1EX4A

Hiv-1 integrase catalytic core and c-terminal domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
212
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACDWAGIKQEDGIPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNSLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords INTEGRASE
publication title Crystal structure of the HIV-1 integrase catalytic core and C-terminal domains: a model for viral DNA binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 49
structure length 212
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ex4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ex4A01
2JGUA 2YKMA 3OYEA 4M3YA 4FK2A 2Z1HA 3VA3A 1B9DA 2YNHA 4OJRA 3SPYA 1NK8A 1NKCA 1J54A 4O5BA 3OYIA 4CEQA 1KCFA 3VQ6A 4IG0A 4DU4A 1SL2A 3BDPA 2YKNA 4CJKA 1U04A 4FM0A 4CGIA 3KIOA 4Z4IA 4DU1A 4FJXA 2FBVA 3TWHA 3MXMA 1KLNA 5D3GA 2D0AA 3OS2A 2X6NA 3L2VA 4CHQA 3SUQA 2KTQA 4AH9A 3VQEA 3SYZA 1B92A 4M3RA 1ASUA 4FW2A 3ZT1A 4CJTA 4Q5VA 3PO5A 1RDBA 4FJNA 1UA0A 2DFEA 2I5JA 4CHYA 5J1EA 4BDYA 1G15A 3DRRA 4CJUA 2F8TA 4CFDA 4DS4A 3MAQA 3C6TA 3OYGA 1RT1A 3HM9A 3O3FA 4QCLA 3TAFA 4DSJA 1HNVA 1WNSA 3H08A 4YFUA 2P5OA 3K5LA 3WNGA 4DLGA 2LSNA 5CZ1A 4DMNA 1RTDA 1Q9YA 3AVAA 1U45A 3TAPA 5CZ2A 3DLHA 5J2QA 5JS1A 1LW2A 2XRIA 4CJFA 1TKXA 1RT2A 4IFYA 1U48A 3K2PA 2XY6A 2G8WA 1WSIA 4FZXC 2HVIA 2GUIA 1C1CA 2HW3A 2HNDA 4KTWA 2VG7A 3ITHA 4LSNA 4Y1CA 4CK3A 1TKZA 2XO7A 4KFBA 4DQPA 3OYMA 3QEPA 4N41A 3AVBA 4CFBA 2VWKA 1SKWA 1RT5A 1UOCA 1SKRA 3L2WA 2D5RA 3U3GA 2PZSA 4CJRA 3NH0A 3SI6A 3TARA 2GBZA 4CEOA 3LWMA 3EZ5A 1SL0A 4LY7A 3EYZA 2OYQA 2P5GA 4PUOA 1RTHA 4CJ3A 3PUFA 1L3SA 4DSFA 2HNYA 4YNQA 4BDPA 4TSXA 1Q9XA 1NKBA 1I39A 1RBTA 3NGIA 2KZZA 1UAXA 1RCHA 1CLQA 1J5OA 2YHBA 1CXQA 4ELVA 3OYDA 2X6SA 1SKSA 2A1SA 1K6YA 3DLKA 3VQ9A 1S1VA 3AVHA 3O4NA 1WLJA 3WNHA 4F8RA 2DY4A 1U4BA 2VG6A 1NJZA 4H4MA 1QS4A 4CGFA 3DOKA 4RW4A 2BDPA 4W5OA 1R0AA 1WSEA 3M8QA 3AVGA 3V4IA 4OKJA 4KTZA 3OYBA 3KLFA 1KTQA 3MECA 4Z4FA 1RDDA 3A2FA 5I42A 1TK5A 3LP1A 3RMBA 2XY7A 4PQUA 3U6FA 4E19A 2QK9A 5FROA 3NF9A 3QESA 3DI6A 4AHTA 4FJ5A 4CGGA 3I0RA 4FLZA 5KGXA 3MEGA 1GOAA 4CJPA 2ETJA 3NFAA 1VSJA 4KO0A 3HP9A 1ZBLA 3KTQA 4DQRA 3SQ2A 3AO1A 3BGRA 3V6DA 3RWUA 1BIZA 3PO4A 3ISNC 3HYFA 4FJJA 3PV8A 3AVLA 1T8EA 3LAKA 1ASWA 1BQMA 2KZMA 1N6QA 3NBPA 3HK2A 4CHPA 2G8FA 4Z4HA 4BWJA 1BCMA 2P51A 1BI4A 3HT3A 1VK0A 1NK6A 2NUBA 5FDLA 3AV9A 4HVJA 3SPZA 4O44A 1KRPA 3AO2A 1QSSA 1S6QA 2QKKA 2G8IA 2G8UA 1WSFA 3RMAA 4JRQA 3O3GA 2BE2A 1KVAA 1VSIA 3M8PA 3NE6A 4Z0UA 3KLIA 4OKEA 4M45A 4JRPA 4K8XA 5FRMA 1SL1A 3OYKA 4FJ8A 4KB0A 2HHVA 1FKPA 4E7KA 1VSHA 3VQDA 4J2BA 4W5TA 3SUOA 4ELTA 1SUQA 4L8RB 2KW4A 4HUFA 3AVCA 4KREA 1KVBA 4DSLA 4CF9A 4MFBA 2E4LA 3ALYA 5CYQA 1TAUA 3VQQA 4OPJA 4PWDA 4FLUA 1C1BA 4I7FA 1Z26A 1KFSA 4KI4A 4F3OA 5D7UA 1EXQA 1D9FA 4FXDA 3SQ1A 2HHXA 4FW1A 3TAQA 4JS4A 4KHQA 3NDKA 3QETA 4DSKA 4CEAA 5KRTA 4CGHA 3O4QA 4PA1A 5J2PA 4CJ5A 1TGOA 2XY8A 3VQ5A 1BHLA 3O3HA 3DRPA 4DTSA 4DFMA 1FKOA 3HO1A 1C0UA 4C8NA 1VRTA 5C25A 3KD1E 3DM2A 4FLVA 4ELUA 3LP0A 3VQ4A 3OYAA 4CCHA 3RRGA 3SNNA 3VQ8A 2HVHA 2XHBA 1NJYA 3PX0A 3V9ZA 3QLHA 4NCGA 3SV4A 2PYLA 4HCBA 2EX3A 3CFOA 1X9MA 2IC3A 3WNEA 1KFDA 1KLMA 4JS5A 4FVMA 3KKSA 1YVUA 1U47A 1RTJA 4DTPA 2R7YA 4GMJB 3KK1A 1S6PA 3LANA 3ZSWA 3TI0A 1JL1A 4FM2A 4B9UA 4KHWA 2G8VA 1EX4A 2RKIA 4C8OA 1MU2A 4C8KA 1RBVA 4CGDA 1ITGA 4CJLA 4CECA 4DTNA 1C6VX 3VQCA 1HMVA 4AHUA 2YNGA 4FK0A 2IOCA 3TR8A 1C0TA 1EKEA 2ITGA 4B9MA 4KHSA 3IS9A 5C24A 4CGJA 1C0MA 1I3AA 4M41A 1REVA 1FK9A 1L3UA 3RTVA 3KD5E 2RF2A 2Y1IA 4I9LA 1TV6A 3DMJA 1S9GA 3AVIA 1YTAA 5CY4A 3NF7A 4EZ9A 2VG5A 3DLRA 1TKTA 4E7HA 1W0HA 4EZ6A 1S1TA 3AA4A 1T05A 4PY5A 4FLXA 3IRXA 2Z1IA 1JLBA 3LPUA 3LZJA 4HTUA 1NJXA 3HVTA 4IG3A 2X78A 3AVMA 3LDSA 1A5VA 4DQSA 1NK7A 4BACA 4N47A 4CHNA 3K5NA 2GV9A 4O55A 4NCAA 1ZYQA 2HHQA 3V9WA 3NGYA 4IKFA 1XWLA 2O4GA 4OVLA 1L3VA 2DTUA 3SCXA 2EHGA 3HPGA 4DFPA 3EY1A 3NHGA 4DU3A 2G8HA 3K5OA 5JS2A 1GOCA 4C8LA 4B9LA 1QE1A 4AHRA 1JLEA 3QEVA 4MQ3A 3V81A 3VQPA 1A5XA 1BIUA 4ZTJA 4KHNA 3HL8A 4I2QA 1LV5A 4E7LA 1NK4A 2WONA 3B6OA 5KRSA 4N5SA 4W5NA 3VQ7A 3OYLA 4CEFA 4HUGA 3S3OA 4DG1A 1CZBA 4OPKA 3QNOA 3SJJA 1VSMA 4JLHA 4C8MA 4DTJA 4F2RA 1NKEA 4BWMA 4FZZA 4CIEA 2FBXA 1TK0A 4M42A 4FM1A 3K59A 1HYVA 3LPTA 3C95A 3S3MA 4Z4EA 4EP4A 4CK1A 5KGWA 3HPOA 4M3ZA 1QTMA 1BL3A 3P83D 1RT6A 2JLEA 1RBRA 2IS3A 5HLFA 4J2EA 3MXIA 5SWMA 1X1PA 1CXUA 2DFHA 3QO9A 5DK5A 4FLWA 5HRPA 2FBYA 4KRFA 1WN7A 2XY5A 2KQ2A 3CFRA 3OJUA 4KAZA 4FJHA 1NK5A 3AA2A 4RW6A 3KJVA 1JXBA 3P1GA 4AHCA 1RTIA 1TL3A 3THVA 4FLYA 3RMCA 4CE9A 1U49A 2D0BA 4CJ4A 3DLEA 4AHSA 4M3WA 2KFNA 3MXJA 1IKXA 1JXEA 1VSFA 1WSHA 1D9DA 3SUNA 2G8KA 1QSYA 1IHVA 1JKHA 2B5JA 3TAMA 4CF8A 4ZHRA 4DS5A 2E6LA 4LD0A 1CZ9A 4DTOA 4J2DA 5T7BA 3P5JA 1IKYA 3SUPA 3S3NA 3TABA 4FLTA 4ID5A 3L2UA 2ZQBA 3LAMA 4BE1A 3AO4A 4DFKA 5FRNA 5C42A 1W9HA 4CEEA 4E89A 2IGIA 1KVCA 3C94A 3LP3A 4OKKA 2RPIA 4E3SA 1XC9A 1QSLA 2HMIA 3NAEA 4Z4GA 1WAJA 4QAGA 1T7PA 1NJWA 4FJ9A 1TKDA 3VQBA 3T3FA 1WSJA 4OGCA 1IHWA 5DMRA 3CFPA 3ZSRA 4HHTA 4ZTFA 4FZYA 1C6VA 1EP4A 2P1JA 3AVKA 4KV8A 4CJWA 3RRHA 4KB1A 4E7IA 4CFAA 3K5MA 2BGGA 1RT4A 4NCBA 1BCOA 2O4IA 3NF6A 3DLGA 3OVNA 1BISA 1HQUA 1IH7A 3V1OA 1EETA 2RN2A 2KFZA 2AJQA 3NH2A 2WOMA 4NYFA 4I9QA 4DTUA 2F8SA 2OPSA 1A5WA 3ZSZA 3F73A 1DTQA 1VSDA 1D8YA 2BANA 4KHYA 5SZTA 3ZSVA 1BI4B 3V1QA 3K58A 1LW0A 3L2RA 1TK8A 4DFJA 4B9VA 3M8RA 5HRRA 4Z4CA 4RW7A 1BGXT 1HQEA 3ZSOA 3KK2A 4M3TA 4Q0BA 1RBSA 4DSIA 4CEZA 1ZBFA 3D0PA 1L3TA 3MEEA 1TL1A 1S9EA 3G0ZA 3LWLA 4E7JA 2HB5A 3B6PA 3JYTA 1NOZA 1RBUA 4CK2A 2DFFA 2OZMA 4LSLA 2E6MA 3ZSQA 4F4KA 2HHWA 2PY5A 3QINA 4FJKA 4NYNA 1XHZA 2YHAA 4W5RA 4E1MA 5KTQA 3HJFA 3TANA 4E1NA 1HYZA 3CG7A 3L3UA 4EP5A 1IO2A 1JLCA 2IAJA 3QIOA 4O4GA 3ULDA 3S9HA 3PX4A 1UA1A 3L2QA 3OYJA 1TAQA 2YNFA 3KK3A 3FFIA 4GW6A 2VWJA 4BDZA 2OZSA 3NCIA 1JL2A 1RDAA 3UIQA 4FJLA 4G1QA 3LZIA 3ASMA 3L8BA 2ZE2A 1C1AA 3PX6A 2B4JA 4AHVA 1WAFA 3JSMA 4HCCA 4GVMA 4CIFA 4FK4A 4B9NA 4B3OA 4CFCA 2OA8A 3E01A 1F21A 3CM6A 4CJQA 1B9FA 4KKOA 3G10A 4B9SA 3VN5A 5J2NA 2HNZA 1XI1A 4ICLA 3OS1A 4N76A 1RILA 3AO3A 2ATQA 4FJ7A 1J9AA 3RMDA 3L3VA 4HUEA 3SZ2A 1ZBHA 4OLAA 1S1WA 3T1AA 4LH5A 3V9SA 1NK0A 3F9KA 2HHTA 2Z1GA 5HRSA 3HP6A 4B08A 4CIGA 1NK9A 1S5JA 2QXFA 4O0JA 1IG9A 3KLEA 3T19A 1LAVA 1DTTA 3ZSXA 3VA0A 3OYNA 5HROA 5HBMA 1HJRA 3HSTB 5HRNA 4IDKA 3DOLA 4QOZB 3PY8A 2ZD1A 4M3UA 3U3YA 2PYJA 3LP2A 1GOBA 2B6AA 4DQIA 3I8DA 4IBNA 4OLBA 1HNIA 3NGZA 3ZT4A 3V9UA 2QKBA 4XIUA 1QQCA 3MEDA 3DLBA 4J2AA 1ASVA 3AVNA 3DYAA 1FXXA 4CHZA 3QNNA 3OJSA 3TAGA 4DTMA 2HHUA 1HPZA 1RNHA 3IG1A 1L5UA 2D0CA 4B8CA 1QHTA 1VSEA 1D5AA 2W42A 4DF8A 5J2MA 3QEIA 3SV3A 4K8ZA 2HHSA 4E0DA 3ZCMA 3SQ4A 1JLAA 1Y97A 3DRSA 3M8SA 4DSEA 2A1RA 4FJIA 1YT3A 4CF1A 3LALA 3HXMA 4KI6A 3AO5A 1Q8IA 3KKRA 3K57A 3RR8A 1RT3A 1VSLA 3NF8A 4KPYA 3WNFA 2YNIA 2X74A 3KLGA 3OYHA 2FBTA 3CYMA 1SV5A 3RR7A 3QIPA 4FJGA 3ZT3A 3QERA 4UQGA 3AA5X 4I2PA 3QEWA 4WE1A 4M3XA 4DQQA 1J53A 1HYSA 3V1RA 4FJMA 4CEBA 1UWBA 4B8AB 2FC0A 3I0SA 1DLOA 4W5QA 3OY9A 4KTQA 1JLQA 1X9WA 4R5PA 3AA3A 5E41A 4RG8A 1HRHA 5K14A 4N56A 3AVJA 4FYDA 5EU7A 4CJSA 3NH1A 4F3TA 1Z25A 4DF4A 1WSGA 3V9XA 1LWEA 3OS0A 4H8KA 3C6UA 4IFVA 3OYFA 1NOYA 4DWIA 4BE2A 2YV0X 3ZSYA 2Y1JA 4ID1A 4CF2A 5HP1A 1YTUA 4CJVA 4RW9A 3KLHA 4DTRA 1QMCA 1BQNA 1XHXA 3ZT0A 5CYMA 3ZT2A 4CHOA 4DTXA 1VRUA 2Q3SA 2Z1JA 3D45A 4AILC 4FCYA 2OPQA 3TAEA 4BE0A 1IKVA 1O1WA 1RT7A 3OYCA 4F2SA 4KHUA 1LWFA 2OPPA 3CM5A 1ZBIA 3CQ8A 4CERA 4B9TA 1N5YA 1S1XA 3SQ0A 2IDOA 1X9SA 4CEDA 2F96A 4O0IA 1TVRA 1VSKA 4LH4A 4H4OA 1JLGA 4RW8A 1RDCA 5KI6A 4OGEA 3VQAA 1JLFA 5I3UA 1ZBUA 1LAWA 4Y1DA 2OPRA 4CESA 4DLEA 1LWCA 1T03A 1KSPA 3HPHA 3IAYA 3AVFA 4CF0A 1IKWA 3HVRA 3QEXA 1S1UA 4CJEA
chains in the Genus database with same CATH superfamily
1ZUUA 2HBPA 3AHUA 1WB9A 1YITA 2CH4A 4OJRA 5AQPA 1NKCA 3OYIA 5AQLA 1KCFA 3VQ6A 3WXKA 4CJKA 2CP6A 2R5AA 4I6MB 4FWOA 1N32K 3CPWA 4DU1A 3KFVA 3VYHB 4FJXA 4J9HA 4LXCA 2L2PA 1NBEB 2K5IA 3THKA 4DV4K 2C0OA 3TWHA 4M75A 1KLNA 3O8MA 1YJ9Q 4M7DF 4JK7A 1VQ6A 4AH9A 4WFNL 4PL8A 2QDLA 3BDUA 4EMHA 1IBLK 1UA0A 1X3MA 5GAOr 3O1WA 4CZEA 4CJUA 3OMCA 4CFDA 4DS4A 1UG1A 3OYGA 2EYZA 1RGIA 3G6ET 1WBDA 1VQ6N 2D6FA 2KE9A 4C8QA 3K5LA 2E65A 4NO7A 2LSNA 5CZ1A 1H3ZA 3VF2A 4DMNA 3I56N 1U45A 4IUPA 5CZ2A 4BC3A 2LTOA 3GOIA 4XTWA 1LW2A 4CJFA 4JI3K 1G3YA 3TTFA 4KGZB 3RR6A 1AT1B 1VQLQ 1D3BA 3K2PA 1T0HA 2C0TA 4X66K 4FZXC 2HVIA 3KHYA 2O4XB 4ZGEB 2HNDA 4LSNA 4Y1CA 2A08A 5GMKm 3CXCM 2NUPB 3OYMA 4K0KK 5KYXB 1UUEA 2J06A 1JCGA 3AVBA 4X65K 3P8DA 2NZTA 2VWKA 2QQBA 4N0AA 2H8HA 4ME7A 3GL1A 2ITMA 3CCQA 3JB9G 2Q2RA 2FF6A 2RQVA 1GLAG 2D5RA 2QWOA 3BUZB 2HBKA 3GG4A 3ZFJA 2YT6A 1QCOA 3NH0A 4WQ5C 3C12A 2CSIA 1D1BA 3SI6A 3TARA 4NL3A 2O01E 5GMKj 5M9OA 2DLPA 1GLCG 4LY7A 1RTHA 1WBBA 4J7IA 3PUFA 4DSFA 3CCQN 3WEEA 4ZGJB 5FU6C 4RCBA 2YHBA 1HNWK 1VQKA 2CGLA 2X6SA 2QAZA 3QBYA 3D2EA 1K6YA 3MX2A 4H5TA 1AOJA 3AVHA 4HCZA 2AT1B 1PHTA 3MCAB 4H4MA 1NJZA 2KT1A 2ZCFB 5KH6A 2BDPA 1VQKN 2KYMA 1R0AA 1YUWA 2ED0A 3CMET 3V4IA 1MUZA 3ULRB 4KTZA 1KTQA 1D0YA 3QUIA 4N4IA 5AR0A 1TSFA 3NGPA 1KD1U 1RI9A 4JKBA 4Z8AA 3NVKA 4LF9K 2QQAA 3GIBA 2RJCA 3RMBA 3CCSA 1RLPC 3ATUA 2UXCK 3JCMh 4FJ5A 2EW3A 2KKZA 1JXOA 3M0QA 1GOAA 3NTHA 2E6ZA 1QQNA 2MAMA 3SDZA 1OPLA 1OV3A 1PKSA 3CBPA 4QQGA 1ZBLA 3M0UA 4DQRA 1YNZA 2XDPA 3CCSN 1OU8A 5GAOl 1YIJA 1BIZA 3HYFA 4CBXA 3AVLA 1BQMA 1SKUB 2Y90A 3R1XA 2NYSA 1HK9A 4BWJA 2P51A 3HT3A 5FDLA 4HVJA 1YIJN 2YSQA 3JAME 1S6QA 3UKRA 2G8UA 1WSFA 3BE3A 2JW4A 5GAMj 3M8PA 3NE6A 3FZFA 3URGA 2P9IB 2UYTA 1OZ2A 2PNIA 3C7NA 4OKEA 4M45A 4K8XA 5JLFA 2HHVA 3WXJA 4E7KA 4JAXA 2YI1A 5GAN8 2ZJQL 1SUQA 4CW7B 3CCVA 3SB2A 1WFWA 2BUDA 4DEYA 1FX7A 3GNGA 1KVBA 1YHQA 1W2BA 3UATA 1VQ8T 2CDTA 1GLJO 1IG8A 5GMKh 2G3RA 4CZLA 4BC2A 5AQGA 4OPJA 4C92F 4F7UF 4I7FA 1Z26A 1C0FA 3CCVN 2AZVA 3MP8A 4FXDA 4BC5A 2AIRB 1YHQN 4LFBK 4KHQA 1NEGA 2F2XA 3NDKA 1BKBA 1K8AO 2F7TA 5ADXA 5BRFA 4PA1A 4J83A 4DBHA 4XU0A 4OMPA 1WPYA 1QVGA 3O3HA 2O8DA 4BY6C 4GV6A 3VEYA 1K0XA 3BY5A 5C25A 4YOUA 2PUKB 3RSEA 3LP0A 3VQ4A 2ZAEA 1YBYA 1JQQA 2W0ZA 1WI7A 3CPWP 1VYVA 1NJYA 3PX0A 2PYLA 3N4PA 4EHUA 5KQ8A 1KFDA 1JJ2A 2HDAA 3EKSA 1Q81O 4FVMA 3KKSA 1K9MC 1U47A 4PL7A 4DTPA 3CQXA 4GMJB 3KK1A 3TI0A 1Q18A 4B9UA 1EX4A 4E1JA 4JKHA 2V7ZA 1BB9A 4CJLA 2HBMA 4NXMK 3VQCA 1ATNA 3E9LA 2PTKA 3M57A 2IOCA 3TR8A 4FK0A 1FJGK 5GANd 3S6WA 3IS9A 5C24A 2NRVA 2LT1A 3DWLA 2HKNA 4M41A 2EJ9A 4B3TK 3JCMd 1L3UA 5GAMh 3CCJA 3G71Q 3KD5E 3CBOA 3JCMQ 2Y1IA 4B6MA 2AKLA 5KYYB 1TV6A 1ZBSA 2NLXA 1AWWA 3DMJA 3AVIA 4J9BA 3HM9A 2L3PA 1PNJA 1YTAA 1VQMA 4D8KA 3TSPA 4CVNE 4OMQA 3CCLQ 1TKTA 4A2AA 3CCJN 1WXBA 3CJBA 3EN9A 3ZETA 4JI5K 1KIKA 1JLBA 5GAOm 3LPUA 3AVMA 1NK7A 4EDUA 1A5VA 4M75B 4N47A 4CHNA 1Z9QA 2L3RA 2GV9A 2EWNA 3A5OC 4O55A 3K5NA 1ZYQA 1VQMN 1P92A 4PKCC 1VQPQ 3CPWM 1XWLA 3CMAT 3HSBA 4OVLA 1G3SA 1VQ9A 3SCXA 4PK4A 5KYUA 2FXUA 1OH8A 2F9TA 2VUBA 4AHRA 1VQ4A 4HVWA 3UB5A 4ZN1A 1X9JA 4C8QB 4ZTJA 3IUCA 4KHNA 2GBQA 4IZ9A 4M7DD 5EXWA 4N5SA 1VQ9N 3OYLA 4IIMA 4JD2B 3VEXA 4HUGA 5JVHL 3SJJA 1VQ4N 1NKEA 1D3BB 4CZKA 1VQNT 3FC3A 3K59A 4IXCA 2YUNA 2DZCA 4DB3A 4BREA 4M7AF 3IFRA 4M3ZA 1QTMA 1CKBA 4ZGDB 3P83D 4BRNA 5AQTA 3AGRA 3CF5L 5HLFA 3VJPA 5LL6Z 2CZ7B 3QO9A 1BWFO 3VEZA 4KULA 4FJHA 1RAAB 1V29B 2ZGYA 3AA2A 3BDLA 5H1SQ 1QKXA 5GAN3 5GAMf 1BOTO 2HOEA 4JKFA 4FLYA 1SSFA 3L1AA 5FPEA 3RMCA 1U49A 2D0BA 2FHDA 5LJVA 1NYFA 1IKXA 3WEEB 1OOTA 4LF4K 1X01A 1K8AR 4JPBW 1JKHA 4CF8A 2RHYA 4ZHRA 4MDXA 4D8DA 6AT1B 1KC8R 1NBWA 4DV3K 2Q97A 3CCRT 2DTIA 4HVVA 3D2EB 3UWNA 1XJWB 3OBWA 4R56A 5LJ3d 3LAMA 4FLTA 4DBFA 1I94K 3VS7A 4X62K 3JCMX 2LJ0A 3VGMA 3JXUA 5AJ3K 3CQYA 3ZL7C 4FWLA 1T7PA 4ILHA 1IREB 3H6EA 1IB8A 4QS8A 4FYXB 3BP8A 2E3HA 3OSSC 3T3FA 5DMRA 1U1TA 1BBZA 2YXYA 4ZTFA 1WXTA 1W2BP 1Q81R 3ATVA 4M75G 1S1NA 1T3LA 3H46O 4KH4A 3AAQA 4KV8A 2DL3A 2OTJA 1UB4A 1UTIA 4KB1A 1ATRA 1Q82U 3K5MA 4RTXA 4PNOA 2EQMA 3UDCA 2LCSA 3DB4A 1BCOA 3THXA 2L3QA 4L3QA 5GAEP 3DLGA 2AJQA 2QG9B 1EETA 4J9IA 3EH2A 3OS5A 2KFZA 2K3XA 4KGXB 4NYFA 2DL7A 4DTUA 2L89A 5LJ5d 2OTJN 4C8QG 4MZPA 1EQYA 4ISGA 3F73A 5B8HA 3VRYA 1BI3A 2QGFB 1QVGP 2O8BA 4PJOF 2FSKA 3ZSVA 1HNZK 2EBPA 1X2KA 4ATOA 3M8RA 3REBB 3UKRB 3A5LC 4MZMA 2EAYA 4JRIA 1BGXT 5LL6S 4D6WA 2D4WA 2BIVA 4FPBA 2JS2A 3C7NB 1VQ7Q 2RK2A 3D0PA 1L3TA 4JK8A 1ZUKA 3HFOA 5C2FA 3VESA 1VQ5T 3LWLA 2LCCA 3JYTA 1M1KC 2DFFA 1JJ2P 4DR5K 2E6MA 2YHYA 2RHIA 4IO9L 4J9GA 4NYNA 1CSKA 4W5RA 5KTQA 3HJFA 2I0NA 2KRMA 3E2UA 3VRZA 1H641 4EP5A 2HF3A 1IO2A 3QIOA 5GAMg 2E1YA 2LX7A 4M77C 4GBQA 3T7ZA 3PX4A 2P9KB 4WQ4C 1MNEA 5E26A 1TAQA 2DF6A 2Q31A 3EGDA 1JL2A 2BTFA 2IVOA 2E10A 2B4JA 4AHVA 3FDRA 3JSMA 4JK9A 4OMMA 4B9NA 1MV3A 1M30A 4FYWB 5EY4A 2O8DB 3M0SA 3EE9A 1B9FA 2LJ1A 3G10A 4CJQA 1YI2A 4IURA 5BN9A 2EJGA 4OMLA 3MN6A 3RSEB 1IRXA 4N76A 3AO3A 1E6HA 4FWNA 1J9AA 3RMDA 3L3VA 3SZ2A 1ZBHA 4HXJA 1H8KA 2Z0WA 4X34A 1NK0A 2DXUA 3F9KA 1LVKA 2W10A 5HK0A 5HRSA 1YI2N 1UGQB 1WHMA 2E12A 4CIGA 3DXMA 1DTTA 1W70A 3HSTB 3GE1A 3DB3A 3DOLA 3UE5A 3CCMT 4M3UA 2D0NA 3U3YA 1GOBA 2B6AA 4LE9A 4AG1C 5I2SA 2EKOA 1HNIA 5C12A 4X64K 3V9UA 1LPLA 1JJ2M 4BRGA 3QNNA 3TAGA 1HYOA 4CZHA 3OJSA 4BRIA 1NJIO 2HHUA 1RNHA 3IG1A 3QEIA 4LC9B 4B3RK 4K8ZA 1PRLC 1JLAA 3CC2T 4LDVA 2F9WA 4J9EA 4DSEA 1TUGB 4FJIA 2CUDA 2DJZA 4OP0A 1YWPA 2QEXT 3LALA 2ASMA 5A0GA 3G4ST 4XEIA 5GADP 3HXMA 2L8DA 1PCXA 3E66A 3IDHA 2QA4T 3KKRA 3K57A 4M7DE 3WNFA 8AT1B 2X74A 3KLGA 2BE9B 3PIPL 3Q1JA 2ZPGB 3RR7A 3WVEB 4L5GA 4A4HA 3CCRN 3ZETB 4ESRA 3UF4A 4JZ4A 3X26B 1YJWA 3AA5X 3HI0A 4DQQA 4J8FA 3HTVA 2IIRA 4WCIA 4XAXB 3GDQA 5KYNA 1UWBA 3I0SA 4BI8B 3OY9A 4PLLA 3I55Q 1K9MO 3QBWA 1QW1A 2JN0A 2DPPB 2JTMA 5E41A 3EH1A 5EU7A 1QWEA 3NH1A 4F3TA 1YJWN 3V9XA 3OMGA 2A3LA 3OS0A 3X20B 5KYUB 4BE2A 2YV0X 5EX5A 3SAFA 3RKXA 1K0SA 1RUWA 4CJVA 2DK3A 4RW9A 2SEMA 1QKWA 3QSUA 1TKDA 4F17A 5A2QE 3FR0A 4CHOA 1V1CA 1VRUA 2GQVA 1TTHB 4FCYA 2GNCA 2DBMA 4CC3A 5KCOA 4BE0A 1HPMA 5CR4A 3TAEA 2BE7D 3OYCA 1RT7A 1T6DA 4F2SA 4KHUA 4IUUA 3P31A 5GAHP 1LWFA 1RAGB 1ZSZA 4LUEA 4OX9K 2E5KA 4BVOA 3UKUA 2BZYA 2PUOB 4FPAA 2QWPA 3SQ0A 4CEDA 2F96A 2P4TA 2NUPA 2A0FB 1JLGA 2W41A 4J9CA 4K25A 2V26A 4RW8A 5KI6A 5GIOA 1G8XA 3M56A 1NG2A 1M90U 1VQOT 1LAWA 4FWQA 3BFMA 2OPRA 2PFUA 4CESA 1T03A 1ARKA 3I55A 4NS5A 4M7DA 4A57A 3I8BA 3E1YA 2HMPA 4CJEA 2ZPHB 2YKMA 3OQ5A 3VA3A 4R79A 4DR7K 4M7AD 2YNHA 1ZBJA 3ME9A 1KQSA 1PC0A 4C23A 3BDPA 4O8UA 3LDQA 1FWZA 3QBXA 2NNWA 3CD6Q 3DLLA 2Q0RA 4CGIA 2ROLA 4FM0A 4Z4IA 1HR0K 2CGJA 5E84A 3VTIA 4FSXA 2JXBA 1N27A 5D3GA 2D0AA 3L2VA 4B1XB 4CHQA 1GLEG 2IVPA 1QCFA 4CJTA 3ZT1A 1H1VA 3C6AA 1NGHA 3M1FA 1J6ZA 1G15A 3DRRA 5HY6A 2XD0A 1YITT 3SMPA 3MAQA 3JCMe 4QCLA 2FG0A 4YFUA 3CCUQ 4LDYA 2DX1A 4AMCA 4DLGA 1VYTA 1K73C 3KWIA 4PJMA 4M78C 2X3XD 4Z94A 2DXBA 3V8KA 2ZJRL 1O9SA 3TAPA 3DLHA 4LDUA 3P38A 2XRIA 1VQ6T 1TKXA 2W40A 2BH1A 3GLXA 5GAN4 4IFYA 1U48A 1TUCA 2XY6A 2HHHK 2G8WA 1K8AU 2DERA 1WSIA 2GUIA 2HW3A 4PFPA 3THXB 1WNLA 5CO7A 3NTKA 2GWKA 4MDWA 3I33A 1OPKA 2XO7A 1RI0A 4A4EA 1NJIR 2KRSA 4Y28E 3JCMc 1Q95G 2QW9A 4CF1A 5CVIA 2O8BB 3RESA 1YFNA 3CCMN 1GLFO 2PZSA 2YDLA 1W2BS 1CZAN 3Q7BA 3GBTA 3LWMA 2OYQA 3EYZA 4PUOA 2O2OA 4CJ3A 4BRFA 1L3SA 3EGXA 2DO3A 2DTHA 5IT9E 3A8OB 5GAN7 2HNYA 2A41A 3QO3A 4JI4K 3NGIA 1GFDA 4N0AC 1UAXA 3NMZC 1CLQA 1J5OA 4JI7K 2NRZA 1WHJA 1CXQA 4ELVA 4C92E 4CZMA 5GMKe 1H3HA 4PJOD 5J26A 1RDWX 3J80E 1QZ6A 2O8EA 3CCQT 4B1UB 4C1NK 4H5WA 3VQ9A 3WNHA 4A59A 1QVGS 2VB6A 1NLVA 1WLJA 4OF1A 2AP1A 4AM6A 1U4BA 4YOYA 1K9MR 3HRSA 5M1QA 1XQHA 1N8RC 4IJAA 4OPHA 1ABQA 1WSEA 4JV5K 4A4GA 4CC7A 1RDDA 3A2FA 3LWHA 2V7YA 3G25A 2CP5A 1T3SA 1WYXA 1VQKT 3O9TA 3EGDB 1WJSA 5FROA 4E19A 1S72Q 1Q7YO 2QK9A 3J81O 5BPNA 4DUZK 4AHTA 4CGGA 1NG9A 2K79A 2JTFA 4JKAA 3VERA 4BRHA 4HA8A 1I8FA 1UDLA 2YHWA 1RADB 3KWGA 3AO1A 3VS6A 5JMVA 3I5RA 3QIIA 5CHIA 3V6DA 1B7TA 3E1SA 2FRYA 1ASWA 1N9SA 2KYBA 2KDSA 2QGGA 4OPAA 4Z4HA 3CCST 3CIPA 5C0YA 1NK6A 1M1KO 2NUBA 1RABB 2K3YA 3LW5E 3SPZA 3DXMB 2JWKA 5AQSA 3J7ZO 1R77A 5FW9A 1QVFA 2YHTA 2VCPA 2QKKA 4LF7K 3MP1A 3O3GA 3J7AP 3CPEA 1VSIA 1I4K1 2YUQA 4C92A 4Z0UA 4GV3A 4DKWA 4OB0B 5FRMA 2FZGB 1YIJT 1Q86U 3OYKA 4FJ8A 3LL3A 5KE2A 4O8KA 2YJEA 1R0BG 4BVPA 5HL7L 4JEPA 3A8HB 3X24B 3GP8A 3C0CA 4JUVA 3SUOA 4FO0A 4L8RB 1S72A 3R6OA 4OB2B 2C06A 2DAQA 2X35A 3HPWA 4DSLA 3O9QA 4DA4A 4CF9A 2E4LA 5LJ5e 5TKYA 1TAUA 2NRXA 2RE2A 3PVQA 3EFSA 4MDAA 2O9VA 3SFMA 3DKMA 1EXQA 3SQ1A 1OH6A 3INZA 2GTJA 2CH4W 3O80A 3MK6A 3SAGA 2JMCA 1CKAA 4CGHA 3I56Q 2K7AA 3CCVT 1SSHA 2RHUA 2ZGWA 1HKCA 5J2PA 3CC4A 4J5YA 4DFMA 1BHLA 3DRPA 2JVVA 2LMJA 1YHQT 2YRCA 2O8CA 2NLUA 4C8NA 1RAIB 1VRTA 3EKUA 1TWBA 2K2MA 2JS0A 1YITN 2YLCA 2PVGB 4WYBA 4FSVA 3VTHA 3QB0A 1KQSP 3CC4N 4XTXA 4CCHA 2FSJA 3MX5A 3VQ8A 2XHBA 5AQKA 1G3WA 1IBMK 4NCGA 4HCBA 3SV4A 4JHDA 2RI5A 1GCQA 4O5FA 1ZBXA 3KUFA 1KLMA 4JS5A 4M7AE 2OTLQ 3OW2A 1RTJA 4JKCA 4JD2A 5HCKA 4K41A 4F04B 3LANA 2J6KA 4FM2A 2G8VA 4OVAA 4AFQC 1ZSZB 3CCEA 4C8KA 3UKUB 1ATSA 3F70A 4CECA 1UGVA 5DM7L 1C6VX 4PFOA 1HMVA 2EJFA 3M4YA 3R3LA 4AHUA 1OI1A 2YNGA 2X9HA 5CK9A 1ZHIA 5AQNA 1C0TA 3SAHA 4LNPA 4B9MA 5DM7R 4BG8A 3CCEN 1C0MA 4L59A 3EG9A 3PIOL 4XU1A 3RERA 2OANA 2RF2A 2OX7A 2CP3A 1YJ9A 4M7DB 4M77F 4NOYA 3LDOA 2VQFK 4AF1A 4ILGB 4IOCL 1QLYA 4EIKA 3THWA 2VG5A 3DLRA 4EMGA 3AARA 3GBQA 1W0HA 4C0FA 5CR2A 1C0GA 1S1TA 4AQYK 4EZ6A 3IRXA 1YJ9N 1Q7YR 3K9KA 4HTUA 2M1HA 2DETA 2JUFA 2X78A 4IG3A 4DQSA 3K9JA 4CZFA 1YVNA 3I35A 2OTLA 3O9SA 4B3MK 3CCJT 3SLCA 2MWPA 3NGYA 4KGVB 5CQYA 1VQLA 1WLPB 3A8LB 3EY1A 1VQMT 2MIOA 1QP2A 1RAHB 1GOCA 2LT4A 1QE1A 5F1XA 1RAFB 4BD3A 4M7AA 2MWOA 5I11A 3HL8A 2WUSA 1M1KR 3EGUA 1VQLN 4ZNXA 1G5VA 4DG1A 4PKHA 3VUZA 4OPKA 2D9TA 1XHZA 4DTJA 1Y57A 5CAIA 1TK0A 4M42A 2JWLA 3EFOB 4FM1A 4LD9K 3C65A 2HEQA 3C95A 2KROA 4KT0E 1VQ9T 4PJOE 2YCHA 4H5NA 2GCXA 1AWOA 1ACMB 4BR7A 3HPOA 2J05A 4C0DB 1VQ4T 4KBOA 3CC7Q 3T1HK 2ATCB 2WSEE 4BRPA 2IS3A 5EOYA 1AHJB 1BIAA 4C5IA 2VWBA 1WJRA 5M1FA 5SWMA 3MXIA 3U9DA 2DRMA 5HRPA 2DD4A 2XY5A 1QCNA 5FU7C 4KAZA 2QYZA 1BA0A 3R8EA 4IDHA 4RW6A 1SEMA 2WBNA 1JXBA 3GF5A 4DQ2A 2YX6A 4ISEA 3KJVA 3P1GA 4BRQA 1YXQA 2RQRA 3ZEHA 2VVKA 4CE9A 3RIRA 3EGXB 4AHSA 4M3WA 2KFNA 1KD1C 3VEVA 4FSSA 3H3NO 1WSHA 2G8KA 4XTVA 1MMDA 5KE3A 2B5JA 3TAMA 4CZJA 2O8EB 2E6LA 3O5BA 2D0OA 4LD0A 4J2DA 5I22A 3RVCA 3T69A 3EG3A 5KPTA 3X25B 1QVFP 4ID5A 1BI2A 1OVQA 1IV0A 1NJIU 3G6EQ 1W9HA 4E89A 4M7DG 3LP3A 2LNHB 2FZCB 1WHHA 4QAGA 3NAEA 4Z4GA 3JCMV 1NJWA 1NGJA 4LN2A 2P84A 1IO6A 2OJ2A 2P9KA 1HXDA 1OEBA 5GJVB 1IHWA 1WSJA 2QQ9A 3CFPA 4HHTA 4YHHK 3RKYA 3A0IX 1EP4A 2FPEA 4DV7K 4FM4B 1UHFA 2P1JA 1U3OA 4PJOA 2I7NA 3AVKA 3OA9A 4NLCA 4CJWA 1KFZA 2VXFA 2MI6A 3B8AX 1M5Q1 4CFAA 1KC8O 2EIFA 2FZKB 4NCBA 1NGIA 5IN1A 1YF5L 3H41A 3OVNA 4ISFA 1HQUA 1IH7A 3V1OA 2FEIA 2CREA 2RN2A 2F2VA 4OO1J 4BRCA 3JB9I 4FL6A 2ZPEB 2F8SA 2OPSA 1HJDA 3KZBA 1K9MU 1DTQA 4E6RA 1VSDA 1BG3A 4H03B 3ZSZA 4BGBA 4PKIA 2R5MA 4KHYA 1W4SA 2LZ6B 3V1QA 2QQSA 4OMNA 1LW0A 3L2RA 1I5LA 3M0TA 4DOWA 5L23A 2OTJT 2EWSA 2NRHA 1MWMA 3JB9D 2DJQA 3KK2A 1ZA1B 3E19A 2CT3A 2P9UA 3H1VX 3Q7CA 2CUBA 2VASA 1RBSA 3CJ7A 4C92B 3CJ9A 1N8RO 4DSIA 5CE3A 2X4XA 2O88A 1WUAA 4Y0WA 3G0ZA 4EMKB 2HB5A 1KQ1A 3B6PA 4KUIA 1RBUA 4CK2A 1W1FA 1MDUB 3TCJA 1NGBA 2J7IA 2K4YA 3OW2P 3QINA 1SF9A 1WIEA 4KUDK 1DKGD 4FU6A 3CMEQ 4RTVA 2JM8A 3O1BA 2J6OA 3CG7A 3L3UA 3F2KA 4DV6K 4C1NI 2I7PA 3S9HA 2YNFA 1SRMA 3KK3A 4GY5A 4GW6A 3VMFB 4M78F 1QQMA 1RDAA 3UIQA 3KK7A 4FJLA 2EQKA 3LZIA 3ASMA 1D09B 3WT0A 5TKWA 3PIPA 2HAXA 1T3VA 2NRRA 2KRNA 2KGTA 4HCCA 2GELA 3FZMA 2MMPA 4GVMA 4FK4A 4IEEA 2HL3A 2CT4A 4B3OA 4WQ5A 4Z88A 2O8CB 5BN8A 2E2PA 3OBYA 3MEUA 4YOWA 1XI1A 4KHPK 5ECAA 4OLAA 4LH5A 4C5GA 1W6XA 3HP6A 4X9DA 1QHAA 4JHDB 1S5JA 2QXFA 2JOYA 1ILYA 1LAVA 3ZSXA 2LQNA 5HROA 4WFAL 5HBMA 3U9ZA 5HRNA 3UA7A 3FJ5A 3PY8A 4JN4A 2KBTA 1YI2T 1QVPA 3MP6A 4QS7A 4DQIA 4OLBA 3I8DA 3NGZA 3MPUB 3G71A 2FPFA 4XIUA 2WSCE 1KQSS 3MEVA 4CHZA 1JB0E 1HPZA 1L5UA 4KH1B 5AT1B 2W42A 1HX1A 1QHTA 4B8CA 3TSUA 4DF8A 1VQ8Q 3SV3A 3CCLA 4BR2A 5AQHA 5AZIA 2P0KA 3SK3A 3G71N 1WDXA 2RMOA 3META 2DL8A 3M8SA 2A1RA 2KXDA 3RMSA 3EG9B 1GRIA 4FOIA 4EPCA 4EAHD 1SG5A 5EC7A 1XC3A 1NYGA 4KI6A 1UJ0A 3C6HA 3CCLN 1VQPA 2LQWA 1EZZB 4C92G 2X4YA 5D6XA 1RT3A 2CH5A 3NF8A 3RR8A 4KPYA 5CKHA 2YNIA 5LJWA 2FPDA 2UXDK 1JCFA 2FBTA 3CYMA 3THWB 3E9FA 1SV5A 3QIPA 4FJGA 3R6MA 3U23A 5D6YA 1N36K 3MJXA 4JKDA 1VQPN 3JB9H 3V1RA 2DEQA 1P8ZA 3M5AA 3LGLA 4CEBA 3QJ6A 5GAOq 4M77D 4B8AB 1DLOA 1G83A 5AZJA 4W5QA 3QWYA 1JLQA 1X9WA 3AA3A 4NXNK 3N4QA 1GXIE 1RDUA 3THYA 4BGAA 1AVZC 4NB4A 2PZ1A 2HZYA 1YCYA 3C6UA 4IFVA 4WF9L 3FLCO 1RFQA 1NOYA 4WFBL 3ID8A 1IGQA 4J9FA 4M7AB 2Y1JA 4G9ZA 4AFUC 4CF2A 1YJWT 4DTRA 2ROTA 4LUDA 2EYWA 4MZTA 2L3SA 3E9OA 3ZT2A 4DTXA 2OCEA 2Q3SA 3EG1A 1IKVA 4GLKA 4WCEL 2H3GX 1BDGA 3QFPA 2ENMA 4RTYA 4H0PA 1N8RR 2Q1NA 1Q7YU 2OPPA 3V8LA 4LDXA 4IOXA 4DQ8A 3CQ8A 4B9TA 2JT4A 1N5YA 3O6WA 3QDKA 1S1XA 4GY2B 5GAMd 2IDOA 1TXQA 1X9SA 4O0IA 3ZEUA 4LH4A 2EKHA 3PLAA 2EGEA 4OGEA 2XKOC 2KEAA 3QWXX 4BR4A 2OAWA 2XICA 1R8OB 2PVDB 4DLEA 2R57A 1HKGA 1LWCA 1KSPA 1YJNQ 1ZSZC 3AVFA 3IAYA 4L6V5 1FMWA 1HSQA 4KH5A 3EAEA 2JGUA 1BA1A 4M3YA 4FK2A 2Z1HA 3M58A 3VENA 4M7YA 1NK8A 1W97L 1SL2A 4CEQA 4A63B 3JB9J 2W6KA 1D0XA 1NPPA 1PD1A 2YKNA 1U04A 5GIPA 1D0ZA 3IQLA 3QDRB 2DE0X 3MXMA 1UGPB 2X6NA 4OB1B 1XUPO 3CMAQ 3VQEA 3SYZA 4M3RA 1ASUA 4FW2A 5CQXA 3PO5A 1E4GT 4V19S 1RDBA 1ZSGA 1X69A 3FFKB 1Q82C 2DFEA 2I5JA 4CHYA 2MYSA 5J1EA 2MPXC 2DA9A 3ASKA 4BB7A 1MMAA 3C6TA 1X6OA 3E9PA 1ZX6A 3I5SA 5BR9A 4AFSC 4R55A 3O3FA 3TAFA 1J5EK 4DSJA 2B8AA 4F14A 4QS9A 2P5OA 1Y0MA 2J6FA 4Y92A 4FT4A 5GMKi 2VQEK 1WHLA 1W2BM 1Q9YA 3AVAA 3RMQA 2HNIA 2M02A 5J2QA 4MMLA 1YJNA 1VQNQ 4BRDA 4PJOB 5FWCA 1QVFS 1M27C 4M4ZA 3L4IA 1JO8A 2RH2A 1K76A 3C0BA 2VG7A 3ITHA 4AFZC 3D2FA 4CK3A 1TKZA 4HT9A 1KD1O 4N41A 2FL7A 1QVGM 2HBLA 1VQ7A 1M8MA 1PSFA 4M7AG 4CFBA 1SKWA 1JU5C 4JI0K 2RHZA 5GINA 5AQFA 2K3BA 3MEAA 4JKEA 2GBZA 4CEOA 1WQWA 1SL0A 1VQ7N 2P5GA 2A40A 2KY9A 2P9UB 3JRZA 4TSXA 1Q9XA 3VKIA 3HFNA 1RCHA 3PGGA 2F1LA 2LNVA 4IWVA 1AD5A 4PHTX 5DLQE 3HZ6A 1EO1A 3N5BB 2A1SA 2GTOA 5D6WA 1S1VA 3O4NA 2BZ8A 4VUBA 4A54A 1QS4A 3DOKA 5ELZA 4U7BA 4W5OA 3REAB 5FPMA 3M8QA 2RD1A 3GNFB 3JCMP 3OYBA 3AVGA 1AZGB 4UC4A 3UT1A 3KLFA 2LRQA 1TK5A 2IIMA 3LP1A 3BZCA 3M4GA 2XY7A 4PQUA 3U6FA 1K1ZA 3RBBB 4FLZA 5KGXA 3GOXA 1LOJA 4CJPA 2V1QA 3J81E 4A5BA 2DL4A 3OW2S 4JJCA 1VSJA 4KO0A 3VOVA 5M1KA 4LF5K 2VV5A 3BGRA 3PO4A 3CQTA 4M78D 4M63C 1T8EA 1FMKA 3LAKA 4JZ3A 5BPLA 1N6QA 3NBPA 1NM1A 3NHNA 5FU6B 5IHNA 2WACA 4K42A 4CHPA 3HK2A 1D4XA 3OTOK 2FO0A 1NGFA 1VK0A 3VS5A 3CI5A 3AV9A 2VGNA 2F69A 4JLGA 1BU6O 1Z6RA 4C8QD 4O44A 4PJOG 4DBRA 4X9CA 2G8IA 2M0YA 4H5RA 3RMAA 4JRQA 1NE8A 2A6AA 4DR4K 2D0PA 3VYGA 1XOVA 1AZEA 1KVAA 5AQUA 3LGFA 1GFCA 3KLIA 2MK5A 1VQ5Q 5AQRA 5CKBA 4MO5A 3A1PA 2E64A 1SL1A 1TUUA 4DHYA 4W5TA 4CZGA 5JLHA 3HOSA 4ELTA 3EG0A 4M77E 1OZ3A 4E7SA 4HUFA 4JKGA 1SRLA 2G6FX 4E7ZA 4IUQA 4KREA 1B07A 5AZIB 4MLEA 1M9SA 4MFBA 1KHCA 2DXCA 2YRDA 3QKJA 4C92C 4RTFD 2KSSA 1C1BA 1NGDA 3PIOA 9ATCB 5DLOA 3U8XA 2KHOA 1W7AA 4F3OA 2HL5C 5LY3A 2E41A 4QVDA 4CD1A 3TAQA 1R59O 2GWJA 5AFUH 4PL6A 5FWBA 1XNIA 3QETA 4DSKA 2H3EB 3H0IA 5IXFA 3CXCA 3O4QA 3BF3A 5EVZA 3I55N 4CJ5A 2XY8A 5F2RA 1X6GA 4XH4A 4BQLA 2ZPFB 5AZJB 5J3BA 4FLVA 1LJOA 1NWKA 2NRWA 4LF6K 3OYAA 3THYB 1WHGA 3SNNA 1OX8A 2HVHA 3LLRA 3VGLA 1KD1R 1PG5B 3QLHA 1ZQ1A 3EHRA 5I21A 3FZKA 2NRTA 2ZPIB 3FIFA 3CFOA 1ZA2B 2RJDA 2IC3A 4M75C 4P5NA 3E9GA 2DFUA 1IZ6A 3CC4T 3QICA 3ENOA 2HQEA 1M90C 3WNEA 5DY9A 2E88A 1YVUA 5JICA 2UU9K 2R7YA 1VIEA 5KCHA 3ZSWA 4JRKA 2FRWA 8ATCB 4IO8A 4KHWA 2COZA 4C8OA 2LX9A 4M77A 4CRIA 3MWPA 4BC4A 3EFOA 2MOXA 3L2ZA 1RBVA 4DTNA 4C8QC 4LF8K 1GCQC 3CC2Q 2CZ6B 1KC8U 3ZEUB 2DIGA 1E3MA 1EKEA 3CD6A 2ITGA 1BK2A 2F2WA 1LCKA 2QEXQ 2QM1A 3CETA 3DAWA 1GLDG 3G4SQ 4CGJA 1REVA 1BI1A 2UXBK 4FWKA 1X3NA 2QA4Q 3RTVA 2RHXA 3O8VA 3DLMA 1XNRK 2RF0A 3VEOA 3H3OB 2HMAA 3CCET 3NF7A 5FLXO 3FB9A 4KH6A 3VEWA 1X2QA 2ED1A 2VYTA 4ZN3A 3AA4A 2BTTA 1T05A 4PY5A 4FLXA 4J8OA 3A8MB 1Q81U 2Z1IA 3CCUA 5GAGP 3LZJA 1OH5A 3UPUA 2YWWA 1I1JA 2QXLA 4F7UE 1KJWA 3V7CA 4NCAA 2HSEB 3ZX0A 3ZYYX 2HHQA 3O9UA 4YDUA 3H0HA 1YJ9T 2O4GA 3H1QA 4RWTA 3CCUN 1U8RA 4RMOA 1L3VA 2YLBA 2EHGA 1M3BA 3NHGA 4DU3A 3SHWA 5JS2A 1MMNA 3V7RA 4NLBA 4C8LA 3TREA 4B9LA 3PVLA 1HD3A 1O75A 3NPFA 4MQ3A 3QEVA 3V81A 3VUBA 3VQPA 1A5XA 1BIUA 2D1XA 1UGRB 3TVTA 2E8AA 4QT7A 1NK4A 2A36A 4W5NA 3KVGA 2CP7A 2DBKA 2KVQG 4H0OA 2OTLT 5BPMA 4DV5K 3QNOA 4FZZA 2OAUA 3EG2A 2MCNA 3P39A 3BY7A 3S3MA 1UJYA 3VS3A 1VQLT 1AWXA 4EP4A 2KQWA 3D2FB 4BY9C 1BL3A 4J2EA 3JB9F 1HKBA 1VQOQ 1HJOA 1CXUA 3LDLA 5DK5A 4FLWA 1V76A 3TSZA 2KQ2A 3OJUA 1M2OA 4MO4A 2RA2A 1P90A 1X27A 2PQWA 1RTIA 2DEUA 3THVA 4FWRA 1Q82O 3EL2A 2QI2A 3FJPA 3VGKA 3QZ9B 3KXTA 3IKMA 4CJ4A 2E5LK 2EQUA 1JXEA 2X4JA 4F7UA 3SUNA 1QSYA 2W6LA 3MEWA 5M1PA 2XDBA 1B34A 1KXPA 2K9GA 4EMKA 1CZ9A 4IFEA 4RTTA 3O5ZA 3S3NA 3TABA 5GAMe 3L2UA 4BE1A 2ZQBA 3MHXA 4DFKA 1YITQ 4M78E 5A0LA 3M5RA 4CEEA 2IGIA 2HMIA 2LCLA 1QSLA 4YTLA 3AAPA 1WAJA 1RL2A 4JJBA 4FJ9A 1S72N 5AQYA 1ZUYA 3VQBA 4OGCA 2GF7A 1VQ6Q 1VHXA 2E70A 4JYAK 2HQHA 2QWMA 4E47A 1C6VA 1MGQA 2A37A 3M0RA 3LH0A 2ZF5O 3FZLA 1N9RA 3ER0A 2IG0A 2JNGA 4E7IA 3P8HA 3MCPA 2EQIA 4AM7A 4XTZA 3FGUA 3A98A 1RT4A 4HVUA 1JCEA 5M1OA 2BGGA 1MHNA 2O4IA 2DXTA 4FOEA 1Q86C 3HSCA 1EWQA 1UFFA 5KYWA 3NH2A 3CXCP 1BU1A 3FZHA 2DYIA 2RI3A 2XHCA 5SZTA 2ABLA 3K58A 1TK8A 3HM8A 2ZPBB 1N34K 2DVJA 2E1HA 4B9VA 1NGEA 1O13A 5IAYA 5HRRA 2F5TX 2Y4YA 1AEYA 4DR3K 4BR0A 3UA6A 5BR8K 4PJNA 2KR3A 2DTOA 1HQEA 4M3TA 4Q0BA 4CJ7A 1LCUA 4CEZA 3AT1B 2RJEA 1U06A 3F5TA 2XI9A 5GANj 4O6JA 3RUXA 3CCQQ 1S9EA 4E7JA 1NOZA 4IUTA 4M78A 2A5XA 4JJDA 2OZMA 2BUPA 3BW1A 2IVWA 4JKGB 3SEMA 4LSLA 5ADXH 2HHWA 2PY5A 4ANJA 3I56A 1HLUA 2YHAA 2QTVA 3FE1A 4E1MA 4C5HA 1GLBG 3TANA 3BZKA 1MMGA 3EFRA 1HYZA 2VGMA 2Q36A 3FRNA 4BRLA 2IAJA 1VIFA 1JXMA 2KK4A 1UA1A 4XH5A 3L2QA 3OYJA 2CGHA 5GAOn 1VQKQ 1MWKA 3OHRA 5AQOA 3LH5A 5IXBA 2GUPA 2VWJA 1NM7A 5BRHA 4BG9A 2OZSA 3NCIA 2RPNA 1KAZA 4PLIA 3QFUA 3L8BA 3HTRA 2ASPA 1C1AA 2IPOB 2V8IA 2ZE2A 1OYXA 2M51A 4CFCA 2OA8A 1F21A 1U2VA 4R0KA 2O9SA 1KQSM 4XTUA 3VN5A 4DR2K 2K57A 4FIBA 1RILA 5CKEA 2B86A 2ATQA 3CCSQ 2V1RA 4HUEA 2WTUA 5IHKA 3C4SA 3SWNA 2KAFA 4A53A 3V9SA 2HHTA 2Z1GA 4YOTA 1R0CB 3OSVA 3W3DA 3DLBA 2OTLN 4O0JA 2WSFE 4BI3A 5IT9O 4J6WA 4Q5WA 3OYNA 3SBGA 4PJLA 2EYXA 2GTDA 1UHCA 3CBMA 3DLLL 4QOZB 1YIJQ 2ZD1A 2CSQA 3LP2A 3J80O 2CS7A 1Q82R 4N4GA 3MMVA 4IBNA 4X1VA 3ZT4A 2NUTA 3TTDA 3MEDA 4M77B 1AWJA 2AKKA 1FXXA 4A5AA 2GGRA 2KMTA 3DXKB 5JVGL 4DTMA 4PJJA 3V8JA 2ESWA 3M3ZA 2P9LA 2D0CA 2HHSA 4CBUA 4HWIA 4E0DA 3T9NA 3ZCMA 3SQ4A 1Y97A 2E2NA 3VS4A 2V8JA 2LDMA 1OVYA 3D7SB 4KH0B 3CJCA 1NPRA 3PMTA 3G71T 5GANh 1WGSA 3TU4K 2K2VA 3CCVQ 5AQZA 2BZXA 4DR6K 5GJWB 1I0CA 3OYHA 3CERA 2LP5A 4RG2A 5LJ3j 1YHQQ 4F9OA 1VA7A 3CEYA 3CCLT 4UQGA 4I2PA 5HK3A 1J53A 2YRVA 4FJMA 1M90O 1K73O 1OU9A 1VUBA 2FC0A 4KTQA 2DIQA 1TU0B 1HRHA 4N56A 2EYQA 3AVJA 4CJSA 1Z25A 1D1AA 1VQPT 5KPZA 1WSGA 2YUPA 3A5NC 1LWEA 4H8KA 5CIUA 3ENBA 1X75C 2CKKA 2P9SA 4A62A 5HP1A 3CC7A 1M2VA 1XHXA 4H0TB 5CYMA 1G3TA 3ZT0A 3D45A 2EGAA 2M0OA 2L5QA 1Y71A 1O1WA 1XTDA 5FPDA 5LJ5j 4J6YA 3CM5A 3CC7N 1ZBIA 2IVNA 2LC4A 4CERA 4JLIA 4XU2A 1SHFA 1BYMA 1Y07A 1NMDA 2X4WA 3HBTA 2DYBA 2QDYB 1TVRA 3OYYA 3QJYA 4U67L 5IWAK 1T0JA 1RDCA 2CGKA 1JLFA 5J39A 1KK7A 2GX9A 1ZBUA 1KAXA 4IUVA 4C0GA 4H5VA 4CF0A 3QMLA 3QEXA 1S1UA 1NJIC 3BF1A 3OYEA 3TQ7P 2K6DA 1FW6A 4FYYB 2XDDA 1B9DA 5C2DA 2EPDA 3SPYA 2JZ2A 4WTOB 3G6EA 1J54A 1QZ5A 4M77G 1SZ2A 4O5BA 4IG0A 4DU4A 1MA9B 2QWRA 5GANf 2K5FA 5AQVA 1I81A 4J9DA 4F7UB 3JCMf 3KIOA 5AQIA 2FBVA 2KT8A 3FEOA 1B34B 1QVFM 3JCMJ 3CCJQ 3OS2A 3SUQA 3G6EN 1TOVA 2KTQA 3QYGB 1B92A 4NL2A 2RI2A 4Q5VA 4ELYC 4FJNA 1VQMQ 4IEIA 4A61A 4BDYA 2F8TA 3U4LA 5AQQA 1BUPA 2K5LA 1RT1A 3L6QA 4DUYK 3GPLA 3VPZA 1HNVA 4RTWA 5LJ3h 1WNSA 3H08A 4N4HA 4CC4B 3WNGA 4QKUA 4M75F 1RTDA 3AGKA 2E2OA 1KHIA 5IHIA 3H45C 3P4IA 5IH2A 3ULEA 2BKDN 5JS1A 2KLAA 3NFCA 3EZWA 1PWTA 2GQIA 2HKQB 1RT2A 1ESVA 1N5ZA 1VQ9Q 2EFIA 1C1CA 3PT9A 1VQ4Q 2H3JA 4KTWA 4XQ3A 1M8VA 1Z05A 2AA4A 2VWFA 4C8QF 2LQ8A 4DQPA 4KFBA 5GAN2 3QEPA 5KYWB 3V7SA 4B9QA 3JV3A 2CYZB 1RT5A 1UOCA 3P8BB 1SKRA 3L2WA 1TS9A 3U3GA 4UY8O 4C0ZA 1YJNT 4CJRA 1A0NB 1SQKA 2JMAA 5LJ5h 1KAYA 1SPKA 3EZ5A 5F0XA 3CMEA 5I2MA 4YNQA 4BDPA 1NKBA 3AY9A 1I39A 1RBTA 2KZZA 3A8YA 3ZX3A 3M54A 1U1SA 3JCMW 1VQ7T 4K11A 3OYDA 2PVOB 1TYQA 3CMEN 3CXCS 3OW2M 4M78B 2X3WD 2R58A 1WXUA 3DLKA 4OB3B 2DZ9A 2P9NA 5C15A 2DY4A 1M90R 2CZ0B 1K73R 2ASOA 2VG6A 2YHXA 1MNDA 4RUGA 3TTCA 1LNXA 4MMKA 3PTAA 4RW4A 4PFZA 1NGCA 4KBMB 2Q0UA 4DEXA 2PU9B 4OKJA 4OMFB 2UUBK 3MECA 1H92A 4B1WB 2JTEA 5I42A 3WXMB 4LFCK 4F16A 1Q86O 2EYYA 3CHWA 1VOMA 4F7UG 2RNAA 5GANg 1IXDA 5LJ3f 1KG1A 4OMOA 3JCMg 3NF9A 1UE9A 3QESA 3DI6A 3KBGA 2E2QA 1PSEA 2AHJB 1E6GA 4A4FA 3I0RA 5AQXA 3MEGA 2F5KA 1QQJA 2ETJA 2L0AA 3NFAA 1U2VB 3HP9A 3KTQA 3SQ2A 1ZXOA 3RWUA 4FJJA 3QHSA 3ISNC 3HRUA 2HSTA 3PV8A 3LWIA 2KZMA 4CBWA 3SWNB 2G8FA 5A0DA 3RDVA 2PAVA 1BCMA 3JAMO 4E2FB 2OTJQ 1BI4A 1TG0A 3MWTA 2RO0A 1YN8A 1VQ8A 3JS6A 1NZ9A 1G99A 3AO2A 1KRPA 1QSSA 3PSIA 2DVEA 4PKGA 2BE2A 4YOVA 3TU5A 5LJ5f 3QPHA 4O5VA 4JRPA 2YJFA 4HT8A 2DD5A 2NUTB 1VQ8N 4KB0A 5HKCA 1FKPA 4YOXA 1VSHA 3VQDA 4J2BA 3QDFA 2P9LB 1PKTA 2KW4A 7AT1B 2FF3B 3AVCA 2E20A 1OULA 4B9WA 1BO5O 2LQKA 1Y64A 5CKDA 3ALYA 5CYQA 3VQQA 4ILJA 4J2AA 4Y91A 2QWQA 4PWDA 4FLUA 4JI8K 1KFSA 4KI4A 1M1FA 5D7UA 3HOTA 1D9FA 2QWNA 3PSFA 3L0QA 2OI3A 4IIOA 2HHXA 4FW1A 4FWMA 3EEQA 1BIBA 5BRDA 4JS4A 1DEJA 2O8FA 4CEAA 1Y96A 1M1KU 2VKNA 5KRTA 3SJHA 1WOQA 4M78G 1FMVA 2HD0A 2QK0A 1TGOA 4JI6K 3VQ5A 4BQZA 4DTSA 1FKOA 1IJJA 5L8RE 3TPQA 4M7DC 1C0UA 3KD1E 3HO1A 4V2SA 3DM2A 1GBRA 1QP3A 2RQTA 3D6RA 1RACB 4H0YB 4JNEA 1EFNA 2XG8D 1IBKK 4ELUA 3I55T 1Q7YC 2V8KA 2XMFA 4QW2A 5FPNA 3SBTA 3RRGA 2UUAK 4QQ6A 3VS0A 4IJNA 3V9ZA 1EIFA 2LJ3A 2KNBB 2MF2A 1U6ZA 3WUHA 2P9SB 2EX3A 1X9MA 5LJ3g 1TUYA 3X28B 3M59A 1SS6A 1B3QA 1M2VB 4GKJK 1YI2Q 3O9RA 4DV2K 3D7EO 3M0PA 3O4WA 1UGSB 2ZGZA 3PFSA 1XMOK 1YWOA 2GFUA 1S6PA 1JL1A 1D1CA 2RKIA 1MU2A 4JI1K 3LX7A 3MN9A 4CGDA 1ITGA 1WX6A 2EGCA 2PBDA 3DJCA 4Z89A 4RCCA 2SRCA 1KSWA 1YJNN 3WQTA 4XU3A 5LMUK 4KHSA 4CI6A 1I3AA 2FVUA 2FLOA 5GAN6 1BI0A 2D8JA 4B9XA 1FK9A 3M55A 2E6NA 2COYA 4I9LA 3CMAA 2E1ZA 3PMIA 1S9GA 1ZLMA 1N33K 5LJ5g 4C0DC 2HCKA 4AG2C 1M4ZA 5CY4A 4EZ9A 1Q86R 1LOTB 4EHTA 4E7HA 2CZ1B 1E7OA 3TEEA 4GV9A 4C92D 5FLXE 3CMAN 4J6XA 1NJXA 4FJ7A 3CD6T 3HVTA 2NUZA 3LDSA 4Z4FA 4BACA 3CCRQ 2AZSA 2E3IA 3WXLA 1GCPA 5DM6L 2I2LA 3MN7A 3V9WA 4IKFA 2WC9A 1VQNA 4RCHA 4J7FA 2RN8A 2ZZDA 3FLGA 2DTUA 1ZC6A 3CJ1A 3HPGA 4DFPA 4B1VA 3G7ZA 2G8HA 3H8ZA 1QQOA 3K5OA 1MV0B 1JLEA 1YJWQ 2DRKA 3HRTA 4M7XA 3A5ZB 4GLMA 3R6NA 1VQNN 3CCUT 4I2QA 1LV5A 4E7LA 4YDUC 2WONA 3B6OA 5KRSA 1OH7A 3ULEB 3VQ7A 3S3OA 3LM2A 4CEFA 1SKSA 1CZBA 1E4FT 1VSMA 4JLHA 1OX9A 4C8MA 4F2RA 4BWMA 2QQRA 4CIEA 3PNWC 3SD4A 1K8KA 2FBXA 3K0SA 1KQ2A 4B1YB 3PE0A 1NLPC 1SHGA 1IGUA 1HYVA 2P9PA 3LPTA 4Z4EA 4CK1A 3QYHB 3CPWS 5KGWA 4M75D 3VS2A 1RT6A 2JLEA 1RBRA 4BROA 4ORZA 1X1PA 3VS1A 2DFHA 4KRFA 2V51B 2CP0A 2FBYA 1WN7A 3LDNA 3CCRA 1Y7XA 3CFRA 1NK5A 5C6SA 2NWMA 3R9PA 2P0QA 2ECZA 4AHCA 3M9QA 4DOVA 1TL3A 5MLCQ 3VU3C 4II1A 4CC2A 4MDBA 3ZBDA 1NEBA 1T44A 3DLEA 1GL5A 2XK0A 1WA7A 4DV0K 3MXJA 2HQXA 1VSFA 4I6MA 1D9DA 1NGAA 1WJQA 1IHVA 2V52B 3SMSA 4DS5A 1YCSB 3H9NA 1TYQB 4BR5A 4DTOA 4FYVB 5T7BA 3P5JA 1IKYA 3SUPA 1F1BB 2EVRA 2P9NB 4LDWA 5FRNA 3OA6A 3AO4A 4F8RA 5C42A 2D1KA 3C94A 1KVCA 1XC9A 1PRMC 2RPIA 4OKKA 4E3SA 4JJNK 5AQJA 3JCMb 4YY3K 1NGGA 2A28A 3VF6A 4FT2A 1OQKA 4EMKC 2D0QB 2DL5A 1X43A 3ZX2A 4XTYA 3ZSRA 1HUXA 2JM9A 2M16A 1DT9A 4FZYA 2AK5A 2HBWA 1RLQC 1DJ7B 5GAN5 1OKJA 2WFBA 5FU7B 1GLLO 1S72T 4BR9A 3RRHA 3IMXA 2QTXA 2O4XA 3WVDB 1I07A 3NF6A 1TUDA 3F9MA 5KQDA 2A3ZA 1BISA 1K4US 3M6GA 1PD0A 1K9AA 1Z9ZA 4JDSA 5KYXA 2UUCK 2WOMA 4I9QA 5I9EB 1K73U 1VQ5A 1A5WA 1D8YA 5C10A 4B1ZA 2BANA 5EG2A 4FVUA 1V4SA 1BI4B 4DFJA 2VC8A 1JRIA 4FWSA 4CGFA 4Z4CA 3OB9A 3CCMQ 4QVZA 1VQ5N 2FSNA 4RW7A 3ZSOA 2RQWA 4HCKA 2ZWHA 3QZ5B 2XU8A 1FYNA 3RKWA 1ZBFA 2DM1A 3MEEA 2D8HA 1TL1A 3RNJA 3L42A 4WQ4A 1YP5A 3DXKA 2DNUA 4B3SK 3CJAA 3ZSQA 4BRKA 4F4KA 4FJKA 1DGKN 5GANe 4CI0C 3HKSA 4E1NA 5AQMA 1JLCA 3ULDA 4O4GA 2GEMA 3TSQA 4BY6B 4MLHA 4BI4A 5AYFA 3T1YK 3FFIA 4BDZA 4JI2K 3CD6N 2DMOA 4EFHA 2O8FB 1Y96B 1UEBA 2CP2A 4G1QA 3I9QA 3LDPA 5KPRA 3PX6A 4IOAL 3VETA 1WAFA 3EE8A 4EIAA 4CIFA 4BRMA 3I56T 4BRAA 1WQ7A 4RTZA 1RAEB 2HBJA 3CM6A 3VV0A 3E01A 4LD6A 3CCMA 4KKOA 1N8RU 4YORA 5AQWA 4CD3A 4B9SA 1NLOC 3G1JA 5J2NA 1S3XA 2HNZA 1X6BA 1I5OB 2FB7A 3OS1A 4ICLA 1NNEA 2A42A 4KRTA 4ELZC 1K8AC 2X51A 1TH7A 1S22A 1S1WA 3A8GB 3T1AA 2KXCA 4WF2A 1XNQK 2LVMA 1KC8C 2JJ9A 4B08A 1NK9A 1IG9A 3JSCA 2A7YA 3KLEA 3T19A 1PM3A 3CC2A 3VA0A 1J3TA 4H0XB 3ID6A 1QWFA 1HJRA 1M3CA 2RM4A 4IDKA 4DV1K 5HOOA 2QEXA 2PYJA 3G4SA 2P9IA 3SWNC 2KI7A 2QA4A 2QKBA 2HF4A 3M53A 3TSWA 1QQCA 1WHKA 3CC2N 2RB6A 4DBQA 1ASVA 3AVNA 3DYAA 4QQDA 1G2BA 5M1NA 1VYUA 1ABOA 1NU0A 3J8AA 1XMQK 4M7AC 1U5SA 2RK1A 2DKGA 2QEXN 2DPNA 2GFAA 4AT1B 3MO8A 1D5AA 1VSEA 3G4SN 2QWLA 5J2MA 5I3UA 2RJFA 3MKDA 1Q81C 4H0VB 2QA4N 1UECA 3A5MC 4A4KA 5CKFA 5CCAA 3DRSA 3HHTB 2ZM6K 2M9UA 5GMKl 3HRGA 3J7YP 5GAOp 1YT3A 2CH6A 2FYKA 2E4HA 3LYIA 5LMNK 3AO5A 4GNIA 2RQUA 1Q8IA 1SAZA 2DILA 5BREA 2COWA 1VSLA 3LM9A 3MDQA 3S41A 3EHQA 1JJ2S 1NMNA 2HSPA 1M1GA 3ZT3A 3QERA 4M3XA 3QEWA 3MN5A 2RHKA 4WE1A 3WXIA 3W0LA 1HNXK 1HYSA 4XK8E 4C5EA 4XH1A 3CPFA 5LJ3e 4Z02A 4R5PA 4M75E 4DCHA 4RG8A 5K14A 4GVEA 4FYDA 1XQSC 4DF4A 4DR1K 5AFUA 2P4RA 3BEXA 1YAGA 3H6ZA 3OYFA 3CC4Q 1M3AA 4DWIA 2C0IA 3H0FA 5A2QO 3ZSYA 2J4RA 1GBQA 4ID1A 1VAZA 1YTUA 2P0PA 4HTLA 2YUOA 3KLHA 3NMUA 1QMCA 1VQOA 4C8QE 1BQNA 3VF4A 1N6AA 2QASA 1JEGA 4CZIA 3ZLJA 2Z1JA 1JBMA 2E5QA 4AILC 4LFAK 2OPQA 2QTDA 3J7AF 3L4QA 1K8KB 2EQJA 2F4VK 3EO3A 2O31A 4QVCA 4K43A 2P9PB 1VQON 4A2BA 2VXEA 5C0MA 3NTIA 3QXEB 3NVMA 1V4TA 4GKKK 1VSKA 3ENHA 3QG1A 4H4OA 4TVRA 3VQAA 2Y4XA 3CC7T 2VYPA 3O08A 1WZOA 4FWPA 4Y1DA 1EWRA 3WQUA 4BUGA 4PJOC 1T6CA 4FL9A 2ZJPL 3HPHA 2XIDA 4RKUE 4HKEA 1IKWA 3HVRA 4RTUA 5KYYA 3CCEQ
chains in the Genus database with same CATH topology
2JGUA 2YKMA 3OYEA 4M3YA 4FK2A 2Z1HA 3VA3A 1B9DA 2YNHA 4OJRA 3SPYA 1NK8A 1NKCA 1J54A 4O5BA 3OYIA 4CEQA 1KCFA 3VQ6A 4IG0A 4DU4A 1SL2A 3BDPA 2YKNA 4CJKA 1U04A 4FM0A 4CGIA 3KIOA 4Z4IA 4DU1A 4FJXA 2FBVA 3TWHA 3MXMA 1KLNA 5D3GA 2D0AA 3OS2A 2X6NA 3L2VA 4CHQA 3SUQA 2KTQA 4AH9A 3VQEA 3SYZA 1B92A 4M3RA 1ASUA 4FW2A 3ZT1A 4CJTA 4Q5VA 3PO5A 1RDBA 4FJNA 1UA0A 2DFEA 2I5JA 4CHYA 5J1EA 4BDYA 1G15A 3DRRA 4CJUA 2F8TA 4CFDA 4DS4A 3MAQA 3C6TA 3OYGA 1RT1A 3HM9A 3O3FA 4QCLA 3TAFA 4DSJA 1HNVA 1WNSA 3H08A 4YFUA 2P5OA 3K5LA 3WNGA 4DLGA 2LSNA 5CZ1A 4DMNA 1RTDA 1Q9YA 3AVAA 1U45A 3TAPA 5CZ2A 3DLHA 5J2QA 5JS1A 1LW2A 2XRIA 4CJFA 1TKXA 1RT2A 4IFYA 1U48A 3K2PA 2XY6A 2G8WA 1WSIA 4FZXC 2HVIA 2GUIA 1C1CA 2HW3A 2HNDA 4KTWA 2VG7A 3ITHA 4LSNA 4Y1CA 4CK3A 1TKZA 2XO7A 4KFBA 4DQPA 3OYMA 3QEPA 4N41A 3AVBA 4CFBA 2VWKA 1SKWA 1RT5A 1UOCA 1SKRA 3L2WA 2D5RA 3U3GA 2PZSA 4CJRA 3NH0A 3SI6A 3TARA 2GBZA 4CEOA 3LWMA 3EZ5A 1SL0A 4LY7A 3EYZA 2OYQA 2P5GA 4PUOA 1RTHA 4CJ3A 3PUFA 1L3SA 4DSFA 2HNYA 4YNQA 4BDPA 4TSXA 1Q9XA 1NKBA 1I39A 1RBTA 3NGIA 2KZZA 1UAXA 1RCHA 1CLQA 1J5OA 2YHBA 1CXQA 4ELVA 3OYDA 2X6SA 1SKSA 2A1SA 1K6YA 3DLKA 3VQ9A 1S1VA 3AVHA 3O4NA 1WLJA 3WNHA 4F8RA 2DY4A 1U4BA 2VG6A 1NJZA 4H4MA 1QS4A 4CGFA 3DOKA 4RW4A 2BDPA 4W5OA 1R0AA 1WSEA 3M8QA 3AVGA 3V4IA 4OKJA 4KTZA 3OYBA 3KLFA 1KTQA 3MECA 4Z4FA 1RDDA 3A2FA 5I42A 1TK5A 3LP1A 3RMBA 2XY7A 4PQUA 3U6FA 4E19A 2QK9A 5FROA 3NF9A 3QESA 3DI6A 4AHTA 4FJ5A 4CGGA 3I0RA 4FLZA 5KGXA 3MEGA 1GOAA 4CJPA 2ETJA 3NFAA 1VSJA 4KO0A 3HP9A 1ZBLA 3KTQA 4DQRA 3SQ2A 3AO1A 3BGRA 3V6DA 3RWUA 1BIZA 3PO4A 3ISNC 3HYFA 4FJJA 3PV8A 3AVLA 1T8EA 3LAKA 1ASWA 1BQMA 2KZMA 1N6QA 3NBPA 3HK2A 4CHPA 2G8FA 4Z4HA 4BWJA 1BCMA 2P51A 1BI4A 3HT3A 1VK0A 1NK6A 2NUBA 5FDLA 3AV9A 4HVJA 3SPZA 4O44A 1KRPA 3AO2A 1QSSA 1S6QA 2QKKA 2G8IA 2G8UA 1WSFA 3RMAA 4JRQA 3O3GA 2BE2A 1KVAA 1VSIA 3M8PA 3NE6A 4Z0UA 3KLIA 4OKEA 4M45A 4JRPA 4K8XA 5FRMA 1SL1A 3OYKA 4FJ8A 4KB0A 2HHVA 1FKPA 4E7KA 1VSHA 3VQDA 4J2BA 4W5TA 3SUOA 4ELTA 1SUQA 4L8RB 2KW4A 4HUFA 3AVCA 4KREA 1KVBA 4DSLA 4CF9A 4MFBA 2E4LA 3ALYA 5CYQA 1TAUA 3VQQA 4OPJA 4PWDA 4FLUA 1C1BA 4I7FA 1Z26A 1KFSA 4KI4A 4F3OA 5D7UA 1EXQA 1D9FA 4FXDA 3SQ1A 2HHXA 4FW1A 3TAQA 4JS4A 4KHQA 3NDKA 3QETA 4DSKA 4CEAA 5KRTA 4CGHA 3O4QA 4PA1A 5J2PA 4CJ5A 1TGOA 2XY8A 3VQ5A 1BHLA 3O3HA 3DRPA 4DTSA 4DFMA 1FKOA 3HO1A 1C0UA 4C8NA 1VRTA 5C25A 3KD1E 3DM2A 4FLVA 4ELUA 3LP0A 3VQ4A 3OYAA 4CCHA 3RRGA 3SNNA 3VQ8A 2HVHA 2XHBA 1NJYA 3PX0A 3V9ZA 3QLHA 4NCGA 3SV4A 2PYLA 4HCBA 2EX3A 3CFOA 1X9MA 2IC3A 3WNEA 1KFDA 1KLMA 4JS5A 4FVMA 3KKSA 1YVUA 1U47A 1RTJA 4DTPA 2R7YA 4GMJB 3KK1A 1S6PA 3LANA 3ZSWA 3TI0A 1JL1A 4FM2A 4B9UA 4KHWA 2G8VA 1EX4A 2RKIA 4C8OA 1MU2A 4C8KA 1RBVA 4CGDA 1ITGA 4CJLA 4CECA 4DTNA 1C6VX 3VQCA 1HMVA 4AHUA 2YNGA 4FK0A 2IOCA 3TR8A 1C0TA 1EKEA 2ITGA 4B9MA 4KHSA 3IS9A 5C24A 4CGJA 1C0MA 1I3AA 4M41A 1REVA 1FK9A 1L3UA 3RTVA 3KD5E 2RF2A 2Y1IA 4I9LA 1TV6A 3DMJA 1S9GA 3AVIA 1YTAA 5CY4A 3NF7A 4EZ9A 2VG5A 3DLRA 1TKTA 4E7HA 1W0HA 4EZ6A 1S1TA 3AA4A 1T05A 4PY5A 4FLXA 3IRXA 2Z1IA 1JLBA 3LPUA 3LZJA 4HTUA 1NJXA 3HVTA 4IG3A 2X78A 3AVMA 3LDSA 1A5VA 4DQSA 1NK7A 4BACA 4N47A 4CHNA 3K5NA 2GV9A 4O55A 4NCAA 1ZYQA 2HHQA 3V9WA 3NGYA 4IKFA 1XWLA 2O4GA 4OVLA 1L3VA 2DTUA 3SCXA 2EHGA 3HPGA 4DFPA 3EY1A 3NHGA 4DU3A 2G8HA 3K5OA 5JS2A 1GOCA 4C8LA 4B9LA 1QE1A 4AHRA 1JLEA 3QEVA 4MQ3A 3V81A 3VQPA 1A5XA 1BIUA 4ZTJA 4KHNA 3HL8A 4I2QA 1LV5A 4E7LA 1NK4A 2WONA 3B6OA 5KRSA 4N5SA 4W5NA 3VQ7A 3OYLA 4CEFA 4HUGA 3S3OA 4DG1A 1CZBA 4OPKA 3QNOA 3SJJA 1VSMA 4JLHA 4C8MA 4DTJA 4F2RA 1NKEA 4BWMA 4FZZA 4CIEA 2FBXA 1TK0A 4M42A 4FM1A 3K59A 1HYVA 3LPTA 3C95A 3S3MA 4Z4EA 4EP4A 4CK1A 5KGWA 3HPOA 4M3ZA 1QTMA 1BL3A 3P83D 1RT6A 2JLEA 1RBRA 2IS3A 5HLFA 4J2EA 3MXIA 5SWMA 1X1PA 1CXUA 2DFHA 3QO9A 5DK5A 4FLWA 5HRPA 2FBYA 4KRFA 1WN7A 2XY5A 2KQ2A 3CFRA 3OJUA 4KAZA 4FJHA 1NK5A 3AA2A 4RW6A 3KJVA 1JXBA 3P1GA 4AHCA 1RTIA 1TL3A 3THVA 4FLYA 3RMCA 4CE9A 1U49A 2D0BA 4CJ4A 3DLEA 4AHSA 4M3WA 2KFNA 3MXJA 1IKXA 1JXEA 1VSFA 1WSHA 1D9DA 3SUNA 2G8KA 1QSYA 1IHVA 1JKHA 2B5JA 3TAMA 4CF8A 4ZHRA 4DS5A 2E6LA 4LD0A 1CZ9A 4DTOA 4J2DA 5T7BA 3P5JA 1IKYA 3SUPA 3S3NA 3TABA 4FLTA 4ID5A 3L2UA 2ZQBA 3LAMA 4BE1A 3AO4A 4DFKA 5FRNA 5C42A 1W9HA 4CEEA 4E89A 2IGIA 1KVCA 3C94A 3LP3A 4OKKA 2RPIA 4E3SA 1XC9A 1QSLA 2HMIA 3NAEA 4Z4GA 1WAJA 4QAGA 1T7PA 1NJWA 4FJ9A 1TKDA 3VQBA 3T3FA 1WSJA 4OGCA 1IHWA 5DMRA 3CFPA 3ZSRA 4HHTA 4ZTFA 4FZYA 1C6VA 1EP4A 2P1JA 3AVKA 4KV8A 4CJWA 3RRHA 4KB1A 4E7IA 4CFAA 3K5MA 2BGGA 1RT4A 4NCBA 1BCOA 2O4IA 3NF6A 3DLGA 3OVNA 1BISA 1HQUA 1IH7A 3V1OA 1EETA 2RN2A 2KFZA 2AJQA 3NH2A 2WOMA 4NYFA 4I9QA 4DTUA 2F8SA 2OPSA 1A5WA 3ZSZA 3F73A 1DTQA 1VSDA 1D8YA 2BANA 4KHYA 5SZTA 3ZSVA 1BI4B 3V1QA 3K58A 1LW0A 3L2RA 1TK8A 4DFJA 4B9VA 3M8RA 5HRRA 4Z4CA 4RW7A 1BGXT 1HQEA 3ZSOA 3KK2A 4M3TA 4Q0BA 1RBSA 4DSIA 4CEZA 1ZBFA 3D0PA 1L3TA 3MEEA 1TL1A 1S9EA 3G0ZA 3LWLA 4E7JA 2HB5A 3B6PA 3JYTA 1NOZA 1RBUA 4CK2A 2DFFA 2OZMA 4LSLA 2E6MA 3ZSQA 4F4KA 2HHWA 2PY5A 3QINA 4FJKA 4NYNA 1XHZA 2YHAA 4W5RA 4E1MA 5KTQA 3HJFA 3TANA 4E1NA 1HYZA 3CG7A 3L3UA 4EP5A 1IO2A 1JLCA 2IAJA 3QIOA 4O4GA 3ULDA 3S9HA 3PX4A 1UA1A 3L2QA 3OYJA 1TAQA 2YNFA 3KK3A 3FFIA 4GW6A 2VWJA 4BDZA 2OZSA 3NCIA 1JL2A 1RDAA 3UIQA 4FJLA 4G1QA 3LZIA 3ASMA 3L8BA 2ZE2A 1C1AA 3PX6A 2B4JA 4AHVA 1WAFA 3JSMA 4HCCA 4GVMA 4CIFA 4FK4A 4B9NA 4B3OA 4CFCA 2OA8A 3E01A 1F21A 3CM6A 4CJQA 1B9FA 4KKOA 3G10A 4B9SA 3VN5A 5J2NA 2HNZA 1XI1A 4ICLA 3OS1A 4N76A 1RILA 3AO3A 2ATQA 4FJ7A 1J9AA 3RMDA 3L3VA 4HUEA 3SZ2A 1ZBHA 4OLAA 1S1WA 3T1AA 4LH5A 3V9SA 1NK0A 3F9KA 2HHTA 2Z1GA 5HRSA 3HP6A 4B08A 4CIGA 1NK9A 1S5JA 2QXFA 4O0JA 1IG9A 3KLEA 3T19A 1LAVA 1DTTA 3ZSXA 3VA0A 3OYNA 5HROA 5HBMA 1HJRA 3HSTB 5HRNA 4IDKA 3DOLA 4QOZB 3PY8A 2ZD1A 4M3UA 3U3YA 2PYJA 3LP2A 1GOBA 2B6AA 4DQIA 3I8DA 4IBNA 4OLBA 1HNIA 3NGZA 3ZT4A 3V9UA 2QKBA 4XIUA 1QQCA 3MEDA 3DLBA 4J2AA 1ASVA 3AVNA 3DYAA 1FXXA 4CHZA 3QNNA 3OJSA 3TAGA 4DTMA 2HHUA 1HPZA 1RNHA 3IG1A 1L5UA 2D0CA 4B8CA 1QHTA 1VSEA 1D5AA 2W42A 4DF8A 5J2MA 3QEIA 3SV3A 4K8ZA 2HHSA 4E0DA 3ZCMA 3SQ4A 1JLAA 1Y97A 3DRSA 3M8SA 4DSEA 2A1RA 4FJIA 1YT3A 4CF1A 3LALA 3HXMA 4KI6A 3AO5A 1Q8IA 3KKRA 3K57A 3RR8A 1RT3A 1VSLA 3NF8A 4KPYA 3WNFA 2YNIA 2X74A 3KLGA 3OYHA 2FBTA 3CYMA 1SV5A 3RR7A 3QIPA 4FJGA 3ZT3A 3QERA 4UQGA 3AA5X 4I2PA 3QEWA 4WE1A 4M3XA 4DQQA 1J53A 1HYSA 3V1RA 4FJMA 4CEBA 1UWBA 4B8AB 2FC0A 3I0SA 1DLOA 4W5QA 3OY9A 4KTQA 1JLQA 1X9WA 4R5PA 3AA3A 5E41A 4RG8A 1HRHA 5K14A 4N56A 3AVJA 4FYDA 5EU7A 4CJSA 3NH1A 4F3TA 1Z25A 4DF4A 1WSGA 3V9XA 1LWEA 3OS0A 4H8KA 3C6UA 4IFVA 3OYFA 1NOYA 4DWIA 4BE2A 2YV0X 3ZSYA 2Y1JA 4ID1A 4CF2A 5HP1A 1YTUA 4CJVA 4RW9A 3KLHA 4DTRA 1QMCA 1BQNA 1XHXA 3ZT0A 5CYMA 3ZT2A 4CHOA 4DTXA 1VRUA 2Q3SA 2Z1JA 3D45A 4AILC 4FCYA 2OPQA 3TAEA 4BE0A 1IKVA 1O1WA 1RT7A 3OYCA 4F2SA 4KHUA 1LWFA 2OPPA 3CM5A 1ZBIA 3CQ8A 4CERA 4B9TA 1N5YA 1S1XA 3SQ0A 2IDOA 1X9SA 4CEDA 2F96A 4O0IA 1TVRA 1VSKA 4LH4A 4H4OA 1JLGA 4RW8A 1RDCA 5KI6A 4OGEA 3VQAA 1JLFA 5I3UA 1ZBUA 1LAWA 4Y1DA 2OPRA 4CESA 4DLEA 1LWCA 1T03A 1KSPA 3HPHA 3IAYA 3AVFA