2BIVA

Crystal structure of the wild-type mbt domains of human scml2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
DFHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQMNTSSWPMFLLKTLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SEX COMB ON MIDLEG-LIKE PROTEIN 2
publication title The Malignant Brain Tumor Repeats of Human Scml2 Bind to Peptides Containing Monomethylated Lysine.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2bivA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2bivA01
3LX7A 2LTOA 5J39A 3MEWA 3FC3A 3META 2DIQA 5FROA 1G5VA 4CRIA 2RHIA 3LYIA 2XK0A 3FEOA 3MP6A 4HCZA 2E6NA 4PLIA 2L3RA 3MEAA 3BDLA 3OMGA 4BDZA 3OS2A 4E7LA 2L8DA 4GY5A 3OYLA 3OYIA 4PLLA 4Q5WA 4IUVA 3P8HA 2L89A 3S3MA 2R57A 3E9GA 3NTKA 4C5GA 4FU6A 1KHCA 3UT1A 4BD3A 3ASKA 2IG0A 3P8DA 2RJFA 2F5KA 2M16A 5KCHA 2CKKA 4FL6A 4N4IA 1WJRA 4PL6A 3SD4A 1MHNA 4QVZA 3L2VA 1WJSA 2M1HA 2PQWA 4RG2A 2YRVA 1RI0A 3DB4A 3S6WA 4BE0A 4II1A 3OS1A 5FRMA 2RHXA 4C5EA 2O4XA 2P0KA 3ME9A 2HQEA 1OI1A 4IUTA 3LLRA 4A4GA 2LCCA 5KCOA 3MO8A 3OYBA 2EQMA 2QQSA 1XNIA 2R5MA 3E9FA 4N4HA 4QW2A 4UC4A 4EDUA 5IN1A 4E7IA 3F70A 3MP8A 4A4EA 2JTFA 2FHDA 3DLMA 5M9OA 4IKFA 2D9TA 3L2QA 2RI5A 3PMTA 2GFUA 2M0OA 2RI3A 5KE3A 3S3NA 3KUFA 4OVAA 4B9XA 1H3ZA 4E7JA 2RJDA 4LD6A 5C0MA 3OB9A 3QKJA 3M9QA 3GOXA 3OQ5A 4IURA 3LH0A 2HQXA 3OYEA 2RHUA 3UWNA 2LVMA 4E7HA 2EQJA 2BKDN 2X4XA 2GFAA 3NTHA 4B9WA 5IAYA 2DIGA 3L2RA 2O4XB 2RJEA 3QIIA 2E5QA 3QJ6A 3CEYA 5KE2A 2G3RA 2DAQA 3PFSA 2VYTA 4L59A 2K3XA 3DB3A 2EQUA 2X35A 4X34A 1WGSA 3LGLA 3OYHA 3OYGA 3ZEHA 3OA6A 3Q1JA 3OY9A 5KH6A 3LGFA 3OS0A 3L42A 2NLUA 1SSFA 3OYKA 3MEUA 4IUQA 4NS5A 2RHYA 2GF7A 2XDPA 2RJCA 4BE1A 2X4YA 5D6XA 2RHZA 4QQGA 2BUDA 5FRNA 4BACA 3PNWC 5D6YA 1OYXA 3OYJA 2R5AA 3O8VA 3L2WA 3OMCA 3OYCA 2R58A 3C4SA 3MEVA 4C5HA 2BIVA 2RO0A 1OZ3A 2B8AA 3FDRA 3L2UA 2MWOA 4N4GA 3OYAA 3OYFA 2K3YA 3PMIA 2JZ2A 2LRQA 3NTIA 4BDYA 3FLGA 4ZTFA 2EFIA 4C5IA 4BE2A 1WJQA 3MP1A 5D6WA 2RI2A 3QBYA 3H6ZA 4Z02A 3OYDA 4E7KA 3S3OA 5CIUA 4A4FA 3OYNA 2QQRA 2EQKA 2MWPA 4QQDA 4IUPA 3EAEA 4IUUA 2EKOA 2LDMA 5C6SA 4ZTJA 2WACA 3OYMA 1OZ2A 3H8ZA 1N27A 4A4HA 4QQ6A 2X4WA 5J26A
chains in the Genus database with same CATH superfamily
2LTOA 1KIKA 3RMQA 4HCZA 2E6NA 4PJJA 5A0GA 3I35A 3I9QA 4DEYA 4R56A 1MNDA 5FWCA 4LXCA 3VS5A 4ATOA 2JXBA 3LWHA 3LWIA 1VQ8A 3T9NA 3EG0A 3EHRA 3KXTA 4BD3A 2O31A 3P8BB 1OU8A 4XU2A 4FM4B 1WYXA 1R0CB 3DB4A 2JT4A 4MZTA 4PJOC 2O4XA 2DM1A 1N8RU 1D1BA 2KXCA 4A4EA 2QEXT 1OEBA 1X6BA 4KUIA 2JOYA 1UHCA 4J5YA 1VQ4Q 1JO8A 3EGXB 5J3BA 4OGEA 1UFFA 4JS5A 1IZ6A 4EMGA 1WHMA 4Y92A 1TS9A 3HTRA 4AFUC 2P4RA 1P92A 2DAQA 2LJ3A 4A53A 4KH0B 4DOWA 1U1TA 4C8QG 2EBPA 1RUWA 3OSSC 3HRUA 1WNLA 4NS5A 3WXMB 4M78F 2GF7A 2X4YA 5D6XA 1PD1A 2MOXA 5HY6A 4C92D 1Z9ZA 1Q86U 3CCLA 2ZZDA 2XD0A 3VS2A 1YI2A 4OB1B 1QVGP 1KQ1A 2WSCE 4J9GA 2EGCA 1NPRA 1WXTA 5GJWB 4ZNXA 3NTIA 3M0PA 3VKIA 2GNCA 3EGDB 4NOYA 1AWOA 1AOJA 3CCJT 3G6EA 1IRXA 1KG1A 2D0NA 3M55A 1PRLC 3CD6A 2DLPA 4RTVA 3CCEA 5J39A 1VQMT 1HK9A 2KT8A 1WDXA 2JM9A 2VGMA 4N0AA 4X1VA 2LQNA 3P8HA 4DBQA 1WXUA 2R57A 2PVGB 1RLQC 1T3LA 4C0GA 3NTKA 1VQ7A 4Z88A 2QQ9A 2VKNA 4M75B 1HD3A 2D8JA 4RG2A 1QWFA 1M1FA 1MUZA 3CXCS 4PFPA 3LLRA 3RIRA 1D0YA 4XTUA 4JUVA 1T0JA 3L2QA 3SB2A 4PJOD 5KE3A 3EG3A 1TUCA 4M7AE 1VQNT 1NBEB 5GANj 2GGRA 3LH0A 1Q81U 2OTLT 2K7AA 3OBYA 3A5ZB 3HL8A 3NTHA 2DD5A 5CAIA 3JB9D 4M75E 4OF1A 5HK3A 4X9CA 4FW2A 1M90R 2OTJT 1ZUYA 3FIFA 2M0YA 1G3TA 4BI4A 3URGA 2J6KA 3EGUA 5HK0A 1ZSGA 2H3EB 1X2QA 1GXIE 2NUPB 4QQGA 5IXBA 3N5BB 2BE9B 3CMEA 4M77E 4P5NA 2K2VA 2NUZA 3OYCA 4FT4A 3CCUA 2FZCB 4Y28E 2QEXQ 2KYBA 2RB6A 2LRQA 3JCMg 2DVJA 4C92G 3QBYA 2DTHA 5CO7A 4M7AC 3X24B 2D1XA 2PVOB 2YUNA 4L5GA 1OZ2A 4QQ6A 1K0XA 4M75C 1BCOA 4CRIA 3G4ST 2PNIA 1YJNT 2YXYA 3TCJA 2L3PA 1YHQA 1KD1R 2L3RA 4CC7A 1VQKQ 1JJ2P 3QWXX 1J3TA 3REAB 1N6AA 1QCNA 5HKCA 2O9SA 1HSQA 1SEMA 5FU6C 3TQ7P 1SF9A 2XDBA 4M77C 5KCHA 2C06A 4FL6A 2E4HA 2CP5A 2KRNA 2KXDA 3EH2A 3S6WA 3OYBA 4TVRA 1JQQA 2FHDA 2M9UA 5EC7A 4IKFA 3CCSA 3CCJQ 4ORZA 4PFZA 2ZPHB 1VQMQ 4XU1A 4HT8A 4J6YA 1EIFA 3GF5A 2NUTA 3G71T 2F69A 2EVRA 2RJEA 1MNEA 2ABLA 1YIJA 4OMPA 2EJFA 1VQ5A 3QZ5B 1XTDA 1BYMA 4F7UE 1YWOA 3C95A 2KR3A 2E3HA 4PJMA 1NJIU 1CKAA 4JS4A 4M7DE 1K9MC 5FLXE 1Y96A 1TSFA 4WF2A 3TVTA 2BZYA 1G2BA 2GBQA 2RN8A 4M7AF 3HP9A 2JMAA 5I21A 3CC4A 2RQVA 3I56A 1M8VA 3DKMA 4E7KA 1VQNQ 2B86A 2GCXA 4M75F 3SWNB 1QVGA 2OTLQ 2WSFE 4JJDA 2DILA 2J6FA 2D0QB 2AZSA 2RK1A 1N27A 1YFNA 4A4HA 1QVFP 2XU8A 1YWPA 8ATCB 2KDSA 3KBGA 2OTJQ 1E6HA 4C8QB 3OMGA 2JM8A 4MZMA 3R6NA 1ZSZC 1XOVA 3FJ5A 3EG1A 4GY5A 4M77F 2JUFA 1YCYA 4PLLA 2VB6A 3L1AA 1LJOA 1OQKA 2GQVA 2ROLA 4M7DC 2KGTA 2PUKB 1WZOA 3A8GB 2RJFA 2CKKA 4LDXA 4O6JA 3NPFA 5IHKA 2HQEA 1V29B 2EQMA 2RQTA 3JCMc 4PNOA 5M9OA 5L23A 1UDLA 2YLBA 5IH2A 2GTOA 3VS7A 1KJWA 1BI1A 2A7YA 5GANf 2FRWA 1ABOA 1I5OB 2E41A 4BY6C 3OB9A 2Y90A 1G3SA 3G4SQ 1YJNQ 2M02A 2SEMA 1B7TA 2GFAA 3ZFJA 5IAYA 4QVDA 3C12A 3JCMQ 2EGEA 1MV3A 1E7OA 1U8RA 2MMPA 3V8LA 2MIOA 1H641 4OMNA 2VASA 2QI2A 1OX9A 2JN0A 1VQ6T 5AT1B 2DXTA 2KAFA 2DNUA 1D1AA 4F17A 1G8XA 1Q7YR 1S72A 4FYVB 2XHCA 2B8AA 3EFOA 1KC8R 4BDYA 1D3BA 4HCBA 3X20B 2CREA 2FPDA 1QP3A 3HRTA 4DBFA 3G71Q 1K73R 1RAEB 1MMGA 3PT9A 4ZTJA 2MI6A 3QDFA 3LYIA 1SRMA 4F7UF 3LGLA 3OS2A 2DVEA 2DL8A 3HHTB 2DL5A 3TU4K 2HKQB 1AHJB 3EG2A 1RAFB 4ANJA 3HKSA 3OW2P 2KRMA 4RCBA 2CZ7B 1M3CA 1RACB 1IGUA 4HVWA 1ZBXA 2LX9A 1JJ2A 2LQKA 1ARKA 1MHNA 4RTUA 4EMKC 4BE0A 2AK5A 4M7DD 1AWJA 5LJ3f 3QYHB 4LDYA 2K4YA 5CQXA 2E3IA 4C92B 2D9TA 3CC2A 4LDVA 3H41A 2M51A 4B9XA 4V2SA 3CCQA 2DFUA 2FPEA 1KC8C 1W1FA 1ZX6A 1G83A 5AYFA 1OX8A 3JCMV 1IGQA 2EQJA 3PTAA 1K8AC 1I8FA 3CD6T 1AZEA 5LJ5g 4L59A 3I55A 2HCKA 1PCXA 1K9AA 3CCRT 1D0ZA 1M2OA 3BW1A 4J9DA 2DJQA 1BU1A 1OULA 5I2SA 2QXFA 2ZPIB 4IUQA 2MPXC 4WCIA 4B6MA 3M53A 5GAMg 1NYGA 1U1SA 3JCMe 3NHNA 2PVDB 4L6V5 4C8QF 3OYJA 1D09B 1PC0A 3RNJA 4JRIA 2VWFA 2YWWA 4J6XA 2MYSA 5IXFA 4J8OA 1NPPA 3RMSA 1NZ9A 4KGVB 3CCVQ 2QDLA 2JS2A 5I11A 2RF0A 3TEEA 3JB9I 2HD0A 3V8KA 3R6OA 3CMAA 3MEAA 2A36A 2CT3A 3OYYA 1GCPA 4PJOA 5GMKl 1VQ6Q 1M2VA 1ABQA 2LJ1A 4M78C 2I0NA 5KYNA 4PLIA 5CQYA 2FRYA 1GL5A 2JS0A 1QVFA 2EJGA 3A1PA 5GAOm 3RBBB 2FB7A 2L8DA 3VS6A 2O01E 2DYIA 4J9BA 2OJ2A 2L89A 4JRKA 2J05A 1ZUUA 1WPYA 2DL3A 2HBWA 5LJ5d 5GAOl 3UT1A 5CKBA 4JZ4A 4CC3A 4N4IA 4HKEA 4QVZA 1WJSA 2M1HA 2PQWA 1WHKA 3PVLA 5LJ3e 4NL2A 4ELZC 4UC4A 3E9FA 4IIOA 5GAMd 4PJLA 2J7IA 1FMKA 2M0OA 2DZCA 3QPHA 1Z9QA 1WHJA 2EYQA 2YRCA 2K6DA 2C0OA 4Z89A 1Q82C 2CH4A 4B9WA 3NMZC 3RKWA 2O4XB 1H3HA 1Y7XA 2LCSA 4RTZA 4HT9A 4EPCA 5A2QE 4ESRA 1VQ9A 1V76A 2NLUA 1UHFA 1UB4A 4R0KA 1YNZA 2DXCA 2R5AA 2X9HA 3C4SA 4GLKA 3CCLQ 1FMWA 1YI2Q 3OYAA 2LJ0A 4FYXB 5LL6S 4XU0A 3GBQA 2QQRA 1YJ9T 2EQKA 1VQKT 1FYNA 2ZGWA 2LT4A 1BI3A 2KRSA 4FCYA 1GBRA 3CCST 3V7CA 2A08A 2L3SA 4C92F 4O5VA 3CD6Q 2DIQA 3CCEQ 2D8HA 1N8RC 1TUDA 3CCRQ 3PVQA 2X4JA 4FSSA 4GLMA 3JCMJ 4DA4A 2CZ6B 4BDZA 2HMAA 3CXCP 3OYIA 4KGXB 1AD5A 4M78D 2DL7A 4X9DA 4KULA 4RMOA 3OW2A 3UDCA 3SHWA 3VRZA 3EFRA 1ZBJA 1JXOA 1B07A 1OI1A 4AT1B 1X2KA 3RERA 2R5MA 3F70A 2LC4A 2JTFA 3VJPA 1BKBA 3HPWA 1I81A 1X75C 4VUBA 2DL4A 2AHJB 1GBQA 9ATCB 3I56T 2JNGA 3M9QA 2CH4W 3OQ5A 1Q86C 4LNPA 1AWWA 4E7HA 4PK4A 2X4XA 1IREB 3L2RA 3QIIA 4M4ZA 4RTTA 1GCQC 5HCKA 4QKUA 4D6WA 4F16A 3M0UA 2JTMA 3X28B 3LGFA 2V8KA 1AZGB 3J81E 3L42A 2PU9B 2PUOB 1C1AA 3OYKA 4LE9A 1VQOT 4M7AA 1IXDA 4FT2A 1Y0MA 2AT1B 2KBTA 3JB9H 1OV3A 2DMOA 2BUDA 5FRNA 1VIEA 3RKYA 1WLPB 3L2WA 4KBMB 1KSWA 4AMCA 5KYXA 2BIVA 3FDRA 3CCUQ 2K3YA 1WIEA 3PIPA 2XI9A 2CP0A 3CCMT 4F14A 2DYBA 3U23A 1QLYA 3G7ZA 4GBQA 3OYNA 4JJNK 3OS5A 3H9NA 3JCMb 3HSBA 2COWA 2LDMA 2QGGA 4J7FA 4M77A 5CKHA 3VS4A 1LVKA 2OAWA 2X4WA 1S1NA 3RKXA 3MEWA 3A8OB 1W6XA 4YTLA 1RABB 2BTTA 2L0AA 4JJBA 1BIBA 5GMKi 4KUDK 4LN2A 3MJXA 4A4KA 1BI2A 1WHGA 2BZ8A 4E7LA 1TWBA 2KROA 3QG1A 3VS3A 4FU6A 4BB7A 2YT6A 2VVKA 1M90U 4PKCC 2LX7A 5DLOA 1UECA 3E19A 2LT1A 2P0KA 2CP3A 2QQSA 3CC7A 1YJ9Q 2LQWA 2F2VA 1K9MR 2GFUA 3CPWS 4D8KA 5GMKh 5LJ5h 1JXMA 3CCSQ 1PSEA 5LJ5e 1D1CA 1Y71A 1KFZA 1U3OA 4EIKA 2H3JA 2QEXA 5GAMh 3J80E 5GAMe 1KQSS 2QA4T 4MMLA 1BB9A 4LUEA 1WGSA 2DO3A 2FO0A 1IO6A 3Q1JA 5KH6A 5LJ3j 1GRIA 1ZA1B 1KD1U 2YLCA 1VQLT 2NUTB 4PJOG 2FYKA 1LCKA 4XTZA 3PE0A 4HVUA 3PIOA 3THKA 4OMMA 3L2UA 2MWOA 4OP0A 3OYFA 2DTOA 3M0QA 1ZSZA 4F7UA 4ZTFA 3H6ZA 3I56Q 3JB9G 5CIUA 2KK4A 2SRCA 4M7DA 2E1HA 3RESA 5LJ3h 1Y96B 4Y91A 3M56A 3GLXA 2QYZA 5GAN2 4AFZC 4XTWA 4DEXA 1W4SA 3G1JA 2JW4A 2EYZA 2QQBA 3BDLA 4CC2A 2RA2A 4QVCA 5IT9E 1VQOQ 4XK8E 1VQPT 1KHIA 1VQMA 3J7AF 2DX1A 2JVVA 1HJDA 1MMAA 1W70A 2CS7A 3CXCA 4JLIA 1BI0A 2YUPA 3E2UA 1B34A 2HDAA 4M7AD 1OPLA 5GAN5 1NEGA 3CCMQ 1XNIA 2JJ9A 1QMCA 3OBWA 1NJIC 4R55A 2V26A 4M75D 2V8JA 5GJVB 4E7JA 5CCAA 4LD6A 2X3WD 4ZGJB 3EH1A 2HQXA 1JEGA 1M30A 3VS1A 2LQ8A 4HCCA 1UUEA 2FZKB 1X6GA 3REBB 2EQUA 2X35A 3WVDB 1PKTA 3V7RA 3OA6A 4M77D 1R77A 2YUQA 2OTLA 3QSUA 4C8QE 3KFVA 1X69A 1UGVA 1SHFA 1WX6A 1UGPB 1C0MA 2RH2A 2V8IA 3CCVT 5I22A 2AKLA 3H0FA 2CP2A 4HCKA 3HRSA 3TSZA 1FMVA 2OTJA 3RUXA 3AHUA 2L5QA 2COYA 2VC8A 2RPNA 2XIDA 1YJWT 3HFNA 1MMNA 2QGFB 2RI2A 3OYDA 3S3OA 2YRDA 2L2PA 3SWNC 1G3WA 1QCFA 1UEBA 1H92A 2CGHA 3M0TA 3JCMf 2MCNA 2DKGA 1TUGB 2P0QA 2QA4Q 1XQHA 1VUBA 5GAOp 4EMKA 2DEUA 2HEQA 1VQ8T 2EYYA 5GAOr 1DJ7B 3EFOB 2FEIA 3FEOA 4J9FA 3MP6A 4EMHA 3SEMA 5FU7B 4C8QC 4C0DB 2BE7D 4AFQC 2HNIA 2MAMA 1VQLQ 2DF6A 2HBPA 3V8JA 2ESWA 1YJNA 1K8AR 2LP5A 2KVQG 4E7SA 2A0FB 1NG2A 2Y4YA 2Z0WA 4IIMA 3SD4A 3CPFA 2VXFA 2ED0A 2LNHB 6AT1B 1Y07A 2LCCA 3MO8A 4E7IA 4QW2A 3AT1B 3CBPA 1Q7YU 2W0ZA 1RAGB 2RI5A 2X3XD 1IB8A 3KUFA 4OVAA 1JU5C 1QKWA 3QKJA 2AIRB 3OYEA 1SHGA 4OMOA 1KC8U 1M1KR 1YBYA 3VV0A 3ZL7C 3VRYA 1WFWA 1ZQ1A 3QJ6A 1VQPQ 4JDSA 1K73U 3E1SA 3CCLT 4ME7A 1NEBA 1YI2T 3G71A 2G6FX 1LPLA 3VYGA 1EZZB 5GAOn 4M77G 3M0RA 1KK7A 1WA7A 2F2WA 1O75A 1WHHA 2KI7A 5FW9A 2R58A 5LJ5j 1CKBA 1AWXA 1M1GA 4OGCA 2E65A 4J83A 4M78A 3G6ET 5KYYA 2K3BA 1NM7A 3CCET 5D6WA 4Z02A 2O88A 1T0HA 1T3SA 4Z8AA 5GAMj 1TTHB 2Y4XA 4C92E 1HXDA 5KYUA 2YUOA 1M8MA 5KYWA 1YN8A 2OX7A 1M5Q1 5IHIA 3SFMA 2CUBA 1SKUB 5J26A 2DXBA 2C0TA 1LOJA 2EYXA 3META 1FX7A 3M58A 1VQ7T 1TU0B 2DXUA 1M1KC 2IPOB 4FSXA 2DZ9A 3M54A 2X51A 2RK2A 1Q82R 3HFOA 3JRZA 2EWNA 3UA6A 1TG0A 3JSCA 4C8QD 3ASKA 3A98A 2F5KA 2M16A 4FIBA 4PL6A 3ULRB 1YJWQ 1B3QA 1AVZC 4PJOB 3QWYA 1M2VB 4A54A 5KCOA 2QDYB 2ENMA 4K11A 3MP8A 3SDZA 1OU9A 2A3LA 4C92C 3EG9A 2AZVA 2IVWA 2EPDA 4A63B 2KYMA 1QW1A 1VQ8Q 1GFCA 3H0IA 4F04B 5CK9A 3QO3A 4AG1C 1HYOA 3BFMA 4JZ3A 2E5QA 3CEYA 2RQRA 5CKFA 3CMET 1YP5A 2VXEA 2ZAEA 4M7DG 3EHQA 3CCUT 1YITA 1AEYA 1N8RR 3JV3A 2H8HA 2RQUA 5CKDA 1VQ6A 2DK3A 2LZ6B 3MEVA 2HZYA 3A8HB 4N4GA 3UPUA 2EFIA 3MP1A 5GAN6 4ZGDB 1YHQT 4FW1A 3MHXA 3CC7T 4IUPA 3EAEA 5I2MA 4IUUA 5C6SA 1QKXA 1D0XA 2A28A 3M5AA 4RTYA 4QT7A 2YDLA 2DE0X 1TXQA 1SPKA 1Q86R 3CBOA 2DRKA 1VYUA 1W2BS 2CP7A 1RAAB 2W10A 2JTEA 1RL2A 1WQ7A 5CR2A 2K79A 3EGXA 4C5GA 4RCCA 1NYFA 5DM7R 4ZN3A 3QDRB 3G6EQ 2K9GA 4II1A 3RDVA 1GCQA 4C5EA 4LD9K 2HKNA 2F2XA 2RMOA 2WSEE 4LDWA 1YIJT 3S3NA 1VQ4A 1QQJA 1VQ5T 2P4TA 3L2ZA 3UF4A 3BY7A 1G3YA 1R0BG 2E12A 1VQ7Q 2DRMA 4XTVA 5KE2A 1RAHB 2E5KA 5L8RE 2EW3A 3M4GA 3GNGA 3MCAB 3VUZA 4X34A 2DBKA 3M0SA 3OS0A 2K5LA 3EGDA 3C0CA 1UJ0A 3MEUA 2CUDA 1JB0E 3CC4T 2BZXA 1PG5B 2RHYA 2XDPA 4OMFB 3UATA 3NGPA 1WXBA 5LJ5f 1FWZA 2PTKA 4BACA 5D6YA 3CCRA 2E64A 4AG2C 2NYSA 4C0ZA 2EIFA 1X43A 2CSIA 4XTXA 5GAMf 1MMDA 1Q81R 2P0PA 4KT0E 2D6FA 4A4FA 1PRMC 1O9SA 4M7AB 4PJOF 4HXJA 2E70A 5GAOq 1QVGS 4C5HA 2PZ1A 3FLGA 3TREA 2JMCA 2OAUA 5KYXB 4M75A 4MDWA 1QCOA 5FROA 2P84A 1M3AA 3JB9F 1PKSA 3CMEQ 2DJZA 2FVUA 2F5TX 2HSEB 2ROTA 1EX4A 1MV0B 3OYLA 4KRTA 1GFDA 5GAN3 1VOMA 3A8MB 5EG2A 4NL3A 3S3MA 2C0IA 5FU6B 1XJWB 1VA7A 3CBMA 1I07A 1PSFA 3QZ9B 1UG1A 4AFSC 1PD0A 2KQWA 1ACMB 1KHCA 4M77B 3CPWP 3OSVA 1PM3A 1WJRA 5GANg 1RI0A 4J9CA 3OS1A 3ME9A 1EFNA 2ZPBB 2L3QA 2J6OA 5IN1A 2DPPB 1YHQQ 1AT1B 1KQSP 3CC7Q 4N0AC 3FJPA 3JCMP 3BDUA 1C6VX 3VYHB 3ZBDA 1UGQB 3RR6A 4JRQA 4WTOB 1Q81C 2YSQA 2V1RA 1PNJA 3MKDA 3GOXA 2K5IA 2NUPA 1ZUKA 1UGRB 1BK2A 2DIGA 4M78G 1ZLMA 4RUGA 1JRIA 2RQWA 1S72T 2DETA 4JPBW 3OYGA 3ZEHA 2HAXA 1RI9A 1KQ2A 4J9IA 1OPKA 1F1BB 2ECZA 1M3BA 1WI7A 2FL7A 5GMKe 1WQWA 2XDDA 4BE1A 4J7IA 3JB9J 2QG9B 2K2MA 2DERA 2ZCFB 2HL3A 2ED1A 1K76A 1E6GA 3JCMX 4HA8A 2RO0A 1OZ3A 1IHVA 4J6WA 1W2BA 1QVPA 1YIJQ 1VQ5Q 3M4YA 2E10A 4CI0C 5ECAA 5GANd 2CDTA 2MWPA 3D7SB 4LUDA 4C0FA 2EKHA 1M90C 2EKOA 2WACA 1R8OB 4XAXB 3H8ZA 4E7ZA 3FC3A 1K9MU 5FWBA 1NJIR 1RAIB 3UA7A 1YJ9A 1VQKA 2CP6A 1ZSZB 4F7UB 3A8LB 5GAN4 3CC4Q 1M4ZA 1UGSB 4Q5WA 4IUVA 4BI8B 4M7DB 1CSKA 1UTIA 5LJ3g 5A0DA 1I4K1 3QHSA 2XG8D 2EAYA 2LNVA 3JCMd 4J9HA 2QASA 3CC2T 3L2VA 1N9RA 4FYYB 4HVVA 1JJ2S 3EFSA 2AKKA 3PGGA 3CCQT 2O2OA 4IUTA 4A4GA 5D7UA 4EDUA 4N4HA 4DQ2A 2V1QA 3CCJA 4OB0B 4DOVA 4PFOA 1V1CA 1KD1C 4BY6B 3INZA 5C0MA 1U06A 3I55T 1K0SA 4RTXA 1K4US 4OB3B 1B34B 2DBMA 3C94A 2J06A 2KY9A 2VYTA 3PFSA 3DB3A 2CT4A 1X27A 4CC4B 4MDXA 1BCMA 2KEAA 2KE9A 4JJCA 5CKEA 2K5FA 4JLGA 3SWNA 1K1ZA 5IHNA 3IQLA 1I1JA 3PNWC 4OMQA 3O8VA 3ER0A 3OMCA 4XQ3A 3GIBA 3VS0A 1VQOA 5LJ3d 1I5LA 4ELYC 3PMIA 1LNXA 4J9EA 3CMAT 4C8QA 4C5IA 4BE2A 1VQNA 1X01A 2ZPGB 1ZA2B 2HSPA 2ATCB 2ZPFB 4ZGEB 4DBRA 1RADB 4RTWA 2XICA 4OMLA 3OYMA 2DA9A 2HL5C 3CCMA 1S72Q 4RKUE 1PHTA 2CZ0B 1RLPC 4MMKA 7AT1B 2EYWA 5DY9A 1M9SA 1QVFS 2DTIA 2IIMA 2MF2A 3E9GA 1OOTA 4XU3A 2IG0A 3P8DA 1JBMA 1YITT 2NWMA 4EMKB 2KSSA 1I0CA 2DEQA 4KH1B 2HQHA 2EGAA 3CPWA 3LH5A 1D3BB 3DLMA 3M59A 2GQIA 1ZHIA 4RG8A 1SG5A 3DLLA 3LW5E 2RI3A 1PWTA 2RJDA 4XTYA 3G4SA 2RHUA 3UWNA 3VU3C 3M57A 1KQSA 4E6RA 1VQ9T 2BKDN 1SRLA 5GAN8 3FRNA 4JRPA 1A0NB 2RNAA 4FYWB 3BE3A 1N5ZA 2VGNA 3JAME 1SSFA 2QK0A 4M7AG 2KMTA 3CC2Q 2QA4A 4ZN1A 2RJCA 2RHZA 3CCQQ 4E47A 3NFCA 4BI3A 3QYGB 4M75G 2RD1A 3CQTA 1VYTA 2KNBB 4D8DA 4M7DF 1UJYA 3TSWA 1NE8A 2JZ2A 1K8AU 3VUBA 1VQLA 2FPFA 3I55Q 3GNFB 2LCLA 2EQIA 1FXXA 5GAN7 2COZA 1VQ4T 3LX7A 1N9SA 1G5VA 4OB2B 2RHIA 5GMKj 3QXEB 4M78B 2XK0A 1TH7A 5KYYB 1Q7YC 1MGQA 5GANh 2RM4A 5GANe 2QQAA 2EJ9A 5FU7C 4C0DC 4C92A 2E6ZA 2VV5A 1M1KU 2QTVA 1U5SA 5KYUB 4LDUA 3V7SA 2ZPEB 5KYWB 3I5RA 1UE9A 2FG0A 1VQPA 2YRVA 3CMAQ 2DD4A 3OW2S 2O9VA 2RHXA 1K73C 5FRMA 3O5ZA 4M78E 2I2LA 3X25B 1YCSB 3PMTA 2QAZA 3JCMh 4BUGA 3FB9A 1H3ZA 1BBZA 2VUBA 3QUIA 4MZPA 3JCMW 4IURA 1QWEA 5CVIA 2LVMA 2KT1A 2FZGB 1VYVA 2G3RA 1NLPC 3H0HA 2K57A 2K3XA 3OYHA 8AT1B 3OY9A 1VIFA 2CYZB 2QTXA 3EG9B 3X26B 5GMKm 3I5SA 1SSHA 1YITQ 2A37A 4DBHA 1X6OA 1TOVA 5DLQE 5A0LA 1WHLA 1OYXA 1BIAA 2GTJA 2OI3A 1Q82U 3GP8A 4PJOE 4F7UG 1QP2A 3CCVA 1Y57A 1M27C 1WJQA 2XKOC 1Q95G 3MPUB 2YHTA 2XMFA 1H8KA 3GPLA 4QQDA 2CZ1B 4PJNA 4E2FB 1VQ9Q 1IHWA 4KGZB 3WVEB 1YJWA 2LMJA 2CSQA 1NLOC 1W2BP 3QJYA 2F1LA 2MK5A
chains in the Genus database with same CATH topology
2DVEA 2LTOA 3HHTB 2OAUA 5GAN2 3TU4K 4XTWA 4M75A 4MDWA 5FROA 3RMQA 1AHJB 1W4SA 3JB9F 4HCZA 2E6NA 2DJZA 5A0GA 2QQBA 3BDLA 2FVUA 2RA2A 4QVCA 2F5TX 3HKSA 5IT9E 4XK8E 3OS2A 3OYLA 1VQPT 4R56A 4RCBA 5GAN3 1KHIA 3A8MB 5EG2A 4ATOA 4NL3A 1VQMA 2CZ7B 3S3MA 3J7AF 5FU6B 3LWHA 2JVVA 3LWIA 3T9NA 1VQ8A 3CBMA 1PSFA 3KXTA 3QZ9B 1ZBXA 2LX9A 2KQWA 4M77B 1KHCA 2LQKA 4BD3A 1JJ2A 3P8BB 3OSVA 2CS7A 3CXCA 4JLIA 1BI0A 4FM4B 1WJRA 4XU2A 5GANg 1MHNA 3DB4A 1RI0A 4MZTA 4EMKC 4BE0A 1B34A 3OS1A 4M7DD 4PJOC 2O4XA 4M7AD 3ME9A 5GAN5 5LJ3f 3QYHB 2ZPBB 1XNIA 4LDYA 1N8RU 5IN1A 2DPPB 2K4YA 4A4EA 5CQXA 3OBWA 2QEXT 4C92B 2D9TA 4N0AC 1NJIC 4R55A 3FJPA 3JCMP 4M75D 3BDUA 4KUIA 4LDVA 3CC2A 2V8JA 3VYHB 4B9XA 3ZBDA 2JOYA 5CCAA 4E7JA 4V2SA 4LD6A 1UGQB 3CCQA 4J5YA 4JRQA 1Q81C 4ZGJB 1KC8C 3GOXA 5J3BA 2HQXA 2K5IA 4OGEA 5AYFA 4JS5A 1IZ6A 3JCMV 4EMGA 3PTAA 2EQJA 1UGRB 2DIGA 4M78G 1K8AC 1I8FA 2LQ8A 4HCCA 1P92A 2DAQA 1JRIA 4A53A 3CD6T 4DOWA 1U1TA 4L59A 4C8QG 5LJ5g 3I55A 2EQUA 2X35A 3WVDB 1S72T 3V7RA 3ZEHA 3OYGA 4M77D 3OA6A 3OSSC 3CCRT 2HAXA 2OTLA 3BW1A 3QSUA 4C8QE 3HRUA 5I2SA 2QXFA 1UGPB 1WNLA 2ZPIB 4IUQA 1KQ2A 2RH2A 2V8IA 3M53A 4NS5A 4M78F 1U1SA 2FL7A 3WXMB 5GMKe 2GF7A 3JCMe 1WQWA 5GAMg 3CCVT 2XDDA 2X4YA 4BE1A 5D6XA 4J7IA 2PVDB 3JB9J 4L6V5 4C8QF 3HRSA 2ZCFB 5HY6A 2OTJA 4C92D 3OYJA 3RUXA 1Q86U 3CCLA 4JRIA 3AHUA 2ZZDA 2XD0A 2L5QA 3JCMX 4HA8A 4OB1B 1YI2A 2VC8A 4J6XA 2RO0A 1OZ3A 2XIDA 4J6WA 1KQ1A 2WSCE 1YJWT 1W2BA 1NPRA 4J8OA 1QVPA 3HFNA 1NPPA 3NTIA 3RMSA 3VKIA 3TREA 1NZ9A 2RI2A 3M4YA 3OYDA 2E10A 4NOYA 4CI0C 3S3OA 5GANd 2MWPA 3SWNC 3TEEA 1G3WA 4C0FA 2HD0A 3JB9I 3CCJT 1M90C 3G6EA 2EKOA 3V8KA 1KG1A 1UEBA 3M55A 3CD6A 2WACA 3R6OA 1R8OB 2CGHA 4XAXB 3H8ZA 3MEAA 3JCMf 3CMAA 2DKGA 3CCEA 2P0QA 5J39A 3FC3A 1XQHA 1VUBA 3OYYA 1VQMT 1K9MU 5GAOp 4EMKA 1HK9A 1VQ8T 5GMKl 4PJOA 5GAOr 1DJ7B 1YJ9A 3FEOA 4EMHA 3MP6A 4M78C 1VQKA 4PLIA 5CQYA 4F7UF 4F7UB 3A8LB 5FU7B 4C8QC 4C0DB 2EJGA 5GAOm 1QVFA 5GAN4 2FB7A 2L8DA 2HNIA 2VGMA 2MAMA 4N0AA 2O01E 1M4ZA 1UGSB 4Q5WA 4IUVA 3P8HA 4BI8B 2HBPA 4M7DB 3V8JA 2L89A 4JRKA 5LJ3g 5A0DA 2R57A 1I4K1 2PVGB 3QHSA 4C0GA 1YJNA 1WPYA 2XG8D 2EAYA 2LNVA 3NTKA 2KVQG 5LJ5d 5GAOl 3JCMd 3UT1A 1VQ7A 2Y4YA 5CKBA 2QQ9A 4N4IA 3SD4A 3L2VA 3CC2T 4HKEA 1N9RA 4M75B 1WJSA 2M1HA 2PQWA 3CPFA 4QVZA 2VXFA 4RG2A 3EFSA 3PGGA 1M1FA 5LJ3e 3CCQT 1JJ2S 4IUTA 4NL2A 3CXCS 1Y07A 3LLRA 4A4GA 2LCCA 3MO8A 4ELZC 4EDUA 4UC4A 3E9FA 4N4HA 4QW2A 3RIRA 4DQ2A 5GAMd 4E7IA 4XTUA 4JUVA 3CCJA 4OB0B 3CBPA 1Q7YU 3L2QA 4DOVA 3SB2A 2RI5A 2M0OA 1KD1C 5KE3A 4PJOD 3KUFA 4OVAA 2DZCA 4BY6B 3INZA 5C0MA 3QPHA 3I55T 3QKJA 4M7AE 1VQNT 2EYQA 5GANj 3LH0A 3OYEA 1Q81U 2OTLT 1KC8U 1Q82C 3OBYA 3A5ZB 4OB3B 1YBYA 3HL8A 3NTHA 4B9WA 1B34B 2DD5A 3RKWA 3VV0A 5CAIA 2O4XB 3JB9D 1Y7XA 1ZQ1A 4M75E 3C94A 3QJ6A 4OF1A 5HK3A 4JDSA 4X9CA 2KY9A 2VYTA 3PFSA 4HT9A 3DB3A 1K73U 3E1SA 2OTJT 4MDXA 4EPCA 3CCLT 4ME7A 5A2QE 3FIFA 1YI2T 1VQ9A 4BI4A 1G3TA 2NLUA 5CKEA 3G71A 2K5FA 4JLGA 3SWNA 3URGA 3VYGA 5HK0A 5GAOn 1UB4A 1GXIE 4M77G 4QQGA 3N5BB 3PNWC 1O75A 2DXCA 3CMEA 2R5AA 4M77E 3O8VA 4P5NA 2K2VA 3ER0A 3OMCA 3OYCA 2R58A 3C4SA 4GLKA 4XQ3A 5LJ5j 4C5HA 4FT4A 1M1GA 3CCUA 4OGCA 3GIBA 2E65A 4J83A 4M78A 4Y28E 5LJ3d 3G6ET 1VQOA 1I5LA 3OYAA 4ELYC 3PMIA 1LNXA 2RB6A 3CMAT 3OW2A 2LRQA 3JCMg 3CCET 5LL6S 4C8QA 4C5IA 4C92G 4BE2A 1VQNA 5D6WA 3QBYA 4XU0A 4Z02A 2DTHA 5GAMj 1X01A 2ZPGB 5CO7A 2QQRA 2Y4XA 1HXDA 2EQKA 4C92E 2ZPFB 4ZGEB 1YJ9T 1VQKT 3X24B 4M7AC 2ZGWA 2LT4A 2PVOB 4L5GA 1BI3A 3CCST 2XICA 1M5Q1 3SFMA 3V7CA 1OZ2A 3OYMA 4QQ6A 5J26A 4C92F 2DXBA 4O5VA 4M75C 1LOJA 3META 2DIQA 3CCMA 1N8RC 1FX7A 4CRIA 4RKUE 3M58A 3G4ST 1YJNT 3TCJA 1YHQA 2X4JA 3JCMJ 1VQ7T 2DXUA 2L3RA 1M1KC 2CZ0B 2CZ6B 4BDZA 4DA4A 4MMKA 4FSXA 1N6AA 2DZ9A 3M54A 2RK2A 5HKCA 5DY9A 3OYIA 1M9SA 1QVFS 4M78D 2DTIA 3HFOA 5FU6C 3JRZA 2EWNA 2MF2A 3E9GA 3JSCA 4XU3A 4C8QD 4X9DA 4KULA 3ASKA 4RMOA 2IG0A 3P8DA 4M77C 2F5KA 1JBMA 2M16A 3UDCA 4FIBA 4FL6A 4PL6A 5KCHA 1YITT 2C06A 4EMKB 2KSSA 4PJOB 3S6WA 3EFRA 2DEQA 4A54A 1OI1A 5KCOA 3OYBA 3RERA 2R5MA 2QDYB 4TVRA 3CPWA 3F70A 3MP8A 2LC4A 1D3BB 2FHDA 2JTFA 2M9UA 3DLMA 3M59A 3SDZA 3VJPA 4IKFA 1BKBA 1ZHIA 3HPWA 2A3LA 1I81A 4RG8A 4C92C 3CCSA 3DLLA 3LW5E 2RI3A 1X75C 2ZPHB 4VUBA 2IVWA 2RJDA 2AHJB 3I56T 2JNGA 4XTYA 3M9QA 3G4SA 3OQ5A 4XU1A 1Q86C 4J6YA 4HT8A 1EIFA 1QW1A 2RHUA 3GF5A 3UWNA 3VU3C 3M57A 1KQSA 4E7HA 1VQ9T 3G71T 2BKDN 2F69A 2X4XA 3QO3A 5CK9A 5GAN8 1IREB 3FRNA 3BFMA 3L2RA 2RJEA 4JRPA 3QIIA 2E5QA 1YIJA 3CEYA 2EJFA 1VQ5A 4D6WA 3QZ5B 1XTDA 5CKFA 1BYMA 3CMET 2JTMA 3X28B 3LGFA 4F7UE 2V8KA 2VGNA 2VXEA 3L42A 2PU9B 2PUOB 3J81E 4M7DG 3JAME 1SSFA 3OYKA 3C95A 3CCUT 1VQOT 1YITA 4M7AA 4M7AG 1NJIU 4FT2A 2KMTA 2QA4A 4JS4A 4ZN1A 4M7DE 2RJCA 1K9MC 5FLXE 3JB9H 2RHZA 1Y96A 5CKDA 2BUDA 3NFCA 4WF2A 4BI3A 4E47A 5FRNA 3QYGB 1VIEA 1VQ6A 4M75G 2RD1A 2DK3A 3RKYA 3L2WA 4KBMB 3MEVA 2BIVA 4M7DF 4M7AF 3HP9A 3FDRA 3A8HB 4N4GA 5I21A 3UPUA 1NE8A 3CC4A 2K3YA 2JZ2A 3PIPA 1K8AU 3I56A 2XI9A 1M8VA 3VUBA 2EFIA 1VQLA 3MP1A 3DKMA 4E7KA 5GAN6 3CCMT 4ZGDB 3G7ZA 3GNFB 5FRMA 2GCXA 3OYNA 4M75F 3SWNB 1YHQT 1QVGA 3MHXA 2LCLA 2WSFE 4JJNK 3CC7T 4IUPA 1FXXA 3OS5A 3EAEA 5I2MA 4IUUA 3JCMb 3HSBA 2LDMA 4J7FA 5C6SA 5GAN7 1VQ5T 2D0QB 2RK1A 4M77A 5CKHA 1N27A 4A4HA 1VQ4T 2XU8A 2X4WA 3LX7A 3RKXA 3MEWA 1N9SA 2KDSA 3A8OB 4YTLA 3KBGA 3M5AA 1G5VA 4OB2B 2RHIA 5GMKj 3QXEB 4M78B 2XK0A 1BIBA 1TH7A 5GMKi 1Q7YC 1MGQA 5GANh 2RM4A 4KUDK 4C8QB 3OMGA 4A4KA 4MZMA 1BI2A 5GANe 1XOVA 2EJ9A 2QQAA 5FU7C 4GY5A 4E7LA 4C0DC 3CBOA 4M77F 4C92A 2E6ZA 2VV5A 2JUFA 1M1KU 1W2BS 1YCYA 4PLLA 3L1AA 1LJOA 2GQVA 4LDUA 4M7DC 1RL2A 2PUKB 3V7SA 1WQ7A 5CR2A 2ZPEB 3A8GB 3QG1A 4C5GA 4RCCA 4FU6A 4BB7A 5DM7R 4ZN3A 2RJFA 3QDRB 2CKKA 1M90U 4PKCC 1VQPA 5DLOA 4LDXA 2YRVA 4II1A 2DD4A 3E19A 4O6JA 2RHXA 2LT1A 2P0KA 4C5EA 3OW2S 2HQEA 1K73C 4LD9K 1V29B 2EQMA 2QQSA 4M78E 3JCMc 4PNOA 3CC7A 5M9OA 2I2LA 2YLBA 3X25B 1BI1A 2A7YA 2WSEE 3PMTA 4LDWA 2GFUA 3CPWS 5GANf 5GMKh 5LJ5h 3JCMh 4BUGA 3FB9A 3S3NA 1VQ4A 1YIJT 1H3ZA 1PSEA 2VUBA 2E41A 1Y71A 3QUIA 2P4TA 4BY6C 3L2ZA 3OB9A 3BY7A 4MZPA 5LJ5e 3JCMW 2Y90A 1G3SA 4IURA 2H3JA 1G3YA 5CVIA 2LVMA 2QEXA 2E12A 2GFAA 3ZFJA 5GAMh 5IAYA 3J80E 4QVDA 3C12A 5GAMe 3JCMQ 1KQSS 4XTVA 5KE2A 2QA4T 2G3RA 2MMPA 5L8RE 1U8RA 3M4GA 4MMLA 3V8LA 1H641 2K57A 3GNGA 3MCAB 3VUZA 2K3XA 4X34A 2QI2A 1WGSA 2DO3A 2JN0A 3LGLA 2DXTA 3OYHA 2KAFA 3Q1JA 1VQ6T 3OY9A 1VIFA 2CYZB 5KH6A 2QTXA 3OS0A 2K5LA 3X26B 5LJ3j 3MEUA 5GMKm 1JB0E 3CC4T 1X6OA 2RHYA 1KD1U 2YLCA 2XDPA 4OMFB 1VQLT 2XDBA 5LJ5f 1FWZA 5DLQE 5A0LA 4BACA 1S72A 5D6YA 1OYXA 2XHCA 2FYKA 1BIAA 4PJOG 3CCRA 2E64A 4XTZA 4C0ZA 1Q82U 3PIOA 2EIFA 3GP8A 4PJOE 2B8AA 3L2UA 2MWOA 4OP0A 4XTXA 5GAMf 2P0PA 3OYFA 4F7UG 1QP2A 2DTOA 3CCVA 1D3BA 4F7UA 4BDYA 4ZTFA 4KT0E 4HCBA 2D6FA 1WJQA 2XKOC 3H6ZA 2YHTA 3X20B 3JB9G 5CIUA 4A4FA 1O9SA 2KK4A 4M7AB 1QP3A 4PJOF 3HRTA 3GPLA 4QQDA 2CZ1B 2E1HA 2E70A 4M7DA 3RESA 3WVEB 1YJWA 1Y96B 4Y91A 3PT9A 5GAOq 4ZTJA 2MI6A 3QJYA 1QVGS 3LYIA 5LJ3h 3M56A 3FLGA 3GLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LX7 A;  2LTO A;  5J39 A;  3MEW A;  3FC3 A;  3MET A;  2DIQ A;  5FRO A;  1G5V A;  4CRI A;  2RHI A;  3LYI A;  2XK0 A;  3FEO A;  3MP6 A;  4HCZ A;  2E6N A;  4PLI A;  2L3R A;  3MEA A;  3BDL A;  3OMG A;  4BDZ A;  3OS2 A;  4E7L A;  2L8D A;  4GY5 A;  3OYL A;  3OYI A;  4PLL A;  4Q5W A;  4IUV A;  3P8H A;  2L89 A;  3S3M A;  2R57 A;  3E9G A;  3NTK A;  4C5G A;  4FU6 A;  1KHC A;  3UT1 A;  4BD3 A;  3ASK A;  2IG0 A;  3P8D A;  2RJF A;  2F5K A;  2M16 A;  5KCH A;  2CKK A;  4FL6 A;  4N4I A;  1WJR A;  4PL6 A;  3SD4 A;  1MHN A;  4QVZ A;  3L2V A;  1WJS A;  2M1H A;  2PQW A;  4RG2 A;  2YRV A;  1RI0 A;  3DB4 A;  3S6W A;  4BE0 A;  4II1 A;  3OS1 A;  5FRM A;  2RHX A;  4C5E A;  2O4X A;  2P0K A;  3ME9 A;  2HQE A;  1OI1 A;  4IUT A;  3LLR A;  4A4G A;  2LCC A;  5KCO A;  3MO8 A;  3OYB A;  2EQM A;  2QQS A;  1XNI A;  2R5M A;  3E9F A;  4N4H A;  4QW2 A;  4UC4 A;  4EDU A;  5IN1 A;  4E7I A;  3F70 A;  3MP8 A;  4A4E A;  2JTF A;  2FHD A;  3DLM A;  5M9O A;  4IKF A;  2D9T A;  3L2Q A;  2RI5 A;  3PMT A;  2GFU A;  2M0O A;  2RI3 A;  5KE3 A;  3S3N A;  3KUF A;  4OVA A;  4B9X A;  1H3Z A;  4E7J A;  2RJD A;  4LD6 A;  5C0M A;  3OB9 A;  3QKJ A;  3M9Q A;  3GOX A;  3OQ5 A;  4IUR A;  3LH0 A;  2HQX A;  3OYE A;  2RHU A;  3UWN A;  2LVM A;  4E7H A;  2EQJ A;  2BKD N;  2X4X A;  2GFA A;  3NTH A;  4B9W A;  5IAY A;  2DIG A;  3L2R A;  2O4X B;  2RJE A;  3QII A;  2E5Q A;  3QJ6 A;  3CEY A;  5KE2 A;  2G3R A;  2DAQ A;  3PFS A;  2VYT A;  4L59 A;  2K3X A;  3DB3 A;  2EQU A;  2X35 A;  4X34 A;  1WGS A;  3LGL A;  3OYH A;  3OYG A;  3ZEH A;  3OA6 A;  3Q1J A;  3OY9 A;  5KH6 A;  3LGF A;  3OS0 A;  3L42 A;  2NLU A;  1SSF A;  3OYK A;  3MEU A;  4IUQ A;  4NS5 A;  2RHY A;  2GF7 A;  2XDP A;  2RJC A;  4BE1 A;  2X4Y A;  5D6X A;  2RHZ A;  4QQG A;  2BUD A;  5FRN A;  4BAC A;  3PNW C;  5D6Y A;  1OYX A;  3OYJ A;  2R5A A;  3O8V A;  3L2W A;  3OMC A;  3OYC A;  2R58 A;  3C4S A;  3MEV A;  4C5H A;  2BIV A;  2RO0 A;  1OZ3 A;  2B8A A;  3FDR A;  3L2U A;  2MWO A;  4N4G A;  3OYA A;  3OYF A;  2K3Y A;  3PMI A;  2JZ2 A;  2LRQ A;  3NTI A;  4BDY A;  3FLG A;  4ZTF A;  2EFI A;  4C5I A;  4BE2 A;  1WJQ A;  3MP1 A;  5D6W A;  2RI2 A;  3QBY A;  3H6Z A;  4Z02 A;  3OYD A;  4E7K A;  3S3O A;  5CIU A;  4A4F A;  3OYN A;  2QQR A;  2EQK A;  2MWP A;  4QQD A;  4IUP A;  3EAE A;  4IUU A;  2EKO A;  2LDM A;  5C6S A;  4ZTJ A;  2WAC A;  3OYM A;  1OZ2 A;  3H8Z A;  1N27 A;  4A4H A;  4QQ6 A;  2X4W A;  5J26 A; 
#chains in the Genus database with same CATH topology
 2LTO A;  1KIK A;  3RMQ A;  4HCZ A;  2E6N A;  4PJJ A;  5A0G A;  3I35 A;  3I9Q A;  4DEY A;  4R56 A;  1MND A;  5FWC A;  4LXC A;  3VS5 A;  4ATO A;  2JXB A;  3LWH A;  3LWI A;  1VQ8 A;  3T9N A;  3EG0 A;  3EHR A;  3KXT A;  4BD3 A;  2O31 A;  3P8B B;  1OU8 A;  4XU2 A;  4FM4 B;  1WYX A;  1R0C B;  3DB4 A;  2JT4 A;  4MZT A;  4PJO C;  2O4X A;  2DM1 A;  1N8R U;  1D1B A;  2KXC A;  4A4E A;  2QEX T;  1OEB A;  1X6B A;  4KUI A;  2JOY A;  1UHC A;  4J5Y A;  1VQ4 Q;  1JO8 A;  3EGX B;  5J3B A;  4OGE A;  1UFF A;  4JS5 A;  1IZ6 A;  4EMG A;  1WHM A;  4Y92 A;  1TS9 A;  3HTR A;  4AFU C;  2P4R A;  1P92 A;  2DAQ A;  2LJ3 A;  4A53 A;  4KH0 B;  4DOW A;  1U1T A;  4C8Q G;  2EBP A;  1RUW A;  3OSS C;  3HRU A;  1WNL A;  4NS5 A;  3WXM B;  4M78 F;  2GF7 A;  2X4Y A;  5D6X A;  1PD1 A;  2MOX A;  5HY6 A;  4C92 D;  1Z9Z A;  1Q86 U;  3CCL A;  2ZZD A;  2XD0 A;  3VS2 A;  1YI2 A;  4OB1 B;  1QVG P;  1KQ1 A;  2WSC E;  4J9G A;  2EGC A;  1NPR A;  1WXT A;  5GJW B;  4ZNX A;  3NTI A;  3M0P A;  3VKI A;  2GNC A;  3EGD B;  4NOY A;  1AWO A;  1AOJ A;  3CCJ T;  3G6E A;  1IRX A;  1KG1 A;  2D0N A;  3M55 A;  1PRL C;  3CD6 A;  2DLP A;  4RTV A;  3CCE A;  5J39 A;  1VQM T;  1HK9 A;  2KT8 A;  1WDX A;  2JM9 A;  2VGM A;  4N0A A;  4X1V A;  2LQN A;  3P8H A;  4DBQ A;  1WXU A;  2R57 A;  2PVG B;  1RLQ C;  1T3L A;  4C0G A;  3NTK A;  1VQ7 A;  4Z88 A;  2QQ9 A;  2VKN A;  4M75 B;  1HD3 A;  2D8J A;  4RG2 A;  1QWF A;  1M1F A;  1MUZ A;  3CXC S;  4PFP A;  3LLR A;  3RIR A;  1D0Y A;  4XTU A;  4JUV A;  1T0J A;  3L2Q A;  3SB2 A;  4PJO D;  5KE3 A;  3EG3 A;  1TUC A;  4M7A E;  1VQN T;  1NBE B;  5GAN j;  2GGR A;  3LH0 A;  1Q81 U;  2OTL T;  2K7A A;  3OBY A;  3A5Z B;  3HL8 A;  3NTH A;  2DD5 A;  5CAI A;  3JB9 D;  4M75 E;  4OF1 A;  5HK3 A;  4X9C A;  4FW2 A;  1M90 R;  2OTJ T;  1ZUY A;  3FIF A;  2M0Y A;  1G3T A;  4BI4 A;  3URG A;  2J6K A;  3EGU A;  5HK0 A;  1ZSG A;  2H3E B;  1X2Q A;  1GXI E;  2NUP B;  4QQG A;  5IXB A;  3N5B B;  2BE9 B;  3CME A;  4M77 E;  4P5N A;  2K2V A;  2NUZ A;  3OYC A;  4FT4 A;  3CCU A;  2FZC B;  4Y28 E;  2QEX Q;  2KYB A;  2RB6 A;  2LRQ A;  3JCM g;  2DVJ A;  4C92 G;  3QBY A;  2DTH A;  5CO7 A;  4M7A C;  3X24 B;  2D1X A;  2PVO B;  2YUN A;  4L5G A;  1OZ2 A;  4QQ6 A;  1K0X A;  4M75 C;  1BCO A;  4CRI A;  3G4S T;  2PNI A;  1YJN T;  2YXY A;  3TCJ A;  2L3P A;  1YHQ A;  1KD1 R;  2L3R A;  4CC7 A;  1VQK Q;  1JJ2 P;  3QWX X;  1J3T A;  3REA B;  1N6A A;  1QCN A;  5HKC A;  2O9S A;  1HSQ A;  1SEM A;  5FU6 C;  3TQ7 P;  1SF9 A;  2XDB A;  4M77 C;  5KCH A;  2C06 A;  4FL6 A;  2E4H A;  2CP5 A;  2KRN A;  2KXD A;  3EH2 A;  3S6W A;  3OYB A;  4TVR A;  1JQQ A;  2FHD A;  2M9U A;  5EC7 A;  4IKF A;  3CCS A;  3CCJ Q;  4ORZ A;  4PFZ A;  2ZPH B;  1VQM Q;  4XU1 A;  4HT8 A;  4J6Y A;  1EIF A;  3GF5 A;  2NUT A;  3G71 T;  2F69 A;  2EVR A;  2RJE A;  1MNE A;  2ABL A;  1YIJ A;  4OMP A;  2EJF A;  1VQ5 A;  3QZ5 B;  1XTD A;  1BYM A;  4F7U E;  1YWO A;  3C95 A;  2KR3 A;  2E3H A;  4PJM A;  1NJI U;  1CKA A;  4JS4 A;  4M7D E;  1K9M C;  5FLX E;  1Y96 A;  1TSF A;  4WF2 A;  3TVT A;  2BZY A;  1G2B A;  2GBQ A;  2RN8 A;  4M7A F;  3HP9 A;  2JMA A;  5I21 A;  3CC4 A;  2RQV A;  3I56 A;  1M8V A;  3DKM A;  4E7K A;  1VQN Q;  2B86 A;  2GCX A;  4M75 F;  3SWN B;  1QVG A;  2OTL Q;  2WSF E;  4JJD A;  2DIL A;  2J6F A;  2D0Q B;  2AZS A;  2RK1 A;  1N27 A;  1YFN A;  4A4H A;  1QVF P;  2XU8 A;  1YWP A;  8ATC B;  2KDS A;  3KBG A;  2OTJ Q;  1E6H A;  4C8Q B;  3OMG A;  2JM8 A;  4MZM A;  3R6N A;  1ZSZ C;  1XOV A;  3FJ5 A;  3EG1 A;  4GY5 A;  4M77 F;  2JUF A;  1YCY A;  4PLL A;  2VB6 A;  3L1A A;  1LJO A;  1OQK A;  2GQV A;  2ROL A;  4M7D C;  2KGT A;  2PUK B;  1WZO A;  3A8G B;  2RJF A;  2CKK A;  4LDX A;  4O6J A;  3NPF A;  5IHK A;  2HQE A;  1V29 B;  2EQM A;  2RQT A;  3JCM c;  4PNO A;  5M9O A;  5L23 A;  1UDL A;  2YLB A;  5IH2 A;  2GTO A;  3VS7 A;  1KJW A;  1BI1 A;  2A7Y A;  5GAN f;  2FRW A;  1ABO A;  1I5O B;  2E41 A;  4BY6 C;  3OB9 A;  2Y90 A;  1G3S A;  3G4S Q;  1YJN Q;  2M02 A;  2SEM A;  1B7T A;  2GFA A;  3ZFJ A;  5IAY A;  4QVD A;  3C12 A;  3JCM Q;  2EGE A;  1MV3 A;  1E7O A;  1U8R A;  2MMP A;  3V8L A;  2MIO A;  1H64 1;  4OMN A;  2VAS A;  2QI2 A;  1OX9 A;  2JN0 A;  1VQ6 T;  5AT1 B;  2DXT A;  2KAF A;  2DNU A;  1D1A A;  4F17 A;  1G8X A;  1Q7Y R;  1S72 A;  4FYV B;  2XHC A;  2B8A A;  3EFO A;  1KC8 R;  4BDY A;  1D3B A;  4HCB A;  3X20 B;  2CRE A;  2FPD A;  1QP3 A;  3HRT A;  4DBF A;  3G71 Q;  1K73 R;  1RAE B;  1MMG A;  3PT9 A;  4ZTJ A;  2MI6 A;  3QDF A;  3LYI A;  1SRM A;  4F7U F;  3LGL A;  3OS2 A;  2DVE A;  2DL8 A;  3HHT B;  2DL5 A;  3TU4 K;  2HKQ B;  1AHJ B;  3EG2 A;  1RAF B;  4ANJ A;  3HKS A;  3OW2 P;  2KRM A;  4RCB A;  2CZ7 B;  1M3C A;  1RAC B;  1IGU A;  4HVW A;  1ZBX A;  2LX9 A;  1JJ2 A;  2LQK A;  1ARK A;  1MHN A;  4RTU A;  4EMK C;  4BE0 A;  2AK5 A;  4M7D D;  1AWJ A;  5LJ3 f;  3QYH B;  4LDY A;  2K4Y A;  5CQX A;  2E3I A;  4C92 B;  2D9T A;  3CC2 A;  4LDV A;  3H41 A;  2M51 A;  4B9X A;  4V2S A;  3CCQ A;  2DFU A;  2FPE A;  1KC8 C;  1W1F A;  1ZX6 A;  1G83 A;  5AYF A;  1OX8 A;  3JCM V;  1IGQ A;  2EQJ A;  3PTA A;  1K8A C;  1I8F A;  3CD6 T;  1AZE A;  5LJ5 g;  4L59 A;  3I55 A;  2HCK A;  1PCX A;  1K9A A;  3CCR T;  1D0Z A;  1M2O A;  3BW1 A;  4J9D A;  2DJQ A;  1BU1 A;  1OUL A;  5I2S A;  2QXF A;  2ZPI B;  4IUQ A;  2MPX C;  4WCI A;  4B6M A;  3M53 A;  5GAM g;  1NYG A;  1U1S A;  3JCM e;  3NHN A;  2PVD B;  4L6V 5;  4C8Q F;  3OYJ A;  1D09 B;  1PC0 A;  3RNJ A;  4JRI A;  2VWF A;  2YWW A;  4J6X A;  2MYS A;  5IXF A;  4J8O A;  1NPP A;  3RMS A;  1NZ9 A;  4KGV B;  3CCV Q;  2QDL A;  2JS2 A;  5I11 A;  2RF0 A;  3TEE A;  3JB9 I;  2HD0 A;  3V8K A;  3R6O A;  3CMA A;  3MEA A;  2A36 A;  2CT3 A;  3OYY A;  1GCP A;  4PJO A;  5GMK l;  1VQ6 Q;  1M2V A;  1ABQ A;  2LJ1 A;  4M78 C;  2I0N A;  5KYN A;  4PLI A;  5CQY A;  2FRY A;  1GL5 A;  2JS0 A;  1QVF A;  2EJG A;  3A1P A;  5GAO m;  3RBB B;  2FB7 A;  2L8D A;  3VS6 A;  2O01 E;  2DYI A;  4J9B A;  2OJ2 A;  2L89 A;  4JRK A;  2J05 A;  1ZUU A;  1WPY A;  2DL3 A;  2HBW A;  5LJ5 d;  5GAO l;  3UT1 A;  5CKB A;  4JZ4 A;  4CC3 A;  4N4I A;  4HKE A;  4QVZ A;  1WJS A;  2M1H A;  2PQW A;  1WHK A;  3PVL A;  5LJ3 e;  4NL2 A;  4ELZ C;  4UC4 A;  3E9F A;  4IIO A;  5GAM d;  4PJL A;  2J7I A;  1FMK A;  2M0O A;  2DZC A;  3QPH A;  1Z9Q A;  1WHJ A;  2EYQ A;  2YRC A;  2K6D A;  2C0O A;  4Z89 A;  1Q82 C;  2CH4 A;  4B9W A;  3NMZ C;  3RKW A;  2O4X B;  1H3H A;  1Y7X A;  2LCS A;  4RTZ A;  4HT9 A;  4EPC A;  5A2Q E;  4ESR A;  1VQ9 A;  1V76 A;  2NLU A;  1UHF A;  1UB4 A;  4R0K A;  1YNZ A;  2DXC A;  2R5A A;  2X9H A;  3C4S A;  4GLK A;  3CCL Q;  1FMW A;  1YI2 Q;  3OYA A;  2LJ0 A;  4FYX B;  5LL6 S;  4XU0 A;  3GBQ A;  2QQR A;  1YJ9 T;  2EQK A;  1VQK T;  1FYN A;  2ZGW A;  2LT4 A;  1BI3 A;  2KRS A;  4FCY A;  1GBR A;  3CCS T;  3V7C A;  2A08 A;  2L3S A;  4C92 F;  4O5V A;  3CD6 Q;  2DIQ A;  3CCE Q;  2D8H A;  1N8R C;  1TUD A;  3CCR Q;  3PVQ A;  2X4J A;  4FSS A;  4GLM A;  3JCM J;  4DA4 A;  2CZ6 B;  4BDZ A;  2HMA A;  3CXC P;  3OYI A;  4KGX B;  1AD5 A;  4M78 D;  2DL7 A;  4X9D A;  4KUL A;  4RMO A;  3OW2 A;  3UDC A;  3SHW A;  3VRZ A;  3EFR A;  1ZBJ A;  1JXO A;  1B07 A;  1OI1 A;  4AT1 B;  1X2K A;  3RER A;  2R5M A;  3F70 A;  2LC4 A;  2JTF A;  3VJP A;  1BKB A;  3HPW A;  1I81 A;  1X75 C;  4VUB A;  2DL4 A;  2AHJ B;  1GBQ A;  9ATC B;  3I56 T;  2JNG A;  3M9Q A;  2CH4 W;  3OQ5 A;  1Q86 C;  4LNP A;  1AWW A;  4E7H A;  4PK4 A;  2X4X A;  1IRE B;  3L2R A;  3QII A;  4M4Z A;  4RTT A;  1GCQ C;  5HCK A;  4QKU A;  4D6W A;  4F16 A;  3M0U A;  2JTM A;  3X28 B;  3LGF A;  2V8K A;  1AZG B;  3J81 E;  3L42 A;  2PU9 B;  2PUO B;  1C1A A;  3OYK A;  4LE9 A;  1VQO T;  4M7A A;  1IXD A;  4FT2 A;  1Y0M A;  2AT1 B;  2KBT A;  3JB9 H;  1OV3 A;  2DMO A;  2BUD A;  5FRN A;  1VIE A;  3RKY A;  1WLP B;  3L2W A;  4KBM B;  1KSW A;  4AMC A;  5KYX A;  2BIV A;  3FDR A;  3CCU Q;  2K3Y A;  1WIE A;  3PIP A;  2XI9 A;  2CP0 A;  3CCM T;  4F14 A;  2DYB A;  3U23 A;  1QLY A;  3G7Z A;  4GBQ A;  3OYN A;  4JJN K;  3OS5 A;  3H9N A;  3JCM b;  3HSB A;  2COW A;  2LDM A;  2QGG A;  4J7F A;  4M77 A;  5CKH A;  3VS4 A;  1LVK A;  2OAW A;  2X4W A;  1S1N A;  3RKX A;  3MEW A;  3A8O B;  1W6X A;  4YTL A;  1RAB B;  2BTT A;  2L0A A;  4JJB A;  1BIB A;  5GMK i;  4KUD K;  4LN2 A;  3MJX A;  4A4K A;  1BI2 A;  1WHG A;  2BZ8 A;  4E7L A;  1TWB A;  2KRO A;  3QG1 A;  3VS3 A;  4FU6 A;  4BB7 A;  2YT6 A;  2VVK A;  1M90 U;  4PKC C;  2LX7 A;  5DLO A;  1UEC A;  3E19 A;  2LT1 A;  2P0K A;  2CP3 A;  2QQS A;  3CC7 A;  1YJ9 Q;  2LQW A;  2F2V A;  1K9M R;  2GFU A;  3CPW S;  4D8K A;  5GMK h;  5LJ5 h;  1JXM A;  3CCS Q;  1PSE A;  5LJ5 e;  1D1C A;  1Y71 A;  1KFZ A;  1U3O A;  4EIK A;  2H3J A;  2QEX A;  5GAM h;  3J80 E;  5GAM e;  1KQS S;  2QA4 T;  4MML A;  1BB9 A;  4LUE A;  1WGS A;  2DO3 A;  2FO0 A;  1IO6 A;  3Q1J A;  5KH6 A;  5LJ3 j;  1GRI A;  1ZA1 B;  1KD1 U;  2YLC A;  1VQL T;  2NUT B;  4PJO G;  2FYK A;  1LCK A;  4XTZ A;  3PE0 A;  4HVU A;  3PIO A;  3THK A;  4OMM A;  3L2U A;  2MWO A;  4OP0 A;  3OYF A;  2DTO A;  3M0Q A;  1ZSZ A;  4F7U A;  4ZTF A;  3H6Z A;  3I56 Q;  3JB9 G;  5CIU A;  2KK4 A;  2SRC A;  4M7D A;  2E1H A;  3RES A;  5LJ3 h;  1Y96 B;  4Y91 A;  3M56 A;  3GLX A;  2QYZ A;  5GAN 2;  4AFZ C;  4XTW A;  4DEX A;  1W4S A;  3G1J A;  2JW4 A;  2EYZ A;  2QQB A;  3BDL A;  4CC2 A;  2RA2 A;  4QVC A;  5IT9 E;  1VQO Q;  4XK8 E;  1VQP T;  1KHI A;  1VQM A;  3J7A F;  2DX1 A;  2JVV A;  1HJD A;  1MMA A;  1W70 A;  2CS7 A;  3CXC A;  4JLI A;  1BI0 A;  2YUP A;  3E2U A;  1B34 A;  2HDA A;  4M7A D;  1OPL A;  5GAN 5;  1NEG A;  3CCM Q;  1XNI A;  2JJ9 A;  1QMC A;  3OBW A;  1NJI C;  4R55 A;  2V26 A;  4M75 D;  2V8J A;  5GJV B;  4E7J A;  5CCA A;  4LD6 A;  2X3W D;  4ZGJ B;  3EH1 A;  2HQX A;  1JEG A;  1M30 A;  3VS1 A;  2LQ8 A;  4HCC A;  1UUE A;  2FZK B;  1X6G A;  3REB B;  2EQU A;  2X35 A;  3WVD B;  1PKT A;  3V7R A;  3OA6 A;  4M77 D;  1R77 A;  2YUQ A;  2OTL A;  3QSU A;  4C8Q E;  3KFV A;  1X69 A;  1UGV A;  1SHF A;  1WX6 A;  1UGP B;  1C0M A;  2RH2 A;  2V8I A;  3CCV T;  5I22 A;  2AKL A;  3H0F A;  2CP2 A;  4HCK A;  3HRS A;  3TSZ A;  1FMV A;  2OTJ A;  3RUX A;  3AHU A;  2L5Q A;  2COY A;  2VC8 A;  2RPN A;  2XID A;  1YJW T;  3HFN A;  1MMN A;  2QGF B;  2RI2 A;  3OYD A;  3S3O A;  2YRD A;  2L2P A;  3SWN C;  1G3W A;  1QCF A;  1UEB A;  1H92 A;  2CGH A;  3M0T A;  3JCM f;  2MCN A;  2DKG A;  1TUG B;  2P0Q A;  2QA4 Q;  1XQH A;  1VUB A;  5GAO p;  4EMK A;  2DEU A;  2HEQ A;  1VQ8 T;  2EYY A;  5GAO r;  1DJ7 B;  3EFO B;  2FEI A;  3FEO A;  4J9F A;  3MP6 A;  4EMH A;  3SEM A;  5FU7 B;  4C8Q C;  4C0D B;  2BE7 D;  4AFQ C;  2HNI A;  2MAM A;  1VQL Q;  2DF6 A;  2HBP A;  3V8J A;  2ESW A;  1YJN A;  1K8A R;  2LP5 A;  2KVQ G;  4E7S A;  2A0F B;  1NG2 A;  2Y4Y A;  2Z0W A;  4IIM A;  3SD4 A;  3CPF A;  2VXF A;  2ED0 A;  2LNH B;  6AT1 B;  1Y07 A;  2LCC A;  3MO8 A;  4E7I A;  4QW2 A;  3AT1 B;  3CBP A;  1Q7Y U;  2W0Z A;  1RAG B;  2RI5 A;  2X3X D;  1IB8 A;  3KUF A;  4OVA A;  1JU5 C;  1QKW A;  3QKJ A;  2AIR B;  3OYE A;  1SHG A;  4OMO A;  1KC8 U;  1M1K R;  1YBY A;  3VV0 A;  3ZL7 C;  3VRY A;  1WFW A;  1ZQ1 A;  3QJ6 A;  1VQP Q;  4JDS A;  1K73 U;  3E1S A;  3CCL T;  4ME7 A;  1NEB A;  1YI2 T;  3G71 A;  2G6F X;  1LPL A;  3VYG A;  1EZZ B;  5GAO n;  4M77 G;  3M0R A;  1KK7 A;  1WA7 A;  2F2W A;  1O75 A;  1WHH A;  2KI7 A;  5FW9 A;  2R58 A;  5LJ5 j;  1CKB A;  1AWX A;  1M1G A;  4OGC A;  2E65 A;  4J83 A;  4M78 A;  3G6E T;  5KYY A;  2K3B A;  1NM7 A;  3CCE T;  5D6W A;  4Z02 A;  2O88 A;  1T0H A;  1T3S A;  4Z8A A;  5GAM j;  1TTH B;  2Y4X A;  4C92 E;  1HXD A;  5KYU A;  2YUO A;  1M8M A;  5KYW A;  1YN8 A;  2OX7 A;  1M5Q 1;  5IHI A;  3SFM A;  2CUB A;  1SKU B;  5J26 A;  2DXB A;  2C0T A;  1LOJ A;  2EYX A;  3MET A;  1FX7 A;  3M58 A;  1VQ7 T;  1TU0 B;  2DXU A;  1M1K C;  2IPO B;  4FSX A;  2DZ9 A;  3M54 A;  2X51 A;  2RK2 A;  1Q82 R;  3HFO A;  3JRZ A;  2EWN A;  3UA6 A;  1TG0 A;  3JSC A;  4C8Q D;  3ASK A;  3A98 A;  2F5K A;  2M16 A;  4FIB A;  4PL6 A;  3ULR B;  1YJW Q;  1B3Q A;  1AVZ C;  4PJO B;  3QWY A;  1M2V B;  4A54 A;  5KCO A;  2QDY B;  2ENM A;  4K11 A;  3MP8 A;  3SDZ A;  1OU9 A;  2A3L A;  4C92 C;  3EG9 A;  2AZV A;  2IVW A;  2EPD A;  4A63 B;  2KYM A;  1QW1 A;  1VQ8 Q;  1GFC A;  3H0I A;  4F04 B;  5CK9 A;  3QO3 A;  4AG1 C;  1HYO A;  3BFM A;  4JZ3 A;  2E5Q A;  3CEY A;  2RQR A;  5CKF A;  3CME T;  1YP5 A;  2VXE A;  2ZAE A;  4M7D G;  3EHQ A;  3CCU T;  1YIT A;  1AEY A;  1N8R R;  3JV3 A;  2H8H A;  2RQU A;  5CKD A;  1VQ6 A;  2DK3 A;  2LZ6 B;  3MEV A;  2HZY A;  3A8H B;  4N4G A;  3UPU A;  2EFI A;  3MP1 A;  5GAN 6;  4ZGD B;  1YHQ T;  4FW1 A;  3MHX A;  3CC7 T;  4IUP A;  3EAE A;  5I2M A;  4IUU A;  5C6S A;  1QKX A;  1D0X A;  2A28 A;  3M5A A;  4RTY A;  4QT7 A;  2YDL A;  2DE0 X;  1TXQ A;  1SPK A;  1Q86 R;  3CBO A;  2DRK A;  1VYU A;  1W2B S;  2CP7 A;  1RAA B;  2W10 A;  2JTE A;  1RL2 A;  1WQ7 A;  5CR2 A;  2K79 A;  3EGX A;  4C5G A;  4RCC A;  1NYF A;  5DM7 R;  4ZN3 A;  3QDR B;  3G6E Q;  2K9G A;  4II1 A;  3RDV A;  1GCQ A;  4C5E A;  4LD9 K;  2HKN A;  2F2X A;  2RMO A;  2WSE E;  4LDW A;  1YIJ T;  3S3N A;  1VQ4 A;  1QQJ A;  1VQ5 T;  2P4T A;  3L2Z A;  3UF4 A;  3BY7 A;  1G3Y A;  1R0B G;  2E12 A;  1VQ7 Q;  2DRM A;  4XTV A;  5KE2 A;  1RAH B;  2E5K A;  5L8R E;  2EW3 A;  3M4G A;  3GNG A;  3MCA B;  3VUZ A;  4X34 A;  2DBK A;  3M0S A;  3OS0 A;  2K5L A;  3EGD A;  3C0C A;  1UJ0 A;  3MEU A;  2CUD A;  1JB0 E;  3CC4 T;  2BZX A;  1PG5 B;  2RHY A;  2XDP A;  4OMF B;  3UAT A;  3NGP A;  1WXB A;  5LJ5 f;  1FWZ A;  2PTK A;  4BAC A;  5D6Y A;  3CCR A;  2E64 A;  4AG2 C;  2NYS A;  4C0Z A;  2EIF A;  1X43 A;  2CSI A;  4XTX A;  5GAM f;  1MMD A;  1Q81 R;  2P0P A;  4KT0 E;  2D6F A;  4A4F A;  1PRM C;  1O9S A;  4M7A B;  4PJO F;  4HXJ A;  2E70 A;  5GAO q;  1QVG S;  4C5H A;  2PZ1 A;  3FLG A;  3TRE A;  2JMC A;  2OAU A;  5KYX B;  4M75 A;  4MDW A;  1QCO A;  5FRO A;  2P84 A;  1M3A A;  3JB9 F;  1PKS A;  3CME Q;  2DJZ A;  2FVU A;  2F5T X;  2HSE B;  2ROT A;  1EX4 A;  1MV0 B;  3OYL A;  4KRT A;  1GFD A;  5GAN 3;  1VOM A;  3A8M B;  5EG2 A;  4NL3 A;  3S3M A;  2C0I A;  5FU6 B;  1XJW B;  1VA7 A;  3CBM A;  1I07 A;  1PSF A;  3QZ9 B;  1UG1 A;  4AFS C;  1PD0 A;  2KQW A;  1ACM B;  1KHC A;  4M77 B;  3CPW P;  3OSV A;  1PM3 A;  1WJR A;  5GAN g;  1RI0 A;  4J9C A;  3OS1 A;  3ME9 A;  1EFN A;  2ZPB B;  2L3Q A;  2J6O A;  5IN1 A;  2DPP B;  1YHQ Q;  1AT1 B;  1KQS P;  3CC7 Q;  4N0A C;  3FJP A;  3JCM P;  3BDU A;  1C6V X;  3VYH B;  3ZBD A;  1UGQ B;  3RR6 A;  4JRQ A;  4WTO B;  1Q81 C;  2YSQ A;  2V1R A;  1PNJ A;  3MKD A;  3GOX A;  2K5I A;  2NUP A;  1ZUK A;  1UGR B;  1BK2 A;  2DIG A;  4M78 G;  1ZLM A;  4RUG A;  1JRI A;  2RQW A;  1S72 T;  2DET A;  4JPB W;  3OYG A;  3ZEH A;  2HAX A;  1RI9 A;  1KQ2 A;  4J9I A;  1OPK A;  1F1B B;  2ECZ A;  1M3B A;  1WI7 A;  2FL7 A;  5GMK e;  1WQW A;  2XDD A;  4BE1 A;  4J7I A;  3JB9 J;  2QG9 B;  2K2M A;  2DER A;  2ZCF B;  2HL3 A;  2ED1 A;  1K76 A;  1E6G A;  3JCM X;  4HA8 A;  2RO0 A;  1OZ3 A;  1IHV A;  4J6W A;  1W2B A;  1QVP A;  1YIJ Q;  1VQ5 Q;  3M4Y A;  2E10 A;  4CI0 C;  5ECA A;  5GAN d;  2CDT A;  2MWP A;  3D7S B;  4LUD A;  4C0F A;  2EKH A;  1M90 C;  2EKO A;  2WAC A;  1R8O B;  4XAX B;  3H8Z A;  4E7Z A;  3FC3 A;  1K9M U;  5FWB A;  1NJI R;  1RAI B;  3UA7 A;  1YJ9 A;  1VQK A;  2CP6 A;  1ZSZ B;  4F7U B;  3A8L B;  5GAN 4;  3CC4 Q;  1M4Z A;  1UGS B;  4Q5W A;  4IUV A;  4BI8 B;  4M7D B;  1CSK A;  1UTI A;  5LJ3 g;  5A0D A;  1I4K 1;  3QHS A;  2XG8 D;  2EAY A;  2LNV A;  3JCM d;  4J9H A;  2QAS A;  3CC2 T;  3L2V A;  1N9R A;  4FYY B;  4HVV A;  1JJ2 S;  3EFS A;  2AKK A;  3PGG A;  3CCQ T;  2O2O A;  4IUT A;  4A4G A;  5D7U A;  4EDU A;  4N4H A;  4DQ2 A;  2V1Q A;  3CCJ A;  4OB0 B;  4DOV A;  4PFO A;  1V1C A;  1KD1 C;  4BY6 B;  3INZ A;  5C0M A;  1U06 A;  3I55 T;  1K0S A;  4RTX A;  1K4U S;  4OB3 B;  1B34 B;  2DBM A;  3C94 A;  2J06 A;  2KY9 A;  2VYT A;  3PFS A;  3DB3 A;  2CT4 A;  1X27 A;  4CC4 B;  4MDX A;  1BCM A;  2KEA A;  2KE9 A;  4JJC A;  5CKE A;  2K5F A;  4JLG A;  3SWN A;  1K1Z A;  5IHN A;  3IQL A;  1I1J A;  3PNW C;  4OMQ A;  3O8V A;  3ER0 A;  3OMC A;  4XQ3 A;  3GIB A;  3VS0 A;  1VQO A;  5LJ3 d;  1I5L A;  4ELY C;  3PMI A;  1LNX A;  4J9E A;  3CMA T;  4C8Q A;  4C5I A;  4BE2 A;  1VQN A;  1X01 A;  2ZPG B;  1ZA2 B;  2HSP A;  2ATC B;  2ZPF B;  4ZGE B;  4DBR A;  1RAD B;  4RTW A;  2XIC A;  4OML A;  3OYM A;  2DA9 A;  2HL5 C;  3CCM A;  1S72 Q;  4RKU E;  1PHT A;  2CZ0 B;  1RLP C;  4MMK A;  7AT1 B;  2EYW A;  5DY9 A;  1M9S A;  1QVF S;  2DTI A;  2IIM A;  2MF2 A;  3E9G A;  1OOT A;  4XU3 A;  2IG0 A;  3P8D A;  1JBM A;  1YIT T;  2NWM A;  4EMK B;  2KSS A;  1I0C A;  2DEQ A;  4KH1 B;  2HQH A;  2EGA A;  3CPW A;  3LH5 A;  1D3B B;  3DLM A;  3M59 A;  2GQI A;  1ZHI A;  4RG8 A;  1SG5 A;  3DLL A;  3LW5 E;  2RI3 A;  1PWT A;  2RJD A;  4XTY A;  3G4S A;  2RHU A;  3UWN A;  3VU3 C;  3M57 A;  1KQS A;  4E6R A;  1VQ9 T;  2BKD N;  1SRL A;  5GAN 8;  3FRN A;  4JRP A;  1A0N B;  2RNA A;  4FYW B;  3BE3 A;  1N5Z A;  2VGN A;  3JAM E;  1SSF A;  2QK0 A;  4M7A G;  2KMT A;  3CC2 Q;  2QA4 A;  4ZN1 A;  2RJC A;  2RHZ A;  3CCQ Q;  4E47 A;  3NFC A;  4BI3 A;  3QYG B;  4M75 G;  2RD1 A;  3CQT A;  1VYT A;  2KNB B;  4D8D A;  4M7D F;  1UJY A;  3TSW A;  1NE8 A;  2JZ2 A;  1K8A U;  3VUB A;  1VQL A;  2FPF A;  3I55 Q;  3GNF B;  2LCL A;  2EQI A;  1FXX A;  5GAN 7;  2COZ A;  1VQ4 T;  3LX7 A;  1N9S A;  1G5V A;  4OB2 B;  2RHI A;  5GMK j;  3QXE B;  4M78 B;  2XK0 A;  1TH7 A;  5KYY B;  1Q7Y C;  1MGQ A;  5GAN h;  2RM4 A;  5GAN e;  2QQA A;  2EJ9 A;  5FU7 C;  4C0D C;  4C92 A;  2E6Z A;  2VV5 A;  1M1K U;  2QTV A;  1U5S A;  5KYU B;  4LDU A;  3V7S A;  2ZPE B;  5KYW B;  3I5R A;  1UE9 A;  2FG0 A;  1VQP A;  2YRV A;  3CMA Q;  2DD4 A;  3OW2 S;  2O9V A;  2RHX A;  1K73 C;  5FRM A;  3O5Z A;  4M78 E;  2I2L A;  3X25 B;  1YCS B;  3PMT A;  2QAZ A;  3JCM h;  4BUG A;  3FB9 A;  1H3Z A;  1BBZ A;  2VUB A;  3QUI A;  4MZP A;  3JCM W;  4IUR A;  1QWE A;  5CVI A;  2LVM A;  2KT1 A;  2FZG B;  1VYV A;  2G3R A;  1NLP C;  3H0H A;  2K57 A;  2K3X A;  3OYH A;  8AT1 B;  3OY9 A;  1VIF A;  2CYZ B;  2QTX A;  3EG9 B;  3X26 B;  5GMK m;  3I5S A;  1SSH A;  1YIT Q;  2A37 A;  4DBH A;  1X6O A;  1TOV A;  5DLQ E;  5A0L A;  1WHL A;  1OYX A;  1BIA A;  2GTJ A;  2OI3 A;  1Q82 U;  3GP8 A;  4PJO E;  4F7U G;  1QP2 A;  3CCV A;  1Y57 A;  1M27 C;  1WJQ A;  2XKO C;  1Q95 G;  3MPU B;  2YHT A;  2XMF A;  1H8K A;  3GPL A;  4QQD A;  2CZ1 B;  4PJN A;  4E2F B;  1VQ9 Q;  1IHW A;  4KGZ B;  3WVE B;  1YJW A;  2LMJ A;  2CSQ A;  1NLO C;  1W2B P;  3QJY A;  2F1L A;  2MK5 A; 
#chains in the Genus database with same CATH homology
 2DVE A;  2LTO A;  3HHT B;  2OAU A;  5GAN 2;  3TU4 K;  4XTW A;  4M75 A;  4MDW A;  5FRO A;  3RMQ A;  1AHJ B;  1W4S A;  3JB9 F;  4HCZ A;  2E6N A;  2DJZ A;  5A0G A;  2QQB A;  3BDL A;  2FVU A;  2RA2 A;  4QVC A;  2F5T X;  3HKS A;  5IT9 E;  4XK8 E;  3OS2 A;  3OYL A;  1VQP T;  4R56 A;  4RCB A;  5GAN 3;  1KHI A;  3A8M B;  5EG2 A;  4ATO A;  4NL3 A;  1VQM A;  2CZ7 B;  3S3M A;  3J7A F;  5FU6 B;  3LWH A;  2JVV A;  3LWI A;  3T9N A;  1VQ8 A;  3CBM A;  1PSF A;  3KXT A;  3QZ9 B;  1ZBX A;  2LX9 A;  2KQW A;  4M77 B;  1KHC A;  2LQK A;  4BD3 A;  1JJ2 A;  3P8B B;  3OSV A;  2CS7 A;  3CXC A;  4JLI A;  1BI0 A;  4FM4 B;  1WJR A;  4XU2 A;  5GAN g;  1MHN A;  3DB4 A;  1RI0 A;  4MZT A;  4EMK C;  4BE0 A;  1B34 A;  3OS1 A;  4M7D D;  4PJO C;  2O4X A;  4M7A D;  3ME9 A;  5GAN 5;  5LJ3 f;  3QYH B;  2ZPB B;  1XNI A;  4LDY A;  1N8R U;  5IN1 A;  2DPP B;  2K4Y A;  4A4E A;  5CQX A;  3OBW A;  2QEX T;  4C92 B;  2D9T A;  4N0A C;  1NJI C;  4R55 A;  3FJP A;  3JCM P;  4M75 D;  3BDU A;  4KUI A;  4LDV A;  3CC2 A;  2V8J A;  3VYH B;  4B9X A;  3ZBD A;  2JOY A;  5CCA A;  4E7J A;  4V2S A;  4LD6 A;  1UGQ B;  3CCQ A;  4J5Y A;  4JRQ A;  1Q81 C;  4ZGJ B;  1KC8 C;  3GOX A;  5J3B A;  2HQX A;  2K5I A;  4OGE A;  5AYF A;  4JS5 A;  1IZ6 A;  3JCM V;  4EMG A;  3PTA A;  2EQJ A;  1UGR B;  2DIG A;  4M78 G;  1K8A C;  1I8F A;  2LQ8 A;  4HCC A;  1P92 A;  2DAQ A;  1JRI A;  4A53 A;  3CD6 T;  4DOW A;  1U1T A;  4L59 A;  4C8Q G;  5LJ5 g;  3I55 A;  2EQU A;  2X35 A;  3WVD B;  1S72 T;  3V7R A;  3ZEH A;  3OYG A;  4M77 D;  3OA6 A;  3OSS C;  3CCR T;  2HAX A;  2OTL A;  3BW1 A;  3QSU A;  4C8Q E;  3HRU A;  5I2S A;  2QXF A;  1UGP B;  1WNL A;  2ZPI B;  4IUQ A;  1KQ2 A;  2RH2 A;  2V8I A;  3M53 A;  4NS5 A;  4M78 F;  1U1S A;  2FL7 A;  3WXM B;  5GMK e;  2GF7 A;  3JCM e;  1WQW A;  5GAM g;  3CCV T;  2XDD A;  2X4Y A;  4BE1 A;  5D6X A;  4J7I A;  2PVD B;  3JB9 J;  4L6V 5;  4C8Q F;  3HRS A;  2ZCF B;  5HY6 A;  2OTJ A;  4C92 D;  3OYJ A;  3RUX A;  1Q86 U;  3CCL A;  4JRI A;  3AHU A;  2ZZD A;  2XD0 A;  2L5Q A;  3JCM X;  4HA8 A;  4OB1 B;  1YI2 A;  2VC8 A;  4J6X A;  2RO0 A;  1OZ3 A;  2XID A;  4J6W A;  1KQ1 A;  2WSC E;  1YJW T;  1W2B A;  1NPR A;  4J8O A;  1QVP A;  3HFN A;  1NPP A;  3NTI A;  3RMS A;  3VKI A;  3TRE A;  1NZ9 A;  2RI2 A;  3M4Y A;  3OYD A;  2E10 A;  4NOY A;  4CI0 C;  3S3O A;  5GAN d;  2MWP A;  3SWN C;  3TEE A;  1G3W A;  4C0F A;  2HD0 A;  3JB9 I;  3CCJ T;  1M90 C;  3G6E A;  2EKO A;  3V8K A;  1KG1 A;  1UEB A;  3M55 A;  3CD6 A;  2WAC A;  3R6O A;  1R8O B;  2CGH A;  4XAX B;  3H8Z A;  3MEA A;  3JCM f;  3CMA A;  2DKG A;  3CCE A;  2P0Q A;  5J39 A;  3FC3 A;  1XQH A;  1VUB A;  3OYY A;  1VQM T;  1K9M U;  5GAO p;  4EMK A;  1HK9 A;  1VQ8 T;  5GMK l;  4PJO A;  5GAO r;  1DJ7 B;  1YJ9 A;  3FEO A;  4EMH A;  3MP6 A;  4M78 C;  1VQK A;  4PLI A;  5CQY A;  4F7U F;  4F7U B;  3A8L B;  5FU7 B;  4C8Q C;  4C0D B;  2EJG A;  5GAO m;  1QVF A;  5GAN 4;  2FB7 A;  2L8D A;  2HNI A;  2VGM A;  2MAM A;  4N0A A;  2O01 E;  1M4Z A;  1UGS B;  4Q5W A;  4IUV A;  3P8H A;  4BI8 B;  2HBP A;  4M7D B;  3V8J A;  2L89 A;  4JRK A;  5LJ3 g;  5A0D A;  2R57 A;  1I4K 1;  2PVG B;  3QHS A;  4C0G A;  1YJN A;  1WPY A;  2XG8 D;  2EAY A;  2LNV A;  3NTK A;  2KVQ G;  5LJ5 d;  5GAO l;  3JCM d;  3UT1 A;  1VQ7 A;  2Y4Y A;  5CKB A;  2QQ9 A;  4N4I A;  3SD4 A;  3L2V A;  3CC2 T;  4HKE A;  1N9R A;  4M75 B;  1WJS A;  2M1H A;  2PQW A;  3CPF A;  4QVZ A;  2VXF A;  4RG2 A;  3EFS A;  3PGG A;  1M1F A;  5LJ3 e;  3CCQ T;  1JJ2 S;  4IUT A;  4NL2 A;  3CXC S;  1Y07 A;  3LLR A;  4A4G A;  2LCC A;  3MO8 A;  4ELZ C;  4EDU A;  4UC4 A;  3E9F A;  4N4H A;  4QW2 A;  3RIR A;  4DQ2 A;  5GAM d;  4E7I A;  4XTU A;  4JUV A;  3CCJ A;  4OB0 B;  3CBP A;  1Q7Y U;  3L2Q A;  4DOV A;  3SB2 A;  2RI5 A;  2M0O A;  1KD1 C;  5KE3 A;  4PJO D;  3KUF A;  4OVA A;  2DZC A;  4BY6 B;  3INZ A;  5C0M A;  3QPH A;  3I55 T;  3QKJ A;  4M7A E;  1VQN T;  2EYQ A;  5GAN j;  3LH0 A;  3OYE A;  1Q81 U;  2OTL T;  1KC8 U;  1Q82 C;  3OBY A;  3A5Z B;  4OB3 B;  1YBY A;  3HL8 A;  3NTH A;  4B9W A;  1B34 B;  2DD5 A;  3RKW A;  3VV0 A;  5CAI A;  2O4X B;  3JB9 D;  1Y7X A;  1ZQ1 A;  4M75 E;  3C94 A;  3QJ6 A;  4OF1 A;  5HK3 A;  4JDS A;  4X9C A;  2KY9 A;  2VYT A;  3PFS A;  4HT9 A;  3DB3 A;  1K73 U;  3E1S A;  2OTJ T;  4MDX A;  4EPC A;  3CCL T;  4ME7 A;  5A2Q E;  3FIF A;  1YI2 T;  1VQ9 A;  4BI4 A;  1G3T A;  2NLU A;  5CKE A;  3G71 A;  2K5F A;  4JLG A;  3SWN A;  3URG A;  3VYG A;  5HK0 A;  5GAO n;  1UB4 A;  1GXI E;  4M77 G;  4QQG A;  3N5B B;  3PNW C;  1O75 A;  2DXC A;  3CME A;  2R5A A;  4M77 E;  3O8V A;  4P5N A;  2K2V A;  3ER0 A;  3OMC A;  3OYC A;  2R58 A;  3C4S A;  4GLK A;  4XQ3 A;  5LJ5 j;  4C5H A;  4FT4 A;  1M1G A;  3CCU A;  4OGC A;  3GIB A;  2E65 A;  4J83 A;  4M78 A;  4Y28 E;  5LJ3 d;  3G6E T;  1VQO A;  1I5L A;  3OYA A;  4ELY C;  3PMI A;  1LNX A;  2RB6 A;  3CMA T;  3OW2 A;  2LRQ A;  3JCM g;  3CCE T;  5LL6 S;  4C8Q A;  4C5I A;  4C92 G;  4BE2 A;  1VQN A;  5D6W A;  3QBY A;  4XU0 A;  4Z02 A;  2DTH A;  5GAM j;  1X01 A;  2ZPG B;  5CO7 A;  2QQR A;  2Y4X A;  1HXD A;  2EQK A;  4C92 E;  2ZPF B;  4ZGE B;  1YJ9 T;  1VQK T;  3X24 B;  4M7A C;  2ZGW A;  2LT4 A;  2PVO B;  4L5G A;  1BI3 A;  3CCS T;  2XIC A;  1M5Q 1;  3SFM A;  3V7C A;  1OZ2 A;  3OYM A;  4QQ6 A;  5J26 A;  4C92 F;  2DXB A;  4O5V A;  4M75 C;  1LOJ A;  3MET A;  2DIQ A;  3CCM A;  1N8R C;  1FX7 A;  4CRI A;  4RKU E;  3M58 A;  3G4S T;  1YJN T;  3TCJ A;  1YHQ A;  2X4J A;  3JCM J;  1VQ7 T;  2DXU A;  2L3R A;  1M1K C;  2CZ0 B;  2CZ6 B;  4BDZ A;  4DA4 A;  4MMK A;  4FSX A;  1N6A A;  2DZ9 A;  3M54 A;  2RK2 A;  5HKC A;  5DY9 A;  3OYI A;  1M9S A;  1QVF S;  4M78 D;  2DTI A;  3HFO A;  5FU6 C;  3JRZ A;  2EWN A;  2MF2 A;  3E9G A;  3JSC A;  4XU3 A;  4C8Q D;  4X9D A;  4KUL A;  3ASK A;  4RMO A;  2IG0 A;  3P8D A;  4M77 C;  2F5K A;  1JBM A;  2M16 A;  3UDC A;  4FIB A;  4FL6 A;  4PL6 A;  5KCH A;  1YIT T;  2C06 A;  4EMK B;  2KSS A;  4PJO B;  3S6W A;  3EFR A;  2DEQ A;  4A54 A;  1OI1 A;  5KCO A;  3OYB A;  3RER A;  2R5M A;  2QDY B;  4TVR A;  3CPW A;  3F70 A;  3MP8 A;  2LC4 A;  1D3B B;  2FHD A;  2JTF A;  2M9U A;  3DLM A;  3M59 A;  3SDZ A;  3VJP A;  4IKF A;  1BKB A;  1ZHI A;  3HPW A;  2A3L A;  1I81 A;  4RG8 A;  4C92 C;  3CCS A;  3DLL A;  3LW5 E;  2RI3 A;  1X75 C;  2ZPH B;  4VUB A;  2IVW A;  2RJD A;  2AHJ B;  3I56 T;  2JNG A;  4XTY A;  3M9Q A;  3G4S A;  3OQ5 A;  4XU1 A;  1Q86 C;  4J6Y A;  4HT8 A;  1EIF A;  1QW1 A;  2RHU A;  3GF5 A;  3UWN A;  3VU3 C;  3M57 A;  1KQS A;  4E7H A;  1VQ9 T;  3G71 T;  2BKD N;  2F69 A;  2X4X A;  3QO3 A;  5CK9 A;  5GAN 8;  1IRE B;  3FRN A;  3BFM A;  3L2R A;  2RJE A;  4JRP A;  3QII A;  2E5Q A;  1YIJ A;  3CEY A;  2EJF A;  1VQ5 A;  4D6W A;  3QZ5 B;  1XTD A;  5CKF A;  1BYM A;  3CME T;  2JTM A;  3X28 B;  3LGF A;  4F7U E;  2V8K A;  2VGN A;  2VXE A;  3L42 A;  2PU9 B;  2PUO B;  3J81 E;  4M7D G;  3JAM E;  1SSF A;  3OYK A;  3C95 A;  3CCU T;  1VQO T;  1YIT A;  4M7A A;  4M7A G;  1NJI U;  4FT2 A;  2KMT A;  2QA4 A;  4JS4 A;  4ZN1 A;  4M7D E;  2RJC A;  1K9M C;  5FLX E;  3JB9 H;  2RHZ A;  1Y96 A;  5CKD A;  2BUD A;  3NFC A;  4WF2 A;  4BI3 A;  4E47 A;  5FRN A;  3QYG B;  1VIE A;  1VQ6 A;  4M75 G;  2RD1 A;  2DK3 A;  3RKY A;  3L2W A;  4KBM B;  3MEV A;  2BIV A;  4M7D F;  4M7A F;  3HP9 A;  3FDR A;  3A8H B;  4N4G A;  5I21 A;  3UPU A;  1NE8 A;  3CC4 A;  2K3Y A;  2JZ2 A;  3PIP A;  1K8A U;  3I56 A;  2XI9 A;  1M8V A;  3VUB A;  2EFI A;  1VQL A;  3MP1 A;  3DKM A;  4E7K A;  5GAN 6;  3CCM T;  4ZGD B;  3G7Z A;  3GNF B;  5FRM A;  2GCX A;  3OYN A;  4M75 F;  3SWN B;  1YHQ T;  1QVG A;  3MHX A;  2LCL A;  2WSF E;  4JJN K;  3CC7 T;  4IUP A;  1FXX A;  3OS5 A;  3EAE A;  5I2M A;  4IUU A;  3JCM b;  3HSB A;  2LDM A;  4J7F A;  5C6S A;  5GAN 7;  1VQ5 T;  2D0Q B;  2RK1 A;  4M77 A;  5CKH A;  1N27 A;  4A4H A;  1VQ4 T;  2XU8 A;  2X4W A;  3LX7 A;  3RKX A;  3MEW A;  1N9S A;  2KDS A;  3A8O B;  4YTL A;  3KBG A;  3M5A A;  1G5V A;  4OB2 B;  2RHI A;  5GMK j;  3QXE B;  4M78 B;  2XK0 A;  1BIB A;  1TH7 A;  5GMK i;  1Q7Y C;  1MGQ A;  5GAN h;  2RM4 A;  4KUD K;  4C8Q B;  3OMG A;  4A4K A;  4MZM A;  1BI2 A;  5GAN e;  1XOV A;  2EJ9 A;  2QQA A;  5FU7 C;  4GY5 A;  4E7L A;  4C0D C;  3CBO A;  4M77 F;  4C92 A;  2E6Z A;  2VV5 A;  2JUF A;  1M1K U;  1W2B S;  1YCY A;  4PLL A;  3L1A A;  1LJO A;  2GQV A;  4LDU A;  4M7D C;  1RL2 A;  2PUK B;  3V7S A;  1WQ7 A;  5CR2 A;  2ZPE B;  3A8G B;  3QG1 A;  4C5G A;  4RCC A;  4FU6 A;  4BB7 A;  5DM7 R;  4ZN3 A;  2RJF A;  3QDR B;  2CKK A;  1M90 U;  4PKC C;  1VQP A;  5DLO A;  4LDX A;  2YRV A;  4II1 A;  2DD4 A;  3E19 A;  4O6J A;  2RHX A;  2LT1 A;  2P0K A;  4C5E A;  3OW2 S;  2HQE A;  1K73 C;  4LD9 K;  1V29 B;  2EQM A;  2QQS A;  4M78 E;  3JCM c;  4PNO A;  3CC7 A;  5M9O A;  2I2L A;  2YLB A;  3X25 B;  1BI1 A;  2A7Y A;  2WSE E;  3PMT A;  4LDW A;  2GFU A;  3CPW S;  5GAN f;  5GMK h;  5LJ5 h;  3JCM h;  4BUG A;  3FB9 A;  3S3N A;  1VQ4 A;  1YIJ T;  1H3Z A;  1PSE A;  2VUB A;  2E41 A;  1Y71 A;  3QUI A;  2P4T A;  4BY6 C;  3L2Z A;  3OB9 A;  3BY7 A;  4MZP A;  5LJ5 e;  3JCM W;  2Y90 A;  1G3S A;  4IUR A;  2H3J A;  1G3Y A;  5CVI A;  2LVM A;  2QEX A;  2E12 A;  2GFA A;  3ZFJ A;  5GAM h;  5IAY A;  3J80 E;  4QVD A;  3C12 A;  5GAM e;  3JCM Q;  1KQS S;  4XTV A;  5KE2 A;  2QA4 T;  2G3R A;  2MMP A;  5L8R E;  1U8R A;  3M4G A;  4MML A;  3V8L A;  1H64 1;  2K57 A;  3GNG A;  3MCA B;  3VUZ A;  2K3X A;  4X34 A;  2QI2 A;  1WGS A;  2DO3 A;  2JN0 A;  3LGL A;  2DXT A;  3OYH A;  2KAF A;  3Q1J A;  1VQ6 T;  3OY9 A;  1VIF A;  2CYZ B;  5KH6 A;  2QTX A;  3OS0 A;  2K5L A;  3X26 B;  5LJ3 j;  3MEU A;  5GMK m;  1JB0 E;  3CC4 T;  1X6O A;  2RHY A;  1KD1 U;  2YLC A;  2XDP A;  4OMF B;  1VQL T;  2XDB A;  5LJ5 f;  1FWZ A;  5DLQ E;  5A0L A;  4BAC A;  1S72 A;  5D6Y A;  1OYX A;  2XHC A;  2FYK A;  1BIA A;  4PJO G;  3CCR A;  2E64 A;  4XTZ A;  4C0Z A;  1Q82 U;  3PIO A;  2EIF A;  3GP8 A;  4PJO E;  2B8A A;  3L2U A;  2MWO A;  4OP0 A;  4XTX A;  5GAM f;  2P0P A;  3OYF A;  4F7U G;  1QP2 A;  2DTO A;  3CCV A;  1D3B A;  4F7U A;  4BDY A;  4ZTF A;  4KT0 E;  4HCB A;  2D6F A;  1WJQ A;  2XKO C;  3H6Z A;  2YHT A;  3X20 B;  3JB9 G;  5CIU A;  4A4F A;  1O9S A;  2KK4 A;  4M7A B;  1QP3 A;  4PJO F;  3HRT A;  3GPL A;  4QQD A;  2CZ1 B;  2E1H A;  2E70 A;  4M7D A;  3RES A;  3WVE B;  1YJW A;  1Y96 B;  4Y91 A;  3PT9 A;  5GAO q;  4ZTJ A;  2MI6 A;  3QJY A;  1QVG S;  3LYI A;  5LJ3 h;  3M56 A;  3FLG A;  3GLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...