1EX4A

Hiv-1 integrase catalytic core and c-terminal domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
212
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACDWAGIKQEDGIPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNSLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Crystal structure of the HIV-1 integrase catalytic core and C-terminal domains: a model for viral DNA binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 49
structure length 212
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ex4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ex4A01
1J53A 2QKKA 3DLHA 2FBYA 4HCBA 1C0UA 1C6VX 1WAJA 2Z1IA 3LPTA 4CFCA 3U3YA 4FJ7A 1ITGA 4W5RA 1QTMA 3PY8A 4OKKA 3VQDA 2G8FA 3QETA 4DS5A 4DS4A 4M3ZA 3OYJA 4B08A 3DLBA 4PUOA 3LAMA 4O5BA 4LH5A 1U45A 1WSGA 2PZSA 3LZJA 3ZSYA 4BE1A 2YNFA 3K2PA 3O4NA 4E3SA 4B9SA 2A1SA 3ZT4A 1IG9A 1TL1A 3DRRA 3HXMA 4AHTA 3SV4A 3SV3A 1REVA 4TSXA 3OYBA 3ALYA 2JLEA 3AVGA 4CJLA 1ZBLA 2KFZA 1NK0A 3NF7A 4BDPA 1HQEA 1GOAA 3K5OA 3O3GA 4Q0BA 3KLFA 2IC3A 5C25A 4M42A 3NH0A 1A5VA 3AVAA 2OPRA 4GMJB 4CF1A 3OS1A 1T05A 1C1BA 3I0SA 5HP1A 3AVFA 4J2DA 3V81A 4DSLA 2VWKA 4M3UA 4G1QA 3BGRA 2KQ2A 2G8KA 3BDPA 1QS4A 4BDYA 2E4LA 5KTQA 4M3TA 1A5WA 2BANA 4YFUA 1RDCA 4CJ4A 4E1NA 1RT1A 3QESA 2A1RA 3V9SA 4EZ6A 1FXXA 4CESA 4CHQA 2D0AA 4CFBA 3OYMA 3AO5A 4KAZA 3LPUA 4DSJA 4E89A 4CJTA 1K6YA 4DU1A 3RWUA 1NOZA 1RBRA 1L3VA 4BACA 2FBVA 4PA1A 1NK7A 1LWCA 5HBMA 1HYSA 5EU7A 2BGGA 5KGXA 1XHXA 4M3XA 1BI4A 3OYIA 4C8KA 4Z4CA 3O3HA 1WSFA 1SL1A 4CJFA 4ZTJA 1ZBIA 3WNFA 2XRIA 3AVKA 3L8BA 4W5NA 3L2UA 4HUEA 4Z4HA 1TKTA 3WNHA 4OGEA 5HRNA 4ZTFA 3RR7A 3UIQA 4BWMA 3CFRA 4FJKA 2X78A 4AH9A 3KLHA 4F8RA 1RT7A 4CJ3A 1RBTA 3NCIA 4L8RB 3AVIA 2D0BA 1S1WA 2KW4A 2JGUA 1L5UA 3HPHA 4E0DA 1NK8A 5C24A 4CHYA 5HRPA 3RTVA 3ZT1A 3NE6A 1JXBA 1U48A 5KGWA 3CQ8A 1NK6A 1IO2A 4DLEA 5HLFA 3WNGA 4Z4GA 1TAUA 4RW6A 4WE1A 5J2MA 4AHRA 4BDZA 2P5OA 4DF4A 3IAYA 1YTAA 1HJRA 2ETJA 1L3SA 5E41A 2YKMA 4AILC 3CM5A 3TWHA 1J9AA 4PY5A 4K8ZA 3S3NA 4DG1A 3K5LA 4FLXA 4FZZA 3SNNA 4DTMA 3L2RA 3NGIA 4CGFA 3NH2A 4YNQA 3QNNA 3KJVA 1WN7A 3PX4A 3AVHA 3DRPA 3DI6A 5HRSA 1JL1A 3AVLA 1LAVA 3JYTA 1RTHA 4FJNA 3AA3A 3THVA 4ID1A 4CEQA 3ZSXA 3ISNC 4E7KA 3K59A 1UA1A 4F4KA 4QCLA 3HP6A 4OJRA 4CF0A 4M41A 4CFAA 3DLEA 1BIZA 2YNIA 3PO5A 4EP4A 1VSHA 1RNHA 2O4IA 1NJYA 1TK0A 4CE9A 3DLRA 3NF8A 1C1CA 1J54A 3OYCA 1C6VA 1TVRA 4FLTA 4KFBA 4OKEA 4E7JA 2KZZA 4DFMA 1WNSA 3LAKA 1RCHA 1NKCA 2XY5A 3RMAA 2DFHA 2HNYA 4Y1CA 1TAQA 4OVLA 2HHWA 1TKZA 3OYGA 2GBZA 2RF2A 4JRQA 1UWBA 4MFBA 4C8NA 3TAFA 1I39A 2P1JA 3OS2A 2FC0A 4CIEA 5KRSA 3ZCMA 4DF8A 4B9MA 3DMJA 1ZBHA 4CGDA 2YHAA 4CJEA 1JLEA 1XWLA 2BDPA 4ELUA 3NFAA 1YT3A 3OJSA 3QEWA 3C6TA 5CZ2A 1T7PA 2F8TA 1QSLA 3SYZA 3DOKA 3CFOA 5CY4A 3VQ5A 3ULDA 4CJSA 1VSJA 5D7UA 1BL3A 2YHBA 1WLJA 4XIUA 2NUBA 1FK9A 4FZYA 3VA3A 3SPYA 4J2EA 2ATQA 3LP1A 4AHVA 2YKNA 1LV5A 2DFEA 4CFDA 3IG1A 1N5YA 4DFPA 3K5NA 1JLCA 4M3RA 4DSKA 3VQEA 1VSKA 4CGHA 3WNEA 4CHNA 3SPZA 1TV6A 4PWDA 1L3UA 4C8OA 4HTUA 3AO2A 3I0RA 1B9FA 3TI0A 4DFJA 2RN2A 4H8KA 3SUQA 2HHTA 4UQGA 2QXFA 1RILA 1CZBA 3ZSRA 5HROA 4FJIA 2ITGA 1SUQA 1VSFA 1HRHA 3SQ1A 3A2FA 1Z25A 3I8DA 4KTZA 1N6QA 4QAGA 3QEVA 2OYQA 1ASWA 1BISA 2XY7A 1KFDA 3FFIA 3TR8A 4CK2A 4QOZB 1IKWA 3SQ4A 3L2VA 1D9FA 3SQ2A 1JLQA 3TAMA 4BE0A 2Y1JA 4HCCA 4KHSA 1C1AA 2G8IA 1SL0A 4CJWA 4M3WA 5CYQA 4FJXA 2WONA 3AVNA 4W5QA 2I5JA 4CHPA 1LW2A 3V9XA 1KLMA 3QEPA 3PX6A 3KLIA 1IKXA 2OA8A 3LANA 4FLVA 4CEOA 3L2WA 4DTXA 3HO1A 4O0IA 1CLQA 3L2QA 1L3TA 3C95A 1VK0A 2FBXA 4M45A 4AHUA 5KRTA 2P51A 3MXJA 3RRGA 3ZT0A 3HT3A 4O44A 2YV0X 1CXUA 3KKRA 4FM2A 3TABA 3SJJA 4B9VA 4NCBA 1NJXA 1KRPA 2IDOA 3V1QA 4OPJA 2XHBA 4BWJA 4AHCA 4DQSA 3ZSZA 4H4OA 5I42A 3P5JA 3TANA 4IFYA 5FROA 2PYJA 2X6NA 4HUGA 4N76A 4OPKA 1EX4A 4CGIA 3TAQA 3QEXA 4Q5VA 3NGYA 1RBSA 1TKXA 1KVAA 5DK5A 4CJ5A 4PQUA 1VSLA 4CIFA 4DSIA 4Z4EA 4HHTA 3MEDA 3M8SA 1JL2A 1JKHA 1QE1A 2RPIA 4DMNA 4E7HA 4K8XA 4FYDA 3KLEA 3PV8A 4DQPA 1IKYA 1BGXT 1TKDA 1A5XA 1HYZA 4HVJA 1EXQA 3AVMA 4DTSA 1NOYA 1VRTA 2GUIA 2HHQA 4IG3A 1SKRA 3QINA 2HHVA 4W5TA 1LAWA 5J1EA 3HPOA 4DQIA 3SUPA 2IS3A 1RTJA 2HHSA 1XC9A 5J2QA 1KVBA 4DTNA 1XHZA 3P1GA 4F2SA 2HMIA 1I3AA 2X74A 4RW8A 2ZD1A 1BHLA 2P5GA 1W9HA 4KREA 4HUFA 3ITHA 4AHSA 4CEBA 4RG8A 3AVJA 3PX0A 4NYNA 1T8EA 3DLKA 1KLNA 4ZHRA 5T7BA 3OY9A 4DU3A 1JLGA 1U4BA 3LDSA 2OPSA 3OYLA 4E1MA 3QERA 4DFKA 3V1RA 4FK4A 4FK0A 3QO9A 4C8MA 1HPZA 3IS9A 2OPPA 3QNOA 4I2PA 2F96A 4E7LA 1Q9YA 2IGIA 3RMCA 1NKBA 2GV9A 1S1TA 4CJVA 1S6PA 3EY1A 3HYFA 3S3MA 4FLUA 3S9HA 3OYKA 3KD1E 4CEEA 3NH1A 4IDKA 3AO4A 4B9UA 1BCOA 1SV5A 2XO7A 4Z0UA 2OZMA 3HSTB 3HVRA 3T1AA 1U04A 2PY5A 3SCXA 2E6LA 4FLWA 2ZQBA 3AVCA 4ELVA 1HNVA 4LSLA 5DMRA 1SKWA 1J5OA 3TARA 1JXEA 4KB0A 4KI4A 3HVTA 4DWIA 1VRUA 4DQQA 4LH4A 2HB5A 1U47A 2KZMA 4KKOA 1S1XA 3CG7A 1KCFA 4CJQA 1RDAA 1EETA 2Z1HA 4LY7A 3F73A 4FJ8A 3KK3A 1B9DA 1TGOA 4OLBA 1DTQA 2AJQA 1KSPA 4DSEA 1QHTA 3RMDA 4FJHA 1U49A 1SKSA 1EP4A 3JSMA 1HQUA 3QIPA 3SI6A 3QLHA 4FJLA 1CXQA 3DOLA 3NGZA 1KFSA 5HRRA 2DFFA 3C6UA 1ASUA 1DLOA 1GOBA 2R7YA 3TAEA 3OYAA 4GVMA 1RT5A 3HK2A 5FRNA 3K5MA 1NK9A 3OYEA 3AVBA 4JLHA 1BIUA 4CK1A 1IKVA 2B6AA 2D0CA 1MU2A 4RW7A 1YVUA 2YNHA 3SZ2A 1RT4A 3NAEA 3HL8A 1BCMA 2XY8A 4CEFA 3B6PA 1R0AA 1IHWA 3C94A 1Z26A 2OPQA 3AA2A 4LD0A 3OYFA 2RKIA 3NHGA 1X9SA 4N47A 4CEDA 4I9QA 4CHOA 2ZE2A 4CHZA 2B4JA 3MXMA 3EYZA 3DRSA 3HPGA 1BI4B 1VSIA 4LSNA 3VQBA 4E7IA 4DTRA 3KD5E 2DTUA 4CEAA 1NJZA 4RW4A 1WSIA 1RBUA 2EHGA 3OYDA 3HM9A 2G8HA 1UAXA 4N5SA 1RDDA 1W0HA 3OYHA 3NDKA 4FW1A 4DLGA 3ZSQA 5JS1A 1RDBA 3NF9A 3VQ9A 3S3OA 3M8PA 3PO4A 3MXIA 3LWMA 4ID5A 3OVNA 4O55A 3L3UA 4CGJA 5J2NA 5SZTA 5J2PA 2BE2A 3VA0A 1T03A 4F2RA 4FJJA 4Z4IA 2D5RA 1XI1A 1D5AA 5JS2A 1C0TA 3SUNA 3D45A 4B8CA 4NCGA 2B5JA 3T19A 4DQRA 3SUOA 3E01A 4KHYA 1KVCA 2HHXA 2HHUA 4EP5A 3AO1A 3VQ7A 3ZSVA 1ZYQA 3V9UA 4KHQA 4M3YA 3HJFA 1DTTA 3AA4A 3AV9A 1S1VA 3NF6A 4Y1DA 1ZBUA 5KI6A 3LWLA 4B3OA 1BQMA 1FKOA 3LZIA 1HMVA 2LSNA 1S9EA 2VG6A 4OGCA 3KK2A 1LWEA 4J2AA 4I7FA 4IBNA 4FK2A 4CJRA 3ZSOA 3AA5X 4CEZA 2PYLA 4B9LA 2HVIA 3HP9A 1YTUA 1F21A 4JRPA 1LWFA 1JLBA 2HNDA 2IOCA 4C8LA 4N56A 1TK5A 1RT6A 4DTUA 2QKBA 4CJKA 1RTIA 1G15A 3M8QA 3U3GA 4CERA 1D9DA 3T3FA 3B6OA 4CCHA 4FJGA 4O0JA 1Q9XA 3RRHA 4E19A 3QEIA 3KIOA 5CZ1A 4FVMA 2O4GA 1IH7A 1S1UA 3MEGA 4KB1A 2F8SA 4FXDA 2IAJA 3VN5A 3P83D 4CECA 3V9ZA 1O1WA 1VSMA 3G10A 4FCYA 3LP2A 3VQPA 2VWJA 3V9WA 3V4IA 2HW3A 3VQ8A 2KFNA 2VG5A 1RT3A 2EX3A 3VQQA 3NBPA 3V6DA 1D8YA 4KTQA 3ASMA 4FM0A 1BQNA 3CFPA 3LP3A 4B9TA 3G0ZA 1WSEA 4O4GA 4CF9A 4KHUA 2Q3SA 3QIOA 4I2QA 1Q8IA 4NCAA 1WSJA 3LP0A 4KO0A 4CK3A 3K58A 2G8VA 4EZ9A 2KTQA 4DTJA 3KTQA 3TAGA 1WAFA 5I3UA 4OLAA 4B8AB 2FBTA 1QSSA 3LALA 3VQ6A 4J2BA 4FJ9A 4KV8A 1FKPA 3V1OA 1IHVA 3KKSA 5C42A 1NJWA 1NKEA 1EKEA 2G8WA 4KPYA 2Z1GA 1TK8A 3KLGA 4CGGA 4GW6A 4CF2A 5D3GA 4I9LA 4FLZA 4FW2A 1KTQA 3DYAA 3IRXA 1UA0A 1X9MA 1X1PA 2VG7A 1JLFA 2OZSA 3VQAA 4CJPA 4KI6A 4FJ5A 4CJUA 3D0PA 1GOCA 4KHWA 1NK4A 3OYNA 1TL3A 1NK5A 4CIGA 3DM2A 4KTWA 3VQCA 1UOCA 1VSEA 3H08A 2W42A 1SL2A 1JLAA 4F3OA 4N41A 4W5OA 3OJUA 1B92A 4B9NA 3O4QA 1HNIA 5FDLA 3U6FA 4FJMA 4JS4A 3VQ4A 4DSFA 3MECA 3PUFA 3CM6A 2HVHA 5CYMA 4ELTA 4KRFA 3EZ5A 2YNGA 2E6MA 4OKJA 1QQCA 3O3FA 1WSHA 2G8UA 4MQ3A 4NYFA 4JS5A 1CZ9A 3RR8A 1QMCA 4FZXC 5K14A 3ZSWA 2X6SA 1QSYA 1C0MA 4RW9A 2WOMA 4CF8A 4IFVA 3OS0A 4DTOA 2QK9A 2DY4A 4BE2A 2Y1IA 4Z4FA 4KHNA 3F9KA 3KK1A 4IKFA 5FRMA 4F3TA 1S5JA 3K57A 4FLYA 1HYVA 1ZBFA 4ICLA 3SQ0A 4IG0A 3AO3A 1VSDA 3MAQA 4FM1A 1RT2A 4R5PA 1RTDA 3ZT3A 3DLGA 3ZT2A 2Z1JA 1X9WA 1RBVA 2HNZA 4DTPA 1S9GA 3MEEA 2XY6A 3TAPA 1ASVA 1LW0A 1S6QA 3CYMA 5SWMA 4H4MA 1Y97A 3M8RA 3L3VA 4DU4A 3RMBA
chains in the Genus database with same CATH superfamily
2EVRA 1PM3A 3U3YA 2ASPA 4CFCA 2KXCA 3A1PA 2ZAEA 4A4GA 4M7YA 4JLGA 4DS5A 4DS4A 1RLQC 4PUOA 3DAWA 3LAMA 1Y57A 2NRXA 2BE7D 1NM7A 3PSIA 4BE1A 4FL9A 5LJ5f 5FPDA 2YNFA 3TSZA 2A1SA 2QQSA 1IG9A 3DRRA 1M1GA 3SV3A 1FYNA 4FM1A 2A3LA 1SS6A 3ALYA 3AVGA 2NLXA 1ZBLA 4JI4K 1BK2A 1NK0A 1D0YA 3A8GB 2FL7A 4CZEA 4BDPA 1H641 3AT1B 1GOAA 3HOSA 4Q0BA 3KLFA 3LLRA 1YWOA 4XTXA 3CCLA 2OPRA 3AVAA 3WVEB 3CPFA 4IEEA 3LL3A 4IUTA 4PKGA 1C1BA 4JKFA 2PBDA 3T1HK 1KC8R 2NRVA 1WGSA 4AG1C 1H1VA 1KAXA 2NRRA 2OTJT 3SK3A 3VESA 3CCQN 4PL6A 4DB3A 3CBPA 2KQ2A 1M5Q1 4U67L 4HVWA 4C92F 2EKHA 1M3CA 3LYIA 1WIEA 5ADXH 5KPTA 4M3TA 1I81A 2BANA 5AQRA 1RDCA 4YFUA 2UXBK 1E3MA 1RT1A 2EAYA 3QESA 4OMNA 3I55A 1M1KU 2PFUA 3CD6Q 1ARKA 4O5FA 3EFRA 1M2VB 4CHQA 2F2VA 1EIFA 4Z88A 3D6RA 3LPUA 4XH1A 4A54A 4CJTA 1VQNT 2GUPA 1NOZA 4I6MA 5BRFA 2K5LA 1RBRA 2LNHB 1LWCA 1VQMA 4JAXA 2JTFA 3L42A 5EU7A 2GTDA 3ULEB 2LX9A 4B1ZA 4QVZA 4GBQA 4M3XA 1O13A 3OYIA 1BI4A 3THKA 5GADP 2YUOA 3AVKA 4OMOA 1TUCA 1AT1B 1OVQA 4KUDK 1WQ7A 2CS7A 2HBKA 3WNHA 5HRNA 1OPKA 4J8FA 1YFNA 2JS2A 5AR0A 4M75E 1SPKA 1D4XA 1U5SA 2VC8A 4PL8A 2LVMA 3KLHA 3NCIA 4IO9L 5KCOA 2YXYA 1VA7A 3NHNA 2WUSA 4YOUA 1JJ2M 4F7UE 2KW4A 2XDDA 5KQDA 4NLBA 1C0GA 1OU9A 5C24A 1AWJA 1BB9A 1QP2A 3A8OB 2JS0A 4CHYA 3VERA 3RTVA 1MMDA 4J9FA 1JXBA 5GAMd 2ASOA 4FSXA 4GKKK 3E19A 1UGPB 1IO2A 4DLEA 3O5ZA 4X9CA 3CCJT 1TAUA 1O9SA 2JNGA 4RW6A 4WE1A 3FZFA 4AHRA 4Y0WA 3MKDA 1RAGB 4BDZA 2A6AA 3G1JA 5D6YA 4AMCA 1HK9A 5E41A 2LC4A 3OYYA 4FVUA 5M1FA 1J9AA 2RMOA 2CT4A 1NMDA 4BRAA 4JPBW 4RTFD 2F4VK 2GWJA 2L8DA 1VOMA 4JKEA 4YNQA 3EGDB 3QNNA 2E5LK 3AVHA 3DI6A 4YOVA 1GLEG 1JL1A 3ZYYX 1LAVA 3A5NC 2WTUA 4FJNA 3HFOA 3AA3A 3THVA 3META 2L3RA 1NLVA 2OANA 3KVGA 2F2WA 1UA1A 1N9RA 3GPLA 4OJRA 3LX7A 1KAYA 3SMPA 2DIQA 3PMTA 2PVDB 1BIZA 3PIPL 1W7AA 5EVZA 3NTIA 1B3QA 4LE9A 2CZ7B 4ELZC 3P8DA 3MWTA 4ISGA 2O4IA 2J6OA 5FU7C 1QW1A 1SKUB 3HSCA 4K25A 1NJIR 2K7AA 3DLRA 2F9WA 3OHRA 5M1OA 4F04B 1TVRA 4GLMA 1QVPA 3SB2A 1M90C 3GDQA 3VYGA 4FLTA 3QB0A 3THWB 2VYPA 1BI1A 1RCHA 4BC2A 2KMTA 2DXBA 4Y1CA 2HHWA 2YUPA 1TKZA 3G71Q 3OYGA 4JRQA 3V8KA 4MFBA 2CH6A 3TAFA 2O8FB 4C8QF 3QBXA 3EGUA 4C92E 1ATRA 5KRSA 5DM7L 1I94K 2BDPA 3WT0A 4GY2B 1GLAG 4KHPK 5ECAA 2E2OA 3OJSA 4LF4K 3QEWA 4PKHA 2J06A 1VYTA 3CC2Q 1QSLA 1X27A 3H45C 1VQ9A 1HD3A 4AFUC 3CFOA 3JCMV 3HTVA 2O01E 5BR8K 2JN0A 1ZSZC 3TSUA 3VS0A 1J3TA 1BL3A 4XEIA 4CJSA 4XIUA 3CCST 3I33A 2Y4YA 2C0OA 1EWRA 1X6OA 4XU0A 4CI0C 4JKBA 3K9JA 3JB9D 3SPYA 4J2EA 1YHQT 4E7SA 4MMKA 1FWZA 2YKNA 4CFDA 1AOJA 2A37A 2NUZA 3EGDA 2EPDA 4U7BA 3K5NA 4M3RA 4ILJA 4ISFA 3R3LA 3WNEA 4CHNA 5GAN8 1G3SA 1QWEA 4II1A 4JK8A 4R79A 5EOYA 2VQEK 4UQGA 3ATUA 3ZSRA 3PIPA 1CZBA 4YDUC 5HROA 2L3QA 4FJIA 3SQ1A 5LJ3e 3I56Q 4NL3A 3E9PA 3OA6A 3A98A 1ASWA 8ATCB 1OULA 4M7AF 3TR8A 4FWQA 1IKWA 3OMCA 2P9SB 3LWHA 1D9FA 4KHSA 2G8IA 3HRUA 1OOTA 1C1AA 1VYVA 2E6NA 2FYKA 2FF6A 1ATSA 4FOEA 1VQ5Q 5CYQA 1BA1A 3AVNA 4CHPA 2CP3A 5F2RA 1LW2A 2P9NB 3VS6A 4PJMA 2OA8A 3DJCA 3LDLA 4CEOA 2CGLA 2HSPA 5GAN2 4H03B 5FU6C 4M78C 2K2MA 1IGUA 5KYNA 3MDQA 4M63C 3C95A 4LDWA 1VK0A 4M45A 1U06A 1XQSC 2P51A 4AHUA 5DY9A 3HRTA 3DXMB 2P0PA 3H46O 2YV0X 4NCBA 3JCMf 1NJXA 2EQIA 4QQDA 2IDOA 2YJFA 2QWNA 2XHBA 4DQSA 3ZSZA 4H4OA 2MWOA 2E6ZA 4GVEA 3PFSA 4XQ3A 3DWLA 1GLCG 2P9IB 4CGIA 2RHZA 3G4SN 4Q5VA 1RBSA 4CD3A 2MIOA 2EIFA 4GV6A 2F1LA 4FPBA 1W2BP 3CERA 4HHTA 4FYXB 1JKHA 2RPIA 4DMNA 1NJIO 4JDSA 2RNAA 2WSFE 1KG1A 1TKDA 1HJOA 5CE3A 1A5XA 2QW9A 5AQKA 1SHGA 4BUGA 3GIBA 1VRTA 2HHQA 1SKRA 2DTIA 2W6LA 3QINA 4JHDA 2HHVA 5IHNA 3KK7A 1LAWA 5J1EA 1PD0A 4WQ4C 1O75A 2DVJA 4DQIA 3ZETA 2RHKA 2HHSA 1WNLA 2P9SA 4C8QE 2GF7A 4F2SA 1N33K 3VS3A 1G5VA 2X74A 2ZD1A 2QTXA 1W9HA 2XHCA 1VQKN 5GANj 4CEBA 1T8EA 3DLKA 2NLUA 4BD3A 3FZMA 4ZHRA 3OY9A 2I7NA 1YI2A 3ZFJA 4DU3A 2DNUA 4XU1A 2HOEA 3MPUB 3LDSA 3UKUA 1ZUYA 3V8LA 3OYLA 5GAN6 4BRNA 3WXJA 3QERA 3V1RA 4NOYA 4C8MA 3VEWA 2MWPA 3IS9A 3QNOA 4I2PA 2AZSA 3CPWP 1Q9YA 3EG0A 4XH5A 2IGIA 2QA4T 2JTMA 4CZJA 3V7RA 4FLUA 1P92A 4HCKA 3R6NA 5GAMh 3KD1E 1ZSZA 5I2MA 1K9MR 3CJ1A 1CKAA 4J9BA 5KE3A 1VQLQ 2IVNA 3QICA 1K8AO 2PY5A 4FLWA 2IG0A 3AVCA 4ELVA 3QDKA 1M30A 1BIAA 5DMRA 4BRMA 5BN8A 4KB0A 2EGCA 4PJOC 3WQTA 2JT4A 1QVGM 1YBYA 1UDLA 5BPNA 4DQQA 3J7AF 3JCMb 1VQON 3CCET 4M7AE 2HB5A 1YJNN 2KZMA 4CJQA 2XMFA 2GELA 2GWKA 4LY7A 2K6DA 1KQ2A 3U8XA 1DTQA 2AJQA 5IH2A 5GANf 1KC8C 4YDUA 4DSEA 3RMDA 3O08A 1U49A 1SKSA 2ECZA 4IUQA 3JSMA 3CCLN 1NYFA 1OPLA 3QIPA 2QEXN 4WF9L 3CMAT 1SRLA 4QQGA 3HFNA 1QVFS 2DFFA 1ASUA 2LT1A 2FVUA 1DLOA 3C6UA 3A0IX 4H5RA 3ZEUB 4FIBA 1ZBSA 5JICA 4ISEA 3K5MA 4JLHA 1IKVA 4A4HA 4DBFA 2D0CA 3CCMN 3DLMA 3NAEA 1BCMA 2XY8A 2QWLA 4J9DA 4FYWB 2OPQA 2ZGWA 3OYFA 1CKBA 4M78A 3CCVQ 3F9MA 4LD0A 3SLCA 3TTFA 1NNEA 5JMVA 2E88A 3MXMA 2W0ZA 3HPGA 1QZ5A 3B8AX 2DTUA 3OYDA 4FSVA 2A08A 1RBUA 4BC3A 3TSWA 2QWRA 1SG5A 1WPYA 3CCQT 1QQJA 3H0HA 4HVUA 5J3BA 5GMKl 1G2BA 3S3OA 5HL7L 3BF1A 3TVTA 3OVNA 4JI7K 4O55A 2KBTA 2O2OA 5IN1A 2SEMA 1T03A 2QTVA 1XNQK 2AK5A 2M02A 2E3HA 3FB9A 3SUNA 4BG9A 4OB2B 4B8CA 4LNPA 4Q5WA 4LD6A 3ZX2A 4C1NK 4DQRA 4D6WA 4WCEL 2AT1B 1KVCA 2YHWA 2KDSA 5CAIA 4M7DG 1AD5A 4B1VA 4EP5A 4M3YA 3V9UA 2VWBA 1DTTA 3AA4A 1S1VA 1HR0K 3HHTB 4A53A 2KRNA 4JRKA 4DBRA 3AHUA 3UA7A 1BQMA 2LSNA 3KK2A 2W41A 3ZX3A 3QJ6A 4WQ4A 4IBNA 4FK2A 1MGQA 2A41A 5C12A 1D1BA 1VQ7N 4RMOA 1QHAA 3ZEUA 1JLBA 4JI2K 4C8LA 1N5ZA 1FX7A 2DZCA 1HX1A 1TK5A 1G3TA 4F16A 4M7DB 3M8QA 3U3GA 4CERA 1D9DA 1VQPQ 1AZGB 1QVFA 4UY8O 3SWNC 1WXUA 2DXUA 4J6XA 4FVMA 1R8OB 1UFFA 4MLEA 5AZJA 3VS4A 4CECA 3V9ZA 3G10A 3OSSC 4ELYC 4FCYA 4CBXA 1MMNA 4ORZA 1K1ZA 2KRSA 2AHJB 1IRXA 1RT3A 2EX3A 3V6DA 3VV0A 1D8YA 2GFUA 2DM1A 2QGGA 3ASMA 4KGXB 1K0SA 3KHYA 1EFNA 3CFPA 3DLLL 2D8HA 4B9TA 3NFCA 4MDWA 2O88A 2F9TA 4Z94A 3LW5E 4RTZA 2MAMA 2B86A 3LDQA 4KO0A 3QHSA 2KTQA 4DTJA 3QPHA 3ENBA 2CGJA 4X64K 4Y28E 4C5IA 5I3UA 1R0CB 4OLAA 1JCGA 3VQ6A 3BE3A 4J2BA 1D0XA 1FKPA 3ER0A 1IHVA 1TYQA 5C42A 2O8CB 2BUDA 4EHUA 3O80A 4KPYA 1ESVA 2AIRB 1OX8A 4PKCC 4I9LA 4FW2A 3DYAA 2JMCA 3GP8A 3VGKA 1X9MA 2P0KA 1X1PA 4KI6A 4CJPA 2GCXA 4KHWA 3ZBDA 4EMKC 3FGUA 3ENOA 2RJFA 3OYNA 3CXCS 1TUGB 3M5AA 3PMIA 4BVOA 2A28A 1VSEA 2W42A 1H92A 4F3OA 4DR4K 3T1YK 1JQQA 1VQ8Q 4B9NA 1HNIA 1YJ9A 3GF5A 5KYYB 4C5GA 4DSFA 1H8KA 2CZ1B 2KGTA 3REBB 3CM6A 3MECA 3PUFA 4PL7A 4WFAL 2D0PA 1W2BA 5JLFA 3EZ5A 3U4LA 2E6MA 1K73U 1QQCA 2H8HA 1IG8A 3R6MA 5DM7R 2G8UA 2FF3B 2LZ6B 2NUTB 1CZ9A 3RR8A 3QDRB 1GL5A 3GNGA 5CKHA 5K14A 4E2FB 3MEUA 1Y71A 5AQLA 4DTOA 3EG9B 3DLLA 2Y1IA 3F70A 4CC3A 4F3TA 3V8JA 1ZBFA 3M0RA 4IG0A 1K4US 1VSDA 3SBTA 1D09B 3G6EA 1RT2A 3SJHA 3ZT3A 3VPZA 4BR4A 2FSJA 3CC7N 5M9OA 1S9GA 3MEEA 2XY6A 3KZBA 2K3YA 5LJWA 5I11A 1KQSM 2CUBA 4KBOA 3RMBA 1J53A 2RD1A 2O8CA 4HCBA 2CP6A 4MZMA 2Z1IA 3C7NB 1ITGA 4EDUA 4LFCK 1GBQA 1QTMA 3PY8A 1UGQB 4A57A 3VQDA 2G8FA 3QETA 2CDTA 2K5FA 3VEZA 3CPWA 4M3ZA 3O8VA 3OYJA 1QP3A 2KI7A 1Q18A 4O5BA 5GAOn 1D3BB 1WSGA 5CO7A 3BDUA 3LZJA 2PZSA 5LJ5d 3O4NA 4E3SA 2DL3A 2X4XA 3HXMA 4ILGB 4AHTA 3A8LB 3SV4A 1REVA 4X62K 4BGAA 4QVCA 3SWNA 1WHJA 3M4GA 2HHHK 3H1VX 3O3GA 4JI6K 2LDMA 3HRSA 3E1YA 4OPAA 1YNZA 4FPAA 1HNWK 1OV3A 2YSQA 2NUTA 1SAZA 4LDUA 4DKWA 3CCLQ 2NNWA 2DERA 2VXFA 3CHWA 4PNOA 4HT9A 1YIJN 4J2DA 2A7YA 5GAGP 5GIOA 1TXQA 3V81A 4DSLA 1QLYA 2VWKA 3EG9A 3RMQA 4G1QA 4JKGA 2VQFK 4B3RK 1QS4A 2RHIA 2XG8D 1OVYA 1W1FA 1A5WA 2OTLA 3G7ZA 2VXEA 4D8DA 1LCKA 2A1RA 2V7YA 2EQKA 1FXXA 2P0QA 1EZZB 3QJYA 4CESA 2D0AA 3MN9A 4CFBA 3OYMA 3G4ST 3AO5A 4JI3K 1PSEA 9ATCB 3RWUA 3CIPA 1UUEA 4QOZB 2W40A 2IIMA 4Y92A 2PAVA 4BACA 1GLJO 2P9UB 1L3VA 1HYSA 3H6ZA 2BGGA 2X9HA 3VF2A 3FJ5A 1Q81O 2X35A 1YI2N 1XHXA 2V7ZA 3QKJA 2QWMA 1LOTB 1X75C 4DV6K 1RFQA 1SL1A 1WSFA 3EHQA 4K41A 2J4RA 1Q82U 1NEBA 1ZBIA 2XRIA 4M77E 4HUEA 4X66K 3CCUA 1GLDG 4EMKA 1K9MC 1UEBA 4B1YB 4QT7A 3QWXX 5C2DA 4GV9A 4ZTFA 4LUEA 1QQOA 4BWMA 4XU3A 3OTOK 2RH2A 3G25A 2DPNA 1RAAB 4RUGA 2KLAA 3TEEA 5AQPA 4AH9A 4JYAK 1RBTA 1VQKT 2I0NA 4WFNL 2JGUA 4K42A 1L5UA 3FC3A 1OZ3A 1M1KR 1YITA 1Y7XA 1NK8A 5HRPA 5I9EB 2KHOA 5AQFA 1ZUUA 3G71N 2CGKA 1VQ4A 1U48A 1OH7A 4LFAK 2KEAA 3Q1JA 1ZSGA 2ENMA 5KGWA 5AQOA 1TUDA 3UKUB 3L1AA 2E2QA 2YT6A 2HSTA 5IAYA 3NVKA 2KRMA 3O8MA 2E4HA 1NEGA 4PLIA 4DF4A 3CC2N 1KFZA 5KH6A 2QQ9A 1HJRA 1L3SA 3IAYA 1YJWT 2F2XA 3M55A 3TWHA 5CVIA 1NGJA 3K5LA 4IDHA 5FPEA 2E65A 5CR4A 2J6KA 3NGIA 3PX4A 2C0TA 2O8BB 3CF5L 2BTFA 4BRGA 2KROA 3LGFA 2JVVA 2P9UA 2ZGZA 4WYBA 1RTHA 3JYTA 4KH6A 2KKZA 5CKEA 5A0LA 4E7KA 3N4QA 2MI6A 1M90O 4F4KA 4QCLA 3VEVA 1MMGA 1VQOT 1KJWA 4IFEA 3HP6A 1YJNT 4M41A 2E5KA 4P5NA 3M53A 1K73C 4PHTX 4EP4A 3THYB 1VSHA 5IWAK 1RNHA 3MN5A 4WQ5A 4GKJK 3MP6A 1J54A 3OYCA 2HNIA 7AT1B 1E4FT 3PGGA 3IMXA 2QEXT 3FZKA 4E7JA 2DXCA 3BP8A 2YX6A 4HWIA 3U9ZA 3J80O 3CCRN 3LAKA 4DFMA 5BR9A 2HQHA 4DR7K 3CQYA 1NBWA 1TAQA 4OVLA 1Z9QA 1W4SA 2X4WA 3NTHA 2YWWA 4XTVA 1UWBA 1S72A 4AM7A 3CCMT 1X3NA 1I39A 3OS2A 4K43A 4CIEA 4B3TK 3DB4A 4XTZA 4B9XA 3ZCMA 3DMJA 4DF8A 4CGDA 4CJEA 1XWLA 3NFAA 1WJRA 1BBZA 2CSIA 2M51A 2CYZB 1Q7YU 1T7PA 5LJ5g 5CY4A 4MLHA 1AVZC 2X4YA 3AY9A 5M1NA 4M7DD 2QWOA 1VQ9Q 5GAMe 1WLJA 1NLOC 3P4IA 3CMEA 2QWPA 3R1XA 5GAOp 5E26A 1QCOA 5FPNA 2D9TA 1RGIA 2PNIA 3FEOA 2ATQA 2K2VA 2D8JA 2ZZDA 4H5VA 1NYGA 3HZ6A 1U8RA 2O8BA 3CC4A 4DSKA 3VQEA 1YCSB 4PJLA 3JSCA 1RDUA 4C8OA 4YOWA 2HBPA 1N27A 2NRTA 2QDLA 4H8KA 2QK0A 1ZLMA 5JVGL 2QXFA 1RILA 1HXDA 2A36A 4AFZC 1SUQA 1HRHA 4JI5K 3A2FA 2HKQB 1QVGP 3QEVA 1AWOA 3CJAA 5LL6Z 2XY7A 5M1PA 1B07A 1WJSA 3L2VA 3SQ4A 1JLQA 3TAMA 4RTUA 1U1TA 4BE0A 1AEYA 2Y1JA 3SQ2A 3CC7Q 1SL0A 2ABLA 4MO4A 1VQ7T 1DGKN 4E47A 2WONA 2YHXA 3HI0A 4BR9A 2I5JA 2MYSA 4CI6A 2DL8A 1IKXA 5LJ5h 2VGMA 3EL2A 3GL1A 3L2WA 3RERA 4O0IA 4FU6A 1CLQA 4JI8K 1ABQA 2V1QA 3VS1A 2Q0RA 3HKSA 5KRTA 1EWQA 5EX5A 5KE2A 4H0VB 4O44A 5AQJA 4YY3K 4XU2A 1CXUA 3TABA 3T9NA 3SJJA 1M9SA 3V1QA 1NM1A 3O9QA 5LY3A 2ED1A 5I42A 2VB6A 5AJ3K 4BRHA 3KXTA 4FJLA 3H3OB 1I4K1 5FROA 1Q82C 2PYJA 4HUGA 4QQ6A 1S22A 5AQQA 4OPKA 1EX4A 4N76A 4J9HA 3QEXA 3NGYA 4M75G 1U2VB 4CJ5A 2V8IA 4IWVA 1VQLN 1I5OB 5AQSA 4LUDA 4Z4EA 5DLQE 1N8RU 3M8SA 1RLPC 4F7UG 3KLEA 4DQPA 1SSFA 3P8BB 1KHCA 4R55A 1K76A 2L5QA 2I7PA 3CETA 1HYZA 2GFAA 1YIJQ 1EXQA 4DTSA 4IUUA 5FWCA 3H3NO 4M75B 3E9LA 2DXTA 4RCBA 3SUPA 4J9CA 2NUPB 1YWPA 4ZN1A 5GMKi 1TSFA 4N4IA 2GGRA 4F7UB 3QFUA 4DTNA 5J2QA 1XHZA 3X24B 1I3AA 3W0LA 2P5GA 3DXKB 3LM9A 4AHSA 1M2VA 2PVOB 5AZIB 3TU5A 1N9SA 3VS2A 2OTJA 1JLGA 4L6V5 3RSEB 4A61A 5AQTA 3URGA 3EFSA 1YI2Q 3ENHA 3ULEA 5CQXA 3QO9A 4FK0A 4FK4A 5H1SQ 2FB7A 1ATNA 2RE2A 3T69A 3CCVN 1E7OA 1IGQA 2PUOB 3CEYA 3RMCA 4CJVA 1G99A 2FPEA 4BI3A 3C0BA 3HYFA 4JV5K 1VQNA 2WSCE 3EO3A 1M3AA 2HKNA 3AO4A 2XO7A 4PKIA 2EYXA 1T05A 5HY6A 4WF2A 5AFUA 2E6LA 2ZQBA 1U2VA 3TTCA 5CHIA 2COZA 1SKWA 1I5LA 4WFBL 2LQ8A 1JXEA 1KC8O 4R0KA 1MHNA 4KULA 2E2PA 1RUWA 3CC7T 1UHCA 4AFSC 4HVVA 2A5XA 2DLPA 2DD4A 1BUPA 3M1FA 1ZQ1A 4C92G 3GOXA 3CD6T 4H5WA 1EETA 3HBTA 3GNFB 1D0ZA 1TGOA 3L4QA 1HNXK 2M9UA 1JEGA 4OLBA 3GBTA 3CI5A 5DLOA 5GANd 2D0OA 3M0TA 2AP1A 3VENA 1HQUA 2NUPA 1Q7YC 3QLHA 1BI3A 1X6BA 3A8HB 1I0CA 3FZHA 1VIEA 3EEQA 1GOBA 3X26B 2EGEA 3OYAA 4GVMA 3DXKA 3HK2A 4C92B 1NK9A 5CK9A 3OYEA 5AZIA 4C5EA 3CCJA 5C2FA 2B6AA 2OTLN 1YVUA 4M78F 2ZGYA 2YNHA 2O9SA 4AT1B 5AQIA 3HL8A 2V52B 2VGNA 1VQPN 4FOIA 3C94A 3VUZA 1IHWA 1KXPA 1XNIA 1Z26A 3F2KA 1X9SA 2MK5A 4I9QA 1S3XA 2RB6A 3M4YA 2ZE2A 4EAHD 2LRQA 1MDUB 1VSIA 3VQBA 5A2QO 4X1VA 4C0DB 1WSIA 3IKMA 4KRTA 4R56A 2EYWA 1YIJT 4N5SA 1RDDA 2KXDA 1JRIA 4DLGA 3CCRQ 4L3QA 3ZSQA 3LGLA 1RDBA 5JS1A 3THWA 5LL6S 2JWKA 1B7TA 4E7ZA 3LWMA 5KPRA 3MXIA 2O8EB 3L3UA 2E12A 5SZTA 2LMJA 3M6GA 4DQ8A 3CCUN 4DUZK 4F2RA 2YHYA 1D5AA 3D45A 1M1KC 1ZBJA 2LTOA 3JXUA 5GMKj 3T19A 2O8FA 3E01A 3JCMg 2QI2A 2COWA 3TQ7P 2HHUA 3VQ7A 3ZSVA 2XU8A 3KBGA 1ZYQA 1LJOA 3MCPA 3NF6A 4EHTA 2HL5C 1YITN 4ZGEB 2YRVA 4OGCA 4CJRA 3J80E 2HVIA 2HQEA 1IO6A 1F1BB 1KQSP 1YTUA 4CZGA 3EG3A 1LWFA 1OZ2A 3IFRA 4N56A 5C15A 4BC5A 3P38A 2ATCB 3X25B 3B6OA 3VYHB 3TPQA 4FJGA 2EFIA 2KAFA 2KVQG 1VUBA 1WOQA 1VQ8N 2EWNA 4DR5K 1N8RC 3CCSA 1WQWA 2F8SA 2DTHA 2IAJA 4D8KA 3EKSA 2QQAA 4H5TA 1O1WA 1T6DA 1YHQA 1NPPA 2P9LB 3G71T 3LP2A 3V4IA 2HW3A 2VG5A 3VQQA 5ELZA 3WQUA 1JCFA 3E66A 3GOIA 5FLXO 3DB3A 1W97L 1WSEA 3SHWA 4KH4A 1QKWA 1QVGA 4JK9A 4C8QG 4I2QA 4N4GA 3CC2T 4PJOF 3A5LC 2CT3A 3LP0A 4LDYA 3K58A 2O8DB 4RTWA 4MZTA 3TAGA 2EYYA 2EYQA 2P9NA 4B8AB 5E84A 1VQ6N 1QQNA 3LALA 2H3JA 4KGZB 3IQLA 3PE0A 3V1OA 1RDWX 1NJWA 3I5SA 4OB1B 2G8WA 4C8QB 3RKYA 2KE9A 3DXMA 5AQMA 5BRDA 2NYSA 3DKMA 1D1AA 4CF2A 1Z05A 5D3GA 3VMFB 4FLZA 2RQWA 2ZPBB 3M54A 4CZFA 2FHDA 4M78E 2RK1A 2VG7A 5F1XA 4FJ5A 3D0PA 3ASKA 4V2SA 1GOCA 2YUQA 4CIGA 2P9IA 3VQCA 1OH5A 3I56T 4JJNK 1JLAA 4ILHA 5MLCQ 1SL2A 3FDRA 3H9NA 4CRIA 4W5OA 3OJUA 1BG3A 3O4QA 4CC4B 5FDLA 3CCRT 4JS4A 4OB0B 3VQ4A 1WX6A 2DPPB 3TCJA 1YJ9Q 1VQ5T 4XTUA 5GANg 5CYMA 4H0PA 1Q95G 4M7AG 3O3FA 3P39A 1ZC6A 5I2SA 5CQYA 1WSHA 4JKAA 3LDPA 4NYFA 1QCFA 4JS5A 1JU5C 1M8MA 2X6SA 1QSYA 1B34B 2DY4A 3OS0A 4IFVA 1W6XA 5KQ8A 4BE2A 4J9GA 3O1WA 3KK1A 4LF5K 3OBYA 1WFWA 3K57A 4M7AB 3IUCA 4BR2A 2RJEA 4M7DC 3AO3A 1RTDA 2O8DA 1AHJB 3DLGA 3AGRA 1X9WA 4BRFA 2LCSA 2HNZA 3L0QA 1K8AU 2G6FX 2DILA 2NZTA 3G6EQ 3TAPA 4H0TB 1S6QA 3CYMA 1T0HA 5SWMA 5GIPA 3UKRB 3I55N 2QKKA 3DLHA 1C0UA 4H0XB 3LPTA 1WUAA 4AG2C 1Z9ZA 4OKKA 3VU3C 1BI2A 4XTYA 1K73R 4RCHA 1UGRB 1JB0E 1VQMN 3DLBA 2DYBA 3U23A 2D1KA 5GANh 2F7TA 1U45A 4M4ZA 3ZSYA 4YOXA 1BA0A 4V19S 1JXMA 2F5TX 3K2PA 1NGHA 3ZT4A 2WFBA 1XNRK 4GNIA 1TL1A 1RAEB 1WA7A 4BVPA 2QA4A 3OYBA 1HKBA 1G8XA 2E41A 5FW9A 3NF7A 3OW2P 1HQEA 3K5OA 3JCMc 4BROA 2K9GA 2IC3A 3NH0A 1A5VA 4M75D 4PJOE 2KY9A 3ID8A 3INZA 4JN4A 5C0YA 5J39A 3CJ9A 2JUFA 1B34A 2GTOA 3VRZA 4DV3K 3BDPA 3THXB 3A5ZB 2RPNA 4BDYA 4BR7A 1M1FA 3CCEA 3TTDA 4DCHA 3J81O 3VEYA 4CJ4A 4B9WA 2P9PB 4DHYA 2QDYB 3WXIA 4E1NA 3V9SA 4EZ6A 2K57A 2OTLQ 2A42A 2DTOA 3EHRA 1W2BS 1K6YA 5FWBA 1PWTA 5AYFA 1VQLT 3CMAA 5AQWA 3QUIA 2P4TA 1K9MO 2CZ6B 4J9EA 2HF3A 2RQRA 8AT1B 5GAOr 4C8KA 2Q97A 4FT4A 2D4WA 4Z4CA 3O3HA 4CJFA 3WNFA 5LJ3j 3E9FA 3L8BA 4OB3B 4A2AA 3EH1A 4MDBA 2LT4A 4OGEA 3UB5A 3CFRA 1Y07A 3CCUQ 4KUIA 3AAQA 3HTRA 4OVAA 2F5KA 1RT7A 4CJ3A 2IIRA 1TOVA 1PSFA 1S1WA 2VV5A 2YUNA 2CP0A 3HPHA 4E0DA 5LJ5e 5AQZA 3CCQA 2E20A 1ZHIA 3ZT1A 5A2QE 5M1KA 1RI9A 1YITQ 3E9OA 1NK6A 3CPWS 3WNGA 4OX9K 1N32K 4IUVA 4O8KA 2O4XB 3CCVT 2GX9A 4C92D 2QWQA 4A4FA 1YTAA 3VGLA 2YKMA 4IURA 3CM5A 1ZUKA 2LP5A 4L5GA 5LJ3g 1Q82R 3S3NA 2RQVA 4DG1A 1VQ9N 3RMSA 3JB9F 4OO1J 2BZXA 4M7DA 4FLXA 2RM4A 4FZZA 3SNNA 1K73O 4DTMA 3L4IA 4FWRA 2PZ1A 4HCZA 3U9DA 1EO1A 4LF6K 1PRMC 5CKDA 3UF4A 3C4SA 5LJ3f 3JS6A 2ITMA 3AVLA 3JB9I 4Z02A 4RWTA 1QVFM 4CEQA 4RTYA 2JOYA 3ISNC 3C6AA 3K59A 2YLBA 4CF0A 1Q86U 4CFAA 1LPLA 3DLEA 2YNIA 2I2LA 4MDAA 2QAZA 1OI1A 2DBKA 2K79A 2Q36A 1NJYA 5I21A 1JJ2P 4KT0E 5GAN4 3PVQA 1UG1A 4C0GA 1C1CA 3EE9A 1C6VA 2EQMA 3LWIA 3UPUA 2KZZA 4IIMA 1T44A 2DA9A 1WNSA 2BKDN 3SAFA 1IJJA 3JCMX 4BRPA 3RMAA 1VQ6Q 2DFHA 2HNYA 3M0PA 2UU9K 1GBRA 2WACA 2RI3A 3GLXA 4FL6A 1TUYA 2RF2A 2YCHA 1K8AC 1VQPT 1S72Q 5FLXE 4OMLA 2W10A 2DEUA 3LDOA 2F8TA 2O4XA 3HPWA 3BW1A 3JB9J 4DV1K 2XICA 1KSWA 3ULDA 2L89A 4WQ5C 3R6OA 4IUPA 5D7UA 1VSJA 2QTDA 2YHBA 4FZYA 1RI0A 4LF7K 1GFDA 3VGMA 4EFHA 3QWYA 4H5NA 1QWFA 2JM8A 3KUFA 3I5RA 3UDCA 3CMEQ 1LV5A 5GAN5 3IG1A 2GBQA 3EKUA 4DFPA 4OF1A 1JLCA 1HUXA 5KYYA 4GLKA 2E2NA 5CCAA 1WHMA 2HF4A 2KR3A 4CGHA 1TV6A 3FR0A 4JI0K 3JB9H 2CH5A 4HTUA 2JZ2A 3FLCO 4CZKA 1NMNA 2OAUA 3I0RA 3N4PA 2FRWA 1UE9A 1YVNA 3PSFA 3TI0A 3LM2A 2RN2A 2VCPA 3QIIA 3RVCA 2DJZA 2ITGA 2E5QA 1VSFA 3I8DA 1MNDA 2DL7A 2VVKA 4JJBA 3S41A 1N6QA 2OYQA 1T3LA 2QASA 4QS8A 3VEOA 1Q7YR 2YHTA 4HCCA 1HKCA 1S1NA 4XAXB 2RN8A 5JVHL 2K3XA 1XJWB 4CJWA 1VIFA 2EJGA 4M3WA 2E70A 3RDVA 4FJXA 2ROTA 2CH4W 1T3VA 4BR0A 2DMOA 1KLMA 1OQKA 4NS5A 4KBMB 2O31A 3I55Q 3LANA 3O9SA 4C8QD 4FLVA 1ZA2B 4DTXA 3HO1A 2E10A 4YOYA 4YHHK 2LQWA 3L2QA 1Q82O 1VQ8T 2DK3A 2UXDK 3MXJA 3C7NA 1UJYA 3WEEB 2L3SA 4BRCA 1VQMQ 4FM2A 4JJDA 1KRPA 1D1CA 1KHIA 4BWJA 3VF4A 5LMNK 2RO0A 4JRIA 2HL3A 2HMAA 1KD1U 4M77G 1D3BA 4B1XB 1TKXA 2KYMA 4J7FA 1MA9B 1M4ZA 2A0FB 4CIFA 2R57A 3SAHA 1JL2A 1CZAN 4E7HA 4K8XA 4FYDA 4GV3A 3PV8A 1IKYA 1BGXT 3UE5A 1NGEA 3CXCM 1VQ6T 2PQWA 3BFMA 4M77B 1DT9A 1YP5A 2XK0A 3OW2A 3AVMA 1NOYA 4IG3A 4DV7K 4W5TA 3M5RA 1H3ZA 3EFOB 2CKKA 3Q7CA 2IS3A 4M7AD 2ZPGB 1K9AA 1Q81U 4FWKA 1WZOA 1XC9A 1IBLK 1PC0A 3RKWA 1UB4A 3P1GA 4QS7A 2HMIA 5IHKA 5A0DA 4RW8A 4CBUA 3D7SB 5FPMA 3T7ZA 3ZL7C 4CC2A 1Y64A 4RG8A 3PX0A 1T0JA 4NYNA 4DV2K 1XOVA 4FYVB 2EKOA 3SEMA 5AQNA 4Y91A 1U4BA 4JZ3A 5HCKA 1TWBA 2R5AA 4XTWA 2OTJQ 4DFKA 1N8RR 1XTDA 3VEXA 2ZPEB 2DD5A 5KYWB 4QS9A 2J7IA 2MPXC 1HKGA 3G4SA 1WXBA 3UA6A 3AARA 3J81E 3I35A 3JCMQ 1Q86C 4BY6B 1JJ2S 3VRYA 3S9HA 2CP7A 3OYKA 4CEEA 3NH1A 4IDKA 4B9UA 1BCOA 3VS7A 3JV3A 4Z0UA 2X3XD 1ACMB 3CCLT 1YAGA 2RHXA 3MHXA 3HSTB 4KH5A 4JI1K 3T1AA 3HVRA 3BZKA 4Z89A 1HNVA 4FYYB 3TARA 4KI4A 2XI9A 4PK4A 4CZIA 1VRUA 3OBWA 1Q7YO 1OH6A 1MWKA 3HSBA 4M77A 1S1XA 1XQHA 1RDAA 1BU1A 3Q7BA 1NBEB 1R0BG 4JD2B 3F73A 4FJ8A 3I55T 4C0FA 4HT8A 4RTVA 1IXDA 3MWPA 1KSPA 2EJ9A 1QHTA 3EFOA 2FSNA 1EP4A 1M90U 1VQKA 3QSUA 1PD1A 4OPHA 2HCKA 4CZMA 1CXQA 3M56A 3DOLA 1KFSA 3UATA 5HK3A 4PFOA 1VQMT 2IVPA 4AF1A 4AQYK 5KYXB 1PCXA 3RIRA 3REAB 2MF2A 3JCMJ 2GTJA 1M27C 1RT5A 2NRZA 3CQTA 5GJVB 1BIUA 1SZ2A 3CCEN 4RW7A 1RT4A 4A2BA 4I6MB 3CCJQ 4CEFA 4BB7A 3AA2A 3NHGA 2RKIA 1YJWA 4N47A 1H3HA 4CEDA 5HOOA 4DOVA 3M59A 5KYWA 4XH4A 4FWSA 3DRSA 4LFBK 3CMAN 1BI4B 1NGAA 3MJXA 4DTRA 2EBPA 2QQRA 3THYA 3KD5E 4M75C 4CEAA 3BEXA 4RW4A 2X3WD 3QZ9B 4MDXA 1RL2A 2KSSA 3HM9A 2G8HA 1UAXA 1M1KO 3OYHA 2HZYA 2VWFA 3NDKA 4FW1A 2QM1A 1GLBG 4KGVB 1JJ2A 1IB8A 3M8PA 1VQOA 3O6WA 2MOXA 1YJNA 5J2NA 4CGJA 4ESRA 2BE2A 3VA0A 5AFUH 1TU0B 1G3WA 1WXTA 2D5RA 1XI1A 3EAEA 4BI4A 4QW2A 4QVDA 3MN7A 2M0OA 3H8ZA 2B5JA 2O9VA 2X51A 3A5OC 3FFKB 4NCGA 1JBMA 4CZLA 4J5YA 3SFMA 2QEXA 2P84A 1JXOA 3EN9A 4JD2A 4LC9B 2BIVA 2Q0UA 4KHQA 1UJ0A 2KQWA 5GJWB 2W6KA 3W3DA 2DAQA 4ZGJB 3QBWA 4DQ2A 2PTKA 4J7IA 3JCMd 5GAOm 5IT9O 3ZSOA 3WXMB 3AA5X 4CEZA 3CCMA 3HP9A 5KYXA 5CIUA 1N8RO 2HNDA 2IOCA 3I9QA 1KD1C 5GANe 2XDBA 4DTUA 4NL2A 2QKBA 3PTAA 1RTIA 1G15A 1V1CA 3D2FB 5M1QA 3O9RA 3T3FA 4L59A 4O0JA 3SBGA 1Q9XA 4E19A 1XMQK 1SSHA 5CZ1A 3VJPA 1NPRA 4CBWA 4FT2A 3MEGA 4KB1A 3P83D 3ZEHA 1VSMA 1YJ9N 4LXCA 2OI3A 3CCSQ 4YORA 3VQPA 4EIAA 2VWJA 3V9WA 1WJQA 2QGFB 4FSSA 1QQMA 2LCLA 1UGSB 1YHQQ 3MK6A 4KTQA 2QG9B 4FM0A 1J5EK 5AQHA 1WB9A 4RKUE 3NVMA 4O4GA 4CF9A 4KHUA 2P4RA 1Q81C 2FSKA 1YUWA 1Q8IA 5I22A 4C92C 3QXEB 1WSJA 1Y0MA 2FO0A 3ATVA 4CW7B 5LMUK 4DV4K 2QQBA 4CK3A 2G8VA 1FMVA 4EZ9A 1WLPB 1RAIB 3M0QA 3KTQA 1VQ9T 4O5VA 3N5BB 1GLFO 3MX5A 3SAGA 3A8YA 5GAEP 2BUPA 4C23A 1V4SA 4HKEA 2P9KB 3QDFA 3G6EN 4LD9K 3KKSA 4EMGA 2D0NA 3MO8A 4A63B 3A5MC 4A4EA 1EKEA 3BZCA 1PRLC 2KYBA 1VQ7A 2E8AA 1TK8A 2LJ1A 4JUVA 4CGGA 4GW6A 1PHTA 3SDZA 2F69A 1NWKA 1OX9A 1KTQA 4C0DC 2PUKB 2OZSA 3CJBA 4CJUA 5CKBA 3NPFA 1T6CA 3DM2A 4KTWA 1UOCA 3H08A 3P31A 4F17A 3D2FA 2K3BA 4N41A 2H3EB 1NU0A 1XC3A 3VF6A 4DR3K 3TREA 3GBQA 1HNZK 4FJMA 3QO3A 2ESWA 1GXIE 2L3PA 2HVHA 4IXCA 4Z8AA 4ELTA 2XIDA 2C0IA 4OKJA 2DBMA 4MQ3A 3ULRB 1GCQC 2DEQA 3MEWA 2BE9B 1BIBA 2QXLA 3PNWC 2UUCK 1UGVA 4IOAL 3WXLA 2J05A 1QMCA 4M75A 3ZSWA 2D6FA 4JKHA 5ADXA 1C0MA 4RW9A 2QK9A 4B1UB 5D6WA 2FZKB 4CF8A 4DEXA 4KHNA 5L8RE 2E64A 4F7UA 1N34K 3F9KA 4IKFA 5FRMA 3EH2A 1S5JA 4NXNK 3L6QA 3C0CA 3X28B 1MUZA 3R9PA 4BG8A 4BRLA 3MAQA 3PLAA 4FWPA 3MN6A 2JM9A 2DE0X 1TUUA 1I1JA 5HK0A 2ZCFB 1ASVA 1LW0A 1BOTO 3RSEA 1T3SA 1AWWA 4LF8K 1Y97A 2P9KA 2CSQA 4AFQC 4DU4A 1KC8U 2CUDA 4JNEA 2LQKA 3P8HA 1JCEA 1C6VX 1WAJA 2FBYA 4FJ7A 3JAMO 1SRMA 1K0XA 1IREB 4W5RA 1KQ1A 1SF9A 3EG2A 3NMZC 3JCMW 1QVGS 5GAN3 3FE1A 4B08A 2DRMA 2IVWA 3VTIA 3D2EB 1ZBXA 5CR2A 1LVKA 1QVFP 4LH5A 1I07A 1W70A 4CZHA 2GNCA 3LH5A 4FWMA 4B9SA 3WUHA 2FRYA 2M16A 4J9IA 4C5HA 1X2KA 1NGFA 1QCNA 4DV5K 4TSXA 2VYTA 4IIOA 4M77D 2JLEA 4CJLA 2KT1A 2KFZA 4RG2A 3BF3A 2QA4Q 2YJEA 1EQYA 2HBWA 2RQTA 3QYHB 5C25A 4M42A 2B8AA 1K8AR 4GMJB 4C8QC 1PNJA 1FMKA 4EIKA 1U3OA 3OS1A 3QG1A 4RTXA 1KIKA 1KAZA 3I0SA 4FWLA 4JHDB 5HP1A 4X34A 5KYUB 3AVFA 1IBMK 4B9MA 4M3UA 1YI2T 3CC7A 1X9JA 3BGRA 2OAWA 5FU7B 2RK2A 5C6SA 1CSKA 3ZETB 4CF1A 1VQ4N 2G8KA 2E4LA 2DZ9A 5KTQA 4NXMK 3VOVA 3CD6A 2J6FA 5GAMj 4C0ZA 4C92A 3CCEQ 2OCEA 5F0XA 3HOTA 4OMQA 4PJJA 2Y90A 1BWFO 3TSQA 4KAZA 3OA9A 1OKJA 1KK7A 4E89A 3ZLJA 4DSJA 4DU1A 3MP1A 2AKLA 1LOJA 1R77A 2IPOB 2FBVA 4PA1A 1NK7A 5HBMA 3QYGB 2DRKA 3CMAQ 1RABB 2MMPA 1ZA1B 2R58A 1J6ZA 1NGDA 5KGXA 2FXUA 2EJFA 2ASMA 2ED0A 3LH0A 4BRDA 2ZPIB 2Q31A 1TS9A 1V76A 4DBHA 1K8KB 4ZTJA 4FWOA 3SMSA 3D2EA 2NRWA 2ZWHA 5EY4A 1ZSZB 4C1NI 4WTOB 3L2UA 2GQIA 4W5NA 4Z4HA 4BQLA 2HDAA 1TKTA 3RR7A 3UIQA 1GLLO 3JCMh 1X01A 2JMAA 2ZPFB 4M7AC 4BRQA 2O8EA 4FJKA 4LN2A 2XD0A 2X78A 4F8RA 4QKUA 4L8RB 1AWXA 2RF0A 2D0BA 5GAMg 3AVIA 3A8MB 4ZGDB 3WVDB 3O1BA 1YIJA 3J7AP 4J6WA 4DR1K 4IOCL 4OMMA 4LDXA 1NZ9A 5KPZA 3NE6A 2LJ3A 5GAMf 4A5AA 2VASA 1GCQA 3CCQQ 5L23A 3CQ8A 4EPCA 5HLFA 1NJIU 4Z4GA 2DL5A 5KYUA 1S72N 1MWMA 5J2MA 5BRHA 3O9UA 2CGHA 4M78G 3CJ7A 2P5OA 3BY5A 2FG0A 2ETJA 5KCHA 4M7DF 2V8KA 2RQUA 4AILC 4A62A 4PY5A 4K8ZA 2ZF5O 4JJCA 2DJQA 2LCCA 1WHGA 5GMKh 3L2RA 4CGFA 3NH2A 4DEYA 3KJVA 1WN7A 3CMEN 1NG2A 3DRPA 5HRSA 3F5TA 5LJ3d 4PFZA 5FU6B 4M78B 3RESA 4ID1A 4K11A 4HXJA 3ZSXA 1WBDA 4TVRA 3RBBB 4BR5A 2CZ0B 1X2QA 5IT9E 3CC4N 2P9LA 3PO5A 1YCYA 3MP8A 2HQXA 2YRCA 1OU8A 3O5BA 1K8KA 1UTIA 1YJWN 2G3RA 3RNJA 3K9KA 1U1SA 1TK0A 2WSEE 3E9GA 2DVEA 4CE9A 3NF8A 1BU6O 4RTTA 4OMFB 3CXCP 4KFBA 4OKEA 4GY5A 5DM6L 3G71A 4M7XA 1NKCA 2XY5A 5AQGA 2V51B 4KH0B 3OMGA 2GBZA 1N36K 4B3SK 4C8NA 4BRKA 2COYA 2K5IA 2P1JA 2FC0A 3VS5A 3O4WA 1ZBHA 2YHAA 1JLEA 4F14A 4ELUA 3CC2A 1BO5O 4C8QA 3AAPA 5AT1B 1YT3A 4IJAA 2L0AA 3OSVA 3C6TA 5J26A 3EZWA 5CZ2A 4F9OA 2E3IA 3SYZA 2RHUA 1NGGA 3DOKA 3VQ5A 4ZN3A 1WHKA 1BYMA 2EQUA 1Q86R 1NGIA 4HTLA 3TSPA 3AGKA 2DKGA 2NUBA 1FK9A 3KWIA 3VA3A 3NMUA 1FJGK 5IHIA 4DUYK 1LCUA 3LP1A 3CBMA 4AHVA 2DFEA 1G83A 1N5YA 5EXWA 2Q1NA 4ANJA 1VSKA 3H6EA 2LJ0A 3SPZA 2WBNA 4PWDA 1L3UA 3AO2A 1Z6RA 1GFCA 1B9FA 1ABOA 4DFJA 5GINA 4DV0K 5JLHA 3I56A 2VUBA 3SUQA 2L2PA 2HHTA 4JEPA 2BZ8A 4PJOG 1V4TA 4DR6K 1ZXOA 1Z25A 3M9QA 3CCRA 2IVOA 4KTZA 4QAGA 2BTTA 3EG1A 3H41A 2JW4A 2QYZA 1BISA 1KFDA 1XUPO 1YF5L 3FFIA 4CK2A 1VQ5A 1KQSS 1RACB 3H0IA 5EG2A 1YXQA 1M2OA 1P8ZA 2DO3A 3GE1A 3NTKA 4M7AA 5AZJB 2D1XA 2ROLA 5IXFA 4W5QA 1X69A 4MZPA 4PJOB 3V9XA 3QEPA 2A3ZA 3PX6A 3KLIA 3V7SA 5LJVA 4YOTA 3J7YP 2HAXA 3HRGA 1L3TA 2KNBB 3UKRA 2HMPA 2M1HA 2FPFA 4M7DE 1TYQB 2FBXA 2EGAA 3RRGA 1UECA 3ZT0A 3HT3A 4DR2K 3CQXA 2OTJN 3KKRA 1WHHA 4HA8A 4B9VA 4UC4A 1YJ9T 1IV0A 2CP5A 4OPJA 2HD0A 4AHCA 1PG5B 3TANA 3MEVA 1C0FA 3P5JA 2AA4A 2UYTA 1N6AA 4IFYA 1A0NB 2X6NA 5AQXA 4JKCA 2NWMA 2DETA 3TAQA 4BC4A 1KVAA 5DK5A 5TKWA 1VQNN 2VKNA 1GRIA 4PQUA 1VSLA 4DSIA 1P90A 3MEDA 2MCNA 1QE1A 1FMWA 5AQYA 4NLCA 4H0OA 2HSEB 3VKIA 5IXBA 3JAME 5BN9A 2BZYA 2HEQA 3ZX0A 2FPDA 4CJ7A 1SEMA 2AZVA 4HVJA 3OB9A 5GAHP 3G6ET 2GUIA 4BREA 2FEIA 1K9MU 1VQ4Q 3ID6A 3HPOA 1NJIC 1RTJA 3FRNA 1RADB 3THXA 4IJNA 1KVBA 2ZPHB 5BPLA 2ZM6K 1VAZA 1OYXA 3WXKA 4KREA 1BHLA 2P9PA 2CREA 1NE8A 4HUFA 2EQJA 1ZX6A 3RKXA 5A0GA 3ITHA 3R8EA 1KD1R 1LNXA 3FJPA 5GAOl 2Q2RA 1KQSA 1IBKK 4PJOA 3AVJA 5AQVA 1PKTA 1KLNA 2E1YA 5T7BA 1Q86O 3E2UA 4JZ4A 3C6HA 2LX7A 3HM8A 2OPSA 2HBMA 4H0YB 4E1MA 3QFPA 4J83A 3M3ZA 3CCJN 2OX7A 4FM4B 4IZ9A 1HPZA 2OPPA 3UWNA 2F96A 4OMPA 4E7LA 1VHXA 1U6ZA 1E6HA 2FLOA 1BKBA 2ZJRL 1NKBA 2GV9A 1S1TA 1S6PA 3EY1A 3S3MA 2H3GX 3G4SQ 3MCAB 1VQLA 2BH1A 4O8UA 2RJCA 3JRZA 4CVNE 1SV5A 2OZMA 2FZCB 4AM6A 2A40A 1WI7A 1U04A 2R5MA 1Q81R 2E1ZA 3SCXA 1SHFA 3H0FA 1PKSA 4LSLA 4J8OA 1J5OA 5AQUA 4M77F 3BY7A 3SWNB 3HVTA 3M0UA 1I8FA 4DWIA 4E1JA 4LH4A 4E6RA 1BI0A 2OTLT 4KKOA 1BDGA 3CG7A 3V7CA 1KCFA 3PIOL 4N0AC 1U47A 2GQVA 2Z1HA 1NGBA 1X3MA 1B9DA 3KK3A 5LJ3h 4IEIA 2D0QB 1IZ6A 3J7ZO 1MNEA 4FJHA 4JKDA 1TTHB 4JKGB 2DIGA 3SI6A 3M57A 3S6WA 3PVLA 4RCCA 3NGZA 2Z0WA 1SQKA 1VQKQ 5HRRA 3TAEA 4PJNA 2CH4A 2R7YA 1NG9A 2K4YA 2RI2A 1AZEA 4MO5A 5FRNA 5C0MA 2RJDA 3H1QA 3AVBA 4CK1A 5BPMA 2LQNA 4K0KK 3VETA 1MU2A 1X43A 3RUXA 3SZ2A 3CCVA 4BQZA 3CD6N 3MEAA 1NGCA 1DEJA 2C06A 4B6MA 1WBBA 1QKXA 3B6PA 3CCUT 2V1RA 3OW2S 3EGXB 5TKYA 1R0AA 3CC4Q 2YI1A 4IO8A 4M77C 4CHOA 4CHZA 2B4JA 4J6YA 2DYIA 4DBQA 3NGPA 4CC7A 1YJWQ 3EYZA 1G3YA 4LSNA 2LNVA 4E7IA 1W2BM 2AKKA 1NJZA 2EHGA 3CCSN 4ME7A 4BI8B 1YN8A 1HJDA 3D7EO 1R59O 1YITT 1W0HA 4EMKB 1MV3A 3MMVA 1YHQN 3OS5A 5EC7A 1WDXA 3UT1A 1VQ4T 1M90R 3NF9A 4FO0A 4JLIA 3VQ9A 3CPEA 3PO4A 1DKGD 3CJCA 4ID5A 4KH1B 1QZ6A 2UUBK 1HPMA 3J8AA 4FJJA 5J2PA 3CXCA 4Z4IA 1VQOQ 2PU9B 1YJNQ 5JS2A 1C0TA 1DJ7B 4BRIA 6AT1B 4KHYA 2RI5A 3SUOA 3C12A 4G9ZA 1RAHB 2HHXA 3PIOA 1FW6A 1E4GT 4OP0A 3AO1A 3HJFA 1KD1O 3MX2A 3M0SA 3AV9A 4DOWA 4Y1DA 2YDLA 2QEXQ 1ZBUA 5KI6A 3LWLA 3JB9G 1FKOA 3LZIA 4B3OA 1X6GA 1HMVA 2JJ9A 1S9EA 2VG6A 4IOXA 4BY6C 1LWEA 4J2AA 4I7FA 2HBLA 2EWSA 3EE8A 1TG0A 2PYLA 4B9LA 2EW3A 1F21A 4JRPA 1VQPA 1WYXA 3CCMQ 1RT6A 2JWLA 4BGBA 3LDNA 4CJKA 3CPWM 3E1SA 4CCHA 2SRCA 3QZ5B 2PVGB 4M78D 2M0YA 2UXCK 3BDLA 4NB4A 3RRHA 2YLCA 1M8VA 1HLUA 3KIOA 4JK7A 3JCMP 4A5BA 3QEIA 3EGXA 2O4GA 1IH7A 2XKOC 4PFPA 1S1UA 2E1HA 4FXDA 3VN5A 4B9QA 2ZJPL 2HBJA 3X20B 3L2ZA 4LF9K 3VQ8A 2KFNA 3BUZB 4B3MK 3NBPA 2KK4A 2V8JA 3OQ5A 1BQNA 3KWGA 2ZJQL 1S72T 2DFUA 5GAN7 4XK8E 3LP3A 3G0ZA 2X4JA 3RR6A 2Q3SA 3QIOA 4NCAA 4A59A 1TH7A 4YTLA 1Y96B 2YRDA 1WAFA 1V29B 2GEMA 2DL4A 2OJ2A 3VUBA 3TU4K 2FBTA 4FWNA 1QSSA 4FJ9A 3CMET 4KV8A 4NO7A 1JO8A 2JTEA 4N0AA 4CD1A 1NKEA 4WCIA 4VUBA 2Y4XA 1XMOK 2Z1GA 3FIFA 3WEEA 5B8HA 3KLGA 4EMHA 3CC4T 1VQ7Q 3QBYA 3IRXA 1UA0A 2FZGB 1MMAA 1JLFA 3VQAA 3FZLA 2JXBA 1NK4A 1NK5A 1TL3A 2XDPA 1VQ8A 2WC9A 1VQNQ 4A4KA 1OH8A 5D6XA 3JCMe 4ATOA 4O6JA 4X65K 1B92A 3SD4A 4DA4A 1E6GA 5GAOq 3FLGA 1RAFB 3O9TA 3U6FA 3IDHA 3M58A 2RA2A 4LDVA 4B1WB 4PLLA 4KRFA 2YNGA 1M3BA 5CKFA 2RHYA 5LJ5j 4M75F 1VYUA 2QA4N 5GMKm 3K0SA 4ZNXA 1HYOA 5HKCA 3QMLA 1WHLA 4MMLA 2V26A 2CP2A 4F7UF 4FZXC 1ILYA 3KFVA 3OW2M 2WOMA 3I56N 3GG4A 3VTHA 4Z4FA 1MV0B 1GCPA 1NLPC 4N4HA 1VQ6A 4PJOD 4FLYA 3CBOA 1HYVA 3I8BA 2UUAK 3SQ0A 4ICLA 2DX1A 2NRHA 1HSQA 1Y96A 2DF6A 4R5PA 3ZT2A 4X9DA 2Z1JA 1VQ5N 3ME9A 1RBVA 4BY9C 5BREA 2KT8A 5GMKe 3PT9A 5C10A 4DTPA 2EYZA 1OEBA 3C65A 1UHFA 4H4MA 3M8RA 3L3VA
chains in the Genus database with same CATH topology
1J53A 2QKKA 3DLHA 2FBYA 4HCBA 1C0UA 1C6VX 1WAJA 2Z1IA 3LPTA 4CFCA 3U3YA 4FJ7A 1ITGA 4W5RA 1QTMA 3PY8A 4OKKA 3VQDA 2G8FA 3QETA 4DS5A 4DS4A 4M3ZA 3OYJA 4B08A 3DLBA 4PUOA 3LAMA 4O5BA 4LH5A 1U45A 1WSGA 2PZSA 3LZJA 3ZSYA 4BE1A 2YNFA 3K2PA 3O4NA 4E3SA 4B9SA 2A1SA 3ZT4A 1IG9A 1TL1A 3DRRA 3HXMA 4AHTA 3SV4A 3SV3A 1REVA 4TSXA 3OYBA 3ALYA 2JLEA 3AVGA 4CJLA 1ZBLA 2KFZA 1NK0A 3NF7A 4BDPA 1HQEA 1GOAA 3K5OA 3O3GA 4Q0BA 3KLFA 2IC3A 5C25A 4M42A 3NH0A 1A5VA 3AVAA 2OPRA 4GMJB 4CF1A 3OS1A 1T05A 1C1BA 3I0SA 5HP1A 3AVFA 4J2DA 3V81A 4DSLA 2VWKA 4M3UA 4G1QA 3BGRA 2KQ2A 2G8KA 3BDPA 1QS4A 4BDYA 2E4LA 5KTQA 4M3TA 1A5WA 2BANA 4YFUA 1RDCA 4CJ4A 4E1NA 1RT1A 3QESA 2A1RA 3V9SA 4EZ6A 1FXXA 4CESA 4CHQA 2D0AA 4CFBA 3OYMA 3AO5A 4KAZA 3LPUA 4DSJA 4E89A 4CJTA 1K6YA 4DU1A 3RWUA 1NOZA 1RBRA 1L3VA 4BACA 2FBVA 4PA1A 1NK7A 1LWCA 5HBMA 1HYSA 5EU7A 2BGGA 5KGXA 1XHXA 4M3XA 1BI4A 3OYIA 4C8KA 4Z4CA 3O3HA 1WSFA 1SL1A 4CJFA 4ZTJA 1ZBIA 3WNFA 2XRIA 3AVKA 3L8BA 4W5NA 3L2UA 4HUEA 4Z4HA 1TKTA 3WNHA 4OGEA 5HRNA 4ZTFA 3RR7A 3UIQA 4BWMA 3CFRA 4FJKA 2X78A 4AH9A 3KLHA 4F8RA 1RT7A 4CJ3A 1RBTA 3NCIA 4L8RB 3AVIA 2D0BA 1S1WA 2KW4A 2JGUA 1L5UA 3HPHA 4E0DA 1NK8A 5C24A 4CHYA 5HRPA 3RTVA 3ZT1A 3NE6A 1JXBA 1U48A 5KGWA 3CQ8A 1NK6A 1IO2A 4DLEA 5HLFA 3WNGA 4Z4GA 1TAUA 4RW6A 4WE1A 5J2MA 4AHRA 4BDZA 2P5OA 4DF4A 3IAYA 1YTAA 1HJRA 2ETJA 1L3SA 5E41A 2YKMA 4AILC 3CM5A 3TWHA 1J9AA 4PY5A 4K8ZA 3S3NA 4DG1A 3K5LA 4FLXA 4FZZA 3SNNA 4DTMA 3L2RA 3NGIA 4CGFA 3NH2A 4YNQA 3QNNA 3KJVA 1WN7A 3PX4A 3AVHA 3DRPA 3DI6A 5HRSA 1JL1A 3AVLA 1LAVA 3JYTA 1RTHA 4FJNA 3AA3A 3THVA 4ID1A 4CEQA 3ZSXA 3ISNC 4E7KA 3K59A 1UA1A 4F4KA 4QCLA 3HP6A 4OJRA 4CF0A 4M41A 4CFAA 3DLEA 1BIZA 2YNIA 3PO5A 4EP4A 1VSHA 1RNHA 2O4IA 1NJYA 1TK0A 4CE9A 3DLRA 3NF8A 1C1CA 1J54A 3OYCA 1C6VA 1TVRA 4FLTA 4KFBA 4OKEA 4E7JA 2KZZA 4DFMA 1WNSA 3LAKA 1RCHA 1NKCA 2XY5A 3RMAA 2DFHA 2HNYA 4Y1CA 1TAQA 4OVLA 2HHWA 1TKZA 3OYGA 2GBZA 2RF2A 4JRQA 1UWBA 4MFBA 4C8NA 3TAFA 1I39A 2P1JA 3OS2A 2FC0A 4CIEA 5KRSA 3ZCMA 4DF8A 4B9MA 3DMJA 1ZBHA 4CGDA 2YHAA 4CJEA 1JLEA 1XWLA 2BDPA 4ELUA 3NFAA 1YT3A 3OJSA 3QEWA 3C6TA 5CZ2A 1T7PA 2F8TA 1QSLA 3SYZA 3DOKA 3CFOA 5CY4A 3VQ5A 3ULDA 4CJSA 1VSJA 5D7UA 1BL3A 2YHBA 1WLJA 4XIUA 2NUBA 1FK9A 4FZYA 3VA3A 3SPYA 4J2EA 2ATQA 3LP1A 4AHVA 2YKNA 1LV5A 2DFEA 4CFDA 3IG1A 1N5YA 4DFPA 3K5NA 1JLCA 4M3RA 4DSKA 3VQEA 1VSKA 4CGHA 3WNEA 4CHNA 3SPZA 1TV6A 4PWDA 1L3UA 4C8OA 4HTUA 3AO2A 3I0RA 1B9FA 3TI0A 4DFJA 2RN2A 4H8KA 3SUQA 2HHTA 4UQGA 2QXFA 1RILA 1CZBA 3ZSRA 5HROA 4FJIA 2ITGA 1SUQA 1VSFA 1HRHA 3SQ1A 3A2FA 1Z25A 3I8DA 4KTZA 1N6QA 4QAGA 3QEVA 2OYQA 1ASWA 1BISA 2XY7A 1KFDA 3FFIA 3TR8A 4CK2A 4QOZB 1IKWA 3SQ4A 3L2VA 1D9FA 3SQ2A 1JLQA 3TAMA 4BE0A 2Y1JA 4HCCA 4KHSA 1C1AA 2G8IA 1SL0A 4CJWA 4M3WA 5CYQA 4FJXA 2WONA 3AVNA 4W5QA 2I5JA 4CHPA 1LW2A 3V9XA 1KLMA 3QEPA 3PX6A 3KLIA 1IKXA 2OA8A 3LANA 4FLVA 4CEOA 3L2WA 4DTXA 3HO1A 4O0IA 1CLQA 3L2QA 1L3TA 3C95A 1VK0A 2FBXA 4M45A 4AHUA 5KRTA 2P51A 3MXJA 3RRGA 3ZT0A 3HT3A 4O44A 2YV0X 1CXUA 3KKRA 4FM2A 3TABA 3SJJA 4B9VA 4NCBA 1NJXA 1KRPA 2IDOA 3V1QA 4OPJA 2XHBA 4BWJA 4AHCA 4DQSA 3ZSZA 4H4OA 5I42A 3P5JA 3TANA 4IFYA 5FROA 2PYJA 2X6NA 4HUGA 4N76A 4OPKA 1EX4A 4CGIA 3TAQA 3QEXA 4Q5VA 3NGYA 1RBSA 1TKXA 1KVAA 5DK5A 4CJ5A 4PQUA 1VSLA 4CIFA 4DSIA 4Z4EA 4HHTA 3MEDA 3M8SA 1JL2A 1JKHA 1QE1A 2RPIA 4DMNA 4E7HA 4K8XA 4FYDA 3KLEA 3PV8A 4DQPA 1IKYA 1BGXT 1TKDA 1A5XA 1HYZA 4HVJA 1EXQA 3AVMA 4DTSA 1NOYA 1VRTA 2GUIA 2HHQA 4IG3A 1SKRA 3QINA 2HHVA 4W5TA 1LAWA 5J1EA 3HPOA 4DQIA 3SUPA 2IS3A 1RTJA 2HHSA 1XC9A 5J2QA 1KVBA 4DTNA 1XHZA 3P1GA 4F2SA 2HMIA 1I3AA 2X74A 4RW8A 2ZD1A 1BHLA 2P5GA 1W9HA 4KREA 4HUFA 3ITHA 4AHSA 4CEBA 4RG8A 3AVJA 3PX0A 4NYNA 1T8EA 3DLKA 1KLNA 4ZHRA 5T7BA 3OY9A 4DU3A 1JLGA 1U4BA 3LDSA 2OPSA 3OYLA 4E1MA 3QERA 4DFKA 3V1RA 4FK4A 4FK0A 3QO9A 4C8MA 1HPZA 3IS9A 2OPPA 3QNOA 4I2PA 2F96A 4E7LA 1Q9YA 2IGIA 3RMCA 1NKBA 2GV9A 1S1TA 4CJVA 1S6PA 3EY1A 3HYFA 3S3MA 4FLUA 3S9HA 3OYKA 3KD1E 4CEEA 3NH1A 4IDKA 3AO4A 4B9UA 1BCOA 1SV5A 2XO7A 4Z0UA 2OZMA 3HSTB 3HVRA 3T1AA 1U04A 2PY5A 3SCXA 2E6LA 4FLWA 2ZQBA 3AVCA 4ELVA 1HNVA 4LSLA 5DMRA 1SKWA 1J5OA 3TARA 1JXEA 4KB0A 4KI4A 3HVTA 4DWIA 1VRUA 4DQQA 4LH4A 2HB5A 1U47A 2KZMA 4KKOA 1S1XA 3CG7A 1KCFA 4CJQA 1RDAA 1EETA 2Z1HA 4LY7A 3F73A 4FJ8A 3KK3A 1B9DA 1TGOA 4OLBA 1DTQA 2AJQA 1KSPA 4DSEA 1QHTA 3RMDA 4FJHA 1U49A 1SKSA 1EP4A 3JSMA 1HQUA 3QIPA 3SI6A 3QLHA 4FJLA 1CXQA 3DOLA 3NGZA 1KFSA 5HRRA 2DFFA 3C6UA 1ASUA 1DLOA 1GOBA 2R7YA 3TAEA 3OYAA 4GVMA 1RT5A 3HK2A 5FRNA 3K5MA 1NK9A 3OYEA 3AVBA 4JLHA 1BIUA 4CK1A 1IKVA 2B6AA 2D0CA 1MU2A 4RW7A 1YVUA 2YNHA 3SZ2A 1RT4A 3NAEA 3HL8A 1BCMA 2XY8A 4CEFA 3B6PA 1R0AA 1IHWA 3C94A 1Z26A 2OPQA 3AA2A 4LD0A 3OYFA 2RKIA 3NHGA 1X9SA 4N47A 4CEDA 4I9QA 4CHOA 2ZE2A 4CHZA 2B4JA 3MXMA 3EYZA 3DRSA 3HPGA 1BI4B 1VSIA 4LSNA 3VQBA 4E7IA 4DTRA 3KD5E 2DTUA 4CEAA 1NJZA 4RW4A 1WSIA 1RBUA 2EHGA 3OYDA 3HM9A 2G8HA 1UAXA 4N5SA 1RDDA 1W0HA 3OYHA 3NDKA 4FW1A 4DLGA 3ZSQA 5JS1A 1RDBA 3NF9A 3VQ9A 3S3OA 3M8PA 3PO4A 3MXIA 3LWMA 4ID5A 3OVNA 4O55A 3L3UA 4CGJA 5J2NA 5SZTA 5J2PA 2BE2A 3VA0A 1T03A 4F2RA 4FJJA 4Z4IA 2D5RA 1XI1A 1D5AA 5JS2A 1C0TA 3SUNA 3D45A 4B8CA 4NCGA 2B5JA 3T19A 4DQRA 3SUOA 3E01A 4KHYA 1KVCA 2HHXA 2HHUA 4EP5A 3AO1A 3VQ7A 3ZSVA 1ZYQA 3V9UA 4KHQA 4M3YA 3HJFA 1DTTA 3AA4A 3AV9A 1S1VA 3NF6A 4Y1DA 1ZBUA 5KI6A 3LWLA 4B3OA 1BQMA 1FKOA 3LZIA 1HMVA 2LSNA 1S9EA 2VG6A 4OGCA 3KK2A 1LWEA 4J2AA 4I7FA 4IBNA 4FK2A 4CJRA 3ZSOA 3AA5X 4CEZA 2PYLA 4B9LA 2HVIA 3HP9A 1YTUA 1F21A 4JRPA 1LWFA 1JLBA 2HNDA 2IOCA 4C8LA 4N56A 1TK5A 1RT6A 4DTUA 2QKBA 4CJKA 1RTIA 1G15A 3M8QA 3U3GA 4CERA 1D9DA 3T3FA 3B6OA 4CCHA 4FJGA 4O0JA 1Q9XA 3RRHA 4E19A 3QEIA 3KIOA 5CZ1A 4FVMA 2O4GA 1IH7A 1S1UA 3MEGA 4KB1A 2F8SA 4FXDA 2IAJA 3VN5A 3P83D 4CECA 3V9ZA 1O1WA 1VSMA 3G10A 4FCYA 3LP2A 3VQPA 2VWJA 3V9WA 3V4IA 2HW3A 3VQ8A 2KFNA 2VG5A 1RT3A 2EX3A 3VQQA 3NBPA 3V6DA 1D8YA 4KTQA 3ASMA 4FM0A 1BQNA 3CFPA 3LP3A 4B9TA 3G0ZA 1WSEA 4O4GA 4CF9A 4KHUA 2Q3SA 3QIOA 4I2QA 1Q8IA 4NCAA 1WSJA 3LP0A 4KO0A 4CK3A 3K58A 2G8VA 4EZ9A 2KTQA 4DTJA 3KTQA 3TAGA 1WAFA 5I3UA 4OLAA 4B8AB 2FBTA 1QSSA 3LALA 3VQ6A 4J2BA 4FJ9A 4KV8A 1FKPA 3V1OA 1IHVA 3KKSA 5C42A 1NJWA 1NKEA 1EKEA 2G8WA 4KPYA 2Z1GA 1TK8A 3KLGA 4CGGA 4GW6A 4CF2A 5D3GA 4I9LA 4FLZA 4FW2A 1KTQA 3DYAA 3IRXA 1UA0A 1X9MA 1X1PA 2VG7A 1JLFA 2OZSA 3VQAA 4CJPA 4KI6A 4FJ5A 4CJUA 3D0PA 1GOCA 4KHWA 1NK4A 3OYNA 1TL3A 1NK5A 4CIGA 3DM2A 4KTWA 3VQCA 1UOCA 1VSEA 3H08A 2W42A 1SL2A 1JLAA 4F3OA 4N41A 4W5OA 3OJUA 1B92A 4B9NA 3O4QA 1HNIA 5FDLA 3U6FA 4FJMA 4JS4A 3VQ4A 4DSFA 3MECA 3PUFA 3CM6A 2HVHA 5CYMA 4ELTA 4KRFA 3EZ5A 2YNGA 2E6MA 4OKJA 1QQCA 3O3FA 1WSHA 2G8UA 4MQ3A 4NYFA 4JS5A 1CZ9A 3RR8A 1QMCA 4FZXC 5K14A 3ZSWA 2X6SA 1QSYA 1C0MA 4RW9A 2WOMA 4CF8A 4IFVA 3OS0A 4DTOA 2QK9A 2DY4A 4BE2A 2Y1IA 4Z4FA 4KHNA 3F9KA 3KK1A 4IKFA 5FRMA 4F3TA 1S5JA 3K57A 4FLYA 1HYVA 1ZBFA 4ICLA 3SQ0A 4IG0A 3AO3A 1VSDA 3MAQA 4FM1A 1RT2A 4R5PA 1RTDA 3ZT3A 3DLGA 3ZT2A 2Z1JA 1X9WA 1RBVA 2HNZA 4DTPA 1S9GA 3MEEA 2XY6A 3TAPA 1ASVA 1LW0A 1S6QA 3CYMA 5SWMA