AK5 A;  1WQ7 A;  3LH5 A;  2E12 A;  1VQK T;  3OYI A;  2RPN A;  4A4H A;  3JCM X;  4BDZ A;  1Q95 G;  3M0U A;  2DER A;  5FLX E;  4RTV A;  2RHY A;  4HVV A;  1D1A A;  2GTO A;  2ED0 A;  2QTX A;  2QDL A;  4BUG A;  3CCR Q;  3AHU A;  5CQY A;  2MOX A;  4QQ6 A;  3J81 E;  1K9M R;  5LJ5 d;  3CME T;  2LQK A;  3M53 A;  4C8Q E;  1X2K A;  1ZLM A;  3G4S Q;  3SD4 A;  4J7I A;  2D6F A;  1H64 1;  3GNF B;  1BI3 A;  3M0T A;  4J9H A;  1VQ5 T;  4CC2 A;  1SF9 A;  5GAN f;  2GGR A;  1KD1 R;  5GAN j;  5GAN e;  4HXJ A;  4M78 C;  4GBQ A;  4RCB A;  1VQ8 Q;  1X43 A;  4M7A F;  5DM7 R;  2RF0 A;  4M75 C;  1KIK A;  5KYU A;  3BE3 A;  3E2U A;  2HEQ A;  3QZ9 B;  2EVR A;  1GCQ C;  2JN0 A;  3VJP A;  1MMG A;  2BE7 D;  4J9I A;  3CPW S;  2BZX A;  1AHJ B;  1K0S A;  3H9N A;  3RUX A;  3H0F A;  1WYX A;  3OY9 A;  2OTJ A;  2F5K A;  1UGV A;  4M77 B;  1K9M C;  4M78 B;  1VQ6 A;  2ZCF B;  5CIU A;  3M57 A;  4C5E A;  2P84 A;  2JMA A;  3M0R A;  3BDU A;  5I21 A;  3MO8 A;  1OPK A;  3U23 A;  4J5Y A;  2DTH A;  2GNC A;  1N27 A;  3EG2 A;  5C0M A;  1SSF A;  5I11 A;  1KG1 A;  4KUI A;  1KD1 C;  1XOV A;  3CCE T;  1TXQ A;  2VXE A;  1AWJ A;  2KQW A;  5GJV B;  4PJO G;  3BW1 A;  3RIR A;  4C92 G;  2X35 A;  3H41 A;  3O5Z A;  2D9T A;  2CP2 A;  3A5Z B;  2CH4 W;  3P8B B;  1K9A A;  4JRI A;  1YIT T;  2DEU A;  3QJ6 A;  4NL3 A;  2YUQ A;  2EQJ A;  3NMZ C;  1BBZ A;  4Y28 E;  2IIM A;  3X26 B;  1UG1 A;  3FEO A;  1GBQ A;  1Y7X A;  1YWO A;  4D8K A;  3DLM A;  3ZFJ A;  5L23 A;  2CKK A;  1WA7 A;  4J6X A;  3SWN C;  3CC4 Q;  4OGE A;  3I56 Q;  4JJD A;  1KQS A;  1OUL A;  5AYF A;  4R55 A;  3UPU A;  3OYG A;  1KQ1 A;  1BYM A;  4C8Q C;  2QEX Q;  3JCM h;  5I2M A;  1AOJ A;  2WAC A;  3G71 Q;  2KXD A;  4ZN1 A;  1SRM A;  1M90 R;  2O4X B;  4J9B A;  1B07 A;  2JMC A;  4Z02 A;  2G3R A;  3OS1 A;  1UUE A;  2RHZ A;  3REB B;  2LJ3 A;  1NJI U;  4M77 A;  3OQ5 A;  4M78 A;  2EKO A;  1UGP B;  2IPO B;  2M0Y A;  2C0O A;  4F17 A;  1WGS A;  5KCO A;  5DLO A;  4L59 A;  1GXI E;  3H6Z A;  2XMF A;  2YUO A;  4E2F B;  1YJN T;  2DF6 A;  3QBY A;  1ZX6 A;  2LNH B;  1VQK A;  5KH6 A;  3CPW P;  1PRL C;  2X51 A;  3MEV A;  4M77 D;  2AIR B;  4LD9 K;  4F7U B;  3ZL7 C;  2L3S A;  1HK9 A;  2OI3 A;  4DBQ A;  2JTF A;  4RKU E;  3HFO A;  4FT2 A;  4RG2 A;  4OMO A;  3I56 T;  2Y4X A;  5KE3 A;  2E41 A;  1RAH B;  4HCK A;  2HQE A;  2GQI A;  3C95 A;  3G71 T;  3EG0 A;  5GAN 7;  3VU3 C;  3CME A;  2FVU A;  2RK1 A;  4AFU C;  4FL6 A;  4DEY A;  3VV0 A;  2VYT A;  2YT6 A;  3MEU A;  1UB4 A;  1UHC A;  1VQ5 A;  1XJW B;  1OX9 A;  3M58 A;  2K57 A;  4J8O A;  5CKE A;  3LLR A;  4V2S A;  4FIB A;  3VYH B;  2JJ9 A;  3JCM V;  3PTA A;  1YI2 T;  3JB9 G;  2RN8 A;  4LDW A;  4QT7 A;  4PFO A;  4BE1 A;  2JM8 A;  1QVF S;  4PLI A;  1C0M A;  2O4X A;  4KUL A;  1NEB A;  1TH7 A;  4J7F A;  4KBM B;  4RTW A;  4PL6 A;  5FWC A;  1AT1 B;  2DVE A;  3VS1 A;  3A8O B;  3LGL A;  2X4W A;  1ZQ1 A;  4OGC A;  1IGU A;  2EKH A;  3RDV A;  1LCK A;  1KC8 R;  5J3B A;  1RAC B;  1BU1 A;  3CCQ A;  1NE8 A;  2B8A A;  3CCE A;  1QWF A;  1W70 A;  4FYX B;  4E7Z A;  2HCK A;  4EMH A;  2VVK A;  2NUP B;  4F7U A;  3RKY A;  2KBT A;  2XHC A;  4C5G A;  3E9G A;  4UC4 A;  3JRZ A;  1YFN A;  1T3L A;  4PJN A;  2P0K A;  1B7T A;  3VS5 A;  3CC2 T;  1VQ9 T;  5GAN g;  3OYB A;  5GAO l;  1QLY A;  1JBM A;  2JNG A;  4NL2 A;  2DJQ A;  1YIT A;  2LQ8 A;  8AT1 B;  5CVI A;  1WJQ A;  4L5G A;  1XTD A;  1YN8 A;  2DXT A;  1IB8 A;  1UFF A;  2V26 A;  3LWI A;  3I5S A;  5FU7 C;  1YJ9 T;  1CSK A;  1AZE A;  3KFV A;  4M78 F;  2F2W A;  3BDL A;  4RTX A;  4M75 F;  2W10 A;  2M02 A;  1KC8 C;  2NUZ A;  2EQU A;  3X25 B;  5KYX B;  5LJ3 h;  2E4H A;  2LQW A;  3A8H B;  4M7A C;  4JRK A;  4LDY A;  2QGF B;  2QTV A;  2DO3 A;  2RJD A;  4MDW A;  2H8H A;  5FU7 B;  2CUB A;  2XD0 A;  1K8A U;  4A53 A;  2M0O A;  5GAO m;  3F70 A;  4M7A B;  2EGA A;  3VS6 A;  1YIJ Q;  3J80 E;  4IUP A;  5GAN 5;  3GP8 A;  1ZA2 B;  1OOT A;  1OPL A;  1IXD A;  1YJN A;  1QVF P;  2MWP A;  3L42 A;  1PRM C;  4BB7 A;  1UEC A;  1NJI R;  2R5M A;  3KXT A;  2BE9 B;  4KGX B;  1YHQ A;  1PSF A;  2B86 A;  4IIO A;  1ZUU A;  2BKD N;  2NUP A;  5HY6 A;  3ER0 A;  1K73 R;  3S3N A;  1MV0 B;  1PC0 A;  2AHJ B;  3EHQ A;  1WPY A;  3QSU A;  3FRN A;  2FPF A;  2P0P A;  1WHJ A;  1V1C A;  2X9H A;  3NPF A;  2QGG A;  1Y96 B;  1KHC A;  1VQO T;  1WI7 A;  3OW2 S;  4KGZ B;  1T3S A;  2KRM A;  4J9D A;  1ZSG A;  1WHM A;  2KYB A;  2DEQ A;  2L8D A;  5IT9 E;  2LJ0 A;  2A28 A;  4PNO A;  1MMD A;  5D7U A;  1UGS B;  1OZ2 A;  5KYX A;  1YI2 A;  4E47 A;  4C8Q F;  1JB0 E;  3SDZ A;  1NJI C;  1FMW A;  4FYV B;  2QA4 T;  2EYQ A;  2K7A A;  2OAW A;  4XU1 A;  1K73 C;  4ELZ C;  3JB9 F;  1D0Z A;  4AFS C;  1VQP T;  3I55 T;  1IRE B;  4ZTF A;  2YRV A;  3IQL A;  1YNZ A;  3OBW A;  2RHU A;  2SRC A;  3PFS A;  3EG1 A;  1TSF A;  3QHS A;  1C6V X;  3M54 A;  2NYS A;  4JUV A;  3G6E T;  4M7A A;  3RR6 A;  3QYH B;  4PFP A;  2D8H A;  2K2M A;  4E7L A;  5IN1 A;  4ZGE B;  1NYG A;  4ME7 A;  2DL4 A;  1JJ2 S;  4FT4 A;  5CCA A;  2FL7 A;  2HKQ B;  3CCM Q;  3Q1J A;  5GAN d;  5HKC A;  4PJO E;  3VYG A;  3V7C A;  5GAO q;  2LCS A;  3L2U A;  4JPB W;  4C92 E;  4C0G A;  4YTL A;  2E3H A;  3C94 A;  3JCM f;  3CCJ Q;  4BE2 A;  1KJW A;  3JCM e;  4HT8 A;  2FRW A;  1LOJ A;  4M7A D;  2KY9 A;  2E6Z A;  3WVE B;  4CI0 C;  5DLQ E;  2OTL T;  2MAM A;  3OS5 A;  4HA8 A;  1OV3 A;  3CC2 A;  1VQ9 A;  1PG5 B;  1JU5 C;  2WSF E;  4JZ4 A;  5CR2 A;  2A7Y A;  4TVR A;  2L3P A;  2EJ9 A;  2PUO B;  4ZN3 A;  3DKM A;  4DOW A;  1D3B B;  3CMA T;  3HL8 A;  1Y96 A;  2CSI A;  1GRI A;  2ZGW A;  4J9C A;  1SPK A;  2GQV A;  1LNX A;  1VYU A;  1WFW A;  3OS2 A;  4ATO A;  1PWT A;  3KBG A;  3MHX A;  2MCN A;  2J05 A;  4P5N A;  2YHT A;  3PVQ A;  2DYI A;  3HRU A;  2QQR A;  4QKU A;  3A8G B;  1X6O A;  2ZPB B;  5IHI A;  3CCV Q;  4B6M A;  3NFC A;  4PJL A;  3CCS T;  2GCX A;  3QKJ A;  1G3Y A;  3CCJ T;  1QP2 A;  1WHL A;  3M59 A;  1VQ4 Q;  4BI3 A;  3OW2 P;  2C0I A;  1QVG S;  1PHT A;  2KT1 A;  2MYS A;  1S72 Q;  2EBP A;  1N5Z A;  1O75 A;  1HJD A;  4QVZ A;  1N6A A;  5GJW B;  1Q7Y U;  3HPW A;  4FYW B;  1YCS B;  3FLG A;  3THK A;  3QDR B;  4RTZ A;  4X9D A;  4BI8 B;  4BY6 C;  2VKN A;  4HCZ A;  1I1J A;  2PUK B;  1K8A R;  5D6Y A;  4XTY A;  4XK8 E;  1VIE A;  2LT1 A;  4A63 B;  3OYN A;  1RAF B;  1HYO A;  2LDM A;  4AT1 B;  2A08 A;  2ZPI B;  2DTO A;  2F2V A;  4EMG A;  1ZSZ C;  3QUI A;  3I35 A;  1D1C A;  5FRO A;  2DD5 A;  1Q81 U;  4B9X A;  1TS9 A;  4VUB A;  1NLO C;  1R0B G;  2ED1 A;  1JJ2 P;  1H92 A;  2MIO A;  2GBQ A;  4PJO C;  2COZ A;  3P8H A;  2E10 A;  4C92 C;  1TWB A;  4QVD A;  1OU8 A;  1D3B A;  4N0A C;  2QQS A;  2GFA A;  1VQO A;  3OA6 A;  4OVA A;  3HKS A;  4AG2 C;  3JCM P;  3CCL Q;  1GBR A;  3CEY A;  2FRY A;  8ATC B;  1QKX A;  3G7Z A;  1NEG A;  1K8A C;  1UGR B;  3H0I A;  3JB9 I;  3PIP A;  5GAN 4;  2WSE E;  2QA4 A;  3OYF A;  5GMK l;  1VQM Q;  4X34 A;  1LJO A;  3WVD B;  3M4Y A;  1J3T A;  2K5I A;  4C0F A;  1R0C B;  3NGP A;  2OJ2 A;  4RTY A;  1VQP A;  3OYH A;  3I55 A;  2GF7 A;  2PQW A;  1GFC A;  2EYX A;  2X3X D;  3CCR T;  4M7D E;  1FMV A;  4M75 B;  2EYY A;  2JXB A;  3VS2 A;  1M1G A;  3G6E A;  2VC8 A;  4ZGJ B;  1PCX A;  2CDT A;  3BFM A;  3V8L A;  2V8J A;  2JOY A;  4RTU A;  5HK3 A;  2DL7 A;  2RQU A;  3JCM b;  2M16 A;  5LJ3 f;  4DBH A;  3G4S T;  3JCM c;  5LJ3 j;  5LJ3 e;  1OYX A;  3CBP A;  5AT1 B;  4XU3 A;  1R77 A;  1VQ8 T;  2FB7 A;  4XU0 A;  2IVW A;  1QVG P;  2O2O A;  1SEM A;  2LNV A;  2DPP B;  5CQX A;  2OTL A;  2A3L A;  1FYN A;  4OMF B;  1VQL Q;  2DBK A;  2ZZD A;  2KAF A;  5GMK m;  4PJM A;  4N4G A;  1U3O A;  1ABQ A;  2CT3 A;  1WLP B;  2ENM A;  1RI9 A;  1VQN Q;  2E65 A;  3CMA A;  5M9O A;  2CP3 A;  3MKD A;  2P0Q A;  4M77 G;  4K11 A;  4QVC A;  5CKD A;  3R6O A;  4BE0 A;  2EFI A;  2W0Z A;  4PFZ A;  4FSS A;  4KH0 B;  4J9E A;  1BI1 A;  1TUG B;  1PD1 A;  4J6W A;  3GPL A;  2EQK A;  4PJO A;  5GAM h;  3ULR B;  2KI7 A;  1BKB A;  2CZ6 B;  2DIL A;  4JS5 A;  2RO0 A;  2K2V A;  1BIB A;  4N0A A;  1T0J A;  3CCS A;  3JSC A;  1PKT A;  1HSQ A;  4OB1 B;  3SWN B;  5GAN 6;  2DMO A;  1KQS S;  1KFZ A;  2Y4Y A;  3GF5 A;  4M75 A;  2YUN A;  2E6N A;  3KUF A;  4LN2 A;  2VWF A;  4XTW A;  5EG2 A;  3JCM g;  2KK4 A;  1K1Z A;  5A2Q E;  4C8Q B;  1GCQ A;  4DQ2 A;  4JJC A;  4J9G A;  4AG1 C;  4BD3 A;  4HVU A;  2HL5 C;  4C5I A;  2HNI A;  2RK2 A;  3CC7 Q;  3EGD B;  3JB9 J;  2XI9 A;  3RNJ A;  4A54 A;  1YJW Q;  2KSS A;  2V1Q A;  4DEX A;  3GBQ A;  4M78 D;  1VQ7 Q;  2DM1 A;  2NLU A;  3CC4 T;  4M75 D;  2DAQ A;  1E6H A;  3H0H A;  1M90 C;  1NLP C;  2J6F A;  2XDP A;  1AEY A;  2RH2 A;  4XTV A;  1I81 A;  3OYJ A;  3FJ5 A;  3QWX X;  3WXM B;  2QEX T;  3V8J A;  5GAN 8;  3CD6 Q;  2PVO B;  1G2B A;  1AWW A;  1CKB A;  3PE0 A;  3T9N A;  2VGM A;  4Z8A A;  3OS0 A;  3JCM Q;  2DRM A;  2HMA A;  2QYZ A;  4KUD K;  1W4S A;  2EIF A;  1M1F A;  1NBE B;  2BZY A;  3TQ7 P;  1WX6 A;  3AT1 B;  1WXU A;  1Q81 R;  2ZPG B;  1Z9Q A;  2RA2 A;  1SHG A;  1BI2 A;  4MZP A;  2J7I A;  1CKA A;  1RAA B;  2KE9 A;  1H8K A;  2K9G A;  3UA7 A;  1ZUY A;  3C0C A;  1M2V B;  1OEB A;  1Z9Z A;  2DZ9 A;  5EC7 A;  1OQK A;  3SWN A;  3CCR A;  1E6G A;  1QP3 A;  2LX7 A;  3JAM E;  4JS4 A;  2K5L A;  1VYT A;  1R8O B;  4M7D G;  1H3Z A;  2L0A A;  2ROL A;  4Q5W A;  1G3T A;  2E1H A;  1M3B A;  4F16 A;  2VUB A;  4C8Q A;  1FXX A;  2CSQ A;  3UA6 A;  2Y90 A;  3CPF A;  3G4S A;  4LXC A;  4WCI A;  3MEW A;  3EGD A;  2Z0W A;  2AT1 B;  5GAO n;  2COW A;  2K79 A;  4OML A;  3JCM W;  1ACM B;  4A4K A;  2CH4 A;  4AFQ C;  1KQS P;  1VQ8 A;  2JS0 A;  2DL5 A;  2CT4 A;  3EHR A;  2HBP A;  1U1T A;  1C1A A;  4C8Q D;  3UDC A;  4PJO F;  1BI0 A;  1WIE A;  3RER A;  3HRT A;  1PD0 A;  4IUT A;  2K5F A;  2F69 A;  4C92 F;  2K3Y A;  2J6O A;  2O01 E;  3CXC A;  3JB9 D;  2XK0 A;  2FPE A;  2RD1 A;  5CKH A;  1ZA1 B;  3CCU Q;  5FWB A;  1Y57 A;  4PLL A;  2F2X A;  5HK0 A;  3QZ5 B;  1AD5 A;  2FO0 A;  5FRN A;  2L3Q A;  3EH1 A;  2CZ0 B;  1AWX A;  1BIA A;  2DXC A;  3CQT A;  3EFO B;  4FW2 A;  4J6Y A;  4OF1 A;  3QDF A;  2ATC B;  3JCM d;  3L2V A;  4F14 A;  2QDY B;  1W2B S;  4Y91 A;  1EX4 A;  3VUZ A;  4RMO A;  5LJ3 g;  3OYM A;  2MK5 A;  1M2V A;  2KVQ G;  4MZT A;  5GAO r;  3JB9 H;  2K3X A;  1BCM A;  1NZ9 A;  3L2Q A;  2HL3 A;  2K4Y A;  2L3R A;  2X4J A;  1N8R U;  3UT1 A;  3ASK A;  3OYE A;  2XG8 D;  2QI2 A;  3EGU A;  2EPD A;  1PM3 A;  4EMK C;  1X2Q A;  2RB6 A;  1GCP A;  2DXU A;  1D09 B;  4JRQ A;  3RMQ A;  1M3C A;  1UJY A;  4CRI A;  2DVJ A;  1O9S A;  4E7K A;  2HZY A;  3CC4 A;  2EYZ A;  3M5A A;  3I56 A;  2L89 A;  3O8V A;  4R0K A;  1JQQ A;  1T0H A;  4RUG A;  3OYA A;  3M9Q A;  1WJR A;  4OB3 B;  4FSX A;  1KHI A;  1QQJ A;  1X75 C;  1WJS A;  2EQM A;  4E7I A;  2QEX A;  1K0X A;  1M3A A;  2OTJ Q;  3G71 A;  3P8D A;  2PU9 B;  2VV5 A;  3HSB A;  1MHN A;  2RNA A;  1VQ6 Q;  1KD1 U;  2EJF A;  3OW2 A;  5LJ5 h;  2XDB A;  1Y07 A;  4HCC A;  4A4E A;  1WHH A;  2EGC A;  4IUV A;  1YIJ T;  2RJC A;  5CK9 A;  4JRP A;  3SB2 A;  2MPX C;  4FYY B;  1Q82 U;  1M5Q 1;  3EFO A;  2LVM A;  2JZ2 A;  3HFN A;  3LX7 A;  3CBO A;  2FEI A;  4OB2 B;  2EGE A;  1FWZ A;  2EAY A;  2FZG B;  4OP0 A;  4LD6 A;  5CKF A;  2DE0 X;  5CO7 A;  2I2L A;  1JJ2 A;  2HQX A;  1MUZ A;  2RHI A;  2G6F X;  4II1 A;  1WXB A;  4N4I A;  5A0G A;  2P4R A;  2O9S A;  4M7D F;  2D0Q B;  2M9U A;  3OSS C;  1W2B P;  3TSZ A;  3ZBD A;  5FU6 C;  5GAM f;  2HAX A;  2K3B A;  4HVW A;  4FU6 A;  2RQV A;  4OMQ A;  2LT4 A;  5GAM j;  3M4G A;  5GAM e;  2HSE B;  4E7S A;  2DIQ A;  3A8M B;  2DXB A;  2YWW A;  2DFU A;  1UE9 A;  1IO6 A;  1NG2 A;  2X4Y A;  1SRL A;  3OYD A;  2A0F B;  4J83 A;  4M77 E;  2LX9 A;  4HKE A;  1FX7 A;  1YJ9 A;  1AVZ C;  5FU6 B;  2HKN A;  2X4X A;  4CC4 B;  3FJP A;  1TTH B;  4CC7 A;  3FB9 A;  2QK0 A;  3UWN A;  1IZ6 A;  1WQW A;  1VQK Q;  2RHX A;  1ARK A;  3TU4 K;  4X9C A;  1W6X A;  3CCM T;  1WNL A;  3VRY A;  1ZUK A;  4R56 A;  6AT1 B;  2CZ1 B;  2XDD A;  4XQ3 A;  3MPU B;  2EWN A;  2XU8 A;  4PKC C;  2KGT A;  2ZPH B;  4LNP A;  3TEE A;  4LDX A; 
#chains in the Genus database with same CATH homology
 2JVV A;  2KAF A;  2M1H A;  3L2Z A;  5GMK m;  5GAO p;  2O4X A;  1OI1 A;  1U1S A;  4L6V 5;  2HD0 A;  4N4G A;  4KUL A;  1TH7 A;  4C0D C;  4HCB A;  2PVD B;  4J7F A;  2LC4 A;  4KBM B;  2RJF A;  1B34 A;  4NOY A;  4PL6 A;  4XAX B;  4JJN K;  2E65 A;  3CMA A;  5M9O A;  1Q86 C;  4LDV A;  5CAI A;  2P0Q A;  4M7A G;  5GMK j;  4XTX A;  4M77 G;  5GMK e;  2MF2 A;  5DY9 A;  2DVE A;  3VKI A;  2P4T A;  4QVC A;  3A8O B;  2QXF A;  3LGL A;  4XTU A;  2F5T X;  2WSC E;  2X4W A;  1ZQ1 A;  4O5V A;  4OGC A;  2MWO A;  5CKD A;  3A8L B;  3R6O A;  5J3B A;  3CC7 A;  4BE0 A;  1G3S A;  1VUB A;  2EFI A;  5L8R E;  3CCQ A;  1NE8 A;  2B8A A;  2DTI A;  1M8V A;  3QYG B;  3RKW A;  3PIO A;  5LJ5 g;  1YJW A;  2ZPE B;  4C0D B;  2RI5 A;  3CCE A;  1BI1 A;  2MMP A;  4DOV A;  2CGH A;  4J6W A;  3GPL A;  1VQ7 A;  2EQK A;  4EMH A;  5GAM h;  4PJO A;  3TCJ A;  4BY6 B;  4F7U A;  4BAC A;  1BKB A;  2CZ6 B;  2XHC A;  3RKY A;  3X24 B;  2RO0 A;  4C5G A;  1X01 A;  3E9G A;  4JS5 A;  2V8K A;  4UC4 A;  4MDX A;  3JRZ A;  2K2V A;  1BIB A;  4N0A A;  4JLI A;  4E7H A;  3CCS A;  3JSC A;  2P0K A;  3CCV T;  5D6X A;  3CC2 T;  1VQ9 T;  4MZM A;  4OB1 B;  5GAN g;  3OYB A;  1I4K 1;  3GLX A;  5GMK i;  1JBM A;  3SWN B;  5GAN 6;  2ZPF B;  5GAO l;  2JNG A;  1KQS S;  4NL2 A;  2OTJ T;  2Y4Y A;  4ZTJ A;  1YIT A;  1UGQ B;  2LQ8 A;  3CD6 A;  1VQ4 T;  5CVI A;  2YLC A;  2RI2 A;  4F7U F;  1ZHI A;  3GF5 A;  4M75 A;  1WJQ A;  2E6N A;  2GFU A;  3KUF A;  3E1S A;  4L5G A;  4XTW A;  5EG2 A;  3JCM g;  1XTD A;  2KK4 A;  4ZGD B;  1VQ6 T;  2DXT A;  5A2Q E;  2XKO C;  1I5L A;  4C8Q B;  3LWI A;  1S72 T;  2QQA A;  5FU7 C;  4DQ2 A;  1YJ9 T;  3OBY A;  1YCY A;  4BD3 A;  4BDY A;  1YIJ A;  4M78 F;  4C5I A;  2HNI A;  2E70 A;  1EIF A;  2RK2 A;  3BDL A;  4O6J A;  4A4G A;  3JB9 J;  3HHT B;  2XI9 A;  2XIC A;  4M75 F;  2BIV A;  4A54 A;  1KC8 C;  2KSS A;  2EQU A;  1I8F A;  3CBM A;  3X25 B;  4PJO B;  5LJ3 h;  2OAU A;  3A8H B;  3CPW A;  2R57 A;  1M4Z A;  4GLK A;  4M78 D;  3L1A A;  4C92 B;  4M7A C;  2RI3 A;  4M77 C;  2NLU A;  3CC4 T;  3EFS A;  4JRK A;  4F7U E;  1RL2 A;  2DAQ A;  4M75 D;  3GNG A;  4LDY A;  2DKG A;  4IKF A;  1YBY A;  3FDR A;  3H8Z A;  2DO3 A;  1N8R C;  1M90 C;  2RJD A;  2V8I A;  3NTK A;  4MDW A;  4MMK A;  1VIF A;  4EMK A;  3RMS A;  2XDP A;  5FU7 B;  2JUF A;  2RH2 A;  1I81 A;  4XTV A;  2XID A;  4A4F A;  3OYJ A;  2QEX T;  3WXM B;  4ELY C;  3LYI A;  3V8J A;  4IUR A;  5CKB A;  5GAN 8;  3OYL A;  2PVO B;  4M78 E;  2XD0 A;  3MP8 A;  3MP1 A;  2DZC A;  4A53 A;  1K8A U;  4LDU A;  5I2S A;  3BY7 A;  3QPH A;  3OYC A;  4M75 E;  1KC8 U;  2M0O A;  3T9N A;  5J39 A;  1KQ2 A;  2VGM A;  3OS0 A;  2LTO A;  3F70 A;  3PMI A;  4GY5 A;  4XTZ A;  3JCM Q;  3C12 A;  5GAO m;  4M7A B;  4KUD K;  1W4S A;  2EIF A;  4OB0 B;  3J80 E;  4IUP A;  5LJ3 d;  5GAN 5;  1M1K U;  1M1F A;  3GP8 A;  2FHD A;  2L5Q A;  2RM4 A;  1DJ7 B;  4BI4 A;  1M90 U;  5GMK h;  2CZ7 B;  4JDS A;  1QVP A;  3CCL T;  1YJN A;  2MWP A;  3L42 A;  4QQG A;  2ZPG B;  1P92 A;  4BB7 A;  2MI6 A;  2RA2 A;  3NTH A;  1N9S A;  5A0D A;  3HP9 A;  4E7J A;  3HRS A;  3LWH A;  2R5M A;  1BI2 A;  3KXT A;  4MZP A;  1XNI A;  1YHQ A;  1OZ3 A;  1PSE A;  1PSF A;  3DB3 A;  1QVG A;  3CCQ T;  2CS7 A;  5KCH A;  3OMC A;  2BKD N;  3OMG A;  3X28 B;  5HY6 A;  3ER0 A;  4B9W A;  3S3N A;  3ME9 A;  1VQM T;  3OYK A;  2AHJ B;  4KT0 E;  1WPY A;  2VGN A;  3QSU A;  1Y71 A;  3FRN A;  3S3O A;  2DJZ A;  5GAN 2;  2DZ9 A;  3SWN A;  3CCR A;  3DLL A;  3LH0 A;  1QP3 A;  4D6W A;  2RJE A;  2P0P A;  4JLG A;  3C4S A;  3JAM E;  4DA4 A;  4JS4 A;  3ZEH A;  2K5L A;  1Q82 C;  1R8O B;  4M7D G;  1H3Z A;  3FIF A;  1Y96 B;  1MGQ A;  3PT9 A;  1KHC A;  4Q5W A;  1G3T A;  2E1H A;  4M78 G;  3CCU A;  2VUB A;  4C8Q A;  4XU2 A;  4EPC A;  1VQO T;  1FXX A;  3LW5 E;  3V7R A;  2Y90 A;  2VXF A;  3EFR A;  3OW2 S;  4M75 G;  3CPF A;  3G4S A;  3DB4 A;  4MML A;  1HXD A;  1WQ7 A;  3MEW A;  2DEQ A;  2L8D A;  3X20 B;  2E12 A;  5IT9 E;  4PNO A;  1UGS B;  1OZ2 A;  4EDU A;  5GAO n;  3OYI A;  1YI2 A;  1VQK T;  3CCM A;  4A4H A;  4E47 A;  3JCM X;  4BDZ A;  3JCM W;  4C8Q F;  1JB0 E;  4C92 A;  3SDZ A;  4A4K A;  1NJI C;  1Q86 U;  5FLX E;  1VQ8 A;  1G5V A;  2RHY A;  2QA4 T;  2EYQ A;  2HBP A;  4XU1 A;  3CCJ A;  1U1T A;  1K73 C;  4ELZ C;  3JB9 F;  2QTX A;  4C8Q D;  3UDC A;  4PJO F;  1BI0 A;  3RER A;  3QJY A;  3TRE A;  4BUG A;  1VQL T;  2EJG A;  3HRT A;  1VQP T;  4IUT A;  3I55 T;  5CQY A;  2K5F A;  2F69 A;  4C92 F;  2K3Y A;  3AHU A;  1IRE B;  4ZTF A;  2O01 E;  2YRV A;  3OBW A;  3PFS A;  2RHU A;  4QQ6 A;  3CXC A;  3QO3 A;  5GAM g;  2XK0 A;  3JB9 D;  5LJ5 f;  3J81 E;  3EAE A;  2RD1 A;  3QHS A;  5CKH A;  5LJ5 d;  3CME T;  5IAY A;  1W2B S;  4PJO D;  3M54 A;  5LJ5 j;  5LJ5 e;  4JUV A;  2LQK A;  4PLL A;  4C92 D;  3G6E T;  3M53 A;  4C8Q E;  4M7A A;  5HK0 A;  3QYH B;  3QZ5 B;  3SD4 A;  4J7I A;  2D6F A;  1VQN T;  1H64 1;  3GNF B;  1BI3 A;  4E7L A;  5IN1 A;  2LCL A;  4ZGE B;  5FRN A;  3NTI A;  4ME7 A;  3L2W A;  1K73 U;  1JJ2 S;  1VQ5 T;  4FT4 A;  2CZ0 B;  5CCA A;  2FL7 A;  1ZBX A;  5GAN f;  4M7D C;  1BIA A;  2DXC A;  3Q1J A;  5GAN d;  5HKC A;  4PJO E;  4QW2 A;  3VYG A;  3V7C A;  2DD4 A;  5GAN e;  5GAO q;  4M78 C;  3L2U A;  5GAN j;  4RCB A;  4C92 E;  4M7A F;  4J6Y A;  4C0G A;  2C06 A;  5DM7 R;  4OF1 A;  3PMT A;  3C94 A;  4YTL A;  3JCM f;  4M75 C;  4BE2 A;  3E9F A;  3JCM d;  3L2V A;  3JCM e;  4HT8 A;  1LOJ A;  1YHQ T;  4M7A D;  3QZ9 B;  2QDY B;  1NPP A;  2JN0 A;  2KY9 A;  2E6Z A;  4Y91 A;  3VJP A;  5DLQ E;  3WVE B;  2MAM A;  3OS5 A;  4CI0 C;  2OTL T;  4HA8 A;  3VUZ A;  4RMO A;  5LJ3 g;  2FYK A;  3CPW S;  3CCV A;  2E64 A;  1AHJ B;  3OYM A;  4MZT A;  2KVQ G;  3CC2 A;  5GAO r;  3RUX A;  1VQ9 A;  2WSF E;  5CR2 A;  2A7Y A;  3JB9 H;  1N9R A;  4RCC A;  2F5K A;  2DIG A;  2K3X A;  4TVR A;  2EJ9 A;  2PUO B;  4M77 B;  3OY9 A;  1NZ9 A;  3L2Q A;  4M7D B;  1VQ4 A;  4ZN3 A;  1K9M C;  4M78 B;  2K4Y A;  2L3R A;  3DKM A;  4C0Z A;  4DOW A;  1VQ6 A;  4M7A E;  2X4J A;  2ZCF B;  1D3B B;  3CMA T;  1N8R U;  3HL8 A;  1Y96 A;  5CIU A;  3UT1 A;  1S72 A;  3ASK A;  3OYE A;  2XG8 D;  3M57 A;  2QI2 A;  4C5E A;  2R5A A;  1U8R A;  3J7A F;  2ZGW A;  3BDU A;  5I21 A;  3MO8 A;  2GQV A;  4EMK C;  5GAN 3;  3FC3 A;  4RG8 A;  2RB6 A;  4J5Y A;  2DTH A;  1QVF A;  2DXU A;  4JRQ A;  1LNX A;  1N27 A;  3OS2 A;  5C0M A;  3RMQ A;  4ATO A;  1SSF A;  4C8Q G;  3CC7 T;  3L2R A;  1KG1 A;  4KUI A;  4CRI A;  2YLB A;  3V8K A;  1KD1 C;  1XOV A;  3KBG A;  2KDS A;  2LCC A;  1O9S A;  3MHX A;  4P5N A;  4E7K A;  2YHT A;  1YJW T;  3QXE B;  3CCE T;  3CC4 A;  3HRU A;  1Q7Y C;  1VQ7 T;  2VXE A;  4N4H A;  2QQR A;  3M5A A;  3I56 A;  2L89 A;  1X6O A;  2KMT A;  2ZPB B;  2KQW A;  3A8G B;  3O8V A;  4PJO G;  5C6S A;  3BW1 A;  3RIR A;  3NFC A;  1QW1 A;  4F7U G;  3OB9 A;  3OYA A;  4C92 G;  3M9Q A;  2OTJ A;  2H3J A;  1WJR A;  2X35 A;  4OB3 B;  3RES A;  1KHI A;  2GCX A;  1X75 C;  1G3Y A;  1WJS A;  1UEB A;  2D9T A;  2EQM A;  3QKJ A;  4FSX A;  2QEX A;  3CCJ T;  3G71 A;  1QP2 A;  3P8D A;  3A5Z B;  3M59 A;  3RKX A;  2PU9 B;  3P8B B;  2VV5 A;  4BI3 A;  3HSB A;  1MHN A;  1QVG S;  4JRI A;  3CD6 T;  1YIT T;  3QJ6 A;  4NL3 A;  1KD1 U;  2EQJ A;  2EJF A;  3OW2 A;  3PGG A;  1O75 A;  5KE2 A;  4QVZ A;  1N6A A;  4Y28 E;  5LJ5 h;  1Q7Y U;  3HPW A;  3X26 B;  3FLG A;  3QDR B;  2XDB A;  1Y07 A;  3FEO A;  4HCC A;  4X9D A;  1Y7X A;  4BI8 B;  3S6W A;  4A4E A;  4IUV A;  4BY6 C;  1YIJ T;  1Q81 C;  2RJC A;  5CK9 A;  4JRP A;  3E19 A;  4IUQ A;  3DLM A;  3ZFJ A;  3SB2 A;  3CCL A;  4HCZ A;  1V29 B;  2CKK A;  2PUK B;  4J6X A;  5D6Y A;  3SWN C;  1Q82 U;  1M5Q 1;  2LVM A;  3M55 A;  4OGE A;  5GAN h;  2QQB A;  1XQH A;  4XTY A;  4XK8 E;  1KQS A;  1VIE A;  5A0L A;  2LT1 A;  2PVG B;  3OYN A;  5AYF A;  4R55 A;  3UPU A;  2LDM A;  2ZPI B;  2JZ2 A;  3HFN A;  1KQ1 A;  3OYG A;  2DTO A;  1BYM A;  2JTM A;  3LX7 A;  3CBO A;  4C8Q C;  5LL6 S;  4EMG A;  3JCM h;  4OB2 B;  5I2M A;  2WAC A;  3QUI A;  1VQM A;  2LRQ A;  1FWZ A;  4ZN1 A;  5FRO A;  2DD5 A;  3QII A;  2O4X B;  1Q81 U;  3SFM A;  4B9X A;  2EAY A;  4Z02 A;  2G3R A;  4VUB A;  4WF2 A;  3V7S A;  3OS1 A;  2RHZ A;  4OP0 A;  4LD6 A;  1NJI U;  4PJO C;  4M77 A;  3MCA B;  4M7D A;  1B34 B;  4HT9 A;  3P8H A;  4IUU A;  2IG0 A;  2E10 A;  5CKF A;  4C92 C;  5CO7 A;  2I2L A;  3OQ5 A;  4M78 A;  1JJ2 A;  2EKO A;  1UGP B;  3GOX A;  4QVD A;  1D3B A;  4N0A C;  1JRI A;  2HQX A;  2QQS A;  2GFA A;  1WGS A;  1VQO A;  3OA6 A;  4OVA A;  3HKS A;  4FM4 B;  5KCO A;  3JCM P;  5DLO A;  2RHI A;  3CEY A;  4II1 A;  3CXC S;  4L59 A;  4N4I A;  1GXI E;  5A0G A;  3H6Z A;  4M77 F;  3OYY A;  1YJN T;  4M7D F;  2D0Q B;  2M9U A;  3OSS C;  3MP6 A;  3QBY A;  3G7Z A;  3ZBD A;  1G3W A;  3GIB A;  5FU6 C;  5GAM f;  1VQK A;  2HAX A;  5KH6 A;  4FU6 A;  5GAM d;  1K8A C;  1UGR B;  1W2B A;  3JB9 I;  2LT4 A;  3PIP A;  5GAM j;  3M4G A;  5GAM e;  3MEV A;  4M77 D;  3URG A;  5GAN 4;  4M7D D;  2DK3 A;  2WSE E;  4LD9 K;  4F7U B;  2QA4 A;  2DIQ A;  3A8M B;  3OYF A;  5GMK l;  1HK9 A;  2DXB A;  4X34 A;  3PNW C;  1LJO A;  1RI0 A;  5D6W A;  1M1K C;  3WVD B;  2JTF A;  2CYZ B;  3M4Y A;  2K5I A;  3HFO A;  4FT2 A;  4RG2 A;  4RKU E;  3VUB A;  4C0F A;  3I56 T;  2X4Y A;  2Y4X A;  1VQL A;  5KE3 A;  2E41 A;  3OYH A;  3I55 A;  2GF7 A;  5J26 A;  3MET A;  3OYD A;  1VQP A;  3INZ A;  2PQW A;  3CCR T;  4J83 A;  4M77 E;  2LX9 A;  2HQE A;  4M7D E;  4HKE A;  3C95 A;  3CCS T;  3G71 T;  5GAN 7;  1NPR A;  4M75 B;  3VU3 C;  1FX7 A;  3CME A;  5FU6 B;  2RK1 A;  2FVU A;  1YJ9 A;  2QQ9 A;  1M1G A;  2E5Q A;  2X4X A;  3OSV A;  3G6E A;  4FL6 A;  2VC8 A;  3JCM J;  3FJP A;  3CCU T;  4ZGJ B;  3VV0 A;  3QG1 A;  2VYT A;  3FB9 A;  1VQN A;  3BFM A;  3V8L A;  2V8J A;  2JOY A;  4C5H A;  3MEU A;  1IZ6 A;  3UWN A;  5HK3 A;  1UB4 A;  2M16 A;  5LJ3 f;  3JCM b;  3G4S T;  3JCM c;  1VQ5 A;  1WQW A;  2K57 A;  3M58 A;  4J8O A;  2RHX A;  3LLR A;  3MEA A;  3LGF A;  5CKE A;  5LJ3 e;  5LJ3 j;  4QQD A;  4E7I A;  4V2S A;  3S3M A;  1OYX A;  4FIB A;  3CBP A;  3VYH B;  3TU4 K;  3JCM V;  3N5B B;  4X9C A;  3PTA A;  3JB9 G;  3M56 A;  1YI2 T;  1K9M U;  4XU3 A;  5FRM A;  3CCM T;  4NS5 A;  4LDW A;  1WNL A;  1VQ8 T;  4R56 A;  2FB7 A;  2CZ1 B;  2IVW A;  4XU0 A;  2XDD A;  4XQ3 A;  2LNV A;  4BE1 A;  1M9S A;  2EWN A;  1QVF S;  2DPP B;  2XU8 A;  4PLI A;  4PKC C;  5CQX A;  2ZPH B;  3TEE A;  4EMK B;  2BUD A;  2OTL A;  2A3L A;  4OMF B;  2R58 A;  2ZZD A;  4LDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...