2PU9B

Crystal srtucture of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin f
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pu9B00
2PVOB 1PSFA 3A8MB 2ZCFB 3X24B 3X26B 1JB0E 4ZGJB 3LW5E 2CZ6B 2WSEE 2DXCA 2DD5A 2ZPBB 3X28B 1PSEA 2DD4A 2O01E 2ZPFB 1UGQB 4KT0E 2ZZDA 2ZPIB 2CZ7B 3A8HB 2DXBA 2PUOB 1UGRB 4FM4B 4RKUE 2CYZB 1IREB 2WSFE 3QZ9B 4ZGDB 4OB0B 4ZGEB 5L8RE 2ZPGB 2D0QB 1UGSB 1QP3A 3X20B 2PU9B 2DPPB 2QDYB 1AHJB 2PUKB 2CZ0B 2ZPHB 1V29B 2PVDB 2PVGB 1DJ7B 2ZPEB 3WVDB 4Y28E 2WSCE 3X25B 3QXEB 3VYGA 2CZ1B 1QP2A 4OB2B 1GXIE 3VYHB 3A8GB 3A8LB 4L6V5 4XK8E 3WVEB 4OB1B 3QYHB 1UGPB 3A8OB 4OB3B 2AHJB 3HHTB 3QYGB 3QZ5B
chains in the Genus database with same CATH superfamily
3EAEA 2COYA 4LDVA 1IHVA 2JTMA 3CCLQ 1V1CA 4BI4A 2DXCA 4AG2C 1GBRA 1AD5A 1YCYA 3RIRA 3VRZA 4C5GA 5A0GA 2YHTA 2PQWA 1GBQA 4M78C 2NWMA 1FXXA 3RDVA 1T3LA 2GBQA 3GPLA 2L5QA 2CSIA 3OS5A 1I0CA 1UGRB 1VQ4Q 5I21A 3V7CA 2EYYA 4KRTA 1VQNT 1VQ7T 1OX8A 1SSFA 2DTOA 4M7DD 2XD0A 3VS3A 1NEBA 5GMKl 1BB9A 5FROA 3CCQT 2RHYA 1U06A 1KSWA 2MF2A 4BY6C 1X2QA 1YBYA 5GAN4 2KYBA 2OTJA 5L8RE 4M7AD 2FG0A 3MP1A 3I56T 2IVWA 2A08A 3CXCP 3DLMA 5GAN6 1QP3A 1Q86U 3EG3A 5CVIA 1RADB 4WF2A 4X9DA 1NZ9A 1Q82C 3TQ7P 2ESWA 4C8QB 2O9VA 2AK5A 4CC3A 1PNJA 1RL2A 3M55A 4J5YA 2QQBA 2FL7A 4M75E 1TUDA 4AFSC 3QO3A 5LJ5g 3CBMA 3OSVA 4J9CA 1VYUA 3PFSA 3LGLA 5IXBA 4BD3A 2X9HA 1Y0MA 1KD1C 2VXFA 1VQ8A 1X69A 2K5FA 2CDTA 2RK1A 2I0NA 4OB1B 3NMZC 3FB9A 2AHJB 3A5ZB 4J9FA 2DYBA 1E7OA 4LDYA 2RQTA 1M1FA 5FU6B 1PSFA 2NUPB 4D8KA 3D7SB 1M90C 4M78A 1D1CA 1ZSZB 4JRPA 4D8DA 1FX7A 2O01E 2R57A 1I5LA 2XU8A 1T3SA 1M1KR 2EQJA 1AVZC 5LJ3e 1FMWA 4FW2A 2KGTA 1JQQA 1PKTA 3A8HB 3OYAA 4N4GA 2H3EB 2X4WA 2LNVA 2DRMA 1KC8C 2NUTA 4OVAA 4JPBW 5CKDA 1KHIA 1VUBA 2QASA 2WSFE 5GANj 2AIRB 1TOVA 4MZMA 3OW2S 4RTUA 1Q81C 1ZUYA 4DOWA 1UG1A 1AWJA 2M9UA 3EH1A 1QVPA 1AHJB 2XHCA 3N5BB 4GBQA 3OYJA 2LQKA 1OQKA 4X9CA 3PTAA 1M3CA 1O9SA 4EDUA 4KGVB 4OMNA 5LJ5d 1VQ6Q 2OTJT 2O2OA 1B07A 5GAMf 1VQLQ 3JCMV 4HVVA 4B9XA 3L2QA 3EHQA 3LWHA 2FZGB 1YJ9Q 1PC0A 4L6V5 3GNFB 3I35A 2MI6A 4QQDA 1HXDA 3QYHB 1UGPB 4Z89A 3CCJA 4EMHA 1WXUA 5ECAA 1WQWA 3QZ5B 4KGZB 9ATCB 3GLXA 2DTIA 2L3PA 2QQSA 1OU8A 2HSPA 2ATCB 4C92B 4AFUC 1VQ8T 2X3WD 4IUUA 3MEVA 1PRLC 4QVDA 1Y96B 4GLMA 4F14A 4IIOA 3HFOA 1HSQA 3VUZA 2Z0WA 3REBB 1Q82U 3C94A 2A0FB 4PJOD 5A2QE 2EQKA 1NLPC 2LCLA 3VJPA 1R0CB 1PWTA 1VQ6T 4Y91A 2JVVA 4FYVB 3OA6A 2PUOB 1T0HA 5IAYA 4ANJA 1D0ZA 2CREA 2JNGA 5LJ3d 3VU3C 6AT1B 2QGGA 8AT1B 1HD3A 1K1ZA 1H3HA 3GP8A 2OI3A 3CPWS 3EGXB 4BE2A 5KYXA 3JCMc 2GNCA 5I2SA 5EC7A 4ZTJA 4E47A 4OMQA 1S72Q 1BIAA 4JDSA 3TSWA 2VKNA 4PFPA 5DY9A 3G71Q 2HSEB 2DMOA 1RI0A 2E41A 2FYKA 1ZHIA 2DA9A 1X75C 1FWZA 4K11A 5GANe 3PVQA 2AZSA 2NUZA 2CP7A 2DIQA 5CKHA 3OSSC 3URGA 3NHNA 1SRMA 2M0YA 3RMQA 3MP6A 3J81E 1ZUKA 3QBYA 4J9DA 2EQMA 1IGUA 3G1JA 4E7HA 4Z02A 2EBPA 3RUXA 2DRKA 2DVEA 1N8RR 2LJ0A 1RAHB 3I5SA 2DO3A 5IXFA 1B34B 3OYFA 2JZ2A 1JJ2S 1UJ0A 1BI1A 4C0GA 3CCEA 3ASKA 5GAOq 1NJIR 4M78G 1W2BA 2DERA 8ATCB 2DL7A 2FRYA 1WHMA 1Q81U 1TWBA 5L23A 3CQTA 1YI2Q 4N4IA 2YUQA 2P84A 3BY7A 2RH2A 1YJWA 3CCJT 3VS6A 1RLPC 1MGQA 2QAZA 4XTXA 5KH6A 2JJ9A 2K3BA 3NPFA 2F2XA 2H3JA 4OP0A 3CD6A 3C95A 2DKGA 1V76A 3LH0A 2LTOA 2M02A 1B7TA 1JJ2P 5GAN8 5DLOA 2G3RA 5IHNA 4FL6A 3MO8A 1YHQA 2E1HA 2V26A 3OW2A 2LQWA 4CC4B 1JRIA 1D3BB 2MAMA 3LGFA 3CCSQ 1NYGA 3JB9J 3MJXA 2AZVA 2D6FA 2RK2A 3H0HA 1KQSP 4KH0B 4JRIA 1K73C 4M77B 2KBTA 3JCMh 4HVUA 2X4JA 2D0QB 4AT1B 1NM7A 3CEYA 2JM9A 3PIPA 2QDYB 4J6WA 4L59A 1TTHB 1WFWA 2RJEA 1YITA 2ZPHB 2CGHA 2RJCA 1X6GA 4R56A 3CCEQ 1M1GA 5C0MA 2DX1A 2KAFA 2DBMA 5GJWB 2SEMA 1BBZA 4C5IA 1KHCA 3FDRA 4BI3A 5GAN2 3VUBA 3INZA 3CMEA 4C8QD 3J80E 1WXBA 2CP6A 2CT3A 4PFOA 3E19A 3OS0A 2D1XA 1M8MA 5GANd 2J7IA 1ACMB 2LRQA 4QQ6A 1VQMA 3META 1QVFP 4J9GA 1YWOA 2QTXA 3QYGB 4RTVA 2KQWA 5D7UA 1YIJQ 1AWXA 2BIVA 2HQXA 3OYCA 2GFUA 3E1SA 2O4XB 1UGVA 2HCKA 4JLIA 4IIMA 1QVGS 4FSSA 2EYQA 1YJNQ 3JCMe 3M56A 4E7ZA 1Q7YU 1PSEA 2CT4A 2DD4A 5FU7C 2RI3A 2ZPFB 3CCET 2EKHA 2LDMA 1WXTA 2RI2A 1WHKA 3S6WA 4C5HA 2C0OA 1CKBA 3RKWA 2DJQA 3LYIA 4M7DG 4RG2A 3JB9D 1UE9A 4J9HA 4GY5A 2K2MA 2P4TA 1UFFA 2COZA 4VUBA 1YJWT 1SSHA 3CPWA 3JCMg 5HK0A 3EG0A 2F5KA 4B9WA 4M7AG 4A63B 2KEAA 4RTXA 3FC3A 2RO0A 4JJBA 4EMKB 3OYDA 1TG0A 1RABB 3E9GA 3M4GA 2K5IA 3L2ZA 2DPPB 2RHUA 2KNBB 1YHQT 2VXEA 3CCMQ 1YIJT 1WJSA 3LLRA 4DOVA 2C06A 3JSCA 4Y28E 3QWXX 1PD1A 3UDCA 3QJYA 2Y4YA 4MDXA 3U23A 1RAAB 3A1PA 2QEXA 5FRNA 1MNDA 1M4ZA 1YITT 4C8QC 1UJYA 3JCMQ 4OGEA 2B86A 2D8HA 3A8OB 4XU1A 3SWNC 4F04B 1I8FA 2M16A 3UT1A 2KRMA 3E2UA 3ME9A 1Q95G 1W6XA 5HK3A 2RMOA 1N6AA 1N5ZA 1VQNQ 3BDUA 5KYUB 3G4SA 2XDDA 4Z88A 2DNUA 1VQ9A 1VQMT 1TXQA 3FLGA 2XICA 4C92D 3ULRB 2MK5A 3UPUA 2VVKA 1GFCA 4C0FA 3CC2A 1WHJA 2ZPIB 5GAOl 1OPKA 1U8RA 2RF0A 1OV3A 3H6ZA 4F7UG 3JCMd 2X4XA 3VS7A 1D1AA 2F69A 2EQUA 2DK3A 3TSZA 1Y71A 2DETA 3QDRB 2XDPA 1OEBA 3EG9A 1I1JA 3CXCS 1VQ5A 2QEXQ 2EAYA 4ZGDB 1MMAA 4F17A 1VQOA 4N0AC 1RI9A 4LUDA 2LVMA 1M8VA 4J6XA 2PU9B 2BE9B 4HXJA 1VYTA 2PUKB 2E6NA 2EJGA 4A4FA 1UHFA 4CI0C 4JS4A 1RAFB 2R5MA 1SF9A 4O5VA 4KUIA 4M75B 3JB9I 3G4SQ 4C8QA 1WHLA 1T0JA 2DLPA 2YLBA 2DVJA 3G6EQ 1VQ9Q 5LJ5e 3QWYA 4PLIA 3EH2A 2KXCA 3HRUA 1PM3A 3SWNA 3QJ6A 2JUFA 2KMTA 2XIDA 4UC4A 2J6KA 2YRCA 2DXTA 5D6YA 1EX4A 2YUPA 1UEBA 5LL6S 2QG9B 2XDBA 2QQ9A 4IUVA 1K76A 2QEXT 1LPLA 1K8AR 3CC7A 3OBWA 2ZCFB 1QVGA 2HQEA 2DILA 4M78F 2EQIA 1M30A 4ZGJB 3OYYA 2PNIA 4XTVA 4OF1A 1UB4A 2CUDA 1HYOA 4PJOG 4E7LA 1QWEA 2DTHA 2RQVA 1RACB 2OTLA 1H641 3M59A 3JCMb 1X01A 2DBKA 3C0CA 3G4ST 3AHUA 2LC4A 5IN1A 1JEGA 3VS2A 3M53A 3OQ5A 3G6ET 1VQ9T 1IREB 4HA8A 2FEIA 2MWPA 4N0AA 2OTJQ 1XQHA 2KK4A 3ZEHA 3CC2T 4KGXB 1K8AC 2LQ8A 2CP0A 5KYYA 5FWBA 3TVTA 4XU0A 3DLLA 1IO6A 4FT4A 4ORZA 5CKBA 3UATA 3PNWC 4BUGA 2D9TA 1ZA2B 2JW4A 4IKFA 4M77D 5GAN5 2BUDA 1K9MR 3SHWA 2PVDB 1RUWA 1BK2A 2HEQA 2BZXA 3S3NA 1VQ5T 1TH7A 2AKKA 5GMKm 5GAN7 4PKCC 2MCNA 1Y57A 3RKXA 1VQOT 3QKJA 1PRMC 4M7DC 2DL5A 5CAIA 2A28A 2VV5A 1VQ8Q 1BI3A 3H8ZA 1SKUB 1JBMA 4JZ4A 3CC4A 1U3OA 3A8LB 1I81A 3JCMJ 4M7AC 4BDYA 3WVEB 1QWFA 1X6BA 3OYHA 1M1KC 2K9GA 3VS0A 2KSSA 5D6WA 2OAWA 4BY6B 2PVOB 2DM1A 3EFRA 1K9MC 2NUTB 2HDAA 4M78E 3GNGA 4LUEA 4XAXB 2Y4XA 2JM8A 3SFMA 2JT4A 4LD6A 4ZN3A 3X28B 5FLXE 1OZ2A 4PJLA 2MMPA 2K2VA 1Y07A 2MIOA 2L89A 2VUBA 1G3SA 3M57A 3REAB 2CUBA 3CC7T 2O9SA 3V8LA 1G83A 3OMGA 1EIFA 1TSFA 2VGNA 1MV0B 3C4SA 5CR2A 3CXCA 1OI1A 3EFOA 3OB9A 1WPYA 4J9EA 1EFNA 3I55A 2OTLT 2XG8D 3CC4Q 4M7AF 2ROTA 2RHZA 5GMKi 5GAMj 2V1QA 5IH2A 2KI7A 4FW1A 3THKA 4LDUA 1FMKA 1MMGA 5CKFA 2X3XD 2GF7A 1K9AA 1NYFA 1Q7YR 4TVRA 2PVGB 1DJ7B 4M7DA 4J8OA 5A0LA 4E7KA 4C8QG 2E3HA 3HRSA 1AWOA 1BKBA 1KD1U 1KK7A 7AT1B 3HPWA 3JAME 4M7AA 3FJPA 1M9SA 5CIUA 2RI5A 4KULA 1QP2A 1W4SA 3S3MA 1GL5A 4FYYB 1GXIE 1AOJA 2LP5A 1G3YA 3CCJQ 2NLUA 2PZ1A 2FRWA 4LDWA 3LX7A 3CCRA 4V2SA 1ABQA 1XTDA 3QUIA 3HHTB 1M90U 1RAGB 1WHGA 3HFNA 1MMNA 2J06A 2JOYA 4ZN1A 3CC4T 1H8KA 1NE8A 2DAQA 3JCMP 2DD5A 4KH1B 5GMKh 4LDXA 5KYXB 2EGAA 5GAMh 1KC8U 1VIFA 1JXOA 4MZPA 1UGQB 1TUGB 4JRQA 3JB9G 2GFAA 2JTEA 1G8XA 4RTYA 2DL4A 4PJJA 4JS5A 4ME7A 3CMAA 5KCHA 1MMDA 4CRIA 4Z8AA 4F7UF 3J7AF 2HQHA 1M5Q1 1KQSS 2KT8A 1WGSA 2HZYA 1C1AA 4HCBA 4YTLA 2R58A 1M3BA 1LVKA 2FHDA 5KE3A 5KYWB 2L8DA 4M7AE 2MOXA 4OGCA 3GBQA 1KQ2A 4E7JA 1KG1A 2RJFA 1M1KU 1BYMA 4OMOA 1D0XA 2CKKA 2EVRA 2A7YA 4Y92A 1N8RC 1Z9ZA 4PJOC 1MUZA 4A54A 1WIEA 2GTOA 2QYZA 4F7UA 4LN2A 1KJWA 2HKNA 2J6FA 1R8OB 2V8IA 4C0DC 1YN8A 1NJIC 4FYXB 4OMFB 3NTIA 5A0DA 1GCQC 3EHRA 4M75D 2BZYA 4PJMA 2KY9A 4A4HA 5GAMe 3VS1A 1QVFS 2CH4W 2FZCB 1G2BA 2DEUA 3I9QA 2AKLA 4WCIA 3H0FA 1IZ6A 3M0TA 3MKDA 4PLLA 4MDWA 4FYWB 2VB6A 2CS7A 4ATOA 2ENMA 2KYMA 1NBEB 1M2VA 2F2WA 3A8MB 4FIBA 4EMGA 2OX7A 5GAMg 1YJWQ 4C92G 3M58A 1AZEA 3CCRT 3LW5E 1J3TA 3PVLA 2EWNA 2HBPA 1NPRA 4RTWA 3EGDA 4ELZC 4QKUA 1NEGA 3CD6Q 2HD0A 1ABOA 4J7FA 3EFSA 3JB9H 4PJOF 4KT0E 4O6JA 4E7IA 2E70A 5GAOn 4PL6A 1E6GA 1Q86R 2LNHB 4RTTA 4HT8A 2PTKA 1YHQQ 1R0BG 2CSQA 4E2FB 1VQPA 4F7UE 3LWIA 2CYZB 3VV0A 2EGCA 3R6OA 4DA4A 5LJ5f 1O75A 3OMCA 1PKSA 2F1LA 4OB0B 1NPPA 4PJOA 1YITQ 1UTIA 1K0XA 2KR3A 3CMAT 3GIBA 4QQGA 4RG8A 2DL3A 2RD1A 3DB3A 4X1VA 2RQWA 1X2KA 1I07A 2VC8A 2V8JA 1C0MA 3VS5A 2B8AA 3CMEQ 3QHSA 1GCQA 3M4YA 4J83A 2HAXA 1VA7A 4JUVA 1PCXA 1H92A 4JRKA 5CK9A 5IHKA 3CD6T 2P4RA 2XKOC 2P0PA 2K7AA 1BI0A 1GFDA 3OYIA 1VQMQ 3MPUB 4QT7A 4M75C 4XK8E 5D6XA 2RN8A 2CP3A 4IUQA 2I2LA 5GAMd 1B3QA 1ZSGA 1ZBJA 2YUOA 3LH5A 5KE2A 1LJOA 1EZZB 5M9OA 2ZPBB 4HCKA 3ZL7C 1JJ2A 5LJ3f 5C6SA 2LT4A 3CCLA 2DIGA 1N8RU 1F1BB 4ELYC 4PJOE 3JV3A 3CMET 3Q1JA 1NLOC 2W10A 4IUPA 1OX9A 2HBWA 2QA4A 4WTOB 4FT2A 1Z9QA 2LX9A 2KE9A 4FSXA 3RR6A 4RMOA 4FM4B 1KQSA 1AEYA 2L2PA 4NOYA 1K73U 1UDLA 2DXUA 4L5GA 1NG2A 1VQ4A 5FU6C 2P0QA 3UF4A 3OYLA 4II1A 1IXDA 4LE9A 2KRSA 3VS4A 3ZFJA 2M0OA 2RPNA 1C6VX 4ZNXA 4M77G 3OYGA 1VQPT 1ZSZC 4JJDA 1QCOA 3M0QA 4D6WA 5KYNA 1W70A 1CSKA 3M0RA 4LD9K 3M54A 2COWA 3JRZA 1ZQ1A 2RA2A 2VASA 1WYXA 2BKDN 1D09B 1LCKA 4C8QF 1WZOA 3BFMA 1AT1B 2ROLA 3VKIA 2XI9A 4P5NA 4ZTFA 2EJFA 4M75A 5FU7B 1QVFA 2LX7A 2EYZA 3TEEA 1JU5C 3A8GB 2IG0A 1RAIB 3OYKA 3OBYA 2C0IA 2J05A 2LCSA 2LT1A 1M2OA 2QA4Q 1IRXA 4OMMA 4OB3B 3RKYA 1WDXA 1Q82R 2GGRA 1N9RA 4KBMB 4C5EA 2R5AA 2GQIA 2XMFA 1QCFA 1G3TA 1M3AA 5HY6A 4RUGA 1OULA 4NL2A 1TUCA 2CZ6B 3EG9B 2A37A 3CC2Q 2AT1B 1XJWB 3UA6A 3FIFA 3CCVA 2HMAA 3M0SA 3R6NA 1X6OA 1KD1R 5CKEA 3UA7A 4OMPA 5AYFA 2DE0X 2KT1A 1X27A 2CZ7B 4JJCA 3JB9F 3QPHA 2RM4A 1VQ5Q 5LJ3h 1YFNA 2NUPA 4A53A 3EG2A 3H9NA 3CCLT 2FB7A 1VQOQ 2BE7D 4E6RA 2VWFA 1M90R 2XK0A 3O5ZA 1IHWA 4RTZA 2HL3A 1ZSZA 4CC2A 2QA4T 5GAOm 3HKSA 3MEUA 1U1TA 4C92C 4RCCA 3SWNB 4JJNK 1U5SA 1UGSB 1VOMA 1WHHA 2CH4A 2FZKB 2DEQA 1V29B 5GANf 3V7SA 1KC8R 4HCZA 3WVDB 1VQ4T 1PG5B 1SHGA 3PT9A 3P8DA 3M0PA 3FEOA 2OJ2A 4C8QE 4OMLA 1WX6A 2GCXA 3X25B 2L3SA 3CCVQ 1Q81R 1VQ6A 2E5KA 1OOTA 2YLCA 3VYHB 2RQRA 1VQLA 1W2BS 2FPFA 1BIBA 2KRNA 2L3RA 4J9BA 3L2RA 1LNXA 5AT1B 4R55A 3V8JA 4A4GA 1K4US 1ZX6A 1YJ9A 2WACA 3F70A 3CC7Q 4BACA 1JO8A 4XTZA 2K6DA 2GQVA 1A0NB 2RB6A 1TS9A 4M78B 4MMLA 3CCUA 3MEWA 3QG1A 5CQXA 3X26B 3HSBA 4Q5WA 2WSEE 4C92F 4FU6A 2OTLQ 5KYYB 4PFZA 3DKMA 2L0AA 2YDLA 3JCMW 1W2BP 1H3ZA 3SDZA 5LJ3g 3O8VA 2LZ6B 4DEYA 1I4K1 2EPDA 2E3IA 1P92A 1UHCA 2JN0A 3CCVT 2HL5C 4C92A 3QZ9B 1PD0A 3KFVA 2EIFA 1Y96A 3L2VA 2EJ9A 4ZGEB 3HL8A 3CBPA 2LJ1A 3V8KA 2ZPGB 2M1HA 4NL3A 2G6FX 4BE1A 2C0TA 3OW2P 2JMCA 1Y7XA 3RMSA 2A36A 3FRNA 4M7DF 5I22A 5EG2A 1S72A 1QCNA 1YP5A 3CCUQ 5GJVB 4HCCA 4M75G 3G71A 5GMKj 3E9FA 2DF6A 3SB2A 3UWNA 1E6HA 3KXTA 1N9SA 1YWPA 4DEXA 2RHIA 3EGXA 3OYNA 1G5VA 5GANh 5IT9E 1CKAA 1N27A 1SG5A 2X4YA 3NGPA 1OZ3A 3PIOA 2YUNA 4M77C 2L3QA 2YXYA 4X34A 1RLQC 4AMCA 2LMJA 3MEAA 5FRMA 2K3XA 3WXMB 5FW9A 5DM7R 1D1BA 1WA7A 1VQLT 1VIEA 3NFCA 3QIIA 3JCMf 3EFOB 1JB0E 4C92E 1FMVA 1MV3A 2GTJA 1YJ9T 2K4YA 1VYVA 3GF5A 3TCJA 4IURA 3HTRA 4PK4A 1SHFA 2OAUA 1YI2A 5DLQE 4KUDK 5GAOp 1B34A 2QXFA 2RJDA 2MWOA 2YWWA 1KQ1A 2EGEA 3CCUT 1AWWA 2EW3A 1Q7YC 4QVCA 4M7DB 1K8AU 2DXBA 5CQYA 1K0SA 3I55Q 3OYMA 4R0KA 3RERA 3L2UA 1ZLMA 4J6YA 2X51A 4FCYA 4DQ2A 4M7AB 2M51A 2HNIA 2JXBA 3CBOA 4XTYA 2LQNA 2ED1A 5KYWA 2JMAA 3G7ZA 3CCSA 4F16A 1BU1A 4M77F 3CPWP 2QGFB 1WI7A 4GLKA 2CZ0B 2MYSA 3H41A 4M7DE 2X35A 3HRTA 3PMTA 4DBFA 2HKQB 2D0NA 3SEMA 5GANg 4M4ZA 4A4EA 2SRCA 1RAEB 4XTWA 3KBGA 1U1SA 4J9IA 2QTVA 1D3BA 3QXEB 2J6OA 4LNPA 3VYGA 2A3LA 3CCRQ 2F5TX 4OB2B 2KDSA 2D8JA 2FPEA 3MCAB 1K73R 4M77A 5CO7A 1AZGB 1ZBXA 1S72T 4CC7A 5I2MA 3BW1A 1K9MU 4EMKC 5I11A 3I55T 3G71T 4HT9A 2W0ZA 2ZAEA 4AFZC 4DBHA 1YNZA 5GMKe 2O88A 2YRDA 3C12A 1ZA1B 3X24B 2VGMA 3FJ5A 1MHNA 1KFZA 3M9QA 2YRVA 1OPLA 2NYSA 1YIJA 4EPCA 1HJDA 3BE3A 4NS5A 3CMAQ 2KXDA 1YJNA 2E64A 3QDFA 4JLGA 1XOVA 4MZTA 2RHXA 3SD4A 4F7UB 2P0KA 1VQKA 2EYWA 3KUFA 5FWCA 3P8HA 1FYNA 4EIKA 3RESA 1HK9A 2O4XA 1TU0B 1SEMA 1YI2T 1X43A 2JS0A 4AFQC 2F2VA 3TU4K 1MNEA 3EGUA 3M0UA 1WJQA 4XU3A 4QW2A 1QW1A 3H0IA 3L2WA 3VRYA 3A98A 2ZGWA 4M77E 3X20B 3PE0A 2DYIA 3GOXA 3EG1A 3CPFA 1OYXA 1M27C 3IQLA 3P8BB 1KIKA 4QVZA 1JXMA 2LJ3A 2EKOA 4PNOA 2QI2A 3CCMA 1BI2A 1M2VB 2QQRA 4AG1C 4ESRA 4HKEA 5GAN3 2EFIA 3BDLA 3CCST 1SRLA 2CZ1B 1R77A 1WQ7A 1WLPB 4EMKA 2RNAA 4BB7A 2KVQG 3M5AA 3EGDB 3QSUA 1I5OB 4BI8B 2E5QA 1GRIA 5HKCA 3PMIA 5J39A 2K57A 2DZ9A 2ED0A 2H8HA 4PJNA 3S3OA 1Q86C 4BDZA 4XTUA 1VQKQ 2IIMA 1UECA 2ECZA 2VYTA 4XQ3A 4B6MA 3OYBA 3MHXA 2JTFA 1W1FA 1LOJA 2Y90A 1QKWA 1QKXA 1XNIA 4M78D 1VQNA 1ZUUA 4RCBA 1VQ7A 2QDLA 1UUEA 2EYXA 2E6ZA 4PJOB 1YCSB 4DBQA 4LXCA 2LCCA 2O31A 1OU9A 5KCOA 3CCQA 5LJ5j 1QVGP 3PGGA 1WJRA 2ZZDA 1VQPQ 5J26A 4E7SA 2YT6A 4XU2A 4C0DB 2E10A 4BE0A 3TREA 1BCOA 1QLYA 2CP2A 3I56A 2DJZA 2K79A 2V8KA 4DBRA 3RNJA 4RKUE 3ZBDA 2CP5A 3ER0A 1QMCA 2FPDA 2BTTA 3I5RA 2JS2A 5KYUA 1D0YA 4MMKA 3OS2A 2K3YA 3L1AA 3NTHA 5GAOr 1YJNT 4A4KA 2ABLA 2IPOB 2RQUA 3NTKA 2FVUA 1IB8A 4HVWA 3AT1B 3JCMX 1VQKT 2V1RA 5IHIA 3MP8A 2DFUA 1WNLA 1NJIU 2K5LA 1BCMA 2ZPEB 2YSQA 3OYEA 3HP9A 4JZ3A 5J3BA 2MPXC 2E4HA 3L42A 1ARKA 4J7IA 1S1NA 5CCAA 3OS1A 2WSCE 4M75F 2KROA 2DZCA 2E65A 1VQ7Q 3T9NA 5HCKA 2FO0A 3V7RA 1QQJA 2QQAA 1IGQA 3CCQQ 1G3WA 3DB4A 4C0ZA 3G6EA 3OY9A 5LJ5h 1SPKA 2QK0A 4N4HA 3CCMT 3RBBB 1GCPA 5LJ3j 2E12A 3I56Q 2DL8A 1PHTA 4IUTA 2BZ8A
chains in the Genus database with same CATH topology
2KQWA 2GQVA 3EAEA 4LDVA 2JOYA 2HQXA 2BIVA 2RB6A 4M78B 4ZN1A 3OYCA 3CC4T 2GFUA 4MMLA 2JTMA 3CCUA 3MEWA 3QG1A 3E1SA 5CQXA 1NE8A 2O4XB 3X26B 3HSBA 4Q5WA 2DAQA 3JCMP 4JLIA 1QVGS 2WSEE 4C92F 4BI4A 2DXCA 2DD5A 5GMKh 4LDXA 2EYQA 4FU6A 1YCYA 3JCMe 3M56A 1Q7YU 1PSEA 3DKMA 3RIRA 4C5GA 5A0GA 2YHTA 5GAMh 2PQWA 1KC8U 1VIFA 2DD4A 5FU7C 4M78C 2RI3A 2ZPFB 1UGQB 4MZPA 3JCMW 3CCET 1H3ZA 3SDZA 2LDMA 5LJ3g 2RI2A 1FXXA 4JRQA 3JB9G 2GFAA 3O8VA 3S6WA 4C5HA 3GPLA 2L5QA 1I4K1 3RKWA 1M1KU 3OS5A 4JS5A 3LYIA 4ME7A 4RG2A 3CMAA 3JB9D 4M7DG 5KCHA 1UGRB 4CRIA 4GY5A 2P4TA 1P92A 4F7UF 3J7AF 5I21A 3V7CA 4VUBA 1VQNT 1M5Q1 1VQ7T 2JN0A 3CCVT 1YJWT 1SSFA 2DTOA 4M7DD 1KQSS 2XD0A 1WGSA 4C92A 3JCMg 5HK0A 5GMKl 3CPWA 4HCBA 3QZ9B 4YTLA 2F5KA 2R58A 5FROA 4B9WA 3CCQT 2EIFA 2RHYA 4BY6C 2MF2A 2FHDA 5KE3A 4M7AG 1YBYA 5GAN4 1Y96A 2L8DA 3FC3A 4M7AE 2RO0A 4OGCA 4EMKB 3L2VA 2EJ9A 1KQ2A 4ZGEB 3OYDA 4E7JA 2OTJA 1KG1A 3HL8A 2RJFA 3CBPA 3E9GA 5L8RE 3M4GA 3V8KA 2K5IA 3L2ZA 2ZPGB 2M1HA 3MP1A 4NL3A 2IVWA 3I56T 4M7AD 1BYMA 3DLMA 2CKKA 5GAN6 1QP3A 4BE1A 1Q86U 2A7YA 2DPPB 1N8RC 5CVIA 2RHUA 1Y7XA 4WF2A 3RMSA 2VXEA 3FRNA 1YHQT 4X9DA 1YIJT 4M7DF 4A54A 4PJOC 1WJSA 1NZ9A 1S72A 5EG2A 4F7UA 3LLRA 1Q82C 4DOVA 1R8OB 2C06A 3JSCA 2V8IA 4C8QB 4Y28E 4C0DC 3UDCA 3QJYA 1RL2A 3M55A 2Y4YA 4M75G 4HCCA 3G71A 4J5YA 2QQBA 4MDXA 1NJIC 5GMKj 2FL7A 3E9FA 3SB2A 3UWNA 4OMFB 4M75E 3NTIA 3KXTA 5A0DA 1N9SA 3QO3A 5LJ5g 3CBMA 2RHIA 3OYNA 1G5VA 4M75D 2QEXA 3OSVA 4A4HA 2KY9A 5GAMe 5GANh 1M4ZA 5IT9E 5FRNA 1YITT 3PFSA 1QVFS 4C8QC 3LGLA 4BD3A 3JCMQ 1KD1C 2VXFA 1VQ8A 1N27A 2X4YA 2K5FA 4OGEA 1OZ3A 1IZ6A 2RK1A 3PIOA 4OB1B 3A8OB 3FB9A 4M77C 4MDWA 4PLLA 4X34A 2AHJB 4XU1A 3SWNC 3A5ZB 1I8FA 2M16A 3UT1A 3MEAA 5FRMA 2K3XA 2CS7A 4ATOA 3ME9A 3WXMB 4LDYA 1M1FA 5HK3A 5FU6B 1N6AA 1PSFA 5DM7R 3A8MB 4EMGA 4FIBA 1VQLT 3BDUA 5GAMg 1VIEA 3NFCA 3QIIA 3JCMf 3G4SA 4C92G 3M58A 2XDDA 1JB0E 1M90C 4M78A 3CCRT 3LW5E 4C92E 1VQ9A 4JRPA 1VQMT 2EWNA 3FLGA 2HBPA 1NPRA 2K4YA 2XICA 3GF5A 3TCJA 4C92D 4IURA 1YJ9T 4ELZC 2HD0A 4J7FA 1FX7A 2O01E 3EFSA 3UPUA 2OAUA 2R57A 1YI2A 1I5LA 4PJOF 3JB9H 5DLQE 4KT0E 4C0FA 3CC2A 2XU8A 4O6JA 4E7IA 2EQJA 2E70A 1B34A 2ZPIB 5LJ3e 5GAOp 5GAOl 5GAOn 4PL6A 2QXFA 1U8RA 2RJDA 2MWOA 3A8HB 1KQ1A 3OYAA 3H6ZA 3CCUT 4HT8A 4N4GA 2X4WA 1Q7YC 2LNVA 4QVCA 4F7UG 4M7DB 3JCMd 2X4XA 1K8AU 2DXBA 1KC8C 1VQPA 5CQYA 4F7UE 2F69A 3LWIA 2CYZB 2EQUA 3OYMA 3VV0A 4OVAA 5CKDA 3RERA 3L2UA 2DK3A 1KHIA 1VUBA 1Y71A 4J6YA 2WSFE 5GANj 3QDRB 2XDPA 3R6OA 4MZMA 4DA4A 1VQ5A 3CXCS 5LJ5f 4DQ2A 4M7AB 2EAYA 1O75A 2HNIA 3OMCA 4ZGDB 3OW2S 3CBOA 4OB0B 4XTYA 1VQOA 1NPPA 4N0AC 1Q81C 4PJOA 3G7ZA 2LVMA 4DOWA 1M8VA 3CCSA 3CMAT 2M9UA 4J6XA 4QQGA 4M77F 3GIBA 2PU9B 4RG8A 1QVPA 2RD1A 1AHJB 2XHCA 3DB3A 3N5BB 4GLKA 3OYJA 2LQKA 2PUKB 2CZ0B 2E6NA 4M7DE 2EJGA 2VC8A 2X35A 2V8JA 4X9CA 4A4FA 3PTAA 1O9SA 3HRTA 2B8AA 4EDUA 3PMTA 3QHSA 5LJ5d 4CI0C 4JS4A 2R5MA 5GANg 3M4YA 4A4EA 4O5VA 4J83A 2HAXA 4KUIA 4M75B 3JB9I 2OTJT 4XTWA 4C8QA 4JUVA 3KBGA 5GAMf 3JCMV 2YLBA 1U1SA 4JRKA 5CK9A 3CD6T 1D3BA 2XKOC 3QXEB 4B9XA 2P0PA 3VYGA 3L2QA 5LJ5e 2A3LA 1BI0A 2F5TX 4PLIA 4OB2B 3HRUA 2KDSA 3LWHA 3MCAB 3OYIA 4L6V5 4M77A 5CO7A 3GNFB 3SWNA 1ZBXA 1S72T 3QJ6A 2JUFA 2KMTA 5I2MA 2XIDA 3BW1A 4M75C 4UC4A 4XK8E 2DXTA 5D6YA 1K9MU 4EMKC 5D6XA 2MI6A 4QQDA 1HXDA 3QYHB 3I55T 1UGPB 1UEBA 3CCJA 5LL6S 3G71T 4HT9A 4IUQA 2QQ9A 2XDBA 2I2LA 4IUVA 4EMHA 5GAMd 1WQWA 3QZ5B 3GLXA 2QEXT 2DTIA 5GMKe 5KE2A 2QQSA 3OBWA 3CC7A 1LJOA 2ZCFB 3C12A 3X24B 1QVGA 2VGMA 2HQEA 4M78F 1MHNA 4C92B 5M9OA 3M9QA 1VQ8T 2YRVA 4ZGJB 4IUUA 3OYYA 3MEVA 1YIJA 4XTVA 4OF1A 2ZPBB 4QVDA 1JJ2A 4EPCA 1Y96B 1UB4A 5LJ3f 5C6SA 2LT4A 3CCLA 2DIGA 1N8RU 4PJOG 4E7LA 4ELYC 3HFOA 2DTHA 4NS5A 4PJOE 3CMET 3Q1JA 3VUZA 2OTLA 4IUPA 1H641 3M59A 3JCMb 1YJNA 1Q82U 3C94A 2E64A 1X01A 5A2QE 2QA4A 4PJOD 4JLGA 2EQKA 3VJPA 2LCLA 1VQ6T 1XOVA 4Y91A 2JVVA 3G4ST 3AHUA 2LC4A 4FT2A 2RHXA 4MZTA 2LX9A 4FSXA 3SD4A 5IN1A 2P0KA 2PUOB 4F7UB 4RMOA 1VQKA 4FM4B 3M53A 5IAYA 3OQ5A 1KQSA 3G6ET 3KUFA 1VQ9T 3P8HA 1IREB 4HA8A 4NOYA 2JNGA 1K73U 2DXUA 2MWPA 4N0AA 1HK9A 3RESA 5LJ3d 3VU3C 1XQHA 2O4XA 4L5GA 1YI2T 2KK4A 1VQ4A 3ZEHA 5FU6C 3CC2T 2P0QA 3GP8A 3CPWS 1K8AC 2LQ8A 4II1A 3OYLA 4BE2A 3TU4K 3ZFJA 1WJQA 2M0OA 4XU3A 3JCMc 4XU0A 5I2SA 3DLLA 4QW2A 4FT4A 5CKBA 4ZTJA 1QW1A 4E47A 4M77G 3L2WA 3OYGA 3PNWC 4BUGA 1BIAA 2ZGWA 4M77E 1VQPT 2D9TA 3X20B 4JDSA 3GOXA 3CPFA 1OYXA 4D6WA 4IKFA 4M77D 5GAN5 2BUDA 3P8BB 5DY9A 4LD9K 3M54A 2RA2A 1ZQ1A 2PVDB 3JRZA 2BKDN 1RI0A 2E41A 4QVZA 3S3NA 1VQ5T 1TH7A 5GMKm 5GAN7 2FYKA 1ZHIA 2EKOA 4PKCC 1X75C 4PNOA 1FWZA 2QI2A 3RKXA 5GANe 1VQOT 3CCMA 1BI2A 3QKJA 4C8QF 2DIQA 2QQRA 3BFMA 5CKHA 4M7DC 4HKEA 5GAN3 2EFIA 3OSSC 3VKIA 5CAIA 3BDLA 3CCST 3URGA 2XI9A 4P5NA 4ZTFA 2EJFA 4M75A 2VV5A 5FU7B 1BI3A 2CZ1B 3H8ZA 1QVFA 1WQ7A 1JBMA 3RMQA 4EMKA 3MP6A 3TEEA 3J81E 3QBYA 4BB7A 2EQMA 2IG0A 3A8GB 2KVQG 4E7HA 3A8LB 3CC4A 1I81A 3M5AA 4Z02A 3JCMJ 3OYKA 3QSUA 4BDYA 3RUXA 4M7AC 4BI8B 3OBYA 3WVEB 2DVEA 2E5QA 5HKCA 2LT1A 3PMIA 5J39A 3OYHA 2DO3A 1B34B 2K57A 3OYFA 1M1KC 2DZ9A 2JZ2A 1JJ2S 4OB3B 1BI1A 2KSSA 3RKYA 3S3OA 1Q86C 4BDZA 4XTUA 1N9RA 4KBMB 4C0GA 3CCEA 5D6WA 4C5EA 2VYTA 4XQ3A 2R5AA 4BY6B 2PVOB 1G3TA 3ASKA 3EFRA 5GAOq 3OA6A 1K9MC 4M78G 1W2BA 5HY6A 3OYBA 3MHXA 4M78E 3GNGA 4XAXB 2Y4XA 1Q81U 2JTFA 4NL2A 3SFMA 1LOJA 2CZ6B 2Y90A 4LD6A 4N4IA 1XNIA 4M78D 3BY7A 2RH2A 4ZN3A 1VQNA 4RCBA 3FIFA 1OZ2A 3X28B 5FLXE 3CCJT 3CCVA 1YJWA 1VQ7A 1X6OA 2E6ZA 4PJOB 5CKEA 2MMPA 2K2VA 1MGQA 1Y07A 2LCCA 5KCOA 3CCQA 2L89A 5AYFA 4XTXA 5LJ5j 2VUBA 5KH6A 1G3SA 3M57A 1WJRA 2ZZDA 3PGGA 5J26A 2CZ7B 3CC7T 2H3JA 4OP0A 4XU2A 2E10A 4C0DB 3CD6A 3C95A 3JB9F 2DKGA 3LH0A 3V8LA 2LTOA 3TREA 4BE0A 3I56A 5GAN8 2DJZA 1EIFA 3OMGA 3QPHA 5DLOA 2V8KA 2RM4A 2G3RA 2VGNA 4FL6A 4RKUE 5LJ3h 4A53A 3ZBDA 3ER0A 3MO8A 3C4SA 3CCLT 5CR2A 2FB7A 3CXCA 1YHQA 1OI1A 3OB9A 2E1HA 3OW2A 1WPYA 4MMKA 1JRIA 2XK0A 3OS2A 1D3BB 2K3YA 2MAMA 3LGFA 3I55A 3L1AA 3JB9J 2OTLT 3NTHA 2XG8D 5GAOr 1YJNT 4M7AF 2D6FA 2QA4T 5GAOm 3HKSA 3MEUA 1U1TA 4A4KA 2RK2A 2RHZA 5GMKi 4C92C 5GAMj 3NTKA 4JRIA 1K73C 4M77B 2FVUA 4RCCA 3SWNB 3JCMh 2X4JA 2D0QB 3JCMX 4JJNK 1VQKT 3CEYA 1UGSB 4LDUA 3MP8A 5CKFA 2GF7A 2QDYB 4J6WA 3PIPA 4L59A 1WNLA 1NJIU 2RJEA 1YITA 2ZPHB 2DEQA 2CGHA 4TVRA 2RJCA 1V29B 5GANf 2PVGB 1DJ7B 2K5LA 2ZPEB 1M1GA 3V7SA 5C0MA 4R56A 4M7DA 3OYEA 4J8OA 4HCZA 3WVDB 2KAFA 3HP9A 5A0LA 5J3BA 1VQ4T 4E7KA 3PT9A 3P8DA 4C8QG 3L42A 3FEOA 3HRSA 4J7IA 1KHCA 4C5IA 3FDRA 4C8QE 5CCAA 3OS1A 2WSCE 1BKBA 4BI3A 5GAN2 1KD1U 3HPWA 3INZA 3VUBA 3CMEA 2GCXA 4M75F 3X25B 4C8QD 3JAME 4M7AA 3J80E 3FJPA 2DZCA 1M9SA 2E65A 5CIUA 2RI5A 4KULA 1QP2A 1W4SA 3T9NA 3S3MA 3E19A 1VQ6A 1GXIE 2YLCA 3V7RA 3VYHB 3OS0A 1VQLA 2QQAA 1W2BS 1G3YA 2NLUA 1G3WA 3DB4A 5GANd 4LDWA 1BIBA 4C0ZA 3LX7A 3G6EA 2L3RA 3L2RA 3OY9A 1LNXA 5LJ5h 2LRQA 4R55A 3CCRA 4V2SA 3V8JA 4QQ6A 4N4HA 4A4GA 3CCMT 1VQMA 3META 1YJ9A 1XTDA 2WACA 3QUIA 2E12A 3F70A 5LJ3j 3HHTB 1M90U 4BACA 2QTXA 3QYGB 4IUTA 4KUDK 4XTZA 3HFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVO B;  1PSF A;  3A8M B;  2ZCF B;  3X24 B;  3X26 B;  1JB0 E;  4ZGJ B;  3LW5 E;  2CZ6 B;  2WSE E;  2DXC A;  2DD5 A;  2ZPB B;  3X28 B;  1PSE A;  2DD4 A;  2O01 E;  2ZPF B;  1UGQ B;  4KT0 E;  2ZZD A;  2ZPI B;  2CZ7 B;  3A8H B;  2DXB A;  2PUO B;  1UGR B;  4FM4 B;  4RKU E;  2CYZ B;  1IRE B;  2WSF E;  3QZ9 B;  4ZGD B;  4OB0 B;  4ZGE B;  5L8R E;  2ZPG B;  2D0Q B;  1UGS B;  1QP3 A;  3X20 B;  2PU9 B;  2DPP B;  2QDY B;  1AHJ B;  2PUK B;  2CZ0 B;  2ZPH B;  1V29 B;  2PVD B;  2PVG B;  1DJ7 B;  2ZPE B;  3WVD B;  4Y28 E;  2WSC E;  3X25 B;  3QXE B;  3VYG A;  2CZ1 B;  1QP2 A;  4OB2 B;  1GXI E;  3VYH B;  3A8G B;  3A8L B;  4L6V 5;  4XK8 E;  3WVE B;  4OB1 B;  3QYH B;  1UGP B;  3A8O B;  4OB3 B;  2AHJ B;  3HHT B;  3QYG B;  3QZ5 B; 
#chains in the Genus database with same CATH topology
 3EAE A;  2COY A;  4LDV A;  1IHV A;  2JTM A;  3CCL Q;  1V1C A;  4BI4 A;  2DXC A;  4AG2 C;  1GBR A;  1AD5 A;  1YCY A;  3RIR A;  3VRZ A;  4C5G A;  5A0G A;  2YHT A;  2PQW A;  1GBQ A;  4M78 C;  2NWM A;  1FXX A;  3RDV A;  1T3L A;  2GBQ A;  3GPL A;  2L5Q A;  2CSI A;  3OS5 A;  1I0C A;  1UGR B;  1VQ4 Q;  5I21 A;  3V7C A;  2EYY A;  4KRT A;  1VQN T;  1VQ7 T;  1OX8 A;  1SSF A;  2DTO A;  4M7D D;  2XD0 A;  3VS3 A;  1NEB A;  5GMK l;  1BB9 A;  5FRO A;  3CCQ T;  2RHY A;  1U06 A;  1KSW A;  2MF2 A;  4BY6 C;  1X2Q A;  1YBY A;  5GAN 4;  2KYB A;  2OTJ A;  5L8R E;  4M7A D;  2FG0 A;  3MP1 A;  3I56 T;  2IVW A;  2A08 A;  3CXC P;  3DLM A;  5GAN 6;  1QP3 A;  1Q86 U;  3EG3 A;  5CVI A;  1RAD B;  4WF2 A;  4X9D A;  1NZ9 A;  1Q82 C;  3TQ7 P;  2ESW A;  4C8Q B;  2O9V A;  2AK5 A;  4CC3 A;  1PNJ A;  1RL2 A;  3M55 A;  4J5Y A;  2QQB A;  2FL7 A;  4M75 E;  1TUD A;  4AFS C;  3QO3 A;  5LJ5 g;  3CBM A;  3OSV A;  4J9C A;  1VYU A;  3PFS A;  3LGL A;  5IXB A;  4BD3 A;  2X9H A;  1Y0M A;  1KD1 C;  2VXF A;  1VQ8 A;  1X69 A;  2K5F A;  2CDT A;  2RK1 A;  2I0N A;  4OB1 B;  3NMZ C;  3FB9 A;  2AHJ B;  3A5Z B;  4J9F A;  2DYB A;  1E7O A;  4LDY A;  2RQT A;  1M1F A;  5FU6 B;  1PSF A;  2NUP B;  4D8K A;  3D7S B;  1M90 C;  4M78 A;  1D1C A;  1ZSZ B;  4JRP A;  4D8D A;  1FX7 A;  2O01 E;  2R57 A;  1I5L A;  2XU8 A;  1T3S A;  1M1K R;  2EQJ A;  1AVZ C;  5LJ3 e;  1FMW A;  4FW2 A;  2KGT A;  1JQQ A;  1PKT A;  3A8H B;  3OYA A;  4N4G A;  2H3E B;  2X4W A;  2LNV A;  2DRM A;  1KC8 C;  2NUT A;  4OVA A;  4JPB W;  5CKD A;  1KHI A;  1VUB A;  2QAS A;  2WSF E;  5GAN j;  2AIR B;  1TOV A;  4MZM A;  3OW2 S;  4RTU A;  1Q81 C;  1ZUY A;  4DOW A;  1UG1 A;  1AWJ A;  2M9U A;  3EH1 A;  1QVP A;  1AHJ B;  2XHC A;  3N5B B;  4GBQ A;  3OYJ A;  2LQK A;  1OQK A;  4X9C A;  3PTA A;  1M3C A;  1O9S A;  4EDU A;  4KGV B;  4OMN A;  5LJ5 d;  1VQ6 Q;  2OTJ T;  2O2O A;  1B07 A;  5GAM f;  1VQL Q;  3JCM V;  4HVV A;  4B9X A;  3L2Q A;  3EHQ A;  3LWH A;  2FZG B;  1YJ9 Q;  1PC0 A;  4L6V 5;  3GNF B;  3I35 A;  2MI6 A;  4QQD A;  1HXD A;  3QYH B;  1UGP B;  4Z89 A;  3CCJ A;  4EMH A;  1WXU A;  5ECA A;  1WQW A;  3QZ5 B;  4KGZ B;  9ATC B;  3GLX A;  2DTI A;  2L3P A;  2QQS A;  1OU8 A;  2HSP A;  2ATC B;  4C92 B;  4AFU C;  1VQ8 T;  2X3W D;  4IUU A;  3MEV A;  1PRL C;  4QVD A;  1Y96 B;  4GLM A;  4F14 A;  4IIO A;  3HFO A;  1HSQ A;  3VUZ A;  2Z0W A;  3REB B;  1Q82 U;  3C94 A;  2A0F B;  4PJO D;  5A2Q E;  2EQK A;  1NLP C;  2LCL A;  3VJP A;  1R0C B;  1PWT A;  1VQ6 T;  4Y91 A;  2JVV A;  4FYV B;  3OA6 A;  2PUO B;  1T0H A;  5IAY A;  4ANJ A;  1D0Z A;  2CRE A;  2JNG A;  5LJ3 d;  3VU3 C;  6AT1 B;  2QGG A;  8AT1 B;  1HD3 A;  1K1Z A;  1H3H A;  3GP8 A;  2OI3 A;  3CPW S;  3EGX B;  4BE2 A;  5KYX A;  3JCM c;  2GNC A;  5I2S A;  5EC7 A;  4ZTJ A;  4E47 A;  4OMQ A;  1S72 Q;  1BIA A;  4JDS A;  3TSW A;  2VKN A;  4PFP A;  5DY9 A;  3G71 Q;  2HSE B;  2DMO A;  1RI0 A;  2E41 A;  2FYK A;  1ZHI A;  2DA9 A;  1X75 C;  1FWZ A;  4K11 A;  5GAN e;  3PVQ A;  2AZS A;  2NUZ A;  2CP7 A;  2DIQ A;  5CKH A;  3OSS C;  3URG A;  3NHN A;  1SRM A;  2M0Y A;  3RMQ A;  3MP6 A;  3J81 E;  1ZUK A;  3QBY A;  4J9D A;  2EQM A;  1IGU A;  3G1J A;  4E7H A;  4Z02 A;  2EBP A;  3RUX A;  2DRK A;  2DVE A;  1N8R R;  2LJ0 A;  1RAH B;  3I5S A;  2DO3 A;  5IXF A;  1B34 B;  3OYF A;  2JZ2 A;  1JJ2 S;  1UJ0 A;  1BI1 A;  4C0G A;  3CCE A;  3ASK A;  5GAO q;  1NJI R;  4M78 G;  1W2B A;  2DER A;  8ATC B;  2DL7 A;  2FRY A;  1WHM A;  1Q81 U;  1TWB A;  5L23 A;  3CQT A;  1YI2 Q;  4N4I A;  2YUQ A;  2P84 A;  3BY7 A;  2RH2 A;  1YJW A;  3CCJ T;  3VS6 A;  1RLP C;  1MGQ A;  2QAZ A;  4XTX A;  5KH6 A;  2JJ9 A;  2K3B A;  3NPF A;  2F2X A;  2H3J A;  4OP0 A;  3CD6 A;  3C95 A;  2DKG A;  1V76 A;  3LH0 A;  2LTO A;  2M02 A;  1B7T A;  1JJ2 P;  5GAN 8;  5DLO A;  2G3R A;  5IHN A;  4FL6 A;  3MO8 A;  1YHQ A;  2E1H A;  2V26 A;  3OW2 A;  2LQW A;  4CC4 B;  1JRI A;  1D3B B;  2MAM A;  3LGF A;  3CCS Q;  1NYG A;  3JB9 J;  3MJX A;  2AZV A;  2D6F A;  2RK2 A;  3H0H A;  1KQS P;  4KH0 B;  4JRI A;  1K73 C;  4M77 B;  2KBT A;  3JCM h;  4HVU A;  2X4J A;  2D0Q B;  4AT1 B;  1NM7 A;  3CEY A;  2JM9 A;  3PIP A;  2QDY B;  4J6W A;  4L59 A;  1TTH B;  1WFW A;  2RJE A;  1YIT A;  2ZPH B;  2CGH A;  2RJC A;  1X6G A;  4R56 A;  3CCE Q;  1M1G A;  5C0M A;  2DX1 A;  2KAF A;  2DBM A;  5GJW B;  2SEM A;  1BBZ A;  4C5I A;  1KHC A;  3FDR A;  4BI3 A;  5GAN 2;  3VUB A;  3INZ A;  3CME A;  4C8Q D;  3J80 E;  1WXB A;  2CP6 A;  2CT3 A;  4PFO A;  3E19 A;  3OS0 A;  2D1X A;  1M8M A;  5GAN d;  2J7I A;  1ACM B;  2LRQ A;  4QQ6 A;  1VQM A;  3MET A;  1QVF P;  4J9G A;  1YWO A;  2QTX A;  3QYG B;  4RTV A;  2KQW A;  5D7U A;  1YIJ Q;  1AWX A;  2BIV A;  2HQX A;  3OYC A;  2GFU A;  3E1S A;  2O4X B;  1UGV A;  2HCK A;  4JLI A;  4IIM A;  1QVG S;  4FSS A;  2EYQ A;  1YJN Q;  3JCM e;  3M56 A;  4E7Z A;  1Q7Y U;  1PSE A;  2CT4 A;  2DD4 A;  5FU7 C;  2RI3 A;  2ZPF B;  3CCE T;  2EKH A;  2LDM A;  1WXT A;  2RI2 A;  1WHK A;  3S6W A;  4C5H A;  2C0O A;  1CKB A;  3RKW A;  2DJQ A;  3LYI A;  4M7D G;  4RG2 A;  3JB9 D;  1UE9 A;  4J9H A;  4GY5 A;  2K2M A;  2P4T A;  1UFF A;  2COZ A;  4VUB A;  1YJW T;  1SSH A;  3CPW A;  3JCM g;  5HK0 A;  3EG0 A;  2F5K A;  4B9W A;  4M7A G;  4A63 B;  2KEA A;  4RTX A;  3FC3 A;  2RO0 A;  4JJB A;  4EMK B;  3OYD A;  1TG0 A;  1RAB B;  3E9G A;  3M4G A;  2K5I A;  3L2Z A;  2DPP B;  2RHU A;  2KNB B;  1YHQ T;  2VXE A;  3CCM Q;  1YIJ T;  1WJS A;  3LLR A;  4DOV A;  2C06 A;  3JSC A;  4Y28 E;  3QWX X;  1PD1 A;  3UDC A;  3QJY A;  2Y4Y A;  4MDX A;  3U23 A;  1RAA B;  3A1P A;  2QEX A;  5FRN A;  1MND A;  1M4Z A;  1YIT T;  4C8Q C;  1UJY A;  3JCM Q;  4OGE A;  2B86 A;  2D8H A;  3A8O B;  4XU1 A;  3SWN C;  4F04 B;  1I8F A;  2M16 A;  3UT1 A;  2KRM A;  3E2U A;  3ME9 A;  1Q95 G;  1W6X A;  5HK3 A;  2RMO A;  1N6A A;  1N5Z A;  1VQN Q;  3BDU A;  5KYU B;  3G4S A;  2XDD A;  4Z88 A;  2DNU A;  1VQ9 A;  1VQM T;  1TXQ A;  3FLG A;  2XIC A;  4C92 D;  3ULR B;  2MK5 A;  3UPU A;  2VVK A;  1GFC A;  4C0F A;  3CC2 A;  1WHJ A;  2ZPI B;  5GAO l;  1OPK A;  1U8R A;  2RF0 A;  1OV3 A;  3H6Z A;  4F7U G;  3JCM d;  2X4X A;  3VS7 A;  1D1A A;  2F69 A;  2EQU A;  2DK3 A;  3TSZ A;  1Y71 A;  2DET A;  3QDR B;  2XDP A;  1OEB A;  3EG9 A;  1I1J A;  3CXC S;  1VQ5 A;  2QEX Q;  2EAY A;  4ZGD B;  1MMA A;  4F17 A;  1VQO A;  4N0A C;  1RI9 A;  4LUD A;  2LVM A;  1M8V A;  4J6X A;  2PU9 B;  2BE9 B;  4HXJ A;  1VYT A;  2PUK B;  2E6N A;  2EJG A;  4A4F A;  1UHF A;  4CI0 C;  4JS4 A;  1RAF B;  2R5M A;  1SF9 A;  4O5V A;  4KUI A;  4M75 B;  3JB9 I;  3G4S Q;  4C8Q A;  1WHL A;  1T0J A;  2DLP A;  2YLB A;  2DVJ A;  3G6E Q;  1VQ9 Q;  5LJ5 e;  3QWY A;  4PLI A;  3EH2 A;  2KXC A;  3HRU A;  1PM3 A;  3SWN A;  3QJ6 A;  2JUF A;  2KMT A;  2XID A;  4UC4 A;  2J6K A;  2YRC A;  2DXT A;  5D6Y A;  1EX4 A;  2YUP A;  1UEB A;  5LL6 S;  2QG9 B;  2XDB A;  2QQ9 A;  4IUV A;  1K76 A;  2QEX T;  1LPL A;  1K8A R;  3CC7 A;  3OBW A;  2ZCF B;  1QVG A;  2HQE A;  2DIL A;  4M78 F;  2EQI A;  1M30 A;  4ZGJ B;  3OYY A;  2PNI A;  4XTV A;  4OF1 A;  1UB4 A;  2CUD A;  1HYO A;  4PJO G;  4E7L A;  1QWE A;  2DTH A;  2RQV A;  1RAC B;  2OTL A;  1H64 1;  3M59 A;  3JCM b;  1X01 A;  2DBK A;  3C0C A;  3G4S T;  3AHU A;  2LC4 A;  5IN1 A;  1JEG A;  3VS2 A;  3M53 A;  3OQ5 A;  3G6E T;  1VQ9 T;  1IRE B;  4HA8 A;  2FEI A;  2MWP A;  4N0A A;  2OTJ Q;  1XQH A;  2KK4 A;  3ZEH A;  3CC2 T;  4KGX B;  1K8A C;  2LQ8 A;  2CP0 A;  5KYY A;  5FWB A;  3TVT A;  4XU0 A;  3DLL A;  1IO6 A;  4FT4 A;  4ORZ A;  5CKB A;  3UAT A;  3PNW C;  4BUG A;  2D9T A;  1ZA2 B;  2JW4 A;  4IKF A;  4M77 D;  5GAN 5;  2BUD A;  1K9M R;  3SHW A;  2PVD B;  1RUW A;  1BK2 A;  2HEQ A;  2BZX A;  3S3N A;  1VQ5 T;  1TH7 A;  2AKK A;  5GMK m;  5GAN 7;  4PKC C;  2MCN A;  1Y57 A;  3RKX A;  1VQO T;  3QKJ A;  1PRM C;  4M7D C;  2DL5 A;  5CAI A;  2A28 A;  2VV5 A;  1VQ8 Q;  1BI3 A;  3H8Z A;  1SKU B;  1JBM A;  4JZ4 A;  3CC4 A;  1U3O A;  3A8L B;  1I81 A;  3JCM J;  4M7A C;  4BDY A;  3WVE B;  1QWF A;  1X6B A;  3OYH A;  1M1K C;  2K9G A;  3VS0 A;  2KSS A;  5D6W A;  2OAW A;  4BY6 B;  2PVO B;  2DM1 A;  3EFR A;  1K9M C;  2NUT B;  2HDA A;  4M78 E;  3GNG A;  4LUE A;  4XAX B;  2Y4X A;  2JM8 A;  3SFM A;  2JT4 A;  4LD6 A;  4ZN3 A;  3X28 B;  5FLX E;  1OZ2 A;  4PJL A;  2MMP A;  2K2V A;  1Y07 A;  2MIO A;  2L89 A;  2VUB A;  1G3S A;  3M57 A;  3REA B;  2CUB A;  3CC7 T;  2O9S A;  3V8L A;  1G83 A;  3OMG A;  1EIF A;  1TSF A;  2VGN A;  1MV0 B;  3C4S A;  5CR2 A;  3CXC A;  1OI1 A;  3EFO A;  3OB9 A;  1WPY A;  4J9E A;  1EFN A;  3I55 A;  2OTL T;  2XG8 D;  3CC4 Q;  4M7A F;  2ROT A;  2RHZ A;  5GMK i;  5GAM j;  2V1Q A;  5IH2 A;  2KI7 A;  4FW1 A;  3THK A;  4LDU A;  1FMK A;  1MMG A;  5CKF A;  2X3X D;  2GF7 A;  1K9A A;  1NYF A;  1Q7Y R;  4TVR A;  2PVG B;  1DJ7 B;  4M7D A;  4J8O A;  5A0L A;  4E7K A;  4C8Q G;  2E3H A;  3HRS A;  1AWO A;  1BKB A;  1KD1 U;  1KK7 A;  7AT1 B;  3HPW A;  3JAM E;  4M7A A;  3FJP A;  1M9S A;  5CIU A;  2RI5 A;  4KUL A;  1QP2 A;  1W4S A;  3S3M A;  1GL5 A;  4FYY B;  1GXI E;  1AOJ A;  2LP5 A;  1G3Y A;  3CCJ Q;  2NLU A;  2PZ1 A;  2FRW A;  4LDW A;  3LX7 A;  3CCR A;  4V2S A;  1ABQ A;  1XTD A;  3QUI A;  3HHT B;  1M90 U;  1RAG B;  1WHG A;  3HFN A;  1MMN A;  2J06 A;  2JOY A;  4ZN1 A;  3CC4 T;  1H8K A;  1NE8 A;  2DAQ A;  3JCM P;  2DD5 A;  4KH1 B;  5GMK h;  4LDX A;  5KYX B;  2EGA A;  5GAM h;  1KC8 U;  1VIF A;  1JXO A;  4MZP A;  1UGQ B;  1TUG B;  4JRQ A;  3JB9 G;  2GFA A;  2JTE A;  1G8X A;  4RTY A;  2DL4 A;  4PJJ A;  4JS5 A;  4ME7 A;  3CMA A;  5KCH A;  1MMD A;  4CRI A;  4Z8A A;  4F7U F;  3J7A F;  2HQH A;  1M5Q 1;  1KQS S;  2KT8 A;  1WGS A;  2HZY A;  1C1A A;  4HCB A;  4YTL A;  2R58 A;  1M3B A;  1LVK A;  2FHD A;  5KE3 A;  5KYW B;  2L8D A;  4M7A E;  2MOX A;  4OGC A;  3GBQ A;  1KQ2 A;  4E7J A;  1KG1 A;  2RJF A;  1M1K U;  1BYM A;  4OMO A;  1D0X A;  2CKK A;  2EVR A;  2A7Y A;  4Y92 A;  1N8R C;  1Z9Z A;  4PJO C;  1MUZ A;  4A54 A;  1WIE A;  2GTO A;  2QYZ A;  4F7U A;  4LN2 A;  1KJW A;  2HKN A;  2J6F A;  1R8O B;  2V8I A;  4C0D C;  1YN8 A;  1NJI C;  4FYX B;  4OMF B;  3NTI A;  5A0D A;  1GCQ C;  3EHR A;  4M75 D;  2BZY A;  4PJM A;  2KY9 A;  4A4H A;  5GAM e;  3VS1 A;  1QVF S;  2CH4 W;  2FZC B;  1G2B A;  2DEU A;  3I9Q A;  2AKL A;  4WCI A;  3H0F A;  1IZ6 A;  3M0T A;  3MKD A;  4PLL A;  4MDW A;  4FYW B;  2VB6 A;  2CS7 A;  4ATO A;  2ENM A;  2KYM A;  1NBE B;  1M2V A;  2F2W A;  3A8M B;  4FIB A;  4EMG A;  2OX7 A;  5GAM g;  1YJW Q;  4C92 G;  3M58 A;  1AZE A;  3CCR T;  3LW5 E;  1J3T A;  3PVL A;  2EWN A;  2HBP A;  1NPR A;  4RTW A;  3EGD A;  4ELZ C;  4QKU A;  1NEG A;  3CD6 Q;  2HD0 A;  1ABO A;  4J7F A;  3EFS A;  3JB9 H;  4PJO F;  4KT0 E;  4O6J A;  4E7I A;  2E70 A;  5GAO n;  4PL6 A;  1E6G A;  1Q86 R;  2LNH B;  4RTT A;  4HT8 A;  2PTK A;  1YHQ Q;  1R0B G;  2CSQ A;  4E2F B;  1VQP A;  4F7U E;  3LWI A;  2CYZ B;  3VV0 A;  2EGC A;  3R6O A;  4DA4 A;  5LJ5 f;  1O75 A;  3OMC A;  1PKS A;  2F1L A;  4OB0 B;  1NPP A;  4PJO A;  1YIT Q;  1UTI A;  1K0X A;  2KR3 A;  3CMA T;  3GIB A;  4QQG A;  4RG8 A;  2DL3 A;  2RD1 A;  3DB3 A;  4X1V A;  2RQW A;  1X2K A;  1I07 A;  2VC8 A;  2V8J A;  1C0M A;  3VS5 A;  2B8A A;  3CME Q;  3QHS A;  1GCQ A;  3M4Y A;  4J83 A;  2HAX A;  1VA7 A;  4JUV A;  1PCX A;  1H92 A;  4JRK A;  5CK9 A;  5IHK A;  3CD6 T;  2P4R A;  2XKO C;  2P0P A;  2K7A A;  1BI0 A;  1GFD A;  3OYI A;  1VQM Q;  3MPU B;  4QT7 A;  4M75 C;  4XK8 E;  5D6X A;  2RN8 A;  2CP3 A;  4IUQ A;  2I2L A;  5GAM d;  1B3Q A;  1ZSG A;  1ZBJ A;  2YUO A;  3LH5 A;  5KE2 A;  1LJO A;  1EZZ B;  5M9O A;  2ZPB B;  4HCK A;  3ZL7 C;  1JJ2 A;  5LJ3 f;  5C6S A;  2LT4 A;  3CCL A;  2DIG A;  1N8R U;  1F1B B;  4ELY C;  4PJO E;  3JV3 A;  3CME T;  3Q1J A;  1NLO C;  2W10 A;  4IUP A;  1OX9 A;  2HBW A;  2QA4 A;  4WTO B;  4FT2 A;  1Z9Q A;  2LX9 A;  2KE9 A;  4FSX A;  3RR6 A;  4RMO A;  4FM4 B;  1KQS A;  1AEY A;  2L2P A;  4NOY A;  1K73 U;  1UDL A;  2DXU A;  4L5G A;  1NG2 A;  1VQ4 A;  5FU6 C;  2P0Q A;  3UF4 A;  3OYL A;  4II1 A;  1IXD A;  4LE9 A;  2KRS A;  3VS4 A;  3ZFJ A;  2M0O A;  2RPN A;  1C6V X;  4ZNX A;  4M77 G;  3OYG A;  1VQP T;  1ZSZ C;  4JJD A;  1QCO A;  3M0Q A;  4D6W A;  5KYN A;  1W70 A;  1CSK A;  3M0R A;  4LD9 K;  3M54 A;  2COW A;  3JRZ A;  1ZQ1 A;  2RA2 A;  2VAS A;  1WYX A;  2BKD N;  1D09 B;  1LCK A;  4C8Q F;  1WZO A;  3BFM A;  1AT1 B;  2ROL A;  3VKI A;  2XI9 A;  4P5N A;  4ZTF A;  2EJF A;  4M75 A;  5FU7 B;  1QVF A;  2LX7 A;  2EYZ A;  3TEE A;  1JU5 C;  3A8G B;  2IG0 A;  1RAI B;  3OYK A;  3OBY A;  2C0I A;  2J05 A;  2LCS A;  2LT1 A;  1M2O A;  2QA4 Q;  1IRX A;  4OMM A;  4OB3 B;  3RKY A;  1WDX A;  1Q82 R;  2GGR A;  1N9R A;  4KBM B;  4C5E A;  2R5A A;  2GQI A;  2XMF A;  1QCF A;  1G3T A;  1M3A A;  5HY6 A;  4RUG A;  1OUL A;  4NL2 A;  1TUC A;  2CZ6 B;  3EG9 B;  2A37 A;  3CC2 Q;  2AT1 B;  1XJW B;  3UA6 A;  3FIF A;  3CCV A;  2HMA A;  3M0S A;  3R6N A;  1X6O A;  1KD1 R;  5CKE A;  3UA7 A;  4OMP A;  5AYF A;  2DE0 X;  2KT1 A;  1X27 A;  2CZ7 B;  4JJC A;  3JB9 F;  3QPH A;  2RM4 A;  1VQ5 Q;  5LJ3 h;  1YFN A;  2NUP A;  4A53 A;  3EG2 A;  3H9N A;  3CCL T;  2FB7 A;  1VQO Q;  2BE7 D;  4E6R A;  2VWF A;  1M90 R;  2XK0 A;  3O5Z A;  1IHW A;  4RTZ A;  2HL3 A;  1ZSZ A;  4CC2 A;  2QA4 T;  5GAO m;  3HKS A;  3MEU A;  1U1T A;  4C92 C;  4RCC A;  3SWN B;  4JJN K;  1U5S A;  1UGS B;  1VOM A;  1WHH A;  2CH4 A;  2FZK B;  2DEQ A;  1V29 B;  5GAN f;  3V7S A;  1KC8 R;  4HCZ A;  3WVD B;  1VQ4 T;  1PG5 B;  1SHG A;  3PT9 A;  3P8D A;  3M0P A;  3FEO A;  2OJ2 A;  4C8Q E;  4OML A;  1WX6 A;  2GCX A;  3X25 B;  2L3S A;  3CCV Q;  1Q81 R;  1VQ6 A;  2E5K A;  1OOT A;  2YLC A;  3VYH B;  2RQR A;  1VQL A;  1W2B S;  2FPF A;  1BIB A;  2KRN A;  2L3R A;  4J9B A;  3L2R A;  1LNX A;  5AT1 B;  4R55 A;  3V8J A;  4A4G A;  1K4U S;  1ZX6 A;  1YJ9 A;  2WAC A;  3F70 A;  3CC7 Q;  4BAC A;  1JO8 A;  4XTZ A;  2K6D A;  2GQV A;  1A0N B;  2RB6 A;  1TS9 A;  4M78 B;  4MML A;  3CCU A;  3MEW A;  3QG1 A;  5CQX A;  3X26 B;  3HSB A;  4Q5W A;  2WSE E;  4C92 F;  4FU6 A;  2OTL Q;  5KYY B;  4PFZ A;  3DKM A;  2L0A A;  2YDL A;  3JCM W;  1W2B P;  1H3Z A;  3SDZ A;  5LJ3 g;  3O8V A;  2LZ6 B;  4DEY A;  1I4K 1;  2EPD A;  2E3I A;  1P92 A;  1UHC A;  2JN0 A;  3CCV T;  2HL5 C;  4C92 A;  3QZ9 B;  1PD0 A;  3KFV A;  2EIF A;  1Y96 A;  3L2V A;  2EJ9 A;  4ZGE B;  3HL8 A;  3CBP A;  2LJ1 A;  3V8K A;  2ZPG B;  2M1H A;  4NL3 A;  2G6F X;  4BE1 A;  2C0T A;  3OW2 P;  2JMC A;  1Y7X A;  3RMS A;  2A36 A;  3FRN A;  4M7D F;  5I22 A;  5EG2 A;  1S72 A;  1QCN A;  1YP5 A;  3CCU Q;  5GJV B;  4HCC A;  4M75 G;  3G71 A;  5GMK j;  3E9F A;  2DF6 A;  3SB2 A;  3UWN A;  1E6H A;  3KXT A;  1N9S A;  1YWP A;  4DEX A;  2RHI A;  3EGX A;  3OYN A;  1G5V A;  5GAN h;  5IT9 E;  1CKA A;  1N27 A;  1SG5 A;  2X4Y A;  3NGP A;  1OZ3 A;  3PIO A;  2YUN A;  4M77 C;  2L3Q A;  2YXY A;  4X34 A;  1RLQ C;  4AMC A;  2LMJ A;  3MEA A;  5FRM A;  2K3X A;  3WXM B;  5FW9 A;  5DM7 R;  1D1B A;  1WA7 A;  1VQL T;  1VIE A;  3NFC A;  3QII A;  3JCM f;  3EFO B;  1JB0 E;  4C92 E;  1FMV A;  1MV3 A;  2GTJ A;  1YJ9 T;  2K4Y A;  1VYV A;  3GF5 A;  3TCJ A;  4IUR A;  3HTR A;  4PK4 A;  1SHF A;  2OAU A;  1YI2 A;  5DLQ E;  4KUD K;  5GAO p;  1B34 A;  2QXF A;  2RJD A;  2MWO A;  2YWW A;  1KQ1 A;  2EGE A;  3CCU T;  1AWW A;  2EW3 A;  1Q7Y C;  4QVC A;  4M7D B;  1K8A U;  2DXB A;  5CQY A;  1K0S A;  3I55 Q;  3OYM A;  4R0K A;  3RER A;  3L2U A;  1ZLM A;  4J6Y A;  2X51 A;  4FCY A;  4DQ2 A;  4M7A B;  2M51 A;  2HNI A;  2JXB A;  3CBO A;  4XTY A;  2LQN A;  2ED1 A;  5KYW A;  2JMA A;  3G7Z A;  3CCS A;  4F16 A;  1BU1 A;  4M77 F;  3CPW P;  2QGF B;  1WI7 A;  4GLK A;  2CZ0 B;  2MYS A;  3H41 A;  4M7D E;  2X35 A;  3HRT A;  3PMT A;  4DBF A;  2HKQ B;  2D0N A;  3SEM A;  5GAN g;  4M4Z A;  4A4E A;  2SRC A;  1RAE B;  4XTW A;  3KBG A;  1U1S A;  4J9I A;  2QTV A;  1D3B A;  3QXE B;  2J6O A;  4LNP A;  3VYG A;  2A3L A;  3CCR Q;  2F5T X;  4OB2 B;  2KDS A;  2D8J A;  2FPE A;  3MCA B;  1K73 R;  4M77 A;  5CO7 A;  1AZG B;  1ZBX A;  1S72 T;  4CC7 A;  5I2M A;  3BW1 A;  1K9M U;  4EMK C;  5I11 A;  3I55 T;  3G71 T;  4HT9 A;  2W0Z A;  2ZAE A;  4AFZ C;  4DBH A;  1YNZ A;  5GMK e;  2O88 A;  2YRD A;  3C12 A;  1ZA1 B;  3X24 B;  2VGM A;  3FJ5 A;  1MHN A;  1KFZ A;  3M9Q A;  2YRV A;  1OPL A;  2NYS A;  1YIJ A;  4EPC A;  1HJD A;  3BE3 A;  4NS5 A;  3CMA Q;  2KXD A;  1YJN A;  2E64 A;  3QDF A;  4JLG A;  1XOV A;  4MZT A;  2RHX A;  3SD4 A;  4F7U B;  2P0K A;  1VQK A;  2EYW A;  3KUF A;  5FWC A;  3P8H A;  1FYN A;  4EIK A;  3RES A;  1HK9 A;  2O4X A;  1TU0 B;  1SEM A;  1YI2 T;  1X43 A;  2JS0 A;  4AFQ C;  2F2V A;  3TU4 K;  1MNE A;  3EGU A;  3M0U A;  1WJQ A;  4XU3 A;  4QW2 A;  1QW1 A;  3H0I A;  3L2W A;  3VRY A;  3A98 A;  2ZGW A;  4M77 E;  3X20 B;  3PE0 A;  2DYI A;  3GOX A;  3EG1 A;  3CPF A;  1OYX A;  1M27 C;  3IQL A;  3P8B B;  1KIK A;  4QVZ A;  1JXM A;  2LJ3 A;  2EKO A;  4PNO A;  2QI2 A;  3CCM A;  1BI2 A;  1M2V B;  2QQR A;  4AG1 C;  4ESR A;  4HKE A;  5GAN 3;  2EFI A;  3BDL A;  3CCS T;  1SRL A;  2CZ1 B;  1R77 A;  1WQ7 A;  1WLP B;  4EMK A;  2RNA A;  4BB7 A;  2KVQ G;  3M5A A;  3EGD B;  3QSU A;  1I5O B;  4BI8 B;  2E5Q A;  1GRI A;  5HKC A;  3PMI A;  5J39 A;  2K57 A;  2DZ9 A;  2ED0 A;  2H8H A;  4PJN A;  3S3O A;  1Q86 C;  4BDZ A;  4XTU A;  1VQK Q;  2IIM A;  1UEC A;  2ECZ A;  2VYT A;  4XQ3 A;  4B6M A;  3OYB A;  3MHX A;  2JTF A;  1W1F A;  1LOJ A;  2Y90 A;  1QKW A;  1QKX A;  1XNI A;  4M78 D;  1VQN A;  1ZUU A;  4RCB A;  1VQ7 A;  2QDL A;  1UUE A;  2EYX A;  2E6Z A;  4PJO B;  1YCS B;  4DBQ A;  4LXC A;  2LCC A;  2O31 A;  1OU9 A;  5KCO A;  3CCQ A;  5LJ5 j;  1QVG P;  3PGG A;  1WJR A;  2ZZD A;  1VQP Q;  5J26 A;  4E7S A;  2YT6 A;  4XU2 A;  4C0D B;  2E10 A;  4BE0 A;  3TRE A;  1BCO A;  1QLY A;  2CP2 A;  3I56 A;  2DJZ A;  2K79 A;  2V8K A;  4DBR A;  3RNJ A;  4RKU E;  3ZBD A;  2CP5 A;  3ER0 A;  1QMC A;  2FPD A;  2BTT A;  3I5R A;  2JS2 A;  5KYU A;  1D0Y A;  4MMK A;  3OS2 A;  2K3Y A;  3L1A A;  3NTH A;  5GAO r;  1YJN T;  4A4K A;  2ABL A;  2IPO B;  2RQU A;  3NTK A;  2FVU A;  1IB8 A;  4HVW A;  3AT1 B;  3JCM X;  1VQK T;  2V1R A;  5IHI A;  3MP8 A;  2DFU A;  1WNL A;  1NJI U;  2K5L A;  1BCM A;  2ZPE B;  2YSQ A;  3OYE A;  3HP9 A;  4JZ3 A;  5J3B A;  2MPX C;  2E4H A;  3L42 A;  1ARK A;  4J7I A;  1S1N A;  5CCA A;  3OS1 A;  2WSC E;  4M75 F;  2KRO A;  2DZC A;  2E65 A;  1VQ7 Q;  3T9N A;  5HCK A;  2FO0 A;  3V7R A;  1QQJ A;  2QQA A;  1IGQ A;  3CCQ Q;  1G3W A;  3DB4 A;  4C0Z A;  3G6E A;  3OY9 A;  5LJ5 h;  1SPK A;  2QK0 A;  4N4H A;  3CCM T;  3RBB B;  1GCP A;  5LJ3 j;  2E12 A;  3I56 Q;  2DL8 A;  1PHT A;  4IUT A;  2BZ8 A; 
#chains in the Genus database with same CATH homology
 2KQW A;  2GQV A;  3EAE A;  4LDV A;  2JOY A;  2HQX A;  2BIV A;  2RB6 A;  4M78 B;  4ZN1 A;  3OYC A;  3CC4 T;  2GFU A;  4MML A;  2JTM A;  3CCU A;  3MEW A;  3QG1 A;  3E1S A;  5CQX A;  1NE8 A;  2O4X B;  3X26 B;  3HSB A;  4Q5W A;  2DAQ A;  3JCM P;  4JLI A;  1QVG S;  2WSE E;  4C92 F;  4BI4 A;  2DXC A;  2DD5 A;  5GMK h;  4LDX A;  2EYQ A;  4FU6 A;  1YCY A;  3JCM e;  3M56 A;  1Q7Y U;  1PSE A;  3DKM A;  3RIR A;  4C5G A;  5A0G A;  2YHT A;  5GAM h;  2PQW A;  1KC8 U;  1VIF A;  2DD4 A;  5FU7 C;  4M78 C;  2RI3 A;  2ZPF B;  1UGQ B;  4MZP A;  3JCM W;  3CCE T;  1H3Z A;  3SDZ A;  2LDM A;  5LJ3 g;  2RI2 A;  1FXX A;  4JRQ A;  3JB9 G;  2GFA A;  3O8V A;  3S6W A;  4C5H A;  3GPL A;  2L5Q A;  1I4K 1;  3RKW A;  1M1K U;  3OS5 A;  4JS5 A;  3LYI A;  4ME7 A;  4RG2 A;  3CMA A;  3JB9 D;  4M7D G;  5KCH A;  1UGR B;  4CRI A;  4GY5 A;  2P4T A;  1P92 A;  4F7U F;  3J7A F;  5I21 A;  3V7C A;  4VUB A;  1VQN T;  1M5Q 1;  1VQ7 T;  2JN0 A;  3CCV T;  1YJW T;  1SSF A;  2DTO A;  4M7D D;  1KQS S;  2XD0 A;  1WGS A;  4C92 A;  3JCM g;  5HK0 A;  5GMK l;  3CPW A;  4HCB A;  3QZ9 B;  4YTL A;  2F5K A;  2R58 A;  5FRO A;  4B9W A;  3CCQ T;  2EIF A;  2RHY A;  4BY6 C;  2MF2 A;  2FHD A;  5KE3 A;  4M7A G;  1YBY A;  5GAN 4;  1Y96 A;  2L8D A;  3FC3 A;  4M7A E;  2RO0 A;  4OGC A;  4EMK B;  3L2V A;  2EJ9 A;  1KQ2 A;  4ZGE B;  3OYD A;  4E7J A;  2OTJ A;  1KG1 A;  3HL8 A;  2RJF A;  3CBP A;  3E9G A;  5L8R E;  3M4G A;  3V8K A;  2K5I A;  3L2Z A;  2ZPG B;  2M1H A;  3MP1 A;  4NL3 A;  2IVW A;  3I56 T;  4M7A D;  1BYM A;  3DLM A;  2CKK A;  5GAN 6;  1QP3 A;  4BE1 A;  1Q86 U;  2A7Y A;  2DPP B;  1N8R C;  5CVI A;  2RHU A;  1Y7X A;  4WF2 A;  3RMS A;  2VXE A;  3FRN A;  1YHQ T;  4X9D A;  1YIJ T;  4M7D F;  4A54 A;  4PJO C;  1WJS A;  1NZ9 A;  1S72 A;  5EG2 A;  4F7U A;  3LLR A;  1Q82 C;  4DOV A;  1R8O B;  2C06 A;  3JSC A;  2V8I A;  4C8Q B;  4Y28 E;  4C0D C;  3UDC A;  3QJY A;  1RL2 A;  3M55 A;  2Y4Y A;  4M75 G;  4HCC A;  3G71 A;  4J5Y A;  2QQB A;  4MDX A;  1NJI C;  5GMK j;  2FL7 A;  3E9F A;  3SB2 A;  3UWN A;  4OMF B;  4M75 E;  3NTI A;  3KXT A;  5A0D A;  1N9S A;  3QO3 A;  5LJ5 g;  3CBM A;  2RHI A;  3OYN A;  1G5V A;  4M75 D;  2QEX A;  3OSV A;  4A4H A;  2KY9 A;  5GAM e;  5GAN h;  1M4Z A;  5IT9 E;  5FRN A;  1YIT T;  3PFS A;  1QVF S;  4C8Q C;  3LGL A;  4BD3 A;  3JCM Q;  1KD1 C;  2VXF A;  1VQ8 A;  1N27 A;  2X4Y A;  2K5F A;  4OGE A;  1OZ3 A;  1IZ6 A;  2RK1 A;  3PIO A;  4OB1 B;  3A8O B;  3FB9 A;  4M77 C;  4MDW A;  4PLL A;  4X34 A;  2AHJ B;  4XU1 A;  3SWN C;  3A5Z B;  1I8F A;  2M16 A;  3UT1 A;  3MEA A;  5FRM A;  2K3X A;  2CS7 A;  4ATO A;  3ME9 A;  3WXM B;  4LDY A;  1M1F A;  5HK3 A;  5FU6 B;  1N6A A;  1PSF A;  5DM7 R;  3A8M B;  4EMG A;  4FIB A;  1VQL T;  3BDU A;  5GAM g;  1VIE A;  3NFC A;  3QII A;  3JCM f;  3G4S A;  4C92 G;  3M58 A;  2XDD A;  1JB0 E;  1M90 C;  4M78 A;  3CCR T;  3LW5 E;  4C92 E;  1VQ9 A;  4JRP A;  1VQM T;  2EWN A;  3FLG A;  2HBP A;  1NPR A;  2K4Y A;  2XIC A;  3GF5 A;  3TCJ A;  4C92 D;  4IUR A;  1YJ9 T;  4ELZ C;  2HD0 A;  4J7F A;  1FX7 A;  2O01 E;  3EFS A;  3UPU A;  2OAU A;  2R57 A;  1YI2 A;  1I5L A;  4PJO F;  3JB9 H;  5DLQ E;  4KT0 E;  4C0F A;  3CC2 A;  2XU8 A;  4O6J A;  4E7I A;  2EQJ A;  2E70 A;  1B34 A;  2ZPI B;  5LJ3 e;  5GAO p;  5GAO l;  5GAO n;  4PL6 A;  2QXF A;  1U8R A;  2RJD A;  2MWO A;  3A8H B;  1KQ1 A;  3OYA A;  3H6Z A;  3CCU T;  4HT8 A;  4N4G A;  2X4W A;  1Q7Y C;  2LNV A;  4QVC A;  4F7U G;  4M7D B;  3JCM d;  2X4X A;  1K8A U;  2DXB A;  1KC8 C;  1VQP A;  5CQY A;  4F7U E;  2F69 A;  3LWI A;  2CYZ B;  2EQU A;  3OYM A;  3VV0 A;  4OVA A;  5CKD A;  3RER A;  3L2U A;  2DK3 A;  1KHI A;  1VUB A;  1Y71 A;  4J6Y A;  2WSF E;  5GAN j;  3QDR B;  2XDP A;  3R6O A;  4MZM A;  4DA4 A;  1VQ5 A;  3CXC S;  5LJ5 f;  4DQ2 A;  4M7A B;  2EAY A;  1O75 A;  2HNI A;  3OMC A;  4ZGD B;  3OW2 S;  3CBO A;  4OB0 B;  4XTY A;  1VQO A;  1NPP A;  4N0A C;  1Q81 C;  4PJO A;  3G7Z A;  2LVM A;  4DOW A;  1M8V A;  3CCS A;  3CMA T;  2M9U A;  4J6X A;  4QQG A;  4M77 F;  3GIB A;  2PU9 B;  4RG8 A;  1QVP A;  2RD1 A;  1AHJ B;  2XHC A;  3DB3 A;  3N5B B;  4GLK A;  3OYJ A;  2LQK A;  2PUK B;  2CZ0 B;  2E6N A;  4M7D E;  2EJG A;  2VC8 A;  2X35 A;  2V8J A;  4X9C A;  4A4F A;  3PTA A;  1O9S A;  3HRT A;  2B8A A;  4EDU A;  3PMT A;  3QHS A;  5LJ5 d;  4CI0 C;  4JS4 A;  2R5M A;  5GAN g;  3M4Y A;  4A4E A;  4O5V A;  4J83 A;  2HAX A;  4KUI A;  4M75 B;  3JB9 I;  2OTJ T;  4XTW A;  4C8Q A;  4JUV A;  3KBG A;  5GAM f;  3JCM V;  2YLB A;  1U1S A;  4JRK A;  5CK9 A;  3CD6 T;  1D3B A;  2XKO C;  3QXE B;  4B9X A;  2P0P A;  3VYG A;  3L2Q A;  5LJ5 e;  2A3L A;  1BI0 A;  2F5T X;  4PLI A;  4OB2 B;  3HRU A;  2KDS A;  3LWH A;  3MCA B;  3OYI A;  4L6V 5;  4M77 A;  5CO7 A;  3GNF B;  3SWN A;  1ZBX A;  1S72 T;  3QJ6 A;  2JUF A;  2KMT A;  5I2M A;  2XID A;  3BW1 A;  4M75 C;  4UC4 A;  4XK8 E;  2DXT A;  5D6Y A;  1K9M U;  4EMK C;  5D6X A;  2MI6 A;  4QQD A;  1HXD A;  3QYH B;  3I55 T;  1UGP B;  1UEB A;  3CCJ A;  5LL6 S;  3G71 T;  4HT9 A;  4IUQ A;  2QQ9 A;  2XDB A;  2I2L A;  4IUV A;  4EMH A;  5GAM d;  1WQW A;  3QZ5 B;  3GLX A;  2QEX T;  2DTI A;  5GMK e;  5KE2 A;  2QQS A;  3OBW A;  3CC7 A;  1LJO A;  2ZCF B;  3C12 A;  3X24 B;  1QVG A;  2VGM A;  2HQE A;  4M78 F;  1MHN A;  4C92 B;  5M9O A;  3M9Q A;  1VQ8 T;  2YRV A;  4ZGJ B;  4IUU A;  3OYY A;  3MEV A;  1YIJ A;  4XTV A;  4OF1 A;  2ZPB B;  4QVD A;  1JJ2 A;  4EPC A;  1Y96 B;  1UB4 A;  5LJ3 f;  5C6S A;  2LT4 A;  3CCL A;  2DIG A;  1N8R U;  4PJO G;  4E7L A;  4ELY C;  3HFO A;  2DTH A;  4NS5 A;  4PJO E;  3CME T;  3Q1J A;  3VUZ A;  2OTL A;  4IUP A;  1H64 1;  3M59 A;  3JCM b;  1YJN A;  1Q82 U;  3C94 A;  2E64 A;  1X01 A;  5A2Q E;  2QA4 A;  4PJO D;  4JLG A;  2EQK A;  3VJP A;  2LCL A;  1VQ6 T;  1XOV A;  4Y91 A;  2JVV A;  3G4S T;  3AHU A;  2LC4 A;  4FT2 A;  2RHX A;  4MZT A;  2LX9 A;  4FSX A;  3SD4 A;  5IN1 A;  2P0K A;  2PUO B;  4F7U B;  4RMO A;  1VQK A;  4FM4 B;  3M53 A;  5IAY A;  3OQ5 A;  1KQS A;  3G6E T;  3KUF A;  1VQ9 T;  3P8H A;  1IRE B;  4HA8 A;  4NOY A;  2JNG A;  1K73 U;  2DXU A;  2MWP A;  4N0A A;  1HK9 A;  3RES A;  5LJ3 d;  3VU3 C;  1XQH A;  2O4X A;  4L5G A;  1YI2 T;  2KK4 A;  1VQ4 A;  3ZEH A;  5FU6 C;  3CC2 T;  2P0Q A;  3GP8 A;  3CPW S;  1K8A C;  2LQ8 A;  4II1 A;  3OYL A;  4BE2 A;  3TU4 K;  3ZFJ A;  1WJQ A;  2M0O A;  4XU3 A;  3JCM c;  4XU0 A;  5I2S A;  3DLL A;  4QW2 A;  4FT4 A;  5CKB A;  4ZTJ A;  1QW1 A;  4E47 A;  4M77 G;  3L2W A;  3OYG A;  3PNW C;  4BUG A;  1BIA A;  2ZGW A;  4M77 E;  1VQP T;  2D9T A;  3X20 B;  4JDS A;  3GOX A;  3CPF A;  1OYX A;  4D6W A;  4IKF A;  4M77 D;  5GAN 5;  2BUD A;  3P8B B;  5DY9 A;  4LD9 K;  3M54 A;  2RA2 A;  1ZQ1 A;  2PVD B;  3JRZ A;  2BKD N;  1RI0 A;  2E41 A;  4QVZ A;  3S3N A;  1VQ5 T;  1TH7 A;  5GMK m;  5GAN 7;  2FYK A;  1ZHI A;  2EKO A;  4PKC C;  1X75 C;  4PNO A;  1FWZ A;  2QI2 A;  3RKX A;  5GAN e;  1VQO T;  3CCM A;  1BI2 A;  3QKJ A;  4C8Q F;  2DIQ A;  2QQR A;  3BFM A;  5CKH A;  4M7D C;  4HKE A;  5GAN 3;  2EFI A;  3OSS C;  3VKI A;  5CAI A;  3BDL A;  3CCS T;  3URG A;  2XI9 A;  4P5N A;  4ZTF A;  2EJF A;  4M75 A;  2VV5 A;  5FU7 B;  1BI3 A;  2CZ1 B;  3H8Z A;  1QVF A;  1WQ7 A;  1JBM A;  3RMQ A;  4EMK A;  3MP6 A;  3TEE A;  3J81 E;  3QBY A;  4BB7 A;  2EQM A;  2IG0 A;  3A8G B;  2KVQ G;  4E7H A;  3A8L B;  3CC4 A;  1I81 A;  3M5A A;  4Z02 A;  3JCM J;  3OYK A;  3QSU A;  4BDY A;  3RUX A;  4M7A C;  4BI8 B;  3OBY A;  3WVE B;  2DVE A;  2E5Q A;  5HKC A;  2LT1 A;  3PMI A;  5J39 A;  3OYH A;  2DO3 A;  1B34 B;  2K57 A;  3OYF A;  1M1K C;  2DZ9 A;  2JZ2 A;  1JJ2 S;  4OB3 B;  1BI1 A;  2KSS A;  3RKY A;  3S3O A;  1Q86 C;  4BDZ A;  4XTU A;  1N9R A;  4KBM B;  4C0G A;  3CCE A;  5D6W A;  4C5E A;  2VYT A;  4XQ3 A;  2R5A A;  4BY6 B;  2PVO B;  1G3T A;  3ASK A;  3EFR A;  5GAO q;  3OA6 A;  1K9M C;  4M78 G;  1W2B A;  5HY6 A;  3OYB A;  3MHX A;  4M78 E;  3GNG A;  4XAX B;  2Y4X A;  1Q81 U;  2JTF A;  4NL2 A;  3SFM A;  1LOJ A;  2CZ6 B;  2Y90 A;  4LD6 A;  4N4I A;  1XNI A;  4M78 D;  3BY7 A;  2RH2 A;  4ZN3 A;  1VQN A;  4RCB A;  3FIF A;  1OZ2 A;  3X28 B;  5FLX E;  3CCJ T;  3CCV A;  1YJW A;  1VQ7 A;  1X6O A;  2E6Z A;  4PJO B;  5CKE A;  2MMP A;  2K2V A;  1MGQ A;  1Y07 A;  2LCC A;  5KCO A;  3CCQ A;  2L89 A;  5AYF A;  4XTX A;  5LJ5 j;  2VUB A;  5KH6 A;  1G3S A;  3M57 A;  1WJR A;  2ZZD A;  3PGG A;  5J26 A;  2CZ7 B;  3CC7 T;  2H3J A;  4OP0 A;  4XU2 A;  2E10 A;  4C0D B;  3CD6 A;  3C95 A;  3JB9 F;  2DKG A;  3LH0 A;  3V8L A;  2LTO A;  3TRE A;  4BE0 A;  3I56 A;  5GAN 8;  2DJZ A;  1EIF A;  3OMG A;  3QPH A;  5DLO A;  2V8K A;  2RM4 A;  2G3R A;  2VGN A;  4FL6 A;  4RKU E;  5LJ3 h;  4A53 A;  3ZBD A;  3ER0 A;  3MO8 A;  3C4S A;  3CCL T;  5CR2 A;  2FB7 A;  3CXC A;  1YHQ A;  1OI1 A;  3OB9 A;  2E1H A;  3OW2 A;  1WPY A;  4MMK A;  1JRI A;  2XK0 A;  3OS2 A;  1D3B B;  2K3Y A;  2MAM A;  3LGF A;  3I55 A;  3L1A A;  3JB9 J;  2OTL T;  3NTH A;  2XG8 D;  5GAO r;  1YJN T;  4M7A F;  2D6F A;  2QA4 T;  5GAO m;  3HKS A;  3MEU A;  1U1T A;  4A4K A;  2RK2 A;  2RHZ A;  5GMK i;  4C92 C;  5GAM j;  3NTK A;  4JRI A;  1K73 C;  4M77 B;  2FVU A;  4RCC A;  3SWN B;  3JCM h;  2X4J A;  2D0Q B;  3JCM X;  4JJN K;  1VQK T;  3CEY A;  1UGS B;  4LDU A;  3MP8 A;  5CKF A;  2GF7 A;  2QDY B;  4J6W A;  3PIP A;  4L59 A;  1WNL A;  1NJI U;  2RJE A;  1YIT A;  2ZPH B;  2DEQ A;  2CGH A;  4TVR A;  2RJC A;  1V29 B;  5GAN f;  2PVG B;  1DJ7 B;  2K5L A;  2ZPE B;  1M1G A;  3V7S A;  5C0M A;  4R56 A;  4M7D A;  3OYE A;  4J8O A;  4HCZ A;  3WVD B;  2KAF A;  3HP9 A;  5A0L A;  5J3B A;  1VQ4 T;  4E7K A;  3PT9 A;  3P8D A;  4C8Q G;  3L42 A;  3FEO A;  3HRS A;  4J7I A;  1KHC A;  4C5I A;  3FDR A;  4C8Q E;  5CCA A;  3OS1 A;  2WSC E;  1BKB A;  4BI3 A;  5GAN 2;  1KD1 U;  3HPW A;  3INZ A;  3VUB A;  3CME A;  2GCX A;  4M75 F;  3X25 B;  4C8Q D;  3JAM E;  4M7A A;  3J80 E;  3FJP A;  2DZC A;  1M9S A;  2E65 A;  5CIU A;  2RI5 A;  4KUL A;  1QP2 A;  1W4S A;  3T9N A;  3S3M A;  3E19 A;  1VQ6 A;  1GXI E;  2YLC A;  3V7R A;  3VYH B;  3OS0 A;  1VQL A;  2QQA A;  1W2B S;  1G3Y A;  2NLU A;  1G3W A;  3DB4 A;  5GAN d;  4LDW A;  1BIB A;  4C0Z A;  3LX7 A;  3G6E A;  2L3R A;  3L2R A;  3OY9 A;  1LNX A;  5LJ5 h;  2LRQ A;  4R55 A;  3CCR A;  4V2S A;  3V8J A;  4QQ6 A;  4N4H A;  4A4G A;  3CCM T;  1VQM A;  3MET A;  1YJ9 A;  1XTD A;  2WAC A;  3QUI A;  2E12 A;  3F70 A;  5LJ3 j;  3HHT B;  1M90 U;  4BAC A;  2QTX A;  3QYG B;  4IUT A;  4KUD K;  4XTZ A;  3HFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...