2K6DA

Cin85 sh3-c domain in complex with ubiquitin
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
62
structure length
62
Chain Sequence
KSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sh3 domain/ubiquitin
molecule keywords SH3 domain-containing kinase-binding protein 1
publication title Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination.
pubmed doi rcsb
source organism Homo sapiens
total genus 1
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k6dA00
3VS6A 2SRCA 3REAB 4OMOA 1AZEA 1FMKA 1AWXA 2JW4A 2YDLA 1K76A 2J6OA 4AG2C 1I0CA 1OOTA 2EVRA 1M30A 2M0YA 3EG3A 2CH4A 1PWTA 5FW9A 1PRMC 1UUEA 2KNBB 4OMLA 2DJQA 2KXDA 4Z89A 3H0HA 4ESRA 1IO6A 2LQWA 3THKA 1M27C 2OJ2A 1H92A 1W6XA 2AZSA 3NPFA 2DA9A 2I0NA 2LCSA 1X6GA 1UECA 2DE0X 2KGTA 4J9CA 3M0UA 3I9QA 1QCFA 2L2PA 1GBRA 4Z8AA 3I35A 3TSZA 1VYVA 2RMOA 1K1ZA 2OAWA 1E7OA 4RTZA 4KRTA 1M3CA 1RLQC 2AK5A 1H3HA 1WDXA 2CUDA 1AD5A 1UTIA 5I22A 2DILA 5IHIA 2LJ1A 4K11A 1Y57A 1X6BA 3H0IA 3KFVA 2BZXA 4RTVA 1GCQA 2EPDA 3O5ZA 2CREA 1UHCA 2A28A 2C0OA 1SHFA 2HCKA 3TVTA 2O2OA 2K79A 2BZ8A 3VS3A 1WXTA 1UJYA 4M4ZA 4ORZA 1T0JA 2KYMA 1AVZC 1ZBJA 4LNPA 1NLOC 2ENMA 1WXUA 4CC4B 4AFQC 3VS5A 4IIOA 2F2XA 4Z88A 2YUNA 4JJBA 2L3PA 1UJ0A 4D8DA 1Z9ZA 2LP5A 2RQTA 4RTYA 1QKWA 2RQWA 1AWWA 1SSHA 4FSSA 2GGRA 1KIKA 1BU1A 4F17A 3EGUA 1RUWA 1J3TA 4J9IA 1VA7A 1PNJA 2V1QA 2F2VA 3I5SA 4JJDA 1H8KA 1WX6A 5IHNA 1BBZA 2A37A 1UE9A 3ULRB 1X27A 1SRMA 2DL4A 1PKSA 1KJWA 2FRYA 2KBTA 2EKHA 2DM1A 2NUZA 4HVVA 2DBKA 3UF4A 3PVLA 2HEQA 2KT8A 2LJ0A 1JO8A 1AEYA 4E6RA 2DRKA 2AKKA 3I5RA 2DL7A 3U23A 3TSWA 2K2MA 4CC7A 2DF6A 1X69A 2CDTA 3PVQA 4F16A 1TUCA 2CT3A 1JXOA 2M51A 2ROLA 2YUPA 3QWXX 4QT7A 2O9SA 1ABOA 1U5SA 3UATA 1N5ZA 3M0RA 1YN8A 1NLPC 2LZ6B 2O31A 4AFUC 2PZ1A 3SEMA 1MV3A 1RI9A 4X1VA 1E6GA 3RNJA 1HJDA 1UGVA 3SHWA 3JV3A 1V1CA 2DRMA 2KR3A 3UA6A 3REBB 4LN2A 2EYXA 2FG0A 2J05A 2D1XA 3EHQA 3VRZA 1WLPB 2FO0A 4J9BA 1LCKA 1OPLA 3M0SA 2DVJA 1UG1A 1W70A 2FPEA 2SEMA 1I1JA 1T3LA 2VWFA 4LE9A 5IHKA 1YWPA 1SPKA 3LH5A 2ED1A 1E6HA 1TG0A 1B07A 2B86A 5I11A 2ESWA 1GCPA 1PHTA 2CH4W 2D8HA 1WIEA 2KT1A 1ABQA 3NMZC 2K9GA 1JQQA 2CSIA 1YP5A 1QLYA 1NYGA 1X2KA 2DYBA 2DX1A 2GTJA 2HBWA 2JM9A 3VS0A 1I07A 2MIOA 3H41A 1GL5A 1SRLA 2ABLA 3R6NA 1QWFA 4JJCA 1KFZA 2K7AA 2P4RA 2DNUA 1CKAA 2FPDA 1GRIA 5FWCA 2KRMA 4GBQA 4J9DA 3M0PA 2BZYA 1YWOA 4OMQA 4CC3A 1FYNA 2X3WD 2LJ3A 2DL8A 2GBQA 2RF0A 3EG1A 1EFNA 1WA7A 1GFCA 1ZUKA 2JT4A 4LUEA 1XOVA 1S1NA 4J9EA 2HSPA 2E5KA 3NHNA 1PRLC 1A0NB 1B3QA 2RQRA 3EHRA 1ARKA 2DL3A 2HDAA 1K4US 1Y0MA 2BTTA 4EIKA 5FWBA 1GCQC 2AKLA 4F14A 2L3SA 2LQNA 2FRWA 3H0FA 1ZUUA 2FEIA 4AFSC 2JXBA 2RNAA 5EC7A 1HD3A 4A63B 2KRNA 1U3OA 3A98A 1T0HA 4OMMA 1RLPC 2J6KA 2C0IA 4GLMA 3RBBB 4RTXA 2GQIA 3VS1A 1ZX6A 1QKXA 1NEGA 4Y92A 2ECZA 2MCNA 3VS4A 2QDLA 1OEBA 2CUBA 2DMOA 2W0ZA 4HVUA 1M8MA 4HXJA 2L0AA 4LUDA 3ZL7C 2YSQA 3QWYA 2LMJA 5L23A 1YNZA 2KEAA 2C0TA 2J6FA 2RQUA 2H8HA 2DL5A 1W1FA 1YCSB 3EG0A 1VYUA 2ED0A 1GFDA 5IH2A 1WXBA 4J9GA 4RTUA 1G2BA 2KE9A 2KROA 1SEMA 1AZGB 1NEBA 2FPFA 2VVKA 2EGCA 1MV0B 2J7IA 3VS2A 2YT6A 2YUOA 5GJWB 2O88A 2EYYA 2RN8A 4JZ3A 5IXBA 3C0CA 3PE0A 2KXCA 2JM8A 3VS7A 1UFFA 2K6DA 2D0NA 1ZLMA 2PTKA 2EGAA 1T3SA 1SHGA 1VYTA 1ZSGA 3UA7A 4DEXA 1BK2A 1OV3A 2RPNA 1CSKA 2JMCA 2O9VA 2W10A 2KYBA 2EQIA 2A36A 1JXMA 2DLPA 2D8JA 1WI7A 2AZVA 2EBPA 2EYZA 1K0SA 2F2WA 1CKBA 1KSWA 1NM7A 4CC2A 2CSQA 2V1RA 1AWOA 1UHFA 4JPBW 1AOJA 3GBQA 1UDLA 4D8KA 1MUZA 2EGEA 2ROTA 4RUGA 2LX7A 3EG2A 4RTWA 3IQLA 1M3AA 2JMAA 4AG1C 1QWEA 2OI3A 1M3BA 4AFZC 1TUDA 2JS2A 2VKNA 2YUQA 1K9AA 3FJ5A 1PKTA 1ZUYA 2IIMA 1BB9A 2J06A 4ZNXA 1K0XA 4DEYA 2RQVA 1U06A 2K3BA 2GNCA 4OMPA 4WCIA 2A08A 3CQTA 1AWJA 4RTTA 1X43A 2JTEA 1JU5C 1WYXA 2CT4A 2X3XD 4IIMA 1NG2A 2EW3A 5HCKA 1NYFA 4HVWA 2NWMA 2KRSA 3M0QA 3VRYA 4R0KA 2GTOA 1WFWA 1X2QA 1Z9QA 3M0TA 2EYWA 2PNIA 5GJVB 1OPKA 2JS0A 2L3QA 2XMFA 2MOXA 4HCKA 4J9FA 1GBQA 2G6FX 4J9HA 1JEGA 2DBMA 5ECAA 1G83A 2LNHB 5IXFA 1HSQA 4JZ4A 4OMNA 3NGPA
chains in the Genus database with same CATH superfamily
1ZSZC 2SRCA 1AWXA 5GANh 4OB1B 2JW4A 4JUVA 1K76A 5KYUA 2R57A 1RACB 3G4SA 2QDYB 2HNIA 1M30A 2FZCB 2JTMA 2K5IA 4QW2A 8AT1B 2OTJT 3CPWP 5FRNA 3J80E 1R77A 2A3LA 4C8QF 1UGRB 2KXDA 5DY9A 1Q86C 2PVGB 4PK4A 4A4KA 1M27C 2OJ2A 1H92A 2I2LA 2LCSA 2DEQA 2KVQG 2DE0X 3OYYA 1Q7YC 3QBYA 3EH2A 4J9CA 1PD1A 4C92D 4F7UB 4DQ2A 3GP8A 5I2MA 1YIJT 4MDXA 2PUKB 4ME7A 2ZPEB 1D3BA 2KQWA 2L3RA 2Y4YA 3QDRB 1UTIA 2CP0A 5KYYB 4M7DB 1QW1A 2LJ1A 1Y57A 3H0IA 1XQHA 3JCMJ 1X6OA 2EPDA 3O5ZA 5FROA 2A28A 2C0OA 5HY6A 7AT1B 1WQ7A 3EGDB 2XI9A 2D9TA 2JUFA 2RO0A 1KQ2A 4M4ZA 3CD6T 2R5AA 3CXCA 6AT1B 2MAMA 2QXFA 2ENMA 4QVCA 2QEXA 4D6WA 2IPOB 4DBQA 5GAN8 3RIRA 1KD1R 2XG8D 2RQTA 3A1PA 4RTYA 2OTJQ 5M9OA 3CCJT 2MK5A 1YITA 2E70A 4MMLA 4J83A 3JCMc 1RUWA 3OS0A 2VB6A 3CCUA 2E6ZA 4J6YA 3HPWA 3M59A 1ZA1B 1MGQA 1TS9A 1VQ8A 4M7DG 4JJDA 3O8VA 1H8KA 4M7DC 1BI3A 1XNIA 1P92A 4RG8A 2EKHA 2DM1A 4HVVA 4J7IA 1XJWB 2BE7D 2JNGA 2P0KA 3UF4A 2LJ0A 4P5NA 1JO8A 1AEYA 2NYSA 1YIJQ 2FB7A 3CCSA 3PNWC 3TSWA 3PVQA 2CDTA 1TUCA 2EKOA 1JBMA 5GANj 3RKXA 2DYIA 1VQNA 1LPLA 1M8VA 2AT1B 3JSCA 5LJ5e 4PJOC 2GFUA 3OYAA 2LZ6B 4AFUC 4A54A 2VYTA 1Q86R 1MV3A 4M78E 5CKFA 1PSEA 3CD6Q 4JDSA 1HJDA 2PQWA 2RHIA 2KR3A 3M4GA 4XTVA 5C6SA 5GAOq 3M5AA 3J81E 2FO0A 1OPLA 3ASKA 3CMAA 4EMKC 3CPWA 3M0SA 3G71T 2P84A 3SWNC 5HK0A 1MMDA 2Y4XA 2SEMA 1T3LA 1TOVA 4LE9A 1YWPA 1PM3A 5GMKl 2ED1A 4FM4B 3CCJQ 3EGXA 3G1JA 2B86A 3GNFB 2CH4W 2VXEA 2WSCE 4ZN1A 1QVGS 5A2QE 2X4WA 5DLQE 4HCZA 1FMWA 1WHJA 2DX1A 2HBWA 4O6JA 2JM9A 3FDRA 1IREB 2V8IA 3H41A 2DXUA 3E19A 3QXEB 4IUQA 2VGNA 4A4HA 1QWFA 1MNEA 4HT8A 4JJCA 4NS5A 1W2BA 3GLXA 3VU3C 2QA4T 3L2ZA 1VQMT 2DNUA 1RAGB 4ZTJA 3OYLA 4GBQA 4CC3A 1YJ9T 1K9MC 2EQJA 2K2VA 2X3WD 3HFNA 5D6XA 2H3EB 1OI1A 1WA7A 2CS7A 5CK9A 3BW1A 5LJ5d 3OW2A 1ZQ1A 3CC2A 1M2VA 1XOVA 4OB2B 4RKUE 4PJOD 2HSPA 3EFRA 2E5KA 3NHNA 4LDYA 1JRIA 1Q86U 5FU6C 4Q5WA 3MO8A 5CKBA 3OYEA 2DTHA 5FRMA 2DIQA 2BTTA 2QQRA 2C06A 5FWBA 1Q7YU 3MP1A 2AKLA 3QPHA 4F14A 4DA4A 2L3SA 3A8MB 3MP6A 3P8BB 4EMGA 3G71Q 1G3WA 2KRNA 4M7AC 3A98A 2QA4A 4OMMA 5LJ5h 2XD0A 4GLMA 3RBBB 2GQVA 3URGA 3VS1A 1NEGA 4Y92A 1M90C 1SKUB 2QDLA 3P8HA 5GAOp 2CUBA 1KQ1A 2LQKA 3MCAB 1NE8A 2WSFE 3OYHA 2RQUA 2DL5A 2LC4A 2P4TA 3JCMf 3EG0A 2QA4Q 2ED0A 1M4ZA 1VQMQ 4J9GA 3RUXA 3NTIA 2EAYA 2GF7A 2KROA 1SEMA 1YJ9Q 4E7LA 2E6NA 2PUOB 2O88A 4LD6A 1QVGP 1EIFA 2HL3A 3DKMA 5DM7R 4E7JA 2KXCA 1M1KR 2B8AA 2FZKB 3GPLA 2KK4A 1ZLMA 3TREA 1LOJA 3P8DA 3MJXA 1BK2A 4OGCA 2DJZA 1CSKA 2QASA 2E1HA 2W10A 2EWNA 2M16A 3X25B 5CKDA 2XDDA 5GAMg 2RHZA 2AZVA 4AT1B 1QVFA 4M7AD 1D1CA 1K0SA 2F2WA 1CKBA 1KSWA 2G3RA 2YWWA 3FB9A 3UWNA 4CC2A 1UHFA 4C5IA 3CXCS 2CZ7B 3JB9G 4RUGA 3EG2A 4LXCA 2FL7A 1KK7A 2OI3A 1M3BA 4AFZC 5GAMf 2AHJB 4XTWA 2YUQA 2FHDA 1PKTA 4ZNXA 2J06A 1TXQA 3BY7A 4M7DE 1D09B 1AT1B 2HBPA 2A08A 5AYFA 1X43A 4E2FB 2X3XD 3BE3A 4BE2A 3I56T 1NG2A 4PJMA 5HCKA 4M78B 1NYFA 4HVWA 1VQPT 2NWMA 2KRSA 1MMAA 3LW5E 3M0QA 1GXIE 1WHGA 2YHTA 5J39A 4XK8E 2ZPBB 4E7ZA 2OAUA 2E3HA 5FU7B 2DFUA 2K57A 2PNIA 3META 4ZGJB 4ATOA 2JS0A 4XTXA 3V7RA 2XMFA 5LJ5j 5GAOn 4J9FA 2DVEA 4PJOE 1RABB 2K3YA 5IXFA 1AHJB 3LGFA 4R56A 3CC7T 2R5MA 3A5ZB 1R8OB 1ZHIA 4B9XA 5I2SA 1C1AA 1Q82C 1G3TA 2WACA 2J6OA 1K9MU 4AG2C 1OOTA 2EVRA 3OSSC 2O01E 1Y7XA 2DD4A 5GANe 1VQ4T 2KNBB 4OMLA 4DOVA 4Z89A 3QHSA 1IB8A 5KCOA 1YHQA 4M78G 1W6XA 2AZSA 2DA9A 2I0NA 1W4SA 4C92B 3CPWS 3L1AA 3CCRT 1RI0A 1OULA 1QCFA 3C12A 5FU7C 3TSZA 2LX9A 3I55A 1K73R 4BE0A 2HKNA 1TSFA 4M75F 2RJDA 5GAOl 1E7OA 4RTZA 1M3CA 1RLQC 3I56Q 3RMQA 1WDXA 1AD5A 1VQPQ 4M77A 4K11A 2F5TX 3C94A 4C5GA 1GCQA 5LJ3h 2CREA 1SHFA 2HCKA 3NTKA 1W2BS 2BZ8A 2KDSA 1G3SA 3VS3A 1WXTA 1M90U 1ZSZB 2COZA 3E9FA 4ORZA 9ATCB 1ZBJA 4LNPA 4N0AA 1B34B 1WXUA 3CC7Q 4CC4B 3OQ5A 1YJWT 4IIOA 3H8ZA 2CKKA 3KXTA 3OW2S 2L3PA 4C92G 2ZAEA 1RL2A 4C92C 1LNXA 1VQLA 3MHXA 3PT9A 2RQWA 1VQ6T 4IUPA 2RK2A 2GGRA 3G6ET 1BU1A 1VQKA 4M7AE 3EGUA 1VQ4Q 4IUVA 3N5BB 1D1BA 4PNOA 1M9SA 1VA7A 1PNJA 4VUBA 1RAHB 4A53A 1WX6A 4M75D 3LX7A 1VIEA 3CCRQ 2ZPHB 3JCMQ 1PKSA 1KJWA 5DLOA 2KBTA 2P0PA 4M77F 3PVLA 3INZA 2KT8A 4FSXA 2JOYA 3A8HB 5D7UA 3EG9A 3I5RA 4C8QG 4N4HA 2BUDA 2DL7A 4YTLA 2VXFA 2KAFA 1OYXA 1IGQA 4C8QC 4F16A 2CT3A 2YUPA 1S72T 2OX7A 2O9SA 1ABOA 1OU8A 3M0RA 2F1LA 4JJNK 2MPXC 2RJEA 1RI9A 4X1VA 3G6EA 3JV3A 1V1CA 2DRMA 3J7AF 3VJPA 3REBB 4LN2A 4ELYC 2D1XA 1LCKA 1QQJA 1YJWQ 2V8KA 4OVAA 2DXCA 2V8JA 1KC8C 1N9SA 2PVOB 1QVPA 2VWFA 2CP6A 3E9GA 5LL6S 2EFIA 2L8DA 4E47A 1W2BP 3LH5A 3SFMA 1V76A 1VQ6Q 5D6WA 1TG0A 1B07A 4IURA 2ESWA 5GMKe 1GCPA 3G6EQ 1WIEA 2KT1A 3GOXA 2CSIA 2DYBA 3VS0A 2M9UA 1SRLA 3OW2P 3D7SB 2OTJA 4F7UA 3V7CA 1S72A 1QVFS 1KFZA 2P4RA 5FWCA 1GRIA 2RM4A 2KRMA 1G8XA 3QZ9B 1D0XA 2BZYA 3EH1A 1YWOA 4OMQA 1G5VA 3UDCA 5KYYA 1EX4A 4M7DA 3GF5A 2LJ3A 2FZGB 2RF0A 3X20B 3EG1A 3JCMX 3R6OA 4C8QD 1ACMB 4PJOB 4B6MA 1NJIC 2A0FB 3RDVA 2JT4A 1VQOT 4LUEA 4BI3A 3EGDA 3HRUA 2RHUA 3TCJA 2QTVA 2COWA 1S72Q 1FX7A 2QAZA 4J7FA 1YIJA 1WHLA 1H3ZA 3MEWA 1U8RA 1WHMA 1K8AR 4EMKB 3KUFA 1Y0MA 1D0ZA 2YRDA 3SWNB 4HCBA 3RKYA 1RAEB 2FRWA 1VOMA 3A8LB 3H0FA 4CI0C 5KYXB 3X28B 3UPUA 4Y91A 3CD6A 2X4JA 5LJ5f 1RLPC 4PFPA 4WF2A 4F7UF 4C5HA 4NL3A 2JJ9A 1QKXA 3EFSA 2QTXA 2ECZA 3VS4A 4PJOG 3HSBA 3CBMA 3PTAA 5KE3A 4HXJA 4KULA 3QWYA 2BE9B 3CCJA 2KEAA 2C0TA 2J6FA 2HQEA 2H8HA 1W1FA 1GFDA 5IH2A 1WXBA 3HKSA 1RAIB 2K5LA 2KE9A 3M9QA 3OYBA 1Q7YR 3VS2A 2YT6A 3VYHB 5GMKh 2YUOA 4HA8A 5GJWB 1I81A 1WNLA 4PL6A 2RHYA 3DB4A 5FU6B 4JZ3A 5IXBA 1VQOQ 4PJJA 2CYZB 3FJPA 3PE0A 3CCET 3L2RA 2K6DA 1QVFP 2LTOA 2EGAA 3RMSA 1K8AU 3OB9A 1R0CB 1SHGA 3UA7A 3SB2A 1OV3A 4LDUA 2HSEB 1IRXA 2EQIA 1NPRA 4M7AB 4C0GA 2D8JA 5GMKm 4BY6C 3CBOA 1N9RA 3FC3A 1WJQA 2MMPA 3LH0A 4RCCA 2V1RA 4C92E 4D8KA 4KGVB 2ROTA 2LX7A 4QQ6A 3IQLA 1LJOA 3OYIA 2BKDN 1QWEA 4C0ZA 2QQAA 4R55A 3G71A 1TUDA 2VKNA 3VUZA 4OB0B 4X9CA 1ZUYA 2CP5A 2IIMA 2XDBA 1K0XA 1U1SA 5A0GA 1HXDA 2DXTA 2Z0WA 1AWJA 3HL8A 2JTFA 1JU5C 4FIBA 4JRQA 1YI2T 5L8RE 4FYWB 2DTIA 1KC8U 2DXBA 4GY5A 4M7AG 2FVUA 5KYWB 4R0KA 1Q81C 3CCEQ 5CVIA 3JCMg 4C8QE 5AT1B 1X2QA 1VQMA 2EYWA 1OPKA 1YJ9A 4L6V5 4HCKA 1TU0B 1FWZA 5IN1A 3MEVA 2DBMA 3OYNA 5HKCA 2QK0A 3CC4T 4IKFA 2GCXA 3ME9A 2ZGWA 3REAB 4OMOA 1FMKA 4X9DA 2YDLA 4O5VA 1I0CA 2QQSA 1I8FA 2CZ0B 2HZYA 4JS5A 3SDZA 2M0YA 2XK0A 3CCQT 5FW9A 1PRMC 5J26A 1TUGB 1G3YA 3QYGB 1IGUA 4A4GA 4ESRA 1IO6A 5GMKj 4AMCA 2LQWA 1I4K1 1YI2A 4DBHA 3HRTA 1Y96B 1FXXA 3BFMA 1X6GA 3G7ZA 4BDYA 1RAAB 1UECA 4KT0E 4MMKA 4FU6A 2KGTA 5GAN3 4RG2A 4J5YA 1GBRA 3RERA 1HK9A 2FYKA 4Z8AA 1X01A 5A0LA 1K1ZA 4XTZA 1C6VX 4LDWA 4X34A 1YI2Q 3OYKA 2K5FA 2DILA 4WTOB 3OBYA 2ZZDA 4OF1A 4XTUA 4QKUA 5IHIA 1M1GA 1X6BA 4FT2A 3KFVA 1K9MR 2BZXA 4RTVA 1U1TA 4KBMB 3C4SA 3TVTA 2E12A 3MEAA 2MWPA 1OZ2A 2M02A 2O2OA 3JCMP 2DETA 1N6AA 1TWBA 1UJYA 2EQUA 3A8OB 3RR6A 2LVMA 1T0JA 1YCYA 2VUBA 1VQ7T 5LJ3e 2NUTB 2RI2A 1NLOC 3CC4Q 3ZFJA 2O4XB 5FLXE 4PFOA 5HK3A 4AFQC 3VS5A 4Z88A 2YUNA 4JJBA 3QO3A 4RMOA 1Z9ZA 2LP5A 4QQGA 3CMET 1N27A 3CCQQ 1AWWA 1OQKA 1SSHA 4FSSA 1VQ9T 1PCXA 4QVDA 1KIKA 4DBRA 3LWHA 2VV5A 4F17A 3JB9F 3OYMA 1J3TA 4M75B 5GANg 4J9IA 3L42A 2V1QA 3X26B 1YJNT 4FYVB 3I5SA 2NUPB 4FCYA 1QCNA 5IHNA 1UGQB 4MZTA 1UE9A 3ULRB 1JB0E 2DO3A 2FRYA 1M90R 2ZPGB 2NUZA 4N4IA 5C0MA 2LRQA 2HQHA 4ZTFA 1RADB 2HEQA 3OS2A 4M78A 5CKHA 5A0DA 3HTRA 2KSSA 5GANf 3BDLA 2AKKA 4TVRA 1QP2A 2E4HA 3U23A 1PG5B 2K2MA 3VYGA 1EZZB 3JCMV 1JXOA 3ER0A 2M51A 2ROLA 2DERA 4QT7A 2RA2A 1U5SA 1Q95G 2E5QA 4C0DC 3UATA 4C0FA 1KG1A 5CQYA 3CMEA 1NLPC 2O31A 2VC8A 5LJ3d 2RI3A 3SEMA 1VIFA 3I56A 2QQ9A 1VQPA 1UGVA 1V29B 4UC4A 1VQ7Q 1YBYA 3EFOB 3OMCA 2FG0A 5KH6A 1JJ2P 4M75G 3VRZA 4J9BA 4M75C 2COYA 2OTLT 2X35A 1WJRA 2XHCA 1YJNA 3WXMB 5J3BA 4DBFA 2Y90A 2HQXA 2DVJA 1W70A 1I1JA 2QGFB 3CMEQ 2DPPB 5IHKA 1SPKA 4B9WA 4FT4A 1E6HA 4ANJA 1VQ5T 1VQ9Q 3ZEHA 1PHTA 3RKWA 3SD4A 1PD0A 3CC7A 1ABQA 4EDUA 1WHKA 5GAMd 4C92A 3QKJA 2K9GA 2RJCA 3OYFA 4M78F 1YJNQ 1O9SA 2BIVA 2YRVA 1I07A 1GL5A 3R6NA 2LNVA 2DZ9A 3OYGA 2LCLA 4FW2A 4Z02A 2K7AA 1VQ4A 4E7KA 4C8QB 1QCOA 3EAEA 2K3XA 3M57A 2DL8A 1EFNA 4PJNA 4JLIA 2KI7A 1UGPB 1GFCA 4RCBA 2PU9B 5CKEA 3CCRA 3CCMT 2IG0A 3PFSA 2EJGA 2CGHA 5GAMh 1ZSZA 3JB9H 2RK1A 1PRLC 3PGGA 1A0NB 5I21A 1B3QA 3QDFA 3M58A 3MP8A 3EHRA 1FMVA 3G4ST 1ARKA 4BD3A 2V26A 1VQ5A 1B34A 2HDAA 4M77C 5CO7A 4XU3A 1WHHA 1KD1C 1GCQC 4FL6A 2OTLQ 1PC0A 1ZA2B 1ZUUA 4KH1B 2JXBA 2RNAA 5EC7A 1H641 2L5QA 4QVZA 1HD3A 4A63B 3VUBA 1U3OA 2EYQA 1T0HA 4N0AC 5KYUB 3AT1B 3Q1JA 2C0IA 1VQ5Q 1Q82R 1BIBA 2GQIA 1ZX6A 5CR2A 2LDMA 2X4YA 1YJWA 2MCNA 3S6WA 4KH0B 1OEBA 4L5GA 2DMOA 2GFAA 1IHWA 4XAXB 3ZL7C 5CQXA 2LMJA 1VQ6A 1Y71A 5L23A 1KQSP 5CCAA 1VYUA 4RTUA 5IAYA 1G2BA 2VVKA 2J7IA 3L2QA 2RB6A 4JRKA 3QSUA 2RN8A 1D3BB 3CCMQ 1BI2A 2DAQA 3C0CA 2QEXT 1OU9A 2ATCB 2JM8A 3VS7A 5GAN4 1UFFA 2E64A 2D0NA 4MZMA 4PJLA 3PMTA 1JJ2A 3G4SQ 4M77D 1ZSGA 1VYTA 4DEXA 5GAN5 2RPNA 2DIGA 4IUTA 4HKEA 1YITT 4ZGEB 1D0YA 2JMCA 2O9VA 3A8GB 3PIPA 5LJ3j 2A36A 1JXMA 3FLGA 3CCUT 3OYJA 2DLPA 1WJSA 3QG1A 1VQ8T 3M55A 5KE2A 2EBPA 2EYZA 2YLCA 2JN0A 3CBPA 1Q82U 1MMNA 1AWOA 3V8LA 2F5KA 2LQ8A 3OA6A 2MI6A 1MUZA 1C0MA 2EGEA 4OB3B 1M3AA 2JMAA 4E7SA 1TH7A 4EMHA 2QI2A 3CCST 2K4YA 4N4GA 2MF2A 5D6YA 1K9AA 3FJ5A 5GAMj 5LJ5g 4DEYA 1SG5A 2RQVA 1U06A 1VQNT 4OMPA 1KHIA 3X24B 3CQTA 4RTTA 4CRIA 2JTEA 2M1HA 4PJOA 2RD1A 1WYXA 2CT4A 4J6XA 1SSFA 4F7UG 2EW3A 2CZ1B 1QMCA 2CP2A 3VRYA 1BCMA 3QYHB 4BI4A 2GTOA 2QEXQ 3CPFA 3F70A 3CMAT 2L89A 3M0TA 2XKOC 4EMKA 2L3QA 3S3NA 4ZN3A 1GBQA 1LVKA 3SWNA 4BI8B 2DTOA 1JEGA 2P0QA 2LNHB 4BY6B 3V8JA 3HP9A 4M7DF 1YITQ 1HSQA 3TEEA 3VV0A 5KYXA 1UEBA 1VQOA 4JZ4A 4OMNA 3VS6A 3FIFA 4PFZA 2LT4A 4XU2A 3CCUQ 1AZEA 4L59A 1VQ8Q 4M75E 2D6FA 3EG3A 2CH4A 3MEUA 8ATCB 2M0OA 3S3MA 1PWTA 1WGSA 3NFCA 1UUEA 2KY9A 4JRPA 2DJQA 3H0HA 1KC8R 3EGXB 3THKA 3UT1A 1KQSA 3NPFA 2JVVA 4PJOF 3CCSQ 3L2UA 2EJFA 4NL2A 3M0UA 3I9QA 2L2PA 3CC2T 3OY9A 5GAN2 1VQNQ 1KD1U 3I35A 2AIRB 1VYVA 2RMOA 2MYSA 4JLGA 2OAWA 4KRTA 1M1KC 3M56A 2AK5A 1H3HA 2CUDA 5I22A 4JS4A 3QUIA 2HD0A 5GMKi 1Y07A 2QYZA 3DLLA 1BCOA 4LD9K 4M7DD 1UHCA 2EQKA 2RHXA 3CMAQ 4II1A 1BKBA 2K79A 1M2VB 2VGMA 3PIOA 4XQ3A 1N8RC 1NJIR 4NOYA 4MDWA 1IZ6A 3E1SA 2YXYA 3HRSA 5CAIA 3QIIA 1QP3A 1BI1A 2KYMA 4M7AA 1AVZC 4KUIA 3WVDB 3TU4K 1DJ7B 3WVEB 3MPUB 2EQMA 4KGXB 3M54A 3CCEA 4M77E 3GNGA 2F2XA 4BE1A 1UJ0A 4D8DA 2X51A 3HFOA 1QKWA 1WQWA 3V7SA 1UB4A 2WSEE 2YLBA 2QQBA 1R0BG 2ZCFB 1NBEB 1KHCA 1M5Q1 5KCHA 2F2VA 3OYCA 4PLLA 1BBZA 2A37A 1X27A 1SRMA 2DL4A 1WZOA 2VASA 3CC2Q 2DBKA 2RH2A 5IT9E 3V8KA 4E6RA 2RI5A 2NLUA 5EG2A 2LT1A 2DRKA 5KYWA 2E41A 4CC7A 2DF6A 1X69A 3H6ZA 4M7AF 4EPCA 3QWXX 1NJIU 1N5ZA 3JCMb 3QJ6A 2EJ9A 1YN8A 1X75C 2PZ1A 4ELZC 1M2OA 2DKGA 3RNJA 1E6GA 3SHWA 3JRZA 3UA6A 2HMAA 2EYXA 3H9NA 2J05A 5GAOr 3EHQA 1WLPB 5LJ3g 2DD5A 3L2WA 3CCVT 3VKIA 3AHUA 1UG1A 4MZPA 3JCMe 2FPEA 4XTYA 2A7YA 2D0QB 1XTDA 2H3JA 2XU8A 3MKDA 4FYXB 5I11A 1JJ2S 3CC4A 1Y96A 2D8HA 4OP0A 4C5EA 2MWOA 3E2UA 2E3IA 3NMZC 1RAFB 5LJ3f 1JQQA 3LGLA 1YP5A 5CIUA 1QLYA 2LCCA 3M4YA 1NYGA 1X2KA 3OBWA 2GTJA 4J6WA 1K73C 2MIOA 1N8RR 3CCQA 2ABLA 2CP3A 2IVWA 4F04B 1M1FA 1CKAA 2FPDA 4J9DA 3M0PA 4E7IA 3S3OA 1FYNA 2GBQA 4C0DB 1MNDA 2HKQB 2JZ2A 1I5OB 1ZUKA 4LDVA 3CCVA 4F7UE 4J9EA 1S1NA 1VUBA 3GIBA 3CEYA 4OGEA 1NZ9A 2RQRA 3HHTB 2NUTA 4KUDK 2HAXA 2DL3A 2O4XA 1Q81R 3OMGA 1K4US 4PLIA 4EIKA 5GAMe 2DZCA 3ZBDA 3RESA 3C95A 2LQNA 1O75A 1UGSB 3JCMd 2FEIA 3CCVQ 1YHQT 4AFSC 4FYYB 1IHVA 4Y28E 3QZ5B 2DEUA 3CCLT 1OX9A 1M1KU 3FEOA 1SF9A 1NPPA 1VQ7A 4PKCC 2J6KA 4M75A 4V2SA 5GAN7 4RTXA 3PMIA 2NUPA 3I55T 2CP7A 2XIDA 3BDUA 2EIFA 2HL5C 1N8RU 2W0ZA 1BI0A 4HVUA 1M8MA 2L0AA 4KGZB 1PSFA 4LUDA 5KYNA 2YSQA 4XU0A 1YNZA 1VQ9A 1YCSB 3JCMh 1B7TA 3JB9J 2R58A 1AZGB 1NEBA 2FPFA 2EGCA 1MV0B 2ZPIB 2EYYA 3JB9D 1KQSS 4BDZA 1F1BB 1TTHB 4M78C 4LDXA 4M77B 1OX8A 1MMGA 2XDPA 4BUGA 2RJFA 3CCLA 2PTKA 2QGGA 3LWIA 1Q81U 1VQLT 1T3SA 3EFOA 1ZBXA 2E65A 1OZ3A 4JRIA 2XICA 3FRNA 1QVGA 1VQKT 2DK3A 4IUUA 2KYBA 3OSVA 2KMTA 2E10A 3CXCP 1D1AA 4FW1A 5GAOm 1WI7A 1YHQQ 3QJYA 3LLRA 1I5LA 3CCLQ 1NM7A 2CSQA 2X4XA 2YRCA 4JPBW 1AOJA 3GBQA 3JAME 1UDLA 4J8OA 4XU1A 4RTWA 2OTLA 4AG1C 3I55Q 3L2VA 2F69A 1BIAA 2JS2A 3LYIA 1BB9A 4GLKA 4C8QA 2GNCA 2K3BA 4M77G 4A4EA 1IXDA 3M53A 3NTHA 4BB7A 4WCIA 3TQ7P 3JB9I 1MHNA 2X9HA 1HYOA 4OMFB 3DB3A 5GANd 2PVDB 4DOWA 4BACA 4QQDA 4IIMA 3DLMA 3OYDA 1YFNA 3OS5A 4HCCA 3T9NA 4C92F 4E7HA 1WPYA 3EG9B 1K8AC 4M78D 3OS1A 2CZ6B 1WFWA 3JCMW 1Z9QA 5GJVB 2MOXA 4HT9A 2G6FX 3KBGA 4J9HA 1BYMA 1VQLQ 4A4FA 5ECAA 1G83A 4ZGDB 1K73U 2QG9B 5GAN6 3CCMA 2ZPFB 1VQKQ 3NGPA
chains in the Genus database with same CATH topology
3VS6A 2SRCA 3REAB 4OMOA 1AZEA 1FMKA 1AWXA 2JW4A 2YDLA 1K76A 2J6OA 4AG2C 1I0CA 1OOTA 2EVRA 1M30A 2M0YA 3EG3A 2CH4A 1PWTA 5FW9A 1PRMC 1UUEA 2KNBB 4OMLA 2DJQA 2KXDA 4Z89A 3H0HA 4ESRA 1IO6A 2LQWA 3THKA 1M27C 2OJ2A 1H92A 1W6XA 2AZSA 3NPFA 2DA9A 2I0NA 2LCSA 1X6GA 1UECA 2DE0X 2KGTA 4J9CA 3M0UA 3I9QA 1QCFA 2L2PA 1GBRA 4Z8AA 3I35A 3TSZA 1VYVA 2RMOA 1K1ZA 2OAWA 1E7OA 4RTZA 4KRTA 1M3CA 1RLQC 2AK5A 1H3HA 1WDXA 2CUDA 1AD5A 1UTIA 5I22A 2DILA 5IHIA 2LJ1A 4K11A 1Y57A 1X6BA 3H0IA 3KFVA 2BZXA 4RTVA 1GCQA 2EPDA 3O5ZA 2CREA 1UHCA 2A28A 2C0OA 1SHFA 2HCKA 3TVTA 2O2OA 2K79A 2BZ8A 3VS3A 1WXTA 1UJYA 4M4ZA 4ORZA 1T0JA 2KYMA 1AVZC 1ZBJA 4LNPA 1NLOC 2ENMA 1WXUA 4CC4B 4AFQC 3VS5A 4IIOA 2F2XA 4Z88A 2YUNA 4JJBA 2L3PA 1UJ0A 4D8DA 1Z9ZA 2LP5A 2RQTA 4RTYA 1QKWA 2RQWA 1AWWA 1SSHA 4FSSA 2GGRA 1KIKA 1BU1A 4F17A 3EGUA 1RUWA 1J3TA 4J9IA 1VA7A 1PNJA 2V1QA 2F2VA 3I5SA 4JJDA 1H8KA 1WX6A 5IHNA 1BBZA 2A37A 1UE9A 3ULRB 1X27A 1SRMA 2DL4A 1PKSA 1KJWA 2FRYA 2KBTA 2EKHA 2DM1A 2NUZA 4HVVA 2DBKA 3UF4A 3PVLA 2HEQA 2KT8A 2LJ0A 1JO8A 1AEYA 4E6RA 2DRKA 2AKKA 3I5RA 2DL7A 3U23A 3TSWA 2K2MA 4CC7A 2DF6A 1X69A 2CDTA 3PVQA 4F16A 1TUCA 2CT3A 1JXOA 2M51A 2ROLA 2YUPA 3QWXX 4QT7A 2O9SA 1ABOA 1U5SA 3UATA 1N5ZA 3M0RA 1YN8A 1NLPC 2LZ6B 2O31A 4AFUC 2PZ1A 3SEMA 1MV3A 1RI9A 4X1VA 1E6GA 3RNJA 1HJDA 1UGVA 3SHWA 3JV3A 1V1CA 2DRMA 2KR3A 3UA6A 3REBB 4LN2A 2EYXA 2FG0A 2J05A 2D1XA 3EHQA 3VRZA 1WLPB 2FO0A 4J9BA 1LCKA 1OPLA 3M0SA 2DVJA 1UG1A 1W70A 2FPEA 2SEMA 1I1JA 1T3LA 2VWFA 4LE9A 5IHKA 1YWPA 1SPKA 3LH5A 2ED1A 1E6HA 1TG0A 1B07A 2B86A 5I11A 2ESWA 1GCPA 1PHTA 2CH4W 2D8HA 1WIEA 2KT1A 1ABQA 3NMZC 2K9GA 1JQQA 2CSIA 1YP5A 1QLYA 1NYGA 1X2KA 2DYBA 2DX1A 2GTJA 2HBWA 2JM9A 3VS0A 1I07A 2MIOA 3H41A 1GL5A 1SRLA 2ABLA 3R6NA 1QWFA 4JJCA 1KFZA 2K7AA 2P4RA 2DNUA 1CKAA 2FPDA 1GRIA 5FWCA 2KRMA 4GBQA 4J9DA 3M0PA 2BZYA 1YWOA 4OMQA 4CC3A 1FYNA 2X3WD 2LJ3A 2DL8A 2GBQA 2RF0A 3EG1A 1EFNA 1WA7A 1GFCA 1ZUKA 2JT4A 4LUEA 1XOVA 1S1NA 4J9EA 2HSPA 2E5KA 3NHNA 1PRLC 1A0NB 1B3QA 2RQRA 3EHRA 1ARKA 2DL3A 2HDAA 1K4US 1Y0MA 2BTTA 4EIKA 5FWBA 1GCQC 2AKLA 4F14A 2L3SA 2LQNA 2FRWA 3H0FA 1ZUUA 2FEIA 4AFSC 2JXBA 2RNAA 5EC7A 1HD3A 4A63B 2KRNA 1U3OA 3A98A 1T0HA 4OMMA 1RLPC 2J6KA 2C0IA 4GLMA 3RBBB 4RTXA 2GQIA 3VS1A 1ZX6A 1QKXA 1NEGA 4Y92A 2ECZA 2MCNA 3VS4A 2QDLA 1OEBA 2CUBA 2DMOA 2W0ZA 4HVUA 1M8MA 4HXJA 2L0AA 4LUDA 3ZL7C 2YSQA 3QWYA 2LMJA 5L23A 1YNZA 2KEAA 2C0TA 2J6FA 2RQUA 2H8HA 2DL5A 1W1FA 1YCSB 3EG0A 1VYUA 2ED0A 1GFDA 5IH2A 1WXBA 4J9GA 4RTUA 1G2BA 2KE9A 2KROA 1SEMA 1AZGB 1NEBA 2FPFA 2VVKA 2EGCA 1MV0B 2J7IA 3VS2A 2YT6A 2YUOA 5GJWB 2O88A 2EYYA 2RN8A 4JZ3A 5IXBA 3C0CA 3PE0A 2KXCA 2JM8A 3VS7A 1UFFA 2K6DA 2D0NA 1ZLMA 2PTKA 2EGAA 1T3SA 1SHGA 1VYTA 1ZSGA 3UA7A 4DEXA 1BK2A 1OV3A 2RPNA 1CSKA 2JMCA 2O9VA 2W10A 2KYBA 2EQIA 2A36A 1JXMA 2DLPA 2D8JA 1WI7A 2AZVA 2EBPA 2EYZA 1K0SA 2F2WA 1CKBA 1KSWA 1NM7A 4CC2A 2CSQA 2V1RA 1AWOA 1UHFA 4JPBW 1AOJA 3GBQA 1UDLA 4D8KA 1MUZA 2EGEA 2ROTA 4RUGA 2LX7A 3EG2A 4RTWA 3IQLA 1M3AA 2JMAA 4AG1C 1QWEA 2OI3A 1M3BA 4AFZC 1TUDA 2JS2A 2VKNA 2YUQA 1K9AA 3FJ5A 1PKTA 1ZUYA 2IIMA 1BB9A 2J06A 4ZNXA 1K0XA 4DEYA 2RQVA 1U06A 2K3BA 2GNCA 4OMPA 4WCIA 2A08A 3CQTA 1AWJA 4RTTA 1X43A 2JTEA 1JU5C 1WYXA 2CT4A 2X3XD 4IIMA 1NG2A 2EW3A 5HCKA 1NYFA 4HVWA 2NWMA 2KRSA 3M0QA 3VRYA 4R0KA 2GTOA 1WFWA 1X2QA 1Z9QA 3M0TA 2EYWA 2PNIA 5GJVB 1OPKA 2JS0A 2L3QA 2XMFA 2MOXA 4HCKA 4J9FA 1GBQA 2G6FX 4J9HA 1JEGA 2DBMA 5ECAA 1G83A 2LNHB 5IXFA 1HSQA 4JZ4A 4OMNA 3NGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS6 A;  2SRC A;  3REA B;  4OMO A;  1AZE A;  1FMK A;  1AWX A;  2JW4 A;  2YDL A;  1K76 A;  2J6O A;  4AG2 C;  1I0C A;  1OOT A;  2EVR A;  1M30 A;  2M0Y A;  3EG3 A;  2CH4 A;  1PWT A;  5FW9 A;  1PRM C;  1UUE A;  2KNB B;  4OML A;  2DJQ A;  2KXD A;  4Z89 A;  3H0H A;  4ESR A;  1IO6 A;  2LQW A;  3THK A;  1M27 C;  2OJ2 A;  1H92 A;  1W6X A;  2AZS A;  3NPF A;  2DA9 A;  2I0N A;  2LCS A;  1X6G A;  1UEC A;  2DE0 X;  2KGT A;  4J9C A;  3M0U A;  3I9Q A;  1QCF A;  2L2P A;  1GBR A;  4Z8A A;  3I35 A;  3TSZ A;  1VYV A;  2RMO A;  1K1Z A;  2OAW A;  1E7O A;  4RTZ A;  4KRT A;  1M3C A;  1RLQ C;  2AK5 A;  1H3H A;  1WDX A;  2CUD A;  1AD5 A;  1UTI A;  5I22 A;  2DIL A;  5IHI A;  2LJ1 A;  4K11 A;  1Y57 A;  1X6B A;  3H0I A;  3KFV A;  2BZX A;  4RTV A;  1GCQ A;  2EPD A;  3O5Z A;  2CRE A;  1UHC A;  2A28 A;  2C0O A;  1SHF A;  2HCK A;  3TVT A;  2O2O A;  2K79 A;  2BZ8 A;  3VS3 A;  1WXT A;  1UJY A;  4M4Z A;  4ORZ A;  1T0J A;  2KYM A;  1AVZ C;  1ZBJ A;  4LNP A;  1NLO C;  2ENM A;  1WXU A;  4CC4 B;  4AFQ C;  3VS5 A;  4IIO A;  2F2X A;  4Z88 A;  2YUN A;  4JJB A;  2L3P A;  1UJ0 A;  4D8D A;  1Z9Z A;  2LP5 A;  2RQT A;  4RTY A;  1QKW A;  2RQW A;  1AWW A;  1SSH A;  4FSS A;  2GGR A;  1KIK A;  1BU1 A;  4F17 A;  3EGU A;  1RUW A;  1J3T A;  4J9I A;  1VA7 A;  1PNJ A;  2V1Q A;  2F2V A;  3I5S A;  4JJD A;  1H8K A;  1WX6 A;  5IHN A;  1BBZ A;  2A37 A;  1UE9 A;  3ULR B;  1X27 A;  1SRM A;  2DL4 A;  1PKS A;  1KJW A;  2FRY A;  2KBT A;  2EKH A;  2DM1 A;  2NUZ A;  4HVV A;  2DBK A;  3UF4 A;  3PVL A;  2HEQ A;  2KT8 A;  2LJ0 A;  1JO8 A;  1AEY A;  4E6R A;  2DRK A;  2AKK A;  3I5R A;  2DL7 A;  3U23 A;  3TSW A;  2K2M A;  4CC7 A;  2DF6 A;  1X69 A;  2CDT A;  3PVQ A;  4F16 A;  1TUC A;  2CT3 A;  1JXO A;  2M51 A;  2ROL A;  2YUP A;  3QWX X;  4QT7 A;  2O9S A;  1ABO A;  1U5S A;  3UAT A;  1N5Z A;  3M0R A;  1YN8 A;  1NLP C;  2LZ6 B;  2O31 A;  4AFU C;  2PZ1 A;  3SEM A;  1MV3 A;  1RI9 A;  4X1V A;  1E6G A;  3RNJ A;  1HJD A;  1UGV A;  3SHW A;  3JV3 A;  1V1C A;  2DRM A;  2KR3 A;  3UA6 A;  3REB B;  4LN2 A;  2EYX A;  2FG0 A;  2J05 A;  2D1X A;  3EHQ A;  3VRZ A;  1WLP B;  2FO0 A;  4J9B A;  1LCK A;  1OPL A;  3M0S A;  2DVJ A;  1UG1 A;  1W70 A;  2FPE A;  2SEM A;  1I1J A;  1T3L A;  2VWF A;  4LE9 A;  5IHK A;  1YWP A;  1SPK A;  3LH5 A;  2ED1 A;  1E6H A;  1TG0 A;  1B07 A;  2B86 A;  5I11 A;  2ESW A;  1GCP A;  1PHT A;  2CH4 W;  2D8H A;  1WIE A;  2KT1 A;  1ABQ A;  3NMZ C;  2K9G A;  1JQQ A;  2CSI A;  1YP5 A;  1QLY A;  1NYG A;  1X2K A;  2DYB A;  2DX1 A;  2GTJ A;  2HBW A;  2JM9 A;  3VS0 A;  1I07 A;  2MIO A;  3H41 A;  1GL5 A;  1SRL A;  2ABL A;  3R6N A;  1QWF A;  4JJC A;  1KFZ A;  2K7A A;  2P4R A;  2DNU A;  1CKA A;  2FPD A;  1GRI A;  5FWC A;  2KRM A;  4GBQ A;  4J9D A;  3M0P A;  2BZY A;  1YWO A;  4OMQ A;  4CC3 A;  1FYN A;  2X3W D;  2LJ3 A;  2DL8 A;  2GBQ A;  2RF0 A;  3EG1 A;  1EFN A;  1WA7 A;  1GFC A;  1ZUK A;  2JT4 A;  4LUE A;  1XOV A;  1S1N A;  4J9E A;  2HSP A;  2E5K A;  3NHN A;  1PRL C;  1A0N B;  1B3Q A;  2RQR A;  3EHR A;  1ARK A;  2DL3 A;  2HDA A;  1K4U S;  1Y0M A;  2BTT A;  4EIK A;  5FWB A;  1GCQ C;  2AKL A;  4F14 A;  2L3S A;  2LQN A;  2FRW A;  3H0F A;  1ZUU A;  2FEI A;  4AFS C;  2JXB A;  2RNA A;  5EC7 A;  1HD3 A;  4A63 B;  2KRN A;  1U3O A;  3A98 A;  1T0H A;  4OMM A;  1RLP C;  2J6K A;  2C0I A;  4GLM A;  3RBB B;  4RTX A;  2GQI A;  3VS1 A;  1ZX6 A;  1QKX A;  1NEG A;  4Y92 A;  2ECZ A;  2MCN A;  3VS4 A;  2QDL A;  1OEB A;  2CUB A;  2DMO A;  2W0Z A;  4HVU A;  1M8M A;  4HXJ A;  2L0A A;  4LUD A;  3ZL7 C;  2YSQ A;  3QWY A;  2LMJ A;  5L23 A;  1YNZ A;  2KEA A;  2C0T A;  2J6F A;  2RQU A;  2H8H A;  2DL5 A;  1W1F A;  1YCS B;  3EG0 A;  1VYU A;  2ED0 A;  1GFD A;  5IH2 A;  1WXB A;  4J9G A;  4RTU A;  1G2B A;  2KE9 A;  2KRO A;  1SEM A;  1AZG B;  1NEB A;  2FPF A;  2VVK A;  2EGC A;  1MV0 B;  2J7I A;  3VS2 A;  2YT6 A;  2YUO A;  5GJW B;  2O88 A;  2EYY A;  2RN8 A;  4JZ3 A;  5IXB A;  3C0C A;  3PE0 A;  2KXC A;  2JM8 A;  3VS7 A;  1UFF A;  2K6D A;  2D0N A;  1ZLM A;  2PTK A;  2EGA A;  1T3S A;  1SHG A;  1VYT A;  1ZSG A;  3UA7 A;  4DEX A;  1BK2 A;  1OV3 A;  2RPN A;  1CSK A;  2JMC A;  2O9V A;  2W10 A;  2KYB A;  2EQI A;  2A36 A;  1JXM A;  2DLP A;  2D8J A;  1WI7 A;  2AZV A;  2EBP A;  2EYZ A;  1K0S A;  2F2W A;  1CKB A;  1KSW A;  1NM7 A;  4CC2 A;  2CSQ A;  2V1R A;  1AWO A;  1UHF A;  4JPB W;  1AOJ A;  3GBQ A;  1UDL A;  4D8K A;  1MUZ A;  2EGE A;  2ROT A;  4RUG A;  2LX7 A;  3EG2 A;  4RTW A;  3IQL A;  1M3A A;  2JMA A;  4AG1 C;  1QWE A;  2OI3 A;  1M3B A;  4AFZ C;  1TUD A;  2JS2 A;  2VKN A;  2YUQ A;  1K9A A;  3FJ5 A;  1PKT A;  1ZUY A;  2IIM A;  1BB9 A;  2J06 A;  4ZNX A;  1K0X A;  4DEY A;  2RQV A;  1U06 A;  2K3B A;  2GNC A;  4OMP A;  4WCI A;  2A08 A;  3CQT A;  1AWJ A;  4RTT A;  1X43 A;  2JTE A;  1JU5 C;  1WYX A;  2CT4 A;  2X3X D;  4IIM A;  1NG2 A;  2EW3 A;  5HCK A;  1NYF A;  4HVW A;  2NWM A;  2KRS A;  3M0Q A;  3VRY A;  4R0K A;  2GTO A;  1WFW A;  1X2Q A;  1Z9Q A;  3M0T A;  2EYW A;  2PNI A;  5GJV B;  1OPK A;  2JS0 A;  2L3Q A;  2XMF A;  2MOX A;  4HCK A;  4J9F A;  1GBQ A;  2G6F X;  4J9H A;  1JEG A;  2DBM A;  5ECA A;  1G83 A;  2LNH B;  5IXF A;  1HSQ A;  4JZ4 A;  4OMN A;  3NGP A; 
#chains in the Genus database with same CATH topology
 1ZSZ C;  2SRC A;  1AWX A;  5GAN h;  4OB1 B;  2JW4 A;  4JUV A;  1K76 A;  5KYU A;  2R57 A;  1RAC B;  3G4S A;  2QDY B;  2HNI A;  1M30 A;  2FZC B;  2JTM A;  2K5I A;  4QW2 A;  8AT1 B;  2OTJ T;  3CPW P;  5FRN A;  3J80 E;  1R77 A;  2A3L A;  4C8Q F;  1UGR B;  2KXD A;  5DY9 A;  1Q86 C;  2PVG B;  4PK4 A;  4A4K A;  1M27 C;  2OJ2 A;  1H92 A;  2I2L A;  2LCS A;  2DEQ A;  2KVQ G;  2DE0 X;  3OYY A;  1Q7Y C;  3QBY A;  3EH2 A;  4J9C A;  1PD1 A;  4C92 D;  4F7U B;  4DQ2 A;  3GP8 A;  5I2M A;  1YIJ T;  4MDX A;  2PUK B;  4ME7 A;  2ZPE B;  1D3B A;  2KQW A;  2L3R A;  2Y4Y A;  3QDR B;  1UTI A;  2CP0 A;  5KYY B;  4M7D B;  1QW1 A;  2LJ1 A;  1Y57 A;  3H0I A;  1XQH A;  3JCM J;  1X6O A;  2EPD A;  3O5Z A;  5FRO A;  2A28 A;  2C0O A;  5HY6 A;  7AT1 B;  1WQ7 A;  3EGD B;  2XI9 A;  2D9T A;  2JUF A;  2RO0 A;  1KQ2 A;  4M4Z A;  3CD6 T;  2R5A A;  3CXC A;  6AT1 B;  2MAM A;  2QXF A;  2ENM A;  4QVC A;  2QEX A;  4D6W A;  2IPO B;  4DBQ A;  5GAN 8;  3RIR A;  1KD1 R;  2XG8 D;  2RQT A;  3A1P A;  4RTY A;  2OTJ Q;  5M9O A;  3CCJ T;  2MK5 A;  1YIT A;  2E70 A;  4MML A;  4J83 A;  3JCM c;  1RUW A;  3OS0 A;  2VB6 A;  3CCU A;  2E6Z A;  4J6Y A;  3HPW A;  3M59 A;  1ZA1 B;  1MGQ A;  1TS9 A;  1VQ8 A;  4M7D G;  4JJD A;  3O8V A;  1H8K A;  4M7D C;  1BI3 A;  1XNI A;  1P92 A;  4RG8 A;  2EKH A;  2DM1 A;  4HVV A;  4J7I A;  1XJW B;  2BE7 D;  2JNG A;  2P0K A;  3UF4 A;  2LJ0 A;  4P5N A;  1JO8 A;  1AEY A;  2NYS A;  1YIJ Q;  2FB7 A;  3CCS A;  3PNW C;  3TSW A;  3PVQ A;  2CDT A;  1TUC A;  2EKO A;  1JBM A;  5GAN j;  3RKX A;  2DYI A;  1VQN A;  1LPL A;  1M8V A;  2AT1 B;  3JSC A;  5LJ5 e;  4PJO C;  2GFU A;  3OYA A;  2LZ6 B;  4AFU C;  4A54 A;  2VYT A;  1Q86 R;  1MV3 A;  4M78 E;  5CKF A;  1PSE A;  3CD6 Q;  4JDS A;  1HJD A;  2PQW A;  2RHI A;  2KR3 A;  3M4G A;  4XTV A;  5C6S A;  5GAO q;  3M5A A;  3J81 E;  2FO0 A;  1OPL A;  3ASK A;  3CMA A;  4EMK C;  3CPW A;  3M0S A;  3G71 T;  2P84 A;  3SWN C;  5HK0 A;  1MMD A;  2Y4X A;  2SEM A;  1T3L A;  1TOV A;  4LE9 A;  1YWP A;  1PM3 A;  5GMK l;  2ED1 A;  4FM4 B;  3CCJ Q;  3EGX A;  3G1J A;  2B86 A;  3GNF B;  2CH4 W;  2VXE A;  2WSC E;  4ZN1 A;  1QVG S;  5A2Q E;  2X4W A;  5DLQ E;  4HCZ A;  1FMW A;  1WHJ A;  2DX1 A;  2HBW A;  4O6J A;  2JM9 A;  3FDR A;  1IRE B;  2V8I A;  3H41 A;  2DXU A;  3E19 A;  3QXE B;  4IUQ A;  2VGN A;  4A4H A;  1QWF A;  1MNE A;  4HT8 A;  4JJC A;  4NS5 A;  1W2B A;  3GLX A;  3VU3 C;  2QA4 T;  3L2Z A;  1VQM T;  2DNU A;  1RAG B;  4ZTJ A;  3OYL A;  4GBQ A;  4CC3 A;  1YJ9 T;  1K9M C;  2EQJ A;  2K2V A;  2X3W D;  3HFN A;  5D6X A;  2H3E B;  1OI1 A;  1WA7 A;  2CS7 A;  5CK9 A;  3BW1 A;  5LJ5 d;  3OW2 A;  1ZQ1 A;  3CC2 A;  1M2V A;  1XOV A;  4OB2 B;  4RKU E;  4PJO D;  2HSP A;  3EFR A;  2E5K A;  3NHN A;  4LDY A;  1JRI A;  1Q86 U;  5FU6 C;  4Q5W A;  3MO8 A;  5CKB A;  3OYE A;  2DTH A;  5FRM A;  2DIQ A;  2BTT A;  2QQR A;  2C06 A;  5FWB A;  1Q7Y U;  3MP1 A;  2AKL A;  3QPH A;  4F14 A;  4DA4 A;  2L3S A;  3A8M B;  3MP6 A;  3P8B B;  4EMG A;  3G71 Q;  1G3W A;  2KRN A;  4M7A C;  3A98 A;  2QA4 A;  4OMM A;  5LJ5 h;  2XD0 A;  4GLM A;  3RBB B;  2GQV A;  3URG A;  3VS1 A;  1NEG A;  4Y92 A;  1M90 C;  1SKU B;  2QDL A;  3P8H A;  5GAO p;  2CUB A;  1KQ1 A;  2LQK A;  3MCA B;  1NE8 A;  2WSF E;  3OYH A;  2RQU A;  2DL5 A;  2LC4 A;  2P4T A;  3JCM f;  3EG0 A;  2QA4 Q;  2ED0 A;  1M4Z A;  1VQM Q;  4J9G A;  3RUX A;  3NTI A;  2EAY A;  2GF7 A;  2KRO A;  1SEM A;  1YJ9 Q;  4E7L A;  2E6N A;  2PUO B;  2O88 A;  4LD6 A;  1QVG P;  1EIF A;  2HL3 A;  3DKM A;  5DM7 R;  4E7J A;  2KXC A;  1M1K R;  2B8A A;  2FZK B;  3GPL A;  2KK4 A;  1ZLM A;  3TRE A;  1LOJ A;  3P8D A;  3MJX A;  1BK2 A;  4OGC A;  2DJZ A;  1CSK A;  2QAS A;  2E1H A;  2W10 A;  2EWN A;  2M16 A;  3X25 B;  5CKD A;  2XDD A;  5GAM g;  2RHZ A;  2AZV A;  4AT1 B;  1QVF A;  4M7A D;  1D1C A;  1K0S A;  2F2W A;  1CKB A;  1KSW A;  2G3R A;  2YWW A;  3FB9 A;  3UWN A;  4CC2 A;  1UHF A;  4C5I A;  3CXC S;  2CZ7 B;  3JB9 G;  4RUG A;  3EG2 A;  4LXC A;  2FL7 A;  1KK7 A;  2OI3 A;  1M3B A;  4AFZ C;  5GAM f;  2AHJ B;  4XTW A;  2YUQ A;  2FHD A;  1PKT A;  4ZNX A;  2J06 A;  1TXQ A;  3BY7 A;  4M7D E;  1D09 B;  1AT1 B;  2HBP A;  2A08 A;  5AYF A;  1X43 A;  4E2F B;  2X3X D;  3BE3 A;  4BE2 A;  3I56 T;  1NG2 A;  4PJM A;  5HCK A;  4M78 B;  1NYF A;  4HVW A;  1VQP T;  2NWM A;  2KRS A;  1MMA A;  3LW5 E;  3M0Q A;  1GXI E;  1WHG A;  2YHT A;  5J39 A;  4XK8 E;  2ZPB B;  4E7Z A;  2OAU A;  2E3H A;  5FU7 B;  2DFU A;  2K57 A;  2PNI A;  3MET A;  4ZGJ B;  4ATO A;  2JS0 A;  4XTX A;  3V7R A;  2XMF A;  5LJ5 j;  5GAO n;  4J9F A;  2DVE A;  4PJO E;  1RAB B;  2K3Y A;  5IXF A;  1AHJ B;  3LGF A;  4R56 A;  3CC7 T;  2R5M A;  3A5Z B;  1R8O B;  1ZHI A;  4B9X A;  5I2S A;  1C1A A;  1Q82 C;  1G3T A;  2WAC A;  2J6O A;  1K9M U;  4AG2 C;  1OOT A;  2EVR A;  3OSS C;  2O01 E;  1Y7X A;  2DD4 A;  5GAN e;  1VQ4 T;  2KNB B;  4OML A;  4DOV A;  4Z89 A;  3QHS A;  1IB8 A;  5KCO A;  1YHQ A;  4M78 G;  1W6X A;  2AZS A;  2DA9 A;  2I0N A;  1W4S A;  4C92 B;  3CPW S;  3L1A A;  3CCR T;  1RI0 A;  1OUL A;  1QCF A;  3C12 A;  5FU7 C;  3TSZ A;  2LX9 A;  3I55 A;  1K73 R;  4BE0 A;  2HKN A;  1TSF A;  4M75 F;  2RJD A;  5GAO l;  1E7O A;  4RTZ A;  1M3C A;  1RLQ C;  3I56 Q;  3RMQ A;  1WDX A;  1AD5 A;  1VQP Q;  4M77 A;  4K11 A;  2F5T X;  3C94 A;  4C5G A;  1GCQ A;  5LJ3 h;  2CRE A;  1SHF A;  2HCK A;  3NTK A;  1W2B S;  2BZ8 A;  2KDS A;  1G3S A;  3VS3 A;  1WXT A;  1M90 U;  1ZSZ B;  2COZ A;  3E9F A;  4ORZ A;  9ATC B;  1ZBJ A;  4LNP A;  4N0A A;  1B34 B;  1WXU A;  3CC7 Q;  4CC4 B;  3OQ5 A;  1YJW T;  4IIO A;  3H8Z A;  2CKK A;  3KXT A;  3OW2 S;  2L3P A;  4C92 G;  2ZAE A;  1RL2 A;  4C92 C;  1LNX A;  1VQL A;  3MHX A;  3PT9 A;  2RQW A;  1VQ6 T;  4IUP A;  2RK2 A;  2GGR A;  3G6E T;  1BU1 A;  1VQK A;  4M7A E;  3EGU A;  1VQ4 Q;  4IUV A;  3N5B B;  1D1B A;  4PNO A;  1M9S A;  1VA7 A;  1PNJ A;  4VUB A;  1RAH B;  4A53 A;  1WX6 A;  4M75 D;  3LX7 A;  1VIE A;  3CCR Q;  2ZPH B;  3JCM Q;  1PKS A;  1KJW A;  5DLO A;  2KBT A;  2P0P A;  4M77 F;  3PVL A;  3INZ A;  2KT8 A;  4FSX A;  2JOY A;  3A8H B;  5D7U A;  3EG9 A;  3I5R A;  4C8Q G;  4N4H A;  2BUD A;  2DL7 A;  4YTL A;  2VXF A;  2KAF A;  1OYX A;  1IGQ A;  4C8Q C;  4F16 A;  2CT3 A;  2YUP A;  1S72 T;  2OX7 A;  2O9S A;  1ABO A;  1OU8 A;  3M0R A;  2F1L A;  4JJN K;  2MPX C;  2RJE A;  1RI9 A;  4X1V A;  3G6E A;  3JV3 A;  1V1C A;  2DRM A;  3J7A F;  3VJP A;  3REB B;  4LN2 A;  4ELY C;  2D1X A;  1LCK A;  1QQJ A;  1YJW Q;  2V8K A;  4OVA A;  2DXC A;  2V8J A;  1KC8 C;  1N9S A;  2PVO B;  1QVP A;  2VWF A;  2CP6 A;  3E9G A;  5LL6 S;  2EFI A;  2L8D A;  4E47 A;  1W2B P;  3LH5 A;  3SFM A;  1V76 A;  1VQ6 Q;  5D6W A;  1TG0 A;  1B07 A;  4IUR A;  2ESW A;  5GMK e;  1GCP A;  3G6E Q;  1WIE A;  2KT1 A;  3GOX A;  2CSI A;  2DYB A;  3VS0 A;  2M9U A;  1SRL A;  3OW2 P;  3D7S B;  2OTJ A;  4F7U A;  3V7C A;  1S72 A;  1QVF S;  1KFZ A;  2P4R A;  5FWC A;  1GRI A;  2RM4 A;  2KRM A;  1G8X A;  3QZ9 B;  1D0X A;  2BZY A;  3EH1 A;  1YWO A;  4OMQ A;  1G5V A;  3UDC A;  5KYY A;  1EX4 A;  4M7D A;  3GF5 A;  2LJ3 A;  2FZG B;  2RF0 A;  3X20 B;  3EG1 A;  3JCM X;  3R6O A;  4C8Q D;  1ACM B;  4PJO B;  4B6M A;  1NJI C;  2A0F B;  3RDV A;  2JT4 A;  1VQO T;  4LUE A;  4BI3 A;  3EGD A;  3HRU A;  2RHU A;  3TCJ A;  2QTV A;  2COW A;  1S72 Q;  1FX7 A;  2QAZ A;  4J7F A;  1YIJ A;  1WHL A;  1H3Z A;  3MEW A;  1U8R A;  1WHM A;  1K8A R;  4EMK B;  3KUF A;  1Y0M A;  1D0Z A;  2YRD A;  3SWN B;  4HCB A;  3RKY A;  1RAE B;  2FRW A;  1VOM A;  3A8L B;  3H0F A;  4CI0 C;  5KYX B;  3X28 B;  3UPU A;  4Y91 A;  3CD6 A;  2X4J A;  5LJ5 f;  1RLP C;  4PFP A;  4WF2 A;  4F7U F;  4C5H A;  4NL3 A;  2JJ9 A;  1QKX A;  3EFS A;  2QTX A;  2ECZ A;  3VS4 A;  4PJO G;  3HSB A;  3CBM A;  3PTA A;  5KE3 A;  4HXJ A;  4KUL A;  3QWY A;  2BE9 B;  3CCJ A;  2KEA A;  2C0T A;  2J6F A;  2HQE A;  2H8H A;  1W1F A;  1GFD A;  5IH2 A;  1WXB A;  3HKS A;  1RAI B;  2K5L A;  2KE9 A;  3M9Q A;  3OYB A;  1Q7Y R;  3VS2 A;  2YT6 A;  3VYH B;  5GMK h;  2YUO A;  4HA8 A;  5GJW B;  1I81 A;  1WNL A;  4PL6 A;  2RHY A;  3DB4 A;  5FU6 B;  4JZ3 A;  5IXB A;  1VQO Q;  4PJJ A;  2CYZ B;  3FJP A;  3PE0 A;  3CCE T;  3L2R A;  2K6D A;  1QVF P;  2LTO A;  2EGA A;  3RMS A;  1K8A U;  3OB9 A;  1R0C B;  1SHG A;  3UA7 A;  3SB2 A;  1OV3 A;  4LDU A;  2HSE B;  1IRX A;  2EQI A;  1NPR A;  4M7A B;  4C0G A;  2D8J A;  5GMK m;  4BY6 C;  3CBO A;  1N9R A;  3FC3 A;  1WJQ A;  2MMP A;  3LH0 A;  4RCC A;  2V1R A;  4C92 E;  4D8K A;  4KGV B;  2ROT A;  2LX7 A;  4QQ6 A;  3IQL A;  1LJO A;  3OYI A;  2BKD N;  1QWE A;  4C0Z A;  2QQA A;  4R55 A;  3G71 A;  1TUD A;  2VKN A;  3VUZ A;  4OB0 B;  4X9C A;  1ZUY A;  2CP5 A;  2IIM A;  2XDB A;  1K0X A;  1U1S A;  5A0G A;  1HXD A;  2DXT A;  2Z0W A;  1AWJ A;  3HL8 A;  2JTF A;  1JU5 C;  4FIB A;  4JRQ A;  1YI2 T;  5L8R E;  4FYW B;  2DTI A;  1KC8 U;  2DXB A;  4GY5 A;  4M7A G;  2FVU A;  5KYW B;  4R0K A;  1Q81 C;  3CCE Q;  5CVI A;  3JCM g;  4C8Q E;  5AT1 B;  1X2Q A;  1VQM A;  2EYW A;  1OPK A;  1YJ9 A;  4L6V 5;  4HCK A;  1TU0 B;  1FWZ A;  5IN1 A;  3MEV A;  2DBM A;  3OYN A;  5HKC A;  2QK0 A;  3CC4 T;  4IKF A;  2GCX A;  3ME9 A;  2ZGW A;  3REA B;  4OMO A;  1FMK A;  4X9D A;  2YDL A;  4O5V A;  1I0C A;  2QQS A;  1I8F A;  2CZ0 B;  2HZY A;  4JS5 A;  3SDZ A;  2M0Y A;  2XK0 A;  3CCQ T;  5FW9 A;  1PRM C;  5J26 A;  1TUG B;  1G3Y A;  3QYG B;  1IGU A;  4A4G A;  4ESR A;  1IO6 A;  5GMK j;  4AMC A;  2LQW A;  1I4K 1;  1YI2 A;  4DBH A;  3HRT A;  1Y96 B;  1FXX A;  3BFM A;  1X6G A;  3G7Z A;  4BDY A;  1RAA B;  1UEC A;  4KT0 E;  4MMK A;  4FU6 A;  2KGT A;  5GAN 3;  4RG2 A;  4J5Y A;  1GBR A;  3RER A;  1HK9 A;  2FYK A;  4Z8A A;  1X01 A;  5A0L A;  1K1Z A;  4XTZ A;  1C6V X;  4LDW A;  4X34 A;  1YI2 Q;  3OYK A;  2K5F A;  2DIL A;  4WTO B;  3OBY A;  2ZZD A;  4OF1 A;  4XTU A;  4QKU A;  5IHI A;  1M1G A;  1X6B A;  4FT2 A;  3KFV A;  1K9M R;  2BZX A;  4RTV A;  1U1T A;  4KBM B;  3C4S A;  3TVT A;  2E12 A;  3MEA A;  2MWP A;  1OZ2 A;  2M02 A;  2O2O A;  3JCM P;  2DET A;  1N6A A;  1TWB A;  1UJY A;  2EQU A;  3A8O B;  3RR6 A;  2LVM A;  1T0J A;  1YCY A;  2VUB A;  1VQ7 T;  5LJ3 e;  2NUT B;  2RI2 A;  1NLO C;  3CC4 Q;  3ZFJ A;  2O4X B;  5FLX E;  4PFO A;  5HK3 A;  4AFQ C;  3VS5 A;  4Z88 A;  2YUN A;  4JJB A;  3QO3 A;  4RMO A;  1Z9Z A;  2LP5 A;  4QQG A;  3CME T;  1N27 A;  3CCQ Q;  1AWW A;  1OQK A;  1SSH A;  4FSS A;  1VQ9 T;  1PCX A;  4QVD A;  1KIK A;  4DBR A;  3LWH A;  2VV5 A;  4F17 A;  3JB9 F;  3OYM A;  1J3T A;  4M75 B;  5GAN g;  4J9I A;  3L42 A;  2V1Q A;  3X26 B;  1YJN T;  4FYV B;  3I5S A;  2NUP B;  4FCY A;  1QCN A;  5IHN A;  1UGQ B;  4MZT A;  1UE9 A;  3ULR B;  1JB0 E;  2DO3 A;  2FRY A;  1M90 R;  2ZPG B;  2NUZ A;  4N4I A;  5C0M A;  2LRQ A;  2HQH A;  4ZTF A;  1RAD B;  2HEQ A;  3OS2 A;  4M78 A;  5CKH A;  5A0D A;  3HTR A;  2KSS A;  5GAN f;  3BDL A;  2AKK A;  4TVR A;  1QP2 A;  2E4H A;  3U23 A;  1PG5 B;  2K2M A;  3VYG A;  1EZZ B;  3JCM V;  1JXO A;  3ER0 A;  2M51 A;  2ROL A;  2DER A;  4QT7 A;  2RA2 A;  1U5S A;  1Q95 G;  2E5Q A;  4C0D C;  3UAT A;  4C0F A;  1KG1 A;  5CQY A;  3CME A;  1NLP C;  2O31 A;  2VC8 A;  5LJ3 d;  2RI3 A;  3SEM A;  1VIF A;  3I56 A;  2QQ9 A;  1VQP A;  1UGV A;  1V29 B;  4UC4 A;  1VQ7 Q;  1YBY A;  3EFO B;  3OMC A;  2FG0 A;  5KH6 A;  1JJ2 P;  4M75 G;  3VRZ A;  4J9B A;  4M75 C;  2COY A;  2OTL T;  2X35 A;  1WJR A;  2XHC A;  1YJN A;  3WXM B;  5J3B A;  4DBF A;  2Y90 A;  2HQX A;  2DVJ A;  1W70 A;  1I1J A;  2QGF B;  3CME Q;  2DPP B;  5IHK A;  1SPK A;  4B9W A;  4FT4 A;  1E6H A;  4ANJ A;  1VQ5 T;  1VQ9 Q;  3ZEH A;  1PHT A;  3RKW A;  3SD4 A;  1PD0 A;  3CC7 A;  1ABQ A;  4EDU A;  1WHK A;  5GAM d;  4C92 A;  3QKJ A;  2K9G A;  2RJC A;  3OYF A;  4M78 F;  1YJN Q;  1O9S A;  2BIV A;  2YRV A;  1I07 A;  1GL5 A;  3R6N A;  2LNV A;  2DZ9 A;  3OYG A;  2LCL A;  4FW2 A;  4Z02 A;  2K7A A;  1VQ4 A;  4E7K A;  4C8Q B;  1QCO A;  3EAE A;  2K3X A;  3M57 A;  2DL8 A;  1EFN A;  4PJN A;  4JLI A;  2KI7 A;  1UGP B;  1GFC A;  4RCB A;  2PU9 B;  5CKE A;  3CCR A;  3CCM T;  2IG0 A;  3PFS A;  2EJG A;  2CGH A;  5GAM h;  1ZSZ A;  3JB9 H;  2RK1 A;  1PRL C;  3PGG A;  1A0N B;  5I21 A;  1B3Q A;  3QDF A;  3M58 A;  3MP8 A;  3EHR A;  1FMV A;  3G4S T;  1ARK A;  4BD3 A;  2V26 A;  1VQ5 A;  1B34 A;  2HDA A;  4M77 C;  5CO7 A;  4XU3 A;  1WHH A;  1KD1 C;  1GCQ C;  4FL6 A;  2OTL Q;  1PC0 A;  1ZA2 B;  1ZUU A;  4KH1 B;  2JXB A;  2RNA A;  5EC7 A;  1H64 1;  2L5Q A;  4QVZ A;  1HD3 A;  4A63 B;  3VUB A;  1U3O A;  2EYQ A;  1T0H A;  4N0A C;  5KYU B;  3AT1 B;  3Q1J A;  2C0I A;  1VQ5 Q;  1Q82 R;  1BIB A;  2GQI A;  1ZX6 A;  5CR2 A;  2LDM A;  2X4Y A;  1YJW A;  2MCN A;  3S6W A;  4KH0 B;  1OEB A;  4L5G A;  2DMO A;  2GFA A;  1IHW A;  4XAX B;  3ZL7 C;  5CQX A;  2LMJ A;  1VQ6 A;  1Y71 A;  5L23 A;  1KQS P;  5CCA A;  1VYU A;  4RTU A;  5IAY A;  1G2B A;  2VVK A;  2J7I A;  3L2Q A;  2RB6 A;  4JRK A;  3QSU A;  2RN8 A;  1D3B B;  3CCM Q;  1BI2 A;  2DAQ A;  3C0C A;  2QEX T;  1OU9 A;  2ATC B;  2JM8 A;  3VS7 A;  5GAN 4;  1UFF A;  2E64 A;  2D0N A;  4MZM A;  4PJL A;  3PMT A;  1JJ2 A;  3G4S Q;  4M77 D;  1ZSG A;  1VYT A;  4DEX A;  5GAN 5;  2RPN A;  2DIG A;  4IUT A;  4HKE A;  1YIT T;  4ZGE B;  1D0Y A;  2JMC A;  2O9V A;  3A8G B;  3PIP A;  5LJ3 j;  2A36 A;  1JXM A;  3FLG A;  3CCU T;  3OYJ A;  2DLP A;  1WJS A;  3QG1 A;  1VQ8 T;  3M55 A;  5KE2 A;  2EBP A;  2EYZ A;  2YLC A;  2JN0 A;  3CBP A;  1Q82 U;  1MMN A;  1AWO A;  3V8L A;  2F5K A;  2LQ8 A;  3OA6 A;  2MI6 A;  1MUZ A;  1C0M A;  2EGE A;  4OB3 B;  1M3A A;  2JMA A;  4E7S A;  1TH7 A;  4EMH A;  2QI2 A;  3CCS T;  2K4Y A;  4N4G A;  2MF2 A;  5D6Y A;  1K9A A;  3FJ5 A;  5GAM j;  5LJ5 g;  4DEY A;  1SG5 A;  2RQV A;  1U06 A;  1VQN T;  4OMP A;  1KHI A;  3X24 B;  3CQT A;  4RTT A;  4CRI A;  2JTE A;  2M1H A;  4PJO A;  2RD1 A;  1WYX A;  2CT4 A;  4J6X A;  1SSF A;  4F7U G;  2EW3 A;  2CZ1 B;  1QMC A;  2CP2 A;  3VRY A;  1BCM A;  3QYH B;  4BI4 A;  2GTO A;  2QEX Q;  3CPF A;  3F70 A;  3CMA T;  2L89 A;  3M0T A;  2XKO C;  4EMK A;  2L3Q A;  3S3N A;  4ZN3 A;  1GBQ A;  1LVK A;  3SWN A;  4BI8 B;  2DTO A;  1JEG A;  2P0Q A;  2LNH B;  4BY6 B;  3V8J A;  3HP9 A;  4M7D F;  1YIT Q;  1HSQ A;  3TEE A;  3VV0 A;  5KYX A;  1UEB A;  1VQO A;  4JZ4 A;  4OMN A;  3VS6 A;  3FIF A;  4PFZ A;  2LT4 A;  4XU2 A;  3CCU Q;  1AZE A;  4L59 A;  1VQ8 Q;  4M75 E;  2D6F A;  3EG3 A;  2CH4 A;  3MEU A;  8ATC B;  2M0O A;  3S3M A;  1PWT A;  1WGS A;  3NFC A;  1UUE A;  2KY9 A;  4JRP A;  2DJQ A;  3H0H A;  1KC8 R;  3EGX B;  3THK A;  3UT1 A;  1KQS A;  3NPF A;  2JVV A;  4PJO F;  3CCS Q;  3L2U A;  2EJF A;  4NL2 A;  3M0U A;  3I9Q A;  2L2P A;  3CC2 T;  3OY9 A;  5GAN 2;  1VQN Q;  1KD1 U;  3I35 A;  2AIR B;  1VYV A;  2RMO A;  2MYS A;  4JLG A;  2OAW A;  4KRT A;  1M1K C;  3M56 A;  2AK5 A;  1H3H A;  2CUD A;  5I22 A;  4JS4 A;  3QUI A;  2HD0 A;  5GMK i;  1Y07 A;  2QYZ A;  3DLL A;  1BCO A;  4LD9 K;  4M7D D;  1UHC A;  2EQK A;  2RHX A;  3CMA Q;  4II1 A;  1BKB A;  2K79 A;  1M2V B;  2VGM A;  3PIO A;  4XQ3 A;  1N8R C;  1NJI R;  4NOY A;  4MDW A;  1IZ6 A;  3E1S A;  2YXY A;  3HRS A;  5CAI A;  3QII A;  1QP3 A;  1BI1 A;  2KYM A;  4M7A A;  1AVZ C;  4KUI A;  3WVD B;  3TU4 K;  1DJ7 B;  3WVE B;  3MPU B;  2EQM A;  4KGX B;  3M54 A;  3CCE A;  4M77 E;  3GNG A;  2F2X A;  4BE1 A;  1UJ0 A;  4D8D A;  2X51 A;  3HFO A;  1QKW A;  1WQW A;  3V7S A;  1UB4 A;  2WSE E;  2YLB A;  2QQB A;  1R0B G;  2ZCF B;  1NBE B;  1KHC A;  1M5Q 1;  5KCH A;  2F2V A;  3OYC A;  4PLL A;  1BBZ A;  2A37 A;  1X27 A;  1SRM A;  2DL4 A;  1WZO A;  2VAS A;  3CC2 Q;  2DBK A;  2RH2 A;  5IT9 E;  3V8K A;  4E6R A;  2RI5 A;  2NLU A;  5EG2 A;  2LT1 A;  2DRK A;  5KYW A;  2E41 A;  4CC7 A;  2DF6 A;  1X69 A;  3H6Z A;  4M7A F;  4EPC A;  3QWX X;  1NJI U;  1N5Z A;  3JCM b;  3QJ6 A;  2EJ9 A;  1YN8 A;  1X75 C;  2PZ1 A;  4ELZ C;  1M2O A;  2DKG A;  3RNJ A;  1E6G A;  3SHW A;  3JRZ A;  3UA6 A;  2HMA A;  2EYX A;  3H9N A;  2J05 A;  5GAO r;  3EHQ A;  1WLP B;  5LJ3 g;  2DD5 A;  3L2W A;  3CCV T;  3VKI A;  3AHU A;  1UG1 A;  4MZP A;  3JCM e;  2FPE A;  4XTY A;  2A7Y A;  2D0Q B;  1XTD A;  2H3J A;  2XU8 A;  3MKD A;  4FYX B;  5I11 A;  1JJ2 S;  3CC4 A;  1Y96 A;  2D8H A;  4OP0 A;  4C5E A;  2MWO A;  3E2U A;  2E3I A;  3NMZ C;  1RAF B;  5LJ3 f;  1JQQ A;  3LGL A;  1YP5 A;  5CIU A;  1QLY A;  2LCC A;  3M4Y A;  1NYG A;  1X2K A;  3OBW A;  2GTJ A;  4J6W A;  1K73 C;  2MIO A;  1N8R R;  3CCQ A;  2ABL A;  2CP3 A;  2IVW A;  4F04 B;  1M1F A;  1CKA A;  2FPD A;  4J9D A;  3M0P A;  4E7I A;  3S3O A;  1FYN A;  2GBQ A;  4C0D B;  1MND A;  2HKQ B;  2JZ2 A;  1I5O B;  1ZUK A;  4LDV A;  3CCV A;  4F7U E;  4J9E A;  1S1N A;  1VUB A;  3GIB A;  3CEY A;  4OGE A;  1NZ9 A;  2RQR A;  3HHT B;  2NUT A;  4KUD K;  2HAX A;  2DL3 A;  2O4X A;  1Q81 R;  3OMG A;  1K4U S;  4PLI A;  4EIK A;  5GAM e;  2DZC A;  3ZBD A;  3RES A;  3C95 A;  2LQN A;  1O75 A;  1UGS B;  3JCM d;  2FEI A;  3CCV Q;  1YHQ T;  4AFS C;  4FYY B;  1IHV A;  4Y28 E;  3QZ5 B;  2DEU A;  3CCL T;  1OX9 A;  1M1K U;  3FEO A;  1SF9 A;  1NPP A;  1VQ7 A;  4PKC C;  2J6K A;  4M75 A;  4V2S A;  5GAN 7;  4RTX A;  3PMI A;  2NUP A;  3I55 T;  2CP7 A;  2XID A;  3BDU A;  2EIF A;  2HL5 C;  1N8R U;  2W0Z A;  1BI0 A;  4HVU A;  1M8M A;  2L0A A;  4KGZ B;  1PSF A;  4LUD A;  5KYN A;  2YSQ A;  4XU0 A;  1YNZ A;  1VQ9 A;  1YCS B;  3JCM h;  1B7T A;  3JB9 J;  2R58 A;  1AZG B;  1NEB A;  2FPF A;  2EGC A;  1MV0 B;  2ZPI B;  2EYY A;  3JB9 D;  1KQS S;  4BDZ A;  1F1B B;  1TTH B;  4M78 C;  4LDX A;  4M77 B;  1OX8 A;  1MMG A;  2XDP A;  4BUG A;  2RJF A;  3CCL A;  2PTK A;  2QGG A;  3LWI A;  1Q81 U;  1VQL T;  1T3S A;  3EFO A;  1ZBX A;  2E65 A;  1OZ3 A;  4JRI A;  2XIC A;  3FRN A;  1QVG A;  1VQK T;  2DK3 A;  4IUU A;  2KYB A;  3OSV A;  2KMT A;  2E10 A;  3CXC P;  1D1A A;  4FW1 A;  5GAO m;  1WI7 A;  1YHQ Q;  3QJY A;  3LLR A;  1I5L A;  3CCL Q;  1NM7 A;  2CSQ A;  2X4X A;  2YRC A;  4JPB W;  1AOJ A;  3GBQ A;  3JAM E;  1UDL A;  4J8O A;  4XU1 A;  4RTW A;  2OTL A;  4AG1 C;  3I55 Q;  3L2V A;  2F69 A;  1BIA A;  2JS2 A;  3LYI A;  1BB9 A;  4GLK A;  4C8Q A;  2GNC A;  2K3B A;  4M77 G;  4A4E A;  1IXD A;  3M53 A;  3NTH A;  4BB7 A;  4WCI A;  3TQ7 P;  3JB9 I;  1MHN A;  2X9H A;  1HYO A;  4OMF B;  3DB3 A;  5GAN d;  2PVD B;  4DOW A;  4BAC A;  4QQD A;  4IIM A;  3DLM A;  3OYD A;  1YFN A;  3OS5 A;  4HCC A;  3T9N A;  4C92 F;  4E7H A;  1WPY A;  3EG9 B;  1K8A C;  4M78 D;  3OS1 A;  2CZ6 B;  1WFW A;  3JCM W;  1Z9Q A;  5GJV B;  2MOX A;  4HT9 A;  2G6F X;  3KBG A;  4J9H A;  1BYM A;  1VQL Q;  4A4F A;  5ECA A;  1G83 A;  4ZGD B;  1K73 U;  2QG9 B;  5GAN 6;  3CCM A;  2ZPF B;  1VQK Q;  3NGP A; 
#chains in the Genus database with same CATH homology
 3VS6 A;  2SRC A;  3REA B;  4OMO A;  1AZE A;  1FMK A;  1AWX A;  2JW4 A;  2YDL A;  1K76 A;  2J6O A;  4AG2 C;  1I0C A;  1OOT A;  2EVR A;  1M30 A;  2M0Y A;  3EG3 A;  2CH4 A;  1PWT A;  5FW9 A;  1PRM C;  1UUE A;  2KNB B;  4OML A;  2DJQ A;  2KXD A;  4Z89 A;  3H0H A;  4ESR A;  1IO6 A;  2LQW A;  3THK A;  1M27 C;  2OJ2 A;  1H92 A;  1W6X A;  2AZS A;  3NPF A;  2DA9 A;  2I0N A;  2LCS A;  1X6G A;  1UEC A;  2DE0 X;  2KGT A;  4J9C A;  3M0U A;  3I9Q A;  1QCF A;  2L2P A;  1GBR A;  4Z8A A;  3I35 A;  3TSZ A;  1VYV A;  2RMO A;  1K1Z A;  2OAW A;  1E7O A;  4RTZ A;  4KRT A;  1M3C A;  1RLQ C;  2AK5 A;  1H3H A;  1WDX A;  2CUD A;  1AD5 A;  1UTI A;  5I22 A;  2DIL A;  5IHI A;  2LJ1 A;  4K11 A;  1Y57 A;  1X6B A;  3H0I A;  3KFV A;  2BZX A;  4RTV A;  1GCQ A;  2EPD A;  3O5Z A;  2CRE A;  1UHC A;  2A28 A;  2C0O A;  1SHF A;  2HCK A;  3TVT A;  2O2O A;  2K79 A;  2BZ8 A;  3VS3 A;  1WXT A;  1UJY A;  4M4Z A;  4ORZ A;  1T0J A;  2KYM A;  1AVZ C;  1ZBJ A;  4LNP A;  1NLO C;  2ENM A;  1WXU A;  4CC4 B;  4AFQ C;  3VS5 A;  4IIO A;  2F2X A;  4Z88 A;  2YUN A;  4JJB A;  2L3P A;  1UJ0 A;  4D8D A;  1Z9Z A;  2LP5 A;  2RQT A;  4RTY A;  1QKW A;  2RQW A;  1AWW A;  1SSH A;  4FSS A;  2GGR A;  1KIK A;  1BU1 A;  4F17 A;  3EGU A;  1RUW A;  1J3T A;  4J9I A;  1VA7 A;  1PNJ A;  2V1Q A;  2F2V A;  3I5S A;  4JJD A;  1H8K A;  1WX6 A;  5IHN A;  1BBZ A;  2A37 A;  1UE9 A;  3ULR B;  1X27 A;  1SRM A;  2DL4 A;  1PKS A;  1KJW A;  2FRY A;  2KBT A;  2EKH A;  2DM1 A;  2NUZ A;  4HVV A;  2DBK A;  3UF4 A;  3PVL A;  2HEQ A;  2KT8 A;  2LJ0 A;  1JO8 A;  1AEY A;  4E6R A;  2DRK A;  2AKK A;  3I5R A;  2DL7 A;  3U23 A;  3TSW A;  2K2M A;  4CC7 A;  2DF6 A;  1X69 A;  2CDT A;  3PVQ A;  4F16 A;  1TUC A;  2CT3 A;  1JXO A;  2M51 A;  2ROL A;  2YUP A;  3QWX X;  4QT7 A;  2O9S A;  1ABO A;  1U5S A;  3UAT A;  1N5Z A;  3M0R A;  1YN8 A;  1NLP C;  2LZ6 B;  2O31 A;  4AFU C;  2PZ1 A;  3SEM A;  1MV3 A;  1RI9 A;  4X1V A;  1E6G A;  3RNJ A;  1HJD A;  1UGV A;  3SHW A;  3JV3 A;  1V1C A;  2DRM A;  2KR3 A;  3UA6 A;  3REB B;  4LN2 A;  2EYX A;  2FG0 A;  2J05 A;  2D1X A;  3EHQ A;  3VRZ A;  1WLP B;  2FO0 A;  4J9B A;  1LCK A;  1OPL A;  3M0S A;  2DVJ A;  1UG1 A;  1W70 A;  2FPE A;  2SEM A;  1I1J A;  1T3L A;  2VWF A;  4LE9 A;  5IHK A;  1YWP A;  1SPK A;  3LH5 A;  2ED1 A;  1E6H A;  1TG0 A;  1B07 A;  2B86 A;  5I11 A;  2ESW A;  1GCP A;  1PHT A;  2CH4 W;  2D8H A;  1WIE A;  2KT1 A;  1ABQ A;  3NMZ C;  2K9G A;  1JQQ A;  2CSI A;  1YP5 A;  1QLY A;  1NYG A;  1X2K A;  2DYB A;  2DX1 A;  2GTJ A;  2HBW A;  2JM9 A;  3VS0 A;  1I07 A;  2MIO A;  3H41 A;  1GL5 A;  1SRL A;  2ABL A;  3R6N A;  1QWF A;  4JJC A;  1KFZ A;  2K7A A;  2P4R A;  2DNU A;  1CKA A;  2FPD A;  1GRI A;  5FWC A;  2KRM A;  4GBQ A;  4J9D A;  3M0P A;  2BZY A;  1YWO A;  4OMQ A;  4CC3 A;  1FYN A;  2X3W D;  2LJ3 A;  2DL8 A;  2GBQ A;  2RF0 A;  3EG1 A;  1EFN A;  1WA7 A;  1GFC A;  1ZUK A;  2JT4 A;  4LUE A;  1XOV A;  1S1N A;  4J9E A;  2HSP A;  2E5K A;  3NHN A;  1PRL C;  1A0N B;  1B3Q A;  2RQR A;  3EHR A;  1ARK A;  2DL3 A;  2HDA A;  1K4U S;  1Y0M A;  2BTT A;  4EIK A;  5FWB A;  1GCQ C;  2AKL A;  4F14 A;  2L3S A;  2LQN A;  2FRW A;  3H0F A;  1ZUU A;  2FEI A;  4AFS C;  2JXB A;  2RNA A;  5EC7 A;  1HD3 A;  4A63 B;  2KRN A;  1U3O A;  3A98 A;  1T0H A;  4OMM A;  1RLP C;  2J6K A;  2C0I A;  4GLM A;  3RBB B;  4RTX A;  2GQI A;  3VS1 A;  1ZX6 A;  1QKX A;  1NEG A;  4Y92 A;  2ECZ A;  2MCN A;  3VS4 A;  2QDL A;  1OEB A;  2CUB A;  2DMO A;  2W0Z A;  4HVU A;  1M8M A;  4HXJ A;  2L0A A;  4LUD A;  3ZL7 C;  2YSQ A;  3QWY A;  2LMJ A;  5L23 A;  1YNZ A;  2KEA A;  2C0T A;  2J6F A;  2RQU A;  2H8H A;  2DL5 A;  1W1F A;  1YCS B;  3EG0 A;  1VYU A;  2ED0 A;  1GFD A;  5IH2 A;  1WXB A;  4J9G A;  4RTU A;  1G2B A;  2KE9 A;  2KRO A;  1SEM A;  1AZG B;  1NEB A;  2FPF A;  2VVK A;  2EGC A;  1MV0 B;  2J7I A;  3VS2 A;  2YT6 A;  2YUO A;  5GJW B;  2O88 A;  2EYY A;  2RN8 A;  4JZ3 A;  5IXB A;  3C0C A;  3PE0 A;  2KXC A;  2JM8 A;  3VS7 A;  1UFF A;  2K6D A;  2D0N A;  1ZLM A;  2PTK A;  2EGA A;  1T3S A;  1SHG A;  1VYT A;  1ZSG A;  3UA7 A;  4DEX A;  1BK2 A;  1OV3 A;  2RPN A;  1CSK A;  2JMC A;  2O9V A;  2W10 A;  2KYB A;  2EQI A;  2A36 A;  1JXM A;  2DLP A;  2D8J A;  1WI7 A;  2AZV A;  2EBP A;  2EYZ A;  1K0S A;  2F2W A;  1CKB A;  1KSW A;  1NM7 A;  4CC2 A;  2CSQ A;  2V1R A;  1AWO A;  1UHF A;  4JPB W;  1AOJ A;  3GBQ A;  1UDL A;  4D8K A;  1MUZ A;  2EGE A;  2ROT A;  4RUG A;  2LX7 A;  3EG2 A;  4RTW A;  3IQL A;  1M3A A;  2JMA A;  4AG1 C;  1QWE A;  2OI3 A;  1M3B A;  4AFZ C;  1TUD A;  2JS2 A;  2VKN A;  2YUQ A;  1K9A A;  3FJ5 A;  1PKT A;  1ZUY A;  2IIM A;  1BB9 A;  2J06 A;  4ZNX A;  1K0X A;  4DEY A;  2RQV A;  1U06 A;  2K3B A;  2GNC A;  4OMP A;  4WCI A;  2A08 A;  3CQT A;  1AWJ A;  4RTT A;  1X43 A;  2JTE A;  1JU5 C;  1WYX A;  2CT4 A;  2X3X D;  4IIM A;  1NG2 A;  2EW3 A;  5HCK A;  1NYF A;  4HVW A;  2NWM A;  2KRS A;  3M0Q A;  3VRY A;  4R0K A;  2GTO A;  1WFW A;  1X2Q A;  1Z9Q A;  3M0T A;  2EYW A;  2PNI A;  5GJV B;  1OPK A;  2JS0 A;  2L3Q A;  2XMF A;  2MOX A;  4HCK A;  4J9F A;  1GBQ A;  2G6F X;  4J9H A;  1JEG A;  2DBM A;  5ECA A;  1G83 A;  2LNH B;  5IXF A;  1HSQ A;  4JZ4 A;  4OMN A;  3NGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...