3QSUA

Structure of staphylococcus aureus hfq in complex with a7 rna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
b'NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA chaperone Hfq
publication title Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Chaperone/rna
total genus 18
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F, G, H, I, J, K, M, N, S
ec nomenclature
pdb deposition date 2011-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qsuA00
3INZA 4MMKA 4XU0A 4F7UA 5GAN5 3JB9I 4N0AC 1I8FA 4PJOG 4C92D 5I21A 2I2LA 4MMLA 5GAOn 4PJOB 5LJ3e 2E10A 4M78A 3JCMc 4PJOE 5GAMe 4RCBA 4WF2A 3M4GA 5LJ5d 2VXFA 4M77C 3JCMV 2RM4A 4M7AG 3L1AA 5GMKj 4C92F 4C8QD 5GANd 2VC8A 3PGGA 3FIFA 4M7AF 4M7AB 4XTVA 2DZCA 4C8QE 3SWNB 4M7AE 4J5YA 4HT8A 3HSBA 4XU3A 4M77A 5LJ5e 3JB9H 4M7DD 4M75D 4PJOC 4C8QF 1Y96A 3BY7A 5GAN8 3JCMf 5LJ3d 2RD1A 3RKXA 1N9RA 1BIBA 5GAMd 1HXDA 4NOYA 5GAOq 4C92G 4M7DF 2DTHA 2DXUA 4M75F 3EFRA 4A54A 1KQ2A 2DTIA 4PJOA 4C92B 3JCMQ 3SWNC 3JCMb 2EJGA 3FJPA 5GAOm 2E64A 2RB6A 2FB7A 3BW1A 4XU2A 1WNLA 1U1SA 3EFSA 4Y91A 1WQWA 4C92E 2DZ9A 5GMKe 3JCMX 5GAN7 3V8JA 4V2SA 5GAOp 3AHUA 3JCMh 4HA8A 5GAN2 5GAN3 4C8QG 5GAN6 4M7AA 5GMKl 5CAIA 2CGHA 2E65A 1B34B 4JRKA 3SWNA 4RCCA 4JLIA 4C8QB 3QHSA 1BIAA 2YLCA 3RUXA 2DXTA 3V7SA 4M7DG 2DJZA 4M75G 1WQ7A 4C92C 3JCMg 4X9CA 4XTYA 4EMHA 4M75B 1WPYA 4NL2A 3RESA 5GMKm 4M7DB 4M7DE 2E1HA 4M75E 3HFNA 3RKWA 1H641 1YCYA 3FB9A 3V7CA 4EMKA 4F7UE 4C92A 2DTOA 2K57A 2VXEA 4C8QC 1M5Q1 4EMGA 3QO3A 4JUVA 4EMKB 4M7AC 2EAYA 1JRIA 4XTXA 1I4K1 4M78D 3BFMA 1X01A 1U1TA 1D3BB 4F7UF 5GANg 3JCMJ 5LJ5f 4M78E 2EWNA 2QTXA 4M7DC 5GAN4 1B34A 4M75C 1I5LA 4C8QA 5GANf 5GAOr 5GMKi 4QVDA 4OP0A 4PNOA 4M78C 4A53A 4M78F 3JB9J 4XU1A 4XTZA 3V7RA 1TH7A 1LOJA 2YHTA 4M77D 4J6YA 3GIBA 3RIRA 4M75A 4M7DA 4EMKC 1LNXA 3JCMd 1I81A 5LJ5h 1LJOA 2E41A 5LJ3f 5GANj 3JB9D 4XTUA 4F7UG 3JCMP 1N9SA 5GAMf 5GANh 3JCMW 2DEQA 4XQ3A 4F7UB 4M77F 1M8VA 4NL3A 4PJOD 3V8LA 3QUIA 4QVCA 3L2ZA 4M78G 3JCMe 1D3BA 4XTWA 3JB9F 4JRIA 5LJ5g 3VU3C 2FYKA 4M78B 4N0AA 5LJ3j 2EJ9A 3V8KA 5LJ3h 5GAMj 5GMKh 4M7AD 3HFOA 4PJOF 3QSUA 5GAMh 4J6XA 2Y90A 2RA2A 2YLBA 2HNIA 4X9DA 3SB2A 1MGQA 2ZGWA 1HK9A 4M77G 3RERA 2DKGA 1KQ1A 4DQ2A 5GAOl 4M77B 1JBMA 2JN0A 5DY9A 3RKYA 2EJFA 4J6WA 2DVEA 5GANe 5LJ3g 5LJ5j 4HT9A 1Y96B 4M77E 3JB9G 5GAMg 3BDUA
chains in the Genus database with same CATH superfamily
2FRYA 1IGQA 4F7UA 2NUPB 2QA4T 3ZL7C 3OYYA 2I2LA 3EFOA 2E10A 3JCMc 5CO7A 4A4KA 1GBQA 2HMAA 2CT4A 2LVMA 2V8JA 2CP6A 1U8RA 3D7SB 2LJ0A 3CCRQ 2H8HA 1Q86C 5CR2A 3CCVA 3G7ZA 3M0SA 2DX1A 3OSSC 4J9FA 3I56T 1HYOA 5DM7R 3CCJQ 2DTIA 2LCSA 1PD0A 4AFSC 1PSEA 3G71Q 1AWJA 2YUPA 3FJ5A 1IXDA 1YITA 4XAXB 5GAN6 4ELZC 2E65A 1AOJA 2ZPEB 2JTMA 2DXTA 1D0ZA 7AT1B 3CCEQ 1TUDA 2DJZA 1X2KA 4EIKA 1WPYA 3CC4Q 4M7DE 1VQOQ 2BUDA 3V7CA 1K4US 2KNBB 1GFCA 4LNPA 1LPLA 4NS5A 5J39A 3VS1A 4CRIA 3QXEB 4O5VA 3CD6A 4DBHA 5A2QE 1M1FA 2QAZA 1AZEA 4XTZA 1M9SA 3EG9A 1KD1C 3QYGB 2ZPFB 3R6OA 2JM9A 2DIGA 4FL6A 1X27A 5IN1A 1WZOA 1M3AA 3OW2A 5IXBA 3CCLT 2RHXA 1KQSA 1M1KC 2YUQA 3L2ZA 2K2VA 4JRIA 4PFZA 2CKKA 5LJ3j 4FCYA 4FU6A 5FRNA 1RAFB 1ZSGA 2MPXC 2EQJA 2DXBA 3VS5A 4DOVA 2B86A 4J8OA 3RKYA 3IQLA 4UC4A 3GPLA 1S72Q 1RAGB 1NLPC 1WX6A 1VQ9Q 4E7IA 3VUBA 4N0AC 3M9QA 1VIEA 2KEAA 4Y92A 1YI2Q 3EGDA 2H3JA 5GJWB 4PJOE 3A98A 2O4XA 4M7AG 2PVOB 4F17A 3S3MA 4E7SA 1VQLQ 4N4IA 1XOVA 2WSFE 1JQQA 1Q7YC 1RAIB 3CC7A 3NHNA 1W6XA 4K11A 3LGLA 3CCJT 4BDYA 3JRZA 1WJSA 1MV0B 1M1GA 3G71T 3OS0A 4M7AA 4P5NA 2E4HA 1VYUA 4CC3A 2ESWA 2K2MA 5EC7A 3TSZA 2M1HA 2FG0A 2C0IA 2DO3A 3CCET 3MO8A 2R5AA 3CC4T 1GCQC 4C8QC 3RDVA 2KRNA 3DKMA 5FLXE 3ME9A 4LD6A 4HXJA 4OMQA 1YWOA 1RLQC 3M0QA 3CBPA 4M7DC 1ZHIA 3QIIA 2GTJA 2CS7A 2OTLA 1SSFA 1VQ7Q 1Y7XA 3VUZA 3VS0A 2Z0WA 1XTDA 2O31A 1NEBA 1EX4A 3CXCP 2G3RA 2EGAA 3CCQA 3T9NA 2DEUA 4R55A 1PHTA 3VU3C 2KRSA 3QG1A 3QWYA 1W2BS 4JZ4A 3QSUA 1Q81R 3S6WA 5GAOl 2HL3A 1KSWA 4Z02A 2OAWA 2OAUA 2DFUA 4XU0A 3UA6A 1ZUKA 1S72T 1SHGA 1RAHB 1VQ9T 2EGEA 1SRMA 5LJ3e 2JNGA 2RNAA 1JJ2A 1EZZB 1YI2T 2W10A 2DVJA 5GMKj 2CDTA 4C8QD 4E47A 3I5SA 3CMAA 2KI7A 5HKCA 3RNJA 2DILA 1K73U 4XU3A 4M7DD 3SEMA 2CSQA 2K3BA 4PJOC 4C8QF 2YSQA 2JW4A 4RUGA 3DLMA 5FU6C 3QKJA 2P4TA 4M7DF 1X43A 2XU8A 3BW1A 1MHNA 1ACMB 5GAN2 5KYYB 3CCVQ 5J26A 3CPWS 3QHSA 4OB3B 1NLOC 4ZNXA 4LDXA 2SEMA 2H3EB 3V7SA 1UJ0A 3QWXX 4OVAA 1QVFA 4M75B 2DL8A 1YITQ 3EG0A 3HP9A 2C06A 1I1JA 3RKWA 1G83A 1WJRA 4A4FA 4F7UE 2DK3A 1TOVA 1X2QA 1GRIA 4DBFA 3HKSA 3BFMA 1PD1A 3JCMJ 2EBPA 1KC8U 3MCAB 4RG8A 1D0XA 4XU1A 2YHTA 4LUDA 4A4HA 1M8MA 1VQ7T 2O9SA 2K3XA 5C6SA 3JCMW 4PJOD 3U23A 4IUQA 1Z9QA 1M90R 2HAXA 4BI8B 4M78B 4WTOB 4N0AA 2O2OA 1I5OB 4PJOF 2JS2A 4JZ3A 2XICA 3BDLA 2HNIA 2R57A 1HK9A 4M77G 1D0YA 1KK7A 4LDYA 2KXDA 4KULA 3JB9G 5GAMg 3TCJA 1CKAA 4JS4A 3FDRA 2GNCA 2FVUA 1BI3A 2EW3A 4JJNK 3CMEQ 3JCMV 2GF7A 4EDUA 2KR3A 4DBRA 2HCKA 5GJVB 4M77A 1BCOA 3PFSA 3REBB 2YT6A 5IT9E 3JCMf 2XDBA 4A4EA 4OB1B 2P0PA 2ZZDA 3L2WA 4HVUA 1NBEB 3MP8A 2XK0A 1M30A 3HHTB 4LDVA 2KSSA 3I55Q 5GMKe 3CCRA 4JPBW 2HKNA 2CGHA 3CC7Q 3C12A 3QBYA 1N8RC 1BKBA 2RMOA 3CCVT 1SSHA 2EYQA 2L5QA 4RKUE 1TUGB 1W70A 2E12A 4X9CA 1IHWA 1TG0A 1W1FA 1T0JA 1YCYA 1YITT 1K73C 2DTOA 3NPFA 1M5Q1 4AFZC 1CSKA 4JDSA 4XTXA 3NTKA 1I4K1 1K1ZA 3GF5A 3RR6A 2HSPA 4FM4B 1YCSB 1VOMA 1R0CB 3A8LB 4QQGA 1VQOA 4FYXB 3JB9J 4LDUA 1WIEA 3RMSA 2EIFA 1WJQA 2L0AA 5CQXA 3JCMd 2SRCA 3OMCA 3QDFA 1QCOA 3CD6T 4E7JA 4LDWA 3FRNA 3NTHA 2KT8A 2ROLA 3C94A 1RAAB 1ZA2B 1UTIA 1WYXA 2YWWA 1FMKA 3PVLA 1W2BP 3L2RA 3CCQQ 1BU1A 4JJCA 2EKOA 2M0YA 1QWEA 2RQTA 1KC8C 1Q86R 3NFCA 1Q82U 1I8FA 1Q95G 1G3YA 2QTVA 3M57A 2WACA 4ATOA 4L5GA 3A1PA 3H0HA 1RACB 3UA7A 3LGFA 3MEAA 3CMET 3EGUA 1DJ7B 1OQKA 4A4GA 3EGXA 2DJQA 3UWNA 4ZN3A 4JJBA 3H8ZA 5EG2A 1F1BB 3CMAQ 3EHRA 3UPUA 2KMTA 1YN8A 4C92B 3JCMQ 1VQLA 2FO0A 2OJ2A 4XU2A 1QVPA 3OY9A 2X9HA 5GAN3 1TU0B 3I55T 2ECZA 3J81E 5M9OA 3TVTA 3CC7T 3PVQA 4XTYA 4M75E 1R77A 2A08A 2BE7D 2K57A 3QO3A 4JUVA 1WXBA 3FEOA 4OGEA 1M1KR 5LJ5f 1WLPB 2MOXA 4C0DB 5GAOr 4IIOA 4OP0A 4OMOA 2L89A 2QGFB 4J9BA 2CP3A 4JRPA 1QQJA 2JVVA 4CC7A 1UGVA 4D8DA 3Q1JA 5FROA 1K9MU 4NL3A 3QUIA 3JCMe 2CP7A 1V29B 1X6OA 4XTWA 1VQ7A 1YJWA 3PE0A 1RLPC 3TU4K 4A63B 2E6NA 2RA2A 1OPLA 5AT1B 1ZUUA 3CCQT 3MKDA 5LJ5j 1AVZC 1O75A 3CXCS 1KG1A 3OYJA 5I11A 1Q7YR 3ZFJA 5A0LA 2YRDA 4BB7A 5CKBA 5LJ5d 2FPEA 1K76A 2AHJB 2MAMA 3SWNB 1VQ5A 3META 3EH1A 4TVRA 2JJ9A 3PT9A 3G4SA 4BACA 5GAN8 3X28B 1EFNA 2B8AA 1HXDA 2A3LA 2DTHA 2ZPIB 2D9TA 3CMAT 2KXCA 5GAOm 2K4YA 1K8AC 3VS2A 5CKHA 3RMQA 1Q82C 4JRKA 3E19A 5KYNA 3C95A 4DBQA 1T3SA 3L2VA 1JEGA 4RTTA 2DETA 1WHGA 2CUBA 2DYIA 3NTIA 5CKDA 1TS9A 2C0OA 2XHCA 4EMGA 4FYVB 2KVQG 1QMCA 1D3BB 1MNEA 2QTXA 4M75C 2V1QA 3CBMA 2J6KA 2DIQA 2WSEE 3BE3A 2LT4A 4ANJA 1M4ZA 1FYNA 2KRMA 3OYGA 1AHJB 1AT1B 5DLQE 5LJ3f 5GANh 2DEQA 4XK8E 2OTJQ 4F7UB 3R6NA 4GLMA 4QVCA 2EKHA 4PJJA 3EFOB 1JB0E 3TSWA 2YDLA 3GNFB 4FIBA 3V8KA 2A36A 5GAMh 3P8BB 2X3XD 2HD0A 2CUDA 3AT1B 3I35A 2LTOA 5C0MA 2RF0A 2VV5A 4E2FB 4M78C 5HK3A 3UF4A 4F16A 3JB9I 3OB9A 1QVGA 3PIPA 1UJYA 3VJPA 1SG5A 4OMNA 4QQDA 1K9MC 1PNJA 2G6FX 2CZ0B 1UHFA 2ATCB 3HSBA 5LJ5e 1NJIU 4M75D 1Z9ZA 1HD3A 2KE9A 5LJ3d 2KK4A 1UHCA 4LD9K 2BE9B 3CMEA 1JXMA 4M75F 5KYUA 4KH0B 4C92E 4PLLA 1WQWA 2DZ9A 3S3NA 3M54A 2RPNA 2I0NA 1ZUYA 2VKNA 1RI9A 2JXBA 1Y07A 3EG9B 1V1CA 3ULRB 4NL2A 3I55A 1VQMQ 3G6EA 3CCRT 3TQ7P 5ECAA 1J3TA 4CI0C 1FXXA 2RI2A 2DL5A 1BB9A 3VS7A 4M78D 2V8IA 3CPWA 4E7LA 1SRLA 3ER0A 4LN2A 1U3OA 1B34A 3NGPA 2EQMA 4OGCA 1HJDA 3I9QA 4A53A 5FU7C 4M78F 5CIUA 3OYAA 1K0XA 1JU5C 4B6MA 2CP0A 4J6YA 3HTRA 1NPPA 3M0RA 5GANj 2RQRA 4XQ3A 3SHWA 4O6JA 1VQOT 2EGCA 2OTJT 2E70A 2M9UA 2HDAA 3EGDB 2A37A 1XNIA 2P0QA 1QLYA 4C5IA 2O4XB 2DYBA 5GAMj 4Z89A 2F2XA 2FL7A 4X9DA 1OZ2A 1YJWQ 2VGMA 4HT9A 3UATA 1YIJQ 1OU8A 3INZA 1BI2A 5FW9A 4DEXA 1SKUB 2XDPA 2CZ1B 3EG2A 2HBPA 3ASKA 2W0ZA 2VXFA 1D09B 2RM4A 4F04B 2GQVA 2KT1A 4M7AB 4E6RA 1WXTA 3UDCA 2D1XA 3A8GB 1N8RR 3JAME 1R0BG 5KYXA 4IUTA 3RKXA 2NUTB 1I0CA 2RJCA 2JUFA 2F1LA 3M56A 3KXTA 1TSFA 1VQ5Q 2J7IA 2VUBA 4ZTFA 3FJPA 3G4SQ 1K73R 4Y91A 5KYYA 3V8JA 4HA8A 4FYWB 1G3WA 4LE9A 1VA7A 4DOWA 4GBQA 4C92C 1VQLT 2F69A 4KH1B 3OQ5A 1KJWA 1QWFA 1Q81U 3VKIA 1W4SA 1VQ4A 1MNDA 2M0OA 1PKSA 1UECA 2A7YA 3LYIA 1C0MA 2EAYA 4PK4A 1NJIC 1PG5B 2RJFA 5KCHA 2YRVA 2DL4A 4E7HA 2BKDN 3M53A 1A0NB 9ATCB 2QQRA 4HCZA 2F5KA 2RQUA 3V7RA 1UEBA 1VQKA 2YXYA 3L2UA 2EQKA 2CSIA 1X75C 2DM1A 3HRSA 4RTZA 3J80E 2AZSA 4C0ZA 4C0DC 3OBYA 2ZCFB 2PQWA 4ME7A 3O5ZA 4HCBA 1IGUA 2GFUA 4MZPA 2O88A 3HFOA 3M0PA 3RBBB 2Y90A 1WGSA 4BI3A 4J83A 1O9SA 4E7KA 5GANe 2F2WA 4J6WA 5CKFA 1YJWT 4KGZB 1TWBA 1YIJT 4C92D 2R58A 2AK5A 5GAMe 1QP2A 3M4GA 3P8DA 2QQ9A 2L3RA 4C92F 4OB0B 4XTVA 2LNHB 3CC2A 2QGGA 3MHXA 4HT8A 4IKFA 3DLLA 2RD1A 2VYTA 1UGQB 4NOYA 1BI1A 3OYFA 2HQHA 3SWNC 2EJGA 1VQ5T 1WNLA 3EFSA 3G4ST 3A8OB 4C8QG 1GL5A 5CK9A 4BDZA 3A8MB 3VRYA 4M7DG 3HL8A 1H3HA 1BI0A 2QASA 4X1VA 2QDYB 2E3IA 3OSVA 1QP3A 4MDXA 1WXUA 2LMJA 4OB2B 5IHIA 4PKCC 4J9EA 3KUFA 3X25B 5GAN4 1ZQ1A 3G6EQ 1GCQA 1I5LA 4C8QA 1M27C 3M59A 1XQHA 2EPDA 1WHJA 4KUIA 2CYZB 3X24B 4M7DA 3ZEHA 1MMDA 5A0DA 1LJOA 5A0GA 3EG3A 4XTUA 1G3SA 2ENMA 1UDLA 3CCUQ 1QCFA 2Y4YA 1KHCA 2J6FA 2L2PA 2FYKA 2VASA 2P84A 2COYA 1Q81C 1T3LA 1R8OB 2MK5A 5D6XA 2C0TA 1RADB 4J6XA 5IHKA 4D6WA 2OTJA 1JXOA 3MPUB 1ZSZB 8ATCB 4QW2A 4M77B 1JBMA 2JT4A 3BDUA 5GAN5 2VVKA 5FWCA 4PJOG 1YNZA 2DD5A 3MJXA 1M2VA 2X4XA 4BD3A 5L8RE 1K8AR 1FMVA 2RO0A 4FSXA 4M7AE 1Q82R 3PMIA 4J5YA 2F5TX 5IAYA 1OV3A 3CXCA 3OYKA 2LC4A 2RK2A 3TREA 1N9RA 6AT1B 1BIBA 3JSCA 2D0QB 2FZCB 3EFRA 4OMFB 4PJOA 3M0UA 1E7OA 2HL5C 2JM8A 3QZ5B 3OW2P 1MMNA 1IREB 3OYLA 2MIOA 1H8KA 1IZ6A 3WXMB 1WA7A 4FYYB 3MEUA 4KT0E 5IH2A 4KBMB 1ZBXA 5AYFA 1BCMA 1RI0A 1YHQQ 4HCCA 1OYXA 3QJ6A 2EYYA 2AZVA 1VQ6A 2XI9A 4EMKB 1X01A 4F7UF 2EWNA 1V76A 4FSSA 1X69A 1VQMA 1AD5A 1WHLA 1VQ4Q 3G6ET 4PJNA 1OOTA 3RIRA 1RAEB 2NWMA 4IURA 1KD1R 1VQNA 3L2QA 4RMOA 2A28A 2EQIA 4VUBA 4ORZA 1VQKQ 2J05A 3E9FA 5D6WA 3S3OA 1K9MR 2EYWA 2ZGWA 3QZ9B 2DLPA 3SD4A 2E5KA 2COZA 1BYMA 5KYWA 5GAOn 2KBTA 1D1AA 3HRUA 1JO8A 3NMZC 1UGPB 3GBQA 2BIVA 1H92A 4B9WA 2XG8D 1YIJA 1UB4A 2CP2A 3FIFA 3FC3A 1GXIE 2M16A 2HBWA 2KROA 3OBWA 3VS4A 3PIOA 1Y96A 1EIFA 2YUOA 4FW2A 2NUPA 1BBZA 1YJ9A 3CC2Q 1KQ2A 2E64A 2RB6A 2FB7A 1U1SA 4JS5A 2COWA 5KE3A 2LZ6B 2MYSA 5CAIA 1M3BA 2FPFA 2YLCA 2RI5A 2JMAA 4J9DA 2F2VA 2HZYA 1VQPA 4R0KA 3JCMg 2Y4XA 4EPCA 1PKTA 5IXFA 2LNVA 1QCNA 1Y57A 2QQSA 2VXEA 3KFVA 1YHQT 1K0SA 3GOXA 3PTAA 1XJWB 2AT1B 1U5SA 2HQEA 4QQ6A 2V8KA 2KDSA 2HQXA 1ZBJA 1JJ2P 2NUZA 3PNWC 5IHNA 1VQ4T 4BE0A 1N6AA 2LCLA 1T0HA 1I81A 5I22A 2LQWA 2PVDB 3JCMP 1G2BA 2PVGB 3OYBA 5KCOA 1M8VA 4PJMA 3CCSA 1PCXA 2E5QA 1VQKT 1B07A 4M7AD 2OI3A 2HSEB 4OMPA 4AG2C 2ZAEA 2DKGA 1NYGA 1KQ1A 4M7AF 3VRZA 4M77E 1GBRA 1NEGA 2L8DA 4MMKA 1QVFP 2KQWA 3GLXA 1FWZA 5I21A 4J7IA 2XIDA 2L3SA 3CPFA 1PC0A 1QW1A 4RCBA 4WF2A 3PGGA 2MCNA 4C8QE 3VYHB 1VQ8A 2EYZA 5I2MA 2FZKB 1RL2A 2X4YA 4A54A 3GNGA 2O9VA 3EH2A 3CC2T 2RN8A 1NJIR 1E6HA 1W2BA 4M4ZA 1NM7A 5CCAA 2GFAA 2BTTA 4AFQC 2RH2A 1IHVA 3OS5A 2LQ8A 1MV3A 4EMHA 5GMKm 4Z8AA 2D6FA 1ARKA 4RTXA 2RHYA 2DL3A 4B9XA 1E6GA 2FHDA 2DERA 1H3ZA 3GP8A 4C5HA 3LLRA 4CC4B 5GANf 2NLUA 4QVDA 1YP5A 4L59A 3MP6A 4PNOA 5L23A 2ROTA 1VQ6Q 2ZPGB 4JRQA 3DB4A 3I5RA 4FW1A 4C0FA 5FWBA 1AZGB 2RK1A 3L42A 1N9SA 5GAMf 2K7AA 1RUWA 4OMLA 3LH0A 2DA9A 3LWHA 4AG1C 5HCKA 5LJ5g 4QVZA 3PMTA 1VQNQ 3DB3A 5GMKh 2RJEA 2PZ1A 2D8HA 1QKWA 3CCUA 2JN0A 3EG1A 3M0TA 4V2SA 5LL6S 4E7ZA 2X51A 2X4WA 4JLGA 2RHUA 2KAFA 2ED1A 2EQUA 2GQIA 2LQKA 2LCCA 5KYUB 3LWIA 3MEVA 1ZSZC 4HVVA 4Z88A 4M77C 1N27A 4ESRA 5GANd 3OYDA 3FLGA 2DZCA 3OYNA 2E3HA 1B7TA 1QKXA 3JB9H 1K9AA 4II1A 3BY7A 2NUTA 1IO6A 2MWOA 2BZYA 1OZ3A 5GAMd 4ZN1A 3OYCA 1UE9A 1KFZA 1B3QA 3WVDB 2V26A 2RI3A 3JCMX 3WVEB 5GAOp 2PUOB 1YJNA 1CKBA 2QEXA 1B34B 1YJ9Q 4HVWA 4BY6B 3QPHA 4M75G 3OYIA 2CZ6B 4QT7A 1H641 4MZMA 1C6VX 1ZX6A 1JRIA 2QDLA 1ABOA 3OW2S 1VQPQ 1QVGS 2M51A 2DAQA 3CCMA 3C0CA 1KQSS 3VV0A 4ZGJB 1MMGA 2R5MA 4LUEA 2RQWA 1YHQA 2IPOB 1SHFA 1Y71A 4M77D 3GIBA 4M75A 4EMKC 1OX8A 3H0FA 2DD4A 4BE1A 1VQ6T 2PNIA 3JB9D 2GTOA 3P8HA 4M77F 1VYVA 3QDRB 1N8RU 2DRKA 8AT1B 1VQMT 4RTWA 4M78G 2VB6A 3JB9F 2X3WD 2K5FA 5CVIA 4BI4A 2QA4A 2EJ9A 3THKA 2DRMA 3H0IA 4PFPA 1VQNT 1MGQA 3CCSQ 4Y28E 3RERA 1LVKA 4DQ2A 1OPKA 2IVWA 5LJ3g 5KYXB 1P92A 5GAN7 2QG9B 4N4HA 2J06A 4OF1A 1TXQA 1PRMC 2QYZA 3HPWA 1KC8R 3LX7A 4R56A 4M78A 1VUBA 2RQVA 2D0NA 4J9GA 2HKQB 4ZGDB 3I56A 4J9CA 3VS6A 1LCKA 1TUCA 2FPDA 3QJYA 1AEYA 2JTEA 1M3CA 4LXCA 1OULA 2CREA 2NYSA 4J7FA 2EFIA 2K79A 5I2SA 3H41A 1X6GA 3O8VA 2V1RA 2QK0A 2MI6A 4ELYC 4IUPA 2OX7A 2DF6A 3OYMA 1VQ8Q 2LX9A 3C4SA 3CEYA 4KUDK 1WHHA 1YBYA 3UT1A 3JCMh 4AFUC 5GMKl 1G5VA 2K6DA 1ZA1B 2FEIA 3CQTA 3OYHA 1YJ9T 1WHMA 2GBQA 3X26B 5HY6A 3CD6Q 4IIMA 3RESA 1IRXA 2LJ3A 1WHKA 3HFNA 4ZTJA 4L6V5 1KIKA 1KHIA 3HRTA 4YTLA 4RTVA 1WFWA 3X20B 2CT3A 4N4GA 1U1TA 5GANg 3CCLA 2IIMA 2IG0A 1VQPT 2K5LA 1TTHB 3QYHB 2JTFA 2DE0X 3URGA 1VYTA 2QQBA 2VGNA 2L3PA 1SEMA 1M90U 4J9IA 1PSFA 4PLIA 1X6BA 2JOYA 1NYFA 5D6YA 2MF2A 1OX9A 1Y0MA 2DXCA 2DPPB 4HCKA 3V8LA 1PRLC 1HSQA 2JS0A 1G8XA 1PM3A 1S1NA 2BZ8A 1AWOA 1YFNA 3OS2A 3SB2A 1ZSZA 3A5ZB 1JJ2S 2KYBA 2ZPBB 4ZGEB 4HKEA 4PFOA 2RHIA 2DNUA 3CCST 2M02A 2LRQA 1OEBA 2K9GA 4DEYA 3SFMA 3MP1A 3EAEA 4PL6A 3E9GA 4WCIA 3L1AA 2LJ1A 1D1CA 1VIFA 1NG2A 3M5AA 3CCJA 3JV3A 1D1BA 3H6ZA 3G71A 5DLOA 5FU7B 1QVFS 1NPRA 4D8KA 5GAOq 4C92G 2J6OA 3CCEA 4RTUA 4C5GA 5J3BA 2QQAA 1UG1A 1VQ8T 1IB8A 3AHUA 1SPKA 2P4RA 4JJDA 3OS1A 3CC4A 4JLIA 4C8QB 4KGVB 3RUXA 3G1JA 1FX7A 3E1SA 3E2UA 5FRMA 4M7DB 1PWTA 1YJNQ 2E1HA 2QEXQ 2JZ2A 3REAB 3FB9A 3MEWA 4EMKA 2OTLQ 1AWWA 4FT4A 3SDZA 4C92A 2CH4A 2FZGB 2AKLA 1QVGP 1SF9A 1KQSP 1YWPA 3VYGA 1G3TA 1N5ZA 2O01E 4IUVA 2XD0A 1LOJA 2X35A 2PU9B 4IUUA 2ED0A 2GCXA 1LNXA 2ZPHB 1K8AU 4AMCA 1M2OA 3CCMQ 2XKOC 5LJ5h 2EVRA 2LQNA 4RTYA 2XMFA 2PTKA 3A8HB 4MDWA 2DL7A 2QXFA 4Q5WA 2X4JA 3LH5A 3OYEA 1M2VB 4PJLA 4CC2A 1S72A 5CKEA 2LDMA 1Q86U 1VQ9A 3H9NA 2BZXA 2LX7A 2AIRB 1OU9A 1YI2A 4J9HA 2QI2A 5DY9A 1NZ9A 2QA4Q 1UGSB 2HEQA 1AWXA 4KRTA 2GGRA 1NE8A 1C1AA 1M90C 1MUZA 5HK0A 3M4YA 4MMLA 4F14A 4PJOB 1GFDA 2KY9A 3LW5E 4GLKA 5KE2A 3CCUT 4FT2A 2K5IA 5FU6B 2WSCE 2VC8A 3M58A 3M55A 3CPWP 2ABLA 2CH4W 2D8JA 1UGRB 1MMAA 5CQYA 4MZTA 2VWFA 3I56Q 3EGXB 1RABB 2DMOA 4BUGA 4X34A 1GCPA 3OMGA 2DXUA 2LT1A 1I07A 3JCMb 1U06A 2KYMA 2XDDA 2FRWA 1KD1U 2KGTA 2RJDA 1WI7A 2MMPA 3SWNA 4RCCA 1BIAA 4OMMA 2MWPA 5KH6A 4C0GA 3EHQA 2L3QA 2DBMA 4DA4A 3J7AF 2YUNA 1M1KU 1WQ7A 4RG2A 1UFFA 2PUKB 3KBGA 2RHZA 5D7UA 2QEXT 1YJNT 2A0FB 1ABQA 4M7AC 4GY5A 2E6ZA 2OTLT 4BY6C 3N5BB 3ZBDA 4M78E 4AT1B 5GMKi 4KGXB 1ZLMA 2EYXA 2YRCA 1TH7A 1OI1A 1BK2A 3CCLQ 2E41A 2JMCA 2K3YA 4F7UG 1FMWA 3CCMT 2DBKA 2LP5A 3CBOA 2P0KA 5KYWB 1D3BA 2AKKA 3VS3A 1UUEA 1WDXA 5LJ3h 2CP5A 1Q7YU 2YLBA 3F70A 4BE2A 3TEEA 4C5EA 3OA6A 2EJFA 2DVEA 1Y96B 4QKUA 2CZ7B
chains in the Genus database with same CATH topology
1KC8C 4F7UA 5LL6S 3NFCA 1YIJT 2X4WA 2QA4T 1I8FA 4JLGA 2RHUA 2KAFA 4C92D 1G3YA 3OYYA 2I2LA 2EQUA 2R58A 3M57A 2WACA 2E10A 2LCCA 2LQKA 3JCMc 3LWIA 4ATOA 4L5GA 5GAMe 1QP2A 3MEVA 5CO7A 3M4GA 4A4KA 3P8DA 2QQ9A 2L3RA 4M77C 1N27A 3LGFA 3OYDA 4C92F 5GANd 3MEAA 2LVMA 2V8JA 3FLGA 4OB0B 4XTVA 3CMET 2DZCA 3OYNA 1U8RA 1DJ7B 3CC2A 3MHXA 4HT8A 4A4GA 3JB9H 4IKFA 4II1A 3BY7A 3DLLA 2MWOA 3UWNA 2RD1A 4ZN3A 5CR2A 2VYTA 1Q86C 3H8ZA 1OZ3A 5EG2A 1UGQB 5GAMd 1Q82U 3CCVA 3G7ZA 4NOYA 4ZN1A 3OSSC 1BI1A 3I56T 3OYCA 3OYFA 5DM7R 3UPUA 2DTIA 2KMTA 4C92B 3JCMQ 3SWNC 1VQLA 2EJGA 3WVDB 4XU2A 1QVPA 1PSEA 3OY9A 1VQ5T 1WNLA 3EFSA 2RI3A 3JCMX 3WVEB 5GAOp 1YITA 2PUOB 5GAN3 3G4ST 4XAXB 3A8OB 4C8QG 5GAN6 4ELZC 3I55T 2QEXA 1YJNA 2E65A 1B34B 5CK9A 3J81E 4BDZA 3A8MB 2ZPEB 5M9OA 2JTMA 2DXTA 4BY6B 4M7DG 3HL8A 2DJZA 3QPHA 4M75G 3CC7T 1BI0A 4XTYA 3OYIA 2CZ6B 1WPYA 4M7DE 4M75E 2BUDA 1H641 2QDYB 3V7CA 3OSVA 1QP3A 4MDXA 4MZMA 4NS5A 2K57A 4OB2B 3QO3A 4JUVA 5J39A 1JRIA 4PKCC 3FEOA 4CRIA 3OW2S 3QXEB 4OGEA 4O5VA 1QVGS 2DAQA 5LJ5f 3CCMA 3KUFA 1KQSS 3X25B 3CD6A 5GAN4 1ZQ1A 1I5LA 4C8QA 4C0DB 5GAOr 3VV0A 5A2QE 3M59A 4OP0A 4ZGJB 2R5MA 1YHQA 1M1FA 1XQHA 2L89A 4XTZA 1M9SA 1Y71A 1KD1C 4KUIA 2CYZB 4M77D 3QYGB 3X24B 2JVVA 2ZPFB 4M75A 3ZEHA 4EMKC 4JRPA 3GIBA 2DD4A 3R6OA 2DIGA 4FL6A 4BE1A 5A0DA 1VQ6T 1LJOA 5A0GA 3JB9D 4XTUA 5IN1A 3Q1JA 1G3SA 5FROA 3OW2A 1K9MU 3CCLT 3P8HA 4M77F 3QDRB 4NL3A 2Y4YA 2RHXA 1N8RU 1KHCA 1KQSA 1VQMT 3QUIA 1M1KC 3L2ZA 4M78G 3JCMe 1V29B 1X6OA 2K2VA 4XTWA 4JRIA 1YJWA 1VQ7A 2CKKA 2FYKA 3JB9F 5LJ3j 2K5FA 5CVIA 4FU6A 4BI4A 2EJ9A 2QA4A 3TU4K 1Q81C 5FRNA 1R8OB 2E6NA 5D6XA 4J6XA 2RA2A 4D6WA 3CCUT 1VQNT 2OTJA 1MGQA 2EQJA 4Y28E 2DXBA 3RERA 4DOVA 4J8OA 4DQ2A 4QW2A 4M77B 1JBMA 3RKYA 2IVWA 3CCQT 5LJ3g 5LJ5j 4UC4A 3GPLA 1P92A 3BDUA 5GAN7 5GAN5 1O75A 4E7IA 4N4HA 3CXCS 3VUBA 1KG1A 3OYJA 4OF1A 4N0AC 3ZFJA 4PJOG 5A0LA 3M9QA 4BB7A 1VIEA 3HPWA 5CKBA 3LX7A 4R56A 2DD5A 2H3JA 4M78A 1VUBA 4PJOE 2X4XA 5LJ5d 2O4XA 4ZGDB 3I56A 4BD3A 4M7AG 5L8RE 2RO0A 2PVOB 3S3MA 2AHJB 3QJYA 2MAMA 4FSXA 3SWNB 1VQ5A 4M7AE 3META 3PMIA 4N4IA 4TVRA 4J5YA 1XOVA 2WSFE 2F5TX 3PT9A 5IAYA 3G4SA 4J7FA 2EFIA 3CXCA 4BACA 3OYKA 2LC4A 5I2SA 5GAN8 2RK2A 3O8VA 3TREA 1Q7YC 1N9RA 3X28B 2B8AA 1BIBA 2MI6A 3JSCA 1HXDA 4ELYC 2D0QB 4IUPA 3CC7A 2A3LA 2DTHA 3EFRA 2ZPIB 4OMFB 4PJOA 2D9TA 3OYMA 3CMAT 5GAOm 2LX9A 3QZ5B 3C4SA 3CEYA 2K4YA 3LGLA 3CCJT 4BDYA 1K8AC 1IREB 3OYLA 4KUDK 1YBYA 4V2SA 3JRZA 3UT1A 3JCMh 5CKHA 3RMQA 1WJSA 1M1GA 3G71T 5GMKl 3OS0A 4M7AA 4P5NA 1IZ6A 4JRKA 3E19A 3WXMB 1Q82C 1G5VA 3MEUA 4KT0E 3C95A 3L2VA 2M1HA 3OYHA 1YJ9T 3X26B 4KBMB 5HY6A 2DO3A 1ZBXA 3RESA 3CCET 3NTIA 5AYFA 3HFNA 3MO8A 5CKDA 1RI0A 4L6V5 4ZTJA 1KHIA 4HCCA 1OYXA 2R5AA 3QJ6A 3CC4T 3HRTA 4YTLA 2XHCA 4C8QC 4EMGA 2XI9A 4EMKB 1VQ6A 2KVQG 3X20B 3DKMA 5FLXE 3ME9A 4LD6A 4N4GA 1X01A 1U1TA 1D3BB 4F7UF 5GANg 3CCLA 2EWNA 2QTXA 2IG0A 3CBPA 1ZHIA 3QIIA 4M75C 4M7DC 3CBMA 1VQPT 2DIQA 2WSEE 2K5LA 1VQMA 3QYHB 2JTFA 3URGA 3G6ET 2CS7A 2LT4A 2OTLA 2QQBA 2VGNA 1M4ZA 1SSFA 1M90U 1Y7XA 3VUZA 1PSFA 3RIRA 3OYGA 1AHJB 1XTDA 4IURA 4PLIA 5DLQE 5LJ3f 3L2QA 1VQNA 2JOYA 4RMOA 5D6YA 5GANh 2MF2A 2DEQA 4XK8E 4F7UB 2G3RA 2DXCA 2DPPB 3T9NA 4VUBA 3CCQA 3V8LA 4R55A 4QVCA 1JB0E 3VU3C 3GNFB 4FIBA 3V8KA 3E9FA 3QG1A 5D6WA 5GAMh 3S3OA 1W2BS 3QSUA 3P8BB 3OS2A 2HD0A 3SB2A 3A5ZB 1JJ2S 2ZGWA 2ZPBB 4ZGEB 4HKEA 3S6WA 2RHIA 2LTOA 5GAOl 3QZ9B 5C0MA 3CCST 4Z02A 2VV5A 2LRQA 2OAUA 4M78C 4XU0A 3SD4A 5HK3A 3JB9I 1S72T 3OB9A 1VQ9T 1QVGA 3PIPA 1BYMA 5GAOn 3SFMA 2JNGA 3MP1A 5LJ3e 3HRUA 1UGPB 3VJPA 3EAEA 2BIVA 1JJ2A 4PL6A 3E9GA 1YI2T 4B9WA 3L1AA 2XG8D 5GMKj 4QQDA 1UB4A 4C8QD 4E47A 1YIJA 3FIFA 1K9MC 3CMAA 5HKCA 3FC3A 1VIFA 3M5AA 2CZ0B 3CCJA 1K73U 2M16A 1GXIE 3OBWA 3HSBA 4XU3A 5LJ5e 4M7DD 1NJIU 4M75D 3H6ZA 3G71A 3PIOA 4C8QF 1Y96A 4PJOC 1EIFA 4LD9K 5LJ3d 2KK4A 5DLOA 3CMEA 5FU7B 1QVFS 3DLMA 1NPRA 5FU6C 3QKJA 5GAOq 2P4TA 1YJ9A 4C92G 4M7DF 4M75F 1KQ2A 3CCEA 2XU8A 2E64A 2RB6A 2FB7A 3BW1A 4C92E 4PLLA 1U1SA 4C5GA 1MHNA 1WQWA 2QQAA 2DZ9A 5J3BA 1VQ8T 3AHUA 4JS5A 3M54A 3OS1A 5GAN2 5KE3A 3S3NA 3CC4A 5CAIA 5J26A 4JLIA 4C8QB 3QHSA 3CPWS 4OB3B 2YLCA 4LDXA 3RUXA 2RI5A 3V7SA 1FX7A 1Y07A 3E1SA 5FRMA 4OVAA 1QVFA 1VQPA 3JCMg 4M7DB 2Y4XA 4M75B 4NL2A 3I55A 2E1HA 3HP9A 2C06A 2JZ2A 4EPCA 3RKWA 3G6EA 3CCRT 1WJRA 3FB9A 2LNVA 4A4FA 3MEWA 4EMKA 4F7UE 2DK3A 4FT4A 2QQSA 3SDZA 2VXEA 4C92A 4CI0C 1FXXA 2RI2A 1YHQT 3HKSA 4M78D 3GOXA 3PTAA 2V8IA 3BFMA 3CPWA 4E7LA 3JCMJ 3ER0A 2HQEA 4QQ6A 1B34A 2V8KA 2EQMA 2KDSA 4OGCA 1KC8U 2HQXA 3MCAB 4A53A 5FU7C 4M78F 4RG8A 1G3TA 2O01E 4IUVA 4XU1A 5CIUA 3VYGA 3OYAA 2XD0A 1LOJA 2X35A 2YHTA 3PNWC 2PU9B 4IUUA 4J6YA 1N6AA 2LCLA 4BE0A 1VQ4T 1NPPA 2GCXA 1LNXA 2ZPHB 1K8AU 1I81A 4A4HA 1VQ7T 2XKOC 5LJ5h 2K3XA 5GANj 2PVDB 3JCMP 5C6SA 1H3ZA 2PVGB 3OYBA 3JCMW 5KCOA 4XQ3A 1M8VA 4O6JA 4PJOD 1VQOT 3CCSA 3A8HB 2OTJT 2E70A 2M9UA 2QXFA 4IUQA 2E5QA 4MDWA 2X4JA 4Q5WA 4BI8B 4M78B 2HAXA 4N0AA 1XNIA 3OYEA 1VQKT 2P0QA 4C5IA 1S72A 2O4XB 2LDMA 5CKEA 5GAMj 1Q86U 4PJOF 1VQ9A 4M7AD 2FL7A 2XICA 3BDLA 2HNIA 4X9DA 2R57A 1OZ2A 1HK9A 4M77G 2DKGA 1YI2A 1KQ1A 4LDYA 2QI2A 5DY9A 2VGMA 4M7AF 4HT9A 4KULA 1NZ9A 4M77E 3JB9G 1UGSB 5GAMg 2L8DA 3INZA 1BI2A 4MMKA 3TCJA 2KQWA 3GLXA 1NE8A 1FWZA 4JS4A 5I21A 1M90C 4J7IA 2XIDA 5HK0A 3M4YA 4MMLA 2XDPA 3CPFA 4PJOB 3FDRA 2FVUA 2CZ1B 1BI3A 1QW1A 2KY9A 3LW5E 2HBPA 3ASKA 4GLKA 4RCBA 4FT2A 4WF2A 5KE2A 2VXFA 4JJNK 2K5IA 5FU6B 2RM4A 2WSCE 3JCMV 2GQVA 2VC8A 3M58A 3PGGA 3M55A 4M7AB 2GF7A 4EDUA 4C8QE 3VYHB 1UGRB 3UDCA 1VQ8A 4M77A 5CQYA 3A8GB 3JAME 3PFSA 4MZTA 5I2MA 5IT9E 4IUTA 3JCMf 2XDBA 3RKXA 4A4EA 4OB1B 1RL2A 2P0PA 2ZZDA 3M56A 2RJCA 2JUFA 3L2WA 4BUGA 4X34A 3KXTA 3OMGA 3MP8A 2DXUA 2LT1A 2X4YA 2XK0A 2VUBA 3GNGA 4A54A 4ZTFA 3JCMb 3FJPA 3HHTB 4LDVA 2KSSA 4Y91A 2XDDA 1KD1U 5GMKe 3CCRA 3CC2T 1W2BA 3V8JA 5CCAA 4HA8A 2GFAA 2CGHA 1G3WA 2RJDA 2MMPA 3SWNA 4RCCA 1BIAA 2RH2A 2MWPA 3C12A 3QBYA 1BKBA 3OS5A 4C0GA 5KH6A 3CCVT 1N8RC 2EYQA 2L5QA 4DA4A 4RKUE 3J7AF 2LQ8A 4DOWA 1M1KU 1WQ7A 4C92C 2E12A 4X9CA 4RG2A 4EMHA 5GMKm 2PUKB 3KBGA 2RHZA 1VQLT 2F69A 2D6FA 3OQ5A 1Q81U 1YCYA 1YITT 3VKIA 1W4SA 2RHYA 2QEXT 2M0OA 1VQ4A 2DTOA 1YJNT 1K73C 1M5Q1 2A7YA 3LYIA 4M7AC 1NJIC 2EAYA 4JDSA 4XTXA 3NTKA 4B9XA 2RJFA 2E6ZA 1I4K1 2FHDA 4GY5A 5KCHA 2OTLT 2YRVA 3N5BB 3GF5A 3ZBDA 4BY6C 4E7HA 3GP8A 2BKDN 4M78E 4FM4B 4C5HA 3M53A 3LLRA 3A8LB 5GANf 4QQGA 2NLUA 5GMKi 4QVDA 1VQOA 4L59A 3MP6A 4PNOA 2QQRA 3JB9J 4LDUA 2ZPGB 2F5KA 4HCZA 3V7RA 1TH7A 1UEBA 3RMSA 1OI1A 2EIFA 4JRQA 1VQKA 3DB4A 4C0FA 1WJQA 3L2UA 2EQKA 5CQXA 1X75C 3JCMd 3HRSA 3OMCA 2RK1A 2E41A 4M7DA 3L42A 2K3YA 4F7UG 1N9SA 5GAMf 3J80E 3CCMT 3CD6T 4E7JA 4C0ZA 4C0DC 4LDWA 3CBOA 3FRNA 3NTHA 3LH0A 3OBYA 2ZCFB 2P0KA 2PQWA 3C94A 3LWHA 4ME7A 1D3BA 5LJ5g 4QVZA 4HCBA 2GFUA 4MZPA 3PMTA 3DB3A 5LJ3h 5GMKh 2RJEA 3HFOA 1Q7YU 2Y90A 2YLBA 3F70A 3L2RA 1WGSA 4BI3A 3CCUA 4BE2A 4J83A 1O9SA 2EKOA 3TEEA 4E7KA 4C5EA 3OA6A 5GANe 2JN0A 2EJFA 4J6WA 2DVEA 5CKFA 1Y96B 2CZ7B 1YJWT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3INZ A;  4MMK A;  4XU0 A;  4F7U A;  5GAN 5;  3JB9 I;  4N0A C;  1I8F A;  4PJO G;  4C92 D;  5I21 A;  2I2L A;  4MML A;  5GAO n;  4PJO B;  5LJ3 e;  2E10 A;  4M78 A;  3JCM c;  4PJO E;  5GAM e;  4RCB A;  4WF2 A;  3M4G A;  5LJ5 d;  2VXF A;  4M77 C;  3JCM V;  2RM4 A;  4M7A G;  3L1A A;  5GMK j;  4C92 F;  4C8Q D;  5GAN d;  2VC8 A;  3PGG A;  3FIF A;  4M7A F;  4M7A B;  4XTV A;  2DZC A;  4C8Q E;  3SWN B;  4M7A E;  4J5Y A;  4HT8 A;  3HSB A;  4XU3 A;  4M77 A;  5LJ5 e;  3JB9 H;  4M7D D;  4M75 D;  4PJO C;  4C8Q F;  1Y96 A;  3BY7 A;  5GAN 8;  3JCM f;  5LJ3 d;  2RD1 A;  3RKX A;  1N9R A;  1BIB A;  5GAM d;  1HXD A;  4NOY A;  5GAO q;  4C92 G;  4M7D F;  2DTH A;  2DXU A;  4M75 F;  3EFR A;  4A54 A;  1KQ2 A;  2DTI A;  4PJO A;  4C92 B;  3JCM Q;  3SWN C;  3JCM b;  2EJG A;  3FJP A;  5GAO m;  2E64 A;  2RB6 A;  2FB7 A;  3BW1 A;  4XU2 A;  1WNL A;  1U1S A;  3EFS A;  4Y91 A;  1WQW A;  4C92 E;  2DZ9 A;  5GMK e;  3JCM X;  5GAN 7;  3V8J A;  4V2S A;  5GAO p;  3AHU A;  3JCM h;  4HA8 A;  5GAN 2;  5GAN 3;  4C8Q G;  5GAN 6;  4M7A A;  5GMK l;  5CAI A;  2CGH A;  2E65 A;  1B34 B;  4JRK A;  3SWN A;  4RCC A;  4JLI A;  4C8Q B;  3QHS A;  1BIA A;  2YLC A;  3RUX A;  2DXT A;  3V7S A;  4M7D G;  2DJZ A;  4M75 G;  1WQ7 A;  4C92 C;  3JCM g;  4X9C A;  4XTY A;  4EMH A;  4M75 B;  1WPY A;  4NL2 A;  3RES A;  5GMK m;  4M7D B;  4M7D E;  2E1H A;  4M75 E;  3HFN A;  3RKW A;  1H64 1;  1YCY A;  3FB9 A;  3V7C A;  4EMK A;  4F7U E;  4C92 A;  2DTO A;  2K57 A;  2VXE A;  4C8Q C;  1M5Q 1;  4EMG A;  3QO3 A;  4JUV A;  4EMK B;  4M7A C;  2EAY A;  1JRI A;  4XTX A;  1I4K 1;  4M78 D;  3BFM A;  1X01 A;  1U1T A;  1D3B B;  4F7U F;  5GAN g;  3JCM J;  5LJ5 f;  4M78 E;  2EWN A;  2QTX A;  4M7D C;  5GAN 4;  1B34 A;  4M75 C;  1I5L A;  4C8Q A;  5GAN f;  5GAO r;  5GMK i;  4QVD A;  4OP0 A;  4PNO A;  4M78 C;  4A53 A;  4M78 F;  3JB9 J;  4XU1 A;  4XTZ A;  3V7R A;  1TH7 A;  1LOJ A;  2YHT A;  4M77 D;  4J6Y A;  3GIB A;  3RIR A;  4M75 A;  4M7D A;  4EMK C;  1LNX A;  3JCM d;  1I81 A;  5LJ5 h;  1LJO A;  2E41 A;  5LJ3 f;  5GAN j;  3JB9 D;  4XTU A;  4F7U G;  3JCM P;  1N9S A;  5GAM f;  5GAN h;  3JCM W;  2DEQ A;  4XQ3 A;  4F7U B;  4M77 F;  1M8V A;  4NL3 A;  4PJO D;  3V8L A;  3QUI A;  4QVC A;  3L2Z A;  4M78 G;  3JCM e;  1D3B A;  4XTW A;  3JB9 F;  4JRI A;  5LJ5 g;  3VU3 C;  2FYK A;  4M78 B;  4N0A A;  5LJ3 j;  2EJ9 A;  3V8K A;  5LJ3 h;  5GAM j;  5GMK h;  4M7A D;  3HFO A;  4PJO F;  3QSU A;  5GAM h;  4J6X A;  2Y90 A;  2RA2 A;  2YLB A;  2HNI A;  4X9D A;  3SB2 A;  1MGQ A;  2ZGW A;  1HK9 A;  4M77 G;  3RER A;  2DKG A;  1KQ1 A;  4DQ2 A;  5GAO l;  4M77 B;  1JBM A;  2JN0 A;  5DY9 A;  3RKY A;  2EJF A;  4J6W A;  2DVE A;  5GAN e;  5LJ3 g;  5LJ5 j;  4HT9 A;  1Y96 B;  4M77 E;  3JB9 G;  5GAM g;  3BDU A; 
#chains in the Genus database with same CATH topology
 2FRY A;  1IGQ A;  4F7U A;  2NUP B;  2QA4 T;  3ZL7 C;  3OYY A;  2I2L A;  3EFO A;  2E10 A;  3JCM c;  5CO7 A;  4A4K A;  1GBQ A;  2HMA A;  2CT4 A;  2LVM A;  2V8J A;  2CP6 A;  1U8R A;  3D7S B;  2LJ0 A;  3CCR Q;  2H8H A;  1Q86 C;  5CR2 A;  3CCV A;  3G7Z A;  3M0S A;  2DX1 A;  3OSS C;  4J9F A;  3I56 T;  1HYO A;  5DM7 R;  3CCJ Q;  2DTI A;  2LCS A;  1PD0 A;  4AFS C;  1PSE A;  3G71 Q;  1AWJ A;  2YUP A;  3FJ5 A;  1IXD A;  1YIT A;  4XAX B;  5GAN 6;  4ELZ C;  2E65 A;  1AOJ A;  2ZPE B;  2JTM A;  2DXT A;  1D0Z A;  7AT1 B;  3CCE Q;  1TUD A;  2DJZ A;  1X2K A;  4EIK A;  1WPY A;  3CC4 Q;  4M7D E;  1VQO Q;  2BUD A;  3V7C A;  1K4U S;  2KNB B;  1GFC A;  4LNP A;  1LPL A;  4NS5 A;  5J39 A;  3VS1 A;  4CRI A;  3QXE B;  4O5V A;  3CD6 A;  4DBH A;  5A2Q E;  1M1F A;  2QAZ A;  1AZE A;  4XTZ A;  1M9S A;  3EG9 A;  1KD1 C;  3QYG B;  2ZPF B;  3R6O A;  2JM9 A;  2DIG A;  4FL6 A;  1X27 A;  5IN1 A;  1WZO A;  1M3A A;  3OW2 A;  5IXB A;  3CCL T;  2RHX A;  1KQS A;  1M1K C;  2YUQ A;  3L2Z A;  2K2V A;  4JRI A;  4PFZ A;  2CKK A;  5LJ3 j;  4FCY A;  4FU6 A;  5FRN A;  1RAF B;  1ZSG A;  2MPX C;  2EQJ A;  2DXB A;  3VS5 A;  4DOV A;  2B86 A;  4J8O A;  3RKY A;  3IQL A;  4UC4 A;  3GPL A;  1S72 Q;  1RAG B;  1NLP C;  1WX6 A;  1VQ9 Q;  4E7I A;  3VUB A;  4N0A C;  3M9Q A;  1VIE A;  2KEA A;  4Y92 A;  1YI2 Q;  3EGD A;  2H3J A;  5GJW B;  4PJO E;  3A98 A;  2O4X A;  4M7A G;  2PVO B;  4F17 A;  3S3M A;  4E7S A;  1VQL Q;  4N4I A;  1XOV A;  2WSF E;  1JQQ A;  1Q7Y C;  1RAI B;  3CC7 A;  3NHN A;  1W6X A;  4K11 A;  3LGL A;  3CCJ T;  4BDY A;  3JRZ A;  1WJS A;  1MV0 B;  1M1G A;  3G71 T;  3OS0 A;  4M7A A;  4P5N A;  2E4H A;  1VYU A;  4CC3 A;  2ESW A;  2K2M A;  5EC7 A;  3TSZ A;  2M1H A;  2FG0 A;  2C0I A;  2DO3 A;  3CCE T;  3MO8 A;  2R5A A;  3CC4 T;  1GCQ C;  4C8Q C;  3RDV A;  2KRN A;  3DKM A;  5FLX E;  3ME9 A;  4LD6 A;  4HXJ A;  4OMQ A;  1YWO A;  1RLQ C;  3M0Q A;  3CBP A;  4M7D C;  1ZHI A;  3QII A;  2GTJ A;  2CS7 A;  2OTL A;  1SSF A;  1VQ7 Q;  1Y7X A;  3VUZ A;  3VS0 A;  2Z0W A;  1XTD A;  2O31 A;  1NEB A;  1EX4 A;  3CXC P;  2G3R A;  2EGA A;  3CCQ A;  3T9N A;  2DEU A;  4R55 A;  1PHT A;  3VU3 C;  2KRS A;  3QG1 A;  3QWY A;  1W2B S;  4JZ4 A;  3QSU A;  1Q81 R;  3S6W A;  5GAO l;  2HL3 A;  1KSW A;  4Z02 A;  2OAW A;  2OAU A;  2DFU A;  4XU0 A;  3UA6 A;  1ZUK A;  1S72 T;  1SHG A;  1RAH B;  1VQ9 T;  2EGE A;  1SRM A;  5LJ3 e;  2JNG A;  2RNA A;  1JJ2 A;  1EZZ B;  1YI2 T;  2W10 A;  2DVJ A;  5GMK j;  2CDT A;  4C8Q D;  4E47 A;  3I5S A;  3CMA A;  2KI7 A;  5HKC A;  3RNJ A;  2DIL A;  1K73 U;  4XU3 A;  4M7D D;  3SEM A;  2CSQ A;  2K3B A;  4PJO C;  4C8Q F;  2YSQ A;  2JW4 A;  4RUG A;  3DLM A;  5FU6 C;  3QKJ A;  2P4T A;  4M7D F;  1X43 A;  2XU8 A;  3BW1 A;  1MHN A;  1ACM B;  5GAN 2;  5KYY B;  3CCV Q;  5J26 A;  3CPW S;  3QHS A;  4OB3 B;  1NLO C;  4ZNX A;  4LDX A;  2SEM A;  2H3E B;  3V7S A;  1UJ0 A;  3QWX X;  4OVA A;  1QVF A;  4M75 B;  2DL8 A;  1YIT Q;  3EG0 A;  3HP9 A;  2C06 A;  1I1J A;  3RKW A;  1G83 A;  1WJR A;  4A4F A;  4F7U E;  2DK3 A;  1TOV A;  1X2Q A;  1GRI A;  4DBF A;  3HKS A;  3BFM A;  1PD1 A;  3JCM J;  2EBP A;  1KC8 U;  3MCA B;  4RG8 A;  1D0X A;  4XU1 A;  2YHT A;  4LUD A;  4A4H A;  1M8M A;  1VQ7 T;  2O9S A;  2K3X A;  5C6S A;  3JCM W;  4PJO D;  3U23 A;  4IUQ A;  1Z9Q A;  1M90 R;  2HAX A;  4BI8 B;  4M78 B;  4WTO B;  4N0A A;  2O2O A;  1I5O B;  4PJO F;  2JS2 A;  4JZ3 A;  2XIC A;  3BDL A;  2HNI A;  2R57 A;  1HK9 A;  4M77 G;  1D0Y A;  1KK7 A;  4LDY A;  2KXD A;  4KUL A;  3JB9 G;  5GAM g;  3TCJ A;  1CKA A;  4JS4 A;  3FDR A;  2GNC A;  2FVU A;  1BI3 A;  2EW3 A;  4JJN K;  3CME Q;  3JCM V;  2GF7 A;  4EDU A;  2KR3 A;  4DBR A;  2HCK A;  5GJV B;  4M77 A;  1BCO A;  3PFS A;  3REB B;  2YT6 A;  5IT9 E;  3JCM f;  2XDB A;  4A4E A;  4OB1 B;  2P0P A;  2ZZD A;  3L2W A;  4HVU A;  1NBE B;  3MP8 A;  2XK0 A;  1M30 A;  3HHT B;  4LDV A;  2KSS A;  3I55 Q;  5GMK e;  3CCR A;  4JPB W;  2HKN A;  2CGH A;  3CC7 Q;  3C12 A;  3QBY A;  1N8R C;  1BKB A;  2RMO A;  3CCV T;  1SSH A;  2EYQ A;  2L5Q A;  4RKU E;  1TUG B;  1W70 A;  2E12 A;  4X9C A;  1IHW A;  1TG0 A;  1W1F A;  1T0J A;  1YCY A;  1YIT T;  1K73 C;  2DTO A;  3NPF A;  1M5Q 1;  4AFZ C;  1CSK A;  4JDS A;  4XTX A;  3NTK A;  1I4K 1;  1K1Z A;  3GF5 A;  3RR6 A;  2HSP A;  4FM4 B;  1YCS B;  1VOM A;  1R0C B;  3A8L B;  4QQG A;  1VQO A;  4FYX B;  3JB9 J;  4LDU A;  1WIE A;  3RMS A;  2EIF A;  1WJQ A;  2L0A A;  5CQX A;  3JCM d;  2SRC A;  3OMC A;  3QDF A;  1QCO A;  3CD6 T;  4E7J A;  4LDW A;  3FRN A;  3NTH A;  2KT8 A;  2ROL A;  3C94 A;  1RAA B;  1ZA2 B;  1UTI A;  1WYX A;  2YWW A;  1FMK A;  3PVL A;  1W2B P;  3L2R A;  3CCQ Q;  1BU1 A;  4JJC A;  2EKO A;  2M0Y A;  1QWE A;  2RQT A;  1KC8 C;  1Q86 R;  3NFC A;  1Q82 U;  1I8F A;  1Q95 G;  1G3Y A;  2QTV A;  3M57 A;  2WAC A;  4ATO A;  4L5G A;  3A1P A;  3H0H A;  1RAC B;  3UA7 A;  3LGF A;  3MEA A;  3CME T;  3EGU A;  1DJ7 B;  1OQK A;  4A4G A;  3EGX A;  2DJQ A;  3UWN A;  4ZN3 A;  4JJB A;  3H8Z A;  5EG2 A;  1F1B B;  3CMA Q;  3EHR A;  3UPU A;  2KMT A;  1YN8 A;  4C92 B;  3JCM Q;  1VQL A;  2FO0 A;  2OJ2 A;  4XU2 A;  1QVP A;  3OY9 A;  2X9H A;  5GAN 3;  1TU0 B;  3I55 T;  2ECZ A;  3J81 E;  5M9O A;  3TVT A;  3CC7 T;  3PVQ A;  4XTY A;  4M75 E;  1R77 A;  2A08 A;  2BE7 D;  2K57 A;  3QO3 A;  4JUV A;  1WXB A;  3FEO A;  4OGE A;  1M1K R;  5LJ5 f;  1WLP B;  2MOX A;  4C0D B;  5GAO r;  4IIO A;  4OP0 A;  4OMO A;  2L89 A;  2QGF B;  4J9B A;  2CP3 A;  4JRP A;  1QQJ A;  2JVV A;  4CC7 A;  1UGV A;  4D8D A;  3Q1J A;  5FRO A;  1K9M U;  4NL3 A;  3QUI A;  3JCM e;  2CP7 A;  1V29 B;  1X6O A;  4XTW A;  1VQ7 A;  1YJW A;  3PE0 A;  1RLP C;  3TU4 K;  4A63 B;  2E6N A;  2RA2 A;  1OPL A;  5AT1 B;  1ZUU A;  3CCQ T;  3MKD A;  5LJ5 j;  1AVZ C;  1O75 A;  3CXC S;  1KG1 A;  3OYJ A;  5I11 A;  1Q7Y R;  3ZFJ A;  5A0L A;  2YRD A;  4BB7 A;  5CKB A;  5LJ5 d;  2FPE A;  1K76 A;  2AHJ B;  2MAM A;  3SWN B;  1VQ5 A;  3MET A;  3EH1 A;  4TVR A;  2JJ9 A;  3PT9 A;  3G4S A;  4BAC A;  5GAN 8;  3X28 B;  1EFN A;  2B8A A;  1HXD A;  2A3L A;  2DTH A;  2ZPI B;  2D9T A;  3CMA T;  2KXC A;  5GAO m;  2K4Y A;  1K8A C;  3VS2 A;  5CKH A;  3RMQ A;  1Q82 C;  4JRK A;  3E19 A;  5KYN A;  3C95 A;  4DBQ A;  1T3S A;  3L2V A;  1JEG A;  4RTT A;  2DET A;  1WHG A;  2CUB A;  2DYI A;  3NTI A;  5CKD A;  1TS9 A;  2C0O A;  2XHC A;  4EMG A;  4FYV B;  2KVQ G;  1QMC A;  1D3B B;  1MNE A;  2QTX A;  4M75 C;  2V1Q A;  3CBM A;  2J6K A;  2DIQ A;  2WSE E;  3BE3 A;  2LT4 A;  4ANJ A;  1M4Z A;  1FYN A;  2KRM A;  3OYG A;  1AHJ B;  1AT1 B;  5DLQ E;  5LJ3 f;  5GAN h;  2DEQ A;  4XK8 E;  2OTJ Q;  4F7U B;  3R6N A;  4GLM A;  4QVC A;  2EKH A;  4PJJ A;  3EFO B;  1JB0 E;  3TSW A;  2YDL A;  3GNF B;  4FIB A;  3V8K A;  2A36 A;  5GAM h;  3P8B B;  2X3X D;  2HD0 A;  2CUD A;  3AT1 B;  3I35 A;  2LTO A;  5C0M A;  2RF0 A;  2VV5 A;  4E2F B;  4M78 C;  5HK3 A;  3UF4 A;  4F16 A;  3JB9 I;  3OB9 A;  1QVG A;  3PIP A;  1UJY A;  3VJP A;  1SG5 A;  4OMN A;  4QQD A;  1K9M C;  1PNJ A;  2G6F X;  2CZ0 B;  1UHF A;  2ATC B;  3HSB A;  5LJ5 e;  1NJI U;  4M75 D;  1Z9Z A;  1HD3 A;  2KE9 A;  5LJ3 d;  2KK4 A;  1UHC A;  4LD9 K;  2BE9 B;  3CME A;  1JXM A;  4M75 F;  5KYU A;  4KH0 B;  4C92 E;  4PLL A;  1WQW A;  2DZ9 A;  3S3N A;  3M54 A;  2RPN A;  2I0N A;  1ZUY A;  2VKN A;  1RI9 A;  2JXB A;  1Y07 A;  3EG9 B;  1V1C A;  3ULR B;  4NL2 A;  3I55 A;  1VQM Q;  3G6E A;  3CCR T;  3TQ7 P;  5ECA A;  1J3T A;  4CI0 C;  1FXX A;  2RI2 A;  2DL5 A;  1BB9 A;  3VS7 A;  4M78 D;  2V8I A;  3CPW A;  4E7L A;  1SRL A;  3ER0 A;  4LN2 A;  1U3O A;  1B34 A;  3NGP A;  2EQM A;  4OGC A;  1HJD A;  3I9Q A;  4A53 A;  5FU7 C;  4M78 F;  5CIU A;  3OYA A;  1K0X A;  1JU5 C;  4B6M A;  2CP0 A;  4J6Y A;  3HTR A;  1NPP A;  3M0R A;  5GAN j;  2RQR A;  4XQ3 A;  3SHW A;  4O6J A;  1VQO T;  2EGC A;  2OTJ T;  2E70 A;  2M9U A;  2HDA A;  3EGD B;  2A37 A;  1XNI A;  2P0Q A;  1QLY A;  4C5I A;  2O4X B;  2DYB A;  5GAM j;  4Z89 A;  2F2X A;  2FL7 A;  4X9D A;  1OZ2 A;  1YJW Q;  2VGM A;  4HT9 A;  3UAT A;  1YIJ Q;  1OU8 A;  3INZ A;  1BI2 A;  5FW9 A;  4DEX A;  1SKU B;  2XDP A;  2CZ1 B;  3EG2 A;  2HBP A;  3ASK A;  2W0Z A;  2VXF A;  1D09 B;  2RM4 A;  4F04 B;  2GQV A;  2KT1 A;  4M7A B;  4E6R A;  1WXT A;  3UDC A;  2D1X A;  3A8G B;  1N8R R;  3JAM E;  1R0B G;  5KYX A;  4IUT A;  3RKX A;  2NUT B;  1I0C A;  2RJC A;  2JUF A;  2F1L A;  3M56 A;  3KXT A;  1TSF A;  1VQ5 Q;  2J7I A;  2VUB A;  4ZTF A;  3FJP A;  3G4S Q;  1K73 R;  4Y91 A;  5KYY A;  3V8J A;  4HA8 A;  4FYW B;  1G3W A;  4LE9 A;  1VA7 A;  4DOW A;  4GBQ A;  4C92 C;  1VQL T;  2F69 A;  4KH1 B;  3OQ5 A;  1KJW A;  1QWF A;  1Q81 U;  3VKI A;  1W4S A;  1VQ4 A;  1MND A;  2M0O A;  1PKS A;  1UEC A;  2A7Y A;  3LYI A;  1C0M A;  2EAY A;  4PK4 A;  1NJI C;  1PG5 B;  2RJF A;  5KCH A;  2YRV A;  2DL4 A;  4E7H A;  2BKD N;  3M53 A;  1A0N B;  9ATC B;  2QQR A;  4HCZ A;  2F5K A;  2RQU A;  3V7R A;  1UEB A;  1VQK A;  2YXY A;  3L2U A;  2EQK A;  2CSI A;  1X75 C;  2DM1 A;  3HRS A;  4RTZ A;  3J80 E;  2AZS A;  4C0Z A;  4C0D C;  3OBY A;  2ZCF B;  2PQW A;  4ME7 A;  3O5Z A;  4HCB A;  1IGU A;  2GFU A;  4MZP A;  2O88 A;  3HFO A;  3M0P A;  3RBB B;  2Y90 A;  1WGS A;  4BI3 A;  4J83 A;  1O9S A;  4E7K A;  5GAN e;  2F2W A;  4J6W A;  5CKF A;  1YJW T;  4KGZ B;  1TWB A;  1YIJ T;  4C92 D;  2R58 A;  2AK5 A;  5GAM e;  1QP2 A;  3M4G A;  3P8D A;  2QQ9 A;  2L3R A;  4C92 F;  4OB0 B;  4XTV A;  2LNH B;  3CC2 A;  2QGG A;  3MHX A;  4HT8 A;  4IKF A;  3DLL A;  2RD1 A;  2VYT A;  1UGQ B;  4NOY A;  1BI1 A;  3OYF A;  2HQH A;  3SWN C;  2EJG A;  1VQ5 T;  1WNL A;  3EFS A;  3G4S T;  3A8O B;  4C8Q G;  1GL5 A;  5CK9 A;  4BDZ A;  3A8M B;  3VRY A;  4M7D G;  3HL8 A;  1H3H A;  1BI0 A;  2QAS A;  4X1V A;  2QDY B;  2E3I A;  3OSV A;  1QP3 A;  4MDX A;  1WXU A;  2LMJ A;  4OB2 B;  5IHI A;  4PKC C;  4J9E A;  3KUF A;  3X25 B;  5GAN 4;  1ZQ1 A;  3G6E Q;  1GCQ A;  1I5L A;  4C8Q A;  1M27 C;  3M59 A;  1XQH A;  2EPD A;  1WHJ A;  4KUI A;  2CYZ B;  3X24 B;  4M7D A;  3ZEH A;  1MMD A;  5A0D A;  1LJO A;  5A0G A;  3EG3 A;  4XTU A;  1G3S A;  2ENM A;  1UDL A;  3CCU Q;  1QCF A;  2Y4Y A;  1KHC A;  2J6F A;  2L2P A;  2FYK A;  2VAS A;  2P84 A;  2COY A;  1Q81 C;  1T3L A;  1R8O B;  2MK5 A;  5D6X A;  2C0T A;  1RAD B;  4J6X A;  5IHK A;  4D6W A;  2OTJ A;  1JXO A;  3MPU B;  1ZSZ B;  8ATC B;  4QW2 A;  4M77 B;  1JBM A;  2JT4 A;  3BDU A;  5GAN 5;  2VVK A;  5FWC A;  4PJO G;  1YNZ A;  2DD5 A;  3MJX A;  1M2V A;  2X4X A;  4BD3 A;  5L8R E;  1K8A R;  1FMV A;  2RO0 A;  4FSX A;  4M7A E;  1Q82 R;  3PMI A;  4J5Y A;  2F5T X;  5IAY A;  1OV3 A;  3CXC A;  3OYK A;  2LC4 A;  2RK2 A;  3TRE A;  1N9R A;  6AT1 B;  1BIB A;  3JSC A;  2D0Q B;  2FZC B;  3EFR A;  4OMF B;  4PJO A;  3M0U A;  1E7O A;  2HL5 C;  2JM8 A;  3QZ5 B;  3OW2 P;  1MMN A;  1IRE B;  3OYL A;  2MIO A;  1H8K A;  1IZ6 A;  3WXM B;  1WA7 A;  4FYY B;  3MEU A;  4KT0 E;  5IH2 A;  4KBM B;  1ZBX A;  5AYF A;  1BCM A;  1RI0 A;  1YHQ Q;  4HCC A;  1OYX A;  3QJ6 A;  2EYY A;  2AZV A;  1VQ6 A;  2XI9 A;  4EMK B;  1X01 A;  4F7U F;  2EWN A;  1V76 A;  4FSS A;  1X69 A;  1VQM A;  1AD5 A;  1WHL A;  1VQ4 Q;  3G6E T;  4PJN A;  1OOT A;  3RIR A;  1RAE B;  2NWM A;  4IUR A;  1KD1 R;  1VQN A;  3L2Q A;  4RMO A;  2A28 A;  2EQI A;  4VUB A;  4ORZ A;  1VQK Q;  2J05 A;  3E9F A;  5D6W A;  3S3O A;  1K9M R;  2EYW A;  2ZGW A;  3QZ9 B;  2DLP A;  3SD4 A;  2E5K A;  2COZ A;  1BYM A;  5KYW A;  5GAO n;  2KBT A;  1D1A A;  3HRU A;  1JO8 A;  3NMZ C;  1UGP B;  3GBQ A;  2BIV A;  1H92 A;  4B9W A;  2XG8 D;  1YIJ A;  1UB4 A;  2CP2 A;  3FIF A;  3FC3 A;  1GXI E;  2M16 A;  2HBW A;  2KRO A;  3OBW A;  3VS4 A;  3PIO A;  1Y96 A;  1EIF A;  2YUO A;  4FW2 A;  2NUP A;  1BBZ A;  1YJ9 A;  3CC2 Q;  1KQ2 A;  2E64 A;  2RB6 A;  2FB7 A;  1U1S A;  4JS5 A;  2COW A;  5KE3 A;  2LZ6 B;  2MYS A;  5CAI A;  1M3B A;  2FPF A;  2YLC A;  2RI5 A;  2JMA A;  4J9D A;  2F2V A;  2HZY A;  1VQP A;  4R0K A;  3JCM g;  2Y4X A;  4EPC A;  1PKT A;  5IXF A;  2LNV A;  1QCN A;  1Y57 A;  2QQS A;  2VXE A;  3KFV A;  1YHQ T;  1K0S A;  3GOX A;  3PTA A;  1XJW B;  2AT1 B;  1U5S A;  2HQE A;  4QQ6 A;  2V8K A;  2KDS A;  2HQX A;  1ZBJ A;  1JJ2 P;  2NUZ A;  3PNW C;  5IHN A;  1VQ4 T;  4BE0 A;  1N6A A;  2LCL A;  1T0H A;  1I81 A;  5I22 A;  2LQW A;  2PVD B;  3JCM P;  1G2B A;  2PVG B;  3OYB A;  5KCO A;  1M8V A;  4PJM A;  3CCS A;  1PCX A;  2E5Q A;  1VQK T;  1B07 A;  4M7A D;  2OI3 A;  2HSE B;  4OMP A;  4AG2 C;  2ZAE A;  2DKG A;  1NYG A;  1KQ1 A;  4M7A F;  3VRZ A;  4M77 E;  1GBR A;  1NEG A;  2L8D A;  4MMK A;  1QVF P;  2KQW A;  3GLX A;  1FWZ A;  5I21 A;  4J7I A;  2XID A;  2L3S A;  3CPF A;  1PC0 A;  1QW1 A;  4RCB A;  4WF2 A;  3PGG A;  2MCN A;  4C8Q E;  3VYH B;  1VQ8 A;  2EYZ A;  5I2M A;  2FZK B;  1RL2 A;  2X4Y A;  4A54 A;  3GNG A;  2O9V A;  3EH2 A;  3CC2 T;  2RN8 A;  1NJI R;  1E6H A;  1W2B A;  4M4Z A;  1NM7 A;  5CCA A;  2GFA A;  2BTT A;  4AFQ C;  2RH2 A;  1IHV A;  3OS5 A;  2LQ8 A;  1MV3 A;  4EMH A;  5GMK m;  4Z8A A;  2D6F A;  1ARK A;  4RTX A;  2RHY A;  2DL3 A;  4B9X A;  1E6G A;  2FHD A;  2DER A;  1H3Z A;  3GP8 A;  4C5H A;  3LLR A;  4CC4 B;  5GAN f;  2NLU A;  4QVD A;  1YP5 A;  4L59 A;  3MP6 A;  4PNO A;  5L23 A;  2ROT A;  1VQ6 Q;  2ZPG B;  4JRQ A;  3DB4 A;  3I5R A;  4FW1 A;  4C0F A;  5FWB A;  1AZG B;  2RK1 A;  3L42 A;  1N9S A;  5GAM f;  2K7A A;  1RUW A;  4OML A;  3LH0 A;  2DA9 A;  3LWH A;  4AG1 C;  5HCK A;  5LJ5 g;  4QVZ A;  3PMT A;  1VQN Q;  3DB3 A;  5GMK h;  2RJE A;  2PZ1 A;  2D8H A;  1QKW A;  3CCU A;  2JN0 A;  3EG1 A;  3M0T A;  4V2S A;  5LL6 S;  4E7Z A;  2X51 A;  2X4W A;  4JLG A;  2RHU A;  2KAF A;  2ED1 A;  2EQU A;  2GQI A;  2LQK A;  2LCC A;  5KYU B;  3LWI A;  3MEV A;  1ZSZ C;  4HVV A;  4Z88 A;  4M77 C;  1N27 A;  4ESR A;  5GAN d;  3OYD A;  3FLG A;  2DZC A;  3OYN A;  2E3H A;  1B7T A;  1QKX A;  3JB9 H;  1K9A A;  4II1 A;  3BY7 A;  2NUT A;  1IO6 A;  2MWO A;  2BZY A;  1OZ3 A;  5GAM d;  4ZN1 A;  3OYC A;  1UE9 A;  1KFZ A;  1B3Q A;  3WVD B;  2V26 A;  2RI3 A;  3JCM X;  3WVE B;  5GAO p;  2PUO B;  1YJN A;  1CKB A;  2QEX A;  1B34 B;  1YJ9 Q;  4HVW A;  4BY6 B;  3QPH A;  4M75 G;  3OYI A;  2CZ6 B;  4QT7 A;  1H64 1;  4MZM A;  1C6V X;  1ZX6 A;  1JRI A;  2QDL A;  1ABO A;  3OW2 S;  1VQP Q;  1QVG S;  2M51 A;  2DAQ A;  3CCM A;  3C0C A;  1KQS S;  3VV0 A;  4ZGJ B;  1MMG A;  2R5M A;  4LUE A;  2RQW A;  1YHQ A;  2IPO B;  1SHF A;  1Y71 A;  4M77 D;  3GIB A;  4M75 A;  4EMK C;  1OX8 A;  3H0F A;  2DD4 A;  4BE1 A;  1VQ6 T;  2PNI A;  3JB9 D;  2GTO A;  3P8H A;  4M77 F;  1VYV A;  3QDR B;  1N8R U;  2DRK A;  8AT1 B;  1VQM T;  4RTW A;  4M78 G;  2VB6 A;  3JB9 F;  2X3W D;  2K5F A;  5CVI A;  4BI4 A;  2QA4 A;  2EJ9 A;  3THK A;  2DRM A;  3H0I A;  4PFP A;  1VQN T;  1MGQ A;  3CCS Q;  4Y28 E;  3RER A;  1LVK A;  4DQ2 A;  1OPK A;  2IVW A;  5LJ3 g;  5KYX B;  1P92 A;  5GAN 7;  2QG9 B;  4N4H A;  2J06 A;  4OF1 A;  1TXQ A;  1PRM C;  2QYZ A;  3HPW A;  1KC8 R;  3LX7 A;  4R56 A;  4M78 A;  1VUB A;  2RQV A;  2D0N A;  4J9G A;  2HKQ B;  4ZGD B;  3I56 A;  4J9C A;  3VS6 A;  1LCK A;  1TUC A;  2FPD A;  3QJY A;  1AEY A;  2JTE A;  1M3C A;  4LXC A;  1OUL A;  2CRE A;  2NYS A;  4J7F A;  2EFI A;  2K79 A;  5I2S A;  3H41 A;  1X6G A;  3O8V A;  2V1R A;  2QK0 A;  2MI6 A;  4ELY C;  4IUP A;  2OX7 A;  2DF6 A;  3OYM A;  1VQ8 Q;  2LX9 A;  3C4S A;  3CEY A;  4KUD K;  1WHH A;  1YBY A;  3UT1 A;  3JCM h;  4AFU C;  5GMK l;  1G5V A;  2K6D A;  1ZA1 B;  2FEI A;  3CQT A;  3OYH A;  1YJ9 T;  1WHM A;  2GBQ A;  3X26 B;  5HY6 A;  3CD6 Q;  4IIM A;  3RES A;  1IRX A;  2LJ3 A;  1WHK A;  3HFN A;  4ZTJ A;  4L6V 5;  1KIK A;  1KHI A;  3HRT A;  4YTL A;  4RTV A;  1WFW A;  3X20 B;  2CT3 A;  4N4G A;  1U1T A;  5GAN g;  3CCL A;  2IIM A;  2IG0 A;  1VQP T;  2K5L A;  1TTH B;  3QYH B;  2JTF A;  2DE0 X;  3URG A;  1VYT A;  2QQB A;  2VGN A;  2L3P A;  1SEM A;  1M90 U;  4J9I A;  1PSF A;  4PLI A;  1X6B A;  2JOY A;  1NYF A;  5D6Y A;  2MF2 A;  1OX9 A;  1Y0M A;  2DXC A;  2DPP B;  4HCK A;  3V8L A;  1PRL C;  1HSQ A;  2JS0 A;  1G8X A;  1PM3 A;  1S1N A;  2BZ8 A;  1AWO A;  1YFN A;  3OS2 A;  3SB2 A;  1ZSZ A;  3A5Z B;  1JJ2 S;  2KYB A;  2ZPB B;  4ZGE B;  4HKE A;  4PFO A;  2RHI A;  2DNU A;  3CCS T;  2M02 A;  2LRQ A;  1OEB A;  2K9G A;  4DEY A;  3SFM A;  3MP1 A;  3EAE A;  4PL6 A;  3E9G A;  4WCI A;  3L1A A;  2LJ1 A;  1D1C A;  1VIF A;  1NG2 A;  3M5A A;  3CCJ A;  3JV3 A;  1D1B A;  3H6Z A;  3G71 A;  5DLO A;  5FU7 B;  1QVF S;  1NPR A;  4D8K A;  5GAO q;  4C92 G;  2J6O A;  3CCE A;  4RTU A;  4C5G A;  5J3B A;  2QQA A;  1UG1 A;  1VQ8 T;  1IB8 A;  3AHU A;  1SPK A;  2P4R A;  4JJD A;  3OS1 A;  3CC4 A;  4JLI A;  4C8Q B;  4KGV B;  3RUX A;  3G1J A;  1FX7 A;  3E1S A;  3E2U A;  5FRM A;  4M7D B;  1PWT A;  1YJN Q;  2E1H A;  2QEX Q;  2JZ2 A;  3REA B;  3FB9 A;  3MEW A;  4EMK A;  2OTL Q;  1AWW A;  4FT4 A;  3SDZ A;  4C92 A;  2CH4 A;  2FZG B;  2AKL A;  1QVG P;  1SF9 A;  1KQS P;  1YWP A;  3VYG A;  1G3T A;  1N5Z A;  2O01 E;  4IUV A;  2XD0 A;  1LOJ A;  2X35 A;  2PU9 B;  4IUU A;  2ED0 A;  2GCX A;  1LNX A;  2ZPH B;  1K8A U;  4AMC A;  1M2O A;  3CCM Q;  2XKO C;  5LJ5 h;  2EVR A;  2LQN A;  4RTY A;  2XMF A;  2PTK A;  3A8H B;  4MDW A;  2DL7 A;  2QXF A;  4Q5W A;  2X4J A;  3LH5 A;  3OYE A;  1M2V B;  4PJL A;  4CC2 A;  1S72 A;  5CKE A;  2LDM A;  1Q86 U;  1VQ9 A;  3H9N A;  2BZX A;  2LX7 A;  2AIR B;  1OU9 A;  1YI2 A;  4J9H A;  2QI2 A;  5DY9 A;  1NZ9 A;  2QA4 Q;  1UGS B;  2HEQ A;  1AWX A;  4KRT A;  2GGR A;  1NE8 A;  1C1A A;  1M90 C;  1MUZ A;  5HK0 A;  3M4Y A;  4MML A;  4F14 A;  4PJO B;  1GFD A;  2KY9 A;  3LW5 E;  4GLK A;  5KE2 A;  3CCU T;  4FT2 A;  2K5I A;  5FU6 B;  2WSC E;  2VC8 A;  3M58 A;  3M55 A;  3CPW P;  2ABL A;  2CH4 W;  2D8J A;  1UGR B;  1MMA A;  5CQY A;  4MZT A;  2VWF A;  3I56 Q;  3EGX B;  1RAB B;  2DMO A;  4BUG A;  4X34 A;  1GCP A;  3OMG A;  2DXU A;  2LT1 A;  1I07 A;  3JCM b;  1U06 A;  2KYM A;  2XDD A;  2FRW A;  1KD1 U;  2KGT A;  2RJD A;  1WI7 A;  2MMP A;  3SWN A;  4RCC A;  1BIA A;  4OMM A;  2MWP A;  5KH6 A;  4C0G A;  3EHQ A;  2L3Q A;  2DBM A;  4DA4 A;  3J7A F;  2YUN A;  1M1K U;  1WQ7 A;  4RG2 A;  1UFF A;  2PUK B;  3KBG A;  2RHZ A;  5D7U A;  2QEX T;  1YJN T;  2A0F B;  1ABQ A;  4M7A C;  4GY5 A;  2E6Z A;  2OTL T;  4BY6 C;  3N5B B;  3ZBD A;  4M78 E;  4AT1 B;  5GMK i;  4KGX B;  1ZLM A;  2EYX A;  2YRC A;  1TH7 A;  1OI1 A;  1BK2 A;  3CCL Q;  2E41 A;  2JMC A;  2K3Y A;  4F7U G;  1FMW A;  3CCM T;  2DBK A;  2LP5 A;  3CBO A;  2P0K A;  5KYW B;  1D3B A;  2AKK A;  3VS3 A;  1UUE A;  1WDX A;  5LJ3 h;  2CP5 A;  1Q7Y U;  2YLB A;  3F70 A;  4BE2 A;  3TEE A;  4C5E A;  3OA6 A;  2EJF A;  2DVE A;  1Y96 B;  4QKU A;  2CZ7 B; 
#chains in the Genus database with same CATH homology
 1KC8 C;  4F7U A;  5LL6 S;  3NFC A;  1YIJ T;  2X4W A;  2QA4 T;  1I8F A;  4JLG A;  2RHU A;  2KAF A;  4C92 D;  1G3Y A;  3OYY A;  2I2L A;  2EQU A;  2R58 A;  3M57 A;  2WAC A;  2E10 A;  2LCC A;  2LQK A;  3JCM c;  3LWI A;  4ATO A;  4L5G A;  5GAM e;  1QP2 A;  3MEV A;  5CO7 A;  3M4G A;  4A4K A;  3P8D A;  2QQ9 A;  2L3R A;  4M77 C;  1N27 A;  3LGF A;  3OYD A;  4C92 F;  5GAN d;  3MEA A;  2LVM A;  2V8J A;  3FLG A;  4OB0 B;  4XTV A;  3CME T;  2DZC A;  3OYN A;  1U8R A;  1DJ7 B;  3CC2 A;  3MHX A;  4HT8 A;  4A4G A;  3JB9 H;  4IKF A;  4II1 A;  3BY7 A;  3DLL A;  2MWO A;  3UWN A;  2RD1 A;  4ZN3 A;  5CR2 A;  2VYT A;  1Q86 C;  3H8Z A;  1OZ3 A;  5EG2 A;  1UGQ B;  5GAM d;  1Q82 U;  3CCV A;  3G7Z A;  4NOY A;  4ZN1 A;  3OSS C;  1BI1 A;  3I56 T;  3OYC A;  3OYF A;  5DM7 R;  3UPU A;  2DTI A;  2KMT A;  4C92 B;  3JCM Q;  3SWN C;  1VQL A;  2EJG A;  3WVD B;  4XU2 A;  1QVP A;  1PSE A;  3OY9 A;  1VQ5 T;  1WNL A;  3EFS A;  2RI3 A;  3JCM X;  3WVE B;  5GAO p;  1YIT A;  2PUO B;  5GAN 3;  3G4S T;  4XAX B;  3A8O B;  4C8Q G;  5GAN 6;  4ELZ C;  3I55 T;  2QEX A;  1YJN A;  2E65 A;  1B34 B;  5CK9 A;  3J81 E;  4BDZ A;  3A8M B;  2ZPE B;  5M9O A;  2JTM A;  2DXT A;  4BY6 B;  4M7D G;  3HL8 A;  2DJZ A;  3QPH A;  4M75 G;  3CC7 T;  1BI0 A;  4XTY A;  3OYI A;  2CZ6 B;  1WPY A;  4M7D E;  4M75 E;  2BUD A;  1H64 1;  2QDY B;  3V7C A;  3OSV A;  1QP3 A;  4MDX A;  4MZM A;  4NS5 A;  2K57 A;  4OB2 B;  3QO3 A;  4JUV A;  5J39 A;  1JRI A;  4PKC C;  3FEO A;  4CRI A;  3OW2 S;  3QXE B;  4OGE A;  4O5V A;  1QVG S;  2DAQ A;  5LJ5 f;  3CCM A;  3KUF A;  1KQS S;  3X25 B;  3CD6 A;  5GAN 4;  1ZQ1 A;  1I5L A;  4C8Q A;  4C0D B;  5GAO r;  3VV0 A;  5A2Q E;  3M59 A;  4OP0 A;  4ZGJ B;  2R5M A;  1YHQ A;  1M1F A;  1XQH A;  2L89 A;  4XTZ A;  1M9S A;  1Y71 A;  1KD1 C;  4KUI A;  2CYZ B;  4M77 D;  3QYG B;  3X24 B;  2JVV A;  2ZPF B;  4M75 A;  3ZEH A;  4EMK C;  4JRP A;  3GIB A;  2DD4 A;  3R6O A;  2DIG A;  4FL6 A;  4BE1 A;  5A0D A;  1VQ6 T;  1LJO A;  5A0G A;  3JB9 D;  4XTU A;  5IN1 A;  3Q1J A;  1G3S A;  5FRO A;  3OW2 A;  1K9M U;  3CCL T;  3P8H A;  4M77 F;  3QDR B;  4NL3 A;  2Y4Y A;  2RHX A;  1N8R U;  1KHC A;  1KQS A;  1VQM T;  3QUI A;  1M1K C;  3L2Z A;  4M78 G;  3JCM e;  1V29 B;  1X6O A;  2K2V A;  4XTW A;  4JRI A;  1YJW A;  1VQ7 A;  2CKK A;  2FYK A;  3JB9 F;  5LJ3 j;  2K5F A;  5CVI A;  4FU6 A;  4BI4 A;  2EJ9 A;  2QA4 A;  3TU4 K;  1Q81 C;  5FRN A;  1R8O B;  2E6N A;  5D6X A;  4J6X A;  2RA2 A;  4D6W A;  3CCU T;  1VQN T;  2OTJ A;  1MGQ A;  2EQJ A;  4Y28 E;  2DXB A;  3RER A;  4DOV A;  4J8O A;  4DQ2 A;  4QW2 A;  4M77 B;  1JBM A;  3RKY A;  2IVW A;  3CCQ T;  5LJ3 g;  5LJ5 j;  4UC4 A;  3GPL A;  1P92 A;  3BDU A;  5GAN 7;  5GAN 5;  1O75 A;  4E7I A;  4N4H A;  3CXC S;  3VUB A;  1KG1 A;  3OYJ A;  4OF1 A;  4N0A C;  3ZFJ A;  4PJO G;  5A0L A;  3M9Q A;  4BB7 A;  1VIE A;  3HPW A;  5CKB A;  3LX7 A;  4R56 A;  2DD5 A;  2H3J A;  4M78 A;  1VUB A;  4PJO E;  2X4X A;  5LJ5 d;  2O4X A;  4ZGD B;  3I56 A;  4BD3 A;  4M7A G;  5L8R E;  2RO0 A;  2PVO B;  3S3M A;  2AHJ B;  3QJY A;  2MAM A;  4FSX A;  3SWN B;  1VQ5 A;  4M7A E;  3MET A;  3PMI A;  4N4I A;  4TVR A;  4J5Y A;  1XOV A;  2WSF E;  2F5T X;  3PT9 A;  5IAY A;  3G4S A;  4J7F A;  2EFI A;  3CXC A;  4BAC A;  3OYK A;  2LC4 A;  5I2S A;  5GAN 8;  2RK2 A;  3O8V A;  3TRE A;  1Q7Y C;  1N9R A;  3X28 B;  2B8A A;  1BIB A;  2MI6 A;  3JSC A;  1HXD A;  4ELY C;  2D0Q B;  4IUP A;  3CC7 A;  2A3L A;  2DTH A;  3EFR A;  2ZPI B;  4OMF B;  4PJO A;  2D9T A;  3OYM A;  3CMA T;  5GAO m;  2LX9 A;  3QZ5 B;  3C4S A;  3CEY A;  2K4Y A;  3LGL A;  3CCJ T;  4BDY A;  1K8A C;  1IRE B;  3OYL A;  4KUD K;  1YBY A;  4V2S A;  3JRZ A;  3UT1 A;  3JCM h;  5CKH A;  3RMQ A;  1WJS A;  1M1G A;  3G71 T;  5GMK l;  3OS0 A;  4M7A A;  4P5N A;  1IZ6 A;  4JRK A;  3E19 A;  3WXM B;  1Q82 C;  1G5V A;  3MEU A;  4KT0 E;  3C95 A;  3L2V A;  2M1H A;  3OYH A;  1YJ9 T;  3X26 B;  4KBM B;  5HY6 A;  2DO3 A;  1ZBX A;  3RES A;  3CCE T;  3NTI A;  5AYF A;  3HFN A;  3MO8 A;  5CKD A;  1RI0 A;  4L6V 5;  4ZTJ A;  1KHI A;  4HCC A;  1OYX A;  2R5A A;  3QJ6 A;  3CC4 T;  3HRT A;  4YTL A;  2XHC A;  4C8Q C;  4EMG A;  2XI9 A;  4EMK B;  1VQ6 A;  2KVQ G;  3X20 B;  3DKM A;  5FLX E;  3ME9 A;  4LD6 A;  4N4G A;  1X01 A;  1U1T A;  1D3B B;  4F7U F;  5GAN g;  3CCL A;  2EWN A;  2QTX A;  2IG0 A;  3CBP A;  1ZHI A;  3QII A;  4M75 C;  4M7D C;  3CBM A;  1VQP T;  2DIQ A;  2WSE E;  2K5L A;  1VQM A;  3QYH B;  2JTF A;  3URG A;  3G6E T;  2CS7 A;  2LT4 A;  2OTL A;  2QQB A;  2VGN A;  1M4Z A;  1SSF A;  1M90 U;  1Y7X A;  3VUZ A;  1PSF A;  3RIR A;  3OYG A;  1AHJ B;  1XTD A;  4IUR A;  4PLI A;  5DLQ E;  5LJ3 f;  3L2Q A;  1VQN A;  2JOY A;  4RMO A;  5D6Y A;  5GAN h;  2MF2 A;  2DEQ A;  4XK8 E;  4F7U B;  2G3R A;  2DXC A;  2DPP B;  3T9N A;  4VUB A;  3CCQ A;  3V8L A;  4R55 A;  4QVC A;  1JB0 E;  3VU3 C;  3GNF B;  4FIB A;  3V8K A;  3E9F A;  3QG1 A;  5D6W A;  5GAM h;  3S3O A;  1W2B S;  3QSU A;  3P8B B;  3OS2 A;  2HD0 A;  3SB2 A;  3A5Z B;  1JJ2 S;  2ZGW A;  2ZPB B;  4ZGE B;  4HKE A;  3S6W A;  2RHI A;  2LTO A;  5GAO l;  3QZ9 B;  5C0M A;  3CCS T;  4Z02 A;  2VV5 A;  2LRQ A;  2OAU A;  4M78 C;  4XU0 A;  3SD4 A;  5HK3 A;  3JB9 I;  1S72 T;  3OB9 A;  1VQ9 T;  1QVG A;  3PIP A;  1BYM A;  5GAO n;  3SFM A;  2JNG A;  3MP1 A;  5LJ3 e;  3HRU A;  1UGP B;  3VJP A;  3EAE A;  2BIV A;  1JJ2 A;  4PL6 A;  3E9G A;  1YI2 T;  4B9W A;  3L1A A;  2XG8 D;  5GMK j;  4QQD A;  1UB4 A;  4C8Q D;  4E47 A;  1YIJ A;  3FIF A;  1K9M C;  3CMA A;  5HKC A;  3FC3 A;  1VIF A;  3M5A A;  2CZ0 B;  3CCJ A;  1K73 U;  2M16 A;  1GXI E;  3OBW A;  3HSB A;  4XU3 A;  5LJ5 e;  4M7D D;  1NJI U;  4M75 D;  3H6Z A;  3G71 A;  3PIO A;  4C8Q F;  1Y96 A;  4PJO C;  1EIF A;  4LD9 K;  5LJ3 d;  2KK4 A;  5DLO A;  3CME A;  5FU7 B;  1QVF S;  3DLM A;  1NPR A;  5FU6 C;  3QKJ A;  5GAO q;  2P4T A;  1YJ9 A;  4C92 G;  4M7D F;  4M75 F;  1KQ2 A;  3CCE A;  2XU8 A;  2E64 A;  2RB6 A;  2FB7 A;  3BW1 A;  4C92 E;  4PLL A;  1U1S A;  4C5G A;  1MHN A;  1WQW A;  2QQA A;  2DZ9 A;  5J3B A;  1VQ8 T;  3AHU A;  4JS5 A;  3M54 A;  3OS1 A;  5GAN 2;  5KE3 A;  3S3N A;  3CC4 A;  5CAI A;  5J26 A;  4JLI A;  4C8Q B;  3QHS A;  3CPW S;  4OB3 B;  2YLC A;  4LDX A;  3RUX A;  2RI5 A;  3V7S A;  1FX7 A;  1Y07 A;  3E1S A;  5FRM A;  4OVA A;  1QVF A;  1VQP A;  3JCM g;  4M7D B;  2Y4X A;  4M75 B;  4NL2 A;  3I55 A;  2E1H A;  3HP9 A;  2C06 A;  2JZ2 A;  4EPC A;  3RKW A;  3G6E A;  3CCR T;  1WJR A;  3FB9 A;  2LNV A;  4A4F A;  3MEW A;  4EMK A;  4F7U E;  2DK3 A;  4FT4 A;  2QQS A;  3SDZ A;  2VXE A;  4C92 A;  4CI0 C;  1FXX A;  2RI2 A;  1YHQ T;  3HKS A;  4M78 D;  3GOX A;  3PTA A;  2V8I A;  3BFM A;  3CPW A;  4E7L A;  3JCM J;  3ER0 A;  2HQE A;  4QQ6 A;  1B34 A;  2V8K A;  2EQM A;  2KDS A;  4OGC A;  1KC8 U;  2HQX A;  3MCA B;  4A53 A;  5FU7 C;  4M78 F;  4RG8 A;  1G3T A;  2O01 E;  4IUV A;  4XU1 A;  5CIU A;  3VYG A;  3OYA A;  2XD0 A;  1LOJ A;  2X35 A;  2YHT A;  3PNW C;  2PU9 B;  4IUU A;  4J6Y A;  1N6A A;  2LCL A;  4BE0 A;  1VQ4 T;  1NPP A;  2GCX A;  1LNX A;  2ZPH B;  1K8A U;  1I81 A;  4A4H A;  1VQ7 T;  2XKO C;  5LJ5 h;  2K3X A;  5GAN j;  2PVD B;  3JCM P;  5C6S A;  1H3Z A;  2PVG B;  3OYB A;  3JCM W;  5KCO A;  4XQ3 A;  1M8V A;  4O6J A;  4PJO D;  1VQO T;  3CCS A;  3A8H B;  2OTJ T;  2E70 A;  2M9U A;  2QXF A;  4IUQ A;  2E5Q A;  4MDW A;  2X4J A;  4Q5W A;  4BI8 B;  4M78 B;  2HAX A;  4N0A A;  1XNI A;  3OYE A;  1VQK T;  2P0Q A;  4C5I A;  1S72 A;  2O4X B;  2LDM A;  5CKE A;  5GAM j;  1Q86 U;  4PJO F;  1VQ9 A;  4M7A D;  2FL7 A;  2XIC A;  3BDL A;  2HNI A;  4X9D A;  2R57 A;  1OZ2 A;  1HK9 A;  4M77 G;  2DKG A;  1YI2 A;  1KQ1 A;  4LDY A;  2QI2 A;  5DY9 A;  2VGM A;  4M7A F;  4HT9 A;  4KUL A;  1NZ9 A;  4M77 E;  3JB9 G;  1UGS B;  5GAM g;  2L8D A;  3INZ A;  1BI2 A;  4MMK A;  3TCJ A;  2KQW A;  3GLX A;  1NE8 A;  1FWZ A;  4JS4 A;  5I21 A;  1M90 C;  4J7I A;  2XID A;  5HK0 A;  3M4Y A;  4MML A;  2XDP A;  3CPF A;  4PJO B;  3FDR A;  2FVU A;  2CZ1 B;  1BI3 A;  1QW1 A;  2KY9 A;  3LW5 E;  2HBP A;  3ASK A;  4GLK A;  4RCB A;  4FT2 A;  4WF2 A;  5KE2 A;  2VXF A;  4JJN K;  2K5I A;  5FU6 B;  2RM4 A;  2WSC E;  3JCM V;  2GQV A;  2VC8 A;  3M58 A;  3PGG A;  3M55 A;  4M7A B;  2GF7 A;  4EDU A;  4C8Q E;  3VYH B;  1UGR B;  3UDC A;  1VQ8 A;  4M77 A;  5CQY A;  3A8G B;  3JAM E;  3PFS A;  4MZT A;  5I2M A;  5IT9 E;  4IUT A;  3JCM f;  2XDB A;  3RKX A;  4A4E A;  4OB1 B;  1RL2 A;  2P0P A;  2ZZD A;  3M56 A;  2RJC A;  2JUF A;  3L2W A;  4BUG A;  4X34 A;  3KXT A;  3OMG A;  3MP8 A;  2DXU A;  2LT1 A;  2X4Y A;  2XK0 A;  2VUB A;  3GNG A;  4A54 A;  4ZTF A;  3JCM b;  3FJP A;  3HHT B;  4LDV A;  2KSS A;  4Y91 A;  2XDD A;  1KD1 U;  5GMK e;  3CCR A;  3CC2 T;  1W2B A;  3V8J A;  5CCA A;  4HA8 A;  2GFA A;  2CGH A;  1G3W A;  2RJD A;  2MMP A;  3SWN A;  4RCC A;  1BIA A;  2RH2 A;  2MWP A;  3C12 A;  3QBY A;  1BKB A;  3OS5 A;  4C0G A;  5KH6 A;  3CCV T;  1N8R C;  2EYQ A;  2L5Q A;  4DA4 A;  4RKU E;  3J7A F;  2LQ8 A;  4DOW A;  1M1K U;  1WQ7 A;  4C92 C;  2E12 A;  4X9C A;  4RG2 A;  4EMH A;  5GMK m;  2PUK B;  3KBG A;  2RHZ A;  1VQL T;  2F69 A;  2D6F A;  3OQ5 A;  1Q81 U;  1YCY A;  1YIT T;  3VKI A;  1W4S A;  2RHY A;  2QEX T;  2M0O A;  1VQ4 A;  2DTO A;  1YJN T;  1K73 C;  1M5Q 1;  2A7Y A;  3LYI A;  4M7A C;  1NJI C;  2EAY A;  4JDS A;  4XTX A;  3NTK A;  4B9X A;  2RJF A;  2E6Z A;  1I4K 1;  2FHD A;  4GY5 A;  5KCH A;  2OTL T;  2YRV A;  3N5B B;  3GF5 A;  3ZBD A;  4BY6 C;  4E7H A;  3GP8 A;  2BKD N;  4M78 E;  4FM4 B;  4C5H A;  3M53 A;  3LLR A;  3A8L B;  5GAN f;  4QQG A;  2NLU A;  5GMK i;  4QVD A;  1VQO A;  4L59 A;  3MP6 A;  4PNO A;  2QQR A;  3JB9 J;  4LDU A;  2ZPG B;  2F5K A;  4HCZ A;  3V7R A;  1TH7 A;  1UEB A;  3RMS A;  1OI1 A;  2EIF A;  4JRQ A;  1VQK A;  3DB4 A;  4C0F A;  1WJQ A;  3L2U A;  2EQK A;  5CQX A;  1X75 C;  3JCM d;  3HRS A;  3OMC A;  2RK1 A;  2E41 A;  4M7D A;  3L42 A;  2K3Y A;  4F7U G;  1N9S A;  5GAM f;  3J80 E;  3CCM T;  3CD6 T;  4E7J A;  4C0Z A;  4C0D C;  4LDW A;  3CBO A;  3FRN A;  3NTH A;  3LH0 A;  3OBY A;  2ZCF B;  2P0K A;  2PQW A;  3C94 A;  3LWH A;  4ME7 A;  1D3B A;  5LJ5 g;  4QVZ A;  4HCB A;  2GFU A;  4MZP A;  3PMT A;  3DB3 A;  5LJ3 h;  5GMK h;  2RJE A;  3HFO A;  1Q7Y U;  2Y90 A;  2YLB A;  3F70 A;  3L2R A;  1WGS A;  4BI3 A;  3CCU A;  4BE2 A;  4J83 A;  1O9S A;  2EKO A;  3TEE A;  4E7K A;  4C5E A;  3OA6 A;  5GAN e;  2JN0 A;  2EJF A;  4J6W A;  2DVE A;  5CKF A;  1Y96 B;  2CZ7 B;  1YJW T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...