4JPBW

The structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
140
Chain Sequence
LKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.2 angstrom resolution structure of a receptor: CheA:CheW signaling complex defines overlapping binding sites and key residue interactions within bacterial chemosensory arrays.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Immune system
molecule keywords Chemotaxis protein CheA
total genus 28
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jpbW01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 4jpbW02
2O2OA 3PVQA 2O31A 2GTOA 4D8DA 3M0SA 4OMLA 1SHGA 1RUWA 2LMJA 3NPFA 4JZ4A 1WXBA 3M0UA 4FSSA 1QKWA 1AZGB 1J3TA 1UFFA 2ED0A 2F2XA 1U3OA 2KT8A 4HVUA 2DNUA 1H8KA 2X3WD 2J6OA 1JXOA 3RBBB 1GCQA 2KROA 5I22A 1GFCA 2VVKA 1M30A 2KYBA 2DA9A 4OMOA 3VS3A 1MV3A 1YNZA 1K1ZA 1IO6A 1GRIA 1PRMC 4LE9A 4OMMA 4LUEA 4IIMA 2ROLA 1T3SA 5L23A 2CREA 1GFDA 2LQWA 1OEBA 2GBQA 3ULRB 1VYTA 4Z89A 2DBMA 5GJWB 1PKTA 2JM9A 1PRLC 2PNIA 5IHIA 2A08A 4J9CA 3RNJA 1WX6A 1T3LA 4HVWA 1SRLA 1X27A 1I07A 1ZLMA 2EYZA 4OMPA 2ECZA 4AFQC 4JZ3A 1H92A 2NUZA 1RI9A 2ENMA 2ED1A 3O5ZA 2KYMA 4KRTA 5FWBA 1AOJA 2RQVA 1JXMA 1G83A 2YUPA 4J9GA 1UUEA 3VS2A 1PNJA 1QCFA 1W6XA 1HSQA 3I5RA 4RTTA 3NHNA 3REAB 2CH4A 3QWYA 1EFNA 1YCSB 2RF0A 1X2QA 1GL5A 4Z88A 1UG1A 1RLPC 1VYVA 1E7OA 2OAWA 2A37A 1V1CA 3PE0A 2JMAA 4RTVA 1JEGA 1JQQA 2LJ0A 1WA7A 3REBB 2YSQA 1NM7A 4J9DA 2EYYA 2PTKA 3TVTA 4HCKA 1AD5A 2F2VA 1X43A 1Z9QA 1TUCA 1UGVA 2DJQA 1U06A 3ZL7C 2DX1A 1YN8A 4LUDA 4OMQA 2J05A 1I0CA 4GLMA 1AWJA 2HSPA 1W70A 5IHNA 3EG0A 2DLPA 4IIOA 1QWEA 2VKNA 2K3BA 3VS7A 4J9HA 2W10A 2DMOA 2GGRA 4X1VA 2B86A 4HXJA 1UECA 3TSZA 4ESRA 2HBWA 2D8HA 4ZNXA 2JW4A 4A63B 1CKBA 1OV3A 3I35A 2KRMA 2K2MA 1MUZA 4F17A 1GCQC 1UHFA 1ZUKA 1NEGA 2HEQA 2FRWA 3H41A 5FWCA 3VRYA 1FYNA 2DL7A 1GCPA 1HD3A 3A98A 3GBQA 2KT1A 4LN2A 4Y92A 2RNAA 1WI7A 4JJDA 2L3SA 3QWXX 1PKSA 2C0OA 3SHWA 1T0JA 2FG0A 1UJ0A 2D8JA 2FO0A 4RTXA 5IH2A 2V1QA 1K9AA 2EQIA 5IHKA 1N5ZA 1WXUA 2J7IA 3M0RA 2L0AA 4CC2A 2RN8A 1K76A 1PHTA 1TUDA 2J06A 1VA7A 4J9FA 3SEMA 2X3XD 1NLPC 2K7AA 1WFWA 2C0TA 1NLOC 1JU5C 3M0QA 1T0HA 2DRKA 1ABQA 2QDLA 1XOVA 2DL5A 4GBQA 2AKLA 1X6GA 1A0NB 2DYBA 2ESWA 1QLYA 1W1FA 2BTTA 3VRZA 1ZBJA 4LNPA 4M4ZA 2HCKA 1Y0MA 4RTWA 4CC4B 2ABLA 4Z8AA 2G6FX 2HDAA 1E6HA 2KGTA 2CH4W 4JPBW 4RTUA 3VS0A 1SSHA 3M0PA 1VYUA 1M3BA 4D8KA 1MV0B 2W0ZA 2DVJA 1WYXA 2JS2A 2KE9A 4AFSC 2YUQA 2KRNA 2MOXA 5ECAA 5HCKA 1ZSGA 4WCIA 1GBRA 1M3CA 1UDLA 4DEXA 2KXDA 1ABOA 2RQWA 2RMOA 1SEMA 1YWPA 2FPDA 2DL4A 2EYWA 1KFZA 1K0SA 2LQNA 2CT3A 2RQRA 4F14A 2DRMA 1X69A 2FPFA 2A36A 3UF4A 3KFVA 1ZUUA 1KIKA 2K6DA 1U5SA 2DM1A 1X2KA 3EG3A 1ZUYA 3U23A 1OPLA 2KR3A 1SPKA 4OMNA 2L2PA 1AVZC 1CKAA 1BK2A 2J6FA 2DL3A 3M0TA 5GJVB 4AG2C 4HVVA 1WXTA 3EHRA 4R0KA 2BZYA 1M3AA 1B3QA 1QWFA 2JS0A 1ARKA 2E5KA 2LCSA 1BB9A 4RTYA 3UA7A 4AFUC 3EG1A 2OJ2A 2LX7A 2K9GA 2GNCA 2EGAA 1UHCA 4K11A 3VS4A 2GQIA 2LJ1A 3I9QA 1H3HA 4JJCA 4E6RA 2DILA 2CSQA 1M8MA 2V1RA 2ROTA 1ZX6A 2M51A 2JT4A 2EGCA 4J9BA 4JJBA 2EBPA 2YUOA 2I0NA 2DF6A 2O88A 2CUBA 1LCKA 2OI3A 1WDXA 3VS6A 4DEYA 3THKA 1NEBA 5EC7A 1TG0A 2EKHA 1JO8A 2CDTA 1AZEA 3H0IA 2A28A 4AG1C 1BU1A 2MCNA 1AWXA 1QKXA 1B07A 2D1XA 4QT7A 2F2WA 2XMFA 2JXBA 2YDLA 4CC3A 4RTZA 1NYGA 4F16A 2CT4A 2AK5A 1WIEA 1Z9ZA 3LH5A 3TSWA 1AEYA 2PZ1A 1M27C 2MIOA 2KEAA 1BBZA 1K4US 2KXCA 2EGEA 4RUGA 2FEIA 2SEMA 2CUDA 3EGUA 2EW3A 2GTJA 3FJ5A 3VS5A 5IXFA 2YT6A 2JM8A 5IXBA 1Y57A 2DL8A 2L3QA 2DBKA 2AKKA 1CSKA 3JV3A 1OOTA 2O9SA 3IQLA 2LP5A 2CSIA 2DE0X 2EPDA 2D0NA 2H8HA 3EG2A 2P4RA 2RQTA 2LNHB 4EIKA 1G2BA 1UJYA 2AZVA 1HJDA 3H0FA 2BZ8A 2KRSA 3UATA 1NG2A 1S1NA 2M0YA 2LZ6B 2C0IA 1GBQA 4J9EA 2RPNA 1AWOA 5FW9A 5I11A 1UE9A 4ORZA 2LJ3A 3R6NA 1SRMA 2FPEA 1KJWA 2NWMA 2J6KA 3CQTA 2L3PA 2O9VA 2RQUA 4CC7A 1E6GA 2AZSA 3EHQA 1RLQC 1X6BA 1YWOA 1OPKA 2EYXA 1KSWA 2BZXA 1WLPB 3PVLA 3UA6A 2KNBB 1UTIA 1YP5A 3VS1A 3NMZC 2JMCA 1FMKA 2YUNA 4AFZC 1NYFA 2JTEA 1PWTA 3C0CA 2EVRA 2IIMA 1K0XA 4J9IA 2VWFA 3H0HA 1AWWA 2KBTA 1I1JA 2K79A 3NGPA 2SRCA 1SHFA 3I5SA 2FRYA
chains in the Genus database with same CATH superfamily
3J7AV 2QA4Q 1L0XB 3G4SA 2OTJT 2GTOA 2XGTA 5IYCH 1YJNA 2PUOB 1H9KA 4M75B 3KF6B 3M0SA 1OX9A 2QA4T 1U0LA 1Z9FA 2QF7A 4OMLA 4C8QC 1TWBA 2KCTA 2XRSD 4KY6A 2KA7A 3M0UA 3CD6Q 3GV3A 2EVBA 3P20A 4M78B 3WXMB 1J3TA 3WOEA 5C44H 4JS4A 1ENAA 4DQ2A 4GOPB 1SEBD 3EH1A 4A3LG 5M3FB 1SYGA 2DNUA 1G8ZD 3I90A 1YJWA 2LCCA 2J6OA 2RO0A 4ZYSA 4R56A 1OXSC 5DEHA 2X6GA 4II1A 2V8IA 3NUCA 1BCPB 1PRTD 3T1YL 1YNZA 1GXIE 1N8RU 3JC66 1S72Q 2VUBA 1JCKB 4IN3A 2K75A 4LUEA 1QE6A 1ZKOA 4JLIA 2CCZA 1HXYD 2DXCA 3K0XA 5IT9c 2D2CC 5IE8A 3JAMi 1ET9A 5I2MA 2KEDA 1EZZB 2F0VA 1TS4A 1PDQA 2DJZA 2QI2A 2DBMA 1QZGA 2M2LA 2RJFA 5A0GA 1ICWA 4HT8A 5IGGA 4JI7L 2SNMA 4R1JA 5GQOA 5IHIA 4RCNA 2EIFA 4KH1B 1TS2A 3H0GH 2F0KA 4J9CA 1KIXA 5K36H 1JRIA 3M4OH 3RMQA 1WX6A 2WSEE 1UGQB 4J5YA 4A3JH 2CQAA 4OXPA 1XQHA 2NUPA 1LTBD 1HZBA 1KAAA 5I2YA 4G7ZC 1PM3A 3I4OA 1O78A 1WCMB 1F2ZA 3TP6A 3HP9A 5IGCA 2EYZA 1CT1D 1UB4A 4AMCA 1TWFB 4MIUA 3RUXA 1EL0A 2A73B 3GO5A 2KUMA 1AT1B 1RI9A 2ENMA 5A0DA 4ZLTF 1PH7A 3O5ZA 1IBLQ 3M3YH 2AHOB 4NXMQ 4IURA 4KRTA 5FWBA 3V8JA 1YIJA 1KRSA 3MWYW 3ERQA 2ZPBB 3QB3A 4DAYA 1Y71A 1WTHA 4XTZA 2Z0SA 1JXMA 4ZKBB 1G83A 3GOXA 1YNXA 4BY1H 4HCEA 4J9GA 1UUEA 2B2UA 2OQ0A 1UE6A 2DIQA 3K6OA 4DA2A 4FYXB 3NHNA 1VQDA 4R4IA 1EFNA 4GN3B 2FL7A 4BI4A 4CKBA 3RKWA 1J8IA 2E74C 3E1SA 5GAOp 1H9JA 3F2UA 1PRTC 4DR7L 1ASZA 4EMKA 4HCBA 5EBDA 4YWMA 3WVDB 3JB9D 1WHJA 1RD9D 2CW0C 2PVOB 4J8OA 1Y8NB 1U8RA 2NN6I 3RMHA 4Y7NB 1NPPA 2OAWA 3TBIB 1PH8A 4DV2Q 1I6HH 3E9FA 2K4YA 1K28A 2A37A 1V1CA 1X65A 2P5ZX 1I5OB 4K5XA 2LJ0A 2RCFA 5AJ3Q 3R6OA 3HOWG 4WJ4A 4LDWA 1Z47A 1K8AU 2IX3A 2F0QA 3CCLQ 2BDNA 1TIID 4KHVA 1YI2A 1O7LA 2XIWA 4M77A 1C8CA 3E9HA 2PTKA 3TVTA 4YCWA 1BF4A 4HCKA 4C8QD 1FX7A 2B2TC 2F1MA 3SK6A 1NPRA 2F2VA 5CIUA 1WJRA 1LJOA 1X43A 1Z9QA 1KG1A 5A2QE 1RTOA 3FVQA 3KF8B 1TUCA 3PSIA 2DFUA 3V96A 4JI6L 3MXUA 2KI7A 4R4QA 1Q81U 2RDGA 4LK1C 3RR5A 2DEUA 2J05A 2VB6A 1CKMA 3BVMA 3GTGH 1D6EC 1AWJA 1OO9B 5GANg 3J7A5 2QEXT 1R0BG 3BZDB 1W6JA 4F8MA 1W70A 5I4DA 1YHAA 3C95A 1SFOB 1VQ4Q 4P2CB 3OWEB 3LGFA 2KDSA 1K0RA 2I5HA 2Z4HA 1RABB 3MVVA 5IGDA 1KRTA 2DIGA 4IIOA 4DOVA 1WJSA 3VS7A 4ZGJB 2TSSA 4J9HA 4XU1A 2A19A 2DMOA 2YU9B 4Z9CB 2QDBA 3OYHA 4X1VA 3A55A 4OWTB 4DXFA 1EQVA 4KGZB 4ESRA 5M9OA 3L2WA 2EY5A 2QQAA 2D8HA 3AFQA 4GLAC 4NW2A 3BJUA 4ZNXA 1NE8A 3HOYG 4LFCQ 2EYHA 1PH1A 1I4GA 2DAQA 2SNSA 4M7AE 4JC0A 1Y96B 3RZDB 4XTYA 2NUCA 4LF5Q 3I35A 2VQEL 4X9CA 1UE7A 1WD1A 3CCMA 4HIMA 5JEAJ 4RWSC 1A3TA 2F0DA 3HOYH 2E41A 1NEGA 4YY3Q 5GMKj 1TVXA 3CD6A 1LPLA 3UDXA 5FWCA 3VRYA 4DBHA 1GCPA 2JYOA 3OQ5A 3A98A 4BA2I 1MKHA 3GTLH 2CYZB 2F3IA 3KBXA 4DR3Q 1M5Q1 3HOUB 4LWCA 3PNWC 5C4XB 2O01E 2ZXPA 3CCQT 2E5LQ 1TXQA 3QSUA 3S17B 2C0OA 3SHWA 2IHFA 3DUZA 3RZDH 2BDOA 4Y7NH 2HHHQ 5FROA 4GOPC 2JA6B 3C46A 5GAN4 2K5QA 3K58A 1N36Q 3AU7A 4K8IA 5EPJA 3HOXG 2RSOA 1RACB 3OMCA 3HKSA 2PVDB 5KE3A 1I50B 1LT4D 5KEEA 4AQYL 4OX9Q 2R5MA 4FF4A 2L8DA 3QG1A 3EFOB 2ZPHB 3MTSA 3E9IA 5IWAL 4C3IB 2JJQA 2I5MX 2OQKA 5IODA 5CV6A 3CBPA 1CQVA 1HFGA 4M7AC 4LAAA 5D65A 2YLCA 5CYUA 1YNNC 2RK2A 2Y4XA 1FMVA 2ICIA 3QYHB 4DV3L 1A2TA 3L2RA 2PW5A 4B3RQ 2Z6KA 2Q2IA 3I4NB 3GTGB 3CXCA 2DL5A 2AKLA 4B3SQ 4IPGA 3OY9A 4OO1H 1PVOA 2RA2A 3D4DA 1HNWQ 4AT1B 1W1FA 3U9SA 2FYKA 2PU9B 1NMFA 4FXKC 4B3ML 3C3LA 4M7AB 2J0TD 5T1IA 2NYSA 3S6WA 1F2LA 3GNGA 1E3PA 1JT8A 3CMEQ 2HCKA 2N78A 4HCSA 4YIJA 2NBFA 3T4AC 3SDZA 3Q23A 2CS7A 2A8VA 2HDAA 2QQ9A 4XYOA 1NJIC 2A6EC 3VS0A 5M3MH 1VYUA 1MHNA 1SXTA 2H1EA 4LDVA 3INZA 1O80A 2W0ZA 3QJ6A 4N9TA 4A93G 2KE9A 3RDVA 4AFSC 2Y4YA 3QHSA 1IBMQ 5J1ZA 5GMKe 1KK7A 4G7HC 2MOXA 3CCVA 4QUCA 2ZZDA 3G48A 2UXCL 4A3JG 2R92B 2KHIA 4RH6A 1QVGA 2F0NA 2KCMA 1F9QA 4FCYA 2K5DA 3HG9A 1UDLA 1NCVA 1KLUD 1EX4A 4DEXA 1ENCA 2CWAA 5GAN7 2QA4A 2CP5A 1K8AC 3I70A 3K81C 2RMOA 4S3SA 2VQFL 3RMSA 1L1OC 1ET6A 1ZSZB 2FZCB 2YXYA 1CM9A 4BWGB 2EQJA 1DM0B 1EWCA 1GKHA 4NPSA 4PNYA 1I6VC 4C56C 4OO1I 5BN3A 5M3FH 1M4VA 3U50C 3T51B 4A4IA 2K03A 1VQ9T 1KIKA 2C5CA 2N49A 3KFVA 1VQGA 4XTCS 4E7SA 3H3VH 3RERA 3HFZB 3PCOB 2F69A 3CCUA 3C94A 1CSPA 3VKIA 2VB2X 2LC4A 1SLJA 1Y8OB 2VB3X 4DR6L 1PV4A 4JJNK 1DJ7B 3JCMf 4LMQD 3HS0C 2Q8TA 4XTWA 5LMUQ 1XNQL 4P5NA 1T5XD 1C0MA 1VDZA 2B2UC 1D8LA 1RI0A 3L2VA 1SYCA 3TEHB 4L5GA 4EQOA 3HOZG 1O7YA 2IW3A 1EFWA 3JCMP 3K5OA 1N33L 2IY5B 1SPKA 8AT1B 2L2PA 1AVZC 4FF2A 2R93H 2DL3A 5GJVB 3VYUA 1N8RC 1J6QA 3K8AA 4DAYB 4A3CG 1F2YA 1WXTA 2GQVA 1OQKA 4JI0Q 2XRQD 3SE0A 4FM4B 4R4TA 2LTOA 1LTAD 3DKMA 3SWNA 3KFUA 3GTMB 1TT2A 4FYWB 1EY4A 1FVIA 1QG7A 2EYOA 2MFIA 3UA7A 2GF7A 1SKUB 2MK5A 3EG1A 1EY6A 5GMKi 2PQAB 2LX7A 5ELCA 4DXGA 1VQ6T 2BE5C 2ZM6Q 4FF1A 2EGAA 1SJHD 4K11A 3VS4A 3M55A 1EWHA 1NR2A 3OSVA 4IZ8A 5JOBA 4G7OC 2GQIA 1D3BA 2NWGA 4JJCA 2JK8A 4R8IA 1G3SA 2BE5D 3JCMh 2V1RA 3BFMA 2AQ3B 2JJ9A 3QO3A 1KLGD 2QGGA 2ROTA 4LFBL 1ZX6A 2EY6A 2N88A 4LUOA 3UI2A 4E7LA 5IYDG 1QMCA 4M77G 1NJIU 5M5WH 4OVAA 1OTCA 1LTID 3EG9A 1VQMA 3GIBA 5LJ5j 2N55A 1M1FA 4FYVB 1STHA 1Q86R 4TSSA 3TP8A 4F7UB 4X6AH 3J81j 3A8KE 3HOZB 2Y0SB 5IYBH 1N6AA 1BVSA 1O75A 5IN1A 5CO7A 1KDAA 3N6RA 2CUBA 4J8QA 4AYBG 2QK0A 2F52A 1LCKA 1QCNA 2OI3A 1WDXA 4PZ6A 3H6MA 3H15A 2ENBA 2VV5A 1RDPD 1HTPA 3THKA 1HYOA 1HA5A 5CC4A 4ALPA 2M9UA 4ID6A 1TG0A 3CCQQ 5KIXA 4JV5Q 5C0XI 4CJ0B 5C44G 3BZCA 1JO8A 4NS5A 1F9SA 3ZJYC 1P16A 4AG1C 1AN8A 3M54A 1JOKA 3X3MA 1IYJB 4MN3A 3AHUA 4N9PA 1AWXA 2JA5G 4WF2A 3CMAT 1RCVD 5IYCG 4DUYL 4DR4Q 2XMFA 2EFIA 5GAN5 3CEYA 2XDDA 3NEMA 3TS2A 1I5FA 4M77F 4F7UG 2E2JB 2DO3A 3I4MH 5FU6C 2Q2UA 2KVQG 3EH2A 4XYQA 4EGVA 1V9PA 4EQPA 1FYCA 2FHTA 3DB3A 2PVGB 1JC7A 3JCMX 2V8KA 4A3IH 1JBMA 1Y96A 4J6HA 4XTVA 1K8GA 2CZ1B 7AT1B 4CJ1B 2LRQA 1ZA2B 1W2BP 1YITQ 4MDXA 2COYA 2F0PA 2E12A 2OCEA 3OOCA 2D0QB 3FJ5A 5IXFA 4TRDA 3T56B 3KOJA 4IPDA 2UU9Q 2D9TA 3OS0A 3OB9A 1MSHA 3TSSA 2NVQB 2O9SA 1M90R 2UUAL 2LP5A 1YJ9Q 3I4LA 3NXWA 4HA8A 2FJ2A 4JI2L 4RFBA 3EG2A 5HGTA 2P4RA 4PFOA 2L15A 1ZQ1A 1Y1VG 2AQ1B 4LF4L 3QKJA 2YWWA 4BI3A 1UJYA 1XX8A 2RD1A 3H0FA 1L1OA 4DK1A 5C4XH 4DK3C 3J81c 1N32L 2RQXA 1V1QA 3Q0AA 3S15B 2LQKA 3M53A 3UATA 1PFSA 3S24A 3GTLB 3BDUA 1BIAA 4B6MA 2QQRA 2QEXA 1B8AA 3EFXD 5BN4A 2WSCE 1OX8A 5KYYA 1TQOA 4B3TL 4J9EA 4M78A 3UE1A 3CCEQ 1E24A 2SOBA 1KDCA 1SMYD 3M5AA 2C06A 3NQTA 4E47A 4ORZA 5CV8A 2RHXA 4O1NA 1OZ2A 3JCMJ 1LACA 3QOJA 2DTIA 3CMEA 1KJWA 4IUUA 5G3LD 5GAOm 1C48A 3CQTA 3QBYA 3PV0A 3ER0A 5J39A 2KHJA 5FO7B 4BACA 4OWXB 4EDUA 2RQUA 4JI5Q 3CCET 1LTTD 1YI2T 1NJIR 1BCMA 3PIO3 2PO4A 5EPKA 3GF5A 1RLQC 1WTXA 5GAEC 4M77D 4PV1C 5A2QL 1OI1A 1VQPQ 3HOXH 1ASYA 4DUZQ 3IL8A 2YU9H 3MEAA 3AEVA 4IUVA 1R4PB 1J9OA 4C8QE 1U1TA 2MNAA 3U58A 1BCPF 2PUKB 4C5IA 1WLPB 4PJJA 3SD4A 3UA6A 5C3WA 1UWVA 1D0ZA 1X3QA 4LF7L 1VQOA 3NMZC 5D6XA 1GHJA 2OT2A 4PJNA 2GA4B 5KE2A 2YUNA 1WHKA 4ZN3A 4KKSA 4A3EB 1WTRA 3GTKB 1E1TA 2OWOA 5C5LA 3LNNA 1FNUA 5EGTA 1WOCA 2JN4A 3QUIA 1PWTA 4OONA 4LDUA 5DNFA 3CCRA 1WTPA 3J80i 4X65Q 2JEBI 1VQKT 3M57A 2PYKA 2G9DA 5CBAE 4P74A 5GAN6 3D0FA 3RKYA 5IY0A 2DY8A 4LFAQ 4OL7A 1UGRB 1YITA 4LF8L 2K79A 3NGPA 5FK9C 1M2VA 2L5QA 4JK1C 5EPLA 2ZPFB 1SHFA 3J7AF 2R7ZH 3EAEA 4NP5A 2XI9A 4DPGA 1QCOA 3GTQB 4FVMA 4R4CA 3NP8A 3MO8A 5LJ5h 3PVQA 2VXEA 1VQOQ 2L9HA 2VXWA 4BY6B 3ND8A 4DR7Q 4LXCA 1BOSA 2LT4A 5FOBB 3OHXC 1GUWA 4ATOA 3CC4Q 3S1RH 1Z6HA 1RUWA 1WXBA 4FSSA 5HKCA 4XQJA 2QEXQ 2ED0A 2F2XA 3QIIA 1U3OA 2KT8A 2NN6G 2HT1A 1TKWB 4DV1L 2RHZA 1IB8A 4HVUA 1QVFA 4CDEC 2KAFA 3KJPA 4JRKA 3LWEA 2UXDQ 5GANe 2LT1A 4HJAA 3EFSA 5IP9G 1Q8IA 1WQWA 1JXOA 1LNXA 3MP1A 3S2HH 2NVXB 4IFDI 2UUCL 3OYIA 4MMKA 4QL5A 3SVMA 5KYNA 1GFCA 3VS3A 2PNHA 2DA9A 2H3EB 1AHJB 4OMOA 4RKUE 4L5TA 1K1ZA 2AIRB 1SNQA 1VQJA 1IO6A 3G7ZA 4DV7Q 5CORA 3EIVA 4MZ9A 4J7IA 3F8TA 4A4FA 4IIMA 3L7ZC 2NUTB 5JJZA 4OWWB 2R92H 1H9MA 4KLKA 3EBEA 5L23A 4BBSG 1YHQQ 2C9OA 2EY1A 1SE4A 2LQWA 1OEBA 1HUMA 3R93A 5IT9L 1PSFA 1RF2D 3ULRB 4Z89A 5GMKh 1AE3A 4AIMA 4U68A 3P8BB 4PKCC 5GJWB 3KF8A 1PKTA 1OU9A 1EYDA 5LJ3j 3OS2A 3JB9F 3M4OB 5C3EH 2K2VA 1U4PA 4A3FH 5GAN8 3TRZA 1MMGA 2COZA 3QWNA 5FU6B 2WACA 3W1BA 4H13C 1EU3A 1VQCA 3L3OC 1HR0Q 3PF4A 2R7ZG 2HD3A 3I91A 1HNXQ 1VQAA 1B53A 4P72A 4HVWA 4C92F 1S5FD 3VYSA 2MHVA 3TP7A 4C3JB 1VQEA 4PK4A 1ZLMA 4J83A 3JCMg 1NR4A 1SMXA 4M7AF 4M75D 1WJJA 4OMPA 2ECZA 4AFQC 3PIOA 2J7ZA 2E65A 4D6WA 1EOTA 1H92A 1EIGA 1U5KA 4QVCA 1Z7TA 1ZYRD 3H91A 3G71A 3CXCS 3HZXA 5FLMG 1IZ6A 2VZAA 4UPAA 1LO5D 3I4NH 4A3IG 4WRDA 2UUBL 4J7FA 5CKEA 2R57A 2R7DA 3G6EA 3EVQA 2RQVA 2NVXH 4JOIC 1I4K1 3MXPA 2KCCA 1H641 3GPLA 4R55A 1PNJA 1QCFA 1HSQA 3I5RA 1C4QA 1Y8PB 3QDRB 3RNUA 2JSOA 1S72T 3J80E 2JA5H 3Q22A 4XU3A 1VQ7A 5DM63 1FJGL 3GTJB 2Q8RE 4BE2A 1MSGA 2A7YA 2BE9B 3UDGA 1FWZA 5GAMh 1G2SA 3VR2A 1RLPC 3M4PA 4ZUJA 4ZGEB 4C92E 5FLMH 1PYSB 1MMAA 5A35A 1SG5A 1VQNT 2B3GA 1Q7YC 1EIFA 4C8QB 1X55A 2HIXA 4LDYA 2E5QA 3GTQH 1X56A 1NM7A 1V1PA 1BR9A 2HQXA 1SNCA 5C0MA 3I8ZA 4TKOB 1TWHH 2EYYA 4H7BA 1QVFS 2B2VC 4NKLA 3EFOA 1STBA 3SK5A 2VUMB 3A0JA 1D1CA 3Q8DA 3ULLA 3ONAB 1EY8A 2QGFB 2JN0A 2LX9A 2OTJQ 4A3BH 4QY7A 5H1SE 2XNAC 2NLUA 4M7DG 3SB2A 2E6NA 4LUDA 1O7IA 5CV7A 4A3EH 1EWIA 3GTKH 5JJIA 2K4KA 4GLMA 4XK8E 1ESFA 4IPHA 2L0CA 1VMCA 1KQSA 4CDCC 2F0FA 3M7GA 2XG8D 3KLWA 1VQNQ 1K9MU 1PFMA 4BBSH 2BE7D 5ELEA 1S5CD 4KD3A 3NPPA 3L2QA 2Y0SG 2E2HH 1D2BA 4RGOS 2CHBD 2F0JA 4J6WA 3J81i 1W2BA 1UECA 1X3GA 4IALA 2M02A 1BXTA 1V8QA 1SFOH 1NAPA 3CP0A 2X4XA 3LGLA 2JW4A 4C92C 2RB6A 3M4GA 4DR5Q 4V2SA 2F0HA 2RBMA 4CRIA 4BBRB 2I2LA 1CKBA 5EQ0A 2F5KA 2HD0A 3S9WA 2P0QA 2K2MA 2DZCA 2DGYA 5IAYA 3CW2C 3EGXA 3S1QB 4F17A 3T9NA 1ZUKA 2JA7H 2HEQA 2F0SA 3S3NA 3TEEA 1AZQA 4HKEA 3JCMc 4PJOB 4FSXA 1GUGA 2XKOC 4C0GA 1FYNA 3BZKA 5GANh 3FDTA 3GBQA 4FT4A 4UC4A 4KUIA 1WZOA 1SF9A 2KT1A 3G6ET 4PJOE 4LN2A 3FDRA 5I21A 4JCVE 4DN4M 4Y92A 2RNAA 1K3RA 4JI8Q 3CMAA 3QZ9B 1YVCA 5GAOq 3RLOA 3L2PA 2L3SA 1EQRA 4BY7G 5FU7B 2E2IB 2ZGWA 2XHCA 2QG9B 4DKAC 1T0JA 2FG0A 4OGCA 1PH3A 5ELFA 4X66Q 3LWIA 3FPUB 2D8JA 5FLXc 5KCOA 1BBXC 4RTXA 3NK9A 5IH2A 4RGNA 4JI1L 3K5MA 4HR7B 2V1QA 1K9AA 2BA1A 1EIYB 2WIIB 3OYLA 4L63B 1N5ZA 5LJ5e 2EZVA 4PMBA 1WXUA 2J7IA 1M8AA 1JWUD 4K14A 4HJ5A 2PQEA 5COYA 2FVUA 1SN8A 1SNDA 2L0AA 3BYTB 4X3KA 5KNCA 5L37A 4BXXH 3GTPH 3FC3A 1TUDA 1XMQL 4N4GA 4A3DB 2I07B 3CBOA 1VA7A 4MHEA 2K33A 2DXBA 4A3GH 3SGIA 3CXCP 3OYDA 4JDSA 1TY2A 4C3HG 1DD2A 1VQHA 2VGNA 2DZ9A 4JBMA 4JUVA 2DRKA 1ABQA 1I94Q 2CP2A 2QDLA 2PMZE 5E1FA 1XOVA 3MHXA 4N0AA 1H9RA 4LF9L 3EROA 4C92B 1IGUA 2EY2A 4BUGA 1A0NB 5CCAA 2DYBA 5HURA 3HHTB 2E75C 4QIWE 1TWFH 2MPMA 1ZBJA 5LL6S 5L8RE 2HZYA 1HQMC 4IFDH 2JUFA 4ZCKA 4BB7A 5C5MA 3BVGA 3D6CA 4A3JB 3G71Q 1FR3A 4LW1A 4KHPL 3G6JB 5ELOA 3L42A 1PTOD 2G6FX 1B1ZA 4B9XA 1LM0A 1JR0D 2CH4W 1SYDA 1WTVA 1Q82C 1V76A 3KYHC 1SSHA 4XIGS 4D8KA 3TS0A 2OXPA 4TVAB 4OGEA 1MV0B 4NL3A 2CP7A 4JLGA 1Q1EA 3LX7A 2FFKB 4JI3L 1XNRQ 3BDCA 2PI2A 3M7NA 4KBMB 1SSOA 3HRZC 4A3DG 1M8VA 5LMNW 3KK7A 2K3XA 3NBIA 1OYXA 3A8JE 3MFYA 5J22A 2DN8A 2KRNA 2M00A 2LQ8A 2WINB 5ECAA 2AMCB 4DV0Q 3F2BA 4NL2A 1ZSGA 3EGDB 4O5VA 5M5WB 3JAMc 5LJ3d 3CMET 3HOWH 3N52A 3FRNA 4DNRB 3MAQA 2KXDA 1QNUA 3DXJC 1FL0A 5GROA 3H09A 5CKFA 1HR0W 1VQBA 1YITT 2JNGA 3KBGA 1XNIA 2EYWA 1VQPT 1JE4A 2E6ZA 1QZHA 1UGPB 2IX1A 2JA8H 2CKZB 1JB7A 1UUPA 3G4SQ 3I56Q 3JB9I 2AKWB 1I4XA 3CCRT 4RG8A 4A3KB 1CI3M 1SSFA 2RQRA 4DBQA 1BBUA 1PYBA 4FXGC 1X69A 2FPFA 3A5ZB 3UF4A 1N27A 1ZUUA 1QOHA 3FHWA 5C44B 2K6DA 4L8JA 4QQ6A 1U5SA 1VIFA 1CKNB 1LT3D 5E4WC 1A2UA 1YNJC 5AFWA 1S5BD 2A69C 1I4QA 5D7UA 5C6SA 2QASA 2HIVA 1X2KA 1N34Q 2IJ0A 1ZUYA 2QCPX 4QF4A 2VYTA 3RIRA 2RI3A 3X26B 5C4JB 3U23A 1J5EL 1HHVA 3X25B 2GVBA 1OPLA 1PZKD 3OYGA 2D0PA 3RESA 1H3ZA 2L5TA 3C1FA 1VQ7T 2J6FA 1R77A 2K05A 3DEPA 5IYDH 1YFNA 4RCOA 2D6FA 1HNZL 1SMYC 1SDFA 1JWSD 3EHRA 5KYWB 4R0KA 3JB9J 1KTKA 2B8FA 2FINB 4JI6Q 4IFDG 2D9UA 5DLQE 2JP1A 1QWFA 1V43A 1ARKA 2LCSA 2E5KA 4AFUC 1D1BA 4GN4B 4KJOA 4QMGA 1F77A 3V05A 4GOPA 1WVLA 1DOKA 2OJ2A 4C0DC 4C0ZA 1IHWA 1LOJA 1OZ3A 4LD6A 3P8HA 3GV6A 4P71A 4KULA 4UDUC 1Q8KA 5C4HA 3D4RA 2CSQA 1ONLA 3PO3H 4ANJA 1M8MA 1FXXA 4NB3A 2NVYH 4UP7A 3F2DA 2HQEA 4DV3Q 1HFNA 1PH6A 4A3CH 1I4HA 2ZXRA 1L1OB 3S1NB 1AEXA 1PH5A 4WORA 2E3HA 3CD6T 1GUNA 3E3XA 1HH2P 2KSSA 2F1LA 3CQZB 2QTXA 5KGUA 2EBPA 2CP0A 5KYYB 1K83B 5LHY1 1SYEA 3K7AH 2QW7A 4XU0A 2I0NA 3V7RA 5GAMe 3KLRA 4B3MQ 4DF7A 1ICFB 5M3MB 1GOZA 1LTRD 1VQMT 4GNXA 1CFMA 1NEBA 3IFDA 2ICEC 3MEUA 4A3MB 3ICEA 4FW2A 3U4ZA 1NTGA 2DETA 5M5YH 3H0IA 2V1CC 3FJPA 3PGGA 2ALYB 4ME7A 3PMIA 4MZPA 1RAFB 2NUPB 2RH2A 4OO1G 3QDFA 1LLRD 2R93G 1XYIA 4X3TA 3PMFA 1X9NA 2O4XA 5JPMC 3D4WA 3OYKA 3CPFA 2F0UA 4FXDA 2LXJA 1Q7YR 2EDGA 1BIBA 2A6HC 5LJ5d 4CJ2C 3PUYA 3H6ZA 1XTCD 2F3VA 5HY6A 1Q90A 2HHHL 1GHKA 3LH5A 1N8RR 4BY1G 1HCZA 3OS5A 4HSVA 3N5BB 1S4ZA 5ISRA 4RG2A 3WVEB 4R4OA 4ZRZA 2JE6I 1RHPA 3RZOB 1KQSP 1P8LA 1CTMA 1BBZA 4QUFA 3KUFA 2BH2A 1BI1A 4CHTB 4DAPA 1Y1WH 3ULPA 2EGEA 1DGSA 2FEIA 2V26A 4C3IH 5GAOr 2MAMA 4EPCA 2M0OA 2KCNA 5I2XA 2GTJA 4G57A 3VS5A 4P73A 1SROA 2JVVA 3EA6A 4LNQA 5IXBA 4FIBA 1MHWC 1STAA 2ZPEB 2XN9C 3L9AX 4YWLA 1Y57A 4M78E 2DL8A 2UU9L 4KT0E 4RMOA 1CSKA 5BR8Q 1OOTA 3IQLA 1E2ZA 3CCSQ 4OELB 1RAAB 2EPDA 3URGA 2D0NA 1VQLA 3P75A 1P92A 4A3EG 3R8BA 4HSPA 4DR6Q 3BVZA 4M7DC 2B29A 2EYMA 1HJDA 1G2BA 4A3BB 4MMLA 5LJ3e 3MCAB 2KRSA 4GLKA 2R7FA 1S1NA 2K3YA 2M0YA 5CQXA 3OW2P 4XTXA 1IL8A 1G6PA 4VUBA 1ACMB 2RPNA 5M5XB 2B2WA 3CRKC 5FW9A 4EMGA 3TCJA 5I11A 4ABNA 1EIHA 4WTOB 2H5XA 5CV9A 3R6NA 1SRMA 2FPEA 2PCFB 4PJLA 2EQSA 2H4OA 3CBMA 4L5RC 3CCST 3OW7A 1W4SA 2IPKD 1G3WA 2L3PA 1CHPD 3DWQA 3OPOA 2NTTA 3GTJH 2YV5A 4M77E 4PFZA 5C6AA 1E2VA 4UY8C 1X54A 3UDIA 2DNCA 1EFID 2UXBQ 2BOSA 2E1HA 1OPKA 3A8LB 2QQBA 4PNOA 2WAQB 1M2OA 2X4YA 4E7HA 3PUXA 3TZUA 4L6V5 2EQKA 2FZGB 4IUTA 1SAPA 3RLNA 3CCEA 1U4LA 2XU8A 2QYZA 2VS1A 3NSWA 3HOVB 4K6LA 4EQNA 4C8QG 5GAOn 1UTIA 1YP5A 3VS1A 2L4NA 1QVCA 3F2CA 3A7AB 2WV6D 1G5VA 5LMNL 4R8NA 2R6GA 1NYFA 1L2FA 2KMTA 5F2DA 4DR5L 4HMIA 3RN5A 2O5JC 4O0AA 3HKZG 3BG3A 3S14B 2ID0A 1DXMA 4NXNL 2VWFA 1FMWA 1BI0A 3MJXA 4QQDA 4EVOA 5JPNC 3H0HA 3WOFA 1Y69U 5I2SA 1Q1BA 2G9HD 3T1HQ 2KBTA 4K0KL 3HKZE 2DD4A 1VQLT 3CCUQ 2SRCA 1EZ8A 1QUQB 5EKIA 4YHHL 3PIP3 1CSQA 1O7ZA 1MGSA 2B2WC 3K57A 3OS1A 3E9GA 1M90U 3JB9H 3I5SA 1PTOB 2A68C 2B39A 1EY7A 2FRYA 2WKCA 1ZSZC 1IBKQ 5CGKA 3PUZA 2JTMA 1STEA 1Q3LA 1SE2A 4DUYQ 2RI2A 2O31A 1VQ6A 2K5VA 5DM73 4IUPA 2R5AA 4RAUC 2HL3A 3VA7A 4D8DA 3CCMQ 1BI2A 5EAYA 4QIWB 3V8KA 1PLFA 5C3EG 3E6ZX 3META 2EJFC 1B7YB 3GP7A 3CPWS 2LMJA 2F4VQ 5CR2A 4WJ3M 4JZ4A 1YHQT 1N36L 1QKWA 4P75A 4NDXA 4FO2A 3HRTA 1UFFA 5IGFA 4DR1Q 4OX9L 1VF7A 4JG2A 4DR2Q 1M9SA 1H8KA 3KDFA 2A5HA 3I56T 2X3WD 1E0BA 1S40A 1CKNA 3OIQA 3RBBB 2L3RA 1O9SA 3NWSA 2OEOA 3GLXA 2JQOA 5I22A 1SE3A 2RF4A 2VVKA 1F2MA 4RCBA 1MV3A 2K5IA 5G3LF 3R2IA 3S2HB 3B6YA 2PZWA 4PLLA 5C0XJ 4JRIA 2M16A 1GRIA 1PRMC 2CKKA 1VCIA 4LE9A 3SEBA 4HCZA 4DU9A 5C0XH 3QXEB 3J81E 1CZWA 4JI4Q 2ROLA 1WTWA 2LDMA 1D7QA 3H94A 1SRUA 2CREA 1GFDA 1VQ8T 2ZPGB 4DOWA 2NN6H 2P0KA 2XWJB 2HCCA 1PRLC 2QILA 1QB5D 1VQOT 5DLOA 1HQRD 3H0GB 3HGBA 3WWVA 2PNIA 1SJED 3PMTA 1JOOA 3UDCA 3CPWP 1VQ5A 4MZTA 1BBWA 5CBEE 1YCYA 3E2UA 4N8X1 3RNJA 4UP9A 3PO2B 5KNDA 5LL6X 2E64A 3ZFJA 3G71T 2B63H 4ZKCB 3QR8A 3AT1B 4ZTFA 1YIJT 1MI2A 4C5GA 4F04B 1TUGB 2VUMG 4G4KA 3VR3A 2LSSA 5CMDA 3D8GA 4GZYC 4E7KA 1IBLL 3GQBA 2NUZA 4M78F 5LJ3g 2NVTB 2KYMA 4OF1A 4C2MB 2UXCQ 2BH8A 5C4ZA 5C4XG 5EKKA 2K6AA 4KI0A 1C0AA 4GNXC 4E7ZA 2EJGA 4OB2B 1ZA1B 1PMRA 4YWKA 2G3RA 1TWAB 2GVAA 1Q81C 3J7YW 4FL6A 3LYIA 3PO3G 1HA6A 4F7UF 1B44D 4GNXB 3S2DH 1PCXA 4J6XA 1GUSA 2COWA 1QCBD 4DV5Q 3OYMA 1G91A 1EU4A 2RF0A 3V7CA 4QJFA 4HT9A 5JJKA 1OULA 2F0WA 4KY7A 4Z88A 5CQYA 1A63A 4B9WA 4XXEA 2K5WA 1UG1A 1RAIB 1VYVA 2RCNA 2YYZA 2K01A 2AHJB 4GLXA 5AJ3L 1PYWD 3PE0A 4M75C 4RTVA 3G1JA 1JEGA 3EFRA 3REBB 4HEDA 2XSCA 3H3VI 1F1BB 2YSQA 1YBYA 4X3UA 3CCUT 1KD1R 4J9DA 3L2ZA 5M5XH 5EJWA 1ENFA 1UNSA 4O2DA 1WJQA 5HGQA 3TQYA 1EQQA 4OB3B 2YRCA 3FPPA 4M77B 3NTKA 1WYDA 1AD5A 2OTLA 2LY7A 2Z9HA 4DNIA 4JI0L 2LVMA 6AT1B 1JORA 1UGVA 1KL9A 3MEHA 5D3DA 1TR5A 3ZL7C 3UWNA 1DCZA 1D5XC 3I72A 5J26A 5J3BA 2E2DC 4XQNA 3F70A 1BCOA 3CC7Q 3CKIB 1I0CA 1ILQA 2MQHA 1HNWL 3VDYA 3I73A 3W5OA 4PLIA 4F7UE 1HZCA 2HSPA 3J7ZC 3OW2S 4JYAQ 2ZM6L 4BY7H 4RKLA 2RHQB 2DJFC 3MEFA 3EG0A 2IPOB 2FZKB 2NZHA 5GAMg 3ERSX 4ME5A 1QWEA 2VKNA 4DUZL 2K3BA 3K0YA 1OXVA 1CUKA 2HQHA 2W10A 4PJOD 1LYLA 5IYBG 3OW2A 2GGRA 1AFPA 4HXJA 5K5PA 1B3AA 5D14A 3TSZA 2XWBB 1XMOQ 3FMCA 2PI2E 2ZXOA 5DM7R 4XT3B 2MPXC 1Y1VB 2CQOA 4BY7B 1Q86C 2F3WA 3CU7A 1BI3A 1V29B 4A63B 1TS5A 4GN5A 5NUCA 1B7TA 4LFCL 1OV3A 1A3UA 2HMAA 1D5ZC 1MUZA 1IYUA 2GCXA 1D0XA 3RD4A 4DAMA 1RODA 3OYAA 1GCQC 2EOTA 1UHFA 2H3JA 3AFPA 5I9OA 2FRWA 5GAMd 3H41A 2DK3A 4IUQA 4OIJA 4KGVB 1HD3A 2CW0D 1ILPA 2MYSA 2ATCB 5CV4A 5GMKm 1CK1A 3QIAA 3FB9A 4FF3A 3E0EA 1A62A 4JJDA 2JA7B 4M78C 3A8OB 1WHHA 3JCMV 4ELZC 3D3RA 1XTDA 1E7ZA 2E5LL 3S3OA 1FGUA 4ILWA 3JAME 1UJ0A 3NQIA 4UHVA 4BBRH 4KV6A 5FLXL 2FO0A 1LUZA 8ATCB 3KF6A 4X62Q 3LLRA 1WPYA 5CV5A 2EQIA 4N0AC 3K7AB 4XAXB 3HOZH 1IREB 2VASA 3M9BA 1VMPA 3CQZH 5IWAQ 1RAHB 3FEWX 2K28A 3M0RA 1EYAA 4CC2A 2RN8A 3EJIA 2E2HB 1KC8R 1K76A 1PHTA 4C3HH 4ME3A 2J06A 1TWGH 2WB1B 3KLSX 4BY6C 3T1YQ 4J9FA 3SEMA 1F9RA 3MXNA 2NVYB 1XMQQ 2X3XD 1NLPC 2DKGA 2K7AA 3PTAA 3CC2Q 3BS1A 4A3MG 4B3RL 4Y52H 2C0TA 2GFAA 2JOYA 1JU5C 4MDWA 2F0OA 4DAVA 4DV6Q 2P0PA 1TSFA 1KD1U 5DAUA 2RJEA 4GBQA 1H9SB 5KNBA 2JEAI 2LFNA 3CCMT 1MJEA 2DYIA 3V7SA 5KYUB 1X6GA 5A0LA 2EYQA 2DTHA 5FRMA 3TZDA 2ESWA 1QLYA 2HCIA 2DVEA 2O2LD 3JCMW 2X4WA 3VRZA 1VQ9A 2WAQG 3OTOL 4DV4L 1TU0B 1PFBA 3NE5B 1CHQD 3MXGA 1EQTA 1C7YA 4UP8A 1U1SA 4JS5A 4RTWA 2HDLA 4KKTA 3K59A 4HIDA 1C6VX 2RDHA 4XQQA 3JCMb 2R93B 4CI0C 2FMCA 4CC4B 4Z8AA 4A75A 2I46A 3JCMe 3PO2H 2KGTA 1E6HA 1QWYA 4XT1B 3SR1A 5C4JH 4JPBW 1I3QB 1WCMG 4RTUA 2EYLA 5DY9A 3M0PA 1M3BA 1CA6A 4BXXG 2MWPA 3LW5E 2MMPA 1IKMA 5CAIA 2DVJA 4OB1B 2HNIA 4DR4L 4QKUA 1NSNS 1VQFA 1TH7A 4Y28E 2WB1G 3NWTA 3STBC 3K5NA 3M58A 3CCLA 3VUZA 3BU2A 2XK0A 2YUQA 1HK9A 1A6XA 3OWFA 1G3TA 2B63G 4PFPA 5FLXE 4NXML 5HCKA 3S2DB 2ZCFB 3CC2T 1KDBA 1GBRA 3JSCA 1RL2A 1TWAH 4NMZA 1ZEQX 4PZ8A 2DUDA 2VQFQ 1VIEA 1OXXK 5FO9B 1ZSZA 1ABOA 1X75C 3DEOA 4M1UB 1JOQA 1A15A 3NENA 1YWPA 2FPDA 2DL4A 1Q81R 3Q6SA 1U4MA 1VS0A 2NVTH 4EX5A 1KFZA 1QILA 4IOAA 3UT1A 1LTGD 4HN7A 3S16B 3FKIG 3UDFA 2DRMA 4IO9A 3I7FA 4L6TB 4X65L 1D1IA 1NZ9A 3A8MB 1FJGQ 4C3JH 2F0TA 4RGTA 5CK9A 3FKIB 2DM1A 4EMKB 2QKIC 1RIPA 1VQ7Q 4NOYA 4EMHA 2KHSA 3SWNC 1M1KU 4U673 3CC7A 4CGYB 3I4MG 1N34L 2CGHA 3EG3A 1E2WA 1NY4A 2K14A 5E4XA 5C3EB 2A0FB 1PTOH 5KYLA 1EYGA 2KR3A 1S72A 2YTVA 1OXTA 3RLFA 4WFN3 3M0TA 1IBKL 1CKAA 1BK2A 4DA4A 3VYHB 1K9MR 4AG2C 4OIKA 3DLLA 1Y07A 1VQPA 3DMUA 1M1GA 1M3AA 2R58A 2AUKA 2RHSB 3S1MH 2PQAA 3PUVA 3S14H 1CA5A 2V4DA 4BS9A 2DEQA 4XTUA 1RAGB 1K73U 4RTYA 4PJMA 2F0LA 4C5EA 4PJOG 2K9GA 2GNCA 3G4ST 3HRSA 2OTJA 1EOVA 4H0LC 3X3NA 3VUBA 4M75E 2Q2HA 3VA5A 4DR1L 1PTOF 1YNJD 3W2DA 4AH6A 4C0FA 5GAMj 2A69D 4GKJQ 4DR2L 2RK1A 3HP3A 4TQUS 4LFBQ 4GKKQ 4A3GB 1B34B 3HPWA 2K5HA 4JW0A 4DK6C 3GTPB 2N8NA 4M7DF 2JT4A 2B2YA 4KY5A 4FYYB 4HIOA 3QZ5B 4J9BA 4HCCA 1STYA 4JJBA 5GAMf 1M1KC 3CC4T 3GP8A 4YCUA 4E7JA 2K57A 2CZ7B 2IL8A 4RCCA 2L1BA 2IX0A 5AYFA 3TP5A 4F7UA 1T5EA 2XD0A 2B2YC 1HTLD 4X3SA 1UE1A 3FLGA 4RKBA 2JA6H 2VC8A 1MBYA 4A93B 1I3QH 3VS6A 1VF5C 2EXDA 4C3JG 4JOIA 1VQ8Q 1YIJQ 1R8OB 2LKVA 4BI8B 2KBNA 2QDYB 4YY3L 5EC7A 1YJ9T 3OSOA 2EKHA 3QOLA 1WTOA 2E2IH 2R7ZB 2D62A 4JV5L 2CDTA 1AZEA 1VQMQ 2K50A 3CRLC 4M7DB 3I55Q 1EEID 1H95A 2ZTEA 1AE2A 4OHJA 1ESRA 3PGZA 1WTQA 1QKXA 2D1XA 4LUZA 4QT7A 5EKLA 3UE0A 4V190 4CC3A 1IXDA 4RTZA 1NYGA 2EJFA 1GUOA 4GS3A 2ZJRA 4PJOC 3H9NA 2R61A 4C0DB 3IKJA 4X66L 5I6WA 1G8XA 1WIEA 4DV0L 3TSWA 1AEYA 2BA0A 4R9WA 1G51A 2ZTCA 2PZ1A 4A53A 1DYQA 1B9MA 4Q5VA 1TU2B 5GAGC 4ODGA 4X64Q 2MIOA 1C9OA 2KEAA 3OBYA 1K4US 1II3A 4A4GA 4DBFA 1TWGB 3OYNA 3DLMA 4C92D 3DWAA 2F03A 2WAQE 1AP0A 2CUDA 3EGUA 4JBWA 2UUCQ 1Q12A 3PT9A 3VU3C 3F1ZA 3E5SA 4OGQC 2K52A 1ZHIA 3EQLC 1K73R 2FMMA 1BKBA 3NFCA 1YJNT 4F88A 1YNND 1IXRA 2Z6BA 2L3QA 1QUQA 3U9OA 4ZK9B 2JA9A 2HL5C 3RZOH 3PO2G 1MMDA 3HKZB 4DV5L 2DTOA 2RDFA 2Z4IA 3K7UC 2ZJPA 2RI5A 2CSIA 3MZ5A 1PSEA 1KABA 2RQTA 5JAVA 2F0EA 4JI2Q 2LNHB 5CKDA 2Z6KC 2AZVA 3D31A 1VQKA 2BZ8A 3JRZA 4ZUIA 1AH9A 3CMAQ 3CCVQ 4M7AA 2BCOA 1X6OA 1STNA 2HDMA 4B3TQ 4JI7Q 2LZ6B 1TS3A 4ZQ3A 1N33Q 4ULLA 1HZ9A 2EPBA 1TWHB 2M1HA 3QPHA 4OEMB 1BCPC 3VR5A 1DOMA 3S15H 1DONA 1S5ED 2DPPB 4PQXA 4A3MH 5IP9H 3KDFB 2LJ3A 3DM1A 5ELNA 1BCPD 1PRTB 1X3PA 4H02A 3EN2A 3OIPA 4IJHA 3HEJA 3JCMd 2LMCB 2O9VA 4CC7A 3I2ZA 2K7VA 4JI5L 5GANd 5FJ8H 4LF6Q 1UAPA 1YJNQ 2VNUD 3CCQA 1FD7D 5IP7H 4A4KA 1XPOA 1X6BA 4RA8A 3CCVT 5FRNA 1MJCA 3DHQA 2EYXA 3LX0A 5KYUA 4M7DD 2X51A 2K04A 3VYRA 1Q7YU 1HXDA 1KSWA 3NBHB 2BZXA 2WP8J 2KQWA 4A3IB 3JB9G 3PVLA 4IFDJ 2KNBB 3C4SA 2XIDA 1QVGS 2R92G 2IHEA 1X32A 2JMCA 3S3MA 2MO0A 1XMOL 3PF5A 1LT5D 1K8AR 2ZT9C 5LMNQ 4E6IA 3L1AA 2E2JH 2QQSA 3C0CA 2QTVA 4I65A 1WD0A 2EVRA 1W6KA 2K1BA 1K0XA 2KECA 3A8GB 5CKBA 1KQ2A 3S1MB 3X24B 4KK7A 5CVIA 4PJOA 1M2VB 1WCMH 2YRVA 1AWWA 1Y1WG 2BIVA 5C3XA 2LNVA 1TWCH 5JVH3 2J4XA 4KTAA 1IHVA 2FHDA 5M5YB 1VQ9Q 5LMUL 1XNQQ 1RAEB 2YHTA 2KENA 3HSBA 4RMFA 4A3FB 2MO1A 2O2OA 3TQ7P 1VUBA 5IIFA 3ZEHA 4HAEA 2YLBA 3A56A 2MI6A 3SK4A 2CP6A 1UGSB 4A3FG 3GD7A 2ZTDA 1KAWA 1KNAA 1SYBA 2KJXA 3LWUA 3A8HB 2Q8IB 3M56A 1SHGA 3MEVA 2OF1A 2HAXA 2HUGA 3HOUG 3NPFA 5KYXB 3SWNB 1GO3E 4O42A 4JI1Q 4B08A 1AZGB 1IW7C 4BE1A 3CAMA 4EMKC 2ATWA 1KQ1A 3MFGA 1MMNA 2V8JA 1EY0A 2PPBC 2EYJA 3STBD 1IW7D 5IP7G 5EBCA 5T1GA 2JA8B 1UEBA 1T9HA 3DM3A 3PO3B 3TDQA 1K73C 1D3BB 1GCQA 2KROA 1VQ8A 1PZJD 2EQUA 3QYGB 1M30A 2KYBA 3T13A 4C2MH 4QVZA 1EEFD 3OA6A 1FNWA 2K5FA 1SNPA 4OMMA 4JBKA 4M75F 3CCJA 3VYTA 4AYBB 4DV6L 1T3SA 3X20B 2PMZB 3D7SB 2VL6A 1BYMA 2GBQA 1K8MA 2NUTA 4LF4Q 3MP6A 1B2TA 4A3LH 1VYTA 4IJLA 2VQEQ 3J81L 3NELA 2JM9A 4M7DE 3O13A 2IG0A 1DJRD 2LCLA 1WI5A 5ELDA 4KHPQ 3GDEA 1I5LA 4KD4A 1JJ2P 4F7XA 1EZ6A 1DZ1A 2A08A 2VXFA 1IKLA 3J80c 2JA8G 4Z02A 2KY9A 3BDLA 1T3LA 4C3IG 4Y91A 2FB7A 2AWNA 4APVA 1SYFA 4KMUC 2EYFA 1HR0L 3ULJA 1SRLA 1X27A 2MF2A 1LTLA 1S5DD 5JJLA 3QJYA 4QVDA 1I07A 1TTHB 1B34A 2BKDN 1IBML 5HK0A 2DJGC 1A3VA 3W3AA 5JEAH 4JZ3A 2ED1A 9ATCB 4CBVA 1X01A 3BW1A 3PUWA 4HIKA 1AOJA 3OYFA 1NMGA 1JICA 1ZYRC 3V2TA 4MNOA 1L0YB 4ZAIA 2YUPA 4M75A 1K8OA 3VS2A 1W6XA 5GMKl 1PD0A 2RSNA 2YTXA 4RTTA 1SNMA 5CR3A 4BA1I 4M7AD 3REAB 2F4IA 2P84A 1EY9A 2CH4A 4CDFC 3QWYA 3FRPB 4XDXA 1YCSB 1S3OA 1M90C 2L55A 5KH6A 2M9VA 1N9WA 1X2QA 2UUAQ 1GL5A 2XDPA 3FIFA 3J80L 3QO2A 3A1PA 2NZ1D 1GJXA 1E7OA 2RM4A 4K2KA 5FO8B 4C8QA 1TXYA 2IVWA 3LGJA 2EYPA 2JMAA 2DNEA 4AYBE 1JQQA 2B8AA 1NNXA 2XICA 1WA7A 1GXDC 4YHHQ 2CZ6B 1PXUA 4E2FB 1ZBXA 1SNOA 1KHIA 1UEAB 2X6LA 1XJWB 4YCVA 1FGBD 1TWCB 1GM5A 2QXFA 2X35A 4PZ7A 4J15A 3DWPA 3FP9A 1AZPA 3R2TA 4LJZC 1KD1C 4QQGA 5KYWA 1VQKQ 1KQSS 1G2TA 1U4RA 1WHGA 2ZPIB 2AWOA 2DJQA 1VQ5T 1GUTA 1U06A 1ML0D 1NE3A 3PIPA 2DX1A 3MXNB 1YN8A 4HTHA 4OMQA 4UAIA 3PFSA 1STGA 4IOCA 2I0QA 4I7AA 4KN4C 4POFA 4IQZA 1PH4A 2OAUA 4DV1Q 3OMGA 3OYEA 1Y1VH 2MP1A 2NVQH 1WGSA 5D6WA 3NTHA 1H9SA 5IHNA 3MC0B 3HTRA 2CFMA 2DLPA 2EJGC 2A6HD 3GTOB 4GKJL 4C1NK 1NBEB 1B4OA 5FJ8G 4HMJA 4GKKL 2P4TA 5GANf 2SDFA 1NUCA 4MTKA 3KUPA 2B86A 2QGQA 4GLVB 3TU4K 3CPWA 4M7AG 2HBWA 5E7NA 5JEAG 2WKDA 5IT9E 2DXUA 2AQ2B 2JA7G 3IRBA 1EUJA 4LF5L 4MTNA 4POGA 1IYVA 5GANj 4OB0B 1JE5A 3I4MB 3H8ZA 2KRMA 1VQNA 1JJCB 4A3GG 3ZBDA 1MNDA 3MHBA 3E0JA 2NB0A 4ZTJA 2F0MA 5I6YA 5M3FG 4N4IA 3EGXB 1BUVT 3HOUH 3I55A 1RADB 4OMFB 3SHLA 3ITPA 3SK8A 4C8QF 4K0KQ 1LT6D 2DL7A 1BQQT 4RG1A 4KUDK 4A3KG 1U9RA 1W3SA 4PMWA 3CCLT 1HNXL 1WI7A 3HOYB 3VR6A 1R4QB 3QWXX 1PKSA 4K5WA 3MKDA 1IL2A 4QGUA 2LXKA 1BNZA 4YTLA 1M1KR 3NBHA 3W1GA 1YJWT 2EXZA 2JA6G 1YJ9A 4AQYQ 2NYZD 3CCJQ 4ZGDB 5IHKA 2RKSA 2ZAEA 3SFMA 1G3YA 2ZJQA 2JA5B 1UE5A 3TMEA 2ASBA 4QW2A 1I4RA 1VQIA 2OTLT 4QB4A 2R3ZA 4J6YA 1MNEA 2IWHA 4KHZA 1WQ7A 3G7LA 1HZAA 3NHHA 1YEZA 5I9PA 1WFWA 1PC0A 2XVSA 3VJPA 5GAN3 3A5UA 5JVG3 1NLOC 1WHLA 3M0QA 4DV7L 2BUDA 1N9SA 2PNRC 1M4ZA 1T0HA 3CC7T 5ELBA 4F87A 4B3SL 4L5SA 2VY3A 3C12A 1QVPA 3M59A 4M78D 2E3IA 2EAYA 5GADC 3CCJT 4QQBX 1VOMA 1YI2Q 2AUJD 4C92A 2BTTA 3RKXA 2KK4A 1CZGA 2EQMA 4LNPA 3I3CA 2RJCA 3GTMH 4XU2A 3I55T 1MIUA 4M4ZA 1IGQA 3JAML 1RTNA 3OSSC 1Y0MA 1B70B 1W2BS 1B9NA 4RGMA 4PJOF 2RHYA 3SXHA 1WNLA 2B63B 2NZOA 1HUNA 2ABLA 3AMUA 3D6WA 3U4VA 1Y7XA 2DXTA 1KXLA 3VYGA 3A54A 3G6EQ 3I4NG 1SR3A 1R9TB 3O8VA 4X9DA 2HKQB 4LD9K 4A93H 3GNFB 1D1KA 1MD2D 2A6ED 1I6HB 3LWHA 1JB3A 1VQ4A 2Z1CA 4I7ZC 5BN5A 1WYXA 5M3MG 2JS2A 1JWMD 1TOVA 1E1OA 1D0YA 2OX7A 1LVKA 2DD5A 3P7JA 5FKAC 2EE1A 4JYAL 4DK0A 3TREA 5LJ3h 1PD1A 1KHCA 3MP8A 3RR6A 2XDBA 1XXGA 2X69A 4WCIA 2DERA 3S1NH 1PZID 4A4HA 1D5MC 1M3CA 2B2VA 2MUYA 2GFUA 3EGDA 4KKUA 1TY0A 3V8LA 3KXTA 2EWNA 4BY1B 4FP5D 2RQWA 5HK3A 1VQ5Q 1SEMA 3KLSA 1QW1A 5GAN2 2F0IA 4K2LA 4LF7Q 2JZ2A 3H3VC 3NTIA 1VQ6Q 2AT1B 3LH0A 3M3YB 3OYCA 1K0SA 2D5DA 3ASKA 1PH2A 2LQNA 2CT3A 2KOLA 4F14A 3VR4A 3UPUA 2A36A 1DOLA 1F9PA 5TSSA 1I8FA 3A8IE 3TN2A 5BR8L 5LJ3f 4M7DA 1WHMA 3AQQA 3S1RB 3CC4A 1K3BC 5FU7C 3BE3A 4DV2L 2MWOA 5GAOl 3JCMQ 4ELYC 4LFAL 1CQFA 3M9QA 5C0XG 4J1MA 4JRPA 1JJGA 1N32Q 1AW7A 3T1HL 3M4YA 2N3SA 3IAYA 4HJ9A 1LABA 1XJVA 1R9TH 4M77C 1K9MC 1PHJA 1V1PB 1CKOA 4OMNA 3MEWA 2L12A 1HNZQ 3L2UA 4HVVA 4FYDA 3FKIH 3HOWB 1JJ2S 2Z0WA 1PTOC 4DNTB 2PZUA 2BZYA 1B3QA 1X3FA 3OBWA 1QP2A 4C5HA 2JS0A 3ZYYX 4X62L 2RJDA 1BB9A 4KGXB 2XTIA 4A3KH 3S16H 1D09B 3Q1JA 4K8JA 2F4VL 1BDOA 4IUNA 3MPUB 1YZ6A 1L0WA 4DFAA 3KJOA 3VV0A 1UHCA 5GAHC 2CWPA 2UXDL 3HFNA 2LS01 2NTSA 3L0OA 3X28B 2UXBL 2LJ1A 2L89A 3I9QA 1H3HA 4E6RA 2IT1A 2K32A 2DILA 4FW1A 5LJ5f 1NBWA 2YTYA 1IRXA 2DY7A 2HKNA 1E22A 2X9HA 3HOVH 1I4PA 1Q95G 2B2TA 3P1HA 4BDYA 4BE0A 2M51A 3CHBD 5KRUA 1Q82U 2X4JA 4GY5A 2EGCA 1GVPA 2K5NA 1I94L 2EJ9A 1JQYD 4KJNA 2RA4A 2Q2TA 3HOXB 2B8GA 5KYIA 2HBPA 4Q5WA 4HJ7A 3HOVG 2Z8LA 4M8AA 1JMCA 2YUOA 1I50H 1N9RA 4A4EA 2DF6A 4C92G 4JI4L 1OU8A 3HRUA 3ND9A 3OTOQ 2O88A 1IHZA 4DV4Q 3M4QA 4O6JA 3P8DA 2Y90A 2QAZA 3ME9A 3A7LA 4HJ8A 3S17H 4DEYA 1KC8C 2WB1E 4PMCA 4LF8Q 4E7IA 3BYYB 4DR3L 1VQLQ 1YHBA 2F5TX 2HSEB 2A28A 3CCRQ 1A8VA 2MJ8A 5K36G 1QJOA 2E4HA 2VW9A 2O4XB 1BU1A 2KEEA 1RKNA 2MCNA 4LF6L 4JI8L 4KH0B 3K80C 1B07A 1KC8U 3OYYA 2F2WA 2JXBA 2YDLA 2A68D 3OYBA 1QQJA 4F16A 2CT4A 2AK5A 4LUVA 3FEOA 4V0BA 1EYCA 1Z9ZA 4DBRA 3IFTA 4K5VA 3DB4A 2YRDA 4L59A 3CCSA 2CZ0B 1M27C 2E76C 4K6DA 2JXMB 1XPRA 2FXQA 2KXCA 4MZMA 5E3FA 2E70A 1FNVA 4X64L 4A3DH 4RHSA 2VGMA 1QVFP 4RUGA 3T16A 4RHRA 4CDDC 1JB0E 1QVGP 2SEMA 4C3HB 4ZN1A 2EW3A 4IPCA 1A0IA 4JRQA 1QP3A 2HQLA 3GTOH 2YT6A 2E8GA 2JM8A 4PG3A 3RN2A 5EG2A 4FNFA 1Y1WB 1KNEA 4JVZA 2A3LA 1TS9A 1Y14B 2DBKA 1LV9A 3A74A 1OXUA 2AKKA 1GD7A 3JV3A 1PRTF 3AB9A 2RHIA 2TMPA 3HFOA 2DE0X 1X3EA 4LF9Q 2H8HA 4Q0FA 2SEBD 2L11A 3AYHB 1JJ2A 1WFQA 3R3OA 4N8FA 4EIKA 2A1AA 4X34A 3OYJA 3I56A 2OTLQ 1G291 4CKCA 1QNKA 4IKFA 3K5LA 4WJWA 1NG2A 5IGEA 3EG9B 1J5EQ 4BD3A 2C0IA 5KYXA 1YHQA 1GBQA 1G6ZA 1AWOA 1PFNA 3PQIA 1I81A 4FDBA 1YJWQ 1UE9A 4QCLA 2E10A 2PZTA 5IOCA 3BDOA 3S1QH 2PQWA 4A54A 3HL8A 2WSFE 2F0GA 4JBJA 3C1EA 1PA6A 4OP0A 3CC2A 2NWMA 1XWEA 2J6KA 2GN5A 5D3IB 1EY5A 2KVMA 1Q46A 4A76A 4JI3Q 4XQ3A 2RVLA 4LDXA 1XNRL 2WFWA 1Q82R 1E6GA 2AZSA 3EHQA 1LTSD 3H0GG 1PH9A 1C1AA 4KN7C 1K83H 2I5LX 4PL6A 2CVRA 2MGSA 5AT1B 3MA2B 1Q86U 2PW7A 3CF5A 1YWOA 2EJMA 1MGQA 5LJ5g 2EKOA 2UUBQ 5D6YA 4BBSB 1R0CB 2JTFA 3WDNA 5IGBA 4CKEA 1VQ4T 1B50A 4BDZA 1PG5B 1XPUA 2QEJC 4A3BG 1FMKA 2ES2A 4AFZC 5KCHA 3RUZA 2C35B 2D0OA 2KQ3A 2JTEA 2O5IC 1HPCA 4EQ5A 3URYA 5CKHA 4NXNQ 2K5LA 2IIMA 4FT2A 1ZXTA 4L5QA 2G5DA 4J9IA 3E19A 2Y0SE 4C1NI 2VUMH 2CP3A 1RJTA 3BY7A 1HRJA 1I1JA 3T53B 3C2PA 1BO0A 1SE8A 3M85A 4H44C 1HJPA 4M78G 1SBBB 4N4HA 4BBRG 1V1OA 1D1AA 2A74C 4FU6A 3Q24A 4DGZA 2RHUA 4M75G 4TVRA
chains in the Genus database with same CATH topology
2O2OA 3PVQA 2O31A 2GTOA 4D8DA 3M0SA 4OMLA 1SHGA 1RUWA 2LMJA 3NPFA 4JZ4A 1WXBA 3M0UA 4FSSA 1QKWA 1AZGB 1J3TA 1UFFA 2ED0A 2F2XA 1U3OA 2KT8A 4HVUA 2DNUA 1H8KA 2X3WD 2J6OA 1JXOA 3RBBB 1GCQA 2KROA 5I22A 1GFCA 2VVKA 1M30A 2KYBA 2DA9A 4OMOA 3VS3A 1MV3A 1YNZA 1K1ZA 1IO6A 1GRIA 1PRMC 4LE9A 4OMMA 4LUEA 4IIMA 2ROLA 1T3SA 5L23A 2CREA 1GFDA 2LQWA 1OEBA 2GBQA 3ULRB 1VYTA 4Z89A 2DBMA 5GJWB 1PKTA 2JM9A 1PRLC 2PNIA 5IHIA 2A08A 4J9CA 3RNJA 1WX6A 1T3LA 4HVWA 1SRLA 1X27A 1I07A 1ZLMA 2EYZA 4OMPA 2ECZA 4AFQC 4JZ3A 1H92A 2NUZA 1RI9A 2ENMA 2ED1A 3O5ZA 2KYMA 4KRTA 5FWBA 1AOJA 2RQVA 1JXMA 1G83A 2YUPA 4J9GA 1UUEA 3VS2A 1PNJA 1QCFA 1W6XA 1HSQA 3I5RA 4RTTA 3NHNA 3REAB 2CH4A 3QWYA 1EFNA 1YCSB 2RF0A 1X2QA 1GL5A 4Z88A 1UG1A 1RLPC 1VYVA 1E7OA 2OAWA 2A37A 1V1CA 3PE0A 2JMAA 4RTVA 1JEGA 1JQQA 2LJ0A 1WA7A 3REBB 2YSQA 1NM7A 4J9DA 2EYYA 2PTKA 3TVTA 4HCKA 1AD5A 2F2VA 1X43A 1Z9QA 1TUCA 1UGVA 2DJQA 1U06A 3ZL7C 2DX1A 1YN8A 4LUDA 4OMQA 2J05A 1I0CA 4GLMA 1AWJA 2HSPA 1W70A 5IHNA 3EG0A 2DLPA 4IIOA 1QWEA 2VKNA 2K3BA 3VS7A 4J9HA 2W10A 2DMOA 2GGRA 4X1VA 2B86A 4HXJA 1UECA 3TSZA 4ESRA 2HBWA 2D8HA 4ZNXA 2JW4A 4A63B 1CKBA 1OV3A 3I35A 2KRMA 2K2MA 1MUZA 4F17A 1GCQC 1UHFA 1ZUKA 1NEGA 2HEQA 2FRWA 3H41A 5FWCA 3VRYA 1FYNA 2DL7A 1GCPA 1HD3A 3A98A 3GBQA 2KT1A 4LN2A 4Y92A 2RNAA 1WI7A 4JJDA 2L3SA 3QWXX 1PKSA 2C0OA 3SHWA 1T0JA 2FG0A 1UJ0A 2D8JA 2FO0A 4RTXA 5IH2A 2V1QA 1K9AA 2EQIA 5IHKA 1N5ZA 1WXUA 2J7IA 3M0RA 2L0AA 4CC2A 2RN8A 1K76A 1PHTA 1TUDA 2J06A 1VA7A 4J9FA 3SEMA 2X3XD 1NLPC 2K7AA 1WFWA 2C0TA 1NLOC 1JU5C 3M0QA 1T0HA 2DRKA 1ABQA 2QDLA 1XOVA 2DL5A 4GBQA 2AKLA 1X6GA 1A0NB 2DYBA 2ESWA 1QLYA 1W1FA 2BTTA 3VRZA 1ZBJA 4LNPA 4M4ZA 2HCKA 1Y0MA 4RTWA 4CC4B 2ABLA 4Z8AA 2G6FX 2HDAA 1E6HA 2KGTA 2CH4W 4JPBW 4RTUA 3VS0A 1SSHA 3M0PA 1VYUA 1M3BA 4D8KA 1MV0B 2W0ZA 2DVJA 1WYXA 2JS2A 2KE9A 4AFSC 2YUQA 2KRNA 2MOXA 5ECAA 5HCKA 1ZSGA 4WCIA 1GBRA 1M3CA 1UDLA 4DEXA 2KXDA 1ABOA 2RQWA 2RMOA 1SEMA 1YWPA 2FPDA 2DL4A 2EYWA 1KFZA 1K0SA 2LQNA 2CT3A 2RQRA 4F14A 2DRMA 1X69A 2FPFA 2A36A 3UF4A 3KFVA 1ZUUA 1KIKA 2K6DA 1U5SA 2DM1A 1X2KA 3EG3A 1ZUYA 3U23A 1OPLA 2KR3A 1SPKA 4OMNA 2L2PA 1AVZC 1CKAA 1BK2A 2J6FA 2DL3A 3M0TA 5GJVB 4AG2C 4HVVA 1WXTA 3EHRA 4R0KA 2BZYA 1M3AA 1B3QA 1QWFA 2JS0A 1ARKA 2E5KA 2LCSA 1BB9A 4RTYA 3UA7A 4AFUC 3EG1A 2OJ2A 2LX7A 2K9GA 2GNCA 2EGAA 1UHCA 4K11A 3VS4A 2GQIA 2LJ1A 3I9QA 1H3HA 4JJCA 4E6RA 2DILA 2CSQA 1M8MA 2V1RA 2ROTA 1ZX6A 2M51A 2JT4A 2EGCA 4J9BA 4JJBA 2EBPA 2YUOA 2I0NA 2DF6A 2O88A 2CUBA 1LCKA 2OI3A 1WDXA 3VS6A 4DEYA 3THKA 1NEBA 5EC7A 1TG0A 2EKHA 1JO8A 2CDTA 1AZEA 3H0IA 2A28A 4AG1C 1BU1A 2MCNA 1AWXA 1QKXA 1B07A 2D1XA 4QT7A 2F2WA 2XMFA 2JXBA 2YDLA 4CC3A 4RTZA 1NYGA 4F16A 2CT4A 2AK5A 1WIEA 1Z9ZA 3LH5A 3TSWA 1AEYA 2PZ1A 1M27C 2MIOA 2KEAA 1BBZA 1K4US 2KXCA 2EGEA 4RUGA 2FEIA 2SEMA 2CUDA 3EGUA 2EW3A 2GTJA 3FJ5A 3VS5A 5IXFA 2YT6A 2JM8A 5IXBA 1Y57A 2DL8A 2L3QA 2DBKA 2AKKA 1CSKA 3JV3A 1OOTA 2O9SA 3IQLA 2LP5A 2CSIA 2DE0X 2EPDA 2D0NA 2H8HA 3EG2A 2P4RA 2RQTA 2LNHB 4EIKA 1G2BA 1UJYA 2AZVA 1HJDA 3H0FA 2BZ8A 2KRSA 3UATA 1NG2A 1S1NA 2M0YA 2LZ6B 2C0IA 1GBQA 4J9EA 2RPNA 1AWOA 5FW9A 5I11A 1UE9A 4ORZA 2LJ3A 3R6NA 1SRMA 2FPEA 1KJWA 2NWMA 2J6KA 3CQTA 2L3PA 2O9VA 2RQUA 4CC7A 1E6GA 2AZSA 3EHQA 1RLQC 1X6BA 1YWOA 1OPKA 2EYXA 1KSWA 2BZXA 1WLPB 3PVLA 3UA6A 2KNBB 1UTIA 1YP5A 3VS1A 3NMZC 2JMCA 1FMKA 2YUNA 4AFZC 1NYFA 2JTEA 1PWTA 3C0CA 2EVRA 2IIMA 1K0XA 4J9IA 2VWFA 3H0HA 1AWWA 2KBTA 1I1JA 2K79A 3NGPA 2SRCA 1SHFA 3I5SA 2FRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O2O A;  3PVQ A;  2O31 A;  2GTO A;  4D8D A;  3M0S A;  4OML A;  1SHG A;  1RUW A;  2LMJ A;  3NPF A;  4JZ4 A;  1WXB A;  3M0U A;  4FSS A;  1QKW A;  1AZG B;  1J3T A;  1UFF A;  2ED0 A;  2F2X A;  1U3O A;  2KT8 A;  4HVU A;  2DNU A;  1H8K A;  2X3W D;  2J6O A;  1JXO A;  3RBB B;  1GCQ A;  2KRO A;  5I22 A;  1GFC A;  2VVK A;  1M30 A;  2KYB A;  2DA9 A;  4OMO A;  3VS3 A;  1MV3 A;  1YNZ A;  1K1Z A;  1IO6 A;  1GRI A;  1PRM C;  4LE9 A;  4OMM A;  4LUE A;  4IIM A;  2ROL A;  1T3S A;  5L23 A;  2CRE A;  1GFD A;  2LQW A;  1OEB A;  2GBQ A;  3ULR B;  1VYT A;  4Z89 A;  2DBM A;  5GJW B;  1PKT A;  2JM9 A;  1PRL C;  2PNI A;  5IHI A;  2A08 A;  4J9C A;  3RNJ A;  1WX6 A;  1T3L A;  4HVW A;  1SRL A;  1X27 A;  1I07 A;  1ZLM A;  2EYZ A;  4OMP A;  2ECZ A;  4AFQ C;  4JZ3 A;  1H92 A;  2NUZ A;  1RI9 A;  2ENM A;  2ED1 A;  3O5Z A;  2KYM A;  4KRT A;  5FWB A;  1AOJ A;  2RQV A;  1JXM A;  1G83 A;  2YUP A;  4J9G A;  1UUE A;  3VS2 A;  1PNJ A;  1QCF A;  1W6X A;  1HSQ A;  3I5R A;  4RTT A;  3NHN A;  3REA B;  2CH4 A;  3QWY A;  1EFN A;  1YCS B;  2RF0 A;  1X2Q A;  1GL5 A;  4Z88 A;  1UG1 A;  1RLP C;  1VYV A;  1E7O A;  2OAW A;  2A37 A;  1V1C A;  3PE0 A;  2JMA A;  4RTV A;  1JEG A;  1JQQ A;  2LJ0 A;  1WA7 A;  3REB B;  2YSQ A;  1NM7 A;  4J9D A;  2EYY A;  2PTK A;  3TVT A;  4HCK A;  1AD5 A;  2F2V A;  1X43 A;  1Z9Q A;  1TUC A;  1UGV A;  2DJQ A;  1U06 A;  3ZL7 C;  2DX1 A;  1YN8 A;  4LUD A;  4OMQ A;  2J05 A;  1I0C A;  4GLM A;  1AWJ A;  2HSP A;  1W70 A;  5IHN A;  3EG0 A;  2DLP A;  4IIO A;  1QWE A;  2VKN A;  2K3B A;  3VS7 A;  4J9H A;  2W10 A;  2DMO A;  2GGR A;  4X1V A;  2B86 A;  4HXJ A;  1UEC A;  3TSZ A;  4ESR A;  2HBW A;  2D8H A;  4ZNX A;  2JW4 A;  4A63 B;  1CKB A;  1OV3 A;  3I35 A;  2KRM A;  2K2M A;  1MUZ A;  4F17 A;  1GCQ C;  1UHF A;  1ZUK A;  1NEG A;  2HEQ A;  2FRW A;  3H41 A;  5FWC A;  3VRY A;  1FYN A;  2DL7 A;  1GCP A;  1HD3 A;  3A98 A;  3GBQ A;  2KT1 A;  4LN2 A;  4Y92 A;  2RNA A;  1WI7 A;  4JJD A;  2L3S A;  3QWX X;  1PKS A;  2C0O A;  3SHW A;  1T0J A;  2FG0 A;  1UJ0 A;  2D8J A;  2FO0 A;  4RTX A;  5IH2 A;  2V1Q A;  1K9A A;  2EQI A;  5IHK A;  1N5Z A;  1WXU A;  2J7I A;  3M0R A;  2L0A A;  4CC2 A;  2RN8 A;  1K76 A;  1PHT A;  1TUD A;  2J06 A;  1VA7 A;  4J9F A;  3SEM A;  2X3X D;  1NLP C;  2K7A A;  1WFW A;  2C0T A;  1NLO C;  1JU5 C;  3M0Q A;  1T0H A;  2DRK A;  1ABQ A;  2QDL A;  1XOV A;  2DL5 A;  4GBQ A;  2AKL A;  1X6G A;  1A0N B;  2DYB A;  2ESW A;  1QLY A;  1W1F A;  2BTT A;  3VRZ A;  1ZBJ A;  4LNP A;  4M4Z A;  2HCK A;  1Y0M A;  4RTW A;  4CC4 B;  2ABL A;  4Z8A A;  2G6F X;  2HDA A;  1E6H A;  2KGT A;  2CH4 W;  4JPB W;  4RTU A;  3VS0 A;  1SSH A;  3M0P A;  1VYU A;  1M3B A;  4D8K A;  1MV0 B;  2W0Z A;  2DVJ A;  1WYX A;  2JS2 A;  2KE9 A;  4AFS C;  2YUQ A;  2KRN A;  2MOX A;  5ECA A;  5HCK A;  1ZSG A;  4WCI A;  1GBR A;  1M3C A;  1UDL A;  4DEX A;  2KXD A;  1ABO A;  2RQW A;  2RMO A;  1SEM A;  1YWP A;  2FPD A;  2DL4 A;  2EYW A;  1KFZ A;  1K0S A;  2LQN A;  2CT3 A;  2RQR A;  4F14 A;  2DRM A;  1X69 A;  2FPF A;  2A36 A;  3UF4 A;  3KFV A;  1ZUU A;  1KIK A;  2K6D A;  1U5S A;  2DM1 A;  1X2K A;  3EG3 A;  1ZUY A;  3U23 A;  1OPL A;  2KR3 A;  1SPK A;  4OMN A;  2L2P A;  1AVZ C;  1CKA A;  1BK2 A;  2J6F A;  2DL3 A;  3M0T A;  5GJV B;  4AG2 C;  4HVV A;  1WXT A;  3EHR A;  4R0K A;  2BZY A;  1M3A A;  1B3Q A;  1QWF A;  2JS0 A;  1ARK A;  2E5K A;  2LCS A;  1BB9 A;  4RTY A;  3UA7 A;  4AFU C;  3EG1 A;  2OJ2 A;  2LX7 A;  2K9G A;  2GNC A;  2EGA A;  1UHC A;  4K11 A;  3VS4 A;  2GQI A;  2LJ1 A;  3I9Q A;  1H3H A;  4JJC A;  4E6R A;  2DIL A;  2CSQ A;  1M8M A;  2V1R A;  2ROT A;  1ZX6 A;  2M51 A;  2JT4 A;  2EGC A;  4J9B A;  4JJB A;  2EBP A;  2YUO A;  2I0N A;  2DF6 A;  2O88 A;  2CUB A;  1LCK A;  2OI3 A;  1WDX A;  3VS6 A;  4DEY A;  3THK A;  1NEB A;  5EC7 A;  1TG0 A;  2EKH A;  1JO8 A;  2CDT A;  1AZE A;  3H0I A;  2A28 A;  4AG1 C;  1BU1 A;  2MCN A;  1AWX A;  1QKX A;  1B07 A;  2D1X A;  4QT7 A;  2F2W A;  2XMF A;  2JXB A;  2YDL A;  4CC3 A;  4RTZ A;  1NYG A;  4F16 A;  2CT4 A;  2AK5 A;  1WIE A;  1Z9Z A;  3LH5 A;  3TSW A;  1AEY A;  2PZ1 A;  1M27 C;  2MIO A;  2KEA A;  1BBZ A;  1K4U S;  2KXC A;  2EGE A;  4RUG A;  2FEI A;  2SEM A;  2CUD A;  3EGU A;  2EW3 A;  2GTJ A;  3FJ5 A;  3VS5 A;  5IXF A;  2YT6 A;  2JM8 A;  5IXB A;  1Y57 A;  2DL8 A;  2L3Q A;  2DBK A;  2AKK A;  1CSK A;  3JV3 A;  1OOT A;  2O9S A;  3IQL A;  2LP5 A;  2CSI A;  2DE0 X;  2EPD A;  2D0N A;  2H8H A;  3EG2 A;  2P4R A;  2RQT A;  2LNH B;  4EIK A;  1G2B A;  1UJY A;  2AZV A;  1HJD A;  3H0F A;  2BZ8 A;  2KRS A;  3UAT A;  1NG2 A;  1S1N A;  2M0Y A;  2LZ6 B;  2C0I A;  1GBQ A;  4J9E A;  2RPN A;  1AWO A;  5FW9 A;  5I11 A;  1UE9 A;  4ORZ A;  2LJ3 A;  3R6N A;  1SRM A;  2FPE A;  1KJW A;  2NWM A;  2J6K A;  3CQT A;  2L3P A;  2O9V A;  2RQU A;  4CC7 A;  1E6G A;  2AZS A;  3EHQ A;  1RLQ C;  1X6B A;  1YWO A;  1OPK A;  2EYX A;  1KSW A;  2BZX A;  1WLP B;  3PVL A;  3UA6 A;  2KNB B;  1UTI A;  1YP5 A;  3VS1 A;  3NMZ C;  2JMC A;  1FMK A;  2YUN A;  4AFZ C;  1NYF A;  2JTE A;  1PWT A;  3C0C A;  2EVR A;  2IIM A;  1K0X A;  4J9I A;  2VWF A;  3H0H A;  1AWW A;  2KBT A;  1I1J A;  2K79 A;  3NGP A;  2SRC A;  1SHF A;  3I5S A;  2FRY A; 
#chains in the Genus database with same CATH topology
 3J7A V;  2QA4 Q;  1L0X B;  3G4S A;  2OTJ T;  2GTO A;  2XGT A;  5IYC H;  1YJN A;  2PUO B;  1H9K A;  4M75 B;  3KF6 B;  3M0S A;  1OX9 A;  2QA4 T;  1U0L A;  1Z9F A;  2QF7 A;  4OML A;  4C8Q C;  1TWB A;  2KCT A;  2XRS D;  4KY6 A;  2KA7 A;  3M0U A;  3CD6 Q;  3GV3 A;  2EVB A;  3P20 A;  4M78 B;  3WXM B;  1J3T A;  3WOE A;  5C44 H;  4JS4 A;  1ENA A;  4DQ2 A;  4GOP B;  1SEB D;  3EH1 A;  4A3L G;  5M3F B;  1SYG A;  2DNU A;  1G8Z D;  3I90 A;  1YJW A;  2LCC A;  2J6O A;  2RO0 A;  4ZYS A;  4R56 A;  1OXS C;  5DEH A;  2X6G A;  4II1 A;  2V8I A;  3NUC A;  1BCP B;  1PRT D;  3T1Y L;  1YNZ A;  1GXI E;  1N8R U;  3JC6 6;  1S72 Q;  2VUB A;  1JCK B;  4IN3 A;  2K75 A;  4LUE A;  1QE6 A;  1ZKO A;  4JLI A;  2CCZ A;  1HXY D;  2DXC A;  3K0X A;  5IT9 c;  2D2C C;  5IE8 A;  3JAM i;  1ET9 A;  5I2M A;  2KED A;  1EZZ B;  2F0V A;  1TS4 A;  1PDQ A;  2DJZ A;  2QI2 A;  2DBM A;  1QZG A;  2M2L A;  2RJF A;  5A0G A;  1ICW A;  4HT8 A;  5IGG A;  4JI7 L;  2SNM A;  4R1J A;  5GQO A;  5IHI A;  4RCN A;  2EIF A;  4KH1 B;  1TS2 A;  3H0G H;  2F0K A;  4J9C A;  1KIX A;  5K36 H;  1JRI A;  3M4O H;  3RMQ A;  1WX6 A;  2WSE E;  1UGQ B;  4J5Y A;  4A3J H;  2CQA A;  4OXP A;  1XQH A;  2NUP A;  1LTB D;  1HZB A;  1KAA A;  5I2Y A;  4G7Z C;  1PM3 A;  3I4O A;  1O78 A;  1WCM B;  1F2Z A;  3TP6 A;  3HP9 A;  5IGC A;  2EYZ A;  1CT1 D;  1UB4 A;  4AMC A;  1TWF B;  4MIU A;  3RUX A;  1EL0 A;  2A73 B;  3GO5 A;  2KUM A;  1AT1 B;  1RI9 A;  2ENM A;  5A0D A;  4ZLT F;  1PH7 A;  3O5Z A;  1IBL Q;  3M3Y H;  2AHO B;  4NXM Q;  4IUR A;  4KRT A;  5FWB A;  3V8J A;  1YIJ A;  1KRS A;  3MWY W;  3ERQ A;  2ZPB B;  3QB3 A;  4DAY A;  1Y71 A;  1WTH A;  4XTZ A;  2Z0S A;  1JXM A;  4ZKB B;  1G83 A;  3GOX A;  1YNX A;  4BY1 H;  4HCE A;  4J9G A;  1UUE A;  2B2U A;  2OQ0 A;  1UE6 A;  2DIQ A;  3K6O A;  4DA2 A;  4FYX B;  3NHN A;  1VQD A;  4R4I A;  1EFN A;  4GN3 B;  2FL7 A;  4BI4 A;  4CKB A;  3RKW A;  1J8I A;  2E74 C;  3E1S A;  5GAO p;  1H9J A;  3F2U A;  1PRT C;  4DR7 L;  1ASZ A;  4EMK A;  4HCB A;  5EBD A;  4YWM A;  3WVD B;  3JB9 D;  1WHJ A;  1RD9 D;  2CW0 C;  2PVO B;  4J8O A;  1Y8N B;  1U8R A;  2NN6 I;  3RMH A;  4Y7N B;  1NPP A;  2OAW A;  3TBI B;  1PH8 A;  4DV2 Q;  1I6H H;  3E9F A;  2K4Y A;  1K28 A;  2A37 A;  1V1C A;  1X65 A;  2P5Z X;  1I5O B;  4K5X A;  2LJ0 A;  2RCF A;  5AJ3 Q;  3R6O A;  3HOW G;  4WJ4 A;  4LDW A;  1Z47 A;  1K8A U;  2IX3 A;  2F0Q A;  3CCL Q;  2BDN A;  1TII D;  4KHV A;  1YI2 A;  1O7L A;  2XIW A;  4M77 A;  1C8C A;  3E9H A;  2PTK A;  3TVT A;  4YCW A;  1BF4 A;  4HCK A;  4C8Q D;  1FX7 A;  2B2T C;  2F1M A;  3SK6 A;  1NPR A;  2F2V A;  5CIU A;  1WJR A;  1LJO A;  1X43 A;  1Z9Q A;  1KG1 A;  5A2Q E;  1RTO A;  3FVQ A;  3KF8 B;  1TUC A;  3PSI A;  2DFU A;  3V96 A;  4JI6 L;  3MXU A;  2KI7 A;  4R4Q A;  1Q81 U;  2RDG A;  4LK1 C;  3RR5 A;  2DEU A;  2J05 A;  2VB6 A;  1CKM A;  3BVM A;  3GTG H;  1D6E C;  1AWJ A;  1OO9 B;  5GAN g;  3J7A 5;  2QEX T;  1R0B G;  3BZD B;  1W6J A;  4F8M A;  1W70 A;  5I4D A;  1YHA A;  3C95 A;  1SFO B;  1VQ4 Q;  4P2C B;  3OWE B;  3LGF A;  2KDS A;  1K0R A;  2I5H A;  2Z4H A;  1RAB B;  3MVV A;  5IGD A;  1KRT A;  2DIG A;  4IIO A;  4DOV A;  1WJS A;  3VS7 A;  4ZGJ B;  2TSS A;  4J9H A;  4XU1 A;  2A19 A;  2DMO A;  2YU9 B;  4Z9C B;  2QDB A;  3OYH A;  4X1V A;  3A55 A;  4OWT B;  4DXF A;  1EQV A;  4KGZ B;  4ESR A;  5M9O A;  3L2W A;  2EY5 A;  2QQA A;  2D8H A;  3AFQ A;  4GLA C;  4NW2 A;  3BJU A;  4ZNX A;  1NE8 A;  3HOY G;  4LFC Q;  2EYH A;  1PH1 A;  1I4G A;  2DAQ A;  2SNS A;  4M7A E;  4JC0 A;  1Y96 B;  3RZD B;  4XTY A;  2NUC A;  4LF5 Q;  3I35 A;  2VQE L;  4X9C A;  1UE7 A;  1WD1 A;  3CCM A;  4HIM A;  5JEA J;  4RWS C;  1A3T A;  2F0D A;  3HOY H;  2E41 A;  1NEG A;  4YY3 Q;  5GMK j;  1TVX A;  3CD6 A;  1LPL A;  3UDX A;  5FWC A;  3VRY A;  4DBH A;  1GCP A;  2JYO A;  3OQ5 A;  3A98 A;  4BA2 I;  1MKH A;  3GTL H;  2CYZ B;  2F3I A;  3KBX A;  4DR3 Q;  1M5Q 1;  3HOU B;  4LWC A;  3PNW C;  5C4X B;  2O01 E;  2ZXP A;  3CCQ T;  2E5L Q;  1TXQ A;  3QSU A;  3S17 B;  2C0O A;  3SHW A;  2IHF A;  3DUZ A;  3RZD H;  2BDO A;  4Y7N H;  2HHH Q;  5FRO A;  4GOP C;  2JA6 B;  3C46 A;  5GAN 4;  2K5Q A;  3K58 A;  1N36 Q;  3AU7 A;  4K8I A;  5EPJ A;  3HOX G;  2RSO A;  1RAC B;  3OMC A;  3HKS A;  2PVD B;  5KE3 A;  1I50 B;  1LT4 D;  5KEE A;  4AQY L;  4OX9 Q;  2R5M A;  4FF4 A;  2L8D A;  3QG1 A;  3EFO B;  2ZPH B;  3MTS A;  3E9I A;  5IWA L;  4C3I B;  2JJQ A;  2I5M X;  2OQK A;  5IOD A;  5CV6 A;  3CBP A;  1CQV A;  1HFG A;  4M7A C;  4LAA A;  5D65 A;  2YLC A;  5CYU A;  1YNN C;  2RK2 A;  2Y4X A;  1FMV A;  2ICI A;  3QYH B;  4DV3 L;  1A2T A;  3L2R A;  2PW5 A;  4B3R Q;  2Z6K A;  2Q2I A;  3I4N B;  3GTG B;  3CXC A;  2DL5 A;  2AKL A;  4B3S Q;  4IPG A;  3OY9 A;  4OO1 H;  1PVO A;  2RA2 A;  3D4D A;  1HNW Q;  4AT1 B;  1W1F A;  3U9S A;  2FYK A;  2PU9 B;  1NMF A;  4FXK C;  4B3M L;  3C3L A;  4M7A B;  2J0T D;  5T1I A;  2NYS A;  3S6W A;  1F2L A;  3GNG A;  1E3P A;  1JT8 A;  3CME Q;  2HCK A;  2N78 A;  4HCS A;  4YIJ A;  2NBF A;  3T4A C;  3SDZ A;  3Q23 A;  2CS7 A;  2A8V A;  2HDA A;  2QQ9 A;  4XYO A;  1NJI C;  2A6E C;  3VS0 A;  5M3M H;  1VYU A;  1MHN A;  1SXT A;  2H1E A;  4LDV A;  3INZ A;  1O80 A;  2W0Z A;  3QJ6 A;  4N9T A;  4A93 G;  2KE9 A;  3RDV A;  4AFS C;  2Y4Y A;  3QHS A;  1IBM Q;  5J1Z A;  5GMK e;  1KK7 A;  4G7H C;  2MOX A;  3CCV A;  4QUC A;  2ZZD A;  3G48 A;  2UXC L;  4A3J G;  2R92 B;  2KHI A;  4RH6 A;  1QVG A;  2F0N A;  2KCM A;  1F9Q A;  4FCY A;  2K5D A;  3HG9 A;  1UDL A;  1NCV A;  1KLU D;  1EX4 A;  4DEX A;  1ENC A;  2CWA A;  5GAN 7;  2QA4 A;  2CP5 A;  1K8A C;  3I70 A;  3K81 C;  2RMO A;  4S3S A;  2VQF L;  3RMS A;  1L1O C;  1ET6 A;  1ZSZ B;  2FZC B;  2YXY A;  1CM9 A;  4BWG B;  2EQJ A;  1DM0 B;  1EWC A;  1GKH A;  4NPS A;  4PNY A;  1I6V C;  4C56 C;  4OO1 I;  5BN3 A;  5M3F H;  1M4V A;  3U50 C;  3T51 B;  4A4I A;  2K03 A;  1VQ9 T;  1KIK A;  2C5C A;  2N49 A;  3KFV A;  1VQG A;  4XTC S;  4E7S A;  3H3V H;  3RER A;  3HFZ B;  3PCO B;  2F69 A;  3CCU A;  3C94 A;  1CSP A;  3VKI A;  2VB2 X;  2LC4 A;  1SLJ A;  1Y8O B;  2VB3 X;  4DR6 L;  1PV4 A;  4JJN K;  1DJ7 B;  3JCM f;  4LMQ D;  3HS0 C;  2Q8T A;  4XTW A;  5LMU Q;  1XNQ L;  4P5N A;  1T5X D;  1C0M A;  1VDZ A;  2B2U C;  1D8L A;  1RI0 A;  3L2V A;  1SYC A;  3TEH B;  4L5G A;  4EQO A;  3HOZ G;  1O7Y A;  2IW3 A;  1EFW A;  3JCM P;  3K5O A;  1N33 L;  2IY5 B;  1SPK A;  8AT1 B;  2L2P A;  1AVZ C;  4FF2 A;  2R93 H;  2DL3 A;  5GJV B;  3VYU A;  1N8R C;  1J6Q A;  3K8A A;  4DAY B;  4A3C G;  1F2Y A;  1WXT A;  2GQV A;  1OQK A;  4JI0 Q;  2XRQ D;  3SE0 A;  4FM4 B;  4R4T A;  2LTO A;  1LTA D;  3DKM A;  3SWN A;  3KFU A;  3GTM B;  1TT2 A;  4FYW B;  1EY4 A;  1FVI A;  1QG7 A;  2EYO A;  2MFI A;  3UA7 A;  2GF7 A;  1SKU B;  2MK5 A;  3EG1 A;  1EY6 A;  5GMK i;  2PQA B;  2LX7 A;  5ELC A;  4DXG A;  1VQ6 T;  2BE5 C;  2ZM6 Q;  4FF1 A;  2EGA A;  1SJH D;  4K11 A;  3VS4 A;  3M55 A;  1EWH A;  1NR2 A;  3OSV A;  4IZ8 A;  5JOB A;  4G7O C;  2GQI A;  1D3B A;  2NWG A;  4JJC A;  2JK8 A;  4R8I A;  1G3S A;  2BE5 D;  3JCM h;  2V1R A;  3BFM A;  2AQ3 B;  2JJ9 A;  3QO3 A;  1KLG D;  2QGG A;  2ROT A;  4LFB L;  1ZX6 A;  2EY6 A;  2N88 A;  4LUO A;  3UI2 A;  4E7L A;  5IYD G;  1QMC A;  4M77 G;  1NJI U;  5M5W H;  4OVA A;  1OTC A;  1LTI D;  3EG9 A;  1VQM A;  3GIB A;  5LJ5 j;  2N55 A;  1M1F A;  4FYV B;  1STH A;  1Q86 R;  4TSS A;  3TP8 A;  4F7U B;  4X6A H;  3J81 j;  3A8K E;  3HOZ B;  2Y0S B;  5IYB H;  1N6A A;  1BVS A;  1O75 A;  5IN1 A;  5CO7 A;  1KDA A;  3N6R A;  2CUB A;  4J8Q A;  4AYB G;  2QK0 A;  2F52 A;  1LCK A;  1QCN A;  2OI3 A;  1WDX A;  4PZ6 A;  3H6M A;  3H15 A;  2ENB A;  2VV5 A;  1RDP D;  1HTP A;  3THK A;  1HYO A;  1HA5 A;  5CC4 A;  4ALP A;  2M9U A;  4ID6 A;  1TG0 A;  3CCQ Q;  5KIX A;  4JV5 Q;  5C0X I;  4CJ0 B;  5C44 G;  3BZC A;  1JO8 A;  4NS5 A;  1F9S A;  3ZJY C;  1P16 A;  4AG1 C;  1AN8 A;  3M54 A;  1JOK A;  3X3M A;  1IYJ B;  4MN3 A;  3AHU A;  4N9P A;  1AWX A;  2JA5 G;  4WF2 A;  3CMA T;  1RCV D;  5IYC G;  4DUY L;  4DR4 Q;  2XMF A;  2EFI A;  5GAN 5;  3CEY A;  2XDD A;  3NEM A;  3TS2 A;  1I5F A;  4M77 F;  4F7U G;  2E2J B;  2DO3 A;  3I4M H;  5FU6 C;  2Q2U A;  2KVQ G;  3EH2 A;  4XYQ A;  4EGV A;  1V9P A;  4EQP A;  1FYC A;  2FHT A;  3DB3 A;  2PVG B;  1JC7 A;  3JCM X;  2V8K A;  4A3I H;  1JBM A;  1Y96 A;  4J6H A;  4XTV A;  1K8G A;  2CZ1 B;  7AT1 B;  4CJ1 B;  2LRQ A;  1ZA2 B;  1W2B P;  1YIT Q;  4MDX A;  2COY A;  2F0P A;  2E12 A;  2OCE A;  3OOC A;  2D0Q B;  3FJ5 A;  5IXF A;  4TRD A;  3T56 B;  3KOJ A;  4IPD A;  2UU9 Q;  2D9T A;  3OS0 A;  3OB9 A;  1MSH A;  3TSS A;  2NVQ B;  2O9S A;  1M90 R;  2UUA L;  2LP5 A;  1YJ9 Q;  3I4L A;  3NXW A;  4HA8 A;  2FJ2 A;  4JI2 L;  4RFB A;  3EG2 A;  5HGT A;  2P4R A;  4PFO A;  2L15 A;  1ZQ1 A;  1Y1V G;  2AQ1 B;  4LF4 L;  3QKJ A;  2YWW A;  4BI3 A;  1UJY A;  1XX8 A;  2RD1 A;  3H0F A;  1L1O A;  4DK1 A;  5C4X H;  4DK3 C;  3J81 c;  1N32 L;  2RQX A;  1V1Q A;  3Q0A A;  3S15 B;  2LQK A;  3M53 A;  3UAT A;  1PFS A;  3S24 A;  3GTL B;  3BDU A;  1BIA A;  4B6M A;  2QQR A;  2QEX A;  1B8A A;  3EFX D;  5BN4 A;  2WSC E;  1OX8 A;  5KYY A;  1TQO A;  4B3T L;  4J9E A;  4M78 A;  3UE1 A;  3CCE Q;  1E24 A;  2SOB A;  1KDC A;  1SMY D;  3M5A A;  2C06 A;  3NQT A;  4E47 A;  4ORZ A;  5CV8 A;  2RHX A;  4O1N A;  1OZ2 A;  3JCM J;  1LAC A;  3QOJ A;  2DTI A;  3CME A;  1KJW A;  4IUU A;  5G3L D;  5GAO m;  1C48 A;  3CQT A;  3QBY A;  3PV0 A;  3ER0 A;  5J39 A;  2KHJ A;  5FO7 B;  4BAC A;  4OWX B;  4EDU A;  2RQU A;  4JI5 Q;  3CCE T;  1LTT D;  1YI2 T;  1NJI R;  1BCM A;  3PIO 3;  2PO4 A;  5EPK A;  3GF5 A;  1RLQ C;  1WTX A;  5GAE C;  4M77 D;  4PV1 C;  5A2Q L;  1OI1 A;  1VQP Q;  3HOX H;  1ASY A;  4DUZ Q;  3IL8 A;  2YU9 H;  3MEA A;  3AEV A;  4IUV A;  1R4P B;  1J9O A;  4C8Q E;  1U1T A;  2MNA A;  3U58 A;  1BCP F;  2PUK B;  4C5I A;  1WLP B;  4PJJ A;  3SD4 A;  3UA6 A;  5C3W A;  1UWV A;  1D0Z A;  1X3Q A;  4LF7 L;  1VQO A;  3NMZ C;  5D6X A;  1GHJ A;  2OT2 A;  4PJN A;  2GA4 B;  5KE2 A;  2YUN A;  1WHK A;  4ZN3 A;  4KKS A;  4A3E B;  1WTR A;  3GTK B;  1E1T A;  2OWO A;  5C5L A;  3LNN A;  1FNU A;  5EGT A;  1WOC A;  2JN4 A;  3QUI A;  1PWT A;  4OON A;  4LDU A;  5DNF A;  3CCR A;  1WTP A;  3J80 i;  4X65 Q;  2JEB I;  1VQK T;  3M57 A;  2PYK A;  2G9D A;  5CBA E;  4P74 A;  5GAN 6;  3D0F A;  3RKY A;  5IY0 A;  2DY8 A;  4LFA Q;  4OL7 A;  1UGR B;  1YIT A;  4LF8 L;  2K79 A;  3NGP A;  5FK9 C;  1M2V A;  2L5Q A;  4JK1 C;  5EPL A;  2ZPF B;  1SHF A;  3J7A F;  2R7Z H;  3EAE A;  4NP5 A;  2XI9 A;  4DPG A;  1QCO A;  3GTQ B;  4FVM A;  4R4C A;  3NP8 A;  3MO8 A;  5LJ5 h;  3PVQ A;  2VXE A;  1VQO Q;  2L9H A;  2VXW A;  4BY6 B;  3ND8 A;  4DR7 Q;  4LXC A;  1BOS A;  2LT4 A;  5FOB B;  3OHX C;  1GUW A;  4ATO A;  3CC4 Q;  3S1R H;  1Z6H A;  1RUW A;  1WXB A;  4FSS A;  5HKC A;  4XQJ A;  2QEX Q;  2ED0 A;  2F2X A;  3QII A;  1U3O A;  2KT8 A;  2NN6 G;  2HT1 A;  1TKW B;  4DV1 L;  2RHZ A;  1IB8 A;  4HVU A;  1QVF A;  4CDE C;  2KAF A;  3KJP A;  4JRK A;  3LWE A;  2UXD Q;  5GAN e;  2LT1 A;  4HJA A;  3EFS A;  5IP9 G;  1Q8I A;  1WQW A;  1JXO A;  1LNX A;  3MP1 A;  3S2H H;  2NVX B;  4IFD I;  2UUC L;  3OYI A;  4MMK A;  4QL5 A;  3SVM A;  5KYN A;  1GFC A;  3VS3 A;  2PNH A;  2DA9 A;  2H3E B;  1AHJ B;  4OMO A;  4RKU E;  4L5T A;  1K1Z A;  2AIR B;  1SNQ A;  1VQJ A;  1IO6 A;  3G7Z A;  4DV7 Q;  5COR A;  3EIV A;  4MZ9 A;  4J7I A;  3F8T A;  4A4F A;  4IIM A;  3L7Z C;  2NUT B;  5JJZ A;  4OWW B;  2R92 H;  1H9M A;  4KLK A;  3EBE A;  5L23 A;  4BBS G;  1YHQ Q;  2C9O A;  2EY1 A;  1SE4 A;  2LQW A;  1OEB A;  1HUM A;  3R93 A;  5IT9 L;  1PSF A;  1RF2 D;  3ULR B;  4Z89 A;  5GMK h;  1AE3 A;  4AIM A;  4U68 A;  3P8B B;  4PKC C;  5GJW B;  3KF8 A;  1PKT A;  1OU9 A;  1EYD A;  5LJ3 j;  3OS2 A;  3JB9 F;  3M4O B;  5C3E H;  2K2V A;  1U4P A;  4A3F H;  5GAN 8;  3TRZ A;  1MMG A;  2COZ A;  3QWN A;  5FU6 B;  2WAC A;  3W1B A;  4H13 C;  1EU3 A;  1VQC A;  3L3O C;  1HR0 Q;  3PF4 A;  2R7Z G;  2HD3 A;  3I91 A;  1HNX Q;  1VQA A;  1B53 A;  4P72 A;  4HVW A;  4C92 F;  1S5F D;  3VYS A;  2MHV A;  3TP7 A;  4C3J B;  1VQE A;  4PK4 A;  1ZLM A;  4J83 A;  3JCM g;  1NR4 A;  1SMX A;  4M7A F;  4M75 D;  1WJJ A;  4OMP A;  2ECZ A;  4AFQ C;  3PIO A;  2J7Z A;  2E65 A;  4D6W A;  1EOT A;  1H92 A;  1EIG A;  1U5K A;  4QVC A;  1Z7T A;  1ZYR D;  3H91 A;  3G71 A;  3CXC S;  3HZX A;  5FLM G;  1IZ6 A;  2VZA A;  4UPA A;  1LO5 D;  3I4N H;  4A3I G;  4WRD A;  2UUB L;  4J7F A;  5CKE A;  2R57 A;  2R7D A;  3G6E A;  3EVQ A;  2RQV A;  2NVX H;  4JOI C;  1I4K 1;  3MXP A;  2KCC A;  1H64 1;  3GPL A;  4R55 A;  1PNJ A;  1QCF A;  1HSQ A;  3I5R A;  1C4Q A;  1Y8P B;  3QDR B;  3RNU A;  2JSO A;  1S72 T;  3J80 E;  2JA5 H;  3Q22 A;  4XU3 A;  1VQ7 A;  5DM6 3;  1FJG L;  3GTJ B;  2Q8R E;  4BE2 A;  1MSG A;  2A7Y A;  2BE9 B;  3UDG A;  1FWZ A;  5GAM h;  1G2S A;  3VR2 A;  1RLP C;  3M4P A;  4ZUJ A;  4ZGE B;  4C92 E;  5FLM H;  1PYS B;  1MMA A;  5A35 A;  1SG5 A;  1VQN T;  2B3G A;  1Q7Y C;  1EIF A;  4C8Q B;  1X55 A;  2HIX A;  4LDY A;  2E5Q A;  3GTQ H;  1X56 A;  1NM7 A;  1V1P A;  1BR9 A;  2HQX A;  1SNC A;  5C0M A;  3I8Z A;  4TKO B;  1TWH H;  2EYY A;  4H7B A;  1QVF S;  2B2V C;  4NKL A;  3EFO A;  1STB A;  3SK5 A;  2VUM B;  3A0J A;  1D1C A;  3Q8D A;  3ULL A;  3ONA B;  1EY8 A;  2QGF B;  2JN0 A;  2LX9 A;  2OTJ Q;  4A3B H;  4QY7 A;  5H1S E;  2XNA C;  2NLU A;  4M7D G;  3SB2 A;  2E6N A;  4LUD A;  1O7I A;  5CV7 A;  4A3E H;  1EWI A;  3GTK H;  5JJI A;  2K4K A;  4GLM A;  4XK8 E;  1ESF A;  4IPH A;  2L0C A;  1VMC A;  1KQS A;  4CDC C;  2F0F A;  3M7G A;  2XG8 D;  3KLW A;  1VQN Q;  1K9M U;  1PFM A;  4BBS H;  2BE7 D;  5ELE A;  1S5C D;  4KD3 A;  3NPP A;  3L2Q A;  2Y0S G;  2E2H H;  1D2B A;  4RGO S;  2CHB D;  2F0J A;  4J6W A;  3J81 i;  1W2B A;  1UEC A;  1X3G A;  4IAL A;  2M02 A;  1BXT A;  1V8Q A;  1SFO H;  1NAP A;  3CP0 A;  2X4X A;  3LGL A;  2JW4 A;  4C92 C;  2RB6 A;  3M4G A;  4DR5 Q;  4V2S A;  2F0H A;  2RBM A;  4CRI A;  4BBR B;  2I2L A;  1CKB A;  5EQ0 A;  2F5K A;  2HD0 A;  3S9W A;  2P0Q A;  2K2M A;  2DZC A;  2DGY A;  5IAY A;  3CW2 C;  3EGX A;  3S1Q B;  4F17 A;  3T9N A;  1ZUK A;  2JA7 H;  2HEQ A;  2F0S A;  3S3N A;  3TEE A;  1AZQ A;  4HKE A;  3JCM c;  4PJO B;  4FSX A;  1GUG A;  2XKO C;  4C0G A;  1FYN A;  3BZK A;  5GAN h;  3FDT A;  3GBQ A;  4FT4 A;  4UC4 A;  4KUI A;  1WZO A;  1SF9 A;  2KT1 A;  3G6E T;  4PJO E;  4LN2 A;  3FDR A;  5I21 A;  4JCV E;  4DN4 M;  4Y92 A;  2RNA A;  1K3R A;  4JI8 Q;  3CMA A;  3QZ9 B;  1YVC A;  5GAO q;  3RLO A;  3L2P A;  2L3S A;  1EQR A;  4BY7 G;  5FU7 B;  2E2I B;  2ZGW A;  2XHC A;  2QG9 B;  4DKA C;  1T0J A;  2FG0 A;  4OGC A;  1PH3 A;  5ELF A;  4X66 Q;  3LWI A;  3FPU B;  2D8J A;  5FLX c;  5KCO A;  1BBX C;  4RTX A;  3NK9 A;  5IH2 A;  4RGN A;  4JI1 L;  3K5M A;  4HR7 B;  2V1Q A;  1K9A A;  2BA1 A;  1EIY B;  2WII B;  3OYL A;  4L63 B;  1N5Z A;  5LJ5 e;  2EZV A;  4PMB A;  1WXU A;  2J7I A;  1M8A A;  1JWU D;  4K14 A;  4HJ5 A;  2PQE A;  5COY A;  2FVU A;  1SN8 A;  1SND A;  2L0A A;  3BYT B;  4X3K A;  5KNC A;  5L37 A;  4BXX H;  3GTP H;  3FC3 A;  1TUD A;  1XMQ L;  4N4G A;  4A3D B;  2I07 B;  3CBO A;  1VA7 A;  4MHE A;  2K33 A;  2DXB A;  4A3G H;  3SGI A;  3CXC P;  3OYD A;  4JDS A;  1TY2 A;  4C3H G;  1DD2 A;  1VQH A;  2VGN A;  2DZ9 A;  4JBM A;  4JUV A;  2DRK A;  1ABQ A;  1I94 Q;  2CP2 A;  2QDL A;  2PMZ E;  5E1F A;  1XOV A;  3MHX A;  4N0A A;  1H9R A;  4LF9 L;  3ERO A;  4C92 B;  1IGU A;  2EY2 A;  4BUG A;  1A0N B;  5CCA A;  2DYB A;  5HUR A;  3HHT B;  2E75 C;  4QIW E;  1TWF H;  2MPM A;  1ZBJ A;  5LL6 S;  5L8R E;  2HZY A;  1HQM C;  4IFD H;  2JUF A;  4ZCK A;  4BB7 A;  5C5M A;  3BVG A;  3D6C A;  4A3J B;  3G71 Q;  1FR3 A;  4LW1 A;  4KHP L;  3G6J B;  5ELO A;  3L42 A;  1PTO D;  2G6F X;  1B1Z A;  4B9X A;  1LM0 A;  1JR0 D;  2CH4 W;  1SYD A;  1WTV A;  1Q82 C;  1V76 A;  3KYH C;  1SSH A;  4XIG S;  4D8K A;  3TS0 A;  2OXP A;  4TVA B;  4OGE A;  1MV0 B;  4NL3 A;  2CP7 A;  4JLG A;  1Q1E A;  3LX7 A;  2FFK B;  4JI3 L;  1XNR Q;  3BDC A;  2PI2 A;  3M7N A;  4KBM B;  1SSO A;  3HRZ C;  4A3D G;  1M8V A;  5LMN W;  3KK7 A;  2K3X A;  3NBI A;  1OYX A;  3A8J E;  3MFY A;  5J22 A;  2DN8 A;  2KRN A;  2M00 A;  2LQ8 A;  2WIN B;  5ECA A;  2AMC B;  4DV0 Q;  3F2B A;  4NL2 A;  1ZSG A;  3EGD B;  4O5V A;  5M5W B;  3JAM c;  5LJ3 d;  3CME T;  3HOW H;  3N52 A;  3FRN A;  4DNR B;  3MAQ A;  2KXD A;  1QNU A;  3DXJ C;  1FL0 A;  5GRO A;  3H09 A;  5CKF A;  1HR0 W;  1VQB A;  1YIT T;  2JNG A;  3KBG A;  1XNI A;  2EYW A;  1VQP T;  1JE4 A;  2E6Z A;  1QZH A;  1UGP B;  2IX1 A;  2JA8 H;  2CKZ B;  1JB7 A;  1UUP A;  3G4S Q;  3I56 Q;  3JB9 I;  2AKW B;  1I4X A;  3CCR T;  4RG8 A;  4A3K B;  1CI3 M;  1SSF A;  2RQR A;  4DBQ A;  1BBU A;  1PYB A;  4FXG C;  1X69 A;  2FPF A;  3A5Z B;  3UF4 A;  1N27 A;  1ZUU A;  1QOH A;  3FHW A;  5C44 B;  2K6D A;  4L8J A;  4QQ6 A;  1U5S A;  1VIF A;  1CKN B;  1LT3 D;  5E4W C;  1A2U A;  1YNJ C;  5AFW A;  1S5B D;  2A69 C;  1I4Q A;  5D7U A;  5C6S A;  2QAS A;  2HIV A;  1X2K A;  1N34 Q;  2IJ0 A;  1ZUY A;  2QCP X;  4QF4 A;  2VYT A;  3RIR A;  2RI3 A;  3X26 B;  5C4J B;  3U23 A;  1J5E L;  1HHV A;  3X25 B;  2GVB A;  1OPL A;  1PZK D;  3OYG A;  2D0P A;  3RES A;  1H3Z A;  2L5T A;  3C1F A;  1VQ7 T;  2J6F A;  1R77 A;  2K05 A;  3DEP A;  5IYD H;  1YFN A;  4RCO A;  2D6F A;  1HNZ L;  1SMY C;  1SDF A;  1JWS D;  3EHR A;  5KYW B;  4R0K A;  3JB9 J;  1KTK A;  2B8F A;  2FIN B;  4JI6 Q;  4IFD G;  2D9U A;  5DLQ E;  2JP1 A;  1QWF A;  1V43 A;  1ARK A;  2LCS A;  2E5K A;  4AFU C;  1D1B A;  4GN4 B;  4KJO A;  4QMG A;  1F77 A;  3V05 A;  4GOP A;  1WVL A;  1DOK A;  2OJ2 A;  4C0D C;  4C0Z A;  1IHW A;  1LOJ A;  1OZ3 A;  4LD6 A;  3P8H A;  3GV6 A;  4P71 A;  4KUL A;  4UDU C;  1Q8K A;  5C4H A;  3D4R A;  2CSQ A;  1ONL A;  3PO3 H;  4ANJ A;  1M8M A;  1FXX A;  4NB3 A;  2NVY H;  4UP7 A;  3F2D A;  2HQE A;  4DV3 Q;  1HFN A;  1PH6 A;  4A3C H;  1I4H A;  2ZXR A;  1L1O B;  3S1N B;  1AEX A;  1PH5 A;  4WOR A;  2E3H A;  3CD6 T;  1GUN A;  3E3X A;  1HH2 P;  2KSS A;  2F1L A;  3CQZ B;  2QTX A;  5KGU A;  2EBP A;  2CP0 A;  5KYY B;  1K83 B;  5LHY 1;  1SYE A;  3K7A H;  2QW7 A;  4XU0 A;  2I0N A;  3V7R A;  5GAM e;  3KLR A;  4B3M Q;  4DF7 A;  1ICF B;  5M3M B;  1GOZ A;  1LTR D;  1VQM T;  4GNX A;  1CFM A;  1NEB A;  3IFD A;  2ICE C;  3MEU A;  4A3M B;  3ICE A;  4FW2 A;  3U4Z A;  1NTG A;  2DET A;  5M5Y H;  3H0I A;  2V1C C;  3FJP A;  3PGG A;  2ALY B;  4ME7 A;  3PMI A;  4MZP A;  1RAF B;  2NUP B;  2RH2 A;  4OO1 G;  3QDF A;  1LLR D;  2R93 G;  1XYI A;  4X3T A;  3PMF A;  1X9N A;  2O4X A;  5JPM C;  3D4W A;  3OYK A;  3CPF A;  2F0U A;  4FXD A;  2LXJ A;  1Q7Y R;  2EDG A;  1BIB A;  2A6H C;  5LJ5 d;  4CJ2 C;  3PUY A;  3H6Z A;  1XTC D;  2F3V A;  5HY6 A;  1Q90 A;  2HHH L;  1GHK A;  3LH5 A;  1N8R R;  4BY1 G;  1HCZ A;  3OS5 A;  4HSV A;  3N5B B;  1S4Z A;  5ISR A;  4RG2 A;  3WVE B;  4R4O A;  4ZRZ A;  2JE6 I;  1RHP A;  3RZO B;  1KQS P;  1P8L A;  1CTM A;  1BBZ A;  4QUF A;  3KUF A;  2BH2 A;  1BI1 A;  4CHT B;  4DAP A;  1Y1W H;  3ULP A;  2EGE A;  1DGS A;  2FEI A;  2V26 A;  4C3I H;  5GAO r;  2MAM A;  4EPC A;  2M0O A;  2KCN A;  5I2X A;  2GTJ A;  4G57 A;  3VS5 A;  4P73 A;  1SRO A;  2JVV A;  3EA6 A;  4LNQ A;  5IXB A;  4FIB A;  1MHW C;  1STA A;  2ZPE B;  2XN9 C;  3L9A X;  4YWL A;  1Y57 A;  4M78 E;  2DL8 A;  2UU9 L;  4KT0 E;  4RMO A;  1CSK A;  5BR8 Q;  1OOT A;  3IQL A;  1E2Z A;  3CCS Q;  4OEL B;  1RAA B;  2EPD A;  3URG A;  2D0N A;  1VQL A;  3P75 A;  1P92 A;  4A3E G;  3R8B A;  4HSP A;  4DR6 Q;  3BVZ A;  4M7D C;  2B29 A;  2EYM A;  1HJD A;  1G2B A;  4A3B B;  4MML A;  5LJ3 e;  3MCA B;  2KRS A;  4GLK A;  2R7F A;  1S1N A;  2K3Y A;  2M0Y A;  5CQX A;  3OW2 P;  4XTX A;  1IL8 A;  1G6P A;  4VUB A;  1ACM B;  2RPN A;  5M5X B;  2B2W A;  3CRK C;  5FW9 A;  4EMG A;  3TCJ A;  5I11 A;  4ABN A;  1EIH A;  4WTO B;  2H5X A;  5CV9 A;  3R6N A;  1SRM A;  2FPE A;  2PCF B;  4PJL A;  2EQS A;  2H4O A;  3CBM A;  4L5R C;  3CCS T;  3OW7 A;  1W4S A;  2IPK D;  1G3W A;  2L3P A;  1CHP D;  3DWQ A;  3OPO A;  2NTT A;  3GTJ H;  2YV5 A;  4M77 E;  4PFZ A;  5C6A A;  1E2V A;  4UY8 C;  1X54 A;  3UDI A;  2DNC A;  1EFI D;  2UXB Q;  2BOS A;  2E1H A;  1OPK A;  3A8L B;  2QQB A;  4PNO A;  2WAQ B;  1M2O A;  2X4Y A;  4E7H A;  3PUX A;  3TZU A;  4L6V 5;  2EQK A;  2FZG B;  4IUT A;  1SAP A;  3RLN A;  3CCE A;  1U4L A;  2XU8 A;  2QYZ A;  2VS1 A;  3NSW A;  3HOV B;  4K6L A;  4EQN A;  4C8Q G;  5GAO n;  1UTI A;  1YP5 A;  3VS1 A;  2L4N A;  1QVC A;  3F2C A;  3A7A B;  2WV6 D;  1G5V A;  5LMN L;  4R8N A;  2R6G A;  1NYF A;  1L2F A;  2KMT A;  5F2D A;  4DR5 L;  4HMI A;  3RN5 A;  2O5J C;  4O0A A;  3HKZ G;  3BG3 A;  3S14 B;  2ID0 A;  1DXM A;  4NXN L;  2VWF A;  1FMW A;  1BI0 A;  3MJX A;  4QQD A;  4EVO A;  5JPN C;  3H0H A;  3WOF A;  1Y69 U;  5I2S A;  1Q1B A;  2G9H D;  3T1H Q;  2KBT A;  4K0K L;  3HKZ E;  2DD4 A;  1VQL T;  3CCU Q;  2SRC A;  1EZ8 A;  1QUQ B;  5EKI A;  4YHH L;  3PIP 3;  1CSQ A;  1O7Z A;  1MGS A;  2B2W C;  3K57 A;  3OS1 A;  3E9G A;  1M90 U;  3JB9 H;  3I5S A;  1PTO B;  2A68 C;  2B39 A;  1EY7 A;  2FRY A;  2WKC A;  1ZSZ C;  1IBK Q;  5CGK A;  3PUZ A;  2JTM A;  1STE A;  1Q3L A;  1SE2 A;  4DUY Q;  2RI2 A;  2O31 A;  1VQ6 A;  2K5V A;  5DM7 3;  4IUP A;  2R5A A;  4RAU C;  2HL3 A;  3VA7 A;  4D8D A;  3CCM Q;  1BI2 A;  5EAY A;  4QIW B;  3V8K A;  1PLF A;  5C3E G;  3E6Z X;  3MET A;  2EJF C;  1B7Y B;  3GP7 A;  3CPW S;  2LMJ A;  2F4V Q;  5CR2 A;  4WJ3 M;  4JZ4 A;  1YHQ T;  1N36 L;  1QKW A;  4P75 A;  4NDX A;  4FO2 A;  3HRT A;  1UFF A;  5IGF A;  4DR1 Q;  4OX9 L;  1VF7 A;  4JG2 A;  4DR2 Q;  1M9S A;  1H8K A;  3KDF A;  2A5H A;  3I56 T;  2X3W D;  1E0B A;  1S40 A;  1CKN A;  3OIQ A;  3RBB B;  2L3R A;  1O9S A;  3NWS A;  2OEO A;  3GLX A;  2JQO A;  5I22 A;  1SE3 A;  2RF4 A;  2VVK A;  1F2M A;  4RCB A;  1MV3 A;  2K5I A;  5G3L F;  3R2I A;  3S2H B;  3B6Y A;  2PZW A;  4PLL A;  5C0X J;  4JRI A;  2M16 A;  1GRI A;  1PRM C;  2CKK A;  1VCI A;  4LE9 A;  3SEB A;  4HCZ A;  4DU9 A;  5C0X H;  3QXE B;  3J81 E;  1CZW A;  4JI4 Q;  2ROL A;  1WTW A;  2LDM A;  1D7Q A;  3H94 A;  1SRU A;  2CRE A;  1GFD A;  1VQ8 T;  2ZPG B;  4DOW A;  2NN6 H;  2P0K A;  2XWJ B;  2HCC A;  1PRL C;  2QIL A;  1QB5 D;  1VQO T;  5DLO A;  1HQR D;  3H0G B;  3HGB A;  3WWV A;  2PNI A;  1SJE D;  3PMT A;  1JOO A;  3UDC A;  3CPW P;  1VQ5 A;  4MZT A;  1BBW A;  5CBE E;  1YCY A;  3E2U A;  4N8X 1;  3RNJ A;  4UP9 A;  3PO2 B;  5KND A;  5LL6 X;  2E64 A;  3ZFJ A;  3G71 T;  2B63 H;  4ZKC B;  3QR8 A;  3AT1 B;  4ZTF A;  1YIJ T;  1MI2 A;  4C5G A;  4F04 B;  1TUG B;  2VUM G;  4G4K A;  3VR3 A;  2LSS A;  5CMD A;  3D8G A;  4GZY C;  4E7K A;  1IBL L;  3GQB A;  2NUZ A;  4M78 F;  5LJ3 g;  2NVT B;  2KYM A;  4OF1 A;  4C2M B;  2UXC Q;  2BH8 A;  5C4Z A;  5C4X G;  5EKK A;  2K6A A;  4KI0 A;  1C0A A;  4GNX C;  4E7Z A;  2EJG A;  4OB2 B;  1ZA1 B;  1PMR A;  4YWK A;  2G3R A;  1TWA B;  2GVA A;  1Q81 C;  3J7Y W;  4FL6 A;  3LYI A;  3PO3 G;  1HA6 A;  4F7U F;  1B44 D;  4GNX B;  3S2D H;  1PCX A;  4J6X A;  1GUS A;  2COW A;  1QCB D;  4DV5 Q;  3OYM A;  1G91 A;  1EU4 A;  2RF0 A;  3V7C A;  4QJF A;  4HT9 A;  5JJK A;  1OUL A;  2F0W A;  4KY7 A;  4Z88 A;  5CQY A;  1A63 A;  4B9W A;  4XXE A;  2K5W A;  1UG1 A;  1RAI B;  1VYV A;  2RCN A;  2YYZ A;  2K01 A;  2AHJ B;  4GLX A;  5AJ3 L;  1PYW D;  3PE0 A;  4M75 C;  4RTV A;  3G1J A;  1JEG A;  3EFR A;  3REB B;  4HED A;  2XSC A;  3H3V I;  1F1B B;  2YSQ A;  1YBY A;  4X3U A;  3CCU T;  1KD1 R;  4J9D A;  3L2Z A;  5M5X H;  5EJW A;  1ENF A;  1UNS A;  4O2D A;  1WJQ A;  5HGQ A;  3TQY A;  1EQQ A;  4OB3 B;  2YRC A;  3FPP A;  4M77 B;  3NTK A;  1WYD A;  1AD5 A;  2OTL A;  2LY7 A;  2Z9H A;  4DNI A;  4JI0 L;  2LVM A;  6AT1 B;  1JOR A;  1UGV A;  1KL9 A;  3MEH A;  5D3D A;  1TR5 A;  3ZL7 C;  3UWN A;  1DCZ A;  1D5X C;  3I72 A;  5J26 A;  5J3B A;  2E2D C;  4XQN A;  3F70 A;  1BCO A;  3CC7 Q;  3CKI B;  1I0C A;  1ILQ A;  2MQH A;  1HNW L;  3VDY A;  3I73 A;  3W5O A;  4PLI A;  4F7U E;  1HZC A;  2HSP A;  3J7Z C;  3OW2 S;  4JYA Q;  2ZM6 L;  4BY7 H;  4RKL A;  2RHQ B;  2DJF C;  3MEF A;  3EG0 A;  2IPO B;  2FZK B;  2NZH A;  5GAM g;  3ERS X;  4ME5 A;  1QWE A;  2VKN A;  4DUZ L;  2K3B A;  3K0Y A;  1OXV A;  1CUK A;  2HQH A;  2W10 A;  4PJO D;  1LYL A;  5IYB G;  3OW2 A;  2GGR A;  1AFP A;  4HXJ A;  5K5P A;  1B3A A;  5D14 A;  3TSZ A;  2XWB B;  1XMO Q;  3FMC A;  2PI2 E;  2ZXO A;  5DM7 R;  4XT3 B;  2MPX C;  1Y1V B;  2CQO A;  4BY7 B;  1Q86 C;  2F3W A;  3CU7 A;  1BI3 A;  1V29 B;  4A63 B;  1TS5 A;  4GN5 A;  5NUC A;  1B7T A;  4LFC L;  1OV3 A;  1A3U A;  2HMA A;  1D5Z C;  1MUZ A;  1IYU A;  2GCX A;  1D0X A;  3RD4 A;  4DAM A;  1ROD A;  3OYA A;  1GCQ C;  2EOT A;  1UHF A;  2H3J A;  3AFP A;  5I9O A;  2FRW A;  5GAM d;  3H41 A;  2DK3 A;  4IUQ A;  4OIJ A;  4KGV B;  1HD3 A;  2CW0 D;  1ILP A;  2MYS A;  2ATC B;  5CV4 A;  5GMK m;  1CK1 A;  3QIA A;  3FB9 A;  4FF3 A;  3E0E A;  1A62 A;  4JJD A;  2JA7 B;  4M78 C;  3A8O B;  1WHH A;  3JCM V;  4ELZ C;  3D3R A;  1XTD A;  1E7Z A;  2E5L L;  3S3O A;  1FGU A;  4ILW A;  3JAM E;  1UJ0 A;  3NQI A;  4UHV A;  4BBR H;  4KV6 A;  5FLX L;  2FO0 A;  1LUZ A;  8ATC B;  3KF6 A;  4X62 Q;  3LLR A;  1WPY A;  5CV5 A;  2EQI A;  4N0A C;  3K7A B;  4XAX B;  3HOZ H;  1IRE B;  2VAS A;  3M9B A;  1VMP A;  3CQZ H;  5IWA Q;  1RAH B;  3FEW X;  2K28 A;  3M0R A;  1EYA A;  4CC2 A;  2RN8 A;  3EJI A;  2E2H B;  1KC8 R;  1K76 A;  1PHT A;  4C3H H;  4ME3 A;  2J06 A;  1TWG H;  2WB1 B;  3KLS X;  4BY6 C;  3T1Y Q;  4J9F A;  3SEM A;  1F9R A;  3MXN A;  2NVY B;  1XMQ Q;  2X3X D;  1NLP C;  2DKG A;  2K7A A;  3PTA A;  3CC2 Q;  3BS1 A;  4A3M G;  4B3R L;  4Y52 H;  2C0T A;  2GFA A;  2JOY A;  1JU5 C;  4MDW A;  2F0O A;  4DAV A;  4DV6 Q;  2P0P A;  1TSF A;  1KD1 U;  5DAU A;  2RJE A;  4GBQ A;  1H9S B;  5KNB A;  2JEA I;  2LFN A;  3CCM T;  1MJE A;  2DYI A;  3V7S A;  5KYU B;  1X6G A;  5A0L A;  2EYQ A;  2DTH A;  5FRM A;  3TZD A;  2ESW A;  1QLY A;  2HCI A;  2DVE A;  2O2L D;  3JCM W;  2X4W A;  3VRZ A;  1VQ9 A;  2WAQ G;  3OTO L;  4DV4 L;  1TU0 B;  1PFB A;  3NE5 B;  1CHQ D;  3MXG A;  1EQT A;  1C7Y A;  4UP8 A;  1U1S A;  4JS5 A;  4RTW A;  2HDL A;  4KKT A;  3K59 A;  4HID A;  1C6V X;  2RDH A;  4XQQ A;  3JCM b;  2R93 B;  4CI0 C;  2FMC A;  4CC4 B;  4Z8A A;  4A75 A;  2I46 A;  3JCM e;  3PO2 H;  2KGT A;  1E6H A;  1QWY A;  4XT1 B;  3SR1 A;  5C4J H;  4JPB W;  1I3Q B;  1WCM G;  4RTU A;  2EYL A;  5DY9 A;  3M0P A;  1M3B A;  1CA6 A;  4BXX G;  2MWP A;  3LW5 E;  2MMP A;  1IKM A;  5CAI A;  2DVJ A;  4OB1 B;  2HNI A;  4DR4 L;  4QKU A;  1NSN S;  1VQF A;  1TH7 A;  4Y28 E;  2WB1 G;  3NWT A;  3STB C;  3K5N A;  3M58 A;  3CCL A;  3VUZ A;  3BU2 A;  2XK0 A;  2YUQ A;  1HK9 A;  1A6X A;  3OWF A;  1G3T A;  2B63 G;  4PFP A;  5FLX E;  4NXM L;  5HCK A;  3S2D B;  2ZCF B;  3CC2 T;  1KDB A;  1GBR A;  3JSC A;  1RL2 A;  1TWA H;  4NMZ A;  1ZEQ X;  4PZ8 A;  2DUD A;  2VQF Q;  1VIE A;  1OXX K;  5FO9 B;  1ZSZ A;  1ABO A;  1X75 C;  3DEO A;  4M1U B;  1JOQ A;  1A15 A;  3NEN A;  1YWP A;  2FPD A;  2DL4 A;  1Q81 R;  3Q6S A;  1U4M A;  1VS0 A;  2NVT H;  4EX5 A;  1KFZ A;  1QIL A;  4IOA A;  3UT1 A;  1LTG D;  4HN7 A;  3S16 B;  3FKI G;  3UDF A;  2DRM A;  4IO9 A;  3I7F A;  4L6T B;  4X65 L;  1D1I A;  1NZ9 A;  3A8M B;  1FJG Q;  4C3J H;  2F0T A;  4RGT A;  5CK9 A;  3FKI B;  2DM1 A;  4EMK B;  2QKI C;  1RIP A;  1VQ7 Q;  4NOY A;  4EMH A;  2KHS A;  3SWN C;  1M1K U;  4U67 3;  3CC7 A;  4CGY B;  3I4M G;  1N34 L;  2CGH A;  3EG3 A;  1E2W A;  1NY4 A;  2K14 A;  5E4X A;  5C3E B;  2A0F B;  1PTO H;  5KYL A;  1EYG A;  2KR3 A;  1S72 A;  2YTV A;  1OXT A;  3RLF A;  4WFN 3;  3M0T A;  1IBK L;  1CKA A;  1BK2 A;  4DA4 A;  3VYH B;  1K9M R;  4AG2 C;  4OIK A;  3DLL A;  1Y07 A;  1VQP A;  3DMU A;  1M1G A;  1M3A A;  2R58 A;  2AUK A;  2RHS B;  3S1M H;  2PQA A;  3PUV A;  3S14 H;  1CA5 A;  2V4D A;  4BS9 A;  2DEQ A;  4XTU A;  1RAG B;  1K73 U;  4RTY A;  4PJM A;  2F0L A;  4C5E A;  4PJO G;  2K9G A;  2GNC A;  3G4S T;  3HRS A;  2OTJ A;  1EOV A;  4H0L C;  3X3N A;  3VUB A;  4M75 E;  2Q2H A;  3VA5 A;  4DR1 L;  1PTO F;  1YNJ D;  3W2D A;  4AH6 A;  4C0F A;  5GAM j;  2A69 D;  4GKJ Q;  4DR2 L;  2RK1 A;  3HP3 A;  4TQU S;  4LFB Q;  4GKK Q;  4A3G B;  1B34 B;  3HPW A;  2K5H A;  4JW0 A;  4DK6 C;  3GTP B;  2N8N A;  4M7D F;  2JT4 A;  2B2Y A;  4KY5 A;  4FYY B;  4HIO A;  3QZ5 B;  4J9B A;  4HCC A;  1STY A;  4JJB A;  5GAM f;  1M1K C;  3CC4 T;  3GP8 A;  4YCU A;  4E7J A;  2K57 A;  2CZ7 B;  2IL8 A;  4RCC A;  2L1B A;  2IX0 A;  5AYF A;  3TP5 A;  4F7U A;  1T5E A;  2XD0 A;  2B2Y C;  1HTL D;  4X3S A;  1UE1 A;  3FLG A;  4RKB A;  2JA6 H;  2VC8 A;  1MBY A;  4A93 B;  1I3Q H;  3VS6 A;  1VF5 C;  2EXD A;  4C3J G;  4JOI A;  1VQ8 Q;  1YIJ Q;  1R8O B;  2LKV A;  4BI8 B;  2KBN A;  2QDY B;  4YY3 L;  5EC7 A;  1YJ9 T;  3OSO A;  2EKH A;  3QOL A;  1WTO A;  2E2I H;  2R7Z B;  2D62 A;  4JV5 L;  2CDT A;  1AZE A;  1VQM Q;  2K50 A;  3CRL C;  4M7D B;  3I55 Q;  1EEI D;  1H95 A;  2ZTE A;  1AE2 A;  4OHJ A;  1ESR A;  3PGZ A;  1WTQ A;  1QKX A;  2D1X A;  4LUZ A;  4QT7 A;  5EKL A;  3UE0 A;  4V19 0;  4CC3 A;  1IXD A;  4RTZ A;  1NYG A;  2EJF A;  1GUO A;  4GS3 A;  2ZJR A;  4PJO C;  3H9N A;  2R61 A;  4C0D B;  3IKJ A;  4X66 L;  5I6W A;  1G8X A;  1WIE A;  4DV0 L;  3TSW A;  1AEY A;  2BA0 A;  4R9W A;  1G51 A;  2ZTC A;  2PZ1 A;  4A53 A;  1DYQ A;  1B9M A;  4Q5V A;  1TU2 B;  5GAG C;  4ODG A;  4X64 Q;  2MIO A;  1C9O A;  2KEA A;  3OBY A;  1K4U S;  1II3 A;  4A4G A;  4DBF A;  1TWG B;  3OYN A;  3DLM A;  4C92 D;  3DWA A;  2F03 A;  2WAQ E;  1AP0 A;  2CUD A;  3EGU A;  4JBW A;  2UUC Q;  1Q12 A;  3PT9 A;  3VU3 C;  3F1Z A;  3E5S A;  4OGQ C;  2K52 A;  1ZHI A;  3EQL C;  1K73 R;  2FMM A;  1BKB A;  3NFC A;  1YJN T;  4F88 A;  1YNN D;  1IXR A;  2Z6B A;  2L3Q A;  1QUQ A;  3U9O A;  4ZK9 B;  2JA9 A;  2HL5 C;  3RZO H;  3PO2 G;  1MMD A;  3HKZ B;  4DV5 L;  2DTO A;  2RDF A;  2Z4I A;  3K7U C;  2ZJP A;  2RI5 A;  2CSI A;  3MZ5 A;  1PSE A;  1KAB A;  2RQT A;  5JAV A;  2F0E A;  4JI2 Q;  2LNH B;  5CKD A;  2Z6K C;  2AZV A;  3D31 A;  1VQK A;  2BZ8 A;  3JRZ A;  4ZUI A;  1AH9 A;  3CMA Q;  3CCV Q;  4M7A A;  2BCO A;  1X6O A;  1STN A;  2HDM A;  4B3T Q;  4JI7 Q;  2LZ6 B;  1TS3 A;  4ZQ3 A;  1N33 Q;  4ULL A;  1HZ9 A;  2EPB A;  1TWH B;  2M1H A;  3QPH A;  4OEM B;  1BCP C;  3VR5 A;  1DOM A;  3S15 H;  1DON A;  1S5E D;  2DPP B;  4PQX A;  4A3M H;  5IP9 H;  3KDF B;  2LJ3 A;  3DM1 A;  5ELN A;  1BCP D;  1PRT B;  1X3P A;  4H02 A;  3EN2 A;  3OIP A;  4IJH A;  3HEJ A;  3JCM d;  2LMC B;  2O9V A;  4CC7 A;  3I2Z A;  2K7V A;  4JI5 L;  5GAN d;  5FJ8 H;  4LF6 Q;  1UAP A;  1YJN Q;  2VNU D;  3CCQ A;  1FD7 D;  5IP7 H;  4A4K A;  1XPO A;  1X6B A;  4RA8 A;  3CCV T;  5FRN A;  1MJC A;  3DHQ A;  2EYX A;  3LX0 A;  5KYU A;  4M7D D;  2X51 A;  2K04 A;  3VYR A;  1Q7Y U;  1HXD A;  1KSW A;  3NBH B;  2BZX A;  2WP8 J;  2KQW A;  4A3I B;  3JB9 G;  3PVL A;  4IFD J;  2KNB B;  3C4S A;  2XID A;  1QVG S;  2R92 G;  2IHE A;  1X32 A;  2JMC A;  3S3M A;  2MO0 A;  1XMO L;  3PF5 A;  1LT5 D;  1K8A R;  2ZT9 C;  5LMN Q;  4E6I A;  3L1A A;  2E2J H;  2QQS A;  3C0C A;  2QTV A;  4I65 A;  1WD0 A;  2EVR A;  1W6K A;  2K1B A;  1K0X A;  2KEC A;  3A8G B;  5CKB A;  1KQ2 A;  3S1M B;  3X24 B;  4KK7 A;  5CVI A;  4PJO A;  1M2V B;  1WCM H;  2YRV A;  1AWW A;  1Y1W G;  2BIV A;  5C3X A;  2LNV A;  1TWC H;  5JVH 3;  2J4X A;  4KTA A;  1IHV A;  2FHD A;  5M5Y B;  1VQ9 Q;  5LMU L;  1XNQ Q;  1RAE B;  2YHT A;  2KEN A;  3HSB A;  4RMF A;  4A3F B;  2MO1 A;  2O2O A;  3TQ7 P;  1VUB A;  5IIF A;  3ZEH A;  4HAE A;  2YLB A;  3A56 A;  2MI6 A;  3SK4 A;  2CP6 A;  1UGS B;  4A3F G;  3GD7 A;  2ZTD A;  1KAW A;  1KNA A;  1SYB A;  2KJX A;  3LWU A;  3A8H B;  2Q8I B;  3M56 A;  1SHG A;  3MEV A;  2OF1 A;  2HAX A;  2HUG A;  3HOU G;  3NPF A;  5KYX B;  3SWN B;  1GO3 E;  4O42 A;  4JI1 Q;  4B08 A;  1AZG B;  1IW7 C;  4BE1 A;  3CAM A;  4EMK C;  2ATW A;  1KQ1 A;  3MFG A;  1MMN A;  2V8J A;  1EY0 A;  2PPB C;  2EYJ A;  3STB D;  1IW7 D;  5IP7 G;  5EBC A;  5T1G A;  2JA8 B;  1UEB A;  1T9H A;  3DM3 A;  3PO3 B;  3TDQ A;  1K73 C;  1D3B B;  1GCQ A;  2KRO A;  1VQ8 A;  1PZJ D;  2EQU A;  3QYG B;  1M30 A;  2KYB A;  3T13 A;  4C2M H;  4QVZ A;  1EEF D;  3OA6 A;  1FNW A;  2K5F A;  1SNP A;  4OMM A;  4JBK A;  4M75 F;  3CCJ A;  3VYT A;  4AYB B;  4DV6 L;  1T3S A;  3X20 B;  2PMZ B;  3D7S B;  2VL6 A;  1BYM A;  2GBQ A;  1K8M A;  2NUT A;  4LF4 Q;  3MP6 A;  1B2T A;  4A3L H;  1VYT A;  4IJL A;  2VQE Q;  3J81 L;  3NEL A;  2JM9 A;  4M7D E;  3O13 A;  2IG0 A;  1DJR D;  2LCL A;  1WI5 A;  5ELD A;  4KHP Q;  3GDE A;  1I5L A;  4KD4 A;  1JJ2 P;  4F7X A;  1EZ6 A;  1DZ1 A;  2A08 A;  2VXF A;  1IKL A;  3J80 c;  2JA8 G;  4Z02 A;  2KY9 A;  3BDL A;  1T3L A;  4C3I G;  4Y91 A;  2FB7 A;  2AWN A;  4APV A;  1SYF A;  4KMU C;  2EYF A;  1HR0 L;  3ULJ A;  1SRL A;  1X27 A;  2MF2 A;  1LTL A;  1S5D D;  5JJL A;  3QJY A;  4QVD A;  1I07 A;  1TTH B;  1B34 A;  2BKD N;  1IBM L;  5HK0 A;  2DJG C;  1A3V A;  3W3A A;  5JEA H;  4JZ3 A;  2ED1 A;  9ATC B;  4CBV A;  1X01 A;  3BW1 A;  3PUW A;  4HIK A;  1AOJ A;  3OYF A;  1NMG A;  1JIC A;  1ZYR C;  3V2T A;  4MNO A;  1L0Y B;  4ZAI A;  2YUP A;  4M75 A;  1K8O A;  3VS2 A;  1W6X A;  5GMK l;  1PD0 A;  2RSN A;  2YTX A;  4RTT A;  1SNM A;  5CR3 A;  4BA1 I;  4M7A D;  3REA B;  2F4I A;  2P84 A;  1EY9 A;  2CH4 A;  4CDF C;  3QWY A;  3FRP B;  4XDX A;  1YCS B;  1S3O A;  1M90 C;  2L55 A;  5KH6 A;  2M9V A;  1N9W A;  1X2Q A;  2UUA Q;  1GL5 A;  2XDP A;  3FIF A;  3J80 L;  3QO2 A;  3A1P A;  2NZ1 D;  1GJX A;  1E7O A;  2RM4 A;  4K2K A;  5FO8 B;  4C8Q A;  1TXY A;  2IVW A;  3LGJ A;  2EYP A;  2JMA A;  2DNE A;  4AYB E;  1JQQ A;  2B8A A;  1NNX A;  2XIC A;  1WA7 A;  1GXD C;  4YHH Q;  2CZ6 B;  1PXU A;  4E2F B;  1ZBX A;  1SNO A;  1KHI A;  1UEA B;  2X6L A;  1XJW B;  4YCV A;  1FGB D;  1TWC B;  1GM5 A;  2QXF A;  2X35 A;  4PZ7 A;  4J15 A;  3DWP A;  3FP9 A;  1AZP A;  3R2T A;  4LJZ C;  1KD1 C;  4QQG A;  5KYW A;  1VQK Q;  1KQS S;  1G2T A;  1U4R A;  1WHG A;  2ZPI B;  2AWO A;  2DJQ A;  1VQ5 T;  1GUT A;  1U06 A;  1ML0 D;  1NE3 A;  3PIP A;  2DX1 A;  3MXN B;  1YN8 A;  4HTH A;  4OMQ A;  4UAI A;  3PFS A;  1STG A;  4IOC A;  2I0Q A;  4I7A A;  4KN4 C;  4POF A;  4IQZ A;  1PH4 A;  2OAU A;  4DV1 Q;  3OMG A;  3OYE A;  1Y1V H;  2MP1 A;  2NVQ H;  1WGS A;  5D6W A;  3NTH A;  1H9S A;  5IHN A;  3MC0 B;  3HTR A;  2CFM A;  2DLP A;  2EJG C;  2A6H D;  3GTO B;  4GKJ L;  4C1N K;  1NBE B;  1B4O A;  5FJ8 G;  4HMJ A;  4GKK L;  2P4T A;  5GAN f;  2SDF A;  1NUC A;  4MTK A;  3KUP A;  2B86 A;  2QGQ A;  4GLV B;  3TU4 K;  3CPW A;  4M7A G;  2HBW A;  5E7N A;  5JEA G;  2WKD A;  5IT9 E;  2DXU A;  2AQ2 B;  2JA7 G;  3IRB A;  1EUJ A;  4LF5 L;  4MTN A;  4POG A;  1IYV A;  5GAN j;  4OB0 B;  1JE5 A;  3I4M B;  3H8Z A;  2KRM A;  1VQN A;  1JJC B;  4A3G G;  3ZBD A;  1MND A;  3MHB A;  3E0J A;  2NB0 A;  4ZTJ A;  2F0M A;  5I6Y A;  5M3F G;  4N4I A;  3EGX B;  1BUV T;  3HOU H;  3I55 A;  1RAD B;  4OMF B;  3SHL A;  3ITP A;  3SK8 A;  4C8Q F;  4K0K Q;  1LT6 D;  2DL7 A;  1BQQ T;  4RG1 A;  4KUD K;  4A3K G;  1U9R A;  1W3S A;  4PMW A;  3CCL T;  1HNX L;  1WI7 A;  3HOY B;  3VR6 A;  1R4Q B;  3QWX X;  1PKS A;  4K5W A;  3MKD A;  1IL2 A;  4QGU A;  2LXK A;  1BNZ A;  4YTL A;  1M1K R;  3NBH A;  3W1G A;  1YJW T;  2EXZ A;  2JA6 G;  1YJ9 A;  4AQY Q;  2NYZ D;  3CCJ Q;  4ZGD B;  5IHK A;  2RKS A;  2ZAE A;  3SFM A;  1G3Y A;  2ZJQ A;  2JA5 B;  1UE5 A;  3TME A;  2ASB A;  4QW2 A;  1I4R A;  1VQI A;  2OTL T;  4QB4 A;  2R3Z A;  4J6Y A;  1MNE A;  2IWH A;  4KHZ A;  1WQ7 A;  3G7L A;  1HZA A;  3NHH A;  1YEZ A;  5I9P A;  1WFW A;  1PC0 A;  2XVS A;  3VJP A;  5GAN 3;  3A5U A;  5JVG 3;  1NLO C;  1WHL A;  3M0Q A;  4DV7 L;  2BUD A;  1N9S A;  2PNR C;  1M4Z A;  1T0H A;  3CC7 T;  5ELB A;  4F87 A;  4B3S L;  4L5S A;  2VY3 A;  3C12 A;  1QVP A;  3M59 A;  4M78 D;  2E3I A;  2EAY A;  5GAD C;  3CCJ T;  4QQB X;  1VOM A;  1YI2 Q;  2AUJ D;  4C92 A;  2BTT A;  3RKX A;  2KK4 A;  1CZG A;  2EQM A;  4LNP A;  3I3C A;  2RJC A;  3GTM H;  4XU2 A;  3I55 T;  1MIU A;  4M4Z A;  1IGQ A;  3JAM L;  1RTN A;  3OSS C;  1Y0M A;  1B70 B;  1W2B S;  1B9N A;  4RGM A;  4PJO F;  2RHY A;  3SXH A;  1WNL A;  2B63 B;  2NZO A;  1HUN A;  2ABL A;  3AMU A;  3D6W A;  3U4V A;  1Y7X A;  2DXT A;  1KXL A;  3VYG A;  3A54 A;  3G6E Q;  3I4N G;  1SR3 A;  1R9T B;  3O8V A;  4X9D A;  2HKQ B;  4LD9 K;  4A93 H;  3GNF B;  1D1K A;  1MD2 D;  2A6E D;  1I6H B;  3LWH A;  1JB3 A;  1VQ4 A;  2Z1C A;  4I7Z C;  5BN5 A;  1WYX A;  5M3M G;  2JS2 A;  1JWM D;  1TOV A;  1E1O A;  1D0Y A;  2OX7 A;  1LVK A;  2DD5 A;  3P7J A;  5FKA C;  2EE1 A;  4JYA L;  4DK0 A;  3TRE A;  5LJ3 h;  1PD1 A;  1KHC A;  3MP8 A;  3RR6 A;  2XDB A;  1XXG A;  2X69 A;  4WCI A;  2DER A;  3S1N H;  1PZI D;  4A4H A;  1D5M C;  1M3C A;  2B2V A;  2MUY A;  2GFU A;  3EGD A;  4KKU A;  1TY0 A;  3V8L A;  3KXT A;  2EWN A;  4BY1 B;  4FP5 D;  2RQW A;  5HK3 A;  1VQ5 Q;  1SEM A;  3KLS A;  1QW1 A;  5GAN 2;  2F0I A;  4K2L A;  4LF7 Q;  2JZ2 A;  3H3V C;  3NTI A;  1VQ6 Q;  2AT1 B;  3LH0 A;  3M3Y B;  3OYC A;  1K0S A;  2D5D A;  3ASK A;  1PH2 A;  2LQN A;  2CT3 A;  2KOL A;  4F14 A;  3VR4 A;  3UPU A;  2A36 A;  1DOL A;  1F9P A;  5TSS A;  1I8F A;  3A8I E;  3TN2 A;  5BR8 L;  5LJ3 f;  4M7D A;  1WHM A;  3AQQ A;  3S1R B;  3CC4 A;  1K3B C;  5FU7 C;  3BE3 A;  4DV2 L;  2MWO A;  5GAO l;  3JCM Q;  4ELY C;  4LFA L;  1CQF A;  3M9Q A;  5C0X G;  4J1M A;  4JRP A;  1JJG A;  1N32 Q;  1AW7 A;  3T1H L;  3M4Y A;  2N3S A;  3IAY A;  4HJ9 A;  1LAB A;  1XJV A;  1R9T H;  4M77 C;  1K9M C;  1PHJ A;  1V1P B;  1CKO A;  4OMN A;  3MEW A;  2L12 A;  1HNZ Q;  3L2U A;  4HVV A;  4FYD A;  3FKI H;  3HOW B;  1JJ2 S;  2Z0W A;  1PTO C;  4DNT B;  2PZU A;  2BZY A;  1B3Q A;  1X3F A;  3OBW A;  1QP2 A;  4C5H A;  2JS0 A;  3ZYY X;  4X62 L;  2RJD A;  1BB9 A;  4KGX B;  2XTI A;  4A3K H;  3S16 H;  1D09 B;  3Q1J A;  4K8J A;  2F4V L;  1BDO A;  4IUN A;  3MPU B;  1YZ6 A;  1L0W A;  4DFA A;  3KJO A;  3VV0 A;  1UHC A;  5GAH C;  2CWP A;  2UXD L;  3HFN A;  2LS0 1;  2NTS A;  3L0O A;  3X28 B;  2UXB L;  2LJ1 A;  2L89 A;  3I9Q A;  1H3H A;  4E6R A;  2IT1 A;  2K32 A;  2DIL A;  4FW1 A;  5LJ5 f;  1NBW A;  2YTY A;  1IRX A;  2DY7 A;  2HKN A;  1E22 A;  2X9H A;  3HOV H;  1I4P A;  1Q95 G;  2B2T A;  3P1H A;  4BDY A;  4BE0 A;  2M51 A;  3CHB D;  5KRU A;  1Q82 U;  2X4J A;  4GY5 A;  2EGC A;  1GVP A;  2K5N A;  1I94 L;  2EJ9 A;  1JQY D;  4KJN A;  2RA4 A;  2Q2T A;  3HOX B;  2B8G A;  5KYI A;  2HBP A;  4Q5W A;  4HJ7 A;  3HOV G;  2Z8L A;  4M8A A;  1JMC A;  2YUO A;  1I50 H;  1N9R A;  4A4E A;  2DF6 A;  4C92 G;  4JI4 L;  1OU8 A;  3HRU A;  3ND9 A;  3OTO Q;  2O88 A;  1IHZ A;  4DV4 Q;  3M4Q A;  4O6J A;  3P8D A;  2Y90 A;  2QAZ A;  3ME9 A;  3A7L A;  4HJ8 A;  3S17 H;  4DEY A;  1KC8 C;  2WB1 E;  4PMC A;  4LF8 Q;  4E7I A;  3BYY B;  4DR3 L;  1VQL Q;  1YHB A;  2F5T X;  2HSE B;  2A28 A;  3CCR Q;  1A8V A;  2MJ8 A;  5K36 G;  1QJO A;  2E4H A;  2VW9 A;  2O4X B;  1BU1 A;  2KEE A;  1RKN A;  2MCN A;  4LF6 L;  4JI8 L;  4KH0 B;  3K80 C;  1B07 A;  1KC8 U;  3OYY A;  2F2W A;  2JXB A;  2YDL A;  2A68 D;  3OYB A;  1QQJ A;  4F16 A;  2CT4 A;  2AK5 A;  4LUV A;  3FEO A;  4V0B A;  1EYC A;  1Z9Z A;  4DBR A;  3IFT A;  4K5V A;  3DB4 A;  2YRD A;  4L59 A;  3CCS A;  2CZ0 B;  1M27 C;  2E76 C;  4K6D A;  2JXM B;  1XPR A;  2FXQ A;  2KXC A;  4MZM A;  5E3F A;  2E70 A;  1FNV A;  4X64 L;  4A3D H;  4RHS A;  2VGM A;  1QVF P;  4RUG A;  3T16 A;  4RHR A;  4CDD C;  1JB0 E;  1QVG P;  2SEM A;  4C3H B;  4ZN1 A;  2EW3 A;  4IPC A;  1A0I A;  4JRQ A;  1QP3 A;  2HQL A;  3GTO H;  2YT6 A;  2E8G A;  2JM8 A;  4PG3 A;  3RN2 A;  5EG2 A;  4FNF A;  1Y1W B;  1KNE A;  4JVZ A;  2A3L A;  1TS9 A;  1Y14 B;  2DBK A;  1LV9 A;  3A74 A;  1OXU A;  2AKK A;  1GD7 A;  3JV3 A;  1PRT F;  3AB9 A;  2RHI A;  2TMP A;  3HFO A;  2DE0 X;  1X3E A;  4LF9 Q;  2H8H A;  4Q0F A;  2SEB D;  2L11 A;  3AYH B;  1JJ2 A;  1WFQ A;  3R3O A;  4N8F A;  4EIK A;  2A1A A;  4X34 A;  3OYJ A;  3I56 A;  2OTL Q;  1G29 1;  4CKC A;  1QNK A;  4IKF A;  3K5L A;  4WJW A;  1NG2 A;  5IGE A;  3EG9 B;  1J5E Q;  4BD3 A;  2C0I A;  5KYX A;  1YHQ A;  1GBQ A;  1G6Z A;  1AWO A;  1PFN A;  3PQI A;  1I81 A;  4FDB A;  1YJW Q;  1UE9 A;  4QCL A;  2E10 A;  2PZT A;  5IOC A;  3BDO A;  3S1Q H;  2PQW A;  4A54 A;  3HL8 A;  2WSF E;  2F0G A;  4JBJ A;  3C1E A;  1PA6 A;  4OP0 A;  3CC2 A;  2NWM A;  1XWE A;  2J6K A;  2GN5 A;  5D3I B;  1EY5 A;  2KVM A;  1Q46 A;  4A76 A;  4JI3 Q;  4XQ3 A;  2RVL A;  4LDX A;  1XNR L;  2WFW A;  1Q82 R;  1E6G A;  2AZS A;  3EHQ A;  1LTS D;  3H0G G;  1PH9 A;  1C1A A;  4KN7 C;  1K83 H;  2I5L X;  4PL6 A;  2CVR A;  2MGS A;  5AT1 B;  3MA2 B;  1Q86 U;  2PW7 A;  3CF5 A;  1YWO A;  2EJM A;  1MGQ A;  5LJ5 g;  2EKO A;  2UUB Q;  5D6Y A;  4BBS B;  1R0C B;  2JTF A;  3WDN A;  5IGB A;  4CKE A;  1VQ4 T;  1B50 A;  4BDZ A;  1PG5 B;  1XPU A;  2QEJ C;  4A3B G;  1FMK A;  2ES2 A;  4AFZ C;  5KCH A;  3RUZ A;  2C35 B;  2D0O A;  2KQ3 A;  2JTE A;  2O5I C;  1HPC A;  4EQ5 A;  3URY A;  5CKH A;  4NXN Q;  2K5L A;  2IIM A;  4FT2 A;  1ZXT A;  4L5Q A;  2G5D A;  4J9I A;  3E19 A;  2Y0S E;  4C1N I;  2VUM H;  2CP3 A;  1RJT A;  3BY7 A;  1HRJ A;  1I1J A;  3T53 B;  3C2P A;  1BO0 A;  1SE8 A;  3M85 A;  4H44 C;  1HJP A;  4M78 G;  1SBB B;  4N4H A;  4BBR G;  1V1O A;  1D1A A;  2A74 C;  4FU6 A;  3Q24 A;  4DGZ A;  2RHU A;  4M75 G;  4TVR A; 
#chains in the Genus database with same CATH homology
 2O2O A;  3PVQ A;  2O31 A;  2GTO A;  4D8D A;  3M0S A;  4OML A;  1SHG A;  1RUW A;  2LMJ A;  3NPF A;  4JZ4 A;  1WXB A;  3M0U A;  4FSS A;  1QKW A;  1AZG B;  1J3T A;  1UFF A;  2ED0 A;  2F2X A;  1U3O A;  2KT8 A;  4HVU A;  2DNU A;  1H8K A;  2X3W D;  2J6O A;  1JXO A;  3RBB B;  1GCQ A;  2KRO A;  5I22 A;  1GFC A;  2VVK A;  1M30 A;  2KYB A;  2DA9 A;  4OMO A;  3VS3 A;  1MV3 A;  1YNZ A;  1K1Z A;  1IO6 A;  1GRI A;  1PRM C;  4LE9 A;  4OMM A;  4LUE A;  4IIM A;  2ROL A;  1T3S A;  5L23 A;  2CRE A;  1GFD A;  2LQW A;  1OEB A;  2GBQ A;  3ULR B;  1VYT A;  4Z89 A;  2DBM A;  5GJW B;  1PKT A;  2JM9 A;  1PRL C;  2PNI A;  5IHI A;  2A08 A;  4J9C A;  3RNJ A;  1WX6 A;  1T3L A;  4HVW A;  1SRL A;  1X27 A;  1I07 A;  1ZLM A;  2EYZ A;  4OMP A;  2ECZ A;  4AFQ C;  4JZ3 A;  1H92 A;  2NUZ A;  1RI9 A;  2ENM A;  2ED1 A;  3O5Z A;  2KYM A;  4KRT A;  5FWB A;  1AOJ A;  2RQV A;  1JXM A;  1G83 A;  2YUP A;  4J9G A;  1UUE A;  3VS2 A;  1PNJ A;  1QCF A;  1W6X A;  1HSQ A;  3I5R A;  4RTT A;  3NHN A;  3REA B;  2CH4 A;  3QWY A;  1EFN A;  1YCS B;  2RF0 A;  1X2Q A;  1GL5 A;  4Z88 A;  1UG1 A;  1RLP C;  1VYV A;  1E7O A;  2OAW A;  2A37 A;  1V1C A;  3PE0 A;  2JMA A;  4RTV A;  1JEG A;  1JQQ A;  2LJ0 A;  1WA7 A;  3REB B;  2YSQ A;  1NM7 A;  4J9D A;  2EYY A;  2PTK A;  3TVT A;  4HCK A;  1AD5 A;  2F2V A;  1X43 A;  1Z9Q A;  1TUC A;  1UGV A;  2DJQ A;  1U06 A;  3ZL7 C;  2DX1 A;  1YN8 A;  4LUD A;  4OMQ A;  2J05 A;  1I0C A;  4GLM A;  1AWJ A;  2HSP A;  1W70 A;  5IHN A;  3EG0 A;  2DLP A;  4IIO A;  1QWE A;  2VKN A;  2K3B A;  3VS7 A;  4J9H A;  2W10 A;  2DMO A;  2GGR A;  4X1V A;  2B86 A;  4HXJ A;  1UEC A;  3TSZ A;  4ESR A;  2HBW A;  2D8H A;  4ZNX A;  2JW4 A;  4A63 B;  1CKB A;  1OV3 A;  3I35 A;  2KRM A;  2K2M A;  1MUZ A;  4F17 A;  1GCQ C;  1UHF A;  1ZUK A;  1NEG A;  2HEQ A;  2FRW A;  3H41 A;  5FWC A;  3VRY A;  1FYN A;  2DL7 A;  1GCP A;  1HD3 A;  3A98 A;  3GBQ A;  2KT1 A;  4LN2 A;  4Y92 A;  2RNA A;  1WI7 A;  4JJD A;  2L3S A;  3QWX X;  1PKS A;  2C0O A;  3SHW A;  1T0J A;  2FG0 A;  1UJ0 A;  2D8J A;  2FO0 A;  4RTX A;  5IH2 A;  2V1Q A;  1K9A A;  2EQI A;  5IHK A;  1N5Z A;  1WXU A;  2J7I A;  3M0R A;  2L0A A;  4CC2 A;  2RN8 A;  1K76 A;  1PHT A;  1TUD A;  2J06 A;  1VA7 A;  4J9F A;  3SEM A;  2X3X D;  1NLP C;  2K7A A;  1WFW A;  2C0T A;  1NLO C;  1JU5 C;  3M0Q A;  1T0H A;  2DRK A;  1ABQ A;  2QDL A;  1XOV A;  2DL5 A;  4GBQ A;  2AKL A;  1X6G A;  1A0N B;  2DYB A;  2ESW A;  1QLY A;  1W1F A;  2BTT A;  3VRZ A;  1ZBJ A;  4LNP A;  4M4Z A;  2HCK A;  1Y0M A;  4RTW A;  4CC4 B;  2ABL A;  4Z8A A;  2G6F X;  2HDA A;  1E6H A;  2KGT A;  2CH4 W;  4JPB W;  4RTU A;  3VS0 A;  1SSH A;  3M0P A;  1VYU A;  1M3B A;  4D8K A;  1MV0 B;  2W0Z A;  2DVJ A;  1WYX A;  2JS2 A;  2KE9 A;  4AFS C;  2YUQ A;  2KRN A;  2MOX A;  5ECA A;  5HCK A;  1ZSG A;  4WCI A;  1GBR A;  1M3C A;  1UDL A;  4DEX A;  2KXD A;  1ABO A;  2RQW A;  2RMO A;  1SEM A;  1YWP A;  2FPD A;  2DL4 A;  2EYW A;  1KFZ A;  1K0S A;  2LQN A;  2CT3 A;  2RQR A;  4F14 A;  2DRM A;  1X69 A;  2FPF A;  2A36 A;  3UF4 A;  3KFV A;  1ZUU A;  1KIK A;  2K6D A;  1U5S A;  2DM1 A;  1X2K A;  3EG3 A;  1ZUY A;  3U23 A;  1OPL A;  2KR3 A;  1SPK A;  4OMN A;  2L2P A;  1AVZ C;  1CKA A;  1BK2 A;  2J6F A;  2DL3 A;  3M0T A;  5GJV B;  4AG2 C;  4HVV A;  1WXT A;  3EHR A;  4R0K A;  2BZY A;  1M3A A;  1B3Q A;  1QWF A;  2JS0 A;  1ARK A;  2E5K A;  2LCS A;  1BB9 A;  4RTY A;  3UA7 A;  4AFU C;  3EG1 A;  2OJ2 A;  2LX7 A;  2K9G A;  2GNC A;  2EGA A;  1UHC A;  4K11 A;  3VS4 A;  2GQI A;  2LJ1 A;  3I9Q A;  1H3H A;  4JJC A;  4E6R A;  2DIL A;  2CSQ A;  1M8M A;  2V1R A;  2ROT A;  1ZX6 A;  2M51 A;  2JT4 A;  2EGC A;  4J9B A;  4JJB A;  2EBP A;  2YUO A;  2I0N A;  2DF6 A;  2O88 A;  2CUB A;  1LCK A;  2OI3 A;  1WDX A;  3VS6 A;  4DEY A;  3THK A;  1NEB A;  5EC7 A;  1TG0 A;  2EKH A;  1JO8 A;  2CDT A;  1AZE A;  3H0I A;  2A28 A;  4AG1 C;  1BU1 A;  2MCN A;  1AWX A;  1QKX A;  1B07 A;  2D1X A;  4QT7 A;  2F2W A;  2XMF A;  2JXB A;  2YDL A;  4CC3 A;  4RTZ A;  1NYG A;  4F16 A;  2CT4 A;  2AK5 A;  1WIE A;  1Z9Z A;  3LH5 A;  3TSW A;  1AEY A;  2PZ1 A;  1M27 C;  2MIO A;  2KEA A;  1BBZ A;  1K4U S;  2KXC A;  2EGE A;  4RUG A;  2FEI A;  2SEM A;  2CUD A;  3EGU A;  2EW3 A;  2GTJ A;  3FJ5 A;  3VS5 A;  5IXF A;  2YT6 A;  2JM8 A;  5IXB A;  1Y57 A;  2DL8 A;  2L3Q A;  2DBK A;  2AKK A;  1CSK A;  3JV3 A;  1OOT A;  2O9S A;  3IQL A;  2LP5 A;  2CSI A;  2DE0 X;  2EPD A;  2D0N A;  2H8H A;  3EG2 A;  2P4R A;  2RQT A;  2LNH B;  4EIK A;  1G2B A;  1UJY A;  2AZV A;  1HJD A;  3H0F A;  2BZ8 A;  2KRS A;  3UAT A;  1NG2 A;  1S1N A;  2M0Y A;  2LZ6 B;  2C0I A;  1GBQ A;  4J9E A;  2RPN A;  1AWO A;  5FW9 A;  5I11 A;  1UE9 A;  4ORZ A;  2LJ3 A;  3R6N A;  1SRM A;  2FPE A;  1KJW A;  2NWM A;  2J6K A;  3CQT A;  2L3P A;  2O9V A;  2RQU A;  4CC7 A;  1E6G A;  2AZS A;  3EHQ A;  1RLQ C;  1X6B A;  1YWO A;  1OPK A;  2EYX A;  1KSW A;  2BZX A;  1WLP B;  3PVL A;  3UA6 A;  2KNB B;  1UTI A;  1YP5 A;  3VS1 A;  3NMZ C;  2JMC A;  1FMK A;  2YUN A;  4AFZ C;  1NYF A;  2JTE A;  1PWT A;  3C0C A;  2EVR A;  2IIM A;  1K0X A;  4J9I A;  2VWF A;  3H0H A;  1AWW A;  2KBT A;  1I1J A;  2K79 A;  3NGP A;  2SRC A;  1SHF A;  3I5S A;  2FRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...