2PU9B

Crystal srtucture of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin f
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pu9B00
2PUOB 2ZCFB 2QDYB 2DD4A 3WVEB 4RKUE 1JB0E 2D0QB 2PUKB 2DD5A 2ZPBB 2ZPHB 1UGSB 2O01E 2WSCE 3LW5E 2PVGB 1PSFA 1PSEA 2DXCA 2ZPEB 2ZPFB 3A8HB 3QXEB 2PVOB 2ZPGB 3QZ9B 4FM4B 3VYHB 3X20B 3A8MB 3QYGB 4ZGJB 1GXIE 1UGRB 3X24B 5L8RE 3X25B 4XK8E 2CZ0B 3A8OB 4OB2B 4Y28E 1UGQB 3VYGA 3X26B 1QP3A 3QZ5B 1DJ7B 2ZPIB 2DPPB 4ZGDB 4KT0E 3QYHB 4L6V5 1IREB 2CZ7B 4OB3B 2PVDB 2PU9B 2ZZDA 3X28B 2DXBA 3WVDB 4OB1B 4OB0B 2AHJB 3HHTB 2CZ1B 1QP2A 2WSFE 2CZ6B 2CYZB 3A8LB 2WSEE 1AHJB 1V29B 4ZGEB 3A8GB 1UGPB
chains in the Genus database with same CATH superfamily
1Y57A 2JS2A 4PFOA 1Y71A 3JCMP 1I07A 1NJIR 2XI9A 1LPLA 5FWBA 4JRPA 5DLQE 2XG8D 4ZTFA 5GJWB 1HK9A 2QQRA 2VYTA 3S6WA 2DL3A 4M7AE 1TUCA 1I0CA 4HVUA 2E3HA 3THKA 2M1HA 2CZ1B 1ZSZA 1N8RC 1VQ8T 1BIAA 2RMOA 4C0GA 2K6DA 1QVFS 1VQOQ 1E6GA 1PSFA 2JW4A 8ATCB 3QIIA 3CCST 3E2UA 5A2QE 2COWA 4IUQA 3MEVA 1PD0A 2A0FB 2RPNA 3I56T 2NLUA 4LDWA 5LJ5j 1RAFB 2LRQA 2CSIA 1MV3A 3L2VA 2LQWA 1SHFA 3M59A 2EQMA 2KAFA 4QKUA 2CP0A 3G6EQ 2FPDA 5EG2A 2AK5A 3CBOA 5A0GA 3EH1A 2LT4A 4AT1B 2ED1A 5D7UA 3EFSA 1LJOA 3O8VA 2K5LA 2RH2A 1LOJA 1G8XA 5KE3A 2OTJA 4KRTA 2FHDA 2V8IA 4M78F 3CCJQ 1C6VX 2CSQA 3VUBA 2JUFA 1XTDA 2RQVA 1K4US 2PVOB 1YI2A 3J80E 3I55T 1YJWA 4BDYA 4C0FA 1C0MA 2MWOA 2RK2A 2M0OA 2A28A 1AZGB 1BCOA 1M90U 2OTLA 1PRMC 2VB6A 3SEMA 4C92G 1PCXA 3V8LA 4LDUA 4B9XA 4XU2A 3QUIA 2KBTA 4C5HA 5GMKi 2EAYA 2X3XD 1UUEA 5GANg 2RI3A 2DIQA 3H9NA 1KD1U 1UG1A 2DXBA 1GCQA 1YITT 5I2MA 2YT6A 1E7OA 4FYYB 1BU1A 2KEAA 3FB9A 4HVVA 4L59A 3I9QA 1VQMA 2HBWA 2YDLA 3CPFA 3JCMJ 1NJIU 1WJQA 1UGSB 1OX9A 5CR2A 1YJNT 3CCMT 2FEIA 2LQKA 4MMKA 1VQ8A 1KHCA 4Y91A 4C5GA 5CQYA 3QYHB 1EFNA 1YIJQ 3X28B 4MDWA 1IGQA 1GFCA 2IG0A 2JN0A 5KCHA 4KUIA 4PLLA 2HDAA 3BFMA 3EHQA 2O2OA 1O75A 4RG2A 4HVWA 5FU6C 1W2BS 2RK1A 3CBMA 4E7ZA 2AKLA 2CGHA 2K9GA 2P0PA 3VS3A 2DKGA 1XOVA 4E7KA 3PTAA 4M78C 4E2FB 4IURA 5HK3A 5GJVB 1SRLA 2DJQA 4J9EA 2X51A 5CCAA 1Z9ZA 2QTVA 3L2RA 1QVGP 2QQSA 4KBMB 4ZGJB 2AIRB 2EGAA 4FU6A 3OW2P 3SWNA 4LDVA 2DRKA 1EZZB 4A63B 2L89A 2QGGA 1XNIA 1F1BB 2OX7A 3OYNA 3EG2A 3OS2A 1PKTA 3PIPA 4M7DB 1NM7A 4L5GA 3G71A 2AZVA 3MHXA 1PC0A 4XTVA 1W70A 5I22A 4C5IA 2SEMA 2PNIA 2OTLT 2A37A 4V2SA 2CUBA 1VQLT 2DILA 3CCRA 1KQ2A 2R5AA 5KYYB 2NUTA 2GCXA 3LH0A 2G3RA 5LL6S 2MOXA 1R77A 2DZCA 3PFSA 1X6GA 3FIFA 1RLQC 3SFMA 2JOYA 4M77E 4RCCA 2DL7A 1AWXA 3Q1JA 2P4RA 3L2QA 5CVIA 5GAN3 2LCSA 2YWWA 3QSUA 1CSKA 1RI0A 1GBRA 2A36A 3S3MA 2M0YA 4ELZC 1VQKQ 2ABLA 1UFFA 4RTTA 5C6SA 3CCQQ 3ZFJA 3LGLA 3SB2A 2W10A 2RHYA 2CP3A 1O9SA 4LD9K 3H0FA 2BE7D 1K8AU 1KIKA 1VQ8Q 4JJDA 1X43A 3OA6A 1OU8A 3CCVA 2H3JA 3CD6T 2PVDB 4OB0B 2JMCA 4BI4A 4R55A 3CCSQ 1AHJB 5GAN7 1AT1B 3V8KA 4M7DC 3P8BB 2F69A 2KSSA 4RTZA 2HL5C 4XTYA 1JJ2A 1JBMA 2CP7A 1LVKA 3BW1A 4MZPA 2ECZA 4Y28E 2RQUA 1KQSS 5FW9A 4C92C 4RTXA 4HXJA 2YUPA 4A4GA 4UC4A 1ZSZC 2K5IA 3CBPA 1D1CA 7AT1B 2L3RA 1SRMA 2E6ZA 1GXIE 4X9CA 1U1TA 3A98A 1X2QA 4CC3A 3CCJT 4E7HA 2DVJA 2E5QA 1Y0MA 2RA2A 1IHVA 1RAIB 3VS7A 4Z8AA 3MP1A 2LX9A 2Y4XA 3EFOA 3I55Q 1G3TA 1SF9A 4PJOE 3ZEHA 1HSQA 2B86A 2RQWA 2RHIA 3FC3A 3A1PA 4C0ZA 2YRVA 2YHTA 3CPWP 1S72A 2ZAEA 3OYDA 2V1QA 3MO8A 1ZA2B 1U1SA 4IUTA 1W2BA 4GY5A 2GFAA 2E4HA 4M78B 2RNAA 3UDCA 3HRTA 3M9QA 4E6RA 4DEXA 4IIOA 4R56A 2ZGWA 3EG1A 3FRNA 5L8RE 1SEMA 2A7YA 4L6V5 5KYUA 4KH1B 3C12A 1JU5C 3CCMQ 2BE9B 2LT1A 1UE9A 1YN8A 4FW1A 5CKHA 2YRCA 2EFIA 4PJOC 3CD6A 1YFNA 3QXEB 2DIGA 2CREA 4ZGEB 4B6MA 2O88A 4OGEA 3TSZA 4X1VA 1VQ5A 4OGCA 3EG3A 3C0CA 2QAZA 2E3IA 4OMOA 2X3WD 3UA7A 2QG9B 3RKYA 1AZEA 2QQBA 2EQJA 2QEXA 3JB9D 4X34A 4J9BA 2KMTA 3BE3A 5D6YA 2HSEB 2G6FX 4JPBW 2C0IA 4HCKA 4Y92A 1X27A 5AYFA 5M9OA 2R58A 2C06A 4EDUA 4AFZC 3QZ5B 2EYZA 2LNVA 3INZA 3M58A 3JRZA 3META 2LDMA 4M78D 2KI7A 2V8KA 2ZCFB 3M54A 2VGMA 3SHWA 1Q95G 4EMHA 5KYWB 1VQ9T 2Z0WA 1S1NA 2WACA 4Z88A 4ESRA 1X6OA 2NWMA 3X26B 1BB9A 3NGPA 3CCEA 3EAEA 1X01A 6AT1B 5GMKe 2YUOA 2JVVA 4M78A 2O9VA 5FRMA 1E6HA 4LDXA 2VC8A 1WA7A 4M77D 4M7DE 3HSBA 1QW1A 4FM4B 2NYSA 1VUBA 2QGFB 1NLOC 5GANh 3ZBDA 3JV3A 4E7SA 1VQKA 1RACB 1IXDA 2RJEA 1RAAB 3OW2A 3OYGA 2BUDA 2VUBA 2KQWA 2YLCA 4KH0B 1FMWA 3EFOB 2YLBA 4M75A 1KD1C 3M4YA 1ZUUA 3CC7Q 4LDYA 1I5LA 4ZN3A 2JNGA 2QDYB 5GMKm 2HQXA 4E7IA 4LN2A 3EFRA 3DKMA 2DX1A 3TREA 3H41A 5CQXA 1SSFA 1YCSB 2Y90A 1G5VA 2QQAA 1UDLA 4PJOF 3CCSA 1WHJA 2KRNA 3E9FA 4E7JA 3EH2A 4M75D 4FT2A 2VASA 3UF4A 2B8AA 3CC7A 1M8VA 5IXBA 1I5OB 2RN8A 2PUOB 1QLYA 2FZGB 1CKBA 4JRKA 2MYSA 2DD5A 3NTIA 1V1CA 1LCKA 2JXBA 1YWPA 3HRSA 3S3NA 1H3HA 2JS0A 2COYA 1PNJA 2EYXA 2LVMA 2DBMA 4J9IA 1IHWA 5LJ3d 1Q81C 1NE8A 1WJSA 4A4KA 4FW2A 4FSSA 4LXCA 4FYWB 5KYXA 1OV3A 2PZ1A 4RTYA 2GFUA 1UHFA 2XDBA 4X9DA 2VWFA 5IXFA 4RTWA 4M7AB 5GMKl 1Q86R 4FCYA 4M4ZA 1NPRA 2O4XA 2XU8A 4MDXA 2LTOA 4PJOA 2K3YA 4JJNK 1AVZC 2DVEA 1D1AA 3PIOA 1KHIA 4M75E 1YI2T 1PSEA 1Q81R 4IUVA 1ZUKA 3PVLA 3FJ5A 2KXDA 2OI3A 3QPHA 2V8JA 1N8RU 2H8HA 4QW2A 4BE2A 1VQ7T 4EMGA 3HHTB 3CQTA 2CZ6B 2QA4Q 2E64A 4F04B 1B7TA 5GMKj 1OEBA 2DRMA 2MIOA 5GAMg 2EIFA 1YJNA 2DAQA 3RKXA 1Z9QA 3G71Q 1M2VA 1I4K1 2DLPA 4M77B 4XK8E 1M1KR 1BKBA 2E1HA 1RAEB 3H8ZA 5HK0A 5J39A 1K8AR 1VQ6T 4MMLA 1MMAA 2BZ8A 2DA9A 1VQPT 1SG5A 2ZPGB 2FVUA 3GNGA 4C92A 1TG0A 1OQKA 5I21A 3OYKA 2A08A 3V7CA 1DJ7B 1B34B 1KSWA 1D0YA 4RG8A 4TVRA 3NTHA 3M56A 3QJYA 3OS1A 1Q82C 5KYYA 4XU3A 1XQHA 3HFOA 3C94A 3M0QA 1D1BA 1FYNA 2KRSA 3JCMc 3SD4A 3CMET 4XTXA 3GBQA 1OULA 1PM3A 2FL7A 4FSXA 3G6EA 1N5ZA 4QT7A 2LZ6B 2RQTA 3LYIA 3ZL7C 2RD1A 1I81A 1B3QA 2HKNA 3GNFB 3RKWA 2I2LA 2JTFA 3MPUB 2GF7A 8AT1B 2EBPA 4J9HA 4EPCA 1GCQC 3SWNB 3CCRQ 1M90C 3V7SA 4N4HA 2OJ2A 4XAXB 4N0AC 4C92D 2E10A 1Q7YR 3P8DA 1VQ4T 1JJ2S 1ZHIA 3J81E 4M7AC 4D8DA 3DLMA 5LJ5d 2KK4A 3V7RA 3OY9A 3OS5A 3HPWA 3A8LB 2CUDA 1Y7XA 4NL2A 5LJ5e 2VKNA 2CT3A 4AG2C 2KRMA 5J3BA 2DEUA 4C5EA 3JCMf 3EG9A 1VQ6Q 5HCKA 3CCQA 2XD0A 2FPFA 3CCLT 2CP2A 1N8RR 4LD6A 1VQMQ 2LJ3A 1X2KA 1VQPQ 3BY7A 3PGGA 3PNWC 4KGXB 1IO6A 3OYFA 3VJPA 3NHNA 5LJ3g 1AOJA 3CC2A 4J6WA 3QHSA 4F7UG 3QDRB 5J26A 1AEYA 1VQ5T 1UGQB 4C8QB 5FROA 4NL3A 1VQOT 1WGSA 1QWEA 1VQPA 1T0HA 3CC2T 2NUPB 4CC4B 3R6NA 4BACA 1K1ZA 2EYWA 3QDFA 1KQSA 2K57A 5GMKh 4OMLA 1IRXA 3VS0A 3JCMQ 1N6AA 3UATA 2HD0A 3MJXA 1RABB 1AWJA 1PKSA 3L2ZA 4ANJA 1M4ZA 4AFQC 1G2BA 1NYFA 4LUDA 4PJJA 1M2VB 2YSQA 3HP9A 1MV0B 1BI1A 5HY6A 2EPDA 1TXQA 4BB7A 4AMCA 3VYHB 3CXCA 4DQ2A 2M02A 2QDLA 2J6OA 2V26A 1VIFA 4GLKA 2QEXQ 2J6KA 3D7SB 5CK9A 3L42A 1D0XA 2R5MA 4OMMA 3CPWA 1MMDA 5KYUB 5A0DA 2ROTA 5LJ5f 3EGUA 1M1KC 1HJDA 4M77G 1BBZA 4XU0A 4J7FA 1VYTA 1TWBA 1OI1A 4FL6A 4JUVA 1QVPA 2BKDN 5D6XA 3LH5A 2QA4A 3VKIA 2BIVA 3CCET 4QVZA 2F5TX 4EMKC 2M51A 2MPXC 2O4XB 3UA6A 5CAIA 1JB0E 1VYUA 2DO3A 3QWYA 1KQ1A 3GF5A 3M0TA 4M7AD 2FRYA 4HCBA 2I0NA 3V8JA 4IUUA 4JJCA 2DE0X 4PJOD 2C0OA 3ASKA 3FEOA 1BI3A 1YJNQ 1K9MR 1WI7A 5FLXE 2HQEA 5LJ3f 5GAOl 5LJ3e 3JCMW 1K0XA 2E5KA 3FJPA 2PTKA 1TUDA 2ZPHB 1VOMA 3I56A 1Q82R 1YJ9Q 2RI2A 4ELYC 2D0NA 2K3BA 2EVRA 2CS7A 4WF2A 5CKEA 2VXFA 3QKJA 1OX8A 1QKWA 3F70A 3IQLA 5GANj 2P0QA 4PJMA 3FLGA 1FX7A 4JJBA 1Q86C 2PVGB 1MMGA 4DBHA 2JMAA 2RJCA 5IAYA 5KE2A 1KD1R 2OTJT 1U5SA 3X25B 3CMEQ 2DL4A 4EMKB 1JQQA 3H0IA 3BDLA 1UGVA 1FMVA 1TS9A 2DETA 2NUPA 1YJWT 3OBYA 4HCZA 1XJWB 1N9SA 3WVEB 4A4EA 2DJZA 3CCEQ 4OP0A 4PJOG 4DOVA 3MKDA 3HKSA 2LMJA 4BD3A 1KQSP 1K9MU 2F2VA 3L2UA 1K8AC 1MNEA 2HCKA 2QI2A 1VYVA 2QTXA 3OBWA 2A3LA 2KT1A 1JXMA 4C8QE 2V1RA 2AHJB 2CH4W 2DYIA 4M75F 2C0TA 4DBQA 1M3CA 2CKKA 1NG2A 1VQNQ 2ROLA 3PVQA 1ZQ1A 2PUKB 1W2BP 3OYJA 3EG0A 4XQ3A 4IIMA 1YJ9A 2BTTA 2K2MA 1NLPC 1ZSGA 2VGNA 3H6ZA 4Z02A 5CKFA 5LJ3h 4JRQA 2FZCB 4D6WA 2MMPA 1NYGA 4Q5WA 3DB3A 4PK4A 1WHLA 4F7UF 2O9SA 1VIEA 2DEQA 1Q82U 2E41A 5KH6A 1TUGB 2NUTB 3M0SA 1FXXA 2X4YA 4PJLA 2K7AA 4JLGA 2CT4A 1FWZA 2RI5A 3CEYA 3GPLA 4RCBA 2LP5A 3OSSC 2DNUA 5FU7C 1D3BA 1GFDA 1KFZA 2OTJQ 4FT4A 4MZMA 2DBKA 2DF6A 2D0QB 2L8DA 3G1JA 3TQ7P 3I56Q 2RQRA 3LLRA 1MUZA 3HRUA 2E6NA 1NBEB 2RHZA 3SWNC 2QYZA 1R8OB 3OYHA 1UECA 4OVAA 4EMKA 3GLXA 1QCFA 2EW3A 4YTLA 3AT1B 3UWNA 3P8HA 1VQLQ 2GNCA 1V29B 4LNPA 3DB4A 1SSHA 4M78G 1ABOA 1UTIA 3VS6A 2DXCA 3OSVA 1T0JA 2D9TA 4C92F 3REBB 3CPWS 1YP5A 1M3AA 2RHXA 2K5FA 1GRIA 5CO7A 2QASA 2LJ0A 2DK3A 2DL5A 1Y07A 2EQKA 5A0LA 3CCVQ 1W4SA 4OB1B 4OMNA 5GAMj 4M7DF 3I55A 2DTHA 1RAGB 4E7LA 4C0DC 1MHNA 3CCJA 4ZN1A 4GBQA 1Y96B 3JCMb 1VQ4A 3CCQT 4M7DG 2P0KA 2ZPIB 2MWPA 4E47A 1JRIA 1WX6A 2HQHA 1VQ7A 2VVKA 3WVDB 5GAOp 4M75B 2ATCB 2E70A 1K76A 1A0NB 1EIFA 1VQNA 2RM4A 2RHUA 2X4JA 2X4WA 4JLIA 4FYVB 1SHGA 2DZ9A 3CXCS 2M16A 1TSFA 4HA8A 1N27A 1TH7A 2H3EB 2ZZDA 5CKBA 3VS1A 1VQ6A 3VRYA 3G4SA 1WXUA 2EGCA 1YCYA 2CP6A 2IPOB 1YHQA 3U23A 4C8QF 1YIJT 3WXMB 2HNIA 1N9RA 3QYGB 1H92A 2Y4YA 2IIMA 4RMOA 1OOTA 4M7AG 2LQ8A 1OZ3A 4N4IA 4J6XA 2XICA 4NOYA 1RL2A 5GANd 1W6XA 2LCCA 4QQ6A 3VS4A 2P4TA 1QP2A 2FYKA 1OPLA 4C0DB 3REAB 2AKKA 1I1JA 1I8FA 1GL5A 2GBQA 3I35A 4KGZB 1BIBA 5GAMh 3CCVT 1NEGA 2MI6A 2KVQG 1SKUB 1WHMA 3RMQA 4PFZA 2W0ZA 4BI3A 1WNLA 1IGUA 3VV0A 1ZX6A 4J9CA 1IB8A 2FZKB 2XMFA 3TCJA 3CMAA 2E65A 3UT1A 1Q7YC 2KDSA 4BE0A 1ZBJA 5GAOq 2R57A 2EKOA 1UGPB 1Y96A 4QQGA 2HBPA 4M75C 2KE9A 1PHTA 3CD6Q 2EYYA 2HZYA 3KUFA 5DLOA 1OU9A 2MAMA 4M75G 2CP5A 2KYBA 2XDDA 2LNHB 1YWOA 1VQ9Q 3T9NA 2OTLQ 1KC8R 2JM9A 3OYMA 3M0PA 4PKCC 4HCCA 1S72T 1BI0A 4ME7A 4PL6A 2BZXA 1WQWA 3RESA 3A8MB 2DMOA 3URGA 4KGVB 4RTVA 3JCMd 4R0KA 1VQNT 3A8OB 5I2SA 1QWFA 3MEWA 2L3PA 1RADB 3MEAA 4C92E 3CCUA 5IHKA 4PFPA 1ZA1B 4ORZA 3EG9B 1VQKT 3CC4Q 3KXTA 1K9AA 1UJYA 4RTUA 3RR6A 1UB4A 2IVWA 1H3ZA 3CCLA 1D09B 1RLPC 2HSPA 1WQ7A 3EGXB 4J6YA 3GOXA 4ZGDB 4BDZA 2ESWA 2RF0A 3QG1A 4PNOA 4F7UB 1QVFA 3RBBB 4CRIA 3M5AA 5GAN6 1KG1A 1G3YA 3C95A 2K79A 2RJDA 1WJRA 3OYIA 3M0UA 4QQDA 1D3BB 5D6WA 1X6BA 2DTOA 2DERA 4OMPA 1WPYA 2JT4A 1UEBA 2WSFE 2VXEA 3OB9A 1BCMA 1JXOA 3RMSA 1M1GA 4BE1A 2O01E 4M77A 2L3SA 3R6OA 3NTKA 1NEBA 1KC8U 3OYYA 4WTOB 3TSWA 1QP3A 1W1FA 3QJ6A 2COZA 1R0CB 2CH4A 1PG5B 5CIUA 2EJGA 1WDXA 4A54A 2J7IA 3JSCA 1C1AA 1WYXA 4J9FA 2WSCE 4AG1C 1PD1A 4F17A 2F1LA 5GAMd 5GAMe 1WZOA 4J83A 3MCAB 2J6FA 3A8HB 4JZ3A 3M0RA 3X24B 5LJ5h 5GAOm 9ATCB 2XDPA 3PE0A 4MZTA 4PJNA 3CC4T 2AZSA 3OYCA 2X9HA 5FU6B 4GLMA 1VQ9A 3OQ5A 4JZ4A 3TU4K 1MGQA 2F2XA 3M55A 3L1AA 3GP8A 1YITA 3LGFA 4O5VA 3A5ZB 1Q7YU 2YUNA 2J06A 1YNZA 3QO3A 1M3BA 4JS4A 1OPKA 5FWCA 2MF2A 3C4SA 4DOWA 5L23A 1VQ7Q 1QCOA 4KULA 1M30A 1MNDA 2FG0A 2QA4T 4F7UE 2HKQB 2P84A 2KR3A 4D8KA 2CDTA 4M7DD 3O5ZA 3EGXA 1PWTA 1Q81U 4F7UA 4XU1A 2L3QA 1B07A 3VS2A 1G3WA 2ZPBB 3JCMV 4PJOB 1UGRB 4II1A 3OS0A 2KY9A 2D1XA 4KT0E 3JB9J 4QVCA 3OW2S 1T3SA 1KJWA 2F2WA 1ARKA 4M7DA 2LQNA 4FIBA 5C0MA 1BI2A 2CYZB 1UHCA 4J9GA 3PMTA 2JZ2A 4RKUE 4N4GA 3M57A 1K73U 3QZ9B 1X75C 3EHRA 1K9MC 1UJ0A 3CC7T 3EGDB 4OB2B 3ER0A 1M5Q1 2DTIA 2PQWA 1ZSZB 2HL3A 1BK2A 3EGDA 3JCMg 2QXFA 4C92B 2DD4A 1M8MA 3JCMX 2VV5A 3JCMh 1BYMA 3LW5E 4XTZA 2ZPEB 5GAN8 3MP6A 4JRIA 3ME9A 4CI0C 1M2OA 1KK7A 3VUZA 2O31A 2KYMA 3M4GA 1TU0B 3BDUA 3N5BB 2EJ9A 1R0BG 4B9WA 1EX4A 1OYXA 3VU3C 1QVGA 2OAUA 2WSEE 3JB9F 3G71T 4PLIA 1QQJA 5IT9E 3RDVA 5KYNA 4VUBA 1ACMB 3E1SA 4DA4A 2OAWA 2DXUA 4OF1A 1VQLA 3LX7A 4ATOA 1M90R 2BZYA 2YUQA 3VYGA 2KROA 1S72Q 1G3SA 4EIKA 2K2VA 5GAN4 4AFUC 3JAME 3LWIA 4OMQA 5KYWA 5IHNA 1FMKA 1VQMT 4P5NA 4QVDA 1LNXA 1SPKA 4LE9A 1CKAA 3X20B 4C8QD 3CCMA 2HEQA 4HKEA 2JTMA 3VRZA 1M9SA 3OYBA 1QKXA 3I5RA 5I11A 1OZ2A 2D8JA 2FO0A 2CZ7B 2JTEA 1QVGS 4J9DA 5KCOA 5LJ3j 5FU7B 4A4HA 2FB7A 3HFNA 1VQ5Q 1MMNA 4F14A 2RO0A 4IKFA 4M7AF 2YRDA 4K11A 3FDRA 1VQOA 1VA7A 4DBFA 2ENMA 4C8QC 3L2WA 4DEYA 3ULRB 1D0ZA 2EKHA 2EYQA 5GANf 5KYXB 1M1KU 4BI8B 1U8RA 1NJIC 1YHQQ 4J7IA 5FRNA 2XKOC 3G6ET 3CMAT 4F16A 1H8KA 1VQ4Q 3RUXA 2LCLA 1HXDA 4DBRA 1RUWA 1AWWA 1T3LA 2RB6A 4JDSA 3SDZA 5GAN5 2LX7A 4Z89A 2MK5A 5GAN2 3OYLA 4BUGA 4XTUA 3G4SQ 3CMEA 1HYOA 1WIEA 1RAHB 2F5KA 3RERA 1K73C 3GIBA 2J05A 3OYEA 3S3OA 4OB3B 4LUEA 3JCMe 2X35A 4C8QG 3NFCA 2QQ9A 3HL8A 1WLPB 2ED0A 4A53A 3AHUA 1K73R 5DY9A 4HT9A 1WHGA 2ZPFB 4CC2A 5EC7A 1IZ6A 3HTRA 2GTJA 1WHHA 4IUPA 2DFUA 1QMCA 1M1FA 3M53A 1RI9A 1IREB 3OMGA 1YI2Q 2NUZA 5CKDA 4N0AA 3OMCA 2XHCA 4BY6C 5LJ5g 2DPPB 3RIRA 2X4XA 1B34A 2EQUA 2XIDA 3CC2Q 5GAMf 4M77F 3TVTA 2JM8A 1U06A 2SRCA 2EJFA 2DL8A 5IN1A 1YITQ 3CCRT 2GQIA 3MEUA 3NPFA 1G83A 2XK0A 2YXYA 3J7AF 4JS5A 1ZLMA 1Q86U 4KUDK 3OYAA 1J3TA 4J8OA 1AWOA 4NS5A 1YHQT 4RUGA 3LWHA 2FPEA 1YIJA 1WXBA 1JJ2P 2QK0A 3CCUQ 3I5SA 3CMAQ 2L5QA 2KNBB 4XTWA 2JJ9A 2M9UA 2EQIA 2CZ0B 4WCIA 5GANe 2FRWA 5ECAA 2LC4A 1ZUYA 3QBYA 3JB9G 2E12A 3G4ST 1WFWA 4CC7A 3CCLQ 2L0AA 4BY6B 2GTOA 1NZ9A 5IHIA 3PT9A 3UPUA 3CXCP 1ABQA 2QEXT 4OMFB 1YBYA 3G7ZA 1AD5A 2GQVA 4M78E 2MCNA 4M77C 5GAOr 1KC8C 4A4FA 3E19A 2K4YA 3JB9H 1X69A 1HD3A 1TTHB 1ZBXA 2HAXA 1QVFP 2D6FA 2DXTA 4O6JA 2K3XA 2KGTA 1NPPA 3QWXX 1TOVA 1WXTA 4J5YA 1GBQA 1V76A 5HKCA 3TEEA 2KT8A 5IH2A 1JO8A 1WHKA 1QCNA 2DM1A 2KXCA 3KFVA 1M27C 5GAOn 1YJWQ 4AFSC 4M7AA 3CC4A 3DLLA 1JEGA 2GGRA 3JB9I 2HMAA 3VS5A 2L2PA 3A8GB 3RNJA 4ZTJA 2AT1B 5AT1B 1K0SA 2EGEA 2LJ1A 4C8QA 3PMIA 3E9GA 3H0HA 2DYBA 3NMZC 1U3OA 1H641 3CCUT 2PU9B 1PRLC 2RJFA 1P92A 3MP8A 4FYXB 5DM7R 1YJ9T 1GCPA 4ZNXA 2D8HA 3KBGA 2EWNA 4HT8A
chains in the Genus database with same CATH topology
5CAIA 2QEXA 3JB9D 4X34A 3RMSA 1JB0E 1M1GA 4BE1A 1Y71A 3JCMP 2KMTA 2DO3A 2O01E 2XI9A 5D6YA 4M77A 3R6OA 1KQ1A 3GF5A 3NTKA 4M7AD 4JRPA 1KC8U 5DLQE 2XG8D 3OYYA 4HCBA 5AYFA 5M9OA 4ZTFA 2R58A 2C06A 4EDUA 3V8JA 4IUUA 1HK9A 1QP3A 2QQRA 2VYTA 3QJ6A 3QZ5B 4PJOD 3ASKA 3FEOA 3S6WA 2LNVA 3INZA 2EJGA 1BI3A 5CIUA 4M7AE 3M58A 4A54A 3JSCA 3JRZA 5FLXE 2HQEA 2M1HA 3META 2CZ1B 2LDMA 4M78D 2WSCE 5LJ3f 5GAOl 2V8KA 2ZCFB 5LJ3e 3M54A 3JCMW 1N8RC 2VGMA 1VQ8T 5GAMd 3FJPA 5GAMe 1BIAA 4C0GA 1QVFS 4EMHA 2ZPHB 1VQ9T 4J83A 3I56A 2WACA 1PSFA 3MCAB 3A8HB 1X6OA 2RI2A 4ELYC 3X24B 3QIIA 5LJ5h 2CS7A 4WF2A 5GAOm 2XDPA 3X26B 3CCST 4MZTA 3CC4T 5A2QE 4IUQA 3OYCA 3MEVA 3CCEA 5CKEA 5FU6B 2VXFA 1VQ9A 3OQ5A 3EAEA 3QKJA 3I56T 2NLUA 4LDWA 5LJ5j 1X01A 3F70A 3TU4K 1MGQA 5GANj 3M55A 5GMKe 3L1AA 2LRQA 3GP8A 1YITA 2JVVA 3LGFA 3L2VA 2P0QA 4O5VA 3A5ZB 4M78A 1Q7YU 3M59A 2EQMA 5FRMA 3QO3A 3FLGA 1FX7A 4JS4A 1Q86C 2KAFA 2MF2A 3C4SA 4LDXA 4DOWA 2PVGB 2VC8A 4M77D 4M7DE 3HSBA 1QW1A 4FM4B 4KULA 2RJCA 5IAYA 1VUBA 5KE2A 5EG2A 2OTJT 2QA4T 3X25B 5GANh 3ZBDA 1VQKA 3CBOA 2RJEA 4F7UE 5A0GA 2LT4A 4EMKB 3OW2A 3OYGA 4M7DD 3EFSA 2BUDA 1LJOA 2VUBA 2KQWA 3O8VA 2K5LA 2RH2A 2YLCA 3BDLA 1Q81U 1LOJA 2YLBA 4M75A 5KE3A 2OTJA 1KD1C 3M4YA 2FHDA 4LDYA 2V8IA 4F7UA 4XU1A 1I5LA 4M78F 1YJWT 3OBYA 4ZN3A 2JNGA 2QDYB 5GMKm 4HCZA 3WVEB 1N9SA 2HQXA 4A4EA 3VUBA 2DJZA 2JUFA 4E7IA 1NJIC 1XTDA 1G3WA 3EFRA 4OP0A 2ZPBB 4PJOG 3JCMV 4DOVA 3DKMA 3HKSA 4BD3A 3TREA 5CQXA 2PVOB 1YI2A 1K9MU 3J80E 3L2UA 1SSFA 2Y90A 1K8AC 4PJOB 2QQAA 1UGRB 1G5VA 4II1A 4PJOF 3CCSA 3I55T 1YJWA 4BDYA 3E9FA 3OS0A 4C0FA 2QI2A 2KY9A 4KT0E 4E7JA 4QVCA 3JB9J 4M75D 3OW2S 2QTXA 3OBWA 2MWOA 2A3LA 2RK2A 2M0OA 4FT2A 4C8QE 4M7DA 1M90U 2AHJB 2B8AA 4FIBA 5C0MA 2OTLA 4M75F 1BI2A 2CYZB 3CC7A 1M8VA 4C92G 2CKKA 2PUOB 3PMTA 2JZ2A 4RKUE 3V8LA 1ZQ1A 2PUKB 4JRKA 4LDUA 4N4GA 4B9XA 2DD5A 3M57A 3OYJA 3NTIA 1K73U 4XQ3A 4XU2A 3QUIA 3QZ9B 1YJ9A 4C5HA 5GMKi 1X75C 2EAYA 1K9MC 2VGNA 3H6ZA 3CC7T 4Z02A 5CKFA 3HRSA 3S3NA 5LJ3h 4OB2B 4JRQA 3ER0A 5GANg 2RI3A 2DIQA 1M5Q1 2DTIA 2LVMA 4BI4A 4D6WA 2MMPA 1KD1U 2PQWA 4Q5WA 5LJ3d 2DXBA 3DB3A 1NE8A 1Q81C 1YITT 5I2MA 3JCMg 2QXFA 4C92B 4F7UF 1WJSA 4A4KA 1VIEA 2DEQA 3FB9A 2DD4A 4L59A 1Q82U 2E41A 1VQMA 5KH6A 3JCMX 3CPFA 3JCMJ 1NJIU 2VV5A 1WJQA 3JCMh 1BYMA 1UGSB 3LW5E 4XTZA 5CR2A 2ZPEB 5GAN8 3MP6A 1FXXA 2GFUA 2X4YA 4JRIA 3ME9A 1YJNT 3CCMT 4CI0C 4JLGA 2XDBA 4X9DA 1FWZA 2LQKA 2RI5A 4MMKA 3CEYA 1VQ8A 3VUZA 1KHCA 3GPLA 4RCBA 4Y91A 4C5GA 3OSSC 3M4GA 4M7AB 5CQYA 5GMKl 3QYHB 3BDUA 1NPRA 3N5BB 2O4XA 5FU7C 1D3BA 3X28B 2XU8A 2EJ9A 2LTOA 4MDWA 2IG0A 4B9WA 4MDXA 1OYXA 3VU3C 2JN0A 1QVGA 5KCHA 4KUIA 4PLLA 4FT4A 2OAUA 2WSEE 2K3YA 4MZMA 3BFMA 3JB9F 3G71T 4PJOA 4PLIA 4JJNK 5IT9E 2D0QB 1O75A 2L8DA 4RG2A 4VUBA 3E1SA 4DA4A 2DVEA 3PIOA 1KHIA 4M75E 5FU6C 1YI2T 1PSEA 1W2BS 2RK1A 2DXUA 3CBMA 4IUVA 4OF1A 3LLRA 1VQLA 2CGHA 3HRUA 3LX7A 4ATOA 2E6NA 2P0PA 2RHZA 3QPHA 2DKGA 3VYGA 2V8JA 1N8RU 1XOVA 3SWNC 1G3SA 2K2VA 1R8OB 3OYHA 4E7KA 4QW2A 5GAN4 4OVAA 4EMKA 3PTAA 3GLXA 3JAME 4BE2A 4M78C 1VQ7T 4YTLA 4IURA 4EMGA 5HK3A 3LWIA 3UWNA 3HHTB 3P8HA 2CZ6B 1V29B 5CCAA 3DB4A 2E64A 5GMKj 1VQMT 4P5NA 3L2RA 4QVDA 1LNXA 4M78G 2QQSA 5GAMg 2DXCA 2EIFA 4KBMB 3OSVA 3X20B 4FU6A 2D9TA 4C92F 4ZGJB 1YJNA 3SWNA 2DAQA 4LDVA 4C8QD 4HKEA 3RKXA 3CCMA 3CPWS 2JTMA 2RHXA 1M9SA 2K5FA 1I4K1 4XK8E 2L89A 4M77B 5CO7A 3OYBA 1XNIA 2DK3A 1BKBA 1Y07A 3OYNA 1OZ2A 2E1HA 2CZ7B 2EQKA 1QVGS 5A0LA 3OS2A 1W4SA 5KCOA 3H8ZA 5HK0A 5LJ3j 4OB1B 5J39A 5FU7B 3PIPA 5GAMj 1VQ6T 4A4HA 2FB7A 3I55A 2DTHA 4M7DF 3HFNA 4M7DB 4L5GA 3G71A 3MHXA 4MMLA 4E7LA 4C0DC 1MHNA 2RO0A 4XTVA 3CCJA 4IKFA 4M7AF 4ZN1A 4C5IA 1Y96B 3JCMb 3FDRA 1VQOA 1VQPT 2OTLT 4V2SA 4C8QC 2ZPGB 3L2WA 2FVUA 3GNGA 4C92A 1VQLT 1VQ4A 3CCQT 5I21A 3OYKA 2EYQA 2P0KA 3CCRA 1KQ2A 4M7DG 2R5AA 3V7CA 5GANf 1DJ7B 2GCXA 2ZPIB 3LH0A 1B34B 2G3RA 5LL6S 1M1KU 4BI8B 2MWPA 4RG8A 1U8RA 2DZCA 3PFSA 1JRIA 3NTHA 3M56A 3QJYA 2XKOC 4J7IA 3FIFA 4TVRA 4E47A 3OS1A 3G6ET 3SFMA 3WVDB 5GAOp 2JOYA 4XU3A 1Q82C 1XQHA 3HFOA 3C94A 4M77E 4M75B 4RCCA 3CMAT 3RUXA 2LCLA 3JCMc 2E70A 3Q1JA 1HXDA 3SD4A 1EIFA 3L2QA 1VQNA 3CMET 5CVIA 2RB6A 2RM4A 4JDSA 4XTXA 3SDZA 5GAN3 2RHUA 2X4JA 5GAN5 2FL7A 4FSXA 3G6EA 2X4WA 5GAN2 4JLIA 3OYLA 3QSUA 1RI0A 4BUGA 3LYIA 3S3MA 4XTUA 2DZ9A 4ELZC 3CMEA 3CXCS 2RD1A 1I81A 2F5KA 3RERA 2M16A 1K73C 3GIBA 3OYEA 3GNFB 3RKWA 3S3OA 4OB3B 2I2LA 2JTFA 1N27A 1TH7A 4HA8A 5C6SA 2ZZDA 2GF7A 5CKBA 3JCMe 1VQ6A 2X35A 4EPCA 3ZFJA 3SWNB 4C8QG 1M90C 3LGLA 3V7SA 4N4HA 3G4SA 3NFCA 3SB2A 2QQ9A 3HL8A 4A53A 3AHUA 4XAXB 1YCYA 5DY9A 4N0AC 2RHYA 4HT9A 4C92D 1YHQA 4C8QF 1O9SA 2ZPFB 1YIJT 3WXMB 4LD9K 1IZ6A 2E10A 2HNIA 1N9RA 3P8DA 1VQ4T 3QYGB 1JJ2S 1ZHIA 3J81E 4M7AC 2Y4YA 4IUPA 1K8AU 4RMOA 1M1FA 4M7AG 2LQ8A 3M53A 3OA6A 1OZ3A 4N4IA 3DLMA 4J6XA 1IREB 2XICA 4NOYA 3CCVA 1RL2A 2H3JA 3CD6T 2PVDB 5GANd 3OMGA 5LJ5d 2KK4A 4OB0B 5CKDA 3V7RA 2LCCA 4QQ6A 3OY9A 3OS5A 2P4TA 3HPWA 4N0AA 1QP2A 2FYKA 2XHCA 1Y7XA 3A8LB 3OMCA 1AHJB 2DPPB 4NL2A 4BY6C 4C0DB 3RIRA 5LJ5g 5LJ5e 5GAN7 2X4XA 3V8KA 4M7DC 3P8BB 1I8FA 2F69A 2KSSA 4XTYA 1BIBA 1B34A 2EQUA 5J3BA 5GAMh 3CCVT 1JBMA 1JJ2A 2XIDA 4C5EA 3JCMf 2MI6A 3BW1A 4M77F 5GAMf 2KVQG 3CCQA 2EJFA 3RMQA 4MZPA 5IN1A 3CCRT 4BI3A 1WNLA 2XD0A 4Y28E 3MEUA 3CCLT 1KQSS 3VV0A 4LD6A 4C92C 4A4GA 2XK0A 3J7AF 4JS5A 4UC4A 1Q86U 4KUDK 3BY7A 3OYAA 3TCJA 3CMAA 2E65A 2K5IA 3PGGA 3PNWC 3UT1A 1Q7YC 2KDSA 4J8OA 3CBPA 4BE0A 5GAOq 2R57A 2EKOA 1Y96A 1UGPB 3OYFA 4QQGA 2HBPA 4M75C 3VJPA 4NS5A 1YHQT 5LJ3g 3LWHA 2L3RA 3CC2A 2EQJA 1YIJA 2E6ZA 4J6WA 3QHSA 3KUFA 5DLOA 4F7UG 1GXIE 2L5QA 3QDRB 4X9CA 4XTWA 2MAMA 1U1TA 5J26A 2M9UA 4M75G 1VQ5T 2CZ0B 3CCJT 1UGQB 5GANe 4E7HA 2LC4A 5FROA 4C8QB 4NL3A 2XDDA 1VQOT 2E5QA 1WGSA 1VQPA 3QBYA 3CC2T 3T9NA 2RA2A 3JB9G 3MP1A 2LX9A 2E12A 2Y4XA 1G3TA 3G4ST 4BACA 4BY6B 3OYMA 4PJOE 1NZ9A 3ZEHA 4PKCC 4HCCA 3PT9A 3UPUA 2QEXT 1S72T 5FRNA 1BI0A 4OMFB 1KQSA 1YBYA 2K57A 4ME7A 3FC3A 2RHIA 5GMKh 4PL6A 3G7ZA 4C0ZA 1WQWA 1N6AA 2GQVA 3JCMQ 4M78E 3RESA 2HD0A 3A8MB 3URGA 4M77C 2YRVA 5GAOr 1KC8C 3L2ZA 4A4FA 3JCMd 1VQNT 3E19A 3A8OB 2YHTA 5I2SA 2K4YA 3JB9H 3MEWA 1S72A 1M4ZA 1ZBXA 3OYDA 3MO8A 2HAXA 2D6FA 3MEAA 1U1SA 4IUTA 4C92E 3CCUA 2DXTA 4O6JA 2K3XA 1W2BA 4GY5A 1NPPA 3HP9A 2GFAA 4J5YA 1VQ7A 5HKCA 3TEEA 1VQKT 1BI1A 3KXTA 5HY6A 4M78B 3UDCA 4BB7A 3HRTA 3M9QA 4R56A 3VYHB 1UB4A 2IVWA 3CXCA 2ZGWA 4DQ2A 5GAOn 1H3ZA 3FRNA 5L8RE 3CCLA 1WQ7A 2A7YA 4J6YA 3GOXA 1VIFA 4GLKA 4M7AA 4ZGDB 3CC4A 4BDZA 4L6V5 3DLLA 3QG1A 4PNOA 4F7UB 2O4XB 5CK9A 1QVFA 4R55A 3C12A 3L42A 4CRIA 3JB9I 2R5MA 3CPWA 3M5AA 2LT1A 5GAN6 5A0DA 3A8GB 4ZTJA 5CKHA 5LJ5f 1M1KC 1KG1A 1G3YA 4M77G 2EFIA 4PJOC 4XU0A 3C95A 3CD6A 4C8QA 4J7FA 2RJDA 3OB9A 3QXEB 1WJRA 2DIGA 3PMIA 4ZGEB 3OYIA 1OI1A 3E9GA 4FL6A 4JUVA 1QVPA 4OGEA 1VQ5A 2BKDN 4QQDA 5D6XA 2QA4A 1D3BB 5D6WA 2DTOA 4OGCA 3VKIA 2BIVA 3CCET 4QVZA 1H641 2F5TX 2PU9B 3CCUT 2RJFA 1P92A 1WPYA 3MP8A 5DM7R 4EMKC 1YJ9T 3RKYA 1UEBA 2WSFE 2VXEA 2QQBA 3KBGA 2EWNA 4HT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PUO B;  2ZCF B;  2QDY B;  2DD4 A;  3WVE B;  4RKU E;  1JB0 E;  2D0Q B;  2PUK B;  2DD5 A;  2ZPB B;  2ZPH B;  1UGS B;  2O01 E;  2WSC E;  3LW5 E;  2PVG B;  1PSF A;  1PSE A;  2DXC A;  2ZPE B;  2ZPF B;  3A8H B;  3QXE B;  2PVO B;  2ZPG B;  3QZ9 B;  4FM4 B;  3VYH B;  3X20 B;  3A8M B;  3QYG B;  4ZGJ B;  1GXI E;  1UGR B;  3X24 B;  5L8R E;  3X25 B;  4XK8 E;  2CZ0 B;  3A8O B;  4OB2 B;  4Y28 E;  1UGQ B;  3VYG A;  3X26 B;  1QP3 A;  3QZ5 B;  1DJ7 B;  2ZPI B;  2DPP B;  4ZGD B;  4KT0 E;  3QYH B;  4L6V 5;  1IRE B;  2CZ7 B;  4OB3 B;  2PVD B;  2PU9 B;  2ZZD A;  3X28 B;  2DXB A;  3WVD B;  4OB1 B;  4OB0 B;  2AHJ B;  3HHT B;  2CZ1 B;  1QP2 A;  2WSF E;  2CZ6 B;  2CYZ B;  3A8L B;  2WSE E;  1AHJ B;  1V29 B;  4ZGE B;  3A8G B;  1UGP B; 
#chains in the Genus database with same CATH topology
 1Y57 A;  2JS2 A;  4PFO A;  1Y71 A;  3JCM P;  1I07 A;  1NJI R;  2XI9 A;  1LPL A;  5FWB A;  4JRP A;  5DLQ E;  2XG8 D;  4ZTF A;  5GJW B;  1HK9 A;  2QQR A;  2VYT A;  3S6W A;  2DL3 A;  4M7A E;  1TUC A;  1I0C A;  4HVU A;  2E3H A;  3THK A;  2M1H A;  2CZ1 B;  1ZSZ A;  1N8R C;  1VQ8 T;  1BIA A;  2RMO A;  4C0G A;  2K6D A;  1QVF S;  1VQO Q;  1E6G A;  1PSF A;  2JW4 A;  8ATC B;  3QII A;  3CCS T;  3E2U A;  5A2Q E;  2COW A;  4IUQ A;  3MEV A;  1PD0 A;  2A0F B;  2RPN A;  3I56 T;  2NLU A;  4LDW A;  5LJ5 j;  1RAF B;  2LRQ A;  2CSI A;  1MV3 A;  3L2V A;  2LQW A;  1SHF A;  3M59 A;  2EQM A;  2KAF A;  4QKU A;  2CP0 A;  3G6E Q;  2FPD A;  5EG2 A;  2AK5 A;  3CBO A;  5A0G A;  3EH1 A;  2LT4 A;  4AT1 B;  2ED1 A;  5D7U A;  3EFS A;  1LJO A;  3O8V A;  2K5L A;  2RH2 A;  1LOJ A;  1G8X A;  5KE3 A;  2OTJ A;  4KRT A;  2FHD A;  2V8I A;  4M78 F;  3CCJ Q;  1C6V X;  2CSQ A;  3VUB A;  2JUF A;  1XTD A;  2RQV A;  1K4U S;  2PVO B;  1YI2 A;  3J80 E;  3I55 T;  1YJW A;  4BDY A;  4C0F A;  1C0M A;  2MWO A;  2RK2 A;  2M0O A;  2A28 A;  1AZG B;  1BCO A;  1M90 U;  2OTL A;  1PRM C;  2VB6 A;  3SEM A;  4C92 G;  1PCX A;  3V8L A;  4LDU A;  4B9X A;  4XU2 A;  3QUI A;  2KBT A;  4C5H A;  5GMK i;  2EAY A;  2X3X D;  1UUE A;  5GAN g;  2RI3 A;  2DIQ A;  3H9N A;  1KD1 U;  1UG1 A;  2DXB A;  1GCQ A;  1YIT T;  5I2M A;  2YT6 A;  1E7O A;  4FYY B;  1BU1 A;  2KEA A;  3FB9 A;  4HVV A;  4L59 A;  3I9Q A;  1VQM A;  2HBW A;  2YDL A;  3CPF A;  3JCM J;  1NJI U;  1WJQ A;  1UGS B;  1OX9 A;  5CR2 A;  1YJN T;  3CCM T;  2FEI A;  2LQK A;  4MMK A;  1VQ8 A;  1KHC A;  4Y91 A;  4C5G A;  5CQY A;  3QYH B;  1EFN A;  1YIJ Q;  3X28 B;  4MDW A;  1IGQ A;  1GFC A;  2IG0 A;  2JN0 A;  5KCH A;  4KUI A;  4PLL A;  2HDA A;  3BFM A;  3EHQ A;  2O2O A;  1O75 A;  4RG2 A;  4HVW A;  5FU6 C;  1W2B S;  2RK1 A;  3CBM A;  4E7Z A;  2AKL A;  2CGH A;  2K9G A;  2P0P A;  3VS3 A;  2DKG A;  1XOV A;  4E7K A;  3PTA A;  4M78 C;  4E2F B;  4IUR A;  5HK3 A;  5GJV B;  1SRL A;  2DJQ A;  4J9E A;  2X51 A;  5CCA A;  1Z9Z A;  2QTV A;  3L2R A;  1QVG P;  2QQS A;  4KBM B;  4ZGJ B;  2AIR B;  2EGA A;  4FU6 A;  3OW2 P;  3SWN A;  4LDV A;  2DRK A;  1EZZ B;  4A63 B;  2L89 A;  2QGG A;  1XNI A;  1F1B B;  2OX7 A;  3OYN A;  3EG2 A;  3OS2 A;  1PKT A;  3PIP A;  4M7D B;  1NM7 A;  4L5G A;  3G71 A;  2AZV A;  3MHX A;  1PC0 A;  4XTV A;  1W70 A;  5I22 A;  4C5I A;  2SEM A;  2PNI A;  2OTL T;  2A37 A;  4V2S A;  2CUB A;  1VQL T;  2DIL A;  3CCR A;  1KQ2 A;  2R5A A;  5KYY B;  2NUT A;  2GCX A;  3LH0 A;  2G3R A;  5LL6 S;  2MOX A;  1R77 A;  2DZC A;  3PFS A;  1X6G A;  3FIF A;  1RLQ C;  3SFM A;  2JOY A;  4M77 E;  4RCC A;  2DL7 A;  1AWX A;  3Q1J A;  2P4R A;  3L2Q A;  5CVI A;  5GAN 3;  2LCS A;  2YWW A;  3QSU A;  1CSK A;  1RI0 A;  1GBR A;  2A36 A;  3S3M A;  2M0Y A;  4ELZ C;  1VQK Q;  2ABL A;  1UFF A;  4RTT A;  5C6S A;  3CCQ Q;  3ZFJ A;  3LGL A;  3SB2 A;  2W10 A;  2RHY A;  2CP3 A;  1O9S A;  4LD9 K;  3H0F A;  2BE7 D;  1K8A U;  1KIK A;  1VQ8 Q;  4JJD A;  1X43 A;  3OA6 A;  1OU8 A;  3CCV A;  2H3J A;  3CD6 T;  2PVD B;  4OB0 B;  2JMC A;  4BI4 A;  4R55 A;  3CCS Q;  1AHJ B;  5GAN 7;  1AT1 B;  3V8K A;  4M7D C;  3P8B B;  2F69 A;  2KSS A;  4RTZ A;  2HL5 C;  4XTY A;  1JJ2 A;  1JBM A;  2CP7 A;  1LVK A;  3BW1 A;  4MZP A;  2ECZ A;  4Y28 E;  2RQU A;  1KQS S;  5FW9 A;  4C92 C;  4RTX A;  4HXJ A;  2YUP A;  4A4G A;  4UC4 A;  1ZSZ C;  2K5I A;  3CBP A;  1D1C A;  7AT1 B;  2L3R A;  1SRM A;  2E6Z A;  1GXI E;  4X9C A;  1U1T A;  3A98 A;  1X2Q A;  4CC3 A;  3CCJ T;  4E7H A;  2DVJ A;  2E5Q A;  1Y0M A;  2RA2 A;  1IHV A;  1RAI B;  3VS7 A;  4Z8A A;  3MP1 A;  2LX9 A;  2Y4X A;  3EFO A;  3I55 Q;  1G3T A;  1SF9 A;  4PJO E;  3ZEH A;  1HSQ A;  2B86 A;  2RQW A;  2RHI A;  3FC3 A;  3A1P A;  4C0Z A;  2YRV A;  2YHT A;  3CPW P;  1S72 A;  2ZAE A;  3OYD A;  2V1Q A;  3MO8 A;  1ZA2 B;  1U1S A;  4IUT A;  1W2B A;  4GY5 A;  2GFA A;  2E4H A;  4M78 B;  2RNA A;  3UDC A;  3HRT A;  3M9Q A;  4E6R A;  4DEX A;  4IIO A;  4R56 A;  2ZGW A;  3EG1 A;  3FRN A;  5L8R E;  1SEM A;  2A7Y A;  4L6V 5;  5KYU A;  4KH1 B;  3C12 A;  1JU5 C;  3CCM Q;  2BE9 B;  2LT1 A;  1UE9 A;  1YN8 A;  4FW1 A;  5CKH A;  2YRC A;  2EFI A;  4PJO C;  3CD6 A;  1YFN A;  3QXE B;  2DIG A;  2CRE A;  4ZGE B;  4B6M A;  2O88 A;  4OGE A;  3TSZ A;  4X1V A;  1VQ5 A;  4OGC A;  3EG3 A;  3C0C A;  2QAZ A;  2E3I A;  4OMO A;  2X3W D;  3UA7 A;  2QG9 B;  3RKY A;  1AZE A;  2QQB A;  2EQJ A;  2QEX A;  3JB9 D;  4X34 A;  4J9B A;  2KMT A;  3BE3 A;  5D6Y A;  2HSE B;  2G6F X;  4JPB W;  2C0I A;  4HCK A;  4Y92 A;  1X27 A;  5AYF A;  5M9O A;  2R58 A;  2C06 A;  4EDU A;  4AFZ C;  3QZ5 B;  2EYZ A;  2LNV A;  3INZ A;  3M58 A;  3JRZ A;  3MET A;  2LDM A;  4M78 D;  2KI7 A;  2V8K A;  2ZCF B;  3M54 A;  2VGM A;  3SHW A;  1Q95 G;  4EMH A;  5KYW B;  1VQ9 T;  2Z0W A;  1S1N A;  2WAC A;  4Z88 A;  4ESR A;  1X6O A;  2NWM A;  3X26 B;  1BB9 A;  3NGP A;  3CCE A;  3EAE A;  1X01 A;  6AT1 B;  5GMK e;  2YUO A;  2JVV A;  4M78 A;  2O9V A;  5FRM A;  1E6H A;  4LDX A;  2VC8 A;  1WA7 A;  4M77 D;  4M7D E;  3HSB A;  1QW1 A;  4FM4 B;  2NYS A;  1VUB A;  2QGF B;  1NLO C;  5GAN h;  3ZBD A;  3JV3 A;  4E7S A;  1VQK A;  1RAC B;  1IXD A;  2RJE A;  1RAA B;  3OW2 A;  3OYG A;  2BUD A;  2VUB A;  2KQW A;  2YLC A;  4KH0 B;  1FMW A;  3EFO B;  2YLB A;  4M75 A;  1KD1 C;  3M4Y A;  1ZUU A;  3CC7 Q;  4LDY A;  1I5L A;  4ZN3 A;  2JNG A;  2QDY B;  5GMK m;  2HQX A;  4E7I A;  4LN2 A;  3EFR A;  3DKM A;  2DX1 A;  3TRE A;  3H41 A;  5CQX A;  1SSF A;  1YCS B;  2Y90 A;  1G5V A;  2QQA A;  1UDL A;  4PJO F;  3CCS A;  1WHJ A;  2KRN A;  3E9F A;  4E7J A;  3EH2 A;  4M75 D;  4FT2 A;  2VAS A;  3UF4 A;  2B8A A;  3CC7 A;  1M8V A;  5IXB A;  1I5O B;  2RN8 A;  2PUO B;  1QLY A;  2FZG B;  1CKB A;  4JRK A;  2MYS A;  2DD5 A;  3NTI A;  1V1C A;  1LCK A;  2JXB A;  1YWP A;  3HRS A;  3S3N A;  1H3H A;  2JS0 A;  2COY A;  1PNJ A;  2EYX A;  2LVM A;  2DBM A;  4J9I A;  1IHW A;  5LJ3 d;  1Q81 C;  1NE8 A;  1WJS A;  4A4K A;  4FW2 A;  4FSS A;  4LXC A;  4FYW B;  5KYX A;  1OV3 A;  2PZ1 A;  4RTY A;  2GFU A;  1UHF A;  2XDB A;  4X9D A;  2VWF A;  5IXF A;  4RTW A;  4M7A B;  5GMK l;  1Q86 R;  4FCY A;  4M4Z A;  1NPR A;  2O4X A;  2XU8 A;  4MDX A;  2LTO A;  4PJO A;  2K3Y A;  4JJN K;  1AVZ C;  2DVE A;  1D1A A;  3PIO A;  1KHI A;  4M75 E;  1YI2 T;  1PSE A;  1Q81 R;  4IUV A;  1ZUK A;  3PVL A;  3FJ5 A;  2KXD A;  2OI3 A;  3QPH A;  2V8J A;  1N8R U;  2H8H A;  4QW2 A;  4BE2 A;  1VQ7 T;  4EMG A;  3HHT B;  3CQT A;  2CZ6 B;  2QA4 Q;  2E64 A;  4F04 B;  1B7T A;  5GMK j;  1OEB A;  2DRM A;  2MIO A;  5GAM g;  2EIF A;  1YJN A;  2DAQ A;  3RKX A;  1Z9Q A;  3G71 Q;  1M2V A;  1I4K 1;  2DLP A;  4M77 B;  4XK8 E;  1M1K R;  1BKB A;  2E1H A;  1RAE B;  3H8Z A;  5HK0 A;  5J39 A;  1K8A R;  1VQ6 T;  4MML A;  1MMA A;  2BZ8 A;  2DA9 A;  1VQP T;  1SG5 A;  2ZPG B;  2FVU A;  3GNG A;  4C92 A;  1TG0 A;  1OQK A;  5I21 A;  3OYK A;  2A08 A;  3V7C A;  1DJ7 B;  1B34 B;  1KSW A;  1D0Y A;  4RG8 A;  4TVR A;  3NTH A;  3M56 A;  3QJY A;  3OS1 A;  1Q82 C;  5KYY A;  4XU3 A;  1XQH A;  3HFO A;  3C94 A;  3M0Q A;  1D1B A;  1FYN A;  2KRS A;  3JCM c;  3SD4 A;  3CME T;  4XTX A;  3GBQ A;  1OUL A;  1PM3 A;  2FL7 A;  4FSX A;  3G6E A;  1N5Z A;  4QT7 A;  2LZ6 B;  2RQT A;  3LYI A;  3ZL7 C;  2RD1 A;  1I81 A;  1B3Q A;  2HKN A;  3GNF B;  3RKW A;  2I2L A;  2JTF A;  3MPU B;  2GF7 A;  8AT1 B;  2EBP A;  4J9H A;  4EPC A;  1GCQ C;  3SWN B;  3CCR Q;  1M90 C;  3V7S A;  4N4H A;  2OJ2 A;  4XAX B;  4N0A C;  4C92 D;  2E10 A;  1Q7Y R;  3P8D A;  1VQ4 T;  1JJ2 S;  1ZHI A;  3J81 E;  4M7A C;  4D8D A;  3DLM A;  5LJ5 d;  2KK4 A;  3V7R A;  3OY9 A;  3OS5 A;  3HPW A;  3A8L B;  2CUD A;  1Y7X A;  4NL2 A;  5LJ5 e;  2VKN A;  2CT3 A;  4AG2 C;  2KRM A;  5J3B A;  2DEU A;  4C5E A;  3JCM f;  3EG9 A;  1VQ6 Q;  5HCK A;  3CCQ A;  2XD0 A;  2FPF A;  3CCL T;  2CP2 A;  1N8R R;  4LD6 A;  1VQM Q;  2LJ3 A;  1X2K A;  1VQP Q;  3BY7 A;  3PGG A;  3PNW C;  4KGX B;  1IO6 A;  3OYF A;  3VJP A;  3NHN A;  5LJ3 g;  1AOJ A;  3CC2 A;  4J6W A;  3QHS A;  4F7U G;  3QDR B;  5J26 A;  1AEY A;  1VQ5 T;  1UGQ B;  4C8Q B;  5FRO A;  4NL3 A;  1VQO T;  1WGS A;  1QWE A;  1VQP A;  1T0H A;  3CC2 T;  2NUP B;  4CC4 B;  3R6N A;  4BAC A;  1K1Z A;  2EYW A;  3QDF A;  1KQS A;  2K57 A;  5GMK h;  4OML A;  1IRX A;  3VS0 A;  3JCM Q;  1N6A A;  3UAT A;  2HD0 A;  3MJX A;  1RAB B;  1AWJ A;  1PKS A;  3L2Z A;  4ANJ A;  1M4Z A;  4AFQ C;  1G2B A;  1NYF A;  4LUD A;  4PJJ A;  1M2V B;  2YSQ A;  3HP9 A;  1MV0 B;  1BI1 A;  5HY6 A;  2EPD A;  1TXQ A;  4BB7 A;  4AMC A;  3VYH B;  3CXC A;  4DQ2 A;  2M02 A;  2QDL A;  2J6O A;  2V26 A;  1VIF A;  4GLK A;  2QEX Q;  2J6K A;  3D7S B;  5CK9 A;  3L42 A;  1D0X A;  2R5M A;  4OMM A;  3CPW A;  1MMD A;  5KYU B;  5A0D A;  2ROT A;  5LJ5 f;  3EGU A;  1M1K C;  1HJD A;  4M77 G;  1BBZ A;  4XU0 A;  4J7F A;  1VYT A;  1TWB A;  1OI1 A;  4FL6 A;  4JUV A;  1QVP A;  2BKD N;  5D6X A;  3LH5 A;  2QA4 A;  3VKI A;  2BIV A;  3CCE T;  4QVZ A;  2F5T X;  4EMK C;  2M51 A;  2MPX C;  2O4X B;  3UA6 A;  5CAI A;  1JB0 E;  1VYU A;  2DO3 A;  3QWY A;  1KQ1 A;  3GF5 A;  3M0T A;  4M7A D;  2FRY A;  4HCB A;  2I0N A;  3V8J A;  4IUU A;  4JJC A;  2DE0 X;  4PJO D;  2C0O A;  3ASK A;  3FEO A;  1BI3 A;  1YJN Q;  1K9M R;  1WI7 A;  5FLX E;  2HQE A;  5LJ3 f;  5GAO l;  5LJ3 e;  3JCM W;  1K0X A;  2E5K A;  3FJP A;  2PTK A;  1TUD A;  2ZPH B;  1VOM A;  3I56 A;  1Q82 R;  1YJ9 Q;  2RI2 A;  4ELY C;  2D0N A;  2K3B A;  2EVR A;  2CS7 A;  4WF2 A;  5CKE A;  2VXF A;  3QKJ A;  1OX8 A;  1QKW A;  3F70 A;  3IQL A;  5GAN j;  2P0Q A;  4PJM A;  3FLG A;  1FX7 A;  4JJB A;  1Q86 C;  2PVG B;  1MMG A;  4DBH A;  2JMA A;  2RJC A;  5IAY A;  5KE2 A;  1KD1 R;  2OTJ T;  1U5S A;  3X25 B;  3CME Q;  2DL4 A;  4EMK B;  1JQQ A;  3H0I A;  3BDL A;  1UGV A;  1FMV A;  1TS9 A;  2DET A;  2NUP A;  1YJW T;  3OBY A;  4HCZ A;  1XJW B;  1N9S A;  3WVE B;  4A4E A;  2DJZ A;  3CCE Q;  4OP0 A;  4PJO G;  4DOV A;  3MKD A;  3HKS A;  2LMJ A;  4BD3 A;  1KQS P;  1K9M U;  2F2V A;  3L2U A;  1K8A C;  1MNE A;  2HCK A;  2QI2 A;  1VYV A;  2QTX A;  3OBW A;  2A3L A;  2KT1 A;  1JXM A;  4C8Q E;  2V1R A;  2AHJ B;  2CH4 W;  2DYI A;  4M75 F;  2C0T A;  4DBQ A;  1M3C A;  2CKK A;  1NG2 A;  1VQN Q;  2ROL A;  3PVQ A;  1ZQ1 A;  2PUK B;  1W2B P;  3OYJ A;  3EG0 A;  4XQ3 A;  4IIM A;  1YJ9 A;  2BTT A;  2K2M A;  1NLP C;  1ZSG A;  2VGN A;  3H6Z A;  4Z02 A;  5CKF A;  5LJ3 h;  4JRQ A;  2FZC B;  4D6W A;  2MMP A;  1NYG A;  4Q5W A;  3DB3 A;  4PK4 A;  1WHL A;  4F7U F;  2O9S A;  1VIE A;  2DEQ A;  1Q82 U;  2E41 A;  5KH6 A;  1TUG B;  2NUT B;  3M0S A;  1FXX A;  2X4Y A;  4PJL A;  2K7A A;  4JLG A;  2CT4 A;  1FWZ A;  2RI5 A;  3CEY A;  3GPL A;  4RCB A;  2LP5 A;  3OSS C;  2DNU A;  5FU7 C;  1D3B A;  1GFD A;  1KFZ A;  2OTJ Q;  4FT4 A;  4MZM A;  2DBK A;  2DF6 A;  2D0Q B;  2L8D A;  3G1J A;  3TQ7 P;  3I56 Q;  2RQR A;  3LLR A;  1MUZ A;  3HRU A;  2E6N A;  1NBE B;  2RHZ A;  3SWN C;  2QYZ A;  1R8O B;  3OYH A;  1UEC A;  4OVA A;  4EMK A;  3GLX A;  1QCF A;  2EW3 A;  4YTL A;  3AT1 B;  3UWN A;  3P8H A;  1VQL Q;  2GNC A;  1V29 B;  4LNP A;  3DB4 A;  1SSH A;  4M78 G;  1ABO A;  1UTI A;  3VS6 A;  2DXC A;  3OSV A;  1T0J A;  2D9T A;  4C92 F;  3REB B;  3CPW S;  1YP5 A;  1M3A A;  2RHX A;  2K5F A;  1GRI A;  5CO7 A;  2QAS A;  2LJ0 A;  2DK3 A;  2DL5 A;  1Y07 A;  2EQK A;  5A0L A;  3CCV Q;  1W4S A;  4OB1 B;  4OMN A;  5GAM j;  4M7D F;  3I55 A;  2DTH A;  1RAG B;  4E7L A;  4C0D C;  1MHN A;  3CCJ A;  4ZN1 A;  4GBQ A;  1Y96 B;  3JCM b;  1VQ4 A;  3CCQ T;  4M7D G;  2P0K A;  2ZPI B;  2MWP A;  4E47 A;  1JRI A;  1WX6 A;  2HQH A;  1VQ7 A;  2VVK A;  3WVD B;  5GAO p;  4M75 B;  2ATC B;  2E70 A;  1K76 A;  1A0N B;  1EIF A;  1VQN A;  2RM4 A;  2RHU A;  2X4J A;  2X4W A;  4JLI A;  4FYV B;  1SHG A;  2DZ9 A;  3CXC S;  2M16 A;  1TSF A;  4HA8 A;  1N27 A;  1TH7 A;  2H3E B;  2ZZD A;  5CKB A;  3VS1 A;  1VQ6 A;  3VRY A;  3G4S A;  1WXU A;  2EGC A;  1YCY A;  2CP6 A;  2IPO B;  1YHQ A;  3U23 A;  4C8Q F;  1YIJ T;  3WXM B;  2HNI A;  1N9R A;  3QYG B;  1H92 A;  2Y4Y A;  2IIM A;  4RMO A;  1OOT A;  4M7A G;  2LQ8 A;  1OZ3 A;  4N4I A;  4J6X A;  2XIC A;  4NOY A;  1RL2 A;  5GAN d;  1W6X A;  2LCC A;  4QQ6 A;  3VS4 A;  2P4T A;  1QP2 A;  2FYK A;  1OPL A;  4C0D B;  3REA B;  2AKK A;  1I1J A;  1I8F A;  1GL5 A;  2GBQ A;  3I35 A;  4KGZ B;  1BIB A;  5GAM h;  3CCV T;  1NEG A;  2MI6 A;  2KVQ G;  1SKU B;  1WHM A;  3RMQ A;  4PFZ A;  2W0Z A;  4BI3 A;  1WNL A;  1IGU A;  3VV0 A;  1ZX6 A;  4J9C A;  1IB8 A;  2FZK B;  2XMF A;  3TCJ A;  3CMA A;  2E65 A;  3UT1 A;  1Q7Y C;  2KDS A;  4BE0 A;  1ZBJ A;  5GAO q;  2R57 A;  2EKO A;  1UGP B;  1Y96 A;  4QQG A;  2HBP A;  4M75 C;  2KE9 A;  1PHT A;  3CD6 Q;  2EYY A;  2HZY A;  3KUF A;  5DLO A;  1OU9 A;  2MAM A;  4M75 G;  2CP5 A;  2KYB A;  2XDD A;  2LNH B;  1YWO A;  1VQ9 Q;  3T9N A;  2OTL Q;  1KC8 R;  2JM9 A;  3OYM A;  3M0P A;  4PKC C;  4HCC A;  1S72 T;  1BI0 A;  4ME7 A;  4PL6 A;  2BZX A;  1WQW A;  3RES A;  3A8M B;  2DMO A;  3URG A;  4KGV B;  4RTV A;  3JCM d;  4R0K A;  1VQN T;  3A8O B;  5I2S A;  1QWF A;  3MEW A;  2L3P A;  1RAD B;  3MEA A;  4C92 E;  3CCU A;  5IHK A;  4PFP A;  1ZA1 B;  4ORZ A;  3EG9 B;  1VQK T;  3CC4 Q;  3KXT A;  1K9A A;  1UJY A;  4RTU A;  3RR6 A;  1UB4 A;  2IVW A;  1H3Z A;  3CCL A;  1D09 B;  1RLP C;  2HSP A;  1WQ7 A;  3EGX B;  4J6Y A;  3GOX A;  4ZGD B;  4BDZ A;  2ESW A;  2RF0 A;  3QG1 A;  4PNO A;  4F7U B;  1QVF A;  3RBB B;  4CRI A;  3M5A A;  5GAN 6;  1KG1 A;  1G3Y A;  3C95 A;  2K79 A;  2RJD A;  1WJR A;  3OYI A;  3M0U A;  4QQD A;  1D3B B;  5D6W A;  1X6B A;  2DTO A;  2DER A;  4OMP A;  1WPY A;  2JT4 A;  1UEB A;  2WSF E;  2VXE A;  3OB9 A;  1BCM A;  1JXO A;  3RMS A;  1M1G A;  4BE1 A;  2O01 E;  4M77 A;  2L3S A;  3R6O A;  3NTK A;  1NEB A;  1KC8 U;  3OYY A;  4WTO B;  3TSW A;  1QP3 A;  1W1F A;  3QJ6 A;  2COZ A;  1R0C B;  2CH4 A;  1PG5 B;  5CIU A;  2EJG A;  1WDX A;  4A54 A;  2J7I A;  3JSC A;  1C1A A;  1WYX A;  4J9F A;  2WSC E;  4AG1 C;  1PD1 A;  4F17 A;  2F1L A;  5GAM d;  5GAM e;  1WZO A;  4J83 A;  3MCA B;  2J6F A;  3A8H B;  4JZ3 A;  3M0R A;  3X24 B;  5LJ5 h;  5GAO m;  9ATC B;  2XDP A;  3PE0 A;  4MZT A;  4PJN A;  3CC4 T;  2AZS A;  3OYC A;  2X9H A;  5FU6 B;  4GLM A;  1VQ9 A;  3OQ5 A;  4JZ4 A;  3TU4 K;  1MGQ A;  2F2X A;  3M55 A;  3L1A A;  3GP8 A;  1YIT A;  3LGF A;  4O5V A;  3A5Z B;  1Q7Y U;  2YUN A;  2J06 A;  1YNZ A;  3QO3 A;  1M3B A;  4JS4 A;  1OPK A;  5FWC A;  2MF2 A;  3C4S A;  4DOW A;  5L23 A;  1VQ7 Q;  1QCO A;  4KUL A;  1M30 A;  1MND A;  2FG0 A;  2QA4 T;  4F7U E;  2HKQ B;  2P84 A;  2KR3 A;  4D8K A;  2CDT A;  4M7D D;  3O5Z A;  3EGX A;  1PWT A;  1Q81 U;  4F7U A;  4XU1 A;  2L3Q A;  1B07 A;  3VS2 A;  1G3W A;  2ZPB B;  3JCM V;  4PJO B;  1UGR B;  4II1 A;  3OS0 A;  2KY9 A;  2D1X A;  4KT0 E;  3JB9 J;  4QVC A;  3OW2 S;  1T3S A;  1KJW A;  2F2W A;  1ARK A;  4M7D A;  2LQN A;  4FIB A;  5C0M A;  1BI2 A;  2CYZ B;  1UHC A;  4J9G A;  3PMT A;  2JZ2 A;  4RKU E;  4N4G A;  3M57 A;  1K73 U;  3QZ9 B;  1X75 C;  3EHR A;  1K9M C;  1UJ0 A;  3CC7 T;  3EGD B;  4OB2 B;  3ER0 A;  1M5Q 1;  2DTI A;  2PQW A;  1ZSZ B;  2HL3 A;  1BK2 A;  3EGD A;  3JCM g;  2QXF A;  4C92 B;  2DD4 A;  1M8M A;  3JCM X;  2VV5 A;  3JCM h;  1BYM A;  3LW5 E;  4XTZ A;  2ZPE B;  5GAN 8;  3MP6 A;  4JRI A;  3ME9 A;  4CI0 C;  1M2O A;  1KK7 A;  3VUZ A;  2O31 A;  2KYM A;  3M4G A;  1TU0 B;  3BDU A;  3N5B B;  2EJ9 A;  1R0B G;  4B9W A;  1EX4 A;  1OYX A;  3VU3 C;  1QVG A;  2OAU A;  2WSE E;  3JB9 F;  3G71 T;  4PLI A;  1QQJ A;  5IT9 E;  3RDV A;  5KYN A;  4VUB A;  1ACM B;  3E1S A;  4DA4 A;  2OAW A;  2DXU A;  4OF1 A;  1VQL A;  3LX7 A;  4ATO A;  1M90 R;  2BZY A;  2YUQ A;  3VYG A;  2KRO A;  1S72 Q;  1G3S A;  4EIK A;  2K2V A;  5GAN 4;  4AFU C;  3JAM E;  3LWI A;  4OMQ A;  5KYW A;  5IHN A;  1FMK A;  1VQM T;  4P5N A;  4QVD A;  1LNX A;  1SPK A;  4LE9 A;  1CKA A;  3X20 B;  4C8Q D;  3CCM A;  2HEQ A;  4HKE A;  2JTM A;  3VRZ A;  1M9S A;  3OYB A;  1QKX A;  3I5R A;  5I11 A;  1OZ2 A;  2D8J A;  2FO0 A;  2CZ7 B;  2JTE A;  1QVG S;  4J9D A;  5KCO A;  5LJ3 j;  5FU7 B;  4A4H A;  2FB7 A;  3HFN A;  1VQ5 Q;  1MMN A;  4F14 A;  2RO0 A;  4IKF A;  4M7A F;  2YRD A;  4K11 A;  3FDR A;  1VQO A;  1VA7 A;  4DBF A;  2ENM A;  4C8Q C;  3L2W A;  4DEY A;  3ULR B;  1D0Z A;  2EKH A;  2EYQ A;  5GAN f;  5KYX B;  1M1K U;  4BI8 B;  1U8R A;  1NJI C;  1YHQ Q;  4J7I A;  5FRN A;  2XKO C;  3G6E T;  3CMA T;  4F16 A;  1H8K A;  1VQ4 Q;  3RUX A;  2LCL A;  1HXD A;  4DBR A;  1RUW A;  1AWW A;  1T3L A;  2RB6 A;  4JDS A;  3SDZ A;  5GAN 5;  2LX7 A;  4Z89 A;  2MK5 A;  5GAN 2;  3OYL A;  4BUG A;  4XTU A;  3G4S Q;  3CME A;  1HYO A;  1WIE A;  1RAH B;  2F5K A;  3RER A;  1K73 C;  3GIB A;  2J05 A;  3OYE A;  3S3O A;  4OB3 B;  4LUE A;  3JCM e;  2X35 A;  4C8Q G;  3NFC A;  2QQ9 A;  3HL8 A;  1WLP B;  2ED0 A;  4A53 A;  3AHU A;  1K73 R;  5DY9 A;  4HT9 A;  1WHG A;  2ZPF B;  4CC2 A;  5EC7 A;  1IZ6 A;  3HTR A;  2GTJ A;  1WHH A;  4IUP A;  2DFU A;  1QMC A;  1M1F A;  3M53 A;  1RI9 A;  1IRE B;  3OMG A;  1YI2 Q;  2NUZ A;  5CKD A;  4N0A A;  3OMC A;  2XHC A;  4BY6 C;  5LJ5 g;  2DPP B;  3RIR A;  2X4X A;  1B34 A;  2EQU A;  2XID A;  3CC2 Q;  5GAM f;  4M77 F;  3TVT A;  2JM8 A;  1U06 A;  2SRC A;  2EJF A;  2DL8 A;  5IN1 A;  1YIT Q;  3CCR T;  2GQI A;  3MEU A;  3NPF A;  1G83 A;  2XK0 A;  2YXY A;  3J7A F;  4JS5 A;  1ZLM A;  1Q86 U;  4KUD K;  3OYA A;  1J3T A;  4J8O A;  1AWO A;  4NS5 A;  1YHQ T;  4RUG A;  3LWH A;  2FPE A;  1YIJ A;  1WXB A;  1JJ2 P;  2QK0 A;  3CCU Q;  3I5S A;  3CMA Q;  2L5Q A;  2KNB B;  4XTW A;  2JJ9 A;  2M9U A;  2EQI A;  2CZ0 B;  4WCI A;  5GAN e;  2FRW A;  5ECA A;  2LC4 A;  1ZUY A;  3QBY A;  3JB9 G;  2E12 A;  3G4S T;  1WFW A;  4CC7 A;  3CCL Q;  2L0A A;  4BY6 B;  2GTO A;  1NZ9 A;  5IHI A;  3PT9 A;  3UPU A;  3CXC P;  1ABQ A;  2QEX T;  4OMF B;  1YBY A;  3G7Z A;  1AD5 A;  2GQV A;  4M78 E;  2MCN A;  4M77 C;  5GAO r;  1KC8 C;  4A4F A;  3E19 A;  2K4Y A;  3JB9 H;  1X69 A;  1HD3 A;  1TTH B;  1ZBX A;  2HAX A;  1QVF P;  2D6F A;  2DXT A;  4O6J A;  2K3X A;  2KGT A;  1NPP A;  3QWX X;  1TOV A;  1WXT A;  4J5Y A;  1GBQ A;  1V76 A;  5HKC A;  3TEE A;  2KT8 A;  5IH2 A;  1JO8 A;  1WHK A;  1QCN A;  2DM1 A;  2KXC A;  3KFV A;  1M27 C;  5GAO n;  1YJW Q;  4AFS C;  4M7A A;  3CC4 A;  3DLL A;  1JEG A;  2GGR A;  3JB9 I;  2HMA A;  3VS5 A;  2L2P A;  3A8G B;  3RNJ A;  4ZTJ A;  2AT1 B;  5AT1 B;  1K0S A;  2EGE A;  2LJ1 A;  4C8Q A;  3PMI A;  3E9G A;  3H0H A;  2DYB A;  3NMZ C;  1U3O A;  1H64 1;  3CCU T;  2PU9 B;  1PRL C;  2RJF A;  1P92 A;  3MP8 A;  4FYX B;  5DM7 R;  1YJ9 T;  1GCP A;  4ZNX A;  2D8H A;  3KBG A;  2EWN A;  4HT8 A; 
#chains in the Genus database with same CATH homology
 5CAI A;  2QEX A;  3JB9 D;  4X34 A;  3RMS A;  1JB0 E;  1M1G A;  4BE1 A;  1Y71 A;  3JCM P;  2KMT A;  2DO3 A;  2O01 E;  2XI9 A;  5D6Y A;  4M77 A;  3R6O A;  1KQ1 A;  3GF5 A;  3NTK A;  4M7A D;  4JRP A;  1KC8 U;  5DLQ E;  2XG8 D;  3OYY A;  4HCB A;  5AYF A;  5M9O A;  4ZTF A;  2R58 A;  2C06 A;  4EDU A;  3V8J A;  4IUU A;  1HK9 A;  1QP3 A;  2QQR A;  2VYT A;  3QJ6 A;  3QZ5 B;  4PJO D;  3ASK A;  3FEO A;  3S6W A;  2LNV A;  3INZ A;  2EJG A;  1BI3 A;  5CIU A;  4M7A E;  3M58 A;  4A54 A;  3JSC A;  3JRZ A;  5FLX E;  2HQE A;  2M1H A;  3MET A;  2CZ1 B;  2LDM A;  4M78 D;  2WSC E;  5LJ3 f;  5GAO l;  2V8K A;  2ZCF B;  5LJ3 e;  3M54 A;  3JCM W;  1N8R C;  2VGM A;  1VQ8 T;  5GAM d;  3FJP A;  5GAM e;  1BIA A;  4C0G A;  1QVF S;  4EMH A;  2ZPH B;  1VQ9 T;  4J83 A;  3I56 A;  2WAC A;  1PSF A;  3MCA B;  3A8H B;  1X6O A;  2RI2 A;  4ELY C;  3X24 B;  3QII A;  5LJ5 h;  2CS7 A;  4WF2 A;  5GAO m;  2XDP A;  3X26 B;  3CCS T;  4MZT A;  3CC4 T;  5A2Q E;  4IUQ A;  3OYC A;  3MEV A;  3CCE A;  5CKE A;  5FU6 B;  2VXF A;  1VQ9 A;  3OQ5 A;  3EAE A;  3QKJ A;  3I56 T;  2NLU A;  4LDW A;  5LJ5 j;  1X01 A;  3F70 A;  3TU4 K;  1MGQ A;  5GAN j;  3M55 A;  5GMK e;  3L1A A;  2LRQ A;  3GP8 A;  1YIT A;  2JVV A;  3LGF A;  3L2V A;  2P0Q A;  4O5V A;  3A5Z B;  4M78 A;  1Q7Y U;  3M59 A;  2EQM A;  5FRM A;  3QO3 A;  3FLG A;  1FX7 A;  4JS4 A;  1Q86 C;  2KAF A;  2MF2 A;  3C4S A;  4LDX A;  4DOW A;  2PVG B;  2VC8 A;  4M77 D;  4M7D E;  3HSB A;  1QW1 A;  4FM4 B;  4KUL A;  2RJC A;  5IAY A;  1VUB A;  5KE2 A;  5EG2 A;  2OTJ T;  2QA4 T;  3X25 B;  5GAN h;  3ZBD A;  1VQK A;  3CBO A;  2RJE A;  4F7U E;  5A0G A;  2LT4 A;  4EMK B;  3OW2 A;  3OYG A;  4M7D D;  3EFS A;  2BUD A;  1LJO A;  2VUB A;  2KQW A;  3O8V A;  2K5L A;  2RH2 A;  2YLC A;  3BDL A;  1Q81 U;  1LOJ A;  2YLB A;  4M75 A;  5KE3 A;  2OTJ A;  1KD1 C;  3M4Y A;  2FHD A;  4LDY A;  2V8I A;  4F7U A;  4XU1 A;  1I5L A;  4M78 F;  1YJW T;  3OBY A;  4ZN3 A;  2JNG A;  2QDY B;  5GMK m;  4HCZ A;  3WVE B;  1N9S A;  2HQX A;  4A4E A;  3VUB A;  2DJZ A;  2JUF A;  4E7I A;  1NJI C;  1XTD A;  1G3W A;  3EFR A;  4OP0 A;  2ZPB B;  4PJO G;  3JCM V;  4DOV A;  3DKM A;  3HKS A;  4BD3 A;  3TRE A;  5CQX A;  2PVO B;  1YI2 A;  1K9M U;  3J80 E;  3L2U A;  1SSF A;  2Y90 A;  1K8A C;  4PJO B;  2QQA A;  1UGR B;  1G5V A;  4II1 A;  4PJO F;  3CCS A;  3I55 T;  1YJW A;  4BDY A;  3E9F A;  3OS0 A;  4C0F A;  2QI2 A;  2KY9 A;  4KT0 E;  4E7J A;  4QVC A;  3JB9 J;  4M75 D;  3OW2 S;  2QTX A;  3OBW A;  2MWO A;  2A3L A;  2RK2 A;  2M0O A;  4FT2 A;  4C8Q E;  4M7D A;  1M90 U;  2AHJ B;  2B8A A;  4FIB A;  5C0M A;  2OTL A;  4M75 F;  1BI2 A;  2CYZ B;  3CC7 A;  1M8V A;  4C92 G;  2CKK A;  2PUO B;  3PMT A;  2JZ2 A;  4RKU E;  3V8L A;  1ZQ1 A;  2PUK B;  4JRK A;  4LDU A;  4N4G A;  4B9X A;  2DD5 A;  3M57 A;  3OYJ A;  3NTI A;  1K73 U;  4XQ3 A;  4XU2 A;  3QUI A;  3QZ9 B;  1YJ9 A;  4C5H A;  5GMK i;  1X75 C;  2EAY A;  1K9M C;  2VGN A;  3H6Z A;  3CC7 T;  4Z02 A;  5CKF A;  3HRS A;  3S3N A;  5LJ3 h;  4OB2 B;  4JRQ A;  3ER0 A;  5GAN g;  2RI3 A;  2DIQ A;  1M5Q 1;  2DTI A;  2LVM A;  4BI4 A;  4D6W A;  2MMP A;  1KD1 U;  2PQW A;  4Q5W A;  5LJ3 d;  2DXB A;  3DB3 A;  1NE8 A;  1Q81 C;  1YIT T;  5I2M A;  3JCM g;  2QXF A;  4C92 B;  4F7U F;  1WJS A;  4A4K A;  1VIE A;  2DEQ A;  3FB9 A;  2DD4 A;  4L59 A;  1Q82 U;  2E41 A;  1VQM A;  5KH6 A;  3JCM X;  3CPF A;  3JCM J;  1NJI U;  2VV5 A;  1WJQ A;  3JCM h;  1BYM A;  1UGS B;  3LW5 E;  4XTZ A;  5CR2 A;  2ZPE B;  5GAN 8;  3MP6 A;  1FXX A;  2GFU A;  2X4Y A;  4JRI A;  3ME9 A;  1YJN T;  3CCM T;  4CI0 C;  4JLG A;  2XDB A;  4X9D A;  1FWZ A;  2LQK A;  2RI5 A;  4MMK A;  3CEY A;  1VQ8 A;  3VUZ A;  1KHC A;  3GPL A;  4RCB A;  4Y91 A;  4C5G A;  3OSS C;  3M4G A;  4M7A B;  5CQY A;  5GMK l;  3QYH B;  3BDU A;  1NPR A;  3N5B B;  2O4X A;  5FU7 C;  1D3B A;  3X28 B;  2XU8 A;  2EJ9 A;  2LTO A;  4MDW A;  2IG0 A;  4B9W A;  4MDX A;  1OYX A;  3VU3 C;  2JN0 A;  1QVG A;  5KCH A;  4KUI A;  4PLL A;  4FT4 A;  2OAU A;  2WSE E;  2K3Y A;  4MZM A;  3BFM A;  3JB9 F;  3G71 T;  4PJO A;  4PLI A;  4JJN K;  5IT9 E;  2D0Q B;  1O75 A;  2L8D A;  4RG2 A;  4VUB A;  3E1S A;  4DA4 A;  2DVE A;  3PIO A;  1KHI A;  4M75 E;  5FU6 C;  1YI2 T;  1PSE A;  1W2B S;  2RK1 A;  2DXU A;  3CBM A;  4IUV A;  4OF1 A;  3LLR A;  1VQL A;  2CGH A;  3HRU A;  3LX7 A;  4ATO A;  2E6N A;  2P0P A;  2RHZ A;  3QPH A;  2DKG A;  3VYG A;  2V8J A;  1N8R U;  1XOV A;  3SWN C;  1G3S A;  2K2V A;  1R8O B;  3OYH A;  4E7K A;  4QW2 A;  5GAN 4;  4OVA A;  4EMK A;  3PTA A;  3GLX A;  3JAM E;  4BE2 A;  4M78 C;  1VQ7 T;  4YTL A;  4IUR A;  4EMG A;  5HK3 A;  3LWI A;  3UWN A;  3HHT B;  3P8H A;  2CZ6 B;  1V29 B;  5CCA A;  3DB4 A;  2E64 A;  5GMK j;  1VQM T;  4P5N A;  3L2R A;  4QVD A;  1LNX A;  4M78 G;  2QQS A;  5GAM g;  2DXC A;  2EIF A;  4KBM B;  3OSV A;  3X20 B;  4FU6 A;  2D9T A;  4C92 F;  4ZGJ B;  1YJN A;  3SWN A;  2DAQ A;  4LDV A;  4C8Q D;  4HKE A;  3RKX A;  3CCM A;  3CPW S;  2JTM A;  2RHX A;  1M9S A;  2K5F A;  1I4K 1;  4XK8 E;  2L89 A;  4M77 B;  5CO7 A;  3OYB A;  1XNI A;  2DK3 A;  1BKB A;  1Y07 A;  3OYN A;  1OZ2 A;  2E1H A;  2CZ7 B;  2EQK A;  1QVG S;  5A0L A;  3OS2 A;  1W4S A;  5KCO A;  3H8Z A;  5HK0 A;  5LJ3 j;  4OB1 B;  5J39 A;  5FU7 B;  3PIP A;  5GAM j;  1VQ6 T;  4A4H A;  2FB7 A;  3I55 A;  2DTH A;  4M7D F;  3HFN A;  4M7D B;  4L5G A;  3G71 A;  3MHX A;  4MML A;  4E7L A;  4C0D C;  1MHN A;  2RO0 A;  4XTV A;  3CCJ A;  4IKF A;  4M7A F;  4ZN1 A;  4C5I A;  1Y96 B;  3JCM b;  3FDR A;  1VQO A;  1VQP T;  2OTL T;  4V2S A;  4C8Q C;  2ZPG B;  3L2W A;  2FVU A;  3GNG A;  4C92 A;  1VQL T;  1VQ4 A;  3CCQ T;  5I21 A;  3OYK A;  2EYQ A;  2P0K A;  3CCR A;  1KQ2 A;  4M7D G;  2R5A A;  3V7C A;  5GAN f;  1DJ7 B;  2GCX A;  2ZPI B;  3LH0 A;  1B34 B;  2G3R A;  5LL6 S;  1M1K U;  4BI8 B;  2MWP A;  4RG8 A;  1U8R A;  2DZC A;  3PFS A;  1JRI A;  3NTH A;  3M56 A;  3QJY A;  2XKO C;  4J7I A;  3FIF A;  4TVR A;  4E47 A;  3OS1 A;  3G6E T;  3SFM A;  3WVD B;  5GAO p;  2JOY A;  4XU3 A;  1Q82 C;  1XQH A;  3HFO A;  3C94 A;  4M77 E;  4M75 B;  4RCC A;  3CMA T;  3RUX A;  2LCL A;  3JCM c;  2E70 A;  3Q1J A;  1HXD A;  3SD4 A;  1EIF A;  3L2Q A;  1VQN A;  3CME T;  5CVI A;  2RB6 A;  2RM4 A;  4JDS A;  4XTX A;  3SDZ A;  5GAN 3;  2RHU A;  2X4J A;  5GAN 5;  2FL7 A;  4FSX A;  3G6E A;  2X4W A;  5GAN 2;  4JLI A;  3OYL A;  3QSU A;  1RI0 A;  4BUG A;  3LYI A;  3S3M A;  4XTU A;  2DZ9 A;  4ELZ C;  3CME A;  3CXC S;  2RD1 A;  1I81 A;  2F5K A;  3RER A;  2M16 A;  1K73 C;  3GIB A;  3OYE A;  3GNF B;  3RKW A;  3S3O A;  4OB3 B;  2I2L A;  2JTF A;  1N27 A;  1TH7 A;  4HA8 A;  5C6S A;  2ZZD A;  2GF7 A;  5CKB A;  3JCM e;  1VQ6 A;  2X35 A;  4EPC A;  3ZFJ A;  3SWN B;  4C8Q G;  1M90 C;  3LGL A;  3V7S A;  4N4H A;  3G4S A;  3NFC A;  3SB2 A;  2QQ9 A;  3HL8 A;  4A53 A;  3AHU A;  4XAX B;  1YCY A;  5DY9 A;  4N0A C;  2RHY A;  4HT9 A;  4C92 D;  1YHQ A;  4C8Q F;  1O9S A;  2ZPF B;  1YIJ T;  3WXM B;  4LD9 K;  1IZ6 A;  2E10 A;  2HNI A;  1N9R A;  3P8D A;  1VQ4 T;  3QYG B;  1JJ2 S;  1ZHI A;  3J81 E;  4M7A C;  2Y4Y A;  4IUP A;  1K8A U;  4RMO A;  1M1F A;  4M7A G;  2LQ8 A;  3M53 A;  3OA6 A;  1OZ3 A;  4N4I A;  3DLM A;  4J6X A;  1IRE B;  2XIC A;  4NOY A;  3CCV A;  1RL2 A;  2H3J A;  3CD6 T;  2PVD B;  5GAN d;  3OMG A;  5LJ5 d;  2KK4 A;  4OB0 B;  5CKD A;  3V7R A;  2LCC A;  4QQ6 A;  3OY9 A;  3OS5 A;  2P4T A;  3HPW A;  4N0A A;  1QP2 A;  2FYK A;  2XHC A;  1Y7X A;  3A8L B;  3OMC A;  1AHJ B;  2DPP B;  4NL2 A;  4BY6 C;  4C0D B;  3RIR A;  5LJ5 g;  5LJ5 e;  5GAN 7;  2X4X A;  3V8K A;  4M7D C;  3P8B B;  1I8F A;  2F69 A;  2KSS A;  4XTY A;  1BIB A;  1B34 A;  2EQU A;  5J3B A;  5GAM h;  3CCV T;  1JBM A;  1JJ2 A;  2XID A;  4C5E A;  3JCM f;  2MI6 A;  3BW1 A;  4M77 F;  5GAM f;  2KVQ G;  3CCQ A;  2EJF A;  3RMQ A;  4MZP A;  5IN1 A;  3CCR T;  4BI3 A;  1WNL A;  2XD0 A;  4Y28 E;  3MEU A;  3CCL T;  1KQS S;  3VV0 A;  4LD6 A;  4C92 C;  4A4G A;  2XK0 A;  3J7A F;  4JS5 A;  4UC4 A;  1Q86 U;  4KUD K;  3BY7 A;  3OYA A;  3TCJ A;  3CMA A;  2E65 A;  2K5I A;  3PGG A;  3PNW C;  3UT1 A;  1Q7Y C;  2KDS A;  4J8O A;  3CBP A;  4BE0 A;  5GAO q;  2R57 A;  2EKO A;  1Y96 A;  1UGP B;  3OYF A;  4QQG A;  2HBP A;  4M75 C;  3VJP A;  4NS5 A;  1YHQ T;  5LJ3 g;  3LWH A;  2L3R A;  3CC2 A;  2EQJ A;  1YIJ A;  2E6Z A;  4J6W A;  3QHS A;  3KUF A;  5DLO A;  4F7U G;  1GXI E;  2L5Q A;  3QDR B;  4X9C A;  4XTW A;  2MAM A;  1U1T A;  5J26 A;  2M9U A;  4M75 G;  1VQ5 T;  2CZ0 B;  3CCJ T;  1UGQ B;  5GAN e;  4E7H A;  2LC4 A;  5FRO A;  4C8Q B;  4NL3 A;  2XDD A;  1VQO T;  2E5Q A;  1WGS A;  1VQP A;  3QBY A;  3CC2 T;  3T9N A;  2RA2 A;  3JB9 G;  3MP1 A;  2LX9 A;  2E12 A;  2Y4X A;  1G3T A;  3G4S T;  4BAC A;  4BY6 B;  3OYM A;  4PJO E;  1NZ9 A;  3ZEH A;  4PKC C;  4HCC A;  3PT9 A;  3UPU A;  2QEX T;  1S72 T;  5FRN A;  1BI0 A;  4OMF B;  1KQS A;  1YBY A;  2K57 A;  4ME7 A;  3FC3 A;  2RHI A;  5GMK h;  4PL6 A;  3G7Z A;  4C0Z A;  1WQW A;  1N6A A;  2GQV A;  3JCM Q;  4M78 E;  3RES A;  2HD0 A;  3A8M B;  3URG A;  4M77 C;  2YRV A;  5GAO r;  1KC8 C;  3L2Z A;  4A4F A;  3JCM d;  1VQN T;  3E19 A;  3A8O B;  2YHT A;  5I2S A;  2K4Y A;  3JB9 H;  3MEW A;  1S72 A;  1M4Z A;  1ZBX A;  3OYD A;  3MO8 A;  2HAX A;  2D6F A;  3MEA A;  1U1S A;  4IUT A;  4C92 E;  3CCU A;  2DXT A;  4O6J A;  2K3X A;  1W2B A;  4GY5 A;  1NPP A;  3HP9 A;  2GFA A;  4J5Y A;  1VQ7 A;  5HKC A;  3TEE A;  1VQK T;  1BI1 A;  3KXT A;  5HY6 A;  4M78 B;  3UDC A;  4BB7 A;  3HRT A;  3M9Q A;  4R56 A;  3VYH B;  1UB4 A;  2IVW A;  3CXC A;  2ZGW A;  4DQ2 A;  5GAO n;  1H3Z A;  3FRN A;  5L8R E;  3CCL A;  1WQ7 A;  2A7Y A;  4J6Y A;  3GOX A;  1VIF A;  4GLK A;  4M7A A;  4ZGD B;  3CC4 A;  4BDZ A;  4L6V 5;  3DLL A;  3QG1 A;  4PNO A;  4F7U B;  2O4X B;  5CK9 A;  1QVF A;  4R55 A;  3C12 A;  3L42 A;  4CRI A;  3JB9 I;  2R5M A;  3CPW A;  3M5A A;  2LT1 A;  5GAN 6;  5A0D A;  3A8G B;  4ZTJ A;  5CKH A;  5LJ5 f;  1M1K C;  1KG1 A;  1G3Y A;  4M77 G;  2EFI A;  4PJO C;  4XU0 A;  3C95 A;  3CD6 A;  4C8Q A;  4J7F A;  2RJD A;  3OB9 A;  3QXE B;  1WJR A;  2DIG A;  3PMI A;  4ZGE B;  3OYI A;  1OI1 A;  3E9G A;  4FL6 A;  4JUV A;  1QVP A;  4OGE A;  1VQ5 A;  2BKD N;  4QQD A;  5D6X A;  2QA4 A;  1D3B B;  5D6W A;  2DTO A;  4OGC A;  3VKI A;  2BIV A;  3CCE T;  4QVZ A;  1H64 1;  2F5T X;  2PU9 B;  3CCU T;  2RJF A;  1P92 A;  1WPY A;  3MP8 A;  5DM7 R;  4EMK C;  1YJ9 T;  3RKY A;  1UEB A;  2WSF E;  2VXE A;  2QQB A;  3KBG A;  2EWN A;  4HT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...