1EX4A

Hiv-1 integrase catalytic core and c-terminal domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
212
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACDWAGIKQEDGIPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNSLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Crystal structure of the HIV-1 integrase catalytic core and C-terminal domains: a model for viral DNA binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 49
structure length 212
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ex4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ex4A01
1HMVA 5J2PA 4HUFA 2IC3A 3OYHA 4E0DA 5FRNA 1XC9A 4B8CA 1IH7A 4CHYA 3LWLA 4E19A 4CEEA 1TL1A 3DRRA 4GVMA 4CESA 3HP9A 4CEQA 5E41A 1RDDA 1C0TA 3KKSA 3TI0A 1RILA 4L8RB 3SI6A 4OLBA 1JKHA 5FRMA 4DQQA 4JLHA 4DQRA 3H08A 3LZJA 4KI4A 3K58A 3DOLA 5D7UA 4CJRA 1JLBA 1WSEA 4OPJA 1A5VA 3C6UA 4R5PA 5J2QA 3CFOA 1SL1A 5K14A 1KCFA 4CCHA 3VQDA 4ZTJA 3G10A 4HCCA 2WONA 4B9MA 3T3FA 4O0JA 1HYVA 1XHXA 4NCGA 3TAMA 1FKPA 4BDYA 3ZSXA 4BWJA 1QHTA 3LWMA 1GOBA 3L2UA 1NK5A 1EETA 3DLBA 3TR8A 1RTIA 1QMCA 1DLOA 2WOMA 1IKVA 1TK5A 1RT5A 1CXQA 1ZBLA 1TVRA 1LV5A 2HVIA 1TV6A 1BCOA 4FJLA 1J9AA 3ZSQA 4JS4A 3ULDA 3V4IA 3WNGA 1N5YA 3AVCA 1EXQA 4KREA 3SZ2A 1RT6A 1TKXA 4FJHA 3QEVA 2HHSA 1JL2A 3A2FA 4O55A 1SL0A 3MEEA 3LP3A 1JLEA 4FJ9A 2E6MA 4ID1A 1KTQA 3QNNA 4CJUA 3SJJA 2KW4A 3ITHA 3KLHA 3NH1A 1JXEA 3SNNA 1NK6A 1ZBIA 3S3NA 1RCHA 3VQ7A 3WNFA 1NJWA 2X78A 5HBMA 3SQ1A 3SUQA 2FBVA 3KD1E 5I42A 1F21A 4M3ZA 3S3OA 2OA8A 5CY4A 4IG3A 1XI1A 2FBTA 1BI4B 3T19A 2HHWA 4I7FA 5J1EA 3SCXA 4MQ3A 3M8QA 1NJZA 3NGYA 2KTQA 3QIPA 3S9HA 1S9GA 1LWFA 1KLNA 1QS4A 4DU3A 5DMRA 4E3SA 2A1SA 3ASMA 3BGRA 4CJWA 3OYNA 2YKMA 1O1WA 3SQ0A 5CYMA 3SUOA 2IDOA 4E7KA 3E01A 5KI6A 4AH9A 3QETA 1NK8A 4B9SA 4ELUA 1HYZA 2ATQA 1NK9A 2PYLA 2BDPA 4J2DA 1D5AA 4CJVA 3CM6A 1WSJA 4PQUA 4B9VA 2IOCA 4FM2A 3NH0A 3V9WA 3LPUA 4FK2A 3OYGA 2ETJA 4ZTFA 4KPYA 3HPGA 4BE2A 4BE1A 4FLXA 4FK4A 1S1UA 1WLJA 3RRHA 3HSTB 1S1VA 2IAJA 4OPKA 3O3GA 1BI4A 4PY5A 3V1OA 2B6AA 3O3FA 3KJVA 4DSFA 4DS4A 3RMCA 1Q9YA 3NGIA 4GW6A 1D8YA 3ZSWA 3K59A 4Z4CA 2QKBA 3AO1A 2ZE2A 3MAQA 3ZSYA 1FK9A 4KI6A 2DY4A 1HJRA 3OYEA 3RRGA 4B9LA 3VQCA 4DSLA 1Q9XA 1Z25A 5C25A 3AVBA 3OS2A 1TL3A 4C8KA 4KHWA 2HNDA 1HNIA 4KV8A 4CE9A 3V9SA 4WE1A 4B9NA 3KLFA 1G15A 1UOCA 2O4GA 1IHVA 1C0MA 1WSIA 3CM5A 3L3VA 2D5RA 5FDLA 4KB1A 2KFZA 4CEAA 3PO4A 2XO7A 3QINA 4QOZB 1KVCA 4LSNA 4DTMA 1NK0A 4CJLA 3LAKA 4IFVA 1BIZA 4LY7A 2DFHA 1TKTA 4BE0A 2YHAA 2RKIA 4CEZA 4DQIA 3LZIA 4DSEA 4O44A 3AA2A 4CJSA 3SPZA 1TK0A 3O4NA 2GV9A 3AVKA 1RTJA 2GUIA 3VQ6A 3B6OA 4Q5VA 1JXBA 2W42A 2R7YA 3SUNA 2Z1JA 4LD0A 4DQPA 1RT2A 1VSHA 3LANA 2FBXA 2KZMA 1BHLA 1A5WA 1C6VA 2RF2A 1HRHA 2BANA 2HNYA 4KTWA 3NCIA 4CGHA 2HW3A 4YFUA 4JRQA 3QO9A 2E4LA 3OYBA 3ISNC 3DLGA 4I9LA 4DTRA 1RDAA 1UAXA 2XY8A 4FK0A 3NH2A 2YHBA 2KQ2A 4HCBA 3AO5A 3VQ9A 3TARA 1T05A 4E7LA 1WSHA 4B9TA 2HHTA 4CGFA 4Z4HA 2I5JA 5C42A 3ZSRA 4FXDA 1W9HA 1N6QA 3SQ4A 2HHQA 4BACA 4CF8A 4CGJA 4FLUA 1KFSA 2HHUA 3RWUA 1KRPA 3LP1A 3K5NA 3V81A 1RDBA 4Y1DA 4CF1A 5FROA 3S3MA 2OYQA 4FYDA 1S5JA 2RN2A 1NJXA 3M8RA 4CF2A 1BCMA 4EP5A 4DTNA 2A1RA 1WSGA 1D9DA 3HL8A 3VQAA 5CZ1A 2QXFA 4Y1CA 4G1QA 4DTSA 3AO3A 5D3GA 2G8HA 3EY1A 2HNZA 2BGGA 1VSMA 4W5OA 3DMJA 4KHQA 4CIEA 1T8EA 3HJFA 4PA1A 4FJKA 4B8AB 4M3XA 4EZ6A 2O4IA 4E7JA 3NDKA 1WAFA 3VQEA 1EKEA 1RT7A 1CZBA 2ZQBA 3AVIA 4CERA 3V9XA 4KO0A 4KTQA 3ZT3A 1UWBA 1CLQA 3C94A 5HP1A 3LDSA 1U47A 1RTDA 2PZSA 2PY5A 4KB0A 1Q8IA 1KVBA 4KHSA 1BQNA 4FJ7A 1UA0A 4C8LA 3C95A 1L3UA 2EHGA 1RTHA 3D45A 1UA1A 3TWHA 4IDKA 5HRNA 3CQ8A 4DU4A 2YNHA 4Z4EA 4CHZA 1IO2A 3K5MA 3K57A 1S1WA 4E1NA 4NYFA 3NFAA 4YNQA 2VG5A 1X9WA 3L3UA 3JSMA 4N56A 3L2QA 1QSLA 4H4MA 4DF8A 5KRTA 1ITGA 2XY7A 1Z26A 1NJYA 1U49A 4O0IA 3V6DA 1GOAA 2XY6A 2P51A 4Z4IA 2HMIA 2VWKA 1RT1A 1WN7A 4CHOA 3PV8A 3DLHA 1WSFA 3OY9A 2JLEA 2OPQA 4OKKA 3OYDA 3HPOA 1LWCA 1BQMA 1ZYQA 4FZXC 4CK2A 3NGZA 1ZBHA 4N41A 2F8TA 3AVJA 4DFKA 4EP4A 3L2VA 4M3WA 3NAEA 3F9KA 1SKRA 4BWMA 4BDPA 2BE2A 5KTQA 2FC0A 1IKYA 4RW4A 4DSJA 3U6FA 4F3OA 3IG1A 1U48A 4F8RA 2D0BA 2X6SA 4CIFA 4TSXA 4DU1A 3NF9A 1IKWA 3SYZA 4FM1A 4E7HA 3IRXA 5CZ2A 4J2AA 1HQUA 3KLGA 4DSIA 3LP2A 3KK3A 4DTJA 5HRPA 3JYTA 4O4GA 1L3SA 4FJGA 3AVGA 4FJMA 1TGOA 1SV5A 1DTQA 2IGIA 1LWEA 2YNIA 3KIOA 4ID5A 3B6PA 3OYKA 1SUQA 3RR7A 1KFDA 4M42A 3QLHA 4DS5A 4RW8A 1B9FA 1FXXA 2XY5A 4H8KA 3OYIA 1YTUA 3KK1A 4OLAA 2D0CA 3AVFA 3K2PA 4RW7A 3PX0A 2RPIA 1IKXA 1C1CA 3TAQA 3HXMA 4DSKA 1FKOA 1B9DA 3TAPA 1U45A 3HVTA 1LAVA 1TKDA 3QESA 4DWIA 2YKNA 3OS1A 3AVHA 3NF7A 3VA3A 1KVAA 4CHQA 4GMJB 2OZMA 4K8ZA 4NCBA 4XIUA 4DLEA 4FLTA 1NKCA 4OKJA 1Y97A 3HT3A 1NOYA 3IAYA 2P1JA 3QEPA 3K5LA 2B4JA 1VSIA 4CFDA 3T1AA 4CJQA 3M8PA 3RTVA 4DFJA 2Z1HA 2Z1GA 3NF8A 3VQQA 3OYMA 1JLCA 3ZT1A 1C1BA 3AV9A 3OVNA 2X74A 2YV0X 1EX4A 4FLWA 3I8DA 2LSNA 3L8BA 1R0AA 4AHVA 3WNEA 2P5GA 1CZ9A 4ELVA 4FLVA 4F3TA 3ZT4A 5HRSA 2B5JA 4N5SA 4I2PA 4QCLA 3AA3A 1SKWA 3QEIA 3RMDA 3CFRA 1CXUA 3QIOA 4M3RA 4E1MA 4DQSA 3P1GA 1JLGA 1S6QA 4CJTA 3MXMA 4KAZA 1IHWA 5CYQA 4W5NA 1LW2A 3U3GA 4CEFA 3HPHA 5HROA 4CF0A 4KHNA 2HVHA 3SUPA 3EZ5A 4ELTA 1C6VX 1QQCA 3NHGA 5JS2A 4FLYA 3ALYA 1S6PA 1YTAA 1VSFA 5HRRA 4AHUA 4CJ5A 3HVRA 4AILC 2YNFA 4OVLA 4NYNA 3VQ5A 4CGGA 4FW2A 3F73A 1RNHA 4DFMA 1TAUA 1L3VA 4CFCA 1NK7A 1SKSA 1A5XA 3MEGA 2NUBA 3AVNA 1RBTA 4UQGA 4FJJA 1ZBUA 5EU7A 4FW1A 2XHBA 4FJ8A 4FVMA 3TAFA 1NK4A 3DOKA 2OPRA 5DK5A 3OS0A 3OYJA 1VSDA 3DLEA 3QEWA 3LPTA 4CJ3A 1X9SA 3VQ4A 4PUOA 3K5OA 1J53A 4M3YA 4I2QA 2PYJA 1JLQA 3DYAA 3RMBA 4DFPA 3NBPA 3SQ2A 3OYFA 3IS9A 3WNHA 4HUGA 3V1QA 4CEBA 1C0UA 1T7PA 1BL3A 4AHCA 2YNGA 3TAEA 1GOCA 3O4QA 3C6TA 1NKEA 3PX6A 5SWMA 1I39A 4AHTA 1NKBA 1XWLA 4K8XA 4KKOA 2G8VA 5JS1A 4ZHRA 1RBSA 4JRPA 1X9MA 1W0HA 2VG6A 1HYSA 1VSKA 4PWDA 1RBVA 4AHRA 4DTOA 4KHYA 1L5UA 4F2SA 4CGDA 2Y1JA 4HTUA 4CHNA 5HLFA 1ASWA 1T03A 2OPPA 4J2EA 4Z4GA 1DTTA 1QSSA 4IKFA 4DMNA 4N76A 1JLFA 4FJ5A 1RBUA 4J2BA 1MU2A 3AA5X 1TKZA 4KTZA 1KLMA 4C8NA 3V1RA 4CFAA 4RW9A 3OJUA 3DM2A 4W5RA 2P5OA 3HP6A 4I9QA 3RMAA 4DTPA 1EP4A 4HHTA 1KSPA 2F8SA 1VRTA 4F4KA 3KLEA 1XHZA 4FZYA 1C1AA 2G8FA 3VQBA 2JGUA 4RG8A 1S1XA 4MFBA 4Z0UA 2VWJA 2HB5A 1U4BA 2Q3SA 4H4OA 1NOZA 4LH5A 3KKRA 3SPYA 1QTMA 4N47A 3O3HA 4CF9A 4JS5A 4W5TA 1HNVA 3MEDA 3KLIA 4CJEA 3TAGA 4E89A 1RT3A 4CEOA 4CGIA 4F2RA 3LAMA 5KRSA 1JLAA 2KZZA 3VQPA 2XRIA 3DLRA 5SZTA 1U04A 1YVUA 1X1PA 2IS3A 2Z1IA 3AVLA 4CJKA 3NE6A 1VK0A 4C8MA 4LSLA 3HK2A 2QK9A 4CHPA 3I0SA 1J54A 3VN5A 1TAQA 4CJ4A 1JL1A 2ZD1A 5KGXA 4DTUA 3KTQA 4IBNA 3V9ZA 3PX4A 4Z4FA 1I3AA 3ZCMA 1VSEA 4OGCA 4Q0BA 3TANA 1L3TA 5T7BA 3BDPA 3MXJA 3PUFA 4OKEA 3U3YA 3DRPA 3ZT2A 1QSYA 2DTUA 1WAJA 4CFBA 3PY8A 4OJRA 1VSJA 2OPSA 3VQ8A 4CECA 4M41A 2AJQA 1ASVA 1ASUA 3QERA 1RBRA 3OYCA 4B3OA 1S9EA 3OYAA 5J2NA 2DFFA 3FFIA 3AVMA 3LALA 3CG7A 3QEXA 4B08A 5C24A 4E7IA 3DRSA 4BDZA 1YT3A 4CEDA 1IG9A 4CIGA 4RW6A 3ZT0A 3CFPA 4M3UA 1ZBFA 2GBZA 3DI6A 2E6LA 3AO2A 2ITGA 4DF4A 3MXIA 2G8WA 3ZSOA 3L2RA 4NCAA 3AA4A 1LAWA 3DLKA 1BGXT 2EX3A 3MECA 3P5JA 5KGWA 4AHSA 4CK1A 5J2MA 4CK3A 3P83D 1VRUA 3EYZA 3VA0A 3OYLA 4IFYA 4ICLA 4FLZA 1D9FA 4KHUA 3HM9A 3KD5E 4M3TA 4LH4A 4DG1A 4FJIA 1BISA 3G0ZA 2G8IA 4M45A 1LW0A 3UIQA 2HHXA 2G8UA 4CJPA 3LP0A 2FBYA 3OJSA 4EZ9A 4FJXA 1VSLA 4IG0A 1RT4A 1RDCA 3ZSZA 1WNSA 2X6NA 1SL2A 4OGEA 2D0AA 3RR8A 3AVAA 1QE1A 4QAGA 3NF6A 1HQEA 4O5BA 2DFEA 4DLGA 3KK2A 4FM0A 2Y1IA 3M8SA 3SV4A 1J5OA 3ZSVA 4B9UA 3I0RA 1K6YA 3THVA 1TK8A 4KFBA 4C8OA 2QKKA 4FZZA 3HYFA 3D0PA 2G8KA 4HVJA 4FCYA 4CJFA 4FJNA 4DTXA 2F96A 1BIUA 3QNOA 1B92A 1HPZA 1S1TA 2VG7A 4W5QA 2OZSA 4KRFA 2HHVA 3L2WA 5I3UA 4HUEA 1REVA 3TABA 3SV3A 2KFNA 3CYMA 3HO1A 3AO4A 3V9UA 3PO5A
chains in the Genus database with same CATH superfamily
1BWFO 4E0DA 2R5AA 1NG2A 2QYZA 1YFNA 5IHIA 1IH7A 3O9QA 3ULEA 4B8CA 3CCVN 4C8QA 4B3TK 4E19A 4CEEA 3DRRA 3R1XA 4CESA 2GX9A 2VB6A 2IIMA 3NGPA 1C0TA 3UPUA 4EFHA 5CE3A 4M78E 4YOVA 3CCRT 1JKHA 3SI6A 4OLBA 2CZ0B 3J7AP 2ENMA 3SMPA 2DF6A 3H45C 3K58A 3QSUA 1OI1A 3G71A 1VQ7T 4IXCA 3SBTA 5F0XA 1MNDA 4OPJA 2OAWA 3G1JA 4R5PA 3CCMN 4CCHA 4WFNL 2XHCA 2DK3A 2AKKA 3O1BA 2JZ2A 4HCCA 3HSCA 2A36A 3T3FA 4XEIA 2FRWA 1HYVA 3TAMA 4PLIA 1FKPA 4J9GA 1Y71A 5LJ5g 1QHTA 2W6KA 1X6BA 2PU9B 2QTDA 1EETA 3FZMA 4MLEA 1RTIA 3N4QA 5M1QA 5FU6C 1DLOA 2WOMA 2EGEA 3CETA 3ZYYX 1MV0B 2PVOB 1YCSB 1LVKA 1BCOA 2ASMA 1J9AA 4CZEA 3ZSQA 2K5LA 3V4IA 2CREA 2KXDA 4GNIA 4YOXA 1X2QA 3LGLA 4KREA 2DYIA 2FZCB 1TKXA 3UATA 1JL2A 4AFZC 1SL0A 3MEEA 3LP3A 5CQYA 4FJ9A 2E6MA 1KHIA 2COZA 4HXJA 5C2FA 4CJUA 1T44A 5KPTA 3KLHA 2XKOC 3SNNA 1ZBIA 4IOAL 1DT9A 3S3NA 1WXTA 4B9QA 2VC8A 3WNFA 1VQ8T 2PBDA 1XQSC 2A37A 4AM6A 4CZGA 3SQ1A 2RNAA 1WZOA 2FBVA 2LJ1A 3EFOA 2PVDB 4MDWA 5GANe 1H1VA 2NRVA 3JCMc 5I42A 1FX7A 1VQ4A 2OA8A 4BR9A 2HHWA 2KE9A 3M8QA 1WPYA 2KTQA 2E3IA 3QIPA 2OTLN 4J6XA 5AQNA 1N9SA 1LWFA 3GL1A 2A40A 2M9UA 3REAB 1TG0A 2L8DA 3IFRA 4DU3A 1HKGA 3IQLA 1UFFA 4BY6B 1O1WA 3H3NO 4AG1C 2DE0X 4QW2A 4XTYA 3H6EA 4ELUA 4J9FA 2BDPA 4CJVA 3QBYA 4OVAA 3VS2A 1WSJA 3HKSA 5I2MA 4M75E 1Z9ZA 4FM2A 1HNZK 4O8KA 3LPUA 1I5OB 1YI2A 3TPQA 4R0KA 2K57A 1VQ9T 4FLXA 3CCSN 2HEQA 3RRHA 3LWHA 3HSTB 1D0YA 1S1VA 3R6MA 1JJ2A 4IJAA 4JJDA 2M51A 2B6AA 3BZCA 2UUCK 1IV0A 1G3YA 4A62A 3NGIA 4GW6A 2LNVA 1I0CA 2DVJA 3CBMA 4GVEA 1QP2A 2R58A 2O2OA 3VOVA 3SK3A 3G7ZA 4A4FA 2ZE2A 1M90R 3ZSYA 3O08A 3OYEA 1M90O 4DSLA 3ASKA 2BIVA 1Z25A 5KYNA 4OF1A 4A4GA 4XTVA 1TL3A 4ZGEB 2RI3A 4FU6A 4KBOA 2Q0UA 3UA6A 1G15A 1QKWA 1IHVA 1VQ7A 1WSIA 1ABQA 1D0XA 3EHQA 2LQ8A 3BUZB 3CM5A 1NMNA 2E2NA 3PO4A 1Z9QA 3QINA 2X51A 1KVCA 1GCQC 4LSNA 2DL3A 1VQLA 4HT9A 3VEOA 4CZJA 4CJLA 2HKNA 1Q7YU 4JK9A 4LY7A 1VHXA 4JJCA 2RKIA 2YHAA 2R57A 4CEZA 1YJ9T 3LZIA 1J6ZA 3L6QA 4EMKB 4CJSA 4A4HA 2MCNA 3CPWS 3AVKA 2R7YA 2GUIA 4D6WA 2LP5A 2RI5A 4LD0A 5LY3A 1RT2A 1VSHA 3LANA 3A98A 1XJWB 2EYQA 2EJFA 2FBXA 4LF5K 1MWMA 4KTWA 1A5WA 1C6VA 2RF2A 4O8UA 4JRQA 4YFUA 2MPXC 3OMGA 3V7CA 1VQ6T 3T7ZA 2YHBA 2RQVA 4E7ZA 3AO5A 3TARA 1YIJN 1T05A 4E7LA 2EQMA 4B9TA 5GAN8 1EWQA 3VS5A 1UDLA 3QYGB 4Z4HA 5FU6B 2I5JA 1VQ8A 2WBNA 3ZSRA 1W9HA 4BUGA 3SLCA 1YITT 1Q82R 5C42A 5HL7L 3I55N 3M3ZA 1KFSA 2E41A 5CCAA 5L8RE 1KRPA 4XTXA 2NRXA 1SRLA 1RDBA 2RJDA 2D9TA 1M2OA 2RN2A 3EL2A 1NGHA 3N4PA 1FMKA 4EMKA 2D0QB 1TUUA 3AGRA 2A1RA 2K6DA 3X25B 3MK6A 2CUDA 4DUZK 2HQHA 1WHLA 1TS9A 2D0NA 1M1KO 3QO3A 2ZZDA 2ZM6K 2K4YA 1FMVA 1VSMA 3DMJA 4JI1K 4W5OA 4JEPA 2YHTA 3X28B 4JKBA 4FJKA 4B8AB 4DR7K 4EZ6A 3VV0A 1KJWA 3AHUA 1WAFA 4JI3K 1EKEA 1RT7A 1CZBA 2P4RA 4F9OA 3OA6A 3VEYA 3J7ZO 4IUPA 3AAQA 4KB0A 1OH8A 3VF4A 2YDLA 1KVBA 4KHSA 3JCMP 2P9KA 4FJ7A 3CCUA 4B6MA 1OH7A 1TUCA 1L3UA 5BPLA 3EGXA 2X4JA 2EHGA 3TWHA 4IDKA 1VA7A 4BY9C 1U5SA 4DU4A 1YAGA 5CK9A 2LCCA 3CCQQ 1IO2A 2JMCA 3A8LB 1S1WA 2CZ6B 2OX7A 3CCJN 3M0UA 4H4MA 2ATCB 4M77C 1AD5A 5KYUB 1QSLA 5KRTA 1KAXA 4L3QA 4YOYA 5L23A 1WXBA 3CCLN 4QKUA 2FF6A 3V6DA 1OKJA 2OTJN 2P51A 1TUGB 4Z4IA 4JYAK 1YJNQ 3O9RA 1HSQA 2LZ6B 2LTOA 2VWKA 3ZBDA 1RT1A 1WN7A 5AQMA 4U7BA 1NYFA 4JK7A 1ZYQA 1LWCA 3NGZA 5GAN6 4N41A 2F8TA 3VS1A 1VQPN 3TSPA 3THWA 5HK3A 3PLAA 1N8RC 4F3OA 5J3BA 4CIFA 1RGIA 4TSXA 4DU1A 1IKWA 3KK7A 5J39A 1YUWA 3SYZA 3LM2A 5BR8K 1NM7A 3KK3A 3M9QA 1VQ6A 2I7PA 1VQNT 1U1TA 4GY2B 3AVGA 3FIFA 1HX1A 5KE3A 1NM1A 2IGIA 1OYXA 1ZHIA 3B6PA 3UDCA 2P9IB 1YITA 1G8XA 2JJ9A 1KFDA 2P9UB 1JCFA 3DWLA 2XY5A 4BREA 2O9SA 4C0ZA 2D0CA 3AVFA 3K2PA 3CMAN 4GKJK 2CP2A 2RHXA 4RTXA 1K0XA 4DSKA 1B9DA 5GANj 3H46O 2ITMA 1RAHB 3HVTA 3TAPA 1U45A 2CDTA 3RESA 4DWIA 1CKBA 1JEGA 1SSHA 2VWFA 3NF7A 3VA3A 4NCBA 5I9EB 4XIUA 3OW2A 3OA9A 1LJOA 4E2FB 1NKCA 4OKJA 3HT3A 3VU3C 3KWIA 3RMQA 3IAYA 3JB9J 2JTMA 5FU7C 5GJVB 5KYWB 1WYXA 2B4JA 5I11A 4H0OA 3T1AA 2P4TA 1MMGA 1W2BS 4EDUA 3NF8A 1WNLA 4LUDA 2GQVA 1YHQQ 3ZT1A 1UECA 1QZ5A 2X74A 3CCET 2LSNA 2M02A 4OMMA 1K73R 1IG8A 1BKBA 3NFCA 1B3QA 1VYTA 3CQTA 3QEIA 4CD3A 1TSFA 3RMDA 1CXUA 4M3RA 1GLDG 2L3SA 3EG0A 1HPMA 1JLGA 4L6V5 3CC7Q 1S6QA 3FJ5A 5AQVA 3MXMA 3I56N 4LF9K 4W5NA 3GBTA 2I2LA 3HPHA 1JCGA 4J7IA 4JD2A 2O9VA 3EZ5A 4ELTA 1BI0A 3NHGA 5JS2A 1OX9A 1S6PA 2FRYA 4F7UG 3ALYA 4LNPA 2E12A 5HRRA 2J7IA 5FPDA 5HOOA 1NNEA 1TWBA 2YNFA 2CT3A 5AZJB 5M1OA 2DKGA 5LJ3j 4NLBA 3VQ5A 4NYNA 3F73A 4FW2A 1RNHA 1NPPA 1NK7A 3CJCA 1L3VA 3MEGA 3AVNA 3CPWM 2A08A 3GNFB 4FW1A 4FJ8A 4FVMA 1G83A 1NK4A 2DPPB 4M77B 3DLEA 5AQZA 3LPTA 4IZ9A 2QAZA 1HKCA 4JI4K 1UGVA 2L3QA 3CCVQ 2JTEA 2RJFA 1HJDA 2MWOA 1ESVA 2XU8A 4IUTA 3DYAA 2FEIA 4H0XB 1KD1R 4BC4A 3RMBA 3QYHB 1WHHA 2EKOA 3OYFA 3WNHA 4ZGJB 4C92B 1VQNA 3TAEA 1GOCA 3G71N 5KYYB 1NKEA 2K3YA 3KUFA 5AZJA 4JUVA 1M90C 2E1ZA 3CCMQ 4KKOA 5JS1A 2FPDA 3THYB 2GGRA 2BKDN 3A5ZB 2QG9B 3FR0A 1M5Q1 3M54A 2DA9A 1PSEA 3M53A 2QQSA 3SJHA 4JZ3A 5HLFA 1GRIA 4J2EA 2ZGZA 2OPPA 5LJWA 4IKFA 2ROTA 1E4GT 4DMNA 4FJ5A 1I1JA 1RBUA 2E1HA 4L59A 1XQHA 2A0FB 2P5OA 3RMAA 4DCHA 1RAIB 4C92A 3JCMg 4HHTA 4M7DB 2EQUA 2F8SA 2C0OA 5KYYA 1VUBA 2L0AA 1P90A 3KLEA 1Y0MA 3CCEA 5KYXA 4J83A 1KC8R 3VQBA 5LJ5h 4Z0UA 1HLUA 2UU9K 1ACMB 3KZBA 1VQ4N 2KVQG 4MMLA 3M58A 4EPCA 2FO0A 1YJWT 3C0BA 1BIBA 3P38A 1Q7YO 3CMET 1CKAA 1D1BA 3T1YK 3O3HA 2G6FX 4NL2A 3VGLA 1QWEA 1WJSA 3E1SA 5FPMA 1HNVA 2OTLQ 4CF9A 4CJEA 4W5TA 1M9SA 4CEOA 3GPLA 5IHKA 4CGIA 1X6GA 4IEIA 1Q82C 1OV3A 2X3WD 3MP8A 1YCYA 4XH5A 4BC3A 3QMLA 1BUPA 1U2VA 5ELZA 2DL8A 4CI6A 2IS3A 3HK2A 2DETA 3NE6A 3TEEA 3FZKA 4LSLA 3V7RA 3EN9A 4F14A 4DOWA 4M7DA 1YI2N 3KTQA 4Z4FA 2YCHA 1BI3A 4MO5A 2K5IA 1I3AA 4JI6K 4WF2A 2HBKA 2HSPA 4IWVA 3THXB 3BDPA 2O31A 2QEXA 3CCSQ 4OKEA 1XOVA 2NUPB 2K2VA 3DRPA 3ZT2A 1QSYA 2RH2A 3VUZA 4OJRA 2P9LA 1DJ7B 4FT2A 4KRFA 1M1GA 4CECA 2O88A 2XICA 3OYCA 1ARKA 3HTVA 3X24B 5J2NA 5AR0A 2FL7A 1QQNA 3LALA 1H92A 1M4ZA 5GMKh 4EHUA 1YWOA 2O4XB 3LX7A 3ME9A 1MMNA 5IAYA 4E7IA 3DRSA 4BDZA 4A2AA 1SEMA 4ILGB 4OP0A 1J5EK 1MNEA 4OPHA 1VQ7N 2RO0A 2E6LA 1NGIA 3U4LA 4HVVA 3PSIA 1VQLN 3AA4A 4CRIA 1FJGK 3P5JA 1KHCA 5DLQE 2EX3A 3UKRA 1XUPO 3EYZA 5AQUA 4FLZA 4A2BA 2R5MA 2JW4A 3ZX0A 4DG1A 5BPNA 2NUPA 1LW0A 2HHXA 3PFSA 4M63C 2FBYA 3EFRA 4EZ9A 3VF6A 4IUUA 1BA1A 4C5IA 4F7UF 2DX1A 2V1QA 1RT4A 3ZSZA 2J6KA 2FB7A 1Q81O 3RR8A 3ENOA 4JDSA 2HBLA 4H5NA 4DLGA 3SBGA 2HF4A 1SPKA 2LRQA 3SV4A 2C06A 3EE9A 2MF2A 1K6YA 3THVA 6AT1B 1TK8A 1M27C 2M1HA 1VQOT 3C65A 4FZZA 5D6YA 1YIJQ 1VQ8N 2G8KA 4M7AD 4FCYA 3TSWA 4MDBA 4CJFA 2EVRA 4DTXA 3C6HA 3I55Q 4DV5K 3A5NC 4WQ4C 4W5QA 2VG7A 1FW6A 1YJWA 4YOTA 4EMHA 4HUEA 4MLHA 3TABA 2KFNA 3AO4A 3TSQA 4A5BA 4F7UE 3DB4A 5JLFA 1HMVA 3LDLA 2IC3A 2KLAA 3OYHA 3A5OC 3IDHA 2ZJQL 5FRNA 2CH4W 1RDUA 2YT6A 1XC9A 5KQ8A 4CHYA 3LWLA 1WQWA 1I5LA 3GE1A 4GVMA 3HP9A 2PQWA 4M7AF 4JK8A 1BI2A 4DEXA 2W40A 1Q86U 1RILA 5CO7A 4L8RB 1TU0B 4E47A 5BN8A 5FRMA 2UXDK 4DQQA 2EGCA 1WBDA 5FWBA 1HJOA 1JJ2S 4KRTA 4BB7A 4OMFB 4CJRA 1JLBA 3ZETA 3CCUN 1QKXA 3C6UA 4BR4A 5GAN4 1VQKT 3CFOA 1K9MR 4ZTJA 5BPMA 1GBRA 3G10A 1H8KA 4KGXB 4DR2K 3O8VA 4BDYA 1XHXA 3E9PA 3L2UA 1GOBA 4IO9L 4JKFA 1NK5A 2F2XA 1K73C 2L3RA 1QVGA 1IKVA 2ZJPL 3QFPA 3CCJQ 3MJXA 5LJ5d 1TUDA 5GAOm 1QVFA 1TV6A 2YHYA 1WHKA 4M7AE 1B07A 4JS4A 2DTOA 2FXUA 3A8YA 3AVCA 3MX5A 1U3OA 4KBMB 2RJCA 3CCLQ 1EXQA 3K0SA 3SZ2A 5FWCA 2OTJQ 3O4WA 1M2VA 3WVEB 4GKKK 2J4RA 4ID1A 1LCKA 3TU4K 2CGJA 1JXEA 4AM7A 2JM8A 4M75G 4PJOA 1QHAA 2A42A 2I7NA 5DM7R 2QWQA 5HBMA 3SUQA 5EX5A 1VQPQ 4IG3A 1XI1A 3SWNA 3M5RA 1S1NA 3J80O 1QCNA 4I7FA 3SCXA 1M1KU 4BRKA 4A54A 3ZX2A 1UEBA 4DV4K 2DYBA 3BEXA 1K8AO 2QI2A 2A1SA 2YKMA 4PLLA 1ZSZC 1A0NB 3U9DA 3SQ0A 1VQ6N 2ECZA 2IDOA 5KI6A 4AH9A 1VQOA 3QETA 1NK8A 4YOUA 4B9SA 2O8BA 2ATQA 1PHTA 5FLXO 1NK9A 2PYLA 3V8LA 1YITN 1D5AA 2CP3A 1UHFA 1V76A 4K11A 2IOCA 1KD1C 1YVNA 4FWNA 4D8DA 3DLMA 4FK2A 3OYGA 1HD3A 1E4FT 4ZTFA 1TH7A 5LMNK 3CMAQ 3HPGA 4GY5A 1WLJA 1UGPB 3H0IA 4N4IA 4XAXB 1WUAA 1YP5A 5CVIA 3E2UA 2IAJA 3O3GA 2UXBK 2LQWA 2E65A 2RA2A 3CXCA 3VS6A 4I6MA 4MZMA 4MO4A 4DS4A 4ILHA 1Q9YA 2ZPBB 2EYZA 1R0BG 2P9SA 4M78C 4Z4CA 4IEEA 2KY9A 2QKBA 2DY4A 1Y96A 4BR2A 1FK9A 5KPRA 1HJRA 4YY3K 3QDRB 4RMOA 3QZ5B 4PNOA 4F17A 4KHWA 3VTIA 4BI3A 4WE1A 4BQZA 4RG2A 1UGRB 3KLFA 1N33K 4KB1A 4CEAA 1VQKA 4QOZB 2AKLA 3LGFA 2RK2A 1BIAA 3KBGA 3G4ST 2QDLA 1XNRK 2DFHA 2HF3A 1KK7A 2RD1A 1KC8C 2VGMA 4A61A 4DQIA 4DR4K 2MOXA 3I56Q 4O44A 1TK0A 3AT1B 3O4NA 2GV9A 3VQ6A 1Q7YC 1UJYA 4B1UB 4DQPA 5D6XA 4LDXA 2JNGA 2MWPA 1BHLA 2Y4XA 2F1LA 2BANA 2HNYA 3ID8A 5C12A 3VJPA 3HTRA 2M16A 1NGDA 4DV0K 2E4LA 4BRFA 3FB9A 3JCMb 4I9LA 4DTRA 3V8KA 2CZ7B 2XY8A 1M8MA 4WTOB 2KEAA 5KH6A 1ABOA 5AZIB 2AT1B 3H3OB 4RCHA 2JMAA 1QLYA 2F9TA 2HHQA 2KGTA 3W3DA 3TTCA 3RWUA 5CR2A 3WXJA 5FPEA 4YTLA 3CIPA 3BZKA 3UT1A 3WVDB 5FROA 4CF1A 5GANg 2OYQA 4KH1B 2LJ3A 5D6WA 4EP5A 1WSGA 4NB4A 2LMJA 4Y1CA 4K41A 3BFMA 1IZ6A 4G1QA 1VQNN 4DTSA 2HL5C 1RFQA 5D3GA 4M75C 3EY1A 2HNZA 2BGGA 3G71Q 3URGA 1P92A 1U6ZA 4KHQA 4H0VB 4C1NK 2LQKA 2D8HA 3PMTA 4M3XA 4B1WB 4E7JA 3NDKA 3MEWA 4CERA 4M75D 5AZIA 2ZQBA 5EY4A 1CLQA 4MZTA 1UWBA 3C94A 1NGBA 5HP1A 3LDSA 1RTDA 2PY5A 3QFUA 4J5YA 1N9RA 4JZ4A 2XDPA 3OW2S 1WJRA 2D0OA 4BQLA 2GWJA 2LT1A 2V8IA 3C95A 3H0HA 1RTHA 1UA1A 1IBMK 2JTFA 5HRNA 2WC9A 3JS6A 4Z4EA 3R6NA 3GIBA 1N6AA 2Y4YA 3K5MA 3O80A 2ABLA 4C0GA 4E1NA 1FYNA 2VG5A 5EC7A 4RCCA 4PKIA 5F2RA 1AT1B 5GAMe 4KH4A 1NLVA 3ATVA 4M75F 2UYTA 5AQYA 3CCEN 1NJYA 2CH4A 4B1YB 2XY6A 2DTIA 5LJ3g 3CC4Q 3CC4A 2HMIA 1KQSP 4X66K 1YN8A 1BOTO 1VQ4Q 2ZPFB 3EGDB 1ZX6A 4FYVB 4XTWA 1WSFA 4AF1A 2D0PA 2JLEA 2DRMA 2OPQA 3G4SA 1KG1A 4M78B 3A5LC 4OKKA 3S41A 4CK2A 3JCMW 3QEPA 1ZQ1A 4EP4A 1SKUB 3L2VA 1HK9A 1VQMT 2VCPA 1KQSM 2GBQA 4M3WA 4QS8A 2KBTA 5CIUA 1WLPB 2BE2A 4CZHA 3JCMJ 5M1FA 3JCMh 3U6FA 3QBWA 4FWSA 3IG1A 3DLLA 2X6SA 4BC5A 4EIKA 3A8HB 3V7SA 1EQYA 3IRXA 5CZ2A 4J2AA 1BDGA 3IMXA 4NLCA 3VMFB 5ADXH 3BY5A 1YI2Q 1ZSGA 5GAOp 3PVLA 3A8MB 2SRCA 5GAMf 4OMLA 2QEXN 3OYKA 1LWEA 3KIOA 3HFNA 3JCMV 3RR7A 2CSQA 1SUQA 2ASPA 5AQQA 4M42A 4DS5A 1FXXA 1MMDA 4TVRA 1X3MA 3ATUA 4H8KA 1BA0A 4JNEA 1GLCG 3EG2A 2DO3A 1MA9B 3PX0A 4ELYC 2RPIA 4B1XB 2VGNA 1IKXA 2X4WA 3TAQA 5C0YA 1RACB 2RB6A 3IUCA 4OB3B 5AQWA 2JWLA 1KIKA 3CCRA 4OMQA 3QIIA 1K9MC 1GLBG 3AVHA 3L4IA 4GMJB 4CHQA 1NGCA 3HI0A 4K8ZA 4DLEA 3D2FB 3INZA 4FLTA 2NLXA 4Y0WA 1VQ7Q 1IRXA 1Y7XA 2EBPA 2B8AA 4FIBA 4P5NA 2NRTA 5AQJA 4U67L 4PL7A 3K5LA 2FHDA 3R3LA 2D6FA 2DNUA 4JJNK 1S3XA 1M30A 2ZWHA 1VQLQ 3CERA 2H3EB 2YJFA 1RI9A 2VKNA 4WF9L 4DFJA 4A53A 2DILA 4DKWA 2GTJA 3H6ZA 3E19A 3AV9A 3OVNA 2MYSA 2FZKB 2YV0X 1WDXA 2E6NA 4M4ZA 4WQ5A 5BRDA 1R0AA 3P4IA 1CZ9A 2P0PA 2EWSA 4CVNE 4F3TA 3ZT4A 1AVZC 3AA3A 3M57A 1SKWA 4FT4A 1NYGA 3CFRA 3DLLL 4DQSA 3P1GA 2ZPHB 1IHWA 3EG9B 3RKWA 2QK0A 3NTKA 1LW2A 3U3GA 1NU0A 4GV6A 4CF0A 2QA4T 2PVGB 3SUPA 3EH2A 5LJ5f 5AQSA 4OMPA 2HMAA 4PQUA 2FZGB 1YTAA 2ZGYA 4CJ5A 4AHUA 3KXTA 1VQ8Q 4J8OA 1SZ2A 2K3BA 1AWXA 4XU1A 8AT1B 1NJIU 3FE1A 1YJWN 4OVLA 4CGGA 2DBMA 4ORZA 3WT0A 2NZTA 2F2VA 2NUBA 1RBTA 4UQGA 3NVKA 2B86A 1ZBUA 4JKGB 3FJPA 1VQMA 2VASA 2DERA 2OPRA 3OYJA 3DOKA 5DK5A 4JI2K 1M1KR 2OJ2A 2PTKA 2Q36A 1Y64A 4LFCK 4ZGDB 2JUFA 1J53A 4JKAA 5GADP 4M3YA 3EG9A 2GEMA 2CSIA 3QPHA 1I81A 1MHNA 1HYOA 1MWKA 4CBXA 4HTLA 3SQ2A 4IURA 3QICA 3RKYA 3V1QA 1T7PA 3T9NA 4AHCA 2P9NB 3AARA 3LM9A 5BRFA 3O4QA 1VQ9A 2XDDA 2MMPA 3C6TA 3Q7CA 1WIEA 1OVYA 3LLRA 1TTHB 3MWTA 4CZMA 3BY7A 3CCUQ 4J9IA 2G8VA 4XU2A 5JLHA 3MEUA 4ZHRA 3ZLJA 2EFIA 3J81O 4JKGA 4KHYA 3MP1A 1Q81U 4DV7K 1L5UA 4PKHA 5CKFA 5ADXA 3M0PA 1PKSA 2O01E 2VYTA 4CHNA 3FLGA 4CC3A 2EWNA 2F2WA 4Y28E 3J7YP 4J2BA 3J80E 1MU2A 3H1VX 4WFBL 3CJAA 3V1RA 4ME7A 4RW9A 1B7TA 2JS0A 4J6YA 4H5TA 2K7AA 3CD6T 3HP6A 1PRMC 2WSFE 3G25A 4AQYK 2P9NA 2QASA 4I9QA 1EP4A 1BB9A 1VRTA 2DVEA 3U8XA 4R79A 3VERA 4FZYA 2LX9A 2AZSA 1YJ9A 3CC7T 1WXUA 4XU3A 5FLXE 3JCMd 2E88A 2HQXA 1U4BA 2Q3SA 4H4OA 1NOZA 1HKBA 2Z0WA 1QTMA 5AQFA 5DY9A 4JS5A 2E6ZA 2JOYA 3J8AA 2XMFA 2RM4A 2KMTA 2IPOB 5KYUA 4B9XA 2V26A 3LAMA 2HHHK 1TXQA 2QA4A 3SD4A 1VQ6Q 2XK0A 1JLAA 1VQON 2KZZA 3C7NB 2KT1A 2XRIA 3DLRA 4IOCL 1EFNA 1V4TA 2MIOA 2Q2RA 1VK0A 4C8MA 4CI0C 1OULA 1YITQ 5M1PA 3I9QA 2KR3A 4CHPA 3I0SA 1W1FA 5GAMj 1TAQA 1N5YA 3V9ZA 4BR7A 3WQTA 4C92D 3JAMO 4OGCA 2KAFA 3TANA 2D4WA 3VEWA 3OYYA 1QQJA 3REBB 3U3YA 1ILYA 4HA8A 2O8EB 4XH4A 2DTUA 2KDSA 1OZ2A 1WAJA 2BH1A 3PY8A 4DQ8A 4ISGA 4M41A 1ASVA 3MPUB 1NPRA 1RABB 1RBRA 4EIAA 2XI9A 4IIOA 1S9EA 5BRHA 1GCQA 5MLCQ 4B3OA 3EGUA 2DFFA 3AVMA 4X34A 5AQTA 4YOWA 4B08A 4JKHA 1BU1A 1GLEG 1V29B 2GCXA 5C24A 2GFAA 2A41A 1YT3A 4C92F 2KT8A 3ZFJA 2P9IA 2GBZA 2P9UA 2CUBA 1VQKN 3LDQA 2DJQA 2ITGA 2G8WA 4RTVA 1RAFB 3MECA 5C2DA 1AZGB 5EG2A 5KGWA 9ATCB 3CC2T 1BU6O 2YUPA 2D1KA 3CPEA 4CK1A 1QVGS 3TSZA 3VA0A 5J2MA 1D9FA 4KHUA 4H0PA 3S6WA 3HM9A 3LDNA 4M3TA 1C0FA 3H0FA 3EO3A 1QVFS 1K8AU 1BISA 4LH4A 4M45A 1W97L 2G8IA 3UIQA 2O8CB 2CP0A 2G8UA 2WUSA 1DEJA 3OJSA 4FWMA 4KH5A 2UUBK 2ZAEA 4CZKA 4IG0A 4X9CA 4RTFD 2XG8D 1RDCA 4DR6K 2HL3A 5CAIA 1D1AA 2Y90A 5KYWA 3CPWP 2HHTA 4LD6A 3C4SA 1LPLA 4ATOA 3GDQA 4QT7A 1J5OA 3MP6A 1PKTA 3CD6A 4C92E 3DB3A 3ZSVA 5J26A 4RCBA 3I0RA 1IBKK 4PFPA 4B9UA 4FL9A 2PNIA 4J6WA 1M3BA 5C6SA 5GAGP 1PNJA 2E2OA 2V8JA 3O6WA 3VPZA 2EAYA 2X35A 3O9SA 2OZSA 2HHVA 1HPZA 3EH1A 3TSUA 1ZBXA 4LE9A 2XDBA 5FPNA 3IKMA 3HO1A 3CBPA 1IB8A 1H3HA 4FSXA 2FSJA 2DRKA 5GAOn 2KK4A 4HUFA 2X4XA 4V2SA 1IXDA 1PC0A 1VQNQ 3HM8A 5GIPA 2CGLA 1TL1A 4CEQA 5E41A 3H41A 1RDDA 3KKSA 3TI0A 3UWNA 1R0CB 2FSKA 4QVCA 4M7AG 1WFWA 4AFQC 4VUBA 3ZEHA 2FSNA 3I5SA 1G5VA 2DZCA 4XQ3A 4GBQA 5DM7L 1HNXK 5AQXA 3CXCS 3PIOL 1VIEA 5D7UA 1Q86C 5GANh 1WSEA 2FF3B 4M77A 3JB9D 3UE5A 1A5VA 3JB9H 3OQ5A 4EHTA 1UUEA 1KCFA 1K9AA 1N36K 5EVZA 1I07A 2WONA 1XC3A 4NCGA 4RTUA 1OX8A 3D7EO 1D0ZA 2BZXA 3ZSXA 3LWMA 1EWRA 3L2ZA 1QMCA 3A5MC 1TK5A 1BBZA 1RT5A 1CXQA 1LV5A 1TVRA 2MK5A 3GOIA 4FJLA 3CCEQ 3MN6A 3M56A 3LDPA 3CC4N 1RT6A 4FJHA 1BI1A 4FVUA 1JRIA 2HHSA 3A2FA 4C0FA 3JB9F 4O55A 1C0GA 1Q7YR 3THYA 3HRUA 4J9HA 3UKUB 1JLEA 4RWTA 1U1SA 2YI1A 5GAOq 3G4SN 3CC2A 1KTQA 1HUXA 3SJJA 4K43A 5AJ3K 4LDWA 5FU7B 3CPWA 4A4EA 1SF9A 2YLBA 1RCHA 3SAGA 3ZEUB 1NJWA 4RTYA 3UA7A 2L89A 1F21A 4M3ZA 3S3OA 4FK4A 5CY4A 5CHIA 1GLAG 4H5WA 1BI4B 2KRMA 2V8KA 5J1EA 1NJZA 5BREA 1KQ2A 4MZPA 5DM6L 4XK8E 5LJ3h 4YDUC 3OYNA 2OAUA 4C8QG 1M1KC 4QS9A 3SUOA 2VYPA 4E7KA 1IGUA 4ZN3A 3E01A 2RI2A 4LUEA 2NRRA 3WXIA 2QEXQ 4J2DA 2K3XA 2QQBA 3EKSA 1NJIO 4B9VA 3CQYA 1HXDA 2YUNA 3ULRB 3NH0A 2DXTA 3E1YA 4KPYA 2NUZA 4BE1A 1ZUUA 2F9WA 1S1UA 3CCRN 4OPKA 2BZYA 1GLJO 4JLIA 1BI4A 1ZBJA 4PJOD 4PY5A 1YWPA 3KJVA 3M0SA 3HFOA 1UTIA 4PL6A 2DD4A 4HVUA 1YBYA 1WHMA 3ZSWA 1D8YA 1RI0A 3QXEB 3KFVA 3JB9I 3AO1A 3BW1A 3HOSA 3MAQA 3C6AA 3RRGA 4FWPA 2L5QA 1T3VA 1Q9XA 1OVQA 5C25A 2ESWA 3AVBA 4C8KA 3THXA 4KV8A 4CE9A 2JN0A 3OSVA 4B9NA 1UOCA 5FDLA 1IG9A 2V1RA 1W2BP 3QZ9B 2K79A 2QTVA 2D5RA 3L3VA 5BN9A 2DEUA 2KFZA 4PJOF 4J9DA 2YX6A 1UJ0A 2RF0A 1NK0A 1Q81R 1OEBA 2DL4A 4IFVA 1WQ7A 3META 1BIZA 2LVMA 1TKTA 3VTHA 1W2BM 2EYYA 4H0TB 2J05A 3CCLT 1T3LA 2O4XA 1ZA1B 4M7AC 3AA2A 4LFAK 5AYFA 4DA4A 1ATSA 3P8HA 2W42A 1RDWX 2NRHA 4IFEA 3B6OA 1OU8A 1JXBA 2EIFA 2C0TA 3RUXA 1AWWA 2WFBA 3D6RA 2EQIA 3PIPL 1YNZA 5GMKi 3VS0A 2A6AA 4J9EA 1S72T 4H0YB 2KZMA 4C23A 2JT4A 4ZN1A 2HW3A 4N0AC 4Z88A 1HRHA 3Q7BA 4BGBA 4CGHA 4BI8B 2J06A 3QO9A 3HBTA 3ISNC 1YJWQ 4PKCC 1RDAA 1UAXA 1M3CA 3CMEQ 1VQPT 2CS7A 2X9HA 3CMEA 4HCBA 1ZC6A 2KQ2A 5AQPA 3VQ9A 3NH2A 2ED1A 1VQMN 5I21A 1VYUA 4PJOE 3LYIA 4OMNA 3I35A 4N4HA 3SQ4A 4CF8A 4CGJA 4FLUA 2DPNA 3RBBB 2SEMA 3K5NA 4JI8K 2WSEE 3BDLA 2KQWA 1S5JA 3M8RA 1X43A 4O5FA 4CF2A 3QDFA 3V8JA 3J81E 3ZX3A 4DTNA 4AFSC 5AFUA 1OQKA 3HL8A 2ZPGB 1UG1A 2QXFA 5GANd 5CZ1A 1KXPA 2DLPA 2YSQA 3VQAA 1VQ9N 4CBWA 3AO3A 1VQ5T 3TU5A 3OSSC 5I22A 1SRMA 2G8HA 4FWRA 5BR9A 4CIEA 1TYQB 1FMWA 4PA1A 4C0DC 4C5GA 2I0NA 1PCXA 3VQEA 4XH1A 2RK1A 4KO0A 2JXBA 4JAXA 1OPKA 2AHJB 2QGGA 2HNIA 1FWZA 2PZSA 4BRDA 1Q8IA 3AGKA 1V4SA 4C8QC 3HRSA 1XMQK 1UA0A 1E6HA 3L0QA 2A3ZA 2A7YA 2CKKA 3D45A 4HWIA 1SSFA 3G6ET 4C8QD 3HHTB 4J9CA 1X9WA 4E7SA 3JSMA 3MEAA 3BDUA 4A5AA 2ASOA 4N56A 1QZ6A 4F7UB 1ITGA 5EOYA 1QWFA 2XY7A 4YHHK 4V19S 1Z26A 1YJ9N 2O8FB 4O0IA 1GOAA 1TYQA 5CKHA 4JHDB 3NVMA 1SS6A 3R9PA 1T0HA 2K9GA 1GLFO 2EGAA 5AQLA 3SFMA 3DLHA 5B8HA 2COYA 3OYDA 1GCPA 2KHOA 5LJ3d 1K8AR 4ILJA 2P9PB 1ZBHA 3AVJA 2GNCA 3JAME 4DFKA 4C8QF 3CJ7A 3WXLA 4PK4A 2QA4N 4DUYK 3D2EB 3KWGA 3NAEA 3ULDA 1SKRA 4BWMA 4OB1B 4BDPA 5KTQA 2FC0A 1IKYA 1X3NA 1VQOQ 4LD9K 4AT1B 1Q82U 3VUBA 3F5TA 4BRLA 3HOTA 2D0BA 3FC3A 2D8JA 1S72A 3NF9A 1XNQK 4DV1K 4FM1A 2RE2A 4F7UA 3OTOK 1UE9A 3RSEB 3KLGA 4DSIA 3JYTA 2O8FA 4JHDA 4O4GA 1L3SA 2E8AA 2JS2A 1TGOA 3SAFA 1SV5A 5EXWA 4FJGA 4LFBK 2QXLA 4ID5A 4M7AB 3RVCA 4RW8A 4LDVA 2RHZA 1K8KB 2BZ8A 3OYIA 1WB9A 4C8QE 2P9PA 1YTUA 4RW7A 3UF4A 1NLPC 4X64K 1Y57A 1C1CA 4Q5WA 2HBWA 2VQFK 4DV3K 1LAVA 1TKDA 3K9JA 1KAYA 2DJZA 5A2QO 4DEYA 3MDQA 2OZMA 2NUTB 3MN5A 1VQ5A 1WHGA 1Y97A 3L42A 3QWYA 1M1FA 1VSIA 3VRYA 1VQKQ 1WX6A 1K4US 3M8PA 4J9BA 1ZBSA 2HQEA 2Z1GA 3LH0A 2CGHA 3OYMA 1JLCA 2YHXA 3VQQA 1C1BA 1PRLC 2ED0A 2W0ZA 4KH6A 4CJ7A 4KUDK 4LDUA 1EX4A 3CPFA 1AWOA 3I8DA 5AT1B 3L8BA 2J6FA 3CI5A 2P5GA 2JWKA 3RMSA 2RQTA 3HRTA 1K8KA 2BTFA 2GTDA 4GLMA 1RAGB 4ELVA 4KUIA 4I2PA 4QCLA 4NS5A 4JLGA 3JV3A 4BY6C 3PGGA 3O5BA 2FVUA 4IDHA 4C5EA 4CJTA 4KAZA 3G6EA 4JKEA 4WQ4A 1PD1A 1ZUKA 3TCJA 3CD6N 2FPFA 1RUWA 2BE9B 2CP5A 3PE0A 5CKBA 1C6VX 2DIQA 3EG1A 3GOXA 4FLYA 1BK2A 2MAMA 1MV3A 2A28A 1VSFA 4AILC 4RTWA 4X62K 1NEGA 3DJCA 4FL6A 4NL3A 1B34B 1MGQA 2QGFB 3L1AA 1GFCA 4LDYA 3F9MA 1OOTA 3RDVA 3QG1A 3NMZC 2QWLA 3EZWA 1A5XA 2P0KA 4CFCA 1SKSA 4FJJA 5EU7A 1NJIC 1JXOA 2KRNA 3J7AF 3TAFA 4OB0B 1VSDA 1X6OA 4XTZA 1JXMA 3VQ4A 4PUOA 1JBMA 4A59A 1YI2T 3K5OA 1N8RO 4I2QA 1W4SA 1JLQA 4CD1A 1G3WA 4DV6K 3NTIA 2J6OA 3SEMA 3IS9A 4HUGA 4E1JA 1C0UA 2OANA 2YNGA 2EJ9A 2G3RA 5LL6S 4NXMK 3R8EA 5GAHP 1I39A 1ZSZB 1NKBA 1B34A 3P31A 1SHFA 1JJ2P 1I94K 1XWLA 4EMKC 4NO7A 3M4YA 2F5TX 1X9MA 2VG6A 1VSKA 3ID6A 1RBVA 4AHRA 2RPNA 1VAZA 5AQKA 5IWAK 3N5BB 4CGDA 3THKA 1JJ2M 2WACA 4HT8A 1E7OA 1ASWA 2E2PA 3MX2A 1K73U 1VQLT 3EFOB 3CBOA 4N76A 2YUQA 1Q81C 5AQIA 1QQOA 4XTUA 3AA5X 2RQWA 4KTZA 2P0QA 4C8NA 2AP1A 4PJNA 3OJUA 3DM2A 3CC2N 4JI5K 3G4SQ 4DR5K 5TKYA 4F4KA 3VGMA 1VOMA 1ZSZA 2G8FA 1S1XA 4JKDA 7AT1B 4MFBA 1ATRA 4GV9A 3VETA 4BROA 1SQKA 5GAEP 1QCOA 1G99A 4CW7B 2BE7D 2YHWA 5GAOl 2F69A 3M4GA 3F2KA 3NMUA 3GLXA 4BVPA 1EZZB 4KGVB 3MEDA 3MHXA 5HKCA 4E89A 4JV5K 3OS5A 4X9DA 3H1QA 2WTUA 5LMUK 5KRSA 5GIOA 2QWRA 3VQPA 1UGSB 3TQ7P 3SAHA 5SZTA 1YVUA 3SHWA 1X1PA 3MEVA 1Y07A 4IUVA 2E3HA 2KYBA 2IVPA 2DD5A 2QK9A 3EGDA 3C0CA 3VN5A 2K5FA 3QBXA 2IVOA 2VXEA 4M78A 1QCFA 2JM9A 4B1ZA 3PX4A 2HMPA 1JO8A 4PFZA 1KD1U 1GLLO 1MDUB 2KNBB 2H3GX 2UXCK 3PUFA 1D1CA 3CCRQ 4DBHA 3K9KA 5LJ5e 2H3JA 4JRKA 1XTDA 2LCSA 2HZYA 1VSJA 3VQ8A 4M77G 1JB0E 3BE3A 3QERA 1Q86R 3Q1JA 3OYAA 2E1YA 3SMSA 3WXKA 2CYZB 3FFIA 4FO0A 3RNJA 2GFUA 3QEXA 2AZVA 3CCUT 5GANf 5AQOA 5IHNA 2NRZA 3P8DA 2KKZA 2GQIA 3JCMX 1NGFA 3ZT0A 1ZBFA 2GF7A 3CFPA 4C92G 2COWA 3DI6A 3CCQT 3AO2A 4DF4A 3MXIA 1K0SA 4AG2C 2EYXA 3L2RA 3ZSOA 4NCAA 4PHTX 4CC7A 4FOEA 1M3AA 4DBRA 5IXBA 1ZXOA 3DLKA 4CBUA 4M75B 5LJ3e 3P83D 1UHCA 1VRUA 3OYLA 2AK5A 4ICLA 4LF8K 2DIGA 2DL7A 3E9FA 3KD5E 5GINA 4FJIA 1H3ZA 3G0ZA 4JJBA 1KQSA 4LC9B 3LP0A 1EIFA 1YJNT 1KC8U 5LL6Z 1VSLA 3D2FA 2HKQB 3EAEA 4Y92A 4DV2K 2DZ9A 1K8AC 2E4HA 1WNSA 2QWNA 4OGEA 2X6NA 3TTDA 3AVAA 1QE1A 4QAGA 3NF6A 1HQEA 1U06A 2HSEB 2DFEA 3KK2A 5IH2A 1KFZA 3CMEN 5HK0A 4KFBA 4C8OA 2QKKA 4DQ2A 5GMKe 3E9LA 2IVWA 4M7DG 1VQMQ 5KE2A 3MO8A 4K42A 3VEVA 1I4K1 4FJNA 1H641 4M75A 2DTHA 1B92A 1BIUA 1S1TA 3RKXA 2CH5A 2F96A 3QNOA 1N32K 3L2WA 5GMKl 3X20B 4QS7A 5LJ3f 4H03B 2AA4A 3FDRA 3T69A 3CYMA 3MWPA 4MDAA 2VXFA 4X1VA 5J2PA 2CGKA 1OPLA 5JICA 3E9GA 4FOIA 2XD0A 2P9KB 1Q82O 3GP8A 1VQ9Q 2VQEK 1QW1A 4DBFA 4CZIA 2PUKB 3EGXB 2YLCA 1G3SA 4L5GA 1NEBA 1HR0K 2P84A 1ZUYA 4CC2A 2YRVA 2V7ZA 4JLHA 3H08A 3LZJA 4DQRA 1YF5L 3EEQA 4BG8A 4KI4A 4FPBA 3CJ9A 3DOLA 3OBWA 1NLOC 2VV5A 2KXCA 1R59O 5J2QA 1SL1A 1AEYA 4YORA 5K14A 4GV3A 3VQDA 4B9WA 4OMOA 1GFDA 4NXNK 3C12A 4K25A 3M6GA 4B9MA 3OW2P 2DMOA 4O0JA 3NTHA 1YHQT 4BWJA 2YXYA 4BRHA 3PNWC 4IJNA 3DLBA 3TR8A 3AY9A 1KQ1A 4XU0A 1ZBLA 3FZHA 2HVIA 3OW2M 1NMDA 3THWB 8ATCB 4RUGA 4FSVA 3WNGA 3H9NA 1YJ9Q 3QHSA 3TVTA 3QEVA 4G9ZA 5KPZA 1KAZA 3CCQA 1XMOK 2E5QA 2LNHB 3JB9G 3SDZA 2W41A 2WSCE 2F5KA 3QNNA 1RAAB 3RIRA 1NK6A 3TREA 2KW4A 3ITHA 3NH1A 4DR1K 4RKUE 1HNWK 3VQ7A 4A63B 2DXBA 2DEQA 2X78A 2QA4Q 3HRGA 3WXMB 3KD1E 4M77D 4ELZC 1YJNA 2ZF5O 2FBTA 3T19A 4MQ3A 1LNXA 3EFSA 4QQ6A 3NGYA 1U8RA 5JVHL 3S9HA 1S72N 4B3RK 4C92C 1S9GA 4HCKA 5GAN3 3MCPA 1KLNA 1QS4A 5DMRA 4E3SA 4EAHD 3ASMA 2VWBA 3BGRA 3FLCO 4CJWA 3EKUA 1LCUA 4R55A 2PZ1A 4F16A 5CYMA 3EG3A 5A2QE 1NE8A 3B8AX 1WOQA 3MKDA 2YWWA 2YJEA 1JU5C 3CCVT 1HYZA 3T1HK 2RHUA 3CM6A 3WQUA 4II1A 4M77F 3CJBA 3V9WA 2DXCA 2RMOA 2ETJA 4D8KA 4BE2A 3OBYA 3FZFA 4CZFA 4ISEA 3QB0A 2QW9A 3JCMQ 1AZEA 2VVKA 2E20A 2Q97A 3C7NA 2F7TA 3V1OA 1N5ZA 1PD0A 1QP3A 1W6XA 3VEZA 2BUPA 2FYKA 3O5ZA 3CCMT 3DAWA 4BR5A 3O3FA 4DSFA 3RMCA 2RQUA 2RN8A 1VQ5N 2ROLA 5A0DA 1K9MU 4M7DC 3K59A 1WA7A 4KULA 4KI6A 2HAXA 1RLPC 4B9LA 3VQCA 1AHJB 4B1VA 4JD2B 1IBLK 4M7DD 4JRIA 3GBQA 3OS2A 2X4YA 1NGAA 3CF5L 2HNDA 1HNIA 2NWMA 4PL8A 3PIOA 3V9SA 4M77E 5C10A 5IT9O 2O8EA 1C0MA 4MDXA 2PAVA 2EYWA 4FM4B 1R8OB 2XO7A 3ER0A 4DTMA 4PJOG 2AIRB 3LAKA 2FPEA 3NPFA 4BRIA 3G6EN 4BE0A 4QQDA 1YHQA 4H5RA 3CEYA 4FWQA 4DSEA 1MMAA 3QJYA 1O9SA 5LJ5j 3CD6Q 4BRQA 4CHOA 3SPZA 3VEXA 1K73O 1RTJA 4RTTA 1KSWA 2MI6A 3DXMB 4Q5VA 2FLOA 3SUNA 1LOJA 4M7DF 2Z1JA 5M1NA 1DKGD 2DXUA 3CC7A 4Z94A 2OTLT 5JMVA 1T3SA 1Q95G 3NCIA 4LF4K 3OYBA 2EW3A 3DLGA 5M1KA 3JRZA 4FK0A 5ECAA 1TUYA 1NBEB 3ENHA 1VIFA 2O8CA 1WSHA 4J8FA 2LJ0A 4BRMA 4CGFA 3GG4A 1N6QA 1D3BB 4BACA 3QKJA 2HHUA 2NLUA 3PTAA 3LP1A 3V81A 1NGJA 4Y1DA 2D1XA 4F04B 3S3MA 4FYDA 3JXUA 1O13A 3LH5A 3W0LA 5GAOr 1BCMA 1ZA2B 1NJXA 2DBKA 2QEXT 5GAMh 3CCST 4M7DE 3DXMA 3MN7A 1D9DA 4H5VA 5E26A 2OCEA 1MUZA 5KCHA 3CCVA 2XIDA 4Y91A 1W7AA 2BUDA 3VYHB 2DL5A 1OH6A 3GF5A 3UB5A 1T8EA 3HJFA 3OHRA 2ZJRL 4BRNA 2E10A 2HBPA 2O4IA 5GMKj 1KD1O 4KTQA 4QQGA 3V9XA 3AVIA 3ZT3A 4GLKA 3M1FA 1U47A 2HBMA 1D3BA 4LN2A 5KYXB 4Z89A 1BQNA 3I8BA 2UUAK 4C8LA 2JVVA 1BG3A 3CCMA 2YUOA 5C15A 3GNGA 4C5HA 3CQ8A 2YNHA 4PKGA 4CHZA 1N27A 2H8HA 3K57A 4WYBA 4NYFA 3NFAA 5M9OA 1W70A 1NWKA 3O9UA 3L3UA 4YNQA 1NG9A 2RHYA 3VRZA 3L2QA 3CC2Q 4JKCA 4DF8A 5AFUH 4A57A 2ZPEB 1SHGA 2L3PA 1G2BA 1UB4A 3RERA 3WUHA 1U49A 1U2VB 4QVDA 3CHWA 2CP7A 1R77A 4PJJA 3M0RA 1SG5A 2PUOB 5A0LA 4BVOA 3PV8A 4JI7K 3OY9A 3HPOA 4FSSA 4FYWB 4BRPA 3OB9A 1BQMA 4FZXC 3MCAB 1T0JA 1N8RU 1CZAN 4FXDA 1YIJT 1QQMA 3VS4A 2HD0A 3F9KA 1KC8O 5E84A 4HVWA 5HY6A 1T6CA 3FRNA 3I55T 4RW4A 4DSJA 4K0KK 2QWMA 2P9LB 4F8RA 3VKIA 3PIPA 4DR3K 1RADB 1NJIR 1U48A 3HZ6A 2M0YA 1Z05A 4BRCA 2OTLA 1VYVA 3LW5E 5CKDA 3UKUA 4E7HA 1NGEA 1HQUA 4PJOC 3LP2A 4ZNXA 4DTJA 5HRPA 4IIMA 3LL3A 1JQQA 4FJMA 3ZEUA 3HSBA 3SWNC 3E9OA 1DTQA 2YNIA 4OB2B 4O5VA 1E3MA 2A5XA 3QLHA 4JPBW 5AQGA 1B9FA 1PWTA 1GL5A 4IOXA 3VF2A 2QWOA 3KK1A 3UKRB 4OLAA 4IO8A 2IG0A 3A8OB 3RR6A 3O9TA 3HXMA 4Z02A 1I8FA 1FKOA 3M59A 3CCSA 3QESA 1X69A 2HCKA 2KSSA 3OS1A 5IN1A 2YKNA 2LX7A 1KVAA 2V52B 3DXKB 4FYXB 4ISFA 1NOYA 1F1BB 5KCOA 4WFAL 3JCMe 2P1JA 1SAZA 4CFDA 4CJQA 2IVNA 4BC2A 2DAQA 3M0QA 4CZLA 3RTVA 2Z1HA 2PFUA 3CCJT 3EHRA 4C1NI 1D4XA 5CR4A 4FLWA 3VGKA 3FZLA 2RHIA 2OTJT 3ENBA 3TTFA 3WNEA 1BYMA 4AHVA 1QVGP 3FGUA 4FLVA 5HRSA 4IUQA 2B5JA 4N5SA 2Q31A 3L4QA 1X9JA 1QVFP 2W6LA 5IXFA 4HCZA 3QIOA 4E1MA 3LWIA 4M7YA 1NZ9A 1Z6RA 2CT4A 5CYQA 1NBWA 2HBJA 1QVGM 1WHJA 4EMGA 4CEFA 5HROA 4AMCA 3DXKA 4KHNA 2HVHA 5FW9A 4A4KA 1QVFM 3A1PA 3O8MA 4LXCA 1QQCA 4M7XA 3HVRA 1X75C 5GAN7 2QTXA 4KGZB 4NOYA 4OO1J 5I2SA 3KVGA 3JCMf 4PJMA 3VYGA 1O75A 4DFMA 1UGQB 3JSCA 1TAUA 2EJGA 2LT4A 5GAMd 2GELA 3VESA 4E6RA 2NRWA 2QWPA 3WEEB 1YIJA 2XHBA 3M5AA 2V7YA 4M78G 4BR0A 2RJEA 2M0OA 3SB2A 3OS0A 4ESRA 1IJJA 2HOEA 3PSFA 3ZETB 3QEWA 4CJ3A 2O8DB 3U23A 3I55A 4BRAA 1X9SA 2VUBA 5TKWA 1YXQA 3CMAT 2PYJA 3P39A 5GAN2 2EKHA 5C0MA 2DFUA 4DFPA 3NBPA 2DM1A 2KI7A 1M90U 4CEBA 1BL3A 4HKEA 2Q1NA 3I5RA 4RTZA 3PX6A 5SWMA 2O4GA 4AHTA 3ZL7C 4DBQA 1AWJA 1OU9A 4DHYA 1T6DA 1WBBA 3CXCP 4K8XA 2GTOA 2E70A 4R56A 3M55A 2E64A 3A8GB 1RBSA 1M2VB 4JRPA 1HYSA 1W0HA 3WEEA 1Q86O 4PWDA 3VS3A 4DTOA 1Q18A 2OI3A 1G3TA 1GXIE 2HDAA 2Y1JA 3QUIA 2YRDA 1W2BA 4HTUA 4F2SA 1X27A 1ZLMA 4PJOB 2CH6A 3CXCM 2O8DA 3PT9A 3HPWA 1T03A 4Z4GA 4FYYB 2KRSA 1DTTA 1QSSA 2EQKA 4KT0E 3QJ6A 1JLFA 1IGQA 1K9MO 1X01A 3SWNB 2E2QA 4X65K 2NNWA 4B3SK 3CCQN 1TKZA 1KLMA 4CFAA 5CKEA 1DGKN 2FG0A 1ATNA 4FWOA 1CSKA 2YRCA 3I56T 4W5RA 4DTPA 3KHYA 2QQRA 1KSPA 3CCJA 1KQSS 4JN4A 5CQXA 4YDUA 2A3LA 3BF1A 1XHZA 3NHNA 1C1AA 2JGUA 4RG8A 3CCLA 4O6JA 1YJNN 2O8BB 2OTJA 5F1XA 4J7FA 2KROA 2VWJA 2HB5A 4LH5A 1N34K 4CC4B 3KKRA 3SPYA 2LDMA 4OX9K 4N47A 3MN9A 3BF3A 1S72Q 2C0IA 4WCEL 2ZPIB 3KLIA 3TAGA 1RT3A 2RHKA 3BP8A 4F2RA 2E5KA 5AQHA 1WJQA 2LC4A 2L2PA 1VQPA 4QVZA 2X3XD 1U04A 2Z1IA 3QDKA 4I6MB 3AVLA 4PFOA 4CJKA 1K76A 1BO5O 2P9SB 2F4VK 2EQJA 4BI4A 1J54A 3AAPA 2K2MA 1Y96B 4CJ4A 1JL1A 5GJWB 2ZD1A 5KGXA 5H1SQ 4IBNA 4DTUA 1OH5A 4Z8AA 3A0IX 4DOVA 3H8ZA 4KH0B 3VENA 2QQ9A 3ZCMA 1VSEA 4Q0BA 4N4GA 2QDYB 4ANJA 3D2EA 5T7BA 1L3TA 3G71T 3MXJA 1TOVA 5IT9E 4B3MK 4CFBA 1WI7A 1V1CA 2OPSA 4DB3A 1WGSA 4FWKA 1VQ5Q 1XNIA 3DKMA 4FPAA 1PG5B 2AJQA 3PVQA 1ASUA 1JCEA 4OPAA 4BD3A 1K1ZA 3CMAA 4WCIA 2LCLA 1RAEB 3P8BB 3FFKB 3RSEA 3CG7A 2QM1A 3F70A 3VS7A 1IO6A 3U9ZA 2LQNA 4CEDA 4M7AA 4RW6A 4CIGA 5LJVA 4M3UA 3M0TA 3EE8A 2W10A 1PM3A 4MMKA 1AOJA 1X2KA 5DLOA 1LAWA 1BGXT 4AHSA 2KYMA 3CQXA 3MMVA 5JVGL 4N0AA 4CK3A 1YHQN 4M78D 4LF7K 3G6EQ 4IFYA 2HSTA 4PJLA 4BG9A 1E6GA 4C0DB 4AFUC 5A0GA 3CC4T 1GBQA 2EPDA 2NUTA 4CJPA 4FWLA 1IREB 5KQDA 4FJXA 1EO1A 3QWXX 1VQ4T 2ZCFB 2IIRA 1P8ZA 2RQRA 2CZ1B 3CC7N 1SL2A 1RLQC 3ULEB 2D0AA 1S22A 4UY8O 1D09B 4C8QB 5GAMg 4FM0A 4O5BA 3R6OA 1LOTB 2Y1IA 4BGAA 3M8SA 2ZGWA 3OMCA 3E66A 3FEOA 3I56A 3I33A 4KHPK 3D7SB 1QVPA 1M8VA 2QQAA 5GMKm 4WQ5C 4M78F 3HYFA 4UC4A 3X26B 3LDOA 3O1WA 4BRGA 4JI0K 2GUPA 3D0PA 4LF6K 2NYSA 1RL2A 4HVJA 3CJ1A 2GWKA 2BTTA 1N8RR 5GAN5 2V51B 1OZ3A 2E5LK 2Q0RA 5I3UA 1PSFA 5AQRA 1REVA 3SV3A 5HCKA 1NGGA 3V9UA 2CP6A 1J3TA 3PMIA 3PO5A
chains in the Genus database with same CATH topology
1HMVA 5J2PA 4HUFA 2IC3A 3OYHA 4E0DA 5FRNA 1XC9A 4B8CA 1IH7A 4CHYA 3LWLA 4E19A 4CEEA 1TL1A 3DRRA 4GVMA 4CESA 3HP9A 4CEQA 5E41A 1RDDA 1C0TA 3KKSA 3TI0A 1RILA 4L8RB 3SI6A 4OLBA 1JKHA 5FRMA 4DQQA 4JLHA 4DQRA 3H08A 3LZJA 4KI4A 3K58A 3DOLA 5D7UA 4CJRA 1JLBA 1WSEA 4OPJA 1A5VA 3C6UA 4R5PA 5J2QA 3CFOA 1SL1A 5K14A 1KCFA 4CCHA 3VQDA 4ZTJA 3G10A 4HCCA 2WONA 4B9MA 3T3FA 4O0JA 1HYVA 1XHXA 4NCGA 3TAMA 1FKPA 4BDYA 3ZSXA 4BWJA 1QHTA 3LWMA 1GOBA 3L2UA 1NK5A 1EETA 3DLBA 3TR8A 1RTIA 1QMCA 1DLOA 2WOMA 1IKVA 1TK5A 1RT5A 1CXQA 1ZBLA 1TVRA 1LV5A 2HVIA 1TV6A 1BCOA 4FJLA 1J9AA 3ZSQA 4JS4A 3ULDA 3V4IA 3WNGA 1N5YA 3AVCA 1EXQA 4KREA 3SZ2A 1RT6A 1TKXA 4FJHA 3QEVA 2HHSA 1JL2A 3A2FA 4O55A 1SL0A 3MEEA 3LP3A 1JLEA 4FJ9A 2E6MA 4ID1A 1KTQA 3QNNA 4CJUA 3SJJA 2KW4A 3ITHA 3KLHA 3NH1A 1JXEA 3SNNA 1NK6A 1ZBIA 3S3NA 1RCHA 3VQ7A 3WNFA 1NJWA 2X78A 5HBMA 3SQ1A 3SUQA 2FBVA 3KD1E 5I42A 1F21A 4M3ZA 3S3OA 2OA8A 5CY4A 4IG3A 1XI1A 2FBTA 1BI4B 3T19A 2HHWA 4I7FA 5J1EA 3SCXA 4MQ3A 3M8QA 1NJZA 3NGYA 2KTQA 3QIPA 3S9HA 1S9GA 1LWFA 1KLNA 1QS4A 4DU3A 5DMRA 4E3SA 2A1SA 3ASMA 3BGRA 4CJWA 3OYNA 2YKMA 1O1WA 3SQ0A 5CYMA 3SUOA 2IDOA 4E7KA 3E01A 5KI6A 4AH9A 3QETA 1NK8A 4B9SA 4ELUA 1HYZA 2ATQA 1NK9A 2PYLA 2BDPA 4J2DA 1D5AA 4CJVA 3CM6A 1WSJA 4PQUA 4B9VA 2IOCA 4FM2A 3NH0A 3V9WA 3LPUA 4FK2A 3OYGA 2ETJA 4ZTFA 4KPYA 3HPGA 4BE2A 4BE1A 4FLXA 4FK4A 1S1UA 1WLJA 3RRHA 3HSTB 1S1VA 2IAJA 4OPKA 3O3GA 1BI4A 4PY5A 3V1OA 2B6AA 3O3FA 3KJVA 4DSFA 4DS4A 3RMCA 1Q9YA 3NGIA 4GW6A 1D8YA 3ZSWA 3K59A 4Z4CA 2QKBA 3AO1A 2ZE2A 3MAQA 3ZSYA 1FK9A 4KI6A 2DY4A 1HJRA 3OYEA 3RRGA 4B9LA 3VQCA 4DSLA 1Q9XA 1Z25A 5C25A 3AVBA 3OS2A 1TL3A 4C8KA 4KHWA 2HNDA 1HNIA 4KV8A 4CE9A 3V9SA 4WE1A 4B9NA 3KLFA 1G15A 1UOCA 2O4GA 1IHVA 1C0MA 1WSIA 3CM5A 3L3VA 2D5RA 5FDLA 4KB1A 2KFZA 4CEAA 3PO4A 2XO7A 3QINA 4QOZB 1KVCA 4LSNA 4DTMA 1NK0A 4CJLA 3LAKA 4IFVA 1BIZA 4LY7A 2DFHA 1TKTA 4BE0A 2YHAA 2RKIA 4CEZA 4DQIA 3LZIA 4DSEA 4O44A 3AA2A 4CJSA 3SPZA 1TK0A 3O4NA 2GV9A 3AVKA 1RTJA 2GUIA 3VQ6A 3B6OA 4Q5VA 1JXBA 2W42A 2R7YA 3SUNA 2Z1JA 4LD0A 4DQPA 1RT2A 1VSHA 3LANA 2FBXA 2KZMA 1BHLA 1A5WA 1C6VA 2RF2A 1HRHA 2BANA 2HNYA 4KTWA 3NCIA 4CGHA 2HW3A 4YFUA 4JRQA 3QO9A 2E4LA 3OYBA 3ISNC 3DLGA 4I9LA 4DTRA 1RDAA 1UAXA 2XY8A 4FK0A 3NH2A 2YHBA 2KQ2A 4HCBA 3AO5A 3VQ9A 3TARA 1T05A 4E7LA 1WSHA 4B9TA 2HHTA 4CGFA 4Z4HA 2I5JA 5C42A 3ZSRA 4FXDA 1W9HA 1N6QA 3SQ4A 2HHQA 4BACA 4CF8A 4CGJA 4FLUA 1KFSA 2HHUA 3RWUA 1KRPA 3LP1A 3K5NA 3V81A 1RDBA 4Y1DA 4CF1A 5FROA 3S3MA 2OYQA 4FYDA 1S5JA 2RN2A 1NJXA 3M8RA 4CF2A 1BCMA 4EP5A 4DTNA 2A1RA 1WSGA 1D9DA 3HL8A 3VQAA 5CZ1A 2QXFA 4Y1CA 4G1QA 4DTSA 3AO3A 5D3GA 2G8HA 3EY1A 2HNZA 2BGGA 1VSMA 4W5OA 3DMJA 4KHQA 4CIEA 1T8EA 3HJFA 4PA1A 4FJKA 4B8AB 4M3XA 4EZ6A 2O4IA 4E7JA 3NDKA 1WAFA 3VQEA 1EKEA 1RT7A 1CZBA 2ZQBA 3AVIA 4CERA 3V9XA 4KO0A 4KTQA 3ZT3A 1UWBA 1CLQA 3C94A 5HP1A 3LDSA 1U47A 1RTDA 2PZSA 2PY5A 4KB0A 1Q8IA 1KVBA 4KHSA 1BQNA 4FJ7A 1UA0A 4C8LA 3C95A 1L3UA 2EHGA 1RTHA 3D45A 1UA1A 3TWHA 4IDKA 5HRNA 3CQ8A 4DU4A 2YNHA 4Z4EA 4CHZA 1IO2A 3K5MA 3K57A 1S1WA 4E1NA 4NYFA 3NFAA 4YNQA 2VG5A 1X9WA 3L3UA 3JSMA 4N56A 3L2QA 1QSLA 4H4MA 4DF8A 5KRTA 1ITGA 2XY7A 1Z26A 1NJYA 1U49A 4O0IA 3V6DA 1GOAA 2XY6A 2P51A 4Z4IA 2HMIA 2VWKA 1RT1A 1WN7A 4CHOA 3PV8A 3DLHA 1WSFA 3OY9A 2JLEA 2OPQA 4OKKA 3OYDA 3HPOA 1LWCA 1BQMA 1ZYQA 4FZXC 4CK2A 3NGZA 1ZBHA 4N41A 2F8TA 3AVJA 4DFKA 4EP4A 3L2VA 4M3WA 3NAEA 3F9KA 1SKRA 4BWMA 4BDPA 2BE2A 5KTQA 2FC0A 1IKYA 4RW4A 4DSJA 3U6FA 4F3OA 3IG1A 1U48A 4F8RA 2D0BA 2X6SA 4CIFA 4TSXA 4DU1A 3NF9A 1IKWA 3SYZA 4FM1A 4E7HA 3IRXA 5CZ2A 4J2AA 1HQUA 3KLGA 4DSIA 3LP2A 3KK3A 4DTJA 5HRPA 3JYTA 4O4GA 1L3SA 4FJGA 3AVGA 4FJMA 1TGOA 1SV5A 1DTQA 2IGIA 1LWEA 2YNIA 3KIOA 4ID5A 3B6PA 3OYKA 1SUQA 3RR7A 1KFDA 4M42A 3QLHA 4DS5A 4RW8A 1B9FA 1FXXA 2XY5A 4H8KA 3OYIA 1YTUA 3KK1A 4OLAA 2D0CA 3AVFA 3K2PA 4RW7A 3PX0A 2RPIA 1IKXA 1C1CA 3TAQA 3HXMA 4DSKA 1FKOA 1B9DA 3TAPA 1U45A 3HVTA 1LAVA 1TKDA 3QESA 4DWIA 2YKNA 3OS1A 3AVHA 3NF7A 3VA3A 1KVAA 4CHQA 4GMJB 2OZMA 4K8ZA 4NCBA 4XIUA 4DLEA 4FLTA 1NKCA 4OKJA 1Y97A 3HT3A 1NOYA 3IAYA 2P1JA 3QEPA 3K5LA 2B4JA 1VSIA 4CFDA 3T1AA 4CJQA 3M8PA 3RTVA 4DFJA 2Z1HA 2Z1GA 3NF8A 3VQQA 3OYMA 1JLCA 3ZT1A 1C1BA 3AV9A 3OVNA 2X74A 2YV0X 1EX4A 4FLWA 3I8DA 2LSNA 3L8BA 1R0AA 4AHVA 3WNEA 2P5GA 1CZ9A 4ELVA 4FLVA 4F3TA 3ZT4A 5HRSA 2B5JA 4N5SA 4I2PA 4QCLA 3AA3A 1SKWA 3QEIA 3RMDA 3CFRA 1CXUA 3QIOA 4M3RA 4E1MA 4DQSA 3P1GA 1JLGA 1S6QA 4CJTA 3MXMA 4KAZA 1IHWA 5CYQA 4W5NA 1LW2A 3U3GA 4CEFA 3HPHA 5HROA 4CF0A 4KHNA 2HVHA 3SUPA 3EZ5A 4ELTA 1C6VX 1QQCA 3NHGA 5JS2A 4FLYA 3ALYA 1S6PA 1YTAA 1VSFA 5HRRA 4AHUA 4CJ5A 3HVRA 4AILC 2YNFA 4OVLA 4NYNA 3VQ5A 4CGGA 4FW2A 3F73A 1RNHA 4DFMA 1TAUA 1L3VA 4CFCA 1NK7A 1SKSA 1A5XA 3MEGA 2NUBA 3AVNA 1RBTA 4UQGA 4FJJA 1ZBUA 5EU7A 4FW1A 2XHBA 4FJ8A 4FVMA 3TAFA 1NK4A 3DOKA 2OPRA 5DK5A 3OS0A 3OYJA 1VSDA 3DLEA 3QEWA 3LPTA 4CJ3A 1X9SA 3VQ4A 4PUOA 3K5OA 1J53A 4M3YA 4I2QA 2PYJA 1JLQA 3DYAA 3RMBA 4DFPA 3NBPA 3SQ2A 3OYFA 3IS9A 3WNHA 4HUGA 3V1QA 4CEBA 1C0UA 1T7PA 1BL3A 4AHCA 2YNGA 3TAEA 1GOCA 3O4QA 3C6TA 1NKEA 3PX6A 5SWMA 1I39A 4AHTA 1NKBA 1XWLA 4K8XA 4KKOA 2G8VA 5JS1A 4ZHRA 1RBSA 4JRPA 1X9MA 1W0HA 2VG6A 1HYSA 1VSKA 4PWDA 1RBVA 4AHRA 4DTOA 4KHYA 1L5UA 4F2SA 4CGDA 2Y1JA 4HTUA 4CHNA 5HLFA 1ASWA 1T03A 2OPPA 4J2EA 4Z4GA 1DTTA 1QSSA 4IKFA 4DMNA 4N76A 1JLFA 4FJ5A 1RBUA 4J2BA 1MU2A 3AA5X 1TKZA 4KTZA 1KLMA 4C8NA 3V1RA 4CFAA 4RW9A 3OJUA 3DM2A 4W5RA 2P5OA 3HP6A 4I9QA 3RMAA 4DTPA 1EP4A 4HHTA 1KSPA 2F8SA 1VRTA 4F4KA 3KLEA 1XHZA 4FZYA 1C1AA 2G8FA 3VQBA 2JGUA 4RG8A 1S1XA 4MFBA 4Z0UA 2VWJA 2HB5A 1U4BA 2Q3SA 4H4OA 1NOZA 4LH5A 3KKRA 3SPYA 1QTMA 4N47A 3O3HA 4CF9A 4JS5A 4W5TA 1HNVA 3MEDA 3KLIA 4CJEA 3TAGA 4E89A 1RT3A 4CEOA 4CGIA 4F2RA 3LAMA 5KRSA 1JLAA 2KZZA 3VQPA 2XRIA 3DLRA 5SZTA 1U04A 1YVUA 1X1PA 2IS3A 2Z1IA 3AVLA 4CJKA 3NE6A 1VK0A 4C8MA 4LSLA 3HK2A 2QK9A 4CHPA 3I0SA 1J54A 3VN5A 1TAQA 4CJ4A 1JL1A 2ZD1A 5KGXA 4DTUA 3KTQA 4IBNA 3V9ZA 3PX4A 4Z4FA 1I3AA 3ZCMA 1VSEA 4OGCA 4Q0BA 3TANA 1L3TA 5T7BA 3BDPA 3MXJA 3PUFA 4OKEA 3U3YA 3DRPA 3ZT2A 1QSYA 2DTUA 1WAJA 4CFBA 3PY8A 4OJRA 1VSJA 2OPSA 3VQ8A 4CECA 4M41A 2AJQA 1ASVA 1ASUA 3QERA 1RBRA 3OYCA 4B3OA 1S9EA 3OYAA 5J2NA 2DFFA 3FFIA 3AVMA 3LALA 3CG7A 3QEXA 4B08A 5C24A 4E7IA 3DRSA 4BDZA 1YT3A 4CEDA 1IG9A 4CIGA 4RW6A 3ZT0A 3CFPA 4M3UA 1ZBFA 2GBZA 3DI6A 2E6LA 3AO2A 2ITGA 4DF4A 3MXIA 2G8WA 3ZSOA 3L2RA 4NCAA 3AA4A 1LAWA 3DLKA 1BGXT 2EX3A 3MECA 3P5JA 5KGWA 4AHSA 4CK1A 5J2MA 4CK3A 3P83D 1VRUA 3EYZA 3VA0A 3OYLA 4IFYA 4ICLA 4FLZA 1D9FA 4KHUA 3HM9A 3KD5E 4M3TA 4LH4A 4DG1A 4FJIA 1BISA 3G0ZA 2G8IA 4M45A 1LW0A 3UIQA 2HHXA 2G8UA 4CJPA 3LP0A 2FBYA 3OJSA 4EZ9A 4FJXA 1VSLA 4IG0A 1RT4A 1RDCA 3ZSZA 1WNSA 2X6NA 1SL2A 4OGEA 2D0AA 3RR8A 3AVAA 1QE1A 4QAGA 3NF6A 1HQEA 4O5BA 2DFEA 4DLGA 3KK2A 4FM0A 2Y1IA 3M8SA 3SV4A 1J5OA 3ZSVA 4B9UA 3I0RA 1K6YA 3THVA 1TK8A 4KFBA 4C8OA 2QKKA 4FZZA 3HYFA 3D0PA 2G8KA 4HVJA 4FCYA 4CJFA 4FJNA 4DTXA 2F96A 1BIUA 3QNOA 1B92A 1HPZA 1S1TA 2VG7A 4W5QA 2OZSA 4KRFA 2HHVA 3L2WA 5I3UA 4HUEA 1REVA 3TABA 3SV3A