3QSUA

Structure of staphylococcus aureus hfq in complex with a7 rna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/rna
molecule keywords RNA chaperone Hfq
publication title Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 18
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F, G, H, I, J, K, M, N, S
ec nomenclature
pdb deposition date 2011-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qsuA00
4XU2A 5GMKj 4RCBA 4A54A 5DY9A 3SB2A 5LJ3d 4C8QA 4XU1A 3INZA 4XTWA 3SWNC 4C8QB 5GAN4 4PJOB 2E64A 3JCMV 4NL3A 3FJPA 4C92F 2YHTA 5GAMf 4V2SA 1JBMA 4JRKA 1WQWA 4C8QE 3HFNA 5LJ3h 2RD1A 4C92D 3GIBA 3JB9H 4M78C 5GAMh 4XTUA 4M7AC 2EJFA 4MMLA 3RUXA 3EFRA 2DZCA 3V8JA 4EMGA 5GANe 3JCMX 1B34A 4XU3A 4NOYA 2EAYA 4RCCA 4M7DC 1B34B 1WQ7A 2E65A 2DTHA 1M5Q1 2DJZA 4M78F 4XTYA 4MMKA 5I21A 3JB9I 1I81A 1BIAA 5GANf 3QHSA 4DQ2A 4XTVA 4M78D 4F7UE 3RERA 4M7AF 4M75A 2EWNA 4NL2A 2RB6A 3JCMc 5LJ5e 4M7AD 4M75B 3JCMf 4M77A 2VXEA 5LJ5g 4M7DF 5GAOn 3JB9J 4M77B 5GAN8 2E41A 4PNOA 4M7DD 3JCMh 4PJOA 4M75E 3V7SA 3VU3C 2DXTA 5GAMd 5GAN2 4M77E 3V7CA 4F7UF 4C92G 5GANj 4QVDA 3JCMW 1MGQA 4PJOE 3JB9F 1WNLA 1X01A 4C8QC 1N9RA 3JB9D 3L1AA 4X9DA 2K57A 3V8KA 4N0AA 2RA2A 2YLCA 3RKWA 5GMKm 1LOJA 1M8VA 4JUVA 3QSUA 4J5YA 2EJ9A 2Y90A 5GANd 4JLIA 2E10A 5LJ3e 4HT9A 3BY7A 4M78G 3QUIA 4PJOF 1HXDA 4C8QF 2DTOA 3JCMd 4N0AC 5LJ3g 4XU0A 2VXFA 1I8FA 4C8QD 4M7AG 1YCYA 2HNIA 1U1TA 5GANh 4EMKA 4EMKB 4M7DG 1D3BA 1D3BB 2DVEA 2YLBA 1LJOA 5GMKe 5LJ5f 1JRIA 5GAOp 3RKYA 3V7RA 4HA8A 4M75C 3RESA 2E1HA 5GAOr 3QO3A 5LJ5h 1I4K1 4XTZA 4M77C 4F7UG 5GAOm 1KQ1A 1TH7A 5GMKi 4C92A 2DEQA 2RM4A 3JB9G 4XQ3A 3FIFA 3BDUA 4C92B 1KQ2A 4PJOC 4QVCA 2QTXA 3JCMJ 2EJGA 1LNXA 1BIBA 3JCMQ 3HFOA 4Y91A 4M75F 1H641 3RKXA 4C92E 3M4GA 3SWNB 5LJ5j 3JCMb 4M75D 3PGGA 4M77F 4J6XA 1U1SA 2CGHA 4M77D 4A53A 5CAIA 5GAN7 4C8QG 4J6WA 4PJOG 2I2LA 5GAN5 4M78A 5GAMe 4PJOD 4M78B 4M7AA 3BFMA 4M7AB 5GAMg 2JN0A 1HK9A 5LJ3f 5LJ5d 3JCMP 1I5LA 2DZ9A 4HT8A 4M7DA 4M78E 4J6YA 4M7DB 5GAOl 2DTIA 2FB7A 4M7AE 2VC8A 1WPYA 5GAN3 2DKGA 2FYKA 3FB9A 2DXUA 1N9SA 3L2ZA 4EMKC 4M7DE 4X9CA 4WF2A 4F7UA 5GMKl 2ZGWA 4F7UB 4JRIA 4EMHA 3AHUA 5LJ3j 5GANg 4XTXA 3RIRA 5GMKh 3JCMe 1Y96A 5GAN6 5GAMj 3SWNA 1Y96B 4M75G 3JCMg 3HSBA 4OP0A 4C92C 4M77G 3BW1A 3EFSA 5GAOq 3V8LA
chains in the Genus database with same CATH superfamily
1R77A 1MNDA 3OMGA 2E64A 3JCMV 3EG9B 3EGUA 1WQWA 2CP2A 3CCMQ 2COYA 2DL5A 2OTJQ 5FW9A 4M7DC 1TU0B 2QEXA 2QDLA 3PE0A 3QHSA 4OGEA 4F7UE 1OI1A 4CC4B 4M7AD 1AT1B 3LWHA 4DEYA 3RR6A 2XMFA 1QVGP 3VU3C 2O01E 5GAN2 1YITA 3M5AA 5EG2A 1QCOA 2A3LA 4C0FA 1KC8C 3QYHB 1K9AA 3I55T 2W10A 3TREA 1GCQA 4N4HA 1IRXA 2KQWA 2DK3A 1M1KR 2X3XD 4PJOF 3QUIA 2PNIA 4A4GA 3CPWA 1WGSA 2QDYB 1YJNT 2K5IA 4JS4A 1X6BA 1SKUB 1R0CB 2JTMA 3DB3A 1ACMB 1TH7A 4RTVA 3ME9A 1QVFA 1MMDA 1VYVA 3CBMA 2IIMA 1VOMA 1PC0A 4J9FA 5IN1A 3GLXA 5KYYA 3JCMb 1UUEA 4BE0A 1KK7A 2DJQA 2CGHA 3UWNA 3CCUT 2K3YA 3CMAQ 1YI2T 2EQUA 1GCQC 2CKKA 9ATCB 1M1KU 1IXDA 2XD0A 4RTYA 1WIEA 5FLXE 5D6XA 3DB4A 1AWJA 3H8ZA 2HL5C 3WVEB 4JJBA 3OBYA 1VQ9T 5LJ3j 1QVGS 3ULRB 4B9XA 4JZ3A 2XDPA 2AKLA 4IUPA 3OS0A 2FPDA 3C12A 1OV3A 4D6WA 1HSQA 4C8QE 4KGVB 4WCIA 1VQMT 5IXFA 3E2UA 4FW2A 1GFCA 3OYBA 4ZTFA 4PFPA 1VQNT 1QWFA 3QZ5B 4M75A 2BTTA 1NM7A 2DMOA 2RK2A 2AT1B 5KE3A 4QVDA 1BBZA 2LTOA 2YLCA 1M8VA 2MMPA 3QJ6A 3VYGA 4KT0E 1XQHA 1NPPA 1YCYA 1EZZB 1SHGA 1D0YA 1RAGB 4LNPA 4M75C 1VYUA 4F17A 1I4K1 4XTZA 4XQ3A 3BDUA 1PHTA 4CC7A 5HK0A 4IKFA 4Y91A 3SD4A 3RKXA 1GBRA 3CXCP 3CCLQ 3Q1JA 4J9IA 7AT1B 4KGZB 2RH2A 2R5AA 4C8QG 4M78A 3PT9A 2C0IA 4EDUA 3OYKA 1KQSA 3D7SB 2L3PA 5LJ3f 3OW2A 1M30A 4C0DB 3PTAA 1NEGA 3U23A 1VQOQ 2CP7A 3I5RA 1M4ZA 2QASA 2RJCA 3M57A 1Y96A 3OSVA 1HJDA 3PMIA 5KCOA 5D7UA 2QA4A 4E47A 4J9GA 2GCXA 4JPBW 3JSCA 2DEUA 1BB9A 1C1AA 3CCRT 1MNEA 3INZA 1SPKA 1VQ7T 4C92F 2DPPB 1KD1R 1JQQA 4M78C 2DL8A 2LT1A 4FYVB 4DOVA 1M1GA 2DTHA 3QWYA 4EPCA 5I21A 3I56T 1KSWA 1QMCA 1GXIE 3G4ST 1JU5C 2FPFA 4OB3B 2FRYA 3CC2Q 2FO0A 3X28B 1QKXA 2C0OA 3CCSQ 5FWCA 3VS4A 3IQLA 3QZ9B 4AFSC 4ESRA 3S3MA 4PJOA 2V1RA 2DXTA 2EKHA 2GTOA 3CXCS 1IHWA 4F7UF 4A63B 1MGQA 3ZBDA 5FU7B 8ATCB 2L2PA 4FW1A 2F5KA 3V8KA 3CBPA 4N0AA 2KYBA 1IGUA 1KD1U 5DM7R 2LZ6B 1UTIA 4HCCA 5LJ3e 2DTOA 1VQNQ 1MMNA 1VQPA 2DIGA 3NTHA 2RHUA 1XTDA 1X69A 1OX9A 1JRIA 1TWBA 3CMET 1FX7A 3E9FA 4N4GA 1JJ2S 3JB9G 3FIFA 4PJOC 2DD4A 1UDLA 2K6DA 5HY6A 2QTVA 1G83A 2NUTB 2GGRA 4LDUA 1M9SA 3R6NA 1BKBA 3EG3A 2D1XA 4OMOA 2E5KA 3CPWP 2PTKA 2RI2A 5CKEA 5CQYA 3VUZA 2DE0X 2KMTA 3FEOA 2V8IA 2A28A 5KYWB 1QWEA 1RI0A 4BDZA 2CP5A 5GAN6 1MUZA 2JM8A 3MP8A 4LDVA 1XJWB 2DNUA 1Y07A 1Q82R 4ME7A 3EFSA 1X2KA 4A4HA 3H6ZA 3L2RA 1H8KA 2YWWA 1YHQA 3SDZA 4C8QB 3S3NA 1F1BB 2EYZA 3OA6A 2O9VA 1E6HA 1X2QA 1SEMA 1YJWA 3CD6Q 3CCEA 2JMCA 3CBOA 2XKOC 3KUFA 1ARKA 2O31A 4XTYA 2EQKA 2LJ3A 4LDXA 3SEMA 2PZ1A 2RJEA 4J7IA 2X4JA 2RQUA 4GY5A 4M7DF 2E12A 5IXBA 3E19A 1Q82U 1Q7YR 2QEXQ 1YN8A 4M77E 1E6GA 3VS3A 1H3HA 1PNJA 1YNZA 1VUBA 2L0AA 4D8KA 1IB8A 1RAHB 2DL3A 1S72T 4ANJA 1YITQ 4ZN1A 2DBMA 3HTRA 2ZPBB 2VWFA 2MWPA 3LH0A 3O8VA 3BY7A 5IH2A 2CH4W 3M56A 2KRSA 4JS5A 4EMKB 3C4SA 2X51A 4HA8A 1BK2A 3QG1A 4OVAA 4Z88A 3VS1A 1Q7YU 3H9NA 2DEQA 4J83A 2VASA 1PKTA 1BIBA 1UB4A 2KEAA 2K2VA 4DEXA 1RADB 2LT4A 2YUNA 5GAN7 2P4RA 1SG5A 2GQVA 1JO8A 1MV3A 1Q81R 3VUBA 3OYNA 1T3LA 1M2VB 2EGAA 2R5MA 2AZVA 1N8RR 4M7AE 2FB7A 1W2BA 2OTLA 1YJ9T 1PRLC 1M3BA 2QQSA 4XTXA 3RIRA 2E6NA 3SWNA 2XDBA 3CCVA 4M77G 5GAOq 4KH0B 2F2XA 1WJQA 3DLMA 1KQSP 3OW2P 3FDRA 1AHJB 4NL3A 3CCMT 1LCKA 4R55A 1Q81U 2OTJT 1UJ0A 2FPEA 1N8RU 2NUPB 1W70A 1WHJA 5CKHA 5CK9A 4BI8B 1OZ3A 2RMOA 1WHGA 4RG8A 1RUWA 1M2OA 3RNJA 3A1PA 2PQWA 2ABLA 4II1A 3I5SA 1IGQA 3LGFA 2LVMA 1MMAA 1GRIA 2RA2A 3EGDB 3PVQA 1O9SA 1Q86R 4GLMA 1VQ5T 1IHVA 5KYNA 2DO3A 5LJ3g 1ZHIA 1D1BA 4M7AG 3I35A 2X4XA 1G3YA 1TUGB 4JDSA 3VS7A 4PLIA 3TU4K 5LL6S 3S3OA 5GAOm 4C5EA 3M0UA 1CKAA 1KQSS 2LNHB 1K9MR 4PLLA 4IIOA 3UPUA 2NUTA 4M75F 1H641 1JXMA 2HMAA 5FU7C 2JJ9A 4OGCA 5DLQE 3CMAT 3GF5A 2M02A 3A8OB 1C6VX 2CZ7B 1Q86U 2XIDA 3A98A 3L2WA 1QVPA 1WPYA 5KYWA 1Y7XA 3G71A 2AKKA 3M54A 3QJYA 5IT9E 2L3SA 2A08A 2ZGWA 2Y4XA 1TXQA 1KIKA 4EIKA 5GAMj 1K9MU 3WXMB 1Q81C 2JZ2A 4HKEA 3UA6A 3CC4A 4C8QA 2IVWA 3HRTA 4RTWA 8AT1B 4C5IA 1AWWA 1ZA1B 2M0YA 3FJPA 1UE9A 2A36A 2QA4Q 2RPNA 1C0MA 2VGNA 5L23A 3OYYA 2COZA 3MPUB 1TG0A 4PL6A 3V8JA 3EG2A 2FZGB 3ZL7C 1I0CA 2G6FX 2AHJB 4M78F 5FU6B 3FC3A 1BIAA 1IZ6A 1EIFA 2LQKA 2ECZA 4M77B 2DL4A 3H0HA 4XK8E 2F1LA 1YCSB 2KI7A 2YUQA 5GANj 2RHYA 3MEVA 5GJVB 2MK5A 4C8QC 3LH5A 3OS2A 4FYXB 3PVLA 1SRMA 4ATOA 4JLIA 2YRVA 4ORZA 4X1VA 1VQ4A 2OAWA 4LN2A 2EQMA 1PD0A 2KGTA 4EMKA 2ED1A 5CR2A 5KCHA 1BU1A 1K76A 3CCJA 2MI6A 1VQPQ 3QBYA 5I11A 2XDDA 2E4HA 1LNXA 3CCLT 1RAEB 2VVKA 1RABB 4ELYC 2OAUA 1VQ5Q 4B6MA 4M7AB 4MZMA 2DZ9A 4J6YA 1VQOT 2H3EB 4JJCA 4DA4A 3FB9A 4EMKC 2KT8A 2GFAA 3G6EA 4EMHA 1PRMC 2VKNA 1YP5A 3VS6A 1OX8A 1TOVA 3PIPA 1KHCA 3UDCA 1WHHA 5LJ3d 2QK0A 4QQ6A 2DD5A 1D09B 2YHTA 1B07A 1JBMA 1M90R 1AWXA 3EAEA 3T9NA 2YRDA 2JT4A 2FRWA 1W2BP 3MEAA 1YHQQ 4EMGA 4XU3A 2VUBA 2NUPA 2J6OA 1QW1A 2RNAA 2DM1A 3OB9A 5GANf 4Q5WA 3TSZA 3CC2T 4NL2A 2RB6A 3CCEQ 3CCST 3ZFJA 3M4YA 3CCQA 1NEBA 3V7SA 2IPOB 2MOXA 4FL6A 1MMGA 2RQTA 4L59A 2RHXA 4Z8AA 1VIFA 1YBYA 1TUDA 4NS5A 4BY6B 4IURA 3EGDA 3OY9A 1M90U 3EG0A 2KY9A 2A37A 3QIIA 3J7AF 1WFWA 1RI9A 2E10A 3A8GB 4QT7A 4X34A 1UECA 1NG2A 1WI7A 4R0KA 3OYMA 3FLGA 5J26A 4R56A 2L5QA 1AZGB 3L2VA 5IHNA 3VRZA 1ZQ1A 4P5NA 4GLKA 4C0ZA 2FEIA 2JTEA 3GPLA 3RESA 3G1JA 2JM9A 2L3RA 1QLYA 5IAYA 4TVRA 1Y0MA 2QAZA 3AT1B 1WX6A 3KFVA 3DLLA 2JVVA 3HP9A 4A53A 2BE9B 1P92A 2JNGA 3LWIA 4C5HA 1EX4A 2PU9B 2JN0A 1HK9A 4OMNA 2K3XA 4J9EA 4PJLA 5J39A 1UG1A 3NPFA 3L42A 3VRYA 5KYUB 1M1KC 1X6OA 2B86A 2KE9A 2OTLQ 3V8LA 1PG5B 1VIEA 3CQTA 1WLPB 2QG9B 2R57A 2V8KA 1JXOA 3CCVQ 2HAXA 3CD6T 5LJ3h 4C92D 2YUOA 2EJFA 2PVDB 2F5TX 1U5SA 3MP1A 3M0RA 1CSKA 2XICA 1VQKA 1G3TA 4M77A 3DKMA 1V1CA 4MZPA 2QEXT 2E41A 4DBQA 2P0PA 5CKBA 1M90C 3HKSA 5FRMA 3CC7A 3EG9A 1K73R 4PJJA 2A0FB 2GQIA 1QCFA 2OX7A 1ZUYA 2DRKA 4KULA 1Y57A 2DX1A 2MPXC 4A4EA 1N9RA 4F14A 2OJ2A 3L1AA 1YITT 3L2UA 2VV5A 4OF1A 1Z9QA 2WSEE 3MEUA 2EJ9A 5FROA 3QWXX 2YDLA 1XOVA 2HNIA 2G3RA 3P8DA 1U1TA 1GBQA 5FU6C 1LJOA 2NWMA 1FMKA 3RKYA 3OBWA 3HL8A 1GL5A 2KK4A 2ATCB 2M9UA 4M77C 1KQ1A 2X4WA 1K73U 3JRZA 2QQ9A 1FWZA 3JCMJ 4M4ZA 1ABQA 2XHCA 1WYXA 2QGGA 4F04B 3G6ET 2K9GA 2I2LA 4M7AA 2QI2A 3JCMP 2CUBA 5KYXB 2XU8A 1NJIR 1WXBA 4RUGA 2GBQA 2Y4YA 3GP8A 1UGSB 2CS7A 1M1FA 5A0GA 1KJWA 2CDTA 2MAMA 3REBB 5DLOA 1UGVA 4OP0A 3G71Q 2HCKA 1HD3A 4RG2A 1OEBA 4D8DA 2D8JA 5GAN4 2CT3A 2B8AA 4LD6A 1J3TA 4ZGEB 3JB9H 2DL7A 4M7AC 3NTIA 4E6RA 1QVFP 1VQ8A 2EAYA 1NJIU 4ZTJA 4RTUA 2QGFB 3JB9I 3RERA 1PSEA 2K79A 4J8OA 2E3HA 3O5ZA 3UATA 4Y28E 3FJ5A 2CZ1B 4IUQA 2QYZA 4M7DD 1U8RA 1D1CA 2P4TA 1VQ6A 5IHIA 2QXFA 2LC4A 4JRQA 1UFFA 4OMFB 1VA7A 2DBKA 1JB0E 2RJDA 2K2MA 3META 3MEWA 2GF7A 3FRNA 1YIJA 1YWOA 2KSSA 2HQXA 2CP0A 4C8QF 2EGEA 2VXFA 4XU0A 2VB6A 3F70A 1NLOC 2L3QA 2O4XB 3P8HA 2EYXA 2FVUA 2DRMA 2YLBA 1OZ2A 1KD1C 2YRCA 1AZEA 5I2MA 1VQ4Q 2E1HA 1BI0A 1X75C 3J81E 2SEMA 4QVCA 3CPWS 2H8HA 3JCMQ 3HFOA 3M4GA 3CCJQ 2LQNA 4BY6C 5D6YA 4E2FB 2CT4A 4IIMA 2DERA 1QVFS 3TEEA 1QVGA 2GNCA 3VYHB 2DFUA 4B9WA 2RK1A 5I2SA 4RMOA 3VS2A 2X35A 2FYKA 3RMSA 1RL2A 1N9SA 5KYUA 4WF2A 2JTFA 2F69A 2LCLA 4JRIA 5GANg 4DBRA 4ZGDB 2QQAA 3M58A 3R6OA 4AFUC 1VYTA 3CD6A 2KROA 3A8HB 4XU2A 1M8MA 3TVTA 3G6EQ 1BCMA 3NHNA 1RLPC 1NJIC 1WHLA 2QA4T 4V2SA 1WHMA 2YUPA 1K1ZA 2HQHA 4KH1B 5CO7A 3UA7A 2EVRA 2DZCA 2COWA 1EFNA 1I5LA 2EWNA 3SFMA 2P0KA 3I55A 2MF2A 2MCNA 1T3SA 4DBFA 5M9OA 3JB9F 2KVQG 2J05A 1B7TA 2BKDN 2M1HA 4X9DA 3CCQQ 4XAXB 4C0DC 4QKUA 1Q82C 4KBMB 1GFDA 2CP6A 1YJNA 3S6WA 2QQBA 2EW3A 1OQKA 1KG1A 1QP3A 1H92A 3RBBB 2YT6A 3V7RA 1VQPT 5GAOr 3NGPA 1G5VA 1ZX6A 5GMKi 1ZLMA 4J9CA 3CCUA 1H3ZA 1YI2A 1LVKA 4QVZA 2EJGA 2FZKB 1FYNA 1AOJA 5LJ5j 4M75D 4PJMA 3PGGA 5CKFA 1CKBA 4PJOG 5GAN5 1D0ZA 2EYQA 1Q7YC 5C0MA 2M16A 2HD0A 5J3BA 3BFMA 2EGCA 1UHCA 5A0DA 3QDRB 5KYXA 1VQ9A 4JJDA 1PKSA 2DTIA 2VC8A 2DKGA 1WA7A 2LJ1A 1KC8R 1WZOA 3OW2S 2DVJA 1K8AR 3A5ZB 4Y92A 4PFZA 2CP3A 2HKNA 5L8RE 4MDXA 2DA9A 1SF9A 2GTJA 2J6KA 4A54A 4FU6A 1DJ7B 1VQMA 1JEGA 3TQ7P 1WDXA 2ZCFB 2E5QA 4FCYA 2NUZA 1A0NB 5IHKA 2F2WA 2HKQB 2RD1A 4BE2A 4OB0B 3RDVA 1YHQT 4LXCA 3OYDA 4HCBA 4AG1C 1YFNA 4RCCA 2E65A 2BE7D 1YJWT 4MDWA 5CCAA 1X43A 1I5OB 3CCET 3X26B 1KC8U 4M78D 1RAFB 4J9HA 1NZ9A 3NMZC 1ZBJA 3JCMf 1K8AU 2MIOA 2NYSA 1PCXA 1Q95G 3JCMh 2HSPA 2EYWA 1N8RC 1FXXA 1BCOA 3TCJA 1VQKQ 1PM3A 4PFOA 3P8BB 4QQGA 1X01A 3VS5A 4C5GA 3PMTA 2X3WD 1K4US 1M3CA 2DILA 3CC7Q 1OULA 5GANd 4PJNA 3OYCA 3JAME 2DF6A 2DAQA 1OU8A 1BI1A 1S1NA 1JJ2A 3EH2A 3HRUA 2ENMA 3QPHA 2DVEA 4Z02A 5LJ5f 2HEQA 1QCNA 4RTZA 2JOYA 5D6WA 5LJ5h 1VQLA 2RQRA 2E3IA 1KQ2A 2KXDA 5HCKA 2YSQA 4C92E 3CPFA 4M77F 1U1SA 3L2QA 3X20B 5CAIA 3OSSC 4CC3A 3ZEHA 3OYGA 4PJOD 3QKJA 3QYGB 3SHWA 1NLPC 1G3SA 2V26A 4HT8A 3EH1A 2I0NA 4E7IA 4JLGA 2FG0A 3LLRA 5GMKl 3OYLA 1YWPA 1Q86C 3X25B 4LDWA 3JCMe 3CCRA 2RQVA 2LQWA 3HSBA 4BI3A 2OTLT 1VQ7A 4OB2B 4BUGA 1TUCA 3N5BB 4RCBA 5GMKj 2M51A 1T0JA 4BD3A 4PJOB 3CCVT 4BI4A 1M2VA 5GAMf 6AT1B 2RI3A 5GAMh 1K9MC 1AWOA 2EIFA 2E6ZA 3I56A 1K8AC 2AIRB 3G4SA 4OMLA 3E9GA 5EC7A 5AYFA 2DJZA 2LJ0A 4AG2C 4M7AF 5LJ5e 3QXEB 4HXJA 1VQ8Q 3MO8A 1WXUA 4ZNXA 1N6AA 2O9SA 1K0XA 3H0IA 4C92G 1UHFA 5CIUA 2C06A 3EHQA 1WNLA 1D0XA 2XK0A 3A8LB 2K7AA 2HQEA 1VQ6Q 1O75A 2JUFA 2RF0A 1U3OA 2KNBB 3CMEA 1YJWQ 2DYIA 3OYJA 1E7OA 4BDYA 5GANh 1N5ZA 4IUUA 1YIJQ 1D3BB 4PKCC 2LNVA 5FRNA 1Y71A 4F7UG 3LGLA 5KH6A 2RN8A 2EQJA 1X6GA 1G8XA 2LX9A 2HZYA 2EFIA 1V76A 1QQJA 5GAMe 1KHIA 2K5LA 4HVWA 1W6XA 4OMQA 4CC2A 1TSFA 1TTHB 3M0PA 3EFOB 4AMCA 2GFUA 5I22A 1UGPB 4L6V5 1PWTA 4AFQC 3PIOA 4M7DE 1I1JA 3H41A 5GMKh 3C0CA 2HL3A 2RHZA 3G71T 4OMMA 1M3AA 2HSEB 1W2BS 1ZA2B 1RAIB 1AD5A 3LX7A 1NYFA 2DXBA 4FT4A 3M0SA 2EYYA 2JS0A 3CC4T 2PVGB 4XTUA 2FZCB 4FSXA 2L8DA 1U06A 3VV0A 5GANe 3JCMX 1M5Q1 1BI3A 2J06A 2K4YA 2QQRA 2LCCA 2CYZB 1SHFA 4J7FA 5GAOn 3HRSA 4KUDK 2BZYA 2BIVA 5CKDA 4LD9K 1S72A 2D8HA 3JCMW 2VYTA 2W0ZA 3URGA 1D1AA 2OI3A 1ABOA 2JMAA 2KXCA 1M27C 3I55Q 2X4YA 4ZN3A 1VQLT 4JRPA 2ZPEB 4CI0C 2EQIA 2WSCE 2H3JA 3NFCA 2AZSA 4HT9A 1HXDA 3OYHA 3OS1A 4O5VA 2PVOB 4E7ZA 4AT1B 4M7DG 1MHNA 1VQ4T 5GMKe 1ZBXA 1YJNQ 4BACA 3NTKA 4C92B 5HKCA 2XI9A 1UJYA 1ZSZB 3CCJT 1IO6A 4ZGJB 2CH4A 1TS9A 4KRTA 3SWNB 4CRIA 4J6XA 5FWBA 1JJ2P 4ELZC 3OYAA 3CCUQ 3GNGA 5A0LA 1YI2Q 2V8JA 4FIBA 1PSFA 4FSSA 1YJ9A 4FT2A 2LX7A 3RMQA 5GAOl 1OU9A 1B3QA 4UC4A 2X9HA 4F7UB 4VUBA 2HBPA 2LP5A 1VQ9Q 4JJNK 3JCMg 3CCMA 4BE1A 2J6FA 3ASKA 2OTJA 4J9DA 2CUDA 1UGQB 2JS2A 4LUDA 3GNFB 2DYBA 4DOWA 4MMLA 4RKUE 3RUXA 5HK3A 1VQMQ 2EPDA 1B34B 1T0HA 2PUKB 2DXCA 2NLUA 4XTVA 3MCAB 2VXEA 5LJ5g 3JB9J 1BYMA 4M75E 1SSFA 4LUEA 3C94A 3BDLA 2CREA 3CCQT 1AVZC 1QKWA 1VQ5A 2P84A 2Z0WA 3CC4Q 1ZSGA 5GMKm 1SSHA 1LOJA 4E7SA 3EGXB 3QSUA 2Y90A 4OB1B 2ZPFB 3OYFA 4N0AC 4C8QD 4E7JA 3UF4A 4JZ4A 1D3BA 2HBWA 2CZ0B 1NPRA 4F16A 2LMJA 4HVVA 2MYSA 4OMPA 3CMAA 2HDAA 2WACA 4FM4B 1W1FA 3C95A 4E7KA 1QP2A 1R8OB 2K3BA 4Z89A 1VQLQ 4A4KA 3MKDA 2ZPIB 4J6WA 2EKOA 2CSQA 2LRQA 4N4IA 1LPLA 5GAMg 1K73C 3EFOA 3VS0A 3GOXA 3I9QA 1HYOA 4M78E 4M7DB 2KRMA 1GCPA 3L2ZA 4DBHA 3OYIA 5CQXA 3UT1A 1MV0B 2LQ8A 2D0NA 3J80E 4M75G 3OS5A 2JW4A 2ZPHB 4RTXA 1WJSA 3M0TA 5ECAA 4IUTA 1ZUKA 5DY9A 3SB2A 1G3WA 1K0SA 5AT1B 3CCRQ 3M9QA 5A2QE 4FYWB 4JRKA 2DLPA 3HFNA 1VQ7Q 3VKIA 1R0BG 2KDSA 2ESWA 2F2VA 1V29B 5KE2A 1WXTA 4NOYA 2J7IA 4KGXB 4HVUA 3MJXA 3QDFA 3TSWA 4MMKA 1I81A 3JCMc 3I56Q 3G4SQ 1W4SA 4PNOA 4L5GA 3PNWC 2JXBA 2D6FA 1VQKT 1ZUUA 3V7CA 4PJOE 3JB9D 2CSIA 2K57A 3CC7T 4FYYB 3X24B 3RKWA 1SRLA 1OYXA 2ROTA 2L89A 1IREB 4M78G 2V1QA 3JCMd 1RLQC 1WJRA 1N27A 3EG1A 2O2OA 4E7LA 3MHXA 4J9BA 4KUIA 3EHRA 3CCLA 2R58A 4IUVA 3QO3A 3CMEQ 3M55A 3KBGA 2DETA 1I07A 4C92A 1ZSZA 2KRNA 2ED0A 3JV3A 2BUDA 5KYYB 3M53A 1RACB 1FMVA 1VQOA 1OPLA 5C6SA 2AK5A 3THKA 1AEYA 1NE8A 2P0QA 3HHTB 5LJ5d 2KBTA 3OQ5A 2ZPGB 1XNIA 2LDMA 3CEYA 4X9CA 2RHIA 3MP6A 4F7UA 3VJPA 5GJWB 2KR3A 4WTOB 1WHKA 1NBEB 1NYGA 2RI5A 3M59A 4C92C 2FHDA 3REAB 1ZSZC 5CVIA 4XU1A 4XTWA 3SWNC 4E7HA 2SRCA 3GBQA 3BE3A 3M0QA 4AFZC 3GIBA 4C0GA 3OMCA 3EFRA 4QW2A 3CC2A 4LE9A 3OYEA 2ROLA 4MZTA 3CCSA 1B34A 2BZXA 1WQ7A 1UEBA 1OPKA 2A7YA 1OOTA 3KXTA 1UGRB 2MWOA 2RQWA 4DQ2A 4PK4A 2EBPA 4M75B 1VQ8T 4LDYA 5GAN8 1FMWA 3HPWA 2E70A 4A4FA 5GAMd 2DIQA 2KT1A 2WSFE 1G2BA 2LCSA 1VQNA 1VQ6T 1BI2A 3EGXA 4YTLA 4JUVA 1S72Q 4J5YA 3E1SA 3CXCA 4K11A 3LYIA 3PFSA 3LW5E 2O88A 1I8FA 2FL7A 2YXYA 1Z9ZA 1YIJT 3H0FA 1PD1A 5GAOp 2ZAEA 3WVDB 4BB7A 2RM4A 4HCZA 1X27A 2XG8D 1KFZA 2QTXA 2RO0A 3A8MB 2D0QB 3G7ZA 2K5FA 4RTTA 2C0TA 4M77D 2M0OA 2CZ6B 2PUOB 4M78B 4HCKA 2RJFA 2O4XA 1RAAB 2IG0A 4M7DA 3ER0A 2ZZDA 5GAN3 2DXUA 2KAFA 2KYMA 2VGMA 1YJ9Q 3AHUA 4QQDA 4O6JA 2D9TA 1Y96B 2BZ8A 3BW1A 4GBQA
chains in the Genus database with same CATH topology
1W2BS 4RG2A 1WJQA 3DLMA 1KD1C 5GAN4 2B8AA 3FDRA 3LX7A 3OMGA 1AHJB 2E64A 2DXBA 4FT4A 3JCMV 4NL3A 4LD6A 3CCMT 1WQWA 4ZGEB 4R55A 3CC4T 2PVGB 3JB9H 1Q81U 2OTJT 4XTUA 4M7AC 3NTIA 4FSXA 2L8DA 1N8RU 3VV0A 5GANe 3JCMX 1VQ8A 2EAYA 1NJIU 4M7DC 2QEXA 1M5Q1 5CKHA 4ZTJA 1BI3A 2K4YA 3JB9I 3RERA 1PSEA 4OGEA 3QHSA 4F7UE 2QQRA 5CK9A 2LCCA 1OI1A 2CYZB 4BI8B 1OZ3A 4M7AD 4J8OA 3LWHA 4Y28E 4J7FA 5GAOn 2CZ1B 4IUQA 4RG8A 3HRSA 4KUDK 4M7DD 1U8RA 2BIVA 2P4TA 3VU3C 2O01E 1VQ6A 2QXFA 5GAN2 3M5AA 5EG2A 5CKDA 1YITA 2A3LA 2LC4A 2PQWA 4JRQA 1S72A 4LD9K 4OMFB 4II1A 3JCMW 2VYTA 4C0FA 3URGA 1KC8C 3LGFA 2LVMA 3QYHB 3I55T 1JB0E 2RJDA 3TREA 3META 2RA2A 4N4HA 3MEWA 2X4YA 2GF7A 3FRNA 2KQWA 2ZPEB 4ZN3A 4JRPA 1YIJA 1VQLT 4CI0C 1O9SA 2H3JA 2WSCE 2DK3A 2KSSA 3NFCA 2HQXA 4HT9A 4C8QF 4PJOF 3QUIA 1VQ5T 1HXDA 3OYHA 2DO3A 4A4GA 1ZHIA 2VXFA 4XU0A 5LJ3g 4M7AG 3OS1A 4O5VA 2X4XA 1G3YA 3F70A 2PVOB 3CPWA 4JDSA 2O4XB 1WGSA 1MHNA 3P8HA 2QDYB 1YJNT 4M7DG 2FVUA 4PLIA 2YLBA 1OZ2A 5GMKe 2K5IA 1ZBXA 4JS4A 3TU4K 1VQ4T 5LL6S 5I2MA 4BACA 2E1HA 3S3OA 2JTMA 5GAOm 4C5EA 3DB3A 1TH7A 1BI0A 1X75C 3J81E 3ME9A 3NTKA 4C92B 1QVFA 5HKCA 1KQSS 2XI9A 4QVCA 3CPWS 4PLLA 3CBMA 3UPUA 3JCMQ 3HFOA 5IN1A 3GLXA 4M75F 4ZGJB 1H641 3JCMb 3CCJT 3M4GA 3SWNB 4CRIA 5FU7C 4OGCA 4J6XA 5DLQE 3GF5A 4BY6C 4BE0A 2CGHA 3UWNA 5D6YA 2K3YA 3CCUT 1YI2T 3A8OB 4ELZC 3OYAA 2EQUA 2CZ7B 3GNGA 2CKKA 5A0LA 1QVFS 1Q86U 2V8JA 4FIBA 2XIDA 3TEEA 1M1KU 3L2WA 1PSFA 2XD0A 1QVGA 1YJ9A 3VYHB 4FT2A 4B9WA 5FLXE 2RK1A 5D6XA 1QVPA 3RMQA 5I2SA 5GAOl 4RMOA 1WPYA 2X35A 2FYKA 1Y7XA 3DB4A 3RMSA 3H8ZA 3G71A 1RL2A 3WVEB 1N9SA 3M54A 3QJYA 5IT9E 4UC4A 4WF2A 2ZGWA 3OBYA 2JTFA 2F69A 2LCLA 2Y4XA 4JRIA 4VUBA 4F7UB 5LJ3j 5GANg 1VQ9T 2HBPA 4ZGDB 2QQAA 1QVGS 4JJNK 5GAMj 3M58A 3JCMg 3R6OA 4B9XA 1K9MU 3WXMB 3CCMA 1Q81C 2JZ2A 2XDPA 4BE1A 3A8HB 4HKEA 4XU2A 3CC4A 3ASKA 4IUPA 4C8QA 2OTJA 3OS0A 2IVWA 1UGQB 3C12A 3HRTA 1NJIC 4C5IA 2QA4T 3GNFB 3FJPA 4D6WA 4V2SA 4C8QE 2VGNA 3OYYA 4DOWA 1VQMT 4MMLA 5CO7A 4RKUE 3RUXA 4PL6A 2DZCA 5HK3A 3V8JA 1B34B 3OYBA 4ZTFA 2PUKB 2AHJB 4M78F 5FU6B 2DXCA 3FC3A 2NLUA 1I5LA 1BIAA 1VQNT 1IZ6A 4XTVA 3QZ5B 4M75A 2EWNA 3MCAB 1EIFA 2LQKA 2P0KA 3SFMA 2VXEA 1YHQA 5LJ5g 3JB9J 4M77B 1BYMA 3I55A 4M75E 4XK8E 2MF2A 1SSFA 2RK2A 3C94A 3BDLA 5KE3A 2RHYA 5GANj 4QVDA 3MEVA 5M9OA 3JB9F 2KVQG 3CCQT 2BKDN 4C8QC 3OS2A 1VQ5A 2M1HA 4X9DA 4XAXB 2LTOA 2YLCA 4C0DC 5GMKm 1LOJA 1M8VA 2MMPA 1Q82C 4KBMB 3QSUA 2Y90A 4ATOA 4JLIA 4OB1B 2YRVA 2ZPFB 3QJ6A 1YJNA 3S6WA 3VYGA 2QQBA 1VQ4A 4KT0E 3OYFA 1XQHA 4N0AC 2EQMA 4C8QD 1NPPA 1YCYA 4E7JA 4EMKA 1KG1A 1D3BA 1QP3A 5CR2A 2CZ0B 1NPRA 5KCHA 3V7RA 4M75C 1VQPT 3CCJA 5GAOr 2MI6A 1I4K1 4XTZA 1G5VA 5GMKi 3CMAA 2WACA 4XQ3A 3BDUA 3QBYA 4FM4B 2XDDA 3CCUA 1H3ZA 1YI2A 4QVZA 2EJGA 1LNXA 3C95A 5HK0A 3CCLT 4IKFA 4Y91A 3SD4A 3RKXA 5LJ5j 1QP2A 4E7KA 1R8OB 3Q1JA 4M75D 3PGGA 5CKFA 2RH2A 4A4KA 4ELYC 2R5AA 2ZPIB 4J6WA 4PJOG 4C8QG 2EKOA 2LRQA 2EYQA 4M78A 2OAUA 4N4IA 3PT9A 5C0MA 5GAN5 1Q7YC 2M16A 2HD0A 5J3BA 3BFMA 4M7AB 4EDUA 5GAMg 5LJ3f 4MZMA 3OYKA 3GOXA 3OW2A 1K73C 1KQSA 4C0DB 5A0DA 2DZ9A 3QDRB 4M78E 3PTAA 4J6YA 1VQ9A 1VQOT 4M7DB 2DTIA 2VC8A 2DKGA 3FB9A 4DA4A 3L2ZA 4EMKC 1M4ZA 2RJCA 3OYIA 2GFAA 5CQXA 3UT1A 3G6EA 4EMHA 3M57A 3OW2S 2LQ8A 1Y96A 3A5ZB 3J80E 3OSVA 4M75G 3OS5A 3PMIA 5KCOA 3PIPA 2ZPHB 1KHCA 5L8RE 4MDXA 1WJSA 3UDCA 2QA4A 4E47A 4IUTA 2GCXA 3JSCA 4A54A 5DY9A 3CCRT 3SB2A 5LJ3d 4FU6A 3INZA 1DJ7B 1G3WA 1VQMA 2ZCFB 4QQ6A 2E5QA 3M9QA 2DD5A 1VQ7T 4C92F 2YHTA 5A2QE 1JBMA 2DPPB 4JRKA 3HFNA 3EAEA 2RD1A 4BE2A 3T9NA 3VKIA 4M78C 2KDSA 4OB0B 1YHQT 1V29B 2LT1A 3OYDA 4HCBA 3MEAA 4DOVA 5KE2A 4EMGA 1M1GA 4XU3A 2VUBA 4NOYA 4RCCA 2E65A 2DTHA 1YJWT 4MDWA 5CCAA 1QW1A 4EPCA 4MMKA 5I21A 3OB9A 1I81A 3X26B 5GANf 3I56T 1KC8U 3CCET 4M78D 4Q5WA 3CC2T 1GXIE 4NL2A 3G4ST 3JCMc 2RB6A 3CCST 1NZ9A 4OB3B 3JCMf 3ZFJA 1K8AU 3M4YA 1W4SA 3X28B 3CCQA 3QZ9B 4PNOA 3JCMh 3S3MA 4L5GA 1N8RC 3PNWC 3V7SA 4PJOA 2DXTA 4FL6A 1VQKT 3CXCS 2D6FA 1FXXA 4L59A 2RHXA 3TCJA 3V7CA 1VIFA 4F7UF 1MGQA 1YBYA 4PJOE 3ZBDA 3P8BB 4NS5A 5FU7B 4QQGA 1X01A 4BY6B 2F5KA 3JB9D 4C5GA 3PMTA 4IURA 2K57A 3V8KA 3CBPA 4N0AA 3OY9A 3X24B 3CC7T 1KD1U 1M90U 3RKWA 5DM7R 2KY9A 1OYXA 3QIIA 4HCCA 3J7AF 5GANd 2L89A 1IREB 2E10A 3A8GB 4X34A 5LJ3e 3OYCA 4M78G 3JAME 2DAQA 2DTOA 1BI1A 3JCMd 1JJ2A 3OYMA 1VQPA 2DIGA 3FLGA 5J26A 2L5QA 1WJRA 3HRUA 3NTHA 4R56A 3L2VA 1N27A 4E7LA 3QPHA 1ZQ1A 4P5NA 2RHUA 4GLKA 4C0ZA 1XTDA 2DVEA 3MHXA 4Z02A 5LJ5f 1JRIA 3CMET 4KUIA 3GPLA 2JOYA 1FX7A 2R58A 4IUVA 5D6WA 3RESA 3CCLA 3QO3A 5LJ5h 3E9FA 1VQLA 3M55A 3KBGA 4N4GA 2L3RA 1JJ2S 4C92A 3JB9G 3FIFA 5IAYA 1KQ2A 4TVRA 4PJOC 2DD4A 5HY6A 2BUDA 3M53A 4C92E 3CMAT 3CPFA 4LDUA 4M77F 3DLLA 2JVVA 1M9SA 1U1SA 3HP9A 3L2QA 3X20B 1BKBA 4A53A 5CAIA 3OSSC 1VQOA 1P92A 5C6SA 3ZEHA 3OYGA 1NE8A 4PJOD 2JNGA 3QKJA 3QYGB 3LWIA 2P0QA 4C5HA 2PU9B 2JN0A 1HK9A 1G3SA 2K3XA 2RI2A 3HHTB 5CKEA 5CQYA 3VUZA 3OQ5A 5J39A 5LJ5d 4HT8A 2KMTA 3FEOA 2V8IA 4E7IA 2ZPGB 4JLGA 1RI0A 3L42A 1XNIA 2LDMA 3CEYA 3LLRA 4X9CA 2RHIA 3MP6A 4F7UA 5GMKl 3OYLA 4BDZA 1Q86C 1M1KC 3X25B 3VJPA 4LDWA 3JCMe 5GAN6 3CCRA 3MP8A 4LDVA 3HSBA 1X6OA 3M59A 1Y07A 2RI5A 4BI3A 2OTLT 4ME7A 4C92C 1VQ7A 3EFSA 4OB2B 2FHDA 4A4HA 4BUGA 3V8LA 5CVIA 1VIEA 3N5BB 3H6ZA 4RCBA 5GMKj 3L2RA 4BD3A 4XU1A 4XTWA 3SDZA 3SWNC 4C8QB 3CCVT 4BI4A 2R57A 4E7HA 3S3NA 2V8KA 4PJOB 3OA6A 5GAMf 2HAXA 3CD6T 5LJ3h 4C92D 3GIBA 1YJWA 4C0GA 2RI3A 5GAMh 1K9MC 2EIFA 2EJFA 2E6ZA 3I56A 3CCEA 3OMCA 1K8AC 3EFRA 4QW2A 3CC2A 3G4SA 2PVDB 3OYEA 2F5TX 4MZTA 3CCSA 3E9GA 1B34A 3CBOA 3MP1A 2XKOC 1WQ7A 5AYFA 1UEBA 2A7YA 3KUFA 2DJZA 3KXTA 4XTYA 1UGRB 2MWOA 2EQKA 4LDXA 4M7AF 4DQ2A 2XICA 1VQKA 2RJEA 5LJ5e 4J7IA 2X4JA 4M75B 1VQ8T 1G3TA 4M77A 3QXEB 4LDYA 4GY5A 3DKMA 2E12A 4MZPA 5GAN8 2QEXT 4M7DF 3E19A 3MO8A 2E41A 2P0PA 3HPWA 5CKBA 1Q82U 2E70A 3HKSA 1M90C 5FRMA 4A4FA 5GAMd 3CC7A 1N6AA 4M77E 2DIQA 4C92G 5CIUA 2C06A 1VUBA 2WSFE 1WNLA 4KULA 4A4EA 2XK0A 1N9RA 3L1AA 1VQNA 3A8LB 1VQ6T 1BI2A 1YITT 3L2UA 2VV5A 2HQEA 1S72T 4OF1A 2WSEE 1O75A 2JUFA 4YTLA 3MEUA 4ZN1A 4JUVA 2ZPBB 4J5YA 2EJ9A 3E1SA 3CXCA 3LYIA 2MWPA 3LH0A 3O8VA 3BY7A 3PFSA 5FROA 3CMEA 3M56A 3LW5E 1I8FA 3OYJA 2FL7A 1XOVA 2HNIA 2G3RA 3P8DA 1YIJT 4BDYA 1U1TA 5GANh 4JS5A 4EMKB 4IUUA 5FU6C 1D3BB 3C4SA 1LJOA 4PKCC 3RKYA 5GAOp 3OBWA 4HA8A 3HL8A 2LNVA 5FRNA 3QG1A 2KK4A 2M9UA 4OVAA 1Y71A 4M77C 3WVDB 1KQ1A 4F7UG 1Q7YU 2DEQA 2RM4A 2X4WA 4BB7A 4HCZA 1K73U 3JRZA 2XG8D 3LGLA 2QQ9A 4J83A 1FWZA 2QTXA 3JCMJ 5KH6A 1BIBA 1UB4A 2RO0A 3A8MB 2D0QB 2XHCA 2EQJA 2K5FA 3G7ZA 2K2VA 2LX9A 3G6ET 2EFIA 4M77D 2M0OA 2LT4A 5GAN7 2CZ6B 2PUOB 2I2LA 2GQVA 5GAMe 4M78B 1KHIA 2K5LA 4M7AA 2RJFA 2O4XA 2QI2A 3VUBA 3OYNA 3JCMP 2GFUA 2IG0A 1UGPB 2R5MA 4L6V5 4M7DA 3ER0A 2ZZDA 4M7AE 2FB7A 2XU8A 5GAN3 2DXUA 3PIOA 2Y4YA 2KAFA 1W2BA 1YJ9T 2OTLA 4M7DE 3GP8A 1UGSB 2CS7A 2VGMA 3AHUA 1M1FA 2QQSA 4QQDA 4XTXA 4O6JA 3RIRA 5GMKh 5A0GA 2RHZA 2E6NA 2D9TA 2MAMA 3SWNA 5DLOA 1Y96B 3G71T 2XDBA 3CCVA 4OP0A 4M77G 3BW1A 5GAOq 3CD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XU2 A;  5GMK j;  4RCB A;  4A54 A;  5DY9 A;  3SB2 A;  5LJ3 d;  4C8Q A;  4XU1 A;  3INZ A;  4XTW A;  3SWN C;  4C8Q B;  5GAN 4;  4PJO B;  2E64 A;  3JCM V;  4NL3 A;  3FJP A;  4C92 F;  2YHT A;  5GAM f;  4V2S A;  1JBM A;  4JRK A;  1WQW A;  4C8Q E;  3HFN A;  5LJ3 h;  2RD1 A;  4C92 D;  3GIB A;  3JB9 H;  4M78 C;  5GAM h;  4XTU A;  4M7A C;  2EJF A;  4MML A;  3RUX A;  3EFR A;  2DZC A;  3V8J A;  4EMG A;  5GAN e;  3JCM X;  1B34 A;  4XU3 A;  4NOY A;  2EAY A;  4RCC A;  4M7D C;  1B34 B;  1WQ7 A;  2E65 A;  2DTH A;  1M5Q 1;  2DJZ A;  4M78 F;  4XTY A;  4MMK A;  5I21 A;  3JB9 I;  1I81 A;  1BIA A;  5GAN f;  3QHS A;  4DQ2 A;  4XTV A;  4M78 D;  4F7U E;  3RER A;  4M7A F;  4M75 A;  2EWN A;  4NL2 A;  2RB6 A;  3JCM c;  5LJ5 e;  4M7A D;  4M75 B;  3JCM f;  4M77 A;  2VXE A;  5LJ5 g;  4M7D F;  5GAO n;  3JB9 J;  4M77 B;  5GAN 8;  2E41 A;  4PNO A;  4M7D D;  3JCM h;  4PJO A;  4M75 E;  3V7S A;  3VU3 C;  2DXT A;  5GAM d;  5GAN 2;  4M77 E;  3V7C A;  4F7U F;  4C92 G;  5GAN j;  4QVD A;  3JCM W;  1MGQ A;  4PJO E;  3JB9 F;  1WNL A;  1X01 A;  4C8Q C;  1N9R A;  3JB9 D;  3L1A A;  4X9D A;  2K57 A;  3V8K A;  4N0A A;  2RA2 A;  2YLC A;  3RKW A;  5GMK m;  1LOJ A;  1M8V A;  4JUV A;  3QSU A;  4J5Y A;  2EJ9 A;  2Y90 A;  5GAN d;  4JLI A;  2E10 A;  5LJ3 e;  4HT9 A;  3BY7 A;  4M78 G;  3QUI A;  4PJO F;  1HXD A;  4C8Q F;  2DTO A;  3JCM d;  4N0A C;  5LJ3 g;  4XU0 A;  2VXF A;  1I8F A;  4C8Q D;  4M7A G;  1YCY A;  2HNI A;  1U1T A;  5GAN h;  4EMK A;  4EMK B;  4M7D G;  1D3B A;  1D3B B;  2DVE A;  2YLB A;  1LJO A;  5GMK e;  5LJ5 f;  1JRI A;  5GAO p;  3RKY A;  3V7R A;  4HA8 A;  4M75 C;  3RES A;  2E1H A;  5GAO r;  3QO3 A;  5LJ5 h;  1I4K 1;  4XTZ A;  4M77 C;  4F7U G;  5GAO m;  1KQ1 A;  1TH7 A;  5GMK i;  4C92 A;  2DEQ A;  2RM4 A;  3JB9 G;  4XQ3 A;  3FIF A;  3BDU A;  4C92 B;  1KQ2 A;  4PJO C;  4QVC A;  2QTX A;  3JCM J;  2EJG A;  1LNX A;  1BIB A;  3JCM Q;  3HFO A;  4Y91 A;  4M75 F;  1H64 1;  3RKX A;  4C92 E;  3M4G A;  3SWN B;  5LJ5 j;  3JCM b;  4M75 D;  3PGG A;  4M77 F;  4J6X A;  1U1S A;  2CGH A;  4M77 D;  4A53 A;  5CAI A;  5GAN 7;  4C8Q G;  4J6W A;  4PJO G;  2I2L A;  5GAN 5;  4M78 A;  5GAM e;  4PJO D;  4M78 B;  4M7A A;  3BFM A;  4M7A B;  5GAM g;  2JN0 A;  1HK9 A;  5LJ3 f;  5LJ5 d;  3JCM P;  1I5L A;  2DZ9 A;  4HT8 A;  4M7D A;  4M78 E;  4J6Y A;  4M7D B;  5GAO l;  2DTI A;  2FB7 A;  4M7A E;  2VC8 A;  1WPY A;  5GAN 3;  2DKG A;  2FYK A;  3FB9 A;  2DXU A;  1N9S A;  3L2Z A;  4EMK C;  4M7D E;  4X9C A;  4WF2 A;  4F7U A;  5GMK l;  2ZGW A;  4F7U B;  4JRI A;  4EMH A;  3AHU A;  5LJ3 j;  5GAN g;  4XTX A;  3RIR A;  5GMK h;  3JCM e;  1Y96 A;  5GAN 6;  5GAM j;  3SWN A;  1Y96 B;  4M75 G;  3JCM g;  3HSB A;  4OP0 A;  4C92 C;  4M77 G;  3BW1 A;  3EFS A;  5GAO q;  3V8L A; 
#chains in the Genus database with same CATH topology
 1R77 A;  1MND A;  3OMG A;  2E64 A;  3JCM V;  3EG9 B;  3EGU A;  1WQW A;  2CP2 A;  3CCM Q;  2COY A;  2DL5 A;  2OTJ Q;  5FW9 A;  4M7D C;  1TU0 B;  2QEX A;  2QDL A;  3PE0 A;  3QHS A;  4OGE A;  4F7U E;  1OI1 A;  4CC4 B;  4M7A D;  1AT1 B;  3LWH A;  4DEY A;  3RR6 A;  2XMF A;  1QVG P;  3VU3 C;  2O01 E;  5GAN 2;  1YIT A;  3M5A A;  5EG2 A;  1QCO A;  2A3L A;  4C0F A;  1KC8 C;  3QYH B;  1K9A A;  3I55 T;  2W10 A;  3TRE A;  1GCQ A;  4N4H A;  1IRX A;  2KQW A;  2DK3 A;  1M1K R;  2X3X D;  4PJO F;  3QUI A;  2PNI A;  4A4G A;  3CPW A;  1WGS A;  2QDY B;  1YJN T;  2K5I A;  4JS4 A;  1X6B A;  1SKU B;  1R0C B;  2JTM A;  3DB3 A;  1ACM B;  1TH7 A;  4RTV A;  3ME9 A;  1QVF A;  1MMD A;  1VYV A;  3CBM A;  2IIM A;  1VOM A;  1PC0 A;  4J9F A;  5IN1 A;  3GLX A;  5KYY A;  3JCM b;  1UUE A;  4BE0 A;  1KK7 A;  2DJQ A;  2CGH A;  3UWN A;  3CCU T;  2K3Y A;  3CMA Q;  1YI2 T;  2EQU A;  1GCQ C;  2CKK A;  9ATC B;  1M1K U;  1IXD A;  2XD0 A;  4RTY A;  1WIE A;  5FLX E;  5D6X A;  3DB4 A;  1AWJ A;  3H8Z A;  2HL5 C;  3WVE B;  4JJB A;  3OBY A;  1VQ9 T;  5LJ3 j;  1QVG S;  3ULR B;  4B9X A;  4JZ3 A;  2XDP A;  2AKL A;  4IUP A;  3OS0 A;  2FPD A;  3C12 A;  1OV3 A;  4D6W A;  1HSQ A;  4C8Q E;  4KGV B;  4WCI A;  1VQM T;  5IXF A;  3E2U A;  4FW2 A;  1GFC A;  3OYB A;  4ZTF A;  4PFP A;  1VQN T;  1QWF A;  3QZ5 B;  4M75 A;  2BTT A;  1NM7 A;  2DMO A;  2RK2 A;  2AT1 B;  5KE3 A;  4QVD A;  1BBZ A;  2LTO A;  2YLC A;  1M8V A;  2MMP A;  3QJ6 A;  3VYG A;  4KT0 E;  1XQH A;  1NPP A;  1YCY A;  1EZZ B;  1SHG A;  1D0Y A;  1RAG B;  4LNP A;  4M75 C;  1VYU A;  4F17 A;  1I4K 1;  4XTZ A;  4XQ3 A;  3BDU A;  1PHT A;  4CC7 A;  5HK0 A;  4IKF A;  4Y91 A;  3SD4 A;  3RKX A;  1GBR A;  3CXC P;  3CCL Q;  3Q1J A;  4J9I A;  7AT1 B;  4KGZ B;  2RH2 A;  2R5A A;  4C8Q G;  4M78 A;  3PT9 A;  2C0I A;  4EDU A;  3OYK A;  1KQS A;  3D7S B;  2L3P A;  5LJ3 f;  3OW2 A;  1M30 A;  4C0D B;  3PTA A;  1NEG A;  3U23 A;  1VQO Q;  2CP7 A;  3I5R A;  1M4Z A;  2QAS A;  2RJC A;  3M57 A;  1Y96 A;  3OSV A;  1HJD A;  3PMI A;  5KCO A;  5D7U A;  2QA4 A;  4E47 A;  4J9G A;  2GCX A;  4JPB W;  3JSC A;  2DEU A;  1BB9 A;  1C1A A;  3CCR T;  1MNE A;  3INZ A;  1SPK A;  1VQ7 T;  4C92 F;  2DPP B;  1KD1 R;  1JQQ A;  4M78 C;  2DL8 A;  2LT1 A;  4FYV B;  4DOV A;  1M1G A;  2DTH A;  3QWY A;  4EPC A;  5I21 A;  3I56 T;  1KSW A;  1QMC A;  1GXI E;  3G4S T;  1JU5 C;  2FPF A;  4OB3 B;  2FRY A;  3CC2 Q;  2FO0 A;  3X28 B;  1QKX A;  2C0O A;  3CCS Q;  5FWC A;  3VS4 A;  3IQL A;  3QZ9 B;  4AFS C;  4ESR A;  3S3M A;  4PJO A;  2V1R A;  2DXT A;  2EKH A;  2GTO A;  3CXC S;  1IHW A;  4F7U F;  4A63 B;  1MGQ A;  3ZBD A;  5FU7 B;  8ATC B;  2L2P A;  4FW1 A;  2F5K A;  3V8K A;  3CBP A;  4N0A A;  2KYB A;  1IGU A;  1KD1 U;  5DM7 R;  2LZ6 B;  1UTI A;  4HCC A;  5LJ3 e;  2DTO A;  1VQN Q;  1MMN A;  1VQP A;  2DIG A;  3NTH A;  2RHU A;  1XTD A;  1X69 A;  1OX9 A;  1JRI A;  1TWB A;  3CME T;  1FX7 A;  3E9F A;  4N4G A;  1JJ2 S;  3JB9 G;  3FIF A;  4PJO C;  2DD4 A;  1UDL A;  2K6D A;  5HY6 A;  2QTV A;  1G83 A;  2NUT B;  2GGR A;  4LDU A;  1M9S A;  3R6N A;  1BKB A;  3EG3 A;  2D1X A;  4OMO A;  2E5K A;  3CPW P;  2PTK A;  2RI2 A;  5CKE A;  5CQY A;  3VUZ A;  2DE0 X;  2KMT A;  3FEO A;  2V8I A;  2A28 A;  5KYW B;  1QWE A;  1RI0 A;  4BDZ A;  2CP5 A;  5GAN 6;  1MUZ A;  2JM8 A;  3MP8 A;  4LDV A;  1XJW B;  2DNU A;  1Y07 A;  1Q82 R;  4ME7 A;  3EFS A;  1X2K A;  4A4H A;  3H6Z A;  3L2R A;  1H8K A;  2YWW A;  1YHQ A;  3SDZ A;  4C8Q B;  3S3N A;  1F1B B;  2EYZ A;  3OA6 A;  2O9V A;  1E6H A;  1X2Q A;  1SEM A;  1YJW A;  3CD6 Q;  3CCE A;  2JMC A;  3CBO A;  2XKO C;  3KUF A;  1ARK A;  2O31 A;  4XTY A;  2EQK A;  2LJ3 A;  4LDX A;  3SEM A;  2PZ1 A;  2RJE A;  4J7I A;  2X4J A;  2RQU A;  4GY5 A;  4M7D F;  2E12 A;  5IXB A;  3E19 A;  1Q82 U;  1Q7Y R;  2QEX Q;  1YN8 A;  4M77 E;  1E6G A;  3VS3 A;  1H3H A;  1PNJ A;  1YNZ A;  1VUB A;  2L0A A;  4D8K A;  1IB8 A;  1RAH B;  2DL3 A;  1S72 T;  4ANJ A;  1YIT Q;  4ZN1 A;  2DBM A;  3HTR A;  2ZPB B;  2VWF A;  2MWP A;  3LH0 A;  3O8V A;  3BY7 A;  5IH2 A;  2CH4 W;  3M56 A;  2KRS A;  4JS5 A;  4EMK B;  3C4S A;  2X51 A;  4HA8 A;  1BK2 A;  3QG1 A;  4OVA A;  4Z88 A;  3VS1 A;  1Q7Y U;  3H9N A;  2DEQ A;  4J83 A;  2VAS A;  1PKT A;  1BIB A;  1UB4 A;  2KEA A;  2K2V A;  4DEX A;  1RAD B;  2LT4 A;  2YUN A;  5GAN 7;  2P4R A;  1SG5 A;  2GQV A;  1JO8 A;  1MV3 A;  1Q81 R;  3VUB A;  3OYN A;  1T3L A;  1M2V B;  2EGA A;  2R5M A;  2AZV A;  1N8R R;  4M7A E;  2FB7 A;  1W2B A;  2OTL A;  1YJ9 T;  1PRL C;  1M3B A;  2QQS A;  4XTX A;  3RIR A;  2E6N A;  3SWN A;  2XDB A;  3CCV A;  4M77 G;  5GAO q;  4KH0 B;  2F2X A;  1WJQ A;  3DLM A;  1KQS P;  3OW2 P;  3FDR A;  1AHJ B;  4NL3 A;  3CCM T;  1LCK A;  4R55 A;  1Q81 U;  2OTJ T;  1UJ0 A;  2FPE A;  1N8R U;  2NUP B;  1W70 A;  1WHJ A;  5CKH A;  5CK9 A;  4BI8 B;  1OZ3 A;  2RMO A;  1WHG A;  4RG8 A;  1RUW A;  1M2O A;  3RNJ A;  3A1P A;  2PQW A;  2ABL A;  4II1 A;  3I5S A;  1IGQ A;  3LGF A;  2LVM A;  1MMA A;  1GRI A;  2RA2 A;  3EGD B;  3PVQ A;  1O9S A;  1Q86 R;  4GLM A;  1VQ5 T;  1IHV A;  5KYN A;  2DO3 A;  5LJ3 g;  1ZHI A;  1D1B A;  4M7A G;  3I35 A;  2X4X A;  1G3Y A;  1TUG B;  4JDS A;  3VS7 A;  4PLI A;  3TU4 K;  5LL6 S;  3S3O A;  5GAO m;  4C5E A;  3M0U A;  1CKA A;  1KQS S;  2LNH B;  1K9M R;  4PLL A;  4IIO A;  3UPU A;  2NUT A;  4M75 F;  1H64 1;  1JXM A;  2HMA A;  5FU7 C;  2JJ9 A;  4OGC A;  5DLQ E;  3CMA T;  3GF5 A;  2M02 A;  3A8O B;  1C6V X;  2CZ7 B;  1Q86 U;  2XID A;  3A98 A;  3L2W A;  1QVP A;  1WPY A;  5KYW A;  1Y7X A;  3G71 A;  2AKK A;  3M54 A;  3QJY A;  5IT9 E;  2L3S A;  2A08 A;  2ZGW A;  2Y4X A;  1TXQ A;  1KIK A;  4EIK A;  5GAM j;  1K9M U;  3WXM B;  1Q81 C;  2JZ2 A;  4HKE A;  3UA6 A;  3CC4 A;  4C8Q A;  2IVW A;  3HRT A;  4RTW A;  8AT1 B;  4C5I A;  1AWW A;  1ZA1 B;  2M0Y A;  3FJP A;  1UE9 A;  2A36 A;  2QA4 Q;  2RPN A;  1C0M A;  2VGN A;  5L23 A;  3OYY A;  2COZ A;  3MPU B;  1TG0 A;  4PL6 A;  3V8J A;  3EG2 A;  2FZG B;  3ZL7 C;  1I0C A;  2G6F X;  2AHJ B;  4M78 F;  5FU6 B;  3FC3 A;  1BIA A;  1IZ6 A;  1EIF A;  2LQK A;  2ECZ A;  4M77 B;  2DL4 A;  3H0H A;  4XK8 E;  2F1L A;  1YCS B;  2KI7 A;  2YUQ A;  5GAN j;  2RHY A;  3MEV A;  5GJV B;  2MK5 A;  4C8Q C;  3LH5 A;  3OS2 A;  4FYX B;  3PVL A;  1SRM A;  4ATO A;  4JLI A;  2YRV A;  4ORZ A;  4X1V A;  1VQ4 A;  2OAW A;  4LN2 A;  2EQM A;  1PD0 A;  2KGT A;  4EMK A;  2ED1 A;  5CR2 A;  5KCH A;  1BU1 A;  1K76 A;  3CCJ A;  2MI6 A;  1VQP Q;  3QBY A;  5I11 A;  2XDD A;  2E4H A;  1LNX A;  3CCL T;  1RAE B;  2VVK A;  1RAB B;  4ELY C;  2OAU A;  1VQ5 Q;  4B6M A;  4M7A B;  4MZM A;  2DZ9 A;  4J6Y A;  1VQO T;  2H3E B;  4JJC A;  4DA4 A;  3FB9 A;  4EMK C;  2KT8 A;  2GFA A;  3G6E A;  4EMH A;  1PRM C;  2VKN A;  1YP5 A;  3VS6 A;  1OX8 A;  1TOV A;  3PIP A;  1KHC A;  3UDC A;  1WHH A;  5LJ3 d;  2QK0 A;  4QQ6 A;  2DD5 A;  1D09 B;  2YHT A;  1B07 A;  1JBM A;  1M90 R;  1AWX A;  3EAE A;  3T9N A;  2YRD A;  2JT4 A;  2FRW A;  1W2B P;  3MEA A;  1YHQ Q;  4EMG A;  4XU3 A;  2VUB A;  2NUP A;  2J6O A;  1QW1 A;  2RNA A;  2DM1 A;  3OB9 A;  5GAN f;  4Q5W A;  3TSZ A;  3CC2 T;  4NL2 A;  2RB6 A;  3CCE Q;  3CCS T;  3ZFJ A;  3M4Y A;  3CCQ A;  1NEB A;  3V7S A;  2IPO B;  2MOX A;  4FL6 A;  1MMG A;  2RQT A;  4L59 A;  2RHX A;  4Z8A A;  1VIF A;  1YBY A;  1TUD A;  4NS5 A;  4BY6 B;  4IUR A;  3EGD A;  3OY9 A;  1M90 U;  3EG0 A;  2KY9 A;  2A37 A;  3QII A;  3J7A F;  1WFW A;  1RI9 A;  2E10 A;  3A8G B;  4QT7 A;  4X34 A;  1UEC A;  1NG2 A;  1WI7 A;  4R0K A;  3OYM A;  3FLG A;  5J26 A;  4R56 A;  2L5Q A;  1AZG B;  3L2V A;  5IHN A;  3VRZ A;  1ZQ1 A;  4P5N A;  4GLK A;  4C0Z A;  2FEI A;  2JTE A;  3GPL A;  3RES A;  3G1J A;  2JM9 A;  2L3R A;  1QLY A;  5IAY A;  4TVR A;  1Y0M A;  2QAZ A;  3AT1 B;  1WX6 A;  3KFV A;  3DLL A;  2JVV A;  3HP9 A;  4A53 A;  2BE9 B;  1P92 A;  2JNG A;  3LWI A;  4C5H A;  1EX4 A;  2PU9 B;  2JN0 A;  1HK9 A;  4OMN A;  2K3X A;  4J9E A;  4PJL A;  5J39 A;  1UG1 A;  3NPF A;  3L42 A;  3VRY A;  5KYU B;  1M1K C;  1X6O A;  2B86 A;  2KE9 A;  2OTL Q;  3V8L A;  1PG5 B;  1VIE A;  3CQT A;  1WLP B;  2QG9 B;  2R57 A;  2V8K A;  1JXO A;  3CCV Q;  2HAX A;  3CD6 T;  5LJ3 h;  4C92 D;  2YUO A;  2EJF A;  2PVD B;  2F5T X;  1U5S A;  3MP1 A;  3M0R A;  1CSK A;  2XIC A;  1VQK A;  1G3T A;  4M77 A;  3DKM A;  1V1C A;  4MZP A;  2QEX T;  2E41 A;  4DBQ A;  2P0P A;  5CKB A;  1M90 C;  3HKS A;  5FRM A;  3CC7 A;  3EG9 A;  1K73 R;  4PJJ A;  2A0F B;  2GQI A;  1QCF A;  2OX7 A;  1ZUY A;  2DRK A;  4KUL A;  1Y57 A;  2DX1 A;  2MPX C;  4A4E A;  1N9R A;  4F14 A;  2OJ2 A;  3L1A A;  1YIT T;  3L2U A;  2VV5 A;  4OF1 A;  1Z9Q A;  2WSE E;  3MEU A;  2EJ9 A;  5FRO A;  3QWX X;  2YDL A;  1XOV A;  2HNI A;  2G3R A;  3P8D A;  1U1T A;  1GBQ A;  5FU6 C;  1LJO A;  2NWM A;  1FMK A;  3RKY A;  3OBW A;  3HL8 A;  1GL5 A;  2KK4 A;  2ATC B;  2M9U A;  4M77 C;  1KQ1 A;  2X4W A;  1K73 U;  3JRZ A;  2QQ9 A;  1FWZ A;  3JCM J;  4M4Z A;  1ABQ A;  2XHC A;  1WYX A;  2QGG A;  4F04 B;  3G6E T;  2K9G A;  2I2L A;  4M7A A;  2QI2 A;  3JCM P;  2CUB A;  5KYX B;  2XU8 A;  1NJI R;  1WXB A;  4RUG A;  2GBQ A;  2Y4Y A;  3GP8 A;  1UGS B;  2CS7 A;  1M1F A;  5A0G A;  1KJW A;  2CDT A;  2MAM A;  3REB B;  5DLO A;  1UGV A;  4OP0 A;  3G71 Q;  2HCK A;  1HD3 A;  4RG2 A;  1OEB A;  4D8D A;  2D8J A;  5GAN 4;  2CT3 A;  2B8A A;  4LD6 A;  1J3T A;  4ZGE B;  3JB9 H;  2DL7 A;  4M7A C;  3NTI A;  4E6R A;  1QVF P;  1VQ8 A;  2EAY A;  1NJI U;  4ZTJ A;  4RTU A;  2QGF B;  3JB9 I;  3RER A;  1PSE A;  2K79 A;  4J8O A;  2E3H A;  3O5Z A;  3UAT A;  4Y28 E;  3FJ5 A;  2CZ1 B;  4IUQ A;  2QYZ A;  4M7D D;  1U8R A;  1D1C A;  2P4T A;  1VQ6 A;  5IHI A;  2QXF A;  2LC4 A;  4JRQ A;  1UFF A;  4OMF B;  1VA7 A;  2DBK A;  1JB0 E;  2RJD A;  2K2M A;  3MET A;  3MEW A;  2GF7 A;  3FRN A;  1YIJ A;  1YWO A;  2KSS A;  2HQX A;  2CP0 A;  4C8Q F;  2EGE A;  2VXF A;  4XU0 A;  2VB6 A;  3F70 A;  1NLO C;  2L3Q A;  2O4X B;  3P8H A;  2EYX A;  2FVU A;  2DRM A;  2YLB A;  1OZ2 A;  1KD1 C;  2YRC A;  1AZE A;  5I2M A;  1VQ4 Q;  2E1H A;  1BI0 A;  1X75 C;  3J81 E;  2SEM A;  4QVC A;  3CPW S;  2H8H A;  3JCM Q;  3HFO A;  3M4G A;  3CCJ Q;  2LQN A;  4BY6 C;  5D6Y A;  4E2F B;  2CT4 A;  4IIM A;  2DER A;  1QVF S;  3TEE A;  1QVG A;  2GNC A;  3VYH B;  2DFU A;  4B9W A;  2RK1 A;  5I2S A;  4RMO A;  3VS2 A;  2X35 A;  2FYK A;  3RMS A;  1RL2 A;  1N9S A;  5KYU A;  4WF2 A;  2JTF A;  2F69 A;  2LCL A;  4JRI A;  5GAN g;  4DBR A;  4ZGD B;  2QQA A;  3M58 A;  3R6O A;  4AFU C;  1VYT A;  3CD6 A;  2KRO A;  3A8H B;  4XU2 A;  1M8M A;  3TVT A;  3G6E Q;  1BCM A;  3NHN A;  1RLP C;  1NJI C;  1WHL A;  2QA4 T;  4V2S A;  1WHM A;  2YUP A;  1K1Z A;  2HQH A;  4KH1 B;  5CO7 A;  3UA7 A;  2EVR A;  2DZC A;  2COW A;  1EFN A;  1I5L A;  2EWN A;  3SFM A;  2P0K A;  3I55 A;  2MF2 A;  2MCN A;  1T3S A;  4DBF A;  5M9O A;  3JB9 F;  2KVQ G;  2J05 A;  1B7T A;  2BKD N;  2M1H A;  4X9D A;  3CCQ Q;  4XAX B;  4C0D C;  4QKU A;  1Q82 C;  4KBM B;  1GFD A;  2CP6 A;  1YJN A;  3S6W A;  2QQB A;  2EW3 A;  1OQK A;  1KG1 A;  1QP3 A;  1H92 A;  3RBB B;  2YT6 A;  3V7R A;  1VQP T;  5GAO r;  3NGP A;  1G5V A;  1ZX6 A;  5GMK i;  1ZLM A;  4J9C A;  3CCU A;  1H3Z A;  1YI2 A;  1LVK A;  4QVZ A;  2EJG A;  2FZK B;  1FYN A;  1AOJ A;  5LJ5 j;  4M75 D;  4PJM A;  3PGG A;  5CKF A;  1CKB A;  4PJO G;  5GAN 5;  1D0Z A;  2EYQ A;  1Q7Y C;  5C0M A;  2M16 A;  2HD0 A;  5J3B A;  3BFM A;  2EGC A;  1UHC A;  5A0D A;  3QDR B;  5KYX A;  1VQ9 A;  4JJD A;  1PKS A;  2DTI A;  2VC8 A;  2DKG A;  1WA7 A;  2LJ1 A;  1KC8 R;  1WZO A;  3OW2 S;  2DVJ A;  1K8A R;  3A5Z B;  4Y92 A;  4PFZ A;  2CP3 A;  2HKN A;  5L8R E;  4MDX A;  2DA9 A;  1SF9 A;  2GTJ A;  2J6K A;  4A54 A;  4FU6 A;  1DJ7 B;  1VQM A;  1JEG A;  3TQ7 P;  1WDX A;  2ZCF B;  2E5Q A;  4FCY A;  2NUZ A;  1A0N B;  5IHK A;  2F2W A;  2HKQ B;  2RD1 A;  4BE2 A;  4OB0 B;  3RDV A;  1YHQ T;  4LXC A;  3OYD A;  4HCB A;  4AG1 C;  1YFN A;  4RCC A;  2E65 A;  2BE7 D;  1YJW T;  4MDW A;  5CCA A;  1X43 A;  1I5O B;  3CCE T;  3X26 B;  1KC8 U;  4M78 D;  1RAF B;  4J9H A;  1NZ9 A;  3NMZ C;  1ZBJ A;  3JCM f;  1K8A U;  2MIO A;  2NYS A;  1PCX A;  1Q95 G;  3JCM h;  2HSP A;  2EYW A;  1N8R C;  1FXX A;  1BCO A;  3TCJ A;  1VQK Q;  1PM3 A;  4PFO A;  3P8B B;  4QQG A;  1X01 A;  3VS5 A;  4C5G A;  3PMT A;  2X3W D;  1K4U S;  1M3C A;  2DIL A;  3CC7 Q;  1OUL A;  5GAN d;  4PJN A;  3OYC A;  3JAM E;  2DF6 A;  2DAQ A;  1OU8 A;  1BI1 A;  1S1N A;  1JJ2 A;  3EH2 A;  3HRU A;  2ENM A;  3QPH A;  2DVE A;  4Z02 A;  5LJ5 f;  2HEQ A;  1QCN A;  4RTZ A;  2JOY A;  5D6W A;  5LJ5 h;  1VQL A;  2RQR A;  2E3I A;  1KQ2 A;  2KXD A;  5HCK A;  2YSQ A;  4C92 E;  3CPF A;  4M77 F;  1U1S A;  3L2Q A;  3X20 B;  5CAI A;  3OSS C;  4CC3 A;  3ZEH A;  3OYG A;  4PJO D;  3QKJ A;  3QYG B;  3SHW A;  1NLP C;  1G3S A;  2V26 A;  4HT8 A;  3EH1 A;  2I0N A;  4E7I A;  4JLG A;  2FG0 A;  3LLR A;  5GMK l;  3OYL A;  1YWP A;  1Q86 C;  3X25 B;  4LDW A;  3JCM e;  3CCR A;  2RQV A;  2LQW A;  3HSB A;  4BI3 A;  2OTL T;  1VQ7 A;  4OB2 B;  4BUG A;  1TUC A;  3N5B B;  4RCB A;  5GMK j;  2M51 A;  1T0J A;  4BD3 A;  4PJO B;  3CCV T;  4BI4 A;  1M2V A;  5GAM f;  6AT1 B;  2RI3 A;  5GAM h;  1K9M C;  1AWO A;  2EIF A;  2E6Z A;  3I56 A;  1K8A C;  2AIR B;  3G4S A;  4OML A;  3E9G A;  5EC7 A;  5AYF A;  2DJZ A;  2LJ0 A;  4AG2 C;  4M7A F;  5LJ5 e;  3QXE B;  4HXJ A;  1VQ8 Q;  3MO8 A;  1WXU A;  4ZNX A;  1N6A A;  2O9S A;  1K0X A;  3H0I A;  4C92 G;  1UHF A;  5CIU A;  2C06 A;  3EHQ A;  1WNL A;  1D0X A;  2XK0 A;  3A8L B;  2K7A A;  2HQE A;  1VQ6 Q;  1O75 A;  2JUF A;  2RF0 A;  1U3O A;  2KNB B;  3CME A;  1YJW Q;  2DYI A;  3OYJ A;  1E7O A;  4BDY A;  5GAN h;  1N5Z A;  4IUU A;  1YIJ Q;  1D3B B;  4PKC C;  2LNV A;  5FRN A;  1Y71 A;  4F7U G;  3LGL A;  5KH6 A;  2RN8 A;  2EQJ A;  1X6G A;  1G8X A;  2LX9 A;  2HZY A;  2EFI A;  1V76 A;  1QQJ A;  5GAM e;  1KHI A;  2K5L A;  4HVW A;  1W6X A;  4OMQ A;  4CC2 A;  1TSF A;  1TTH B;  3M0P A;  3EFO B;  4AMC A;  2GFU A;  5I22 A;  1UGP B;  4L6V 5;  1PWT A;  4AFQ C;  3PIO A;  4M7D E;  1I1J A;  3H41 A;  5GMK h;  3C0C A;  2HL3 A;  2RHZ A;  3G71 T;  4OMM A;  1M3A A;  2HSE B;  1W2B S;  1ZA2 B;  1RAI B;  1AD5 A;  3LX7 A;  1NYF A;  2DXB A;  4FT4 A;  3M0S A;  2EYY A;  2JS0 A;  3CC4 T;  2PVG B;  4XTU A;  2FZC B;  4FSX A;  2L8D A;  1U06 A;  3VV0 A;  5GAN e;  3JCM X;  1M5Q 1;  1BI3 A;  2J06 A;  2K4Y A;  2QQR A;  2LCC A;  2CYZ B;  1SHF A;  4J7F A;  5GAO n;  3HRS A;  4KUD K;  2BZY A;  2BIV A;  5CKD A;  4LD9 K;  1S72 A;  2D8H A;  3JCM W;  2VYT A;  2W0Z A;  3URG A;  1D1A A;  2OI3 A;  1ABO A;  2JMA A;  2KXC A;  1M27 C;  3I55 Q;  2X4Y A;  4ZN3 A;  1VQL T;  4JRP A;  2ZPE B;  4CI0 C;  2EQI A;  2WSC E;  2H3J A;  3NFC A;  2AZS A;  4HT9 A;  1HXD A;  3OYH A;  3OS1 A;  4O5V A;  2PVO B;  4E7Z A;  4AT1 B;  4M7D G;  1MHN A;  1VQ4 T;  5GMK e;  1ZBX A;  1YJN Q;  4BAC A;  3NTK A;  4C92 B;  5HKC A;  2XI9 A;  1UJY A;  1ZSZ B;  3CCJ T;  1IO6 A;  4ZGJ B;  2CH4 A;  1TS9 A;  4KRT A;  3SWN B;  4CRI A;  4J6X A;  5FWB A;  1JJ2 P;  4ELZ C;  3OYA A;  3CCU Q;  3GNG A;  5A0L A;  1YI2 Q;  2V8J A;  4FIB A;  1PSF A;  4FSS A;  1YJ9 A;  4FT2 A;  2LX7 A;  3RMQ A;  5GAO l;  1OU9 A;  1B3Q A;  4UC4 A;  2X9H A;  4F7U B;  4VUB A;  2HBP A;  2LP5 A;  1VQ9 Q;  4JJN K;  3JCM g;  3CCM A;  4BE1 A;  2J6F A;  3ASK A;  2OTJ A;  4J9D A;  2CUD A;  1UGQ B;  2JS2 A;  4LUD A;  3GNF B;  2DYB A;  4DOW A;  4MML A;  4RKU E;  3RUX A;  5HK3 A;  1VQM Q;  2EPD A;  1B34 B;  1T0H A;  2PUK B;  2DXC A;  2NLU A;  4XTV A;  3MCA B;  2VXE A;  5LJ5 g;  3JB9 J;  1BYM A;  4M75 E;  1SSF A;  4LUE A;  3C94 A;  3BDL A;  2CRE A;  3CCQ T;  1AVZ C;  1QKW A;  1VQ5 A;  2P84 A;  2Z0W A;  3CC4 Q;  1ZSG A;  5GMK m;  1SSH A;  1LOJ A;  4E7S A;  3EGX B;  3QSU A;  2Y90 A;  4OB1 B;  2ZPF B;  3OYF A;  4N0A C;  4C8Q D;  4E7J A;  3UF4 A;  4JZ4 A;  1D3B A;  2HBW A;  2CZ0 B;  1NPR A;  4F16 A;  2LMJ A;  4HVV A;  2MYS A;  4OMP A;  3CMA A;  2HDA A;  2WAC A;  4FM4 B;  1W1F A;  3C95 A;  4E7K A;  1QP2 A;  1R8O B;  2K3B A;  4Z89 A;  1VQL Q;  4A4K A;  3MKD A;  2ZPI B;  4J6W A;  2EKO A;  2CSQ A;  2LRQ A;  4N4I A;  1LPL A;  5GAM g;  1K73 C;  3EFO A;  3VS0 A;  3GOX A;  3I9Q A;  1HYO A;  4M78 E;  4M7D B;  2KRM A;  1GCP A;  3L2Z A;  4DBH A;  3OYI A;  5CQX A;  3UT1 A;  1MV0 B;  2LQ8 A;  2D0N A;  3J80 E;  4M75 G;  3OS5 A;  2JW4 A;  2ZPH B;  4RTX A;  1WJS A;  3M0T A;  5ECA A;  4IUT A;  1ZUK A;  5DY9 A;  3SB2 A;  1G3W A;  1K0S A;  5AT1 B;  3CCR Q;  3M9Q A;  5A2Q E;  4FYW B;  4JRK A;  2DLP A;  3HFN A;  1VQ7 Q;  3VKI A;  1R0B G;  2KDS A;  2ESW A;  2F2V A;  1V29 B;  5KE2 A;  1WXT A;  4NOY A;  2J7I A;  4KGX B;  4HVU A;  3MJX A;  3QDF A;  3TSW A;  4MMK A;  1I81 A;  3JCM c;  3I56 Q;  3G4S Q;  1W4S A;  4PNO A;  4L5G A;  3PNW C;  2JXB A;  2D6F A;  1VQK T;  1ZUU A;  3V7C A;  4PJO E;  3JB9 D;  2CSI A;  2K57 A;  3CC7 T;  4FYY B;  3X24 B;  3RKW A;  1SRL A;  1OYX A;  2ROT A;  2L89 A;  1IRE B;  4M78 G;  2V1Q A;  3JCM d;  1RLQ C;  1WJR A;  1N27 A;  3EG1 A;  2O2O A;  4E7L A;  3MHX A;  4J9B A;  4KUI A;  3EHR A;  3CCL A;  2R58 A;  4IUV A;  3QO3 A;  3CME Q;  3M55 A;  3KBG A;  2DET A;  1I07 A;  4C92 A;  1ZSZ A;  2KRN A;  2ED0 A;  3JV3 A;  2BUD A;  5KYY B;  3M53 A;  1RAC B;  1FMV A;  1VQO A;  1OPL A;  5C6S A;  2AK5 A;  3THK A;  1AEY A;  1NE8 A;  2P0Q A;  3HHT B;  5LJ5 d;  2KBT A;  3OQ5 A;  2ZPG B;  1XNI A;  2LDM A;  3CEY A;  4X9C A;  2RHI A;  3MP6 A;  4F7U A;  3VJP A;  5GJW B;  2KR3 A;  4WTO B;  1WHK A;  1NBE B;  1NYG A;  2RI5 A;  3M59 A;  4C92 C;  2FHD A;  3REA B;  1ZSZ C;  5CVI A;  4XU1 A;  4XTW A;  3SWN C;  4E7H A;  2SRC A;  3GBQ A;  3BE3 A;  3M0Q A;  4AFZ C;  3GIB A;  4C0G A;  3OMC A;  3EFR A;  4QW2 A;  3CC2 A;  4LE9 A;  3OYE A;  2ROL A;  4MZT A;  3CCS A;  1B34 A;  2BZX A;  1WQ7 A;  1UEB A;  1OPK A;  2A7Y A;  1OOT A;  3KXT A;  1UGR B;  2MWO A;  2RQW A;  4DQ2 A;  4PK4 A;  2EBP A;  4M75 B;  1VQ8 T;  4LDY A;  5GAN 8;  1FMW A;  3HPW A;  2E70 A;  4A4F A;  5GAM d;  2DIQ A;  2KT1 A;  2WSF E;  1G2B A;  2LCS A;  1VQN A;  1VQ6 T;  1BI2 A;  3EGX A;  4YTL A;  4JUV A;  1S72 Q;  4J5Y A;  3E1S A;  3CXC A;  4K11 A;  3LYI A;  3PFS A;  3LW5 E;  2O88 A;  1I8F A;  2FL7 A;  2YXY A;  1Z9Z A;  1YIJ T;  3H0F A;  1PD1 A;  5GAO p;  2ZAE A;  3WVD B;  4BB7 A;  2RM4 A;  4HCZ A;  1X27 A;  2XG8 D;  1KFZ A;  2QTX A;  2RO0 A;  3A8M B;  2D0Q B;  3G7Z A;  2K5F A;  4RTT A;  2C0T A;  4M77 D;  2M0O A;  2CZ6 B;  2PUO B;  4M78 B;  4HCK A;  2RJF A;  2O4X A;  1RAA B;  2IG0 A;  4M7D A;  3ER0 A;  2ZZD A;  5GAN 3;  2DXU A;  2KAF A;  2KYM A;  2VGM A;  1YJ9 Q;  3AHU A;  4QQD A;  4O6J A;  2D9T A;  1Y96 B;  2BZ8 A;  3BW1 A;  4GBQ A; 
#chains in the Genus database with same CATH homology
 1W2B S;  4RG2 A;  1WJQ A;  3DLM A;  1KD1 C;  5GAN 4;  2B8A A;  3FDR A;  3LX7 A;  3OMG A;  1AHJ B;  2E64 A;  2DXB A;  4FT4 A;  3JCM V;  4NL3 A;  4LD6 A;  3CCM T;  1WQW A;  4ZGE B;  4R55 A;  3CC4 T;  2PVG B;  3JB9 H;  1Q81 U;  2OTJ T;  4XTU A;  4M7A C;  3NTI A;  4FSX A;  2L8D A;  1N8R U;  3VV0 A;  5GAN e;  3JCM X;  1VQ8 A;  2EAY A;  1NJI U;  4M7D C;  2QEX A;  1M5Q 1;  5CKH A;  4ZTJ A;  1BI3 A;  2K4Y A;  3JB9 I;  3RER A;  1PSE A;  4OGE A;  3QHS A;  4F7U E;  2QQR A;  5CK9 A;  2LCC A;  1OI1 A;  2CYZ B;  4BI8 B;  1OZ3 A;  4M7A D;  4J8O A;  3LWH A;  4Y28 E;  4J7F A;  5GAO n;  2CZ1 B;  4IUQ A;  4RG8 A;  3HRS A;  4KUD K;  4M7D D;  1U8R A;  2BIV A;  2P4T A;  3VU3 C;  2O01 E;  1VQ6 A;  2QXF A;  5GAN 2;  3M5A A;  5EG2 A;  5CKD A;  1YIT A;  2A3L A;  2LC4 A;  2PQW A;  4JRQ A;  1S72 A;  4LD9 K;  4OMF B;  4II1 A;  3JCM W;  2VYT A;  4C0F A;  3URG A;  1KC8 C;  3LGF A;  2LVM A;  3QYH B;  3I55 T;  1JB0 E;  2RJD A;  3TRE A;  3MET A;  2RA2 A;  4N4H A;  3MEW A;  2X4Y A;  2GF7 A;  3FRN A;  2KQW A;  2ZPE B;  4ZN3 A;  4JRP A;  1YIJ A;  1VQL T;  4CI0 C;  1O9S A;  2H3J A;  2WSC E;  2DK3 A;  2KSS A;  3NFC A;  2HQX A;  4HT9 A;  4C8Q F;  4PJO F;  3QUI A;  1VQ5 T;  1HXD A;  3OYH A;  2DO3 A;  4A4G A;  1ZHI A;  2VXF A;  4XU0 A;  5LJ3 g;  4M7A G;  3OS1 A;  4O5V A;  2X4X A;  1G3Y A;  3F70 A;  2PVO B;  3CPW A;  4JDS A;  2O4X B;  1WGS A;  1MHN A;  3P8H A;  2QDY B;  1YJN T;  4M7D G;  2FVU A;  4PLI A;  2YLB A;  1OZ2 A;  5GMK e;  2K5I A;  1ZBX A;  4JS4 A;  3TU4 K;  1VQ4 T;  5LL6 S;  5I2M A;  4BAC A;  2E1H A;  3S3O A;  2JTM A;  5GAO m;  4C5E A;  3DB3 A;  1TH7 A;  1BI0 A;  1X75 C;  3J81 E;  3ME9 A;  3NTK A;  4C92 B;  1QVF A;  5HKC A;  1KQS S;  2XI9 A;  4QVC A;  3CPW S;  4PLL A;  3CBM A;  3UPU A;  3JCM Q;  3HFO A;  5IN1 A;  3GLX A;  4M75 F;  4ZGJ B;  1H64 1;  3JCM b;  3CCJ T;  3M4G A;  3SWN B;  4CRI A;  5FU7 C;  4OGC A;  4J6X A;  5DLQ E;  3GF5 A;  4BY6 C;  4BE0 A;  2CGH A;  3UWN A;  5D6Y A;  2K3Y A;  3CCU T;  1YI2 T;  3A8O B;  4ELZ C;  3OYA A;  2EQU A;  2CZ7 B;  3GNG A;  2CKK A;  5A0L A;  1QVF S;  1Q86 U;  2V8J A;  4FIB A;  2XID A;  3TEE A;  1M1K U;  3L2W A;  1PSF A;  2XD0 A;  1QVG A;  1YJ9 A;  3VYH B;  4FT2 A;  4B9W A;  5FLX E;  2RK1 A;  5D6X A;  1QVP A;  3RMQ A;  5I2S A;  5GAO l;  4RMO A;  1WPY A;  2X35 A;  2FYK A;  1Y7X A;  3DB4 A;  3RMS A;  3H8Z A;  3G71 A;  1RL2 A;  3WVE B;  1N9S A;  3M54 A;  3QJY A;  5IT9 E;  4UC4 A;  4WF2 A;  2ZGW A;  3OBY A;  2JTF A;  2F69 A;  2LCL A;  2Y4X A;  4JRI A;  4VUB A;  4F7U B;  5LJ3 j;  5GAN g;  1VQ9 T;  2HBP A;  4ZGD B;  2QQA A;  1QVG S;  4JJN K;  5GAM j;  3M58 A;  3JCM g;  3R6O A;  4B9X A;  1K9M U;  3WXM B;  3CCM A;  1Q81 C;  2JZ2 A;  2XDP A;  4BE1 A;  3A8H B;  4HKE A;  4XU2 A;  3CC4 A;  3ASK A;  4IUP A;  4C8Q A;  2OTJ A;  3OS0 A;  2IVW A;  1UGQ B;  3C12 A;  3HRT A;  1NJI C;  4C5I A;  2QA4 T;  3GNF B;  3FJP A;  4D6W A;  4V2S A;  4C8Q E;  2VGN A;  3OYY A;  4DOW A;  1VQM T;  4MML A;  5CO7 A;  4RKU E;  3RUX A;  4PL6 A;  2DZC A;  5HK3 A;  3V8J A;  1B34 B;  3OYB A;  4ZTF A;  2PUK B;  2AHJ B;  4M78 F;  5FU6 B;  2DXC A;  3FC3 A;  2NLU A;  1I5L A;  1BIA A;  1VQN T;  1IZ6 A;  4XTV A;  3QZ5 B;  4M75 A;  2EWN A;  3MCA B;  1EIF A;  2LQK A;  2P0K A;  3SFM A;  2VXE A;  1YHQ A;  5LJ5 g;  3JB9 J;  4M77 B;  1BYM A;  3I55 A;  4M75 E;  4XK8 E;  2MF2 A;  1SSF A;  2RK2 A;  3C94 A;  3BDL A;  5KE3 A;  2RHY A;  5GAN j;  4QVD A;  3MEV A;  5M9O A;  3JB9 F;  2KVQ G;  3CCQ T;  2BKD N;  4C8Q C;  3OS2 A;  1VQ5 A;  2M1H A;  4X9D A;  4XAX B;  2LTO A;  2YLC A;  4C0D C;  5GMK m;  1LOJ A;  1M8V A;  2MMP A;  1Q82 C;  4KBM B;  3QSU A;  2Y90 A;  4ATO A;  4JLI A;  4OB1 B;  2YRV A;  2ZPF B;  3QJ6 A;  1YJN A;  3S6W A;  3VYG A;  2QQB A;  1VQ4 A;  4KT0 E;  3OYF A;  1XQH A;  4N0A C;  2EQM A;  4C8Q D;  1NPP A;  1YCY A;  4E7J A;  4EMK A;  1KG1 A;  1D3B A;  1QP3 A;  5CR2 A;  2CZ0 B;  1NPR A;  5KCH A;  3V7R A;  4M75 C;  1VQP T;  3CCJ A;  5GAO r;  2MI6 A;  1I4K 1;  4XTZ A;  1G5V A;  5GMK i;  3CMA A;  2WAC A;  4XQ3 A;  3BDU A;  3QBY A;  4FM4 B;  2XDD A;  3CCU A;  1H3Z A;  1YI2 A;  4QVZ A;  2EJG A;  1LNX A;  3C95 A;  5HK0 A;  3CCL T;  4IKF A;  4Y91 A;  3SD4 A;  3RKX A;  5LJ5 j;  1QP2 A;  4E7K A;  1R8O B;  3Q1J A;  4M75 D;  3PGG A;  5CKF A;  2RH2 A;  4A4K A;  4ELY C;  2R5A A;  2ZPI B;  4J6W A;  4PJO G;  4C8Q G;  2EKO A;  2LRQ A;  2EYQ A;  4M78 A;  2OAU A;  4N4I A;  3PT9 A;  5C0M A;  5GAN 5;  1Q7Y C;  2M16 A;  2HD0 A;  5J3B A;  3BFM A;  4M7A B;  4EDU A;  5GAM g;  5LJ3 f;  4MZM A;  3OYK A;  3GOX A;  3OW2 A;  1K73 C;  1KQS A;  4C0D B;  5A0D A;  2DZ9 A;  3QDR B;  4M78 E;  3PTA A;  4J6Y A;  1VQ9 A;  1VQO T;  4M7D B;  2DTI A;  2VC8 A;  2DKG A;  3FB9 A;  4DA4 A;  3L2Z A;  4EMK C;  1M4Z A;  2RJC A;  3OYI A;  2GFA A;  5CQX A;  3UT1 A;  3G6E A;  4EMH A;  3M57 A;  3OW2 S;  2LQ8 A;  1Y96 A;  3A5Z B;  3J80 E;  3OSV A;  4M75 G;  3OS5 A;  3PMI A;  5KCO A;  3PIP A;  2ZPH B;  1KHC A;  5L8R E;  4MDX A;  1WJS A;  3UDC A;  2QA4 A;  4E47 A;  4IUT A;  2GCX A;  3JSC A;  4A54 A;  5DY9 A;  3CCR T;  3SB2 A;  5LJ3 d;  4FU6 A;  3INZ A;  1DJ7 B;  1G3W A;  1VQM A;  2ZCF B;  4QQ6 A;  2E5Q A;  3M9Q A;  2DD5 A;  1VQ7 T;  4C92 F;  2YHT A;  5A2Q E;  1JBM A;  2DPP B;  4JRK A;  3HFN A;  3EAE A;  2RD1 A;  4BE2 A;  3T9N A;  3VKI A;  4M78 C;  2KDS A;  4OB0 B;  1YHQ T;  1V29 B;  2LT1 A;  3OYD A;  4HCB A;  3MEA A;  4DOV A;  5KE2 A;  4EMG A;  1M1G A;  4XU3 A;  2VUB A;  4NOY A;  4RCC A;  2E65 A;  2DTH A;  1YJW T;  4MDW A;  5CCA A;  1QW1 A;  4EPC A;  4MMK A;  5I21 A;  3OB9 A;  1I81 A;  3X26 B;  5GAN f;  3I56 T;  1KC8 U;  3CCE T;  4M78 D;  4Q5W A;  3CC2 T;  1GXI E;  4NL2 A;  3G4S T;  3JCM c;  2RB6 A;  3CCS T;  1NZ9 A;  4OB3 B;  3JCM f;  3ZFJ A;  1K8A U;  3M4Y A;  1W4S A;  3X28 B;  3CCQ A;  3QZ9 B;  4PNO A;  3JCM h;  3S3M A;  4L5G A;  1N8R C;  3PNW C;  3V7S A;  4PJO A;  2DXT A;  4FL6 A;  1VQK T;  3CXC S;  2D6F A;  1FXX A;  4L59 A;  2RHX A;  3TCJ A;  3V7C A;  1VIF A;  4F7U F;  1MGQ A;  1YBY A;  4PJO E;  3ZBD A;  3P8B B;  4NS5 A;  5FU7 B;  4QQG A;  1X01 A;  4BY6 B;  2F5K A;  3JB9 D;  4C5G A;  3PMT A;  4IUR A;  2K57 A;  3V8K A;  3CBP A;  4N0A A;  3OY9 A;  3X24 B;  3CC7 T;  1KD1 U;  1M90 U;  3RKW A;  5DM7 R;  2KY9 A;  1OYX A;  3QII A;  4HCC A;  3J7A F;  5GAN d;  2L89 A;  1IRE B;  2E10 A;  3A8G B;  4X34 A;  5LJ3 e;  3OYC A;  4M78 G;  3JAM E;  2DAQ A;  2DTO A;  1BI1 A;  3JCM d;  1JJ2 A;  3OYM A;  1VQP A;  2DIG A;  3FLG A;  5J26 A;  2L5Q A;  1WJR A;  3HRU A;  3NTH A;  4R56 A;  3L2V A;  1N27 A;  4E7L A;  3QPH A;  1ZQ1 A;  4P5N A;  2RHU A;  4GLK A;  4C0Z A;  1XTD A;  2DVE A;  3MHX A;  4Z02 A;  5LJ5 f;  1JRI A;  3CME T;  4KUI A;  3GPL A;  2JOY A;  1FX7 A;  2R58 A;  4IUV A;  5D6W A;  3RES A;  3CCL A;  3QO3 A;  5LJ5 h;  3E9F A;  1VQL A;  3M55 A;  3KBG A;  4N4G A;  2L3R A;  1JJ2 S;  4C92 A;  3JB9 G;  3FIF A;  5IAY A;  1KQ2 A;  4TVR A;  4PJO C;  2DD4 A;  5HY6 A;  2BUD A;  3M53 A;  4C92 E;  3CMA T;  3CPF A;  4LDU A;  4M77 F;  3DLL A;  2JVV A;  1M9S A;  1U1S A;  3HP9 A;  3L2Q A;  3X20 B;  1BKB A;  4A53 A;  5CAI A;  3OSS C;  1VQO A;  1P92 A;  5C6S A;  3ZEH A;  3OYG A;  1NE8 A;  4PJO D;  2JNG A;  3QKJ A;  3QYG B;  3LWI A;  2P0Q A;  4C5H A;  2PU9 B;  2JN0 A;  1HK9 A;  1G3S A;  2K3X A;  2RI2 A;  3HHT B;  5CKE A;  5CQY A;  3VUZ A;  3OQ5 A;  5J39 A;  5LJ5 d;  4HT8 A;  2KMT A;  3FEO A;  2V8I A;  4E7I A;  2ZPG B;  4JLG A;  1RI0 A;  3L42 A;  1XNI A;  2LDM A;  3CEY A;  3LLR A;  4X9C A;  2RHI A;  3MP6 A;  4F7U A;  5GMK l;  3OYL A;  4BDZ A;  1Q86 C;  1M1K C;  3X25 B;  3VJP A;  4LDW A;  3JCM e;  5GAN 6;  3CCR A;  3MP8 A;  4LDV A;  3HSB A;  1X6O A;  3M59 A;  1Y07 A;  2RI5 A;  4BI3 A;  2OTL T;  4ME7 A;  4C92 C;  1VQ7 A;  3EFS A;  4OB2 B;  2FHD A;  4A4H A;  4BUG A;  3V8L A;  5CVI A;  1VIE A;  3N5B B;  3H6Z A;  4RCB A;  5GMK j;  3L2R A;  4BD3 A;  4XU1 A;  4XTW A;  3SDZ A;  3SWN C;  4C8Q B;  3CCV T;  4BI4 A;  2R57 A;  4E7H A;  3S3N A;  2V8K A;  4PJO B;  3OA6 A;  5GAM f;  2HAX A;  3CD6 T;  5LJ3 h;  4C92 D;  3GIB A;  1YJW A;  4C0G A;  2RI3 A;  5GAM h;  1K9M C;  2EIF A;  2EJF A;  2E6Z A;  3I56 A;  3CCE A;  3OMC A;  1K8A C;  3EFR A;  4QW2 A;  3CC2 A;  3G4S A;  2PVD B;  3OYE A;  2F5T X;  4MZT A;  3CCS A;  3E9G A;  1B34 A;  3CBO A;  3MP1 A;  2XKO C;  1WQ7 A;  5AYF A;  1UEB A;  2A7Y A;  3KUF A;  2DJZ A;  3KXT A;  4XTY A;  1UGR B;  2MWO A;  2EQK A;  4LDX A;  4M7A F;  4DQ2 A;  2XIC A;  1VQK A;  2RJE A;  5LJ5 e;  4J7I A;  2X4J A;  4M75 B;  1VQ8 T;  1G3T A;  4M77 A;  3QXE B;  4LDY A;  4GY5 A;  3DKM A;  2E12 A;  4MZP A;  5GAN 8;  2QEX T;  4M7D F;  3E19 A;  3MO8 A;  2E41 A;  2P0P A;  3HPW A;  5CKB A;  1Q82 U;  2E70 A;  3HKS A;  1M90 C;  5FRM A;  4A4F A;  5GAM d;  3CC7 A;  1N6A A;  4M77 E;  2DIQ A;  4C92 G;  5CIU A;  2C06 A;  1VUB A;  2WSF E;  1WNL A;  4KUL A;  4A4E A;  2XK0 A;  1N9R A;  3L1A A;  1VQN A;  3A8L B;  1VQ6 T;  1BI2 A;  1YIT T;  3L2U A;  2VV5 A;  2HQE A;  1S72 T;  4OF1 A;  2WSE E;  1O75 A;  2JUF A;  4YTL A;  3MEU A;  4ZN1 A;  4JUV A;  2ZPB B;  4J5Y A;  2EJ9 A;  3E1S A;  3CXC A;  3LYI A;  2MWP A;  3LH0 A;  3O8V A;  3BY7 A;  3PFS A;  5FRO A;  3CME A;  3M56 A;  3LW5 E;  1I8F A;  3OYJ A;  2FL7 A;  1XOV A;  2HNI A;  2G3R A;  3P8D A;  1YIJ T;  4BDY A;  1U1T A;  5GAN h;  4JS5 A;  4EMK B;  4IUU A;  5FU6 C;  1D3B B;  3C4S A;  1LJO A;  4PKC C;  3RKY A;  5GAO p;  3OBW A;  4HA8 A;  3HL8 A;  2LNV A;  5FRN A;  3QG1 A;  2KK4 A;  2M9U A;  4OVA A;  1Y71 A;  4M77 C;  3WVD B;  1KQ1 A;  4F7U G;  1Q7Y U;  2DEQ A;  2RM4 A;  2X4W A;  4BB7 A;  4HCZ A;  1K73 U;  3JRZ A;  2XG8 D;  3LGL A;  2QQ9 A;  4J83 A;  1FWZ A;  2QTX A;  3JCM J;  5KH6 A;  1BIB A;  1UB4 A;  2RO0 A;  3A8M B;  2D0Q B;  2XHC A;  2EQJ A;  2K5F A;  3G7Z A;  2K2V A;  2LX9 A;  3G6E T;  2EFI A;  4M77 D;  2M0O A;  2LT4 A;  5GAN 7;  2CZ6 B;  2PUO B;  2I2L A;  2GQV A;  5GAM e;  4M78 B;  1KHI A;  2K5L A;  4M7A A;  2RJF A;  2O4X A;  2QI2 A;  3VUB A;  3OYN A;  3JCM P;  2GFU A;  2IG0 A;  1UGP B;  2R5M A;  4L6V 5;  4M7D A;  3ER0 A;  2ZZD A;  4M7A E;  2FB7 A;  2XU8 A;  5GAN 3;  2DXU A;  3PIO A;  2Y4Y A;  2KAF A;  1W2B A;  1YJ9 T;  2OTL A;  4M7D E;  3GP8 A;  1UGS B;  2CS7 A;  2VGM A;  3AHU A;  1M1F A;  2QQS A;  4QQD A;  4XTX A;  4O6J A;  3RIR A;  5GMK h;  5A0G A;  2RHZ A;  2E6N A;  2D9T A;  2MAM A;  3SWN A;  5DLO A;  1Y96 B;  3G71 T;  2XDB A;  3CCV A;  4OP0 A;  4M77 G;  3BW1 A;  5GAO q;  3CD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...