1C6VX

Siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
55
structure length
55
Chain Sequence
b'KNSKFKNFRVYYREGRDQLWKGPGELLWKGEGAVLLKVGTDIKVVPRRKAKIIKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (SIV INTEGRASE)
molecule tags Dna binding protein
source organism Simian immunodeficiency virus
publication title X-ray structure of simian immunodeficiency virus integrase containing the core and C-terminal domain (residues 50-293)--an initial glance of the viral DNA binding platform.
pubmed doi rcsb
total genus 5
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 1999-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1c6vX00
1IHVA 1IHWA 1C0MA 1EX4A 1QMCA 4FW2A 4FW1A 1C1AA 1C6VX 5D7UA
chains in the Genus database with same CATH superfamily
1Q82R 4PJLA 1MV3A 2XI9A 2DJZA 5IHNA 1C6VX 4E7KA 1H3HA 2ENMA 2A37A 3J81E 4PFPA 2CUBA 1WHGA 3QWYA 3EGDA 3JCMV 3M4GA 2DILA 1FX7A 4C5GA 1GCQC 2YLCA 4ORZA 3CCUQ 4HA8A 1ZSZB 3HPWA 3HRTA 3WXMB 4R0KA 3CCQA 1IO6A 4TVRA 4C92E 2DXTA 1M90R 2KRMA 1CKBA 2RMOA 3ZFJA 2L0AA 4N4GA 2EGAA 5D7UA 4GY5A 3TU4K 5CIUA 5IN1A 3VS0A 1KQSA 1RAIB 4HCKA 3FC3A 4D6WA 5I21A 2EYQA 1PNJA 4OMMA 2E6ZA 3CCUT 3OYCA 1D1CA 3MP8A 3CD6T 2QEXA 4F04B 4BI4A 3JAME 1HYOA 2GQIA 2JUFA 3CBMA 1QVGS 4FSSA 2HMAA 2JOYA 1YJWT 2E41A 4ME7A 1K9MU 4C0ZA 1Q82U 2YUQA 3H6ZA 3LGLA 4EMKC 1VQ7A 2K2VA 3G1JA 4MZTA 4ZTFA 2A0FB 3VRZA 4C8QD 1M2VB 2E10A 2LJ1A 1D0ZA 5GAOr 3QDFA 4L5GA 7AT1B 2QA4Q 2XDDA 2FVUA 4C8QE 3M55A 2CT3A 1SSFA 3C95A 4F7UF 2KRSA 2M0YA 1UG1A 5LJ3e 1VQOA 4E47A 2YXYA 1K0XA 1SRLA 4LE9A 2RQWA 1MUZA 2J6KA 1M3AA 5GANf 4GBQA 3U23A 1U1TA 3HP9A 3JCMd 2RK1A 2M51A 4PJOE 1K8AC 2YDLA 2LT4A 2YHTA 1GFCA 5LJ3f 3NFCA 4R56A 2QK0A 4A4KA 3MPUB 4M7DD 1IXDA 3JCMf 1VQKA 2K79A 2KROA 5GAN5 1YFNA 1PSEA 3PFSA 1SHFA 3RKYA 1QKWA 2PVOB 1K73C 1JBMA 3E2UA 1OZ2A 1M5Q1 2EYXA 3NHNA 4J6WA 5A2QE 1VYUA 4OGEA 1R0BG 5GJVB 1QVGP 1XTDA 2HEQA 1ZSZC 1QKXA 3UA6A 1JB0E 2BZYA 1KC8R 2H3JA 2YRVA 3OYJA 2DJQA 2HSPA 1AHJB 3EGUA 2RI2A 2VC8A 4DBQA 1W1FA 1I07A 1UJYA 1RAHB 2DL3A 3JB9J 1RAAB 2IG0A 3NPFA 3OBWA 4L59A 4A4EA 2X35A 4AFUC 3CCST 1UB4A 2ZCFB 2K7AA 3RR6A 4LUDA 1WQ7A 3RNJA 5KYYA 1NEGA 1ZUUA 4RG2A 1H641 1YITT 4O5VA 1N9RA 4BE1A 5LJ5e 4F7UA 5GAN7 1YP5A 5IXFA 1OQKA 3NMZC 1TOVA 3J7AF 3OS1A 3M0RA 2EQMA 4OMPA 2BE7D 3ZL7C 1BK2A 4CC4B 5KYXB 2EQJA 4MDXA 1Q86C 3CCUA 3E9FA 2FZKB 5GANd 1VQPA 1YJWA 2CSIA 3G71T 4HCBA 4YTLA 1M1GA 4IIMA 3LW5E 2COWA 4FYYB 3CC2A 1N6AA 2KVQG 3I5SA 5CAIA 1RAEB 2L2PA 3QIIA 3DKMA 3SD4A 2BE9B 3EFOA 2KE9A 1M2VA 4FT2A 4XTYA 4DBHA 4RCBA 5GMKi 1FYNA 4JLIA 2C0OA 2LTOA 2QDYB 1OPLA 2VKNA 2EJFA 2CP7A 1ACMB 2EQKA 2QQBA 2HBPA 4ZGEB 2XDBA 2RQVA 3I55Q 1VIFA 3EG0A 3CBPA 4LD9K 4OMNA 1OEBA 3OW2A 1D0XA 1AWJA 3IQLA 3FRNA 1D1BA 4J9FA 1VQKT 3MP6A 3GLXA 5KYWA 2OTJQ 4FSXA 4RTXA 2DNUA 1NPRA 3QKJA 5KYXA 4KT0E 2DXCA 2JMCA 4XTUA 4C8QG 3I56Q 3PT9A 1SEMA 3C12A 4RMOA 3NGPA 3EG2A 3V7CA 2OAUA 4OMOA 3DLLA 4A54A 3VRYA 3OYNA 5LJ3h 2PNIA 4BD3A 1VQ8A 2VB6A 1VQ5A 1YWPA 4E7IA 4Q5WA 1ZSZA 1GRIA 3CEYA 3EH2A 3G6EQ 5KE3A 1TUDA 1TG0A 1WHHA 4VUBA 1JQQA 5CCAA 3CCSA 1M1FA 4UC4A 3ZBDA 5I11A 3EGDB 3CCLT 1WJSA 4XTVA 3CCRT 2LRQA 3OMGA 4PJNA 3TSWA 3H41A 1QCNA 4RTYA 3E1SA 5FU7C 2F2WA 2L3QA 5GAMg 1ARKA 4X9CA 3X26B 1IB8A 4F17A 1GL5A 4EDUA 4GLKA 1MMGA 2ECZA 1SSHA 5FLXE 4OB1B 2RQUA 2C0TA 2RQTA 5EC7A 2JZ2A 3G71A 1PRLC 3JCMX 4N0AA 1Q81R 2RH2A 1I5OB 3H0HA 2CP3A 2VUBA 4CC7A 4C8QF 3A1PA 2DTOA 2KRNA 1UGQB 3R6OA 2GQVA 2L3PA 3FLGA 4JDSA 2GGRA 3CCET 2OTJT 2WSCE 1K0SA 2KK4A 1AVZC 3ME9A 4ELYC 2VGMA 2RJDA 3HRSA 1VOMA 2KXDA 5GAOl 1WXTA 2BUDA 3CCMA 2MWPA 4FIBA 1PCXA 5LJ5g 1S72T 4BACA 1VQ4Q 3OSVA 1YNZA 2FO0A 3CCQQ 4OB2B 1GXIE 2J6OA 3CXCS 2XMFA 3HTRA 4IUQA 3G4SA 1F1BB 4M7DE 1VQMT 2L5QA 2V8IA 3GBQA 5D6YA 1KHCA 2DEQA 4KGZB 1U5SA 1YJWQ 1AWXA 3THKA 4KUDK 1QMCA 1KK7A 1FMVA 1X6GA 3M5AA 1BI0A 2YSQA 2JT4A 2E12A 5LJ3g 3UATA 4MZPA 4KH1B 2RHXA 1AD5A 4J7IA 2E5QA 1HSQA 1Y96B 2EJ9A 3OYYA 5CK9A 3LWHA 2MF2A 4M7AE 3PIOA 2JM9A 4ZN3A 4BDZA 2DD5A 4ESRA 2QQAA 1NLOC 1OU8A 3A8GB 3FB9A 2CH4W 3BY7A 1J3TA 2NUTB 1WYXA 1X69A 1QP2A 2O9SA 2ESWA 2ROTA 3J80E 4ZNXA 3PNWC 1NJIR 2WSEE 3RKXA 3JB9F 4C8QA 4RTTA 5IAYA 3KXTA 3KBGA 3WVDB 4ZTJA 4EMKB 1ABQA 2DBMA 2X51A 1Y7XA 4BI3A 3INZA 2LMJA 2LX9A 1M30A 3OMCA 4FW2A 5FRNA 2LCSA 2P84A 5ECAA 3FJPA 1VQ7T 2DIGA 2K3YA 4M77E 1M90C 3RMSA 3TQ7P 4EPCA 1D09B 1Q7YR 4X34A 3OYIA 5LJ5h 2XDPA 1UGSB 3URGA 1VQ5Q 1OX9A 2RJFA 1G3SA 4AT1B 1YJ9Q 1ZLMA 4QW2A 3S3MA 2OI3A 2LVMA 1KQ1A 1NG2A 3VS1A 1MNDA 4LDVA 1VQLA 2RA2A 1I8FA 4ELZC 2COYA 2W10A 4KBMB 2CDTA 1K73R 4IIOA 1NZ9A 2PQWA 1DJ7B 1G5VA 2D6FA 1VIEA 2QQRA 2H8HA 1BIBA 1ZSGA 2DX1A 1QCOA 4E6RA 2H3EB 3EG9A 3VYHB 3QYGB 2VWFA 4KRTA 2XG8D 1M3CA 3G4ST 1KC8C 5DLQE 4Y91A 2WSFE 4RTUA 3OYEA 1VQ9A 2CP6A 1KD1C 3QZ5B 3CC4T 1K73U 1YBYA 2DTHA 4HT9A 2CP0A 3UPUA 3CCJQ 2E3IA 3G7ZA 4QKUA 2M0OA 2D9TA 2QQSA 2ED0A 3CMAA 1RL2A 2JM8A 5GAN6 1P92A 3QO3A 4J9IA 1A0NB 1GCQA 4D8DA 1WHLA 3L2WA 4II1A 1LJOA 2D0NA 5IHIA 1Z9ZA 3OS0A 2KY9A 4M75C 3CPWA 5CKFA 2RNAA 3CCRA 1G8XA 3CD6A 3PTAA 2M02A 2LT1A 4F16A 1Q82C 2CZ6B 1QQJA 2MI6A 1UJ0A 1WI7A 2HL3A 1BI2A 3VV0A 2XICA 1N8RC 1VQ6A 1Z9QA 3LH5A 1TSFA 4PJOC 1JXMA 2XK0A 1YJNA 2NUZA 5KCOA 4NOYA 2BZXA 4LDXA 2K3BA 3CPWP 4E7JA 1M1KC 1WHKA 3OBYA 4M4ZA 2GNCA 1MMDA 4N4IA 1E7OA 1JXOA 2RHYA 4FYXB 4HVWA 1M8MA 1R77A 2LX7A 3DB3A 4FCYA 4MMLA 1YITQ 5HKCA 4NL2A 2DTIA 4LXCA 3PIPA 2VYTA 3MEVA 5DLOA 2HD0A 2RM4A 2E6NA 4RUGA 4N0AC 2FL7A 3I56T 2E1HA 4XU0A 5GANh 2VASA 1XNIA 4AMCA 3P8HA 2OTJA 2PU9B 2M9UA 3QZ9B 3M59A 1AWWA 4M7AG 2QASA 2VXEA 2OTLA 2DRMA 1ZUKA 2KBTA 1W70A 2CSQA 2X3WD 2DERA 4FW1A 1U3OA 4F14A 3CCVA 1N8RU 3EGXA 4M75G 1X01A 2HQXA 1V29B 4M7AD 1NLPC 1E6GA 5LJ5f 1YWOA 3OSSC 4XTXA 3CMAT 5D6XA 4J83A 3MP1A 2HQHA 3SWNB 2O88A 4RTVA 3EFSA 4M75A 3V8KA 3QSUA 1Y0MA 4FU6A 4P5NA 1RLQC 1TUCA 1MNEA 3LX7A 4M77G 4Z88A 5IHKA 2QQ9A 1BBZA 2GFUA 3BDLA 1BYMA 1WGSA 4C92C 3CC7Q 2DXUA 1VQ6T 3VS7A 4QVDA 4M78D 3MEUA 1OZ3A 2ATCB 5AT1B 1KFZA 2JTEA 3GNFB 4C0DB 2A08A 1YJ9T 1K4US 1CKAA 4FYVB 1W6XA 2LQNA 4EMHA 1YIJQ 5A0DA 2BIVA 3ASKA 3CMEQ 4BB7A 5GAOm 1WA7A 4XU2A 2XU8A 3M0QA 1IGUA 5IXBA 3JCMe 3M0SA 2OX7A 1VQPT 2IVWA 2DRKA 2J6FA 1SF9A 2D1XA 3TSZA 3NTHA 1GBQA 2D8HA 3SDZA 3OB9A 5KYUB 3G4SQ 1HXDA 2ED1A 1MV0B 5FW9A 2K4YA 4M78C 2YRCA 3CMEA 4M78B 2KI7A 1TH7A 2PTKA 3JCMW 4FL6A 4LD6A 2DL8A 2O9VA 3CCJT 1VYVA 2KT8A 2DK3A 2I0NA 4PJOF 3C0CA 2O4XB 3JCMh 1NJIC 3I9QA 1AZEA 3GP8A 2GBQA 1QVGA 2EVRA 2DZCA 1W2BA 3A8HB 3H0IA 3SB2A 2JN0A 2O31A 2DAQA 1VQOQ 4M7AC 4M75F 5GAMj 4HT8A 2NYSA 2KMTA 2CUDA 2HZYA 2YUNA 4FT4A 4C92G 4ZGDB 3L42A 3PVLA 2DA9A 2DZ9A 4JLGA 1VQPQ 4OMFB 3RIRA 1AOJA 1S72Q 5FU6B 1LVKA 2QTVA 3VU3C 1X2KA 3JCMJ 2F5KA 3S3OA 2CREA 3PVQA 2FZCB 2YLBA 2DMOA 3CCEQ 1BI1A 3PMIA 1H3ZA 1VQ8T 1K9AA 1T0HA 4RKUE 3I55A 4C92D 4DEYA 2CKKA 1ABOA 2EQUA 2EFIA 4J9BA 5LJ3j 2KNBB 5LL6S 3TREA 4C5IA 4FM4B 1MGQA 3A98A 2D0QB 1QP3A 1M8VA 4X9DA 5GAOq 3MO8A 3HFOA 1XOVA 5CQYA 2C06A 4M77B 1WNLA 4BUGA 2KR3A 1YJNT 1QCFA 3QBYA 2A3LA 4M77C 3CXCP 2VGNA 3QWXX 4ANJA 4JZ3A 2J7IA 3AT1B 4PNOA 3QDRB 2VXFA 1UHCA 2LJ0A 1BB9A 4A4GA 5GMKm 4JRIA 4RG8A 5HCKA 3FEOA 4B6MA 4XK8E 2GF7A 3OY9A 3LH0A 3V8LA 4L6V5 1S1NA 4CC2A 4PJOA 2CH4A 1PD1A 4XQ3A 1N27A 2V1QA 1YI2Q 4BY6C 6AT1B 1I81A 1PD0A 5GAOn 5KH6A 3CC7T 1I5LA 1AZGB 4DOWA 4J7FA 3OYHA 3M9QA 2EBPA 2LNHB 1OX8A 1KQSP 1UFFA 4M77D 3OW2S 3CCMT 5J26A 1TS9A 1BCOA 2KSSA 1Q86R 3JCMg 1BCMA 4OB3B 2DFUA 5AYFA 3L2VA 5GAMf 1IRXA 2RF0A 4CI0C 1PC0A 1BI3A 2G6FX 4M78G 5CQXA 4XU3A 1E6HA 3MKDA 1WQWA 1ZA2B 4M7DB 5DM7R 2DD4A 5M9OA 4F7UG 2QG9B 3FDRA 3OYLA 2WACA 4M7DG 4XAXB 4A63B 3L2QA 2ZAEA 1B34A 2JW4A 3JB9G 3O8VA 1M1KU 2FZGB 4PJMA 1GFDA 4HKEA 1BKBA 4M7AA 1RADB 1UHFA 2DYBA 4PFZA 2Y4XA 2F69A 2L3SA 2Y90A 2LCLA 2ZGWA 3UWNA 5CKDA 1QVFS 3RMQA 1HD3A 2PZ1A 2X3XD 2LNVA 2OAWA 3VJPA 5I2MA 1UDLA 3SWNA 2F1LA 2MPXC 1VQ9Q 1YN8A 4RTWA 1KD1R 3OYKA 4PJJA 1CSKA 2L89A 2GTOA 3HSBA 3CC4Q 4B9XA 3CCQT 4BI8B 4RTZA 2MCNA 4BY6B 2G3RA 2NUPA 4C92B 1FXXA 2EQIA 1WPYA 1NM7A 4ZGJB 2EYZA 1G3WA 1WJQA 4LDWA 4WF2A 2LP5A 1UGRB 3M56A 4B9WA 2DE0X 2X9HA 1H92A 1VYTA 1VQ8Q 2FPEA 4E7SA 1X43A 2DEUA 5GAN4 3VYGA 3PGGA 3H0FA 4CC3A 2XIDA 1IGQA 3R6NA 4O6JA 4C8QC 5FWBA 2CZ1B 2EW3A 2FPFA 2JVVA 3VUZA 4PLLA 1JJ2A 3SHWA 2F2XA 5GANj 1I1JA 4D8KA 9ATCB 1W2BP 3SFMA 1YIJA 1NPPA 3QHSA 4E7ZA 5KE2A 2KXCA 1VQOT 4JUVA 5FU7B 2AZVA 1MMAA 4NS5A 5A0LA 4V2SA 4J9GA 3UDCA 2YRDA 5KCHA 3M54A 1JJ2P 2DVJA 5L8RE 1VQ4T 4M78A 2AHJB 1O75A 4C5EA 1OOTA 5I22A 1RI0A 1M1KR 4M7DC 5GMKl 4Z8AA 1PHTA 1TTHB 2X4JA 1WXUA 3QJ6A 2HNIA 1N5ZA 1UECA 2HQEA 1ZHIA 5KYUA 1GBRA 2HSEB 3TVTA 1W2BS 4MMKA 3SEMA 3AHUA 3CC2Q 2E64A 3HKSA 1BU1A 1GCPA 1BIAA 4IUPA 4BE2A 2W0ZA 1PKTA 1B07A 3WVEB 8ATCB 1G3TA 3V7RA 2QGGA 2AKKA 4IUTA 1VQLQ 1VQ7Q 4HVVA 1YI2T 1D3BB 1MHNA 1KC8U 2ZPFB 3MCAB 3VS6A 3TEEA 2QGFB 2SEMA 3META 4OF1A 4X1VA 1NYGA 5IT9E 2EIFA 2E4HA 1OI1A 1VQ9T 2DETA 2B86A 1SPKA 3PMTA 3CD6Q 1JJ2S 2RHIA 3OA6A 3X20B 1IZ6A 1KD1U 1VQNA 2EYYA 3GIBA 1Y57A 3D7SB 2CYZB 2RHZA 4EIKA 2PVGB 5GMKh 2YT6A 1TXQA 2RN8A 1SG5A 2P4TA 3P8BB 2LDMA 1G3YA 3DLMA 2DXBA 1K8AR 2FEIA 3EAEA 2VVKA 1EFNA 3FJ5A 1LPLA 2COZA 4OVAA 5HK0A 3X28B 1QW1A 3LWIA 1WHMA 1K8AU 5HK3A 3JV3A 2K3XA 3EG1A 5GMKe 3RESA 4LUEA 2KAFA 2EAYA 4JRQA 1T3LA 1HJDA 3REBB 2CP5A 1UUEA 3CPWS 4M78F 3I56A 1D0YA 3QG1A 3VS4A 2HCKA 1YCYA 4AFQC 3CQTA 2ZPIB 2L8DA 1SKUB 3E19A 4JPBW 2AIRB 3S6WA 3NTIA 1N9SA 2LQ8A 3MHXA 4M7DA 4LNPA 1D3BA 2OTLT 4JS5A 2HDAA 3H8ZA 1B3QA 2CZ0B 2DO3A 2ZZDA 1C1AA 1W4SA 3CCJA 2LJ3A 1K9MC 5A0GA 1WZOA 2FYKA 3PE0A 5LJ5j 3GOXA 5GAMe 1FWZA 1N8RR 3CMAQ 1WDXA 1T3SA 1NYFA 4WCIA 2JJ9A 2EGCA 2ZPEB 1SHGA 3BFMA 1JU5C 2RPNA 1H8KA 3CCLQ 1LCKA 5CKHA 2O4XA 2ZPGB 3M4YA 3Q1JA 1VQMA 4DA4A 1EX4A 4M75E 2E70A 3OYMA 4Z02A 3REAB 2EKOA 1U8RA 1NE8A 2BZ8A 3UT1A 4A4HA 2KDSA 3JCMc 2K5IA 4HCZA 1LNXA 2CP2A 3QXEB 4QT7A 5GJWB 2X4WA 4PK4A 2JMAA 2DM1A 4QVCA 1VA7A 2KYBA 2P0KA 2MOXA 2JNGA 1YI2A 4LDYA 5LJ3d 2MMPA 1JO8A 3V7SA 1Y07A 3JCMQ 3LYIA 3OS5A 4Z89A 1QWEA 3OYDA 1NBEB 2EJGA 3M58A 2LQWA 2RHUA 2HL5C 3O5ZA 3EHRA 5CKEA 2L3RA 4C92A 4PLIA 2AZSA 4E7HA 4PJOB 1M9SA 4JS4A 3A8OB 1ZUYA 2MIOA 1K9MR 4J6YA 4R55A 4C0GA 1Y71A 1JRIA 2FB7A 1KIKA 2YUPA 4IUUA 4XU1A 2JXBA 2DYIA 4A4FA 1WXBA 2Y4YA 2KYMA 3CMET 5GAN8 1QVPA 2FPDA 2PUOB 2QDLA 4BDYA 4MDWA 3QJYA 4E7LA 1VQNQ 4GLMA 4M77F 1VQ4A 4J9HA 4QQGA 2MWOA 1RACB 2K5LA 2V26A 3EHQA 5J3BA 2CZ7B 3CC2T 4KUIA 4WTOB 3KFVA 2EPDA 5LJ5d 1B34B 1M2OA 4HXJA 4LDUA 1VQKQ 4MZMA 3P8DA 4JJBA 1YHQQ 1TUGB 2XD0A 1WLPB 4KGVB 2FRYA 2R58A 1KG1A 1WJRA 2A7YA 1IHVA 2F2VA 3JB9H 2K5FA 4J8OA 4PKCC 5GANe 1IREB 4RCCA 5EG2A 3RKWA 2DIQA 2P4RA 3OYGA 8AT1B 4N4HA 2DVEA 3MEAA 2V1RA 5FRMA 3CPFA 3HL8A 4E2FB 1Q95G 2V8JA 1YJNQ 4AFSC 3I35A 1XJWB 3VS3A 1PM3A 5J39A 5HY6A 2A36A 2IIMA 2RO0A 3MJXA 1OV3A 2QI2A 4DEXA 4IKFA 1KQSS 3HRUA 3A8LB 5C0MA 1KHIA 1PKSA 4C92F 2CT4A 1X75C 2NUTA 3G6EA 2B8AA 1V1CA 3GF5A 3QUIA 1VQNT 4DOVA 3EFRA 3C4SA 2EWNA 2CGHA 2LCCA 3HFNA 3VS2A 1FMKA 3OW2P 2E5KA 2A28A 2MK5A 3CCVQ 1IHWA 1UE9A 3S3NA 2XHCA 1VQMQ 4C0FA 3A8MB 4KGXB 1OU9A 2V8KA 5L23A 4M77A 1D1AA 2RK2A 1Q7YC 1B7TA 4M75D 1RAFB 1JEGA 3M0UA 3CC7A 1T0JA 1VUBA 1OYXA 1X6BA 1U1SA 1R0CB 1Q86U 4C0DC 4FYWB 1YITA 2OJ2A 1X2QA 1EZZB 4BE0A 4JZ4A 3C94A 1WX6A 4PJOD 4KH0B 3EGXB 1RLPC 3X24B 4KULA 1Q81C 4PL6A 4PFOA 2NUPB 3BW1A 1I4K1 3N5BB 3M0TA 2K57A 4DQ2A 5GMKj 3QPHA 2BTTA 4A53A 5DY9A 1RAGB 3LGFA 1ZQ1A 3CCEA 3EG3A 1M90U 2HKQB 4NL3A 4K11A 4J9CA 3M53A 2CS7A 2ZPHB 2MAMA 2DLPA 1VQLT 4OP0A 4DBFA 3JCMP 1KQ2A 4M7AB 1I0CA 3RDVA 3G71Q 2YUOA 2P0PA 5GANg 3VKIA 2DL5A 5GAOp 3CBOA 3JSCA 1KSWA 5FU6C 1NEBA 2RI3A 2AKLA 4CRIA 1FMWA 2FRWA 2PVDB 1Q81U 2K6DA 2DF6A 3CC4A 2DL4A 3TCJA 1MMNA 2PUKB 1PWTA 1QVFP 5GAMd 2QTXA 4IUVA 2QA4T 2X4YA 2RJEA 3OYAA 1K76A 2FG0A 3G6ET 2EGEA 3H9NA 1OULA 4QQ6A 3SWNC 2J05A 4ATOA 1YHQT 2JTFA 3OQ5A 2EKHA 4M7AF 2HBWA 2JTMA 1AT1B 2R57A 1YJ9A 1QVFA 4Y92A 1AWOA 1TU0B 1V76A 2NWMA 4IURA 1PRMC 3OYBA 1YCSB 2JS2A 1M27C 2RB6A 2C0IA 2X4XA 4AG2C 1VQ5T 3FIFA 1ZBJA 2M16A 3RBBB 4EMGA 2SRCA 4ZN1A 2LQKA 2DL7A 2RD1A 2HKNA 4JJNK 1HK9A 1G83A 3CCLA 3V8JA 2KT1A 4OB0B 3L2UA 2O2OA 3X25B 2R5MA 2FHDA 1LOJA 4M78E 3JCMb 3CCMQ 2R5AA 4OGCA 1ZBXA 1UGVA 3GNGA 4JJCA 4AG1C 4QQDA 2GFAA 2J06A 2RI5A 2K2MA 5CO7A 2QXFA 4OMQA 3UA7A 2ROLA 3LLRA 3GPLA 2QAZA 3M0PA 1VQ6Q 3CCVT 4AFZC 2IPOB 2P0QA 4J9DA 5CR2A 1RI9A 5IH2A 3EH1A 3I5RA 1PG5B 1Q7YU 3NTKA 1UTIA 2M1HA 2K9GA 2NLUA 1TWBA 1X27A 2AK5A 5GAMh 3JB9I 3OS2A 3E9GA 4F7UB 4OMLA 2QEXQ 2ZPBB 1XQHA 2E65A 3BDUA 5C6SA 5KYYB 3ER0A 1QWFA 3KUFA 1RABB 4PJOG 3I55T 2I2LA 2F5TX 2BKDN 1NJIU 3VS5A 1KJWA 4XTWA 3VUBA 2O01E 1ZX6A 1PSFA 2DBKA 3JRZA 5KYWB 1K1ZA 2D8JA 1WHJA 2JS0A 4HVUA 3M57A 5FROA 3L2RA 2YWWA 2QA4A 3L1AA 1WFWA 1UEBA 2KGTA 2QEXT 1M3BA 2LC4A 3RUXA 1Y96A 3T9NA 1ZA1B 4LN2A 1AEYA 3MEWA 2AT1B 5CKBA 2GCXA 2OTLQ 2GTJA 2XKOC 2ABLA 5CVIA 2QYZA 1YHQA 4C5HA 4EMKA 2MYSA 1EIFA 2KEAA 3EFOB 4J9EA 3BE3A 5I2SA 2EYWA 1C0MA 2KQWA 4C8QB 3OYFA 5GAN2 4J6XA 1U06A 1WIEA 4HCCA 4F7UE 1YIJT 3CXCA 4JRKA 5GAN3 1OPKA 1UGPB 2RQRA 1R8OB 1O9SA 2DKGA 3F70A 1RUWA 2RJCA 2VV5A 4XTZA 2HAXA 3UF4A 3CCSQ 2Z0WA 3EG9B 4DBRA 3QYHB 3ULRB 2LZ6B 4JJDA 1M4ZA 3RERA 3A5ZB 1X6OA 3ZEHA 4M75B 2E3HA 4J5YA 1S72A 4QVZA 3L2ZA 5FWCA 5KYNA 4Y28E 4JRPA 1QLYA 3JB9D 1SRMA 5D6WA 4M7DF 2DPPB 1G2BA 3CCRQ 3DB4A 3HHTB
chains in the Genus database with same CATH topology
1IHVA 1IHWA 1C0MA 1EX4A 1QMCA 4FW2A 4FW1A 1C1AA 1C6VX 5D7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHV A;  1IHW A;  1C0M A;  1EX4 A;  1QMC A;  4FW2 A;  4FW1 A;  1C1A A;  1C6V X;  5D7U A; 
#chains in the Genus database with same CATH topology
 1Q82 R;  4PJL A;  1MV3 A;  2XI9 A;  2DJZ A;  5IHN A;  1C6V X;  4E7K A;  1H3H A;  2ENM A;  2A37 A;  3J81 E;  4PFP A;  2CUB A;  1WHG A;  3QWY A;  3EGD A;  3JCM V;  3M4G A;  2DIL A;  1FX7 A;  4C5G A;  1GCQ C;  2YLC A;  4ORZ A;  3CCU Q;  4HA8 A;  1ZSZ B;  3HPW A;  3HRT A;  3WXM B;  4R0K A;  3CCQ A;  1IO6 A;  4TVR A;  4C92 E;  2DXT A;  1M90 R;  2KRM A;  1CKB A;  2RMO A;  3ZFJ A;  2L0A A;  4N4G A;  2EGA A;  5D7U A;  4GY5 A;  3TU4 K;  5CIU A;  5IN1 A;  3VS0 A;  1KQS A;  1RAI B;  4HCK A;  3FC3 A;  4D6W A;  5I21 A;  2EYQ A;  1PNJ A;  4OMM A;  2E6Z A;  3CCU T;  3OYC A;  1D1C A;  3MP8 A;  3CD6 T;  2QEX A;  4F04 B;  4BI4 A;  3JAM E;  1HYO A;  2GQI A;  2JUF A;  3CBM A;  1QVG S;  4FSS A;  2HMA A;  2JOY A;  1YJW T;  2E41 A;  4ME7 A;  1K9M U;  4C0Z A;  1Q82 U;  2YUQ A;  3H6Z A;  3LGL A;  4EMK C;  1VQ7 A;  2K2V A;  3G1J A;  4MZT A;  4ZTF A;  2A0F B;  3VRZ A;  4C8Q D;  1M2V B;  2E10 A;  2LJ1 A;  1D0Z A;  5GAO r;  3QDF A;  4L5G A;  7AT1 B;  2QA4 Q;  2XDD A;  2FVU A;  4C8Q E;  3M55 A;  2CT3 A;  1SSF A;  3C95 A;  4F7U F;  2KRS A;  2M0Y A;  1UG1 A;  5LJ3 e;  1VQO A;  4E47 A;  2YXY A;  1K0X A;  1SRL A;  4LE9 A;  2RQW A;  1MUZ A;  2J6K A;  1M3A A;  5GAN f;  4GBQ A;  3U23 A;  1U1T A;  3HP9 A;  3JCM d;  2RK1 A;  2M51 A;  4PJO E;  1K8A C;  2YDL A;  2LT4 A;  2YHT A;  1GFC A;  5LJ3 f;  3NFC A;  4R56 A;  2QK0 A;  4A4K A;  3MPU B;  4M7D D;  1IXD A;  3JCM f;  1VQK A;  2K79 A;  2KRO A;  5GAN 5;  1YFN A;  1PSE A;  3PFS A;  1SHF A;  3RKY A;  1QKW A;  2PVO B;  1K73 C;  1JBM A;  3E2U A;  1OZ2 A;  1M5Q 1;  2EYX A;  3NHN A;  4J6W A;  5A2Q E;  1VYU A;  4OGE A;  1R0B G;  5GJV B;  1QVG P;  1XTD A;  2HEQ A;  1ZSZ C;  1QKX A;  3UA6 A;  1JB0 E;  2BZY A;  1KC8 R;  2H3J A;  2YRV A;  3OYJ A;  2DJQ A;  2HSP A;  1AHJ B;  3EGU A;  2RI2 A;  2VC8 A;  4DBQ A;  1W1F A;  1I07 A;  1UJY A;  1RAH B;  2DL3 A;  3JB9 J;  1RAA B;  2IG0 A;  3NPF A;  3OBW A;  4L59 A;  4A4E A;  2X35 A;  4AFU C;  3CCS T;  1UB4 A;  2ZCF B;  2K7A A;  3RR6 A;  4LUD A;  1WQ7 A;  3RNJ A;  5KYY A;  1NEG A;  1ZUU A;  4RG2 A;  1H64 1;  1YIT T;  4O5V A;  1N9R A;  4BE1 A;  5LJ5 e;  4F7U A;  5GAN 7;  1YP5 A;  5IXF A;  1OQK A;  3NMZ C;  1TOV A;  3J7A F;  3OS1 A;  3M0R A;  2EQM A;  4OMP A;  2BE7 D;  3ZL7 C;  1BK2 A;  4CC4 B;  5KYX B;  2EQJ A;  4MDX A;  1Q86 C;  3CCU A;  3E9F A;  2FZK B;  5GAN d;  1VQP A;  1YJW A;  2CSI A;  3G71 T;  4HCB A;  4YTL A;  1M1G A;  4IIM A;  3LW5 E;  2COW A;  4FYY B;  3CC2 A;  1N6A A;  2KVQ G;  3I5S A;  5CAI A;  1RAE B;  2L2P A;  3QII A;  3DKM A;  3SD4 A;  2BE9 B;  3EFO A;  2KE9 A;  1M2V A;  4FT2 A;  4XTY A;  4DBH A;  4RCB A;  5GMK i;  1FYN A;  4JLI A;  2C0O A;  2LTO A;  2QDY B;  1OPL A;  2VKN A;  2EJF A;  2CP7 A;  1ACM B;  2EQK A;  2QQB A;  2HBP A;  4ZGE B;  2XDB A;  2RQV A;  3I55 Q;  1VIF A;  3EG0 A;  3CBP A;  4LD9 K;  4OMN A;  1OEB A;  3OW2 A;  1D0X A;  1AWJ A;  3IQL A;  3FRN A;  1D1B A;  4J9F A;  1VQK T;  3MP6 A;  3GLX A;  5KYW A;  2OTJ Q;  4FSX A;  4RTX A;  2DNU A;  1NPR A;  3QKJ A;  5KYX A;  4KT0 E;  2DXC A;  2JMC A;  4XTU A;  4C8Q G;  3I56 Q;  3PT9 A;  1SEM A;  3C12 A;  4RMO A;  3NGP A;  3EG2 A;  3V7C A;  2OAU A;  4OMO A;  3DLL A;  4A54 A;  3VRY A;  3OYN A;  5LJ3 h;  2PNI A;  4BD3 A;  1VQ8 A;  2VB6 A;  1VQ5 A;  1YWP A;  4E7I A;  4Q5W A;  1ZSZ A;  1GRI A;  3CEY A;  3EH2 A;  3G6E Q;  5KE3 A;  1TUD A;  1TG0 A;  1WHH A;  4VUB A;  1JQQ A;  5CCA A;  3CCS A;  1M1F A;  4UC4 A;  3ZBD A;  5I11 A;  3EGD B;  3CCL T;  1WJS A;  4XTV A;  3CCR T;  2LRQ A;  3OMG A;  4PJN A;  3TSW A;  3H41 A;  1QCN A;  4RTY A;  3E1S A;  5FU7 C;  2F2W A;  2L3Q A;  5GAM g;  1ARK A;  4X9C A;  3X26 B;  1IB8 A;  4F17 A;  1GL5 A;  4EDU A;  4GLK A;  1MMG A;  2ECZ A;  1SSH A;  5FLX E;  4OB1 B;  2RQU A;  2C0T A;  2RQT A;  5EC7 A;  2JZ2 A;  3G71 A;  1PRL C;  3JCM X;  4N0A A;  1Q81 R;  2RH2 A;  1I5O B;  3H0H A;  2CP3 A;  2VUB A;  4CC7 A;  4C8Q F;  3A1P A;  2DTO A;  2KRN A;  1UGQ B;  3R6O A;  2GQV A;  2L3P A;  3FLG A;  4JDS A;  2GGR A;  3CCE T;  2OTJ T;  2WSC E;  1K0S A;  2KK4 A;  1AVZ C;  3ME9 A;  4ELY C;  2VGM A;  2RJD A;  3HRS A;  1VOM A;  2KXD A;  5GAO l;  1WXT A;  2BUD A;  3CCM A;  2MWP A;  4FIB A;  1PCX A;  5LJ5 g;  1S72 T;  4BAC A;  1VQ4 Q;  3OSV A;  1YNZ A;  2FO0 A;  3CCQ Q;  4OB2 B;  1GXI E;  2J6O A;  3CXC S;  2XMF A;  3HTR A;  4IUQ A;  3G4S A;  1F1B B;  4M7D E;  1VQM T;  2L5Q A;  2V8I A;  3GBQ A;  5D6Y A;  1KHC A;  2DEQ A;  4KGZ B;  1U5S A;  1YJW Q;  1AWX A;  3THK A;  4KUD K;  1QMC A;  1KK7 A;  1FMV A;  1X6G A;  3M5A A;  1BI0 A;  2YSQ A;  2JT4 A;  2E12 A;  5LJ3 g;  3UAT A;  4MZP A;  4KH1 B;  2RHX A;  1AD5 A;  4J7I A;  2E5Q A;  1HSQ A;  1Y96 B;  2EJ9 A;  3OYY A;  5CK9 A;  3LWH A;  2MF2 A;  4M7A E;  3PIO A;  2JM9 A;  4ZN3 A;  4BDZ A;  2DD5 A;  4ESR A;  2QQA A;  1NLO C;  1OU8 A;  3A8G B;  3FB9 A;  2CH4 W;  3BY7 A;  1J3T A;  2NUT B;  1WYX A;  1X69 A;  1QP2 A;  2O9S A;  2ESW A;  2ROT A;  3J80 E;  4ZNX A;  3PNW C;  1NJI R;  2WSE E;  3RKX A;  3JB9 F;  4C8Q A;  4RTT A;  5IAY A;  3KXT A;  3KBG A;  3WVD B;  4ZTJ A;  4EMK B;  1ABQ A;  2DBM A;  2X51 A;  1Y7X A;  4BI3 A;  3INZ A;  2LMJ A;  2LX9 A;  1M30 A;  3OMC A;  4FW2 A;  5FRN A;  2LCS A;  2P84 A;  5ECA A;  3FJP A;  1VQ7 T;  2DIG A;  2K3Y A;  4M77 E;  1M90 C;  3RMS A;  3TQ7 P;  4EPC A;  1D09 B;  1Q7Y R;  4X34 A;  3OYI A;  5LJ5 h;  2XDP A;  1UGS B;  3URG A;  1VQ5 Q;  1OX9 A;  2RJF A;  1G3S A;  4AT1 B;  1YJ9 Q;  1ZLM A;  4QW2 A;  3S3M A;  2OI3 A;  2LVM A;  1KQ1 A;  1NG2 A;  3VS1 A;  1MND A;  4LDV A;  1VQL A;  2RA2 A;  1I8F A;  4ELZ C;  2COY A;  2W10 A;  4KBM B;  2CDT A;  1K73 R;  4IIO A;  1NZ9 A;  2PQW A;  1DJ7 B;  1G5V A;  2D6F A;  1VIE A;  2QQR A;  2H8H A;  1BIB A;  1ZSG A;  2DX1 A;  1QCO A;  4E6R A;  2H3E B;  3EG9 A;  3VYH B;  3QYG B;  2VWF A;  4KRT A;  2XG8 D;  1M3C A;  3G4S T;  1KC8 C;  5DLQ E;  4Y91 A;  2WSF E;  4RTU A;  3OYE A;  1VQ9 A;  2CP6 A;  1KD1 C;  3QZ5 B;  3CC4 T;  1K73 U;  1YBY A;  2DTH A;  4HT9 A;  2CP0 A;  3UPU A;  3CCJ Q;  2E3I A;  3G7Z A;  4QKU A;  2M0O A;  2D9T A;  2QQS A;  2ED0 A;  3CMA A;  1RL2 A;  2JM8 A;  5GAN 6;  1P92 A;  3QO3 A;  4J9I A;  1A0N B;  1GCQ A;  4D8D A;  1WHL A;  3L2W A;  4II1 A;  1LJO A;  2D0N A;  5IHI A;  1Z9Z A;  3OS0 A;  2KY9 A;  4M75 C;  3CPW A;  5CKF A;  2RNA A;  3CCR A;  1G8X A;  3CD6 A;  3PTA A;  2M02 A;  2LT1 A;  4F16 A;  1Q82 C;  2CZ6 B;  1QQJ A;  2MI6 A;  1UJ0 A;  1WI7 A;  2HL3 A;  1BI2 A;  3VV0 A;  2XIC A;  1N8R C;  1VQ6 A;  1Z9Q A;  3LH5 A;  1TSF A;  4PJO C;  1JXM A;  2XK0 A;  1YJN A;  2NUZ A;  5KCO A;  4NOY A;  2BZX A;  4LDX A;  2K3B A;  3CPW P;  4E7J A;  1M1K C;  1WHK A;  3OBY A;  4M4Z A;  2GNC A;  1MMD A;  4N4I A;  1E7O A;  1JXO A;  2RHY A;  4FYX B;  4HVW A;  1M8M A;  1R77 A;  2LX7 A;  3DB3 A;  4FCY A;  4MML A;  1YIT Q;  5HKC A;  4NL2 A;  2DTI A;  4LXC A;  3PIP A;  2VYT A;  3MEV A;  5DLO A;  2HD0 A;  2RM4 A;  2E6N A;  4RUG A;  4N0A C;  2FL7 A;  3I56 T;  2E1H A;  4XU0 A;  5GAN h;  2VAS A;  1XNI A;  4AMC A;  3P8H A;  2OTJ A;  2PU9 B;  2M9U A;  3QZ9 B;  3M59 A;  1AWW A;  4M7A G;  2QAS A;  2VXE A;  2OTL A;  2DRM A;  1ZUK A;  2KBT A;  1W70 A;  2CSQ A;  2X3W D;  2DER A;  4FW1 A;  1U3O A;  4F14 A;  3CCV A;  1N8R U;  3EGX A;  4M75 G;  1X01 A;  2HQX A;  1V29 B;  4M7A D;  1NLP C;  1E6G A;  5LJ5 f;  1YWO A;  3OSS C;  4XTX A;  3CMA T;  5D6X A;  4J83 A;  3MP1 A;  2HQH A;  3SWN B;  2O88 A;  4RTV A;  3EFS A;  4M75 A;  3V8K A;  3QSU A;  1Y0M A;  4FU6 A;  4P5N A;  1RLQ C;  1TUC A;  1MNE A;  3LX7 A;  4M77 G;  4Z88 A;  5IHK A;  2QQ9 A;  1BBZ A;  2GFU A;  3BDL A;  1BYM A;  1WGS A;  4C92 C;  3CC7 Q;  2DXU A;  1VQ6 T;  3VS7 A;  4QVD A;  4M78 D;  3MEU A;  1OZ3 A;  2ATC B;  5AT1 B;  1KFZ A;  2JTE A;  3GNF B;  4C0D B;  2A08 A;  1YJ9 T;  1K4U S;  1CKA A;  4FYV B;  1W6X A;  2LQN A;  4EMH A;  1YIJ Q;  5A0D A;  2BIV A;  3ASK A;  3CME Q;  4BB7 A;  5GAO m;  1WA7 A;  4XU2 A;  2XU8 A;  3M0Q A;  1IGU A;  5IXB A;  3JCM e;  3M0S A;  2OX7 A;  1VQP T;  2IVW A;  2DRK A;  2J6F A;  1SF9 A;  2D1X A;  3TSZ A;  3NTH A;  1GBQ A;  2D8H A;  3SDZ A;  3OB9 A;  5KYU B;  3G4S Q;  1HXD A;  2ED1 A;  1MV0 B;  5FW9 A;  2K4Y A;  4M78 C;  2YRC A;  3CME A;  4M78 B;  2KI7 A;  1TH7 A;  2PTK A;  3JCM W;  4FL6 A;  4LD6 A;  2DL8 A;  2O9V A;  3CCJ T;  1VYV A;  2KT8 A;  2DK3 A;  2I0N A;  4PJO F;  3C0C A;  2O4X B;  3JCM h;  1NJI C;  3I9Q A;  1AZE A;  3GP8 A;  2GBQ A;  1QVG A;  2EVR A;  2DZC A;  1W2B A;  3A8H B;  3H0I A;  3SB2 A;  2JN0 A;  2O31 A;  2DAQ A;  1VQO Q;  4M7A C;  4M75 F;  5GAM j;  4HT8 A;  2NYS A;  2KMT A;  2CUD A;  2HZY A;  2YUN A;  4FT4 A;  4C92 G;  4ZGD B;  3L42 A;  3PVL A;  2DA9 A;  2DZ9 A;  4JLG A;  1VQP Q;  4OMF B;  3RIR A;  1AOJ A;  1S72 Q;  5FU6 B;  1LVK A;  2QTV A;  3VU3 C;  1X2K A;  3JCM J;  2F5K A;  3S3O A;  2CRE A;  3PVQ A;  2FZC B;  2YLB A;  2DMO A;  3CCE Q;  1BI1 A;  3PMI A;  1H3Z A;  1VQ8 T;  1K9A A;  1T0H A;  4RKU E;  3I55 A;  4C92 D;  4DEY A;  2CKK A;  1ABO A;  2EQU A;  2EFI A;  4J9B A;  5LJ3 j;  2KNB B;  5LL6 S;  3TRE A;  4C5I A;  4FM4 B;  1MGQ A;  3A98 A;  2D0Q B;  1QP3 A;  1M8V A;  4X9D A;  5GAO q;  3MO8 A;  3HFO A;  1XOV A;  5CQY A;  2C06 A;  4M77 B;  1WNL A;  4BUG A;  2KR3 A;  1YJN T;  1QCF A;  3QBY A;  2A3L A;  4M77 C;  3CXC P;  2VGN A;  3QWX X;  4ANJ A;  4JZ3 A;  2J7I A;  3AT1 B;  4PNO A;  3QDR B;  2VXF A;  1UHC A;  2LJ0 A;  1BB9 A;  4A4G A;  5GMK m;  4JRI A;  4RG8 A;  5HCK A;  3FEO A;  4B6M A;  4XK8 E;  2GF7 A;  3OY9 A;  3LH0 A;  3V8L A;  4L6V 5;  1S1N A;  4CC2 A;  4PJO A;  2CH4 A;  1PD1 A;  4XQ3 A;  1N27 A;  2V1Q A;  1YI2 Q;  4BY6 C;  6AT1 B;  1I81 A;  1PD0 A;  5GAO n;  5KH6 A;  3CC7 T;  1I5L A;  1AZG B;  4DOW A;  4J7F A;  3OYH A;  3M9Q A;  2EBP A;  2LNH B;  1OX8 A;  1KQS P;  1UFF A;  4M77 D;  3OW2 S;  3CCM T;  5J26 A;  1TS9 A;  1BCO A;  2KSS A;  1Q86 R;  3JCM g;  1BCM A;  4OB3 B;  2DFU A;  5AYF A;  3L2V A;  5GAM f;  1IRX A;  2RF0 A;  4CI0 C;  1PC0 A;  1BI3 A;  2G6F X;  4M78 G;  5CQX A;  4XU3 A;  1E6H A;  3MKD A;  1WQW A;  1ZA2 B;  4M7D B;  5DM7 R;  2DD4 A;  5M9O A;  4F7U G;  2QG9 B;  3FDR A;  3OYL A;  2WAC A;  4M7D G;  4XAX B;  4A63 B;  3L2Q A;  2ZAE A;  1B34 A;  2JW4 A;  3JB9 G;  3O8V A;  1M1K U;  2FZG B;  4PJM A;  1GFD A;  4HKE A;  1BKB A;  4M7A A;  1RAD B;  1UHF A;  2DYB A;  4PFZ A;  2Y4X A;  2F69 A;  2L3S A;  2Y90 A;  2LCL A;  2ZGW A;  3UWN A;  5CKD A;  1QVF S;  3RMQ A;  1HD3 A;  2PZ1 A;  2X3X D;  2LNV A;  2OAW A;  3VJP A;  5I2M A;  1UDL A;  3SWN A;  2F1L A;  2MPX C;  1VQ9 Q;  1YN8 A;  4RTW A;  1KD1 R;  3OYK A;  4PJJ A;  1CSK A;  2L89 A;  2GTO A;  3HSB A;  3CC4 Q;  4B9X A;  3CCQ T;  4BI8 B;  4RTZ A;  2MCN A;  4BY6 B;  2G3R A;  2NUP A;  4C92 B;  1FXX A;  2EQI A;  1WPY A;  1NM7 A;  4ZGJ B;  2EYZ A;  1G3W A;  1WJQ A;  4LDW A;  4WF2 A;  2LP5 A;  1UGR B;  3M56 A;  4B9W A;  2DE0 X;  2X9H A;  1H92 A;  1VYT A;  1VQ8 Q;  2FPE A;  4E7S A;  1X43 A;  2DEU A;  5GAN 4;  3VYG A;  3PGG A;  3H0F A;  4CC3 A;  2XID A;  1IGQ A;  3R6N A;  4O6J A;  4C8Q C;  5FWB A;  2CZ1 B;  2EW3 A;  2FPF A;  2JVV A;  3VUZ A;  4PLL A;  1JJ2 A;  3SHW A;  2F2X A;  5GAN j;  1I1J A;  4D8K A;  9ATC B;  1W2B P;  3SFM A;  1YIJ A;  1NPP A;  3QHS A;  4E7Z A;  5KE2 A;  2KXC A;  1VQO T;  4JUV A;  5FU7 B;  2AZV A;  1MMA A;  4NS5 A;  5A0L A;  4V2S A;  4J9G A;  3UDC A;  2YRD A;  5KCH A;  3M54 A;  1JJ2 P;  2DVJ A;  5L8R E;  1VQ4 T;  4M78 A;  2AHJ B;  1O75 A;  4C5E A;  1OOT A;  5I22 A;  1RI0 A;  1M1K R;  4M7D C;  5GMK l;  4Z8A A;  1PHT A;  1TTH B;  2X4J A;  1WXU A;  3QJ6 A;  2HNI A;  1N5Z A;  1UEC A;  2HQE A;  1ZHI A;  5KYU A;  1GBR A;  2HSE B;  3TVT A;  1W2B S;  4MMK A;  3SEM A;  3AHU A;  3CC2 Q;  2E64 A;  3HKS A;  1BU1 A;  1GCP A;  1BIA A;  4IUP A;  4BE2 A;  2W0Z A;  1PKT A;  1B07 A;  3WVE B;  8ATC B;  1G3T A;  3V7R A;  2QGG A;  2AKK A;  4IUT A;  1VQL Q;  1VQ7 Q;  4HVV A;  1YI2 T;  1D3B B;  1MHN A;  1KC8 U;  2ZPF B;  3MCA B;  3VS6 A;  3TEE A;  2QGF B;  2SEM A;  3MET A;  4OF1 A;  4X1V A;  1NYG A;  5IT9 E;  2EIF A;  2E4H A;  1OI1 A;  1VQ9 T;  2DET A;  2B86 A;  1SPK A;  3PMT A;  3CD6 Q;  1JJ2 S;  2RHI A;  3OA6 A;  3X20 B;  1IZ6 A;  1KD1 U;  1VQN A;  2EYY A;  3GIB A;  1Y57 A;  3D7S B;  2CYZ B;  2RHZ A;  4EIK A;  2PVG B;  5GMK h;  2YT6 A;  1TXQ A;  2RN8 A;  1SG5 A;  2P4T A;  3P8B B;  2LDM A;  1G3Y A;  3DLM A;  2DXB A;  1K8A R;  2FEI A;  3EAE A;  2VVK A;  1EFN A;  3FJ5 A;  1LPL A;  2COZ A;  4OVA A;  5HK0 A;  3X28 B;  1QW1 A;  3LWI A;  1WHM A;  1K8A U;  5HK3 A;  3JV3 A;  2K3X A;  3EG1 A;  5GMK e;  3RES A;  4LUE A;  2KAF A;  2EAY A;  4JRQ A;  1T3L A;  1HJD A;  3REB B;  2CP5 A;  1UUE A;  3CPW S;  4M78 F;  3I56 A;  1D0Y A;  3QG1 A;  3VS4 A;  2HCK A;  1YCY A;  4AFQ C;  3CQT A;  2ZPI B;  2L8D A;  1SKU B;  3E19 A;  4JPB W;  2AIR B;  3S6W A;  3NTI A;  1N9S A;  2LQ8 A;  3MHX A;  4M7D A;  4LNP A;  1D3B A;  2OTL T;  4JS5 A;  2HDA A;  3H8Z A;  1B3Q A;  2CZ0 B;  2DO3 A;  2ZZD A;  1C1A A;  1W4S A;  3CCJ A;  2LJ3 A;  1K9M C;  5A0G A;  1WZO A;  2FYK A;  3PE0 A;  5LJ5 j;  3GOX A;  5GAM e;  1FWZ A;  1N8R R;  3CMA Q;  1WDX A;  1T3S A;  1NYF A;  4WCI A;  2JJ9 A;  2EGC A;  2ZPE B;  1SHG A;  3BFM A;  1JU5 C;  2RPN A;  1H8K A;  3CCL Q;  1LCK A;  5CKH A;  2O4X A;  2ZPG B;  3M4Y A;  3Q1J A;  1VQM A;  4DA4 A;  1EX4 A;  4M75 E;  2E70 A;  3OYM A;  4Z02 A;  3REA B;  2EKO A;  1U8R A;  1NE8 A;  2BZ8 A;  3UT1 A;  4A4H A;  2KDS A;  3JCM c;  2K5I A;  4HCZ A;  1LNX A;  2CP2 A;  3QXE B;  4QT7 A;  5GJW B;  2X4W A;  4PK4 A;  2JMA A;  2DM1 A;  4QVC A;  1VA7 A;  2KYB A;  2P0K A;  2MOX A;  2JNG A;  1YI2 A;  4LDY A;  5LJ3 d;  2MMP A;  1JO8 A;  3V7S A;  1Y07 A;  3JCM Q;  3LYI A;  3OS5 A;  4Z89 A;  1QWE A;  3OYD A;  1NBE B;  2EJG A;  3M58 A;  2LQW A;  2RHU A;  2HL5 C;  3O5Z A;  3EHR A;  5CKE A;  2L3R A;  4C92 A;  4PLI A;  2AZS A;  4E7H A;  4PJO B;  1M9S A;  4JS4 A;  3A8O B;  1ZUY A;  2MIO A;  1K9M R;  4J6Y A;  4R55 A;  4C0G A;  1Y71 A;  1JRI A;  2FB7 A;  1KIK A;  2YUP A;  4IUU A;  4XU1 A;  2JXB A;  2DYI A;  4A4F A;  1WXB A;  2Y4Y A;  2KYM A;  3CME T;  5GAN 8;  1QVP A;  2FPD A;  2PUO B;  2QDL A;  4BDY A;  4MDW A;  3QJY A;  4E7L A;  1VQN Q;  4GLM A;  4M77 F;  1VQ4 A;  4J9H A;  4QQG A;  2MWO A;  1RAC B;  2K5L A;  2V26 A;  3EHQ A;  5J3B A;  2CZ7 B;  3CC2 T;  4KUI A;  4WTO B;  3KFV A;  2EPD A;  5LJ5 d;  1B34 B;  1M2O A;  4HXJ A;  4LDU A;  1VQK Q;  4MZM A;  3P8D A;  4JJB A;  1YHQ Q;  1TUG B;  2XD0 A;  1WLP B;  4KGV B;  2FRY A;  2R58 A;  1KG1 A;  1WJR A;  2A7Y A;  1IHV A;  2F2V A;  3JB9 H;  2K5F A;  4J8O A;  4PKC C;  5GAN e;  1IRE B;  4RCC A;  5EG2 A;  3RKW A;  2DIQ A;  2P4R A;  3OYG A;  8AT1 B;  4N4H A;  2DVE A;  3MEA A;  2V1R A;  5FRM A;  3CPF A;  3HL8 A;  4E2F B;  1Q95 G;  2V8J A;  1YJN Q;  4AFS C;  3I35 A;  1XJW B;  3VS3 A;  1PM3 A;  5J39 A;  5HY6 A;  2A36 A;  2IIM A;  2RO0 A;  3MJX A;  1OV3 A;  2QI2 A;  4DEX A;  4IKF A;  1KQS S;  3HRU A;  3A8L B;  5C0M A;  1KHI A;  1PKS A;  4C92 F;  2CT4 A;  1X75 C;  2NUT A;  3G6E A;  2B8A A;  1V1C A;  3GF5 A;  3QUI A;  1VQN T;  4DOV A;  3EFR A;  3C4S A;  2EWN A;  2CGH A;  2LCC A;  3HFN A;  3VS2 A;  1FMK A;  3OW2 P;  2E5K A;  2A28 A;  2MK5 A;  3CCV Q;  1IHW A;  1UE9 A;  3S3N A;  2XHC A;  1VQM Q;  4C0F A;  3A8M B;  4KGX B;  1OU9 A;  2V8K A;  5L23 A;  4M77 A;  1D1A A;  2RK2 A;  1Q7Y C;  1B7T A;  4M75 D;  1RAF B;  1JEG A;  3M0U A;  3CC7 A;  1T0J A;  1VUB A;  1OYX A;  1X6B A;  1U1S A;  1R0C B;  1Q86 U;  4C0D C;  4FYW B;  1YIT A;  2OJ2 A;  1X2Q A;  1EZZ B;  4BE0 A;  4JZ4 A;  3C94 A;  1WX6 A;  4PJO D;  4KH0 B;  3EGX B;  1RLP C;  3X24 B;  4KUL A;  1Q81 C;  4PL6 A;  4PFO A;  2NUP B;  3BW1 A;  1I4K 1;  3N5B B;  3M0T A;  2K57 A;  4DQ2 A;  5GMK j;  3QPH A;  2BTT A;  4A53 A;  5DY9 A;  1RAG B;  3LGF A;  1ZQ1 A;  3CCE A;  3EG3 A;  1M90 U;  2HKQ B;  4NL3 A;  4K11 A;  4J9C A;  3M53 A;  2CS7 A;  2ZPH B;  2MAM A;  2DLP A;  1VQL T;  4OP0 A;  4DBF A;  3JCM P;  1KQ2 A;  4M7A B;  1I0C A;  3RDV A;  3G71 Q;  2YUO A;  2P0P A;  5GAN g;  3VKI A;  2DL5 A;  5GAO p;  3CBO A;  3JSC A;  1KSW A;  5FU6 C;  1NEB A;  2RI3 A;  2AKL A;  4CRI A;  1FMW A;  2FRW A;  2PVD B;  1Q81 U;  2K6D A;  2DF6 A;  3CC4 A;  2DL4 A;  3TCJ A;  1MMN A;  2PUK B;  1PWT A;  1QVF P;  5GAM d;  2QTX A;  4IUV A;  2QA4 T;  2X4Y A;  2RJE A;  3OYA A;  1K76 A;  2FG0 A;  3G6E T;  2EGE A;  3H9N A;  1OUL A;  4QQ6 A;  3SWN C;  2J05 A;  4ATO A;  1YHQ T;  2JTF A;  3OQ5 A;  2EKH A;  4M7A F;  2HBW A;  2JTM A;  1AT1 B;  2R57 A;  1YJ9 A;  1QVF A;  4Y92 A;  1AWO A;  1TU0 B;  1V76 A;  2NWM A;  4IUR A;  1PRM C;  3OYB A;  1YCS B;  2JS2 A;  1M27 C;  2RB6 A;  2C0I A;  2X4X A;  4AG2 C;  1VQ5 T;  3FIF A;  1ZBJ A;  2M16 A;  3RBB B;  4EMG A;  2SRC A;  4ZN1 A;  2LQK A;  2DL7 A;  2RD1 A;  2HKN A;  4JJN K;  1HK9 A;  1G83 A;  3CCL A;  3V8J A;  2KT1 A;  4OB0 B;  3L2U A;  2O2O A;  3X25 B;  2R5M A;  2FHD A;  1LOJ A;  4M78 E;  3JCM b;  3CCM Q;  2R5A A;  4OGC A;  1ZBX A;  1UGV A;  3GNG A;  4JJC A;  4AG1 C;  4QQD A;  2GFA A;  2J06 A;  2RI5 A;  2K2M A;  5CO7 A;  2QXF A;  4OMQ A;  3UA7 A;  2ROL A;  3LLR A;  3GPL A;  2QAZ A;  3M0P A;  1VQ6 Q;  3CCV T;  4AFZ C;  2IPO B;  2P0Q A;  4J9D A;  5CR2 A;  1RI9 A;  5IH2 A;  3EH1 A;  3I5R A;  1PG5 B;  1Q7Y U;  3NTK A;  1UTI A;  2M1H A;  2K9G A;  2NLU A;  1TWB A;  1X27 A;  2AK5 A;  5GAM h;  3JB9 I;  3OS2 A;  3E9G A;  4F7U B;  4OML A;  2QEX Q;  2ZPB B;  1XQH A;  2E65 A;  3BDU A;  5C6S A;  5KYY B;  3ER0 A;  1QWF A;  3KUF A;  1RAB B;  4PJO G;  3I55 T;  2I2L A;  2F5T X;  2BKD N;  1NJI U;  3VS5 A;  1KJW A;  4XTW A;  3VUB A;  2O01 E;  1ZX6 A;  1PSF A;  2DBK A;  3JRZ A;  5KYW B;  1K1Z A;  2D8J A;  1WHJ A;  2JS0 A;  4HVU A;  3M57 A;  5FRO A;  3L2R A;  2YWW A;  2QA4 A;  3L1A A;  1WFW A;  1UEB A;  2KGT A;  2QEX T;  1M3B A;  2LC4 A;  3RUX A;  1Y96 A;  3T9N A;  1ZA1 B;  4LN2 A;  1AEY A;  3MEW A;  2AT1 B;  5CKB A;  2GCX A;  2OTL Q;  2GTJ A;  2XKO C;  2ABL A;  5CVI A;  2QYZ A;  1YHQ A;  4C5H A;  4EMK A;  2MYS A;  1EIF A;  2KEA A;  3EFO B;  4J9E A;  3BE3 A;  5I2S A;  2EYW A;  1C0M A;  2KQW A;  4C8Q B;  3OYF A;  5GAN 2;  4J6X A;  1U06 A;  1WIE A;  4HCC A;  4F7U E;  1YIJ T;  3CXC A;  4JRK A;  5GAN 3;  1OPK A;  1UGP B;  2RQR A;  1R8O B;  1O9S A;  2DKG A;  3F70 A;  1RUW A;  2RJC A;  2VV5 A;  4XTZ A;  2HAX A;  3UF4 A;  3CCS Q;  2Z0W A;  3EG9 B;  4DBR A;  3QYH B;  3ULR B;  2LZ6 B;  4JJD A;  1M4Z A;  3RER A;  3A5Z B;  1X6O A;  3ZEH A;  4M75 B;  2E3H A;  4J5Y A;  1S72 A;  4QVZ A;  3L2Z A;  5FWC A;  5KYN A;  4Y28 E;  4JRP A;  1QLY A;  3JB9 D;  1SRM A;  5D6W A;  4M7D F;  2DPP B;  1G2B A;  3CCR Q;  3DB4 A;  3HHT B; 
#chains in the Genus database with same CATH homology
 1IHV A;  1IHW A;  1C0M A;  1EX4 A;  1QMC A;  4FW2 A;  4FW1 A;  1C1A A;  1C6V X;  5D7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...