2BIVA

Crystal structure of the wild-type mbt domains of human scml2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
DFHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQMNTSSWPMFLLKTLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX COMB ON MIDLEG-LIKE PROTEIN 2
publication title The Malignant Brain Tumor Repeats of Human Scml2 Bind to Peptides Containing Monomethylated Lysine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 56
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2bivA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2bivA01
3S3OA 4B9XA 5J26A 5D6YA 1KHCA 2LDMA 2VYTA 4IURA 4C5IA 3MEWA 4OVAA 2M16A 3FDRA 2R5MA 3L42A 3NTKA 3O8VA 2O4XA 3MEVA 2R5AA 4C5GA 2BIVA 2L3RA 3NTIA 5FRNA 3C4SA 3S3NA 3ZEHA 3OMCA 2PQWA 2RHXA 2NLUA 4BDYA 3F70A 3OB9A 3MP6A 4ZTFA 2RJFA 2XK0A 2DIGA 3OYIA 3META 4PLIA 4N4GA 3PMTA 4BE0A 3BDLA 4N4IA 5KH6A 4Z02A 4E7KA 3QIIA 3OYMA 2LVMA 4EDUA 2RI2A 2R58A 3OYLA 2L89A 3PFSA 5KE3A 3OQ5A 5KE2A 2F5KA 2G3RA 3NTHA 4A4EA 1OZ3A 4ZTJA 5D6XA 3ASKA 2BKDN 4PLLA 2QQRA 5FROA 3OYJA 2EKOA 2RI5A 3LX7A 3PMIA 1OYXA 5J39A 5FRMA 2O4XB 2X35A 1MHNA 3LLRA 5IAYA 2WACA 2XDPA 4BE2A 4BE1A 4C5EA 3OY9A 2RO0A 3QJ6A 4IUVA 3OYHA 4A4FA 3EAEA 4E7LA 4HCZA 3P8HA 4QQGA 2M1HA 4BD3A 2RJEA 4Q5WA 3LYIA 3OYKA 2L8DA 3ME9A 2EQJA 3FEOA 2LCCA 2EFIA 1WGSA 4IUPA 3FLGA 4PL6A 3P8DA 3OYEA 3KUFA 2HQEA 3M9QA 3DB4A 2YRVA 3MEUA 5C0MA 2RJCA 3L2VA 1OI1A 2MWPA 2P0KA 2RJDA 3OYDA 4E7HA 4RG2A 3UT1A 3OS0A 2JZ2A 3QBYA 2BUDA 2GFAA 4QQDA 3LH0A 3OYNA 4E7JA 4IUQA 2X4XA 4UC4A 4X34A 3MP8A 5IN1A 1RI0A 2X4YA 4E7IA 3L2WA 2E6NA 1N27A 2RHYA 3GOXA 5D6WA 4LD6A 3L2RA 3MP1A 3Q1JA 5KCHA 3FC3A 2LTOA 3MEAA 3E9GA 3L2UA 3DLMA 3SD4A 3OMGA 3H6ZA 2DIQA 3OS1A 3QKJA 2RHIA 2GFUA 3OS2A 2B8AA 2DAQA 3PNWC 2QQSA 1SSFA 2MWOA 4A4GA 4QVZA 5C6SA 2EQMA 3DB3A 3E9FA 3CEYA 3LGLA 2M0OA 1WJQA 5M9OA 3UWNA 3OYGA 5KCOA 4IUTA 2RI3A 4FU6A 2EQUA 2RHZA 3OYAA 2HQXA 3OYBA 3OYCA 3MO8A 4FL6A 4C5HA 2E5QA 2GF7A 2JTFA 2R57A 2LRQA 4BDZA 1H3ZA 1G5VA 3OA6A 4IUUA 1OZ2A 4QQ6A 3H8ZA 2IG0A 3S6WA 4B9WA 2RHUA 1XNIA 1WJRA 2D9TA 3S3MA 4BACA 2K3XA 2FHDA 4GY5A 2X4WA 4N4HA 5CIUA 2K3YA 4NS5A 4IKFA 2CKKA 4L59A 4CRIA 3OYFA 3LGFA 3L2QA 4A4HA 4QW2A 1WJSA 2EQKA 4II1A
chains in the Genus database with same CATH superfamily
4OMQA 1VQPT 3M0QA 4J9EA 2QXFA 4IURA 1R8OB 4M78F 4HCCA 3O8VA 1QVFP 1R77A 2KK4A 3CXCA 3QDRB 2L3RA 1Y96B 1K73R 5GAMj 3TU4K 2BE9B 4V2SA 3VS4A 2GTJA 2RB6A 3A1PA 5IT9E 2RQWA 5CQYA 3EG1A 1WPYA 1C0MA 3M0TA 3C0CA 1VQ6Q 3JAME 1EZZB 3GP8A 1K8AR 3QJ6A 3I56T 2D0QB 3EAEA 1NM7A 2OTJT 1Y71A 4NL2A 3JB9J 1W70A 3OYKA 2K9GA 2WSCE 2M9UA 4PNOA 3OYEA 1N5ZA 3JB9D 3I35A 2EPDA 1PM3A 1WIEA 1YIJT 3CPWS 3UA7A 3LH0A 3CMET 1YJWT 4X34A 1UB4A 4M78D 3PVQA 1HYOA 2PUOB 3A8GB 1AVZC 5EC7A 3H41A 4MZMA 3E1SA 1B07A 2CDTA 2B8AA 3I56Q 2LP5A 4JRIA 2OTJQ 3I9QA 1UEBA 3CEYA 1YJ9T 1ABOA 1VQ6A 4K11A 4A4KA 3NGPA 1RADB 2JM9A 4PJLA 1QLYA 3EGDA 1T3LA 1YIJQ 1TU0B 1H3ZA 3CMEQ 4MDXA 1JXMA 1YJWQ 1YN8A 1AZEA 1WZOA 4J6WA 3WVDB 1U3OA 3LW5E 3NHNA 3OYFA 3M57A 1UHCA 1S1NA 3EGXB 4XAXB 1XQHA 4C5IA 3MEWA 1NPPA 2W0ZA 4F04B 3EH1A 4OGEA 2EJFA 2J6FA 2OI3A 3OMCA 2K5IA 2OX7A 1YJ9Q 3G71A 2XDBA 3GIBA 2SEMA 3M5AA 1O75A 2BZXA 2DIGA 2F69A 3QWYA 1Y0MA 4OB2B 1S72T 1C1AA 1K76A 3X20B 1QVFA 2R58A 4E7ZA 1ZSGA 3VRZA 4MZTA 4JS5A 1VQ4T 4ZTJA 2HKNA 4PLLA 2E3IA 2QQRA 4FM4B 3EFRA 5J39A 1MHNA 4CC3A 2VWFA 1BI1A 3PT9A 4HVVA 3MKDA 4A4FA 2LX9A 3O5ZA 1VQ8T 4QQGA 2RQTA 2CGHA 2DJZA 3J80E 1GCQC 3H9NA 5DLOA 9ATCB 5LJ3g 1JJ2P 1G83A 6AT1B 2FB7A 3JSCA 2HQEA 1NYFA 2P0QA 1NEGA 3VV0A 2MI6A 1ZBXA 2YRVA 1O9SA 4C8QF 2XMFA 3N5BB 2CH4A 5KYWB 3G7ZA 2RJDA 4M75A 3A8HB 1K9MU 4UC4A 1OV3A 2JS2A 2YRDA 3EHQA 3M59A 3JV3A 4GBQA 2A3LA 3EG3A 4EIKA 1UDLA 1D1BA 3QZ5B 1RLPC 1FX7A 5LJ3d 1XTDA 2QQSA 1MV3A 2LT4A 1TUGB 1BI2A 1YWPA 2KBTA 1VQ8Q 4M7DB 2QEXQ 3PGGA 2XDDA 3V8LA 3UWNA 5IHKA 4ZN1A 2RI3A 4FT4A 1BK2A 2ZPHB 1Y07A 1UG1A 4HT8A 2KSSA 1Q82C 1PKSA 2E10A 5GANh 3TEEA 3H8ZA 1RAIB 2CREA 5CVIA 2E64A 1NJIU 3HL8A 4J6XA 2X4WA 4A54A 2O01E 1NEBA 1AWXA 1JQQA 2HBPA 2EQKA 1SSHA 4ESRA 5GAOn 3CD6T 2BE7D 2PUKB 4M78B 2F2XA 1PD1A 2L3QA 2QGFB 2LNHB 3OS5A 5GAN3 1TG0A 3C4SA 2NLUA 1JO8A 1M90U 2RJFA 4C92F 1ZLMA 1RAGB 4M78C 3MJXA 4KBMB 1BIAA 2PVGB 4FSXA 4C0DC 4EDUA 2QEXA 1NPRA 2HQHA 3M54A 2VUBA 3G4SQ 3U23A 2ATCB 1GRIA 1PCXA 2AK5A 4GLKA 1OYXA 1PNJA 1M8VA 2KEAA 4J7IA 4QKUA 1EX4A 4DEXA 1QCNA 4BE2A 1WXUA 2GBQA 2KNBB 1K73C 1G3WA 5DM7R 5AT1B 2MYSA 2J05A 4M7AF 4JJNK 4R56A 5I2SA 3EGUA 1QP2A 2DL5A 4ZGJB 2Z0WA 4FT2A 2JN0A 4D8KA 4PJOG 2FEIA 2ZPGB 1G2BA 8ATCB 1JJ2A 1IB8A 4HCBA 3MP1A 1IHVA 3SHWA 1M3AA 2CZ7B 3DLLA 1RL2A 2DL4A 3H6ZA 4LDUA 1M1KU 2HBWA 2I0NA 3QG1A 5HK3A 1SSFA 3LWIA 3G4SA 4LD9K 4PKCC 5AYFA 3EGXA 2LQNA 4ELZC 2EQUA 3SFMA 2PTKA 3CMAQ 2R57A 4BDZA 4RCBA 1IREB 1U1SA 2DTIA 1SRLA 2MPXC 2F2WA 2DETA 4N4HA 2DEUA 2JXBA 5FLXE 2XKOC 2FPEA 4ZN3A 1I1JA 2LDMA 2M16A 2QG9B 5KYNA 4D6WA 3GBQA 3JCMV 3WXMB 1ZSZC 2CZ1B 4HVWA 4XTVA 2EBPA 3SWNB 5KH6A 3G6ET 4E7KA 4OB3B 1OULA 3JCMb 5KYWA 4WTOB 1HD3A 4XTZA 2JTMA 3CMAA 3VYGA 4EMKC 4RTYA 1VQ9A 4J8OA 2CT3A 1YNZA 3I5SA 4HT9A 1U06A 1WHGA 2M1HA 3R6NA 2DX1A 1KFZA 2AZSA 3V7CA 2GQVA 4C8QB 1OI1A 2K2MA 2YDLA 1VQOT 2EYQA 4M7DA 4YTLA 1KSWA 4RG2A 2JOYA 3JCMc 2KR3A 4PJJA 4HXJA 2DXTA 4M7DG 4E7IA 5GAN7 4ORZA 3CCUQ 4M77A 2QASA 2EGAA 5IHNA 2Y90A 1LOJA 3QPHA 1JEGA 2E1HA 4M77G 1IZ6A 2DAQA 2PNIA 1YJNT 1Z9ZA 4X9CA 4KH1B 4C0GA 4OP0A 3HHTB 2FPDA 4FL6A 2VASA 4AFUC 2O9SA 1VQOQ 2QQ9A 1ACMB 1VQLT 3QDFA 2RHUA 2E70A 1M4ZA 2E3HA 4KGVB 4PJOE 1AWWA 2DKGA 1SEMA 3RMSA 4C0ZA 4VUBA 3G1JA 2RK1A 5GAOq 2EKHA 1KHCA 3T9NA 3VS7A 2VYTA 1ZX6A 2DK3A 3M4GA 4J9IA 3CC2T 3MEVA 1YJNQ 1R0BG 3VS2A 3CCUA 1U8RA 2RQVA 3EH2A 4C92B 3OB9A 3PE0A 3M0RA 4ZTFA 2LJ1A 1BU1A 3VS6A 4N0AA 4KRTA 1RAAB 1D0YA 3UA6A 2LJ3A 1VQLQ 5GMKh 2F2VA 2L89A 3HKSA 1WLPB 2AIRB 2DEQA 4JRQA 1NZ9A 1I5OB 4HCKA 1CSKA 2JVVA 2CP6A 1X69A 1YBYA 2L8DA 4FYXB 3ME9A 4M7AB 1W1FA 4JDSA 1JJ2S 3CC4T 4RTXA 3DB4A 3JB9H 4JJDA 3RDVA 3C95A 1G3SA 4FYYB 3OYDA 4J9BA 2HNIA 3I55T 1IGUA 1SPKA 2A08A 5LJ5j 4KGZB 1G3YA 3MP8A 5GAMh 4Z88A 1MUZA 1YCYA 3A98A 2QYZA 2DJQA 3C12A 4B6MA 3PNWC 1UUEA 3JCMJ 1PKTA 1FYNA 2KT8A 4JZ3A 4ZNXA 1E6GA 5M9OA 1BYMA 2O31A 2RHZA 2H8HA 2HQXA 3RESA 4OMOA 1TH7A 2CP7A 2VXEA 2ROLA 3M0SA 2RN8A 4DOWA 3SB2A 1Q82U 3CCVQ 1VYTA 2L3SA 4E2FB 4M7DE 1ARKA 3SWNA 1UJYA 5J26A 1PSEA 4Y92A 5GMKj 4M77E 4PJNA 2BIVA 1WHMA 1UHFA 4QVDA 5FRNA 2K79A 1T3SA 1LNXA 2K3BA 5ECAA 3L1AA 2NUZA 1IGQA 1H3HA 2HL3A 3CCJQ 2JMAA 2DZ9A 4C8QA 1N6AA 1VQNT 2PU9B 3RERA 4C8QG 3OYJA 1IO6A 2RD1A 3X26B 4F14A 1ZA2B 4DEYA 2AZVA 5A0LA 3CCVA 1R0CB 1W2BP 4LN2A 4LUEA 4PL6A 1FWZA 2DL7A 2KGTA 1K73U 3L2VA 2O88A 1WFWA 4EPCA 5L23A 4PFPA 1WDXA 2JZ2A 3QBYA 4QQDA 2D1XA 3OYNA 3CCLA 1VQPQ 1SHFA 4WF2A 4MMLA 3CCJA 3NPFA 2DYIA 3RKWA 3QKJA 1BIBA 1K8AU 2DZCA 2DILA 4RTZA 2EQMA 1JB0E 1UGVA 5CKBA 1WJQA 5GAN5 3E19A 2DRMA 2EGEA 2VXFA 2EYZA 4OF1A 1W4SA 1JXOA 5CCAA 4E47A 2GCXA 3OA6A 4BUGA 4C92A 2DBMA 3A8MB 1NLPC 2XHCA 2FHDA 2DL8A 4C92G 1OX8A 1WJSA 2COYA 1V29B 2PVOB 3MPUB 1N8RR 5GAN6 1U5SA 1ZBJA 2CSIA 3NTKA 2CP3A 1VQPA 3CCET 4OMMA 2Y4XA 2E41A 4J5YA 1RLQC 1VQKT 3SDZA 5A0DA 2KY9A 2VGMA 2V26A 2YXYA 3V7SA 3META 1T0JA 4M7AA 1ZA1B 4PK4A 4FCYA 4M7AG 4RUGA 5HKCA 5FWCA 2LJ0A 2FO0A 3GNGA 3LX7A 5FRMA 3QZ9B 2WACA 3ZFJA 1YWOA 2FVUA 4D8DA 2OAWA 4BD3A 2NUPB 3CCMT 1Z9QA 2EWNA 5CR2A 4BI3A 3I56A 1A0NB 1M2OA 2OTJA 1FXXA 1VQKQ 4RTUA 2X4JA 2VGNA 1PHTA 2FG0A 2FPFA 1P92A 2P0PA 2P4RA 4E7JA 5CO7A 1W2BA 3TVTA 4J9CA 1YI2T 2K7AA 1VQMT 3L2WA 1J3TA 1H92A 1YIJA 3R6OA 5D6WA 4IIMA 1AT1B 3CMEA 4BY6B 4C8QE 1YJWA 3E9GA 2D0NA 1OQKA 2AKLA 1YFNA 2H3EB 5IH2A 4J9FA 1WHKA 2LZ6B 5GAOl 5KYXA 4BY6C 1S72Q 4RTTA 1SG5A 3JCMP 2E6ZA 2QTVA 4JRPA 4M75G 2XICA 4OGCA 1YJ9A 1AWOA 1VQ4Q 4R0KA 2DLPA 1KQ1A 2XI9A 3VJPA 1WJRA 5GAOr 1X6BA 1KC8R 7AT1B 1M30A 2K5FA 1GFDA 2E4HA 1OPKA 3OYIA 2QGGA 1OX9A 4J9HA 1V76A 3QYHB 2HL5C 4LDWA 5GANg 1XOVA 1M27C 1Y96A 4BB7A 3LH5A 3TREA 3HRSA 3KXTA 4BE0A 4AG2C 3FJ5A 2W10A 2A37A 1GXIE 3QIIA 2L5QA 2EJ9A 3NMZC 2LQKA 1WHLA 2CYZB 1D1AA 3CBPA 5D6XA 1S72A 2BKDN 3PMIA 1TWBA 2X3WD 1GL5A 4C92E 4FYVB 1Y57A 4JLGA 5GANd 1VQ7T 4C5EA 2ZCFB 2V1QA 5GJWB 4C0DB 4DQ2A 3CCQT 1VQ4A 1QKXA 4FW1A 3TSWA 2D6FA 3FEOA 3CCST 4FSSA 2VV5A 1QCOA 1I0CA 1VQ8A 3CBOA 2RJCA 2MWPA 2P0KA 3JCMQ 1M90R 5GMKi 1U1TA 2YT6A 1VOMA 1RACB 3THKA 1NG2A 1GBQA 2E6NA 2HSEB 1Q86R 4M7AE 3CD6Q 3MEAA 3SD4A 3OMGA 2DIQA 2EGCA 3CCQQ 5HK0A 2CZ0B 3HFNA 2KRNA 2ZPBB 2FZKB 4A53A 4CI0C 2ROTA 5LJ3j 2M0OA 2EVRA 2MAMA 3OYGA 2DA9A 3ULRB 2K4YA 2DTOA 3OYAA 1RI9A 2A7YA 3RBBB 2JTFA 3A8LB 1KIKA 1OZ2A 1K8AC 2DXBA 2K3XA 1AWJA 1TUCA 5GANf 1WHJA 2CP2A 1YHQT 4F17A 2OTLT 1K1ZA 1MMDA 4B9XA 3VYHB 2KE9A 4JS4A 2QQBA 1MMGA 2E12A 4MMKA 2R5AA 3NTIA 3REBB 2PQWA 2RHXA 3CD6A 5A0GA 2XG8D 4Z89A 4E6RA 1MNEA 2NUPA 1WHHA 4N4GA 1TTHB 5DLQE 3QO3A 2YSQA 2HSPA 4M75E 3FJPA 3OW2S 1N9RA 3ZBDA 1H641 3OYYA 3LWHA 3OQ5A 2GTOA 1ZSZB 5IXBA 1YHQQ 2X35A 2DYBA 1N8RC 1GCQA 2JUFA 4JPBW 5FU6C 1W2BS 3CQTA 3HRUA 2ED0A 4OMPA 1D0XA 4EMKB 2VVKA 3CBMA 1K0XA 5CQXA 2CH4W 1N9SA 3HSBA 2A36A 4XQ3A 3JCMh 5IN1A 2ZGWA 2RM4A 1QKWA 4QVCA 1VQ5T 2LTOA 3CC7T 1VUBA 2RNAA 1PSFA 3V8KA 2DM1A 2X51A 2JS0A 4RTVA 2JM8A 3QHSA 3C94A 1YHQA 4IUTA 5I11A 3OYCA 1UECA 3G6EQ 1KQSP 3HPWA 1G5VA 2B86A 4QQ6A 1YP5A 2KROA 2CP0A 2KVQG 3X25B 3CCRT 1IRXA 1ZUUA 2X9HA 2RA2A 3L2QA 3JB9G 1M5Q1 2KYMA 2DTHA 1Q81R 1UGQB 5LJ5h 5D6YA 3JCMX 1X01A 1LCKA 2QDLA 4M78A 4M75D 2R5MA 1KD1R 1QVGS 4AMCA 2DFUA 2KMTA 2EQIA 4M78G 1T0HA 2HKQB 2E65A 2ZPEB 4PLIA 2VKNA 2KYBA 3VS3A 2ZPIB 2YLBA 1KC8C 3OSVA 1BB9A 1E6HA 2F5KA 3CCRQ 2DMOA 2QQAA 3DKMA 1BI0A 5FROA 3G6EA 2YLCA 5CK9A 2JMCA 2NYSA 2XDPA 3UDCA 2FRYA 3OY9A 2MK5A 2KXCA 2RO0A 1GBRA 3JCMf 1YITT 1VIFA 2XIDA 3H0IA 2J6OA 4L6V5 1WA7A 5GANe 5DY9A 1X75C 4XTXA 4XK8E 2RF0A 5C0MA 5CKEA 4PJOF 5GAN8 1NYGA 2NUTB 1UGPB 2YUQA 4P5NA 1VA7A 3TCJA 2LX7A 3EFSA 4IUQA 2X4YA 2CSQA 1VQOA 4XU1A 3UF4A 1NE8A 4OMLA 2DD5A 3RKYA 3CXCP 4IIOA 3DLMA 3CC2Q 1ZHIA 2DXUA 4A4GA 2MF2A 1YITQ 3NFCA 4RCCA 2ESWA 1VYVA 3MHXA 1OEBA 2KDSA 5GAMg 2QA4T 2O9VA 3M55A 4F7UF 2KRMA 2DPPB 2YWWA 5LJ5f 1YJNA 2RK2A 1M8MA 2GQIA 1M1FA 2M0YA 1Q86C 1RAEB 4AT1B 5CIUA 1X2QA 2WSEE 2EIFA 4M4ZA 3TSZA 1Q7YR 1VQLA 4A4HA 1BKBA 1LJOA 2ZPFB 5I2MA 4PJOD 1ZSZA 2FL7A 4HVUA 4J7FA 4DOVA 2HDAA 5GAMd 3CC4Q 2X3XD 4C5GA 3ZEHA 3L2ZA 1FMKA 4BDYA 3HRTA 3I55Q 3CC2A 2XK0A 2LQ8A 4N4IA 1FMVA 5D7UA 3X24B 4EMKA 1C6VX 2M02A 8AT1B 1E7OA 3FRNA 4ZGDB 5I22A 4C0FA 5A2QE 1KG1A 1LVKA 4IUVA 2HAXA 1JRIA 4ME7A 2RJEA 2MCNA 1CKAA 3M9QA 1TSFA 1OU8A 3WVEB 4M78E 2K2VA 3J7AF 3OW2P 3P8BB 1B34B 1M3BA 2L3PA 1G3TA 2FYKA 3OS0A 3UPUA 1Q95G 3CC4A 1D09B 1I81A 2X4XA 4EMHA 3M0PA 4XU2A 1RI0A 3X28B 3I55A 4M77F 5KCHA 5GAMf 2HMAA 1WXBA 1VQ6T 1PG5B 1TXQA 1PRMC 3DB3A 3E9FA 2A0FB 5L8RE 2BTTA 2DXCA 2JTEA 5GAN4 1H8KA 2P4TA 2E5QA 1VQNQ 2YUOA 2KQWA 1OOTA 4IUUA 3INZA 3JCMe 1DJ7B 4DBHA 5GAOp 3V8JA 2O2OA 1MMNA 1PD0A 1VIEA 3BE3A 2P84A 5HCKA 2DRKA 3G71T 5GAN2 4Z8AA 4M7DD 3FDRA 4J83A 1PWTA 2FRWA 2MIOA 2RH2A 3F70A 1RUWA 4OMNA 2LQWA 2LNVA 4M77D 3PMTA 4LDYA 1BBZA 4Z02A 1WQWA 2LVMA 2LCLA 2HEQA 4J9GA 1F1BB 2G3RA 3NTHA 2PVDB 2D8JA 2ENMA 2NUTA 4ELYC 2RI5A 1Q81C 1VQNA 1QVGP 5LJ5e 1KD1C 3BW1A 4KH0B 1AEYA 2EYYA 4RMOA 3G71Q 1N8RU 3E2UA 1SRMA 3BFMA 1WQ7A 2EFIA 1WGSA 2LCCA 1MGQA 3FB9A 1TOVA 4IUPA 2J6KA 1ZQ1A 4PJOB 4JJBA 2DL3A 2AT1B 1M2VB 4PJMA 2V8JA 1OPLA 2WSFE 2EW3A 4FW2A 3GLXA 1QMCA 4PJOC 3L2RA 2COWA 5GJVB 3OW2A 5KYUB 2RHIA 1NBEB 2GFUA 2HD0A 3CCEQ 2A28A 3A5ZB 5C6SA 3A8OB 3LGLA 4F7UB 2E5KA 2ECZA 4O6JA 3OYBA 3MO8A 4C5HA 1KQSS 5GMKe 2LRQA 4KUDK 2K5LA 2IVWA 1RABB 2DVEA 3S3MA 3BDUA 1M9SA 1B3QA 2CUDA 2K3YA 3M0UA 4RG8A 3EHRA 4DA4A 2RQRA 3CCMQ 1D0ZA 1UFFA 1RAHB 3M56A 4OVAA 3ZL7C 3VRYA 1KJWA 2M51A 3MP6A 2QEXT 2OAUA 5GAMe 1SHGA 3BDLA 3QSUA 3CCEA 1YI2Q 1VQMQ 4E7SA 2PZ1A 1K9MR 4KT0E 1I07A 5LJ3h 1VQKA 2GGRA 1Q7YC 3RR6A 1B34A 3ASKA 3QYGB 2QK0A 1D3BB 4CC7A 2SRCA 3FIFA 1X2KA 3LLRA 4O5VA 1KC8U 3I5RA 1QVPA 3REAB 4NOYA 4X9DA 2BZ8A 4BI4A 3QXEB 4Q5WA 1AD5A 3KUFA 4AFQC 1K0SA 4LE9A 3RNJA 4F16A 1QVGA 3CCMA 4E7HA 3UT1A 4RKUE 2BUDA 2F1LA 2GFAA 1WXTA 2KI7A 3M4YA 1NJIR 2C0OA 1N27A 2I2LA 2RHYA 4M77B 4LD6A 4M7DC 3CXCS 3G4ST 2YRCA 3QUIA 4XTYA 1TS9A 1YI2A 3RUXA 1VQMA 2G6FX 3BY7A 1AZGB 4M77C 4C8QD 3M58A 1TUDA 4FIBA 1X43A 3V7RA 1WNLA 2QTXA 3GF5A 3ER0A 3EG9B 4JRKA 3H0FA 2C0IA 4HKEA 3VUZA 1KHIA 3S6WA 4B9WA 4RTWA 2QAZA 2RPNA 1VQ7Q 4CRIA 1Q86U 1GFCA 5FWBA 1AHJB 3RIRA 2HZYA 4CC4B 4BE1A 2YHTA 1G8XA 3CCSQ 4KUIA 5LJ3f 2YUNA 1UGRB 3L42A 1I4K1 4ZGEB 3MCAB 2DO3A 3EFOB 1ABQA 2AHJB 3RMQA 2DF6A 3PTAA 1MMAA 3CMAT 4PJOA 3VUBA 2RI2A 3PFSA 5GAOm 1VQ9T 1SKUB 1M2VA 2EKOA 1QWEA 4N0AC 3HTRA 2O4XB 3OBWA 1M1KR 2CP5A 1X27A 2LT1A 4Y91A 3OYHA 2ABLA 3AT1B 4TVRA 5GANj 2EQJA 4C92D 1VQ7A 5KYUA 3CCQA 3SEMA 4XU3A 4KULA 4XU0A 3JB9I 3TQ7P 5FU6B 2AKKA 3CPWP 3CCSA 4DBQA 1V1CA 3CPFA 5FW9A 4F7UA 1WX6A 2ED1A 3H0HA 4HA8A 1Y7XA 2OTLQ 4F7UG 1JBMA 5IXFA 1VQ9Q 1YCSB 3GOXA 3Q1JA 1KQ2A 3IQLA 3L2UA 2H3JA 5CKHA 2IIMA 2MWOA 4EMGA 4M7AD 4JLIA 2V8IA 2ZAEA 4QVZA 1IHWA 3VS0A 1BCOA 4L5GA 4MZPA 3JCMg 4M75F 1CKBA 1QVFS 1UTIA 2D8HA 1QP3A 4JJCA 1WYXA 4AG1C 3URGA 1GCPA 4GY5A 5KYYB 3QJYA 1PRLC 4A63B 5GMKl 4KGXB 3S3OA 3CCUT 3JCMd 2F5TX 4ANJA 1D3BA 2OTLA 3J81E 2KT1A 3SWNC 2EJGA 3UATA 1QW1A 3KFVA 3HFOA 1UE9A 1W6XA 2GNCA 2FZCB 3AHUA 3VS5A 2BZYA 4CC2A 2DBKA 1ZUKA 1I5LA 5LJ5g 2EYWA 3VKIA 3VS1A 4OB0B 3OYLA 1VQ5Q 3CC7Q 2MOXA 1OZ3A 2DE0X 2J7IA 2XD0A 1BCMA 2MMPA 2LC4A 4OB1B 4MDWA 4C8QC 2LCSA 4LXCA 1Q81U 1QCFA 2JW4A 4E7LA 2KRSA 4HCZA 3LYIA 1KD1U 2Y4YA 3EG0A 3MEUA 2J06A 3VU3C 5LJ5d 1K9MC 1UJ0A 1QWFA 2QDYB 1SF9A 1KK7A 4ATOA 5LJ3e 4WCIA 2YUPA 4XTWA 4AFZC 2EYXA 3EG9A 2XU8A 2ZZDA 3FC3A 3CPWA 3OS1A 4LUDA 2QI2A 1VQ5A 2K6DA 3CC7A 4XTUA 2RQUA 4GLMA 5KCOA 2GF7A 1D1CA 1NJIC 2EAYA 2RMOA 3EFOA 3OSSC 2L2PA 4LNPA 2D9TA 4BACA 4LDXA 4Y28E 4AFSC 2V8KA 4F7UE 4IKFA 5LL6S 1IXDA 1M1GA 1VYUA 3LGFA 4QW2A 1JU5C 4C92C 3CCRA 1LPLA 3JCMW 5EG2A 5CAIA 5CKDA 1BI3A 1M90C 3EGDB 1EIFA 2O4XA 2HCKA 3S3NA 1HK9A 1X6GA 1UGSB 2OJ2A 3JRZA 5GMKm 5FU7B 1NLOC 4OMFB 3OYMA 4J6YA 5KE3A 5KE2A 4QT7A 4JZ4A 4JUVA 1MV0B 3EG2A 2KAFA 4A4EA 1HSQA 3GPLA 1KQSA 4X1VA 1RAFB 2COZA 2L0AA 3CCVT 5IAYA 4M7AC 2CT4A 1Q7YU 1FMWA 5HY6A 5FU7C 4PFZA 3OBYA 3GNFB 1QQJA 3P8HA 5I21A 4NL3A 2V1RA 2QA4Q 1HXDA 1M3CA 3PVLA 4PFOA 2KXDA 4LDVA 3FLGA 2VC8A 3M53A 3P8DA 2IPOB 2FZGB 1YITA 1MNDA 1K4US 1X6OA 3CCLT 1I8FA 3HP9A 3QWXX 1Q82R 2CS7A 3CCJT 2JNGA 1PC0A 1K9AA 2CUBA 4FYWB 1M1KC 2JT4A 5CKFA 2CZ6B 2DERA 2LMJA 4J9DA 2C0TA 2VB6A 3OS2A 5KYYA 3RKXA 4DBRA 2JJ9A 1B7TA 4BI8B 5KYXB 4M75B 4M7DF 2C06A 4FU6A 5IHIA 3PIPA 4DBFA 1ZUYA 1XJWB 3D7SB 5J3BA 3CCLQ 2DVJA 2QA4A 2IG0A 1HJDA 4M75C 1XNIA 3PIOA 1OU9A 2NWMA 2DNUA 4R55A 3JB9F 2K57A 1EFNA 1AOJA 1WI7A 4NS5A 2CKKA 4L59A 3KBGA 2DD4A 4II1A
chains in the Genus database with same CATH topology
1VQPT 4DA4A 2RK1A 5GAOq 4B9XA 3VYHB 4JS4A 2QQBA 1KHCA 3T9NA 2QXFA 4IURA 2VYTA 1R8OB 4OVAA 3M56A 4M78F 4HCCA 2E12A 2DK3A 3O8VA 3M4GA 3CC2T 4MMKA 2KK4A 3CXCA 3MEVA 2R5AA 3QDRB 2L3RA 3NTIA 5GAN5 1Y96B 3CCUA 2PQWA 2RHXA 3CD6A 5GAMj 1U8RA 4C92B 5A0GA 3OB9A 3MP6A 2XG8D 3TU4K 4ZTFA 2QEXT 2OAUA 4V2SA 5GAMe 2RB6A 4N4GA 4N0AA 3BDLA 5DLQE 3QSUA 3CCEA 3QO3A 5IT9E 5CQYA 4KT0E 4M75E 5LJ3h 3FJPA 3OW2S 1VQKA 1N9RA 3ZBDA 1H641 5GMKh 1WPYA 2L89A 3OYYA 3LWHA 3HKSA 3OQ5A 1Q7YC 1B34A 3ASKA 3QYGB 2DEQA 1D3BB 3FIFA 4JRQA 2X35A 1N8RC 3LLRA 1NZ9A 4O5VA 1KC8U 2JVVA 3JAME 2JUFA 3GP8A 1QVPA 3QJ6A 4NOYA 5FU6C 4X9DA 3I56T 2D0QB 3EAEA 4BI4A 1Y71A 2OTJT 4NL2A 3JB9J 1YBYA 3QXEB 4Q5WA 3OYKA 1W2BS 2L8DA 2WSCE 3HRUA 3ME9A 2M9UA 4M7AB 4PNOA 4JDSA 1JJ2S 3CC4T 3OYEA 3KUFA 3DB4A 3JB9D 3JB9H 4EMKB 3C95A 3CBMA 1G3SA 5CQXA 3CCMA 1YIJT 3CPWS 3OYDA 1QVGA 4E7HA 3UT1A 2HNIA 4RKUE 1N9SA 3I55T 3HSBA 2BUDA 2GFAA 3LH0A 3CMET 5LJ5j 1YJWT 4X34A 3M4YA 4XQ3A 1G3YA 3MP8A 1UB4A 2ZGWA 5IN1A 3JCMh 4M78D 5GAMh 2RM4A 1N27A 2I2LA 2RHYA 1YCYA 4M77B 4QVCA 4LD6A 4M7DC 3CXCS 3G4ST 2PUOB 2LTOA 3A8GB 1VQ5T 3CC7T 3QUIA 4XTYA 1VUBA 4MZMA 3RUXA 3E1SA 1YI2A 1VQMA 1PSFA 3C12A 3BY7A 2B8AA 3PNWC 3V8KA 3JCMJ 4JRIA 4M77C 1UEBA 3CEYA 3M58A 4C8QD 3QHSA 1YJ9T 3C94A 1VQ6A 4FIBA 5M9OA 1BYMA 1YHQA 3V7RA 1WNLA 4IUTA 2QTXA 2RHZA 3GF5A 2HQXA 3RESA 4A4KA 3OYCA 1TH7A 3ER0A 3HPWA 1H3ZA 1G5VA 2VXEA 4JRKA 4HKEA 4QQ6A 3VUZA 1KHIA 3S6WA 4B9WA 4MDXA 4DOWA 2KVQG 3SB2A 3X25B 3CCRT 1Q82U 4J6WA 4M7DE 3WVDB 3LW5E 3SWNA 4CRIA 1Q86U 3OYFA 2RA2A 3L2QA 1AHJB 3RIRA 4BE1A 3JB9G 1M5Q1 2DTHA 2YHTA 3M57A 1UGQB 5J26A 5D6YA 5LJ5h 3JCMX 1PSEA 1X01A 4KUIA 1XQHA 4XAXB 5LJ3f 3MEWA 4C5IA 5GMKj 1NPPA 1UGRB 4M78A 4M75D 2R5MA 3L42A 4M77E 1QVGS 1I4K1 4OGEA 4ZGEB 3MCAB 2BIVA 2EJFA 2DO3A 4QVDA 5FRNA 2AHJB 3OMCA 2K5IA 2KMTA 4M78G 3G71A 2XDBA 3GIBA 1LNXA 2E65A 3M5AA 3L1AA 1O75A 2DIGA 2F69A 2ZPEB 4PLIA 4OB2B 3RMQA 1S72T 3PTAA 2DZ9A 3X20B 4C8QA 3CMAT 4PJOA 1N6AA 2ZPIB 3VUBA 2RI2A 1QVFA 2R58A 2YLBA 1KC8C 3OSVA 3PFSA 2PU9B 5GAOm 1VQNT 2F5KA 1VQ9T 3RERA 4MZTA 4JS5A 2QQAA 4ZTJA 1VQ4T 4FM4B 4PLLA 2QQRA 4C8QG 3DKMA 1BI0A 2EKOA 4N0AC 3EFRA 5FROA 2YLCA 5J39A 3OYJA 3G6EA 2O4XB 1MHNA 5CK9A 3JB9I 3OBWA 2XDPA 1BI1A 3UDCA 3PT9A 2RD1A 3X26B 2LT1A 2RO0A 4Y91A 3OY9A 3OYHA 4A4FA 5A0LA 3JCMf 2LX9A 1YITT 1VQ8T 4QQGA 4TVRA 1VIFA 2XIDA 3CCVA 5GANj 2CGHA 2EQJA 2DJZA 4C92D 4L6V5 3J80E 5LJ3g 5DLOA 1VQ7A 4PL6A 3CCQA 5GANe 5DY9A 1FWZA 1X75C 2FB7A 2HQEA 3JSCA 1K73U 2P0QA 4XTXA 3VV0A 2MI6A 1ZBXA 2YRVA 4KULA 4XK8E 4XU0A 4XU3A 1O9SA 5CKEA 5FU6B 3N5BB 4PJOF 4C8QF 4EPCA 3G7ZA 2RJDA 5GAN8 3CCSA 1UGPB 4M75A 4P5NA 2JZ2A 3A8HB 3CPFA 3QBYA 4QQDA 4F7UA 3TCJA 3OYNA 3EFSA 1K9MU 4IUQA 4HA8A 4UC4A 1Y7XA 2X4YA 4F7UG 3M59A 1VQOA 1JBMA 4XU1A 3GOXA 1NE8A 3CCLA 4WF2A 2DD5A 3RKYA 2A3LA 3Q1JA 1KQ2A 4MMLA 3L2UA 3DLMA 3CCJA 2H3JA 3QZ5B 1ZHIA 5CKHA 1FX7A 2DXUA 3QKJA 1BIBA 3RKWA 1XTDA 5LJ3d 1K8AU 2QQSA 2DZCA 2MWOA 4EMGA 2LT4A 4A4GA 4JLIA 1BI2A 2MF2A 4M7AD 3NFCA 2V8IA 4QVZA 2EQMA 4RCCA 1JB0E 4M7DB 3PGGA 5CKBA 2XDDA 1WJQA 4L5GA 3MHXA 4MZPA 3JCMg 3UWNA 3V8LA 2KDSA 5GAMg 4M75F 4ZN1A 3E19A 3M55A 4F7UF 2RI3A 4FT4A 2QA4T 1QVFS 2ZPHB 2VXFA 2DPPB 1Y07A 4OF1A 4HT8A 2KSSA 5LJ5f 1YJNA 1W4SA 1Q82C 5CCAA 2E10A 5GANh 4E47A 2GCXA 2RK2A 1QP3A 3TEEA 3OA6A 3H8ZA 5CVIA 4BUGA 4C92A 1M1FA 1Q86C 3A8MB 2E64A 2XHCA 2FHDA 3URGA 1NJIU 3HL8A 4GY5A 4J6XA 2X4WA 3QJYA 2WSEE 5CIUA 4A54A 2EIFA 4C92G 2O01E 5GMKl 1VQLA 4A4HA 2HBPA 2PVOB 1V29B 1WJSA 2EQKA 1BKBA 1LJOA 2ZPFB 5GAOn 3S3OA 5I2MA 3CCUT 3CD6T 4PJOD 4J7FA 2FL7A 2PUKB 4M78B 4DOVA 5GAN6 3JCMd 2F5TX 5GAMd 1D3BA 3NTKA 2OTLA 3OS5A 3J81E 3SWNC 4C5GA 2EJGA 5GAN3 1VQPA 3C4SA 1QW1A 3CCET 3ZEHA 3HFOA 2Y4XA 2E41A 2NLUA 3L2ZA 4J5YA 4BDYA 3HRTA 1M90U 1VQKT 3SDZA 3AHUA 2RJFA 4C92F 5A0DA 2KY9A 2VGMA 3CC2A 2XK0A 4M78C 3V7SA 3META 2LQ8A 4N4IA 4M7AA 4KBMB 5C0MA 1BIAA 2PVGB 4FSXA 5LJ5g 3X24B 4C0DC 1I5LA 3VKIA 4EDUA 1NPRA 4EMKA 4OB0B 2QEXA 3OYLA 4M7AG 3M54A 2VUBA 5HKCA 1OZ3A 2XD0A 2MMPA 3GNGA 1KQSA 3LX7A 3FRNA 1OYXA 4GLKA 4ZGDB 5FRMA 1M8VA 3QZ9B 2LC4A 4OB1B 2WACA 4J7IA 4MDWA 3ZFJA 4C0FA 4C8QC 2FVUA 5A2QE 4BE2A 1KG1A 3CCST 4IUVA 1Q81U 2HAXA 1JRIA 4E7LA 4HCZA 4ME7A 4BD3A 1K73C 2RJEA 1G3WA 3LYIA 5DM7R 3CCMT 1KD1U 2Y4YA 2EWNA 5CR2A 4BI3A 4M7AF 4JJNK 3I56A 3M9QA 4R56A 3MEUA 2OTJA 1FXXA 3WVEB 4M78E 2K2VA 3VU3C 5I2SA 3J7AF 1QP2A 5LJ5d 1K9MC 3P8BB 2X4JA 1B34B 4ZGJB 4FT2A 1G3TA 2VGNA 2FYKA 2QDYB 3OS0A 3UPUA 2JN0A 3CC4A 1P92A 2P0PA 4ATOA 5LJ3e 4PJOG 1I81A 4E7JA 2ZPGB 2X4XA 5CO7A 4EMHA 4XU2A 1W2BA 1RI0A 1KD1C 1YI2T 1VQMT 4XTWA 3X28B 3L2WA 1YIJA 3R6OA 5D6WA 1JJ2A 3I55A 4HCBA 2XU8A 4M77F 3MP1A 5KCHA 3CMEA 2ZZDA 3FC3A 4BY6B 4C8QE 5GAMf 2CZ7B 3E9GA 1YJWA 3DLLA 1RL2A 1VQ6T 4LDUA 3H6ZA 3CPWA 3OS1A 1M1KU 3QG1A 2QI2A 5HK3A 1SSFA 3LWIA 1VQ5A 3G4SA 3CC7A 3DB3A 3E9FA 4LD9K 5L8RE 5GAOl 4XTUA 4PKCC 2DXCA 5AYFA 5GAN4 4BY6C 5KCOA 4ELZC 2EQUA 3SFMA 2P4TA 2E5QA 2GF7A 3JCMP 2E6ZA 2R57A 4JRPA 4M75G 2XICA 4OGCA 1YJ9A 4BDZA 2EAYA 2KQWA 1NJIC 4RCBA 1IREB 3OSSC 4IUUA 1U1SA 1KQ1A 2DTIA 3INZA 3JCMe 2XI9A 3VJPA 1DJ7B 1WJRA 2D9TA 5GAOp 4BACA 4LDXA 5GAOr 4Y28E 4N4HA 2V8KA 3V8JA 5FLXE 4F7UE 4IKFA 5LL6S 1M1GA 2XKOC 2K5FA 3LGFA 4QW2A 3OYIA 1VIEA 4C92C 3CCRA 4ZN3A 3G71T 3JCMW 5EG2A 5CAIA 5CKDA 2LDMA 5GAN2 4M7DD 3QYHB 2M16A 3FDRA 4LDWA 1BI3A 4J83A 1M90C 5GANg 1EIFA 2O4XA 3L2VA 4D6WA 3S3NA 2RH2A 1XOVA 3F70A 3JCMV 1Y96A 3WXMB 1HK9A 4BB7A 1UGSB 2CZ1B 3TREA 4M77D 2LNVA 3HRSA 4XTVA 3PMTA 3KXTA 4BE0A 3JRZA 5GMKm 4LDYA 3SWNB 5FU7B 5KH6A 3G6ET 4Z02A 1GXIE 4E7KA 4OMFB 3QIIA 2L5QA 1WQWA 2LVMA 4OB3B 3OYMA 2LCLA 4J6YA 2EJ9A 5KE3A 5KE2A 2LQKA 3JCMb 2G3RA 3NTHA 4JUVA 2CYZB 2KAFA 2PVDB 3CBPA 5D6XA 4A4EA 2BKDN 3GPLA 1S72A 4XTZA 4ELYC 2JTMA 2RI5A 3PMIA 1Q81C 4M7AC 3CCVT 5IAYA 3CMAA 4C92E 1Q7YU 1VQNA 4JLGA 5GANd 5HY6A 5LJ5e 5FU7C 3VYGA 4EMKC 4C5EA 2ZCFB 3BW1A 4C0DB 4J8OA 4DQ2A 3CCQT 1VQ4A 1VQ9A 4RMOA 4HT9A 3OBYA 3GNFB 1N8RU 3P8HA 5I21A 2M1HA 4NL3A 1HXDA 2D6FA 3FEOA 3BFMA 1WQ7A 2EFIA 1WGSA 2LCCA 1MGQA 3FB9A 2VV5A 4IUPA 3FLGA 4LDVA 2VC8A 3M53A 3P8DA 3V7CA 1ZQ1A 2GQVA 4C8QB 4PJOB 1YITA 1VQ8A 3CBOA 2RJCA 1OI1A 2MWPA 2P0KA 1VQOT 2EYQA 4M7DA 1X6OA 4RG2A 4YTLA 3JCMQ 2JOYA 5GMKi 3JCMc 3CCLT 1I8FA 1U1TA 3HP9A 2V8JA 2DXTA 2CS7A 4M7DG 3CCJT 2WSFE 2JNGA 4E7IA 2E6NA 5GAN7 4PJOC 3GLXA 1M1KC 4M7AE 3L2RA 4M77A 5CKFA 3MEAA 2CZ6B 3OW2A 2Y90A 1LOJA 3OMGA 3QPHA 3SD4A 2DIQA 2E1HA 4M77G 1IZ6A 2RHIA 2GFUA 3OS2A 2DAQA 5HK0A 2HD0A 3RKXA 2CZ0B 3A5ZB 3HFNA 5C6SA 1YJNT 4BI8B 2ZPBB 3A8OB 4X9CA 4M75B 3LGLA 4A53A 4C0GA 2M0OA 4F7UB 4CI0C 5LJ3j 4M7DF 2MAMA 4O6JA 3OYGA 2C06A 4FU6A 4OP0A 3HHTB 3OYAA 2K4YA 2DTOA 3MO8A 4FL6A 2A7YA 4C5HA 3PIPA 3OYBA 1KQSS 5GMKe 2JTFA 2LRQA 3A8LB 4KUDK 5J3BA 2QQ9A 1OZ2A 2QA4A 2K5LA 2IG0A 1VQLT 2RHUA 1K8AC 4M75C 1XNIA 2E70A 1M4ZA 2IVWA 2DVEA 3PIOA 2DXBA 3S3MA 4PJOE 1M9SA 2K3XA 3BDUA 4R55A 2K57A 3JB9F 5GANf 2DKGA 2K3YA 4NS5A 1YHQT 3RMSA 2CKKA 4L59A 1VQ7T 3KBGA 2OTLT 4C0ZA 2DD4A 4RG8A 4VUBA 4II1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3O A;  4B9X A;  5J26 A;  5D6Y A;  1KHC A;  2LDM A;  2VYT A;  4IUR A;  4C5I A;  3MEW A;  4OVA A;  2M16 A;  3FDR A;  2R5M A;  3L42 A;  3NTK A;  3O8V A;  2O4X A;  3MEV A;  2R5A A;  4C5G A;  2BIV A;  2L3R A;  3NTI A;  5FRN A;  3C4S A;  3S3N A;  3ZEH A;  3OMC A;  2PQW A;  2RHX A;  2NLU A;  4BDY A;  3F70 A;  3OB9 A;  3MP6 A;  4ZTF A;  2RJF A;  2XK0 A;  2DIG A;  3OYI A;  3MET A;  4PLI A;  4N4G A;  3PMT A;  4BE0 A;  3BDL A;  4N4I A;  5KH6 A;  4Z02 A;  4E7K A;  3QII A;  3OYM A;  2LVM A;  4EDU A;  2RI2 A;  2R58 A;  3OYL A;  2L89 A;  3PFS A;  5KE3 A;  3OQ5 A;  5KE2 A;  2F5K A;  2G3R A;  3NTH A;  4A4E A;  1OZ3 A;  4ZTJ A;  5D6X A;  3ASK A;  2BKD N;  4PLL A;  2QQR A;  5FRO A;  3OYJ A;  2EKO A;  2RI5 A;  3LX7 A;  3PMI A;  1OYX A;  5J39 A;  5FRM A;  2O4X B;  2X35 A;  1MHN A;  3LLR A;  5IAY A;  2WAC A;  2XDP A;  4BE2 A;  4BE1 A;  4C5E A;  3OY9 A;  2RO0 A;  3QJ6 A;  4IUV A;  3OYH A;  4A4F A;  3EAE A;  4E7L A;  4HCZ A;  3P8H A;  4QQG A;  2M1H A;  4BD3 A;  2RJE A;  4Q5W A;  3LYI A;  3OYK A;  2L8D A;  3ME9 A;  2EQJ A;  3FEO A;  2LCC A;  2EFI A;  1WGS A;  4IUP A;  3FLG A;  4PL6 A;  3P8D A;  3OYE A;  3KUF A;  2HQE A;  3M9Q A;  3DB4 A;  2YRV A;  3MEU A;  5C0M A;  2RJC A;  3L2V A;  1OI1 A;  2MWP A;  2P0K A;  2RJD A;  3OYD A;  4E7H A;  4RG2 A;  3UT1 A;  3OS0 A;  2JZ2 A;  3QBY A;  2BUD A;  2GFA A;  4QQD A;  3LH0 A;  3OYN A;  4E7J A;  4IUQ A;  2X4X A;  4UC4 A;  4X34 A;  3MP8 A;  5IN1 A;  1RI0 A;  2X4Y A;  4E7I A;  3L2W A;  2E6N A;  1N27 A;  2RHY A;  3GOX A;  5D6W A;  4LD6 A;  3L2R A;  3MP1 A;  3Q1J A;  5KCH A;  3FC3 A;  2LTO A;  3MEA A;  3E9G A;  3L2U A;  3DLM A;  3SD4 A;  3OMG A;  3H6Z A;  2DIQ A;  3OS1 A;  3QKJ A;  2RHI A;  2GFU A;  3OS2 A;  2B8A A;  2DAQ A;  3PNW C;  2QQS A;  1SSF A;  2MWO A;  4A4G A;  4QVZ A;  5C6S A;  2EQM A;  3DB3 A;  3E9F A;  3CEY A;  3LGL A;  2M0O A;  1WJQ A;  5M9O A;  3UWN A;  3OYG A;  5KCO A;  4IUT A;  2RI3 A;  4FU6 A;  2EQU A;  2RHZ A;  3OYA A;  2HQX A;  3OYB A;  3OYC A;  3MO8 A;  4FL6 A;  4C5H A;  2E5Q A;  2GF7 A;  2JTF A;  2R57 A;  2LRQ A;  4BDZ A;  1H3Z A;  1G5V A;  3OA6 A;  4IUU A;  1OZ2 A;  4QQ6 A;  3H8Z A;  2IG0 A;  3S6W A;  4B9W A;  2RHU A;  1XNI A;  1WJR A;  2D9T A;  3S3M A;  4BAC A;  2K3X A;  2FHD A;  4GY5 A;  2X4W A;  4N4H A;  5CIU A;  2K3Y A;  4NS5 A;  4IKF A;  2CKK A;  4L59 A;  4CRI A;  3OYF A;  3LGF A;  3L2Q A;  4A4H A;  4QW2 A;  1WJS A;  2EQK A;  4II1 A; 
#chains in the Genus database with same CATH topology
 4OMQ A;  1VQP T;  3M0Q A;  4J9E A;  2QXF A;  4IUR A;  1R8O B;  4M78 F;  4HCC A;  3O8V A;  1QVF P;  1R77 A;  2KK4 A;  3CXC A;  3QDR B;  2L3R A;  1Y96 B;  1K73 R;  5GAM j;  3TU4 K;  2BE9 B;  4V2S A;  3VS4 A;  2GTJ A;  2RB6 A;  3A1P A;  5IT9 E;  2RQW A;  5CQY A;  3EG1 A;  1WPY A;  1C0M A;  3M0T A;  3C0C A;  1VQ6 Q;  3JAM E;  1EZZ B;  3GP8 A;  1K8A R;  3QJ6 A;  3I56 T;  2D0Q B;  3EAE A;  1NM7 A;  2OTJ T;  1Y71 A;  4NL2 A;  3JB9 J;  1W70 A;  3OYK A;  2K9G A;  2WSC E;  2M9U A;  4PNO A;  3OYE A;  1N5Z A;  3JB9 D;  3I35 A;  2EPD A;  1PM3 A;  1WIE A;  1YIJ T;  3CPW S;  3UA7 A;  3LH0 A;  3CME T;  1YJW T;  4X34 A;  1UB4 A;  4M78 D;  3PVQ A;  1HYO A;  2PUO B;  3A8G B;  1AVZ C;  5EC7 A;  3H41 A;  4MZM A;  3E1S A;  1B07 A;  2CDT A;  2B8A A;  3I56 Q;  2LP5 A;  4JRI A;  2OTJ Q;  3I9Q A;  1UEB A;  3CEY A;  1YJ9 T;  1ABO A;  1VQ6 A;  4K11 A;  4A4K A;  3NGP A;  1RAD B;  2JM9 A;  4PJL A;  1QLY A;  3EGD A;  1T3L A;  1YIJ Q;  1TU0 B;  1H3Z A;  3CME Q;  4MDX A;  1JXM A;  1YJW Q;  1YN8 A;  1AZE A;  1WZO A;  4J6W A;  3WVD B;  1U3O A;  3LW5 E;  3NHN A;  3OYF A;  3M57 A;  1UHC A;  1S1N A;  3EGX B;  4XAX B;  1XQH A;  4C5I A;  3MEW A;  1NPP A;  2W0Z A;  4F04 B;  3EH1 A;  4OGE A;  2EJF A;  2J6F A;  2OI3 A;  3OMC A;  2K5I A;  2OX7 A;  1YJ9 Q;  3G71 A;  2XDB A;  3GIB A;  2SEM A;  3M5A A;  1O75 A;  2BZX A;  2DIG A;  2F69 A;  3QWY A;  1Y0M A;  4OB2 B;  1S72 T;  1C1A A;  1K76 A;  3X20 B;  1QVF A;  2R58 A;  4E7Z A;  1ZSG A;  3VRZ A;  4MZT A;  4JS5 A;  1VQ4 T;  4ZTJ A;  2HKN A;  4PLL A;  2E3I A;  2QQR A;  4FM4 B;  3EFR A;  5J39 A;  1MHN A;  4CC3 A;  2VWF A;  1BI1 A;  3PT9 A;  4HVV A;  3MKD A;  4A4F A;  2LX9 A;  3O5Z A;  1VQ8 T;  4QQG A;  2RQT A;  2CGH A;  2DJZ A;  3J80 E;  1GCQ C;  3H9N A;  5DLO A;  9ATC B;  5LJ3 g;  1JJ2 P;  1G83 A;  6AT1 B;  2FB7 A;  3JSC A;  2HQE A;  1NYF A;  2P0Q A;  1NEG A;  3VV0 A;  2MI6 A;  1ZBX A;  2YRV A;  1O9S A;  4C8Q F;  2XMF A;  3N5B B;  2CH4 A;  5KYW B;  3G7Z A;  2RJD A;  4M75 A;  3A8H B;  1K9M U;  4UC4 A;  1OV3 A;  2JS2 A;  2YRD A;  3EHQ A;  3M59 A;  3JV3 A;  4GBQ A;  2A3L A;  3EG3 A;  4EIK A;  1UDL A;  1D1B A;  3QZ5 B;  1RLP C;  1FX7 A;  5LJ3 d;  1XTD A;  2QQS A;  1MV3 A;  2LT4 A;  1TUG B;  1BI2 A;  1YWP A;  2KBT A;  1VQ8 Q;  4M7D B;  2QEX Q;  3PGG A;  2XDD A;  3V8L A;  3UWN A;  5IHK A;  4ZN1 A;  2RI3 A;  4FT4 A;  1BK2 A;  2ZPH B;  1Y07 A;  1UG1 A;  4HT8 A;  2KSS A;  1Q82 C;  1PKS A;  2E10 A;  5GAN h;  3TEE A;  3H8Z A;  1RAI B;  2CRE A;  5CVI A;  2E64 A;  1NJI U;  3HL8 A;  4J6X A;  2X4W A;  4A54 A;  2O01 E;  1NEB A;  1AWX A;  1JQQ A;  2HBP A;  2EQK A;  1SSH A;  4ESR A;  5GAO n;  3CD6 T;  2BE7 D;  2PUK B;  4M78 B;  2F2X A;  1PD1 A;  2L3Q A;  2QGF B;  2LNH B;  3OS5 A;  5GAN 3;  1TG0 A;  3C4S A;  2NLU A;  1JO8 A;  1M90 U;  2RJF A;  4C92 F;  1ZLM A;  1RAG B;  4M78 C;  3MJX A;  4KBM B;  1BIA A;  2PVG B;  4FSX A;  4C0D C;  4EDU A;  2QEX A;  1NPR A;  2HQH A;  3M54 A;  2VUB A;  3G4S Q;  3U23 A;  2ATC B;  1GRI A;  1PCX A;  2AK5 A;  4GLK A;  1OYX A;  1PNJ A;  1M8V A;  2KEA A;  4J7I A;  4QKU A;  1EX4 A;  4DEX A;  1QCN A;  4BE2 A;  1WXU A;  2GBQ A;  2KNB B;  1K73 C;  1G3W A;  5DM7 R;  5AT1 B;  2MYS A;  2J05 A;  4M7A F;  4JJN K;  4R56 A;  5I2S A;  3EGU A;  1QP2 A;  2DL5 A;  4ZGJ B;  2Z0W A;  4FT2 A;  2JN0 A;  4D8K A;  4PJO G;  2FEI A;  2ZPG B;  1G2B A;  8ATC B;  1JJ2 A;  1IB8 A;  4HCB A;  3MP1 A;  1IHV A;  3SHW A;  1M3A A;  2CZ7 B;  3DLL A;  1RL2 A;  2DL4 A;  3H6Z A;  4LDU A;  1M1K U;  2HBW A;  2I0N A;  3QG1 A;  5HK3 A;  1SSF A;  3LWI A;  3G4S A;  4LD9 K;  4PKC C;  5AYF A;  3EGX A;  2LQN A;  4ELZ C;  2EQU A;  3SFM A;  2PTK A;  3CMA Q;  2R57 A;  4BDZ A;  4RCB A;  1IRE B;  1U1S A;  2DTI A;  1SRL A;  2MPX C;  2F2W A;  2DET A;  4N4H A;  2DEU A;  2JXB A;  5FLX E;  2XKO C;  2FPE A;  4ZN3 A;  1I1J A;  2LDM A;  2M16 A;  2QG9 B;  5KYN A;  4D6W A;  3GBQ A;  3JCM V;  3WXM B;  1ZSZ C;  2CZ1 B;  4HVW A;  4XTV A;  2EBP A;  3SWN B;  5KH6 A;  3G6E T;  4E7K A;  4OB3 B;  1OUL A;  3JCM b;  5KYW A;  4WTO B;  1HD3 A;  4XTZ A;  2JTM A;  3CMA A;  3VYG A;  4EMK C;  4RTY A;  1VQ9 A;  4J8O A;  2CT3 A;  1YNZ A;  3I5S A;  4HT9 A;  1U06 A;  1WHG A;  2M1H A;  3R6N A;  2DX1 A;  1KFZ A;  2AZS A;  3V7C A;  2GQV A;  4C8Q B;  1OI1 A;  2K2M A;  2YDL A;  1VQO T;  2EYQ A;  4M7D A;  4YTL A;  1KSW A;  4RG2 A;  2JOY A;  3JCM c;  2KR3 A;  4PJJ A;  4HXJ A;  2DXT A;  4M7D G;  4E7I A;  5GAN 7;  4ORZ A;  3CCU Q;  4M77 A;  2QAS A;  2EGA A;  5IHN A;  2Y90 A;  1LOJ A;  3QPH A;  1JEG A;  2E1H A;  4M77 G;  1IZ6 A;  2DAQ A;  2PNI A;  1YJN T;  1Z9Z A;  4X9C A;  4KH1 B;  4C0G A;  4OP0 A;  3HHT B;  2FPD A;  4FL6 A;  2VAS A;  4AFU C;  2O9S A;  1VQO Q;  2QQ9 A;  1ACM B;  1VQL T;  3QDF A;  2RHU A;  2E70 A;  1M4Z A;  2E3H A;  4KGV B;  4PJO E;  1AWW A;  2DKG A;  1SEM A;  3RMS A;  4C0Z A;  4VUB A;  3G1J A;  2RK1 A;  5GAO q;  2EKH A;  1KHC A;  3T9N A;  3VS7 A;  2VYT A;  1ZX6 A;  2DK3 A;  3M4G A;  4J9I A;  3CC2 T;  3MEV A;  1YJN Q;  1R0B G;  3VS2 A;  3CCU A;  1U8R A;  2RQV A;  3EH2 A;  4C92 B;  3OB9 A;  3PE0 A;  3M0R A;  4ZTF A;  2LJ1 A;  1BU1 A;  3VS6 A;  4N0A A;  4KRT A;  1RAA B;  1D0Y A;  3UA6 A;  2LJ3 A;  1VQL Q;  5GMK h;  2F2V A;  2L89 A;  3HKS A;  1WLP B;  2AIR B;  2DEQ A;  4JRQ A;  1NZ9 A;  1I5O B;  4HCK A;  1CSK A;  2JVV A;  2CP6 A;  1X69 A;  1YBY A;  2L8D A;  4FYX B;  3ME9 A;  4M7A B;  1W1F A;  4JDS A;  1JJ2 S;  3CC4 T;  4RTX A;  3DB4 A;  3JB9 H;  4JJD A;  3RDV A;  3C95 A;  1G3S A;  4FYY B;  3OYD A;  4J9B A;  2HNI A;  3I55 T;  1IGU A;  1SPK A;  2A08 A;  5LJ5 j;  4KGZ B;  1G3Y A;  3MP8 A;  5GAM h;  4Z88 A;  1MUZ A;  1YCY A;  3A98 A;  2QYZ A;  2DJQ A;  3C12 A;  4B6M A;  3PNW C;  1UUE A;  3JCM J;  1PKT A;  1FYN A;  2KT8 A;  4JZ3 A;  4ZNX A;  1E6G A;  5M9O A;  1BYM A;  2O31 A;  2RHZ A;  2H8H A;  2HQX A;  3RES A;  4OMO A;  1TH7 A;  2CP7 A;  2VXE A;  2ROL A;  3M0S A;  2RN8 A;  4DOW A;  3SB2 A;  1Q82 U;  3CCV Q;  1VYT A;  2L3S A;  4E2F B;  4M7D E;  1ARK A;  3SWN A;  1UJY A;  5J26 A;  1PSE A;  4Y92 A;  5GMK j;  4M77 E;  4PJN A;  2BIV A;  1WHM A;  1UHF A;  4QVD A;  5FRN A;  2K79 A;  1T3S A;  1LNX A;  2K3B A;  5ECA A;  3L1A A;  2NUZ A;  1IGQ A;  1H3H A;  2HL3 A;  3CCJ Q;  2JMA A;  2DZ9 A;  4C8Q A;  1N6A A;  1VQN T;  2PU9 B;  3RER A;  4C8Q G;  3OYJ A;  1IO6 A;  2RD1 A;  3X26 B;  4F14 A;  1ZA2 B;  4DEY A;  2AZV A;  5A0L A;  3CCV A;  1R0C B;  1W2B P;  4LN2 A;  4LUE A;  4PL6 A;  1FWZ A;  2DL7 A;  2KGT A;  1K73 U;  3L2V A;  2O88 A;  1WFW A;  4EPC A;  5L23 A;  4PFP A;  1WDX A;  2JZ2 A;  3QBY A;  4QQD A;  2D1X A;  3OYN A;  3CCL A;  1VQP Q;  1SHF A;  4WF2 A;  4MML A;  3CCJ A;  3NPF A;  2DYI A;  3RKW A;  3QKJ A;  1BIB A;  1K8A U;  2DZC A;  2DIL A;  4RTZ A;  2EQM A;  1JB0 E;  1UGV A;  5CKB A;  1WJQ A;  5GAN 5;  3E19 A;  2DRM A;  2EGE A;  2VXF A;  2EYZ A;  4OF1 A;  1W4S A;  1JXO A;  5CCA A;  4E47 A;  2GCX A;  3OA6 A;  4BUG A;  4C92 A;  2DBM A;  3A8M B;  1NLP C;  2XHC A;  2FHD A;  2DL8 A;  4C92 G;  1OX8 A;  1WJS A;  2COY A;  1V29 B;  2PVO B;  3MPU B;  1N8R R;  5GAN 6;  1U5S A;  1ZBJ A;  2CSI A;  3NTK A;  2CP3 A;  1VQP A;  3CCE T;  4OMM A;  2Y4X A;  2E41 A;  4J5Y A;  1RLQ C;  1VQK T;  3SDZ A;  5A0D A;  2KY9 A;  2VGM A;  2V26 A;  2YXY A;  3V7S A;  3MET A;  1T0J A;  4M7A A;  1ZA1 B;  4PK4 A;  4FCY A;  4M7A G;  4RUG A;  5HKC A;  5FWC A;  2LJ0 A;  2FO0 A;  3GNG A;  3LX7 A;  5FRM A;  3QZ9 B;  2WAC A;  3ZFJ A;  1YWO A;  2FVU A;  4D8D A;  2OAW A;  4BD3 A;  2NUP B;  3CCM T;  1Z9Q A;  2EWN A;  5CR2 A;  4BI3 A;  3I56 A;  1A0N B;  1M2O A;  2OTJ A;  1FXX A;  1VQK Q;  4RTU A;  2X4J A;  2VGN A;  1PHT A;  2FG0 A;  2FPF A;  1P92 A;  2P0P A;  2P4R A;  4E7J A;  5CO7 A;  1W2B A;  3TVT A;  4J9C A;  1YI2 T;  2K7A A;  1VQM T;  3L2W A;  1J3T A;  1H92 A;  1YIJ A;  3R6O A;  5D6W A;  4IIM A;  1AT1 B;  3CME A;  4BY6 B;  4C8Q E;  1YJW A;  3E9G A;  2D0N A;  1OQK A;  2AKL A;  1YFN A;  2H3E B;  5IH2 A;  4J9F A;  1WHK A;  2LZ6 B;  5GAO l;  5KYX A;  4BY6 C;  1S72 Q;  4RTT A;  1SG5 A;  3JCM P;  2E6Z A;  2QTV A;  4JRP A;  4M75 G;  2XIC A;  4OGC A;  1YJ9 A;  1AWO A;  1VQ4 Q;  4R0K A;  2DLP A;  1KQ1 A;  2XI9 A;  3VJP A;  1WJR A;  5GAO r;  1X6B A;  1KC8 R;  7AT1 B;  1M30 A;  2K5F A;  1GFD A;  2E4H A;  1OPK A;  3OYI A;  2QGG A;  1OX9 A;  4J9H A;  1V76 A;  3QYH B;  2HL5 C;  4LDW A;  5GAN g;  1XOV A;  1M27 C;  1Y96 A;  4BB7 A;  3LH5 A;  3TRE A;  3HRS A;  3KXT A;  4BE0 A;  4AG2 C;  3FJ5 A;  2W10 A;  2A37 A;  1GXI E;  3QII A;  2L5Q A;  2EJ9 A;  3NMZ C;  2LQK A;  1WHL A;  2CYZ B;  1D1A A;  3CBP A;  5D6X A;  1S72 A;  2BKD N;  3PMI A;  1TWB A;  2X3W D;  1GL5 A;  4C92 E;  4FYV B;  1Y57 A;  4JLG A;  5GAN d;  1VQ7 T;  4C5E A;  2ZCF B;  2V1Q A;  5GJW B;  4C0D B;  4DQ2 A;  3CCQ T;  1VQ4 A;  1QKX A;  4FW1 A;  3TSW A;  2D6F A;  3FEO A;  3CCS T;  4FSS A;  2VV5 A;  1QCO A;  1I0C A;  1VQ8 A;  3CBO A;  2RJC A;  2MWP A;  2P0K A;  3JCM Q;  1M90 R;  5GMK i;  1U1T A;  2YT6 A;  1VOM A;  1RAC B;  3THK A;  1NG2 A;  1GBQ A;  2E6N A;  2HSE B;  1Q86 R;  4M7A E;  3CD6 Q;  3MEA A;  3SD4 A;  3OMG A;  2DIQ A;  2EGC A;  3CCQ Q;  5HK0 A;  2CZ0 B;  3HFN A;  2KRN A;  2ZPB B;  2FZK B;  4A53 A;  4CI0 C;  2ROT A;  5LJ3 j;  2M0O A;  2EVR A;  2MAM A;  3OYG A;  2DA9 A;  3ULR B;  2K4Y A;  2DTO A;  3OYA A;  1RI9 A;  2A7Y A;  3RBB B;  2JTF A;  3A8L B;  1KIK A;  1OZ2 A;  1K8A C;  2DXB A;  2K3X A;  1AWJ A;  1TUC A;  5GAN f;  1WHJ A;  2CP2 A;  1YHQ T;  4F17 A;  2OTL T;  1K1Z A;  1MMD A;  4B9X A;  3VYH B;  2KE9 A;  4JS4 A;  2QQB A;  1MMG A;  2E12 A;  4MMK A;  2R5A A;  3NTI A;  3REB B;  2PQW A;  2RHX A;  3CD6 A;  5A0G A;  2XG8 D;  4Z89 A;  4E6R A;  1MNE A;  2NUP A;  1WHH A;  4N4G A;  1TTH B;  5DLQ E;  3QO3 A;  2YSQ A;  2HSP A;  4M75 E;  3FJP A;  3OW2 S;  1N9R A;  3ZBD A;  1H64 1;  3OYY A;  3LWH A;  3OQ5 A;  2GTO A;  1ZSZ B;  5IXB A;  1YHQ Q;  2X35 A;  2DYB A;  1N8R C;  1GCQ A;  2JUF A;  4JPB W;  5FU6 C;  1W2B S;  3CQT A;  3HRU A;  2ED0 A;  4OMP A;  1D0X A;  4EMK B;  2VVK A;  3CBM A;  1K0X A;  5CQX A;  2CH4 W;  1N9S A;  3HSB A;  2A36 A;  4XQ3 A;  3JCM h;  5IN1 A;  2ZGW A;  2RM4 A;  1QKW A;  4QVC A;  1VQ5 T;  2LTO A;  3CC7 T;  1VUB A;  2RNA A;  1PSF A;  3V8K A;  2DM1 A;  2X51 A;  2JS0 A;  4RTV A;  2JM8 A;  3QHS A;  3C94 A;  1YHQ A;  4IUT A;  5I11 A;  3OYC A;  1UEC A;  3G6E Q;  1KQS P;  3HPW A;  1G5V A;  2B86 A;  4QQ6 A;  1YP5 A;  2KRO A;  2CP0 A;  2KVQ G;  3X25 B;  3CCR T;  1IRX A;  1ZUU A;  2X9H A;  2RA2 A;  3L2Q A;  3JB9 G;  1M5Q 1;  2KYM A;  2DTH A;  1Q81 R;  1UGQ B;  5LJ5 h;  5D6Y A;  3JCM X;  1X01 A;  1LCK A;  2QDL A;  4M78 A;  4M75 D;  2R5M A;  1KD1 R;  1QVG S;  4AMC A;  2DFU A;  2KMT A;  2EQI A;  4M78 G;  1T0H A;  2HKQ B;  2E65 A;  2ZPE B;  4PLI A;  2VKN A;  2KYB A;  3VS3 A;  2ZPI B;  2YLB A;  1KC8 C;  3OSV A;  1BB9 A;  1E6H A;  2F5K A;  3CCR Q;  2DMO A;  2QQA A;  3DKM A;  1BI0 A;  5FRO A;  3G6E A;  2YLC A;  5CK9 A;  2JMC A;  2NYS A;  2XDP A;  3UDC A;  2FRY A;  3OY9 A;  2MK5 A;  2KXC A;  2RO0 A;  1GBR A;  3JCM f;  1YIT T;  1VIF A;  2XID A;  3H0I A;  2J6O A;  4L6V 5;  1WA7 A;  5GAN e;  5DY9 A;  1X75 C;  4XTX A;  4XK8 E;  2RF0 A;  5C0M A;  5CKE A;  4PJO F;  5GAN 8;  1NYG A;  2NUT B;  1UGP B;  2YUQ A;  4P5N A;  1VA7 A;  3TCJ A;  2LX7 A;  3EFS A;  4IUQ A;  2X4Y A;  2CSQ A;  1VQO A;  4XU1 A;  3UF4 A;  1NE8 A;  4OML A;  2DD5 A;  3RKY A;  3CXC P;  4IIO A;  3DLM A;  3CC2 Q;  1ZHI A;  2DXU A;  4A4G A;  2MF2 A;  1YIT Q;  3NFC A;  4RCC A;  2ESW A;  1VYV A;  3MHX A;  1OEB A;  2KDS A;  5GAM g;  2QA4 T;  2O9V A;  3M55 A;  4F7U F;  2KRM A;  2DPP B;  2YWW A;  5LJ5 f;  1YJN A;  2RK2 A;  1M8M A;  2GQI A;  1M1F A;  2M0Y A;  1Q86 C;  1RAE B;  4AT1 B;  5CIU A;  1X2Q A;  2WSE E;  2EIF A;  4M4Z A;  3TSZ A;  1Q7Y R;  1VQL A;  4A4H A;  1BKB A;  1LJO A;  2ZPF B;  5I2M A;  4PJO D;  1ZSZ A;  2FL7 A;  4HVU A;  4J7F A;  4DOV A;  2HDA A;  5GAM d;  3CC4 Q;  2X3X D;  4C5G A;  3ZEH A;  3L2Z A;  1FMK A;  4BDY A;  3HRT A;  3I55 Q;  3CC2 A;  2XK0 A;  2LQ8 A;  4N4I A;  1FMV A;  5D7U A;  3X24 B;  4EMK A;  1C6V X;  2M02 A;  8AT1 B;  1E7O A;  3FRN A;  4ZGD B;  5I22 A;  4C0F A;  5A2Q E;  1KG1 A;  1LVK A;  4IUV A;  2HAX A;  1JRI A;  4ME7 A;  2RJE A;  2MCN A;  1CKA A;  3M9Q A;  1TSF A;  1OU8 A;  3WVE B;  4M78 E;  2K2V A;  3J7A F;  3OW2 P;  3P8B B;  1B34 B;  1M3B A;  2L3P A;  1G3T A;  2FYK A;  3OS0 A;  3UPU A;  1Q95 G;  3CC4 A;  1D09 B;  1I81 A;  2X4X A;  4EMH A;  3M0P A;  4XU2 A;  1RI0 A;  3X28 B;  3I55 A;  4M77 F;  5KCH A;  5GAM f;  2HMA A;  1WXB A;  1VQ6 T;  1PG5 B;  1TXQ A;  1PRM C;  3DB3 A;  3E9F A;  2A0F B;  5L8R E;  2BTT A;  2DXC A;  2JTE A;  5GAN 4;  1H8K A;  2P4T A;  2E5Q A;  1VQN Q;  2YUO A;  2KQW A;  1OOT A;  4IUU A;  3INZ A;  3JCM e;  1DJ7 B;  4DBH A;  5GAO p;  3V8J A;  2O2O A;  1MMN A;  1PD0 A;  1VIE A;  3BE3 A;  2P84 A;  5HCK A;  2DRK A;  3G71 T;  5GAN 2;  4Z8A A;  4M7D D;  3FDR A;  4J83 A;  1PWT A;  2FRW A;  2MIO A;  2RH2 A;  3F70 A;  1RUW A;  4OMN A;  2LQW A;  2LNV A;  4M77 D;  3PMT A;  4LDY A;  1BBZ A;  4Z02 A;  1WQW A;  2LVM A;  2LCL A;  2HEQ A;  4J9G A;  1F1B B;  2G3R A;  3NTH A;  2PVD B;  2D8J A;  2ENM A;  2NUT A;  4ELY C;  2RI5 A;  1Q81 C;  1VQN A;  1QVG P;  5LJ5 e;  1KD1 C;  3BW1 A;  4KH0 B;  1AEY A;  2EYY A;  4RMO A;  3G71 Q;  1N8R U;  3E2U A;  1SRM A;  3BFM A;  1WQ7 A;  2EFI A;  1WGS A;  2LCC A;  1MGQ A;  3FB9 A;  1TOV A;  4IUP A;  2J6K A;  1ZQ1 A;  4PJO B;  4JJB A;  2DL3 A;  2AT1 B;  1M2V B;  4PJM A;  2V8J A;  1OPL A;  2WSF E;  2EW3 A;  4FW2 A;  3GLX A;  1QMC A;  4PJO C;  3L2R A;  2COW A;  5GJV B;  3OW2 A;  5KYU B;  2RHI A;  1NBE B;  2GFU A;  2HD0 A;  3CCE Q;  2A28 A;  3A5Z B;  5C6S A;  3A8O B;  3LGL A;  4F7U B;  2E5K A;  2ECZ A;  4O6J A;  3OYB A;  3MO8 A;  4C5H A;  1KQS S;  5GMK e;  2LRQ A;  4KUD K;  2K5L A;  2IVW A;  1RAB B;  2DVE A;  3S3M A;  3BDU A;  1M9S A;  1B3Q A;  2CUD A;  2K3Y A;  3M0U A;  4RG8 A;  3EHR A;  4DA4 A;  2RQR A;  3CCM Q;  1D0Z A;  1UFF A;  1RAH B;  3M56 A;  4OVA A;  3ZL7 C;  3VRY A;  1KJW A;  2M51 A;  3MP6 A;  2QEX T;  2OAU A;  5GAM e;  1SHG A;  3BDL A;  3QSU A;  3CCE A;  1YI2 Q;  1VQM Q;  4E7S A;  2PZ1 A;  1K9M R;  4KT0 E;  1I07 A;  5LJ3 h;  1VQK A;  2GGR A;  1Q7Y C;  3RR6 A;  1B34 A;  3ASK A;  3QYG B;  2QK0 A;  1D3B B;  4CC7 A;  2SRC A;  3FIF A;  1X2K A;  3LLR A;  4O5V A;  1KC8 U;  3I5R A;  1QVP A;  3REA B;  4NOY A;  4X9D A;  2BZ8 A;  4BI4 A;  3QXE B;  4Q5W A;  1AD5 A;  3KUF A;  4AFQ C;  1K0S A;  4LE9 A;  3RNJ A;  4F16 A;  1QVG A;  3CCM A;  4E7H A;  3UT1 A;  4RKU E;  2BUD A;  2F1L A;  2GFA A;  1WXT A;  2KI7 A;  3M4Y A;  1NJI R;  2C0O A;  1N27 A;  2I2L A;  2RHY A;  4M77 B;  4LD6 A;  4M7D C;  3CXC S;  3G4S T;  2YRC A;  3QUI A;  4XTY A;  1TS9 A;  1YI2 A;  3RUX A;  1VQM A;  2G6F X;  3BY7 A;  1AZG B;  4M77 C;  4C8Q D;  3M58 A;  1TUD A;  4FIB A;  1X43 A;  3V7R A;  1WNL A;  2QTX A;  3GF5 A;  3ER0 A;  3EG9 B;  4JRK A;  3H0F A;  2C0I A;  4HKE A;  3VUZ A;  1KHI A;  3S6W A;  4B9W A;  4RTW A;  2QAZ A;  2RPN A;  1VQ7 Q;  4CRI A;  1Q86 U;  1GFC A;  5FWB A;  1AHJ B;  3RIR A;  2HZY A;  4CC4 B;  4BE1 A;  2YHT A;  1G8X A;  3CCS Q;  4KUI A;  5LJ3 f;  2YUN A;  1UGR B;  3L42 A;  1I4K 1;  4ZGE B;  3MCA B;  2DO3 A;  3EFO B;  1ABQ A;  2AHJ B;  3RMQ A;  2DF6 A;  3PTA A;  1MMA A;  3CMA T;  4PJO A;  3VUB A;  2RI2 A;  3PFS A;  5GAO m;  1VQ9 T;  1SKU B;  1M2V A;  2EKO A;  1QWE A;  4N0A C;  3HTR A;  2O4X B;  3OBW A;  1M1K R;  2CP5 A;  1X27 A;  2LT1 A;  4Y91 A;  3OYH A;  2ABL A;  3AT1 B;  4TVR A;  5GAN j;  2EQJ A;  4C92 D;  1VQ7 A;  5KYU A;  3CCQ A;  3SEM A;  4XU3 A;  4KUL A;  4XU0 A;  3JB9 I;  3TQ7 P;  5FU6 B;  2AKK A;  3CPW P;  3CCS A;  4DBQ A;  1V1C A;  3CPF A;  5FW9 A;  4F7U A;  1WX6 A;  2ED1 A;  3H0H A;  4HA8 A;  1Y7X A;  2OTL Q;  4F7U G;  1JBM A;  5IXF A;  1VQ9 Q;  1YCS B;  3GOX A;  3Q1J A;  1KQ2 A;  3IQL A;  3L2U A;  2H3J A;  5CKH A;  2IIM A;  2MWO A;  4EMG A;  4M7A D;  4JLI A;  2V8I A;  2ZAE A;  4QVZ A;  1IHW A;  3VS0 A;  1BCO A;  4L5G A;  4MZP A;  3JCM g;  4M75 F;  1CKB A;  1QVF S;  1UTI A;  2D8H A;  1QP3 A;  4JJC A;  1WYX A;  4AG1 C;  3URG A;  1GCP A;  4GY5 A;  5KYY B;  3QJY A;  1PRL C;  4A63 B;  5GMK l;  4KGX B;  3S3O A;  3CCU T;  3JCM d;  2F5T X;  4ANJ A;  1D3B A;  2OTL A;  3J81 E;  2KT1 A;  3SWN C;  2EJG A;  3UAT A;  1QW1 A;  3KFV A;  3HFO A;  1UE9 A;  1W6X A;  2GNC A;  2FZC B;  3AHU A;  3VS5 A;  2BZY A;  4CC2 A;  2DBK A;  1ZUK A;  1I5L A;  5LJ5 g;  2EYW A;  3VKI A;  3VS1 A;  4OB0 B;  3OYL A;  1VQ5 Q;  3CC7 Q;  2MOX A;  1OZ3 A;  2DE0 X;  2J7I A;  2XD0 A;  1BCM A;  2MMP A;  2LC4 A;  4OB1 B;  4MDW A;  4C8Q C;  2LCS A;  4LXC A;  1Q81 U;  1QCF A;  2JW4 A;  4E7L A;  2KRS A;  4HCZ A;  3LYI A;  1KD1 U;  2Y4Y A;  3EG0 A;  3MEU A;  2J06 A;  3VU3 C;  5LJ5 d;  1K9M C;  1UJ0 A;  1QWF A;  2QDY B;  1SF9 A;  1KK7 A;  4ATO A;  5LJ3 e;  4WCI A;  2YUP A;  4XTW A;  4AFZ C;  2EYX A;  3EG9 A;  2XU8 A;  2ZZD A;  3FC3 A;  3CPW A;  3OS1 A;  4LUD A;  2QI2 A;  1VQ5 A;  2K6D A;  3CC7 A;  4XTU A;  2RQU A;  4GLM A;  5KCO A;  2GF7 A;  1D1C A;  1NJI C;  2EAY A;  2RMO A;  3EFO A;  3OSS C;  2L2P A;  4LNP A;  2D9T A;  4BAC A;  4LDX A;  4Y28 E;  4AFS C;  2V8K A;  4F7U E;  4IKF A;  5LL6 S;  1IXD A;  1M1G A;  1VYU A;  3LGF A;  4QW2 A;  1JU5 C;  4C92 C;  3CCR A;  1LPL A;  3JCM W;  5EG2 A;  5CAI A;  5CKD A;  1BI3 A;  1M90 C;  3EGD B;  1EIF A;  2O4X A;  2HCK A;  3S3N A;  1HK9 A;  1X6G A;  1UGS B;  2OJ2 A;  3JRZ A;  5GMK m;  5FU7 B;  1NLO C;  4OMF B;  3OYM A;  4J6Y A;  5KE3 A;  5KE2 A;  4QT7 A;  4JZ4 A;  4JUV A;  1MV0 B;  3EG2 A;  2KAF A;  4A4E A;  1HSQ A;  3GPL A;  1KQS A;  4X1V A;  1RAF B;  2COZ A;  2L0A A;  3CCV T;  5IAY A;  4M7A C;  2CT4 A;  1Q7Y U;  1FMW A;  5HY6 A;  5FU7 C;  4PFZ A;  3OBY A;  3GNF B;  1QQJ A;  3P8H A;  5I21 A;  4NL3 A;  2V1R A;  2QA4 Q;  1HXD A;  1M3C A;  3PVL A;  4PFO A;  2KXD A;  4LDV A;  3FLG A;  2VC8 A;  3M53 A;  3P8D A;  2IPO B;  2FZG B;  1YIT A;  1MND A;  1K4U S;  1X6O A;  3CCL T;  1I8F A;  3HP9 A;  3QWX X;  1Q82 R;  2CS7 A;  3CCJ T;  2JNG A;  1PC0 A;  1K9A A;  2CUB A;  4FYW B;  1M1K C;  2JT4 A;  5CKF A;  2CZ6 B;  2DER A;  2LMJ A;  4J9D A;  2C0T A;  2VB6 A;  3OS2 A;  5KYY A;  3RKX A;  4DBR A;  2JJ9 A;  1B7T A;  4BI8 B;  5KYX B;  4M75 B;  4M7D F;  2C06 A;  4FU6 A;  5IHI A;  3PIP A;  4DBF A;  1ZUY A;  1XJW B;  3D7S B;  5J3B A;  3CCL Q;  2DVJ A;  2QA4 A;  2IG0 A;  1HJD A;  4M75 C;  1XNI A;  3PIO A;  1OU9 A;  2NWM A;  2DNU A;  4R55 A;  3JB9 F;  2K57 A;  1EFN A;  1AOJ A;  1WI7 A;  4NS5 A;  2CKK A;  4L59 A;  3KBG A;  2DD4 A;  4II1 A; 
#chains in the Genus database with same CATH homology
 1VQP T;  4DA4 A;  2RK1 A;  5GAO q;  4B9X A;  3VYH B;  4JS4 A;  2QQB A;  1KHC A;  3T9N A;  2QXF A;  4IUR A;  2VYT A;  1R8O B;  4OVA A;  3M56 A;  4M78 F;  4HCC A;  2E12 A;  2DK3 A;  3O8V A;  3M4G A;  3CC2 T;  4MMK A;  2KK4 A;  3CXC A;  3MEV A;  2R5A A;  3QDR B;  2L3R A;  3NTI A;  5GAN 5;  1Y96 B;  3CCU A;  2PQW A;  2RHX A;  3CD6 A;  5GAM j;  1U8R A;  4C92 B;  5A0G A;  3OB9 A;  3MP6 A;  2XG8 D;  3TU4 K;  4ZTF A;  2QEX T;  2OAU A;  4V2S A;  5GAM e;  2RB6 A;  4N4G A;  4N0A A;  3BDL A;  5DLQ E;  3QSU A;  3CCE A;  3QO3 A;  5IT9 E;  5CQY A;  4KT0 E;  4M75 E;  5LJ3 h;  3FJP A;  3OW2 S;  1VQK A;  1N9R A;  3ZBD A;  1H64 1;  5GMK h;  1WPY A;  2L89 A;  3OYY A;  3LWH A;  3HKS A;  3OQ5 A;  1Q7Y C;  1B34 A;  3ASK A;  3QYG B;  2DEQ A;  1D3B B;  3FIF A;  4JRQ A;  2X35 A;  1N8R C;  3LLR A;  1NZ9 A;  4O5V A;  1KC8 U;  2JVV A;  3JAM E;  2JUF A;  3GP8 A;  1QVP A;  3QJ6 A;  4NOY A;  5FU6 C;  4X9D A;  3I56 T;  2D0Q B;  3EAE A;  4BI4 A;  1Y71 A;  2OTJ T;  4NL2 A;  3JB9 J;  1YBY A;  3QXE B;  4Q5W A;  3OYK A;  1W2B S;  2L8D A;  2WSC E;  3HRU A;  3ME9 A;  2M9U A;  4M7A B;  4PNO A;  4JDS A;  1JJ2 S;  3CC4 T;  3OYE A;  3KUF A;  3DB4 A;  3JB9 D;  3JB9 H;  4EMK B;  3C95 A;  3CBM A;  1G3S A;  5CQX A;  3CCM A;  1YIJ T;  3CPW S;  3OYD A;  1QVG A;  4E7H A;  3UT1 A;  2HNI A;  4RKU E;  1N9S A;  3I55 T;  3HSB A;  2BUD A;  2GFA A;  3LH0 A;  3CME T;  5LJ5 j;  1YJW T;  4X34 A;  3M4Y A;  4XQ3 A;  1G3Y A;  3MP8 A;  1UB4 A;  2ZGW A;  5IN1 A;  3JCM h;  4M78 D;  5GAM h;  2RM4 A;  1N27 A;  2I2L A;  2RHY A;  1YCY A;  4M77 B;  4QVC A;  4LD6 A;  4M7D C;  3CXC S;  3G4S T;  2PUO B;  2LTO A;  3A8G B;  1VQ5 T;  3CC7 T;  3QUI A;  4XTY A;  1VUB A;  4MZM A;  3RUX A;  3E1S A;  1YI2 A;  1VQM A;  1PSF A;  3C12 A;  3BY7 A;  2B8A A;  3PNW C;  3V8K A;  3JCM J;  4JRI A;  4M77 C;  1UEB A;  3CEY A;  3M58 A;  4C8Q D;  3QHS A;  1YJ9 T;  3C94 A;  1VQ6 A;  4FIB A;  5M9O A;  1BYM A;  1YHQ A;  3V7R A;  1WNL A;  4IUT A;  2QTX A;  2RHZ A;  3GF5 A;  2HQX A;  3RES A;  4A4K A;  3OYC A;  1TH7 A;  3ER0 A;  3HPW A;  1H3Z A;  1G5V A;  2VXE A;  4JRK A;  4HKE A;  4QQ6 A;  3VUZ A;  1KHI A;  3S6W A;  4B9W A;  4MDX A;  4DOW A;  2KVQ G;  3SB2 A;  3X25 B;  3CCR T;  1Q82 U;  4J6W A;  4M7D E;  3WVD B;  3LW5 E;  3SWN A;  4CRI A;  1Q86 U;  3OYF A;  2RA2 A;  3L2Q A;  1AHJ B;  3RIR A;  4BE1 A;  3JB9 G;  1M5Q 1;  2DTH A;  2YHT A;  3M57 A;  1UGQ B;  5J26 A;  5D6Y A;  5LJ5 h;  3JCM X;  1PSE A;  1X01 A;  4KUI A;  1XQH A;  4XAX B;  5LJ3 f;  3MEW A;  4C5I A;  5GMK j;  1NPP A;  1UGR B;  4M78 A;  4M75 D;  2R5M A;  3L42 A;  4M77 E;  1QVG S;  1I4K 1;  4OGE A;  4ZGE B;  3MCA B;  2BIV A;  2EJF A;  2DO3 A;  4QVD A;  5FRN A;  2AHJ B;  3OMC A;  2K5I A;  2KMT A;  4M78 G;  3G71 A;  2XDB A;  3GIB A;  1LNX A;  2E65 A;  3M5A A;  3L1A A;  1O75 A;  2DIG A;  2F69 A;  2ZPE B;  4PLI A;  4OB2 B;  3RMQ A;  1S72 T;  3PTA A;  2DZ9 A;  3X20 B;  4C8Q A;  3CMA T;  4PJO A;  1N6A A;  2ZPI B;  3VUB A;  2RI2 A;  1QVF A;  2R58 A;  2YLB A;  1KC8 C;  3OSV A;  3PFS A;  2PU9 B;  5GAO m;  1VQN T;  2F5K A;  1VQ9 T;  3RER A;  4MZT A;  4JS5 A;  2QQA A;  4ZTJ A;  1VQ4 T;  4FM4 B;  4PLL A;  2QQR A;  4C8Q G;  3DKM A;  1BI0 A;  2EKO A;  4N0A C;  3EFR A;  5FRO A;  2YLC A;  5J39 A;  3OYJ A;  3G6E A;  2O4X B;  1MHN A;  5CK9 A;  3JB9 I;  3OBW A;  2XDP A;  1BI1 A;  3UDC A;  3PT9 A;  2RD1 A;  3X26 B;  2LT1 A;  2RO0 A;  4Y91 A;  3OY9 A;  3OYH A;  4A4F A;  5A0L A;  3JCM f;  2LX9 A;  1YIT T;  1VQ8 T;  4QQG A;  4TVR A;  1VIF A;  2XID A;  3CCV A;  5GAN j;  2CGH A;  2EQJ A;  2DJZ A;  4C92 D;  4L6V 5;  3J80 E;  5LJ3 g;  5DLO A;  1VQ7 A;  4PL6 A;  3CCQ A;  5GAN e;  5DY9 A;  1FWZ A;  1X75 C;  2FB7 A;  2HQE A;  3JSC A;  1K73 U;  2P0Q A;  4XTX A;  3VV0 A;  2MI6 A;  1ZBX A;  2YRV A;  4KUL A;  4XK8 E;  4XU0 A;  4XU3 A;  1O9S A;  5CKE A;  5FU6 B;  3N5B B;  4PJO F;  4C8Q F;  4EPC A;  3G7Z A;  2RJD A;  5GAN 8;  3CCS A;  1UGP B;  4M75 A;  4P5N A;  2JZ2 A;  3A8H B;  3CPF A;  3QBY A;  4QQD A;  4F7U A;  3TCJ A;  3OYN A;  3EFS A;  1K9M U;  4IUQ A;  4HA8 A;  4UC4 A;  1Y7X A;  2X4Y A;  4F7U G;  3M59 A;  1VQO A;  1JBM A;  4XU1 A;  3GOX A;  1NE8 A;  3CCL A;  4WF2 A;  2DD5 A;  3RKY A;  2A3L A;  3Q1J A;  1KQ2 A;  4MML A;  3L2U A;  3DLM A;  3CCJ A;  2H3J A;  3QZ5 B;  1ZHI A;  5CKH A;  1FX7 A;  2DXU A;  3QKJ A;  1BIB A;  3RKW A;  1XTD A;  5LJ3 d;  1K8A U;  2QQS A;  2DZC A;  2MWO A;  4EMG A;  2LT4 A;  4A4G A;  4JLI A;  1BI2 A;  2MF2 A;  4M7A D;  3NFC A;  2V8I A;  4QVZ A;  2EQM A;  4RCC A;  1JB0 E;  4M7D B;  3PGG A;  5CKB A;  2XDD A;  1WJQ A;  4L5G A;  3MHX A;  4MZP A;  3JCM g;  3UWN A;  3V8L A;  2KDS A;  5GAM g;  4M75 F;  4ZN1 A;  3E19 A;  3M55 A;  4F7U F;  2RI3 A;  4FT4 A;  2QA4 T;  1QVF S;  2ZPH B;  2VXF A;  2DPP B;  1Y07 A;  4OF1 A;  4HT8 A;  2KSS A;  5LJ5 f;  1YJN A;  1W4S A;  1Q82 C;  5CCA A;  2E10 A;  5GAN h;  4E47 A;  2GCX A;  2RK2 A;  1QP3 A;  3TEE A;  3OA6 A;  3H8Z A;  5CVI A;  4BUG A;  4C92 A;  1M1F A;  1Q86 C;  3A8M B;  2E64 A;  2XHC A;  2FHD A;  3URG A;  1NJI U;  3HL8 A;  4GY5 A;  4J6X A;  2X4W A;  3QJY A;  2WSE E;  5CIU A;  4A54 A;  2EIF A;  4C92 G;  2O01 E;  5GMK l;  1VQL A;  4A4H A;  2HBP A;  2PVO B;  1V29 B;  1WJS A;  2EQK A;  1BKB A;  1LJO A;  2ZPF B;  5GAO n;  3S3O A;  5I2M A;  3CCU T;  3CD6 T;  4PJO D;  4J7F A;  2FL7 A;  2PUK B;  4M78 B;  4DOV A;  5GAN 6;  3JCM d;  2F5T X;  5GAM d;  1D3B A;  3NTK A;  2OTL A;  3OS5 A;  3J81 E;  3SWN C;  4C5G A;  2EJG A;  5GAN 3;  1VQP A;  3C4S A;  1QW1 A;  3CCE T;  3ZEH A;  3HFO A;  2Y4X A;  2E41 A;  2NLU A;  3L2Z A;  4J5Y A;  4BDY A;  3HRT A;  1M90 U;  1VQK T;  3SDZ A;  3AHU A;  2RJF A;  4C92 F;  5A0D A;  2KY9 A;  2VGM A;  3CC2 A;  2XK0 A;  4M78 C;  3V7S A;  3MET A;  2LQ8 A;  4N4I A;  4M7A A;  4KBM B;  5C0M A;  1BIA A;  2PVG B;  4FSX A;  5LJ5 g;  3X24 B;  4C0D C;  1I5L A;  3VKI A;  4EDU A;  1NPR A;  4EMK A;  4OB0 B;  2QEX A;  3OYL A;  4M7A G;  3M54 A;  2VUB A;  5HKC A;  1OZ3 A;  2XD0 A;  2MMP A;  3GNG A;  1KQS A;  3LX7 A;  3FRN A;  1OYX A;  4GLK A;  4ZGD B;  5FRM A;  1M8V A;  3QZ9 B;  2LC4 A;  4OB1 B;  2WAC A;  4J7I A;  4MDW A;  3ZFJ A;  4C0F A;  4C8Q C;  2FVU A;  5A2Q E;  4BE2 A;  1KG1 A;  3CCS T;  4IUV A;  1Q81 U;  2HAX A;  1JRI A;  4E7L A;  4HCZ A;  4ME7 A;  4BD3 A;  1K73 C;  2RJE A;  1G3W A;  3LYI A;  5DM7 R;  3CCM T;  1KD1 U;  2Y4Y A;  2EWN A;  5CR2 A;  4BI3 A;  4M7A F;  4JJN K;  3I56 A;  3M9Q A;  4R56 A;  3MEU A;  2OTJ A;  1FXX A;  3WVE B;  4M78 E;  2K2V A;  3VU3 C;  5I2S A;  3J7A F;  1QP2 A;  5LJ5 d;  1K9M C;  3P8B B;  2X4J A;  1B34 B;  4ZGJ B;  4FT2 A;  1G3T A;  2VGN A;  2FYK A;  2QDY B;  3OS0 A;  3UPU A;  2JN0 A;  3CC4 A;  1P92 A;  2P0P A;  4ATO A;  5LJ3 e;  4PJO G;  1I81 A;  4E7J A;  2ZPG B;  2X4X A;  5CO7 A;  4EMH A;  4XU2 A;  1W2B A;  1RI0 A;  1KD1 C;  1YI2 T;  1VQM T;  4XTW A;  3X28 B;  3L2W A;  1YIJ A;  3R6O A;  5D6W A;  1JJ2 A;  3I55 A;  4HCB A;  2XU8 A;  4M77 F;  3MP1 A;  5KCH A;  3CME A;  2ZZD A;  3FC3 A;  4BY6 B;  4C8Q E;  5GAM f;  2CZ7 B;  3E9G A;  1YJW A;  3DLL A;  1RL2 A;  1VQ6 T;  4LDU A;  3H6Z A;  3CPW A;  3OS1 A;  1M1K U;  3QG1 A;  2QI2 A;  5HK3 A;  1SSF A;  3LWI A;  1VQ5 A;  3G4S A;  3CC7 A;  3DB3 A;  3E9F A;  4LD9 K;  5L8R E;  5GAO l;  4XTU A;  4PKC C;  2DXC A;  5AYF A;  5GAN 4;  4BY6 C;  5KCO A;  4ELZ C;  2EQU A;  3SFM A;  2P4T A;  2E5Q A;  2GF7 A;  3JCM P;  2E6Z A;  2R57 A;  4JRP A;  4M75 G;  2XIC A;  4OGC A;  1YJ9 A;  4BDZ A;  2EAY A;  2KQW A;  1NJI C;  4RCB A;  1IRE B;  3OSS C;  4IUU A;  1U1S A;  1KQ1 A;  2DTI A;  3INZ A;  3JCM e;  2XI9 A;  3VJP A;  1DJ7 B;  1WJR A;  2D9T A;  5GAO p;  4BAC A;  4LDX A;  5GAO r;  4Y28 E;  4N4H A;  2V8K A;  3V8J A;  5FLX E;  4F7U E;  4IKF A;  5LL6 S;  1M1G A;  2XKO C;  2K5F A;  3LGF A;  4QW2 A;  3OYI A;  1VIE A;  4C92 C;  3CCR A;  4ZN3 A;  3G71 T;  3JCM W;  5EG2 A;  5CAI A;  5CKD A;  2LDM A;  5GAN 2;  4M7D D;  3QYH B;  2M16 A;  3FDR A;  4LDW A;  1BI3 A;  4J83 A;  1M90 C;  5GAN g;  1EIF A;  2O4X A;  3L2V A;  4D6W A;  3S3N A;  2RH2 A;  1XOV A;  3F70 A;  3JCM V;  1Y96 A;  3WXM B;  1HK9 A;  4BB7 A;  1UGS B;  2CZ1 B;  3TRE A;  4M77 D;  2LNV A;  3HRS A;  4XTV A;  3PMT A;  3KXT A;  4BE0 A;  3JRZ A;  5GMK m;  4LDY A;  3SWN B;  5FU7 B;  5KH6 A;  3G6E T;  4Z02 A;  1GXI E;  4E7K A;  4OMF B;  3QII A;  2L5Q A;  1WQW A;  2LVM A;  4OB3 B;  3OYM A;  2LCL A;  4J6Y A;  2EJ9 A;  5KE3 A;  5KE2 A;  2LQK A;  3JCM b;  2G3R A;  3NTH A;  4JUV A;  2CYZ B;  2KAF A;  2PVD B;  3CBP A;  5D6X A;  4A4E A;  2BKD N;  3GPL A;  1S72 A;  4XTZ A;  4ELY C;  2JTM A;  2RI5 A;  3PMI A;  1Q81 C;  4M7A C;  3CCV T;  5IAY A;  3CMA A;  4C92 E;  1Q7Y U;  1VQN A;  4JLG A;  5GAN d;  5HY6 A;  5LJ5 e;  5FU7 C;  3VYG A;  4EMK C;  4C5E A;  2ZCF B;  3BW1 A;  4C0D B;  4J8O A;  4DQ2 A;  3CCQ T;  1VQ4 A;  1VQ9 A;  4RMO A;  4HT9 A;  3OBY A;  3GNF B;  1N8R U;  3P8H A;  5I21 A;  2M1H A;  4NL3 A;  1HXD A;  2D6F A;  3FEO A;  3BFM A;  1WQ7 A;  2EFI A;  1WGS A;  2LCC A;  1MGQ A;  3FB9 A;  2VV5 A;  4IUP A;  3FLG A;  4LDV A;  2VC8 A;  3M53 A;  3P8D A;  3V7C A;  1ZQ1 A;  2GQV A;  4C8Q B;  4PJO B;  1YIT A;  1VQ8 A;  3CBO A;  2RJC A;  1OI1 A;  2MWP A;  2P0K A;  1VQO T;  2EYQ A;  4M7D A;  1X6O A;  4RG2 A;  4YTL A;  3JCM Q;  2JOY A;  5GMK i;  3JCM c;  3CCL T;  1I8F A;  1U1T A;  3HP9 A;  2V8J A;  2DXT A;  2CS7 A;  4M7D G;  3CCJ T;  2WSF E;  2JNG A;  4E7I A;  2E6N A;  5GAN 7;  4PJO C;  3GLX A;  1M1K C;  4M7A E;  3L2R A;  4M77 A;  5CKF A;  3MEA A;  2CZ6 B;  3OW2 A;  2Y90 A;  1LOJ A;  3OMG A;  3QPH A;  3SD4 A;  2DIQ A;  2E1H A;  4M77 G;  1IZ6 A;  2RHI A;  2GFU A;  3OS2 A;  2DAQ A;  5HK0 A;  2HD0 A;  3RKX A;  2CZ0 B;  3A5Z B;  3HFN A;  5C6S A;  1YJN T;  4BI8 B;  2ZPB B;  3A8O B;  4X9C A;  4M75 B;  3LGL A;  4A53 A;  4C0G A;  2M0O A;  4F7U B;  4CI0 C;  5LJ3 j;  4M7D F;  2MAM A;  4O6J A;  3OYG A;  2C06 A;  4FU6 A;  4OP0 A;  3HHT B;  3OYA A;  2K4Y A;  2DTO A;  3MO8 A;  4FL6 A;  2A7Y A;  4C5H A;  3PIP A;  3OYB A;  1KQS S;  5GMK e;  2JTF A;  2LRQ A;  3A8L B;  4KUD K;  5J3B A;  2QQ9 A;  1OZ2 A;  2QA4 A;  2K5L A;  2IG0 A;  1VQL T;  2RHU A;  1K8A C;  4M75 C;  1XNI A;  2E70 A;  1M4Z A;  2IVW A;  2DVE A;  3PIO A;  2DXB A;  3S3M A;  4PJO E;  1M9S A;  2K3X A;  3BDU A;  4R55 A;  2K57 A;  3JB9 F;  5GAN f;  2DKG A;  2K3Y A;  4NS5 A;  1YHQ T;  3RMS A;  2CKK A;  4L59 A;  1VQ7 T;  3KBG A;  2OTL T;  4C0Z A;  2DD4 A;  4RG8 A;  4VUB A;  4II1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...