1K76A

Solution structure of the c-terminal sem-5 sh3 domain (minimized average structure)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
publication title Solution Structure, Dynamics and Thermodynamics of the Native State Ensemble of Sem-5 C-Terminal SH3 Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k76A00
1WLPB 2JM9A 2GTOA 2EYWA 2J6FA 1YCSB 1UGVA 5IXFA 1GBQA 2EPDA 3EG0A 4AFZC 4AG2C 1IO6A 2QDLA 4ZNXA 2EYYA 3VS1A 5L23A 3O5ZA 1AZGB 2RQRA 4DEYA 4DEXA 1BBZA 3UF4A 1QWEA 2LNHB 2ECZA 3TSWA 2DBKA 4CC2A 2F2XA 2XMFA 2EQIA 1QLYA 2I0NA 2RQVA 2KGTA 3VRYA 1GL5A 1NG2A 2GNCA 1CKAA 1SPKA 1SSHA 3QWXX 2W10A 1PHTA 1X27A 1GCPA 1U5SA 3IQLA 2RMOA 1GCQA 2DL4A 1NEBA 1PRLC 4OMMA 1K4US 2C0TA 4Z89A 2LMJA 2LQWA 2CSQA 1ABQA 2K6DA 1M3AA 4JJBA 2DRKA 1BU1A 1UJYA 1SRMA 4RTXA 2KE9A 4LE9A 1ABOA 2OAWA 1WI7A 4J9HA 1WFWA 3EGUA 2YUQA 1X69A 1RLPC 3VS3A 1B07A 1S1NA 2ROTA 2MIOA 2DBMA 1NYGA 4RTTA 1SHFA 1B3QA 1Z9QA 2LJ3A 2CREA 2FPEA 1AD5A 1WXTA 2CT3A 4X1VA 4LUDA 2NUZA 4Y92A 2RQWA 4F17A 2V1RA 4OMOA 4CC3A 1RLQC 1K0SA 1ZBJA 2AZSA 2FPDA 5IHNA 3GBQA 1RUWA 1TUDA 1UE9A 1FYNA 3PE0A 2EGAA 4LNPA 4D8DA 2JMCA 1JEGA 1OPLA 3M0SA 2J7IA 1UHFA 1ARKA 2C0IA 1WX6A 2HCKA 1NM7A 1PKTA 2FG0A 2DNUA 1U3OA 1AZEA 1UJ0A 2EYXA 2HDAA 1GFCA 2OI3A 2RPNA 5GJWB 1V1CA 2K2MA 2A37A 2AK5A 2DL7A 4JZ3A 3C0CA 2RF0A 2DF6A 2KNBB 1Z9ZA 2ROLA 1UG1A 2ENMA 4R0KA 4HVVA 3I35A 3TSZA 2YSQA 1Y57A 1ZSGA 1E7OA 1G2BA 2EGEA 1YNZA 2JMAA 4ESRA 1TG0A 4J9EA 1OOTA 2AKLA 4IIMA 1ZUKA 1AEYA 2DLPA 3NHNA 2NWMA 1JU5C 3ULRB 2VKNA 4RTWA 1YP5A 2FRWA 2KXCA 3KFVA 4IIOA 2K9GA 3VS7A 2KEAA 2C0OA 3PVQA 1CSKA 2VVKA 3H0IA 2O9SA 1WYXA 2ED1A 1JO8A 2LX7A 2DILA 1PKSA 2BZXA 1XOVA 4LUEA 4HVWA 3ZL7C 3M0RA 1SEMA 4F16A 1K9AA 5I22A 5IXBA 1A0NB 2DYBA 2J05A 1WXUA 1T3LA 2OJ2A 3SEMA 1OPKA 1QKXA 2J6KA 4AFSC 2LZ6B 2F2VA 1GBRA 1KFZA 2X3WD 3EG1A 1NLOC 2RNAA 2HSPA 3NGPA 4KRTA 4AFQC 1X2QA 2CDTA 1GCQC 3LH5A 4K11A 2PNIA 4J9FA 1I1JA 2E5KA 1M3CA 1AOJA 2GTJA 1NLPC 2KRNA 2DA9A 1OEBA 3M0PA 1AWOA 2SRCA 2H8HA 4J9BA 2PTKA 2SEMA 1H92A 2EGCA 1WA7A 3VRZA 1X6BA 3RBBB 1T0JA 2FEIA 2W0ZA 1M27C 2HBWA 2O2OA 3VS4A 1PRMC 3NMZC 2YT6A 4GLMA 2GQIA 2YDLA 3RNJA 3I5RA 1GFDA 4Z8AA 2DL8A 1HJDA 1I07A 2MCNA 3M0TA 2CUBA 2FRYA 2JXBA 4J9DA 3I9QA 4OMNA 5HCKA 2L3PA 4HVUA 1UTIA 5IH2A 2LJ0A 4EIKA 1LCKA 1UECA 3EHRA 2M51A 1NEGA 3A98A 2M0YA 3R6NA 2KRSA 4J9CA 3VS5A 3UA6A 1U06A 1MUZA 4E6RA 1AWWA 2JT4A 3CQTA 2DX1A 1KIKA 3H0HA 1W70A 2B86A 2CH4A 2O9VA 3H0FA 1UUEA 5IHKA 1NYFA 2L0AA 2BTTA 2YUPA 3PVLA 2D0NA 2KBTA 1SHGA 3VS0A 2DE0X 5IHIA 4JZ4A 3THKA 1WDXA 1WXBA 2AKKA 2GGRA 4HXJA 1Y0MA 4JPBW 1OV3A 3EG2A 1X2KA 1JQQA 4CC7A 2JS2A 1MV3A 3VS2A 2RQTA 4WCIA 2JM8A 2YUNA 1T3SA 2BZ8A 1M8MA 2L3SA 1H3HA 1QCFA 1J3TA 2A36A 2A08A 4RTVA 1BK2A 3EG3A 1GRIA 2EBPA 2EKHA 1I0CA 2L3QA 3NPFA 2O88A 3REAB 2AZVA 1K1ZA 3FJ5A 1HD3A 1T0HA 1YN8A 2LQNA 1VYTA 2JTEA 3VS6A 2MOXA 2KYBA 3JV3A 1FMKA 2DVJA 4J9IA 2O31A 2JS0A 2ESWA 1BB9A 3M0UA 3U23A 2J06A 1X6GA 4Z88A 1W1FA 1YWOA 4D8KA 2ED0A 3QWYA 1PWTA 4JJCA 4QT7A 2G6FX 1VA7A 1KJWA 1K0XA 2HEQA 2BZYA 3UA7A 2RQUA 4ORZA 2A28A 2DMOA 3SHWA 2EVRA 1AWJA 2CUDA 1HSQA 4J9GA 2IIMA 2DL5A 4FSSA 1AVZC 2LP5A 5EC7A 2F2WA 2YUOA 4RTYA 2D1XA 1E6HA 1W6XA 4CC4B 3I5SA 4OMPA 1ZUUA 2RN8A 1UDLA 5FWBA 1PNJA 3H41A 2V1QA 2FO0A 4F14A 2KT8A 1VYVA 2LCSA 2K3BA 2KT1A 5ECAA 2CSIA 1KSWA 1E6GA 1M3BA 2KR3A 1RI9A 3TVTA 2GBQA 1TUCA 1M30A 2DJQA 2FPFA 4HCKA 2PZ1A 1N5ZA 2JW4A 1JXMA 2KXDA 4OMLA 5FW9A 2ABLA 1UHCA 2J6OA 1UFFA 4AFUC 2DL3A 1VYUA 4A63B 1H8KA 3EHQA 1EFNA 4GBQA 1X43A 2EW3A 2K79A 2P4RA 2X3XD 4RUGA 1CKBA 5FWCA 1K76A 2D8JA 1MV0B 2CH4W 2KYMA 1WIEA 4M4ZA 3UATA 2VWFA 1QWFA 1ZUYA 2EYZA 1QKWA 1YWPA 2K7AA 2KROA 2L2PA 5GJVB 2DM1A 2DRMA 3M0QA 1AWXA 4RTZA 2LJ1A 2D8HA 1ZX6A 4OMQA 3REBB 5I11A 1G83A 4JJDA 1JXOA 4LN2A 2CT4A 4AG1C 1SRLA 1ZLMA 2KRMA 4RTUA
chains in the Genus database with same CATH superfamily
4M7DB 2JM9A 2LX9A 2GTOA 2J6FA 3JB9D 2FHDA 5IXFA 2EPDA 4AG2C 1VQ7Q 2EYYA 5L23A 3QDRB 2CZ6B 3E1SA 5GAOq 4JJNK 4DEXA 1BBZA 4MMKA 3UF4A 2LNHB 4XU2A 4C0DB 3BDUA 2JZ2A 2EQIA 2I0NA 1Q82C 2BE9B 1GL5A 1CKAA 3QWXX 1PHTA 4OVAA 1YITT 1GCPA 4EPCA 5CK9A 2RMOA 3OBYA 2MAMA 4F7UF 1D1BA 2VASA 2Y4YA 1K4US 3OW2S 4E7LA 5KYYA 4FCYA 3PFSA 3HL8A 4ELZC 2CSQA 3MKDA 4KGVB 3P8BB 4M7AD 4J9HA 4QVCA 1VQ5T 1U8RA 1RLPC 1NJIC 3BY7A 1B07A 4RTTA 4WTOB 2CREA 2FPEA 1RI0A 2KVQG 4FW2A 2XKOC 4J6XA 3SB2A 1ZSZB 3OYFA 1C6VX 5KH6A 2V1RA 4CC3A 1RLQC 1OZ3A 2AZSA 2MF2A 2IPOB 1X75C 3GBQA 2DD5A 1IXDA 5KYWA 2FVUA 2MK5A 3M9QA 2EGAA 3S3NA 2RHYA 3OW2A 2QAZA 3OYNA 1OX8A 3M0SA 2J7IA 2JVVA 2NUTB 3CCJA 2FYKA 1G3TA 1YHQQ 1VQ6T 3H9NA 1QCNA 2AT1B 3JCMP 2OX7A 2FG0A 1BI0A 1VQOQ 1U3OA 1AZEA 2EYXA 4PJNA 3CCSA 3QJ6A 2LDMA 3QZ5B 3E9FA 2A37A 2YRDA 4JZ3A 1U1TA 2DF6A 1JJ2A 2F69A 2ROLA 4A4EA 3I55Q 4M78D 5I21A 1VUBA 4R0KA 1R77A 3I35A 2E1HA 5GAN5 1Q95G 3CC7Q 4QVDA 1TG0A 2E4HA 4A4KA 3JB9G 2G3RA 2KAFA 3URGA 2DLPA 2VKNA 4FYYB 4RTWA 4EMKB 2EAYA 2KXCA 4IIOA 2CYZB 2YRCA 3OYKA 3R6OA 2EJFA 2CP0A 1RADB 1YJWQ 3CCVT 3H0IA 1RAEB 3OYGA 1WYXA 4Y28E 3JCMe 3Q1JA 2NUPB 1JO8A 5GMKe 2LT1A 3M0RA 1VQMT 2LQ8A 5IXBA 1OYXA 4PFZA 1T3LA 3SEMA 3HTRA 2F5TX 5IAYA 2DTHA 2E5QA 2JJ9A 4KGZB 4AFSC 2QTXA 4BE0A 4M7AG 2RNAA 4M77D 4KRTA 1D0XA 5LJ3e 2CDTA 4KT0E 4B9XA 2PNIA 2IG0A 1K9MR 4JRKA 1D0ZA 2KRNA 3M0PA 3L2UA 2LTOA 2EQMA 3QDFA 2PTKA 1X6BA 2VGMA 2HBWA 3CCLQ 2QG9B 3VS4A 1PRMC 2JOYA 4GLMA 2E70A 5LJ5h 3CPWA 2D0QB 2X4JA 4ME7A 3V8JA 4XTUA 4Z8AA 1PG5B 2DL8A 1RAHB 1HJDA 2MCNA 4GY5A 1VIEA 3OS1A 4M75A 3I9QA 2L3PA 1UTIA 5LJ5j 3OS5A 2COYA 4M7AB 2X35A 1TTHB 2M51A 4JRQA 1VQ4Q 2KRSA 2R58A 3INZA 3M5AA 4M78G 2ZZDA 4E6RA 2CP6A 1SF9A 5DY9A 5KCHA 1C0MA 2XDBA 5IHKA 1UUEA 3PMIA 2BTTA 2YUPA 4BI8B 1H641 2KBTA 3J7AF 1VQ6Q 1OI1A 2COWA 2GGRA 3OYBA 2COZA 1Y0MA 2R57A 1JQQA 2YLCA 3C4SA 3JSCA 3VS2A 3EFSA 2JM8A 2Y90A 5KYUA 4C92G 3RDVA 3MHXA 1WJQA 2F5KA 1QCFA 2A08A 4RTVA 3FB9A 3E19A 3EG3A 3PMTA 1V29B 1VQLA 1OZ2A 2PU9B 3MEVA 1YJ9T 3FLGA 3VV0A 4QQGA 2K2VA 5FU6C 1S72A 1WHKA 4RCBA 4QVZA 1YN8A 3V7SA 2LQNA 4M78B 2HAXA 2DKGA 3VUBA 4PFOA 2QEXA 1VIFA 1Y96A 2X9HA 4L5GA 3EGDA 2RD1A 4C8QA 4M77G 3M0UA 1TUGB 4PL6A 1Q86U 3QWYA 1PWTA 4QT7A 2RJCA 3RIRA 2VB6A 3A8LB 2P84A 1KJWA 3NTKA 2HEQA 1S72T 2BZYA 4CRIA 4J7FA 4LDXA 2DMOA 5GAMd 1AWJA 2CUDA 1G3WA 4PJOA 4HA8A 2DL5A 3QXEB 5GAOp 2LP5A 3L2VA 1JRIA 3QHSA 2QEXT 4TVRA 4F7UA 2D1XA 1E6HA 4CC4B 1I5LA 2K5FA 3VKIA 3E2UA 3V8LA 1UDLA 1Q81U 3H41A 2MMPA 4JLGA 2XI9A 2FO0A 1M1KU 3F70A 4IKFA 1BI3A 2E3IA 1VYVA 3CCQT 2YRVA 5ECAA 2RI2A 1MHNA 4M77B 3SD4A 2QQBA 1M3BA 3LWHA 3JCMc 3OYYA 1M30A 2K57A 2PZ1A 2C06A 1YI2A 3CCEA 2QASA 5FW9A 2CP2A 1UHCA 2PVGB 2J6OA 3H8ZA 4J8OA 2E10A 1TS9A 4WF2A 5IN1A 1VYUA 1X43A 2QQSA 5FWCA 1M2VA 2CH4W 2KYMA 1IGUA 1FMWA 2VWFA 1VQ7A 3G4SA 1Q7YR 1QP2A 3OYIA 2DM1A 4F04B 4BY6C 3META 2QA4A 1Y71A 2AIRB 1Q82U 1M90R 5L8RE 4XTWA 3CCET 2E12A 2HZYA 2ATCB 1G83A 1Y7XA 4M75E 4LN2A 2HQXA 4E7SA 2QYZA 1SRLA 4XTXA 2DYIA 1ACMB 5FU7C 1WHMA 4ELYC 4OMFB 1YCSB 3G4ST 2CKKA 1BI1A 4IUTA 3WVEB 2P4TA 3PT9A 2QA4T 4ZNXA 2EYQA 3C12A 5I2MA 1WZOA 1AZGB 2K3YA 2H3JA 1N6AA 1NJIU 3CCRA 4RKUE 1D1CA 1QWEA 4HCCA 2DBKA 4BUGA 5A0LA 1TWBA 1K73C 1QLYA 2RQVA 3VRYA 2KGTA 2GNCA 2L3RA 1SSHA 2W10A 4BB7A 1VQ8T 2HKQB 1WJRA 1TXQA 3I56Q 2ZPBB 3CCMA 1YIJQ 2DL4A 2IVWA 1PRLC 4OMMA 3QYHB 2C0TA 4FYVB 4J83A 1EIFA 2VYTA 4PFPA 1VQNA 2HNIA 2LQWA 1NZ9A 1BU1A 2D9TA 2KE9A 3HRTA 4LE9A 5CKHA 1WFWA 1PD0A 2YUQA 2OTLT 1X69A 1VQOA 3EFOA 1NYGA 1YCYA 1AD5A 2FZKB 1WXTA 4EMHA 1QVPA 2DEUA 2NUZA 4NL3A 4C8QE 9ATCB 3CD6Q 4FT2A 4OMOA 2O4XA 3CCMT 3CMAT 1ZBJA 2CZ0B 2X4YA 2FPDA 4C5EA 4DBRA 1RUWA 1TUDA 1FYNA 4NS5A 3OS2A 3G71A 2JMCA 1JEGA 1QVGP 4N4IA 4PJOE 3CCQQ 4R56A 1ARKA 1PKTA 2DIGA 1BCMA 4HKEA 1RAAB 1UJ0A 1QVFS 2HDAA 2M0OA 2QGGA 1XNIA 2OI3A 2RPNA 2HL3A 2K2MA 2QK0A 1QW1A 5FRMA 2DL7A 2EJ9A 3C0CA 4BD3A 3PTAA 2V8JA 5DLQE 2DTOA 4ZGEB 2DPPB 2P0KA 1UG1A 1TSFA 3GP8A 2YSQA 1MNEA 1UGPB 1Y57A 1E7OA 1ZSGA 3TREA 1G2BA 1YNZA 1VQ9A 4IIMA 1ZUKA 3QSUA 2NWMA 2WSFE 3DLLA 5CIUA 4JDSA 3JCMg 1YP5A 3UWNA 2DD4A 4X9DA 4OB3B 5GANd 2FRWA 3KFVA 4E7JA 2K9GA 2RJDA 3VS7A 4C8QF 3CC4A 3PVQA 1KC8R 4XU3A 3UPUA 1QVFA 4AT1B 3QJYA 4PLIA 3OYDA 4IUQA 2HSEB 5GAMe 1ZSZA 4OB1B 5GMKi 2O9SA 2L8DA 4D6WA 3JB9I 4B6MA 1RACB 1KK7A 1PKSA 4LUEA 2GF7A 4HVWA 3OMCA 1SEMA 3L1AA 5HK3A 4F16A 1VQ9T 4PJOF 3A8GB 1VQPT 4MDWA 3MCAB 4QQDA 3G6EQ 2J05A 4A53A 3CCLA 5LJ3g 4C8QC 3LH0A 3OY9A 1QKXA 2YWWA 4XU0A 2LZ6B 4EDUA 4IUVA 1GBRA 1KFZA 2X3WD 3EG1A 1NLOC 4KGXB 2RI5A 3V7RA 2HSPA 1WPYA 3AHUA 3KBGA 2GFAA 3LH5A 3LW5E 5GMKh 1I1JA 4MDXA 4FSXA 2GTJA 2E6ZA 4KUDK 4KBMB 1NLPC 4PJOC 1KQSP 1OEBA 3CXCP 1AWOA 3LX7A 2H8HA 4J9BA 1N8RR 3CC2A 2CS7A 2EGCA 1WA7A 3VRZA 5GMKj 3HRSA 5GAOr 4N0AC 2EFIA 2FEIA 4MZPA 1XQHA 2QQRA 4PK4A 1OX9A 2XDPA 5C0MA 2E6NA 2RHIA 3FRNA 1ZA1B 4EMKA 3NMZC 1RABB 4ZGJB 4HT9A 1NBEB 1IGQA 1I07A 2DXCA 1VQKA 2JXBA 5LJ5d 4J9DA 2JTMA 4L6V5 5HCKA 3RERA 4HVUA 5IH2A 3NTIA 4OGEA 1LCKA 1UECA 4O6JA 4NOYA 2D6FA 1K8AC 3CMAQ 1NEGA 5GMKl 2M0YA 3CC2T 2RM4A 4J9CA 4X9CA 3L2RA 2ZPFB 2CGHA 2DX1A 1W70A 3H0FA 2L0AA 3OBWA 2D0NA 5KYYB 1SHGA 1WDXA 4M75D 5CKBA 3RKYA 4JPBW 4M7DE 4ATOA 1N9RA 3ER0A 3CCJT 2RQTA 3M4GA 4PNOA 4WCIA 5CCAA 1IZ6A 1WQWA 2YUNA 3C95A 1MNDA 4MZMA 7AT1B 3CCST 1J3TA 2DIQA 3JCMb 4C92D 2I2LA 2L3QA 2O88A 2DZ9A 2AZVA 3CCUQ 3FJ5A 1HD3A 3OA6A 2VUBA 3OSSC 4C5IA 1UGSB 5KYWB 2JTEA 5GMKm 1QVGS 2HD0A 3FC3A 2MOXA 4BE1A 2MYSA 2YHTA 2CZ1B 3LGFA 2JS0A 5CKFA 3UT1A 1BB9A 4Z88A 1YWOA 2VXFA 1VA7A 1K0XA 3DKMA 3UA7A 4FIBA 1YITQ 1VQPQ 5KYXA 1AT1B 2IIMA 4M7DF 5FROA 3X24B 1YJNA 2F2WA 1LJOA 2DZCA 1I5OB 1HK9A 3CBOA 2E65A 1PC0A 2V1QA 2DETA 3FDRA 3UDCA 2MWPA 4HCZA 4F14A 3QKJA 1H3ZA 4KUIA 3J80E 1VQ5Q 2L5QA 2LT4A 2KT1A 3VJPA 1E6GA 4PJOD 2EQUA 1IREB 4M7DC 4PKCC 3TVTA 3GLXA 2GCXA 2KXDA 2OTJA 1KD1R 1YJNT 1O9SA 1UFFA 1LNXA 4AFUC 3EG9A 3C94A 2KDSA 4A63B 2EW3A 2K79A 5GANe 2D8JA 4M75G 3UATA 4C0DC 1QWFA 3VUZA 3WVDB 2K7AA 2BIVA 3RUXA 1SKUB 2DRMA 4RTZA 2D8HA 1K73U 1FWZA 3CXCS 2R5MA 2NYSA 1OU8A 4BE2A 1PD1A 1JBMA 5EG2A 1JXOA 2K5LA 3I56A 1ZLMA 4RTUA 1WLPB 1KQ2A 2EYWA 1UGVA 3GNGA 1GBQA 3CCJQ 2AHJB 3EG0A 1MMAA 2QDLA 1PSEA 4PJMA 3O5ZA 1YBYA 4DQ2A 3CCSQ 1ZSZC 4DEYA 3RR6A 3TSWA 3OYEA 4CC2A 1W2BP 3CCVQ 3CXCA 2XMFA 3SWNB 3EFRA 3LGLA 1NG2A 3EH2A 1SPKA 4QKUA 1VQLT 3A8OB 1UEBA 1X27A 2K4YA 5GAN2 4RCCA 1VQMQ 3IQLA 5KYNA 4C92B 2DXBA 4BI3A 1HYOA 1NEBA 1Q7YC 4C8QG 1XTDA 4Z89A 2LCLA 3JCMf 5LJ5e 1M4ZA 2K6DA 1M3AA 3CMEA 3HRUA 4FL6A 2XU8A 1KHIA 3JCMW 1M90C 4N0AA 5KYUB 4BDZA 2RHUA 2XD0A 1R0CB 5CQXA 2XDDA 2ROTA 1S1NA 2DBMA 1SHFA 1B3QA 4PJOG 4LD9K 2CT3A 4X1VA 2CP3A 2M16A 4LUDA 4F17A 4F7UG 4LDWA 5GAOm 3L2QA 2JTFA 2K5IA 1K0SA 1MGQA 2QGFB 1PCXA 3LWIA 4M7AE 4E7HA 4EMKC 1YFNA 4C0FA 5GAN8 1UGRB 5LJ3f 1UE9A 3PE0A 4ZGDB 3HFOA 4LNPA 1N27A 3OQ5A 4D8DA 1X01A 3EGDB 3JB9F 3CEYA 3NTHA 1WX6A 4KH0B 2HCKA 1NM7A 5GAN6 3L2ZA 4RMOA 2X4WA 3JB9H 1GFCA 5GJWB 3QIIA 1V1CA 1M1FA 2AK5A 2H3EB 1Z9ZA 4E7IA 4CI0C 1YI2T 1WHJA 4XAXB 4F7UB 2JMAA 3EAEA 4ESRA 4XTZA 2EQJA 4J9EA 4OB2B 2AKLA 1AEYA 3EGXA 3VYHB 2VV5A 3PIOA 3NHNA 3WXMB 3FJPA 5GAMg 1VQ7T 1UGQB 2GFUA 2KSSA 5CR2A 5D6WA 3JRZA 4M78E 3S6WA 1ZBXA 2KEAA 2ZPIB 4ANJA 1B34A 2VXEA 4M7AF 5D7UA 3MEWA 3OSVA 2OAUA 3JCMJ 1RAGB 3HSBA 2E41A 4C0ZA 1JJ2P 4FYWB 1YJ9Q 4MMLA 3ME9A 4P5NA 2BZXA 1XOVA 2LVMA 3ZL7C 5CO7A 4QQ6A 4LDYA 2QQAA 5I22A 2DYBA 1WXUA 3S3MA 1M2VB 3ZEHA 1WJSA 2YLBA 2J6KA 3CBMA 2ZPEB 4M7AC 2F2VA 2CZ7B 1HXDA 3NGPA 1YHQA 3CCRT 4FYXB 1GCQC 2VGNA 4K11A 1VQLQ 2HMAA 1K8AU 3M58A 1M3CA 1AOJA 2XICA 4L59A 1IHVA 2QQ9A 1S72Q 1VOMA 2FB7A 5GAMj 4Q5WA 2SRCA 2WSEE 3M53A 4M77E 4HT8A 1AHJB 4XU1A 3RBBB 3I55A 2P0QA 1T0JA 4M78F 4M7DA 2QEXQ 3CC7A 4XTVA 1LPLA 3L2WA 1VQNT 4A4HA 2YT6A 2YDLA 4OF1A 2KQWA 1KC8C 4J6YA 3I5RA 1GFDA 1YHQT 3QYGB 2ZPGB 2FRYA 1VQOT 4OMNA 4RG8A 1QP3A 4QW2A 3SDZA 2RK1A 3DB4A 2LJ0A 4EIKA 4FU6A 4M78C 4PJJA 3R6NA 3JCMX 1YJWA 3UA6A 3CCUA 3M4YA 3N5BB 4O5VA 4DOWA 3CQTA 2XK0A 1KHCA 3CC7T 1KIKA 3H0HA 2B86A 2O9VA 2DEQA 1TH7A 2RJFA 2X51A 1NYFA 3G7ZA 3VS0A 3SWNC 3T9NA 2DE0X 4JZ4A 3THKA 3G71T 4V2SA 4JUVA 2AKKA 5CQYA 3CPWP 1OV3A 3MO8A 3MPUB 4ZTFA 1MV3A 3HFNA 4DA4A 2A0FB 3BDLA 3EFOB 2V8KA 3HPWA 1D3BB 2L3SA 4M77F 3TU4K 2A36A 1N8RC 4E2FB 2DVEA 2HQEA 3VU3C 3CCEQ 1GRIA 5HKCA 2EBPA 2JNGA 3SFMA 2DK3A 1M5Q1 2O4XB 3RESA 1WQ7A 1Q86R 1K1ZA 4AMCA 3OYCA 1T0HA 5D6XA 2RK2A 3X28B 1R8OB 3G4SQ 2PUKB 2MI6A 1M8VA 1P92A 3X25B 3JV3A 1FMKA 3P8HA 2QA4Q 4M77C 2NUTA 4XQ3A 1D09B 2DAQA 2J06A 1VQ5A 3CC4T 1W1FA 8AT1B 4D8KA 1Q81R 1RL2A 2DO3A 2ED0A 2M1HA 1PM3A 3JCMh 1G5VA 1M1KR 3LLRA 3A1PA 2CP7A 4ORZA 2A28A 1VQ8Q 3SHWA 2EVRA 1VQ4A 1WHLA 4C0GA 1AVZC 2BE7D 4LD6A 1NE8A 1FX7A 2DERA 2YUOA 4RTYA 3CCLT 1SSFA 3I5SA 4OMPA 1V76A 5CAIA 5FU6B 2RN8A 1NPPA 5FWBA 4JLIA 1PNJA 2LQKA 5GAN4 1QQJA 3CCRQ 1VQ6A 2ZPHB 2YXYA 5DM7R 2WACA 2OTLQ 5LJ3h 2WSCE 5CKEA 4UC4A 1KG1A 1JJ2S 2CSIA 3GNFB 1KSWA 3PGGA 3PIPA 3M59A 2BUDA 5GANg 2KR3A 1RI9A 1VQ4T 2GBQA 2DJQA 4A4GA 4FT4A 1NPRA 1G3YA 2NUPA 3MP6A 1UB4A 1JXMA 5LJ3j 3CCMQ 2ABLA 2EQKA 3P8DA 2MPXC 4OB0B 1Q82R 3MP1A 3D7SB 1VQNQ 5DLOA 1EFNA 5GAN3 2P4RA 2X3XD 1MV0B 4FW1A 4LDVA 5J26A 1WIEA 3MEAA 1X6OA 1M2OA 1ZUYA 2EYZA 1QKWA 2L2PA 3M54A 3X26B 1VQKT 1SG5A 3M0QA 1AWXA 2E64A 3OB9A 2LJ1A 4OGCA 4II1A 1K9MC 3RMQA 1RAFB 3CCVA 3G1JA 4OMQA 1NJIR 5I11A 2FZGB 4JJDA 2CT4A 1VQMA 5GANh 2KRMA 1Q7YU 1B7TA 3G71Q 2A7YA 4J5YA 3GF5A 3ZFJA 5KCOA 2Z0WA 3FIFA 4AFZC 5GANj 1IO6A 1BIAA 2LCCA 2HL5C 1M90U 3VS1A 2RQRA 5C6SA 3TEEA 3GPLA 2ECZA 3OYMA 5FLXE 3M57A 1KD1C 2F2XA 2V8IA 1N9SA 4M7AA 3DLMA 2HQHA 5LL6S 4BY6B 1K8AR 4OP0A 3KUFA 5FRNA 5LJ5g 1U5SA 2KI7A 1GCQA 2RO0A 1VQ9Q 1BCOA 3V7CA 3CPWS 2PUOB 5GAMf 2LMJA 1BKBA 1IHWA 4C8QD 1KQ1A 1QVGA 1ABQA 4JJBA 2DRKA 4GLKA 4C5GA 5GAN7 3CC4Q 3RMSA 5FU7B 1UJYA 1Y07A 1SRMA 4RTXA 1ABOA 2OAWA 2QI2A 1WI7A 3EGUA 3VS3A 3TCJA 2MIOA 2MWOA 1Z9QA 4KULA 2LJ3A 4BACA 3JB9J 3CBPA 2DFUA 2FL7A 2GQVA 2P0PA 1OQKA 1IB8A 4Y92A 2RQWA 1U1SA 2K3XA 1BYMA 2DJZA 2NLUA 2EWNA 2RH2A 4A54A 3V8KA 4DBHA 5IHNA 4YTLA 4Z02A 5J3BA 1GXIE 2M9UA 4M78A 4DOVA 1OPLA 2HKNA 4E7KA 5AYFA 2LNVA 2XIDA 1UHFA 3OMGA 4ZN3A 2C0IA 3L42A 4R55A 2JUFA 2DNUA 1I8FA 2VC8A 3SWNA 1OU9A 3MEUA 1W4SA 3MJXA 3QBYA 3HHTB 1KQSS 3CC2Q 2RF0A 2KNBB 1YJ9A 3O8VA 4C92A 1PSFA 5KYXB 2ENMA 2OTJT 8ATCB 4HVVA 3TQ7P 3TSZA 5A0DA 3NFCA 4JS5A 2L89A 2PQWA 2EGEA 1OOTA 1YIJA 2V26A 1JU5C 2LC4A 3ULRB 4J6WA 1VQKQ 2KMTA 3JAME 1MMGA 2C0OA 2KY9A 3BE3A 3BFMA 5IT9E 1CSKA 3BW1A 5J39A 4M75B 4PLLA 2VVKA 4HCBA 1ZA2B 2O01E 5A0GA 5GAOl 2ED1A 4M77A 1KQSA 2LX7A 2RHZA 2RB6A 2DILA 3EG9B 3QPHA 3I56T 3CD6A 1K9AA 4EMGA 3QUIA 1YIJT 4XK8E 1A0NB 3ZBDA 4NL2A 2OJ2A 1OPKA 1KC8U 2ZCFB 4ZN1A 4XTYA 1MMNA 2JN0A 1BIBA 4AFQC 1WHGA 3CCQA 1X2QA 1MMDA 4DBQA 1QVFP 4J9FA 5A2QE 3A8MB 2E5KA 1QCOA 3QZ9B 4FM4B 3FEOA 1ZQ1A 2DA9A 4J7IA 4BDYA 3CD6T 4KH1B 1QMCA 5D6YA 5HY6A 2SEMA 2A3LA 3OS0A 1H92A 3H6ZA 1TOVA 2W0ZA 1M27C 1IRXA 2O2OA 1FXXA 2GQIA 3CMET 3RNJA 1Y96B 2M02A 3M0TA 2CUBA 3MP8A 4C8QB 4ZTJA 1N8RU 3X20B 4IURA 3EHRA 4RG2A 2B8AA 3RKWA 1EX4A 3A98A 4M7DD 3VS5A 5AT1B 1U06A 1MUZA 1AWWA 3HP9A 4MZTA 2JT4A 1YJNQ 2PVOB 2CH4A 4PJOB 1F1BB 3PVLA 4B9WA 3PNWC 5IHIA 4C5HA 3GOXA 3G6EA 1WXBA 2QDYB 3OYJA 2QXFA 4HXJA 3RKXA 2DTIA 3EG2A 1X2KA 3OW2P 4CC7A 2JS2A 3A8HB 3OYHA 1T3SA 2BZ8A 1XJWB 1FMVA 2X4XA 1M8MA 1H3HA 5GANf 4JS4A 1WGSA 2EJGA 2PVDB 1BK2A 2OTJQ 2RI3A 2EKHA 1I0CA 3LYIA 3NPFA 1RAIB 3EH1A 3REAB 4JRPA 1VQ8A 2DXUA 2KK4A 1VYTA 3G6ET 2BKDN 3VS6A 3E9GA 2E3HA 4IUPA 2KYBA 4C92E 3J81E 1R0BG 3DB3A 3CPFA 1LOJA 2DVJA 4J9IA 2O31A 1OULA 2ESWA 3U23A 2OTLA 3M56A 1X6GA 4E7ZA 4JJCA 5KE3A 5GAMh 3AT1B 2XG8D 4N4GA 2G6FX 5KE2A 4BI4A 4VUBA 3QO3A 2R5AA 2RQUA 3CMAA 1HSQA 4J9GA 3JCMd 5M9OA 4FSSA 1I81A 2ZGWA 5EC7A 4IUUA 3EGXB 1W6XA 5CVIA 1ZUUA 1DJ7B 2RJEA 2LRQA 2QTVA 4M75F 2F1LA 1I4K1 1BI2A 2CP5A 1B34B 4E47A 2EKOA 1D3BA 1K9MU 2KT8A 3OYLA 1W2BS 2LCSA 3QG1A 2K3BA 1Q86C 3VYGA 1G3SA 1D0YA 5I2SA 5LJ3d 5LJ5f 1ZHIA 4M7DG 1TUCA 2FPFA 4HCKA 5CKDA 1N5ZA 2JW4A 4OMLA 4C92F 1JB0E 1K73R 4X34A 4LDUA 2DL3A 1WHHA 2DXTA 3OYAA 3GIBA 1H8KA 5HK0A 3I55T 3EHQA 4GBQA 1WNLA 4M75C 1M1GA 4Y91A 4RUGA 1CKBA 3CMEQ 1K76A 3KXTA 4M4ZA 3ASKA 4JRIA 3JCMQ 2XHCA 1C1AA 4F7UE 1Q81C 1D1AA 1YWPA 5GJVB 2KROA 2RHXA 4N4HA 1EZZB 2HBPA 1M1KC 1KD1U 3M55A 1W2BA 3S3OA 4C92C 1ZX6A 2ZAEA 3A5ZB 3HKSA 4LXCA 1M9SA 3REBB 4PJLA 2RA2A 2EIFA 2Y4XA 1YJWT 1O75A 1YI2Q 3CCUT 3JCMV 1G8XA 4A4FA 4DBFA 5GAOn 1LVKA 1TU0B 4AG1C 2FZCB 6AT1B 1YITA 1VQPA
chains in the Genus database with same CATH topology
1WLPB 2JM9A 2GTOA 2EYWA 2J6FA 1YCSB 1UGVA 5IXFA 1GBQA 2EPDA 3EG0A 4AFZC 4AG2C 1IO6A 2QDLA 4ZNXA 2EYYA 3VS1A 5L23A 3O5ZA 1AZGB 2RQRA 4DEYA 4DEXA 1BBZA 3UF4A 1QWEA 2LNHB 2ECZA 3TSWA 2DBKA 4CC2A 2F2XA 2XMFA 2EQIA 1QLYA 2I0NA 2RQVA 2KGTA 3VRYA 1GL5A 1NG2A 2GNCA 1CKAA 1SPKA 1SSHA 3QWXX 2W10A 1PHTA 1X27A 1GCPA 1U5SA 3IQLA 2RMOA 1GCQA 2DL4A 1NEBA 1PRLC 4OMMA 1K4US 2C0TA 4Z89A 2LMJA 2LQWA 2CSQA 1ABQA 2K6DA 1M3AA 4JJBA 2DRKA 1BU1A 1UJYA 1SRMA 4RTXA 2KE9A 4LE9A 1ABOA 2OAWA 1WI7A 4J9HA 1WFWA 3EGUA 2YUQA 1X69A 1RLPC 3VS3A 1B07A 1S1NA 2ROTA 2MIOA 2DBMA 1NYGA 4RTTA 1SHFA 1B3QA 1Z9QA 2LJ3A 2CREA 2FPEA 1AD5A 1WXTA 2CT3A 4X1VA 4LUDA 2NUZA 4Y92A 2RQWA 4F17A 2V1RA 4OMOA 4CC3A 1RLQC 1K0SA 1ZBJA 2AZSA 2FPDA 5IHNA 3GBQA 1RUWA 1TUDA 1UE9A 1FYNA 3PE0A 2EGAA 4LNPA 4D8DA 2JMCA 1JEGA 1OPLA 3M0SA 2J7IA 1UHFA 1ARKA 2C0IA 1WX6A 2HCKA 1NM7A 1PKTA 2FG0A 2DNUA 1U3OA 1AZEA 1UJ0A 2EYXA 2HDAA 1GFCA 2OI3A 2RPNA 5GJWB 1V1CA 2K2MA 2A37A 2AK5A 2DL7A 4JZ3A 3C0CA 2RF0A 2DF6A 2KNBB 1Z9ZA 2ROLA 1UG1A 2ENMA 4R0KA 4HVVA 3I35A 3TSZA 2YSQA 1Y57A 1ZSGA 1E7OA 1G2BA 2EGEA 1YNZA 2JMAA 4ESRA 1TG0A 4J9EA 1OOTA 2AKLA 4IIMA 1ZUKA 1AEYA 2DLPA 3NHNA 2NWMA 1JU5C 3ULRB 2VKNA 4RTWA 1YP5A 2FRWA 2KXCA 3KFVA 4IIOA 2K9GA 3VS7A 2KEAA 2C0OA 3PVQA 1CSKA 2VVKA 3H0IA 2O9SA 1WYXA 2ED1A 1JO8A 2LX7A 2DILA 1PKSA 2BZXA 1XOVA 4LUEA 4HVWA 3ZL7C 3M0RA 1SEMA 4F16A 1K9AA 5I22A 5IXBA 1A0NB 2DYBA 2J05A 1WXUA 1T3LA 2OJ2A 3SEMA 1OPKA 1QKXA 2J6KA 4AFSC 2LZ6B 2F2VA 1GBRA 1KFZA 2X3WD 3EG1A 1NLOC 2RNAA 2HSPA 3NGPA 4KRTA 4AFQC 1X2QA 2CDTA 1GCQC 3LH5A 4K11A 2PNIA 4J9FA 1I1JA 2E5KA 1M3CA 1AOJA 2GTJA 1NLPC 2KRNA 2DA9A 1OEBA 3M0PA 1AWOA 2SRCA 2H8HA 4J9BA 2PTKA 2SEMA 1H92A 2EGCA 1WA7A 3VRZA 1X6BA 3RBBB 1T0JA 2FEIA 2W0ZA 1M27C 2HBWA 2O2OA 3VS4A 1PRMC 3NMZC 2YT6A 4GLMA 2GQIA 2YDLA 3RNJA 3I5RA 1GFDA 4Z8AA 2DL8A 1HJDA 1I07A 2MCNA 3M0TA 2CUBA 2FRYA 2JXBA 4J9DA 3I9QA 4OMNA 5HCKA 2L3PA 4HVUA 1UTIA 5IH2A 2LJ0A 4EIKA 1LCKA 1UECA 3EHRA 2M51A 1NEGA 3A98A 2M0YA 3R6NA 2KRSA 4J9CA 3VS5A 3UA6A 1U06A 1MUZA 4E6RA 1AWWA 2JT4A 3CQTA 2DX1A 1KIKA 3H0HA 1W70A 2B86A 2CH4A 2O9VA 3H0FA 1UUEA 5IHKA 1NYFA 2L0AA 2BTTA 2YUPA 3PVLA 2D0NA 2KBTA 1SHGA 3VS0A 2DE0X 5IHIA 4JZ4A 3THKA 1WDXA 1WXBA 2AKKA 2GGRA 4HXJA 1Y0MA 4JPBW 1OV3A 3EG2A 1X2KA 1JQQA 4CC7A 2JS2A 1MV3A 3VS2A 2RQTA 4WCIA 2JM8A 2YUNA 1T3SA 2BZ8A 1M8MA 2L3SA 1H3HA 1QCFA 1J3TA 2A36A 2A08A 4RTVA 1BK2A 3EG3A 1GRIA 2EBPA 2EKHA 1I0CA 2L3QA 3NPFA 2O88A 3REAB 2AZVA 1K1ZA 3FJ5A 1HD3A 1T0HA 1YN8A 2LQNA 1VYTA 2JTEA 3VS6A 2MOXA 2KYBA 3JV3A 1FMKA 2DVJA 4J9IA 2O31A 2JS0A 2ESWA 1BB9A 3M0UA 3U23A 2J06A 1X6GA 4Z88A 1W1FA 1YWOA 4D8KA 2ED0A 3QWYA 1PWTA 4JJCA 4QT7A 2G6FX 1VA7A 1KJWA 1K0XA 2HEQA 2BZYA 3UA7A 2RQUA 4ORZA 2A28A 2DMOA 3SHWA 2EVRA 1AWJA 2CUDA 1HSQA 4J9GA 2IIMA 2DL5A 4FSSA 1AVZC 2LP5A 5EC7A 2F2WA 2YUOA 4RTYA 2D1XA 1E6HA 1W6XA 4CC4B 3I5SA 4OMPA 1ZUUA 2RN8A 1UDLA 5FWBA 1PNJA 3H41A 2V1QA 2FO0A 4F14A 2KT8A 1VYVA 2LCSA 2K3BA 2KT1A 5ECAA 2CSIA 1KSWA 1E6GA 1M3BA 2KR3A 1RI9A 3TVTA 2GBQA 1TUCA 1M30A 2DJQA 2FPFA 4HCKA 2PZ1A 1N5ZA 2JW4A 1JXMA 2KXDA 4OMLA 5FW9A 2ABLA 1UHCA 2J6OA 1UFFA 4AFUC 2DL3A 1VYUA 4A63B 1H8KA 3EHQA 1EFNA 4GBQA 1X43A 2EW3A 2K79A 2P4RA 2X3XD 4RUGA 1CKBA 5FWCA 1K76A 2D8JA 1MV0B 2CH4W 2KYMA 1WIEA 4M4ZA 3UATA 2VWFA 1QWFA 1ZUYA 2EYZA 1QKWA 1YWPA 2K7AA 2KROA 2L2PA 5GJVB 2DM1A 2DRMA 3M0QA 1AWXA 4RTZA 2LJ1A 2D8HA 1ZX6A 4OMQA 3REBB 5I11A 1G83A 4JJDA 1JXOA 4LN2A 2CT4A 4AG1C 1SRLA 1ZLMA 2KRMA 4RTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLP B;  2JM9 A;  2GTO A;  2EYW A;  2J6F A;  1YCS B;  1UGV A;  5IXF A;  1GBQ A;  2EPD A;  3EG0 A;  4AFZ C;  4AG2 C;  1IO6 A;  2QDL A;  4ZNX A;  2EYY A;  3VS1 A;  5L23 A;  3O5Z A;  1AZG B;  2RQR A;  4DEY A;  4DEX A;  1BBZ A;  3UF4 A;  1QWE A;  2LNH B;  2ECZ A;  3TSW A;  2DBK A;  4CC2 A;  2F2X A;  2XMF A;  2EQI A;  1QLY A;  2I0N A;  2RQV A;  2KGT A;  3VRY A;  1GL5 A;  1NG2 A;  2GNC A;  1CKA A;  1SPK A;  1SSH A;  3QWX X;  2W10 A;  1PHT A;  1X27 A;  1GCP A;  1U5S A;  3IQL A;  2RMO A;  1GCQ A;  2DL4 A;  1NEB A;  1PRL C;  4OMM A;  1K4U S;  2C0T A;  4Z89 A;  2LMJ A;  2LQW A;  2CSQ A;  1ABQ A;  2K6D A;  1M3A A;  4JJB A;  2DRK A;  1BU1 A;  1UJY A;  1SRM A;  4RTX A;  2KE9 A;  4LE9 A;  1ABO A;  2OAW A;  1WI7 A;  4J9H A;  1WFW A;  3EGU A;  2YUQ A;  1X69 A;  1RLP C;  3VS3 A;  1B07 A;  1S1N A;  2ROT A;  2MIO A;  2DBM A;  1NYG A;  4RTT A;  1SHF A;  1B3Q A;  1Z9Q A;  2LJ3 A;  2CRE A;  2FPE A;  1AD5 A;  1WXT A;  2CT3 A;  4X1V A;  4LUD A;  2NUZ A;  4Y92 A;  2RQW A;  4F17 A;  2V1R A;  4OMO A;  4CC3 A;  1RLQ C;  1K0S A;  1ZBJ A;  2AZS A;  2FPD A;  5IHN A;  3GBQ A;  1RUW A;  1TUD A;  1UE9 A;  1FYN A;  3PE0 A;  2EGA A;  4LNP A;  4D8D A;  2JMC A;  1JEG A;  1OPL A;  3M0S A;  2J7I A;  1UHF A;  1ARK A;  2C0I A;  1WX6 A;  2HCK A;  1NM7 A;  1PKT A;  2FG0 A;  2DNU A;  1U3O A;  1AZE A;  1UJ0 A;  2EYX A;  2HDA A;  1GFC A;  2OI3 A;  2RPN A;  5GJW B;  1V1C A;  2K2M A;  2A37 A;  2AK5 A;  2DL7 A;  4JZ3 A;  3C0C A;  2RF0 A;  2DF6 A;  2KNB B;  1Z9Z A;  2ROL A;  1UG1 A;  2ENM A;  4R0K A;  4HVV A;  3I35 A;  3TSZ A;  2YSQ A;  1Y57 A;  1ZSG A;  1E7O A;  1G2B A;  2EGE A;  1YNZ A;  2JMA A;  4ESR A;  1TG0 A;  4J9E A;  1OOT A;  2AKL A;  4IIM A;  1ZUK A;  1AEY A;  2DLP A;  3NHN A;  2NWM A;  1JU5 C;  3ULR B;  2VKN A;  4RTW A;  1YP5 A;  2FRW A;  2KXC A;  3KFV A;  4IIO A;  2K9G A;  3VS7 A;  2KEA A;  2C0O A;  3PVQ A;  1CSK A;  2VVK A;  3H0I A;  2O9S A;  1WYX A;  2ED1 A;  1JO8 A;  2LX7 A;  2DIL A;  1PKS A;  2BZX A;  1XOV A;  4LUE A;  4HVW A;  3ZL7 C;  3M0R A;  1SEM A;  4F16 A;  1K9A A;  5I22 A;  5IXB A;  1A0N B;  2DYB A;  2J05 A;  1WXU A;  1T3L A;  2OJ2 A;  3SEM A;  1OPK A;  1QKX A;  2J6K A;  4AFS C;  2LZ6 B;  2F2V A;  1GBR A;  1KFZ A;  2X3W D;  3EG1 A;  1NLO C;  2RNA A;  2HSP A;  3NGP A;  4KRT A;  4AFQ C;  1X2Q A;  2CDT A;  1GCQ C;  3LH5 A;  4K11 A;  2PNI A;  4J9F A;  1I1J A;  2E5K A;  1M3C A;  1AOJ A;  2GTJ A;  1NLP C;  2KRN A;  2DA9 A;  1OEB A;  3M0P A;  1AWO A;  2SRC A;  2H8H A;  4J9B A;  2PTK A;  2SEM A;  1H92 A;  2EGC A;  1WA7 A;  3VRZ A;  1X6B A;  3RBB B;  1T0J A;  2FEI A;  2W0Z A;  1M27 C;  2HBW A;  2O2O A;  3VS4 A;  1PRM C;  3NMZ C;  2YT6 A;  4GLM A;  2GQI A;  2YDL A;  3RNJ A;  3I5R A;  1GFD A;  4Z8A A;  2DL8 A;  1HJD A;  1I07 A;  2MCN A;  3M0T A;  2CUB A;  2FRY A;  2JXB A;  4J9D A;  3I9Q A;  4OMN A;  5HCK A;  2L3P A;  4HVU A;  1UTI A;  5IH2 A;  2LJ0 A;  4EIK A;  1LCK A;  1UEC A;  3EHR A;  2M51 A;  1NEG A;  3A98 A;  2M0Y A;  3R6N A;  2KRS A;  4J9C A;  3VS5 A;  3UA6 A;  1U06 A;  1MUZ A;  4E6R A;  1AWW A;  2JT4 A;  3CQT A;  2DX1 A;  1KIK A;  3H0H A;  1W70 A;  2B86 A;  2CH4 A;  2O9V A;  3H0F A;  1UUE A;  5IHK A;  1NYF A;  2L0A A;  2BTT A;  2YUP A;  3PVL A;  2D0N A;  2KBT A;  1SHG A;  3VS0 A;  2DE0 X;  5IHI A;  4JZ4 A;  3THK A;  1WDX A;  1WXB A;  2AKK A;  2GGR A;  4HXJ A;  1Y0M A;  4JPB W;  1OV3 A;  3EG2 A;  1X2K A;  1JQQ A;  4CC7 A;  2JS2 A;  1MV3 A;  3VS2 A;  2RQT A;  4WCI A;  2JM8 A;  2YUN A;  1T3S A;  2BZ8 A;  1M8M A;  2L3S A;  1H3H A;  1QCF A;  1J3T A;  2A36 A;  2A08 A;  4RTV A;  1BK2 A;  3EG3 A;  1GRI A;  2EBP A;  2EKH A;  1I0C A;  2L3Q A;  3NPF A;  2O88 A;  3REA B;  2AZV A;  1K1Z A;  3FJ5 A;  1HD3 A;  1T0H A;  1YN8 A;  2LQN A;  1VYT A;  2JTE A;  3VS6 A;  2MOX A;  2KYB A;  3JV3 A;  1FMK A;  2DVJ A;  4J9I A;  2O31 A;  2JS0 A;  2ESW A;  1BB9 A;  3M0U A;  3U23 A;  2J06 A;  1X6G A;  4Z88 A;  1W1F A;  1YWO A;  4D8K A;  2ED0 A;  3QWY A;  1PWT A;  4JJC A;  4QT7 A;  2G6F X;  1VA7 A;  1KJW A;  1K0X A;  2HEQ A;  2BZY A;  3UA7 A;  2RQU A;  4ORZ A;  2A28 A;  2DMO A;  3SHW A;  2EVR A;  1AWJ A;  2CUD A;  1HSQ A;  4J9G A;  2IIM A;  2DL5 A;  4FSS A;  1AVZ C;  2LP5 A;  5EC7 A;  2F2W A;  2YUO A;  4RTY A;  2D1X A;  1E6H A;  1W6X A;  4CC4 B;  3I5S A;  4OMP A;  1ZUU A;  2RN8 A;  1UDL A;  5FWB A;  1PNJ A;  3H41 A;  2V1Q A;  2FO0 A;  4F14 A;  2KT8 A;  1VYV A;  2LCS A;  2K3B A;  2KT1 A;  5ECA A;  2CSI A;  1KSW A;  1E6G A;  1M3B A;  2KR3 A;  1RI9 A;  3TVT A;  2GBQ A;  1TUC A;  1M30 A;  2DJQ A;  2FPF A;  4HCK A;  2PZ1 A;  1N5Z A;  2JW4 A;  1JXM A;  2KXD A;  4OML A;  5FW9 A;  2ABL A;  1UHC A;  2J6O A;  1UFF A;  4AFU C;  2DL3 A;  1VYU A;  4A63 B;  1H8K A;  3EHQ A;  1EFN A;  4GBQ A;  1X43 A;  2EW3 A;  2K79 A;  2P4R A;  2X3X D;  4RUG A;  1CKB A;  5FWC A;  1K76 A;  2D8J A;  1MV0 B;  2CH4 W;  2KYM A;  1WIE A;  4M4Z A;  3UAT A;  2VWF A;  1QWF A;  1ZUY A;  2EYZ A;  1QKW A;  1YWP A;  2K7A A;  2KRO A;  2L2P A;  5GJV B;  2DM1 A;  2DRM A;  3M0Q A;  1AWX A;  4RTZ A;  2LJ1 A;  2D8H A;  1ZX6 A;  4OMQ A;  3REB B;  5I11 A;  1G83 A;  4JJD A;  1JXO A;  4LN2 A;  2CT4 A;  4AG1 C;  1SRL A;  1ZLM A;  2KRM A;  4RTU A; 
#chains in the Genus database with same CATH topology
 4M7D B;  2JM9 A;  2LX9 A;  2GTO A;  2J6F A;  3JB9 D;  2FHD A;  5IXF A;  2EPD A;  4AG2 C;  1VQ7 Q;  2EYY A;  5L23 A;  3QDR B;  2CZ6 B;  3E1S A;  5GAO q;  4JJN K;  4DEX A;  1BBZ A;  4MMK A;  3UF4 A;  2LNH B;  4XU2 A;  4C0D B;  3BDU A;  2JZ2 A;  2EQI A;  2I0N A;  1Q82 C;  2BE9 B;  1GL5 A;  1CKA A;  3QWX X;  1PHT A;  4OVA A;  1YIT T;  1GCP A;  4EPC A;  5CK9 A;  2RMO A;  3OBY A;  2MAM A;  4F7U F;  1D1B A;  2VAS A;  2Y4Y A;  1K4U S;  3OW2 S;  4E7L A;  5KYY A;  4FCY A;  3PFS A;  3HL8 A;  4ELZ C;  2CSQ A;  3MKD A;  4KGV B;  3P8B B;  4M7A D;  4J9H A;  4QVC A;  1VQ5 T;  1U8R A;  1RLP C;  1NJI C;  3BY7 A;  1B07 A;  4RTT A;  4WTO B;  2CRE A;  2FPE A;  1RI0 A;  2KVQ G;  4FW2 A;  2XKO C;  4J6X A;  3SB2 A;  1ZSZ B;  3OYF A;  1C6V X;  5KH6 A;  2V1R A;  4CC3 A;  1RLQ C;  1OZ3 A;  2AZS A;  2MF2 A;  2IPO B;  1X75 C;  3GBQ A;  2DD5 A;  1IXD A;  5KYW A;  2FVU A;  2MK5 A;  3M9Q A;  2EGA A;  3S3N A;  2RHY A;  3OW2 A;  2QAZ A;  3OYN A;  1OX8 A;  3M0S A;  2J7I A;  2JVV A;  2NUT B;  3CCJ A;  2FYK A;  1G3T A;  1YHQ Q;  1VQ6 T;  3H9N A;  1QCN A;  2AT1 B;  3JCM P;  2OX7 A;  2FG0 A;  1BI0 A;  1VQO Q;  1U3O A;  1AZE A;  2EYX A;  4PJN A;  3CCS A;  3QJ6 A;  2LDM A;  3QZ5 B;  3E9F A;  2A37 A;  2YRD A;  4JZ3 A;  1U1T A;  2DF6 A;  1JJ2 A;  2F69 A;  2ROL A;  4A4E A;  3I55 Q;  4M78 D;  5I21 A;  1VUB A;  4R0K A;  1R77 A;  3I35 A;  2E1H A;  5GAN 5;  1Q95 G;  3CC7 Q;  4QVD A;  1TG0 A;  2E4H A;  4A4K A;  3JB9 G;  2G3R A;  2KAF A;  3URG A;  2DLP A;  2VKN A;  4FYY B;  4RTW A;  4EMK B;  2EAY A;  2KXC A;  4IIO A;  2CYZ B;  2YRC A;  3OYK A;  3R6O A;  2EJF A;  2CP0 A;  1RAD B;  1YJW Q;  3CCV T;  3H0I A;  1RAE B;  3OYG A;  1WYX A;  4Y28 E;  3JCM e;  3Q1J A;  2NUP B;  1JO8 A;  5GMK e;  2LT1 A;  3M0R A;  1VQM T;  2LQ8 A;  5IXB A;  1OYX A;  4PFZ A;  1T3L A;  3SEM A;  3HTR A;  2F5T X;  5IAY A;  2DTH A;  2E5Q A;  2JJ9 A;  4KGZ B;  4AFS C;  2QTX A;  4BE0 A;  4M7A G;  2RNA A;  4M77 D;  4KRT A;  1D0X A;  5LJ3 e;  2CDT A;  4KT0 E;  4B9X A;  2PNI A;  2IG0 A;  1K9M R;  4JRK A;  1D0Z A;  2KRN A;  3M0P A;  3L2U A;  2LTO A;  2EQM A;  3QDF A;  2PTK A;  1X6B A;  2VGM A;  2HBW A;  3CCL Q;  2QG9 B;  3VS4 A;  1PRM C;  2JOY A;  4GLM A;  2E70 A;  5LJ5 h;  3CPW A;  2D0Q B;  2X4J A;  4ME7 A;  3V8J A;  4XTU A;  4Z8A A;  1PG5 B;  2DL8 A;  1RAH B;  1HJD A;  2MCN A;  4GY5 A;  1VIE A;  3OS1 A;  4M75 A;  3I9Q A;  2L3P A;  1UTI A;  5LJ5 j;  3OS5 A;  2COY A;  4M7A B;  2X35 A;  1TTH B;  2M51 A;  4JRQ A;  1VQ4 Q;  2KRS A;  2R58 A;  3INZ A;  3M5A A;  4M78 G;  2ZZD A;  4E6R A;  2CP6 A;  1SF9 A;  5DY9 A;  5KCH A;  1C0M A;  2XDB A;  5IHK A;  1UUE A;  3PMI A;  2BTT A;  2YUP A;  4BI8 B;  1H64 1;  2KBT A;  3J7A F;  1VQ6 Q;  1OI1 A;  2COW A;  2GGR A;  3OYB A;  2COZ A;  1Y0M A;  2R57 A;  1JQQ A;  2YLC A;  3C4S A;  3JSC A;  3VS2 A;  3EFS A;  2JM8 A;  2Y90 A;  5KYU A;  4C92 G;  3RDV A;  3MHX A;  1WJQ A;  2F5K A;  1QCF A;  2A08 A;  4RTV A;  3FB9 A;  3E19 A;  3EG3 A;  3PMT A;  1V29 B;  1VQL A;  1OZ2 A;  2PU9 B;  3MEV A;  1YJ9 T;  3FLG A;  3VV0 A;  4QQG A;  2K2V A;  5FU6 C;  1S72 A;  1WHK A;  4RCB A;  4QVZ A;  1YN8 A;  3V7S A;  2LQN A;  4M78 B;  2HAX A;  2DKG A;  3VUB A;  4PFO A;  2QEX A;  1VIF A;  1Y96 A;  2X9H A;  4L5G A;  3EGD A;  2RD1 A;  4C8Q A;  4M77 G;  3M0U A;  1TUG B;  4PL6 A;  1Q86 U;  3QWY A;  1PWT A;  4QT7 A;  2RJC A;  3RIR A;  2VB6 A;  3A8L B;  2P84 A;  1KJW A;  3NTK A;  2HEQ A;  1S72 T;  2BZY A;  4CRI A;  4J7F A;  4LDX A;  2DMO A;  5GAM d;  1AWJ A;  2CUD A;  1G3W A;  4PJO A;  4HA8 A;  2DL5 A;  3QXE B;  5GAO p;  2LP5 A;  3L2V A;  1JRI A;  3QHS A;  2QEX T;  4TVR A;  4F7U A;  2D1X A;  1E6H A;  4CC4 B;  1I5L A;  2K5F A;  3VKI A;  3E2U A;  3V8L A;  1UDL A;  1Q81 U;  3H41 A;  2MMP A;  4JLG A;  2XI9 A;  2FO0 A;  1M1K U;  3F70 A;  4IKF A;  1BI3 A;  2E3I A;  1VYV A;  3CCQ T;  2YRV A;  5ECA A;  2RI2 A;  1MHN A;  4M77 B;  3SD4 A;  2QQB A;  1M3B A;  3LWH A;  3JCM c;  3OYY A;  1M30 A;  2K57 A;  2PZ1 A;  2C06 A;  1YI2 A;  3CCE A;  2QAS A;  5FW9 A;  2CP2 A;  1UHC A;  2PVG B;  2J6O A;  3H8Z A;  4J8O A;  2E10 A;  1TS9 A;  4WF2 A;  5IN1 A;  1VYU A;  1X43 A;  2QQS A;  5FWC A;  1M2V A;  2CH4 W;  2KYM A;  1IGU A;  1FMW A;  2VWF A;  1VQ7 A;  3G4S A;  1Q7Y R;  1QP2 A;  3OYI A;  2DM1 A;  4F04 B;  4BY6 C;  3MET A;  2QA4 A;  1Y71 A;  2AIR B;  1Q82 U;  1M90 R;  5L8R E;  4XTW A;  3CCE T;  2E12 A;  2HZY A;  2ATC B;  1G83 A;  1Y7X A;  4M75 E;  4LN2 A;  2HQX A;  4E7S A;  2QYZ A;  1SRL A;  4XTX A;  2DYI A;  1ACM B;  5FU7 C;  1WHM A;  4ELY C;  4OMF B;  1YCS B;  3G4S T;  2CKK A;  1BI1 A;  4IUT A;  3WVE B;  2P4T A;  3PT9 A;  2QA4 T;  4ZNX A;  2EYQ A;  3C12 A;  5I2M A;  1WZO A;  1AZG B;  2K3Y A;  2H3J A;  1N6A A;  1NJI U;  3CCR A;  4RKU E;  1D1C A;  1QWE A;  4HCC A;  2DBK A;  4BUG A;  5A0L A;  1TWB A;  1K73 C;  1QLY A;  2RQV A;  3VRY A;  2KGT A;  2GNC A;  2L3R A;  1SSH A;  2W10 A;  4BB7 A;  1VQ8 T;  2HKQ B;  1WJR A;  1TXQ A;  3I56 Q;  2ZPB B;  3CCM A;  1YIJ Q;  2DL4 A;  2IVW A;  1PRL C;  4OMM A;  3QYH B;  2C0T A;  4FYV B;  4J83 A;  1EIF A;  2VYT A;  4PFP A;  1VQN A;  2HNI A;  2LQW A;  1NZ9 A;  1BU1 A;  2D9T A;  2KE9 A;  3HRT A;  4LE9 A;  5CKH A;  1WFW A;  1PD0 A;  2YUQ A;  2OTL T;  1X69 A;  1VQO A;  3EFO A;  1NYG A;  1YCY A;  1AD5 A;  2FZK B;  1WXT A;  4EMH A;  1QVP A;  2DEU A;  2NUZ A;  4NL3 A;  4C8Q E;  9ATC B;  3CD6 Q;  4FT2 A;  4OMO A;  2O4X A;  3CCM T;  3CMA T;  1ZBJ A;  2CZ0 B;  2X4Y A;  2FPD A;  4C5E A;  4DBR A;  1RUW A;  1TUD A;  1FYN A;  4NS5 A;  3OS2 A;  3G71 A;  2JMC A;  1JEG A;  1QVG P;  4N4I A;  4PJO E;  3CCQ Q;  4R56 A;  1ARK A;  1PKT A;  2DIG A;  1BCM A;  4HKE A;  1RAA B;  1UJ0 A;  1QVF S;  2HDA A;  2M0O A;  2QGG A;  1XNI A;  2OI3 A;  2RPN A;  2HL3 A;  2K2M A;  2QK0 A;  1QW1 A;  5FRM A;  2DL7 A;  2EJ9 A;  3C0C A;  4BD3 A;  3PTA A;  2V8J A;  5DLQ E;  2DTO A;  4ZGE B;  2DPP B;  2P0K A;  1UG1 A;  1TSF A;  3GP8 A;  2YSQ A;  1MNE A;  1UGP B;  1Y57 A;  1E7O A;  1ZSG A;  3TRE A;  1G2B A;  1YNZ A;  1VQ9 A;  4IIM A;  1ZUK A;  3QSU A;  2NWM A;  2WSF E;  3DLL A;  5CIU A;  4JDS A;  3JCM g;  1YP5 A;  3UWN A;  2DD4 A;  4X9D A;  4OB3 B;  5GAN d;  2FRW A;  3KFV A;  4E7J A;  2K9G A;  2RJD A;  3VS7 A;  4C8Q F;  3CC4 A;  3PVQ A;  1KC8 R;  4XU3 A;  3UPU A;  1QVF A;  4AT1 B;  3QJY A;  4PLI A;  3OYD A;  4IUQ A;  2HSE B;  5GAM e;  1ZSZ A;  4OB1 B;  5GMK i;  2O9S A;  2L8D A;  4D6W A;  3JB9 I;  4B6M A;  1RAC B;  1KK7 A;  1PKS A;  4LUE A;  2GF7 A;  4HVW A;  3OMC A;  1SEM A;  3L1A A;  5HK3 A;  4F16 A;  1VQ9 T;  4PJO F;  3A8G B;  1VQP T;  4MDW A;  3MCA B;  4QQD A;  3G6E Q;  2J05 A;  4A53 A;  3CCL A;  5LJ3 g;  4C8Q C;  3LH0 A;  3OY9 A;  1QKX A;  2YWW A;  4XU0 A;  2LZ6 B;  4EDU A;  4IUV A;  1GBR A;  1KFZ A;  2X3W D;  3EG1 A;  1NLO C;  4KGX B;  2RI5 A;  3V7R A;  2HSP A;  1WPY A;  3AHU A;  3KBG A;  2GFA A;  3LH5 A;  3LW5 E;  5GMK h;  1I1J A;  4MDX A;  4FSX A;  2GTJ A;  2E6Z A;  4KUD K;  4KBM B;  1NLP C;  4PJO C;  1KQS P;  1OEB A;  3CXC P;  1AWO A;  3LX7 A;  2H8H A;  4J9B A;  1N8R R;  3CC2 A;  2CS7 A;  2EGC A;  1WA7 A;  3VRZ A;  5GMK j;  3HRS A;  5GAO r;  4N0A C;  2EFI A;  2FEI A;  4MZP A;  1XQH A;  2QQR A;  4PK4 A;  1OX9 A;  2XDP A;  5C0M A;  2E6N A;  2RHI A;  3FRN A;  1ZA1 B;  4EMK A;  3NMZ C;  1RAB B;  4ZGJ B;  4HT9 A;  1NBE B;  1IGQ A;  1I07 A;  2DXC A;  1VQK A;  2JXB A;  5LJ5 d;  4J9D A;  2JTM A;  4L6V 5;  5HCK A;  3RER A;  4HVU A;  5IH2 A;  3NTI A;  4OGE A;  1LCK A;  1UEC A;  4O6J A;  4NOY A;  2D6F A;  1K8A C;  3CMA Q;  1NEG A;  5GMK l;  2M0Y A;  3CC2 T;  2RM4 A;  4J9C A;  4X9C A;  3L2R A;  2ZPF B;  2CGH A;  2DX1 A;  1W70 A;  3H0F A;  2L0A A;  3OBW A;  2D0N A;  5KYY B;  1SHG A;  1WDX A;  4M75 D;  5CKB A;  3RKY A;  4JPB W;  4M7D E;  4ATO A;  1N9R A;  3ER0 A;  3CCJ T;  2RQT A;  3M4G A;  4PNO A;  4WCI A;  5CCA A;  1IZ6 A;  1WQW A;  2YUN A;  3C95 A;  1MND A;  4MZM A;  7AT1 B;  3CCS T;  1J3T A;  2DIQ A;  3JCM b;  4C92 D;  2I2L A;  2L3Q A;  2O88 A;  2DZ9 A;  2AZV A;  3CCU Q;  3FJ5 A;  1HD3 A;  3OA6 A;  2VUB A;  3OSS C;  4C5I A;  1UGS B;  5KYW B;  2JTE A;  5GMK m;  1QVG S;  2HD0 A;  3FC3 A;  2MOX A;  4BE1 A;  2MYS A;  2YHT A;  2CZ1 B;  3LGF A;  2JS0 A;  5CKF A;  3UT1 A;  1BB9 A;  4Z88 A;  1YWO A;  2VXF A;  1VA7 A;  1K0X A;  3DKM A;  3UA7 A;  4FIB A;  1YIT Q;  1VQP Q;  5KYX A;  1AT1 B;  2IIM A;  4M7D F;  5FRO A;  3X24 B;  1YJN A;  2F2W A;  1LJO A;  2DZC A;  1I5O B;  1HK9 A;  3CBO A;  2E65 A;  1PC0 A;  2V1Q A;  2DET A;  3FDR A;  3UDC A;  2MWP A;  4HCZ A;  4F14 A;  3QKJ A;  1H3Z A;  4KUI A;  3J80 E;  1VQ5 Q;  2L5Q A;  2LT4 A;  2KT1 A;  3VJP A;  1E6G A;  4PJO D;  2EQU A;  1IRE B;  4M7D C;  4PKC C;  3TVT A;  3GLX A;  2GCX A;  2KXD A;  2OTJ A;  1KD1 R;  1YJN T;  1O9S A;  1UFF A;  1LNX A;  4AFU C;  3EG9 A;  3C94 A;  2KDS A;  4A63 B;  2EW3 A;  2K79 A;  5GAN e;  2D8J A;  4M75 G;  3UAT A;  4C0D C;  1QWF A;  3VUZ A;  3WVD B;  2K7A A;  2BIV A;  3RUX A;  1SKU B;  2DRM A;  4RTZ A;  2D8H A;  1K73 U;  1FWZ A;  3CXC S;  2R5M A;  2NYS A;  1OU8 A;  4BE2 A;  1PD1 A;  1JBM A;  5EG2 A;  1JXO A;  2K5L A;  3I56 A;  1ZLM A;  4RTU A;  1WLP B;  1KQ2 A;  2EYW A;  1UGV A;  3GNG A;  1GBQ A;  3CCJ Q;  2AHJ B;  3EG0 A;  1MMA A;  2QDL A;  1PSE A;  4PJM A;  3O5Z A;  1YBY A;  4DQ2 A;  3CCS Q;  1ZSZ C;  4DEY A;  3RR6 A;  3TSW A;  3OYE A;  4CC2 A;  1W2B P;  3CCV Q;  3CXC A;  2XMF A;  3SWN B;  3EFR A;  3LGL A;  1NG2 A;  3EH2 A;  1SPK A;  4QKU A;  1VQL T;  3A8O B;  1UEB A;  1X27 A;  2K4Y A;  5GAN 2;  4RCC A;  1VQM Q;  3IQL A;  5KYN A;  4C92 B;  2DXB A;  4BI3 A;  1HYO A;  1NEB A;  1Q7Y C;  4C8Q G;  1XTD A;  4Z89 A;  2LCL A;  3JCM f;  5LJ5 e;  1M4Z A;  2K6D A;  1M3A A;  3CME A;  3HRU A;  4FL6 A;  2XU8 A;  1KHI A;  3JCM W;  1M90 C;  4N0A A;  5KYU B;  4BDZ A;  2RHU A;  2XD0 A;  1R0C B;  5CQX A;  2XDD A;  2ROT A;  1S1N A;  2DBM A;  1SHF A;  1B3Q A;  4PJO G;  4LD9 K;  2CT3 A;  4X1V A;  2CP3 A;  2M16 A;  4LUD A;  4F17 A;  4F7U G;  4LDW A;  5GAO m;  3L2Q A;  2JTF A;  2K5I A;  1K0S A;  1MGQ A;  2QGF B;  1PCX A;  3LWI A;  4M7A E;  4E7H A;  4EMK C;  1YFN A;  4C0F A;  5GAN 8;  1UGR B;  5LJ3 f;  1UE9 A;  3PE0 A;  4ZGD B;  3HFO A;  4LNP A;  1N27 A;  3OQ5 A;  4D8D A;  1X01 A;  3EGD B;  3JB9 F;  3CEY A;  3NTH A;  1WX6 A;  4KH0 B;  2HCK A;  1NM7 A;  5GAN 6;  3L2Z A;  4RMO A;  2X4W A;  3JB9 H;  1GFC A;  5GJW B;  3QII A;  1V1C A;  1M1F A;  2AK5 A;  2H3E B;  1Z9Z A;  4E7I A;  4CI0 C;  1YI2 T;  1WHJ A;  4XAX B;  4F7U B;  2JMA A;  3EAE A;  4ESR A;  4XTZ A;  2EQJ A;  4J9E A;  4OB2 B;  2AKL A;  1AEY A;  3EGX A;  3VYH B;  2VV5 A;  3PIO A;  3NHN A;  3WXM B;  3FJP A;  5GAM g;  1VQ7 T;  1UGQ B;  2GFU A;  2KSS A;  5CR2 A;  5D6W A;  3JRZ A;  4M78 E;  3S6W A;  1ZBX A;  2KEA A;  2ZPI B;  4ANJ A;  1B34 A;  2VXE A;  4M7A F;  5D7U A;  3MEW A;  3OSV A;  2OAU A;  3JCM J;  1RAG B;  3HSB A;  2E41 A;  4C0Z A;  1JJ2 P;  4FYW B;  1YJ9 Q;  4MML A;  3ME9 A;  4P5N A;  2BZX A;  1XOV A;  2LVM A;  3ZL7 C;  5CO7 A;  4QQ6 A;  4LDY A;  2QQA A;  5I22 A;  2DYB A;  1WXU A;  3S3M A;  1M2V B;  3ZEH A;  1WJS A;  2YLB A;  2J6K A;  3CBM A;  2ZPE B;  4M7A C;  2F2V A;  2CZ7 B;  1HXD A;  3NGP A;  1YHQ A;  3CCR T;  4FYX B;  1GCQ C;  2VGN A;  4K11 A;  1VQL Q;  2HMA A;  1K8A U;  3M58 A;  1M3C A;  1AOJ A;  2XIC A;  4L59 A;  1IHV A;  2QQ9 A;  1S72 Q;  1VOM A;  2FB7 A;  5GAM j;  4Q5W A;  2SRC A;  2WSE E;  3M53 A;  4M77 E;  4HT8 A;  1AHJ B;  4XU1 A;  3RBB B;  3I55 A;  2P0Q A;  1T0J A;  4M78 F;  4M7D A;  2QEX Q;  3CC7 A;  4XTV A;  1LPL A;  3L2W A;  1VQN T;  4A4H A;  2YT6 A;  2YDL A;  4OF1 A;  2KQW A;  1KC8 C;  4J6Y A;  3I5R A;  1GFD A;  1YHQ T;  3QYG B;  2ZPG B;  2FRY A;  1VQO T;  4OMN A;  4RG8 A;  1QP3 A;  4QW2 A;  3SDZ A;  2RK1 A;  3DB4 A;  2LJ0 A;  4EIK A;  4FU6 A;  4M78 C;  4PJJ A;  3R6N A;  3JCM X;  1YJW A;  3UA6 A;  3CCU A;  3M4Y A;  3N5B B;  4O5V A;  4DOW A;  3CQT A;  2XK0 A;  1KHC A;  3CC7 T;  1KIK A;  3H0H A;  2B86 A;  2O9V A;  2DEQ A;  1TH7 A;  2RJF A;  2X51 A;  1NYF A;  3G7Z A;  3VS0 A;  3SWN C;  3T9N A;  2DE0 X;  4JZ4 A;  3THK A;  3G71 T;  4V2S A;  4JUV A;  2AKK A;  5CQY A;  3CPW P;  1OV3 A;  3MO8 A;  3MPU B;  4ZTF A;  1MV3 A;  3HFN A;  4DA4 A;  2A0F B;  3BDL A;  3EFO B;  2V8K A;  3HPW A;  1D3B B;  2L3S A;  4M77 F;  3TU4 K;  2A36 A;  1N8R C;  4E2F B;  2DVE A;  2HQE A;  3VU3 C;  3CCE Q;  1GRI A;  5HKC A;  2EBP A;  2JNG A;  3SFM A;  2DK3 A;  1M5Q 1;  2O4X B;  3RES A;  1WQ7 A;  1Q86 R;  1K1Z A;  4AMC A;  3OYC A;  1T0H A;  5D6X A;  2RK2 A;  3X28 B;  1R8O B;  3G4S Q;  2PUK B;  2MI6 A;  1M8V A;  1P92 A;  3X25 B;  3JV3 A;  1FMK A;  3P8H A;  2QA4 Q;  4M77 C;  2NUT A;  4XQ3 A;  1D09 B;  2DAQ A;  2J06 A;  1VQ5 A;  3CC4 T;  1W1F A;  8AT1 B;  4D8K A;  1Q81 R;  1RL2 A;  2DO3 A;  2ED0 A;  2M1H A;  1PM3 A;  3JCM h;  1G5V A;  1M1K R;  3LLR A;  3A1P A;  2CP7 A;  4ORZ A;  2A28 A;  1VQ8 Q;  3SHW A;  2EVR A;  1VQ4 A;  1WHL A;  4C0G A;  1AVZ C;  2BE7 D;  4LD6 A;  1NE8 A;  1FX7 A;  2DER A;  2YUO A;  4RTY A;  3CCL T;  1SSF A;  3I5S A;  4OMP A;  1V76 A;  5CAI A;  5FU6 B;  2RN8 A;  1NPP A;  5FWB A;  4JLI A;  1PNJ A;  2LQK A;  5GAN 4;  1QQJ A;  3CCR Q;  1VQ6 A;  2ZPH B;  2YXY A;  5DM7 R;  2WAC A;  2OTL Q;  5LJ3 h;  2WSC E;  5CKE A;  4UC4 A;  1KG1 A;  1JJ2 S;  2CSI A;  3GNF B;  1KSW A;  3PGG A;  3PIP A;  3M59 A;  2BUD A;  5GAN g;  2KR3 A;  1RI9 A;  1VQ4 T;  2GBQ A;  2DJQ A;  4A4G A;  4FT4 A;  1NPR A;  1G3Y A;  2NUP A;  3MP6 A;  1UB4 A;  1JXM A;  5LJ3 j;  3CCM Q;  2ABL A;  2EQK A;  3P8D A;  2MPX C;  4OB0 B;  1Q82 R;  3MP1 A;  3D7S B;  1VQN Q;  5DLO A;  1EFN A;  5GAN 3;  2P4R A;  2X3X D;  1MV0 B;  4FW1 A;  4LDV A;  5J26 A;  1WIE A;  3MEA A;  1X6O A;  1M2O A;  1ZUY A;  2EYZ A;  1QKW A;  2L2P A;  3M54 A;  3X26 B;  1VQK T;  1SG5 A;  3M0Q A;  1AWX A;  2E64 A;  3OB9 A;  2LJ1 A;  4OGC A;  4II1 A;  1K9M C;  3RMQ A;  1RAF B;  3CCV A;  3G1J A;  4OMQ A;  1NJI R;  5I11 A;  2FZG B;  4JJD A;  2CT4 A;  1VQM A;  5GAN h;  2KRM A;  1Q7Y U;  1B7T A;  3G71 Q;  2A7Y A;  4J5Y A;  3GF5 A;  3ZFJ A;  5KCO A;  2Z0W A;  3FIF A;  4AFZ C;  5GAN j;  1IO6 A;  1BIA A;  2LCC A;  2HL5 C;  1M90 U;  3VS1 A;  2RQR A;  5C6S A;  3TEE A;  3GPL A;  2ECZ A;  3OYM A;  5FLX E;  3M57 A;  1KD1 C;  2F2X A;  2V8I A;  1N9S A;  4M7A A;  3DLM A;  2HQH A;  5LL6 S;  4BY6 B;  1K8A R;  4OP0 A;  3KUF A;  5FRN A;  5LJ5 g;  1U5S A;  2KI7 A;  1GCQ A;  2RO0 A;  1VQ9 Q;  1BCO A;  3V7C A;  3CPW S;  2PUO B;  5GAM f;  2LMJ A;  1BKB A;  1IHW A;  4C8Q D;  1KQ1 A;  1QVG A;  1ABQ A;  4JJB A;  2DRK A;  4GLK A;  4C5G A;  5GAN 7;  3CC4 Q;  3RMS A;  5FU7 B;  1UJY A;  1Y07 A;  1SRM A;  4RTX A;  1ABO A;  2OAW A;  2QI2 A;  1WI7 A;  3EGU A;  3VS3 A;  3TCJ A;  2MIO A;  2MWO A;  1Z9Q A;  4KUL A;  2LJ3 A;  4BAC A;  3JB9 J;  3CBP A;  2DFU A;  2FL7 A;  2GQV A;  2P0P A;  1OQK A;  1IB8 A;  4Y92 A;  2RQW A;  1U1S A;  2K3X A;  1BYM A;  2DJZ A;  2NLU A;  2EWN A;  2RH2 A;  4A54 A;  3V8K A;  4DBH A;  5IHN A;  4YTL A;  4Z02 A;  5J3B A;  1GXI E;  2M9U A;  4M78 A;  4DOV A;  1OPL A;  2HKN A;  4E7K A;  5AYF A;  2LNV A;  2XID A;  1UHF A;  3OMG A;  4ZN3 A;  2C0I A;  3L42 A;  4R55 A;  2JUF A;  2DNU A;  1I8F A;  2VC8 A;  3SWN A;  1OU9 A;  3MEU A;  1W4S A;  3MJX A;  3QBY A;  3HHT B;  1KQS S;  3CC2 Q;  2RF0 A;  2KNB B;  1YJ9 A;  3O8V A;  4C92 A;  1PSF A;  5KYX B;  2ENM A;  2OTJ T;  8ATC B;  4HVV A;  3TQ7 P;  3TSZ A;  5A0D A;  3NFC A;  4JS5 A;  2L89 A;  2PQW A;  2EGE A;  1OOT A;  1YIJ A;  2V26 A;  1JU5 C;  2LC4 A;  3ULR B;  4J6W A;  1VQK Q;  2KMT A;  3JAM E;  1MMG A;  2C0O A;  2KY9 A;  3BE3 A;  3BFM A;  5IT9 E;  1CSK A;  3BW1 A;  5J39 A;  4M75 B;  4PLL A;  2VVK A;  4HCB A;  1ZA2 B;  2O01 E;  5A0G A;  5GAO l;  2ED1 A;  4M77 A;  1KQS A;  2LX7 A;  2RHZ A;  2RB6 A;  2DIL A;  3EG9 B;  3QPH A;  3I56 T;  3CD6 A;  1K9A A;  4EMG A;  3QUI A;  1YIJ T;  4XK8 E;  1A0N B;  3ZBD A;  4NL2 A;  2OJ2 A;  1OPK A;  1KC8 U;  2ZCF B;  4ZN1 A;  4XTY A;  1MMN A;  2JN0 A;  1BIB A;  4AFQ C;  1WHG A;  3CCQ A;  1X2Q A;  1MMD A;  4DBQ A;  1QVF P;  4J9F A;  5A2Q E;  3A8M B;  2E5K A;  1QCO A;  3QZ9 B;  4FM4 B;  3FEO A;  1ZQ1 A;  2DA9 A;  4J7I A;  4BDY A;  3CD6 T;  4KH1 B;  1QMC A;  5D6Y A;  5HY6 A;  2SEM A;  2A3L A;  3OS0 A;  1H92 A;  3H6Z A;  1TOV A;  2W0Z A;  1M27 C;  1IRX A;  2O2O A;  1FXX A;  2GQI A;  3CME T;  3RNJ A;  1Y96 B;  2M02 A;  3M0T A;  2CUB A;  3MP8 A;  4C8Q B;  4ZTJ A;  1N8R U;  3X20 B;  4IUR A;  3EHR A;  4RG2 A;  2B8A A;  3RKW A;  1EX4 A;  3A98 A;  4M7D D;  3VS5 A;  5AT1 B;  1U06 A;  1MUZ A;  1AWW A;  3HP9 A;  4MZT A;  2JT4 A;  1YJN Q;  2PVO B;  2CH4 A;  4PJO B;  1F1B B;  3PVL A;  4B9W A;  3PNW C;  5IHI A;  4C5H A;  3GOX A;  3G6E A;  1WXB A;  2QDY B;  3OYJ A;  2QXF A;  4HXJ A;  3RKX A;  2DTI A;  3EG2 A;  1X2K A;  3OW2 P;  4CC7 A;  2JS2 A;  3A8H B;  3OYH A;  1T3S A;  2BZ8 A;  1XJW B;  1FMV A;  2X4X A;  1M8M A;  1H3H A;  5GAN f;  4JS4 A;  1WGS A;  2EJG A;  2PVD B;  1BK2 A;  2OTJ Q;  2RI3 A;  2EKH A;  1I0C A;  3LYI A;  3NPF A;  1RAI B;  3EH1 A;  3REA B;  4JRP A;  1VQ8 A;  2DXU A;  2KK4 A;  1VYT A;  3G6E T;  2BKD N;  3VS6 A;  3E9G A;  2E3H A;  4IUP A;  2KYB A;  4C92 E;  3J81 E;  1R0B G;  3DB3 A;  3CPF A;  1LOJ A;  2DVJ A;  4J9I A;  2O31 A;  1OUL A;  2ESW A;  3U23 A;  2OTL A;  3M56 A;  1X6G A;  4E7Z A;  4JJC A;  5KE3 A;  5GAM h;  3AT1 B;  2XG8 D;  4N4G A;  2G6F X;  5KE2 A;  4BI4 A;  4VUB A;  3QO3 A;  2R5A A;  2RQU A;  3CMA A;  1HSQ A;  4J9G A;  3JCM d;  5M9O A;  4FSS A;  1I81 A;  2ZGW A;  5EC7 A;  4IUU A;  3EGX B;  1W6X A;  5CVI A;  1ZUU A;  1DJ7 B;  2RJE A;  2LRQ A;  2QTV A;  4M75 F;  2F1L A;  1I4K 1;  1BI2 A;  2CP5 A;  1B34 B;  4E47 A;  2EKO A;  1D3B A;  1K9M U;  2KT8 A;  3OYL A;  1W2B S;  2LCS A;  3QG1 A;  2K3B A;  1Q86 C;  3VYG A;  1G3S A;  1D0Y A;  5I2S A;  5LJ3 d;  5LJ5 f;  1ZHI A;  4M7D G;  1TUC A;  2FPF A;  4HCK A;  5CKD A;  1N5Z A;  2JW4 A;  4OML A;  4C92 F;  1JB0 E;  1K73 R;  4X34 A;  4LDU A;  2DL3 A;  1WHH A;  2DXT A;  3OYA A;  3GIB A;  1H8K A;  5HK0 A;  3I55 T;  3EHQ A;  4GBQ A;  1WNL A;  4M75 C;  1M1G A;  4Y91 A;  4RUG A;  1CKB A;  3CME Q;  1K76 A;  3KXT A;  4M4Z A;  3ASK A;  4JRI A;  3JCM Q;  2XHC A;  1C1A A;  4F7U E;  1Q81 C;  1D1A A;  1YWP A;  5GJV B;  2KRO A;  2RHX A;  4N4H A;  1EZZ B;  2HBP A;  1M1K C;  1KD1 U;  3M55 A;  1W2B A;  3S3O A;  4C92 C;  1ZX6 A;  2ZAE A;  3A5Z B;  3HKS A;  4LXC A;  1M9S A;  3REB B;  4PJL A;  2RA2 A;  2EIF A;  2Y4X A;  1YJW T;  1O75 A;  1YI2 Q;  3CCU T;  3JCM V;  1G8X A;  4A4F A;  4DBF A;  5GAO n;  1LVK A;  1TU0 B;  4AG1 C;  2FZC B;  6AT1 B;  1YIT A;  1VQP A; 
#chains in the Genus database with same CATH homology
 1WLP B;  2JM9 A;  2GTO A;  2EYW A;  2J6F A;  1YCS B;  1UGV A;  5IXF A;  1GBQ A;  2EPD A;  3EG0 A;  4AFZ C;  4AG2 C;  1IO6 A;  2QDL A;  4ZNX A;  2EYY A;  3VS1 A;  5L23 A;  3O5Z A;  1AZG B;  2RQR A;  4DEY A;  4DEX A;  1BBZ A;  3UF4 A;  1QWE A;  2LNH B;  2ECZ A;  3TSW A;  2DBK A;  4CC2 A;  2F2X A;  2XMF A;  2EQI A;  1QLY A;  2I0N A;  2RQV A;  2KGT A;  3VRY A;  1GL5 A;  1NG2 A;  2GNC A;  1CKA A;  1SPK A;  1SSH A;  3QWX X;  2W10 A;  1PHT A;  1X27 A;  1GCP A;  1U5S A;  3IQL A;  2RMO A;  1GCQ A;  2DL4 A;  1NEB A;  1PRL C;  4OMM A;  1K4U S;  2C0T A;  4Z89 A;  2LMJ A;  2LQW A;  2CSQ A;  1ABQ A;  2K6D A;  1M3A A;  4JJB A;  2DRK A;  1BU1 A;  1UJY A;  1SRM A;  4RTX A;  2KE9 A;  4LE9 A;  1ABO A;  2OAW A;  1WI7 A;  4J9H A;  1WFW A;  3EGU A;  2YUQ A;  1X69 A;  1RLP C;  3VS3 A;  1B07 A;  1S1N A;  2ROT A;  2MIO A;  2DBM A;  1NYG A;  4RTT A;  1SHF A;  1B3Q A;  1Z9Q A;  2LJ3 A;  2CRE A;  2FPE A;  1AD5 A;  1WXT A;  2CT3 A;  4X1V A;  4LUD A;  2NUZ A;  4Y92 A;  2RQW A;  4F17 A;  2V1R A;  4OMO A;  4CC3 A;  1RLQ C;  1K0S A;  1ZBJ A;  2AZS A;  2FPD A;  5IHN A;  3GBQ A;  1RUW A;  1TUD A;  1UE9 A;  1FYN A;  3PE0 A;  2EGA A;  4LNP A;  4D8D A;  2JMC A;  1JEG A;  1OPL A;  3M0S A;  2J7I A;  1UHF A;  1ARK A;  2C0I A;  1WX6 A;  2HCK A;  1NM7 A;  1PKT A;  2FG0 A;  2DNU A;  1U3O A;  1AZE A;  1UJ0 A;  2EYX A;  2HDA A;  1GFC A;  2OI3 A;  2RPN A;  5GJW B;  1V1C A;  2K2M A;  2A37 A;  2AK5 A;  2DL7 A;  4JZ3 A;  3C0C A;  2RF0 A;  2DF6 A;  2KNB B;  1Z9Z A;  2ROL A;  1UG1 A;  2ENM A;  4R0K A;  4HVV A;  3I35 A;  3TSZ A;  2YSQ A;  1Y57 A;  1ZSG A;  1E7O A;  1G2B A;  2EGE A;  1YNZ A;  2JMA A;  4ESR A;  1TG0 A;  4J9E A;  1OOT A;  2AKL A;  4IIM A;  1ZUK A;  1AEY A;  2DLP A;  3NHN A;  2NWM A;  1JU5 C;  3ULR B;  2VKN A;  4RTW A;  1YP5 A;  2FRW A;  2KXC A;  3KFV A;  4IIO A;  2K9G A;  3VS7 A;  2KEA A;  2C0O A;  3PVQ A;  1CSK A;  2VVK A;  3H0I A;  2O9S A;  1WYX A;  2ED1 A;  1JO8 A;  2LX7 A;  2DIL A;  1PKS A;  2BZX A;  1XOV A;  4LUE A;  4HVW A;  3ZL7 C;  3M0R A;  1SEM A;  4F16 A;  1K9A A;  5I22 A;  5IXB A;  1A0N B;  2DYB A;  2J05 A;  1WXU A;  1T3L A;  2OJ2 A;  3SEM A;  1OPK A;  1QKX A;  2J6K A;  4AFS C;  2LZ6 B;  2F2V A;  1GBR A;  1KFZ A;  2X3W D;  3EG1 A;  1NLO C;  2RNA A;  2HSP A;  3NGP A;  4KRT A;  4AFQ C;  1X2Q A;  2CDT A;  1GCQ C;  3LH5 A;  4K11 A;  2PNI A;  4J9F A;  1I1J A;  2E5K A;  1M3C A;  1AOJ A;  2GTJ A;  1NLP C;  2KRN A;  2DA9 A;  1OEB A;  3M0P A;  1AWO A;  2SRC A;  2H8H A;  4J9B A;  2PTK A;  2SEM A;  1H92 A;  2EGC A;  1WA7 A;  3VRZ A;  1X6B A;  3RBB B;  1T0J A;  2FEI A;  2W0Z A;  1M27 C;  2HBW A;  2O2O A;  3VS4 A;  1PRM C;  3NMZ C;  2YT6 A;  4GLM A;  2GQI A;  2YDL A;  3RNJ A;  3I5R A;  1GFD A;  4Z8A A;  2DL8 A;  1HJD A;  1I07 A;  2MCN A;  3M0T A;  2CUB A;  2FRY A;  2JXB A;  4J9D A;  3I9Q A;  4OMN A;  5HCK A;  2L3P A;  4HVU A;  1UTI A;  5IH2 A;  2LJ0 A;  4EIK A;  1LCK A;  1UEC A;  3EHR A;  2M51 A;  1NEG A;  3A98 A;  2M0Y A;  3R6N A;  2KRS A;  4J9C A;  3VS5 A;  3UA6 A;  1U06 A;  1MUZ A;  4E6R A;  1AWW A;  2JT4 A;  3CQT A;  2DX1 A;  1KIK A;  3H0H A;  1W70 A;  2B86 A;  2CH4 A;  2O9V A;  3H0F A;  1UUE A;  5IHK A;  1NYF A;  2L0A A;  2BTT A;  2YUP A;  3PVL A;  2D0N A;  2KBT A;  1SHG A;  3VS0 A;  2DE0 X;  5IHI A;  4JZ4 A;  3THK A;  1WDX A;  1WXB A;  2AKK A;  2GGR A;  4HXJ A;  1Y0M A;  4JPB W;  1OV3 A;  3EG2 A;  1X2K A;  1JQQ A;  4CC7 A;  2JS2 A;  1MV3 A;  3VS2 A;  2RQT A;  4WCI A;  2JM8 A;  2YUN A;  1T3S A;  2BZ8 A;  1M8M A;  2L3S A;  1H3H A;  1QCF A;  1J3T A;  2A36 A;  2A08 A;  4RTV A;  1BK2 A;  3EG3 A;  1GRI A;  2EBP A;  2EKH A;  1I0C A;  2L3Q A;  3NPF A;  2O88 A;  3REA B;  2AZV A;  1K1Z A;  3FJ5 A;  1HD3 A;  1T0H A;  1YN8 A;  2LQN A;  1VYT A;  2JTE A;  3VS6 A;  2MOX A;  2KYB A;  3JV3 A;  1FMK A;  2DVJ A;  4J9I A;  2O31 A;  2JS0 A;  2ESW A;  1BB9 A;  3M0U A;  3U23 A;  2J06 A;  1X6G A;  4Z88 A;  1W1F A;  1YWO A;  4D8K A;  2ED0 A;  3QWY A;  1PWT A;  4JJC A;  4QT7 A;  2G6F X;  1VA7 A;  1KJW A;  1K0X A;  2HEQ A;  2BZY A;  3UA7 A;  2RQU A;  4ORZ A;  2A28 A;  2DMO A;  3SHW A;  2EVR A;  1AWJ A;  2CUD A;  1HSQ A;  4J9G A;  2IIM A;  2DL5 A;  4FSS A;  1AVZ C;  2LP5 A;  5EC7 A;  2F2W A;  2YUO A;  4RTY A;  2D1X A;  1E6H A;  1W6X A;  4CC4 B;  3I5S A;  4OMP A;  1ZUU A;  2RN8 A;  1UDL A;  5FWB A;  1PNJ A;  3H41 A;  2V1Q A;  2FO0 A;  4F14 A;  2KT8 A;  1VYV A;  2LCS A;  2K3B A;  2KT1 A;  5ECA A;  2CSI A;  1KSW A;  1E6G A;  1M3B A;  2KR3 A;  1RI9 A;  3TVT A;  2GBQ A;  1TUC A;  1M30 A;  2DJQ A;  2FPF A;  4HCK A;  2PZ1 A;  1N5Z A;  2JW4 A;  1JXM A;  2KXD A;  4OML A;  5FW9 A;  2ABL A;  1UHC A;  2J6O A;  1UFF A;  4AFU C;  2DL3 A;  1VYU A;  4A63 B;  1H8K A;  3EHQ A;  1EFN A;  4GBQ A;  1X43 A;  2EW3 A;  2K79 A;  2P4R A;  2X3X D;  4RUG A;  1CKB A;  5FWC A;  1K76 A;  2D8J A;  1MV0 B;  2CH4 W;  2KYM A;  1WIE A;  4M4Z A;  3UAT A;  2VWF A;  1QWF A;  1ZUY A;  2EYZ A;  1QKW A;  1YWP A;  2K7A A;  2KRO A;  2L2P A;  5GJV B;  2DM1 A;  2DRM A;  3M0Q A;  1AWX A;  4RTZ A;  2LJ1 A;  2D8H A;  1ZX6 A;  4OMQ A;  3REB B;  5I11 A;  1G83 A;  4JJD A;  1JXO A;  4LN2 A;  2CT4 A;  4AG1 C;  1SRL A;  1ZLM A;  2KRM A;  4RTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...