2K6DA

Cin85 sh3-c domain in complex with ubiquitin
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
62
structure length
62
Chain Sequence
b'KSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3 domain-containing kinase-binding protein 1
publication title Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain/ubiquitin
total genus 1
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k6dA00
4OMQA 1B3QA 2W10A 3M0TA 2EGCA 3KFVA 1JQQA 3UA6A 1ZSGA 1AVZC 2PZ1A 4LUDA 1T0JA 2A36A 3UATA 2F2VA 2GQIA 2L3SA 1KIKA 4J9IA 4OMNA 2IIMA 4RUGA 2CH4W 3PVQA 2EYWA 2EVRA 2CUDA 2HDAA 5IXFA 2HBWA 2L0AA 1WIEA 2KROA 2E5KA 3TVTA 3H0FA 2J05A 4LNPA 2ED1A 4OMMA 1OPLA 1V1CA 4R0KA 3CQTA 2KT1A 4OMLA 1Z9ZA 2KYBA 1UTIA 4Z89A 1MUZA 4IIMA 3UF4A 2JXBA 3ZL7C 1UECA 1WXBA 2KXDA 2KT8A 1GFCA 4ESRA 3REBB 3M0PA 1K0XA 3LH5A 1WXTA 4J9HA 1H92A 4Y92A 1X6GA 1EFNA 1AWWA 1X2KA 4AFZC 1BBZA 2DE0X 2DVJA 1M27C 3VS3A 1TUDA 2NUZA 2ESWA 3A98A 1W6XA 4JZ3A 3SHWA 1AZEA 1TUCA 1BU1A 1OOTA 2O9SA 2DRKA 4CC2A 1PRLC 2J7IA 1I0CA 1AOJA 2DYBA 2ED0A 4QT7A 5IHKA 4J9BA 1NLPC 2LJ0A 4D8KA 1SRMA 2JS2A 1VA7A 2SEMA 1PHTA 2DRMA 1KFZA 2F2XA 2DJQA 2YUOA 3REAB 3VRZA 1IO6A 2C0TA 1PKTA 2EGAA 2JS0A 2LJ1A 3VS2A 1X69A 3U23A 2GTJA 2A37A 2YT6A 1A0NB 1B07A 1LCKA 1M3CA 4Z88A 1MV3A 1M3AA 1KSWA 2VKNA 2J06A 2KYMA 2P4RA 1SHGA 2ENMA 3VS1A 2K7AA 2DF6A 2F2WA 4X1VA 2DL3A 2YSQA 1UE9A 2RNAA 2X3XD 4J9EA 1JEGA 3EG2A 1G2BA 2SRCA 1M3BA 3EG0A 2AKLA 1X27A 1AEYA 2NWMA 5EC7A 1RI9A 1X6BA 4AFSC 1K1ZA 1HSQA 1OV3A 1K0SA 4RTXA 4GBQA 3ULRB 1U5SA 2VVKA 2DM1A 2RQUA 3I5RA 1ZUUA 2AK5A 2C0OA 2EW3A 4HVUA 2DL4A 1UG1A 3I9QA 1ZX6A 1U3OA 3R6NA 2KRMA 1UDLA 1UJYA 2HEQA 2KXCA 1YCSB 1WX6A 1QLYA 1JU5C 2GGRA 2W0ZA 3H41A 1FMKA 2O9VA 2O31A 2BTTA 2ECZA 3M0QA 1Y57A 2HCKA 1OPKA 1ARKA 1GCQA 1Z9QA 2LMJA 2LJ3A 1T0HA 2AKKA 2EYYA 1WLPB 1K9AA 2LX7A 2RQVA 3PVLA 3VS4A 1ZLMA 2EGEA 1QWEA 2J6FA 1FYNA 2EBPA 2KEAA 2EYZA 4J9GA 2CDTA 1M30A 1UHCA 2DA9A 1GCPA 1I07A 5IHIA 4AG2C 2RN8A 4HCKA 1QKWA 3H0HA 1GRIA 5FW9A 1OEBA 2DL7A 5I11A 3M0UA 4ZNXA 1X43A 2K2MA 2RQWA 3VS7A 1JXOA 5ECAA 2FPFA 4JJBA 2LP5A 1YN8A 1CKAA 2PTKA 2OJ2A 4FSSA 1WYXA 2RMOA 4LN2A 2JW4A 1KJWA 2CSQA 1H3HA 2JTEA 2BZYA 4RTZA 2CT3A 4F14A 1XOVA 3NMZC 2L2PA 1AWXA 2FPEA 4RTUA 4JJCA 1AWOA 2X3WD 3NPFA 1NEBA 2VWFA 2G6FX 1JXMA 3SEMA 3FJ5A 3VS5A 2J6OA 1I1JA 1RUWA 4GLMA 4A63B 4IIOA 4M4ZA 1SPKA 2FG0A 1PKSA 4WCIA 4JPBW 2LNHB 5I22A 3EG1A 2A28A 4AG1C 2V1QA 4F17A 3EGUA 2O2OA 1N5ZA 2FRYA 5GJWB 1AWJA 1YWOA 3PE0A 4Z8AA 2RQRA 3GBQA 1AD5A 1WI7A 1T3LA 2RPNA 1MV0B 5L23A 1RLPC 2QDLA 2RQTA 4RTVA 1SEMA 5GJVB 4HVWA 2V1RA 2MOXA 1UJ0A 1CSKA 4RTYA 2JMCA 1W1FA 1ZBJA 4AFQC 2DLPA 2DMOA 4LUEA 2K6DA 2D8HA 1QWFA 4K11A 1GBRA 1U06A 3QWXX 4CC7A 5IXBA 1NYGA 1SHFA 3JV3A 3RNJA 2KR3A 4OMPA 2K3BA 1ABQA 2O88A 2KNBB 2MCNA 1UGVA 1K76A 2M0YA 3H0IA 2L3QA 1WA7A 2CT4A 2DNUA 2GBQA 2KE9A 2JM9A 4F16A 2AZVA 2EQIA 1E6GA 1VYUA 2I0NA 2CREA 2OAWA 2DBMA 1W70A 1AZGB 4ORZA 2DILA 4HVVA 1E6HA 1VYTA 2D8JA 1GL5A 2C0IA 3EG3A 1GFDA 2LQWA 5FWBA 2LCSA 4CC4B 1S1NA 4KRTA 2AZSA 3I5SA 1NEGA 5FWCA 3EHQA 4HXJA 1NLOC 2JT4A 2YUQA 2ABLA 4LE9A 1WFWA 1PWTA 4AFUC 5HCKA 3RBBB 3UA7A 1ZUYA 1NG2A 2CH4A 2EKHA 2MIOA 2LZ6B 3TSZA 1K4US 4J9FA 2FEIA 2DX1A 2A08A 4DEYA 1UHFA 2B86A 1T3SA 2EPDA 1M8MA 4OMOA 1QKXA 2HSPA 1RLQC 2JM8A 2GNCA 2LQNA 1H8KA 1NM7A 1HD3A 2BZ8A 2OI3A 2EYXA 3VRYA 4RTTA 4J9CA 3NGPA 1TG0A 1YWPA 1CKBA 1E7OA 1HJDA 3M0SA 1UFFA 2PNIA 1PRMC 1YP5A 2K79A 3THKA 4DEXA 4D8DA 1WDXA 2GTOA 3NHNA 4J9DA 2BZXA 2CUBA 3M0RA 1WXUA 4EIKA 2CSIA 1JO8A 2DBKA 2YUPA 4RTWA 1J3TA 2M51A 2ROLA 1YNZA 1Y0MA 2RF0A 3VS0A 2L3PA 1UUEA 2DL5A 2FRWA 2J6KA 2FO0A 2KGTA 3QWYA 5IHNA 3VS6A 1SSHA 1GBQA 3IQLA 2D1XA 2JMAA 5IH2A 1G83A 1SRLA 2H8HA 2DL8A 3O5ZA 2FPDA 1ZUKA 2XMFA 4E6RA 2K9GA 2YDLA 1QCFA 2YUNA 1VYVA 2KRSA 1ABOA 1GCQC 4JZ4A 1X2QA 1BK2A 4CC3A 1PNJA 2KBTA 3C0CA 4JJDA 3EHRA 2D0NA 3TSWA 2KRNA 1NYFA 3I35A 2ROTA 1BB9A
chains in the Genus database with same CATH superfamily
4OMQA 1Q86R 3C95A 1B3QA 3M0TA 5M9OA 2EGCA 3JSCA 4IUQA 4KUIA 3CCRQ 3UA6A 1KD1C 2DIQA 2PZ1A 1U1TA 2A36A 5KYYA 1Q82C 3OMGA 2QQAA 4Y91A 4A4HA 4J9IA 2BE7D 2IIMA 4J6YA 2CH4W 3HP9A 3JCMg 3V8JA 5GAOp 1KG1A 4ANJA 2GCXA 4M78F 2L0AA 3H9NA 2DTIA 4M78B 4M77D 4M7DC 2QQBA 1WIEA 3JRZA 2QDYB 2E5KA 3L2WA 3GPLA 5C6SA 3UWNA 1R0BG 2ED1A 5GANf 2DTOA 3BE3A 1V1CA 3RIRA 2HAXA 3VU3C 4N4HA 3CCRT 3OMCA 2KXDA 1M2VA 2KT8A 4DBQA 1GFCA 2YHTA 3E19A 4WF2A 1K0XA 4CRIA 4PJOA 1WXTA 2BE9B 5GMKl 4R55A 3M57A 3E9GA 1AWWA 4PJNA 3J80E 2DE0X 3TQ7P 4PJOE 2DVJA 3CPWS 2Y4YA 3FEOA 3HFOA 3VS3A 3A5ZB 3X25B 1Q86U 1OYXA 2ESWA 1W6XA 1YCYA 3MCAB 4JZ3A 3ASKA 1TUCA 4C92C 3OYCA 1PRLC 3KUFA 5IHKA 3CCUA 6AT1B 4D8KA 3CMEA 2OTJQ 1SRMA 2KQWA 1VA7A 2SEMA 3G71A 5GMKj 1K73C 1S72A 1Q7YR 3LH0A 1H3ZA 2FYKA 3G1JA 2ZPGB 3REAB 2C0TA 5EG2A 3VS2A 3CD6T 1X69A 2GTJA 3JB9F 2A37A 3EG9A 5LJ5f 1VQ7A 5GAN4 1MV3A 1M3AA 2DK3A 2K5LA 2K2VA 3I55A 3G6EQ 4OVAA 5CCAA 2P4RA 1SHGA 3JCMc 4F7UA 4X9DA 3VS1A 4FYWB 4X1VA 4JDSA 1LNXA 2DVEA 2X3XD 4F7UE 1JEGA 2K3YA 1X01A 3EG0A 3WXMB 2X35A 3OYEA 3VKIA 1X27A 2ZCFB 2CZ7B 3A8GB 1RI9A 3OYMA 2K4YA 2OAUA 4M7DF 2QGGA 3HRUA 4M7DB 5GMKe 2FB7A 3UPUA 3VYGA 1M2OA 3RUXA 2C0OA 2EW3A 2DL4A 3EGDB 3G6ET 4JS5A 2CP2A 1ZSZA 1Q7YU 3G4ST 1U3OA 5LJ3g 1UDLA 1WHGA 3A1PA 2H3JA 2HEQA 2KXCA 1QLYA 3AHUA 3JCMb 3PMIA 3H41A 2O31A 2BTTA 2ECZA 3M0QA 2HCKA 1ARKA 4D6WA 4RCBA 1FXXA 4KGZB 1YJ9A 4HCZA 4QVCA 2LX7A 1MMDA 3VS4A 3PVLA 3P8HA 4C92F 1ZLMA 2E41A 3S3OA 2EGEA 4KH1B 2J6FA 1FYNA 4C92B 4UC4A 3RKXA 3EAEA 5GAN6 1UHCA 3H6ZA 3M9QA 4J7IA 3OW2P 2RK2A 5FW9A 2P0KA 2DXBA 3M0UA 2VGMA 3VS7A 4C5HA 2YLBA 3X20B 2LP5A 2X4YA 2RM4A 4F04B 1IZ6A 4RG2A 2JW4A 4ZTFA 2COYA 2EFIA 4M78D 2MWPA 4RMOA 1XOVA 5KYYB 1OU9A 2L2PA 2FPEA 2VWFA 1VOMA 1JXMA 3FJ5A 1JJ2S 3VS5A 3RMQA 2J6OA 2YWWA 2BUDA 1I1JA 1RUWA 4GLMA 1VQ4Q 3DKMA 5FU6C 4IIOA 1QVGS 1PKSA 4JPBW 5I22A 3EG1A 4M78G 2A28A 4J7FA 2O2OA 1N5ZA 2BIVA 4B9WA 3X28B 3GOXA 1O9SA 5I2MA 5GANj 4PLLA 2EIFA 2V26A 3FLGA 3FB9A 2RPNA 5L23A 1X75C 2YXYA 1MNDA 1QCNA 2MOXA 1UJ0A 2GFAA 3CCVQ 8AT1B 4EMKC 4PJOB 4LUEA 1FMWA 1ZBXA 1VQMA 4K11A 4RKUE 1GBRA 1RAGB 4CC7A 5CKFA 1VQ4T 1KHCA 1SHFA 1YITQ 3RNJA 2KR3A 4OP0A 2FZGB 3X26B 1HXDA 1B34A 4ZN1A 2XU8A 4MZPA 1QVFA 2O88A 2MCNA 3JB9D 2I2LA 1K76A 2L3QA 3VJPA 2JOYA 2A3LA 4R56A 1W4SA 2HQXA 2JM9A 5DLOA 1E6GA 1NPPA 3QPHA 4E7ZA 3CCVT 2HBPA 5GANe 1YHQQ 4HVVA 3EG9B 1E6HA 2LCSA 4KRTA 4N4IA 5LJ5j 4A4GA 1YITT 4HXJA 3JB9H 2XHCA 2YUQA 5CK9A 5LJ3h 4AFUC 4HCBA 5HCKA 5GMKm 2XDDA 3FC3A 3FJPA 1KK7A 2EKHA 1EIFA 2CKKA 1K4US 1T3SA 2EPDA 2JVVA 3ZBDA 1M8MA 5FU6B 4IURA 2XIDA 2BKDN 4YTLA 1YHQT 3OYFA 1SKUB 2GNCA 4M7DG 2WSFE 1BCOA 3E1SA 2RA2A 5KCOA 1M8VA 2BZ8A 2EQMA 4MZTA 1YWPA 3CMAQ 5GAOl 1KD1R 4DA4A 4KUDK 3V7CA 2PNIA 1PRMC 2DXTA 3QJ6A 2NUTA 3I56A 3CC7A 1Q82R 5LJ5e 2K79A 1OX9A 5HKCA 2D9TA 3CC2A 4DEXA 4C92D 1QMCA 1VQ8A 2NLUA 1WDXA 1BI3A 1XNIA 3A8MB 4EMKB 3M0RA 2CUBA 2QYZA 2CSIA 1JO8A 1M90C 1YI2Q 4RTWA 2ROLA 1YNZA 4QVDA 3CCMT 5J3BA 2DL5A 3GNGA 1GBQA 3IQLA 5IH2A 1G83A 1V29B 4E7IA 3KBGA 4IUUA 1I4K1 1W2BS 3O5ZA 3NFCA 4IKFA 2K9GA 4C92G 3CCJA 1GCQC 1PNJA 2KBTA 4BDYA 4OB2B 2D0NA 3TSWA 2MAMA 2QASA 4BE0A 1JB0E 2DYIA 3I35A 3KFVA 1JQQA 1AVZC 1VQPA 1YJNQ 1YBYA 1T0JA 4LUDA 3UATA 1AT1B 1U1SA 1Y96B 1KQSS 2GQIA 4RG8A 2L3SA 1KIKA 4OMNA 5GAMf 3CC4Q 3CBPA 3JCMJ 1KD1U 3PVQA 4OGEA 1MMGA 5CO7A 1Q82U 2RJEA 3JB9J 3MP6A 1N6AA 1K73R 4HA8A 2HQEA 3TVTA 1N9SA 3H0FA 1AHJB 4LNPA 1FWZA 1DJ7B 3JCMQ 4Q5WA 1VQ6A 3L1AA 2JTFA 3ZEHA 2DEUA 1MUZA 3JCMX 3UF4A 1YJNT 3GF5A 3QYGB 2QEXA 1KHIA 3M0PA 2ZPHB 3CCLA 3CC4T 1QVGP 3LH5A 4J9HA 1H92A 5CKDA 4Y92A 4N0AC 4ELYC 1X2KA 2VC8A 5J26A 1BBZA 2CP0A 2DFUA 1VQ5Q 5FRMA 1Y07A 4PJOG 1TUDA 1NE8A 2CP3A 1PM3A 3M5AA 3HPWA 4ZGJB 1AZEA 2K57A 2MMPA 2MYSA 1BU1A 2O9SA 2QAZA 3QYHB 2KSSA 2QXFA 1I0CA 1RL2A 2JNGA 2ED0A 3MP1A 1NLPC 1K9MC 1B34B 2JS2A 1M9SA 3G4SA 2L5QA 3HFNA 2DRMA 3QUIA 5GANg 2F2XA 2DJQA 1VQOQ 3L2UA 2FL7A 2YUOA 1PSEA 4FT4A 2KAFA 2E6NA 1M1FA 2DZ9A 1SG5A 1K73U 4VUBA 3CXCS 5AT1B 3H8ZA 3P8BB 5CQYA 4XU1A 2KMTA 4Z88A 3MEAA 1SF9A 1KSWA 4B6MA 2VKNA 2X4XA 2J06A 1WJSA 3S3NA 2HSEB 1RAAB 2EAYA 4BI3A 2K7AA 2YSQA 2WSEE 1Y71A 2RNAA 4J9EA 1OI1A 4BDZA 1VQOT 1M4ZA 2K3XA 3CCRA 2VASA 5KYUB 1AEYA 2NWMA 1X6BA 4PLIA 1OV3A 1N8RC 4GBQA 4BE1A 4LDUA 5GAOq 1U5SA 3OW2A 2RQUA 4HVUA 2M02A 4CI0C 1VQ9Q 3RKWA 3QJYA 4NS5A 4C8QE 5GAOr 4FL6A 2CZ0B 4A4EA 2VGNA 1ZX6A 5KE3A 2NUPA 5KCHA 4XTZA 3P8DA 3LWIA 1C6VX 1MHNA 2E4HA 4J6WA 1TWBA 1JU5C 2NUTB 4EDUA 1YJWQ 4OB0B 1WQ7A 2GF7A 3DLLA 2PVGB 1Z9QA 2LMJA 3CCQQ 2LX9A 4OB3B 1O75A 3CD6A 2KVQG 1K9AA 4PK4A 2PQWA 2QA4A 2A7YA 2EBPA 2KEAA 2FHDA 4J9GA 1VQ9T 3OSVA 2DA9A 4J8OA 2LC4A 2DD5A 4AG2C 1KC8C 2RN8A 1WNLA 3MKDA 4HCKA 1PCXA 2CP7A 1GRIA 1OEBA 5I11A 4NL3A 2K2MA 2RQWA 5KYXB 2RHIA 1YJWT 4M75A 3QSUA 3QO3A 2PTKA 3QZ9B 1WYXA 3VUBA 1W2BP 3JCMP 3D7SB 3EGXB 1D09B 1KJWA 3URGA 4M75E 1RADB 5GAOm 3OYJA 3CCQT 2BZYA 2O4XB 4F14A 1F1BB 4JJCA 2QI2A 1AWOA 3OS2A 4J5YA 5GAMj 1Q95G 1D0YA 3V8KA 3NTKA 2ZGWA 3CEYA 3V7SA 3G6EA 2YRCA 3QBYA 2ATCB 4M4ZA 4PNOA 1VIFA 5D6YA 5D7UA 2FG0A 3J7AF 5A0DA 2LNHB 2LVMA 4AG1C 1S72Q 1KQSP 3EGUA 2RH2A 2DD4A 2COWA 1GXIE 5GJWB 3OS0A 4X34A 3JCMf 2DO3A 1C1AA 2OTJT 3HHTB 5GANh 1T3LA 3OQ5A 2PUKB 1MV0B 4IUVA 2K5FA 3C12A 4XTVA 1G8XA 2RQTA 4RTVA 4E7LA 1YIJQ 4HVWA 1VQ7Q 2JTMA 1CSKA 1TSFA 4JLIA 1SSFA 2JMCA 1ZBJA 2DLPA 1JBMA 4M7AE 1QWFA 1U06A 4BE2A 2RI5A 1N27A 4L6V5 4C5GA 1NYGA 3NTHA 4Y28E 4ELZC 1QP3A 3BDLA 4MMLA 1S72T 4TVRA 5GAMe 1BKBA 4PJOC 4DBHA 4DBFA 2KNBB 1UGVA 2M0YA 2HMAA 4GY5A 3L42A 2CT4A 2DNUA 3EFOB 2GBQA 3LWHA 1YIJT 1VYUA 1MMNA 2LDMA 3JCMV 2V8KA 4M75C 2DILA 1WPYA 1XQHA 2D8JA 1GL5A 2C0IA 3EG3A 1GFDA 2LQWA 4HT8A 3I5SA 2XICA 3EHQA 3TREA 3OYYA 3JAME 4A4KA 4FT2A 2ABLA 3M56A 1WFWA 2E1HA 4M77A 1M90R 3CXCP 3VV0A 2CH4A 4M77E 3S6WA 2LZ6B 3ZFJA 4ZN3A 2DX1A 4DEYA 4GLKA 3MO8A 3QHSA 1TTHB 1JRIA 1YFNA 1WHMA 3SD4A 1BI1A 2HKNA 1IHWA 1QKXA 1RLQC 1WQWA 4QQ6A 2RJFA 3SWNA 5GANd 2YLCA 1QP2A 3QG1A 1WHKA 1HD3A 2OI3A 3TU4K 2EYXA 3VRYA 1VQ4A 4RTTA 3FRNA 4J9CA 1TG0A 1BI2A 2NUPB 1IRXA 4JRPA 3V7RA 2YRVA 4D8DA 2GTOA 4DOVA 4FIBA 2BZXA 4EIKA 2DBKA 2YUPA 3M59A 2M51A 1ZSZC 3T9NA 2LT1A 4IUTA 3CCSA 1PC0A 1UUEA 2J6KA 4QQGA 2KGTA 5LJ3f 3OS1A 3CCVA 1QVFS 3JCMW 2JMAA 2PVDB 1M2VB 1M90U 2M16A 4PJOF 2DL8A 2CZ1B 2XMFA 2YDLA 2YUNA 1X6OA 3OYIA 1YITA 1K8AC 1BIAA 3KXTA 3C0CA 3M53A 2KI7A 2KRNA 2ZPIB 4C0DB 4E7KA 4M75F 4QVZA 4JRQA 5LJ5d 3SDZA 4M75B 2E3HA 2F2VA 3EH2A 1IB8A 3CBOA 4JJNK 3MHXA 3CPWP 2RJDA 1VQMQ 2KDSA 3E2UA 1YHQA 2F5KA 2E70A 5IN1A 5IXFA 9ATCB 2K5IA 2D0QB 1K9MR 1EZZB 4QW2A 2EJGA 2VXFA 2QQSA 3GLXA 2P0QA 1VQLQ 4XAXB 7AT1B 1IXDA 4EMHA 3SWNC 1MMAA 4R0KA 4F7UF 3CQTA 2RB6A 3M4GA 2KT1A 4OMLA 4F7UB 2KYBA 4PJJA 3QIIA 4Z89A 1OQKA 4M7DD 4XTYA 3CCEQ 2JXBA 1B7TA 1RI0A 1WXBA 3ZL7C 2EKOA 2QQ9A 3CCMA 3V8LA 3RDVA 1EFNA 1IREB 3M54A 4FYXB 4AFZC 1LOJA 2OX7A 5A0LA 2GQVA 1M27C 5GAMg 4ZGEB 1RAFB 2NUZA 3A98A 2ZZDA 3SHWA 1VQLT 2XKOC 2EQJA 1OOTA 4A54A 1Y7XA 2DRKA 4CC2A 2J7IA 1AOJA 4J9BA 1ZSZB 3S3MA 2LJ0A 4E7JA 1N8RR 3CCET 3OSSC 4BY6C 2R57A 1FMVA 1K9MU 2EGAA 2LCLA 2P4TA 3HTRA 2QTXA 2YT6A 2A0FB 2DIGA 1M3CA 4OB1B 2VUBA 4MZMA 4JRIA 1PD0A 4M78E 3JCMe 4PFPA 5CIUA 3CC7Q 3I56Q 1H641 2ENMA 2X9HA 3MEUA 1D1BA 2RK1A 1P92A 2F2WA 3CC2Q 2DL3A 3CMAT 1VQ8Q 1UE9A 4M77B 2RHXA 3EG2A 1TXQA 1G2BA 4FM4B 4LDVA 1M3BA 2MWOA 1YJNA 3PIOA 5LL6S 5EC7A 5HK3A 1YI2T 4O6JA 2OTLA 4PJLA 4PL6A 4FU6A 2B8AA 1KC8R 2VVKA 2DM1A 2GFUA 4LDXA 3I5RA 2AK5A 1N9RA 3SWNB 4FCYA 1N8RU 1UG1A 3I9QA 2CP6A 3I56T 3R6NA 2QQRA 3CC2T 2KRMA 4PFOA 5HY6A 1UJYA 5FLXE 1YCSB 2E3IA 1UGQB 1V76A 1WX6A 3OB9A 1VQPQ 2GGRA 1FMKA 2AIRB 1ZA2B 1R8OB 1C0MA 1OPKA 4PJOD 3PTAA 1JJ2P 1VIEA 1FX7A 4LD6A 1M5Q1 1OU8A 1WLPB 2ZPBB 1QW1A 4HT9A 4JRKA 1QWEA 5HK0A 2L8DA 5GAOn 1MGQA 2M1HA 2DKGA 2R58A 5IHIA 5LJ3j 3HRTA 3GP8A 2DXUA 5CKEA 2PU9B 1VQNQ 1XJWB 2DL7A 4BY6B 3MEVA 1VUBA 4ZNXA 2JJ9A 5C0MA 1JXOA 3AT1B 2FPFA 5ECAA 4C0FA 1KC8U 1QVFP 1YN8A 1CKAA 4E7SA 3GNFB 2QEXQ 3CCLQ 2Y4XA 4MDXA 1VQOA 3UT1A 5GMKh 4HCCA 1PD1A 2CSQA 3MPUB 3OYBA 4M7DE 4M75G 1LVKA 2CT3A 1AWXA 2F5TX 4RTUA 2E5QA 4IUPA 4QKUA 2MPXC 5GAMh 2V8IA 3DB3A 1VQ5T 1VQNT 2F1LA 3A8HB 1LJOA 3VYHB 4BD3A 4XTXA 4F17A 5LJ3e 5D6XA 5KH6A 1AWJA 1YWOA 3PE0A 2QEXT 1BI0A 3CCLT 2G3RA 3GBQA 2X4JA 5IAYA 3HKSA 4F7UG 2QDLA 1VQKQ 1D0XA 1WZOA 1HK9A 2C06A 5GJVB 2E64A 2EWNA 1IGQA 2V1RA 3QDRB 4V2SA 1UGPB 1QQJA 2HL5C 3FDRA 4C92E 3X24B 2DMOA 2K6DA 2D8HA 1NPRA 4JUVA 3QWXX 2CS7A 3BW1A 4C8QA 1VQ9A 5IXBA 2AHJB 5FU7C 1ACMB 3F70A 3JV3A 2LNVA 5LJ5g 3ER0A 3NTIA 1UB4A 2MF2A 3M58A 1ABQA 2K3BA 4MMKA 2WSCE 3WVDB 5KYNA 2LQKA 5CVIA 3H0IA 1YJWA 4LXCA 1WA7A 1OZ3A 1TU0B 1VQKT 4QQDA 2HZYA 4F16A 2AZVA 4AT1B 3CCQA 3A8LB 2CREA 2OAWA 2DBMA 4KGXB 1W70A 2P84A 2WACA 3PGGA 5FWBA 4Z02A 4CC4B 1S1NA 2AZSA 4KULA 1TUGB 1NLOC 2JT4A 8ATCB 2QG9B 1PWTA 3EFSA 2NYSA 3UA7A 1M1KC 1ZUYA 5GAMd 1UGSB 3TSZA 3INZA 4L5GA 4M77G 2OTJA 3CD6Q 1UHFA 4LD9K 2H3EB 4JLGA 2QA4Q 2DPPB 3LW5E 4FW2A 1K8AR 1QCOA 1BIBA 1Q81R 2JM8A 4ME7A 3RKYA 2LQNA 1H8KA 1NM7A 1R0CB 4OMFB 2RHYA 1CKBA 3L2QA 1I5OB 3M0SA 3CCUQ 4DQ2A 3CMEQ 3G71Q 3A8OB 3THKA 4C8QC 4OF1A 3CPWA 2IG0A 5GAN7 1WXUA 2V8JA 1J3TA 2QA4T 3Q1JA 3VS0A 2QK0A 4FYYB 1YIJA 2RI3A 5FU7B 3VS6A 4M7AA 1SRLA 2P0PA 5KE2A 3OYNA 4RCCA 2FPDA 3I55Q 1QCFA 3BFMA 1VYVA 3HSBA 2KRSA 1KQ1A 3MP8A 4JJDA 3CCUT 3CMET 3G71T 1K8AU 2W10A 1Q81U 1ZSGA 1WJRA 3N5BB 4RUGA 1LPLA 4C0DC 2EYWA 2EVRA 1VQ7T 2CUDA 2HDAA 5DM7R 2HBWA 2D6FA 3I55T 1D3BA 2KROA 5LJ5h 2J05A 4EMKA 3OBYA 4OMMA 1OPLA 3GIBA 1I5LA 2HNIA 2VV5A 1Z9ZA 3PFSA 1UTIA 4EMGA 5CQXA 4BB7A 5GAN3 4IIMA 2RI2A 1UECA 1MNEA 4ESRA 3REBB 3LGFA 1YJ9Q 3JCMh 2LRQA 5CKBA 1Q86C 1X6GA 4E7HA 2DETA 4PKCC 3RR6A 3G7ZA 2JN0A 2M0OA 2RD1A 3OYAA 2XDPA 3OY9A 1I8FA 4C8QF 4C8QB 1RACB 2PUOB 4M7AC 2DYBA 4QT7A 2CP5A 4L59A 2DXCA 1Y96A 1PHTA 1IHVA 2AT1B 3ME9A 1KFZA 1ZA1B 4HKEA 2FVUA 2X4WA 3PMTA 3RERA 4XTWA 3VRZA 2ZPEB 1IO6A 1TOVA 1PKTA 1YJ9T 2JS0A 3BY7A 2LJ1A 3HRSA 3QKJA 3U23A 5A2QE 4J6XA 1A0NB 1B07A 5GMKi 1LCKA 5GAN8 1WHJA 2RO0A 5AYFA 1UEBA 3RMSA 2YRDA 1IGUA 1OULA 1RAIB 3UDCA 2KYMA 3RESA 3L2RA 4E47A 3PNWC 2DF6A 1TS9A 3E9FA 1QVPA 1Q81C 2MK5A 2IPOB 2DTHA 4WTOB 4XU0A 4II1A 1JJ2A 3M4YA 1RABB 2SRCA 2AKLA 2RJCA 3CCSQ 4XQ3A 4DBRA 1QVGA 3OYGA 4AFSC 2HD0A 1K1ZA 1HSQA 1K0SA 1NJIR 4O5VA 1G5VA 4RTXA 5IT9E 4M77C 3ULRB 1Q7YC 1G3SA 3SFMA 2Z0WA 5GAN5 1ZUUA 4E2FB 1WGSA 3VUZA 1RAHB 3L2VA 3META 3LYIA 2DAQA 1D1CA 3JCMd 2E65A 1VQLA 3OYHA 3LGLA 4A4FA 4KT0E 2W0ZA 2O9VA 5J39A 3QDFA 3CCST 1Y57A 4XK8E 3CCEA 1GCQA 5L8RE 3DLMA 1OX8A 4PFZA 2L3RA 2LJ3A 1T0HA 2AKKA 2EJFA 2F69A 3OA6A 5KYWA 2E6ZA 2RQVA 2EYYA 2CZ6B 5I21A 1NZ9A 2E10A 2M9UA 3JB9G 1VQMT 3JB9I 4M7AF 3DB4A 2EYZA 4KH0B 4M7AB 2CDTA 1M30A 1GCPA 1I07A 4C0GA 3CPFA 1G3YA 1QKWA 3H0HA 4BUGA 1X43A 5KYUA 3CMAA 5A0GA 3L2ZA 1NJIU 4JJBA 2KY9A 5GAN2 2EQKA 2OJ2A 4FSSA 1XTDA 2RMOA 4LN2A 3CCMQ 2FZCB 2XDBA 1H3HA 2JTEA 3OBWA 2HQHA 2EQUA 4RTZA 1U8RA 3NMZC 1UGRB 4DOWA 4NOYA 1YI2A 1NBEB 1PG5B 2X3WD 3NPFA 1NEBA 2G6FX 3SEMA 1HYOA 4M78A 2QGFB 2XI9A 2ZAEA 2E12A 4A63B 1SPKA 2VYTA 2ZPFB 4AMCA 1D3BB 4WCIA 3BDUA 4N0AA 4ATOA 2HKQB 2V1QA 4FW1A 4BACA 2EYQA 2XG8D 2RHUA 2FRYA 4XU3A 3WVEB 4ZGDB 4M77F 4Z8AA 2RQRA 2DJZA 1AD5A 1OZ2A 1WI7A 4N4GA 4B9XA 3C94A 3O8VA 1RLPC 2O01E 2PVOB 3MEWA 1SEMA 4C8QD 5D6WA 4LDWA 4NL2A 4KGVB 4RTYA 1W1FA 4XTUA 2IVWA 4PJMA 4AFQC 3J81E 2LCCA 2X51A 3CC4A 3EH1A 2R5AA 2DEQA 1M1KR 1TH7A 4ZTJA 5KYXA 3CCJQ 2DERA 1EX4A 3C4SA 2DZCA 3CC7T 4C8QG 2XD0A 3EGXA 4OMPA 4FYVB 2LTOA 3QXEB 1VQ8T 3EFRA 1W2BA 1WHHA 2O4XA 5LJ3d 1M1GA 2OTLQ 3MJXA 2KE9A 4X9CA 2EQIA 3OYKA 2I0NA 3M55A 1PSFA 3OYDA 2VXEA 5FRNA 4JS4A 1AZGB 4ORZA 2FZKB 1VYTA 1BCMA 4J83A 4C5IA 1NEGA 3CCJT 5FWCA 3PT9A 2XK0A 2CYZB 1D0ZA 2L89A 1VQ5A 2CGHA 4LE9A 1VQNA 2LT4A 4XU2A 1KQSA 1NJIC 4M75D 3RBBB 1VQ6Q 4M78C 1NG2A 2MIOA 2COZA 4J9FA 1VQPT 4A53A 2FEIA 2OTLT 2A08A 4BI4A 2B86A 2EJ9A 5CR2A 1M1KU 4M7DA 3LX7A 4C0ZA 3SB2A 4C5EA 1G3WA 4OMOA 4LDYA 2LQ8A 2HSPA 5CAIA 1R77A 3EGDA 5DY9A 3HL8A 2JZ2A 1ZHIA 1KQ2A 3OS5A 1G3TA 4KBMB 3NGPA 4P5NA 1E7OA 1HJDA 1RAEB 2Y90A 1I81A 2VB6A 1ZQ1A 1UFFA 3TCJA 1VQ6T 1YP5A 3EFOA 5I2SA 3R6OA 3CBMA 3G4SQ 3NHNA 2RHZA 4J9DA 4MDWA 3OW2S 4M7AD 4BI8B 2JUFA 1VQKA 1Y0MA 5DLQE 2RF0A 3PIPA 3OYLA 2L3PA 2FRWA 4C92A 3QWYA 5IHNA 2FO0A 5CKHA 5KYWB 1SSHA 1WHLA 2D1XA 1WJQA 2H8HA 3FIFA 2HL3A 3LLRA 2QTVA 1ZUKA 4E6RA 5FROA 1BYMA 3QZ5B 1ABOA 4M7AG 4JZ4A 1X2QA 1BK2A 4CC3A 3CXCA 2KK4A 3EHRA 2R5MA 2MI6A 4FSXA 3TEEA 4OGCA 4EPCA 1NYFA 1D1AA 2ROTA 1BB9A
chains in the Genus database with same CATH topology
4OMQA 1B3QA 2W10A 3M0TA 2EGCA 3KFVA 1JQQA 3UA6A 1ZSGA 1AVZC 2PZ1A 4LUDA 1T0JA 2A36A 3UATA 2F2VA 2GQIA 2L3SA 1KIKA 4J9IA 4OMNA 2IIMA 4RUGA 2CH4W 3PVQA 2EYWA 2EVRA 2CUDA 2HDAA 5IXFA 2HBWA 2L0AA 1WIEA 2KROA 2E5KA 3TVTA 3H0FA 2J05A 4LNPA 2ED1A 4OMMA 1OPLA 1V1CA 4R0KA 3CQTA 2KT1A 4OMLA 1Z9ZA 2KYBA 1UTIA 4Z89A 1MUZA 4IIMA 3UF4A 2JXBA 3ZL7C 1UECA 1WXBA 2KXDA 2KT8A 1GFCA 4ESRA 3REBB 3M0PA 1K0XA 3LH5A 1WXTA 4J9HA 1H92A 4Y92A 1X6GA 1EFNA 1AWWA 1X2KA 4AFZC 1BBZA 2DE0X 2DVJA 1M27C 3VS3A 1TUDA 2NUZA 2ESWA 3A98A 1W6XA 4JZ3A 3SHWA 1AZEA 1TUCA 1BU1A 1OOTA 2O9SA 2DRKA 4CC2A 1PRLC 2J7IA 1I0CA 1AOJA 2DYBA 2ED0A 4QT7A 5IHKA 4J9BA 1NLPC 2LJ0A 4D8KA 1SRMA 2JS2A 1VA7A 2SEMA 1PHTA 2DRMA 1KFZA 2F2XA 2DJQA 2YUOA 3REAB 3VRZA 1IO6A 2C0TA 1PKTA 2EGAA 2JS0A 2LJ1A 3VS2A 1X69A 3U23A 2GTJA 2A37A 2YT6A 1A0NB 1B07A 1LCKA 1M3CA 4Z88A 1MV3A 1M3AA 1KSWA 2VKNA 2J06A 2KYMA 2P4RA 1SHGA 2ENMA 3VS1A 2K7AA 2DF6A 2F2WA 4X1VA 2DL3A 2YSQA 1UE9A 2RNAA 2X3XD 4J9EA 1JEGA 3EG2A 1G2BA 2SRCA 1M3BA 3EG0A 2AKLA 1X27A 1AEYA 2NWMA 5EC7A 1RI9A 1X6BA 4AFSC 1K1ZA 1HSQA 1OV3A 1K0SA 4RTXA 4GBQA 3ULRB 1U5SA 2VVKA 2DM1A 2RQUA 3I5RA 1ZUUA 2AK5A 2C0OA 2EW3A 4HVUA 2DL4A 1UG1A 3I9QA 1ZX6A 1U3OA 3R6NA 2KRMA 1UDLA 1UJYA 2HEQA 2KXCA 1YCSB 1WX6A 1QLYA 1JU5C 2GGRA 2W0ZA 3H41A 1FMKA 2O9VA 2O31A 2BTTA 2ECZA 3M0QA 1Y57A 2HCKA 1OPKA 1ARKA 1GCQA 1Z9QA 2LMJA 2LJ3A 1T0HA 2AKKA 2EYYA 1WLPB 1K9AA 2LX7A 2RQVA 3PVLA 3VS4A 1ZLMA 2EGEA 1QWEA 2J6FA 1FYNA 2EBPA 2KEAA 2EYZA 4J9GA 2CDTA 1M30A 1UHCA 2DA9A 1GCPA 1I07A 5IHIA 4AG2C 2RN8A 4HCKA 1QKWA 3H0HA 1GRIA 5FW9A 1OEBA 2DL7A 5I11A 3M0UA 4ZNXA 1X43A 2K2MA 2RQWA 3VS7A 1JXOA 5ECAA 2FPFA 4JJBA 2LP5A 1YN8A 1CKAA 2PTKA 2OJ2A 4FSSA 1WYXA 2RMOA 4LN2A 2JW4A 1KJWA 2CSQA 1H3HA 2JTEA 2BZYA 4RTZA 2CT3A 4F14A 1XOVA 3NMZC 2L2PA 1AWXA 2FPEA 4RTUA 4JJCA 1AWOA 2X3WD 3NPFA 1NEBA 2VWFA 2G6FX 1JXMA 3SEMA 3FJ5A 3VS5A 2J6OA 1I1JA 1RUWA 4GLMA 4A63B 4IIOA 4M4ZA 1SPKA 2FG0A 1PKSA 4WCIA 4JPBW 2LNHB 5I22A 3EG1A 2A28A 4AG1C 2V1QA 4F17A 3EGUA 2O2OA 1N5ZA 2FRYA 5GJWB 1AWJA 1YWOA 3PE0A 4Z8AA 2RQRA 3GBQA 1AD5A 1WI7A 1T3LA 2RPNA 1MV0B 5L23A 1RLPC 2QDLA 2RQTA 4RTVA 1SEMA 5GJVB 4HVWA 2V1RA 2MOXA 1UJ0A 1CSKA 4RTYA 2JMCA 1W1FA 1ZBJA 4AFQC 2DLPA 2DMOA 4LUEA 2K6DA 2D8HA 1QWFA 4K11A 1GBRA 1U06A 3QWXX 4CC7A 5IXBA 1NYGA 1SHFA 3JV3A 3RNJA 2KR3A 4OMPA 2K3BA 1ABQA 2O88A 2KNBB 2MCNA 1UGVA 1K76A 2M0YA 3H0IA 2L3QA 1WA7A 2CT4A 2DNUA 2GBQA 2KE9A 2JM9A 4F16A 2AZVA 2EQIA 1E6GA 1VYUA 2I0NA 2CREA 2OAWA 2DBMA 1W70A 1AZGB 4ORZA 2DILA 4HVVA 1E6HA 1VYTA 2D8JA 1GL5A 2C0IA 3EG3A 1GFDA 2LQWA 5FWBA 2LCSA 4CC4B 1S1NA 4KRTA 2AZSA 3I5SA 1NEGA 5FWCA 3EHQA 4HXJA 1NLOC 2JT4A 2YUQA 2ABLA 4LE9A 1WFWA 1PWTA 4AFUC 5HCKA 3RBBB 3UA7A 1ZUYA 1NG2A 2CH4A 2EKHA 2MIOA 2LZ6B 3TSZA 1K4US 4J9FA 2FEIA 2DX1A 2A08A 4DEYA 1UHFA 2B86A 1T3SA 2EPDA 1M8MA 4OMOA 1QKXA 2HSPA 1RLQC 2JM8A 2GNCA 2LQNA 1H8KA 1NM7A 1HD3A 2BZ8A 2OI3A 2EYXA 3VRYA 4RTTA 4J9CA 3NGPA 1TG0A 1YWPA 1CKBA 1E7OA 1HJDA 3M0SA 1UFFA 2PNIA 1PRMC 1YP5A 2K79A 3THKA 4DEXA 4D8DA 1WDXA 2GTOA 3NHNA 4J9DA 2BZXA 2CUBA 3M0RA 1WXUA 4EIKA 2CSIA 1JO8A 2DBKA 2YUPA 4RTWA 1J3TA 2M51A 2ROLA 1YNZA 1Y0MA 2RF0A 3VS0A 2L3PA 1UUEA 2DL5A 2FRWA 2J6KA 2FO0A 2KGTA 3QWYA 5IHNA 3VS6A 1SSHA 1GBQA 3IQLA 2D1XA 2JMAA 5IH2A 1G83A 1SRLA 2H8HA 2DL8A 3O5ZA 2FPDA 1ZUKA 2XMFA 4E6RA 2K9GA 2YDLA 1QCFA 2YUNA 1VYVA 2KRSA 1ABOA 1GCQC 4JZ4A 1X2QA 1BK2A 4CC3A 1PNJA 2KBTA 3C0CA 4JJDA 3EHRA 2D0NA 3TSWA 2KRNA 1NYFA 3I35A 2ROTA 1BB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMQ A;  1B3Q A;  2W10 A;  3M0T A;  2EGC A;  3KFV A;  1JQQ A;  3UA6 A;  1ZSG A;  1AVZ C;  2PZ1 A;  4LUD A;  1T0J A;  2A36 A;  3UAT A;  2F2V A;  2GQI A;  2L3S A;  1KIK A;  4J9I A;  4OMN A;  2IIM A;  4RUG A;  2CH4 W;  3PVQ A;  2EYW A;  2EVR A;  2CUD A;  2HDA A;  5IXF A;  2HBW A;  2L0A A;  1WIE A;  2KRO A;  2E5K A;  3TVT A;  3H0F A;  2J05 A;  4LNP A;  2ED1 A;  4OMM A;  1OPL A;  1V1C A;  4R0K A;  3CQT A;  2KT1 A;  4OML A;  1Z9Z A;  2KYB A;  1UTI A;  4Z89 A;  1MUZ A;  4IIM A;  3UF4 A;  2JXB A;  3ZL7 C;  1UEC A;  1WXB A;  2KXD A;  2KT8 A;  1GFC A;  4ESR A;  3REB B;  3M0P A;  1K0X A;  3LH5 A;  1WXT A;  4J9H A;  1H92 A;  4Y92 A;  1X6G A;  1EFN A;  1AWW A;  1X2K A;  4AFZ C;  1BBZ A;  2DE0 X;  2DVJ A;  1M27 C;  3VS3 A;  1TUD A;  2NUZ A;  2ESW A;  3A98 A;  1W6X A;  4JZ3 A;  3SHW A;  1AZE A;  1TUC A;  1BU1 A;  1OOT A;  2O9S A;  2DRK A;  4CC2 A;  1PRL C;  2J7I A;  1I0C A;  1AOJ A;  2DYB A;  2ED0 A;  4QT7 A;  5IHK A;  4J9B A;  1NLP C;  2LJ0 A;  4D8K A;  1SRM A;  2JS2 A;  1VA7 A;  2SEM A;  1PHT A;  2DRM A;  1KFZ A;  2F2X A;  2DJQ A;  2YUO A;  3REA B;  3VRZ A;  1IO6 A;  2C0T A;  1PKT A;  2EGA A;  2JS0 A;  2LJ1 A;  3VS2 A;  1X69 A;  3U23 A;  2GTJ A;  2A37 A;  2YT6 A;  1A0N B;  1B07 A;  1LCK A;  1M3C A;  4Z88 A;  1MV3 A;  1M3A A;  1KSW A;  2VKN A;  2J06 A;  2KYM A;  2P4R A;  1SHG A;  2ENM A;  3VS1 A;  2K7A A;  2DF6 A;  2F2W A;  4X1V A;  2DL3 A;  2YSQ A;  1UE9 A;  2RNA A;  2X3X D;  4J9E A;  1JEG A;  3EG2 A;  1G2B A;  2SRC A;  1M3B A;  3EG0 A;  2AKL A;  1X27 A;  1AEY A;  2NWM A;  5EC7 A;  1RI9 A;  1X6B A;  4AFS C;  1K1Z A;  1HSQ A;  1OV3 A;  1K0S A;  4RTX A;  4GBQ A;  3ULR B;  1U5S A;  2VVK A;  2DM1 A;  2RQU A;  3I5R A;  1ZUU A;  2AK5 A;  2C0O A;  2EW3 A;  4HVU A;  2DL4 A;  1UG1 A;  3I9Q A;  1ZX6 A;  1U3O A;  3R6N A;  2KRM A;  1UDL A;  1UJY A;  2HEQ A;  2KXC A;  1YCS B;  1WX6 A;  1QLY A;  1JU5 C;  2GGR A;  2W0Z A;  3H41 A;  1FMK A;  2O9V A;  2O31 A;  2BTT A;  2ECZ A;  3M0Q A;  1Y57 A;  2HCK A;  1OPK A;  1ARK A;  1GCQ A;  1Z9Q A;  2LMJ A;  2LJ3 A;  1T0H A;  2AKK A;  2EYY A;  1WLP B;  1K9A A;  2LX7 A;  2RQV A;  3PVL A;  3VS4 A;  1ZLM A;  2EGE A;  1QWE A;  2J6F A;  1FYN A;  2EBP A;  2KEA A;  2EYZ A;  4J9G A;  2CDT A;  1M30 A;  1UHC A;  2DA9 A;  1GCP A;  1I07 A;  5IHI A;  4AG2 C;  2RN8 A;  4HCK A;  1QKW A;  3H0H A;  1GRI A;  5FW9 A;  1OEB A;  2DL7 A;  5I11 A;  3M0U A;  4ZNX A;  1X43 A;  2K2M A;  2RQW A;  3VS7 A;  1JXO A;  5ECA A;  2FPF A;  4JJB A;  2LP5 A;  1YN8 A;  1CKA A;  2PTK A;  2OJ2 A;  4FSS A;  1WYX A;  2RMO A;  4LN2 A;  2JW4 A;  1KJW A;  2CSQ A;  1H3H A;  2JTE A;  2BZY A;  4RTZ A;  2CT3 A;  4F14 A;  1XOV A;  3NMZ C;  2L2P A;  1AWX A;  2FPE A;  4RTU A;  4JJC A;  1AWO A;  2X3W D;  3NPF A;  1NEB A;  2VWF A;  2G6F X;  1JXM A;  3SEM A;  3FJ5 A;  3VS5 A;  2J6O A;  1I1J A;  1RUW A;  4GLM A;  4A63 B;  4IIO A;  4M4Z A;  1SPK A;  2FG0 A;  1PKS A;  4WCI A;  4JPB W;  2LNH B;  5I22 A;  3EG1 A;  2A28 A;  4AG1 C;  2V1Q A;  4F17 A;  3EGU A;  2O2O A;  1N5Z A;  2FRY A;  5GJW B;  1AWJ A;  1YWO A;  3PE0 A;  4Z8A A;  2RQR A;  3GBQ A;  1AD5 A;  1WI7 A;  1T3L A;  2RPN A;  1MV0 B;  5L23 A;  1RLP C;  2QDL A;  2RQT A;  4RTV A;  1SEM A;  5GJV B;  4HVW A;  2V1R A;  2MOX A;  1UJ0 A;  1CSK A;  4RTY A;  2JMC A;  1W1F A;  1ZBJ A;  4AFQ C;  2DLP A;  2DMO A;  4LUE A;  2K6D A;  2D8H A;  1QWF A;  4K11 A;  1GBR A;  1U06 A;  3QWX X;  4CC7 A;  5IXB A;  1NYG A;  1SHF A;  3JV3 A;  3RNJ A;  2KR3 A;  4OMP A;  2K3B A;  1ABQ A;  2O88 A;  2KNB B;  2MCN A;  1UGV A;  1K76 A;  2M0Y A;  3H0I A;  2L3Q A;  1WA7 A;  2CT4 A;  2DNU A;  2GBQ A;  2KE9 A;  2JM9 A;  4F16 A;  2AZV A;  2EQI A;  1E6G A;  1VYU A;  2I0N A;  2CRE A;  2OAW A;  2DBM A;  1W70 A;  1AZG B;  4ORZ A;  2DIL A;  4HVV A;  1E6H A;  1VYT A;  2D8J A;  1GL5 A;  2C0I A;  3EG3 A;  1GFD A;  2LQW A;  5FWB A;  2LCS A;  4CC4 B;  1S1N A;  4KRT A;  2AZS A;  3I5S A;  1NEG A;  5FWC A;  3EHQ A;  4HXJ A;  1NLO C;  2JT4 A;  2YUQ A;  2ABL A;  4LE9 A;  1WFW A;  1PWT A;  4AFU C;  5HCK A;  3RBB B;  3UA7 A;  1ZUY A;  1NG2 A;  2CH4 A;  2EKH A;  2MIO A;  2LZ6 B;  3TSZ A;  1K4U S;  4J9F A;  2FEI A;  2DX1 A;  2A08 A;  4DEY A;  1UHF A;  2B86 A;  1T3S A;  2EPD A;  1M8M A;  4OMO A;  1QKX A;  2HSP A;  1RLQ C;  2JM8 A;  2GNC A;  2LQN A;  1H8K A;  1NM7 A;  1HD3 A;  2BZ8 A;  2OI3 A;  2EYX A;  3VRY A;  4RTT A;  4J9C A;  3NGP A;  1TG0 A;  1YWP A;  1CKB A;  1E7O A;  1HJD A;  3M0S A;  1UFF A;  2PNI A;  1PRM C;  1YP5 A;  2K79 A;  3THK A;  4DEX A;  4D8D A;  1WDX A;  2GTO A;  3NHN A;  4J9D A;  2BZX A;  2CUB A;  3M0R A;  1WXU A;  4EIK A;  2CSI A;  1JO8 A;  2DBK A;  2YUP A;  4RTW A;  1J3T A;  2M51 A;  2ROL A;  1YNZ A;  1Y0M A;  2RF0 A;  3VS0 A;  2L3P A;  1UUE A;  2DL5 A;  2FRW A;  2J6K A;  2FO0 A;  2KGT A;  3QWY A;  5IHN A;  3VS6 A;  1SSH A;  1GBQ A;  3IQL A;  2D1X A;  2JMA A;  5IH2 A;  1G83 A;  1SRL A;  2H8H A;  2DL8 A;  3O5Z A;  2FPD A;  1ZUK A;  2XMF A;  4E6R A;  2K9G A;  2YDL A;  1QCF A;  2YUN A;  1VYV A;  2KRS A;  1ABO A;  1GCQ C;  4JZ4 A;  1X2Q A;  1BK2 A;  4CC3 A;  1PNJ A;  2KBT A;  3C0C A;  4JJD A;  3EHR A;  2D0N A;  3TSW A;  2KRN A;  1NYF A;  3I35 A;  2ROT A;  1BB9 A; 
#chains in the Genus database with same CATH topology
 4OMQ A;  1Q86 R;  3C95 A;  1B3Q A;  3M0T A;  5M9O A;  2EGC A;  3JSC A;  4IUQ A;  4KUI A;  3CCR Q;  3UA6 A;  1KD1 C;  2DIQ A;  2PZ1 A;  1U1T A;  2A36 A;  5KYY A;  1Q82 C;  3OMG A;  2QQA A;  4Y91 A;  4A4H A;  4J9I A;  2BE7 D;  2IIM A;  4J6Y A;  2CH4 W;  3HP9 A;  3JCM g;  3V8J A;  5GAO p;  1KG1 A;  4ANJ A;  2GCX A;  4M78 F;  2L0A A;  3H9N A;  2DTI A;  4M78 B;  4M77 D;  4M7D C;  2QQB A;  1WIE A;  3JRZ A;  2QDY B;  2E5K A;  3L2W A;  3GPL A;  5C6S A;  3UWN A;  1R0B G;  2ED1 A;  5GAN f;  2DTO A;  3BE3 A;  1V1C A;  3RIR A;  2HAX A;  3VU3 C;  4N4H A;  3CCR T;  3OMC A;  2KXD A;  1M2V A;  2KT8 A;  4DBQ A;  1GFC A;  2YHT A;  3E19 A;  4WF2 A;  1K0X A;  4CRI A;  4PJO A;  1WXT A;  2BE9 B;  5GMK l;  4R55 A;  3M57 A;  3E9G A;  1AWW A;  4PJN A;  3J80 E;  2DE0 X;  3TQ7 P;  4PJO E;  2DVJ A;  3CPW S;  2Y4Y A;  3FEO A;  3HFO A;  3VS3 A;  3A5Z B;  3X25 B;  1Q86 U;  1OYX A;  2ESW A;  1W6X A;  1YCY A;  3MCA B;  4JZ3 A;  3ASK A;  1TUC A;  4C92 C;  3OYC A;  1PRL C;  3KUF A;  5IHK A;  3CCU A;  6AT1 B;  4D8K A;  3CME A;  2OTJ Q;  1SRM A;  2KQW A;  1VA7 A;  2SEM A;  3G71 A;  5GMK j;  1K73 C;  1S72 A;  1Q7Y R;  3LH0 A;  1H3Z A;  2FYK A;  3G1J A;  2ZPG B;  3REA B;  2C0T A;  5EG2 A;  3VS2 A;  3CD6 T;  1X69 A;  2GTJ A;  3JB9 F;  2A37 A;  3EG9 A;  5LJ5 f;  1VQ7 A;  5GAN 4;  1MV3 A;  1M3A A;  2DK3 A;  2K5L A;  2K2V A;  3I55 A;  3G6E Q;  4OVA A;  5CCA A;  2P4R A;  1SHG A;  3JCM c;  4F7U A;  4X9D A;  3VS1 A;  4FYW B;  4X1V A;  4JDS A;  1LNX A;  2DVE A;  2X3X D;  4F7U E;  1JEG A;  2K3Y A;  1X01 A;  3EG0 A;  3WXM B;  2X35 A;  3OYE A;  3VKI A;  1X27 A;  2ZCF B;  2CZ7 B;  3A8G B;  1RI9 A;  3OYM A;  2K4Y A;  2OAU A;  4M7D F;  2QGG A;  3HRU A;  4M7D B;  5GMK e;  2FB7 A;  3UPU A;  3VYG A;  1M2O A;  3RUX A;  2C0O A;  2EW3 A;  2DL4 A;  3EGD B;  3G6E T;  4JS5 A;  2CP2 A;  1ZSZ A;  1Q7Y U;  3G4S T;  1U3O A;  5LJ3 g;  1UDL A;  1WHG A;  3A1P A;  2H3J A;  2HEQ A;  2KXC A;  1QLY A;  3AHU A;  3JCM b;  3PMI A;  3H41 A;  2O31 A;  2BTT A;  2ECZ A;  3M0Q A;  2HCK A;  1ARK A;  4D6W A;  4RCB A;  1FXX A;  4KGZ B;  1YJ9 A;  4HCZ A;  4QVC A;  2LX7 A;  1MMD A;  3VS4 A;  3PVL A;  3P8H A;  4C92 F;  1ZLM A;  2E41 A;  3S3O A;  2EGE A;  4KH1 B;  2J6F A;  1FYN A;  4C92 B;  4UC4 A;  3RKX A;  3EAE A;  5GAN 6;  1UHC A;  3H6Z A;  3M9Q A;  4J7I A;  3OW2 P;  2RK2 A;  5FW9 A;  2P0K A;  2DXB A;  3M0U A;  2VGM A;  3VS7 A;  4C5H A;  2YLB A;  3X20 B;  2LP5 A;  2X4Y A;  2RM4 A;  4F04 B;  1IZ6 A;  4RG2 A;  2JW4 A;  4ZTF A;  2COY A;  2EFI A;  4M78 D;  2MWP A;  4RMO A;  1XOV A;  5KYY B;  1OU9 A;  2L2P A;  2FPE A;  2VWF A;  1VOM A;  1JXM A;  3FJ5 A;  1JJ2 S;  3VS5 A;  3RMQ A;  2J6O A;  2YWW A;  2BUD A;  1I1J A;  1RUW A;  4GLM A;  1VQ4 Q;  3DKM A;  5FU6 C;  4IIO A;  1QVG S;  1PKS A;  4JPB W;  5I22 A;  3EG1 A;  4M78 G;  2A28 A;  4J7F A;  2O2O A;  1N5Z A;  2BIV A;  4B9W A;  3X28 B;  3GOX A;  1O9S A;  5I2M A;  5GAN j;  4PLL A;  2EIF A;  2V26 A;  3FLG A;  3FB9 A;  2RPN A;  5L23 A;  1X75 C;  2YXY A;  1MND A;  1QCN A;  2MOX A;  1UJ0 A;  2GFA A;  3CCV Q;  8AT1 B;  4EMK C;  4PJO B;  4LUE A;  1FMW A;  1ZBX A;  1VQM A;  4K11 A;  4RKU E;  1GBR A;  1RAG B;  4CC7 A;  5CKF A;  1VQ4 T;  1KHC A;  1SHF A;  1YIT Q;  3RNJ A;  2KR3 A;  4OP0 A;  2FZG B;  3X26 B;  1HXD A;  1B34 A;  4ZN1 A;  2XU8 A;  4MZP A;  1QVF A;  2O88 A;  2MCN A;  3JB9 D;  2I2L A;  1K76 A;  2L3Q A;  3VJP A;  2JOY A;  2A3L A;  4R56 A;  1W4S A;  2HQX A;  2JM9 A;  5DLO A;  1E6G A;  1NPP A;  3QPH A;  4E7Z A;  3CCV T;  2HBP A;  5GAN e;  1YHQ Q;  4HVV A;  3EG9 B;  1E6H A;  2LCS A;  4KRT A;  4N4I A;  5LJ5 j;  4A4G A;  1YIT T;  4HXJ A;  3JB9 H;  2XHC A;  2YUQ A;  5CK9 A;  5LJ3 h;  4AFU C;  4HCB A;  5HCK A;  5GMK m;  2XDD A;  3FC3 A;  3FJP A;  1KK7 A;  2EKH A;  1EIF A;  2CKK A;  1K4U S;  1T3S A;  2EPD A;  2JVV A;  3ZBD A;  1M8M A;  5FU6 B;  4IUR A;  2XID A;  2BKD N;  4YTL A;  1YHQ T;  3OYF A;  1SKU B;  2GNC A;  4M7D G;  2WSF E;  1BCO A;  3E1S A;  2RA2 A;  5KCO A;  1M8V A;  2BZ8 A;  2EQM A;  4MZT A;  1YWP A;  3CMA Q;  5GAO l;  1KD1 R;  4DA4 A;  4KUD K;  3V7C A;  2PNI A;  1PRM C;  2DXT A;  3QJ6 A;  2NUT A;  3I56 A;  3CC7 A;  1Q82 R;  5LJ5 e;  2K79 A;  1OX9 A;  5HKC A;  2D9T A;  3CC2 A;  4DEX A;  4C92 D;  1QMC A;  1VQ8 A;  2NLU A;  1WDX A;  1BI3 A;  1XNI A;  3A8M B;  4EMK B;  3M0R A;  2CUB A;  2QYZ A;  2CSI A;  1JO8 A;  1M90 C;  1YI2 Q;  4RTW A;  2ROL A;  1YNZ A;  4QVD A;  3CCM T;  5J3B A;  2DL5 A;  3GNG A;  1GBQ A;  3IQL A;  5IH2 A;  1G83 A;  1V29 B;  4E7I A;  3KBG A;  4IUU A;  1I4K 1;  1W2B S;  3O5Z A;  3NFC A;  4IKF A;  2K9G A;  4C92 G;  3CCJ A;  1GCQ C;  1PNJ A;  2KBT A;  4BDY A;  4OB2 B;  2D0N A;  3TSW A;  2MAM A;  2QAS A;  4BE0 A;  1JB0 E;  2DYI A;  3I35 A;  3KFV A;  1JQQ A;  1AVZ C;  1VQP A;  1YJN Q;  1YBY A;  1T0J A;  4LUD A;  3UAT A;  1AT1 B;  1U1S A;  1Y96 B;  1KQS S;  2GQI A;  4RG8 A;  2L3S A;  1KIK A;  4OMN A;  5GAM f;  3CC4 Q;  3CBP A;  3JCM J;  1KD1 U;  3PVQ A;  4OGE A;  1MMG A;  5CO7 A;  1Q82 U;  2RJE A;  3JB9 J;  3MP6 A;  1N6A A;  1K73 R;  4HA8 A;  2HQE A;  3TVT A;  1N9S A;  3H0F A;  1AHJ B;  4LNP A;  1FWZ A;  1DJ7 B;  3JCM Q;  4Q5W A;  1VQ6 A;  3L1A A;  2JTF A;  3ZEH A;  2DEU A;  1MUZ A;  3JCM X;  3UF4 A;  1YJN T;  3GF5 A;  3QYG B;  2QEX A;  1KHI A;  3M0P A;  2ZPH B;  3CCL A;  3CC4 T;  1QVG P;  3LH5 A;  4J9H A;  1H92 A;  5CKD A;  4Y92 A;  4N0A C;  4ELY C;  1X2K A;  2VC8 A;  5J26 A;  1BBZ A;  2CP0 A;  2DFU A;  1VQ5 Q;  5FRM A;  1Y07 A;  4PJO G;  1TUD A;  1NE8 A;  2CP3 A;  1PM3 A;  3M5A A;  3HPW A;  4ZGJ B;  1AZE A;  2K57 A;  2MMP A;  2MYS A;  1BU1 A;  2O9S A;  2QAZ A;  3QYH B;  2KSS A;  2QXF A;  1I0C A;  1RL2 A;  2JNG A;  2ED0 A;  3MP1 A;  1NLP C;  1K9M C;  1B34 B;  2JS2 A;  1M9S A;  3G4S A;  2L5Q A;  3HFN A;  2DRM A;  3QUI A;  5GAN g;  2F2X A;  2DJQ A;  1VQO Q;  3L2U A;  2FL7 A;  2YUO A;  1PSE A;  4FT4 A;  2KAF A;  2E6N A;  1M1F A;  2DZ9 A;  1SG5 A;  1K73 U;  4VUB A;  3CXC S;  5AT1 B;  3H8Z A;  3P8B B;  5CQY A;  4XU1 A;  2KMT A;  4Z88 A;  3MEA A;  1SF9 A;  1KSW A;  4B6M A;  2VKN A;  2X4X A;  2J06 A;  1WJS A;  3S3N A;  2HSE B;  1RAA B;  2EAY A;  4BI3 A;  2K7A A;  2YSQ A;  2WSE E;  1Y71 A;  2RNA A;  4J9E A;  1OI1 A;  4BDZ A;  1VQO T;  1M4Z A;  2K3X A;  3CCR A;  2VAS A;  5KYU B;  1AEY A;  2NWM A;  1X6B A;  4PLI A;  1OV3 A;  1N8R C;  4GBQ A;  4BE1 A;  4LDU A;  5GAO q;  1U5S A;  3OW2 A;  2RQU A;  4HVU A;  2M02 A;  4CI0 C;  1VQ9 Q;  3RKW A;  3QJY A;  4NS5 A;  4C8Q E;  5GAO r;  4FL6 A;  2CZ0 B;  4A4E A;  2VGN A;  1ZX6 A;  5KE3 A;  2NUP A;  5KCH A;  4XTZ A;  3P8D A;  3LWI A;  1C6V X;  1MHN A;  2E4H A;  4J6W A;  1TWB A;  1JU5 C;  2NUT B;  4EDU A;  1YJW Q;  4OB0 B;  1WQ7 A;  2GF7 A;  3DLL A;  2PVG B;  1Z9Q A;  2LMJ A;  3CCQ Q;  2LX9 A;  4OB3 B;  1O75 A;  3CD6 A;  2KVQ G;  1K9A A;  4PK4 A;  2PQW A;  2QA4 A;  2A7Y A;  2EBP A;  2KEA A;  2FHD A;  4J9G A;  1VQ9 T;  3OSV A;  2DA9 A;  4J8O A;  2LC4 A;  2DD5 A;  4AG2 C;  1KC8 C;  2RN8 A;  1WNL A;  3MKD A;  4HCK A;  1PCX A;  2CP7 A;  1GRI A;  1OEB A;  5I11 A;  4NL3 A;  2K2M A;  2RQW A;  5KYX B;  2RHI A;  1YJW T;  4M75 A;  3QSU A;  3QO3 A;  2PTK A;  3QZ9 B;  1WYX A;  3VUB A;  1W2B P;  3JCM P;  3D7S B;  3EGX B;  1D09 B;  1KJW A;  3URG A;  4M75 E;  1RAD B;  5GAO m;  3OYJ A;  3CCQ T;  2BZY A;  2O4X B;  4F14 A;  1F1B B;  4JJC A;  2QI2 A;  1AWO A;  3OS2 A;  4J5Y A;  5GAM j;  1Q95 G;  1D0Y A;  3V8K A;  3NTK A;  2ZGW A;  3CEY A;  3V7S A;  3G6E A;  2YRC A;  3QBY A;  2ATC B;  4M4Z A;  4PNO A;  1VIF A;  5D6Y A;  5D7U A;  2FG0 A;  3J7A F;  5A0D A;  2LNH B;  2LVM A;  4AG1 C;  1S72 Q;  1KQS P;  3EGU A;  2RH2 A;  2DD4 A;  2COW A;  1GXI E;  5GJW B;  3OS0 A;  4X34 A;  3JCM f;  2DO3 A;  1C1A A;  2OTJ T;  3HHT B;  5GAN h;  1T3L A;  3OQ5 A;  2PUK B;  1MV0 B;  4IUV A;  2K5F A;  3C12 A;  4XTV A;  1G8X A;  2RQT A;  4RTV A;  4E7L A;  1YIJ Q;  4HVW A;  1VQ7 Q;  2JTM A;  1CSK A;  1TSF A;  4JLI A;  1SSF A;  2JMC A;  1ZBJ A;  2DLP A;  1JBM A;  4M7A E;  1QWF A;  1U06 A;  4BE2 A;  2RI5 A;  1N27 A;  4L6V 5;  4C5G A;  1NYG A;  3NTH A;  4Y28 E;  4ELZ C;  1QP3 A;  3BDL A;  4MML A;  1S72 T;  4TVR A;  5GAM e;  1BKB A;  4PJO C;  4DBH A;  4DBF A;  2KNB B;  1UGV A;  2M0Y A;  2HMA A;  4GY5 A;  3L42 A;  2CT4 A;  2DNU A;  3EFO B;  2GBQ A;  3LWH A;  1YIJ T;  1VYU A;  1MMN A;  2LDM A;  3JCM V;  2V8K A;  4M75 C;  2DIL A;  1WPY A;  1XQH A;  2D8J A;  1GL5 A;  2C0I A;  3EG3 A;  1GFD A;  2LQW A;  4HT8 A;  3I5S A;  2XIC A;  3EHQ A;  3TRE A;  3OYY A;  3JAM E;  4A4K A;  4FT2 A;  2ABL A;  3M56 A;  1WFW A;  2E1H A;  4M77 A;  1M90 R;  3CXC P;  3VV0 A;  2CH4 A;  4M77 E;  3S6W A;  2LZ6 B;  3ZFJ A;  4ZN3 A;  2DX1 A;  4DEY A;  4GLK A;  3MO8 A;  3QHS A;  1TTH B;  1JRI A;  1YFN A;  1WHM A;  3SD4 A;  1BI1 A;  2HKN A;  1IHW A;  1QKX A;  1RLQ C;  1WQW A;  4QQ6 A;  2RJF A;  3SWN A;  5GAN d;  2YLC A;  1QP2 A;  3QG1 A;  1WHK A;  1HD3 A;  2OI3 A;  3TU4 K;  2EYX A;  3VRY A;  1VQ4 A;  4RTT A;  3FRN A;  4J9C A;  1TG0 A;  1BI2 A;  2NUP B;  1IRX A;  4JRP A;  3V7R A;  2YRV A;  4D8D A;  2GTO A;  4DOV A;  4FIB A;  2BZX A;  4EIK A;  2DBK A;  2YUP A;  3M59 A;  2M51 A;  1ZSZ C;  3T9N A;  2LT1 A;  4IUT A;  3CCS A;  1PC0 A;  1UUE A;  2J6K A;  4QQG A;  2KGT A;  5LJ3 f;  3OS1 A;  3CCV A;  1QVF S;  3JCM W;  2JMA A;  2PVD B;  1M2V B;  1M90 U;  2M16 A;  4PJO F;  2DL8 A;  2CZ1 B;  2XMF A;  2YDL A;  2YUN A;  1X6O A;  3OYI A;  1YIT A;  1K8A C;  1BIA A;  3KXT A;  3C0C A;  3M53 A;  2KI7 A;  2KRN A;  2ZPI B;  4C0D B;  4E7K A;  4M75 F;  4QVZ A;  4JRQ A;  5LJ5 d;  3SDZ A;  4M75 B;  2E3H A;  2F2V A;  3EH2 A;  1IB8 A;  3CBO A;  4JJN K;  3MHX A;  3CPW P;  2RJD A;  1VQM Q;  2KDS A;  3E2U A;  1YHQ A;  2F5K A;  2E70 A;  5IN1 A;  5IXF A;  9ATC B;  2K5I A;  2D0Q B;  1K9M R;  1EZZ B;  4QW2 A;  2EJG A;  2VXF A;  2QQS A;  3GLX A;  2P0Q A;  1VQL Q;  4XAX B;  7AT1 B;  1IXD A;  4EMH A;  3SWN C;  1MMA A;  4R0K A;  4F7U F;  3CQT A;  2RB6 A;  3M4G A;  2KT1 A;  4OML A;  4F7U B;  2KYB A;  4PJJ A;  3QII A;  4Z89 A;  1OQK A;  4M7D D;  4XTY A;  3CCE Q;  2JXB A;  1B7T A;  1RI0 A;  1WXB A;  3ZL7 C;  2EKO A;  2QQ9 A;  3CCM A;  3V8L A;  3RDV A;  1EFN A;  1IRE B;  3M54 A;  4FYX B;  4AFZ C;  1LOJ A;  2OX7 A;  5A0L A;  2GQV A;  1M27 C;  5GAM g;  4ZGE B;  1RAF B;  2NUZ A;  3A98 A;  2ZZD A;  3SHW A;  1VQL T;  2XKO C;  2EQJ A;  1OOT A;  4A54 A;  1Y7X A;  2DRK A;  4CC2 A;  2J7I A;  1AOJ A;  4J9B A;  1ZSZ B;  3S3M A;  2LJ0 A;  4E7J A;  1N8R R;  3CCE T;  3OSS C;  4BY6 C;  2R57 A;  1FMV A;  1K9M U;  2EGA A;  2LCL A;  2P4T A;  3HTR A;  2QTX A;  2YT6 A;  2A0F B;  2DIG A;  1M3C A;  4OB1 B;  2VUB A;  4MZM A;  4JRI A;  1PD0 A;  4M78 E;  3JCM e;  4PFP A;  5CIU A;  3CC7 Q;  3I56 Q;  1H64 1;  2ENM A;  2X9H A;  3MEU A;  1D1B A;  2RK1 A;  1P92 A;  2F2W A;  3CC2 Q;  2DL3 A;  3CMA T;  1VQ8 Q;  1UE9 A;  4M77 B;  2RHX A;  3EG2 A;  1TXQ A;  1G2B A;  4FM4 B;  4LDV A;  1M3B A;  2MWO A;  1YJN A;  3PIO A;  5LL6 S;  5EC7 A;  5HK3 A;  1YI2 T;  4O6J A;  2OTL A;  4PJL A;  4PL6 A;  4FU6 A;  2B8A A;  1KC8 R;  2VVK A;  2DM1 A;  2GFU A;  4LDX A;  3I5R A;  2AK5 A;  1N9R A;  3SWN B;  4FCY A;  1N8R U;  1UG1 A;  3I9Q A;  2CP6 A;  3I56 T;  3R6N A;  2QQR A;  3CC2 T;  2KRM A;  4PFO A;  5HY6 A;  1UJY A;  5FLX E;  1YCS B;  2E3I A;  1UGQ B;  1V76 A;  1WX6 A;  3OB9 A;  1VQP Q;  2GGR A;  1FMK A;  2AIR B;  1ZA2 B;  1R8O B;  1C0M A;  1OPK A;  4PJO D;  3PTA A;  1JJ2 P;  1VIE A;  1FX7 A;  4LD6 A;  1M5Q 1;  1OU8 A;  1WLP B;  2ZPB B;  1QW1 A;  4HT9 A;  4JRK A;  1QWE A;  5HK0 A;  2L8D A;  5GAO n;  1MGQ A;  2M1H A;  2DKG A;  2R58 A;  5IHI A;  5LJ3 j;  3HRT A;  3GP8 A;  2DXU A;  5CKE A;  2PU9 B;  1VQN Q;  1XJW B;  2DL7 A;  4BY6 B;  3MEV A;  1VUB A;  4ZNX A;  2JJ9 A;  5C0M A;  1JXO A;  3AT1 B;  2FPF A;  5ECA A;  4C0F A;  1KC8 U;  1QVF P;  1YN8 A;  1CKA A;  4E7S A;  3GNF B;  2QEX Q;  3CCL Q;  2Y4X A;  4MDX A;  1VQO A;  3UT1 A;  5GMK h;  4HCC A;  1PD1 A;  2CSQ A;  3MPU B;  3OYB A;  4M7D E;  4M75 G;  1LVK A;  2CT3 A;  1AWX A;  2F5T X;  4RTU A;  2E5Q A;  4IUP A;  4QKU A;  2MPX C;  5GAM h;  2V8I A;  3DB3 A;  1VQ5 T;  1VQN T;  2F1L A;  3A8H B;  1LJO A;  3VYH B;  4BD3 A;  4XTX A;  4F17 A;  5LJ3 e;  5D6X A;  5KH6 A;  1AWJ A;  1YWO A;  3PE0 A;  2QEX T;  1BI0 A;  3CCL T;  2G3R A;  3GBQ A;  2X4J A;  5IAY A;  3HKS A;  4F7U G;  2QDL A;  1VQK Q;  1D0X A;  1WZO A;  1HK9 A;  2C06 A;  5GJV B;  2E64 A;  2EWN A;  1IGQ A;  2V1R A;  3QDR B;  4V2S A;  1UGP B;  1QQJ A;  2HL5 C;  3FDR A;  4C92 E;  3X24 B;  2DMO A;  2K6D A;  2D8H A;  1NPR A;  4JUV A;  3QWX X;  2CS7 A;  3BW1 A;  4C8Q A;  1VQ9 A;  5IXB A;  2AHJ B;  5FU7 C;  1ACM B;  3F70 A;  3JV3 A;  2LNV A;  5LJ5 g;  3ER0 A;  3NTI A;  1UB4 A;  2MF2 A;  3M58 A;  1ABQ A;  2K3B A;  4MMK A;  2WSC E;  3WVD B;  5KYN A;  2LQK A;  5CVI A;  3H0I A;  1YJW A;  4LXC A;  1WA7 A;  1OZ3 A;  1TU0 B;  1VQK T;  4QQD A;  2HZY A;  4F16 A;  2AZV A;  4AT1 B;  3CCQ A;  3A8L B;  2CRE A;  2OAW A;  2DBM A;  4KGX B;  1W70 A;  2P84 A;  2WAC A;  3PGG A;  5FWB A;  4Z02 A;  4CC4 B;  1S1N A;  2AZS A;  4KUL A;  1TUG B;  1NLO C;  2JT4 A;  8ATC B;  2QG9 B;  1PWT A;  3EFS A;  2NYS A;  3UA7 A;  1M1K C;  1ZUY A;  5GAM d;  1UGS B;  3TSZ A;  3INZ A;  4L5G A;  4M77 G;  2OTJ A;  3CD6 Q;  1UHF A;  4LD9 K;  2H3E B;  4JLG A;  2QA4 Q;  2DPP B;  3LW5 E;  4FW2 A;  1K8A R;  1QCO A;  1BIB A;  1Q81 R;  2JM8 A;  4ME7 A;  3RKY A;  2LQN A;  1H8K A;  1NM7 A;  1R0C B;  4OMF B;  2RHY A;  1CKB A;  3L2Q A;  1I5O B;  3M0S A;  3CCU Q;  4DQ2 A;  3CME Q;  3G71 Q;  3A8O B;  3THK A;  4C8Q C;  4OF1 A;  3CPW A;  2IG0 A;  5GAN 7;  1WXU A;  2V8J A;  1J3T A;  2QA4 T;  3Q1J A;  3VS0 A;  2QK0 A;  4FYY B;  1YIJ A;  2RI3 A;  5FU7 B;  3VS6 A;  4M7A A;  1SRL A;  2P0P A;  5KE2 A;  3OYN A;  4RCC A;  2FPD A;  3I55 Q;  1QCF A;  3BFM A;  1VYV A;  3HSB A;  2KRS A;  1KQ1 A;  3MP8 A;  4JJD A;  3CCU T;  3CME T;  3G71 T;  1K8A U;  2W10 A;  1Q81 U;  1ZSG A;  1WJR A;  3N5B B;  4RUG A;  1LPL A;  4C0D C;  2EYW A;  2EVR A;  1VQ7 T;  2CUD A;  2HDA A;  5DM7 R;  2HBW A;  2D6F A;  3I55 T;  1D3B A;  2KRO A;  5LJ5 h;  2J05 A;  4EMK A;  3OBY A;  4OMM A;  1OPL A;  3GIB A;  1I5L A;  2HNI A;  2VV5 A;  1Z9Z A;  3PFS A;  1UTI A;  4EMG A;  5CQX A;  4BB7 A;  5GAN 3;  4IIM A;  2RI2 A;  1UEC A;  1MNE A;  4ESR A;  3REB B;  3LGF A;  1YJ9 Q;  3JCM h;  2LRQ A;  5CKB A;  1Q86 C;  1X6G A;  4E7H A;  2DET A;  4PKC C;  3RR6 A;  3G7Z A;  2JN0 A;  2M0O A;  2RD1 A;  3OYA A;  2XDP A;  3OY9 A;  1I8F A;  4C8Q F;  4C8Q B;  1RAC B;  2PUO B;  4M7A C;  2DYB A;  4QT7 A;  2CP5 A;  4L59 A;  2DXC A;  1Y96 A;  1PHT A;  1IHV A;  2AT1 B;  3ME9 A;  1KFZ A;  1ZA1 B;  4HKE A;  2FVU A;  2X4W A;  3PMT A;  3RER A;  4XTW A;  3VRZ A;  2ZPE B;  1IO6 A;  1TOV A;  1PKT A;  1YJ9 T;  2JS0 A;  3BY7 A;  2LJ1 A;  3HRS A;  3QKJ A;  3U23 A;  5A2Q E;  4J6X A;  1A0N B;  1B07 A;  5GMK i;  1LCK A;  5GAN 8;  1WHJ A;  2RO0 A;  5AYF A;  1UEB A;  3RMS A;  2YRD A;  1IGU A;  1OUL A;  1RAI B;  3UDC A;  2KYM A;  3RES A;  3L2R A;  4E47 A;  3PNW C;  2DF6 A;  1TS9 A;  3E9F A;  1QVP A;  1Q81 C;  2MK5 A;  2IPO B;  2DTH A;  4WTO B;  4XU0 A;  4II1 A;  1JJ2 A;  3M4Y A;  1RAB B;  2SRC A;  2AKL A;  2RJC A;  3CCS Q;  4XQ3 A;  4DBR A;  1QVG A;  3OYG A;  4AFS C;  2HD0 A;  1K1Z A;  1HSQ A;  1K0S A;  1NJI R;  4O5V A;  1G5V A;  4RTX A;  5IT9 E;  4M77 C;  3ULR B;  1Q7Y C;  1G3S A;  3SFM A;  2Z0W A;  5GAN 5;  1ZUU A;  4E2F B;  1WGS A;  3VUZ A;  1RAH B;  3L2V A;  3MET A;  3LYI A;  2DAQ A;  1D1C A;  3JCM d;  2E65 A;  1VQL A;  3OYH A;  3LGL A;  4A4F A;  4KT0 E;  2W0Z A;  2O9V A;  5J39 A;  3QDF A;  3CCS T;  1Y57 A;  4XK8 E;  3CCE A;  1GCQ A;  5L8R E;  3DLM A;  1OX8 A;  4PFZ A;  2L3R A;  2LJ3 A;  1T0H A;  2AKK A;  2EJF A;  2F69 A;  3OA6 A;  5KYW A;  2E6Z A;  2RQV A;  2EYY A;  2CZ6 B;  5I21 A;  1NZ9 A;  2E10 A;  2M9U A;  3JB9 G;  1VQM T;  3JB9 I;  4M7A F;  3DB4 A;  2EYZ A;  4KH0 B;  4M7A B;  2CDT A;  1M30 A;  1GCP A;  1I07 A;  4C0G A;  3CPF A;  1G3Y A;  1QKW A;  3H0H A;  4BUG A;  1X43 A;  5KYU A;  3CMA A;  5A0G A;  3L2Z A;  1NJI U;  4JJB A;  2KY9 A;  5GAN 2;  2EQK A;  2OJ2 A;  4FSS A;  1XTD A;  2RMO A;  4LN2 A;  3CCM Q;  2FZC B;  2XDB A;  1H3H A;  2JTE A;  3OBW A;  2HQH A;  2EQU A;  4RTZ A;  1U8R A;  3NMZ C;  1UGR B;  4DOW A;  4NOY A;  1YI2 A;  1NBE B;  1PG5 B;  2X3W D;  3NPF A;  1NEB A;  2G6F X;  3SEM A;  1HYO A;  4M78 A;  2QGF B;  2XI9 A;  2ZAE A;  2E12 A;  4A63 B;  1SPK A;  2VYT A;  2ZPF B;  4AMC A;  1D3B B;  4WCI A;  3BDU A;  4N0A A;  4ATO A;  2HKQ B;  2V1Q A;  4FW1 A;  4BAC A;  2EYQ A;  2XG8 D;  2RHU A;  2FRY A;  4XU3 A;  3WVE B;  4ZGD B;  4M77 F;  4Z8A A;  2RQR A;  2DJZ A;  1AD5 A;  1OZ2 A;  1WI7 A;  4N4G A;  4B9X A;  3C94 A;  3O8V A;  1RLP C;  2O01 E;  2PVO B;  3MEW A;  1SEM A;  4C8Q D;  5D6W A;  4LDW A;  4NL2 A;  4KGV B;  4RTY A;  1W1F A;  4XTU A;  2IVW A;  4PJM A;  4AFQ C;  3J81 E;  2LCC A;  2X51 A;  3CC4 A;  3EH1 A;  2R5A A;  2DEQ A;  1M1K R;  1TH7 A;  4ZTJ A;  5KYX A;  3CCJ Q;  2DER A;  1EX4 A;  3C4S A;  2DZC A;  3CC7 T;  4C8Q G;  2XD0 A;  3EGX A;  4OMP A;  4FYV B;  2LTO A;  3QXE B;  1VQ8 T;  3EFR A;  1W2B A;  1WHH A;  2O4X A;  5LJ3 d;  1M1G A;  2OTL Q;  3MJX A;  2KE9 A;  4X9C A;  2EQI A;  3OYK A;  2I0N A;  3M55 A;  1PSF A;  3OYD A;  2VXE A;  5FRN A;  4JS4 A;  1AZG B;  4ORZ A;  2FZK B;  1VYT A;  1BCM A;  4J83 A;  4C5I A;  1NEG A;  3CCJ T;  5FWC A;  3PT9 A;  2XK0 A;  2CYZ B;  1D0Z A;  2L89 A;  1VQ5 A;  2CGH A;  4LE9 A;  1VQN A;  2LT4 A;  4XU2 A;  1KQS A;  1NJI C;  4M75 D;  3RBB B;  1VQ6 Q;  4M78 C;  1NG2 A;  2MIO A;  2COZ A;  4J9F A;  1VQP T;  4A53 A;  2FEI A;  2OTL T;  2A08 A;  4BI4 A;  2B86 A;  2EJ9 A;  5CR2 A;  1M1K U;  4M7D A;  3LX7 A;  4C0Z A;  3SB2 A;  4C5E A;  1G3W A;  4OMO A;  4LDY A;  2LQ8 A;  2HSP A;  5CAI A;  1R77 A;  3EGD A;  5DY9 A;  3HL8 A;  2JZ2 A;  1ZHI A;  1KQ2 A;  3OS5 A;  1G3T A;  4KBM B;  3NGP A;  4P5N A;  1E7O A;  1HJD A;  1RAE B;  2Y90 A;  1I81 A;  2VB6 A;  1ZQ1 A;  1UFF A;  3TCJ A;  1VQ6 T;  1YP5 A;  3EFO A;  5I2S A;  3R6O A;  3CBM A;  3G4S Q;  3NHN A;  2RHZ A;  4J9D A;  4MDW A;  3OW2 S;  4M7A D;  4BI8 B;  2JUF A;  1VQK A;  1Y0M A;  5DLQ E;  2RF0 A;  3PIP A;  3OYL A;  2L3P A;  2FRW A;  4C92 A;  3QWY A;  5IHN A;  2FO0 A;  5CKH A;  5KYW B;  1SSH A;  1WHL A;  2D1X A;  1WJQ A;  2H8H A;  3FIF A;  2HL3 A;  3LLR A;  2QTV A;  1ZUK A;  4E6R A;  5FRO A;  1BYM A;  3QZ5 B;  1ABO A;  4M7A G;  4JZ4 A;  1X2Q A;  1BK2 A;  4CC3 A;  3CXC A;  2KK4 A;  3EHR A;  2R5M A;  2MI6 A;  4FSX A;  3TEE A;  4OGC A;  4EPC A;  1NYF A;  1D1A A;  2ROT A;  1BB9 A; 
#chains in the Genus database with same CATH homology
 4OMQ A;  1B3Q A;  2W10 A;  3M0T A;  2EGC A;  3KFV A;  1JQQ A;  3UA6 A;  1ZSG A;  1AVZ C;  2PZ1 A;  4LUD A;  1T0J A;  2A36 A;  3UAT A;  2F2V A;  2GQI A;  2L3S A;  1KIK A;  4J9I A;  4OMN A;  2IIM A;  4RUG A;  2CH4 W;  3PVQ A;  2EYW A;  2EVR A;  2CUD A;  2HDA A;  5IXF A;  2HBW A;  2L0A A;  1WIE A;  2KRO A;  2E5K A;  3TVT A;  3H0F A;  2J05 A;  4LNP A;  2ED1 A;  4OMM A;  1OPL A;  1V1C A;  4R0K A;  3CQT A;  2KT1 A;  4OML A;  1Z9Z A;  2KYB A;  1UTI A;  4Z89 A;  1MUZ A;  4IIM A;  3UF4 A;  2JXB A;  3ZL7 C;  1UEC A;  1WXB A;  2KXD A;  2KT8 A;  1GFC A;  4ESR A;  3REB B;  3M0P A;  1K0X A;  3LH5 A;  1WXT A;  4J9H A;  1H92 A;  4Y92 A;  1X6G A;  1EFN A;  1AWW A;  1X2K A;  4AFZ C;  1BBZ A;  2DE0 X;  2DVJ A;  1M27 C;  3VS3 A;  1TUD A;  2NUZ A;  2ESW A;  3A98 A;  1W6X A;  4JZ3 A;  3SHW A;  1AZE A;  1TUC A;  1BU1 A;  1OOT A;  2O9S A;  2DRK A;  4CC2 A;  1PRL C;  2J7I A;  1I0C A;  1AOJ A;  2DYB A;  2ED0 A;  4QT7 A;  5IHK A;  4J9B A;  1NLP C;  2LJ0 A;  4D8K A;  1SRM A;  2JS2 A;  1VA7 A;  2SEM A;  1PHT A;  2DRM A;  1KFZ A;  2F2X A;  2DJQ A;  2YUO A;  3REA B;  3VRZ A;  1IO6 A;  2C0T A;  1PKT A;  2EGA A;  2JS0 A;  2LJ1 A;  3VS2 A;  1X69 A;  3U23 A;  2GTJ A;  2A37 A;  2YT6 A;  1A0N B;  1B07 A;  1LCK A;  1M3C A;  4Z88 A;  1MV3 A;  1M3A A;  1KSW A;  2VKN A;  2J06 A;  2KYM A;  2P4R A;  1SHG A;  2ENM A;  3VS1 A;  2K7A A;  2DF6 A;  2F2W A;  4X1V A;  2DL3 A;  2YSQ A;  1UE9 A;  2RNA A;  2X3X D;  4J9E A;  1JEG A;  3EG2 A;  1G2B A;  2SRC A;  1M3B A;  3EG0 A;  2AKL A;  1X27 A;  1AEY A;  2NWM A;  5EC7 A;  1RI9 A;  1X6B A;  4AFS C;  1K1Z A;  1HSQ A;  1OV3 A;  1K0S A;  4RTX A;  4GBQ A;  3ULR B;  1U5S A;  2VVK A;  2DM1 A;  2RQU A;  3I5R A;  1ZUU A;  2AK5 A;  2C0O A;  2EW3 A;  4HVU A;  2DL4 A;  1UG1 A;  3I9Q A;  1ZX6 A;  1U3O A;  3R6N A;  2KRM A;  1UDL A;  1UJY A;  2HEQ A;  2KXC A;  1YCS B;  1WX6 A;  1QLY A;  1JU5 C;  2GGR A;  2W0Z A;  3H41 A;  1FMK A;  2O9V A;  2O31 A;  2BTT A;  2ECZ A;  3M0Q A;  1Y57 A;  2HCK A;  1OPK A;  1ARK A;  1GCQ A;  1Z9Q A;  2LMJ A;  2LJ3 A;  1T0H A;  2AKK A;  2EYY A;  1WLP B;  1K9A A;  2LX7 A;  2RQV A;  3PVL A;  3VS4 A;  1ZLM A;  2EGE A;  1QWE A;  2J6F A;  1FYN A;  2EBP A;  2KEA A;  2EYZ A;  4J9G A;  2CDT A;  1M30 A;  1UHC A;  2DA9 A;  1GCP A;  1I07 A;  5IHI A;  4AG2 C;  2RN8 A;  4HCK A;  1QKW A;  3H0H A;  1GRI A;  5FW9 A;  1OEB A;  2DL7 A;  5I11 A;  3M0U A;  4ZNX A;  1X43 A;  2K2M A;  2RQW A;  3VS7 A;  1JXO A;  5ECA A;  2FPF A;  4JJB A;  2LP5 A;  1YN8 A;  1CKA A;  2PTK A;  2OJ2 A;  4FSS A;  1WYX A;  2RMO A;  4LN2 A;  2JW4 A;  1KJW A;  2CSQ A;  1H3H A;  2JTE A;  2BZY A;  4RTZ A;  2CT3 A;  4F14 A;  1XOV A;  3NMZ C;  2L2P A;  1AWX A;  2FPE A;  4RTU A;  4JJC A;  1AWO A;  2X3W D;  3NPF A;  1NEB A;  2VWF A;  2G6F X;  1JXM A;  3SEM A;  3FJ5 A;  3VS5 A;  2J6O A;  1I1J A;  1RUW A;  4GLM A;  4A63 B;  4IIO A;  4M4Z A;  1SPK A;  2FG0 A;  1PKS A;  4WCI A;  4JPB W;  2LNH B;  5I22 A;  3EG1 A;  2A28 A;  4AG1 C;  2V1Q A;  4F17 A;  3EGU A;  2O2O A;  1N5Z A;  2FRY A;  5GJW B;  1AWJ A;  1YWO A;  3PE0 A;  4Z8A A;  2RQR A;  3GBQ A;  1AD5 A;  1WI7 A;  1T3L A;  2RPN A;  1MV0 B;  5L23 A;  1RLP C;  2QDL A;  2RQT A;  4RTV A;  1SEM A;  5GJV B;  4HVW A;  2V1R A;  2MOX A;  1UJ0 A;  1CSK A;  4RTY A;  2JMC A;  1W1F A;  1ZBJ A;  4AFQ C;  2DLP A;  2DMO A;  4LUE A;  2K6D A;  2D8H A;  1QWF A;  4K11 A;  1GBR A;  1U06 A;  3QWX X;  4CC7 A;  5IXB A;  1NYG A;  1SHF A;  3JV3 A;  3RNJ A;  2KR3 A;  4OMP A;  2K3B A;  1ABQ A;  2O88 A;  2KNB B;  2MCN A;  1UGV A;  1K76 A;  2M0Y A;  3H0I A;  2L3Q A;  1WA7 A;  2CT4 A;  2DNU A;  2GBQ A;  2KE9 A;  2JM9 A;  4F16 A;  2AZV A;  2EQI A;  1E6G A;  1VYU A;  2I0N A;  2CRE A;  2OAW A;  2DBM A;  1W70 A;  1AZG B;  4ORZ A;  2DIL A;  4HVV A;  1E6H A;  1VYT A;  2D8J A;  1GL5 A;  2C0I A;  3EG3 A;  1GFD A;  2LQW A;  5FWB A;  2LCS A;  4CC4 B;  1S1N A;  4KRT A;  2AZS A;  3I5S A;  1NEG A;  5FWC A;  3EHQ A;  4HXJ A;  1NLO C;  2JT4 A;  2YUQ A;  2ABL A;  4LE9 A;  1WFW A;  1PWT A;  4AFU C;  5HCK A;  3RBB B;  3UA7 A;  1ZUY A;  1NG2 A;  2CH4 A;  2EKH A;  2MIO A;  2LZ6 B;  3TSZ A;  1K4U S;  4J9F A;  2FEI A;  2DX1 A;  2A08 A;  4DEY A;  1UHF A;  2B86 A;  1T3S A;  2EPD A;  1M8M A;  4OMO A;  1QKX A;  2HSP A;  1RLQ C;  2JM8 A;  2GNC A;  2LQN A;  1H8K A;  1NM7 A;  1HD3 A;  2BZ8 A;  2OI3 A;  2EYX A;  3VRY A;  4RTT A;  4J9C A;  3NGP A;  1TG0 A;  1YWP A;  1CKB A;  1E7O A;  1HJD A;  3M0S A;  1UFF A;  2PNI A;  1PRM C;  1YP5 A;  2K79 A;  3THK A;  4DEX A;  4D8D A;  1WDX A;  2GTO A;  3NHN A;  4J9D A;  2BZX A;  2CUB A;  3M0R A;  1WXU A;  4EIK A;  2CSI A;  1JO8 A;  2DBK A;  2YUP A;  4RTW A;  1J3T A;  2M51 A;  2ROL A;  1YNZ A;  1Y0M A;  2RF0 A;  3VS0 A;  2L3P A;  1UUE A;  2DL5 A;  2FRW A;  2J6K A;  2FO0 A;  2KGT A;  3QWY A;  5IHN A;  3VS6 A;  1SSH A;  1GBQ A;  3IQL A;  2D1X A;  2JMA A;  5IH2 A;  1G83 A;  1SRL A;  2H8H A;  2DL8 A;  3O5Z A;  2FPD A;  1ZUK A;  2XMF A;  4E6R A;  2K9G A;  2YDL A;  1QCF A;  2YUN A;  1VYV A;  2KRS A;  1ABO A;  1GCQ C;  4JZ4 A;  1X2Q A;  1BK2 A;  4CC3 A;  1PNJ A;  2KBT A;  3C0C A;  4JJD A;  3EHR A;  2D0N A;  3TSW A;  2KRN A;  1NYF A;  3I35 A;  2ROT A;  1BB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...