2K6DA

Cin85 sh3-c domain in complex with ubiquitin
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
62
structure length
62
Chain Sequence
KSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3 domain-containing kinase-binding protein 1
publication title Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain/ubiquitin
total genus 1
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k6dA00
3REAB 2KGTA 4J9FA 4EIKA 2FPDA 2K2MA 1FYNA 1AWOA 3TSZA 1E7OA 5I22A 3ULRB 1NEBA 4RTWA 3M0UA 1UHFA 2AZSA 1QLYA 1T0HA 3NPFA 1GRIA 1X6GA 5IHNA 2DA9A 2NWMA 1N5ZA 5EC7A 4DEXA 2JMCA 2X3WD 2EGEA 2CDTA 1GFCA 2GGRA 2YSQA 2YUOA 1G2BA 1K0SA 3VS7A 2O31A 3M0SA 2GNCA 2FPEA 4OMLA 1FMKA 2LZ6B 2KT8A 4J9GA 2AKLA 2ABLA 1JU5C 2DL8A 4F14A 1SSHA 2CSIA 1HSQA 3CQTA 4AFSC 2DJQA 2KXDA 4CC7A 1KFZA 1H92A 1YCSB 1WDXA 3FJ5A 2RN8A 1GBRA 1AEYA 4IIOA 4JJDA 3H41A 5IXBA 1Z9QA 2KEAA 1CKAA 4J9BA 4LE9A 2ECZA 2H8HA 2VKNA 4J9CA 1AWXA 4WCIA 2F2WA 2P4RA 1AZEA 2BZYA 3LH5A 2K6DA 1JQQA 1MV0B 4GBQA 3EG3A 2PNIA 2RQTA 3PVQA 1ABQA 3VS3A 4GLMA 2K3BA 1RLPC 2K79A 2A08A 1AWWA 1X2QA 4OMMA 4OMOA 1J3TA 1BBZA 4JZ3A 2MCNA 1NM7A 1NG2A 1GBQA 2DILA 2YUPA 1X69A 2KXCA 4KRTA 1S1NA 2DM1A 1U06A 1TUCA 1NLPC 1ZSGA 4RTYA 2B86A 2L0AA 1ABOA 4RTUA 4RTVA 3NMZC 2EBPA 2KRSA 1RLQC 3SEMA 1I0CA 4R0KA 2D0NA 3O5ZA 3NGPA 1NEGA 2KR3A 1SHFA 2V1QA 2YT6A 2BTTA 2O2OA 4HVUA 2CREA 3UA7A 2CT3A 2DF6A 2CH4A 1BK2A 1ZUYA 3SHWA 1OEBA 2AK5A 2EGAA 1X2KA 1E6HA 2BZ8A 4K11A 1VYTA 3TVTA 2F2XA 2D8JA 4J9IA 4RUGA 2EGCA 2QDLA 5HCKA 3M0TA 4J9EA 1AZGB 1M3BA 1SRLA 1YP5A 2OJ2A 2C0TA 1PRLC 1SPKA 4LUEA 1H3HA 1RUWA 1WIEA 2M51A 1ZUKA 2KE9A 1OPLA 2J6FA 2O9VA 1H8KA 2IIMA 2GQIA 4QT7A 1NYFA 3H0FA 2CUBA 3EG0A 2RQWA 2KRNA 4ORZA 4HCKA 1QKWA 1B3QA 1WX6A 1WXTA 1UG1A 2EQIA 1WLPB 4J9DA 1ZUUA 2DVJA 3I5SA 1B07A 3M0PA 1IO6A 1W1FA 2ROLA 1SRMA 1T3LA 4ESRA 4DEYA 2DX1A 1WXUA 2LJ0A 1T3SA 1JEGA 2HDAA 3I5RA 1BB9A 4JZ4A 1QKXA 1HD3A 1WI7A 2KRMA 2V1RA 2DL7A 1AD5A 2M0YA 1GCQA 1NYGA 3UA6A 2LMJA 3VS1A 1HJDA 2EYWA 2RNAA 2EPDA 1SHGA 3I9QA 4D8KA 1JXOA 1OPKA 1QWFA 2DBKA 2JXBA 3REBB 1ZX6A 2X3XD 1UGVA 2K9GA 4CC3A 1PKTA 2J6KA 1ARKA 3NHNA 1UJ0A 1KIKA 1PRMC 4Z8AA 3H0IA 2EVRA 2JM8A 2DLPA 1AVZC 2YDLA 2NUZA 2O88A 2DL3A 4FSSA 3VS6A 4HVWA 4A63B 2A37A 2VVKA 4JJBA 2I0NA 2YUQA 3QWXX 4CC2A 1UUEA 2FRYA 3UF4A 2L2PA 1U3OA 2FO0A 2CH4W 3PVLA 2SEMA 1QWEA 4E6RA 5I11A 1EFNA 5FWBA 1QCFA 1I07A 1UE9A 1YNZA 2J06A 1CKBA 3PE0A 1WA7A 1T0JA 2W0ZA 3VRYA 3VS2A 1JXMA 2FG0A 2RQVA 1WXBA 1Y0MA 2C0OA 2LQNA 1LCKA 2AZVA 1K9AA 3EGUA 1XOVA 4X1VA 2CUDA 3IQLA 2ENMA 2J7IA 1UJYA 4IIMA 1I1JA 2L3PA 3UATA 2SRCA 1JO8A 2DNUA 2D1XA 2KYMA 1BU1A 2EYZA 3VS5A 2DRMA 1K0XA 1K4US 2DBMA 5GJVB 2JT4A 2MIOA 4LUDA 2RQUA 1PKSA 1WFWA 3RBBB 3EG1A 2JMAA 2F2VA 1PWTA 3VS0A 2RMOA 3EHQA 1E6GA 1VYVA 4OMNA 1M3AA 2RF0A 2J6OA 2JW4A 2JS0A 3KFVA 1W6XA 1X43A 1YWOA 1ZBJA 1W70A 4OMQA 1UDLA 3I35A 4AFZC 2W10A 2LNHB 2J05A 2OI3A 1MUZA 2K7AA 2JTEA 2A28A 3QWYA 2ED1A 1K1ZA 2RPNA 2HCKA 1PNJA 2KT1A 2D8HA 1YWPA 1M27C 2GTJA 2HSPA 2AKKA 2FRWA 1OOTA 1WYXA 4F17A 1OV3A 3U23A 5GJWB 4AFQC 1GCQC 1M3CA 2EKHA 1Z9ZA 2FPFA 2LCSA 1M30A 2LQWA 4LN2A 3H0HA 2MOXA 5FW9A 2DMOA 2LP5A 2PTKA 4AG1C 2C0IA 2O9SA 4HVVA 1A0NB 2RQRA 1PHTA 5ECAA 2LX7A 1AWJA 2LJ3A 5IHKA 4HXJA 1U5SA 1KJWA 2KBTA 4F16A 2VWFA 3GBQA 3VS4A 1GFDA 2ROTA 1M8MA 2DL4A 1V1CA 2CSQA 1ZLMA 2E5KA 4JPBW 2A36A 1RI9A 3M0QA 1UHCA 5L23A 2DL5A 1KSWA 1NLOC 3THKA 3M0RA 3C0CA 5FWCA 2KNBB 2GBQA 5IHIA 2L3QA 3EG2A 1VA7A 4RTXA 2DRKA 1VYUA 4RTZA 2BZXA 3TSWA 4Y92A 4Z89A 3ZL7C 2G6FX 1K76A 1TG0A 2YUNA 4AG2C 1X6BA 1UTIA 3JV3A 4CC4B 3VRZA 2CT4A 3R6NA 1UECA 2HEQA 5IXFA 2KYBA 5IH2A 1TUDA 2KROA 1CSKA 3EHRA 4AFUC 2GTOA 2FEIA 3A98A 4Z88A 4D8DA 2ED0A 4M4ZA 1GL5A 2EYXA 2ESWA 2PZ1A 1AOJA 1MV3A 1Y57A 2XMFA 4JJCA 1UFFA 2DYBA 4LNPA 1G83A 2JS2A 2HBWA 2L3SA 1YN8A 2DE0X 1GCPA 4OMPA 4RTTA 2JM9A 4ZNXA 2LJ1A 2EYYA 4J9HA 2OAWA 3RNJA 2EW3A 1SEMA 1X27A
chains in the Genus database with same CATH superfamily
2KGTA 3EGDB 1KC8U 4FW1A 3JCMJ 1E7OA 5I22A 3ULRB 1GXIE 4A4KA 1KD1U 4RTWA 2K5IA 1UHFA 5DM7R 1WNLA 1G5VA 1GRIA 1ACMB 1VQMT 2EGEA 2CDTA 3L2RA 4M7DC 3M0SA 4OB0B 4OMLA 4M7DG 2ATCB 5KYNA 2VB6A 2A3LA 2EQUA 1FMVA 4J9GA 2AKLA 1JU5C 1TWBA 3AHUA 1SSHA 3BW1A 3CQTA 1H92A 1OYXA 2DPPB 3PFSA 1GBRA 4JJDA 3H41A 1MNDA 1FWZA 5CK9A 2VXFA 1RI0A 1NPPA 3CPFA 4IURA 4WCIA 2MWPA 2P4RA 1AZEA 5DLQE 1QVPA 1JQQA 1MV0B 1D09B 5GMKj 3CCLT 2P0KA 4M7AD 1FXXA 1G3WA 1PD1A 2CP7A 4PJOB 4E7KA 2RJFA 2NUTA 3VS3A 3CCJA 3GOXA 4GLMA 3S3MA 2K3BA 4C5IA 3JB9I 4OMMA 4OMOA 4KGZB 1M8VA 1SKUB 4JZ3A 1K8AC 4MZPA 1NG2A 3CCJQ 3JCMh 1X69A 3TEEA 5LJ3j 2RM4A 3PMTA 1BKBA 2DM1A 2PUKB 1VQ9A 2MWOA 1ZSGA 2JJ9A 2B86A 4RTYA 3QJ6A 4ANJA 4M7AF 4RTUA 2JVVA 5LJ5d 3NMZC 2EBPA 2YLBA 2KRSA 1RLQC 3SEMA 2QQSA 2M02A 1YJWA 3CCQA 1VQ9Q 2JTFA 4F7UB 2E65A 1NEGA 2V1QA 2MYSA 3UA7A 2EQKA 2ZZDA 2DVEA 3JCMQ 3CC4T 4ZN3A 2MAMA 4J8OA 2JN0A 1X2KA 2BZ8A 4XQ3A 1YJWQ 3CCQQ 4JRKA 1I4K1 4K11A 2RI5A 3TVTA 4C0ZA 2BUDA 2D8JA 3RKXA 4RUGA 4KGVB 1WHJA 2QDLA 3FB9A 4RG2A 5GAN4 5HCKA 3M0TA 1UB4A 4J9EA 1M3BA 3J81E 1VQKT 3EFOA 2H3JA 6AT1B 3G4SA 2HMAA 2C0TA 1SPKA 3QDRB 4LDUA 1IXDA 1ZUKA 3CXCS 4E2FB 1TXQA 1VQOQ 2IIMA 2GQIA 1M2VA 4QT7A 3G4SQ 3OYEA 1ZSZA 3MPUB 1WZOA 2JNGA 2EQIA 3L2ZA 1WLPB 4HA8A 1IGQA 3M0PA 3OBYA 1IO6A 3X28B 2OX7A 1T3SA 2RK2A 1G3YA 2DAQA 4O6JA 2CZ1B 2V1RA 2CZ7B 1V76A 5EG2A 2DEQA 3DLLA 1Q81U 3UA6A 2LMJA 3WVEB 2EYQA 4C0FA 3CMAT 4M78C 3HRSA 4D8KA 2C06A 1KC8R 3QZ9B 5GAN2 2Y4YA 1QP2A 3GLXA 5LJ3e 5AYFA 3GP8A 3G71T 4HKEA 5GMKl 2GFUA 4LDXA 1XNIA 2J6KA 2OTLA 4EMGA 3UPUA 1H3ZA 4HCCA 1UJ0A 3QUIA 3V7CA 3OMCA 1NJIU 1D0XA 3H0IA 3RIRA 4FT4A 2OTLQ 1QCNA 2DZCA 2O88A 2DL3A 4FSSA 1W2BS 2A37A 1YJ9T 4M7AB 2I0NA 2YUQA 3GNFB 2FRYA 1BIAA 2FO0A 2KDSA 3PVLA 2E6ZA 2E70A 5I11A 1QCFA 2VXEA 3X24B 3FC3A 3MJXA 5LJ5e 1CKBA 1T0JA 1JXMA 3OS5A 2C0OA 1K9AA 3OYKA 1XOVA 2ENMA 4C0GA 2XKOC 1Y96A 1I1JA 5FU6B 2BE9B 5KYWB 5A2QE 3S3OA 4DQ2A 3VS5A 2QASA 1K4US 1B7TA 3QIIA 4XAXB 5CKFA 3MEVA 4ZGDB 4RMOA 3EG1A 4A4FA 3BE3A 4BB7A 2F2VA 3AT1B 2QQAA 4L5GA 2RMOA 3E2UA 4EMKC 1VQNT 3I55T 2VGNA 1X43A 2QGGA 3RESA 1XJWB 1ZA1B 1KG1A 5A0GA 5GAMj 4M75A 4ATOA 2J05A 2K57A 2M1HA 4OP0A 4GLKA 3LX7A 2K3YA 4ZTFA 3UDCA 1M90C 3CMEA 1YWPA 3LWIA 4RCBA 1GCQC 1EZZB 2EKHA 4NOYA 1M4ZA 4X34A 5FRMA 2H3EB 3H6ZA 5FW9A 4AG1C 3CCUA 2O9SA 4HVVA 2CP0A 1G3SA 4M7DA 1KK7A 2A0FB 3LYIA 3MHXA 3OYAA 2KBTA 4F16A 1UEBA 2KSSA 3M53A 2RJCA 3VS4A 5KYYB 5GAN8 4JPBW 1AHJB 4KH1B 1RI9A 1EIFA 3FJPA 1FX7A 1KSWA 1NLOC 3PNWC 4KUDK 3MKDA 1NZ9A 5GANd 2GBQA 2M0OA 2GQVA 5J39A 5IHIA 3EG2A 3TSWA 4RTZA 2DRKA 1VYUA 5HK3A 4Y92A 4DA4A 3G7ZA 1QMCA 3M4GA 3JCMg 3CPWS 4AG2C 3OSVA 4J6YA 1VQ4T 3ZBDA 4Q5WA 3JV3A 3M5AA 3JCMc 5CAIA 3HHTB 3C95A 2CT4A 4FYYB 2F5KA 4LDVA 2HD0A 3QG1A 3R6NA 4XTXA 1MMAA 3OBWA 5LJ3f 1YITT 5IH2A 4C5GA 1YFNA 4C0DC 4XU1A 5GANj 2NUPB 3JCMb 3CC7A 3A98A 2FB7A 2RD1A 5GAMe 4M4ZA 1GL5A 2EYXA 4PFPA 4ME7A 1VQ7T 2CZ0B 4JJCA 1KQ2A 4LNPA 1G83A 5HY6A 3CC7Q 4C92D 4QKUA 2I2LA 4WTOB 1IZ6A 4KT0E 3SB2A 3OYCA 2PU9B 4BDYA 4ZNXA 1LPLA 4PNOA 1MMDA 3QXEB 4J9HA 2OAWA 1QVFS 2DXCA 4A4EA 1YI2A 4C92F 2RHZA 5CQXA 1N6AA 1KHCA 4A4HA 1D3BA 2FPDA 2K2MA 1FYNA 3LGLA 3VYGA 3FEOA 1D1BA 1NEBA 3EGXA 1YHQT 1YI2Q 2AZSA 4QVZA 1QLYA 2F69A 4BI3A 3RMQA 4A4GA 2IG0A 2MMPA 2EWNA 4NL3A 2NWMA 9ATCB 5EC7A 1GFCA 3CC2T 2MK5A 4XU3A 2DD5A 2GNCA 2XDDA 2P0QA 1FMKA 2LZ6B 4B9WA 1YJNA 3EAEA 4M77D 5CCAA 2DL8A 2D9TA 2CSIA 4LD9K 2KXDA 1VQ6A 2X4JA 1YJNQ 3FJ5A 1AEYA 4IIOA 5IXBA 1Z9QA 1RADB 1CKAA 1PG5B 2ECZA 4FSXA 2H8HA 4M78A 1S72T 2VKNA 1AWXA 1XTDA 2F2WA 1VQ6Q 4M77F 5GANe 3SWNB 4IUVA 2K6DA 4GBQA 2QTVA 3VKIA 3META 2LT4A 4DBHA 2K79A 1AWWA 5CQYA 5GAN6 5KH6A 1J3TA 1BBZA 2WACA 4KULA 2YUPA 2QEXT 1QVGP 3LH0A 1NLPC 4C8QE 2L0AA 1ABOA 4PFOA 3EG9A 3M57A 1IGUA 3EFSA 4R0KA 3O5ZA 1QVFA 2QA4A 5A0LA 1TH7A 2CREA 1MGQA 1WHKA 5FU7B 2D0QB 3A8MB 4DBQA 3JB9J 1OEBA 3A8GB 2EQMA 5GAN5 2F2XA 5IAYA 3G6ET 3CEYA 3NTKA 2CYZB 1LNXA 4C92B 3CMAQ 1X01A 1JB0E 5A0DA 1M1KR 1RAHB 4XTWA 3OYHA 1VQ5T 2PVDB 5KYUB 2GF7A 4BACA 3H0FA 1RACB 3SD4A 3TU4K 3MP6A 2CUBA 3EG0A 5GAMf 4EMKA 1Y07A 5CKDA 4HCKA 3M9QA 4J7IA 1B34B 3PIOA 1UG1A 3I56A 2OTJA 4XTZA 1ZUUA 1TSFA 1VQPA 2EJFA 2DZ9A 1U8RA 1R8OB 1T3LA 2ZPBB 3I56Q 2OTJQ 2LJ0A 2AT1B 1PM3A 3PGGA 3A8OB 4JJNK 2HAXA 3CCET 2HKNA 1QKXA 1WI7A 1VQPQ 3X20B 2G3RA 2O4XB 1GCQA 2RNAA 5GMKi 3GPLA 3CCMA 1SHGA 1YBYA 4OB3B 1OPKA 1QWFA 4M77B 4AT1B 3REBB 2DO3A 3CCMQ 1WHGA 2E4HA 2ZPEB 1VQLT 4ELZC 4QVDA 1ARKA 3QHSA 1KIKA 4PJOE 2IPOB 1PRMC 4Z8AA 8ATCB 3QPHA 4JLIA 2JM8A 5GAN3 2YDLA 3PTAA 4DBRA 4HVWA 2BIVA 2RA2A 2RI2A 3QWXX 3CBMA 3DB4A 5CKBA 5FLXE 1U3OA 2AHJB 3M4YA 2SEMA 2Y90A 3HRUA 4N0AC 4E6RA 4C8QC 3PE0A 1Q7YC 2X35A 1M1FA 4FYVB 4F7UE 1YCYA 2FG0A 3ZFJA 3M58A 4C8QG 1OU8A 2LQNA 1LCKA 3DLMA 1KHIA 3EGUA 5KE2A 3L2QA 1UJYA 5HK0A 1W4SA 4IIMA 2KI7A 3UATA 3CCRA 3CCVA 2DNUA 1U1SA 2RO0A 1BU1A 2EYZA 3DB3A 4XU2A 5GAOl 1VQOA 4E7ZA 2DBMA 4HT9A 4E7LA 4FW2A 4LUDA 3JRZA 1WFWA 1OZ2A 3RBBB 5LJ5j 1KD1C 1EX4A 3CCRQ 3CCVQ 2BE7D 4RG8A 1PWTA 4E47A 1F1BB 1VQ8T 1E6GA 1OI1A 1VYVA 4J7FA 2CZ6B 1JJ2P 3CD6A 3C12A 4OF1A 2JS0A 1ZBJA 3SFMA 5AT1B 3CCSA 4BE1A 2EIFA 4FL6A 2COZA 2B8AA 1MUZA 3CXCP 1C1AA 3CD6Q 1WGSA 5GAOp 2ZGWA 3CCSQ 5KYXA 2HCKA 5I21A 4FYXB 1KQSP 5DLOA 3WVDB 2NLUA 1UGQB 2HSPA 1K8AR 2AKKA 2FRWA 2QQRA 3OW2P 4F17A 3U23A 4PLIA 1M3CA 3M55A 1LOJA 2HQXA 3D7SB 3H0HA 4OGCA 2MOXA 2PTKA 2RJEA 4AMCA 2E5QA 2MPXC 2RB6A 5IHKA 1M90U 4HXJA 1U5SA 2RJDA 4BY6B 2K5FA 2FZKB 2ROTA 1WJSA 2ZCFB 2LX9A 1VOMA 3QJYA 2CSQA 1ZLMA 2VC8A 2E5KA 1MNEA 2A36A 2M16A 2EJ9A 2YXYA 3L2WA 3OYMA 5L23A 1IB8A 4BD3A 3EH1A 2X4WA 5KYYA 2NUTB 4PJOC 3ER0A 3OA6A 2E3IA 2BZXA 4PJOG 2G6FX 3KXTA 4FT2A 4M7AE 2YUNA 3GNGA 2QDYB 2LT1A 2DJZA 1PSEA 3QYHB 3JCMd 5KCHA 1UECA 4BE0A 1M9SA 3RUXA 1TUDA 2LNVA 4MDXA 1V29B 3QBYA 3INZA 4F7UG 1OQKA 2ESWA 2PZ1A 4B9XA 2FHDA 2XIDA 1YIJA 2E41A 3ME9A 8AT1B 5M9OA 2QK0A 1GCPA 4E7IA 3EFOB 4BDZA 4OMPA 4M75D 3L2VA 1M2OA 1SG5A 1YIJQ 2JM9A 4IUTA 1PCXA 3FRNA 4II1A 2DERA 1KQSA 3M59A 2HL3A 5CIUA 1M2VB 4ZTJA 2KK4A 1BIBA 2LTOA 2VGMA 3HTRA 2DYIA 3P8DA 1ZSZB 3OS2A 1D1AA 1AT1B 1QP3A 3REAB 5J3BA 4Z02A 1BI1A 4J9FA 3CCJT 4EIKA 4M75F 1AWOA 1S72Q 1M1GA 5GMKm 5L8RE 4WF2A 5LL6S 1T0HA 2HZYA 1X6GA 5IHNA 4M7DD 1WHLA 2V8KA 1VQ9T 1N5ZA 4JRPA 1RAAB 2X3WD 2YSQA 2XG8D 2O31A 2KAFA 2CP3A 3HL8A 2KT8A 2EFIA 3H8ZA 3CCQT 1YJWT 3TREA 2GCXA 4M7DF 4AFSC 1KFZA 3MEAA 1WDXA 4UC4A 1WPYA 5C6SA 3HP9A 2DTOA 3X26B 4OMFB 3VYHB 2VYTA 4J9CA 3G4ST 2HNIA 3LH5A 1SSFA 4E7SA 3CBPA 4JRQA 3EG3A 3TQ7P 4XK8E 2RQTA 1N9RA 3A8HB 2ZPGB 4M7AC 2A08A 3JCMe 3OYDA 3OYFA 4M7AG 2MCNA 1M1KU 3JCMW 1VQ5Q 5CR2A 1NM7A 4EMHA 1GBQA 2DILA 2P4TA 1M90R 2KXCA 4KRTA 4J6XA 1VQMA 2KQWA 1I81A 3VV0A 4OB2B 2CP5A 1Y96B 3QZ5B 5FU6C 4N0AA 1VQMQ 2KR3A 2YT6A 2BTTA 4C8QA 2DF6A 4L6V5 1I5OB 2PVOB 4ZN1A 2AK5A 4PLLA 3NTIA 4B6MA 2E3HA 4Y28E 5IT9E 2CKKA 1VYTA 2DXUA 1Q86C 3QYGB 4J9IA 1MMNA 1N27A 1AZGB 1FMWA 3FLGA 1BI0A 5LJ5f 1YP5A 2OJ2A 1N8RC 1R0BG 4PKCC 2OTLT 1PRLC 1H3HA 1HYOA 2R58A 3OSSC 2KE9A 4M75B 3CCLA 1JRIA 1OPLA 1UGRB 2J6FA 2O9VA 3QSUA 1H8KA 1NYFA 1Q82C 4BI8B 2RQWA 4ORZA 3BFMA 3LGFA 1QKWA 1K73C 3CCLQ 3LWHA 5KYUA 3EGDA 4TVRA 2LRQA 3OYJA 4DOVA 4J9DA 2DVJA 1SRMA 4R56A 4DEYA 2DX1A 2WSFE 1VUBA 1M5Q1 3PMIA 3OY9A 1JEGA 4QQ6A 1BB9A 4M7DB 3VJPA 2LDMA 3OQ5A 2M0YA 1NYGA 1ZQ1A 4M78D 3VS1A 4C5EA 5GMKh 5KE3A 2EYWA 1U1TA 3EFRA 3CC4A 4J5YA 2EPDA 3JCMV 1BI3A 2COWA 3S3NA 1JXOA 3HKSA 3N5BB 2DBKA 4CI0C 2O4XA 1G8XA 1NPRA 1VQKA 2CGHA 3CC4Q 2F5TX 2K9GA 2VV5A 4JUVA 4CC3A 1PKTA 2JUFA 5LJ3h 3NHNA 2ZAEA 4M78F 2P84A 1BI2A 1Q86R 1VQKQ 3OYGA 2EVRA 1P92A 1N8RR 4F04B 1VQ8Q 1RL2A 1ZBXA 4A63B 4PJOA 2VVKA 2V8IA 3J80E 2L8DA 4CC2A 2QQBA 1UUEA 3UF4A 3VUBA 1Q82R 2HQEA 2CH4W 3CMET 1QWEA 1OULA 5FWBA 1K73R 2J06A 1UE9A 4XTUA 5GAN7 2XD0A 2DXTA 3VS2A 1UGSB 1Y0MA 1WHMA 2VUBA 4X1VA 2CUDA 1H641 3IQLA 1VIEA 3CCUT 2K2VA 3J7AF 3R6OA 4FU6A 3A8LB 1K8AU 3CMAA 2HSEB 2EAYA 2DETA 2XI9A 4F7UA 2D1XA 3P8BB 2DK3A 2DRMA 4MDWA 1K0XA 2JT4A 4PL6A 2K4YA 2RQUA 3HFNA 1PKSA 3G71A 1X27A 4C92E 4D6WA 1C6VX 2JMAA 4QQDA 2IVWA 3EHQA 1M3AA 1ZA2B 2LCCA 3V7SA 2JW4A 3JCMP 1NBEB 3G71Q 5HKCA 4OMQA 1W70A 1UDLA 4PFZA 4KUIA 4JDSA 1ZHIA 3I35A 3A1PA 2W10A 1RAEB 3EGXB 2P0PA 2OI3A 4MZMA 2JTEA 2WSEE 1YJ9A 1K9MC 3QWYA 4IUQA 2E12A 5C0MA 2COYA 2DEUA 2D6FA 2RI3A 2D8HA 3OYBA 2GTJA 3LLRA 1YJ9Q 4E7HA 1OOTA 1PSFA 1WYXA 1IRXA 1IREB 1OV3A 4AFQC 5FROA 1O75A 4QQGA 3LW5E 4BI4A 3CC7T 3EH2A 4J83A 3BY7A 2X4XA 4KBMB 2HBPA 4N4GA 1PHTA 3MCAB 1R77A 5FRNA 4M77E 2LJ3A 3JB9D 1KJWA 1QQJA 4EDUA 3QO3A 4M78B 4M78E 2DL4A 1OU9A 2E6NA 3G1JA 4A53A 1QVGA 3S6WA 2E64A 1R0CB 3SWNC 3Q1JA 2DL5A 4V2SA 1VQNA 5LJ3d 3I55A 4FYWB 3M0RA 3C0CA 5FWCA 2KNBB 2L3QA 1SF9A 3JB9F 3ZL7C 1YI2T 5J26A 3RR6A 1VQNQ 3I55Q 1X6BA 3OMGA 2GFAA 2DD4A 2E10A 4MMKA 5GAOn 3VRZA 3H9NA 4CRIA 4M7AA 1Q95G 3EG9B 1K9MR 4RKUE 4J6WA 1KQ1A 1MHNA 2KROA 5GANf 3MP8A 2GTOA 2YLCA 3CBOA 3RKWA 2FEIA 4MMLA 2X4YA 2XU8A 2ED0A 5FU7C 1MMGA 1Y57A 2XMFA 1PD0A 1YJNT 1D0YA 1KC8C 2EJGA 1BYMA 4XU0A 2JS2A 2LQ8A 2CS7A 4FIBA 5GAMh 2L3SA 1WJRA 2RHXA 5KYWA 4LD6A 1VQ6T 3VUZA 2X9HA 4C92C 3BDLA 4OB1B 3M54A 4C92G 1JJ2S 3O8VA 2LJ1A 2EYYA 3E19A 1TTHB 3HRTA 2EKOA 4EMKB 1Y71A 3OB9A 2EW3A 2QG9B 3NTHA 5CVIA 1VQ4A 3TSZA 2YRCA 5KCOA 4RCCA 3M0UA 1KQSS 4Y91A 2FYKA 2PQWA 2LQKA 3NPFA 2DA9A 3OW2S 1VQ4Q 3V8JA 3QDFA 3V8LA 1YITA 4JRIA 1X75C 1IHVA 2JMCA 4DEXA 2GGRA 2YUOA 1K0SA 1G2BA 5IN1A 5GAOq 3MEUA 3VS7A 2FPEA 1O9SA 1Q7YR 4DOWA 1YITQ 5GMKe 1VQ7A 2QA4T 3HPWA 2ABLA 2QGFB 3OS0A 4F14A 1HSQA 4M77C 2DJQA 1G3TA 2YRDA 4CC7A 5LJ3g 1YCSB 5D6XA 3V7RA 1TU0B 1VQ7Q 4M77G 1WJQA 2RN8A 1BCMA 4P5NA 2XHCA 4XTVA 2KEAA 4J9BA 4LE9A 4JS4A 4M78G 1KD1R 3VU3C 2BZYA 3L1AA 3WXMB 3OYNA 2PNIA 3OYYA 1JBMA 5GAOm 2QYZA 3PVQA 5GANh 1ABQA 3RKYA 1RLPC 4C5HA 2BKDN 5D6WA 4IKFA 1X2QA 3MP1A 1YHQA 2LC4A 1W2BP 2DFUA 4N4HA 3HSBA 1Y7XA 2XDPA 3I56T 2OTJT 2CP6A 2HQHA 1S1NA 5LJ5g 1U06A 1TUCA 1VQPT 1YHQQ 2KMTA 3CC2A 2FZCB 4RTVA 3ASKA 1JJ2A 1RAGB 4PJLA 1PC0A 3RDVA 1I0CA 4C0DB 2V26A 5DY9A 2D0NA 4ZGJB 2L89A 1SHFA 4KH0B 4PJNA 4HVUA 2O2OA 2DIGA 2XICA 2XK0A 2NUPA 3CC2Q 2K3XA 2CT3A 4L59A 3CXCA 2CH4A 1BK2A 4HT8A 1ZUYA 2O01E 3SHWA 5GAMd 2EGAA 3CCMT 1E6HA 1BCOA 5I2SA 2FZGB 2EGCA 2L3RA 1SRLA 3OW2A 1S72A 2R57A 2DXBA 4LUEA 1RUWA 1WIEA 1WHHA 2M51A 3M56A 3SDZA 2Z0WA 3KBGA 1C0MA 3FIFA 2HL5C 3OYIA 3JB9H 1Q81C 5KYXB 2E1HA 2KRNA 4ZGEB 1B3QA 1WX6A 3KUFA 1WXTA 2RHYA 2LCLA 2QQ9A 3I5SA 1Q86U 1B07A 2QEXA 4A54A 1W1FA 3V8KA 1QW1A 2ROLA 3TCJA 4LXCA 4QW2A 3FDRA 4ESRA 1N8RU 1WXUA 3MO8A 5CKEA 2HDAA 2QI2A 3I5RA 2QEXQ 4JZ4A 1HD3A 3RMSA 2KRMA 1NJIC 2DL7A 1XQHA 4O5VA 1AD5A 3CMEQ 1Q82U 1OX8A 1HXDA 2LVMA 4BY6C 1HJDA 4PJMA 3CCRT 1K73U 3CCVT 5GAOr 2EQJA 3I9QA 4FCYA 1VQOT 2JXBA 3G6EA 3PT9A 3E1SA 1ZX6A 2K5LA 5D6YA 1W2BA 2X3XD 1UGVA 7AT1B 3CCUQ 4QVCA 1OX9A 2QAZA 2PUOB 2AIRB 1VQ5A 3CD6T 3JB9G 3G6EQ 1RAIB 3DKMA 3C94A 1I5LA 3CCST 2YHTA 3SWNA 2DLPA 1AVZC 1D0ZA 3CPWP 2NUZA 2DIQA 3VS6A 3GIBA 1NE8A 4IUPA 1DJ7B 4JJBA 4JS5A 4VUBA 2L5QA 1VIFA 2L2PA 4ELYC 4DBFA 4C8QD 1Q81R 1EFNA 2V8JA 4YTLA 3UT1A 1I07A 1YNZA 2YWWA 1WA7A 3VRYA 2W0ZA 2RQVA 1WXBA 3CCEA 2AZVA 5GAMg 3JSCA 1UGPB 2RH2A 2J7IA 2YRVA 2XDBA 2Y4XA 2L3PA 2SRCA 4C8QF 1JO8A 1TOVA 3E9FA 3CCEQ 2KYMA 1RABB 4BE2A 2ZPHB 2DTHA 2VASA 1NJIR 2OAUA 5GJVB 2MIOA 3VS0A 2DTIA 4M75E 1VQLA 3L2UA 3GF5A 2MI6A 3URGA 1ZSZC 4OMNA 2RF0A 2J6OA 3C4SA 2WSCE 3KFVA 1W6XA 1YWOA 5D7UA 4C92A 3BDUA 1QVFP 4AFZC 1WQWA 2LNHB 4X9CA 1VQLQ 4PK4A 2K7AA 4XTYA 2A28A 2ED1A 4NS5A 3NFCA 1K1ZA 2R5AA 2RPNA 2FVUA 1PNJA 1X6OA 2KT1A 2A7YA 3UWNA 4FM4B 2QXFA 4E7JA 1M27C 3A5ZB 1B34A 2CP2A 3X25B 3P8HA 1OZ3A 5GJWB 4M7DE 2JOYA 3F70A 1TS9A 4MZTA 1Z9ZA 2FPFA 3L42A 2LCSA 1M30A 2LQWA 4LN2A 3RERA 2M9UA 2DMOA 2LP5A 2JTMA 2C0IA 1A0NB 2RQRA 4LDYA 3MEWA 4IUUA 2ZPIB 5ECAA 1YIJT 1K9MU 2LX7A 2MF2A 1AWJA 1LVKA 1RAFB 2VWFA 1WQ7A 4X9DA 3GBQA 3CPWA 1GFDA 4BUGA 1M8MA 1LJOA 1IHWA 1V1CA 2ZPFB 2JZ2A 4OGEA 1M1KC 1VQ8A 3M0QA 1UHCA 4M77A 5GANg 4PJOD 2KVQG 3THKA 3JAME 2RK1A 4GY5A 3OS1A 2R5MA 1VA7A 1I8FA 4RTXA 4Z89A 1K76A 1TG0A 4KGXB 2RHUA 4HCBA 1TUGB 1QVGS 1UTIA 4CC4B 4PJOF 4JLGA 1N9SA 4NL2A 2HEQA 5I2MA 3E9GA 5IXFA 2FL7A 2KYBA 3OYLA 1CSKA 4PJJA 2RHIA 5LJ5h 3JCMX 3EHRA 1D1CA 4AFUC 4HCZA 4C8QB 4N4IA 2KY9A 1HK9A 4Z88A 4D8DA 5CO7A 4OVAA 1AOJA 1MV3A 3ZEHA 3T9NA 1UFFA 4LDWA 3JCMf 2DYBA 4EPCA 3HFOA 2HBWA 4F7UF 3PIPA 1YN8A 2F1LA 2DE0X 2NYSA 2DKGA 4RTTA 1Q7YU 3QKJA 2QA4Q 2PVGB 5CKHA 4M75C 1D3BB 2X51A 4M75G 3RNJA 2HKQB 2QTXA 1SEMA 3NGPA 4R55A 1QCOA
chains in the Genus database with same CATH topology
3REAB 2KGTA 4J9FA 4EIKA 2FPDA 2K2MA 1FYNA 1AWOA 3TSZA 1E7OA 5I22A 3ULRB 1NEBA 4RTWA 3M0UA 1UHFA 2AZSA 1QLYA 1T0HA 3NPFA 1GRIA 1X6GA 5IHNA 2DA9A 2NWMA 1N5ZA 5EC7A 4DEXA 2JMCA 2X3WD 2EGEA 2CDTA 1GFCA 2GGRA 2YSQA 2YUOA 1G2BA 1K0SA 3VS7A 2O31A 3M0SA 2GNCA 2FPEA 4OMLA 1FMKA 2LZ6B 2KT8A 4J9GA 2AKLA 2ABLA 1JU5C 2DL8A 4F14A 1SSHA 2CSIA 1HSQA 3CQTA 4AFSC 2DJQA 2KXDA 4CC7A 1KFZA 1H92A 1YCSB 1WDXA 3FJ5A 2RN8A 1GBRA 1AEYA 4IIOA 4JJDA 3H41A 5IXBA 1Z9QA 2KEAA 1CKAA 4J9BA 4LE9A 2ECZA 2H8HA 2VKNA 4J9CA 1AWXA 4WCIA 2F2WA 2P4RA 1AZEA 2BZYA 3LH5A 2K6DA 1JQQA 1MV0B 4GBQA 3EG3A 2PNIA 2RQTA 3PVQA 1ABQA 3VS3A 4GLMA 2K3BA 1RLPC 2K79A 2A08A 1AWWA 1X2QA 4OMMA 4OMOA 1J3TA 1BBZA 4JZ3A 2MCNA 1NM7A 1NG2A 1GBQA 2DILA 2YUPA 1X69A 2KXCA 4KRTA 1S1NA 2DM1A 1U06A 1TUCA 1NLPC 1ZSGA 4RTYA 2B86A 2L0AA 1ABOA 4RTUA 4RTVA 3NMZC 2EBPA 2KRSA 1RLQC 3SEMA 1I0CA 4R0KA 2D0NA 3O5ZA 3NGPA 1NEGA 2KR3A 1SHFA 2V1QA 2YT6A 2BTTA 2O2OA 4HVUA 2CREA 3UA7A 2CT3A 2DF6A 2CH4A 1BK2A 1ZUYA 3SHWA 1OEBA 2AK5A 2EGAA 1X2KA 1E6HA 2BZ8A 4K11A 1VYTA 3TVTA 2F2XA 2D8JA 4J9IA 4RUGA 2EGCA 2QDLA 5HCKA 3M0TA 4J9EA 1AZGB 1M3BA 1SRLA 1YP5A 2OJ2A 2C0TA 1PRLC 1SPKA 4LUEA 1H3HA 1RUWA 1WIEA 2M51A 1ZUKA 2KE9A 1OPLA 2J6FA 2O9VA 1H8KA 2IIMA 2GQIA 4QT7A 1NYFA 3H0FA 2CUBA 3EG0A 2RQWA 2KRNA 4ORZA 4HCKA 1QKWA 1B3QA 1WX6A 1WXTA 1UG1A 2EQIA 1WLPB 4J9DA 1ZUUA 2DVJA 3I5SA 1B07A 3M0PA 1IO6A 1W1FA 2ROLA 1SRMA 1T3LA 4ESRA 4DEYA 2DX1A 1WXUA 2LJ0A 1T3SA 1JEGA 2HDAA 3I5RA 1BB9A 4JZ4A 1QKXA 1HD3A 1WI7A 2KRMA 2V1RA 2DL7A 1AD5A 2M0YA 1GCQA 1NYGA 3UA6A 2LMJA 3VS1A 1HJDA 2EYWA 2RNAA 2EPDA 1SHGA 3I9QA 4D8KA 1JXOA 1OPKA 1QWFA 2DBKA 2JXBA 3REBB 1ZX6A 2X3XD 1UGVA 2K9GA 4CC3A 1PKTA 2J6KA 1ARKA 3NHNA 1UJ0A 1KIKA 1PRMC 4Z8AA 3H0IA 2EVRA 2JM8A 2DLPA 1AVZC 2YDLA 2NUZA 2O88A 2DL3A 4FSSA 3VS6A 4HVWA 4A63B 2A37A 2VVKA 4JJBA 2I0NA 2YUQA 3QWXX 4CC2A 1UUEA 2FRYA 3UF4A 2L2PA 1U3OA 2FO0A 2CH4W 3PVLA 2SEMA 1QWEA 4E6RA 5I11A 1EFNA 5FWBA 1QCFA 1I07A 1UE9A 1YNZA 2J06A 1CKBA 3PE0A 1WA7A 1T0JA 2W0ZA 3VRYA 3VS2A 1JXMA 2FG0A 2RQVA 1WXBA 1Y0MA 2C0OA 2LQNA 1LCKA 2AZVA 1K9AA 3EGUA 1XOVA 4X1VA 2CUDA 3IQLA 2ENMA 2J7IA 1UJYA 4IIMA 1I1JA 2L3PA 3UATA 2SRCA 1JO8A 2DNUA 2D1XA 2KYMA 1BU1A 2EYZA 3VS5A 2DRMA 1K0XA 1K4US 2DBMA 5GJVB 2JT4A 2MIOA 4LUDA 2RQUA 1PKSA 1WFWA 3RBBB 3EG1A 2JMAA 2F2VA 1PWTA 3VS0A 2RMOA 3EHQA 1E6GA 1VYVA 4OMNA 1M3AA 2RF0A 2J6OA 2JW4A 2JS0A 3KFVA 1W6XA 1X43A 1YWOA 1ZBJA 1W70A 4OMQA 1UDLA 3I35A 4AFZC 2W10A 2LNHB 2J05A 2OI3A 1MUZA 2K7AA 2JTEA 2A28A 3QWYA 2ED1A 1K1ZA 2RPNA 2HCKA 1PNJA 2KT1A 2D8HA 1YWPA 1M27C 2GTJA 2HSPA 2AKKA 2FRWA 1OOTA 1WYXA 4F17A 1OV3A 3U23A 5GJWB 4AFQC 1GCQC 1M3CA 2EKHA 1Z9ZA 2FPFA 2LCSA 1M30A 2LQWA 4LN2A 3H0HA 2MOXA 5FW9A 2DMOA 2LP5A 2PTKA 4AG1C 2C0IA 2O9SA 4HVVA 1A0NB 2RQRA 1PHTA 5ECAA 2LX7A 1AWJA 2LJ3A 5IHKA 4HXJA 1U5SA 1KJWA 2KBTA 4F16A 2VWFA 3GBQA 3VS4A 1GFDA 2ROTA 1M8MA 2DL4A 1V1CA 2CSQA 1ZLMA 2E5KA 4JPBW 2A36A 1RI9A 3M0QA 1UHCA 5L23A 2DL5A 1KSWA 1NLOC 3THKA 3M0RA 3C0CA 5FWCA 2KNBB 2GBQA 5IHIA 2L3QA 3EG2A 1VA7A 4RTXA 2DRKA 1VYUA 4RTZA 2BZXA 3TSWA 4Y92A 4Z89A 3ZL7C 2G6FX 1K76A 1TG0A 2YUNA 4AG2C 1X6BA 1UTIA 3JV3A 4CC4B 3VRZA 2CT4A 3R6NA 1UECA 2HEQA 5IXFA 2KYBA 5IH2A 1TUDA 2KROA 1CSKA 3EHRA 4AFUC 2GTOA 2FEIA 3A98A 4Z88A 4D8DA 2ED0A 4M4ZA 1GL5A 2EYXA 2ESWA 2PZ1A 1AOJA 1MV3A 1Y57A 2XMFA 4JJCA 1UFFA 2DYBA 4LNPA 1G83A 2JS2A 2HBWA 2L3SA 1YN8A 2DE0X 1GCPA 4OMPA 4RTTA 2JM9A 4ZNXA 2LJ1A 2EYYA 4J9HA 2OAWA 3RNJA 2EW3A 1SEMA 1X27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REA B;  2KGT A;  4J9F A;  4EIK A;  2FPD A;  2K2M A;  1FYN A;  1AWO A;  3TSZ A;  1E7O A;  5I22 A;  3ULR B;  1NEB A;  4RTW A;  3M0U A;  1UHF A;  2AZS A;  1QLY A;  1T0H A;  3NPF A;  1GRI A;  1X6G A;  5IHN A;  2DA9 A;  2NWM A;  1N5Z A;  5EC7 A;  4DEX A;  2JMC A;  2X3W D;  2EGE A;  2CDT A;  1GFC A;  2GGR A;  2YSQ A;  2YUO A;  1G2B A;  1K0S A;  3VS7 A;  2O31 A;  3M0S A;  2GNC A;  2FPE A;  4OML A;  1FMK A;  2LZ6 B;  2KT8 A;  4J9G A;  2AKL A;  2ABL A;  1JU5 C;  2DL8 A;  4F14 A;  1SSH A;  2CSI A;  1HSQ A;  3CQT A;  4AFS C;  2DJQ A;  2KXD A;  4CC7 A;  1KFZ A;  1H92 A;  1YCS B;  1WDX A;  3FJ5 A;  2RN8 A;  1GBR A;  1AEY A;  4IIO A;  4JJD A;  3H41 A;  5IXB A;  1Z9Q A;  2KEA A;  1CKA A;  4J9B A;  4LE9 A;  2ECZ A;  2H8H A;  2VKN A;  4J9C A;  1AWX A;  4WCI A;  2F2W A;  2P4R A;  1AZE A;  2BZY A;  3LH5 A;  2K6D A;  1JQQ A;  1MV0 B;  4GBQ A;  3EG3 A;  2PNI A;  2RQT A;  3PVQ A;  1ABQ A;  3VS3 A;  4GLM A;  2K3B A;  1RLP C;  2K79 A;  2A08 A;  1AWW A;  1X2Q A;  4OMM A;  4OMO A;  1J3T A;  1BBZ A;  4JZ3 A;  2MCN A;  1NM7 A;  1NG2 A;  1GBQ A;  2DIL A;  2YUP A;  1X69 A;  2KXC A;  4KRT A;  1S1N A;  2DM1 A;  1U06 A;  1TUC A;  1NLP C;  1ZSG A;  4RTY A;  2B86 A;  2L0A A;  1ABO A;  4RTU A;  4RTV A;  3NMZ C;  2EBP A;  2KRS A;  1RLQ C;  3SEM A;  1I0C A;  4R0K A;  2D0N A;  3O5Z A;  3NGP A;  1NEG A;  2KR3 A;  1SHF A;  2V1Q A;  2YT6 A;  2BTT A;  2O2O A;  4HVU A;  2CRE A;  3UA7 A;  2CT3 A;  2DF6 A;  2CH4 A;  1BK2 A;  1ZUY A;  3SHW A;  1OEB A;  2AK5 A;  2EGA A;  1X2K A;  1E6H A;  2BZ8 A;  4K11 A;  1VYT A;  3TVT A;  2F2X A;  2D8J A;  4J9I A;  4RUG A;  2EGC A;  2QDL A;  5HCK A;  3M0T A;  4J9E A;  1AZG B;  1M3B A;  1SRL A;  1YP5 A;  2OJ2 A;  2C0T A;  1PRL C;  1SPK A;  4LUE A;  1H3H A;  1RUW A;  1WIE A;  2M51 A;  1ZUK A;  2KE9 A;  1OPL A;  2J6F A;  2O9V A;  1H8K A;  2IIM A;  2GQI A;  4QT7 A;  1NYF A;  3H0F A;  2CUB A;  3EG0 A;  2RQW A;  2KRN A;  4ORZ A;  4HCK A;  1QKW A;  1B3Q A;  1WX6 A;  1WXT A;  1UG1 A;  2EQI A;  1WLP B;  4J9D A;  1ZUU A;  2DVJ A;  3I5S A;  1B07 A;  3M0P A;  1IO6 A;  1W1F A;  2ROL A;  1SRM A;  1T3L A;  4ESR A;  4DEY A;  2DX1 A;  1WXU A;  2LJ0 A;  1T3S A;  1JEG A;  2HDA A;  3I5R A;  1BB9 A;  4JZ4 A;  1QKX A;  1HD3 A;  1WI7 A;  2KRM A;  2V1R A;  2DL7 A;  1AD5 A;  2M0Y A;  1GCQ A;  1NYG A;  3UA6 A;  2LMJ A;  3VS1 A;  1HJD A;  2EYW A;  2RNA A;  2EPD A;  1SHG A;  3I9Q A;  4D8K A;  1JXO A;  1OPK A;  1QWF A;  2DBK A;  2JXB A;  3REB B;  1ZX6 A;  2X3X D;  1UGV A;  2K9G A;  4CC3 A;  1PKT A;  2J6K A;  1ARK A;  3NHN A;  1UJ0 A;  1KIK A;  1PRM C;  4Z8A A;  3H0I A;  2EVR A;  2JM8 A;  2DLP A;  1AVZ C;  2YDL A;  2NUZ A;  2O88 A;  2DL3 A;  4FSS A;  3VS6 A;  4HVW A;  4A63 B;  2A37 A;  2VVK A;  4JJB A;  2I0N A;  2YUQ A;  3QWX X;  4CC2 A;  1UUE A;  2FRY A;  3UF4 A;  2L2P A;  1U3O A;  2FO0 A;  2CH4 W;  3PVL A;  2SEM A;  1QWE A;  4E6R A;  5I11 A;  1EFN A;  5FWB A;  1QCF A;  1I07 A;  1UE9 A;  1YNZ A;  2J06 A;  1CKB A;  3PE0 A;  1WA7 A;  1T0J A;  2W0Z A;  3VRY A;  3VS2 A;  1JXM A;  2FG0 A;  2RQV A;  1WXB A;  1Y0M A;  2C0O A;  2LQN A;  1LCK A;  2AZV A;  1K9A A;  3EGU A;  1XOV A;  4X1V A;  2CUD A;  3IQL A;  2ENM A;  2J7I A;  1UJY A;  4IIM A;  1I1J A;  2L3P A;  3UAT A;  2SRC A;  1JO8 A;  2DNU A;  2D1X A;  2KYM A;  1BU1 A;  2EYZ A;  3VS5 A;  2DRM A;  1K0X A;  1K4U S;  2DBM A;  5GJV B;  2JT4 A;  2MIO A;  4LUD A;  2RQU A;  1PKS A;  1WFW A;  3RBB B;  3EG1 A;  2JMA A;  2F2V A;  1PWT A;  3VS0 A;  2RMO A;  3EHQ A;  1E6G A;  1VYV A;  4OMN A;  1M3A A;  2RF0 A;  2J6O A;  2JW4 A;  2JS0 A;  3KFV A;  1W6X A;  1X43 A;  1YWO A;  1ZBJ A;  1W70 A;  4OMQ A;  1UDL A;  3I35 A;  4AFZ C;  2W10 A;  2LNH B;  2J05 A;  2OI3 A;  1MUZ A;  2K7A A;  2JTE A;  2A28 A;  3QWY A;  2ED1 A;  1K1Z A;  2RPN A;  2HCK A;  1PNJ A;  2KT1 A;  2D8H A;  1YWP A;  1M27 C;  2GTJ A;  2HSP A;  2AKK A;  2FRW A;  1OOT A;  1WYX A;  4F17 A;  1OV3 A;  3U23 A;  5GJW B;  4AFQ C;  1GCQ C;  1M3C A;  2EKH A;  1Z9Z A;  2FPF A;  2LCS A;  1M30 A;  2LQW A;  4LN2 A;  3H0H A;  2MOX A;  5FW9 A;  2DMO A;  2LP5 A;  2PTK A;  4AG1 C;  2C0I A;  2O9S A;  4HVV A;  1A0N B;  2RQR A;  1PHT A;  5ECA A;  2LX7 A;  1AWJ A;  2LJ3 A;  5IHK A;  4HXJ A;  1U5S A;  1KJW A;  2KBT A;  4F16 A;  2VWF A;  3GBQ A;  3VS4 A;  1GFD A;  2ROT A;  1M8M A;  2DL4 A;  1V1C A;  2CSQ A;  1ZLM A;  2E5K A;  4JPB W;  2A36 A;  1RI9 A;  3M0Q A;  1UHC A;  5L23 A;  2DL5 A;  1KSW A;  1NLO C;  3THK A;  3M0R A;  3C0C A;  5FWC A;  2KNB B;  2GBQ A;  5IHI A;  2L3Q A;  3EG2 A;  1VA7 A;  4RTX A;  2DRK A;  1VYU A;  4RTZ A;  2BZX A;  3TSW A;  4Y92 A;  4Z89 A;  3ZL7 C;  2G6F X;  1K76 A;  1TG0 A;  2YUN A;  4AG2 C;  1X6B A;  1UTI A;  3JV3 A;  4CC4 B;  3VRZ A;  2CT4 A;  3R6N A;  1UEC A;  2HEQ A;  5IXF A;  2KYB A;  5IH2 A;  1TUD A;  2KRO A;  1CSK A;  3EHR A;  4AFU C;  2GTO A;  2FEI A;  3A98 A;  4Z88 A;  4D8D A;  2ED0 A;  4M4Z A;  1GL5 A;  2EYX A;  2ESW A;  2PZ1 A;  1AOJ A;  1MV3 A;  1Y57 A;  2XMF A;  4JJC A;  1UFF A;  2DYB A;  4LNP A;  1G83 A;  2JS2 A;  2HBW A;  2L3S A;  1YN8 A;  2DE0 X;  1GCP A;  4OMP A;  4RTT A;  2JM9 A;  4ZNX A;  2LJ1 A;  2EYY A;  4J9H A;  2OAW A;  3RNJ A;  2EW3 A;  1SEM A;  1X27 A; 
#chains in the Genus database with same CATH topology
 2KGT A;  3EGD B;  1KC8 U;  4FW1 A;  3JCM J;  1E7O A;  5I22 A;  3ULR B;  1GXI E;  4A4K A;  1KD1 U;  4RTW A;  2K5I A;  1UHF A;  5DM7 R;  1WNL A;  1G5V A;  1GRI A;  1ACM B;  1VQM T;  2EGE A;  2CDT A;  3L2R A;  4M7D C;  3M0S A;  4OB0 B;  4OML A;  4M7D G;  2ATC B;  5KYN A;  2VB6 A;  2A3L A;  2EQU A;  1FMV A;  4J9G A;  2AKL A;  1JU5 C;  1TWB A;  3AHU A;  1SSH A;  3BW1 A;  3CQT A;  1H92 A;  1OYX A;  2DPP B;  3PFS A;  1GBR A;  4JJD A;  3H41 A;  1MND A;  1FWZ A;  5CK9 A;  2VXF A;  1RI0 A;  1NPP A;  3CPF A;  4IUR A;  4WCI A;  2MWP A;  2P4R A;  1AZE A;  5DLQ E;  1QVP A;  1JQQ A;  1MV0 B;  1D09 B;  5GMK j;  3CCL T;  2P0K A;  4M7A D;  1FXX A;  1G3W A;  1PD1 A;  2CP7 A;  4PJO B;  4E7K A;  2RJF A;  2NUT A;  3VS3 A;  3CCJ A;  3GOX A;  4GLM A;  3S3M A;  2K3B A;  4C5I A;  3JB9 I;  4OMM A;  4OMO A;  4KGZ B;  1M8V A;  1SKU B;  4JZ3 A;  1K8A C;  4MZP A;  1NG2 A;  3CCJ Q;  3JCM h;  1X69 A;  3TEE A;  5LJ3 j;  2RM4 A;  3PMT A;  1BKB A;  2DM1 A;  2PUK B;  1VQ9 A;  2MWO A;  1ZSG A;  2JJ9 A;  2B86 A;  4RTY A;  3QJ6 A;  4ANJ A;  4M7A F;  4RTU A;  2JVV A;  5LJ5 d;  3NMZ C;  2EBP A;  2YLB A;  2KRS A;  1RLQ C;  3SEM A;  2QQS A;  2M02 A;  1YJW A;  3CCQ A;  1VQ9 Q;  2JTF A;  4F7U B;  2E65 A;  1NEG A;  2V1Q A;  2MYS A;  3UA7 A;  2EQK A;  2ZZD A;  2DVE A;  3JCM Q;  3CC4 T;  4ZN3 A;  2MAM A;  4J8O A;  2JN0 A;  1X2K A;  2BZ8 A;  4XQ3 A;  1YJW Q;  3CCQ Q;  4JRK A;  1I4K 1;  4K11 A;  2RI5 A;  3TVT A;  4C0Z A;  2BUD A;  2D8J A;  3RKX A;  4RUG A;  4KGV B;  1WHJ A;  2QDL A;  3FB9 A;  4RG2 A;  5GAN 4;  5HCK A;  3M0T A;  1UB4 A;  4J9E A;  1M3B A;  3J81 E;  1VQK T;  3EFO A;  2H3J A;  6AT1 B;  3G4S A;  2HMA A;  2C0T A;  1SPK A;  3QDR B;  4LDU A;  1IXD A;  1ZUK A;  3CXC S;  4E2F B;  1TXQ A;  1VQO Q;  2IIM A;  2GQI A;  1M2V A;  4QT7 A;  3G4S Q;  3OYE A;  1ZSZ A;  3MPU B;  1WZO A;  2JNG A;  2EQI A;  3L2Z A;  1WLP B;  4HA8 A;  1IGQ A;  3M0P A;  3OBY A;  1IO6 A;  3X28 B;  2OX7 A;  1T3S A;  2RK2 A;  1G3Y A;  2DAQ A;  4O6J A;  2CZ1 B;  2V1R A;  2CZ7 B;  1V76 A;  5EG2 A;  2DEQ A;  3DLL A;  1Q81 U;  3UA6 A;  2LMJ A;  3WVE B;  2EYQ A;  4C0F A;  3CMA T;  4M78 C;  3HRS A;  4D8K A;  2C06 A;  1KC8 R;  3QZ9 B;  5GAN 2;  2Y4Y A;  1QP2 A;  3GLX A;  5LJ3 e;  5AYF A;  3GP8 A;  3G71 T;  4HKE A;  5GMK l;  2GFU A;  4LDX A;  1XNI A;  2J6K A;  2OTL A;  4EMG A;  3UPU A;  1H3Z A;  4HCC A;  1UJ0 A;  3QUI A;  3V7C A;  3OMC A;  1NJI U;  1D0X A;  3H0I A;  3RIR A;  4FT4 A;  2OTL Q;  1QCN A;  2DZC A;  2O88 A;  2DL3 A;  4FSS A;  1W2B S;  2A37 A;  1YJ9 T;  4M7A B;  2I0N A;  2YUQ A;  3GNF B;  2FRY A;  1BIA A;  2FO0 A;  2KDS A;  3PVL A;  2E6Z A;  2E70 A;  5I11 A;  1QCF A;  2VXE A;  3X24 B;  3FC3 A;  3MJX A;  5LJ5 e;  1CKB A;  1T0J A;  1JXM A;  3OS5 A;  2C0O A;  1K9A A;  3OYK A;  1XOV A;  2ENM A;  4C0G A;  2XKO C;  1Y96 A;  1I1J A;  5FU6 B;  2BE9 B;  5KYW B;  5A2Q E;  3S3O A;  4DQ2 A;  3VS5 A;  2QAS A;  1K4U S;  1B7T A;  3QII A;  4XAX B;  5CKF A;  3MEV A;  4ZGD B;  4RMO A;  3EG1 A;  4A4F A;  3BE3 A;  4BB7 A;  2F2V A;  3AT1 B;  2QQA A;  4L5G A;  2RMO A;  3E2U A;  4EMK C;  1VQN T;  3I55 T;  2VGN A;  1X43 A;  2QGG A;  3RES A;  1XJW B;  1ZA1 B;  1KG1 A;  5A0G A;  5GAM j;  4M75 A;  4ATO A;  2J05 A;  2K57 A;  2M1H A;  4OP0 A;  4GLK A;  3LX7 A;  2K3Y A;  4ZTF A;  3UDC A;  1M90 C;  3CME A;  1YWP A;  3LWI A;  4RCB A;  1GCQ C;  1EZZ B;  2EKH A;  4NOY A;  1M4Z A;  4X34 A;  5FRM A;  2H3E B;  3H6Z A;  5FW9 A;  4AG1 C;  3CCU A;  2O9S A;  4HVV A;  2CP0 A;  1G3S A;  4M7D A;  1KK7 A;  2A0F B;  3LYI A;  3MHX A;  3OYA A;  2KBT A;  4F16 A;  1UEB A;  2KSS A;  3M53 A;  2RJC A;  3VS4 A;  5KYY B;  5GAN 8;  4JPB W;  1AHJ B;  4KH1 B;  1RI9 A;  1EIF A;  3FJP A;  1FX7 A;  1KSW A;  1NLO C;  3PNW C;  4KUD K;  3MKD A;  1NZ9 A;  5GAN d;  2GBQ A;  2M0O A;  2GQV A;  5J39 A;  5IHI A;  3EG2 A;  3TSW A;  4RTZ A;  2DRK A;  1VYU A;  5HK3 A;  4Y92 A;  4DA4 A;  3G7Z A;  1QMC A;  3M4G A;  3JCM g;  3CPW S;  4AG2 C;  3OSV A;  4J6Y A;  1VQ4 T;  3ZBD A;  4Q5W A;  3JV3 A;  3M5A A;  3JCM c;  5CAI A;  3HHT B;  3C95 A;  2CT4 A;  4FYY B;  2F5K A;  4LDV A;  2HD0 A;  3QG1 A;  3R6N A;  4XTX A;  1MMA A;  3OBW A;  5LJ3 f;  1YIT T;  5IH2 A;  4C5G A;  1YFN A;  4C0D C;  4XU1 A;  5GAN j;  2NUP B;  3JCM b;  3CC7 A;  3A98 A;  2FB7 A;  2RD1 A;  5GAM e;  4M4Z A;  1GL5 A;  2EYX A;  4PFP A;  4ME7 A;  1VQ7 T;  2CZ0 B;  4JJC A;  1KQ2 A;  4LNP A;  1G83 A;  5HY6 A;  3CC7 Q;  4C92 D;  4QKU A;  2I2L A;  4WTO B;  1IZ6 A;  4KT0 E;  3SB2 A;  3OYC A;  2PU9 B;  4BDY A;  4ZNX A;  1LPL A;  4PNO A;  1MMD A;  3QXE B;  4J9H A;  2OAW A;  1QVF S;  2DXC A;  4A4E A;  1YI2 A;  4C92 F;  2RHZ A;  5CQX A;  1N6A A;  1KHC A;  4A4H A;  1D3B A;  2FPD A;  2K2M A;  1FYN A;  3LGL A;  3VYG A;  3FEO A;  1D1B A;  1NEB A;  3EGX A;  1YHQ T;  1YI2 Q;  2AZS A;  4QVZ A;  1QLY A;  2F69 A;  4BI3 A;  3RMQ A;  4A4G A;  2IG0 A;  2MMP A;  2EWN A;  4NL3 A;  2NWM A;  9ATC B;  5EC7 A;  1GFC A;  3CC2 T;  2MK5 A;  4XU3 A;  2DD5 A;  2GNC A;  2XDD A;  2P0Q A;  1FMK A;  2LZ6 B;  4B9W A;  1YJN A;  3EAE A;  4M77 D;  5CCA A;  2DL8 A;  2D9T A;  2CSI A;  4LD9 K;  2KXD A;  1VQ6 A;  2X4J A;  1YJN Q;  3FJ5 A;  1AEY A;  4IIO A;  5IXB A;  1Z9Q A;  1RAD B;  1CKA A;  1PG5 B;  2ECZ A;  4FSX A;  2H8H A;  4M78 A;  1S72 T;  2VKN A;  1AWX A;  1XTD A;  2F2W A;  1VQ6 Q;  4M77 F;  5GAN e;  3SWN B;  4IUV A;  2K6D A;  4GBQ A;  2QTV A;  3VKI A;  3MET A;  2LT4 A;  4DBH A;  2K79 A;  1AWW A;  5CQY A;  5GAN 6;  5KH6 A;  1J3T A;  1BBZ A;  2WAC A;  4KUL A;  2YUP A;  2QEX T;  1QVG P;  3LH0 A;  1NLP C;  4C8Q E;  2L0A A;  1ABO A;  4PFO A;  3EG9 A;  3M57 A;  1IGU A;  3EFS A;  4R0K A;  3O5Z A;  1QVF A;  2QA4 A;  5A0L A;  1TH7 A;  2CRE A;  1MGQ A;  1WHK A;  5FU7 B;  2D0Q B;  3A8M B;  4DBQ A;  3JB9 J;  1OEB A;  3A8G B;  2EQM A;  5GAN 5;  2F2X A;  5IAY A;  3G6E T;  3CEY A;  3NTK A;  2CYZ B;  1LNX A;  4C92 B;  3CMA Q;  1X01 A;  1JB0 E;  5A0D A;  1M1K R;  1RAH B;  4XTW A;  3OYH A;  1VQ5 T;  2PVD B;  5KYU B;  2GF7 A;  4BAC A;  3H0F A;  1RAC B;  3SD4 A;  3TU4 K;  3MP6 A;  2CUB A;  3EG0 A;  5GAM f;  4EMK A;  1Y07 A;  5CKD A;  4HCK A;  3M9Q A;  4J7I A;  1B34 B;  3PIO A;  1UG1 A;  3I56 A;  2OTJ A;  4XTZ A;  1ZUU A;  1TSF A;  1VQP A;  2EJF A;  2DZ9 A;  1U8R A;  1R8O B;  1T3L A;  2ZPB B;  3I56 Q;  2OTJ Q;  2LJ0 A;  2AT1 B;  1PM3 A;  3PGG A;  3A8O B;  4JJN K;  2HAX A;  3CCE T;  2HKN A;  1QKX A;  1WI7 A;  1VQP Q;  3X20 B;  2G3R A;  2O4X B;  1GCQ A;  2RNA A;  5GMK i;  3GPL A;  3CCM A;  1SHG A;  1YBY A;  4OB3 B;  1OPK A;  1QWF A;  4M77 B;  4AT1 B;  3REB B;  2DO3 A;  3CCM Q;  1WHG A;  2E4H A;  2ZPE B;  1VQL T;  4ELZ C;  4QVD A;  1ARK A;  3QHS A;  1KIK A;  4PJO E;  2IPO B;  1PRM C;  4Z8A A;  8ATC B;  3QPH A;  4JLI A;  2JM8 A;  5GAN 3;  2YDL A;  3PTA A;  4DBR A;  4HVW A;  2BIV A;  2RA2 A;  2RI2 A;  3QWX X;  3CBM A;  3DB4 A;  5CKB A;  5FLX E;  1U3O A;  2AHJ B;  3M4Y A;  2SEM A;  2Y90 A;  3HRU A;  4N0A C;  4E6R A;  4C8Q C;  3PE0 A;  1Q7Y C;  2X35 A;  1M1F A;  4FYV B;  4F7U E;  1YCY A;  2FG0 A;  3ZFJ A;  3M58 A;  4C8Q G;  1OU8 A;  2LQN A;  1LCK A;  3DLM A;  1KHI A;  3EGU A;  5KE2 A;  3L2Q A;  1UJY A;  5HK0 A;  1W4S A;  4IIM A;  2KI7 A;  3UAT A;  3CCR A;  3CCV A;  2DNU A;  1U1S A;  2RO0 A;  1BU1 A;  2EYZ A;  3DB3 A;  4XU2 A;  5GAO l;  1VQO A;  4E7Z A;  2DBM A;  4HT9 A;  4E7L A;  4FW2 A;  4LUD A;  3JRZ A;  1WFW A;  1OZ2 A;  3RBB B;  5LJ5 j;  1KD1 C;  1EX4 A;  3CCR Q;  3CCV Q;  2BE7 D;  4RG8 A;  1PWT A;  4E47 A;  1F1B B;  1VQ8 T;  1E6G A;  1OI1 A;  1VYV A;  4J7F A;  2CZ6 B;  1JJ2 P;  3CD6 A;  3C12 A;  4OF1 A;  2JS0 A;  1ZBJ A;  3SFM A;  5AT1 B;  3CCS A;  4BE1 A;  2EIF A;  4FL6 A;  2COZ A;  2B8A A;  1MUZ A;  3CXC P;  1C1A A;  3CD6 Q;  1WGS A;  5GAO p;  2ZGW A;  3CCS Q;  5KYX A;  2HCK A;  5I21 A;  4FYX B;  1KQS P;  5DLO A;  3WVD B;  2NLU A;  1UGQ B;  2HSP A;  1K8A R;  2AKK A;  2FRW A;  2QQR A;  3OW2 P;  4F17 A;  3U23 A;  4PLI A;  1M3C A;  3M55 A;  1LOJ A;  2HQX A;  3D7S B;  3H0H A;  4OGC A;  2MOX A;  2PTK A;  2RJE A;  4AMC A;  2E5Q A;  2MPX C;  2RB6 A;  5IHK A;  1M90 U;  4HXJ A;  1U5S A;  2RJD A;  4BY6 B;  2K5F A;  2FZK B;  2ROT A;  1WJS A;  2ZCF B;  2LX9 A;  1VOM A;  3QJY A;  2CSQ A;  1ZLM A;  2VC8 A;  2E5K A;  1MNE A;  2A36 A;  2M16 A;  2EJ9 A;  2YXY A;  3L2W A;  3OYM A;  5L23 A;  1IB8 A;  4BD3 A;  3EH1 A;  2X4W A;  5KYY A;  2NUT B;  4PJO C;  3ER0 A;  3OA6 A;  2E3I A;  2BZX A;  4PJO G;  2G6F X;  3KXT A;  4FT2 A;  4M7A E;  2YUN A;  3GNG A;  2QDY B;  2LT1 A;  2DJZ A;  1PSE A;  3QYH B;  3JCM d;  5KCH A;  1UEC A;  4BE0 A;  1M9S A;  3RUX A;  1TUD A;  2LNV A;  4MDX A;  1V29 B;  3QBY A;  3INZ A;  4F7U G;  1OQK A;  2ESW A;  2PZ1 A;  4B9X A;  2FHD A;  2XID A;  1YIJ A;  2E41 A;  3ME9 A;  8AT1 B;  5M9O A;  2QK0 A;  1GCP A;  4E7I A;  3EFO B;  4BDZ A;  4OMP A;  4M75 D;  3L2V A;  1M2O A;  1SG5 A;  1YIJ Q;  2JM9 A;  4IUT A;  1PCX A;  3FRN A;  4II1 A;  2DER A;  1KQS A;  3M59 A;  2HL3 A;  5CIU A;  1M2V B;  4ZTJ A;  2KK4 A;  1BIB A;  2LTO A;  2VGM A;  3HTR A;  2DYI A;  3P8D A;  1ZSZ B;  3OS2 A;  1D1A A;  1AT1 B;  1QP3 A;  3REA B;  5J3B A;  4Z02 A;  1BI1 A;  4J9F A;  3CCJ T;  4EIK A;  4M75 F;  1AWO A;  1S72 Q;  1M1G A;  5GMK m;  5L8R E;  4WF2 A;  5LL6 S;  1T0H A;  2HZY A;  1X6G A;  5IHN A;  4M7D D;  1WHL A;  2V8K A;  1VQ9 T;  1N5Z A;  4JRP A;  1RAA B;  2X3W D;  2YSQ A;  2XG8 D;  2O31 A;  2KAF A;  2CP3 A;  3HL8 A;  2KT8 A;  2EFI A;  3H8Z A;  3CCQ T;  1YJW T;  3TRE A;  2GCX A;  4M7D F;  4AFS C;  1KFZ A;  3MEA A;  1WDX A;  4UC4 A;  1WPY A;  5C6S A;  3HP9 A;  2DTO A;  3X26 B;  4OMF B;  3VYH B;  2VYT A;  4J9C A;  3G4S T;  2HNI A;  3LH5 A;  1SSF A;  4E7S A;  3CBP A;  4JRQ A;  3EG3 A;  3TQ7 P;  4XK8 E;  2RQT A;  1N9R A;  3A8H B;  2ZPG B;  4M7A C;  2A08 A;  3JCM e;  3OYD A;  3OYF A;  4M7A G;  2MCN A;  1M1K U;  3JCM W;  1VQ5 Q;  5CR2 A;  1NM7 A;  4EMH A;  1GBQ A;  2DIL A;  2P4T A;  1M90 R;  2KXC A;  4KRT A;  4J6X A;  1VQM A;  2KQW A;  1I81 A;  3VV0 A;  4OB2 B;  2CP5 A;  1Y96 B;  3QZ5 B;  5FU6 C;  4N0A A;  1VQM Q;  2KR3 A;  2YT6 A;  2BTT A;  4C8Q A;  2DF6 A;  4L6V 5;  1I5O B;  2PVO B;  4ZN1 A;  2AK5 A;  4PLL A;  3NTI A;  4B6M A;  2E3H A;  4Y28 E;  5IT9 E;  2CKK A;  1VYT A;  2DXU A;  1Q86 C;  3QYG B;  4J9I A;  1MMN A;  1N27 A;  1AZG B;  1FMW A;  3FLG A;  1BI0 A;  5LJ5 f;  1YP5 A;  2OJ2 A;  1N8R C;  1R0B G;  4PKC C;  2OTL T;  1PRL C;  1H3H A;  1HYO A;  2R58 A;  3OSS C;  2KE9 A;  4M75 B;  3CCL A;  1JRI A;  1OPL A;  1UGR B;  2J6F A;  2O9V A;  3QSU A;  1H8K A;  1NYF A;  1Q82 C;  4BI8 B;  2RQW A;  4ORZ A;  3BFM A;  3LGF A;  1QKW A;  1K73 C;  3CCL Q;  3LWH A;  5KYU A;  3EGD A;  4TVR A;  2LRQ A;  3OYJ A;  4DOV A;  4J9D A;  2DVJ A;  1SRM A;  4R56 A;  4DEY A;  2DX1 A;  2WSF E;  1VUB A;  1M5Q 1;  3PMI A;  3OY9 A;  1JEG A;  4QQ6 A;  1BB9 A;  4M7D B;  3VJP A;  2LDM A;  3OQ5 A;  2M0Y A;  1NYG A;  1ZQ1 A;  4M78 D;  3VS1 A;  4C5E A;  5GMK h;  5KE3 A;  2EYW A;  1U1T A;  3EFR A;  3CC4 A;  4J5Y A;  2EPD A;  3JCM V;  1BI3 A;  2COW A;  3S3N A;  1JXO A;  3HKS A;  3N5B B;  2DBK A;  4CI0 C;  2O4X A;  1G8X A;  1NPR A;  1VQK A;  2CGH A;  3CC4 Q;  2F5T X;  2K9G A;  2VV5 A;  4JUV A;  4CC3 A;  1PKT A;  2JUF A;  5LJ3 h;  3NHN A;  2ZAE A;  4M78 F;  2P84 A;  1BI2 A;  1Q86 R;  1VQK Q;  3OYG A;  2EVR A;  1P92 A;  1N8R R;  4F04 B;  1VQ8 Q;  1RL2 A;  1ZBX A;  4A63 B;  4PJO A;  2VVK A;  2V8I A;  3J80 E;  2L8D A;  4CC2 A;  2QQB A;  1UUE A;  3UF4 A;  3VUB A;  1Q82 R;  2HQE A;  2CH4 W;  3CME T;  1QWE A;  1OUL A;  5FWB A;  1K73 R;  2J06 A;  1UE9 A;  4XTU A;  5GAN 7;  2XD0 A;  2DXT A;  3VS2 A;  1UGS B;  1Y0M A;  1WHM A;  2VUB A;  4X1V A;  2CUD A;  1H64 1;  3IQL A;  1VIE A;  3CCU T;  2K2V A;  3J7A F;  3R6O A;  4FU6 A;  3A8L B;  1K8A U;  3CMA A;  2HSE B;  2EAY A;  2DET A;  2XI9 A;  4F7U A;  2D1X A;  3P8B B;  2DK3 A;  2DRM A;  4MDW A;  1K0X A;  2JT4 A;  4PL6 A;  2K4Y A;  2RQU A;  3HFN A;  1PKS A;  3G71 A;  1X27 A;  4C92 E;  4D6W A;  1C6V X;  2JMA A;  4QQD A;  2IVW A;  3EHQ A;  1M3A A;  1ZA2 B;  2LCC A;  3V7S A;  2JW4 A;  3JCM P;  1NBE B;  3G71 Q;  5HKC A;  4OMQ A;  1W70 A;  1UDL A;  4PFZ A;  4KUI A;  4JDS A;  1ZHI A;  3I35 A;  3A1P A;  2W10 A;  1RAE B;  3EGX B;  2P0P A;  2OI3 A;  4MZM A;  2JTE A;  2WSE E;  1YJ9 A;  1K9M C;  3QWY A;  4IUQ A;  2E12 A;  5C0M A;  2COY A;  2DEU A;  2D6F A;  2RI3 A;  2D8H A;  3OYB A;  2GTJ A;  3LLR A;  1YJ9 Q;  4E7H A;  1OOT A;  1PSF A;  1WYX A;  1IRX A;  1IRE B;  1OV3 A;  4AFQ C;  5FRO A;  1O75 A;  4QQG A;  3LW5 E;  4BI4 A;  3CC7 T;  3EH2 A;  4J83 A;  3BY7 A;  2X4X A;  4KBM B;  2HBP A;  4N4G A;  1PHT A;  3MCA B;  1R77 A;  5FRN A;  4M77 E;  2LJ3 A;  3JB9 D;  1KJW A;  1QQJ A;  4EDU A;  3QO3 A;  4M78 B;  4M78 E;  2DL4 A;  1OU9 A;  2E6N A;  3G1J A;  4A53 A;  1QVG A;  3S6W A;  2E64 A;  1R0C B;  3SWN C;  3Q1J A;  2DL5 A;  4V2S A;  1VQN A;  5LJ3 d;  3I55 A;  4FYW B;  3M0R A;  3C0C A;  5FWC A;  2KNB B;  2L3Q A;  1SF9 A;  3JB9 F;  3ZL7 C;  1YI2 T;  5J26 A;  3RR6 A;  1VQN Q;  3I55 Q;  1X6B A;  3OMG A;  2GFA A;  2DD4 A;  2E10 A;  4MMK A;  5GAO n;  3VRZ A;  3H9N A;  4CRI A;  4M7A A;  1Q95 G;  3EG9 B;  1K9M R;  4RKU E;  4J6W A;  1KQ1 A;  1MHN A;  2KRO A;  5GAN f;  3MP8 A;  2GTO A;  2YLC A;  3CBO A;  3RKW A;  2FEI A;  4MML A;  2X4Y A;  2XU8 A;  2ED0 A;  5FU7 C;  1MMG A;  1Y57 A;  2XMF A;  1PD0 A;  1YJN T;  1D0Y A;  1KC8 C;  2EJG A;  1BYM A;  4XU0 A;  2JS2 A;  2LQ8 A;  2CS7 A;  4FIB A;  5GAM h;  2L3S A;  1WJR A;  2RHX A;  5KYW A;  4LD6 A;  1VQ6 T;  3VUZ A;  2X9H A;  4C92 C;  3BDL A;  4OB1 B;  3M54 A;  4C92 G;  1JJ2 S;  3O8V A;  2LJ1 A;  2EYY A;  3E19 A;  1TTH B;  3HRT A;  2EKO A;  4EMK B;  1Y71 A;  3OB9 A;  2EW3 A;  2QG9 B;  3NTH A;  5CVI A;  1VQ4 A;  3TSZ A;  2YRC A;  5KCO A;  4RCC A;  3M0U A;  1KQS S;  4Y91 A;  2FYK A;  2PQW A;  2LQK A;  3NPF A;  2DA9 A;  3OW2 S;  1VQ4 Q;  3V8J A;  3QDF A;  3V8L A;  1YIT A;  4JRI A;  1X75 C;  1IHV A;  2JMC A;  4DEX A;  2GGR A;  2YUO A;  1K0S A;  1G2B A;  5IN1 A;  5GAO q;  3MEU A;  3VS7 A;  2FPE A;  1O9S A;  1Q7Y R;  4DOW A;  1YIT Q;  5GMK e;  1VQ7 A;  2QA4 T;  3HPW A;  2ABL A;  2QGF B;  3OS0 A;  4F14 A;  1HSQ A;  4M77 C;  2DJQ A;  1G3T A;  2YRD A;  4CC7 A;  5LJ3 g;  1YCS B;  5D6X A;  3V7R A;  1TU0 B;  1VQ7 Q;  4M77 G;  1WJQ A;  2RN8 A;  1BCM A;  4P5N A;  2XHC A;  4XTV A;  2KEA A;  4J9B A;  4LE9 A;  4JS4 A;  4M78 G;  1KD1 R;  3VU3 C;  2BZY A;  3L1A A;  3WXM B;  3OYN A;  2PNI A;  3OYY A;  1JBM A;  5GAO m;  2QYZ A;  3PVQ A;  5GAN h;  1ABQ A;  3RKY A;  1RLP C;  4C5H A;  2BKD N;  5D6W A;  4IKF A;  1X2Q A;  3MP1 A;  1YHQ A;  2LC4 A;  1W2B P;  2DFU A;  4N4H A;  3HSB A;  1Y7X A;  2XDP A;  3I56 T;  2OTJ T;  2CP6 A;  2HQH A;  1S1N A;  5LJ5 g;  1U06 A;  1TUC A;  1VQP T;  1YHQ Q;  2KMT A;  3CC2 A;  2FZC B;  4RTV A;  3ASK A;  1JJ2 A;  1RAG B;  4PJL A;  1PC0 A;  3RDV A;  1I0C A;  4C0D B;  2V26 A;  5DY9 A;  2D0N A;  4ZGJ B;  2L89 A;  1SHF A;  4KH0 B;  4PJN A;  4HVU A;  2O2O A;  2DIG A;  2XIC A;  2XK0 A;  2NUP A;  3CC2 Q;  2K3X A;  2CT3 A;  4L59 A;  3CXC A;  2CH4 A;  1BK2 A;  4HT8 A;  1ZUY A;  2O01 E;  3SHW A;  5GAM d;  2EGA A;  3CCM T;  1E6H A;  1BCO A;  5I2S A;  2FZG B;  2EGC A;  2L3R A;  1SRL A;  3OW2 A;  1S72 A;  2R57 A;  2DXB A;  4LUE A;  1RUW A;  1WIE A;  1WHH A;  2M51 A;  3M56 A;  3SDZ A;  2Z0W A;  3KBG A;  1C0M A;  3FIF A;  2HL5 C;  3OYI A;  3JB9 H;  1Q81 C;  5KYX B;  2E1H A;  2KRN A;  4ZGE B;  1B3Q A;  1WX6 A;  3KUF A;  1WXT A;  2RHY A;  2LCL A;  2QQ9 A;  3I5S A;  1Q86 U;  1B07 A;  2QEX A;  4A54 A;  1W1F A;  3V8K A;  1QW1 A;  2ROL A;  3TCJ A;  4LXC A;  4QW2 A;  3FDR A;  4ESR A;  1N8R U;  1WXU A;  3MO8 A;  5CKE A;  2HDA A;  2QI2 A;  3I5R A;  2QEX Q;  4JZ4 A;  1HD3 A;  3RMS A;  2KRM A;  1NJI C;  2DL7 A;  1XQH A;  4O5V A;  1AD5 A;  3CME Q;  1Q82 U;  1OX8 A;  1HXD A;  2LVM A;  4BY6 C;  1HJD A;  4PJM A;  3CCR T;  1K73 U;  3CCV T;  5GAO r;  2EQJ A;  3I9Q A;  4FCY A;  1VQO T;  2JXB A;  3G6E A;  3PT9 A;  3E1S A;  1ZX6 A;  2K5L A;  5D6Y A;  1W2B A;  2X3X D;  1UGV A;  7AT1 B;  3CCU Q;  4QVC A;  1OX9 A;  2QAZ A;  2PUO B;  2AIR B;  1VQ5 A;  3CD6 T;  3JB9 G;  3G6E Q;  1RAI B;  3DKM A;  3C94 A;  1I5L A;  3CCS T;  2YHT A;  3SWN A;  2DLP A;  1AVZ C;  1D0Z A;  3CPW P;  2NUZ A;  2DIQ A;  3VS6 A;  3GIB A;  1NE8 A;  4IUP A;  1DJ7 B;  4JJB A;  4JS5 A;  4VUB A;  2L5Q A;  1VIF A;  2L2P A;  4ELY C;  4DBF A;  4C8Q D;  1Q81 R;  1EFN A;  2V8J A;  4YTL A;  3UT1 A;  1I07 A;  1YNZ A;  2YWW A;  1WA7 A;  3VRY A;  2W0Z A;  2RQV A;  1WXB A;  3CCE A;  2AZV A;  5GAM g;  3JSC A;  1UGP B;  2RH2 A;  2J7I A;  2YRV A;  2XDB A;  2Y4X A;  2L3P A;  2SRC A;  4C8Q F;  1JO8 A;  1TOV A;  3E9F A;  3CCE Q;  2KYM A;  1RAB B;  4BE2 A;  2ZPH B;  2DTH A;  2VAS A;  1NJI R;  2OAU A;  5GJV B;  2MIO A;  3VS0 A;  2DTI A;  4M75 E;  1VQL A;  3L2U A;  3GF5 A;  2MI6 A;  3URG A;  1ZSZ C;  4OMN A;  2RF0 A;  2J6O A;  3C4S A;  2WSC E;  3KFV A;  1W6X A;  1YWO A;  5D7U A;  4C92 A;  3BDU A;  1QVF P;  4AFZ C;  1WQW A;  2LNH B;  4X9C A;  1VQL Q;  4PK4 A;  2K7A A;  4XTY A;  2A28 A;  2ED1 A;  4NS5 A;  3NFC A;  1K1Z A;  2R5A A;  2RPN A;  2FVU A;  1PNJ A;  1X6O A;  2KT1 A;  2A7Y A;  3UWN A;  4FM4 B;  2QXF A;  4E7J A;  1M27 C;  3A5Z B;  1B34 A;  2CP2 A;  3X25 B;  3P8H A;  1OZ3 A;  5GJW B;  4M7D E;  2JOY A;  3F70 A;  1TS9 A;  4MZT A;  1Z9Z A;  2FPF A;  3L42 A;  2LCS A;  1M30 A;  2LQW A;  4LN2 A;  3RER A;  2M9U A;  2DMO A;  2LP5 A;  2JTM A;  2C0I A;  1A0N B;  2RQR A;  4LDY A;  3MEW A;  4IUU A;  2ZPI B;  5ECA A;  1YIJ T;  1K9M U;  2LX7 A;  2MF2 A;  1AWJ A;  1LVK A;  1RAF B;  2VWF A;  1WQ7 A;  4X9D A;  3GBQ A;  3CPW A;  1GFD A;  4BUG A;  1M8M A;  1LJO A;  1IHW A;  1V1C A;  2ZPF B;  2JZ2 A;  4OGE A;  1M1K C;  1VQ8 A;  3M0Q A;  1UHC A;  4M77 A;  5GAN g;  4PJO D;  2KVQ G;  3THK A;  3JAM E;  2RK1 A;  4GY5 A;  3OS1 A;  2R5M A;  1VA7 A;  1I8F A;  4RTX A;  4Z89 A;  1K76 A;  1TG0 A;  4KGX B;  2RHU A;  4HCB A;  1TUG B;  1QVG S;  1UTI A;  4CC4 B;  4PJO F;  4JLG A;  1N9S A;  4NL2 A;  2HEQ A;  5I2M A;  3E9G A;  5IXF A;  2FL7 A;  2KYB A;  3OYL A;  1CSK A;  4PJJ A;  2RHI A;  5LJ5 h;  3JCM X;  3EHR A;  1D1C A;  4AFU C;  4HCZ A;  4C8Q B;  4N4I A;  2KY9 A;  1HK9 A;  4Z88 A;  4D8D A;  5CO7 A;  4OVA A;  1AOJ A;  1MV3 A;  3ZEH A;  3T9N A;  1UFF A;  4LDW A;  3JCM f;  2DYB A;  4EPC A;  3HFO A;  2HBW A;  4F7U F;  3PIP A;  1YN8 A;  2F1L A;  2DE0 X;  2NYS A;  2DKG A;  4RTT A;  1Q7Y U;  3QKJ A;  2QA4 Q;  2PVG B;  5CKH A;  4M75 C;  1D3B B;  2X51 A;  4M75 G;  3RNJ A;  2HKQ B;  2QTX A;  1SEM A;  3NGP A;  4R55 A;  1QCO A; 
#chains in the Genus database with same CATH homology
 3REA B;  2KGT A;  4J9F A;  4EIK A;  2FPD A;  2K2M A;  1FYN A;  1AWO A;  3TSZ A;  1E7O A;  5I22 A;  3ULR B;  1NEB A;  4RTW A;  3M0U A;  1UHF A;  2AZS A;  1QLY A;  1T0H A;  3NPF A;  1GRI A;  1X6G A;  5IHN A;  2DA9 A;  2NWM A;  1N5Z A;  5EC7 A;  4DEX A;  2JMC A;  2X3W D;  2EGE A;  2CDT A;  1GFC A;  2GGR A;  2YSQ A;  2YUO A;  1G2B A;  1K0S A;  3VS7 A;  2O31 A;  3M0S A;  2GNC A;  2FPE A;  4OML A;  1FMK A;  2LZ6 B;  2KT8 A;  4J9G A;  2AKL A;  2ABL A;  1JU5 C;  2DL8 A;  4F14 A;  1SSH A;  2CSI A;  1HSQ A;  3CQT A;  4AFS C;  2DJQ A;  2KXD A;  4CC7 A;  1KFZ A;  1H92 A;  1YCS B;  1WDX A;  3FJ5 A;  2RN8 A;  1GBR A;  1AEY A;  4IIO A;  4JJD A;  3H41 A;  5IXB A;  1Z9Q A;  2KEA A;  1CKA A;  4J9B A;  4LE9 A;  2ECZ A;  2H8H A;  2VKN A;  4J9C A;  1AWX A;  4WCI A;  2F2W A;  2P4R A;  1AZE A;  2BZY A;  3LH5 A;  2K6D A;  1JQQ A;  1MV0 B;  4GBQ A;  3EG3 A;  2PNI A;  2RQT A;  3PVQ A;  1ABQ A;  3VS3 A;  4GLM A;  2K3B A;  1RLP C;  2K79 A;  2A08 A;  1AWW A;  1X2Q A;  4OMM A;  4OMO A;  1J3T A;  1BBZ A;  4JZ3 A;  2MCN A;  1NM7 A;  1NG2 A;  1GBQ A;  2DIL A;  2YUP A;  1X69 A;  2KXC A;  4KRT A;  1S1N A;  2DM1 A;  1U06 A;  1TUC A;  1NLP C;  1ZSG A;  4RTY A;  2B86 A;  2L0A A;  1ABO A;  4RTU A;  4RTV A;  3NMZ C;  2EBP A;  2KRS A;  1RLQ C;  3SEM A;  1I0C A;  4R0K A;  2D0N A;  3O5Z A;  3NGP A;  1NEG A;  2KR3 A;  1SHF A;  2V1Q A;  2YT6 A;  2BTT A;  2O2O A;  4HVU A;  2CRE A;  3UA7 A;  2CT3 A;  2DF6 A;  2CH4 A;  1BK2 A;  1ZUY A;  3SHW A;  1OEB A;  2AK5 A;  2EGA A;  1X2K A;  1E6H A;  2BZ8 A;  4K11 A;  1VYT A;  3TVT A;  2F2X A;  2D8J A;  4J9I A;  4RUG A;  2EGC A;  2QDL A;  5HCK A;  3M0T A;  4J9E A;  1AZG B;  1M3B A;  1SRL A;  1YP5 A;  2OJ2 A;  2C0T A;  1PRL C;  1SPK A;  4LUE A;  1H3H A;  1RUW A;  1WIE A;  2M51 A;  1ZUK A;  2KE9 A;  1OPL A;  2J6F A;  2O9V A;  1H8K A;  2IIM A;  2GQI A;  4QT7 A;  1NYF A;  3H0F A;  2CUB A;  3EG0 A;  2RQW A;  2KRN A;  4ORZ A;  4HCK A;  1QKW A;  1B3Q A;  1WX6 A;  1WXT A;  1UG1 A;  2EQI A;  1WLP B;  4J9D A;  1ZUU A;  2DVJ A;  3I5S A;  1B07 A;  3M0P A;  1IO6 A;  1W1F A;  2ROL A;  1SRM A;  1T3L A;  4ESR A;  4DEY A;  2DX1 A;  1WXU A;  2LJ0 A;  1T3S A;  1JEG A;  2HDA A;  3I5R A;  1BB9 A;  4JZ4 A;  1QKX A;  1HD3 A;  1WI7 A;  2KRM A;  2V1R A;  2DL7 A;  1AD5 A;  2M0Y A;  1GCQ A;  1NYG A;  3UA6 A;  2LMJ A;  3VS1 A;  1HJD A;  2EYW A;  2RNA A;  2EPD A;  1SHG A;  3I9Q A;  4D8K A;  1JXO A;  1OPK A;  1QWF A;  2DBK A;  2JXB A;  3REB B;  1ZX6 A;  2X3X D;  1UGV A;  2K9G A;  4CC3 A;  1PKT A;  2J6K A;  1ARK A;  3NHN A;  1UJ0 A;  1KIK A;  1PRM C;  4Z8A A;  3H0I A;  2EVR A;  2JM8 A;  2DLP A;  1AVZ C;  2YDL A;  2NUZ A;  2O88 A;  2DL3 A;  4FSS A;  3VS6 A;  4HVW A;  4A63 B;  2A37 A;  2VVK A;  4JJB A;  2I0N A;  2YUQ A;  3QWX X;  4CC2 A;  1UUE A;  2FRY A;  3UF4 A;  2L2P A;  1U3O A;  2FO0 A;  2CH4 W;  3PVL A;  2SEM A;  1QWE A;  4E6R A;  5I11 A;  1EFN A;  5FWB A;  1QCF A;  1I07 A;  1UE9 A;  1YNZ A;  2J06 A;  1CKB A;  3PE0 A;  1WA7 A;  1T0J A;  2W0Z A;  3VRY A;  3VS2 A;  1JXM A;  2FG0 A;  2RQV A;  1WXB A;  1Y0M A;  2C0O A;  2LQN A;  1LCK A;  2AZV A;  1K9A A;  3EGU A;  1XOV A;  4X1V A;  2CUD A;  3IQL A;  2ENM A;  2J7I A;  1UJY A;  4IIM A;  1I1J A;  2L3P A;  3UAT A;  2SRC A;  1JO8 A;  2DNU A;  2D1X A;  2KYM A;  1BU1 A;  2EYZ A;  3VS5 A;  2DRM A;  1K0X A;  1K4U S;  2DBM A;  5GJV B;  2JT4 A;  2MIO A;  4LUD A;  2RQU A;  1PKS A;  1WFW A;  3RBB B;  3EG1 A;  2JMA A;  2F2V A;  1PWT A;  3VS0 A;  2RMO A;  3EHQ A;  1E6G A;  1VYV A;  4OMN A;  1M3A A;  2RF0 A;  2J6O A;  2JW4 A;  2JS0 A;  3KFV A;  1W6X A;  1X43 A;  1YWO A;  1ZBJ A;  1W70 A;  4OMQ A;  1UDL A;  3I35 A;  4AFZ C;  2W10 A;  2LNH B;  2J05 A;  2OI3 A;  1MUZ A;  2K7A A;  2JTE A;  2A28 A;  3QWY A;  2ED1 A;  1K1Z A;  2RPN A;  2HCK A;  1PNJ A;  2KT1 A;  2D8H A;  1YWP A;  1M27 C;  2GTJ A;  2HSP A;  2AKK A;  2FRW A;  1OOT A;  1WYX A;  4F17 A;  1OV3 A;  3U23 A;  5GJW B;  4AFQ C;  1GCQ C;  1M3C A;  2EKH A;  1Z9Z A;  2FPF A;  2LCS A;  1M30 A;  2LQW A;  4LN2 A;  3H0H A;  2MOX A;  5FW9 A;  2DMO A;  2LP5 A;  2PTK A;  4AG1 C;  2C0I A;  2O9S A;  4HVV A;  1A0N B;  2RQR A;  1PHT A;  5ECA A;  2LX7 A;  1AWJ A;  2LJ3 A;  5IHK A;  4HXJ A;  1U5S A;  1KJW A;  2KBT A;  4F16 A;  2VWF A;  3GBQ A;  3VS4 A;  1GFD A;  2ROT A;  1M8M A;  2DL4 A;  1V1C A;  2CSQ A;  1ZLM A;  2E5K A;  4JPB W;  2A36 A;  1RI9 A;  3M0Q A;  1UHC A;  5L23 A;  2DL5 A;  1KSW A;  1NLO C;  3THK A;  3M0R A;  3C0C A;  5FWC A;  2KNB B;  2GBQ A;  5IHI A;  2L3Q A;  3EG2 A;  1VA7 A;  4RTX A;  2DRK A;  1VYU A;  4RTZ A;  2BZX A;  3TSW A;  4Y92 A;  4Z89 A;  3ZL7 C;  2G6F X;  1K76 A;  1TG0 A;  2YUN A;  4AG2 C;  1X6B A;  1UTI A;  3JV3 A;  4CC4 B;  3VRZ A;  2CT4 A;  3R6N A;  1UEC A;  2HEQ A;  5IXF A;  2KYB A;  5IH2 A;  1TUD A;  2KRO A;  1CSK A;  3EHR A;  4AFU C;  2GTO A;  2FEI A;  3A98 A;  4Z88 A;  4D8D A;  2ED0 A;  4M4Z A;  1GL5 A;  2EYX A;  2ESW A;  2PZ1 A;  1AOJ A;  1MV3 A;  1Y57 A;  2XMF A;  4JJC A;  1UFF A;  2DYB A;  4LNP A;  1G83 A;  2JS2 A;  2HBW A;  2L3S A;  1YN8 A;  2DE0 X;  1GCP A;  4OMP A;  4RTT A;  2JM9 A;  4ZNX A;  2LJ1 A;  2EYY A;  4J9H A;  2OAW A;  3RNJ A;  2EW3 A;  1SEM A;  1X27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...