1C6VX

Siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
55
structure length
55
Chain Sequence
KNSKFKNFRVYYREGRDQLWKGPGELLWKGEGAVLLKVGTDIKVVPRRKAKIIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords PROTEIN (SIV INTEGRASE)
publication title X-ray structure of simian immunodeficiency virus integrase containing the core and C-terminal domain (residues 50-293)--an initial glance of the viral DNA binding platform.
pubmed doi rcsb
source organism Simian immunodeficiency virus
total genus 5
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 1999-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1c6vX00
4FW2A 1IHVA 1C6VX 1IHWA 1C1AA 1QMCA 1C0MA 5D7UA 4FW1A 1EX4A
chains in the Genus database with same CATH superfamily
1K0XA 3VRYA 2QA4A 2YUPA 1WJRA 2QAZA 1K9AA 4J5YA 3A8HB 1XOVA 4BDZA 3I56Q 4JS4A 4BY6C 3OMCA 2FYKA 2JTFA 2LTOA 4QVDA 1UGVA 3G71A 3KXTA 2V26A 4HCZA 3X26B 4N0AA 2LT4A 4DBQA 2DTIA 2OTLT 1WZOA 3MEWA 5DLQE 4RTVA 1SEMA 3QKJA 5GAN8 2ZPHB 4N4GA 3OSSC 3EGXA 2E3IA 3JCMf 3CCVA 2LVMA 2XHCA 3V8KA 5GAMf 3EH2A 4RG2A 4JJNK 2RK2A 1V76A 2E65A 3CBMA 5FLXE 2FG0A 4PLIA 1OPKA 5LL6S 4JS5A 4M75C 4HVWA 2FZKB 1IRXA 5GAOp 1VQNQ 1WA7A 4AFUC 1Q81U 4M7DD 3CXCA 5GANf 2NUPA 3MEVA 4C8QE 2KDSA 5GAN7 4ORZA 2KY9A 4B6MA 4JZ4A 4M7AB 1YNZA 3H41A 4C92B 2CP5A 5DY9A 1VQ7A 3CCET 1ZSGA 5GMKj 1M90C 1ARKA 3CMEA 2J05A 3OYFA 2DXTA 4KGZB 2ABLA 3DLLA 4ELYC 1M90R 4QW2A 3CCMA 2CH4W 1YJNA 5I2SA 3OYKA 1AVZC 1IHVA 2LJ1A 2D8JA 3CD6A 1YFNA 3PFSA 3I5RA 3JCMe 4IUTA 4N0AC 1XQHA 2WSEE 1E6HA 4HCKA 1G2BA 1K73U 2KE9A 1ABOA 1VQ5A 1R0BG 4PJOE 1M5Q1 1OOTA 2K3BA 5LJ3f 5D6XA 4J6YA 2FPEA 5GANe 3J7AF 3CCSA 2AKLA 2PVGB 2RQRA 2M51A 4X34A 2DIGA 2OTLA 3A8LB 5GMKh 3MO8A 3QJ6A 2DE0X 5AT1B 4XU0A 2VASA 3CC4Q 4MZPA 5A2QE 4M77E 3EFOB 4XTZA 4J9EA 2CH4A 3PE0A 3MEUA 2K7AA 5KCHA 1GFDA 3PGGA 3WVDB 1Y0MA 4UC4A 3UA7A 4KUDK 3M56A 3MCAB 3PMIA 1SSHA 2EQUA 1UFFA 4BI3A 2FZCB 2CZ0B 2XDDA 3M0PA 3DB3A 4M4ZA 4QVCA 1UE9A 1R77A 2DX1A 4HT8A 5LJ3e 3CCEA 3CCRQ 3QIIA 2DD5A 2FRYA 2RHUA 1A0NB 3RR6A 5A0GA 1OX9A 1Q81C 5LJ5f 4LUDA 1LVKA 5D6YA 4C0DB 2E10A 2VC8A 2QG9B 2V1RA 2VVKA 3CMAQ 1Q81R 1HXDA 1VQ8A 4E7JA 4O5VA 2NUTB 4ZGEB 1RAHB 5A0DA 2LT1A 1PKTA 1M4ZA 3EAEA 1O75A 3A98A 3TVTA 2GGRA 4YTLA 1D0XA 2XIDA 4F7UA 5KYWB 3JB9J 4N4IA 5J3BA 1EX4A 1VQPA 1O9SA 3QXEB 3E19A 2GFAA 1YJWT 1F1BB 1YITA 4DQ2A 4F17A 3WXMB 3META 2VUBA 3LLRA 3M0QA 5KYXA 4AFQC 1AWWA 3HFNA 8ATCB 3L2VA 2IPOB 1KIKA 3A8OB 3GP8A 4M78F 2D0NA 1NEGA 1K73C 2A28A 2EJ9A 1B34B 2AHJB 5GAN4 3CCQQ 1NLOC 1KD1C 4OGCA 3UDCA 1CSKA 1QKXA 3QDRB 2AKKA 2OTJQ 3ZFJA 2RJCA 1H641 1K73R 3NMZC 2K79A 3JCMV 5FWBA 3M59A 2VXFA 2DA9A 2EJFA 1YJ9T 4EDUA 4IUQA 4C5IA 4BD3A 3MPUB 3EG9B 3M9QA 3URGA 1BI1A 4A53A 3FB9A 5J26A 3VV0A 1YCYA 3S6WA 2YRCA 1D1BA 4Z8AA 4CC3A 1VQLT 4J9FA 5L8RE 1TU0B 3OYGA 3OS5A 4BE1A 2BKDN 1P92A 2V8IA 3NGPA 4D8KA 3CPWS 2EYZA 2RHZA 2FPDA 3VU3C 3KUFA 1QP3A 4RTUA 4NL3A 1WHGA 4J9DA 2E5QA 1VYTA 1X27A 5GMKm 2KT1A 1FMVA 4Y28E 4C92E 3FEOA 1ZSZA 4BY6B 2ZCFB 1LCKA 3RKWA 2DBKA 2K5FA 2EKHA 4PFZA 2QQBA 3L1AA 4M7DB 5FU6C 1BIAA 2DVEA 2CSQA 1TOVA 4PLLA 4FYXB 2NWMA 2O88A 1U1SA 2EAYA 2COYA 2EKOA 1W2BA 4E47A 2OAWA 4OMQA 2KSSA 2JM8A 5CIUA 1YIJT 1H8KA 3N5BB 5GAOm 5GJWB 3HRTA 5CKDA 2DXBA 5FROA 1WI7A 2RD1A 3RESA 3JB9D 4E7LA 2I2LA 4ZGDB 4A4KA 2JMAA 4J6XA 4E7KA 1Z9ZA 1MGQA 4M7AC 4IUVA 2QDLA 5GAN5 1QWFA 3PT9A 3NTKA 3MEAA 3OYEA 1VQ9A 1U8RA 5CKBA 4MDXA 2QTVA 2ESWA 3OS0A 4RMOA 3CPWP 2YUNA 1QQJA 3X28B 2WSFE 2HQHA 3OBYA 2KAFA 1VQKT 3S3NA 1T0JA 4J9HA 2IG0A 4ZGJB 4KULA 3ASKA 4M75F 2RH2A 1FYNA 3EGDA 5FRNA 2FO0A 3JCMQ 5KCOA 4PK4A 1KQ1A 2DILA 3X20B 4R55A 4C8QG 1BB9A 1ZSZC 4NL2A 3U23A 2RM4A 4IURA 2LZ6B 2O01E 2X4WA 4IKFA 3EH1A 2E3HA 2DD4A 2KR3A 2XI9A 5FW9A 2BTTA 3RUXA 2O4XA 3CXCS 1ACMB 2L3SA 3EGXB 1G3SA 1X2QA 1D09B 4OB1B 4FW2A 1VQOT 2O9VA 4MZMA 1AWXA 2SRCA 3CCUT 1QW1A 2O2OA 4PFOA 2NUZA 1BI0A 2DRKA 2EWNA 2PVDB 3ME9A 1QVPA 1SSFA 3H0IA 1SRMA 4ZN1A 2HBPA 2NUPB 2V8JA 3UA6A 8AT1B 3OYJA 2CUBA 3J80E 4KGVB 2OI3A 2EFIA 3I56A 1AZGB 3QBYA 1NZ9A 3HPWA 3JCMg 4J7FA 1RAGB 2DTHA 1ZLMA 2YUQA 2CP6A 3VUZA 2IIMA 3OYIA 2G6FX 1K0SA 2EPDA 3VUBA 4C5EA 3G6EA 4M77G 1I07A 1TUCA 4JLGA 4C0DC 1FXXA 3EGUA 2R5MA 2Y90A 3PIPA 5GANg 4WTOB 2YLBA 3G4ST 1GBRA 4EMGA 3BFMA 1FMWA 1I1JA 4PJOF 2WSCE 1QVFS 3CXCP 1ZHIA 3EFSA 3BW1A 4ATOA 3VS5A 4HKEA 1QVGP 1YJ9Q 4XAXB 3E9GA 2EYWA 2W0ZA 1TTHB 4VUBA 1ZUUA 2KMTA 1AD5A 1VQNA 1YHQT 4HVVA 2L5QA 1WQ7A 4PFPA 3FC3A 3FDRA 1RAIB 1I81A 2E6ZA 1IHWA 2L0AA 1VQLQ 4M77F 2LJ0A 5IHNA 2DO3A 2GQVA 1IO6A 1NBEB 2L3QA 2LQ8A 5GAMj 4FYWB 3E1SA 3M0UA 1TSFA 5CQYA 5LJ3g 2RK1A 3L2UA 4EMKA 2LNHB 1B3QA 4K11A 2AT1B 4J83A 5DLOA 1G3TA 2WACA 3CMAT 3FRNA 2CDTA 3I55Q 5GANj 3EG0A 3LH5A 1HYOA 4B9XA 2ENMA 2EVRA 4FL6A 3P8BB 3EG2A 2PQWA 2JJ9A 4J9GA 4RTYA 4EPCA 2DXUA 2HMAA 2IVWA 2VWFA 3CCLQ 3GNGA 4E7ZA 1JBMA 1BCOA 1QVFP 4LNPA 3RERA 4J7IA 5GAOr 2ZPBB 1WHKA 1RABB 1NYFA 1UGPB 2LCCA 4OGEA 1UUEA 2OX7A 1MMGA 3JCMh 1BK2A 3GBQA 2GBQA 2RJFA 1YIJQ 1TG0A 4HXJA 2ZPEB 4P5NA 5CO7A 3OW2A 2EIFA 1UJ0A 5HK3A 3CCQT 3EFRA 6AT1B 3UATA 2DZCA 2ED1A 2BE7D 3RMSA 4M75E 1NJIU 3F70A 2DRMA 1AWJA 3TSZA 3CC4A 2MOXA 2KXCA 2M16A 2OTJT 4R56A 1OX8A 2DTOA 3KFVA 4F7UB 1UJYA 4WF2A 2KYBA 1N9RA 2MI6A 5GANh 1M8VA 1R0CB 5LJ3j 4M7DC 3TU4K 3LH0A 4LXCA 1G3WA 1N8RU 2RF0A 3M53A 3SFMA 4HA8A 5KYXB 3OA6A 1VQKQ 5LJ5g 1MNEA 3VS7A 5FU6B 4EMKC 4X9DA 2VYTA 1WIEA 2B86A 4Z89A 1YI2Q 1WHJA 2ATCB 3C0CA 3CCRA 2D6FA 1VQ6Q 2QASA 4C8QA 4PJLA 5HY6A 2J6OA 2LJ3A 4IUUA 1X6OA 3OS1A 3SHWA 4BDYA 1JJ2A 3OSVA 4KGXB 2M02A 3OYNA 1M3BA 1D0ZA 1FWZA 3P8DA 1N27A 5LJ3h 5M9OA 1ZBJA 5AYFA 1VQOQ 4OP0A 2YRDA 1QCFA 3CCUQ 2EGAA 4TVRA 1VYVA 2RHYA 4J9CA 3T9NA 1JQQA 5LJ5j 3JB9H 3DLMA 2QI2A 1FMKA 2XKOC 2K6DA 4AG2C 3QPHA 4M7AF 1UGQB 4C92F 1W2BS 1CKAA 5GAMe 1KQSA 5CVIA 3CCQA 3TREA 2EJGA 1ZSZB 4FSSA 2E70A 2JZ2A 3Q1JA 4L5GA 2CZ6B 2HCKA 1X6GA 2YSQA 2LX9A 3QG1A 5IXFA 1WX6A 3RKXA 1UGSB 4QQ6A 3RNJA 4HCBA 2ED0A 1OEBA 4MDWA 2XD0A 4L59A 1NJIC 2YLCA 1VOMA 2EYXA 2A36A 1KG1A 2Z0WA 2KEAA 4OMFB 3G4SQ 1WPYA 3L2RA 3NTIA 3MP8A 1NJIR 2P4RA 1AT1B 2G3RA 1T3LA 4II1A 5LJ5h 2QYZA 3OQ5A 4JDSA 1Q7YU 2HSEB 2DEQA 3M54A 3OYYA 2RN8A 2C0IA 3UT1A 2VKNA 1KFZA 1T3SA 1U3OA 4OB3B 1WXUA 1OV3A 1YHQQ 4GLMA 3DKMA 1N8RR 5KYYA 1NYGA 1YWOA 1M2VA 2JM9A 4CI0C 4E6RA 1VQMT 2RB6A 2FL7A 4C8QD 3NHNA 5FRMA 1KC8U 2YRVA 2LCSA 3LGFA 1W2BP 2A37A 1M27C 3EGDB 2O9SA 1AHJB 1VYUA 4XU1A 4M78G 3OS2A 3CCJT 1PC0A 2DMOA 3CQTA 3RBBB 3JCMb 3EG1A 1YP5A 2XK0A 3JCMW 2K5LA 1UTIA 3HKSA 2E6NA 2Y4YA 2ZPIB 3CC2T 3H8ZA 2DM1A 2O4XB 3M58A 3JSCA 3V7CA 4DBFA 1IB8A 3NPFA 4JRKA 1S72T 3VJPA 2PU9B 3PVQA 5IXBA 4J8OA 2F1LA 2PZ1A 1VUBA 1RACB 3L2QA 1VQ7Q 2KVQG 2RPNA 2X3XD 4XTVA 3X25B 1JXOA 2HQEA 3CMEQ 1M1KU 2EQIA 2QGGA 2YT6A 4MMKA 1K9MU 3PMTA 3JCMJ 4LDXA 4J9BA 2HSPA 2F2XA 1UDLA 3KBGA 2D1XA 2F2WA 1ZQ1A 5LJ5e 4OMOA 3UPUA 2J6FA 2LDMA 2P84A 3VYGA 1GXIE 4C0GA 5GAOl 3A1PA 1M3CA 4IIOA 1WXBA 2D0QB 1HJDA 1Q7YC 5IHKA 4IUPA 2C0OA 2YUOA 3CCSQ 2EGCA 3C12A 4KUIA 1T0HA 3SWNA 1Q7YR 2K2MA 2LRQA 3OB9A 1GCQA 1G5VA 4NOYA 3DB4A 4V2SA 1PSFA 1BBZA 2KQWA 2C0TA 5CKHA 2F5KA 2L89A 4JRPA 1YN8A 3LWHA 1KC8C 3AT1B 1H3HA 4M7AE 4RG8A 1UEBA 3FJPA 2EQMA 2LC4A 4O6JA 1M3AA 3I55T 3HTRA 2ZZDA 4DOWA 1UHFA 3QZ5B 1KC8R 1YBYA 4CC4B 1BCMA 2RI5A 1QCOA 3H0FA 4KH1B 2CGHA 2DZ9A 3CCLT 4JJBA 3L2WA 1KQ2A 1WXTA 3S3MA 4B9WA 1RAEB 1YJWA 2LX7A 1Y7XA 2RO0A 3M5AA 1AZEA 4JZ3A 5ECAA 3TEEA 4M75G 3I9QA 3PNWC 2CP2A 3INZA 4EMKB 1RLPC 2L8DA 4E7IA 2E12A 2X35A 4XU2A 1C6VX 3GLXA 2MK5A 1Q86R 3QZ9B 4XTUA 5CKFA 4M7DF 3FJ5A 1YWPA 4PJJA 1Y71A 1OQKA 5IHIA 4PL6A 2A7YA 3OW2S 2GF7A 2JTEA 2OJ2A 4JRQA 4DEYA 1YJ9A 1GBQA 5L23A 2QQ9A 3CC7T 2VV5A 1M1KC 3SWNC 2L3PA 2DKGA 3OYHA 1K9MC 3IQLA 1TXQA 2R57A 1VQPQ 3L2ZA 1GCQC 1X75C 2K3XA 1M1KR 5GAOn 5EC7A 1K9MR 2LNVA 3CEYA 1VQLA 2XICA 3QUIA 1YI2T 3JCMX 1LJOA 4ZTFA 1TUDA 1VQ6T 1S1NA 2X3WD 3FIFA 2ECZA 1WDXA 5GJVB 4J9IA 3EHRA 4J6WA 2X4XA 2DL4A 2RI3A 1JB0E 2DJZA 1RI9A 1UB4A 1VQMQ 1QCNA 4HT9A 3VKIA 1JJ2S 2KK4A 3HHTB 2VB6A 2HQXA 2HEQA 4FIBA 1WNLA 1K76A 2X4YA 2EYQA 3MJXA 3CCJQ 1OYXA 1PD1A 3GPLA 1PRMC 4M78A 3OW2P 4C8QB 3VYHB 3LYIA 1VA7A 1Q95G 3M0SA 5HCKA 4PJOG 2DNUA 2R5AA 1YIJA 1WJQA 3BDUA 3CC2Q 2GCXA 3HP9A 2LQNA 4DA4A 4MZTA 4OMNA 1MMNA 1VQ4Q 1CKBA 1Y96A 4LDUA 2CKKA 3VS4A 2HZYA 1OZ3A 1S72Q 1KQSS 4FU6A 5GAMg 2CP0A 2AK5A 3RDVA 1LOJA 3OMGA 4QKUA 2LMJA 5IT9E 3OYCA 4PNOA 4XU3A 4JJDA 1VQKA 2BZYA 2XMFA 5GAN6 5A0LA 2DL3A 2KT8A 1KHIA 2FVUA 4R0KA 1RL2A 4JJCA 1WJSA 1JJ2P 4RTZA 4LD9K 3REAB 5KYNA 1PWTA 2ZPGB 4AMCA 1IGUA 1QKWA 2RQUA 2RQVA 2KGTA 2BIVA 1MMDA 1RI0A 1GL5A 2EQKA 1VQ6A 2KBTA 2K3YA 2B8AA 9ATCB 3AHUA 3BE3A 1X01A 2KRSA 2CUDA 1QP2A 2MYSA 1EZZB 2MWPA 5I2MA 4M78C 2SEMA 5IN1A 3LW5E 4RCCA 3QWYA 3G71T 1N5ZA 3RKYA 1QMCA 4QQGA 2DXCA 3VS1A 4XQ3A 3VS6A 1VQOA 4BE2A 3CCUA 2JNGA 3JCMd 4ELZC 4KBMB 4HCCA 5GAMd 3OYDA 1KQSP 3CCVT 3CPWA 2JUFA 2XU8A 2RJDA 2QGFB 5KYYB 5C0MA 3C4SA 1M2VB 2K4YA 1JU5C 2D9TA 3LWIA 4M78D 4M7DE 4D6WA 1NLPC 5GANd 2FPFA 1VIEA 2XDBA 1NM7A 5KYUB 1D1CA 4E2FB 1NE8A 2M0YA 2L2PA 2HL3A 1V29B 4C0ZA 1SHFA 3QJYA 4NS5A 5I11A 2M1HA 4AFSC 4M75A 3M4GA 1VQ7T 3A5ZB 1ZUKA 2M0OA 5GAMh 4GLKA 1GCPA 1MNDA 5IAYA 3CMET 2EGEA 1JXMA 5HKCA 1H92A 4PKCC 1PRLC 2VGNA 2VXEA 2X4JA 3G4SA 3CCMT 2JS0A 1YJNT 4KT0E 1ZX6A 2J06A 4LE9A 4BUGA 1M9SA 2DL5A 1IGQA 2RMOA 4HVUA 3BY7A 3HFOA 3CD6T 1AWOA 2YXYA 3TQ7P 5FWCA 2OAUA 3V7SA 2ZPFB 3CC7Q 4KRTA 4XK8E 2PVOB 4LDWA 3M4YA 1RAFB 2LCLA 5LJ3d 5CKEA 5EG2A 1YHQA 1VQ5T 2BZ8A 1OI1A 4X1VA 2QEXQ 1W1FA 2P4TA 1KSWA 4F7UF 1G8XA 3G6EQ 4L6V5 3CCST 2AZSA 5GMKi 4M7AG 1WHHA 3ZEHA 2H3JA 4C92G 2DYBA 2Y4XA 3JB9F 3UWNA 1BI3A 2QQSA 1ZBXA 2YWWA 2C06A 1HD3A 2BUDA 3A8MB 3CMAA 1TWBA 1BKBA 2CREA 5IH2A 1K8AU 4LUEA 3GNFB 4FYVB 1OU8A 1QLYA 1B7TA 2RJEA 5C6SA 1LNXA 2JW4A 4DBRA 3SWNB 1QVGA 2MCNA 4A54A 4ZTJA 1MHNA 2KI7A 3OYBA 2J6KA 2LP5A 3VS3A 4A4FA 3A8GB 2MMPA 4JUVA 4Q5WA 4PJMA 2DBMA 4AG1C 2HNIA 5LJ5d 3OYAA 4PJOA 3JCMP 3D7SB 2QQAA 2DETA 1IXDA 4XTXA 1IZ6A 3NFCA 3HRUA 1WQWA 2DVJA 1G83A 2OTJA 4M75D 1I8FA 1E6GA 1PM3A 4CC2A 1VQ8T 4RCBA 3C94A 2KXDA 1N9SA 2HD0A 2F2VA 2MWOA 1KJWA 3ER0A 2HL5C 4FW1A 4C5GA 3M0RA 2QQRA 3VS0A 4OB2B 4M77A 4C8QC 1KD1U 4C0FA 3M55A 2O31A 1VQPT 2A0FB 2R58A 4JLIA 4BI4A 4FT4A 2QA4Q 2RNAA 1YITT 1NPRA 2AZVA 2PUOB 1D3BA 1MMAA 1KK7A 4QT7A 4C5HA 1SPKA 1WFWA 1N8RC 3G1JA 4ME7A 1X6BA 3TCJA 1OULA 3EHQA 2E5KA 1U1TA 1QVFA 3I35A 1PSEA 1AEYA 1WYXA 1W4SA 2DF6A 4E7HA 2D8HA 3QWXX 2A08A 3PTAA 2MAMA 3ULRB 2QXFA 4DEXA 3R6OA 3G71Q 2ROTA 4OMMA 3LX7A 4OMPA 2COZA 4QVZA 1PHTA 4LDYA 1TH7A 4EMHA 1WHLA 5KYUA 3OY9A 2KRMA 1U5SA 4FSXA 3SB2A 4PJOC 5KE2A 4A4EA 5KH6A 1AOJA 2F5TX 2JTMA 2QTXA 1R8OB 1UG1A 3CCVQ 1K4US 4XTYA 3M0TA 2KROA 1K8AC 2P0PA 1X43A 1B07A 2DL8A 2JS2A 1YCSB 4RTWA 2RHIA 1I0CA 1Q86U 1FX7A 4N4HA 1PCXA 3E9FA 1PD0A 1K8AR 4M77C 5FU7B 1VQ4T 1D1AA 1J3TA 5D6WA 4PJOD 1UGRB 5GMKl 3L42A 4M78B 3JB9I 7AT1B 4DBHA 3OBWA 2DJQA 2P0QA 2FRWA 1ZA2B 2HAXA 1HK9A 3NTHA 4AT1B 1UECA 2RI2A 2X9HA 3PIOA 2PTKA 3CCMQ 1W70A 3JV3A 1WHMA 4F7UE 1YJNQ 2K57A 5KE3A 1XJWB 4M77D 3CD6Q 3MKDA 1Y96B 4FM4B 5GMKe 2F69A 2NYSA 3QDFA 4MMLA 1OZ2A 1VQ5Q 2QK0A 3O5ZA 2FZGB 1Q82U 1JEGA 2V8KA 2FHDA 1KD1R 4Y91A 4FCYA 1SRLA 1VQMA 2E4HA 2CSIA 3SD4A 3R6NA 1VQ9T 4X9CA 2JOYA 2HKQB 2P0KA 1DJ7B 2OTLQ 5GAOq 4RTTA 2RHXA 1NEBA 4LDVA 2E64A 2JVVA 4M7AA 2KRNA 1M8MA 4C92A 2NLUA 3CCJA 3CBPA 2XG8D 3RMQA 2E41A 4M7DG 2EW3A 2PUKB 1WGSA 1N6AA 3VS2A 4OMLA 2FB7A 2CP7A 1I5LA 4OF1A 4A4HA 3PVLA 5I22A 3CC2A 1H3ZA 4BB7A 4GBQA 3ZBDA 2CZ7B 1VQ4A 4XTWA 2COWA 2YHTA 1S72A 3CBOA 1RUWA 1PNJA 1X2KA 2GFUA 2CP3A 3QSUA 1Q86C 4JRIA 2X51A 3QYGB 5CK9A 3CCEQ 1Y57A 2DAQA 2BZXA 2H3EB 1M2OA 4F14A 2MPXC 3EG3A 4Z02A 1SKUB 2MIOA 4BI8B 4CC7A 2XDPA 2VGMA 4F16A 1VQ8Q 1VIFA 3UF4A 3HL8A 4KH0B 3J81E 2K9GA 2K5IA 4IIMA 4RKUE 3OYLA 4E7SA 1GFCA 2DK3A 3EFOA 1XTDA 3I56T 3RIRA 4M75B 4OVAA 2DPPB 2EBPA 4C92C 4LN2A 1YITQ 2QEXT 3MHXA 1K1ZA 1MV0B 5I21A 4AFZC 1BI2A 1LPLA 4BACA 3H6ZA 3QO3A 3G6ET 2H8HA 2DEUA 1OU9A 1Q82C 5CQXA 3V8JA 2GTOA 2MF2A 2GTJA 4DOVA 4Z88A 1Q82R 1WLPB 2LQKA 2I0NA 1MV3A 1MUZA 1M1FA 2JMCA 4Y92A 3I55A 3V8LA 4RTXA 5CCAA 4M7AD 4C92D 2CS7A 1Y07A 1OPLA 1SF9A 2JXBA 4QQDA 4PJNA 1VQNT 1JO8A 2HBWA 2ZAEA 4LD6A 2NUTA 3CCLA 2DERA 2KYMA 1BU1A 1BYMA 2YDLA 1EFNA 2LQWA 2GNCA 2HKNA 1UHCA 2QDYB 1U06A 5KYWA 1QVGS 2EYYA 3WVEB 3JRZA 2E1HA 3FLGA 5CAIA 1I4K1 4ANJA 3GOXA 3GIBA 4ZN3A 1C1AA 1NPPA 1ZUYA 1EIFA 3G7ZA 3M57A 1B34A 4C8QF 4M78E 3P8HA 3E2UA 4WCIA 3HSBA 1BIBA 3BDLA 3CC7A 2DFUA 5D7UA 4RUGA 2L3RA 1YJWQ 4PJOB 3C95A 2QEXA 2DL7A 2QA4T 1Z9QA 1W6XA 1TUGB 2CYZB 1ABQA 3EG9A 3H0HA 1SG5A 3MP1A 2DIQA 1YI2A 3QYHB 2ROLA 2PNIA 1PG5B 5FU7C 2RQTA 4FT2A 1M1GA 3JCMc 4GY5A 1IREB 4JPBW 1XNIA 2DYIA 3CC4T 1PKSA 2KNBB 2CT4A 4A63B 1GRIA 2V1QA 4M77B 2BE9B 3I5SA 1ZA1B 3MP6A 1QWEA 4ZNXA 1VQ9Q 2FEIA 5HK0A 3O8VA 2JT4A 3H9NA 3SEMA 3TSWA 3GF5A 1C0MA 2CT3A 1D3BB 3REBB 3X24B 3QHSA 1RAAB 3LGLA 1SHGA 1KHCA 1RLQC 4EIKA 2JN0A 4OB0B 2CZ1B 1M30A 1NG2A 2J7IA 4CRIA 3SDZA 4F04B 4M7DA 4FYYB 4D8DA 3THKA 2RQWA 1RADB 3CCRT 3S3OA 2RA2A 2W10A 3V7RA 1V1CA 4ESRA 1JRIA 5GAN3 1HSQA 1M90U 2M9UA 1I5OB 2ZGWA 5DM7R 3JAME 1G3YA 3CPFA 5CR2A 1TS9A 2EQJA 2HDAA 1E7OA 2A3LA 4A4GA 3HRSA 1X69A 2DLPA 2GQIA 4BE0A 2AIRB 4F7UG 2K2VA 3ZL7C 5GAN2 3VRZA 5J39A 1D0YA 3OYMA 3JB9G
chains in the Genus database with same CATH topology
4FW2A 1IHVA 1C6VX 1IHWA 1C1AA 1QMCA 1C0MA 5D7UA 4FW1A 1EX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FW2 A;  1IHV A;  1C6V X;  1IHW A;  1C1A A;  1QMC A;  1C0M A;  5D7U A;  4FW1 A;  1EX4 A; 
#chains in the Genus database with same CATH topology
 1K0X A;  3VRY A;  2QA4 A;  2YUP A;  1WJR A;  2QAZ A;  1K9A A;  4J5Y A;  3A8H B;  1XOV A;  4BDZ A;  3I56 Q;  4JS4 A;  4BY6 C;  3OMC A;  2FYK A;  2JTF A;  2LTO A;  4QVD A;  1UGV A;  3G71 A;  3KXT A;  2V26 A;  4HCZ A;  3X26 B;  4N0A A;  2LT4 A;  4DBQ A;  2DTI A;  2OTL T;  1WZO A;  3MEW A;  5DLQ E;  4RTV A;  1SEM A;  3QKJ A;  5GAN 8;  2ZPH B;  4N4G A;  3OSS C;  3EGX A;  2E3I A;  3JCM f;  3CCV A;  2LVM A;  2XHC A;  3V8K A;  5GAM f;  3EH2 A;  4RG2 A;  4JJN K;  2RK2 A;  1V76 A;  2E65 A;  3CBM A;  5FLX E;  2FG0 A;  4PLI A;  1OPK A;  5LL6 S;  4JS5 A;  4M75 C;  4HVW A;  2FZK B;  1IRX A;  5GAO p;  1VQN Q;  1WA7 A;  4AFU C;  1Q81 U;  4M7D D;  3CXC A;  5GAN f;  2NUP A;  3MEV A;  4C8Q E;  2KDS A;  5GAN 7;  4ORZ A;  2KY9 A;  4B6M A;  4JZ4 A;  4M7A B;  1YNZ A;  3H41 A;  4C92 B;  2CP5 A;  5DY9 A;  1VQ7 A;  3CCE T;  1ZSG A;  5GMK j;  1M90 C;  1ARK A;  3CME A;  2J05 A;  3OYF A;  2DXT A;  4KGZ B;  2ABL A;  3DLL A;  4ELY C;  1M90 R;  4QW2 A;  3CCM A;  2CH4 W;  1YJN A;  5I2S A;  3OYK A;  1AVZ C;  1IHV A;  2LJ1 A;  2D8J A;  3CD6 A;  1YFN A;  3PFS A;  3I5R A;  3JCM e;  4IUT A;  4N0A C;  1XQH A;  2WSE E;  1E6H A;  4HCK A;  1G2B A;  1K73 U;  2KE9 A;  1ABO A;  1VQ5 A;  1R0B G;  4PJO E;  1M5Q 1;  1OOT A;  2K3B A;  5LJ3 f;  5D6X A;  4J6Y A;  2FPE A;  5GAN e;  3J7A F;  3CCS A;  2AKL A;  2PVG B;  2RQR A;  2M51 A;  4X34 A;  2DIG A;  2OTL A;  3A8L B;  5GMK h;  3MO8 A;  3QJ6 A;  2DE0 X;  5AT1 B;  4XU0 A;  2VAS A;  3CC4 Q;  4MZP A;  5A2Q E;  4M77 E;  3EFO B;  4XTZ A;  4J9E A;  2CH4 A;  3PE0 A;  3MEU A;  2K7A A;  5KCH A;  1GFD A;  3PGG A;  3WVD B;  1Y0M A;  4UC4 A;  3UA7 A;  4KUD K;  3M56 A;  3MCA B;  3PMI A;  1SSH A;  2EQU A;  1UFF A;  4BI3 A;  2FZC B;  2CZ0 B;  2XDD A;  3M0P A;  3DB3 A;  4M4Z A;  4QVC A;  1UE9 A;  1R77 A;  2DX1 A;  4HT8 A;  5LJ3 e;  3CCE A;  3CCR Q;  3QII A;  2DD5 A;  2FRY A;  2RHU A;  1A0N B;  3RR6 A;  5A0G A;  1OX9 A;  1Q81 C;  5LJ5 f;  4LUD A;  1LVK A;  5D6Y A;  4C0D B;  2E10 A;  2VC8 A;  2QG9 B;  2V1R A;  2VVK A;  3CMA Q;  1Q81 R;  1HXD A;  1VQ8 A;  4E7J A;  4O5V A;  2NUT B;  4ZGE B;  1RAH B;  5A0D A;  2LT1 A;  1PKT A;  1M4Z A;  3EAE A;  1O75 A;  3A98 A;  3TVT A;  2GGR A;  4YTL A;  1D0X A;  2XID A;  4F7U A;  5KYW B;  3JB9 J;  4N4I A;  5J3B A;  1EX4 A;  1VQP A;  1O9S A;  3QXE B;  3E19 A;  2GFA A;  1YJW T;  1F1B B;  1YIT A;  4DQ2 A;  4F17 A;  3WXM B;  3MET A;  2VUB A;  3LLR A;  3M0Q A;  5KYX A;  4AFQ C;  1AWW A;  3HFN A;  8ATC B;  3L2V A;  2IPO B;  1KIK A;  3A8O B;  3GP8 A;  4M78 F;  2D0N A;  1NEG A;  1K73 C;  2A28 A;  2EJ9 A;  1B34 B;  2AHJ B;  5GAN 4;  3CCQ Q;  1NLO C;  1KD1 C;  4OGC A;  3UDC A;  1CSK A;  1QKX A;  3QDR B;  2AKK A;  2OTJ Q;  3ZFJ A;  2RJC A;  1H64 1;  1K73 R;  3NMZ C;  2K79 A;  3JCM V;  5FWB A;  3M59 A;  2VXF A;  2DA9 A;  2EJF A;  1YJ9 T;  4EDU A;  4IUQ A;  4C5I A;  4BD3 A;  3MPU B;  3EG9 B;  3M9Q A;  3URG A;  1BI1 A;  4A53 A;  3FB9 A;  5J26 A;  3VV0 A;  1YCY A;  3S6W A;  2YRC A;  1D1B A;  4Z8A A;  4CC3 A;  1VQL T;  4J9F A;  5L8R E;  1TU0 B;  3OYG A;  3OS5 A;  4BE1 A;  2BKD N;  1P92 A;  2V8I A;  3NGP A;  4D8K A;  3CPW S;  2EYZ A;  2RHZ A;  2FPD A;  3VU3 C;  3KUF A;  1QP3 A;  4RTU A;  4NL3 A;  1WHG A;  4J9D A;  2E5Q A;  1VYT A;  1X27 A;  5GMK m;  2KT1 A;  1FMV A;  4Y28 E;  4C92 E;  3FEO A;  1ZSZ A;  4BY6 B;  2ZCF B;  1LCK A;  3RKW A;  2DBK A;  2K5F A;  2EKH A;  4PFZ A;  2QQB A;  3L1A A;  4M7D B;  5FU6 C;  1BIA A;  2DVE A;  2CSQ A;  1TOV A;  4PLL A;  4FYX B;  2NWM A;  2O88 A;  1U1S A;  2EAY A;  2COY A;  2EKO A;  1W2B A;  4E47 A;  2OAW A;  4OMQ A;  2KSS A;  2JM8 A;  5CIU A;  1YIJ T;  1H8K A;  3N5B B;  5GAO m;  5GJW B;  3HRT A;  5CKD A;  2DXB A;  5FRO A;  1WI7 A;  2RD1 A;  3RES A;  3JB9 D;  4E7L A;  2I2L A;  4ZGD B;  4A4K A;  2JMA A;  4J6X A;  4E7K A;  1Z9Z A;  1MGQ A;  4M7A C;  4IUV A;  2QDL A;  5GAN 5;  1QWF A;  3PT9 A;  3NTK A;  3MEA A;  3OYE A;  1VQ9 A;  1U8R A;  5CKB A;  4MDX A;  2QTV A;  2ESW A;  3OS0 A;  4RMO A;  3CPW P;  2YUN A;  1QQJ A;  3X28 B;  2WSF E;  2HQH A;  3OBY A;  2KAF A;  1VQK T;  3S3N A;  1T0J A;  4J9H A;  2IG0 A;  4ZGJ B;  4KUL A;  3ASK A;  4M75 F;  2RH2 A;  1FYN A;  3EGD A;  5FRN A;  2FO0 A;  3JCM Q;  5KCO A;  4PK4 A;  1KQ1 A;  2DIL A;  3X20 B;  4R55 A;  4C8Q G;  1BB9 A;  1ZSZ C;  4NL2 A;  3U23 A;  2RM4 A;  4IUR A;  2LZ6 B;  2O01 E;  2X4W A;  4IKF A;  3EH1 A;  2E3H A;  2DD4 A;  2KR3 A;  2XI9 A;  5FW9 A;  2BTT A;  3RUX A;  2O4X A;  3CXC S;  1ACM B;  2L3S A;  3EGX B;  1G3S A;  1X2Q A;  1D09 B;  4OB1 B;  4FW2 A;  1VQO T;  2O9V A;  4MZM A;  1AWX A;  2SRC A;  3CCU T;  1QW1 A;  2O2O A;  4PFO A;  2NUZ A;  1BI0 A;  2DRK A;  2EWN A;  2PVD B;  3ME9 A;  1QVP A;  1SSF A;  3H0I A;  1SRM A;  4ZN1 A;  2HBP A;  2NUP B;  2V8J A;  3UA6 A;  8AT1 B;  3OYJ A;  2CUB A;  3J80 E;  4KGV B;  2OI3 A;  2EFI A;  3I56 A;  1AZG B;  3QBY A;  1NZ9 A;  3HPW A;  3JCM g;  4J7F A;  1RAG B;  2DTH A;  1ZLM A;  2YUQ A;  2CP6 A;  3VUZ A;  2IIM A;  3OYI A;  2G6F X;  1K0S A;  2EPD A;  3VUB A;  4C5E A;  3G6E A;  4M77 G;  1I07 A;  1TUC A;  4JLG A;  4C0D C;  1FXX A;  3EGU A;  2R5M A;  2Y90 A;  3PIP A;  5GAN g;  4WTO B;  2YLB A;  3G4S T;  1GBR A;  4EMG A;  3BFM A;  1FMW A;  1I1J A;  4PJO F;  2WSC E;  1QVF S;  3CXC P;  1ZHI A;  3EFS A;  3BW1 A;  4ATO A;  3VS5 A;  4HKE A;  1QVG P;  1YJ9 Q;  4XAX B;  3E9G A;  2EYW A;  2W0Z A;  1TTH B;  4VUB A;  1ZUU A;  2KMT A;  1AD5 A;  1VQN A;  1YHQ T;  4HVV A;  2L5Q A;  1WQ7 A;  4PFP A;  3FC3 A;  3FDR A;  1RAI B;  1I81 A;  2E6Z A;  1IHW A;  2L0A A;  1VQL Q;  4M77 F;  2LJ0 A;  5IHN A;  2DO3 A;  2GQV A;  1IO6 A;  1NBE B;  2L3Q A;  2LQ8 A;  5GAM j;  4FYW B;  3E1S A;  3M0U A;  1TSF A;  5CQY A;  5LJ3 g;  2RK1 A;  3L2U A;  4EMK A;  2LNH B;  1B3Q A;  4K11 A;  2AT1 B;  4J83 A;  5DLO A;  1G3T A;  2WAC A;  3CMA T;  3FRN A;  2CDT A;  3I55 Q;  5GAN j;  3EG0 A;  3LH5 A;  1HYO A;  4B9X A;  2ENM A;  2EVR A;  4FL6 A;  3P8B B;  3EG2 A;  2PQW A;  2JJ9 A;  4J9G A;  4RTY A;  4EPC A;  2DXU A;  2HMA A;  2IVW A;  2VWF A;  3CCL Q;  3GNG A;  4E7Z A;  1JBM A;  1BCO A;  1QVF P;  4LNP A;  3RER A;  4J7I A;  5GAO r;  2ZPB B;  1WHK A;  1RAB B;  1NYF A;  1UGP B;  2LCC A;  4OGE A;  1UUE A;  2OX7 A;  1MMG A;  3JCM h;  1BK2 A;  3GBQ A;  2GBQ A;  2RJF A;  1YIJ Q;  1TG0 A;  4HXJ A;  2ZPE B;  4P5N A;  5CO7 A;  3OW2 A;  2EIF A;  1UJ0 A;  5HK3 A;  3CCQ T;  3EFR A;  6AT1 B;  3UAT A;  2DZC A;  2ED1 A;  2BE7 D;  3RMS A;  4M75 E;  1NJI U;  3F70 A;  2DRM A;  1AWJ A;  3TSZ A;  3CC4 A;  2MOX A;  2KXC A;  2M16 A;  2OTJ T;  4R56 A;  1OX8 A;  2DTO A;  3KFV A;  4F7U B;  1UJY A;  4WF2 A;  2KYB A;  1N9R A;  2MI6 A;  5GAN h;  1M8V A;  1R0C B;  5LJ3 j;  4M7D C;  3TU4 K;  3LH0 A;  4LXC A;  1G3W A;  1N8R U;  2RF0 A;  3M53 A;  3SFM A;  4HA8 A;  5KYX B;  3OA6 A;  1VQK Q;  5LJ5 g;  1MNE A;  3VS7 A;  5FU6 B;  4EMK C;  4X9D A;  2VYT A;  1WIE A;  2B86 A;  4Z89 A;  1YI2 Q;  1WHJ A;  2ATC B;  3C0C A;  3CCR A;  2D6F A;  1VQ6 Q;  2QAS A;  4C8Q A;  4PJL A;  5HY6 A;  2J6O A;  2LJ3 A;  4IUU A;  1X6O A;  3OS1 A;  3SHW A;  4BDY A;  1JJ2 A;  3OSV A;  4KGX B;  2M02 A;  3OYN A;  1M3B A;  1D0Z A;  1FWZ A;  3P8D A;  1N27 A;  5LJ3 h;  5M9O A;  1ZBJ A;  5AYF A;  1VQO Q;  4OP0 A;  2YRD A;  1QCF A;  3CCU Q;  2EGA A;  4TVR A;  1VYV A;  2RHY A;  4J9C A;  3T9N A;  1JQQ A;  5LJ5 j;  3JB9 H;  3DLM A;  2QI2 A;  1FMK A;  2XKO C;  2K6D A;  4AG2 C;  3QPH A;  4M7A F;  1UGQ B;  4C92 F;  1W2B S;  1CKA A;  5GAM e;  1KQS A;  5CVI A;  3CCQ A;  3TRE A;  2EJG A;  1ZSZ B;  4FSS A;  2E70 A;  2JZ2 A;  3Q1J A;  4L5G A;  2CZ6 B;  2HCK A;  1X6G A;  2YSQ A;  2LX9 A;  3QG1 A;  5IXF A;  1WX6 A;  3RKX A;  1UGS B;  4QQ6 A;  3RNJ A;  4HCB A;  2ED0 A;  1OEB A;  4MDW A;  2XD0 A;  4L59 A;  1NJI C;  2YLC A;  1VOM A;  2EYX A;  2A36 A;  1KG1 A;  2Z0W A;  2KEA A;  4OMF B;  3G4S Q;  1WPY A;  3L2R A;  3NTI A;  3MP8 A;  1NJI R;  2P4R A;  1AT1 B;  2G3R A;  1T3L A;  4II1 A;  5LJ5 h;  2QYZ A;  3OQ5 A;  4JDS A;  1Q7Y U;  2HSE B;  2DEQ A;  3M54 A;  3OYY A;  2RN8 A;  2C0I A;  3UT1 A;  2VKN A;  1KFZ A;  1T3S A;  1U3O A;  4OB3 B;  1WXU A;  1OV3 A;  1YHQ Q;  4GLM A;  3DKM A;  1N8R R;  5KYY A;  1NYG A;  1YWO A;  1M2V A;  2JM9 A;  4CI0 C;  4E6R A;  1VQM T;  2RB6 A;  2FL7 A;  4C8Q D;  3NHN A;  5FRM A;  1KC8 U;  2YRV A;  2LCS A;  3LGF A;  1W2B P;  2A37 A;  1M27 C;  3EGD B;  2O9S A;  1AHJ B;  1VYU A;  4XU1 A;  4M78 G;  3OS2 A;  3CCJ T;  1PC0 A;  2DMO A;  3CQT A;  3RBB B;  3JCM b;  3EG1 A;  1YP5 A;  2XK0 A;  3JCM W;  2K5L A;  1UTI A;  3HKS A;  2E6N A;  2Y4Y A;  2ZPI B;  3CC2 T;  3H8Z A;  2DM1 A;  2O4X B;  3M58 A;  3JSC A;  3V7C A;  4DBF A;  1IB8 A;  3NPF A;  4JRK A;  1S72 T;  3VJP A;  2PU9 B;  3PVQ A;  5IXB A;  4J8O A;  2F1L A;  2PZ1 A;  1VUB A;  1RAC B;  3L2Q A;  1VQ7 Q;  2KVQ G;  2RPN A;  2X3X D;  4XTV A;  3X25 B;  1JXO A;  2HQE A;  3CME Q;  1M1K U;  2EQI A;  2QGG A;  2YT6 A;  4MMK A;  1K9M U;  3PMT A;  3JCM J;  4LDX A;  4J9B A;  2HSP A;  2F2X A;  1UDL A;  3KBG A;  2D1X A;  2F2W A;  1ZQ1 A;  5LJ5 e;  4OMO A;  3UPU A;  2J6F A;  2LDM A;  2P84 A;  3VYG A;  1GXI E;  4C0G A;  5GAO l;  3A1P A;  1M3C A;  4IIO A;  1WXB A;  2D0Q B;  1HJD A;  1Q7Y C;  5IHK A;  4IUP A;  2C0O A;  2YUO A;  3CCS Q;  2EGC A;  3C12 A;  4KUI A;  1T0H A;  3SWN A;  1Q7Y R;  2K2M A;  2LRQ A;  3OB9 A;  1GCQ A;  1G5V A;  4NOY A;  3DB4 A;  4V2S A;  1PSF A;  1BBZ A;  2KQW A;  2C0T A;  5CKH A;  2F5K A;  2L89 A;  4JRP A;  1YN8 A;  3LWH A;  1KC8 C;  3AT1 B;  1H3H A;  4M7A E;  4RG8 A;  1UEB A;  3FJP A;  2EQM A;  2LC4 A;  4O6J A;  1M3A A;  3I55 T;  3HTR A;  2ZZD A;  4DOW A;  1UHF A;  3QZ5 B;  1KC8 R;  1YBY A;  4CC4 B;  1BCM A;  2RI5 A;  1QCO A;  3H0F A;  4KH1 B;  2CGH A;  2DZ9 A;  3CCL T;  4JJB A;  3L2W A;  1KQ2 A;  1WXT A;  3S3M A;  4B9W A;  1RAE B;  1YJW A;  2LX7 A;  1Y7X A;  2RO0 A;  3M5A A;  1AZE A;  4JZ3 A;  5ECA A;  3TEE A;  4M75 G;  3I9Q A;  3PNW C;  2CP2 A;  3INZ A;  4EMK B;  1RLP C;  2L8D A;  4E7I A;  2E12 A;  2X35 A;  4XU2 A;  1C6V X;  3GLX A;  2MK5 A;  1Q86 R;  3QZ9 B;  4XTU A;  5CKF A;  4M7D F;  3FJ5 A;  1YWP A;  4PJJ A;  1Y71 A;  1OQK A;  5IHI A;  4PL6 A;  2A7Y A;  3OW2 S;  2GF7 A;  2JTE A;  2OJ2 A;  4JRQ A;  4DEY A;  1YJ9 A;  1GBQ A;  5L23 A;  2QQ9 A;  3CC7 T;  2VV5 A;  1M1K C;  3SWN C;  2L3P A;  2DKG A;  3OYH A;  1K9M C;  3IQL A;  1TXQ A;  2R57 A;  1VQP Q;  3L2Z A;  1GCQ C;  1X75 C;  2K3X A;  1M1K R;  5GAO n;  5EC7 A;  1K9M R;  2LNV A;  3CEY A;  1VQL A;  2XIC A;  3QUI A;  1YI2 T;  3JCM X;  1LJO A;  4ZTF A;  1TUD A;  1VQ6 T;  1S1N A;  2X3W D;  3FIF A;  2ECZ A;  1WDX A;  5GJV B;  4J9I A;  3EHR A;  4J6W A;  2X4X A;  2DL4 A;  2RI3 A;  1JB0 E;  2DJZ A;  1RI9 A;  1UB4 A;  1VQM Q;  1QCN A;  4HT9 A;  3VKI A;  1JJ2 S;  2KK4 A;  3HHT B;  2VB6 A;  2HQX A;  2HEQ A;  4FIB A;  1WNL A;  1K76 A;  2X4Y A;  2EYQ A;  3MJX A;  3CCJ Q;  1OYX A;  1PD1 A;  3GPL A;  1PRM C;  4M78 A;  3OW2 P;  4C8Q B;  3VYH B;  3LYI A;  1VA7 A;  1Q95 G;  3M0S A;  5HCK A;  4PJO G;  2DNU A;  2R5A A;  1YIJ A;  1WJQ A;  3BDU A;  3CC2 Q;  2GCX A;  3HP9 A;  2LQN A;  4DA4 A;  4MZT A;  4OMN A;  1MMN A;  1VQ4 Q;  1CKB A;  1Y96 A;  4LDU A;  2CKK A;  3VS4 A;  2HZY A;  1OZ3 A;  1S72 Q;  1KQS S;  4FU6 A;  5GAM g;  2CP0 A;  2AK5 A;  3RDV A;  1LOJ A;  3OMG A;  4QKU A;  2LMJ A;  5IT9 E;  3OYC A;  4PNO A;  4XU3 A;  4JJD A;  1VQK A;  2BZY A;  2XMF A;  5GAN 6;  5A0L A;  2DL3 A;  2KT8 A;  1KHI A;  2FVU A;  4R0K A;  1RL2 A;  4JJC A;  1WJS A;  1JJ2 P;  4RTZ A;  4LD9 K;  3REA B;  5KYN A;  1PWT A;  2ZPG B;  4AMC A;  1IGU A;  1QKW A;  2RQU A;  2RQV A;  2KGT A;  2BIV A;  1MMD A;  1RI0 A;  1GL5 A;  2EQK A;  1VQ6 A;  2KBT A;  2K3Y A;  2B8A A;  9ATC B;  3AHU A;  3BE3 A;  1X01 A;  2KRS A;  2CUD A;  1QP2 A;  2MYS A;  1EZZ B;  2MWP A;  5I2M A;  4M78 C;  2SEM A;  5IN1 A;  3LW5 E;  4RCC A;  3QWY A;  3G71 T;  1N5Z A;  3RKY A;  1QMC A;  4QQG A;  2DXC A;  3VS1 A;  4XQ3 A;  3VS6 A;  1VQO A;  4BE2 A;  3CCU A;  2JNG A;  3JCM d;  4ELZ C;  4KBM B;  4HCC A;  5GAM d;  3OYD A;  1KQS P;  3CCV T;  3CPW A;  2JUF A;  2XU8 A;  2RJD A;  2QGF B;  5KYY B;  5C0M A;  3C4S A;  1M2V B;  2K4Y A;  1JU5 C;  2D9T A;  3LWI A;  4M78 D;  4M7D E;  4D6W A;  1NLP C;  5GAN d;  2FPF A;  1VIE A;  2XDB A;  1NM7 A;  5KYU B;  1D1C A;  4E2F B;  1NE8 A;  2M0Y A;  2L2P A;  2HL3 A;  1V29 B;  4C0Z A;  1SHF A;  3QJY A;  4NS5 A;  5I11 A;  2M1H A;  4AFS C;  4M75 A;  3M4G A;  1VQ7 T;  3A5Z B;  1ZUK A;  2M0O A;  5GAM h;  4GLK A;  1GCP A;  1MND A;  5IAY A;  3CME T;  2EGE A;  1JXM A;  5HKC A;  1H92 A;  4PKC C;  1PRL C;  2VGN A;  2VXE A;  2X4J A;  3G4S A;  3CCM T;  2JS0 A;  1YJN T;  4KT0 E;  1ZX6 A;  2J06 A;  4LE9 A;  4BUG A;  1M9S A;  2DL5 A;  1IGQ A;  2RMO A;  4HVU A;  3BY7 A;  3HFO A;  3CD6 T;  1AWO A;  2YXY A;  3TQ7 P;  5FWC A;  2OAU A;  3V7S A;  2ZPF B;  3CC7 Q;  4KRT A;  4XK8 E;  2PVO B;  4LDW A;  3M4Y A;  1RAF B;  2LCL A;  5LJ3 d;  5CKE A;  5EG2 A;  1YHQ A;  1VQ5 T;  2BZ8 A;  1OI1 A;  4X1V A;  2QEX Q;  1W1F A;  2P4T A;  1KSW A;  4F7U F;  1G8X A;  3G6E Q;  4L6V 5;  3CCS T;  2AZS A;  5GMK i;  4M7A G;  1WHH A;  3ZEH A;  2H3J A;  4C92 G;  2DYB A;  2Y4X A;  3JB9 F;  3UWN A;  1BI3 A;  2QQS A;  1ZBX A;  2YWW A;  2C06 A;  1HD3 A;  2BUD A;  3A8M B;  3CMA A;  1TWB A;  1BKB A;  2CRE A;  5IH2 A;  1K8A U;  4LUE A;  3GNF B;  4FYV B;  1OU8 A;  1QLY A;  1B7T A;  2RJE A;  5C6S A;  1LNX A;  2JW4 A;  4DBR A;  3SWN B;  1QVG A;  2MCN A;  4A54 A;  4ZTJ A;  1MHN A;  2KI7 A;  3OYB A;  2J6K A;  2LP5 A;  3VS3 A;  4A4F A;  3A8G B;  2MMP A;  4JUV A;  4Q5W A;  4PJM A;  2DBM A;  4AG1 C;  2HNI A;  5LJ5 d;  3OYA A;  4PJO A;  3JCM P;  3D7S B;  2QQA A;  2DET A;  1IXD A;  4XTX A;  1IZ6 A;  3NFC A;  3HRU A;  1WQW A;  2DVJ A;  1G83 A;  2OTJ A;  4M75 D;  1I8F A;  1E6G A;  1PM3 A;  4CC2 A;  1VQ8 T;  4RCB A;  3C94 A;  2KXD A;  1N9S A;  2HD0 A;  2F2V A;  2MWO A;  1KJW A;  3ER0 A;  2HL5 C;  4FW1 A;  4C5G A;  3M0R A;  2QQR A;  3VS0 A;  4OB2 B;  4M77 A;  4C8Q C;  1KD1 U;  4C0F A;  3M55 A;  2O31 A;  1VQP T;  2A0F B;  2R58 A;  4JLI A;  4BI4 A;  4FT4 A;  2QA4 Q;  2RNA A;  1YIT T;  1NPR A;  2AZV A;  2PUO B;  1D3B A;  1MMA A;  1KK7 A;  4QT7 A;  4C5H A;  1SPK A;  1WFW A;  1N8R C;  3G1J A;  4ME7 A;  1X6B A;  3TCJ A;  1OUL A;  3EHQ A;  2E5K A;  1U1T A;  1QVF A;  3I35 A;  1PSE A;  1AEY A;  1WYX A;  1W4S A;  2DF6 A;  4E7H A;  2D8H A;  3QWX X;  2A08 A;  3PTA A;  2MAM A;  3ULR B;  2QXF A;  4DEX A;  3R6O A;  3G71 Q;  2ROT A;  4OMM A;  3LX7 A;  4OMP A;  2COZ A;  4QVZ A;  1PHT A;  4LDY A;  1TH7 A;  4EMH A;  1WHL A;  5KYU A;  3OY9 A;  2KRM A;  1U5S A;  4FSX A;  3SB2 A;  4PJO C;  5KE2 A;  4A4E A;  5KH6 A;  1AOJ A;  2F5T X;  2JTM A;  2QTX A;  1R8O B;  1UG1 A;  3CCV Q;  1K4U S;  4XTY A;  3M0T A;  2KRO A;  1K8A C;  2P0P A;  1X43 A;  1B07 A;  2DL8 A;  2JS2 A;  1YCS B;  4RTW A;  2RHI A;  1I0C A;  1Q86 U;  1FX7 A;  4N4H A;  1PCX A;  3E9F A;  1PD0 A;  1K8A R;  4M77 C;  5FU7 B;  1VQ4 T;  1D1A A;  1J3T A;  5D6W A;  4PJO D;  1UGR B;  5GMK l;  3L42 A;  4M78 B;  3JB9 I;  7AT1 B;  4DBH A;  3OBW A;  2DJQ A;  2P0Q A;  2FRW A;  1ZA2 B;  2HAX A;  1HK9 A;  3NTH A;  4AT1 B;  1UEC A;  2RI2 A;  2X9H A;  3PIO A;  2PTK A;  3CCM Q;  1W70 A;  3JV3 A;  1WHM A;  4F7U E;  1YJN Q;  2K57 A;  5KE3 A;  1XJW B;  4M77 D;  3CD6 Q;  3MKD A;  1Y96 B;  4FM4 B;  5GMK e;  2F69 A;  2NYS A;  3QDF A;  4MML A;  1OZ2 A;  1VQ5 Q;  2QK0 A;  3O5Z A;  2FZG B;  1Q82 U;  1JEG A;  2V8K A;  2FHD A;  1KD1 R;  4Y91 A;  4FCY A;  1SRL A;  1VQM A;  2E4H A;  2CSI A;  3SD4 A;  3R6N A;  1VQ9 T;  4X9C A;  2JOY A;  2HKQ B;  2P0K A;  1DJ7 B;  2OTL Q;  5GAO q;  4RTT A;  2RHX A;  1NEB A;  4LDV A;  2E64 A;  2JVV A;  4M7A A;  2KRN A;  1M8M A;  4C92 A;  2NLU A;  3CCJ A;  3CBP A;  2XG8 D;  3RMQ A;  2E41 A;  4M7D G;  2EW3 A;  2PUK B;  1WGS A;  1N6A A;  3VS2 A;  4OML A;  2FB7 A;  2CP7 A;  1I5L A;  4OF1 A;  4A4H A;  3PVL A;  5I22 A;  3CC2 A;  1H3Z A;  4BB7 A;  4GBQ A;  3ZBD A;  2CZ7 B;  1VQ4 A;  4XTW A;  2COW A;  2YHT A;  1S72 A;  3CBO A;  1RUW A;  1PNJ A;  1X2K A;  2GFU A;  2CP3 A;  3QSU A;  1Q86 C;  4JRI A;  2X51 A;  3QYG B;  5CK9 A;  3CCE Q;  1Y57 A;  2DAQ A;  2BZX A;  2H3E B;  1M2O A;  4F14 A;  2MPX C;  3EG3 A;  4Z02 A;  1SKU B;  2MIO A;  4BI8 B;  4CC7 A;  2XDP A;  2VGM A;  4F16 A;  1VQ8 Q;  1VIF A;  3UF4 A;  3HL8 A;  4KH0 B;  3J81 E;  2K9G A;  2K5I A;  4IIM A;  4RKU E;  3OYL A;  4E7S A;  1GFC A;  2DK3 A;  3EFO A;  1XTD A;  3I56 T;  3RIR A;  4M75 B;  4OVA A;  2DPP B;  2EBP A;  4C92 C;  4LN2 A;  1YIT Q;  2QEX T;  3MHX A;  1K1Z A;  1MV0 B;  5I21 A;  4AFZ C;  1BI2 A;  1LPL A;  4BAC A;  3H6Z A;  3QO3 A;  3G6E T;  2H8H A;  2DEU A;  1OU9 A;  1Q82 C;  5CQX A;  3V8J A;  2GTO A;  2MF2 A;  2GTJ A;  4DOV A;  4Z88 A;  1Q82 R;  1WLP B;  2LQK A;  2I0N A;  1MV3 A;  1MUZ A;  1M1F A;  2JMC A;  4Y92 A;  3I55 A;  3V8L A;  4RTX A;  5CCA A;  4M7A D;  4C92 D;  2CS7 A;  1Y07 A;  1OPL A;  1SF9 A;  2JXB A;  4QQD A;  4PJN A;  1VQN T;  1JO8 A;  2HBW A;  2ZAE A;  4LD6 A;  2NUT A;  3CCL A;  2DER A;  2KYM A;  1BU1 A;  1BYM A;  2YDL A;  1EFN A;  2LQW A;  2GNC A;  2HKN A;  1UHC A;  2QDY B;  1U06 A;  5KYW A;  1QVG S;  2EYY A;  3WVE B;  3JRZ A;  2E1H A;  3FLG A;  5CAI A;  1I4K 1;  4ANJ A;  3GOX A;  3GIB A;  4ZN3 A;  1C1A A;  1NPP A;  1ZUY A;  1EIF A;  3G7Z A;  3M57 A;  1B34 A;  4C8Q F;  4M78 E;  3P8H A;  3E2U A;  4WCI A;  3HSB A;  1BIB A;  3BDL A;  3CC7 A;  2DFU A;  5D7U A;  4RUG A;  2L3R A;  1YJW Q;  4PJO B;  3C95 A;  2QEX A;  2DL7 A;  2QA4 T;  1Z9Q A;  1W6X A;  1TUG B;  2CYZ B;  1ABQ A;  3EG9 A;  3H0H A;  1SG5 A;  3MP1 A;  2DIQ A;  1YI2 A;  3QYH B;  2ROL A;  2PNI A;  1PG5 B;  5FU7 C;  2RQT A;  4FT2 A;  1M1G A;  3JCM c;  4GY5 A;  1IRE B;  4JPB W;  1XNI A;  2DYI A;  3CC4 T;  1PKS A;  2KNB B;  2CT4 A;  4A63 B;  1GRI A;  2V1Q A;  4M77 B;  2BE9 B;  3I5S A;  1ZA1 B;  3MP6 A;  1QWE A;  4ZNX A;  1VQ9 Q;  2FEI A;  5HK0 A;  3O8V A;  2JT4 A;  3H9N A;  3SEM A;  3TSW A;  3GF5 A;  1C0M A;  2CT3 A;  1D3B B;  3REB B;  3X24 B;  3QHS A;  1RAA B;  3LGL A;  1SHG A;  1KHC A;  1RLQ C;  4EIK A;  2JN0 A;  4OB0 B;  2CZ1 B;  1M30 A;  1NG2 A;  2J7I A;  4CRI A;  3SDZ A;  4F04 B;  4M7D A;  4FYY B;  4D8D A;  3THK A;  2RQW A;  1RAD B;  3CCR T;  3S3O A;  2RA2 A;  2W10 A;  3V7R A;  1V1C A;  4ESR A;  1JRI A;  5GAN 3;  1HSQ A;  1M90 U;  2M9U A;  1I5O B;  2ZGW A;  5DM7 R;  3JAM E;  1G3Y A;  3CPF A;  5CR2 A;  1TS9 A;  2EQJ A;  2HDA A;  1E7O A;  2A3L A;  4A4G A;  3HRS A;  1X69 A;  2DLP A;  2GQI A;  4BE0 A;  2AIR B;  4F7U G;  2K2V A;  3ZL7 C;  5GAN 2;  3VRZ A;  5J39 A;  1D0Y A;  3OYM A;  3JB9 G; 
#chains in the Genus database with same CATH homology
 4FW2 A;  1IHV A;  1C6V X;  1IHW A;  1C1A A;  1QMC A;  1C0M A;  5D7U A;  4FW1 A;  1EX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...