3QSUA

Structure of staphylococcus aureus hfq in complex with a7 rna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA chaperone Hfq
publication title Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Chaperone/rna
total genus 18
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F, G, H, I, J, K, M, N, S
ec nomenclature
pdb deposition date 2011-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qsuA00
5GANh 5GAN3 3HFNA 4XU2A 1B34B 1D3BB 3AHUA 5GMKi 4F7UG 3V7RA 4M77F 1H641 1M8VA 3SB2A 5GAMg 1WPYA 3RERA 4C92C 5GAMd 3JCMc 4M78F 3L1AA 4EMKA 1JRIA 3QO3A 4M77E 4M7DG 1I8FA 3BDUA 5GAOn 3FIFA 4C92G 4M7AD 4M75B 2DXUA 3RKXA 4PNOA 3V8LA 5GMKj 2E10A 4M78E 3JCMX 2DTOA 5LJ5j 2CGHA 4M77D 4JUVA 4C8QF 5I21A 3L2ZA 5GAOp 3JB9H 4PJOC 4X9DA 1WNLA 4EMKB 5LJ3j 3JCMW 4M78D 4M7AA 4F7UF 4M7DD 4JRKA 3SWNA 5GANg 4PJOG 4M77A 3JCMf 4C8QE 5GANd 1I4K1 4N0AC 5LJ3h 4XTZA 4QVCA 3RKYA 3V7CA 5GMKl 4V2SA 4A54A 4M78A 4RCBA 4F7UE 4M7DA 3RESA 1HXDA 4XTYA 3JCMe 4M7AB 2YLCA 5GMKm 4M75C 4NL2A 4RCCA 4C92F 5LJ3f 3SWNB 3PGGA 5GMKe 3INZA 2DKGA 4M77B 2E1HA 4MMLA 1Y96A 1YCYA 1I81A 4MMKA 3RKWA 4M75G 4M78B 5LJ3e 3V7SA 4M7DB 5GAOq 1JBMA 2VXEA 4XTUA 1U1SA 3EFSA 4C92E 1WQWA 3VU3C 2FB7A 5CAIA 2RD1A 4F7UA 3JCMd 4J6XA 3JCMh 4PJOF 3JB9I 3V8KA 4X9CA 1Y96B 1U1TA 4J5YA 4C92D 5GMKh 3JB9J 4M7AC 2HNIA 4J6YA 2I2LA 2QTXA 3JCMJ 5LJ3g 3JCMV 4PJOE 5LJ3d 3JB9G 4F7UB 5GAOm 3BY7A 4C92A 5GAN2 2DZCA 3JCMQ 4HT8A 4M7AG 1LJOA 4EMGA 4EMHA 2JN0A 1HK9A 3M4GA 4C8QD 4M7DC 4M75F 4PJOD 4QVDA 2EWNA 4XQ3A 2RB6A 2VC8A 4XU0A 3RUXA 4XTVA 2EJGA 1KQ1A 4OP0A 5GAMf 2E64A 2VXFA 2E41A 1X01A 4C92B 4C8QA 4EMKC 2FYKA 3FB9A 4M75E 2DTIA 4PJOA 1D3BA 1LNXA 2E65A 4HT9A 3BW1A 5DY9A 3JCMg 1BIBA 5GAMe 5LJ5h 5GAN4 2DVEA 4JRIA 3BFMA 4M75D 3JB9F 4A53A 1LOJA 2DEQA 3QHSA 4N0AA 4JLIA 4HA8A 4XTWA 5GAN7 4XU1A 3JCMP 1KQ2A 4WF2A 1WQ7A 4C8QB 4M7AF 4PJOB 5GAOl 1N9RA 5LJ5f 5GAMj 4NL3A 2YHTA 3SWNC 5GAOr 2ZGWA 2EJ9A 4M75A 3JCMb 4M77C 5GAN6 1I5LA 4NOYA 1N9SA 3QSUA 2DTHA 3EFRA 5GANf 2DXTA 5LJ5e 1MGQA 5GAMh 4M7AE 4M7DF 4M78C 4DQ2A 4XTXA 3JB9D 3V8JA 2DZ9A 2DJZA 4M77G 1BIAA 2Y90A 3HSBA 3FJPA 5GANe 1M5Q1 4J6WA 5GAN5 4M78G 5GAN8 4M7DE 3GIBA 2EAYA 4C8QC 1B34A 4XU3A 4Y91A 2K57A 2RM4A 5LJ5g 5LJ5d 3RIRA 5GANj 2RA2A 2YLBA 3QUIA 2EJFA 3HFOA 4C8QG 1TH7A
chains in the Genus database with same CATH superfamily
2M1HA 5DLOA 1YBYA 1QVPA 2C0TA 1OX9A 2NUPB 1YJNQ 1K9MC 5J39A 1YWPA 2XG8D 5GAMg 2DX1A 2CDTA 2DIGA 3OYGA 1R77A 2ROTA 3DB3A 3EGDA 2F2WA 5GMKj 2MIOA 3SD4A 3A5ZB 1IXDA 3S3MA 1O9SA 1JJ2S 2YRDA 4JRKA 2DK3A 2GGRA 2JJ9A 4PJLA 3SWNA 2NWMA 3I5SA 2CP7A 5KYXB 3JCMe 3C95A 2ATCB 5DLQE 4M77B 2P4RA 2J6FA 2JTMA 1PKTA 1MNDA 2L2PA 1R8OB 3EFSA 2FO0A 2K3XA 3ZEHA 1VQ7T 3OYDA 1U1TA 3C94A 5GMKh 4DBQA 1D1AA 4BI3A 1YIJA 1PWTA 2P4TA 3CCLQ 4IUQA 2DEUA 1CKBA 1AHJB 2EWNA 2RHXA 2JW4A 3EG3A 4B9WA 4F14A 1RAHB 1BU1A 3EHRA 2X4YA 1ZQ1A 2RPNA 3M59A 2QA4A 3G4SA 1VYUA 3X24B 4BY6C 4PFOA 1LVKA 2B86A 5D6YA 5A0GA 4PFZA 4ESRA 3R6OA 4UC4A 5GAN6 3TSWA 2MMPA 2DA9A 4DQ2A 3CCMA 1RLQC 2LQ8A 1RAAB 2LQNA 1ZLMA 1OPKA 5L23A 4M7DE 1M1GA 5GANj 2HAXA 5D7UA 3X25B 4QQDA 1M1KC 2ENMA 1FYNA 2P0KA 3ZBDA 3I56A 1XNIA 1OZ2A 4JZ3A 4AT1B 1GRIA 3SB2A 1PCXA 4PL6A 3VS5A 2DFUA 3MCAB 3N5BB 5KYYA 1GFDA 1IGQA 3AT1B 1XJWB 4BI4A 1VQLA 4PJOC 3JB9H 3VS3A 2DF6A 1WNLA 1ZSZC 1YHQQ 4M7DD 1M1KU 1WLPB 1UGQB 4PJOG 2GF7A 4XTZA 4HVUA 3CCEQ 2COYA 1UGVA 1XTDA 4M75C 4NL2A 2QGFB 4ANJA 2XDPA 4XAXB 4BUGA 4X1VA 4M75G 5LJ3e 1K73U 1UJYA 1K76A 4QKUA 4RTUA 4J6XA 3M58A 4X9CA 3REAB 2MWOA 4C92D 3L2QA 3QZ9B 1VQKA 2QYZA 2X3XD 2AZVA 2BKDN 2EGCA 2DL4A 1WHHA 4KBMB 1WHJA 4KH1B 2D8JA 3TQ7P 1SKUB 4BE2A 1C6VX 1ZX6A 1G3YA 2D1XA 2KYBA 1NJIU 4HXJA 1JO8A 2JZ2A 1WXTA 2VC8A 4LXCA 3A8LB 1VQ4Q 2F2VA 2E6ZA 2QASA 2CP6A 1GBRA 3BFMA 2LQKA 3MEAA 5GAN7 1B7TA 5CCAA 4XU1A 2CREA 2DXBA 2KNBB 2RF0A 1Q82U 2CSQA 5CKBA 3OS2A 1KC8U 3E2UA 2M16A 2DXTA 3A8MB 1RI0A 3UA7A 2VASA 3NMZC 2KT8A 4O6JA 2RI3A 3KXTA 1RUWA 2VYTA 3OYLA 3SHWA 4Y91A 1QP3A 2KSSA 2L0AA 4ME7A 3CMEQ 3THKA 1RABB 4N4IA 2YUPA 1D0ZA 1NYFA 5CKFA 3X28B 1NG2A 3AHUA 4RTTA 2L8DA 2BE9B 5KYUB 5GAMd 2DD4A 2CUDA 2QQ9A 3UATA 5CKDA 4M78E 2JVVA 4HVWA 3EG0A 2P84A 4KRTA 3CPWS 3CC2A 2O9VA 4NS5A 2ED0A 1I4K1 5I2MA 2C0IA 2KROA 5GMKl 1UECA 2DILA 1D09B 1OU8A 3R6NA 4ZGDB 4MMKA 1EFNA 3I55Q 1C0MA 1ZA2B 4JLGA 1WHMA 3PMIA 3VU3C 2JS0A 2A0FB 1VQNT 4E47A 1ABOA 2DPPB 2OAUA 1G2BA 1Y0MA 1X27A 1OI1A 4FYYB 1Q86U 1NLPC 4HT8A 4EMGA 4EMHA 1W2BP 2RI2A 1FXXA 4FIBA 3HRUA 1KD1U 1KQ1A 4GY5A 1D1BA 1LNXA 4Z8AA 1TU0B 3HHTB 1NEGA 3EHQA 2OTJT 5KYUA 4AFZC 2DEQA 2RO0A 2A3LA 4A4KA 4WF2A 1KQSA 3A8HB 2OI3A 1VQ4A 1I5LA 2YRCA 3QSUA 1QMCA 3OW2P 2RJCA 2H3EB 5FWCA 3GBQA 2HBWA 5KYWA 4JJDA 1VQ7A 4BB7A 4Z88A 3M53A 5D6XA 2RM4A 2RA2A 2YLBA 2DNUA 3HFOA 2EYYA 3DLLA 2XDBA 2XICA 1N6AA 3NFCA 2J05A 4OF1A 4N4GA 4QVZA 4QQGA 2XIDA 5DM7R 3G71Q 2DVJA 1YJ9T 4C92C 1G3SA 2AZSA 1U5SA 1I5OB 2R5AA 4C92G 1WZOA 2RK2A 1BCMA 4JUVA 2OX7A 2W0ZA 4EMKB 4CC3A 2HSPA 4LN2A 4E7HA 3C12A 4C8QE 1IO6A 4AG2C 1HSQA 2LCLA 1HJDA 4M7AB 2LC4A 1UGRB 1UB4A 3PGGA 4AFUC 1WA7A 2DERA 1Y96A 1Q81C 1RI9A 4LD9K 4M78B 5GAOq 3BE3A 2P0PA 2RD1A 4DEYA 1YJWT 2K9GA 1WJSA 1GXIE 4GBQA 3C0CA 1ZSGA 4J6YA 2FPFA 1QVFS 3UA6A 1VQPQ 2QA4T 1K73R 3SDZA 3CXCP 3M4GA 4C8QD 2CZ7B 1YP5A 5FU6C 2RQRA 4QVDA 1Q81U 3M0RA 1UUEA 3CC4T 4XU0A 1T3SA 3P8HA 3X20B 2PVGB 3CCMT 2EQJA 3VRZA 3BW1A 2CP2A 2QQAA 1NJIR 4XTWA 1X2QA 1PD0A 4HCKA 2K2MA 4M7AF 5GAOl 5GAMj 4ZGEB 2J06A 1KHCA 3ASKA 1KQSP 2JT4A 2K7AA 3I56T 4OMNA 3FJPA 2O31A 5GANe 2F5KA 1WXBA 2A36A 2ZPEB 1Q82R 3S6WA 5IHKA 2EFIA 1KC8R 3H41A 1FMKA 2KY9A 3QUIA 3PTAA 1ZA1B 4WCIA 3REBB 2XK0A 3EGXB 1BYMA 2EBPA 1NPPA 3MKDA 2H8HA 4CI0C 3CCUQ 3EG9B 2FVUA 1E6GA 1WHLA 4CC2A 3C4SA 2GTOA 2M9UA 4RMOA 2AT1B 3VS2A 2DTOA 3G71A 3RMQA 3G7ZA 3EFOA 2LCSA 1NZ9A 3QJYA 3CD6Q 1A0NB 8ATCB 2FPDA 3OYNA 3PT9A 1KJWA 5LJ3h 3M5AA 1IRXA 3A98A 4V2SA 3L42A 4RCBA 2QEXQ 2OTLA 2X3WD 1B07A 4RCCA 5IH2A 4J9BA 3V7SA 3Q1JA 2DJQA 2XHCA 3QBYA 1V29B 1WJRA 2H3JA 2KR3A 3CCLT 1M27C 2A37A 5KE3A 3WXMB 2DL3A 1VQ6Q 3NTHA 3H9NA 4PJOE 3I35A 2NYSA 3OYBA 1SSHA 1VQ8A 3M0QA 2QAZA 5CIUA 2Z0WA 3QJ6A 2RB6A 1M2VA 2WSEE 4OB2B 1TSFA 2VXFA 4E7IA 3FB9A 4M75E 3S3OA 3G6EA 1Q86R 3OSVA 3E1SA 1T3LA 2LJ1A 4KT0E 2DYBA 3JB9F 1JB0E 7AT1B 4EIKA 1QKWA 2DD5A 3CMAA 3IQLA 4ZTJA 1KD1R 3OYIA 2EJ9A 3LWHA 2D6FA 3L2RA 3FDRA 3GPLA 1DJ7B 2EYZA 4MZMA 2KXDA 1UGPB 2LRQA 2HQEA 1BIAA 4CRIA 1VQNA 3QYGB 1YI2Q 1W6XA 3UPUA 1KFZA 3VV0A 4PJJA 1YN8A 1VQOA 3EG1A 4LDWA 2BZXA 4EPCA 1CSKA 1XOVA 5GAN3 1FX7A 2ZPGB 5GMKi 1GBQA 4HKEA 3MO8A 2QDYB 3HRSA 4VUBA 2NLUA 1YCSB 2Y4XA 4KGVB 2VGMA 4RUGA 2G3RA 1D0YA 1UFFA 2HCKA 3TCJA 2L3PA 1ABQA 1TG0A 1YHQT 3M0TA 2VUBA 1Q7YR 2K3BA 2CP3A 2PTKA 1QVGA 4F7UF 2GQIA 1YITQ 3OQ5A 3OYEA 4BY6B 4OVAA 3VKIA 1KG1A 4PLLA 4IUPA 4MMLA 1OPLA 4QW2A 3PFSA 3VS0A 2E5KA 3GOXA 1VQ5Q 2QEXA 4F7UA 3MP8A 3VS6A 2FZCB 3LWIA 2JMCA 1RAFB 1H92A 2K79A 5LJ3g 4RKUE 3NTIA 1YJ9A 1K9MU 3BY7A 1U3OA 2QI2A 2DZCA 1U8RA 1LJOA 1WI7A 1VOMA 1VQ4T 1GFCA 3RUXA 1PC0A 1VQ6A 4Z89A 4BE1A 1BI3A 4OGCA 3EH2A 4AG1C 3CC7Q 4BDZA 5CR2A 2JNGA 4E7ZA 4A53A 4ZGJB 4N0AA 1K8AR 4PJOB 4E7JA 1X6OA 1S1NA 1ZSZB 2JTEA 2SEMA 3SWNC 4BD3A 2HL5C 1ZUYA 2DRMA 1BK2A 1WHKA 4CC7A 1S72Q 3P8DA 3FRNA 2Y90A 4E6RA 1YJWA 2JXBA 3OYYA 2VGNA 5FROA 4LUDA 5GAN8 3DB4A 1NYGA 1X2KA 3CCQQ 4XU3A 2CZ1B 3CMET 2NUPA 1T0HA 1M90C 1AVZC 4GLMA 5KCOA 2KEAA 1AZEA 1K4US 3ME9A 2CZ0B 3HFNA 4AFQC 1B34B 1YI2A 2MOXA 3VS1A 3RBBB 3CC4A 4M77F 2J6KA 2ZPFB 2M0OA 3QYHB 1TS9A 2CP5A 3MEUA 4OMOA 2GBQA 2NUTB 3OS5A 1CKAA 3QDFA 4PNOA 3JCMX 3CCRQ 1M90U 5IHIA 5KYXA 3CBMA 1AWWA 4ELZC 1VIEA 2FRYA 4M77A 1QVGP 3SFMA 2L3QA 3BDLA 3TREA 3PNWC 1YITA 2RHUA 2G6FX 4C92E 1YJNA 1PSEA 2V8IA 2LVMA 3JCMd 2WSFE 1NEBA 2IVWA 1VYVA 3VS4A 2CH4W 3MPUB 2HQHA 2J7IA 1MMNA 2E5QA 1UEBA 4FU6A 5CK9A 2E3HA 1YNZA 3M54A 5GAMe 1N8RC 4JRIA 4HA8A 4BI8B 3L2VA 3OBWA 1OZ3A 3M9QA 4OB0B 2FL7A 1W2BA 4PK4A 1MV0B 1V1CA 1PG5B 2R57A 2KQWA 5LJ5e 2DZ9A 1QW1A 3LH0A 2R58A 2VV5A 3T9NA 1QP2A 2EVRA 2GNCA 1BKBA 1R0CB 1SSFA 2F1LA 2EAYA 3CCLA 5I2SA 2PNIA 4R55A 1VQ9Q 2X9HA 3G71T 5HK3A 4KULA 3OW2A 4LD6A 2X51A 2SRCA 3VYHB 1OYXA 2KGTA 2FHDA 1OU9A 4FCYA 2HD0A 1HYOA 2DL8A 5GAOn 2OTLT 4IUVA 1QCFA 3E9FA 2VB6A 4B6MA 3WVDB 2RH2A 3M56A 3MHXA 2EYQA 4C5IA 2RHIA 1NPRA 2ABLA 3V7CA 3CCRA 2M51A 4KUIA 2D9TA 3QWYA 1HXDA 4XTYA 2LNHB 4CC4B 4MDWA 4E7LA 5AYFA 4J9GA 1IHVA 1RADB 1VQ8T 1MHNA 2FEIA 4M7DB 1BBZA 4K11A 2VXEA 2ECZA 1WQWA 1H3HA 3LW5E 2R5MA 4J9EA 1ZUKA 5FW9A 3G6ET 1RL2A 2HNIA 2QTXA 3FC3A 5LJ3d 3URGA 3J81E 5GAOm 2AKKA 1W70A 3CMAT 2AHJB 2DAQA 2RNAA 1YHQA 2E64A 4C92B 1BI2A 3OBYA 3GNFB 1EZZB 1K9MR 2E65A 2RJDA 2DXCA 3CCEA 2EQMA 4D8KA 5I11A 5FLXE 2I0NA 3GF5A 3CXCA 1UE9A 2K5IA 1VQOT 2MI6A 4NOYA 2JOYA 1OQKA 3DKMA 4M7DF 2EKHA 2LDMA 1EX4A 4JRQA 4PKCC 3NHNA 2COWA 2EYWA 5GAN5 3QDRB 2DE0X 2KMTA 2RHYA 5IXBA 3OYKA 4J9FA 4IUUA 2XDDA 2P0QA 1SHGA 2KYMA 3OYHA 4DOVA 2F5TX 4A4HA 4HCCA 4XU2A 3CCVQ 4Y92A 2XU8A 3CCJQ 1BB9A 1H641 1M8VA 4OMQA 4FT4A 2QXFA 1LPLA 1JRIA 2YUQA 3BDUA 2NUZA 2CYZB 2C0OA 4BACA 2EQUA 3TSZA 5IXFA 5AT1B 3QPHA 2QEXT 3I5RA 1RLPC 3SEMA 3FEOA 1Q7YC 1PHTA 3LYIA 1WFWA 5KE2A 3RR6A 5GMKe 5CKEA 2ZPHB 1I81A 4L6V5 1UHFA 3QXEB 3CMEA 2PZ1A 1WIEA 4R56A 1JBMA 5CAIA 2PQWA 3JCMh 1VQ6T 3V8KA 3JCMJ 3OSSC 1G3TA 2AKLA 2YT6A 5GAN2 3PMTA 1VYTA 1OV3A 4F16A 3OMGA 2EIFA 3QG1A 2V8KA 1M1KR 1JJ2P 3EAEA 3KUFA 4OMPA 2DTIA 1JXMA 1PM3A 1Y07A 4FYXB 4E7SA 1IHWA 2DVEA 1JQQA 1WX6A 2L3RA 3QHSA 2F2XA 3I55A 2LT1A 4NL3A 2YUNA 2EYXA 3RNJA 2YDLA 1U06A 2DTHA 1NE8A 1QCNA 1K8AC 3UWNA 3JB9D 1YI2T 3M0PA 1O75A 5FU7C 5HY6A 1MMDA 4C5EA 2HBPA 2CSIA 4IIMA 2JTFA 3HTRA 4C0DC 4RG8A 2RQTA 4RTZA 4IUTA 5J26A 1QQJA 5A2QE 1M3CA 1E6HA 1TTHB 3JCMc 1GCQA 4M78F 2LCCA 4EMKA 2K2VA 5KCHA 1QWEA 1VQMQ 3CCVA 5CO7A 4DBHA 5I21A 2KI7A 1YITT 1NM7A 4QQ6A 5LJ3j 3OYFA 3JCMW 3A1PA 4M7AA 3CCSQ 4RTWA 4DEXA 1YJNT 3JCMf 2YRVA 2PVOB 4A54A 4M78A 1R0BG 4DA4A 3ULRB 2RJEA 1YCYA 4JJCA 1SRLA 1W4SA 1VA7A 1U1SA 5CQYA 5J3BA 1X43A 1N5ZA 3JB9I 1VUBA 2GTJA 4AMCA 4EDUA 2OTJQ 1WXUA 4BDYA 4M7AC 2FG0A 4JJNK 4J8OA 1M3BA 5A0DA 4DBFA 4M7AG 2LP5A 2QQBA 1BI0A 4FW2A 4XTVA 2CT3A 1FMVA 1AWJA 3CC7T 1JEGA 3JCMg 1BIBA 4F04B 5LJ5h 2RMOA 2ZCFB 3OMCA 2CUBA 4O5VA 4C8QB 1WQ7A 2DRKA 2HQXA 1OX8A 4D6WA 3L2WA 2ZGWA 2PUKB 1S72T 2C06A 3H0HA 3RDVA 3CCQT 1SRMA 2HSEB 1VQPA 3EGXA 3MEVA 4J9HA 2O4XB 2EJFA 2HL3A 1XQHA 3EG9A 1PSFA 2EW3A 3ZFJA 1YIJQ 3CCRT 3LX7A 4M4ZA 1KHIA 3PIOA 1W2BS 2A28A 2CGHA 4M77D 4C8QF 1Y71A 1PKSA 3LGFA 3H0IA 2QGGA 2LX7A 3EGDB 5A0LA 1I1JA 3PVQA 2RJFA 2RQWA 6AT1B 3F70A 2GFUA 3G4SQ 4J7IA 5LJ3f 3SWNB 4LNPA 4ORZA 2XMFA 4ZNXA 1SPKA 3OW2S 2FB7A 3CCMQ 3LH5A 4HCBA 4J5YA 4C5HA 1IB8A 3CCUA 2V1QA 3CCET 3JB9G 1V76A 4OB1B 2GCXA 1J3TA 1HK9A 2L5QA 2KVQG 3CD6A 2JUFA 2O4XA 4JRPA 3EH1A 3CPWP 2FYKA 4KH0B 1H3ZA 2FPEA 5DY9A 3X26B 2V1RA 2PU9B 2RN8A 2DLPA 2KRNA 4YTLA 2HEQA 1WJQA 3G1JA 1VQLQ 3QZ5B 2JM8A 3TVTA 1N9SA 3VUZA 1K0SA 3NPFA 1X75C 3V8JA 3HSBA 2RI5A 3RMSA 1QVFA 1VQ9T 5LJ5g 3D7SB 2E70A 1T0JA 4LDVA 1Q81R 2O88A 1PRLC 3OYMA 1D3BB 4F7UG 3HPWA 1OULA 2MF2A 1VQKQ 5EG2A 3L1AA 4ATOA 3CXCS 3GNGA 4PJMA 4M75B 2PUOB 2CP0A 3MP1A 1F1BB 5KYYB 3J7AF 1N27A 4N0AC 4OMFB 2D0NA 2RHZA 4Y28E 1WYXA 3MEWA 5GMKm 2ZAEA 2DKGA 2ZPIB 4J9DA 3OYAA 1KQSS 2DL5A 2FZGB 4JS4A 2HMAA 1SHFA 2K6DA 4PJOF 4II1A 3VS7A 3JB9J 2DL7A 3PVLA 1TOVA 3JCMQ 1OOTA 2E6NA 4M75F 2K5LA 3I55T 1YWOA 1PRMC 2EJGA 4OP0A 1ZHIA 4PJOA 1D3BA 1ZSZA 1SG5A 2KAFA 5GAN4 2MCNA 2QDLA 2O2OA 2VKNA 3HRTA 4JLIA 4JZ4A 3NGPA 4GLKA 4RTXA 5GAOr 4M75A 1M9SA 2DIQA 4M77C 5EC7A 1VQ5A 4A63B 2QK0A 1BCOA 3CC2Q 3VYGA 4XTXA 5L8RE 4M77G 5GJVB 1M5Q1 4J6WA 2KXCA 2WACA 1W1FA 1K73C 2YUOA 2F69A 1QVFP 1B34A 2K57A 4A4EA 1Q95G 1I0CA 3VRYA 3CCVT 1QKXA 2YWWA 1EIFA 3CCJT 5GANh 1IZ6A 2GFAA 1WGSA 2NUTA 4ZTFA 3JRZA 3JAME 2X4JA 1M8MA 3RERA 3CC7A 3CBOA 1NJIC 2QQSA 5IT9E 4IURA 1I8FA 2EGAA 2FZKB 1FMWA 2VWFA 4MDXA 1N8RU 1JXOA 3L2ZA 1Y7XA 4J9CA 4X9DA 3M55A 4IIOA 1MMAA 3QKJA 2HKQB 1S72A 1SEMA 2ROLA 2DO3A 1HD3A 4N4HA 2MYSA 1Q82C 2HKNA 1KC8C 2YLCA 3CCQA 2KT1A 2XI9A 3LGLA 2M0YA 1SF9A 4JPBW 2EQIA 4LE9A 1LCKA 2MAMA 4XTUA 1E7OA 1AOJA 1WHGA 2A7YA 2COZA 1GCPA 2X35A 2GQVA 4PFPA 1VQ7Q 3OYCA 3P8BB 3OS0A 3PE0A 4Q5WA 1AWXA 1K0XA 3UF4A 2RK1A 2K5FA 2V26A 1M2OA 1KK7A 5M9OA 2E41A 1OEBA 3QWXX 1G83A 1UTIA 3ZL7C 4PLIA 2RQUA 2KK4A 3U23A 1LOJA 4A4FA 1KQ2A 1AZGB 3KBGA 4FW1A 1VQPT 1D0XA 2ZZDA 1UG1A 4JJBA 4Z02A 3ER0A 5GANf 1M1FA 4M7AE 3HKSA 1JJ2A 4C0FA 2DJZA 3O5ZA 3GIBA 1TUDA 4JDSA 3CPFA 5LJ5d 5D6WA 2LJ0A 3E9GA 5KYWB 4TVRA 4RTYA 4FYWB 3E19A 5KH6A 1Q86C 1UHCA 4KGZB 4ZN1A 4L59A 1VQMT 2BZ8A 3TU4K 1MNEA 1KD1C 3FIFA 4M7AD 3RKXA 5FRMA 3CCST 1IGUA 3HL8A 3CEYA 3OYJA 4M78D 5GANg 2LZ6B 5HCKA 3M0SA 4P5NA 3RKYA 1X69A 1BI1A 4M7DA 3NTKA 3RESA 1VIFA 3CCUT 4DBRA 3H0FA 4C92F 1VQ9A 2O01E 3RKWA 3EG2A 3EGUA 4JS5A 5FU6B 5CQXA 3CD6T 4F17A 1K1ZA 2JMAA 5FU7B 2E4HA 1Y96B 1Z9ZA 3CBPA 2ESWA 4AFSC 2KE9A 4WTOB 4C0DB 3OY9A 2MK5A 2L3SA 4C92A 1M90R 4M7DC 5IAYA 1UGSB 2XKOC 4ELYC 1QCOA 3MP6A 5KYNA 4M7DG 2JS2A 3JV3A 2CS7A 1AEYA 1UDLA 2PVDB 2V8JA 3JCMP 2EKOA 3META 2IPOB 4PJNA 1AT1B 2BE7D 3JCMb 1Q7YU 2IIMA 2LX9A 4MZPA 1MGQA 4L5GA 1QVGS 2FRWA 3O8VA 2QG9B 3M57A 1FWZA 1Y57A 4OMMA 5IN1A 5ECAA 2OTLQ 2EGEA 1G3WA 1PD1A 2RQVA 2VVKA 2CT4A 3QIIA 2MWPA 2LT4A 1RACB 2Y4YA 1ZUUA 1YIJT 5GJWB 1MV3A 2O9SA 4C0ZA 2LTOA 3M4YA 4ZN3A 4J7FA 3S3NA 1VQ8Q 2E10A 1NBEB 2AIRB 1G8XA 2L89A 1TWBA 2B8AA 2DBKA 1ZBJA 3G6EQ 3G4ST 4C0GA 4KUDK 3EFOB 1I07A 1NLOC 4F7UE 3L2UA 1N8RR 1K8AU 2HZYA 4KGXB 1H8KA 3INZA 3CMAQ 1M4ZA 2E3IA 3LLRA 3MJXA 3TEEA 2DBMA 2BIVA 3CCJA 4FL6A 1ARKA 3GLXA 1VQNQ 2JM9A 4FT2A 2J6OA 4QT7A 1RAEB 3OB9A 3A8GB 1VQOQ 5FRNA 2JN0A 1K9AA 4A4GA 4HVVA 1GCQC 1VQ5T 4RTVA 1M30A 1M3AA 4EMKC 1X01A 5LJ5j 4LDUA 1X6BA 2LNVA 2YSQA 1X6GA 1M2VB 2D8HA 1D1CA 1B3QA 2QQRA 1VQLT 2EQKA 2BZYA 3UT1A 4E2FB 1UJ0A 3OS1A 8AT1B 1TXQA 2YHTA 1QWFA 1IREB 3M0UA 4J83A 5FWBA 3A8OB 1RAIB 5GAMh 2CKKA 4FSXA 4M78C 3CPWA 1Z9QA 2KDSA 2D0QB 4BE0A 4M78G 5IHNA 1TUGB 4E7KA 3RIRA 3CQTA 2OJ2A 4OMLA 4OB3B 5C0MA 2LMJA 1TH7A 4OGEA 4DOWA 5LL6S 3UDCA 1JU5C 3KFVA 1VQKT 2KRMA 3V7RA 2KBTA 1QLYA 4J9IA 3J80E 1WPYA 5HKCA 1C1AA 2QTVA 3QO3A 4M77E 1YJ9Q 5I22A 2CZ6B 3VJPA 2DXUA 3V8LA 5GAOp 2M02A 5CVIA 2CH4A 2E12A 1RAGB 3H8ZA 3WVEB 5GANd 4QVCA 4RG2A 5CKHA 2LQWA 3DLMA 2MPXC 2BTTA 4C5GA 1KIKA 2K4YA 1AWOA 2E1HA 3FJ5A 3GP8A 2IG0A 1P92A 2ED1A 1ACMB 4B9XA 1YJWQ 2W10A 2X4WA 4LDYA 2I2LA 2ZPBB 3VUBA 1G5VA 3JCMV 1VQMA 4F7UB 2A08A 4LDXA 3HP9A 4HCZA 3I9QA 4IKFA 4PJOD 5C6SA 2QA4Q 2DETA 1MUZA 4XQ3A 1WDXA 1AD5A 2DYIA 2DMOA 3CCSA 5HK0A 1GL5A 1ZBXA 5GAMf 2YXYA 4C8QA 3CC4Q 4FYVB 1YFNA 4HT9A 2LJ3A 4D8DA 4M75D 2KRSA 2OAWA 2XD0A 1N9RA 2K3YA 3H6ZA 4FSSA 4XK8E 5LJ5f 1MMGA 3CC2T 2X4XA 4LUEA 3EFRA 2BUDA 2EPDA 1PNJA 4MZTA 9ATCB 4FM4B 3PIPA 3OA6A 3I56Q 2OTJA 1KSWA 2DM1A 2HDAA 1TUCA 3JSCA 4C8QC 4X34A 3FLGA 2WSCE 2AK5A 4C8QG 4R0KA
chains in the Genus database with same CATH topology
1EIFA 2F5TX 2M1HA 4A4HA 1IZ6A 5DLOA 5GANh 3CCJT 2GFAA 2XK0A 1YBYA 4XU2A 1QVPA 4HCCA 1WGSA 1K9MC 1BYMA 4ZTFA 2XU8A 1H641 1M8VA 1NPPA 3JRZA 5J39A 3JAME 2X4JA 2XG8D 5GAMg 3RERA 3CC7A 4FT4A 3CBOA 1NJIC 4CI0C 2DIGA 2QQSA 2QXFA 3OYGA 1JRIA 5IT9E 4IURA 2FVUA 1I8FA 3BDUA 3DB3A 3C4SA 2CYZB 2M9UA 5GMKj 4RMOA 4BACA 2DTOA 3SD4A 4MDXA 3A5ZB 1N8RU 3S3MA 3G71A 1O9SA 3L2ZA 1Y7XA 2EQUA 3G7ZA 4X9DA 3RMQA 1NZ9A 3M55A 3QJYA 1JJ2S 3QKJA 3OYNA 3PT9A 4JRKA 2DK3A 3QPHA 3SWNA 1S72A 2QEXT 2DO3A 5LJ3h 3M5AA 4N4HA 1Q82C 4V2SA 3L42A 4RCBA 3FEOA 1Q7YC 3LYIA 3JCMe 1KC8C 2YLCA 3CCQA 2OTLA 2XI9A 3LGLA 3C95A 4RCCA 5KE2A 5GMKe 5DLQE 5CKEA 4M77B 2ZPHB 1I81A 4L6V5 2JTMA 3QXEB 3CMEA 2MAMA 3V7SA 4R56A 1JBMA 1R8OB 4XTUA 3EFSA 3Q1JA 5CAIA 2K3XA 2PQWA 3ZEHA 2XHCA 3JCMh 1VQ7T 3QBYA 2A7YA 1VQ6T 3V8KA 1V29B 1U1TA 1WJRA 2H3JA 3C94A 5GMKh 3OYDA 3CCLT 5KE3A 2X35A 2GQVA 3WXMB 4BI3A 1YIJA 3OYCA 3NTHA 3OSSC 3P8BB 2P4TA 3OS0A 3JCMJ 4Q5WA 4PJOE 1G3TA 4IUQA 3OYBA 5GAN2 3PMTA 1VQ8A 2RK1A 1AHJB 2K5FA 5CIUA 3OMGA 2EWNA 3QJ6A 2RB6A 2EIFA 2RHXA 2V8KA 3QG1A 2WSEE 4B9WA 4OB2B 5M9OA 3EAEA 2VXFA 2X4YA 2E41A 3KUFA 1ZQ1A 4E7IA 3FB9A 4M75E 2DTIA 3G6EA 3S3OA 3OSVA 1Y07A 4PLIA 3M59A 3E1SA 2KK4A 2DVEA 2QA4A 4KT0E 3G4SA 3JB9F 1JB0E 1LOJA 2L3RA 3QHSA 3X24B 4A4FA 4BY6C 1KQ2A 3KBGA 1VQPT 5D6YA 2DD5A 2ZZDA 5A0GA 3CMAA 4ZTJA 3R6OA 2LT1A 3OYIA 4NL3A 3I55A 4Z02A 3ER0A 2EJ9A 4UC4A 3LWHA 3L2RA 5GAN6 2D6FA 3FDRA 3GPLA 1DJ7B 4MZMA 2MMPA 2DTHA 5GANf 1M1FA 4M7AE 1NE8A 3HKSA 1UGPB 2LRQA 1K8AC 4DQ2A 3UWNA 3CCMA 3JB9D 1JJ2A 4C0FA 1YI2T 2DJZA 2HQEA 1BIAA 2LQ8A 4CRIA 1VQNA 3QYGB 1O75A 5FU7C 5HY6A 4C5EA 4M7DE 2HBPA 3UPUA 3GIBA 2JTFA 3VV0A 4JDSA 3CPFA 1M1GA 4C0DC 1VQOA 5LJ5d 5GANj 4RG8A 5D6WA 4LDWA 3E9GA 4IUTA 5J26A 4EPCA 2HAXA 1XOVA 4TVRA 3X25B 4QQDA 5A2QE 1M1KC 2P0KA 5GAN3 3ZBDA 3I56A 1XNIA 1FX7A 1OZ2A 2ZPGB 3E19A 4HKEA 5GMKi 3MO8A 5KH6A 1Q86C 2QDYB 4ZN1A 3HRSA 4L59A 3SB2A 4VUBA 2NLUA 1VQMT 2Y4XA 4M78F 3JCMc 2LCCA 2VGMA 4PL6A 4EMKA 2K2VA 3TU4K 3MCAB 5KCHA 3N5BB 1KD1C 3FIFA 4M7AD 2G3RA 3RKXA 3CCVA 5FRMA 5CO7A 3TCJA 4BI4A 1YHQT 1VQLA 3CCST 5GAMf 5I21A 1YITT 4PJOC 3JB9H 2VUBA 1WNLA 3HL8A 3CEYA 3OYJA 4QQ6A 5LJ3j 3OYFA 3JCMW 4M78D 1QVGA 4M7AA 4F7UF 4M7DD 1M1KU 1UGQB 1YJNT 5GANg 4PJOG 3OQ5A 3JCMf 2GF7A 3OYEA 4XTZA 4P5NA 2YRVA 2PVOB 3RKYA 4BY6B 4OVAA 4M78A 4A54A 1BI1A 3VKIA 4M7DA 1KG1A 3NTKA 3RESA 1VIFA 4DA4A 1XTDA 3CCUT 4M75C 4PLLA 4NL2A 4C92F 2RJEA 1VQ9A 2O01E 4IUPA 4MMLA 1YCYA 2XDPA 4XAXB 3RKWA 4BUGA 4M75G 5LJ3e 4JS5A 1K73U 4QW2A 1W4SA 3PFSA 1U1SA 5FU6B 5CQXA 5CQYA 3GOXA 3CD6T 5J3BA 2QEXA 4F7UA 3MP8A 4J6XA 5FU7B 3JB9I 3M58A 4X9CA 1Y96B 3LWIA 1VUBA 2MWOA 4C92D 3L2QA 3CBPA 3QZ9B 4EDUA 1VQKA 4BDYA 2BKDN 4M7AC 4JJNK 4C0DB 4KBMB 5LJ3g 4J8OA 3NTIA 4RKUE 5A0DA 3OY9A 1YJ9A 1K9MU 4BE2A 3BY7A 4C92A 2QI2A 2DZCA 1U8RA 4M7AG 1LJOA 1G3YA 4M7DC 5IAYA 1NJIU 1UGSB 2JZ2A 2QQBA 1BI0A 2XKOC 1VQ4T 2VC8A 3RUXA 4ELYC 4XTVA 1VQ6A 3MP6A 4M7DG 3CC7T 3A8LB 4BE1A 1BI3A 2CS7A 4OGCA 2E6ZA 3JCMg 1BIBA 5LJ5h 4BDZA 5CR2A 2ZCFB 3BFMA 2JNGA 3OMCA 2LQKA 4O5VA 4A53A 4ZGJB 2PVDB 2V8JA 3MEAA 4N0AA 5GAN7 5CCAA 3JCMP 4XU1A 4C8QB 1WQ7A 4PJOB 2HQXA 2DXBA 2EKOA 3META 4D6WA 4E7JA 1X6OA 1Q82U 3SWNC 4BD3A 2ZGWA 5CKBA 3JCMb 3L2WA 1Q7YU 2PUKB 3OS2A 1S72T 2LX9A 1KC8U 4MZPA 2M16A 2DXTA 3A8MB 1MGQA 1RI0A 2C06A 4O6JA 4L5GA 3P8DA 1QVGS 3FRNA 2RI3A 2Y90A 3O8VA 1YJWA 3CCQT 3OYYA 3M57A 2VGNA 3KXTA 5FROA 1FWZA 2VYTA 5GAN8 3OYLA 3DB4A 5IN1A 1VQPA 4XU3A 2CZ1B 4Y91A 3CMET 1G3WA 1M90C 1QP3A 2KSSA 3MEVA 5KCOA 2O4XB 4ME7A 2EJFA 3ME9A 4N4IA 1XQHA 2CZ0B 3QIIA 2MWPA 3HFNA 5CKFA 3X28B 1B34B 2LT4A 3AHUA 1YI2A 2L8DA 2Y4YA 3CC4A 4M77F 1YIJT 1PSFA 2ZPFB 2M0OA 3QYHB 3ZFJA 5GAMd 3MEUA 2DD4A 4C0ZA 2LTOA 3CCRT 2QQ9A 3LX7A 5CKDA 3M4YA 4ZN3A 1KHIA 4J7FA 3PIOA 3OS5A 3S3NA 3JCMX 4PNOA 1W2BS 2E10A 4M78E 1M90U 2JVVA 2CGHA 4M77D 4C8QF 1Y71A 3LGFA 3CBMA 2L89A 3CPWS 4ELZC 1VIEA 2B8AA 3CC2A 4M77A 4NS5A 5A0LA 1I4K1 5I2MA 3G4ST 4C0GA 3SFMA 4KUDK 2RJFA 5GMKl 3F70A 4F7UE 3L2UA 2GFUA 3BDLA 1K8AU 3TREA 4J7IA 5LJ3f 3SWNB 3INZA 4ZGDB 3PNWC 4MMKA 1YITA 2RHUA 1M4ZA 4JLGA 3OW2S 4C92E 3PMIA 3LLRA 3VU3C 2FB7A 3TEEA 1YJNA 1PSEA 2V8IA 2BIVA 2LVMA 4E47A 3JCMd 1VQNT 3CCJA 4HCBA 2WSFE 2IVWA 4J5YA 4FL6A 4C5HA 3GLXA 2DPPB 2OAUA 3CCUA 3CCET 4FT2A 3JB9G 4OB1B 1OI1A 1Q86U 2E5QA 3OB9A 4HT8A 1UEBA 2GCXA 3A8GB 4EMGA 4EMHA 5FRNA 2JN0A 1HK9A 2L5QA 2RI2A 2KVQG 4FU6A 3CD6A 1FXXA 4A4GA 2JUFA 2O4XA 4FIBA 3HRUA 4JRPA 1KD1U 1KQ1A 5CK9A 1VQ5T 5LJ5j 4EMKC 1X01A 4GY5A 2FYKA 4LDUA 1LNXA 3M54A 2LNVA 1H3ZA 5DY9A 3X26B 5GAMe 1N8RC 2PU9B 3HHTB 2OTJT 4JRIA 2QQRA 2DEQA 2RO0A 1VQLT 2A3LA 2EQKA 4HA8A 4A4KA 3UT1A 4BI8B 4YTLA 4WF2A 3L2VA 3OBWA 1KQSA 3OS1A 1OZ3A 3A8HB 3M9QA 4OB0B 1WJQA 2YHTA 2FL7A 1VQ4A 1W2BA 3QZ5B 1I5LA 1IREB 4J83A 1N9SA 3VUZA 3QSUA 3A8OB 2R57A 2KQWA 2CKKA 4FSXA 5LJ5e 5GAMh 4M78C 2RJCA 1X75C 3V8JA 2DZ9A 2KDSA 3CPWA 3HSBA 2RI5A 2D0QB 3RMSA 1QVFA 1QW1A 3LH0A 2R58A 2VV5A 3T9NA 1QP2A 1VQ7A 4BB7A 4BE0A 4M78G 1BKBA 1VQ9T 1SSFA 2EAYA 3CCLA 3M53A 4E7KA 5I2SA 5D6XA 2RM4A 5LJ5g 4R55A 3RIRA 2RA2A 2E70A 2YLBA 4OB3B 5C0MA 3HFOA 4LDVA 3DLLA 2XDBA 2XICA 1TH7A 4OGEA 1N6AA 3NFCA 4OF1A 4DOWA 3G71T 4N4GA 5LL6S 4QVZA 3UDCA 4QQGA 2XIDA 4KULA 1D3BB 5HK3A 4LD6A 4F7UG 5DM7R 3OYMA 3HPWA 3OW2A 3V7RA 1VQKT 3J80E 3VYHB 1OYXA 1YJ9T 1WPYA 5HKCA 2FHDA 2MF2A 4C92C 5EG2A 3L1AA 1G3SA 1VQOT 3CMAT 2HD0A 4ATOA 3QO3A 4M77E 2R5AA 5GAOn 3CXCS 3GNGA 2OTLT 4IUVA 2CZ6B 4M75B 2DXUA 2PUOB 3V8LA 3E9FA 3VJPA 4C92G 2RK2A 3WVDB 5GAOp 2RH2A 3M56A 4JUVA 3MP1A 4EMKB 5CVIA 3MHXA 2EYQA 4E7HA 3C12A 2E12A 4C5IA 3H8ZA 1N27A 3J7AF 4C8QE 3WVEB 2RHIA 5GANd 4N0AC 4QVCA 4OMFB 4RG2A 1NPRA 2RHZA 5CKHA 4Y28E 2LCLA 3V7CA 3DLMA 4KUIA 3CCRA 2D9TA 3MEWA 1HXDA 4XTYA 4M7AB 4C5GA 5GMKm 2LC4A 1UGRB 1UB4A 2K4YA 3PGGA 2DKGA 4MDWA 2E1HA 2ZPIB 1Y96A 5AYFA 3GP8A 4E7LA 1Q81C 1VQ8T 4LD9K 3OYAA 1KQSS 1MHNA 2IG0A 4M78B 4JS4A 5GAOq 4M7DB 2VXEA 1WQWA 2P0PA 2RD1A 1YJWT 3LW5E 1P92A 2R5MA 1WJSA 4PJOF 1GXIE 4II1A 4B9XA 3JB9J 3G6ET 1RL2A 2HNIA 2X4WA 2I2LA 2QTXA 2ZPBB 4J6YA 4LDYA 3VUBA 3FC3A 3JCMV 1QVFS 1G5VA 5LJ3d 1VQMA 3URGA 4F7UB 3J81E 5GAOm 2QA4T 3HP9A 4LDXA 3SDZA 4HCZA 3JCMQ 4IKFA 3M4GA 4C8QD 2AHJB 2CZ7B 2E6NA 4M75F 5C6SA 2DAQA 2K5LA 5FU6C 4QVDA 3I55T 1Q81U 4XQ3A 3CC4T 4XU0A 1YHQA 3CCSA 2EJGA 5HK0A 4OP0A 1ZBXA 2E64A 3P8HA 1BI2A 3OBYA 2PVGB 3GNFB 1ZHIA 3X20B 4C8QA 4C92B 4PJOA 3CCMT 1D3BA 2E65A 2RJDA 4HT9A 2EQJA 3BW1A 2KAFA 5GAN4 2DXCA 3CCEA 2EQMA 2QQAA 4M75D 4XTWA 5FLXE 3HRTA 4JLIA 2XD0A 3GF5A 4M7AF 5GAOl 3CXCA 4GLKA 2K5IA 1N9RA 2K3YA 3H6ZA 4XK8E 2MI6A 5LJ5f 5GAMj 5GAOr 4ZGEB 4M75A 1M9SA 2DIQA 4M77C 2X4XA 3CC2T 4NOYA 1KHCA 2JOYA 3ASKA 1VQ5A 3EFRA 3DKMA 3I56T 4M7DF 2BUDA 3VYGA 4XTXA 5L8RE 4M77G 4MZTA 2LDMA 3FJPA 4JRQA 4PJOD 5GANe 4FM4B 2F5KA 4PKCC 3PIPA 3OA6A 2OTJA 1M5Q1 4J6WA 5GAN5 2WACA 3QDRB 2ZPEB 1K73C 2KMTA 2F69A 2RHYA 3JSCA 4C8QC 1B34A 3S6WA 3OYKA 2K57A 2EFIA 4IUUA 4X34A 4A4EA 2XDDA 3FLGA 2P0QA 2KY9A 3QUIA 2WSCE 3PTAA 3OYHA 3CCVT 4C8QG 4DOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN h;  5GAN 3;  3HFN A;  4XU2 A;  1B34 B;  1D3B B;  3AHU A;  5GMK i;  4F7U G;  3V7R A;  4M77 F;  1H64 1;  1M8V A;  3SB2 A;  5GAM g;  1WPY A;  3RER A;  4C92 C;  5GAM d;  3JCM c;  4M78 F;  3L1A A;  4EMK A;  1JRI A;  3QO3 A;  4M77 E;  4M7D G;  1I8F A;  3BDU A;  5GAO n;  3FIF A;  4C92 G;  4M7A D;  4M75 B;  2DXU A;  3RKX A;  4PNO A;  3V8L A;  5GMK j;  2E10 A;  4M78 E;  3JCM X;  2DTO A;  5LJ5 j;  2CGH A;  4M77 D;  4JUV A;  4C8Q F;  5I21 A;  3L2Z A;  5GAO p;  3JB9 H;  4PJO C;  4X9D A;  1WNL A;  4EMK B;  5LJ3 j;  3JCM W;  4M78 D;  4M7A A;  4F7U F;  4M7D D;  4JRK A;  3SWN A;  5GAN g;  4PJO G;  4M77 A;  3JCM f;  4C8Q E;  5GAN d;  1I4K 1;  4N0A C;  5LJ3 h;  4XTZ A;  4QVC A;  3RKY A;  3V7C A;  5GMK l;  4V2S A;  4A54 A;  4M78 A;  4RCB A;  4F7U E;  4M7D A;  3RES A;  1HXD A;  4XTY A;  3JCM e;  4M7A B;  2YLC A;  5GMK m;  4M75 C;  4NL2 A;  4RCC A;  4C92 F;  5LJ3 f;  3SWN B;  3PGG A;  5GMK e;  3INZ A;  2DKG A;  4M77 B;  2E1H A;  4MML A;  1Y96 A;  1YCY A;  1I81 A;  4MMK A;  3RKW A;  4M75 G;  4M78 B;  5LJ3 e;  3V7S A;  4M7D B;  5GAO q;  1JBM A;  2VXE A;  4XTU A;  1U1S A;  3EFS A;  4C92 E;  1WQW A;  3VU3 C;  2FB7 A;  5CAI A;  2RD1 A;  4F7U A;  3JCM d;  4J6X A;  3JCM h;  4PJO F;  3JB9 I;  3V8K A;  4X9C A;  1Y96 B;  1U1T A;  4J5Y A;  4C92 D;  5GMK h;  3JB9 J;  4M7A C;  2HNI A;  4J6Y A;  2I2L A;  2QTX A;  3JCM J;  5LJ3 g;  3JCM V;  4PJO E;  5LJ3 d;  3JB9 G;  4F7U B;  5GAO m;  3BY7 A;  4C92 A;  5GAN 2;  2DZC A;  3JCM Q;  4HT8 A;  4M7A G;  1LJO A;  4EMG A;  4EMH A;  2JN0 A;  1HK9 A;  3M4G A;  4C8Q D;  4M7D C;  4M75 F;  4PJO D;  4QVD A;  2EWN A;  4XQ3 A;  2RB6 A;  2VC8 A;  4XU0 A;  3RUX A;  4XTV A;  2EJG A;  1KQ1 A;  4OP0 A;  5GAM f;  2E64 A;  2VXF A;  2E41 A;  1X01 A;  4C92 B;  4C8Q A;  4EMK C;  2FYK A;  3FB9 A;  4M75 E;  2DTI A;  4PJO A;  1D3B A;  1LNX A;  2E65 A;  4HT9 A;  3BW1 A;  5DY9 A;  3JCM g;  1BIB A;  5GAM e;  5LJ5 h;  5GAN 4;  2DVE A;  4JRI A;  3BFM A;  4M75 D;  3JB9 F;  4A53 A;  1LOJ A;  2DEQ A;  3QHS A;  4N0A A;  4JLI A;  4HA8 A;  4XTW A;  5GAN 7;  4XU1 A;  3JCM P;  1KQ2 A;  4WF2 A;  1WQ7 A;  4C8Q B;  4M7A F;  4PJO B;  5GAO l;  1N9R A;  5LJ5 f;  5GAM j;  4NL3 A;  2YHT A;  3SWN C;  5GAO r;  2ZGW A;  2EJ9 A;  4M75 A;  3JCM b;  4M77 C;  5GAN 6;  1I5L A;  4NOY A;  1N9S A;  3QSU A;  2DTH A;  3EFR A;  5GAN f;  2DXT A;  5LJ5 e;  1MGQ A;  5GAM h;  4M7A E;  4M7D F;  4M78 C;  4DQ2 A;  4XTX A;  3JB9 D;  3V8J A;  2DZ9 A;  2DJZ A;  4M77 G;  1BIA A;  2Y90 A;  3HSB A;  3FJP A;  5GAN e;  1M5Q 1;  4J6W A;  5GAN 5;  4M78 G;  5GAN 8;  4M7D E;  3GIB A;  2EAY A;  4C8Q C;  1B34 A;  4XU3 A;  4Y91 A;  2K57 A;  2RM4 A;  5LJ5 g;  5LJ5 d;  3RIR A;  5GAN j;  2RA2 A;  2YLB A;  3QUI A;  2EJF A;  3HFO A;  4C8Q G;  1TH7 A; 
#chains in the Genus database with same CATH topology
 2M1H A;  5DLO A;  1YBY A;  1QVP A;  2C0T A;  1OX9 A;  2NUP B;  1YJN Q;  1K9M C;  5J39 A;  1YWP A;  2XG8 D;  5GAM g;  2DX1 A;  2CDT A;  2DIG A;  3OYG A;  1R77 A;  2ROT A;  3DB3 A;  3EGD A;  2F2W A;  5GMK j;  2MIO A;  3SD4 A;  3A5Z B;  1IXD A;  3S3M A;  1O9S A;  1JJ2 S;  2YRD A;  4JRK A;  2DK3 A;  2GGR A;  2JJ9 A;  4PJL A;  3SWN A;  2NWM A;  3I5S A;  2CP7 A;  5KYX B;  3JCM e;  3C95 A;  2ATC B;  5DLQ E;  4M77 B;  2P4R A;  2J6F A;  2JTM A;  1PKT A;  1MND A;  2L2P A;  1R8O B;  3EFS A;  2FO0 A;  2K3X A;  3ZEH A;  1VQ7 T;  3OYD A;  1U1T A;  3C94 A;  5GMK h;  4DBQ A;  1D1A A;  4BI3 A;  1YIJ A;  1PWT A;  2P4T A;  3CCL Q;  4IUQ A;  2DEU A;  1CKB A;  1AHJ B;  2EWN A;  2RHX A;  2JW4 A;  3EG3 A;  4B9W A;  4F14 A;  1RAH B;  1BU1 A;  3EHR A;  2X4Y A;  1ZQ1 A;  2RPN A;  3M59 A;  2QA4 A;  3G4S A;  1VYU A;  3X24 B;  4BY6 C;  4PFO A;  1LVK A;  2B86 A;  5D6Y A;  5A0G A;  4PFZ A;  4ESR A;  3R6O A;  4UC4 A;  5GAN 6;  3TSW A;  2MMP A;  2DA9 A;  4DQ2 A;  3CCM A;  1RLQ C;  2LQ8 A;  1RAA B;  2LQN A;  1ZLM A;  1OPK A;  5L23 A;  4M7D E;  1M1G A;  5GAN j;  2HAX A;  5D7U A;  3X25 B;  4QQD A;  1M1K C;  2ENM A;  1FYN A;  2P0K A;  3ZBD A;  3I56 A;  1XNI A;  1OZ2 A;  4JZ3 A;  4AT1 B;  1GRI A;  3SB2 A;  1PCX A;  4PL6 A;  3VS5 A;  2DFU A;  3MCA B;  3N5B B;  5KYY A;  1GFD A;  1IGQ A;  3AT1 B;  1XJW B;  4BI4 A;  1VQL A;  4PJO C;  3JB9 H;  3VS3 A;  2DF6 A;  1WNL A;  1ZSZ C;  1YHQ Q;  4M7D D;  1M1K U;  1WLP B;  1UGQ B;  4PJO G;  2GF7 A;  4XTZ A;  4HVU A;  3CCE Q;  2COY A;  1UGV A;  1XTD A;  4M75 C;  4NL2 A;  2QGF B;  4ANJ A;  2XDP A;  4XAX B;  4BUG A;  4X1V A;  4M75 G;  5LJ3 e;  1K73 U;  1UJY A;  1K76 A;  4QKU A;  4RTU A;  4J6X A;  3M58 A;  4X9C A;  3REA B;  2MWO A;  4C92 D;  3L2Q A;  3QZ9 B;  1VQK A;  2QYZ A;  2X3X D;  2AZV A;  2BKD N;  2EGC A;  2DL4 A;  1WHH A;  4KBM B;  1WHJ A;  4KH1 B;  2D8J A;  3TQ7 P;  1SKU B;  4BE2 A;  1C6V X;  1ZX6 A;  1G3Y A;  2D1X A;  2KYB A;  1NJI U;  4HXJ A;  1JO8 A;  2JZ2 A;  1WXT A;  2VC8 A;  4LXC A;  3A8L B;  1VQ4 Q;  2F2V A;  2E6Z A;  2QAS A;  2CP6 A;  1GBR A;  3BFM A;  2LQK A;  3MEA A;  5GAN 7;  1B7T A;  5CCA A;  4XU1 A;  2CRE A;  2DXB A;  2KNB B;  2RF0 A;  1Q82 U;  2CSQ A;  5CKB A;  3OS2 A;  1KC8 U;  3E2U A;  2M16 A;  2DXT A;  3A8M B;  1RI0 A;  3UA7 A;  2VAS A;  3NMZ C;  2KT8 A;  4O6J A;  2RI3 A;  3KXT A;  1RUW A;  2VYT A;  3OYL A;  3SHW A;  4Y91 A;  1QP3 A;  2KSS A;  2L0A A;  4ME7 A;  3CME Q;  3THK A;  1RAB B;  4N4I A;  2YUP A;  1D0Z A;  1NYF A;  5CKF A;  3X28 B;  1NG2 A;  3AHU A;  4RTT A;  2L8D A;  2BE9 B;  5KYU B;  5GAM d;  2DD4 A;  2CUD A;  2QQ9 A;  3UAT A;  5CKD A;  4M78 E;  2JVV A;  4HVW A;  3EG0 A;  2P84 A;  4KRT A;  3CPW S;  3CC2 A;  2O9V A;  4NS5 A;  2ED0 A;  1I4K 1;  5I2M A;  2C0I A;  2KRO A;  5GMK l;  1UEC A;  2DIL A;  1D09 B;  1OU8 A;  3R6N A;  4ZGD B;  4MMK A;  1EFN A;  3I55 Q;  1C0M A;  1ZA2 B;  4JLG A;  1WHM A;  3PMI A;  3VU3 C;  2JS0 A;  2A0F B;  1VQN T;  4E47 A;  1ABO A;  2DPP B;  2OAU A;  1G2B A;  1Y0M A;  1X27 A;  1OI1 A;  4FYY B;  1Q86 U;  1NLP C;  4HT8 A;  4EMG A;  4EMH A;  1W2B P;  2RI2 A;  1FXX A;  4FIB A;  3HRU A;  1KD1 U;  1KQ1 A;  4GY5 A;  1D1B A;  1LNX A;  4Z8A A;  1TU0 B;  3HHT B;  1NEG A;  3EHQ A;  2OTJ T;  5KYU A;  4AFZ C;  2DEQ A;  2RO0 A;  2A3L A;  4A4K A;  4WF2 A;  1KQS A;  3A8H B;  2OI3 A;  1VQ4 A;  1I5L A;  2YRC A;  3QSU A;  1QMC A;  3OW2 P;  2RJC A;  2H3E B;  5FWC A;  3GBQ A;  2HBW A;  5KYW A;  4JJD A;  1VQ7 A;  4BB7 A;  4Z88 A;  3M53 A;  5D6X A;  2RM4 A;  2RA2 A;  2YLB A;  2DNU A;  3HFO A;  2EYY A;  3DLL A;  2XDB A;  2XIC A;  1N6A A;  3NFC A;  2J05 A;  4OF1 A;  4N4G A;  4QVZ A;  4QQG A;  2XID A;  5DM7 R;  3G71 Q;  2DVJ A;  1YJ9 T;  4C92 C;  1G3S A;  2AZS A;  1U5S A;  1I5O B;  2R5A A;  4C92 G;  1WZO A;  2RK2 A;  1BCM A;  4JUV A;  2OX7 A;  2W0Z A;  4EMK B;  4CC3 A;  2HSP A;  4LN2 A;  4E7H A;  3C12 A;  4C8Q E;  1IO6 A;  4AG2 C;  1HSQ A;  2LCL A;  1HJD A;  4M7A B;  2LC4 A;  1UGR B;  1UB4 A;  3PGG A;  4AFU C;  1WA7 A;  2DER A;  1Y96 A;  1Q81 C;  1RI9 A;  4LD9 K;  4M78 B;  5GAO q;  3BE3 A;  2P0P A;  2RD1 A;  4DEY A;  1YJW T;  2K9G A;  1WJS A;  1GXI E;  4GBQ A;  3C0C A;  1ZSG A;  4J6Y A;  2FPF A;  1QVF S;  3UA6 A;  1VQP Q;  2QA4 T;  1K73 R;  3SDZ A;  3CXC P;  3M4G A;  4C8Q D;  2CZ7 B;  1YP5 A;  5FU6 C;  2RQR A;  4QVD A;  1Q81 U;  3M0R A;  1UUE A;  3CC4 T;  4XU0 A;  1T3S A;  3P8H A;  3X20 B;  2PVG B;  3CCM T;  2EQJ A;  3VRZ A;  3BW1 A;  2CP2 A;  2QQA A;  1NJI R;  4XTW A;  1X2Q A;  1PD0 A;  4HCK A;  2K2M A;  4M7A F;  5GAO l;  5GAM j;  4ZGE B;  2J06 A;  1KHC A;  3ASK A;  1KQS P;  2JT4 A;  2K7A A;  3I56 T;  4OMN A;  3FJP A;  2O31 A;  5GAN e;  2F5K A;  1WXB A;  2A36 A;  2ZPE B;  1Q82 R;  3S6W A;  5IHK A;  2EFI A;  1KC8 R;  3H41 A;  1FMK A;  2KY9 A;  3QUI A;  3PTA A;  1ZA1 B;  4WCI A;  3REB B;  2XK0 A;  3EGX B;  1BYM A;  2EBP A;  1NPP A;  3MKD A;  2H8H A;  4CI0 C;  3CCU Q;  3EG9 B;  2FVU A;  1E6G A;  1WHL A;  4CC2 A;  3C4S A;  2GTO A;  2M9U A;  4RMO A;  2AT1 B;  3VS2 A;  2DTO A;  3G71 A;  3RMQ A;  3G7Z A;  3EFO A;  2LCS A;  1NZ9 A;  3QJY A;  3CD6 Q;  1A0N B;  8ATC B;  2FPD A;  3OYN A;  3PT9 A;  1KJW A;  5LJ3 h;  3M5A A;  1IRX A;  3A98 A;  4V2S A;  3L42 A;  4RCB A;  2QEX Q;  2OTL A;  2X3W D;  1B07 A;  4RCC A;  5IH2 A;  4J9B A;  3V7S A;  3Q1J A;  2DJQ A;  2XHC A;  3QBY A;  1V29 B;  1WJR A;  2H3J A;  2KR3 A;  3CCL T;  1M27 C;  2A37 A;  5KE3 A;  3WXM B;  2DL3 A;  1VQ6 Q;  3NTH A;  3H9N A;  4PJO E;  3I35 A;  2NYS A;  3OYB A;  1SSH A;  1VQ8 A;  3M0Q A;  2QAZ A;  5CIU A;  2Z0W A;  3QJ6 A;  2RB6 A;  1M2V A;  2WSE E;  4OB2 B;  1TSF A;  2VXF A;  4E7I A;  3FB9 A;  4M75 E;  3S3O A;  3G6E A;  1Q86 R;  3OSV A;  3E1S A;  1T3L A;  2LJ1 A;  4KT0 E;  2DYB A;  3JB9 F;  1JB0 E;  7AT1 B;  4EIK A;  1QKW A;  2DD5 A;  3CMA A;  3IQL A;  4ZTJ A;  1KD1 R;  3OYI A;  2EJ9 A;  3LWH A;  2D6F A;  3L2R A;  3FDR A;  3GPL A;  1DJ7 B;  2EYZ A;  4MZM A;  2KXD A;  1UGP B;  2LRQ A;  2HQE A;  1BIA A;  4CRI A;  1VQN A;  3QYG B;  1YI2 Q;  1W6X A;  3UPU A;  1KFZ A;  3VV0 A;  4PJJ A;  1YN8 A;  1VQO A;  3EG1 A;  4LDW A;  2BZX A;  4EPC A;  1CSK A;  1XOV A;  5GAN 3;  1FX7 A;  2ZPG B;  5GMK i;  1GBQ A;  4HKE A;  3MO8 A;  2QDY B;  3HRS A;  4VUB A;  2NLU A;  1YCS B;  2Y4X A;  4KGV B;  2VGM A;  4RUG A;  2G3R A;  1D0Y A;  1UFF A;  2HCK A;  3TCJ A;  2L3P A;  1ABQ A;  1TG0 A;  1YHQ T;  3M0T A;  2VUB A;  1Q7Y R;  2K3B A;  2CP3 A;  2PTK A;  1QVG A;  4F7U F;  2GQI A;  1YIT Q;  3OQ5 A;  3OYE A;  4BY6 B;  4OVA A;  3VKI A;  1KG1 A;  4PLL A;  4IUP A;  4MML A;  1OPL A;  4QW2 A;  3PFS A;  3VS0 A;  2E5K A;  3GOX A;  1VQ5 Q;  2QEX A;  4F7U A;  3MP8 A;  3VS6 A;  2FZC B;  3LWI A;  2JMC A;  1RAF B;  1H92 A;  2K79 A;  5LJ3 g;  4RKU E;  3NTI A;  1YJ9 A;  1K9M U;  3BY7 A;  1U3O A;  2QI2 A;  2DZC A;  1U8R A;  1LJO A;  1WI7 A;  1VOM A;  1VQ4 T;  1GFC A;  3RUX A;  1PC0 A;  1VQ6 A;  4Z89 A;  4BE1 A;  1BI3 A;  4OGC A;  3EH2 A;  4AG1 C;  3CC7 Q;  4BDZ A;  5CR2 A;  2JNG A;  4E7Z A;  4A53 A;  4ZGJ B;  4N0A A;  1K8A R;  4PJO B;  4E7J A;  1X6O A;  1S1N A;  1ZSZ B;  2JTE A;  2SEM A;  3SWN C;  4BD3 A;  2HL5 C;  1ZUY A;  2DRM A;  1BK2 A;  1WHK A;  4CC7 A;  1S72 Q;  3P8D A;  3FRN A;  2Y90 A;  4E6R A;  1YJW A;  2JXB A;  3OYY A;  2VGN A;  5FRO A;  4LUD A;  5GAN 8;  3DB4 A;  1NYG A;  1X2K A;  3CCQ Q;  4XU3 A;  2CZ1 B;  3CME T;  2NUP A;  1T0H A;  1M90 C;  1AVZ C;  4GLM A;  5KCO A;  2KEA A;  1AZE A;  1K4U S;  3ME9 A;  2CZ0 B;  3HFN A;  4AFQ C;  1B34 B;  1YI2 A;  2MOX A;  3VS1 A;  3RBB B;  3CC4 A;  4M77 F;  2J6K A;  2ZPF B;  2M0O A;  3QYH B;  1TS9 A;  2CP5 A;  3MEU A;  4OMO A;  2GBQ A;  2NUT B;  3OS5 A;  1CKA A;  3QDF A;  4PNO A;  3JCM X;  3CCR Q;  1M90 U;  5IHI A;  5KYX A;  3CBM A;  1AWW A;  4ELZ C;  1VIE A;  2FRY A;  4M77 A;  1QVG P;  3SFM A;  2L3Q A;  3BDL A;  3TRE A;  3PNW C;  1YIT A;  2RHU A;  2G6F X;  4C92 E;  1YJN A;  1PSE A;  2V8I A;  2LVM A;  3JCM d;  2WSF E;  1NEB A;  2IVW A;  1VYV A;  3VS4 A;  2CH4 W;  3MPU B;  2HQH A;  2J7I A;  1MMN A;  2E5Q A;  1UEB A;  4FU6 A;  5CK9 A;  2E3H A;  1YNZ A;  3M54 A;  5GAM e;  1N8R C;  4JRI A;  4HA8 A;  4BI8 B;  3L2V A;  3OBW A;  1OZ3 A;  3M9Q A;  4OB0 B;  2FL7 A;  1W2B A;  4PK4 A;  1MV0 B;  1V1C A;  1PG5 B;  2R57 A;  2KQW A;  5LJ5 e;  2DZ9 A;  1QW1 A;  3LH0 A;  2R58 A;  2VV5 A;  3T9N A;  1QP2 A;  2EVR A;  2GNC A;  1BKB A;  1R0C B;  1SSF A;  2F1L A;  2EAY A;  3CCL A;  5I2S A;  2PNI A;  4R55 A;  1VQ9 Q;  2X9H A;  3G71 T;  5HK3 A;  4KUL A;  3OW2 A;  4LD6 A;  2X51 A;  2SRC A;  3VYH B;  1OYX A;  2KGT A;  2FHD A;  1OU9 A;  4FCY A;  2HD0 A;  1HYO A;  2DL8 A;  5GAO n;  2OTL T;  4IUV A;  1QCF A;  3E9F A;  2VB6 A;  4B6M A;  3WVD B;  2RH2 A;  3M56 A;  3MHX A;  2EYQ A;  4C5I A;  2RHI A;  1NPR A;  2ABL A;  3V7C A;  3CCR A;  2M51 A;  4KUI A;  2D9T A;  3QWY A;  1HXD A;  4XTY A;  2LNH B;  4CC4 B;  4MDW A;  4E7L A;  5AYF A;  4J9G A;  1IHV A;  1RAD B;  1VQ8 T;  1MHN A;  2FEI A;  4M7D B;  1BBZ A;  4K11 A;  2VXE A;  2ECZ A;  1WQW A;  1H3H A;  3LW5 E;  2R5M A;  4J9E A;  1ZUK A;  5FW9 A;  3G6E T;  1RL2 A;  2HNI A;  2QTX A;  3FC3 A;  5LJ3 d;  3URG A;  3J81 E;  5GAO m;  2AKK A;  1W70 A;  3CMA T;  2AHJ B;  2DAQ A;  2RNA A;  1YHQ A;  2E64 A;  4C92 B;  1BI2 A;  3OBY A;  3GNF B;  1EZZ B;  1K9M R;  2E65 A;  2RJD A;  2DXC A;  3CCE A;  2EQM A;  4D8K A;  5I11 A;  5FLX E;  2I0N A;  3GF5 A;  3CXC A;  1UE9 A;  2K5I A;  1VQO T;  2MI6 A;  4NOY A;  2JOY A;  1OQK A;  3DKM A;  4M7D F;  2EKH A;  2LDM A;  1EX4 A;  4JRQ A;  4PKC C;  3NHN A;  2COW A;  2EYW A;  5GAN 5;  3QDR B;  2DE0 X;  2KMT A;  2RHY A;  5IXB A;  3OYK A;  4J9F A;  4IUU A;  2XDD A;  2P0Q A;  1SHG A;  2KYM A;  3OYH A;  4DOV A;  2F5T X;  4A4H A;  4HCC A;  4XU2 A;  3CCV Q;  4Y92 A;  2XU8 A;  3CCJ Q;  1BB9 A;  1H64 1;  1M8V A;  4OMQ A;  4FT4 A;  2QXF A;  1LPL A;  1JRI A;  2YUQ A;  3BDU A;  2NUZ A;  2CYZ B;  2C0O A;  4BAC A;  2EQU A;  3TSZ A;  5IXF A;  5AT1 B;  3QPH A;  2QEX T;  3I5R A;  1RLP C;  3SEM A;  3FEO A;  1Q7Y C;  1PHT A;  3LYI A;  1WFW A;  5KE2 A;  3RR6 A;  5GMK e;  5CKE A;  2ZPH B;  1I81 A;  4L6V 5;  1UHF A;  3QXE B;  3CME A;  2PZ1 A;  1WIE A;  4R56 A;  1JBM A;  5CAI A;  2PQW A;  3JCM h;  1VQ6 T;  3V8K A;  3JCM J;  3OSS C;  1G3T A;  2AKL A;  2YT6 A;  5GAN 2;  3PMT A;  1VYT A;  1OV3 A;  4F16 A;  3OMG A;  2EIF A;  3QG1 A;  2V8K A;  1M1K R;  1JJ2 P;  3EAE A;  3KUF A;  4OMP A;  2DTI A;  1JXM A;  1PM3 A;  1Y07 A;  4FYX B;  4E7S A;  1IHW A;  2DVE A;  1JQQ A;  1WX6 A;  2L3R A;  3QHS A;  2F2X A;  3I55 A;  2LT1 A;  4NL3 A;  2YUN A;  2EYX A;  3RNJ A;  2YDL A;  1U06 A;  2DTH A;  1NE8 A;  1QCN A;  1K8A C;  3UWN A;  3JB9 D;  1YI2 T;  3M0P A;  1O75 A;  5FU7 C;  5HY6 A;  1MMD A;  4C5E A;  2HBP A;  2CSI A;  4IIM A;  2JTF A;  3HTR A;  4C0D C;  4RG8 A;  2RQT A;  4RTZ A;  4IUT A;  5J26 A;  1QQJ A;  5A2Q E;  1M3C A;  1E6H A;  1TTH B;  3JCM c;  1GCQ A;  4M78 F;  2LCC A;  4EMK A;  2K2V A;  5KCH A;  1QWE A;  1VQM Q;  3CCV A;  5CO7 A;  4DBH A;  5I21 A;  2KI7 A;  1YIT T;  1NM7 A;  4QQ6 A;  5LJ3 j;  3OYF A;  3JCM W;  3A1P A;  4M7A A;  3CCS Q;  4RTW A;  4DEX A;  1YJN T;  3JCM f;  2YRV A;  2PVO B;  4A54 A;  4M78 A;  1R0B G;  4DA4 A;  3ULR B;  2RJE A;  1YCY A;  4JJC A;  1SRL A;  1W4S A;  1VA7 A;  1U1S A;  5CQY A;  5J3B A;  1X43 A;  1N5Z A;  3JB9 I;  1VUB A;  2GTJ A;  4AMC A;  4EDU A;  2OTJ Q;  1WXU A;  4BDY A;  4M7A C;  2FG0 A;  4JJN K;  4J8O A;  1M3B A;  5A0D A;  4DBF A;  4M7A G;  2LP5 A;  2QQB A;  1BI0 A;  4FW2 A;  4XTV A;  2CT3 A;  1FMV A;  1AWJ A;  3CC7 T;  1JEG A;  3JCM g;  1BIB A;  4F04 B;  5LJ5 h;  2RMO A;  2ZCF B;  3OMC A;  2CUB A;  4O5V A;  4C8Q B;  1WQ7 A;  2DRK A;  2HQX A;  1OX8 A;  4D6W A;  3L2W A;  2ZGW A;  2PUK B;  1S72 T;  2C06 A;  3H0H A;  3RDV A;  3CCQ T;  1SRM A;  2HSE B;  1VQP A;  3EGX A;  3MEV A;  4J9H A;  2O4X B;  2EJF A;  2HL3 A;  1XQH A;  3EG9 A;  1PSF A;  2EW3 A;  3ZFJ A;  1YIJ Q;  3CCR T;  3LX7 A;  4M4Z A;  1KHI A;  3PIO A;  1W2B S;  2A28 A;  2CGH A;  4M77 D;  4C8Q F;  1Y71 A;  1PKS A;  3LGF A;  3H0I A;  2QGG A;  2LX7 A;  3EGD B;  5A0L A;  1I1J A;  3PVQ A;  2RJF A;  2RQW A;  6AT1 B;  3F70 A;  2GFU A;  3G4S Q;  4J7I A;  5LJ3 f;  3SWN B;  4LNP A;  4ORZ A;  2XMF A;  4ZNX A;  1SPK A;  3OW2 S;  2FB7 A;  3CCM Q;  3LH5 A;  4HCB A;  4J5Y A;  4C5H A;  1IB8 A;  3CCU A;  2V1Q A;  3CCE T;  3JB9 G;  1V76 A;  4OB1 B;  2GCX A;  1J3T A;  1HK9 A;  2L5Q A;  2KVQ G;  3CD6 A;  2JUF A;  2O4X A;  4JRP A;  3EH1 A;  3CPW P;  2FYK A;  4KH0 B;  1H3Z A;  2FPE A;  5DY9 A;  3X26 B;  2V1R A;  2PU9 B;  2RN8 A;  2DLP A;  2KRN A;  4YTL A;  2HEQ A;  1WJQ A;  3G1J A;  1VQL Q;  3QZ5 B;  2JM8 A;  3TVT A;  1N9S A;  3VUZ A;  1K0S A;  3NPF A;  1X75 C;  3V8J A;  3HSB A;  2RI5 A;  3RMS A;  1QVF A;  1VQ9 T;  5LJ5 g;  3D7S B;  2E70 A;  1T0J A;  4LDV A;  1Q81 R;  2O88 A;  1PRL C;  3OYM A;  1D3B B;  4F7U G;  3HPW A;  1OUL A;  2MF2 A;  1VQK Q;  5EG2 A;  3L1A A;  4ATO A;  3CXC S;  3GNG A;  4PJM A;  4M75 B;  2PUO B;  2CP0 A;  3MP1 A;  1F1B B;  5KYY B;  3J7A F;  1N27 A;  4N0A C;  4OMF B;  2D0N A;  2RHZ A;  4Y28 E;  1WYX A;  3MEW A;  5GMK m;  2ZAE A;  2DKG A;  2ZPI B;  4J9D A;  3OYA A;  1KQS S;  2DL5 A;  2FZG B;  4JS4 A;  2HMA A;  1SHF A;  2K6D A;  4PJO F;  4II1 A;  3VS7 A;  3JB9 J;  2DL7 A;  3PVL A;  1TOV A;  3JCM Q;  1OOT A;  2E6N A;  4M75 F;  2K5L A;  3I55 T;  1YWO A;  1PRM C;  2EJG A;  4OP0 A;  1ZHI A;  4PJO A;  1D3B A;  1ZSZ A;  1SG5 A;  2KAF A;  5GAN 4;  2MCN A;  2QDL A;  2O2O A;  2VKN A;  3HRT A;  4JLI A;  4JZ4 A;  3NGP A;  4GLK A;  4RTX A;  5GAO r;  4M75 A;  1M9S A;  2DIQ A;  4M77 C;  5EC7 A;  1VQ5 A;  4A63 B;  2QK0 A;  1BCO A;  3CC2 Q;  3VYG A;  4XTX A;  5L8R E;  4M77 G;  5GJV B;  1M5Q 1;  4J6W A;  2KXC A;  2WAC A;  1W1F A;  1K73 C;  2YUO A;  2F69 A;  1QVF P;  1B34 A;  2K57 A;  4A4E A;  1Q95 G;  1I0C A;  3VRY A;  3CCV T;  1QKX A;  2YWW A;  1EIF A;  3CCJ T;  5GAN h;  1IZ6 A;  2GFA A;  1WGS A;  2NUT A;  4ZTF A;  3JRZ A;  3JAM E;  2X4J A;  1M8M A;  3RER A;  3CC7 A;  3CBO A;  1NJI C;  2QQS A;  5IT9 E;  4IUR A;  1I8F A;  2EGA A;  2FZK B;  1FMW A;  2VWF A;  4MDX A;  1N8R U;  1JXO A;  3L2Z A;  1Y7X A;  4J9C A;  4X9D A;  3M55 A;  4IIO A;  1MMA A;  3QKJ A;  2HKQ B;  1S72 A;  1SEM A;  2ROL A;  2DO3 A;  1HD3 A;  4N4H A;  2MYS A;  1Q82 C;  2HKN A;  1KC8 C;  2YLC A;  3CCQ A;  2KT1 A;  2XI9 A;  3LGL A;  2M0Y A;  1SF9 A;  4JPB W;  2EQI A;  4LE9 A;  1LCK A;  2MAM A;  4XTU A;  1E7O A;  1AOJ A;  1WHG A;  2A7Y A;  2COZ A;  1GCP A;  2X35 A;  2GQV A;  4PFP A;  1VQ7 Q;  3OYC A;  3P8B B;  3OS0 A;  3PE0 A;  4Q5W A;  1AWX A;  1K0X A;  3UF4 A;  2RK1 A;  2K5F A;  2V26 A;  1M2O A;  1KK7 A;  5M9O A;  2E41 A;  1OEB A;  3QWX X;  1G83 A;  1UTI A;  3ZL7 C;  4PLI A;  2RQU A;  2KK4 A;  3U23 A;  1LOJ A;  4A4F A;  1KQ2 A;  1AZG B;  3KBG A;  4FW1 A;  1VQP T;  1D0X A;  2ZZD A;  1UG1 A;  4JJB A;  4Z02 A;  3ER0 A;  5GAN f;  1M1F A;  4M7A E;  3HKS A;  1JJ2 A;  4C0F A;  2DJZ A;  3O5Z A;  3GIB A;  1TUD A;  4JDS A;  3CPF A;  5LJ5 d;  5D6W A;  2LJ0 A;  3E9G A;  5KYW B;  4TVR A;  4RTY A;  4FYW B;  3E19 A;  5KH6 A;  1Q86 C;  1UHC A;  4KGZ B;  4ZN1 A;  4L59 A;  1VQM T;  2BZ8 A;  3TU4 K;  1MNE A;  1KD1 C;  3FIF A;  4M7A D;  3RKX A;  5FRM A;  3CCS T;  1IGU A;  3HL8 A;  3CEY A;  3OYJ A;  4M78 D;  5GAN g;  2LZ6 B;  5HCK A;  3M0S A;  4P5N A;  3RKY A;  1X69 A;  1BI1 A;  4M7D A;  3NTK A;  3RES A;  1VIF A;  3CCU T;  4DBR A;  3H0F A;  4C92 F;  1VQ9 A;  2O01 E;  3RKW A;  3EG2 A;  3EGU A;  4JS5 A;  5FU6 B;  5CQX A;  3CD6 T;  4F17 A;  1K1Z A;  2JMA A;  5FU7 B;  2E4H A;  1Y96 B;  1Z9Z A;  3CBP A;  2ESW A;  4AFS C;  2KE9 A;  4WTO B;  4C0D B;  3OY9 A;  2MK5 A;  2L3S A;  4C92 A;  1M90 R;  4M7D C;  5IAY A;  1UGS B;  2XKO C;  4ELY C;  1QCO A;  3MP6 A;  5KYN A;  4M7D G;  2JS2 A;  3JV3 A;  2CS7 A;  1AEY A;  1UDL A;  2PVD B;  2V8J A;  3JCM P;  2EKO A;  3MET A;  2IPO B;  4PJN A;  1AT1 B;  2BE7 D;  3JCM b;  1Q7Y U;  2IIM A;  2LX9 A;  4MZP A;  1MGQ A;  4L5G A;  1QVG S;  2FRW A;  3O8V A;  2QG9 B;  3M57 A;  1FWZ A;  1Y57 A;  4OMM A;  5IN1 A;  5ECA A;  2OTL Q;  2EGE A;  1G3W A;  1PD1 A;  2RQV A;  2VVK A;  2CT4 A;  3QII A;  2MWP A;  2LT4 A;  1RAC B;  2Y4Y A;  1ZUU A;  1YIJ T;  5GJW B;  1MV3 A;  2O9S A;  4C0Z A;  2LTO A;  3M4Y A;  4ZN3 A;  4J7F A;  3S3N A;  1VQ8 Q;  2E10 A;  1NBE B;  2AIR B;  1G8X A;  2L89 A;  1TWB A;  2B8A A;  2DBK A;  1ZBJ A;  3G6E Q;  3G4S T;  4C0G A;  4KUD K;  3EFO B;  1I07 A;  1NLO C;  4F7U E;  3L2U A;  1N8R R;  1K8A U;  2HZY A;  4KGX B;  1H8K A;  3INZ A;  3CMA Q;  1M4Z A;  2E3I A;  3LLR A;  3MJX A;  3TEE A;  2DBM A;  2BIV A;  3CCJ A;  4FL6 A;  1ARK A;  3GLX A;  1VQN Q;  2JM9 A;  4FT2 A;  2J6O A;  4QT7 A;  1RAE B;  3OB9 A;  3A8G B;  1VQO Q;  5FRN A;  2JN0 A;  1K9A A;  4A4G A;  4HVV A;  1GCQ C;  1VQ5 T;  4RTV A;  1M30 A;  1M3A A;  4EMK C;  1X01 A;  5LJ5 j;  4LDU A;  1X6B A;  2LNV A;  2YSQ A;  1X6G A;  1M2V B;  2D8H A;  1D1C A;  1B3Q A;  2QQR A;  1VQL T;  2EQK A;  2BZY A;  3UT1 A;  4E2F B;  1UJ0 A;  3OS1 A;  8AT1 B;  1TXQ A;  2YHT A;  1QWF A;  1IRE B;  3M0U A;  4J83 A;  5FWB A;  3A8O B;  1RAI B;  5GAM h;  2CKK A;  4FSX A;  4M78 C;  3CPW A;  1Z9Q A;  2KDS A;  2D0Q B;  4BE0 A;  4M78 G;  5IHN A;  1TUG B;  4E7K A;  3RIR A;  3CQT A;  2OJ2 A;  4OML A;  4OB3 B;  5C0M A;  2LMJ A;  1TH7 A;  4OGE A;  4DOW A;  5LL6 S;  3UDC A;  1JU5 C;  3KFV A;  1VQK T;  2KRM A;  3V7R A;  2KBT A;  1QLY A;  4J9I A;  3J80 E;  1WPY A;  5HKC A;  1C1A A;  2QTV A;  3QO3 A;  4M77 E;  1YJ9 Q;  5I22 A;  2CZ6 B;  3VJP A;  2DXU A;  3V8L A;  5GAO p;  2M02 A;  5CVI A;  2CH4 A;  2E12 A;  1RAG B;  3H8Z A;  3WVE B;  5GAN d;  4QVC A;  4RG2 A;  5CKH A;  2LQW A;  3DLM A;  2MPX C;  2BTT A;  4C5G A;  1KIK A;  2K4Y A;  1AWO A;  2E1H A;  3FJ5 A;  3GP8 A;  2IG0 A;  1P92 A;  2ED1 A;  1ACM B;  4B9X A;  1YJW Q;  2W10 A;  2X4W A;  4LDY A;  2I2L A;  2ZPB B;  3VUB A;  1G5V A;  3JCM V;  1VQM A;  4F7U B;  2A08 A;  4LDX A;  3HP9 A;  4HCZ A;  3I9Q A;  4IKF A;  4PJO D;  5C6S A;  2QA4 Q;  2DET A;  1MUZ A;  4XQ3 A;  1WDX A;  1AD5 A;  2DYI A;  2DMO A;  3CCS A;  5HK0 A;  1GL5 A;  1ZBX A;  5GAM f;  2YXY A;  4C8Q A;  3CC4 Q;  4FYV B;  1YFN A;  4HT9 A;  2LJ3 A;  4D8D A;  4M75 D;  2KRS A;  2OAW A;  2XD0 A;  1N9R A;  2K3Y A;  3H6Z A;  4FSS A;  4XK8 E;  5LJ5 f;  1MMG A;  3CC2 T;  2X4X A;  4LUE A;  3EFR A;  2BUD A;  2EPD A;  1PNJ A;  4MZT A;  9ATC B;  4FM4 B;  3PIP A;  3OA6 A;  3I56 Q;  2OTJ A;  1KSW A;  2DM1 A;  2HDA A;  1TUC A;  3JSC A;  4C8Q C;  4X34 A;  3FLG A;  2WSC E;  2AK5 A;  4C8Q G;  4R0K A; 
#chains in the Genus database with same CATH homology
 1EIF A;  2F5T X;  2M1H A;  4A4H A;  1IZ6 A;  5DLO A;  5GAN h;  3CCJ T;  2GFA A;  2XK0 A;  1YBY A;  4XU2 A;  1QVP A;  4HCC A;  1WGS A;  1K9M C;  1BYM A;  4ZTF A;  2XU8 A;  1H64 1;  1M8V A;  1NPP A;  3JRZ A;  5J39 A;  3JAM E;  2X4J A;  2XG8 D;  5GAM g;  3RER A;  3CC7 A;  4FT4 A;  3CBO A;  1NJI C;  4CI0 C;  2DIG A;  2QQS A;  2QXF A;  3OYG A;  1JRI A;  5IT9 E;  4IUR A;  2FVU A;  1I8F A;  3BDU A;  3DB3 A;  3C4S A;  2CYZ B;  2M9U A;  5GMK j;  4RMO A;  4BAC A;  2DTO A;  3SD4 A;  4MDX A;  3A5Z B;  1N8R U;  3S3M A;  3G71 A;  1O9S A;  3L2Z A;  1Y7X A;  2EQU A;  3G7Z A;  4X9D A;  3RMQ A;  1NZ9 A;  3M55 A;  3QJY A;  1JJ2 S;  3QKJ A;  3OYN A;  3PT9 A;  4JRK A;  2DK3 A;  3QPH A;  3SWN A;  1S72 A;  2QEX T;  2DO3 A;  5LJ3 h;  3M5A A;  4N4H A;  1Q82 C;  4V2S A;  3L42 A;  4RCB A;  3FEO A;  1Q7Y C;  3LYI A;  3JCM e;  1KC8 C;  2YLC A;  3CCQ A;  2OTL A;  2XI9 A;  3LGL A;  3C95 A;  4RCC A;  5KE2 A;  5GMK e;  5DLQ E;  5CKE A;  4M77 B;  2ZPH B;  1I81 A;  4L6V 5;  2JTM A;  3QXE B;  3CME A;  2MAM A;  3V7S A;  4R56 A;  1JBM A;  1R8O B;  4XTU A;  3EFS A;  3Q1J A;  5CAI A;  2K3X A;  2PQW A;  3ZEH A;  2XHC A;  3JCM h;  1VQ7 T;  3QBY A;  2A7Y A;  1VQ6 T;  3V8K A;  1V29 B;  1U1T A;  1WJR A;  2H3J A;  3C94 A;  5GMK h;  3OYD A;  3CCL T;  5KE3 A;  2X35 A;  2GQV A;  3WXM B;  4BI3 A;  1YIJ A;  3OYC A;  3NTH A;  3OSS C;  3P8B B;  2P4T A;  3OS0 A;  3JCM J;  4Q5W A;  4PJO E;  1G3T A;  4IUQ A;  3OYB A;  5GAN 2;  3PMT A;  1VQ8 A;  2RK1 A;  1AHJ B;  2K5F A;  5CIU A;  3OMG A;  2EWN A;  3QJ6 A;  2RB6 A;  2EIF A;  2RHX A;  2V8K A;  3QG1 A;  2WSE E;  4B9W A;  4OB2 B;  5M9O A;  3EAE A;  2VXF A;  2X4Y A;  2E41 A;  3KUF A;  1ZQ1 A;  4E7I A;  3FB9 A;  4M75 E;  2DTI A;  3G6E A;  3S3O A;  3OSV A;  1Y07 A;  4PLI A;  3M59 A;  3E1S A;  2KK4 A;  2DVE A;  2QA4 A;  4KT0 E;  3G4S A;  3JB9 F;  1JB0 E;  1LOJ A;  2L3R A;  3QHS A;  3X24 B;  4A4F A;  4BY6 C;  1KQ2 A;  3KBG A;  1VQP T;  5D6Y A;  2DD5 A;  2ZZD A;  5A0G A;  3CMA A;  4ZTJ A;  3R6O A;  2LT1 A;  3OYI A;  4NL3 A;  3I55 A;  4Z02 A;  3ER0 A;  2EJ9 A;  4UC4 A;  3LWH A;  3L2R A;  5GAN 6;  2D6F A;  3FDR A;  3GPL A;  1DJ7 B;  4MZM A;  2MMP A;  2DTH A;  5GAN f;  1M1F A;  4M7A E;  1NE8 A;  3HKS A;  1UGP B;  2LRQ A;  1K8A C;  4DQ2 A;  3UWN A;  3CCM A;  3JB9 D;  1JJ2 A;  4C0F A;  1YI2 T;  2DJZ A;  2HQE A;  1BIA A;  2LQ8 A;  4CRI A;  1VQN A;  3QYG B;  1O75 A;  5FU7 C;  5HY6 A;  4C5E A;  4M7D E;  2HBP A;  3UPU A;  3GIB A;  2JTF A;  3VV0 A;  4JDS A;  3CPF A;  1M1G A;  4C0D C;  1VQO A;  5LJ5 d;  5GAN j;  4RG8 A;  5D6W A;  4LDW A;  3E9G A;  4IUT A;  5J26 A;  4EPC A;  2HAX A;  1XOV A;  4TVR A;  3X25 B;  4QQD A;  5A2Q E;  1M1K C;  2P0K A;  5GAN 3;  3ZBD A;  3I56 A;  1XNI A;  1FX7 A;  1OZ2 A;  2ZPG B;  3E19 A;  4HKE A;  5GMK i;  3MO8 A;  5KH6 A;  1Q86 C;  2QDY B;  4ZN1 A;  3HRS A;  4L59 A;  3SB2 A;  4VUB A;  2NLU A;  1VQM T;  2Y4X A;  4M78 F;  3JCM c;  2LCC A;  2VGM A;  4PL6 A;  4EMK A;  2K2V A;  3TU4 K;  3MCA B;  5KCH A;  3N5B B;  1KD1 C;  3FIF A;  4M7A D;  2G3R A;  3RKX A;  3CCV A;  5FRM A;  5CO7 A;  3TCJ A;  4BI4 A;  1YHQ T;  1VQL A;  3CCS T;  5GAM f;  5I21 A;  1YIT T;  4PJO C;  3JB9 H;  2VUB A;  1WNL A;  3HL8 A;  3CEY A;  3OYJ A;  4QQ6 A;  5LJ3 j;  3OYF A;  3JCM W;  4M78 D;  1QVG A;  4M7A A;  4F7U F;  4M7D D;  1M1K U;  1UGQ B;  1YJN T;  5GAN g;  4PJO G;  3OQ5 A;  3JCM f;  2GF7 A;  3OYE A;  4XTZ A;  4P5N A;  2YRV A;  2PVO B;  3RKY A;  4BY6 B;  4OVA A;  4M78 A;  4A54 A;  1BI1 A;  3VKI A;  4M7D A;  1KG1 A;  3NTK A;  3RES A;  1VIF A;  4DA4 A;  1XTD A;  3CCU T;  4M75 C;  4PLL A;  4NL2 A;  4C92 F;  2RJE A;  1VQ9 A;  2O01 E;  4IUP A;  4MML A;  1YCY A;  2XDP A;  4XAX B;  3RKW A;  4BUG A;  4M75 G;  5LJ3 e;  4JS5 A;  1K73 U;  4QW2 A;  1W4S A;  3PFS A;  1U1S A;  5FU6 B;  5CQX A;  5CQY A;  3GOX A;  3CD6 T;  5J3B A;  2QEX A;  4F7U A;  3MP8 A;  4J6X A;  5FU7 B;  3JB9 I;  3M58 A;  4X9C A;  1Y96 B;  3LWI A;  1VUB A;  2MWO A;  4C92 D;  3L2Q A;  3CBP A;  3QZ9 B;  4EDU A;  1VQK A;  4BDY A;  2BKD N;  4M7A C;  4JJN K;  4C0D B;  4KBM B;  5LJ3 g;  4J8O A;  3NTI A;  4RKU E;  5A0D A;  3OY9 A;  1YJ9 A;  1K9M U;  4BE2 A;  3BY7 A;  4C92 A;  2QI2 A;  2DZC A;  1U8R A;  4M7A G;  1LJO A;  1G3Y A;  4M7D C;  5IAY A;  1NJI U;  1UGS B;  2JZ2 A;  2QQB A;  1BI0 A;  2XKO C;  1VQ4 T;  2VC8 A;  3RUX A;  4ELY C;  4XTV A;  1VQ6 A;  3MP6 A;  4M7D G;  3CC7 T;  3A8L B;  4BE1 A;  1BI3 A;  2CS7 A;  4OGC A;  2E6Z A;  3JCM g;  1BIB A;  5LJ5 h;  4BDZ A;  5CR2 A;  2ZCF B;  3BFM A;  2JNG A;  3OMC A;  2LQK A;  4O5V A;  4A53 A;  4ZGJ B;  2PVD B;  2V8J A;  3MEA A;  4N0A A;  5GAN 7;  5CCA A;  3JCM P;  4XU1 A;  4C8Q B;  1WQ7 A;  4PJO B;  2HQX A;  2DXB A;  2EKO A;  3MET A;  4D6W A;  4E7J A;  1X6O A;  1Q82 U;  3SWN C;  4BD3 A;  2ZGW A;  5CKB A;  3JCM b;  3L2W A;  1Q7Y U;  2PUK B;  3OS2 A;  1S72 T;  2LX9 A;  1KC8 U;  4MZP A;  2M16 A;  2DXT A;  3A8M B;  1MGQ A;  1RI0 A;  2C06 A;  4O6J A;  4L5G A;  3P8D A;  1QVG S;  3FRN A;  2RI3 A;  2Y90 A;  3O8V A;  1YJW A;  3CCQ T;  3OYY A;  3M57 A;  2VGN A;  3KXT A;  5FRO A;  1FWZ A;  2VYT A;  5GAN 8;  3OYL A;  3DB4 A;  5IN1 A;  1VQP A;  4XU3 A;  2CZ1 B;  4Y91 A;  3CME T;  1G3W A;  1M90 C;  1QP3 A;  2KSS A;  3MEV A;  5KCO A;  2O4X B;  4ME7 A;  2EJF A;  3ME9 A;  4N4I A;  1XQH A;  2CZ0 B;  3QII A;  2MWP A;  3HFN A;  5CKF A;  3X28 B;  1B34 B;  2LT4 A;  3AHU A;  1YI2 A;  2L8D A;  2Y4Y A;  3CC4 A;  4M77 F;  1YIJ T;  1PSF A;  2ZPF B;  2M0O A;  3QYH B;  3ZFJ A;  5GAM d;  3MEU A;  2DD4 A;  4C0Z A;  2LTO A;  3CCR T;  2QQ9 A;  3LX7 A;  5CKD A;  3M4Y A;  4ZN3 A;  1KHI A;  4J7F A;  3PIO A;  3OS5 A;  3S3N A;  3JCM X;  4PNO A;  1W2B S;  2E10 A;  4M78 E;  1M90 U;  2JVV A;  2CGH A;  4M77 D;  4C8Q F;  1Y71 A;  3LGF A;  3CBM A;  2L89 A;  3CPW S;  4ELZ C;  1VIE A;  2B8A A;  3CC2 A;  4M77 A;  4NS5 A;  5A0L A;  1I4K 1;  5I2M A;  3G4S T;  4C0G A;  3SFM A;  4KUD K;  2RJF A;  5GMK l;  3F70 A;  4F7U E;  3L2U A;  2GFU A;  3BDL A;  1K8A U;  3TRE A;  4J7I A;  5LJ3 f;  3SWN B;  3INZ A;  4ZGD B;  3PNW C;  4MMK A;  1YIT A;  2RHU A;  1M4Z A;  4JLG A;  3OW2 S;  4C92 E;  3PMI A;  3LLR A;  3VU3 C;  2FB7 A;  3TEE A;  1YJN A;  1PSE A;  2V8I A;  2BIV A;  2LVM A;  4E47 A;  3JCM d;  1VQN T;  3CCJ A;  4HCB A;  2WSF E;  2IVW A;  4J5Y A;  4FL6 A;  4C5H A;  3GLX A;  2DPP B;  2OAU A;  3CCU A;  3CCE T;  4FT2 A;  3JB9 G;  4OB1 B;  1OI1 A;  1Q86 U;  2E5Q A;  3OB9 A;  4HT8 A;  1UEB A;  2GCX A;  3A8G B;  4EMG A;  4EMH A;  5FRN A;  2JN0 A;  1HK9 A;  2L5Q A;  2RI2 A;  2KVQ G;  4FU6 A;  3CD6 A;  1FXX A;  4A4G A;  2JUF A;  2O4X A;  4FIB A;  3HRU A;  4JRP A;  1KD1 U;  1KQ1 A;  5CK9 A;  1VQ5 T;  5LJ5 j;  4EMK C;  1X01 A;  4GY5 A;  2FYK A;  4LDU A;  1LNX A;  3M54 A;  2LNV A;  1H3Z A;  5DY9 A;  3X26 B;  5GAM e;  1N8R C;  2PU9 B;  3HHT B;  2OTJ T;  4JRI A;  2QQR A;  2DEQ A;  2RO0 A;  1VQL T;  2A3L A;  2EQK A;  4HA8 A;  4A4K A;  3UT1 A;  4BI8 B;  4YTL A;  4WF2 A;  3L2V A;  3OBW A;  1KQS A;  3OS1 A;  1OZ3 A;  3A8H B;  3M9Q A;  4OB0 B;  1WJQ A;  2YHT A;  2FL7 A;  1VQ4 A;  1W2B A;  3QZ5 B;  1I5L A;  1IRE B;  4J83 A;  1N9S A;  3VUZ A;  3QSU A;  3A8O B;  2R57 A;  2KQW A;  2CKK A;  4FSX A;  5LJ5 e;  5GAM h;  4M78 C;  2RJC A;  1X75 C;  3V8J A;  2DZ9 A;  2KDS A;  3CPW A;  3HSB A;  2RI5 A;  2D0Q B;  3RMS A;  1QVF A;  1QW1 A;  3LH0 A;  2R58 A;  2VV5 A;  3T9N A;  1QP2 A;  1VQ7 A;  4BB7 A;  4BE0 A;  4M78 G;  1BKB A;  1VQ9 T;  1SSF A;  2EAY A;  3CCL A;  3M53 A;  4E7K A;  5I2S A;  5D6X A;  2RM4 A;  5LJ5 g;  4R55 A;  3RIR A;  2RA2 A;  2E70 A;  2YLB A;  4OB3 B;  5C0M A;  3HFO A;  4LDV A;  3DLL A;  2XDB A;  2XIC A;  1TH7 A;  4OGE A;  1N6A A;  3NFC A;  4OF1 A;  4DOW A;  3G71 T;  4N4G A;  5LL6 S;  4QVZ A;  3UDC A;  4QQG A;  2XID A;  4KUL A;  1D3B B;  5HK3 A;  4LD6 A;  4F7U G;  5DM7 R;  3OYM A;  3HPW A;  3OW2 A;  3V7R A;  1VQK T;  3J80 E;  3VYH B;  1OYX A;  1YJ9 T;  1WPY A;  5HKC A;  2FHD A;  2MF2 A;  4C92 C;  5EG2 A;  3L1A A;  1G3S A;  1VQO T;  3CMA T;  2HD0 A;  4ATO A;  3QO3 A;  4M77 E;  2R5A A;  5GAO n;  3CXC S;  3GNG A;  2OTL T;  4IUV A;  2CZ6 B;  4M75 B;  2DXU A;  2PUO B;  3V8L A;  3E9F A;  3VJP A;  4C92 G;  2RK2 A;  3WVD B;  5GAO p;  2RH2 A;  3M56 A;  4JUV A;  3MP1 A;  4EMK B;  5CVI A;  3MHX A;  2EYQ A;  4E7H A;  3C12 A;  2E12 A;  4C5I A;  3H8Z A;  1N27 A;  3J7A F;  4C8Q E;  3WVE B;  2RHI A;  5GAN d;  4N0A C;  4QVC A;  4OMF B;  4RG2 A;  1NPR A;  2RHZ A;  5CKH A;  4Y28 E;  2LCL A;  3V7C A;  3DLM A;  4KUI A;  3CCR A;  2D9T A;  3MEW A;  1HXD A;  4XTY A;  4M7A B;  4C5G A;  5GMK m;  2LC4 A;  1UGR B;  1UB4 A;  2K4Y A;  3PGG A;  2DKG A;  4MDW A;  2E1H A;  2ZPI B;  1Y96 A;  5AYF A;  3GP8 A;  4E7L A;  1Q81 C;  1VQ8 T;  4LD9 K;  3OYA A;  1KQS S;  1MHN A;  2IG0 A;  4M78 B;  4JS4 A;  5GAO q;  4M7D B;  2VXE A;  1WQW A;  2P0P A;  2RD1 A;  1YJW T;  3LW5 E;  1P92 A;  2R5M A;  1WJS A;  4PJO F;  1GXI E;  4II1 A;  4B9X A;  3JB9 J;  3G6E T;  1RL2 A;  2HNI A;  2X4W A;  2I2L A;  2QTX A;  2ZPB B;  4J6Y A;  4LDY A;  3VUB A;  3FC3 A;  3JCM V;  1QVF S;  1G5V A;  5LJ3 d;  1VQM A;  3URG A;  4F7U B;  3J81 E;  5GAO m;  2QA4 T;  3HP9 A;  4LDX A;  3SDZ A;  4HCZ A;  3JCM Q;  4IKF A;  3M4G A;  4C8Q D;  2AHJ B;  2CZ7 B;  2E6N A;  4M75 F;  5C6S A;  2DAQ A;  2K5L A;  5FU6 C;  4QVD A;  3I55 T;  1Q81 U;  4XQ3 A;  3CC4 T;  4XU0 A;  1YHQ A;  3CCS A;  2EJG A;  5HK0 A;  4OP0 A;  1ZBX A;  2E64 A;  3P8H A;  1BI2 A;  3OBY A;  2PVG B;  3GNF B;  1ZHI A;  3X20 B;  4C8Q A;  4C92 B;  4PJO A;  3CCM T;  1D3B A;  2E65 A;  2RJD A;  4HT9 A;  2EQJ A;  3BW1 A;  2KAF A;  5GAN 4;  2DXC A;  3CCE A;  2EQM A;  2QQA A;  4M75 D;  4XTW A;  5FLX E;  3HRT A;  4JLI A;  2XD0 A;  3GF5 A;  4M7A F;  5GAO l;  3CXC A;  4GLK A;  2K5I A;  1N9R A;  2K3Y A;  3H6Z A;  4XK8 E;  2MI6 A;  5LJ5 f;  5GAM j;  5GAO r;  4ZGE B;  4M75 A;  1M9S A;  2DIQ A;  4M77 C;  2X4X A;  3CC2 T;  4NOY A;  1KHC A;  2JOY A;  3ASK A;  1VQ5 A;  3EFR A;  3DKM A;  3I56 T;  4M7D F;  2BUD A;  3VYG A;  4XTX A;  5L8R E;  4M77 G;  4MZT A;  2LDM A;  3FJP A;  4JRQ A;  4PJO D;  5GAN e;  4FM4 B;  2F5K A;  4PKC C;  3PIP A;  3OA6 A;  2OTJ A;  1M5Q 1;  4J6W A;  5GAN 5;  2WAC A;  3QDR B;  2ZPE B;  1K73 C;  2KMT A;  2F69 A;  2RHY A;  3JSC A;  4C8Q C;  1B34 A;  3S6W A;  3OYK A;  2K57 A;  2EFI A;  4IUU A;  4X34 A;  4A4E A;  2XDD A;  3FLG A;  2P0Q A;  2KY9 A;  3QUI A;  2WSC E;  3PTA A;  3OYH A;  3CCV T;  4C8Q G;  4DOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...