1D3BA

Crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
GVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGCKIRFLILPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D3)
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 18
structure length 72
sequence length 72
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 1998-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1d3bA00
5GAOp 3JB9H 2DVEA 1BIBA 4C92E 2CGHA 2DZ9A 4F7UB 5LJ3f 2EJ9A 3V8JA 2EJGA 4JRKA 4PJOF 4PJOC 4XU2A 3L2ZA 3GIBA 2YLCA 4DQ2A 3QUIA 3JCMW 1Y96B 4JUVA 1HK9A 4PJOB 1M5Q1 2YHTA 2RB6A 1U1TA 4MMLA 4F7UG 3VU3C 5GMKm 4PJOD 4N0AC 2VXFA 4XU1A 4A54A 3AHUA 4M7AA 3M4GA 3SB2A 2DXUA 3BW1A 1HXDA 3SWNA 5CAIA 5GAMg 5GANd 3JCMc 3JCMV 4PJOG 4C8QE 5LJ5d 1LNXA 3PGGA 2I2LA 3RKWA 4F7UA 2RM4A 4M78F 4M78C 1N9SA 4M77F 4M77C 4NOYA 5DY9A 3JCMJ 5GANe 5GAOl 4JRIA 3RIRA 5LJ5h 1D3BB 4XTYA 1Y96A 1U1SA 2DKGA 2K57A 4M78B 4XQ3A 4M77B 1JBMA 3V7SA 5LJ5j 3JB9J 4PJOA 3HFNA 3INZA 4M78D 3EFRA 4M77D 3RESA 1KQ1A 1KQ2A 4MMKA 2E65A 5GAMf 4QVDA 3JCMX 2DTIA 2ZGWA 2EWNA 3QO3A 2JN0A 5LJ5e 2E64A 2DTHA 4J5YA 4XTVA 4M78G 3V7RA 3EFSA 4XTZA 4M77G 3BDUA 4M75E 1X01A 2E10A 3JCMd 3V7CA 2EJFA 3RKYA 5GMKe 4M7AE 2E41A 3L1AA 4RCBA 1MGQA 1M8VA 2YLBA 3JCMb 4C8QF 4C8QC 5I21A 1D3BA 4M78A 1YCYA 4F7UE 4J6WA 4M77A 3JCMe 4PNOA 3QHSA 4JLIA 4NL3A 4C8QB 4HT9A 4M7DE 5GANh 5GANj 3QSUA 5LJ5g 1I8FA 4XTXA 4C8QD 4C92C 4C92F 5GMKl 5LJ3d 5GAN2 1LJOA 5GAOr 4XTWA 1BIAA 3V8LA 4C92B 5GAOm 1WNLA 3RUXA 3JB9F 3JCMP 4NL2A 3BFMA 4C8QG 4C92D 4EMKC 5GAN6 5LJ3e 5LJ3j 3HFOA 4N0AA 5GMKi 3FB9A 4M75F 4M75C 5GAMe 4QVCA 4EMKB 2FYKA 5GANf 3JB9D 4M7AF 4X9CA 5GMKh 4M7AC 4C92G 4V2SA 4C8QA 5GMKj 5LJ5f 5GAN5 4RCCA 4WF2A 2DEQA 3JCMQ 4M77E 3JB9G 4M75D 1H641 3JCMg 1N9RA 3JCMh 3FJPA 5GAN7 4M7AD 1I81A 4HA8A 4M7DF 4M7DC 1LOJA 1B34B 1WQWA 4C92A 5GANg 4HT8A 1TH7A 4EMHA 1WQ7A 4XU3A 1JRIA 1I4K1 4M75G 2FB7A 2DXTA 4Y91A 4M7DB 4PJOE 4M7AG 5GAOn 2VC8A 5GAOq 3RERA 2EAYA 4X9DA 3RKXA 4M7DD 4EMKA 5GAMd 3BY7A 1WPYA 5LJ3g 1I5LA 5LJ3h 4M75A 2RD1A 4EMGA 2DJZA 4XU0A 3JCMf 2QTXA 2DZCA 2VXEA 4M7DG 4J6YA 4XTUA 3FIFA 5GAMh 4OP0A 5GAN3 4J6XA 5GAMj 3HSBA 2DTOA 1B34A 3SWNC 2RA2A 2HNIA 4M75B 3V8KA 4A53A 2E1HA 5GAN8 5GAN4 4F7UF 4M78E 4M7AB 3JB9I 4M7DA 2Y90A 3SWNB
chains in the Genus database with same CATH superfamily
3OBYA 1Q7YU 2JNGA 4HVWA 1T0JA 2K2VA 3LH0A 2R58A 3JCMW 2NUZA 4C0DB 3I55A 1AWJA 2JZ2A 3GNFB 3OYLA 1PHTA 1KQSP 4M7AA 3M4GA 1VQ5T 1UHCA 2DBKA 2XI9A 3OW2A 3H8ZA 8AT1B 2H3EB 3KXTA 1WZOA 2K57A 4QVZA 4HKEA 1S72A 1LCKA 3A8LB 3A5ZB 4RTXA 2FPFA 3I5RA 3OQ5A 2E70A 3PTAA 1JB0E 1MGQA 2EIFA 4C8QF 5KH6A 3CPWA 2GGRA 5J39A 1QVPA 4NL3A 4AG1C 2KI7A 4KUDK 4E7KA 3EFOB 5DLQE 4GY5A 3JB9F 3JCMP 2GNCA 4GLMA 2MI6A 7AT1B 3KBGA 1PCXA 3HFOA 2DE0X 5GMKi 3CMEQ 5GANf 3OYNA 4OMOA 2RQRA 1PD0A 1H641 5GAN7 3EG9A 1QMCA 2ABLA 5I11A 5FU7C 4ZGEB 1U8RA 2ROLA 1W70A 1I5OB 1Q81C 4LE9A 2VKNA 2IVWA 2EPDA 1TS9A 5GAN3 5GAMj 2CT4A 3LLRA 2RQUA 2AKKA 1VYTA 2DL8A 1NLPC 2QYZA 1AZGB 2EJ9A 3I55Q 4EDUA 1QW1A 1ZBJA 3CCQA 4DQ2A 4OMFB 4R0KA 4E6RA 3UF4A 4PJOD 5CIUA 2I0NA 3CCLT 1VQMT 4RTTA 2LCLA 4KT0E 4C0GA 1G3WA 2HD0A 3OMGA 1BB9A 2O2OA 2MOXA 3RESA 2EQKA 3SDZA 4FT2A 1K73R 4J5YA 3SHWA 2JVVA 4M78G 2DIQA 3G6ET 3BDUA 1X01A 2XG8D 1XJWB 5GMKe 2LQ8A 3M0QA 4A4EA 1NYFA 4M4ZA 5IHIA 3X25B 1BKBA 1K0XA 1IB8A 1Y0MA 2FHDA 5GANj 3EGXB 2KY9A 1XOVA 4ZN3A 5GJWB 2KR3A 1SPKA 1F1BB 2LT4A 4BB7A 2CYZB 3ER0A 1VIEA 2EFIA 2KRMA 1C0MA 3MCAB 2EKOA 2E6NA 4CRIA 1VQ6A 2KE9A 1SHGA 2IIMA 3CCST 1R8OB 2DEQA 3EFOA 4M75D 4R55A 5FRNA 1M1GA 3PMTA 4HT8A 1VQNA 2Y4YA 5IXFA 1KC8C 4LUEA 2DYBA 4X9DA 2JTEA 4B6MA 5LJ3h 2LC4A 4CC3A 2GCXA 2JM8A 1K76A 3PIOA 1YITT 4PFOA 4BACA 3I9QA 5GAOp 1KC8U 3VS6A 2KRNA 3NTKA 1JJ2P 3OW2P 1TG0A 4C0DC 4PJOF 3L2ZA 2JMCA 4E7ZA 2JS0A 3LWHA 4LD9K 2B8AA 4MMLA 5KYNA 2VYTA 1M1FA 4LDUA 2YUQA 5CVIA 1Y57A 1Q86R 2CSIA 1HXDA 5CK9A 2K5IA 1TU0B 1ZHIA 2QDYB 4DBQA 3M9QA 2CZ0B 4KRTA 4M78B 4VUBA 5LJ5j 3CPWP 1D0XA 2GQVA 2PQWA 3OB9A 4M77D 2DYIA 1SRMA 1FMKA 1KG1A 2DTHA 2QGFB 2E10A 4FSSA 2EJFA 1TUCA 1VQ7A 3J80E 5CKEA 8ATCB 4MZPA 4BDYA 4JLIA 2A08A 2LT1A 5LJ3d 2ED0A 2OTLA 1I1JA 4XTWA 1BIAA 3TU4K 1SHFA 2OAUA 1VQ6Q 4C92D 1AVZC 4FW2A 2P84A 4XK8E 4M75F 4KGXB 2CT3A 4IIMA 4F04B 2MWPA 4WF2A 1SF9A 1NYGA 3EGXA 1X69A 3L42A 1VQNQ 3LYIA 3FJPA 1O75A 4M7AD 1LOJA 1JQQA 1G5VA 1JRIA 2LQNA 4FYYB 4BY6B 2A3LA 2DAQA 3BDLA 4A4FA 2HKNA 3QZ9B 4M7DD 1FYNA 3EHQA 1GBRA 2X4YA 2CS7A 3LW5E 1ZLMA 5DM7R 2RQVA 2AZSA 3UA7A 1VQKT 3QDRB 1OZ2A 2GBQA 1ZBXA 2GF7A 5CQYA 3N5BB 1W2BA 3CCVT 2JT4A 1M5Q1 4KH1B 3P8BB 2D0NA 4K11A 4QT7A 3G4SA 4J9FA 3A8OB 2C06A 3EHRA 4OB0B 1GCQA 4J9HA 1M30A 4M77F 4PJLA 5DY9A 5GAOl 3JV3A 3OMCA 1JBMA 4OB2B 1WXUA 2DPPB 1YNZA 3C94A 3DLMA 2J6KA 3EFRA 2XMFA 1ABOA 1KQ2A 1TOVA 4D6WA 2JN0A 3M4YA 1VQ7Q 2E64A 1VQ9A 2ESWA 1RUWA 2DO3A 2VASA 3QBYA 3V7CA 4ANJA 2KBTA 2C0IA 2D1XA 1VQLA 1M8VA 4M78A 1FWZA 1M1KC 2OTLQ 2P0KA 4C92F 3E1SA 1LJOA 1X2KA 2OTJA 1D1CA 1NJIC 4C5EA 2BZXA 3UATA 5KYWB 2P4TA 3CCMA 4L59A 1M90R 4KBMB 5LJ3e 3CC7A 3CMAA 4J7FA 1YHQT 4M7AF 1UGPB 3VS2A 3PNWC 4RCCA 1VQPA 2PTKA 3P8HA 3VS7A 1VQ4T 3FC3A 3NHNA 2M9UA 4M7DF 3AT1B 1AHJB 5I22A 2FB7A 2LP5A 2HKQB 4ZGJB 2DMOA 1PNJA 3I56T 2FVUA 2M51A 4RTWA 1UECA 2M0YA 1M4ZA 2QA4T 2M16A 1WHGA 4J6YA 2DILA 3M56A 1NM7A 3OYIA 2HNIA 3V8KA 5D6WA 4R56A 1PKSA 1QCNA 5FU6B 5IHKA 3CD6A 1GCQC 1WGSA 1UTIA 3MHXA 3JB9H 5CCAA 5LL6S 3KFVA 2JTFA 4PFZA 3GIBA 3G4SQ 3M59A 2MCNA 3VS0A 3H41A 4X34A 2CZ6B 2FRYA 1UGQB 3BW1A 5GAMg 1FXXA 3PGGA 1O9SA 2G6FX 3E9FA 2ZZDA 4M78C 1TSFA 2EBPA 4WTOB 1WHHA 5IHNA 3GP8A 1VQ9Q 3G71T 3CQTA 3X26B 1VQOQ 2XDPA 3HPWA 5KYYB 3OY9A 1C1AA 2E5QA 1VQLQ 2RHYA 5C0MA 1Q82R 4HVUA 1H8KA 2XHCA 2E41A 1Y07A 2V8JA 1OEBA 5FLXE 2XKOC 2RN8A 4Z88A 4Z02A 2DETA 2OTJQ 1YP5A 3CCJA 2DIGA 1X75C 3PVLA 1YJNQ 2RJCA 3H0FA 2LJ3A 2ZPFB 3CMAQ 4O6JA 3MP6A 4DEXA 5GAN6 1VQPQ 4HCZA 5HCKA 2RO0A 2R5MA 1KFZA 1UB4A 4ESRA 4IUQA 2LJ1A 3M53A 1N8RC 1YJ9T 5CO7A 5GANg 5KYWA 2WSCE 4XU3A 4Y91A 2KGTA 2V8KA 1X27A 3REAB 4OGEA 1KD1C 3BY7A 2RI3A 1PSFA 2DL3A 2G3RA 3M0SA 1PSEA 1NZ9A 5DLOA 3CD6Q 2F2VA 1N8RU 5GAN8 1K9MR 1WDXA 2CGHA 4ELZC 4KGVB 1KD1U 3GLXA 1RAHB 4JUVA 1V1CA 1HK9A 4TVRA 4Y92A 1QCFA 4F7UG 2VXFA 1W2BS 4J8OA 5CQXA 2CUDA 1YBYA 3QPHA 2DXUA 4J9DA 1TUDA 3CCRA 4L6V5 3CXCA 1WFWA 4MZTA 4E7IA 2LX9A 3OYMA 2LVMA 2YDLA 4J9GA 4BUGA 3RIRA 4J9BA 4XQ3A 1Q7YR 3CMET 1X6OA 2D9TA 1PM3A 3INZA 5GAMf 4QQDA 1S1NA 3LX7A 2H3JA 2JTMA 3CBMA 4XTZA 3C4SA 4JDSA 1X43A 3RKYA 1RAFB 2BE9B 2DL7A 2RH2A 1JJ2A 1OZ3A 4MDWA 3QHSA 1NPRA 4JJCA 5LJ5g 4LN2A 5KYYA 2YRCA 3A98A 2IPOB 2KRSA 3LH5A 3NFCA 3PFSA 1OULA 2MF2A 2FO0A 3RUXA 4C8QG 2RF0A 1ABQA 3A8GB 3G7ZA 2YUNA 1KQSS 2LCCA 2COWA 3I55T 4RTZA 4CC2A 3X24B 2CP6A 2BZ8A 1BI3A 3JB9G 3JCMg 2M02A 2O9SA 4A4KA 2XK0A 1RI9A 1UGVA 2EYZA 1JEGA 4HVVA 4JJDA 3OYDA 1QQJA 2QQRA 4ZNXA 3VV0A 3LGLA 1M2VB 1NE8A 3OA6A 1HSQA 3D7SB 3JRZA 3MEUA 3EGDB 5FU6C 3HSBA 1Y71A 3O8VA 2CSQA 3PE0A 2CUBA 5I2SA 1PG5B 3QZ5B 2Y90A 3FB9A 4Z8AA 4E47A 2DVEA 2X35A 1GRIA 4F7UB 3P8DA 2K4YA 2LJ0A 5M9OA 4KH0B 1YIJT 1Z9ZA 2RB6A 1MUZA 2EGAA 1NEGA 4DBRA 3UA6A 3CCRQ 2JMAA 4BI4A 1VQ8A 3QG1A 4E7JA 2HDAA 1QLYA 3C12A 3MP8A 1CSKA 2V8IA 3JCMJ 4KUIA 4FYXB 4DOWA 2QEXT 3CCLA 2KQWA 1VQMA 1Q81R 3TQ7P 2MWOA 1W4SA 3OS2A 2JXBA 5CR2A 3R6OA 2RI5A 4BI3A 3M57A 4BE0A 4F7UE 4PLIA 2CZ7B 1S72Q 4C8QB 3QSUA 4JJNK 2RI2A 4XTXA 3G6EA 1VA7A 4NL2A 1K73C 1SSHA 5LJ3j 3A8MB 2YWWA 1XNIA 1A0NB 2FYKA 3TVTA 2KVQG 5LJ5f 2A36A 4EPCA 2A28A 3M0UA 1ZSZB 5IAYA 3Q1JA 5KE2A 1I81A 3MO8A 1TH7A 2DVJA 3OYCA 2KEAA 2LCSA 1K73U 2CP0A 1SG5A 2RHUA 2EAYA 1B3QA 1ZUUA 2ROTA 2AZVA 1WPYA 3CCET 1TTHB 4LDVA 3JCMf 2VXEA 1YFNA 4RTYA 5GAMh 2K3BA 2AHJB 3CBPA 1U06A 3CC2T 3JB9I 3CC4A 1YJWT 4LDYA 5AT1B 3CXCP 1M2VA 4XU2A 2X9HA 2YUOA 5KCHA 3EG0A 2DNUA 1VQ8Q 4C5HA 4ZTJA 2YHTA 3EGDA 3C95A 3E19A 1UEBA 1YITA 3CCUA 3AHUA 2CDTA 5CAIA 2JJ9A 1H3HA 4OB1B 4PJOG 4F7UA 5J3BA 2ZCFB 1ZA2B 3RKWA 3E9GA 4OMNA 2E4HA 1UUEA 1UJ0A 1AWOA 3DKMA 1VQ6T 4JRIA 3CCLQ 1D3BB 3CCQQ 1VQMQ 3RNJA 2X4JA 2DXCA 2ZGWA 3OYHA 2EYXA 2M1HA 2VWFA 1VQNT 4ORZA 2HZYA 3RMQA 4N4GA 5HY6A 3A1PA 1Q86C 3E2UA 1YWPA 5IH2A 3JCMb 3G6EQ 1X6BA 1SSFA 1PWTA 4HT9A 5GANh 1JJ2S 3OW2S 1UGSB 1FMWA 2L3PA 5GAOr 4J9EA 2F2WA 2AIRB 1QVFA 5HK0A 1BCOA 2GTOA 5CKDA 3QXEB 2C0OA 1Q86U 1G2BA 1U5SA 1YI2A 1OPKA 2KT1A 1AD5A 3OYJA 4E7SA 1TWBA 4EMKB 4C8QA 1E7OA 2CP2A 2PVDB 3HKSA 2HBWA 3OBWA 1NBEB 4DEYA 2RJEA 3JSCA 4JLGA 1I4K1 4MZMA 4M75G 1MV3A 4C5GA 2JUFA 3CPWS 2ZPIB 4IIOA 2SRCA 3VUZA 2LDMA 2A7YA 1M3AA 2FZCB 3JAME 3UDCA 4GLKA 1NLOC 1WXBA 2FL7A 5D6YA 1ZSZA 2L2PA 5A2QE 3CC4Q 3HHTB 1B07A 2J7IA 3CPFA 4J9IA 4A53A 4OMMA 2XDDA 4M78E 1VQ7T 1SKUB 1OU9A 4JRPA 3CCUQ 2KNBB 4PJOB 5ECAA 1TXQA 3H6ZA 4RKUE 2OAWA 3QYGB 2KSSA 3ZEHA 2OTLT 4A54A 4ATOA 2NUPB 4FYVB 4AT1B 5GANd 2QQBA 3UWNA 1N9SA 4NOYA 3UPUA 5LJ5h 3V7SA 3EAEA 4WCIA 2QXFA 1N6AA 4DA4A 2EQMA 4M77G 3F70A 2XDBA 4RCBA 2D8HA 3ZFJA 1K9AA 1VYVA 1D3BA 2QQAA 4C8QC 1YCYA 3EH2A 1OPLA 3TSZA 2KAFA 4JZ4A 3VYGA 3MEAA 2ZAEA 4HXJA 5L8RE 1MMAA 2PZ1A 3OS5A 1YI2Q 3V8LA 4HCBA 4QQ6A 2YT6A 4BD3A 4BI8B 5GAMe 2P4RA 4O5VA 1WA7A 2RQTA 4IUPA 4C92G 1ZSZC 2VV5A 3M58A 2CP5A 2MPXC 2KROA 1XQHA 4N4IA 3GPLA 4PK4A 2L5QA 1B34B 2EW3A 3QIIA 3FRNA 3NMZC 4M7AG 2D0QB 1YHQA 5CKFA 1M90C 4EMKA 1VQ4A 2K5LA 2DJZA 4Y28E 4JS5A 2KK4A 4M7DG 1WXTA 3MPUB 2GTJA 2XU8A 1UJYA 2E1HA 1M1KR 1VQOT 1BIBA 3V8JA 2QA4A 2EJGA 5IN1A 1M90U 1NJIR 3MEWA 1Q95G 1Z9QA 2O31A 2FEIA 4D8DA 1T0HA 3OYYA 2HL3A 4NS5A 2FZKB 1YJNT 2LNHB 1AZEA 4CC7A 1ARKA 4OGCA 2RJDA 1UFFA 3L2WA 1OOTA 1MNDA 5GANe 5EG2A 1ACMB 1QKWA 3PIPA 4XTYA 1VQPT 1ZX6A 1RADB 4M77B 4Q5WA 1D0YA 4PJOA 5FROA 1IREB 1KQ1A 1WYXA 2NUPA 3L2VA 2ZPBB 1QVGA 1QVFP 2VUBA 2K2MA 2L3RA 3G71A 2CH4A 5I2MA 1KK7A 1Y7XA 1KJWA 4N4HA 1D09B 4RG8A 5C6SA 2L3QA 4L5GA 1H3ZA 5KCOA 1G8XA 3I5SA 3M55A 4C92B 1WNLA 3RBBB 1BI0A 4EMKC 1Q82C 3EG2A 2LX7A 5GMKj 1D1BA 1WLPB 1NG2A 2K3YA 4GBQA 3G1JA 2F5KA 4M77E 5FWBA 3RR6A 4KGZB 2QDLA 1IGQA 4ZTFA 1V29B 1JO8A 1WHJA 4FW1A 3CCMQ 4M7DB 2LQWA 2CREA 4B9XA 3CC7Q 2W0ZA 1Q82U 2K6DA 5LJ3g 2JW4A 1RI0A 4M75A 3ULRB 2BTTA 2LQKA 3OS0A 1YJ9A 2DF6A 3ME9A 4IURA 4CC4B 1AOJA 2L89A 1B34A 2O9VA 3S3OA 1G3SA 1ZUKA 1MMGA 4C92E 3OYEA 2HL5C 4PJOC 1M3BA 2GFAA 2RHIA 3HTRA 2QASA 4N0AC 3HP9A 2NUTB 5GJVB 5D7UA 3H0HA 2ENMA 5FW9A 1AWXA 1WHKA 4AG2C 3HRTA 1K9MC 2JM9A 3MJXA 2DKGA 3QJYA 2AKLA 2NWMA 3HFNA 4QQGA 4MMKA 2E65A 4HCKA 2YRDA 1UE9A 2RK1A 2MK5A 1RACB 3G71Q 2H8HA 1OV3A 2P0QA 2KYBA 1K9MU 1BK2A 2RNAA 4M77A 1KSWA 3WXMB 1K8AR 1VYUA 2ECZA 1VQ5A 4ELYC 2FRWA 3VS5A 1GCPA 2K9GA 3OYBA 4M75C 3S3NA 2E3IA 4RUGA 2QG9B 2KMTA 1M2OA 3CCJQ 3DLLA 1VUBA 4HA8A 5KYUB 4C92A 4XAXB 2V26A 4EMHA 2RMOA 4CI0C 3CCRT 2CH4W 2EGCA 5GAOn 1KHIA 3RERA 1YJ9Q 2F5TX 4QKUA 3NPFA 2BE7D 3LWIA 1WHLA 1I5LA 4JZ3A 4LXCA 1MV0B 2HQHA 4EMGA 3VRZA 2NLUA 4XTUA 3FIFA 4J6XA 2L3SA 2ED1A 1PRMC 2DM1A 2PUOB 4OVAA 4A63B 4FL6A 4AFQC 5GAN4 1BYMA 1UGRB 2CP7A 2DA9A 3EG1A 1GFDA 1DJ7B 4M7DA 2DD4A 2L8DA 2MMPA 5LJ3f 2CZ1B 1OU8A 4HCCA 4JRKA 2KT8A 3CEYA 1OX8A 4J83A 1JXMA 3VU3C 1S72T 1H92A 2DEUA 4RG2A 2WACA 2GQIA 1NPPA 4FU6A 3H9NA 1B7TA 1G3TA 1QVGP 2MYSA 2RQWA 2OX7A 4M77C 1BBZA 2FZGB 1YIJA 4YTLA 1PC0A 4JRQA 2HQEA 1U1SA 2COYA 2KXCA 4M78D 1D1AA 1WI7A 2NUTA 2EWNA 3QO3A 2X3XD 4F17A 3M0PA 3QDFA 1R77A 2EQJA 4IKFA 2E5KA 3HRUA 3EGUA 3RMSA 1CKAA 1W1FA 3PVQA 2QEXA 4OB3B 1QVGS 4J6WA 1RAGB 4PNOA 3H0IA 1J3TA 1VQ5Q 4E7HA 4C92C 4IUTA 5GAN2 3EG3A 1FX7A 2OJ2A 4MDXA 1BU1A 1D0ZA 5GAOm 3OYAA 1UG1A 9ATCB 3BFMA 4AFZC 5KYXB 2YSQA 3TSWA 4V2SA 3TCJA 4M7AC 2LZ6B 2VVKA 2X3WD 3A8HB 3M54A 2Y4XA 1VQ8T 4M7DC 1E6HA 2JS2A 3VJPA 2DXTA 2C0TA 1Q81U 4LNPA 4FM4B 2DBMA 3VS4A 2MAMA 1CKBA 2CKKA 2QTVA 2RD1A 2DERA 2QAZA 3CCQT 2LRQA 5FWCA 1NEBA 5KYUA 3L2UA 3J7AF 2IG0A 1BI2A 4IUVA 4FYWB 1QWFA 1HYOA 4PJNA 2JOYA 1BCMA 2DZ9A 4PLLA 3SFMA 1N27A 3CCEA 2DD5A 3NTHA 2V1QA 3GF5A 2DL5A 1EX4A 1P92A 4JPBW 3CCSA 3QWYA 4DOVA 3CC2A 1YJWA 2DRMA 3ASKA 3C0CA 2HSPA 1G3YA 3SB2A 3OYGA 4C8QE 1YIJQ 3U23A 4M78F 4P5NA 5IT9E 2DX1A 1AEYA 2M0OA 3I35A 4QVDA 1PKTA 2QQ9A 3EFSA 1MNEA 1U3OA 3OYFA 2YRVA 2QEXQ 2YUPA 3L1AA 3KUFA 3J81E 2L0AA 2PNIA 3SEMA 1OQKA 1E6GA 4LUDA 2EKHA 1ZSGA 1TUGB 2WSFE 3NTIA 1R0BG 2X51A 1K4US 3FJ5A 1I0CA 2PUKB 1KC8R 1WJQA 3CXCS 3CC4T 3VRYA 3X20B 1N5ZA 2AK5A 5IXBA 4QVCA 2R5AA 1QP2A 4X9CA 1UDLA 1GXIE 2Z0WA 5HKCA 3X28B 2X4WA 3CCUT 3R6NA 4PFPA 5KYXA 2O88A 4J9CA 5GAMd 3RDVA 2W10A 1WX6A 2R57A 4XU0A 2E12A 1LPLA 2O01E 1JXOA 4JS4A 1IO6A 2RA2A 3CCEQ 2WSEE 4A4HA 3META 2E3HA 2EYQA 2K79A 2HBPA 3CCSQ 1M3CA 1V76A 3OSSC 3CC2Q 2HMAA 3PMIA 2BZYA 4FCYA 1YJWQ 3QUIA 1Y96B 4PJMA 3UT1A 5GMKm 4Z89A 2D8JA 1AT1B 1MMNA 1LNXA 2I2LA 1YI2T 3SD4A 4BE1A 2RM4A 1VOMA 1RABB 3HRSA 3QYHB 1K0SA 2HAXA 4UC4A 1WJSA 2AT1B 5AYFA 6AT1B 4AMCA 2PVOB 3EH1A 1YITQ 3JCMX 3ZBDA 1YCSB 2FG0A 2GFUA 2B86A 2DL4A 4FIBA 1VQKA 1GFCA 5L23A 2DLPA 1ZA1B 2EYYA 5I21A 4E2FB 2KXDA 4E7LA 1RAAB 5FRMA 3S6WA 3CCVA 4KULA 4FT4A 3GOXA 1IGUA 1JU5C 3TEEA 1K1ZA 2P0PA 1IHVA 1WJRA 2ZPEB 1RL2A 2BKDN 4LDWA 1M9SA 2XD0A 3OS1A 3TREA 1QKXA 5GAN5 4C5IA 1T3SA 1N9RA 2J6OA 1LVKA 3JCMh 2SEMA 3DB3A 3VS3A 2X4XA 3MKDA 4PJOE 1FMVA 2VC8A 3MP1A 2QI2A 4ME7A 3LGFA 3O5ZA 2HQXA 2LTOA 1UHFA 2DZCA 5CKHA 1IRXA 4OP0A 3VKIA 1R0CB 4M75B 1C6VX 1EIFA 2EQUA 5J26A 3SWNB 3G4ST 2CP3A 3IQLA 4A4GA 3GNGA 2QGGA 5EC7A 5A0LA 3FEOA 2F2XA 1X6GA 2YLCA 2XIDA 2EGEA 5KE3A 2FPDA 1VQOA 4XU1A 2FPEA 2KDSA 1SRLA 3JCMc 4LD6A 3JCMV 5HK3A 5LJ5d 1MHNA 1VQ9T 2PVGB 2LNVA 3I56A 4JJBA 3M5AA 1Y96A 3FDRA 1VQLT 3THKA 5A0DA 1YJNA 4B9WA 3S3MA 2BIVA 1KQSA 2A37A 2HSEB 2DTIA 3REBB 1OYXA 1VQKQ 1YN8A 2OTJT 4M75E 4FSXA 3M0RA 2K7AA 2O4XB 3JCMd 1M27C 1M1KU 1AWWA 2EQIA 3CCMT 4AFSC 2YLBA 3CCVQ 2XICA 2QK0A 3NGPA 2ZPHB 3CC7T 5D6XA 3VS1A 2EYWA 3CMAT 1NJIU 1BI1A 1GBQA 3WVDB 1KHCA 1SEMA 2J6FA 4RMOA 2K3XA 1OI1A 4EIKA 1WHMA 1GL5A 3QKJA 4N0AA 2QQSA 2RHZA 1IHWA 2BUDA 2F69A 2RJFA 2MIOA 5CKBA 2DK3A 1WQWA 1RAEB 3GBQA 2LMJA 1RLPC 3QJ6A 1I07A 3L2RA 4J7IA 3FLGA 3CD6T 3RKXA 3OSVA 4RTVA 3BE3A 5FU7B 2ZPGB 4PJJA 3ZL7C 1EZZB 1QVFS 4AFUC 2DTOA 2RPNA 4ZN1A 4M7AB 4F14A 4LDXA 1YHQQ 2E6ZA 5A0GA 4PL6A 1VQ4Q 3VUBA 1M8MA 1RLQC 1XTDA 1U1TA 2YXYA 3QWXX 3WVEB 1IZ6A 4DBFA 3M0TA 2RHXA 1WIEA 4D8KA 2DJQA 3SWNA 4C0ZA 3I56Q 2V1RA 4II1A 1PRLC 3HL8A 3VYHB 4C0FA 2QA4Q 4X1VA 2NYSA 3L2QA 2HEQA 5LJ5e 3JB9J 4BDZA 2VGNA 1X2QA 4OMPA 2D6FA 4DBHA 1PD1A 1YWOA 3CCJT 4QW2A 4XTVA 3V7RA 1QWEA 4M7AE 1VIFA 2VB6A 2A0FB 1HD3A 3OYKA 4BY6C 3JCMe 3T9NA 1N8RR 4M7DE 4IUUA 4PKCC 4F16A 1I8FA 4C8QD 3PT9A 5GMKl 2ATCB 1ZUYA 3EG9B 2O4XA 1KD1R 1MMDA 4BE2A 2VGMA 2DXBA 2RK2A 1W2BP 2K5FA 4RTUA 3JB9D 1QP3A 3MEVA 5GMKh 2EVRA 2J06A 4ZGDB 2DRKA 1RAIB 3JCMQ 3CMEA 3URGA 2COZA 3DB4A 1IXDA 1ZQ1A 2DFUA 2KYMA 1WQ7A 1K8AC 2OI3A 1QCOA 2J05A 1Q7YC 2F1LA 5GAOq 1EFNA 1G83A 1HJDA 2HCKA 1T3LA 2QTXA 4OF1A 3CBOA 1KIKA 3SWNC 2PU9B 1W6XA 1OX9A 4OMLA 4F7UF 1K8AU 4OMQA
chains in the Genus database with same CATH topology
3MHXA 3JB9H 3OBYA 1Q7YU 2JNGA 1VQ7T 2JOYA 2DZ9A 4PLLA 3SFMA 5CCAA 1N27A 3CCEA 2K2VA 5LL6S 2DD5A 3LH0A 2JTFA 3NTHA 2R58A 3GIBA 3GF5A 4JRPA 1P92A 3JCMW 4C0DB 3I55A 3CCSA 3M59A 4PJOB 2JZ2A 3H6ZA 4RKUE 4DOVA 3GNFB 3CC2A 3OYLA 4X34A 3QYGB 2KSSA 2CZ6B 3ASKA 3ZEHA 4A54A 1YJWA 2OTLT 1UGQB 4ATOA 4M7AA 3M4GA 1G3YA 3BW1A 3SB2A 5GAMg 5GANd 1VQ5T 1FXXA 2XI9A 3OYGA 3OW2A 3H8ZA 4C8QE 3PGGA 1O9SA 3E9FA 2ZZDA 2QQBA 3KXTA 4M78F 4M78C 1N9SA 3UWNA 4NOYA 4P5NA 5IT9E 3UPUA 5LJ5h 2K57A 3V7SA 4QVZA 4HKEA 1S72A 3EAEA 2QXFA 3GP8A 3G71T 2M0OA 3A8LB 1N6AA 3A5ZB 3X26B 2XDPA 3HPWA 4QVDA 4DA4A 2EQMA 3OY9A 2QQ9A 2E5QA 2RHYA 3EFSA 4M77G 5C0MA 3OYFA 2YRVA 3F70A 2XDBA 3OQ5A 2E70A 3PTAA 1JB0E 2XHCA 2E41A 3L1AA 4RCBA 3KUFA 1MGQA 1Y07A 2EIFA 2V8JA 3ZFJA 5FLXE 3J81E 4C8QF 2QQAA 2XKOC 1D3BA 4C8QC 1YCYA 4Z02A 5KH6A 3CPWA 3VYGA 2KAFA 5J39A 1QVPA 2WSFE 3MEAA 4NL3A 3CCJA 2DIGA 1X75C 5L8RE 3NTIA 2RJCA 4KUDK 4E7KA 2PUKB 1WJQA 3CXCS 3OS5A 3CC4T 5DLQE 3V8LA 4GY5A 4HCBA 3JB9F 2ZPFB 3JCMP 4QQ6A 4O6JA 3MP6A 2MI6A 3X20B 5GAN6 3KBGA 3HFOA 5GMKi 4BD3A 4BI8B 4HCZA 5GAMe 4QVCA 2R5AA 5GANf 3OYNA 4O5VA 1QP2A 4IUPA 4X9CA 4C92G 1GXIE 2RO0A 2VV5A 5HKCA 2R5MA 3X28B 3M58A 1UB4A 2X4WA 1H641 3CCUT 1XQHA 5GAN7 4N4IA 4IUQA 3GPLA 2L5QA 3M53A 1N8RC 1YJ9T 1B34B 5CO7A 5GANg 2WSCE 4XU3A 3QIIA 4Y91A 3FRNA 4M7AG 2D0QB 1YHQA 5FU7C 2V8KA 4ZGEB 4OGEA 5CKFA 1U8RA 1KD1C 1M90C 4EMKA 5GAMd 3BY7A 1VQ4A 2RI3A 2K5LA 1Q81C 1PSFA 2G3RA 2DJZA 4Y28E 2R57A 1PSEA 2KK4A 2E12A 2IVWA 4XU0A 4JS5A 4M7DG 1NZ9A 2O01E 5GAN3 5DLOA 4JS4A 5GAMj 3LLRA 2RA2A 2XU8A 1N8RU 2E1HA 5GAN8 2WSEE 4A4HA 1VQOT 3META 1BIBA 2EYQA 2CGHA 4ELZC 2EJ9A 2HBPA 3V8JA 2QA4A 2EJGA 5IN1A 4EDUA 1KD1U 1M90U 3GLXA 3OSSC 1QW1A 3CD6A 3MEWA 3PMIA 3CCQA 4DQ2A 3QUIA 4OMFB 1Y96B 4JUVA 1HK9A 4TVRA 4F7UG 3UT1A 5GMKm 3OYYA 4PJOD 2VXFA 5CIUA 4NS5A 1W2BS 4J8OA 5CQXA 1YJNT 1YBYA 3QPHA 2DXUA 3CCLT 1VQMT 4OGCA 2RJDA 3CCRA 1LNXA 2I2LA 2LCLA 3SD4A 4L6V5 4BE1A 2RM4A 3CXCA 1YI2T 4MZTA 4E7IA 2LX9A 3OYMA 4KT0E 3L2WA 4C0GA 5GANe 5EG2A 2LVMA 1G3WA 3HRSA 3QYHB 4BUGA 3RIRA 3PIPA 4XTYA 1VQPT 4XQ3A 2HD0A 4PJOA 4M77B 4Q5WA 3OMGA 3CMET 2HAXA 4UC4A 1WJSA 1X6OA 2D9TA 5FROA 3INZA 5AYFA 1IREB 2PVOB 3RESA 1KQ1A 2EQKA 5GAMf 4QQDA 3JCMX 3SDZA 4FT2A 3L2VA 2ZPBB 4J5YA 3LX7A 2H3JA 2JVVA 4M78G 2JTMA 3CBMA 2DIQA 4XTZA 2GFUA 3BDUA 3C4SA 3G6ET 1QVGA 1X01A 2XG8D 4JDSA 1VQKA 4FIBA 5GMKe 3RKYA 2VUBA 2LQ8A 2L3RA 2RH2A 5I21A 1JJ2A 1OZ3A 3G71A 4A4EA 5I2MA 4E7LA 4MDWA 3QHSA 5FRMA 1Y7XA 1NPRA 3X25B 4N4HA 3S6WA 3CCVA 1BKBA 2FHDA 5GANj 5LJ5g 4KULA 2KY9A 1XOVA 4L5GA 4RG8A 4ZN3A 5C6SA 4FT4A 5KCOA 1H3ZA 3GOXA 4BB7A 2LT4A 3NFCA 2CYZB 3M55A 3PFSA 2MF2A 1VIEA 1WNLA 2EFIA 3ER0A 3RUXA 3TEEA 4C8QG 4C92B 1BI0A 2P0PA 4EMKC 1WJRA 3A8GB 3G7ZA 2ZPEB 1RL2A 3MCAB 2EKOA 1Q82C 2BKDN 2E6NA 4LDWA 4CRIA 1M9SA 1KQSS 2XD0A 1VQ6A 3OS1A 2LCCA 3TREA 5GMKj 3I55T 3CCST 1R8OB 5GAN5 2DEQA 3X24B 4C5IA 2K3YA 2F5KA 4M77E 1BI3A 4M75D 3JB9G 3JCMg 1N9RA 3JCMh 4R55A 5FRNA 1M1GA 3PMTA 4ZTFA 1V29B 4A4KA 4HT8A 2XK0A 3DB3A 2Y4YA 2X4XA 1VQNA 1KC8C 4M7DB 4PJOE 3OYDA 4B9XA 2QQRA 2VC8A 3MP1A 4X9DA 3VV0A 2QI2A 1Q82U 3LGLA 1NE8A 4ME7A 3LGFA 5LJ3g 1RI0A 5LJ3h 2HQXA 4M75A 3OA6A 2LC4A 2LQKA 2LTOA 3OS0A 2DZCA 5CKHA 3JRZA 1YJ9A 2GCXA 4OP0A 3ME9A 4IURA 3MEUA 3VKIA 3HSBA 5FU6C 1Y71A 1B34A 2L89A 3O8VA 3S3OA 1G3SA 4M75B 5I2SA 3PIOA 1YITT 3QZ5B 1EIFA 2EQUA 2Y90A 3FB9A 5J26A 3SWNB 5GAOp 4BACA 3G4ST 1KC8U 4E47A 2DVEA 3NTKA 4C92E 2X35A 4F7UB 4A4GA 3GNGA 3OYEA 4C0DC 3P8DA 4PJOF 5A0LA 3FEOA 2K4YA 3L2ZA 4PJOC 2GFAA 5M9OA 2YLCA 2XIDA 2RHIA 4LD9K 3LWHA 2B8AA 1YIJT 4MMLA 2RB6A 5KE3A 2VYTA 1VQOA 4N0AC 1M1FA 3HP9A 4XU1A 4BI4A 4LDUA 5CVIA 1VQ8A 3QG1A 4E7JA 1HXDA 2KDSA 5CK9A 3JCMc 2K5IA 4LD6A 3JCMV 5HK3A 1MHNA 1ZHIA 3HRTA 5LJ5d 2PVGB 1VQ9T 3MP8A 3C12A 1K9MC 2V8IA 3JCMJ 2QDYB 4KUIA 2LNVA 3I56A 3M5AA 3M9QA 2CZ0B 1Y96A 2DKGA 3FDRA 3QJYA 4M78B 4VUBA 5LJ5j 1VQLT 4DOWA 5A0DA 3HFNA 2GQVA 4QQGA 2QEXT 2PQWA 4B9WA 3OB9A 2BIVA 4M77D 3S3MA 1YJNA 1KQSA 2KQWA 3CCLA 4MMKA 2E65A 1VQMA 2DTIA 1OYXA 1KG1A 2DTHA 2RK1A 2MWOA 1W4SA 4M75E 4FSXA 2P0QA 2E10A 2OTJT 2O4XB 3JCMd 3OS2A 2EJFA 1VQ7A 5CR2A 1M1KU 3R6OA 2RI5A 3J80E 1K9MU 3CCMT 5CKEA 4BI3A 2YLBA 2XICA 3M57A 4BE0A 2ZPHB 4MZPA 4PLIA 2CZ7B 4F7UE 4M77A 3CC7T 5D6XA 4BDYA 4JLIA 4C8QB 3CMAT 1NJIU 3WXMB 3QSUA 4JJNK 1BI1A 2RI2A 3WVDB 4XTXA 1KHCA 2LT1A 3G6EA 5LJ3d 4RMOA 2OTLA 4XTWA 2K3XA 1BIAA 3TU4K 2OAUA 1VQ5A 4NL2A 1OI1A 4ELYC 1K73C 4C92D 5LJ3j 3OYBA 3QKJA 4N0AA 3A8MB 2QQSA 2RHZA 4XK8E 4M75F 4M75C 1XNIA 2BUDA 2FYKA 2KVQG 2F69A 3S3NA 5LJ5f 2RJFA 2MWPA 4WF2A 4EPCA 2KMTA 3L42A 3DLLA 3CCJT 5CKBA 5IAYA 3LYIA 3Q1JA 1VUBA 1O75A 3FJPA 5KE2A 1I81A 4HA8A 3MO8A 2DK3A 1LOJA 1WQWA 4M7AD 4C92A 4XAXB 3ZBDA 1TH7A 4EMHA 4CI0C 3OYCA 1G5VA 1JRIA 3CCRT 4BY6B 1K73U 2A3LA 3QJ6A 2DAQA 5GAOn 3L2RA 3BDLA 2RHUA 1KHIA 4J7IA 3FLGA 3QZ9B 2EAYA 3RKXA 4A4FA 3CD6T 3RERA 3OSVA 4M7DD 2F5TX 3LWIA 1WPYA 2ZPGB 5FU7B 1I5LA 3CCET 2X4YA 2CS7A 3LW5E 4EMGA 4LDVA 3JCMf 2VXEA 2NLUA 4XTUA 3FIFA 5GAMh 4J6XA 5DM7R 1QVFS 2DTOA 2AHJB 2PUOB 3CBPA 4OVAA 4FL6A 4ZN1A 5GAN4 1BYMA 1UGRB 3CC2T 4M7AB 1DJ7B 3JB9I 3CC4A 1YJWT 4M7DA 1VQKT 4LDYA 2DD4A 3QDRB 2L8DA 4LDXA 1OZ2A 2MMPA 1ZBXA 5LJ3f 2GF7A 2CZ1B 5CQYA 2E6ZA 4HCCA 4JRKA 5A0GA 4PL6A 4XU2A 3VUBA 3N5BB 5KCHA 3CEYA 1W2BA 3CCVT 1XTDA 4C5HA 4ZTJA 1M5Q1 2YHTA 3P8BB 1U1TA 3C95A 4J83A 3E19A 1UEBA 3VU3C 3WVEB 1IZ6A 1YITA 1S72T 4RG2A 2RHXA 3CCUA 3G4SA 2WACA 3AHUA 1NPPA 5CAIA 3SWNA 4OB1B 3A8OB 4FU6A 4C0ZA 2C06A 4PJOG 1G3TA 4F7UA 5J3BA 2ZCFB 3RKWA 3E9GA 4II1A 4OB0B 3HL8A 4M77F 4M77C 5DY9A 3VYHB 4C0FA 3DKMA 5GAOl 1VQ6T 4JRIA 1YIJA 4YTLA 3L2QA 3OMCA 4JRQA 1D3BB 2HQEA 5LJ5e 1U1SA 1JBMA 4OB2B 3JB9J 4BDZA 2DPPB 2VGNA 3C94A 3DLMA 4M78D 3EFRA 1KQ2A 2D6FA 2X4JA 2DXCA 2ZGWA 4QW2A 2EWNA 3QO3A 2JN0A 3M4YA 4D6WA 2E64A 2M1HA 4XTVA 3OYHA 1VQ9A 1VQNT 2DO3A 3V7RA 3RMQA 4N4GA 5HY6A 2EQJA 4IKFA 3QBYA 3V7CA 1Q86C 4M7AE 1VIFA 3HRUA 1VQLA 3RMSA 1M8VA 3JCMb 2QEXA 4M78A 4OB3B 1QVGS 4J6WA 1FWZA 1SSFA 4BY6C 3JCMe 3OYKA 4PNOA 1M1KC 3T9NA 4HT9A 4M7DE 5GANh 4IUUA 4PKCC 1JJ2S 3OW2S 1UGSB 4E7HA 1I8FA 2P0KA 4IUTA 3PT9A 4C8QD 4C92C 3E1SA 1FX7A 1LJOA 4C92F 5GMKl 5GAN2 5GAOr 4MDXA 2OTJA 1NJIC 4C5EA 5GAOm 3OYAA 2O4XA 2P4TA 3CCMA 3BFMA 4L59A 5HK0A 5CKDA 4KBMB 1QVFA 3QXEB 1Q86U 5LJ3e 2VGMA 4BE2A 3CC7A 2DXBA 1YI2A 2RK2A 2K5FA 3OYJA 3CMAA 4J7FA 4EMKB 3JB9D 1QP3A 3MEVA 3TCJA 5GMKh 1YHQT 4M7AF 4M7AC 4V2SA 4C8QA 1UGPB 3PNWC 2PVDB 4RCCA 4ZGDB 1VQPA 3JCMQ 3P8HA 3CMEA 1VQ4T 3A8HB 3URGA 3HKSA 3M54A 3FC3A 3DB4A 2Y4XA 1VQ8T 3OBWA 2M9UA 4M7DF 4M7DC 1ZQ1A 2RJEA 3JSCA 1AHJB 4JLGA 1WQ7A 1K8AC 1I4K1 3VJPA 4MZMA 4M75G 2FB7A 2DXTA 4C5GA 1Q7YC 2JUFA 3CPWS 4ZGJB 2ZPIB 1Q81U 3VUZA 4FM4B 5GAOq 2LDMA 3I56T 2MAMA 2FVUA 2CKKA 2A7YA 3JAME 2RD1A 3UDCA 1M4ZA 2QA4T 2M16A 4GLKA 2QTXA 4OF1A 2FL7A 4J6YA 5D6YA 3CBOA 3CCQT 5A2QE 2LRQA 3M56A 3HHTB 3CPFA 3SWNC 3L2UA 3J7AF 2PU9B 3OYIA 2HNIA 1BI2A 2IG0A 4IUVA 5D6WA 3V8KA 4A53A 4R56A 2XDDA 4F7UF 5FU6B 4M78E 1K8AU 1WGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAO p;  3JB9 H;  2DVE A;  1BIB A;  4C92 E;  2CGH A;  2DZ9 A;  4F7U B;  5LJ3 f;  2EJ9 A;  3V8J A;  2EJG A;  4JRK A;  4PJO F;  4PJO C;  4XU2 A;  3L2Z A;  3GIB A;  2YLC A;  4DQ2 A;  3QUI A;  3JCM W;  1Y96 B;  4JUV A;  1HK9 A;  4PJO B;  1M5Q 1;  2YHT A;  2RB6 A;  1U1T A;  4MML A;  4F7U G;  3VU3 C;  5GMK m;  4PJO D;  4N0A C;  2VXF A;  4XU1 A;  4A54 A;  3AHU A;  4M7A A;  3M4G A;  3SB2 A;  2DXU A;  3BW1 A;  1HXD A;  3SWN A;  5CAI A;  5GAM g;  5GAN d;  3JCM c;  3JCM V;  4PJO G;  4C8Q E;  5LJ5 d;  1LNX A;  3PGG A;  2I2L A;  3RKW A;  4F7U A;  2RM4 A;  4M78 F;  4M78 C;  1N9S A;  4M77 F;  4M77 C;  4NOY A;  5DY9 A;  3JCM J;  5GAN e;  5GAO l;  4JRI A;  3RIR A;  5LJ5 h;  1D3B B;  4XTY A;  1Y96 A;  1U1S A;  2DKG A;  2K57 A;  4M78 B;  4XQ3 A;  4M77 B;  1JBM A;  3V7S A;  5LJ5 j;  3JB9 J;  4PJO A;  3HFN A;  3INZ A;  4M78 D;  3EFR A;  4M77 D;  3RES A;  1KQ1 A;  1KQ2 A;  4MMK A;  2E65 A;  5GAM f;  4QVD A;  3JCM X;  2DTI A;  2ZGW A;  2EWN A;  3QO3 A;  2JN0 A;  5LJ5 e;  2E64 A;  2DTH A;  4J5Y A;  4XTV A;  4M78 G;  3V7R A;  3EFS A;  4XTZ A;  4M77 G;  3BDU A;  4M75 E;  1X01 A;  2E10 A;  3JCM d;  3V7C A;  2EJF A;  3RKY A;  5GMK e;  4M7A E;  2E41 A;  3L1A A;  4RCB A;  1MGQ A;  1M8V A;  2YLB A;  3JCM b;  4C8Q F;  4C8Q C;  5I21 A;  1D3B A;  4M78 A;  1YCY A;  4F7U E;  4J6W A;  4M77 A;  3JCM e;  4PNO A;  3QHS A;  4JLI A;  4NL3 A;  4C8Q B;  4HT9 A;  4M7D E;  5GAN h;  5GAN j;  3QSU A;  5LJ5 g;  1I8F A;  4XTX A;  4C8Q D;  4C92 C;  4C92 F;  5GMK l;  5LJ3 d;  5GAN 2;  1LJO A;  5GAO r;  4XTW A;  1BIA A;  3V8L A;  4C92 B;  5GAO m;  1WNL A;  3RUX A;  3JB9 F;  3JCM P;  4NL2 A;  3BFM A;  4C8Q G;  4C92 D;  4EMK C;  5GAN 6;  5LJ3 e;  5LJ3 j;  3HFO A;  4N0A A;  5GMK i;  3FB9 A;  4M75 F;  4M75 C;  5GAM e;  4QVC A;  4EMK B;  2FYK A;  5GAN f;  3JB9 D;  4M7A F;  4X9C A;  5GMK h;  4M7A C;  4C92 G;  4V2S A;  4C8Q A;  5GMK j;  5LJ5 f;  5GAN 5;  4RCC A;  4WF2 A;  2DEQ A;  3JCM Q;  4M77 E;  3JB9 G;  4M75 D;  1H64 1;  3JCM g;  1N9R A;  3JCM h;  3FJP A;  5GAN 7;  4M7A D;  1I81 A;  4HA8 A;  4M7D F;  4M7D C;  1LOJ A;  1B34 B;  1WQW A;  4C92 A;  5GAN g;  4HT8 A;  1TH7 A;  4EMH A;  1WQ7 A;  4XU3 A;  1JRI A;  1I4K 1;  4M75 G;  2FB7 A;  2DXT A;  4Y91 A;  4M7D B;  4PJO E;  4M7A G;  5GAO n;  2VC8 A;  5GAO q;  3RER A;  2EAY A;  4X9D A;  3RKX A;  4M7D D;  4EMK A;  5GAM d;  3BY7 A;  1WPY A;  5LJ3 g;  1I5L A;  5LJ3 h;  4M75 A;  2RD1 A;  4EMG A;  2DJZ A;  4XU0 A;  3JCM f;  2QTX A;  2DZC A;  2VXE A;  4M7D G;  4J6Y A;  4XTU A;  3FIF A;  5GAM h;  4OP0 A;  5GAN 3;  4J6X A;  5GAM j;  3HSB A;  2DTO A;  1B34 A;  3SWN C;  2RA2 A;  2HNI A;  4M75 B;  3V8K A;  4A53 A;  2E1H A;  5GAN 8;  5GAN 4;  4F7U F;  4M78 E;  4M7A B;  3JB9 I;  4M7D A;  2Y90 A;  3SWN B; 
#chains in the Genus database with same CATH topology
 3OBY A;  1Q7Y U;  2JNG A;  4HVW A;  1T0J A;  2K2V A;  3LH0 A;  2R58 A;  3JCM W;  2NUZ A;  4C0D B;  3I55 A;  1AWJ A;  2JZ2 A;  3GNF B;  3OYL A;  1PHT A;  1KQS P;  4M7A A;  3M4G A;  1VQ5 T;  1UHC A;  2DBK A;  2XI9 A;  3OW2 A;  3H8Z A;  8AT1 B;  2H3E B;  3KXT A;  1WZO A;  2K57 A;  4QVZ A;  4HKE A;  1S72 A;  1LCK A;  3A8L B;  3A5Z B;  4RTX A;  2FPF A;  3I5R A;  3OQ5 A;  2E70 A;  3PTA A;  1JB0 E;  1MGQ A;  2EIF A;  4C8Q F;  5KH6 A;  3CPW A;  2GGR A;  5J39 A;  1QVP A;  4NL3 A;  4AG1 C;  2KI7 A;  4KUD K;  4E7K A;  3EFO B;  5DLQ E;  4GY5 A;  3JB9 F;  3JCM P;  2GNC A;  4GLM A;  2MI6 A;  7AT1 B;  3KBG A;  1PCX A;  3HFO A;  2DE0 X;  5GMK i;  3CME Q;  5GAN f;  3OYN A;  4OMO A;  2RQR A;  1PD0 A;  1H64 1;  5GAN 7;  3EG9 A;  1QMC A;  2ABL A;  5I11 A;  5FU7 C;  4ZGE B;  1U8R A;  2ROL A;  1W70 A;  1I5O B;  1Q81 C;  4LE9 A;  2VKN A;  2IVW A;  2EPD A;  1TS9 A;  5GAN 3;  5GAM j;  2CT4 A;  3LLR A;  2RQU A;  2AKK A;  1VYT A;  2DL8 A;  1NLP C;  2QYZ A;  1AZG B;  2EJ9 A;  3I55 Q;  4EDU A;  1QW1 A;  1ZBJ A;  3CCQ A;  4DQ2 A;  4OMF B;  4R0K A;  4E6R A;  3UF4 A;  4PJO D;  5CIU A;  2I0N A;  3CCL T;  1VQM T;  4RTT A;  2LCL A;  4KT0 E;  4C0G A;  1G3W A;  2HD0 A;  3OMG A;  1BB9 A;  2O2O A;  2MOX A;  3RES A;  2EQK A;  3SDZ A;  4FT2 A;  1K73 R;  4J5Y A;  3SHW A;  2JVV A;  4M78 G;  2DIQ A;  3G6E T;  3BDU A;  1X01 A;  2XG8 D;  1XJW B;  5GMK e;  2LQ8 A;  3M0Q A;  4A4E A;  1NYF A;  4M4Z A;  5IHI A;  3X25 B;  1BKB A;  1K0X A;  1IB8 A;  1Y0M A;  2FHD A;  5GAN j;  3EGX B;  2KY9 A;  1XOV A;  4ZN3 A;  5GJW B;  2KR3 A;  1SPK A;  1F1B B;  2LT4 A;  4BB7 A;  2CYZ B;  3ER0 A;  1VIE A;  2EFI A;  2KRM A;  1C0M A;  3MCA B;  2EKO A;  2E6N A;  4CRI A;  1VQ6 A;  2KE9 A;  1SHG A;  2IIM A;  3CCS T;  1R8O B;  2DEQ A;  3EFO A;  4M75 D;  4R55 A;  5FRN A;  1M1G A;  3PMT A;  4HT8 A;  1VQN A;  2Y4Y A;  5IXF A;  1KC8 C;  4LUE A;  2DYB A;  4X9D A;  2JTE A;  4B6M A;  5LJ3 h;  2LC4 A;  4CC3 A;  2GCX A;  2JM8 A;  1K76 A;  3PIO A;  1YIT T;  4PFO A;  4BAC A;  3I9Q A;  5GAO p;  1KC8 U;  3VS6 A;  2KRN A;  3NTK A;  1JJ2 P;  3OW2 P;  1TG0 A;  4C0D C;  4PJO F;  3L2Z A;  2JMC A;  4E7Z A;  2JS0 A;  3LWH A;  4LD9 K;  2B8A A;  4MML A;  5KYN A;  2VYT A;  1M1F A;  4LDU A;  2YUQ A;  5CVI A;  1Y57 A;  1Q86 R;  2CSI A;  1HXD A;  5CK9 A;  2K5I A;  1TU0 B;  1ZHI A;  2QDY B;  4DBQ A;  3M9Q A;  2CZ0 B;  4KRT A;  4M78 B;  4VUB A;  5LJ5 j;  3CPW P;  1D0X A;  2GQV A;  2PQW A;  3OB9 A;  4M77 D;  2DYI A;  1SRM A;  1FMK A;  1KG1 A;  2DTH A;  2QGF B;  2E10 A;  4FSS A;  2EJF A;  1TUC A;  1VQ7 A;  3J80 E;  5CKE A;  8ATC B;  4MZP A;  4BDY A;  4JLI A;  2A08 A;  2LT1 A;  5LJ3 d;  2ED0 A;  2OTL A;  1I1J A;  4XTW A;  1BIA A;  3TU4 K;  1SHF A;  2OAU A;  1VQ6 Q;  4C92 D;  1AVZ C;  4FW2 A;  2P84 A;  4XK8 E;  4M75 F;  4KGX B;  2CT3 A;  4IIM A;  4F04 B;  2MWP A;  4WF2 A;  1SF9 A;  1NYG A;  3EGX A;  1X69 A;  3L42 A;  1VQN Q;  3LYI A;  3FJP A;  1O75 A;  4M7A D;  1LOJ A;  1JQQ A;  1G5V A;  1JRI A;  2LQN A;  4FYY B;  4BY6 B;  2A3L A;  2DAQ A;  3BDL A;  4A4F A;  2HKN A;  3QZ9 B;  4M7D D;  1FYN A;  3EHQ A;  1GBR A;  2X4Y A;  2CS7 A;  3LW5 E;  1ZLM A;  5DM7 R;  2RQV A;  2AZS A;  3UA7 A;  1VQK T;  3QDR B;  1OZ2 A;  2GBQ A;  1ZBX A;  2GF7 A;  5CQY A;  3N5B B;  1W2B A;  3CCV T;  2JT4 A;  1M5Q 1;  4KH1 B;  3P8B B;  2D0N A;  4K11 A;  4QT7 A;  3G4S A;  4J9F A;  3A8O B;  2C06 A;  3EHR A;  4OB0 B;  1GCQ A;  4J9H A;  1M30 A;  4M77 F;  4PJL A;  5DY9 A;  5GAO l;  3JV3 A;  3OMC A;  1JBM A;  4OB2 B;  1WXU A;  2DPP B;  1YNZ A;  3C94 A;  3DLM A;  2J6K A;  3EFR A;  2XMF A;  1ABO A;  1KQ2 A;  1TOV A;  4D6W A;  2JN0 A;  3M4Y A;  1VQ7 Q;  2E64 A;  1VQ9 A;  2ESW A;  1RUW A;  2DO3 A;  2VAS A;  3QBY A;  3V7C A;  4ANJ A;  2KBT A;  2C0I A;  2D1X A;  1VQL A;  1M8V A;  4M78 A;  1FWZ A;  1M1K C;  2OTL Q;  2P0K A;  4C92 F;  3E1S A;  1LJO A;  1X2K A;  2OTJ A;  1D1C A;  1NJI C;  4C5E A;  2BZX A;  3UAT A;  5KYW B;  2P4T A;  3CCM A;  4L59 A;  1M90 R;  4KBM B;  5LJ3 e;  3CC7 A;  3CMA A;  4J7F A;  1YHQ T;  4M7A F;  1UGP B;  3VS2 A;  3PNW C;  4RCC A;  1VQP A;  2PTK A;  3P8H A;  3VS7 A;  1VQ4 T;  3FC3 A;  3NHN A;  2M9U A;  4M7D F;  3AT1 B;  1AHJ B;  5I22 A;  2FB7 A;  2LP5 A;  2HKQ B;  4ZGJ B;  2DMO A;  1PNJ A;  3I56 T;  2FVU A;  2M51 A;  4RTW A;  1UEC A;  2M0Y A;  1M4Z A;  2QA4 T;  2M16 A;  1WHG A;  4J6Y A;  2DIL A;  3M56 A;  1NM7 A;  3OYI A;  2HNI A;  3V8K A;  5D6W A;  4R56 A;  1PKS A;  1QCN A;  5FU6 B;  5IHK A;  3CD6 A;  1GCQ C;  1WGS A;  1UTI A;  3MHX A;  3JB9 H;  5CCA A;  5LL6 S;  3KFV A;  2JTF A;  4PFZ A;  3GIB A;  3G4S Q;  3M59 A;  2MCN A;  3VS0 A;  3H41 A;  4X34 A;  2CZ6 B;  2FRY A;  1UGQ B;  3BW1 A;  5GAM g;  1FXX A;  3PGG A;  1O9S A;  2G6F X;  3E9F A;  2ZZD A;  4M78 C;  1TSF A;  2EBP A;  4WTO B;  1WHH A;  5IHN A;  3GP8 A;  1VQ9 Q;  3G71 T;  3CQT A;  3X26 B;  1VQO Q;  2XDP A;  3HPW A;  5KYY B;  3OY9 A;  1C1A A;  2E5Q A;  1VQL Q;  2RHY A;  5C0M A;  1Q82 R;  4HVU A;  1H8K A;  2XHC A;  2E41 A;  1Y07 A;  2V8J A;  1OEB A;  5FLX E;  2XKO C;  2RN8 A;  4Z88 A;  4Z02 A;  2DET A;  2OTJ Q;  1YP5 A;  3CCJ A;  2DIG A;  1X75 C;  3PVL A;  1YJN Q;  2RJC A;  3H0F A;  2LJ3 A;  2ZPF B;  3CMA Q;  4O6J A;  3MP6 A;  4DEX A;  5GAN 6;  1VQP Q;  4HCZ A;  5HCK A;  2RO0 A;  2R5M A;  1KFZ A;  1UB4 A;  4ESR A;  4IUQ A;  2LJ1 A;  3M53 A;  1N8R C;  1YJ9 T;  5CO7 A;  5GAN g;  5KYW A;  2WSC E;  4XU3 A;  4Y91 A;  2KGT A;  2V8K A;  1X27 A;  3REA B;  4OGE A;  1KD1 C;  3BY7 A;  2RI3 A;  1PSF A;  2DL3 A;  2G3R A;  3M0S A;  1PSE A;  1NZ9 A;  5DLO A;  3CD6 Q;  2F2V A;  1N8R U;  5GAN 8;  1K9M R;  1WDX A;  2CGH A;  4ELZ C;  4KGV B;  1KD1 U;  3GLX A;  1RAH B;  4JUV A;  1V1C A;  1HK9 A;  4TVR A;  4Y92 A;  1QCF A;  4F7U G;  2VXF A;  1W2B S;  4J8O A;  5CQX A;  2CUD A;  1YBY A;  3QPH A;  2DXU A;  4J9D A;  1TUD A;  3CCR A;  4L6V 5;  3CXC A;  1WFW A;  4MZT A;  4E7I A;  2LX9 A;  3OYM A;  2LVM A;  2YDL A;  4J9G A;  4BUG A;  3RIR A;  4J9B A;  4XQ3 A;  1Q7Y R;  3CME T;  1X6O A;  2D9T A;  1PM3 A;  3INZ A;  5GAM f;  4QQD A;  1S1N A;  3LX7 A;  2H3J A;  2JTM A;  3CBM A;  4XTZ A;  3C4S A;  4JDS A;  1X43 A;  3RKY A;  1RAF B;  2BE9 B;  2DL7 A;  2RH2 A;  1JJ2 A;  1OZ3 A;  4MDW A;  3QHS A;  1NPR A;  4JJC A;  5LJ5 g;  4LN2 A;  5KYY A;  2YRC A;  3A98 A;  2IPO B;  2KRS A;  3LH5 A;  3NFC A;  3PFS A;  1OUL A;  2MF2 A;  2FO0 A;  3RUX A;  4C8Q G;  2RF0 A;  1ABQ A;  3A8G B;  3G7Z A;  2YUN A;  1KQS S;  2LCC A;  2COW A;  3I55 T;  4RTZ A;  4CC2 A;  3X24 B;  2CP6 A;  2BZ8 A;  1BI3 A;  3JB9 G;  3JCM g;  2M02 A;  2O9S A;  4A4K A;  2XK0 A;  1RI9 A;  1UGV A;  2EYZ A;  1JEG A;  4HVV A;  4JJD A;  3OYD A;  1QQJ A;  2QQR A;  4ZNX A;  3VV0 A;  3LGL A;  1M2V B;  1NE8 A;  3OA6 A;  1HSQ A;  3D7S B;  3JRZ A;  3MEU A;  3EGD B;  5FU6 C;  3HSB A;  1Y71 A;  3O8V A;  2CSQ A;  3PE0 A;  2CUB A;  5I2S A;  1PG5 B;  3QZ5 B;  2Y90 A;  3FB9 A;  4Z8A A;  4E47 A;  2DVE A;  2X35 A;  1GRI A;  4F7U B;  3P8D A;  2K4Y A;  2LJ0 A;  5M9O A;  4KH0 B;  1YIJ T;  1Z9Z A;  2RB6 A;  1MUZ A;  2EGA A;  1NEG A;  4DBR A;  3UA6 A;  3CCR Q;  2JMA A;  4BI4 A;  1VQ8 A;  3QG1 A;  4E7J A;  2HDA A;  1QLY A;  3C12 A;  3MP8 A;  1CSK A;  2V8I A;  3JCM J;  4KUI A;  4FYX B;  4DOW A;  2QEX T;  3CCL A;  2KQW A;  1VQM A;  1Q81 R;  3TQ7 P;  2MWO A;  1W4S A;  3OS2 A;  2JXB A;  5CR2 A;  3R6O A;  2RI5 A;  4BI3 A;  3M57 A;  4BE0 A;  4F7U E;  4PLI A;  2CZ7 B;  1S72 Q;  4C8Q B;  3QSU A;  4JJN K;  2RI2 A;  4XTX A;  3G6E A;  1VA7 A;  4NL2 A;  1K73 C;  1SSH A;  5LJ3 j;  3A8M B;  2YWW A;  1XNI A;  1A0N B;  2FYK A;  3TVT A;  2KVQ G;  5LJ5 f;  2A36 A;  4EPC A;  2A28 A;  3M0U A;  1ZSZ B;  5IAY A;  3Q1J A;  5KE2 A;  1I81 A;  3MO8 A;  1TH7 A;  2DVJ A;  3OYC A;  2KEA A;  2LCS A;  1K73 U;  2CP0 A;  1SG5 A;  2RHU A;  2EAY A;  1B3Q A;  1ZUU A;  2ROT A;  2AZV A;  1WPY A;  3CCE T;  1TTH B;  4LDV A;  3JCM f;  2VXE A;  1YFN A;  4RTY A;  5GAM h;  2K3B A;  2AHJ B;  3CBP A;  1U06 A;  3CC2 T;  3JB9 I;  3CC4 A;  1YJW T;  4LDY A;  5AT1 B;  3CXC P;  1M2V A;  4XU2 A;  2X9H A;  2YUO A;  5KCH A;  3EG0 A;  2DNU A;  1VQ8 Q;  4C5H A;  4ZTJ A;  2YHT A;  3EGD A;  3C95 A;  3E19 A;  1UEB A;  1YIT A;  3CCU A;  3AHU A;  2CDT A;  5CAI A;  2JJ9 A;  1H3H A;  4OB1 B;  4PJO G;  4F7U A;  5J3B A;  2ZCF B;  1ZA2 B;  3RKW A;  3E9G A;  4OMN A;  2E4H A;  1UUE A;  1UJ0 A;  1AWO A;  3DKM A;  1VQ6 T;  4JRI A;  3CCL Q;  1D3B B;  3CCQ Q;  1VQM Q;  3RNJ A;  2X4J A;  2DXC A;  2ZGW A;  3OYH A;  2EYX A;  2M1H A;  2VWF A;  1VQN T;  4ORZ A;  2HZY A;  3RMQ A;  4N4G A;  5HY6 A;  3A1P A;  1Q86 C;  3E2U A;  1YWP A;  5IH2 A;  3JCM b;  3G6E Q;  1X6B A;  1SSF A;  1PWT A;  4HT9 A;  5GAN h;  1JJ2 S;  3OW2 S;  1UGS B;  1FMW A;  2L3P A;  5GAO r;  4J9E A;  2F2W A;  2AIR B;  1QVF A;  5HK0 A;  1BCO A;  2GTO A;  5CKD A;  3QXE B;  2C0O A;  1Q86 U;  1G2B A;  1U5S A;  1YI2 A;  1OPK A;  2KT1 A;  1AD5 A;  3OYJ A;  4E7S A;  1TWB A;  4EMK B;  4C8Q A;  1E7O A;  2CP2 A;  2PVD B;  3HKS A;  2HBW A;  3OBW A;  1NBE B;  4DEY A;  2RJE A;  3JSC A;  4JLG A;  1I4K 1;  4MZM A;  4M75 G;  1MV3 A;  4C5G A;  2JUF A;  3CPW S;  2ZPI B;  4IIO A;  2SRC A;  3VUZ A;  2LDM A;  2A7Y A;  1M3A A;  2FZC B;  3JAM E;  3UDC A;  4GLK A;  1NLO C;  1WXB A;  2FL7 A;  5D6Y A;  1ZSZ A;  2L2P A;  5A2Q E;  3CC4 Q;  3HHT B;  1B07 A;  2J7I A;  3CPF A;  4J9I A;  4A53 A;  4OMM A;  2XDD A;  4M78 E;  1VQ7 T;  1SKU B;  1OU9 A;  4JRP A;  3CCU Q;  2KNB B;  4PJO B;  5ECA A;  1TXQ A;  3H6Z A;  4RKU E;  2OAW A;  3QYG B;  2KSS A;  3ZEH A;  2OTL T;  4A54 A;  4ATO A;  2NUP B;  4FYV B;  4AT1 B;  5GAN d;  2QQB A;  3UWN A;  1N9S A;  4NOY A;  3UPU A;  5LJ5 h;  3V7S A;  3EAE A;  4WCI A;  2QXF A;  1N6A A;  4DA4 A;  2EQM A;  4M77 G;  3F70 A;  2XDB A;  4RCB A;  2D8H A;  3ZFJ A;  1K9A A;  1VYV A;  1D3B A;  2QQA A;  4C8Q C;  1YCY A;  3EH2 A;  1OPL A;  3TSZ A;  2KAF A;  4JZ4 A;  3VYG A;  3MEA A;  2ZAE A;  4HXJ A;  5L8R E;  1MMA A;  2PZ1 A;  3OS5 A;  1YI2 Q;  3V8L A;  4HCB A;  4QQ6 A;  2YT6 A;  4BD3 A;  4BI8 B;  5GAM e;  2P4R A;  4O5V A;  1WA7 A;  2RQT A;  4IUP A;  4C92 G;  1ZSZ C;  2VV5 A;  3M58 A;  2CP5 A;  2MPX C;  2KRO A;  1XQH A;  4N4I A;  3GPL A;  4PK4 A;  2L5Q A;  1B34 B;  2EW3 A;  3QII A;  3FRN A;  3NMZ C;  4M7A G;  2D0Q B;  1YHQ A;  5CKF A;  1M90 C;  4EMK A;  1VQ4 A;  2K5L A;  2DJZ A;  4Y28 E;  4JS5 A;  2KK4 A;  4M7D G;  1WXT A;  3MPU B;  2GTJ A;  2XU8 A;  1UJY A;  2E1H A;  1M1K R;  1VQO T;  1BIB A;  3V8J A;  2QA4 A;  2EJG A;  5IN1 A;  1M90 U;  1NJI R;  3MEW A;  1Q95 G;  1Z9Q A;  2O31 A;  2FEI A;  4D8D A;  1T0H A;  3OYY A;  2HL3 A;  4NS5 A;  2FZK B;  1YJN T;  2LNH B;  1AZE A;  4CC7 A;  1ARK A;  4OGC A;  2RJD A;  1UFF A;  3L2W A;  1OOT A;  1MND A;  5GAN e;  5EG2 A;  1ACM B;  1QKW A;  3PIP A;  4XTY A;  1VQP T;  1ZX6 A;  1RAD B;  4M77 B;  4Q5W A;  1D0Y A;  4PJO A;  5FRO A;  1IRE B;  1KQ1 A;  1WYX A;  2NUP A;  3L2V A;  2ZPB B;  1QVG A;  1QVF P;  2VUB A;  2K2M A;  2L3R A;  3G71 A;  2CH4 A;  5I2M A;  1KK7 A;  1Y7X A;  1KJW A;  4N4H A;  1D09 B;  4RG8 A;  5C6S A;  2L3Q A;  4L5G A;  1H3Z A;  5KCO A;  1G8X A;  3I5S A;  3M55 A;  4C92 B;  1WNL A;  3RBB B;  1BI0 A;  4EMK C;  1Q82 C;  3EG2 A;  2LX7 A;  5GMK j;  1D1B A;  1WLP B;  1NG2 A;  2K3Y A;  4GBQ A;  3G1J A;  2F5K A;  4M77 E;  5FWB A;  3RR6 A;  4KGZ B;  2QDL A;  1IGQ A;  4ZTF A;  1V29 B;  1JO8 A;  1WHJ A;  4FW1 A;  3CCM Q;  4M7D B;  2LQW A;  2CRE A;  4B9X A;  3CC7 Q;  2W0Z A;  1Q82 U;  2K6D A;  5LJ3 g;  2JW4 A;  1RI0 A;  4M75 A;  3ULR B;  2BTT A;  2LQK A;  3OS0 A;  1YJ9 A;  2DF6 A;  3ME9 A;  4IUR A;  4CC4 B;  1AOJ A;  2L89 A;  1B34 A;  2O9V A;  3S3O A;  1G3S A;  1ZUK A;  1MMG A;  4C92 E;  3OYE A;  2HL5 C;  4PJO C;  1M3B A;  2GFA A;  2RHI A;  3HTR A;  2QAS A;  4N0A C;  3HP9 A;  2NUT B;  5GJV B;  5D7U A;  3H0H A;  2ENM A;  5FW9 A;  1AWX A;  1WHK A;  4AG2 C;  3HRT A;  1K9M C;  2JM9 A;  3MJX A;  2DKG A;  3QJY A;  2AKL A;  2NWM A;  3HFN A;  4QQG A;  4MMK A;  2E65 A;  4HCK A;  2YRD A;  1UE9 A;  2RK1 A;  2MK5 A;  1RAC B;  3G71 Q;  2H8H A;  1OV3 A;  2P0Q A;  2KYB A;  1K9M U;  1BK2 A;  2RNA A;  4M77 A;  1KSW A;  3WXM B;  1K8A R;  1VYU A;  2ECZ A;  1VQ5 A;  4ELY C;  2FRW A;  3VS5 A;  1GCP A;  2K9G A;  3OYB A;  4M75 C;  3S3N A;  2E3I A;  4RUG A;  2QG9 B;  2KMT A;  1M2O A;  3CCJ Q;  3DLL A;  1VUB A;  4HA8 A;  5KYU B;  4C92 A;  4XAX B;  2V26 A;  4EMH A;  2RMO A;  4CI0 C;  3CCR T;  2CH4 W;  2EGC A;  5GAO n;  1KHI A;  3RER A;  1YJ9 Q;  2F5T X;  4QKU A;  3NPF A;  2BE7 D;  3LWI A;  1WHL A;  1I5L A;  4JZ3 A;  4LXC A;  1MV0 B;  2HQH A;  4EMG A;  3VRZ A;  2NLU A;  4XTU A;  3FIF A;  4J6X A;  2L3S A;  2ED1 A;  1PRM C;  2DM1 A;  2PUO B;  4OVA A;  4A63 B;  4FL6 A;  4AFQ C;  5GAN 4;  1BYM A;  1UGR B;  2CP7 A;  2DA9 A;  3EG1 A;  1GFD A;  1DJ7 B;  4M7D A;  2DD4 A;  2L8D A;  2MMP A;  5LJ3 f;  2CZ1 B;  1OU8 A;  4HCC A;  4JRK A;  2KT8 A;  3CEY A;  1OX8 A;  4J83 A;  1JXM A;  3VU3 C;  1S72 T;  1H92 A;  2DEU A;  4RG2 A;  2WAC A;  2GQI A;  1NPP A;  4FU6 A;  3H9N A;  1B7T A;  1G3T A;  1QVG P;  2MYS A;  2RQW A;  2OX7 A;  4M77 C;  1BBZ A;  2FZG B;  1YIJ A;  4YTL A;  1PC0 A;  4JRQ A;  2HQE A;  1U1S A;  2COY A;  2KXC A;  4M78 D;  1D1A A;  1WI7 A;  2NUT A;  2EWN A;  3QO3 A;  2X3X D;  4F17 A;  3M0P A;  3QDF A;  1R77 A;  2EQJ A;  4IKF A;  2E5K A;  3HRU A;  3EGU A;  3RMS A;  1CKA A;  1W1F A;  3PVQ A;  2QEX A;  4OB3 B;  1QVG S;  4J6W A;  1RAG B;  4PNO A;  3H0I A;  1J3T A;  1VQ5 Q;  4E7H A;  4C92 C;  4IUT A;  5GAN 2;  3EG3 A;  1FX7 A;  2OJ2 A;  4MDX A;  1BU1 A;  1D0Z A;  5GAO m;  3OYA A;  1UG1 A;  9ATC B;  3BFM A;  4AFZ C;  5KYX B;  2YSQ A;  3TSW A;  4V2S A;  3TCJ A;  4M7A C;  2LZ6 B;  2VVK A;  2X3W D;  3A8H B;  3M54 A;  2Y4X A;  1VQ8 T;  4M7D C;  1E6H A;  2JS2 A;  3VJP A;  2DXT A;  2C0T A;  1Q81 U;  4LNP A;  4FM4 B;  2DBM A;  3VS4 A;  2MAM A;  1CKB A;  2CKK A;  2QTV A;  2RD1 A;  2DER A;  2QAZ A;  3CCQ T;  2LRQ A;  5FWC A;  1NEB A;  5KYU A;  3L2U A;  3J7A F;  2IG0 A;  1BI2 A;  4IUV A;  4FYW B;  1QWF A;  1HYO A;  4PJN A;  2JOY A;  1BCM A;  2DZ9 A;  4PLL A;  3SFM A;  1N27 A;  3CCE A;  2DD5 A;  3NTH A;  2V1Q A;  3GF5 A;  2DL5 A;  1EX4 A;  1P92 A;  4JPB W;  3CCS A;  3QWY A;  4DOV A;  3CC2 A;  1YJW A;  2DRM A;  3ASK A;  3C0C A;  2HSP A;  1G3Y A;  3SB2 A;  3OYG A;  4C8Q E;  1YIJ Q;  3U23 A;  4M78 F;  4P5N A;  5IT9 E;  2DX1 A;  1AEY A;  2M0O A;  3I35 A;  4QVD A;  1PKT A;  2QQ9 A;  3EFS A;  1MNE A;  1U3O A;  3OYF A;  2YRV A;  2QEX Q;  2YUP A;  3L1A A;  3KUF A;  3J81 E;  2L0A A;  2PNI A;  3SEM A;  1OQK A;  1E6G A;  4LUD A;  2EKH A;  1ZSG A;  1TUG B;  2WSF E;  3NTI A;  1R0B G;  2X51 A;  1K4U S;  3FJ5 A;  1I0C A;  2PUK B;  1KC8 R;  1WJQ A;  3CXC S;  3CC4 T;  3VRY A;  3X20 B;  1N5Z A;  2AK5 A;  5IXB A;  4QVC A;  2R5A A;  1QP2 A;  4X9C A;  1UDL A;  1GXI E;  2Z0W A;  5HKC A;  3X28 B;  2X4W A;  3CCU T;  3R6N A;  4PFP A;  5KYX A;  2O88 A;  4J9C A;  5GAM d;  3RDV A;  2W10 A;  1WX6 A;  2R57 A;  4XU0 A;  2E12 A;  1LPL A;  2O01 E;  1JXO A;  4JS4 A;  1IO6 A;  2RA2 A;  3CCE Q;  2WSE E;  4A4H A;  3MET A;  2E3H A;  2EYQ A;  2K79 A;  2HBP A;  3CCS Q;  1M3C A;  1V76 A;  3OSS C;  3CC2 Q;  2HMA A;  3PMI A;  2BZY A;  4FCY A;  1YJW Q;  3QUI A;  1Y96 B;  4PJM A;  3UT1 A;  5GMK m;  4Z89 A;  2D8J A;  1AT1 B;  1MMN A;  1LNX A;  2I2L A;  1YI2 T;  3SD4 A;  4BE1 A;  2RM4 A;  1VOM A;  1RAB B;  3HRS A;  3QYH B;  1K0S A;  2HAX A;  4UC4 A;  1WJS A;  2AT1 B;  5AYF A;  6AT1 B;  4AMC A;  2PVO B;  3EH1 A;  1YIT Q;  3JCM X;  3ZBD A;  1YCS B;  2FG0 A;  2GFU A;  2B86 A;  2DL4 A;  4FIB A;  1VQK A;  1GFC A;  5L23 A;  2DLP A;  1ZA1 B;  2EYY A;  5I21 A;  4E2F B;  2KXD A;  4E7L A;  1RAA B;  5FRM A;  3S6W A;  3CCV A;  4KUL A;  4FT4 A;  3GOX A;  1IGU A;  1JU5 C;  3TEE A;  1K1Z A;  2P0P A;  1IHV A;  1WJR A;  2ZPE B;  1RL2 A;  2BKD N;  4LDW A;  1M9S A;  2XD0 A;  3OS1 A;  3TRE A;  1QKX A;  5GAN 5;  4C5I A;  1T3S A;  1N9R A;  2J6O A;  1LVK A;  3JCM h;  2SEM A;  3DB3 A;  3VS3 A;  2X4X A;  3MKD A;  4PJO E;  1FMV A;  2VC8 A;  3MP1 A;  2QI2 A;  4ME7 A;  3LGF A;  3O5Z A;  2HQX A;  2LTO A;  1UHF A;  2DZC A;  5CKH A;  1IRX A;  4OP0 A;  3VKI A;  1R0C B;  4M75 B;  1C6V X;  1EIF A;  2EQU A;  5J26 A;  3SWN B;  3G4S T;  2CP3 A;  3IQL A;  4A4G A;  3GNG A;  2QGG A;  5EC7 A;  5A0L A;  3FEO A;  2F2X A;  1X6G A;  2YLC A;  2XID A;  2EGE A;  5KE3 A;  2FPD A;  1VQO A;  4XU1 A;  2FPE A;  2KDS A;  1SRL A;  3JCM c;  4LD6 A;  3JCM V;  5HK3 A;  5LJ5 d;  1MHN A;  1VQ9 T;  2PVG B;  2LNV A;  3I56 A;  4JJB A;  3M5A A;  1Y96 A;  3FDR A;  1VQL T;  3THK A;  5A0D A;  1YJN A;  4B9W A;  3S3M A;  2BIV A;  1KQS A;  2A37 A;  2HSE B;  2DTI A;  3REB B;  1OYX A;  1VQK Q;  1YN8 A;  2OTJ T;  4M75 E;  4FSX A;  3M0R A;  2K7A A;  2O4X B;  3JCM d;  1M27 C;  1M1K U;  1AWW A;  2EQI A;  3CCM T;  4AFS C;  2YLB A;  3CCV Q;  2XIC A;  2QK0 A;  3NGP A;  2ZPH B;  3CC7 T;  5D6X A;  3VS1 A;  2EYW A;  3CMA T;  1NJI U;  1BI1 A;  1GBQ A;  3WVD B;  1KHC A;  1SEM A;  2J6F A;  4RMO A;  2K3X A;  1OI1 A;  4EIK A;  1WHM A;  1GL5 A;  3QKJ A;  4N0A A;  2QQS A;  2RHZ A;  1IHW A;  2BUD A;  2F69 A;  2RJF A;  2MIO A;  5CKB A;  2DK3 A;  1WQW A;  1RAE B;  3GBQ A;  2LMJ A;  1RLP C;  3QJ6 A;  1I07 A;  3L2R A;  4J7I A;  3FLG A;  3CD6 T;  3RKX A;  3OSV A;  4RTV A;  3BE3 A;  5FU7 B;  2ZPG B;  4PJJ A;  3ZL7 C;  1EZZ B;  1QVF S;  4AFU C;  2DTO A;  2RPN A;  4ZN1 A;  4M7A B;  4F14 A;  4LDX A;  1YHQ Q;  2E6Z A;  5A0G A;  4PL6 A;  1VQ4 Q;  3VUB A;  1M8M A;  1RLQ C;  1XTD A;  1U1T A;  2YXY A;  3QWX X;  3WVE B;  1IZ6 A;  4DBF A;  3M0T A;  2RHX A;  1WIE A;  4D8K A;  2DJQ A;  3SWN A;  4C0Z A;  3I56 Q;  2V1R A;  4II1 A;  1PRL C;  3HL8 A;  3VYH B;  4C0F A;  2QA4 Q;  4X1V A;  2NYS A;  3L2Q A;  2HEQ A;  5LJ5 e;  3JB9 J;  4BDZ A;  2VGN A;  1X2Q A;  4OMP A;  2D6F A;  4DBH A;  1PD1 A;  1YWO A;  3CCJ T;  4QW2 A;  4XTV A;  3V7R A;  1QWE A;  4M7A E;  1VIF A;  2VB6 A;  2A0F B;  1HD3 A;  3OYK A;  4BY6 C;  3JCM e;  3T9N A;  1N8R R;  4M7D E;  4IUU A;  4PKC C;  4F16 A;  1I8F A;  4C8Q D;  3PT9 A;  5GMK l;  2ATC B;  1ZUY A;  3EG9 B;  2O4X A;  1KD1 R;  1MMD A;  4BE2 A;  2VGM A;  2DXB A;  2RK2 A;  1W2B P;  2K5F A;  4RTU A;  3JB9 D;  1QP3 A;  3MEV A;  5GMK h;  2EVR A;  2J06 A;  4ZGD B;  2DRK A;  1RAI B;  3JCM Q;  3CME A;  3URG A;  2COZ A;  3DB4 A;  1IXD A;  1ZQ1 A;  2DFU A;  2KYM A;  1WQ7 A;  1K8A C;  2OI3 A;  1QCO A;  2J05 A;  1Q7Y C;  2F1L A;  5GAO q;  1EFN A;  1G83 A;  1HJD A;  2HCK A;  1T3L A;  2QTX A;  4OF1 A;  3CBO A;  1KIK A;  3SWN C;  2PU9 B;  1W6X A;  1OX9 A;  4OML A;  4F7U F;  1K8A U;  4OMQ A; 
#chains in the Genus database with same CATH homology
 3MHX A;  3JB9 H;  3OBY A;  1Q7Y U;  2JNG A;  1VQ7 T;  2JOY A;  2DZ9 A;  4PLL A;  3SFM A;  5CCA A;  1N27 A;  3CCE A;  2K2V A;  5LL6 S;  2DD5 A;  3LH0 A;  2JTF A;  3NTH A;  2R58 A;  3GIB A;  3GF5 A;  4JRP A;  1P92 A;  3JCM W;  4C0D B;  3I55 A;  3CCS A;  3M59 A;  4PJO B;  2JZ2 A;  3H6Z A;  4RKU E;  4DOV A;  3GNF B;  3CC2 A;  3OYL A;  4X34 A;  3QYG B;  2KSS A;  2CZ6 B;  3ASK A;  3ZEH A;  4A54 A;  1YJW A;  2OTL T;  1UGQ B;  4ATO A;  4M7A A;  3M4G A;  1G3Y A;  3BW1 A;  3SB2 A;  5GAM g;  5GAN d;  1VQ5 T;  1FXX A;  2XI9 A;  3OYG A;  3OW2 A;  3H8Z A;  4C8Q E;  3PGG A;  1O9S A;  3E9F A;  2ZZD A;  2QQB A;  3KXT A;  4M78 F;  4M78 C;  1N9S A;  3UWN A;  4NOY A;  4P5N A;  5IT9 E;  3UPU A;  5LJ5 h;  2K57 A;  3V7S A;  4QVZ A;  4HKE A;  1S72 A;  3EAE A;  2QXF A;  3GP8 A;  3G71 T;  2M0O A;  3A8L B;  1N6A A;  3A5Z B;  3X26 B;  2XDP A;  3HPW A;  4QVD A;  4DA4 A;  2EQM A;  3OY9 A;  2QQ9 A;  2E5Q A;  2RHY A;  3EFS A;  4M77 G;  5C0M A;  3OYF A;  2YRV A;  3F70 A;  2XDB A;  3OQ5 A;  2E70 A;  3PTA A;  1JB0 E;  2XHC A;  2E41 A;  3L1A A;  4RCB A;  3KUF A;  1MGQ A;  1Y07 A;  2EIF A;  2V8J A;  3ZFJ A;  5FLX E;  3J81 E;  4C8Q F;  2QQA A;  2XKO C;  1D3B A;  4C8Q C;  1YCY A;  4Z02 A;  5KH6 A;  3CPW A;  3VYG A;  2KAF A;  5J39 A;  1QVP A;  2WSF E;  3MEA A;  4NL3 A;  3CCJ A;  2DIG A;  1X75 C;  5L8R E;  3NTI A;  2RJC A;  4KUD K;  4E7K A;  2PUK B;  1WJQ A;  3CXC S;  3OS5 A;  3CC4 T;  5DLQ E;  3V8L A;  4GY5 A;  4HCB A;  3JB9 F;  2ZPF B;  3JCM P;  4QQ6 A;  4O6J A;  3MP6 A;  2MI6 A;  3X20 B;  5GAN 6;  3KBG A;  3HFO A;  5GMK i;  4BD3 A;  4BI8 B;  4HCZ A;  5GAM e;  4QVC A;  2R5A A;  5GAN f;  3OYN A;  4O5V A;  1QP2 A;  4IUP A;  4X9C A;  4C92 G;  1GXI E;  2RO0 A;  2VV5 A;  5HKC A;  2R5M A;  3X28 B;  3M58 A;  1UB4 A;  2X4W A;  1H64 1;  3CCU T;  1XQH A;  5GAN 7;  4N4I A;  4IUQ A;  3GPL A;  2L5Q A;  3M53 A;  1N8R C;  1YJ9 T;  1B34 B;  5CO7 A;  5GAN g;  2WSC E;  4XU3 A;  3QII A;  4Y91 A;  3FRN A;  4M7A G;  2D0Q B;  1YHQ A;  5FU7 C;  2V8K A;  4ZGE B;  4OGE A;  5CKF A;  1U8R A;  1KD1 C;  1M90 C;  4EMK A;  5GAM d;  3BY7 A;  1VQ4 A;  2RI3 A;  2K5L A;  1Q81 C;  1PSF A;  2G3R A;  2DJZ A;  4Y28 E;  2R57 A;  1PSE A;  2KK4 A;  2E12 A;  2IVW A;  4XU0 A;  4JS5 A;  4M7D G;  1NZ9 A;  2O01 E;  5GAN 3;  5DLO A;  4JS4 A;  5GAM j;  3LLR A;  2RA2 A;  2XU8 A;  1N8R U;  2E1H A;  5GAN 8;  2WSE E;  4A4H A;  1VQO T;  3MET A;  1BIB A;  2EYQ A;  2CGH A;  4ELZ C;  2EJ9 A;  2HBP A;  3V8J A;  2QA4 A;  2EJG A;  5IN1 A;  4EDU A;  1KD1 U;  1M90 U;  3GLX A;  3OSS C;  1QW1 A;  3CD6 A;  3MEW A;  3PMI A;  3CCQ A;  4DQ2 A;  3QUI A;  4OMF B;  1Y96 B;  4JUV A;  1HK9 A;  4TVR A;  4F7U G;  3UT1 A;  5GMK m;  3OYY A;  4PJO D;  2VXF A;  5CIU A;  4NS5 A;  1W2B S;  4J8O A;  5CQX A;  1YJN T;  1YBY A;  3QPH A;  2DXU A;  3CCL T;  1VQM T;  4OGC A;  2RJD A;  3CCR A;  1LNX A;  2I2L A;  2LCL A;  3SD4 A;  4L6V 5;  4BE1 A;  2RM4 A;  3CXC A;  1YI2 T;  4MZT A;  4E7I A;  2LX9 A;  3OYM A;  4KT0 E;  3L2W A;  4C0G A;  5GAN e;  5EG2 A;  2LVM A;  1G3W A;  3HRS A;  3QYH B;  4BUG A;  3RIR A;  3PIP A;  4XTY A;  1VQP T;  4XQ3 A;  2HD0 A;  4PJO A;  4M77 B;  4Q5W A;  3OMG A;  3CME T;  2HAX A;  4UC4 A;  1WJS A;  1X6O A;  2D9T A;  5FRO A;  3INZ A;  5AYF A;  1IRE B;  2PVO B;  3RES A;  1KQ1 A;  2EQK A;  5GAM f;  4QQD A;  3JCM X;  3SDZ A;  4FT2 A;  3L2V A;  2ZPB B;  4J5Y A;  3LX7 A;  2H3J A;  2JVV A;  4M78 G;  2JTM A;  3CBM A;  2DIQ A;  4XTZ A;  2GFU A;  3BDU A;  3C4S A;  3G6E T;  1QVG A;  1X01 A;  2XG8 D;  4JDS A;  1VQK A;  4FIB A;  5GMK e;  3RKY A;  2VUB A;  2LQ8 A;  2L3R A;  2RH2 A;  5I21 A;  1JJ2 A;  1OZ3 A;  3G71 A;  4A4E A;  5I2M A;  4E7L A;  4MDW A;  3QHS A;  5FRM A;  1Y7X A;  1NPR A;  3X25 B;  4N4H A;  3S6W A;  3CCV A;  1BKB A;  2FHD A;  5GAN j;  5LJ5 g;  4KUL A;  2KY9 A;  1XOV A;  4L5G A;  4RG8 A;  4ZN3 A;  5C6S A;  4FT4 A;  5KCO A;  1H3Z A;  3GOX A;  4BB7 A;  2LT4 A;  3NFC A;  2CYZ B;  3M55 A;  3PFS A;  2MF2 A;  1VIE A;  1WNL A;  2EFI A;  3ER0 A;  3RUX A;  3TEE A;  4C8Q G;  4C92 B;  1BI0 A;  2P0P A;  4EMK C;  1WJR A;  3A8G B;  3G7Z A;  2ZPE B;  1RL2 A;  3MCA B;  2EKO A;  1Q82 C;  2BKD N;  2E6N A;  4LDW A;  4CRI A;  1M9S A;  1KQS S;  2XD0 A;  1VQ6 A;  3OS1 A;  2LCC A;  3TRE A;  5GMK j;  3I55 T;  3CCS T;  1R8O B;  5GAN 5;  2DEQ A;  3X24 B;  4C5I A;  2K3Y A;  2F5K A;  4M77 E;  1BI3 A;  4M75 D;  3JB9 G;  3JCM g;  1N9R A;  3JCM h;  4R55 A;  5FRN A;  1M1G A;  3PMT A;  4ZTF A;  1V29 B;  4A4K A;  4HT8 A;  2XK0 A;  3DB3 A;  2Y4Y A;  2X4X A;  1VQN A;  1KC8 C;  4M7D B;  4PJO E;  3OYD A;  4B9X A;  2QQR A;  2VC8 A;  3MP1 A;  4X9D A;  3VV0 A;  2QI2 A;  1Q82 U;  3LGL A;  1NE8 A;  4ME7 A;  3LGF A;  5LJ3 g;  1RI0 A;  5LJ3 h;  2HQX A;  4M75 A;  3OA6 A;  2LC4 A;  2LQK A;  2LTO A;  3OS0 A;  2DZC A;  5CKH A;  3JRZ A;  1YJ9 A;  2GCX A;  4OP0 A;  3ME9 A;  4IUR A;  3MEU A;  3VKI A;  3HSB A;  5FU6 C;  1Y71 A;  1B34 A;  2L89 A;  3O8V A;  3S3O A;  1G3S A;  4M75 B;  5I2S A;  3PIO A;  1YIT T;  3QZ5 B;  1EIF A;  2EQU A;  2Y90 A;  3FB9 A;  5J26 A;  3SWN B;  5GAO p;  4BAC A;  3G4S T;  1KC8 U;  4E47 A;  2DVE A;  3NTK A;  4C92 E;  2X35 A;  4F7U B;  4A4G A;  3GNG A;  3OYE A;  4C0D C;  3P8D A;  4PJO F;  5A0L A;  3FEO A;  2K4Y A;  3L2Z A;  4PJO C;  2GFA A;  5M9O A;  2YLC A;  2XID A;  2RHI A;  4LD9 K;  3LWH A;  2B8A A;  1YIJ T;  4MML A;  2RB6 A;  5KE3 A;  2VYT A;  1VQO A;  4N0A C;  1M1F A;  3HP9 A;  4XU1 A;  4BI4 A;  4LDU A;  5CVI A;  1VQ8 A;  3QG1 A;  4E7J A;  1HXD A;  2KDS A;  5CK9 A;  3JCM c;  2K5I A;  4LD6 A;  3JCM V;  5HK3 A;  1MHN A;  1ZHI A;  3HRT A;  5LJ5 d;  2PVG B;  1VQ9 T;  3MP8 A;  3C12 A;  1K9M C;  2V8I A;  3JCM J;  2QDY B;  4KUI A;  2LNV A;  3I56 A;  3M5A A;  3M9Q A;  2CZ0 B;  1Y96 A;  2DKG A;  3FDR A;  3QJY A;  4M78 B;  4VUB A;  5LJ5 j;  1VQL T;  4DOW A;  5A0D A;  3HFN A;  2GQV A;  4QQG A;  2QEX T;  2PQW A;  4B9W A;  3OB9 A;  2BIV A;  4M77 D;  3S3M A;  1YJN A;  1KQS A;  2KQW A;  3CCL A;  4MMK A;  2E65 A;  1VQM A;  2DTI A;  1OYX A;  1KG1 A;  2DTH A;  2RK1 A;  2MWO A;  1W4S A;  4M75 E;  4FSX A;  2P0Q A;  2E10 A;  2OTJ T;  2O4X B;  3JCM d;  3OS2 A;  2EJF A;  1VQ7 A;  5CR2 A;  1M1K U;  3R6O A;  2RI5 A;  3J80 E;  1K9M U;  3CCM T;  5CKE A;  4BI3 A;  2YLB A;  2XIC A;  3M57 A;  4BE0 A;  2ZPH B;  4MZP A;  4PLI A;  2CZ7 B;  4F7U E;  4M77 A;  3CC7 T;  5D6X A;  4BDY A;  4JLI A;  4C8Q B;  3CMA T;  1NJI U;  3WXM B;  3QSU A;  4JJN K;  1BI1 A;  2RI2 A;  3WVD B;  4XTX A;  1KHC A;  2LT1 A;  3G6E A;  5LJ3 d;  4RMO A;  2OTL A;  4XTW A;  2K3X A;  1BIA A;  3TU4 K;  2OAU A;  1VQ5 A;  4NL2 A;  1OI1 A;  4ELY C;  1K73 C;  4C92 D;  5LJ3 j;  3OYB A;  3QKJ A;  4N0A A;  3A8M B;  2QQS A;  2RHZ A;  4XK8 E;  4M75 F;  4M75 C;  1XNI A;  2BUD A;  2FYK A;  2KVQ G;  2F69 A;  3S3N A;  5LJ5 f;  2RJF A;  2MWP A;  4WF2 A;  4EPC A;  2KMT A;  3L42 A;  3DLL A;  3CCJ T;  5CKB A;  5IAY A;  3LYI A;  3Q1J A;  1VUB A;  1O75 A;  3FJP A;  5KE2 A;  1I81 A;  4HA8 A;  3MO8 A;  2DK3 A;  1LOJ A;  1WQW A;  4M7A D;  4C92 A;  4XAX B;  3ZBD A;  1TH7 A;  4EMH A;  4CI0 C;  3OYC A;  1G5V A;  1JRI A;  3CCR T;  4BY6 B;  1K73 U;  2A3L A;  3QJ6 A;  2DAQ A;  5GAO n;  3L2R A;  3BDL A;  2RHU A;  1KHI A;  4J7I A;  3FLG A;  3QZ9 B;  2EAY A;  3RKX A;  4A4F A;  3CD6 T;  3RER A;  3OSV A;  4M7D D;  2F5T X;  3LWI A;  1WPY A;  2ZPG B;  5FU7 B;  1I5L A;  3CCE T;  2X4Y A;  2CS7 A;  3LW5 E;  4EMG A;  4LDV A;  3JCM f;  2VXE A;  2NLU A;  4XTU A;  3FIF A;  5GAM h;  4J6X A;  5DM7 R;  1QVF S;  2DTO A;  2AHJ B;  2PUO B;  3CBP A;  4OVA A;  4FL6 A;  4ZN1 A;  5GAN 4;  1BYM A;  1UGR B;  3CC2 T;  4M7A B;  1DJ7 B;  3JB9 I;  3CC4 A;  1YJW T;  4M7D A;  1VQK T;  4LDY A;  2DD4 A;  3QDR B;  2L8D A;  4LDX A;  1OZ2 A;  2MMP A;  1ZBX A;  5LJ3 f;  2GF7 A;  2CZ1 B;  5CQY A;  2E6Z A;  4HCC A;  4JRK A;  5A0G A;  4PL6 A;  4XU2 A;  3VUB A;  3N5B B;  5KCH A;  3CEY A;  1W2B A;  3CCV T;  1XTD A;  4C5H A;  4ZTJ A;  1M5Q 1;  2YHT A;  3P8B B;  1U1T A;  3C95 A;  4J83 A;  3E19 A;  1UEB A;  3VU3 C;  3WVE B;  1IZ6 A;  1YIT A;  1S72 T;  4RG2 A;  2RHX A;  3CCU A;  3G4S A;  2WAC A;  3AHU A;  1NPP A;  5CAI A;  3SWN A;  4OB1 B;  3A8O B;  4FU6 A;  4C0Z A;  2C06 A;  4PJO G;  1G3T A;  4F7U A;  5J3B A;  2ZCF B;  3RKW A;  3E9G A;  4II1 A;  4OB0 B;  3HL8 A;  4M77 F;  4M77 C;  5DY9 A;  3VYH B;  4C0F A;  3DKM A;  5GAO l;  1VQ6 T;  4JRI A;  1YIJ A;  4YTL A;  3L2Q A;  3OMC A;  4JRQ A;  1D3B B;  2HQE A;  5LJ5 e;  1U1S A;  1JBM A;  4OB2 B;  3JB9 J;  4BDZ A;  2DPP B;  2VGN A;  3C94 A;  3DLM A;  4M78 D;  3EFR A;  1KQ2 A;  2D6F A;  2X4J A;  2DXC A;  2ZGW A;  4QW2 A;  2EWN A;  3QO3 A;  2JN0 A;  3M4Y A;  4D6W A;  2E64 A;  2M1H A;  4XTV A;  3OYH A;  1VQ9 A;  1VQN T;  2DO3 A;  3V7R A;  3RMQ A;  4N4G A;  5HY6 A;  2EQJ A;  4IKF A;  3QBY A;  3V7C A;  1Q86 C;  4M7A E;  1VIF A;  3HRU A;  1VQL A;  3RMS A;  1M8V A;  3JCM b;  2QEX A;  4M78 A;  4OB3 B;  1QVG S;  4J6W A;  1FWZ A;  1SSF A;  4BY6 C;  3JCM e;  3OYK A;  4PNO A;  1M1K C;  3T9N A;  4HT9 A;  4M7D E;  5GAN h;  4IUU A;  4PKC C;  1JJ2 S;  3OW2 S;  1UGS B;  4E7H A;  1I8F A;  2P0K A;  4IUT A;  3PT9 A;  4C8Q D;  4C92 C;  3E1S A;  1FX7 A;  1LJO A;  4C92 F;  5GMK l;  5GAN 2;  5GAO r;  4MDX A;  2OTJ A;  1NJI C;  4C5E A;  5GAO m;  3OYA A;  2O4X A;  2P4T A;  3CCM A;  3BFM A;  4L59 A;  5HK0 A;  5CKD A;  4KBM B;  1QVF A;  3QXE B;  1Q86 U;  5LJ3 e;  2VGM A;  4BE2 A;  3CC7 A;  2DXB A;  1YI2 A;  2RK2 A;  2K5F A;  3OYJ A;  3CMA A;  4J7F A;  4EMK B;  3JB9 D;  1QP3 A;  3MEV A;  3TCJ A;  5GMK h;  1YHQ T;  4M7A F;  4M7A C;  4V2S A;  4C8Q A;  1UGP B;  3PNW C;  2PVD B;  4RCC A;  4ZGD B;  1VQP A;  3JCM Q;  3P8H A;  3CME A;  1VQ4 T;  3A8H B;  3URG A;  3HKS A;  3M54 A;  3FC3 A;  3DB4 A;  2Y4X A;  1VQ8 T;  3OBW A;  2M9U A;  4M7D F;  4M7D C;  1ZQ1 A;  2RJE A;  3JSC A;  1AHJ B;  4JLG A;  1WQ7 A;  1K8A C;  1I4K 1;  3VJP A;  4MZM A;  4M75 G;  2FB7 A;  2DXT A;  4C5G A;  1Q7Y C;  2JUF A;  3CPW S;  4ZGJ B;  2ZPI B;  1Q81 U;  3VUZ A;  4FM4 B;  5GAO q;  2LDM A;  3I56 T;  2MAM A;  2FVU A;  2CKK A;  2A7Y A;  3JAM E;  2RD1 A;  3UDC A;  1M4Z A;  2QA4 T;  2M16 A;  4GLK A;  2QTX A;  4OF1 A;  2FL7 A;  4J6Y A;  5D6Y A;  3CBO A;  3CCQ T;  5A2Q E;  2LRQ A;  3M56 A;  3HHT B;  3CPF A;  3SWN C;  3L2U A;  3J7A F;  2PU9 B;  3OYI A;  2HNI A;  1BI2 A;  2IG0 A;  4IUV A;  5D6W A;  3V8K A;  4A53 A;  4R56 A;  2XDD A;  4F7U F;  5FU6 B;  4M78 E;  1K8A U;  1WGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...