1EX4A

Hiv-1 integrase catalytic core and c-terminal domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
212
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACDWAGIKQEDGIPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNSLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the HIV-1 integrase catalytic core and C-terminal domains: a model for viral DNA binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords INTEGRASE
total genus 49
structure length 212
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ex4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ex4A01
3OYEA 3MAQA 3KLIA 1QS4A 3O4QA 3V1QA 3O3HA 4DSKA 5FRNA 4NYFA 4OKKA 4CCHA 4CEAA 1G15A 1T03A 5J2NA 4KKOA 3OJSA 3T1AA 4CJLA 4CJQA 1BGXT 3ZT1A 1RTDA 1J9AA 1VSMA 3P1GA 3L2UA 1ASVA 3OVNA 3OYGA 3OS1A 3V6DA 4KV8A 4Z4IA 4IFYA 4B9NA 4DSFA 4ID1A 1LAWA 1FKPA 3DOLA 2HHVA 3S3NA 3QLHA 1YVUA 1U48A 3QEVA 4HCBA 2GUIA 3SCXA 2KFNA 4HUFA 3L2WA 3DRRA 3WNHA 4Q5VA 1TKDA 1VRTA 4FLXA 4PUOA 4ID5A 4LSNA 2ITGA 3V1RA 3QNNA 2PYJA 3RMCA 4UQGA 1JLCA 2R7YA 3H08A 3OS0A 4FCYA 4FM1A 3TR8A 3ZT3A 1QMCA 4C8MA 4Z4EA 4DFJA 3JSMA 4FJXA 1VRUA 3RWUA 4BWJA 4E7KA 3VA3A 1WSGA 1VSKA 5FDLA 3LWMA 1TGOA 4FLZA 3SPYA 3L2VA 4RW6A 4CIGA 1C0MA 2RPIA 1NKCA 4AHCA 4RW8A 2ZD1A 2ZQBA 4DTNA 1L3SA 4BDPA 1HNIA 2JGUA 1TKXA 3C6TA 2YNFA 4RW7A 3B6OA 1R0AA 1NK5A 4CGJA 3V9SA 4H4MA 1WAJA 4CEZA 1D9DA 1Q9YA 3C6UA 4KTZA 4FJ5A 4DG1A 4PQUA 1TV6A 4AHTA 3O4NA 1NK6A 4CJVA 2ZE2A 3AA4A 1KVAA 1NJWA 4Z4HA 5HLFA 3ULDA 4KHUA 4CF2A 3IS9A 3HK2A 4BACA 3M8SA 2HHQA 3K2PA 4FM2A 1SL0A 1JLQA 1RDAA 1TL3A 3AA3A 3NAEA 3TANA 3MXIA 4E7IA 1QSYA 4N76A 4F2SA 2HW3A 1NK8A 2YHAA 5J1EA 3VQ6A 2YV0X 1GOAA 1RNHA 2OZSA 5T7BA 4DTRA 5D7UA 2HHUA 4O0IA 3RMAA 3HYFA 1NK7A 4B9VA 4KHWA 3C94A 4FJKA 5JS2A 1KFSA 1JXBA 1HYSA 3BDPA 4TSXA 4M45A 3ZSXA 1D8YA 2P51A 3OY9A 1QQCA 3HJFA 1IHVA 1RT6A 3O3GA 4AHVA 1CZ9A 3SV4A 3AVCA 3HT3A 3ITHA 4AH9A 1KSPA 2OPRA 4LH4A 1JKHA 4Z4CA 1HQEA 1Z25A 3OYMA 3LZIA 3VQ7A 3DLHA 4B9SA 3ZSYA 2YKNA 1C0UA 3SYZA 4FK2A 1L3UA 3MEDA 3NCIA 4HTUA 3PX6A 3RRGA 4FJNA 5FROA 5CY4A 1FKOA 1BHLA 1YT3A 3KIOA 2B6AA 3KD1E 3NGYA 3ZSRA 2IS3A 4KFBA 2HB5A 1GOCA 1T7PA 4E3SA 1N5YA 1IKYA 4CK1A 1KTQA 1YTUA 1DTQA 1U45A 1JLGA 3ZT2A 3O3FA 3LALA 2X74A 3OYIA 4DU3A 3K5OA 5DK5A 2XY7A 1XC9A 1XHXA 2D0CA 3L2QA 3WNEA 3KK3A 3VQEA 1S1VA 2Q3SA 2FBYA 3QEIA 4FJMA 2OPQA 2RKIA 4C8NA 1IH7A 3ZSVA 4M3ZA 1HQUA 3CYMA 4OGEA 2XHBA 4ZHRA 2DFFA 3SUPA 3AVLA 4NCBA 4Y1CA 3IRXA 4CGGA 2F8TA 3QEWA 1ASUA 2XO7A 1ZBHA 5CZ2A 3RR8A 4DQPA 4Q0BA 2KFZA 1T05A 3HO1A 1RDDA 3DYAA 3QIPA 1X9MA 4NYNA 1QHTA 3AVKA 1TL1A 5E41A 1VSLA 3MECA 3NE6A 2BDPA 1RCHA 1QSSA 4N5SA 3NFAA 1S1UA 1BL3A 3K57A 4KHNA 4M3RA 4EP5A 3V81A 1SKSA 3KLFA 1RBVA 2YKMA 3DM2A 4DF8A 1IHWA 3TAQA 3ASMA 2DTUA 4CIFA 4GVMA 2Y1JA 4CHZA 1J54A 1SL1A 2DFEA 4IBNA 2ETJA 2W42A 3TWHA 3SZ2A 4KHQA 1ZBIA 2X6SA 4W5NA 2D5RA 3VA0A 4FK0A 4CJWA 2G8KA 1JXEA 4N41A 4ELVA 4I9QA 2P5GA 4FM0A 3PO5A 3D45A 1WSEA 1WN7A 4CFBA 2HMIA 2HHWA 4HUGA 4B9LA 1VK0A 4B8AB 1RT5A 4BE2A 2LSNA 4KRFA 1Q9XA 3VQ9A 1FXXA 4FLVA 1C1CA 4CGIA 4CHQA 3HVTA 4DF4A 2QK9A 4CF9A 4E7JA 1EP4A 1SL2A 4C8KA 4AHUA 1UA0A 3QIOA 2IC3A 1TKZA 3LPTA 1LAVA 1DTTA 4ZTJA 1WNSA 3VQBA 4CE9A 1S1XA 2G8UA 2OZMA 3S9HA 1F21A 2HVIA 4CF0A 1SKWA 4F3OA 4W5QA 3KD5E 2HNDA 4OVLA 3KTQA 1HYZA 3ZSZA 1LV5A 2B5JA 1C6VA 2I5JA 1HJRA 2RF2A 3NHGA 4GMJB 2VG7A 3OYDA 1X9SA 4FJJA 5J2QA 2HNZA 1TK8A 1C0TA 4EP4A 4NCGA 4BE0A 4O44A 3A2FA 5C24A 2OPSA 3ZSOA 4CHPA 4BWMA 3QNOA 1S1WA 3SNNA 4CECA 3HPGA 3KKRA 1BI4B 1J5OA 4RW4A 3OS2A 1IKWA 4CJFA 3TARA 2JLEA 1MU2A 4DTUA 2O4GA 3AVIA 4CJ3A 5HRRA 3K5MA 4J2BA 4KHSA 4JRPA 1K6YA 1BIZA 3HL8A 4E1NA 3AVBA 3OYBA 1IKVA 3U6FA 2Z1GA 3PV8A 1EKEA 2FC0A 4I7FA 3SUQA 1NJYA 1IG9A 3HP6A 4FJLA 1EXQA 2A1SA 3K58A 3AVAA 4M3UA 2PYLA 1CZBA 3TAPA 4KI6A 3ZT4A 1DLOA 1TVRA 3T19A 4EZ9A 2X6NA 2FBXA 4DWIA 1LW2A 4FW1A 1EETA 3U3YA 4K8XA 1W0HA 1S1TA 2E6MA 3HM9A 4DSIA 1NK0A 1ITGA 4CEBA 4IKFA 4DQQA 4W5OA 2VWJA 4CGFA 3V4IA 3V9WA 2YNIA 2Z1IA 1SKRA 2F96A 4CJ4A 2G8WA 4FJIA 3OYHA 1TK0A 2KQ2A 4CIEA 4KHYA 5HROA 3LWLA 4XIUA 3VQQA 2HHSA 1D9FA 3HSTB 4IG0A 3AA5X 4DS5A 1Z26A 1RTIA 3L3UA 4LD0A 4OLBA 1UWBA 1CXQA 4I9LA 4FYDA 1JLAA 1RTJA 3KKSA 3KK1A 1JL1A 1KFDA 4CF1A 4B9TA 4BDYA 2D0AA 4W5RA 3B6PA 3PUFA 2FBTA 2EX3A 3I0RA 3OYNA 3WNGA 5FRMA 4DFPA 3S3MA 2G8IA 4KTQA 5I3UA 3KJVA 3SPZA 3LP3A 1FK9A 4CJTA 3F9KA 3NF6A 1WAFA 5KTQA 3NH0A 3NGZA 3RRHA 1U47A 1JLBA 3LPUA 3L8BA 4QAGA 4DS4A 3IAYA 4B3OA 4CEQA 1T8EA 3DLEA 3HP9A 4H8KA 4FZYA 3VQDA 4CEFA 2NUBA 1N6QA 4NCAA 2HHXA 1X1PA 5KRSA 4G1QA 4OPJA 1UA1A 1LWFA 4RW9A 2F8SA 4CF8A 1HMVA 4KTWA 4E7LA 4MQ3A 3LAMA 4OKEA 3V9ZA 4EZ6A 4FJHA 4LY7A 1I3AA 3WNFA 4CEOA 3L2RA 4KI4A 1ASWA 3LP1A 1NK9A 1WSJA 3AVMA 4CHNA 3AA2A 1WLJA 1B9FA 2E6LA 3AVJA 1VSHA 1L3TA 5C25A 1NOZA 1BISA 4LSLA 4OGCA 1L5UA 4HVJA 2YHBA 4ZTFA 2YNGA 3DI6A 3HXMA 4BE1A 3S3OA 4Z4GA 4LH5A 3VQPA 1B9DA 4Y1DA 4DU4A 1L3VA 1O1WA 1LWCA 4YFUA 1KRPA 3IG1A 1ZBFA 4OPKA 5D3GA 4OLAA 1S9GA 4F8RA 1VSDA 1EX4A 1RT2A 3DLRA 4QOZB 1ZBUA 2X78A 3KK2A 3SQ2A 3PX0A 2KZZA 1XWLA 3SV3A 5KRTA 1RILA 2XY8A 3AVHA 3SQ1A 4DTPA 4CJEA 3P83D 4DU1A 4B8CA 4CHOA 4E89A 3DOKA 1U4BA 1S5JA 3LAKA 3QEXA 4J2EA 1RBSA 4IFVA 5EU7A 1RBRA 5K14A 2IOCA 1VSIA 4HUEA 3QETA 4KB0A 3EZ5A 3AO1A 3ZCMA 3OYCA 3HVRA 4HHTA 1U49A 1XI1A 1RT7A 5J2MA 2A1RA 3AVGA 1QE1A 2OA8A 1KLMA 3TAEA 3EY1A 1JLEA 3VQ8A 1TAQA 3VQ5A 5DMRA 5HP1A 3AO4A 3M8QA 5CZ1A 3M8PA 2P1JA 5SZTA 1IKXA 3AV9A 3HPOA 2BE2A 3TAFA 1RBTA 3AO2A 4FJ9A 2FBVA 4KPYA 4IG3A 4AHRA 4ELTA 1BCMA 4OJRA 1ZBLA 1D5AA 4KB1A 4C8LA 3QO9A 4O55A 1A5VA 1HNVA 4E0DA 2HVHA 3OJUA 4CGHA 2IGIA 1IO2A 3DLGA 4M41A 2QKKA 3MEEA 4DTSA 1CXUA 1NK4A 5HRSA 5CYQA 4M3XA 3PY8A 5KI6A 4AILC 4F2RA 1Y97A 4DLEA 3AO5A 4DSLA 1LW0A 2PY5A 1S6QA 3DRPA 1NJZA 4PA1A 3I0SA 3PO4A 3CQ8A 3ZSQA 5HRPA 3TAMA 3SQ4A 3EYZA 2BANA 4J2AA 4H4OA 4WE1A 1J53A 4M3YA 3DLKA 1YTAA 3THVA 4O0JA 3NGIA 4FLWA 4F3TA 2WOMA 4DQRA 4KREA 1U04A 3C95A 5CYMA 4BDZA 3RMDA 4Z0UA 1HPZA 4FZZA 4QCLA 2KTQA 3OYFA 3DLBA 3CFOA 2XY5A 4HCCA 4FW2A 4CJ5A 5HRNA 4DFMA 3LP0A 4JS5A 1RT3A 1TK5A 4DFKA 3D0PA 1HRHA 3QESA 3MXMA 1NKBA 3M8RA 4PY5A 2QXFA 4DQIA 2KW4A 4CK2A 4FJGA 3HPHA 1A5WA 1JL2A 1LWEA 1KVCA 1TKTA 4CJPA 2E4LA 2XRIA 2Y1IA 2HHTA 4CGDA 4YNQA 2RN2A 5C42A 3SQ0A 4CFCA 4ICLA 3TAGA 4JLHA 3NDKA 3SJJA 3I8DA 3RMBA 3KLEA 1C6VX 1CLQA 3QEPA 2OYQA 3CFRA 2HNYA 1GOBA 1VSFA 3SUNA 2Z1HA 3CFPA 1KLNA 4KO0A 3CG7A 2D0BA 4M3WA 4FXDA 4CFDA 4IDKA 1C1BA 3NF7A 3VQAA 1S6PA 3L3VA 3CM6A 3AVNA 3ISNC 3MEGA 5HBMA 4AHSA 4CERA 4E7HA 5I42A 4B08A 2P5OA 4FK4A 3OYKA 4F4KA 4GW6A 3NBPA 1S9EA 3OYLA 3SUOA 4ELUA 3JYTA 4OKJA 2KZMA 4M3TA 3AO3A 4DSJA 1Q8IA 3TABA 4M42A 1WSIA 2GBZA 4CEEA 4DTXA 3ZSWA 2OPPA 1I39A 4JS4A 3NH1A 3K59A 1TAUA 1X9WA 2DY4A 4E19A 3VQCA 3LZJA 1JLFA 1B92A 3SI6A 1UAXA 4MFBA 1BI4A 1NOYA 4L8RB 1WSHA 2VWKA 1NJXA 4FLTA 2QKBA 4CK3A 4FJ7A 2PZSA 4I2PA 4JRQA 2IDOA 3NF9A 4FLUA 3PX4A 3NF8A 4DQSA 4CJUA 4KAZA 3UIQA 1HYVA 4CJSA 3DRSA 3FFIA 2VG5A 1RTHA 3QINA 3BGRA 3G10A 5KGWA 1XHZA 4Z4FA 3VN5A 4J2DA 3VQ4A 2YNHA 2ATQA 3KLHA 4W5TA 3F73A 4C8OA 4K8ZA 4DTMA 4FZXC 4RG8A 1SV5A 1KCFA 3E01A 4CJKA 5J2PA 1BQNA 1SUQA 2XY6A 1QTMA 2G8FA 1VSJA 3P5JA 4DMNA 4O5BA 4N56A 2AJQA 4FLYA 1RDCA 2G8HA 3KLGA 4DLGA 1VSEA 1RDBA 3MXJA 3OYAA 1UOCA 1REVA 2IAJA 3LP2A 2Z1JA 5SWMA 3V9UA 3RR7A 4FJ8A 1BIUA 4PWDA 3RTVA 3ZT0A 4DTOA 2G8VA 1RT1A 4FVMA 4B9MA 4I2QA 4CHYA 4CJRA 3LDSA 1BCOA 1KVBA 1WSFA 3T3FA 2EHGA 5KGXA 3QERA 3U3GA 4O4GA 1ZYQA 2GV9A 3V1OA 3OYJA 2VG6A 4N47A 4E1MA 2B4JA 3ALYA 3K5NA 3V9XA 2WONA 4DSEA 4B9UA 3NH2A 2O4IA 4R5PA 1C1AA 4CFAA 3K5LA 1RBUA 3TI0A 4CESA 1NKEA 1BQMA 3AVFA 3G0ZA 3LANA 4CEDA 4DTJA 5JS1A 1A5XA 3DMJA 2DFHA 1RT4A 3CM5A 2BGGA 1W9HA 1QSLA
chains in the Genus database with same CATH superfamily
3OYEA 4IUVA 3KLIA 2E88A 4N0AC 4BR4A 3SWNC 1NGBA 3O3HA 4CCHA 4DSKA 2K79A 4CEAA 2D1XA 4FU6A 5AQTA 4KKOA 5IWAK 3OJSA 3T1AA 4CJLA 1D1CA 4J9HA 4CJQA 4M7YA 2K3BA 2FZCB 2RQUA 1SHGA 3H41A 3DLLA 3TTDA 2ABLA 2LQKA 3NVKA 4LF8K 4QKUA 3O9SA 1IB8A 2ITMA 1WBBA 1GLBG 4ID1A 4CD1A 3DOLA 2MAMA 1EO1A 4KH4A 3L0QA 3QLHA 1U48A 1HNWK 3QEVA 2DTHA 2JUFA 2O2OA 1OZ3A 4EMKB 5LY3A 4OMNA 1D1AA 4IFEA 2J06A 3WNHA 1JXOA 1JJ2P 4R79A 2MI6A 1RAGB 4BC3A 2PYJA 4FM1A 1QP2A 2O9VA 2E3IA 3OS0A 4C92G 3H08A 2R7YA 5AQPA 1QMCA 4C8MA 4Z4EA 3U23A 4LNPA 3D7EO 3RWUA 4GNIA 4BWJA 3P39A 1GL5A 4L59A 4BRHA 4A4EA 2O8CB 1TGOA 3L2VA 2F5KA 1YJ9T 2ZQBA 5E26A 2JGUA 3B6OA 1RUWA 1FMVA 1NK5A 4RKUE 1VQKT 4OMFB 3V9SA 4H4MA 1D9DA 4JK9A 1Q9YA 3OMGA 3EG0A 3CCLN 2HSEB 4FL9A 4FJ5A 4PQUA 2QWLA 3KBGA 1QW1A 3O4NA 3EH1A 3IKMA 3BY5A 1NK6A 2ZE2A 1Z9ZA 3G6EQ 1U6ZA 2R58A 1NJWA 2JW4A 3CXCS 2CP0A 1RLQC 3IS9A 1VQNQ 4J8FA 3CD6A 1VQPN 3K2PA 4FM2A 4M7DD 4JI4K 3TANA 2IPOB 4RTUA 1QSYA 2IVPA 4BG9A 1YNZA 4MDAA 4H5NA 2LNVA 1M2OA 3O5BA 1GOAA 5EOYA 4DR4K 2WBNA 5A0DA 4CD3A 2KY9A 1NK7A 4F7UG 3ZYYX 4B1WB 3ASKA 5EY4A 1JXBA 2PFUA 2DXBA 3FJ5A 5LJ5h 3BDPA 2KYBA 4BGBA 5M1QA 2W6LA 3ZSXA 1D8YA 2P51A 4IO8A 5CAIA 4DR5K 4G9ZA 4GKKK 4D6WA 1Q86R 4DV6K 1KC8O 4BRPA 1AZGB 1G2BA 3AGKA 3P4IA 5TKYA 4AH9A 2Y90A 3WXIA 4Z4CA 1HQEA 2I7PA 4NL3A 4YOWA 1UGPB 5LJVA 2ZJPL 4ILJA 1WZOA 4XH1A 3SYZA 4M63C 2OCEA 4HTUA 4FJNA 1M27C 2LCLA 3CCSN 2CP3A 1TS9A 4ATOA 3T1YK 4YORA 2D0OA 4XQ3A 3ZETB 2IS3A 4OMMA 3HI0A 2QA4T 1IKYA 1XNRK 1XNQK 1U45A 3O3FA 3W3DA 2O01E 3VESA 3LALA 2JMCA 2V51B 2YI1A 5KPTA 4RTVA 1M1FA 3T7ZA 1I07A 3G6EA 1D09B 2L3RA 2OPQA 4IJNA 5JMVA 3ZSVA 3CF5L 1I5OB 4M3ZA 2JM8A 4ZHRA 3UKUA 3DB4A 1UGVA 3VUZA 3AVLA 3IRXA 2CP5A 3QEWA 1ASUA 5KQ8A 4Y28E 1WHLA 5CZ2A 2XO7A 1M90C 2F7TA 1T05A 4JYAK 2RI2A 1X9MA 3G4SQ 4NYNA 5E41A 5EC7A 1RCHA 1QSSA 1IGQA 4FT2A 4N5SA 1S1UA 2ED0A 1R8OB 5GANd 2HCKA 5GMKl 4EP5A 3V81A 3KLFA 3DM2A 3HRSA 3TAQA 1VQMQ 2ASMA 2IIRA 2NZTA 2HAXA 2EAYA 1SL1A 2DFEA 4IBNA 3CC4T 5A2QO 4O8KA 4W5NA 3CI5A 3MO8A 1M8MA 4LN2A 5IXFA 5FW9A 2P9PB 4FK0A 4N41A 4FWMA 3JAME 3D45A 4CFBA 4DA4A 1NEBA 4B9QA 3VEXA 4B8AB 4K43A 1U5SA 2LSNA 1Y7XA 2D4WA 3QPHA 4M78D 8ATCB 5C6SA 1FXXA 4FLVA 4CHQA 2QK9A 2FL7A 2HD0A 4ZGEB 3I55A 1DGKN 1QZ6A 2HOEA 1RFQA 4WQ4A 4CF9A 1SL2A 4AHUA 5LJ5g 5FPEA 1NGAA 2B8AA 2DRMA 3CMET 3I8BA 3I56N 2JN0A 4C0ZA 1S1XA 2OZMA 1BIAA 3SB2A 1YCSB 2DEUA 4ZGJB 1SKWA 4W5QA 2KT1A 1U8RA 1K1ZA 2DETA 3J7YP 3ULEB 1HYZA 3ZSZA 3ZFJA 2EKHA 3EFRA 1C6VA 2RA2A 2B5JA 3HHTB 3A8YA 3CCET 3OYDA 2KXCA 1YHQA 4M78A 2RK1A 2LT4A 4CHPA 4BWMA 3QNOA 5GAN3 3OSVA 3HPGA 3FRNA 4BQLA 4CJFA 4CI6A 1XTDA 3VF6A 1Q7YO 2KYMA 4A4GA 4H03B 1C0GA 4WQ5C 4J2BA 5HRRA 4KHSA 4LDYA 2JTEA 4NS5A 1K6YA 4F7UB 1BIZA 3NTIA 4PLIA 3CC4N 1IKVA 1W70A 3GLXA 2Z1GA 1K9MR 2QG9B 2MK5A 3T9NA 1OH6A 2PYLA 2F2XA 4KBOA 4M3UA 3EG3A 2E64A 1N32K 2P9NB 2EJFA 3MEAA 1DLOA 3E9FA 1TVRA 1BKBA 3S41A 3T19A 4EZ9A 1MDUB 2KR3A 5GAOr 1NE8A 5LJ3g 1W0HA 1Q82O 4K8XA 2FSKA 2E70A 4IOCL 5GAMh 4FSVA 3VJPA 1X2QA 3I55Q 1ITGA 4CEBA 4DQQA 4RG2A 1JB0E 1M1GA 4M7DF 3MN6A 3JB9D 1OX9A 2Z1IA 2F96A 4CJ4A 3RUXA 2QXLA 2G8WA 4WCEL 1YWOA 3F2KA 3CPEA 1LVKA 3FLGA 5AQRA 2GX9A 1NBEB 5D6XA 4IG0A 2LCCA 3QO3A 4LD6A 4ILGB 4DS5A 1D9FA 1UWBA 1CXQA 3RNJA 4I9LA 4A54A 1JL1A 3P38A 3LGFA 5KE3A 3VV0A 3JCMQ 4CF1A 3CCEN 1YI2A 1W97L 1KAYA 2FPEA 3OHRA 2RHKA 2FBTA 4EHUA 4GV6A 2OX7A 4DFPA 2LC4A 4FM4B 3ENHA 5C2DA 4KTQA 1MNDA 1WHKA 3SPZA 3R9PA 5FU6B 2WFBA 5KTQA 3DWLA 2A3LA 3LPUA 4BRLA 2K9GA 3CIPA 3DLEA 4DHYA 4H8KA 3JCMd 2PAVA 4K41A 4CEFA 2GTDA 1JRIA 2LDMA 3MPUB 4YOVA 3NMZC 3CPWS 1X1PA 2RM4A 2YCHA 2CH4A 1MMAA 3MX5A 3GE1A 5GAN8 4PJOG 1HMVA 4E7LA 4KTWA 3LAMA 2HL5C 2EKOA 4EZ6A 4XTVA 1J3TA 1KAXA 1I3AA 3WNFA 1T0HA 2MOXA 3G71T 1ASWA 3LP1A 3VKIA 2QM1A 4MDBA 1NK9A 2EQIA 2V8KA 3EG1A 1VSHA 4CJ7A 5C25A 1BISA 4OGCA 1SSFA 4LSLA 4C0DB 4E1JA 4DBFA 2E10A 2HMPA 3HXMA 2E2NA 4Z4GA 5HL7L 2ZZDA 3W0LA 3SK3A 3O1BA 4E6RA 1QP3A 1K9MC 3C7NB 3H45C 1B9DA 4Y1DA 3CC7N 3SWNB 3JRZA 4DU4A 3RERA 4YFUA 1L3VA 1ZBFA 4ISFA 4F8RA 1VSDA 1RT2A 4QOZB 1XQHA 3CEYA 4F16A 4RMOA 4EAHD 1JJ2M 1VQ6Q 2FSNA 1XWLA 5TKWA 2GCXA 5AQVA 1D0ZA 3SV3A 2ZPFB 1M30A 3CCJN 1GBRA 1I4K1 4FWOA 8AT1B 4DU1A 3SQ1A 2DERA 4CZIA 2IVOA 4CHOA 1Q95G 4E89A 4PY5A 5DLOA 4M7AA 1VSIA 3A0IX 5JLFA 1TUGB 3UATA 4JKHA 3V8LA 2A3ZA 1BIBA 1YP5A 2VASA 3HVRA 1U49A 4RCBA 3FGUA 3EE9A 2HEQA 4RTWA 3JXUA 2OA8A 1YBYA 4HXJA 4J6YA 1JLEA 2HZYA 2CGKA 3REBB 3VQ8A 4XK8E 2OTJN 4QQDA 1PD1A 3AO4A 5CZ1A 5GAGP 3JCMP 2BE2A 3TAFA 4H0PA 4X65K 1P90A 3NTKA 3SUPA 3AO2A 2RO0A 5AQNA 2FBVA 1UECA 5KE2A 4MZMA 4C8LA 4O55A 1HNVA 4PK4A 3RSEB 4PJOF 4E0DA 4C8QB 3CCQA 2DD4A 1FW6A 1KD1O 4IOAL 1IO2A 2X4YA 1WLPB 1GFDA 3DLGA 3O9RA 4QS9A 2QKKA 4ELZC 1KK7A 2H3EB 1QQMA 2G3RA 2OAUA 3THWA 4LF5K 5KYWA 2M1HA 4J9CA 5CYQA 4JI2K 1UJYA 4AILC 4F2RA 2OTLA 3LX7A 1ZBXA 1GCPA 3R8EA 5BRFA 5KH6A 3V8JA 3I0SA 3FJPA 3THXB 5HRPA 1VQ4A 3WXKA 1OPKA 4XU3A 3CCJT 3H8ZA 4YHHK 3SQ4A 1OEBA 2QWQA 3DLKA 3FZMA 2HBLA 3SDZA 3MK6A 1U04A 3RMDA 1C0FA 5AQJA 1YVNA 3BZKA 5GANe 3OYFA 2NRXA 4O5FA 3VUBA 3CCUA 2D1KA 3CERA 2XY5A 2DVJA 2ZPHB 3DXKB 4L3QA 2O8FA 2GWKA 1Q86C 3DXMB 3M57A 4O8UA 2RMOA 3PFSA 3CCRT 2X4XA 4HVWA 2A6AA 1TKTA 4CJPA 2VGNA 3MKDA 4IIMA 2DJQA 2NUTB 4DR6K 2F69A 4CZLA 1ZSZB 4YOTA 2DJZA 3TAGA 3UT1A 2HHHK 4JLHA 3I8DA 2YRDA 3RMBA 3QEPA 1VQLN 1GOBA 2HBWA 2CZ6B 3CC2Q 4QS8A 1IBMK 4KO0A 1F1BB 1Q7YU 1VQON 2MCNA 3ISNC 2NLXA 2A7YA 4B08A 4QW2A 3I35A 3ID6A 5JLHA 4GW6A 1BI0A 2HBPA 3OYLA 3NBPA 3SUOA 2E5KA 4HVVA 3CPWM 1BU6O 4A4KA 5C2FA 3QJYA 4Y91A 3AO3A 4M42A 1N9SA 3TABA 4M3TA 1YUWA 3ZSWA 1FMKA 3F70A 1VQLT 4M78B 1NLVA 2WUSA 3K59A 2UXCK 1VQ4Q 4A62A 3QSUA 4DV7K 1ZSZC 4CZGA 5AQMA 2Q31A 3CHWA 2LJ0A 5I2SA 1KHIA 5KCHA 4FJ7A 2QEXN 1B3QA 2NRVA 2FXUA 2JM9A 4PL8A 1VQ5A 4FLUA 4DQSA 3M5RA 4KAZA 3FEOA 3OBWA 5L23A 3L1AA 2VG5A 2VYPA 3FFIA 1WDXA 4ISGA 5HK0A 5JVGL 4PKCC 3CCMQ 4J2DA 5LJ3e 3CMAQ 1JO8A 3KLHA 3UWNA 1PC0A 4RG8A 1SV5A 2E5QA 4CBUA 2L89A 4E2FB 4O5BA 2DFUA 4DMNA 1NZ9A 4FO0A 1AWJA 2YXYA 2D8JA 4VUBA 1ZUYA 4H0XB 3R3LA 5I21A 1ATSA 4JKDA 3SD4A 2IAJA 3LP2A 2COYA 4PJMA 1IGUA 1VQMN 3RR7A 2HQXA 2M51A 1VQ9Q 2L8DA 1TH7A 2CGJA 4CHYA 4CJRA 1BCOA 2EGAA 4A63B 2ED1A 4O4GA 1VIFA 3P8BB 1XMOK 2VG6A 4C92B 2B4JA 3V9XA 2XD0A 5M1KA 1M3BA 2WONA 3FLCO 3EL2A 2P9LA 3LYIA 5GANg 4EIKA 2VXFA 1LNXA 2BTTA 2JVVA 3LANA 1UHCA 5AQSA 2FYKA 1A5XA 3DMJA 1VQ8A 4B6MA 1I0CA 4WTOB 1H92A 2KAFA 1QSLA 2FG0A 3J80O 2DXTA 1RI0A 4M75E 3CD6Q 3CCQT 1GCQA 5AFUH 4YDUC 1G15A 5LJ5f 3J81O 1T03A 1E3MA 1N6AA 5FPDA 4DV0K 1WPYA 3RMQA 2RE2A 4RTTA 4JI5K 4JUVA 1WIEA 1HK9A 4ESRA 4C0FA 5J39A 2ZPBB 3OS1A 4M7AC 3OVNA 3V6DA 3A1PA 2GUPA 2KT8A 3DKMA 4IFYA 4B9WA 1LAWA 2DF6A 3HTVA 1YVUA 2GUIA 2EGCA 3SCXA 1OULA 1UG1A 2JS0A 2DZ9A 3ENOA 2J6OA 1TKDA 1FMWA 4N0AA 3SLCA 2FSJA 4C1NK 1UB4A 4PUOA 3V1RA 1G3SA 1JCEA 3VTIA 4UQGA 1JLCA 2E3HA 3IDHA 4FCYA 3U9ZA 2SEMA 2RQWA 3ZT3A 1D0YA 1VYTA 3MEVA 4K0KK 1TWBA 1MNEA 3SBGA 1YFNA 1NWKA 1OI1A 2QDLA 3RIRA 3SPYA 3MN5A 4BDPA 3T69A 5LL6S 3TVTA 2ZD1A 3QG1A 4HVUA 4MO4A 4DTNA 1L3SA 3BF3A 3DLLL 1TKXA 1KQSS 4MZPA 2YNFA 4DV5K 1R0AA 2YUPA 2X3XD 1AEYA 3MDQA 2K5LA 2HNIA 3RKXA 1Q81U 1JEGA 1T6CA 2XIDA 4PFPA 1P8ZA 2L3QA 2H3JA 3TU4K 3JB9G 3LH0A 3QIIA 1TV6A 3CMEN 5BREA 1SKUB 2EJ9A 3L42A 1KVAA 1TYQB 1BUPA 2NLUA 4AG2C 4Z4HA 1W7AA 4CF2A 2DBMA 4JNEA 4BACA 2RH2A 1SL0A 1RDAA 1TL3A 3OS5A 4C1NI 2KROA 1NJIC 1IBLK 5GAOp 2EQJA 4KHPK 2HW3A 1HSQA 1NK8A 1P92A 4A5AA 2YHAA 4M7AE 3FIFA 4FPAA 3I55T 4I6MB 5T7BA 2F1LA 5GMKe 4LFBK 4CI0C 3H3NO 3P8HA 3RMAA 4B9VA 4M7DG 1OH7A 4KHWA 3C94A 2ZF5O 3C6HA 1ESVA 4BRNA 3PGGA 4BRIA 4TSXA 3PIOA 4HTLA 1KIKA 1NM1A 2DX1A 3WVDB 3CJBA 3VRZA 3HJFA 3NVMA 1VQMA 1VQ7Q 5LJ3h 3AVCA 2C0OA 3FB9A 1SAZA 3ITHA 3HT3A 1KSPA 3PIPA 3HOSA 1Y57A 1I8FA 2P9SB 3LZIA 1CKAA 2RQVA 3NFCA 3VQ7A 3DLHA 4B9SA 3CCRN 1C0UA 3KUFA 1NMNA 4LUEA 4BROA 3RRGA 3NCIA 2KMTA 5AT1B 2DL5A 2XG8D 2FZKB 1BHLA 2A0FB 2KRNA 4FT4A 3NGYA 3KD1E 2MMPA 4XTUA 4NXMK 4WF2A 1PKTA 4C8QD 2HB5A 1NMDA 4O6JA 4E3SA 4PJOA 2X35A 1VQ8N 2QWMA 3H0IA 4OMQA 3OYIA 4K42A 4DOWA 3K5OA 3O80A 2XY7A 3O6WA 1XC9A 3PMTA 4OF1A 2A36A 1S1VA 2FBYA 2D8HA 1R77A 3OYYA 3VEVA 4GV3A 1VQ6N 5EXWA 7AT1B 1HKGA 3S6WA 4M75C 4C0DC 2XICA 2RJDA 4NCBA 4M75B 2P9LB 3CXCM 3OA9A 4DQPA 3HFNA 4CZHA 3HO1A 1FYNA 1RAAB 2KBTA 2DKGA 1TL1A 3AVKA 5F0XA 3H46O 1VSLA 3FZKA 5C15A 1T6DA 4X9DA 2DL7A 3NFAA 2JNGA 1BL3A 3K57A 5ADXA 4KHNA 3VGKA 3MP8A 3D6RA 1VQKA 4X34A 2OTJQ 1SKSA 3U4LA 1RBVA 1X27A 5C12A 3ASMA 2DTUA 4AFUC 1G8XA 2LQWA 3K9KA 2O31A 1J54A 1YN8A 2W42A 4KHQA 4BRAA 3TWHA 4IO9L 2X6SA 1D1BA 1PRLC 2G8KA 2DEQA 3IUCA 4Z88A 4BI3A 2KQWA 2KSSA 3LM2A 5EX5A 1QVFS 1EQYA 3G1JA 3D2FA 1VK0A 2EWNA 4KRFA 4BE2A 4J9EA 4A53A 2FLOA 2DMOA 3AAQA 1C1CA 4CGIA 1G83A 3SUNA 2OTLQ 4E7JA 3Q7BA 1WX6A 3UKRB 1UA0A 2YLCA 2DZCA 1XMQK 4BG8A 2JT4A 1NGJA 1WQ7A 1WNSA 2HVIA 3S9HA 1AHJB 3H3OB 2BZ8A 3HM8A 4CF0A 2HNDA 1K4US 4WFBL 4WCIA 2A41A 2M02A 1X43A 1PHTA 2I5JA 3EG9A 5LJ5e 1HYOA 4FJJA 3AY9A 3O4WA 2GFUA 1C0TA 3R6MA 4NCGA 5JVHL 4OB0B 1G3TA 4J83A 4X9CA 3ATVA 3C4SA 3ZSOA 1B7TA 2J6KA 2QWOA 1NLOC 1UE9A 1YJ9Q 4RW4A 1D3BA 2NUTA 1IKWA 3WEEB 3TARA 1MU2A 3VEZA 5KYUB 3AVIA 5IHKA 1VQKQ 4QVZA 2A5XA 4OMPA 4NO7A 4AF1A 4U67L 4LXCA 3E9GA 4M7DB 2GNCA 4LDVA 1GLAG 3UB5A 4E1NA 3OYBA 3PV8A 5IT9O 1TG0A 1EKEA 4MLEA 6AT1B 3SUQA 2DO3A 2RJFA 3K58A 2ATCB 3AVAA 2ASOA 5IHIA 2EBPA 3TAPA 1HJOA 4DV2K 3C0CA 2KNBB 4M77B 1B34B 3M4GA 5BPLA 2BZXA 4BR2A 4M77C 3PTAA 5GAN6 4PFOA 1S1TA 1K0SA 5AQXA 2IIMA 2VCPA 1IO6A 3HM9A 4DSIA 3PLAA 2VWJA 1W2BP 4DBRA 4Z02A 1TUYA 4CGFA 3V4IA 4IXCA 4FJIA 2QYZA 4GY2B 4JI0K 3OYHA 1PKSA 4MLHA 4CIEA 3LWLA 1VQ6A 4KH0B 1UGSB 1YJNT 1O13A 3VQQA 4XIUA 2HHSA 3AA5X 3MP6A 4B1YB 5LJ3f 4OPAA 3QBXA 3VU3C 4LD0A 4V2SA 3MMVA 4OLBA 5D6YA 1ZC6A 2VKNA 2ZWHA 1NGCA 2AKKA 4BDYA 2D0AA 4W5RA 3UA6A 2FEIA 3B6PA 1NJIO 4PNOA 2H8HA 4JKFA 4JJNK 2CP7A 2EX3A 3I0RA 5GMKm 3URGA 5FRMA 2W0ZA 3M4YA 5J3BA 4K11A 2ZPEB 1AZEA 3OW2P 3KJVA 4Z89A 2A40A 3C0BA 3CCMA 4CJTA 3NGZA 1WAFA 3IAYA 4B3OA 4YOUA 3OSSC 1T8EA 2LQNA 1DJ7B 2NUZA 2NRTA 1VHXA 2HHXA 4BGAA 4G1QA 1S22A 4RW9A 2F8SA 4M75A 1WFWA 5ECAA 2X4JA 4OKEA 2K3YA 1BG3A 4J9GA 4FWPA 2HKQB 2R5MA 4CEOA 1QVGM 1WBDA 1YXQA 4CBXA 4KI4A 2RJEA 3AA2A 1WLJA 3AVJA 1L3TA 3MP1A 1V4SA 1VQ9A 4NXNK 1E6HA 4TVRA 3CCQQ 2HSPA 2ZAEA 2QAZA 4RCCA 2ENMA 2IG0A 3MCAB 1OH5A 2YNGA 2E65A 2FB7A 3S3OA 4BQZA 3LH5A 4B3SK 2PNIA 5CR4A 1K8AU 3AAPA 1VYVA 2DTIA 3EGXB 3HRTA 4JAXA 3CCUN 1H1VA 1KRPA 3IG1A 4OPKA 5D3GA 4C8QG 3LWIA 5M9OA 1OZ2A 1SEMA 4X1VA 2P4TA 3FE1A 4LC9B 1HNXK 3PX0A 1BOTO 2KZZA 3E2UA 4C5IA 3A8MB 3QYHB 2KHOA 1U06A 4WQ5A 1ABOA 1SF9A 3CJAA 4J7IA 3VEYA 3EAEA 1WHJA 4A4FA 2EVRA 2A08A 2CH6A 2PU9B 5HY6A 1B34A 2PVDB 3LAKA 4FWLA 4IFVA 5EU7A 4J2EA 1Y71A 1ZUKA 3QETA 1XJWB 4XTWA 1OX8A 3DB3A 1K73R 3EZ5A 3KWGA 3AO1A 3ZCMA 1AWWA 1PWTA 4HHTA 2E6NA 1XI1A 4U7BA 3QHSA 3E9LA 3U8XA 5GIPA 1QE1A 5C0YA 1KLMA 2VWBA 3CCLQ 4DB3A 3TAEA 4C0GA 2QGGA 3JCMc 1T3SA 3EGDA 3M8QA 1SS6A 4KUIA 1I81A 2P1JA 4JEPA 3G6EN 2UXBK 2P9KA 3TSPA 1RBTA 3OBYA 1YIJT 5M1PA 4Z94A 1HNZK 3N4QA 3RMSA 2NRZA 1ZBLA 3O9UA 4LFAK 4KB1A 1N8RC 4H0TB 1A5VA 2ROLA 1R59O 2YSQA 3DXKA 3H0FA 4L6V5 3QFUA 3I33A 1K73U 5AQKA 3QB0A 4M41A 2WSEE 4E7SA 4M77E 4N4HA 4FOIA 1BO5O 5HRSA 1KQSA 3M9QA 1HX1A 3PY8A 5KI6A 1TSFA 3D2EA 4KGZB 4DQ2A 4DLEA 2EJGA 3TPQA 2K2VA 3CCVA 4K25A 2PZ1A 3HKSA 3ME9A 2EIFA 3OB9A 1Z9QA 1NJZA 2O8EB 1ZA1B 2K5IA 1E4FT 4PA1A 3CQ8A 1WJQA 1BYMA 1SPKA 4BY9C 3EYZA 4M3YA 4JZ3A 3THVA 2NNWA 4O0JA 4FLWA 1VQOA 2QEXT 2Y4YA 5IT9E 4DQRA 5GANj 4AT1B 3C95A 3GPLA 4Z0UA 4BVPA 2KZMA 2YHWA 5AQQA 3DLBA 3TTCA 4CJ5A 4OMLA 4JS5A 4II1A 3CMAT 1TK5A 4DFKA 2QQAA 3QESA 3LDLA 3M54A 3CCLA 2PUOB 4YTLA 4NL2A 3ZBDA 3SAHA 3M8RA 3J7AP 4DQIA 3BFMA 5KYXB 3CMEA 3EEQA 5GAMf 1CKBA 1S1NA 4EMKC 1LWEA 3RKYA 4DOVA 4CFCA 3EGDB 1VQ7A 4B9XA 3EFOB 5AQHA 3SJJA 1IBKK 1C6VX 1Q81O 1CLQA 1HPMA 1U2VB 3HRUA 2AT1B 1MV0B 1K9MO 5ADXH 5AYFA 2J4RA 2D0BA 4FXDA 3VYGA 4M7AD 4IWVA 1C1BA 3VQAA 3G4SN 1OQKA 5DM6L 1XOVA 3AVNA 4CERA 1EZZB 2NRRA 3JAMO 2P5OA 5LL6Z 4PJOC 1VA7A 4F4KA 4F7UE 1BI1A 1PRMC 2FPFA 3N4PA 3ZX3A 4J9DA 5M1OA 5AFUA 2JWKA 1Q82R 2RHUA 1KJWA 4ME7A 3M0PA 4DTXA 4CEEA 2QWNA 4JZ4A 3VEOA 3UPUA 3NH1A 1KC8C 1YWPA 1OOTA 3EKUA 4DCHA 2DY4A 4E19A 4JN4A 3ER0A 1VQ8Q 3VQCA 3LZJA 1JLFA 1B92A 4JV5K 4FYXB 3CD6T 4MFBA 2VWKA 2E6ZA 4M75G 1Y96B 2B86A 2DXCA 4JRQA 5GJWB 4JI6K 3NF9A 3NF8A 4EMKA 3UIQA 1GCQC 1HUXA 4UY8O 1TXQA 3BF1A 3DRSA 5I11A 4RTFD 4C92A 3PT9A 1N34K 2VUBA 3BGRA 1XHZA 2BZYA 4Z4FA 3VN5A 3FC3A 3G4SA 2FF3B 2YUQA 3VQ4A 2ROTA 1Q86O 4A57A 4K8ZA 3OW2A 1W6XA 3E01A 1JBMA 2JWLA 2QA4Q 2XY6A 3ULRB 4IOXA 2AJQA 5HK3A 1MHNA 3O9QA 3SJHA 1PCXA 2G8HA 4DLGA 2LZ6B 2VB6A 3OYAA 3CJ1A 4F7UA 1DT9A 4FWNA 5I2MA 5AZIA 5CR2A 3LDOA 4DTOA 1RT1A 4JDSA 4R56A 1Q82U 3LDSA 1WYXA 2K4YA 2J05A 5KYYB 1KVBA 4KULA 2HF4A 2GBQA 3J8AA 3CJCA 5KGXA 1M3AA 1ZYQA 2GV9A 5KYXA 3DJCA 4KH1B 4E1MA 3VA3A 3ALYA 3LWHA 4B9UA 2O4IA 1BBZA 4R5PA 3GNFB 1C1AA 1RADB 2YWWA 3RBBB 1KD1C 4NOYA 3JB9H 1RBUA 3FZFA 4CFAA 1BQMA 2RHYA 3G0ZA 4DTJA 4LF7K 5ELZA 1SSHA 2DFHA 2RHXA 1QLYA 2Q2RA 1W9HA 4QS7A 3KVGA 5CKDA 3CQYA 3MAQA 3G6ET 5FRNA 1QQOA 3MWTA 3O4QA 2ESWA 4OKKA 3GNGA 4CZEA 3CC4A 4BY6C 4PJJA 3E19A 1GLEG 2Q1NA 4EFHA 2D9TA 1AOJA 1QKXA 2CT4A 1BGXT 4H5WA 3ZT1A 1GBQA 2DAQA 3I55N 1MUZA 3H9NA 2O8EA 1Y96A 4M75F 3MWPA 4KH6A 2XU8A 2VGMA 4RUGA 4DR7K 2HHVA 1FKPA 3VS6A 1X6OA 1Q18A 4HCBA 4B1ZA 2KFNA 4HUFA 1LOJA 3L2WA 1U3OA 3DRRA 1D0XA 1RABB 2EQMA 1IRXA 3LM9A 1VRTA 4Q5VA 2O8BB 2UUAK 4ID5A 4LF6K 3O8VA 2ITGA 4LSNA 4RCHA 3VERA 1VQKN 3RMCA 1TTHB 1WNLA 4M77A 3TR8A 3G71N 2OI3A 4PFZA 4JI3K 3JSMA 4FJXA 1VRUA 1OVYA 2RB6A 4AFZC 3MN9A 1M5Q1 2M0YA 4XU0A 1RI9A 4OB3B 1IXDA 1PSFA 5FDLA 4F9OA 5AZJA 3LWMA 4FLZA 4V19S 2MYSA 4CIGA 1YI2N 2RPIA 3AHUA 4AHCA 1S72N 1X9JA 1HNIA 2EQUA 3C6TA 2NRHA 2KXDA 5H1SQ 3ZL7C 1QCFA 2F9TA 3QWYA 3HOTA 4AMCA 3C6UA 3GBTA 1Q86U 4DG1A 2EYZA 2P9IB 2VYTA 4IZ9A 2NYSA 3VF4A 5IXBA 4AHTA 3LW5E 3UDCA 3AA4A 1M1KR 1BDGA 5HLFA 4CRIA 3HZ6A 2MWPA 4DV1K 3HK2A 2A37A 2P9SA 1YHQN 2C06A 1KC8R 2HKNA 4IJAA 4P5NA 3AA3A 5I9EB 1KXPA 5CKFA 5GMKi 1ZXOA 1QVPA 3VETA 1M90O 2O8FB 2P9UB 5J1EA 1WXTA 4H0OA 2YV0X 5HKCA 1RNHA 2L0AA 4DTRA 5D7UA 4OP0A 3HYFA 4M77D 3HPWA 5CKBA 4PKHA 4B3MK 4OX9K 5JS2A 2WTUA 1NGHA 2QTXA 2FF6A 3M58A 3J81E 1ZSZA 1QVFP 1T3LA 4ELYC 1M90R 4M7AF 4QT7A 3VGMA 2ASPA 2OTJA 4AM6A 2CP2A 3EO3A 1IHVA 1RT6A 4CBWA 3SV4A 1O75A 1G3YA 1JKHA 2GEMA 4IEIA 4LH4A 1Z25A 5CKEA 2P0PA 1VQ9T 5GANh 3ZSYA 2ZCFB 2EQKA 2R5AA 4FK2A 2Q97A 3MEDA 3PX6A 1J5EK 1ATNA 1TUDA 2M9UA 4FWSA 4ORZA 5HCKA 1YT3A 2B6AA 2M0OA 5MLCQ 3KXTA 1MWKA 1NGGA 4KFBA 4RWTA 3KWIA 4FWRA 4HWIA 1UJ0A 4EMHA 1YJWQ 1N5YA 1N8RO 3WQUA 4CK1A 1KTQA 3NTHA 1YTUA 1JLGA 3ZT2A 3THWB 1NG9A 5KYNA 3A8HB 4DU3A 5DK5A 4ANJA 2Q0RA 5IHNA 1XHXA 4B3RK 2D0CA 2DD5A 2COZA 1BA1A 2OTJT 1QQNA 4FVUA 4AM7A 3V7RA 5AQYA 1GLDG 2E2QA 2DVEA 1B07A 3R1XA 4C5HA 4DR1K 5AQIA 3FZLA 3SFMA 2RKIA 3GIBA 4GLMA 4CC7A 3ZLJA 3CYMA 3WXMB 4XH5A 2CKKA 2QWPA 4YOYA 2F8TA 2QASA 4Y1CA 1WI7A 2M16A 2E12A 4MMKA 3RR8A 3L4IA 4Q0BA 3GOIA 2KFZA 1NGIA 4CZKA 2HQHA 3M56A 1RDDA 3DYAA 4C8QF 3MECA 2BDPA 1N9RA 1KFZA 1WB9A 4M78C 3QDKA 3JB9F 1QWEA 2P9IA 2OTLT 2P9NA 2DA9A 1VOMA 5A0LA 1FWZA 4BVOA 1KQSM 4DF8A 2IVNA 4CIFA 4GVMA 2ETJA 1AT1B 1T44A 3FFKB 1ZBIA 2D5RA 2JTFA 1KQ2A 3X24B 2LX7A 4ELVA 4I9QA 3OTOK 1R0CB 4FM0A 2F9WA 3PO5A 1ACMB 1K9MU 2HMIA 3UE5A 2HHWA 4JPBW 4PJOE 2HMAA 1X69A 5FLXE 1Q9XA 1D3BB 3WEEA 1UDLA 4DF4A 3KZBA 1YJWA 3PMIA 3A5MC 1X6GA 3EG2A 1K76A 3QIOA 1RGIA 4C8KA 2IC3A 3V7SA 5J26A 1TKZA 2AA4A 1XNIA 1DKGD 1WQWA 5CCAA 2HBJA 1VQLQ 3HTRA 3SAFA 2G8UA 1KQSP 1F21A 3CC2N 4F3OA 1OPLA 3KD5E 1WXBA 1VQOQ 4XTZA 2C0IA 4GY5A 3DAWA 1MMDA 4FWQA 3ZETA 1BI2A 5AQZA 2LP5A 1ATRA 3P31A 3RESA 3CCUT 4DV4K 1OV3A 2V8JA 1UUEA 3VRYA 1HJRA 1K73O 4GMJB 4GV9A 2D6FA 3F9MA 1W2BS 2YHXA 4CC3A 1V29B 2LJ3A 2LVMA 3TSZA 2OPSA 4O44A 5C24A 4BB7A 3ZX0A 1S1WA 1JCGA 3KKRA 3JV3A 4BUGA 1J5OA 3OS2A 3CCMT 2QQRA 3D2FB 4J9FA 2JLEA 4JI7K 2JTMA 3JCMJ 4DTUA 5A0GA 4CJ3A 3K5MA 3LGLA 3QYGB 4JRPA 1K73C 1S72T 1U2VA 3C7NA 3AVBA 4M78F 2QEXQ 4I7FA 1NJYA 4B1XB 1IG9A 4LF9K 2QK0A 1G5VA 2A1SA 4NLBA 4FJLA 2O8DA 4DEYA 3CC2A 4MDWA 1CZBA 3VOVA 4MO5A 4JJBA 4C92D 3CCMN 2GELA 2WSFE 2X6NA 2FBXA 4DWIA 1AVZC 2BE9B 4FW1A 4AFQC 1LW2A 2RF0A 2DPNA 4ILHA 4B1VA 1YHQT 3EHQA 2E1HA 3L2ZA 2V7YA 2X51A 4W5OA 2CGHA 3A8GB 3A5OC 5KQDA 4OVAA 4A61A 3D2EB 1HJDA 2WC9A 5HROA 4KHYA 1VQOT 3LDNA 1G99A 5GINA 1OH8A 1RTIA 1QVFM 1VQ7T 1JLAA 1QCOA 1NBWA 1K8AR 3KK1A 4GKJK 4DEXA 1LJOA 1M9SA 3PUFA 3V8KA 2XDDA 4C8QC 3OYNA 5FPMA 3QFPA 3WNGA 2G8IA 4RTXA 5CKHA 1EFNA 3S3MA 1IZ6A 1RAEB 3CCLT 3VGLA 5I3UA 1PD0A 4CZJA 3LP3A 1JU5C 3OA6A 1FK9A 3F9KA 3NH0A 5JS1A 3CMAA 3TU5A 1JLBA 3EGXA 4A2AA 3L8BA 3CBPA 4PJLA 1AWXA 3HP9A 2ZGWA 4J9BA 4OB2B 3CJ9A 1HKCA 2NUBA 2W6KA 2Z0WA 1J6ZA 4NCAA 3A5LC 5GAN5 3TSWA 5KRSA 3C12A 4OPJA 1UA1A 1VAZA 4PL6A 1M8VA 3PIOL 1KHCA 4WQ4C 2QEXA 1PG5B 4MQ3A 4M75D 5AR0A 2RD1A 4LY7A 2QA4N 3L2RA 3G7ZA 1WJRA 3JCMV 1GXIE 1Y07A 4EMGA 1GLCG 4CHNA 1NNEA 1B9FA 4XAXB 2E6LA 2P84A 2WSCE 2KRSA 1NOZA 2CUDA 3A8LB 2E2OA 3PNWC 3VS1A 1YI2T 3CQXA 4HVJA 2GQIA 5GAOn 3SAGA 3THXA 1VQ5T 5GMKj 1M1KC 4XEIA 2QW9A 2ZJRL 4BRGA 4XU2A 4LH5A 1HLUA 4PJOB 1Y0MA 5KPRA 3FR0A 1OYXA 4M77F 1O1WA 5AQLA 4BRKA 3VYHB 2FRWA 2JS2A 2YDLA 1R0BG 1YJNA 3VTHA 2RNAA 3DLRA 3WVEB 2X78A 3KK2A 1XC3A 1VQPA 3M3ZA 2AP1A 2O8DB 5KRTA 2ZPGB 3OMCA 5FU6C 1YIJQ 4LDWA 4EPCA 1RILA 3QWXX 3CJ7A 5CIUA 3JCMg 3VS5A 5LJ3d 3P83D 4KT0E 1VQ5N 1U4BA 3DOKA 2AK5A 1S5JA 3NMUA 1RBRA 1WHGA 2IOCA 1OU8A 2MPXC 1WJSA 5BRHA 4KB0A 3PSIA 1XUPO 2E8AA 4BR7A 1CSKA 3X20B 3OYCA 2CREA 5J2MA 3NGPA 2EYYA 2A1RA 2UUCK 3J7ZO 3J80E 4C92E 1NPPA 3EY1A 1TAQA 5HP1A 2JOYA 5DMRA 3CMEQ 2FHDA 1JJ2S 2EGEA 5SZTA 1BA0A 3H6EA 4KPYA 4IG3A 2OJ2A 4ELTA 3GP8A 1BCMA 3MCPA 3MJXA 1D5AA 4IEEA 3EFSA 3QO9A 2I7NA 2YUOA 1QZ5A 3CCSA 2X4WA 2QQSA 3O1WA 3EKSA 3MEUA 4CGHA 3SBTA 4EHTA 4H5RA 4F04B 3CCVN 3MEEA 1UTIA 3TEEA 1NK4A 4M3XA 2AHJB 1G3WA 1Y97A 1HD3A 1BK2A 3A5ZB 4JK7A 3VENA 4DSLA 5CHIA 5IN1A 5GIOA 1KSWA 2LTOA 1S72Q 1YJNQ 1X3MA 3M55A 3PO4A 3ZSQA 4M77G 4ZNXA 4DR3K 2BANA 4J2AA 4HT8A 1JJ2A 2F4VK 3MHXA 4FOEA 4QQGA 3O9TA 2OAWA 5EVZA 4PKGA 2WOMA 3WUHA 4KREA 5DY9A 5CYMA 4KGXB 4QCLA 1HPZA 2KTQA 1H3HA 2K5FA 3CFOA 4WFAL 2E4HA 4HCCA 5HRNA 1YHQQ 4DFMA 3LP0A 3HRGA 5GAOl 3ATUA 1RT3A 2V52B 1HRHA 2DE0X 3MXMA 1NKBA 5AQOA 4FL6A 3SMPA 2QXFA 2LRQA 1M4ZA 5KYUA 2KKZA 2KW4A 4FJGA 3P8DA 3HPHA 1PNJA 2QA4A 1KVCA 4JJCA 5AQWA 2E4LA 2RJCA 2HHTA 4YNQA 2E1ZA 3NDKA 3KLEA 4YY3K 2DL3A 3I56Q 3VPZA 2HNYA 5E84A 2Z1HA 1KLNA 5LJ5j 5GAMg 4CFDA 4IDKA 3M59A 3RDVA 1QWFA 4AHSA 1UFFA 3MEGA 1U1TA 5HBMA 2YT6A 5BN8A 3SEMA 1AWOA 4M7DE 5CO7A 1S9EA 5BRDA 4ELUA 4OKJA 4OO1J 5AZJB 2RPNA 3M6GA 3J7AF 4HCKA 1Q8IA 4DSJA 1WSIA 2GBZA 2IVWA 2QWRA 3RSEA 1YJWN 1IJJA 1UAXA 5AZIB 3E9PA 1NOYA 1WSHA 3GOXA 4FLTA 1YITT 5L8RE 4JRKA 2L5QA 4BI8B 2CZ7B 5KYWB 2PBDA 3CC4Q 2VXEA 3EN9A 4KUDK 4FIBA 1NU0A 3PX4A 4CJUA 2DNUA 1HYVA 5CQYA 2RK2A 2K6DA 1RTHA 3QINA 3G10A 3BEXA 4YDUA 5KGWA 2ATQA 3ZEHA 4DBQA 4EIAA 3F73A 4C8OA 2P9UA 4DTMA 4QVCA 2HSTA 2EPDA 4PJNA 2V7ZA 3C65A 4BRMA 4XTYA 1HKBA 3BDLA 1VQPT 1BQNA 1SUQA 4CJKA 3JCMW 5CE3A 1QTMA 3CC7A 2HF3A 4N56A 4BR9A 3TTFA 4FLYA 1VUBA 3QBYA 1RDCA 2GWJA 2HBKA 3KHYA 3QZ5B 5LJ3j 2XMFA 1RAFB 1RDBA 3MXJA 4QVDA 1RAIB 3WT0A 4M7DA 4DUYK 2Z1JA 3V9UA 1BIUA 2E41A 3VEWA 4J6WA 1GLFO 2DL4A 2G8VA 1RL2A 4FVMA 4B9MA 5LJWA 1WSFA 1YJ9N 5M1FA 3CCEQ 1O9SA 3QBWA 4IIOA 4BRFA 2YUNA 3LDQA 3OYJA 2FVUA 4N47A 3C6AA 4GLKA 3RVCA 2NUPA 5BR8K 1YAGA 2KK4A 3Q7CA 4DSEA 2EFIA 2EW3A 2MWOA 3NH2A 2LCSA 3CPWA 4IUQA 1L5UA 2J7IA 4E7ZA 3AVFA 2DK3A 1NYFA 3G71A 1SRLA 1VQNT 1RT4A 4XTXA 4ZGDB 2O8BA 4DBHA 3CM5A 1OKJA 2O8CA 1QS4A 3V1QA 2CH4W 1XQSC 2CUBA 4NYFA 5BR9A 4JKGA 4C8QE 5JICA 2BIVA 2DIQA 5J2NA 3UF4A 4XU1A 2DTOA 4KGVB 1RTDA 1J9AA 3CBOA 1VSMA 3GBQA 4LUDA 3L2UA 3CCRA 1MMNA 3P1GA 3OYGA 2DXUA 1ASVA 2EYQA 1PM3A 3JB9I 4KV8A 4Z4IA 4B9NA 2WACA 3VS4A 4DSFA 2P9KB 1I5LA 3S3NA 1RLPC 1UEBA 2YLBA 2A28A 1VYUA 2CDTA 4IURA 2UXDK 3CETA 1QCNA 3CC7Q 4PLLA 1WHMA 2CT3A 2YJFA 5D6WA 2CH5A 4FLXA 1ZLMA 1VQMT 1YCYA 2V26A 5GADP 3QNNA 2QQBA 2J6FA 3TSUA 2VVKA 4LDXA 2YRVA 4R0KA 5BPNA 2CGLA 4DFJA 3EG9B 4E7KA 2G6FX 1M2VA 1VSKA 1WSGA 4JK8A 3THYA 3CCEA 1QVFA 1OVQA 1E4GT 4RW6A 1C0MA 2QQ9A 3PVLA 5I22A 3DXMA 5EG2A 1Z05A 4RW8A 3T1HK 1NKCA 3IMXA 4RW7A 5FWBA 1K9AA 4RTYA 4CGJA 2AZSA 3H6ZA 1WAJA 4CEZA 1K8AC 1QVGP 2KDSA 1VIEA 2F2WA 2NWMA 4KTZA 1MWMA 3O8MA 4IUUA 3BY7A 4CJVA 4M7AB 1OU9A 2A42A 3ULDA 3CCQN 3EGUA 4KHUA 1JQQA 3BUZB 5C10A 5AQGA 3M8SA 2HHQA 4KH5A 1JLQA 2E2PA 1NGDA 4J6XA 3NAEA 3MXIA 4N76A 2PUKB 4E7IA 1LCUA 4CVNE 4F2SA 3R6NA 2BUDA 1MA9B 3GL1A 3I9QA 3CCUQ 4JKBA 3OW2M 3IFRA 2QDYB 3VQ6A 4A5BA 2UYTA 4C92C 1M90U 2OZSA 2P0QA 2HHUA 5FPNA 4O0IA 4H5TA 4C23A 4M78E 4FJKA 2K7AA 2RQRA 2VC8A 1KFSA 3ID8A 1HYSA 4M45A 4LFCK 3X28B 1RAHB 2GTJA 4N4IA 3INZA 3OY9A 1QQCA 4NB4A 2KI7A 1WA7A 2HQEA 3ZEUB 3UA7A 5GMKh 3O3GA 4AHVA 1CZ9A 1NM7A 4JHDA 2O88A 2LJ1A 2OPRA 1E7OA 3OYMA 4IUPA 1KC8U 3TSQA 2CP6A 1CZAN 3PSFA 1W2BM 2YKNA 1MGQA 2D0PA 3GG4A 3A5NC 4BR0A 3U9DA 4KRTA 1L3UA 2YHTA 5FROA 2VV5A 3LL3A 5CY4A 1FKOA 2XK0A 2BTFA 3KIOA 2ZM6K 4DV3K 3ZSRA 1M1KO 5LMNK 3SMSA 2JMAA 1GOCA 3F5TA 1T7PA 4YOXA 3VS7A 3MX2A 1DTQA 2D0QB 2KE9A 2YRCA 2EWSA 2DL8A 4JLIA 2X74A 3QICA 4BR5A 2ZGYA 3NPFA 4LDUA 4LF4K 1WGSA 2RN8A 1BI3A 1HXDA 1VQLA 1N36K 3L2QA 2PQWA 3WNEA 3VF2A 3V7CA 2Q3SA 3HBTA 1YIJA 3VQEA 3KK3A 3QEIA 3H1VX 4FJMA 1GRIA 4C5GA 1VQNA 2FO0A 3L4QA 2V1QA 2BH1A 4H5VA 4C8NA 4B3TK 1IH7A 3MEWA 4HCZA 5C0MA 1YIJN 1HQUA 4FYWB 4OGEA 2PVOB 5GJVB 1VQ5Q 2DFFA 2PVGB 2Q0UA 2K3XA 2XHBA 4CGGA 2KGTA 3CQTA 1ZBHA 1NPRA 4LE9A 5BPMA 1QKWA 3QIPA 3QDRB 1IV0A 1QHTA 3JCMf 3EE8A 4ZN3A 3NE6A 1TYQA 3X26B 2I0NA 3HSBA 1NG2A 1YITN 3K9JA 1VQ6T 4M3RA 2YKMA 3QMLA 3JSCA 1IHWA 1YITA 2Y1JA 3MN7A 4CHZA 1FJGK 4CC2A 2HBMA 3H0HA 2BKDN 3SZ2A 1EIFA 1T0JA 1VQ4N 4HA8A 3VA0A 4CJWA 5DM7R 1JXEA 3EFOA 2QTVA 4Y92A 1IG8A 2NRWA 2P5GA 1WSEA 1WN7A 1NGEA 2LQ8A 1DEJA 3X25B 4HUGA 4B9LA 1BWFO 3I5SA 3G4ST 4M7DC 1N8RR 1RT5A 2CSQA 4JI8K 2ECZA 3QDFA 3VQ9A 4QQ6A 1UGRB 5A2QE 3HVTA 1EP4A 4M7XA 4Y0WA 3CCVQ 3QZ9B 2CZ1B 1TUCA 1S72A 3TREA 3CCJA 3LPTA 1LAVA 1DTTA 4D8DA 3CMAN 4L5GA 4ZTJA 3HFOA 3VQBA 4CE9A 2LX9A 4MMLA 1ZUUA 3M0TA 5HOOA 1Q81C 1YJNN 2GQVA 3META 2L2PA 2P0KA 4CZFA 4OVLA 1ZHIA 3KTQA 4J8OA 9ATCB 2PTKA 1LV5A 4C92F 1QQJA 5GAEP 2XHCA 2RF2A 3NHGA 1UGQB 4J5YA 2VG7A 1X9SA 5J2QA 2HNZA 2JZ2A 3M0RA 1TK8A 4EP4A 4X62K 3CXCP 4BE0A 3A2FA 3CXCA 1VQ9N 4JD2A 1NJIU 4WFNL 2O9SA 3SNNA 4CECA 3PIPL 1LPLA 3VS0A 5IAYA 1BI4B 2F5TX 2DM1A 2O4GA 5LJ5d 2XKOC 4MDXA 1N8RU 4CW7B 2YX6A 3CPFA 3HL8A 1QVGA 3U6FA 2FC0A 1VQ4T 3AGRA 4FYYB 3HP6A 4X64K 1X01A 1EXQA 1RACB 2AKLA 1SG5A 3ULEA 4OB1B 3GF5A 4WF9L 4KI6A 3ZT4A 3CCST 1ABQA 3GDQA 3CD6N 1EETA 4M4ZA 5FU7B 3U3YA 1YF5L 4JRIA 4M7AG 2L3PA 1N5ZA 5GAOq 2E6MA 3VMFB 1QHAA 1NK0A 4FPBA 1GFCA 5KYYA 4IKFA 1GLJO 4F7UF 3V9WA 2YNIA 1SKRA 2BE7D 2DYBA 1TK0A 2KQ2A 1VQNN 2E1YA 1VQPQ 4HT9A 1NJIR 3HSTB 4B1UB 1WHHA 1Z26A 1V1CA 1Q7YC 3L3UA 4FYDA 1NGFA 5CQXA 1RTJA 3A98A 3CBMA 1KFDA 3KKSA 3E66A 4B9TA 2HL3A 1TUUA 3FZHA 3EH2A 1W2BA 2CYZB 3Q1JA 3SHWA 4H0VB 3UKRA 2X9HA 1BB9A 3PVQA 1H641 1WUAA 1Q81R 3K0SA 4D8KA 3EHRA 5F1XA 3VS3A 1W1FA 4R55A 3RRHA 3NF6A 2UU9K 1U47A 2EYXA 4DS4A 4QAGA 2BUPA 4CEQA 2I2LA 1K8KB 4C5EA 2LMJA 3AARA 3VQDA 1KQ1A 4FZYA 1ZBJA 2RHZA 1N6QA 2V1RA 4DR2K 4LD9K 5CK9A 1LWFA 3G25A 4CF8A 2VQEK 1WOQA 1ZQ1A 3V9ZA 4FJHA 2YJEA 2COWA 2KRMA 4ZN1A 1VQ8T 2CSIA 2LT1A 2W40A 5AQFA 4BC2A 1WSJA 3AVMA 3ZX2A 1BU1A 1E6GA 3CCSQ 3JCMe 4J7FA 3I56T 2LNHB 3M5AA 4JI1K 1K8AO 2FRYA 3IQLA 2YHBA 4ZTFA 4E47A 1X2KA 3DI6A 4BE1A 1Q7YR 1H3ZA 3VQPA 1LWCA 3FDRA 1MMGA 1ARKA 5GAMj 3E1SA 1S9GA 3WXJA 4OLAA 1EX4A 1M3CA 3N5BB 1ZBUA 3TCJA 3SQ2A 2RQTA 3G71Q 4JKGB 2XY8A 3AVHA 5KPZA 1WXUA 4DTPA 2QTDA 4CJEA 4B8CA 1KD1R 2QGFB 3QEXA 1RBSA 1K0XA 5K14A 1VQ7N 1YI2Q 4HUEA 5F2RA 1HR0K 4PHTX 4IUTA 3TQ7P 1S3XA 2RI5A 1KG1A 4BC4A 4Z8AA 2UUBK 2SRCA 3I5RA 1U1SA 3CCRQ 4DKWA 1RT7A 2ZGZA 3B8AX 4A2BA 1YJWT 3AVGA 4F17A 3BP8A 3SWNA 3THKA 1X3NA 3VQ5A 2DLPA 2F2VA 2XDPA 5GAHP 3M8PA 1D4XA 2W10A 1IKXA 3AV9A 3HPOA 2MF2A 3A8OB 4IDHA 3M0QA 4HKEA 4FJ9A 2RHIA 2X3WD 4AHRA 1LOTB 4OJRA 1Q82C 5GAMe 3I56A 4JD2B 2AIRB 1AD5A 2Y4XA 2AZVA 2DRKA 1M2VB 1UHFA 2P9PA 3HSCA 3THYB 3OJUA 2HVHA 3BDUA 2IGIA 3RKWA 3JCMX 1M1KU 2H3GX 1N33K 2FPDA 4UC4A 4FSSA 1CXUA 4DTSA 2OANA 4FWKA 1KD1U 3M0UA 3JB9J 4OMOA 2L3SA 4Q5WA 2E5LK 2JJ9A 4PL7A 4M78G 3AO5A 3CC7T 2CS7A 1LW0A 3KFVA 1S6QA 2KLAA 3DRPA 3R6OA 1SZ2A 4EDUA 2PY5A 2NUPB 3TAMA 5FU7C 2GFAA 4H4OA 2HDAA 5GAN7 1J53A 4I6MA 4WE1A 1YTAA 2DBKA 2DPPB 1SRMA 3NGIA 3BE3A 4CZMA 4ISEA 1I94K 4BY6B 4F14A 2E20A 4F3TA 1X6BA 4BDZA 4FZZA 4BC5A 3JCMb 5BN9A 2EYWA 1LCKA 1V76A 4FW2A 4JJDA 4A4HA 4C8QA 5AJ3K 3M1FA 2RI3A 4FSXA 3D0PA 1RDUA 3LDPA 1NEGA 2O4XB 3M53A 1YJ9A 1W4SA 4CK2A 5IH2A 2ZJQL 5DLQE 4KBMB 1A5WA 2C0TA 1JL2A 2GF7A 4JKEA 2XRIA 3ZEUA 3JCMh 4CGDA 2Y1IA 1SHFA 2RN2A 5M1NA 5C42A 2OTLN 4J9IA 3SQ0A 4ICLA 4N4GA 3QXEB 4CC4B 4WYBA 1A0NB 2DILA 2KEAA 3PE0A 1GLLO 5AQUA 4AQYK 3E9OA 1V4TA 2OYQA 1ZBSA 3CFRA 2VWFA 2KVQG 3BW1A 1VSFA 3AT1B 3WQTA 5FLXO 3CFPA 3RR6A 4XH4A 3CPWP 5CVIA 3CG7A 3H1QA 4M3WA 1ILYA 1JCFA 1K8KA 3NF7A 4E7HA 1S6PA 3CM6A 4FYVB 2DYIA 3L3VA 2W41A 5I42A 4FK4A 1KAZA 4OPHA 3OYKA 2ZPIB 1SQKA 2YHYA 3CCVT 4BD3A 3JYTA 5GAN2 2FZGB 2OPPA 3LLRA 4JS4A 1EWRA 1I39A 1TAUA 1X9WA 2JXBA 4RTZA 3O08A 3L6QA 3SI6A 1I1JA 4O5VA 4DQ8A 1BI4A 3QJ6A 2GGRA 3CC2T 4JKCA 1NJXA 4L8RB 2QKBA 1N27A 5LMUK 4CK3A 4BRCA 1PSEA 2PZSA 1QVGS 4PJOD 2D0NA 4I2PA 2IDOA 3BZCA 4GBQA 1Z6RA 3WXLA 1ZA2B 3QKJA 1Y64A 2V8IA 4CJSA 1IREB 4PKIA 5GAOm 3OQ5A 3E1YA 2YNHA 2K2MA 4W5TA 2K57A 2P4RA 1JXMA 5GAMd 3O5ZA 3JS6A 4FZXC 4DUZK 1KCFA 4BREA 5J2PA 2G8FA 1ZX6A 2MIOA 2QI2A 1RDWX 1VSJA 3P5JA 1T3VA 3EZWA 2O4XA 2VQFK 4JLGA 3DLMA 3ENBA 2CZ0B 4X66K 2R57A 1YITQ 5B8HA 3KLGA 1FX7A 2XI9A 1VSEA 4NLCA 3QUIA 4MZTA 1UOCA 1REVA 5GANf 1H8KA 5FWCA 2GTOA 4JHDB 2XDBA 5SWMA 4FJ8A 5DM7L 2Q36A 1TU0B 3ZT0A 3RTVA 4PWDA 1EWQA 4I2QA 1NLPC 5KCOA 3T3FA 2EHGA 3QERA 4BI4A 3U3GA 4AG1C 3V1OA 1MV3A 2DIGA 3VS2A 4A59A 3K5NA 3KK7A 5GAN4 4JKAA 3D7SB 3M0SA 3UKUB 4BRDA 4BRQA 1TOVA 3CCJQ 3K5LA 4AFSC 3TI0A 4H0YB 4CESA 1NYGA 1ZSGA 1NKEA 4CEDA 1X75C 3NHNA 3REAB 3OW2S 2BGGA 4GVEA
chains in the Genus database with same CATH topology
3OYEA 3MAQA 3KLIA 1QS4A 3O4QA 3V1QA 3O3HA 4DSKA 5FRNA 4NYFA 4OKKA 4CCHA 4CEAA 1G15A 1T03A 5J2NA 4KKOA 3OJSA 3T1AA 4CJLA 4CJQA 1BGXT 3ZT1A 1RTDA 1J9AA 1VSMA 3P1GA 3L2UA 1ASVA 3OVNA 3OYGA 3OS1A 3V6DA 4KV8A 4Z4IA 4IFYA 4B9NA 4DSFA 4ID1A 1LAWA 1FKPA 3DOLA 2HHVA 3S3NA 3QLHA 1YVUA 1U48A 3QEVA 4HCBA 2GUIA 3SCXA 2KFNA 4HUFA 3L2WA 3DRRA 3WNHA 4Q5VA 1TKDA 1VRTA 4FLXA 4PUOA 4ID5A 4LSNA 2ITGA 3V1RA 3QNNA 2PYJA 3RMCA 4UQGA 1JLCA 2R7YA 3H08A 3OS0A 4FCYA 4FM1A 3TR8A 3ZT3A 1QMCA 4C8MA 4Z4EA 4DFJA 3JSMA 4FJXA 1VRUA 3RWUA 4BWJA 4E7KA 3VA3A 1WSGA 1VSKA 5FDLA 3LWMA 1TGOA 4FLZA 3SPYA 3L2VA 4RW6A 4CIGA 1C0MA 2RPIA 1NKCA 4AHCA 4RW8A 2ZD1A 2ZQBA 4DTNA 1L3SA 4BDPA 1HNIA 2JGUA 1TKXA 3C6TA 2YNFA 4RW7A 3B6OA 1R0AA 1NK5A 4CGJA 3V9SA 4H4MA 1WAJA 4CEZA 1D9DA 1Q9YA 3C6UA 4KTZA 4FJ5A 4DG1A 4PQUA 1TV6A 4AHTA 3O4NA 1NK6A 4CJVA 2ZE2A 3AA4A 1KVAA 1NJWA 4Z4HA 5HLFA 3ULDA 4KHUA 4CF2A 3IS9A 3HK2A 4BACA 3M8SA 2HHQA 3K2PA 4FM2A 1SL0A 1JLQA 1RDAA 1TL3A 3AA3A 3NAEA 3TANA 3MXIA 4E7IA 1QSYA 4N76A 4F2SA 2HW3A 1NK8A 2YHAA 5J1EA 3VQ6A 2YV0X 1GOAA 1RNHA 2OZSA 5T7BA 4DTRA 5D7UA 2HHUA 4O0IA 3RMAA 3HYFA 1NK7A 4B9VA 4KHWA 3C94A 4FJKA 5JS2A 1KFSA 1JXBA 1HYSA 3BDPA 4TSXA 4M45A 3ZSXA 1D8YA 2P51A 3OY9A 1QQCA 3HJFA 1IHVA 1RT6A 3O3GA 4AHVA 1CZ9A 3SV4A 3AVCA 3HT3A 3ITHA 4AH9A 1KSPA 2OPRA 4LH4A 1JKHA 4Z4CA 1HQEA 1Z25A 3OYMA 3LZIA 3VQ7A 3DLHA 4B9SA 3ZSYA 2YKNA 1C0UA 3SYZA 4FK2A 1L3UA 3MEDA 3NCIA 4HTUA 3PX6A 3RRGA 4FJNA 5FROA 5CY4A 1FKOA 1BHLA 1YT3A 3KIOA 2B6AA 3KD1E 3NGYA 3ZSRA 2IS3A 4KFBA 2HB5A 1GOCA 1T7PA 4E3SA 1N5YA 1IKYA 4CK1A 1KTQA 1YTUA 1DTQA 1U45A 1JLGA 3ZT2A 3O3FA 3LALA 2X74A 3OYIA 4DU3A 3K5OA 5DK5A 2XY7A 1XC9A 1XHXA 2D0CA 3L2QA 3WNEA 3KK3A 3VQEA 1S1VA 2Q3SA 2FBYA 3QEIA 4FJMA 2OPQA 2RKIA 4C8NA 1IH7A 3ZSVA 4M3ZA 1HQUA 3CYMA 4OGEA 2XHBA 4ZHRA 2DFFA 3SUPA 3AVLA 4NCBA 4Y1CA 3IRXA 4CGGA 2F8TA 3QEWA 1ASUA 2XO7A 1ZBHA 5CZ2A 3RR8A 4DQPA 4Q0BA 2KFZA 1T05A 3HO1A 1RDDA 3DYAA 3QIPA 1X9MA 4NYNA 1QHTA 3AVKA 1TL1A 5E41A 1VSLA 3MECA 3NE6A 2BDPA 1RCHA 1QSSA 4N5SA 3NFAA 1S1UA 1BL3A 3K57A 4KHNA 4M3RA 4EP5A 3V81A 1SKSA 3KLFA 1RBVA 2YKMA 3DM2A 4DF8A 1IHWA 3TAQA 3ASMA 2DTUA 4CIFA 4GVMA 2Y1JA 4CHZA 1J54A 1SL1A 2DFEA 4IBNA 2ETJA 2W42A 3TWHA 3SZ2A 4KHQA 1ZBIA 2X6SA 4W5NA 2D5RA 3VA0A 4FK0A 4CJWA 2G8KA 1JXEA 4N41A 4ELVA 4I9QA 2P5GA 4FM0A 3PO5A 3D45A 1WSEA 1WN7A 4CFBA 2HMIA 2HHWA 4HUGA 4B9LA 1VK0A 4B8AB 1RT5A 4BE2A 2LSNA 4KRFA 1Q9XA 3VQ9A 1FXXA 4FLVA 1C1CA 4CGIA 4CHQA 3HVTA 4DF4A 2QK9A 4CF9A 4E7JA 1EP4A 1SL2A 4C8KA 4AHUA 1UA0A 3QIOA 2IC3A 1TKZA 3LPTA 1LAVA 1DTTA 4ZTJA 1WNSA 3VQBA 4CE9A 1S1XA 2G8UA 2OZMA 3S9HA 1F21A 2HVIA 4CF0A 1SKWA 4F3OA 4W5QA 3KD5E 2HNDA 4OVLA 3KTQA 1HYZA 3ZSZA 1LV5A 2B5JA 1C6VA 2I5JA 1HJRA 2RF2A 3NHGA 4GMJB 2VG7A 3OYDA 1X9SA 4FJJA 5J2QA 2HNZA 1TK8A 1C0TA 4EP4A 4NCGA 4BE0A 4O44A 3A2FA 5C24A 2OPSA 3ZSOA 4CHPA 4BWMA 3QNOA 1S1WA 3SNNA 4CECA 3HPGA 3KKRA 1BI4B 1J5OA 4RW4A 3OS2A 1IKWA 4CJFA 3TARA 2JLEA 1MU2A 4DTUA 2O4GA 3AVIA 4CJ3A 5HRRA 3K5MA 4J2BA 4KHSA 4JRPA 1K6YA 1BIZA 3HL8A 4E1NA 3AVBA 3OYBA 1IKVA 3U6FA 2Z1GA 3PV8A 1EKEA 2FC0A 4I7FA 3SUQA 1NJYA 1IG9A 3HP6A 4FJLA 1EXQA 2A1SA 3K58A 3AVAA 4M3UA 2PYLA 1CZBA 3TAPA 4KI6A 3ZT4A 1DLOA 1TVRA 3T19A 4EZ9A 2X6NA 2FBXA 4DWIA 1LW2A 4FW1A 1EETA 3U3YA 4K8XA 1W0HA 1S1TA 2E6MA 3HM9A 4DSIA 1NK0A 1ITGA 4CEBA 4IKFA 4DQQA 4W5OA 2VWJA 4CGFA 3V4IA 3V9WA 2YNIA 2Z1IA 1SKRA 2F96A 4CJ4A 2G8WA 4FJIA 3OYHA 1TK0A 2KQ2A 4CIEA 4KHYA 5HROA 3LWLA 4XIUA 3VQQA 2HHSA 1D9FA 3HSTB 4IG0A 3AA5X 4DS5A 1Z26A 1RTIA 3L3UA 4LD0A 4OLBA 1UWBA 1CXQA 4I9LA 4FYDA 1JLAA 1RTJA 3KKSA 3KK1A 1JL1A 1KFDA 4CF1A 4B9TA 4BDYA 2D0AA 4W5RA 3B6PA 3PUFA 2FBTA 2EX3A 3I0RA 3OYNA 3WNGA 5FRMA 4DFPA 3S3MA 2G8IA 4KTQA 5I3UA 3KJVA 3SPZA 3LP3A 1FK9A 4CJTA 3F9KA 3NF6A 1WAFA 5KTQA 3NH0A 3NGZA 3RRHA 1U47A 1JLBA 3LPUA 3L8BA 4QAGA 4DS4A 3IAYA 4B3OA 4CEQA 1T8EA 3DLEA 3HP9A 4H8KA 4FZYA 3VQDA 4CEFA 2NUBA 1N6QA 4NCAA 2HHXA 1X1PA 5KRSA 4G1QA 4OPJA 1UA1A 1LWFA 4RW9A 2F8SA 4CF8A 1HMVA 4KTWA 4E7LA 4MQ3A 3LAMA 4OKEA 3V9ZA 4EZ6A 4FJHA 4LY7A 1I3AA 3WNFA 4CEOA 3L2RA 4KI4A 1ASWA 3LP1A 1NK9A 1WSJA 3AVMA 4CHNA 3AA2A 1WLJA 1B9FA 2E6LA 3AVJA 1VSHA 1L3TA 5C25A 1NOZA 1BISA 4LSLA 4OGCA 1L5UA 4HVJA 2YHBA 4ZTFA 2YNGA 3DI6A 3HXMA 4BE1A 3S3OA 4Z4GA 4LH5A 3VQPA 1B9DA 4Y1DA 4DU4A 1L3VA 1O1WA 1LWCA 4YFUA 1KRPA 3IG1A 1ZBFA 4OPKA 5D3GA 4OLAA 1S9GA 4F8RA 1VSDA 1EX4A 1RT2A 3DLRA 4QOZB 1ZBUA 2X78A 3KK2A 3SQ2A 3PX0A 2KZZA 1XWLA 3SV3A 5KRTA 1RILA 2XY8A 3AVHA 3SQ1A 4DTPA 4CJEA 3P83D 4DU1A 4B8CA 4CHOA 4E89A 3DOKA 1U4BA 1S5JA 3LAKA 3QEXA 4J2EA 1RBSA 4IFVA 5EU7A 1RBRA 5K14A 2IOCA 1VSIA 4HUEA 3QETA 4KB0A 3EZ5A 3AO1A 3ZCMA 3OYCA 3HVRA 4HHTA 1U49A 1XI1A 1RT7A 5J2MA 2A1RA 3AVGA 1QE1A 2OA8A 1KLMA 3TAEA 3EY1A 1JLEA 3VQ8A 1TAQA 3VQ5A 5DMRA 5HP1A 3AO4A 3M8QA 5CZ1A 3M8PA 2P1JA 5SZTA 1IKXA 3AV9A 3HPOA 2BE2A 3TAFA 1RBTA 3AO2A 4FJ9A 2FBVA 4KPYA 4IG3A 4AHRA 4ELTA 1BCMA 4OJRA 1ZBLA 1D5AA 4KB1A 4C8LA 3QO9A 4O55A 1A5VA 1HNVA 4E0DA 2HVHA 3OJUA 4CGHA 2IGIA 1IO2A 3DLGA 4M41A 2QKKA 3MEEA 4DTSA 1CXUA 1NK4A 5HRSA 5CYQA 4M3XA 3PY8A 5KI6A 4AILC 4F2RA 1Y97A 4DLEA 3AO5A 4DSLA 1LW0A 2PY5A 1S6QA 3DRPA 1NJZA 4PA1A 3I0SA 3PO4A 3CQ8A 3ZSQA 5HRPA 3TAMA 3SQ4A 3EYZA 2BANA 4J2AA 4H4OA 4WE1A 1J53A 4M3YA 3DLKA 1YTAA 3THVA 4O0JA 3NGIA 4FLWA 4F3TA 2WOMA 4DQRA 4KREA 1U04A 3C95A 5CYMA 4BDZA 3RMDA 4Z0UA 1HPZA 4FZZA 4QCLA 2KTQA 3OYFA 3DLBA 3CFOA 2XY5A 4HCCA 4FW2A 4CJ5A 5HRNA 4DFMA 3LP0A 4JS5A 1RT3A 1TK5A 4DFKA 3D0PA 1HRHA 3QESA 3MXMA 1NKBA 3M8RA 4PY5A 2QXFA 4DQIA 2KW4A 4CK2A 4FJGA 3HPHA 1A5WA 1JL2A 1LWEA 1KVCA 1TKTA 4CJPA 2E4LA 2XRIA 2Y1IA 2HHTA 4CGDA 4YNQA 2RN2A 5C42A 3SQ0A 4CFCA 4ICLA 3TAGA 4JLHA 3NDKA 3SJJA 3I8DA 3RMBA 3KLEA 1C6VX 1CLQA 3QEPA 2OYQA 3CFRA 2HNYA 1GOBA 1VSFA 3SUNA 2Z1HA 3CFPA 1KLNA 4KO0A 3CG7A 2D0BA 4M3WA 4FXDA 4CFDA 4IDKA 1C1BA 3NF7A 3VQAA 1S6PA 3L3VA 3CM6A 3AVNA 3ISNC 3MEGA 5HBMA 4AHSA 4CERA 4E7HA 5I42A 4B08A 2P5OA 4FK4A 3OYKA 4F4KA 4GW6A 3NBPA 1S9EA 3OYLA 3SUOA 4ELUA 3JYTA 4OKJA 2KZMA 4M3TA 3AO3A 4DSJA 1Q8IA 3TABA 4M42A 1WSIA 2GBZA 4CEEA 4DTXA 3ZSWA 2OPPA 1I39A 4JS4A 3NH1A 3K59A 1TAUA 1X9WA 2DY4A 4E19A 3VQCA 3LZJA 1JLFA 1B92A 3SI6A 1UAXA 4MFBA 1BI4A 1NOYA 4L8RB 1WSHA 2VWKA 1NJXA 4FLTA 2QKBA 4CK3A 4FJ7A 2PZSA 4I2PA 4JRQA 2IDOA 3NF9A 4FLUA 3PX4A 3NF8A 4DQSA 4CJUA 4KAZA 3UIQA 1HYVA 4CJSA 3DRSA 3FFIA 2VG5A 1RTHA 3QINA 3BGRA 3G10A 5KGWA 1XHZA 4Z4FA 3VN5A 4J2DA 3VQ4A 2YNHA 2ATQA 3KLHA 4W5TA 3F73A 4C8OA 4K8ZA 4DTMA 4FZXC 4RG8A 1SV5A 1KCFA 3E01A 4CJKA 5J2PA 1BQNA 1SUQA 2XY6A 1QTMA 2G8FA 1VSJA 3P5JA 4DMNA 4O5BA 4N56A 2AJQA 4FLYA 1RDCA 2G8HA 3KLGA 4DLGA 1VSEA 1RDBA 3MXJA 3OYAA 1UOCA 1REVA 2IAJA 3LP2A 2Z1JA 5SWMA 3V9UA 3RR7A 4FJ8A 1BIUA 4PWDA 3RTVA 3ZT0A 4DTOA 2G8VA 1RT1A 4FVMA 4B9MA 4I2QA 4CHYA 4CJRA 3LDSA 1BCOA 1KVBA 1WSFA 3T3FA 2EHGA 5KGXA 3QERA 3U3GA 4O4GA 1ZYQA 2GV9A 3V1OA 3OYJA 2VG6A 4N47A 4E1MA 2B4JA 3ALYA 3K5NA 3V9XA 2WONA 4DSEA 4B9UA 3NH2A 2O4IA 4R5PA 1C1AA 4CFAA 3K5LA 1RBUA 3TI0A 4CESA 1NKEA 1BQMA 3AVFA 3G0ZA 3LANA 4CEDA 4DTJA 5JS1A 1A5XA 3DMJA