4JPBW

The structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
140
Chain Sequence
LKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheA
publication title The 3.2 angstrom resolution structure of a receptor: CheA:CheW signaling complex defines overlapping binding sites and key residue interactions within bacterial chemosensory arrays.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Immune system
total genus 28
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jpbW01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 4jpbW02
3UATA 2CSIA 1ZBJA 2K7AA 3THKA 1UHFA 2DBKA 1Y57A 2I0NA 1UJ0A 2D8HA 2K79A 2A28A 1AZGB 1E7OA 2K3BA 2DL8A 2O88A 1K0SA 1OPKA 2JMAA 1VA7A 2JMCA 2KRMA 1JXOA 5HCKA 2A36A 2HEQA 1GBRA 3NMZC 2J6FA 4OMPA 2J6OA 1I07A 1ZX6A 2DA9A 2ECZA 3UA7A 4D8KA 2GBQA 1K9AA 1AWOA 2EGEA 3M0RA 4QT7A 1H8KA 4Z89A 2O2OA 3RBBB 2LJ0A 2JT4A 2HDAA 2J6KA 3REAB 1LCKA 1OPLA 2SEMA 3H0FA 1TG0A 2EYYA 2KXDA 2LMJA 1E6GA 5IHKA 2EYXA 2CH4A 2KYMA 2RQRA 1PKTA 1HD3A 4AFQC 1TUCA 2BZYA 1OEBA 3A98A 2FRWA 1B07A 4Y92A 3NGPA 2OAWA 1AEYA 5FW9A 2ENMA 2IIMA 1TUDA 4JJBA 1VYTA 4KRTA 2EQIA 1OOTA 2LP5A 4LUEA 4JZ4A 4D8DA 2JS2A 5IH2A 2DJQA 4EIKA 1WDXA 1T3SA 5IXBA 3QWYA 1UE9A 1M8MA 1JXMA 4RTXA 5FWBA 1X27A 2KT1A 1VYUA 4RUGA 1AWWA 1PHTA 1A0NB 1YNZA 1NLOC 1ZUKA 5IHIA 3I35A 1BK2A 1SEMA 1GFCA 1KIKA 1AOJA 1PWTA 2K2MA 1ZSGA 1UECA 2FPEA 4J9GA 1E6HA 1M3BA 2NUZA 1UDLA 1T0HA 1M3CA 1Y0MA 4JPBW 2FO0A 2M51A 4OMNA 2G6FX 1G83A 1WLPB 4ESRA 4LNPA 2VWFA 1QLYA 1FMKA 3GBQA 2AKKA 3UF4A 1QKXA 3NPFA 2KT8A 2BZXA 2A08A 1X43A 1X2QA 1BU1A 1B3QA 2EGCA 1YWOA 2DL5A 1HSQA 3VRYA 2JXBA 2ESWA 2GQIA 2L3SA 3QWXX 1AD5A 4FSSA 1QKWA 4IIMA 1SSHA 1X6GA 4ORZA 2DE0X 4J9BA 2RQVA 3M0UA 5I22A 1AVZC 3U23A 1JEGA 1X6BA 2JTEA 1CKAA 2BTTA 2EBPA 1YN8A 2YUOA 1WIEA 2EYWA 4RTYA 1NYGA 4IIOA 2NWMA 1K76A 1NEGA 2CSQA 2RF0A 3IQLA 1H92A 2CREA 2LJ3A 4J9CA 3M0SA 1UGVA 1JQQA 1SHGA 3VRZA 1JO8A 2L0AA 1CKBA 2O9VA 1W6XA 2L3QA 2ED1A 3VS3A 2DM1A 1G2BA 1PRMC 1K1ZA 2LQWA 4DEXA 2FRYA 4CC2A 2AZVA 1UHCA 1KSWA 2JW4A 1ZUUA 2MOXA 1GBQA 2ED0A 3SEMA 1BBZA 1FYNA 2H8HA 1UFFA 3VS6A 1GCQA 1W70A 1GRIA 4AFSC 2L2PA 3TSZA 3KFVA 2QDLA 4R0KA 5GJVB 1RLQC 1U06A 3VS0A 2LJ1A 1WXUA 1MV3A 1JU5C 5IXFA 1GFDA 2DILA 2MCNA 2GGRA 2PTKA 3O5ZA 2D0NA 3ULRB 2EYZA 2DBMA 3EGUA 2VKNA 2AZSA 2J06A 4HCKA 4M4ZA 2A37A 2FPDA 4ZNXA 2F2VA 2W10A 2KE9A 2HSPA 2KYBA 3VS2A 1QWFA 1SHFA 3FJ5A 1K0XA 1ABQA 1SPKA 3R6NA 1WYXA 4X1VA 2EVRA 2D1XA 4JJCA 2KBTA 3VS7A 3I5SA 2KNBB 4RTWA 1T3LA 4RTZA 2X3WD 2CH4W 3TVTA 2KRNA 1ZUYA 1J3TA 1WI7A 2E5KA 3M0PA 2KGTA 2K9GA 1H3HA 3H41A 2LQNA 2VVKA 1GCPA 2FG0A 2XMFA 2YSQA 4J9DA 3TSWA 4AFZC 4CC4B 4F16A 1M3AA 1VYVA 1XOVA 1Z9ZA 1SRLA 2GTJA 3VS1A 2O9SA 2RQTA 1WA7A 2DLPA 2RMOA 2D8JA 2CUBA 1RLPC 2GNCA 2V1QA 4HVWA 1I1JA 1RUWA 1UJYA 2J7IA 3ZL7C 1UG1A 2JM9A 2YUQA 1WFWA 1WXBA 1S1NA 1KJWA 2ROTA 1IO6A 2AK5A 2EKHA 2CDTA 2J05A 2M0YA 1GCQC 2LX7A 1N5ZA 2P4RA 3VS4A 4OMQA 2DVJA 3RNJA 1PKSA 2DF6A 4JJDA 4F14A 1U5SA 3UA6A 3EHQA 4K11A 5GJWB 4LUDA 2JS0A 4RTVA 2ROLA 3M0TA 1NEBA 1MUZA 2DL4A 2L3PA 2DNUA 1Z9QA 5L23A 5ECAA 2YUNA 4DEYA 3NHNA 2C0IA 1WX6A 2CUDA 2AKLA 1U3OA 1ZLMA 2JM8A 1EFNA 2KEAA 1QWEA 2B86A 2RQUA 2K6DA 2DYBA 2ABLA 1YP5A 4J9HA 4HXJA 1UUEA 1AWJA 1WXTA 1UTIA 3I5RA 1YWPA 2EGAA 4GBQA 1ARKA 2YUPA 3EHRA 1PRLC 2DRMA 3EG1A 1BB9A 2PZ1A 2FEIA 1YCSB 1NM7A 1NYFA 3CQTA 2LNHB 4WCIA 2CT4A 4Z88A 3I9QA 4LE9A 3PVQA 4J9FA 4A63B 2BZ8A 2X3XD 5FWCA 1QCFA 2F2XA 2DL3A 2DRKA 2LZ6B 2RQWA 1OV3A 1W1FA 1CSKA 2DX1A 1X2KA 2EPDA 2F2WA 1M30A 4LN2A 1KFZA 4HVUA 4OMMA 2CT3A 2KROA 2SRCA 3VS5A 2OI3A 2RN8A 3EG0A 2YT6A 2LCSA 4AG2C 2HCKA 5I11A 1HJDA 3PE0A 2V1RA 2KR3A 2RPNA 2KXCA 4OMLA 4Z8AA 3EG3A 3C0CA 4F17A 1K4US 3H0IA 3EG2A 2PNIA 2EW3A 2MIOA 1AZEA 3REBB 2DMOA 1V1CA 5IHNA 4JZ3A 1NLPC 4RTTA 2GTOA 4CC3A 4RTUA 1ABOA 2YDLA 2HBWA 3SHWA 3LH5A 1MV0B 2OJ2A 4OMOA 3H0HA 4GLMA 1M27C 2W0ZA 1AWXA 3JV3A 3PVLA 2DL7A 5EC7A 2FPFA 1GL5A 4E6RA 2C0TA 2C0OA 3M0QA 4J9EA 4CC7A 1SRMA 1X69A 1NG2A 4J9IA 1I0CA 1PNJA 4HVVA 2O31A 1T0JA 4AFUC 2RNAA 4AG1C 1RI9A 2KRSA
chains in the Genus database with same CATH superfamily
4JLIA 1IW7D 4RGOS 1E2ZA 3UATA 4XTZA 3M9BA 1VDZA 4YHHQ 2K7AA 3F1ZA 5T1IA 4IUNA 2DBKA 2A6EC 3JCMJ 2LT1A 5JPNC 2XWBB 2I0NA 4VUBA 2QTXA 2K79A 1LT5D 2QILA 1SE4A 3P8DA 1AZGB 1E7OA 2XD0A 2K3BA 2AWNA 2EJGC 2EQSA 2KCNA 4RGTA 4NMZA 2KK4A 1OPKA 3BDOA 1RABB 2JMCA 2KRMA 4P5NA 4N8FA 2YLCA 3JB9F 4BB7A 1ASYA 3CD6T 2B2WC 3A56A 3FKIG 4N9PA 2A36A 5E1FA 4OO1G 1JJ2S 2AMCB 1GBRA 3NMZC 5T1GA 2UUBL 3SK6A 4RKLA 1I07A 2ECZA 4KY7A 1PZID 2CP3A 5IP9H 1KK7A 3OTOQ 3DM1A 4AH6A 1PSEA 2K05A 4IPDA 1V43A 1D1BA 2RK2A 3OS0A 4C3IG 2MFIA 4C5GA 2EGEA 3PIPA 3M0RA 2PQAA 3ZBDA 4FYYB 4Z89A 1FD7D 1CQVA 1F77A 1PTOH 1YNJD 1M90C 2O2OA 4DR6Q 3FVQA 1G91A 2C5CA 3RBBB 5GAN7 2LJ0A 2LRQA 2JT4A 4NP5A 5GAOr 3J7ZC 2HDAA 3S15B 5JVG3 5G3LF 4B9WA 2HDMA 3H0FA 1UEAB 2JN4A 5LMUL 2EAYA 4N0AA 4IFDG 1TG0A 2DXUA 4PJJA 3CD6A 4K2LA 3VR3A 3W1GA 1E6GA 3S6WA 4UY8C 4Y91A 1SJED 4A75A 2DN8A 5GANd 3MKDA 1EOTA 4I7ZC 4JI2Q 2UUCL 1ACMB 2BKDN 1KL9A 4JV5Q 4TSSA 4E7JA 3D8GA 1AEXA 4R56A 2JQOA 4E6IA 2KCTA 2ZTDA 1OEBA 4C8QA 5CAIA 1L1OC 1RIPA 2EY2A 2BDNA 4LFBL 3SR1A 2ENMA 1STNA 1SYGA 4CJ0B 4DR5L 1ZQ1A 4R4IA 4J8QA 4A3FG 3PQIA 4M77G 3LGFA 4JJBA 1K83B 2JVVA 3G71Q 2Y0SE 3MXNA 3LWUA 4ELZC 4X3UA 2EQIA 5CV4A 5C4XH 1TS2A 5GQOA 4JZ4A 3VYGA 2Q8TA 3RD4A 1HNWL 1EX4A 3J80i 2E2JB 1V1PA 4KHZA 1BBXC 1WQ7A 5IH2A 1LABA 3KF6A 1HCZA 2DAQA 2MAMA 1G2SA 1SAPA 4LFAL 2NUPA 2HT1A 4WJ3M 1M8MA 1AHJB 3STBC 4DR4L 1D7QA 1CUKA 5JEAH 5JAVA 4BY6B 1LO5D 2EQUA 1ZKOA 1TWCH 3K7AH 4FF4A 4HA8A 2JA5G 2WB1E 1R9TH 4Q0FA 5CK9A 5LJ3d 4D6WA 4JOIC 2P0KA 1FGBD 2VY3A 4JI0Q 3S1QH 1PH6A 2JN0A 3M55A 2LNVA 5LJ3j 1AE2A 1GD7A 2PQEA 3OWEB 1M3BA 5J1ZA 1B9NA 3H0GG 3HRZC 3SK8A 4JPBW 1MGQA 5AFWA 4PLIA 2FO0A 2E3HA 4KBMB 2G6FX 3TREA 1N8RR 2CQOA 2NTTA 1G83A 4ESRA 4R4TA 5LMNL 3GTGH 5C5LA 1AH9A 3PMFA 1PZJD 4ZTJA 4YWMA 3OSOA 4RKBA 1SFOB 2JA8B 2LCCA 1FMKA 4KI0A 1KC8C 1VQ7T 2DZCA 1YI2T 1H641 2QK0A 2BZXA 3INZA 3H3VI 5I2MA 3E5SA 1DXMA 3E2UA 5GANg 1WCMB 1DD2A 2D62A 1TWGH 2EGCA 2A6HD 2Z4IA 3SHLA 4A3JB 2DL5A 5EPLA 3IL8A 1W6JA 4JS4A 4CKBA 1P8LA 3PFSA 3P7JA 4LDXA 1TWFB 2L3SA 3VUZA 3L42A 3QWXX 1AN8A 5KYUA 4HJ5A 4FSSA 1QKWA 1ZYRD 2Y90A 3GPLA 4RH6A 5M5WH 4A3BH 3TSSA 1W2BA 4M77F 4J9BA 6AT1B 4HEDA 3M0UA 5C3EG 3WDNA 1CFMA 2JXMB 1VQ7A 1JEGA 5FKAC 1AZQA 1YI2A 2LVMA 4JK1C 3T13A 1WYDA 2NZOA 3TP7A 3QO3A 4XIGS 2JA7B 1WIEA 3J80L 2KSSA 4IIOA 2RH2A 2NWMA 4DAYA 3Q24A 1I81A 2OT2A 3FLGA 1O80A 2IJ0A 2ZTCA 2NVQH 1ILPA 3J7AF 5CYUA 1UGRB 2LFNA 3L0OA 3ICEA 3S17H 1R4PB 3CEYA 2CREA 4NL2A 4KT0E 2LJ3A 4E7ZA 1Q7YC 2XWJB 2E2IH 1LACA 2ZXOA 1UGVA 3EH1A 1JICA 1BNZA 3V7CA 2O9VA 1CKBA 3TP5A 4F7UF 4PMCA 1WOCA 4CDEC 2E2HH 4K5VA 1ICFB 5LJ3g 4BA1I 3F2DA 1EQVA 2LQWA 1U5KA 2FRYA 3L2UA 2UXCQ 3QOLA 1NZ9A 1UHCA 1EFWA 2JW4A 2L1BA 3O13A 2AQ2B 1MMAA 2DNCA 2ED0A 2LSSA 4DUZQ 3GIBA 4JI3L 4F04B 3CCET 3FPUB 4DA2A 2R5MA 1RL2A 3RR6A 1EWCA 4IPCA 1BDOA 1BBZA 4RA8A 2A7YA 4KGXB 1PYBA 4KH0B 2I5MX 1GCQA 2TSSA 4M7DD 1A3UA 2LXKA 1Y1WG 3JAMc 3HOZB 2HKNA 2KY9A 2L2PA 4X3TA 2EYJA 5A2QL 2ATWA 3RUXA 3LW5E 2QQBA 3DB4A 1GKHA 2JA6B 2NB0A 3D7SB 3GD7A 5ELCA 2K5FA 2ZPGB 2I0QA 3V8LA 1TR5A 3PO3B 4BBRG 4PLLA 5CCAA 3R3OA 5IWAL 1QVPA 3HFOA 1WXUA 1Y1VB 4B3TQ 5IXFA 1UE1A 2DILA 1YJNQ 3GTPH 3X24B 3E9FA 3CCEA 4RG1A 2AHOB 1I4K1 3O5ZA 4J6XA 1UE5A 1ZEQX 2PI2E 5GMKe 2DK3A 3EGUA 1CI3M 1LT6D 1N8RC 2MWPA 3TQ7P 1MNEA 4JC0A 1UUPA 4F7UB 2KMTA 4IQZA 1KDAA 2A74C 4MTNA 1B34B 2F2VA 2F0NA 3I4MB 1MMDA 4B3ML 4DV7L 1FX7A 1NY4A 3Q0AA 4C0GA 3OBWA 2OXPA 2Q2IA 1BI0A 5LHY1 3FJ5A 1ABQA 2JE6I 3KK7A 3R6NA 1MHWC 4DAMA 4GLXA 3M54A 4DV0L 3G6EQ 3G4SA 3GOXA 1AE3A 2D1XA 4JJCA 2KBTA 3VS7A 1E24A 4RCOA 1S72Q 2KNBB 2UXBQ 3J80E 1EYDA 1X3FA 3KF8A 3OW2A 3ND8A 3M4QA 4RTZA 2X3WD 4CGYB 1BI2A 2B2VC 3I70A 3HOUG 2EJFC 1QVGA 2R7DA 4JS5A 2PW7A 3C4SA 2K5DA 3CHBD 4M78E 2Y4XA 1IGQA 1WI7A 4XT1B 4DGZA 1VQMT 3RZOH 3FPPA 1SYEA 2E8GA 1WHLA 1STGA 3H41A 4DN4M 3VA7A 1JRIA 4N4GA 1K9MC 2IX3A 1NUCA 2F0GA 1QZGA 2CZ7B 1XPRA 1GCPA 2YSQA 4J9DA 4BE2A 3SWNB 5KYWB 3S16H 3KJPA 4N9TA 1VYVA 4PJLA 3T53B 1Z9ZA 2V1CC 4P73A 1D0XA 3PNWC 1XNIA 1MI2A 3VS1A 2O9SA 2RQTA 1DGSA 4XYQA 2RBMA 2RMOA 4CDDC 4OF1A 5C0XG 2JUFA 4UP8A 3OYBA 2CUBA 1RLPC 2IW3A 4X64L 5C44G 4FF3A 1YITT 5E4WC 3BE3A 1JWMD 3QWNA 3VA5A 1VQMA 3PUVA 2J7IA 1LV9A 5A2QE 1Q3LA 1SNQA 5CBEE 5GAN4 2E4HA 3OMGA 1PH4A 1UE6A 1WXBA 1BYMA 4ZRZA 2DEUA 2F3VA 3M57A 2AUJD 1SRUA 1PH5A 1IO6A 3K80C 2AK5A 2EKHA 1YJ9Q 1LYLA 1VQ8T 1TWAB 5AJ3Q 1FYCA 3K5LA 2LKVA 5KYXB 4QVCA 3C12A 3EH2A 1CKNA 4ZGDB 1VQ9Q 2ZGWA 2OAUA 4EQNA 3AT1B 1HNZL 4DV4Q 2Q2TA 2K5VA 2LX7A 1YITA 4MMLA 1K73R 2CVRA 4MZPA 7AT1B 5HY6A 2P4RA 3VS4A 2MMPA 3H3VH 2X9HA 3RNJA 4X9DA 4JJDA 4BS9A 1D5XC 5H1SE 5IN1A 4F14A 1U5SA 2DETA 2RA4A 1W2BS 1VQAA 2IX1A 2QEJC 1IGUA 2EFIA 3UA6A 3HP3A 3OYDA 1D1CA 3DEPA 3CRLC 3KUPA 4RTVA 1YHBA 4GNXC 1LPLA 3D3RA 4M77E 2QQ9A 1VQ8A 2VW9A 2CGHA 2BUDA 4A3EB 1VQMQ 2AWOA 3O8VA 2DNUA 3MPUB 1Z9QA 5AT1B 5IYCH 4JRQA 3F8TA 5C3WA 4BY6C 1HJPA 4FO2A 5L8RE 3NHNA 3WOFA 3GNFB 1QVFA 1DONA 3OS2A 2VS1A 2CUDA 4BY7B 2OTJT 3D31A 1QCOA 1U3OA 4KULA 2JM8A 4G7OC 2KEAA 4DA4A 3EG9B 3KOJA 5C0XI 2ZJPA 4KGZB 1BR9A 5IGGA 2ABLA 2CP5A 1YP5A 3R6OA 4J9HA 1X3PA 3QOJA 1UUEA 5A35A 2K5WA 5JEAJ 2HZYA 2EYMA 3I5RA 4HJ8A 2EGAA 2QDBA 1SNDA 2VQEQ 3JCMP 3EHRA 4F7UE 5FLXL 1WTOA 1M4VA 2PZ1A 1KABA 3MC0B 3SE0A 2DTOA 2NYZD 1SYFA 1WI5A 4C3JB 2K50A 4KKUA 4PL6A 4WCIA 4L6V5 1X3QA 3E9GA 3S1RB 1Y96B 1VQKQ 3V7RA 2R6GA 2OTJA 3JCMV 4AMCA 1PFBA 2HSEB 2QF7A 1NE3A 1NPPA 2WSCE 5ELBA 1F9PA 1N9SA 3KUFA 2F2XA 4J6WA 4E2FB 1VQDA 2NN6I 3I3CA 3I2ZA 4UHVA 3GTLB 4EPCA 4XQJA 2LZ6B 2RQWA 4NXMQ 1OV3A 3A0JA 2O4XB 2EPDA 3G6JB 1OX9A 2PVDB 1M30A 4C0ZA 1PTOD 1PZKD 3L1AA 4M75D 3QG1A 4OMMA 1KFZA 1L0XB 4LDVA 2VC8A 5GANf 1EYAA 5KYIA 2RN8A 3BU2A 2VV5A 1JT8A 4H7BA 2OQ0A 1EY6A 1RADB 2K52A 2MO1A 4DBHA 1CKOA 3I8ZA 1ESFA 1EIYB 2PZTA 4AG2C 4DAVA 1F9SA 3L2PA 3NTIA 4JUVA 3HGBA 3JCMh 4KLKA 3SK4A 4BBSG 2V1RA 2HIXA 3H6MA 2FZCB 2BA1A 1N34Q 5C3EH 2B63H 3Q1JA 5M3MG 3EFSA 5M5YH 4CJ2C 3EG3A 3C0CA 3SD4A 5E7NA 1QZHA 4FW1A 5F2DA 4XQNA 1N36Q 2RDHA 1HNXL 1K4US 1ZSZA 3DWQA 2NLUA 3HRSA 1F9QA 1LT3D 3C3LA 3HOWG 2DIQA 1DZ1A 2EW3A 3EGDA 2LC4A 3HZXA 4LK1C 2MIOA 2E65A 2HHHQ 1A63A 1IW7C 4PJOD 4K5XA 3QYHB 2KEEA 2R92H 5GAMf 4OWXB 4A54A 2DY8A 1FNWA 3D4RA 4JI4Q 3REBB 1K73C 2C06A 4A3KB 2H3EB 3OW2S 4JI8Q 3X20B 2CZ6B 4CC3A 4RTUA 1F2YA 1C6VX 3K5NA 1QVGS 2HBWA 3LWIA 3QB3A 4HMIA 5EBCA 2DERA 1P92A 5IY0A 1PFNA 2D9UA 1V9PA 2K57A 4A3MB 1SF9A 4OMOA 3H0HA 3HOXB 4QQ6A 2ZPBB 5GMKj 3OS1A 3CMAA 2Y0SG 2QA4Q 2UXBL 4LDWA 4LDYA 5GAN6 3GP8A 3EFXD 2Z4HA 1KDBA 2OCEA 4P72A 2Z0SA 5D3DA 5C4ZA 3PVLA 5DLOA 4YY3L 2OTLQ 3QO2A 3CCJQ 2NVYH 3PO2H 1L1OB 1I3QH 2SOBA 2BE7D 5FLXE 1GL5A 1HTLD 2H5XA 1HFGA 2ZXPA 3KBGA 3SFMA 2NTSA 1YNJC 2KAFA 2K03A 2K5LA 1G5VA 4J9EA 4DV6Q 2VYTA 5EGTA 5DLQE 4ZGEB 2L3RA 5IOCA 4UP9A 1TWHH 2MPMA 4CC7A 2HD3A 4DUYL 3TS0A 4J9IA 4N4IA 1D5ZC 2COZA 3OYLA 1K3BC 2IPKD 1PNJA 3CCST 2WB1G 3KLWA 4BY1B 4C0DB 3T4AC 4G7ZC 1PFMA 2XN9C 1HR0L 3OSSC 2J7ZA 3TRZA 2G5DA 1RI9A 5FLMG 1PH1A 2R93B 4GOPA 4ODGA 3ONAB 1HYOA 1EY0A 1Q81U 1IZ6A 2CSIA 1ZBJA 5C5MA 1DCZA 1JWUD 3E19A 1SE8A 5KH6A 1OU8A 1U4PA 1C7YA 4NOYA 2EY5A 3QZ9B 2D8HA 4N0AC 3JAMi 1TS3A 2B2UA 3OSVA 3NBHB 4RMOA 2DL8A 1K0SA 2YYZA 2NZHA 3A1PA 1VA7A 5GAMe 1O75A 3CCSA 2Z6KA 2YRDA 1CTMA 4MIUA 3IRBA 4IOCA 2LCLA 2DY7A 2LDMA 1VQPT 2HEQA 2FJ2A 1X56A 3NENA 4DKAC 4OMPA 2O5JC 2QQRA 2F0MA 2JP1A 3HOUH 3LGLA 1ILQA 4DV4L 2NVTB 1DOLA 1PTOF 5M3FB 4M75F 4O2DA 2E64A 3SWNC 3OYJA 4K6LA 1PA6A 5HK0A 2J0TD 4LF4L 2N49A 3M7NA 4C3HH 1K0RA 4M7AD 1QVFS 1Y69U 1OYXA 5KYYB 1OPLA 4Q5WA 1SDFA 2SEMA 5CKEA 4FSXA 4DV3Q 1HXYD 2E75C 1VQPA 4YCWA 1HFNA 2EYXA 4ANJA 2RJCA 1HD3A 3GTMH 1TWBA 3V7SA 4AFQC 5CQYA 3MP8A 5GAOq 1UNSA 2F4VQ 4EMGA 2FRWA 4RHSA 4PJOF 5C0XH 2PI2A 4DR1Q 1FWZA 4J8OA 2R7ZH 2B2TA 3W5OA 2SEBD 1IBLQ 4PV1C 4C92A 2KI7A 2A6HC 2DGYA 3UDGA 2QASA 4A3GH 3U58A 2EQJA 3EGXA 1EU4A 4ME7A 2FVUA 1C1AA 4ZN1A 1STHA 3FIFA 2EXDA 4LUEA 1FVIA 1VQOQ 4D8DA 1IKLA 2JS2A 2WINB 1ZYRC 5FROA 2N88A 2IHEA 3D4DA 1M90R 2BCOA 3BS1A 4GZYC 1PTOB 3JAML 4M75B 2UUAQ 1T3SA 1M90U 1DJRD 1TY0A 4YWKA 2XI9A 1S5FD 5FWBA 1RD9D 1X27A 4IURA 1OXXK 2NN6H 3BVGA 4LUVA 5DY9A 1YNZA 2F4IA 2X4XA 2J4XA 2E2DC 1A62A 1UGQB 3H09A 4L8JA 5IIFA 3JB9G 4JI5Q 3I35A 5CV6A 1BK2A 1SEMA 1I5LA 1VQNT 1GFCA 2DTIA 4M78A 1EY9A 1SNOA 1I5FA 4NXML 1UGPB 3A7AB 3GQBA 3NTHA 3RKXA 1CHPD 1EFID 1II3A 3PGZA 4A4IA 4K0KL 1MBYA 4J7IA 4NXNQ 3ERQA 2NUZA 1Q8IA 1YNND 4WJWA 1Y0MA 2YXYA 3KYHC 1VQ4T 1WLPB 1KQSP 4PJOB 3A5UA 3CXCP 2Q2HA 1LVKA 2V8IA 2HBPA 2VWFA 1QLYA 2ASBA 2MPXC 1OXSC 3NSWA 3S2DB 5C4XB 1KD1R 3W1BA 3UF4A 3M59A 3R2TA 1IKMA 1L0YB 1FNUA 3NPFA 2KT8A 3F2CA 2A08A 3A7LA 3CCLQ 1VQNA 1PV4A 1X2QA 1N36L 1I8FA 1BI3A 4PJMA 5IP7G 3RMQA 2JTFA 2Y4YA 3M56A 1QUQB 1N6AA 3GLXA 4M7DC 2P4TA 4C56C 1CA5A 3E3XA 2HHHL 3BZDB 2IX0A 2EWNA 4XT3B 3VR2A 1D3BA 3I56Q 1Q86C 3ND9A 2X4YA 2JA8G 1VQ4A 2NUTB 1TWCB 2DE0X 3K7AB 1L2FA 1VQ5T 2RVLA 5FLXc 2RQVA 3J81j 1R9TB 3RLOA 5I22A 2YTXA 5EPKA 3CF5A 3S1QB 4OVAA 2JTEA 2A1AA 2CHBD 2BTTA 3FEWX 1EY4A 1WCMG 3TEHB 2AQ3B 3KDFA 1YN8A 3CMET 4A4HA 4DU9A 3VDYA 4A3JG 5IT9c 2KENA 4LAAA 4LF8Q 4GKJQ 4EVOA 5HK3A 3GTGB 1OU9A 1WTVA 3ER0A 1NEGA 2K2VA 3A8KE 4M7AF 3IAYA 2YHTA 3OQ5A 4KGVB 5GMKm 1KC8R 1FNVA 2QI2A 2K75A 3E9IA 4LFCL 5I2XA 4R8IA 3OYIA 1SNMA 3T1YQ 1I94Q 1KC8U 4HMJA 4A76A 4JI6Q 3Q23A 2HD0A 3N5BB 1HXDA 2B8AA 3VRZA 4NKLA 3V2TA 4EQOA 1XJWB 4M77A 1VQ5A 3JAME 3I4LA 2ED1A 1TWGB 4F8MA 2JA7G 5A0GA 2LY7A 1WTHA 2PNRC 4QJFA 4HCEA 1XMOQ 4KHPQ 1EL0A 4FYWB 2AZVA 3PMIA 5BN5A 3PGGA 3CMEA 3EAEA 1BBWA 1NCVA 4OX9Q 3S1NH 3OPOA 4HIDA 5M5WB 5EQ0A 3SEMA 4A3BB 2E76C 4FXDA 3OHXC 4OWTB 3GNGA 1I4RA 1B2TA 1FYNA 3X28B 1KAAA 4E7IA 4XQQA 3CPWP 5CKFA 3VS6A 4QF4A 3LWHA 2MYSA 1GRIA 3CBMA 3BDUA 2RHUA 3K6OA 3LWEA 4J15A 3TSZA 3KFVA 4QIWE 1M2VB 4JI7L 1MJEA 4B3SL 2XK0A 5EKKA 3KLSX 2NVQB 2F0WA 2KQ3A 1B7TA 5GANj 1U06A 3S17B 2XVSA 1H9SB 1Q7YR 2UXDL 2DEQA 2UU9Q 3BVMA 1BCOA 1GFDA 2EY1A 2E2IB 2MCNA 3I4NG 1U1TA 4QQGA 5D6WA 4M7AB 1Q7YU 3TDQA 4QCLA 3SEBA 3C1FA 2D0NA 4A3DH 5JVH3 5J26A 2HUGA 2D5DA 4K2KA 2RK1A 2E2HB 2VKNA 3OIQA 3QPHA 5ELFA 4LF7Q 1TKWB 4C1NK 3HOZG 4HCKA 4EMKA 1YIJT 2F0HA 2FPDA 3MEFA 1GUWA 4WORA 4ZNXA 2W10A 1KD1C 4KJOA 2LQKA 1MSGA 1BIAA 3VV0A 4KN4C 2KE9A 2KYBA 4DV2Q 3PO3G 3VS2A 1QWFA 2RCNA 5GAMd 4C0DC 4EDUA 2F3IA 4J6HA 2A0FB 1OX8A 1K0XA 1WZOA 1Y1VG 4C8QD 2PNHA 1SPKA 4GNXB 4OO1I 3SDZA 3SB2A 2IG0A 5GAMj 4UAIA 4X1VA 2RHIA 1SYBA 2E5LL 5I4DA 2IL8A 4NW2A 4A93H 4UPAA 4R4QA 1C9OA 3NFCA 3CD6Q 3I7FA 1IHVA 4DV3L 3KLSA 5C4JH 1TU2B 4PJOE 1N9RA 4F7UG 3UE1A 1RAAB 4DV1L 1YIJA 3TVTA 2KRNA 2WKCA 3BW1A 3I4MG 2XNAC 2PYKA 5CORA 1LTSD 4L63B 3AQQA 1J3TA 2DJGC 4A3IG 2E5KA 2F4VL 1XNQL 2B2YA 3GTPB 2DVEA 4DR1L 3M0PA 4ELYC 4IFDI 3T1HL 1V29B 1I4HA 1YVCA 4DR7L 2LQNA 2MNAA 2VVKA 4AFZC 2XMFA 1N8RU 1N27A 1EQTA 1X3GA 2RDFA 2MUYA 4FVMA 3TBIB 3VJPA 1M3AA 1QCBD 3GTQH 2R5AA 5K36H 3H6ZA 1EZ8A 1XOVA 1SBBB 1SRLA 1TUGB 1OULA 3CQZH 1WTXA 1HA6A 1GUOA 4DR2Q 3VR5A 3TP8A 1WA7A 2DLPA 2IPOB 2PZWA 2KECA 3D6WA 3WWVA 4BDYA 2DO3A 3CCMT 2YRCA 2F0KA 5EAYA 2QGGA 2IVWA 3K57A 1PH7A 2BE9B 1ET6A 3MA2B 4JBMA 5IYBH 5FOBB 3WVDB 1PH8A 4K8IA 1KRTA 2JM9A 4JCVE 4FW2A 4O42A 4B3RQ 3H91A 4LF6Q 3A8HB 2RHSB 1B44D 1S1NA 1KJWA 1VQHA 2ROTA 2M1HA 3TU4K 2WFWA 4KY5A 4HSVA 1E1OA 4Z9CB 2F0VA 2LS01 1G8XA 4LJZC 3CC4T 3RZOB 2XDBA 5KEEA 5KE2A 1K9MR 2J05A 1U4LA 3GTKH 3ITPA 1Z9FA 5GAMg 1YEZA 4BXXH 3QIAA 3CCMA 1RCVD 1IL8A 5C3XA 1K9MU 1SYDA 3WOEA 1TU0B 4AQYQ 1IYUA 3VUBA 4C2MH 3S16B 2QGQA 1M1FA 5FJ8H 1CHQD 1LNXA 4G7HC 1OO9B 2DF6A 3CBPA 2K01A 3EFOB 3JSCA 3MVVA 3S1MH 4HJ9A 2D2CC 1XTDA 5C0XJ 4QVDA 3PIP3 3GP7A 2K6AA 5COYA 3EHQA 1PTOC 2WP8J 2Z6BA 4ZKBB 4M75C 5GJWB 4LD6A 1MHNA 2MWOA 2ROLA 4R4OA 3UI2A 4X62L 2QEXT 3M7GA 2TMPA 4JBKA 2F3WA 4F7XA 4QUCA 2L3PA 3CC4A 4FT4A 3ULJA 4K5WA 1KLUD 3HOVH 4MDXA 1A0IA 1E22A 3HL8A 4DNIA 2C0IA 1O7IA 2GF7A 1EY5A 1I50H 2ATCB 2AKLA 3P8BB 4RMFA 5CQXA 3RZDH 1VQ7Q 1TQOA 2E10A 3S14H 1YI2Q 1QWEA 2B86A 4F87A 4M7AE 2ZM6Q 3OYHA 2K6DA 4JLGA 5HKCA 4F88A 2DYBA 1H9KA 2K7VA 3LX0A 3L7ZC 4YHHL 2VUMH 2GFUA 2K3XA 3V8JA 1VQLT 1SSFA 4ZN3A 2ZCFB 4ULLA 4A3EG 4ZLTF 1JBMA 4PJOC 4C8QF 2DRMA 2QEXA 5IYDG 4E47A 4L5SA 5D6XA 1YJWT 3DWAA 3X25B 3BG3A 4MN3A 3CCRT 3G4ST 1NM7A 2VL6A 3C2PA 1PCXA 4KK7A 1WHJA 1TS4A 2HNIA 3VR6A 2F03A 1V76A 1HH2P 1RAIB 1M8AA 4JI6L 2WAQB 4BY7G 1KNAA 2CT4A 4CI0C 1XX8A 4Z88A 4DQ2A 3DWPA 3MO8A 2B8FA 2F0TA 2RJDA 1R0BG 5GAN5 3W2DA 1HHVA 4IO9A 4KHPL 5CKDA 2NUCA 2EJGA 3S3NA 2XIWA 2B3GA 3OTOL 4PQXA 3LX7A 1PG5B 4ID6A 4A4GA 5ELDA 1VQLA 3MEHA 2B2WA 1C0AA 1E2VA 1X2KA 2L9HA 2PQAB 5DAUA 5E3FA 2M2LA 4C3JG 4POGA 4DR6L 4FNFA 3NQIA 1YJWA 4C5EA 2YU9H 4PFPA 2KROA 4IUQA 3VS5A 3CCRA 1JJCB 4ALPA 1I6HH 4LUZA 4GKKQ 4FXKC 3ME9A 4BI4A 1Z7TA 4DNRB 1K8GA 1VUBA 4RFBA 5GAN8 5FO9B 4YTLA 4JI2L 5I11A 1HJDA 3PE0A 4DR3Q 2KR3A 4KD3A 1OXVA 2GCXA 1LTGD 3Q6SA 4JV5L 3Q22A 1TS5A 4GLAC 3BDLA 4F17A 3FDRA 4C8QB 3FEOA 1V8QA 3CCEQ 2V8JA 2KVQG 2E1HA 4BUGA 1VS0A 4DBQA 1SNPA 2L11A 3A74A 4KN7C 1I4QA 1JB7A 1LTLA 3OBYA 3CAMA 1EZZB 3MXNB 1HQMC 2EYFA 5IHNA 5JJIA 4JZ3A 2HDLA 4O1NA 1RJTA 2KHIA 3FKIH 2YDLA 1V1PB 4OO1H 4XK8E 3KF6B 5D65A 4A3LG 2ICIA 4HIKA 2ES2A 2RHXA 2DPPB 2FXQA 3G4SQ 4CBVA 1U9RA 2NYSA 2NUPB 3URYA 4MHEA 1QWYA 1E7ZA 4RHRA 1EQQA 3UT1A 4C3IH 2PUOB 2CKZB 4XAXB 4DBRA 2Z1CA 4B6MA 1D09B 4A3KG 3E9HA 2DL7A 5EC7A 1SMYD 2FPFA 2RHZA 4PFZA 1D0ZA 1QG7A 5C3EB 3MAQA 4JI0L 4GN4B 2B63B 4IOAA 5M5YB 1EU3A 1KTKA 1MD2D 4R8NA 1F2MA 4IFDH 2WACA 3JCMe 3LH0A 4OXPA 1E0BA 3NXWA 4M7AC 4OWWB 2O01E 2OF1A 2KA7A 4NDXA 4A3MG 4OELB 1X69A 1WFQA 2KHSA 4QB4A 1MIUA 2WIIB 2X6GA 4JOIA 2CP7A 3HOXG 1DM0B 2R92B 3FB9A 1U4RA 5D3IB 1I0CA 1RAEB 4UC4A 3G7ZA 4M7DF 2O31A 3P20A 1K73U 1MNDA 1Q8KA 1T0JA 1EZ6A 1N33Q 4OB3B 3I4NH 2HKQB 4AYBB 2OEOA 2EYPA 2KRSA 1KXLA 1LJOA 3MXPA 3OIPA 4KHVA 4TRDA 1G291 4XTVA 4A3FH 1B1ZA 5A0LA 1KQSA 1NTGA 3CXCA 2COYA 2D0PA 1JOKA 2CP2A 3THKA 1UHFA 3L9AX 4CRIA 1Y57A 3K81C 3FJPA 3V96A 3M5AA 2L5TA 4TQUS 2XHCA 3M4PA 3VYUA 2O5IC 4OEMB 2JYOA 5HGQA 4BY1G 1EYGA 4PFOA 2NVYB 3JCMb 2NVXH 1I3QB 3PO2B 2JMAA 3OYCA 2JNGA 1BVSA 1G3TA 2R7FA 5J39A 3V05A 2R93G 3C46A 4KY6A 2OQKA 8AT1B 4IUVA 2F0EA 2J6OA 1TWHB 1ZX6A 3QXEB 1TH7A 2D0OA 4D8KA 4DAYB 3HFNA 2JA5H 3BZCA 1YITQ 3NWTA 1ONLA 3R2IA 1K9AA 4PZ7A 4FU6A 4FT2A 5GAOm 1LTBD 4A3IH 4QY7A 5CO7A 1PYWD 3CCQT 1QE6A 3H0GH 2QTVA 3HOYG 2RM4A 3REAB 4M7DB 1LCKA 2A69D 4H13C 5IT9L 1BI1A 1UWVA 1HUNA 2EYYA 3C1EA 5LJ5h 1QNKA 1SJHD 1YNNC 1M9SA 1VQ8Q 2LMJA 1EUJA 2CW0D 5IHKA 2UXCL 1BOSA 2R57A 3S2DH 1PVOA 2KYMA 5GAOp 1PRTD 2FYKA 2EKOA 2WSEE 4IUPA 3L2QA 1QVCA 1PKTA 5JJZA 1JB3A 5M3FG 4DUZL 3HRUA 1W3SA 4JYAL 4FYXB 5FRMA 4MTKA 1TUCA 4QUFA 2VUBA 2VZAA 5KCHA 3VKIA 3MFGA 4Y92A 3NWSA 2F0QA 2OAWA 4C1NI 1LUZA 4EMHA 1SG5A 1STYA 2QGFB 4X6AH 5GAN3 4C8QE 3GTJH 1M1GA 1SNCA 3CCQA 3MZ5A 2IIMA 1TUDA 4KD4A 5IODA 1RACB 1VYTA 4ME3A 1EWIA 1QP3A 3DLLA 2ALYB 1IBKQ 3HOUB 1Y14B 3ULPA 1OOTA 1CK1A 4XU2A 4L6TB 3PTAA 3CC7T 4XTWA 2AHJB 1YHQT 3CPWA 5KRUA 3GV6A 2DJQA 4B3TL 3X26B 3FDTA 4C3HB 3CMAT 2KCCA 5D14A 3M3YH 2KOLA 5IXBA 1ZXTA 2PMZB 5BR8Q 3QWYA 2C35B 1K8AR 2OTJQ 1JXMA 4RTXA 2KT1A 1C8CA 1VYUA 4XTXA 1NR2A 1PHTA 1MJCA 4DPGA 1IREB 2R58A 1NLOC 2XKOC 3PUXA 4CDFC 2QQSA 2JK8A 2EYOA 3N6RA 5IP9G 3BYYB 4FCYA 1KIKA 1Y8PB 2I2LA 3RLFA 2L55A 1PWTA 4KKSA 1GHKA 3LNNA 2DNEA 5GAGC 2K2MA 3GTMB 1X01A 1ZSGA 4RG2A 3VYRA 2HCCA 1UECA 1A3TA 4B08A 2FPEA 4OP0A 3CC7A 3OYYA 4J9GA 1E6HA 2R7ZB 1YHQA 1M1KC 4M75G 1CZWA 5I9PA 1ASZA 1QB5D 3A5ZB 3CCVT 2M51A 2RI5A 4OMNA 3FC3A 1IXRA 3I72A 1BF4A 2K5IA 2KUMA 3CKIB 4GKKL 5EKLA 3MP1A 1KLGD 4A3GB 2FFKB 3KF8B 1JQYD 2AKKA 8ATCB 3L2WA 3DHQA 1R0CB 1QKXA 3MFYA 3OY9A 2E3IA 1YHAA 3M4OH 4RCCA 4DK3C 1X43A 4OGQC 3H3VC 1BU1A 1B3QA 2QDYB 1U8RA 1BXTA 4GN5A 4AYBE 1Y1WH 1G3WA 3RDVA 4L5QA 1VMCA 2ZT9C 3FHWA 2A3LA 1HSQA 3M85A 5IT9E 3VRYA 2ENBA 2NWGA 2B2VA 2OX7A 3HRTA 2EJFA 4EQPA 3OS5A 3A8GB 1WTQA 4PJOG 2EIFA 5KYLA 1H3ZA 3CCVA 4BBRH 1WHKA 3C95A 4R55A 4IIMA 3EQLC 4WRDA 3DLMA 1SSHA 1X6GA 4FL6A 4QL5A 2N78A 2A73B 1STBA 5JOBA 4X3KA 3PMTA 2N3SA 1VQ6A 3OOCA 2EE1A 2ZJRA 1X6BA 5I2YA 4XTYA 1HZBA 2YUOA 2EYWA 1PXUA 1UEBA 1NYGA 2UUBQ 2DXTA 2F5TX 3D4WA 3CMAQ 4ZCKA 2GA4B 3IKJA 4MZTA 1K76A 1TTHB 4HCCA 4RGMA 4RCBA 5EKIA 5JEAG 2CSQA 4S3SA 2RF0A 3IQLA 2B29A 5GAHC 2RI2A 4J9CA 1A2UA 4AIMA 3M0SA 3B6YA 2EXZA 1SHGA 3IFTA 5AJ3L 1JO8A 4TKOB 2L0AA 3I4OA 3UE0A 1JWSD 2L3QA 1BCPD 4C8QC 3G1JA 3E0JA 2DJZA 4M7DE 2DM1A 1CSPA 1G2BA 2Z8LA 1CKNB 2HMAA 1KQSS 1KQ2A 1WJRA 3FRNA 3CXCS 4BDZA 2MOXA 1Q86R 2UUCQ 3CCVQ 1A2TA 1X9NA 2A8VA 1WHHA 3M58A 1B50A 4LF5L 1FL0A 2VXFA 5CR3A 3NEMA 3TZUA 4IUTA 5CKBA 2GN5A 2JEAI 2RD1A 3UDCA 1D8LA 1N33L 2K1BA 2H8HA 1QP2A 1UFFA 3CPFA 3JCMd 4LFBQ 1J9OA 3F2UA 4DR5Q 1LTTD 1CZGA 1K8AC 3PT9A 1Q82R 4OGCA 3AU7A 4AFSC 1PC0A 4RWSC 1WD0A 4QMGA 2F1MA 2RQXA 2QDLA 3MCAB 1RF2D 1NJIR 1G2TA 5IGCA 2QQAA 1F2ZA 4WJ4A 1JJGA 1E1TA 2XIDA 2N8NA 3S2HH 4R0KA 1PLFA 4HCZA 3T9NA 5IGBA 5CR2A 3DEOA 1K8MA 4A3BG 4HT9A 4FF2A 4DK0A 2F1LA 4GNXA 3CCSQ 3AMUA 2CFMA 4A4FA 2PTKA 5C44H 3H94A 2EYZA 4GN3B 4XU3A 4ZAIA 4DK6C 4DR4Q 2PMZE 2EQKA 4K8JA 3MEUA 3QZ5B 4JW0A 4M4ZA 3JB9D 3I73A 4P2CB 3SXHA 5JPMC 4HJ7A 2VQEL 3S1NB 1H95A 3H15A 2GQVA 2P5ZX 1KRSA 2K28A 3PSIA 4BA2I 1PMRA 3ZFJA 3PCOB 3RIRA 1SHFA 2IT1A 4JDSA 1JOOA 3QKJA 1XXGA 4IFDJ 1WYXA 3MEAA 4M7AG 2VQFQ 2EVRA 4XDXA 2C9OA 3GTOH 2DFUA 5M5XH 1KAWA 4C92D 1A3VA 1Q90A 3PUZA 4ZTFA 1TSFA 5LMNQ 4LNQA 4RTWA 4I7AA 1JORA 1XMQQ 1VQPQ 4Y7NH 5EG2A 4LWCA 1T3LA 2HQEA 2KDSA 3GDEA 3KLRA 3UPUA 5J22A 4XTUA 1FXXA 1PDQA 2X4WA 4X65Q 1WJJA 4ZKCB 1F1BB 3FMCA 1ZUYA 3S3MA 5ELOA 2P0PA 1A15A 1TT2A 3META 2X6LA 3CPWS 1IRXA 5GANh 1IYJB 2KGTA 3OB9A 4A3DB 4IZ8A 4FDBA 5FO8B 2X4JA 2E12A 2XDPA 4E7HA 1LT4D 4HT8A 3EJIA 2H4OA 1C0MA 4TVAB 3U9SA 3DUZA 5GMKl 2FG0A 4FYVB 3TSWA 3JCMg 4CC4B 1VOMA 4F16A 1OXTA 3PIO3 1QMCA 1IBKL 2AT1B 2FB7A 1KD1U 1TXYA 1N34L 4M78D 1D1AA 1BUVT 2GTJA 1NBWA 2KQWA 1A6XA 4RGNA 3QSUA 1Y8NB 1H9JA 4CHTB 1PFSA 1GM5A 3RLNA 4RAUC 2D8JA 1J8IA 1ZSZB 4IJHA 4NB3A 3K7UC 2GNCA 2QAZA 1WVLA 2V1QA 5KYNA 4A93B 3EGDB 5ELNA 4HVWA 4GLKA 3GO5A 1RUWA 4XTCS 4OIJA 1CA6A 1UJYA 1PH9A 1UG1A 5C4JB 2YUQA 4JI4L 3MHXA 2VNUD 3HP9A 1VIEA 1BIBA 1Z6HA 3HHTB 2EOTA 1BCPF 2EDGA 3DMUA 4JI8L 4V0BA 4LF5Q 4GLVB 5KIXA 3HOYH 4N8X1 2L4NA 5I2SA 3MJXA 1SMXA 3S9WA 3HKZB 2PU9B 4NPSA 2RHQB 1Q82C 2R61A 3ULLA 1X75C 4BI8B 2CDTA 2XGTA 2M0YA 2DTHA 2WV6D 5LJ3h 1GCQC 1TS9A 3JB9I 1NJIC 1D1KA 4J83A 1X65A 3I90A 4KJNA 5EJWA 2CQAA 3URGA 3NELA 1G6PA 3GTQB 1G3YA 4ATOA 4J1MA 2CZ0B 4J7FA 4JI3Q 2AUKA 3U4VA 2DVJA 5TSSA 1PKSA 1R4QB 3CQZB 1VQNQ 2A68D 2QW7A 4P75A 2RSNA 4H02A 1WGSA 3G71T 2M9VA 4K11A 2JS0A 4DV6L 3A8MB 2DKGA 3EVQA 4L59A 2AIRB 1MUZA 3BY7A 1QQJA 2DL4A 2F69A 5EBDA 4BBSH 1XNRQ 2Q2UA 1CM9A 1O9SA 2MHVA 5ECAA 1VQEA 4PMWA 1RODA 2YUNA 4TVRA 4DEYA 3S24A 1VQ4Q 3U50C 5M3MH 5IWAQ 3V8KA 1XJVA 2HL3A 1WX6A 1VQIA 1UB4A 3HOWH 1TVXA 1EIFA 2QG9B 4ME5A 1TIID 4LUOA 3DB3A 5CV7A 4GOPB 1BCPB 4M77D 1M5Q1 1G3SA 2E70A 3MXUA 1Q95G 4BE1A 1S5DD 4FXGC 1IL2A 3CCUT 3GTKB 3A8OB 4F7UA 2VGNA 2V26A 2EQMA 1AWJA 1WXTA 3G71A 2HCIA 3K0XA 1B34A 1UTIA 3JC66 1YWPA 3OA6A 4GBQA 3JCMX 1E3PA 2WKDA 3CW2C 3DM3A 3LGJA 3SGIA 1FR3A 3EG1A 4C2MB 2RSOA 4B3MQ 4DV7Q 2FEIA 1YCSB 5CV9A 4U673 2BA0A 1NYFA 4II1A 3CQTA 4C92F 4DXFA 1XPUA 3FP9A 3S1MB 2Q8RE 4PZ8A 5CV5A 1DOKA 1IHZA 4M75E 4BE0A 1VQ5Q 3ERSX 4DV0Q 3I9QA 1HZ9A 2VB2X 3PVQA 4J9FA 3J81c 4A63B 2BZ8A 1M4ZA 4FIBA 2K3YA 2L89A 1X32A 5CV8A 1QCFA 2DL3A 3CMEQ 2H1EA 3MHBA 5CGKA 1GVPA 2JA6G 2JTMA 3CCUA 1Y7XA 1W1FA 1DYQA 2SNSA 3HOVB 5KNBA 2F2WA 2DX1A 2DXBA 1B8AA 1Y07A 1I50B 1VF5C 2MO0A 4QW2A 1SMYC 2M0OA 4LN2A 4PKCC 3RZDB 2CT3A 5GAN2 2KVMA 2WAQG 3S14B 3EG0A 4XQ3A 2A19A 2BOSA 2YT6A 4YCUA 4HJAA 1QW1A 1QCNA 2CP0A 3EBEA 5LMNW 1SEBD 3SWNA 4M78F 5KYWA 1G51A 2I5LX 1K3RA 2VUMB 4POFA 5GAEC 3AB9A 3MXGA 2HCKA 1HA5A 3OYMA 3EIVA 1RTNA 2E41A 2RPNA 3ASKA 3OYEA 5IYCG 3H8ZA 2KXCA 5FLMH 3K59A 2DIGA 4JRKA 5I21A 2F0OA 3H0IA 3CC2T 3EG2A 1MGSA 3EN2A 2PNIA 1IBLL 4X64Q 5D7UA 2K14A 4QVZA 4C92B 1AZEA 1GO3E 3L2RA 1MMNA 3QHSA 1F2LA 4CDCC 3TS2A 1O7YA 2F52A 3D0FA 5KGUA 4Q5VA 4XXEA 3EGXB 1V1CA 4N4HA 1WHGA 3CCUQ 1RHPA 1TOVA 1W4SA 3EA6A 2HQXA 2GTOA 4Y52H 1ABOA 4R1JA 1PSFA 1UE7A 3SHWA 5KYXA 3M4YA 2CWAA 1JJ2P 1ENFA 2UUAL 2Z9HA 2RI3A 4C8QG 2YU9B 3NPPA 1JE4A 2IY5B 2VQFL 3HKZE 2ZXRA 2LTOA 1HNZQ 2CS7A 2OJ2A 1I6HB 3CC2A 5ISRA 3KFUA 3JCMQ 1PH3A 3P1HA 3NQTA 4GS3A 1KHIA 2F0SA 1XMQL 2W0ZA 1JE5A 1DJ7B 4A3CG 3CRKC 4JI5L 1AWXA 3KJOA 5E4XA 1I5OB 1L0WA 4QGUA 2FL7A 4ZUIA 4IPHA 1NPRA 1YIJQ 3RESA 3TN2A 4M78B 3NBIA 1FJGQ 2HQLA 2C0TA 4DV5Q 4X65L 2VXEA 3U4ZA 2X35A 4KUDK 2YLBA 4NXNL 3M0QA 5FU6B 4E7KA 3NE5B 4A4KA 4JRPA 2EJ9A 3S3OA 1RAHB 4XU1A 2A69C 4KV6A 2YTYA 1SKUB 2VB6A 1BO0A 1OXUA 1SRMA 3M53A 5C6SA 5LL6X 1NG2A 1X6OA 3VU3C 2QKIC 2CW0C 1S40A 1UAPA 1ESRA 1YJNT 1TY2A 4HVVA 1DOMA 4HSPA 1I6VC 1PRTC 1ZBXA 2GFAA 1WHMA 2M00A 2XICA 1LTAD 3C94A 3MEWA 5NUCA 5I6YA 3FKIB 4HKEA 1JR0D 4DOWA 2B63G 2FZGB 3EG9A 3S15H 1E2WA 1ZA2B 1V1QA 1D2BA 2MP1A 2RJFA 5GMKi 3K8AA 1Y8OB 2K5NA 1EEFD 1NMFA 2K5QA 2QYZA 4ZYSA 3X3MA 3RKYA 4QKUA 2DZ9A 3CC2Q 3I4MH 1UJ0A 4C3IB 2DUDA 4EGVA 1YFNA 2AQ1B 2R92G 2A28A 1D3BB 4LD9K 1VCIA 1V1OA 1J5EQ 3BDCA 1BCMA 4RKUE 2O88A 4ZK9B 3G6ET 1STAA 4OIKA 4OB0B 1YJNA 1Y96A 5KCOA 4AYBG 1JXOA 1S72T 4M7DA 5HCKA 3H9NA 2FMCA 3K58A 1U4MA 2J6FA 3KDFB 1K83H 4X34A 3JB9H 5LJ5f 2QCPX 4OL7A 3QIIA 1CQFA 2DA9A 3UA7A 3CCMQ 4O0AA 1OZ2A 1WTPA 4LF8L 2YV5A 4GKJL 2GBQA 2FHDA 2ZPEB 1AZPA 1M2OA 2E2JH 2HQHA 2O4XA 4WF2A 1AWOA 1X54A 2M16A 2BE5D 1G8ZD 4QT7A 2KHJA 1XYIA 1C4QA 4L5GA 1H8KA 3A8IE 2RDGA 4H44C 1RTOA 1B53A 3T1YL 3LYIA 1I94L 2OWOA 3I4NB 3PO2G 4QQBX 5JJKA 1B7YB 2M02A 2L5QA 1B70B 2J6KA 2G3RA 3G48A 3G6EA 1ENCA 4A3FB 2Z0WA 4M77B 1JMCA 2IHFA 2L0CA 2KXDA 1NBEB 1ZSZC 1S72A 3I91A 1XMOL 1YZ6A 4NL3A 2JJQA 1IBMQ 3CC4Q 1S5BD 2CH4A 1XNRL 2RQRA 4OX9L 1MMGA 3JCMf 2F0LA 1VMPA 2MJ8A 1EY7A 5IAYA 3ZYYX 2BZYA 2E74C 2NVXB 2EYHA 3A98A 2CWPA 1B07A 1HNXQ 4MZMA 5IP7H 3NGPA 1YNXA 4KKTA 1RI0A 3GV3A 1Q1EA 1AEYA 5FW9A 2F5KA 4M7DG 5ELEA 4YCVA 1EOVA 2A6ED 2RJEA 3P75A 5FU7C 4JJNK 3RN5A 3M4GA 1SFOH 3DXJC 2JA8H 4C92E 1PH2A 1GXIE 4KRTA 2JA5B 2DD4A 4IN3A 1WQWA 2LP5A 2QEXQ 1YJ9T 1GUSA 3U9OA 4IUUA 1H9MA 4UDUC 4PNYA 3QYGB 2PUKB 4A3IB 2DXCA 4EIKA 1WDXA 1WCMH 5KNDA 1VQ9T 2UU9L 2RCFA 1WJQA 3H0GB 2K5HA 4A3JH 1UE9A 2FINB 4MZ9A 2SDFA 1K28A 3MEVA 3OYKA 2EZVA 4RUGA 1AWWA 1A0NB 3PV0A 1TWFH 4XU0A 4LF7L 1KG1A 1ZUKA 2ZPFB 5IHIA 2JA9A 1ZHIA 3MP6A 4EMKB 1EIHA 1AT1B 2XG8D 3HSBA 1LLRD 4YY3Q 1L1OA 2MGSA 3OYAA 1AOJA 1VQLQ 4RCNA 3RUZA 3PF5A 1F9RA 5LJ5e 3GF5A 2XRQD 4DV2L 2QXFA 1YJ9A 2E6NA 1O7LA 1YJWQ 4IALA 2MQHA 3ZEHA 3TZDA 3F2BA 2RO0A 2JA7H 4C3HG 1UDLA 1OQKA 1PM3A 3CCRQ 4K6DA 1T0HA 1M3CA 1KHCA 2KEDA 1VQ9A 3BJUA 1C48A 3GTJB 3A8LB 4C5HA 1BCPC 4UP7A 4DUYQ 4GOPC 3JCMW 1Q12A 4LNPA 2G9DA 4LDUA 1BBUA 3GBQA 2A5HA 3R93A 3HEJA 4ZGJB 2BH8A 1PHJA 4KH1B 1OZ3A 5K5PA 4G4KA 1N32Q 3FRPB 1HR0Q 3JRZA 2B2UC 4OMFB 5DM63 4R9WA 2YRVA 1FMVA 3UDIA 3OYGA 3M3YB 2R7ZG 1YWOA 2Z6KC 1AP0A 1QJOA 4DBFA 1I4GA 4X66Q 2JXBA 2ESWA 1PD1A 2GQIA 1GXDC 4HIOA 1AD5A 1ENAA 1CT1D 2L12A 4PG3A 1XTCD 3X3NA 3NBHA 5GAOl 4A3GG 3UDXA 4ORZA 4QQDA 3VYHB 2ZAEA 1VQKT 5L37A 2I5HA 1AVZC 2CZ1B 2X51A 3CU7A 3U23A 1LTID 4H0LC 5BN3A 2F0IA 4DR2L 1CKAA 1M1KR 2EBPA 3STBD 3AYHB 3HOZH 3WVEB 4RTYA 1M1KU 2D0QB 4WFN3 4P71A 4LF9Q 1NE8A 5D6YA 3J7YW 2NN6G 2JA6H 4HN7A 2XTIA 1S3OA 5KYUB 2FMMA 2RHYA 3PO3H 4B3RL 3PUYA 3UDFA 1HUMA 3RN2A 4LF6L 1H92A 4P74A 5GMKh 1AFPA 1Y1VH 4LF4Q 3J7AV 1BKBA 3TP6A 1Y71A 3M4OB 1JQQA 2K04A 5KYYA 4DV5L 1FJGL 2X69A 1W6XA 2BIVA 1VQKA 1Y1WB 2WAQE 4IJLA 3OWFA 1AW7A 4A53A 3VS3A 1PYSB 1K1ZA 1PRMC 4DEXA 2ZTEA 1STEA 2B2TC 2D9TA 1EY8A 4CC2A 2G9HD 4HTHA 1KSWA 4MNOA 1GOZA 4C92C 2PVGB 2PO4A 1ZUUA 2ICEC 4CKCA 3J81i 1GBQA 4KUIA 1U0LA 1JCKB 4BBRB 4AQYL 4YIJA 4IKFA 3F70A 1ML0D 4OONA 3ZJYC 3SK5A 1HK9A 1NSNS 3TCJA 1XPOA 2CYZB 4PNOA 2VB3X 1WTWA 3QR8A 1SSOA 2F0DA 2VGMA 1W70A 1NMGA 4FP5D 1IYVA 4PK4A 5CIUA 3BZKA 4E7SA 3E0EA 4L5TA 5DM73 5LL6S 1KQ1A 2XSCA 2JSOA 3UWNA 1WPYA 5GJVB 1RLQC 4L5RC 3VS0A 2PQWA 2LJ1A 3RMHA 4C0FA 4CKEA 1MV3A 1JU5C 1ZA1B 1EIGA 4JG2A 5I9OA 4M75A 1J5EL 2EJMA 3EROA 4M78C 3VYTA 3I55T 2GGRA 2RKSA 4DNTB 3NTKA 5CKHA 3ULRB 2QA4T 1MSHA 1KNEA 2ZM6L 2DBMA 5FU6C 4JYAQ 2AZSA 2J06A 1SLJA 2RF4A 2OTLT 3CCJT 2ZZDA 2A37A 1SE3A 3VYSA 4A3CH 4AT1B 2IWHA 1HPCA 2K33A 1VQGA 3T16A 4JI1Q 1JOQA 2HSPA 4MMKA 2VASA 4K0KQ 4DF7A 1QNUA 9ATCB 3SVMA 3RERA 1KDCA 2GVBA 1BQQT 5FRNA 5M9OA 5JJLA 1G6ZA 3QBYA 3PUWA 1S4ZA 2E5QA 1H9RA 3QUIA 4PJOA 1MKHA 1QOHA 1SE2A 3I5SA 3I55A 1K8AU 4U68A 4DAPA 5HURA 2QA4A 5I6WA 4M1UB 1LTRD 2NZ1D 1IBML 1O78A 3P8HA 1SR3A 5C6AA 2R3ZA 3S2HB 2CH4W 2OTLA 3CCJA 2PW5A 1GHJA 2DYIA 1TWAH 1W2BP 3G7LA 4PMBA 3J81L 1NNXA 2PCFB 4CJ1B 2A68C 2ZPHB 5C44B 3OYFA 1H3HA 2K9GA 1QUQA 1S5ED 4DOVA 1T9HA 5IGEA 3CCQQ 1PD0A 3MWYW 1YBYA 2P0QA 3K0YA 1EQRA 1HZCA 1RAGB 2KJXA 1RKNA 3J80c 4A4EA 2YTVA 1X3EA 3T56B 2JJ9A 2NUTA 1VQ6T 3KBXA 2YWWA 2XU8A 4DR3L 3IFDA 4FM4B 3A8JE 2BDOA 4IPGA 4BACA 1HR0W 4XYOA 3HG9A 3KXTA 1LOJA 1WJSA 4ZQ3A 1TXQA 1YCYA 1VQCA 2RB6A 1R8OB 1VQJA 2KBNA 3HS0C 1JB0E 4A3DG 3GTOB 2MK5A 4A3EH 3AHUA 5M5XB 4M77C 3JB9J 3AFQA 3I55Q 1I1JA 5LJ3f 5IYDH 3ZL7C 2EY6A 4EX5A 4Y7NB 4BD3A 4NS5A 2F0UA 1UGSB 1WFWA 4LFCQ 5C4XG 3K5MA 5HGTA 3W3AA 3WXMB 3L2VA 4O5VA 4JVZA 2ZPIB 5DNFA 4DK1A 4BY7H 2GVAA 2LMCB 5GAOn 3HKSA 1NAPA 2ID0A 3CC7Q 2FHTA 4V190 2B8GA 1YHQQ 3OYNA 4BWGB 3PIOA 2HL5C 4EQ5A 1OTCA 1N9WA 4E7LA 3A54A 1SN8A 1T5EA 5C4HA 1SXTA 1M8VA 4A93G 2MI6A 3HFZB 3BFMA 2HAXA 2D6FA 3E1SA 1IB8A 4HR7B 1N5ZA 5GANe 3N52A 2LQ8A 5LJ5d 4OMQA 5IGFA 2CKKA 4C3JH 1KIXA 2EPBA 1JJ2A 1JC7A 4WTOB 1U1SA 3HTRA 2MF2A 4GY5A 5LJ5j 1XWEA 2XRSD 3S1RH 1N32L 5LMUQ 1Q81R 1PRTF 5DEHA 1QILA 4LUDA 3HKZG 1OI1A 3CBOA 2F0FA 4J6YA 3K5OA 3M0TA 2FZKB 1M2VA 1NEBA 1VQOT 1VQFA 4DXGA 4JI7Q 3GTLH 4OGEA 4X66L 4B3SQ 4FYDA 5L23A 3DKMA 1D1IA 5FK9C 1Q86U 4EMKC 1H9SA 4KMUC 3EFRA 1R77A 2UXDQ 5FO7B 5K36G 4M7AA 4X3SA 4HCBA 1VQ6Q 3HOYB 1ZLMA 1NR4A 1EFNA 2RQUA 2O2LD 3QDRB 4OB1B 3J81E 2V8KA 5CVIA 1I4PA 5KNCA 4PJNA 2F0JA 1SROA 2AKWB 3T51B 1Q82U 4APVA 4HXJA 1D0YA 2COWA 1Q1BA 1GUTA 4LF9L 1ARKA 3E6ZX 1NJIU 2YUPA 1HQRD 3L3OC 5IYBG 1PRLC 3OW2P 1O7ZA 1HNWQ 1VQOA 2PPBC 2VXWA 1BB9A 2CCZA 1J6QA 1K8OA 2L8DA 5LJ3e 1QVGP 4J5YA 3AEVA 2B39A 2ZJQA 2LNHB 4BI3A 4A3LH 5J3BA 4LFAQ 1W6KA 2E5LQ 1VIFA 3RR5A 4LE9A 2LXJA 3D6CA 2LT4A 1EYCA 3TEEA 2B2YC 2X3XD 5FWCA 1B4OA 4YWLA 4BXXG 3NUCA 4BBSB 3R8BA 1PRTB 1HTPA 4A3KH 2P84A 2DRKA 3M9QA 3CCLT 4DV1Q 2I46A 5M3MB 3PF4A 2DJFC 1CSKA 2NBFA 2EYLA 3QJYA 5FJ8G 3TMEA 1XNQQ 4OB2B 1D6EC 2L15A 4Y28E 3HOWB 4HVUA 1VQBA 2SRCA 2DD5A 2OI3A 5LJ5g 2HIVA 4A3MH 3T1HQ 1WNLA 4R4CA 3I56T 4QIWB 3TQYA 3HOXH 4DR7Q 4I65A 2N55A 4LXCA 2LCSA 5CBAE 4JBJA 5DM7R 1IXDA 1B3AA 5G3LD 4FF1A 1GUNA 3RMSA 1VF7A 3BYTB 3RKWA 4JBWA 4OMLA 4Z8AA 5BN4A 3NP8A 3RNUA 2SNMA 4X9CA 3CCLA 3HOVG 5GADC 2F0PA 1GUGA 4ILWA 3NHHA 1HRJA 1X55A 4B9XA 4C5IA 3OMCA 1B9MA 1XQHA 1S5CD 2Y0SB 3OW7A 5C0MA 1D5MC 4Z02A 1EWHA 2VUMG 1A8VA 3I56A 4BY1H 4PZ6A 2K4YA 2DMOA 3QDFA 2RA2A 4HCSA 3JCMc 4HIMA 5EPJA 1I4XA 2Q8IB 1NLPC 4RTTA 2K4KA 2KCMA 2BH2A 4JI1L 4MDWA 2H3JA 3LLRA 1CKMA 1WD1A 2V4DA 2R93H 5IE8A 1Q81C 3LH5A 2WSFE 5BR8L 4V2SA 1FGUA 4K14A 1MV0B 3L2ZA 4G57A 2EVBA 3AFPA 3CP0A 4OHJA 1CSQA 4C92G 2M9UA 4GLMA 5GAMh 1SYCA 1IHWA 1Z47A 2JZ2A 4JRIA 5AYFA 5IGDA 1M27C 1WTRA 1T5XD 2WB1B 2I07B 2EYQA 3Q8DA 3NK9A 3JV3A 3MTSA 3QJ6A 3A55A 4ABNA 5CC4A 1GJXA 3EFOA 2LX9A 4E6RA 2E6ZA 5KE3A 2BE5C 1QVFP 2PVOB 2CP6A 1RDPD 3BVZA 5A0DA 4KTAA 2PZUA 2C0OA 3HPWA 5FU7B 1ET9A 5GROA 4LMQD 2XDDA 1EEID 4X62Q 4ZUJA 1LM0A 3J7A5 2NVTH 2JEBI 1ICWA 2K32A 5M3FH 4HAEA 4O6JA 1Q46A 3VR4A 4RG8A 2JOYA 1HZAA 4LW1A 5CMDA 4AFUC 4DFAA 1FMWA 2RNAA 4AG1C 4M78G 4M8AA 1RAFB 1P16A
chains in the Genus database with same CATH topology
3UATA 2CSIA 1ZBJA 2K7AA 3THKA 1UHFA 2DBKA 1Y57A 2I0NA 1UJ0A 2D8HA 2K79A 2A28A 1AZGB 1E7OA 2K3BA 2DL8A 2O88A 1K0SA 1OPKA 2JMAA 1VA7A 2JMCA 2KRMA 1JXOA 5HCKA 2A36A 2HEQA 1GBRA 3NMZC 2J6FA 4OMPA 2J6OA 1I07A 1ZX6A 2DA9A 2ECZA 3UA7A 4D8KA 2GBQA 1K9AA 1AWOA 2EGEA 3M0RA 4QT7A 1H8KA 4Z89A 2O2OA 3RBBB 2LJ0A 2JT4A 2HDAA 2J6KA 3REAB 1LCKA 1OPLA 2SEMA 3H0FA 1TG0A 2EYYA 2KXDA 2LMJA 1E6GA 5IHKA 2EYXA 2CH4A 2KYMA 2RQRA 1PKTA 1HD3A 4AFQC 1TUCA 2BZYA 1OEBA 3A98A 2FRWA 1B07A 4Y92A 3NGPA 2OAWA 1AEYA 5FW9A 2ENMA 2IIMA 1TUDA 4JJBA 1VYTA 4KRTA 2EQIA 1OOTA 2LP5A 4LUEA 4JZ4A 4D8DA 2JS2A 5IH2A 2DJQA 4EIKA 1WDXA 1T3SA 5IXBA 3QWYA 1UE9A 1M8MA 1JXMA 4RTXA 5FWBA 1X27A 2KT1A 1VYUA 4RUGA 1AWWA 1PHTA 1A0NB 1YNZA 1NLOC 1ZUKA 5IHIA 3I35A 1BK2A 1SEMA 1GFCA 1KIKA 1AOJA 1PWTA 2K2MA 1ZSGA 1UECA 2FPEA 4J9GA 1E6HA 1M3BA 2NUZA 1UDLA 1T0HA 1M3CA 1Y0MA 4JPBW 2FO0A 2M51A 4OMNA 2G6FX 1G83A 1WLPB 4ESRA 4LNPA 2VWFA 1QLYA 1FMKA 3GBQA 2AKKA 3UF4A 1QKXA 3NPFA 2KT8A 2BZXA 2A08A 1X43A 1X2QA 1BU1A 1B3QA 2EGCA 1YWOA 2DL5A 1HSQA 3VRYA 2JXBA 2ESWA 2GQIA 2L3SA 3QWXX 1AD5A 4FSSA 1QKWA 4IIMA 1SSHA 1X6GA 4ORZA 2DE0X 4J9BA 2RQVA 3M0UA 5I22A 1AVZC 3U23A 1JEGA 1X6BA 2JTEA 1CKAA 2BTTA 2EBPA 1YN8A 2YUOA 1WIEA 2EYWA 4RTYA 1NYGA 4IIOA 2NWMA 1K76A 1NEGA 2CSQA 2RF0A 3IQLA 1H92A 2CREA 2LJ3A 4J9CA 3M0SA 1UGVA 1JQQA 1SHGA 3VRZA 1JO8A 2L0AA 1CKBA 2O9VA 1W6XA 2L3QA 2ED1A 3VS3A 2DM1A 1G2BA 1PRMC 1K1ZA 2LQWA 4DEXA 2FRYA 4CC2A 2AZVA 1UHCA 1KSWA 2JW4A 1ZUUA 2MOXA 1GBQA 2ED0A 3SEMA 1BBZA 1FYNA 2H8HA 1UFFA 3VS6A 1GCQA 1W70A 1GRIA 4AFSC 2L2PA 3TSZA 3KFVA 2QDLA 4R0KA 5GJVB 1RLQC 1U06A 3VS0A 2LJ1A 1WXUA 1MV3A 1JU5C 5IXFA 1GFDA 2DILA 2MCNA 2GGRA 2PTKA 3O5ZA 2D0NA 3ULRB 2EYZA 2DBMA 3EGUA 2VKNA 2AZSA 2J06A 4HCKA 4M4ZA 2A37A 2FPDA 4ZNXA 2F2VA 2W10A 2KE9A 2HSPA 2KYBA 3VS2A 1QWFA 1SHFA 3FJ5A 1K0XA 1ABQA 1SPKA 3R6NA 1WYXA 4X1VA 2EVRA 2D1XA 4JJCA 2KBTA 3VS7A 3I5SA 2KNBB 4RTWA 1T3LA 4RTZA 2X3WD 2CH4W 3TVTA 2KRNA 1ZUYA 1J3TA 1WI7A 2E5KA 3M0PA 2KGTA 2K9GA 1H3HA 3H41A 2LQNA 2VVKA 1GCPA 2FG0A 2XMFA 2YSQA 4J9DA 3TSWA 4AFZC 4CC4B 4F16A 1M3AA 1VYVA 1XOVA 1Z9ZA 1SRLA 2GTJA 3VS1A 2O9SA 2RQTA 1WA7A 2DLPA 2RMOA 2D8JA 2CUBA 1RLPC 2GNCA 2V1QA 4HVWA 1I1JA 1RUWA 1UJYA 2J7IA 3ZL7C 1UG1A 2JM9A 2YUQA 1WFWA 1WXBA 1S1NA 1KJWA 2ROTA 1IO6A 2AK5A 2EKHA 2CDTA 2J05A 2M0YA 1GCQC 2LX7A 1N5ZA 2P4RA 3VS4A 4OMQA 2DVJA 3RNJA 1PKSA 2DF6A 4JJDA 4F14A 1U5SA 3UA6A 3EHQA 4K11A 5GJWB 4LUDA 2JS0A 4RTVA 2ROLA 3M0TA 1NEBA 1MUZA 2DL4A 2L3PA 2DNUA 1Z9QA 5L23A 5ECAA 2YUNA 4DEYA 3NHNA 2C0IA 1WX6A 2CUDA 2AKLA 1U3OA 1ZLMA 2JM8A 1EFNA 2KEAA 1QWEA 2B86A 2RQUA 2K6DA 2DYBA 2ABLA 1YP5A 4J9HA 4HXJA 1UUEA 1AWJA 1WXTA 1UTIA 3I5RA 1YWPA 2EGAA 4GBQA 1ARKA 2YUPA 3EHRA 1PRLC 2DRMA 3EG1A 1BB9A 2PZ1A 2FEIA 1YCSB 1NM7A 1NYFA 3CQTA 2LNHB 4WCIA 2CT4A 4Z88A 3I9QA 4LE9A 3PVQA 4J9FA 4A63B 2BZ8A 2X3XD 5FWCA 1QCFA 2F2XA 2DL3A 2DRKA 2LZ6B 2RQWA 1OV3A 1W1FA 1CSKA 2DX1A 1X2KA 2EPDA 2F2WA 1M30A 4LN2A 1KFZA 4HVUA 4OMMA 2CT3A 2KROA 2SRCA 3VS5A 2OI3A 2RN8A 3EG0A 2YT6A 2LCSA 4AG2C 2HCKA 5I11A 1HJDA 3PE0A 2V1RA 2KR3A 2RPNA 2KXCA 4OMLA 4Z8AA 3EG3A 3C0CA 4F17A 1K4US 3H0IA 3EG2A 2PNIA 2EW3A 2MIOA 1AZEA 3REBB 2DMOA 1V1CA 5IHNA 4JZ3A 1NLPC 4RTTA 2GTOA 4CC3A 4RTUA 1ABOA 2YDLA 2HBWA 3SHWA 3LH5A 1MV0B 2OJ2A 4OMOA 3H0HA 4GLMA 1M27C 2W0ZA 1AWXA 3JV3A 3PVLA 2DL7A 5EC7A 2FPFA 1GL5A 4E6RA 2C0TA 2C0OA 3M0QA 4J9EA 4CC7A 1SRMA 1X69A 1NG2A 4J9IA 1I0CA 1PNJA 4HVVA 2O31A 1T0JA 4AFUC 2RNAA 4AG1C 1RI9A 2KRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UAT A;  2CSI A;  1ZBJ A;  2K7A A;  3THK A;  1UHF A;  2DBK A;  1Y57 A;  2I0N A;  1UJ0 A;  2D8H A;  2K79 A;  2A28 A;  1AZG B;  1E7O A;  2K3B A;  2DL8 A;  2O88 A;  1K0S A;  1OPK A;  2JMA A;  1VA7 A;  2JMC A;  2KRM A;  1JXO A;  5HCK A;  2A36 A;  2HEQ A;  1GBR A;  3NMZ C;  2J6F A;  4OMP A;  2J6O A;  1I07 A;  1ZX6 A;  2DA9 A;  2ECZ A;  3UA7 A;  4D8K A;  2GBQ A;  1K9A A;  1AWO A;  2EGE A;  3M0R A;  4QT7 A;  1H8K A;  4Z89 A;  2O2O A;  3RBB B;  2LJ0 A;  2JT4 A;  2HDA A;  2J6K A;  3REA B;  1LCK A;  1OPL A;  2SEM A;  3H0F A;  1TG0 A;  2EYY A;  2KXD A;  2LMJ A;  1E6G A;  5IHK A;  2EYX A;  2CH4 A;  2KYM A;  2RQR A;  1PKT A;  1HD3 A;  4AFQ C;  1TUC A;  2BZY A;  1OEB A;  3A98 A;  2FRW A;  1B07 A;  4Y92 A;  3NGP A;  2OAW A;  1AEY A;  5FW9 A;  2ENM A;  2IIM A;  1TUD A;  4JJB A;  1VYT A;  4KRT A;  2EQI A;  1OOT A;  2LP5 A;  4LUE A;  4JZ4 A;  4D8D A;  2JS2 A;  5IH2 A;  2DJQ A;  4EIK A;  1WDX A;  1T3S A;  5IXB A;  3QWY A;  1UE9 A;  1M8M A;  1JXM A;  4RTX A;  5FWB A;  1X27 A;  2KT1 A;  1VYU A;  4RUG A;  1AWW A;  1PHT A;  1A0N B;  1YNZ A;  1NLO C;  1ZUK A;  5IHI A;  3I35 A;  1BK2 A;  1SEM A;  1GFC A;  1KIK A;  1AOJ A;  1PWT A;  2K2M A;  1ZSG A;  1UEC A;  2FPE A;  4J9G A;  1E6H A;  1M3B A;  2NUZ A;  1UDL A;  1T0H A;  1M3C A;  1Y0M A;  4JPB W;  2FO0 A;  2M51 A;  4OMN A;  2G6F X;  1G83 A;  1WLP B;  4ESR A;  4LNP A;  2VWF A;  1QLY A;  1FMK A;  3GBQ A;  2AKK A;  3UF4 A;  1QKX A;  3NPF A;  2KT8 A;  2BZX A;  2A08 A;  1X43 A;  1X2Q A;  1BU1 A;  1B3Q A;  2EGC A;  1YWO A;  2DL5 A;  1HSQ A;  3VRY A;  2JXB A;  2ESW A;  2GQI A;  2L3S A;  3QWX X;  1AD5 A;  4FSS A;  1QKW A;  4IIM A;  1SSH A;  1X6G A;  4ORZ A;  2DE0 X;  4J9B A;  2RQV A;  3M0U A;  5I22 A;  1AVZ C;  3U23 A;  1JEG A;  1X6B A;  2JTE A;  1CKA A;  2BTT A;  2EBP A;  1YN8 A;  2YUO A;  1WIE A;  2EYW A;  4RTY A;  1NYG A;  4IIO A;  2NWM A;  1K76 A;  1NEG A;  2CSQ A;  2RF0 A;  3IQL A;  1H92 A;  2CRE A;  2LJ3 A;  4J9C A;  3M0S A;  1UGV A;  1JQQ A;  1SHG A;  3VRZ A;  1JO8 A;  2L0A A;  1CKB A;  2O9V A;  1W6X A;  2L3Q A;  2ED1 A;  3VS3 A;  2DM1 A;  1G2B A;  1PRM C;  1K1Z A;  2LQW A;  4DEX A;  2FRY A;  4CC2 A;  2AZV A;  1UHC A;  1KSW A;  2JW4 A;  1ZUU A;  2MOX A;  1GBQ A;  2ED0 A;  3SEM A;  1BBZ A;  1FYN A;  2H8H A;  1UFF A;  3VS6 A;  1GCQ A;  1W70 A;  1GRI A;  4AFS C;  2L2P A;  3TSZ A;  3KFV A;  2QDL A;  4R0K A;  5GJV B;  1RLQ C;  1U06 A;  3VS0 A;  2LJ1 A;  1WXU A;  1MV3 A;  1JU5 C;  5IXF A;  1GFD A;  2DIL A;  2MCN A;  2GGR A;  2PTK A;  3O5Z A;  2D0N A;  3ULR B;  2EYZ A;  2DBM A;  3EGU A;  2VKN A;  2AZS A;  2J06 A;  4HCK A;  4M4Z A;  2A37 A;  2FPD A;  4ZNX A;  2F2V A;  2W10 A;  2KE9 A;  2HSP A;  2KYB A;  3VS2 A;  1QWF A;  1SHF A;  3FJ5 A;  1K0X A;  1ABQ A;  1SPK A;  3R6N A;  1WYX A;  4X1V A;  2EVR A;  2D1X A;  4JJC A;  2KBT A;  3VS7 A;  3I5S A;  2KNB B;  4RTW A;  1T3L A;  4RTZ A;  2X3W D;  2CH4 W;  3TVT A;  2KRN A;  1ZUY A;  1J3T A;  1WI7 A;  2E5K A;  3M0P A;  2KGT A;  2K9G A;  1H3H A;  3H41 A;  2LQN A;  2VVK A;  1GCP A;  2FG0 A;  2XMF A;  2YSQ A;  4J9D A;  3TSW A;  4AFZ C;  4CC4 B;  4F16 A;  1M3A A;  1VYV A;  1XOV A;  1Z9Z A;  1SRL A;  2GTJ A;  3VS1 A;  2O9S A;  2RQT A;  1WA7 A;  2DLP A;  2RMO A;  2D8J A;  2CUB A;  1RLP C;  2GNC A;  2V1Q A;  4HVW A;  1I1J A;  1RUW A;  1UJY A;  2J7I A;  3ZL7 C;  1UG1 A;  2JM9 A;  2YUQ A;  1WFW A;  1WXB A;  1S1N A;  1KJW A;  2ROT A;  1IO6 A;  2AK5 A;  2EKH A;  2CDT A;  2J05 A;  2M0Y A;  1GCQ C;  2LX7 A;  1N5Z A;  2P4R A;  3VS4 A;  4OMQ A;  2DVJ A;  3RNJ A;  1PKS A;  2DF6 A;  4JJD A;  4F14 A;  1U5S A;  3UA6 A;  3EHQ A;  4K11 A;  5GJW B;  4LUD A;  2JS0 A;  4RTV A;  2ROL A;  3M0T A;  1NEB A;  1MUZ A;  2DL4 A;  2L3P A;  2DNU A;  1Z9Q A;  5L23 A;  5ECA A;  2YUN A;  4DEY A;  3NHN A;  2C0I A;  1WX6 A;  2CUD A;  2AKL A;  1U3O A;  1ZLM A;  2JM8 A;  1EFN A;  2KEA A;  1QWE A;  2B86 A;  2RQU A;  2K6D A;  2DYB A;  2ABL A;  1YP5 A;  4J9H A;  4HXJ A;  1UUE A;  1AWJ A;  1WXT A;  1UTI A;  3I5R A;  1YWP A;  2EGA A;  4GBQ A;  1ARK A;  2YUP A;  3EHR A;  1PRL C;  2DRM A;  3EG1 A;  1BB9 A;  2PZ1 A;  2FEI A;  1YCS B;  1NM7 A;  1NYF A;  3CQT A;  2LNH B;  4WCI A;  2CT4 A;  4Z88 A;  3I9Q A;  4LE9 A;  3PVQ A;  4J9F A;  4A63 B;  2BZ8 A;  2X3X D;  5FWC A;  1QCF A;  2F2X A;  2DL3 A;  2DRK A;  2LZ6 B;  2RQW A;  1OV3 A;  1W1F A;  1CSK A;  2DX1 A;  1X2K A;  2EPD A;  2F2W A;  1M30 A;  4LN2 A;  1KFZ A;  4HVU A;  4OMM A;  2CT3 A;  2KRO A;  2SRC A;  3VS5 A;  2OI3 A;  2RN8 A;  3EG0 A;  2YT6 A;  2LCS A;  4AG2 C;  2HCK A;  5I11 A;  1HJD A;  3PE0 A;  2V1R A;  2KR3 A;  2RPN A;  2KXC A;  4OML A;  4Z8A A;  3EG3 A;  3C0C A;  4F17 A;  1K4U S;  3H0I A;  3EG2 A;  2PNI A;  2EW3 A;  2MIO A;  1AZE A;  3REB B;  2DMO A;  1V1C A;  5IHN A;  4JZ3 A;  1NLP C;  4RTT A;  2GTO A;  4CC3 A;  4RTU A;  1ABO A;  2YDL A;  2HBW A;  3SHW A;  3LH5 A;  1MV0 B;  2OJ2 A;  4OMO A;  3H0H A;  4GLM A;  1M27 C;  2W0Z A;  1AWX A;  3JV3 A;  3PVL A;  2DL7 A;  5EC7 A;  2FPF A;  1GL5 A;  4E6R A;  2C0T A;  2C0O A;  3M0Q A;  4J9E A;  4CC7 A;  1SRM A;  1X69 A;  1NG2 A;  4J9I A;  1I0C A;  1PNJ A;  4HVV A;  2O31 A;  1T0J A;  4AFU C;  2RNA A;  4AG1 C;  1RI9 A;  2KRS A; 
#chains in the Genus database with same CATH topology
 4JLI A;  1IW7 D;  4RGO S;  1E2Z A;  3UAT A;  4XTZ A;  3M9B A;  1VDZ A;  4YHH Q;  2K7A A;  3F1Z A;  5T1I A;  4IUN A;  2DBK A;  2A6E C;  3JCM J;  2LT1 A;  5JPN C;  2XWB B;  2I0N A;  4VUB A;  2QTX A;  2K79 A;  1LT5 D;  2QIL A;  1SE4 A;  3P8D A;  1AZG B;  1E7O A;  2XD0 A;  2K3B A;  2AWN A;  2EJG C;  2EQS A;  2KCN A;  4RGT A;  4NMZ A;  2KK4 A;  1OPK A;  3BDO A;  1RAB B;  2JMC A;  2KRM A;  4P5N A;  4N8F A;  2YLC A;  3JB9 F;  4BB7 A;  1ASY A;  3CD6 T;  2B2W C;  3A56 A;  3FKI G;  4N9P A;  2A36 A;  5E1F A;  4OO1 G;  1JJ2 S;  2AMC B;  1GBR A;  3NMZ C;  5T1G A;  2UUB L;  3SK6 A;  4RKL A;  1I07 A;  2ECZ A;  4KY7 A;  1PZI D;  2CP3 A;  5IP9 H;  1KK7 A;  3OTO Q;  3DM1 A;  4AH6 A;  1PSE A;  2K05 A;  4IPD A;  1V43 A;  1D1B A;  2RK2 A;  3OS0 A;  4C3I G;  2MFI A;  4C5G A;  2EGE A;  3PIP A;  3M0R A;  2PQA A;  3ZBD A;  4FYY B;  4Z89 A;  1FD7 D;  1CQV A;  1F77 A;  1PTO H;  1YNJ D;  1M90 C;  2O2O A;  4DR6 Q;  3FVQ A;  1G91 A;  2C5C A;  3RBB B;  5GAN 7;  2LJ0 A;  2LRQ A;  2JT4 A;  4NP5 A;  5GAO r;  3J7Z C;  2HDA A;  3S15 B;  5JVG 3;  5G3L F;  4B9W A;  2HDM A;  3H0F A;  1UEA B;  2JN4 A;  5LMU L;  2EAY A;  4N0A A;  4IFD G;  1TG0 A;  2DXU A;  4PJJ A;  3CD6 A;  4K2L A;  3VR3 A;  3W1G A;  1E6G A;  3S6W A;  4UY8 C;  4Y91 A;  1SJE D;  4A75 A;  2DN8 A;  5GAN d;  3MKD A;  1EOT A;  4I7Z C;  4JI2 Q;  2UUC L;  1ACM B;  2BKD N;  1KL9 A;  4JV5 Q;  4TSS A;  4E7J A;  3D8G A;  1AEX A;  4R56 A;  2JQO A;  4E6I A;  2KCT A;  2ZTD A;  1OEB A;  4C8Q A;  5CAI A;  1L1O C;  1RIP A;  2EY2 A;  2BDN A;  4LFB L;  3SR1 A;  2ENM A;  1STN A;  1SYG A;  4CJ0 B;  4DR5 L;  1ZQ1 A;  4R4I A;  4J8Q A;  4A3F G;  3PQI A;  4M77 G;  3LGF A;  4JJB A;  1K83 B;  2JVV A;  3G71 Q;  2Y0S E;  3MXN A;  3LWU A;  4ELZ C;  4X3U A;  2EQI A;  5CV4 A;  5C4X H;  1TS2 A;  5GQO A;  4JZ4 A;  3VYG A;  2Q8T A;  3RD4 A;  1HNW L;  1EX4 A;  3J80 i;  2E2J B;  1V1P A;  4KHZ A;  1BBX C;  1WQ7 A;  5IH2 A;  1LAB A;  3KF6 A;  1HCZ A;  2DAQ A;  2MAM A;  1G2S A;  1SAP A;  4LFA L;  2NUP A;  2HT1 A;  4WJ3 M;  1M8M A;  1AHJ B;  3STB C;  4DR4 L;  1D7Q A;  1CUK A;  5JEA H;  5JAV A;  4BY6 B;  1LO5 D;  2EQU A;  1ZKO A;  1TWC H;  3K7A H;  4FF4 A;  4HA8 A;  2JA5 G;  2WB1 E;  1R9T H;  4Q0F A;  5CK9 A;  5LJ3 d;  4D6W A;  4JOI C;  2P0K A;  1FGB D;  2VY3 A;  4JI0 Q;  3S1Q H;  1PH6 A;  2JN0 A;  3M55 A;  2LNV A;  5LJ3 j;  1AE2 A;  1GD7 A;  2PQE A;  3OWE B;  1M3B A;  5J1Z A;  1B9N A;  3H0G G;  3HRZ C;  3SK8 A;  4JPB W;  1MGQ A;  5AFW A;  4PLI A;  2FO0 A;  2E3H A;  4KBM B;  2G6F X;  3TRE A;  1N8R R;  2CQO A;  2NTT A;  1G83 A;  4ESR A;  4R4T A;  5LMN L;  3GTG H;  5C5L A;  1AH9 A;  3PMF A;  1PZJ D;  4ZTJ A;  4YWM A;  3OSO A;  4RKB A;  1SFO B;  2JA8 B;  2LCC A;  1FMK A;  4KI0 A;  1KC8 C;  1VQ7 T;  2DZC A;  1YI2 T;  1H64 1;  2QK0 A;  2BZX A;  3INZ A;  3H3V I;  5I2M A;  3E5S A;  1DXM A;  3E2U A;  5GAN g;  1WCM B;  1DD2 A;  2D62 A;  1TWG H;  2EGC A;  2A6H D;  2Z4I A;  3SHL A;  4A3J B;  2DL5 A;  5EPL A;  3IL8 A;  1W6J A;  4JS4 A;  4CKB A;  1P8L A;  3PFS A;  3P7J A;  4LDX A;  1TWF B;  2L3S A;  3VUZ A;  3L42 A;  3QWX X;  1AN8 A;  5KYU A;  4HJ5 A;  4FSS A;  1QKW A;  1ZYR D;  2Y90 A;  3GPL A;  4RH6 A;  5M5W H;  4A3B H;  3TSS A;  1W2B A;  4M77 F;  4J9B A;  6AT1 B;  4HED A;  3M0U A;  5C3E G;  3WDN A;  1CFM A;  2JXM B;  1VQ7 A;  1JEG A;  5FKA C;  1AZQ A;  1YI2 A;  2LVM A;  4JK1 C;  3T13 A;  1WYD A;  2NZO A;  3TP7 A;  3QO3 A;  4XIG S;  2JA7 B;  1WIE A;  3J80 L;  2KSS A;  4IIO A;  2RH2 A;  2NWM A;  4DAY A;  3Q24 A;  1I81 A;  2OT2 A;  3FLG A;  1O80 A;  2IJ0 A;  2ZTC A;  2NVQ H;  1ILP A;  3J7A F;  5CYU A;  1UGR B;  2LFN A;  3L0O A;  3ICE A;  3S17 H;  1R4P B;  3CEY A;  2CRE A;  4NL2 A;  4KT0 E;  2LJ3 A;  4E7Z A;  1Q7Y C;  2XWJ B;  2E2I H;  1LAC A;  2ZXO A;  1UGV A;  3EH1 A;  1JIC A;  1BNZ A;  3V7C A;  2O9V A;  1CKB A;  3TP5 A;  4F7U F;  4PMC A;  1WOC A;  4CDE C;  2E2H H;  4K5V A;  1ICF B;  5LJ3 g;  4BA1 I;  3F2D A;  1EQV A;  2LQW A;  1U5K A;  2FRY A;  3L2U A;  2UXC Q;  3QOL A;  1NZ9 A;  1UHC A;  1EFW A;  2JW4 A;  2L1B A;  3O13 A;  2AQ2 B;  1MMA A;  2DNC A;  2ED0 A;  2LSS A;  4DUZ Q;  3GIB A;  4JI3 L;  4F04 B;  3CCE T;  3FPU B;  4DA2 A;  2R5M A;  1RL2 A;  3RR6 A;  1EWC A;  4IPC A;  1BDO A;  1BBZ A;  4RA8 A;  2A7Y A;  4KGX B;  1PYB A;  4KH0 B;  2I5M X;  1GCQ A;  2TSS A;  4M7D D;  1A3U A;  2LXK A;  1Y1W G;  3JAM c;  3HOZ B;  2HKN A;  2KY9 A;  2L2P A;  4X3T A;  2EYJ A;  5A2Q L;  2ATW A;  3RUX A;  3LW5 E;  2QQB A;  3DB4 A;  1GKH A;  2JA6 B;  2NB0 A;  3D7S B;  3GD7 A;  5ELC A;  2K5F A;  2ZPG B;  2I0Q A;  3V8L A;  1TR5 A;  3PO3 B;  4BBR G;  4PLL A;  5CCA A;  3R3O A;  5IWA L;  1QVP A;  3HFO A;  1WXU A;  1Y1V B;  4B3T Q;  5IXF A;  1UE1 A;  2DIL A;  1YJN Q;  3GTP H;  3X24 B;  3E9F A;  3CCE A;  4RG1 A;  2AHO B;  1I4K 1;  3O5Z A;  4J6X A;  1UE5 A;  1ZEQ X;  2PI2 E;  5GMK e;  2DK3 A;  3EGU A;  1CI3 M;  1LT6 D;  1N8R C;  2MWP A;  3TQ7 P;  1MNE A;  4JC0 A;  1UUP A;  4F7U B;  2KMT A;  4IQZ A;  1KDA A;  2A74 C;  4MTN A;  1B34 B;  2F2V A;  2F0N A;  3I4M B;  1MMD A;  4B3M L;  4DV7 L;  1FX7 A;  1NY4 A;  3Q0A A;  4C0G A;  3OBW A;  2OXP A;  2Q2I A;  1BI0 A;  5LHY 1;  3FJ5 A;  1ABQ A;  2JE6 I;  3KK7 A;  3R6N A;  1MHW C;  4DAM A;  4GLX A;  3M54 A;  4DV0 L;  3G6E Q;  3G4S A;  3GOX A;  1AE3 A;  2D1X A;  4JJC A;  2KBT A;  3VS7 A;  1E24 A;  4RCO A;  1S72 Q;  2KNB B;  2UXB Q;  3J80 E;  1EYD A;  1X3F A;  3KF8 A;  3OW2 A;  3ND8 A;  3M4Q A;  4RTZ A;  2X3W D;  4CGY B;  1BI2 A;  2B2V C;  3I70 A;  3HOU G;  2EJF C;  1QVG A;  2R7D A;  4JS5 A;  2PW7 A;  3C4S A;  2K5D A;  3CHB D;  4M78 E;  2Y4X A;  1IGQ A;  1WI7 A;  4XT1 B;  4DGZ A;  1VQM T;  3RZO H;  3FPP A;  1SYE A;  2E8G A;  1WHL A;  1STG A;  3H41 A;  4DN4 M;  3VA7 A;  1JRI A;  4N4G A;  1K9M C;  2IX3 A;  1NUC A;  2F0G A;  1QZG A;  2CZ7 B;  1XPR A;  1GCP A;  2YSQ A;  4J9D A;  4BE2 A;  3SWN B;  5KYW B;  3S16 H;  3KJP A;  4N9T A;  1VYV A;  4PJL A;  3T53 B;  1Z9Z A;  2V1C C;  4P73 A;  1D0X A;  3PNW C;  1XNI A;  1MI2 A;  3VS1 A;  2O9S A;  2RQT A;  1DGS A;  4XYQ A;  2RBM A;  2RMO A;  4CDD C;  4OF1 A;  5C0X G;  2JUF A;  4UP8 A;  3OYB A;  2CUB A;  1RLP C;  2IW3 A;  4X64 L;  5C44 G;  4FF3 A;  1YIT T;  5E4W C;  3BE3 A;  1JWM D;  3QWN A;  3VA5 A;  1VQM A;  3PUV A;  2J7I A;  1LV9 A;  5A2Q E;  1Q3L A;  1SNQ A;  5CBE E;  5GAN 4;  2E4H A;  3OMG A;  1PH4 A;  1UE6 A;  1WXB A;  1BYM A;  4ZRZ A;  2DEU A;  2F3V A;  3M57 A;  2AUJ D;  1SRU A;  1PH5 A;  1IO6 A;  3K80 C;  2AK5 A;  2EKH A;  1YJ9 Q;  1LYL A;  1VQ8 T;  1TWA B;  5AJ3 Q;  1FYC A;  3K5L A;  2LKV A;  5KYX B;  4QVC A;  3C12 A;  3EH2 A;  1CKN A;  4ZGD B;  1VQ9 Q;  2ZGW A;  2OAU A;  4EQN A;  3AT1 B;  1HNZ L;  4DV4 Q;  2Q2T A;  2K5V A;  2LX7 A;  1YIT A;  4MML A;  1K73 R;  2CVR A;  4MZP A;  7AT1 B;  5HY6 A;  2P4R A;  3VS4 A;  2MMP A;  3H3V H;  2X9H A;  3RNJ A;  4X9D A;  4JJD A;  4BS9 A;  1D5X C;  5H1S E;  5IN1 A;  4F14 A;  1U5S A;  2DET A;  2RA4 A;  1W2B S;  1VQA A;  2IX1 A;  2QEJ C;  1IGU A;  2EFI A;  3UA6 A;  3HP3 A;  3OYD A;  1D1C A;  3DEP A;  3CRL C;  3KUP A;  4RTV A;  1YHB A;  4GNX C;  1LPL A;  3D3R A;  4M77 E;  2QQ9 A;  1VQ8 A;  2VW9 A;  2CGH A;  2BUD A;  4A3E B;  1VQM Q;  2AWO A;  3O8V A;  2DNU A;  3MPU B;  1Z9Q A;  5AT1 B;  5IYC H;  4JRQ A;  3F8T A;  5C3W A;  4BY6 C;  1HJP A;  4FO2 A;  5L8R E;  3NHN A;  3WOF A;  3GNF B;  1QVF A;  1DON A;  3OS2 A;  2VS1 A;  2CUD A;  4BY7 B;  2OTJ T;  3D31 A;  1QCO A;  1U3O A;  4KUL A;  2JM8 A;  4G7O C;  2KEA A;  4DA4 A;  3EG9 B;  3KOJ A;  5C0X I;  2ZJP A;  4KGZ B;  1BR9 A;  5IGG A;  2ABL A;  2CP5 A;  1YP5 A;  3R6O A;  4J9H A;  1X3P A;  3QOJ A;  1UUE A;  5A35 A;  2K5W A;  5JEA J;  2HZY A;  2EYM A;  3I5R A;  4HJ8 A;  2EGA A;  2QDB A;  1SND A;  2VQE Q;  3JCM P;  3EHR A;  4F7U E;  5FLX L;  1WTO A;  1M4V A;  2PZ1 A;  1KAB A;  3MC0 B;  3SE0 A;  2DTO A;  2NYZ D;  1SYF A;  1WI5 A;  4C3J B;  2K50 A;  4KKU A;  4PL6 A;  4WCI A;  4L6V 5;  1X3Q A;  3E9G A;  3S1R B;  1Y96 B;  1VQK Q;  3V7R A;  2R6G A;  2OTJ A;  3JCM V;  4AMC A;  1PFB A;  2HSE B;  2QF7 A;  1NE3 A;  1NPP A;  2WSC E;  5ELB A;  1F9P A;  1N9S A;  3KUF A;  2F2X A;  4J6W A;  4E2F B;  1VQD A;  2NN6 I;  3I3C A;  3I2Z A;  4UHV A;  3GTL B;  4EPC A;  4XQJ A;  2LZ6 B;  2RQW A;  4NXM Q;  1OV3 A;  3A0J A;  2O4X B;  2EPD A;  3G6J B;  1OX9 A;  2PVD B;  1M30 A;  4C0Z A;  1PTO D;  1PZK D;  3L1A A;  4M75 D;  3QG1 A;  4OMM A;  1KFZ A;  1L0X B;  4LDV A;  2VC8 A;  5GAN f;  1EYA A;  5KYI A;  2RN8 A;  3BU2 A;  2VV5 A;  1JT8 A;  4H7B A;  2OQ0 A;  1EY6 A;  1RAD B;  2K52 A;  2MO1 A;  4DBH A;  1CKO A;  3I8Z A;  1ESF A;  1EIY B;  2PZT A;  4AG2 C;  4DAV A;  1F9S A;  3L2P A;  3NTI A;  4JUV A;  3HGB A;  3JCM h;  4KLK A;  3SK4 A;  4BBS G;  2V1R A;  2HIX A;  3H6M A;  2FZC B;  2BA1 A;  1N34 Q;  5C3E H;  2B63 H;  3Q1J A;  5M3M G;  3EFS A;  5M5Y H;  4CJ2 C;  3EG3 A;  3C0C A;  3SD4 A;  5E7N A;  1QZH A;  4FW1 A;  5F2D A;  4XQN A;  1N36 Q;  2RDH A;  1HNX L;  1K4U S;  1ZSZ A;  3DWQ A;  2NLU A;  3HRS A;  1F9Q A;  1LT3 D;  3C3L A;  3HOW G;  2DIQ A;  1DZ1 A;  2EW3 A;  3EGD A;  2LC4 A;  3HZX A;  4LK1 C;  2MIO A;  2E65 A;  2HHH Q;  1A63 A;  1IW7 C;  4PJO D;  4K5X A;  3QYH B;  2KEE A;  2R92 H;  5GAM f;  4OWX B;  4A54 A;  2DY8 A;  1FNW A;  3D4R A;  4JI4 Q;  3REB B;  1K73 C;  2C06 A;  4A3K B;  2H3E B;  3OW2 S;  4JI8 Q;  3X20 B;  2CZ6 B;  4CC3 A;  4RTU A;  1F2Y A;  1C6V X;  3K5N A;  1QVG S;  2HBW A;  3LWI A;  3QB3 A;  4HMI A;  5EBC A;  2DER A;  1P92 A;  5IY0 A;  1PFN A;  2D9U A;  1V9P A;  2K57 A;  4A3M B;  1SF9 A;  4OMO A;  3H0H A;  3HOX B;  4QQ6 A;  2ZPB B;  5GMK j;  3OS1 A;  3CMA A;  2Y0S G;  2QA4 Q;  2UXB L;  4LDW A;  4LDY A;  5GAN 6;  3GP8 A;  3EFX D;  2Z4H A;  1KDB A;  2OCE A;  4P72 A;  2Z0S A;  5D3D A;  5C4Z A;  3PVL A;  5DLO A;  4YY3 L;  2OTL Q;  3QO2 A;  3CCJ Q;  2NVY H;  3PO2 H;  1L1O B;  1I3Q H;  2SOB A;  2BE7 D;  5FLX E;  1GL5 A;  1HTL D;  2H5X A;  1HFG A;  2ZXP A;  3KBG A;  3SFM A;  2NTS A;  1YNJ C;  2KAF A;  2K03 A;  2K5L A;  1G5V A;  4J9E A;  4DV6 Q;  2VYT A;  5EGT A;  5DLQ E;  4ZGE B;  2L3R A;  5IOC A;  4UP9 A;  1TWH H;  2MPM A;  4CC7 A;  2HD3 A;  4DUY L;  3TS0 A;  4J9I A;  4N4I A;  1D5Z C;  2COZ A;  3OYL A;  1K3B C;  2IPK D;  1PNJ A;  3CCS T;  2WB1 G;  3KLW A;  4BY1 B;  4C0D B;  3T4A C;  4G7Z C;  1PFM A;  2XN9 C;  1HR0 L;  3OSS C;  2J7Z A;  3TRZ A;  2G5D A;  1RI9 A;  5FLM G;  1PH1 A;  2R93 B;  4GOP A;  4ODG A;  3ONA B;  1HYO A;  1EY0 A;  1Q81 U;  1IZ6 A;  2CSI A;  1ZBJ A;  5C5M A;  1DCZ A;  1JWU D;  3E19 A;  1SE8 A;  5KH6 A;  1OU8 A;  1U4P A;  1C7Y A;  4NOY A;  2EY5 A;  3QZ9 B;  2D8H A;  4N0A C;  3JAM i;  1TS3 A;  2B2U A;  3OSV A;  3NBH B;  4RMO A;  2DL8 A;  1K0S A;  2YYZ A;  2NZH A;  3A1P A;  1VA7 A;  5GAM e;  1O75 A;  3CCS A;  2Z6K A;  2YRD A;  1CTM A;  4MIU A;  3IRB A;  4IOC A;  2LCL A;  2DY7 A;  2LDM A;  1VQP T;  2HEQ A;  2FJ2 A;  1X56 A;  3NEN A;  4DKA C;  4OMP A;  2O5J C;  2QQR A;  2F0M A;  2JP1 A;  3HOU H;  3LGL A;  1ILQ A;  4DV4 L;  2NVT B;  1DOL A;  1PTO F;  5M3F B;  4M75 F;  4O2D A;  2E64 A;  3SWN C;  3OYJ A;  4K6L A;  1PA6 A;  5HK0 A;  2J0T D;  4LF4 L;  2N49 A;  3M7N A;  4C3H H;  1K0R A;  4M7A D;  1QVF S;  1Y69 U;  1OYX A;  5KYY B;  1OPL A;  4Q5W A;  1SDF A;  2SEM A;  5CKE A;  4FSX A;  4DV3 Q;  1HXY D;  2E75 C;  1VQP A;  4YCW A;  1HFN A;  2EYX A;  4ANJ A;  2RJC A;  1HD3 A;  3GTM H;  1TWB A;  3V7S A;  4AFQ C;  5CQY A;  3MP8 A;  5GAO q;  1UNS A;  2F4V Q;  4EMG A;  2FRW A;  4RHS A;  4PJO F;  5C0X H;  2PI2 A;  4DR1 Q;  1FWZ A;  4J8O A;  2R7Z H;  2B2T A;  3W5O A;  2SEB D;  1IBL Q;  4PV1 C;  4C92 A;  2KI7 A;  2A6H C;  2DGY A;  3UDG A;  2QAS A;  4A3G H;  3U58 A;  2EQJ A;  3EGX A;  1EU4 A;  4ME7 A;  2FVU A;  1C1A A;  4ZN1 A;  1STH A;  3FIF A;  2EXD A;  4LUE A;  1FVI A;  1VQO Q;  4D8D A;  1IKL A;  2JS2 A;  2WIN B;  1ZYR C;  5FRO A;  2N88 A;  2IHE A;  3D4D A;  1M90 R;  2BCO A;  3BS1 A;  4GZY C;  1PTO B;  3JAM L;  4M75 B;  2UUA Q;  1T3S A;  1M90 U;  1DJR D;  1TY0 A;  4YWK A;  2XI9 A;  1S5F D;  5FWB A;  1RD9 D;  1X27 A;  4IUR A;  1OXX K;  2NN6 H;  3BVG A;  4LUV A;  5DY9 A;  1YNZ A;  2F4I A;  2X4X A;  2J4X A;  2E2D C;  1A62 A;  1UGQ B;  3H09 A;  4L8J A;  5IIF A;  3JB9 G;  4JI5 Q;  3I35 A;  5CV6 A;  1BK2 A;  1SEM A;  1I5L A;  1VQN T;  1GFC A;  2DTI A;  4M78 A;  1EY9 A;  1SNO A;  1I5F A;  4NXM L;  1UGP B;  3A7A B;  3GQB A;  3NTH A;  3RKX A;  1CHP D;  1EFI D;  1II3 A;  3PGZ A;  4A4I A;  4K0K L;  1MBY A;  4J7I A;  4NXN Q;  3ERQ A;  2NUZ A;  1Q8I A;  1YNN D;  4WJW A;  1Y0M A;  2YXY A;  3KYH C;  1VQ4 T;  1WLP B;  1KQS P;  4PJO B;  3A5U A;  3CXC P;  2Q2H A;  1LVK A;  2V8I A;  2HBP A;  2VWF A;  1QLY A;  2ASB A;  2MPX C;  1OXS C;  3NSW A;  3S2D B;  5C4X B;  1KD1 R;  3W1B A;  3UF4 A;  3M59 A;  3R2T A;  1IKM A;  1L0Y B;  1FNU A;  3NPF A;  2KT8 A;  3F2C A;  2A08 A;  3A7L A;  3CCL Q;  1VQN A;  1PV4 A;  1X2Q A;  1N36 L;  1I8F A;  1BI3 A;  4PJM A;  5IP7 G;  3RMQ A;  2JTF A;  2Y4Y A;  3M56 A;  1QUQ B;  1N6A A;  3GLX A;  4M7D C;  2P4T A;  4C56 C;  1CA5 A;  3E3X A;  2HHH L;  3BZD B;  2IX0 A;  2EWN A;  4XT3 B;  3VR2 A;  1D3B A;  3I56 Q;  1Q86 C;  3ND9 A;  2X4Y A;  2JA8 G;  1VQ4 A;  2NUT B;  1TWC B;  2DE0 X;  3K7A B;  1L2F A;  1VQ5 T;  2RVL A;  5FLX c;  2RQV A;  3J81 j;  1R9T B;  3RLO A;  5I22 A;  2YTX A;  5EPK A;  3CF5 A;  3S1Q B;  4OVA A;  2JTE A;  2A1A A;  2CHB D;  2BTT A;  3FEW X;  1EY4 A;  1WCM G;  3TEH B;  2AQ3 B;  3KDF A;  1YN8 A;  3CME T;  4A4H A;  4DU9 A;  3VDY A;  4A3J G;  5IT9 c;  2KEN A;  4LAA A;  4LF8 Q;  4GKJ Q;  4EVO A;  5HK3 A;  3GTG B;  1OU9 A;  1WTV A;  3ER0 A;  1NEG A;  2K2V A;  3A8K E;  4M7A F;  3IAY A;  2YHT A;  3OQ5 A;  4KGV B;  5GMK m;  1KC8 R;  1FNV A;  2QI2 A;  2K75 A;  3E9I A;  4LFC L;  5I2X A;  4R8I A;  3OYI A;  1SNM A;  3T1Y Q;  1I94 Q;  1KC8 U;  4HMJ A;  4A76 A;  4JI6 Q;  3Q23 A;  2HD0 A;  3N5B B;  1HXD A;  2B8A A;  3VRZ A;  4NKL A;  3V2T A;  4EQO A;  1XJW B;  4M77 A;  1VQ5 A;  3JAM E;  3I4L A;  2ED1 A;  1TWG B;  4F8M A;  2JA7 G;  5A0G A;  2LY7 A;  1WTH A;  2PNR C;  4QJF A;  4HCE A;  1XMO Q;  4KHP Q;  1EL0 A;  4FYW B;  2AZV A;  3PMI A;  5BN5 A;  3PGG A;  3CME A;  3EAE A;  1BBW A;  1NCV A;  4OX9 Q;  3S1N H;  3OPO A;  4HID A;  5M5W B;  5EQ0 A;  3SEM A;  4A3B B;  2E76 C;  4FXD A;  3OHX C;  4OWT B;  3GNG A;  1I4R A;  1B2T A;  1FYN A;  3X28 B;  1KAA A;  4E7I A;  4XQQ A;  3CPW P;  5CKF A;  3VS6 A;  4QF4 A;  3LWH A;  2MYS A;  1GRI A;  3CBM A;  3BDU A;  2RHU A;  3K6O A;  3LWE A;  4J15 A;  3TSZ A;  3KFV A;  4QIW E;  1M2V B;  4JI7 L;  1MJE A;  4B3S L;  2XK0 A;  5EKK A;  3KLS X;  2NVQ B;  2F0W A;  2KQ3 A;  1B7T A;  5GAN j;  1U06 A;  3S17 B;  2XVS A;  1H9S B;  1Q7Y R;  2UXD L;  2DEQ A;  2UU9 Q;  3BVM A;  1BCO A;  1GFD A;  2EY1 A;  2E2I B;  2MCN A;  3I4N G;  1U1T A;  4QQG A;  5D6W A;  4M7A B;  1Q7Y U;  3TDQ A;  4QCL A;  3SEB A;  3C1F A;  2D0N A;  4A3D H;  5JVH 3;  5J26 A;  2HUG A;  2D5D A;  4K2K A;  2RK1 A;  2E2H B;  2VKN A;  3OIQ A;  3QPH A;  5ELF A;  4LF7 Q;  1TKW B;  4C1N K;  3HOZ G;  4HCK A;  4EMK A;  1YIJ T;  2F0H A;  2FPD A;  3MEF A;  1GUW A;  4WOR A;  4ZNX A;  2W10 A;  1KD1 C;  4KJO A;  2LQK A;  1MSG A;  1BIA A;  3VV0 A;  4KN4 C;  2KE9 A;  2KYB A;  4DV2 Q;  3PO3 G;  3VS2 A;  1QWF A;  2RCN A;  5GAM d;  4C0D C;  4EDU A;  2F3I A;  4J6H A;  2A0F B;  1OX8 A;  1K0X A;  1WZO A;  1Y1V G;  4C8Q D;  2PNH A;  1SPK A;  4GNX B;  4OO1 I;  3SDZ A;  3SB2 A;  2IG0 A;  5GAM j;  4UAI A;  4X1V A;  2RHI A;  1SYB A;  2E5L L;  5I4D A;  2IL8 A;  4NW2 A;  4A93 H;  4UPA A;  4R4Q A;  1C9O A;  3NFC A;  3CD6 Q;  3I7F A;  1IHV A;  4DV3 L;  3KLS A;  5C4J H;  1TU2 B;  4PJO E;  1N9R A;  4F7U G;  3UE1 A;  1RAA B;  4DV1 L;  1YIJ A;  3TVT A;  2KRN A;  2WKC A;  3BW1 A;  3I4M G;  2XNA C;  2PYK A;  5COR A;  1LTS D;  4L63 B;  3AQQ A;  1J3T A;  2DJG C;  4A3I G;  2E5K A;  2F4V L;  1XNQ L;  2B2Y A;  3GTP B;  2DVE A;  4DR1 L;  3M0P A;  4ELY C;  4IFD I;  3T1H L;  1V29 B;  1I4H A;  1YVC A;  4DR7 L;  2LQN A;  2MNA A;  2VVK A;  4AFZ C;  2XMF A;  1N8R U;  1N27 A;  1EQT A;  1X3G A;  2RDF A;  2MUY A;  4FVM A;  3TBI B;  3VJP A;  1M3A A;  1QCB D;  3GTQ H;  2R5A A;  5K36 H;  3H6Z A;  1EZ8 A;  1XOV A;  1SBB B;  1SRL A;  1TUG B;  1OUL A;  3CQZ H;  1WTX A;  1HA6 A;  1GUO A;  4DR2 Q;  3VR5 A;  3TP8 A;  1WA7 A;  2DLP A;  2IPO B;  2PZW A;  2KEC A;  3D6W A;  3WWV A;  4BDY A;  2DO3 A;  3CCM T;  2YRC A;  2F0K A;  5EAY A;  2QGG A;  2IVW A;  3K57 A;  1PH7 A;  2BE9 B;  1ET6 A;  3MA2 B;  4JBM A;  5IYB H;  5FOB B;  3WVD B;  1PH8 A;  4K8I A;  1KRT A;  2JM9 A;  4JCV E;  4FW2 A;  4O42 A;  4B3R Q;  3H91 A;  4LF6 Q;  3A8H B;  2RHS B;  1B44 D;  1S1N A;  1KJW A;  1VQH A;  2ROT A;  2M1H A;  3TU4 K;  2WFW A;  4KY5 A;  4HSV A;  1E1O A;  4Z9C B;  2F0V A;  2LS0 1;  1G8X A;  4LJZ C;  3CC4 T;  3RZO B;  2XDB A;  5KEE A;  5KE2 A;  1K9M R;  2J05 A;  1U4L A;  3GTK H;  3ITP A;  1Z9F A;  5GAM g;  1YEZ A;  4BXX H;  3QIA A;  3CCM A;  1RCV D;  1IL8 A;  5C3X A;  1K9M U;  1SYD A;  3WOE A;  1TU0 B;  4AQY Q;  1IYU A;  3VUB A;  4C2M H;  3S16 B;  2QGQ A;  1M1F A;  5FJ8 H;  1CHQ D;  1LNX A;  4G7H C;  1OO9 B;  2DF6 A;  3CBP A;  2K01 A;  3EFO B;  3JSC A;  3MVV A;  3S1M H;  4HJ9 A;  2D2C C;  1XTD A;  5C0X J;  4QVD A;  3PIP 3;  3GP7 A;  2K6A A;  5COY A;  3EHQ A;  1PTO C;  2WP8 J;  2Z6B A;  4ZKB B;  4M75 C;  5GJW B;  4LD6 A;  1MHN A;  2MWO A;  2ROL A;  4R4O A;  3UI2 A;  4X62 L;  2QEX T;  3M7G A;  2TMP A;  4JBK A;  2F3W A;  4F7X A;  4QUC A;  2L3P A;  3CC4 A;  4FT4 A;  3ULJ A;  4K5W A;  1KLU D;  3HOV H;  4MDX A;  1A0I A;  1E22 A;  3HL8 A;  4DNI A;  2C0I A;  1O7I A;  2GF7 A;  1EY5 A;  1I50 H;  2ATC B;  2AKL A;  3P8B B;  4RMF A;  5CQX A;  3RZD H;  1VQ7 Q;  1TQO A;  2E10 A;  3S14 H;  1YI2 Q;  1QWE A;  2B86 A;  4F87 A;  4M7A E;  2ZM6 Q;  3OYH A;  2K6D A;  4JLG A;  5HKC A;  4F88 A;  2DYB A;  1H9K A;  2K7V A;  3LX0 A;  3L7Z C;  4YHH L;  2VUM H;  2GFU A;  2K3X A;  3V8J A;  1VQL T;  1SSF A;  4ZN3 A;  2ZCF B;  4ULL A;  4A3E G;  4ZLT F;  1JBM A;  4PJO C;  4C8Q F;  2DRM A;  2QEX A;  5IYD G;  4E47 A;  4L5S A;  5D6X A;  1YJW T;  3DWA A;  3X25 B;  3BG3 A;  4MN3 A;  3CCR T;  3G4S T;  1NM7 A;  2VL6 A;  3C2P A;  1PCX A;  4KK7 A;  1WHJ A;  1TS4 A;  2HNI A;  3VR6 A;  2F03 A;  1V76 A;  1HH2 P;  1RAI B;  1M8A A;  4JI6 L;  2WAQ B;  4BY7 G;  1KNA A;  2CT4 A;  4CI0 C;  1XX8 A;  4Z88 A;  4DQ2 A;  3DWP A;  3MO8 A;  2B8F A;  2F0T A;  2RJD A;  1R0B G;  5GAN 5;  3W2D A;  1HHV A;  4IO9 A;  4KHP L;  5CKD A;  2NUC A;  2EJG A;  3S3N A;  2XIW A;  2B3G A;  3OTO L;  4PQX A;  3LX7 A;  1PG5 B;  4ID6 A;  4A4G A;  5ELD A;  1VQL A;  3MEH A;  2B2W A;  1C0A A;  1E2V A;  1X2K A;  2L9H A;  2PQA B;  5DAU A;  5E3F A;  2M2L A;  4C3J G;  4POG A;  4DR6 L;  4FNF A;  3NQI A;  1YJW A;  4C5E A;  2YU9 H;  4PFP A;  2KRO A;  4IUQ A;  3VS5 A;  3CCR A;  1JJC B;  4ALP A;  1I6H H;  4LUZ A;  4GKK Q;  4FXK C;  3ME9 A;  4BI4 A;  1Z7T A;  4DNR B;  1K8G A;  1VUB A;  4RFB A;  5GAN 8;  5FO9 B;  4YTL A;  4JI2 L;  5I11 A;  1HJD A;  3PE0 A;  4DR3 Q;  2KR3 A;  4KD3 A;  1OXV A;  2GCX A;  1LTG D;  3Q6S A;  4JV5 L;  3Q22 A;  1TS5 A;  4GLA C;  3BDL A;  4F17 A;  3FDR A;  4C8Q B;  3FEO A;  1V8Q A;  3CCE Q;  2V8J A;  2KVQ G;  2E1H A;  4BUG A;  1VS0 A;  4DBQ A;  1SNP A;  2L11 A;  3A74 A;  4KN7 C;  1I4Q A;  1JB7 A;  1LTL A;  3OBY A;  3CAM A;  1EZZ B;  3MXN B;  1HQM C;  2EYF A;  5IHN A;  5JJI A;  4JZ3 A;  2HDL A;  4O1N A;  1RJT A;  2KHI A;  3FKI H;  2YDL A;  1V1P B;  4OO1 H;  4XK8 E;  3KF6 B;  5D65 A;  4A3L G;  2ICI A;  4HIK A;  2ES2 A;  2RHX A;  2DPP B;  2FXQ A;  3G4S Q;  4CBV A;  1U9R A;  2NYS A;  2NUP B;  3URY A;  4MHE A;  1QWY A;  1E7Z A;  4RHR A;  1EQQ A;  3UT1 A;  4C3I H;  2PUO B;  2CKZ B;  4XAX B;  4DBR A;  2Z1C A;  4B6M A;  1D09 B;  4A3K G;  3E9H A;  2DL7 A;  5EC7 A;  1SMY D;  2FPF A;  2RHZ A;  4PFZ A;  1D0Z A;  1QG7 A;  5C3E B;  3MAQ A;  4JI0 L;  4GN4 B;  2B63 B;  4IOA A;  5M5Y B;  1EU3 A;  1KTK A;  1MD2 D;  4R8N A;  1F2M A;  4IFD H;  2WAC A;  3JCM e;  3LH0 A;  4OXP A;  1E0B A;  3NXW A;  4M7A C;  4OWW B;  2O01 E;  2OF1 A;  2KA7 A;  4NDX A;  4A3M G;  4OEL B;  1X69 A;  1WFQ A;  2KHS A;  4QB4 A;  1MIU A;  2WII B;  2X6G A;  4JOI A;  2CP7 A;  3HOX G;  1DM0 B;  2R92 B;  3FB9 A;  1U4R A;  5D3I B;  1I0C A;  1RAE B;  4UC4 A;  3G7Z A;  4M7D F;  2O31 A;  3P20 A;  1K73 U;  1MND A;  1Q8K A;  1T0J A;  1EZ6 A;  1N33 Q;  4OB3 B;  3I4N H;  2HKQ B;  4AYB B;  2OEO A;  2EYP A;  2KRS A;  1KXL A;  1LJO A;  3MXP A;  3OIP A;  4KHV A;  4TRD A;  1G29 1;  4XTV A;  4A3F H;  1B1Z A;  5A0L A;  1KQS A;  1NTG A;  3CXC A;  2COY A;  2D0P A;  1JOK A;  2CP2 A;  3THK A;  1UHF A;  3L9A X;  4CRI A;  1Y57 A;  3K81 C;  3FJP A;  3V96 A;  3M5A A;  2L5T A;  4TQU S;  2XHC A;  3M4P A;  3VYU A;  2O5I C;  4OEM B;  2JYO A;  5HGQ A;  4BY1 G;  1EYG A;  4PFO A;  2NVY B;  3JCM b;  2NVX H;  1I3Q B;  3PO2 B;  2JMA A;  3OYC A;  2JNG A;  1BVS A;  1G3T A;  2R7F A;  5J39 A;  3V05 A;  2R93 G;  3C46 A;  4KY6 A;  2OQK A;  8AT1 B;  4IUV A;  2F0E A;  2J6O A;  1TWH B;  1ZX6 A;  3QXE B;  1TH7 A;  2D0O A;  4D8K A;  4DAY B;  3HFN A;  2JA5 H;  3BZC A;  1YIT Q;  3NWT A;  1ONL A;  3R2I A;  1K9A A;  4PZ7 A;  4FU6 A;  4FT2 A;  5GAO m;  1LTB D;  4A3I H;  4QY7 A;  5CO7 A;  1PYW D;  3CCQ T;  1QE6 A;  3H0G H;  2QTV A;  3HOY G;  2RM4 A;  3REA B;  4M7D B;  1LCK A;  2A69 D;  4H13 C;  5IT9 L;  1BI1 A;  1UWV A;  1HUN A;  2EYY A;  3C1E A;  5LJ5 h;  1QNK A;  1SJH D;  1YNN C;  1M9S A;  1VQ8 Q;  2LMJ A;  1EUJ A;  2CW0 D;  5IHK A;  2UXC L;  1BOS A;  2R57 A;  3S2D H;  1PVO A;  2KYM A;  5GAO p;  1PRT D;  2FYK A;  2EKO A;  2WSE E;  4IUP A;  3L2Q A;  1QVC A;  1PKT A;  5JJZ A;  1JB3 A;  5M3F G;  4DUZ L;  3HRU A;  1W3S A;  4JYA L;  4FYX B;  5FRM A;  4MTK A;  1TUC A;  4QUF A;  2VUB A;  2VZA A;  5KCH A;  3VKI A;  3MFG A;  4Y92 A;  3NWS A;  2F0Q A;  2OAW A;  4C1N I;  1LUZ A;  4EMH A;  1SG5 A;  1STY A;  2QGF B;  4X6A H;  5GAN 3;  4C8Q E;  3GTJ H;  1M1G A;  1SNC A;  3CCQ A;  3MZ5 A;  2IIM A;  1TUD A;  4KD4 A;  5IOD A;  1RAC B;  1VYT A;  4ME3 A;  1EWI A;  1QP3 A;  3DLL A;  2ALY B;  1IBK Q;  3HOU B;  1Y14 B;  3ULP A;  1OOT A;  1CK1 A;  4XU2 A;  4L6T B;  3PTA A;  3CC7 T;  4XTW A;  2AHJ B;  1YHQ T;  3CPW A;  5KRU A;  3GV6 A;  2DJQ A;  4B3T L;  3X26 B;  3FDT A;  4C3H B;  3CMA T;  2KCC A;  5D14 A;  3M3Y H;  2KOL A;  5IXB A;  1ZXT A;  2PMZ B;  5BR8 Q;  3QWY A;  2C35 B;  1K8A R;  2OTJ Q;  1JXM A;  4RTX A;  2KT1 A;  1C8C A;  1VYU A;  4XTX A;  1NR2 A;  1PHT A;  1MJC A;  4DPG A;  1IRE B;  2R58 A;  1NLO C;  2XKO C;  3PUX A;  4CDF C;  2QQS A;  2JK8 A;  2EYO A;  3N6R A;  5IP9 G;  3BYY B;  4FCY A;  1KIK A;  1Y8P B;  2I2L A;  3RLF A;  2L55 A;  1PWT A;  4KKS A;  1GHK A;  3LNN A;  2DNE A;  5GAG C;  2K2M A;  3GTM B;  1X01 A;  1ZSG A;  4RG2 A;  3VYR A;  2HCC A;  1UEC A;  1A3T A;  4B08 A;  2FPE A;  4OP0 A;  3CC7 A;  3OYY A;  4J9G A;  1E6H A;  2R7Z B;  1YHQ A;  1M1K C;  4M75 G;  1CZW A;  5I9P A;  1ASZ A;  1QB5 D;  3A5Z B;  3CCV T;  2M51 A;  2RI5 A;  4OMN A;  3FC3 A;  1IXR A;  3I72 A;  1BF4 A;  2K5I A;  2KUM A;  3CKI B;  4GKK L;  5EKL A;  3MP1 A;  1KLG D;  4A3G B;  2FFK B;  3KF8 B;  1JQY D;  2AKK A;  8ATC B;  3L2W A;  3DHQ A;  1R0C B;  1QKX A;  3MFY A;  3OY9 A;  2E3I A;  1YHA A;  3M4O H;  4RCC A;  4DK3 C;  1X43 A;  4OGQ C;  3H3V C;  1BU1 A;  1B3Q A;  2QDY B;  1U8R A;  1BXT A;  4GN5 A;  4AYB E;  1Y1W H;  1G3W A;  3RDV A;  4L5Q A;  1VMC A;  2ZT9 C;  3FHW A;  2A3L A;  1HSQ A;  3M85 A;  5IT9 E;  3VRY A;  2ENB A;  2NWG A;  2B2V A;  2OX7 A;  3HRT A;  2EJF A;  4EQP A;  3OS5 A;  3A8G B;  1WTQ A;  4PJO G;  2EIF A;  5KYL A;  1H3Z A;  3CCV A;  4BBR H;  1WHK A;  3C95 A;  4R55 A;  4IIM A;  3EQL C;  4WRD A;  3DLM A;  1SSH A;  1X6G A;  4FL6 A;  4QL5 A;  2N78 A;  2A73 B;  1STB A;  5JOB A;  4X3K A;  3PMT A;  2N3S A;  1VQ6 A;  3OOC A;  2EE1 A;  2ZJR A;  1X6B A;  5I2Y A;  4XTY A;  1HZB A;  2YUO A;  2EYW A;  1PXU A;  1UEB A;  1NYG A;  2UUB Q;  2DXT A;  2F5T X;  3D4W A;  3CMA Q;  4ZCK A;  2GA4 B;  3IKJ A;  4MZT A;  1K76 A;  1TTH B;  4HCC A;  4RGM A;  4RCB A;  5EKI A;  5JEA G;  2CSQ A;  4S3S A;  2RF0 A;  3IQL A;  2B29 A;  5GAH C;  2RI2 A;  4J9C A;  1A2U A;  4AIM A;  3M0S A;  3B6Y A;  2EXZ A;  1SHG A;  3IFT A;  5AJ3 L;  1JO8 A;  4TKO B;  2L0A A;  3I4O A;  3UE0 A;  1JWS D;  2L3Q A;  1BCP D;  4C8Q C;  3G1J A;  3E0J A;  2DJZ A;  4M7D E;  2DM1 A;  1CSP A;  1G2B A;  2Z8L A;  1CKN B;  2HMA A;  1KQS S;  1KQ2 A;  1WJR A;  3FRN A;  3CXC S;  4BDZ A;  2MOX A;  1Q86 R;  2UUC Q;  3CCV Q;  1A2T A;  1X9N A;  2A8V A;  1WHH A;  3M58 A;  1B50 A;  4LF5 L;  1FL0 A;  2VXF A;  5CR3 A;  3NEM A;  3TZU A;  4IUT A;  5CKB A;  2GN5 A;  2JEA I;  2RD1 A;  3UDC A;  1D8L A;  1N33 L;  2K1B A;  2H8H A;  1QP2 A;  1UFF A;  3CPF A;  3JCM d;  4LFB Q;  1J9O A;  3F2U A;  4DR5 Q;  1LTT D;  1CZG A;  1K8A C;  3PT9 A;  1Q82 R;  4OGC A;  3AU7 A;  4AFS C;  1PC0 A;  4RWS C;  1WD0 A;  4QMG A;  2F1M A;  2RQX A;  2QDL A;  3MCA B;  1RF2 D;  1NJI R;  1G2T A;  5IGC A;  2QQA A;  1F2Z A;  4WJ4 A;  1JJG A;  1E1T A;  2XID A;  2N8N A;  3S2H H;  4R0K A;  1PLF A;  4HCZ A;  3T9N A;  5IGB A;  5CR2 A;  3DEO A;  1K8M A;  4A3B G;  4HT9 A;  4FF2 A;  4DK0 A;  2F1L A;  4GNX A;  3CCS Q;  3AMU A;  2CFM A;  4A4F A;  2PTK A;  5C44 H;  3H94 A;  2EYZ A;  4GN3 B;  4XU3 A;  4ZAI A;  4DK6 C;  4DR4 Q;  2PMZ E;  2EQK A;  4K8J A;  3MEU A;  3QZ5 B;  4JW0 A;  4M4Z A;  3JB9 D;  3I73 A;  4P2C B;  3SXH A;  5JPM C;  4HJ7 A;  2VQE L;  3S1N B;  1H95 A;  3H15 A;  2GQV A;  2P5Z X;  1KRS A;  2K28 A;  3PSI A;  4BA2 I;  1PMR A;  3ZFJ A;  3PCO B;  3RIR A;  1SHF A;  2IT1 A;  4JDS A;  1JOO A;  3QKJ A;  1XXG A;  4IFD J;  1WYX A;  3MEA A;  4M7A G;  2VQF Q;  2EVR A;  4XDX A;  2C9O A;  3GTO H;  2DFU A;  5M5X H;  1KAW A;  4C92 D;  1A3V A;  1Q90 A;  3PUZ A;  4ZTF A;  1TSF A;  5LMN Q;  4LNQ A;  4RTW A;  4I7A A;  1JOR A;  1XMQ Q;  1VQP Q;  4Y7N H;  5EG2 A;  4LWC A;  1T3L A;  2HQE A;  2KDS A;  3GDE A;  3KLR A;  3UPU A;  5J22 A;  4XTU A;  1FXX A;  1PDQ A;  2X4W A;  4X65 Q;  1WJJ A;  4ZKC B;  1F1B B;  3FMC A;  1ZUY A;  3S3M A;  5ELO A;  2P0P A;  1A15 A;  1TT2 A;  3MET A;  2X6L A;  3CPW S;  1IRX A;  5GAN h;  1IYJ B;  2KGT A;  3OB9 A;  4A3D B;  4IZ8 A;  4FDB A;  5FO8 B;  2X4J A;  2E12 A;  2XDP A;  4E7H A;  1LT4 D;  4HT8 A;  3EJI A;  2H4O A;  1C0M A;  4TVA B;  3U9S A;  3DUZ A;  5GMK l;  2FG0 A;  4FYV B;  3TSW A;  3JCM g;  4CC4 B;  1VOM A;  4F16 A;  1OXT A;  3PIO 3;  1QMC A;  1IBK L;  2AT1 B;  2FB7 A;  1KD1 U;  1TXY A;  1N34 L;  4M78 D;  1D1A A;  1BUV T;  2GTJ A;  1NBW A;  2KQW A;  1A6X A;  4RGN A;  3QSU A;  1Y8N B;  1H9J A;  4CHT B;  1PFS A;  1GM5 A;  3RLN A;  4RAU C;  2D8J A;  1J8I A;  1ZSZ B;  4IJH A;  4NB3 A;  3K7U C;  2GNC A;  2QAZ A;  1WVL A;  2V1Q A;  5KYN A;  4A93 B;  3EGD B;  5ELN A;  4HVW A;  4GLK A;  3GO5 A;  1RUW A;  4XTC S;  4OIJ A;  1CA6 A;  1UJY A;  1PH9 A;  1UG1 A;  5C4J B;  2YUQ A;  4JI4 L;  3MHX A;  2VNU D;  3HP9 A;  1VIE A;  1BIB A;  1Z6H A;  3HHT B;  2EOT A;  1BCP F;  2EDG A;  3DMU A;  4JI8 L;  4V0B A;  4LF5 Q;  4GLV B;  5KIX A;  3HOY H;  4N8X 1;  2L4N A;  5I2S A;  3MJX A;  1SMX A;  3S9W A;  3HKZ B;  2PU9 B;  4NPS A;  2RHQ B;  1Q82 C;  2R61 A;  3ULL A;  1X75 C;  4BI8 B;  2CDT A;  2XGT A;  2M0Y A;  2DTH A;  2WV6 D;  5LJ3 h;  1GCQ C;  1TS9 A;  3JB9 I;  1NJI C;  1D1K A;  4J83 A;  1X65 A;  3I90 A;  4KJN A;  5EJW A;  2CQA A;  3URG A;  3NEL A;  1G6P A;  3GTQ B;  1G3Y A;  4ATO A;  4J1M A;  2CZ0 B;  4J7F A;  4JI3 Q;  2AUK A;  3U4V A;  2DVJ A;  5TSS A;  1PKS A;  1R4Q B;  3CQZ B;  1VQN Q;  2A68 D;  2QW7 A;  4P75 A;  2RSN A;  4H02 A;  1WGS A;  3G71 T;  2M9V A;  4K11 A;  2JS0 A;  4DV6 L;  3A8M B;  2DKG A;  3EVQ A;  4L59 A;  2AIR B;  1MUZ A;  3BY7 A;  1QQJ A;  2DL4 A;  2F69 A;  5EBD A;  4BBS H;  1XNR Q;  2Q2U A;  1CM9 A;  1O9S A;  2MHV A;  5ECA A;  1VQE A;  4PMW A;  1ROD A;  2YUN A;  4TVR A;  4DEY A;  3S24 A;  1VQ4 Q;  3U50 C;  5M3M H;  5IWA Q;  3V8K A;  1XJV A;  2HL3 A;  1WX6 A;  1VQI A;  1UB4 A;  3HOW H;  1TVX A;  1EIF A;  2QG9 B;  4ME5 A;  1TII D;  4LUO A;  3DB3 A;  5CV7 A;  4GOP B;  1BCP B;  4M77 D;  1M5Q 1;  1G3S A;  2E70 A;  3MXU A;  1Q95 G;  4BE1 A;  1S5D D;  4FXG C;  1IL2 A;  3CCU T;  3GTK B;  3A8O B;  4F7U A;  2VGN A;  2V26 A;  2EQM A;  1AWJ A;  1WXT A;  3G71 A;  2HCI A;  3K0X A;  1B34 A;  1UTI A;  3JC6 6;  1YWP A;  3OA6 A;  4GBQ A;  3JCM X;  1E3P A;  2WKD A;  3CW2 C;  3DM3 A;  3LGJ A;  3SGI A;  1FR3 A;  3EG1 A;  4C2M B;  2RSO A;  4B3M Q;  4DV7 Q;  2FEI A;  1YCS B;  5CV9 A;  4U67 3;  2BA0 A;  1NYF A;  4II1 A;  3CQT A;  4C92 F;  4DXF A;  1XPU A;  3FP9 A;  3S1M B;  2Q8R E;  4PZ8 A;  5CV5 A;  1DOK A;  1IHZ A;  4M75 E;  4BE0 A;  1VQ5 Q;  3ERS X;  4DV0 Q;  3I9Q A;  1HZ9 A;  2VB2 X;  3PVQ A;  4J9F A;  3J81 c;  4A63 B;  2BZ8 A;  1M4Z A;  4FIB A;  2K3Y A;  2L89 A;  1X32 A;  5CV8 A;  1QCF A;  2DL3 A;  3CME Q;  2H1E A;  3MHB A;  5CGK A;  1GVP A;  2JA6 G;  2JTM A;  3CCU A;  1Y7X A;  1W1F A;  1DYQ A;  2SNS A;  3HOV B;  5KNB A;  2F2W A;  2DX1 A;  2DXB A;  1B8A A;  1Y07 A;  1I50 B;  1VF5 C;  2MO0 A;  4QW2 A;  1SMY C;  2M0O A;  4LN2 A;  4PKC C;  3RZD B;  2CT3 A;  5GAN 2;  2KVM A;  2WAQ G;  3S14 B;  3EG0 A;  4XQ3 A;  2A19 A;  2BOS A;  2YT6 A;  4YCU A;  4HJA A;  1QW1 A;  1QCN A;  2CP0 A;  3EBE A;  5LMN W;  1SEB D;  3SWN A;  4M78 F;  5KYW A;  1G51 A;  2I5L X;  1K3R A;  2VUM B;  4POF A;  5GAE C;  3AB9 A;  3MXG A;  2HCK A;  1HA5 A;  3OYM A;  3EIV A;  1RTN A;  2E41 A;  2RPN A;  3ASK A;  3OYE A;  5IYC G;  3H8Z A;  2KXC A;  5FLM H;  3K59 A;  2DIG A;  4JRK A;  5I21 A;  2F0O A;  3H0I A;  3CC2 T;  3EG2 A;  1MGS A;  3EN2 A;  2PNI A;  1IBL L;  4X64 Q;  5D7U A;  2K14 A;  4QVZ A;  4C92 B;  1AZE A;  1GO3 E;  3L2R A;  1MMN A;  3QHS A;  1F2L A;  4CDC C;  3TS2 A;  1O7Y A;  2F52 A;  3D0F A;  5KGU A;  4Q5V A;  4XXE A;  3EGX B;  1V1C A;  4N4H A;  1WHG A;  3CCU Q;  1RHP A;  1TOV A;  1W4S A;  3EA6 A;  2HQX A;  2GTO A;  4Y52 H;  1ABO A;  4R1J A;  1PSF A;  1UE7 A;  3SHW A;  5KYX A;  3M4Y A;  2CWA A;  1JJ2 P;  1ENF A;  2UUA L;  2Z9H A;  2RI3 A;  4C8Q G;  2YU9 B;  3NPP A;  1JE4 A;  2IY5 B;  2VQF L;  3HKZ E;  2ZXR A;  2LTO A;  1HNZ Q;  2CS7 A;  2OJ2 A;  1I6H B;  3CC2 A;  5ISR A;  3KFU A;  3JCM Q;  1PH3 A;  3P1H A;  3NQT A;  4GS3 A;  1KHI A;  2F0S A;  1XMQ L;  2W0Z A;  1JE5 A;  1DJ7 B;  4A3C G;  3CRK C;  4JI5 L;  1AWX A;  3KJO A;  5E4X A;  1I5O B;  1L0W A;  4QGU A;  2FL7 A;  4ZUI A;  4IPH A;  1NPR A;  1YIJ Q;  3RES A;  3TN2 A;  4M78 B;  3NBI A;  1FJG Q;  2HQL A;  2C0T A;  4DV5 Q;  4X65 L;  2VXE A;  3U4Z A;  2X35 A;  4KUD K;  2YLB A;  4NXN L;  3M0Q A;  5FU6 B;  4E7K A;  3NE5 B;  4A4K A;  4JRP A;  2EJ9 A;  3S3O A;  1RAH B;  4XU1 A;  2A69 C;  4KV6 A;  2YTY A;  1SKU B;  2VB6 A;  1BO0 A;  1OXU A;  1SRM A;  3M53 A;  5C6S A;  5LL6 X;  1NG2 A;  1X6O A;  3VU3 C;  2QKI C;  2CW0 C;  1S40 A;  1UAP A;  1ESR A;  1YJN T;  1TY2 A;  4HVV A;  1DOM A;  4HSP A;  1I6V C;  1PRT C;  1ZBX A;  2GFA A;  1WHM A;  2M00 A;  2XIC A;  1LTA D;  3C94 A;  3MEW A;  5NUC A;  5I6Y A;  3FKI B;  4HKE A;  1JR0 D;  4DOW A;  2B63 G;  2FZG B;  3EG9 A;  3S15 H;  1E2W A;  1ZA2 B;  1V1Q A;  1D2B A;  2MP1 A;  2RJF A;  5GMK i;  3K8A A;  1Y8O B;  2K5N A;  1EEF D;  1NMF A;  2K5Q A;  2QYZ A;  4ZYS A;  3X3M A;  3RKY A;  4QKU A;  2DZ9 A;  3CC2 Q;  3I4M H;  1UJ0 A;  4C3I B;  2DUD A;  4EGV A;  1YFN A;  2AQ1 B;  2R92 G;  2A28 A;  1D3B B;  4LD9 K;  1VCI A;  1V1O A;  1J5E Q;  3BDC A;  1BCM A;  4RKU E;  2O88 A;  4ZK9 B;  3G6E T;  1STA A;  4OIK A;  4OB0 B;  1YJN A;  1Y96 A;  5KCO A;  4AYB G;  1JXO A;  1S72 T;  4M7D A;  5HCK A;  3H9N A;  2FMC A;  3K58 A;  1U4M A;  2J6F A;  3KDF B;  1K83 H;  4X34 A;  3JB9 H;  5LJ5 f;  2QCP X;  4OL7 A;  3QII A;  1CQF A;  2DA9 A;  3UA7 A;  3CCM Q;  4O0A A;  1OZ2 A;  1WTP A;  4LF8 L;  2YV5 A;  4GKJ L;  2GBQ A;  2FHD A;  2ZPE B;  1AZP A;  1M2O A;  2E2J H;  2HQH A;  2O4X A;  4WF2 A;  1AWO A;  1X54 A;  2M16 A;  2BE5 D;  1G8Z D;  4QT7 A;  2KHJ A;  1XYI A;  1C4Q A;  4L5G A;  1H8K A;  3A8I E;  2RDG A;  4H44 C;  1RTO A;  1B53 A;  3T1Y L;  3LYI A;  1I94 L;  2OWO A;  3I4N B;  3PO2 G;  4QQB X;  5JJK A;  1B7Y B;  2M02 A;  2L5Q A;  1B70 B;  2J6K A;  2G3R A;  3G48 A;  3G6E A;  1ENC A;  4A3F B;  2Z0W A;  4M77 B;  1JMC A;  2IHF A;  2L0C A;  2KXD A;  1NBE B;  1ZSZ C;  1S72 A;  3I91 A;  1XMO L;  1YZ6 A;  4NL3 A;  2JJQ A;  1IBM Q;  3CC4 Q;  1S5B D;  2CH4 A;  1XNR L;  2RQR A;  4OX9 L;  1MMG A;  3JCM f;  2F0L A;  1VMP A;  2MJ8 A;  1EY7 A;  5IAY A;  3ZYY X;  2BZY A;  2E74 C;  2NVX B;  2EYH A;  3A98 A;  2CWP A;  1B07 A;  1HNX Q;  4MZM A;  5IP7 H;  3NGP A;  1YNX A;  4KKT A;  1RI0 A;  3GV3 A;  1Q1E A;  1AEY A;  5FW9 A;  2F5K A;  4M7D G;  5ELE A;  4YCV A;  1EOV A;  2A6E D;  2RJE A;  3P75 A;  5FU7 C;  4JJN K;  3RN5 A;  3M4G A;  1SFO H;  3DXJ C;  2JA8 H;  4C92 E;  1PH2 A;  1GXI E;  4KRT A;  2JA5 B;  2DD4 A;  4IN3 A;  1WQW A;  2LP5 A;  2QEX Q;  1YJ9 T;  1GUS A;  3U9O A;  4IUU A;  1H9M A;  4UDU C;  4PNY A;  3QYG B;  2PUK B;  4A3I B;  2DXC A;  4EIK A;  1WDX A;  1WCM H;  5KND A;  1VQ9 T;  2UU9 L;  2RCF A;  1WJQ A;  3H0G B;  2K5H A;  4A3J H;  1UE9 A;  2FIN B;  4MZ9 A;  2SDF A;  1K28 A;  3MEV A;  3OYK A;  2EZV A;  4RUG A;  1AWW A;  1A0N B;  3PV0 A;  1TWF H;  4XU0 A;  4LF7 L;  1KG1 A;  1ZUK A;  2ZPF B;  5IHI A;  2JA9 A;  1ZHI A;  3MP6 A;  4EMK B;  1EIH A;  1AT1 B;  2XG8 D;  3HSB A;  1LLR D;  4YY3 Q;  1L1O A;  2MGS A;  3OYA A;  1AOJ A;  1VQL Q;  4RCN A;  3RUZ A;  3PF5 A;  1F9R A;  5LJ5 e;  3GF5 A;  2XRQ D;  4DV2 L;  2QXF A;  1YJ9 A;  2E6N A;  1O7L A;  1YJW Q;  4IAL A;  2MQH A;  3ZEH A;  3TZD A;  3F2B A;  2RO0 A;  2JA7 H;  4C3H G;  1UDL A;  1OQK A;  1PM3 A;  3CCR Q;  4K6D A;  1T0H A;  1M3C A;  1KHC A;  2KED A;  1VQ9 A;  3BJU A;  1C48 A;  3GTJ B;  3A8L B;  4C5H A;  1BCP C;  4UP7 A;  4DUY Q;  4GOP C;  3JCM W;  1Q12 A;  4LNP A;  2G9D A;  4LDU A;  1BBU A;  3GBQ A;  2A5H A;  3R93 A;  3HEJ A;  4ZGJ B;  2BH8 A;  1PHJ A;  4KH1 B;  1OZ3 A;  5K5P A;  4G4K A;  1N32 Q;  3FRP B;  1HR0 Q;  3JRZ A;  2B2U C;  4OMF B;  5DM6 3;  4R9W A;  2YRV A;  1FMV A;  3UDI A;  3OYG A;  3M3Y B;  2R7Z G;  1YWO A;  2Z6K C;  1AP0 A;  1QJO A;  4DBF A;  1I4G A;  4X66 Q;  2JXB A;  2ESW A;  1PD1 A;  2GQI A;  1GXD C;  4HIO A;  1AD5 A;  1ENA A;  1CT1 D;  2L12 A;  4PG3 A;  1XTC D;  3X3N A;  3NBH A;  5GAO l;  4A3G G;  3UDX A;  4ORZ A;  4QQD A;  3VYH B;  2ZAE A;  1VQK T;  5L37 A;  2I5H A;  1AVZ C;  2CZ1 B;  2X51 A;  3CU7 A;  3U23 A;  1LTI D;  4H0L C;  5BN3 A;  2F0I A;  4DR2 L;  1CKA A;  1M1K R;  2EBP A;  3STB D;  3AYH B;  3HOZ H;  3WVE B;  4RTY A;  1M1K U;  2D0Q B;  4WFN 3;  4P71 A;  4LF9 Q;  1NE8 A;  5D6Y A;  3J7Y W;  2NN6 G;  2JA6 H;  4HN7 A;  2XTI A;  1S3O A;  5KYU B;  2FMM A;  2RHY A;  3PO3 H;  4B3R L;  3PUY A;  3UDF A;  1HUM A;  3RN2 A;  4LF6 L;  1H92 A;  4P74 A;  5GMK h;  1AFP A;  1Y1V H;  4LF4 Q;  3J7A V;  1BKB A;  3TP6 A;  1Y71 A;  3M4O B;  1JQQ A;  2K04 A;  5KYY A;  4DV5 L;  1FJG L;  2X69 A;  1W6X A;  2BIV A;  1VQK A;  1Y1W B;  2WAQ E;  4IJL A;  3OWF A;  1AW7 A;  4A53 A;  3VS3 A;  1PYS B;  1K1Z A;  1PRM C;  4DEX A;  2ZTE A;  1STE A;  2B2T C;  2D9T A;  1EY8 A;  4CC2 A;  2G9H D;  4HTH A;  1KSW A;  4MNO A;  1GOZ A;  4C92 C;  2PVG B;  2PO4 A;  1ZUU A;  2ICE C;  4CKC A;  3J81 i;  1GBQ A;  4KUI A;  1U0L A;  1JCK B;  4BBR B;  4AQY L;  4YIJ A;  4IKF A;  3F70 A;  1ML0 D;  4OON A;  3ZJY C;  3SK5 A;  1HK9 A;  1NSN S;  3TCJ A;  1XPO A;  2CYZ B;  4PNO A;  2VB3 X;  1WTW A;  3QR8 A;  1SSO A;  2F0D A;  2VGM A;  1W70 A;  1NMG A;  4FP5 D;  1IYV A;  4PK4 A;  5CIU A;  3BZK A;  4E7S A;  3E0E A;  4L5T A;  5DM7 3;  5LL6 S;  1KQ1 A;  2XSC A;  2JSO A;  3UWN A;  1WPY A;  5GJV B;  1RLQ C;  4L5R C;  3VS0 A;  2PQW A;  2LJ1 A;  3RMH A;  4C0F A;  4CKE A;  1MV3 A;  1JU5 C;  1ZA1 B;  1EIG A;  4JG2 A;  5I9O A;  4M75 A;  1J5E L;  2EJM A;  3ERO A;  4M78 C;  3VYT A;  3I55 T;  2GGR A;  2RKS A;  4DNT B;  3NTK A;  5CKH A;  3ULR B;  2QA4 T;  1MSH A;  1KNE A;  2ZM6 L;  2DBM A;  5FU6 C;  4JYA Q;  2AZS A;  2J06 A;  1SLJ A;  2RF4 A;  2OTL T;  3CCJ T;  2ZZD A;  2A37 A;  1SE3 A;  3VYS A;  4A3C H;  4AT1 B;  2IWH A;  1HPC A;  2K33 A;  1VQG A;  3T16 A;  4JI1 Q;  1JOQ A;  2HSP A;  4MMK A;  2VAS A;  4K0K Q;  4DF7 A;  1QNU A;  9ATC B;  3SVM A;  3RER A;  1KDC A;  2GVB A;  1BQQ T;  5FRN A;  5M9O A;  5JJL A;  1G6Z A;  3QBY A;  3PUW A;  1S4Z A;  2E5Q A;  1H9R A;  3QUI A;  4PJO A;  1MKH A;  1QOH A;  1SE2 A;  3I5S A;  3I55 A;  1K8A U;  4U68 A;  4DAP A;  5HUR A;  2QA4 A;  5I6W A;  4M1U B;  1LTR D;  2NZ1 D;  1IBM L;  1O78 A;  3P8H A;  1SR3 A;  5C6A A;  2R3Z A;  3S2H B;  2CH4 W;  2OTL A;  3CCJ A;  2PW5 A;  1GHJ A;  2DYI A;  1TWA H;  1W2B P;  3G7L A;  4PMB A;  3J81 L;  1NNX A;  2PCF B;  4CJ1 B;  2A68 C;  2ZPH B;  5C44 B;  3OYF A;  1H3H A;  2K9G A;  1QUQ A;  1S5E D;  4DOV A;  1T9H A;  5IGE A;  3CCQ Q;  1PD0 A;  3MWY W;  1YBY A;  2P0Q A;  3K0Y A;  1EQR A;  1HZC A;  1RAG B;  2KJX A;  1RKN A;  3J80 c;  4A4E A;  2YTV A;  1X3E A;  3T56 B;  2JJ9 A;  2NUT A;  1VQ6 T;  3KBX A;  2YWW A;  2XU8 A;  4DR3 L;  3IFD A;  4FM4 B;  3A8J E;  2BDO A;  4IPG A;  4BAC A;  1HR0 W;  4XYO A;  3HG9 A;  3KXT A;  1LOJ A;  1WJS A;  4ZQ3 A;  1TXQ A;  1YCY A;  1VQC A;  2RB6 A;  1R8O B;  1VQJ A;  2KBN A;  3HS0 C;  1JB0 E;  4A3D G;  3GTO B;  2MK5 A;  4A3E H;  3AHU A;  5M5X B;  4M77 C;  3JB9 J;  3AFQ A;  3I55 Q;  1I1J A;  5LJ3 f;  5IYD H;  3ZL7 C;  2EY6 A;  4EX5 A;  4Y7N B;  4BD3 A;  4NS5 A;  2F0U A;  1UGS B;  1WFW A;  4LFC Q;  5C4X G;  3K5M A;  5HGT A;  3W3A A;  3WXM B;  3L2V A;  4O5V A;  4JVZ A;  2ZPI B;  5DNF A;  4DK1 A;  4BY7 H;  2GVA A;  2LMC B;  5GAO n;  3HKS A;  1NAP A;  2ID0 A;  3CC7 Q;  2FHT A;  4V19 0;  2B8G A;  1YHQ Q;  3OYN A;  4BWG B;  3PIO A;  2HL5 C;  4EQ5 A;  1OTC A;  1N9W A;  4E7L A;  3A54 A;  1SN8 A;  1T5E A;  5C4H A;  1SXT A;  1M8V A;  4A93 G;  2MI6 A;  3HFZ B;  3BFM A;  2HAX A;  2D6F A;  3E1S A;  1IB8 A;  4HR7 B;  1N5Z A;  5GAN e;  3N52 A;  2LQ8 A;  5LJ5 d;  4OMQ A;  5IGF A;  2CKK A;  4C3J H;  1KIX A;  2EPB A;  1JJ2 A;  1JC7 A;  4WTO B;  1U1S A;  3HTR A;  2MF2 A;  4GY5 A;  5LJ5 j;  1XWE A;  2XRS D;  3S1R H;  1N32 L;  5LMU Q;  1Q81 R;  1PRT F;  5DEH A;  1QIL A;  4LUD A;  3HKZ G;  1OI1 A;  3CBO A;  2F0F A;  4J6Y A;  3K5O A;  3M0T A;  2FZK B;  1M2V A;  1NEB A;  1VQO T;  1VQF A;  4DXG A;  4JI7 Q;  3GTL H;  4OGE A;  4X66 L;  4B3S Q;  4FYD A;  5L23 A;  3DKM A;  1D1I A;  5FK9 C;  1Q86 U;  4EMK C;  1H9S A;  4KMU C;  3EFR A;  1R77 A;  2UXD Q;  5FO7 B;  5K36 G;  4M7A A;  4X3S A;  4HCB A;  1VQ6 Q;  3HOY B;  1ZLM A;  1NR4 A;  1EFN A;  2RQU A;  2O2L D;  3QDR B;  4OB1 B;  3J81 E;  2V8K A;  5CVI A;  1I4P A;  5KNC A;  4PJN A;  2F0J A;  1SRO A;  2AKW B;  3T51 B;  1Q82 U;  4APV A;  4HXJ A;  1D0Y A;  2COW A;  1Q1B A;  1GUT A;  4LF9 L;  1ARK A;  3E6Z X;  1NJI U;  2YUP A;  1HQR D;  3L3O C;  5IYB G;  1PRL C;  3OW2 P;  1O7Z A;  1HNW Q;  1VQO A;  2PPB C;  2VXW A;  1BB9 A;  2CCZ A;  1J6Q A;  1K8O A;  2L8D A;  5LJ3 e;  1QVG P;  4J5Y A;  3AEV A;  2B39 A;  2ZJQ A;  2LNH B;  4BI3 A;  4A3L H;  5J3B A;  4LFA Q;  1W6K A;  2E5L Q;  1VIF A;  3RR5 A;  4LE9 A;  2LXJ A;  3D6C A;  2LT4 A;  1EYC A;  3TEE A;  2B2Y C;  2X3X D;  5FWC A;  1B4O A;  4YWL A;  4BXX G;  3NUC A;  4BBS B;  3R8B A;  1PRT B;  1HTP A;  4A3K H;  2P84 A;  2DRK A;  3M9Q A;  3CCL T;  4DV1 Q;  2I46 A;  5M3M B;  3PF4 A;  2DJF C;  1CSK A;  2NBF A;  2EYL A;  3QJY A;  5FJ8 G;  3TME A;  1XNQ Q;  4OB2 B;  1D6E C;  2L15 A;  4Y28 E;  3HOW B;  4HVU A;  1VQB A;  2SRC A;  2DD5 A;  2OI3 A;  5LJ5 g;  2HIV A;  4A3M H;  3T1H Q;  1WNL A;  4R4C A;  3I56 T;  4QIW B;  3TQY A;  3HOX H;  4DR7 Q;  4I65 A;  2N55 A;  4LXC A;  2LCS A;  5CBA E;  4JBJ A;  5DM7 R;  1IXD A;  1B3A A;  5G3L D;  4FF1 A;  1GUN A;  3RMS A;  1VF7 A;  3BYT B;  3RKW A;  4JBW A;  4OML A;  4Z8A A;  5BN4 A;  3NP8 A;  3RNU A;  2SNM A;  4X9C A;  3CCL A;  3HOV G;  5GAD C;  2F0P A;  1GUG A;  4ILW A;  3NHH A;  1HRJ A;  1X55 A;  4B9X A;  4C5I A;  3OMC A;  1B9M A;  1XQH A;  1S5C D;  2Y0S B;  3OW7 A;  5C0M A;  1D5M C;  4Z02 A;  1EWH A;  2VUM G;  1A8V A;  3I56 A;  4BY1 H;  4PZ6 A;  2K4Y A;  2DMO A;  3QDF A;  2RA2 A;  4HCS A;  3JCM c;  4HIM A;  5EPJ A;  1I4X A;  2Q8I B;  1NLP C;  4RTT A;  2K4K A;  2KCM A;  2BH2 A;  4JI1 L;  4MDW A;  2H3J A;  3LLR A;  1CKM A;  1WD1 A;  2V4D A;  2R93 H;  5IE8 A;  1Q81 C;  3LH5 A;  2WSF E;  5BR8 L;  4V2S A;  1FGU A;  4K14 A;  1MV0 B;  3L2Z A;  4G57 A;  2EVB A;  3AFP A;  3CP0 A;  4OHJ A;  1CSQ A;  4C92 G;  2M9U A;  4GLM A;  5GAM h;  1SYC A;  1IHW A;  1Z47 A;  2JZ2 A;  4JRI A;  5AYF A;  5IGD A;  1M27 C;  1WTR A;  1T5X D;  2WB1 B;  2I07 B;  2EYQ A;  3Q8D A;  3NK9 A;  3JV3 A;  3MTS A;  3QJ6 A;  3A55 A;  4ABN A;  5CC4 A;  1GJX A;  3EFO A;  2LX9 A;  4E6R A;  2E6Z A;  5KE3 A;  2BE5 C;  1QVF P;  2PVO B;  2CP6 A;  1RDP D;  3BVZ A;  5A0D A;  4KTA A;  2PZU A;  2C0O A;  3HPW A;  5FU7 B;  1ET9 A;  5GRO A;  4LMQ D;  2XDD A;  1EEI D;  4X62 Q;  4ZUJ A;  1LM0 A;  3J7A 5;  2NVT H;  2JEB I;  1ICW A;  2K32 A;  5M3F H;  4HAE A;  4O6J A;  1Q46 A;  3VR4 A;  4RG8 A;  2JOY A;  1HZA A;  4LW1 A;  5CMD A;  4AFU C;  4DFA A;  1FMW A;  2RNA A;  4AG1 C;  4M78 G;  4M8A A;  1RAF B;  1P16 A; 
#chains in the Genus database with same CATH homology
 3UAT A;  2CSI A;  1ZBJ A;  2K7A A;  3THK A;  1UHF A;  2DBK A;  1Y57 A;  2I0N A;  1UJ0 A;  2D8H A;  2K79 A;  2A28 A;  1AZG B;  1E7O A;  2K3B A;  2DL8 A;  2O88 A;  1K0S A;  1OPK A;  2JMA A;  1VA7 A;  2JMC A;  2KRM A;  1JXO A;  5HCK A;  2A36 A;  2HEQ A;  1GBR A;  3NMZ C;  2J6F A;  4OMP A;  2J6O A;  1I07 A;  1ZX6 A;  2DA9 A;  2ECZ A;  3UA7 A;  4D8K A;  2GBQ A;  1K9A A;  1AWO A;  2EGE A;  3M0R A;  4QT7 A;  1H8K A;  4Z89 A;  2O2O A;  3RBB B;  2LJ0 A;  2JT4 A;  2HDA A;  2J6K A;  3REA B;  1LCK A;  1OPL A;  2SEM A;  3H0F A;  1TG0 A;  2EYY A;  2KXD A;  2LMJ A;  1E6G A;  5IHK A;  2EYX A;  2CH4 A;  2KYM A;  2RQR A;  1PKT A;  1HD3 A;  4AFQ C;  1TUC A;  2BZY A;  1OEB A;  3A98 A;  2FRW A;  1B07 A;  4Y92 A;  3NGP A;  2OAW A;  1AEY A;  5FW9 A;  2ENM A;  2IIM A;  1TUD A;  4JJB A;  1VYT A;  4KRT A;  2EQI A;  1OOT A;  2LP5 A;  4LUE A;  4JZ4 A;  4D8D A;  2JS2 A;  5IH2 A;  2DJQ A;  4EIK A;  1WDX A;  1T3S A;  5IXB A;  3QWY A;  1UE9 A;  1M8M A;  1JXM A;  4RTX A;  5FWB A;  1X27 A;  2KT1 A;  1VYU A;  4RUG A;  1AWW A;  1PHT A;  1A0N B;  1YNZ A;  1NLO C;  1ZUK A;  5IHI A;  3I35 A;  1BK2 A;  1SEM A;  1GFC A;  1KIK A;  1AOJ A;  1PWT A;  2K2M A;  1ZSG A;  1UEC A;  2FPE A;  4J9G A;  1E6H A;  1M3B A;  2NUZ A;  1UDL A;  1T0H A;  1M3C A;  1Y0M A;  4JPB W;  2FO0 A;  2M51 A;  4OMN A;  2G6F X;  1G83 A;  1WLP B;  4ESR A;  4LNP A;  2VWF A;  1QLY A;  1FMK A;  3GBQ A;  2AKK A;  3UF4 A;  1QKX A;  3NPF A;  2KT8 A;  2BZX A;  2A08 A;  1X43 A;  1X2Q A;  1BU1 A;  1B3Q A;  2EGC A;  1YWO A;  2DL5 A;  1HSQ A;  3VRY A;  2JXB A;  2ESW A;  2GQI A;  2L3S A;  3QWX X;  1AD5 A;  4FSS A;  1QKW A;  4IIM A;  1SSH A;  1X6G A;  4ORZ A;  2DE0 X;  4J9B A;  2RQV A;  3M0U A;  5I22 A;  1AVZ C;  3U23 A;  1JEG A;  1X6B A;  2JTE A;  1CKA A;  2BTT A;  2EBP A;  1YN8 A;  2YUO A;  1WIE A;  2EYW A;  4RTY A;  1NYG A;  4IIO A;  2NWM A;  1K76 A;  1NEG A;  2CSQ A;  2RF0 A;  3IQL A;  1H92 A;  2CRE A;  2LJ3 A;  4J9C A;  3M0S A;  1UGV A;  1JQQ A;  1SHG A;  3VRZ A;  1JO8 A;  2L0A A;  1CKB A;  2O9V A;  1W6X A;  2L3Q A;  2ED1 A;  3VS3 A;  2DM1 A;  1G2B A;  1PRM C;  1K1Z A;  2LQW A;  4DEX A;  2FRY A;  4CC2 A;  2AZV A;  1UHC A;  1KSW A;  2JW4 A;  1ZUU A;  2MOX A;  1GBQ A;  2ED0 A;  3SEM A;  1BBZ A;  1FYN A;  2H8H A;  1UFF A;  3VS6 A;  1GCQ A;  1W70 A;  1GRI A;  4AFS C;  2L2P A;  3TSZ A;  3KFV A;  2QDL A;  4R0K A;  5GJV B;  1RLQ C;  1U06 A;  3VS0 A;  2LJ1 A;  1WXU A;  1MV3 A;  1JU5 C;  5IXF A;  1GFD A;  2DIL A;  2MCN A;  2GGR A;  2PTK A;  3O5Z A;  2D0N A;  3ULR B;  2EYZ A;  2DBM A;  3EGU A;  2VKN A;  2AZS A;  2J06 A;  4HCK A;  4M4Z A;  2A37 A;  2FPD A;  4ZNX A;  2F2V A;  2W10 A;  2KE9 A;  2HSP A;  2KYB A;  3VS2 A;  1QWF A;  1SHF A;  3FJ5 A;  1K0X A;  1ABQ A;  1SPK A;  3R6N A;  1WYX A;  4X1V A;  2EVR A;  2D1X A;  4JJC A;  2KBT A;  3VS7 A;  3I5S A;  2KNB B;  4RTW A;  1T3L A;  4RTZ A;  2X3W D;  2CH4 W;  3TVT A;  2KRN A;  1ZUY A;  1J3T A;  1WI7 A;  2E5K A;  3M0P A;  2KGT A;  2K9G A;  1H3H A;  3H41 A;  2LQN A;  2VVK A;  1GCP A;  2FG0 A;  2XMF A;  2YSQ A;  4J9D A;  3TSW A;  4AFZ C;  4CC4 B;  4F16 A;  1M3A A;  1VYV A;  1XOV A;  1Z9Z A;  1SRL A;  2GTJ A;  3VS1 A;  2O9S A;  2RQT A;  1WA7 A;  2DLP A;  2RMO A;  2D8J A;  2CUB A;  1RLP C;  2GNC A;  2V1Q A;  4HVW A;  1I1J A;  1RUW A;  1UJY A;  2J7I A;  3ZL7 C;  1UG1 A;  2JM9 A;  2YUQ A;  1WFW A;  1WXB A;  1S1N A;  1KJW A;  2ROT A;  1IO6 A;  2AK5 A;  2EKH A;  2CDT A;  2J05 A;  2M0Y A;  1GCQ C;  2LX7 A;  1N5Z A;  2P4R A;  3VS4 A;  4OMQ A;  2DVJ A;  3RNJ A;  1PKS A;  2DF6 A;  4JJD A;  4F14 A;  1U5S A;  3UA6 A;  3EHQ A;  4K11 A;  5GJW B;  4LUD A;  2JS0 A;  4RTV A;  2ROL A;  3M0T A;  1NEB A;  1MUZ A;  2DL4 A;  2L3P A;  2DNU A;  1Z9Q A;  5L23 A;  5ECA A;  2YUN A;  4DEY A;  3NHN A;  2C0I A;  1WX6 A;  2CUD A;  2AKL A;  1U3O A;  1ZLM A;  2JM8 A;  1EFN A;  2KEA A;  1QWE A;  2B86 A;  2RQU A;  2K6D A;  2DYB A;  2ABL A;  1YP5 A;  4J9H A;  4HXJ A;  1UUE A;  1AWJ A;  1WXT A;  1UTI A;  3I5R A;  1YWP A;  2EGA A;  4GBQ A;  1ARK A;  2YUP A;  3EHR A;  1PRL C;  2DRM A;  3EG1 A;  1BB9 A;  2PZ1 A;  2FEI A;  1YCS B;  1NM7 A;  1NYF A;  3CQT A;  2LNH B;  4WCI A;  2CT4 A;  4Z88 A;  3I9Q A;  4LE9 A;  3PVQ A;  4J9F A;  4A63 B;  2BZ8 A;  2X3X D;  5FWC A;  1QCF A;  2F2X A;  2DL3 A;  2DRK A;  2LZ6 B;  2RQW A;  1OV3 A;  1W1F A;  1CSK A;  2DX1 A;  1X2K A;  2EPD A;  2F2W A;  1M30 A;  4LN2 A;  1KFZ A;  4HVU A;  4OMM A;  2CT3 A;  2KRO A;  2SRC A;  3VS5 A;  2OI3 A;  2RN8 A;  3EG0 A;  2YT6 A;  2LCS A;  4AG2 C;  2HCK A;  5I11 A;  1HJD A;  3PE0 A;  2V1R A;  2KR3 A;  2RPN A;  2KXC A;  4OML A;  4Z8A A;  3EG3 A;  3C0C A;  4F17 A;  1K4U S;  3H0I A;  3EG2 A;  2PNI A;  2EW3 A;  2MIO A;  1AZE A;  3REB B;  2DMO A;  1V1C A;  5IHN A;  4JZ3 A;  1NLP C;  4RTT A;  2GTO A;  4CC3 A;  4RTU A;  1ABO A;  2YDL A;  2HBW A;  3SHW A;  3LH5 A;  1MV0 B;  2OJ2 A;  4OMO A;  3H0H A;  4GLM A;  1M27 C;  2W0Z A;  1AWX A;  3JV3 A;  3PVL A;  2DL7 A;  5EC7 A;  2FPF A;  1GL5 A;  4E6R A;  2C0T A;  2C0O A;  3M0Q A;  4J9E A;  4CC7 A;  1SRM A;  1X69 A;  1NG2 A;  4J9I A;  1I0C A;  1PNJ A;  4HVV A;  2O31 A;  1T0J A;  4AFU C;  2RNA A;  4AG1 C;  1RI9 A;  2KRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...