1D3BA

Crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
GVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGCKIRFLILPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D3)
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 72
sequence length 72
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 1998-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1d3bA00
4M7DF 3JB9J 3QSUA 1N9SA 3JCMh 4NL3A 2DXUA 2E1HA 1KQ1A 1TH7A 4M7DC 2VXEA 2YLCA 3JCMf 5GANg 2EWNA 4JRKA 1U1SA 3FIFA 3PGGA 4XTXA 3JCMP 4PJOE 5GAOl 2DJZA 4JLIA 3SB2A 3EFRA 4C8QA 4PJOB 2RM4A 3HFOA 1LOJA 3V7SA 3V8KA 3JB9I 5LJ5j 5GAOr 1MGQA 5LJ3j 2I2LA 3JCMe 3L1AA 5LJ5g 4HA8A 2Y90A 2EJ9A 4F7UE 4M75E 4DQ2A 3JCMd 2DTIA 2RA2A 4XU1A 5GAN8 3L2ZA 3SWNA 5GAN3 4M78D 4M78G 3BY7A 4EMKC 3HSBA 2YLBA 3V7RA 4C8QE 4MMLA 3VU3C 4C8QB 4M78F 4XU3A 1HXDA 4N0AA 3JCMX 1I5LA 4M7AC 4M77A 3GIBA 1HK9A 4F7UA 4M75A 2E41A 5GAMg 5LJ3e 4V2SA 5GAN6 4J6WA 5GANj 3QUIA 4XTYA 4M78C 5CAIA 1N9RA 1WPYA 4J6YA 4C8QF 5LJ3d 2RB6A 5GANh 3RKXA 4XU2A 3SWNB 3RIRA 3JB9H 2QTXA 3BDUA 4EMHA 3M4GA 3EFSA 2DVEA 1WQWA 2DZCA 4PNOA 4PJOG 5GANf 3JCMW 1BIBA 3JCMJ 4PJOD 4M77E 4C92A 4RCBA 4JRIA 5LJ5h 1LJOA 5LJ3h 5GAOq 3V8LA 4M77B 4PJOF 1Y96A 4F7UB 4M75B 3RKWA 3JCMb 4M75D 5LJ5f 4F7UG 5LJ3f 1JRIA 2E64A 4M75G 5GANe 5GMKi 2RD1A 5GAN5 4M7DA 1I4K1 4PJOC 5GMKj 4M77F 3V8JA 5GANd 4F7UF 2HNIA 2JN0A 4M75F 4A53A 1KQ2A 3RERA 2DZ9A 5GMKh 2FYKA 4C92E 4C8QD 5GAMj 5GAOn 2E65A 1B34A 1JBMA 4RCCA 1X01A 3JCMV 4C8QG 3BFMA 4C92B 5GMKm 5LJ5e 2DKGA 4X9DA 2K57A 4J5YA 4J6XA 1D3BA 1U1TA 5LJ5d 1Y96B 1M5Q1 4A54A 3JCMQ 1H641 4M7DE 3HFNA 2E10A 4QVCA 4M7DB 4C8QC 2VC8A 4WF2A 4XQ3A 4EMKA 5GMKe 5GAOm 4XTVA 4XTUA 3RESA 5GAN2 1BIAA 4NOYA 3QHSA 4XU0A 2DTHA 1WNLA 3FJPA 5GAMe 1M8VA 3JCMg 2EJFA 4JUVA 4M77D 2DTOA 4M7AA 4M77G 3BW1A 4XTWA 4XTZA 1D3BB 4MMKA 3SWNC 4OP0A 5GAMd 3INZA 2ZGWA 4HT8A 4EMGA 5GAN7 4M78A 1LNXA 2FB7A 1YCYA 3FB9A 3RKYA 5GAN4 3QO3A 5GAOp 4N0AC 2VXFA 4M77C 4EMKB 5DY9A 5GAMh 4M75C 3JCMc 5I21A 1WQ7A 4C92D 4M7AE 4HT9A 4C92G 3V7CA 4NL2A 5LJ3g 4M7AB 2EJGA 5GAMf 2EAYA 3RUXA 4Y91A 4M78E 1I81A 2YHTA 4C92F 4QVDA 2DEQA 3JB9D 3JB9G 4M7AG 4M7AD 2CGHA 4X9CA 4M78B 4M7DD 2DXTA 3AHUA 1I8FA 4M7DG 4PJOA 3JB9F 4M7AF 4C92C 5GMKl 1B34B
chains in the Genus database with same CATH superfamily
4M7DF 3JCMh 1VQMQ 5J39A 2KXCA 4DBHA 1BCOA 3CC4Q 3VS5A 2K3XA 2LDMA 3PGGA 1YJ9Q 2DJZA 1VQ8T 2M1HA 3JCMe 2O9SA 3R6OA 2RJCA 2DIGA 4BD3A 3JCMd 3GPLA 4ELZC 2ROLA 3LYIA 1FMWA 2HSEB 3CC7A 2GGRA 4KH1B 3GOXA 5KCOA 2FHDA 2J6OA 1X6GA 2YSQA 5LJ3e 2OI3A 4RTZA 2HCKA 2QXFA 4XTYA 1ZHIA 1H92A 5LJ3d 5IT9E 2VYTA 1KFZA 3HTRA 3EGXA 3HPWA 3H9NA 4LE9A 5IXFA 2KRSA 2WSCE 1T3LA 1Y96A 3RKWA 1UHCA 2HKQB 4NS5A 3TVTA 2L3PA 3P8BB 2QAZA 2GQIA 3RERA 1K9AA 9ATCB 5GAMj 1ZSGA 3A8MB 1G3YA 4JRPA 2DFUA 2RPNA 3LH0A 1NM7A 2DO3A 2KE9A 1E7OA 3CPWP 4AFQC 2DXBA 4PFOA 4CC3A 2OX7A 3A8LB 1BI1A 2RK1A 2H3EB 2CP5A 2OTLA 4ELYC 2BUDA 4OP0A 3QWYA 3BDLA 1JU5C 2HQXA 2LCSA 2VV5A 1VQPA 3RKYA 4J9DA 1K8AR 1T0HA 3D7SB 4K11A 4EMKB 5DY9A 4L59A 2L3QA 3DB4A 1VQNA 3JB9D 2YHTA 4KGXB 1WFWA 1Q7YR 1EZZB 4PK4A 3I5SA 1WXTA 1I8FA 3TREA 3JB9F 1TUDA 3A8GB 3VYGA 4MDWA 2FL7A 2PVGB 1M90C 3CCVQ 1M1KC 2PTKA 2QQBA 3L42A 4RG8A 5DLOA 2D6FA 3A8HB 2NUTA 1RAEB 5I22A 2K9GA 3DLMA 3CPFA 4KT0E 4LDWA 1NBEB 1OZ3A 2O4XA 1OX9A 1GBRA 3G6EA 5GANj 3CCVT 4AG2C 2BE7D 3OYGA 4XU2A 2CH4W 3VS2A 1KIKA 2RNAA 1VOMA 2L5QA 3CPWS 2X3WD 3MHXA 5GAN5 2ZPFB 4F17A 4CC7A 3QZ5B 4KULA 1VQLQ 1M2VA 1B07A 1M1KU 3JCMV 1HJDA 2K57A 4LXCA 1WDXA 1OI1A 5IN1A 3X25B 4QVCA 2LP5A 4R0KA 1SSFA 2E6ZA 2JZ2A 2HL5C 5GAMe 3I55T 1JXMA 5CKEA 2QDLA 4XTZA 4MMKA 5GAMd 3CCQA 1TU0B 1X27A 4EDUA 2J05A 1VQLT 3NGPA 4ME7A 3RR6A 1UGRB 3MCAB 1I0CA 3QDFA 1N8RU 4AG1C 4HCCA 1M3CA 1VQ7Q 4M78E 2ZPBB 4HVUA 3MP1A 5IHKA 2QDYB 4D8DA 2O88A 2E1HA 1YBYA 4BE0A 1OU9A 4DBQA 4C0DC 2QEXQ 1LOJA 3AT1B 4LNPA 2I2LA 1VIEA 2KT8A 1XOVA 2CZ0B 2RHIA 4IUTA 3NTIA 3H6ZA 4RTUA 2HD0A 3M57A 2DNUA 2RJEA 3CMAQ 2LQNA 1VQMA 3CCLQ 2RHUA 3GIBA 4M75A 1FMKA 2DXCA 1W2BP 3CC4A 1OU8A 1YJ9A 1HYOA 5GANh 3CMEQ 2AIRB 3JB9H 2QEXT 1VIFA 2AZVA 3CCJQ 2JM9A 4PNOA 1WLPB 2L2PA 4OGEA 4JRIA 2X4XA 3WVDB 1NLOC 2VB6A 5FU6B 1YCSB 4C5IA 5GANe 4OMPA 4M7DA 2COZA 2RJDA 5GANd 4A53A 3P8DA 2LZ6B 1KD1R 1SHFA 4C92B 2KGTA 1D1BA 4OB2B 2GFUA 1U1TA 2NUPB 1M1GA 4E7LA 2MI6A 2JOYA 2RQRA 1LPLA 3CQTA 1MMDA 2O31A 3QYHB 4FW1A 3VS1A 2O9VA 4XAXB 5KCHA 2LNHB 5GJVB 1TS9A 2QQRA 4JUVA 1T3SA 4ZTJA 3HP9A 3OYAA 5IXBA 4HT8A 1G3WA 1Y07A 1IHVA 3REBB 3FB9A 1QVGA 3PIOA 3CEYA 4M75C 4N4HA 1RAGB 5HY6A 4E7HA 3TSZA 2GQVA 1PKSA 5KYYB 1MNDA 4M7DG 1QQJA 4BI4A 2KAFA 5KYWA 1FWZA 3QDRB 1YJWQ 1QCFA 3VYHB 3FDRA 1YNZA 1AWWA 4D6WA 4M7DC 3EHQA 3QWXX 3OW2P 2E3HA 3FLGA 2DF6A 4E7ZA 4PJOB 5KYXB 1W2BS 1XTDA 2RHZA 2KYBA 2X4YA 4DA4A 5GAN3 2CP7A 2HMAA 3UF4A 1NPPA 2EKOA 2FPEA 1A0NB 4N0AA 3JV3A 3CCVA 3OS2A 2E41A 2K7AA 2PVOB 2YWWA 1YHQQ 4E2FB 2V8JA 5D7UA 2E6NA 1X6BA 4RCBA 1KC8C 3PT9A 1K1ZA 1U8RA 3TCJA 2QYZA 3NTKA 2CYZB 2RD1A 3UA7A 2J7IA 4GBQA 3MO8A 1UB4A 4RCCA 3GBQA 3BFMA 4J5YA 4OB3B 2RH2A 3LWHA 1YHQT 2X3XD 1C1AA 1D1CA 2F1LA 4O6JA 1M3BA 4PLIA 2KSSA 4XTVA 4XTUA 3URGA 1VYVA 3J7AF 3MEUA 2D8JA 1VQLA 1GBQA 3KXTA 3QJYA 1TSFA 4CC4B 4N0AC 1ABQA 4BY6B 2WSFE 4ZN1A 2CH4A 3OW2S 4NL2A 3CCST 3VV0A 3JB9G 1C0MA 3U23A 2D9TA 3HRTA 3X24B 1B34B 1M30A 4WTOB 2M0YA 2OTLT 4J9BA 4LUEA 2LTOA 2EWNA 1B7TA 1NZ9A 1UJYA 2BE9B 4RTXA 5FU7B 1VQPT 1ZX6A 3QKJA 3HFOA 1VQ7A 1M8MA 4TVRA 2K2VA 4R56A 2P4RA 4F7UE 1VQNT 1NJIR 3LLRA 1JQQA 3DB3A 1Q81U 4XU1A 4ESRA 1UJ0A 3SWNA 1IGQA 4QT7A 2ZPHB 1KSWA 3S3NA 2CT3A 2E3IA 1HK9A 1K0XA 1QVGP 2JT4A 2ZAEA 1MHNA 2L8DA 4FW2A 2QEXA 2ROTA 1K9MU 5CKBA 3RBBB 1Q82U 2EKHA 3CPWA 3EG9A 1D0ZA 1Q86U 3A5ZB 3EFOB 1VQ5Q 1RI9A 3CMAA 2XDDA 2R5MA 4PLLA 3G6ET 4C92E 5HCKA 3MJXA 1VQ6Q 1KG1A 1JBMA 4BE1A 3CMEA 3O8VA 1RABB 4ZNXA 3CCJA 2ABLA 1VQ4Q 1WA7A 1OQKA 2WACA 3KBGA 4Y28E 1I1JA 5GJWB 2A37A 3FJPA 3Q1JA 4N4IA 2MF2A 2EJFA 4M7AA 2K5LA 1VQ5T 2CSIA 3SWNC 1VQKQ 3INZA 1E6HA 2CZ6B 2FRYA 3OS0A 2QA4Q 4FSXA 3CCRT 4HCBA 3H41A 3C94A 5CQYA 1HSQA 1PSEA 2AHJB 2RI2A 4J7IA 2RI5A 1PHTA 2X35A 4QVZA 4DOWA 3E2UA 1UGSB 3HKSA 1KQSP 2V1RA 1ARKA 3CCQT 3PNWC 4FIBA 3JCMP 4PJOE 3H0HA 2EQIA 4AFZC 2G3RA 4KUIA 3LWIA 4CC2A 3QBYA 3JB9I 1UFFA 1IGUA 3OS5A 4RUGA 3GNFB 4ZTFA 4PL6A 2RA2A 3H0FA 5GAN8 1QCNA 4M78D 1UG1A 1YJWA 2QASA 4ANJA 4P5NA 4M78F 3RNJA 2PU9B 4M7AC 2R57A 4JS4A 5GAN6 3EG1A 5J26A 3BE3A 1AOJA 1K73R 4IUQA 1FYNA 1VQ9Q 3M4GA 2DZCA 1G2BA 2MWOA 2MOXA 1TWBA 2AKLA 5LJ3h 4M77B 2VGMA 1OYXA 1GFCA 3QJ6A 1K8AC 1BU1A 4OVAA 5LJ5f 1YI2Q 3VRYA 2LX7A 4M77F 1RUWA 3ASKA 1QVFP 5LL6S 1VQMT 5C6SA 3TEEA 1YP5A 1GCQA 1Q7YC 2LCLA 1YHQA 1D3BA 2NUZA 4X1VA 4A4FA 3CC4T 3OMGA 3SDZA 1YJ9T 2KRMA 1EFNA 1VQ9T 5J3BA 4DEXA 4J8OA 2V26A 2L3SA 1YI2T 3EH1A 2CT4A 1IO6A 1YN8A 4F14A 1R8OB 2GTOA 3HRUA 2K2MA 2PUKB 5A0GA 3M59A 2QQSA 1KQSS 3L2UA 3CCSA 2P4TA 4KGVB 2EJGA 2ZPEB 2DD5A 3MEWA 3CCEQ 4CI0C 4HCZA 7AT1B 2MK5A 1GFDA 5HKCA 4A4EA 4E47A 4ZGDB 2ED0A 3J80E 1S72Q 1MV0B 2MAMA 4RTYA 4JJDA 3SB2A 1W2BA 5EG2A 3V7SA 1M27C 1GCQC 5CCAA 2EYZA 4JRQA 2FPFA 2LC4A 1WJQA 2RHXA 2O2OA 3CBMA 2EQKA 2R58A 2F2WA 3M0RA 3KFVA 4C8QB 1HXDA 1M9SA 1RAIB 3QUIA 2K3YA 4D8KA 1N9RA 1S72T 4C8QF 4KUDK 1ZA1B 1OV3A 1AVZC 1QVFS 3BDUA 3RMQA 3M55A 2YUPA 3JCMW 2P0QA 2KMTA 3EGUA 1Y57A 4Y92A 1M4ZA 4FT2A 2OTJQ 2KY9A 3M0UA 4J9IA 2WSEE 3V8JA 1VUBA 1RADB 4ORZA 3VUBA 1B34A 4PFPA 2XD0A 4LDUA 1M5Q1 2KK4A 1MNEA 3JCMQ 2GNCA 2DE0X 1AWOA 3H0IA 5GAOm 2ZZDA 5AYFA 1WX6A 1YITQ 1VQ5A 5L8RE 3F70A 1WHKA 2FZCB 2YT6A 3BW1A 2YUNA 3SD4A 2OTJT 3CCRA 3I9QA 4KRTA 1M90U 1VQ6A 1EX4A 4OB0B 3OBWA 2VXFA 5GAMh 4BE2A 3OW2A 1MMAA 3O5ZA 1K0SA 1VQ4A 1I81A 1X2QA 1NYFA 5CKHA 4GLKA 3M0SA 1I07A 4E6RA 1YITT 1VQKA 2LT1A 3EH2A 2SRCA 2QA4A 3JCMf 1RL2A 1MMNA 3E1SA 2Y4XA 4JLIA 3CD6Q 3S3OA 1WJSA 1SPKA 1TUCA 1BKBA 4HVWA 2HEQA 4E7IA 4M75E 3RDVA 3EGDA 1KD1C 2F5KA 3OA6A 2YLBA 2EW3A 2DM1A 3UATA 1KJWA 3A98A 2CSQA 3OYIA 3OY9A 3ZFJA 1GXIE 3RKXA 2JTMA 1ABOA 3VRZA 2XU8A 3CD6T 1WQWA 3THKA 2OAWA 1QWFA 1BIBA 4M77E 4BACA 1VQ7T 4FYVB 4F7UB 1N8RR 1ZSZB 3S6WA 4Z88A 5HK3A 5GMKi 2RQTA 5GMKj 5CQXA 4F7UF 2HNIA 3A1PA 3CXCS 2BTTA 4Z89A 2CP0A 1Y71A 5HK0A 1KHIA 4RG2A 4A54A 2AK5A 1VQ9A 4AFUC 2JS2A 2ECZA 2LQKA 4XQ3A 3M5AA 3VS4A 1H3HA 4L6V5 2A28A 1YI2A 2DTOA 3VKIA 4EMGA 4HVVA 2MMPA 5KYUA 4M78A 5GAN7 3OYNA 3CCMQ 3CMAT 1OULA 2C0OA 2LJ0A 2RJFA 2DPPB 3CCLT 1YJNQ 3M58A 5IH2A 1QLYA 3FJ5A 5L23A 3JCMc 4GLMA 4C92D 2XDBA 5CKDA 5D6YA 2GF7A 3CMET 1PD1A 4Y91A 1GL5A 4C92F 2DEQA 3CCJT 1HD3A 1MV3A 1T0JA 2RMOA 3LX7A 4F16A 2QGFB 4YTLA 1IZ6A 4BUGA 4OMOA 3OYYA 4FM4B 1TH7A 3OSVA 3PFSA 3OYBA 1N27A 2YLCA 3CCMT 1LCKA 2XKOC 5IAYA 2A36A 2COYA 1UGQB 1M2OA 3G7ZA 3M54A 5LJ5j 2DEUA 3L1AA 4HXJA 4HA8A 3CCEA 4HKEA 2JW4A 4OF1A 3REAB 5CVIA 4RMOA 1QMCA 2VUBA 1V76A 3MPUB 4XK8E 2X9HA 4M78G 4C8QE 1BI2A 2E70A 4BDZA 1NPRA 2EYQA 3JCMX 4PFZA 1S72A 4C5EA 2BZYA 5FLXE 1OZ2A 3T9NA 2XHCA 2VVKA 4M78C 1Y0MA 2H8HA 3RIRA 4PJOD 3QPHA 5I11A 1VQOQ 2BZXA 4PJOF 3JCMb 2CP2A 3R6NA 3M9QA 3G4SQ 5D6XA 4J9GA 1XNIA 2LNVA 5GMKh 1YJWT 3EGXB 5GAOn 4FT4A 3OYHA 1OOTA 1Y96B 5IHNA 2GCXA 3OSSC 2XG8D 5GMKe 1UE9A 2KT1A 4EMKA 1JB0E 1VQOT 2D0QB 2KRNA 2DETA 3S3MA 2OTJA 2EIFA 4XTWA 2DIQA 4EPCA 3G4ST 4RTTA 1KQSA 2DL4A 1NJIC 2DL7A 2J6FA 1XJWB 4N4GA 1WHMA 4HT9A 2NYSA 3KUFA 1G8XA 2RQVA 3OYMA 1BYMA 1ZBJA 5ECAA 1R0BG 1PG5B 3JRZA 2M16A 1YITA 2KEAA 1OPLA 1X75C 2J06A 2JTEA 3JB9J 4IIOA 3WXMB 2XK0A 2GTJA 1M3AA 3WVEB 3PTAA 2H3JA 1FXXA 2DVJA 4Q5WA 1UGPB 1QVPA 1MGQA 1XQHA 2Y90A 4C0FA 3E9GA 3QXEB 4E7SA 4DQ2A 3L2VA 2E5KA 4J9FA 1KC8U 2K3BA 4EMKC 4BI3A 3V7RA 2W10A 4FSSA 3CC2Q 1M1FA 1W6XA 4MDXA 1NEGA 1PRMC 1O9SA 1WZOA 5IHIA 4Z02A 3C0CA 1NJIU 1RAAB 2YRDA 1QVFA 2O4XB 3E9FA 3CD6A 1GCPA 2LMJA 2DL3A 5GANf 1JO8A 1LJOA 4J7FA 4QQGA 2XICA 2X51A 3PVQA 1UTIA 1SRLA 2YRVA 3PE0A 1QP3A 4JLGA 1NYGA 2JTFA 2ESWA 2DZ9A 3CC2T 3P8HA 2LQ8A 5A0DA 1UEBA 4FU6A 2YUQA 4PJLA 2HQEA 1H641 3VS3A 3H8ZA 5FRMA 3VS6A 1OPKA 5CK9A 2VC8A 1K76A 4C0DB 1M2VB 3I56Q 1ACMB 4NOYA 3OYJA 2DTHA 1M8VA 5I2MA 5A2QE 2EPDA 1Q81R 1X2KA 1AZGB 3CCLA 2FB7A 4MZTA 4RKUE 2LQWA 3NTHA 3DLLA 1X69A 2VWFA 4FL6A 3V7CA 3SEMA 4AFSC 1Q95G 4FYXB 2L89A 4JZ3A 1K9MR 3OBYA 2JMAA 4QKUA 2RQUA 1RAHB 2JJ9A 4J9EA 1Q82R 3I56T 4JJBA 1K73C 1WI7A 4NL3A 4KGZB 3CCMA 4ZN3A 1Q86R 3G1JA 4QQDA 1YJNA 2W0ZA 3PIPA 4B9WA 1VQ6T 1RI0A 1VA7A 1S1NA 3CCUQ 3EFRA 3SFMA 1JJ2S 3CBOA 2MPXC 5GAOr 4PJJA 2EJ9A 2ENMA 1VQ4T 3L2ZA 2XI9A 3NPFA 3HSBA 2RK2A 2OJ2A 2DMOA 2RI3A 3SHWA 1VQKT 2QQ9A 2SEMA 2ED1A 2BIVA 4OMQA 2MYSA 5FRNA 4LUDA 2QA4T 2GBQA 3OMCA 3VJPA 3CCUT 2LT4A 3C12A 4C92A 2P84A 2NUPA 4M75B 2D8HA 4X34A 3OB9A 4M75D 4F7UG 2EYXA 3CXCA 1QKXA 2ZPGB 2KYMA 4M75F 1WHGA 1TG0A 2FYKA 2HAXA 1VQ8Q 1CSKA 5GMKm 1QW1A 1YIJQ 4FYYB 3FEOA 4M7DB 1VQOA 1KK7A 1AHJB 2PNIA 1E6GA 1WNLA 2F5TX 2AKKA 4M77D 3RMSA 2EGEA 3G4SA 4R55A 5KYYA 1LNXA 2AZSA 1U06A 3LW5E 5FU6C 3OS1A 4C92G 1FMVA 2X4JA 2RN8A 1YIJT 1V1CA 1WGSA 1G3SA 4PJOA 1AD5A 2V8KA 4C92C 5KYXA 3QSUA 1N9SA 2ZCFB 4LDVA 1H3ZA 4KH0B 4OMMA 2VASA 1ZUYA 4JRKA 1U1SA 2DYIA 3FIFA 2LJ3A 2A3LA 3FC3A 5KYWB 1N5ZA 1UUEA 5LJ5g 1G5VA 2KVQG 1Z9QA 2DTIA 2LX9A 1QKWA 4J9CA 3C95A 1BBZA 2DRMA 1K8AU 2X4WA 3OYFA 1OEBA 2FVUA 4JPBW 2CZ7B 4B6MA 3OYEA 2HDAA 4OMLA 5M9OA 2EBPA 3EG0A 3EAEA 2A0FB 3ULRB 1Q7YU 3ZL7C 2M51A 4RTWA 2DERA 3EFSA 2DVEA 4FYWB 4PJOG 1IRXA 1QCOA 4E7KA 3L2WA 4A63B 4DBFA 4IUVA 4OGCA 5KE2A 3CCET 2D0NA 3MEAA 1I4K1 4PJOC 3CC2A 1CKAA 1QP2A 2RQWA 5C0MA 1KQ2A 3N5BB 2DLPA 3META 4C8QD 2DJQA 8ATCB 3QYGB 1SEMA 2DAQA 2C06A 3HFNA 2E10A 2RHYA 2V8IA 1PRLC 2EGCA 5GAN2 3IQLA 4HCKA 2DBMA 1NEBA 2EYYA 1MMGA 1WYXA 3LGFA 2HSPA 2KDSA 2ZPIB 2VKNA 1K4US 2B8AA 2CZ1B 2B86A 2M9UA 4LN2A 1TXQA 1UECA 1AWXA 2K6DA 2QK0A 4JZ4A 2CGHA 4OB1B 1U5SA 1WXUA 2IPOB 3I56A 3AHUA 1JEGA 3CXCP 3MEVA 1VYTA 1C6VX 3I5RA 1UDLA 1PC0A 3M53A 5GAOl 1N8RC 3G71Q 1U3OA 3TSWA 1ZUKA 3GP8A 2HZYA 3I55Q 2O01E 1WHHA 3M0PA 2EFIA 4BY6C 1AZEA 4PKCC 3UA6A 4BDYA 3NHNA 1RLQC 1W1FA 3EFOA 1PSFA 2MWPA 1WPYA 2K5FA 5KYNA 1YFNA 1V29B 2DRKA 3SWNB 3CCUA 4IUUA 3G71T 2HBWA 1M90R 1M1KR 2RF0A 2KQWA 2LVMA 2OAUA 2JS0A 2PZ1A 4PJNA 1SF9A 3V8LA 2IIMA 2J6KA 3QZ9B 3DKMA 4A4GA 1SKUB 1PWTA 4II1A 1JRIA 5FU7C 5LJ3f 3OYDA 1GRIA 3GLXA 1H8KA 3A8OB 1X6OA 3EG9B 5EC7A 2KBTA 4M7DE 1ZQ1A 2KXDA 2MCNA 3I35A 2CKKA 4XU0A 3OYKA 3ZBDA 2DX1A 4E7JA 2L0AA 2P0PA 3JCMg 2HQHA 4DBRA 2IG0A 2BZ8A 4FCYA 2HKNA 2DYBA 4F04B 4C0GA 2CUBA 1VQ8A 3NMZC 3OQ5A 3TQ7P 3QG1A 1YIJA 1N6AA 4PJMA 5LJ3g 4M7AB 3OYCA 2EAYA 2DK3A 4M7AD 1CKBA 1J3TA 2NLUA 5FWCA 1WHLA 1KD1U 2QQAA 4M7AF 3UT1A 3GNGA 5I2SA 2K79A 2FPDA 3X28B 2K4YA 1PM3A 2L3RA 2VXEA 3VUZA 2PVDB 2EQJA 1JJ2A 3PMIA 4MZPA 1KHCA 4RTVA 4Z8AA 4DEYA 3HRSA 3JSCA 4KBMB 5D6WA 2IVWA 3BY7A 4IKFA 2F2XA 1AEYA 3EHRA 1I5LA 2DL5A 4M77A 2XDPA 5CR2A 1OX8A 2V1QA 4J6WA 4A4HA 1SHGA 4J6YA 5FROA 4JJCA 2JMCA 1YJNT 4B9XA 2QTXA 4EMHA 2E12A 2P0KA 5KH6A 2LJ1A 1AT1B 3L2QA 2GFAA 2G6FX 2LCCA 4M75G 1NE8A 2JN0A 2A7YA 2CREA 3EG3A 4LDYA 1D0XA 2ATCB 1X01A 2EGAA 3ZEHA 2DKGA 4C5HA 3L2RA 1ZBXA 3M0TA 2PQWA 2CDTA 4BI8B 1SG5A 3M0QA 4CRIA 3X20B 1SSHA 4WF2A 4QW2A 2I0NA 2QG9B 4GY5A 1D1AA 1BIAA 2JNGA 3ER0A 3HHTB 4L5GA 4M77G 3VS0A 1D3BB 4AT1B 4LD9K 1BI0A 1FX7A 3CBPA 1Z9ZA 1YCYA 5GAOp 3MP6A 4M77C 4JS5A 5I21A 2M0OA 5A0LA 2EVRA 5GAMf 2CS7A 2BKDN 5FWBA 3CC7Q 3TU4K 4EIKA 2DXUA 4XTXA 4M4ZA 4C8QA 2CP6A 2DA9A 1X43A 3M56A 3GF5A 4MZMA 2FRWA 2EQMA 4C0ZA 3QIIA 1B3QA 3CC7T 2YUOA 4XU3A 4V2SA 5GAMg 2PUOB 2C0TA 1I5OB 2CUDA 5CAIA 3CCSQ 2RB6A 3G71A 3X26B 1BCMA 1EIFA 2M02A 3PMTA 1VYUA 3JCMJ 1Q81C 1TOVA 2F69A 4BB7A 5LJ5h 3I55A 5GAOq 1BB9A 2E4HA 3FRNA 4IUPA 2OTLQ 2E64A 2K5IA 2XIDA 1QWEA 2NUTB 1VQPQ 5AT1B 4C8QG 1JJ2P 5LJ5e 2RO0A 5CKFA 4O5VA 1K9MC 4X9DA 4J6XA 5LJ5d 4ZGEB 1IXDA 1VQNQ 2Y4YA 1Q82C 1JXOA 1R77A 2FG0A 2EYWA 1WJRA 3VS7A 4C8QC 1BK2A 1DJ7B 1WHJA 2QGGA 1Q86C 4J9HA 3PVLA 2VGNA 1D0YA 4UC4A 1WIEA 5FW9A 3UWNA 2JVVA 2E5QA 4JDSA 1UHFA 2R5AA 1KC8R 4VUBA 1YWOA 2LRQA 3UPUA 1ZLMA 1D09B 2KI7A 1G3TA 2JUFA 2JXBA 4M7AE 2QTVA 2DILA 1NG2A 4ATOA 2KR3A 2HBPA 4QVDA 1F1BB 1TUGB 4X9CA 4LDXA 1IB8A 1IREB 1R0CB 1AWJA 4DOVA 3G6EQ 2DL8A 4IURA 1KQ1A 2MIOA 2CP3A 5GANg 3JAME 3E19A 3MP8A 2RM4A 3V8KA 2D1XA 3M4YA 5CO7A 5LJ3j 3OYLA 2C0IA 1W4SA 1BI3A 1TTHB 2DBKA 3NFCA 8AT1B 2F2VA 2FZKB 2Z0WA 4MMLA 2YDLA 4WCIA 3VU3C 3MKDA 3CCRQ 4F7UA 1ZSZA 2AT1B 3EGDB 1UGVA 1ZUUA 1RACB 1PKTA 1YWPA 1SRMA 2A08A 5KE3A 4AMCA 1IHWA 1ZA2B 1G83A 1Y7XA 2XMFA 3CCQQ 4JJNK 4ZGJB 5CIUA 3J81E 2E65A 2FEIA 3LH5A 1W70A 5DM7R 3EG2A 4QQ6A 2QI2A 4C5GA 3C4SA 5DLQE 1LVKA 2YXYA 1PCXA 3RESA 1O75A 3QHSA 3UDCA 4A4KA 2EQUA 2ZGWA 1K73U 3HL8A 4J83A 3ME9A 1PD0A 5GAN4 3QO3A 4IIMA 1ZSZC 1QVGS 1RAFB 1WQ7A 1NLPC 1WXBA 2COWA 1RLPC 2FO0A 4OMNA 3RUXA 1P92A 3LGLA 2NWMA 2DD4A 4M7AG 2HL3A 6AT1B 5KYUB 1MUZA 4LD6A 4M78B 4M7DD 2DXTA 1PNJA 2FZGB 2JM8A 2KROA 2YRCA 5GMKl 2KNBB 4OMFB
chains in the Genus database with same CATH topology
4M7DF 4BUGA 3MEVA 1VQNT 3JCMh 5J39A 3OYYA 2OTLT 4FM4B 1TH7A 3OSVA 3PFSA 3OYBA 2LTOA 1N27A 2YLCA 3M53A 3CCMT 2EWNA 2XKOC 2K3XA 2LDMA 1NZ9A 3PGGA 5IAYA 5FU7B 5GAOl 1VQPT 2DJZA 1N8RC 1UGQB 3G7ZA 3M54A 1VQ8T 2M1HA 3QKJA 3HFOA 1VQ7A 5LJ5j 3JCMe 3L1AA 4HA8A 2K2VA 4TVRA 4R56A 4F7UE 3R6OA 3GP8A 3CCEA 3LLRA 4HKEA 3DB3A 4OF1A 1Q81U 2RJCA 2DIGA 5CVIA 4BD3A 2O01E 3JCMd 4XU1A 4ELZC 4RMOA 3SWNA 3GPLA 3LYIA 2VUBA 2EFIA 4XK8E 4BY6C 4M78G 4PKCC 3CC7A 4C8QE 2ZPHB 4BDYA 1BI2A 3GOXA 2E70A 3S3NA 4BDZA 5KCOA 1NPRA 2EYQA 3JCMX 2FHDA 1HK9A 1S72A 4C5EA 5LJ3e 1PSFA 5FLXE 1OZ2A 3T9NA 2XHCA 1MHNA 2L8DA 2QXFA 1ZHIA 4M78C 4XTYA 2MWPA 1WPYA 2K5FA 5LJ3d 2QEXA 1K9MU 1V29B 3SWNB 3CCUA 3RIRA 5IT9E 4IUUA 5CKBA 2VYTA 3G71T 1Q82U 4PJOD 3HPWA 3QPHA 2KQWA 2LVMA 2OAUA 3CPWA 2WSCE 3V8LA 3QZ9B 4OMFB 4PJOF 1Y96A 1Q86U 3DKMA 3A5ZB 3RKWA 4A4GA 3JCMb 4NS5A 4II1A 3M9QA 5FU7C 1JRIA 5LJ3f 3CMAA 5D6XA 3OYDA 2XDDA 3P8BB 2R5MA 3GLXA 4PLLA 3RERA 1XNIA 2LNVA 5GMKh 3A8OB 3G6ET 1YJWT 4C92E 5GAMj 1KG1A 5GAOn 4FT4A 1JBMA 3A8MB 1G3YA 1X6OA 3OYHA 4JRPA 4BE1A 3LH0A 3CMEA 3O8VA 1Y96B 2DO3A 2GCXA 4M7DE 3OSSC 3CCJA 2DXBA 1ZQ1A 2WACA 2XG8D 5GMKe 4EMKA 2CKKA 3KBGA 1JB0E 1VQOT 3A8LB 2D0QB 4Y28E 1BI1A 2RK1A 4XU0A 3OYKA 3FJPA 3ZBDA 3Q1JA 4N4IA 4E7JA 2MF2A 3JCMg 2EJFA 2P0PA 4ELYC 3S3MA 2OTLA 2K5LA 1VQ5T 4M7AA 2EIFA 2BUDA 2IG0A 4XTWA 3SWNC 2OTJA 2DIQA 4OP0A 3INZA 4EPCA 2CZ6B 3G4ST 3BDLA 4C0GA 2HQXA 2VV5A 3OS0A 1VQPA 3RKYA 1KQSA 1VQ8A 4FSXA 1NJIC 3OQ5A 3CCRT 3QG1A 4EMKB 5DY9A 4L59A 1YIJA 4HCBA 1N6AA 4N4GA 4HT9A 3DB4A 1VQNA 3KUFA 5LJ3g 4M7AB 3OYMA 3C94A 5CQYA 3OYCA 2EAYA 1PSEA 2DK3A 1BYMA 2AHJB 3JB9D 2YHTA 4M7AD 3JRZA 2RI2A 2NLUA 2M16A 1I8FA 4J7IA 3TREA 1YITA 3JB9F 1KD1U 2QQAA 3A8GB 4M7AF 3UT1A 3VYGA 3GNGA 2RI5A 2X35A 1X75C 5I2SA 4MDWA 4QVZA 4DOWA 3JB9J 1UGSB 2FL7A 3HKSA 2PVGB 3WXMB 1M90C 2XK0A 3X28B 2K4YA 1M1KC 2L3RA 3VUZA 2QQBA 2VXEA 3CCQT 3PNWC 2PVDB 4FIBA 2EQJA 3WVEB 3L42A 3JCMP 4PJOE 4RG8A 1JJ2A 5DLOA 3PTAA 3PMIA 3A8HB 4MZPA 2G3RA 1FXXA 2H3JA 4KUIA 4Q5WA 1UGPB 3LWIA 3QBYA 3JB9I 1KHCA 1QVPA 1MGQA 3OS5A 1XQHA 3DLMA 3CPFA 2Y90A 3GNFB 4C0FA 4KT0E 4LDWA 3E9GA 4ZTFA 3QXEB 4PL6A 4DQ2A 1OZ3A 3L2VA 2RA2A 2O4XA 5GAN8 1KC8U 3HRSA 3JSCA 4KBMB 5D6WA 4M78D 2IVWA 4EMKC 3BY7A 4IKFA 4BI3A 3V7RA 3G6EA 1YJWA 1M1FA 4P5NA 4M78F 1I5LA 2PU9B 4M7AC 2R57A 4M77A 2XDPA 1O9SA 5CR2A 4JS4A 4MDXA 4Z02A 5GAN6 4J6WA 5GANj 1NJIU 3CCVT 5J26A 4A4HA 1QVFA 4J6YA 5FROA 2O4XB 3E9FA 4XU2A 3OYGA 1YJNT 4B9XA 3CD6A 4IUQA 2QTXA 4EMHA 2E12A 2P0KA 3M4GA 5KH6A 5GANf 2DZCA 2MWOA 1LJOA 5LJ3h 4J7FA 3L2QA 2GFAA 4M77B 2VGMA 1OYXA 2L5QA 2XICA 4QQGA 3CPWS 3QJ6A 1K8AC 2YRVA 3MHXA 4OVAA 5LJ5f 2LCCA 4M75G 5GAN5 1NE8A 1QP3A 4JLGA 2ZPFB 3QZ5B 4M77F 2JTFA 2JN0A 2A7YA 4KULA 3ASKA 2DZ9A 3CC2T 3P8HA 2LQ8A 5LL6S 4LDYA 5A0DA 5C6SA 1VQMT 1UEBA 4FU6A 1M1KU 1X01A 3JCMV 3TEEA 3ZEHA 2DKGA 1Q7YC 2K57A 2LCLA 4C5HA 3L2RA 1D3BA 1ZBXA 1YHQA 2HQEA 2PQWA 4A4FA 3CC4T 3OMGA 3SDZA 1H641 4BI8B 3H8ZA 5FRMA 1YJ9T 5IN1A 1OI1A 3X25B 4QVCA 4CRIA 5CK9A 3X20B 1VQ9T 2VC8A 4WF2A 4QW2A 4GY5A 1SSFA 4C0DB 2E6ZA 1BIAA 2JZ2A 4NOYA 3OYJA 2DTHA 1M8VA 2JNGA 5J3BA 3ER0A 3HHTB 5GAMe 3I55T 4L5GA 4J8OA 5I2MA 4M77G 5CKEA 5A2QE 4XTZA 1D3BB 4MMKA 5GAMd 1YI2T 3CCQA 4LD9K 3CCLA 1BI0A 1FX7A 4EDUA 3CBPA 1R8OB 2FB7A 1YCYA 3HRUA 4ME7A 4MZTA 2PUKB 3MP6A 4RKUE 3NTHA 5A0GA 5GAOp 3M59A 2QQSA 1UGRB 3MCAB 4M77C 4JS5A 1KQSS 3L2UA 3DLLA 3CCSA 2P4TA 5I21A 2M0OA 4FL6A 3V7CA 1N8RU 4HCCA 5A0LA 2EJGA 5GAMf 4M78E 2ZPBB 2ZPEB 2DD5A 3MEWA 2L89A 3OBYA 4CI0C 4HCZA 3MP1A 2CS7A 2BKDN 3I56T 2QDYB 5HKCA 1K73C 4A4EA 3TU4K 4NL3A 2DXUA 4E47A 3CCMA 4ZN3A 2E1HA 1YBYA 4ZGDB 3J80E 4QQDA 4BE0A 1YJNA 2MAMA 4XTXA 3PIPA 4C0DC 4B9WA 1VQ6T 1RI0A 1W2BA 3SB2A 3EFRA 3SFMA 5EG2A 4C8QA 3V7SA 1JJ2S 1LOJA 3CBOA 5GAOr 5CCAA 2I2LA 1VIEA 4JRQA 2EJ9A 2LC4A 1WJQA 1XOVA 2CZ0B 2RHXA 3M56A 3GF5A 2RHIA 4MZMA 1VQ4T 3L2ZA 4IUTA 2XI9A 3NTIA 2EQMA 3CBMA 3H6ZA 2EQKA 4C0ZA 2HD0A 3M57A 2R58A 2RJEA 3HSBA 2RK2A 3QIIA 1VQMA 2RI3A 3CC7T 2RHUA 4C8QB 4XU3A 1HXDA 1M9SA 3GIBA 4M75A 5GAMg 1VQKT 2PUOB 4V2SA 2DXCA 2QQ9A 3CC4A 3QUIA 2BIVA 2K3YA 5CAIA 1N9RA 1YJ9A 1S72T 4C8QF 5GANh 2RB6A 4KUDK 3G71A 2QA4T 3X26B 5FRNA 1EIFA 3JB9H 1QVFS 3OMCA 2QEXT 3BDUA 3VJPA 3PMTA 1VIFA 3CCUT 2LT4A 3C12A 3M55A 4PNOA 3RMQA 3JCMJ 4OGEA 3JCMW 1Q81C 2P0QA 2F69A 2KMTA 4BB7A 4C92A 4JRIA 5LJ5h 3I55A 2X4XA 5GAOq 3WVDB 4M75B 5FU6B 4X34A 3FRNA 4IUPA 1M4ZA 3OB9A 4M75D 4C5IA 4F7UG 5GANe 2E64A 2K5IA 2XIDA 4FT2A 2KY9A 4M7DA 3CXCA 2RJDA 3V8JA 2WSEE 5GANd 1VUBA 2ZPGB 3P8DA 4M75F 4A53A 2FYKA 2HAXA 3VUBA 1B34A 4C8QG 5LJ5e 5GMKm 2RO0A 5CKFA 4O5VA 4C92B 4X9DA 1K9MC 2XD0A 4OB2B 1QW1A 2GFUA 4J6XA 1U1TA 5LJ5d 1M1GA 3FEOA 1M5Q1 2KK4A 2MI6A 4LDUA 4ZGEB 3JCMQ 2Y4YA 2JOYA 4E7LA 1Q82C 1WJRA 3QYHB 4M7DB 4C8QC 1VQOA 1DJ7B 1AHJB 5GAOm 1Q86C 2ZZDA 5AYFA 4XAXB 5KCHA 1VQ5A 1WNLA 2VGNA 2F5TX 4UC4A 2QQRA 3F70A 4JUVA 4M77D 5L8RE 3RMSA 3G4SA 4ZTJA 3BW1A 3HP9A 3UWNA 2JVVA 4R55A 3OYAA 1G3WA 2E5QA 4JDSA 3SD4A 4HT8A 2OTJT 2R5AA 1Y07A 1LNXA 4VUBA 3CCRA 1VQ6A 3FB9A 1M90U 4OB0B 2LRQA 3OBWA 3UPUA 1QVGA 2VXFA 3PIOA 3CEYA 5GAMh 4BE2A 4M75C 3LW5E 5FU6C 3OW2A 1G3TA 2JUFA 4N4HA 4C92G 3OS1A 2X4JA 4M7AE 1YIJT 1VQ4A 4ATOA 5HY6A 4E7HA 1I81A 2HBPA 4QVDA 1WGSA 2GQVA 5CKHA 4X9CA 4GLKA 1G3SA 4LDXA 4M7DG 4PJOA 1IREB 2V8KA 4C92C 4BI4A 2KAFA 1FWZA 1YITT 4DOVA 3QDRB 1N9SA 2ZCFB 1VQKA 4IURA 3VYHB 4LDVA 3QSUA 1H3ZA 3FDRA 2LT1A 1KQ1A 4D6WA 4M7DC 2D6FA 2QA4A 3JCMf 1RL2A 5GANg 4JRKA 1U1SA 3FIFA 3FLGA 3E1SA 2Y4XA 3JAME 3E19A 4JLIA 4PJOB 3MP8A 2RM4A 2A3LA 3M4YA 3V8KA 3S3OA 5CO7A 1WJSA 3FC3A 1W2BS 5LJ3j 3OYLA 5LJ5g 1G5VA 1BKBA 1XTDA 4E7IA 2KVQG 2RHZA 4M75E 1W4SA 1BI3A 2X4YA 2DTIA 2LX9A 1KD1C 3NFCA 4DA4A 5GAN3 3C95A 2F5KA 1NPPA 2X4WA 2EKOA 3OYFA 3OA6A 1K8AU 2YLBA 4MMLA 2FVUA 3VU3C 4N0AA 3CCVA 2CZ7B 4F7UA 3OS2A 3OYIA 2E41A 3OYEA 3OY9A 2PVOB 3ZFJA 5M9OA 1GXIE 3EAEA 1Q7YU 3RKXA 2JTMA 2V8JA 2XU8A 3EFSA 2DVEA 1WQWA 3CD6T 2E6NA 4PJOG 1BIBA 4M77E 4E7KA 4RCBA 3L2WA 4BACA 1KC8C 5KE3A 1VQ7T 3PT9A 4IUVA 4F7UB 1U8RA 3TCJA 4OGCA 3S6WA 5KE2A 5HK3A 3CCET 3NTKA 2CYZB 3MEAA 5GMKi 2RD1A 1I4K1 4PJOC 3CC2A 5GMKj 1Y7XA 1QP2A 5CQXA 3MO8A 4F7UF 2HNIA 5C0MA 4JJNK 1UB4A 3N5BB 3CXCS 4ZGJB 1KQ2A 3META 5CIUA 4C8QD 3J81E 2E65A 4RCCA 1Y71A 3BFMA 5HK0A 4J5YA 4OB3B 3QYGB 5DM7R 1KHIA 4RG2A 2DAQA 2RH2A 4QQ6A 3LWHA 4A54A 1YHQT 2C06A 1VQ9A 2QI2A 3HFNA 4C5GA 1VQLT 2E10A 2LQKA 2RHYA 2V8IA 3C4SA 5DLQE 4O6JA 4XQ3A 4PLIA 2KSSA 4XTVA 3M5AA 4XTUA 3RESA 3URGA 5GAN2 1O75A 3QHSA 3UDCA 4L6V5 4A4KA 3MEUA 2DTOA 3VKIA 1YI2A 3J7AF 3LGFA 2EQUA 2ZGWA 4EMGA 1K73U 2MMPA 3HL8A 1VQLA 5GAN7 4M78A 3CMAT 4J83A 3OYNA 3ME9A 2KDSA 2ZPIB 2RJFA 2DPPB 5GAN4 3CCLT 3QO3A 3M58A 3KXTA 3QJYA 4N0AC 2B8AA 2CZ1B 4BY6B 2WSFE 4ZN1A 2M9UA 3JCMc 1QVGS 1WQ7A 4C92D 2XDBA 5CKDA 5D6YA 2GF7A 4NL2A 3CCST 3CMET 3OW2S 3VV0A 3RUXA 4Y91A 1P92A 3LGLA 4C92F 3JB9G 2DD4A 2DEQA 4M7AG 2CGHA 2D9TA 4OB1B 4M78B 4LD6A 3CCJT 4M7DD 2DXTA 3I56A 3AHUA 3HRTA 3LX7A 4YTLA 5GMKl 3X24B 1B34B 1IZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D F;  3JB9 J;  3QSU A;  1N9S A;  3JCM h;  4NL3 A;  2DXU A;  2E1H A;  1KQ1 A;  1TH7 A;  4M7D C;  2VXE A;  2YLC A;  3JCM f;  5GAN g;  2EWN A;  4JRK A;  1U1S A;  3FIF A;  3PGG A;  4XTX A;  3JCM P;  4PJO E;  5GAO l;  2DJZ A;  4JLI A;  3SB2 A;  3EFR A;  4C8Q A;  4PJO B;  2RM4 A;  3HFO A;  1LOJ A;  3V7S A;  3V8K A;  3JB9 I;  5LJ5 j;  5GAO r;  1MGQ A;  5LJ3 j;  2I2L A;  3JCM e;  3L1A A;  5LJ5 g;  4HA8 A;  2Y90 A;  2EJ9 A;  4F7U E;  4M75 E;  4DQ2 A;  3JCM d;  2DTI A;  2RA2 A;  4XU1 A;  5GAN 8;  3L2Z A;  3SWN A;  5GAN 3;  4M78 D;  4M78 G;  3BY7 A;  4EMK C;  3HSB A;  2YLB A;  3V7R A;  4C8Q E;  4MML A;  3VU3 C;  4C8Q B;  4M78 F;  4XU3 A;  1HXD A;  4N0A A;  3JCM X;  1I5L A;  4M7A C;  4M77 A;  3GIB A;  1HK9 A;  4F7U A;  4M75 A;  2E41 A;  5GAM g;  5LJ3 e;  4V2S A;  5GAN 6;  4J6W A;  5GAN j;  3QUI A;  4XTY A;  4M78 C;  5CAI A;  1N9R A;  1WPY A;  4J6Y A;  4C8Q F;  5LJ3 d;  2RB6 A;  5GAN h;  3RKX A;  4XU2 A;  3SWN B;  3RIR A;  3JB9 H;  2QTX A;  3BDU A;  4EMH A;  3M4G A;  3EFS A;  2DVE A;  1WQW A;  2DZC A;  4PNO A;  4PJO G;  5GAN f;  3JCM W;  1BIB A;  3JCM J;  4PJO D;  4M77 E;  4C92 A;  4RCB A;  4JRI A;  5LJ5 h;  1LJO A;  5LJ3 h;  5GAO q;  3V8L A;  4M77 B;  4PJO F;  1Y96 A;  4F7U B;  4M75 B;  3RKW A;  3JCM b;  4M75 D;  5LJ5 f;  4F7U G;  5LJ3 f;  1JRI A;  2E64 A;  4M75 G;  5GAN e;  5GMK i;  2RD1 A;  5GAN 5;  4M7D A;  1I4K 1;  4PJO C;  5GMK j;  4M77 F;  3V8J A;  5GAN d;  4F7U F;  2HNI A;  2JN0 A;  4M75 F;  4A53 A;  1KQ2 A;  3RER A;  2DZ9 A;  5GMK h;  2FYK A;  4C92 E;  4C8Q D;  5GAM j;  5GAO n;  2E65 A;  1B34 A;  1JBM A;  4RCC A;  1X01 A;  3JCM V;  4C8Q G;  3BFM A;  4C92 B;  5GMK m;  5LJ5 e;  2DKG A;  4X9D A;  2K57 A;  4J5Y A;  4J6X A;  1D3B A;  1U1T A;  5LJ5 d;  1Y96 B;  1M5Q 1;  4A54 A;  3JCM Q;  1H64 1;  4M7D E;  3HFN A;  2E10 A;  4QVC A;  4M7D B;  4C8Q C;  2VC8 A;  4WF2 A;  4XQ3 A;  4EMK A;  5GMK e;  5GAO m;  4XTV A;  4XTU A;  3RES A;  5GAN 2;  1BIA A;  4NOY A;  3QHS A;  4XU0 A;  2DTH A;  1WNL A;  3FJP A;  5GAM e;  1M8V A;  3JCM g;  2EJF A;  4JUV A;  4M77 D;  2DTO A;  4M7A A;  4M77 G;  3BW1 A;  4XTW A;  4XTZ A;  1D3B B;  4MMK A;  3SWN C;  4OP0 A;  5GAM d;  3INZ A;  2ZGW A;  4HT8 A;  4EMG A;  5GAN 7;  4M78 A;  1LNX A;  2FB7 A;  1YCY A;  3FB9 A;  3RKY A;  5GAN 4;  3QO3 A;  5GAO p;  4N0A C;  2VXF A;  4M77 C;  4EMK B;  5DY9 A;  5GAM h;  4M75 C;  3JCM c;  5I21 A;  1WQ7 A;  4C92 D;  4M7A E;  4HT9 A;  4C92 G;  3V7C A;  4NL2 A;  5LJ3 g;  4M7A B;  2EJG A;  5GAM f;  2EAY A;  3RUX A;  4Y91 A;  4M78 E;  1I81 A;  2YHT A;  4C92 F;  4QVD A;  2DEQ A;  3JB9 D;  3JB9 G;  4M7A G;  4M7A D;  2CGH A;  4X9C A;  4M78 B;  4M7D D;  2DXT A;  3AHU A;  1I8F A;  4M7D G;  4PJO A;  3JB9 F;  4M7A F;  4C92 C;  5GMK l;  1B34 B; 
#chains in the Genus database with same CATH topology
 4M7D F;  3JCM h;  1VQM Q;  5J39 A;  2KXC A;  4DBH A;  1BCO A;  3CC4 Q;  3VS5 A;  2K3X A;  2LDM A;  3PGG A;  1YJ9 Q;  2DJZ A;  1VQ8 T;  2M1H A;  3JCM e;  2O9S A;  3R6O A;  2RJC A;  2DIG A;  4BD3 A;  3JCM d;  3GPL A;  4ELZ C;  2ROL A;  3LYI A;  1FMW A;  2HSE B;  3CC7 A;  2GGR A;  4KH1 B;  3GOX A;  5KCO A;  2FHD A;  2J6O A;  1X6G A;  2YSQ A;  5LJ3 e;  2OI3 A;  4RTZ A;  2HCK A;  2QXF A;  4XTY A;  1ZHI A;  1H92 A;  5LJ3 d;  5IT9 E;  2VYT A;  1KFZ A;  3HTR A;  3EGX A;  3HPW A;  3H9N A;  4LE9 A;  5IXF A;  2KRS A;  2WSC E;  1T3L A;  1Y96 A;  3RKW A;  1UHC A;  2HKQ B;  4NS5 A;  3TVT A;  2L3P A;  3P8B B;  2QAZ A;  2GQI A;  3RER A;  1K9A A;  9ATC B;  5GAM j;  1ZSG A;  3A8M B;  1G3Y A;  4JRP A;  2DFU A;  2RPN A;  3LH0 A;  1NM7 A;  2DO3 A;  2KE9 A;  1E7O A;  3CPW P;  4AFQ C;  2DXB A;  4PFO A;  4CC3 A;  2OX7 A;  3A8L B;  1BI1 A;  2RK1 A;  2H3E B;  2CP5 A;  2OTL A;  4ELY C;  2BUD A;  4OP0 A;  3QWY A;  3BDL A;  1JU5 C;  2HQX A;  2LCS A;  2VV5 A;  1VQP A;  3RKY A;  4J9D A;  1K8A R;  1T0H A;  3D7S B;  4K11 A;  4EMK B;  5DY9 A;  4L59 A;  2L3Q A;  3DB4 A;  1VQN A;  3JB9 D;  2YHT A;  4KGX B;  1WFW A;  1Q7Y R;  1EZZ B;  4PK4 A;  3I5S A;  1WXT A;  1I8F A;  3TRE A;  3JB9 F;  1TUD A;  3A8G B;  3VYG A;  4MDW A;  2FL7 A;  2PVG B;  1M90 C;  3CCV Q;  1M1K C;  2PTK A;  2QQB A;  3L42 A;  4RG8 A;  5DLO A;  2D6F A;  3A8H B;  2NUT A;  1RAE B;  5I22 A;  2K9G A;  3DLM A;  3CPF A;  4KT0 E;  4LDW A;  1NBE B;  1OZ3 A;  2O4X A;  1OX9 A;  1GBR A;  3G6E A;  5GAN j;  3CCV T;  4AG2 C;  2BE7 D;  3OYG A;  4XU2 A;  2CH4 W;  3VS2 A;  1KIK A;  2RNA A;  1VOM A;  2L5Q A;  3CPW S;  2X3W D;  3MHX A;  5GAN 5;  2ZPF B;  4F17 A;  4CC7 A;  3QZ5 B;  4KUL A;  1VQL Q;  1M2V A;  1B07 A;  1M1K U;  3JCM V;  1HJD A;  2K57 A;  4LXC A;  1WDX A;  1OI1 A;  5IN1 A;  3X25 B;  4QVC A;  2LP5 A;  4R0K A;  1SSF A;  2E6Z A;  2JZ2 A;  2HL5 C;  5GAM e;  3I55 T;  1JXM A;  5CKE A;  2QDL A;  4XTZ A;  4MMK A;  5GAM d;  3CCQ A;  1TU0 B;  1X27 A;  4EDU A;  2J05 A;  1VQL T;  3NGP A;  4ME7 A;  3RR6 A;  1UGR B;  3MCA B;  1I0C A;  3QDF A;  1N8R U;  4AG1 C;  4HCC A;  1M3C A;  1VQ7 Q;  4M78 E;  2ZPB B;  4HVU A;  3MP1 A;  5IHK A;  2QDY B;  4D8D A;  2O88 A;  2E1H A;  1YBY A;  4BE0 A;  1OU9 A;  4DBQ A;  4C0D C;  2QEX Q;  1LOJ A;  3AT1 B;  4LNP A;  2I2L A;  1VIE A;  2KT8 A;  1XOV A;  2CZ0 B;  2RHI A;  4IUT A;  3NTI A;  3H6Z A;  4RTU A;  2HD0 A;  3M57 A;  2DNU A;  2RJE A;  3CMA Q;  2LQN A;  1VQM A;  3CCL Q;  2RHU A;  3GIB A;  4M75 A;  1FMK A;  2DXC A;  1W2B P;  3CC4 A;  1OU8 A;  1YJ9 A;  1HYO A;  5GAN h;  3CME Q;  2AIR B;  3JB9 H;  2QEX T;  1VIF A;  2AZV A;  3CCJ Q;  2JM9 A;  4PNO A;  1WLP B;  2L2P A;  4OGE A;  4JRI A;  2X4X A;  3WVD B;  1NLO C;  2VB6 A;  5FU6 B;  1YCS B;  4C5I A;  5GAN e;  4OMP A;  4M7D A;  2COZ A;  2RJD A;  5GAN d;  4A53 A;  3P8D A;  2LZ6 B;  1KD1 R;  1SHF A;  4C92 B;  2KGT A;  1D1B A;  4OB2 B;  2GFU A;  1U1T A;  2NUP B;  1M1G A;  4E7L A;  2MI6 A;  2JOY A;  2RQR A;  1LPL A;  3CQT A;  1MMD A;  2O31 A;  3QYH B;  4FW1 A;  3VS1 A;  2O9V A;  4XAX B;  5KCH A;  2LNH B;  5GJV B;  1TS9 A;  2QQR A;  4JUV A;  1T3S A;  4ZTJ A;  3HP9 A;  3OYA A;  5IXB A;  4HT8 A;  1G3W A;  1Y07 A;  1IHV A;  3REB B;  3FB9 A;  1QVG A;  3PIO A;  3CEY A;  4M75 C;  4N4H A;  1RAG B;  5HY6 A;  4E7H A;  3TSZ A;  2GQV A;  1PKS A;  5KYY B;  1MND A;  4M7D G;  1QQJ A;  4BI4 A;  2KAF A;  5KYW A;  1FWZ A;  3QDR B;  1YJW Q;  1QCF A;  3VYH B;  3FDR A;  1YNZ A;  1AWW A;  4D6W A;  4M7D C;  3EHQ A;  3QWX X;  3OW2 P;  2E3H A;  3FLG A;  2DF6 A;  4E7Z A;  4PJO B;  5KYX B;  1W2B S;  1XTD A;  2RHZ A;  2KYB A;  2X4Y A;  4DA4 A;  5GAN 3;  2CP7 A;  2HMA A;  3UF4 A;  1NPP A;  2EKO A;  2FPE A;  1A0N B;  4N0A A;  3JV3 A;  3CCV A;  3OS2 A;  2E41 A;  2K7A A;  2PVO B;  2YWW A;  1YHQ Q;  4E2F B;  2V8J A;  5D7U A;  2E6N A;  1X6B A;  4RCB A;  1KC8 C;  3PT9 A;  1K1Z A;  1U8R A;  3TCJ A;  2QYZ A;  3NTK A;  2CYZ B;  2RD1 A;  3UA7 A;  2J7I A;  4GBQ A;  3MO8 A;  1UB4 A;  4RCC A;  3GBQ A;  3BFM A;  4J5Y A;  4OB3 B;  2RH2 A;  3LWH A;  1YHQ T;  2X3X D;  1C1A A;  1D1C A;  2F1L A;  4O6J A;  1M3B A;  4PLI A;  2KSS A;  4XTV A;  4XTU A;  3URG A;  1VYV A;  3J7A F;  3MEU A;  2D8J A;  1VQL A;  1GBQ A;  3KXT A;  3QJY A;  1TSF A;  4CC4 B;  4N0A C;  1ABQ A;  4BY6 B;  2WSF E;  4ZN1 A;  2CH4 A;  3OW2 S;  4NL2 A;  3CCS T;  3VV0 A;  3JB9 G;  1C0M A;  3U23 A;  2D9T A;  3HRT A;  3X24 B;  1B34 B;  1M30 A;  4WTO B;  2M0Y A;  2OTL T;  4J9B A;  4LUE A;  2LTO A;  2EWN A;  1B7T A;  1NZ9 A;  1UJY A;  2BE9 B;  4RTX A;  5FU7 B;  1VQP T;  1ZX6 A;  3QKJ A;  3HFO A;  1VQ7 A;  1M8M A;  4TVR A;  2K2V A;  4R56 A;  2P4R A;  4F7U E;  1VQN T;  1NJI R;  3LLR A;  1JQQ A;  3DB3 A;  1Q81 U;  4XU1 A;  4ESR A;  1UJ0 A;  3SWN A;  1IGQ A;  4QT7 A;  2ZPH B;  1KSW A;  3S3N A;  2CT3 A;  2E3I A;  1HK9 A;  1K0X A;  1QVG P;  2JT4 A;  2ZAE A;  1MHN A;  2L8D A;  4FW2 A;  2QEX A;  2ROT A;  1K9M U;  5CKB A;  3RBB B;  1Q82 U;  2EKH A;  3CPW A;  3EG9 A;  1D0Z A;  1Q86 U;  3A5Z B;  3EFO B;  1VQ5 Q;  1RI9 A;  3CMA A;  2XDD A;  2R5M A;  4PLL A;  3G6E T;  4C92 E;  5HCK A;  3MJX A;  1VQ6 Q;  1KG1 A;  1JBM A;  4BE1 A;  3CME A;  3O8V A;  1RAB B;  4ZNX A;  3CCJ A;  2ABL A;  1VQ4 Q;  1WA7 A;  1OQK A;  2WAC A;  3KBG A;  4Y28 E;  1I1J A;  5GJW B;  2A37 A;  3FJP A;  3Q1J A;  4N4I A;  2MF2 A;  2EJF A;  4M7A A;  2K5L A;  1VQ5 T;  2CSI A;  3SWN C;  1VQK Q;  3INZ A;  1E6H A;  2CZ6 B;  2FRY A;  3OS0 A;  2QA4 Q;  4FSX A;  3CCR T;  4HCB A;  3H41 A;  3C94 A;  5CQY A;  1HSQ A;  1PSE A;  2AHJ B;  2RI2 A;  4J7I A;  2RI5 A;  1PHT A;  2X35 A;  4QVZ A;  4DOW A;  3E2U A;  1UGS B;  3HKS A;  1KQS P;  2V1R A;  1ARK A;  3CCQ T;  3PNW C;  4FIB A;  3JCM P;  4PJO E;  3H0H A;  2EQI A;  4AFZ C;  2G3R A;  4KUI A;  3LWI A;  4CC2 A;  3QBY A;  3JB9 I;  1UFF A;  1IGU A;  3OS5 A;  4RUG A;  3GNF B;  4ZTF A;  4PL6 A;  2RA2 A;  3H0F A;  5GAN 8;  1QCN A;  4M78 D;  1UG1 A;  1YJW A;  2QAS A;  4ANJ A;  4P5N A;  4M78 F;  3RNJ A;  2PU9 B;  4M7A C;  2R57 A;  4JS4 A;  5GAN 6;  3EG1 A;  5J26 A;  3BE3 A;  1AOJ A;  1K73 R;  4IUQ A;  1FYN A;  1VQ9 Q;  3M4G A;  2DZC A;  1G2B A;  2MWO A;  2MOX A;  1TWB A;  2AKL A;  5LJ3 h;  4M77 B;  2VGM A;  1OYX A;  1GFC A;  3QJ6 A;  1K8A C;  1BU1 A;  4OVA A;  5LJ5 f;  1YI2 Q;  3VRY A;  2LX7 A;  4M77 F;  1RUW A;  3ASK A;  1QVF P;  5LL6 S;  1VQM T;  5C6S A;  3TEE A;  1YP5 A;  1GCQ A;  1Q7Y C;  2LCL A;  1YHQ A;  1D3B A;  2NUZ A;  4X1V A;  4A4F A;  3CC4 T;  3OMG A;  3SDZ A;  1YJ9 T;  2KRM A;  1EFN A;  1VQ9 T;  5J3B A;  4DEX A;  4J8O A;  2V26 A;  2L3S A;  1YI2 T;  3EH1 A;  2CT4 A;  1IO6 A;  1YN8 A;  4F14 A;  1R8O B;  2GTO A;  3HRU A;  2K2M A;  2PUK B;  5A0G A;  3M59 A;  2QQS A;  1KQS S;  3L2U A;  3CCS A;  2P4T A;  4KGV B;  2EJG A;  2ZPE B;  2DD5 A;  3MEW A;  3CCE Q;  4CI0 C;  4HCZ A;  7AT1 B;  2MK5 A;  1GFD A;  5HKC A;  4A4E A;  4E47 A;  4ZGD B;  2ED0 A;  3J80 E;  1S72 Q;  1MV0 B;  2MAM A;  4RTY A;  4JJD A;  3SB2 A;  1W2B A;  5EG2 A;  3V7S A;  1M27 C;  1GCQ C;  5CCA A;  2EYZ A;  4JRQ A;  2FPF A;  2LC4 A;  1WJQ A;  2RHX A;  2O2O A;  3CBM A;  2EQK A;  2R58 A;  2F2W A;  3M0R A;  3KFV A;  4C8Q B;  1HXD A;  1M9S A;  1RAI B;  3QUI A;  2K3Y A;  4D8K A;  1N9R A;  1S72 T;  4C8Q F;  4KUD K;  1ZA1 B;  1OV3 A;  1AVZ C;  1QVF S;  3BDU A;  3RMQ A;  3M55 A;  2YUP A;  3JCM W;  2P0Q A;  2KMT A;  3EGU A;  1Y57 A;  4Y92 A;  1M4Z A;  4FT2 A;  2OTJ Q;  2KY9 A;  3M0U A;  4J9I A;  2WSE E;  3V8J A;  1VUB A;  1RAD B;  4ORZ A;  3VUB A;  1B34 A;  4PFP A;  2XD0 A;  4LDU A;  1M5Q 1;  2KK4 A;  1MNE A;  3JCM Q;  2GNC A;  2DE0 X;  1AWO A;  3H0I A;  5GAO m;  2ZZD A;  5AYF A;  1WX6 A;  1YIT Q;  1VQ5 A;  5L8R E;  3F70 A;  1WHK A;  2FZC B;  2YT6 A;  3BW1 A;  2YUN A;  3SD4 A;  2OTJ T;  3CCR A;  3I9Q A;  4KRT A;  1M90 U;  1VQ6 A;  1EX4 A;  4OB0 B;  3OBW A;  2VXF A;  5GAM h;  4BE2 A;  3OW2 A;  1MMA A;  3O5Z A;  1K0S A;  1VQ4 A;  1I81 A;  1X2Q A;  1NYF A;  5CKH A;  4GLK A;  3M0S A;  1I07 A;  4E6R A;  1YIT T;  1VQK A;  2LT1 A;  3EH2 A;  2SRC A;  2QA4 A;  3JCM f;  1RL2 A;  1MMN A;  3E1S A;  2Y4X A;  4JLI A;  3CD6 Q;  3S3O A;  1WJS A;  1SPK A;  1TUC A;  1BKB A;  4HVW A;  2HEQ A;  4E7I A;  4M75 E;  3RDV A;  3EGD A;  1KD1 C;  2F5K A;  3OA6 A;  2YLB A;  2EW3 A;  2DM1 A;  3UAT A;  1KJW A;  3A98 A;  2CSQ A;  3OYI A;  3OY9 A;  3ZFJ A;  1GXI E;  3RKX A;  2JTM A;  1ABO A;  3VRZ A;  2XU8 A;  3CD6 T;  1WQW A;  3THK A;  2OAW A;  1QWF A;  1BIB A;  4M77 E;  4BAC A;  1VQ7 T;  4FYV B;  4F7U B;  1N8R R;  1ZSZ B;  3S6W A;  4Z88 A;  5HK3 A;  5GMK i;  2RQT A;  5GMK j;  5CQX A;  4F7U F;  2HNI A;  3A1P A;  3CXC S;  2BTT A;  4Z89 A;  2CP0 A;  1Y71 A;  5HK0 A;  1KHI A;  4RG2 A;  4A54 A;  2AK5 A;  1VQ9 A;  4AFU C;  2JS2 A;  2ECZ A;  2LQK A;  4XQ3 A;  3M5A A;  3VS4 A;  1H3H A;  4L6V 5;  2A28 A;  1YI2 A;  2DTO A;  3VKI A;  4EMG A;  4HVV A;  2MMP A;  5KYU A;  4M78 A;  5GAN 7;  3OYN A;  3CCM Q;  3CMA T;  1OUL A;  2C0O A;  2LJ0 A;  2RJF A;  2DPP B;  3CCL T;  1YJN Q;  3M58 A;  5IH2 A;  1QLY A;  3FJ5 A;  5L23 A;  3JCM c;  4GLM A;  4C92 D;  2XDB A;  5CKD A;  5D6Y A;  2GF7 A;  3CME T;  1PD1 A;  4Y91 A;  1GL5 A;  4C92 F;  2DEQ A;  3CCJ T;  1HD3 A;  1MV3 A;  1T0J A;  2RMO A;  3LX7 A;  4F16 A;  2QGF B;  4YTL A;  1IZ6 A;  4BUG A;  4OMO A;  3OYY A;  4FM4 B;  1TH7 A;  3OSV A;  3PFS A;  3OYB A;  1N27 A;  2YLC A;  3CCM T;  1LCK A;  2XKO C;  5IAY A;  2A36 A;  2COY A;  1UGQ B;  1M2O A;  3G7Z A;  3M54 A;  5LJ5 j;  2DEU A;  3L1A A;  4HXJ A;  4HA8 A;  3CCE A;  4HKE A;  2JW4 A;  4OF1 A;  3REA B;  5CVI A;  4RMO A;  1QMC A;  2VUB A;  1V76 A;  3MPU B;  4XK8 E;  2X9H A;  4M78 G;  4C8Q E;  1BI2 A;  2E70 A;  4BDZ A;  1NPR A;  2EYQ A;  3JCM X;  4PFZ A;  1S72 A;  4C5E A;  2BZY A;  5FLX E;  1OZ2 A;  3T9N A;  2XHC A;  2VVK A;  4M78 C;  1Y0M A;  2H8H A;  3RIR A;  4PJO D;  3QPH A;  5I11 A;  1VQO Q;  2BZX A;  4PJO F;  3JCM b;  2CP2 A;  3R6N A;  3M9Q A;  3G4S Q;  5D6X A;  4J9G A;  1XNI A;  2LNV A;  5GMK h;  1YJW T;  3EGX B;  5GAO n;  4FT4 A;  3OYH A;  1OOT A;  1Y96 B;  5IHN A;  2GCX A;  3OSS C;  2XG8 D;  5GMK e;  1UE9 A;  2KT1 A;  4EMK A;  1JB0 E;  1VQO T;  2D0Q B;  2KRN A;  2DET A;  3S3M A;  2OTJ A;  2EIF A;  4XTW A;  2DIQ A;  4EPC A;  3G4S T;  4RTT A;  1KQS A;  2DL4 A;  1NJI C;  2DL7 A;  2J6F A;  1XJW B;  4N4G A;  1WHM A;  4HT9 A;  2NYS A;  3KUF A;  1G8X A;  2RQV A;  3OYM A;  1BYM A;  1ZBJ A;  5ECA A;  1R0B G;  1PG5 B;  3JRZ A;  2M16 A;  1YIT A;  2KEA A;  1OPL A;  1X75 C;  2J06 A;  2JTE A;  3JB9 J;  4IIO A;  3WXM B;  2XK0 A;  2GTJ A;  1M3A A;  3WVE B;  3PTA A;  2H3J A;  1FXX A;  2DVJ A;  4Q5W A;  1UGP B;  1QVP A;  1MGQ A;  1XQH A;  2Y90 A;  4C0F A;  3E9G A;  3QXE B;  4E7S A;  4DQ2 A;  3L2V A;  2E5K A;  4J9F A;  1KC8 U;  2K3B A;  4EMK C;  4BI3 A;  3V7R A;  2W10 A;  4FSS A;  3CC2 Q;  1M1F A;  1W6X A;  4MDX A;  1NEG A;  1PRM C;  1O9S A;  1WZO A;  5IHI A;  4Z02 A;  3C0C A;  1NJI U;  1RAA B;  2YRD A;  1QVF A;  2O4X B;  3E9F A;  3CD6 A;  1GCP A;  2LMJ A;  2DL3 A;  5GAN f;  1JO8 A;  1LJO A;  4J7F A;  4QQG A;  2XIC A;  2X51 A;  3PVQ A;  1UTI A;  1SRL A;  2YRV A;  3PE0 A;  1QP3 A;  4JLG A;  1NYG A;  2JTF A;  2ESW A;  2DZ9 A;  3CC2 T;  3P8H A;  2LQ8 A;  5A0D A;  1UEB A;  4FU6 A;  2YUQ A;  4PJL A;  2HQE A;  1H64 1;  3VS3 A;  3H8Z A;  5FRM A;  3VS6 A;  1OPK A;  5CK9 A;  2VC8 A;  1K76 A;  4C0D B;  1M2V B;  3I56 Q;  1ACM B;  4NOY A;  3OYJ A;  2DTH A;  1M8V A;  5I2M A;  5A2Q E;  2EPD A;  1Q81 R;  1X2K A;  1AZG B;  3CCL A;  2FB7 A;  4MZT A;  4RKU E;  2LQW A;  3NTH A;  3DLL A;  1X69 A;  2VWF A;  4FL6 A;  3V7C A;  3SEM A;  4AFS C;  1Q95 G;  4FYX B;  2L89 A;  4JZ3 A;  1K9M R;  3OBY A;  2JMA A;  4QKU A;  2RQU A;  1RAH B;  2JJ9 A;  4J9E A;  1Q82 R;  3I56 T;  4JJB A;  1K73 C;  1WI7 A;  4NL3 A;  4KGZ B;  3CCM A;  4ZN3 A;  1Q86 R;  3G1J A;  4QQD A;  1YJN A;  2W0Z A;  3PIP A;  4B9W A;  1VQ6 T;  1RI0 A;  1VA7 A;  1S1N A;  3CCU Q;  3EFR A;  3SFM A;  1JJ2 S;  3CBO A;  2MPX C;  5GAO r;  4PJJ A;  2EJ9 A;  2ENM A;  1VQ4 T;  3L2Z A;  2XI9 A;  3NPF A;  3HSB A;  2RK2 A;  2OJ2 A;  2DMO A;  2RI3 A;  3SHW A;  1VQK T;  2QQ9 A;  2SEM A;  2ED1 A;  2BIV A;  4OMQ A;  2MYS A;  5FRN A;  4LUD A;  2QA4 T;  2GBQ A;  3OMC A;  3VJP A;  3CCU T;  2LT4 A;  3C12 A;  4C92 A;  2P84 A;  2NUP A;  4M75 B;  2D8H A;  4X34 A;  3OB9 A;  4M75 D;  4F7U G;  2EYX A;  3CXC A;  1QKX A;  2ZPG B;  2KYM A;  4M75 F;  1WHG A;  1TG0 A;  2FYK A;  2HAX A;  1VQ8 Q;  1CSK A;  5GMK m;  1QW1 A;  1YIJ Q;  4FYY B;  3FEO A;  4M7D B;  1VQO A;  1KK7 A;  1AHJ B;  2PNI A;  1E6G A;  1WNL A;  2F5T X;  2AKK A;  4M77 D;  3RMS A;  2EGE A;  3G4S A;  4R55 A;  5KYY A;  1LNX A;  2AZS A;  1U06 A;  3LW5 E;  5FU6 C;  3OS1 A;  4C92 G;  1FMV A;  2X4J A;  2RN8 A;  1YIJ T;  1V1C A;  1WGS A;  1G3S A;  4PJO A;  1AD5 A;  2V8K A;  4C92 C;  5KYX A;  3QSU A;  1N9S A;  2ZCF B;  4LDV A;  1H3Z A;  4KH0 B;  4OMM A;  2VAS A;  1ZUY A;  4JRK A;  1U1S A;  2DYI A;  3FIF A;  2LJ3 A;  2A3L A;  3FC3 A;  5KYW B;  1N5Z A;  1UUE A;  5LJ5 g;  1G5V A;  2KVQ G;  1Z9Q A;  2DTI A;  2LX9 A;  1QKW A;  4J9C A;  3C95 A;  1BBZ A;  2DRM A;  1K8A U;  2X4W A;  3OYF A;  1OEB A;  2FVU A;  4JPB W;  2CZ7 B;  4B6M A;  3OYE A;  2HDA A;  4OML A;  5M9O A;  2EBP A;  3EG0 A;  3EAE A;  2A0F B;  3ULR B;  1Q7Y U;  3ZL7 C;  2M51 A;  4RTW A;  2DER A;  3EFS A;  2DVE A;  4FYW B;  4PJO G;  1IRX A;  1QCO A;  4E7K A;  3L2W A;  4A63 B;  4DBF A;  4IUV A;  4OGC A;  5KE2 A;  3CCE T;  2D0N A;  3MEA A;  1I4K 1;  4PJO C;  3CC2 A;  1CKA A;  1QP2 A;  2RQW A;  5C0M A;  1KQ2 A;  3N5B B;  2DLP A;  3MET A;  4C8Q D;  2DJQ A;  8ATC B;  3QYG B;  1SEM A;  2DAQ A;  2C06 A;  3HFN A;  2E10 A;  2RHY A;  2V8I A;  1PRL C;  2EGC A;  5GAN 2;  3IQL A;  4HCK A;  2DBM A;  1NEB A;  2EYY A;  1MMG A;  1WYX A;  3LGF A;  2HSP A;  2KDS A;  2ZPI B;  2VKN A;  1K4U S;  2B8A A;  2CZ1 B;  2B86 A;  2M9U A;  4LN2 A;  1TXQ A;  1UEC A;  1AWX A;  2K6D A;  2QK0 A;  4JZ4 A;  2CGH A;  4OB1 B;  1U5S A;  1WXU A;  2IPO B;  3I56 A;  3AHU A;  1JEG A;  3CXC P;  3MEV A;  1VYT A;  1C6V X;  3I5R A;  1UDL A;  1PC0 A;  3M53 A;  5GAO l;  1N8R C;  3G71 Q;  1U3O A;  3TSW A;  1ZUK A;  3GP8 A;  2HZY A;  3I55 Q;  2O01 E;  1WHH A;  3M0P A;  2EFI A;  4BY6 C;  1AZE A;  4PKC C;  3UA6 A;  4BDY A;  3NHN A;  1RLQ C;  1W1F A;  3EFO A;  1PSF A;  2MWP A;  1WPY A;  2K5F A;  5KYN A;  1YFN A;  1V29 B;  2DRK A;  3SWN B;  3CCU A;  4IUU A;  3G71 T;  2HBW A;  1M90 R;  1M1K R;  2RF0 A;  2KQW A;  2LVM A;  2OAU A;  2JS0 A;  2PZ1 A;  4PJN A;  1SF9 A;  3V8L A;  2IIM A;  2J6K A;  3QZ9 B;  3DKM A;  4A4G A;  1SKU B;  1PWT A;  4II1 A;  1JRI A;  5FU7 C;  5LJ3 f;  3OYD A;  1GRI A;  3GLX A;  1H8K A;  3A8O B;  1X6O A;  3EG9 B;  5EC7 A;  2KBT A;  4M7D E;  1ZQ1 A;  2KXD A;  2MCN A;  3I35 A;  2CKK A;  4XU0 A;  3OYK A;  3ZBD A;  2DX1 A;  4E7J A;  2L0A A;  2P0P A;  3JCM g;  2HQH A;  4DBR A;  2IG0 A;  2BZ8 A;  4FCY A;  2HKN A;  2DYB A;  4F04 B;  4C0G A;  2CUB A;  1VQ8 A;  3NMZ C;  3OQ5 A;  3TQ7 P;  3QG1 A;  1YIJ A;  1N6A A;  4PJM A;  5LJ3 g;  4M7A B;  3OYC A;  2EAY A;  2DK3 A;  4M7A D;  1CKB A;  1J3T A;  2NLU A;  5FWC A;  1WHL A;  1KD1 U;  2QQA A;  4M7A F;  3UT1 A;  3GNG A;  5I2S A;  2K79 A;  2FPD A;  3X28 B;  2K4Y A;  1PM3 A;  2L3R A;  2VXE A;  3VUZ A;  2PVD B;  2EQJ A;  1JJ2 A;  3PMI A;  4MZP A;  1KHC A;  4RTV A;  4Z8A A;  4DEY A;  3HRS A;  3JSC A;  4KBM B;  5D6W A;  2IVW A;  3BY7 A;  4IKF A;  2F2X A;  1AEY A;  3EHR A;  1I5L A;  2DL5 A;  4M77 A;  2XDP A;  5CR2 A;  1OX8 A;  2V1Q A;  4J6W A;  4A4H A;  1SHG A;  4J6Y A;  5FRO A;  4JJC A;  2JMC A;  1YJN T;  4B9X A;  2QTX A;  4EMH A;  2E12 A;  2P0K A;  5KH6 A;  2LJ1 A;  1AT1 B;  3L2Q A;  2GFA A;  2G6F X;  2LCC A;  4M75 G;  1NE8 A;  2JN0 A;  2A7Y A;  2CRE A;  3EG3 A;  4LDY A;  1D0X A;  2ATC B;  1X01 A;  2EGA A;  3ZEH A;  2DKG A;  4C5H A;  3L2R A;  1ZBX A;  3M0T A;  2PQW A;  2CDT A;  4BI8 B;  1SG5 A;  3M0Q A;  4CRI A;  3X20 B;  1SSH A;  4WF2 A;  4QW2 A;  2I0N A;  2QG9 B;  4GY5 A;  1D1A A;  1BIA A;  2JNG A;  3ER0 A;  3HHT B;  4L5G A;  4M77 G;  3VS0 A;  1D3B B;  4AT1 B;  4LD9 K;  1BI0 A;  1FX7 A;  3CBP A;  1Z9Z A;  1YCY A;  5GAO p;  3MP6 A;  4M77 C;  4JS5 A;  5I21 A;  2M0O A;  5A0L A;  2EVR A;  5GAM f;  2CS7 A;  2BKD N;  5FWB A;  3CC7 Q;  3TU4 K;  4EIK A;  2DXU A;  4XTX A;  4M4Z A;  4C8Q A;  2CP6 A;  2DA9 A;  1X43 A;  3M56 A;  3GF5 A;  4MZM A;  2FRW A;  2EQM A;  4C0Z A;  3QII A;  1B3Q A;  3CC7 T;  2YUO A;  4XU3 A;  4V2S A;  5GAM g;  2PUO B;  2C0T A;  1I5O B;  2CUD A;  5CAI A;  3CCS Q;  2RB6 A;  3G71 A;  3X26 B;  1BCM A;  1EIF A;  2M02 A;  3PMT A;  1VYU A;  3JCM J;  1Q81 C;  1TOV A;  2F69 A;  4BB7 A;  5LJ5 h;  3I55 A;  5GAO q;  1BB9 A;  2E4H A;  3FRN A;  4IUP A;  2OTL Q;  2E64 A;  2K5I A;  2XID A;  1QWE A;  2NUT B;  1VQP Q;  5AT1 B;  4C8Q G;  1JJ2 P;  5LJ5 e;  2RO0 A;  5CKF A;  4O5V A;  1K9M C;  4X9D A;  4J6X A;  5LJ5 d;  4ZGE B;  1IXD A;  1VQN Q;  2Y4Y A;  1Q82 C;  1JXO A;  1R77 A;  2FG0 A;  2EYW A;  1WJR A;  3VS7 A;  4C8Q C;  1BK2 A;  1DJ7 B;  1WHJ A;  2QGG A;  1Q86 C;  4J9H A;  3PVL A;  2VGN A;  1D0Y A;  4UC4 A;  1WIE A;  5FW9 A;  3UWN A;  2JVV A;  2E5Q A;  4JDS A;  1UHF A;  2R5A A;  1KC8 R;  4VUB A;  1YWO A;  2LRQ A;  3UPU A;  1ZLM A;  1D09 B;  2KI7 A;  1G3T A;  2JUF A;  2JXB A;  4M7A E;  2QTV A;  2DIL A;  1NG2 A;  4ATO A;  2KR3 A;  2HBP A;  4QVD A;  1F1B B;  1TUG B;  4X9C A;  4LDX A;  1IB8 A;  1IRE B;  1R0C B;  1AWJ A;  4DOV A;  3G6E Q;  2DL8 A;  4IUR A;  1KQ1 A;  2MIO A;  2CP3 A;  5GAN g;  3JAM E;  3E19 A;  3MP8 A;  2RM4 A;  3V8K A;  2D1X A;  3M4Y A;  5CO7 A;  5LJ3 j;  3OYL A;  2C0I A;  1W4S A;  1BI3 A;  1TTH B;  2DBK A;  3NFC A;  8AT1 B;  2F2V A;  2FZK B;  2Z0W A;  4MML A;  2YDL A;  4WCI A;  3VU3 C;  3MKD A;  3CCR Q;  4F7U A;  1ZSZ A;  2AT1 B;  3EGD B;  1UGV A;  1ZUU A;  1RAC B;  1PKT A;  1YWP A;  1SRM A;  2A08 A;  5KE3 A;  4AMC A;  1IHW A;  1ZA2 B;  1G83 A;  1Y7X A;  2XMF A;  3CCQ Q;  4JJN K;  4ZGJ B;  5CIU A;  3J81 E;  2E65 A;  2FEI A;  3LH5 A;  1W70 A;  5DM7 R;  3EG2 A;  4QQ6 A;  2QI2 A;  4C5G A;  3C4S A;  5DLQ E;  1LVK A;  2YXY A;  1PCX A;  3RES A;  1O75 A;  3QHS A;  3UDC A;  4A4K A;  2EQU A;  2ZGW A;  1K73 U;  3HL8 A;  4J83 A;  3ME9 A;  1PD0 A;  5GAN 4;  3QO3 A;  4IIM A;  1ZSZ C;  1QVG S;  1RAF B;  1WQ7 A;  1NLP C;  1WXB A;  2COW A;  1RLP C;  2FO0 A;  4OMN A;  3RUX A;  1P92 A;  3LGL A;  2NWM A;  2DD4 A;  4M7A G;  2HL3 A;  6AT1 B;  5KYU B;  1MUZ A;  4LD6 A;  4M78 B;  4M7D D;  2DXT A;  1PNJ A;  2FZG B;  2JM8 A;  2KRO A;  2YRC A;  5GMK l;  2KNB B;  4OMF B; 
#chains in the Genus database with same CATH homology
 4M7D F;  4BUG A;  3MEV A;  1VQN T;  3JCM h;  5J39 A;  3OYY A;  2OTL T;  4FM4 B;  1TH7 A;  3OSV A;  3PFS A;  3OYB A;  2LTO A;  1N27 A;  2YLC A;  3M53 A;  3CCM T;  2EWN A;  2XKO C;  2K3X A;  2LDM A;  1NZ9 A;  3PGG A;  5IAY A;  5FU7 B;  5GAO l;  1VQP T;  2DJZ A;  1N8R C;  1UGQ B;  3G7Z A;  3M54 A;  1VQ8 T;  2M1H A;  3QKJ A;  3HFO A;  1VQ7 A;  5LJ5 j;  3JCM e;  3L1A A;  4HA8 A;  2K2V A;  4TVR A;  4R56 A;  4F7U E;  3R6O A;  3GP8 A;  3CCE A;  3LLR A;  4HKE A;  3DB3 A;  4OF1 A;  1Q81 U;  2RJC A;  2DIG A;  5CVI A;  4BD3 A;  2O01 E;  3JCM d;  4XU1 A;  4ELZ C;  4RMO A;  3SWN A;  3GPL A;  3LYI A;  2VUB A;  2EFI A;  4XK8 E;  4BY6 C;  4M78 G;  4PKC C;  3CC7 A;  4C8Q E;  2ZPH B;  4BDY A;  1BI2 A;  3GOX A;  2E70 A;  3S3N A;  4BDZ A;  5KCO A;  1NPR A;  2EYQ A;  3JCM X;  2FHD A;  1HK9 A;  1S72 A;  4C5E A;  5LJ3 e;  1PSF A;  5FLX E;  1OZ2 A;  3T9N A;  2XHC A;  1MHN A;  2L8D A;  2QXF A;  1ZHI A;  4M78 C;  4XTY A;  2MWP A;  1WPY A;  2K5F A;  5LJ3 d;  2QEX A;  1K9M U;  1V29 B;  3SWN B;  3CCU A;  3RIR A;  5IT9 E;  4IUU A;  5CKB A;  2VYT A;  3G71 T;  1Q82 U;  4PJO D;  3HPW A;  3QPH A;  2KQW A;  2LVM A;  2OAU A;  3CPW A;  2WSC E;  3V8L A;  3QZ9 B;  4OMF B;  4PJO F;  1Y96 A;  1Q86 U;  3DKM A;  3A5Z B;  3RKW A;  4A4G A;  3JCM b;  4NS5 A;  4II1 A;  3M9Q A;  5FU7 C;  1JRI A;  5LJ3 f;  3CMA A;  5D6X A;  3OYD A;  2XDD A;  3P8B B;  2R5M A;  3GLX A;  4PLL A;  3RER A;  1XNI A;  2LNV A;  5GMK h;  3A8O B;  3G6E T;  1YJW T;  4C92 E;  5GAM j;  1KG1 A;  5GAO n;  4FT4 A;  1JBM A;  3A8M B;  1G3Y A;  1X6O A;  3OYH A;  4JRP A;  4BE1 A;  3LH0 A;  3CME A;  3O8V A;  1Y96 B;  2DO3 A;  2GCX A;  4M7D E;  3OSS C;  3CCJ A;  2DXB A;  1ZQ1 A;  2WAC A;  2XG8 D;  5GMK e;  4EMK A;  2CKK A;  3KBG A;  1JB0 E;  1VQO T;  3A8L B;  2D0Q B;  4Y28 E;  1BI1 A;  2RK1 A;  4XU0 A;  3OYK A;  3FJP A;  3ZBD A;  3Q1J A;  4N4I A;  4E7J A;  2MF2 A;  3JCM g;  2EJF A;  2P0P A;  4ELY C;  3S3M A;  2OTL A;  2K5L A;  1VQ5 T;  4M7A A;  2EIF A;  2BUD A;  2IG0 A;  4XTW A;  3SWN C;  2OTJ A;  2DIQ A;  4OP0 A;  3INZ A;  4EPC A;  2CZ6 B;  3G4S T;  3BDL A;  4C0G A;  2HQX A;  2VV5 A;  3OS0 A;  1VQP A;  3RKY A;  1KQS A;  1VQ8 A;  4FSX A;  1NJI C;  3OQ5 A;  3CCR T;  3QG1 A;  4EMK B;  5DY9 A;  4L59 A;  1YIJ A;  4HCB A;  1N6A A;  4N4G A;  4HT9 A;  3DB4 A;  1VQN A;  3KUF A;  5LJ3 g;  4M7A B;  3OYM A;  3C94 A;  5CQY A;  3OYC A;  2EAY A;  1PSE A;  2DK3 A;  1BYM A;  2AHJ B;  3JB9 D;  2YHT A;  4M7A D;  3JRZ A;  2RI2 A;  2NLU A;  2M16 A;  1I8F A;  4J7I A;  3TRE A;  1YIT A;  3JB9 F;  1KD1 U;  2QQA A;  3A8G B;  4M7A F;  3UT1 A;  3VYG A;  3GNG A;  2RI5 A;  2X35 A;  1X75 C;  5I2S A;  4MDW A;  4QVZ A;  4DOW A;  3JB9 J;  1UGS B;  2FL7 A;  3HKS A;  2PVG B;  3WXM B;  1M90 C;  2XK0 A;  3X28 B;  2K4Y A;  1M1K C;  2L3R A;  3VUZ A;  2QQB A;  2VXE A;  3CCQ T;  3PNW C;  2PVD B;  4FIB A;  2EQJ A;  3WVE B;  3L42 A;  3JCM P;  4PJO E;  4RG8 A;  1JJ2 A;  5DLO A;  3PTA A;  3PMI A;  3A8H B;  4MZP A;  2G3R A;  1FXX A;  2H3J A;  4KUI A;  4Q5W A;  1UGP B;  3LWI A;  3QBY A;  3JB9 I;  1KHC A;  1QVP A;  1MGQ A;  3OS5 A;  1XQH A;  3DLM A;  3CPF A;  2Y90 A;  3GNF B;  4C0F A;  4KT0 E;  4LDW A;  3E9G A;  4ZTF A;  3QXE B;  4PL6 A;  4DQ2 A;  1OZ3 A;  3L2V A;  2RA2 A;  2O4X A;  5GAN 8;  1KC8 U;  3HRS A;  3JSC A;  4KBM B;  5D6W A;  4M78 D;  2IVW A;  4EMK C;  3BY7 A;  4IKF A;  4BI3 A;  3V7R A;  3G6E A;  1YJW A;  1M1F A;  4P5N A;  4M78 F;  1I5L A;  2PU9 B;  4M7A C;  2R57 A;  4M77 A;  2XDP A;  1O9S A;  5CR2 A;  4JS4 A;  4MDX A;  4Z02 A;  5GAN 6;  4J6W A;  5GAN j;  1NJI U;  3CCV T;  5J26 A;  4A4H A;  1QVF A;  4J6Y A;  5FRO A;  2O4X B;  3E9F A;  4XU2 A;  3OYG A;  1YJN T;  4B9X A;  3CD6 A;  4IUQ A;  2QTX A;  4EMH A;  2E12 A;  2P0K A;  3M4G A;  5KH6 A;  5GAN f;  2DZC A;  2MWO A;  1LJO A;  5LJ3 h;  4J7F A;  3L2Q A;  2GFA A;  4M77 B;  2VGM A;  1OYX A;  2L5Q A;  2XIC A;  4QQG A;  3CPW S;  3QJ6 A;  1K8A C;  2YRV A;  3MHX A;  4OVA A;  5LJ5 f;  2LCC A;  4M75 G;  5GAN 5;  1NE8 A;  1QP3 A;  4JLG A;  2ZPF B;  3QZ5 B;  4M77 F;  2JTF A;  2JN0 A;  2A7Y A;  4KUL A;  3ASK A;  2DZ9 A;  3CC2 T;  3P8H A;  2LQ8 A;  5LL6 S;  4LDY A;  5A0D A;  5C6S A;  1VQM T;  1UEB A;  4FU6 A;  1M1K U;  1X01 A;  3JCM V;  3TEE A;  3ZEH A;  2DKG A;  1Q7Y C;  2K57 A;  2LCL A;  4C5H A;  3L2R A;  1D3B A;  1ZBX A;  1YHQ A;  2HQE A;  2PQW A;  4A4F A;  3CC4 T;  3OMG A;  3SDZ A;  1H64 1;  4BI8 B;  3H8Z A;  5FRM A;  1YJ9 T;  5IN1 A;  1OI1 A;  3X25 B;  4QVC A;  4CRI A;  5CK9 A;  3X20 B;  1VQ9 T;  2VC8 A;  4WF2 A;  4QW2 A;  4GY5 A;  1SSF A;  4C0D B;  2E6Z A;  1BIA A;  2JZ2 A;  4NOY A;  3OYJ A;  2DTH A;  1M8V A;  2JNG A;  5J3B A;  3ER0 A;  3HHT B;  5GAM e;  3I55 T;  4L5G A;  4J8O A;  5I2M A;  4M77 G;  5CKE A;  5A2Q E;  4XTZ A;  1D3B B;  4MMK A;  5GAM d;  1YI2 T;  3CCQ A;  4LD9 K;  3CCL A;  1BI0 A;  1FX7 A;  4EDU A;  3CBP A;  1R8O B;  2FB7 A;  1YCY A;  3HRU A;  4ME7 A;  4MZT A;  2PUK B;  3MP6 A;  4RKU E;  3NTH A;  5A0G A;  5GAO p;  3M59 A;  2QQS A;  1UGR B;  3MCA B;  4M77 C;  4JS5 A;  1KQS S;  3L2U A;  3DLL A;  3CCS A;  2P4T A;  5I21 A;  2M0O A;  4FL6 A;  3V7C A;  1N8R U;  4HCC A;  5A0L A;  2EJG A;  5GAM f;  4M78 E;  2ZPB B;  2ZPE B;  2DD5 A;  3MEW A;  2L89 A;  3OBY A;  4CI0 C;  4HCZ A;  3MP1 A;  2CS7 A;  2BKD N;  3I56 T;  2QDY B;  5HKC A;  1K73 C;  4A4E A;  3TU4 K;  4NL3 A;  2DXU A;  4E47 A;  3CCM A;  4ZN3 A;  2E1H A;  1YBY A;  4ZGD B;  3J80 E;  4QQD A;  4BE0 A;  1YJN A;  2MAM A;  4XTX A;  3PIP A;  4C0D C;  4B9W A;  1VQ6 T;  1RI0 A;  1W2B A;  3SB2 A;  3EFR A;  3SFM A;  5EG2 A;  4C8Q A;  3V7S A;  1JJ2 S;  1LOJ A;  3CBO A;  5GAO r;  5CCA A;  2I2L A;  1VIE A;  4JRQ A;  2EJ9 A;  2LC4 A;  1WJQ A;  1XOV A;  2CZ0 B;  2RHX A;  3M56 A;  3GF5 A;  2RHI A;  4MZM A;  1VQ4 T;  3L2Z A;  4IUT A;  2XI9 A;  3NTI A;  2EQM A;  3CBM A;  3H6Z A;  2EQK A;  4C0Z A;  2HD0 A;  3M57 A;  2R58 A;  2RJE A;  3HSB A;  2RK2 A;  3QII A;  1VQM A;  2RI3 A;  3CC7 T;  2RHU A;  4C8Q B;  4XU3 A;  1HXD A;  1M9S A;  3GIB A;  4M75 A;  5GAM g;  1VQK T;  2PUO B;  4V2S A;  2DXC A;  2QQ9 A;  3CC4 A;  3QUI A;  2BIV A;  2K3Y A;  5CAI A;  1N9R A;  1YJ9 A;  1S72 T;  4C8Q F;  5GAN h;  2RB6 A;  4KUD K;  3G71 A;  2QA4 T;  3X26 B;  5FRN A;  1EIF A;  3JB9 H;  1QVF S;  3OMC A;  2QEX T;  3BDU A;  3VJP A;  3PMT A;  1VIF A;  3CCU T;  2LT4 A;  3C12 A;  3M55 A;  4PNO A;  3RMQ A;  3JCM J;  4OGE A;  3JCM W;  1Q81 C;  2P0Q A;  2F69 A;  2KMT A;  4BB7 A;  4C92 A;  4JRI A;  5LJ5 h;  3I55 A;  2X4X A;  5GAO q;  3WVD B;  4M75 B;  5FU6 B;  4X34 A;  3FRN A;  4IUP A;  1M4Z A;  3OB9 A;  4M75 D;  4C5I A;  4F7U G;  5GAN e;  2E64 A;  2K5I A;  2XID A;  4FT2 A;  2KY9 A;  4M7D A;  3CXC A;  2RJD A;  3V8J A;  2WSE E;  5GAN d;  1VUB A;  2ZPG B;  3P8D A;  4M75 F;  4A53 A;  2FYK A;  2HAX A;  3VUB A;  1B34 A;  4C8Q G;  5LJ5 e;  5GMK m;  2RO0 A;  5CKF A;  4O5V A;  4C92 B;  4X9D A;  1K9M C;  2XD0 A;  4OB2 B;  1QW1 A;  2GFU A;  4J6X A;  1U1T A;  5LJ5 d;  1M1G A;  3FEO A;  1M5Q 1;  2KK4 A;  2MI6 A;  4LDU A;  4ZGE B;  3JCM Q;  2Y4Y A;  2JOY A;  4E7L A;  1Q82 C;  1WJR A;  3QYH B;  4M7D B;  4C8Q C;  1VQO A;  1DJ7 B;  1AHJ B;  5GAO m;  1Q86 C;  2ZZD A;  5AYF A;  4XAX B;  5KCH A;  1VQ5 A;  1WNL A;  2VGN A;  2F5T X;  4UC4 A;  2QQR A;  3F70 A;  4JUV A;  4M77 D;  5L8R E;  3RMS A;  3G4S A;  4ZTJ A;  3BW1 A;  3HP9 A;  3UWN A;  2JVV A;  4R55 A;  3OYA A;  1G3W A;  2E5Q A;  4JDS A;  3SD4 A;  4HT8 A;  2OTJ T;  2R5A A;  1Y07 A;  1LNX A;  4VUB A;  3CCR A;  1VQ6 A;  3FB9 A;  1M90 U;  4OB0 B;  2LRQ A;  3OBW A;  3UPU A;  1QVG A;  2VXF A;  3PIO A;  3CEY A;  5GAM h;  4BE2 A;  4M75 C;  3LW5 E;  5FU6 C;  3OW2 A;  1G3T A;  2JUF A;  4N4H A;  4C92 G;  3OS1 A;  2X4J A;  4M7A E;  1YIJ T;  1VQ4 A;  4ATO A;  5HY6 A;  4E7H A;  1I81 A;  2HBP A;  4QVD A;  1WGS A;  2GQV A;  5CKH A;  4X9C A;  4GLK A;  1G3S A;  4LDX A;  4M7D G;  4PJO A;  1IRE B;  2V8K A;  4C92 C;  4BI4 A;  2KAF A;  1FWZ A;  1YIT T;  4DOV A;  3QDR B;  1N9S A;  2ZCF B;  1VQK A;  4IUR A;  3VYH B;  4LDV A;  3QSU A;  1H3Z A;  3FDR A;  2LT1 A;  1KQ1 A;  4D6W A;  4M7D C;  2D6F A;  2QA4 A;  3JCM f;  1RL2 A;  5GAN g;  4JRK A;  1U1S A;  3FIF A;  3FLG A;  3E1S A;  2Y4X A;  3JAM E;  3E19 A;  4JLI A;  4PJO B;  3MP8 A;  2RM4 A;  2A3L A;  3M4Y A;  3V8K A;  3S3O A;  5CO7 A;  1WJS A;  3FC3 A;  1W2B S;  5LJ3 j;  3OYL A;  5LJ5 g;  1G5V A;  1BKB A;  1XTD A;  4E7I A;  2KVQ G;  2RHZ A;  4M75 E;  1W4S A;  1BI3 A;  2X4Y A;  2DTI A;  2LX9 A;  1KD1 C;  3NFC A;  4DA4 A;  5GAN 3;  3C95 A;  2F5K A;  1NPP A;  2X4W A;  2EKO A;  3OYF A;  3OA6 A;  1K8A U;  2YLB A;  4MML A;  2FVU A;  3VU3 C;  4N0A A;  3CCV A;  2CZ7 B;  4F7U A;  3OS2 A;  3OYI A;  2E41 A;  3OYE A;  3OY9 A;  2PVO B;  3ZFJ A;  5M9O A;  1GXI E;  3EAE A;  1Q7Y U;  3RKX A;  2JTM A;  2V8J A;  2XU8 A;  3EFS A;  2DVE A;  1WQW A;  3CD6 T;  2E6N A;  4PJO G;  1BIB A;  4M77 E;  4E7K A;  4RCB A;  3L2W A;  4BAC A;  1KC8 C;  5KE3 A;  1VQ7 T;  3PT9 A;  4IUV A;  4F7U B;  1U8R A;  3TCJ A;  4OGC A;  3S6W A;  5KE2 A;  5HK3 A;  3CCE T;  3NTK A;  2CYZ B;  3MEA A;  5GMK i;  2RD1 A;  1I4K 1;  4PJO C;  3CC2 A;  5GMK j;  1Y7X A;  1QP2 A;  5CQX A;  3MO8 A;  4F7U F;  2HNI A;  5C0M A;  4JJN K;  1UB4 A;  3N5B B;  3CXC S;  4ZGJ B;  1KQ2 A;  3MET A;  5CIU A;  4C8Q D;  3J81 E;  2E65 A;  4RCC A;  1Y71 A;  3BFM A;  5HK0 A;  4J5Y A;  4OB3 B;  3QYG B;  5DM7 R;  1KHI A;  4RG2 A;  2DAQ A;  2RH2 A;  4QQ6 A;  3LWH A;  4A54 A;  1YHQ T;  2C06 A;  1VQ9 A;  2QI2 A;  3HFN A;  4C5G A;  1VQL T;  2E10 A;  2LQK A;  2RHY A;  2V8I A;  3C4S A;  5DLQ E;  4O6J A;  4XQ3 A;  4PLI A;  2KSS A;  4XTV A;  3M5A A;  4XTU A;  3RES A;  3URG A;  5GAN 2;  1O75 A;  3QHS A;  3UDC A;  4L6V 5;  4A4K A;  3MEU A;  2DTO A;  3VKI A;  1YI2 A;  3J7A F;  3LGF A;  2EQU A;  2ZGW A;  4EMG A;  1K73 U;  2MMP A;  3HL8 A;  1VQL A;  5GAN 7;  4M78 A;  3CMA T;  4J83 A;  3OYN A;  3ME9 A;  2KDS A;  2ZPI B;  2RJF A;  2DPP B;  5GAN 4;  3CCL T;  3QO3 A;  3M58 A;  3KXT A;  3QJY A;  4N0A C;  2B8A A;  2CZ1 B;  4BY6 B;  2WSF E;  4ZN1 A;  2M9U A;  3JCM c;  1QVG S;  1WQ7 A;  4C92 D;  2XDB A;  5CKD A;  5D6Y A;  2GF7 A;  4NL2 A;  3CCS T;  3CME T;  3OW2 S;  3VV0 A;  3RUX A;  4Y91 A;  1P92 A;  3LGL A;  4C92 F;  3JB9 G;  2DD4 A;  2DEQ A;  4M7A G;  2CGH A;  2D9T A;  4OB1 B;  4M78 B;  4LD6 A;  3CCJ T;  4M7D D;  2DXT A;  3I56 A;  3AHU A;  3HRT A;  3LX7 A;  4YTL A;  5GMK l;  3X24 B;  1B34 B;  1IZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...