1EX4A

Hiv-1 integrase catalytic core and c-terminal domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
212
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACDWAGIKQEDGIPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNSLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Crystal structure of the HIV-1 integrase catalytic core and C-terminal domains: a model for viral DNA binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 49
structure length 212
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ex4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ex4A01
3CG7A 2JLEA 3ZT4A 3FFIA 1Q9XA 2XY6A 1JL1A 4M3TA 4CERA 4CGDA 1IKVA 1C1BA 3EZ5A 1FK9A 5D7UA 1RTIA 3OYEA 3ZSRA 1FKPA 1BQNA 1TK8A 5DMRA 4DSFA 3V9XA 5E41A 2F8SA 4RW4A 4E1MA 4HUFA 1HYVA 1JLFA 4UQGA 5FRNA 1C1AA 4FJ9A 4K8ZA 3MEDA 4M3ZA 2DFFA 3C6TA 5CYQA 3V1RA 1RDAA 4EP5A 4JRPA 4CHQA 3SUOA 4B9LA 5SWMA 4CGJA 1S6QA 4BACA 3OYFA 1BGXT 1J54A 2GUIA 3CFPA 4KPYA 1RBSA 3QEVA 4JLHA 4MQ3A 1D5AA 1RBRA 3RMCA 2O4IA 1HYSA 1HNIA 4B9TA 5CZ1A 4LY7A 1U48A 3QLHA 4J2DA 3B6OA 3L2WA 4DTRA 4HUGA 4CCHA 5T7BA 3SUQA 3C95A 1JLCA 3KK3A 1BQMA 1B92A 2WONA 4FCYA 3LAMA 3K59A 4IFVA 5FRMA 4KHYA 3THVA 1VSIA 3DRRA 1T03A 4QOZB 2ZQBA 1SV5A 5EU7A 3TAQA 3MXIA 3AVIA 4DF4A 4EZ6A 1TKTA 4N56A 2HHXA 1B9DA 1S9EA 2XO7A 1HRHA 1SUQA 3KJVA 5HP1A 3QIOA 3V9UA 1JLAA 1RT7A 3KLEA 4CK2A 4DTJA 1TAQA 3MXJA 4DQQA 1N5YA 4KHQA 4E19A 4KB0A 4I7FA 2QKKA 3T3FA 1GOBA 4I9LA 2XY7A 4M3XA 1U45A 1SL2A 2X78A 3BDPA 3PX6A 3SUPA 3KLFA 2VWJA 3I0RA 4W5OA 3IS9A 3OYNA 3DOLA 5JS1A 1LWEA 3P83D 1J9AA 2BE2A 4OPKA 1LW2A 1RBTA 2P5GA 1RT4A 3CQ8A 1X9WA 2D0BA 4B9MA 3M8QA 1HYZA 3M8PA 3AA2A 4F2RA 4CIGA 3JYTA 1VSLA 4KRFA 4RW6A 3PX4A 3RMDA 3QIPA 1KLNA 2EX3A 3HVTA 1XC9A 4E0DA 5D3GA 4QCLA 2B5JA 4FJJA 3C6UA 1BL3A 3KKRA 1YVUA 5HRPA 1S1XA 1ZBHA 2HB5A 4CHPA 1QSSA 1JLQA 4FZYA 2BGGA 2VG6A 4IG3A 2HHUA 2O4GA 4LSNA 3I8DA 3NDKA 1FXXA 3K2PA 2HHSA 2A1SA 1G15A 4FLTA 2OPSA 2HHQA 3ZSQA 3ZSVA 3VQ4A 4KHUA 3QEIA 1RTJA 3OYHA 3K57A 4HCBA 5J2PA 1EXQA 4H4OA 3DLBA 3O4QA 1NJXA 3SNNA 4CF0A 1HQUA 4E89A 2F8TA 4FK2A 3NH0A 3CM5A 2HVHA 4AHRA 3AO5A 4O5BA 2G8FA 4DQIA 5C24A 2VWKA 1KRPA 1VSFA 4FM0A 5J1EA 1NK8A 2HHTA 3LWLA 1ZBUA 3TWHA 2G8KA 3K5MA 3SI6A 4N47A 1O1WA 4LSLA 5KGWA 3SCXA 4F4KA 4CGIA 1Z26A 4CEZA 3ZSOA 2OZSA 3LP3A 2AJQA 3E01A 3S3MA 1LV5A 3MEEA 3AVAA 4KTQA 3AO1A 4CJKA 3T19A 4DTXA 3QNOA 5KRSA 2BANA 1WSJA 3HPOA 4M41A 3WNGA 4CJRA 4ELUA 3AVLA 4IFYA 2BDPA 3RR8A 4HCCA 4OKKA 4CEFA 4CESA 4FK4A 1BI4A 4OJRA 3CM6A 1Q8IA 4E7HA 3TANA 3TI0A 3PX0A 3RTVA 1SKWA 2OPPA 3DRSA 3M8RA 1U04A 4AHVA 1QSLA 4R5PA 1A5VA 3NF9A 1T8EA 3OYIA 3HPGA 1TKZA 4J2AA 3CYMA 4FZZA 4FW2A 4CJLA 3S3NA 1U4BA 2PZSA 3NBPA 2KZMA 3ITHA 2G8VA 5KI6A 4ZTJA 4N5SA 4F3OA 3ZSWA 1RTHA 4H8KA 3QETA 3AVFA 3DLKA 2Z1HA 5KTQA 1QS4A 4CHYA 4CFCA 2FBXA 1UOCA 4PA1A 3EY1A 3V9WA 3T1AA 1TVRA 3TAMA 1S6PA 2E6MA 3LPTA 3V81A 4OPJA 1JXEA 2IAJA 2ATQA 1NOYA 3U3GA 3HXMA 4CIEA 2E6LA 4ZHRA 3O3HA 2P5OA 3OJSA 4DTNA 3LALA 3KK2A 3SYZA 4CE9A 4DQRA 4Z4IA 2XHBA 4G1QA 5CZ2A 4OVLA 1ZYQA 4FXDA 3VQ5A 3VQPA 2HVIA 4DFPA 3VQCA 3OY9A 1QMCA 1RBVA 4TSXA 1EP4A 3VA0A 4I2PA 1WSGA 1D9FA 3DOKA 4M3RA 3HPHA 3TAPA 3PO4A 1RT3A 1BIUA 4FK0A 3SV4A 1UWBA 3ALYA 3NE6A 2P51A 4CEDA 2R7YA 2KW4A 3NHGA 5HRNA 1XI1A 1VSKA 1IKXA 4BDPA 3QINA 2X74A 2KZZA 1QSYA 4PQUA 3AA5X 3LWMA 2G8HA 4DSKA 4KREA 2OA8A 3B6PA 3VQ6A 1NK6A 1TL1A 4W5TA 1LAVA 3AA4A 5C25A 4DTSA 2PYJA 2NUBA 1RDDA 4DSEA 4GW6A 1BISA 3NAEA 1NK5A 4KHSA 1KCFA 3SPZA 1A5WA 1R0AA 4Q5VA 1TL3A 2IGIA 1TK5A 3TAFA 3D0PA 1HNVA 4M42A 4NYNA 2HMIA 1Y97A 4KFBA 2P1JA 4F3TA 3IG1A 2YNGA 3WNEA 1HJRA 2HHVA 1XHZA 3DM2A 4Q0BA 3DYAA 3V1QA 1IH7A 4DLEA 4WE1A 4O44A 3HJFA 4W5NA 4BWMA 1BIZA 4GVMA 4DU4A 3HM9A 4CGFA 5CYMA 5KRTA 1UA0A 1YTUA 4CJSA 3L2RA 1NOZA 5HROA 3NFAA 4N76A 1KTQA 3HSTB 1BCMA 4XIUA 1CXQA 1HQEA 1QHTA 4Y1CA 5FDLA 3PV8A 3TR8A 1SL1A 4LD0A 4E7JA 4I9QA 4CEBA 4B8AB 4IG0A 1ZBLA 3MAQA 2RF2A 3AVCA 3VQDA 4FVMA 5HBMA 4CIFA 4DFJA 5J2NA 2Q3SA 3SJJA 4CEQA 1IO2A 3L3UA 4CJVA 1NK0A 4DU1A 1Q9YA 4CF9A 2WOMA 3OYBA 4OLAA 4E7IA 4L8RB 3QERA 3HK2A 2XY8A 4F8RA 1NK7A 3NF6A 1C0MA 2B6AA 1EX4A 2PYLA 2PY5A 2OYQA 2HNZA 2A1RA 1L3TA 2YNFA 4Z0UA 4FJGA 2EHGA 2YKNA 1SKRA 4M3YA 1LAWA 1TK0A 4M45A 1LWCA 4B9VA 5K14A 4CJQA 3NGYA 4FJMA 3KD1E 3DI6A 4DSLA 1JL2A 2ZE2A 3OJUA 1QE1A 4FLZA 3SQ0A 4DSJA 2Z1IA 2HNDA 3MECA 4KTWA 2W42A 1X9SA 3O3GA 4CF1A 4RG8A 4DTPA 1W9HA 4MFBA 3LAKA 3OVNA 3ZSZA 4Z4HA 4OLBA 1WSEA 3L2QA 2OPRA 4RW7A 2FBTA 3LZJA 3V4IA 3ISNC 3ULDA 4OKEA 3K5OA 1YTAA 1DTTA 3VQEA 1ASVA 1TKDA 4CHZA 3RRHA 5I42A 3PY8A 3HO1A 1TKXA 4OKJA 3U3YA 4PY5A 3AA3A 3AVHA 3PUFA 1EETA 3L2UA 4KKOA 1IHVA 5J2QA 3VQQA 1RT2A 2Z1JA 3SV3A 1RDCA 4DFKA 4J2BA 4O0IA 4B9UA 4Y1DA 2YKMA 4ICLA 4RW9A 3VQ9A 3OYAA 4FM1A 2Y1IA 2D0CA 1KVCA 4AHTA 4AHSA 3QEWA 4N41A 1JKHA 4KI4A 1VRTA 3IRXA 4FLVA 1EKEA 1WAFA 3OYKA 3JSMA 1VSJA 1D8YA 2D5RA 4EP4A 4KB1A 1WNSA 4FLWA 2IDOA 1A5XA 2X6SA 3AVMA 3DRPA 4BDYA 3TAEA 2IOCA 3VQBA 3MXMA 2G8WA 4C8KA 1X1PA 1TV6A 4FJKA 3K5LA 4CJ4A 1WSFA 4Z4FA 3HT3A 1U47A 4KTZA 1NJWA 4DQPA 1SL0A 4NCBA 3LP0A 4KO0A 1NJZA 2I5JA 1L3SA 5KGXA 4B9NA 4IBNA 1VK0A 3NF7A 4C8LA 3AVNA 1TAUA 3OYCA 3DLRA 3K58A 1B9FA 1CZ9A 4HVJA 3OS2A 1JXBA 4C8OA 1S1VA 4BWJA 2HNYA 4CJ3A 3AV9A 1KVAA 1X9MA 1VSDA 1WLJA 1WSIA 1Z25A 2YHAA 4O4GA 4DQSA 4AILC 4LH4A 1C6VA 2E4LA 2FC0A 3AVKA 3DLEA 4AHCA 4DMNA 4B08A 3IAYA 4OGEA 2IC3A 4CFDA 3SPYA 2GV9A 3O3FA 3PO5A 4PWDA 3V1OA 1CXUA 5SZTA 3LPUA 3AO2A 4M3WA 4ZTFA 4GMJB 2RKIA 4DF8A 1GOCA 2IS3A 4NCAA 2YNHA 4CJUA 3KIOA 4DWIA 4CF2A 4KI6A 1C0UA 2XY5A 4E7KA 1VRUA 1C0TA 1MU2A 3QEPA 1IHWA 3ZCMA 3RR7A 3HL8A 4Z4CA 3OYGA 3ASMA 4CJEA 4CJWA 5HLFA 3NGIA 2KTQA 4DLGA 1K6YA 3KKSA 1SKSA 2OZMA 3SQ2A 3HP9A 1WAJA 4ID5A 3ZSYA 4HTUA 1J53A 1DTQA 2QKBA 1WSHA 4FLUA 4E7LA 3A2FA 4HHTA 1QQCA 3QESA 2ZD1A 3VQ8A 2HHWA 2Z1GA 4I2QA 4CJTA 1ASUA 4ELVA 1HMVA 3DMJA 3G10A 1GOAA 2RN2A 1ITGA 4LH5A 1I3AA 2FBYA 1JLEA 3RRGA 1JLBA 1VSHA 4B9SA 3KLHA 4KAZA 5JS2A 3NH1A 3L2VA 3S9HA 3RWUA 2X6NA 4FJ5A 1KSPA 4CJPA 3V9SA 4J2EA 1WN7A 3KTQA 3LP2A 3TABA 4JS4A 1S1WA 3ZSXA 4DFMA 1J5OA 1C6VX 1ASWA 2KQ2A 1BHLA 4YNQA 3CFOA 4DS4A 3LZIA 5HRRA 3U6FA 4FZXC 1QTMA 4JS5A 3OS1A 1ZBIA 1RCHA 3VN5A 2DTUA 1IKWA 4FJ7A 4FYDA 3QO9A 1T05A 4C8NA 3TARA 3RMAA 3RMBA 2LSNA 5C42A 4CGGA 1NJYA 1NK9A 1KFSA 2DY4A 4W5RA 3LDSA 4W5QA 3V6DA 2ETJA 1T7PA 1KVBA 1C1CA 4EZ9A 1BCOA 2YV0X 3O4NA 1NKBA 3NF8A 3OYDA 4CFBA 1RT1A 1NKCA 4E1NA 3KD5E 3OYJA 2DFEA 4QAGA 4CEOA 3OS0A 4JRQA 1CLQA 3SZ2A 4H4MA 5I3UA 1S1UA 1LWFA 1REVA 1VSMA 3AVJA 4CFAA 3KLGA 2VG5A 3F73A 4B3OA 3F9KA 2YHBA 3P1GA 4OGCA 5HRSA 3OYMA 4DTOA 1RDBA 1UA1A 2GBZA 2XRIA 1L3VA 2G8UA 1ZBFA 1RNHA 4FW1A 4B8CA 3V9ZA 4HUEA 4FJNA 3AVGA 3K5NA 3H08A 1L5UA 1DLOA 3LANA 4AHUA 2JGUA 4YFUA 4KHWA 4CGHA 4NYFA 1RT6A 1VSEA 4CF8A 4IDKA 4FLYA 1D9DA 2F96A 1BI4B 4DG1A 4CK1A 2YNIA 1KFDA 3DLGA 2FBVA 3AVBA 3NGZA 3M8SA 3QNNA 2KFNA 1TGOA 3VA3A 4FJHA 1JLGA 3HP6A 4FJIA 1RBUA 4DS5A 4CJFA 1UAXA 3MEGA 4O55A 4KHNA 3HVRA 4FJLA 1RILA 1U49A 4DSIA 1LW0A 4O0JA 4DU3A 3HYFA 4IKFA 3AO3A 3TAGA 1NK4A 4Z4GA 3P5JA 3SQ1A 4BE1A 3QEXA 3AO4A 4C8MA 4F2SA 1F21A 2DFHA 1W0HA 4CECA 1IKYA 3OYLA 2Y1JA 2QK9A 5FROA 3ZT3A 1XWLA 4CEAA 2HW3A 3VQAA 4BE0A 1S1TA 3KLIA 3ZT0A 3KK1A 3NCIA 4CEEA 4KV8A 1N6QA 4DTUA 1RT5A 3WNHA 3UIQA 4M3UA 5J2MA 4CJ5A 5CY4A 1I39A 3NH2A 2OPQA 3ZT2A 3SUNA 3G0ZA 2KFZA 1S5JA 2B4JA 3ZT1A 4FJ8A 3LP1A 4PUOA 3L3VA 1L3UA 4Z4EA 1YT3A 4E3SA 4K8XA 3SQ4A 4FM2A 3WNFA 2VG7A 4BDZA 2ITGA 4ID1A 1RTDA 1KLMA 4RW8A 1NKEA 1CZBA 4CHNA 2RPIA 4DTMA 1IG9A 2G8IA 5DK5A 3D45A 3BGRA 4CK3A 4ELTA 3S3OA 3C94A 3EYZA 3DLHA 3CFRA 4FJXA 2QXFA 2D0AA 1XHXA 1S9GA 3L8BA 4CHOA 4FLXA 3I0SA 1FKOA 1HPZA 4BE2A 3VQ7A 4AH9A 4NCGA
chains in the Genus database with same CATH superfamily
5GANf 3FRNA 3NTKA 3Q7BA 2GNCA 1JL1A 4M3TA 3UWNA 3G6EQ 4CGDA 1VIFA 2C0IA 4M78C 1C1BA 1SRLA 4J9IA 3BEXA 3EZ5A 5DM7R 3QBYA 5GAN4 1FK9A 3ZSRA 1UE9A 5GAMe 3DXKA 1M5Q1 1Q7YR 4M7DG 5CQYA 4JD2A 1WBBA 1TK8A 1YJNT 2O8EB 4CZJA 3V9XA 1UUEA 2F8SA 3EL2A 2ZPBB 4YDUC 2DXTA 4WTOB 4UQGA 1VQLN 5FRNA 4GY5A 2AT1B 4A53A 4K8ZA 5AJ3K 4M3ZA 2DFFA 3C6TA 4X9DA 2CP0A 3F2KA 2JM9A 4HVWA 4BACA 1S6QA 2E70A 1VQ7A 3U9ZA 3CFPA 1RGIA 1S22A 2OTJQ 1C0FA 3QEVA 4MQ3A 3RMCA 1WJRA 3VYGA 3G4SN 4KH0B 1OKJA 3O9SA 1JQQA 1U48A 2DL4A 2FHDA 4DTRA 4WQ5A 3VEOA 1T0JA 3FLGA 4JI4K 3KK3A 1I0CA 1ATNA 2WONA 3K59A 4IFVA 3CJCA 1VQ6A 4KHYA 4LF6K 1GCPA 3DLLA 3LDPA 3PT9A 2YT6A 5GMKl 3DRRA 3VTIA 1T03A 2DL8A 4LDXA 4BI8B 3MXIA 4ZGDB 1HKGA 4DF4A 5AQWA 3D2EA 1NBEB 1S72Q 3TSPA 3KJVA 1X01A 2J6FA 1D3BA 5HP1A 2ZGZA 1ZUUA 1RT7A 1YWOA 4MO4A 1V4SA 3TREA 1Q81R 4KB0A 3QPHA 4X1VA 4I7FA 4C92A 1ATRA 4I9LA 4M3XA 3T9NA 3SBTA 2UXDK 3PX6A 5EG2A 1O13A 1R77A 4BRGA 5IHKA 4FPAA 1PKTA 1ZUKA 2EYWA 3DOLA 2C06A 2CGJA 2DIGA 5AQMA 2MAMA 2PVGB 1LWEA 3P83D 2BE2A 5BR8K 5BRDA 1NJIU 1BI1A 2P5GA 1K0SA 4FU6A 3PLAA 1NPRA 3M8QA 4DV4K 3CCSQ 1JJ2M 1VQ9N 2ZM6K 1VSLA 4KRFA 1QP2A 2DPPB 3PGGA 4RW6A 3IDHA 2Y90A 3PX4A 3QIPA 1XMQK 2QK0A 4F7UG 2EX3A 3CJBA 4E0DA 4QCLA 2V8JA 4FJJA 2RK1A 3CERA 1BL3A 3QJYA 3CD6T 1K8AO 3M58A 4M7DA 1SQKA 4IG3A 1OQKA 2EQMA 3NDKA 2DD5A 2HHQA 2GUPA 4OB1B 3ZSQA 1F1BB 1WXBA 5AQSA 1N6AA 3OYHA 1GLFO 3K57A 2P4TA 5J2PA 3B8AX 2XI9A 1I8FA 1EXQA 3GPLA 4A5AA 3NFCA 1NJXA 3SNNA 2JOYA 4CF0A 1HQUA 4E89A 1FJGK 2E12A 5GMKj 3CM5A 3TU4K 3AO5A 2G8FA 3VF6A 3G71N 4M75E 2F2VA 3HHTB 4NXMK 4FM0A 2LX9A 1LCKA 1UEBA 2OTLQ 2YHWA 3LWLA 1ZBUA 3CPWM 2G8KA 2K5IA 4A57A 4MZTA 3CC2A 3SI6A 1O1WA 5HL7L 1SS6A 2JMCA 4X66K 3SCXA 4F4KA 3IMXA 4CGIA 4CEZA 3VYHB 3WUHA 2OZSA 3S3MA 3E01A 1Y64A 2P9PA 4OO1J 4CJKA 5KE3A 5FPMA 2LVMA 1YJWN 1GLDG 3QDRB 4N4GA 3MX5A 4M41A 3AVLA 2BDPA 4FK4A 1N8RO 4M7AC 1BI4A 1KAXA 1Q8IA 2E2PA 1IBLK 2CUBA 4PJLA 5AQFA 4C1NI 1YJ9N 1SKWA 3KWIA 4AHVA 4H5RA 1VQMT 3I56T 4Q5WA 1WB9A 3NF9A 1VQ8T 3OYIA 1T8EA 2EYYA 2O9VA 3MPUB 1W70A 2A3ZA 3S3NA 3NBPA 2D0QB 2GCXA 4H8KA 1QP3A 3UKRB 3AVFA 3DLKA 2Z1HA 5KTQA 3CXCS 3CC4Q 1QS4A 4CFCA 4CHYA 1UOCA 3CCLN 4CI6A 1HNWK 4MDAA 1S6PA 1J6ZA 3LPTA 3UT1A 1JXEA 2PTKA 5GJVB 4F7UA 4DB3A 1K73U 3EG9B 3HXMA 4C8QF 2MWOA 2E6LA 4CIEA 4ZHRA 3O3HA 4DTNA 3RKXA 3KK2A 5CIUA 4Z4IA 4M7AB 1NGCA 4BI4A 3VQ5A 4N4HA 2IVOA 1EP4A 3CHWA 1RACB 1WHKA 4ESRA 1Y57A 3DOKA 4J9HA 3QMLA 1UHCA 3PO4A 3QXEB 1RT3A 3EFOA 4CD3A 1WZOA 3SV4A 3AARA 1SRMA 3ALYA 4CEDA 1G8XA 2J06A 4C0GA 5GAN2 1Y07A 1YITA 5BR9A 2HCKA 4CC7A 1QSYA 3AA5X 3A1PA 3UDCA 3JCMQ 2OA8A 5HOOA 1OX9A 2PYJA 2DRMA 2NUBA 2AHJB 1RDDA 3M5AA 4JKDA 2XHCA 4KH5A 4YOVA 3SPZA 2AZSA 4QQ6A 2YI1A 1TK5A 2EQKA 3TAFA 2QEXT 3D0PA 1G3SA 4IXCA 4NYNA 4FWMA 3RERA 2ZJPL 1SF9A 3CCRN 3IKMA 2K5FA 3URGA 1KJWA 4M78E 3IG1A 4JHDB 4A62A 3LGFA 1HJRA 1VQON 1A0NB 1N27A 3WXMB 1NJIC 1K9AA 2H8HA 3HJFA 3CCET 4O44A 4CZKA 1TG0A 3MP8A 1BIZA 2MIOA 2EJGA 3OBYA 5HKCA 3AAPA 4DU4A 2MK5A 1NOZA 5HROA 1QVGM 1KTQA 4XIUA 1BCMA 4NXNK 1WQWA 1VQKT 3UA7A 3VRZA 1CXQA 3PV8A 4F14A 4CZIA 2YWWA 3P8BB 4YHHK 4B8AB 3I5SA 4C0ZA 5HK0A 4D6WA 3G6EA 1YI2T 2V52B 5JLHA 4FVMA 5E84A 5AQQA 3VS5A 3O5ZA 4CIFA 1NK0A 1EWQA 1IO2A 3CMAT 4ZGEB 1GLLO 2BUPA 3R6MA 1RL2A 4DU1A 1Q9YA 2K6DA 4OLAA 4L8RB 3JB9G 3M0SA 4D8KA 3NF6A 2VWFA 4FYYB 2HNZA 2VC8A 2R58A 4Z0UA 3JCMb 1LPLA 2MMPA 3M0QA 4J9DA 4H5NA 4IUPA 1LWCA 4B9VA 4WCEL 5AQKA 4BRPA 3EHRA 3KD1E 2OTJA 4N4IA 3OB9A 2A6AA 4AF1A 4IJAA 3WXJA 2VCPA 1VQ7N 4NS5A 1YIJQ 5EXWA 1X9SA 3O3GA 3VS7A 3D6RA 4YOWA 3CCJT 1JJ2S 2NZTA 1NYGA 1OEBA 5GAOm 1Q95G 2OPRA 4RW7A 4F04B 3FZMA 3THKA 1KD1O 2LCSA 3I55A 1ZQ1A 1DTTA 3UF4A 3THYA 1TKDA 4WQ5C 3VGLA 4PJOD 1VQ6N 3AVHA 4BRDA 3A5MC 2LT4A 3EH2A 3JB9H 1Q82C 2QTDA 4FWPA 3SV3A 5I11A 4CZGA 3BY7A 3DXKB 4JZ3A 4JD2B 3T1HK 1Q7YU 1HK9A 4N0AA 3PIOA 4KH1B 3SMSA 4C92D 2W41A 3QEWA 1H1VA 2KK4A 2NUPA 4KI4A 1VRTA 2UXBK 3JSMA 2NUZA 4JK9A 2DE0X 5D6YA 1OPLA 2FZKB 1TUCA 1D8YA 4IO9L 1WNSA 1QQMA 2CZ7B 5I21A 1KQSM 4HTLA 4C92C 2WFBA 3T7ZA 4L59A 3O8VA 2OCEA 3CPWS 3SD4A 2G8WA 4C8KA 4DR5K 2ZGYA 2QA4T 4M75A 4FJKA 4CJ4A 3CCSA 1RAFB 5AQJA 3I33A 1MA9B 3VMFB 1U47A 1NJWA 4LN2A 1K73C 3ZEUA 2HBPA 5KGXA 1FMKA 3HOTA 2EVRA 3NF7A 1MNEA 3HTRA 3FC3A 5FLXE 2DVEA 2CP7A 3OS2A 4HVJA 1AZGB 4C8OA 3CBOA 2E1YA 4BWJA 1WPYA 4M7DD 4OMNA 1IB8A 4JLIA 3AV9A 1KK7A 2VB6A 4V19S 1WLJA 4O4GA 1JJ2A 2E4LA 4WF2A 2RI5A 3D2EB 2EGEA 4AHCA 4UC4A 3O1BA 4XTVA 3QHSA 2QQSA 1D3BB 4M7DC 4JKHA 2ED0A 4PKCC 3LPUA 4M3WA 4ZTFA 3CI5A 1XNRK 2ZCFB 2RKIA 4DF8A 2IS3A 1XJWB 1MMGA 4PKHA 3TU5A 4C92B 2O01E 1Q81U 5I9EB 1OH5A 4DWIA 4IO8A 5J39A 3WXKA 1OU8A 4M7AE 2OTLA 2XY5A 4U7BA 1C0TA 2EYQA 3QEPA 1NGBA 3ZCMA 2O8BA 3OYGA 3CCVT 4CJWA 2KTQA 1SKSA 1SSHA 3KKSA 2OZMA 3SQ2A 3HP9A 5LL6S 1YXQA 2DIQA 2DJQA 1J53A 4JDSA 3CC2N 1FYNA 4E7LA 4FLUA 2VQEK 3QESA 2RH2A 1YHQQ 2Z1GA 4I2QA 1QVPA 2HQEA 5KYUA 1ASUA 4ELVA 4A2AA 3RRGA 4LH5A 1EWRA 2FBYA 4YOYA 3CPWA 5JS2A 2JTFA 3S9HA 2HL5C 2R5AA 2JUFA 3CCQT 3VV0A 1MDUB 1WN7A 3V9SA 3KTQA 1XNQK 2RPNA 2XICA 2ZPFB 4DFMA 3QSUA 4RCCA 4M7DB 4OMFB 2G3RA 2VYTA 4HT9A 3BUZB 5IWAK 1J5OA 2XMFA 2VGMA 5GAN7 1G99A 3HFOA 4OMMA 4FZXC 1PKSA 3OS1A 3GG4A 1RCHA 1ZBIA 2L2PA 1R0BG 1K4US 2DTUA 4C5IA 2IVWA 2PFUA 2CGKA 3QO9A 3TARA 1WNLA 3CCUT 3RMBA 5C42A 2JN0A 1NK9A 1KFSA 4NOYA 1H3HA 1WX6A 3BE3A 1GBQA 3GNGA 4RTZA 4BRFA 2DY4A 1P8ZA 3EFSA 4J83A 2YJFA 5FLXO 3CCRQ 2EJ9A 3LYIA 5AQPA 1C1CA 4X9CA 4E6RA 3JCMc 2H3GX 4CC3A 1VQOQ 3CC4A 4FSVA 4CFBA 1OX8A 4ANJA 4M63C 4AFSC 2KE9A 5I3UA 1KQ2A 1REVA 3AVJA 2ASPA 3VF2A 1VQ4T 4XK8E 4BRAA 2YHBA 2DL5A 3EG2A 5HRSA 2XRIA 3NMZC 2P9PB 3VEZA 2G8UA 2HD0A 1RNHA 3L4IA 5GIOA 4M78A 3O8MA 3H08A 4CGHA 3ULEA 4HVUA 1ILYA 4AFUC 1QVGS 5BPLA 4PJMA 3SBGA 3SJHA 3OW2P 1BI4B 3NVKA 3M8SA 1JXMA 1AHJB 1UDLA 1TGOA 1OOTA 6AT1B 4BRLA 3VA3A 4FJHA 1K9MC 3NPFA 4CJFA 4DS5A 3MEGA 2JNGA 1WQ7A 1RILA 1YITN 4A59A 1BB9A 5C0YA 3EFRA 1MGQA 1U6ZA 3HYFA 4DU3A 5D6WA 3TAGA 1M3AA 1G5VA 3P5JA 3VU3C 4DOVA 2DTOA 1Q7YC 3U4LA 3AO4A 4C8MA 3E9GA 5C0MA 3JB9F 4BGBA 2COWA 4CECA 1IXDA 1BA0A 1SSFA 2QWPA 3MN7A 2Y1JA 1VQ7Q 2BTTA 4B1WB 1XWLA 4FWQA 3ZL7C 1S1TA 4A4EA 1M1GA 2GFUA 3OSSC 2QKBA 1VQNT 4F7UB 4CI0C 2FSJA 3WNHA 4DUYK 2JZ2A 2NWMA 3CQTA 2KEAA 1HKCA 2QWLA 3VESA 2CDTA 2EJFA 1I39A 4JK7A 3NH2A 2OAUA 3GOIA 3O9RA 1HNXK 1D1AA 3LP1A 3CCMT 1NGEA 1D1BA 1E4GT 1FW6A 2D1KA 3L3VA 2OAWA 4Z4EA 2Q0UA 3WNFA 4A4KA 3EFOB 3HOSA 1NKEA 2CT4A 2ENMA 3G6EN 4CHNA 3WT0A 1U8RA 2A40A 5LMNK 2E3IA 5HY6A 1IG9A 4LF7K 2JS0A 2D9TA 4DR3K 1I5LA 4PK4A 3EYZA 4FJXA 3CJ9A 1NEBA 1S9GA 2X4JA 4FLXA 3I0SA 2ZPGB 4J9GA 1HPZA 1OH8A 2A42A 2KXCA 4ZNXA 1VYVA 4HT8A 4AH9A 4DHYA 2CZ1B 3RUXA 1AT1B 2W10A 4FSSA 1BU1A 2CYZB 3FFIA 3ZT4A 1DT9A 1NMNA 2XY6A 3SAGA 1VOMA 3MEWA 4CBWA 3WEEA 2BE9B 2X9HA 3O5BA 3SAHA 1YIJA 1IKVA 1NJIO 2OTJN 1GBRA 4QW2A 5D7UA 3OYEA 4O5FA 1FKPA 3RIRA 2WC9A 5DMRA 4BR0A 3LWHA 5E41A 4RW4A 4E1MA 1JLFA 4PL8A 1JB0E 1C1AA 3ER0A 3MEAA 2ZZDA 2I0NA 3I55N 3V1RA 1R8OB 1RDAA 4C92E 4CHQA 4CD1A 3OSVA 4B9LA 5SWMA 4CGJA 3QO3A 1WUAA 1BGXT 1R0CB 2IVNA 4ISEA 3MP6A 5CK9A 2EFIA 2KNBB 2FG0A 4JLHA 2E5LK 2O4IA 1D5AA 2YHYA 4IUVA 1N36K 5CZ1A 3QLHA 1WJSA 2DZCA 4CCHA 3C95A 4FCYA 1KAYA 1BQMA 1B92A 1U2VA 3LAMA 5FRMA 3CD6Q 1JCGA 4N0AC 2VVKA 3THVA 4PFOA 1UB4A 3VS0A 3X25B 3DB4A 1VQPT 3TAQA 5EU7A 3KFVA 3T1YK 4M75D 1HPMA 3ZFJA 2KHOA 4IJNA 1EIFA 2DD4A 2YUOA 4M7DE 1E4FT 1HRHA 1Q86R 5IXBA 1SUQA 3MHXA 4EMKA 1UGRB 3CCSN 3A5ZB 3V9UA 3KLEA 4DTJA 1N5YA 1TAQA 4CVNE 2K5LA 1OVYA 2COZA 1T6DA 4BRQA 2HQHA 3T3FA 1GOBA 1U45A 1WYXA 2VWJA 3THYB 3ZLJA 3M56A 3JV3A 1WHJA 5CR2A 1M1KR 3OYNA 3QZ5B 5GAGP 2MOXA 4KBOA 4BC2A 3CC7N 1K1ZA 1X6GA 3GL1A 3CQ8A 4GV6A 2D0BA 4B9MA 3JCMW 1Z9QA 4OB3B 2OANA 3RMDA 5TKYA 2NUPB 1KLNA 3M53A 3HVTA 1O75A 2HBWA 2YUPA 3H0FA 3TEEA 1XC9A 3THWA 4HA8A 2CGLA 5HRPA 1ZBHA 2HB5A 2DTIA 4BR5A 1JLQA 1TXQA 3JAME 2HHSA 4M75B 3JS6A 3NH0A 5AQLA 3VQ4A 1VQ8Q 3D2FA 3QEIA 1K73O 1YHQA 3MCPA 3SK3A 4Z88A 1GLEG 1QQNA 5AFUH 5FU6C 3REAB 3X28B 2Q0RA 2HSPA 1IBMK 2O31A 2QGGA 2Q36A 3CF5L 1KHIA 1BKBA 3EG1A 3R8EA 4IURA 4AHRA 2EGCA 1U1SA 5A0LA 1KC8R 2VWKA 3CJ1A 5CHIA 1ZA1B 1NK8A 3GDQA 5GANj 2HHTA 3MWPA 1YITQ 4DQ2A 4B1ZA 3K5MA 1TUGB 5M1PA 1DJ7B 2HMPA 2A0FB 2E41A 1YNZA 2QWMA 2W40A 5AT1B 4DR1K 3PNWC 2D0OA 4MZPA 3BP8A 3AVAA 4F7UE 3AO1A 1W6XA 2DERA 3CCRA 2BANA 5DLOA 4CJRA 4ELUA 3JB9I 4IFYA 1VQOA 4C8QG 3A8YA 2O8BB 2KKZA 2RE2A 4OJRA 4E7HA 3THXA 4GVEA 5GAN8 3A8LB 3CC4N 2RQRA 1PG5B 3SDZA 5FU6B 4PL6A 3BW1A 2D1XA 3X24B 1HJOA 1RAIB 1U04A 4BY9C 1CZAN 3MN5A 4M77F 2NLXA 4IOXA 1HNZK 1Y0MA 2FPDA 4M78D 5CVIA 1TKZA 5AFUA 4J2AA 2PAVA 1WFWA 5KYUB 2CREA 2EYXA 2NRHA 1U4BA 4OB0B 4ZTJA 3MDQA 4N5SA 4GKKK 4FYXB 4Z8AA 2AP1A 2RHXA 1RTHA 1NGFA 2QEXQ 4CZHA 4KGZB 2RD1A 3V8JA 3QFUA 2DL3A 3SAFA 2LCLA 3PE0A 3JAMO 1XMOK 4CW7B 4PA1A 5C2DA 1TVRA 4JI2K 3QIIA 2L8DA 2EYZA 4JAXA 3TAMA 4JKAA 2P5OA 4WFNL 3DXMA 4CE9A 4DQRA 4M4ZA 5CZ2A 1GLBG 4PLIA 1D1CA 1XQHA 4A5BA 2QGFB 3PIPL 1MUZA 3GBQA 1QVFS 4I2PA 3GBTA 2A36A 4BR2A 3FJ5A 4E47A 3ME9A 4IUTA 1BIUA 4LUDA 2JMAA 1UWBA 1D09B 3CMAQ 2KW4A 2ZJRL 5HRNA 2Q2RA 1YJNA 2R5MA 3MK6A 2KZZA 1N34K 3LWMA 2G8HA 4DSKA 1VQ6T 3OTOK 4M78B 3MEVA 1NK6A 1TOVA 1LAVA 3I55Q 2P9SA 4F9OA 2DYBA 4MDBA 4GW6A 3ULEB 3MN9A 3HFNA 3M6GA 1KCFA 4H5TA 1R0AA 1A5WA 4KHSA 3LL3A 1YAGA 4EMGA 2BKDN 3C4SA 2K9GA 3DB3A 4M42A 4J7IA 4OPAA 2X3WD 3E2UA 1K9MO 2NRXA 1VYTA 2LQ8A 1K8AR 3Q1JA 4FWNA 2LJ3A 2HHVA 1XHZA 4Z89A 3DM2A 4Q0BA 3V1QA 5CKHA 2LJ1A 1SPKA 4KGXB 4C8QA 4W5NA 3CCJQ 1M90R 1TH7A 3HM9A 1Q7YO 1YFNA 2ABLA 2JVVA 4AG1C 4NO7A 4CJSA 5AZJA 1YTUA 3RNJA 1NG2A 3AGRA 4Y1CA 4M7YA 4CRIA 3C6AA 3ZYYX 1SL1A 2XDBA 4E7JA 2HSEB 4HKEA 5FWCA 3BDLA 2QWRA 4LD0A 3SEMA 4CBUA 3REBB 1X6OA 3MAQA 3VQDA 4DBFA 1NGJA 3AGKA 3PMTA 5CCAA 1RLPC 3KBGA 5HBMA 2WACA 5J2NA 1YIJN 4CF9A 4B3SK 1QVFA 1AWXA 4E7IA 4XEIA 3QERA 3GLXA 4F8RA 3U9DA 1NK7A 2O4XA 5GAOr 2B6AA 3M57A 1N33K 1W4SA 3OMCA 3CC7Q 3HTVA 2A1RA 1L3TA 2EHGA 2DLPA 2L3SA 1SKRA 1I07A 4XU2A 2IG0A 1H3ZA 1W97L 4B3RK 4FJMA 5KCHA 1N8RR 1JL2A 3DI6A 2D8JA 2ZE2A 4DOWA 4DSLA 3QBXA 2DAQA 2KI7A 5CO7A 2MF2A 3MECA 4KTWA 2LT1A 2MI6A 3H6EA 4CBXA 3ZX3A 4CF1A 4RG8A 4DTPA 3VF4A 2V7YA 3LAKA 3OVNA 2HDAA 3CXCP 3ZSZA 4Z4HA 4OLBA 1WSEA 2NRWA 1I4K1 3L2QA 1E6HA 3CD6A 3QWYA 3QFPA 3K5OA 4OKEA 4FOIA 3VQEA 3RRHA 3PY8A 4PY5A 1TKXA 5AR0A 3PUFA 4M7AD 2KGTA 3WEEB 3FFKB 3VQQA 3ENHA 1RI0A 4KGVB 1LOTB 3A8GB 3IQLA 4Y1DA 2YKMA 1EQYA 4FSXA 2Y1IA 5F1XA 1KVCA 4AHTA 4N41A 2E6NA 2KROA 2RHIA 3AHUA 3PTAA 4FLVA 5IHNA 2WTUA 4C1NK 4EMKC 2D6FA 5LJ5j 1WOQA 1WAFA 4JI0K 1FWZA 4CZLA 2NRVA 3TAEA 3NTIA 2IOCA 2YRCA 4DUZK 2YLCA 1X1PA 1TSFA 4BI3A 2L3QA 5AQTA 1IG8A 3KXTA 1WSFA 4NLBA 2NLUA 5EC7A 1T44A 3HT3A 5JVHL 4Z4FA 5J26A 1JCFA 4KO0A 2YLBA 2I5JA 2Y4XA 4HCZA 3TSQA 2QWQA 3RR6A 4C8LA 1TAUA 1U2VB 8AT1B 1Y7XA 2J4RA 3K58A 3C65A 4MMLA 1B9FA 4AG2C 2VWBA 5FPEA 2K57A 1AZEA 3RSEA 1QQJA 2HNYA 2D8HA 1WSIA 1Z25A 4DQSA 4ILHA 1VQ5N 3I56A 1PCXA 3HRSA 2DK3A 1VQ8A 4G9ZA 3RKWA 3IAYA 4B08A 4OGEA 2IC3A 4CFDA 3SPYA 2DVJA 2LJ0A 3O3FA 3PO5A 4PJOF 4EMKB 1Q86U 2MYSA 4WYBA 3AO2A 1YHQN 3H3OB 4GMJB 1GOCA 3KIOA 3WVEB 4Z94A 5GAHP 2JTMA 1RDWX 3HM8A 4CZEA 5IXFA 3CJAA 3HL8A 1M1KU 4Z4CA 1TTHB 4CJEA 3L1AA 1LNXA 3GF5A 3NGIA 4DLGA 2LX7A 1ESVA 1VQ4Q 3VGMA 1ZSZA 1RI9A 2FL7A 3SWNA 2ZGWA 2HHWA 2W6KA 2MCNA 3M0TA 4JJCA 1NLOC 3M3ZA 2RN2A 4B9SA 4LF4K 2CH5A 1JLEA 4H0TB 3KLHA 5FWBA 1VHXA 4FJ5A 1KSPA 4J2EA 3THWB 2RHZA 2P9LA 1NM1A 4I6MA 4B9WA 3LM2A 3LP2A 1NM7A 3ZSXA 3LH0A 3VS2A 3FGUA 3CBPA 5M9OA 1C6VX 5A0GA 1ASWA 5GMKh 2KRMA 3VKIA 5GAOn 1KQ1A 1BHLA 2KQ2A 1JJ2P 1JCEA 4BRMA 4BR9A 3T69A 4LF9K 5HRRA 2LZ6B 3U6FA 5LJ3j 4JKCA 2HBMA 4J5YA 3MWTA 3CMET 1PSEA 4C5EA 2YHXA 3VN5A 1IKWA 4FJ7A 2DILA 4FYDA 2HVIA 1NJYA 3RMAA 2VKNA 2LSNA 3G6ET 3ZX2A 2HL3A 2MWPA 3DLLL 4W5QA 1DKGD 2OI3A 2QEXA 1JBMA 3VS1A 1NPPA 4DV5K 4QVCA 1KC8U 1Y96A 3CBMA 3OYDA 2YV0X 3NF8A 1RT1A 1NKCA 2AIRB 3L42A 3IUCA 4JRQA 4CEOA 1IO6A 1YBYA 1KD1R 4L3QA 3SZ2A 5KYXA 1S1UA 4YOXA 4LC9B 4CFAA 1VSMA 3KLGA 3F73A 3E9FA 2KLAA 3CPFA 3OYMA 2FLOA 4DTOA 1L3VA 4FW1A 5LJ5h 4HUEA 4A2BA 4AFQC 3SLCA 1BI3A 1LVKA 1VQKA 3LANA 4AHUA 3K5NA 1L5UA 1NG9A 4K0KK 2JGUA 5IH2A 4BRHA 2OTJT 2JW4A 3VPZA 3CPWP 4NYFA 2HBKA 4B9XA 4CF8A 4IDKA 4FLYA 2J05A 1YI2A 2CH6A 3THXB 1WGSA 1JXOA 3AVBA 4B1VA 2K3XA 2GWKA 2P4RA 3A5OC 2YRDA 3CMAA 2P9NA 2E88A 3HP6A 4HCKA 4QVDA 4FJIA 4Y0WA 1BI2A 4DSIA 2B8AA 4MMKA 1LW0A 3EO3A 4RWTA 1YJNN 4IKFA 3JSCA 4LF5K 3J7AP 2HQXA 4O8KA 2D0PA 2QASA 1S72T 1F21A 5EOYA 5A0DA 1W0HA 2YXYA 1AOJA 1IKYA 9ATCB 5AQGA 1PD1A 2EKOA 3EGDA 4BE0A 5M1KA 1M1FA 2DO3A 1UJYA 1WJQA 3NCIA 1M9SA 3KK1A 1W2BM 4KV8A 5BREA 4M3UA 1RT5A 4H5VA 2ASOA 3CCJA 4XU3A 5BRFA 3DXMB 1K8KA 2QDLA 2X4XA 3SUNA 4XU1A 2OPQA 3ZT2A 3G0ZA 3EN9A 4DR6K 2KFZA 4C8QC 4PUOA 5F2RA 4DBHA 4XAXB 7AT1B 4J9EA 3QBWA 4BVOA 4E3SA 5AQVA 1X69A 4ORZA 2VG7A 1RTDA 3VEXA 2QTVA 4K42A 3A8OB 1SHFA 2DF6A 2RPIA 4DTMA 4MLHA 2G8IA 4C0FA 2C0OA 2HMAA 4BGAA 2DA9A 4LDYA 2O9SA 1I5OB 3C94A 3OA6A 4OMLA 2E1ZA 4XU0A 3V7RA 2QXFA 3VEWA 2P9SB 3CFRA 1XHXA 2RF0A 3CC7A 1AEYA 4X34A 4PNOA 4RMOA 1NGHA 2HBLA 2O8FA 1M2VA 3ATUA 4BE2A 3RMQA 4NCGA 1FMVA 1VQPQ 3CG7A 3HZ6A 2VQFK 2RB6A 3PSFA 3QKJA 4C5HA 1OZ3A 2QA4A 3QB0A 1GXIE 4CERA 3C6HA 2M51A 3V8KA 4JKGA 3GIBA 4QT7A 4Z02A 1K8AU 1AWOA 2OTLT 4LFAK 3HKSA 5GMKe 4ATOA 1M90U 4DSFA 2A5XA 5AZJB 1C0GA 2KRSA 3RVCA 1VQ5Q 3UKUA 3CD6N 1ZBXA 3MEDA 1QZ5A 4ILGB 5LL6Z 5CYQA 1CKAA 1GL5A 5AQIA 2ECZA 4H0VB 3SUOA 1XUPO 3OYFA 3ZX0A 2ITMA 4FVUA 3O9TA 4JV5K 4RG2A 4LDWA 1HYSA 1T3VA 2I2LA 5AQXA 1HNIA 4B9TA 1QVGP 3I9QA 3O80A 4J2DA 3B6OA 3M0PA 2O4XB 4HUGA 1ARKA 2HKQB 3SB2A 1IJJA 1JLCA 2IPOB 4DV2K 3CCVA 2ROTA 5FU7C 3P4IA 4QOZB 2DXBA 1KC8C 3KZBA 1GCQA 4AT1B 8ATCB 3AVIA 4EZ6A 1X27A 1N8RU 4BRNA 3M0UA 2V7ZA 1B9DA 4PFPA 1S9EA 2XO7A 1OH7A 3A0IX 2RN8A 5KQ8A 1JLAA 1XTDA 1ZA2B 2QWNA 3ZETA 3UE5A 4CK2A 1B3QA 4DQQA 1OH6A 3CCQA 4E19A 2E2QA 4OMOA 2QKKA 2DNUA 1SL2A 2X78A 2KT1A 4XTUA 1NYFA 3SUPA 1AD5A 3I0RA 2DL7A 1WXTA 3NTHA 2IVPA 5IHIA 2A37A 3IS9A 5C12A 2WSCE 1FMWA 1TUYA 4BR4A 1LW2A 1RBTA 4XTYA 1VQMN 4RTFD 3I56N 3F5TA 3CCUA 1VQ8N 5GAN3 4DR7K 4F2RA 1HYZA 3M8PA 2V8KA 5KYNA 1X3NA 2BE7D 3JB9J 1RADB 3MO8A 4J6XA 1SHGA 1D0ZA 1PRMC 5FU7B 4IZ9A 3MKDA 1KFZA 5D3GA 2DXCA 4OX9K 1VQLT 3C6UA 4MLEA 1UG1A 5D6XA 2DBMA 3KKRA 5CKDA 1X6BA 1S1XA 3LDLA 1QSSA 4FZYA 4JUVA 1VQ4A 2VG6A 2BGGA 3M1FA 2HHUA 2KYBA 3QWXX 2O4GA 4LSNA 3I8DA 3K2PA 2A1SA 4FLTA 2GBQA 3GE1A 3ZSVA 2ZF5O 1M3CA 3A8MB 1X3MA 3G4ST 1WDXA 3DLBA 2EKHA 2FXUA 2QDYB 5GAMj 1ZSZC 2ED1A 4FK2A 3SWNC 1RLQC 2M1HA 1KQSP 5C2FA 2ZPHB 1VUBA 1Z05A 4O5BA 5AQYA 4DQIA 4JI5K 5C24A 1KRPA 4M77G 2BTFA 1VYUA 1VSFA 2GTOA 1OI1A 3I35A 1OULA 4AMCA 3TWHA 3H45C 3S6WA 1YJNQ 2Q97A 3MCAB 2RJCA 4RTVA 3LH5A 5KGWA 2PQWA 3HBTA 4JI8K 3OHRA 4J6WA 5CQXA 3AAQA 3ZSOA 1UECA 2JWLA 2NNWA 5M1NA 2LTOA 4DTXA 3QNOA 5CKFA 4OB2B 3HPOA 3WNGA 2VV5A 3RR8A 3ZEHA 4L6V5 3M4YA 2CT3A 3QYGB 3M9QA 2V51B 4OKKA 4CEFA 1B34A 4IFEA 4CESA 2QEXN 4B3TK 2F4VK 3TCJA 2I7NA 1VQNA 4XH4A 4OPHA 2RQUA 4IUUA 3TI0A 4QS9A 2QQ9A 1NZ9A 3L2ZA 4RTXA 2FO0A 1NGAA 3DRSA 3PIOL 1W2BS 1QSLA 1ZSZB 2DKGA 3SWNB 1A5VA 1YN8A 3LDOA 1QVFM 3CCEN 4U67L 2DEQA 2W6LA 2VYPA 1Q81C 3DAWA 1VQ9T 4FZZA 2SEMA 3CCMA 4FW2A 3UPUA 4CJLA 1P92A 5AYFA 4AM7A 2UUCK 3I5RA 1EO1A 1M90C 2FPFA 3AT1B 3DKMA 1VQKN 4F3OA 2KQWA 4KUIA 2P9LB 4I6MB 4FM4B 1QWEA 3ZSWA 3EKUA 3JCMd 3SMPA 2IIMA 1YI2N 4IDHA 1PWTA 2K3YA 1G3TA 1G3YA 1T3LA 4EIKA 3H0IA 2FBXA 3HI0A 4PJJA 4ZN3A 4CJ7A 3FDRA 5DM6L 3EY1A 3V9WA 5GMKi 4KBMB 2E6MA 3BZKA 4OPJA 3V81A 1KXPA 3CMAN 1NOYA 3U3GA 2CP2A 2WUSA 3R3LA 3OJSA 2E6ZA 1HX1A 5TKWA 3M4GA 2ZAEA 2XHBA 4OVLA 2KR3A 2YCHA 3VQPA 2JS2A 4PKIA 3JCMJ 4DFPA 2LQKA 4C8QE 1QMCA 2VXFA 3RESA 3J7AF 1RBVA 3VQCA 5FW9A 1WXUA 4JEPA 1Y96B 4FWSA 3G71T 2CH4A 2LC4A 1ATSA 1RAGB 1UJ0A 3HPHA 3TAPA 3CPEA 3N4QA 4FK0A 2VASA 5KYXB 3O9UA 3X26B 5KPRA 2RJEA 2P51A 4XTWA 3NE6A 2R7YA 2DJZA 3NHGA 1XI1A 1VSKA 4BDPA 2E10A 4WF9L 2X74A 1AWJA 2F69A 1Q82R 4KREA 2HF3A 4M77A 3P39A 3CCJN 1WLPB 3ULRB 3B6PA 3VQ6A 1SKUB 1TL1A 4GLMA 5C25A 1YJWT 1U5SA 1SEMA 3JCMf 1ZX6A 1BISA 4AM6A 2HF4A 3NAEA 1W2BA 4Q5VA 4FO0A 3FIFA 1HNVA 4RTWA 2FB7A 2D0NA 4OVAA 4BROA 2P9NB 4BQZA 2HMIA 2XU8A 2V8IA 1YJ9T 5J3BA 2YNGA 3WNEA 4J7FA 3BF3A 2NRRA 1IH7A 1NGDA 2ATCB 4WE1A 3HRUA 2X35A 4BWMA 1Y71A 2M0YA 3NHNA 1WHMA 4CGFA 5CYMA 1UHFA 3JRZA 1BUPA 1UA0A 3KVGA 3VTHA 3L2RA 3JB9D 4N76A 4DV7K 3HSTB 2A08A 4BG8A 1QHTA 1NNEA 1VQPA 3TR8A 1MV0B 2GEMA 2RI3A 3EGDB 3DJCA 2RF2A 3AVCA 4A63B 3FZHA 5JMVA 2LQNA 4WQ4A 1MMAA 2QA4N 3CCLT 3J8AA 1HXDA 5BPNA 4DFJA 4GV3A 4CEQA 4CJVA 1K8KB 2WOMA 3OYBA 1JEGA 2QG9B 4NB4A 2A7YA 2XY8A 3HK2A 1EZZB 1VQ5A 3DLMA 4RUGA 1C0MA 2EPDA 1EX4A 4QVZA 2HHHK 3JCMh 2PYLA 2PY5A 2OYQA 1HUXA 5C10A 4FJGA 4LF8K 2F1LA 1ZBJA 1VQMQ 3I56Q 2YKNA 4H0XB 2O8CA 3LWIA 3BFMA 1CKBA 2DM1A 3L0QA 1UGQB 3ZEUB 3NGYA 1G2BA 2QQAA 4F16A 3OJUA 1QE1A 3JCMg 3N4PA 4FLZA 3SQ0A 2P9KA 4CZFA 2W42A 3RDVA 2DRKA 2FZCB 2JM8A 4Y92A 1EFNA 1W9HA 2HEQA 2KBTA 2VUBA 1MMDA 4YTLA 2EWNA 2O8FB 2FBTA 3LZJA 3V4IA 3ISNC 3LM9A 3HRGA 3ULDA 2QXLA 1YTAA 3F70A 1ASVA 1SG5A 5I42A 3CCVN 4OKJA 1BO5O 1EETA 2QWOA 3L2UA 4KKOA 1IHVA 4LD9K 5J2QA 5JICA 3CCRT 1RFQA 3C7NA 2E5KA 1RDCA 1VQOT 4J2BA 4O0IA 3VGKA 5KPTA 1GCQC 3U23A 3EE9A 2GTJA 5GANd 3OYAA 4ICLA 4RW9A 3VQ9A 2RJFA 2D0CA 4MDWA 1JKHA 3CCQN 1EKEA 1XNIA 1VSJA 4DV0K 1P90A 2D5RA 4YORA 4PJOG 4KB1A 3O1WA 2QQRA 3QICA 3AVMA 3DRPA 2XDPA 2BUDA 5AZIA 3VQBA 3WQTA 3MXMA 2CUDA 1OPKA 2UXCK 3H9NA 1TV6A 3K5LA 4OMPA 1H92A 2SRCA 3CCUN 3LP0A 1NJZA 2CP6A 4B9NA 4IBNA 3UA6A 5GAOp 1KHCA 2KVQG 1HR0K 4C5GA 2EBPA 1CZ9A 1O9SA 2DZ9A 1RABB 4C0DC 5KYYA 1JXBA 1TS9A 1S1VA 1J3TA 4FWKA 4JNEA 5JVGL 2GFAA 4JPBW 4MO5A 1KC8O 2CH4W 3CCEQ 1X9MA 1MNDA 5KYWA 2YHAA 3OQ5A 1C6VA 4LH4A 5EY4A 1MWKA 3IFRA 4DMNA 3CMEQ 4DEYA 1VQ4N 4PWDA 2GV9A 1TYQA 1JO8A 4EPCA 1K9MR 1TWBA 2F2WA 1VQ7T 1VQKQ 1CXUA 4QKUA 2Q1NA 3Q7CA 4M7AF 3ZETB 2GELA 1QCFA 5IT9E 2FEIA 4LXCA 1YI2Q 1ZBSA 3M59A 2YNHA 4NCAA 4K43A 3NGPA 4CF2A 4PJNA 4BR7A 4KI6A 3W0LA 1C0UA 3LW5E 2M9UA 4B6MA 1VRUA 1MU2A 5GIPA 3ASMA 4QS7A 3INZA 3MEUA 3G7ZA 5FPDA 3H6ZA 2NUTA 5LJWA 3J80E 2M0OA 2FPEA 4ID5A 3ZSYA 4HVVA 5L8RE 3VETA 1DTQA 1WSHA 3A2FA 2V1QA 1QQCA 4C0DB 2ZD1A 3A5NC 3VQ8A 3GNFB 5CAIA 4CJTA 1SAZA 1HMVA 2XDDA 2C0TA 1GOAA 1E3MA 1I3AA 4KAZA 2BZ8A 1JLBA 1V4TA 1VSHA 2BZYA 1XC3A 2P9UA 3NH1A 3L2VA 4KHWA 1N9SA 3EAEA 2DETA 1VIEA 4CJPA 4AFZC 4FYVB 3O6WA 4JS4A 1S1WA 3TABA 5A2QE 2XKOC 3JCMe 1VQNN 1D0XA 3HPWA 4DS4A 1PM3A 2FRYA 1M3BA 2NYSA 4JS5A 5GANh 1QW1A 4DV1K 2PNIA 1ABQA 4PJOA 3FLCO 1T05A 2RK2A 2NRTA 1NEGA 5I22A 4W5RA 3LDSA 4NL2A 3CCMN 1B07A 1JU5C 2P0QA 5IAYA 2GTDA 2CP3A 3E9LA 5BRHA 1T7PA 1KVBA 5GANg 1BCOA 4E1NA 3OYJA 3OS0A 1CLQA 4H4MA 1V1CA 3RMSA 1LWFA 4BC3A 1B7TA 2B86A 2RHUA 4ISFA 4OGCA 1UA1A 1RDBA 2GBZA 2BIVA 1ZBFA 4OF1A 4B8CA 3V9ZA 5IT9O 3CEYA 4D8DA 2CP5A 2V26A 3G25A 2R57A 4JJNK 2CSQA 2RJDA 1VSEA 2QA4Q 2PUKB 2WBNA 1D9DA 3E1SA 1B34B 4A4FA 2F96A 3FEOA 4F17A 2KFNA 3NGZA 2KRNA 2D4WA 2E1HA 2QI2A 3WXIA 3J80O 1JLGA 5GAN6 1RBUA 3M54A 1WHHA 3CC2T 3TVTA 3HVRA 4KHNA 2COYA 4M77D 1U49A 1Q81O 1WI7A 4O0JA 1X9JA 3AO3A 3BDUA 3VS3A 4Z4GA 1M90O 2CZ0B 4BE1A 3QEXA 2HAXA 1NLPC 2EQUA 3EG3A 4FOEA 2DFHA 4BVPA 4M77C 2K2MA 2DPNA 4JYAK 1QLYA 5KQDA 1BI0A 3ZT3A 5A2QO 2HW3A 4A61A 4DR2K 3ENOA 3ZT0A 1YCSB 3O9QA 2CSIA 1TUUA 1N6QA 3UIQA 1TUDA 1NU0A 2LCCA 1KAZA 1X43A 3O08A 4CJ5A 3M55A 4II1A 5CY4A 3X20B 3A5LC 1BBZA 3CCVQ 3BF1A 5F0XA 5GAN5 1S5JA 2NRZA 3OMGA 3OA9A 3VEYA 3ZT1A 2F2XA 2E5QA 5BN8A 4FJ8A 4GBQA 5FPNA 2F5KA 3EKSA 2O8DA 1L3UA 1M8VA 1BG3A 4K8XA 3D7EO 3GOXA 3SQ4A 1VQPN 2ITGA 1X2QA 4ID1A 1KLMA 4ELYC 4RTYA 1CZBA 5C15A 3KWGA 3LGLA 2LQWA 3EHQA 1HSQA 3QG1A 3AY9A 4BY6C 5LJ5d 3D45A 3CCQQ 3L6QA 3RBBB 5DK5A 4M77B 1Q82U 2Z0WA 4WQ4C 3DLHA 4DEXA 2D0AA 3L8BA 2LRQA 1PRLC 3SFMA 1FKOA 4QQGA 1VQMA 4FL9A 2WSEE 5H1SQ 1GRIA 3VQ7A 3H1QA 1S1NA 4L5GA 4R55A 2PUOB 3NVMA 4NLCA 2YX6A 2JLEA 1Q9XA 3CCUQ 1YP5A 5GJWB 1NMDA 5L23A 2ESWA 4MZMA 1MWMA 3OYYA 1GLAG 3C0BA 4DBQA 3W3DA 1UFFA 1RTIA 1BQNA 1YITT 4IOAL 3CETA 3J7YP 2XG8D 4EDUA 3R6OA 5C6SA 4C92F 1NGIA 3JCMV 2UU9K 4HUFA 1HYVA 2FZGB 2YUQA 5GANe 4FJ9A 3P38A 3LLRA 4RCBA 4JJDA 4BY6B 4JRPA 4C23A 4EP5A 4IOCL 1CSKA 3VERA 1ACMB 4FIBA 3R6NA 3TQ7P 5LJ5f 1J54A 4JI6K 1T0HA 4ZGJB 2X3XD 2GUIA 3R9PA 4KPYA 1RBSA 2P9IA 1RBRA 3F9MA 4FWOA 2F7TA 2UYTA 4LY7A 3QJ6A 4A54A 3L2WA 4LDUA 4YOUA 1MV3A 3MP1A 5T7BA 3SUQA 2K79A 4GLKA 2HNIA 4FT2A 2FSKA 2EAYA 4NL3A 1VQLQ 3CQXA 2RNAA 2PU9B 1BYMA 2O8CB 3D2FB 1X2KA 4M7DF 3HSCA 5GAOq 3LDQA 1N32K 1VSIA 2ZQBA 1SV5A 5I2SA 1Z9ZA 4K11A 1TKTA 4N56A 2HHXA 1QHAA 2P9KB 3G4SQ 4TVRA 1QKXA 3QIOA 4OP0A 4BB7A 2KSSA 4KHQA 3MXJA 2L3RA 4KULA 4KHPK 3TSWA 4J9BA 4O6JA 2XY7A 3QZ9B 4FT4A 1V29B 3H0HA 2PBDA 1VQNQ 1HYOA 3BDPA 5LJ3d 3VUBA 3KLFA 3L4QA 3CCEA 4R79A 3CXCA 1BIBA 4W5OA 2K3BA 1QWFA 4V2SA 4M75G 1KIKA 1VAZA 3FR0A 2KY9A 2JWKA 3VEVA 5BPMA 5JS1A 3CMEA 4OPKA 1J9AA 2V1RA 2HKNA 1RT4A 1X9WA 1AVZC 1W1FA 1ZUYA 3N5BB 5KH6A 2A3LA 3CCMQ 3C7NB 2AA4A 2FRWA 5LJVA 5M1FA 3AA2A 4CIGA 3JYTA 4YY3K 1WBDA 5LJ5g 4H03B 3H46O 4BC4A 2B5JA 3H3NO 3PFSA 1H641 3SHWA 2AKLA 4X65K 1YVUA 4LFCK 1M2OA 1I94K 4CHPA 5AZIB 2YRVA 3QDFA 3I55T 4BD3A 1OV3A 1QKWA 1RAHB 1V76A 2OX7A 1DEJA 2RHKA 5CE3A 1AWWA 3J7ZO 1FXXA 5E26A 4ZN1A 4EAHD 1G15A 4FL6A 2OPSA 3A98A 2E3HA 4JN4A 1WA7A 4KHUA 4ELZC 2KDSA 1RTJA 1VQ9Q 4HCBA 1R59O 1UTIA 3V7CA 4R56A 4H4OA 2DX1A 4LE9A 3O4QA 4WCIA 5LJ3f 1M30A 1LCUA 1DGKN 2E2NA 2E20A 4DV3K 2ZPEB 1IZ6A 2RM4A 4OMQA 2F8TA 2FVUA 2HVHA 4BC5A 2X4YA 5KYYB 5EVZA 2DYIA 4LDVA 2RI2A 4E1JA 4C8QD 3S41A 5J1EA 4Y91A 4CC4B 5KYWB 1G83A 2QTXA 4N47A 4F7UF 4LSLA 1BK2A 5AQUA 3OW2M 4KH4A 1D4XA 2GF7A 1TYQB 3UATA 3VS4A 1Z26A 2BH1A 3E1YA 4FPBA 2JTEA 3LP3A 4LNPA 1K9MU 3VENA 4XH1A 4EMHA 2AJQA 2BZXA 3GP8A 1LV5A 3MEEA 3CCST 1S72A 1RUWA 4KTQA 2RQTA 1OZ2A 1E6GA 3I8BA 3G1JA 3KHYA 5AQHA 3T19A 5KRSA 1WSJA 3P8HA 2YHTA 4KUDK 4H5WA 4HCCA 4PJOC 3G71Q 2YDLA 3H1VX 4RCHA 4FWRA 2FYKA 3TANA 3CM6A 1T6CA 4DV6K 3JCMP 2F5TX 4YOTA 4GV9A 2NUTB 3PX0A 3RTVA 3META 2OPPA 3CC7T 4AQYK 1Q86C 3M8RA 3TTCA 3DWLA 4JZ4A 1K0XA 5CR4A 5AQOA 4BRKA 3C12A 4R5PA 4EIAA 3HPGA 2EW3A 3CYMA 1U06A 4RKUE 2GX9A 4HXJA 1YJWQ 5LJ3h 2E2OA 2PZSA 3JXUA 2KZMA 5GINA 3ITHA 1YUWA 3KK7A 2P9UB 2G8VA 5KI6A 3TTFA 2JT4A 4JLGA 4M77E 2H3EB 1LJOA 1M1KC 3FE1A 4X64K 1MHNA 2CGHA 1VA7A 3QETA 1M8MA 4KT0E 4C8QB 4PFZA 3FZLA 1YJ9Q 1TU0B 5LJ3g 3T1AA 4X62K 3P8DA 2IAJA 2ATQA 2JXBA 4M78G 2I7PA 1LOJA 1RAEB 3K9JA 4PJOB 3LALA 3SYZA 2E65A 4FXDA 2VXEA 4G1QA 1ZYQA 3EGXA 1I1JA 2CKKA 2GQIA 1E7OA 1OU9A 4E7SA 3OY9A 2LNVA 4PL7A 3CQYA 2L3PA 1N5ZA 4TSXA 1PNJA 3VA0A 4PHTX 4K41A 1WSGA 1D9FA 4J9CA 4M3RA 4JI3K 3LX7A 3CCLQ 4A4GA 2VGNA 1IKXA 4LUEA 3QINA 1U1TA 4PQUA 3FJPA 2QYZA 2RQWA 5LJ5e 4W5TA 4DTSA 3AA4A 5DM7L 4QS8A 4DSEA 4IWVA 2HBJA 1M4ZA 5KE2A 1NK5A 3RKYA 1TL3A 2IGIA 2XK0A 5CKEA 4O5VA 1JRIA 4IIMA 1Y97A 3CC4T 2P1JA 4KFBA 4F3TA 2ASMA 3EZWA 3QUIA 1UGPB 2KT8A 2GGRA 2L0AA 2EQJA 3DYAA 4JI1K 3LDNA 1S3XA 4DLEA 1NWKA 4JRIA 3M5RA 4GVMA 4H0OA 2O8EA 1RAAB 1G3WA 2IIRA 5KRTA 2L89A 3NFAA 2O2OA 3QYHB 1HQEA 5FDLA 1ABOA 1PD0A 1BA1A 4I9QA 2KAFA 4CEBA 4IG0A 1SZ2A 1ZBLA 2J7IA 2HZYA 1BU6O 1U3OA 1Z6RA 1NLVA 2Q3SA 3SJJA 3L3UA 2UUBK 2XIDA 2AZVA 2OJ2A 1UGSB 4QQDA 3NMUA 4EHUA 1KSWA 2EIFA 4GY2B 2QAZA 1GLCG 2YNFA 2O8DB 4JI7K 4J8OA 1W2BP 4M3YA 1LAWA 1TK0A 4M45A 2FSNA 4M7XA 2DXUA 5K14A 5M1QA 4EFHA 4VUBA 4CJQA 1HLUA 4M75F 5AQZA 2AK5A 1OVQA 1QQOA 4P5NA 4YDUA 2HSTA 2Z1IA 2HNDA 4DSJA 2AKKA 3RSEB 2EWSA 3EG0A 3E9PA 4MFBA 1N9RA 4RTTA 1VQLA 1QZ6A 4CZMA 4DA4A 2MPXC 2DEUA 4JKBA 4CHZA 2K2VA 2FF6A 3HO1A 3U3YA 5LJ3e 3AA3A 5CKBA 3U8XA 1NJIR 1RT2A 5GAMd 4PLLA 2Z1JA 4IIOA 3G4SA 4DKWA 2PVOB 4DFKA 4B9UA 1T3SA 3P31A 4ISGA 4LFBK 4FM1A 4DCHA 4AHSA 2GWJA 2W0ZA 2DTHA 4XTZA 1WHGA 1WIEA 1MMNA 3IRXA 1GFCA 2KMTA 2RQVA 3OYKA 3BY5A 3OS5A 1YVNA 3V8LA 2A28A 4BREA 4EP4A 4FLWA 2IDOA 1A5XA 2X6SA 4BDYA 1VQ6Q 4M7AG 2O88A 1K8AC 4J8FA 4Y28E 3CMEN 2P9IB 2A41A 4KH6A 3OW2S 4WFBL 5MLCQ 4KTZA 1YIJT 4DQPA 1SL0A 2RO0A 1W7AA 2J6KA 5ADXH 2Q31A 1L3SA 2PVDB 4GNIA 2LMJA 1VK0A 5GMKm 2P0PA 3AVNA 4UY8O 3K9KA 3D7SB 3OYCA 3DLRA 1QVGA 1PHTA 4ME7A 3MN6A 2KYMA 3BZCA 1RDUA 3CJ7A 4JJBA 3V7SA 5GAMf 4CJ3A 1KVAA 3PIPA 4H0YB 1VSDA 4FYWB 4AILC 5LY3A 3E66A 3PVQA 2FC0A 3AVKA 2EQIA 4WFAL 3DLEA 4NCBA 2YJEA 1BDGA 5EX5A 5GAOl 4A4HA 1VQ9A 1D0YA 3V1OA 2DBKA 5KCOA 1PC0A 5SZTA 4BRIA 3CIPA 1KQSS 1ZLMA 5ECAA 2ZWHA 5JLFA 2HOEA 4CJUA 3KUFA 1KD1U 4PJOE 1GFDA 4EHTA 5AQRA 2J6OA 4E7KA 1BWFO 5B8HA 1IHWA 3RR7A 1N8RC 4PKGA 3ID6A 4FWLA 1IRXA 4B1XB 5HLFA 1K6YA 4J9FA 1WAJA 4HTUA 3WQUA 2P84A 3FB9A 4JKFA 3VJPA 3J81E 4HHTA 4M78F 4XQ3A 4E7ZA 1PSFA 5HCKA 1Q18A 5ADXA 3ASKA 1X75C 2ROLA 1GLJO 3H8ZA 1IREB 1ITGA 3DMJA 3G10A 2ZJQL 1S72N 4HWIA 1K76A 5DLQE 3G71A 3RWUA 2LNHB 2X6NA 4XH5A 3PMIA 3WVDB 3OW2A 3UKRA 5GAMh 5BN9A 4E2FB 5HK3A 2L5QA 4YNQA 1HD3A 1UGVA 3HRTA 3MJXA 3CFOA 4KRTA 2QM1A 3E9OA 4K25A 3LZIA 1K73R 3CC2Q 4IEEA 4ILJA 1QTMA 1KG1A 3EG9A 4BRCA 4GKJK 1YJWA 2E4HA 5I2MA 5GAMg 4C8NA 4M7AA 1NGGA 4CGGA 3EEQA 1YWPA 1ZXOA 3QDKA 4BG9A 3V6DA 2ETJA 4EZ9A 2XD0A 4DBRA 3VUZA 3O4NA 1NKBA 4M75C 1YJ9A 4IUQA 3KD5E 1IV0A 2DFEA 4QAGA 1KQSA 5LMUK 3PVLA 1VQ5T 3FZKA 2F9TA 2P0KA 2RMOA 4B3OA 2VG5A 5GAEP 2JJ9A 1NE8A 2Y4YA 3F9KA 4O8UA 3P1GA 4B9QA 3M0RA 5ELZA 2YSQA 2UUAK 3E19A 3A8HB 4JRKA 4FJNA 4B1UB 1Q82O 2KXDA 3AVGA 1YHQT 3VRYA 3ID8A 3VOVA 1DLOA 3R1XA 4BQLA 3ENBA 4YFUA 1ZC6A 1NBWA 3ZBDA 3ATVA 1RT6A 3EE8A 1YCYA 4R0KA 3K0SA 1I81A 4DG1A 1IBKK 4CK1A 2YNIA 1KFDA 3CCLA 2FBVA 3DLGA 4B1YB 3QNNA 4H0PA 2EGAA 1Q86O 4LD6A 3TSUA 4JHDA 3TTDA 2ZPIB 3HSBA 1UAXA 4O55A 5IN1A 2YUNA 2CS7A 1M2VB 5GADP 3J81O 2OTLN 2F9WA 3WXLA 4FJLA 3OBWA 1YF5L 2X4WA 3FZFA 2FF3B 1NK4A 1OYXA 2K4YA 3SQ1A 4XTXA 4F2SA 1M1KO 1IGUA 3MMVA 2X51A 2RHYA 4JKGB 3H41A 2LP5A 3OYLA 2QK9A 5FROA 4CEAA 3VQAA 1WHLA 1QVFP 3PSIA 1XOVA 3KLIA 4CC2A 4CEEA 4DTUA 4BUGA 5AQNA 1IGQA 1ZHIA 5J2MA 3UKUB 3TPQA 3EGXB 4RTUA 1HKBA 3EGUA 5M1OA 4JKEA 1J5EK 1QCNA 2B4JA 4IEIA 2GQVA 3CXCM 1YT3A 4B3MK 5KPZA 4FM2A 1QCOA 2QQBA 4BDZA 2LDMA 1XQSC 4RW8A 3VS6A 4C92G 1BOTO 4J6YA 4JK8A 3TSZA 3UB5A 2K7AA 3JCMX 2E64A 4MDXA 2CZ6B 2M02A 3BGRA 4CK3A 4ELTA 1M27C 2PZ1A 1HJDA 3S3OA 2M16A 2WSFE 2DMOA 4DR4K 3C0CA 3O4WA 1FX7A 1BIAA 2QW9A 2G6FX 4CHOA 1ZSGA 2RA2A 3MX2A 3EH1A 4DQ8A 1H8KA 5DY9A 2E8AA 1KD1C 2DFUA 2H3JA
chains in the Genus database with same CATH topology
3CG7A 2JLEA 3ZT4A 3FFIA 1Q9XA 2XY6A 1JL1A 4M3TA 4CERA 4CGDA 1IKVA 1C1BA 3EZ5A 1FK9A 5D7UA 1RTIA 3OYEA 3ZSRA 1FKPA 1BQNA 1TK8A 5DMRA 4DSFA 3V9XA 5E41A 2F8SA 4RW4A 4E1MA 4HUFA 1HYVA 1JLFA 4UQGA 5FRNA 1C1AA 4FJ9A 4K8ZA 3MEDA 4M3ZA 2DFFA 3C6TA 5CYQA 3V1RA 1RDAA 4EP5A 4JRPA 4CHQA 3SUOA 4B9LA 5SWMA 4CGJA 1S6QA 4BACA 3OYFA 1BGXT 1J54A 2GUIA 3CFPA 4KPYA 1RBSA 3QEVA 4JLHA 4MQ3A 1D5AA 1RBRA 3RMCA 2O4IA 1HYSA 1HNIA 4B9TA 5CZ1A 4LY7A 1U48A 3QLHA 4J2DA 3B6OA 3L2WA 4DTRA 4HUGA 4CCHA 5T7BA 3SUQA 3C95A 1JLCA 3KK3A 1BQMA 1B92A 2WONA 4FCYA 3LAMA 3K59A 4IFVA 5FRMA 4KHYA 3THVA 1VSIA 3DRRA 1T03A 4QOZB 2ZQBA 1SV5A 5EU7A 3TAQA 3MXIA 3AVIA 4DF4A 4EZ6A 1TKTA 4N56A 2HHXA 1B9DA 1S9EA 2XO7A 1HRHA 1SUQA 3KJVA 5HP1A 3QIOA 3V9UA 1JLAA 1RT7A 3KLEA 4CK2A 4DTJA 1TAQA 3MXJA 4DQQA 1N5YA 4KHQA 4E19A 4KB0A 4I7FA 2QKKA 3T3FA 1GOBA 4I9LA 2XY7A 4M3XA 1U45A 1SL2A 2X78A 3BDPA 3PX6A 3SUPA 3KLFA 2VWJA 3I0RA 4W5OA 3IS9A 3OYNA 3DOLA 5JS1A 1LWEA 3P83D 1J9AA 2BE2A 4OPKA 1LW2A 1RBTA 2P5GA 1RT4A 3CQ8A 1X9WA 2D0BA 4B9MA 3M8QA 1HYZA 3M8PA 3AA2A 4F2RA 4CIGA 3JYTA 1VSLA 4KRFA 4RW6A 3PX4A 3RMDA 3QIPA 1KLNA 2EX3A 3HVTA 1XC9A 4E0DA 5D3GA 4QCLA 2B5JA 4FJJA 3C6UA 1BL3A 3KKRA 1YVUA 5HRPA 1S1XA 1ZBHA 2HB5A 4CHPA 1QSSA 1JLQA 4FZYA 2BGGA 2VG6A 4IG3A 2HHUA 2O4GA 4LSNA 3I8DA 3NDKA 1FXXA 3K2PA 2HHSA 2A1SA 1G15A 4FLTA 2OPSA 2HHQA 3ZSQA 3ZSVA 3VQ4A 4KHUA 3QEIA 1RTJA 3OYHA 3K57A 4HCBA 5J2PA 1EXQA 4H4OA 3DLBA 3O4QA 1NJXA 3SNNA 4CF0A 1HQUA 4E89A 2F8TA 4FK2A 3NH0A 3CM5A 2HVHA 4AHRA 3AO5A 4O5BA 2G8FA 4DQIA 5C24A 2VWKA 1KRPA 1VSFA 4FM0A 5J1EA 1NK8A 2HHTA 3LWLA 1ZBUA 3TWHA 2G8KA 3K5MA 3SI6A 4N47A 1O1WA 4LSLA 5KGWA 3SCXA 4F4KA 4CGIA 1Z26A 4CEZA 3ZSOA 2OZSA 3LP3A 2AJQA 3E01A 3S3MA 1LV5A 3MEEA 3AVAA 4KTQA 3AO1A 4CJKA 3T19A 4DTXA 3QNOA 5KRSA 2BANA 1WSJA 3HPOA 4M41A 3WNGA 4CJRA 4ELUA 3AVLA 4IFYA 2BDPA 3RR8A 4HCCA 4OKKA 4CEFA 4CESA 4FK4A 1BI4A 4OJRA 3CM6A 1Q8IA 4E7HA 3TANA 3TI0A 3PX0A 3RTVA 1SKWA 2OPPA 3DRSA 3M8RA 1U04A 4AHVA 1QSLA 4R5PA 1A5VA 3NF9A 1T8EA 3OYIA 3HPGA 1TKZA 4J2AA 3CYMA 4FZZA 4FW2A 4CJLA 3S3NA 1U4BA 2PZSA 3NBPA 2KZMA 3ITHA 2G8VA 5KI6A 4ZTJA 4N5SA 4F3OA 3ZSWA 1RTHA 4H8KA 3QETA 3AVFA 3DLKA 2Z1HA 5KTQA 1QS4A 4CHYA 4CFCA 2FBXA 1UOCA 4PA1A 3EY1A 3V9WA 3T1AA 1TVRA 3TAMA 1S6PA 2E6MA 3LPTA 3V81A 4OPJA 1JXEA 2IAJA 2ATQA 1NOYA 3U3GA 3HXMA 4CIEA 2E6LA 4ZHRA 3O3HA 2P5OA 3OJSA 4DTNA 3LALA 3KK2A 3SYZA 4CE9A 4DQRA 4Z4IA 2XHBA 4G1QA 5CZ2A 4OVLA 1ZYQA 4FXDA 3VQ5A 3VQPA 2HVIA 4DFPA 3VQCA 3OY9A 1QMCA 1RBVA 4TSXA 1EP4A 3VA0A 4I2PA 1WSGA 1D9FA 3DOKA 4M3RA 3HPHA 3TAPA 3PO4A 1RT3A 1BIUA 4FK0A 3SV4A 1UWBA 3ALYA 3NE6A 2P51A 4CEDA 2R7YA 2KW4A 3NHGA 5HRNA 1XI1A 1VSKA 1IKXA 4BDPA 3QINA 2X74A 2KZZA 1QSYA 4PQUA 3AA5X 3LWMA 2G8HA 4DSKA 4KREA 2OA8A 3B6PA 3VQ6A 1NK6A 1TL1A 4W5TA 1LAVA 3AA4A 5C25A 4DTSA 2PYJA 2NUBA 1RDDA 4DSEA 4GW6A 1BISA 3NAEA 1NK5A 4KHSA 1KCFA 3SPZA 1A5WA 1R0AA 4Q5VA 1TL3A 2IGIA 1TK5A 3TAFA 3D0PA 1HNVA 4M42A 4NYNA 2HMIA 1Y97A 4KFBA 2P1JA 4F3TA 3IG1A 2YNGA 3WNEA 1HJRA 2HHVA 1XHZA 3DM2A 4Q0BA 3DYAA 3V1QA 1IH7A 4DLEA 4WE1A 4O44A 3HJFA 4W5NA 4BWMA 1BIZA 4GVMA 4DU4A 3HM9A 4CGFA 5CYMA 5KRTA 1UA0A 1YTUA 4CJSA 3L2RA 1NOZA 5HROA 3NFAA 4N76A 1KTQA 3HSTB 1BCMA 4XIUA 1CXQA 1HQEA 1QHTA 4Y1CA 5FDLA 3PV8A 3TR8A 1SL1A 4LD0A 4E7JA 4I9QA 4CEBA 4B8AB 4IG0A 1ZBLA 3MAQA 2RF2A 3AVCA 3VQDA 4FVMA 5HBMA 4CIFA 4DFJA 5J2NA 2Q3SA 3SJJA 4CEQA 1IO2A 3L3UA 4CJVA 1NK0A 4DU1A 1Q9YA 4CF9A 2WOMA 3OYBA 4OLAA 4E7IA 4L8RB 3QERA 3HK2A 2XY8A 4F8RA 1NK7A 3NF6A 1C0MA 2B6AA 1EX4A 2PYLA 2PY5A 2OYQA 2HNZA 2A1RA 1L3TA 2YNFA 4Z0UA 4FJGA 2EHGA 2YKNA 1SKRA 4M3YA 1LAWA 1TK0A 4M45A 1LWCA 4B9VA 5K14A 4CJQA 3NGYA 4FJMA 3KD1E 3DI6A 4DSLA 1JL2A 2ZE2A 3OJUA 1QE1A 4FLZA 3SQ0A 4DSJA 2Z1IA 2HNDA 3MECA 4KTWA 2W42A 1X9SA 3O3GA 4CF1A 4RG8A 4DTPA 1W9HA 4MFBA 3LAKA 3OVNA 3ZSZA 4Z4HA 4OLBA 1WSEA 3L2QA 2OPRA 4RW7A 2FBTA 3LZJA 3V4IA 3ISNC 3ULDA 4OKEA 3K5OA 1YTAA 1DTTA 3VQEA 1ASVA 1TKDA 4CHZA 3RRHA 5I42A 3PY8A 3HO1A 1TKXA 4OKJA 3U3YA 4PY5A 3AA3A 3AVHA 3PUFA 1EETA 3L2UA 4KKOA 1IHVA 5J2QA 3VQQA 1RT2A 2Z1JA 3SV3A 1RDCA 4DFKA 4J2BA 4O0IA 4B9UA 4Y1DA 2YKMA 4ICLA 4RW9A 3VQ9A 3OYAA 4FM1A 2Y1IA 2D0CA 1KVCA 4AHTA 4AHSA 3QEWA 4N41A 1JKHA 4KI4A 1VRTA 3IRXA 4FLVA 1EKEA 1WAFA 3OYKA 3JSMA 1VSJA 1D8YA 2D5RA 4EP4A 4KB1A 1WNSA 4FLWA 2IDOA 1A5XA 2X6SA 3AVMA 3DRPA 4BDYA 3TAEA 2IOCA 3VQBA 3MXMA 2G8WA 4C8KA 1X1PA 1TV6A 4FJKA 3K5LA 4CJ4A 1WSFA 4Z4FA 3HT3A 1U47A 4KTZA 1NJWA 4DQPA 1SL0A 4NCBA 3LP0A 4KO0A 1NJZA 2I5JA 1L3SA 5KGXA 4B9NA 4IBNA 1VK0A 3NF7A 4C8LA 3AVNA 1TAUA 3OYCA 3DLRA 3K58A 1B9FA 1CZ9A 4HVJA 3OS2A 1JXBA 4C8OA 1S1VA 4BWJA 2HNYA 4CJ3A 3AV9A 1KVAA 1X9MA 1VSDA 1WLJA 1WSIA 1Z25A 2YHAA 4O4GA 4DQSA 4AILC 4LH4A 1C6VA 2E4LA 2FC0A 3AVKA 3DLEA 4AHCA 4DMNA 4B08A 3IAYA 4OGEA 2IC3A 4CFDA 3SPYA 2GV9A 3O3FA 3PO5A 4PWDA 3V1OA 1CXUA 5SZTA 3LPUA 3AO2A 4M3WA 4ZTFA 4GMJB 2RKIA 4DF8A 1GOCA 2IS3A 4NCAA 2YNHA 4CJUA 3KIOA 4DWIA 4CF2A 4KI6A 1C0UA 2XY5A 4E7KA 1VRUA 1C0TA 1MU2A 3QEPA 1IHWA 3ZCMA 3RR7A 3HL8A 4Z4CA 3OYGA 3ASMA 4CJEA 4CJWA 5HLFA 3NGIA 2KTQA 4DLGA 1K6YA 3KKSA 1SKSA 2OZMA 3SQ2A 3HP9A 1WAJA 4ID5A 3ZSYA 4HTUA 1J53A 1DTQA 2QKBA 1WSHA 4FLUA 4E7LA 3A2FA 4HHTA 1QQCA 3QESA 2ZD1A 3VQ8A 2HHWA 2Z1GA 4I2QA 4CJTA 1ASUA 4ELVA 1HMVA 3DMJA 3G10A 1GOAA 2RN2A 1ITGA 4LH5A 1I3AA 2FBYA 1JLEA 3RRGA 1JLBA 1VSHA 4B9SA 3KLHA 4KAZA 5JS2A 3NH1A 3L2VA 3S9HA 3RWUA 2X6NA 4FJ5A 1KSPA 4CJPA 3V9SA 4J2EA 1WN7A 3KTQA 3LP2A 3TABA 4JS4A 1S1WA 3ZSXA 4DFMA 1J5OA 1C6VX 1ASWA 2KQ2A 1BHLA 4YNQA 3CFOA 4DS4A 3LZIA 5HRRA 3U6FA 4FZXC 1QTMA 4JS5A 3OS1A 1ZBIA 1RCHA 3VN5A 2DTUA 1IKWA 4FJ7A 4FYDA 3QO9A 1T05A 4C8NA 3TARA 3RMAA 3RMBA 2LSNA 5C42A 4CGGA 1NJYA 1NK9A 1KFSA 2DY4A 4W5RA 3LDSA 4W5QA 3V6DA 2ETJA 1T7PA 1KVBA 1C1CA 4EZ9A 1BCOA 2YV0X 3O4NA 1NKBA 3NF8A 3OYDA 4CFBA 1RT1A 1NKCA 4E1NA 3KD5E 3OYJA 2DFEA 4QAGA 4CEOA 3OS0A 4JRQA 1CLQA 3SZ2A 4H4MA 5I3UA 1S1UA 1LWFA 1REVA 1VSMA 3AVJA 4CFAA 3KLGA 2VG5A 3F73A 4B3OA 3F9KA 2YHBA 3P1GA 4OGCA 5HRSA 3OYMA 4DTOA 1RDBA 1UA1A 2GBZA 2XRIA 1L3VA 2G8UA 1ZBFA 1RNHA 4FW1A 4B8CA 3V9ZA 4HUEA 4FJNA 3AVGA 3K5NA 3H08A 1L5UA 1DLOA 3LANA 4AHUA 2JGUA 4YFUA 4KHWA 4CGHA 4NYFA 1RT6A 1VSEA 4CF8A 4IDKA 4FLYA 1D9DA 2F96A 1BI4B 4DG1A 4CK1A 2YNIA 1KFDA 3DLGA 2FBVA 3AVBA 3NGZA 3M8SA 3QNNA 2KFNA 1TGOA 3VA3A 4FJHA 1JLGA 3HP6A 4FJIA 1RBUA 4DS5A 4CJFA 1UAXA 3MEGA 4O55A 4KHNA 3HVRA 4FJLA 1RILA 1U49A 4DSIA 1LW0A 4O0JA 4DU3A 3HYFA 4IKFA 3AO3A 3TAGA 1NK4A 4Z4GA 3P5JA 3SQ1A 4BE1A 3QEXA 3AO4A 4C8MA 4F2SA 1F21A 2DFHA 1W0HA 4CECA 1IKYA 3OYLA 2Y1JA 2QK9A 5FROA 3ZT3A 1XWLA 4CEAA 2HW3A 3VQAA 4BE0A 1S1TA 3KLIA 3ZT0A 3KK1A 3NCIA 4CEEA 4KV8A 1N6QA 4DTUA 1RT5A 3WNHA 3UIQA 4M3UA 5J2MA 4CJ5A 5CY4A 1I39A 3NH2A 2OPQA 3ZT2A 3SUNA 3G0ZA 2KFZA 1S5JA 2B4JA 3ZT1A 4FJ8A 3LP1A 4PUOA 3L3VA 1L3UA 4Z4EA 1YT3A 4E3SA 4K8XA 3SQ4A 4FM2A 3WNFA 2VG7A 4BDZA 2ITGA 4ID1A 1RTDA 1KLMA 4RW8A 1NKEA 1CZBA 4CHNA 2RPIA 4DTMA 1IG9A 2G8IA 5DK5A 3D45A 3BGRA 4CK3A 4ELTA 3S3OA 3C94A 3EYZA 3DLHA 3CFRA 4FJXA 2QXFA 2D0AA 1XHXA 1S9GA 3L8BA 4CHOA 4FLXA 3I0SA