4JPBW

The structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
140
Chain Sequence
LKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.2 angstrom resolution structure of a receptor: CheA:CheW signaling complex defines overlapping binding sites and key residue interactions within bacterial chemosensory arrays.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Immune system
molecule keywords Chemotaxis protein CheA
total genus 28
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jpbW01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 4jpbW02
2XMFA 4J9HA 2J6FA 1QWFA 4QT7A 1SHFA 2A37A 1JXOA 2PNIA 3VRYA 2LCSA 1T3SA 1K76A 4J9EA 2EYXA 3VS1A 2EVRA 3QWXX 2PZ1A 3GBQA 2EYYA 2K79A 2J06A 4K11A 4ESRA 1U3OA 4JJCA 1BBZA 4EIKA 3TSWA 3LH5A 2A36A 4CC3A 1GCPA 1JXMA 2AZVA 1ZSGA 2CSIA 4IIOA 2EYZA 3EGUA 1XOVA 4Z88A 4A63B 1T0HA 1G2BA 2JMAA 2K2MA 4HXJA 2B86A 1TUDA 2X3XD 1TUCA 1JU5C 3EG0A 2CSQA 1AWWA 1KFZA 1UTIA 1WLPB 1NLOC 2PTKA 3UATA 2QDLA 2CT4A 1AWJA 2LX7A 1RLQC 2RN8A 2GTOA 2DL5A 4AG1C 1WFWA 2RQWA 2JS2A 3M0RA 2CH4A 1AOJA 2DL4A 1UE9A 1V1CA 4RTXA 2V1QA 1ARKA 3A98A 3CQTA 3JV3A 4OMQA 4AFQC 1WIEA 2EW3A 4J9CA 1ZBJA 1WX6A 2DE0X 1UJ0A 1K0SA 2O88A 4LUEA 1GRIA 2OAWA 3M0SA 1CKAA 2VVKA 1ZUUA 2EPDA 2G6FX 2HSPA 5I11A 1PRMC 4J9IA 1I0CA 2E5KA 3SEMA 1X27A 1Z9ZA 4M4ZA 2YUPA 1GCQC 2YUNA 1H8KA 2BTTA 3QWYA 2L3QA 1OV3A 1LCKA 2ABLA 2EKHA 1E7OA 2RQVA 2GTJA 5IXFA 1NG2A 1VA7A 4AG2C 3H0FA 1AWOA 1Y57A 1M3BA 2J6KA 1GL5A 1NM7A 1W1FA 1JEGA 3VS3A 4D8KA 2LJ3A 1KSWA 4FSSA 1HSQA 2C0OA 5FWCA 2ED1A 3R6NA 1PKTA 1UGVA 1UHCA 4AFZC 1WI7A 2DMOA 1K9AA 2FRYA 1K0XA 2KE9A 2V1RA 2GQIA 4HVUA 4R0KA 2HEQA 1RUWA 2JW4A 2JM8A 2DRKA 2RMOA 1A0NB 1M3AA 1EFNA 2I0NA 3PVLA 2KR3A 2FPEA 2CREA 3EG3A 4RTUA 3THKA 1GFDA 5FW9A 2J05A 2DNUA 1Y0MA 4JZ4A 2DVJA 3M0TA 2DL7A 2AK5A 2KRSA 2FO0A 2RF0A 1SEMA 3NPFA 2F2WA 2P4RA 3H0IA 4Z8AA 2DYBA 4Z89A 2JTEA 1AD5A 2KT8A 1AZEA 1Z9QA 4IIMA 1MV3A 2JM9A 2W10A 4F14A 2K7AA 1AEYA 3UA6A 1SPKA 1BU1A 2DLPA 2KT1A 2O9SA 3VS6A 2FEIA 2NWMA 2YSQA 2KROA 2LP5A 2LQWA 2EQIA 4KRTA 2ED0A 3IQLA 1CKBA 2K3BA 2DJQA 2M0YA 4LNPA 1VYUA 2RQUA 2FPFA 2MIOA 3VS2A 2DA9A 1PRLC 1GBQA 1N5ZA 4RTZA 2DBMA 2YUOA 1ZLMA 4HVWA 1GCQA 1WXBA 3I9QA 1QLYA 1M30A 2A08A 1ABQA 3NMZC 4J9FA 1UDLA 1ZUKA 2L2PA 3KFVA 2JXBA 3RBBB 2K9GA 3NGPA 1B07A 2FG0A 1TG0A 2GGRA 2LJ1A 4JZ3A 1UJYA 3VS4A 2JMCA 3VS5A 1K4US 3EG2A 4J9BA 1HD3A 2ENMA 3I5SA 1BK2A 4ZNXA 1AZGB 2OJ2A 4JJDA 2A28A 4OMNA 3ULRB 1X43A 2H8HA 2DILA 2HDAA 1PWTA 1OPKA 3REBB 2L0AA 1GFCA 1X2KA 2CT3A 4OMPA 1ZUYA 1SRLA 2DM1A 2KXDA 4CC4B 2KRMA 2D0NA 4F16A 2KYBA 1NYGA 3O5ZA 1UECA 1X2QA 1QKXA 2KYMA 2RQRA 3C0CA 1UHFA 2K6DA 1NYFA 1G83A 4OMOA 2YT6A 2FRWA 2SEMA 1KJWA 2CUDA 2OI3A 1PNJA 5EC7A 2RQTA 3PVQA 2ROTA 1AVZC 1PKSA 2DBKA 2EGAA 5ECAA 2GNCA 5HCKA 2BZYA 1SHGA 2F2XA 4DEYA 2BZXA 2J6OA 2NUZA 2C0IA 3U23A 1QCFA 1I1JA 2MOXA 1E6HA 1S1NA 1YCSB 1FMKA 2LMJA 1M8MA 1RLPC 1W6XA 2L3SA 2ECZA 2JS0A 2LZ6B 2KRNA 2RNAA 2LNHB 1YP5A 2F2VA 1PHTA 1T3LA 1UFFA 2KGTA 2VWFA 4GLMA 1UG1A 1H92A 1WDXA 1ABOA 4LN2A 1YN8A 2J7IA 1T0JA 4LUDA 5IHKA 4GBQA 2DL8A 2C0TA 4OMMA 1JO8A 2RPNA 1X6BA 4CC2A 1MV0B 4HCKA 4E6RA 2AZSA 1WXUA 2DF6A 3M0UA 2D8JA 4RTVA 4D8DA 3EG1A 1YWOA 5IXBA 1UUEA 2CUBA 1B3QA 3NHNA 1YNZA 1J3TA 4DEXA 4LE9A 5GJWB 4CC7A 1GBRA 1OOTA 4X1VA 2X3WD 3EHRA 1VYTA 3TVTA 3H0HA 1RI9A 2D8HA 2M51A 4J9GA 2KEAA 4F17A 1CSKA 1ZX6A 1WXTA 1VYVA 2DRMA 3SHWA 1X6GA 1U5SA 4OMLA 5IHIA 1QWEA 4ORZA 5L23A 3I5RA 2KXCA 4WCIA 1BB9A 2GBQA 3PE0A 4RTTA 1K1ZA 5FWBA 2L3PA 1NLPC 3REAB 2HCKA 3M0PA 1AWXA 2DL3A 2O31A 2LJ0A 4RTYA 1W70A 4AFSC 3FJ5A 2KNBB 2MCNA 2ROLA 4J9DA 1WYXA 3UF4A 5IHNA 5I22A 1JQQA 2EGCA 1KIKA 2BZ8A 1X69A 4JJBA 4JPBW 1I07A 1WA7A 2W0ZA 1SSHA 2O9VA 2KBTA 1OPLA 2YDLA 1SRMA 2SRCA 2EYWA 3M0QA 3H41A 2IIMA 3TSZA 4AFUC 2EGEA 2FPDA 1E6GA 3VS0A 3UA7A 1OEBA 1NEBA 1IO6A 3ZL7C 4HVVA 1HJDA 4RTWA 2AKLA 1NEGA 3I35A 5IH2A 2CDTA 3EHQA 2CH4W 4RUGA 1H3HA 1FYNA 1MUZA 5GJVB 3VS7A 1YWPA 1M27C 1U06A 4Y92A 2EBPA 2DX1A 3VRZA 2HBWA 3RNJA 2ESWA 2YUQA 2JT4A 2D1XA 2AKKA 2O2OA 1M3CA 2LQNA 2VKNA 1QKWA
chains in the Genus database with same CATH superfamily
5A2QE 1KC8C 3GV3A 2Y0SE 5CCAA 2NLUA 4GKJL 4J9HA 4BBRG 1O7ZA 5T1IA 5C4JB 3VDYA 2OT2A 4LK1C 1Q12A 2ALYB 1Y8NB 4M75B 3CCET 1SHFA 4M1UB 2A37A 2RI3A 3P8BB 5IE8A 5IP9G 2AHJB 1YI2A 5CORA 4X66L 2LCSA 1N33L 1K76A 2M9UA 1KQ1A 2EYXA 4J9EA 3VS1A 3QWXX 1CZGA 1Q46A 1XYIA 2PVDB 2PZ1A 1VQ8Q 3GQBA 3CCRQ 2L5TA 1QVGP 1F9QA 2HSEB 2EYYA 2F0SA 3M4OB 4DV6L 2CCZA 2VL6A 4ESRA 3HRUA 1KDAA 1D8LA 1I4HA 1Q3LA 1U3OA 1XNRL 3H6ZA 3I3CA 1WD0A 1ASZA 4EIKA 1UE7A 1IRXA 2ATCB 4M75F 1D5XC 3LH5A 4KHZA 2A36A 1Y71A 1Q1BA 1TUGB 4M7AA 1IXDA 4RGOS 4A3BG 3OWFA 1XNQQ 1G6PA 2HHHL 1N36Q 1ZSGA 1Y1VG 1DYQA 5GAOn 2Y0SG 2OTLQ 2E3IA 1NJIC 4KGZB 1STNA 1RABB 4II1A 2JMAA 1Y1WH 1PG5B 4RMOA 1B34A 3P1HA 4KH1B 2K01A 4DV7L 1Q1EA 4F7UF 1Q82C 2X3XD 4M7AD 3LWEA 1TUCA 1KQSP 4DR6L 4MDXA 3SE0A 4IOAA 1JU5C 1QILA 4LJZC 1FMWA 1WLPB 3CMET 2CP7A 2PTKA 1HZCA 1AH9A 2CT4A 3RUXA 1H641 1NSNS 4A3MG 3GTKB 2LX7A 1Q82U 1RLQC 1PZKD 2GTOA 4DF7A 2L3RA 3J81i 4WORA 4LF4L 3H9NA 2EYQA 1PTOF 1ZEQX 3NFCA 3BU2A 4QQ6A 1OU9A 1E0BA 2XSCA 5DM73 5KNBA 5M5YB 3S3OA 3E2UA 1RODA 4EGVA 3SWNB 3JB9H 5AJ3Q 1S40A 4XT1B 5F2DA 2DL4A 2VQEL 1V1CA 2PQAB 3A8KE 4GNXA 4NXMQ 1EQVA 5D3DA 2V8IA 3OYDA 2EJMA 2B2TA 1QMCA 2EW3A 1LABA 4YY3Q 4B3ML 4NL3A 2VB3X 1K73R 1UGPB 1JORA 4IPHA 4LUEA 1GRIA 5HK0A 3C46A 2OAWA 5EAYA 3TCJA 5FROA 3URGA 4DV4Q 2R58A 3CCST 1I81A 2VVKA 1D5ZC 1YNJD 3T51B 1N27A 2YRVA 4XXEA 2E2JH 1J5EL 1PH2A 1NE3A 3SEMA 4OGEA 3VJPA 4BI8B 1DJRD 1Z9ZA 2E70A 2K14A 4EMGA 2RQXA 1BBXC 5KE2A 1I5OB 2DN8A 4OB2B 2IHEA 1I94L 4HCSA 2ZPGB 1OU8A 2COYA 3QWYA 1R9TH 5COYA 1C6VX 4RA8A 5C5LA 4QVZA 1M90U 3DEPA 1EZ8A 4LF7L 1E7OA 3AEVA 2RQVA 1ZSZB 2GTJA 4PNOA 1OZ3A 3VYGA 3C1EA 4L5QA 5M5XH 1VA7A 1D5MC 3FLGA 2JE6I 2M16A 4FSXA 5EBCA 5IN1A 1TS4A 1IBKL 5D7UA 3CCJA 1NM7A 1YJNA 2E75C 1OI1A 1S72A 4PJJA 1CKOA 3CP0A 4IN3A 4Q5VA 3VYSA 2LJ3A 2JA5H 1QZHA 5IWAL 3DWPA 4MHEA 4C3HB 2C5CA 1HSQA 2GQVA 2NVXH 3CBMA 1NBWA 2XU8A 1CSQA 3J80c 1K83B 3HZXA 3MEHA 2ZPBB 3OYCA 4A3EB 1MMAA 1FGUA 3ZBDA 4AFZC 4IFDI 2L0CA 3CCLT 1KIXA 2DMOA 1K9AA 3KF6A 1E22A 2QGGA 2Z6BA 3TQYA 1MNDA 2F0OA 4L5TA 1NR2A 5IODA 2HEQA 4IUQA 2EAYA 2KK4A 4CI0C 1Y8OB 5JPNC 5KYIA 4DV5L 4FNFA 1W2BP 1KNAA 1BBWA 2MMPA 4BY7H 4M78A 4N4HA 4HCCA 2CP5A 2ZXRA 3PUZA 4C8QC 2YU9B 4OHJA 5I4DA 1HNXQ 4C8QD 4LFBL 1I50H 2XTIA 3DWAA 3PVLA 3G4SQ 4KUDK 1K8OA 2CREA 3EG3A 2E2IH 2BA0A 1VQFA 4NXNL 4X6AH 2DVJA 1AFPA 1HFNA 4E7LA 3H0GG 4A93G 2DL7A 1WTPA 4HT8A 3S2HB 1IHVA 2AK5A 1G6ZA 1QVFS 2WAQB 1SEMA 1H95A 2KJXA 1V1OA 1IBKQ 4BDZA 2BE5D 1FWZA 2MAMA 3PO2H 1H9JA 1SMXA 4RCCA 1WHHA 4Z89A 2JTEA 4FF1A 2DD5A 1AZEA 3LWUA 4RAUC 2TMPA 1PA6A 2HL5C 5GANg 2K7AA 2XI9A 1I6VC 4LF7Q 1WZOA 3FPPA 2PQEA 4GKJQ 2COWA 1YIJT 4PV1C 1U4LA 2ZPEB 2HQEA 1S5DD 1VQKT 2R93H 4QQDA 2NWMA 3T9NA 4YCWA 2MF2A 3M58A 3HOUG 1N32Q 5KCHA 1AN8A 2KROA 1Y1VB 2J0TD 4JI7Q 1IBLQ 2EQIA 4KRTA 4XAXB 3Q8DA 5LJ3j 3IQLA 3PCOB 1WTQA 3CMAA 4PJOA 5JJLA 5GAMh 1KC8R 2DJQA 3GNFB 4ILWA 3PIO3 1B34B 3TREA 1K8GA 4PLIA 3MXUA 4ZAIA 4XTZA 1CHPD 1ONLA 2SOBA 3OTOQ 5EBDA 2DA9A 1PTOD 1EY5A 3HRZC 1PRLC 1GBQA 2AUKA 1LT5D 2YRCA 3S15B 5DM63 4GLVB 2V4DA 4KN4C 1Q86R 1OYXA 4HVWA 2DNEA 1WXBA 1FGBD 2Z0WA 2BDOA 3T56B 3WOEA 4HIDA 3ME9A 1Q86C 1SJHD 3H3VC 4J83A 1VQKA 1BOSA 1F9PA 2F4VQ 1GUWA 3KFVA 2RH2A 1ZKOA 2HQXA 4JRIA 3NGPA 3PO2B 2CZ7B 2DETA 4JOIA 4BWGB 4DR2L 1QVGA 1G51A 3G71A 2R6GA 4O2DA 1PM3A 1PRTD 3EFOB 4A3FB 3O13A 3F2CA 2RKSA 3VS5A 3TEHB 1K4US 1DCZA 2XWJB 3M4QA 3EG2A 3NWTA 4N4IA 5IT9L 3E9GA 4QKUA 4BI3A 3CD6A 4GNXC 2HCCA 1JJ2P 3A8HB 3A55A 1AZGB 2IJ0A 2OJ2A 2DJGC 1VQMT 1HPCA 2YU9H 1SMYD 3DMUA 4IFDG 1NUCA 2K50A 1PZID 2PW7A 5JJZA 3EROA 2A6HD 4KLKA 1VQ4A 4OMNA 1VQNA 2QW7A 4RKLA 2B29A 4JS5A 1DM0B 4B3SL 2H8HA 3BDCA 1SFOH 3FPUB 3TSSA 3REBB 5ELOA 3OMGA 5I9OA 4X64L 3RR6A 1QVFP 4G57A 5FO9B 3OTOL 3GTQB 3EJIA 4EQ5A 2KXDA 4CC4B 1EIGA 2HT1A 2K5VA 4A3EH 3UE1A 4E7IA 4HTHA 3OHXC 3BG3A 4PJOC 4ZRZA 5GMKi 4A4HA 2E12A 3QR8A 4GLAC 2NUPB 3HKSA 4DR3Q 4XQ3A 4D6WA 1N33Q 3E19A 4FYYB 2KYMA 4OWWB 1A3TA 1D1IA 2C35B 4X3KA 4JBKA 1VQ5T 4UPAA 2KVQG 3F2UA 5CC4A 4I7AA 1IYJB 2K6DA 1NYFA 4M7DC 1WYDA 1HHVA 1A0IA 3P20A 2EJGC 3PIPA 3S1NB 2LNVA 1PH9A 3SEBA 5LJ5d 2JA8G 4DBFA 4DUZQ 4PZ6A 5HKCA 3OBYA 2JXMB 2SEMA 1NPPA 1E1OA 3W5OA 5JAVA 2SNSA 3CCRT 1ZYRC 3I2ZA 2IY5B 1PNJA 2CFMA 1Z47A 2TSSA 4M77C 2ROTA 2PMZB 3G6ET 4OWXB 3F70A 5C0XH 3G1JA 1Q95G 1SE2A 2WP8J 1CQVA 2ZTDA 3MO8A 1YJNQ 1WFQA 3GTMH 3WOFA 2M0OA 1EIFA 1YIJA 2IHFA 2BKDN 3NE5B 4IJHA 5LL6X 3RD4A 2MOXA 1E6HA 2VQFL 2LFNA 4NXNQ 2WIIB 3I90A 3MEAA 4ZCKA 3TP8A 5LJ3g 5J22A 2EWNA 2LMJA 3JAMc 1N34L 1CHQD 2R92B 2A1AA 4LF9L 4C0DB 1N8RR 3K0XA 2R92H 3H0GH 2ECZA 1W6XA 2L3SA 2VUMG 2EYHA 2KRNA 2LZ6B 1QP3A 2L12A 3RZDH 3HOVB 1VQ8T 4KT0E 2K5DA 2ZJRA 3S2DB 3N6RA 2MWOA 9ATCB 3V96A 3A54A 1PSEA 3CC2T 4C8QA 3MA2B 5C3EB 3E9IA 2B2WC 2EQJA 5T1GA 1QCOA 4H02A 1BI3A 2BH2A 2NVYB 4O0AA 3TN2A 4DK3C 1BCPB 1H92A 3D8GA 2IX1A 1RACB 1MD2D 2BOSA 4XYQA 4LF9Q 3QO2A 2Q2UA 1T0JA 4AT1B 1M1KC 1XWEA 4GBQA 3EFXD 4MIUA 4QIWE 4A75A 4KTAA 3DM3A 4FCYA 1JJ2A 1ENCA 2C9OA 2SDFA 4LFAL 1I6HH 1X6BA 3CMAT 3FEOA 3A8LB 1LTSD 4TSSA 4KY5A 4A3LG 2PW5A 1VQPT 1P16A 1VIFA 2N55A 3GTJH 1WTOA 5IOCA 3OW7A 2BE9B 2FB7A 3JB9D 5J39A 3MC0B 1WXUA 1K9MR 3OYLA 3J7AV 2D8JA 4D8DA 5E3FA 4LF8Q 2OTLA 3SK6A 4PQXA 5J26A 4NS5A 2YTYA 1YWOA 4KI0A 1VQOT 1YBYA 2QA4A 1EY9A 1BDOA 5FLXE 1VF5C 1I94Q 3FDTA 3E0JA 2EQSA 5GAOr 2EY6A 1HYOA 1EL0A 2RHQB 1YJWA 3CPWA 3L42A 4CDCC 2NUPA 4YTLA 1LUZA 2R61A 1J3TA 3A7AB 4EQNA 4ELYC 2RCNA 1GBRA 4DV4L 1C0AA 1XMQL 4A54A 2E64A 2DD4A 2P4TA 4P71A 2X3WD 1VQ6T 3CMAQ 3QDFA 3EHRA 2X35A 2MHVA 3MFYA 1JICA 4N0AC 2D8HA 3OS5A 4J8QA 5GAMg 2M51A 2OTLT 4X3UA 3V7RA 2DUDA 3CD6Q 5C4ZA 5GAHC 2ZPFB 4J5YA 4FYDA 2JJQA 2B2TC 4DKAC 1XX8A 1WXTA 1BIBA 1X6GA 2P0KA 1SROA 2AWOA 5IHIA 3OIQA 1BCOA 2NB0A 4XTVA 4ORZA 2MUYA 2PI2A 5IYBH 3I5RA 3E3XA 4ME3A 4WCIA 1K3BC 3M7NA 1PRTB 3VYRA 4A3JB 3GTPH 1BB9A 4VUBA 3SD4A 2OX7A 2Y4YA 4E7HA 2I5HA 2MPXC 2GBQA 1OXXK 2P5ZX 3PE0A 4RTTA 5CV9A 3I8ZA 3F2BA 3MEVA 2BCOA 2L3PA 1NLPC 4C0ZA 1Y69U 1XTDA 5A0LA 1EOTA 2GFAA 1A63A 4RKBA 2EYJA 1YI2T 1S5BD 2DFUA 1CZWA 4OO1I 2NYZD 2QEXT 1JOQA 2QTXA 3SDZA 2EQKA 2FYKA 5IHNA 5I22A 2GVBA 4J15A 2B8AA 3CMEA 5DNFA 2BZ8A 3GLXA 4M77G 2FJ2A 2RJFA 1TKWB 1Y1VH 3KJPA 3Q23A 1UE6A 2YDLA 5GAN5 1BQQT 1YJ9T 2EYWA 1N8RC 1CQFA 5M5WH 2QYZA 3M0QA 3PF4A 3TSZA 1T5EA 1MSGA 4F7XA 1S4ZA 1L0XB 2PYKA 2RI5A 2RA2A 1C4QA 5C4XH 1NEBA 3S9WA 1I5LA 3C4SA 4RG8A 3S17H 1I4PA 3CCVT 2NVYH 3PGGA 4NP5A 1HJDA 2RM4A 4B9XA 2P84A 2EJFA 4FYWB 1IW7D 5ISRA 2UUAQ 2CDTA 3S6WA 1EYCA 2CHBD 1AW7A 1H3HA 4X9CA 3T16A 4DNRB 3NBIA 4LUVA 1LT6D 1N9WA 2EY1A 1M1KR 1OXVA 5GAN4 4B9WA 3HOVH 4JI2Q 1OULA 4KHVA 1M27C 4KHPL 2F03A 2AUJD 3D7SB 4XU1A 4R9WA 2E2IB 2RHUA 3UPUA 4UC4A 4C0FA 2YUQA 3L3OC 3M3YB 3CCEA 3H91A 1GUGA 4A4EA 4DV2L 3OYEA 1VQMA 4BA2I 4BB7A 1Q81R 3CC2A 2DTHA 1KDCA 3A8IE 1VQ7A 2K52A 4PJOF 2PZWA 2RDGA 2A6EC 1Q7YU 3KYHC 3KFUA 1PMRA 3AMUA 1SBBB 1WHMA 1F77A 1G291 1NR4A 2D9TA 3MHXA 3HFZB 4JI1Q 1JXOA 3C2PA 3KOJA 4A93H 3VRYA 1VQ4T 1WNLA 1Q86U 2NZHA 4ME7A 2RB6A 3JCMd 1IHZA 4KKSA 1MHNA 3NENA 5GAMj 5C6SA 2PUKB 3QG1A 8ATCB 1A2UA 2K4KA 2X9HA 5L8RE 2K79A 2K1BA 1QNUA 5I9PA 2D0OA 3JAML 4OONA 1TS5A 4K11A 2ZM6Q 1HXDA 3PT9A 1NE8A 1FR3A 2QA4Q 1SN8A 4UHVA 1BBZA 1U4PA 4K0KL 1AZQA 3M9QA 2NN6G 3NUCA 3H3VI 1HR0Q 1LOJA 4XU0A 4CC3A 2RHSB 4X65Q 1EIHA 2AZVA 4WF2A 2VQFQ 1G91A 4BUGA 1V29B 2EYZA 3LWIA 3OB9A 1SYFA 2RI2A 1XOVA 4DQ2A 4Z88A 4LW1A 1T0HA 4RCNA 4CKEA 4X3SA 2K2MA 5EKIA 1JRIA 4RHRA 3K5OA 4RMFA 2VV5A 5CKDA 5LL6S 1WD1A 3SXHA 1MSHA 1PHJA 2OTJA 2F0PA 3RMSA 3G6JB 4KD3A 2D0QB 3BZKA 1FXXA 1AWWA 1TU0B 4BD3A 2OCEA 2DTOA 4DGZA 4QMGA 3J81L 3ICEA 4DR4Q 1NLOC 1VOMA 2QDLA 2F0KA 2IT1A 2ICIA 1W4SA 1GO3E 1D1CA 3CCMT 2QKIC 3S14B 3S1MB 3P8DA 2EJGA 2HMAA 1YNND 4GLKA 2K04A 1K8AR 5E4WC 3V05A 2QQRA 2VASA 4PFZA 2RQWA 3D31A 3JB9I 2RD1A 2HKNA 1SSOA 3MCAB 2QAZA 4ZLTF 3VA5A 1EY4A 2IX3A 3Q0AA 3KXTA 4TRDA 5LJ5h 5FLXL 3JV3A 1HZ9A 3KJOA 4M75D 2OTJT 3NP8A 3OBWA 4M75C 1PZJD 4Z9CB 5A35A 5C44H 2FVUA 4HAEA 4A3GG 5GAN3 4AYBG 1N34Q 4LF5Q 4A4KA 1NZ9A 1RAFB 3LGLA 1ZA2B 3M0SA 3HP9A 2DERA 2CQAA 3CAMA 3EQLC 3HOXB 2PO4A 2YXYA 3T1YQ 1ZUUA 1CA5A 3EG9A 3NQTA 1PRMC 4IUPA 3KDFB 5C0XJ 1ILQA 3MAQA 1X27A 3PUVA 3R8BA 4M4ZA 1VQLT 1I4XA 4L63B 2D6FA 2YUNA 4XYOA 4M78B 1LNXA 4FVMA 3KF8A 1EQQA 1UUPA 1S5ED 5GAOl 2X69A 3QHSA 4R1JA 5E1FA 2QCPX 5GAN2 2I07B 2DNCA 1LCKA 3GV6A 3ITPA 3MXNA 3CQZB 4C92F 4QY7A 2VXWA 3CXCA 4H44C 4UY8C 3JAME 4DNTB 1EU4A 4C92C 2I0QA 3AHUA 2CZ6B 3HHTB 4A53A 2LQ8A 1U4RA 2B2VA 3H0FA 1AWOA 4RGTA 1Y57A 1M3BA 2J6KA 3L2WA 4B3TL 5IT9E 3SK8A 2YRDA 1W1FA 1EEID 1VQ6A 2IW3A 2R5AA 2JA5G 2F4VL 4M7AB 4JBWA 1KSWA 1CI3M 2C06A 2QQSA 5FWCA 1XNQL 3CCLA 2EYFA 4IALA 1M4ZA 3BZCA 3LX0A 4RGMA 3R6NA 3M5AA 4C92G 1HXYD 1UE1A 1UGVA 2PI2E 8AT1B 3HOVG 5FKAC 1K8AC 1WI7A 3G4SA 1SMYC 4DXFA 4R8IA 2QA4T 4JRPA 1EY6A 2R7ZB 4DAPA 2GQIA 4HVUA 4R0KA 1VQCA 3OW2A 1B7YB 1RUWA 2JW4A 4OB3B 1UEAB 4O6JA 2XN9C 2RMOA 5CIUA 5GQOA 5GMKj 3MKDA 1VQKQ 5GAMe 1M3AA 3RLFA 2CW0D 5LMUL 1PD0A 5C3EH 1EFNA 3E0EA 4R4TA 2FPEA 1WVLA 1GFDA 1FVIA 4R4CA 1A2TA 1JBMA 2J05A 4OP0A 1I3QB 3S16B 2DNUA 2B8FA 3KLWA 2ZPIB 2NTTA 3M0TA 2KQWA 4M7AC 4F8MA 1X6OA 5KYNA 1KQSA 2EYMA 3LWHA 4TVRA 4ID6A 2KRSA 1UGSB 2ES2A 2MYSA 4MZMA 1X56A 4EMKB 2WB1B 3FVQA 3JB9J 4MZ9A 3UDFA 2F2WA 1F2LA 4MZPA 3H0IA 4Z8AA 3FP9A 2DYBA 4JG2A 3J81c 3CCSA 3SVMA 2PVOB 2JA7B 1CKNA 3A5UA 4XQJA 4A3JG 1STYA 4F14A 3RZOB 3JSCA 1ENFA 3UA6A 2LC4A 3CKIB 1BU1A 1VQMQ 2DLPA 1I4QA 2KT1A 2O9SA 2R5MA 2IL8A 1G8XA 2DJZA 2WSFE 4IFDJ 1S5CD 1AHJB 1C48A 2D9UA 1JMCA 3JCMb 1QB5D 2F3VA 2ZXPA 5D6XA 3IRBA 3E9FA 3NHHA 4RFBA 3JC66 3L7ZC 3GIBA 1SNDA 4J8OA 2RBMA 5ELCA 1FL0A 3AFQA 3D4RA 1CKBA 3DLLA 1EQRA 1PYBA 2HNIA 3PMIA 1IBLL 3HOZB 3OA6A 2HDMA 3VYTA 3URYA 2XG8D 5LMNL 2FHDA 2FPFA 4PJOB 1VS0A 1UWVA 3HOZH 2MIOA 1SYDA 4PMBA 4IUTA 3DM1A 4E7SA 2UXCQ 2OQKA 2X4WA 2CYZB 5GMKm 1LTRD 2RJEA 1LTTD 2DBMA 3I4MH 1IREB 1L0YB 2YUOA 5C4XB 4A3KH 1GCQA 1STEA 4KKUA 1BXTA 4OX9L 1QLYA 2MPMA 2XHCA 2LT1A 3CCVQ 2M9VA 4FYXB 1ZUKA 4Z02A 2L2PA 4XU3A 1NMFA 1ZYRD 1RAAB 2H3JA 5CR2A 2A74C 2MJ8A 2PQWA 4H7BA 1J6QA 4KY7A 4HJ7A 2K9GA 3ZYYX 5LMUQ 1W6JA 3MHBA 1TG0A 2GGRA 2JOYA 4JZ3A 3MVVA 4NKLA 5HURA 1R0CB 1GVPA 5I21A 1EYGA 3M4GA 1TOVA 2JMCA 4M75G 4HIOA 4KMUC 4U68A 3BY7A 2ENMA 1WTXA 4JV5Q 3OYFA 4XQQA 3K5LA 4NL2A 4ZN1A 2XDDA 4G7HC 4LDWA 2Y4XA 1KK7A 4Y7NB 2DKGA 4PG3A 2A28A 3OPOA 2X4YA 2AIRB 2WACA 4HA8A 3SB2A 4O5VA 1ZHIA 2DILA 2QGFB 1PWTA 1YNXA 2LXKA 3QYHB 4RHSA 2L0AA 1H3ZA 1LTLA 2E10A 4KN7C 4JDSA 2KENA 4DV0L 1GUNA 5GAN6 1M1KU 1TWBA 2D0PA 4JI8Q 3VV0A 2DM1A 4NB3A 2OXPA 4NW2A 3HL8A 4JLIA 5KYYA 1M4VA 1KQ2A 4PJLA 1LYLA 1PH4A 4PJNA 1E2ZA 1VQGA 4A4IA 4F16A 2O01E 2XICA 1VQ6Q 1NYGA 1QJOA 3LNNA 2RCFA 4OL7A 4NXML 3RMHA 1P92A 5DLQE 3J7YW 1LV9A 2QF7A 4JVZA 3U9OA 4PKCC 1UHFA 1EEFD 5IYCH 1IKMA 1B3AA 3OYYA 2ATWA 4KV6A 3UDCA 5CV5A 1CM9A 2FZGB 4HMIA 2DTIA 3EGXA 2EIFA 4QQGA 3E1SA 1VQ5A 2VS1A 3VR5A 5M3FH 4CGYB 5ELFA 3T1YL 1WHGA 1CSPA 1BBUA 3LX7A 4B08A 1TWGH 4JRQA 3K81C 2DXUA 2VYTA 2K3XA 1YIJQ 2F0DA 1EZ6A 2B2UA 4FM4B 4L5GA 4XTUA 2BH8A 5C4XG 1EUJA 3M4PA 2RQTA 3PVQA 4KH0B 2DBKA 3KF8B 1RD9D 3AU7A 3HKZG 1KHCA 2GNCA 2O4XB 3P7JA 5BN5A 1K8MA 1FJGL 4DEYA 2KBNA 2K03A 5BR8L 4A3MH 3V8JA 1KD1R 2BZXA 2J6OA 1STHA 2NUZA 3NQIA 2YYZA 3U23A 4WFN3 4C2MB 1S1NA 2HHHQ 3ZFJA 4IPCA 4KBMB 1FMKA 1M5Q1 2F0QA 2E76C 3T13A 4GN3B 3M54A 3RDVA 1RLPC 3JB9F 2R92G 3OMCA 1JJ2S 1II3A 3GTGH 3VR2A 2I2LA 2LNHB 1YP5A 3L0OA 1DOLA 4O42A 2K33A 5KRUA 4C8QB 5G3LF 5I2XA 1UGRB 3VUZA 1YITQ 1UFFA 1A3UA 1UG1A 4JI4L 3PNWC 5K36H 4LF4Q 1W2BA 1DOKA 2H1EA 3TZDA 2DXTA 4P75A 4LN2A 3CCQQ 1RF2D 3NELA 5E7NA 2E5LQ 4KJOA 2J7IA 2RHIA 4B3TQ 4R4OA 3SK5A 4L59A 4OX9Q 2JEAI 4BY6B 2DL8A 2PMZE 3K0YA 3W1GA 2ZTEA 2C0TA 3VUBA 5CGKA 2IVWA 2CKZB 4OMMA 1JO8A 2VGNA 1E2VA 3R93A 3TDQA 4F88A 2R57A 4EQOA 3CHBD 3L2PA 3L2ZA 1IHWA 1A8VA 1MV0B 4C3JH 4JRKA 3GPLA 2AZSA 4E6IA 5KNDA 1VCIA 3KF6B 1R0BG 5D14A 5LMNQ 1V1PB 2K5FA 1TWCH 1AE2A 1V1QA 4JC0A 4LFCQ 3M0UA 2K28A 1N36L 1S72T 4BY7B 1SNMA 3EG1A 4J6YA 4HCEA 2EVBA 4XTCS 5IXBA 1SYCA 5JEAJ 5BN4A 1QQJA 1B8AA 2RSOA 1YHQQ 3X20B 3RNUA 2R93G 2NUCA 4A3KG 1XNRQ 3NHNA 1HA6A 3CCVA 2B2YC 1RAIB 2CS7A 2WKDA 4A4GA 4QB4A 5D3IB 2KEEA 3K7AH 4PJOD 2JA8H 1JE4A 3N52A 5GAMf 2XD0A 3IKJA 1KTKA 4POGA 1KABA 4FYVB 2K05A 1G3TA 1OOTA 3U4ZA 1PTOB 4OWTB 4BY1B 1XMQQ 3C12A 3FRNA 2NUTA 4DOVA 3BVGA 2EOTA 4LFCL 1XMOQ 4JI7L 3H0HA 1TSFA 4QJFA 5C4HA 3X28B 1Y1WG 2KSSA 4J9GA 1IGUA 4DBQA 4F17A 4M7DD 2LVMA 2R3ZA 2G5DA 1TS2A 1ZX6A 4M75A 1QVPA 3L2UA 3HOYH 3SHWA 3K58A 3U58A 2JA8B 4JYAL 2VUMB 4OMLA 3LYIA 3KBGA 2A73B 1AZPA 4PJMA 4M7AF 1B70B 5AT1B 3UDGA 1RADB 2VXEA 2KXCA 3CXCS 5DAUA 4POFA 4CJ0B 1BUVT 2WKCA 3V7CA 1GM5A 1KAWA 5LJ5j 1RJTA 1STBA 3PO3G 2E5LL 1XMOL 4JI3L 3FDRA 1LTBD 1SYGA 1K1ZA 2QQAA 2OAUA 2B63B 2HCKA 4X62L 3M0PA 4DR3L 3S14H 2HD0A 2PVGB 4LFAQ 2ZXOA 3CBOA 3M3YH 1T5XD 2ENBA 3H94A 3GTLB 3M85A 1LTID 2FL7A 3B6YA 2LKVA 2SNMA 2XDPA 2XIDA 2KNBB 4YCUA 4X64Q 3GTLH 3I4NB 4OGCA 2ROLA 4J9DA 4BBSH 2F0EA 4V0BA 3UF4A 4IUUA 4DK6C 2I5MX 5GAMd 1PYWD 2J4XA 2AQ2B 2E74C 2B63H 1WJSA 2QGQA 5GAOq 4JJBA 4JPBW 2JZ2A 3QUIA 2QEXQ 1I07A 1WA7A 2W0ZA 1NNXA 1E7ZA 1YITT 1LVKA 5IAYA 2SRCA 4A3LH 3PIP3 4EQPA 2JTFA 2CKKA 4MTKA 2QG9B 2B8GA 4X34A 4KY6A 3KK7A 4C1NI 3CU7A 2EGEA 5KYUB 3GF5A 3I56Q 1SNCA 2E2DC 3GTKH 2FPDA 1DD2A 1E6GA 3VS0A 4M7DA 2K5QA 3K8AA 4DNIA 1OEBA 3BFMA 5GAGC 1K9MU 1T9HA 1IO6A 2JA9A 4OO1H 2ZJQA 3ZL7C 3V8LA 4DR5L 4RTWA 2EYLA 3OYHA 3R2TA 3GP8A 1H9SA 3N5BB 2JSOA 5FJ8H 4E47A 1BO0A 1KRSA 2ZCFB 1SAPA 2CQOA 1O9SA 1BVSA 2F52A 5GJVB 3EH1A 2CP3A 3QJ6A 3VS7A 3HRTA 4PK4A 1U8RA 2ZJPA 4IFDH 4GOPC 2E3HA 2MP1A 4A93B 2CP0A 3K7AB 3JCMh 2PU9B 4A3MB 1U06A 4Y92A 2EZVA 1HZBA 3A74A 1GHKA 2R7ZG 2A3LA 4XK8E 1CKNB 4FW1A 3RNJA 1STAA 3WDNA 3S1QB 2ESWA 3I70A 4LUOA 2CZ0B 1FNUA 2R93B 3CC7A 2JT4A 2LS01 1J8IA 2EPBA 2O2OA 1OX9A 4WRDA 1LPLA 3AT1B 5AYFA 4EPCA 3CCQA 2EXZA 2ICEC 5C0XG 4DN4M 4JI0L 3IFDA 3ASKA 2DJFC 3OYAA 2Y0SB 3J80E 2DAQA 2DK3A 1Z7TA 2XMFA 2F0GA 4ZGJB 3V7SA 4IJLA 3MEUA 1P8LA 3RN2A 1ESFA 2J6FA 2MGSA 3KLSA 1O80A 1QWFA 1U4MA 4QT7A 4RGNA 3NEMA 3DHQA 2XNAC 2NVQB 3LH0A 1EOVA 2MO0A 1BIAA 3PF5A 2LDMA 2N3SA 1BCPD 2P0PA 3CC4A 2XKOC 3GBQA 1L1OC 2XRSD 1ILPA 2QXFA 3BYYB 4P74A 1C7YA 3CRLC 1OXUA 1PH8A 2J06A 3SGIA 3HPWA 1WJJA 2HBPA 1MI2A 1OQKA 4A3IB 2RDHA 2K5IA 1EFWA 4XDXA 3TSWA 1D0ZA 3MP8A 2DXCA 2NN6H 4RG1A 5LJ5g 1GCPA 2A7YA 7AT1B 2KHJA 1JXMA 1H9SB 5IGEA 4KJNA 3G6EA 2CSIA 4IIOA 1YEZA 1YZ6A 4H13C 4MN3A 5NUCA 1DGSA 4BBRB 4RG2A 2COZA 1BI0A 1TWFB 1WTHA 4JI8L 4R4QA 4K0KQ 3M53A 4HXJA 3OYKA 1WJRA 1LT3D 3BDOA 4PJOG 4ZGEB 4RKUE 5KYLA 2DXBA 2QI2A 3CCLQ 4DA2A 1RKNA 3EG0A 3T1HQ 1UTIA 1LJOA 4C92E 1MGSA 4A3DG 3L2RA 4WJ3M 5FU6B 5LJ3f 1KDBA 3MJXA 1AWJA 3Q22A 1RAGB 1VUBA 2RN8A 1CKMA 1Z6HA 2DL5A 2NZOA 4P2CB 4L5RC 1QVFA 2CWPA 5CBEE 3X3NA 4GN4B 1WHKA 5BN3A 2UUBQ 3HP3A 3EA6A 1WFWA 2K75A 1TWHH 4HJ5A 2AQ1B 4M8AA 4CDDC 5CQXA 3ULJA 2LCCA 2RJCA 2CH4A 1AOJA 4F7UE 3LW5E 2QTVA 4RTXA 1FNWA 1ZBXA 1Q81C 1PD1A 1N9RA 1FX7A 4M78C 3A98A 1ARKA 1A62A 1LACA 3NSWA 4DAVA 3D6CA 4AFQC 4J9CA 2E2JB 3S3NA 1WCMH 1F2ZA 3A5ZB 1QP2A 3JRZA 5M3MG 1WX6A 2QQ9A 2DO3A 3JCMc 2O88A 3AQQA 5CV6A 3G7LA 1AEXA 1VQAA 5H1SE 1PH1A 3MWYW 1CKAA 3OS0A 2UXBQ 3M4YA 2EPDA 4BBSB 4QVCA 2G6FX 2HSPA 1Q7YR 5EJWA 4Y28E 2Z6KC 3MFGA 4H0LC 5G3LD 3OWEB 1PSFA 2QQBA 2YUPA 3FB9A 5CQYA 2DGYA 3PMFA 5GROA 3GDEA 1DOMA 4K8IA 1JJGA 3TZUA 2L3QA 1IZ6A 1OV3A 4M77F 3CW2C 3LGJA 3I56A 2JJ9A 3PTAA 3OSSC 4IOCA 2VY3A 3VYUA 3HOWG 4KUIA 3HOUB 2A6ED 2NUTB 2Q2IA 3H3VH 5IXFA 1R4QB 4LUZA 3ZEHA 2AHOB 2F0IA 3ER0A 3JCMQ 4AYBB 3QXEB 3BE3A 3CCMQ 2V26A 5CKFA 4IPGA 5AJ3L 3VS3A 4D8KA 4FSSA 4C92B 4M75E 4ATOA 1HTPA 1QG7A 2A68D 2LY7A 4O1NA 3J81j 3T1HL 3GTJB 4M77B 5IGGA 1JJCB 5C3WA 2ED1A 2FHTA 3UWNA 2MWPA 1PKTA 3FC3A 2WAQG 2JVVA 1UHCA 3KLSX 2JA7G 1OX8A 5A2QL 2LTOA 2LSSA 2EQUA 1E3PA 3DB3A 2MFIA 3CCJT 1V1PA 1VQDA 4OXPA 2KE9A 3WXMB 1SEBD 5JJIA 2K5NA 3CXCP 2UUCQ 2F0MA 1G2TA 4M78E 1EYDA 5C0XI 2DRKA 2HD3A 1E1TA 4DV7Q 3U50C 2GVAA 2Q2HA 1R8OB 1VQ7T 5A0GA 2E4HA 4R56A 2I0NA 1YVCA 4RTUA 1TWAH 2F0NA 4EMKC 3I55A 3QOLA 3AB9A 1YHQT 3I72A 4BXXG 1Y0MA 1QCBD 5FLMH 1B9NA 2GN5A 1SF9A 1K0RA 2YHTA 1G2SA 3W1BA 4DOWA 2F0UA 2L11A 1GUOA 1K28A 4DFAA 1DZ1A 3D0FA 3GNGA 3NPFA 2F0TA 1UE5A 2ID0A 2IWHA 4N0AA 2Q8TA 2D5DA 5C4JH 4R55A 5FRNA 2DYIA 4C1NK 1AD5A 5JEAG 3GTMB 4A3GH 2KT8A 3S24A 1Z9QA 3DWQA 5CKBA 3HGBA 3ULLA 5IIFA 1MV3A 3FKIG 3OYIA 5CVIA 2RO0A 1AEYA 1TXYA 1KLGD 1V76A 1UB4A 2JYOA 1X3EA 5IP7G 3K59A 3C95A 2UU9L 5GAOp 4JJNK 3RIRA 5KH6A 5CV8A 4F87A 1ESRA 2UU9Q 1IL8A 2FINB 3I4OA 1M90C 1HRJA 3EGDA 2KCCA 4DUYL 2MQHA 2YLBA 5TSSA 2YSQA 2LP5A 5M3FG 4HMJA 4MNOA 5M5WB 2GF7A 1VQEA 3PQIA 4LAAA 5IGCA 4NPSA 4A3FG 4FW2A 4ME5A 2ED0A 2JN4A 5CR3A 3MEWA 5GANf 4J1MA 4HJ8A 2XGTA 1KRTA 4GOPA 4LNPA 1TY2A 4DR4L 2XIWA 2KECA 2KCTA 1FMVA 2WAQE 4C2MH 4OF1A 1SRUA 2YV5A 5FOBB 2P0QA 3HOZG 2IG0A 4K5WA 2X4XA 4YHHL 1NPRA 1B7TA 2M00A 5EKLA 2D62A 2WB1E 4IURA 6AT1B 1V9PA 2FMMA 3PUWA 2O5IC 4XTYA 3I4MG 1ZLMA 4C5HA 4DV3L 2MK5A 3G4ST 3A7LA 1WTVA 1RTOA 2F0HA 2Q8IB 4EX5A 4DV1Q 1RAHB 1N9SA 3HFOA 1UDLA 1X3FA 4K2KA 4ZKCB 1HR0L 3M4OH 2EXDA 2VXFA 3F2DA 2JXBA 3QZ9B 3NK9A 3L1AA 5M3FB 1PV4A 1F1BB 3M57A 5KYYB 2FG0A 4OIJA 1YJ9Q 3ND8A 1YHAA 3EFSA 1VQIA 2HIXA 1X01A 2KA7A 1TTHB 1UJYA 1SG5A 1R4PB 1LM0A 1X3PA 1WHJA 2LCLA 4CRIA 2VC8A 1HFGA 2B2VC 1HD3A 2F4IA 4QL5A 3I5SA 1BK2A 1SNQA 2NTSA 1G3YA 4J7IA 1IL2A 2BE7D 4JJDA 4UAIA 1PCXA 5ELBA 2A6HC 2PNHA 3CQZH 4DAYB 4MMLA 2XRQD 1U1SA 2BUDA 3FIFA 3R3OA 3ULRB 3DLMA 2H3EB 2Q8RE 1X43A 3PO3H 4M78G 1GFCA 3CC2Q 2CZ1B 4OMPA 4HJAA 1SRLA 1N6AA 2K4YA 3S15H 3W3AA 1ACMB 1A6XA 2KRMA 1Q82R 3H15A 1VQNT 4DA4A 1JWMD 1YHBA 3HOXG 3FJPA 1X2QA 3O5ZA 1QKXA 3I55T 5LJ3d 2K32A 3MXPA 3ONAB 3PFSA 2RQRA 5C44B 3CCUQ 4JI2L 4JYAQ 4OMFB 3V8KA 4C92A 3C0CA 2GFUA 1D1AA 3QSUA 1H9MA 3VR3A 3F1ZA 1Q81U 4YIJA 2O5JC 4BA1I 1XQHA 4C3HH 2RJDA 1HNZL 2F5TX 3QPHA 3A1PA 2KEDA 1ASYA 2G9DA 4QQBX 1SJED 4HR7B 2QILA 5GMKh 4RCBA 3NBHA 3S1MH 4FT2A 1IYVA 1MMDA 5KYUA 2QASA 1KC8U 4F7UA 2PNRC 4MTNA 2CUDA 4ZKBB 3PMTA 3VYHB 2X4JA 4ZTJA 3NXWA 1PKSA 2EGAA 2QK0A 4M77D 2X6GA 1D3BB 1SHGA 2F2XA 3GD7A 3OIPA 3Q6SA 5GAOm 4HEDA 4JS4A 1TIID 4B3SQ 3ERSX 3OOCA 2A8VA 2C0IA 2L1BA 1QCFA 2E5QA 3BVMA 1RL2A 2OTJQ 1M90R 1WCMB 1BCMA 5KYXB 1VQLA 3QBYA 5FLMG 3VU3C 5FU6C 3S2HH 2JS0A 5HK3A 3RUZA 4HIMA 1RIPA 2K6AA 5GANd 1G3WA 2N8NA 2WB1G 1UGQB 1ZQ1A 1SR3A 2V1CC 3W2DA 4A4FA 1OTCA 3TS2A 1R77A 4KHPQ 4E7ZA 1T3LA 1TWHB 3HEJA 1ET9A 4QF4A 2F1MA 1G8ZD 5EPJA 4ABNA 3Q1JA 4RWSC 1CT1D 2K5LA 2KGTA 4GLMA 3SWNA 2LT4A 4ELZC 1X32A 2KHSA 1W2BS 3RKWA 3SFMA 2EJFC 3UI2A 5IP7H 2E65A 5K36G 1WDXA 1ABOA 4FP5D 4FXGC 2UUAL 3RZOH 4L6TB 5C3EG 4Y52H 1KL9A 2YLCA 5D6YA 1YCYA 3PIOA 3HOWB 1YN8A 1QVGS 4XTWA 4LUDA 5IHKA 4HCBA 3OYGA 1TT2A 2HKQB 4LD9K 4A76A 2DY7A 1PDQA 2XWBB 5HGTA 1SNPA 2RPNA 1WTRA 3TS0A 3BJUA 1S72Q 4QGUA 4AYBE 2KOLA 4AMCA 2NVXB 3PSIA 4HCKA 1OXTA 3SWNC 4JI5Q 1GJXA 3K57A 5FK9C 2DF6A 1YFNA 1B50A 4EMHA 1DXMA 4X62Q 1Y8PB 4A3IG 4DR7Q 3PUXA 4FO2A 3VR4A 2Z4HA 4BY1H 4PFPA 1HQRD 1J5EQ 1SSFA 3PO3B 3VR6A 1GD7A 4N8X1 2MNAA 4PZ7A 1KHIA 1PFSA 1ICWA 1K73C 1EY8A 4L6V5 3IL8A 4LDVA 5HGQA 2EJ9A 4K8JA 2L9HA 5CV4A 1WI5A 5GMKl 1XTCD 1K3RA 4DEXA 4LE9A 1QNKA 3M9BA 2R7ZH 1SFOB 3I56T 4X1VA 4C3IG 1BNZA 4UDUC 2CP2A 3OYBA 4LF8L 3QZ5B 2OEOA 1VYTA 2Y90A 3TVTA 1FD7D 2B3GA 4K6LA 4IZ8A 4C56C 5FO8B 1GUTA 1J9OA 1JWUD 4BY7G 1BCPC 1AP0A 1CSKA 3D4DA 4QUFA 4PNYA 1U5SA 3KDFA 1Y7XA 2JA6H 1Y96A 1BI2A 5L23A 1SXTA 3H8ZA 1GKHA 3MP6A 1PFMA 2M1HA 1XNIA 2Q2TA 4PMWA 4V190 3JAMi 3BDLA 1VF7A 3J7A5 1QZGA 2F0FA 3CEYA 4LFBQ 4DBRA 4DV0Q 1VQPQ 2RVLA 2O31A 5GANe 3TP7A 2JN0A 2PQAA 2QEXA 2LJ0A 2NYSA 2WFWA 4K5VA 1M2VA 2GCXA 4G7ZC 4XT3B 2BIVA 3DEOA 1BKBA 4AFSC 3ND9A 3QIIA 1SE3A 2Z9HA 3HOXH 1G5VA 4BBSG 4XU2A 4PMCA 2AT1B 2N78A 3X25B 4NOYA 4KGVB 1QOHA 4CJ1B 3CC4Q 1I5FA 4A3CG 4JV5L 4AQYQ 2DZCA 1E2WA 1JC7A 4JBMA 1IBML 4Q0FA 1B44D 1SSHA 2O9VA 1PVOA 3WVDB 3CBPA 2KBTA 1WHLA 3CC7T 4WJWA 1SRMA 1WJQA 1QCNA 3M56A 2HUGA 4FT4A 4J6HA 4DR1L 3H41A 4M7DB 4K6DA 5FO7B 2L5QA 1O7YA 5CK9A 3EIVA 1VQOQ 2I46A 4XQNA 1KD1C 1EFID 2DZ9A 1GHJA 1VDZA 3NBHB 3UA7A 3JCMg 1MIUA 2K57A 4LD6A 3JCMP 2E8GA 2B2YA 1IBMQ 2EY5A 4RH6A 5J1ZA 3BDUA 1TU2B 4X65L 4ULLA 3HOYG 4HVVA 3RERA 1TWGB 5EQ0A 2CGHA 1D6EC 2F0VA 3EGDB 1Y14B 1IW7C 2FFKB 3EHQA 1MBYA 2CH4W 2JTMA 4UP9A 4JI6Q 3NPPA 3BZDB 1FYNA 4DUYQ 2BA1A 4DK0A 1WOCA 4BE1A 1KG1A 3META 3STBC 3I4LA 5IYCG 5ELNA 5L37A 2E1HA 5JJKA 4GN5A 1YWPA 2AMCB 1M2VB 4EDUA 3INZA 4HT9A 4AH6A 2DX1A 2RSNA 1TXQA 3V2TA 1XPUA 2F3IA 2VB6A 1TS3A 2PZUA 3I55Q 4G7OC 5GANh 4HN7A 4OELB 3O8VA 2M2LA 3OS2A 1WTWA 1I4GA 4YY3L 1VQNQ 2D1XA 3E5SA 4JI1L 4ZGDB 2AKKA 1I8FA 4JCVE 2LQNA 1IKLA 2HCIA 2IX0A 2VGMA 2VQEQ 3M55A 1QKWA 4KKTA 4ZUIA 2K3YA 5LJ5f 5M3MB 5M9OA 3CCQT 1GXDC 2OQ0A 2ZPHB 4OGQC 1M1GA 2EDGA 3EFRA 2A19A 4JLGA 4Y7NH 2ZAEA 4P5NA 5IP9H 3S1RH 1I6HB 2PNIA 2R7DA 1X75C 3CPFA 2FZCB 1MJCA 3OYJA 1Q90A 1T3SA 1ZXTA 2VB2X 1PTOH 3DXJC 1PFNA 1QWYA 2HQLA 3OSOA 4JW0A 4S3SA 2EVRA 4X3TA 4DUZL 3EFOA 2HDLA 3BVZA 2PPBC 1YNJC 2KCMA 4OEMB 2UUCL 3GTOH 4HJ9A 5EG2A 3G6EQ 4A3EG 3GTQH 5I2MA 4IUNA 3UE0A 5CAIA 4MZTA 1HH2P 4A3DB 3IFTA 3U4VA 3TQ7P 4JJCA 2NBFA 1KNEA 5CKEA 1HZAA 4EVOA 1X54A 1EIYB 1HQMC 1RHPA 4MMKA 2EQMA 5GAN8 4ALPA 2B63G 3HRSA 5FRMA 4M7DG 2JEBI 3CCRA 2AKWB 2K7VA 4CDFC 4F7UG 4YWLA 1S3OA 5LHY1 4I65A 2CP6A 1FNVA 2A69D 1PC0A 1U9RA 1LTAD 2PZTA 1O78A 3EGUA 1VMPA 3QOJA 4B3RL 4A63B 2EYPA 4C3JB 3E6ZX 2VW9A 1G2BA 1H9KA 3I4NG 5KYWA 1C0MA 3P75A 1X55A 1MNEA 2B86A 1OZ2A 3SK4A 4C3JG 2RHYA 1TUDA 4GOPB 4ODGA 1M9SA 4FXDA 2A68C 3WWVA 2G9HD 3NTKA 1KFZA 2CSQA 4M77E 1VQHA 3OYMA 1JB3A 1O7LA 1LLRD 1XPRA 3UATA 3FHWA 3S17B 5FJ8G 4N9PA 4G4KA 3BW1A 2HQHA 1I4RA 4YWKA 3JCMJ 3TP6A 3JCMW 1FJGQ 2ZGWA 4BXXH 3MP1A 5LJ3e 4AG1C 5IY0A 2JA6G 5ELEA 5KE3A 3NWSA 3H09A 1JOOA 1JT8A 2JS2A 3M0RA 3RKYA 1PYSB 2NZ1D 4FF4A 3JB9G 2Z6KA 1QUQA 1HNWL 3ULPA 4NMZA 2JUFA 1UE9A 4E7KA 2V1QA 1TY0A 1D1BA 3CQTA 4PLLA 3UDXA 4C8QF 5JEAH 5LJ5e 4OMQA 1WIEA 2JK8A 4GNXB 1TQOA 2XVSA 4M7AG 1JB0E 1ZBJA 2DE0X 1V8QA 1STGA 1WCMG 1UJ0A 3DKMA 3GOXA 3MEFA 3HTRA 1D09B 1K0SA 1YI2Q 2F3WA 1K9MC 2N49A 2KQ3A 4CHTB 1PRTF 5KYXA 5E4XA 2A5HA 1WGSA 4OIKA 2R7FA 1UAPA 1TWFH 1IB8A 1NJIR 1VQ8A 4C8QG 1VQ7Q 5I11A 2CVRA 2L89A 2RK2A 4LF6L 4J9IA 1I0CA 2E5KA 3IAYA 2L55A 4BBRH 5FU7B 4LXCA 1M2OA 1GCQC 1EX4A 3EAEA 5IGBA 2O4XA 1H8KA 2BTTA 3CCMA 1JR0D 1C8CA 1IGQA 3J80i 1HNXL 2JA6B 5KCOA 2RHXA 5IYDG 2ABLA 2EKHA 2QDBA 5J3BA 4KD4A 5KGUA 3H6MA 4ZK9B 2VUBA 1NG2A 2NN6I 4N8FA 5KYWB 4MDWA 3CD6T 4DV5Q 4IUVA 2MO1A 2E2HH 4AG2C 3PUYA 4K14A 2DEQA 1S5FD 1XJWB 1AE3A 2HZYA 3RMQA 1GL5A 5JVH3 4LDYA 1JEGA 2EKOA 2JQOA 3MTSA 4CKBA 4A3GB 3KUPA 4KK7A 4B6MA 2C0OA 2LQKA 3K6OA 2KDSA 4UP8A 4C3HG 3FRPB 1CA6A 5IWAQ 2V8KA 1A15A 1I50B 3EBEA 1M1FA 5KNCA 1PTOC 2FRYA 1K0XA 3TU4K 1ZSZA 2V1RA 4AIMA 1YHQA 2YTXA 2QDYB 4XTXA 4ANJA 3FKIB 3MXNB 1CTMA 2WINB 5I6WA 2JM8A 1A0NB 5D6WA 3MPUB 2CW0C 1CK1A 1E24A 2FMCA 5EKKA 4A3DH 4YWMA 4M78D 1MJEA 2KR3A 2VZAA 1A3VA 4QIWB 1C9OA 1MGQA 3THKA 3GTOB 3K5MA 5FW9A 5LMNW 4HKEA 1RTNA 3MZ5A 4JZ4A 1PRTC 1GUSA 5I2SA 3STBD 1K8AU 4CJ2C 1CUKA 1D7QA 1HK9A 2NVTH 2JA5B 2SEBD 1NMGA 1H9RA 1U5KA 2XK0A 2FO0A 2RF0A 4Y91A 3S1RB 4JI0Q 1EU3A 3RR5A 4DPGA 5ELDA 1NY4A 4JK1C 3HOWH 1QW1A 2P4RA 4J7FA 3CMEQ 1C1AA 4IKFA 4CDEC 1ET6A 1F9SA 5EPLA 3T53B 4F04B 5M3MH 1RCVD 2O2LD 1W3SA 2CWAA 4B3MQ 1M8AA 4IIMA 5C3XA 2JM9A 2W10A 1WQWA 5DY9A 2UXDQ 5JOBA 1RDPD 3ERQA 4TQUS 1SPKA 2MI6A 1HTLD 3F8TA 4BI4A 4FF2A 3C94A 3I4MB 1RI0A 2DIGA 3VS6A 5GANj 1B1ZA 3C3LA 3UDIA 2KI7A 4C0GA 2FEIA 3OW2P 2KMTA 1ICFB 1NCVA 2LXJA 4X9DA 2K2VA 3HOUH 4A3BH 1GXIE 2FXQA 3DB4A 4DV2Q 2F0WA 5CYUA 1XJVA 4WJ4A 1MMNA 1D3BA 2LQWA 3CPWS 2EY2A 1Q8KA 4QVDA 3CCUT 1XXGA 4ZYSA 3H0GB 3S2DH 3D4WA 3BYTB 4OB1B 3T4AC 5GADC 3RZDB 2K3BA 2M0YA 3I4NH 2UXDL 3CCUA 2KAFA 4HSPA 1VYUA 2XDBA 1V43A 1PH6A 2VNUD 3KBXA 2RQUA 4C8QE 3L2VA 4M7DF 4E2FB 4DR6Q 5A0DA 3U9SA 1G3SA 4OO1G 3VS2A 1EYAA 3EGXB 1IXRA 3G7ZA 1WQ7A 5I2YA 1YJ9A 1TWAB 1N5ZA 4RTZA 3CRKC 3GO5A 2RA4A 3D3RA 3I91A 4YCVA 3BS1A 3CCEQ 3I9QA 1B9MA 1ENAA 1QVCA 4DR7L 3CF5A 4A3BB 4J9FA 1M30A 2A08A 1ABQA 3NMZC 1N8RU 1EWHA 2KVMA 3QB3A 2JA7H 1DJ7B 4CKCA 4U673 3RBBB 1EY0A 2VUMH 1B07A 1EQTA 2LJ1A 2RHZA 3I73A 3CCSQ 2EFIA 1YITA 4B3RQ 4HSVA 3VS4A 3X24B 2G3RA 4C5GA 4EMKA 1VQ9A 3G71T 2I5LX 1D2BA 1VQLQ 4J9BA 4V2SA 1Q8IA 5LJ3h 1JOKA 2X6LA 5K5PA 4GZYC 1EZZB 4ZNXA 1SNOA 2B39A 4BDYA 1HUMA 4DAYA 3CC4T 1VQPA 1W6KA 4NDXA 1Y96B 2B2WA 5IT9c 1OXSC 1U0LA 5DLOA 2K5HA 3G71Q 3TMEA 4L5SA 1KXLA 1GOZA 1SKUB 2E41A 3OSVA 5EGTA 4OVAA 3X26B 1PH7A 2HDAA 1LO5D 1JWSD 1AT1B 1OPKA 5IGDA 2UXBL 3D6WA 4ZN3A 1X2KA 2CT3A 4P73A 4DR2Q 2J7ZA 1ZUYA 1RAEB 3PO2G 2JP1A 1MHWC 2WSCE 2X51A 3FKIH 4TVAB 2D0NA 3TRZA 4J6XA 1MKHA 2HAXA 3K80C 5IGFA 4A3IH 3OS1A 5CMDA 4FU6A 2HIVA 1TWCB 1YJNT 2KYBA 1UECA 2PCFB 5CV7A 1PH5A 3JCMX 3QYGB 1DONA 4M77A 2OWOA 1VIEA 5D65A 2BE5C 3K5NA 3OW2S 3WVEB 1YJWT 2ZT9C 4R4IA 4WTOB 1BF4A 1CFMA 4A3FH 4N4GA 1SDFA 4LF6Q 4I7ZC 1G83A 4OMOA 2NVQH 3QWNA 2YT6A 3CPWP 2L4NA 4CBVA 1K73U 3QJYA 2DVEA 3QKJA 2FRWA 2E2HB 2DPPB 3JCMe 1Q7YC 1KJWA 2OI3A 1LT4D 4C92D 1X3QA 1MMGA 4DAMA 5EC7A 1BI1A 3J81E 1AVZC 2KCNA 4GKKQ 5ECAA 5HCKA 2BZYA 3RLNA 4C3IB 1WPYA 4M7AE 3M59A 4LDUA 1JQYD 1X65A 5CKHA 4QUCA 1O75A 3NTIA 1KAAA 3TP5A 4ZTFA 1I1JA 2F5KA 3EG9B 1F2MA 4K2LA 1L1OB 3L2QA 1YCSB 1KQSS 3VKIA 3E9HA 4ZUJA 1NAPA 3A8GB 1BCPF 1M8MA 1JE5A 4DBHA 3VA7A 1HR0W 1O7IA 2RNAA 1M8VA 4P72A 3UT1A 3LGFA 2F2VA 2KUMA 4DR1Q 5AFWA 2K5WA 2KY9A 1ML0D 1PHTA 2WV6D 4JI5L 2VWFA 5FU7C 4FIBA 2ASBA 2HL3A 4AQYL 3NTHA 2Z0SA 2UUBL 3S3MA 1SE8A 2RF4A 4HIKA 4JI4Q 4IPDA 1JB7A 4BE0A 3A56A 1B2TA 3MXGA 3HKZE 4K5XA 4R8NA 1B53A 1LTGD 2ZM6L 1VQ9T 5IYBG 1VQ5Q 5KIXA 1Z9FA 2H5XA 2A0FB 4M78F 2DIQA 3GP7A 4IQZA 4CC2A 3RLOA 2LX9A 5BR8Q 5FLXc 2GA4B 2Z1CA 3FEWX 4PZ8A 2LRQA 4N9TA 4E6RA 4QW2A 1SE4A 3HSBA 4J6WA 1I4K1 4RCOA 1B4OA 5DEHA 3AFPA 3J80L 4C5IA 4GY5A 3ZJYC 1SYBA 4PFOA 1IYUA 3X3MA 4HCZA 3P8HA 4RTVA 2F0JA 4GS3A 2IPKD 2YTVA 3RN5A 1UUEA 2V8JA 2CUBA 4KGXB 2F1LA 1B3QA 4APVA 3RKXA 2QEJC 1VQOA 5JPMC 1NBEB 3TBIB 3KUFA 4YHHQ 3SHLA 1EWIA 2PUOB 1NJIU 1JCKB 3OQ5A 4BACA 4FXKC 1YNZA 5GJWB 1TH7A 4CC7A 1KLUD 2LMCB 3HS0C 3S1QH 3G48A 2JNGA 4LF5L 2KHIA 5C44G 4PL6A 1NTGA 1HNWQ 1SYEA 4LDXA 1TVXA 5C0MA 2RK1A 1K83H 1PFBA 1RI9A 1QE6A 4TKOB 1D1KA 3S1NH 1D0XA 1YJWQ 2KEAA 1PH3A 3JCMV 4FF3A 4E7JA 2L8DA 1X3GA 4JOIC 3RESA 1Y1WB 5I6YA 1VQJA 1VYVA 2DRMA 5CBAE 2E6ZA 4OB0B 1KD1U 1X9NA 3A0JA 5M5XB 1QWEA 3R6OA 1EWCA 4FL6A 4BE2A 3Q24A 3K7UC 5HY6A 1HCZA 2RDFA 4GLXA 3QIAA 2EE1A 1HJPA 4A3KB 3JCMf 5FWBA 3REAB 1R9TB 3PGZA 1AWXA 2DL3A 4JUVA 1FYCA 3A8JE 4C5EA 1HUNA 3QDRB 4IO9A 1VQ4Q 1PXUA 3CC7Q 4RTYA 1XPOA 1QUQB 3FMCA 1EY7A 4BS9A 3CCJQ 1W70A 1VQ9Q 2BDNA 3FJ5A 1OO9B 4BY1G 2MCNA 3I7FA 3DUZA 1WYXA 3TEEA 1L1OA 2YWWA 5CO7A 1Y07A 4DR5Q 1JQQA 2EGCA 3QO3A 3L9AX 4LNQA 1KIKA 1BR9A 2F0LA 4XIGS 2L15A 4A3CH 4JBJA 1X69A 4QCLA 4LWCA 2ZZDA 5JVG3 1OPLA 1D0YA 2UXCL 4KULA 2NWGA 1UEBA 2IIMA 2F69A 2D2CC 4GKKL 4DXGA 3EH2A 4F7UB 5IYDH 4AFUC 1TR5A 2EYOA 5M5YH 1U1TA 3PV0A 2N88A 2AQ3B 2DEUA 4C0DC 1F9RA 2IPOB 4M7DE 2OF1A 3J7ZC 3EVQA 1ZSZC 2A69C 4Q5WA 3HKZB 2AKLA 1L2FA 3R2IA 1NEGA 2E6NA 3I35A 1F2YA 2AWNA 2B2UC 5IH2A 3OY9A 2H4OA 4LMQD 3A8OB 2FZKB 3HOYB 3SR1A 4RUGA 1VQBA 2Z4IA 4DV1L 3J7AF 1MUZA 1VMCA 4DV3Q 4DV6Q 1I3QH 3S16H 2M02A 4PJOE 3HG9A 5C6AA 3GTGB 5EPKA 4DK1A 3HFNA 1UNSA 3EN2A 1SLJA 2EBPA 1BYMA 3AYHB 4FDBA 5GAN7 4L8JA 2Z8LA 4C3IH 3VRZA 2NVTB 2HBWA 5GMKe 3M7GA 1ZA1B 5DM7R 3C1FA 5C5MA 5KEEA 4BY6C 4JI3Q 3A8MB 4X66Q 3KLRA 1L0WA 2ZTCA 4UP7A 4A3JH 3GTPB 1HA5A 1YNNC 1PLFA 1HNZQ 1M3CA 1N32L 5GAEC 3LLRA 2DY8A 4JI6L 2VKNA 3OYNA 2WSEE 4DU9A 4ZQ3A 1TS9A
chains in the Genus database with same CATH topology
2XMFA 4J9HA 2J6FA 1QWFA 4QT7A 1SHFA 2A37A 1JXOA 2PNIA 3VRYA 2LCSA 1T3SA 1K76A 4J9EA 2EYXA 3VS1A 2EVRA 3QWXX 2PZ1A 3GBQA 2EYYA 2K79A 2J06A 4K11A 4ESRA 1U3OA 4JJCA 1BBZA 4EIKA 3TSWA 3LH5A 2A36A 4CC3A 1GCPA 1JXMA 2AZVA 1ZSGA 2CSIA 4IIOA 2EYZA 3EGUA 1XOVA 4Z88A 4A63B 1T0HA 1G2BA 2JMAA 2K2MA 4HXJA 2B86A 1TUDA 2X3XD 1TUCA 1JU5C 3EG0A 2CSQA 1AWWA 1KFZA 1UTIA 1WLPB 1NLOC 2PTKA 3UATA 2QDLA 2CT4A 1AWJA 2LX7A 1RLQC 2RN8A 2GTOA 2DL5A 4AG1C 1WFWA 2RQWA 2JS2A 3M0RA 2CH4A 1AOJA 2DL4A 1UE9A 1V1CA 4RTXA 2V1QA 1ARKA 3A98A 3CQTA 3JV3A 4OMQA 4AFQC 1WIEA 2EW3A 4J9CA 1ZBJA 1WX6A 2DE0X 1UJ0A 1K0SA 2O88A 4LUEA 1GRIA 2OAWA 3M0SA 1CKAA 2VVKA 1ZUUA 2EPDA 2G6FX 2HSPA 5I11A 1PRMC 4J9IA 1I0CA 2E5KA 3SEMA 1X27A 1Z9ZA 4M4ZA 2YUPA 1GCQC 2YUNA 1H8KA 2BTTA 3QWYA 2L3QA 1OV3A 1LCKA 2ABLA 2EKHA 1E7OA 2RQVA 2GTJA 5IXFA 1NG2A 1VA7A 4AG2C 3H0FA 1AWOA 1Y57A 1M3BA 2J6KA 1GL5A 1NM7A 1W1FA 1JEGA 3VS3A 4D8KA 2LJ3A 1KSWA 4FSSA 1HSQA 2C0OA 5FWCA 2ED1A 3R6NA 1PKTA 1UGVA 1UHCA 4AFZC 1WI7A 2DMOA 1K9AA 2FRYA 1K0XA 2KE9A 2V1RA 2GQIA 4HVUA 4R0KA 2HEQA 1RUWA 2JW4A 2JM8A 2DRKA 2RMOA 1A0NB 1M3AA 1EFNA 2I0NA 3PVLA 2KR3A 2FPEA 2CREA 3EG3A 4RTUA 3THKA 1GFDA 5FW9A 2J05A 2DNUA 1Y0MA 4JZ4A 2DVJA 3M0TA 2DL7A 2AK5A 2KRSA 2FO0A 2RF0A 1SEMA 3NPFA 2F2WA 2P4RA 3H0IA 4Z8AA 2DYBA 4Z89A 2JTEA 1AD5A 2KT8A 1AZEA 1Z9QA 4IIMA 1MV3A 2JM9A 2W10A 4F14A 2K7AA 1AEYA 3UA6A 1SPKA 1BU1A 2DLPA 2KT1A 2O9SA 3VS6A 2FEIA 2NWMA 2YSQA 2KROA 2LP5A 2LQWA 2EQIA 4KRTA 2ED0A 3IQLA 1CKBA 2K3BA 2DJQA 2M0YA 4LNPA 1VYUA 2RQUA 2FPFA 2MIOA 3VS2A 2DA9A 1PRLC 1GBQA 1N5ZA 4RTZA 2DBMA 2YUOA 1ZLMA 4HVWA 1GCQA 1WXBA 3I9QA 1QLYA 1M30A 2A08A 1ABQA 3NMZC 4J9FA 1UDLA 1ZUKA 2L2PA 3KFVA 2JXBA 3RBBB 2K9GA 3NGPA 1B07A 2FG0A 1TG0A 2GGRA 2LJ1A 4JZ3A 1UJYA 3VS4A 2JMCA 3VS5A 1K4US 3EG2A 4J9BA 1HD3A 2ENMA 3I5SA 1BK2A 4ZNXA 1AZGB 2OJ2A 4JJDA 2A28A 4OMNA 3ULRB 1X43A 2H8HA 2DILA 2HDAA 1PWTA 1OPKA 3REBB 2L0AA 1GFCA 1X2KA 2CT3A 4OMPA 1ZUYA 1SRLA 2DM1A 2KXDA 4CC4B 2KRMA 2D0NA 4F16A 2KYBA 1NYGA 3O5ZA 1UECA 1X2QA 1QKXA 2KYMA 2RQRA 3C0CA 1UHFA 2K6DA 1NYFA 1G83A 4OMOA 2YT6A 2FRWA 2SEMA 1KJWA 2CUDA 2OI3A 1PNJA 5EC7A 2RQTA 3PVQA 2ROTA 1AVZC 1PKSA 2DBKA 2EGAA 5ECAA 2GNCA 5HCKA 2BZYA 1SHGA 2F2XA 4DEYA 2BZXA 2J6OA 2NUZA 2C0IA 3U23A 1QCFA 1I1JA 2MOXA 1E6HA 1S1NA 1YCSB 1FMKA 2LMJA 1M8MA 1RLPC 1W6XA 2L3SA 2ECZA 2JS0A 2LZ6B 2KRNA 2RNAA 2LNHB 1YP5A 2F2VA 1PHTA 1T3LA 1UFFA 2KGTA 2VWFA 4GLMA 1UG1A 1H92A 1WDXA 1ABOA 4LN2A 1YN8A 2J7IA 1T0JA 4LUDA 5IHKA 4GBQA 2DL8A 2C0TA 4OMMA 1JO8A 2RPNA 1X6BA 4CC2A 1MV0B 4HCKA 4E6RA 2AZSA 1WXUA 2DF6A 3M0UA 2D8JA 4RTVA 4D8DA 3EG1A 1YWOA 5IXBA 1UUEA 2CUBA 1B3QA 3NHNA 1YNZA 1J3TA 4DEXA 4LE9A 5GJWB 4CC7A 1GBRA 1OOTA 4X1VA 2X3WD 3EHRA 1VYTA 3TVTA 3H0HA 1RI9A 2D8HA 2M51A 4J9GA 2KEAA 4F17A 1CSKA 1ZX6A 1WXTA 1VYVA 2DRMA 3SHWA 1X6GA 1U5SA 4OMLA 5IHIA 1QWEA 4ORZA 5L23A 3I5RA 2KXCA 4WCIA 1BB9A 2GBQA 3PE0A 4RTTA 1K1ZA 5FWBA 2L3PA 1NLPC 3REAB 2HCKA 3M0PA 1AWXA 2DL3A 2O31A 2LJ0A 4RTYA 1W70A 4AFSC 3FJ5A 2KNBB 2MCNA 2ROLA 4J9DA 1WYXA 3UF4A 5IHNA 5I22A 1JQQA 2EGCA 1KIKA 2BZ8A 1X69A 4JJBA 4JPBW 1I07A 1WA7A 2W0ZA 1SSHA 2O9VA 2KBTA 1OPLA 2YDLA 1SRMA 2SRCA 2EYWA 3M0QA 3H41A 2IIMA 3TSZA 4AFUC 2EGEA 2FPDA 1E6GA 3VS0A 3UA7A 1OEBA 1NEBA 1IO6A 3ZL7C 4HVVA 1HJDA 4RTWA 2AKLA 1NEGA 3I35A 5IH2A 2CDTA 3EHQA 2CH4W 4RUGA 1H3HA 1FYNA 1MUZA 5GJVB 3VS7A 1YWPA 1M27C 1U06A 4Y92A 2EBPA 2DX1A 3VRZA 2HBWA 3RNJA 2ESWA 2YUQA 2JT4A 2D1XA 2AKKA 2O2OA 1M3CA 2LQNA 2VKNA 1QKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XMF A;  4J9H A;  2J6F A;  1QWF A;  4QT7 A;  1SHF A;  2A37 A;  1JXO A;  2PNI A;  3VRY A;  2LCS A;  1T3S A;  1K76 A;  4J9E A;  2EYX A;  3VS1 A;  2EVR A;  3QWX X;  2PZ1 A;  3GBQ A;  2EYY A;  2K79 A;  2J06 A;  4K11 A;  4ESR A;  1U3O A;  4JJC A;  1BBZ A;  4EIK A;  3TSW A;  3LH5 A;  2A36 A;  4CC3 A;  1GCP A;  1JXM A;  2AZV A;  1ZSG A;  2CSI A;  4IIO A;  2EYZ A;  3EGU A;  1XOV A;  4Z88 A;  4A63 B;  1T0H A;  1G2B A;  2JMA A;  2K2M A;  4HXJ A;  2B86 A;  1TUD A;  2X3X D;  1TUC A;  1JU5 C;  3EG0 A;  2CSQ A;  1AWW A;  1KFZ A;  1UTI A;  1WLP B;  1NLO C;  2PTK A;  3UAT A;  2QDL A;  2CT4 A;  1AWJ A;  2LX7 A;  1RLQ C;  2RN8 A;  2GTO A;  2DL5 A;  4AG1 C;  1WFW A;  2RQW A;  2JS2 A;  3M0R A;  2CH4 A;  1AOJ A;  2DL4 A;  1UE9 A;  1V1C A;  4RTX A;  2V1Q A;  1ARK A;  3A98 A;  3CQT A;  3JV3 A;  4OMQ A;  4AFQ C;  1WIE A;  2EW3 A;  4J9C A;  1ZBJ A;  1WX6 A;  2DE0 X;  1UJ0 A;  1K0S A;  2O88 A;  4LUE A;  1GRI A;  2OAW A;  3M0S A;  1CKA A;  2VVK A;  1ZUU A;  2EPD A;  2G6F X;  2HSP A;  5I11 A;  1PRM C;  4J9I A;  1I0C A;  2E5K A;  3SEM A;  1X27 A;  1Z9Z A;  4M4Z A;  2YUP A;  1GCQ C;  2YUN A;  1H8K A;  2BTT A;  3QWY A;  2L3Q A;  1OV3 A;  1LCK A;  2ABL A;  2EKH A;  1E7O A;  2RQV A;  2GTJ A;  5IXF A;  1NG2 A;  1VA7 A;  4AG2 C;  3H0F A;  1AWO A;  1Y57 A;  1M3B A;  2J6K A;  1GL5 A;  1NM7 A;  1W1F A;  1JEG A;  3VS3 A;  4D8K A;  2LJ3 A;  1KSW A;  4FSS A;  1HSQ A;  2C0O A;  5FWC A;  2ED1 A;  3R6N A;  1PKT A;  1UGV A;  1UHC A;  4AFZ C;  1WI7 A;  2DMO A;  1K9A A;  2FRY A;  1K0X A;  2KE9 A;  2V1R A;  2GQI A;  4HVU A;  4R0K A;  2HEQ A;  1RUW A;  2JW4 A;  2JM8 A;  2DRK A;  2RMO A;  1A0N B;  1M3A A;  1EFN A;  2I0N A;  3PVL A;  2KR3 A;  2FPE A;  2CRE A;  3EG3 A;  4RTU A;  3THK A;  1GFD A;  5FW9 A;  2J05 A;  2DNU A;  1Y0M A;  4JZ4 A;  2DVJ A;  3M0T A;  2DL7 A;  2AK5 A;  2KRS A;  2FO0 A;  2RF0 A;  1SEM A;  3NPF A;  2F2W A;  2P4R A;  3H0I A;  4Z8A A;  2DYB A;  4Z89 A;  2JTE A;  1AD5 A;  2KT8 A;  1AZE A;  1Z9Q A;  4IIM A;  1MV3 A;  2JM9 A;  2W10 A;  4F14 A;  2K7A A;  1AEY A;  3UA6 A;  1SPK A;  1BU1 A;  2DLP A;  2KT1 A;  2O9S A;  3VS6 A;  2FEI A;  2NWM A;  2YSQ A;  2KRO A;  2LP5 A;  2LQW A;  2EQI A;  4KRT A;  2ED0 A;  3IQL A;  1CKB A;  2K3B A;  2DJQ A;  2M0Y A;  4LNP A;  1VYU A;  2RQU A;  2FPF A;  2MIO A;  3VS2 A;  2DA9 A;  1PRL C;  1GBQ A;  1N5Z A;  4RTZ A;  2DBM A;  2YUO A;  1ZLM A;  4HVW A;  1GCQ A;  1WXB A;  3I9Q A;  1QLY A;  1M30 A;  2A08 A;  1ABQ A;  3NMZ C;  4J9F A;  1UDL A;  1ZUK A;  2L2P A;  3KFV A;  2JXB A;  3RBB B;  2K9G A;  3NGP A;  1B07 A;  2FG0 A;  1TG0 A;  2GGR A;  2LJ1 A;  4JZ3 A;  1UJY A;  3VS4 A;  2JMC A;  3VS5 A;  1K4U S;  3EG2 A;  4J9B A;  1HD3 A;  2ENM A;  3I5S A;  1BK2 A;  4ZNX A;  1AZG B;  2OJ2 A;  4JJD A;  2A28 A;  4OMN A;  3ULR B;  1X43 A;  2H8H A;  2DIL A;  2HDA A;  1PWT A;  1OPK A;  3REB B;  2L0A A;  1GFC A;  1X2K A;  2CT3 A;  4OMP A;  1ZUY A;  1SRL A;  2DM1 A;  2KXD A;  4CC4 B;  2KRM A;  2D0N A;  4F16 A;  2KYB A;  1NYG A;  3O5Z A;  1UEC A;  1X2Q A;  1QKX A;  2KYM A;  2RQR A;  3C0C A;  1UHF A;  2K6D A;  1NYF A;  1G83 A;  4OMO A;  2YT6 A;  2FRW A;  2SEM A;  1KJW A;  2CUD A;  2OI3 A;  1PNJ A;  5EC7 A;  2RQT A;  3PVQ A;  2ROT A;  1AVZ C;  1PKS A;  2DBK A;  2EGA A;  5ECA A;  2GNC A;  5HCK A;  2BZY A;  1SHG A;  2F2X A;  4DEY A;  2BZX A;  2J6O A;  2NUZ A;  2C0I A;  3U23 A;  1QCF A;  1I1J A;  2MOX A;  1E6H A;  1S1N A;  1YCS B;  1FMK A;  2LMJ A;  1M8M A;  1RLP C;  1W6X A;  2L3S A;  2ECZ A;  2JS0 A;  2LZ6 B;  2KRN A;  2RNA A;  2LNH B;  1YP5 A;  2F2V A;  1PHT A;  1T3L A;  1UFF A;  2KGT A;  2VWF A;  4GLM A;  1UG1 A;  1H92 A;  1WDX A;  1ABO A;  4LN2 A;  1YN8 A;  2J7I A;  1T0J A;  4LUD A;  5IHK A;  4GBQ A;  2DL8 A;  2C0T A;  4OMM A;  1JO8 A;  2RPN A;  1X6B A;  4CC2 A;  1MV0 B;  4HCK A;  4E6R A;  2AZS A;  1WXU A;  2DF6 A;  3M0U A;  2D8J A;  4RTV A;  4D8D A;  3EG1 A;  1YWO A;  5IXB A;  1UUE A;  2CUB A;  1B3Q A;  3NHN A;  1YNZ A;  1J3T A;  4DEX A;  4LE9 A;  5GJW B;  4CC7 A;  1GBR A;  1OOT A;  4X1V A;  2X3W D;  3EHR A;  1VYT A;  3TVT A;  3H0H A;  1RI9 A;  2D8H A;  2M51 A;  4J9G A;  2KEA A;  4F17 A;  1CSK A;  1ZX6 A;  1WXT A;  1VYV A;  2DRM A;  3SHW A;  1X6G A;  1U5S A;  4OML A;  5IHI A;  1QWE A;  4ORZ A;  5L23 A;  3I5R A;  2KXC A;  4WCI A;  1BB9 A;  2GBQ A;  3PE0 A;  4RTT A;  1K1Z A;  5FWB A;  2L3P A;  1NLP C;  3REA B;  2HCK A;  3M0P A;  1AWX A;  2DL3 A;  2O31 A;  2LJ0 A;  4RTY A;  1W70 A;  4AFS C;  3FJ5 A;  2KNB B;  2MCN A;  2ROL A;  4J9D A;  1WYX A;  3UF4 A;  5IHN A;  5I22 A;  1JQQ A;  2EGC A;  1KIK A;  2BZ8 A;  1X69 A;  4JJB A;  4JPB W;  1I07 A;  1WA7 A;  2W0Z A;  1SSH A;  2O9V A;  2KBT A;  1OPL A;  2YDL A;  1SRM A;  2SRC A;  2EYW A;  3M0Q A;  3H41 A;  2IIM A;  3TSZ A;  4AFU C;  2EGE A;  2FPD A;  1E6G A;  3VS0 A;  3UA7 A;  1OEB A;  1NEB A;  1IO6 A;  3ZL7 C;  4HVV A;  1HJD A;  4RTW A;  2AKL A;  1NEG A;  3I35 A;  5IH2 A;  2CDT A;  3EHQ A;  2CH4 W;  4RUG A;  1H3H A;  1FYN A;  1MUZ A;  5GJV B;  3VS7 A;  1YWP A;  1M27 C;  1U06 A;  4Y92 A;  2EBP A;  2DX1 A;  3VRZ A;  2HBW A;  3RNJ A;  2ESW A;  2YUQ A;  2JT4 A;  2D1X A;  2AKK A;  2O2O A;  1M3C A;  2LQN A;  2VKN A;  1QKW A; 
#chains in the Genus database with same CATH topology
 5A2Q E;  1KC8 C;  3GV3 A;  2Y0S E;  5CCA A;  2NLU A;  4GKJ L;  4J9H A;  4BBR G;  1O7Z A;  5T1I A;  5C4J B;  3VDY A;  2OT2 A;  4LK1 C;  1Q12 A;  2ALY B;  1Y8N B;  4M75 B;  3CCE T;  1SHF A;  4M1U B;  2A37 A;  2RI3 A;  3P8B B;  5IE8 A;  5IP9 G;  2AHJ B;  1YI2 A;  5COR A;  4X66 L;  2LCS A;  1N33 L;  1K76 A;  2M9U A;  1KQ1 A;  2EYX A;  4J9E A;  3VS1 A;  3QWX X;  1CZG A;  1Q46 A;  1XYI A;  2PVD B;  2PZ1 A;  1VQ8 Q;  3GQB A;  3CCR Q;  2L5T A;  1QVG P;  1F9Q A;  2HSE B;  2EYY A;  2F0S A;  3M4O B;  4DV6 L;  2CCZ A;  2VL6 A;  4ESR A;  3HRU A;  1KDA A;  1D8L A;  1I4H A;  1Q3L A;  1U3O A;  1XNR L;  3H6Z A;  3I3C A;  1WD0 A;  1ASZ A;  4EIK A;  1UE7 A;  1IRX A;  2ATC B;  4M75 F;  1D5X C;  3LH5 A;  4KHZ A;  2A36 A;  1Y71 A;  1Q1B A;  1TUG B;  4M7A A;  1IXD A;  4RGO S;  4A3B G;  3OWF A;  1XNQ Q;  1G6P A;  2HHH L;  1N36 Q;  1ZSG A;  1Y1V G;  1DYQ A;  5GAO n;  2Y0S G;  2OTL Q;  2E3I A;  1NJI C;  4KGZ B;  1STN A;  1RAB B;  4II1 A;  2JMA A;  1Y1W H;  1PG5 B;  4RMO A;  1B34 A;  3P1H A;  4KH1 B;  2K01 A;  4DV7 L;  1Q1E A;  4F7U F;  1Q82 C;  2X3X D;  4M7A D;  3LWE A;  1TUC A;  1KQS P;  4DR6 L;  4MDX A;  3SE0 A;  4IOA A;  1JU5 C;  1QIL A;  4LJZ C;  1FMW A;  1WLP B;  3CME T;  2CP7 A;  2PTK A;  1HZC A;  1AH9 A;  2CT4 A;  3RUX A;  1H64 1;  1NSN S;  4A3M G;  3GTK B;  2LX7 A;  1Q82 U;  1RLQ C;  1PZK D;  2GTO A;  4DF7 A;  2L3R A;  3J81 i;  4WOR A;  4LF4 L;  3H9N A;  2EYQ A;  1PTO F;  1ZEQ X;  3NFC A;  3BU2 A;  4QQ6 A;  1OU9 A;  1E0B A;  2XSC A;  5DM7 3;  5KNB A;  5M5Y B;  3S3O A;  3E2U A;  1ROD A;  4EGV A;  3SWN B;  3JB9 H;  5AJ3 Q;  1S40 A;  4XT1 B;  5F2D A;  2DL4 A;  2VQE L;  1V1C A;  2PQA B;  3A8K E;  4GNX A;  4NXM Q;  1EQV A;  5D3D A;  2V8I A;  3OYD A;  2EJM A;  2B2T A;  1QMC A;  2EW3 A;  1LAB A;  4YY3 Q;  4B3M L;  4NL3 A;  2VB3 X;  1K73 R;  1UGP B;  1JOR A;  4IPH A;  4LUE A;  1GRI A;  5HK0 A;  3C46 A;  2OAW A;  5EAY A;  3TCJ A;  5FRO A;  3URG A;  4DV4 Q;  2R58 A;  3CCS T;  1I81 A;  2VVK A;  1D5Z C;  1YNJ D;  3T51 B;  1N27 A;  2YRV A;  4XXE A;  2E2J H;  1J5E L;  1PH2 A;  1NE3 A;  3SEM A;  4OGE A;  3VJP A;  4BI8 B;  1DJR D;  1Z9Z A;  2E70 A;  2K14 A;  4EMG A;  2RQX A;  1BBX C;  5KE2 A;  1I5O B;  2DN8 A;  4OB2 B;  2IHE A;  1I94 L;  4HCS A;  2ZPG B;  1OU8 A;  2COY A;  3QWY A;  1R9T H;  5COY A;  1C6V X;  4RA8 A;  5C5L A;  4QVZ A;  1M90 U;  3DEP A;  1EZ8 A;  4LF7 L;  1E7O A;  3AEV A;  2RQV A;  1ZSZ B;  2GTJ A;  4PNO A;  1OZ3 A;  3VYG A;  3C1E A;  4L5Q A;  5M5X H;  1VA7 A;  1D5M C;  3FLG A;  2JE6 I;  2M16 A;  4FSX A;  5EBC A;  5IN1 A;  1TS4 A;  1IBK L;  5D7U A;  3CCJ A;  1NM7 A;  1YJN A;  2E75 C;  1OI1 A;  1S72 A;  4PJJ A;  1CKO A;  3CP0 A;  4IN3 A;  4Q5V A;  3VYS A;  2LJ3 A;  2JA5 H;  1QZH A;  5IWA L;  3DWP A;  4MHE A;  4C3H B;  2C5C A;  1HSQ A;  2GQV A;  2NVX H;  3CBM A;  1NBW A;  2XU8 A;  1CSQ A;  3J80 c;  1K83 B;  3HZX A;  3MEH A;  2ZPB B;  3OYC A;  4A3E B;  1MMA A;  1FGU A;  3ZBD A;  4AFZ C;  4IFD I;  2L0C A;  3CCL T;  1KIX A;  2DMO A;  1K9A A;  3KF6 A;  1E22 A;  2QGG A;  2Z6B A;  3TQY A;  1MND A;  2F0O A;  4L5T A;  1NR2 A;  5IOD A;  2HEQ A;  4IUQ A;  2EAY A;  2KK4 A;  4CI0 C;  1Y8O B;  5JPN C;  5KYI A;  4DV5 L;  4FNF A;  1W2B P;  1KNA A;  1BBW A;  2MMP A;  4BY7 H;  4M78 A;  4N4H A;  4HCC A;  2CP5 A;  2ZXR A;  3PUZ A;  4C8Q C;  2YU9 B;  4OHJ A;  5I4D A;  1HNX Q;  4C8Q D;  4LFB L;  1I50 H;  2XTI A;  3DWA A;  3PVL A;  3G4S Q;  4KUD K;  1K8O A;  2CRE A;  3EG3 A;  2E2I H;  2BA0 A;  1VQF A;  4NXN L;  4X6A H;  2DVJ A;  1AFP A;  1HFN A;  4E7L A;  3H0G G;  4A93 G;  2DL7 A;  1WTP A;  4HT8 A;  3S2H B;  1IHV A;  2AK5 A;  1G6Z A;  1QVF S;  2WAQ B;  1SEM A;  1H95 A;  2KJX A;  1V1O A;  1IBK Q;  4BDZ A;  2BE5 D;  1FWZ A;  2MAM A;  3PO2 H;  1H9J A;  1SMX A;  4RCC A;  1WHH A;  4Z89 A;  2JTE A;  4FF1 A;  2DD5 A;  1AZE A;  3LWU A;  4RAU C;  2TMP A;  1PA6 A;  2HL5 C;  5GAN g;  2K7A A;  2XI9 A;  1I6V C;  4LF7 Q;  1WZO A;  3FPP A;  2PQE A;  4GKJ Q;  2COW A;  1YIJ T;  4PV1 C;  1U4L A;  2ZPE B;  2HQE A;  1S5D D;  1VQK T;  2R93 H;  4QQD A;  2NWM A;  3T9N A;  4YCW A;  2MF2 A;  3M58 A;  3HOU G;  1N32 Q;  5KCH A;  1AN8 A;  2KRO A;  1Y1V B;  2J0T D;  4JI7 Q;  1IBL Q;  2EQI A;  4KRT A;  4XAX B;  3Q8D A;  5LJ3 j;  3IQL A;  3PCO B;  1WTQ A;  3CMA A;  4PJO A;  5JJL A;  5GAM h;  1KC8 R;  2DJQ A;  3GNF B;  4ILW A;  3PIO 3;  1B34 B;  3TRE A;  1K8G A;  4PLI A;  3MXU A;  4ZAI A;  4XTZ A;  1CHP D;  1ONL A;  2SOB A;  3OTO Q;  5EBD A;  2DA9 A;  1PTO D;  1EY5 A;  3HRZ C;  1PRL C;  1GBQ A;  2AUK A;  1LT5 D;  2YRC A;  3S15 B;  5DM6 3;  4GLV B;  2V4D A;  4KN4 C;  1Q86 R;  1OYX A;  4HVW A;  2DNE A;  1WXB A;  1FGB D;  2Z0W A;  2BDO A;  3T56 B;  3WOE A;  4HID A;  3ME9 A;  1Q86 C;  1SJH D;  3H3V C;  4J83 A;  1VQK A;  1BOS A;  1F9P A;  2F4V Q;  1GUW A;  3KFV A;  2RH2 A;  1ZKO A;  2HQX A;  4JRI A;  3NGP A;  3PO2 B;  2CZ7 B;  2DET A;  4JOI A;  4BWG B;  4DR2 L;  1QVG A;  1G51 A;  3G71 A;  2R6G A;  4O2D A;  1PM3 A;  1PRT D;  3EFO B;  4A3F B;  3O13 A;  3F2C A;  2RKS A;  3VS5 A;  3TEH B;  1K4U S;  1DCZ A;  2XWJ B;  3M4Q A;  3EG2 A;  3NWT A;  4N4I A;  5IT9 L;  3E9G A;  4QKU A;  4BI3 A;  3CD6 A;  4GNX C;  2HCC A;  1JJ2 P;  3A8H B;  3A55 A;  1AZG B;  2IJ0 A;  2OJ2 A;  2DJG C;  1VQM T;  1HPC A;  2YU9 H;  1SMY D;  3DMU A;  4IFD G;  1NUC A;  2K50 A;  1PZI D;  2PW7 A;  5JJZ A;  3ERO A;  2A6H D;  4KLK A;  1VQ4 A;  4OMN A;  1VQN A;  2QW7 A;  4RKL A;  2B29 A;  4JS5 A;  1DM0 B;  4B3S L;  2H8H A;  3BDC A;  1SFO H;  3FPU B;  3TSS A;  3REB B;  5ELO A;  3OMG A;  5I9O A;  4X64 L;  3RR6 A;  1QVF P;  4G57 A;  5FO9 B;  3OTO L;  3GTQ B;  3EJI A;  4EQ5 A;  2KXD A;  4CC4 B;  1EIG A;  2HT1 A;  2K5V A;  4A3E H;  3UE1 A;  4E7I A;  4HTH A;  3OHX C;  3BG3 A;  4PJO C;  4ZRZ A;  5GMK i;  4A4H A;  2E12 A;  3QR8 A;  4GLA C;  2NUP B;  3HKS A;  4DR3 Q;  4XQ3 A;  4D6W A;  1N33 Q;  3E19 A;  4FYY B;  2KYM A;  4OWW B;  1A3T A;  1D1I A;  2C35 B;  4X3K A;  4JBK A;  1VQ5 T;  4UPA A;  2KVQ G;  3F2U A;  5CC4 A;  4I7A A;  1IYJ B;  2K6D A;  1NYF A;  4M7D C;  1WYD A;  1HHV A;  1A0I A;  3P20 A;  2EJG C;  3PIP A;  3S1N B;  2LNV A;  1PH9 A;  3SEB A;  5LJ5 d;  2JA8 G;  4DBF A;  4DUZ Q;  4PZ6 A;  5HKC A;  3OBY A;  2JXM B;  2SEM A;  1NPP A;  1E1O A;  3W5O A;  5JAV A;  2SNS A;  3CCR T;  1ZYR C;  3I2Z A;  2IY5 B;  1PNJ A;  2CFM A;  1Z47 A;  2TSS A;  4M77 C;  2ROT A;  2PMZ B;  3G6E T;  4OWX B;  3F70 A;  5C0X H;  3G1J A;  1Q95 G;  1SE2 A;  2WP8 J;  1CQV A;  2ZTD A;  3MO8 A;  1YJN Q;  1WFQ A;  3GTM H;  3WOF A;  2M0O A;  1EIF A;  1YIJ A;  2IHF A;  2BKD N;  3NE5 B;  4IJH A;  5LL6 X;  3RD4 A;  2MOX A;  1E6H A;  2VQF L;  2LFN A;  4NXN Q;  2WII B;  3I90 A;  3MEA A;  4ZCK A;  3TP8 A;  5LJ3 g;  5J22 A;  2EWN A;  2LMJ A;  3JAM c;  1N34 L;  1CHQ D;  2R92 B;  2A1A A;  4LF9 L;  4C0D B;  1N8R R;  3K0X A;  2R92 H;  3H0G H;  2ECZ A;  1W6X A;  2L3S A;  2VUM G;  2EYH A;  2KRN A;  2LZ6 B;  1QP3 A;  2L12 A;  3RZD H;  3HOV B;  1VQ8 T;  4KT0 E;  2K5D A;  2ZJR A;  3S2D B;  3N6R A;  2MWO A;  9ATC B;  3V96 A;  3A54 A;  1PSE A;  3CC2 T;  4C8Q A;  3MA2 B;  5C3E B;  3E9I A;  2B2W C;  2EQJ A;  5T1G A;  1QCO A;  4H02 A;  1BI3 A;  2BH2 A;  2NVY B;  4O0A A;  3TN2 A;  4DK3 C;  1BCP B;  1H92 A;  3D8G A;  2IX1 A;  1RAC B;  1MD2 D;  2BOS A;  4XYQ A;  4LF9 Q;  3QO2 A;  2Q2U A;  1T0J A;  4AT1 B;  1M1K C;  1XWE A;  4GBQ A;  3EFX D;  4MIU A;  4QIW E;  4A75 A;  4KTA A;  3DM3 A;  4FCY A;  1JJ2 A;  1ENC A;  2C9O A;  2SDF A;  4LFA L;  1I6H H;  1X6B A;  3CMA T;  3FEO A;  3A8L B;  1LTS D;  4TSS A;  4KY5 A;  4A3L G;  2PW5 A;  1VQP T;  1P16 A;  1VIF A;  2N55 A;  3GTJ H;  1WTO A;  5IOC A;  3OW7 A;  2BE9 B;  2FB7 A;  3JB9 D;  5J39 A;  3MC0 B;  1WXU A;  1K9M R;  3OYL A;  3J7A V;  2D8J A;  4D8D A;  5E3F A;  4LF8 Q;  2OTL A;  3SK6 A;  4PQX A;  5J26 A;  4NS5 A;  2YTY A;  1YWO A;  4KI0 A;  1VQO T;  1YBY A;  2QA4 A;  1EY9 A;  1BDO A;  5FLX E;  1VF5 C;  1I94 Q;  3FDT A;  3E0J A;  2EQS A;  5GAO r;  2EY6 A;  1HYO A;  1EL0 A;  2RHQ B;  1YJW A;  3CPW A;  3L42 A;  4CDC C;  2NUP A;  4YTL A;  1LUZ A;  2R61 A;  1J3T A;  3A7A B;  4EQN A;  4ELY C;  2RCN A;  1GBR A;  4DV4 L;  1C0A A;  1XMQ L;  4A54 A;  2E64 A;  2DD4 A;  2P4T A;  4P71 A;  2X3W D;  1VQ6 T;  3CMA Q;  3QDF A;  3EHR A;  2X35 A;  2MHV A;  3MFY A;  1JIC A;  4N0A C;  2D8H A;  3OS5 A;  4J8Q A;  5GAM g;  2M51 A;  2OTL T;  4X3U A;  3V7R A;  2DUD A;  3CD6 Q;  5C4Z A;  5GAH C;  2ZPF B;  4J5Y A;  4FYD A;  2JJQ A;  2B2T C;  4DKA C;  1XX8 A;  1WXT A;  1BIB A;  1X6G A;  2P0K A;  1SRO A;  2AWO A;  5IHI A;  3OIQ A;  1BCO A;  2NB0 A;  4XTV A;  4ORZ A;  2MUY A;  2PI2 A;  5IYB H;  3I5R A;  3E3X A;  4ME3 A;  4WCI A;  1K3B C;  3M7N A;  1PRT B;  3VYR A;  4A3J B;  3GTP H;  1BB9 A;  4VUB A;  3SD4 A;  2OX7 A;  2Y4Y A;  4E7H A;  2I5H A;  2MPX C;  2GBQ A;  1OXX K;  2P5Z X;  3PE0 A;  4RTT A;  5CV9 A;  3I8Z A;  3F2B A;  3MEV A;  2BCO A;  2L3P A;  1NLP C;  4C0Z A;  1Y69 U;  1XTD A;  5A0L A;  1EOT A;  2GFA A;  1A63 A;  4RKB A;  2EYJ A;  1YI2 T;  1S5B D;  2DFU A;  1CZW A;  4OO1 I;  2NYZ D;  2QEX T;  1JOQ A;  2QTX A;  3SDZ A;  2EQK A;  2FYK A;  5IHN A;  5I22 A;  2GVB A;  4J15 A;  2B8A A;  3CME A;  5DNF A;  2BZ8 A;  3GLX A;  4M77 G;  2FJ2 A;  2RJF A;  1TKW B;  1Y1V H;  3KJP A;  3Q23 A;  1UE6 A;  2YDL A;  5GAN 5;  1BQQ T;  1YJ9 T;  2EYW A;  1N8R C;  1CQF A;  5M5W H;  2QYZ A;  3M0Q A;  3PF4 A;  3TSZ A;  1T5E A;  1MSG A;  4F7X A;  1S4Z A;  1L0X B;  2PYK A;  2RI5 A;  2RA2 A;  1C4Q A;  5C4X H;  1NEB A;  3S9W A;  1I5L A;  3C4S A;  4RG8 A;  3S17 H;  1I4P A;  3CCV T;  2NVY H;  3PGG A;  4NP5 A;  1HJD A;  2RM4 A;  4B9X A;  2P84 A;  2EJF A;  4FYW B;  1IW7 D;  5ISR A;  2UUA Q;  2CDT A;  3S6W A;  1EYC A;  2CHB D;  1AW7 A;  1H3H A;  4X9C A;  3T16 A;  4DNR B;  3NBI A;  4LUV A;  1LT6 D;  1N9W A;  2EY1 A;  1M1K R;  1OXV A;  5GAN 4;  4B9W A;  3HOV H;  4JI2 Q;  1OUL A;  4KHV A;  1M27 C;  4KHP L;  2F03 A;  2AUJ D;  3D7S B;  4XU1 A;  4R9W A;  2E2I B;  2RHU A;  3UPU A;  4UC4 A;  4C0F A;  2YUQ A;  3L3O C;  3M3Y B;  3CCE A;  3H91 A;  1GUG A;  4A4E A;  4DV2 L;  3OYE A;  1VQM A;  4BA2 I;  4BB7 A;  1Q81 R;  3CC2 A;  2DTH A;  1KDC A;  3A8I E;  1VQ7 A;  2K52 A;  4PJO F;  2PZW A;  2RDG A;  2A6E C;  1Q7Y U;  3KYH C;  3KFU A;  1PMR A;  3AMU A;  1SBB B;  1WHM A;  1F77 A;  1G29 1;  1NR4 A;  2D9T A;  3MHX A;  3HFZ B;  4JI1 Q;  1JXO A;  3C2P A;  3KOJ A;  4A93 H;  3VRY A;  1VQ4 T;  1WNL A;  1Q86 U;  2NZH A;  4ME7 A;  2RB6 A;  3JCM d;  1IHZ A;  4KKS A;  1MHN A;  3NEN A;  5GAM j;  5C6S A;  2PUK B;  3QG1 A;  8ATC B;  1A2U A;  2K4K A;  2X9H A;  5L8R E;  2K79 A;  2K1B A;  1QNU A;  5I9P A;  2D0O A;  3JAM L;  4OON A;  1TS5 A;  4K11 A;  2ZM6 Q;  1HXD A;  3PT9 A;  1NE8 A;  1FR3 A;  2QA4 Q;  1SN8 A;  4UHV A;  1BBZ A;  1U4P A;  4K0K L;  1AZQ A;  3M9Q A;  2NN6 G;  3NUC A;  3H3V I;  1HR0 Q;  1LOJ A;  4XU0 A;  4CC3 A;  2RHS B;  4X65 Q;  1EIH A;  2AZV A;  4WF2 A;  2VQF Q;  1G91 A;  4BUG A;  1V29 B;  2EYZ A;  3LWI A;  3OB9 A;  1SYF A;  2RI2 A;  1XOV A;  4DQ2 A;  4Z88 A;  4LW1 A;  1T0H A;  4RCN A;  4CKE A;  4X3S A;  2K2M A;  5EKI A;  1JRI A;  4RHR A;  3K5O A;  4RMF A;  2VV5 A;  5CKD A;  5LL6 S;  1WD1 A;  3SXH A;  1MSH A;  1PHJ A;  2OTJ A;  2F0P A;  3RMS A;  3G6J B;  4KD3 A;  2D0Q B;  3BZK A;  1FXX A;  1AWW A;  1TU0 B;  4BD3 A;  2OCE A;  2DTO A;  4DGZ A;  4QMG A;  3J81 L;  3ICE A;  4DR4 Q;  1NLO C;  1VOM A;  2QDL A;  2F0K A;  2IT1 A;  2ICI A;  1W4S A;  1GO3 E;  1D1C A;  3CCM T;  2QKI C;  3S14 B;  3S1M B;  3P8D A;  2EJG A;  2HMA A;  1YNN D;  4GLK A;  2K04 A;  1K8A R;  5E4W C;  3V05 A;  2QQR A;  2VAS A;  4PFZ A;  2RQW A;  3D31 A;  3JB9 I;  2RD1 A;  2HKN A;  1SSO A;  3MCA B;  2QAZ A;  4ZLT F;  3VA5 A;  1EY4 A;  2IX3 A;  3Q0A A;  3KXT A;  4TRD A;  5LJ5 h;  5FLX L;  3JV3 A;  1HZ9 A;  3KJO A;  4M75 D;  2OTJ T;  3NP8 A;  3OBW A;  4M75 C;  1PZJ D;  4Z9C B;  5A35 A;  5C44 H;  2FVU A;  4HAE A;  4A3G G;  5GAN 3;  4AYB G;  1N34 Q;  4LF5 Q;  4A4K A;  1NZ9 A;  1RAF B;  3LGL A;  1ZA2 B;  3M0S A;  3HP9 A;  2DER A;  2CQA A;  3CAM A;  3EQL C;  3HOX B;  2PO4 A;  2YXY A;  3T1Y Q;  1ZUU A;  1CA5 A;  3EG9 A;  3NQT A;  1PRM C;  4IUP A;  3KDF B;  5C0X J;  1ILQ A;  3MAQ A;  1X27 A;  3PUV A;  3R8B A;  4M4Z A;  1VQL T;  1I4X A;  4L63 B;  2D6F A;  2YUN A;  4XYO A;  4M78 B;  1LNX A;  4FVM A;  3KF8 A;  1EQQ A;  1UUP A;  1S5E D;  5GAO l;  2X69 A;  3QHS A;  4R1J A;  5E1F A;  2QCP X;  5GAN 2;  2I07 B;  2DNC A;  1LCK A;  3GV6 A;  3ITP A;  3MXN A;  3CQZ B;  4C92 F;  4QY7 A;  2VXW A;  3CXC A;  4H44 C;  4UY8 C;  3JAM E;  4DNT B;  1EU4 A;  4C92 C;  2I0Q A;  3AHU A;  2CZ6 B;  3HHT B;  4A53 A;  2LQ8 A;  1U4R A;  2B2V A;  3H0F A;  1AWO A;  4RGT A;  1Y57 A;  1M3B A;  2J6K A;  3L2W A;  4B3T L;  5IT9 E;  3SK8 A;  2YRD A;  1W1F A;  1EEI D;  1VQ6 A;  2IW3 A;  2R5A A;  2JA5 G;  2F4V L;  4M7A B;  4JBW A;  1KSW A;  1CI3 M;  2C06 A;  2QQS A;  5FWC A;  1XNQ L;  3CCL A;  2EYF A;  4IAL A;  1M4Z A;  3BZC A;  3LX0 A;  4RGM A;  3R6N A;  3M5A A;  4C92 G;  1HXY D;  1UE1 A;  1UGV A;  2PI2 E;  8AT1 B;  3HOV G;  5FKA C;  1K8A C;  1WI7 A;  3G4S A;  1SMY C;  4DXF A;  4R8I A;  2QA4 T;  4JRP A;  1EY6 A;  2R7Z B;  4DAP A;  2GQI A;  4HVU A;  4R0K A;  1VQC A;  3OW2 A;  1B7Y B;  1RUW A;  2JW4 A;  4OB3 B;  1UEA B;  4O6J A;  2XN9 C;  2RMO A;  5CIU A;  5GQO A;  5GMK j;  3MKD A;  1VQK Q;  5GAM e;  1M3A A;  3RLF A;  2CW0 D;  5LMU L;  1PD0 A;  5C3E H;  1EFN A;  3E0E A;  4R4T A;  2FPE A;  1WVL A;  1GFD A;  1FVI A;  4R4C A;  1A2T A;  1JBM A;  2J05 A;  4OP0 A;  1I3Q B;  3S16 B;  2DNU A;  2B8F A;  3KLW A;  2ZPI B;  2NTT A;  3M0T A;  2KQW A;  4M7A C;  4F8M A;  1X6O A;  5KYN A;  1KQS A;  2EYM A;  3LWH A;  4TVR A;  4ID6 A;  2KRS A;  1UGS B;  2ES2 A;  2MYS A;  4MZM A;  1X56 A;  4EMK B;  2WB1 B;  3FVQ A;  3JB9 J;  4MZ9 A;  3UDF A;  2F2W A;  1F2L A;  4MZP A;  3H0I A;  4Z8A A;  3FP9 A;  2DYB A;  4JG2 A;  3J81 c;  3CCS A;  3SVM A;  2PVO B;  2JA7 B;  1CKN A;  3A5U A;  4XQJ A;  4A3J G;  1STY A;  4F14 A;  3RZO B;  3JSC A;  1ENF A;  3UA6 A;  2LC4 A;  3CKI B;  1BU1 A;  1VQM Q;  2DLP A;  1I4Q A;  2KT1 A;  2O9S A;  2R5M A;  2IL8 A;  1G8X A;  2DJZ A;  2WSF E;  4IFD J;  1S5C D;  1AHJ B;  1C48 A;  2D9U A;  1JMC A;  3JCM b;  1QB5 D;  2F3V A;  2ZXP A;  5D6X A;  3IRB A;  3E9F A;  3NHH A;  4RFB A;  3JC6 6;  3L7Z C;  3GIB A;  1SND A;  4J8O A;  2RBM A;  5ELC A;  1FL0 A;  3AFQ A;  3D4R A;  1CKB A;  3DLL A;  1EQR A;  1PYB A;  2HNI A;  3PMI A;  1IBL L;  3HOZ B;  3OA6 A;  2HDM A;  3VYT A;  3URY A;  2XG8 D;  5LMN L;  2FHD A;  2FPF A;  4PJO B;  1VS0 A;  1UWV A;  3HOZ H;  2MIO A;  1SYD A;  4PMB A;  4IUT A;  3DM1 A;  4E7S A;  2UXC Q;  2OQK A;  2X4W A;  2CYZ B;  5GMK m;  1LTR D;  2RJE A;  1LTT D;  2DBM A;  3I4M H;  1IRE B;  1L0Y B;  2YUO A;  5C4X B;  4A3K H;  1GCQ A;  1STE A;  4KKU A;  1BXT A;  4OX9 L;  1QLY A;  2MPM A;  2XHC A;  2LT1 A;  3CCV Q;  2M9V A;  4FYX B;  1ZUK A;  4Z02 A;  2L2P A;  4XU3 A;  1NMF A;  1ZYR D;  1RAA B;  2H3J A;  5CR2 A;  2A74 C;  2MJ8 A;  2PQW A;  4H7B A;  1J6Q A;  4KY7 A;  4HJ7 A;  2K9G A;  3ZYY X;  5LMU Q;  1W6J A;  3MHB A;  1TG0 A;  2GGR A;  2JOY A;  4JZ3 A;  3MVV A;  4NKL A;  5HUR A;  1R0C B;  1GVP A;  5I21 A;  1EYG A;  3M4G A;  1TOV A;  2JMC A;  4M75 G;  4HIO A;  4KMU C;  4U68 A;  3BY7 A;  2ENM A;  1WTX A;  4JV5 Q;  3OYF A;  4XQQ A;  3K5L A;  4NL2 A;  4ZN1 A;  2XDD A;  4G7H C;  4LDW A;  2Y4X A;  1KK7 A;  4Y7N B;  2DKG A;  4PG3 A;  2A28 A;  3OPO A;  2X4Y A;  2AIR B;  2WAC A;  4HA8 A;  3SB2 A;  4O5V A;  1ZHI A;  2DIL A;  2QGF B;  1PWT A;  1YNX A;  2LXK A;  3QYH B;  4RHS A;  2L0A A;  1H3Z A;  1LTL A;  2E10 A;  4KN7 C;  4JDS A;  2KEN A;  4DV0 L;  1GUN A;  5GAN 6;  1M1K U;  1TWB A;  2D0P A;  4JI8 Q;  3VV0 A;  2DM1 A;  4NB3 A;  2OXP A;  4NW2 A;  3HL8 A;  4JLI A;  5KYY A;  1M4V A;  1KQ2 A;  4PJL A;  1LYL A;  1PH4 A;  4PJN A;  1E2Z A;  1VQG A;  4A4I A;  4F16 A;  2O01 E;  2XIC A;  1VQ6 Q;  1NYG A;  1QJO A;  3LNN A;  2RCF A;  4OL7 A;  4NXM L;  3RMH A;  1P92 A;  5DLQ E;  3J7Y W;  1LV9 A;  2QF7 A;  4JVZ A;  3U9O A;  4PKC C;  1UHF A;  1EEF D;  5IYC H;  1IKM A;  1B3A A;  3OYY A;  2ATW A;  4KV6 A;  3UDC A;  5CV5 A;  1CM9 A;  2FZG B;  4HMI A;  2DTI A;  3EGX A;  2EIF A;  4QQG A;  3E1S A;  1VQ5 A;  2VS1 A;  3VR5 A;  5M3F H;  4CGY B;  5ELF A;  3T1Y L;  1WHG A;  1CSP A;  1BBU A;  3LX7 A;  4B08 A;  1TWG H;  4JRQ A;  3K81 C;  2DXU A;  2VYT A;  2K3X A;  1YIJ Q;  2F0D A;  1EZ6 A;  2B2U A;  4FM4 B;  4L5G A;  4XTU A;  2BH8 A;  5C4X G;  1EUJ A;  3M4P A;  2RQT A;  3PVQ A;  4KH0 B;  2DBK A;  3KF8 B;  1RD9 D;  3AU7 A;  3HKZ G;  1KHC A;  2GNC A;  2O4X B;  3P7J A;  5BN5 A;  1K8M A;  1FJG L;  4DEY A;  2KBN A;  2K03 A;  5BR8 L;  4A3M H;  3V8J A;  1KD1 R;  2BZX A;  2J6O A;  1STH A;  2NUZ A;  3NQI A;  2YYZ A;  3U23 A;  4WFN 3;  4C2M B;  1S1N A;  2HHH Q;  3ZFJ A;  4IPC A;  4KBM B;  1FMK A;  1M5Q 1;  2F0Q A;  2E76 C;  3T13 A;  4GN3 B;  3M54 A;  3RDV A;  1RLP C;  3JB9 F;  2R92 G;  3OMC A;  1JJ2 S;  1II3 A;  3GTG H;  3VR2 A;  2I2L A;  2LNH B;  1YP5 A;  3L0O A;  1DOL A;  4O42 A;  2K33 A;  5KRU A;  4C8Q B;  5G3L F;  5I2X A;  1UGR B;  3VUZ A;  1YIT Q;  1UFF A;  1A3U A;  1UG1 A;  4JI4 L;  3PNW C;  5K36 H;  4LF4 Q;  1W2B A;  1DOK A;  2H1E A;  3TZD A;  2DXT A;  4P75 A;  4LN2 A;  3CCQ Q;  1RF2 D;  3NEL A;  5E7N A;  2E5L Q;  4KJO A;  2J7I A;  2RHI A;  4B3T Q;  4R4O A;  3SK5 A;  4L59 A;  4OX9 Q;  2JEA I;  4BY6 B;  2DL8 A;  2PMZ E;  3K0Y A;  3W1G A;  2ZTE A;  2C0T A;  3VUB A;  5CGK A;  2IVW A;  2CKZ B;  4OMM A;  1JO8 A;  2VGN A;  1E2V A;  3R93 A;  3TDQ A;  4F88 A;  2R57 A;  4EQO A;  3CHB D;  3L2P A;  3L2Z A;  1IHW A;  1A8V A;  1MV0 B;  4C3J H;  4JRK A;  3GPL A;  2AZS A;  4E6I A;  5KND A;  1VCI A;  3KF6 B;  1R0B G;  5D14 A;  5LMN Q;  1V1P B;  2K5F A;  1TWC H;  1AE2 A;  1V1Q A;  4JC0 A;  4LFC Q;  3M0U A;  2K28 A;  1N36 L;  1S72 T;  4BY7 B;  1SNM A;  3EG1 A;  4J6Y A;  4HCE A;  2EVB A;  4XTC S;  5IXB A;  1SYC A;  5JEA J;  5BN4 A;  1QQJ A;  1B8A A;  2RSO A;  1YHQ Q;  3X20 B;  3RNU A;  2R93 G;  2NUC A;  4A3K G;  1XNR Q;  3NHN A;  1HA6 A;  3CCV A;  2B2Y C;  1RAI B;  2CS7 A;  2WKD A;  4A4G A;  4QB4 A;  5D3I B;  2KEE A;  3K7A H;  4PJO D;  2JA8 H;  1JE4 A;  3N52 A;  5GAM f;  2XD0 A;  3IKJ A;  1KTK A;  4POG A;  1KAB A;  4FYV B;  2K05 A;  1G3T A;  1OOT A;  3U4Z A;  1PTO B;  4OWT B;  4BY1 B;  1XMQ Q;  3C12 A;  3FRN A;  2NUT A;  4DOV A;  3BVG A;  2EOT A;  4LFC L;  1XMO Q;  4JI7 L;  3H0H A;  1TSF A;  4QJF A;  5C4H A;  3X28 B;  1Y1W G;  2KSS A;  4J9G A;  1IGU A;  4DBQ A;  4F17 A;  4M7D D;  2LVM A;  2R3Z A;  2G5D A;  1TS2 A;  1ZX6 A;  4M75 A;  1QVP A;  3L2U A;  3HOY H;  3SHW A;  3K58 A;  3U58 A;  2JA8 B;  4JYA L;  2VUM B;  4OML A;  3LYI A;  3KBG A;  2A73 B;  1AZP A;  4PJM A;  4M7A F;  1B70 B;  5AT1 B;  3UDG A;  1RAD B;  2VXE A;  2KXC A;  3CXC S;  5DAU A;  4POF A;  4CJ0 B;  1BUV T;  2WKC A;  3V7C A;  1GM5 A;  1KAW A;  5LJ5 j;  1RJT A;  1STB A;  3PO3 G;  2E5L L;  1XMO L;  4JI3 L;  3FDR A;  1LTB D;  1SYG A;  1K1Z A;  2QQA A;  2OAU A;  2B63 B;  2HCK A;  4X62 L;  3M0P A;  4DR3 L;  3S14 H;  2HD0 A;  2PVG B;  4LFA Q;  2ZXO A;  3CBO A;  3M3Y H;  1T5X D;  2ENB A;  3H94 A;  3GTL B;  3M85 A;  1LTI D;  2FL7 A;  3B6Y A;  2LKV A;  2SNM A;  2XDP A;  2XID A;  2KNB B;  4YCU A;  4X64 Q;  3GTL H;  3I4N B;  4OGC A;  2ROL A;  4J9D A;  4BBS H;  2F0E A;  4V0B A;  3UF4 A;  4IUU A;  4DK6 C;  2I5M X;  5GAM d;  1PYW D;  2J4X A;  2AQ2 B;  2E74 C;  2B63 H;  1WJS A;  2QGQ A;  5GAO q;  4JJB A;  4JPB W;  2JZ2 A;  3QUI A;  2QEX Q;  1I07 A;  1WA7 A;  2W0Z A;  1NNX A;  1E7Z A;  1YIT T;  1LVK A;  5IAY A;  2SRC A;  4A3L H;  3PIP 3;  4EQP A;  2JTF A;  2CKK A;  4MTK A;  2QG9 B;  2B8G A;  4X34 A;  4KY6 A;  3KK7 A;  4C1N I;  3CU7 A;  2EGE A;  5KYU B;  3GF5 A;  3I56 Q;  1SNC A;  2E2D C;  3GTK H;  2FPD A;  1DD2 A;  1E6G A;  3VS0 A;  4M7D A;  2K5Q A;  3K8A A;  4DNI A;  1OEB A;  3BFM A;  5GAG C;  1K9M U;  1T9H A;  1IO6 A;  2JA9 A;  4OO1 H;  2ZJQ A;  3ZL7 C;  3V8L A;  4DR5 L;  4RTW A;  2EYL A;  3OYH A;  3R2T A;  3GP8 A;  1H9S A;  3N5B B;  2JSO A;  5FJ8 H;  4E47 A;  1BO0 A;  1KRS A;  2ZCF B;  1SAP A;  2CQO A;  1O9S A;  1BVS A;  2F52 A;  5GJV B;  3EH1 A;  2CP3 A;  3QJ6 A;  3VS7 A;  3HRT A;  4PK4 A;  1U8R A;  2ZJP A;  4IFD H;  4GOP C;  2E3H A;  2MP1 A;  4A93 B;  2CP0 A;  3K7A B;  3JCM h;  2PU9 B;  4A3M B;  1U06 A;  4Y92 A;  2EZV A;  1HZB A;  3A74 A;  1GHK A;  2R7Z G;  2A3L A;  4XK8 E;  1CKN B;  4FW1 A;  3RNJ A;  1STA A;  3WDN A;  3S1Q B;  2ESW A;  3I70 A;  4LUO A;  2CZ0 B;  1FNU A;  2R93 B;  3CC7 A;  2JT4 A;  2LS0 1;  1J8I A;  2EPB A;  2O2O A;  1OX9 A;  4WRD A;  1LPL A;  3AT1 B;  5AYF A;  4EPC A;  3CCQ A;  2EXZ A;  2ICE C;  5C0X G;  4DN4 M;  4JI0 L;  3IFD A;  3ASK A;  2DJF C;  3OYA A;  2Y0S B;  3J80 E;  2DAQ A;  2DK3 A;  1Z7T A;  2XMF A;  2F0G A;  4ZGJ B;  3V7S A;  4IJL A;  3MEU A;  1P8L A;  3RN2 A;  1ESF A;  2J6F A;  2MGS A;  3KLS A;  1O80 A;  1QWF A;  1U4M A;  4QT7 A;  4RGN A;  3NEM A;  3DHQ A;  2XNA C;  2NVQ B;  3LH0 A;  1EOV A;  2MO0 A;  1BIA A;  3PF5 A;  2LDM A;  2N3S A;  1BCP D;  2P0P A;  3CC4 A;  2XKO C;  3GBQ A;  1L1O C;  2XRS D;  1ILP A;  2QXF A;  3BYY B;  4P74 A;  1C7Y A;  3CRL C;  1OXU A;  1PH8 A;  2J06 A;  3SGI A;  3HPW A;  1WJJ A;  2HBP A;  1MI2 A;  1OQK A;  4A3I B;  2RDH A;  2K5I A;  1EFW A;  4XDX A;  3TSW A;  1D0Z A;  3MP8 A;  2DXC A;  2NN6 H;  4RG1 A;  5LJ5 g;  1GCP A;  2A7Y A;  7AT1 B;  2KHJ A;  1JXM A;  1H9S B;  5IGE A;  4KJN A;  3G6E A;  2CSI A;  4IIO A;  1YEZ A;  1YZ6 A;  4H13 C;  4MN3 A;  5NUC A;  1DGS A;  4BBR B;  4RG2 A;  2COZ A;  1BI0 A;  1TWF B;  1WTH A;  4JI8 L;  4R4Q A;  4K0K Q;  3M53 A;  4HXJ A;  3OYK A;  1WJR A;  1LT3 D;  3BDO A;  4PJO G;  4ZGE B;  4RKU E;  5KYL A;  2DXB A;  2QI2 A;  3CCL Q;  4DA2 A;  1RKN A;  3EG0 A;  3T1H Q;  1UTI A;  1LJO A;  4C92 E;  1MGS A;  4A3D G;  3L2R A;  4WJ3 M;  5FU6 B;  5LJ3 f;  1KDB A;  3MJX A;  1AWJ A;  3Q22 A;  1RAG B;  1VUB A;  2RN8 A;  1CKM A;  1Z6H A;  2DL5 A;  2NZO A;  4P2C B;  4L5R C;  1QVF A;  2CWP A;  5CBE E;  3X3N A;  4GN4 B;  1WHK A;  5BN3 A;  2UUB Q;  3HP3 A;  3EA6 A;  1WFW A;  2K75 A;  1TWH H;  4HJ5 A;  2AQ1 B;  4M8A A;  4CDD C;  5CQX A;  3ULJ A;  2LCC A;  2RJC A;  2CH4 A;  1AOJ A;  4F7U E;  3LW5 E;  2QTV A;  4RTX A;  1FNW A;  1ZBX A;  1Q81 C;  1PD1 A;  1N9R A;  1FX7 A;  4M78 C;  3A98 A;  1ARK A;  1A62 A;  1LAC A;  3NSW A;  4DAV A;  3D6C A;  4AFQ C;  4J9C A;  2E2J B;  3S3N A;  1WCM H;  1F2Z A;  3A5Z B;  1QP2 A;  3JRZ A;  5M3M G;  1WX6 A;  2QQ9 A;  2DO3 A;  3JCM c;  2O88 A;  3AQQ A;  5CV6 A;  3G7L A;  1AEX A;  1VQA A;  5H1S E;  1PH1 A;  3MWY W;  1CKA A;  3OS0 A;  2UXB Q;  3M4Y A;  2EPD A;  4BBS B;  4QVC A;  2G6F X;  2HSP A;  1Q7Y R;  5EJW A;  4Y28 E;  2Z6K C;  3MFG A;  4H0L C;  5G3L D;  3OWE B;  1PSF A;  2QQB A;  2YUP A;  3FB9 A;  5CQY A;  2DGY A;  3PMF A;  5GRO A;  3GDE A;  1DOM A;  4K8I A;  1JJG A;  3TZU A;  2L3Q A;  1IZ6 A;  1OV3 A;  4M77 F;  3CW2 C;  3LGJ A;  3I56 A;  2JJ9 A;  3PTA A;  3OSS C;  4IOC A;  2VY3 A;  3VYU A;  3HOW G;  4KUI A;  3HOU B;  2A6E D;  2NUT B;  2Q2I A;  3H3V H;  5IXF A;  1R4Q B;  4LUZ A;  3ZEH A;  2AHO B;  2F0I A;  3ER0 A;  3JCM Q;  4AYB B;  3QXE B;  3BE3 A;  3CCM Q;  2V26 A;  5CKF A;  4IPG A;  5AJ3 L;  3VS3 A;  4D8K A;  4FSS A;  4C92 B;  4M75 E;  4ATO A;  1HTP A;  1QG7 A;  2A68 D;  2LY7 A;  4O1N A;  3J81 j;  3T1H L;  3GTJ B;  4M77 B;  5IGG A;  1JJC B;  5C3W A;  2ED1 A;  2FHT A;  3UWN A;  2MWP A;  1PKT A;  3FC3 A;  2WAQ G;  2JVV A;  1UHC A;  3KLS X;  2JA7 G;  1OX8 A;  5A2Q L;  2LTO A;  2LSS A;  2EQU A;  1E3P A;  3DB3 A;  2MFI A;  3CCJ T;  1V1P A;  1VQD A;  4OXP A;  2KE9 A;  3WXM B;  1SEB D;  5JJI A;  2K5N A;  3CXC P;  2UUC Q;  2F0M A;  1G2T A;  4M78 E;  1EYD A;  5C0X I;  2DRK A;  2HD3 A;  1E1T A;  4DV7 Q;  3U50 C;  2GVA A;  2Q2H A;  1R8O B;  1VQ7 T;  5A0G A;  2E4H A;  4R56 A;  2I0N A;  1YVC A;  4RTU A;  1TWA H;  2F0N A;  4EMK C;  3I55 A;  3QOL A;  3AB9 A;  1YHQ T;  3I72 A;  4BXX G;  1Y0M A;  1QCB D;  5FLM H;  1B9N A;  2GN5 A;  1SF9 A;  1K0R A;  2YHT A;  1G2S A;  3W1B A;  4DOW A;  2F0U A;  2L11 A;  1GUO A;  1K28 A;  4DFA A;  1DZ1 A;  3D0F A;  3GNG A;  3NPF A;  2F0T A;  1UE5 A;  2ID0 A;  2IWH A;  4N0A A;  2Q8T A;  2D5D A;  5C4J H;  4R55 A;  5FRN A;  2DYI A;  4C1N K;  1AD5 A;  5JEA G;  3GTM B;  4A3G H;  2KT8 A;  3S24 A;  1Z9Q A;  3DWQ A;  5CKB A;  3HGB A;  3ULL A;  5IIF A;  1MV3 A;  3FKI G;  3OYI A;  5CVI A;  2RO0 A;  1AEY A;  1TXY A;  1KLG D;  1V76 A;  1UB4 A;  2JYO A;  1X3E A;  5IP7 G;  3K59 A;  3C95 A;  2UU9 L;  5GAO p;  4JJN K;  3RIR A;  5KH6 A;  5CV8 A;  4F87 A;  1ESR A;  2UU9 Q;  1IL8 A;  2FIN B;  3I4O A;  1M90 C;  1HRJ A;  3EGD A;  2KCC A;  4DUY L;  2MQH A;  2YLB A;  5TSS A;  2YSQ A;  2LP5 A;  5M3F G;  4HMJ A;  4MNO A;  5M5W B;  2GF7 A;  1VQE A;  3PQI A;  4LAA A;  5IGC A;  4NPS A;  4A3F G;  4FW2 A;  4ME5 A;  2ED0 A;  2JN4 A;  5CR3 A;  3MEW A;  5GAN f;  4J1M A;  4HJ8 A;  2XGT A;  1KRT A;  4GOP A;  4LNP A;  1TY2 A;  4DR4 L;  2XIW A;  2KEC A;  2KCT A;  1FMV A;  2WAQ E;  4C2M H;  4OF1 A;  1SRU A;  2YV5 A;  5FOB B;  2P0Q A;  3HOZ G;  2IG0 A;  4K5W A;  2X4X A;  4YHH L;  1NPR A;  1B7T A;  2M00 A;  5EKL A;  2D62 A;  2WB1 E;  4IUR A;  6AT1 B;  1V9P A;  2FMM A;  3PUW A;  2O5I C;  4XTY A;  3I4M G;  1ZLM A;  4C5H A;  4DV3 L;  2MK5 A;  3G4S T;  3A7L A;  1WTV A;  1RTO A;  2F0H A;  2Q8I B;  4EX5 A;  4DV1 Q;  1RAH B;  1N9S A;  3HFO A;  1UDL A;  1X3F A;  4K2K A;  4ZKC B;  1HR0 L;  3M4O H;  2EXD A;  2VXF A;  3F2D A;  2JXB A;  3QZ9 B;  3NK9 A;  3L1A A;  5M3F B;  1PV4 A;  1F1B B;  3M57 A;  5KYY B;  2FG0 A;  4OIJ A;  1YJ9 Q;  3ND8 A;  1YHA A;  3EFS A;  1VQI A;  2HIX A;  1X01 A;  2KA7 A;  1TTH B;  1UJY A;  1SG5 A;  1R4P B;  1LM0 A;  1X3P A;  1WHJ A;  2LCL A;  4CRI A;  2VC8 A;  1HFG A;  2B2V C;  1HD3 A;  2F4I A;  4QL5 A;  3I5S A;  1BK2 A;  1SNQ A;  2NTS A;  1G3Y A;  4J7I A;  1IL2 A;  2BE7 D;  4JJD A;  4UAI A;  1PCX A;  5ELB A;  2A6H C;  2PNH A;  3CQZ H;  4DAY B;  4MML A;  2XRQ D;  1U1S A;  2BUD A;  3FIF A;  3R3O A;  3ULR B;  3DLM A;  2H3E B;  2Q8R E;  1X43 A;  3PO3 H;  4M78 G;  1GFC A;  3CC2 Q;  2CZ1 B;  4OMP A;  4HJA A;  1SRL A;  1N6A A;  2K4Y A;  3S15 H;  3W3A A;  1ACM B;  1A6X A;  2KRM A;  1Q82 R;  3H15 A;  1VQN T;  4DA4 A;  1JWM D;  1YHB A;  3HOX G;  3FJP A;  1X2Q A;  3O5Z A;  1QKX A;  3I55 T;  5LJ3 d;  2K32 A;  3MXP A;  3ONA B;  3PFS A;  2RQR A;  5C44 B;  3CCU Q;  4JI2 L;  4JYA Q;  4OMF B;  3V8K A;  4C92 A;  3C0C A;  2GFU A;  1D1A A;  3QSU A;  1H9M A;  3VR3 A;  3F1Z A;  1Q81 U;  4YIJ A;  2O5J C;  4BA1 I;  1XQH A;  4C3H H;  2RJD A;  1HNZ L;  2F5T X;  3QPH A;  3A1P A;  2KED A;  1ASY A;  2G9D A;  4QQB X;  1SJE D;  4HR7 B;  2QIL A;  5GMK h;  4RCB A;  3NBH A;  3S1M H;  4FT2 A;  1IYV A;  1MMD A;  5KYU A;  2QAS A;  1KC8 U;  4F7U A;  2PNR C;  4MTN A;  2CUD A;  4ZKB B;  3PMT A;  3VYH B;  2X4J A;  4ZTJ A;  3NXW A;  1PKS A;  2EGA A;  2QK0 A;  4M77 D;  2X6G A;  1D3B B;  1SHG A;  2F2X A;  3GD7 A;  3OIP A;  3Q6S A;  5GAO m;  4HED A;  4JS4 A;  1TII D;  4B3S Q;  3ERS X;  3OOC A;  2A8V A;  2C0I A;  2L1B A;  1QCF A;  2E5Q A;  3BVM A;  1RL2 A;  2OTJ Q;  1M90 R;  1WCM B;  1BCM A;  5KYX B;  1VQL A;  3QBY A;  5FLM G;  3VU3 C;  5FU6 C;  3S2H H;  2JS0 A;  5HK3 A;  3RUZ A;  4HIM A;  1RIP A;  2K6A A;  5GAN d;  1G3W A;  2N8N A;  2WB1 G;  1UGQ B;  1ZQ1 A;  1SR3 A;  2V1C C;  3W2D A;  4A4F A;  1OTC A;  3TS2 A;  1R77 A;  4KHP Q;  4E7Z A;  1T3L A;  1TWH B;  3HEJ A;  1ET9 A;  4QF4 A;  2F1M A;  1G8Z D;  5EPJ A;  4ABN A;  3Q1J A;  4RWS C;  1CT1 D;  2K5L A;  2KGT A;  4GLM A;  3SWN A;  2LT4 A;  4ELZ C;  1X32 A;  2KHS A;  1W2B S;  3RKW A;  3SFM A;  2EJF C;  3UI2 A;  5IP7 H;  2E65 A;  5K36 G;  1WDX A;  1ABO A;  4FP5 D;  4FXG C;  2UUA L;  3RZO H;  4L6T B;  5C3E G;  4Y52 H;  1KL9 A;  2YLC A;  5D6Y A;  1YCY A;  3PIO A;  3HOW B;  1YN8 A;  1QVG S;  4XTW A;  4LUD A;  5IHK A;  4HCB A;  3OYG A;  1TT2 A;  2HKQ B;  4LD9 K;  4A76 A;  2DY7 A;  1PDQ A;  2XWB B;  5HGT A;  1SNP A;  2RPN A;  1WTR A;  3TS0 A;  3BJU A;  1S72 Q;  4QGU A;  4AYB E;  2KOL A;  4AMC A;  2NVX B;  3PSI A;  4HCK A;  1OXT A;  3SWN C;  4JI5 Q;  1GJX A;  3K57 A;  5FK9 C;  2DF6 A;  1YFN A;  1B50 A;  4EMH A;  1DXM A;  4X62 Q;  1Y8P B;  4A3I G;  4DR7 Q;  3PUX A;  4FO2 A;  3VR4 A;  2Z4H A;  4BY1 H;  4PFP A;  1HQR D;  1J5E Q;  1SSF A;  3PO3 B;  3VR6 A;  1GD7 A;  4N8X 1;  2MNA A;  4PZ7 A;  1KHI A;  1PFS A;  1ICW A;  1K73 C;  1EY8 A;  4L6V 5;  3IL8 A;  4LDV A;  5HGQ A;  2EJ9 A;  4K8J A;  2L9H A;  5CV4 A;  1WI5 A;  5GMK l;  1XTC D;  1K3R A;  4DEX A;  4LE9 A;  1QNK A;  3M9B A;  2R7Z H;  1SFO B;  3I56 T;  4X1V A;  4C3I G;  1BNZ A;  4UDU C;  2CP2 A;  3OYB A;  4LF8 L;  3QZ5 B;  2OEO A;  1VYT A;  2Y90 A;  3TVT A;  1FD7 D;  2B3G A;  4K6L A;  4IZ8 A;  4C56 C;  5FO8 B;  1GUT A;  1J9O A;  1JWU D;  4BY7 G;  1BCP C;  1AP0 A;  1CSK A;  3D4D A;  4QUF A;  4PNY A;  1U5S A;  3KDF A;  1Y7X A;  2JA6 H;  1Y96 A;  1BI2 A;  5L23 A;  1SXT A;  3H8Z A;  1GKH A;  3MP6 A;  1PFM A;  2M1H A;  1XNI A;  2Q2T A;  4PMW A;  4V19 0;  3JAM i;  3BDL A;  1VF7 A;  3J7A 5;  1QZG A;  2F0F A;  3CEY A;  4LFB Q;  4DBR A;  4DV0 Q;  1VQP Q;  2RVL A;  2O31 A;  5GAN e;  3TP7 A;  2JN0 A;  2PQA A;  2QEX A;  2LJ0 A;  2NYS A;  2WFW A;  4K5V A;  1M2V A;  2GCX A;  4G7Z C;  4XT3 B;  2BIV A;  3DEO A;  1BKB A;  4AFS C;  3ND9 A;  3QII A;  1SE3 A;  2Z9H A;  3HOX H;  1G5V A;  4BBS G;  4XU2 A;  4PMC A;  2AT1 B;  2N78 A;  3X25 B;  4NOY A;  4KGV B;  1QOH A;  4CJ1 B;  3CC4 Q;  1I5F A;  4A3C G;  4JV5 L;  4AQY Q;  2DZC A;  1E2W A;  1JC7 A;  4JBM A;  1IBM L;  4Q0F A;  1B44 D;  1SSH A;  2O9V A;  1PVO A;  3WVD B;  3CBP A;  2KBT A;  1WHL A;  3CC7 T;  4WJW A;  1SRM A;  1WJQ A;  1QCN A;  3M56 A;  2HUG A;  4FT4 A;  4J6H A;  4DR1 L;  3H41 A;  4M7D B;  4K6D A;  5FO7 B;  2L5Q A;  1O7Y A;  5CK9 A;  3EIV A;  1VQO Q;  2I46 A;  4XQN A;  1KD1 C;  1EFI D;  2DZ9 A;  1GHJ A;  1VDZ A;  3NBH B;  3UA7 A;  3JCM g;  1MIU A;  2K57 A;  4LD6 A;  3JCM P;  2E8G A;  2B2Y A;  1IBM Q;  2EY5 A;  4RH6 A;  5J1Z A;  3BDU A;  1TU2 B;  4X65 L;  4ULL A;  3HOY G;  4HVV A;  3RER A;  1TWG B;  5EQ0 A;  2CGH A;  1D6E C;  2F0V A;  3EGD B;  1Y14 B;  1IW7 C;  2FFK B;  3EHQ A;  1MBY A;  2CH4 W;  2JTM A;  4UP9 A;  4JI6 Q;  3NPP A;  3BZD B;  1FYN A;  4DUY Q;  2BA1 A;  4DK0 A;  1WOC A;  4BE1 A;  1KG1 A;  3MET A;  3STB C;  3I4L A;  5IYC G;  5ELN A;  5L37 A;  2E1H A;  5JJK A;  4GN5 A;  1YWP A;  2AMC B;  1M2V B;  4EDU A;  3INZ A;  4HT9 A;  4AH6 A;  2DX1 A;  2RSN A;  1TXQ A;  3V2T A;  1XPU A;  2F3I A;  2VB6 A;  1TS3 A;  2PZU A;  3I55 Q;  4G7O C;  5GAN h;  4HN7 A;  4OEL B;  3O8V A;  2M2L A;  3OS2 A;  1WTW A;  1I4G A;  4YY3 L;  1VQN Q;  2D1X A;  3E5S A;  4JI1 L;  4ZGD B;  2AKK A;  1I8F A;  4JCV E;  2LQN A;  1IKL A;  2HCI A;  2IX0 A;  2VGM A;  2VQE Q;  3M55 A;  1QKW A;  4KKT A;  4ZUI A;  2K3Y A;  5LJ5 f;  5M3M B;  5M9O A;  3CCQ T;  1GXD C;  2OQ0 A;  2ZPH B;  4OGQ C;  1M1G A;  2EDG A;  3EFR A;  2A19 A;  4JLG A;  4Y7N H;  2ZAE A;  4P5N A;  5IP9 H;  3S1R H;  1I6H B;  2PNI A;  2R7D A;  1X75 C;  3CPF A;  2FZC B;  1MJC A;  3OYJ A;  1Q90 A;  1T3S A;  1ZXT A;  2VB2 X;  1PTO H;  3DXJ C;  1PFN A;  1QWY A;  2HQL A;  3OSO A;  4JW0 A;  4S3S A;  2EVR A;  4X3T A;  4DUZ L;  3EFO A;  2HDL A;  3BVZ A;  2PPB C;  1YNJ C;  2KCM A;  4OEM B;  2UUC L;  3GTO H;  4HJ9 A;  5EG2 A;  3G6E Q;  4A3E G;  3GTQ H;  5I2M A;  4IUN A;  3UE0 A;  5CAI A;  4MZT A;  1HH2 P;  4A3D B;  3IFT A;  3U4V A;  3TQ7 P;  4JJC A;  2NBF A;  1KNE A;  5CKE A;  1HZA A;  4EVO A;  1X54 A;  1EIY B;  1HQM C;  1RHP A;  4MMK A;  2EQM A;  5GAN 8;  4ALP A;  2B63 G;  3HRS A;  5FRM A;  4M7D G;  2JEB I;  3CCR A;  2AKW B;  2K7V A;  4CDF C;  4F7U G;  4YWL A;  1S3O A;  5LHY 1;  4I65 A;  2CP6 A;  1FNV A;  2A69 D;  1PC0 A;  1U9R A;  1LTA D;  2PZT A;  1O78 A;  3EGU A;  1VMP A;  3QOJ A;  4B3R L;  4A63 B;  2EYP A;  4C3J B;  3E6Z X;  2VW9 A;  1G2B A;  1H9K A;  3I4N G;  5KYW A;  1C0M A;  3P75 A;  1X55 A;  1MNE A;  2B86 A;  1OZ2 A;  3SK4 A;  4C3J G;  2RHY A;  1TUD A;  4GOP B;  4ODG A;  1M9S A;  4FXD A;  2A68 C;  3WWV A;  2G9H D;  3NTK A;  1KFZ A;  2CSQ A;  4M77 E;  1VQH A;  3OYM A;  1JB3 A;  1O7L A;  1LLR D;  1XPR A;  3UAT A;  3FHW A;  3S17 B;  5FJ8 G;  4N9P A;  4G4K A;  3BW1 A;  2HQH A;  1I4R A;  4YWK A;  3JCM J;  3TP6 A;  3JCM W;  1FJG Q;  2ZGW A;  4BXX H;  3MP1 A;  5LJ3 e;  4AG1 C;  5IY0 A;  2JA6 G;  5ELE A;  5KE3 A;  3NWS A;  3H09 A;  1JOO A;  1JT8 A;  2JS2 A;  3M0R A;  3RKY A;  1PYS B;  2NZ1 D;  4FF4 A;  3JB9 G;  2Z6K A;  1QUQ A;  1HNW L;  3ULP A;  4NMZ A;  2JUF A;  1UE9 A;  4E7K A;  2V1Q A;  1TY0 A;  1D1B A;  3CQT A;  4PLL A;  3UDX A;  4C8Q F;  5JEA H;  5LJ5 e;  4OMQ A;  1WIE A;  2JK8 A;  4GNX B;  1TQO A;  2XVS A;  4M7A G;  1JB0 E;  1ZBJ A;  2DE0 X;  1V8Q A;  1STG A;  1WCM G;  1UJ0 A;  3DKM A;  3GOX A;  3MEF A;  3HTR A;  1D09 B;  1K0S A;  1YI2 Q;  2F3W A;  1K9M C;  2N49 A;  2KQ3 A;  4CHT B;  1PRT F;  5KYX A;  5E4X A;  2A5H A;  1WGS A;  4OIK A;  2R7F A;  1UAP A;  1TWF H;  1IB8 A;  1NJI R;  1VQ8 A;  4C8Q G;  1VQ7 Q;  5I11 A;  2CVR A;  2L89 A;  2RK2 A;  4LF6 L;  4J9I A;  1I0C A;  2E5K A;  3IAY A;  2L55 A;  4BBR H;  5FU7 B;  4LXC A;  1M2O A;  1GCQ C;  1EX4 A;  3EAE A;  5IGB A;  2O4X A;  1H8K A;  2BTT A;  3CCM A;  1JR0 D;  1C8C A;  1IGQ A;  3J80 i;  1HNX L;  2JA6 B;  5KCO A;  2RHX A;  5IYD G;  2ABL A;  2EKH A;  2QDB A;  5J3B A;  4KD4 A;  5KGU A;  3H6M A;  4ZK9 B;  2VUB A;  1NG2 A;  2NN6 I;  4N8F A;  5KYW B;  4MDW A;  3CD6 T;  4DV5 Q;  4IUV A;  2MO1 A;  2E2H H;  4AG2 C;  3PUY A;  4K14 A;  2DEQ A;  1S5F D;  1XJW B;  1AE3 A;  2HZY A;  3RMQ A;  1GL5 A;  5JVH 3;  4LDY A;  1JEG A;  2EKO A;  2JQO A;  3MTS A;  4CKB A;  4A3G B;  3KUP A;  4KK7 A;  4B6M A;  2C0O A;  2LQK A;  3K6O A;  2KDS A;  4UP8 A;  4C3H G;  3FRP B;  1CA6 A;  5IWA Q;  2V8K A;  1A15 A;  1I50 B;  3EBE A;  1M1F A;  5KNC A;  1PTO C;  2FRY A;  1K0X A;  3TU4 K;  1ZSZ A;  2V1R A;  4AIM A;  1YHQ A;  2YTX A;  2QDY B;  4XTX A;  4ANJ A;  3FKI B;  3MXN B;  1CTM A;  2WIN B;  5I6W A;  2JM8 A;  1A0N B;  5D6W A;  3MPU B;  2CW0 C;  1CK1 A;  1E24 A;  2FMC A;  5EKK A;  4A3D H;  4YWM A;  4M78 D;  1MJE A;  2KR3 A;  2VZA A;  1A3V A;  4QIW B;  1C9O A;  1MGQ A;  3THK A;  3GTO B;  3K5M A;  5FW9 A;  5LMN W;  4HKE A;  1RTN A;  3MZ5 A;  4JZ4 A;  1PRT C;  1GUS A;  5I2S A;  3STB D;  1K8A U;  4CJ2 C;  1CUK A;  1D7Q A;  1HK9 A;  2NVT H;  2JA5 B;  2SEB D;  1NMG A;  1H9R A;  1U5K A;  2XK0 A;  2FO0 A;  2RF0 A;  4Y91 A;  3S1R B;  4JI0 Q;  1EU3 A;  3RR5 A;  4DPG A;  5ELD A;  1NY4 A;  4JK1 C;  3HOW H;  1QW1 A;  2P4R A;  4J7F A;  3CME Q;  1C1A A;  4IKF A;  4CDE C;  1ET6 A;  1F9S A;  5EPL A;  3T53 B;  4F04 B;  5M3M H;  1RCV D;  2O2L D;  1W3S A;  2CWA A;  4B3M Q;  1M8A A;  4IIM A;  5C3X A;  2JM9 A;  2W10 A;  1WQW A;  5DY9 A;  2UXD Q;  5JOB A;  1RDP D;  3ERQ A;  4TQU S;  1SPK A;  2MI6 A;  1HTL D;  3F8T A;  4BI4 A;  4FF2 A;  3C94 A;  3I4M B;  1RI0 A;  2DIG A;  3VS6 A;  5GAN j;  1B1Z A;  3C3L A;  3UDI A;  2KI7 A;  4C0G A;  2FEI A;  3OW2 P;  2KMT A;  1ICF B;  1NCV A;  2LXJ A;  4X9D A;  2K2V A;  3HOU H;  4A3B H;  1GXI E;  2FXQ A;  3DB4 A;  4DV2 Q;  2F0W A;  5CYU A;  1XJV A;  4WJ4 A;  1MMN A;  1D3B A;  2LQW A;  3CPW S;  2EY2 A;  1Q8K A;  4QVD A;  3CCU T;  1XXG A;  4ZYS A;  3H0G B;  3S2D H;  3D4W A;  3BYT B;  4OB1 B;  3T4A C;  5GAD C;  3RZD B;  2K3B A;  2M0Y A;  3I4N H;  2UXD L;  3CCU A;  2KAF A;  4HSP A;  1VYU A;  2XDB A;  1V43 A;  1PH6 A;  2VNU D;  3KBX A;  2RQU A;  4C8Q E;  3L2V A;  4M7D F;  4E2F B;  4DR6 Q;  5A0D A;  3U9S A;  1G3S A;  4OO1 G;  3VS2 A;  1EYA A;  3EGX B;  1IXR A;  3G7Z A;  1WQ7 A;  5I2Y A;  1YJ9 A;  1TWA B;  1N5Z A;  4RTZ A;  3CRK C;  3GO5 A;  2RA4 A;  3D3R A;  3I91 A;  4YCV A;  3BS1 A;  3CCE Q;  3I9Q A;  1B9M A;  1ENA A;  1QVC A;  4DR7 L;  3CF5 A;  4A3B B;  4J9F A;  1M30 A;  2A08 A;  1ABQ A;  3NMZ C;  1N8R U;  1EWH A;  2KVM A;  3QB3 A;  2JA7 H;  1DJ7 B;  4CKC A;  4U67 3;  3RBB B;  1EY0 A;  2VUM H;  1B07 A;  1EQT A;  2LJ1 A;  2RHZ A;  3I73 A;  3CCS Q;  2EFI A;  1YIT A;  4B3R Q;  4HSV A;  3VS4 A;  3X24 B;  2G3R A;  4C5G A;  4EMK A;  1VQ9 A;  3G71 T;  2I5L X;  1D2B A;  1VQL Q;  4J9B A;  4V2S A;  1Q8I A;  5LJ3 h;  1JOK A;  2X6L A;  5K5P A;  4GZY C;  1EZZ B;  4ZNX A;  1SNO A;  2B39 A;  4BDY A;  1HUM A;  4DAY A;  3CC4 T;  1VQP A;  1W6K A;  4NDX A;  1Y96 B;  2B2W A;  5IT9 c;  1OXS C;  1U0L A;  5DLO A;  2K5H A;  3G71 Q;  3TME A;  4L5S A;  1KXL A;  1GOZ A;  1SKU B;  2E41 A;  3OSV A;  5EGT A;  4OVA A;  3X26 B;  1PH7 A;  2HDA A;  1LO5 D;  1JWS D;  1AT1 B;  1OPK A;  5IGD A;  2UXB L;  3D6W A;  4ZN3 A;  1X2K A;  2CT3 A;  4P73 A;  4DR2 Q;  2J7Z A;  1ZUY A;  1RAE B;  3PO2 G;  2JP1 A;  1MHW C;  2WSC E;  2X51 A;  3FKI H;  4TVA B;  2D0N A;  3TRZ A;  4J6X A;  1MKH A;  2HAX A;  3K80 C;  5IGF A;  4A3I H;  3OS1 A;  5CMD A;  4FU6 A;  2HIV A;  1TWC B;  1YJN T;  2KYB A;  1UEC A;  2PCF B;  5CV7 A;  1PH5 A;  3JCM X;  3QYG B;  1DON A;  4M77 A;  2OWO A;  1VIE A;  5D65 A;  2BE5 C;  3K5N A;  3OW2 S;  3WVE B;  1YJW T;  2ZT9 C;  4R4I A;  4WTO B;  1BF4 A;  1CFM A;  4A3F H;  4N4G A;  1SDF A;  4LF6 Q;  4I7Z C;  1G83 A;  4OMO A;  2NVQ H;  3QWN A;  2YT6 A;  3CPW P;  2L4N A;  4CBV A;  1K73 U;  3QJY A;  2DVE A;  3QKJ A;  2FRW A;  2E2H B;  2DPP B;  3JCM e;  1Q7Y C;  1KJW A;  2OI3 A;  1LT4 D;  4C92 D;  1X3Q A;  1MMG A;  4DAM A;  5EC7 A;  1BI1 A;  3J81 E;  1AVZ C;  2KCN A;  4GKK Q;  5ECA A;  5HCK A;  2BZY A;  3RLN A;  4C3I B;  1WPY A;  4M7A E;  3M59 A;  4LDU A;  1JQY D;  1X65 A;  5CKH A;  4QUC A;  1O75 A;  3NTI A;  1KAA A;  3TP5 A;  4ZTF A;  1I1J A;  2F5K A;  3EG9 B;  1F2M A;  4K2L A;  1L1O B;  3L2Q A;  1YCS B;  1KQS S;  3VKI A;  3E9H A;  4ZUJ A;  1NAP A;  3A8G B;  1BCP F;  1M8M A;  1JE5 A;  4DBH A;  3VA7 A;  1HR0 W;  1O7I A;  2RNA A;  1M8V A;  4P72 A;  3UT1 A;  3LGF A;  2F2V A;  2KUM A;  4DR1 Q;  5AFW A;  2K5W A;  2KY9 A;  1ML0 D;  1PHT A;  2WV6 D;  4JI5 L;  2VWF A;  5FU7 C;  4FIB A;  2ASB A;  2HL3 A;  4AQY L;  3NTH A;  2Z0S A;  2UUB L;  3S3M A;  1SE8 A;  2RF4 A;  4HIK A;  4JI4 Q;  4IPD A;  1JB7 A;  4BE0 A;  3A56 A;  1B2T A;  3MXG A;  3HKZ E;  4K5X A;  4R8N A;  1B53 A;  1LTG D;  2ZM6 L;  1VQ9 T;  5IYB G;  1VQ5 Q;  5KIX A;  1Z9F A;  2H5X A;  2A0F B;  4M78 F;  2DIQ A;  3GP7 A;  4IQZ A;  4CC2 A;  3RLO A;  2LX9 A;  5BR8 Q;  5FLX c;  2GA4 B;  2Z1C A;  3FEW X;  4PZ8 A;  2LRQ A;  4N9T A;  4E6R A;  4QW2 A;  1SE4 A;  3HSB A;  4J6W A;  1I4K 1;  4RCO A;  1B4O A;  5DEH A;  3AFP A;  3J80 L;  4C5I A;  4GY5 A;  3ZJY C;  1SYB A;  4PFO A;  1IYU A;  3X3M A;  4HCZ A;  3P8H A;  4RTV A;  2F0J A;  4GS3 A;  2IPK D;  2YTV A;  3RN5 A;  1UUE A;  2V8J A;  2CUB A;  4KGX B;  2F1L A;  1B3Q A;  4APV A;  3RKX A;  2QEJ C;  1VQO A;  5JPM C;  1NBE B;  3TBI B;  3KUF A;  4YHH Q;  3SHL A;  1EWI A;  2PUO B;  1NJI U;  1JCK B;  3OQ5 A;  4BAC A;  4FXK C;  1YNZ A;  5GJW B;  1TH7 A;  4CC7 A;  1KLU D;  2LMC B;  3HS0 C;  3S1Q H;  3G48 A;  2JNG A;  4LF5 L;  2KHI A;  5C44 G;  4PL6 A;  1NTG A;  1HNW Q;  1SYE A;  4LDX A;  1TVX A;  5C0M A;  2RK1 A;  1K83 H;  1PFB A;  1RI9 A;  1QE6 A;  4TKO B;  1D1K A;  3S1N H;  1D0X A;  1YJW Q;  2KEA A;  1PH3 A;  3JCM V;  4FF3 A;  4E7J A;  2L8D A;  1X3G A;  4JOI C;  3RES A;  1Y1W B;  5I6Y A;  1VQJ A;  1VYV A;  2DRM A;  5CBA E;  2E6Z A;  4OB0 B;  1KD1 U;  1X9N A;  3A0J A;  5M5X B;  1QWE A;  3R6O A;  1EWC A;  4FL6 A;  4BE2 A;  3Q24 A;  3K7U C;  5HY6 A;  1HCZ A;  2RDF A;  4GLX A;  3QIA A;  2EE1 A;  1HJP A;  4A3K B;  3JCM f;  5FWB A;  3REA B;  1R9T B;  3PGZ A;  1AWX A;  2DL3 A;  4JUV A;  1FYC A;  3A8J E;  4C5E A;  1HUN A;  3QDR B;  4IO9 A;  1VQ4 Q;  1PXU A;  3CC7 Q;  4RTY A;  1XPO A;  1QUQ B;  3FMC A;  1EY7 A;  4BS9 A;  3CCJ Q;  1W70 A;  1VQ9 Q;  2BDN A;  3FJ5 A;  1OO9 B;  4BY1 G;  2MCN A;  3I7F A;  3DUZ A;  1WYX A;  3TEE A;  1L1O A;  2YWW A;  5CO7 A;  1Y07 A;  4DR5 Q;  1JQQ A;  2EGC A;  3QO3 A;  3L9A X;  4LNQ A;  1KIK A;  1BR9 A;  2F0L A;  4XIG S;  2L15 A;  4A3C H;  4JBJ A;  1X69 A;  4QCL A;  4LWC A;  2ZZD A;  5JVG 3;  1OPL A;  1D0Y A;  2UXC L;  4KUL A;  2NWG A;  1UEB A;  2IIM A;  2F69 A;  2D2C C;  4GKK L;  4DXG A;  3EH2 A;  4F7U B;  5IYD H;  4AFU C;  1TR5 A;  2EYO A;  5M5Y H;  1U1T A;  3PV0 A;  2N88 A;  2AQ3 B;  2DEU A;  4C0D C;  1F9R A;  2IPO B;  4M7D E;  2OF1 A;  3J7Z C;  3EVQ A;  1ZSZ C;  2A69 C;  4Q5W A;  3HKZ B;  2AKL A;  1L2F A;  3R2I A;  1NEG A;  2E6N A;  3I35 A;  1F2Y A;  2AWN A;  2B2U C;  5IH2 A;  3OY9 A;  2H4O A;  4LMQ D;  3A8O B;  2FZK B;  3HOY B;  3SR1 A;  4RUG A;  1VQB A;  2Z4I A;  4DV1 L;  3J7A F;  1MUZ A;  1VMC A;  4DV3 Q;  4DV6 Q;  1I3Q H;  3S16 H;  2M02 A;  4PJO E;  3HG9 A;  5C6A A;  3GTG B;  5EPK A;  4DK1 A;  3HFN A;  1UNS A;  3EN2 A;  1SLJ A;  2EBP A;  1BYM A;  3AYH B;  4FDB A;  5GAN 7;  4L8J A;  2Z8L A;  4C3I H;  3VRZ A;  2NVT B;  2HBW A;  5GMK e;  3M7G A;  1ZA1 B;  5DM7 R;  3C1F A;  5C5M A;  5KEE A;  4BY6 C;  4JI3 Q;  3A8M B;  4X66 Q;  3KLR A;  1L0W A;  2ZTC A;  4UP7 A;  4A3J H;  3GTP B;  1HA5 A;  1YNN C;  1PLF A;  1HNZ Q;  1M3C A;  1N32 L;  5GAE C;  3LLR A;  2DY8 A;  4JI6 L;  2VKN A;  3OYN A;  2WSE E;  4DU9 A;  4ZQ3 A;  1TS9 A; 
#chains in the Genus database with same CATH homology
 2XMF A;  4J9H A;  2J6F A;  1QWF A;  4QT7 A;  1SHF A;  2A37 A;  1JXO A;  2PNI A;  3VRY A;  2LCS A;  1T3S A;  1K76 A;  4J9E A;  2EYX A;  3VS1 A;  2EVR A;  3QWX X;  2PZ1 A;  3GBQ A;  2EYY A;  2K79 A;  2J06 A;  4K11 A;  4ESR A;  1U3O A;  4JJC A;  1BBZ A;  4EIK A;  3TSW A;  3LH5 A;  2A36 A;  4CC3 A;  1GCP A;  1JXM A;  2AZV A;  1ZSG A;  2CSI A;  4IIO A;  2EYZ A;  3EGU A;  1XOV A;  4Z88 A;  4A63 B;  1T0H A;  1G2B A;  2JMA A;  2K2M A;  4HXJ A;  2B86 A;  1TUD A;  2X3X D;  1TUC A;  1JU5 C;  3EG0 A;  2CSQ A;  1AWW A;  1KFZ A;  1UTI A;  1WLP B;  1NLO C;  2PTK A;  3UAT A;  2QDL A;  2CT4 A;  1AWJ A;  2LX7 A;  1RLQ C;  2RN8 A;  2GTO A;  2DL5 A;  4AG1 C;  1WFW A;  2RQW A;  2JS2 A;  3M0R A;  2CH4 A;  1AOJ A;  2DL4 A;  1UE9 A;  1V1C A;  4RTX A;  2V1Q A;  1ARK A;  3A98 A;  3CQT A;  3JV3 A;  4OMQ A;  4AFQ C;  1WIE A;  2EW3 A;  4J9C A;  1ZBJ A;  1WX6 A;  2DE0 X;  1UJ0 A;  1K0S A;  2O88 A;  4LUE A;  1GRI A;  2OAW A;  3M0S A;  1CKA A;  2VVK A;  1ZUU A;  2EPD A;  2G6F X;  2HSP A;  5I11 A;  1PRM C;  4J9I A;  1I0C A;  2E5K A;  3SEM A;  1X27 A;  1Z9Z A;  4M4Z A;  2YUP A;  1GCQ C;  2YUN A;  1H8K A;  2BTT A;  3QWY A;  2L3Q A;  1OV3 A;  1LCK A;  2ABL A;  2EKH A;  1E7O A;  2RQV A;  2GTJ A;  5IXF A;  1NG2 A;  1VA7 A;  4AG2 C;  3H0F A;  1AWO A;  1Y57 A;  1M3B A;  2J6K A;  1GL5 A;  1NM7 A;  1W1F A;  1JEG A;  3VS3 A;  4D8K A;  2LJ3 A;  1KSW A;  4FSS A;  1HSQ A;  2C0O A;  5FWC A;  2ED1 A;  3R6N A;  1PKT A;  1UGV A;  1UHC A;  4AFZ C;  1WI7 A;  2DMO A;  1K9A A;  2FRY A;  1K0X A;  2KE9 A;  2V1R A;  2GQI A;  4HVU A;  4R0K A;  2HEQ A;  1RUW A;  2JW4 A;  2JM8 A;  2DRK A;  2RMO A;  1A0N B;  1M3A A;  1EFN A;  2I0N A;  3PVL A;  2KR3 A;  2FPE A;  2CRE A;  3EG3 A;  4RTU A;  3THK A;  1GFD A;  5FW9 A;  2J05 A;  2DNU A;  1Y0M A;  4JZ4 A;  2DVJ A;  3M0T A;  2DL7 A;  2AK5 A;  2KRS A;  2FO0 A;  2RF0 A;  1SEM A;  3NPF A;  2F2W A;  2P4R A;  3H0I A;  4Z8A A;  2DYB A;  4Z89 A;  2JTE A;  1AD5 A;  2KT8 A;  1AZE A;  1Z9Q A;  4IIM A;  1MV3 A;  2JM9 A;  2W10 A;  4F14 A;  2K7A A;  1AEY A;  3UA6 A;  1SPK A;  1BU1 A;  2DLP A;  2KT1 A;  2O9S A;  3VS6 A;  2FEI A;  2NWM A;  2YSQ A;  2KRO A;  2LP5 A;  2LQW A;  2EQI A;  4KRT A;  2ED0 A;  3IQL A;  1CKB A;  2K3B A;  2DJQ A;  2M0Y A;  4LNP A;  1VYU A;  2RQU A;  2FPF A;  2MIO A;  3VS2 A;  2DA9 A;  1PRL C;  1GBQ A;  1N5Z A;  4RTZ A;  2DBM A;  2YUO A;  1ZLM A;  4HVW A;  1GCQ A;  1WXB A;  3I9Q A;  1QLY A;  1M30 A;  2A08 A;  1ABQ A;  3NMZ C;  4J9F A;  1UDL A;  1ZUK A;  2L2P A;  3KFV A;  2JXB A;  3RBB B;  2K9G A;  3NGP A;  1B07 A;  2FG0 A;  1TG0 A;  2GGR A;  2LJ1 A;  4JZ3 A;  1UJY A;  3VS4 A;  2JMC A;  3VS5 A;  1K4U S;  3EG2 A;  4J9B A;  1HD3 A;  2ENM A;  3I5S A;  1BK2 A;  4ZNX A;  1AZG B;  2OJ2 A;  4JJD A;  2A28 A;  4OMN A;  3ULR B;  1X43 A;  2H8H A;  2DIL A;  2HDA A;  1PWT A;  1OPK A;  3REB B;  2L0A A;  1GFC A;  1X2K A;  2CT3 A;  4OMP A;  1ZUY A;  1SRL A;  2DM1 A;  2KXD A;  4CC4 B;  2KRM A;  2D0N A;  4F16 A;  2KYB A;  1NYG A;  3O5Z A;  1UEC A;  1X2Q A;  1QKX A;  2KYM A;  2RQR A;  3C0C A;  1UHF A;  2K6D A;  1NYF A;  1G83 A;  4OMO A;  2YT6 A;  2FRW A;  2SEM A;  1KJW A;  2CUD A;  2OI3 A;  1PNJ A;  5EC7 A;  2RQT A;  3PVQ A;  2ROT A;  1AVZ C;  1PKS A;  2DBK A;  2EGA A;  5ECA A;  2GNC A;  5HCK A;  2BZY A;  1SHG A;  2F2X A;  4DEY A;  2BZX A;  2J6O A;  2NUZ A;  2C0I A;  3U23 A;  1QCF A;  1I1J A;  2MOX A;  1E6H A;  1S1N A;  1YCS B;  1FMK A;  2LMJ A;  1M8M A;  1RLP C;  1W6X A;  2L3S A;  2ECZ A;  2JS0 A;  2LZ6 B;  2KRN A;  2RNA A;  2LNH B;  1YP5 A;  2F2V A;  1PHT A;  1T3L A;  1UFF A;  2KGT A;  2VWF A;  4GLM A;  1UG1 A;  1H92 A;  1WDX A;  1ABO A;  4LN2 A;  1YN8 A;  2J7I A;  1T0J A;  4LUD A;  5IHK A;  4GBQ A;  2DL8 A;  2C0T A;  4OMM A;  1JO8 A;  2RPN A;  1X6B A;  4CC2 A;  1MV0 B;  4HCK A;  4E6R A;  2AZS A;  1WXU A;  2DF6 A;  3M0U A;  2D8J A;  4RTV A;  4D8D A;  3EG1 A;  1YWO A;  5IXB A;  1UUE A;  2CUB A;  1B3Q A;  3NHN A;  1YNZ A;  1J3T A;  4DEX A;  4LE9 A;  5GJW B;  4CC7 A;  1GBR A;  1OOT A;  4X1V A;  2X3W D;  3EHR A;  1VYT A;  3TVT A;  3H0H A;  1RI9 A;  2D8H A;  2M51 A;  4J9G A;  2KEA A;  4F17 A;  1CSK A;  1ZX6 A;  1WXT A;  1VYV A;  2DRM A;  3SHW A;  1X6G A;  1U5S A;  4OML A;  5IHI A;  1QWE A;  4ORZ A;  5L23 A;  3I5R A;  2KXC A;  4WCI A;  1BB9 A;  2GBQ A;  3PE0 A;  4RTT A;  1K1Z A;  5FWB A;  2L3P A;  1NLP C;  3REA B;  2HCK A;  3M0P A;  1AWX A;  2DL3 A;  2O31 A;  2LJ0 A;  4RTY A;  1W70 A;  4AFS C;  3FJ5 A;  2KNB B;  2MCN A;  2ROL A;  4J9D A;  1WYX A;  3UF4 A;  5IHN A;  5I22 A;  1JQQ A;  2EGC A;  1KIK A;  2BZ8 A;  1X69 A;  4JJB A;  4JPB W;  1I07 A;  1WA7 A;  2W0Z A;  1SSH A;  2O9V A;  2KBT A;  1OPL A;  2YDL A;  1SRM A;  2SRC A;  2EYW A;  3M0Q A;  3H41 A;  2IIM A;  3TSZ A;  4AFU C;  2EGE A;  2FPD A;  1E6G A;  3VS0 A;  3UA7 A;  1OEB A;  1NEB A;  1IO6 A;  3ZL7 C;  4HVV A;  1HJD A;  4RTW A;  2AKL A;  1NEG A;  3I35 A;  5IH2 A;  2CDT A;  3EHQ A;  2CH4 W;  4RUG A;  1H3H A;  1FYN A;  1MUZ A;  5GJV B;  3VS7 A;  1YWP A;  1M27 C;  1U06 A;  4Y92 A;  2EBP A;  2DX1 A;  3VRZ A;  2HBW A;  3RNJ A;  2ESW A;  2YUQ A;  2JT4 A;  2D1X A;  2AKK A;  2O2O A;  1M3C A;  2LQN A;  2VKN A;  1QKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...