1EX4A

Hiv-1 integrase catalytic core and c-terminal domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
212
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACDWAGIKQEDGIPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNSLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the HIV-1 integrase catalytic core and C-terminal domains: a model for viral DNA binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords INTEGRASE
total genus 49
structure length 212
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00552 IN_DBD_C Integrase DNA binding domain
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1ex4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ex4A01
1YTAA 3K57A 1B9FA 4CEEA 4BACA 1B92A 3MEDA 4DTJA 3AVNA 3JYTA 3RMCA 4BE0A 4M42A 3QEVA 1IHWA 3RMBA 4QCLA 4CJKA 2RN2A 3RMAA 1S1TA 1BQNA 1U4BA 1HYSA 4CF9A 3KKSA 4E3SA 3AA5X 4JRPA 1LWCA 2IGIA 2VG7A 4DTUA 4OKEA 3KTQA 2FC0A 1J54A 4CK1A 1U48A 1SL0A 2RF2A 4J2EA 4H8KA 1CZ9A 3NHGA 1WNSA 4LD0A 1TKXA 1HYZA 1FKPA 1TK0A 3CFOA 1IO2A 3LWLA 1QMCA 1U47A 3RWUA 4Z4GA 4DSKA 3KLGA 1HNIA 4LY7A 2HVHA 4O4GA 2HHQA 2ITGA 4M3RA 4Z4FA 1YTUA 4KHYA 4PA1A 3RMDA 3CM5A 2JLEA 3OS1A 4OGEA 5HRPA 4AHUA 3SPYA 2GUIA 4FJIA 1JLFA 4FJMA 4AHTA 2XY8A 2G8WA 4Z4HA 2GBZA 3KD5E 1C6VA 1TL3A 1BCOA 1NOZA 2G8HA 1IKXA 3M8RA 4ELUA 1IKYA 4M3WA 5J2NA 3JSMA 3NH2A 4FLYA 3VQBA 3IS9A 4E0DA 4F2SA 3NFAA 4FJ7A 4DQPA 1HPZA 4FYDA 3LWMA 2YV0X 4FZZA 1HQUA 3I0RA 4FVMA 3WNFA 1SKWA 4DQSA 4OLBA 2QK9A 3VN5A 4N76A 3OJUA 3KKRA 3T1AA 3CG7A 3TI0A 1KVBA 1TAQA 3PX0A 1ZBFA 1GOAA 1RTDA 4FLUA 2KZZA 5JS1A 3L3VA 4OPJA 1YVUA 1TK8A 4DS5A 4HTUA 1QS4A 4Y1CA 4CJPA 1LAVA 5HRNA 3TAEA 2IC3A 4JRQA 4B3OA 3LDSA 3P83D 4O55A 1U04A 2KQ2A 3TANA 4DSLA 3NF8A 3HPHA 1C0UA 1RT4A 4CJ5A 4E7KA 2G8KA 2Z1JA 3OY9A 4CJSA 3CQ8A 2IDOA 3O3HA 1K6YA 3HK2A 2RPIA 4CJUA 2D5RA 5C42A 1JXEA 1RBSA 4FW2A 3ZSVA 3KIOA 3AA2A 4CEZA 2HHWA 2LSNA 1TKTA 4DTPA 1L3VA 3AVAA 4B08A 4PUOA 3HJFA 3DOLA 4K8XA 4KFBA 1IHVA 4Z0UA 3L2UA 3SI6A 5CZ1A 1HYVA 4FLXA 1L3UA 4IKFA 2Q3SA 3C94A 3V4IA 5HRSA 4MFBA 3S3MA 1O1WA 4EP5A 1JL2A 2D0AA 2PY5A 1RTJA 2YNGA 4DLEA 4AHCA 4NYFA 1N6QA 3DLGA 3DRPA 1BCMA 1C1AA 2DTUA 3E01A 4FJ9A 3C95A 2HB5A 4J2BA 3UIQA 4KREA 1X1PA 3IG1A 3PX4A 3HP6A 4BE2A 4CFAA 2HW3A 3OYGA 4RW8A 1QTMA 2HVIA 3DYAA 1RDAA 1N5YA 1S1UA 2F8TA 3NH0A 4DQRA 5KTQA 4KPYA 1VSIA 1ZBIA 2XO7A 4Z4EA 5CYMA 1HRHA 3HSTB 1RILA 4HUEA 3L2RA 1WSIA 1RT7A 3CFRA 2PZSA 4KHQA 2P5OA 1SL2A 4CJWA 3DM2A 4B9NA 3AV9A 4KV8A 4DLGA 5HP1A 4E7IA 3OYBA 5I42A 4M3ZA 4CIEA 4EZ9A 4DS4A 4M45A 4MQ3A 4E7JA 4M3TA 1WSEA 3QINA 3VQ7A 3QESA 1KFSA 4K8ZA 1RDBA 4KTWA 3V1OA 1WSHA 1JXBA 3C6TA 4DTMA 1WAJA 3DMJA 4OKJA 4DQIA 3NBPA 1VK0A 3AO1A 3KLHA 4DSIA 1BGXT 1Y97A 2P51A 3LPUA 1RT1A 4AILC 2BE2A 2X74A 2OA8A 3G10A 2DFFA 3ZSXA 3OYLA 3L2WA 2QKBA 2HHUA 1ZBLA 4IFYA 3LZIA 4DF8A 3HPGA 3MAQA 4B9LA 1JLQA 1ZYQA 2FBYA 3D45A 1LAWA 3P5JA 4DMNA 1JLBA 3AVMA 3PX6A 4Q0BA 1UWBA 4CFDA 1XI1A 1WSFA 4GMJB 1EKEA 5CYQA 4N56A 4LH4A 1XHZA 4FK0A 5FRNA 1QHTA 3S9HA 3H08A 4OKKA 1IKVA 1LWFA 4E1NA 5FROA 1SV5A 1VSKA 2I5JA 2JGUA 4TSXA 1ASWA 1Q8IA 2ZE2A 4CJTA 1VSJA 4H4OA 1NKCA 1SUQA 2FBTA 3I8DA 3TWHA 3NGZA 1JLAA 2YNHA 3ZCMA 3HPOA 1C1BA 3ULDA 4KTQA 4DTRA 4CHPA 3SQ4A 4NCBA 2Z1HA 4W5NA 5DMRA 4CF8A 4LH5A 5D7UA 1CZBA 3AA3A 4YFUA 4RG8A 3OS2A 4BDYA 1NJZA 3WNEA 4DSEA 3WNGA 3K5NA 4DU1A 4DU3A 4FK2A 4M3UA 4DSJA 3HT3A 3AVLA 4GW6A 4KRFA 1EX4A 3TABA 2OZSA 4Z4CA 4CJRA 1RBTA 4CJVA 4B9UA 2YNIA 1VSDA 2B5JA 3F9KA 4CJ3A 3ALYA 4CIFA 2FBVA 3K59A 1RBUA 2HNZA 3OYIA 4FJ5A 5KGWA 3DI6A 3HYFA 3SQ2A 1RBVA 3SUOA 3QNOA 2A1SA 3LALA 4B9MA 1SKRA 1CXUA 4DSFA 1NK6A 1DTTA 4HVJA 4AHVA 1BIUA 5JS2A 2YKNA 5EU7A 3HVTA 1EP4A 3BDPA 4IG3A 4L8RB 1C1CA 1NK5A 5HRRA 4NCAA 1QSSA 1ITGA 4CGDA 4CGHA 3RTVA 3SUNA 3EY1A 3I0SA 1B9DA 1SL1A 4HCBA 4N41A 4CEQA 1Z26A 1RDDA 4FJGA 1T7PA 4YNQA 1CLQA 4FJHA 4B8CA 2HHVA 4DF4A 1FKOA 3QEIA 4GVMA 4FW1A 1EETA 3ZSRA 4F4KA 4NCGA 1VSMA 4CK2A 4DFMA 3SUQA 1RTHA 4CFBA 2IOCA 3QETA 2DFHA 2DFEA 3V9UA 3F73A 4E19A 3LAMA 4I2QA 1D5AA 4JS4A 1XWLA 2HHSA 2YHBA 3U6FA 4M3YA 3MECA 1IG9A 3PUFA 3V1QA 4LSLA 4KHSA 5CY4A 1VRUA 3TAGA 1FXXA 1DTQA 1S9GA 3LP2A 1XHXA 3TR8A 4I9QA 1T03A 1JLGA 1QQCA 3AVIA 4KTZA 4OGCA 3ZT4A 5J1EA 1A5XA 3KK1A 1NK9A 2PYJA 2DY4A 3MXIA 5FDLA 4IFVA 3HM9A 2IAJA 4OJRA 3VQPA 3LP3A 1RCHA 4CGJA 1WSGA 4CHZA 4CHOA 3KLIA 3L2QA 3DRRA 4CJFA 4O5BA 4NYNA 1NK8A 2X78A 1UAXA 3QERA 3VQ8A 2EX3A 1UOCA 1RT2A 1G15A 3V1RA 4CK3A 4FM0A 4FLVA 5HROA 1NJYA 4OPKA 1ZBUA 1NJWA 1SKSA 3ZT2A 2NUBA 2PYLA 3AVGA 3MXMA 3G0ZA 2HMIA 4C8LA 2YNFA 1JL1A 1IH7A 2OPQA 4OVLA 3ZSWA 4CEAA 4E1MA 3SV3A 1Q9YA 1TL1A 3ZSOA 1L5UA 3OYAA 1RT5A 3CYMA 2P5GA 3SZ2A 3AVJA 1D9DA 3VQ4A 3B6PA 2VWJA 3OYFA 1R0AA 4I7FA 4FXDA 1W0HA 1VSEA 4E7LA 1RBRA 4HUGA 3DLBA 5HBMA 1QE1A 2E6MA 3HP9A 3HO1A 1VSLA 5KRSA 2QKKA 3DLRA 1WN7A 4FLZA 4RW6A 4E89A 4R5PA 2F96A 4FLTA 5J2PA 4BWMA 3QEPA 2HNDA 3VA0A 2ATQA 3ITHA 4FJ8A 3O4QA 3AVKA 4EP4A 4QOZB 4FZYA 2Z1IA 3V6DA 3TAQA 1NOYA 1VSHA 1ZBHA 3OVNA 2Y1JA 1BL3A 2G8UA 4OLAA 3QO9A 5E41A 2XY6A 3WNHA 3U3GA 4CHYA 3KD1E 4FK4A 5T7BA 2OYQA 4O0JA 1S9EA 4FM1A 1TGOA 3L8BA 4QAGA 3RRHA 3HVRA 1GOBA 3NF9A 3ZT0A 3K58A 3SQ0A 3ZSZA 1BI4A 3L3UA 3SUPA 2YKMA 1VSFA 3LP1A 1NK4A 1TKZA 1RTIA 3TAPA 4KO0A 3DLKA 4CF2A 1J5OA 2VG5A 3QIPA 1RT6A 3T19A 2B4JA 3SJJA 3NCIA 4BE1A 3MEEA 5SZTA 1LW2A 1L3TA 4BWJA 4PWDA 1WSJA 3B6OA 4IG0A 1JLCA 3VQ5A 4W5OA 3NAEA 4C8OA 2AJQA 1S5JA 1VRTA 1KCFA 4FZXC 2OPSA 4DTOA 1UA1A 2G8IA 5SWMA 1BI4B 1REVA 1W9HA 1S1WA 3ISNC 4ID5A 1NK7A 4N47A 1KTQA 1U49A 1KRPA 1TV6A 3VQCA 4CJLA 3M8SA 5HLFA 1NKBA 1F21A 2YHAA 3V9ZA 2R7YA 3TAMA 1C0TA 3BGRA 1A5WA 3FFIA 3THVA 1WAFA 4AHSA 1C6VX 1RDCA 1CXQA 3CM6A 3CFPA 2KFNA 3M8QA 1J53A 3OYJA 1TKDA 2GV9A 4JLHA 4FJXA 1EXQA 1KVCA 4IDKA 3PY8A 4CJQA 2P1JA 3TARA 4FJNA 4B9TA 1NKEA 1X9MA 3AO5A 4KKOA 3SQ1A 2EHGA 3LP0A 3KJVA 1TAUA 1I3AA 1HMVA 4O44A 1Q9XA 1KLNA 4C8NA 3IRXA 2X6SA 3LANA 1D9FA 4DQQA 4XIUA 4KI6A 4PY5A 4FLWA 1UA0A 1BISA 1JKHA 4KAZA 1S6QA 2D0BA 2VG6A 5J2MA 2RKIA 4KB1A 2ZD1A 4CIGA 3P1GA 1LW0A 2QXFA 3VQQA 2WONA 3QEXA 2G8VA 3DRSA 3SPZA 4CCHA 4Y1DA 2XY7A 3AO4A 1T8EA 4BDZA 3NH1A 4G1QA 4CFCA 4CE9A 4HUFA 2OZMA 4DWIA 1GOCA 4HCCA 4CEBA 4CJ4A 4RW7A 3HL8A 1S1VA 1FK9A 3AVHA 1BQMA 4B8AB 4E7HA 4J2AA 3DLEA 2VWKA 2E4LA 3U3YA 3S3OA 3RR8A 4DTNA 4DTXA 3NDKA 4ZTFA 2O4GA 1KFDA 4F8RA 3NGIA 3VQEA 1T05A 2W42A 3OYDA 4JS5A 2BANA 4IBNA 4DFJA 2FBXA 1L3SA 3ZT3A 4ICLA 4CGFA 4DG1A 1QSLA 4KHWA 3AVBA 4DU4A 3PV8A 1D8YA 2KW4A 3OJSA 5KRTA 4H4MA 2XRIA 1Z25A 3A2FA 5CZ2A 1S1XA 2HNYA 4FCYA 3SCXA 4HHTA 1X9SA 5K14A 4FJLA 4EZ6A 4PQUA 3AO3A 3LAKA 4N5SA 4BDPA 4CEOA 4CGIA 3M8PA 3ASMA 1TK5A 1U45A 3K5OA 3ZSQA 1LWEA 1RT3A 3DOKA 1RNHA 3O3GA 4B9SA 3KLEA 1BHLA 3ZT1A 3OYKA 4C8KA 3KK2A 5KGXA 3IAYA 3C6UA 3O3FA 3LZJA 1I39A 3K5MA 2B6AA 4ELTA 4O0IA 4RW9A 4RW4A 2G8FA 5DK5A 3VQAA 1X9WA 3QNNA 1HQEA 3MXJA 4CF1A 3AVFA 3EZ5A 2E6LA 2IS3A 3VA3A 1XC9A 3ZSYA 4KB0A 3L2VA 4Z4IA 2F8SA 2ZQBA 1KVAA 4FJKA 2KFZA 3LPTA 3D0PA 3AA4A 3O4NA 4Q5VA 3OS0A 3T3FA 1J9AA 4AHRA 2HHXA 4CHQA 1S6PA 3NGYA 3HXMA 3AVCA 4DFPA 3QLHA 4ZHRA 4CECA 4CJEA 1MU2A 3OYNA 4W5QA 4M41A 4UQGA 3KK3A 3EYZA 3SYZA 4DFKA 5J2QA 1QSYA 2XHBA 3OYHA 4ID1A 1DLOA 3VQDA 4I9LA 1YT3A 4KHUA 2XY5A 2Z1GA 3K2PA 3NE6A 1ASUA 3QIOA 4DTSA 3NF7A 2Y1IA 4W5RA 2O4IA 3V9XA 4FJJA 4KHNA 5C24A 2OPRA 1HNVA 4KI4A 3OYMA 4FM2A 4ELVA 3RR7A 1LV5A 3AO2A 1A5VA 4CEFA 1NK0A 3SNNA 4F3OA 2BGGA 2KTQA 3OYEA 3S3NA 4W5TA 2D0CA 3V81A 5KI6A 2A1RA 4F2RA 3MEGA 1NJXA 5C25A 4LSNA 4I2PA 3KLFA 5I3UA 2BDPA 2OPPA 4J2DA 4M3XA 4CERA 3QEWA 2KZMA 1TVRA 3NF6A 3PO5A 4C8MA 2ETJA 4ZTJA 1C0MA 3V9SA 1KLMA 4CF0A 3SV4A 2WOMA 2HHTA 4CGGA 1KSPA 1WLJA 4CESA 3K5LA 3TAFA 5FRMA 1JLEA 4CHNA 1ASVA 1IKWA 1HJRA 4AH9A 4B9VA 2X6NA 3V9WA 5D3GA 4WE1A 3VQ6A 4CEDA 3DLHA 4F3TA 3PO4A 3RRGA 1BIZA 3OYCA 3VQ9A
chains in the Genus database with same CATH superfamily
3SWNA 2HMAA 2EGEA 1KQSP 1YTAA 4RTYA 3G4SQ 1QQJA 1VQOQ 1K73R 1B9FA 3KK7A 2O8BA 1BB9A 3OB9A 5BRDA 3CI5A 3JYTA 1GCQC 4BE0A 3QEVA 3QZ9B 1IHWA 4CJKA 3UA7A 4F7UG 1YI2A 3AY9A 3RMAA 4M78D 4WQ5C 3FZLA 2DD4A 3KKSA 3AA5X 1GCPA 3BF1A 4OKEA 3HM8A 2KDSA 2D0QB 4BRQA 2ZF5O 3G71Q 4JI2K 4CZFA 1TWBA 2K57A 3EFOB 4J2EA 3QICA 3A8HB 4Z88A 3NHGA 4XTVA 1TKXA 3UF4A 2GTJA 3A5MC 1G3SA 1TUDA 1R77A 2KRMA 3CCMQ 2X51A 3M0RA 3BF3A 4JI0K 4OO1J 1U1TA 4XTWA 4M3RA 1W2BP 4Z4FA 4PA1A 1JXOA 2E70A 2V7ZA 1MNEA 1EFNA 2V1QA 1E6HA 1Q82C 3IQLA 3SPYA 4FJIA 2XY8A 4JJNK 4OMLA 1BOTO 2Q97A 2GBZA 1QCOA 3TU4K 4EIAA 2DILA 3PTAA 2G8HA 1VQ5A 1IKXA 1BI0A 4M3WA 4BR7A 2JM8A 5J2NA 2YXYA 3VS7A 1K8AU 4FJ7A 5AQGA 4E0DA 2ATCB 4F2SA 3EGXA 2FXUA 5C12A 5CR2A 3TVTA 2DYBA 4IJNA 2HOEA 3R6MA 4JI3K 4DR4K 3R9PA 4XU3A 1NZ9A 5D6YA 2JWKA 1S72Q 4MZPA 2XDBA 3TI0A 4N76A 2BZ8A 1IXDA 3TSPA 4X9CA 2FG0A 1VQ5T 1GOAA 5GIOA 4FLUA 2KY9A 2JNGA 3LDOA 5JS1A 2GFUA 2LMJA 1YVUA 1PM3A 1U3OA 5GAGP 1QS4A 4DS5A 1QZ5A 2QM1A 5AQOA 1CSKA 2C0IA 2OX7A 4JRQA 1KFZA 4O55A 4PFOA 1U04A 3CCLT 2KQ2A 2PTKA 5LJ5d 3GP8A 3TEEA 1Q7YU 3TANA 1V29B 3HPHA 1YJNQ 3EL2A 3UKUB 1XNQK 3KVGA 2DXUA 2FEIA 2QI2A 2XKOC 5GMKe 4E7KA 1NGJA 4H5RA 3NMUA 4LF7K 4R55A 4RG2A 1X75C 2JS2A 3ID6A 2D5RA 2GWJA 1JXEA 1RBSA 4RKUE 3AA2A 2PVOB 2HHWA 4RUGA 4DTPA 1K8AR 4GKJK 1XQSC 1RAGB 1UGPB 3GLXA 4PUOA 5IN1A 5FU6B 3HJFA 4K8XA 3AAQA 2EQUA 2HBLA 3L2UA 4KFBA 1YWPA 2C06A 4FLXA 3SI6A 1L3UA 2E6ZA 2Q3SA 4IIMA 3EG3A 3EE9A 5I42A 1T6CA 1O1WA 4EP5A 2PY5A 2QA4N 3VMFB 1ZUUA 1VQMN 1N6QA 3DRPA 3FEOA 1BCMA 2NRVA 3R3LA 1M30A 2ROTA 2Q0RA 3ENHA 4FWOA 4HCKA 2HB5A 3LDLA 3JB9G 3A8OB 4BG9A 5FLXO 1UB4A 3HP6A 3G6EN 1QTMA 2AZVA 4JZ4A 3RBBB 3DYAA 1RDAA 1ZSZB 2HVIA 2K3XA 2OTJQ 1SF9A 3O8VA 4LC9B 5KTQA 4DQRA 1VSIA 3GNGA 4KPYA 4C92F 2XO7A 3SBTA 1WHKA 1TU0B 1RILA 4LF9K 4FOIA 1RT7A 4KHQA 3GDQA 2P5OA 1K9AA 3MCAB 2YCHA 1SL2A 1QVFM 3G71N 2M02A 3AV9A 4DLGA 4B9NA 4E7IA 3QFUA 2VC8A 4M77C 4K41A 4DBRA 2CP7A 3ZX0A 1H641 4BR4A 4MDXA 5KYWB 2CUBA 5C0MA 2YX6A 3UKUA 1SG5A 4E7JA 4M3TA 1BI1A 1ZBSA 3QINA 3VQ7A 2JW4A 1T44A 5KYYB 3C6TA 4M77E 4JI5K 4PJJA 1TXQA 1NJIO 5GAOl 4C8QE 4NL3A 1WI7A 3VETA 3QXEB 4DQ8A 4DSIA 1Y97A 2P51A 3EG0A 1W7AA 4AILC 5KYUA 2BE2A 3CETA 4BGBA 4JKHA 1Y0MA 4A5AA 1R0CB 3NHNA 3EKUA 5C2FA 3LZIA 2VGMA 2DL5A 5GIPA 1M1KO 2HZYA 4BI3A 2FBYA 3GBQA 3D45A 2D9TA 1QQNA 3P5JA 4DR1K 4Q0BA 1DT9A 1XUPO 3M4YA 3PMIA 2CH4A 3MX5A 5GAMe 2VKNA 1EKEA 2D8JA 4LH4A 2D1KA 3W3DA 2CSQA 2O8FB 2E12A 4J9GA 1AWOA 1VSKA 2YHWA 2JGUA 2ZE2A 4XH4A 4CJTA 2KI7A 1SUQA 4YTLA 2FBTA 2GWKA 2JN0A 4M78F 2RPNA 3TWHA 5F2RA 3NGZA 3M56A 3H46O 8ATCB 5TKYA 3ULDA 1HKBA 4KTQA 4CHPA 3THXB 2Z1HA 3GE1A 3I56A 2A3LA 2CGKA 4LH5A 3E9GA 4DU1A 1VQ9A 1UJYA 3JB9J 4JV5K 4E47A 4KRFA 3LM2A 4CJRA 4BB7A 4B9UA 4BR9A 2ED1A 4JRKA 3FC3A 1VSDA 2B5JA 3QDFA 4C5EA 2RHKA 3HFNA 4FJ5A 5KGWA 2ZGYA 1NGDA 3VS1A 3QNOA 3LALA 5KPRA 1OH5A 3RKXA 2JZ2A 4HVJA 4AHVA 1BIUA 1I8FA 2ASOA 1K8KB 1C1CA 2L3SA 3E19A 1NK5A 3E9FA 2PQWA 2HBJA 4CGDA 3T7ZA 3RTVA 1Q7YR 3D2EB 4DEYA 2COYA 3JCMb 1B9DA 1SL1A 5GJVB 4CEQA 1Z26A 1CLQA 1YITQ 4ILGB 4FJHA 2EJ9A 1U06A 2QA4A 2O4XA 2K9GA 3WEEA 3EG1A 3VEXA 1IBLK 4DBQA 1MMGA 3F5TA 5ADXH 4BY6B 1IJJA 4JI1K 2DFHA 4YOVA 1ABQA 4J9IA 4QS7A 4FYYB 1XWLA 2SRCA 3ME9A 3CC4T 1SS6A 3OW2P 1B34A 1VQMT 5CY4A 1VRUA 3SK3A 2LX9A 4HT8A 1PNJA 1KQSS 1WYXA 1S22A 4AM7A 5E84A 4I9QA 1RDWX 1JLGA 4RTVA 3KD1E 2IVNA 3KK1A 3H0FA 5DY9A 4OJRA 1GXIE 1RCHA 5LJ3h 2P9PA 4O5BA 5FPNA 1UAXA 5I11A 4FM0A 1G15A 4FLVA 1NYGA 4OPKA 2K4YA 1ZBUA 3UA6A 2E4HA 4Y92A 2J4RA 2WSCE 1HKGA 3VF4A 3ZT2A 4XTXA 2A3ZA 3AVGA 3VOVA 2PYLA 1QCFA 2E2NA 3ER0A 1JL1A 4A4HA 2FRYA 3X20B 4OVLA 4CEAA 3SV3A 2X35A 4C5GA 3MWTA 1L5UA 3OYAA 1RT5A 1EIFA 2VASA 2QDLA 4M78C 3OYFA 4J8OA 3CXCA 1I0CA 2XIDA 2AK5A 1T3SA 4IJAA 4A4FA 5KRSA 2M9UA 4M75C 1VYTA 2ABLA 4J9HA 2BTTA 2F96A 3QEPA 3QZ5B 2HNDA 2KT8A 3VA0A 4QOZB 1GLDG 4EP4A 4KH5A 3HOTA 3I55A 2DX1A 3M58A 3THYB 2GGRA 2RN8A 5AQRA 2GFAA 4PLIA 2G8UA 1BL3A 1ZBHA 4GVEA 3WNHA 3U3GA 5FPDA 3PSIA 4GBQA 3QDKA 4O0JA 3I56N 2MIOA 4BRIA 1VQ6A 3HVRA 3G6EA 3GF5A 3M54A 4N4IA 3X26B 1X6BA 2FSKA 2O9SA 4JDSA 4J7FA 3L3UA 3ZSZA 4DV4K 1VQPT 2A08A 1YHQT 3DXKA 3SMSA 1NK4A 1Q82U 2KYMA 1RTIA 2HNIA 2E5QA 3QIPA 3ZL7C 5KQ8A 2B4JA 1Y07A 4AMCA 4BC3A 2KNBB 2HF3A 3CPWM 2LQNA 2YHYA 4BWJA 1L3TA 4JN4A 1RAEB 2EGCA 2KR3A 5H1SQ 4PWDA 1WSJA 1QQOA 2YRDA 4AFQC 2X3WD 1JLCA 2ZJQL 2AJQA 4C8OA 1WDXA 1S5JA 3QSUA 4FZXC 4BI8B 1JJ2M 3CBOA 3LL3A 1Y71A 4ORZA 4EIKA 1GBQA 2F5TX 1KTQA 2E20A 3GPLA 1W4SA 2BE7D 1S72T 1F21A 2YHAA 4ZN1A 4M7DC 1VAZA 2DMOA 4AHSA 1C6VX 4M7AE 3CM6A 3CFPA 3M8QA 4PK4A 4FPAA 1WBBA 2YDLA 1GLAG 4FJXA 4JLHA 3THYA 1WX6A 1N32K 1D0XA 2D1XA 3TSZA 1K76A 3JS6A 4R79A 4FJNA 4B9TA 1M1FA 1AVZC 1S1NA 3BDUA 2FO0A 2EQIA 2EHGA 1ZSZC 2LT1A 2KEAA 1KC8R 3FE1A 1KLNA 3CHWA 1TSFA 3IRXA 1D9FA 4KI6A 4PY5A 4EMKA 4JHDA 3VTHA 4FLWA 4DA4A 5AQTA 2EBPA 2LX7A 5LL6Z 2L3RA 2D0BA 4C92D 2H3GX 3NPFA 5J2MA 1MV3A 1EO1A 2YHTA 2ZD1A 3GOIA 2QXFA 3OBYA 4IDHA 2CP2A 1K73O 1VQMA 1YIJN 1WXTA 2G8VA 4L5GA 2W0ZA 4BDZA 5GAOr 1J5EK 1MWKA 2XDDA 2EKHA 4HUFA 3QFPA 5FLXE 1SHGA 2Y4XA 2XU8A 4E7HA 1ATNA 3S6WA 4J2AA 5IT9E 4E2FB 2E4LA 3MP6A 5GANe 5HK0A 2QA4T 4DTNA 4ZTFA 4WFNL 5LMUK 4DTXA 2HMPA 2F4VK 3NGIA 1AD5A 4N4GA 2NLXA 3L0QA 1Y96A 5AFUH 1JO8A 4WQ4A 2ZJPL 2HKNA 1VUBA 2A36A 3CC7A 3ZT3A 3RDVA 4KHWA 1W6XA 3AVBA 4DU4A 4IEEA 3DB3A 1D8YA 4CRIA 3CCMA 3OJSA 2DETA 2XRIA 3CC7Q 5CZ2A 3I5SA 4DR5K 2E2OA 2P9LB 3QBWA 2KVQG 4N5SA 3LAKA 1VQ8Q 3OBWA 5A0GA 4BG8A 3M8PA 2QTXA 3CCVN 3RKWA 2A42A 1G8XA 1LWEA 3D7EO 2ZPFB 3K5OA 3CPEA 2DPPB 3KLEA 1OYXA 3ZT1A 4PHTX 5KGXA 3IAYA 1FJGK 3O3FA 3ZLJA 1EZZB 2B6AA 1Y96B 5DK5A 4GLKA 4YOWA 1HQEA 4M3YA 1WJSA 3MJXA 3KXTA 4IUUA 3VF2A 3VA3A 1OI1A 2E88A 3SMPA 2D0NA 4NS5A 3B8AX 1KVAA 5JVHL 5GAOp 5KPTA 3PNWC 2DO3A 4YOXA 2KXCA 3CCRT 4QS8A 1XQHA 4DV0K 3T3FA 3M5RA 4JKGA 3JCMf 1YFNA 1S6PA 3EGUA 5AZIA 3HXMA 4F7UB 1VQ7T 4CECA 3TAQA 4BGAA 5CO7A 5L8RE 1GBRA 2AT1B 1X9JA 5J2QA 1RGIA 2XHBA 1YJ9T 4I9LA 3CD6T 4BROA 2SEMA 1RACB 4KULA 2YUOA 2Z1GA 2L5QA 4JK8A 1IV0A 4OB2B 2I2LA 4IZ9A 1ASUA 5C6SA 2DTHA 4W5RA 2O4IA 3WQUA 2OPRA 3QYHB 4JYAK 3LLRA 4AM6A 2XDPA 3RR7A 1G83A 4CEFA 3F9MA 1NK0A 4F3OA 3OYEA 1VIFA 1N9SA 3QDRB 3VS6A 2CGHA 5KE3A 3P8DA 2D0CA 4W5TA 4F2RA 3MEGA 2E5KA 5C25A 4LSNA 4ZGEB 3KLFA 5I3UA 4J2DA 4C1NK 1WHJA 1NM1A 2P9NA 4B1XB 1HNZK 1TVRA 2KZMA 1Z6RA 3PO5A 2RH2A 1Y7XA 4ZTJA 2P0QA 2LRQA 2ZPBB 2NNWA 3OA9A 1KSPA 1N36K 3JV3A 4CESA 3TAFA 5FRMA 5CAIA 1JLEA 3C6HA 4PKIA 1YITT 1ASVA 5BR9A 1IKWA 2XK0A 5IHIA 4B9VA 5D3GA 1GFCA 1T3VA 3KHYA 4CEDA 3DLHA 1Q81R 1D0ZA 2CP3A 1UUEA 4A5BA 3VYHB 4FWLA 5HCKA 4CEEA 4RTTA 5CVIA 1B92A 1UJ0A 4DTJA 2PUKB 3AVNA 3ZX3A 1K0XA 4D8DA 5M1KA 4CD3A 3AHUA 1BQNA 3C4SA 1M90R 4BRLA 4M78B 4CF9A 2ZJRL 4JRPA 5AQPA 1LWCA 1M1KU 1K73C 1SL0A 1QP2A 4L3QA 2ASPA 3OQ5A 1WPYA 3RIRA 1MV0B 2E2PA 1FWZA 4LD0A 3RMSA 1HYZA 3EH2A 3PE0A 4AG2C 3MN9A 3QIIA 4NLCA 2YUQA 3LWLA 1U47A 3RWUA 4IUPA 1XTDA 2HVHA 1WIEA 4O4GA 3L6QA 1VYUA 3VEVA 3I56Q 4AFZC 1Q81U 2JLEA 5LJ5f 1YF5L 4XH5A 2PBDA 4F04B 3KZBA 2GUIA 5HK3A 1JLFA 2BUDA 2G8WA 3CD6N 3OS5A 4IIOA 4WQ4C 5AQSA 2LZ6B 3FDRA 1NOZA 1KQSM 2RI2A 2HKQB 4MLEA 5EXWA 4TVRA 4ELUA 4RCBA 1M90U 2OTLQ 1PWTA 3IS9A 4BD3A 4BRHA 1HPZA 3WXLA 4OB1B 3CD6A 2QWQA 4HVUA 2HQXA 2JXBA 3LWMA 4C92G 1SKWA 3WNFA 4DQSA 3VN5A 5AQUA 3OJUA 4XU2A 1KJWA 3FLCO 3KKRA 3T1AA 3E1SA 3ATUA 4FO0A 1RTDA 2RD1A 1WHMA 4GNIA 2KZZA 3M53A 4XAXB 5HRNA 4CJPA 1WHHA 3D7SB 1HUXA 3U9ZA 4BQLA 3TAEA 2AP1A 2ITMA 4EFHA 3FJ5A 4B6MA 4BUGA 1LOJA 2EW3A 4DSLA 3J81E 4M7DB 2O8CB 1Q7YO 2G8KA 4CZHA 4CJSA 2DM1A 5CK9A 1VQPQ 5JLHA 5I9EB 1X01A 2P4RA 1IBMK 5EX5A 3V7SA 1M2OA 2WC9A 3ZSVA 2LNHB 4FW2A 3VEZA 4CEZA 1M4ZA 1C0FA 2LSNA 1N33K 1TKTA 4C92B 3CMEN 2HDAA 2EWSA 5BRHA 3DOLA 5KYXB 1YJNN 3PSFA 5GMKh 5CZ1A 1HYVA 2O31A 3CCST 3Q1JA 1H3ZA 2QWLA 3V4IA 5HRSA 4PKHA 2QAZA 4BR2A 1X6GA 2EJGA 1VQNA 3P8BB 3S3MA 4WQ5A 3BDLA 1YI2T 4MZTA 2O8CA 1D09B 1SSHA 2R5AA 5IAYA 4M75F 4AHCA 3DLGA 4AQYK 2P0KA 2DTUA 3E01A 3C95A 2EYWA 2QK0A 3JCMd 1X1PA 1TUYA 1VQ7N 1VQLT 2RHIA 1HKCA 3PX4A 2EVRA 2HW3A 2K3BA 1HD3A 1N5YA 2F8TA 4E6RA 1UHCA 2AKKA 3M3ZA 2P9IB 3FZKA 1YBYA 4PL8A 3WQTA 1ZA2B 5CYMA 3A98A 2CP0A 1YHQA 3HSTB 3JCMh 3CC2T 1WSIA 4CZMA 3FFKB 3L4IA 3CFRA 5KYXA 1Q81O 3ULRB 4EMHA 1YHQN 4FM4B 4C8QC 4KV8A 5HP1A 3BZCA 1N8RC 3OYBA 3T69A 1YJ9Q 4EZ9A 1GLEG 4YORA 4QVZA 2E41A 4MQ3A 1R59O 2BZXA 1RAFB 3LGLA 1R8OB 4K8ZA 2QW9A 4HVVA 1NU0A 2RJDA 2VUBA 4KTWA 3V1OA 4M7AG 1JXBA 4DTMA 4DQIA 3DMJA 2UXCK 2D0PA 5FU7C 1K9MR 4IUVA 1VK0A 1WOQA 5B8HA 1BGXT 4KHPK 1OOTA 1RT1A 3LPUA 2OA8A 4J9FA 4AFSC 3INZA 4ZN3A 1M8VA 3A8MB 2DFFA 4JKCA 2QGFB 3ZEUA 3ZSXA 4BRKA 4CW7B 1WHLA 3HPGA 4DF8A 4OMMA 1JLQA 1ZYQA 4DMNA 3PX6A 3QBXA 5ELZA 3CCUA 5KE2A 3P31A 1QVGS 2W40A 4CFDA 4J6XA 1BKBA 4N56A 4E7SA 4Y28E 1QHTA 3MWPA 5CIUA 1HK9A 2PVGB 3S9HA 5FROA 1NKCA 4TSXA 1P90A 1VIEA 4GY5A 4RMOA 4M7DE 4H4OA 1B34B 5KYNA 3I8DA 4O6JA 5D6XA 4A2BA 5BPMA 3VS0A 1I81A 1D0YA 1QVFP 2LTOA 2QTVA 3MHXA 5GAMj 2PAVA 3P38A 3BP8A 3MDQA 4DTRA 4XH1A 2PUOB 5HY6A 1AZEA 3CCJN 3UE5A 5D7UA 1RADB 3SB2A 2CP5A 3N4QA 4ILJA 2HBWA 3HT3A 2NUPB 3EG9B 3TABA 2DFUA 4ISGA 5GAOm 3O9SA 1ZSGA 4WCIA 3F9KA 3BEXA 4KBOA 2CH5A 2FBVA 3CBMA 1YCYA 3OYIA 2HNZA 2WTUA 2F5KA 2XD0A 5FWCA 4DUYK 2A1SA 1RAHB 3FZMA 4FT4A 2HSTA 1NGCA 3CJAA 1M3BA 3PVLA 2WSFE 5JS2A 2YKNA 2COZA 3A5ZB 5J26A 1EP4A 2J6FA 4CI6A 1NBEB 1Q95G 1VQ6T 4NCAA 3A8GB 1ITGA 4CGHA 2P9SB 4YHHK 3SUNA 3H6ZA 3I0SA 3HSCA 1B7TA 4JZ3A 4FU6A 1YJWN 5LJ3d 3M0SA 2YWWA 4K11A 4B8CA 1U8RA 1VQ7Q 3GIBA 4XK8E 5I2SA 2YRCA 5AQNA 3VERA 3CCEQ 4F4KA 3QJ6A 1RTHA 3EHRA 3LWHA 2OTLT 3VS5A 1YJWQ 4E19A 4YOUA 1AEYA 4JD2A 1I1JA 1YITN 3JAMO 3THWA 2HHSA 2FPDA 5GMKl 5C10A 4ELYC 2BKDN 2ZCFB 5GANg 2E2QA 1FXXA 1X2KA 1EWRA 3TAGA 4B3MK 4M4ZA 4EPCA 1GL5A 2K79A 4LUEA 1XHXA 4H5NA 2QK9A 1QQCA 2XMFA 3BE3A 3I8BA 5J1EA 5GAEP 4PL7A 1A5XA 2PYJA 4LFBK 2DY4A 4AFUC 3HM9A 3VF6A 2LCSA 5KCOA 1ILYA 2KK4A 4B9WA 1WSGA 5LJ3j 3U8XA 3VRYA 5DM6L 3DRRA 3QWYA 2RE2A 2D8HA 4NYNA 1K9MC 2X78A 3ID8A 3VQ8A 3QERA 2CH4W 2EX3A 1UOCA 2RO0A 1RAAB 1X2QA 2DNUA 1RT2A 3V1RA 1A0NB 1QHAA 1N5ZA 1N9RA 2HBKA 1SKSA 2JMCA 4OP0A 1BU6O 1QVGA 1NGBA 2B8AA 4N4HA 4C8LA 4EZ6A 4H0VB 1OULA 1Q9YA 1T6DA 3A0IX 3CMAN 2A6AA 3N4PA 3VQ4A 1VQKA 1YJ9N 1R0AA 2DXCA 4I7FA 1UE9A 1SRLA 3CCSQ 5A0DA 1W0HA 3R1XA 1P8ZA 3DLBA 2OAUA 1WLPB 2O88A 5LJ5j 5HBMA 1QE1A 1QWFA 1MDUB 3BZKA 5M1FA 3HO1A 2M16A 2QKKA 1KQ2A 1WN7A 3DLRA 3PFSA 3M0PA 3GG4A 3VGKA 2VYTA 3G7ZA 4FLZA 3HRGA 3OW2M 2ESWA 5J2PA 4BWMA 2QWPA 5AT1B 4FJ8A 1WHGA 1XMOK 1V76A 1VQLQ 3CCSN 3V6DA 3CCQT 3IUCA 2LCCA 3OVNA 7AT1B 4M3ZA 2J6OA 3HTVA 2E65A 4C0FA 1VQ8A 4CHYA 2ZPIB 5T7BA 1T0JA 2JM9A 1S9EA 4FM1A 3L8BA 3J8AA 4QAGA 3RRHA 3HSBA 1GOBA 1S3XA 4FOEA 3ZT0A 3CCRN 3SQ0A 3G4SA 1Q86U 2Y4YA 1KHIA 3L1AA 4GKKK 5I22A 3HRTA 3TAPA 3DLKA 2EQKA 2KLAA 1OPKA 2IVOA 2C0TA 2BH1A 3MEEA 3NCIA 2P4TA 3G25A 3U9DA 4B1YB 2F2XA 4A4EA 5GAMg 3QB0A 4MDWA 4M7DD 5FPEA 4NOYA 2I7NA 1RUWA 1VRTA 2FB7A 3ZYYX 3LDQA 4L6V5 2J06A 5SWMA 4PFPA 4C92C 1REVA 4M7AD 1S1WA 1NK7A 1WXBA 3CCEN 2ECZA 1U49A 3JCMJ 2Z0WA 4FSSA 3V9ZA 2R7YA 1QP3A 1WJRA 4C8QG 5CCAA 3TAMA 4OMNA 5AJ3K 5JVGL 1A5WA 1M3AA 4M77G 4OVAA 4M77F 3RMQA 3VV0A 1RDCA 1ZUYA 1CXQA 2VWBA 2BTFA 4WF2A 2FPFA 4A4KA 3ASKA 4FYVB 2IIRA 4IXCA 1KVCA 4B1WB 4A59A 1NWKA 4CJQA 1I4K1 4YDUC 2VVKA 4DR2K 2HQHA 1K8AC 4DV6K 2DJZA 3MK6A 3LP0A 3SQ1A 4ELZC 4JK9A 3KJVA 1HMVA 3LH0A 1Q9XA 3U23A 4A61A 4C8NA 3GL1A 3I35A 1M2VB 4XU1A 3V8KA 3SEMA 2DLPA 4GLMA 1JKHA 2J7IA 1UFFA 5FW9A 3CCQA 4LFCK 1WGSA 4CIGA 2K2MA 2L3QA 3RSEB 4M7YA 5J3BA 1YUWA 2RHYA 2D4WA 4AG1C 1JJ2P 3NH1A 4G1QA 4CFCA 1M90O 3AGKA 4KRTA 2DL4A 5AQKA 4A57A 1JJ2A 5GAHP 3J80E 1VQNQ 3HL8A 1VQKT 1S1VA 4XTYA 1SSFA 2ED0A 3DLEA 3U3YA 5KYYA 3JCMP 2QEXA 3RESA 3VU3C 2HSPA 4F8RA 2P84A 2YUPA 1J3TA 5HOOA 1NGAA 3LDNA 3OYDA 4JS5A 1TYQB 1OZ3A 4IBNA 2KAFA 1M1KR 2E1ZA 5AQJA 2V52B 1QSLA 4GY2B 3Q7CA 3X25B 1VQ4T 4M7AB 3CXCP 2KW4A 2HBPA 4QQDA 2FPEA 4X9DA 1WQWA 5KRTA 3EE8A 3D2FB 4J9BA 3DXKB 4FCYA 2HNYA 3PLAA 2KE9A 4HHTA 2CSIA 5K14A 4B9XA 2VQEK 1X9SA 2PZ1A 3VJPA 4YOTA 3AO3A 4BDPA 3DKMA 3O9UA 1TK5A 2EQJA 4PJMA 3H6EA 4M75G 3DOKA 4C23A 1BHLA 3UKRB 4BRFA 4C8KA 1OZ2A 4QQ6A 1KXPA 3ENOA 5F0XA 3CC7N 3GBTA 3RSEA 3CCVA 5GAN2 4XEIA 1QLYA 4RW9A 4RW4A 4WF9L 2A37A 2EKOA 2A40A 4YDUA 5AQQA 1BBZA 3ZSYA 3MP1A 5CE3A 2ZQBA 3A5NC 2WSEE 3O4NA 3OTOK 1I07A 3OS0A 4GV3A 4PJOD 2OTLN 1X69A 4X64K 1MMNA 2PU9B 3MEUA 2JWLA 3AVCA 4DSFA 2P9KB 5ADXA 2ZGZA 1GLFO 1NMNA 3O1BA 4A2AA 4DUZK 1D3BB 5CKFA 4WCEL 4ID1A 3VQDA 4F9OA 5JICA 5M9OA 1BWFO 2DPNA 3WXIA 4KHUA 2QYZA 2XY5A 4FWMA 3K2PA 3NFCA 1G99A 4DV5K 3O80A 3QIOA 5CQXA 2P9SA 4WFAL 2QA4Q 3V9XA 4FWSA 2HCKA 1HNVA 3V7CA 4NO7A 3OYMA 4QVCA 2H3EB 2O8DB 2RHUA 4G9ZA 3WVEB 3NMZC 3CCQQ 2KTQA 1MMAA 1PD1A 2HF4A 3VENA 4KUDK 4C0ZA 3D6RA 2JT4A 1VQPN 2A1RA 2UXDK 1AHJB 1IZ6A 4F7UE 1G5VA 1PKTA 1HX1A 5GINA 2BDPA 3G4ST 4MLHA 3NF6A 4FSXA 4OPAA 3G6ET 2ETJA 2DEUA 1KLMA 4CF0A 3PIOA 2WOMA 4KT0E 4CGGA 1VQ8T 4LDVA 5GAN5 3A1PA 3RR6A 3GNFB 2DRKA 3CEYA 3E66A 1OU9A 2GUPA 1YWOA 1QVGP 4AH9A 3A8LB 3V9WA 3VQ6A 1YP5A 3FIFA 5D6WA 3OYCA 2ZAEA 1PD0A 1J6ZA 4KH4A 1JCEA 3E9OA 5C2DA 3K57A 4BACA 3Q7BA 3R6OA 2GQIA 4B1UB 4GV6A 4UC4A 1NGIA 3MEDA 3OW2A 4CZEA 5HL7L 2GELA 4QCLA 2RN2A 1JU5C 1S1TA 3FZHA 1U4BA 4J5YA 1FX7A 2X4JA 5CKDA 2DXTA 5EG2A 2IGIA 3KTQA 2VG7A 4CK1A 3CPWA 1FMKA 2A5XA 1O9SA 2DYIA 2LJ3A 3VEWA 2X4WA 1NPRA 1P92A 1NG9A 4H8KA 1Z9ZA 4NLBA 1FKPA 1WZOA 2FRWA 1M90C 5AQHA 4JKFA 4JI6K 4Z94A 4H5WA 1QMCA 2DEQA 3J7ZO 3CD6Q 1N8RO 4Z4GA 4C8QD 1FYNA 4C1NI 4EHUA 2BIVA 2ITGA 4O8KA 2LNVA 4M77D 3SWNB 4DOWA 4VUBA 3I55N 3LW5E 3RMDA 2RMOA 2P9LA 2O01E 3FGUA 4YY3K 2COWA 4OGEA 1VQ5Q 1ZUKA 1VQ6N 2L2PA 3H0IA 4RTWA 4JKGB 3KFVA 3AGRA 3KD5E 1BCOA 3EH1A 1O75A 4M78G 2GX9A 1Q82O 3EEQA 4JPBW 4M7DF 4BVPA 2K2VA 2L8DA 4FYWB 4BR5A 3CCLQ 3NFAA 4DQPA 1W1FA 5DLQE 1XMQK 2QXLA 4H0TB 2WBNA 3JCMg 2G3RA 4FYDA 4QKUA 2YV0X 2MYSA 1HQUA 3I0RA 4QS9A 5BR8K 4OLBA 3HFOA 3CPFA 4ILHA 4PKGA 1B07A 1KVBA 1TAQA 4LN2A 2KROA 5EOYA 1XNRK 3G71A 3PX0A 1ZBFA 4H0PA 3SFMA 4OB0B 3O5ZA 3PIOL 4OPJA 2RQRA 1TK8A 4CI0C 4Y1CA 1LAVA 3RVCA 1WFWA 4V2SA 3O1WA 3VGLA 1ABOA 2O2OA 4B3OA 3JB9D 2QGGA 1M1GA 5L23A 3NF8A 4FT2A 1YVNA 2JVVA 1NMDA 1RT4A 3E9LA 2RJCA 5GAN3 3EKSA 3OY9A 2IDOA 1N34K 5M1QA 5CHIA 1PSEA 2RI5A 4CJUA 2BE9B 3AT1B 3REAB 4EMKB 5C42A 3VS3A 2NRXA 3KIOA 3JAME 3AVAA 3P4IA 1QVFS 4DQ2A 1IHVA 4II1A 4Z0UA 4HTLA 1OH6A 2WUSA 2E10A 1DEJA 2GQVA 4F17A 3C94A 4LD6A 2VYPA 5EY4A 2HHHK 4Y91A 4QQGA 4MFBA 1HNWK 5DLOA 1KC8O 2UUCK 1U1SA 1SKUB 1NGHA 1JRIA 1RTJA 4DLEA 3C0BA 1N8RU 4NYFA 1YN8A 2CREA 2HL3A 4XU0A 2K3YA 4OMPA 2CDTA 1WUAA 3UIQA 4KREA 1H3HA 3IG1A 1NNEA 3QKJA 4BE2A 4CFAA 2LCLA 2DAQA 1S1UA 3NH0A 2MMPA 3DB4A 4HT9A 3RUXA 4H5TA 4Z4EA 3VUZA 1DGKN 2QWNA 4JEPA 1VA7A 4FVUA 3QPHA 4FWNA 2DKGA 3ZETA 2A0FB 1NM7A 1Q18A 3DLMA 1WA7A 4DS4A 4X34A 1CKBA 3M4GA 4M75B 3TSQA 3J7AF 1WSEA 3E9PA 3QESA 4JKBA 1RDBA 1SPKA 1ZA1B 1U5SA 1WSHA 1GCQA 3PGGA 5KCHA 4PLLA 3UPUA 1KAZA 3NBPA 1JEGA 1W2BS 4M7AC 3AO1A 1OX8A 2YHXA 1RI9A 1ZC6A 4LDXA 3TSUA 4BC2A 2X74A 2Q1NA 4I6MA 2HHUA 4HXJA 2QKBA 4C8QF 2QWOA 1ZBLA 4IFYA 3MAQA 4B9LA 4M63C 1Q86C 1LAWA 3M57A 1UWBA 2P9NB 1UG1A 1M3CA 2R5MA 3O9QA 2AA4A 4GMJB 2KHOA 5CYQA 3DAWA 4FK0A 4F7UA 3ZETB 2MK5A 1QVPA 1Y57A 3H08A 3O9TA 2VV5A 1IKVA 1LWFA 4OKKA 4AF1A 2DVJA 1SV5A 4E1NA 3K5NA 1M2VA 2MWOA 2NRZA 2CYZB 1VQLA 4OB3B 1TTHB 3HPWA 2YNHA 3MX2A 3ZCMA 1X43A 1C1BA 3HPOA 3SQ4A 4NCBA 4BRNA 4CZJA 2CH6A 2P9IA 3O4WA 1Q82R 5DMRA 4CF8A 5GAMh 3OS2A 3AA3A 3H9NA 4YFUA 3VS2A 1U2VB 2J05A 4DU3A 4FK2A 2Y90A 2NYSA 3AVLA 4DSJA 1FMWA 2GTDA 4GW6A 3ULEB 3JXUA 2OZSA 4IUTA 1RBTA 4CJVA 4DB3A 3HHTB 4EHTA 2ZM6K 1OU8A 4DHYA 4HCZA 3EGDA 2X4YA 3LDPA 2AZSA 3K59A 3DI6A 3SUOA 3SQ2A 2LDMA 3DXMA 3ZBDA 4B9MA 1SKRA 1CXUA 1NK6A 2WACA 5M1PA 4LFAK 3CIPA 3X24B 3TSWA 5EU7A 3HVTA 3EFSA 3DLLA 3JCMe 2R57A 4IG3A 4L8RB 5HRRA 2FVUA 1QSSA 1BIBA 1LCUA 3LH5A 4JKEA 3VYGA 3EY1A 3JCMQ 5C15A 3T1HK 4HCBA 3LX7A 2LVMA 1HLUA 4FJGA 4IO8A 4YNQA 1T7PA 2NUZA 2PVDB 4ISEA 4C8QA 2HHVA 2RM4A 4J9EA 4DF4A 1FKOA 2RA2A 3QEIA 4FW1A 1EETA 1NGFA 3ZSRA 2P9UB 4AT1B 4NCGA 4CK2A 4CFBA 4MMLA 3QETA 2DFEA 4N0AC 4JUVA 4FSVA 3V9UA 1KHCA 3CBPA 2VCPA 4LDYA 2D6FA 5AQWA 2E6NA 1YIJQ 1VQ9N 4J6WA 1T3LA 3WXJA 3C7NA 1BA0A 2DBKA 3PUFA 4KHSA 5LL6S 4DKWA 5FU6C 5AQFA 4XTUA 2NLUA 1DTQA 1S9GA 3VPZA 3MN6A 3VRZA 3DJCA 3TR8A 3AVIA 3ZT4A 3CJCA 3SDZA 1NJYA 1PCXA 1QZ6A 3MXIA 4IFVA 3VQPA 4CHOA 3CF5L 3KLIA 3NVKA 3G6EQ 4LE9A 3CJ9A 4KBMB 4CK3A 2QTDA 5HROA 3CC2N 1NJWA 3EGDB 4V19S 3MXMA 3SLCA 3REBB 3TTCA 3UKRA 2M51A 3K9KA 4E1MA 1LJOA 2B86A 1OQKA 2VXFA 3FLGA 2OPQA 2HEQA 4PJOA 2P9KA 3ZSWA 3I55Q 2E3IA 2KRNA 3L2ZA 1ZQ1A 4HVWA 2BUPA 2F7TA 2LC4A 4KGVB 1VQ4N 1OVQA 3AVJA 3SZ2A 1UDLA 3SWNC 3B6PA 4CJ7A 2DL8A 2P5GA 2HSEB 4FXDA 1U2VA 5AQLA 5MLCQ 1W2BA 3EO3A 3HZ6A 4E7LA 1RBRA 4FWPA 1X27A 4HUGA 2RF0A 3HP9A 4M77B 1XC3A 5AQVA 4OX9K 1ATRA 4M7AA 4MZMA 2JS0A 1SZ2A 4FLTA 4R5PA 1X3NA 2YUNA 3ITHA 2JTMA 2KMTA 1LNXA 4JJCA 3AVKA 3O4QA 2QG9B 4FZYA 3AAPA 3FB9A 3QUIA 3EAEA 3THWB 1NOYA 1VSHA 3OMGA 1GLJO 1SAZA 2GNCA 5E41A 2XY6A 2Q31A 1AZGB 4PNOA 1IRXA 1WXUA 4C0DB 4J9DA 1TGOA 2ZGWA 3SHWA 1YJWT 5J39A 3NF9A 3MCPA 1W70A 1VQLN 3SUPA 1TUGB 3CCVQ 3CCLA 2YJFA 2HQEA 4MMKA 4O5VA 1LVKA 3UWNA 4FWRA 2W41A 1RLQC 3C12A 4OPHA 2H8HA 4KO0A 4DR6K 5KYWA 4OMOA 1WJQA 3T19A 4ZNXA 3K0SA 4CC4B 3CCJQ 3SJJA 2C0OA 2LJ1A 1LW2A 1HYOA 2YLCA 1KAYA 2DA9A 3EHQA 4DBFA 3M6GA 1TG0A 2JJ9A 2V51B 4W5OA 2X3XD 2EYQA 1KCFA 1YAGA 2DF6A 4DTOA 1UA1A 2LJ0A 4ID5A 3ISNC 1RFQA 3P8HA 3A5OC 3E2UA 1SQKA 4H0YB 2KT1A 2IIMA 1TV6A 5AQZA 2HAXA 3VQCA 3M8SA 4DR3K 3MN5A 1NKBA 3HBTA 2OTJA 1C0TA 3D2FA 3SAFA 3FFIA 3THVA 3M0UA 1WAFA 3J81O 4Y0WA 2H3JA 1YCSB 3EG9A 4J83A 2JTFA 1J53A 1TKDA 2GV9A 4CBUA 4CZIA 1AWJA 5DM7L 4IDKA 2YLBA 3PY8A 1VQPA 1IO6A 4JNEA 3TARA 5LJ3f 1VYVA 5AZIB 2DJQA 1NKEA 3IKMA 2CS7A 3AO5A 4KKOA 1TAUA 1G2BA 2QASA 1I3AA 4O44A 1WQ7A 5IT9O 1ESVA 1NJIU 3LANA 4KUIA 2X6SA 1CKAA 4DQQA 4X65K 5LJ3e 4H03B 1BISA 1JJ2S 4KAZA 1S6QA 1RL2A 2RKIA 2EYYA 4KH6A 4KB1A 4J9CA 2LP5A 2RNAA 4NL2A 3TCJA 3P1GA 2CGJA 3MMVA 2V8JA 4FIBA 2EGAA 5ECAA 1KD1O 5LY3A 1PRLC 3DRSA 1VQ9Q 4CCHA 4Y1DA 2NRRA 1PKSA 2XY7A 3ZEUB 1T8EA 3R6NA 1JBMA 3JCMW 3PT9A 2OTLA 2ZPGB 3CC7T 2RHXA 1U6ZA 4JAXA 3SJHA 4CEBA 2O8EB 4BI4A 5CKHA 1NJIC 2CUDA 1Q81C 2VXEA 1FK9A 3CJBA 2RHZA 2DRMA 5LJ5e 4B8AB 2YRVA 3HRSA 2HD0A 3RR8A 4IWVA 2OANA 3NDKA 3ZX2A 3O08A 1N8RR 4K42A 2W42A 3MEAA 2Q2RA 4KGZB 2BANA 2VQFK 1Q86O 2ROLA 4LUDA 1NJIR 1D4XA 1GLLO 3M55A 3CCUQ 2FBXA 2L89A 4FPBA 2DD5A 4ICLA 4BRDA 4DG1A 2O9VA 2FSJA 3CPWS 3PV8A 2EFIA 3OA6A 5GANj 5AR0A 1JQQA 1ARKA 1KAXA 1UTIA 2ZZDA 5A2QE 3LWIA 1Z25A 3A2FA 4LF6K 3CMET 3HI0A 1UECA 5CKEA 4DOVA 1S1XA 3CQYA 2UUBK 1LPLA 2F9TA 3CCRQ 2O4XB 2I0NA 3ATVA 4CEOA 4IFEA 4CGIA 3ASMA 3DWLA 3E1YA 3ZSQA 1RT3A 4IURA 4CD1A 3O3GA 4J8FA 2CZ7B 3EN9A 5KYUB 5I21A 1ZBJA 5GAN4 1VOMA 3LZJA 1I39A 4FWQA 4ELTA 1ZHIA 4CVNE 2P0PA 3PVQA 4O0IA 2G8FA 3UATA 3VQAA 3QNNA 1QQMA 2UYTA 3A5LC 2GCXA 3MXJA 1Y64A 2DIQA 3V8JA 4C5HA 4CF1A 4IOXA 4KB0A 4Z4IA 5FPMA 2KFZA 3LPTA 3VESA 1V1CA 3D0PA 3AA4A 2O8EA 1OPLA 4AHRA 3QO3A 1NBWA 2K5FA 5BN8A 3DXMB 3QLHA 3I55T 3G71T 4CJEA 4ZHRA 3OYNA 4W5QA 1HNXK 4UQGA 4DFKA 3M5AA 5GANd 2KKZA 3MPUB 5LJ5h 1QSYA 3CXCM 1NG2A 2QEXN 3OYHA 1GLCG 2MWPA 1YT3A 4A54A 4C5IA 4HWIA 2DZ9A 1GLBG 1PRMC 2MAMA 3OSVA 3CCSA 3NE6A 3D2EA 5AQMA 2DTIA 4DEXA 2Q36A 3VS4A 3WUHA 4IOCL 3IMXA 2AKLA 1K1ZA 4JI7K 4FM2A 2O8DA 4N0AA 5AZJB 3AO2A 1A5VA 2AIRB 8AT1B 4YOYA 2G6FX 5LJVA 1ZXOA 4QVDA 2V26A 2O8FA 3QBYA 3V81A 5KI6A 4IEIA 4I2PA 2VGNA 4BRCA 1Z9QA 1IGUA 3QEWA 2LQWA 1NGGA 1L3SA 3V9SA 3SV4A 1G3YA 2W6KA 3LGFA 4OMFB 4M78E 4EDUA 2CGLA 2W10A 1W2BM 5AQIA 1WLJA 3K5LA 2V1RA 3L42A 5EC7A 4A4GA 3AARA 2MF2A 4B3TK 1QCNA 1ZSZA 2MPXC 2JTEA 4DV2K 5A2QO 2X6NA 4WE1A 3JB9I 4BRMA 3CCJT 2RB6A 1WB9A 5FU7B 3RRGA 1KC8C 4F3TA 1JB0E 1OV3A 1RI0A 1KD1R 3F70A 1HPMA 5GAOq 3VEOA 3RMCA 4M42A 4NXMK 3RMBA 1YIJT 2KRSA 2F1LA 1HYSA 4M78A 5LJ3g 3VEYA 3CCJA 2FZCB 4E3SA 2ENMA 4LDUA 4DTUA 4JD2B 2FC0A 1J54A 3FJPA 2FHDA 1U48A 3G4SN 2F2VA 5KH6A 3BY5A 2RI3A 2RF2A 2QQSA 2NWMA 3CXCS 2DBMA 3QG1A 1CZ9A 3JRZA 2JOYA 2X4XA 4FL6A 5AYFA 1WNSA 1PC0A 1VQ5N 1TK0A 5M1OA 3CFOA 1IO2A 1RAIB 4DSKA 2NUPA 1HNIA 2XHCA 3META 4LY7A 3KLGA 4JKAA 2HHQA 5C0YA 4B3SK 1YTUA 1KQ1A 1KIKA 2CZ1B 4ESRA 4KHYA 4K25A 1E4FT 2HBMA 3CM5A 4BQZA 4PJNA 3OS1A 2EYXA 4AHUA 3FZFA 5HRPA 4C0DC 1QVGM 4FJMA 4AHTA 3RKYA 2UXBK 4LF5K 4Z4HA 2KSSA 2GEMA 2V8KA 4R56A 1C6VA 1TL3A 4PJOF 2OTJT 2DXBA 2EAYA 3CC4A 1IKYA 3M8RA 3H3NO 4BC5A 3JSMA 3NH2A 1IG8A 4FLYA 3VQBA 3EFOA 1VQ9T 1TUCA 3EGXB 4ANJA 1VQOA 3C6AA 2F2WA 4FZZA 4FVMA 1MA9B 2CT4A 3I56T 3CG7A 5M1NA 1YI2N 4FL9A 3L3VA 3NVMA 5BPLA 3N5BB 1I5LA 1HJOA 2E1YA 3QHSA 4M7XA 5JMVA 4HTUA 2O8BB 3NTIA 2VWFA 3O6WA 3BFMA 2IC3A 1NLVA 3LDSA 2GBQA 3P83D 1FW6A 3CMAT 2YJEA 4JI8K 4BR0A 2YT6A 1NEBA 1YI2Q 3EG2A 4Z02A 2DVEA 3CCUT 1C0UA 3H1QA 3VTIA 4C92E 4CJ5A 2Z1JA 1T0HA 3R8EA 3CQ8A 3RNJA 3O3HA 3CCVT 4JJBA 4PL6A 1K6YA 1NGEA 3THXA 3HK2A 2NRTA 3CCEA 2FL7A 1QW1A 2RPIA 4JJDA 3KWIA 4CZKA 5F1XA 2JMAA 2RQWA 3V8LA 4DBHA 1AWXA 3OSSC 4PFZA 1L3VA 9ATCB 4B08A 3JSCA 5AZJA 4JLGA 4EMGA 3K58A 4IKFA 2KQWA 4RWTA 5AFUA 1E4GT 2DTOA 5GAOn 1ZX6A 3CMEA 4BRGA 5AQYA 1JL2A 2D0AA 1K9MU 5GANf 2YNGA 3PIPL 1UGQB 2Q0UA 5IH2A 2F69A 1C1AA 4F14A 5BREA 1O13A 4FJ9A 4FWKA 4J2BA 4J7IA 1TH7A 4BREA 4M75E 4EAHD 2W6LA 1IBKK 2CT3A 3I9QA 3OYGA 4RW8A 2D0OA 3U4LA 1I5OB 1WBDA 1ZBIA 3WEEB 1HRHA 4HUEA 3L2RA 1BDGA 4DV1K 3TREA 2PZSA 1DJ7B 5TKWA 4CJWA 3DM2A 1YJWA 1B3QA 1D1CA 1Z05A 1KQSA 2L0AA 1C0GA 4BC4A 2L3PA 4CIEA 4M7DA 4H5VA 4B1ZA 4M45A 3HOSA 1NYFA 1XJWB 5HKCA 2V7YA 3M1FA 1KFSA 2QQAA 1OVYA 4PJOB 1WAJA 4OKJA 1JCFA 1N6AA 2FZKB 3TU5A 4WTOB 4BRAA 3KLHA 3VKIA 1VQKN 3CC2Q 1D1BA 3G10A 3MP8A 1VQNN 3L2WA 2WFBA 3OYLA 2XICA 3JB9H 4PKCC 4M7AF 1OX9A 1JLBA 1AOJA 3AVMA 1MMDA 2RJEA 1XI1A 1WSFA 4OMQA 2NUTA 3IFRA 5FRNA 3HRUA 1XHZA 3CC4Q 1ATSA 5CQYA 2QEXT 1SRMA 3CCUN 2FYKA 2I5JA 4JHDB 1ASWA 1Q8IA 2FF6A 2EQMA 1VSJA 1QWEA 3TTDA 4CC2A 3CCRA 3PIPA 1JLAA 5GMKm 1OH7A 4I6MB 4W5NA 1X3MA 1F1BB 5GAMd 1CZBA 4BDYA 1NJZA 4RG8A 5IHNA 1I94K 1VQ8N 3WNEA 4DSEA 3OMCA 1VQ6Q 3WNGA 2NZTA 3EZWA 1UGRB 4M3UA 4QT7A 1EX4A 1E6GA 3ULEA 2NRHA 4Z4CA 3ZFJA 4D8KA 3M0QA 2YNIA 3G1JA 1OKJA 1GFDA 1YXQA 4M75A 5GMKi 3ALYA 4CJ3A 4CIFA 1HXDA 1HR0K 1RBUA 3HTRA 3HYFA 1RBVA 4CZGA 3DLLL 1ACMB 2RQUA 3CCET 2OAWA 1DTTA 1S72N 3SD4A 4NXNK 3CCQN 4DV3K 2DL3A 4X1VA 1YJ9A 3OHRA 3BDPA 1IB8A 4FYXB 2A28A 4GV9A 5GAN8 3CMAA 4ZGJB 4RCHA 1VQ7A 1K73U 2DERA 4DR7K 2E8AA 4N41A 1RDDA 5EVZA 1G3TA 1TUUA 4A63B 3UDCA 3JB9F 2QQRA 5I2MA 1E3MA 3MEVA 4GVMA 2ZPHB 1H92A 1KK7A 1VSMA 5GAN6 1GRIA 4DFMA 3SUQA 2FF3B 1VQOT 2IOCA 4MO4A 3F73A 1PHTA 4KGXB 5BRFA 3LAMA 4I2QA 1D5AA 4JS4A 4E7ZA 4UY8O 5GAMf 4DCHA 4CZLA 2YHBA 3U6FA 3MECA 1IG9A 3V1QA 1YHQQ 4PJLA 4LSLA 2E5LK 5BPNA 2E64A 5IXFA 1TYQA 1V4TA 4Z89A 1KC8U 3LP2A 2M0YA 2UU9K 2GTOA 1MGQA 1YITA 4JK7A 1R0BG 1RLPC 1T03A 4KTZA 4OGCA 4KH0B 1NK9A 3V7RA 2K7AA 5FDLA 2E3HA 2IAJA 4CGJA 3LP3A 3L2QA 3KUFA 4CHZA 3CCMT 1HJDA 5A0LA 3CMAQ 4CJFA 4OF1A 1BYMA 1KG1A 1MWMA 2DZCA 4ZGDB 1NK8A 4CBWA 3JCMX 2OTJN 3C7NB 1BIAA 2K6DA 2NUBA 3G0ZA 2HMIA 1IH7A 2YNFA 1Q86R 1NEGA 1KD1C 1TL1A 4KH1B 3ZSOA 1BUPA 3CYMA 1D9DA 1PSFA 3CPWP 2VWJA 5AQXA 3C0CA 3TPQA 4C8QB 1S72A 1VSEA 3OYYA 3VUBA 3MEWA 1FMVA 1LOTB 3A8YA 2E6MA 4MO5A 2LT4A 2XI9A 1VSLA 4PJOE 2RJFA 3KBGA 3NTHA 4LXCA 4HKEA 4J6YA 1QVFA 3CERA 1EWQA 4RW6A 4E89A 2OI3A 2ATQA 2NUTB 4DV7K 2Z1IA 3T1YK 1UHFA 2CZ6B 2MOXA 3M9QA 3CJ1A 2R58A 2EPDA 1NPPA 1KD1U 4CC7A 3O9RA 3VGMA 2Y1JA 3QO9A 4OLAA 1BO5O 2A41A 3FRNA 3QWXX 2DE0X 4FK4A 2OYQA 4WYBA 2NRWA 1UGVA 5IXBA 1RDUA 4HA8A 1BI4A 3SBGA 2YKMA 5GANh 1VSFA 2P9PB 3LP1A 4B3RK 2QDYB 3THKA 1TKZA 4JI4K 1IGQA 4JLIA 3NTKA 1LCKA 3ZEHA 4CF2A 3H41A 1IREB 3TTFA 3SAHA 1WNLA 1TS9A 2VG5A 1J5OA 1RT6A 4BE1A 5SZTA 3PMTA 4F7UF 5LJWA 2XG8D 3BY7A 3BW1A 3B6OA 4IG0A 2A7YA 3VQ5A 3NAEA 4XQ3A 4U67L 2KBTA 2ZPEB 2M1HA 2X9HA 3EFRA 2E1HA 2I7PA 4MDBA 3T9NA 2OPSA 2G8IA 1BI4B 1W9HA 2ASMA 4X66K 4X62K 4N47A 1KRPA 1K0SA 1RABB 4CJLA 5HLFA 4B9QA 1MUZA 4H0OA 1G3WA 1JXMA 3LM9A 1N27A 2CP6A 3S41A 3BGRA 2UUAK 3O5BA 1M27C 2QEXQ 1M5Q1 3QJYA 2KFNA 1VHXA 5GMKj 3OYJA 1W97L 3I33A 4MDAA 4C0GA 3JCMc 3WXMB 4LDWA 5CKBA 1K8AO 6AT1B 1EXQA 3BUZB 2CZ0B 4JRIA 3H8ZA 4F16A 1DKGD 3C65A 3UT1A 3LYIA 1JCGA 2P1JA 4WFBL 1ZBXA 4RCCA 2ZWHA 2LQ8A 1X9MA 2JUFA 1H1VA 2GF7A 2LQKA 5E26A 3NGPA 3RERA 1PG5B 2J6KA 1VQON 4XIUA 3K9JA 4M7DG 1MHNA 2KYBA 3MKDA 4CC3A 3FR0A 5JLFA 1UA0A 3J80O 5IWAK 4C92A 3M59A 5IHKA 3X28B 2VG6A 3OW2S 2QWRA 4K43A 4BY9C 4U7BA 1LW0A 3VQQA 5GADP 2P9UA 2WONA 3QEXA 2KGTA 3SPZA 3ENBA 3KWGA 1EQYA 2KXDA 1SEMA 1YIJA 3AO4A 5GJWB 2IPOB 1AWWA 1VQ4Q 4RTUA 4CE9A 4PJOC 4M75D 3MO8A 1BI3A 1CZAN 1YJNA 2OZMA 4DWIA 1NLPC 4HCCA 1GOCA 4CJ4A 4RW7A 3WXKA 3AVHA 4R0KA 1BQMA 1BU1A 1MNDA 5GAN7 4CBXA 2VWKA 3UB5A 3S3OA 1V4SA 2RQTA 4P5NA 4RTXA 1KFDA 2O4GA 1K4US 3VQEA 2RQVA 5LMNK 2K5IA 1T05A 3SAGA 3H0HA 1KSWA 2FSNA 5DM7R 4DFJA 1K9MO 1YJNT 3P39A 4CGFA 4BVOA 1ZLMA 4PJOG 2EIFA 4M77A 4RTZA 2RK2A 2YSQA 3TQ7P 4H4MA 4BRPA 4K0KK 4LF8K 4E1JA 1VQNT 3J7YP 1VQKQ 3SCXA 1NE8A 4FJLA 1M1KC 4PQUA 4ATOA 2OCEA 3JCMV 4O8UA 1U45A 3CCMN 4B9SA 1RNHA 1D3BA 3L4QA 1QKWA 1UEBA 2EJFA 3OYKA 1OH8A 1D1AA 4ME7A 2PFUA 1OEBA 4JKDA 3KK2A 2AHJB 1UGSB 2EYZA 2IVPA 3C6UA 4Z8AA 5LJ5g 2BZYA 3H3OB 3W0LA 3K5MA 4O5FA 2K5LA 2MI6A 3WT0A 3CC4N 4IO9L 2DIGA 1X9WA 1BI2A 4B1VA 3EZ5A 3HKSA 3AVFA 2F8SA 2E6LA 3CC2A 2IS3A 1XC9A 4ISFA 3L2VA 1HSQA 2HL5C 3MN7A 4FJKA 2DL7A 1QKXA 2FZGB 4Q5WA 4Q5VA 2MCNA 1TOVA 4EMKC 4QW2A 1J9AA 3CCLN 2CKKA 2QQ9A 4CHQA 3NGYA 2HHXA 5KQDA 2DK3A 4XTZA 2RK1A 4DFPA 1M8MA 3EYZA 3KK3A 1MU2A 4M41A 3CQTA 1BA1A 1NLOC 3SYZA 1SHFA 2YI1A 3H45C 5BN9A 4LD9K 1BK2A 1DLOA 3QMLA 3H1VX 4A62A 3CJ7A 1XOVA 3I5RA 3M0TA 4L59A 2QWMA 4IOAL 3CQXA 2IG0A 4DTSA 3NF7A 2Y1IA 1E7OA 2QQBA 4FJJA 4KHNA 1VQMQ 5C24A 4KI4A 4ELVA 3J7AP 1LV5A 4LF4K 3URGA 2FLOA 5KPZA 3SNNA 2BGGA 3S3NA 3QYGB 3F2KA 4D6WA 3IDHA 1Q7YC 1NJXA 2EWNA 4H0XB 2OPPA 2M0OA 1AT1B 4CERA 4M3XA 1XNIA 1K8KA 3O8MA 1C0MA 4IUQA 1VQ4A 4C8MA 3CMEQ 4A53A 1X6OA 2HHTA 2V8IA 5FWBA 3WVDB 2PNIA 4LNPA 4BY6C 4NB4A 1BG3A 4RTFD 2VB6A 1M9SA 1YNZA 4CHNA 2IVWA 2OJ2A 1HJRA 3GOXA 5CR4A 1H8KA 3PO4A 2F9WA 1BIZA 3VQ9A
chains in the Genus database with same CATH topology
1YTAA 3K57A 1B9FA 4CEEA 4BACA 1B92A 3MEDA 4DTJA 3AVNA 3JYTA 3RMCA 4BE0A 4M42A 3QEVA 1IHWA 3RMBA 4QCLA 4CJKA 2RN2A 3RMAA 1S1TA 1BQNA 1U4BA 1HYSA 4CF9A 3KKSA 4E3SA 3AA5X 4JRPA 1LWCA 2IGIA 2VG7A 4DTUA 4OKEA 3KTQA 2FC0A 1J54A 4CK1A 1U48A 1SL0A 2RF2A 4J2EA 4H8KA 1CZ9A 3NHGA 1WNSA 4LD0A 1TKXA 1HYZA 1FKPA 1TK0A 3CFOA 1IO2A 3LWLA 1QMCA 1U47A 3RWUA 4Z4GA 4DSKA 3KLGA 1HNIA 4LY7A 2HVHA 4O4GA 2HHQA 2ITGA 4M3RA 4Z4FA 1YTUA 4KHYA 4PA1A 3RMDA 3CM5A 2JLEA 3OS1A 4OGEA 5HRPA 4AHUA 3SPYA 2GUIA 4FJIA 1JLFA 4FJMA 4AHTA 2XY8A 2G8WA 4Z4HA 2GBZA 3KD5E 1C6VA 1TL3A 1BCOA 1NOZA 2G8HA 1IKXA 3M8RA 4ELUA 1IKYA 4M3WA 5J2NA 3JSMA 3NH2A 4FLYA 3VQBA 3IS9A 4E0DA 4F2SA 3NFAA 4FJ7A 4DQPA 1HPZA 4FYDA 3LWMA 2YV0X 4FZZA 1HQUA 3I0RA 4FVMA 3WNFA 1SKWA 4DQSA 4OLBA 2QK9A 3VN5A 4N76A 3OJUA 3KKRA 3T1AA 3CG7A 3TI0A 1KVBA 1TAQA 3PX0A 1ZBFA 1GOAA 1RTDA 4FLUA 2KZZA 5JS1A 3L3VA 4OPJA 1YVUA 1TK8A 4DS5A 4HTUA 1QS4A 4Y1CA 4CJPA 1LAVA 5HRNA 3TAEA 2IC3A 4JRQA 4B3OA 3LDSA 3P83D 4O55A 1U04A 2KQ2A 3TANA 4DSLA 3NF8A 3HPHA 1C0UA 1RT4A 4CJ5A 4E7KA 2G8KA 2Z1JA 3OY9A 4CJSA 3CQ8A 2IDOA 3O3HA 1K6YA 3HK2A 2RPIA 4CJUA 2D5RA 5C42A 1JXEA 1RBSA 4FW2A 3ZSVA 3KIOA 3AA2A 4CEZA 2HHWA 2LSNA 1TKTA 4DTPA 1L3VA 3AVAA 4B08A 4PUOA 3HJFA 3DOLA 4K8XA 4KFBA 1IHVA 4Z0UA 3L2UA 3SI6A 5CZ1A 1HYVA 4FLXA 1L3UA 4IKFA 2Q3SA 3C94A 3V4IA 5HRSA 4MFBA 3S3MA 1O1WA 4EP5A 1JL2A 2D0AA 2PY5A 1RTJA 2YNGA 4DLEA 4AHCA 4NYFA 1N6QA 3DLGA 3DRPA 1BCMA 1C1AA 2DTUA 3E01A 4FJ9A 3C95A 2HB5A 4J2BA 3UIQA 4KREA 1X1PA 3IG1A 3PX4A 3HP6A 4BE2A 4CFAA 2HW3A 3OYGA 4RW8A 1QTMA 2HVIA 3DYAA 1RDAA 1N5YA 1S1UA 2F8TA 3NH0A 4DQRA 5KTQA 4KPYA 1VSIA 1ZBIA 2XO7A 4Z4EA 5CYMA 1HRHA 3HSTB 1RILA 4HUEA 3L2RA 1WSIA 1RT7A 3CFRA 2PZSA 4KHQA 2P5OA 1SL2A 4CJWA 3DM2A 4B9NA 3AV9A 4KV8A 4DLGA 5HP1A 4E7IA 3OYBA 5I42A 4M3ZA 4CIEA 4EZ9A 4DS4A 4M45A 4MQ3A 4E7JA 4M3TA 1WSEA 3QINA 3VQ7A 3QESA 1KFSA 4K8ZA 1RDBA 4KTWA 3V1OA 1WSHA 1JXBA 3C6TA 4DTMA 1WAJA 3DMJA 4OKJA 4DQIA 3NBPA 1VK0A 3AO1A 3KLHA 4DSIA 1BGXT 1Y97A 2P51A 3LPUA 1RT1A 4AILC 2BE2A 2X74A 2OA8A 3G10A 2DFFA 3ZSXA 3OYLA 3L2WA 2QKBA 2HHUA 1ZBLA 4IFYA 3LZIA 4DF8A 3HPGA 3MAQA 4B9LA 1JLQA 1ZYQA 2FBYA 3D45A 1LAWA 3P5JA 4DMNA 1JLBA 3AVMA 3PX6A 4Q0BA 1UWBA 4CFDA 1XI1A 1WSFA 4GMJB 1EKEA 5CYQA 4N56A 4LH4A 1XHZA 4FK0A 5FRNA 1QHTA 3S9HA 3H08A 4OKKA 1IKVA 1LWFA 4E1NA 5FROA 1SV5A 1VSKA 2I5JA 2JGUA 4TSXA 1ASWA 1Q8IA 2ZE2A 4CJTA 1VSJA 4H4OA 1NKCA 1SUQA 2FBTA 3I8DA 3TWHA 3NGZA 1JLAA 2YNHA 3ZCMA 3HPOA 1C1BA 3ULDA 4KTQA 4DTRA 4CHPA 3SQ4A 4NCBA 2Z1HA 4W5NA 5DMRA 4CF8A 4LH5A 5D7UA 1CZBA 3AA3A 4YFUA 4RG8A 3OS2A 4BDYA 1NJZA 3WNEA 4DSEA 3WNGA 3K5NA 4DU1A 4DU3A 4FK2A 4M3UA 4DSJA 3HT3A 3AVLA 4GW6A 4KRFA 1EX4A 3TABA 2OZSA 4Z4CA 4CJRA 1RBTA 4CJVA 4B9UA 2YNIA 1VSDA 2B5JA 3F9KA 4CJ3A 3ALYA 4CIFA 2FBVA 3K59A 1RBUA 2HNZA 3OYIA 4FJ5A 5KGWA 3DI6A 3HYFA 3SQ2A 1RBVA 3SUOA 3QNOA 2A1SA 3LALA 4B9MA 1SKRA 1CXUA 4DSFA 1NK6A 1DTTA 4HVJA 4AHVA 1BIUA 5JS2A 2YKNA 5EU7A 3HVTA 1EP4A 3BDPA 4IG3A 4L8RB 1C1CA 1NK5A 5HRRA 4NCAA 1QSSA 1ITGA 4CGDA 4CGHA 3RTVA 3SUNA 3EY1A 3I0SA 1B9DA 1SL1A 4HCBA 4N41A 4CEQA 1Z26A 1RDDA 4FJGA 1T7PA 4YNQA 1CLQA 4FJHA 4B8CA 2HHVA 4DF4A 1FKOA 3QEIA 4GVMA 4FW1A 1EETA 3ZSRA 4F4KA 4NCGA 1VSMA 4CK2A 4DFMA 3SUQA 1RTHA 4CFBA 2IOCA 3QETA 2DFHA 2DFEA 3V9UA 3F73A 4E19A 3LAMA 4I2QA 1D5AA 4JS4A 1XWLA 2HHSA 2YHBA 3U6FA 4M3YA 3MECA 1IG9A 3PUFA 3V1QA 4LSLA 4KHSA 5CY4A 1VRUA 3TAGA 1FXXA 1DTQA 1S9GA 3LP2A 1XHXA 3TR8A 4I9QA 1T03A 1JLGA 1QQCA 3AVIA 4KTZA 4OGCA 3ZT4A 5J1EA 1A5XA 3KK1A 1NK9A 2PYJA 2DY4A 3MXIA 5FDLA 4IFVA 3HM9A 2IAJA 4OJRA 3VQPA 3LP3A 1RCHA 4CGJA 1WSGA 4CHZA 4CHOA 3KLIA 3L2QA 3DRRA 4CJFA 4O5BA 4NYNA 1NK8A 2X78A 1UAXA 3QERA 3VQ8A 2EX3A 1UOCA 1RT2A 1G15A 3V1RA 4CK3A 4FM0A 4FLVA 5HROA 1NJYA 4OPKA 1ZBUA 1NJWA 1SKSA 3ZT2A 2NUBA 2PYLA 3AVGA 3MXMA 3G0ZA 2HMIA 4C8LA 2YNFA 1JL1A 1IH7A 2OPQA 4OVLA 3ZSWA 4CEAA 4E1MA 3SV3A 1Q9YA 1TL1A 3ZSOA 1L5UA 3OYAA 1RT5A 3CYMA 2P5GA 3SZ2A 3AVJA 1D9DA 3VQ4A 3B6PA 2VWJA 3OYFA 1R0AA 4I7FA 4FXDA 1W0HA 1VSEA 4E7LA 1RBRA 4HUGA 3DLBA 5HBMA 1QE1A 2E6MA 3HP9A 3HO1A 1VSLA 5KRSA 2QKKA 3DLRA 1WN7A 4FLZA 4RW6A 4E89A 4R5PA 2F96A 4FLTA 5J2PA 4BWMA 3QEPA 2HNDA 3VA0A 2ATQA 3ITHA 4FJ8A 3O4QA 3AVKA 4EP4A 4QOZB 4FZYA 2Z1IA 3V6DA 3TAQA 1NOYA 1VSHA 1ZBHA 3OVNA 2Y1JA 1BL3A 2G8UA 4OLAA 3QO9A 5E41A 2XY6A 3WNHA 3U3GA 4CHYA 3KD1E 4FK4A 5T7BA 2OYQA 4O0JA 1S9EA 4FM1A 1TGOA 3L8BA 4QAGA 3RRHA 3HVRA 1GOBA 3NF9A 3ZT0A 3K58A 3SQ0A 3ZSZA 1BI4A 3L3UA 3SUPA 2YKMA 1VSFA 3LP1A 1NK4A 1TKZA 1RTIA 3TAPA 4KO0A 3DLKA 4CF2A 1J5OA 2VG5A 3QIPA 1RT6A 3T19A 2B4JA 3SJJA 3NCIA 4BE1A 3MEEA 5SZTA 1LW2A 1L3TA 4BWJA 4PWDA 1WSJA 3B6OA 4IG0A 1JLCA 3VQ5A 4W5OA 3NAEA 4C8OA 2AJQA 1S5JA 1VRTA 1KCFA 4FZXC 2OPSA 4DTOA 1UA1A 2G8IA 5SWMA 1BI4B 1REVA 1W9HA 1S1WA 3ISNC 4ID5A 1NK7A 4N47A 1KTQA 1U49A 1KRPA 1TV6A 3VQCA 4CJLA 3M8SA 5HLFA 1NKBA 1F21A 2YHAA 3V9ZA 2R7YA 3TAMA 1C0TA 3BGRA 1A5WA 3FFIA 3THVA 1WAFA 4AHSA 1C6VX 1RDCA 1CXQA 3CM6A 3CFPA 2KFNA 3M8QA 1J53A 3OYJA 1TKDA 2GV9A 4JLHA 4FJXA 1EXQA 1KVCA 4IDKA 3PY8A 4CJQA 2P1JA 3TARA 4FJNA 4B9TA 1NKEA 1X9MA 3AO5A 4KKOA 3SQ1A 2EHGA 3LP0A 3KJVA 1TAUA 1I3AA 1HMVA 4O44A 1Q9XA 1KLNA 4C8NA 3IRXA 2X6SA 3LANA 1D9FA 4DQQA 4XIUA 4KI6A 4PY5A 4FLWA 1UA0A 1BISA 1JKHA 4KAZA 1S6QA 2D0BA 2VG6A 5J2MA 2RKIA 4KB1A 2ZD1A 4CIGA 3P1GA 1LW0A 2QXFA 3VQQA 2WONA 3QEXA 2G8VA 3DRSA 3SPZA 4CCHA 4Y1DA 2XY7A 3AO4A 1T8EA 4BDZA 3NH1A 4G1QA 4CFCA 4CE9A 4HUFA 2OZMA 4DWIA 1GOCA 4HCCA 4CEBA 4CJ4A 4RW7A 3HL8A 1S1VA 1FK9A 3AVHA 1BQMA 4B8AB 4E7HA 4J2AA 3DLEA 2VWKA 2E4LA 3U3YA 3S3OA 3RR8A 4DTNA 4DTXA 3NDKA 4ZTFA 2O4GA 1KFDA 4F8RA 3NGIA 3VQEA 1T05A 2W42A 3OYDA 4JS5A 2BANA 4IBNA 4DFJA 2FBXA 1L3SA 3ZT3A 4ICLA 4CGFA 4DG1A 1QSLA 4KHWA 3AVBA 4DU4A 3PV8A 1D8YA 2KW4A 3OJSA 5KRTA 4H4MA 2XRIA 1Z25A 3A2FA 5CZ2A 1S1XA 2HNYA 4FCYA 3SCXA 4HHTA 1X9SA 5K14A 4FJLA 4EZ6A 4PQUA 3AO3A 3LAKA 4N5SA 4BDPA 4CEOA 4CGIA 3M8PA 3ASMA 1TK5A 1U45A 3K5OA 3ZSQA 1LWEA 1RT3A 3DOKA 1RNHA 3O3GA 4B9SA 3KLEA 1BHLA 3ZT1A 3OYKA 4C8KA 3KK2A 5KGXA 3IAYA 3C6UA 3O3FA 3LZJA 1I39A 3K5MA 2B6AA 4ELTA 4O0IA 4RW9A 4RW4A 2G8FA 5DK5A 3VQAA 1X9WA 3QNNA 1HQEA 3MXJA 4CF1A 3AVFA 3EZ5A 2E6LA 2IS3A 3VA3A 1XC9A 3ZSYA 4KB0A 3L2VA 4Z4IA 2F8SA 2ZQBA 1KVAA 4FJKA 2KFZA 3LPTA 3D0PA 3AA4A 3O4NA 4Q5VA 3OS0A 3T3FA 1J9AA 4AHRA 2HHXA 4CHQA 1S6PA 3NGYA 3HXMA 3AVCA 4DFPA 3QLHA 4ZHRA 4CECA 4CJEA 1MU2A 3OYNA 4W5QA 4M41A 4UQGA 3KK3A 3EYZA 3SYZA 4DFKA 5J2QA 1QSYA 2XHBA 3OYHA 4ID1A 1DLOA 3VQDA 4I9LA 1YT3A 4KHUA 2XY5A 2Z1GA 3K2PA 3NE6A 1ASUA 3QIOA 4DTSA 3NF7A 2Y1IA 4W5RA 2O4IA 3V9XA 4FJJA 4KHNA 5C24A 2OPRA 1HNVA 4KI4A 3OYMA 4FM2A 4ELVA 3RR7A 1LV5A 3AO2A 1A5VA 4CEFA 1NK0A 3SNNA 4F3OA 2BGGA 2KTQA 3OYEA 3S3NA 4W5TA 2D0CA 3V81A 5KI6A 2A1RA 4F2RA 3MEGA 1NJXA 5C25A 4LSNA 4I2PA 3KLFA 5I3UA 2BDPA 2OPPA 4J2DA 4M3XA 4CERA 3QEWA 2KZMA 1TVRA 3NF6A 3PO5A 4C8MA 2ETJA 4ZTJA 1C0MA 3V9SA 1KLMA 4CF0A 3SV4A 2WOMA 2HHTA 4CGGA 1KSPA 1WLJA 4CESA 3K5LA 3TAFA 5FRMA 1JLEA 4CHNA 1ASVA 1IKWA 1HJRA 4AH9A 4B9VA 2X6NA 3V9WA 5D3GA 4WE1A 3VQ6A 4CEDA 3DLHA