1K76A

Solution structure of the c-terminal sem-5 sh3 domain (minimized average structure)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVAPYNSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure, Dynamics and Thermodynamics of the Native State Ensemble of Sem-5 C-Terminal SH3 Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k76A00
4RTTA 2GNCA 2K9GA 2DRMA 1BB9A 3H0FA 3FJ5A 1W70A 1WA7A 2CH4W 2EYZA 2DRKA 2HCKA 4OMLA 2RMOA 2EGAA 1Y0MA 4OMPA 1AOJA 4J9CA 2DL4A 4CC2A 2GTOA 2LMJA 4RTUA 2GQIA 4Y92A 3NGPA 2J06A 1GCQC 1PRMC 3UF4A 1H3HA 2GTJA 3SEMA 2CDTA 1XOVA 1NLOC 1GCPA 2EW3A 1K0SA 5IHNA 1ZLMA 2OJ2A 1X69A 3PE0A 2KROA 1M3BA 4JJCA 1U5SA 2W10A 1NYFA 2DBKA 3RNJA 1W6XA 1MV3A 4R0KA 4F16A 4LE9A 2KEAA 1CKBA 1NM7A 2DX1A 1HSQA 1JXOA 2B86A 1PHTA 2EYWA 1TUDA 2EYYA 1K4US 2O2OA 1NEGA 1ABOA 4HVWA 3UATA 1G2BA 1BBZA 2AKLA 2KGTA 3VS7A 2HEQA 2DMOA 2KXCA 3VRZA 2P4RA 3U23A 3EG0A 3THKA 2RPNA 2L3SA 1K9AA 1CSKA 2LP5A 3EHQA 2JM8A 5I11A 3O5ZA 1M3CA 2RQWA 1UFFA 1OPLA 1AWXA 1H92A 1WYXA 3I5SA 1KFZA 2KRNA 5IXFA 1GBRA 2CUDA 1QWFA 1HJDA 1RI9A 3M0TA 5L23A 1AWOA 1OPKA 2LZ6B 4AG1C 1AWWA 2QDLA 2AZSA 1HD3A 1GFDA 5IHKA 1KSWA 4FSSA 2JS0A 2LQWA 4J9EA 1K0XA 1BU1A 2AK5A 2ABLA 2RQTA 1ARKA 1AWJA 2M51A 3UA7A 1SSHA 2L2PA 2JM9A 4AFUC 4HVUA 2EPDA 1GBQA 2KBTA 1WFWA 2L0AA 3M0SA 4GLMA 1UECA 2J6OA 3H0HA 1GL5A 2DNUA 1PKSA 2RN8A 2SRCA 2M0YA 3VS6A 2ED1A 2MCNA 4F14A 4CC7A 1A0NB 4J9BA 3ZL7C 3IQLA 2DJQA 4OMOA 1I0CA 2YUPA 2JS2A 2CREA 2XMFA 2KE9A 2NWMA 2BZYA 2OAWA 5FWBA 2ED0A 1UTIA 1E6HA 3VRYA 2V1QA 2EBPA 4JZ4A 2G6FX 2DL7A 2K7AA 3JV3A 2K2MA 3NMZC 2CSIA 1YP5A 1I1JA 1YWPA 3TVTA 1IO6A 2ECZA 5IXBA 1JQQA 1VYUA 4QT7A 2ROTA 2CT3A 4J9DA 2DL5A 2RQVA 4JJBA 1VYTA 1Y57A 2EKHA 2HSPA 1SRLA 1S1NA 3H41A 2GGRA 1ZBJA 3I35A 1T3LA 1M8MA 4D8DA 4RTZA 1NEBA 1T0HA 1MUZA 1N5ZA 2YUQA 2A08A 1UE9A 4Z88A 2RF0A 3A98A 1UDLA 2X3XD 4RTXA 3LH5A 2DL3A 1EFNA 2KYMA 1K1ZA 1QLYA 2VWFA 1FMKA 2RQUA 1X6GA 2D8HA 4DEYA 4AFSC 3EGUA 3EHRA 1JO8A 1SPKA 2HDAA 4J9GA 4X1VA 2YDLA 1QWEA 2JTEA 4M4ZA 1X43A 2FRWA 4JPBW 4J9IA 2DILA 2JMCA 2EQIA 2KT1A 4WCIA 3VS1A 1ZX6A 2SEMA 4J9HA 1ABQA 4HVVA 2F2VA 1Z9QA 1GFCA 1CKAA 1UJYA 3GBQA 2X3WD 3NHNA 1E7OA 4JJDA 2DA9A 1NYGA 2EYXA 1WIEA 2KR3A 3VS2A 1X6BA 2ROLA 2L3QA 2F2XA 4OMQA 5FW9A 2BTTA 1TUCA 2C0OA 2YT6A 2KXDA 4AFZC 4J9FA 2LJ3A 4AG2C 1MV0B 2A37A 2FPDA 1JU5C 2A28A 2BZXA 5ECAA 1ZUKA 3VS0A 1UJ0A 4CC3A 3R6NA 4KRTA 2FPFA 2J6FA 2KRMA 4EIKA 1YWOA 2KYBA 1ZUUA 2LJ1A 4ORZA 5GJVB 2AZVA 1FYNA 2NUZA 2CUBA 4K11A 1B07A 1ZSGA 2E5KA 2W0ZA 2IIMA 1GRIA 2A36A 2YUNA 1NG2A 1W1FA 2LNHB 2J7IA 2FPEA 1PWTA 1UG1A 4JZ3A 3M0PA 1KIKA 5HCKA 2J6KA 4OMMA 2LCSA 2JT4A 2EGCA 4DEXA 1GCQA 4GBQA 3REBB 1AVZC 2RNAA 5FWCA 2EGEA 3TSWA 1H8KA 4HXJA 2PTKA 3RBBB 5IHIA 1M30A 3ULRB 4D8KA 3VS3A 1JEGA 1ZUYA 1VYVA 2DE0X 3PVQA 4ESRA 2C0TA 3EG1A 1NLPC 1SRMA 1V1CA 1X2KA 1WX6A 4LN2A 4HCKA 1T0JA 3M0UA 2BZ8A 2O31A 2FO0A 4IIOA 1PKTA 2JW4A 2YUOA 1VA7A 2CH4A 2LJ0A 4LUDA 1OV3A 2AKKA 1WXUA 1YNZA 2L3PA 1U06A 5I22A 2O9SA 3UA6A 3VS5A 1G83A 2D0NA 2DF6A 2K79A 3EG2A 1X27A 3I5RA 4IIMA 1BK2A 2MOXA 3REAB 1LCKA 3M0QA 4LNPA 2OI3A 3I9QA 1Z9ZA 2DVJA 3NPFA 4RTWA 1AZEA 1E6GA 2VVKA 2KNBB 4LUEA 1YN8A 1KJWA 2I0NA 1K76A 1OEBA 2MIOA 1UHCA 3VS4A 1JXMA 1PNJA 2DLPA 2O9VA 2CT4A 1J3TA 1I07A 1RLPC 1M27C 2KT8A 1RUWA 1U3OA 2D8JA 4CC4B 3TSZA 2O88A 2EVRA 3CQTA 2ESWA 2DYBA 2GBQA 2JMAA 3QWXX 4A63B 2V1RA 2LX7A 1AZGB 2DL8A 2VKNA 4RTYA 2YSQA 2K3BA 1UGVA 1T3SA 1QKWA 4ZNXA 1AEYA 2HBWA 2PZ1A 4OMNA 4RUGA 2D1XA 1PRLC 1TG0A 1OOTA 4F17A 1X2QA 2JXBA 2ENMA 2J05A 4Z8AA 2F2WA 1M3AA 2FEIA 3EG3A 1QKXA 3PVLA 3C0CA 1WXTA 2LQNA 1UUEA 2H8HA 2FRYA 1WDXA 3M0RA 2DM1A 1SEMA 2RQRA 1UHFA 1WLPB 4RTVA 4Z89A 5IH2A 2CSQA 1AD5A 1SHFA 2K6DA 2PNIA 3SHWA 1RLQC 3H0IA 1WXBA 3QWYA 1WI7A 2FG0A 4AFQC 3KFVA 1QCFA 1B3QA 2DBMA 4E6RA 5EC7A 1SHGA 1YCSB 2KRSA 5GJWB 2C0IA
chains in the Genus database with same CATH superfamily
1K9MR 2RK2A 2GNCA 2DRMA 3JCMc 2EJGA 3RKWA 2CP0A 2HCKA 4MZTA 4OMPA 2DL4A 1N27A 1NE8A 2LMJA 4RTUA 2F1LA 1VQ9A 1FX7A 3NGPA 4CRIA 1RL2A 2EFIA 1ZHIA 1NLOC 3V8LA 3CCLT 1D3BB 3O8VA 4A54A 2VGNA 2KROA 1U5SA 4JLIA 1W6XA 4C8QF 4M78G 4E7SA 3HRTA 4LE9A 3CPWS 2QASA 1K9MU 3JCMQ 1OZ3A 1PHTA 1M90R 1TUDA 2EYYA 1K4US 3OYBA 2O2OA 2FHDA 4HVWA 3CCUQ 3LLRA 3QG1A 1LJOA 1MGQA 2AKLA 4BI4A 3QXEB 3VS7A 1YBYA 3ZFJA 1VQPT 4XTZA 4A4FA 4BDZA 3X24B 1QMCA 4IUPA 3M59A 2MF2A 2L3SA 1CSKA 2CP7A 4C0ZA 3OY9A 3CCLA 1K8AR 3QSUA 2RQWA 1OPLA 1WYXA 3EGDB 1XTDA 3A8GB 3UPUA 3V7CA 1M90C 3CMAT 1WPYA 3JB9D 3FB9A 2Y90A 4ZTFA 1RADB 2E6ZA 2XU8A 3QPHA 7AT1B 5GAN8 1OPKA 4AG1C 1G8XA 1WGSA 1AWWA 3CCLQ 2AZSA 1M8VA 1WQ7A 3OMGA 5IT9E 1KQSS 3RDVA 2K5LA 4EPCA 1D0XA 2DPPB 3A8LB 3G71T 2AK5A 1LVKA 4C5EA 3DB3A 3HPWA 3V7SA 3MO8A 1B34A 4ZGDB 1SSHA 1M1GA 3L2RA 2JM9A 2COWA 4HVUA 4AFUC 3OYLA 3BW1A 2EPDA 2DTHA 2KBTA 1KC8R 4PFOA 4M7DB 4XTVA 1YIJA 2PQWA 4KGZB 1GL5A 1HYOA 3PGGA 2SRCA 1Y71A 3GNFB 4JRPA 2HMAA 4J8OA 4E7LA 3P8BB 4CC7A 4FW2A 3CMEA 3ZL7C 4ATOA 2DJQA 2JOYA 1Q86U 4XAXB 2JS2A 1Y7XA 2OAWA 4J6YA 5GAMh 4N4HA 1E6HA 1N9RA 1MNEA 2NUPA 1Q82R 4R56A 3CD6A 2LT4A 2G6FX 3VUZA 2OTLQ 2K7AA 3CC4T 2K2MA 2HQEA 1PD1A 2CSIA 5D7UA 1I1JA 3CBMA 1TS9A 5IXBA 3G6EA 5CKDA 2NUTA 1JQQA 1ACMB 4J9DA 2RQVA 3G71Q 1SRLA 1S1NA 1W2BP 3MEVA 3I35A 2NYSA 1T3LA 4C0GA 1YJNT 1NEBA 1G3WA 2YUQA 2A08A 4PFPA 2RF0A 3A98A 4M7AF 2VV5A 3CMEQ 1D09B 1FMVA 2RA2A 4ANJA 4OB0B 3EGXA 5KYXA 1QLYA 4JJNK 3JSCA 1R0CB 5KH6A 4GLKA 4DEYA 5AT1B 3EGUA 2WACA 2FZGB 1IZ6A 9ATCB 4M4ZA 1X43A 4N4IA 2KT1A 2CZ7B 3DLLA 4FW1A 1MMNA 3CCMA 1M90U 1KQ1A 1CKAA 3P8HA 1NJIU 2X3WD 2DERA 3HFNA 2EYXA 1NYGA 4KH0B 3FLGA 2BE7D 1WIEA 4XTYA 4KBMB 3C94A 3VS2A 1X6BA 1Y96A 2ROLA 1ZSZC 5AYFA 5FU6B 5FW9A 3URGA 3JCMg 3PIPA 1MV0B 5LJ5h 2A37A 2FPDA 4RCBA 3I56A 3TU4K 1ZUKA 1UJ0A 3KUFA 1YJWA 4EIKA 2E12A 2LJ1A 4PJOG 3H8ZA 2DD5A 5C0MA 5GJVB 3EFSA 2EQJA 2PU9B 3S3OA 2W0ZA 3JB9I 2E3IA 4M78C 1JRIA 3CCMT 1NG2A 2LNHB 2FPEA 1PWTA 4PFZA 4DQ2A 2YWWA 2NLUA 2P0QA 2EGCA 4M7AD 4IUVA 3REBB 4GBQA 3UDCA 4X9CA 1U1SA 4QQDA 3TSWA 2PTKA 4EDUA 4GY5A 3JCMX 3QYHB 1JEGA 1VYVA 3QZ9B 2QGGA 3PVQA 3VKIA 4ESRA 3RESA 1V1CA 1SRMA 1X2KA 4LDYA 4XTUA 1WX6A 1I8FA 1YITA 4IKFA 2R5MA 4IIOA 3G7ZA 1VA7A 2LJ0A 4ZN1A 5FRMA 2AKKA 5GAMj 3RMSA 5FLXE 1MNDA 5KYUA 2H3EB 2R5AA 3UA6A 3CCQT 1G83A 5GAN4 3HTRA 1WHJA 2K79A 3EG2A 1R0BG 4Z02A 3TQ7P 1QVGA 2FZKB 1UGQB 2V8IA 1LCKA 3X25B 3I9QA 1AZEA 4RTWA 2RHUA 4N4GA 2KNBB 3LW5E 1M1KR 2X35A 3A1PA 4LUEA 1YN8A 5KE3A 5L8RE 5LJ3j 2M16A 3L2VA 2I0NA 1K76A 4M75D 2ZPEB 1OU9A 3VS4A 2OTLA 4UC4A 1PNJA 2DLPA 4J6XA 2CT4A 1Q7YR 2A0FB 2A7YA 1OQKA 3NTIA 2QI2A 3OS0A 1N8RR 2RM4A 2D8JA 2JVVA 2KI7A 3PFSA 2O88A 4HT8A 1KD1C 2EVRA 1TH7A 3CQTA 2ESWA 2DYBA 3CCQA 1QQJA 2X4WA 3QKJA 1D1CA 2XDPA 3LYIA 1UGRB 2LX7A 4LXCA 2VKNA 1BKBA 2HD0A 4M78B 4FYVB 5J26A 4XK8E 3QUIA 1T3SA 5CKBA 4ZNXA 4XU3A 1AEYA 4M7DC 3OYNA 4KT0E 3JCMW 5I21A 1PRLC 2RHXA 2E5QA 2OTLT 4HCZA 2DKGA 2MK5A 4Z8AA 3L42A 4C8QG 1M3AA 4M7AB 1MMDA 5LJ5j 5LJ5d 1W2BA 2XK0A 1UUEA 3PIOA 5GAOp 2JJ9A 1WDXA 3M55A 3DB4A 5GANe 1N8RC 4OVAA 5IH2A 5GMKj 3SHWA 1RLQC 1WXBA 2A3LA 3CCSA 1YJ9T 3PNWC 3CMET 1QCFA 2BIVA 2HBPA 3SWNA 4E6RA 4KUDK 1Y07A 2K5IA 1M2VB 4NS5A 2PVGB 3V8JA 2XD0A 4M7DA 3QIIA 1VQ6T 2Y4XA 4C92E 4F7UG 1WA7A 1NBEB 3JCMh 4TVRA 4A4GA 3CC4A 2RMOA 2EGAA 1Y0MA 2MAMA 1AOJA 4J9CA 2GTOA 1PM3A 3CCVT 4PLLA 1N9SA 5GAMg 2HZYA 4FT4A 2Z0WA 2XIDA 4M7AC 1BIAA 2RI3A 1TTHB 1EIFA 3I55A 4LDXA 1RACB 2EW3A 3KXTA 2OJ2A 4DOVA 3BY7A 2W10A 2DBKA 1MV3A 2YRCA 1PSEA 4R0KA 3P8DA 4F16A 3OYHA 3OYYA 4BB7A 1QVPA 2EQUA 1HSQA 1JXOA 2VASA 5FRNA 1R77A 4LDWA 4BY6C 4ZTJA 3SWNC 4O5VA 3V8KA 1ABOA 2CP5A 3MEWA 3MP6A 3UATA 1KK7A 1HXDA 2B8AA 1G3YA 5CKHA 3JCMP 2VUBA 2DMOA 5KYYB 2IVWA 5GAMd 2L89A 4M77G 4XU2A 3E19A 2LC4A 1K9AA 4IUQA 2LP5A 3EHQA 2GFAA 2LDMA 2CZ0B 3O5ZA 4M7AG 1UFFA 1AWXA 1H92A 1NJIR 2DETA 1BCMA 1GBRA 2CUDA 1VQOQ 5I2SA 3M0TA 1NJIC 3EFOA 2QEXA 2E4HA 2QDLA 3CPWP 2QYZA 4L6V5 1F1BB 1YJWT 3SDZA 2AHJB 3D7SB 4OF1A 2RB6A 1R8OB 3M5AA 2FVUA 2HQXA 5GAOq 1RABB 4NL3A 4J9EA 4BE2A 1Q86C 1BU1A 2C06A 2XDBA 1K0XA 1BIBA 4M7DD 1M2OA 2VYTA 3SD4A 3OSSC 2ABLA 5A0LA 2E70A 1ARKA 5CCAA 3CCEA 1OYXA 2DYIA 1GBQA 1UEBA 2L0AA 1D0ZA 4M75B 3M0SA 4GLMA 1UECA 3EGXB 4OMFB 5KYXB 5KYWA 2KSSA 2RN8A 5J3BA 4B9XA 4EMKB 1VQMQ 4PJOF 2MCNA 4F14A 1QVFA 5CR2A 4BD3A 1YJNA 3IQLA 5HK3A 1TWBA 4OMOA 2YUPA 5GAN5 2CREA 2XMFA 2KE9A 4ME7A 4FCYA 2NWMA 4C8QA 2BZYA 2V8JA 2QAZA 2KK4A 2F69A 4BDYA 1VQOT 1YI2A 4E7JA 3META 4PJOE 2EBPA 4JZ4A 2AIRB 3CCET 3NMZC 4DA4A 1YP5A 2FB7A 1YWPA 3TVTA 2QQSA 1O9SA 4M7AE 3OYGA 2CT3A 2DL5A 5FU7B 3MPUB 1VYTA 3H41A 2DEUA 3H9NA 1XJWB 3M56A 4J7IA 4C5HA 5LJ3f 5J39A 2O4XA 1SG5A 1PCXA 2DAQA 3WVEB 2X3XD 4RTXA 3MCAB 5LJ3e 3QO3A 2KAFA 1EFNA 2KYMA 4M75F 4E47A 2CKKA 2VWFA 4C0DC 5GANd 2ZAEA 4KH1B 1X6GA 3PMTA 1V29B 4HCCA 3EHRA 4E7ZA 4M78A 4KGVB 1N8RU 3C12A 1RAFB 4X1VA 1UGSB 2YDLA 5KYNA 1GXIE 5KCOA 4J9IA 3UT1A 4WCIA 3M58A 3VS1A 1I5OB 1ZX6A 2SEMA 4J9HA 4QQGA 2LQ8A 1OZ2A 3OQ5A 2F2VA 1UJYA 2HKQB 3GIBA 3GBQA 5A0GA 4QVDA 1WHGA 3UWNA 4J7FA 2QGFB 3JCMb 4MZPA 3TEEA 2BTTA 2C0OA 3GLXA 2LTOA 4AG2C 3OA6A 1OI1A 5LJ5f 4BI8B 3LH0A 5ECAA 2A28A 3GPLA 3E2UA 4IUTA 5FROA 4QKUA 1IRXA 1QW1A 5KYWB 2YLBA 3T9NA 1G3SA 1YITT 4ORZA 2AZVA 1FYNA 4C8QD 4K11A 4JS5A 1BI2A 1PC0A 3CCST 1YJ9A 3A5ZB 5KCHA 3R6OA 5GAOn 2K2VA 2LCSA 5LJ5e 3OS1A 2M0OA 4QQ6A 1TSFA 2QDYB 4DEXA 1K9MC 2E64A 1AVZC 2CYZB 1KQSA 3OYEA 4EMKA 3OB9A 3MKDA 8AT1B 4D8KA 2GQVA 4EMKC 2C0TA 1FMWA 1NLPC 1SSFA 3CCVA 2RI5A 1H3ZA 1T0JA 2WSEE 2O31A 2FO0A 1PKTA 5LJ3d 3FRNA 2QEXQ 2CH4A 4M77D 4LUDA 1WXUA 3HP9A 1U06A 2DTOA 1VQ8Q 2XKOC 1Q7YC 3CXCS 2DF6A 2V26A 4E7IA 4Y91A 2MPXC 3M0QA 2VC8A 2VXFA 3EH1A 1Z9ZA 1E6GA 2CS7A 1M4ZA 4KGXB 1BI0A 3CC7T 2OAUA 3CCJA 1OEBA 1VQ5A 1SKUB 1UHCA 2ZPBB 1D1AA 2LCLA 1KQ2A 3OYFA 1RLPC 4PJNA 4C0DB 3CC2Q 4CC4B 2K3XA 3RERA 2PVOB 1I81A 2GBQA 2M9UA 5CQXA 5LL6S 4RG8A 1AZGB 4QVZA 1M1KC 3EH2A 1LOJA 2K57A 2YRDA 1K73U 2K3BA 2AT1B 2QEXT 1HK9A 2F5TX 4Q5WA 1KC8U 2PZ1A 3LGFA 2HSEB 5DY9A 3JB9G 4OMNA 2KQWA 2PUOB 2QQAA 1VQ5T 1VQ6A 4F17A 3JB9J 1X2QA 2XHCA 1TOVA 2F2WA 2EYQA 2ZPIB 3CPFA 4RKUE 5GAOr 2LQNA 4P5NA 3C95A 4A4HA 3CC7Q 5KYUB 1VQ4Q 3Q1JA 2DM1A 2RQRA 4L59A 1WQWA 3OYJA 2K6DA 1SHFA 2DFUA 1TXQA 2FG0A 3GP8A 4Y28E 1M1FA 1B3QA 2ZPGB 5GMKh 3CC2T 5CQYA 1IGQA 4OB1B 1SHGA 3E9FA 2KRSA 2JUFA 5GJWB 3FC3A 4FU6A 1RI0A 1M9SA 2K9GA 2CP6A 1FXXA 3H0FA 2E6NA 3FJ5A 5CIUA 1W70A 3OYKA 2EYZA 2DRKA 4OMLA 1XQHA 1WZOA 3OS5A 4CC2A 4E7HA 1QVGS 2GQIA 3G6ET 1Q82U 1B7TA 1VQ5Q 3OW2S 3BDLA 2GTJA 1KD1U 4V2SA 3SFMA 1K0SA 5IHNA 2E41A 2X4YA 3PE0A 2CZ6B 1M3BA 4JJCA 1H641 1PSFA 5IN1A 3LWIA 1NYFA 3RNJA 2R57A 4DBRA 4C8QC 2KEAA 1OX9A 3CCUT 2DD4A 2RJEA 2DX1A 1VQ4T 3OS2A 3RMQA 2EYWA 4RG2A 1VQ8A 2LNVA 3CBOA 1NEGA 1WHKA 3DLMA 3AT1B 4PJJA 3X28B 2G3RA 2KGTA 2HEQA 3C4SA 1VQNQ 1VQKA 2P4RA 1OULA 3U23A 3THKA 2RPNA 3VYGA 2JM8A 5M9OA 3OMCA 4JRQA 1M3CA 2CGHA 2DTIA 3DKMA 5GANh 2QXFA 1KFZA 2KRNA 5CKEA 5IXFA 1G3TA 1YHQT 1QP2A 1QWFA 1HJDA 2JN0A 5L23A 3MEUA 2EJFA 2YLCA 3M4YA 3MP8A 3X26B 3CMAQ 1X75C 1LPLA 1HD3A 1D3BA 1KSWA 3TCJA 4FSSA 1RAIB 5CVIA 4M75G 1VQOA 1AWJA 3UA7A 2L2PA 1IHVA 1QVFP 1WFWA 3G1JA 2EAYA 3CEYA 2MI6A 1YHQA 2J6OA 1VQNT 2EKOA 2DXBA 5KE2A 3FEOA 2M0YA 3VS6A 3CCRQ 4XTWA 1MMGA 3CCRA 4EMGA 2QQBA 4EMHA 1A0NB 4J9BA 3QBYA 4C92G 4F7UE 3L2UA 1D1BA 3GNGA 2LRQA 3JRZA 3VRYA 1BCOA 3L2QA 2V1QA 3INZA 5GAOl 4ELZC 2DIGA 2DL7A 3MP1A 2RHZA 3M54A 1PD0A 2I2LA 3RIRA 2DZ9A 2FYKA 4DBFA 2ECZA 1VYUA 3QDFA 4QT7A 1Q95G 2ROTA 1G5VA 4MZMA 1K73C 1Y57A 2EKHA 2HSPA 4B6MA 4M77A 5A2QE 1ZBJA 4PK4A 4BI3A 4D8DA 4KUIA 1PG5B 3MHXA 3JCMe 1T0HA 3S3MA 1MUZA 1N5ZA 2CP2A 1Q86R 1UE9A 4Z88A 3BDUA 4WTOB 2BE9B 2X4JA 2GF7A 3GF5A 2RHIA 1YJNQ 4PNOA 1JB0E 4JLGA 1FMKA 3HHTB 1VQPQ 1JO8A 1SPKA 2HDAA 4J9GA 1QWEA 2JTEA 2H3JA 3AHUA 2JMCA 2XG8D 4HVVA 4PLIA 1K8AC 3ZBDA 1JBMA 1VQLQ 1E7OA 5DLQE 2DA9A 4OGCA 5DLOA 1TU0B 4PJOC 2E3HA 3CMAA 2L3QA 3NTKA 4OMQA 4C5IA 1WHMA 5GAN6 4AFZC 1KD1R 3X20B 2NUTB 4HT9A 3QYGB 1ZSZA 1JU5C 2DO3A 2ZCFB 4CC3A 1RAGB 1Q82C 3R6NA 4KRTA 2KRMA 2KYBA 1ZUUA 3E1SA 3J7AF 2KY9A 4C8QE 1RAAB 1I5LA 4E7KA 4OGEA 1B07A 1ZSGA 2E5KA 2MWOA 1K8AU 3RKYA 3CXCP 5LJ3h 2A36A 1W1FA 3JCMJ 4A4KA 1UG1A 3NFCA 4JZ3A 5GAN7 3LGLA 4HA8A 1KHCA 5HCKA 2CZ1B 2J6KA 4OMMA 1UGPB 3JCMf 2JT4A 5DM7R 1GCQA 2OTJT 2RNAA 4FSXA 2RJDA 1YIJT 5FWCA 1H8KA 4M7DE 4HXJA 4YTLA 2ZPFB 5IHIA 3ULRB 3VS3A 2MWPA 4DBHA 1KHIA 1ZUYA 1P92A 2DE0X 4B9WA 5HK0A 1VQLT 3CC7A 3EFRA 3OYDA 1C1AA 2XI9A 4AMCA 4QW2A 3CCVQ 2BZ8A 1RAEB 3PT9A 3CCQQ 4M7AA 5GMKi 1UB4A 1OV3A 3CD6T 2M1HA 1MHNA 2JTMA 3EG9B 2X9HA 5I22A 2O9SA 2COZA 3VS5A 1ZBXA 2RJFA 2OTJA 1X27A 1VQ4A 4IIMA 5GMKe 3CBPA 1O75A 1BK2A 2LX9A 2MOXA 4RMOA 1DJ7B 3OBYA 1YCYA 4R55A 2OI3A 2QQRA 4M78D 3NPFA 2DVEA 1IXDA 4OB3B 1VQLA 3J81E 2QG9B 2IPOB 2OTJQ 1KQSP 3J80E 2M02A 2MMPA 4J5YA 1J3TA 1JJ2S 2DXUA 2KT8A 5GANg 2WSCE 1U3OA 3TSZA 4MDXA 2HL3A 3HRSA 1BI3A 2JMAA 4L5GA 2YRVA 3QWXX 2EIFA 4A63B 2V1RA 4JUVA 2DL8A 4RTYA 4XTXA 3WXMB 4FM4B 4XU1A 3SB2A 3CD6Q 1QKWA 2XDDA 2R58A 1WJQA 3CC2A 3S3NA 2GCXA 1YJWQ 2DJZA 3JB9H 1KG1A 3MJXA 3OYAA 3CCJQ 1ZSZB 3RKXA 3L1AA 2FEIA 3I56T 1YFNA 5GAMe 1QKXA 4E2FB 4XQ3A 2BUDA 3LX7A 1ZQ1A 1JJ2A 1IB8A 2H8HA 1X6OA 1OX8A 2FRYA 3M0RA 1SEMA 4M7DF 1RAHB 1EZZB 2DZCA 5GAOm 4Z89A 2HNIA 3CCMQ 3JCMd 2QQ9A 2PUKB 1AD5A 2PNIA 1U8RA 1Q7YU 1VQMT 4FYXB 1VQ6Q 3QWYA 1TUGB 1WI7A 3VYHB 3KBGA 4AFQC 5KYYA 5GAN2 1S72A 1QVGP 3E9GA 3QJYA 5EC7A 3L2ZA 4FIBA 2DK3A 4LD6A 3PMIA 4RTTA 1BB9A 1KC8C 2QA4A 3M57A 2CH4W 3A8HB 4FYWB 1Q81C 5HY6A 2RD1A 1VQ7T 5D6XA 2P0PA 2K3YA 4Y92A 4JS4A 2J06A 1GCQC 5GAMf 4F7UA 1PRMC 3UF4A 1H3HA 1VUBA 3SEMA 2CDTA 5EG2A 1XOVA 1GCPA 4DOWA 2COYA 3FJPA 1ZLMA 1X69A 2ZGWA 2EJ9A 2JNGA 4M77B 3HRUA 1CKBA 1NM7A 3OYMA 2X4XA 2B86A 4PKCC 1LNXA 3RR6A 4FYYB 2MYSA 1D0YA 2HAXA 3VJPA 8ATCB 1G2BA 1BBZA 1VQ7A 2EQKA 2KXCA 3VRZA 1VQ9T 3EG0A 4M75C 4PJOD 2RK1A 3VV0A 5GANj 3F70A 5I11A 3V7RA 5I2MA 1ZA1B 1YIJQ 1QCNA 3L2WA 3I5SA 1BI1A 4KULA 4M77F 2RH2A 3OW2P 2F5KA 2LVMA 3QJ6A 3GOXA 4JRIA 3HKSA 1RI9A 2EWNA 3M53A 1AWOA 2LZ6B 2E10A 3PTAA 2RJCA 4PL6A 2OX7A 4BE1A 2X51A 3G4SQ 1QCOA 1GFDA 5IHKA 3OYCA 1VQPA 2JS0A 2LQWA 5GAN3 1Q81U 1V76A 2XICA 2LCCA 2RQTA 4M78E 3WVDB 3H6ZA 2M51A 2L8DA 5CO7A 4C92F 3QZ5B 1MMAA 2FL7A 4F7UB 3EGDA 3H0HA 4C92B 2DNUA 1PKSA 4N0AC 3VU3C 4HCBA 2P0KA 4BE0A 1YJ9Q 2ED1A 4F7UF 2DXTA 1ZA2B 4C0FA 2D0QB 4N0AA 3QHSA 4PJOB 4M78F 4WF2A 1I0CA 5FU6C 3CCEQ 1U1TA 5HKCA 5FWBA 2ED0A 1UTIA 1I4K1 2V8KA 3SWNB 5GANf 2D6FA 1K73R 2D9TA 4A53A 3JV3A 1M2VA 2RI2A 4ZGEB 2KVQG 3G4ST 2BKDN 4LDVA 2QA4Q 3EG9A 4MDWA 1IO6A 2QTXA 4JJBA 3HFOA 4HKEA 5A0DA 3I55T 1X01A 2VB6A 4DBQA 2GGRA 4M77E 1XNIA 2YXYA 4AT1B 1M8MA 4RTZA 2IG0A 4NOYA 4IUUA 2HQHA 4LD9K 3CCJT 3EAEA 1UDLA 4BACA 2DIQA 2JZ2A 3I56Q 4PJLA 3LH5A 2DL3A 1K1ZA 4QVCA 4BUGA 4X34A 1N6AA 2RQUA 1M5Q1 2D8HA 4AFSC 2LT1A 3G4SA 2CP3A 3HL8A 2K5FA 2HL5C 1AT1B 4JPBW 2FRWA 1NPPA 4IURA 4PJMA 3ZEHA 2DILA 2EQIA 4M75A 5FU7C 2VXEA 1C6VX 4FL6A 1C0MA 1ABQA 4O6JA 5C6SA 1Z9QA 4MMLA 1GFCA 2NUPB 3NHNA 2YHTA 2KDSA 4JJDA 1QVFS 4JRKA 4FT2A 2KR3A 2DXCA 4LDUA 4C92A 2F2XA 5GMKm 3TREA 2L5QA 1EX4A 1NZ9A 1TUCA 2YT6A 2KXDA 4J9FA 1WNLA 2LJ3A 4F04B 1VQ7Q 4M7DG 3I55Q 3VS0A 2BZXA 5LJ3g 6AT1B 2FPFA 2J6FA 1YWOA 3MEAA 3FIFA 2O01E 1NPRA 2O4XB 2NUZA 3CPWA 2CUBA 4J6WA 2GFUA 2IIMA 3G71A 1GRIA 2YUNA 1VQMA 2FZCB 2J7IA 3M4GA 3M0PA 3QDRB 1KIKA 2VGMA 4VUBA 3OYIA 1VQKQ 5CAIA 2EGEA 2DEQA 4MMKA 2PVDB 1IGUA 3RBBB 1M30A 2KMTA 1W2BS 4PJOA 1QP3A 2ZPHB 1VQ9Q 4M77C 5D6WA 2HKNA 3OSVA 3EG1A 2P4TA 1M1KU 2WSFE 4LN2A 4HCKA 4OP0A 3M0UA 3OW2A 4C5GA 3G6EQ 4BY6B 1Y96B 2JW4A 2YUOA 3NTHA 1YI2T 1IHWA 1S72Q 4II1A 3FDRA 1YNZA 2QTVA 4M75E 2P84A 2L3PA 2E1HA 3JB9F 5D6YA 4X9DA 4C8QB 2D0NA 3CCUA 4CI0C 1VIFA 3ER0A 3I5RA 4OB2B 1OU8A 4ELYC 2ZZDA 5LJ5g 1VOMA 3REAB 1VQ8T 3S6WA 3ME9A 4LNPA 2DVJA 4ZN3A 2VVKA 3VUBA 1KJWA 2MIOA 4NL2A 1VQKT 2Y4YA 1WJSA 4C92D 1JXMA 3JAME 1AHJB 2O9VA 1FWZA 1IREB 1I07A 4D6WA 1M27C 2ATCB 3LWHA 5CKFA 1RUWA 5IAYA 1W4SA 1WHLA 3A8OB 3CC4Q 2JTFA 1BYMA 2RHYA 2E65A 1YHQQ 1VIEA 3A8MB 2YSQA 1UGVA 1YI2Q 1SF9A 3ASKA 1S72T 2HBWA 4ZGJB 4RUGA 2D1XA 3CXCA 4C92C 1TG0A 5CK9A 1OOTA 3M9QA 2L3RA 2JXBA 2RO0A 4XU0A 2ENMA 2J05A 4JDSA 1Q81R 4A4EA 2QA4T 1WHHA 3BFMA 3EG3A 1WJRA 3BE3A 4RCCA 3N5BB 3PVLA 3C0CA 3JCMV 1WXTA 1YITQ 1JJ2P 3OBWA 1UHFA 1WLPB 1VQNA 4RTVA 2CSQA 5GMKl 3CCSQ 2EQMA 3RUXA 3H0IA 2QK0A 3CCRT 3KFVA 3HSBA 4J83A 3EFOB 1B34B 2DBMA 2K4YA 1YCSB 2LQKA 2C0IA
chains in the Genus database with same CATH topology
4RTTA 2GNCA 2K9GA 2DRMA 1BB9A 3H0FA 3FJ5A 1W70A 1WA7A 2CH4W 2EYZA 2DRKA 2HCKA 4OMLA 2RMOA 2EGAA 1Y0MA 4OMPA 1AOJA 4J9CA 2DL4A 4CC2A 2GTOA 2LMJA 4RTUA 2GQIA 4Y92A 3NGPA 2J06A 1GCQC 1PRMC 3UF4A 1H3HA 2GTJA 3SEMA 2CDTA 1XOVA 1NLOC 1GCPA 2EW3A 1K0SA 5IHNA 1ZLMA 2OJ2A 1X69A 3PE0A 2KROA 1M3BA 4JJCA 1U5SA 2W10A 1NYFA 2DBKA 3RNJA 1W6XA 1MV3A 4R0KA 4F16A 4LE9A 2KEAA 1CKBA 1NM7A 2DX1A 1HSQA 1JXOA 2B86A 1PHTA 2EYWA 1TUDA 2EYYA 1K4US 2O2OA 1NEGA 1ABOA 4HVWA 3UATA 1G2BA 1BBZA 2AKLA 2KGTA 3VS7A 2HEQA 2DMOA 2KXCA 3VRZA 2P4RA 3U23A 3EG0A 3THKA 2RPNA 2L3SA 1K9AA 1CSKA 2LP5A 3EHQA 2JM8A 5I11A 3O5ZA 1M3CA 2RQWA 1UFFA 1OPLA 1AWXA 1H92A 1WYXA 3I5SA 1KFZA 2KRNA 5IXFA 1GBRA 2CUDA 1QWFA 1HJDA 1RI9A 3M0TA 5L23A 1AWOA 1OPKA 2LZ6B 4AG1C 1AWWA 2QDLA 2AZSA 1HD3A 1GFDA 5IHKA 1KSWA 4FSSA 2JS0A 2LQWA 4J9EA 1K0XA 1BU1A 2AK5A 2ABLA 2RQTA 1ARKA 1AWJA 2M51A 3UA7A 1SSHA 2L2PA 2JM9A 4AFUC 4HVUA 2EPDA 1GBQA 2KBTA 1WFWA 2L0AA 3M0SA 4GLMA 1UECA 2J6OA 3H0HA 1GL5A 2DNUA 1PKSA 2RN8A 2SRCA 2M0YA 3VS6A 2ED1A 2MCNA 4F14A 4CC7A 1A0NB 4J9BA 3ZL7C 3IQLA 2DJQA 4OMOA 1I0CA 2YUPA 2JS2A 2CREA 2XMFA 2KE9A 2NWMA 2BZYA 2OAWA 5FWBA 2ED0A 1UTIA 1E6HA 3VRYA 2V1QA 2EBPA 4JZ4A 2G6FX 2DL7A 2K7AA 3JV3A 2K2MA 3NMZC 2CSIA 1YP5A 1I1JA 1YWPA 3TVTA 1IO6A 2ECZA 5IXBA 1JQQA 1VYUA 4QT7A 2ROTA 2CT3A 4J9DA 2DL5A 2RQVA 4JJBA 1VYTA 1Y57A 2EKHA 2HSPA 1SRLA 1S1NA 3H41A 2GGRA 1ZBJA 3I35A 1T3LA 1M8MA 4D8DA 4RTZA 1NEBA 1T0HA 1MUZA 1N5ZA 2YUQA 2A08A 1UE9A 4Z88A 2RF0A 3A98A 1UDLA 2X3XD 4RTXA 3LH5A 2DL3A 1EFNA 2KYMA 1K1ZA 1QLYA 2VWFA 1FMKA 2RQUA 1X6GA 2D8HA 4DEYA 4AFSC 3EGUA 3EHRA 1JO8A 1SPKA 2HDAA 4J9GA 4X1VA 2YDLA 1QWEA 2JTEA 4M4ZA 1X43A 2FRWA 4JPBW 4J9IA 2DILA 2JMCA 2EQIA 2KT1A 4WCIA 3VS1A 1ZX6A 2SEMA 4J9HA 1ABQA 4HVVA 2F2VA 1Z9QA 1GFCA 1CKAA 1UJYA 3GBQA 2X3WD 3NHNA 1E7OA 4JJDA 2DA9A 1NYGA 2EYXA 1WIEA 2KR3A 3VS2A 1X6BA 2ROLA 2L3QA 2F2XA 4OMQA 5FW9A 2BTTA 1TUCA 2C0OA 2YT6A 2KXDA 4AFZC 4J9FA 2LJ3A 4AG2C 1MV0B 2A37A 2FPDA 1JU5C 2A28A 2BZXA 5ECAA 1ZUKA 3VS0A 1UJ0A 4CC3A 3R6NA 4KRTA 2FPFA 2J6FA 2KRMA 4EIKA 1YWOA 2KYBA 1ZUUA 2LJ1A 4ORZA 5GJVB 2AZVA 1FYNA 2NUZA 2CUBA 4K11A 1B07A 1ZSGA 2E5KA 2W0ZA 2IIMA 1GRIA 2A36A 2YUNA 1NG2A 1W1FA 2LNHB 2J7IA 2FPEA 1PWTA 1UG1A 4JZ3A 3M0PA 1KIKA 5HCKA 2J6KA 4OMMA 2LCSA 2JT4A 2EGCA 4DEXA 1GCQA 4GBQA 3REBB 1AVZC 2RNAA 5FWCA 2EGEA 3TSWA 1H8KA 4HXJA 2PTKA 3RBBB 5IHIA 1M30A 3ULRB 4D8KA 3VS3A 1JEGA 1ZUYA 1VYVA 2DE0X 3PVQA 4ESRA 2C0TA 3EG1A 1NLPC 1SRMA 1V1CA 1X2KA 1WX6A 4LN2A 4HCKA 1T0JA 3M0UA 2BZ8A 2O31A 2FO0A 4IIOA 1PKTA 2JW4A 2YUOA 1VA7A 2CH4A 2LJ0A 4LUDA 1OV3A 2AKKA 1WXUA 1YNZA 2L3PA 1U06A 5I22A 2O9SA 3UA6A 3VS5A 1G83A 2D0NA 2DF6A 2K79A 3EG2A 1X27A 3I5RA 4IIMA 1BK2A 2MOXA 3REAB 1LCKA 3M0QA 4LNPA 2OI3A 3I9QA 1Z9ZA 2DVJA 3NPFA 4RTWA 1AZEA 1E6GA 2VVKA 2KNBB 4LUEA 1YN8A 1KJWA 2I0NA 1K76A 1OEBA 2MIOA 1UHCA 3VS4A 1JXMA 1PNJA 2DLPA 2O9VA 2CT4A 1J3TA 1I07A 1RLPC 1M27C 2KT8A 1RUWA 1U3OA 2D8JA 4CC4B 3TSZA 2O88A 2EVRA 3CQTA 2ESWA 2DYBA 2GBQA 2JMAA 3QWXX 4A63B 2V1RA 2LX7A 1AZGB 2DL8A 2VKNA 4RTYA 2YSQA 2K3BA 1UGVA 1T3SA 1QKWA 4ZNXA 1AEYA 2HBWA 2PZ1A 4OMNA 4RUGA 2D1XA 1PRLC 1TG0A 1OOTA 4F17A 1X2QA 2JXBA 2ENMA 2J05A 4Z8AA 2F2WA 1M3AA 2FEIA 3EG3A 1QKXA 3PVLA 3C0CA 1WXTA 2LQNA 1UUEA 2H8HA 2FRYA 1WDXA 3M0RA 2DM1A 1SEMA 2RQRA 1UHFA 1WLPB 4RTVA 4Z89A 5IH2A 2CSQA 1AD5A 1SHFA 2K6DA 2PNIA 3SHWA 1RLQC 3H0IA 1WXBA 3QWYA 1WI7A 2FG0A 4AFQC 3KFVA 1QCFA 1B3QA 2DBMA 4E6RA 5EC7A 1SHGA 1YCSB 2KRSA 5GJWB 2C0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RTT A;  2GNC A;  2K9G A;  2DRM A;  1BB9 A;  3H0F A;  3FJ5 A;  1W70 A;  1WA7 A;  2CH4 W;  2EYZ A;  2DRK A;  2HCK A;  4OML A;  2RMO A;  2EGA A;  1Y0M A;  4OMP A;  1AOJ A;  4J9C A;  2DL4 A;  4CC2 A;  2GTO A;  2LMJ A;  4RTU A;  2GQI A;  4Y92 A;  3NGP A;  2J06 A;  1GCQ C;  1PRM C;  3UF4 A;  1H3H A;  2GTJ A;  3SEM A;  2CDT A;  1XOV A;  1NLO C;  1GCP A;  2EW3 A;  1K0S A;  5IHN A;  1ZLM A;  2OJ2 A;  1X69 A;  3PE0 A;  2KRO A;  1M3B A;  4JJC A;  1U5S A;  2W10 A;  1NYF A;  2DBK A;  3RNJ A;  1W6X A;  1MV3 A;  4R0K A;  4F16 A;  4LE9 A;  2KEA A;  1CKB A;  1NM7 A;  2DX1 A;  1HSQ A;  1JXO A;  2B86 A;  1PHT A;  2EYW A;  1TUD A;  2EYY A;  1K4U S;  2O2O A;  1NEG A;  1ABO A;  4HVW A;  3UAT A;  1G2B A;  1BBZ A;  2AKL A;  2KGT A;  3VS7 A;  2HEQ A;  2DMO A;  2KXC A;  3VRZ A;  2P4R A;  3U23 A;  3EG0 A;  3THK A;  2RPN A;  2L3S A;  1K9A A;  1CSK A;  2LP5 A;  3EHQ A;  2JM8 A;  5I11 A;  3O5Z A;  1M3C A;  2RQW A;  1UFF A;  1OPL A;  1AWX A;  1H92 A;  1WYX A;  3I5S A;  1KFZ A;  2KRN A;  5IXF A;  1GBR A;  2CUD A;  1QWF A;  1HJD A;  1RI9 A;  3M0T A;  5L23 A;  1AWO A;  1OPK A;  2LZ6 B;  4AG1 C;  1AWW A;  2QDL A;  2AZS A;  1HD3 A;  1GFD A;  5IHK A;  1KSW A;  4FSS A;  2JS0 A;  2LQW A;  4J9E A;  1K0X A;  1BU1 A;  2AK5 A;  2ABL A;  2RQT A;  1ARK A;  1AWJ A;  2M51 A;  3UA7 A;  1SSH A;  2L2P A;  2JM9 A;  4AFU C;  4HVU A;  2EPD A;  1GBQ A;  2KBT A;  1WFW A;  2L0A A;  3M0S A;  4GLM A;  1UEC A;  2J6O A;  3H0H A;  1GL5 A;  2DNU A;  1PKS A;  2RN8 A;  2SRC A;  2M0Y A;  3VS6 A;  2ED1 A;  2MCN A;  4F14 A;  4CC7 A;  1A0N B;  4J9B A;  3ZL7 C;  3IQL A;  2DJQ A;  4OMO A;  1I0C A;  2YUP A;  2JS2 A;  2CRE A;  2XMF A;  2KE9 A;  2NWM A;  2BZY A;  2OAW A;  5FWB A;  2ED0 A;  1UTI A;  1E6H A;  3VRY A;  2V1Q A;  2EBP A;  4JZ4 A;  2G6F X;  2DL7 A;  2K7A A;  3JV3 A;  2K2M A;  3NMZ C;  2CSI A;  1YP5 A;  1I1J A;  1YWP A;  3TVT A;  1IO6 A;  2ECZ A;  5IXB A;  1JQQ A;  1VYU A;  4QT7 A;  2ROT A;  2CT3 A;  4J9D A;  2DL5 A;  2RQV A;  4JJB A;  1VYT A;  1Y57 A;  2EKH A;  2HSP A;  1SRL A;  1S1N A;  3H41 A;  2GGR A;  1ZBJ A;  3I35 A;  1T3L A;  1M8M A;  4D8D A;  4RTZ A;  1NEB A;  1T0H A;  1MUZ A;  1N5Z A;  2YUQ A;  2A08 A;  1UE9 A;  4Z88 A;  2RF0 A;  3A98 A;  1UDL A;  2X3X D;  4RTX A;  3LH5 A;  2DL3 A;  1EFN A;  2KYM A;  1K1Z A;  1QLY A;  2VWF A;  1FMK A;  2RQU A;  1X6G A;  2D8H A;  4DEY A;  4AFS C;  3EGU A;  3EHR A;  1JO8 A;  1SPK A;  2HDA A;  4J9G A;  4X1V A;  2YDL A;  1QWE A;  2JTE A;  4M4Z A;  1X43 A;  2FRW A;  4JPB W;  4J9I A;  2DIL A;  2JMC A;  2EQI A;  2KT1 A;  4WCI A;  3VS1 A;  1ZX6 A;  2SEM A;  4J9H A;  1ABQ A;  4HVV A;  2F2V A;  1Z9Q A;  1GFC A;  1CKA A;  1UJY A;  3GBQ A;  2X3W D;  3NHN A;  1E7O A;  4JJD A;  2DA9 A;  1NYG A;  2EYX A;  1WIE A;  2KR3 A;  3VS2 A;  1X6B A;  2ROL A;  2L3Q A;  2F2X A;  4OMQ A;  5FW9 A;  2BTT A;  1TUC A;  2C0O A;  2YT6 A;  2KXD A;  4AFZ C;  4J9F A;  2LJ3 A;  4AG2 C;  1MV0 B;  2A37 A;  2FPD A;  1JU5 C;  2A28 A;  2BZX A;  5ECA A;  1ZUK A;  3VS0 A;  1UJ0 A;  4CC3 A;  3R6N A;  4KRT A;  2FPF A;  2J6F A;  2KRM A;  4EIK A;  1YWO A;  2KYB A;  1ZUU A;  2LJ1 A;  4ORZ A;  5GJV B;  2AZV A;  1FYN A;  2NUZ A;  2CUB A;  4K11 A;  1B07 A;  1ZSG A;  2E5K A;  2W0Z A;  2IIM A;  1GRI A;  2A36 A;  2YUN A;  1NG2 A;  1W1F A;  2LNH B;  2J7I A;  2FPE A;  1PWT A;  1UG1 A;  4JZ3 A;  3M0P A;  1KIK A;  5HCK A;  2J6K A;  4OMM A;  2LCS A;  2JT4 A;  2EGC A;  4DEX A;  1GCQ A;  4GBQ A;  3REB B;  1AVZ C;  2RNA A;  5FWC A;  2EGE A;  3TSW A;  1H8K A;  4HXJ A;  2PTK A;  3RBB B;  5IHI A;  1M30 A;  3ULR B;  4D8K A;  3VS3 A;  1JEG A;  1ZUY A;  1VYV A;  2DE0 X;  3PVQ A;  4ESR A;  2C0T A;  3EG1 A;  1NLP C;  1SRM A;  1V1C A;  1X2K A;  1WX6 A;  4LN2 A;  4HCK A;  1T0J A;  3M0U A;  2BZ8 A;  2O31 A;  2FO0 A;  4IIO A;  1PKT A;  2JW4 A;  2YUO A;  1VA7 A;  2CH4 A;  2LJ0 A;  4LUD A;  1OV3 A;  2AKK A;  1WXU A;  1YNZ A;  2L3P A;  1U06 A;  5I22 A;  2O9S A;  3UA6 A;  3VS5 A;  1G83 A;  2D0N A;  2DF6 A;  2K79 A;  3EG2 A;  1X27 A;  3I5R A;  4IIM A;  1BK2 A;  2MOX A;  3REA B;  1LCK A;  3M0Q A;  4LNP A;  2OI3 A;  3I9Q A;  1Z9Z A;  2DVJ A;  3NPF A;  4RTW A;  1AZE A;  1E6G A;  2VVK A;  2KNB B;  4LUE A;  1YN8 A;  1KJW A;  2I0N A;  1K76 A;  1OEB A;  2MIO A;  1UHC A;  3VS4 A;  1JXM A;  1PNJ A;  2DLP A;  2O9V A;  2CT4 A;  1J3T A;  1I07 A;  1RLP C;  1M27 C;  2KT8 A;  1RUW A;  1U3O A;  2D8J A;  4CC4 B;  3TSZ A;  2O88 A;  2EVR A;  3CQT A;  2ESW A;  2DYB A;  2GBQ A;  2JMA A;  3QWX X;  4A63 B;  2V1R A;  2LX7 A;  1AZG B;  2DL8 A;  2VKN A;  4RTY A;  2YSQ A;  2K3B A;  1UGV A;  1T3S A;  1QKW A;  4ZNX A;  1AEY A;  2HBW A;  2PZ1 A;  4OMN A;  4RUG A;  2D1X A;  1PRL C;  1TG0 A;  1OOT A;  4F17 A;  1X2Q A;  2JXB A;  2ENM A;  2J05 A;  4Z8A A;  2F2W A;  1M3A A;  2FEI A;  3EG3 A;  1QKX A;  3PVL A;  3C0C A;  1WXT A;  2LQN A;  1UUE A;  2H8H A;  2FRY A;  1WDX A;  3M0R A;  2DM1 A;  1SEM A;  2RQR A;  1UHF A;  1WLP B;  4RTV A;  4Z89 A;  5IH2 A;  2CSQ A;  1AD5 A;  1SHF A;  2K6D A;  2PNI A;  3SHW A;  1RLQ C;  3H0I A;  1WXB A;  3QWY A;  1WI7 A;  2FG0 A;  4AFQ C;  3KFV A;  1QCF A;  1B3Q A;  2DBM A;  4E6R A;  5EC7 A;  1SHG A;  1YCS B;  2KRS A;  5GJW B;  2C0I A; 
#chains in the Genus database with same CATH topology
 1K9M R;  2RK2 A;  2GNC A;  2DRM A;  3JCM c;  2EJG A;  3RKW A;  2CP0 A;  2HCK A;  4MZT A;  4OMP A;  2DL4 A;  1N27 A;  1NE8 A;  2LMJ A;  4RTU A;  2F1L A;  1VQ9 A;  1FX7 A;  3NGP A;  4CRI A;  1RL2 A;  2EFI A;  1ZHI A;  1NLO C;  3V8L A;  3CCL T;  1D3B B;  3O8V A;  4A54 A;  2VGN A;  2KRO A;  1U5S A;  4JLI A;  1W6X A;  4C8Q F;  4M78 G;  4E7S A;  3HRT A;  4LE9 A;  3CPW S;  2QAS A;  1K9M U;  3JCM Q;  1OZ3 A;  1PHT A;  1M90 R;  1TUD A;  2EYY A;  1K4U S;  3OYB A;  2O2O A;  2FHD A;  4HVW A;  3CCU Q;  3LLR A;  3QG1 A;  1LJO A;  1MGQ A;  2AKL A;  4BI4 A;  3QXE B;  3VS7 A;  1YBY A;  3ZFJ A;  1VQP T;  4XTZ A;  4A4F A;  4BDZ A;  3X24 B;  1QMC A;  4IUP A;  3M59 A;  2MF2 A;  2L3S A;  1CSK A;  2CP7 A;  4C0Z A;  3OY9 A;  3CCL A;  1K8A R;  3QSU A;  2RQW A;  1OPL A;  1WYX A;  3EGD B;  1XTD A;  3A8G B;  3UPU A;  3V7C A;  1M90 C;  3CMA T;  1WPY A;  3JB9 D;  3FB9 A;  2Y90 A;  4ZTF A;  1RAD B;  2E6Z A;  2XU8 A;  3QPH A;  7AT1 B;  5GAN 8;  1OPK A;  4AG1 C;  1G8X A;  1WGS A;  1AWW A;  3CCL Q;  2AZS A;  1M8V A;  1WQ7 A;  3OMG A;  5IT9 E;  1KQS S;  3RDV A;  2K5L A;  4EPC A;  1D0X A;  2DPP B;  3A8L B;  3G71 T;  2AK5 A;  1LVK A;  4C5E A;  3DB3 A;  3HPW A;  3V7S A;  3MO8 A;  1B34 A;  4ZGD B;  1SSH A;  1M1G A;  3L2R A;  2JM9 A;  2COW A;  4HVU A;  4AFU C;  3OYL A;  3BW1 A;  2EPD A;  2DTH A;  2KBT A;  1KC8 R;  4PFO A;  4M7D B;  4XTV A;  1YIJ A;  2PQW A;  4KGZ B;  1GL5 A;  1HYO A;  3PGG A;  2SRC A;  1Y71 A;  3GNF B;  4JRP A;  2HMA A;  4J8O A;  4E7L A;  3P8B B;  4CC7 A;  4FW2 A;  3CME A;  3ZL7 C;  4ATO A;  2DJQ A;  2JOY A;  1Q86 U;  4XAX B;  2JS2 A;  1Y7X A;  2OAW A;  4J6Y A;  5GAM h;  4N4H A;  1E6H A;  1N9R A;  1MNE A;  2NUP A;  1Q82 R;  4R56 A;  3CD6 A;  2LT4 A;  2G6F X;  3VUZ A;  2OTL Q;  2K7A A;  3CC4 T;  2K2M A;  2HQE A;  1PD1 A;  2CSI A;  5D7U A;  1I1J A;  3CBM A;  1TS9 A;  5IXB A;  3G6E A;  5CKD A;  2NUT A;  1JQQ A;  1ACM B;  4J9D A;  2RQV A;  3G71 Q;  1SRL A;  1S1N A;  1W2B P;  3MEV A;  3I35 A;  2NYS A;  1T3L A;  4C0G A;  1YJN T;  1NEB A;  1G3W A;  2YUQ A;  2A08 A;  4PFP A;  2RF0 A;  3A98 A;  4M7A F;  2VV5 A;  3CME Q;  1D09 B;  1FMV A;  2RA2 A;  4ANJ A;  4OB0 B;  3EGX A;  5KYX A;  1QLY A;  4JJN K;  3JSC A;  1R0C B;  5KH6 A;  4GLK A;  4DEY A;  5AT1 B;  3EGU A;  2WAC A;  2FZG B;  1IZ6 A;  9ATC B;  4M4Z A;  1X43 A;  4N4I A;  2KT1 A;  2CZ7 B;  3DLL A;  4FW1 A;  1MMN A;  3CCM A;  1M90 U;  1KQ1 A;  1CKA A;  3P8H A;  1NJI U;  2X3W D;  2DER A;  3HFN A;  2EYX A;  1NYG A;  4KH0 B;  3FLG A;  2BE7 D;  1WIE A;  4XTY A;  4KBM B;  3C94 A;  3VS2 A;  1X6B A;  1Y96 A;  2ROL A;  1ZSZ C;  5AYF A;  5FU6 B;  5FW9 A;  3URG A;  3JCM g;  3PIP A;  1MV0 B;  5LJ5 h;  2A37 A;  2FPD A;  4RCB A;  3I56 A;  3TU4 K;  1ZUK A;  1UJ0 A;  3KUF A;  1YJW A;  4EIK A;  2E12 A;  2LJ1 A;  4PJO G;  3H8Z A;  2DD5 A;  5C0M A;  5GJV B;  3EFS A;  2EQJ A;  2PU9 B;  3S3O A;  2W0Z A;  3JB9 I;  2E3I A;  4M78 C;  1JRI A;  3CCM T;  1NG2 A;  2LNH B;  2FPE A;  1PWT A;  4PFZ A;  4DQ2 A;  2YWW A;  2NLU A;  2P0Q A;  2EGC A;  4M7A D;  4IUV A;  3REB B;  4GBQ A;  3UDC A;  4X9C A;  1U1S A;  4QQD A;  3TSW A;  2PTK A;  4EDU A;  4GY5 A;  3JCM X;  3QYH B;  1JEG A;  1VYV A;  3QZ9 B;  2QGG A;  3PVQ A;  3VKI A;  4ESR A;  3RES A;  1V1C A;  1SRM A;  1X2K A;  4LDY A;  4XTU A;  1WX6 A;  1I8F A;  1YIT A;  4IKF A;  2R5M A;  4IIO A;  3G7Z A;  1VA7 A;  2LJ0 A;  4ZN1 A;  5FRM A;  2AKK A;  5GAM j;  3RMS A;  5FLX E;  1MND A;  5KYU A;  2H3E B;  2R5A A;  3UA6 A;  3CCQ T;  1G83 A;  5GAN 4;  3HTR A;  1WHJ A;  2K79 A;  3EG2 A;  1R0B G;  4Z02 A;  3TQ7 P;  1QVG A;  2FZK B;  1UGQ B;  2V8I A;  1LCK A;  3X25 B;  3I9Q A;  1AZE A;  4RTW A;  2RHU A;  4N4G A;  2KNB B;  3LW5 E;  1M1K R;  2X35 A;  3A1P A;  4LUE A;  1YN8 A;  5KE3 A;  5L8R E;  5LJ3 j;  2M16 A;  3L2V A;  2I0N A;  1K76 A;  4M75 D;  2ZPE B;  1OU9 A;  3VS4 A;  2OTL A;  4UC4 A;  1PNJ A;  2DLP A;  4J6X A;  2CT4 A;  1Q7Y R;  2A0F B;  2A7Y A;  1OQK A;  3NTI A;  2QI2 A;  3OS0 A;  1N8R R;  2RM4 A;  2D8J A;  2JVV A;  2KI7 A;  3PFS A;  2O88 A;  4HT8 A;  1KD1 C;  2EVR A;  1TH7 A;  3CQT A;  2ESW A;  2DYB A;  3CCQ A;  1QQJ A;  2X4W A;  3QKJ A;  1D1C A;  2XDP A;  3LYI A;  1UGR B;  2LX7 A;  4LXC A;  2VKN A;  1BKB A;  2HD0 A;  4M78 B;  4FYV B;  5J26 A;  4XK8 E;  3QUI A;  1T3S A;  5CKB A;  4ZNX A;  4XU3 A;  1AEY A;  4M7D C;  3OYN A;  4KT0 E;  3JCM W;  5I21 A;  1PRL C;  2RHX A;  2E5Q A;  2OTL T;  4HCZ A;  2DKG A;  2MK5 A;  4Z8A A;  3L42 A;  4C8Q G;  1M3A A;  4M7A B;  1MMD A;  5LJ5 j;  5LJ5 d;  1W2B A;  2XK0 A;  1UUE A;  3PIO A;  5GAO p;  2JJ9 A;  1WDX A;  3M55 A;  3DB4 A;  5GAN e;  1N8R C;  4OVA A;  5IH2 A;  5GMK j;  3SHW A;  1RLQ C;  1WXB A;  2A3L A;  3CCS A;  1YJ9 T;  3PNW C;  3CME T;  1QCF A;  2BIV A;  2HBP A;  3SWN A;  4E6R A;  4KUD K;  1Y07 A;  2K5I A;  1M2V B;  4NS5 A;  2PVG B;  3V8J A;  2XD0 A;  4M7D A;  3QII A;  1VQ6 T;  2Y4X A;  4C92 E;  4F7U G;  1WA7 A;  1NBE B;  3JCM h;  4TVR A;  4A4G A;  3CC4 A;  2RMO A;  2EGA A;  1Y0M A;  2MAM A;  1AOJ A;  4J9C A;  2GTO A;  1PM3 A;  3CCV T;  4PLL A;  1N9S A;  5GAM g;  2HZY A;  4FT4 A;  2Z0W A;  2XID A;  4M7A C;  1BIA A;  2RI3 A;  1TTH B;  1EIF A;  3I55 A;  4LDX A;  1RAC B;  2EW3 A;  3KXT A;  2OJ2 A;  4DOV A;  3BY7 A;  2W10 A;  2DBK A;  1MV3 A;  2YRC A;  1PSE A;  4R0K A;  3P8D A;  4F16 A;  3OYH A;  3OYY A;  4BB7 A;  1QVP A;  2EQU A;  1HSQ A;  1JXO A;  2VAS A;  5FRN A;  1R77 A;  4LDW A;  4BY6 C;  4ZTJ A;  3SWN C;  4O5V A;  3V8K A;  1ABO A;  2CP5 A;  3MEW A;  3MP6 A;  3UAT A;  1KK7 A;  1HXD A;  2B8A A;  1G3Y A;  5CKH A;  3JCM P;  2VUB A;  2DMO A;  5KYY B;  2IVW A;  5GAM d;  2L89 A;  4M77 G;  4XU2 A;  3E19 A;  2LC4 A;  1K9A A;  4IUQ A;  2LP5 A;  3EHQ A;  2GFA A;  2LDM A;  2CZ0 B;  3O5Z A;  4M7A G;  1UFF A;  1AWX A;  1H92 A;  1NJI R;  2DET A;  1BCM A;  1GBR A;  2CUD A;  1VQO Q;  5I2S A;  3M0T A;  1NJI C;  3EFO A;  2QEX A;  2E4H A;  2QDL A;  3CPW P;  2QYZ A;  4L6V 5;  1F1B B;  1YJW T;  3SDZ A;  2AHJ B;  3D7S B;  4OF1 A;  2RB6 A;  1R8O B;  3M5A A;  2FVU A;  2HQX A;  5GAO q;  1RAB B;  4NL3 A;  4J9E A;  4BE2 A;  1Q86 C;  1BU1 A;  2C06 A;  2XDB A;  1K0X A;  1BIB A;  4M7D D;  1M2O A;  2VYT A;  3SD4 A;  3OSS C;  2ABL A;  5A0L A;  2E70 A;  1ARK A;  5CCA A;  3CCE A;  1OYX A;  2DYI A;  1GBQ A;  1UEB A;  2L0A A;  1D0Z A;  4M75 B;  3M0S A;  4GLM A;  1UEC A;  3EGX B;  4OMF B;  5KYX B;  5KYW A;  2KSS A;  2RN8 A;  5J3B A;  4B9X A;  4EMK B;  1VQM Q;  4PJO F;  2MCN A;  4F14 A;  1QVF A;  5CR2 A;  4BD3 A;  1YJN A;  3IQL A;  5HK3 A;  1TWB A;  4OMO A;  2YUP A;  5GAN 5;  2CRE A;  2XMF A;  2KE9 A;  4ME7 A;  4FCY A;  2NWM A;  4C8Q A;  2BZY A;  2V8J A;  2QAZ A;  2KK4 A;  2F69 A;  4BDY A;  1VQO T;  1YI2 A;  4E7J A;  3MET A;  4PJO E;  2EBP A;  4JZ4 A;  2AIR B;  3CCE T;  3NMZ C;  4DA4 A;  1YP5 A;  2FB7 A;  1YWP A;  3TVT A;  2QQS A;  1O9S A;  4M7A E;  3OYG A;  2CT3 A;  2DL5 A;  5FU7 B;  3MPU B;  1VYT A;  3H41 A;  2DEU A;  3H9N A;  1XJW B;  3M56 A;  4J7I A;  4C5H A;  5LJ3 f;  5J39 A;  2O4X A;  1SG5 A;  1PCX A;  2DAQ A;  3WVE B;  2X3X D;  4RTX A;  3MCA B;  5LJ3 e;  3QO3 A;  2KAF A;  1EFN A;  2KYM A;  4M75 F;  4E47 A;  2CKK A;  2VWF A;  4C0D C;  5GAN d;  2ZAE A;  4KH1 B;  1X6G A;  3PMT A;  1V29 B;  4HCC A;  3EHR A;  4E7Z A;  4M78 A;  4KGV B;  1N8R U;  3C12 A;  1RAF B;  4X1V A;  1UGS B;  2YDL A;  5KYN A;  1GXI E;  5KCO A;  4J9I A;  3UT1 A;  4WCI A;  3M58 A;  3VS1 A;  1I5O B;  1ZX6 A;  2SEM A;  4J9H A;  4QQG A;  2LQ8 A;  1OZ2 A;  3OQ5 A;  2F2V A;  1UJY A;  2HKQ B;  3GIB A;  3GBQ A;  5A0G A;  4QVD A;  1WHG A;  3UWN A;  4J7F A;  2QGF B;  3JCM b;  4MZP A;  3TEE A;  2BTT A;  2C0O A;  3GLX A;  2LTO A;  4AG2 C;  3OA6 A;  1OI1 A;  5LJ5 f;  4BI8 B;  3LH0 A;  5ECA A;  2A28 A;  3GPL A;  3E2U A;  4IUT A;  5FRO A;  4QKU A;  1IRX A;  1QW1 A;  5KYW B;  2YLB A;  3T9N A;  1G3S A;  1YIT T;  4ORZ A;  2AZV A;  1FYN A;  4C8Q D;  4K11 A;  4JS5 A;  1BI2 A;  1PC0 A;  3CCS T;  1YJ9 A;  3A5Z B;  5KCH A;  3R6O A;  5GAO n;  2K2V A;  2LCS A;  5LJ5 e;  3OS1 A;  2M0O A;  4QQ6 A;  1TSF A;  2QDY B;  4DEX A;  1K9M C;  2E64 A;  1AVZ C;  2CYZ B;  1KQS A;  3OYE A;  4EMK A;  3OB9 A;  3MKD A;  8AT1 B;  4D8K A;  2GQV A;  4EMK C;  2C0T A;  1FMW A;  1NLP C;  1SSF A;  3CCV A;  2RI5 A;  1H3Z A;  1T0J A;  2WSE E;  2O31 A;  2FO0 A;  1PKT A;  5LJ3 d;  3FRN A;  2QEX Q;  2CH4 A;  4M77 D;  4LUD A;  1WXU A;  3HP9 A;  1U06 A;  2DTO A;  1VQ8 Q;  2XKO C;  1Q7Y C;  3CXC S;  2DF6 A;  2V26 A;  4E7I A;  4Y91 A;  2MPX C;  3M0Q A;  2VC8 A;  2VXF A;  3EH1 A;  1Z9Z A;  1E6G A;  2CS7 A;  1M4Z A;  4KGX B;  1BI0 A;  3CC7 T;  2OAU A;  3CCJ A;  1OEB A;  1VQ5 A;  1SKU B;  1UHC A;  2ZPB B;  1D1A A;  2LCL A;  1KQ2 A;  3OYF A;  1RLP C;  4PJN A;  4C0D B;  3CC2 Q;  4CC4 B;  2K3X A;  3RER A;  2PVO B;  1I81 A;  2GBQ A;  2M9U A;  5CQX A;  5LL6 S;  4RG8 A;  1AZG B;  4QVZ A;  1M1K C;  3EH2 A;  1LOJ A;  2K57 A;  2YRD A;  1K73 U;  2K3B A;  2AT1 B;  2QEX T;  1HK9 A;  2F5T X;  4Q5W A;  1KC8 U;  2PZ1 A;  3LGF A;  2HSE B;  5DY9 A;  3JB9 G;  4OMN A;  2KQW A;  2PUO B;  2QQA A;  1VQ5 T;  1VQ6 A;  4F17 A;  3JB9 J;  1X2Q A;  2XHC A;  1TOV A;  2F2W A;  2EYQ A;  2ZPI B;  3CPF A;  4RKU E;  5GAO r;  2LQN A;  4P5N A;  3C95 A;  4A4H A;  3CC7 Q;  5KYU B;  1VQ4 Q;  3Q1J A;  2DM1 A;  2RQR A;  4L59 A;  1WQW A;  3OYJ A;  2K6D A;  1SHF A;  2DFU A;  1TXQ A;  2FG0 A;  3GP8 A;  4Y28 E;  1M1F A;  1B3Q A;  2ZPG B;  5GMK h;  3CC2 T;  5CQY A;  1IGQ A;  4OB1 B;  1SHG A;  3E9F A;  2KRS A;  2JUF A;  5GJW B;  3FC3 A;  4FU6 A;  1RI0 A;  1M9S A;  2K9G A;  2CP6 A;  1FXX A;  3H0F A;  2E6N A;  3FJ5 A;  5CIU A;  1W70 A;  3OYK A;  2EYZ A;  2DRK A;  4OML A;  1XQH A;  1WZO A;  3OS5 A;  4CC2 A;  4E7H A;  1QVG S;  2GQI A;  3G6E T;  1Q82 U;  1B7T A;  1VQ5 Q;  3OW2 S;  3BDL A;  2GTJ A;  1KD1 U;  4V2S A;  3SFM A;  1K0S A;  5IHN A;  2E41 A;  2X4Y A;  3PE0 A;  2CZ6 B;  1M3B A;  4JJC A;  1H64 1;  1PSF A;  5IN1 A;  3LWI A;  1NYF A;  3RNJ A;  2R57 A;  4DBR A;  4C8Q C;  2KEA A;  1OX9 A;  3CCU T;  2DD4 A;  2RJE A;  2DX1 A;  1VQ4 T;  3OS2 A;  3RMQ A;  2EYW A;  4RG2 A;  1VQ8 A;  2LNV A;  3CBO A;  1NEG A;  1WHK A;  3DLM A;  3AT1 B;  4PJJ A;  3X28 B;  2G3R A;  2KGT A;  2HEQ A;  3C4S A;  1VQN Q;  1VQK A;  2P4R A;  1OUL A;  3U23 A;  3THK A;  2RPN A;  3VYG A;  2JM8 A;  5M9O A;  3OMC A;  4JRQ A;  1M3C A;  2CGH A;  2DTI A;  3DKM A;  5GAN h;  2QXF A;  1KFZ A;  2KRN A;  5CKE A;  5IXF A;  1G3T A;  1YHQ T;  1QP2 A;  1QWF A;  1HJD A;  2JN0 A;  5L23 A;  3MEU A;  2EJF A;  2YLC A;  3M4Y A;  3MP8 A;  3X26 B;  3CMA Q;  1X75 C;  1LPL A;  1HD3 A;  1D3B A;  1KSW A;  3TCJ A;  4FSS A;  1RAI B;  5CVI A;  4M75 G;  1VQO A;  1AWJ A;  3UA7 A;  2L2P A;  1IHV A;  1QVF P;  1WFW A;  3G1J A;  2EAY A;  3CEY A;  2MI6 A;  1YHQ A;  2J6O A;  1VQN T;  2EKO A;  2DXB A;  5KE2 A;  3FEO A;  2M0Y A;  3VS6 A;  3CCR Q;  4XTW A;  1MMG A;  3CCR A;  4EMG A;  2QQB A;  4EMH A;  1A0N B;  4J9B A;  3QBY A;  4C92 G;  4F7U E;  3L2U A;  1D1B A;  3GNG A;  2LRQ A;  3JRZ A;  3VRY A;  1BCO A;  3L2Q A;  2V1Q A;  3INZ A;  5GAO l;  4ELZ C;  2DIG A;  2DL7 A;  3MP1 A;  2RHZ A;  3M54 A;  1PD0 A;  2I2L A;  3RIR A;  2DZ9 A;  2FYK A;  4DBF A;  2ECZ A;  1VYU A;  3QDF A;  4QT7 A;  1Q95 G;  2ROT A;  1G5V A;  4MZM A;  1K73 C;  1Y57 A;  2EKH A;  2HSP A;  4B6M A;  4M77 A;  5A2Q E;  1ZBJ A;  4PK4 A;  4BI3 A;  4D8D A;  4KUI A;  1PG5 B;  3MHX A;  3JCM e;  1T0H A;  3S3M A;  1MUZ A;  1N5Z A;  2CP2 A;  1Q86 R;  1UE9 A;  4Z88 A;  3BDU A;  4WTO B;  2BE9 B;  2X4J A;  2GF7 A;  3GF5 A;  2RHI A;  1YJN Q;  4PNO A;  1JB0 E;  4JLG A;  1FMK A;  3HHT B;  1VQP Q;  1JO8 A;  1SPK A;  2HDA A;  4J9G A;  1QWE A;  2JTE A;  2H3J A;  3AHU A;  2JMC A;  2XG8 D;  4HVV A;  4PLI A;  1K8A C;  3ZBD A;  1JBM A;  1VQL Q;  1E7O A;  5DLQ E;  2DA9 A;  4OGC A;  5DLO A;  1TU0 B;  4PJO C;  2E3H A;  3CMA A;  2L3Q A;  3NTK A;  4OMQ A;  4C5I A;  1WHM A;  5GAN 6;  4AFZ C;  1KD1 R;  3X20 B;  2NUT B;  4HT9 A;  3QYG B;  1ZSZ A;  1JU5 C;  2DO3 A;  2ZCF B;  4CC3 A;  1RAG B;  1Q82 C;  3R6N A;  4KRT A;  2KRM A;  2KYB A;  1ZUU A;  3E1S A;  3J7A F;  2KY9 A;  4C8Q E;  1RAA B;  1I5L A;  4E7K A;  4OGE A;  1B07 A;  1ZSG A;  2E5K A;  2MWO A;  1K8A U;  3RKY A;  3CXC P;  5LJ3 h;  2A36 A;  1W1F A;  3JCM J;  4A4K A;  1UG1 A;  3NFC A;  4JZ3 A;  5GAN 7;  3LGL A;  4HA8 A;  1KHC A;  5HCK A;  2CZ1 B;  2J6K A;  4OMM A;  1UGP B;  3JCM f;  2JT4 A;  5DM7 R;  1GCQ A;  2OTJ T;  2RNA A;  4FSX A;  2RJD A;  1YIJ T;  5FWC A;  1H8K A;  4M7D E;  4HXJ A;  4YTL A;  2ZPF B;  5IHI A;  3ULR B;  3VS3 A;  2MWP A;  4DBH A;  1KHI A;  1ZUY A;  1P92 A;  2DE0 X;  4B9W A;  5HK0 A;  1VQL T;  3CC7 A;  3EFR A;  3OYD A;  1C1A A;  2XI9 A;  4AMC A;  4QW2 A;  3CCV Q;  2BZ8 A;  1RAE B;  3PT9 A;  3CCQ Q;  4M7A A;  5GMK i;  1UB4 A;  1OV3 A;  3CD6 T;  2M1H A;  1MHN A;  2JTM A;  3EG9 B;  2X9H A;  5I22 A;  2O9S A;  2COZ A;  3VS5 A;  1ZBX A;  2RJF A;  2OTJ A;  1X27 A;  1VQ4 A;  4IIM A;  5GMK e;  3CBP A;  1O75 A;  1BK2 A;  2LX9 A;  2MOX A;  4RMO A;  1DJ7 B;  3OBY A;  1YCY A;  4R55 A;  2OI3 A;  2QQR A;  4M78 D;  3NPF A;  2DVE A;  1IXD A;  4OB3 B;  1VQL A;  3J81 E;  2QG9 B;  2IPO B;  2OTJ Q;  1KQS P;  3J80 E;  2M02 A;  2MMP A;  4J5Y A;  1J3T A;  1JJ2 S;  2DXU A;  2KT8 A;  5GAN g;  2WSC E;  1U3O A;  3TSZ A;  4MDX A;  2HL3 A;  3HRS A;  1BI3 A;  2JMA A;  4L5G A;  2YRV A;  3QWX X;  2EIF A;  4A63 B;  2V1R A;  4JUV A;  2DL8 A;  4RTY A;  4XTX A;  3WXM B;  4FM4 B;  4XU1 A;  3SB2 A;  3CD6 Q;  1QKW A;  2XDD A;  2R58 A;  1WJQ A;  3CC2 A;  3S3N A;  2GCX A;  1YJW Q;  2DJZ A;  3JB9 H;  1KG1 A;  3MJX A;  3OYA A;  3CCJ Q;  1ZSZ B;  3RKX A;  3L1A A;  2FEI A;  3I56 T;  1YFN A;  5GAM e;  1QKX A;  4E2F B;  4XQ3 A;  2BUD A;  3LX7 A;  1ZQ1 A;  1JJ2 A;  1IB8 A;  2H8H A;  1X6O A;  1OX8 A;  2FRY A;  3M0R A;  1SEM A;  4M7D F;  1RAH B;  1EZZ B;  2DZC A;  5GAO m;  4Z89 A;  2HNI A;  3CCM Q;  3JCM d;  2QQ9 A;  2PUK B;  1AD5 A;  2PNI A;  1U8R A;  1Q7Y U;  1VQM T;  4FYX B;  1VQ6 Q;  3QWY A;  1TUG B;  1WI7 A;  3VYH B;  3KBG A;  4AFQ C;  5KYY A;  5GAN 2;  1S72 A;  1QVG P;  3E9G A;  3QJY A;  5EC7 A;  3L2Z A;  4FIB A;  2DK3 A;  4LD6 A;  3PMI A;  4RTT A;  1BB9 A;  1KC8 C;  2QA4 A;  3M57 A;  2CH4 W;  3A8H B;  4FYW B;  1Q81 C;  5HY6 A;  2RD1 A;  1VQ7 T;  5D6X A;  2P0P A;  2K3Y A;  4Y92 A;  4JS4 A;  2J06 A;  1GCQ C;  5GAM f;  4F7U A;  1PRM C;  3UF4 A;  1H3H A;  1VUB A;  3SEM A;  2CDT A;  5EG2 A;  1XOV A;  1GCP A;  4DOW A;  2COY A;  3FJP A;  1ZLM A;  1X69 A;  2ZGW A;  2EJ9 A;  2JNG A;  4M77 B;  3HRU A;  1CKB A;  1NM7 A;  3OYM A;  2X4X A;  2B86 A;  4PKC C;  1LNX A;  3RR6 A;  4FYY B;  2MYS A;  1D0Y A;  2HAX A;  3VJP A;  8ATC B;  1G2B A;  1BBZ A;  1VQ7 A;  2EQK A;  2KXC A;  3VRZ A;  1VQ9 T;  3EG0 A;  4M75 C;  4PJO D;  2RK1 A;  3VV0 A;  5GAN j;  3F70 A;  5I11 A;  3V7R A;  5I2M A;  1ZA1 B;  1YIJ Q;  1QCN A;  3L2W A;  3I5S A;  1BI1 A;  4KUL A;  4M77 F;  2RH2 A;  3OW2 P;  2F5K A;  2LVM A;  3QJ6 A;  3GOX A;  4JRI A;  3HKS A;  1RI9 A;  2EWN A;  3M53 A;  1AWO A;  2LZ6 B;  2E10 A;  3PTA A;  2RJC A;  4PL6 A;  2OX7 A;  4BE1 A;  2X51 A;  3G4S Q;  1QCO A;  1GFD A;  5IHK A;  3OYC A;  1VQP A;  2JS0 A;  2LQW A;  5GAN 3;  1Q81 U;  1V76 A;  2XIC A;  2LCC A;  2RQT A;  4M78 E;  3WVD B;  3H6Z A;  2M51 A;  2L8D A;  5CO7 A;  4C92 F;  3QZ5 B;  1MMA A;  2FL7 A;  4F7U B;  3EGD A;  3H0H A;  4C92 B;  2DNU A;  1PKS A;  4N0A C;  3VU3 C;  4HCB A;  2P0K A;  4BE0 A;  1YJ9 Q;  2ED1 A;  4F7U F;  2DXT A;  1ZA2 B;  4C0F A;  2D0Q B;  4N0A A;  3QHS A;  4PJO B;  4M78 F;  4WF2 A;  1I0C A;  5FU6 C;  3CCE Q;  1U1T A;  5HKC A;  5FWB A;  2ED0 A;  1UTI A;  1I4K 1;  2V8K A;  3SWN B;  5GAN f;  2D6F A;  1K73 R;  2D9T A;  4A53 A;  3JV3 A;  1M2V A;  2RI2 A;  4ZGE B;  2KVQ G;  3G4S T;  2BKD N;  4LDV A;  2QA4 Q;  3EG9 A;  4MDW A;  1IO6 A;  2QTX A;  4JJB A;  3HFO A;  4HKE A;  5A0D A;  3I55 T;  1X01 A;  2VB6 A;  4DBQ A;  2GGR A;  4M77 E;  1XNI A;  2YXY A;  4AT1 B;  1M8M A;  4RTZ A;  2IG0 A;  4NOY A;  4IUU A;  2HQH A;  4LD9 K;  3CCJ T;  3EAE A;  1UDL A;  4BAC A;  2DIQ A;  2JZ2 A;  3I56 Q;  4PJL A;  3LH5 A;  2DL3 A;  1K1Z A;  4QVC A;  4BUG A;  4X34 A;  1N6A A;  2RQU A;  1M5Q 1;  2D8H A;  4AFS C;  2LT1 A;  3G4S A;  2CP3 A;  3HL8 A;  2K5F A;  2HL5 C;  1AT1 B;  4JPB W;  2FRW A;  1NPP A;  4IUR A;  4PJM A;  3ZEH A;  2DIL A;  2EQI A;  4M75 A;  5FU7 C;  2VXE A;  1C6V X;  4FL6 A;  1C0M A;  1ABQ A;  4O6J A;  5C6S A;  1Z9Q A;  4MML A;  1GFC A;  2NUP B;  3NHN A;  2YHT A;  2KDS A;  4JJD A;  1QVF S;  4JRK A;  4FT2 A;  2KR3 A;  2DXC A;  4LDU A;  4C92 A;  2F2X A;  5GMK m;  3TRE A;  2L5Q A;  1EX4 A;  1NZ9 A;  1TUC A;  2YT6 A;  2KXD A;  4J9F A;  1WNL A;  2LJ3 A;  4F04 B;  1VQ7 Q;  4M7D G;  3I55 Q;  3VS0 A;  2BZX A;  5LJ3 g;  6AT1 B;  2FPF A;  2J6F A;  1YWO A;  3MEA A;  3FIF A;  2O01 E;  1NPR A;  2O4X B;  2NUZ A;  3CPW A;  2CUB A;  4J6W A;  2GFU A;  2IIM A;  3G71 A;  1GRI A;  2YUN A;  1VQM A;  2FZC B;  2J7I A;  3M4G A;  3M0P A;  3QDR B;  1KIK A;  2VGM A;  4VUB A;  3OYI A;  1VQK Q;  5CAI A;  2EGE A;  2DEQ A;  4MMK A;  2PVD B;  1IGU A;  3RBB B;  1M30 A;  2KMT A;  1W2B S;  4PJO A;  1QP3 A;  2ZPH B;  1VQ9 Q;  4M77 C;  5D6W A;  2HKN A;  3OSV A;  3EG1 A;  2P4T A;  1M1K U;  2WSF E;  4LN2 A;  4HCK A;  4OP0 A;  3M0U A;  3OW2 A;  4C5G A;  3G6E Q;  4BY6 B;  1Y96 B;  2JW4 A;  2YUO A;  3NTH A;  1YI2 T;  1IHW A;  1S72 Q;  4II1 A;  3FDR A;  1YNZ A;  2QTV A;  4M75 E;  2P84 A;  2L3P A;  2E1H A;  3JB9 F;  5D6Y A;  4X9D A;  4C8Q B;  2D0N A;  3CCU A;  4CI0 C;  1VIF A;  3ER0 A;  3I5R A;  4OB2 B;  1OU8 A;  4ELY C;  2ZZD A;  5LJ5 g;  1VOM A;  3REA B;  1VQ8 T;  3S6W A;  3ME9 A;  4LNP A;  2DVJ A;  4ZN3 A;  2VVK A;  3VUB A;  1KJW A;  2MIO A;  4NL2 A;  1VQK T;  2Y4Y A;  1WJS A;  4C92 D;  1JXM A;  3JAM E;  1AHJ B;  2O9V A;  1FWZ A;  1IRE B;  1I07 A;  4D6W A;  1M27 C;  2ATC B;  3LWH A;  5CKF A;  1RUW A;  5IAY A;  1W4S A;  1WHL A;  3A8O B;  3CC4 Q;  2JTF A;  1BYM A;  2RHY A;  2E65 A;  1YHQ Q;  1VIE A;  3A8M B;  2YSQ A;  1UGV A;  1YI2 Q;  1SF9 A;  3ASK A;  1S72 T;  2HBW A;  4ZGJ B;  4RUG A;  2D1X A;  3CXC A;  4C92 C;  1TG0 A;  5CK9 A;  1OOT A;  3M9Q A;  2L3R A;  2JXB A;  2RO0 A;  4XU0 A;  2ENM A;  2J05 A;  4JDS A;  1Q81 R;  4A4E A;  2QA4 T;  1WHH A;  3BFM A;  3EG3 A;  1WJR A;  3BE3 A;  4RCC A;  3N5B B;  3PVL A;  3C0C A;  3JCM V;  1WXT A;  1YIT Q;  1JJ2 P;  3OBW A;  1UHF A;  1WLP B;  1VQN A;  4RTV A;  2CSQ A;  5GMK l;  3CCS Q;  2EQM A;  3RUX A;  3H0I A;  2QK0 A;  3CCR T;  3KFV A;  3HSB A;  4J83 A;  3EFO B;  1B34 B;  2DBM A;  2K4Y A;  1YCS B;  2LQK A;  2C0I A; 
#chains in the Genus database with same CATH homology
 4RTT A;  2GNC A;  2K9G A;  2DRM A;  1BB9 A;  3H0F A;  3FJ5 A;  1W70 A;  1WA7 A;  2CH4 W;  2EYZ A;  2DRK A;  2HCK A;  4OML A;  2RMO A;  2EGA A;  1Y0M A;  4OMP A;  1AOJ A;  4J9C A;  2DL4 A;  4CC2 A;  2GTO A;  2LMJ A;  4RTU A;  2GQI A;  4Y92 A;  3NGP A;  2J06 A;  1GCQ C;  1PRM C;  3UF4 A;  1H3H A;  2GTJ A;  3SEM A;  2CDT A;  1XOV A;  1NLO C;  1GCP A;  2EW3 A;  1K0S A;  5IHN A;  1ZLM A;  2OJ2 A;  1X69 A;  3PE0 A;  2KRO A;  1M3B A;  4JJC A;  1U5S A;  2W10 A;  1NYF A;  2DBK A;  3RNJ A;  1W6X A;  1MV3 A;  4R0K A;  4F16 A;  4LE9 A;  2KEA A;  1CKB A;  1NM7 A;  2DX1 A;  1HSQ A;  1JXO A;  2B86 A;  1PHT A;  2EYW A;  1TUD A;  2EYY A;  1K4U S;  2O2O A;  1NEG A;  1ABO A;  4HVW A;  3UAT A;  1G2B A;  1BBZ A;  2AKL A;  2KGT A;  3VS7 A;  2HEQ A;  2DMO A;  2KXC A;  3VRZ A;  2P4R A;  3U23 A;  3EG0 A;  3THK A;  2RPN A;  2L3S A;  1K9A A;  1CSK A;  2LP5 A;  3EHQ A;  2JM8 A;  5I11 A;  3O5Z A;  1M3C A;  2RQW A;  1UFF A;  1OPL A;  1AWX A;  1H92 A;  1WYX A;  3I5S A;  1KFZ A;  2KRN A;  5IXF A;  1GBR A;  2CUD A;  1QWF A;  1HJD A;  1RI9 A;  3M0T A;  5L23 A;  1AWO A;  1OPK A;  2LZ6 B;  4AG1 C;  1AWW A;  2QDL A;  2AZS A;  1HD3 A;  1GFD A;  5IHK A;  1KSW A;  4FSS A;  2JS0 A;  2LQW A;  4J9E A;  1K0X A;  1BU1 A;  2AK5 A;  2ABL A;  2RQT A;  1ARK A;  1AWJ A;  2M51 A;  3UA7 A;  1SSH A;  2L2P A;  2JM9 A;  4AFU C;  4HVU A;  2EPD A;  1GBQ A;  2KBT A;  1WFW A;  2L0A A;  3M0S A;  4GLM A;  1UEC A;  2J6O A;  3H0H A;  1GL5 A;  2DNU A;  1PKS A;  2RN8 A;  2SRC A;  2M0Y A;  3VS6 A;  2ED1 A;  2MCN A;  4F14 A;  4CC7 A;  1A0N B;  4J9B A;  3ZL7 C;  3IQL A;  2DJQ A;  4OMO A;  1I0C A;  2YUP A;  2JS2 A;  2CRE A;  2XMF A;  2KE9 A;  2NWM A;  2BZY A;  2OAW A;  5FWB A;  2ED0 A;  1UTI A;  1E6H A;  3VRY A;  2V1Q A;  2EBP A;  4JZ4 A;  2G6F X;  2DL7 A;  2K7A A;  3JV3 A;  2K2M A;  3NMZ C;  2CSI A;  1YP5 A;  1I1J A;  1YWP A;  3TVT A;  1IO6 A;  2ECZ A;  5IXB A;  1JQQ A;  1VYU A;  4QT7 A;  2ROT A;  2CT3 A;  4J9D A;  2DL5 A;  2RQV A;  4JJB A;  1VYT A;  1Y57 A;  2EKH A;  2HSP A;  1SRL A;  1S1N A;  3H41 A;  2GGR A;  1ZBJ A;  3I35 A;  1T3L A;  1M8M A;  4D8D A;  4RTZ A;  1NEB A;  1T0H A;  1MUZ A;  1N5Z A;  2YUQ A;  2A08 A;  1UE9 A;  4Z88 A;  2RF0 A;  3A98 A;  1UDL A;  2X3X D;  4RTX A;  3LH5 A;  2DL3 A;  1EFN A;  2KYM A;  1K1Z A;  1QLY A;  2VWF A;  1FMK A;  2RQU A;  1X6G A;  2D8H A;  4DEY A;  4AFS C;  3EGU A;  3EHR A;  1JO8 A;  1SPK A;  2HDA A;  4J9G A;  4X1V A;  2YDL A;  1QWE A;  2JTE A;  4M4Z A;  1X43 A;  2FRW A;  4JPB W;  4J9I A;  2DIL A;  2JMC A;  2EQI A;  2KT1 A;  4WCI A;  3VS1 A;  1ZX6 A;  2SEM A;  4J9H A;  1ABQ A;  4HVV A;  2F2V A;  1Z9Q A;  1GFC A;  1CKA A;  1UJY A;  3GBQ A;  2X3W D;  3NHN A;  1E7O A;  4JJD A;  2DA9 A;  1NYG A;  2EYX A;  1WIE A;  2KR3 A;  3VS2 A;  1X6B A;  2ROL A;  2L3Q A;  2F2X A;  4OMQ A;  5FW9 A;  2BTT A;  1TUC A;  2C0O A;  2YT6 A;  2KXD A;  4AFZ C;  4J9F A;  2LJ3 A;  4AG2 C;  1MV0 B;  2A37 A;  2FPD A;  1JU5 C;  2A28 A;  2BZX A;  5ECA A;  1ZUK A;  3VS0 A;  1UJ0 A;  4CC3 A;  3R6N A;  4KRT A;  2FPF A;  2J6F A;  2KRM A;  4EIK A;  1YWO A;  2KYB A;  1ZUU A;  2LJ1 A;  4ORZ A;  5GJV B;  2AZV A;  1FYN A;  2NUZ A;  2CUB A;  4K11 A;  1B07 A;  1ZSG A;  2E5K A;  2W0Z A;  2IIM A;  1GRI A;  2A36 A;  2YUN A;  1NG2 A;  1W1F A;  2LNH B;  2J7I A;  2FPE A;  1PWT A;  1UG1 A;  4JZ3 A;  3M0P A;  1KIK A;  5HCK A;  2J6K A;  4OMM A;  2LCS A;  2JT4 A;  2EGC A;  4DEX A;  1GCQ A;  4GBQ A;  3REB B;  1AVZ C;  2RNA A;  5FWC A;  2EGE A;  3TSW A;  1H8K A;  4HXJ A;  2PTK A;  3RBB B;  5IHI A;  1M30 A;  3ULR B;  4D8K A;  3VS3 A;  1JEG A;  1ZUY A;  1VYV A;  2DE0 X;  3PVQ A;  4ESR A;  2C0T A;  3EG1 A;  1NLP C;  1SRM A;  1V1C A;  1X2K A;  1WX6 A;  4LN2 A;  4HCK A;  1T0J A;  3M0U A;  2BZ8 A;  2O31 A;  2FO0 A;  4IIO A;  1PKT A;  2JW4 A;  2YUO A;  1VA7 A;  2CH4 A;  2LJ0 A;  4LUD A;  1OV3 A;  2AKK A;  1WXU A;  1YNZ A;  2L3P A;  1U06 A;  5I22 A;  2O9S A;  3UA6 A;  3VS5 A;  1G83 A;  2D0N A;  2DF6 A;  2K79 A;  3EG2 A;  1X27 A;  3I5R A;  4IIM A;  1BK2 A;  2MOX A;  3REA B;  1LCK A;  3M0Q A;  4LNP A;  2OI3 A;  3I9Q A;  1Z9Z A;  2DVJ A;  3NPF A;  4RTW A;  1AZE A;  1E6G A;  2VVK A;  2KNB B;  4LUE A;  1YN8 A;  1KJW A;  2I0N A;  1K76 A;  1OEB A;  2MIO A;  1UHC A;  3VS4 A;  1JXM A;  1PNJ A;  2DLP A;  2O9V A;  2CT4 A;  1J3T A;  1I07 A;  1RLP C;  1M27 C;  2KT8 A;  1RUW A;  1U3O A;  2D8J A;  4CC4 B;  3TSZ A;  2O88 A;  2EVR A;  3CQT A;  2ESW A;  2DYB A;  2GBQ A;  2JMA A;  3QWX X;  4A63 B;  2V1R A;  2LX7 A;  1AZG B;  2DL8 A;  2VKN A;  4RTY A;  2YSQ A;  2K3B A;  1UGV A;  1T3S A;  1QKW A;  4ZNX A;  1AEY A;  2HBW A;  2PZ1 A;  4OMN A;  4RUG A;  2D1X A;  1PRL C;  1TG0 A;  1OOT A;  4F17 A;  1X2Q A;  2JXB A;  2ENM A;  2J05 A;  4Z8A A;  2F2W A;  1M3A A;  2FEI A;  3EG3 A;  1QKX A;  3PVL A;  3C0C A;  1WXT A;  2LQN A;  1UUE A;  2H8H A;  2FRY A;  1WDX A;  3M0R A;  2DM1 A;  1SEM A;  2RQR A;  1UHF A;  1WLP B;  4RTV A;  4Z89 A;  5IH2 A;  2CSQ A;  1AD5 A;  1SHF A;  2K6D A;  2PNI A;  3SHW A;  1RLQ C;  3H0I A;  1WXB A;  3QWY A;  1WI7 A;  2FG0 A;  4AFQ C;  3KFV A;  1QCF A;  1B3Q A;  2DBM A;  4E6R A;  5EC7 A;  1SHG A;  1YCS B;  2KRS A;  5GJW B;  2C0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...