1D3BA

Crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
GVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGCKIRFLILPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D3)
total genus 18
structure length 72
sequence length 72
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 1998-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1d3bA00
3QO3A 1B34A 5CAIA 1I5LA 4M7AD 4M78F 2DEQA 5GAMe 2RB6A 4M7AG 2VC8A 4RCCA 4M75G 2E65A 4NOYA 3HFNA 3JCMf 4J6YA 4EMKC 1WQWA 4RCBA 4M7AA 4WF2A 4C92F 4M7DD 3AHUA 3HSBA 2DXTA 2E41A 4EMHA 3JB9G 4EMKB 2VXFA 3L2ZA 2EAYA 3SWNA 3SWNC 5LJ5j 2CGHA 3JCMb 4JUVA 1WQ7A 2DTIA 3RESA 4J5YA 4M77C 2E10A 3JCMe 1JBMA 2ZGWA 4M77A 4C8QB 3QSUA 4PJOC 5LJ3j 2EWNA 2YLBA 4F7UF 2EJ9A 4XTUA 1BIAA 4M78A 3RKXA 5GMKh 1I8FA 4M7DA 1N9SA 3INZA 3BDUA 1N9RA 4XTXA 1KQ1A 4C8QC 1MGQA 5GAMg 4PJOA 4HA8A 4M78G 4MMKA 1U1SA 4XU1A 4F7UA 2HNIA 1TH7A 3JCMd 3JB9I 4JRIA 5LJ5e 4C8QE 4C92A 3FJPA 2DJZA 2VXEA 1X01A 4M77F 3V7RA 4M75D 4C92G 2DZCA 5GAMj 4EMGA 2YLCA 5GMKe 4X9DA 3V8KA 4M7AC 1D3BA 4M75A 4A54A 3JB9F 4J6XA 5GANj 4JRKA 5GAN2 4MMLA 3JB9D 5LJ5d 3FB9A 1Y96B 4QVCA 5GAOn 4V2SA 3JCMc 2E64A 3JCMV 3V8JA 4M7DC 4PJOD 4N0AC 4C92D 1I4K1 1M5Q1 5DY9A 1I81A 3V7CA 5GAN8 4PJOG 5GAN5 2JN0A 1B34B 5LJ3f 1WNLA 5GAOr 1WPYA 2I2LA 4C8QF 2EJGA 4M78D 5GANe 3PGGA 3VU3C 3BY7A 4C8QG 4M78C 3JCMg 4M7AE 1HK9A 4M77E 4XTVA 4C8QD 4J6WA 4XTZA 3V8LA 2RA2A 4OP0A 3L1AA 5LJ3d 3JCMX 5LJ5h 4Y91A 1U1TA 3FIFA 4EMKA 4HT9A 2DXUA 4C92C 2FYKA 5GAMf 1YCYA 5GANd 2DVEA 5GAN4 1KQ2A 3HFOA 3RUXA 3SB2A 3JCMQ 1BIBA 5GANf 4XU2A 4M7AB 5LJ3g 4M77B 4XU0A 4A53A 4PNOA 5GMKj 5GAMh 2E1HA 5LJ3e 4M7DE 2DTHA 4M78B 3SWNB 3GIBA 3M4GA 4HT8A 4PJOE 3RKYA 4M7DG 2YHTA 4M75E 4N0AA 5GANg 3JB9J 5GAOl 5GAN6 1H641 3EFRA 4XQ3A 4F7UB 2QTXA 3QHSA 4C8QA 3JCMP 4XTWA 5GAN3 5I21A 2Y90A 1JRIA 3V7SA 3JB9H 2DTOA 1LOJA 1M8VA 4M7DB 4M78E 3QUIA 3JCMJ 4PJOB 4M75C 1D3BB 4M75B 4F7UG 5GANh 4DQ2A 5GAOp 4NL2A 4M7AF 4F7UE 4XTYA 3BFMA 2K57A 4X9CA 4C92B 1Y96A 1HXDA 2FB7A 3BW1A 1LJOA 4NL3A 5LJ5f 5GAOm 5LJ3h 5GMKm 2DKGA 3EFSA 5GAOq 5GAN7 3RERA 4M77G 2EJFA 4M75F 4M7DF 1LNXA 3JCMW 4PJOF 5LJ5g 4M77D 4XU3A 4C92E 5GAMd 5GMKl 4JLIA 5GMKi 2DZ9A 3JCMh 2RM4A 3RIRA 2RD1A 3RKWA 4QVDA
chains in the Genus database with same CATH superfamily
2HEQA 2YUQA 4ZTJA 3CPWS 1IGQA 1SPKA 2ZPGB 4OMNA 3SHWA 3JCMf 4A4KA 4RUGA 1H8KA 1NPRA 1GXIE 4EMHA 4A4EA 4PFZA 5LJ5j 4MDWA 1M90C 3DLLA 4II1A 3UDCA 1WFWA 1PNJA 4F17A 3OS1A 4IUQA 2KROA 4B6MA 2YT6A 4F7UA 3MKDA 1AEYA 1PD1A 3S3NA 1XNIA 2RK2A 2XHCA 1VQ4A 3A1PA 1CKBA 1BK2A 2FL7A 4Z88A 3UF4A 1V29B 1VIFA 3CC4A 1K73C 3E1SA 2G3RA 2AK5A 3HTRA 2LT4A 1EFNA 2FHDA 1SRMA 4FT2A 4ZGDB 1X6BA 2EJGA 4Z8AA 4FYXB 3BY7A 1VQMA 1K8AC 1I1JA 4JJBA 4PK4A 1IZ6A 2FPEA 3PIPA 1I0CA 3TU4K 1WXTA 1OPKA 4XU0A 2ED0A 4A53A 1OQKA 1VA7A 1UGQB 1UGPB 2CSIA 3M4GA 3ME9A 4M7DG 4GLMA 3JB9J 5GAN6 3MP8A 2QTXA 1V1CA 4XTWA 2F2WA 4AT1B 3MJXA 4J9FA 1YITA 2MI6A 1UE9A 5A0GA 4AFUC 2ZAEA 4F7UE 2ENMA 1YBYA 1YI2T 4AFQC 1NLOC 2EQKA 5M9OA 2KGTA 3A8LB 3VS5A 3N5BB 3CEYA 1EIFA 3CCJA 4OF1A 5KYWA 1UGVA 3QO3A 1YJNQ 1NE8A 4R55A 4JDSA 3CC4T 1VQ8Q 1K8AR 2DIQA 1AZGB 1FMWA 2E41A 3JB9G 2EAYA 3EH1A 2BTTA 3X24B 2DTIA 3CCUA 2RI2A 4M77C 3CBOA 3TQ7P 1Q81C 1QW1A 3QYGB 2ATCB 1X27A 1BIAA 1ZA2B 5GMKh 3MEUA 4FYYB 2PUKB 3QJYA 2QYZA 3CCMQ 3J81E 1X01A 4LDYA 1M9SA 3VS6A 4C92G 4M7AC 2KAFA 3QWXX 3G7ZA 2IIMA 3LH5A 1GL5A 4MMLA 5LJ5d 4PLIA 2R58A 2M1HA 2JJ9A 2DIGA 2O31A 4D8DA 3L2UA 2QA4A 1M90R 4JRQA 2DL7A 2RO0A 2E4HA 5GANe 2LJ3A 3I55Q 2CUBA 2MOXA 4J6WA 4XTZA 2CDTA 5GJWB 2O2OA 4PNOA 1RABB 2GTOA 2DTHA 2ABLA 1BI3A 3RKYA 5IXBA 2FPFA 1WHJA 3O8VA 3LGFA 1U5SA 2V8JA 3UT1A 4JJDA 2GQVA 5GAOp 3CC2T 3DB4A 1YJWQ 5LJ3h 4C0GA 1J3TA 4IUUA 2DAQA 1BCOA 3RERA 1NM7A 2LC4A 5IHNA 2DNUA 4D6WA 1KSWA 4TVRA 2L3RA 1JEGA 1MNEA 4HVWA 4LXCA 1Q86R 3FLGA 3AHUA 1FMVA 3EAEA 1WQ7A 4J83A 2E10A 3JCMe 4C8QB 3CC7Q 3NTKA 2VASA 5GAMg 5A0DA 2OAUA 2F2XA 2BE9B 4WCIA 4FYWB 1VQ7Q 1G3WA 1Q81U 1VUBA 1ABQA 4UC4A 1T0HA 5KYUA 4AG1C 1AVZC 1K9MU 1JXMA 2ZPIB 1OZ2A 4V2SA 1G3TA 4KT0E 1VQ4T 4N4IA 3V7CA 1UEBA 2XD0A 1DJ7B 1G83A 1H3ZA 4KBMB 1BCMA 2PVOB 1AWXA 4CRIA 1D1AA 4M78C 1VQ5T 4XK8E 3GOXA 1MMAA 3A8OB 1RAFB 1KQ2A 3RUXA 1ZUUA 3JCMQ 1D0YA 2LTOA 5D6XA 4IKFA 3M0PA 1YWOA 2KK4A 2E70A 4ELZC 5FWCA 2OTLA 2DM1A 1JXOA 1GCPA 3VRZA 5CVIA 1QVGA 5I21A 3MO8A 3I5RA 1QWFA 2CT3A 4XTYA 1VQ8A 4M7AF 2K57A 1Q81R 2D6FA 1T0JA 5GAOq 4E7SA 2LP5A 1S72T 2H8HA 2J06A 1PRLC 2GFAA 2YSQA 4ESRA 3CCUQ 5GMKi 2QXFA 3OYDA 2ZCFB 4MZTA 4EPCA 5KYYB 2FG0A 4BI8B 3FC3A 4M78F 2LZ6B 5I2MA 3C0CA 2HL5C 3TCJA 3OYAA 3META 4M7AA 3ASKA 3PT9A 1FYNA 3BE3A 3OS5A 1VQOT 2K6DA 3TSWA 3SD4A 1VYVA 3CC2A 1JBMA 1V76A 2GGRA 3C4SA 3OYJA 1KC8R 4ELYC 2MK5A 2EJ9A 1YWPA 4JJCA 5FROA 3H41A 3ZBDA 3FJPA 1VQLT 1UJ0A 1K9MR 4QVZA 2K5FA 4A54A 1WXBA 2E3IA 3KBGA 1VQMQ 3JB9D 3J7AF 1OPLA 3MHXA 2KVQG 3OS0A 2ZPFB 3KUFA 2XDDA 4J9IA 1I81A 3CPWA 2JN0A 4WTOB 1WNLA 3LLRA 5KE3A 1TOVA 1PC0A 1W4SA 2HSEB 4ATOA 3CMAT 4HVVA 4RKUE 3H9NA 3A8HB 1AWJA 3M5AA 2COZA 5KYWB 4GBQA 4DA4A 1U06A 2QA4T 3V8LA 4JPBW 3FDRA 1C6VX 2OI3A 2DF6A 1WZOA 4BDZA 2PVGB 5GMKj 4RTWA 2LJ0A 3PMIA 2F69A 1XOVA 3QJ6A 3PMTA 3QHSA 3S3MA 1VYUA 4C5GA 3CMAA 3VYGA 3MP6A 1VQOA 5I22A 4F7UG 3M54A 1W70A 1ZLMA 2EGAA 3F70A 3I55T 1D1CA 1YJNA 2W0ZA 1YHQT 3OSVA 2J6OA 3RMSA 2P84A 4AFZC 4M77D 2LX7A 3MEAA 3REBB 2EPDA 3CCLQ 2O01E 1B34A 4KUDK 3M0SA 2EYWA 1WIEA 2V8IA 1YJWT 3M0UA 3VV0A 1EZZB 2DL5A 2J7IA 2JNGA 4PJJA 3FRNA 2OTJQ 2XICA 1SHGA 2JVVA 3PIOA 4FCYA 3GF5A 1W2BS 1Q95G 1N8RU 2DFUA 1PKTA 3QSUA 3E2UA 1Q82R 4PL6A 3INZA 4HA8A 2V1RA 2DPPB 3OYYA 2F5KA 3GLXA 4C8QE 2CP6A 2DD5A 4QW2A 2EVRA 1LPLA 1AT1B 1VQLA 3X26B 2EYZA 5GANj 2X9HA 1KG1A 1I4K1 1P92A 1YI2Q 3J80E 3EH2A 1WPYA 1ZX6A 5CQXA 3JCMg 3CMAQ 2DRKA 1MMNA 3DKMA 2EYXA 4C0DC 2L8DA 2C0OA 1XQHA 4FU6A 2FYKA 2L0AA 3SB2A 1UUEA 5L23A 1WX6A 2RJDA 2E1HA 3GIBA 2CSQA 1N8RR 2LQKA 3QZ5B 1YJWA 2DA9A 1CKAA 2AT1B 3EGXB 1LOJA 1TUGB 2A3LA 1SF9A 5GANh 3T9NA 2X4YA 2RJCA 1MNDA 4C92B 3GBQA 1R77A 5GMKm 2DRMA 2WACA 1YJNT 2JW4A 1YP5A 2ZPBB 4M77G 3CCVQ 1YJ9A 4M7DF 3JCMW 1QCFA 2W10A 2CS7A 1RAEB 2RJFA 5GAMd 3CCEQ 1VQ6T 4F04B 5IHIA 1MUZA 2VVKA 2DEQA 2GCXA 2ZZDA 4RCCA 4KH0B 3HFNA 3OSSC 1NJIC 1UHFA 3A8MB 5CKEA 4QQ6A 3G4ST 1G5VA 1YHQQ 1PD0A 4J9GA 1ZUKA 4KGXB 1PG5B 5CCAA 2X4JA 2A08A 1VQ7T 3SEMA 4F7UF 1R0BG 4M78A 5LL6S 2VWFA 1TSFA 1O9SA 3BDUA 2P0KA 1WI7A 2HNIA 3VUBA 2KRMA 1I07A 4LE9A 4J8OA 2QQRA 4Y28E 4C5HA 5GAN2 2E5QA 2LNVA 3FB9A 2M0OA 3SDZA 3JCMV 3CCUT 3MPUB 2LRQA 5CO7A 1N6AA 2O9SA 4JJNK 2QEXT 1TTHB 4KGZB 4L6V5 2DX1A 2M51A 1K9MC 4BE0A 1QVFS 1M4ZA 2J6KA 4RTZA 4DBQA 5KYYA 2V8KA 3NHNA 2E5KA 4OB2B 5LJ3d 3H6ZA 1YIJT 3EGDB 5I2SA 2NUZA 2GF7A 2AIRB 2ECZA 3GP8A 3EG9B 1KC8C 4LNPA 2QGGA 4N0AA 4C5EA 4KGVB 2YRDA 1X43A 2XI9A 2JMAA 2Y90A 2NUTB 1G2BA 3DB3A 3EG1A 5FW9A 2QDYB 4X9CA 2QA4Q 1IGUA 2IPOB 2AZSA 1ABOA 1SKUB 3HP9A 1C0MA 4LDVA 1D0XA 3CCJT 1AWOA 4ZGJB 2EQIA 2XK0A 2HBPA 4HCKA 3C94A 5CAIA 4DEXA 2OJ2A 1T3LA 3L42A 4J9BA 3OW2A 3QWYA 1OI1A 1VQKQ 4KULA 3PNWC 4E47A 2CP5A 2VXFA 3HRTA 1IREB 5HK3A 4JUVA 3VS7A 2F2VA 4FIBA 2DBMA 4C8QC 1KQ1A 4X34A 3JCMd 1IHVA 1TH7A 4JRIA 4VUBA 3I56Q 2VXEA 4OMFB 3V7RA 1BI2A 2NUPB 4C0FA 1RACB 2CZ6B 1Y0MA 3JB9F 2RQVA 4N4HA 2KRSA 3OBWA 1D1BA 2K3YA 3A98A 1WJQA 5GAN5 1RAIB 3LYIA 3OYNA 4M78D 3PGGA 1C1AA 4QKUA 4XTVA 3M55A 3L1AA 5LJ5h 1VQPQ 1X75C 3UWNA 1RUWA 2D8JA 1VQ9T 4GY5A 4PFPA 4M78B 3SWNB 1YN8A 1IHWA 2EYYA 3AT1B 4LDUA 1OX9A 5GAOl 1H641 2EQMA 3OA6A 2DTOA 4M7DB 2M16A 2D9TA 2FEIA 2O4XB 4RTUA 3X28B 1KC8U 1FWZA 5LJ5f 1M3CA 2MIOA 4N4GA 2F1LA 4P5NA 1Q7YC 1LNXA 1Y7XA 2Z0WA 3A8GB 3URGA 4C92E 3RNJA 1WJSA 4PJNA 2DXBA 1Y57A 5C6SA 2KYMA 1OU8A 2RD1A 3VS0A 2Y4YA 4K11A 1QKXA 1YJ9T 5GAMe 1RAHB 2RB6A 3EGDA 1AZEA 1OZ3A 2L5QA 2KSSA 2XIDA 2D0QB 4JLGA 2HAXA 2OTLQ 2DXTA 5I11A 1K1ZA 1PRMC 2BIVA 2PQWA 1UECA 2CGHA 2EGEA 3RESA 1IRXA 1S72A 1VQNT 2M0YA 1HJDA 2JM9A 1FMKA 2PTKA 2LVMA 2WSCE 3NTHA 3QDFA 3EGXA 3EHQA 2YRCA 3RR6A 3P8HA 3V8JA 5J26A 4ME7A 1YIJQ 1Q86U 1JQQA 1Y71A 4R56A 3G6EQ 1VQNA 2HKNA 4LD9K 1JJ2S 3CBPA 1BB9A 2NLUA 3L2RA 1QKWA 2K5LA 2RA2A 3OYLA 1KFZA 2DVEA 2RQRA 1X69A 3VUZA 1KQSA 3WVEB 1OOTA 2KXCA 1D09B 2D1XA 2H3EB 2KRNA 4HKEA 4M7DE 4PJOE 1KD1C 2F5TX 2CUDA 3M9QA 1YITQ 3U23A 2NWMA 1M3AA 1KQSP 3VS1A 3HPWA 4D8KA 5FU6C 2HBWA 1AHJB 3EG3A 4FYVB 3OW2S 2DL3A 5IT9E 1LJOA 2G6FX 2DKGA 4OGEA 5FU7B 2WSEE 3CCQQ 4CC4B 5LJ5g 1FXXA 1T3SA 2CP2A 3OYMA 2M9UA 2ZGWA 3R6OA 3OB9A 5CK9A 2L3QA 2ESWA 4M7AG 3UPUA 1OEBA 4RG2A 1KK7A 2CP3A 4BUGA 1W6XA 2EQJA 3LWHA 3SWNA 2KNBB 1BBZA 2JS2A 3I5SA 3OYEA 2HL3A 3M4YA 2RI3A 4PKCC 5LJ3j 2K9GA 4PJOA 2VGNA 1M1GA 4XTXA 4ZGEB 2L3PA 5GJVB 1TU0B 1G8XA 2RQUA 4C92A 3I35A 1WHGA 1NZ9A 3QYHB 5KYXA 4PJLA 2DERA 2DZCA 1YCSB 4JRKA 2MWPA 1NPPA 3CCLA 3OS2A 1M5Q1 3L2WA 4F14A 2LQ8A 3H0HA 4E7LA 3GNFB 3CMEA 4HVUA 1RLQC 2PVDB 2QQAA 3I55A 4A4HA 2R57A 1N27A 3EGUA 1E6HA 2MPXC 2ROTA 4FT4A 4GLKA 4C8QD 3M57A 4OP0A 3CCSA 2XDBA 1AWWA 1Q7YU 2DXUA 3I9QA 3VS3A 4E6RA 1BIBA 1M8MA 2C0IA 5GANf 3EHRA 5LJ3g 4M77B 2SEMA 4DBHA 5GAMh 5CR2A 2PU9B 4MDXA 4BD3A 2PUOB 2FPDA 3JB9H 2DO3A 2YUPA 2MF2A 4M78E 2RHZA 4E2FB 2CH4W 3H0FA 4M75C 1KQSS 1TS9A 2QQBA 4BDYA 1MMGA 2CREA 3BFMA 3TSZA 5GAN7 4HCBA 2VUBA 1VQKA 5KH6A 3MCAB 4J7FA 3CCET 4LUEA 1WXUA 1ZUYA 1IB8A 2P4TA 3PVLA 1QWEA 4HXJA 3CCLT 3WXMB 1G3YA 5KCOA 4R0KA 3EG9A 2V1QA 2MCNA 2L3SA 3G71T 1K0XA 3SWNC 2K79A 4Q5WA 5HKCA 2E12A 3JCMb 4E7IA 2XMFA 1GCQC 1UJYA 3EFOA 2EWNA 5CKDA 1NEGA 2LQNA 4Y92A 3QXEB 4BACA 2HMAA 4PFOA 3CCVA 1YJ9Q 1MV0B 2CZ0B 1BU1A 1ZBJA 2YUNA 2VB6A 5GAOn 2KEAA 5C0MA 5CKHA 1VQPA 3KXTA 4NS5A 3G4SQ 1K0SA 2OTJA 5EC7A 4C8QF 5D7UA 2ED1A 3REAB 4M7AE 4M77E 3C95A 2HDAA 2LCLA 1ZSZC 4HT9A 1YFNA 4IIOA 4ZN3A 3CCQT 3OMCA 2EGCA 4J9DA 4X1VA 2P0PA 5LJ3e 2RN8A 4DEYA 4HT8A 3OYGA 4L59A 2YHTA 5GANg 2VV5A 2GQIA 1VQ9Q 3UATA 2OAWA 1VQLQ 2MWOA 2HKQB 1JRIA 2QEXA 2K4YA 1RI9A 2FRYA 5KYXB 3NTIA 2QASA 3OQ5A 4OMMA 3OYCA 2A37A 2IVWA 1OX8A 2AKKA 1NEBA 2KT1A 4CC7A 2FZGB 1YI2A 1KIKA 3QDRB 1NG2A 2NYSA 2WSFE 1KD1R 1H3HA 1K9AA 2JTMA 4PJMA 1GCQA 3HHTB 3JCMh 1ARKA 2RM4A 3LWIA 1ZQ1A 1PSFA 3QKJA 2ROLA 4OB1B 2PNIA 1X2QA 1PM3A 4KH1B 1ZBXA 4M75G 3G6ET 1K73U 2K7AA 1WHKA 2EQUA 1GBRA 3FJ5A 1SRLA 2X4XA 3CC2Q 1NLPC 1M1FA 1YNZA 3HRSA 3CC7A 1SHFA 2BE7D 4XAXB 1QP2A 1MGQA 1W2BP 2DD4A 1ZA1B 1U1SA 2RQWA 1VQKT 3JB9I 1U3OA 2KR3A 3CCMA 3L2QA 1KHIA 4M77F 1M2OA 1VQNQ 1XJWB 1QMCA 3Q1JA 5GAMj 2YLCA 2DEUA 4E7HA 3V8KA 3QIIA 2YRVA 3CBMA 4M75A 5IAYA 6AT1B 1QVFA 1Y96B 4J9HA 2DETA 2RHUA 2QGFB 1NJIU 1Q86C 2QTVA 8ATCB 1M3BA 3QZ9B 4FSXA 3TREA 2I2LA 1SG5A 5J3BA 1VQ9A 1UB4A 8AT1B 2QEXQ 4A63B 3EG0A 4DBRA 2MYSA 4PLLA 4E7JA 4MZMA 1PCXA 3JRZA 1RI0A 1VQ5A 1B3QA 1WA7A 4EIKA 2BUDA 5AYFA 2MMPA 3BDLA 3EFRA 5FLXE 4C8QA 2ZPEB 4OMQA 3QUIA 4PJOB 3UA7A 4IUPA 2FVUA 5DLQE 4NL2A 3CC7T 2EYQA 2BZYA 1HXDA 2FB7A 1ZSZB 2VYTA 1WHHA 2D8HA 5KYUB 3S6WA 3OYBA 4OMLA 1ACMB 2COYA 1VQ4Q 5GMKl 3THKA 4IUTA 4FL6A 1NYFA 2PZ1A 2X35A 1KJWA 2KQWA 3ZL7C 4Z02A 2CP0A 4IIMA 2L89A 2CZ7B 4NOYA 1WQWA 3CCRA 4WF2A 2DJQA 4YTLA 1BI0A 1EX4A 1JO8A 1RLPC 3HSBA 2YDLA 1TXQA 3TEEA 2BZ8A 1VYTA 3FEOA 5A0LA 2DILA 2R5MA 1OYXA 1VQMT 2JT4A 4M77A 1OU9A 2YLBA 3RMQA 3G4SA 1VQ6A 1I8FA 4B9WA 2RK1A 1H92A 1HD3A 1R8OB 1K76A 1WYXA 2C06A 2X3XD 3CMEQ 2AZVA 1TG0A 1WHLA 4X9DA 4F16A 4J6XA 1K8AU 4IURA 2A28A 4QVCA 3OMGA 1I5OB 1RL2A 3JCMc 2XG8D 2CP7A 4C92D 2A36A 1B34B 2JS0A 5GAOr 1QCNA 1BI1A 2RHIA 1HK9A 5FWBA 2DYBA 5AT1B 3VRYA 5GAMf 3HFOA 2K3XA 4DOVA 3HKSA 2VKNA 2QG9B 1QVFP 1WJRA 2RPNA 2ZPHB 3EFOB 3JCMP 2DL8A 2VGMA 4IUVA 1VQOQ 2P4RA 3JV3A 2LCCA 2DXCA 3CXCS 4ZN1A 3JCMJ 1D3BB 2C0TA 1WHMA 2HZYA 1X2KA 1UGSB 1KD1U 3M53A 3P8DA 2XDPA 4FM4B 4DOWA 1O75A 3BW1A 1YIJA 3L2VA 2RHXA 2COWA 2DVJA 3EFSA 3G71Q 4M75F 2O9VA 2HCKA 3CCEA 2X51A 1UG1A 1RADB 4JLIA 3S3OA 4LDXA 1S1NA 2RF0A 3CC4Q 1VQ6Q 4C0DB 2X3WD 4CI0C 1QVGP 1X6GA 4KUIA 3PFSA 1LCKA 3VYHB 2EW3A 1XTDA 2KBTA 3H8ZA 4A4GA 3HL8A 4Z89A 1UTIA 2RHYA 3C12A 3L2ZA 1GRIA 4QQGA 4PJOC 4J7IA 2RI5A 4XTUA 2GTJA 2L2PA 2Y4XA 1N9RA 2RH2A 2H3JA 2A0FB 2LMJA 2OX7A 2CT4A 2KYBA 3MP1A 1ZSZA 4M75D 5FRNA 4OMPA 3ZEHA 5D6WA 4KRTA 4QT7A 5DY9A 4LUDA 5LJ3f 1N5ZA 2RNAA 2QDLA 3JSCA 5DLOA 2RJEA 4RG8A 3OBYA 1NJIR 2P0QA 3CCJQ 2A7YA 1S72Q 4CC3A 3JCMX 1U1TA 1QP3A 5GAN4 2LT1A 1M1KR 3E19A 4LDWA 3I56T 1BKBA 1MMDA 2B86A 3NMZC 2GNCA 2JUFA 4OGCA 2KMTA 3DLMA 4J9EA 5IH2A 2FRWA 5GAN3 1RAGB 1SSHA 1QVGS 3O5ZA 1IO6A 1AOJA 2JTFA 4C0ZA 2V26A 5L8RE 1IXDA 3TVTA 2QQSA 2HQHA 1FX7A 4LD6A 2BZXA 1Z9QA 2YUOA 2QAZA 1U8RA 2EJFA 2I0NA 1F1BB 2CYZB 4J9CA 1R0CB 3X25B 3M59A 4O6JA 1GBQA 3E9FA 3RIRA 3CCSQ 4RMOA 4OB3B 3GPLA 4FW2A 4L5GA 1NYGA 2VC8A 2E65A 3VKIA 4EMKC 2IG0A 2DLPA 4RCBA 4RTVA 1Q7YR 2K2VA 2QI2A 1Q82C 3LW5E 1M1KC 3RKXA 3PVQA 3LGLA 2YXYA 4JS5A 3CCMT 3I56A 4XU1A 1W2BA 2DBKA 5LJ5e 2E6ZA 2DJZA 1G3SA 1WLPB 5CIUA 4C5IA 1Q82U 1JB0E 1MHNA 3RDVA 2KXDA 3X20B 3QPHA 3P8BB 3RBBB 1OULA 2J6FA 4N0AC 3OYFA 2LDMA 4PJOG 1ZSGA 1B07A 1VQ8T 1JJ2A 1GFCA 4RTXA 1VQ5Q 3VU3C 2R5AA 2XU8A 3H0IA 3VS2A 5KCHA 1LVKA 1NBEB 2M02A 2DYIA 4HCZA 4Y91A 4C92C 4ORZA 1SEMA 1K73R 2AHJB 2FZCB 4E7KA 1PWTA 4RTTA 2X4WA 1UFFA 4F7UB 2DL4A 1QQJA 3LH0A 4FW1A 3EG2A 1SSFA 4M75B 5EG2A 3VJPA 4AMCA 3LX7A 2KDSA 4BB7A 1Y96A 1PSEA 4ZTFA 1B7TA 4LN2A 1AD5A 2K5IA 1PHTA 4BI3A 5CKBA 4A4FA 4CC2A 1PKSA 2RMOA 5DM7R 3CCRQ 3CCST 1A0NB 1MV3A 3PTAA 2DZ9A 4DBFA 1QVPA 5A2QE 1I5LA 3CD6A 5CQYA 1E7OA 1JU5C 3CXCP 3CCRT 3ULRB 2CH4A 1HSQA 2LQWA 4C92F 2FZKB 1D0ZA 3A5ZB 4EMKB 1YHQA 2CZ1B 2YWWA 1M30A 2EKHA 4J5YA 4ANJA 3M56A 2HQEA 3CMET 4M7DA 4AFSC 2E3HA 3G1JA 1OV3A 4M78G 1TUDA 1X6OA 2NUTA 2JM8A 3QG1A 5HY6A 5GMKe 5KYNA 1D3BA 4OMOA 2J05A 1M2VB 4MZPA 1GFDA 2E64A 4PJOD 4QQDA 4M7DD 4JZ4A 5GAN8 5FRMA 3M0RA 3SFMA 2K3BA 1WGSA 2DE0X 4FSSA 7AT1B 2GFUA 2LJ1A 5D6YA 2BKDN 2GBQA 2HSPA 1YCYA 1KHCA 1M27C 3M0QA 4XU2A 2QQ9A 4JS4A 3HRUA 3CQTA 4M4ZA 2D0NA 3M58A 5ECAA 3JAME 3WVDB 5CKFA 3NGPA 4M75E 1QLYA 4XQ3A 4BE2A 3V7SA 4EDUA 5IXFA 1M8VA 5FU6B 1VQPT 1TUCA 2QK0A 3MEVA 2OTLT 2OTJT 2CKKA 4NL3A 5GAOm 2FO0A 4JZ3A 2NUPA 2EFIA 5HCKA 2LNHB 2RQTA 4BY6C 3MEWA 4PJOF 5HK0A 4XU3A 2JXBA 1UHCA 2K2MA 5IN1A 1TWBA 1BYMA 3CPFA 1W1FA 4M7AD 4BE1A 5J39A 5FU7C 3CD6T 3NFCA 3CCVT 4J6YA 2KT8A 4ZNXA 3OYKA 1K4US 2HD0A 3CXCA 1E6GA 3R6NA 1N9SA 2DK3A 3G71A 4JRPA 4MMKA 2DMOA 2JZ2A 3PE0A 3UA6A 1CSKA 3IQLA 3CPWP 2EIFA 1M1KU 4OB0B 4EMGA 1QCOA 3NPFA 3M0TA 1M90U 2O4XA 1N8RC 2MAMA 2B8AA 4RTYA 1HYOA 4M7DC 1ZHIA 3G6EA 2EKOA 5KE2A 1VIEA 1VQ7A 2AKLA 2EBPA 2KY9A 4C8QG 3KFVA 3OY9A 1UDLA 2KI7A 3D7SB 4HCCA 4O5VA 2HQXA 2KE9A 1Z9ZA 4AG2C 4EMKA 3FIFA 2E6NA 5GANd 4E7ZA 4M7AB 1RAAB 3OYHA 9ATCB 1WDXA 2XKOC 3VS4A 1UGRB 1VOMA 1YITT 1Y07A 2JMCA 1JJ2P 2LCSA 3E9GA 2JOYA 3CD6Q 4DQ2A 3OW2P 1M2VA 4BI4A 5IHKA 2JTEA 3CCQA 4BY6B 3OYIA 3ER0A 3GNGA 4B9XA 4OVAA 3QBYA 2LX9A 2O88A 2SRCA 3ZFJA 3RKWA 4QVDA
chains in the Genus database with same CATH topology
1B34A 4KUDK 5CK9A 4C0DB 4CI0C 4ZTJA 2V8IA 3CPWS 1YJWT 3PFSA 4KUIA 3VV0A 2ZPGB 4M7AG 3UPUA 2JNGA 4RG2A 3JCMf 3FRNA 3VYHB 4A4KA 2XICA 1XTDA 2JVVA 3H8ZA 4A4GA 4BUGA 3PIOA 1NPRA 3HL8A 1GXIE 4EMHA 2EQJA 2RHYA 3GF5A 3C12A 3L2ZA 4MDWA 3SWNA 4A4EA 5LJ5j 3LWHA 1W2BS 1N8RU 1M90C 4QQGA 3DLLA 3OYEA 3M4YA 2RI3A 3QSUA 4PJOC 4II1A 4J7IA 3R6OA 4PKCC 4PL6A 3UDCA 5LJ3j 2RI5A 4XTUA 2Y4XA 3INZA 3OS1A 2VGNA 1M1GA 1N9RA 2H3JA 2RH2A 4XTXA 4IUQA 4ZGEB 4HA8A 3OYYA 2DPPB 2F5KA 4F7UA 3GLXA 4C8QE 4C92A 2DD5A 3S3NA 1NZ9A 1XNIA 2RK2A 3MP1A 3QYHB 2XHCA 4M75D 4QW2A 1VQ4A 2DZCA 1VQLA 5FRNA 3X26B 5GANj 4JRKA 2FL7A 3ZEHA 2MWPA 1V29B 1NPPA 1VIFA 3CC4A 3CCLA 1K73C 3E1SA 2G3RA 5D6WA 2LT4A 3OS2A 1I4K1 1M5Q1 1P92A 5DY9A 1KG1A 3L2WA 2FHDA 2LQ8A 5LJ3f 3GNFB 3J80E 3CMEA 4E7LA 4QVDA 1WPYA 2PVDB 2QQAA 3JSCA 2EJGA 4FT2A 4ZGDB 4A4HA 5DLOA 3I55A 2RJEA 3BY7A 2R57A 3OBYA 1N27A 4RG8A 1VQMA 1K8AC 4FT4A 3JCMg 5CQXA 4GLKA 2P0QA 4C8QD 3DKMA 3M57A 4C0DC 2L8DA 2A7YA 4OP0A 3CCSA 2XDBA 3JCMX 1U1TA 1IZ6A 1XQHA 1QP3A 2DXUA 2FYKA 2LT1A 4FU6A 5GAN4 3E19A 1Q7YU 3PIPA 3TU4K 4LDWA 3SB2A 3I56T 1BKBA 1BIBA 5GANf 5LJ3g 4M77B 4XU0A 4A53A 5GAMh 2RJDA 2E1HA 1UGQB 1UGPB 5CR2A 3GIBA 2JUFA 2PU9B 3M4GA 2LQKA 3ME9A 3QZ5B 2KMTA 3DLMA 4OGCA 3JB9J 1YJWA 4M7DG 5GAN6 4MDXA 4BD3A 3MP8A 2QTXA 4XTWA 5GAN3 2PUOB 1QVGS 3JB9H 2DO3A 1LOJA 1YITA 2MF2A 2MI6A 2RHZA 4M78E 2A3LA 4M75C 1KQSS 2JTFA 5A0GA 5GANh 3T9NA 4C0ZA 5L8RE 2X4YA 2RJCA 2QQBA 4F7UE 4BDYA 3BFMA 4C92B 2QQSA 1FX7A 4LD6A 1YBYA 5GMKm 2WACA 1YJNT 1YI2T 5GAN7 1U8RA 2ZPBB 2EJFA 4M77G 5M9OA 2EQKA 1YJ9A 4HCBA 2CYZB 2VUBA 3JCMW 1VQKA 3A8LB 4M7DF 2CS7A 3ZFJA 3N5BB 2RJFA 3CEYA 3MCAB 4J7FA 5KH6A 3X25B 5GAMd 1EIFA 3M59A 4O6JA 3CCJA 3CCET 4OF1A 1VQ6T 3E9FA 3RIRA 2P4TA 4RMOA 4OB3B 3QO3A 1NE8A 3GPLA 2DEQA 4L5GA 2GCXA 4R55A 4JDSA 3CC4T 3CCLT 3WXMB 2ZZDA 1G3YA 2VC8A 4RCCA 2E65A 3VKIA 3HFNA 3OSSC 4EMKC 1NJIC 2DIQA 2IG0A 3A8MB 4RCBA 4QQ6A 5CKEA 5KCOA 3G4ST 1G5VA 2E41A 3JB9G 3G71T 2EAYA 3SWNC 4Q5WA 2K2VA 2E12A 5HKCA 2QI2A 3X24B 3JCMb 4E7IA 2DTIA 1Q82C 3CCUA 2RI2A 5CCAA 4M77C 3LW5E 2X4JA 3CBOA 1M1KC 1VQ7T 1Q81C 1QW1A 2EWNA 3QYGB 4F7UF 5CKDA 1BIAA 4M78A 5LL6S 3MEUA 3RKXA 5GMKh 1O9SA 3BDUA 2PUKB 3LGLA 3QJYA 4JS5A 2P0KA 3CCMT 3QXEB 4XU1A 3I56A 1W2BA 2HNIA 3VUBA 4BACA 5LJ5e 3J81E 2E6ZA 2DJZA 1X01A 4LDYA 1G3SA 1M9SA 4J8OA 4C92G 2QQRA 5CIUA 4Y28E 4C5IA 3CCVA 2KAFA 4M7AC 4C5HA 3G7ZA 2CZ0B 1Q82U 5GAN2 4MMLA 1JB0E 1MHNA 2E5QA 5LJ5d 2LNVA 3FB9A 4PLIA 2M0OA 2R58A 2M1HA 3SDZA 3X20B 5GAOn 3QPHA 3P8BB 2DIGA 3JCMV 5C0MA 3CCUT 5CKHA 1VQPA 3KXTA 3L2UA 4NS5A 4N0AC 3OYFA 2QA4A 2LDMA 2LRQA 4PJOG 4JRQA 5CO7A 1VQ8T 1N6AA 2OTJA 2RO0A 1JJ2A 4JJNK 2QEXT 4C8QF 4L6V5 5GANe 3VU3C 2R5AA 2XU8A 1K9MC 4M7AE 4M77E 3C95A 4BE0A 1QVFS 1M4ZA 2LCLA 4J6WA 2V8KA 5KCHA 4XTZA 4OB2B 5LJ3d 4HCZA 4Y91A 4HT9A 3H6ZA 4C92C 1YIJT 5I2SA 4ZN3A 2GF7A 3CCQT 3OMCA 4PNOA 2AHJB 3GP8A 4E7KA 1KC8C 2P0PA 5LJ3e 2DTHA 2X4WA 4HT8A 3OYGA 1BI3A 4L59A 3RKYA 2YHTA 4N0AA 5GANg 4C5EA 2VV5A 4F7UB 3O8VA 2XI9A 2MWOA 2Y90A 1JRIA 3LGFA 3LH0A 2QEXA 2K4YA 2V8JA 3UT1A 3NTIA 3OQ5A 2GQVA 1SSFA 3DB3A 4M75B 5GAOp 3OYCA 2IVWA 5EG2A 3VJPA 3LX7A 2KDSA 2QDYB 4BB7A 4X9CA 3CC2T 1Y96A 3DB4A 1PSEA 1YI2A 4ZTFA 5LJ3h 4C0GA 3QDRB 4IUUA 2DAQA 3HP9A 2K5IA 2WSFE 3RERA 4BI3A 5CKBA 4A4FA 4LDVA 5DM7R 3CCST 2LC4A 2JTMA 3CCJT 4D6WA 3PTAA 2DZ9A 3HHTB 3JCMh 2RM4A 3LWIA 4ZGJB 1ZQ1A 4TVRA 2XK0A 2HBPA 1PSFA 1QVPA 2L3RA 3QKJA 3C94A 4OB1B 5CAIA 5A2QE 1I5LA 3CD6A 5CQYA 3CCRT 3L42A 1ZBXA 4M75G 3OW2A 3G6ET 1OI1A 1K73U 4KULA 3FLGA 3PNWC 4C92F 4E47A 3AHUA 2EQUA 3A5ZB 4EMKB 2VXFA 1YHQA 3HRTA 1IREB 2CZ1B 5HK3A 3EAEA 2X4XA 4JUVA 1WQ7A 1M1FA 3HRSA 4J5YA 4FIBA 4J83A 3CC7A 2E10A 3JCMe 4C8QB 3M56A 2HQEA 3NTKA 3CMET 4M7DA 4XAXB 5GAMg 5A0DA 1QP2A 4C8QC 1KQ1A 1MGQA 2DD4A 4M78G 2OAUA 4X34A 1U1SA 3JCMd 1VQKT 1TH7A 3JB9I 4JRIA 1X6OA 4VUBA 3CCMA 2VXEA 1G3WA 1KHIA 4M77F 4OMFB 3V7RA 3L2QA 1Q81U 1VUBA 1BI2A 3Q1JA 3QG1A 5HY6A 5GAMj 4UC4A 2YLCA 4C0FA 5GMKe 3V8KA 4E7HA 1D3BA 2YRVA 2CZ6B 3CBMA 3QIIA 4M75A 5IAYA 3JB9F 1K9MU 1QVFA 4MZPA 4N4HA 1Y96B 4PJOA 2ZPIB 1OZ2A 2RHUA 3OBWA 4V2SA 1G3TA 2E64A 4PJOD 1NJIU 2K3YA 4QQDA 4KT0E 4M7DD 1WJQA 4N4IA 1VQ4T 3V7CA 5GAN8 1Q86C 5FRMA 1UEBA 5GAN5 2XD0A 1DJ7B 3LYIA 3QZ9B 1H3ZA 4KBMB 4FSXA 3OYNA 3SFMA 3TREA 2I2LA 2PVOB 1WGSA 4CRIA 4M78D 3PGGA 5J3BA 1VQ9A 1UB4A 4M78C 1VQ5T 4XTVA 2GFUA 3M55A 3L1AA 5D6YA 5LJ5h 2BKDN 4XK8E 3GOXA 4PLLA 1YCYA 3A8OB 4MZMA 1X75C 1KHCA 3RUXA 4E7JA 1KQ2A 3UWNA 3JCMQ 2LTOA 3JRZA 4XU2A 2QQ9A 5D6XA 1VQ9T 4JS4A 4IKFA 3HRUA 4GY5A 1RI0A 2KK4A 1VQ5A 2E70A 4ELZC 4M78B 3SWNB 3M58A 3JAME 2BUDA 2OTLA 5AYFA 5CKFA 4LDUA 3WVDB 4M75E 2MMPA 5GAOl 3BDLA 1H641 3EFRA 4XQ3A 5FLXE 4BE2A 4C8QA 2EQMA 5CVIA 1QVGA 5I21A 3V7SA 4EDUA 2ZPEB 3OA6A 2DTOA 1M8VA 5FU6B 4M7DB 2M16A 1VQPT 3QUIA 4PJOB 3MO8A 2D9TA 3MEVA 4IUPA 2OTLT 2FVUA 2O4XB 4NL2A 5DLQE 3CC7T 4M7AF 4XTYA 2EYQA 3X28B 2K57A 1VQ8A 2OTJT 2CKKA 4NL3A 1HXDA 2FB7A 1KC8U 1FWZA 5LJ5f 2VYTA 5GAOm 4N4GA 2EFIA 4P5NA 2D6FA 3S6WA 5GAOq 3OYBA 1Q7YC 1S72T 1LNXA 1Y7XA 3MEWA 4PJOF 3A8GB 2GFAA 4XU3A 3URGA 4BY6C 4C92E 5HK0A 1WJSA 5GMKl 5IN1A 5GMKi 4IUTA 2DXBA 4FL6A 2QXFA 1BYMA 2X35A 5C6SA 2KQWA 2ZCFB 3OYDA 2RD1A 2Y4YA 4MZTA 4EPCA 3CPFA 4Z02A 4BI8B 4M7AD 3FC3A 4M78F 1YJ9T 5GAMe 5J39A 4BE1A 2RB6A 2L89A 5FU7C 5I2MA 1OZ3A 2L5QA 3CD6T 2CZ7B 3NFCA 2KSSA 4NOYA 3TCJA 4J6YA 3OYAA 3CCVT 3META 1WQWA 2XIDA 2D0QB 4WF2A 3ASKA 3CCRA 4JLGA 2HAXA 4M7AA 1BI0A 3PT9A 4YTLA 2DXTA 3HSBA 3OS5A 1VQOT 3TEEA 2BIVA 3OYKA 2PQWA 2CGHA 3FEOA 5A0LA 2R5MA 3RESA 1OYXA 3SD4A 1S72A 1VQMT 3CC2A 1JBMA 4M77A 3C4SA 3OYJA 4ELYC 2HD0A 3CXCA 2YLBA 2EJ9A 3RMQA 3G4SA 1VQNT 1VQ6A 1I8FA 4B9WA 1N9SA 2DK3A 5FROA 3G71A 4JRPA 2RK1A 2LVMA 2WSCE 4MMKA 3NTHA 2JZ2A 3ZBDA 3FJPA 1R8OB 1VQLT 2C06A 2EIFA 1M1KU 4OB0B 4EMGA 4QVZA 4X9DA 2K5FA 4A54A 3KBGA 4J6XA 1M90U 2O4XA 1N8RC 1K8AU 4IURA 2MAMA 2B8AA 3JB9D 3J7AF 3MHXA 4QVCA 3OMGA 3P8HA 1RL2A 2KVQG 3OS0A 2ZPFB 3KUFA 3JCMc 3V8JA 1ZHIA 2XG8D 5J26A 3G6EA 4M7DC 2EKOA 5KE2A 4ME7A 2XDDA 1Q86U 4C92D 1VIEA 1I81A 1VQ7A 1Y71A 3CPWA 2JN0A 4R56A 1B34B 1WNLA 1VQNA 3LLRA 5KE3A 1W4SA 5GAOr 4ATOA 3CMAT 1BI1A 4RKUE 4LD9K 1JJ2S 2RHIA 2KY9A 3CBPA 4C8QG 3A8HB 3OY9A 3M5AA 1HK9A 2NLUA 3L2RA 4DA4A 2K5LA 2QA4T 4O5VA 2HQXA 2RA2A 3V8LA 4HCCA 3FDRA 3OYLA 4EMKA 3FIFA 5GAMf 2E6NA 2DVEA 5GANd 1KQSA 3HFOA 3VUZA 2K3XA 3WVEB 4DOVA 4BDZA 3HKSA 4M7AB 2PVGB 5GMKj 4HKEA 3OYHA 4M7DE 1WJRA 3PMIA 4PJOE 2F69A 1KD1C 2XKOC 2ZPHB 1XOVA 1UGRB 2F5TX 3QJ6A 3PMTA 3QHSA 3JCMP 3M9QA 4IUVA 2VGMA 4C5GA 3S3MA 1YITT 1Y07A 3CMAA 3VYGA 2LCCA 2DXCA 3MP6A 1VQOA 3CXCS 4ZN1A 3JCMJ 1D3BB 3E9GA 3HPWA 2JOYA 4F7UG 4DQ2A 3M54A 1UGSB 1KD1U 3M53A 3P8DA 5FU6C 1AHJB 2XDPA 4BI4A 4FM4B 3OW2S 3F70A 4DOWA 1O75A 3BW1A 3I55T 1LJOA 3L2VA 2RHXA 5IT9E 1YIJA 1YJNA 3CCQA 1YHQT 4BY6B 3OSVA 3OYIA 2DKGA 3EFSA 4OGEA 3ER0A 5FU7B 2WSEE 4M75F 3RMSA 3GNGA 4B9XA 3CCEA 5LJ5g 4M77D 4OVAA 1FXXA 3QBYA 4JLIA 3MEAA 2LX9A 3S3OA 4LDXA 3OYMA 2M9UA 2ZGWA 3OB9A 3RKWA 2O01E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QO3 A;  1B34 A;  5CAI A;  1I5L A;  4M7A D;  4M78 F;  2DEQ A;  5GAM e;  2RB6 A;  4M7A G;  2VC8 A;  4RCC A;  4M75 G;  2E65 A;  4NOY A;  3HFN A;  3JCM f;  4J6Y A;  4EMK C;  1WQW A;  4RCB A;  4M7A A;  4WF2 A;  4C92 F;  4M7D D;  3AHU A;  3HSB A;  2DXT A;  2E41 A;  4EMH A;  3JB9 G;  4EMK B;  2VXF A;  3L2Z A;  2EAY A;  3SWN A;  3SWN C;  5LJ5 j;  2CGH A;  3JCM b;  4JUV A;  1WQ7 A;  2DTI A;  3RES A;  4J5Y A;  4M77 C;  2E10 A;  3JCM e;  1JBM A;  2ZGW A;  4M77 A;  4C8Q B;  3QSU A;  4PJO C;  5LJ3 j;  2EWN A;  2YLB A;  4F7U F;  2EJ9 A;  4XTU A;  1BIA A;  4M78 A;  3RKX A;  5GMK h;  1I8F A;  4M7D A;  1N9S A;  3INZ A;  3BDU A;  1N9R A;  4XTX A;  1KQ1 A;  4C8Q C;  1MGQ A;  5GAM g;  4PJO A;  4HA8 A;  4M78 G;  4MMK A;  1U1S A;  4XU1 A;  4F7U A;  2HNI A;  1TH7 A;  3JCM d;  3JB9 I;  4JRI A;  5LJ5 e;  4C8Q E;  4C92 A;  3FJP A;  2DJZ A;  2VXE A;  1X01 A;  4M77 F;  3V7R A;  4M75 D;  4C92 G;  2DZC A;  5GAM j;  4EMG A;  2YLC A;  5GMK e;  4X9D A;  3V8K A;  4M7A C;  1D3B A;  4M75 A;  4A54 A;  3JB9 F;  4J6X A;  5GAN j;  4JRK A;  5GAN 2;  4MML A;  3JB9 D;  5LJ5 d;  3FB9 A;  1Y96 B;  4QVC A;  5GAO n;  4V2S A;  3JCM c;  2E64 A;  3JCM V;  3V8J A;  4M7D C;  4PJO D;  4N0A C;  4C92 D;  1I4K 1;  1M5Q 1;  5DY9 A;  1I81 A;  3V7C A;  5GAN 8;  4PJO G;  5GAN 5;  2JN0 A;  1B34 B;  5LJ3 f;  1WNL A;  5GAO r;  1WPY A;  2I2L A;  4C8Q F;  2EJG A;  4M78 D;  5GAN e;  3PGG A;  3VU3 C;  3BY7 A;  4C8Q G;  4M78 C;  3JCM g;  4M7A E;  1HK9 A;  4M77 E;  4XTV A;  4C8Q D;  4J6W A;  4XTZ A;  3V8L A;  2RA2 A;  4OP0 A;  3L1A A;  5LJ3 d;  3JCM X;  5LJ5 h;  4Y91 A;  1U1T A;  3FIF A;  4EMK A;  4HT9 A;  2DXU A;  4C92 C;  2FYK A;  5GAM f;  1YCY A;  5GAN d;  2DVE A;  5GAN 4;  1KQ2 A;  3HFO A;  3RUX A;  3SB2 A;  3JCM Q;  1BIB A;  5GAN f;  4XU2 A;  4M7A B;  5LJ3 g;  4M77 B;  4XU0 A;  4A53 A;  4PNO A;  5GMK j;  5GAM h;  2E1H A;  5LJ3 e;  4M7D E;  2DTH A;  4M78 B;  3SWN B;  3GIB A;  3M4G A;  4HT8 A;  4PJO E;  3RKY A;  4M7D G;  2YHT A;  4M75 E;  4N0A A;  5GAN g;  3JB9 J;  5GAO l;  5GAN 6;  1H64 1;  3EFR A;  4XQ3 A;  4F7U B;  2QTX A;  3QHS A;  4C8Q A;  3JCM P;  4XTW A;  5GAN 3;  5I21 A;  2Y90 A;  1JRI A;  3V7S A;  3JB9 H;  2DTO A;  1LOJ A;  1M8V A;  4M7D B;  4M78 E;  3QUI A;  3JCM J;  4PJO B;  4M75 C;  1D3B B;  4M75 B;  4F7U G;  5GAN h;  4DQ2 A;  5GAO p;  4NL2 A;  4M7A F;  4F7U E;  4XTY A;  3BFM A;  2K57 A;  4X9C A;  4C92 B;  1Y96 A;  1HXD A;  2FB7 A;  3BW1 A;  1LJO A;  4NL3 A;  5LJ5 f;  5GAO m;  5LJ3 h;  5GMK m;  2DKG A;  3EFS A;  5GAO q;  5GAN 7;  3RER A;  4M77 G;  2EJF A;  4M75 F;  4M7D F;  1LNX A;  3JCM W;  4PJO F;  5LJ5 g;  4M77 D;  4XU3 A;  4C92 E;  5GAM d;  5GMK l;  4JLI A;  5GMK i;  2DZ9 A;  3JCM h;  2RM4 A;  3RIR A;  2RD1 A;  3RKW A;  4QVD A; 
#chains in the Genus database with same CATH topology
 2HEQ A;  2YUQ A;  4ZTJ A;  3CPW S;  1IGQ A;  1SPK A;  2ZPG B;  4OMN A;  3SHW A;  3JCM f;  4A4K A;  4RUG A;  1H8K A;  1NPR A;  1GXI E;  4EMH A;  4A4E A;  4PFZ A;  5LJ5 j;  4MDW A;  1M90 C;  3DLL A;  4II1 A;  3UDC A;  1WFW A;  1PNJ A;  4F17 A;  3OS1 A;  4IUQ A;  2KRO A;  4B6M A;  2YT6 A;  4F7U A;  3MKD A;  1AEY A;  1PD1 A;  3S3N A;  1XNI A;  2RK2 A;  2XHC A;  1VQ4 A;  3A1P A;  1CKB A;  1BK2 A;  2FL7 A;  4Z88 A;  3UF4 A;  1V29 B;  1VIF A;  3CC4 A;  1K73 C;  3E1S A;  2G3R A;  2AK5 A;  3HTR A;  2LT4 A;  1EFN A;  2FHD A;  1SRM A;  4FT2 A;  4ZGD B;  1X6B A;  2EJG A;  4Z8A A;  4FYX B;  3BY7 A;  1VQM A;  1K8A C;  1I1J A;  4JJB A;  4PK4 A;  1IZ6 A;  2FPE A;  3PIP A;  1I0C A;  3TU4 K;  1WXT A;  1OPK A;  4XU0 A;  2ED0 A;  4A53 A;  1OQK A;  1VA7 A;  1UGQ B;  1UGP B;  2CSI A;  3M4G A;  3ME9 A;  4M7D G;  4GLM A;  3JB9 J;  5GAN 6;  3MP8 A;  2QTX A;  1V1C A;  4XTW A;  2F2W A;  4AT1 B;  3MJX A;  4J9F A;  1YIT A;  2MI6 A;  1UE9 A;  5A0G A;  4AFU C;  2ZAE A;  4F7U E;  2ENM A;  1YBY A;  1YI2 T;  4AFQ C;  1NLO C;  2EQK A;  5M9O A;  2KGT A;  3A8L B;  3VS5 A;  3N5B B;  3CEY A;  1EIF A;  3CCJ A;  4OF1 A;  5KYW A;  1UGV A;  3QO3 A;  1YJN Q;  1NE8 A;  4R55 A;  4JDS A;  3CC4 T;  1VQ8 Q;  1K8A R;  2DIQ A;  1AZG B;  1FMW A;  2E41 A;  3JB9 G;  2EAY A;  3EH1 A;  2BTT A;  3X24 B;  2DTI A;  3CCU A;  2RI2 A;  4M77 C;  3CBO A;  3TQ7 P;  1Q81 C;  1QW1 A;  3QYG B;  2ATC B;  1X27 A;  1BIA A;  1ZA2 B;  5GMK h;  3MEU A;  4FYY B;  2PUK B;  3QJY A;  2QYZ A;  3CCM Q;  3J81 E;  1X01 A;  4LDY A;  1M9S A;  3VS6 A;  4C92 G;  4M7A C;  2KAF A;  3QWX X;  3G7Z A;  2IIM A;  3LH5 A;  1GL5 A;  4MML A;  5LJ5 d;  4PLI A;  2R58 A;  2M1H A;  2JJ9 A;  2DIG A;  2O31 A;  4D8D A;  3L2U A;  2QA4 A;  1M90 R;  4JRQ A;  2DL7 A;  2RO0 A;  2E4H A;  5GAN e;  2LJ3 A;  3I55 Q;  2CUB A;  2MOX A;  4J6W A;  4XTZ A;  2CDT A;  5GJW B;  2O2O A;  4PNO A;  1RAB B;  2GTO A;  2DTH A;  2ABL A;  1BI3 A;  3RKY A;  5IXB A;  2FPF A;  1WHJ A;  3O8V A;  3LGF A;  1U5S A;  2V8J A;  3UT1 A;  4JJD A;  2GQV A;  5GAO p;  3CC2 T;  3DB4 A;  1YJW Q;  5LJ3 h;  4C0G A;  1J3T A;  4IUU A;  2DAQ A;  1BCO A;  3RER A;  1NM7 A;  2LC4 A;  5IHN A;  2DNU A;  4D6W A;  1KSW A;  4TVR A;  2L3R A;  1JEG A;  1MNE A;  4HVW A;  4LXC A;  1Q86 R;  3FLG A;  3AHU A;  1FMV A;  3EAE A;  1WQ7 A;  4J83 A;  2E10 A;  3JCM e;  4C8Q B;  3CC7 Q;  3NTK A;  2VAS A;  5GAM g;  5A0D A;  2OAU A;  2F2X A;  2BE9 B;  4WCI A;  4FYW B;  1VQ7 Q;  1G3W A;  1Q81 U;  1VUB A;  1ABQ A;  4UC4 A;  1T0H A;  5KYU A;  4AG1 C;  1AVZ C;  1K9M U;  1JXM A;  2ZPI B;  1OZ2 A;  4V2S A;  1G3T A;  4KT0 E;  1VQ4 T;  4N4I A;  3V7C A;  1UEB A;  2XD0 A;  1DJ7 B;  1G83 A;  1H3Z A;  4KBM B;  1BCM A;  2PVO B;  1AWX A;  4CRI A;  1D1A A;  4M78 C;  1VQ5 T;  4XK8 E;  3GOX A;  1MMA A;  3A8O B;  1RAF B;  1KQ2 A;  3RUX A;  1ZUU A;  3JCM Q;  1D0Y A;  2LTO A;  5D6X A;  4IKF A;  3M0P A;  1YWO A;  2KK4 A;  2E70 A;  4ELZ C;  5FWC A;  2OTL A;  2DM1 A;  1JXO A;  1GCP A;  3VRZ A;  5CVI A;  1QVG A;  5I21 A;  3MO8 A;  3I5R A;  1QWF A;  2CT3 A;  4XTY A;  1VQ8 A;  4M7A F;  2K57 A;  1Q81 R;  2D6F A;  1T0J A;  5GAO q;  4E7S A;  2LP5 A;  1S72 T;  2H8H A;  2J06 A;  1PRL C;  2GFA A;  2YSQ A;  4ESR A;  3CCU Q;  5GMK i;  2QXF A;  3OYD A;  2ZCF B;  4MZT A;  4EPC A;  5KYY B;  2FG0 A;  4BI8 B;  3FC3 A;  4M78 F;  2LZ6 B;  5I2M A;  3C0C A;  2HL5 C;  3TCJ A;  3OYA A;  3MET A;  4M7A A;  3ASK A;  3PT9 A;  1FYN A;  3BE3 A;  3OS5 A;  1VQO T;  2K6D A;  3TSW A;  3SD4 A;  1VYV A;  3CC2 A;  1JBM A;  1V76 A;  2GGR A;  3C4S A;  3OYJ A;  1KC8 R;  4ELY C;  2MK5 A;  2EJ9 A;  1YWP A;  4JJC A;  5FRO A;  3H41 A;  3ZBD A;  3FJP A;  1VQL T;  1UJ0 A;  1K9M R;  4QVZ A;  2K5F A;  4A54 A;  1WXB A;  2E3I A;  3KBG A;  1VQM Q;  3JB9 D;  3J7A F;  1OPL A;  3MHX A;  2KVQ G;  3OS0 A;  2ZPF B;  3KUF A;  2XDD A;  4J9I A;  1I81 A;  3CPW A;  2JN0 A;  4WTO B;  1WNL A;  3LLR A;  5KE3 A;  1TOV A;  1PC0 A;  1W4S A;  2HSE B;  4ATO A;  3CMA T;  4HVV A;  4RKU E;  3H9N A;  3A8H B;  1AWJ A;  3M5A A;  2COZ A;  5KYW B;  4GBQ A;  4DA4 A;  1U06 A;  2QA4 T;  3V8L A;  4JPB W;  3FDR A;  1C6V X;  2OI3 A;  2DF6 A;  1WZO A;  4BDZ A;  2PVG B;  5GMK j;  4RTW A;  2LJ0 A;  3PMI A;  2F69 A;  1XOV A;  3QJ6 A;  3PMT A;  3QHS A;  3S3M A;  1VYU A;  4C5G A;  3CMA A;  3VYG A;  3MP6 A;  1VQO A;  5I22 A;  4F7U G;  3M54 A;  1W70 A;  1ZLM A;  2EGA A;  3F70 A;  3I55 T;  1D1C A;  1YJN A;  2W0Z A;  1YHQ T;  3OSV A;  2J6O A;  3RMS A;  2P84 A;  4AFZ C;  4M77 D;  2LX7 A;  3MEA A;  3REB B;  2EPD A;  3CCL Q;  2O01 E;  1B34 A;  4KUD K;  3M0S A;  2EYW A;  1WIE A;  2V8I A;  1YJW T;  3M0U A;  3VV0 A;  1EZZ B;  2DL5 A;  2J7I A;  2JNG A;  4PJJ A;  3FRN A;  2OTJ Q;  2XIC A;  1SHG A;  2JVV A;  3PIO A;  4FCY A;  3GF5 A;  1W2B S;  1Q95 G;  1N8R U;  2DFU A;  1PKT A;  3QSU A;  3E2U A;  1Q82 R;  4PL6 A;  3INZ A;  4HA8 A;  2V1R A;  2DPP B;  3OYY A;  2F5K A;  3GLX A;  4C8Q E;  2CP6 A;  2DD5 A;  4QW2 A;  2EVR A;  1LPL A;  1AT1 B;  1VQL A;  3X26 B;  2EYZ A;  5GAN j;  2X9H A;  1KG1 A;  1I4K 1;  1P92 A;  1YI2 Q;  3J80 E;  3EH2 A;  1WPY A;  1ZX6 A;  5CQX A;  3JCM g;  3CMA Q;  2DRK A;  1MMN A;  3DKM A;  2EYX A;  4C0D C;  2L8D A;  2C0O A;  1XQH A;  4FU6 A;  2FYK A;  2L0A A;  3SB2 A;  1UUE A;  5L23 A;  1WX6 A;  2RJD A;  2E1H A;  3GIB A;  2CSQ A;  1N8R R;  2LQK A;  3QZ5 B;  1YJW A;  2DA9 A;  1CKA A;  2AT1 B;  3EGX B;  1LOJ A;  1TUG B;  2A3L A;  1SF9 A;  5GAN h;  3T9N A;  2X4Y A;  2RJC A;  1MND A;  4C92 B;  3GBQ A;  1R77 A;  5GMK m;  2DRM A;  2WAC A;  1YJN T;  2JW4 A;  1YP5 A;  2ZPB B;  4M77 G;  3CCV Q;  1YJ9 A;  4M7D F;  3JCM W;  1QCF A;  2W10 A;  2CS7 A;  1RAE B;  2RJF A;  5GAM d;  3CCE Q;  1VQ6 T;  4F04 B;  5IHI A;  1MUZ A;  2VVK A;  2DEQ A;  2GCX A;  2ZZD A;  4RCC A;  4KH0 B;  3HFN A;  3OSS C;  1NJI C;  1UHF A;  3A8M B;  5CKE A;  4QQ6 A;  3G4S T;  1G5V A;  1YHQ Q;  1PD0 A;  4J9G A;  1ZUK A;  4KGX B;  1PG5 B;  5CCA A;  2X4J A;  2A08 A;  1VQ7 T;  3SEM A;  4F7U F;  1R0B G;  4M78 A;  5LL6 S;  2VWF A;  1TSF A;  1O9S A;  3BDU A;  2P0K A;  1WI7 A;  2HNI A;  3VUB A;  2KRM A;  1I07 A;  4LE9 A;  4J8O A;  2QQR A;  4Y28 E;  4C5H A;  5GAN 2;  2E5Q A;  2LNV A;  3FB9 A;  2M0O A;  3SDZ A;  3JCM V;  3CCU T;  3MPU B;  2LRQ A;  5CO7 A;  1N6A A;  2O9S A;  4JJN K;  2QEX T;  1TTH B;  4KGZ B;  4L6V 5;  2DX1 A;  2M51 A;  1K9M C;  4BE0 A;  1QVF S;  1M4Z A;  2J6K A;  4RTZ A;  4DBQ A;  5KYY A;  2V8K A;  3NHN A;  2E5K A;  4OB2 B;  5LJ3 d;  3H6Z A;  1YIJ T;  3EGD B;  5I2S A;  2NUZ A;  2GF7 A;  2AIR B;  2ECZ A;  3GP8 A;  3EG9 B;  1KC8 C;  4LNP A;  2QGG A;  4N0A A;  4C5E A;  4KGV B;  2YRD A;  1X43 A;  2XI9 A;  2JMA A;  2Y90 A;  2NUT B;  1G2B A;  3DB3 A;  3EG1 A;  5FW9 A;  2QDY B;  4X9C A;  2QA4 Q;  1IGU A;  2IPO B;  2AZS A;  1ABO A;  1SKU B;  3HP9 A;  1C0M A;  4LDV A;  1D0X A;  3CCJ T;  1AWO A;  4ZGJ B;  2EQI A;  2XK0 A;  2HBP A;  4HCK A;  3C94 A;  5CAI A;  4DEX A;  2OJ2 A;  1T3L A;  3L42 A;  4J9B A;  3OW2 A;  3QWY A;  1OI1 A;  1VQK Q;  4KUL A;  3PNW C;  4E47 A;  2CP5 A;  2VXF A;  3HRT A;  1IRE B;  5HK3 A;  4JUV A;  3VS7 A;  2F2V A;  4FIB A;  2DBM A;  4C8Q C;  1KQ1 A;  4X34 A;  3JCM d;  1IHV A;  1TH7 A;  4JRI A;  4VUB A;  3I56 Q;  2VXE A;  4OMF B;  3V7R A;  1BI2 A;  2NUP B;  4C0F A;  1RAC B;  2CZ6 B;  1Y0M A;  3JB9 F;  2RQV A;  4N4H A;  2KRS A;  3OBW A;  1D1B A;  2K3Y A;  3A98 A;  1WJQ A;  5GAN 5;  1RAI B;  3LYI A;  3OYN A;  4M78 D;  3PGG A;  1C1A A;  4QKU A;  4XTV A;  3M55 A;  3L1A A;  5LJ5 h;  1VQP Q;  1X75 C;  3UWN A;  1RUW A;  2D8J A;  1VQ9 T;  4GY5 A;  4PFP A;  4M78 B;  3SWN B;  1YN8 A;  1IHW A;  2EYY A;  3AT1 B;  4LDU A;  1OX9 A;  5GAO l;  1H64 1;  2EQM A;  3OA6 A;  2DTO A;  4M7D B;  2M16 A;  2D9T A;  2FEI A;  2O4X B;  4RTU A;  3X28 B;  1KC8 U;  1FWZ A;  5LJ5 f;  1M3C A;  2MIO A;  4N4G A;  2F1L A;  4P5N A;  1Q7Y C;  1LNX A;  1Y7X A;  2Z0W A;  3A8G B;  3URG A;  4C92 E;  3RNJ A;  1WJS A;  4PJN A;  2DXB A;  1Y57 A;  5C6S A;  2KYM A;  1OU8 A;  2RD1 A;  3VS0 A;  2Y4Y A;  4K11 A;  1QKX A;  1YJ9 T;  5GAM e;  1RAH B;  2RB6 A;  3EGD A;  1AZE A;  1OZ3 A;  2L5Q A;  2KSS A;  2XID A;  2D0Q B;  4JLG A;  2HAX A;  2OTL Q;  2DXT A;  5I11 A;  1K1Z A;  1PRM C;  2BIV A;  2PQW A;  1UEC A;  2CGH A;  2EGE A;  3RES A;  1IRX A;  1S72 A;  1VQN T;  2M0Y A;  1HJD A;  2JM9 A;  1FMK A;  2PTK A;  2LVM A;  2WSC E;  3NTH A;  3QDF A;  3EGX A;  3EHQ A;  2YRC A;  3RR6 A;  3P8H A;  3V8J A;  5J26 A;  4ME7 A;  1YIJ Q;  1Q86 U;  1JQQ A;  1Y71 A;  4R56 A;  3G6E Q;  1VQN A;  2HKN A;  4LD9 K;  1JJ2 S;  3CBP A;  1BB9 A;  2NLU A;  3L2R A;  1QKW A;  2K5L A;  2RA2 A;  3OYL A;  1KFZ A;  2DVE A;  2RQR A;  1X69 A;  3VUZ A;  1KQS A;  3WVE B;  1OOT A;  2KXC A;  1D09 B;  2D1X A;  2H3E B;  2KRN A;  4HKE A;  4M7D E;  4PJO E;  1KD1 C;  2F5T X;  2CUD A;  3M9Q A;  1YIT Q;  3U23 A;  2NWM A;  1M3A A;  1KQS P;  3VS1 A;  3HPW A;  4D8K A;  5FU6 C;  2HBW A;  1AHJ B;  3EG3 A;  4FYV B;  3OW2 S;  2DL3 A;  5IT9 E;  1LJO A;  2G6F X;  2DKG A;  4OGE A;  5FU7 B;  2WSE E;  3CCQ Q;  4CC4 B;  5LJ5 g;  1FXX A;  1T3S A;  2CP2 A;  3OYM A;  2M9U A;  2ZGW A;  3R6O A;  3OB9 A;  5CK9 A;  2L3Q A;  2ESW A;  4M7A G;  3UPU A;  1OEB A;  4RG2 A;  1KK7 A;  2CP3 A;  4BUG A;  1W6X A;  2EQJ A;  3LWH A;  3SWN A;  2KNB B;  1BBZ A;  2JS2 A;  3I5S A;  3OYE A;  2HL3 A;  3M4Y A;  2RI3 A;  4PKC C;  5LJ3 j;  2K9G A;  4PJO A;  2VGN A;  1M1G A;  4XTX A;  4ZGE B;  2L3P A;  5GJV B;  1TU0 B;  1G8X A;  2RQU A;  4C92 A;  3I35 A;  1WHG A;  1NZ9 A;  3QYH B;  5KYX A;  4PJL A;  2DER A;  2DZC A;  1YCS B;  4JRK A;  2MWP A;  1NPP A;  3CCL A;  3OS2 A;  1M5Q 1;  3L2W A;  4F14 A;  2LQ8 A;  3H0H A;  4E7L A;  3GNF B;  3CME A;  4HVU A;  1RLQ C;  2PVD B;  2QQA A;  3I55 A;  4A4H A;  2R57 A;  1N27 A;  3EGU A;  1E6H A;  2MPX C;  2ROT A;  4FT4 A;  4GLK A;  4C8Q D;  3M57 A;  4OP0 A;  3CCS A;  2XDB A;  1AWW A;  1Q7Y U;  2DXU A;  3I9Q A;  3VS3 A;  4E6R A;  1BIB A;  1M8M A;  2C0I A;  5GAN f;  3EHR A;  5LJ3 g;  4M77 B;  2SEM A;  4DBH A;  5GAM h;  5CR2 A;  2PU9 B;  4MDX A;  4BD3 A;  2PUO B;  2FPD A;  3JB9 H;  2DO3 A;  2YUP A;  2MF2 A;  4M78 E;  2RHZ A;  4E2F B;  2CH4 W;  3H0F A;  4M75 C;  1KQS S;  1TS9 A;  2QQB A;  4BDY A;  1MMG A;  2CRE A;  3BFM A;  3TSZ A;  5GAN 7;  4HCB A;  2VUB A;  1VQK A;  5KH6 A;  3MCA B;  4J7F A;  3CCE T;  4LUE A;  1WXU A;  1ZUY A;  1IB8 A;  2P4T A;  3PVL A;  1QWE A;  4HXJ A;  3CCL T;  3WXM B;  1G3Y A;  5KCO A;  4R0K A;  3EG9 A;  2V1Q A;  2MCN A;  2L3S A;  3G71 T;  1K0X A;  3SWN C;  2K79 A;  4Q5W A;  5HKC A;  2E12 A;  3JCM b;  4E7I A;  2XMF A;  1GCQ C;  1UJY A;  3EFO A;  2EWN A;  5CKD A;  1NEG A;  2LQN A;  4Y92 A;  3QXE B;  4BAC A;  2HMA A;  4PFO A;  3CCV A;  1YJ9 Q;  1MV0 B;  2CZ0 B;  1BU1 A;  1ZBJ A;  2YUN A;  2VB6 A;  5GAO n;  2KEA A;  5C0M A;  5CKH A;  1VQP A;  3KXT A;  4NS5 A;  3G4S Q;  1K0S A;  2OTJ A;  5EC7 A;  4C8Q F;  5D7U A;  2ED1 A;  3REA B;  4M7A E;  4M77 E;  3C95 A;  2HDA A;  2LCL A;  1ZSZ C;  4HT9 A;  1YFN A;  4IIO A;  4ZN3 A;  3CCQ T;  3OMC A;  2EGC A;  4J9D A;  4X1V A;  2P0P A;  5LJ3 e;  2RN8 A;  4DEY A;  4HT8 A;  3OYG A;  4L59 A;  2YHT A;  5GAN g;  2VV5 A;  2GQI A;  1VQ9 Q;  3UAT A;  2OAW A;  1VQL Q;  2MWO A;  2HKQ B;  1JRI A;  2QEX A;  2K4Y A;  1RI9 A;  2FRY A;  5KYX B;  3NTI A;  2QAS A;  3OQ5 A;  4OMM A;  3OYC A;  2A37 A;  2IVW A;  1OX8 A;  2AKK A;  1NEB A;  2KT1 A;  4CC7 A;  2FZG B;  1YI2 A;  1KIK A;  3QDR B;  1NG2 A;  2NYS A;  2WSF E;  1KD1 R;  1H3H A;  1K9A A;  2JTM A;  4PJM A;  1GCQ A;  3HHT B;  3JCM h;  1ARK A;  2RM4 A;  3LWI A;  1ZQ1 A;  1PSF A;  3QKJ A;  2ROL A;  4OB1 B;  2PNI A;  1X2Q A;  1PM3 A;  4KH1 B;  1ZBX A;  4M75 G;  3G6E T;  1K73 U;  2K7A A;  1WHK A;  2EQU A;  1GBR A;  3FJ5 A;  1SRL A;  2X4X A;  3CC2 Q;  1NLP C;  1M1F A;  1YNZ A;  3HRS A;  3CC7 A;  1SHF A;  2BE7 D;  4XAX B;  1QP2 A;  1MGQ A;  1W2B P;  2DD4 A;  1ZA1 B;  1U1S A;  2RQW A;  1VQK T;  3JB9 I;  1U3O A;  2KR3 A;  3CCM A;  3L2Q A;  1KHI A;  4M77 F;  1M2O A;  1VQN Q;  1XJW B;  1QMC A;  3Q1J A;  5GAM j;  2YLC A;  2DEU A;  4E7H A;  3V8K A;  3QII A;  2YRV A;  3CBM A;  4M75 A;  5IAY A;  6AT1 B;  1QVF A;  1Y96 B;  4J9H A;  2DET A;  2RHU A;  2QGF B;  1NJI U;  1Q86 C;  2QTV A;  8ATC B;  1M3B A;  3QZ9 B;  4FSX A;  3TRE A;  2I2L A;  1SG5 A;  5J3B A;  1VQ9 A;  1UB4 A;  8AT1 B;  2QEX Q;  4A63 B;  3EG0 A;  4DBR A;  2MYS A;  4PLL A;  4E7J A;  4MZM A;  1PCX A;  3JRZ A;  1RI0 A;  1VQ5 A;  1B3Q A;  1WA7 A;  4EIK A;  2BUD A;  5AYF A;  2MMP A;  3BDL A;  3EFR A;  5FLX E;  4C8Q A;  2ZPE B;  4OMQ A;  3QUI A;  4PJO B;  3UA7 A;  4IUP A;  2FVU A;  5DLQ E;  4NL2 A;  3CC7 T;  2EYQ A;  2BZY A;  1HXD A;  2FB7 A;  1ZSZ B;  2VYT A;  1WHH A;  2D8H A;  5KYU B;  3S6W A;  3OYB A;  4OML A;  1ACM B;  2COY A;  1VQ4 Q;  5GMK l;  3THK A;  4IUT A;  4FL6 A;  1NYF A;  2PZ1 A;  2X35 A;  1KJW A;  2KQW A;  3ZL7 C;  4Z02 A;  2CP0 A;  4IIM A;  2L89 A;  2CZ7 B;  4NOY A;  1WQW A;  3CCR A;  4WF2 A;  2DJQ A;  4YTL A;  1BI0 A;  1EX4 A;  1JO8 A;  1RLP C;  3HSB A;  2YDL A;  1TXQ A;  3TEE A;  2BZ8 A;  1VYT A;  3FEO A;  5A0L A;  2DIL A;  2R5M A;  1OYX A;  1VQM T;  2JT4 A;  4M77 A;  1OU9 A;  2YLB A;  3RMQ A;  3G4S A;  1VQ6 A;  1I8F A;  4B9W A;  2RK1 A;  1H92 A;  1HD3 A;  1R8O B;  1K76 A;  1WYX A;  2C06 A;  2X3X D;  3CME Q;  2AZV A;  1TG0 A;  1WHL A;  4X9D A;  4F16 A;  4J6X A;  1K8A U;  4IUR A;  2A28 A;  4QVC A;  3OMG A;  1I5O B;  1RL2 A;  3JCM c;  2XG8 D;  2CP7 A;  4C92 D;  2A36 A;  1B34 B;  2JS0 A;  5GAO r;  1QCN A;  1BI1 A;  2RHI A;  1HK9 A;  5FWB A;  2DYB A;  5AT1 B;  3VRY A;  5GAM f;  3HFO A;  2K3X A;  4DOV A;  3HKS A;  2VKN A;  2QG9 B;  1QVF P;  1WJR A;  2RPN A;  2ZPH B;  3EFO B;  3JCM P;  2DL8 A;  2VGM A;  4IUV A;  1VQO Q;  2P4R A;  3JV3 A;  2LCC A;  2DXC A;  3CXC S;  4ZN1 A;  3JCM J;  1D3B B;  2C0T A;  1WHM A;  2HZY A;  1X2K A;  1UGS B;  1KD1 U;  3M53 A;  3P8D A;  2XDP A;  4FM4 B;  4DOW A;  1O75 A;  3BW1 A;  1YIJ A;  3L2V A;  2RHX A;  2COW A;  2DVJ A;  3EFS A;  3G71 Q;  4M75 F;  2O9V A;  2HCK A;  3CCE A;  2X51 A;  1UG1 A;  1RAD B;  4JLI A;  3S3O A;  4LDX A;  1S1N A;  2RF0 A;  3CC4 Q;  1VQ6 Q;  4C0D B;  2X3W D;  4CI0 C;  1QVG P;  1X6G A;  4KUI A;  3PFS A;  1LCK A;  3VYH B;  2EW3 A;  1XTD A;  2KBT A;  3H8Z A;  4A4G A;  3HL8 A;  4Z89 A;  1UTI A;  2RHY A;  3C12 A;  3L2Z A;  1GRI A;  4QQG A;  4PJO C;  4J7I A;  2RI5 A;  4XTU A;  2GTJ A;  2L2P A;  2Y4X A;  1N9R A;  2RH2 A;  2H3J A;  2A0F B;  2LMJ A;  2OX7 A;  2CT4 A;  2KYB A;  3MP1 A;  1ZSZ A;  4M75 D;  5FRN A;  4OMP A;  3ZEH A;  5D6W A;  4KRT A;  4QT7 A;  5DY9 A;  4LUD A;  5LJ3 f;  1N5Z A;  2RNA A;  2QDL A;  3JSC A;  5DLO A;  2RJE A;  4RG8 A;  3OBY A;  1NJI R;  2P0Q A;  3CCJ Q;  2A7Y A;  1S72 Q;  4CC3 A;  3JCM X;  1U1T A;  1QP3 A;  5GAN 4;  2LT1 A;  1M1K R;  3E19 A;  4LDW A;  3I56 T;  1BKB A;  1MMD A;  2B86 A;  3NMZ C;  2GNC A;  2JUF A;  4OGC A;  2KMT A;  3DLM A;  4J9E A;  5IH2 A;  2FRW A;  5GAN 3;  1RAG B;  1SSH A;  1QVG S;  3O5Z A;  1IO6 A;  1AOJ A;  2JTF A;  4C0Z A;  2V26 A;  5L8R E;  1IXD A;  3TVT A;  2QQS A;  2HQH A;  1FX7 A;  4LD6 A;  2BZX A;  1Z9Q A;  2YUO A;  2QAZ A;  1U8R A;  2EJF A;  2I0N A;  1F1B B;  2CYZ B;  4J9C A;  1R0C B;  3X25 B;  3M59 A;  4O6J A;  1GBQ A;  3E9F A;  3RIR A;  3CCS Q;  4RMO A;  4OB3 B;  3GPL A;  4FW2 A;  4L5G A;  1NYG A;  2VC8 A;  2E65 A;  3VKI A;  4EMK C;  2IG0 A;  2DLP A;  4RCB A;  4RTV A;  1Q7Y R;  2K2V A;  2QI2 A;  1Q82 C;  3LW5 E;  1M1K C;  3RKX A;  3PVQ A;  3LGL A;  2YXY A;  4JS5 A;  3CCM T;  3I56 A;  4XU1 A;  1W2B A;  2DBK A;  5LJ5 e;  2E6Z A;  2DJZ A;  1G3S A;  1WLP B;  5CIU A;  4C5I A;  1Q82 U;  1JB0 E;  1MHN A;  3RDV A;  2KXD A;  3X20 B;  3QPH A;  3P8B B;  3RBB B;  1OUL A;  2J6F A;  4N0A C;  3OYF A;  2LDM A;  4PJO G;  1ZSG A;  1B07 A;  1VQ8 T;  1JJ2 A;  1GFC A;  4RTX A;  1VQ5 Q;  3VU3 C;  2R5A A;  2XU8 A;  3H0I A;  3VS2 A;  5KCH A;  1LVK A;  1NBE B;  2M02 A;  2DYI A;  4HCZ A;  4Y91 A;  4C92 C;  4ORZ A;  1SEM A;  1K73 R;  2AHJ B;  2FZC B;  4E7K A;  1PWT A;  4RTT A;  2X4W A;  1UFF A;  4F7U B;  2DL4 A;  1QQJ A;  3LH0 A;  4FW1 A;  3EG2 A;  1SSF A;  4M75 B;  5EG2 A;  3VJP A;  4AMC A;  3LX7 A;  2KDS A;  4BB7 A;  1Y96 A;  1PSE A;  4ZTF A;  1B7T A;  4LN2 A;  1AD5 A;  2K5I A;  1PHT A;  4BI3 A;  5CKB A;  4A4F A;  4CC2 A;  1PKS A;  2RMO A;  5DM7 R;  3CCR Q;  3CCS T;  1A0N B;  1MV3 A;  3PTA A;  2DZ9 A;  4DBF A;  1QVP A;  5A2Q E;  1I5L A;  3CD6 A;  5CQY A;  1E7O A;  1JU5 C;  3CXC P;  3CCR T;  3ULR B;  2CH4 A;  1HSQ A;  2LQW A;  4C92 F;  2FZK B;  1D0Z A;  3A5Z B;  4EMK B;  1YHQ A;  2CZ1 B;  2YWW A;  1M30 A;  2EKH A;  4J5Y A;  4ANJ A;  3M56 A;  2HQE A;  3CME T;  4M7D A;  4AFS C;  2E3H A;  3G1J A;  1OV3 A;  4M78 G;  1TUD A;  1X6O A;  2NUT A;  2JM8 A;  3QG1 A;  5HY6 A;  5GMK e;  5KYN A;  1D3B A;  4OMO A;  2J05 A;  1M2V B;  4MZP A;  1GFD A;  2E64 A;  4PJO D;  4QQD A;  4M7D D;  4JZ4 A;  5GAN 8;  5FRM A;  3M0R A;  3SFM A;  2K3B A;  1WGS A;  2DE0 X;  4FSS A;  7AT1 B;  2GFU A;  2LJ1 A;  5D6Y A;  2BKD N;  2GBQ A;  2HSP A;  1YCY A;  1KHC A;  1M27 C;  3M0Q A;  4XU2 A;  2QQ9 A;  4JS4 A;  3HRU A;  3CQT A;  4M4Z A;  2D0N A;  3M58 A;  5ECA A;  3JAM E;  3WVD B;  5CKF A;  3NGP A;  4M75 E;  1QLY A;  4XQ3 A;  4BE2 A;  3V7S A;  4EDU A;  5IXF A;  1M8V A;  5FU6 B;  1VQP T;  1TUC A;  2QK0 A;  3MEV A;  2OTL T;  2OTJ T;  2CKK A;  4NL3 A;  5GAO m;  2FO0 A;  4JZ3 A;  2NUP A;  2EFI A;  5HCK A;  2LNH B;  2RQT A;  4BY6 C;  3MEW A;  4PJO F;  5HK0 A;  4XU3 A;  2JXB A;  1UHC A;  2K2M A;  5IN1 A;  1TWB A;  1BYM A;  3CPF A;  1W1F A;  4M7A D;  4BE1 A;  5J39 A;  5FU7 C;  3CD6 T;  3NFC A;  3CCV T;  4J6Y A;  2KT8 A;  4ZNX A;  3OYK A;  1K4U S;  2HD0 A;  3CXC A;  1E6G A;  3R6N A;  1N9S A;  2DK3 A;  3G71 A;  4JRP A;  4MMK A;  2DMO A;  2JZ2 A;  3PE0 A;  3UA6 A;  1CSK A;  3IQL A;  3CPW P;  2EIF A;  1M1K U;  4OB0 B;  4EMG A;  1QCO A;  3NPF A;  3M0T A;  1M90 U;  2O4X A;  1N8R C;  2MAM A;  2B8A A;  4RTY A;  1HYO A;  4M7D C;  1ZHI A;  3G6E A;  2EKO A;  5KE2 A;  1VIE A;  1VQ7 A;  2AKL A;  2EBP A;  2KY9 A;  4C8Q G;  3KFV A;  3OY9 A;  1UDL A;  2KI7 A;  3D7S B;  4HCC A;  4O5V A;  2HQX A;  2KE9 A;  1Z9Z A;  4AG2 C;  4EMK A;  3FIF A;  2E6N A;  5GAN d;  4E7Z A;  4M7A B;  1RAA B;  3OYH A;  9ATC B;  1WDX A;  2XKO C;  3VS4 A;  1UGR B;  1VOM A;  1YIT T;  1Y07 A;  2JMC A;  1JJ2 P;  2LCS A;  3E9G A;  2JOY A;  3CD6 Q;  4DQ2 A;  3OW2 P;  1M2V A;  4BI4 A;  5IHK A;  2JTE A;  3CCQ A;  4BY6 B;  3OYI A;  3ER0 A;  3GNG A;  4B9X A;  4OVA A;  3QBY A;  2LX9 A;  2O88 A;  2SRC A;  3ZFJ A;  3RKW A;  4QVD A; 
#chains in the Genus database with same CATH homology
 1B34 A;  4KUD K;  5CK9 A;  4C0D B;  4CI0 C;  4ZTJ A;  2V8I A;  3CPW S;  1YJW T;  3PFS A;  4KUI A;  3VV0 A;  2ZPG B;  4M7A G;  3UPU A;  2JNG A;  4RG2 A;  3JCM f;  3FRN A;  3VYH B;  4A4K A;  2XIC A;  1XTD A;  2JVV A;  3H8Z A;  4A4G A;  4BUG A;  3PIO A;  1NPR A;  3HL8 A;  1GXI E;  4EMH A;  2EQJ A;  2RHY A;  3GF5 A;  3C12 A;  3L2Z A;  4MDW A;  3SWN A;  4A4E A;  5LJ5 j;  3LWH A;  1W2B S;  1N8R U;  1M90 C;  4QQG A;  3DLL A;  3OYE A;  3M4Y A;  2RI3 A;  3QSU A;  4PJO C;  4II1 A;  4J7I A;  3R6O A;  4PKC C;  4PL6 A;  3UDC A;  5LJ3 j;  2RI5 A;  4XTU A;  2Y4X A;  3INZ A;  3OS1 A;  2VGN A;  1M1G A;  1N9R A;  2H3J A;  2RH2 A;  4XTX A;  4IUQ A;  4ZGE B;  4HA8 A;  3OYY A;  2DPP B;  2F5K A;  4F7U A;  3GLX A;  4C8Q E;  4C92 A;  2DD5 A;  3S3N A;  1NZ9 A;  1XNI A;  2RK2 A;  3MP1 A;  3QYH B;  2XHC A;  4M75 D;  4QW2 A;  1VQ4 A;  2DZC A;  1VQL A;  5FRN A;  3X26 B;  5GAN j;  4JRK A;  2FL7 A;  3ZEH A;  2MWP A;  1V29 B;  1NPP A;  1VIF A;  3CC4 A;  3CCL A;  1K73 C;  3E1S A;  2G3R A;  5D6W A;  2LT4 A;  3OS2 A;  1I4K 1;  1M5Q 1;  1P92 A;  5DY9 A;  1KG1 A;  3L2W A;  2FHD A;  2LQ8 A;  5LJ3 f;  3GNF B;  3J80 E;  3CME A;  4E7L A;  4QVD A;  1WPY A;  2PVD B;  2QQA A;  3JSC A;  2EJG A;  4FT2 A;  4ZGD B;  4A4H A;  5DLO A;  3I55 A;  2RJE A;  3BY7 A;  2R57 A;  3OBY A;  1N27 A;  4RG8 A;  1VQM A;  1K8A C;  4FT4 A;  3JCM g;  5CQX A;  4GLK A;  2P0Q A;  4C8Q D;  3DKM A;  3M57 A;  4C0D C;  2L8D A;  2A7Y A;  4OP0 A;  3CCS A;  2XDB A;  3JCM X;  1U1T A;  1IZ6 A;  1XQH A;  1QP3 A;  2DXU A;  2FYK A;  2LT1 A;  4FU6 A;  5GAN 4;  3E19 A;  1Q7Y U;  3PIP A;  3TU4 K;  4LDW A;  3SB2 A;  3I56 T;  1BKB A;  1BIB A;  5GAN f;  5LJ3 g;  4M77 B;  4XU0 A;  4A53 A;  5GAM h;  2RJD A;  2E1H A;  1UGQ B;  1UGP B;  5CR2 A;  3GIB A;  2JUF A;  2PU9 B;  3M4G A;  2LQK A;  3ME9 A;  3QZ5 B;  2KMT A;  3DLM A;  4OGC A;  3JB9 J;  1YJW A;  4M7D G;  5GAN 6;  4MDX A;  4BD3 A;  3MP8 A;  2QTX A;  4XTW A;  5GAN 3;  2PUO B;  1QVG S;  3JB9 H;  2DO3 A;  1LOJ A;  1YIT A;  2MF2 A;  2MI6 A;  2RHZ A;  4M78 E;  2A3L A;  4M75 C;  1KQS S;  2JTF A;  5A0G A;  5GAN h;  3T9N A;  4C0Z A;  5L8R E;  2X4Y A;  2RJC A;  2QQB A;  4F7U E;  4BDY A;  3BFM A;  4C92 B;  2QQS A;  1FX7 A;  4LD6 A;  1YBY A;  5GMK m;  2WAC A;  1YJN T;  1YI2 T;  5GAN 7;  1U8R A;  2ZPB B;  2EJF A;  4M77 G;  5M9O A;  2EQK A;  1YJ9 A;  4HCB A;  2CYZ B;  2VUB A;  3JCM W;  1VQK A;  3A8L B;  4M7D F;  2CS7 A;  3ZFJ A;  3N5B B;  2RJF A;  3CEY A;  3MCA B;  4J7F A;  5KH6 A;  3X25 B;  5GAM d;  1EIF A;  3M59 A;  4O6J A;  3CCJ A;  3CCE T;  4OF1 A;  1VQ6 T;  3E9F A;  3RIR A;  2P4T A;  4RMO A;  4OB3 B;  3QO3 A;  1NE8 A;  3GPL A;  2DEQ A;  4L5G A;  2GCX A;  4R55 A;  4JDS A;  3CC4 T;  3CCL T;  3WXM B;  2ZZD A;  1G3Y A;  2VC8 A;  4RCC A;  2E65 A;  3VKI A;  3HFN A;  3OSS C;  4EMK C;  1NJI C;  2DIQ A;  2IG0 A;  3A8M B;  4RCB A;  4QQ6 A;  5CKE A;  5KCO A;  3G4S T;  1G5V A;  2E41 A;  3JB9 G;  3G71 T;  2EAY A;  3SWN C;  4Q5W A;  2K2V A;  2E12 A;  5HKC A;  2QI2 A;  3X24 B;  3JCM b;  4E7I A;  2DTI A;  1Q82 C;  3CCU A;  2RI2 A;  5CCA A;  4M77 C;  3LW5 E;  2X4J A;  3CBO A;  1M1K C;  1VQ7 T;  1Q81 C;  1QW1 A;  2EWN A;  3QYG B;  4F7U F;  5CKD A;  1BIA A;  4M78 A;  5LL6 S;  3MEU A;  3RKX A;  5GMK h;  1O9S A;  3BDU A;  2PUK B;  3LGL A;  3QJY A;  4JS5 A;  2P0K A;  3CCM T;  3QXE B;  4XU1 A;  3I56 A;  1W2B A;  2HNI A;  3VUB A;  4BAC A;  5LJ5 e;  3J81 E;  2E6Z A;  2DJZ A;  1X01 A;  4LDY A;  1G3S A;  1M9S A;  4J8O A;  4C92 G;  2QQR A;  5CIU A;  4Y28 E;  4C5I A;  3CCV A;  2KAF A;  4M7A C;  4C5H A;  3G7Z A;  2CZ0 B;  1Q82 U;  5GAN 2;  4MML A;  1JB0 E;  1MHN A;  2E5Q A;  5LJ5 d;  2LNV A;  3FB9 A;  4PLI A;  2M0O A;  2R58 A;  2M1H A;  3SDZ A;  3X20 B;  5GAO n;  3QPH A;  3P8B B;  2DIG A;  3JCM V;  5C0M A;  3CCU T;  5CKH A;  1VQP A;  3KXT A;  3L2U A;  4NS5 A;  4N0A C;  3OYF A;  2QA4 A;  2LDM A;  2LRQ A;  4PJO G;  4JRQ A;  5CO7 A;  1VQ8 T;  1N6A A;  2OTJ A;  2RO0 A;  1JJ2 A;  4JJN K;  2QEX T;  4C8Q F;  4L6V 5;  5GAN e;  3VU3 C;  2R5A A;  2XU8 A;  1K9M C;  4M7A E;  4M77 E;  3C95 A;  4BE0 A;  1QVF S;  1M4Z A;  2LCL A;  4J6W A;  2V8K A;  5KCH A;  4XTZ A;  4OB2 B;  5LJ3 d;  4HCZ A;  4Y91 A;  4HT9 A;  3H6Z A;  4C92 C;  1YIJ T;  5I2S A;  4ZN3 A;  2GF7 A;  3CCQ T;  3OMC A;  4PNO A;  2AHJ B;  3GP8 A;  4E7K A;  1KC8 C;  2P0P A;  5LJ3 e;  2DTH A;  2X4W A;  4HT8 A;  3OYG A;  1BI3 A;  4L59 A;  3RKY A;  2YHT A;  4N0A A;  5GAN g;  4C5E A;  2VV5 A;  4F7U B;  3O8V A;  2XI9 A;  2MWO A;  2Y90 A;  1JRI A;  3LGF A;  3LH0 A;  2QEX A;  2K4Y A;  2V8J A;  3UT1 A;  3NTI A;  3OQ5 A;  2GQV A;  1SSF A;  3DB3 A;  4M75 B;  5GAO p;  3OYC A;  2IVW A;  5EG2 A;  3VJP A;  3LX7 A;  2KDS A;  2QDY B;  4BB7 A;  4X9C A;  3CC2 T;  1Y96 A;  3DB4 A;  1PSE A;  1YI2 A;  4ZTF A;  5LJ3 h;  4C0G A;  3QDR B;  4IUU A;  2DAQ A;  3HP9 A;  2K5I A;  2WSF E;  3RER A;  4BI3 A;  5CKB A;  4A4F A;  4LDV A;  5DM7 R;  3CCS T;  2LC4 A;  2JTM A;  3CCJ T;  4D6W A;  3PTA A;  2DZ9 A;  3HHT B;  3JCM h;  2RM4 A;  3LWI A;  4ZGJ B;  1ZQ1 A;  4TVR A;  2XK0 A;  2HBP A;  1PSF A;  1QVP A;  2L3R A;  3QKJ A;  3C94 A;  4OB1 B;  5CAI A;  5A2Q E;  1I5L A;  3CD6 A;  5CQY A;  3CCR T;  3L42 A;  1ZBX A;  4M75 G;  3OW2 A;  3G6E T;  1OI1 A;  1K73 U;  4KUL A;  3FLG A;  3PNW C;  4C92 F;  4E47 A;  3AHU A;  2EQU A;  3A5Z B;  4EMK B;  2VXF A;  1YHQ A;  3HRT A;  1IRE B;  2CZ1 B;  5HK3 A;  3EAE A;  2X4X A;  4JUV A;  1WQ7 A;  1M1F A;  3HRS A;  4J5Y A;  4FIB A;  4J83 A;  3CC7 A;  2E10 A;  3JCM e;  4C8Q B;  3M56 A;  2HQE A;  3NTK A;  3CME T;  4M7D A;  4XAX B;  5GAM g;  5A0D A;  1QP2 A;  4C8Q C;  1KQ1 A;  1MGQ A;  2DD4 A;  4M78 G;  2OAU A;  4X34 A;  1U1S A;  3JCM d;  1VQK T;  1TH7 A;  3JB9 I;  4JRI A;  1X6O A;  4VUB A;  3CCM A;  2VXE A;  1G3W A;  1KHI A;  4M77 F;  4OMF B;  3V7R A;  3L2Q A;  1Q81 U;  1VUB A;  1BI2 A;  3Q1J A;  3QG1 A;  5HY6 A;  5GAM j;  4UC4 A;  2YLC A;  4C0F A;  5GMK e;  3V8K A;  4E7H A;  1D3B A;  2YRV A;  2CZ6 B;  3CBM A;  3QII A;  4M75 A;  5IAY A;  3JB9 F;  1K9M U;  1QVF A;  4MZP A;  4N4H A;  1Y96 B;  4PJO A;  2ZPI B;  1OZ2 A;  2RHU A;  3OBW A;  4V2S A;  1G3T A;  2E64 A;  4PJO D;  1NJI U;  2K3Y A;  4QQD A;  4KT0 E;  4M7D D;  1WJQ A;  4N4I A;  1VQ4 T;  3V7C A;  5GAN 8;  1Q86 C;  5FRM A;  1UEB A;  5GAN 5;  2XD0 A;  1DJ7 B;  3LYI A;  3QZ9 B;  1H3Z A;  4KBM B;  4FSX A;  3OYN A;  3SFM A;  3TRE A;  2I2L A;  2PVO B;  1WGS A;  4CRI A;  4M78 D;  3PGG A;  5J3B A;  1VQ9 A;  1UB4 A;  4M78 C;  1VQ5 T;  4XTV A;  2GFU A;  3M55 A;  3L1A A;  5D6Y A;  5LJ5 h;  2BKD N;  4XK8 E;  3GOX A;  4PLL A;  1YCY A;  3A8O B;  4MZM A;  1X75 C;  1KHC A;  3RUX A;  4E7J A;  1KQ2 A;  3UWN A;  3JCM Q;  2LTO A;  3JRZ A;  4XU2 A;  2QQ9 A;  5D6X A;  1VQ9 T;  4JS4 A;  4IKF A;  3HRU A;  4GY5 A;  1RI0 A;  2KK4 A;  1VQ5 A;  2E70 A;  4ELZ C;  4M78 B;  3SWN B;  3M58 A;  3JAM E;  2BUD A;  2OTL A;  5AYF A;  5CKF A;  4LDU A;  3WVD B;  4M75 E;  2MMP A;  5GAO l;  3BDL A;  1H64 1;  3EFR A;  4XQ3 A;  5FLX E;  4BE2 A;  4C8Q A;  2EQM A;  5CVI A;  1QVG A;  5I21 A;  3V7S A;  4EDU A;  2ZPE B;  3OA6 A;  2DTO A;  1M8V A;  5FU6 B;  4M7D B;  2M16 A;  1VQP T;  3QUI A;  4PJO B;  3MO8 A;  2D9T A;  3MEV A;  4IUP A;  2OTL T;  2FVU A;  2O4X B;  4NL2 A;  5DLQ E;  3CC7 T;  4M7A F;  4XTY A;  2EYQ A;  3X28 B;  2K57 A;  1VQ8 A;  2OTJ T;  2CKK A;  4NL3 A;  1HXD A;  2FB7 A;  1KC8 U;  1FWZ A;  5LJ5 f;  2VYT A;  5GAO m;  4N4G A;  2EFI A;  4P5N A;  2D6F A;  3S6W A;  5GAO q;  3OYB A;  1Q7Y C;  1S72 T;  1LNX A;  1Y7X A;  3MEW A;  4PJO F;  3A8G B;  2GFA A;  4XU3 A;  3URG A;  4BY6 C;  4C92 E;  5HK0 A;  1WJS A;  5GMK l;  5IN1 A;  5GMK i;  4IUT A;  2DXB A;  4FL6 A;  2QXF A;  1BYM A;  2X35 A;  5C6S A;  2KQW A;  2ZCF B;  3OYD A;  2RD1 A;  2Y4Y A;  4MZT A;  4EPC A;  3CPF A;  4Z02 A;  4BI8 B;  4M7A D;  3FC3 A;  4M78 F;  1YJ9 T;  5GAM e;  5J39 A;  4BE1 A;  2RB6 A;  2L89 A;  5FU7 C;  5I2M A;  1OZ3 A;  2L5Q A;  3CD6 T;  2CZ7 B;  3NFC A;  2KSS A;  4NOY A;  3TCJ A;  4J6Y A;  3OYA A;  3CCV T;  3MET A;  1WQW A;  2XID A;  2D0Q B;  4WF2 A;  3ASK A;  3CCR A;  4JLG A;  2HAX A;  4M7A A;  1BI0 A;  3PT9 A;  4YTL A;  2DXT A;  3HSB A;  3OS5 A;  1VQO T;  3TEE A;  2BIV A;  3OYK A;  2PQW A;  2CGH A;  3FEO A;  5A0L A;  2R5M A;  3RES A;  1OYX A;  3SD4 A;  1S72 A;  1VQM T;  3CC2 A;  1JBM A;  4M77 A;  3C4S A;  3OYJ A;  4ELY C;  2HD0 A;  3CXC A;  2YLB A;  2EJ9 A;  3RMQ A;  3G4S A;  1VQN T;  1VQ6 A;  1I8F A;  4B9W A;  1N9S A;  2DK3 A;  5FRO A;  3G71 A;  4JRP A;  2RK1 A;  2LVM A;  2WSC E;  4MMK A;  3NTH A;  2JZ2 A;  3ZBD A;  3FJP A;  1R8O B;  1VQL T;  2C06 A;  2EIF A;  1M1K U;  4OB0 B;  4EMG A;  4QVZ A;  4X9D A;  2K5F A;  4A54 A;  3KBG A;  4J6X A;  1M90 U;  2O4X A;  1N8R C;  1K8A U;  4IUR A;  2MAM A;  2B8A A;  3JB9 D;  3J7A F;  3MHX A;  4QVC A;  3OMG A;  3P8H A;  1RL2 A;  2KVQ G;  3OS0 A;  2ZPF B;  3KUF A;  3JCM c;  3V8J A;  1ZHI A;  2XG8 D;  5J26 A;  3G6E A;  4M7D C;  2EKO A;  5KE2 A;  4ME7 A;  2XDD A;  1Q86 U;  4C92 D;  1VIE A;  1I81 A;  1VQ7 A;  1Y71 A;  3CPW A;  2JN0 A;  4R56 A;  1B34 B;  1WNL A;  1VQN A;  3LLR A;  5KE3 A;  1W4S A;  5GAO r;  4ATO A;  3CMA T;  1BI1 A;  4RKU E;  4LD9 K;  1JJ2 S;  2RHI A;  2KY9 A;  3CBP A;  4C8Q G;  3A8H B;  3OY9 A;  3M5A A;  1HK9 A;  2NLU A;  3L2R A;  4DA4 A;  2K5L A;  2QA4 T;  4O5V A;  2HQX A;  2RA2 A;  3V8L A;  4HCC A;  3FDR A;  3OYL A;  4EMK A;  3FIF A;  5GAM f;  2E6N A;  2DVE A;  5GAN d;  1KQS A;  3HFO A;  3VUZ A;  2K3X A;  3WVE B;  4DOV A;  4BDZ A;  3HKS A;  4M7A B;  2PVG B;  5GMK j;  4HKE A;  3OYH A;  4M7D E;  1WJR A;  3PMI A;  4PJO E;  2F69 A;  1KD1 C;  2XKO C;  2ZPH B;  1XOV A;  1UGR B;  2F5T X;  3QJ6 A;  3PMT A;  3QHS A;  3JCM P;  3M9Q A;  4IUV A;  2VGM A;  4C5G A;  3S3M A;  1YIT T;  1Y07 A;  3CMA A;  3VYG A;  2LCC A;  2DXC A;  3MP6 A;  1VQO A;  3CXC S;  4ZN1 A;  3JCM J;  1D3B B;  3E9G A;  3HPW A;  2JOY A;  4F7U G;  4DQ2 A;  3M54 A;  1UGS B;  1KD1 U;  3M53 A;  3P8D A;  5FU6 C;  1AHJ B;  2XDP A;  4BI4 A;  4FM4 B;  3OW2 S;  3F70 A;  4DOW A;  1O75 A;  3BW1 A;  3I55 T;  1LJO A;  3L2V A;  2RHX A;  5IT9 E;  1YIJ A;  1YJN A;  3CCQ A;  1YHQ T;  4BY6 B;  3OSV A;  3OYI A;  2DKG A;  3EFS A;  4OGE A;  3ER0 A;  5FU7 B;  2WSE E;  4M75 F;  3RMS A;  3GNG A;  4B9X A;  3CCE A;  5LJ5 g;  4M77 D;  4OVA A;  1FXX A;  3QBY A;  4JLI A;  3MEA A;  2LX9 A;  3S3O A;  4LDX A;  3OYM A;  2M9U A;  2ZGW A;  3OB9 A;  3RKW A;  2O01 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...