1K76A

Solution structure of the c-terminal sem-5 sh3 domain (minimized average structure)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
publication title Solution Structure, Dynamics and Thermodynamics of the Native State Ensemble of Sem-5 C-Terminal SH3 Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k76A00
2PNIA 2RQTA 1OPKA 1OV3A 1W1FA 1YP5A 2ED1A 2NUZA 5GJVB 2MCNA 2D1XA 2JXBA 1B07A 4HXJA 2LQWA 2F2VA 3TSWA 1N5ZA 2JS0A 3UA6A 2X3WD 3QWYA 2J6OA 3PVQA 2FPFA 1ZBJA 2CH4W 3NGPA 2HDAA 3SHWA 3EHQA 1AWWA 1X6GA 2VWFA 1AZEA 2C0OA 1PRLC 1KJWA 1CSKA 4Z88A 1UG1A 1M3AA 4J9IA 5IH2A 1UUEA 2VKNA 2V1QA 2JM9A 1QWFA 3M0TA 1U06A 1FMKA 2CH4A 2DRMA 1S1NA 3FJ5A 2EYWA 5GJWB 5L23A 2A28A 3VS0A 2ECZA 4OMMA 1M30A 1CKBA 1VYTA 2ESWA 1UECA 1T0JA 1RUWA 1UJYA 4HVUA 1SSHA 3VS1A 1Z9QA 2RQRA 1BB9A 4JJDA 2OJ2A 5IXFA 2A37A 2LQNA 3JV3A 1U3OA 2DVJA 1BBZA 2M0YA 4LN2A 4D8DA 3REBB 1NYFA 3CQTA 2O31A 1ZUYA 2FO0A 4HCKA 2KRMA 1WI7A 4J9CA 1K4US 5FW9A 2J7IA 1AOJA 2BZYA 4LUDA 1M3BA 1WDXA 2DYBA 4K11A 4A63B 1UTIA 5EC7A 1H92A 4CC3A 4RUGA 4J9FA 2PZ1A 1YWOA 2DILA 1QLYA 1CKAA 1GFCA 2K3BA 1I07A 2W0ZA 2RMOA 1I1JA 2EPDA 2D8JA 2KROA 2RQVA 2LZ6B 1Y0MA 2IIMA 3VS7A 2AZSA 3LH5A 1WXUA 2E5KA 1NEBA 3M0UA 3REAB 1SHFA 4ORZA 1WFWA 2KXCA 2O2OA 1V1CA 2O9VA 2BZXA 2JS2A 2LMJA 3I5SA 4CC2A 2DL3A 2EYXA 1IO6A 1SEMA 2AK5A 2G6FX 3R6NA 1AWJA 1AVZC 2FEIA 3VS2A 2JTEA 1I0CA 3U23A 3M0SA 2DL5A 1RLQC 2K9GA 2RQUA 1WX6A 4LE9A 2I0NA 1AWXA 4RTZA 2OI3A 2EYYA 2YSQA 2EYZA 4RTVA 2L2PA 2KT1A 4CC4B 3NPFA 3TSZA 2DL8A 1X2QA 1E7OA 2K2MA 1GCPA 1NM7A 1ARKA 2LJ3A 1W70A 1B3QA 1YNZA 2D0NA 1K0SA 1K9AA 2CDTA 4M4ZA 1KSWA 5FWBA 2JM8A 4F17A 4E6RA 2OAWA 1MV0B 1NLPC 2HBWA 2DX1A 4JJCA 2DRKA 2X3XD 1T0HA 1ZLMA 1XOVA 1GCQC 3M0PA 5IHKA 2RN8A 2XMFA 1QKWA 2EKHA 2DL4A 2ROLA 1UJ0A 2FPEA 2L3QA 1UFFA 1JQQA 2BTTA 2KE9A 4JJBA 1MV3A 2GTJA 1QCFA 1W6XA 2KGTA 4Z8AA 1GBRA 1WYXA 2YT6A 4OMQA 1EFNA 2ENMA 4X1VA 2MOXA 1Z9ZA 2FG0A 1UHFA 2YDLA 2RPNA 1FYNA 4D8KA 2J06A 2O9SA 2A36A 2CREA 3H0HA 4AFSC 1TUDA 2HSPA 2KRNA 4IIMA 2AZVA 1UE9A 1U5SA 4FSSA 2CT4A 2YUQA 2DF6A 3VRZA 1OOTA 1NG2A 1NEGA 2MIOA 1TG0A 4CC7A 3I9QA 4QT7A 1JXMA 1VYUA 2RNAA 4KRTA 1ZX6A 3PVLA 4R0KA 5IHNA 2SEMA 4OMPA 1PHTA 3M0RA 1E6HA 1RI9A 1NLOC 1Y57A 2DLPA 5ECAA 2SRCA 2VVKA 1PWTA 4HVWA 2AKLA 2KYBA 1ZUUA 1PNJA 1WLPB 1H3HA 1BK2A 2EGEA 1K0XA 1A0NB 3RBBB 3IQLA 2ED0A 3C0CA 1SRLA 2RQWA 1NYGA 1AD5A 1WXBA 3H0IA 1PKSA 1JEGA 1KIKA 1GL5A 2AKKA 1T3LA 1GFDA 4RTWA 3VS5A 2W10A 1GCQA 1ZSGA 1JU5C 1M27C 4RTXA 3EG2A 1PKTA 4DEYA 2EBPA 2KNBB 5FWCA 4F14A 3VS4A 3VS6A 4OMLA 3ULRB 1WIEA 2D8HA 1HD3A 3TVTA 1SHGA 1G2BA 1X43A 2EQIA 2EVRA 4J9HA 1M8MA 5HCKA 1YWPA 2JMCA 2K7AA 1X2KA 1AEYA 1HJDA 4Y92A 2KT8A 3PE0A 2M51A 4DEXA 2L3PA 2O88A 3UATA 1J3TA 2LP5A 2CUDA 3RNJA 1QWEA 1QKXA 2YUPA 4F16A 1OEBA 1RLPC 3ZL7C 4OMOA 2J05A 1H8KA 3O5ZA 1OPLA 1SPKA 3VS3A 5IXBA 2HEQA 2L0AA 2GQIA 1AWOA 1UDLA 1VA7A 2ABLA 1JXOA 4ESRA 2GNCA 4AFZC 2DM1A 1GBQA 2HCKA 1G83A 3SEMA 1MUZA 2PTKA 2FRWA 2KYMA 2RF0A 4GLMA 1UHCA 2GTOA 2NWMA 4RTYA 2JT4A 3QWXX 2DL7A 2C0IA 2DA9A 2JW4A 2FRYA 4J9BA 1ABQA 3GBQA 2F2WA 4JZ4A 2GGRA 3H41A 3KFVA 4J9EA 4RTTA 4WCIA 1VYVA 1AZGB 2FPDA 2DBKA 4HVVA 2DNUA 3UA7A 1JO8A 2LX7A 3THKA 1WA7A 2KR3A 4J9DA 2A08A 2DE0X 3EG0A 1HSQA 1ZUKA 2KXDA 1TUCA 3A98A 3VRYA 2BZ8A 4AFQC 4EIKA 3EHRA 2J6KA 3M0QA 2EGCA 3EGUA 2CSIA 2J6FA 1X6BA 4JZ3A 1PRMC 1UGVA 3NMZC 4Z89A 3NHNA 3I5RA 2JMAA 1BU1A 2LCSA 1YN8A 3I35A 1X27A 2DMOA 4JPBW 4AG1C 2F2XA 2DJQA 1KFZA 2V1RA 2CUBA 1E6GA 5I22A 2KRSA 4ZNXA 2YUNA 2CSQA 2GBQA 2K6DA 3EG3A 1WXTA 2KEAA 4IIOA 4J9GA 3EG1A 2DBMA 2ROTA 1ABOA 2LJ1A 2LNHB 2LJ0A 2EW3A 1M3CA 1SRMA 1YCSB 2EGAA 2P4RA 2QDLA 3H0FA 4AG2C 1LCKA 2B86A 1GRIA 3UF4A 4RTUA 4LUEA 1K76A 2K79A 5IHIA 2H8HA 5I11A 4AFUC 1T3SA 2YUOA 2L3SA 4OMNA 2C0TA 1X69A 4GBQA 2KBTA 4LNPA 2CT3A 1K1ZA
chains in the Genus database with same CATH superfamily
2PNIA 2RQTA 4XTVA 4HCCA 3E2UA 3HFOA 3P8BB 2K4YA 2JS0A 2X3WD 1MMAA 2J6OA 3G71A 1S72T 2FPFA 1YJNQ 3NGPA 3VKIA 2VYTA 4IUVA 1QVFS 2C0OA 1M1KU 3PIOA 2F5KA 1JBMA 3BW1A 2V1QA 3KBGA 4QQ6A 3URGA 3CCST 4F7UG 2CH4A 4QVDA 2DRMA 1S1NA 3FJ5A 1FMWA 3EG9A 5CCAA 4EMHA 4C5GA 2DXTA 4MZPA 2HSEB 4PJOD 1VYTA 1UECA 2QAZA 2XKOC 3CCEA 4HVUA 1NJIR 2RQRA 3I56A 2OJ2A 5IXFA 1YI2T 2A37A 2LQNA 4N4IA 4PJLA 2K3YA 2DVJA 3TREA 3DLLA 4HCKA 4FYVB 2DIQA 2JJ9A 3UDCA 5FW9A 1N8RC 1W2BS 1AOJA 4MMLA 2WSFE 2PVOB 4K11A 4M75D 2VB6A 3AHUA 3SDZA 4RUGA 3BDLA 2W0ZA 2OX7A 3CEYA 4A4FA 2D8JA 2KROA 2VXEA 1H641 4R55A 3GOXA 3RIRA 5GAN7 1WFWA 2FZGB 1YIJA 3CCVT 2RB6A 1K9MC 4PJNA 1VQLQ 2JS2A 2LMJA 5IT9E 5CKDA 2DL3A 4RKUE 5AYFA 3R6NA 4JRIA 2FEIA 3VS2A 2RJCA 1VQOA 3PGGA 1ZA1B 5DM7R 2RJDA 4C8QA 3CCQQ 5GMKl 1I5OB 3EG9B 3OY9A 2LQ8A 2OI3A 3CD6Q 2I2LA 5EG2A 3M56A 3OYAA 2KQWA 2QDYB 4CC4B 1OQKA 1VQ4Q 3G6EA 4IURA 4FCYA 2FHDA 4C92A 2K2MA 1ARKA 4BACA 2LJ3A 1MMNA 1W70A 4F7UB 1K0SA 4E47A 2CP3A 1K9AA 2KI7A 3QXEB 4M4ZA 2YWWA 1M90U 4O5VA 1VQ7T 4C0ZA 1TOVA 1YITA 1GCQC 3S3NA 2QEXT 4BI8B 3KUFA 3CC2A 2MWPA 2KE9A 4Z8AA 2E4HA 3LGLA 1WYXA 3V7CA 5L8RE 5I21A 1WHGA 4M7DG 2YDLA 2RPNA 4PJMA 3P8DA 2EFIA 3MPUB 2EJFA 3FC3A 5KYXB 3OA6A 4XU3A 5LJ3d 2YUQA 3FEOA 1VQMT 1RAGB 3VRZA 1VIEA 1NEGA 3Q1JA 1HK9A 3I9QA 4QT7A 4C8QB 5A0LA 3I55Q 1VQ6Q 5IHNA 3VUZA 4EPCA 1ZSZA 1YJNA 2JZ2A 1E6HA 4QKUA 3OS5A 2BUDA 2GFUA 2SRCA 2CP7A 3HTRA 4HVWA 3GF5A 3OW2A 1ZHIA 4C92B 1QVGP 2YLBA 3UPUA 3RBBB 4E7ZA 5I2MA 1FXXA 2JVVA 3A8GB 1T3LA 3OYBA 2AIRB 3D7SB 2YLCA 2K5IA 2EBPA 5FU6C 5FWCA 1D1CA 4OMLA 4HCZA 5CK9A 4ELZC 2M9UA 3TVTA 2O01E 1YJ9T 5GAOr 3T9NA 2RI3A 4Z02A 2EVRA 3EGDB 4M77C 5LJ5e 1YWPA 1VQ5T 1DJ7B 2RI2A 3O8VA 2IPOB 2HZYA 3L2RA 4B9WA 3MKDA 1X75C 3QYGB 2GF7A 2M51A 2PVGB 1J3TA 3M4YA 3CC7T 3G4SQ 1D3BA 2LVMA 3MP1A 3L2WA 4OMOA 1N8RR 3QKJA 4OMFB 5HK3A 4PLLA 2HEQA 2L0AA 1ZSZB 1QVGA 1AWOA 1PCXA 1UDLA 5GAMg 4B9XA 2IVWA 4CI0C 1TWBA 2E65A 1LOJA 5GMKj 3OYLA 1G83A 3BE3A 3SEMA 3JB9G 2XICA 4OVAA 4PK4A 2DTIA 1MNEA 4NL2A 1BI1A 4RTYA 3QWXX 2DL7A 1G3WA 1BIBA 1B7TA 4J9BA 5D6YA 1K9MR 4M78G 3H41A 1BKBA 3KFVA 4WCIA 3OW2S 1VYVA 3M4GA 4IKFA 2DBKA 2DFUA 2M16A 3OYEA 3KXTA 2JUFA 2LX7A 1WA7A 1VQNT 2A08A 3R6OA 4M77F 2CP0A 3CPWP 4A4KA 1D09B 4O6JA 3X28B 1QMCA 4KH0B 1ZUKA 4Q5WA 2RI5A 1ACMB 1VUBA 3JCMP 1NZ9A 1KG1A 3OBWA 4ME7A 4UC4A 3EHRA 3M0QA 3EGUA 2M0OA 4QQGA 3CCMT 5GAMh 1UGVA 4Z89A 2AT1B 3I5RA 3EFRA 4JLIA 1KHCA 1D3BB 2X4JA 5GAOl 2DJQA 4OF1A 3SFMA 1KFZA 5I22A 4ZNXA 2YUNA 1BIAA 5A2QE 1IHVA 1QVFP 4ELYC 4BE0A 3QIIA 1RAAB 5GMKe 2KEAA 3EG1A 2ROTA 1ABOA 2X4WA 1WJQA 1X6OA 5KYWA 1M3CA 3CMAT 4HT8A 4XTUA 2COYA 3OS1A 1SRMA 1WJSA 3H0FA 4BE1A 4EDUA 2DJZA 3UF4A 5GAN2 1K76A 5I11A 3PMIA 3VUBA 2L3SA 1VQ9T 4LNPA 4C0GA 3I55A 1VQ6A 3DLMA 1BCOA 4AMCA 1RACB 2DXUA 3OYIA 2RHUA 4J83A 1QVGS 1YP5A 2ED1A 2D1XA 1VQ8A 2JXBA 2NLUA 3A8HB 3F70A 7AT1B 2QEXQ 3CPWA 4KULA 3QPHA 3TSWA 5LJ3j 3QWYA 4BI4A 3NFCA 2DEQA 2PQWA 3HRTA 1W2BP 3A1PA 4DBQA 2HDAA 3SHWA 3X20B 4M78C 2E6NA 1AWWA 3WVEB 1X6GA 3QYHB 1HYOA 5KH6A 1AZEA 1QQJA 3JCMX 1Q95G 1CSKA 4BE2A 4FW2A 1R0BG 1UG1A 5IH2A 2CP2A 1QW1A 2QQBA 4M7DD 1QWFA 1FMKA 1YIJQ 2EKOA 2X35A 3LWIA 1QVFA 2EYWA 1YBYA 2ECZA 4OMMA 1M30A 1K8AU 2XDBA 3H8ZA 3M57A 1S72A 2ESWA 3X25B 1SSHA 2HNIA 1Q82C 1Z9QA 3CCJT 2EJGA 1BB9A 3LW5E 1HXDA 1FWZA 3SWNB 5KYYB 5KYWB 1SF9A 1U3OA 4LN2A 1BBZA 2E41A 2M0YA 1IHWA 2R5MA 1NYFA 3NTKA 2O31A 4JRQA 4KGVB 2EQMA 2FO0A 4LDUA 1WI7A 1KQ1A 4PLIA 5C6SA 4E2FB 5AT1B 3ZFJA 1Q7YC 3JB9F 1U1SA 2QQRA 2PZ1A 5LJ3e 1QLYA 1ZBXA 2K3BA 1I07A 2DYIA 1RABB 2AHJB 4XTYA 1N27A 2EPDA 1Y96A 2KSSA 1Y0MA 1YI2A 2RK1A 2DETA 3RR6A 3GP8A 3M59A 2E5KA 2NUPB 4PJOF 1NEBA 3M0UA 1YITQ 3OYFA 3GPLA 1UB4A 3REAB 5A0DA 5GAN4 4XU1A 5LJ3f 4PNOA 3CCUT 2BZXA 1KC8C 3I5SA 2EYXA 1Q86C 1SKUB 2G6FX 1R8OB 1K73C 4BY6B 2LT4A 4PFPA 4ZTFA 2HKQB 5CO7A 3CPWS 2DL5A 4P5NA 1WX6A 4LE9A 2RD1A 1AWXA 1H3ZA 4XU0A 1M1FA 1WQWA 4DOWA 4RTVA 4FSXA 2L2PA 3QJ6A 2LRQA 2CS7A 3TSZA 2DL8A 3CCVA 2RJEA 1B34A 2H3JA 1YNZA 2OTLT 1Q81C 3LGFA 4PFOA 1TSFA 1KSWA 1XJWB 4F17A 3OYHA 1M1KC 1OZ3A 2QA4T 3TCJA 3JB9D 2DRKA 3L42A 1T0HA 2K3XA 1XOVA 3M0PA 1WHKA 5IHKA 2RN8A 1QKWA 3JCMJ 2DL4A 2ROLA 2FPEA 4N0AC 3QDFA 1Y96B 2BTTA 3PMTA 4M77E 4JJBA 1VQNQ 1QCFA 2KGTA 4BDZA 2JN0A 1GBRA 4M78D 2YT6A 1BCMA 2V8IA 4X1VA 3FJPA 1G5VA 4KUIA 2K5FA 2FB7A 2MMPA 2XG8D 4D8KA 2J06A 3H0HA 3CXCP 3CCMQ 1TUDA 2HSPA 2KRNA 3JB9I 1U5SA 2CT4A 4GLKA 1OOTA 1QVPA 3X24B 2QEXA 1G3TA 4MMKA 1YJWT 2MIOA 3OS2A 1TG0A 3MP6A 4CC7A 1N6AA 1WJRA 2HAXA 2RNAA 4KRTA 3EGXA 2DVEA 2SEMA 4OMPA 3ZBDA 1LVKA 1NLOC 2P0QA 4IUPA 4E7KA 1PWTA 2OAUA 3BY7A 2AKLA 3OYGA 4C8QG 3M53A 4FYYB 1K0XA 5CKEA 1A0NB 1B34B 2LC4A 2OTJT 2ED0A 3C0CA 2DERA 2RQWA 1NYGA 1PKSA 1KIKA 1GL5A 1VQ9Q 1GFDA 1GCQA 4C92G 3EG2A 2EJ9A 1KQ2A 2KNBB 3VS4A 1SSFA 3VS6A 2YRVA 1UGPB 1WHJA 2D8HA 5LL6S 1HD3A 4J6WA 1SHGA 5J26A 1X43A 2EQIA 1K9MU 1OZ2A 4C5HA 3UT1A 1M8MA 2JTFA 2JMCA 4X9DA 1X2KA 2FL7A 4M7AE 3CXCA 3NTIA 1HJDA 3OSVA 4DEXA 2A0FB 1RAFB 4MZTA 4HA8A 2L3PA 2O88A 3ASKA 1Q82R 3RKXA 3RNJA 3OW2P 2HKNA 3CCLT 3PT9A 5IN1A 1M90C 2DTHA 2MWOA 5GAOn 3EGXB 3PFSA 3EFOA 1YHQQ 1OPLA 3FDRA 2DPPB 3H9NA 2GQIA 4PL6A 1Q7YR 1VQ5A 3A5ZB 2QI2A 3WXMB 4AFZC 2A3LA 2DM1A 1GBQA 2HCKA 2HD0A 2X51A 3CC7A 2WSEE 2HL3A 4GLMA 2L8DA 5LJ5j 5D6XA 2JT4A 2QXFA 3X26B 3JB9H 2C0IA 4C8QC 2XIDA 2CP6A 3CMEQ 3QHSA 3GBQA 4J8OA 2F69A 1KC8R 3HRUA 4FM4B 3RESA 1PG5B 4J9EA 2Y90A 1AZGB 4IUUA 3JCMd 2DNUA 3UA7A 4PJOE 1K73R 4J9DA 2R57A 4LXCA 2QGFB 2ZPBB 4M77A 3EG0A 1IGUA 4F7UF 1HSQA 1XTDA 1VQ8Q 1F1BB 2HQEA 2BIVA 1FMVA 2QQSA 3VRYA 4EIKA 5DLOA 2J6KA 3CCUQ 3JCMQ 4BD3A 1PRMC 3NHNA 3ZEHA 1MGQA 2JMAA 3MHXA 1D0XA 5CAIA 5GAMd 1YN8A 4EMKA 1VQOT 1X27A 2DMOA 1I8FA 2RA2A 4JPBW 2LNVA 4M75E 4AG1C 4NS5A 2F2XA 2CKKA 1Q81R 2V1RA 4KT0E 4ZTJA 1VQNA 2HQHA 2CSQA 2GBQA 1G8XA 3EFOB 1M1KR 3CXCS 4IIOA 2DBMA 3CCRT 2QK0A 2LJ1A 2LNHB 3HPWA 2MI6A 2LJ0A 3G6ET 5CQXA 4A4HA 1S72Q 1YCSB 3MEAA 2QDLA 3CCMA 4AG2C 1LCKA 2XHCA 3OMGA 2WACA 3A8OB 5IHIA 4DA4A 4AFUC 2ZPEB 2ZPGB 4OMNA 4C0FA 2M1HA 2C0TA 2ZPHB 4GBQA 5GANd 4FT2A 4MZMA 4FIBA 3CPFA 1VQKT 4PJJA 1NE8A 1OPKA 1OV3A 2DO3A 2MCNA 4M7DC 3CCSQ 1B07A 4HXJA 5LJ3g 1ZSZC 1AT1B 5LJ5f 1N5ZA 4A53A 3CMAA 4JS5A 5GMKi 3GNFB 1PD0A 4JUVA 1KD1C 1OU9A 3EHQA 3UWNA 3VU3C 1YI2Q 4M7AA 4A4GA 4OP0A 1M1GA 2ZAEA 1VQ9A 3M58A 1MHNA 1PRLC 1WHHA 4Z88A 3HRSA 1LPLA 1M3AA 4J9IA 1UUEA 3VJPA 2VKNA 2JM9A 4E7LA 4QQDA 4EMKB 2PVDB 2A28A 3VS0A 1CKBA 1D0YA 3RKWA 1T0JA 1RUWA 2BKDN 3MEUA 3LYIA 1YJNT 4JJDA 4FYWB 2CZ6B 3JV3A 1LJOA 3V7SA 5LJ3h 4D8DA 2MK5A 4BUGA 2DIGA 1ZUYA 3VV0A 4II1A 1K4US 1RAHB 5DY9A 4N4HA 3CCVQ 4CRIA 1M3BA 1WDXA 4A63B 4C8QD 1UTIA 5EC7A 4CC3A 1OX9A 2CZ0B 2RHYA 1YWOA 1PM3A 2DILA 4QVCA 1YHQA 3RERA 4M7DF 1Y71A 4L59A 2RMOA 1I1JA 3M54A 3CCJA 1EIFA 2RQVA 2LZ6B 5J3BA 3VS7A 3MEWA 5I2SA 2AZSA 2JNGA 3LH5A 1WXUA 4C92D 4PJOA 1OX8A 2NYSA 2GFAA 1M90R 1SHFA 3OSSC 4ORZA 2KXCA 2R5AA 2XU8A 2G3RA 2QASA 1OI1A 5CKFA 2L89A 4M7AB 1FX7A 3PIPA 3JAME 1NJIU 4CC2A 4LDYA 1IO6A 2EYQA 1SEMA 2AK5A 3CMEA 2E3IA 2F5TX 3V8KA 1AVZC 1D1BA 3DB3A 2JTEA 3CCLQ 2VV5A 3U23A 4XAXB 3OYCA 2LDMA 2YRCA 4M75A 1RLQC 2K9GA 1VQ7Q 2RQUA 2EAYA 2VGNA 3OYNA 2RHIA 1BI3A 3WVDB 2MPXC 2YSQA 4FU6A 3NPFA 3PTAA 2YHTA 3CCUA 1VQLT 3DB4A 4C0DB 4LD9K 4J5YA 1B3QA 2QTVA 2D0NA 2CDTA 4E6RA 2V8JA 2KVQG 1MV0B 1NLPC 3CCQT 2DXBA 4QW2A 2X3XD 4JS4A 1ZLMA 1OYXA 2LQKA 3CD6T 3A8LB 3OB9A 1VQMQ 1MMGA 2XK0A 1WHMA 2QQ9A 2ZPFB 1VQ4T 2L3QA 1UFFA 3CC4T 3SWNC 5KCHA 1JQQA 1K8AC 1MV3A 2GTJA 1W6XA 4N4GA 4PJOB 4F7UE 1MMDA 2EIFA 4FYXB 5KCOA 1EFNA 2MOXA 2H3EB 3N5BB 1YFNA 1Z9ZA 2FG0A 5HK0A 4KUDK 2QA4A 3OMCA 4ATOA 5GAN6 3TU4K 1WQ7A 4IIMA 2AZVA 1UE9A 1BI0A 3MJXA 4OB1B 3C12A 3CCSA 2ATCB 2LTOA 5KYUA 2COWA 4KBMB 4M75B 4LDXA 3E9GA 5GANj 3QUIA 4B6MA 4GY5A 1Y57A 4WTOB 3CCRQ 3JCMe 1UGSB 2VVKA 5FU7B 3VYGA 4AT1B 1YJ9Q 1JJ2S 1VOMA 1ZUUA 1TH7A 2EGEA 3EH2A 4M78F 1BYMA 5D7UA 1VQ5Q 1SRLA 1U1TA 1WXBA 3E9FA 4BY6C 3EFSA 1JEGA 2K5LA 1VQPT 1RAEB 2AKKA 3PNWC 1TXQA 3QBYA 1KD1R 3RUXA 4RMOA 4OGCA 3HHTB 2XDPA 4RTWA 3VS5A 3JCMf 1TU0B 2W10A 3RMQA 3CC7Q 1ZSGA 1JU5C 1PKTA 4DEYA 2LT1A 2DKGA 5GAMe 1RL2A 2KAFA 3ULRB 3MP8A 1WIEA 3GNGA 1M8VA 3HL8A 1KC8U 1NBEB 4X34A 3FRNA 2ZCFB 1TUGB 3LX7A 4VUBA 4DQ2A 2K7AA 2OTJA 5CIUA 2HQXA 4L6V5 2XD0A 2PU9B 2QYZA 3UATA 4RG8A 1M9SA 2CUDA 3OYYA 3CBPA 1QKXA 2X9HA 1U8RA 1OEBA 3ZL7C 5GANe 1D0ZA 1I4K1 5KYUB 2XDDA 5CQYA 4F04B 4JRKA 3QZ5B 2FZKB 3TEEA 1Q81U 1BI2A 1JXOA 5GAOq 3HSBA 1W4SA 2GNCA 3J7AF 3L1AA 2F1LA 5GANf 5J39A 3G4ST 1TTHB 3OYMA 5LJ5g 3CCLA 2KYMA 2QQAA 1V76A 1UHCA 3OBYA 3LWHA 4E7JA 1VQ7A 1C6VX 5HKCA 2CGHA 3J81E 5FROA 4M7DE 2FRYA 5FLXE 1NPPA 4A4EA 2F2WA 2GGRA 1I81A 1C1AA 4RTTA 2FPDA 2RM4A 4HVVA 1KK7A 3HKSA 1JO8A 2CZ7B 5CKBA 3L2UA 4PFZA 3G1JA 3JSCA 4F7UA 1UGRB 1RADB 2YXYA 4ZGDB 2P4TA 2KXDA 3FIFA 3S3OA 1N8RU 3A98A 4JDSA 2BZ8A 4AFQC 4BB7A 3CMAQ 1RI0A 2EGCA 5CR2A 1X6BA 3BFMA 3INZA 4JZ3A 3NMZC 4YTLA 4XTWA 1KQSS 1VQMA 3I35A 4IUQA 2VXFA 3HFNA 5LJ5h 2CUBA 1E6GA 2LCCA 2A7YA 2D9TA 1XNIA 5A0GA 2K6DA 2KMTA 1WXTA 1I5LA 4HT9A 2P84A 4DOVA 1P92A 2LX9A 1M4ZA 3G71T 1IREB 3JCMb 2P4RA 2RJFA 2B86A 2COZA 5KYXA 2L3RA 4LUEA 1K8AR 2H8HA 3QJYA 2YUOA 4JJNK 6AT1B 2QTXA 4E7IA 3V7RA 8ATCB 2KBTA 2VGMA 2PUOB 2CT3A 4EMGA 2Z0WA 4J7IA 1W1FA 2NUZA 4ZN3A 5GJVB 4R56A 2LQWA 3CCRA 2F2VA 2DZCA 2E1HA 3UA6A 1YJ9A 3CC4Q 2HL5C 4LD6A 2DXCA 3PVQA 3QDRB 1ZBJA 2CH4W 3L2ZA 2HMAA 4C5EA 3CCET 2RK2A 3I56T 3CCJQ 1WNLA 2VWFA 2YRDA 1WZOA 2P0PA 1KJWA 3M9QA 2VC8A 3OQ5A 4DBRA 1VQKA 4M77G 4XTXA 2Y4XA 3M0TA 1U06A 2E10A 4XQ3A 3AT1B 2RHXA 4BI3A 2EQUA 4OB3B 3JCMc 5GJWB 1Y07A 5L23A 4L5GA 4E7SA 1WHLA 4JLGA 2V8KA 3EGDA 2VUBA 2CZ1B 2M02A 3C4SA 1UJYA 3VS1A 1Q86R 1GXIE 2MF2A 4C92C 1OU8A 2QGGA 4M78E 3REBB 3CQTA 2DD5A 2E3HA 2KRMA 4J9CA 3LH0A 2RHZA 2J7IA 4TVRA 1YIJT 4FL6A 5D6WA 2BZYA 4LUDA 1VQPQ 2DYBA 1QCNA 1H92A 1G3SA 3SB2A 5GMKh 5KE3A 4ANJA 4J9FA 3GLXA 2IG0A 1CKAA 4M7DA 4MDWA 1N9RA 1GFCA 5CVIA 4J6XA 4QVZA 4XTZA 2IIMA 1QCOA 4ZGJB 2WSCE 4RCBA 1EX4A 1PSEA 1M5Q1 2KY9A 2MAMA 3SD4A 2O2OA 5FRMA 2Y4YA 1V1CA 2O9VA 4NOYA 2FYKA 1N9SA 3FLGA 2HBPA 2OTLQ 4OB0B 4LDVA 2XI9A 1AWJA 2X4XA 1I0CA 4XU2A 4KGZB 3NTHA 4C8QF 3M0SA 2E6ZA 3QZ9B 4D6WA 2X4YA 2L5QA 2QA4Q 4M7AG 2I0NA 3OS0A 2E64A 4ZGEB 5GMKm 5FU6B 1YITT 2VASA 4RTZA 2KDSA 2EYYA 3C94A 3DKMA 2E5QA 2FZCB 4J6YA 1R0CB 2EYZA 3META 2KT1A 2DEUA 5GAOp 5C0MA 3CC2T 2D0QB 2JOYA 4C92F 1X2QA 2V26A 1YCYA 1E7OA 2EWNA 3JCMg 1GCPA 1NM7A 3LLRA 5M9OA 4M77B 3JCMV 2ZGWA 1UGQB 3M55A 4J7FA 5FWBA 2JM8A 2OAWA 1ZA2B 3M5AA 4EMKC 2HBWA 3ER0A 2DX1A 2KK4A 4JJCA 2NUTA 4A54A 1JJ2P 1KD1U 2D6FA 2XMFA 4M7DB 1Y7XA 2EKHA 3ME9A 4OB2B 1UJ0A 1YJWQ 1IXDA 3J80E 2GCXA 1IRXA 3RKYA 1VQLA 5KE2A 2BE7D 1UEBA 4FW1A 4XK8E 3OYDA 4RCCA 4OMQA 2ENMA 2LCLA 5IAYA 2RH2A 1UHFA 3MO8A 1FYNA 3QG1A 3CCQA 2JTMA 2O9SA 2A36A 2CREA 3L2VA 5HY6A 4AFSC 1X01A 2E12A 2OTJQ 4FSSA 3VYHB 2O4XA 2PUKB 4PJOG 5GAN8 3CD6A 3JCMh 2DF6A 2DD4A 5FRNA 1NG2A 1ZQ1A 1VQ4A 5GAN3 3CC4A 1R77A 1JXMA 1VYUA 5GANg 3GIBA 1ZX6A 3PVLA 4R0KA 1PHTA 3M0RA 1RI9A 4FT4A 2DLPA 5ECAA 2ZPIB 2MYSA 2DAQA 3HP9A 3RMSA 2KYBA 3G71Q 4M7AC 1SG5A 1OULA 1PNJA 1WLPB 1H3HA 1BK2A 4M75G 4M78A 3IQLA 4OGEA 1AD5A 3H0IA 1G3YA 3P8HA 1JJ2A 1NJIC 3S6WA 2BE9B 1QP2A 3BDUA 1M27C 4RTXA 2CP5A 2NUTB 4F14A 4LDWA 1M2OA 5GAN5 2R58A 4IUTA 3SWNA 5KYYA 1TS9A 1G2BA 4J9HA 4C0DC 5HCKA 3EH1A 1PSFA 4Y28E 1O75A 3CCEQ 5GANh 3TQ7P 3C95A 3I56Q 4WF2A 4BDYA 1AEYA 2RO0A 4Y92A 2K2VA 1VQPA 2KT8A 3PE0A 2ZZDA 3G7ZA 2LP5A 4KGXB 1QWEA 3MEVA 2O4XB 2YUPA 4F16A 3S3MA 1RLPC 4DBHA 4Y91A 2NUPA 2J05A 1EZZB 3CBOA 5KYNA 4M77D 1H8KA 3O5ZA 4PJOC 1SPKA 3VS3A 4RG2A 5IXBA 1VA7A 2ABLA 5CKHA 3H6ZA 3OYKA 1XQHA 4ESRA 4C5IA 1PC0A 1KQSP 1WGSA 4M7AF 5GAMj 3V8JA 4JRPA 1C0MA 4HKEA 5DLQE 4MDXA 2OTLA 4M78B 1MUZA 1QP3A 2PTKA 1WPYA 1M2VA 4ZN1A 2FRWA 1IB8A 2RF0A 3E1SA 2GTOA 1V29B 2NWMA 3A8MB 2EQKA 2DA9A 4M75C 2JW4A 2P0KA 2DZ9A 1ABQA 4JZ4A 1YHQT 2DTOA 1KHIA 1Q82U 1VQOQ 4V2SA 4KH1B 3FB9A 5FU7C 3THKA 2KR3A 8AT1B 1AHJB 4NL3A 2DE0X 3G4SA 3QO3A 3EAEA 2GQVA 3MCAB 4HCBA 1IZ6A 1TUCA 2EQJA 3G6EQ 3JRZA 2CSIA 2J6FA 1Q7YU 3CBMA 1MNDA 4X9CA 1PD1A 2QG9B 3CMET 3JB9J 1BU1A 2LCSA 9ATCB 1YJWA 1D1AA 4C8QE 3V8LA 3OYJA 1W2BA 5GAOm 1RAIB 2E70A 3I55T 3L2QA 1VQ6T 3QSUA 2KRSA 2C06A 1VQKQ 1KQSA 3E19A 1JB0E 4N0AA 3EG3A 1VIFA 2CYZB 1VQ8T 5LJ5d 4J9GA 1NPRA 4C92E 4DBFA 2EW3A 4M7AD 3CC2Q 2B8AA 1JRIA 2EGAA 1IGQA 1Q86U 4E7HA 1GRIA 4RTUA 1LNXA 1K73U 2K79A 2DK3A 1M2VB 1T3SA 3JCMW 5GAMf 3RDVA 2FVUA 1X69A 1O9SA 1K1ZA 4M75F 2K57A 4PKCC
chains in the Genus database with same CATH topology
2PNIA 2RQTA 1OPKA 1OV3A 1W1FA 1YP5A 2ED1A 2NUZA 5GJVB 2MCNA 2D1XA 2JXBA 1B07A 4HXJA 2LQWA 2F2VA 3TSWA 1N5ZA 2JS0A 3UA6A 2X3WD 3QWYA 2J6OA 3PVQA 2FPFA 1ZBJA 2CH4W 3NGPA 2HDAA 3SHWA 3EHQA 1AWWA 1X6GA 2VWFA 1AZEA 2C0OA 1PRLC 1KJWA 1CSKA 4Z88A 1UG1A 1M3AA 4J9IA 5IH2A 1UUEA 2VKNA 2V1QA 2JM9A 1QWFA 3M0TA 1U06A 1FMKA 2CH4A 2DRMA 1S1NA 3FJ5A 2EYWA 5GJWB 5L23A 2A28A 3VS0A 2ECZA 4OMMA 1M30A 1CKBA 1VYTA 2ESWA 1UECA 1T0JA 1RUWA 1UJYA 4HVUA 1SSHA 3VS1A 1Z9QA 2RQRA 1BB9A 4JJDA 2OJ2A 5IXFA 2A37A 2LQNA 3JV3A 1U3OA 2DVJA 1BBZA 2M0YA 4LN2A 4D8DA 3REBB 1NYFA 3CQTA 2O31A 1ZUYA 2FO0A 4HCKA 2KRMA 1WI7A 4J9CA 1K4US 5FW9A 2J7IA 1AOJA 2BZYA 4LUDA 1M3BA 1WDXA 2DYBA 4K11A 4A63B 1UTIA 5EC7A 1H92A 4CC3A 4RUGA 4J9FA 2PZ1A 1YWOA 2DILA 1QLYA 1CKAA 1GFCA 2K3BA 1I07A 2W0ZA 2RMOA 1I1JA 2EPDA 2D8JA 2KROA 2RQVA 2LZ6B 1Y0MA 2IIMA 3VS7A 2AZSA 3LH5A 1WXUA 2E5KA 1NEBA 3M0UA 3REAB 1SHFA 4ORZA 1WFWA 2KXCA 2O2OA 1V1CA 2O9VA 2BZXA 2JS2A 2LMJA 3I5SA 4CC2A 2DL3A 2EYXA 1IO6A 1SEMA 2AK5A 2G6FX 3R6NA 1AWJA 1AVZC 2FEIA 3VS2A 2JTEA 1I0CA 3U23A 3M0SA 2DL5A 1RLQC 2K9GA 2RQUA 1WX6A 4LE9A 2I0NA 1AWXA 4RTZA 2OI3A 2EYYA 2YSQA 2EYZA 4RTVA 2L2PA 2KT1A 4CC4B 3NPFA 3TSZA 2DL8A 1X2QA 1E7OA 2K2MA 1GCPA 1NM7A 1ARKA 2LJ3A 1W70A 1B3QA 1YNZA 2D0NA 1K0SA 1K9AA 2CDTA 4M4ZA 1KSWA 5FWBA 2JM8A 4F17A 4E6RA 2OAWA 1MV0B 1NLPC 2HBWA 2DX1A 4JJCA 2DRKA 2X3XD 1T0HA 1ZLMA 1XOVA 1GCQC 3M0PA 5IHKA 2RN8A 2XMFA 1QKWA 2EKHA 2DL4A 2ROLA 1UJ0A 2FPEA 2L3QA 1UFFA 1JQQA 2BTTA 2KE9A 4JJBA 1MV3A 2GTJA 1QCFA 1W6XA 2KGTA 4Z8AA 1GBRA 1WYXA 2YT6A 4OMQA 1EFNA 2ENMA 4X1VA 2MOXA 1Z9ZA 2FG0A 1UHFA 2YDLA 2RPNA 1FYNA 4D8KA 2J06A 2O9SA 2A36A 2CREA 3H0HA 4AFSC 1TUDA 2HSPA 2KRNA 4IIMA 2AZVA 1UE9A 1U5SA 4FSSA 2CT4A 2YUQA 2DF6A 3VRZA 1OOTA 1NG2A 1NEGA 2MIOA 1TG0A 4CC7A 3I9QA 4QT7A 1JXMA 1VYUA 2RNAA 4KRTA 1ZX6A 3PVLA 4R0KA 5IHNA 2SEMA 4OMPA 1PHTA 3M0RA 1E6HA 1RI9A 1NLOC 1Y57A 2DLPA 5ECAA 2SRCA 2VVKA 1PWTA 4HVWA 2AKLA 2KYBA 1ZUUA 1PNJA 1WLPB 1H3HA 1BK2A 2EGEA 1K0XA 1A0NB 3RBBB 3IQLA 2ED0A 3C0CA 1SRLA 2RQWA 1NYGA 1AD5A 1WXBA 3H0IA 1PKSA 1JEGA 1KIKA 1GL5A 2AKKA 1T3LA 1GFDA 4RTWA 3VS5A 2W10A 1GCQA 1ZSGA 1JU5C 1M27C 4RTXA 3EG2A 1PKTA 4DEYA 2EBPA 2KNBB 5FWCA 4F14A 3VS4A 3VS6A 4OMLA 3ULRB 1WIEA 2D8HA 1HD3A 3TVTA 1SHGA 1G2BA 1X43A 2EQIA 2EVRA 4J9HA 1M8MA 5HCKA 1YWPA 2JMCA 2K7AA 1X2KA 1AEYA 1HJDA 4Y92A 2KT8A 3PE0A 2M51A 4DEXA 2L3PA 2O88A 3UATA 1J3TA 2LP5A 2CUDA 3RNJA 1QWEA 1QKXA 2YUPA 4F16A 1OEBA 1RLPC 3ZL7C 4OMOA 2J05A 1H8KA 3O5ZA 1OPLA 1SPKA 3VS3A 5IXBA 2HEQA 2L0AA 2GQIA 1AWOA 1UDLA 1VA7A 2ABLA 1JXOA 4ESRA 2GNCA 4AFZC 2DM1A 1GBQA 2HCKA 1G83A 3SEMA 1MUZA 2PTKA 2FRWA 2KYMA 2RF0A 4GLMA 1UHCA 2GTOA 2NWMA 4RTYA 2JT4A 3QWXX 2DL7A 2C0IA 2DA9A 2JW4A 2FRYA 4J9BA 1ABQA 3GBQA 2F2WA 4JZ4A 2GGRA 3H41A 3KFVA 4J9EA 4RTTA 4WCIA 1VYVA 1AZGB 2FPDA 2DBKA 4HVVA 2DNUA 3UA7A 1JO8A 2LX7A 3THKA 1WA7A 2KR3A 4J9DA 2A08A 2DE0X 3EG0A 1HSQA 1ZUKA 2KXDA 1TUCA 3A98A 3VRYA 2BZ8A 4AFQC 4EIKA 3EHRA 2J6KA 3M0QA 2EGCA 3EGUA 2CSIA 2J6FA 1X6BA 4JZ3A 1PRMC 1UGVA 3NMZC 4Z89A 3NHNA 3I5RA 2JMAA 1BU1A 2LCSA 1YN8A 3I35A 1X27A 2DMOA 4JPBW 4AG1C 2F2XA 2DJQA 1KFZA 2V1RA 2CUBA 1E6GA 5I22A 2KRSA 4ZNXA 2YUNA 2CSQA 2GBQA 2K6DA 3EG3A 1WXTA 2KEAA 4IIOA 4J9GA 3EG1A 2DBMA 2ROTA 1ABOA 2LJ1A 2LNHB 2LJ0A 2EW3A 1M3CA 1SRMA 1YCSB 2EGAA 2P4RA 2QDLA 3H0FA 4AG2C 1LCKA 2B86A 1GRIA 3UF4A 4RTUA 4LUEA 1K76A 2K79A 5IHIA 2H8HA 5I11A 4AFUC 1T3SA 2YUOA 2L3SA 4OMNA 2C0TA 1X69A 4GBQA 2KBTA 4LNPA 2CT3A 1K1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNI A;  2RQT A;  1OPK A;  1OV3 A;  1W1F A;  1YP5 A;  2ED1 A;  2NUZ A;  5GJV B;  2MCN A;  2D1X A;  2JXB A;  1B07 A;  4HXJ A;  2LQW A;  2F2V A;  3TSW A;  1N5Z A;  2JS0 A;  3UA6 A;  2X3W D;  3QWY A;  2J6O A;  3PVQ A;  2FPF A;  1ZBJ A;  2CH4 W;  3NGP A;  2HDA A;  3SHW A;  3EHQ A;  1AWW A;  1X6G A;  2VWF A;  1AZE A;  2C0O A;  1PRL C;  1KJW A;  1CSK A;  4Z88 A;  1UG1 A;  1M3A A;  4J9I A;  5IH2 A;  1UUE A;  2VKN A;  2V1Q A;  2JM9 A;  1QWF A;  3M0T A;  1U06 A;  1FMK A;  2CH4 A;  2DRM A;  1S1N A;  3FJ5 A;  2EYW A;  5GJW B;  5L23 A;  2A28 A;  3VS0 A;  2ECZ A;  4OMM A;  1M30 A;  1CKB A;  1VYT A;  2ESW A;  1UEC A;  1T0J A;  1RUW A;  1UJY A;  4HVU A;  1SSH A;  3VS1 A;  1Z9Q A;  2RQR A;  1BB9 A;  4JJD A;  2OJ2 A;  5IXF A;  2A37 A;  2LQN A;  3JV3 A;  1U3O A;  2DVJ A;  1BBZ A;  2M0Y A;  4LN2 A;  4D8D A;  3REB B;  1NYF A;  3CQT A;  2O31 A;  1ZUY A;  2FO0 A;  4HCK A;  2KRM A;  1WI7 A;  4J9C A;  1K4U S;  5FW9 A;  2J7I A;  1AOJ A;  2BZY A;  4LUD A;  1M3B A;  1WDX A;  2DYB A;  4K11 A;  4A63 B;  1UTI A;  5EC7 A;  1H92 A;  4CC3 A;  4RUG A;  4J9F A;  2PZ1 A;  1YWO A;  2DIL A;  1QLY A;  1CKA A;  1GFC A;  2K3B A;  1I07 A;  2W0Z A;  2RMO A;  1I1J A;  2EPD A;  2D8J A;  2KRO A;  2RQV A;  2LZ6 B;  1Y0M A;  2IIM A;  3VS7 A;  2AZS A;  3LH5 A;  1WXU A;  2E5K A;  1NEB A;  3M0U A;  3REA B;  1SHF A;  4ORZ A;  1WFW A;  2KXC A;  2O2O A;  1V1C A;  2O9V A;  2BZX A;  2JS2 A;  2LMJ A;  3I5S A;  4CC2 A;  2DL3 A;  2EYX A;  1IO6 A;  1SEM A;  2AK5 A;  2G6F X;  3R6N A;  1AWJ A;  1AVZ C;  2FEI A;  3VS2 A;  2JTE A;  1I0C A;  3U23 A;  3M0S A;  2DL5 A;  1RLQ C;  2K9G A;  2RQU A;  1WX6 A;  4LE9 A;  2I0N A;  1AWX A;  4RTZ A;  2OI3 A;  2EYY A;  2YSQ A;  2EYZ A;  4RTV A;  2L2P A;  2KT1 A;  4CC4 B;  3NPF A;  3TSZ A;  2DL8 A;  1X2Q A;  1E7O A;  2K2M A;  1GCP A;  1NM7 A;  1ARK A;  2LJ3 A;  1W70 A;  1B3Q A;  1YNZ A;  2D0N A;  1K0S A;  1K9A A;  2CDT A;  4M4Z A;  1KSW A;  5FWB A;  2JM8 A;  4F17 A;  4E6R A;  2OAW A;  1MV0 B;  1NLP C;  2HBW A;  2DX1 A;  4JJC A;  2DRK A;  2X3X D;  1T0H A;  1ZLM A;  1XOV A;  1GCQ C;  3M0P A;  5IHK A;  2RN8 A;  2XMF A;  1QKW A;  2EKH A;  2DL4 A;  2ROL A;  1UJ0 A;  2FPE A;  2L3Q A;  1UFF A;  1JQQ A;  2BTT A;  2KE9 A;  4JJB A;  1MV3 A;  2GTJ A;  1QCF A;  1W6X A;  2KGT A;  4Z8A A;  1GBR A;  1WYX A;  2YT6 A;  4OMQ A;  1EFN A;  2ENM A;  4X1V A;  2MOX A;  1Z9Z A;  2FG0 A;  1UHF A;  2YDL A;  2RPN A;  1FYN A;  4D8K A;  2J06 A;  2O9S A;  2A36 A;  2CRE A;  3H0H A;  4AFS C;  1TUD A;  2HSP A;  2KRN A;  4IIM A;  2AZV A;  1UE9 A;  1U5S A;  4FSS A;  2CT4 A;  2YUQ A;  2DF6 A;  3VRZ A;  1OOT A;  1NG2 A;  1NEG A;  2MIO A;  1TG0 A;  4CC7 A;  3I9Q A;  4QT7 A;  1JXM A;  1VYU A;  2RNA A;  4KRT A;  1ZX6 A;  3PVL A;  4R0K A;  5IHN A;  2SEM A;  4OMP A;  1PHT A;  3M0R A;  1E6H A;  1RI9 A;  1NLO C;  1Y57 A;  2DLP A;  5ECA A;  2SRC A;  2VVK A;  1PWT A;  4HVW A;  2AKL A;  2KYB A;  1ZUU A;  1PNJ A;  1WLP B;  1H3H A;  1BK2 A;  2EGE A;  1K0X A;  1A0N B;  3RBB B;  3IQL A;  2ED0 A;  3C0C A;  1SRL A;  2RQW A;  1NYG A;  1AD5 A;  1WXB A;  3H0I A;  1PKS A;  1JEG A;  1KIK A;  1GL5 A;  2AKK A;  1T3L A;  1GFD A;  4RTW A;  3VS5 A;  2W10 A;  1GCQ A;  1ZSG A;  1JU5 C;  1M27 C;  4RTX A;  3EG2 A;  1PKT A;  4DEY A;  2EBP A;  2KNB B;  5FWC A;  4F14 A;  3VS4 A;  3VS6 A;  4OML A;  3ULR B;  1WIE A;  2D8H A;  1HD3 A;  3TVT A;  1SHG A;  1G2B A;  1X43 A;  2EQI A;  2EVR A;  4J9H A;  1M8M A;  5HCK A;  1YWP A;  2JMC A;  2K7A A;  1X2K A;  1AEY A;  1HJD A;  4Y92 A;  2KT8 A;  3PE0 A;  2M51 A;  4DEX A;  2L3P A;  2O88 A;  3UAT A;  1J3T A;  2LP5 A;  2CUD A;  3RNJ A;  1QWE A;  1QKX A;  2YUP A;  4F16 A;  1OEB A;  1RLP C;  3ZL7 C;  4OMO A;  2J05 A;  1H8K A;  3O5Z A;  1OPL A;  1SPK A;  3VS3 A;  5IXB A;  2HEQ A;  2L0A A;  2GQI A;  1AWO A;  1UDL A;  1VA7 A;  2ABL A;  1JXO A;  4ESR A;  2GNC A;  4AFZ C;  2DM1 A;  1GBQ A;  2HCK A;  1G83 A;  3SEM A;  1MUZ A;  2PTK A;  2FRW A;  2KYM A;  2RF0 A;  4GLM A;  1UHC A;  2GTO A;  2NWM A;  4RTY A;  2JT4 A;  3QWX X;  2DL7 A;  2C0I A;  2DA9 A;  2JW4 A;  2FRY A;  4J9B A;  1ABQ A;  3GBQ A;  2F2W A;  4JZ4 A;  2GGR A;  3H41 A;  3KFV A;  4J9E A;  4RTT A;  4WCI A;  1VYV A;  1AZG B;  2FPD A;  2DBK A;  4HVV A;  2DNU A;  3UA7 A;  1JO8 A;  2LX7 A;  3THK A;  1WA7 A;  2KR3 A;  4J9D A;  2A08 A;  2DE0 X;  3EG0 A;  1HSQ A;  1ZUK A;  2KXD A;  1TUC A;  3A98 A;  3VRY A;  2BZ8 A;  4AFQ C;  4EIK A;  3EHR A;  2J6K A;  3M0Q A;  2EGC A;  3EGU A;  2CSI A;  2J6F A;  1X6B A;  4JZ3 A;  1PRM C;  1UGV A;  3NMZ C;  4Z89 A;  3NHN A;  3I5R A;  2JMA A;  1BU1 A;  2LCS A;  1YN8 A;  3I35 A;  1X27 A;  2DMO A;  4JPB W;  4AG1 C;  2F2X A;  2DJQ A;  1KFZ A;  2V1R A;  2CUB A;  1E6G A;  5I22 A;  2KRS A;  4ZNX A;  2YUN A;  2CSQ A;  2GBQ A;  2K6D A;  3EG3 A;  1WXT A;  2KEA A;  4IIO A;  4J9G A;  3EG1 A;  2DBM A;  2ROT A;  1ABO A;  2LJ1 A;  2LNH B;  2LJ0 A;  2EW3 A;  1M3C A;  1SRM A;  1YCS B;  2EGA A;  2P4R A;  2QDL A;  3H0F A;  4AG2 C;  1LCK A;  2B86 A;  1GRI A;  3UF4 A;  4RTU A;  4LUE A;  1K76 A;  2K79 A;  5IHI A;  2H8H A;  5I11 A;  4AFU C;  1T3S A;  2YUO A;  2L3S A;  4OMN A;  2C0T A;  1X69 A;  4GBQ A;  2KBT A;  4LNP A;  2CT3 A;  1K1Z A; 
#chains in the Genus database with same CATH topology
 2PNI A;  2RQT A;  4XTV A;  4HCC A;  3E2U A;  3HFO A;  3P8B B;  2K4Y A;  2JS0 A;  2X3W D;  1MMA A;  2J6O A;  3G71 A;  1S72 T;  2FPF A;  1YJN Q;  3NGP A;  3VKI A;  2VYT A;  4IUV A;  1QVF S;  2C0O A;  1M1K U;  3PIO A;  2F5K A;  1JBM A;  3BW1 A;  2V1Q A;  3KBG A;  4QQ6 A;  3URG A;  3CCS T;  4F7U G;  2CH4 A;  4QVD A;  2DRM A;  1S1N A;  3FJ5 A;  1FMW A;  3EG9 A;  5CCA A;  4EMH A;  4C5G A;  2DXT A;  4MZP A;  2HSE B;  4PJO D;  1VYT A;  1UEC A;  2QAZ A;  2XKO C;  3CCE A;  4HVU A;  1NJI R;  2RQR A;  3I56 A;  2OJ2 A;  5IXF A;  1YI2 T;  2A37 A;  2LQN A;  4N4I A;  4PJL A;  2K3Y A;  2DVJ A;  3TRE A;  3DLL A;  4HCK A;  4FYV B;  2DIQ A;  2JJ9 A;  3UDC A;  5FW9 A;  1N8R C;  1W2B S;  1AOJ A;  4MML A;  2WSF E;  2PVO B;  4K11 A;  4M75 D;  2VB6 A;  3AHU A;  3SDZ A;  4RUG A;  3BDL A;  2W0Z A;  2OX7 A;  3CEY A;  4A4F A;  2D8J A;  2KRO A;  2VXE A;  1H64 1;  4R55 A;  3GOX A;  3RIR A;  5GAN 7;  1WFW A;  2FZG B;  1YIJ A;  3CCV T;  2RB6 A;  1K9M C;  4PJN A;  1VQL Q;  2JS2 A;  2LMJ A;  5IT9 E;  5CKD A;  2DL3 A;  4RKU E;  5AYF A;  3R6N A;  4JRI A;  2FEI A;  3VS2 A;  2RJC A;  1VQO A;  3PGG A;  1ZA1 B;  5DM7 R;  2RJD A;  4C8Q A;  3CCQ Q;  5GMK l;  1I5O B;  3EG9 B;  3OY9 A;  2LQ8 A;  2OI3 A;  3CD6 Q;  2I2L A;  5EG2 A;  3M56 A;  3OYA A;  2KQW A;  2QDY B;  4CC4 B;  1OQK A;  1VQ4 Q;  3G6E A;  4IUR A;  4FCY A;  2FHD A;  4C92 A;  2K2M A;  1ARK A;  4BAC A;  2LJ3 A;  1MMN A;  1W70 A;  4F7U B;  1K0S A;  4E47 A;  2CP3 A;  1K9A A;  2KI7 A;  3QXE B;  4M4Z A;  2YWW A;  1M90 U;  4O5V A;  1VQ7 T;  4C0Z A;  1TOV A;  1YIT A;  1GCQ C;  3S3N A;  2QEX T;  4BI8 B;  3KUF A;  3CC2 A;  2MWP A;  2KE9 A;  4Z8A A;  2E4H A;  3LGL A;  1WYX A;  3V7C A;  5L8R E;  5I21 A;  1WHG A;  4M7D G;  2YDL A;  2RPN A;  4PJM A;  3P8D A;  2EFI A;  3MPU B;  2EJF A;  3FC3 A;  5KYX B;  3OA6 A;  4XU3 A;  5LJ3 d;  2YUQ A;  3FEO A;  1VQM T;  1RAG B;  3VRZ A;  1VIE A;  1NEG A;  3Q1J A;  1HK9 A;  3I9Q A;  4QT7 A;  4C8Q B;  5A0L A;  3I55 Q;  1VQ6 Q;  5IHN A;  3VUZ A;  4EPC A;  1ZSZ A;  1YJN A;  2JZ2 A;  1E6H A;  4QKU A;  3OS5 A;  2BUD A;  2GFU A;  2SRC A;  2CP7 A;  3HTR A;  4HVW A;  3GF5 A;  3OW2 A;  1ZHI A;  4C92 B;  1QVG P;  2YLB A;  3UPU A;  3RBB B;  4E7Z A;  5I2M A;  1FXX A;  2JVV A;  3A8G B;  1T3L A;  3OYB A;  2AIR B;  3D7S B;  2YLC A;  2K5I A;  2EBP A;  5FU6 C;  5FWC A;  1D1C A;  4OML A;  4HCZ A;  5CK9 A;  4ELZ C;  2M9U A;  3TVT A;  2O01 E;  1YJ9 T;  5GAO r;  3T9N A;  2RI3 A;  4Z02 A;  2EVR A;  3EGD B;  4M77 C;  5LJ5 e;  1YWP A;  1VQ5 T;  1DJ7 B;  2RI2 A;  3O8V A;  2IPO B;  2HZY A;  3L2R A;  4B9W A;  3MKD A;  1X75 C;  3QYG B;  2GF7 A;  2M51 A;  2PVG B;  1J3T A;  3M4Y A;  3CC7 T;  3G4S Q;  1D3B A;  2LVM A;  3MP1 A;  3L2W A;  4OMO A;  1N8R R;  3QKJ A;  4OMF B;  5HK3 A;  4PLL A;  2HEQ A;  2L0A A;  1ZSZ B;  1QVG A;  1AWO A;  1PCX A;  1UDL A;  5GAM g;  4B9X A;  2IVW A;  4CI0 C;  1TWB A;  2E65 A;  1LOJ A;  5GMK j;  3OYL A;  1G83 A;  3BE3 A;  3SEM A;  3JB9 G;  2XIC A;  4OVA A;  4PK4 A;  2DTI A;  1MNE A;  4NL2 A;  1BI1 A;  4RTY A;  3QWX X;  2DL7 A;  1G3W A;  1BIB A;  1B7T A;  4J9B A;  5D6Y A;  1K9M R;  4M78 G;  3H41 A;  1BKB A;  3KFV A;  4WCI A;  3OW2 S;  1VYV A;  3M4G A;  4IKF A;  2DBK A;  2DFU A;  2M16 A;  3OYE A;  3KXT A;  2JUF A;  2LX7 A;  1WA7 A;  1VQN T;  2A08 A;  3R6O A;  4M77 F;  2CP0 A;  3CPW P;  4A4K A;  1D09 B;  4O6J A;  3X28 B;  1QMC A;  4KH0 B;  1ZUK A;  4Q5W A;  2RI5 A;  1ACM B;  1VUB A;  3JCM P;  1NZ9 A;  1KG1 A;  3OBW A;  4ME7 A;  4UC4 A;  3EHR A;  3M0Q A;  3EGU A;  2M0O A;  4QQG A;  3CCM T;  5GAM h;  1UGV A;  4Z89 A;  2AT1 B;  3I5R A;  3EFR A;  4JLI A;  1KHC A;  1D3B B;  2X4J A;  5GAO l;  2DJQ A;  4OF1 A;  3SFM A;  1KFZ A;  5I22 A;  4ZNX A;  2YUN A;  1BIA A;  5A2Q E;  1IHV A;  1QVF P;  4ELY C;  4BE0 A;  3QII A;  1RAA B;  5GMK e;  2KEA A;  3EG1 A;  2ROT A;  1ABO A;  2X4W A;  1WJQ A;  1X6O A;  5KYW A;  1M3C A;  3CMA T;  4HT8 A;  4XTU A;  2COY A;  3OS1 A;  1SRM A;  1WJS A;  3H0F A;  4BE1 A;  4EDU A;  2DJZ A;  3UF4 A;  5GAN 2;  1K76 A;  5I11 A;  3PMI A;  3VUB A;  2L3S A;  1VQ9 T;  4LNP A;  4C0G A;  3I55 A;  1VQ6 A;  3DLM A;  1BCO A;  4AMC A;  1RAC B;  2DXU A;  3OYI A;  2RHU A;  4J83 A;  1QVG S;  1YP5 A;  2ED1 A;  2D1X A;  1VQ8 A;  2JXB A;  2NLU A;  3A8H B;  3F70 A;  7AT1 B;  2QEX Q;  3CPW A;  4KUL A;  3QPH A;  3TSW A;  5LJ3 j;  3QWY A;  4BI4 A;  3NFC A;  2DEQ A;  2PQW A;  3HRT A;  1W2B P;  3A1P A;  4DBQ A;  2HDA A;  3SHW A;  3X20 B;  4M78 C;  2E6N A;  1AWW A;  3WVE B;  1X6G A;  3QYH B;  1HYO A;  5KH6 A;  1AZE A;  1QQJ A;  3JCM X;  1Q95 G;  1CSK A;  4BE2 A;  4FW2 A;  1R0B G;  1UG1 A;  5IH2 A;  2CP2 A;  1QW1 A;  2QQB A;  4M7D D;  1QWF A;  1FMK A;  1YIJ Q;  2EKO A;  2X35 A;  3LWI A;  1QVF A;  2EYW A;  1YBY A;  2ECZ A;  4OMM A;  1M30 A;  1K8A U;  2XDB A;  3H8Z A;  3M57 A;  1S72 A;  2ESW A;  3X25 B;  1SSH A;  2HNI A;  1Q82 C;  1Z9Q A;  3CCJ T;  2EJG A;  1BB9 A;  3LW5 E;  1HXD A;  1FWZ A;  3SWN B;  5KYY B;  5KYW B;  1SF9 A;  1U3O A;  4LN2 A;  1BBZ A;  2E41 A;  2M0Y A;  1IHW A;  2R5M A;  1NYF A;  3NTK A;  2O31 A;  4JRQ A;  4KGV B;  2EQM A;  2FO0 A;  4LDU A;  1WI7 A;  1KQ1 A;  4PLI A;  5C6S A;  4E2F B;  5AT1 B;  3ZFJ A;  1Q7Y C;  3JB9 F;  1U1S A;  2QQR A;  2PZ1 A;  5LJ3 e;  1QLY A;  1ZBX A;  2K3B A;  1I07 A;  2DYI A;  1RAB B;  2AHJ B;  4XTY A;  1N27 A;  2EPD A;  1Y96 A;  2KSS A;  1Y0M A;  1YI2 A;  2RK1 A;  2DET A;  3RR6 A;  3GP8 A;  3M59 A;  2E5K A;  2NUP B;  4PJO F;  1NEB A;  3M0U A;  1YIT Q;  3OYF A;  3GPL A;  1UB4 A;  3REA B;  5A0D A;  5GAN 4;  4XU1 A;  5LJ3 f;  4PNO A;  3CCU T;  2BZX A;  1KC8 C;  3I5S A;  2EYX A;  1Q86 C;  1SKU B;  2G6F X;  1R8O B;  1K73 C;  4BY6 B;  2LT4 A;  4PFP A;  4ZTF A;  2HKQ B;  5CO7 A;  3CPW S;  2DL5 A;  4P5N A;  1WX6 A;  4LE9 A;  2RD1 A;  1AWX A;  1H3Z A;  4XU0 A;  1M1F A;  1WQW A;  4DOW A;  4RTV A;  4FSX A;  2L2P A;  3QJ6 A;  2LRQ A;  2CS7 A;  3TSZ A;  2DL8 A;  3CCV A;  2RJE A;  1B34 A;  2H3J A;  1YNZ A;  2OTL T;  1Q81 C;  3LGF A;  4PFO A;  1TSF A;  1KSW A;  1XJW B;  4F17 A;  3OYH A;  1M1K C;  1OZ3 A;  2QA4 T;  3TCJ A;  3JB9 D;  2DRK A;  3L42 A;  1T0H A;  2K3X A;  1XOV A;  3M0P A;  1WHK A;  5IHK A;  2RN8 A;  1QKW A;  3JCM J;  2DL4 A;  2ROL A;  2FPE A;  4N0A C;  3QDF A;  1Y96 B;  2BTT A;  3PMT A;  4M77 E;  4JJB A;  1VQN Q;  1QCF A;  2KGT A;  4BDZ A;  2JN0 A;  1GBR A;  4M78 D;  2YT6 A;  1BCM A;  2V8I A;  4X1V A;  3FJP A;  1G5V A;  4KUI A;  2K5F A;  2FB7 A;  2MMP A;  2XG8 D;  4D8K A;  2J06 A;  3H0H A;  3CXC P;  3CCM Q;  1TUD A;  2HSP A;  2KRN A;  3JB9 I;  1U5S A;  2CT4 A;  4GLK A;  1OOT A;  1QVP A;  3X24 B;  2QEX A;  1G3T A;  4MMK A;  1YJW T;  2MIO A;  3OS2 A;  1TG0 A;  3MP6 A;  4CC7 A;  1N6A A;  1WJR A;  2HAX A;  2RNA A;  4KRT A;  3EGX A;  2DVE A;  2SEM A;  4OMP A;  3ZBD A;  1LVK A;  1NLO C;  2P0Q A;  4IUP A;  4E7K A;  1PWT A;  2OAU A;  3BY7 A;  2AKL A;  3OYG A;  4C8Q G;  3M53 A;  4FYY B;  1K0X A;  5CKE A;  1A0N B;  1B34 B;  2LC4 A;  2OTJ T;  2ED0 A;  3C0C A;  2DER A;  2RQW A;  1NYG A;  1PKS A;  1KIK A;  1GL5 A;  1VQ9 Q;  1GFD A;  1GCQ A;  4C92 G;  3EG2 A;  2EJ9 A;  1KQ2 A;  2KNB B;  3VS4 A;  1SSF A;  3VS6 A;  2YRV A;  1UGP B;  1WHJ A;  2D8H A;  5LL6 S;  1HD3 A;  4J6W A;  1SHG A;  5J26 A;  1X43 A;  2EQI A;  1K9M U;  1OZ2 A;  4C5H A;  3UT1 A;  1M8M A;  2JTF A;  2JMC A;  4X9D A;  1X2K A;  2FL7 A;  4M7A E;  3CXC A;  3NTI A;  1HJD A;  3OSV A;  4DEX A;  2A0F B;  1RAF B;  4MZT A;  4HA8 A;  2L3P A;  2O88 A;  3ASK A;  1Q82 R;  3RKX A;  3RNJ A;  3OW2 P;  2HKN A;  3CCL T;  3PT9 A;  5IN1 A;  1M90 C;  2DTH A;  2MWO A;  5GAO n;  3EGX B;  3PFS A;  3EFO A;  1YHQ Q;  1OPL A;  3FDR A;  2DPP B;  3H9N A;  2GQI A;  4PL6 A;  1Q7Y R;  1VQ5 A;  3A5Z B;  2QI2 A;  3WXM B;  4AFZ C;  2A3L A;  2DM1 A;  1GBQ A;  2HCK A;  2HD0 A;  2X51 A;  3CC7 A;  2WSE E;  2HL3 A;  4GLM A;  2L8D A;  5LJ5 j;  5D6X A;  2JT4 A;  2QXF A;  3X26 B;  3JB9 H;  2C0I A;  4C8Q C;  2XID A;  2CP6 A;  3CME Q;  3QHS A;  3GBQ A;  4J8O A;  2F69 A;  1KC8 R;  3HRU A;  4FM4 B;  3RES A;  1PG5 B;  4J9E A;  2Y90 A;  1AZG B;  4IUU A;  3JCM d;  2DNU A;  3UA7 A;  4PJO E;  1K73 R;  4J9D A;  2R57 A;  4LXC A;  2QGF B;  2ZPB B;  4M77 A;  3EG0 A;  1IGU A;  4F7U F;  1HSQ A;  1XTD A;  1VQ8 Q;  1F1B B;  2HQE A;  2BIV A;  1FMV A;  2QQS A;  3VRY A;  4EIK A;  5DLO A;  2J6K A;  3CCU Q;  3JCM Q;  4BD3 A;  1PRM C;  3NHN A;  3ZEH A;  1MGQ A;  2JMA A;  3MHX A;  1D0X A;  5CAI A;  5GAM d;  1YN8 A;  4EMK A;  1VQO T;  1X27 A;  2DMO A;  1I8F A;  2RA2 A;  4JPB W;  2LNV A;  4M75 E;  4AG1 C;  4NS5 A;  2F2X A;  2CKK A;  1Q81 R;  2V1R A;  4KT0 E;  4ZTJ A;  1VQN A;  2HQH A;  2CSQ A;  2GBQ A;  1G8X A;  3EFO B;  1M1K R;  3CXC S;  4IIO A;  2DBM A;  3CCR T;  2QK0 A;  2LJ1 A;  2LNH B;  3HPW A;  2MI6 A;  2LJ0 A;  3G6E T;  5CQX A;  4A4H A;  1S72 Q;  1YCS B;  3MEA A;  2QDL A;  3CCM A;  4AG2 C;  1LCK A;  2XHC A;  3OMG A;  2WAC A;  3A8O B;  5IHI A;  4DA4 A;  4AFU C;  2ZPE B;  2ZPG B;  4OMN A;  4C0F A;  2M1H A;  2C0T A;  2ZPH B;  4GBQ A;  5GAN d;  4FT2 A;  4MZM A;  4FIB A;  3CPF A;  1VQK T;  4PJJ A;  1NE8 A;  1OPK A;  1OV3 A;  2DO3 A;  2MCN A;  4M7D C;  3CCS Q;  1B07 A;  4HXJ A;  5LJ3 g;  1ZSZ C;  1AT1 B;  5LJ5 f;  1N5Z A;  4A53 A;  3CMA A;  4JS5 A;  5GMK i;  3GNF B;  1PD0 A;  4JUV A;  1KD1 C;  1OU9 A;  3EHQ A;  3UWN A;  3VU3 C;  1YI2 Q;  4M7A A;  4A4G A;  4OP0 A;  1M1G A;  2ZAE A;  1VQ9 A;  3M58 A;  1MHN A;  1PRL C;  1WHH A;  4Z88 A;  3HRS A;  1LPL A;  1M3A A;  4J9I A;  1UUE A;  3VJP A;  2VKN A;  2JM9 A;  4E7L A;  4QQD A;  4EMK B;  2PVD B;  2A28 A;  3VS0 A;  1CKB A;  1D0Y A;  3RKW A;  1T0J A;  1RUW A;  2BKD N;  3MEU A;  3LYI A;  1YJN T;  4JJD A;  4FYW B;  2CZ6 B;  3JV3 A;  1LJO A;  3V7S A;  5LJ3 h;  4D8D A;  2MK5 A;  4BUG A;  2DIG A;  1ZUY A;  3VV0 A;  4II1 A;  1K4U S;  1RAH B;  5DY9 A;  4N4H A;  3CCV Q;  4CRI A;  1M3B A;  1WDX A;  4A63 B;  4C8Q D;  1UTI A;  5EC7 A;  4CC3 A;  1OX9 A;  2CZ0 B;  2RHY A;  1YWO A;  1PM3 A;  2DIL A;  4QVC A;  1YHQ A;  3RER A;  4M7D F;  1Y71 A;  4L59 A;  2RMO A;  1I1J A;  3M54 A;  3CCJ A;  1EIF A;  2RQV A;  2LZ6 B;  5J3B A;  3VS7 A;  3MEW A;  5I2S A;  2AZS A;  2JNG A;  3LH5 A;  1WXU A;  4C92 D;  4PJO A;  1OX8 A;  2NYS A;  2GFA A;  1M90 R;  1SHF A;  3OSS C;  4ORZ A;  2KXC A;  2R5A A;  2XU8 A;  2G3R A;  2QAS A;  1OI1 A;  5CKF A;  2L89 A;  4M7A B;  1FX7 A;  3PIP A;  3JAM E;  1NJI U;  4CC2 A;  4LDY A;  1IO6 A;  2EYQ A;  1SEM A;  2AK5 A;  3CME A;  2E3I A;  2F5T X;  3V8K A;  1AVZ C;  1D1B A;  3DB3 A;  2JTE A;  3CCL Q;  2VV5 A;  3U23 A;  4XAX B;  3OYC A;  2LDM A;  2YRC A;  4M75 A;  1RLQ C;  2K9G A;  1VQ7 Q;  2RQU A;  2EAY A;  2VGN A;  3OYN A;  2RHI A;  1BI3 A;  3WVD B;  2MPX C;  2YSQ A;  4FU6 A;  3NPF A;  3PTA A;  2YHT A;  3CCU A;  1VQL T;  3DB4 A;  4C0D B;  4LD9 K;  4J5Y A;  1B3Q A;  2QTV A;  2D0N A;  2CDT A;  4E6R A;  2V8J A;  2KVQ G;  1MV0 B;  1NLP C;  3CCQ T;  2DXB A;  4QW2 A;  2X3X D;  4JS4 A;  1ZLM A;  1OYX A;  2LQK A;  3CD6 T;  3A8L B;  3OB9 A;  1VQM Q;  1MMG A;  2XK0 A;  1WHM A;  2QQ9 A;  2ZPF B;  1VQ4 T;  2L3Q A;  1UFF A;  3CC4 T;  3SWN C;  5KCH A;  1JQQ A;  1K8A C;  1MV3 A;  2GTJ A;  1W6X A;  4N4G A;  4PJO B;  4F7U E;  1MMD A;  2EIF A;  4FYX B;  5KCO A;  1EFN A;  2MOX A;  2H3E B;  3N5B B;  1YFN A;  1Z9Z A;  2FG0 A;  5HK0 A;  4KUD K;  2QA4 A;  3OMC A;  4ATO A;  5GAN 6;  3TU4 K;  1WQ7 A;  4IIM A;  2AZV A;  1UE9 A;  1BI0 A;  3MJX A;  4OB1 B;  3C12 A;  3CCS A;  2ATC B;  2LTO A;  5KYU A;  2COW A;  4KBM B;  4M75 B;  4LDX A;  3E9G A;  5GAN j;  3QUI A;  4B6M A;  4GY5 A;  1Y57 A;  4WTO B;  3CCR Q;  3JCM e;  1UGS B;  2VVK A;  5FU7 B;  3VYG A;  4AT1 B;  1YJ9 Q;  1JJ2 S;  1VOM A;  1ZUU A;  1TH7 A;  2EGE A;  3EH2 A;  4M78 F;  1BYM A;  5D7U A;  1VQ5 Q;  1SRL A;  1U1T A;  1WXB A;  3E9F A;  4BY6 C;  3EFS A;  1JEG A;  2K5L A;  1VQP T;  1RAE B;  2AKK A;  3PNW C;  1TXQ A;  3QBY A;  1KD1 R;  3RUX A;  4RMO A;  4OGC A;  3HHT B;  2XDP A;  4RTW A;  3VS5 A;  3JCM f;  1TU0 B;  2W10 A;  3RMQ A;  3CC7 Q;  1ZSG A;  1JU5 C;  1PKT A;  4DEY A;  2LT1 A;  2DKG A;  5GAM e;  1RL2 A;  2KAF A;  3ULR B;  3MP8 A;  1WIE A;  3GNG A;  1M8V A;  3HL8 A;  1KC8 U;  1NBE B;  4X34 A;  3FRN A;  2ZCF B;  1TUG B;  3LX7 A;  4VUB A;  4DQ2 A;  2K7A A;  2OTJ A;  5CIU A;  2HQX A;  4L6V 5;  2XD0 A;  2PU9 B;  2QYZ A;  3UAT A;  4RG8 A;  1M9S A;  2CUD A;  3OYY A;  3CBP A;  1QKX A;  2X9H A;  1U8R A;  1OEB A;  3ZL7 C;  5GAN e;  1D0Z A;  1I4K 1;  5KYU B;  2XDD A;  5CQY A;  4F04 B;  4JRK A;  3QZ5 B;  2FZK B;  3TEE A;  1Q81 U;  1BI2 A;  1JXO A;  5GAO q;  3HSB A;  1W4S A;  2GNC A;  3J7A F;  3L1A A;  2F1L A;  5GAN f;  5J39 A;  3G4S T;  1TTH B;  3OYM A;  5LJ5 g;  3CCL A;  2KYM A;  2QQA A;  1V76 A;  1UHC A;  3OBY A;  3LWH A;  4E7J A;  1VQ7 A;  1C6V X;  5HKC A;  2CGH A;  3J81 E;  5FRO A;  4M7D E;  2FRY A;  5FLX E;  1NPP A;  4A4E A;  2F2W A;  2GGR A;  1I81 A;  1C1A A;  4RTT A;  2FPD A;  2RM4 A;  4HVV A;  1KK7 A;  3HKS A;  1JO8 A;  2CZ7 B;  5CKB A;  3L2U A;  4PFZ A;  3G1J A;  3JSC A;  4F7U A;  1UGR B;  1RAD B;  2YXY A;  4ZGD B;  2P4T A;  2KXD A;  3FIF A;  3S3O A;  1N8R U;  3A98 A;  4JDS A;  2BZ8 A;  4AFQ C;  4BB7 A;  3CMA Q;  1RI0 A;  2EGC A;  5CR2 A;  1X6B A;  3BFM A;  3INZ A;  4JZ3 A;  3NMZ C;  4YTL A;  4XTW A;  1KQS S;  1VQM A;  3I35 A;  4IUQ A;  2VXF A;  3HFN A;  5LJ5 h;  2CUB A;  1E6G A;  2LCC A;  2A7Y A;  2D9T A;  1XNI A;  5A0G A;  2K6D A;  2KMT A;  1WXT A;  1I5L A;  4HT9 A;  2P84 A;  4DOV A;  1P92 A;  2LX9 A;  1M4Z A;  3G71 T;  1IRE B;  3JCM b;  2P4R A;  2RJF A;  2B86 A;  2COZ A;  5KYX A;  2L3R A;  4LUE A;  1K8A R;  2H8H A;  3QJY A;  2YUO A;  4JJN K;  6AT1 B;  2QTX A;  4E7I A;  3V7R A;  8ATC B;  2KBT A;  2VGM A;  2PUO B;  2CT3 A;  4EMG A;  2Z0W A;  4J7I A;  1W1F A;  2NUZ A;  4ZN3 A;  5GJV B;  4R56 A;  2LQW A;  3CCR A;  2F2V A;  2DZC A;  2E1H A;  3UA6 A;  1YJ9 A;  3CC4 Q;  2HL5 C;  4LD6 A;  2DXC A;  3PVQ A;  3QDR B;  1ZBJ A;  2CH4 W;  3L2Z A;  2HMA A;  4C5E A;  3CCE T;  2RK2 A;  3I56 T;  3CCJ Q;  1WNL A;  2VWF A;  2YRD A;  1WZO A;  2P0P A;  1KJW A;  3M9Q A;  2VC8 A;  3OQ5 A;  4DBR A;  1VQK A;  4M77 G;  4XTX A;  2Y4X A;  3M0T A;  1U06 A;  2E10 A;  4XQ3 A;  3AT1 B;  2RHX A;  4BI3 A;  2EQU A;  4OB3 B;  3JCM c;  5GJW B;  1Y07 A;  5L23 A;  4L5G A;  4E7S A;  1WHL A;  4JLG A;  2V8K A;  3EGD A;  2VUB A;  2CZ1 B;  2M02 A;  3C4S A;  1UJY A;  3VS1 A;  1Q86 R;  1GXI E;  2MF2 A;  4C92 C;  1OU8 A;  2QGG A;  4M78 E;  3REB B;  3CQT A;  2DD5 A;  2E3H A;  2KRM A;  4J9C A;  3LH0 A;  2RHZ A;  2J7I A;  4TVR A;  1YIJ T;  4FL6 A;  5D6W A;  2BZY A;  4LUD A;  1VQP Q;  2DYB A;  1QCN A;  1H92 A;  1G3S A;  3SB2 A;  5GMK h;  5KE3 A;  4ANJ A;  4J9F A;  3GLX A;  2IG0 A;  1CKA A;  4M7D A;  4MDW A;  1N9R A;  1GFC A;  5CVI A;  4J6X A;  4QVZ A;  4XTZ A;  2IIM A;  1QCO A;  4ZGJ B;  2WSC E;  4RCB A;  1EX4 A;  1PSE A;  1M5Q 1;  2KY9 A;  2MAM A;  3SD4 A;  2O2O A;  5FRM A;  2Y4Y A;  1V1C A;  2O9V A;  4NOY A;  2FYK A;  1N9S A;  3FLG A;  2HBP A;  2OTL Q;  4OB0 B;  4LDV A;  2XI9 A;  1AWJ A;  2X4X A;  1I0C A;  4XU2 A;  4KGZ B;  3NTH A;  4C8Q F;  3M0S A;  2E6Z A;  3QZ9 B;  4D6W A;  2X4Y A;  2L5Q A;  2QA4 Q;  4M7A G;  2I0N A;  3OS0 A;  2E64 A;  4ZGE B;  5GMK m;  5FU6 B;  1YIT T;  2VAS A;  4RTZ A;  2KDS A;  2EYY A;  3C94 A;  3DKM A;  2E5Q A;  2FZC B;  4J6Y A;  1R0C B;  2EYZ A;  3MET A;  2KT1 A;  2DEU A;  5GAO p;  5C0M A;  3CC2 T;  2D0Q B;  2JOY A;  4C92 F;  1X2Q A;  2V26 A;  1YCY A;  1E7O A;  2EWN A;  3JCM g;  1GCP A;  1NM7 A;  3LLR A;  5M9O A;  4M77 B;  3JCM V;  2ZGW A;  1UGQ B;  3M55 A;  4J7F A;  5FWB A;  2JM8 A;  2OAW A;  1ZA2 B;  3M5A A;  4EMK C;  2HBW A;  3ER0 A;  2DX1 A;  2KK4 A;  4JJC A;  2NUT A;  4A54 A;  1JJ2 P;  1KD1 U;  2D6F A;  2XMF A;  4M7D B;  1Y7X A;  2EKH A;  3ME9 A;  4OB2 B;  1UJ0 A;  1YJW Q;  1IXD A;  3J80 E;  2GCX A;  1IRX A;  3RKY A;  1VQL A;  5KE2 A;  2BE7 D;  1UEB A;  4FW1 A;  4XK8 E;  3OYD A;  4RCC A;  4OMQ A;  2ENM A;  2LCL A;  5IAY A;  2RH2 A;  1UHF A;  3MO8 A;  1FYN A;  3QG1 A;  3CCQ A;  2JTM A;  2O9S A;  2A36 A;  2CRE A;  3L2V A;  5HY6 A;  4AFS C;  1X01 A;  2E12 A;  2OTJ Q;  4FSS A;  3VYH B;  2O4X A;  2PUK B;  4PJO G;  5GAN 8;  3CD6 A;  3JCM h;  2DF6 A;  2DD4 A;  5FRN A;  1NG2 A;  1ZQ1 A;  1VQ4 A;  5GAN 3;  3CC4 A;  1R77 A;  1JXM A;  1VYU A;  5GAN g;  3GIB A;  1ZX6 A;  3PVL A;  4R0K A;  1PHT A;  3M0R A;  1RI9 A;  4FT4 A;  2DLP A;  5ECA A;  2ZPI B;  2MYS A;  2DAQ A;  3HP9 A;  3RMS A;  2KYB A;  3G71 Q;  4M7A C;  1SG5 A;  1OUL A;  1PNJ A;  1WLP B;  1H3H A;  1BK2 A;  4M75 G;  4M78 A;  3IQL A;  4OGE A;  1AD5 A;  3H0I A;  1G3Y A;  3P8H A;  1JJ2 A;  1NJI C;  3S6W A;  2BE9 B;  1QP2 A;  3BDU A;  1M27 C;  4RTX A;  2CP5 A;  2NUT B;  4F14 A;  4LDW A;  1M2O A;  5GAN 5;  2R58 A;  4IUT A;  3SWN A;  5KYY A;  1TS9 A;  1G2B A;  4J9H A;  4C0D C;  5HCK A;  3EH1 A;  1PSF A;  4Y28 E;  1O75 A;  3CCE Q;  5GAN h;  3TQ7 P;  3C95 A;  3I56 Q;  4WF2 A;  4BDY A;  1AEY A;  2RO0 A;  4Y92 A;  2K2V A;  1VQP A;  2KT8 A;  3PE0 A;  2ZZD A;  3G7Z A;  2LP5 A;  4KGX B;  1QWE A;  3MEV A;  2O4X B;  2YUP A;  4F16 A;  3S3M A;  1RLP C;  4DBH A;  4Y91 A;  2NUP A;  2J05 A;  1EZZ B;  3CBO A;  5KYN A;  4M77 D;  1H8K A;  3O5Z A;  4PJO C;  1SPK A;  3VS3 A;  4RG2 A;  5IXB A;  1VA7 A;  2ABL A;  5CKH A;  3H6Z A;  3OYK A;  1XQH A;  4ESR A;  4C5I A;  1PC0 A;  1KQS P;  1WGS A;  4M7A F;  5GAM j;  3V8J A;  4JRP A;  1C0M A;  4HKE A;  5DLQ E;  4MDX A;  2OTL A;  4M78 B;  1MUZ A;  1QP3 A;  2PTK A;  1WPY A;  1M2V A;  4ZN1 A;  2FRW A;  1IB8 A;  2RF0 A;  3E1S A;  2GTO A;  1V29 B;  2NWM A;  3A8M B;  2EQK A;  2DA9 A;  4M75 C;  2JW4 A;  2P0K A;  2DZ9 A;  1ABQ A;  4JZ4 A;  1YHQ T;  2DTO A;  1KHI A;  1Q82 U;  1VQO Q;  4V2S A;  4KH1 B;  3FB9 A;  5FU7 C;  3THK A;  2KR3 A;  8AT1 B;  1AHJ B;  4NL3 A;  2DE0 X;  3G4S A;  3QO3 A;  3EAE A;  2GQV A;  3MCA B;  4HCB A;  1IZ6 A;  1TUC A;  2EQJ A;  3G6E Q;  3JRZ A;  2CSI A;  2J6F A;  1Q7Y U;  3CBM A;  1MND A;  4X9C A;  1PD1 A;  2QG9 B;  3CME T;  3JB9 J;  1BU1 A;  2LCS A;  9ATC B;  1YJW A;  1D1A A;  4C8Q E;  3V8L A;  3OYJ A;  1W2B A;  5GAO m;  1RAI B;  2E70 A;  3I55 T;  3L2Q A;  1VQ6 T;  3QSU A;  2KRS A;  2C06 A;  1VQK Q;  1KQS A;  3E19 A;  1JB0 E;  4N0A A;  3EG3 A;  1VIF A;  2CYZ B;  1VQ8 T;  5LJ5 d;  4J9G A;  1NPR A;  4C92 E;  4DBF A;  2EW3 A;  4M7A D;  3CC2 Q;  2B8A A;  1JRI A;  2EGA A;  1IGQ A;  1Q86 U;  4E7H A;  1GRI A;  4RTU A;  1LNX A;  1K73 U;  2K79 A;  2DK3 A;  1M2V B;  1T3S A;  3JCM W;  5GAM f;  3RDV A;  2FVU A;  1X69 A;  1O9S A;  1K1Z A;  4M75 F;  2K57 A;  4PKC C; 
#chains in the Genus database with same CATH homology
 2PNI A;  2RQT A;  1OPK A;  1OV3 A;  1W1F A;  1YP5 A;  2ED1 A;  2NUZ A;  5GJV B;  2MCN A;  2D1X A;  2JXB A;  1B07 A;  4HXJ A;  2LQW A;  2F2V A;  3TSW A;  1N5Z A;  2JS0 A;  3UA6 A;  2X3W D;  3QWY A;  2J6O A;  3PVQ A;  2FPF A;  1ZBJ A;  2CH4 W;  3NGP A;  2HDA A;  3SHW A;  3EHQ A;  1AWW A;  1X6G A;  2VWF A;  1AZE A;  2C0O A;  1PRL C;  1KJW A;  1CSK A;  4Z88 A;  1UG1 A;  1M3A A;  4J9I A;  5IH2 A;  1UUE A;  2VKN A;  2V1Q A;  2JM9 A;  1QWF A;  3M0T A;  1U06 A;  1FMK A;  2CH4 A;  2DRM A;  1S1N A;  3FJ5 A;  2EYW A;  5GJW B;  5L23 A;  2A28 A;  3VS0 A;  2ECZ A;  4OMM A;  1M30 A;  1CKB A;  1VYT A;  2ESW A;  1UEC A;  1T0J A;  1RUW A;  1UJY A;  4HVU A;  1SSH A;  3VS1 A;  1Z9Q A;  2RQR A;  1BB9 A;  4JJD A;  2OJ2 A;  5IXF A;  2A37 A;  2LQN A;  3JV3 A;  1U3O A;  2DVJ A;  1BBZ A;  2M0Y A;  4LN2 A;  4D8D A;  3REB B;  1NYF A;  3CQT A;  2O31 A;  1ZUY A;  2FO0 A;  4HCK A;  2KRM A;  1WI7 A;  4J9C A;  1K4U S;  5FW9 A;  2J7I A;  1AOJ A;  2BZY A;  4LUD A;  1M3B A;  1WDX A;  2DYB A;  4K11 A;  4A63 B;  1UTI A;  5EC7 A;  1H92 A;  4CC3 A;  4RUG A;  4J9F A;  2PZ1 A;  1YWO A;  2DIL A;  1QLY A;  1CKA A;  1GFC A;  2K3B A;  1I07 A;  2W0Z A;  2RMO A;  1I1J A;  2EPD A;  2D8J A;  2KRO A;  2RQV A;  2LZ6 B;  1Y0M A;  2IIM A;  3VS7 A;  2AZS A;  3LH5 A;  1WXU A;  2E5K A;  1NEB A;  3M0U A;  3REA B;  1SHF A;  4ORZ A;  1WFW A;  2KXC A;  2O2O A;  1V1C A;  2O9V A;  2BZX A;  2JS2 A;  2LMJ A;  3I5S A;  4CC2 A;  2DL3 A;  2EYX A;  1IO6 A;  1SEM A;  2AK5 A;  2G6F X;  3R6N A;  1AWJ A;  1AVZ C;  2FEI A;  3VS2 A;  2JTE A;  1I0C A;  3U23 A;  3M0S A;  2DL5 A;  1RLQ C;  2K9G A;  2RQU A;  1WX6 A;  4LE9 A;  2I0N A;  1AWX A;  4RTZ A;  2OI3 A;  2EYY A;  2YSQ A;  2EYZ A;  4RTV A;  2L2P A;  2KT1 A;  4CC4 B;  3NPF A;  3TSZ A;  2DL8 A;  1X2Q A;  1E7O A;  2K2M A;  1GCP A;  1NM7 A;  1ARK A;  2LJ3 A;  1W70 A;  1B3Q A;  1YNZ A;  2D0N A;  1K0S A;  1K9A A;  2CDT A;  4M4Z A;  1KSW A;  5FWB A;  2JM8 A;  4F17 A;  4E6R A;  2OAW A;  1MV0 B;  1NLP C;  2HBW A;  2DX1 A;  4JJC A;  2DRK A;  2X3X D;  1T0H A;  1ZLM A;  1XOV A;  1GCQ C;  3M0P A;  5IHK A;  2RN8 A;  2XMF A;  1QKW A;  2EKH A;  2DL4 A;  2ROL A;  1UJ0 A;  2FPE A;  2L3Q A;  1UFF A;  1JQQ A;  2BTT A;  2KE9 A;  4JJB A;  1MV3 A;  2GTJ A;  1QCF A;  1W6X A;  2KGT A;  4Z8A A;  1GBR A;  1WYX A;  2YT6 A;  4OMQ A;  1EFN A;  2ENM A;  4X1V A;  2MOX A;  1Z9Z A;  2FG0 A;  1UHF A;  2YDL A;  2RPN A;  1FYN A;  4D8K A;  2J06 A;  2O9S A;  2A36 A;  2CRE A;  3H0H A;  4AFS C;  1TUD A;  2HSP A;  2KRN A;  4IIM A;  2AZV A;  1UE9 A;  1U5S A;  4FSS A;  2CT4 A;  2YUQ A;  2DF6 A;  3VRZ A;  1OOT A;  1NG2 A;  1NEG A;  2MIO A;  1TG0 A;  4CC7 A;  3I9Q A;  4QT7 A;  1JXM A;  1VYU A;  2RNA A;  4KRT A;  1ZX6 A;  3PVL A;  4R0K A;  5IHN A;  2SEM A;  4OMP A;  1PHT A;  3M0R A;  1E6H A;  1RI9 A;  1NLO C;  1Y57 A;  2DLP A;  5ECA A;  2SRC A;  2VVK A;  1PWT A;  4HVW A;  2AKL A;  2KYB A;  1ZUU A;  1PNJ A;  1WLP B;  1H3H A;  1BK2 A;  2EGE A;  1K0X A;  1A0N B;  3RBB B;  3IQL A;  2ED0 A;  3C0C A;  1SRL A;  2RQW A;  1NYG A;  1AD5 A;  1WXB A;  3H0I A;  1PKS A;  1JEG A;  1KIK A;  1GL5 A;  2AKK A;  1T3L A;  1GFD A;  4RTW A;  3VS5 A;  2W10 A;  1GCQ A;  1ZSG A;  1JU5 C;  1M27 C;  4RTX A;  3EG2 A;  1PKT A;  4DEY A;  2EBP A;  2KNB B;  5FWC A;  4F14 A;  3VS4 A;  3VS6 A;  4OML A;  3ULR B;  1WIE A;  2D8H A;  1HD3 A;  3TVT A;  1SHG A;  1G2B A;  1X43 A;  2EQI A;  2EVR A;  4J9H A;  1M8M A;  5HCK A;  1YWP A;  2JMC A;  2K7A A;  1X2K A;  1AEY A;  1HJD A;  4Y92 A;  2KT8 A;  3PE0 A;  2M51 A;  4DEX A;  2L3P A;  2O88 A;  3UAT A;  1J3T A;  2LP5 A;  2CUD A;  3RNJ A;  1QWE A;  1QKX A;  2YUP A;  4F16 A;  1OEB A;  1RLP C;  3ZL7 C;  4OMO A;  2J05 A;  1H8K A;  3O5Z A;  1OPL A;  1SPK A;  3VS3 A;  5IXB A;  2HEQ A;  2L0A A;  2GQI A;  1AWO A;  1UDL A;  1VA7 A;  2ABL A;  1JXO A;  4ESR A;  2GNC A;  4AFZ C;  2DM1 A;  1GBQ A;  2HCK A;  1G83 A;  3SEM A;  1MUZ A;  2PTK A;  2FRW A;  2KYM A;  2RF0 A;  4GLM A;  1UHC A;  2GTO A;  2NWM A;  4RTY A;  2JT4 A;  3QWX X;  2DL7 A;  2C0I A;  2DA9 A;  2JW4 A;  2FRY A;  4J9B A;  1ABQ A;  3GBQ A;  2F2W A;  4JZ4 A;  2GGR A;  3H41 A;  3KFV A;  4J9E A;  4RTT A;  4WCI A;  1VYV A;  1AZG B;  2FPD A;  2DBK A;  4HVV A;  2DNU A;  3UA7 A;  1JO8 A;  2LX7 A;  3THK A;  1WA7 A;  2KR3 A;  4J9D A;  2A08 A;  2DE0 X;  3EG0 A;  1HSQ A;  1ZUK A;  2KXD A;  1TUC A;  3A98 A;  3VRY A;  2BZ8 A;  4AFQ C;  4EIK A;  3EHR A;  2J6K A;  3M0Q A;  2EGC A;  3EGU A;  2CSI A;  2J6F A;  1X6B A;  4JZ3 A;  1PRM C;  1UGV A;  3NMZ C;  4Z89 A;  3NHN A;  3I5R A;  2JMA A;  1BU1 A;  2LCS A;  1YN8 A;  3I35 A;  1X27 A;  2DMO A;  4JPB W;  4AG1 C;  2F2X A;  2DJQ A;  1KFZ A;  2V1R A;  2CUB A;  1E6G A;  5I22 A;  2KRS A;  4ZNX A;  2YUN A;  2CSQ A;  2GBQ A;  2K6D A;  3EG3 A;  1WXT A;  2KEA A;  4IIO A;  4J9G A;  3EG1 A;  2DBM A;  2ROT A;  1ABO A;  2LJ1 A;  2LNH B;  2LJ0 A;  2EW3 A;  1M3C A;  1SRM A;  1YCS B;  2EGA A;  2P4R A;  2QDL A;  3H0F A;  4AG2 C;  1LCK A;  2B86 A;  1GRI A;  3UF4 A;  4RTU A;  4LUE A;  1K76 A;  2K79 A;  5IHI A;  2H8H A;  5I11 A;  4AFU C;  1T3S A;  2YUO A;  2L3S A;  4OMN A;  2C0T A;  1X69 A;  4GBQ A;  2KBT A;  4LNP A;  2CT3 A;  1K1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...