2K6DA

Cin85 sh3-c domain in complex with ubiquitin
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
62
structure length
62
Chain Sequence
KSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3 domain-containing kinase-binding protein 1
publication title Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain/ubiquitin
total genus 1
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k6dA00
4LNPA 2KYBA 2F2XA 4X1VA 2DL4A 4QT7A 4AG2C 4JJBA 2DRKA 4JZ3A 1OOTA 5IHIA 2FO0A 1AVZC 1JXMA 2EKHA 2K3BA 2LJ0A 1FMKA 1UJ0A 2RMOA 3GBQA 1G83A 2DA9A 2CH4W 3REBB 2DNUA 1WLPB 3NPFA 1H8KA 4GBQA 4J9CA 2LJ1A 2XMFA 1WXTA 1ZUYA 4CC4B 2D8JA 1QKWA 4J9BA 1B07A 1H92A 2LNHB 3VS2A 2BZ8A 3H41A 2JM8A 1YCSB 2DM1A 5GJWB 2DL8A 1HSQA 1WIEA 3VS6A 2KNBB 3EG2A 5IHKA 4RTWA 1AZEA 1NG2A 1PRLC 3PVQA 3UATA 1MV0B 4AFSC 2DLPA 1T0JA 4CC7A 3VS1A 1VA7A 1RI9A 2V1QA 2O9VA 2AK5A 3QWYA 1ABQA 2ED1A 2DILA 1BK2A 1CSKA 1QWFA 2W10A 2CSIA 1Y57A 1NEBA 4FSSA 4LUEA 2L3QA 2GQIA 2LQWA 2O2OA 2ED0A 2K79A 2EPDA 4F16A 1Z9ZA 2EW3A 1NLOC 2A37A 2CT4A 2JW4A 2L0AA 1NM7A 1SRMA 4JJDA 3RBBB 1GCQA 2KRMA 1M3CA 3REAB 2ESWA 2AKLA 3KFVA 4F17A 4RTVA 1UTIA 1RLPC 2LP5A 2PZ1A 1X6BA 4OMPA 3ULRB 1AWOA 2AKKA 1K0XA 1Z9QA 1N5ZA 2A08A 5I22A 1W6XA 2NWMA 2K6DA 2DBMA 1WFWA 4CC3A 2RQUA 5IXBA 2FEIA 3LH5A 3H0IA 2JS2A 3O5ZA 2IIMA 2J06A 2FPDA 4AFUC 4RTZA 2EGCA 2EQIA 2KXCA 1IO6A 5L23A 2DYBA 2KROA 2FG0A 5I11A 4D8KA 1KFZA 2H8HA 2EYZA 2FRWA 1LCKA 3NMZC 4HVUA 1ARKA 2A36A 2C0IA 1CKAA 2JXBA 1WI7A 2SRCA 3U23A 1YNZA 3QWXX 1PKSA 2BZXA 4Y92A 3VS0A 2RNAA 1K4US 2ECZA 1NYFA 1AEYA 1RLQC 4K11A 4HVWA 4Z88A 1KIKA 1A0NB 4CC2A 2HSPA 3RNJA 1X43A 1GCQC 1OEBA 2ENMA 1GFDA 2CT3A 1U5SA 1CKBA 2FRYA 4OMQA 1OPKA 2O9SA 2P4RA 3I35A 1K0SA 2J6FA 1UG1A 2D1XA 5GJVB 3VRZA 2CREA 1UUEA 2KYMA 2NUZA 2BTTA 1SPKA 1X27A 1PKTA 1SSHA 2DE0X 3M0UA 1WDXA 4RUGA 1AWXA 2O31A 1GL5A 2YUQA 2M0YA 2DRMA 2YUPA 1RUWA 3JV3A 4OMMA 4ORZA 1U3OA 1X69A 3C0CA 2J7IA 2RQRA 2YT6A 2FPFA 2LMJA 2MIOA 2LJ3A 4AFZC 1GFCA 1SHFA 4J9HA 4JPBW 4HXJA 2OAWA 2KRNA 2DL7A 2PTKA 2L3PA 4LN2A 2ABLA 1ZX6A 4D8DA 1BBZA 1SEMA 2VVKA 2F2WA 2KGTA 1OPLA 2YUOA 3UA7A 2JTEA 1SHGA 2W0ZA 1KSWA 2X3XD 2OI3A 2GTJA 1AZGB 1KJWA 3EG1A 3M0SA 4EIKA 2DMOA 2LCSA 4WCIA 1XOVA 1K76A 4J9DA 2EYXA 2YSQA 3PVLA 2KEAA 2RPNA 3EGUA 1GBQA 4RTUA 4OMOA 4RTXA 2CH4A 2EYYA 1UJYA 1E6HA 1PHTA 2LZ6B 1UHFA 2HDAA 4HVVA 3I5SA 1BU1A 3EHRA 1GCPA 5HCKA 2GNCA 4LUDA 2KRSA 1BB9A 4E6RA 1TG0A 2J05A 1X2QA 1UECA 1K9AA 1YWOA 1NYGA 4R0KA 2HCKA 4OMLA 2DL3A 1UGVA 2M51A 4J9GA 2C0OA 2I0NA 2RQTA 2J6KA 2LX7A 1HD3A 4RTTA 1VYUA 3EHQA 1ZBJA 1PRMC 3VS5A 4AFQC 1M3BA 2E5KA 2KXDA 4JJCA 3SHWA 1V1CA 1U06A 3NHNA 2RN8A 3VS4A 1YN8A 4KRTA 3TSZA 3TVTA 1FYNA 2SEMA 2LQNA 1I0CA 3IQLA 2RF0A 2DVJA 1W70A 3PE0A 2KT1A 3EG0A 1E7OA 1ZUUA 1B3QA 4RTYA 2JT4A 1JQQA 1T0HA 2JMCA 1QLYA 1QKXA 1EFNA 2EBPA 4AG1C 1WA7A 1Y0MA 4Z8AA 1UE9A 2VKNA 2AZVA 1ZUKA 3M0RA 1YP5A 4J9IA 2K2MA 3M0TA 2J6OA 2GGRA 4HCKA 2QDLA 2EVRA 5ECAA 1AWJA 3UA6A 2HBWA 2JM9A 2PNIA 1M3AA 2FPEA 1GRIA 1SRLA 2EGAA 2YUNA 2MCNA 1MV3A 1AD5A 2DX1A 2DJQA 3TSWA 2KBTA 2KE9A 1TUDA 2OJ2A 5EC7A 1I1JA 2D8HA 2DBKA 5IXFA 2B86A 3I9QA 1JXOA 3THKA 2F2VA 2RQWA 1X2KA 3FJ5A 4J9EA 4OMNA 2K9GA 2CDTA 4M4ZA 4A63B 1NLPC 1UDLA 1M27C 2CUBA 2EGEA 1PWTA 1QWEA 1WX6A 3VS7A 1JO8A 2CUDA 1JU5C 3ZL7C 4LE9A 1W1FA 1AOJA 1E6GA 1WXUA 1WYXA 5FWCA 1G2BA 1J3TA 2G6FX 1VYVA 5IH2A 1X6GA 5IHNA 3M0QA 2YDLA 2X3WD 2JS0A 5FW9A 4F14A 2BZYA 3I5RA 2ROTA 2RQVA 1ABOA 1M30A 1K1ZA 1H3HA 2A28A 1QCFA 1AWWA 2EYWA 1WXBA 1UFFA 2KT8A 2D0NA 4Z89A 3UF4A 2L2PA 3NGPA 2K7AA 4IIMA 1PNJA 3CQTA 2VWFA 3H0HA 2O88A 4DEXA 2AZSA 1S1NA 2V1RA 2GTOA 4DEYA 2ROLA 2DL5A 2KR3A 2MOXA 1MUZA 2C0TA 1HJDA 1TUCA 1JEGA 1GBRA 1M8MA 3VRYA 1YWPA 2CSQA 1T3LA 1T3SA 2DF6A 4J9FA 1I07A 5FWBA 3A98A 1UHCA 1VYTA 3VS3A 2JMAA 3R6NA 3M0PA 1OV3A 1ZLMA 4JZ4A 3H0FA 4GLMA 4ESRA 1NEGA 1ZSGA 3SEMA 2GBQA 3EG3A 4IIOA 2HEQA 2L3SA 4ZNXA
chains in the Genus database with same CATH superfamily
5FU7C 3MHXA 2K4YA 2KYBA 3HKSA 2F2XA 2DL4A 4QT7A 4JZ3A 3C94A 5IHIA 2KAFA 3JSCA 1W2BS 1QP3A 1JXMA 4N0AA 2RK1A 3OBYA 2LJ0A 3CC2Q 1OZ3A 2DNUA 4LD6A 3NPFA 3CCQA 5GAMj 4HCBA 4J9CA 2LJ1A 4M75D 1FX7A 2MWOA 1ZUYA 2X9HA 3V7RA 4XK8E 3L2ZA 2LNHB 2BZ8A 2ZZDA 2JM8A 2RB6A 4M78A 1YCSB 2DM1A 5GJWB 5A0LA 2D6FA 3VS6A 3MCAB 2NUTA 1D3BA 3M56A 2DK3A 3PVQA 3LYIA 4BY6B 4CC7A 3VS1A 4NS5A 3L2WA 1IHWA 1KG1A 3MP8A 1RAEB 1VUBA 1RI9A 1O75A 2CP0A 2ED1A 2RJFA 4MDXA 1FMVA 2DXUA 1RABB 4XU0A 3CC4A 5FU7B 1OI1A 5I2MA 5IAYA 3GNGA 4M77E 4FW2A 4O6JA 1FWZA 1Z9ZA 2EW3A 3EG9A 1IB8A 3TREA 2JW4A 2VB6A 3RESA 1SRMA 1WHGA 3EFRA 4C0FA 3QZ9B 2RHYA 4HKEA 1KQSP 4AMCA 1OU9A 4BE1A 1YBYA 4M7DF 4RTVA 1U1TA 1UTIA 2CS7A 2K2VA 2YLCA 3FC3A 2AKKA 2EQUA 2V26A 4PJOA 1BI1A 3I55A 1WHHA 3OA6A 2BIVA 1YI2Q 2E3HA 1WFWA 4CC3A 3V8LA 5IXBA 2QA4Q 1VQ4A 1G5VA 3O5ZA 2RHIA 2FPDA 2CP7A 2LTOA 4AFUC 2IPOB 5KYYA 4JDSA 4JLIA 5L23A 2KROA 1KHIA 4ZTJA 3HTRA 2RM4A 4D8KA 1KFZA 2H8HA 3NMZC 3QO3A 1ARKA 5FRMA 3AT1B 2A36A 1PC0A 3CCJQ 1WPYA 1VQPA 3CC7Q 3CCLQ 2A7YA 2D9TA 1PSEA 3QWXX 1TTHB 1LVKA 2PUKB 2EJFA 1AEYA 4HVWA 1YITT 1K9MC 4C8QF 3SWNA 4M7AE 1VQMT 2ENMA 1QVFA 4HT9A 1WQWA 1K9MU 4C0ZA 4C92E 3M55A 4LDUA 5LJ5j 1CKBA 1OPKA 2JTMA 1YIJA 1K0SA 3JCMP 3VRZA 2CREA 1UUEA 4IUTA 2HAXA 1W2BP 1SPKA 3CD6A 2H3JA 2LT1A 2M0YA 1VQ6A 1RUWA 3FJPA 3JV3A 1VQLA 1BYMA 2R58A 5LJ3j 4HCZA 1MGQA 4OB3B 4HCCA 1TSFA 2J7IA 4M7DD 3CCRT 1M1GA 4J7IA 2MIOA 3OYNA 1SHFA 4BI8B 2OTJA 1JBMA 3VJPA 4XTVA 2RHZA 2L3PA 1ZSZC 1S72A 3J81E 1BBZA 1IHVA 5GANg 3L2UA 3E9FA 4C5EA 2F2WA 3VUZA 3OS1A 3TU4K 1OPLA 3UA7A 1N9RA 3ER0A 4RCBA 2BE9B 2OI3A 1LNXA 5FRNA 1PG5B 3EG1A 4EIKA 2DMOA 1XOVA 4BI4A 1VQOA 2XG8D 2EYXA 4J9DA 2VV5A 1M90C 3EGUA 4RTUA 4OMOA 1G8XA 1I5LA 3RKXA 1LPLA 4EMKC 3SD4A 1NE8A 1M90U 3I5SA 3A5ZB 5LJ5f 5GMKi 4YTLA 4C8QD 1N9SA 4M7AF 1TG0A 3RMQA 1IZ6A 1PCXA 4C92F 1K9AA 1WHLA 3H9NA 4Y91A 1YWOA 4R0KA 4OMLA 3QKJA 3QYGB 4J9GA 2LQKA 2RQTA 4EDUA 2J6KA 4C5GA 4E7ZA 3TCJA 1D0YA 4FU6A 1PRMC 2F5TX 4AFQC 5LJ3f 1ZSZB 1M1KR 1V1CA 4EMHA 3NHNA 4C5IA 4KRTA 2DYIA 1MNDA 3BY7A 3TVTA 3G6ET 2C06A 3JB9F 2X51A 2SEMA 1QP2A 4OF1A 4CRIA 1W4SA 1C0MA 1OYXA 2RF0A 2YRCA 3E9GA 2Y4XA 4M75A 3JCMW 1YITQ 2E10A 4E2FB 1B3QA 2ZPHB 1VQMQ 3LX7A 4Z8AA 3JCMh 1UE9A 1U1SA 3E1SA 2WSEE 3M0RA 3CCUT 3CEYA 1NPPA 2GGRA 4N4IA 3HRSA 4B9XA 2EYQA 1I8FA 1BI0A 1ZQ1A 2HBWA 2JM9A 1XQHA 4NL3A 5GANh 2E64A 3OQ5A 2OJ2A 4DBFA 3HPWA 2D8HA 3LLRA 1TOVA 2B86A 8AT1B 3JB9J 3OYBA 2RQWA 3EFOA 3CCRQ 4M4ZA 4A63B 3HFNA 2EFIA 1WZOA 3L2VA 2O01E 2GFUA 3PNWC 1WQ7A 2CUDA 3J80E 3HRUA 1W1FA 1SKUB 1J3TA 4M7AD 3C95A 3OYMA 1BIBA 3CCSA 1VYVA 5KYWB 1X6GA 2XK0A 4C92D 4ELZC 1X01A 1WGSA 1K1ZA 1VQ8A 3I56A 3A8LB 1QCFA 2EYWA 2D0NA 4PJLA 4F7UF 2L2PA 2K7AA 2IVWA 2EKOA 2CZ1B 1BI2A 3A8GB 2AZSA 2OTLT 2V1RA 2GTOA 4DEYA 1SSFA 5C0MA 3JB9D 1HJDA 4X34A 1TUCA 5CKFA 1YJ9T 3VV0A 1YWPA 2MAMA 1BIAA 1JJ2A 5CKDA 1B7TA 1T3SA 3VYHB 2QEXA 3PGGA 3NFCA 3M0PA 2L89A 1OV3A 4TVRA 4EPCA 4UC4A 2RJDA 4N4HA 4ESRA 3SEMA 2DJZA 2GBQA 3EG3A 4IIOA 3JCMd 4DBQA 2JNGA 2FZKB 1Q81R 2RI5A 2P0QA 4ZNXA 2NYSA 2E41A 1F1BB 2ZPEB 1VQ7A 3CCET 3BE3A 1AVZC 2RA2A 2K3BA 2RMOA 2CH4W 2VGMA 3G6EQ 2AT1B 2HSEB 3LGLA 4QQDA 3GPLA 2CP2A 2FB7A 1H92A 3OYEA 2LT4A 3VS2A 3CCQT 5GAOq 4JRKA 1DJ7B 2DL8A 3JCMV 3CPWA 3OYCA 2KNBB 5IHKA 1WNLA 1PRLC 1BCOA 3CCUQ 4AFSC 2DLPA 1QVGA 1EX4A 1T0JA 2BE7D 1GXIE 3Q1JA 1K8AR 3OYHA 1Q86R 3UT1A 1Y7XA 4XU3A 2O9VA 1QVFS 3X25B 2HD0A 2LCCA 4L6V5 1BK2A 1PD1A 3JCMJ 1Y57A 1NEBA 4A4HA 2ZPFB 4FSSA 3PFSA 4BUGA 4LUEA 2GQIA 2QYZA 1BI3A 1M2VB 2LQWA 5CKEA 3RDVA 1TXQA 3CC4T 2K79A 2EPDA 4N0AC 5L8RE 8ATCB 1YJNA 3OMGA 3X24B 2KK4A 2DXCA 2QTXA 3REAB 3CMEA 2ESWA 2JJ9A 3KFVA 4F17A 6AT1B 5CVIA 2LP5A 3ULRB 4JS4A 4M78C 1Z9QA 4O5VA 1YJWT 2M1HA 1I5OB 2A08A 5I22A 1W6XA 4BY6C 2NWMA 1MMNA 2K6DA 3OY9A 2OTLQ 2DD5A 2RQUA 4FYWB 2JS2A 5CKBA 1UGPB 3GOXA 4RTZA 2EGCA 5AYFA 2EIFA 4JUVA 2DYBA 4PLLA 4J6WA 4M77A 2MK5A 4M7DE 3EAEA 1QCOA 1R0CB 5GAOl 5CAIA 4M77B 3JCMb 2EWNA 1VQ5A 3CC2A 3GF5A 4FL6A 1PKSA 2BZXA 4PJJA 1WHJA 3RMSA 2E12A 1VQPT 1RLQC 4ZGJB 1WJQA 3LWIA 1A0NB 1D1BA 2AHJB 2QK0A 1Y71A 1D0XA 2K5LA 5GAOr 2KQWA 4J6YA 2EQKA 2FRYA 5KYXA 2X4JA 4M78B 5CKHA 4JRPA 4PJOC 2VASA 4QQGA 3CCQQ 2KYMA 4E7KA 1QW1A 4Y28E 2NUTB 5EG2A 1D3BB 1PKTA 1SSHA 2COWA 2DE0X 4RUGA 5GMKj 1YIJT 2O31A 2QASA 2YUPA 3UPUA 3AHUA 1OQKA 1RAGB 2K5FA 4FT2A 1X69A 3EH1A 4C8QE 1KD1R 3CD6T 2M02A 2DEUA 2RQRA 5GAOn 2LMJA 1VQLT 4OB1B 4PFOA 2ZAEA 4HXJA 3RKYA 4PFZA 3JAME 1RAAB 2DL7A 2ABLA 1VQKA 3CCVT 1EZZB 1ZX6A 4A4FA 3MJXA 1SEMA 2VVKA 2OTJT 2KGTA 2DTIA 4M7AA 2FZCB 2QG9B 1UGQB 1S72T 1KSWA 2JTFA 2MI6A 2VXEA 4C92A 2GTJA 3EG9B 3CC4Q 2BUDA 2EAYA 3QZ5B 3SWNC 1QVFP 1AZGB 1B34A 2KSSA 2CP3A 3DB4A 3M0SA 3L2RA 3OS5A 1V76A 4NL2A 3QDFA 2LCSA 4JRQA 4WCIA 1ZA2B 3PMTA 5GAMf 3PVLA 1YI2A 2RPNA 2VGNA 4RTXA 4PJOB 3QIIA 2RHUA 1UJYA 4BE0A 3OYAA 2QA4A 1M8VA 1PHTA 2HDAA 4XAXB 1RI0A 1YJWQ 1BU1A 5HCKA 1VQNT 1AT1B 1Y07A 3HHTB 3EGXA 2XICA 2X35A 2JUFA 2QGGA 1X2QA 1UECA 1G3YA 3EH2A 1NYGA 4L5GA 4BDYA 5KYYB 1UGVA 2C0OA 3CCJA 2VUBA 2IG0A 4MMKA 1IGUA 2ZPIB 4A54A 4OMFB 1XTDA 2GCXA 1RAIB 2GF7A 3EHQA 5J26A 1G3TA 4CI0C 2QI2A 1M3BA 2RJCA 2E5KA 3SHWA 5LL6S 3LWHA 2RN8A 2FVUA 4FYYB 4IURA 4JLGA 3OS2A 3S3OA 1JJ2S 3MPUB 2FZGB 1M1KC 5HKCA 3S6WA 3SWNB 1D1AA 1W70A 1VQPQ 2KT1A 3EG0A 2XKOC 3GP8A 3SDZA 2CYZB 1M1KU 5A0DA 2JT4A 2KY9A 1JQQA 1T0HA 1YCYA 2JMCA 1QLYA 2EBPA 2L8DA 2QXFA 3MEVA 4ZN1A 3LH0A 2MPXC 5GAN6 3M4GA 3S3MA 2XD0A 2LC4A 2QDLA 1AWJA 1M3AA 3JCMg 1GRIA 1SRLA 2EGAA 5FLXE 2DIQA 2YUNA 2MCNA 3V8KA 1MV3A 5GANj 2DX1A 1YIJQ 5DLOA 2EQJA 5EC7A 5CO7A 3QJYA 3CD6Q 2YXYA 2F2VA 2FYKA 1AHJB 1X2KA 2VYTA 2X4YA 1KC8R 2EQMA 2JZ2A 3QHSA 1VQLQ 3GNFB 2RD1A 1M27C 4ELYC 3CPWS 1ZA1B 3ZBDA 4XTWA 3ZL7C 1AOJA 3OYDA 5FWCA 1FXXA 4R55A 3CCVQ 1QVGS 1HYOA 3A8MB 2DETA 4E7SA 2QDYB 3M0QA 2A3LA 3ME9A 3QBYA 3X26B 3I5RA 1IREB 1S72Q 1M30A 1WJSA 1H3HA 2E1HA 4M75C 1U8RA 3CCST 3BDLA 1M2OA 4Z89A 3UF4A 4QW2A 3NGPA 5CK9A 1PNJA 1VQ8T 3J7AF 1OULA 1RL2A 3FRNA 2V8JA 3BW1A 3JCMc 3VU3C 4V2SA 2XHCA 2MOXA 1GBRA 3OYLA 1M8MA 1R0BG 2DEQA 1IXDA 2JVVA 2E4HA 4FM4B 1VQNQ 3JCMQ 5I2SA 5IN1A 3GLXA 4MZTA 3R6NA 2VXFA 1JB0E 4F7UE 1NEGA 1ZSGA 5GAMd 5GANf 4XTUA 1M4ZA 3G71T 3C4SA 4P5NA 2HEQA 4KGZB 4LNPA 2RO0A 4X1VA 4JS5A 4KH0B 2NLUA 3CPFA 4JJBA 2HQXA 4QQ6A 1OOTA 4XU1A 2YRDA 4ME7A 1Q81C 1Q7YR 4PJOF 2P84A 1FMKA 1UJ0A 4JRIA 2DA9A 2WSFE 1WLPB 3OBWA 1Q81U 2NUPA 4GBQA 1WHKA 4M75B 2XMFA 2D8JA 1QKWA 1C6VX 4J8OA 4BB7A 2RH2A 3GIBA 3RKWA 2RI3A 3OYFA 4M77G 1RADB 1HSQA 2E6NA 1WIEA 3CBOA 5KCOA 2O4XA 1KQ1A 3EG2A 1R8OB 3H8ZA 1AZEA 5IT9E 1ZBXA 1MV0B 1JJ2P 1OU8A 1M1FA 2EJGA 4EMKA 2I2LA 3M9QA 4X9CA 2CKKA 4Z02A 2VC8A 1K73R 2OAUA 4MMLA 3HL8A 1KHCA 1IGQA 3QWYA 3OYYA 5GAMe 3EFOB 5FU6C 1NJIR 1CSKA 2YWWA 1QWFA 1K8AC 1Q86C 2ZCFB 1VQ9A 3MEWA 2X4WA 4M78G 2HQHA 2L3QA 4RMOA 1IRXA 2DPPB 2ED0A 1Q86U 4F16A 1JRIA 3OYKA 1N8RR 3WVEB 4FYVB 4JJDA 3RBBB 1GCQA 5GMKe 2KRMA 1M3CA 1RLPC 1YJNT 3CPWP 4HA8A 4II1A 3CCSQ 4OMPA 4KULA 1K0XA 1N5ZA 4J7FA 3CMET 7AT1B 2PQWA 3M53A 4BE2A 5CQYA 1VQ8Q 1QVGP 3M58A 2DZ9A 3N5BB 3FLGA 4MZMA 2FEIA 2RJEA 3LH5A 4PL6A 3QJ6A 3QSUA 2IIMA 3CMAT 2K57A 3VYGA 2KXCA 1IO6A 2FG0A 5I11A 3A8HB 2EYZA 3M4YA 2XU8A 4FT4A 4A53A 3G4SA 2K5IA 4HVUA 4N4GA 5FU6B 3DKMA 2C0IA 4PJOG 2KI7A 2QQ9A 3QUIA 5LJ5d 2JXBA 2V8KA 1QVPA 3G71Q 4E7LA 2SRCA 4D6WA 1YNZA 2E70A 2P4TA 2HBPA 4Y92A 3QXEB 3VS0A 2P0PA 3NTHA 2CP5A 2ECZA 2BKDN 1NYFA 1VQ5T 4K11A 1H641 2PVGB 4L59A 1KIKA 4CC2A 2HSPA 4MZPA 1X43A 5D6XA 4DBRA 4DQ2A 2M0OA 1GFDA 3T9NA 1UGRB 5LJ3d 3MEAA 2QAZA 1M9SA 2RI2A 2YRVA 1H3ZA 5GAOm 3SFMA 3META 3CCMA 5KH6A 2PU9B 1WDXA 3MP1A 2PVDB 2XDDA 2DRMA 4M7DA 4LDYA 3FIFA 2QQRA 4IUUA 1YHQA 4BI3A 4DOWA 4J83A 4M7DB 2YT6A 2FPFA 3HRTA 4M77C 2LDMA 1KQ2A 3H6ZA 2LJ3A 4J9HA 1KD1C 2OAWA 3O8VA 2YHTA 2PTKA 3P8DA 5LJ5e 3PT9A 4D8DA 3HFOA 1KD1U 2LCLA 4A4EA 3MP6A 4FYXB 2K3XA 5A2QE 2JTEA 2F5KA 2W0ZA 1VQKT 1MMAA 3UWNA 1D09B 2JN0A 1PD0A 3DB3A 3FEOA 1KJWA 5HY6A 5LJ3e 1K76A 1ACMB 2KEAA 1YJNQ 2EYYA 2XDPA 4IKFA 4C8QA 3I55T 3CXCA 5HK3A 3CMEQ 1TWBA 2FL7A 3EHRA 2Y90A 5HK0A 1YJ9Q 5GMKl 4C8QB 4LUDA 2RHXA 2QA4T 1VQ4T 5KYUA 4OVAA 4BACA 2LQ8A 5D6WA 3CMAQ 4LDXA 2HCKA 3TEEA 2DL3A 4PLIA 5KYUB 4PNOA 2LX7A 2CZ0B 4QKUA 1QQJA 5AT1B 3G1JA 5J3BA 1BCMA 3A8OB 4PKCC 4BDZA 2GQVA 2KXDA 3CCEQ 1U06A 1D1CA 3OW2A 3VS4A 1YN8A 2D0QB 4OP0A 3TSZA 4M7AC 2LQNA 4ZN3A 1I0CA 4C92C 1EIFA 3IQLA 1QMCA 4LDWA 4C0DB 4GY5A 4VUBA 5GAN2 1Q82R 3PE0A 1VQ5Q 1ZUUA 4RTYA 1QKXA 1SF9A 4AG1C 3KXTA 1Y0MA 2AZVA 5KYXB 1ZUKA 2R5MA 3HSBA 2K2MA 3M0TA 2J6OA 4KBMB 3HP9A 5ECAA 4PJNA 2PNIA 2FPEA 5GAMg 1AD5A 1FMWA 1VQ6T 2DJQA 3L2QA 4WF2A 3TSWA 2R57A 4RCCA 1LOJA 2KE9A 1TUDA 2XIDA 3G7ZA 3OS0A 2DBKA 5IXFA 2CP6A 3I9QA 4M75G 1JXOA 2A0FB 2DAQA 1KK7A 2XDBA 4J9EA 2K9GA 2CDTA 2COZA 1I4K1 1TUGB 1C1AA 1N27A 2EGEA 1QWEA 3VS7A 2WACA 1KC8C 1JU5C 2HL3A 3TQ7P 3C12A 1G2BA 4M7AB 3MO8A 3M5AA 5J39A 4OGEA 4XTZA 3CBPA 1KC8U 2YLBA 4C92B 2YDLA 2X3WD 2JS0A 5FW9A 2ROTA 4F04B 1VQKQ 2E3IA 1B34B 2A28A 1NZ9A 3JB9I 3QDRB 3VKIA 1WXBA 1RAHB 2DXBA 2QQAA 4IIMA 3EFSA 2HL5C 1YJWA 1VQOT 3CQTA 2VWFA 3H0HA 3KUFA 4FIBA 4FCYA 2ROLA 2KR3A 1MUZA 2COYA 1TS9A 4M78E 1HK9A 3I55Q 4HT8A 2CSQA 1T3LA 3EGXB 2DF6A 4J9FA 1R77A 1I07A 5FWBA 3A98A 3CC7A 3CCLA 1VYTA 1VQ4Q 3R6OA 3H0FA 2DZCA 4QVDA 2FHDA 2Z0WA 2Y4YA 3OYJA 2M9UA 1X6OA 4AG2C 2X4XA 4E7IA 2DKGA 1LJOA 2DRKA 3E2UA 3JB9H 1HXDA 3OSVA 2FO0A 3P8HA 2JOYA 4OB2B 1OZ2A 3X20B 4ZGDB 9ATCB 5CIUA 2EKHA 4KGXB 1G3SA 3GBQA 1G83A 3REBB 1O9SA 2KMTA 5CQXA 2KDSA 4ANJA 1H8KA 3ASKA 1Q7YC 5GAMh 1WXTA 4CC4B 1TH7A 5I21A 4J9BA 1KQSA 1B07A 2DFUA 5KCHA 3H41A 5C6SA 4MDWA 1Q7YU 5KE3A 3OMCA 5FROA 4KT0E 4C0GA 4M77F 4RTWA 1NG2A 2LRQA 2DIGA 3UATA 3P8BB 4DOVA 4PJOE 1XJWB 4F7UA 1Q95G 1N6AA 3FB9A 5DY9A 5LJ5g 1VA7A 5GMKh 4ATOA 1SG5A 2QGFB 3RERA 1VQ6Q 4F7UB 2HMAA 2V1QA 2AK5A 1ABQA 3SB2A 3PIPA 4R56A 2DILA 2OX7A 5GAN8 2L5QA 2W10A 2CSIA 4Q5WA 5CR2A 3CCVA 1K73C 4FSXA 3L42A 1BKBA 4GLKA 4M78F 1TU0B 3RIRA 2O2OA 2OTJQ 5LJ3g 1NJIC 2ATCB 1K73U 2K3YA 1VQ9T 3QPHA 5KE2A 1NLOC 2A37A 4AT1B 2CT4A 5DM7R 2L0AA 1NJIU 1NM7A 3JRZA 4M7DG 3BDUA 3X28B 1VIFA 3I56T 2AKLA 1X75C 5D7UA 2PZ1A 1N8RC 1X6BA 1AWOA 4WTOB 3ZEHA 2MF2A 1MMDA 2CGHA 3JCMf 1N8RU 4E47A 1VQOQ 2L3RA 1VQNA 3F70A 2M16A 4B9WA 2DBMA 3M59A 1W2BA 4PJMA 3OB9A 3H0IA 4KH1B 2J06A 3UDCA 2HQEA 4JJNK 4XU2A 4NOYA 1NPRA 2EQIA 3EGDA 3M57A 3VUBA 2QEXT 4LXCA 2H3EB 4RG2A 4IUPA 2FRWA 1LCKA 3EGDB 3OSSC 1ZSZA 4M77D 1QCNA 4DBHA 2HNIA 4PFPA 1CKAA 2RK2A 3PMIA 1VIEA 3KBGA 3G4ST 1WI7A 1K9MR 1YITA 3U23A 3CXCS 1VQ7T 3BFMA 2RNAA 2MYSA 4J6XA 1VQMA 1K4US 4C8QG 4PK4A 5GAN5 2PUOB 4Z88A 4IUQA 4KUIA 3RNJA 4KUDK 2DXTA 2NUPB 1GCQC 1UGSB 1OEBA 3ZFJA 2CT3A 4RKUE 1U5SA 4OMQA 1P92A 5LJ5h 4KGVB 2O9SA 2P4RA 3I35A 4LDVA 2J6FA 4M78D 5KYNA 1WHMA 1UG1A 2D1XA 5GJVB 2F1LA 2NUZA 1VOMA 2O4XB 2BTTA 4DA4A 3OW2S 2G3RA 1X27A 3M0UA 2E5QA 1AWXA 1GL5A 2YUQA 1MNEA 4EMKB 3CCRA 4OMMA 3M54A 3CCMT 4ORZA 1RACB 1OX8A 1U3OA 3C0CA 5LJ3h 2ZPGB 4A4GA 2LNVA 4AFZC 1GFCA 3A1PA 4JPBW 4XQ3A 1YHQT 2KRNA 5GAN3 3QG1A 1K8AU 3LW5E 4LN2A 2V8IA 3QYHB 1I81A 4IUVA 1D0ZA 2YUOA 1SHGA 5KYWA 2X3XD 2CZ7B 1VQ9Q 1M90R 2CZ6B 3URGA 2KVQG 2P0KA 2QQBA 2ZGWA 3RR6A 4B6MA 2YSQA 2EJ9A 2GFAA 3I56Q 1GBQA 3NTIA 2AIRB 4M75E 2CH4A 4X9DA 4PJOD 1E6HA 1MMGA 5M9OA 2F69A 4ZTFA 2DTOA 2LZ6B 1UHFA 4ZGEB 4HVVA 2E65A 1GCPA 1OX9A 2MMPA 4M7AG 2GNCA 3L1AA 2KRSA 1BB9A 4E6RA 4M7DC 4LD9K 4C92G 1UEBA 3V8JA 2J05A 2M51A 2I0NA 4QVCA 4EMGA 2DERA 3G71A 2QEXQ 1HD3A 3DLLA 4RTTA 1RAFB 5CCAA 1VYUA 2QTVA 1ZBJA 3G6EA 2R5AA 4XTYA 3VS5A 4BD3A 4QVZA 4JJCA 3JB9G 3CC2T 1FYNA 3G4SQ 4RG8A 3MEUA 3V7SA 2E6ZA 1VQ7Q 2B8AA 2XI9A 5GMKm 2DVJA 3INZA 5GANd 4A4KA 3OYGA 1E7OA 1Y96A 3CCUA 2DVEA 3V7CA 5A0GA 1EFNA 1M5Q1 1WA7A 1PM3A 2VKNA 1Q82C 2LVMA 1G3WA 1Y96B 5GAN4 3MKDA 1YP5A 3CXCP 4E7JA 4J9IA 2ZPBB 2WSCE 4HCKA 4OB0B 4C8QC 5D6YA 1ZHIA 4E7HA 1XNIA 2EVRA 1Q82U 3UA6A 3RUXA 2PVOB 2KBTA 1MHNA 3CCMQ 1I1JA 3THKA 5GAOp 3OYIA 1KQSS 3FJ5A 4M75F 4OMNA 2QQSA 2DD4A 4J5YA 4OGCA 1V29B 1NLPC 1UDLA 3JCMX 3CBMA 2CUBA 3JCMe 1PWTA 1M2VA 3OW2P 1WX6A 1JO8A 1YHQQ 4C5HA 4LE9A 2DO3A 1NBEB 1E6GA 1WXUA 1WYXA 1PSFA 4C0DC 2G6FX 4XTXA 4FW1A 2MWPA 5IH2A 2LX9A 2HKQB 5IHNA 4F14A 2BZYA 3WVDB 2RQVA 3D7SB 3FDRA 1ABOA 5GANe 3LGFA 4F7UG 2DTHA 3E19A 1AWWA 3S3NA 2OTLA 1UFFA 2KT8A 1YFNA 5DLQE 1WJRA 3DLMA 2O88A 4DEXA 1YI2T 1YJ9A 1S1NA 3PTAA 2HZYA 2DL5A 2C0TA 1JEGA 3CMAA 3VRYA 5GAN7 3PIOA 3WXMB 2HKNA 1UHCA 3NTKA 3VS3A 2JMAA 1UB4A 1ZLMA 4JZ4A 4GLMA 3CCEA 3CCJT 3CC7T 3CCLT 2L3SA
chains in the Genus database with same CATH topology
4LNPA 2KYBA 2F2XA 4X1VA 2DL4A 4QT7A 4AG2C 4JJBA 2DRKA 4JZ3A 1OOTA 5IHIA 2FO0A 1AVZC 1JXMA 2EKHA 2K3BA 2LJ0A 1FMKA 1UJ0A 2RMOA 3GBQA 1G83A 2DA9A 2CH4W 3REBB 2DNUA 1WLPB 3NPFA 1H8KA 4GBQA 4J9CA 2LJ1A 2XMFA 1WXTA 1ZUYA 4CC4B 2D8JA 1QKWA 4J9BA 1B07A 1H92A 2LNHB 3VS2A 2BZ8A 3H41A 2JM8A 1YCSB 2DM1A 5GJWB 2DL8A 1HSQA 1WIEA 3VS6A 2KNBB 3EG2A 5IHKA 4RTWA 1AZEA 1NG2A 1PRLC 3PVQA 3UATA 1MV0B 4AFSC 2DLPA 1T0JA 4CC7A 3VS1A 1VA7A 1RI9A 2V1QA 2O9VA 2AK5A 3QWYA 1ABQA 2ED1A 2DILA 1BK2A 1CSKA 1QWFA 2W10A 2CSIA 1Y57A 1NEBA 4FSSA 4LUEA 2L3QA 2GQIA 2LQWA 2O2OA 2ED0A 2K79A 2EPDA 4F16A 1Z9ZA 2EW3A 1NLOC 2A37A 2CT4A 2JW4A 2L0AA 1NM7A 1SRMA 4JJDA 3RBBB 1GCQA 2KRMA 1M3CA 3REAB 2ESWA 2AKLA 3KFVA 4F17A 4RTVA 1UTIA 1RLPC 2LP5A 2PZ1A 1X6BA 4OMPA 3ULRB 1AWOA 2AKKA 1K0XA 1Z9QA 1N5ZA 2A08A 5I22A 1W6XA 2NWMA 2K6DA 2DBMA 1WFWA 4CC3A 2RQUA 5IXBA 2FEIA 3LH5A 3H0IA 2JS2A 3O5ZA 2IIMA 2J06A 2FPDA 4AFUC 4RTZA 2EGCA 2EQIA 2KXCA 1IO6A 5L23A 2DYBA 2KROA 2FG0A 5I11A 4D8KA 1KFZA 2H8HA 2EYZA 2FRWA 1LCKA 3NMZC 4HVUA 1ARKA 2A36A 2C0IA 1CKAA 2JXBA 1WI7A 2SRCA 3U23A 1YNZA 3QWXX 1PKSA 2BZXA 4Y92A 3VS0A 2RNAA 1K4US 2ECZA 1NYFA 1AEYA 1RLQC 4K11A 4HVWA 4Z88A 1KIKA 1A0NB 4CC2A 2HSPA 3RNJA 1X43A 1GCQC 1OEBA 2ENMA 1GFDA 2CT3A 1U5SA 1CKBA 2FRYA 4OMQA 1OPKA 2O9SA 2P4RA 3I35A 1K0SA 2J6FA 1UG1A 2D1XA 5GJVB 3VRZA 2CREA 1UUEA 2KYMA 2NUZA 2BTTA 1SPKA 1X27A 1PKTA 1SSHA 2DE0X 3M0UA 1WDXA 4RUGA 1AWXA 2O31A 1GL5A 2YUQA 2M0YA 2DRMA 2YUPA 1RUWA 3JV3A 4OMMA 4ORZA 1U3OA 1X69A 3C0CA 2J7IA 2RQRA 2YT6A 2FPFA 2LMJA 2MIOA 2LJ3A 4AFZC 1GFCA 1SHFA 4J9HA 4JPBW 4HXJA 2OAWA 2KRNA 2DL7A 2PTKA 2L3PA 4LN2A 2ABLA 1ZX6A 4D8DA 1BBZA 1SEMA 2VVKA 2F2WA 2KGTA 1OPLA 2YUOA 3UA7A 2JTEA 1SHGA 2W0ZA 1KSWA 2X3XD 2OI3A 2GTJA 1AZGB 1KJWA 3EG1A 3M0SA 4EIKA 2DMOA 2LCSA 4WCIA 1XOVA 1K76A 4J9DA 2EYXA 2YSQA 3PVLA 2KEAA 2RPNA 3EGUA 1GBQA 4RTUA 4OMOA 4RTXA 2CH4A 2EYYA 1UJYA 1E6HA 1PHTA 2LZ6B 1UHFA 2HDAA 4HVVA 3I5SA 1BU1A 3EHRA 1GCPA 5HCKA 2GNCA 4LUDA 2KRSA 1BB9A 4E6RA 1TG0A 2J05A 1X2QA 1UECA 1K9AA 1YWOA 1NYGA 4R0KA 2HCKA 4OMLA 2DL3A 1UGVA 2M51A 4J9GA 2C0OA 2I0NA 2RQTA 2J6KA 2LX7A 1HD3A 4RTTA 1VYUA 3EHQA 1ZBJA 1PRMC 3VS5A 4AFQC 1M3BA 2E5KA 2KXDA 4JJCA 3SHWA 1V1CA 1U06A 3NHNA 2RN8A 3VS4A 1YN8A 4KRTA 3TSZA 3TVTA 1FYNA 2SEMA 2LQNA 1I0CA 3IQLA 2RF0A 2DVJA 1W70A 3PE0A 2KT1A 3EG0A 1E7OA 1ZUUA 1B3QA 4RTYA 2JT4A 1JQQA 1T0HA 2JMCA 1QLYA 1QKXA 1EFNA 2EBPA 4AG1C 1WA7A 1Y0MA 4Z8AA 1UE9A 2VKNA 2AZVA 1ZUKA 3M0RA 1YP5A 4J9IA 2K2MA 3M0TA 2J6OA 2GGRA 4HCKA 2QDLA 2EVRA 5ECAA 1AWJA 3UA6A 2HBWA 2JM9A 2PNIA 1M3AA 2FPEA 1GRIA 1SRLA 2EGAA 2YUNA 2MCNA 1MV3A 1AD5A 2DX1A 2DJQA 3TSWA 2KBTA 2KE9A 1TUDA 2OJ2A 5EC7A 1I1JA 2D8HA 2DBKA 5IXFA 2B86A 3I9QA 1JXOA 3THKA 2F2VA 2RQWA 1X2KA 3FJ5A 4J9EA 4OMNA 2K9GA 2CDTA 4M4ZA 4A63B 1NLPC 1UDLA 1M27C 2CUBA 2EGEA 1PWTA 1QWEA 1WX6A 3VS7A 1JO8A 2CUDA 1JU5C 3ZL7C 4LE9A 1W1FA 1AOJA 1E6GA 1WXUA 1WYXA 5FWCA 1G2BA 1J3TA 2G6FX 1VYVA 5IH2A 1X6GA 5IHNA 3M0QA 2YDLA 2X3WD 2JS0A 5FW9A 4F14A 2BZYA 3I5RA 2ROTA 2RQVA 1ABOA 1M30A 1K1ZA 1H3HA 2A28A 1QCFA 1AWWA 2EYWA 1WXBA 1UFFA 2KT8A 2D0NA 4Z89A 3UF4A 2L2PA 3NGPA 2K7AA 4IIMA 1PNJA 3CQTA 2VWFA 3H0HA 2O88A 4DEXA 2AZSA 1S1NA 2V1RA 2GTOA 4DEYA 2ROLA 2DL5A 2KR3A 2MOXA 1MUZA 2C0TA 1HJDA 1TUCA 1JEGA 1GBRA 1M8MA 3VRYA 1YWPA 2CSQA 1T3LA 1T3SA 2DF6A 4J9FA 1I07A 5FWBA 3A98A 1UHCA 1VYTA 3VS3A 2JMAA 3R6NA 3M0PA 1OV3A 1ZLMA 4JZ4A 3H0FA 4GLMA 4ESRA 1NEGA 1ZSGA 3SEMA 2GBQA 3EG3A 4IIOA 2HEQA 2L3SA 4ZNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNP A;  2KYB A;  2F2X A;  4X1V A;  2DL4 A;  4QT7 A;  4AG2 C;  4JJB A;  2DRK A;  4JZ3 A;  1OOT A;  5IHI A;  2FO0 A;  1AVZ C;  1JXM A;  2EKH A;  2K3B A;  2LJ0 A;  1FMK A;  1UJ0 A;  2RMO A;  3GBQ A;  1G83 A;  2DA9 A;  2CH4 W;  3REB B;  2DNU A;  1WLP B;  3NPF A;  1H8K A;  4GBQ A;  4J9C A;  2LJ1 A;  2XMF A;  1WXT A;  1ZUY A;  4CC4 B;  2D8J A;  1QKW A;  4J9B A;  1B07 A;  1H92 A;  2LNH B;  3VS2 A;  2BZ8 A;  3H41 A;  2JM8 A;  1YCS B;  2DM1 A;  5GJW B;  2DL8 A;  1HSQ A;  1WIE A;  3VS6 A;  2KNB B;  3EG2 A;  5IHK A;  4RTW A;  1AZE A;  1NG2 A;  1PRL C;  3PVQ A;  3UAT A;  1MV0 B;  4AFS C;  2DLP A;  1T0J A;  4CC7 A;  3VS1 A;  1VA7 A;  1RI9 A;  2V1Q A;  2O9V A;  2AK5 A;  3QWY A;  1ABQ A;  2ED1 A;  2DIL A;  1BK2 A;  1CSK A;  1QWF A;  2W10 A;  2CSI A;  1Y57 A;  1NEB A;  4FSS A;  4LUE A;  2L3Q A;  2GQI A;  2LQW A;  2O2O A;  2ED0 A;  2K79 A;  2EPD A;  4F16 A;  1Z9Z A;  2EW3 A;  1NLO C;  2A37 A;  2CT4 A;  2JW4 A;  2L0A A;  1NM7 A;  1SRM A;  4JJD A;  3RBB B;  1GCQ A;  2KRM A;  1M3C A;  3REA B;  2ESW A;  2AKL A;  3KFV A;  4F17 A;  4RTV A;  1UTI A;  1RLP C;  2LP5 A;  2PZ1 A;  1X6B A;  4OMP A;  3ULR B;  1AWO A;  2AKK A;  1K0X A;  1Z9Q A;  1N5Z A;  2A08 A;  5I22 A;  1W6X A;  2NWM A;  2K6D A;  2DBM A;  1WFW A;  4CC3 A;  2RQU A;  5IXB A;  2FEI A;  3LH5 A;  3H0I A;  2JS2 A;  3O5Z A;  2IIM A;  2J06 A;  2FPD A;  4AFU C;  4RTZ A;  2EGC A;  2EQI A;  2KXC A;  1IO6 A;  5L23 A;  2DYB A;  2KRO A;  2FG0 A;  5I11 A;  4D8K A;  1KFZ A;  2H8H A;  2EYZ A;  2FRW A;  1LCK A;  3NMZ C;  4HVU A;  1ARK A;  2A36 A;  2C0I A;  1CKA A;  2JXB A;  1WI7 A;  2SRC A;  3U23 A;  1YNZ A;  3QWX X;  1PKS A;  2BZX A;  4Y92 A;  3VS0 A;  2RNA A;  1K4U S;  2ECZ A;  1NYF A;  1AEY A;  1RLQ C;  4K11 A;  4HVW A;  4Z88 A;  1KIK A;  1A0N B;  4CC2 A;  2HSP A;  3RNJ A;  1X43 A;  1GCQ C;  1OEB A;  2ENM A;  1GFD A;  2CT3 A;  1U5S A;  1CKB A;  2FRY A;  4OMQ A;  1OPK A;  2O9S A;  2P4R A;  3I35 A;  1K0S A;  2J6F A;  1UG1 A;  2D1X A;  5GJV B;  3VRZ A;  2CRE A;  1UUE A;  2KYM A;  2NUZ A;  2BTT A;  1SPK A;  1X27 A;  1PKT A;  1SSH A;  2DE0 X;  3M0U A;  1WDX A;  4RUG A;  1AWX A;  2O31 A;  1GL5 A;  2YUQ A;  2M0Y A;  2DRM A;  2YUP A;  1RUW A;  3JV3 A;  4OMM A;  4ORZ A;  1U3O A;  1X69 A;  3C0C A;  2J7I A;  2RQR A;  2YT6 A;  2FPF A;  2LMJ A;  2MIO A;  2LJ3 A;  4AFZ C;  1GFC A;  1SHF A;  4J9H A;  4JPB W;  4HXJ A;  2OAW A;  2KRN A;  2DL7 A;  2PTK A;  2L3P A;  4LN2 A;  2ABL A;  1ZX6 A;  4D8D A;  1BBZ A;  1SEM A;  2VVK A;  2F2W A;  2KGT A;  1OPL A;  2YUO A;  3UA7 A;  2JTE A;  1SHG A;  2W0Z A;  1KSW A;  2X3X D;  2OI3 A;  2GTJ A;  1AZG B;  1KJW A;  3EG1 A;  3M0S A;  4EIK A;  2DMO A;  2LCS A;  4WCI A;  1XOV A;  1K76 A;  4J9D A;  2EYX A;  2YSQ A;  3PVL A;  2KEA A;  2RPN A;  3EGU A;  1GBQ A;  4RTU A;  4OMO A;  4RTX A;  2CH4 A;  2EYY A;  1UJY A;  1E6H A;  1PHT A;  2LZ6 B;  1UHF A;  2HDA A;  4HVV A;  3I5S A;  1BU1 A;  3EHR A;  1GCP A;  5HCK A;  2GNC A;  4LUD A;  2KRS A;  1BB9 A;  4E6R A;  1TG0 A;  2J05 A;  1X2Q A;  1UEC A;  1K9A A;  1YWO A;  1NYG A;  4R0K A;  2HCK A;  4OML A;  2DL3 A;  1UGV A;  2M51 A;  4J9G A;  2C0O A;  2I0N A;  2RQT A;  2J6K A;  2LX7 A;  1HD3 A;  4RTT A;  1VYU A;  3EHQ A;  1ZBJ A;  1PRM C;  3VS5 A;  4AFQ C;  1M3B A;  2E5K A;  2KXD A;  4JJC A;  3SHW A;  1V1C A;  1U06 A;  3NHN A;  2RN8 A;  3VS4 A;  1YN8 A;  4KRT A;  3TSZ A;  3TVT A;  1FYN A;  2SEM A;  2LQN A;  1I0C A;  3IQL A;  2RF0 A;  2DVJ A;  1W70 A;  3PE0 A;  2KT1 A;  3EG0 A;  1E7O A;  1ZUU A;  1B3Q A;  4RTY A;  2JT4 A;  1JQQ A;  1T0H A;  2JMC A;  1QLY A;  1QKX A;  1EFN A;  2EBP A;  4AG1 C;  1WA7 A;  1Y0M A;  4Z8A A;  1UE9 A;  2VKN A;  2AZV A;  1ZUK A;  3M0R A;  1YP5 A;  4J9I A;  2K2M A;  3M0T A;  2J6O A;  2GGR A;  4HCK A;  2QDL A;  2EVR A;  5ECA A;  1AWJ A;  3UA6 A;  2HBW A;  2JM9 A;  2PNI A;  1M3A A;  2FPE A;  1GRI A;  1SRL A;  2EGA A;  2YUN A;  2MCN A;  1MV3 A;  1AD5 A;  2DX1 A;  2DJQ A;  3TSW A;  2KBT A;  2KE9 A;  1TUD A;  2OJ2 A;  5EC7 A;  1I1J A;  2D8H A;  2DBK A;  5IXF A;  2B86 A;  3I9Q A;  1JXO A;  3THK A;  2F2V A;  2RQW A;  1X2K A;  3FJ5 A;  4J9E A;  4OMN A;  2K9G A;  2CDT A;  4M4Z A;  4A63 B;  1NLP C;  1UDL A;  1M27 C;  2CUB A;  2EGE A;  1PWT A;  1QWE A;  1WX6 A;  3VS7 A;  1JO8 A;  2CUD A;  1JU5 C;  3ZL7 C;  4LE9 A;  1W1F A;  1AOJ A;  1E6G A;  1WXU A;  1WYX A;  5FWC A;  1G2B A;  1J3T A;  2G6F X;  1VYV A;  5IH2 A;  1X6G A;  5IHN A;  3M0Q A;  2YDL A;  2X3W D;  2JS0 A;  5FW9 A;  4F14 A;  2BZY A;  3I5R A;  2ROT A;  2RQV A;  1ABO A;  1M30 A;  1K1Z A;  1H3H A;  2A28 A;  1QCF A;  1AWW A;  2EYW A;  1WXB A;  1UFF A;  2KT8 A;  2D0N A;  4Z89 A;  3UF4 A;  2L2P A;  3NGP A;  2K7A A;  4IIM A;  1PNJ A;  3CQT A;  2VWF A;  3H0H A;  2O88 A;  4DEX A;  2AZS A;  1S1N A;  2V1R A;  2GTO A;  4DEY A;  2ROL A;  2DL5 A;  2KR3 A;  2MOX A;  1MUZ A;  2C0T A;  1HJD A;  1TUC A;  1JEG A;  1GBR A;  1M8M A;  3VRY A;  1YWP A;  2CSQ A;  1T3L A;  1T3S A;  2DF6 A;  4J9F A;  1I07 A;  5FWB A;  3A98 A;  1UHC A;  1VYT A;  3VS3 A;  2JMA A;  3R6N A;  3M0P A;  1OV3 A;  1ZLM A;  4JZ4 A;  3H0F A;  4GLM A;  4ESR A;  1NEG A;  1ZSG A;  3SEM A;  2GBQ A;  3EG3 A;  4IIO A;  2HEQ A;  2L3S A;  4ZNX A; 
#chains in the Genus database with same CATH topology
 5FU7 C;  3MHX A;  2K4Y A;  2KYB A;  3HKS A;  2F2X A;  2DL4 A;  4QT7 A;  4JZ3 A;  3C94 A;  5IHI A;  2KAF A;  3JSC A;  1W2B S;  1QP3 A;  1JXM A;  4N0A A;  2RK1 A;  3OBY A;  2LJ0 A;  3CC2 Q;  1OZ3 A;  2DNU A;  4LD6 A;  3NPF A;  3CCQ A;  5GAM j;  4HCB A;  4J9C A;  2LJ1 A;  4M75 D;  1FX7 A;  2MWO A;  1ZUY A;  2X9H A;  3V7R A;  4XK8 E;  3L2Z A;  2LNH B;  2BZ8 A;  2ZZD A;  2JM8 A;  2RB6 A;  4M78 A;  1YCS B;  2DM1 A;  5GJW B;  5A0L A;  2D6F A;  3VS6 A;  3MCA B;  2NUT A;  1D3B A;  3M56 A;  2DK3 A;  3PVQ A;  3LYI A;  4BY6 B;  4CC7 A;  3VS1 A;  4NS5 A;  3L2W A;  1IHW A;  1KG1 A;  3MP8 A;  1RAE B;  1VUB A;  1RI9 A;  1O75 A;  2CP0 A;  2ED1 A;  2RJF A;  4MDX A;  1FMV A;  2DXU A;  1RAB B;  4XU0 A;  3CC4 A;  5FU7 B;  1OI1 A;  5I2M A;  5IAY A;  3GNG A;  4M77 E;  4FW2 A;  4O6J A;  1FWZ A;  1Z9Z A;  2EW3 A;  3EG9 A;  1IB8 A;  3TRE A;  2JW4 A;  2VB6 A;  3RES A;  1SRM A;  1WHG A;  3EFR A;  4C0F A;  3QZ9 B;  2RHY A;  4HKE A;  1KQS P;  4AMC A;  1OU9 A;  4BE1 A;  1YBY A;  4M7D F;  4RTV A;  1U1T A;  1UTI A;  2CS7 A;  2K2V A;  2YLC A;  3FC3 A;  2AKK A;  2EQU A;  2V26 A;  4PJO A;  1BI1 A;  3I55 A;  1WHH A;  3OA6 A;  2BIV A;  1YI2 Q;  2E3H A;  1WFW A;  4CC3 A;  3V8L A;  5IXB A;  2QA4 Q;  1VQ4 A;  1G5V A;  3O5Z A;  2RHI A;  2FPD A;  2CP7 A;  2LTO A;  4AFU C;  2IPO B;  5KYY A;  4JDS A;  4JLI A;  5L23 A;  2KRO A;  1KHI A;  4ZTJ A;  3HTR A;  2RM4 A;  4D8K A;  1KFZ A;  2H8H A;  3NMZ C;  3QO3 A;  1ARK A;  5FRM A;  3AT1 B;  2A36 A;  1PC0 A;  3CCJ Q;  1WPY A;  1VQP A;  3CC7 Q;  3CCL Q;  2A7Y A;  2D9T A;  1PSE A;  3QWX X;  1TTH B;  1LVK A;  2PUK B;  2EJF A;  1AEY A;  4HVW A;  1YIT T;  1K9M C;  4C8Q F;  3SWN A;  4M7A E;  1VQM T;  2ENM A;  1QVF A;  4HT9 A;  1WQW A;  1K9M U;  4C0Z A;  4C92 E;  3M55 A;  4LDU A;  5LJ5 j;  1CKB A;  1OPK A;  2JTM A;  1YIJ A;  1K0S A;  3JCM P;  3VRZ A;  2CRE A;  1UUE A;  4IUT A;  2HAX A;  1W2B P;  1SPK A;  3CD6 A;  2H3J A;  2LT1 A;  2M0Y A;  1VQ6 A;  1RUW A;  3FJP A;  3JV3 A;  1VQL A;  1BYM A;  2R58 A;  5LJ3 j;  4HCZ A;  1MGQ A;  4OB3 B;  4HCC A;  1TSF A;  2J7I A;  4M7D D;  3CCR T;  1M1G A;  4J7I A;  2MIO A;  3OYN A;  1SHF A;  4BI8 B;  2OTJ A;  1JBM A;  3VJP A;  4XTV A;  2RHZ A;  2L3P A;  1ZSZ C;  1S72 A;  3J81 E;  1BBZ A;  1IHV A;  5GAN g;  3L2U A;  3E9F A;  4C5E A;  2F2W A;  3VUZ A;  3OS1 A;  3TU4 K;  1OPL A;  3UA7 A;  1N9R A;  3ER0 A;  4RCB A;  2BE9 B;  2OI3 A;  1LNX A;  5FRN A;  1PG5 B;  3EG1 A;  4EIK A;  2DMO A;  1XOV A;  4BI4 A;  1VQO A;  2XG8 D;  2EYX A;  4J9D A;  2VV5 A;  1M90 C;  3EGU A;  4RTU A;  4OMO A;  1G8X A;  1I5L A;  3RKX A;  1LPL A;  4EMK C;  3SD4 A;  1NE8 A;  1M90 U;  3I5S A;  3A5Z B;  5LJ5 f;  5GMK i;  4YTL A;  4C8Q D;  1N9S A;  4M7A F;  1TG0 A;  3RMQ A;  1IZ6 A;  1PCX A;  4C92 F;  1K9A A;  1WHL A;  3H9N A;  4Y91 A;  1YWO A;  4R0K A;  4OML A;  3QKJ A;  3QYG B;  4J9G A;  2LQK A;  2RQT A;  4EDU A;  2J6K A;  4C5G A;  4E7Z A;  3TCJ A;  1D0Y A;  4FU6 A;  1PRM C;  2F5T X;  4AFQ C;  5LJ3 f;  1ZSZ B;  1M1K R;  1V1C A;  4EMH A;  3NHN A;  4C5I A;  4KRT A;  2DYI A;  1MND A;  3BY7 A;  3TVT A;  3G6E T;  2C06 A;  3JB9 F;  2X51 A;  2SEM A;  1QP2 A;  4OF1 A;  4CRI A;  1W4S A;  1C0M A;  1OYX A;  2RF0 A;  2YRC A;  3E9G A;  2Y4X A;  4M75 A;  3JCM W;  1YIT Q;  2E10 A;  4E2F B;  1B3Q A;  2ZPH B;  1VQM Q;  3LX7 A;  4Z8A A;  3JCM h;  1UE9 A;  1U1S A;  3E1S A;  2WSE E;  3M0R A;  3CCU T;  3CEY A;  1NPP A;  2GGR A;  4N4I A;  3HRS A;  4B9X A;  2EYQ A;  1I8F A;  1BI0 A;  1ZQ1 A;  2HBW A;  2JM9 A;  1XQH A;  4NL3 A;  5GAN h;  2E64 A;  3OQ5 A;  2OJ2 A;  4DBF A;  3HPW A;  2D8H A;  3LLR A;  1TOV A;  2B86 A;  8AT1 B;  3JB9 J;  3OYB A;  2RQW A;  3EFO A;  3CCR Q;  4M4Z A;  4A63 B;  3HFN A;  2EFI A;  1WZO A;  3L2V A;  2O01 E;  2GFU A;  3PNW C;  1WQ7 A;  2CUD A;  3J80 E;  3HRU A;  1W1F A;  1SKU B;  1J3T A;  4M7A D;  3C95 A;  3OYM A;  1BIB A;  3CCS A;  1VYV A;  5KYW B;  1X6G A;  2XK0 A;  4C92 D;  4ELZ C;  1X01 A;  1WGS A;  1K1Z A;  1VQ8 A;  3I56 A;  3A8L B;  1QCF A;  2EYW A;  2D0N A;  4PJL A;  4F7U F;  2L2P A;  2K7A A;  2IVW A;  2EKO A;  2CZ1 B;  1BI2 A;  3A8G B;  2AZS A;  2OTL T;  2V1R A;  2GTO A;  4DEY A;  1SSF A;  5C0M A;  3JB9 D;  1HJD A;  4X34 A;  1TUC A;  5CKF A;  1YJ9 T;  3VV0 A;  1YWP A;  2MAM A;  1BIA A;  1JJ2 A;  5CKD A;  1B7T A;  1T3S A;  3VYH B;  2QEX A;  3PGG A;  3NFC A;  3M0P A;  2L89 A;  1OV3 A;  4TVR A;  4EPC A;  4UC4 A;  2RJD A;  4N4H A;  4ESR A;  3SEM A;  2DJZ A;  2GBQ A;  3EG3 A;  4IIO A;  3JCM d;  4DBQ A;  2JNG A;  2FZK B;  1Q81 R;  2RI5 A;  2P0Q A;  4ZNX A;  2NYS A;  2E41 A;  1F1B B;  2ZPE B;  1VQ7 A;  3CCE T;  3BE3 A;  1AVZ C;  2RA2 A;  2K3B A;  2RMO A;  2CH4 W;  2VGM A;  3G6E Q;  2AT1 B;  2HSE B;  3LGL A;  4QQD A;  3GPL A;  2CP2 A;  2FB7 A;  1H92 A;  3OYE A;  2LT4 A;  3VS2 A;  3CCQ T;  5GAO q;  4JRK A;  1DJ7 B;  2DL8 A;  3JCM V;  3CPW A;  3OYC A;  2KNB B;  5IHK A;  1WNL A;  1PRL C;  1BCO A;  3CCU Q;  4AFS C;  2DLP A;  1QVG A;  1EX4 A;  1T0J A;  2BE7 D;  1GXI E;  3Q1J A;  1K8A R;  3OYH A;  1Q86 R;  3UT1 A;  1Y7X A;  4XU3 A;  2O9V A;  1QVF S;  3X25 B;  2HD0 A;  2LCC A;  4L6V 5;  1BK2 A;  1PD1 A;  3JCM J;  1Y57 A;  1NEB A;  4A4H A;  2ZPF B;  4FSS A;  3PFS A;  4BUG A;  4LUE A;  2GQI A;  2QYZ A;  1BI3 A;  1M2V B;  2LQW A;  5CKE A;  3RDV A;  1TXQ A;  3CC4 T;  2K79 A;  2EPD A;  4N0A C;  5L8R E;  8ATC B;  1YJN A;  3OMG A;  3X24 B;  2KK4 A;  2DXC A;  2QTX A;  3REA B;  3CME A;  2ESW A;  2JJ9 A;  3KFV A;  4F17 A;  6AT1 B;  5CVI A;  2LP5 A;  3ULR B;  4JS4 A;  4M78 C;  1Z9Q A;  4O5V A;  1YJW T;  2M1H A;  1I5O B;  2A08 A;  5I22 A;  1W6X A;  4BY6 C;  2NWM A;  1MMN A;  2K6D A;  3OY9 A;  2OTL Q;  2DD5 A;  2RQU A;  4FYW B;  2JS2 A;  5CKB A;  1UGP B;  3GOX A;  4RTZ A;  2EGC A;  5AYF A;  2EIF A;  4JUV A;  2DYB A;  4PLL A;  4J6W A;  4M77 A;  2MK5 A;  4M7D E;  3EAE A;  1QCO A;  1R0C B;  5GAO l;  5CAI A;  4M77 B;  3JCM b;  2EWN A;  1VQ5 A;  3CC2 A;  3GF5 A;  4FL6 A;  1PKS A;  2BZX A;  4PJJ A;  1WHJ A;  3RMS A;  2E12 A;  1VQP T;  1RLQ C;  4ZGJ B;  1WJQ A;  3LWI A;  1A0N B;  1D1B A;  2AHJ B;  2QK0 A;  1Y71 A;  1D0X A;  2K5L A;  5GAO r;  2KQW A;  4J6Y A;  2EQK A;  2FRY A;  5KYX A;  2X4J A;  4M78 B;  5CKH A;  4JRP A;  4PJO C;  2VAS A;  4QQG A;  3CCQ Q;  2KYM A;  4E7K A;  1QW1 A;  4Y28 E;  2NUT B;  5EG2 A;  1D3B B;  1PKT A;  1SSH A;  2COW A;  2DE0 X;  4RUG A;  5GMK j;  1YIJ T;  2O31 A;  2QAS A;  2YUP A;  3UPU A;  3AHU A;  1OQK A;  1RAG B;  2K5F A;  4FT2 A;  1X69 A;  3EH1 A;  4C8Q E;  1KD1 R;  3CD6 T;  2M02 A;  2DEU A;  2RQR A;  5GAO n;  2LMJ A;  1VQL T;  4OB1 B;  4PFO A;  2ZAE A;  4HXJ A;  3RKY A;  4PFZ A;  3JAM E;  1RAA B;  2DL7 A;  2ABL A;  1VQK A;  3CCV T;  1EZZ B;  1ZX6 A;  4A4F A;  3MJX A;  1SEM A;  2VVK A;  2OTJ T;  2KGT A;  2DTI A;  4M7A A;  2FZC B;  2QG9 B;  1UGQ B;  1S72 T;  1KSW A;  2JTF A;  2MI6 A;  2VXE A;  4C92 A;  2GTJ A;  3EG9 B;  3CC4 Q;  2BUD A;  2EAY A;  3QZ5 B;  3SWN C;  1QVF P;  1AZG B;  1B34 A;  2KSS A;  2CP3 A;  3DB4 A;  3M0S A;  3L2R A;  3OS5 A;  1V76 A;  4NL2 A;  3QDF A;  2LCS A;  4JRQ A;  4WCI A;  1ZA2 B;  3PMT A;  5GAM f;  3PVL A;  1YI2 A;  2RPN A;  2VGN A;  4RTX A;  4PJO B;  3QII A;  2RHU A;  1UJY A;  4BE0 A;  3OYA A;  2QA4 A;  1M8V A;  1PHT A;  2HDA A;  4XAX B;  1RI0 A;  1YJW Q;  1BU1 A;  5HCK A;  1VQN T;  1AT1 B;  1Y07 A;  3HHT B;  3EGX A;  2XIC A;  2X35 A;  2JUF A;  2QGG A;  1X2Q A;  1UEC A;  1G3Y A;  3EH2 A;  1NYG A;  4L5G A;  4BDY A;  5KYY B;  1UGV A;  2C0O A;  3CCJ A;  2VUB A;  2IG0 A;  4MMK A;  1IGU A;  2ZPI B;  4A54 A;  4OMF B;  1XTD A;  2GCX A;  1RAI B;  2GF7 A;  3EHQ A;  5J26 A;  1G3T A;  4CI0 C;  2QI2 A;  1M3B A;  2RJC A;  2E5K A;  3SHW A;  5LL6 S;  3LWH A;  2RN8 A;  2FVU A;  4FYY B;  4IUR A;  4JLG A;  3OS2 A;  3S3O A;  1JJ2 S;  3MPU B;  2FZG B;  1M1K C;  5HKC A;  3S6W A;  3SWN B;  1D1A A;  1W70 A;  1VQP Q;  2KT1 A;  3EG0 A;  2XKO C;  3GP8 A;  3SDZ A;  2CYZ B;  1M1K U;  5A0D A;  2JT4 A;  2KY9 A;  1JQQ A;  1T0H A;  1YCY A;  2JMC A;  1QLY A;  2EBP A;  2L8D A;  2QXF A;  3MEV A;  4ZN1 A;  3LH0 A;  2MPX C;  5GAN 6;  3M4G A;  3S3M A;  2XD0 A;  2LC4 A;  2QDL A;  1AWJ A;  1M3A A;  3JCM g;  1GRI A;  1SRL A;  2EGA A;  5FLX E;  2DIQ A;  2YUN A;  2MCN A;  3V8K A;  1MV3 A;  5GAN j;  2DX1 A;  1YIJ Q;  5DLO A;  2EQJ A;  5EC7 A;  5CO7 A;  3QJY A;  3CD6 Q;  2YXY A;  2F2V A;  2FYK A;  1AHJ B;  1X2K A;  2VYT A;  2X4Y A;  1KC8 R;  2EQM A;  2JZ2 A;  3QHS A;  1VQL Q;  3GNF B;  2RD1 A;  1M27 C;  4ELY C;  3CPW S;  1ZA1 B;  3ZBD A;  4XTW A;  3ZL7 C;  1AOJ A;  3OYD A;  5FWC A;  1FXX A;  4R55 A;  3CCV Q;  1QVG S;  1HYO A;  3A8M B;  2DET A;  4E7S A;  2QDY B;  3M0Q A;  2A3L A;  3ME9 A;  3QBY A;  3X26 B;  3I5R A;  1IRE B;  1S72 Q;  1M30 A;  1WJS A;  1H3H A;  2E1H A;  4M75 C;  1U8R A;  3CCS T;  3BDL A;  1M2O A;  4Z89 A;  3UF4 A;  4QW2 A;  3NGP A;  5CK9 A;  1PNJ A;  1VQ8 T;  3J7A F;  1OUL A;  1RL2 A;  3FRN A;  2V8J A;  3BW1 A;  3JCM c;  3VU3 C;  4V2S A;  2XHC A;  2MOX A;  1GBR A;  3OYL A;  1M8M A;  1R0B G;  2DEQ A;  1IXD A;  2JVV A;  2E4H A;  4FM4 B;  1VQN Q;  3JCM Q;  5I2S A;  5IN1 A;  3GLX A;  4MZT A;  3R6N A;  2VXF A;  1JB0 E;  4F7U E;  1NEG A;  1ZSG A;  5GAM d;  5GAN f;  4XTU A;  1M4Z A;  3G71 T;  3C4S A;  4P5N A;  2HEQ A;  4KGZ B;  4LNP A;  2RO0 A;  4X1V A;  4JS5 A;  4KH0 B;  2NLU A;  3CPF A;  4JJB A;  2HQX A;  4QQ6 A;  1OOT A;  4XU1 A;  2YRD A;  4ME7 A;  1Q81 C;  1Q7Y R;  4PJO F;  2P84 A;  1FMK A;  1UJ0 A;  4JRI A;  2DA9 A;  2WSF E;  1WLP B;  3OBW A;  1Q81 U;  2NUP A;  4GBQ A;  1WHK A;  4M75 B;  2XMF A;  2D8J A;  1QKW A;  1C6V X;  4J8O A;  4BB7 A;  2RH2 A;  3GIB A;  3RKW A;  2RI3 A;  3OYF A;  4M77 G;  1RAD B;  1HSQ A;  2E6N A;  1WIE A;  3CBO A;  5KCO A;  2O4X A;  1KQ1 A;  3EG2 A;  1R8O B;  3H8Z A;  1AZE A;  5IT9 E;  1ZBX A;  1MV0 B;  1JJ2 P;  1OU8 A;  1M1F A;  2EJG A;  4EMK A;  2I2L A;  3M9Q A;  4X9C A;  2CKK A;  4Z02 A;  2VC8 A;  1K73 R;  2OAU A;  4MML A;  3HL8 A;  1KHC A;  1IGQ A;  3QWY A;  3OYY A;  5GAM e;  3EFO B;  5FU6 C;  1NJI R;  1CSK A;  2YWW A;  1QWF A;  1K8A C;  1Q86 C;  2ZCF B;  1VQ9 A;  3MEW A;  2X4W A;  4M78 G;  2HQH A;  2L3Q A;  4RMO A;  1IRX A;  2DPP B;  2ED0 A;  1Q86 U;  4F16 A;  1JRI A;  3OYK A;  1N8R R;  3WVE B;  4FYV B;  4JJD A;  3RBB B;  1GCQ A;  5GMK e;  2KRM A;  1M3C A;  1RLP C;  1YJN T;  3CPW P;  4HA8 A;  4II1 A;  3CCS Q;  4OMP A;  4KUL A;  1K0X A;  1N5Z A;  4J7F A;  3CME T;  7AT1 B;  2PQW A;  3M53 A;  4BE2 A;  5CQY A;  1VQ8 Q;  1QVG P;  3M58 A;  2DZ9 A;  3N5B B;  3FLG A;  4MZM A;  2FEI A;  2RJE A;  3LH5 A;  4PL6 A;  3QJ6 A;  3QSU A;  2IIM A;  3CMA T;  2K57 A;  3VYG A;  2KXC A;  1IO6 A;  2FG0 A;  5I11 A;  3A8H B;  2EYZ A;  3M4Y A;  2XU8 A;  4FT4 A;  4A53 A;  3G4S A;  2K5I A;  4HVU A;  4N4G A;  5FU6 B;  3DKM A;  2C0I A;  4PJO G;  2KI7 A;  2QQ9 A;  3QUI A;  5LJ5 d;  2JXB A;  2V8K A;  1QVP A;  3G71 Q;  4E7L A;  2SRC A;  4D6W A;  1YNZ A;  2E70 A;  2P4T A;  2HBP A;  4Y92 A;  3QXE B;  3VS0 A;  2P0P A;  3NTH A;  2CP5 A;  2ECZ A;  2BKD N;  1NYF A;  1VQ5 T;  4K11 A;  1H64 1;  2PVG B;  4L59 A;  1KIK A;  4CC2 A;  2HSP A;  4MZP A;  1X43 A;  5D6X A;  4DBR A;  4DQ2 A;  2M0O A;  1GFD A;  3T9N A;  1UGR B;  5LJ3 d;  3MEA A;  2QAZ A;  1M9S A;  2RI2 A;  2YRV A;  1H3Z A;  5GAO m;  3SFM A;  3MET A;  3CCM A;  5KH6 A;  2PU9 B;  1WDX A;  3MP1 A;  2PVD B;  2XDD A;  2DRM A;  4M7D A;  4LDY A;  3FIF A;  2QQR A;  4IUU A;  1YHQ A;  4BI3 A;  4DOW A;  4J83 A;  4M7D B;  2YT6 A;  2FPF A;  3HRT A;  4M77 C;  2LDM A;  1KQ2 A;  3H6Z A;  2LJ3 A;  4J9H A;  1KD1 C;  2OAW A;  3O8V A;  2YHT A;  2PTK A;  3P8D A;  5LJ5 e;  3PT9 A;  4D8D A;  3HFO A;  1KD1 U;  2LCL A;  4A4E A;  3MP6 A;  4FYX B;  2K3X A;  5A2Q E;  2JTE A;  2F5K A;  2W0Z A;  1VQK T;  1MMA A;  3UWN A;  1D09 B;  2JN0 A;  1PD0 A;  3DB3 A;  3FEO A;  1KJW A;  5HY6 A;  5LJ3 e;  1K76 A;  1ACM B;  2KEA A;  1YJN Q;  2EYY A;  2XDP A;  4IKF A;  4C8Q A;  3I55 T;  3CXC A;  5HK3 A;  3CME Q;  1TWB A;  2FL7 A;  3EHR A;  2Y90 A;  5HK0 A;  1YJ9 Q;  5GMK l;  4C8Q B;  4LUD A;  2RHX A;  2QA4 T;  1VQ4 T;  5KYU A;  4OVA A;  4BAC A;  2LQ8 A;  5D6W A;  3CMA Q;  4LDX A;  2HCK A;  3TEE A;  2DL3 A;  4PLI A;  5KYU B;  4PNO A;  2LX7 A;  2CZ0 B;  4QKU A;  1QQJ A;  5AT1 B;  3G1J A;  5J3B A;  1BCM A;  3A8O B;  4PKC C;  4BDZ A;  2GQV A;  2KXD A;  3CCE Q;  1U06 A;  1D1C A;  3OW2 A;  3VS4 A;  1YN8 A;  2D0Q B;  4OP0 A;  3TSZ A;  4M7A C;  2LQN A;  4ZN3 A;  1I0C A;  4C92 C;  1EIF A;  3IQL A;  1QMC A;  4LDW A;  4C0D B;  4GY5 A;  4VUB A;  5GAN 2;  1Q82 R;  3PE0 A;  1VQ5 Q;  1ZUU A;  4RTY A;  1QKX A;  1SF9 A;  4AG1 C;  3KXT A;  1Y0M A;  2AZV A;  5KYX B;  1ZUK A;  2R5M A;  3HSB A;  2K2M A;  3M0T A;  2J6O A;  4KBM B;  3HP9 A;  5ECA A;  4PJN A;  2PNI A;  2FPE A;  5GAM g;  1AD5 A;  1FMW A;  1VQ6 T;  2DJQ A;  3L2Q A;  4WF2 A;  3TSW A;  2R57 A;  4RCC A;  1LOJ A;  2KE9 A;  1TUD A;  2XID A;  3G7Z A;  3OS0 A;  2DBK A;  5IXF A;  2CP6 A;  3I9Q A;  4M75 G;  1JXO A;  2A0F B;  2DAQ A;  1KK7 A;  2XDB A;  4J9E A;  2K9G A;  2CDT A;  2COZ A;  1I4K 1;  1TUG B;  1C1A A;  1N27 A;  2EGE A;  1QWE A;  3VS7 A;  2WAC A;  1KC8 C;  1JU5 C;  2HL3 A;  3TQ7 P;  3C12 A;  1G2B A;  4M7A B;  3MO8 A;  3M5A A;  5J39 A;  4OGE A;  4XTZ A;  3CBP A;  1KC8 U;  2YLB A;  4C92 B;  2YDL A;  2X3W D;  2JS0 A;  5FW9 A;  2ROT A;  4F04 B;  1VQK Q;  2E3I A;  1B34 B;  2A28 A;  1NZ9 A;  3JB9 I;  3QDR B;  3VKI A;  1WXB A;  1RAH B;  2DXB A;  2QQA A;  4IIM A;  3EFS A;  2HL5 C;  1YJW A;  1VQO T;  3CQT A;  2VWF A;  3H0H A;  3KUF A;  4FIB A;  4FCY A;  2ROL A;  2KR3 A;  1MUZ A;  2COY A;  1TS9 A;  4M78 E;  1HK9 A;  3I55 Q;  4HT8 A;  2CSQ A;  1T3L A;  3EGX B;  2DF6 A;  4J9F A;  1R77 A;  1I07 A;  5FWB A;  3A98 A;  3CC7 A;  3CCL A;  1VYT A;  1VQ4 Q;  3R6O A;  3H0F A;  2DZC A;  4QVD A;  2FHD A;  2Z0W A;  2Y4Y A;  3OYJ A;  2M9U A;  1X6O A;  4AG2 C;  2X4X A;  4E7I A;  2DKG A;  1LJO A;  2DRK A;  3E2U A;  3JB9 H;  1HXD A;  3OSV A;  2FO0 A;  3P8H A;  2JOY A;  4OB2 B;  1OZ2 A;  3X20 B;  4ZGD B;  9ATC B;  5CIU A;  2EKH A;  4KGX B;  1G3S A;  3GBQ A;  1G83 A;  3REB B;  1O9S A;  2KMT A;  5CQX A;  2KDS A;  4ANJ A;  1H8K A;  3ASK A;  1Q7Y C;  5GAM h;  1WXT A;  4CC4 B;  1TH7 A;  5I21 A;  4J9B A;  1KQS A;  1B07 A;  2DFU A;  5KCH A;  3H41 A;  5C6S A;  4MDW A;  1Q7Y U;  5KE3 A;  3OMC A;  5FRO A;  4KT0 E;  4C0G A;  4M77 F;  4RTW A;  1NG2 A;  2LRQ A;  2DIG A;  3UAT A;  3P8B B;  4DOV A;  4PJO E;  1XJW B;  4F7U A;  1Q95 G;  1N6A A;  3FB9 A;  5DY9 A;  5LJ5 g;  1VA7 A;  5GMK h;  4ATO A;  1SG5 A;  2QGF B;  3RER A;  1VQ6 Q;  4F7U B;  2HMA A;  2V1Q A;  2AK5 A;  1ABQ A;  3SB2 A;  3PIP A;  4R56 A;  2DIL A;  2OX7 A;  5GAN 8;  2L5Q A;  2W10 A;  2CSI A;  4Q5W A;  5CR2 A;  3CCV A;  1K73 C;  4FSX A;  3L42 A;  1BKB A;  4GLK A;  4M78 F;  1TU0 B;  3RIR A;  2O2O A;  2OTJ Q;  5LJ3 g;  1NJI C;  2ATC B;  1K73 U;  2K3Y A;  1VQ9 T;  3QPH A;  5KE2 A;  1NLO C;  2A37 A;  4AT1 B;  2CT4 A;  5DM7 R;  2L0A A;  1NJI U;  1NM7 A;  3JRZ A;  4M7D G;  3BDU A;  3X28 B;  1VIF A;  3I56 T;  2AKL A;  1X75 C;  5D7U A;  2PZ1 A;  1N8R C;  1X6B A;  1AWO A;  4WTO B;  3ZEH A;  2MF2 A;  1MMD A;  2CGH A;  3JCM f;  1N8R U;  4E47 A;  1VQO Q;  2L3R A;  1VQN A;  3F70 A;  2M16 A;  4B9W A;  2DBM A;  3M59 A;  1W2B A;  4PJM A;  3OB9 A;  3H0I A;  4KH1 B;  2J06 A;  3UDC A;  2HQE A;  4JJN K;  4XU2 A;  4NOY A;  1NPR A;  2EQI A;  3EGD A;  3M57 A;  3VUB A;  2QEX T;  4LXC A;  2H3E B;  4RG2 A;  4IUP A;  2FRW A;  1LCK A;  3EGD B;  3OSS C;  1ZSZ A;  4M77 D;  1QCN A;  4DBH A;  2HNI A;  4PFP A;  1CKA A;  2RK2 A;  3PMI A;  1VIE A;  3KBG A;  3G4S T;  1WI7 A;  1K9M R;  1YIT A;  3U23 A;  3CXC S;  1VQ7 T;  3BFM A;  2RNA A;  2MYS A;  4J6X A;  1VQM A;  1K4U S;  4C8Q G;  4PK4 A;  5GAN 5;  2PUO B;  4Z88 A;  4IUQ A;  4KUI A;  3RNJ A;  4KUD K;  2DXT A;  2NUP B;  1GCQ C;  1UGS B;  1OEB A;  3ZFJ A;  2CT3 A;  4RKU E;  1U5S A;  4OMQ A;  1P92 A;  5LJ5 h;  4KGV B;  2O9S A;  2P4R A;  3I35 A;  4LDV A;  2J6F A;  4M78 D;  5KYN A;  1WHM A;  1UG1 A;  2D1X A;  5GJV B;  2F1L A;  2NUZ A;  1VOM A;  2O4X B;  2BTT A;  4DA4 A;  3OW2 S;  2G3R A;  1X27 A;  3M0U A;  2E5Q A;  1AWX A;  1GL5 A;  2YUQ A;  1MNE A;  4EMK B;  3CCR A;  4OMM A;  3M54 A;  3CCM T;  4ORZ A;  1RAC B;  1OX8 A;  1U3O A;  3C0C A;  5LJ3 h;  2ZPG B;  4A4G A;  2LNV A;  4AFZ C;  1GFC A;  3A1P A;  4JPB W;  4XQ3 A;  1YHQ T;  2KRN A;  5GAN 3;  3QG1 A;  1K8A U;  3LW5 E;  4LN2 A;  2V8I A;  3QYH B;  1I81 A;  4IUV A;  1D0Z A;  2YUO A;  1SHG A;  5KYW A;  2X3X D;  2CZ7 B;  1VQ9 Q;  1M90 R;  2CZ6 B;  3URG A;  2KVQ G;  2P0K A;  2QQB A;  2ZGW A;  3RR6 A;  4B6M A;  2YSQ A;  2EJ9 A;  2GFA A;  3I56 Q;  1GBQ A;  3NTI A;  2AIR B;  4M75 E;  2CH4 A;  4X9D A;  4PJO D;  1E6H A;  1MMG A;  5M9O A;  2F69 A;  4ZTF A;  2DTO A;  2LZ6 B;  1UHF A;  4ZGE B;  4HVV A;  2E65 A;  1GCP A;  1OX9 A;  2MMP A;  4M7A G;  2GNC A;  3L1A A;  2KRS A;  1BB9 A;  4E6R A;  4M7D C;  4LD9 K;  4C92 G;  1UEB A;  3V8J A;  2J05 A;  2M51 A;  2I0N A;  4QVC A;  4EMG A;  2DER A;  3G71 A;  2QEX Q;  1HD3 A;  3DLL A;  4RTT A;  1RAF B;  5CCA A;  1VYU A;  2QTV A;  1ZBJ A;  3G6E A;  2R5A A;  4XTY A;  3VS5 A;  4BD3 A;  4QVZ A;  4JJC A;  3JB9 G;  3CC2 T;  1FYN A;  3G4S Q;  4RG8 A;  3MEU A;  3V7S A;  2E6Z A;  1VQ7 Q;  2B8A A;  2XI9 A;  5GMK m;  2DVJ A;  3INZ A;  5GAN d;  4A4K A;  3OYG A;  1E7O A;  1Y96 A;  3CCU A;  2DVE A;  3V7C A;  5A0G A;  1EFN A;  1M5Q 1;  1WA7 A;  1PM3 A;  2VKN A;  1Q82 C;  2LVM A;  1G3W A;  1Y96 B;  5GAN 4;  3MKD A;  1YP5 A;  3CXC P;  4E7J A;  4J9I A;  2ZPB B;  2WSC E;  4HCK A;  4OB0 B;  4C8Q C;  5D6Y A;  1ZHI A;  4E7H A;  1XNI A;  2EVR A;  1Q82 U;  3UA6 A;  3RUX A;  2PVO B;  2KBT A;  1MHN A;  3CCM Q;  1I1J A;  3THK A;  5GAO p;  3OYI A;  1KQS S;  3FJ5 A;  4M75 F;  4OMN A;  2QQS A;  2DD4 A;  4J5Y A;  4OGC A;  1V29 B;  1NLP C;  1UDL A;  3JCM X;  3CBM A;  2CUB A;  3JCM e;  1PWT A;  1M2V A;  3OW2 P;  1WX6 A;  1JO8 A;  1YHQ Q;  4C5H A;  4LE9 A;  2DO3 A;  1NBE B;  1E6G A;  1WXU A;  1WYX A;  1PSF A;  4C0D C;  2G6F X;  4XTX A;  4FW1 A;  2MWP A;  5IH2 A;  2LX9 A;  2HKQ B;  5IHN A;  4F14 A;  2BZY A;  3WVD B;  2RQV A;  3D7S B;  3FDR A;  1ABO A;  5GAN e;  3LGF A;  4F7U G;  2DTH A;  3E19 A;  1AWW A;  3S3N A;  2OTL A;  1UFF A;  2KT8 A;  1YFN A;  5DLQ E;  1WJR A;  3DLM A;  2O88 A;  4DEX A;  1YI2 T;  1YJ9 A;  1S1N A;  3PTA A;  2HZY A;  2DL5 A;  2C0T A;  1JEG A;  3CMA A;  3VRY A;  5GAN 7;  3PIO A;  3WXM B;  2HKN A;  1UHC A;  3NTK A;  3VS3 A;  2JMA A;  1UB4 A;  1ZLM A;  4JZ4 A;  4GLM A;  3CCE A;  3CCJ T;  3CC7 T;  3CCL T;  2L3S A; 
#chains in the Genus database with same CATH homology
 4LNP A;  2KYB A;  2F2X A;  4X1V A;  2DL4 A;  4QT7 A;  4AG2 C;  4JJB A;  2DRK A;  4JZ3 A;  1OOT A;  5IHI A;  2FO0 A;  1AVZ C;  1JXM A;  2EKH A;  2K3B A;  2LJ0 A;  1FMK A;  1UJ0 A;  2RMO A;  3GBQ A;  1G83 A;  2DA9 A;  2CH4 W;  3REB B;  2DNU A;  1WLP B;  3NPF A;  1H8K A;  4GBQ A;  4J9C A;  2LJ1 A;  2XMF A;  1WXT A;  1ZUY A;  4CC4 B;  2D8J A;  1QKW A;  4J9B A;  1B07 A;  1H92 A;  2LNH B;  3VS2 A;  2BZ8 A;  3H41 A;  2JM8 A;  1YCS B;  2DM1 A;  5GJW B;  2DL8 A;  1HSQ A;  1WIE A;  3VS6 A;  2KNB B;  3EG2 A;  5IHK A;  4RTW A;  1AZE A;  1NG2 A;  1PRL C;  3PVQ A;  3UAT A;  1MV0 B;  4AFS C;  2DLP A;  1T0J A;  4CC7 A;  3VS1 A;  1VA7 A;  1RI9 A;  2V1Q A;  2O9V A;  2AK5 A;  3QWY A;  1ABQ A;  2ED1 A;  2DIL A;  1BK2 A;  1CSK A;  1QWF A;  2W10 A;  2CSI A;  1Y57 A;  1NEB A;  4FSS A;  4LUE A;  2L3Q A;  2GQI A;  2LQW A;  2O2O A;  2ED0 A;  2K79 A;  2EPD A;  4F16 A;  1Z9Z A;  2EW3 A;  1NLO C;  2A37 A;  2CT4 A;  2JW4 A;  2L0A A;  1NM7 A;  1SRM A;  4JJD A;  3RBB B;  1GCQ A;  2KRM A;  1M3C A;  3REA B;  2ESW A;  2AKL A;  3KFV A;  4F17 A;  4RTV A;  1UTI A;  1RLP C;  2LP5 A;  2PZ1 A;  1X6B A;  4OMP A;  3ULR B;  1AWO A;  2AKK A;  1K0X A;  1Z9Q A;  1N5Z A;  2A08 A;  5I22 A;  1W6X A;  2NWM A;  2K6D A;  2DBM A;  1WFW A;  4CC3 A;  2RQU A;  5IXB A;  2FEI A;  3LH5 A;  3H0I A;  2JS2 A;  3O5Z A;  2IIM A;  2J06 A;  2FPD A;  4AFU C;  4RTZ A;  2EGC A;  2EQI A;  2KXC A;  1IO6 A;  5L23 A;  2DYB A;  2KRO A;  2FG0 A;  5I11 A;  4D8K A;  1KFZ A;  2H8H A;  2EYZ A;  2FRW A;  1LCK A;  3NMZ C;  4HVU A;  1ARK A;  2A36 A;  2C0I A;  1CKA A;  2JXB A;  1WI7 A;  2SRC A;  3U23 A;  1YNZ A;  3QWX X;  1PKS A;  2BZX A;  4Y92 A;  3VS0 A;  2RNA A;  1K4U S;  2ECZ A;  1NYF A;  1AEY A;  1RLQ C;  4K11 A;  4HVW A;  4Z88 A;  1KIK A;  1A0N B;  4CC2 A;  2HSP A;  3RNJ A;  1X43 A;  1GCQ C;  1OEB A;  2ENM A;  1GFD A;  2CT3 A;  1U5S A;  1CKB A;  2FRY A;  4OMQ A;  1OPK A;  2O9S A;  2P4R A;  3I35 A;  1K0S A;  2J6F A;  1UG1 A;  2D1X A;  5GJV B;  3VRZ A;  2CRE A;  1UUE A;  2KYM A;  2NUZ A;  2BTT A;  1SPK A;  1X27 A;  1PKT A;  1SSH A;  2DE0 X;  3M0U A;  1WDX A;  4RUG A;  1AWX A;  2O31 A;  1GL5 A;  2YUQ A;  2M0Y A;  2DRM A;  2YUP A;  1RUW A;  3JV3 A;  4OMM A;  4ORZ A;  1U3O A;  1X69 A;  3C0C A;  2J7I A;  2RQR A;  2YT6 A;  2FPF A;  2LMJ A;  2MIO A;  2LJ3 A;  4AFZ C;  1GFC A;  1SHF A;  4J9H A;  4JPB W;  4HXJ A;  2OAW A;  2KRN A;  2DL7 A;  2PTK A;  2L3P A;  4LN2 A;  2ABL A;  1ZX6 A;  4D8D A;  1BBZ A;  1SEM A;  2VVK A;  2F2W A;  2KGT A;  1OPL A;  2YUO A;  3UA7 A;  2JTE A;  1SHG A;  2W0Z A;  1KSW A;  2X3X D;  2OI3 A;  2GTJ A;  1AZG B;  1KJW A;  3EG1 A;  3M0S A;  4EIK A;  2DMO A;  2LCS A;  4WCI A;  1XOV A;  1K76 A;  4J9D A;  2EYX A;  2YSQ A;  3PVL A;  2KEA A;  2RPN A;  3EGU A;  1GBQ A;  4RTU A;  4OMO A;  4RTX A;  2CH4 A;  2EYY A;  1UJY A;  1E6H A;  1PHT A;  2LZ6 B;  1UHF A;  2HDA A;  4HVV A;  3I5S A;  1BU1 A;  3EHR A;  1GCP A;  5HCK A;  2GNC A;  4LUD A;  2KRS A;  1BB9 A;  4E6R A;  1TG0 A;  2J05 A;  1X2Q A;  1UEC A;  1K9A A;  1YWO A;  1NYG A;  4R0K A;  2HCK A;  4OML A;  2DL3 A;  1UGV A;  2M51 A;  4J9G A;  2C0O A;  2I0N A;  2RQT A;  2J6K A;  2LX7 A;  1HD3 A;  4RTT A;  1VYU A;  3EHQ A;  1ZBJ A;  1PRM C;  3VS5 A;  4AFQ C;  1M3B A;  2E5K A;  2KXD A;  4JJC A;  3SHW A;  1V1C A;  1U06 A;  3NHN A;  2RN8 A;  3VS4 A;  1YN8 A;  4KRT A;  3TSZ A;  3TVT A;  1FYN A;  2SEM A;  2LQN A;  1I0C A;  3IQL A;  2RF0 A;  2DVJ A;  1W70 A;  3PE0 A;  2KT1 A;  3EG0 A;  1E7O A;  1ZUU A;  1B3Q A;  4RTY A;  2JT4 A;  1JQQ A;  1T0H A;  2JMC A;  1QLY A;  1QKX A;  1EFN A;  2EBP A;  4AG1 C;  1WA7 A;  1Y0M A;  4Z8A A;  1UE9 A;  2VKN A;  2AZV A;  1ZUK A;  3M0R A;  1YP5 A;  4J9I A;  2K2M A;  3M0T A;  2J6O A;  2GGR A;  4HCK A;  2QDL A;  2EVR A;  5ECA A;  1AWJ A;  3UA6 A;  2HBW A;  2JM9 A;  2PNI A;  1M3A A;  2FPE A;  1GRI A;  1SRL A;  2EGA A;  2YUN A;  2MCN A;  1MV3 A;  1AD5 A;  2DX1 A;  2DJQ A;  3TSW A;  2KBT A;  2KE9 A;  1TUD A;  2OJ2 A;  5EC7 A;  1I1J A;  2D8H A;  2DBK A;  5IXF A;  2B86 A;  3I9Q A;  1JXO A;  3THK A;  2F2V A;  2RQW A;  1X2K A;  3FJ5 A;  4J9E A;  4OMN A;  2K9G A;  2CDT A;  4M4Z A;  4A63 B;  1NLP C;  1UDL A;  1M27 C;  2CUB A;  2EGE A;  1PWT A;  1QWE A;  1WX6 A;  3VS7 A;  1JO8 A;  2CUD A;  1JU5 C;  3ZL7 C;  4LE9 A;  1W1F A;  1AOJ A;  1E6G A;  1WXU A;  1WYX A;  5FWC A;  1G2B A;  1J3T A;  2G6F X;  1VYV A;  5IH2 A;  1X6G A;  5IHN A;  3M0Q A;  2YDL A;  2X3W D;  2JS0 A;  5FW9 A;  4F14 A;  2BZY A;  3I5R A;  2ROT A;  2RQV A;  1ABO A;  1M30 A;  1K1Z A;  1H3H A;  2A28 A;  1QCF A;  1AWW A;  2EYW A;  1WXB A;  1UFF A;  2KT8 A;  2D0N A;  4Z89 A;  3UF4 A;  2L2P A;  3NGP A;  2K7A A;  4IIM A;  1PNJ A;  3CQT A;  2VWF A;  3H0H A;  2O88 A;  4DEX A;  2AZS A;  1S1N A;  2V1R A;  2GTO A;  4DEY A;  2ROL A;  2DL5 A;  2KR3 A;  2MOX A;  1MUZ A;  2C0T A;  1HJD A;  1TUC A;  1JEG A;  1GBR A;  1M8M A;  3VRY A;  1YWP A;  2CSQ A;  1T3L A;  1T3S A;  2DF6 A;  4J9F A;  1I07 A;  5FWB A;  3A98 A;  1UHC A;  1VYT A;  3VS3 A;  2JMA A;  3R6N A;  3M0P A;  1OV3 A;  1ZLM A;  4JZ4 A;  3H0F A;  4GLM A;  4ESR A;  1NEG A;  1ZSG A;  3SEM A;  2GBQ A;  3EG3 A;  4IIO A;  2HEQ A;  2L3S A;  4ZNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...