1C6VX

Siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
55
structure length
55
Chain Sequence
KNSKFKNFRVYYREGRDQLWKGPGELLWKGEGAVLLKVGTDIKVVPRRKAKIIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structure of simian immunodeficiency virus integrase containing the core and C-terminal domain (residues 50-293)--an initial glance of the viral DNA binding platform.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Dna binding protein
molecule keywords PROTEIN (SIV INTEGRASE)
total genus 5
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 1999-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00552 IN_DBD_C Integrase DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.10 Mainly Beta Roll SH3 type barrels. Integrase, C-terminal domain superfamily, retroviral 1c6vX00
4FW1A 1QMCA 1C6VX 1IHVA 1C1AA 5D7UA 1EX4A 4FW2A 1IHWA 1C0MA
chains in the Genus database with same CATH superfamily
2QEXT 2D8JA 1U3OA 1AOJA 4PL6A 4RTTA 1NJIR 4FIBA 3I55T 1PNJA 4C8QF 1M1KU 3V8LA 3RDVA 4P5NA 3OS0A 1NLOC 2JMAA 2DTHA 4AMCA 2XIDA 2K4YA 4C92C 1K9MU 1ZSGA 3VU3C 4QVCA 4M77E 1JQQA 2VC8A 1YNZA 1M8VA 3QHSA 5HK3A 2I0NA 3M0PA 1QCNA 1VQ8T 2JS2A 2DIQA 4AFQC 1AT1B 2HMAA 3H0FA 4IUUA 1M90R 2KBTA 3I56A 4GBQA 1BCOA 4PFZA 1NZ9A 2DL8A 4HCCA 2WSEE 2BIVA 2EAYA 1G3TA 2AHJB 4RCCA 5M9OA 1IZ6A 1OEBA 3TU4K 1SSFA 2B86A 3MHXA 2VGNA 2FRYA 4JZ3A 5FU6B 2YHTA 1WFWA 3CCUA 1K0SA 1SSHA 1T0HA 2PVOB 4FSSA 5GMKj 3L1AA 3MPUB 1RAGB 2DBKA 3HSBA 2E64A 1ABQA 2GTOA 3SEMA 4B9WA 3MP6A 2KEAA 2RF0A 1UGPB 2LVMA 1AZGB 1R8OB 1RAEB 4X34A 1M8MA 4A4KA 4WF2A 3HHTB 1KK7A 1I8FA 3THKA 4LUEA 2KQWA 3VUBA 2HQEA 2O88A 1QCOA 3H9NA 2DEQA 1BKBA 3SFMA 1OZ3A 3C0CA 3CCVA 2BE7D 3V8KA 5I22A 4JS4A 5J3BA 4X1VA 3SWNB 2HSPA 5L23A 1QVGA 2OAWA 3J7AF 4AFZC 5C0MA 2DO3A 1X27A 2COZA 1U1TA 2L2PA 2AKKA 3SB2A 3EH2A 2DRMA 3RMQA 5GAN5 3FC3A 1V29B 5LJ5d 3L2UA 4N4IA 2GQVA 2LQ8A 3CPWA 3SWNA 2XDBA 5GMKl 2MWOA 3OYYA 4KGXB 3CCMA 2C0TA 4E7HA 5LJ3h 3CMAQ 5D6WA 3CXCS 5DLOA 1VQMQ 3I56T 1CKAA 3S3NA 2XK0A 3RKYA 1VQKA 2K5FA 1ABOA 1SF9A 1VOMA 1WHJA 3UDCA 1LNXA 3CCQT 1WQ7A 2K6DA 1RUWA 2EWNA 3P8BB 4BE2A 2OX7A 2ZPHB 2P4RA 3CMAT 1VQ5A 2EKHA 2KVQG 1D0XA 3VS7A 1N8RC 1PRLC 2PVGB 1QVPA 3OYEA 5A0GA 3SHWA 2ED1A 2EW3A 1KD1C 4M7AG 4M78F 2HBPA 3SD4A 3L2RA 1WHHA 4WTOB 3I55A 4AT1B 1TTHB 1M4ZA 4RMOA 4IUVA 2LQWA 1N5ZA 4BDYA 1X6OA 2FO0A 2W0ZA 5GANe 3CMEA 2RQRA 4DBHA 4ZGEB 3OQ5A 4F17A 1NEGA 2OI3A 2RQVA 3VS5A 1FXXA 1YJ9T 4C8QE 2WSCE 2DL3A 2L3PA 3I5SA 1KQ2A 3CCQA 4OP0A 3JB9I 2LNHB 1KSWA 2RD1A 4F04B 3CC2T 1M2VB 1VQ4T 2O9VA 3GOXA 2JW4A 2CGHA 2B8AA 4M7AF 4GY5A 2C0OA 1B3QA 2EQMA 4LUDA 3EGXB 4RTZA 5LJ5e 1VQ7Q 2HL3A 3CPFA 1WNLA 1G5VA 1AWJA 1J3TA 3JCMQ 1JEGA 1O9SA 3CC7A 1SG5A 2RHYA 3LH0A 3OYCA 2J05A 2QTXA 2X4JA 3QYHB 3L42A 2QXFA 3HP9A 2PUKB 1YI2A 1MHNA 4M78D 3I55Q 2MPXC 1D1AA 2LT1A 2RHUA 2OTLQ 2P0QA 1PG5B 1LVKA 1ZSZA 3BDUA 2KRSA 3G6EQ 5GAN6 2E5KA 2CS7A 2A0FB 3H0HA 2C0IA 2R57A 4J7IA 3AT1B 1QVFP 3TREA 3M56A 2YUOA 3QIIA 2XG8D 1V1CA 1GCQA 4XAXB 2RI5A 1EX4A 4ME7A 3H6ZA 5GAOq 4M7DB 4AG2C 4KGVB 3EHQA 1C0MA 3OB9A 4GLMA 1Q81U 4M75G 4Q5WA 1VYTA 3M9QA 4DEYA 4D8KA 2O4XB 2DERA 4R0KA 1K73C 2Z0WA 2W10A 4DEXA 2EVRA 2DZ9A 2MAMA 3CCSQ 4LDUA 7AT1B 4A4EA 4C92G 2VB6A 4PJOG 5GAOn 3JCMX 1YITA 1M90U 3MO8A 1VQNA 1NJIC 3EG0A 1SHGA 1RAAB 1VQLA 4OVAA 2E70A 2O01E 3CCLQ 2IIMA 2DD5A 5EC7A 2FHDA 1WXTA 3SWNC 2HZYA 2LDMA 2MF2A 2X4XA 1VQ6Q 2QASA 4E7IA 1PD0A 5KYXB 4M7DG 1GBRA 3PTAA 1N9RA 2DMOA 3S6WA 4M77G 4F7UE 4OGCA 4LE9A 3A98A 4KUIA 3JCMW 2JTEA 4C8QD 2HL5C 1PSFA 2CREA 1X43A 2QA4T 1UHCA 2EYQA 1Q7YR 3I35A 2XKOC 1WJQA 4M77C 1BK2A 4M7DF 3QDRB 5EG2A 1K76A 3E9FA 2DILA 4J9FA 2CP6A 1B34B 1PC0A 5LJ3g 3NHNA 3CPWP 1YCSB 2DKGA 4RTYA 3WVDB 2X4WA 3CC4Q 3V7RA 3OMGA 1H92A 5L8RE 3U23A 1JB0E 2FZKB 3CCUQ 2ZPFB 4M78E 1VQLQ 2NYSA 4IIMA 2V26A 1M3AA 2COYA 4C0DB 2V1RA 3H41A 1JO8A 1M9SA 1D0YA 4PJNA 2JN0A 2KAFA 2JS0A 4XU0A 4DA4A 5CR2A 2J7IA 4J7FA 1W2BP 3DB4A 1OV3A 2HKNA 1YN8A 1ZA1B 4FT2A 2EPDA 4L59A 3REAB 2F69A 1QP2A 3MEWA 2DYIA 2G6FX 3REBB 4QVDA 2M16A 2K57A 5CQXA 4O6JA 2FG0A 5GAOr 1OULA 3EG3A 4RUGA 2DXCA 1OZ2A 1YI2T 1U5SA 3EFOA 3JB9F 1X2KA 2DYBA 4A54A 2F1LA 2KDSA 5CVIA 1N8RU 4L6V5 2CZ7B 2KY9A 3JCMf 2L0AA 4M75A 3HPWA 3QBYA 1X2QA 3CC4A 4JLIA 2K79A 5GAN4 5CK9A 3CCMQ 1ZBJA 2ZPEB 4E7SA 1KHIA 3CMAA 2E65A 1YJNA 1SEMA 2QGFB 3KXTA 4C92A 1AEYA 1RAHB 2E1HA 2X51A 1OU9A 2A7YA 1HD3A 2EKOA 3KUFA 1H641 1VQKT 3PFSA 1WDXA 2PNIA 4IUPA 3UPUA 1NM7A 1G3SA 4BDZA 3HRUA 4HT8A 4N4GA 1BI0A 1PKTA 2ZPGB 1TSFA 5KYWA 3A8GB 4CI0C 2RK1A 4D6WA 1KIKA 4FCYA 2R5MA 3QZ5B 1O75A 2PQWA 5LJ5j 4M7AE 4FM4B 1QKWA 3R6OA 1I07A 1ZUYA 4LDVA 5DM7R 1EFNA 2E6NA 5LJ5h 2JTMA 2KSSA 1LPLA 3OS2A 1QVFA 3X25B 1ZHIA 4LDYA 4HCKA 1S72T 1PCXA 3M4GA 2VVKA 1KHCA 4ELZC 3KBGA 4BI8B 5GAMe 5KE3A 4E6RA 2QA4Q 4Z8AA 2WSFE 1K8AR 1UJYA 3TVTA 2XDPA 2CT3A 4Y92A 4HA8A 5FW9A 1QVFS 4M7AC 2ED0A 2FL7A 1NEBA 5ECAA 2M02A 4BI4A 2J6KA 5KYYA 1HK9A 2ZPBB 2LJ1A 1OI1A 3PMTA 1IO6A 2CH4A 3QWYA 1UGVA 2M0YA 1JXOA 4MDWA 5D6XA 3JB9G 2LTOA 2QQAA 2RB6A 1W2BA 3L2QA 2CZ1B 1BCMA 3L2ZA 2RN8A 3A8MB 5HCKA 1WPYA 2E10A 4MZTA 3L2WA 3VJPA 2VXEA 1AHJB 3OS1A 4RTVA 2J6OA 1K8AU 1WHMA 2KE9A 4OGEA 1QVGP 1SKUB 1XTDA 5KYWB 1X01A 1E6HA 2BZ8A 3JCMg 3FB9A 1Q81C 4CC2A 2Y4XA 2QEXQ 3UA7A 3JAME 2YSQA 2L3RA 1VQ9A 1KC8U 4CC4B 2E12A 2FZGB 4E7LA 3MJXA 3DB3A 2V8JA 3JB9D 2RI3A 4J6XA 4KRTA 1UFFA 3ME9A 3I5RA 3GIBA 1MMGA 5LJ3j 1K0XA 3ER0A 2RNAA 5CKEA 4QT7A 4J9HA 1Y96B 5GAOm 3G6ET 4M75B 4DOVA 2NUPA 2GFUA 5D7UA 4PJOE 4M78A 1OPKA 2BZYA 1YITT 1UGSB 3OYAA 4LNPA 1IGUA 1QLYA 1KG1A 4B9XA 4PJOB 1RADB 2X3XD 4B6MA 2JNGA 3PVQA 3RNJA 3P8DA 4ORZA 3OA6A 3CCLA 1YHQQ 1WZOA 2DE0X 2CKKA 3VS2A 1YJWA 4M7DE 5LJ3f 2JMCA 5A0DA 2F2WA 8AT1B 4F7UG 2GFAA 3QWXX 2JTFA 1GCQC 1JBMA 2LJ3A 1VIEA 2DXBA 4M7AB 3RESA 1OX8A 3JCMP 4PFOA 4XK8E 2D1XA 2K3XA 3FLGA 1UHFA 4C5EA 2YUQA 1ZQ1A 4A4FA 3TSWA 2XICA 1VQOA 2BZXA 1HYOA 2JOYA 3M55A 1M1KR 1JU5C 1BU1A 5IN1A 2NWMA 5IXBA 1VYUA 4J83A 2DX1A 5A0LA 2L8DA 2CDTA 1UG1A 4M7DD 4M75F 2COWA 1JJ2S 4JZ4A 5FU7B 3M4YA 4FL6A 4M78G 5HY6A 1A0NB 1WHGA 1N8RR 4OMOA 4FU6A 3OS5A 1KQSA 1BBZA 3OYFA 3JCMc 3CEYA 4ZN3A 2NUTA 4TVRA 4Y28E 4CC3A 3MP1A 5FU6C 2FEIA 3CCJT 5J39A 3TCJA 1R0BG 5KYXA 3C12A 1QP3A 1W4SA 2DRKA 1YJ9A 2SEMA 4JJNK 3I56Q 1VQMT 4MDXA 5KYUA 3EFSA 3NFCA 1TS9A 1TH7A 4CC7A 3CD6A 3LYIA 5KCHA 5GAMd 3M0RA 1YWOA 5CKFA 1D0ZA 3EHRA 2RJDA 2DJQA 3IQLA 1SHFA 1D3BB 3G71A 4DBQA 1KFZA 3OW2P 1Y07A 4IUTA 3EG9A 2VASA 1OOTA 1D3BA 1TUGB 1TOVA 2GGRA 4OB3B 1UEBA 1GCPA 4XQ3A 5HK0A 2YRCA 2EIFA 4PLIA 1WHKA 4J9DA 4XTWA 1QWEA 4FW1A 1GFCA 3NTKA 2X35A 4EMKA 2FVUA 3C95A 3RMSA 4KBMB 1G3YA 2LC4A 1B34A 1K8AC 2EJFA 4JRIA 1K4US 4AFUC 1XQHA 1YJNQ 3CPWS 5D6YA 5GJVB 4ZNXA 2QYZA 4RTXA 3JB9H 2GTJA 2YRVA 3CD6T 1V76A 4UC4A 5C6SA 3OY9A 1WYXA 4E2FB 1YJ9Q 1YIJA 3L2VA 3OYHA 1H8KA 4M77D 3LGLA 4IUQA 2J06A 3CD6Q 4EMGA 3O5ZA 1NBEB 3FDRA 3M59A 1G8XA 1WXBA 1BB9A 3BDLA 1GBQA 3CQTA 9ATCB 2HDAA 3VUZA 1XOVA 1WGSA 5GANj 3G71Q 3D7SB 2DLPA 2JT4A 2QDYB 3PMIA 2KT8A 2XHCA 2AIRB 3JV3A 2RJFA 4C8QC 1QMCA 2LJ0A 4J9BA 4E7JA 5IHIA 3V8JA 1X6BA 2MK5A 1MGQA 3PVLA 5FWBA 1Y71A 2K2VA 4EMKB 2L3QA 4KUDK 4RTWA 1NLPC 2LNVA 4FT4A 1K73R 2DL7A 4F7UF 4BD3A 1BIAA 1C1AA 3X24B 3ZL7C 4FW2A 4JRPA 2DBMA 1MV3A 3GP8A 3VYHB 2DA9A 4PJOA 3DLLA 1N27A 1M3CA 4JUVA 2P84A 2CZ6B 1BI2A 2DEUA 1B07A 3J81E 5AYFA 1YIJQ 3FJ5A 1ZUUA 1VQ5Q 2OTJT 3NTHA 2YT6A 3PIPA 2E3IA 2VV5A 3GLXA 3ULRB 2L89A 3QJYA 6AT1B 1WQWA 4KH0B 2QQRA 3CCLT 2BTTA 2VUBA 1Y0MA 5GAOp 3OYJA 2CZ0B 3TEEA 4ZTFA 3TSZA 4KGZB 4M4ZA 4ELYC 2EQKA 1IGQA 4BI3A 1PD1A 1NG2A 1K9MC 4RKUE 2DJZA 3CCJQ 4XU3A 3VRZA 1VQ8A 2QG9B 2J6FA 3MCAB 4J9EA 2MMPA 2F5TX 2HNIA 2VKNA 2XI9A 4MZMA 2AT1B 2BUDA 3A8OB 4AG1C 2LX9A 3DKMA 2RHXA 1VQ9Q 3Q1JA 1M2VA 1Y57A 4RG2A 1WXUA 2EBPA 3G4ST 1VQ7A 3G4SA 3EGXA 3PNWC 1DJ7B 5KYYB 1K9AA 2JUFA 3BFMA 3QKJA 1D1CA 1QVGS 1XJWB 2LCCA 4F7UB 3RBBB 5GAN2 3JCMJ 4BE0A 1Q86C 2QI2A 3C4SA 3FRNA 2LCSA 1KQ1A 2X3WD 2KNBB 2ATCB 2CT4A 1Q95G 3CBMA 1RI9A 2JVVA 3GF5A 4NOYA 4M7AD 4LXCA 3H8ZA 4J5YA 4FYXB 4CRIA 4F14A 5CKHA 3FJPA 4ZGJB 2ESWA 1X69A 2DIGA 5KYNA 2EYWA 3PIOA 1LJOA 4N4HA 1MV0B 1VIFA 4FYVB 2I2LA 2KGTA 4YTLA 3GNGA 1M5Q1 4OMLA 2OTLA 1Q81R 2BE9B 1RLQC 2CP5A 4QQDA 3QUIA 5I2SA 3G6EA 4JJBA 2R5AA 1YHQA 2A28A 5GANf 1VQ8Q 4JS5A 1BI3A 1YJWQ 4JLGA 1NJIU 4BB7A 2VWFA 4OMPA 2O9SA 2D0QB 4M7AA 4OMQA 4PK4A 1VQ6T 2DPPB 1YP5A 2HD0A 3JCMV 1IHVA 8ATCB 3G4SQ 4C5IA 2HBWA 3CBPA 5KE2A 2KROA 2PTKA 1YITQ 4EDUA 1LOJA 1PWTA 4A4HA 5GAMj 4C0FA 1S72Q 1VQNQ 4WCIA 4C8QA 1BI1A 3CCSA 1QWFA 1VQOQ 4PJLA 1D09B 1WIEA 2QTVA 1AZEA 5J26A 5GMKm 1YCYA 4MMLA 5GMKi 3OYLA 3CCST 1ZSZC 2YLCA 1RL2A 2K5LA 5HKCA 2M0OA 2DF6A 2DVJA 2K2MA 4O5VA 3OYMA 4L5GA 1LCKA 2KXCA 1G2BA 2JJ9A 2RO0A 2CYZB 2EQUA 2QQ9A 1P92A 1TWBA 1PM3A 1UJ0A 3JRZA 1AWXA 3OBWA 4PJOC 2EJGA 4JRKA 1YIJT 1VQ6A 4PFPA 2CP3A 1U1SA 2F2XA 5CAIA 4LD9K 3QXEB 3OBYA 4J6YA 3EFRA 3CCET 3QYGB 3E9GA 3N5BB 1VQ4A 1X6GA 2K9GA 1T3SA 1Q82U 4C92F 4DOWA 1ARKA 4JJDA 4XTXA 2OTLT 1PHTA 2AZSA 3CCVQ 2D8HA 3OMCA 2CP7A 1TU0B 3A5ZB 2FPFA 3V7SA 4J9GA 2XD0A 1S72A 1VQPT 1M30A 1HSQA 1MUZA 4HCBA 3HTRA 3CMET 3CCRQ 2DVEA 3S3OA 1RABB 5LJ5g 2EGEA 4C92D 2OTJQ 2GF7A 5IT9E 2RJEA 2YRDA 2YDLA 2ROLA 4ZTJA 2CUBA 2QQBA 1MMNA 2DTOA 1WJSA 3PE0A 2IPOB 3EGDB 2HCKA 2F5KA 2LQNA 3HKSA 2DXTA 4F16A 1VQ7T 1XNIA 1VQMA 1G83A 3LX7A 4ZGDB 1UGQB 2GCXA 2EQJA 2L5QA 2PUOB 4A63B 1HJDA 2X4YA 3EAEA 4NS5A 1RAIB 1YJNT 2LCLA 1S1NA 3X20B 1EZZB 3JSCA 1WHLA 4FYWB 2EYZA 1KQSS 2YXYA 5DY9A 4ZN1A 3CC4T 2DNUA 4M77A 1GL5A 4R56A 1B7TA 2FPEA 1UB4A 2KRMA 3HRTA 1G3WA 3CCMT 2A3LA 3UF4A 2DTIA 1UE9A 2DAQA 2X9HA 3PGGA 4M7DC 2ZCFB 3J80E 2BKDN 5GMKh 4C5HA 2IVWA 3JCMd 2DK3A 2XU8A 3EGDA 5GAMf 1RAFB 2A37A 2ZGWA 3NMZC 4ANJA 2KR3A 2RPNA 1CSKA 2ECZA 2RHIA 3CMEQ 4C0DC 1IHWA 1UGRB 2E5QA 4OMNA 3MP8A 2LZ6B 1ZSZB 2KYBA 5FLXE 4HVUA 2HSEB 3HRSA 4QVZA 4IURA 2R58A 3OYGA 3WXMB 2CP0A 1UDLA 1WA7A 3X28B 1NPRA 3CCVT 5FRNA 4R55A 3MEVA 1KC8C 5GAOl 3EFOB 3LW5E 3CCQQ 2YLBA 4LD6A 4C0GA 4EIKA 3CCRT 4QQGA 3M57A 1PSEA 1ACMB 2Y4YA 5CKBA 2DD4A 4HVVA 1VQPQ 4HVWA 3VRYA 1AWOA 2E4HA 1JRIA 3CC7Q 3M0UA 2HAXA 1QKXA 4C8QB 1IB8A 3FEOA 3G7ZA 2O2OA 1Q86R 2RM4A 1YI2Q 2DL4A 2ZPIB 4EMKC 3GBQA 5IHKA 4PJOF 1SPKA 3HFOA 2A08A 5CQYA 2DL5A 4J9IA 2A36A 3JCMb 4DBFA 3VV0A 5IAYA 4BY6B 4LN2A 3LH5A 3LWIA 2GBQA 2QA4A 4J9CA 2FZCB 2M9UA 4FYYB 3F70A 5CCAA 3KFVA 4GLKA 4PLLA 4OMFB 4Y91A 4XU2A 2K7AA 5GANg 1W70A 1WX6A 3M0QA 2NLUA 2O4XA 3P8HA 4J6WA 4XTZA 1I5OB 4HT9A 1I4K1 1ZUKA 2VXFA 2E6ZA 2GQIA 4XTVA 1NPPA 2P0KA 1Z9ZA 1VQPA 1H3ZA 4N0AC 1I0CA 4BACA 3TQ7P 2KK4A 2NUPB 2M1HA 4A53A 2VYTA 1I81A 1NYGA 1UUEA 2RA2A 3M5AA 1GRIA 1KC8R 1U06A 5GJWB 2QEXA 3M53A 4II1A 1KQSP 1N6AA 1IRXA 4NL2A 2MIOA 1BIBA 4M75C 1E6GA 1JXMA 1VA7A 3QG1A 4QQ6A 3QSUA 2KMTA 2QQSA 4JJCA 3CCEA 1M3BA 2HQXA 3ASKA 2HQHA 1OU8A 1CKBA 2DETA 4QW2A 3VYGA 1M90C 1C6VX 1Z9QA 3O8VA 4XU1A 4A4GA 3MEAA 2ROTA 1BYMA 2QK0A 2L3SA 4PNOA 1WI7A 2KT1A 4XTUA 2LP5A 1PRMC 2KYMA 1FMWA 2PZ1A 4OB0B 5DLQE 4ESRA 3OW2A 3CC2A 1X75C 3VS3A 2ENMA 3QDFA 1SRMA 2YWWA 5FRMA 1VYVA 5LJ3d 2AZVA 3EH1A 3T9NA 3VS1A 3M0SA 3ZEHA 2RQUA 2C06A 5I2MA 2E3HA 1QW1A 4K11A 4PJJA 2VGMA 4JDSA 3S3MA 4N0AA 1T0JA 4HXJA 2EFIA 3QPHA 3E1SA 2RHZA 4KT0E 4M78C 1IXDA 4QKUA 3BY7A 2AK5A 3JCMe 5IH2A 2DXUA 4RTUA 2SRCA 2FYKA 3E19A 1OQKA 1VQOT 2CH4W 1KD1U 1R77A 4DQ2A 2MOXA 3EG2A 4AFSC 3CC7T 4M77B 1GFDA 1MMDA 3VS0A 2K5IA 5AT1B 2E41A 3FIFA 5CIUA 3INZA 2MCNA 3EGUA 4NL3A 2QDLA 2JXBA 3M58A 1VQ5T 3NGPA 2M51A 1I1JA 3EG1A 2KI7A 1T3LA 2CSQA 1YJWT 2QAZA 3A8HB 4BE1A 3X26B 1VQ4Q 3V7CA 2DFUA 3CC2Q 3WVEB 2D9TA 1WJRA 3CXCP 4BUGA 5KCOA 3GPLA 2FRWA 1KD1R 2FB7A 4E7KA 2FPDA 1MNDA 5FROA 2V8KA 5GANh 1ZX6A 3M0TA 5KH6A 5KYUB 2RI2A 4E7ZA 3R6NA 1RI0A 3CCRA 2P0PA 5GAN7 4OMMA 3QZ9B 4VUBA 4V2SA 4MMKA 2OTJA 1ZLMA 1TUCA 1AWWA 3G1JA 1AVZC 1PKSA 1FMVA 2MWPA 3MKDA 2V1QA 2EGCA 1R0CB 2YUNA 3BE3A 3UATA 1Q82R 4DBRA 1RACB 3VS6A 1NYFA 1TG0A 3C94A 4LDXA 4ATOA 4EPCA 1VQ9T 2DM1A 2KRNA 1OX9A 1EIFA 5I11A 3OSSC 2EYXA 2H3JA 3RERA 1OYXA 2EQIA 4M7DA 1HXDA 4C5GA 4PKCC 2JZ2A 1YWPA 3SDZA 1M2OA 2RJCA 2RQTA 2HKQB 5GAMh 3I9QA 3MEUA 4LDWA 3HL8A 2H8HA 2MYSA 1JJ2P 5LJ5f 4IKFA 2KXDA 3QJ6A 4HKEA 4JRQA 4J8OA 4M75D 1VQKQ 2NUZA 1YFNA 3VS4A 2H3EB 3RKXA 3NTIA 1IREB 3CBOA 1M1FA 2LQKA 2CUDA 3URGA 3GNFB 3OSVA 4MZPA 2P4TA 4JPBW 3JCMh 3EG9B 4PJOD 4Z02A 3A1PA 1M27C 2PU9B 1QQJA 3DLMA 1MMAA 4PJMA 3RIRA 1FYNA 4C92B 2LRQA 3UWNA 1M1KC 4F7UA 1KJWA 3RKWA 3H0IA 4E47A 1NE8A 5IXFA 2LMJA 1UECA 1QCFA 3VKIA 1Y96A 2RK2A 3NPFA 1D1BA 2Y90A 3LLRA 1Q82C 1VQLT 2PVDB 3CCUT 2ZAEA 3META 2XDDA 4M77F 1VQNT 2YUPA 3CXCA 1Y7XA 5CO7A 1U8RA 1TUDA 4IIOA 2CSIA 1K73U 2CP2A 3G71T 1SRLA 4C0ZA 1VUBA 4C8QG 5I21A 5GAN8 4XTYA 2K3BA 5LJ3e 1W2BS 2JM9A 1FWZA 5IHNA 1UTIA 5FWCA 5GAMg 2RH2A 2F2VA 2WACA 4OB2B 3AHUA 2QGGA 1RLPC 5GANd 2D0NA 2LT4A 3OYDA 3PT9A 1FMKA 4HCZA 5GAN3 1AD5A 3OYBA 2GNCA 2NUTB 2HEQA 4RCBA 3ZBDA 2JM8A 1ZA2B 5GMKe 3QO3A 4OB1B 2MI6A 3LGFA 1Q86U 4RG8A 4OF1A 3M54A 3BW1A 4X9CA 3ZFJA 5A2QE 3OYIA 1K1ZA 2G3RA 1H3HA 3RR6A 1OPLA 5FU7C 3UT1A 2XMFA 3E2UA 4Z88A 2K3YA 1FX7A 3CCEQ 3A8LB 3CCJA 1MNEA 2RQWA 3UA6A 1I5LA 1Q7YC 1JJ2A 2AKLA 3OYNA 3RUXA 4M75E 2DZCA 1YHQT 1ZBXA 3OW2S 3LWHA 1GXIE 4KH1B 1W1FA 2EJ9A 2EYYA 3JB9J 4D8DA 4M78B 2ZZDA 1WLPB 3HFNA 4BY6C 2O31A 1F1BB 1K9MR 1YBYA 2RMOA 2OAUA 2EGAA 4KULA 4C92E 1M1GA 2V8IA 1TXQA 1Q7YU 2ABLA 5CKDA 2D6FA 2OJ2A 2IG0A 4X9DA 1N9SA 4EMHA 2LX7A 1W6XA 4FSXA 1E7OA 5LL6S 3OYKA 4Z89A
chains in the Genus database with same CATH topology
4FW1A 1QMCA 1C6VX 1IHVA 1C1AA 5D7UA 1EX4A 4FW2A 1IHWA 1C0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FW1 A;  1QMC A;  1C6V X;  1IHV A;  1C1A A;  5D7U A;  1EX4 A;  4FW2 A;  1IHW A;  1C0M A; 
#chains in the Genus database with same CATH topology
 2QEX T;  2D8J A;  1U3O A;  1AOJ A;  4PL6 A;  4RTT A;  1NJI R;  4FIB A;  3I55 T;  1PNJ A;  4C8Q F;  1M1K U;  3V8L A;  3RDV A;  4P5N A;  3OS0 A;  1NLO C;  2JMA A;  2DTH A;  4AMC A;  2XID A;  2K4Y A;  4C92 C;  1K9M U;  1ZSG A;  3VU3 C;  4QVC A;  4M77 E;  1JQQ A;  2VC8 A;  1YNZ A;  1M8V A;  3QHS A;  5HK3 A;  2I0N A;  3M0P A;  1QCN A;  1VQ8 T;  2JS2 A;  2DIQ A;  4AFQ C;  1AT1 B;  2HMA A;  3H0F A;  4IUU A;  1M90 R;  2KBT A;  3I56 A;  4GBQ A;  1BCO A;  4PFZ A;  1NZ9 A;  2DL8 A;  4HCC A;  2WSE E;  2BIV A;  2EAY A;  1G3T A;  2AHJ B;  4RCC A;  5M9O A;  1IZ6 A;  1OEB A;  3TU4 K;  1SSF A;  2B86 A;  3MHX A;  2VGN A;  2FRY A;  4JZ3 A;  5FU6 B;  2YHT A;  1WFW A;  3CCU A;  1K0S A;  1SSH A;  1T0H A;  2PVO B;  4FSS A;  5GMK j;  3L1A A;  3MPU B;  1RAG B;  2DBK A;  3HSB A;  2E64 A;  1ABQ A;  2GTO A;  3SEM A;  4B9W A;  3MP6 A;  2KEA A;  2RF0 A;  1UGP B;  2LVM A;  1AZG B;  1R8O B;  1RAE B;  4X34 A;  1M8M A;  4A4K A;  4WF2 A;  3HHT B;  1KK7 A;  1I8F A;  3THK A;  4LUE A;  2KQW A;  3VUB A;  2HQE A;  2O88 A;  1QCO A;  3H9N A;  2DEQ A;  1BKB A;  3SFM A;  1OZ3 A;  3C0C A;  3CCV A;  2BE7 D;  3V8K A;  5I22 A;  4JS4 A;  5J3B A;  4X1V A;  3SWN B;  2HSP A;  5L23 A;  1QVG A;  2OAW A;  3J7A F;  4AFZ C;  5C0M A;  2DO3 A;  1X27 A;  2COZ A;  1U1T A;  2L2P A;  2AKK A;  3SB2 A;  3EH2 A;  2DRM A;  3RMQ A;  5GAN 5;  3FC3 A;  1V29 B;  5LJ5 d;  3L2U A;  4N4I A;  2GQV A;  2LQ8 A;  3CPW A;  3SWN A;  2XDB A;  5GMK l;  2MWO A;  3OYY A;  4KGX B;  3CCM A;  2C0T A;  4E7H A;  5LJ3 h;  3CMA Q;  5D6W A;  3CXC S;  5DLO A;  1VQM Q;  3I56 T;  1CKA A;  3S3N A;  2XK0 A;  3RKY A;  1VQK A;  2K5F A;  1ABO A;  1SF9 A;  1VOM A;  1WHJ A;  3UDC A;  1LNX A;  3CCQ T;  1WQ7 A;  2K6D A;  1RUW A;  2EWN A;  3P8B B;  4BE2 A;  2OX7 A;  2ZPH B;  2P4R A;  3CMA T;  1VQ5 A;  2EKH A;  2KVQ G;  1D0X A;  3VS7 A;  1N8R C;  1PRL C;  2PVG B;  1QVP A;  3OYE A;  5A0G A;  3SHW A;  2ED1 A;  2EW3 A;  1KD1 C;  4M7A G;  4M78 F;  2HBP A;  3SD4 A;  3L2R A;  1WHH A;  4WTO B;  3I55 A;  4AT1 B;  1TTH B;  1M4Z A;  4RMO A;  4IUV A;  2LQW A;  1N5Z A;  4BDY A;  1X6O A;  2FO0 A;  2W0Z A;  5GAN e;  3CME A;  2RQR A;  4DBH A;  4ZGE B;  3OQ5 A;  4F17 A;  1NEG A;  2OI3 A;  2RQV A;  3VS5 A;  1FXX A;  1YJ9 T;  4C8Q E;  2WSC E;  2DL3 A;  2L3P A;  3I5S A;  1KQ2 A;  3CCQ A;  4OP0 A;  3JB9 I;  2LNH B;  1KSW A;  2RD1 A;  4F04 B;  3CC2 T;  1M2V B;  1VQ4 T;  2O9V A;  3GOX A;  2JW4 A;  2CGH A;  2B8A A;  4M7A F;  4GY5 A;  2C0O A;  1B3Q A;  2EQM A;  4LUD A;  3EGX B;  4RTZ A;  5LJ5 e;  1VQ7 Q;  2HL3 A;  3CPF A;  1WNL A;  1G5V A;  1AWJ A;  1J3T A;  3JCM Q;  1JEG A;  1O9S A;  3CC7 A;  1SG5 A;  2RHY A;  3LH0 A;  3OYC A;  2J05 A;  2QTX A;  2X4J A;  3QYH B;  3L42 A;  2QXF A;  3HP9 A;  2PUK B;  1YI2 A;  1MHN A;  4M78 D;  3I55 Q;  2MPX C;  1D1A A;  2LT1 A;  2RHU A;  2OTL Q;  2P0Q A;  1PG5 B;  1LVK A;  1ZSZ A;  3BDU A;  2KRS A;  3G6E Q;  5GAN 6;  2E5K A;  2CS7 A;  2A0F B;  3H0H A;  2C0I A;  2R57 A;  4J7I A;  3AT1 B;  1QVF P;  3TRE A;  3M56 A;  2YUO A;  3QII A;  2XG8 D;  1V1C A;  1GCQ A;  4XAX B;  2RI5 A;  1EX4 A;  4ME7 A;  3H6Z A;  5GAO q;  4M7D B;  4AG2 C;  4KGV B;  3EHQ A;  1C0M A;  3OB9 A;  4GLM A;  1Q81 U;  4M75 G;  4Q5W A;  1VYT A;  3M9Q A;  4DEY A;  4D8K A;  2O4X B;  2DER A;  4R0K A;  1K73 C;  2Z0W A;  2W10 A;  4DEX A;  2EVR A;  2DZ9 A;  2MAM A;  3CCS Q;  4LDU A;  7AT1 B;  4A4E A;  4C92 G;  2VB6 A;  4PJO G;  5GAO n;  3JCM X;  1YIT A;  1M90 U;  3MO8 A;  1VQN A;  1NJI C;  3EG0 A;  1SHG A;  1RAA B;  1VQL A;  4OVA A;  2E70 A;  2O01 E;  3CCL Q;  2IIM A;  2DD5 A;  5EC7 A;  2FHD A;  1WXT A;  3SWN C;  2HZY A;  2LDM A;  2MF2 A;  2X4X A;  1VQ6 Q;  2QAS A;  4E7I A;  1PD0 A;  5KYX B;  4M7D G;  1GBR A;  3PTA A;  1N9R A;  2DMO A;  3S6W A;  4M77 G;  4F7U E;  4OGC A;  4LE9 A;  3A98 A;  4KUI A;  3JCM W;  2JTE A;  4C8Q D;  2HL5 C;  1PSF A;  2CRE A;  1X43 A;  2QA4 T;  1UHC A;  2EYQ A;  1Q7Y R;  3I35 A;  2XKO C;  1WJQ A;  4M77 C;  1BK2 A;  4M7D F;  3QDR B;  5EG2 A;  1K76 A;  3E9F A;  2DIL A;  4J9F A;  2CP6 A;  1B34 B;  1PC0 A;  5LJ3 g;  3NHN A;  3CPW P;  1YCS B;  2DKG A;  4RTY A;  3WVD B;  2X4W A;  3CC4 Q;  3V7R A;  3OMG A;  1H92 A;  5L8R E;  3U23 A;  1JB0 E;  2FZK B;  3CCU Q;  2ZPF B;  4M78 E;  1VQL Q;  2NYS A;  4IIM A;  2V26 A;  1M3A A;  2COY A;  4C0D B;  2V1R A;  3H41 A;  1JO8 A;  1M9S A;  1D0Y A;  4PJN A;  2JN0 A;  2KAF A;  2JS0 A;  4XU0 A;  4DA4 A;  5CR2 A;  2J7I A;  4J7F A;  1W2B P;  3DB4 A;  1OV3 A;  2HKN A;  1YN8 A;  1ZA1 B;  4FT2 A;  2EPD A;  4L59 A;  3REA B;  2F69 A;  1QP2 A;  3MEW A;  2DYI A;  2G6F X;  3REB B;  4QVD A;  2M16 A;  2K57 A;  5CQX A;  4O6J A;  2FG0 A;  5GAO r;  1OUL A;  3EG3 A;  4RUG A;  2DXC A;  1OZ2 A;  1YI2 T;  1U5S A;  3EFO A;  3JB9 F;  1X2K A;  2DYB A;  4A54 A;  2F1L A;  2KDS A;  5CVI A;  1N8R U;  4L6V 5;  2CZ7 B;  2KY9 A;  3JCM f;  2L0A A;  4M75 A;  3HPW A;  3QBY A;  1X2Q A;  3CC4 A;  4JLI A;  2K79 A;  5GAN 4;  5CK9 A;  3CCM Q;  1ZBJ A;  2ZPE B;  4E7S A;  1KHI A;  3CMA A;  2E65 A;  1YJN A;  1SEM A;  2QGF B;  3KXT A;  4C92 A;  1AEY A;  1RAH B;  2E1H A;  2X51 A;  1OU9 A;  2A7Y A;  1HD3 A;  2EKO A;  3KUF A;  1H64 1;  1VQK T;  3PFS A;  1WDX A;  2PNI A;  4IUP A;  3UPU A;  1NM7 A;  1G3S A;  4BDZ A;  3HRU A;  4HT8 A;  4N4G A;  1BI0 A;  1PKT A;  2ZPG B;  1TSF A;  5KYW A;  3A8G B;  4CI0 C;  2RK1 A;  4D6W A;  1KIK A;  4FCY A;  2R5M A;  3QZ5 B;  1O75 A;  2PQW A;  5LJ5 j;  4M7A E;  4FM4 B;  1QKW A;  3R6O A;  1I07 A;  1ZUY A;  4LDV A;  5DM7 R;  1EFN A;  2E6N A;  5LJ5 h;  2JTM A;  2KSS A;  1LPL A;  3OS2 A;  1QVF A;  3X25 B;  1ZHI A;  4LDY A;  4HCK A;  1S72 T;  1PCX A;  3M4G A;  2VVK A;  1KHC A;  4ELZ C;  3KBG A;  4BI8 B;  5GAM e;  5KE3 A;  4E6R A;  2QA4 Q;  4Z8A A;  2WSF E;  1K8A R;  1UJY A;  3TVT A;  2XDP A;  2CT3 A;  4Y92 A;  4HA8 A;  5FW9 A;  1QVF S;  4M7A C;  2ED0 A;  2FL7 A;  1NEB A;  5ECA A;  2M02 A;  4BI4 A;  2J6K A;  5KYY A;  1HK9 A;  2ZPB B;  2LJ1 A;  1OI1 A;  3PMT A;  1IO6 A;  2CH4 A;  3QWY A;  1UGV A;  2M0Y A;  1JXO A;  4MDW A;  5D6X A;  3JB9 G;  2LTO A;  2QQA A;  2RB6 A;  1W2B A;  3L2Q A;  2CZ1 B;  1BCM A;  3L2Z A;  2RN8 A;  3A8M B;  5HCK A;  1WPY A;  2E10 A;  4MZT A;  3L2W A;  3VJP A;  2VXE A;  1AHJ B;  3OS1 A;  4RTV A;  2J6O A;  1K8A U;  1WHM A;  2KE9 A;  4OGE A;  1QVG P;  1SKU B;  1XTD A;  5KYW B;  1X01 A;  1E6H A;  2BZ8 A;  3JCM g;  3FB9 A;  1Q81 C;  4CC2 A;  2Y4X A;  2QEX Q;  3UA7 A;  3JAM E;  2YSQ A;  2L3R A;  1VQ9 A;  1KC8 U;  4CC4 B;  2E12 A;  2FZG B;  4E7L A;  3MJX A;  3DB3 A;  2V8J A;  3JB9 D;  2RI3 A;  4J6X A;  4KRT A;  1UFF A;  3ME9 A;  3I5R A;  3GIB A;  1MMG A;  5LJ3 j;  1K0X A;  3ER0 A;  2RNA A;  5CKE A;  4QT7 A;  4J9H A;  1Y96 B;  5GAO m;  3G6E T;  4M75 B;  4DOV A;  2NUP A;  2GFU A;  5D7U A;  4PJO E;  4M78 A;  1OPK A;  2BZY A;  1YIT T;  1UGS B;  3OYA A;  4LNP A;  1IGU A;  1QLY A;  1KG1 A;  4B9X A;  4PJO B;  1RAD B;  2X3X D;  4B6M A;  2JNG A;  3PVQ A;  3RNJ A;  3P8D A;  4ORZ A;  3OA6 A;  3CCL A;  1YHQ Q;  1WZO A;  2DE0 X;  2CKK A;  3VS2 A;  1YJW A;  4M7D E;  5LJ3 f;  2JMC A;  5A0D A;  2F2W A;  8AT1 B;  4F7U G;  2GFA A;  3QWX X;  2JTF A;  1GCQ C;  1JBM A;  2LJ3 A;  1VIE A;  2DXB A;  4M7A B;  3RES A;  1OX8 A;  3JCM P;  4PFO A;  4XK8 E;  2D1X A;  2K3X A;  3FLG A;  1UHF A;  4C5E A;  2YUQ A;  1ZQ1 A;  4A4F A;  3TSW A;  2XIC A;  1VQO A;  2BZX A;  1HYO A;  2JOY A;  3M55 A;  1M1K R;  1JU5 C;  1BU1 A;  5IN1 A;  2NWM A;  5IXB A;  1VYU A;  4J83 A;  2DX1 A;  5A0L A;  2L8D A;  2CDT A;  1UG1 A;  4M7D D;  4M75 F;  2COW A;  1JJ2 S;  4JZ4 A;  5FU7 B;  3M4Y A;  4FL6 A;  4M78 G;  5HY6 A;  1A0N B;  1WHG A;  1N8R R;  4OMO A;  4FU6 A;  3OS5 A;  1KQS A;  1BBZ A;  3OYF A;  3JCM c;  3CEY A;  4ZN3 A;  2NUT A;  4TVR A;  4Y28 E;  4CC3 A;  3MP1 A;  5FU6 C;  2FEI A;  3CCJ T;  5J39 A;  3TCJ A;  1R0B G;  5KYX A;  3C12 A;  1QP3 A;  1W4S A;  2DRK A;  1YJ9 A;  2SEM A;  4JJN K;  3I56 Q;  1VQM T;  4MDX A;  5KYU A;  3EFS A;  3NFC A;  1TS9 A;  1TH7 A;  4CC7 A;  3CD6 A;  3LYI A;  5KCH A;  5GAM d;  3M0R A;  1YWO A;  5CKF A;  1D0Z A;  3EHR A;  2RJD A;  2DJQ A;  3IQL A;  1SHF A;  1D3B B;  3G71 A;  4DBQ A;  1KFZ A;  3OW2 P;  1Y07 A;  4IUT A;  3EG9 A;  2VAS A;  1OOT A;  1D3B A;  1TUG B;  1TOV A;  2GGR A;  4OB3 B;  1UEB A;  1GCP A;  4XQ3 A;  5HK0 A;  2YRC A;  2EIF A;  4PLI A;  1WHK A;  4J9D A;  4XTW A;  1QWE A;  4FW1 A;  1GFC A;  3NTK A;  2X35 A;  4EMK A;  2FVU A;  3C95 A;  3RMS A;  4KBM B;  1G3Y A;  2LC4 A;  1B34 A;  1K8A C;  2EJF A;  4JRI A;  1K4U S;  4AFU C;  1XQH A;  1YJN Q;  3CPW S;  5D6Y A;  5GJV B;  4ZNX A;  2QYZ A;  4RTX A;  3JB9 H;  2GTJ A;  2YRV A;  3CD6 T;  1V76 A;  4UC4 A;  5C6S A;  3OY9 A;  1WYX A;  4E2F B;  1YJ9 Q;  1YIJ A;  3L2V A;  3OYH A;  1H8K A;  4M77 D;  3LGL A;  4IUQ A;  2J06 A;  3CD6 Q;  4EMG A;  3O5Z A;  1NBE B;  3FDR A;  3M59 A;  1G8X A;  1WXB A;  1BB9 A;  3BDL A;  1GBQ A;  3CQT A;  9ATC B;  2HDA A;  3VUZ A;  1XOV A;  1WGS A;  5GAN j;  3G71 Q;  3D7S B;  2DLP A;  2JT4 A;  2QDY B;  3PMI A;  2KT8 A;  2XHC A;  2AIR B;  3JV3 A;  2RJF A;  4C8Q C;  1QMC A;  2LJ0 A;  4J9B A;  4E7J A;  5IHI A;  3V8J A;  1X6B A;  2MK5 A;  1MGQ A;  3PVL A;  5FWB A;  1Y71 A;  2K2V A;  4EMK B;  2L3Q A;  4KUD K;  4RTW A;  1NLP C;  2LNV A;  4FT4 A;  1K73 R;  2DL7 A;  4F7U F;  4BD3 A;  1BIA A;  1C1A A;  3X24 B;  3ZL7 C;  4FW2 A;  4JRP A;  2DBM A;  1MV3 A;  3GP8 A;  3VYH B;  2DA9 A;  4PJO A;  3DLL A;  1N27 A;  1M3C A;  4JUV A;  2P84 A;  2CZ6 B;  1BI2 A;  2DEU A;  1B07 A;  3J81 E;  5AYF A;  1YIJ Q;  3FJ5 A;  1ZUU A;  1VQ5 Q;  2OTJ T;  3NTH A;  2YT6 A;  3PIP A;  2E3I A;  2VV5 A;  3GLX A;  3ULR B;  2L89 A;  3QJY A;  6AT1 B;  1WQW A;  4KH0 B;  2QQR A;  3CCL T;  2BTT A;  2VUB A;  1Y0M A;  5GAO p;  3OYJ A;  2CZ0 B;  3TEE A;  4ZTF A;  3TSZ A;  4KGZ B;  4M4Z A;  4ELY C;  2EQK A;  1IGQ A;  4BI3 A;  1PD1 A;  1NG2 A;  1K9M C;  4RKU E;  2DJZ A;  3CCJ Q;  4XU3 A;  3VRZ A;  1VQ8 A;  2QG9 B;  2J6F A;  3MCA B;  4J9E A;  2MMP A;  2F5T X;  2HNI A;  2VKN A;  2XI9 A;  4MZM A;  2AT1 B;  2BUD A;  3A8O B;  4AG1 C;  2LX9 A;  3DKM A;  2RHX A;  1VQ9 Q;  3Q1J A;  1M2V A;  1Y57 A;  4RG2 A;  1WXU A;  2EBP A;  3G4S T;  1VQ7 A;  3G4S A;  3EGX A;  3PNW C;  1DJ7 B;  5KYY B;  1K9A A;  2JUF A;  3BFM A;  3QKJ A;  1D1C A;  1QVG S;  1XJW B;  2LCC A;  4F7U B;  3RBB B;  5GAN 2;  3JCM J;  4BE0 A;  1Q86 C;  2QI2 A;  3C4S A;  3FRN A;  2LCS A;  1KQ1 A;  2X3W D;  2KNB B;  2ATC B;  2CT4 A;  1Q95 G;  3CBM A;  1RI9 A;  2JVV A;  3GF5 A;  4NOY A;  4M7A D;  4LXC A;  3H8Z A;  4J5Y A;  4FYX B;  4CRI A;  4F14 A;  5CKH A;  3FJP A;  4ZGJ B;  2ESW A;  1X69 A;  2DIG A;  5KYN A;  2EYW A;  3PIO A;  1LJO A;  4N4H A;  1MV0 B;  1VIF A;  4FYV B;  2I2L A;  2KGT A;  4YTL A;  3GNG A;  1M5Q 1;  4OML A;  2OTL A;  1Q81 R;  2BE9 B;  1RLQ C;  2CP5 A;  4QQD A;  3QUI A;  5I2S A;  3G6E A;  4JJB A;  2R5A A;  1YHQ A;  2A28 A;  5GAN f;  1VQ8 Q;  4JS5 A;  1BI3 A;  1YJW Q;  4JLG A;  1NJI U;  4BB7 A;  2VWF A;  4OMP A;  2O9S A;  2D0Q B;  4M7A A;  4OMQ A;  4PK4 A;  1VQ6 T;  2DPP B;  1YP5 A;  2HD0 A;  3JCM V;  1IHV A;  8ATC B;  3G4S Q;  4C5I A;  2HBW A;  3CBP A;  5KE2 A;  2KRO A;  2PTK A;  1YIT Q;  4EDU A;  1LOJ A;  1PWT A;  4A4H A;  5GAM j;  4C0F A;  1S72 Q;  1VQN Q;  4WCI A;  4C8Q A;  1BI1 A;  3CCS A;  1QWF A;  1VQO Q;  4PJL A;  1D09 B;  1WIE A;  2QTV A;  1AZE A;  5J26 A;  5GMK m;  1YCY A;  4MML A;  5GMK i;  3OYL A;  3CCS T;  1ZSZ C;  2YLC A;  1RL2 A;  2K5L A;  5HKC A;  2M0O A;  2DF6 A;  2DVJ A;  2K2M A;  4O5V A;  3OYM A;  4L5G A;  1LCK A;  2KXC A;  1G2B A;  2JJ9 A;  2RO0 A;  2CYZ B;  2EQU A;  2QQ9 A;  1P92 A;  1TWB A;  1PM3 A;  1UJ0 A;  3JRZ A;  1AWX A;  3OBW A;  4PJO C;  2EJG A;  4JRK A;  1YIJ T;  1VQ6 A;  4PFP A;  2CP3 A;  1U1S A;  2F2X A;  5CAI A;  4LD9 K;  3QXE B;  3OBY A;  4J6Y A;  3EFR A;  3CCE T;  3QYG B;  3E9G A;  3N5B B;  1VQ4 A;  1X6G A;  2K9G A;  1T3S A;  1Q82 U;  4C92 F;  4DOW A;  1ARK A;  4JJD A;  4XTX A;  2OTL T;  1PHT A;  2AZS A;  3CCV Q;  2D8H A;  3OMC A;  2CP7 A;  1TU0 B;  3A5Z B;  2FPF A;  3V7S A;  4J9G A;  2XD0 A;  1S72 A;  1VQP T;  1M30 A;  1HSQ A;  1MUZ A;  4HCB A;  3HTR A;  3CME T;  3CCR Q;  2DVE A;  3S3O A;  1RAB B;  5LJ5 g;  2EGE A;  4C92 D;  2OTJ Q;  2GF7 A;  5IT9 E;  2RJE A;  2YRD A;  2YDL A;  2ROL A;  4ZTJ A;  2CUB A;  2QQB A;  1MMN A;  2DTO A;  1WJS A;  3PE0 A;  2IPO B;  3EGD B;  2HCK A;  2F5K A;  2LQN A;  3HKS A;  2DXT A;  4F16 A;  1VQ7 T;  1XNI A;  1VQM A;  1G83 A;  3LX7 A;  4ZGD B;  1UGQ B;  2GCX A;  2EQJ A;  2L5Q A;  2PUO B;  4A63 B;  1HJD A;  2X4Y A;  3EAE A;  4NS5 A;  1RAI B;  1YJN T;  2LCL A;  1S1N A;  3X20 B;  1EZZ B;  3JSC A;  1WHL A;  4FYW B;  2EYZ A;  1KQS S;  2YXY A;  5DY9 A;  4ZN1 A;  3CC4 T;  2DNU A;  4M77 A;  1GL5 A;  4R56 A;  1B7T A;  2FPE A;  1UB4 A;  2KRM A;  3HRT A;  1G3W A;  3CCM T;  2A3L A;  3UF4 A;  2DTI A;  1UE9 A;  2DAQ A;  2X9H A;  3PGG A;  4M7D C;  2ZCF B;  3J80 E;  2BKD N;  5GMK h;  4C5H A;  2IVW A;  3JCM d;  2DK3 A;  2XU8 A;  3EGD A;  5GAM f;  1RAF B;  2A37 A;  2ZGW A;  3NMZ C;  4ANJ A;  2KR3 A;  2RPN A;  1CSK A;  2ECZ A;  2RHI A;  3CME Q;  4C0D C;  1IHW A;  1UGR B;  2E5Q A;  4OMN A;  3MP8 A;  2LZ6 B;  1ZSZ B;  2KYB A;  5FLX E;  4HVU A;  2HSE B;  3HRS A;  4QVZ A;  4IUR A;  2R58 A;  3OYG A;  3WXM B;  2CP0 A;  1UDL A;  1WA7 A;  3X28 B;  1NPR A;  3CCV T;  5FRN A;  4R55 A;  3MEV A;  1KC8 C;  5GAO l;  3EFO B;  3LW5 E;  3CCQ Q;  2YLB A;  4LD6 A;  4C0G A;  4EIK A;  3CCR T;  4QQG A;  3M57 A;  1PSE A;  1ACM B;  2Y4Y A;  5CKB A;  2DD4 A;  4HVV A;  1VQP Q;  4HVW A;  3VRY A;  1AWO A;  2E4H A;  1JRI A;  3CC7 Q;  3M0U A;  2HAX A;  1QKX A;  4C8Q B;  1IB8 A;  3FEO A;  3G7Z A;  2O2O A;  1Q86 R;  2RM4 A;  1YI2 Q;  2DL4 A;  2ZPI B;  4EMK C;  3GBQ A;  5IHK A;  4PJO F;  1SPK A;  3HFO A;  2A08 A;  5CQY A;  2DL5 A;  4J9I A;  2A36 A;  3JCM b;  4DBF A;  3VV0 A;  5IAY A;  4BY6 B;  4LN2 A;  3LH5 A;  3LWI A;  2GBQ A;  2QA4 A;  4J9C A;  2FZC B;  2M9U A;  4FYY B;  3F70 A;  5CCA A;  3KFV A;  4GLK A;  4PLL A;  4OMF B;  4Y91 A;  4XU2 A;  2K7A A;  5GAN g;  1W70 A;  1WX6 A;  3M0Q A;  2NLU A;  2O4X A;  3P8H A;  4J6W A;  4XTZ A;  1I5O B;  4HT9 A;  1I4K 1;  1ZUK A;  2VXF A;  2E6Z A;  2GQI A;  4XTV A;  1NPP A;  2P0K A;  1Z9Z A;  1VQP A;  1H3Z A;  4N0A C;  1I0C A;  4BAC A;  3TQ7 P;  2KK4 A;  2NUP B;  2M1H A;  4A53 A;  2VYT A;  1I81 A;  1NYG A;  1UUE A;  2RA2 A;  3M5A A;  1GRI A;  1KC8 R;  1U06 A;  5GJW B;  2QEX A;  3M53 A;  4II1 A;  1KQS P;  1N6A A;  1IRX A;  4NL2 A;  2MIO A;  1BIB A;  4M75 C;  1E6G A;  1JXM A;  1VA7 A;  3QG1 A;  4QQ6 A;  3QSU A;  2KMT A;  2QQS A;  4JJC A;  3CCE A;  1M3B A;  2HQX A;  3ASK A;  2HQH A;  1OU8 A;  1CKB A;  2DET A;  4QW2 A;  3VYG A;  1M90 C;  1C6V X;  1Z9Q A;  3O8V A;  4XU1 A;  4A4G A;  3MEA A;  2ROT A;  1BYM A;  2QK0 A;  2L3S A;  4PNO A;  1WI7 A;  2KT1 A;  4XTU A;  2LP5 A;  1PRM C;  2KYM A;  1FMW A;  2PZ1 A;  4OB0 B;  5DLQ E;  4ESR A;  3OW2 A;  3CC2 A;  1X75 C;  3VS3 A;  2ENM A;  3QDF A;  1SRM A;  2YWW A;  5FRM A;  1VYV A;  5LJ3 d;  2AZV A;  3EH1 A;  3T9N A;  3VS1 A;  3M0S A;  3ZEH A;  2RQU A;  2C06 A;  5I2M A;  2E3H A;  1QW1 A;  4K11 A;  4PJJ A;  2VGM A;  4JDS A;  3S3M A;  4N0A A;  1T0J A;  4HXJ A;  2EFI A;  3QPH A;  3E1S A;  2RHZ A;  4KT0 E;  4M78 C;  1IXD A;  4QKU A;  3BY7 A;  2AK5 A;  3JCM e;  5IH2 A;  2DXU A;  4RTU A;  2SRC A;  2FYK A;  3E19 A;  1OQK A;  1VQO T;  2CH4 W;  1KD1 U;  1R77 A;  4DQ2 A;  2MOX A;  3EG2 A;  4AFS C;  3CC7 T;  4M77 B;  1GFD A;  1MMD A;  3VS0 A;  2K5I A;  5AT1 B;  2E41 A;  3FIF A;  5CIU A;  3INZ A;  2MCN A;  3EGU A;  4NL3 A;  2QDL A;  2JXB A;  3M58 A;  1VQ5 T;  3NGP A;  2M51 A;  1I1J A;  3EG1 A;  2KI7 A;  1T3L A;  2CSQ A;  1YJW T;  2QAZ A;  3A8H B;  4BE1 A;  3X26 B;  1VQ4 Q;  3V7C A;  2DFU A;  3CC2 Q;  3WVE B;  2D9T A;  1WJR A;  3CXC P;  4BUG A;  5KCO A;  3GPL A;  2FRW A;  1KD1 R;  2FB7 A;  4E7K A;  2FPD A;  1MND A;  5FRO A;  2V8K A;  5GAN h;  1ZX6 A;  3M0T A;  5KH6 A;  5KYU B;  2RI2 A;  4E7Z A;  3R6N A;  1RI0 A;  3CCR A;  2P0P A;  5GAN 7;  4OMM A;  3QZ9 B;  4VUB A;  4V2S A;  4MMK A;  2OTJ A;  1ZLM A;  1TUC A;  1AWW A;  3G1J A;  1AVZ C;  1PKS A;  1FMV A;  2MWP A;  3MKD A;  2V1Q A;  2EGC A;  1R0C B;  2YUN A;  3BE3 A;  3UAT A;  1Q82 R;  4DBR A;  1RAC B;  3VS6 A;  1NYF A;  1TG0 A;  3C94 A;  4LDX A;  4ATO A;  4EPC A;  1VQ9 T;  2DM1 A;  2KRN A;  1OX9 A;  1EIF A;  5I11 A;  3OSS C;  2EYX A;  2H3J A;  3RER A;  1OYX A;  2EQI A;  4M7D A;  1HXD A;  4C5G A;  4PKC C;  2JZ2 A;  1YWP A;  3SDZ A;  1M2O A;  2RJC A;  2RQT A;  2HKQ B;  5GAM h;  3I9Q A;  3MEU A;  4LDW A;  3HL8 A;  2H8H A;  2MYS A;  1JJ2 P;  5LJ5 f;  4IKF A;  2KXD A;  3QJ6 A;  4HKE A;  4JRQ A;  4J8O A;  4M75 D;  1VQK Q;  2NUZ A;  1YFN A;  3VS4 A;  2H3E B;  3RKX A;  3NTI A;  1IRE B;  3CBO A;  1M1F A;  2LQK A;  2CUD A;  3URG A;  3GNF B;  3OSV A;  4MZP A;  2P4T A;  4JPB W;  3JCM h;  3EG9 B;  4PJO D;  4Z02 A;  3A1P A;  1M27 C;  2PU9 B;  1QQJ A;  3DLM A;  1MMA A;  4PJM A;  3RIR A;  1FYN A;  4C92 B;  2LRQ A;  3UWN A;  1M1K C;  4F7U A;  1KJW A;  3RKW A;  3H0I A;  4E47 A;  1NE8 A;  5IXF A;  2LMJ A;  1UEC A;  1QCF A;  3VKI A;  1Y96 A;  2RK2 A;  3NPF A;  1D1B A;  2Y90 A;  3LLR A;  1Q82 C;  1VQL T;  2PVD B;  3CCU T;  2ZAE A;  3MET A;  2XDD A;  4M77 F;  1VQN T;  2YUP A;  3CXC A;  1Y7X A;  5CO7 A;  1U8R A;  1TUD A;  4IIO A;  2CSI A;  1K73 U;  2CP2 A;  3G71 T;  1SRL A;  4C0Z A;  1VUB A;  4C8Q G;  5I21 A;  5GAN 8;  4XTY A;  2K3B A;  5LJ3 e;  1W2B S;  2JM9 A;  1FWZ A;  5IHN A;  1UTI A;  5FWC A;  5GAM g;  2RH2 A;  2F2V A;  2WAC A;  4OB2 B;  3AHU A;  2QGG A;  1RLP C;  5GAN d;  2D0N A;  2LT4 A;  3OYD A;  3PT9 A;  1FMK A;  4HCZ A;  5GAN 3;  1AD5 A;  3OYB A;  2GNC A;  2NUT B;  2HEQ A;  4RCB A;  3ZBD A;  2JM8 A;  1ZA2 B;  5GMK e;  3QO3 A;  4OB1 B;  2MI6 A;  3LGF A;  1Q86 U;  4RG8 A;  4OF1 A;  3M54 A;  3BW1 A;  4X9C A;  3ZFJ A;  5A2Q E;  3OYI A;  1K1Z A;  2G3R A;  1H3H A;  3RR6 A;  1OPL A;  5FU7 C;  3UT1 A;  2XMF A;  3E2U A;  4Z88 A;  2K3Y A;  1FX7 A;  3CCE Q;  3A8L B;  3CCJ A;  1MNE A;  2RQW A;  3UA6 A;  1I5L A;  1Q7Y C;  1JJ2 A;  2AKL A;  3OYN A;  3RUX A;  4M75 E;  2DZC A;  1YHQ T;  1ZBX A;  3OW2 S;  3LWH A;  1GXI E;  4KH1 B;  1W1F A;  2EJ9 A;  2EYY A;  3JB9 J;  4D8D A;  4M78 B;  2ZZD A;  1WLP B;  3HFN A;  4BY6 C;  2O31 A;  1F1B B;  1K9M R;  1YBY A;  2RMO A;  2OAU A;  2EGA A;  4KUL A;  4C92 E;  1M1G A;  2V8I A;  1TXQ A;  1Q7Y U;  2ABL A;  5CKD A;  2D6F A;  2OJ2 A;  2IG0 A;  4X9D A;  1N9S A;  4EMH A;  2LX7 A;  1W6X A;  4FSX A;  1E7O A;  5LL6 S;  3OYK A;  4Z89 A; 
#chains in the Genus database with same CATH homology
 4FW1 A;  1QMC A;  1C6V X;  1IHV A;  1C1A A;  5D7U A;  1EX4 A;  4FW2 A;  1IHW A;  1C0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...