2PU9B

Crystal srtucture of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin f
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pu9B00
2PVOB 2DD4A 2DXCA 3A8HB 1QP2A 2WSCE 3QZ9B 2ZPGB 2ZPHB 3LW5E 1V29B 2WSFE 2CYZB 1AHJB 4OB0B 2QDYB 2CZ7B 2PVDB 3X26B 2CZ0B 1IREB 2ZCFB 3A8LB 2AHJB 2O01E 1PSEA 1UGQB 3A8OB 4OB2B 3HHTB 4XK8E 4FM4B 1JB0E 3X20B 4ZGDB 2CZ6B 2CZ1B 2DD5A 4OB3B 1DJ7B 3A8GB 2ZPEB 1UGPB 3A8MB 2D0QB 3X25B 4L6V5 2PU9B 2DPPB 2PVGB 2ZPFB 4ZGEB 3QYGB 4Y28E 3X28B 3QZ5B 3VYGA 2DXBA 1GXIE 2WSEE 2ZPBB 4OB1B 1UGRB 3WVDB 2PUKB 4KT0E 1UGSB 2ZZDA 3X24B 5L8RE 2ZPIB 3WVEB 4ZGJB 4RKUE 3VYHB 3QXEB 2PUOB 1QP3A 3QYHB 1PSFA
chains in the Genus database with same CATH superfamily
4M4ZA 2J6FA 2LT4A 3JCMg 4D8DA 4FYWB 2RH2A 1RLPC 2OTJQ 2LZ6B 2ZPHB 2ATCB 5LJ5e 1V29B 3H0FA 4BE2A 3JRZA 3M56A 5FWBA 4J9GA 1VQKA 3JCMd 4F17A 2HEQA 1N27A 3FIFA 2KBTA 3EGUA 4C5HA 3VKIA 4EPCA 2CH4A 2JMAA 1MMAA 2COYA 4XU2A 1GL5A 5DLOA 1VYTA 5FU6C 4M7AE 1NM7A 1RAGB 2JXBA 1N9RA 1YJ9T 1VQLQ 1W2BS 4PJLA 2NYSA 4M78B 3GOXA 8AT1B 3VUZA 3S3MA 1KJWA 1U3OA 4M7DC 5IHNA 1OPLA 1BK2A 3G6EQ 2DBMA 1M2VA 2D1XA 4KRTA 1K1ZA 1R0BG 1D0YA 1H8KA 4MZMA 3UDCA 2JM8A 5CKBA 2RQRA 2DPPB 2VASA 1AVZC 1BKBA 2KE9A 1VQLT 1SKUB 3HL8A 4JJCA 1YI2A 4PK4A 4D6WA 4J9CA 4FL6A 1KQSS 1MV0B 3M0SA 4XTZA 3REBB 4KH1B 4RCCA 3OW2A 2LJ0A 3CCUA 4XU1A 3G6ET 3OSSC 3INZA 3OBWA 3PTAA 5M9OA 1YJWT 2A36A 1V1CA 2A37A 3TEEA 3L2UA 2EWNA 2JT4A 3M4YA 1OQKA 2JTEA 1M8VA 1X6BA 5J3BA 2QYZA 1WQ7A 3EFOB 2PVOB 5GAN4 1OOTA 3JV3A 3SWNC 1Z9ZA 4MMKA 4CI0C 4E7IA 3CCVT 1ZX6A 4J83A 1WFWA 4QQGA 1YWPA 1G3SA 1ABOA 3L2WA 2RHXA 2LQNA 2X4JA 1GFDA 2GGRA 2I0NA 1VQNQ 3X26B 2X35A 1AWJA 4M77E 1OZ2A 1YIJA 2ZCFB 5CO7A 3GPLA 3JCMb 1Y71A 2O01E 1PSEA 1JXOA 1N8RR 1M3CA 3SEMA 2DTHA 4DBFA 2SRCA 3VS0A 4XK8E 1PCXA 4J9EA 3VRZA 2EQMA 2CSIA 5KE2A 5CQXA 3CBMA 1MV3A 2E3IA 2LX7A 1VQNT 2MMPA 2P0KA 2J6KA 2CZ1B 2DD5A 4LNPA 4E2FB 5CIUA 4MMLA 2RHZA 4L5GA 3JCMJ 4MDWA 2KSSA 4R56A 1LCKA 2DL8A 5HCKA 1F1BB 4Z88A 2KXDA 2ZPFB 2MPXC 1FMKA 5GAMe 4Y28E 1E6HA 3L42A 1GRIA 3EGXA 2JOYA 2ZPBB 1UUEA 1WI7A 4PJOC 2KT8A 4PKCC 1IGQA 2KEAA 4KUDK 5FWCA 3EG1A 4K11A 3OS2A 1QW1A 1EFNA 1B3QA 2CGHA 1I81A 1JQQA 2OTJA 4IUPA 3A1PA 2JS0A 3G71T 5KYXB 2RI3A 3OS0A 4C0DC 3NTHA 2CP2A 5FRNA 3L2VA 1TH7A 2DD4A 1PHTA 3A8HB 4B9XA 2Y4YA 1QP2A 5EC7A 4E7ZA 4PJNA 1I5LA 4J5YA 2WSCE 1H92A 3PIPA 4JLGA 2P4TA 5GMKh 4M7DF 1VYUA 2KYBA 1Y0MA 1KHIA 1WHJA 2E12A 3EGDB 1VQ8Q 2O9VA 3EG2A 4F14A 2LC4A 4R55A 2PZ1A 3JCMV 4BACA 1VQLA 3JCMW 1NG2A 1IO6A 2E41A 2K3BA 2KY9A 2YHTA 2BUDA 3UT1A 3HHTB 3CCMQ 5KYYA 4PJMA 1WJRA 4C8QD 1QVPA 4C5GA 4ELYC 1MNDA 5GANf 4KGXB 3PT9A 1IHWA 2RK1A 3QDRB 4IKFA 4HT9A 2FL7A 4OB3B 1VQ9T 1RI9A 3H0IA 3M5AA 5IAYA 2JS2A 4KUIA 2KNBB 1KG1A 3CCMT 1C6VX 2IVWA 1PC0A 2HL5C 2DBKA 1YITQ 1Q95G 1T3LA 4M78C 1HXDA 3ASKA 3H9NA 1ZSZA 4E7KA 4BY6B 1K73R 1VQ6T 5GANh 2CDTA 1IXDA 5GAOn 4O5VA 4BI3A 3CMEQ 4A53A 5J39A 1M1KC 4XTWA 1EIFA 3I56Q 3PMTA 1JJ2A 4AMCA 1QVGA 4KT0E 2K4YA 2EYZA 1YITT 1QLYA 2QAZA 2MWOA 2ESWA 3J81E 1ZUUA 2EGCA 5LJ3e 2FPEA 4OGEA 2QA4T 5CCAA 3CMET 3RBBB 4OMPA 3VS3A 1OULA 2DIQA 2OAWA 2G3RA 3RMQA 4ZN1A 2RNAA 5GAOq 3MP6A 1PSFA 2MAMA 1VQNA 3OW2P 3CQTA 3RESA 4DBQA 5KYUB 3LW5E 2CS7A 2XKOC 3CBOA 3CXCA 3I5RA 1PKSA 4NOYA 2DF6A 2F1LA 3PE0A 2M9UA 2D8HA 1VQ5Q 1D3BB 1M1GA 4AFZC 1WIEA 3V7CA 2E70A 3JCMe 4M7DG 3J7AF 2DILA 4HVUA 2DLPA 5GAN3 2R58A 1M90R 2DZ9A 4EMKA 4BI4A 1M1KU 2BZ8A 3MEWA 1JBMA 3A5ZB 4M7AD 5FU6B 4PJOF 1KK7A 3D7SB 4J7FA 2QTXA 3EHQA 4QQDA 1Y96B 1VQ5T 2LQWA 2L2PA 2VGNA 2D0NA 2RK2A 1VYVA 4PFPA 2O2OA 4M7DB 5CKDA 1VQKQ 2EJGA 3PNWC 3RIRA 2EYXA 3CCRT 2A08A 2E10A 4FU6A 4HKEA 4J6YA 1P92A 2BE7D 3V8JA 2MI6A 2WSEE 4II1A 5CR2A 4JRKA 3O8VA 1N8RC 2VXFA 2CKKA 2A0FB 1VQKT 2I2LA 2JJ9A 3R6NA 2Y4XA 1TUGB 2GNCA 5GANg 1C0MA 1AWWA 2ROLA 3JB9F 2IG0A 2QQBA 2DK3A 3FC3A 4J9BA 3MEAA 1CKBA 5GANd 4E6RA 2QGGA 2YRVA 1NEBA 1T3SA 5HK3A 1VQ8A 5IXBA 2L5QA 3KFVA 1VQPA 2ZPGB 1D1BA 3OA6A 1HK9A 1AHJB 4HA8A 3SWNB 2E65A 5GAOr 2SEMA 2HKNA 1BIBA 4IUQA 2KQWA 1M1FA 3EFRA 3ME9A 2AHJB 2YUNA 2RF0A 4M77D 4M78F 2LQ8A 4HVWA 1YI2T 2F69A 3OYCA 1QMCA 3PVQA 3CCJQ 2R5AA 1SG5A 4FM4B 5CAIA 4M7DE 1JB0E 3URGA 2KRNA 2E64A 5HK0A 3CCUT 1YITA 4RCBA 1N8RU 2GTJA 5GMKj 2VWFA 3M0UA 4J9FA 1X27A 2DMOA 3OYNA 4IIOA 2B8AA 1W6XA 3H6ZA 1AOJA 1ZLMA 2MK5A 3UA6A 2M0OA 1NYGA 2DERA 1WX6A 1UGPB 4M7AA 4BUGA 1QVFP 4PJOG 3I56A 1YJNQ 4HVVA 2BKDN 3KBGA 1YWOA 3OS5A 4JZ3A 3CC4Q 2XHCA 2BTTA 3HRTA 3QYGB 3JB9I 4DEYA 4A4FA 3OMCA 1ZA2B 2QI2A 1RL2A 3HFOA 3SFMA 1LNXA 2PUKB 4M75E 4FYVB 4JRPA 2O88A 4E7HA 1TUCA 2DJZA 4BY6C 4QW2A 1IB8A 1OEBA 1Q86R 1YJNT 1KFZA 4PJOB 2AK5A 2MF2A 2P84A 3PGGA 3MKDA 1YIJT 3CC4T 2QQRA 5L8RE 5A0LA 2J7IA 2FRYA 2KDSA 2K6DA 1IZ6A 5GANj 5KCHA 3QIIA 1TSFA 2KI7A 5KH6A 3QXEB 2OAUA 3EG9A 1N5ZA 3TSZA 3JCMQ 4C0GA 3SHWA 3QZ9B 1JJ2P 3O5ZA 4XTXA 4C0DB 1SSHA 1QVGP 3JB9G 1VQ5A 1GCQA 1K73C 2CYZB 4OMOA 4Z02A 1PNJA 4RTVA 2A28A 2GTOA 4C92B 1OV3A 2GFUA 2LDMA 1ACMB 3RMSA 1JEGA 1I1JA 1X6GA 4C5EA 2QG9B 2M02A 2OX7A 1S1NA 4QVDA 2GQIA 2DX1A 1I8FA 2NUTA 1GFCA 5A0GA 2XK0A 1JRIA 3EG0A 3CD6Q 2V1RA 4OMMA 4M77A 4M78G 3CXCP 1NLPC 2PQWA 4X9DA 4F7UF 4ZTJA 1M1KR 3A8GB 1AEYA 2RHYA 5I11A 3RDVA 2OTJT 1D1AA 2BIVA 2FZKB 4Z89A 2E5QA 4PJOE 3RKYA 1MMDA 1ZBJA 4C5IA 2L3QA 3OBYA 1KSWA 2JW4A 3OSVA 4KGZB 7AT1B 4AG1C 1GXIE 2LMJA 1E7OA 5GAOl 1OI1A 3RUXA 1B34B 1K73U 4JJBA 2RQTA 1FXXA 2EIFA 4LN2A 1UGSB 1X6OA 2K7AA 1M90C 3X24B 3CPWA 2DFUA 4N4GA 3OYMA 3EFSA 4OP0A 3FDRA 5IH2A 1ZHIA 3OQ5A 2LX9A 2QXFA 3C4SA 1BB9A 4C0FA 1QKXA 1YN8A 4JPBW 1FMVA 2M51A 4EMKC 1I4K1 3VUBA 2DYIA 4ATOA 2KXCA 4BE0A 4RG8A 4EIKA 1VUBA 1X43A 2FB7A 1R0CB 2DO3A 4ZN3A 4A4EA 1BIAA 1UHFA 2CREA 1N9SA 5GJWB 3CCJA 3HFNA 3ER0A 4TVRA 1NE8A 3Q1JA 5L23A 2FEIA 1M2VB 1Y07A 1UGVA 2COZA 1NEGA 1G83A 4FSSA 4J6XA 4E47A 2YUOA 1ZQ1A 4PLLA 1YHQQ 1VQ4Q 3E2UA 3ULRB 5LJ5h 4RTWA 1W2BA 3VJPA 2HSPA 1YJNA 3LYIA 2DL5A 2E4HA 2AZVA 1R77A 2RJDA 4ESRA 1M90U 1RAFB 2XG8D 2ZGWA 2C06A 2DZCA 3CC4A 1NYFA 3H41A 4M78E 3QHSA 1D09B 5CKEA 2EKHA 1RAHB 2MCNA 1RUWA 3LH5A 3EAEA 1NPPA 1YHQT 1VIFA 1ABQA 1VQ4T 4RG2A 2NUZA 1NJIR 2FPDA 4JRQA 1KQSA 4F7UG 2Y90A 3X28B 4E7SA 3LLRA 3QZ5B 3KXTA 1EX4A 4JLIA 5KCOA 5C6SA 2EW3A 4KBMB 2O31A 1KHCA 1UGRB 1KC8R 4DOWA 3E1SA 4KH0B 3TREA 2CP0A 2KGTA 1D1CA 1QKWA 2FO0A 2ZPIB 4A63B 4LD9K 4F7UB 3OYJA 2RMOA 5CQYA 4FSXA 4N0AC 3BW1A 3OY9A 1K0SA 3EG3A 3OYIA 3H8ZA 2EVRA 3VYHB 2X51A 3TCJA 2MIOA 2LNVA 1GBRA 3FLGA 2HMAA 2V8IA 5I21A 1HJDA 2WSFE 5GANe 2C0IA 3HKSA 1BI1A 2XI9A 3MEUA 1KQ2A 2OTLQ 1IREB 2L8DA 3CCLQ 4DQ2A 1YCSB 4AT1B 2ENMA 2YSQA 3CD6A 3A8LB 3I55A 5GAN7 2YT6A 1Q86C 3GP8A 1PRLC 1TOVA 3AT1B 4C92C 5KE3A 2VKNA 2RI5A 3VS5A 1VQ7Q 3VS1A 2LRQA 4FT2A 4CC3A 1OZ3A 3EGXB 2OTLT 8ATCB 4Y91A 1G5VA 4M7DD 4PLIA 4QVCA 1UHCA 3DLMA 1AZEA 2VC8A 3KUFA 2ABLA 3L2QA 2KVQG 2RPNA 1H3ZA 1VQPQ 3I9QA 2K5LA 3RNJA 3OS1A 3OYDA 1QVFA 3A8MB 2YUQA 2VUBA 5LJ5g 3SB2A 2EFIA 4XTUA 1OPKA 2HBPA 2PU9B 4MDXA 4MZTA 2V8KA 5D7UA 3PMIA 4A4HA 5LJ5d 2VGMA 1VQ8T 1AZGB 4F7UE 2RM4A 1VQPT 2NUPB 3UATA 2LP5A 3TSWA 1WJSA 4QQ6A 2BZXA 3DB4A 6AT1B 2X4YA 4M75D 3SDZA 4CC7A 1M5Q1 4Z8AA 3JCMc 3OYBA 5DLQE 1PWTA 2E6ZA 2KT1A 5GAMh 1Q86U 2FZGB 2J05A 2YRCA 3G4SQ 2XD0A 5A2QE 2RHIA 3RR6A 2HBWA 1TUDA 3PIOA 4M77C 3DLLA 2M16A 4BI8B 1VQOQ 1TU0B 3CPWP 5KYWA 2C0OA 1YHQA 1VQ4A 3HPWA 4OMFB 1SEMA 3G4ST 4MZPA 1WZOA 4ME7A 3I56T 1X2QA 4NS5A 3EHRA 1OYXA 1ZSZB 4RTYA 3FRNA 3LGFA 2RO0A 2AT1B 1BBZA 3NTKA 4ZGDB 2FVUA 2VVKA 4E7LA 3C0CA 2LTOA 1M9SA 4OF1A 1XQHA 1WHLA 2DVJA 1RADB 3A98A 2EJ9A 1Z9QA 4PL6A 4M7DA 1MHNA 2MWPA 4HXJA 2R5MA 3OYEA 5LJ5j 1FWZA 1G3WA 1N6AA 4WCIA 3CCSQ 1W2BP 3VYGA 4PJOD 1WHMA 3GNFB 1SF9A 1U5SA 2YLBA 1ZUYA 4RTZA 2HD0A 4C8QA 3MO8A 2QGFB 3M0QA 2LCSA 1UTIA 3VS7A 3CCST 1WHGA 1W1FA 1KQSP 2DNUA 2QTVA 4AFUC 4C92F 4M75A 3FJPA 5GAOp 3QYHB 5D6WA 2OTLA 1GCPA 2W0ZA 1G2BA 2A3LA 3CCLA 4EMKB 1NJIC 4L59A 5LJ3h 5GAMg 5IN1A 3SWNA 3JCMP 1VQ7A 2PVDB 2VYTA 1UDLA 3CBPA 1KC8C 2K5IA 4LDXA 5GAMd 4JRIA 3H0HA 1VQMQ 1K9MR 1WDXA 2LJ3A 3A8OB 3UA7A 3CCQQ 4LUEA 1S72Q 2X3WD 2EYQA 1RABB 3M9QA 3I35A 1M3BA 3M54A 2ECZA 2H3EB 2O4XB 5CVIA 4FCYA 5AYFA 3V7SA 2QDLA 1OU9A 4J7IA 3CCQT 1S72T 2GFAA 4M78D 2D0QB 4JDSA 1U8RA 4ZTFA 1IGUA 1A0NB 1G8XA 1MNEA 1M2OA 2XICA 1RI0A 2HNIA 1OX9A 2VB6A 4HCZA 2RQUA 5FU7C 2F2VA 2LJ1A 2HCKA 1WYXA 4KULA 2FZCB 3E9FA 4M77F 1QWFA 4QKUA 1KD1R 1NJIU 4DA4A 2EYYA 3JSCA 1G3YA 4BDYA 4N4IA 3TVTA 2DE0X 3G4SA 3CCJT 1KC8U 3LH0A 2DAQA 3VV0A 3G7ZA 1U1TA 1UEBA 1VQOA 4EMGA 2DVEA 3HTRA 1LPLA 4DOVA 4GLKA 1Q81C 3I5SA 3THKA 1MUZA 1MGQA 2YRDA 1VIEA 1XTDA 4RUGA 1MMGA 4OMNA 4B6MA 2HAXA 4NL3A 2LQKA 2QDYB 4DEXA 4C92G 1BU1A 2CZ7B 2AKKA 2M1HA 2RHUA 3UF4A 5IHKA 4ZNXA 1CSKA 4A54A 2CZ0B 5GAMj 3HSBA 1FYNA 4M7AB 2EGEA 1TG0A 1WHKA 2X4WA 3JB9J 5LJ3g 3P8BB 4LXCA 4IUVA 3UWNA 1V76A 3QSUA 2K2VA 2RN8A 4XQ3A 4OMLA 5LJ3d 4GLMA 1ZSZC 3CCSA 1M30A 3L2RA 3PFSA 2F2WA 2P0PA 3QG1A 3NHNA 5IXFA 2KRMA 1WHHA 2PVGB 2LCCA 1T0HA 4BDZA 1M3AA 3P8HA 3OYAA 1Q81U 2F2XA 3JCMX 1QQJA 2J06A 3I55Q 2RQWA 1H641 2D8JA 1YNZA 4AG2C 4M78A 1W4SA 3QKJA 3GF5A 4E7JA 3OW2S 1B34A 2EAYA 1Y7XA 2RD1A 2ZZDA 1X75C 4FT4A 3ZFJA 2HL3A 4M77G 5GAN5 1YJ9Q 3CD6T 5KYNA 1WXTA 1WPYA 5GAOm 3I55T 4HT8A 1LJOA 2R57A 4ELZC 1PG5B 2HQXA 2M0YA 4F16A 2L3RA 3QDFA 3M53A 2JNGA 5D6YA 4YTLA 1GBQA 3IQLA 2NUTB 1I07A 1VQMA 2PTKA 2FPFA 3BDLA 4M77B 3M0RA 4QVZA 2KK4A 4J6WA 4X34A 3CCQA 2C0TA 2DL4A 2MOXA 1S72A 1U1SA 4X9CA 4B9WA 5C0MA 2JZ2A 4C0ZA 4C92E 2DEQA 2EQJA 2G6FX 2KR3A 1YJWQ 3EFOA 5J26A 3OYKA 1JO8A 4EMHA 2RI2A 3MJXA 3QPHA 4JS5A 3FJ5A 3U23A 4C8QC 1BCMA 5LJ5f 5LJ3j 2MYSA 3CPFA 2XDPA 2HKQB 2K79A 1AWOA 4RTTA 4JS4A 2CT3A 4LDUA 2V26A 2QK0A 3CCVQ 1NLOC 3QO3A 2CH4W 4M75C 4GY5A 4ZGEB 1K4US 4R0KA 3CCEQ 2YXYA 3V8LA 3TQ7P 1LOJA 1K9AA 2XDDA 1I0CA 3CMAQ 1YP5A 3CC7A 1YCYA 1K9MC 3SD4A 3G1JA 1K8AR 1BI2A 2RQVA 1M4ZA 3NGPA 1G3TA 4XTVA 1AD5A 1BI3A 3META 5GMKe 5GJVB 2DRKA 3ZBDA 1Q7YC 2JMCA 5EG2A 2HSEB 3CCET 4ORZA 2IPOB 2OJ2A 3C12A 4F7UA 1TWBA 3CMAT 3CC2A 1J3TA 4RKUE 1O9SA 2K2MA 4XU0A 1PD1A 4LUDA 1RAAB 1IHVA 2LVMA 1O75A 2EKOA 2HZYA 4LD6A 2JVVA 2JN0A 1UB4A 5A0DA 2EPDA 2XDBA 1EZZB 3LX7A 2CP5A 3CEYA 2RJEA 2BE9B 4FW2A 2EGAA 5IT9E 1KD1C 2KROA 3NPFA 2VXEA 4FIBA 2DRMA 3M55A 5CKFA 5KYXA 1PD0A 5IHIA 2AZSA 1UGQB 2D9TA 1QVFS 4A4GA 1SRMA 3HRUA 5GAN8 1ZBXA 1YFNA 3RKXA 3L2ZA 2J6OA 5FROA 1K9MU 4XTYA 1WXUA 4OGCA 3G71Q 1Q82C 4M7AC 1QWEA 1RACB 3RERA 2EQUA 2F5TX 3EGDA 2A7YA 4J9IA 3VS4A 4J9HA 3FEOA 1DJ7B 3TU4K 1Q7YU 2V8JA 3V8KA 2AIRB 2H8HA 4PNOA 2EQKA 3BE3A 1M27C 2DETA 1QCNA 2LNHB 1CKAA 3QJYA 3M0TA 3MEVA 2EBPA 1KIKA 2E6NA 4FYXB 2DIGA 4DBRA 2IIMA 5CKHA 1PM3A 4VUBA 3OYFA 4OB1B 3CCLT 1YJ9A 2DXUA 2FHDA 5FU7B 4AFQC 1NPRA 2DL3A 2NUPA 4IUTA 1E6GA 1JJ2S 4RTXA 5I2SA 1QVGS 4RTUA 2V1QA 1Q81R 1R8OB 2H3JA 1K0XA 1KD1U 1BCOA 1VQ7T 3MP1A 9ATCB 2JUFA 1I5OB 3L1AA 2CP6A 2ROTA 2E1HA 4V2SA 3N5BB 2CP7A 3QUIA 4ZGJB 4BD3A 5GAMf 1GCQC 2E3HA 3OB9A 2PUOB 4PFZA 3QBYA 3NFCA 1VQ9Q 1WA7A 1RAEB 4C8QF 3MHXA 1Q82U 3G6EA 4J8OA 1YBYA 3LWIA 2GCXA 4O6JA 4OB0B 1YJWA 1VQ6Q 1T0JA 2EYWA 2K57A 3CXCS 3C95A 1K76A 2D6FA 4OMQA 4M75F 1D0XA 3BDUA 3RKWA 5KYYB 3JAME 1X01A 4OB2B 2RA2A 4PFOA 2KYMA 1SHFA 2L0AA 5KYUA 1AT1B 4Y92A 3GIBA 1QCFA 3CCVA 2CSQA 2QA4Q 3LWHA 3FB9A 4LDYA 2FRWA 2CZ6B 3VS6A 1HYOA 3CCEA 5HKCA 1OU8A 2EJFA 3NTIA 4GBQA 3MP8A 3HP9A 4CC4B 3CMAA 1SHGA 1D3BA 2JTMA 2K9GA 1VQOT 1PKTA 4ANJA 3ZEHA 3OYGA 5GMKm 4CC2A 2W10A 3EH2A 1NZ9A 4FYYB 3M57A 5GMKl 2DXBA 2JTFA 1SSFA 4CRIA 2DKGA 4J9DA 3BFMA 3BY7A 1Y96A 3OMGA 2RJFA 2JM9A 2YWWA 5KYWB 4BB7A 1TTHB 4AFSC 2CUDA 1RLQC 2CUBA 3V7RA 2DEUA 1UJ0A 1ZSGA 4Q5WA 1XJWB 2QEXQ 5GMKi 2YUPA 5CK9A 4DBHA 4LE9A 4LDVA 2DYBA 4NL2A 5ECAA 1Y57A 3QWYA 2DXCA 4IIMA 1NBEB 2GF7A 2L3PA 3CCRQ 4M7AF 3F70A 2PNIA 3MCAB 1M8MA 2K3YA 3OYHA 2QEXT 3JB9H 3LGLA 5LJ3f 1C1AA 2DXTA 4JJNK 1WLPB 3T9NA 4C8QG 3ZL7C 1K8AC 5AT1B 3WXMB 4XU3A 3G71A 2EQIA 3VU3C 4JUVA 4F04B 4C92D 2DJQA 3DKMA 3X20B 3P8DA 3E9GA 3M4GA 2K5FA 4WF2A 2GBQA 2HQHA 3C94A 4M75G 3JB9D 4C8QB 2O4XA 1UG1A 1KQ1A 2DTIA 3GBQA 1X2KA 2ZPEB 3REAB 2CP3A 5GAN2 2KRSA 5DY9A 5HY6A 1SRLA 4XAXB 4L6V5 2X9HA 1VA7A 1ZUKA 2CT4A 3M0PA 4HCKA 3GLXA 3JCMf 1VOMA 1UE9A 5FLXE 5I2MA 1XNIA 3AHUA 1Q7YR 2YDLA 2X3XD 4M75B 2B86A 3QJ6A 2QQ9A 3S6WA 2F5KA 5FRMA 2XIDA 4RMOA 3OYLA 1XOVA 1VQMT 1TS9A 2L89A 1U06A 1UECA 4JJDA 1YI2Q 2LT1A 3JCMh 1VQ9A 2COWA 1IRXA 2K3XA 2OI3A 1K8AU 1WJQA 1UJYA 3CCMA 4D8KA 2YLCA 3CCUQ 2QQAA 1OX8A 1BYMA 2RJCA 4IUUA 2ZAEA 3M59A 2DA9A 3NMZC 1VQ6A 3QWXX 3R6OA 1QP3A 3M58A 2L3SA 2X4XA 3J80E 1ARKA 1HD3A 4N0AA 5FW9A 2QQSA 2LCLA 2KMTA 2DL7A 1UFFA 2FG0A 1FX7A 4PJOA 3EH1A 1B07A 3VRYA 5LL6S 3CC7Q 4N4HA 2QASA 1ZA1B 3MPUB 2NWMA 2NLUA 1Q82R 1B7TA 4PJJA 2QA4A 4UC4A 2XMFA 3CMEA 4M7AG 4C8QE 2DM1A 4EDUA 1HSQA 1TXQA 1W70A 1WNLA 4P5NA 1H3HA 4QT7A 5I22A 4BE1A 1YIJQ 3CC2Q 5DM7R 3CC7T 3GNGA 2XU8A 3VS2A 4C92A 4JZ4A 4LDWA 1WGSA 2E5KA 1D0ZA 4X1VA 2AKLA 1RAIB 3PVLA 3UPUA 1PRMC 2Z0WA 3X25B 2GQVA 2HDAA 3CC2T 5D6XA 2RB6A 2WACA 1LVKA 1JU5C 2BZYA 1JXMA 1QCOA 2P4RA 4OVAA 4IURA 2VV5A 3E19A 3WVDB 1FMWA 2ED1A 2QEXA 4FW1A 1AWXA 2O9SA 1WXBA 3HRSA 3CPWS 2HQEA 1BI0A 2DTOA 4WTOB 4HCBA 1MMNA 3DB3A 3OYYA 3WVEB 1SPKA 4A4KA 3CCRA 1WQWA 2ED0A 1X69A 3EG9B 4HCCA 3S3OA 2FYKA 4KGVB 5GAN6 2KAFA 3S3NA 2P0QA
chains in the Genus database with same CATH topology
5HK3A 2LVMA 1O75A 1VQ8A 2EKOA 3PIOA 4M77C 2LT4A 3JCMg 3DLLA 2L5QA 4LD6A 1VQPA 2M16A 2RH2A 2ZPGB 2JVVA 2JN0A 4BI8B 1UB4A 2ZPHB 5A0DA 5LJ5e 3OA6A 1HK9A 1V29B 3LX7A 2XDBA 3CEYA 1AHJB 4BE2A 4HA8A 3JRZA 3M56A 3SWNB 2RJEA 2E65A 1VQKA 5GAOr 5IT9E 3JCMd 1N27A 1YHQA 1VQ4A 3FIFA 1BIBA 1KD1C 3HPWA 2KQWA 4IUQA 1M1FA 3EFRA 2VXEA 4C5HA 4OMFB 4FIBA 3VKIA 3M55A 5A2QE 5CKFA 3G4ST 4EPCA 4MZPA 4ME7A 3I56T 3ME9A 2AHJB 4M77D 4M78F 4XU2A 1UGQB 4NS5A 2D9TA 1QVFS 4A4GA 5DLOA 1OYXA 2LQ8A 1YI2T 3HRUA 2F69A 5GAN8 3OYCA 5FU6C 4M7AE 1ZBXA 2R5AA 3FRNA 3LGFA 4FM4B 5CAIA 3RKXA 4M7DE 1JB0E 2RO0A 1N9RA 3URGA 1YJ9T 3NTKA 3L2ZA 2E64A 4ZGDB 5FROA 5HK0A 3CCUT 1K9MU 1YITA 4RCBA 1W2BS 1N8RU 4XTYA 5GMKj 2FVUA 4M78B 4OGCA 3GOXA 1Q82C 3VUZA 4E7LA 3S3MA 4M7AC 3OYNA 3RERA 4M7DC 2B8AA 2EQUA 2F5TX 1M9SA 1XQHA 2LTOA 4OF1A 2A7YA 3H6ZA 3FEOA 1DJ7B 2M0OA 3TU4K 2V8JA 3V8KA 1Q7YU 2EJ9A 1UGPB 4PNOA 4MZMA 4M7AA 4BUGA 4PL6A 2EQKA 3UDCA 4PJOG 5CKBA 4M7DA 3I56A 1MHNA 2MWPA 2BKDN 2DPPB 1BKBA 3KBGA 1VQLT 3OS5A 2R5MA 3OYEA 3HL8A 3QJYA 3MEVA 5LJ5j 2XHCA 1YI2A 1FWZA 1G3WA 1N6AA 2E6NA 3HRTA 3QYGB 4FL6A 4D6WA 1KQSS 3VYGA 2DIGA 3JB9I 4PJOD 4XTZA 5CKHA 4VUBA 3OYFA 3CCLT 4OB1B 4A4FA 1YJ9A 2DXUA 3OMCA 4RCCA 3OW2A 2QI2A 3CCUA 2FHDA 5FU7B 1RL2A 3GNFB 3HFOA 4XU1A 3SFMA 1LNXA 2YLBA 3G6ET 1NPRA 2PUKB 3OSSC 4M75E 3INZA 2HD0A 4IUTA 4JRPA 4C8QA 4E7HA 3MO8A 3OBWA 3PTAA 5M9OA 2DJZA 1YJWT 5I2SA 4BY6C 1QVGS 1JJ2S 4QW2A 1YJNT 1R8OB 2H3JA 1KD1U 4PJOB 3TEEA 1VQ7T 2MF2A 3MP1A 3L2UA 3PGGA 1YIJT 3CC4T 2QQRA 5L8RE 5A0LA 2EWNA 3CCST 2KDSA 2JUFA 1IZ6A 3L1AA 3M4YA 2E1HA 5GANj 4V2SA 3N5BB 3QUIA 5KCHA 3QIIA 4ZGJB 1M8VA 4BD3A 5KH6A 5J3BA 5GAMf 3OB9A 3QXEB 2OAUA 4C92F 1WQ7A 4M75A 3FJPA 2PUOB 5GAOp 3QBYA 3QYHB 3NFCA 5D6WA 2PVOB 2OTLA 5GAN4 3JCMQ 3SWNC 4C0GA 2A3LA 4MMKA 4CI0C 4E7IA 4C8QF 3QZ9B 4EMKB 3CCVT 3CCLA 4XTXA 4C0DB 3MHXA 4J83A 3JB9G 1Q82U 3G6EA 4J8OA 1YBYA 1NJIC 1VQ5A 1K73C 4QQGA 2CYZB 3LWIA 4L59A 2GCXA 4O6JA 4Z02A 1G3SA 4OB0B 3L2WA 5LJ3h 2RHXA 5GAMg 1YJWA 4C92B 2X4JA 5IN1A 3SWNA 3JCMP 2GFUA 2K57A 3CXCS 3C95A 2LDMA 1VQ7A 2PVDB 2VYTA 2X35A 4M77E 3X26B 1OZ2A 1YIJA 2ZCFB 3CBPA 5CO7A 1KC8C 3RMSA 2K5IA 4LDXA 2D6FA 5GAMd 4JRIA 3GPLA 3JCMb 1Y71A 2O01E 1PSEA 4M75F 3BDUA 3RKWA 3A8OB 3JAME 1X01A 2DTHA 4OB2B 2RA2A 4C5EA 4XK8E 2EYQA 4QVDA 1I8FA 3M9QA 2EQMA 3GIBA 5KE2A 5A0GA 2XK0A 5CQXA 3CBMA 1JRIA 3CCVA 1VQNT 3LWHA 3FB9A 3M54A 2MMPA 4M77A 2P0KA 4M78G 4LDYA 2O4XB 5CVIA 2CZ6B 2CZ1B 2DD5A 2PQWA 5AYFA 3V7SA 4X9DA 4F7UF 3CCEA 4ZTJA 5HKCA 1S72T 2EJFA 5CIUA 3A8GB 4MMLA 2RHZA 3NTIA 4J7IA 4L5GA 3MP8A 3HP9A 3CCQT 3JCMJ 3CMAA 4MDWA 2KSSA 2RHYA 1D3BA 2GFAA 2D0QB 4JDSA 4M78D 4R56A 4ZTFA 1U8RA 2OTJT 2JTMA 2BIVA 1VQOT 2XICA 1RI0A 2HNIA 3ZEHA 2E5QA 2ZPFB 3OYGA 4PJOE 4HCZA 5GMKm 3RKYA 5GAMe 5FU7C 4Y28E 4C5IA 1NZ9A 3L42A 3OBYA 3OSVA 3M57A 4KULA 5GMKl 3E9FA 2DXBA 2JOYA 1GXIE 4M77F 2ZPBB 1OI1A 5GAOl 1NJIU 2JTFA 3RUXA 1SSFA 1B34B 4CRIA 4DA4A 2DKGA 1K73U 3BFMA 3BY7A 4PKCC 4PJOC 1FXXA 1Y96A 3OMGA 2RJFA 2EIFA 3JSCA 1G3YA 1UGSB 4BDYA 4KUDK 1X6OA 1M90C 3X24B 3CPWA 4N4IA 4N4GA 3OYMA 4BB7A 3G4SA 3EFSA 4OP0A 3FDRA 3CCJT 1ZHIA 1KC8U 3LH0A 3OQ5A 3V7RA 2LX9A 1QW1A 2DAQA 3OS2A 2QXFA 2CGHA 3VV0A 3G7ZA 1I81A 3C4SA 1U1TA 4Q5WA 4IUPA 4C0FA 2OTJA 1UEBA 3G71T 1VQOA 4EMGA 2RI3A 5GMKi 2DVEA 5CK9A 3OS0A 4LDVA 4EMKC 4NL2A 4C0DC 1I4K1 3VUBA 4DOVA 3NTHA 4GLKA 5FRNA 4ATOA 4BE0A 1Q81C 4RG8A 3L2VA 1TH7A 2DD4A 2DXCA 3A8HB 1VUBA 4B9XA 2FB7A 1QP2A 2Y4YA 1I5LA 4J5YA 2DO3A 4ZN3A 2WSCE 1MGQA 4A4EA 3PIPA 2GF7A 1VIEA 1BIAA 1XTDA 4M7AF 2HAXA 4JLGA 2P4TA 4NL3A 2LQKA 2QDYB 3F70A 5GMKh 4M7DF 3MCAB 4C92G 2K3YA 1KHIA 3OYHA 1N9SA 2CZ7B 2M1HA 2RHUA 3LGLA 5LJ3f 2QEXT 3JB9H 2E12A 3CCJA 3HFNA 3ER0A 4TVRA 1NE8A 2CZ0B 4A54A 3Q1JA 4R55A 2DXTA 5GAMj 2LC4A 4JJNK 3JCMV 3T9NA 4BACA 1VQLA 3JCMW 4C8QG 1K8AC 3WXMB 4XU3A 1Y07A 3HSBA 3G71A 4M7AB 3VU3C 2E41A 4JUVA 4C92D 4J6XA 2KY9A 2X4WA 2YHTA 3JB9J 2BUDA 3UT1A 3HHTB 4E47A 5LJ3g 1ZQ1A 3DKMA 4PLLA 1WJRA 3P8BB 4C8QD 5LJ5h 1QVPA 3X20B 3P8DA 4C5GA 3E9GA 3M4GA 3VJPA 1W2BA 2K5FA 4ELYC 4IUVA 3UWNA 3QSUA 2K2VA 4WF2A 1YJNA 3LYIA 5GANf 4XQ3A 3C94A 4M75G 5LJ3d 2RJDA 1M90U 2XG8D 2ZGWA 3PT9A 2C06A 2RK1A 2DZCA 3QDRB 3JB9D 3S3NA 3CC4A 4C8QB 2O4XA 4IKFA 4M78E 4HT9A 3QHSA 3CCSA 1KQ1A 2FL7A 5CKEA 4OB3B 3L2RA 2DTIA 3PFSA 1VQ9T 3M5AA 2ZPEB 5IAYA 4KUIA 1KG1A 2P0PA 3EAEA 3QG1A 5GAN2 3CCMT 2IVWA 5DY9A 1NPPA 5HY6A 1YHQT 1VIFA 1VQ4T 4XAXB 4L6V5 4RG2A 4M78C 1HXDA 3ASKA 4E7KA 3GLXA 3JCMf 2PVGB 4BY6B 2LCCA 4JRQA 4BDZA 5FLXE 5GANh 1KQSA 5I2MA 1VQ6T 4F7UG 1XNIA 2Y90A 3P8HA 3OYAA 1Q81U 3AHUA 3JCMX 3X28B 3LLRA 3QZ5B 4O5VA 4BI3A 5GAOn 3KXTA 4M75B 4A53A 1H641 3QJ6A 4JLIA 5KCOA 2QQ9A 3S6WA 2F5KA 5J39A 5FRMA 5C6SA 4M78A 1M1KC 1W4SA 2XIDA 3QKJA 4XTWA 4RMOA 1EIFA 1XOVA 4KBMB 3OYLA 1KHCA 1UGRB 3GF5A 4E7JA 1VQMT 3OW2S 3PMTA 4DOWA 2L89A 3E1SA 1JJ2A 1B34A 2EAYA 1Y7XA 2RD1A 4KT0E 1QVGA 2K4YA 2ZZDA 1X75C 1YITT 3TREA 4FT4A 2LT1A 2MWOA 3ZFJA 3J81E 3JCMh 1VQ9A 5LJ3e 2K3XA 4M77G 5GAN5 1K8AU 2ZPIB 1WJQA 4OGEA 3CCMA 4LD9K 3CD6T 4F7UB 2QA4T 2YLCA 2QQAA 5CCAA 1BYMA 1WPYA 5GAOm 3OYJA 3I55T 3CMET 2RJCA 4IUUA 5CQYA 4FSXA 4N0AC 3BW1A 3OY9A 3M59A 4HT8A 1LJOA 3OYIA 3H8ZA 2DIQA 2R57A 2G3RA 3RMQA 3VYHB 4ELZC 4ZN1A 1VQ6A 3R6OA 3TCJA 1QP3A 3M58A 3MP6A 5GAOq 1PSFA 2LNVA 2MAMA 1VQNA 2HQXA 3FLGA 2L3RA 2V8IA 3M53A 2X4XA 2JNGA 5I21A 3J80E 5D6YA 4YTLA 3RESA 4N0AA 2QQSA 1VQMA 2LCLA 2KMTA 3LW5E 2WSFE 5GANe 3BDLA 1FX7A 4M77B 4PJOA 2CS7A 2XKOC 2KK4A 4J6WA 4QVZA 4X34A 3CCQA 3HKSA 1S72A 3CBOA 3CXCA 1BI1A 1U1SA 2XI9A 5LL6S 4X9CA 3MEUA 4B9WA 4NOYA 5C0MA 4N4HA 1KQ2A 2JZ2A 4C0ZA 2M9UA 4C92E 1IREB 2L8DA 2NLUA 4DQ2A 3CD6A 2QA4A 4UC4A 3A8LB 1D3BB 2DEQA 3I55A 1M1GA 5GAN7 3CMEA 4M7AG 3V7CA 3GP8A 4C8QE 2EQJA 2E70A 1Q86C 4EDUA 3JCMe 4M7DG 3J7AF 4C92C 5GAN3 5KE3A 5J26A 2R58A 2RI5A 3OYKA 2DZ9A 4EMHA 1WNLA 4P5NA 4EMKA 2RI2A 4BI4A 3QPHA 4BE1A 1M1KU 3MEWA 1JBMA 3A5ZB 2LRQA 4FT2A 5DM7R 4JS5A 4C8QC 1OZ3A 3CC7T 4M7AD 5LJ5f 5LJ3j 3GNGA 5FU6B 4PJOF 4Y91A 2OTLT 2XU8A 4M7DD 4J7FA 1G5VA 4PLIA 4C92A 4QVCA 3CPFA 3DLMA 2QTXA 2XDPA 2VC8A 4QQDA 3KUFA 4LDWA 1Y96B 3L2QA 1VQ5T 2KVQG 1H3ZA 2VGNA 4JS4A 4LDUA 1WGSA 2K5LA 2RK2A 3OS1A 3OYDA 1QVFA 3A8MB 4M7DB 3UPUA 2VUBA 5CKDA 5LJ5g 3SB2A 2EFIA 2EJGA 4XTUA 3X25B 2GQVA 2HBPA 3PNWC 3QO3A 2PU9B 3RIRA 3CCRT 4MDXA 4M75C 4GY5A 3CC2T 4MZTA 2E10A 4FU6A 4HKEA 5D6XA 2RB6A 2WACA 4ZGEB 4J6YA 2V8KA 1P92A 3PMIA 4A4HA 3V8LA 5LJ5d 1LOJA 3V8JA 2VGMA 1VQ8T 4OVAA 2XDDA 2MI6A 4F7UE 2WSEE 4II1A 2RM4A 1VQPT 4IURA 5CR2A 2VV5A 3E19A 3CC7A 4JRKA 1YCYA 3O8VA 3WVDB 1K9MC 1WJSA 3SD4A 1N8RC 4QQ6A 2QEXA 1BI2A 2VXFA 1M4ZA 2CKKA 3DB4A 1VQKT 1G3TA 2I2LA 2X4YA 4XTVA 3HRSA 1BI3A 4M75D 3CPWS 3SDZA 2Y4XA 3META 2HQEA 5GANg 1BI0A 1M5Q1 2DTOA 5GMKe 3JCMc 3ZBDA 3OYBA 5DLQE 1Q7YC 4HCBA 5EG2A 3CCET 3DB3A 3OYYA 3WVEB 2E6ZA 3JB9F 2IG0A 2QQBA 5GAMh 1Q86U 2DK3A 3C12A 4A4KA 4F7UA 3FC3A 3CCRA 1WQWA 3CMAT 3MEAA 3CC2A 5GANd 4HCCA 4RKUE 1O9SA 2YRVA 4XU0A 3S3OA 2FYKA 5GAN6 2XD0A 2KAFA 2RHIA 2P0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVO B;  2DD4 A;  2DXC A;  3A8H B;  1QP2 A;  2WSC E;  3QZ9 B;  2ZPG B;  2ZPH B;  3LW5 E;  1V29 B;  2WSF E;  2CYZ B;  1AHJ B;  4OB0 B;  2QDY B;  2CZ7 B;  2PVD B;  3X26 B;  2CZ0 B;  1IRE B;  2ZCF B;  3A8L B;  2AHJ B;  2O01 E;  1PSE A;  1UGQ B;  3A8O B;  4OB2 B;  3HHT B;  4XK8 E;  4FM4 B;  1JB0 E;  3X20 B;  4ZGD B;  2CZ6 B;  2CZ1 B;  2DD5 A;  4OB3 B;  1DJ7 B;  3A8G B;  2ZPE B;  1UGP B;  3A8M B;  2D0Q B;  3X25 B;  4L6V 5;  2PU9 B;  2DPP B;  2PVG B;  2ZPF B;  4ZGE B;  3QYG B;  4Y28 E;  3X28 B;  3QZ5 B;  3VYG A;  2DXB A;  1GXI E;  2WSE E;  2ZPB B;  4OB1 B;  1UGR B;  3WVD B;  2PUK B;  4KT0 E;  1UGS B;  2ZZD A;  3X24 B;  5L8R E;  2ZPI B;  3WVE B;  4ZGJ B;  4RKU E;  3VYH B;  3QXE B;  2PUO B;  1QP3 A;  3QYH B;  1PSF A; 
#chains in the Genus database with same CATH topology
 4M4Z A;  2J6F A;  2LT4 A;  3JCM g;  4D8D A;  4FYW B;  2RH2 A;  1RLP C;  2OTJ Q;  2LZ6 B;  2ZPH B;  2ATC B;  5LJ5 e;  1V29 B;  3H0F A;  4BE2 A;  3JRZ A;  3M56 A;  5FWB A;  4J9G A;  1VQK A;  3JCM d;  4F17 A;  2HEQ A;  1N27 A;  3FIF A;  2KBT A;  3EGU A;  4C5H A;  3VKI A;  4EPC A;  2CH4 A;  2JMA A;  1MMA A;  2COY A;  4XU2 A;  1GL5 A;  5DLO A;  1VYT A;  5FU6 C;  4M7A E;  1NM7 A;  1RAG B;  2JXB A;  1N9R A;  1YJ9 T;  1VQL Q;  1W2B S;  4PJL A;  2NYS A;  4M78 B;  3GOX A;  8AT1 B;  3VUZ A;  3S3M A;  1KJW A;  1U3O A;  4M7D C;  5IHN A;  1OPL A;  1BK2 A;  3G6E Q;  2DBM A;  1M2V A;  2D1X A;  4KRT A;  1K1Z A;  1R0B G;  1D0Y A;  1H8K A;  4MZM A;  3UDC A;  2JM8 A;  5CKB A;  2RQR A;  2DPP B;  2VAS A;  1AVZ C;  1BKB A;  2KE9 A;  1VQL T;  1SKU B;  3HL8 A;  4JJC A;  1YI2 A;  4PK4 A;  4D6W A;  4J9C A;  4FL6 A;  1KQS S;  1MV0 B;  3M0S A;  4XTZ A;  3REB B;  4KH1 B;  4RCC A;  3OW2 A;  2LJ0 A;  3CCU A;  4XU1 A;  3G6E T;  3OSS C;  3INZ A;  3OBW A;  3PTA A;  5M9O A;  1YJW T;  2A36 A;  1V1C A;  2A37 A;  3TEE A;  3L2U A;  2EWN A;  2JT4 A;  3M4Y A;  1OQK A;  2JTE A;  1M8V A;  1X6B A;  5J3B A;  2QYZ A;  1WQ7 A;  3EFO B;  2PVO B;  5GAN 4;  1OOT A;  3JV3 A;  3SWN C;  1Z9Z A;  4MMK A;  4CI0 C;  4E7I A;  3CCV T;  1ZX6 A;  4J83 A;  1WFW A;  4QQG A;  1YWP A;  1G3S A;  1ABO A;  3L2W A;  2RHX A;  2LQN A;  2X4J A;  1GFD A;  2GGR A;  2I0N A;  1VQN Q;  3X26 B;  2X35 A;  1AWJ A;  4M77 E;  1OZ2 A;  1YIJ A;  2ZCF B;  5CO7 A;  3GPL A;  3JCM b;  1Y71 A;  2O01 E;  1PSE A;  1JXO A;  1N8R R;  1M3C A;  3SEM A;  2DTH A;  4DBF A;  2SRC A;  3VS0 A;  4XK8 E;  1PCX A;  4J9E A;  3VRZ A;  2EQM A;  2CSI A;  5KE2 A;  5CQX A;  3CBM A;  1MV3 A;  2E3I A;  2LX7 A;  1VQN T;  2MMP A;  2P0K A;  2J6K A;  2CZ1 B;  2DD5 A;  4LNP A;  4E2F B;  5CIU A;  4MML A;  2RHZ A;  4L5G A;  3JCM J;  4MDW A;  2KSS A;  4R56 A;  1LCK A;  2DL8 A;  5HCK A;  1F1B B;  4Z88 A;  2KXD A;  2ZPF B;  2MPX C;  1FMK A;  5GAM e;  4Y28 E;  1E6H A;  3L42 A;  1GRI A;  3EGX A;  2JOY A;  2ZPB B;  1UUE A;  1WI7 A;  4PJO C;  2KT8 A;  4PKC C;  1IGQ A;  2KEA A;  4KUD K;  5FWC A;  3EG1 A;  4K11 A;  3OS2 A;  1QW1 A;  1EFN A;  1B3Q A;  2CGH A;  1I81 A;  1JQQ A;  2OTJ A;  4IUP A;  3A1P A;  2JS0 A;  3G71 T;  5KYX B;  2RI3 A;  3OS0 A;  4C0D C;  3NTH A;  2CP2 A;  5FRN A;  3L2V A;  1TH7 A;  2DD4 A;  1PHT A;  3A8H B;  4B9X A;  2Y4Y A;  1QP2 A;  5EC7 A;  4E7Z A;  4PJN A;  1I5L A;  4J5Y A;  2WSC E;  1H92 A;  3PIP A;  4JLG A;  2P4T A;  5GMK h;  4M7D F;  1VYU A;  2KYB A;  1Y0M A;  1KHI A;  1WHJ A;  2E12 A;  3EGD B;  1VQ8 Q;  2O9V A;  3EG2 A;  4F14 A;  2LC4 A;  4R55 A;  2PZ1 A;  3JCM V;  4BAC A;  1VQL A;  3JCM W;  1NG2 A;  1IO6 A;  2E41 A;  2K3B A;  2KY9 A;  2YHT A;  2BUD A;  3UT1 A;  3HHT B;  3CCM Q;  5KYY A;  4PJM A;  1WJR A;  4C8Q D;  1QVP A;  4C5G A;  4ELY C;  1MND A;  5GAN f;  4KGX B;  3PT9 A;  1IHW A;  2RK1 A;  3QDR B;  4IKF A;  4HT9 A;  2FL7 A;  4OB3 B;  1VQ9 T;  1RI9 A;  3H0I A;  3M5A A;  5IAY A;  2JS2 A;  4KUI A;  2KNB B;  1KG1 A;  3CCM T;  1C6V X;  2IVW A;  1PC0 A;  2HL5 C;  2DBK A;  1YIT Q;  1Q95 G;  1T3L A;  4M78 C;  1HXD A;  3ASK A;  3H9N A;  1ZSZ A;  4E7K A;  4BY6 B;  1K73 R;  1VQ6 T;  5GAN h;  2CDT A;  1IXD A;  5GAO n;  4O5V A;  4BI3 A;  3CME Q;  4A53 A;  5J39 A;  1M1K C;  4XTW A;  1EIF A;  3I56 Q;  3PMT A;  1JJ2 A;  4AMC A;  1QVG A;  4KT0 E;  2K4Y A;  2EYZ A;  1YIT T;  1QLY A;  2QAZ A;  2MWO A;  2ESW A;  3J81 E;  1ZUU A;  2EGC A;  5LJ3 e;  2FPE A;  4OGE A;  2QA4 T;  5CCA A;  3CME T;  3RBB B;  4OMP A;  3VS3 A;  1OUL A;  2DIQ A;  2OAW A;  2G3R A;  3RMQ A;  4ZN1 A;  2RNA A;  5GAO q;  3MP6 A;  1PSF A;  2MAM A;  1VQN A;  3OW2 P;  3CQT A;  3RES A;  4DBQ A;  5KYU B;  3LW5 E;  2CS7 A;  2XKO C;  3CBO A;  3CXC A;  3I5R A;  1PKS A;  4NOY A;  2DF6 A;  2F1L A;  3PE0 A;  2M9U A;  2D8H A;  1VQ5 Q;  1D3B B;  1M1G A;  4AFZ C;  1WIE A;  3V7C A;  2E70 A;  3JCM e;  4M7D G;  3J7A F;  2DIL A;  4HVU A;  2DLP A;  5GAN 3;  2R58 A;  1M90 R;  2DZ9 A;  4EMK A;  4BI4 A;  1M1K U;  2BZ8 A;  3MEW A;  1JBM A;  3A5Z B;  4M7A D;  5FU6 B;  4PJO F;  1KK7 A;  3D7S B;  4J7F A;  2QTX A;  3EHQ A;  4QQD A;  1Y96 B;  1VQ5 T;  2LQW A;  2L2P A;  2VGN A;  2D0N A;  2RK2 A;  1VYV A;  4PFP A;  2O2O A;  4M7D B;  5CKD A;  1VQK Q;  2EJG A;  3PNW C;  3RIR A;  2EYX A;  3CCR T;  2A08 A;  2E10 A;  4FU6 A;  4HKE A;  4J6Y A;  1P92 A;  2BE7 D;  3V8J A;  2MI6 A;  2WSE E;  4II1 A;  5CR2 A;  4JRK A;  3O8V A;  1N8R C;  2VXF A;  2CKK A;  2A0F B;  1VQK T;  2I2L A;  2JJ9 A;  3R6N A;  2Y4X A;  1TUG B;  2GNC A;  5GAN g;  1C0M A;  1AWW A;  2ROL A;  3JB9 F;  2IG0 A;  2QQB A;  2DK3 A;  3FC3 A;  4J9B A;  3MEA A;  1CKB A;  5GAN d;  4E6R A;  2QGG A;  2YRV A;  1NEB A;  1T3S A;  5HK3 A;  1VQ8 A;  5IXB A;  2L5Q A;  3KFV A;  1VQP A;  2ZPG B;  1D1B A;  3OA6 A;  1HK9 A;  1AHJ B;  4HA8 A;  3SWN B;  2E65 A;  5GAO r;  2SEM A;  2HKN A;  1BIB A;  4IUQ A;  2KQW A;  1M1F A;  3EFR A;  3ME9 A;  2AHJ B;  2YUN A;  2RF0 A;  4M77 D;  4M78 F;  2LQ8 A;  4HVW A;  1YI2 T;  2F69 A;  3OYC A;  1QMC A;  3PVQ A;  3CCJ Q;  2R5A A;  1SG5 A;  4FM4 B;  5CAI A;  4M7D E;  1JB0 E;  3URG A;  2KRN A;  2E64 A;  5HK0 A;  3CCU T;  1YIT A;  4RCB A;  1N8R U;  2GTJ A;  5GMK j;  2VWF A;  3M0U A;  4J9F A;  1X27 A;  2DMO A;  3OYN A;  4IIO A;  2B8A A;  1W6X A;  3H6Z A;  1AOJ A;  1ZLM A;  2MK5 A;  3UA6 A;  2M0O A;  1NYG A;  2DER A;  1WX6 A;  1UGP B;  4M7A A;  4BUG A;  1QVF P;  4PJO G;  3I56 A;  1YJN Q;  4HVV A;  2BKD N;  3KBG A;  1YWO A;  3OS5 A;  4JZ3 A;  3CC4 Q;  2XHC A;  2BTT A;  3HRT A;  3QYG B;  3JB9 I;  4DEY A;  4A4F A;  3OMC A;  1ZA2 B;  2QI2 A;  1RL2 A;  3HFO A;  3SFM A;  1LNX A;  2PUK B;  4M75 E;  4FYV B;  4JRP A;  2O88 A;  4E7H A;  1TUC A;  2DJZ A;  4BY6 C;  4QW2 A;  1IB8 A;  1OEB A;  1Q86 R;  1YJN T;  1KFZ A;  4PJO B;  2AK5 A;  2MF2 A;  2P84 A;  3PGG A;  3MKD A;  1YIJ T;  3CC4 T;  2QQR A;  5L8R E;  5A0L A;  2J7I A;  2FRY A;  2KDS A;  2K6D A;  1IZ6 A;  5GAN j;  5KCH A;  3QII A;  1TSF A;  2KI7 A;  5KH6 A;  3QXE B;  2OAU A;  3EG9 A;  1N5Z A;  3TSZ A;  3JCM Q;  4C0G A;  3SHW A;  3QZ9 B;  1JJ2 P;  3O5Z A;  4XTX A;  4C0D B;  1SSH A;  1QVG P;  3JB9 G;  1VQ5 A;  1GCQ A;  1K73 C;  2CYZ B;  4OMO A;  4Z02 A;  1PNJ A;  4RTV A;  2A28 A;  2GTO A;  4C92 B;  1OV3 A;  2GFU A;  2LDM A;  1ACM B;  3RMS A;  1JEG A;  1I1J A;  1X6G A;  4C5E A;  2QG9 B;  2M02 A;  2OX7 A;  1S1N A;  4QVD A;  2GQI A;  2DX1 A;  1I8F A;  2NUT A;  1GFC A;  5A0G A;  2XK0 A;  1JRI A;  3EG0 A;  3CD6 Q;  2V1R A;  4OMM A;  4M77 A;  4M78 G;  3CXC P;  1NLP C;  2PQW A;  4X9D A;  4F7U F;  4ZTJ A;  1M1K R;  3A8G B;  1AEY A;  2RHY A;  5I11 A;  3RDV A;  2OTJ T;  1D1A A;  2BIV A;  2FZK B;  4Z89 A;  2E5Q A;  4PJO E;  3RKY A;  1MMD A;  1ZBJ A;  4C5I A;  2L3Q A;  3OBY A;  1KSW A;  2JW4 A;  3OSV A;  4KGZ B;  7AT1 B;  4AG1 C;  1GXI E;  2LMJ A;  1E7O A;  5GAO l;  1OI1 A;  3RUX A;  1B34 B;  1K73 U;  4JJB A;  2RQT A;  1FXX A;  2EIF A;  4LN2 A;  1UGS B;  1X6O A;  2K7A A;  1M90 C;  3X24 B;  3CPW A;  2DFU A;  4N4G A;  3OYM A;  3EFS A;  4OP0 A;  3FDR A;  5IH2 A;  1ZHI A;  3OQ5 A;  2LX9 A;  2QXF A;  3C4S A;  1BB9 A;  4C0F A;  1QKX A;  1YN8 A;  4JPB W;  1FMV A;  2M51 A;  4EMK C;  1I4K 1;  3VUB A;  2DYI A;  4ATO A;  2KXC A;  4BE0 A;  4RG8 A;  4EIK A;  1VUB A;  1X43 A;  2FB7 A;  1R0C B;  2DO3 A;  4ZN3 A;  4A4E A;  1BIA A;  1UHF A;  2CRE A;  1N9S A;  5GJW B;  3CCJ A;  3HFN A;  3ER0 A;  4TVR A;  1NE8 A;  3Q1J A;  5L23 A;  2FEI A;  1M2V B;  1Y07 A;  1UGV A;  2COZ A;  1NEG A;  1G83 A;  4FSS A;  4J6X A;  4E47 A;  2YUO A;  1ZQ1 A;  4PLL A;  1YHQ Q;  1VQ4 Q;  3E2U A;  3ULR B;  5LJ5 h;  4RTW A;  1W2B A;  3VJP A;  2HSP A;  1YJN A;  3LYI A;  2DL5 A;  2E4H A;  2AZV A;  1R77 A;  2RJD A;  4ESR A;  1M90 U;  1RAF B;  2XG8 D;  2ZGW A;  2C06 A;  2DZC A;  3CC4 A;  1NYF A;  3H41 A;  4M78 E;  3QHS A;  1D09 B;  5CKE A;  2EKH A;  1RAH B;  2MCN A;  1RUW A;  3LH5 A;  3EAE A;  1NPP A;  1YHQ T;  1VIF A;  1ABQ A;  1VQ4 T;  4RG2 A;  2NUZ A;  1NJI R;  2FPD A;  4JRQ A;  1KQS A;  4F7U G;  2Y90 A;  3X28 B;  4E7S A;  3LLR A;  3QZ5 B;  3KXT A;  1EX4 A;  4JLI A;  5KCO A;  5C6S A;  2EW3 A;  4KBM B;  2O31 A;  1KHC A;  1UGR B;  1KC8 R;  4DOW A;  3E1S A;  4KH0 B;  3TRE A;  2CP0 A;  2KGT A;  1D1C A;  1QKW A;  2FO0 A;  2ZPI B;  4A63 B;  4LD9 K;  4F7U B;  3OYJ A;  2RMO A;  5CQY A;  4FSX A;  4N0A C;  3BW1 A;  3OY9 A;  1K0S A;  3EG3 A;  3OYI A;  3H8Z A;  2EVR A;  3VYH B;  2X51 A;  3TCJ A;  2MIO A;  2LNV A;  1GBR A;  3FLG A;  2HMA A;  2V8I A;  5I21 A;  1HJD A;  2WSF E;  5GAN e;  2C0I A;  3HKS A;  1BI1 A;  2XI9 A;  3MEU A;  1KQ2 A;  2OTL Q;  1IRE B;  2L8D A;  3CCL Q;  4DQ2 A;  1YCS B;  4AT1 B;  2ENM A;  2YSQ A;  3CD6 A;  3A8L B;  3I55 A;  5GAN 7;  2YT6 A;  1Q86 C;  3GP8 A;  1PRL C;  1TOV A;  3AT1 B;  4C92 C;  5KE3 A;  2VKN A;  2RI5 A;  3VS5 A;  1VQ7 Q;  3VS1 A;  2LRQ A;  4FT2 A;  4CC3 A;  1OZ3 A;  3EGX B;  2OTL T;  8ATC B;  4Y91 A;  1G5V A;  4M7D D;  4PLI A;  4QVC A;  1UHC A;  3DLM A;  1AZE A;  2VC8 A;  3KUF A;  2ABL A;  3L2Q A;  2KVQ G;  2RPN A;  1H3Z A;  1VQP Q;  3I9Q A;  2K5L A;  3RNJ A;  3OS1 A;  3OYD A;  1QVF A;  3A8M B;  2YUQ A;  2VUB A;  5LJ5 g;  3SB2 A;  2EFI A;  4XTU A;  1OPK A;  2HBP A;  2PU9 B;  4MDX A;  4MZT A;  2V8K A;  5D7U A;  3PMI A;  4A4H A;  5LJ5 d;  2VGM A;  1VQ8 T;  1AZG B;  4F7U E;  2RM4 A;  1VQP T;  2NUP B;  3UAT A;  2LP5 A;  3TSW A;  1WJS A;  4QQ6 A;  2BZX A;  3DB4 A;  6AT1 B;  2X4Y A;  4M75 D;  3SDZ A;  4CC7 A;  1M5Q 1;  4Z8A A;  3JCM c;  3OYB A;  5DLQ E;  1PWT A;  2E6Z A;  2KT1 A;  5GAM h;  1Q86 U;  2FZG B;  2J05 A;  2YRC A;  3G4S Q;  2XD0 A;  5A2Q E;  2RHI A;  3RR6 A;  2HBW A;  1TUD A;  3PIO A;  4M77 C;  3DLL A;  2M16 A;  4BI8 B;  1VQO Q;  1TU0 B;  3CPW P;  5KYW A;  2C0O A;  1YHQ A;  1VQ4 A;  3HPW A;  4OMF B;  1SEM A;  3G4S T;  4MZP A;  1WZO A;  4ME7 A;  3I56 T;  1X2Q A;  4NS5 A;  3EHR A;  1OYX A;  1ZSZ B;  4RTY A;  3FRN A;  3LGF A;  2RO0 A;  2AT1 B;  1BBZ A;  3NTK A;  4ZGD B;  2FVU A;  2VVK A;  4E7L A;  3C0C A;  2LTO A;  1M9S A;  4OF1 A;  1XQH A;  1WHL A;  2DVJ A;  1RAD B;  3A98 A;  2EJ9 A;  1Z9Q A;  4PL6 A;  4M7D A;  1MHN A;  2MWP A;  4HXJ A;  2R5M A;  3OYE A;  5LJ5 j;  1FWZ A;  1G3W A;  1N6A A;  4WCI A;  3CCS Q;  1W2B P;  3VYG A;  4PJO D;  1WHM A;  3GNF B;  1SF9 A;  1U5S A;  2YLB A;  1ZUY A;  4RTZ A;  2HD0 A;  4C8Q A;  3MO8 A;  2QGF B;  3M0Q A;  2LCS A;  1UTI A;  3VS7 A;  3CCS T;  1WHG A;  1W1F A;  1KQS P;  2DNU A;  2QTV A;  4AFU C;  4C92 F;  4M75 A;  3FJP A;  5GAO p;  3QYH B;  5D6W A;  2OTL A;  1GCP A;  2W0Z A;  1G2B A;  2A3L A;  3CCL A;  4EMK B;  1NJI C;  4L59 A;  5LJ3 h;  5GAM g;  5IN1 A;  3SWN A;  3JCM P;  1VQ7 A;  2PVD B;  2VYT A;  1UDL A;  3CBP A;  1KC8 C;  2K5I A;  4LDX A;  5GAM d;  4JRI A;  3H0H A;  1VQM Q;  1K9M R;  1WDX A;  2LJ3 A;  3A8O B;  3UA7 A;  3CCQ Q;  4LUE A;  1S72 Q;  2X3W D;  2EYQ A;  1RAB B;  3M9Q A;  3I35 A;  1M3B A;  3M54 A;  2ECZ A;  2H3E B;  2O4X B;  5CVI A;  4FCY A;  5AYF A;  3V7S A;  2QDL A;  1OU9 A;  4J7I A;  3CCQ T;  1S72 T;  2GFA A;  4M78 D;  2D0Q B;  4JDS A;  1U8R A;  4ZTF A;  1IGU A;  1A0N B;  1G8X A;  1MNE A;  1M2O A;  2XIC A;  1RI0 A;  2HNI A;  1OX9 A;  2VB6 A;  4HCZ A;  2RQU A;  5FU7 C;  2F2V A;  2LJ1 A;  2HCK A;  1WYX A;  4KUL A;  2FZC B;  3E9F A;  4M77 F;  1QWF A;  4QKU A;  1KD1 R;  1NJI U;  4DA4 A;  2EYY A;  3JSC A;  1G3Y A;  4BDY A;  4N4I A;  3TVT A;  2DE0 X;  3G4S A;  3CCJ T;  1KC8 U;  3LH0 A;  2DAQ A;  3VV0 A;  3G7Z A;  1U1T A;  1UEB A;  1VQO A;  4EMG A;  2DVE A;  3HTR A;  1LPL A;  4DOV A;  4GLK A;  1Q81 C;  3I5S A;  3THK A;  1MUZ A;  1MGQ A;  2YRD A;  1VIE A;  1XTD A;  4RUG A;  1MMG A;  4OMN A;  4B6M A;  2HAX A;  4NL3 A;  2LQK A;  2QDY B;  4DEX A;  4C92 G;  1BU1 A;  2CZ7 B;  2AKK A;  2M1H A;  2RHU A;  3UF4 A;  5IHK A;  4ZNX A;  1CSK A;  4A54 A;  2CZ0 B;  5GAM j;  3HSB A;  1FYN A;  4M7A B;  2EGE A;  1TG0 A;  1WHK A;  2X4W A;  3JB9 J;  5LJ3 g;  3P8B B;  4LXC A;  4IUV A;  3UWN A;  1V76 A;  3QSU A;  2K2V A;  2RN8 A;  4XQ3 A;  4OML A;  5LJ3 d;  4GLM A;  1ZSZ C;  3CCS A;  1M30 A;  3L2R A;  3PFS A;  2F2W A;  2P0P A;  3QG1 A;  3NHN A;  5IXF A;  2KRM A;  1WHH A;  2PVG B;  2LCC A;  1T0H A;  4BDZ A;  1M3A A;  3P8H A;  3OYA A;  1Q81 U;  2F2X A;  3JCM X;  1QQJ A;  2J06 A;  3I55 Q;  2RQW A;  1H64 1;  2D8J A;  1YNZ A;  4AG2 C;  4M78 A;  1W4S A;  3QKJ A;  3GF5 A;  4E7J A;  3OW2 S;  1B34 A;  2EAY A;  1Y7X A;  2RD1 A;  2ZZD A;  1X75 C;  4FT4 A;  3ZFJ A;  2HL3 A;  4M77 G;  5GAN 5;  1YJ9 Q;  3CD6 T;  5KYN A;  1WXT A;  1WPY A;  5GAO m;  3I55 T;  4HT8 A;  1LJO A;  2R57 A;  4ELZ C;  1PG5 B;  2HQX A;  2M0Y A;  4F16 A;  2L3R A;  3QDF A;  3M53 A;  2JNG A;  5D6Y A;  4YTL A;  1GBQ A;  3IQL A;  2NUT B;  1I07 A;  1VQM A;  2PTK A;  2FPF A;  3BDL A;  4M77 B;  3M0R A;  4QVZ A;  2KK4 A;  4J6W A;  4X34 A;  3CCQ A;  2C0T A;  2DL4 A;  2MOX A;  1S72 A;  1U1S A;  4X9C A;  4B9W A;  5C0M A;  2JZ2 A;  4C0Z A;  4C92 E;  2DEQ A;  2EQJ A;  2G6F X;  2KR3 A;  1YJW Q;  3EFO A;  5J26 A;  3OYK A;  1JO8 A;  4EMH A;  2RI2 A;  3MJX A;  3QPH A;  4JS5 A;  3FJ5 A;  3U23 A;  4C8Q C;  1BCM A;  5LJ5 f;  5LJ3 j;  2MYS A;  3CPF A;  2XDP A;  2HKQ B;  2K79 A;  1AWO A;  4RTT A;  4JS4 A;  2CT3 A;  4LDU A;  2V26 A;  2QK0 A;  3CCV Q;  1NLO C;  3QO3 A;  2CH4 W;  4M75 C;  4GY5 A;  4ZGE B;  1K4U S;  4R0K A;  3CCE Q;  2YXY A;  3V8L A;  3TQ7 P;  1LOJ A;  1K9A A;  2XDD A;  1I0C A;  3CMA Q;  1YP5 A;  3CC7 A;  1YCY A;  1K9M C;  3SD4 A;  3G1J A;  1K8A R;  1BI2 A;  2RQV A;  1M4Z A;  3NGP A;  1G3T A;  4XTV A;  1AD5 A;  1BI3 A;  3MET A;  5GMK e;  5GJV B;  2DRK A;  3ZBD A;  1Q7Y C;  2JMC A;  5EG2 A;  2HSE B;  3CCE T;  4ORZ A;  2IPO B;  2OJ2 A;  3C12 A;  4F7U A;  1TWB A;  3CMA T;  3CC2 A;  1J3T A;  4RKU E;  1O9S A;  2K2M A;  4XU0 A;  1PD1 A;  4LUD A;  1RAA B;  1IHV A;  2LVM A;  1O75 A;  2EKO A;  2HZY A;  4LD6 A;  2JVV A;  2JN0 A;  1UB4 A;  5A0D A;  2EPD A;  2XDB A;  1EZZ B;  3LX7 A;  2CP5 A;  3CEY A;  2RJE A;  2BE9 B;  4FW2 A;  2EGA A;  5IT9 E;  1KD1 C;  2KRO A;  3NPF A;  2VXE A;  4FIB A;  2DRM A;  3M55 A;  5CKF A;  5KYX A;  1PD0 A;  5IHI A;  2AZS A;  1UGQ B;  2D9T A;  1QVF S;  4A4G A;  1SRM A;  3HRU A;  5GAN 8;  1ZBX A;  1YFN A;  3RKX A;  3L2Z A;  2J6O A;  5FRO A;  1K9M U;  4XTY A;  1WXU A;  4OGC A;  3G71 Q;  1Q82 C;  4M7A C;  1QWE A;  1RAC B;  3RER A;  2EQU A;  2F5T X;  3EGD A;  2A7Y A;  4J9I A;  3VS4 A;  4J9H A;  3FEO A;  1DJ7 B;  3TU4 K;  1Q7Y U;  2V8J A;  3V8K A;  2AIR B;  2H8H A;  4PNO A;  2EQK A;  3BE3 A;  1M27 C;  2DET A;  1QCN A;  2LNH B;  1CKA A;  3QJY A;  3M0T A;  3MEV A;  2EBP A;  1KIK A;  2E6N A;  4FYX B;  2DIG A;  4DBR A;  2IIM A;  5CKH A;  1PM3 A;  4VUB A;  3OYF A;  4OB1 B;  3CCL T;  1YJ9 A;  2DXU A;  2FHD A;  5FU7 B;  4AFQ C;  1NPR A;  2DL3 A;  2NUP A;  4IUT A;  1E6G A;  1JJ2 S;  4RTX A;  5I2S A;  1QVG S;  4RTU A;  2V1Q A;  1Q81 R;  1R8O B;  2H3J A;  1K0X A;  1KD1 U;  1BCO A;  1VQ7 T;  3MP1 A;  9ATC B;  2JUF A;  1I5O B;  3L1A A;  2CP6 A;  2ROT A;  2E1H A;  4V2S A;  3N5B B;  2CP7 A;  3QUI A;  4ZGJ B;  4BD3 A;  5GAM f;  1GCQ C;  2E3H A;  3OB9 A;  2PUO B;  4PFZ A;  3QBY A;  3NFC A;  1VQ9 Q;  1WA7 A;  1RAE B;  4C8Q F;  3MHX A;  1Q82 U;  3G6E A;  4J8O A;  1YBY A;  3LWI A;  2GCX A;  4O6J A;  4OB0 B;  1YJW A;  1VQ6 Q;  1T0J A;  2EYW A;  2K57 A;  3CXC S;  3C95 A;  1K76 A;  2D6F A;  4OMQ A;  4M75 F;  1D0X A;  3BDU A;  3RKW A;  5KYY B;  3JAM E;  1X01 A;  4OB2 B;  2RA2 A;  4PFO A;  2KYM A;  1SHF A;  2L0A A;  5KYU A;  1AT1 B;  4Y92 A;  3GIB A;  1QCF A;  3CCV A;  2CSQ A;  2QA4 Q;  3LWH A;  3FB9 A;  4LDY A;  2FRW A;  2CZ6 B;  3VS6 A;  1HYO A;  3CCE A;  5HKC A;  1OU8 A;  2EJF A;  3NTI A;  4GBQ A;  3MP8 A;  3HP9 A;  4CC4 B;  3CMA A;  1SHG A;  1D3B A;  2JTM A;  2K9G A;  1VQO T;  1PKT A;  4ANJ A;  3ZEH A;  3OYG A;  5GMK m;  4CC2 A;  2W10 A;  3EH2 A;  1NZ9 A;  4FYY B;  3M57 A;  5GMK l;  2DXB A;  2JTF A;  1SSF A;  4CRI A;  2DKG A;  4J9D A;  3BFM A;  3BY7 A;  1Y96 A;  3OMG A;  2RJF A;  2JM9 A;  2YWW A;  5KYW B;  4BB7 A;  1TTH B;  4AFS C;  2CUD A;  1RLQ C;  2CUB A;  3V7R A;  2DEU A;  1UJ0 A;  1ZSG A;  4Q5W A;  1XJW B;  2QEX Q;  5GMK i;  2YUP A;  5CK9 A;  4DBH A;  4LE9 A;  4LDV A;  2DYB A;  4NL2 A;  5ECA A;  1Y57 A;  3QWY A;  2DXC A;  4IIM A;  1NBE B;  2GF7 A;  2L3P A;  3CCR Q;  4M7A F;  3F70 A;  2PNI A;  3MCA B;  1M8M A;  2K3Y A;  3OYH A;  2QEX T;  3JB9 H;  3LGL A;  5LJ3 f;  1C1A A;  2DXT A;  4JJN K;  1WLP B;  3T9N A;  4C8Q G;  3ZL7 C;  1K8A C;  5AT1 B;  3WXM B;  4XU3 A;  3G71 A;  2EQI A;  3VU3 C;  4JUV A;  4F04 B;  4C92 D;  2DJQ A;  3DKM A;  3X20 B;  3P8D A;  3E9G A;  3M4G A;  2K5F A;  4WF2 A;  2GBQ A;  2HQH A;  3C94 A;  4M75 G;  3JB9 D;  4C8Q B;  2O4X A;  1UG1 A;  1KQ1 A;  2DTI A;  3GBQ A;  1X2K A;  2ZPE B;  3REA B;  2CP3 A;  5GAN 2;  2KRS A;  5DY9 A;  5HY6 A;  1SRL A;  4XAX B;  4L6V 5;  2X9H A;  1VA7 A;  1ZUK A;  2CT4 A;  3M0P A;  4HCK A;  3GLX A;  3JCM f;  1VOM A;  1UE9 A;  5FLX E;  5I2M A;  1XNI A;  3AHU A;  1Q7Y R;  2YDL A;  2X3X D;  4M75 B;  2B86 A;  3QJ6 A;  2QQ9 A;  3S6W A;  2F5K A;  5FRM A;  2XID A;  4RMO A;  3OYL A;  1XOV A;  1VQM T;  1TS9 A;  2L89 A;  1U06 A;  1UEC A;  4JJD A;  1YI2 Q;  2LT1 A;  3JCM h;  1VQ9 A;  2COW A;  1IRX A;  2K3X A;  2OI3 A;  1K8A U;  1WJQ A;  1UJY A;  3CCM A;  4D8K A;  2YLC A;  3CCU Q;  2QQA A;  1OX8 A;  1BYM A;  2RJC A;  4IUU A;  2ZAE A;  3M59 A;  2DA9 A;  3NMZ C;  1VQ6 A;  3QWX X;  3R6O A;  1QP3 A;  3M58 A;  2L3S A;  2X4X A;  3J80 E;  1ARK A;  1HD3 A;  4N0A A;  5FW9 A;  2QQS A;  2LCL A;  2KMT A;  2DL7 A;  1UFF A;  2FG0 A;  1FX7 A;  4PJO A;  3EH1 A;  1B07 A;  3VRY A;  5LL6 S;  3CC7 Q;  4N4H A;  2QAS A;  1ZA1 B;  3MPU B;  2NWM A;  2NLU A;  1Q82 R;  1B7T A;  4PJJ A;  2QA4 A;  4UC4 A;  2XMF A;  3CME A;  4M7A G;  4C8Q E;  2DM1 A;  4EDU A;  1HSQ A;  1TXQ A;  1W70 A;  1WNL A;  4P5N A;  1H3H A;  4QT7 A;  5I22 A;  4BE1 A;  1YIJ Q;  3CC2 Q;  5DM7 R;  3CC7 T;  3GNG A;  2XU8 A;  3VS2 A;  4C92 A;  4JZ4 A;  4LDW A;  1WGS A;  2E5K A;  1D0Z A;  4X1V A;  2AKL A;  1RAI B;  3PVL A;  3UPU A;  1PRM C;  2Z0W A;  3X25 B;  2GQV A;  2HDA A;  3CC2 T;  5D6X A;  2RB6 A;  2WAC A;  1LVK A;  1JU5 C;  2BZY A;  1JXM A;  1QCO A;  2P4R A;  4OVA A;  4IUR A;  2VV5 A;  3E19 A;  3WVD B;  1FMW A;  2ED1 A;  2QEX A;  4FW1 A;  1AWX A;  2O9S A;  1WXB A;  3HRS A;  3CPW S;  2HQE A;  1BI0 A;  2DTO A;  4WTO B;  4HCB A;  1MMN A;  3DB3 A;  3OYY A;  3WVE B;  1SPK A;  4A4K A;  3CCR A;  1WQW A;  2ED0 A;  1X69 A;  3EG9 B;  4HCC A;  3S3O A;  2FYK A;  4KGV B;  5GAN 6;  2KAF A;  3S3N A;  2P0Q A; 
#chains in the Genus database with same CATH homology
 5HK3 A;  2LVM A;  1O75 A;  1VQ8 A;  2EKO A;  3PIO A;  4M77 C;  2LT4 A;  3JCM g;  3DLL A;  2L5Q A;  4LD6 A;  1VQP A;  2M16 A;  2RH2 A;  2ZPG B;  2JVV A;  2JN0 A;  4BI8 B;  1UB4 A;  2ZPH B;  5A0D A;  5LJ5 e;  3OA6 A;  1HK9 A;  1V29 B;  3LX7 A;  2XDB A;  3CEY A;  1AHJ B;  4BE2 A;  4HA8 A;  3JRZ A;  3M56 A;  3SWN B;  2RJE A;  2E65 A;  1VQK A;  5GAO r;  5IT9 E;  3JCM d;  1N27 A;  1YHQ A;  1VQ4 A;  3FIF A;  1BIB A;  1KD1 C;  3HPW A;  2KQW A;  4IUQ A;  1M1F A;  3EFR A;  2VXE A;  4C5H A;  4OMF B;  4FIB A;  3VKI A;  3M55 A;  5A2Q E;  5CKF A;  3G4S T;  4EPC A;  4MZP A;  4ME7 A;  3I56 T;  3ME9 A;  2AHJ B;  4M77 D;  4M78 F;  4XU2 A;  1UGQ B;  4NS5 A;  2D9T A;  1QVF S;  4A4G A;  5DLO A;  1OYX A;  2LQ8 A;  1YI2 T;  3HRU A;  2F69 A;  5GAN 8;  3OYC A;  5FU6 C;  4M7A E;  1ZBX A;  2R5A A;  3FRN A;  3LGF A;  4FM4 B;  5CAI A;  3RKX A;  4M7D E;  1JB0 E;  2RO0 A;  1N9R A;  3URG A;  1YJ9 T;  3NTK A;  3L2Z A;  2E64 A;  4ZGD B;  5FRO A;  5HK0 A;  3CCU T;  1K9M U;  1YIT A;  4RCB A;  1W2B S;  1N8R U;  4XTY A;  5GMK j;  2FVU A;  4M78 B;  4OGC A;  3GOX A;  1Q82 C;  3VUZ A;  4E7L A;  3S3M A;  4M7A C;  3OYN A;  3RER A;  4M7D C;  2B8A A;  2EQU A;  2F5T X;  1M9S A;  1XQH A;  2LTO A;  4OF1 A;  2A7Y A;  3H6Z A;  3FEO A;  1DJ7 B;  2M0O A;  3TU4 K;  2V8J A;  3V8K A;  1Q7Y U;  2EJ9 A;  1UGP B;  4PNO A;  4MZM A;  4M7A A;  4BUG A;  4PL6 A;  2EQK A;  3UDC A;  4PJO G;  5CKB A;  4M7D A;  3I56 A;  1MHN A;  2MWP A;  2BKD N;  2DPP B;  1BKB A;  3KBG A;  1VQL T;  3OS5 A;  2R5M A;  3OYE A;  3HL8 A;  3QJY A;  3MEV A;  5LJ5 j;  2XHC A;  1YI2 A;  1FWZ A;  1G3W A;  1N6A A;  2E6N A;  3HRT A;  3QYG B;  4FL6 A;  4D6W A;  1KQS S;  3VYG A;  2DIG A;  3JB9 I;  4PJO D;  4XTZ A;  5CKH A;  4VUB A;  3OYF A;  3CCL T;  4OB1 B;  4A4F A;  1YJ9 A;  2DXU A;  3OMC A;  4RCC A;  3OW2 A;  2QI2 A;  3CCU A;  2FHD A;  5FU7 B;  1RL2 A;  3GNF B;  3HFO A;  4XU1 A;  3SFM A;  1LNX A;  2YLB A;  3G6E T;  1NPR A;  2PUK B;  3OSS C;  4M75 E;  3INZ A;  2HD0 A;  4IUT A;  4JRP A;  4C8Q A;  4E7H A;  3MO8 A;  3OBW A;  3PTA A;  5M9O A;  2DJZ A;  1YJW T;  5I2S A;  4BY6 C;  1QVG S;  1JJ2 S;  4QW2 A;  1YJN T;  1R8O B;  2H3J A;  1KD1 U;  4PJO B;  3TEE A;  1VQ7 T;  2MF2 A;  3MP1 A;  3L2U A;  3PGG A;  1YIJ T;  3CC4 T;  2QQR A;  5L8R E;  5A0L A;  2EWN A;  3CCS T;  2KDS A;  2JUF A;  1IZ6 A;  3L1A A;  3M4Y A;  2E1H A;  5GAN j;  4V2S A;  3N5B B;  3QUI A;  5KCH A;  3QII A;  4ZGJ B;  1M8V A;  4BD3 A;  5KH6 A;  5J3B A;  5GAM f;  3OB9 A;  3QXE B;  2OAU A;  4C92 F;  1WQ7 A;  4M75 A;  3FJP A;  2PUO B;  5GAO p;  3QBY A;  3QYH B;  3NFC A;  5D6W A;  2PVO B;  2OTL A;  5GAN 4;  3JCM Q;  3SWN C;  4C0G A;  2A3L A;  4MMK A;  4CI0 C;  4E7I A;  4C8Q F;  3QZ9 B;  4EMK B;  3CCV T;  3CCL A;  4XTX A;  4C0D B;  3MHX A;  4J83 A;  3JB9 G;  1Q82 U;  3G6E A;  4J8O A;  1YBY A;  1NJI C;  1VQ5 A;  1K73 C;  4QQG A;  2CYZ B;  3LWI A;  4L59 A;  2GCX A;  4O6J A;  4Z02 A;  1G3S A;  4OB0 B;  3L2W A;  5LJ3 h;  2RHX A;  5GAM g;  1YJW A;  4C92 B;  2X4J A;  5IN1 A;  3SWN A;  3JCM P;  2GFU A;  2K57 A;  3CXC S;  3C95 A;  2LDM A;  1VQ7 A;  2PVD B;  2VYT A;  2X35 A;  4M77 E;  3X26 B;  1OZ2 A;  1YIJ A;  2ZCF B;  3CBP A;  5CO7 A;  1KC8 C;  3RMS A;  2K5I A;  4LDX A;  2D6F A;  5GAM d;  4JRI A;  3GPL A;  3JCM b;  1Y71 A;  2O01 E;  1PSE A;  4M75 F;  3BDU A;  3RKW A;  3A8O B;  3JAM E;  1X01 A;  2DTH A;  4OB2 B;  2RA2 A;  4C5E A;  4XK8 E;  2EYQ A;  4QVD A;  1I8F A;  3M9Q A;  2EQM A;  3GIB A;  5KE2 A;  5A0G A;  2XK0 A;  5CQX A;  3CBM A;  1JRI A;  3CCV A;  1VQN T;  3LWH A;  3FB9 A;  3M54 A;  2MMP A;  4M77 A;  2P0K A;  4M78 G;  4LDY A;  2O4X B;  5CVI A;  2CZ6 B;  2CZ1 B;  2DD5 A;  2PQW A;  5AYF A;  3V7S A;  4X9D A;  4F7U F;  3CCE A;  4ZTJ A;  5HKC A;  1S72 T;  2EJF A;  5CIU A;  3A8G B;  4MML A;  2RHZ A;  3NTI A;  4J7I A;  4L5G A;  3MP8 A;  3HP9 A;  3CCQ T;  3JCM J;  3CMA A;  4MDW A;  2KSS A;  2RHY A;  1D3B A;  2GFA A;  2D0Q B;  4JDS A;  4M78 D;  4R56 A;  4ZTF A;  1U8R A;  2OTJ T;  2JTM A;  2BIV A;  1VQO T;  2XIC A;  1RI0 A;  2HNI A;  3ZEH A;  2E5Q A;  2ZPF B;  3OYG A;  4PJO E;  4HCZ A;  5GMK m;  3RKY A;  5GAM e;  5FU7 C;  4Y28 E;  4C5I A;  1NZ9 A;  3L42 A;  3OBY A;  3OSV A;  3M57 A;  4KUL A;  5GMK l;  3E9F A;  2DXB A;  2JOY A;  1GXI E;  4M77 F;  2ZPB B;  1OI1 A;  5GAO l;  1NJI U;  2JTF A;  3RUX A;  1SSF A;  1B34 B;  4CRI A;  4DA4 A;  2DKG A;  1K73 U;  3BFM A;  3BY7 A;  4PKC C;  4PJO C;  1FXX A;  1Y96 A;  3OMG A;  2RJF A;  2EIF A;  3JSC A;  1G3Y A;  1UGS B;  4BDY A;  4KUD K;  1X6O A;  1M90 C;  3X24 B;  3CPW A;  4N4I A;  4N4G A;  3OYM A;  4BB7 A;  3G4S A;  3EFS A;  4OP0 A;  3FDR A;  3CCJ T;  1ZHI A;  1KC8 U;  3LH0 A;  3OQ5 A;  3V7R A;  2LX9 A;  1QW1 A;  2DAQ A;  3OS2 A;  2QXF A;  2CGH A;  3VV0 A;  3G7Z A;  1I81 A;  3C4S A;  1U1T A;  4Q5W A;  4IUP A;  4C0F A;  2OTJ A;  1UEB A;  3G71 T;  1VQO A;  4EMG A;  2RI3 A;  5GMK i;  2DVE A;  5CK9 A;  3OS0 A;  4LDV A;  4EMK C;  4NL2 A;  4C0D C;  1I4K 1;  3VUB A;  4DOV A;  3NTH A;  4GLK A;  5FRN A;  4ATO A;  4BE0 A;  1Q81 C;  4RG8 A;  3L2V A;  1TH7 A;  2DD4 A;  2DXC A;  3A8H B;  1VUB A;  4B9X A;  2FB7 A;  1QP2 A;  2Y4Y A;  1I5L A;  4J5Y A;  2DO3 A;  4ZN3 A;  2WSC E;  1MGQ A;  4A4E A;  3PIP A;  2GF7 A;  1VIE A;  1BIA A;  1XTD A;  4M7A F;  2HAX A;  4JLG A;  2P4T A;  4NL3 A;  2LQK A;  2QDY B;  3F70 A;  5GMK h;  4M7D F;  3MCA B;  4C92 G;  2K3Y A;  1KHI A;  3OYH A;  1N9S A;  2CZ7 B;  2M1H A;  2RHU A;  3LGL A;  5LJ3 f;  2QEX T;  3JB9 H;  2E12 A;  3CCJ A;  3HFN A;  3ER0 A;  4TVR A;  1NE8 A;  2CZ0 B;  4A54 A;  3Q1J A;  4R55 A;  2DXT A;  5GAM j;  2LC4 A;  4JJN K;  3JCM V;  3T9N A;  4BAC A;  1VQL A;  3JCM W;  4C8Q G;  1K8A C;  3WXM B;  4XU3 A;  1Y07 A;  3HSB A;  3G71 A;  4M7A B;  3VU3 C;  2E41 A;  4JUV A;  4C92 D;  4J6X A;  2KY9 A;  2X4W A;  2YHT A;  3JB9 J;  2BUD A;  3UT1 A;  3HHT B;  4E47 A;  5LJ3 g;  1ZQ1 A;  3DKM A;  4PLL A;  1WJR A;  3P8B B;  4C8Q D;  5LJ5 h;  1QVP A;  3X20 B;  3P8D A;  4C5G A;  3E9G A;  3M4G A;  3VJP A;  1W2B A;  2K5F A;  4ELY C;  4IUV A;  3UWN A;  3QSU A;  2K2V A;  4WF2 A;  1YJN A;  3LYI A;  5GAN f;  4XQ3 A;  3C94 A;  4M75 G;  5LJ3 d;  2RJD A;  1M90 U;  2XG8 D;  2ZGW A;  3PT9 A;  2C06 A;  2RK1 A;  2DZC A;  3QDR B;  3JB9 D;  3S3N A;  3CC4 A;  4C8Q B;  2O4X A;  4IKF A;  4M78 E;  4HT9 A;  3QHS A;  3CCS A;  1KQ1 A;  2FL7 A;  5CKE A;  4OB3 B;  3L2R A;  2DTI A;  3PFS A;  1VQ9 T;  3M5A A;  2ZPE B;  5IAY A;  4KUI A;  1KG1 A;  2P0P A;  3EAE A;  3QG1 A;  5GAN 2;  3CCM T;  2IVW A;  5DY9 A;  1NPP A;  5HY6 A;  1YHQ T;  1VIF A;  1VQ4 T;  4XAX B;  4L6V 5;  4RG2 A;  4M78 C;  1HXD A;  3ASK A;  4E7K A;  3GLX A;  3JCM f;  2PVG B;  4BY6 B;  2LCC A;  4JRQ A;  4BDZ A;  5FLX E;  5GAN h;  1KQS A;  5I2M A;  1VQ6 T;  4F7U G;  1XNI A;  2Y90 A;  3P8H A;  3OYA A;  1Q81 U;  3AHU A;  3JCM X;  3X28 B;  3LLR A;  3QZ5 B;  4O5V A;  4BI3 A;  5GAO n;  3KXT A;  4M75 B;  4A53 A;  1H64 1;  3QJ6 A;  4JLI A;  5KCO A;  2QQ9 A;  3S6W A;  2F5K A;  5J39 A;  5FRM A;  5C6S A;  4M78 A;  1M1K C;  1W4S A;  2XID A;  3QKJ A;  4XTW A;  4RMO A;  1EIF A;  1XOV A;  4KBM B;  3OYL A;  1KHC A;  1UGR B;  3GF5 A;  4E7J A;  1VQM T;  3OW2 S;  3PMT A;  4DOW A;  2L89 A;  3E1S A;  1JJ2 A;  1B34 A;  2EAY A;  1Y7X A;  2RD1 A;  4KT0 E;  1QVG A;  2K4Y A;  2ZZD A;  1X75 C;  1YIT T;  3TRE A;  4FT4 A;  2LT1 A;  2MWO A;  3ZFJ A;  3J81 E;  3JCM h;  1VQ9 A;  5LJ3 e;  2K3X A;  4M77 G;  5GAN 5;  1K8A U;  2ZPI B;  1WJQ A;  4OGE A;  3CCM A;  4LD9 K;  3CD6 T;  4F7U B;  2QA4 T;  2YLC A;  2QQA A;  5CCA A;  1BYM A;  1WPY A;  5GAO m;  3OYJ A;  3I55 T;  3CME T;  2RJC A;  4IUU A;  5CQY A;  4FSX A;  4N0A C;  3BW1 A;  3OY9 A;  3M59 A;  4HT8 A;  1LJO A;  3OYI A;  3H8Z A;  2DIQ A;  2R57 A;  2G3R A;  3RMQ A;  3VYH B;  4ELZ C;  4ZN1 A;  1VQ6 A;  3R6O A;  3TCJ A;  1QP3 A;  3M58 A;  3MP6 A;  5GAO q;  1PSF A;  2LNV A;  2MAM A;  1VQN A;  2HQX A;  3FLG A;  2L3R A;  2V8I A;  3M53 A;  2X4X A;  2JNG A;  5I21 A;  3J80 E;  5D6Y A;  4YTL A;  3RES A;  4N0A A;  2QQS A;  1VQM A;  2LCL A;  2KMT A;  3LW5 E;  2WSF E;  5GAN e;  3BDL A;  1FX7 A;  4M77 B;  4PJO A;  2CS7 A;  2XKO C;  2KK4 A;  4J6W A;  4QVZ A;  4X34 A;  3CCQ A;  3HKS A;  1S72 A;  3CBO A;  3CXC A;  1BI1 A;  1U1S A;  2XI9 A;  5LL6 S;  4X9C A;  3MEU A;  4B9W A;  4NOY A;  5C0M A;  4N4H A;  1KQ2 A;  2JZ2 A;  4C0Z A;  2M9U A;  4C92 E;  1IRE B;  2L8D A;  2NLU A;  4DQ2 A;  3CD6 A;  2QA4 A;  4UC4 A;  3A8L B;  1D3B B;  2DEQ A;  3I55 A;  1M1G A;  5GAN 7;  3CME A;  4M7A G;  3V7C A;  3GP8 A;  4C8Q E;  2EQJ A;  2E70 A;  1Q86 C;  4EDU A;  3JCM e;  4M7D G;  3J7A F;  4C92 C;  5GAN 3;  5KE3 A;  5J26 A;  2R58 A;  2RI5 A;  3OYK A;  2DZ9 A;  4EMH A;  1WNL A;  4P5N A;  4EMK A;  2RI2 A;  4BI4 A;  3QPH A;  4BE1 A;  1M1K U;  3MEW A;  1JBM A;  3A5Z B;  2LRQ A;  4FT2 A;  5DM7 R;  4JS5 A;  4C8Q C;  1OZ3 A;  3CC7 T;  4M7A D;  5LJ5 f;  5LJ3 j;  3GNG A;  5FU6 B;  4PJO F;  4Y91 A;  2OTL T;  2XU8 A;  4M7D D;  4J7F A;  1G5V A;  4PLI A;  4C92 A;  4QVC A;  3CPF A;  3DLM A;  2QTX A;  2XDP A;  2VC8 A;  4QQD A;  3KUF A;  4LDW A;  1Y96 B;  3L2Q A;  1VQ5 T;  2KVQ G;  1H3Z A;  2VGN A;  4JS4 A;  4LDU A;  1WGS A;  2K5L A;  2RK2 A;  3OS1 A;  3OYD A;  1QVF A;  3A8M B;  4M7D B;  3UPU A;  2VUB A;  5CKD A;  5LJ5 g;  3SB2 A;  2EFI A;  2EJG A;  4XTU A;  3X25 B;  2GQV A;  2HBP A;  3PNW C;  3QO3 A;  2PU9 B;  3RIR A;  3CCR T;  4MDX A;  4M75 C;  4GY5 A;  3CC2 T;  4MZT A;  2E10 A;  4FU6 A;  4HKE A;  5D6X A;  2RB6 A;  2WAC A;  4ZGE B;  4J6Y A;  2V8K A;  1P92 A;  3PMI A;  4A4H A;  3V8L A;  5LJ5 d;  1LOJ A;  3V8J A;  2VGM A;  1VQ8 T;  4OVA A;  2XDD A;  2MI6 A;  4F7U E;  2WSE E;  4II1 A;  2RM4 A;  1VQP T;  4IUR A;  5CR2 A;  2VV5 A;  3E19 A;  3CC7 A;  4JRK A;  1YCY A;  3O8V A;  3WVD B;  1K9M C;  1WJS A;  3SD4 A;  1N8R C;  4QQ6 A;  2QEX A;  1BI2 A;  2VXF A;  1M4Z A;  2CKK A;  3DB4 A;  1VQK T;  1G3T A;  2I2L A;  2X4Y A;  4XTV A;  3HRS A;  1BI3 A;  4M75 D;  3CPW S;  3SDZ A;  2Y4X A;  3MET A;  2HQE A;  5GAN g;  1BI0 A;  1M5Q 1;  2DTO A;  5GMK e;  3JCM c;  3ZBD A;  3OYB A;  5DLQ E;  1Q7Y C;  4HCB A;  5EG2 A;  3CCE T;  3DB3 A;  3OYY A;  3WVE B;  2E6Z A;  3JB9 F;  2IG0 A;  2QQB A;  5GAM h;  1Q86 U;  2DK3 A;  3C12 A;  4A4K A;  4F7U A;  3FC3 A;  3CCR A;  1WQW A;  3CMA T;  3MEA A;  3CC2 A;  5GAN d;  4HCC A;  4RKU E;  1O9S A;  2YRV A;  4XU0 A;  3S3O A;  2FYK A;  5GAN 6;  2XD0 A;  2KAF A;  2RHI A;  2P0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...