4JPBW

The structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
140
Chain Sequence
LKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Chemotaxis protein CheA
publication title The 3.2 angstrom resolution structure of a receptor: CheA:CheW signaling complex defines overlapping binding sites and key residue interactions within bacterial chemosensory arrays.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 28
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jpbW01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 4jpbW02
1RLPC 2A37A 2ESWA 1WYXA 4OMPA 2M0YA 2K9GA 1T0JA 4CC7A 2J6OA 4CC2A 2FPDA 3UA6A 2JS2A 4J9BA 2SRCA 1UG1A 1B07A 3M0SA 4Z88A 2VVKA 3VS6A 1HJDA 2K3BA 3EG2A 2G6FX 1OPLA 2YUQA 1VYUA 2CT4A 4KRTA 3VS1A 4LNPA 4D8DA 2KEAA 5I11A 2O88A 1W1FA 1M30A 1G2BA 3EHRA 1VA7A 2JT4A 2LP5A 1PNJA 2K79A 2KYBA 1UECA 3VRYA 1WA7A 1JEGA 2C0TA 4RTWA 1PHTA 1ARKA 3EHQA 3A98A 4EIKA 2CH4A 1WXUA 2FRYA 2F2WA 2YSQA 2J6FA 2DM1A 3NMZC 4AFQC 5IHNA 3SEMA 4J9IA 1QKXA 2FO0A 4R0KA 1TUDA 2AKLA 2H8HA 4HXJA 1W6XA 2YUOA 3C0CA 2AK5A 1AZGB 2ED0A 1GL5A 1SHGA 1CKAA 3R6NA 2LJ0A 1AZEA 2I0NA 1BU1A 1YNZA 1KJWA 2JMCA 1QLYA 1OPKA 2GGRA 2C0IA 2ROTA 5HCKA 3VS2A 2ROLA 2CSQA 1RUWA 2DL8A 1MV3A 4HVWA 1GBQA 4HCKA 5FWBA 5FWCA 4JPBW 2EBPA 1K0XA 2DA9A 4JJDA 1Z9QA 3I5SA 4RTTA 2CUBA 2PNIA 1UHFA 2K2MA 1NEBA 1SRLA 1K9AA 1ZLMA 4DEXA 2M51A 1NLPC 2BZYA 4JZ3A 1UE9A 4RUGA 2RN8A 1U5SA 3EG1A 4RTZA 4ESRA 4AFSC 1A0NB 3M0PA 4RTUA 2LCSA 2RQRA 3KFVA 2BZ8A 2DX1A 1X2QA 2MOXA 3IQLA 2CSIA 1AEYA 4OMQA 2PTKA 1ZUYA 2IIMA 2D8JA 1PKSA 5IHIA 4J9FA 2RF0A 1W70A 1YWPA 2HDAA 2RMOA 3VS5A 2D8HA 3ZL7C 1WLPB 1JU5C 4J9HA 1X69A 2CDTA 1AOJA 1WIEA 3ULRB 2XMFA 2W0ZA 2F2VA 2J05A 1UHCA 4RTXA 1ZSGA 4IIOA 1KFZA 1PRMC 3VRZA 4D8KA 2JTEA 1HD3A 1GRIA 2DRKA 2DBMA 1OV3A 1Y0MA 4LUDA 2DYBA 1FMKA 1H92A 2A08A 3REBB 1WXTA 1H8KA 4OMMA 3M0TA 1RLQC 2DRMA 1ZUKA 1BB9A 1UGVA 3RNJA 5L23A 3I9QA 1NLOC 2RNAA 3UATA 3UA7A 4WCIA 2KYMA 4JZ4A 2HEQA 4LE9A 4JJBA 4X1VA 4DEYA 2ENMA 1BBZA 1MV0B 1WXBA 5EC7A 1WFWA 3M0RA 1SSHA 2F2XA 3QWXX 2AZSA 1UJYA 1YP5A 1WI7A 2KRSA 2K7AA 3RBBB 1YWOA 1PWTA 1VYTA 1QCFA 2CREA 1VYVA 3VS3A 2EYZA 3VS0A 1ZX6A 1B3QA 2ABLA 2DJQA 4J9EA 1T0HA 2ED1A 1SPKA 2BZXA 3TSWA 2GNCA 2KRNA 3GBQA 2OAWA 1I1JA 3H41A 4J9GA 3M0QA 1BK2A 2K6DA 3I35A 2EKHA 2FPEA 1YN8A 4AFUC 2J06A 1SHFA 2KXCA 2DL4A 1M27C 5I22A 2DILA 2KROA 3NGPA 1AWXA 4ZNXA 2BTTA 1H3HA 2V1RA 1CSKA 2DE0X 2D0NA 4Z89A 2LMJA 2FG0A 1RI9A 2V1QA 3REAB 1M8MA 1WDXA 4OMOA 1JO8A 5FW9A 2J6KA 1E6HA 3TVTA 2CH4W 3M0UA 2LJ1A 2LZ6B 1GFDA 1K76A 1K4US 1GCQC 1KIKA 1KSWA 2KT1A 2FEIA 4Z8AA 2GBQA 1YCSB 1UJ0A 1N5ZA 2LX7A 2OJ2A 2L3QA 3PVQA 5GJVB 1NEGA 2CT3A 3NHNA 2J7IA 4FSSA 4RTVA 1X6BA 1JQQA 2NWMA 3LH5A 1FYNA 2LQNA 2RQTA 4HVUA 1T3LA 2KBTA 1T3SA 2MCNA 4JJCA 2JXBA 1OEBA 3CQTA 2AZVA 2GQIA 3H0IA 3I5RA 2DLPA 4F17A 2EYYA 2GTJA 2KT8A 4QT7A 4AFZC 2JM9A 1GCQA 1X43A 4K11A 2KNBB 2DBKA 1TG0A 2SEMA 2JS0A 3QWYA 2JM8A 2EGCA 1X2KA 2KXDA 2EPDA 2JW4A 1PKTA 2EGAA 2X3WD 2VWFA 1JXOA 2EGEA 3TSZA 2EW3A 3UF4A 3SHWA 2PZ1A 3H0FA 4J9CA 2DL7A 1HSQA 1K0SA 1X6GA 4RTYA 3H0HA 2QDLA 4AG2C 3THKA 2EYWA 2O9VA 5IHKA 2DNUA 1UUEA 2P4RA 2DVJA 1U06A 2YUPA 1AWOA 1U3OA 1NM7A 1TUCA 5ECAA 5IH2A 1AWWA 1JXMA 2O31A 2A36A 1M3AA 2MIOA 2DL5A 1M3CA 2RPNA 2YUNA 2A28A 2ECZA 1J3TA 5GJWB 3FJ5A 1IO6A 1WX6A 1S1NA 2O2OA 4HVVA 1NYFA 2L0AA 1PRLC 3U23A 2DL3A 3O5ZA 2OI3A 2RQVA 2B86A 2L3PA 1X27A 2FPFA 4AG1C 1Y57A 2LQWA 2RQWA 1QWEA 2C0OA 2X3XD 3VS4A 1SRMA 2DF6A 4J9DA 1ZUUA 2LNHB 1G83A 1NYGA 1GCPA 1I07A 4CC3A 3PE0A 1E6GA 1AVZC 2L2PA 2HCKA 1QKWA 2DMOA 2HSPA 5IXBA 1GFCA 4E6RA 2KGTA 2LJ3A 4Y92A 4M4ZA 1K1ZA 2YDLA 2EQIA 2YT6A 3NPFA 4IIMA 5IXFA 4ORZA 1CKBA 2KE9A 1GBRA 2KRMA 1LCKA 3JV3A 1NG2A 4LUEA 2O9SA 2VKNA 2AKKA 2GTOA 1V1CA 1MUZA 4LN2A 4OMNA 1AD5A 2JMAA 2CUDA 1AWJA 1EFNA 1ABQA 2EVRA 2RQUA 2W10A 1SEMA 4F14A 4A63B 1OOTA 3VS7A 1E7OA 1M3BA 1XOVA 4F16A 1UFFA 2D1XA 3EGUA 1I0CA 1UDLA 2E5KA 4OMLA 2HBWA 3EG3A 2FRWA 2NUZA 1ZBJA 1Z9ZA 1QWFA 1ABOA 4CC4B 1UTIA 3PVLA 2L3SA 3EG0A 2KR3A 4GBQA 4GLMA 2EYXA
chains in the Genus database with same CATH superfamily
1VQJA 4N8X1 2WACA 2MFIA 4Y91A 2B8AA 1L1OC 3FVQA 2G9HD 1EX4A 3KBXA 3M4OH 1JMCA 3R6OA 3QWNA 4RGTA 4UY8C 2K9GA 4MN3A 3OS1A 1T0JA 1VQ4T 1K9MU 2X4YA 4EX5A 4IUTA 4CC2A 3JCMX 4JI8L 2JA5B 3KJOA 1JWSD 3M3YH 3J80L 4L8JA 4JBKA 1YNXA 2SOBA 5H1SE 3EA6A 3I4LA 4XT3B 3I56T 4DR1L 4JS4A 3NWSA 3OS2A 2O2LD 1SNQA 5LJ3g 2UXCL 2RK1A 5EBDA 4YY3Q 5C44G 4J6HA 1VQNA 3X3MA 1M9SA 1VYUA 1FYCA 2YRCA 3CCEQ 4K8IA 1E2WA 3TP7A 4B3TQ 4BA2I 1HNXQ 4C0GA 4H13C 4QIWE 4KRTA 1PYWD 4BS9A 4NXMQ 2D0PA 1S72Q 2CGHA 3CKIB 4EQPA 2BUDA 2PUOB 2O88A 3RERA 3U4VA 3RESA 2K5VA 1VQ5A 2LT1A 2GVBA 4HIOA 1G2BA 4K0KQ 4RWSC 1YJ9A 4XQQA 1QVPA 2NUTB 1S5BD 2A6HC 3U9OA 3UDGA 2EFIA 3N52A 2M1HA 1EL0A 3DKMA 1BQQT 1QZGA 3X26B 4I65A 4KD4A 3T53B 1F2YA 1PHTA 3EHQA 1GUOA 2K7VA 2KHJA 4A93H 4OB2B 2KEEA 1FVIA 3NMZC 3M54A 2LFNA 5IHNA 1BXTA 4O6JA 2FO0A 4R0KA 1PDQA 1VQIA 4A3IH 4LDVA 5CCAA 2F0FA 4GN3B 2R7ZB 2E4HA 3J81j 4BXXG 5CKDA 2K4KA 3VYUA 2ED0A 4ELYC 1X9NA 2NYZD 5J39A 1CM9A 2BE5D 4HMIA 2K01A 3NBIA 3CC2Q 4M78C 1KQSS 4UPAA 3ULPA 1VMCA 5IT9L 3R6NA 5LJ5h 5IP7G 2I0NA 1BU1A 2D5DA 4FCYA 4HCEA 4QGUA 4YHHQ 2JMCA 4JI3L 4ALPA 1PYBA 3ERSX 1QLYA 1OPKA 1K3BC 4FXDA 2Q8TA 3SEBA 2ROTA 2OTJA 3HRTA 4XTCS 3E5SA 4GOPC 2LDMA 1CTMA 2GCXA 2CSQA 4FXGC 1Q86U 4A3DB 3LWUA 2XN9C 3OYBA 4DAYB 1D8LA 3CMAA 3H94A 3SB2A 1ONLA 4BB7A 1VQ6T 2WSFE 2B8GA 4DR6L 4HCKA 5FWBA 2R7FA 2RBMA 2YTXA 1TWBA 4PLLA 1E1OA 4BI8B 3I5SA 3W1GA 3META 2ZJPA 3HEJA 4ULLA 2CUBA 2NVYB 4K5XA 2COYA 3TBIB 1UHFA 2HSEB 3BYTB 4QQBX 1ZLMA 2JTMA 2VYTA 1FD7D 4DN4M 4JZ3A 4F04B 1E22A 3HZXA 4KGZB 2B63H 1Y7XA 4N4HA 4AFSC 3RR5A 1I5FA 3E0JA 3H3VH 3OS0A 1K73U 1UUPA 5AJ3L 2X4XA 3GDEA 3OYYA 3G6EA 1M90C 5D6WA 1X2QA 1AEYA 4DV1L 2CSIA 3GNGA 4CDEC 2LQ8A 4OMQA 5I21A 1CQFA 4O2DA 3JB9F 2C35B 1EY7A 2VW9A 1Y07A 2G3RA 3KDFB 3I2ZA 2RF0A 3VDYA 3JAML 3RR6A 1D1BA 3GNFB 4AMCA 4B3SQ 4ZK9B 3F2CA 2R93G 1PD0A 3Q24A 5EJWA 4CKEA 1JB7A 2F5KA 1Y14B 1QB5D 4P2CB 3EFRA 4N0AC 4E7IA 3K0YA 2XTIA 2X51A 3HRZC 3VYHB 4L5GA 3SWNC 1PH8A 1IL2A 5FU7C 2MP1A 3KYHC 2PNHA 1PXUA 4IKFA 4FXKC 3ULRB 3S1RH 2MWOA 4BY1G 2LTOA 1KABA 5GAN8 5JAVA 1SNCA 4X3TA 3M58A 3CCMT 5KYWA 1SYGA 5IYBH 2DK3A 5JJKA 2IX3A 5I2YA 5DEHA 1A0IA 3RZOH 3S2HH 1FX7A 4D8KA 1J8IA 2EVBA 1HD3A 5I6WA 1STBA 1VQ8A 3FMCA 1GHKA 4M75F 1OV3A 1Y0MA 3EGDB 1AW7A 3OYEA 4LUDA 3FEWX 4LF7Q 5E4XA 2KMTA 4JI4Q 3A5UA 3HFNA 3REBB 1WXTA 4OMMA 3H0GG 3G7ZA 2DRMA 4JUVA 1I6VC 5GADC 5IYDH 2PUKB 2B2WC 1UGVA 2L15A 1YNJD 2PZTA 4A93B 2IT1A 1G6ZA 1WGSA 5C4HA 3I9QA 2DXBA 1NLOC 3UA7A 1DYQA 2ZPIB 1TS3A 1XX8A 2WFWA 3RN5A 3PF4A 3CCVA 4A3IB 1CZGA 3A8HB 1F2ZA 3C1EA 1Q81U 1VIEA 1R9TH 1R0CB 2P4TA 3AT1B 3D7SB 1EY6A 1PZJD 2EYFA 3GTMH 5GAN6 3CXCS 1A8VA 2NTSA 4PNYA 2QEXT 1PFBA 5HY6A 1BBZA 4ZUIA 2F0VA 3PSIA 3CHBD 3HOWH 4B3TL 1KQ2A 1HNXL 3QWXX 4XTXA 5K36G 4NXML 2PI2E 2EDGA 1WI7A 2KRSA 2L89A 2K7AA 1VQPA 2JNGA 1YI2Q 1Q3LA 3D6WA 2N78A 1WTWA 5LMNQ 1DXMA 1EY8A 2WAQE 4O42A 3VS0A 1MNEA 2L55A 2XGTA 1HYOA 5GAMf 4HSVA 3EIVA 2F4VQ 5AYFA 1EFWA 2EWNA 1B3QA 4J9EA 2EPBA 4EQOA 1JJ2S 1W2BP 5J26A 4ME7A 4DFAA 4OGCA 5IYCG 4L59A 2GNCA 4M75A 2NN6G 3OSVA 3BVMA 4C1NI 3H41A 1TXQA 1IHWA 2F4IA 3U4ZA 2DEQA 4JRIA 3CCQT 1BK2A 2K03A 2B63B 3I35A 2G9DA 4IUVA 2PQAA 4KHZA 5LJ5g 1G8ZD 1MD2D 2EY5A 3S15B 2JK8A 2RHSB 4DR2Q 3K80C 2E65A 2J06A 4JC0A 4GNXC 1M27C 2HQXA 5I22A 1TS4A 3OQ5A 2KROA 1SR3A 2ZPHB 3NEMA 3WVDB 4A3GH 1Q86C 5C4XH 2V1RA 1VQ4A 1HCZA 3QKJA 1AT1B 2OT2A 3NXWA 2DE0X 2PVGB 3MFGA 1G91A 4PJMA 2LMJA 3LGJA 5KYUA 1FNWA 4LDYA 1UWVA 1JE4A 1VF5C 3I56A 3OYDA 3A56A 3RIRA 1AN8A 5LMUQ 4A3GB 4LFCQ 3S1RB 3TRZA 3OYMA 2RSNA 2VUMG 1SE3A 2K5FA 3OBWA 4JI0L 2EQMA 3A7LA 2ZPGB 2K04A 2Y4XA 1LT4D 4M7DF 4A3CH 4JI5L 1XPOA 1IKLA 1E6HA 4M78E 4KD3A 4C8QD 1NMFA 3RZOB 1M4ZA 2CH4W 4A3MH 3X24B 3S2HB 3T1YQ 5IODA 4KKTA 1NR2A 2TMPA 1NR4A 3G7LA 3UI2A 3K57A 3PO3H 1K4US 2ENBA 1U9RA 5CV5A 4TRDA 1B9MA 4L6TB 5KYIA 2Q2UA 3AEVA 3S14H 3BY7A 1CHPD 4G7HC 4M77F 4Z8AA 5IN1A 4IOAA 1GUGA 5D14A 2KENA 3TSSA 2HHHQ 2ICIA 4OB1B 1ILQA 2LCLA 1X3QA 1C1AA 1QVGA 3PVQA 5GJVB 4ZGJB 1QVFP 3I7FA 1E3PA 2F0HA 3KUPA 5HK3A 1R9TB 5IGEA 3VU3C 1EIYB 3S2DH 1VQ7T 1H9MA 3NHNA 3LWIA 2AMCB 2J7IA 1EIFA 2GFAA 4RTVA 5FU6B 1K8AR 1XTDA 3RKWA 2E3IA 1X6BA 3CCSQ 2N3SA 4G57A 2B8FA 2NWMA 4H02A 1HQMC 3SR1A 3UDFA 1RI0A 2LQNA 4LF6L 2JA7H 3HOWB 2H5XA 3A8IE 3VYGA 1STHA 2MCNA 2DFUA 2HD0A 3BDLA 4JJCA 4ZQ3A 2V8JA 3QB3A 1AH9A 1KC8C 3CQTA 4P71A 1A15A 1E2VA 2VQFQ 2H3EB 2L3RA 3OYLA 3L7ZC 2MNAA 4JI4L 4LF7L 2F69A 3A74A 4ZAIA 4YTLA 4EMKA 4X64L 2QYZA 2GTJA 4M7DA 5JEAG 2B3GA 3J81L 4DBRA 4JG2A 3CPWA 5CKHA 3MEWA 2WB1G 5CK9A 2JM9A 2X6LA 1N36Q 1GCQA 1X43A 4K11A 4A3BH 2K28A 5C3EH 2KNBB 3BE3A 1Q81C 3HOZH 1FXXA 2EIFA 3QWYA 3L1AA 4PJOD 2K5QA 4ILWA 5KCHA 2AWNA 1XNQL 3M4GA 4M7AD 1JQYD 1X2KA 1V1PB 4XU2A 1A62A 1ICWA 4A3KH 1SMXA 4GN5A 3P8BB 4OF1A 3V2TA 2IHFA 3HOUG 3TP6A 3SWNA 4M77A 2Z0WA 2NB0A 5M3FH 1MKHA 1LO5D 5BN3A 3DEOA 3SDZA 2Q8RE 1R8OB 1K83H 3NPPA 4IURA 4QL5A 3JCMQ 2EGEA 2DJGC 2EW3A 3UF4A 2PVOB 1KQSP 1LTRD 4HJ9A 3H3VI 4DAPA 2K3XA 3HOVB 5BN5A 4OO1G 2K2VA 1HSQA 3PUYA 4FIBA 3H91A 5C4XB 4C8QB 4KY7A 5KYNA 3M57A 2HKNA 2O4XA 2DKGA 1BI3A 1N8RR 2F0LA 3H0HA 2MAMA 5CV6A 1RKNA 5LMNL 3CD6T 1CZWA 1QNUA 2JA6G 5AT1B 1SN8A 2JJQA 3CCET 2X6GA 5IHKA 2F4VL 2DPPB 1A3UA 2IWHA 3LX7A 3GTOH 1UUEA 4JJNK 2IJ0A 2MUYA 3K7AH 3CCMA 2BDOA 2A1AA 2DNEA 4NPSA 2YU9H 3VA5A 2DVJA 2F0TA 1U06A 2NUTA 3R2IA 2MI6A 1AWOA 3JB9G 1FL0A 2AIRB 1OU9A 1S5CD 1NJIR 3QR8A 1RDPD 4Y52H 2B2WA 1JXMA 2ZCFB 3BDUA 1S3OA 1Q7YC 1E1TA 3LNNA 3UE1A 2MIOA 2FHDA 4A3MB 5DAUA 4DV3L 2PQEA 1MSHA 4C3HB 4CKCA 1IYUA 1VQKA 3PO3B 2YUNA 2EYOA 2ECZA 4DR2L 5D3IB 1R4PB 3BZCA 3ONAB 4PL6A 1RAIB 2A69D 2WKCA 2JN0A 2XD0A 2RB6A 3S14B 3JCMh 1NMGA 1QQJA 4HVVA 5JJLA 2CP3A 2R58A 2L8DA 2EQKA 3QXEB 3PO2G 1RTOA 1MNDA 3O5ZA 4MHEA 2OI3A 3J80E 2B86A 2X4WA 4FF1A 3I4OA 1CK1A 1X27A 1VQ6Q 2L9HA 2K32A 2QQ9A 3MXNA 4C5GA 4DPGA 3I4MH 7AT1B 3PGZA 3RZDH 4AG1C 5LMUL 3K0XA 1SE2A 1QWEA 1XTCD 1K8OA 4LFCL 4M75G 2QEXA 1PTOC 1I50H 1QCBD 4MIUA 3S2DB 1W6KA 3I91A 3G71Q 3GLXA 2JN4A 2H4OA 3EN2A 1KD1U 1XJWB 1GCPA 5J3BA 1HXYD 4BY7G 2JA7B 5G3LD 1AVZC 4LMQD 3E19A 2MGSA 3T1YL 1IRXA 3OHXC 4XQ3A 3LWEA 5IE8A 2KJXA 2DETA 4PJOB 1PYSB 1GFCA 3J7A5 1YFNA 4M7AB 1RF2D 2LJ3A 4J7FA 3K5LA 1RAAB 4NL2A 1D0ZA 4NL3A 4G4KA 3E9IA 4I7ZC 2YDLA 2RJCA 2EQIA 1ASZA 4QJFA 1IYVA 1Z9FA 2ZJRA 1O7ZA 3EFSA 4ORZA 3TREA 4GNXA 2OAUA 3MCAB 2IHEA 4DR4L 3GTJH 1BBUA 4KGXB 4L63B 3CCJQ 5KE2A 4Y28E 3CCRQ 1U4LA 1EYCA 3Q23A 1LCKA 2VZAA 1ZKOA 2ZTEA 5C3EB 4A3BB 3CCQA 3HOZB 1B53A 2VKNA 3KDFA 1GKHA 5A0GA 2IX0A 2K50A 2R92B 1B44D 1MUZA 2IPOB 3JC66 4OMNA 4A3KB 4DKAC 2CUDA 5FK9C 3HP9A 1KL9A 5FJ8G 1XNIA 4KUDK 5M3FB 1W4SA 4RG8A 4QW2A 1F2MA 1K83B 2ALYB 2L1BA 3CXCP 1N34Q 3TP5A 1Q82U 2LQKA 5GMKi 5IP9G 4ZUJA 1E7OA 3JCMP 3I70A 4PG3A 1AEXA 4OB3B 2LX9A 3CP0A 2EYJA 1IBMQ 2M9UA 1I0CA 4NXNQ 3IFDA 1X6OA 2HBWA 3H09A 4LF4L 2D0OA 2NUZA 4JYAL 1W3SA 3GTOB 1QWFA 1ABOA 3ZFJA 4CC4B 4F88A 2NTTA 1XJVA 1UGSB 1QWYA 4QY7A 1N36L 1PRTC 2YU9B 3EG0A 2I07B 3W2DA 2K52A 3DWAA 4G7ZC 2LNVA 4GLMA 3BFMA 1XMOL 3PMFA 4JVZA 5T1GA 1RLPC 1JJ2P 2ESWA 1KRTA 1WYXA 2K1BA 3PMTA 1WVLA 1G3WA 3E1SA 1VUBA 2RI2A 2EOTA 5C3WA 1OULA 3PIP3 2M0YA 3GIBA 4A3FH 4EGVA 4R4TA 4CC7A 1EWCA 4IPGA 3MHBA 2KAFA 2UUCL 3CW2C 3FDTA 1MGSA 4IN3A 1V9PA 3JAME 2VY3A 3T1HQ 3QG1A 2JS2A 1YJWA 2ZT9C 4AQYQ 4QVCA 1UE6A 2HIXA 3FPUB 3S1NH 2MK5A 3M4QA 3KK7A 4M7DG 5LJ3h 1HJDA 1JOOA 2OWOA 2K3BA 2RI5A 4F87A 3K7UC 3PTAA 1OXVA 3I4MB 5NUCA 1LTGD 3RZDB 4DR5Q 2CT4A 1VQ7A 3VS1A 4C0FA 3STBC 4D8DA 2A68C 2FL7A 4JLIA 2EJMA 5COYA 1XNRQ 4H0LC 1RADB 1W1FA 1M30A 2QGFB 4C0DB 1YI2T 1CUKA 2M9VA 3FKIB 1J9OA 1EU4A 2JA5G 4C56C 3MEUA 2F0DA 1TWHB 2JT4A 1HZBA 4DQ2A 2K79A 2KYBA 2FMMA 3UWNA 5D65A 5HKCA 4QF4A 3T16A 3VR5A 2XICA 1ARKA 1TWGH 2HD3A 4PZ8A 1EIHA 2JVVA 3M56A 1QOHA 3JCMg 4BBRH 1I5OB 2J6FA 2DM1A 2MMPA 2P0KA 2CWPA 4MZ9A 4U673 1QKXA 2WV6D 4DV7L 4RG2A 1PH1A 1WHKA 3C0CA 2A74C 1SHGA 1WTHA 5I6YA 3A8LB 4LF5L 1WHLA 1Q1EA 2MJ8A 2DD5A 1CKNA 1YNZA 4TSSA 1KJWA 2WAQB 3VA7A 2HQLA 2KCNA 3HFZB 2C0IA 4WFN3 5HCKA 3VS2A 3NUCA 2D9TA 5LJ5j 1OZ3A 2BH2A 2ROLA 1EQRA 3O13A 1D2BA 4FM4B 2RK2A 1IW7D 1RUWA 4G7OC 1JCKB 1VF7A 2A5HA 4RAUC 2VASA 3HG9A 4HVWA 2F3IA 2R7ZG 1KAWA 4JPBW 1NBEB 2EBPA 2Y90A 1K0XA 2DA9A 2P5ZX 1Z9QA 3PNWC 2F0UA 2B2TA 4LF9Q 1YBYA 4B3RQ 2R7DA 3KJPA 1BI1A 1CQVA 2NZHA 3M9BA 4HA8A 5C0XJ 1SRLA 4AYBG 1K9AA 5JEAJ 4C3JH 1TTHB 2L4NA 4KY5A 1I4K1 4DEXA 1UE9A 1S72A 2RN8A 4FYYB 5EAYA 1Y1WG 1RODA 1BUVT 2CQOA 3GQBA 2ZZDA 1ZSZB 3M0PA 2RO0A 2CKKA 4QQGA 1M1KR 1UEAB 2PO4A 4DGZA 5GAEC 2C9OA 2KUMA 4HAEA 1VQOQ 3KFVA 1IHZA 4ODGA 3IQLA 3RKYA 4ZCKA 4A3DG 5GAMd 3MA2B 2PTKA 3ZEHA 2VV5A 5CV8A 2CW0C 4RGOS 5CBEE 4IUPA 2K3YA 4JRQA 1ZUYA 3CCLQ 2IIMA 1YZ6A 3E0EA 3NELA 4RCOA 1NY4A 1QP3A 4J9FA 2HCIA 2UXBQ 4C3IH 4A3FB 1CSPA 2E70A 3MXUA 1Y8OB 3S17B 2HDAA 2FFKB 4J1MA 4C8QF 2D8HA 1C48A 2IPKD 4EMGA 1NSNS 3AMUA 1JU5C 1A3TA 5CR3A 2EYMA 1P92A 2KI7A 1SKUB 2VB6A 3H9NA 4C0ZA 1SROA 4A4GA 2VGNA 3CC2A 1LTSD 1HH2P 4POFA 4JI7Q 2QDBA 2I5MX 3S1NB 4L6V5 3INZA 3KBGA 4RTXA 3N6RA 1ZSGA 4JBWA 1TIID 1KFZA 2PW7A 4B3MQ 3S1MB 1Y1VG 2FINB 1MSGA 2I5HA 4NXNL 1PRMC 5GQOA 5ELFA 3I55Q 1Q1BA 3CU7A 3K5OA 4ZN3A 2DTHA 2JTEA 4R1JA 4CDDC 2PNRC 1GRIA 2DIQA 2DBMA 2QA4Q 2I5LX 1L0WA 1FJGQ 1PLFA 1I3QH 4WJWA 1CA5A 1FMKA 1ZYRD 2D62A 2E12A 2JYOA 5GAN5 4K6LA 2A08A 1GM5A 1PH4A 1W2BA 1QMCA 2FMCA 4M75C 1TVXA 3NE5B 1JR0D 1JB0E 4K6DA 2P0PA 1RLQC 4OIKA 2BE7D 4K2KA 4C92D 1TWGB 2B2YA 3TU4K 1YEZA 1PSEA 1C7YA 4XQJA 3T51B 3UATA 4BBRB 2JUFA 3FJPA 4DBHA 2HUGA 1PD1A 2KYMA 2L5TA 4GS3A 4MMLA 2WSEE 2MWPA 1OTCA 4AQYL 2ID0A 1X32A 2XSCA 1S5FD 5E7NA 4X1VA 2K75A 4YWMA 4LFAQ 1MGQA 1BBXC 3CD6Q 4LDUA 1EY5A 1DONA 1WCMH 5A0LA 1WXBA 4LUVA 1A63A 1WFWA 4HCSA 4KUIA 1K8GA 3M0RA 4FYVB 4FYDA 1SSHA 4DR5L 2RDGA 4PJNA 4BE0A 3OSSC 1SNMA 4MTKA 2N55A 1PH6A 1XNRL 1PCXA 1X3FA 2F0MA 1B34B 5FU7B 1ZA1B 3RBBB 1YWOA 2V4DA 1PWTA 1VQCA 1QCFA 1BKBA 4PJOF 1D5MC 3S9WA 4A93G 2BA1A 5EG2A 3OY9A 4M7AF 3VS3A 1LTLA 2EYZA 5GANh 2M2LA 5J1ZA 4OWXB 1PMRA 2CP7A 2A6ED 2LKVA 1X65A 2JQOA 2XWBB 4AH6A 4X65Q 2HBPA 1BBWA 1T0HA 2DERA 1LTAD 2NBFA 2F0OA 4DV4Q 1TWFH 2CFMA 3ZBDA 3MP1A 2BZXA 4IFDJ 3TSWA 3S3NA 5FLMG 1MIUA 1EQQA 2KRNA 2QXFA 3GBQA 2F1LA 2OAWA 5FLXE 3J81E 1I1JA 3L2QA 2GN5A 3HSBA 4M1UB 2B39A 3GTKH 4BBSG 2K6DA 5GAN3 1KNEA 3OB9A 2EKHA 2FPEA 5M3MH 3OMCA 2K5NA 4L5QA 2Y4YA 3KF6B 4PK4A 1OX9A 4AFUC 1WJQA 3M59A 1SHFA 1WJRA 1DGSA 2PMZE 4F7UB 5BR8Q 2DILA 1PZKD 5JOBA 4PFOA 4KH0B 3SK4A 1AWXA 3EG9A 3QOJA 4RMFA 1I4QA 3I8ZA 1QVFA 1CSKA 2ZJQA 4C3IB 3J80c 4WRDA 4Z89A 5GROA 3ND8A 3RMSA 3P75A 2FG0A 3GV6A 3MFYA 5ELDA 3F2BA 1RI9A 4ZKCB 2DXTA 4MZPA 1IBLL 1IXRA 5CR2A 3S3MA 3K59A 2YRDA 2B63G 4BXXH 3J80i 1YIJQ 3G71T 1J6QA 1WDXA 3G4ST 4OMOA 1KK7A 5GAHC 2J6KA 1SNOA 3X28B 1YHAA 4C92B 5IP7H 4JDSA 3TVTA 2ZXOA 2DIGA 1XMQQ 2RDFA 4EMKC 1TWCH 1X56A 4O0AA 3C1FA 4APVA 2LZ6B 4B6MA 1YI2A 4M7DC 2N88A 1U4MA 3JCMe 1RAFB 3DB4A 4ELZC 4BACA 1M90R 3ZJYC 2RHYA 4QKUA 1GJXA 4A53A 1I3QB 1FNUA 1Z7TA 2GA4B 1GCQC 3M4OB 4A3GG 1BCPF 3A0JA 2CZ0B 2FEIA 3LGFA 1Q90A 2J0TD 2XG8D 1SYDA 5IY0A 2BH8A 1BIBA 1Y96B 3CCJT 5DM63 3CCRT 2GBQA 1Q8IA 1YCSB 1LTTD 2V8KA 1N5ZA 5M5WH 2ES2A 5G3LF 5IYBG 2L3QA 4M77C 4HIDA 1G8XA 1G2TA 1EOTA 1ET9A 1OXSC 1SNPA 1STAA 4NMZA 4C5IA 4DV5Q 3BG3A 1TS5A 2CT3A 2ASBA 3QPHA 1HTPA 5KYXB 2QEJC 5CC4A 4FSSA 2E64A 3CRLC 4B3ML 3QYGB 1KQSA 2PZUA 1QJOA 5C6AA 1KQ1A 2ZM6Q 1HR0L 3P8HA 4KJOA 3KFUA 4DUYQ 4ABNA 4O5VA 3M85A 4RKLA 5IYDG 1KDAA 1FJGL 1OEBA 2A3LA 1L2FA 4OWWB 4HIMA 1KC8U 3EJIA 4FT2A 1Y8PB 2GQIA 2XKOC 3M4YA 1IZ6A 2DLPA 3A8OB 1GOZA 3MXGA 2EYYA 3Q0AA 1Y1WH 3MPUB 2OX7A 3MP6A 3AHUA 1K9MR 4MDXA 5CIUA 5EQ0A 1JBMA 1E2ZA 2KT8A 2B2VA 3WOEA 5CBAE 2NUPB 2LXJA 4AFZC 1TWFB 2CVRA 4LNQA 3OYFA 2WINB 2OQ0A 2EE1A 1H9RA 1M2VB 2BDNA 4JOIA 2QDYB 2OXPA 4DNRB 3NTHA 4OMFB 5CQYA 5IGDA 1QCNA 5C5LA 3J7ZC 2Z0SA 3HOWG 3GTKB 1LT5D 4YY3L 2EPDA 5M3MB 2JW4A 1HFNA 3MAQA 1O7YA 1Y69U 4NOYA 1XQHA 2CWAA 3QZ5B 3NENA 3FRNA 1D3BB 2DUDA 3V8JA 3M53A 2Y0SB 1PHJA 2UU9Q 3TSZA 3SHWA 1E24A 4FYWB 2PZ1A 4M75E 4Q5WA 3JAMc 4A3EG 3URYA 2DL7A 5JJZA 1K0SA 3H0GH 1ZBXA 1F9SA 4K0KL 4RTYA 5GANg 1J5EQ 3CMEQ 4RG1A 1KG1A 4AG2C 3S1QH 3ICEA 3THKA 1G5VA 3BS1A 1WFQA 3JAMi 3OBYA 1FNVA 1WI5A 2Z8LA 3EBEA 4KLKA 1VQEA 2AHJB 1M4VA 2DNUA 4P72A 3T4AC 3H6MA 4X65L 3HP3A 2K33A 2JZ2A 3CC7A 3CCSA 1MMAA 4DV4L 5FOBB 2HQEA 1DM0B 1ZEQX 3EH1A 2QQBA 5CQXA 3A55A 3EFOB 2HCCA 3TS0A 4H44C 4TVRA 3GOXA 2QK0A 1TWCB 3JRZA 1SBBB 1NTGA 1NAPA 1Q7YU 5KNDA 4CDCC 1Z47A 1AE2A 4C1NK 3HOVG 1M3CA 1QVCA 2L0CA 3T9NA 5C4XG 4QVDA 4X62Q 4C8QG 5D3DA 4YHHL 2ZGWA 2LMCB 3B6YA 5IOCA 5IAYA 3BYYB 2O2OA 5BR8L 5LJ3e 2MPXC 1NYFA 3K58A 4QQ6A 2DXCA 1Q86R 1LUZA 4LF8Q 3KXTA 2UUBQ 4ME5A 1SSFA 5CAIA 3U23A 2Z9HA 2DL3A 3T56B 1U4RA 3QOLA 1LACA 3OTOQ 5M5WB 3LW5E 1BCOA 3VV0A 3E9FA 3QUIA 4A3CG 4P5NA 1A2UA 2M00A 2NN6H 3C4SA 4JS5A 2RA2A 1B7YB 2UXDQ 3G48A 4KY6A 1FR3A 2X3XD 3S24A 4A3JH 2BA0A 4A3MG 4F7XA 2F0WA 3UE0A 1G83A 3HTRA 4C3HG 3P20A 3CXCA 4O1NA 3RLNA 3PO3G 4LXCA 1NYGA 1H9JA 1GUWA 3MXPA 4BI4A 3GV3A 4CGYB 1K73R 4DBFA 1DOKA 1BIAA 1WPYA 4N4GA 1XMQL 1N9SA 2CZ1B 2L2PA 1F77A 4M8AA 4BY6C 4EPCA 4RGMA 2DMOA 2DYIA 1SE4A 5GAGC 5IXBA 1HK9A 3JSCA 3CPWS 5LHY1 3MEVA 5DM7R 2ZPFB 1GHJA 1H9SA 2EAYA 3MKDA 2BE5C 4IJHA 1AZQA 3D6CA 5D6XA 2K4YA 3G1JA 3NPFA 4IIMA 1X54A 4PZ7A 1ICFB 1WHJA 2E5LQ 4E47A 3J7AF 3QYHB 4B3SL 1B1ZA 1CKBA 1JRIA 4KGVB 1RHPA 3PIO3 1TT2A 4RKBA 2KRMA 1VQHA 3P7JA 4PMWA 4XYQA 1VQOT 2MO0A 1DZ1A 2ZTCA 4FF4A 1I81A 1NG2A 3LLRA 2PCFB 4FW2A 2YYZA 4J8QA 1WQ7A 5GMKh 4LJZC 4PMBA 3U50C 2VQEQ 5D7UA 2JA7G 3D8GA 2DTIA 2OQKA 4E7SA 1A3VA 4YIJA 3SFMA 3GTMB 2O5JC 3CCLT 1UGPB 2R6GA 4LN2A 2BCOA 2SDFA 1PV4A 2JMAA 4PJOG 3LX0A 4PV1C 3W3AA 4M7DE 1EFNA 4Z02A 4M7AG 2NUCA 1PH5A 5EPKA 1HHVA 5GMKm 1SG5A 4VUBA 4FDBA 1X3GA 2A8VA 3D4WA 4A63B 4DOWA 1AZPA 4DU9A 2R5AA 1HNWQ 4E7HA 4L5RC 5BN4A 3EGXB 3H0GB 3JCMb 1VQ6A 2E6NA 1XOVA 2A73B 1VQ9Q 4F16A 5C3EG 4A3BG 3M3YB 4E7ZA 5E4WC 4DV0Q 1KDCA 1HFGA 3HOZG 1Q46A 3I73A 1I6HH 1Z6HA 3EG3A 4KULA 4XU0A 4OONA 5EPJA 3I55T 1AP0A 1ZBJA 2JJ9A 4M77E 1Z9ZA 2RI3A 2LSSA 3G71A 3KLRA 2H1EA 5FROA 3VR4A 2QA4T 1DCZA 4CHTB 4A3KG 2R92G 1EYDA 2L3SA 1EEFD 1JICA 2Q2TA 2O5IC 1SMYD 2LRQA 1EY0A 2RSOA 2WKDA 3OW2S 5M3FG 1V29B 3C95A 3HOYH 3FHWA 4OHJA 1UGRB 2A37A 1C9OA 4F7UF 1LT3D 1SSOA 2KOLA 4ZTFA 3STBD 3H3VC 1N9WA 1NZ9A 1D5XC 3KF8B 4P74A 1MJEA 2J6OA 1ET6A 1EYAA 1A2TA 5EKIA 2FPDA 1K8MA 3OSOA 2PU9B 1UGQB 3TQYA 4CBVA 5C0XH 3CCJA 3CCRA 4J9BA 2NZOA 5JEAH 1WNLA 2SRCA 3L2WA 4NS5A 5JJIA 1B07A 4FYXB 1XWEA 2M16A 1N33Q 2HZYA 4Z88A 2VVKA 3VS6A 2EXZA 4KN4C 3EG2A 1KDBA 2QKIC 3ZYYX 4KKSA 4X66Q 2KVMA 4HIKA 2YUQA 2E75C 3KOJA 1OO9B 3Q6SA 3IL8A 4C92F 4A3JB 3TMEA 5LJ3j 5I11A 3PT9A 4J6XA 4A75A 1NE3A 4JI6Q 4JV5Q 2B2TC 3HOUH 1Y8NB 2C06A 2Z6KC 4QMGA 5KRUA 1GD7A 3NTIA 5IWAQ 4AYBE 3EHRA 3CCUQ 1YNJC 1PNJA 1HA5A 3DMUA 1AFPA 2QG9B 1UECA 2VL6A 2QCPX 3M55A 4FT4A 1JEGA 4KHVA 2C0TA 4RTWA 1BF4A 1LT6D 4OO1H 4ZGEB 3PUVA 3SK8A 4X62L 5KGUA 3OYNA 1WXUA 2RD1A 1RD9D 1B8AA 3TZUA 5ELOA 3N5BB 4AFQC 3SK5A 3NQIA 4DV2Q 4GLXA 3OW7A 4QIWB 1TUDA 5FLXc 3J81c 3I4MG 2H8HA 3KF6A 2QW7A 2UUBL 3L42A 2QQSA 1AZGB 5A0DA 1NJIC 1GL5A 4F7UA 4UP8A 4DAMA 4N9TA 3OTOL 3HKZE 2YTVA 1KHIA 3FKIG 3J81i 2LJ0A 2EJ9A 1KLUD 2CS7A 1VQBA 5KCOA 2KA7A 4A4IA 4FNFA 3DHQA 1RIPA 5LJ5d 2NLUA 2XVSA 4K14A 2GGRA 4DAYA 5FU6C 4BD3A 2DXUA 3G4SQ 2EY1A 1SJHD 3ITPA 3ULJA 1ILPA 3OIPA 1MMDA 3NTKA 4J6WA 1B50A 1BYMA 1TUGB 2DL8A 3OYHA 2JA8H 1WTPA 1JE5A 3BZDB 1LM0A 1EZZB 4V190 4JJDA 2OTLT 1BDOA 1T5XD 4NW2A 1YIJT 4C92A 1D1AA 5JVH3 4C5EA 4I7AA 4RHRA 1WJSA 3F2UA 4RKUE 1NEBA 2CZ6B 4PFPA 5LJ5e 3CC4T 2BZYA 2CCZA 4ME3A 3SXHA 1U5SA 2E5LL 1JOQA 1K3RA 3TEEA 3GP8A 3O8VA 1A0NB 2HHHL 4E7LA 5CV7A 2HDMA 1R4QB 2RQRA 5GAMg 2IL8A 4JI2Q 4OXPA 1QUQB 3AYHB 2B2YC 1UB4A 2DX1A 1H95A 2VXWA 2VQEL 3HOYB 3MZ5A 2ZAEA 5LJ3f 5M5YH 5IT9E 4BY7H 1D0XA 1EZ8A 4CI0C 1HUNA 1I4GA 2D8JA 4EMHA 5IHIA 1UE5A 1YHQQ 1XPUA 1CKMA 3CQZH 2BKDN 1ESRA 4GZYC 2NYSA 2RMOA 3ZL7C 1WLPB 4B9WA 1X69A 2CDTA 1OXUA 2RHZA 1L0YB 1HUMA 1AOJA 2VXFA 2FHTA 4IFDH 4Y7NH 2LVMA 2VB3X 4C8QC 3MWYW 1YCYA 4IJLA 2VQFL 3M4PA 5L8RE 1R77A 2J05A 4R55A 4IIOA 5C4JH 4A4FA 1M2OA 3EGDA 3X3NA 3TCJA 3RKXA 4FO2A 5M5XH 2QF7A 4DR7Q 3VRZA 4R4IA 1LVKA 3K7AB 1HQRD 2NVXH 2E6ZA 2DRKA 1JWUD 1OYXA 2DNCA 2I2LA 2DYBA 2PVDB 1IHVA 4A3FG 3CEYA 4AT1B 4IQZA 3HRSA 1L0XB 3AFPA 2QTVA 2XWJB 1VQKQ 4L5TA 3FB9A 2DZ9A 1LYLA 1BR9A 3M0TA 4PJJA 1V1OA 2F0JA 3HOXH 2NVTH 2VGMA 2NVQH 3HGBA 4PFZA 2B2UA 3RNJA 5L23A 3OYKA 1XPRA 2RKSA 2A6HD 4JLGA 5CKFA 5ELNA 1BNZA 5K5PA 4DK0A 5GAOl 4JZ4A 1VIFA 1JJGA 2HEQA 1B3AA 2KBNA 2JP1A 3HKSA 3GTQH 2K5HA 4JJBA 3U58A 1N33L 1YNNC 4DEYA 3HS0C 2ENMA 5KNBA 1ACMB 1MV0B 2YWWA 2AWOA 1PA6A 5EC7A 3L2ZA 3Q1JA 3NFCA 3CCLA 1DJRD 3LYIA 4PQXA 1I50B 3NHHA 1CHQD 4JI8Q 3FPPA 1B9NA 4HMJA 3EROA 4E7KA 1UJYA 4M78D 1PH7A 3T13A 2IY5B 1PSFA 4XTYA 4JV5L 2KCCA 4ZYSA 3CMET 5TSSA 2UXCQ 2VUBA 4BBRG 1KNAA 1O9SA 3OPOA 2E5QA 4RFBA 4BE2A 2JA8B 2FVUA 3QZ9B 4A54A 4PJOC 2ABLA 4M7AC 3EFOA 1E7ZA 1ESFA 5C4ZA 2X9HA 1SPKA 2FYKA 4DAVA 1SNDA 5GANj 1HNZQ 3I55A 3A8JE 3OWEB 1U1SA 2QA4A 4K5VA 3GTJB 2CP6A 3CPWP 4II1A 3G6ET 3F70A 1L1OB 1GUTA 4IALA 2CP2A 2PW5A 4GN4B 2QQAA 4KJNA 4XDXA 2H3JA 4XTWA 3H6ZA 4J7IA 3QBYA 2RCFA 3AQQA 3NBHB 2JA5H 2LS01 1KD1R 5M5YB 2PQAB 3TEHB 4BY7B 2F52A 4ZNXA 5CGKA 1JC7A 4OGEA 2N49A 2XHCA 1T5EA 1VQLQ 1I4PA 3LH0A 3CQZB 2D0NA 4HTHA 5F2DA 5A2QL 1PVOA 5I2SA 1JJCB 5KH6A 4PKCC 4LD9K 2V1QA 1ZA2B 4C3JG 2E2JH 1TSFA 3REAB 4QB4A 2GQVA 4FU6A 1YJNQ 2Z6KA 4CKBA 2EKOA 3CD6A 1YVCA 4Y7NB 1CI3M 2OEOA 4A4KA 1UE7A 5KYUB 3CCEA 1M8MA 5EBCA 4LD6A 3DEPA 1D5ZC 5JPNC 1N27A 2WSCE 5M9OA 1SEBD 1JO8A 4M77D 2V1CC 3K6OA 5C4JB 4F7UG 1VQ8T 3GTGH 5KNCA 5C0XI 5M5XB 1IREB 1RACB 2P0QA 2CKZB 3M0UA 2A69C 2LJ1A 2NVXB 4HSPA 2EJGA 1X3EA 1HR0W 2B2VC 2YV5A 4JI2L 4C3IG 1K76A 4DK1A 2F0PA 1KIKA 1O75A 5FRNA 1KSWA 4RH6A 4JOIC 2KT1A 3D0FA 2RJDA 4ZRZA 4X3UA 4A3LH 2NWGA 2NVQB 3HOXB 2NVTB 1NUCA 3OW2P 3PUWA 1TWAH 1Q82R 4YCWA 1UJ0A 2LX7A 1BCPC 3K81C 5FO7B 1JORA 2OJ2A 1N34L 5AJ3Q 3FRPB 4M78B 4DXGA 3AB9A 3RLOA 1M1KC 1K28A 4C92G 3C3LA 3TQ7P 4DV1Q 4UHVA 5CORA 4JRPA 2E2HH 4CDFC 4J83A 3S16H 3TS2A 3FC3A 1IBML 3GTQB 3DLMA 2GFUA 1WOCA 4OO1I 4K5WA 5KIXA 2EZVA 1NNXA 2AQ1B 4GOPB 3GF5A 3TP8A 3I4NH 2F0IA 3UDXA 2RQTA 4IO9A 1T3LA 1MBYA 2LXKA 3AU7A 1T3SA 1MMGA 1GUSA 5C3XA 3JB9J 2XIWA 1D7QA 2F0QA 1QG7A 1VQMQ 2JXBA 4C0DC 2HAXA 4OL7A 5L37A 4XU1A 1MHWC 1MI2A 2P84A 3OYIA 3VR2A 5GAOq 4B9XA 1VQ9T 4BDYA 3H0IA 4HT8A 3I5RA 4E2FB 2ATWA 3VYRA 1C0MA 4F17A 4DR3Q 5LJ5f 5DM73 1YIJA 4QT7A 1YITQ 1SYBA 3ERQA 1F9PA 1V1PA 2HMAA 3VUZA 1PFNA 4CRIA 4EMKB 4C8QE 4MDWA 1DOLA 4HR7B 4ANJA 1LPLA 2DBKA 1IGQA 2SEMA 3T1HL 4NB3A 1TKWB 1Y1VH 2XRSD 2JM8A 4DOVA 4LUZA 1S40A 2EGCA 3L2PA 5JVG3 1UNSA 2RM4A 3M7GA 3D3RA 1ENAA 2YLBA 2DO3A 1P16A 4Z9CB 2EGAA 2X3WD 5C5MA 2ZXPA 1QVFS 3QIAA 2RHUA 1TY2A 1ML0D 2UUAQ 4L5SA 1RJTA 1VQGA 4C8QA 5E1FA 4WF2A 1EOVA 3M5AA 4HEDA 3D4RA 3QJ6A 1JXOA 4NP5A 4EVOA 2SNMA 3SWNB 1O78A 3A5ZB 4M77B 3H0FA 1X6GA 2E2IH 4OB0B 3WXMB 3EAEA 3SVMA 3W5OA 4QVZA 3IAYA 3BU2A 4A3IG 1WD0A 2E2JB 2O9VA 2RH2A 4DV6Q 3GTLH 8AT1B 2P4RA 2O4XB 4X34A 1K0RA 3D31A 4C3JB 5M3MG 3KLSX 4N8FA 4R4OA 3DB3A 4TVAB 5C44H 5KYYB 1HNZL 3P8DA 1TUCA 3IKJA 3CCUT 5ECAA 1PH2A 4IFDI 3GTGB 1AWWA 2EXDA 2Y0SG 1ZSZC 1M3AA 2A36A 4A4EA 3F2DA 1QE6A 2K57A 2EQUA 1AE3A 4NDXA 4YWKA 4EQNA 1QW1A 2PYKA 3OOCA 5GAOp 3RMHA 4POGA 2FZCB 1S1NA 5ELBA 1WHMA 2E76C 3OWFA 2R5MA 3V7SA 3JCMJ 4ZKBB 2L0AA 3JCMV 1CSQA 3JCMd 4JCVE 4DNIA 4J5YA 2VNUD 2RQVA 3DWPA 4BUGA 4PJOE 9ATCB 1TWAB 4X3KA 2L3PA 3ND9A 3FEOA 6AT1B 4OIJA 4M7AE 2JSOA 2FPFA 1EY9A 5FLMH 1RCVD 4QQDA 4AYBB 4LF9L 2OTLQ 2LQWA 4JBMA 4MTNA 2E2HB 2C0OA 2XDBA 4B3RL 3S16B 3VS4A 4J9DA 1ZUUA 2LNHB 3I90A 4BBSH 2QILA 4CJ2C 3V7CA 3MXNB 2KCMA 3TDQA 4KHPQ 1D1CA 3CC4Q 1I07A 4PJOA 2ATCB 3PE0A 1OU8A 3I4NB 4M7AA 1C0AA 1G291 8ATCB 4U68A 1V76A 2F3VA 3PGGA 2WB1E 2KQ3A 2YRVA 2HSPA 3CMEA 3EFXD 4E6RA 5LL6S 3RN2A 1U5KA 2D6FA 3RUXA 2KGTA 3HKZB 4JI0Q 4ID6A 1YHBA 4RMOA 1II3A 3QO2A 2YT6A 4JI5Q 1QILA 2UXBL 2F5TX 2A19A 3ASKA 1QUQA 4DBQA 5FKAC 2JEAI 4XK8E 3BDCA 5I2XA 1U0LA 2Q2IA 3FDRA 4EDUA 3URGA 4WORA 3S15H 1B2TA 4LUEA 1CFMA 3PIOA 1TXYA 2F0GA 4GNXB 1Y1VB 1VQNQ 2AKKA 1IW7C 4JI7L 2HL5C 3OYJA 1SFOH 5IT9c 1WZOA 4XYOA 3DWQA 5GAOn 2WIIB 1JWMD 1WCMB 1YHQT 1ASYA 5GAMj 1TS2A 4RHSA 5GMKj 5HGQA 1ABQA 2E41A 2EVRA 2W10A 4NKLA 1SEMA 1QZHA 1VQ5Q 1G2SA 1YJ9Q 2RDHA 3I72A 1OOTA 1GO3E 1LJOA 3UDIA 2XDDA 1M3BA 1KIXA 3MEAA 2HT1A 2R93H 4KK7A 1IYJB 2E2IB 1CT1D 4XU3A 5FO9B 3E9GA 1UFFA 2D1XA 3EGUA 3NP8A 3VR6A 3WWVA 2E5KA 3J7AV 4DR3L 2FRWA 2SEBD 2EY6A 1K8AU 5LMNW 4A76A 4CJ1B 4LF6Q 4XT1B 4BY1H 3GTLB 4OX9Q 3L2UA 2HIVA 2YXYA 1UTIA 2BIVA 3PVLA 1I5LA 5IGFA 2KR3A 5C44B 1N6AA 3UT1A 4J9GA 4GBQA 3VUBA 4BY6B 1BOSA 2EYXA 1KTKA 4A4HA 1VQKT 1S5DD 1U4PA 4IOCA 4LFAL 2HQHA 1U8RA 3RNUA 3BJUA 4X64Q 4OMPA 2WP8J 4LK1C 2O01E 2JOYA 4XTZA 1K9MC 2OTJQ 2UUAL 1LTID 1F9QA 1HRJA 4XQNA 2L5QA 1HXDA 1G51A 4YWLA 3UA6A 1DD2A 1SYCA 3DXJC 2PZWA 5T1IA 3CMAQ 3PMIA 2BOSA 1XNQQ 1UG1A 1PTOH 2QTXA 2F0NA 4WJ3M 1C4QA 3M0SA 4X9DA 5HGTA 5AFWA 1M1GA 4WTOB 2G6FX 1SJED 3M7NA 4IUNA 1OPLA 3H8ZA 4YCVA 5CVIA 5LJ3d 3CF5A 1OQKA 1UAPA 1AHJB 4DV6L 1ZYRC 4PMCA 1H9KA 2RHIA 1SE8A 1RAEB 1EEID 4XIGS 4LNPA 2KEAA 3TZDA 1WTQA 3F8TA 2F3WA 4C2MH 3C2PA 3VKIA 4BBSB 1PFMA 4HJAA 3PUXA 1EZ6A 1VOMA 4C92C 1IBKQ 1VS0A 1VA7A 2LP5A 2FZGB 3QDFA 3G6EQ 4XAXB 1PTOD 2N8NA 3EQLC 4LWCA 3RMQA 5K36H 1VDZA 2AUKA 3VRYA 4PZ6A 1N8RU 4AIMA 1WA7A 4A3EH 5CYUA 1VQ9A 3A98A 2HKQB 2CH4A 2V26A 4OVAA 4EIKA 2FRYA 2YSQA 2F2WA 1QNKA 4LFBQ 5KE3A 1QVGS 2PI2A 3QO3A 1EU3A 1L1OA 1IGUA 4KT0E 4J9IA 3SEMA 3CRKC 3TN2A 2AKLA 2EQJA 5CV4A 1FWZA 4M78F 1PH3A 5IGCA 4HXJA 2CP0A 1W6XA 2CYZB 2YUOA 5GAOr 2AK5A 4A3JG 3QJYA 3SK6A 1V8QA 2COWA 4ZN1A 1NJIU 4IPCA 3NBHA 4DF7A 4KKUA 1TU0B 1CKAA 5IYCH 4DV3Q 1WTOA 1GXDC 4JK1C 1AZEA 1CKOA 2HDLA 3VYTA 1VQDA 4FF3A 1CA6A 3A1PA 1V43A 3MO8A 3K5NA 1SFOB 1GUNA 2A6EC 4IPDA 1CKNB 2KDSA 3HOVH 1VQLT 3L2VA 1VQ8Q 2FXQA 4KHPL 1HJPA 2JA9A 2R3ZA 4OEMB 2B29A 1STEA 4P73A 4RCBA 1MV3A 2JXMB 1GBQA 1ZQ1A 5FWCA 2LY7A 4Q5VA 1YJNT 2IVWA 3RLFA 2MF2A 2YTYA 4RTTA 5CMDA 3L9AX 2R93B 1ZSZA 2PNIA 2K2MA 5I9OA 3OA6A 2MPMA 2JTFA 4GKKQ 4KI0A 1Y1WB 2M51A 1NLPC 3A8KE 4TQUS 1U1TA 2IG0A 4RUGA 4RTZA 1LLRD 3EG1A 1E0BA 2VUMH 4ESRA 3OYCA 3CCVQ 1JJ2A 4BY1B 1K73C 4F8MA 5DNFA 4R8IA 4RTUA 4X6AH 2LCSA 2F0KA 5GAMh 2QGGA 3CCUA 2KECA 4C3HH 1LNXA 2BZ8A 2MOXA 2B2UC 2KSSA 2V8IA 3ER0A 3L3OC 3NK9A 4DV5L 2XIDA 1NBWA 1OXTA 1LTBD 3AFQA 4HCCA 5JPMC 2FB7A 1RTNA 3UPUA 1PRTD 4BI3A 3KLWA 2F0SA 4RCCA 3IFTA 1PKSA 1I4HA 2AQ2B 4DK3C 4M78A 4R8NA 2R57A 1MJCA 2ZM6L 4DR4Q 2X69A 1B7TA 1SF9A 5IGGA 2TSSA 1W70A 1YWPA 3VS5A 1YJWT 1VQPQ 1EFID 3E6ZX 3F1ZA 3QIIA 3KLSA 4DUYL 4RGNA 4J9HA 1KC8R 1FMWA 2EY2A 5A2QE 1WIEA 2XMFA 4GOPA 2W0ZA 3PUZA 4KTAA 2F2VA 3JCMW 2ICEC 1PTOB 4FW1A 1UHCA 3PFSA 3U9SA 2F1MA 3S1QB 2ZPEB 1K8AC 1XXGA 2RQXA 2RF4A 1G3YA 3FIFA 3CC7Q 5I2MA 4OP0A 3HOYG 3GP7A 3G4SA 3JCMf 5C6SA 4OX9L 5CKBA 2FJ2A 1VQMT 2YHTA 1Q81R 1YNND 4C2MB 2PPBC 1HA6A 1C6VX 4JI1Q 3I3CA 1H92A 3M9QA 2NZ1D 4V0BA 1BI2A 3MEHA 2A68D 1KXLA 1H8KA 3WDNA 2D0QB 5C0XG 5GMKl 2D9UA 4LF4Q 1YITT 4UP7A 1ZUKA 4A3EB 1X75C 1BB9A 3S6WA 4XTVA 2J7ZA 3EVQA 5EPLA 5FLXL 3PIPA 4JYAQ 1VQ4Q 2RNAA 1EWHA 4HJ8A 2UU9L 3VYSA 3ULLA 3RUZA 4WCIA 4FL6A 4BA1I 2XK0A 2DZCA 1XMOQ 1R0BG 2EJFC 3MJXA 3I56Q 3MP8A 1DJ7B 4LE9A 2F0EA 3NSWA 3R3OA 1J5EL 1SAPA 1WTRA 2MQHA 3LGLA 3OYAA 2R92H 3VJPA 1PZID 4QCLA 2DVEA 2KCTA 4N0AA 5FO8B 3RD4A 1N32Q 2E10A 1ENFA 1B34A 4PNOA 3HFOA 3IRBA 2UUCQ 2F2XA 4DXFA 4LW1A 3OMGA 2DD4A 1YHQA 4DA2A 2AZSA 2AHOB 4B08A 1YP5A 3K5MA 4GKJQ 4JBJA 5IIFA 2CREA 1VYTA 1TR5A 1IBKL 1Q7YR 1VYVA 3E9HA 1N8RC 3L2RA 4F7UE 1X3PA 2VXEA 4N9PA 1H641 3X25B 4K2LA 1ZX6A 5IGBA 1T9HA 3PF5A 1MMNA 2DJQA 5GANd 1FGUA 5KYYA 2RHQB 1RAGB 2ED1A 4ATOA 2DY8A 4MZMA 2KHIA 3SGIA 1H3ZA 2BE9B 2EJGC 1S72T 4OGQC 5DY9A 4LFBL 1PRTB 3A7AB 2JA6H 1SYEA 4LF8L 3PV0A 1HZAA 1QCOA 3M0QA 1BVSA 2C5CA 3CAMA 4MNOA 2E74C 1D1KA 1IB8A 1NPPA 1KLGD 1Q12A 5KYLA 3GTPH 2VUMB 1M8AA 2DJFC 1STGA 4FP5D 1YN8A 3JB9H 2KXCA 2UXDL 2DL4A 2XDPA 1X01A 3HL8A 3QHSA 3OW2A 1I4XA 2K6AA 3MVVA 5ELCA 3Q22A 1M5Q1 4C92E 2JA8G 5GANe 3NGPA 2BTTA 1H3HA 2DN8A 4DV7Q 4P75A 2XI9A 2ZTDA 1O80A 4CJ0B 4LDWA 2CW0D 2JE6I 3DM3A 2IW3A 3EG9B 3CC2T 2R61A 4LF5Q 1D09B 4OWTB 5EGTA 1FMVA 2X4JA 4X3SA 4HCZA 3JB9D 2RHXA 3MHXA 1LOJA 3J7YW 2OCEA 3PO2H 4GLVB 1OX8A 4J15A 4EQ5A 2EYPA 1PC0A 4KH1B 4PLIA 3S3OA 1BCPD 2PMZB 4GKKL 1I6HB 4TKOB 5FW9A 1KAAA 2AT1B 2WAQG 3FKIH 3BZKA 4ZTJA 4QUCA 1TWHH 1B70B 2KK4A 1VMPA 5I4DA 3GPLA 1GFDA 2Z4IA 2EYHA 1JB3A 5C0MA 1PM3A 2G5DA 2K5DA 2F03A 4DUZQ 5ELEA 3MEFA 1Y96A 4V2SA 3K8AA 4DA4A 1HZCA 1F9RA 5I9PA 1FGBD 1GVPA 4IFDG 1EWIA 1XYIA 1EQTA 4MMKA 5GAN7 2I46A 1TU2B 4M75D 3P1HA 1ZHIA 2RJFA 2COZA 5KYXA 2LC4A 1B4OA 1M1FA 4LAAA 1VQNT 1M1KU 1EUJA 3R8BA 1HNWL 1NEGA 2QAZA 1Q8KA 1I94Q 1G6PA 1BO0A 2WB1B 1Q95G 4XXEA 2GF7A 4X9CA 2KY9A 3C46A 4DV0L 3CCMQ 1VQAA 1I4RA 3DM1A 1JQQA 3LH5A 1FYNA 3A8GB 4IPHA 4ZLTF 1A6XA 4HVUA 4K8JA 2Z4HA 1VQ5T 5KYWB 3RDVA 2KBTA 3DLLA 1SYFA 1YJ9T 5E3FA 2DTOA 1F2LA 2HL3A 1VQLA 1TH7A 3NWTA 5EKLA 3HOUB 3HOXG 5ISRA 2A7YA 1WYDA 5FJ8H 4OELB 3WVEB 2AZVA 5GAOm 2K5WA 2NN6I 1RL2A 5CO7A 4YCUA 4JI1L 2NUPA 5CV9A 1EYGA 4WJ4A 2HNIA 1KHCA 4M78G 1YJNA 4UP9A 4FF2A 2X35A 2KVQG 1M2VA 5IP9H 2M02A 1D1IA 2Y0SE 1O7IA 3E3XA 1WHHA 4HT9A 2J4XA 3A8MB 3A54A 4UC4A 4N4IA 1TS9A 2M0OA 1GXIE 1LV9A 1SRUA 1TG0A 2JA6B 4KBMB 2JS0A 3QSUA 1HPCA 2K5IA 3OYGA 1ZXTA 1VQOA 2KXDA 1D3BA 3W1BA 3GTPB 4X66L 3H15A 1QVGP 1PKTA 2QI2A 5HK0A 2QEXQ 2KHSA 2Z6BA 2Q8IB 1WTVA 2MHVA 2Q2HA 2VWFA 2OTJT 2K05A 1NPRA 1N32L 2EYQA 3S17H 1NCVA 1BCPB 4UDUC 3HRUA 4R9WA 4RCNA 4DR1Q 2L11A 4JI6L 3CMAT 4J9CA 5DLQE 2LT4A 4E7JA 4GKJL 2L12A 4HN7A 2XRQD 5IWAL 2RCNA 1UEBA 2EQSA 2KEDA 1BCMA 3PCOB 1WTXA 1NE8A 2QQRA 2VC8A 3BDOA 3E2UA 2QDLA 3ME9A 1P8LA 1STNA 2D2CC 2K14A 3L0OA 4GLAC 4RA8A 2EYWA 1SMYC 3S1MH 2SNSA 4HKEA 1SDFA 4S3SA 5D6YA 3DUZA 3X20B 2ZPBB 3PO2B 3V8KA 2OF1A 4PJLA 2AUJD 2YUPA 4DV2L 1ENCA 2DAQA 1U3OA 1UE1A 1TQOA 1NM7A 5IH2A 1SLJA 2O31A 3CCQQ 1VQMA 3MC0B 4BWGB 4QUFA 4M75B 4LDXA 3MTSA 2ZXRA 1DOMA 4HJ5A 2CP5A 2DL5A 3OS5A 4KMUC 4M77G 2FZKB 1PG5B 1IL8A 1KRSA 3V96A 3OIQA 2RPNA 5KEEA 2A28A 5DLOA 1J3TA 4BDZA 2EJFA 3EH2A 3FJ5A 5GJWB 1V1QA 1IO6A 1WJJA 4IZ8A 1WX6A 4ZGDB 3V7RA 2DGYA 4JW0A 4R4CA 3VR3A 4M7DD 3G6JB 2DY7A 1YITA 4R56A 1EY4A 4GY5A 2KQWA 1OI1A 3FP9A 2A0FB 1PRLC 3SE0A 5A35A 4D6WA 2QGQA 3JCMc 4GLKA 3R2TA 2VS1A 1PTOF 1O7LA 5CKEA 4MZTA 2CQAA 1Y71A 1HTLD 2EYLA 3CBPA 5EKKA 1Y57A 4JI3Q 2RQWA 2RJEA 3R93A 4XTUA 2CZ7B 1SRMA 2DF6A 4DNTB 5LL6X 3PQIA 2XNAC 4BE1A 2IX1A 2CHBD 1RABB 4H7BA 1KD1C 3C94A 4J8OA 1QP2A 2MYSA 4CC3A 5GAN4 1W2BS 1VQFA 1S4ZA 4UAIA 1E6GA 1D6EC 4HJ7A 1WQWA 1VCIA 3GD7A 4DK6C 4DR6Q 3HPWA 2HCKA 1QKWA 1HZ9A 2LCCA 4A3LG 1IBLQ 2VB2X 5FRMA 1C8CA 1X55A 4DUZL 4IUUA 1WD1A 4LUOA 2PQWA 2XU8A 2AKWB 4Y92A 1PH9A 4M4ZA 1K1ZA 4JRKA 1JOKA 1JT8A 2R7ZH 3SHLA 1N9RA 3UDCA 4FVMA 1PFSA 5IXFA 2QASA 4Q0FA 1I8FA 3CCVT 2E3HA 4FSXA 1H9SB 1MHNA 3KUFA 2KE9A 1YJWQ 1GBRA 4IUQA 1F1BB 1STYA 3JV3A 1W6JA 3D4DA 2O9SA 1SXTA 3I4NG 1M90U 3CPFA 2GTOA 1D0YA 1V1CA 5GANf 5GAN2 3NQTA 4KV6A 1I94L 3BW1A 1LABA 2RVLA 2E1HA 1VQ7Q 1AD5A 1AWJA 3CBOA 1S5ED 1RAHB 1IKMA 4DR7L 3SD4A 4A3DH 2DJZA 2RQUA 3CBMA 3EGXA 1VQPT 2E2DC 2GVAA 3BVZA 3HKZG 4R4QA 4E6IA 1Q82C 1M8VA 4F14A 3WOFA 4HCBA 1TY0A 2AQ3B 3QDRB 5HURA 3VS7A 3HHTB 2YLCA 3C12A 4KN7C 3V8LA 3JB9I 1WHGA 2NVYH 2Z1CA 5J22A 2OTLA 2JEBI 3LWHA 1UDLA 2K5LA 4J6YA 4C5HA 5GAMe 3CCST 3CC7T 1G3SA 4OMLA 5GMKe 1IXDA 1PRTF 2E8GA 1EQVA 3FLGA 2I0QA 1HR0Q 2RA4A 3Q8DA 1TOVA 1OXXK 2DEUA 3CC4A 4M7DB 1WCMG 1OZ2A 1BI0A 1G3TA 3V05A 1EIGA 3GO5A 3BVGA 3KF8A 2MO1A
chains in the Genus database with same CATH topology
1RLPC 2A37A 2ESWA 1WYXA 4OMPA 2M0YA 2K9GA 1T0JA 4CC7A 2J6OA 4CC2A 2FPDA 3UA6A 2JS2A 4J9BA 2SRCA 1UG1A 1B07A 3M0SA 4Z88A 2VVKA 3VS6A 1HJDA 2K3BA 3EG2A 2G6FX 1OPLA 2YUQA 1VYUA 2CT4A 4KRTA 3VS1A 4LNPA 4D8DA 2KEAA 5I11A 2O88A 1W1FA 1M30A 1G2BA 3EHRA 1VA7A 2JT4A 2LP5A 1PNJA 2K79A 2KYBA 1UECA 3VRYA 1WA7A 1JEGA 2C0TA 4RTWA 1PHTA 1ARKA 3EHQA 3A98A 4EIKA 2CH4A 1WXUA 2FRYA 2F2WA 2YSQA 2J6FA 2DM1A 3NMZC 4AFQC 5IHNA 3SEMA 4J9IA 1QKXA 2FO0A 4R0KA 1TUDA 2AKLA 2H8HA 4HXJA 1W6XA 2YUOA 3C0CA 2AK5A 1AZGB 2ED0A 1GL5A 1SHGA 1CKAA 3R6NA 2LJ0A 1AZEA 2I0NA 1BU1A 1YNZA 1KJWA 2JMCA 1QLYA 1OPKA 2GGRA 2C0IA 2ROTA 5HCKA 3VS2A 2ROLA 2CSQA 1RUWA 2DL8A 1MV3A 4HVWA 1GBQA 4HCKA 5FWBA 5FWCA 4JPBW 2EBPA 1K0XA 2DA9A 4JJDA 1Z9QA 3I5SA 4RTTA 2CUBA 2PNIA 1UHFA 2K2MA 1NEBA 1SRLA 1K9AA 1ZLMA 4DEXA 2M51A 1NLPC 2BZYA 4JZ3A 1UE9A 4RUGA 2RN8A 1U5SA 3EG1A 4RTZA 4ESRA 4AFSC 1A0NB 3M0PA 4RTUA 2LCSA 2RQRA 3KFVA 2BZ8A 2DX1A 1X2QA 2MOXA 3IQLA 2CSIA 1AEYA 4OMQA 2PTKA 1ZUYA 2IIMA 2D8JA 1PKSA 5IHIA 4J9FA 2RF0A 1W70A 1YWPA 2HDAA 2RMOA 3VS5A 2D8HA 3ZL7C 1WLPB 1JU5C 4J9HA 1X69A 2CDTA 1AOJA 1WIEA 3ULRB 2XMFA 2W0ZA 2F2VA 2J05A 1UHCA 4RTXA 1ZSGA 4IIOA 1KFZA 1PRMC 3VRZA 4D8KA 2JTEA 1HD3A 1GRIA 2DRKA 2DBMA 1OV3A 1Y0MA 4LUDA 2DYBA 1FMKA 1H92A 2A08A 3REBB 1WXTA 1H8KA 4OMMA 3M0TA 1RLQC 2DRMA 1ZUKA 1BB9A 1UGVA 3RNJA 5L23A 3I9QA 1NLOC 2RNAA 3UATA 3UA7A 4WCIA 2KYMA 4JZ4A 2HEQA 4LE9A 4JJBA 4X1VA 4DEYA 2ENMA 1BBZA 1MV0B 1WXBA 5EC7A 1WFWA 3M0RA 1SSHA 2F2XA 3QWXX 2AZSA 1UJYA 1YP5A 1WI7A 2KRSA 2K7AA 3RBBB 1YWOA 1PWTA 1VYTA 1QCFA 2CREA 1VYVA 3VS3A 2EYZA 3VS0A 1ZX6A 1B3QA 2ABLA 2DJQA 4J9EA 1T0HA 2ED1A 1SPKA 2BZXA 3TSWA 2GNCA 2KRNA 3GBQA 2OAWA 1I1JA 3H41A 4J9GA 3M0QA 1BK2A 2K6DA 3I35A 2EKHA 2FPEA 1YN8A 4AFUC 2J06A 1SHFA 2KXCA 2DL4A 1M27C 5I22A 2DILA 2KROA 3NGPA 1AWXA 4ZNXA 2BTTA 1H3HA 2V1RA 1CSKA 2DE0X 2D0NA 4Z89A 2LMJA 2FG0A 1RI9A 2V1QA 3REAB 1M8MA 1WDXA 4OMOA 1JO8A 5FW9A 2J6KA 1E6HA 3TVTA 2CH4W 3M0UA 2LJ1A 2LZ6B 1GFDA 1K76A 1K4US 1GCQC 1KIKA 1KSWA 2KT1A 2FEIA 4Z8AA 2GBQA 1YCSB 1UJ0A 1N5ZA 2LX7A 2OJ2A 2L3QA 3PVQA 5GJVB 1NEGA 2CT3A 3NHNA 2J7IA 4FSSA 4RTVA 1X6BA 1JQQA 2NWMA 3LH5A 1FYNA 2LQNA 2RQTA 4HVUA 1T3LA 2KBTA 1T3SA 2MCNA 4JJCA 2JXBA 1OEBA 3CQTA 2AZVA 2GQIA 3H0IA 3I5RA 2DLPA 4F17A 2EYYA 2GTJA 2KT8A 4QT7A 4AFZC 2JM9A 1GCQA 1X43A 4K11A 2KNBB 2DBKA 1TG0A 2SEMA 2JS0A 3QWYA 2JM8A 2EGCA 1X2KA 2KXDA 2EPDA 2JW4A 1PKTA 2EGAA 2X3WD 2VWFA 1JXOA 2EGEA 3TSZA 2EW3A 3UF4A 3SHWA 2PZ1A 3H0FA 4J9CA 2DL7A 1HSQA 1K0SA 1X6GA 4RTYA 3H0HA 2QDLA 4AG2C 3THKA 2EYWA 2O9VA 5IHKA 2DNUA 1UUEA 2P4RA 2DVJA 1U06A 2YUPA 1AWOA 1U3OA 1NM7A 1TUCA 5ECAA 5IH2A 1AWWA 1JXMA 2O31A 2A36A 1M3AA 2MIOA 2DL5A 1M3CA 2RPNA 2YUNA 2A28A 2ECZA 1J3TA 5GJWB 3FJ5A 1IO6A 1WX6A 1S1NA 2O2OA 4HVVA 1NYFA 2L0AA 1PRLC 3U23A 2DL3A 3O5ZA 2OI3A 2RQVA 2B86A 2L3PA 1X27A 2FPFA 4AG1C 1Y57A 2LQWA 2RQWA 1QWEA 2C0OA 2X3XD 3VS4A 1SRMA 2DF6A 4J9DA 1ZUUA 2LNHB 1G83A 1NYGA 1GCPA 1I07A 4CC3A 3PE0A 1E6GA 1AVZC 2L2PA 2HCKA 1QKWA 2DMOA 2HSPA 5IXBA 1GFCA 4E6RA 2KGTA 2LJ3A 4Y92A 4M4ZA 1K1ZA 2YDLA 2EQIA 2YT6A 3NPFA 4IIMA 5IXFA 4ORZA 1CKBA 2KE9A 1GBRA 2KRMA 1LCKA 3JV3A 1NG2A 4LUEA 2O9SA 2VKNA 2AKKA 2GTOA 1V1CA 1MUZA 4LN2A 4OMNA 1AD5A 2JMAA 2CUDA 1AWJA 1EFNA 1ABQA 2EVRA 2RQUA 2W10A 1SEMA 4F14A 4A63B 1OOTA 3VS7A 1E7OA 1M3BA 1XOVA 4F16A 1UFFA 2D1XA 3EGUA 1I0CA 1UDLA 2E5KA 4OMLA 2HBWA 3EG3A 2FRWA 2NUZA 1ZBJA 1Z9ZA 1QWFA 1ABOA 4CC4B 1UTIA 3PVLA 2L3SA 3EG0A 2KR3A 4GBQA 4GLMA 2EYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLP C;  2A37 A;  2ESW A;  1WYX A;  4OMP A;  2M0Y A;  2K9G A;  1T0J A;  4CC7 A;  2J6O A;  4CC2 A;  2FPD A;  3UA6 A;  2JS2 A;  4J9B A;  2SRC A;  1UG1 A;  1B07 A;  3M0S A;  4Z88 A;  2VVK A;  3VS6 A;  1HJD A;  2K3B A;  3EG2 A;  2G6F X;  1OPL A;  2YUQ A;  1VYU A;  2CT4 A;  4KRT A;  3VS1 A;  4LNP A;  4D8D A;  2KEA A;  5I11 A;  2O88 A;  1W1F A;  1M30 A;  1G2B A;  3EHR A;  1VA7 A;  2JT4 A;  2LP5 A;  1PNJ A;  2K79 A;  2KYB A;  1UEC A;  3VRY A;  1WA7 A;  1JEG A;  2C0T A;  4RTW A;  1PHT A;  1ARK A;  3EHQ A;  3A98 A;  4EIK A;  2CH4 A;  1WXU A;  2FRY A;  2F2W A;  2YSQ A;  2J6F A;  2DM1 A;  3NMZ C;  4AFQ C;  5IHN A;  3SEM A;  4J9I A;  1QKX A;  2FO0 A;  4R0K A;  1TUD A;  2AKL A;  2H8H A;  4HXJ A;  1W6X A;  2YUO A;  3C0C A;  2AK5 A;  1AZG B;  2ED0 A;  1GL5 A;  1SHG A;  1CKA A;  3R6N A;  2LJ0 A;  1AZE A;  2I0N A;  1BU1 A;  1YNZ A;  1KJW A;  2JMC A;  1QLY A;  1OPK A;  2GGR A;  2C0I A;  2ROT A;  5HCK A;  3VS2 A;  2ROL A;  2CSQ A;  1RUW A;  2DL8 A;  1MV3 A;  4HVW A;  1GBQ A;  4HCK A;  5FWB A;  5FWC A;  4JPB W;  2EBP A;  1K0X A;  2DA9 A;  4JJD A;  1Z9Q A;  3I5S A;  4RTT A;  2CUB A;  2PNI A;  1UHF A;  2K2M A;  1NEB A;  1SRL A;  1K9A A;  1ZLM A;  4DEX A;  2M51 A;  1NLP C;  2BZY A;  4JZ3 A;  1UE9 A;  4RUG A;  2RN8 A;  1U5S A;  3EG1 A;  4RTZ A;  4ESR A;  4AFS C;  1A0N B;  3M0P A;  4RTU A;  2LCS A;  2RQR A;  3KFV A;  2BZ8 A;  2DX1 A;  1X2Q A;  2MOX A;  3IQL A;  2CSI A;  1AEY A;  4OMQ A;  2PTK A;  1ZUY A;  2IIM A;  2D8J A;  1PKS A;  5IHI A;  4J9F A;  2RF0 A;  1W70 A;  1YWP A;  2HDA A;  2RMO A;  3VS5 A;  2D8H A;  3ZL7 C;  1WLP B;  1JU5 C;  4J9H A;  1X69 A;  2CDT A;  1AOJ A;  1WIE A;  3ULR B;  2XMF A;  2W0Z A;  2F2V A;  2J05 A;  1UHC A;  4RTX A;  1ZSG A;  4IIO A;  1KFZ A;  1PRM C;  3VRZ A;  4D8K A;  2JTE A;  1HD3 A;  1GRI A;  2DRK A;  2DBM A;  1OV3 A;  1Y0M A;  4LUD A;  2DYB A;  1FMK A;  1H92 A;  2A08 A;  3REB B;  1WXT A;  1H8K A;  4OMM A;  3M0T A;  1RLQ C;  2DRM A;  1ZUK A;  1BB9 A;  1UGV A;  3RNJ A;  5L23 A;  3I9Q A;  1NLO C;  2RNA A;  3UAT A;  3UA7 A;  4WCI A;  2KYM A;  4JZ4 A;  2HEQ A;  4LE9 A;  4JJB A;  4X1V A;  4DEY A;  2ENM A;  1BBZ A;  1MV0 B;  1WXB A;  5EC7 A;  1WFW A;  3M0R A;  1SSH A;  2F2X A;  3QWX X;  2AZS A;  1UJY A;  1YP5 A;  1WI7 A;  2KRS A;  2K7A A;  3RBB B;  1YWO A;  1PWT A;  1VYT A;  1QCF A;  2CRE A;  1VYV A;  3VS3 A;  2EYZ A;  3VS0 A;  1ZX6 A;  1B3Q A;  2ABL A;  2DJQ A;  4J9E A;  1T0H A;  2ED1 A;  1SPK A;  2BZX A;  3TSW A;  2GNC A;  2KRN A;  3GBQ A;  2OAW A;  1I1J A;  3H41 A;  4J9G A;  3M0Q A;  1BK2 A;  2K6D A;  3I35 A;  2EKH A;  2FPE A;  1YN8 A;  4AFU C;  2J06 A;  1SHF A;  2KXC A;  2DL4 A;  1M27 C;  5I22 A;  2DIL A;  2KRO A;  3NGP A;  1AWX A;  4ZNX A;  2BTT A;  1H3H A;  2V1R A;  1CSK A;  2DE0 X;  2D0N A;  4Z89 A;  2LMJ A;  2FG0 A;  1RI9 A;  2V1Q A;  3REA B;  1M8M A;  1WDX A;  4OMO A;  1JO8 A;  5FW9 A;  2J6K A;  1E6H A;  3TVT A;  2CH4 W;  3M0U A;  2LJ1 A;  2LZ6 B;  1GFD A;  1K76 A;  1K4U S;  1GCQ C;  1KIK A;  1KSW A;  2KT1 A;  2FEI A;  4Z8A A;  2GBQ A;  1YCS B;  1UJ0 A;  1N5Z A;  2LX7 A;  2OJ2 A;  2L3Q A;  3PVQ A;  5GJV B;  1NEG A;  2CT3 A;  3NHN A;  2J7I A;  4FSS A;  4RTV A;  1X6B A;  1JQQ A;  2NWM A;  3LH5 A;  1FYN A;  2LQN A;  2RQT A;  4HVU A;  1T3L A;  2KBT A;  1T3S A;  2MCN A;  4JJC A;  2JXB A;  1OEB A;  3CQT A;  2AZV A;  2GQI A;  3H0I A;  3I5R A;  2DLP A;  4F17 A;  2EYY A;  2GTJ A;  2KT8 A;  4QT7 A;  4AFZ C;  2JM9 A;  1GCQ A;  1X43 A;  4K11 A;  2KNB B;  2DBK A;  1TG0 A;  2SEM A;  2JS0 A;  3QWY A;  2JM8 A;  2EGC A;  1X2K A;  2KXD A;  2EPD A;  2JW4 A;  1PKT A;  2EGA A;  2X3W D;  2VWF A;  1JXO A;  2EGE A;  3TSZ A;  2EW3 A;  3UF4 A;  3SHW A;  2PZ1 A;  3H0F A;  4J9C A;  2DL7 A;  1HSQ A;  1K0S A;  1X6G A;  4RTY A;  3H0H A;  2QDL A;  4AG2 C;  3THK A;  2EYW A;  2O9V A;  5IHK A;  2DNU A;  1UUE A;  2P4R A;  2DVJ A;  1U06 A;  2YUP A;  1AWO A;  1U3O A;  1NM7 A;  1TUC A;  5ECA A;  5IH2 A;  1AWW A;  1JXM A;  2O31 A;  2A36 A;  1M3A A;  2MIO A;  2DL5 A;  1M3C A;  2RPN A;  2YUN A;  2A28 A;  2ECZ A;  1J3T A;  5GJW B;  3FJ5 A;  1IO6 A;  1WX6 A;  1S1N A;  2O2O A;  4HVV A;  1NYF A;  2L0A A;  1PRL C;  3U23 A;  2DL3 A;  3O5Z A;  2OI3 A;  2RQV A;  2B86 A;  2L3P A;  1X27 A;  2FPF A;  4AG1 C;  1Y57 A;  2LQW A;  2RQW A;  1QWE A;  2C0O A;  2X3X D;  3VS4 A;  1SRM A;  2DF6 A;  4J9D A;  1ZUU A;  2LNH B;  1G83 A;  1NYG A;  1GCP A;  1I07 A;  4CC3 A;  3PE0 A;  1E6G A;  1AVZ C;  2L2P A;  2HCK A;  1QKW A;  2DMO A;  2HSP A;  5IXB A;  1GFC A;  4E6R A;  2KGT A;  2LJ3 A;  4Y92 A;  4M4Z A;  1K1Z A;  2YDL A;  2EQI A;  2YT6 A;  3NPF A;  4IIM A;  5IXF A;  4ORZ A;  1CKB A;  2KE9 A;  1GBR A;  2KRM A;  1LCK A;  3JV3 A;  1NG2 A;  4LUE A;  2O9S A;  2VKN A;  2AKK A;  2GTO A;  1V1C A;  1MUZ A;  4LN2 A;  4OMN A;  1AD5 A;  2JMA A;  2CUD A;  1AWJ A;  1EFN A;  1ABQ A;  2EVR A;  2RQU A;  2W10 A;  1SEM A;  4F14 A;  4A63 B;  1OOT A;  3VS7 A;  1E7O A;  1M3B A;  1XOV A;  4F16 A;  1UFF A;  2D1X A;  3EGU A;  1I0C A;  1UDL A;  2E5K A;  4OML A;  2HBW A;  3EG3 A;  2FRW A;  2NUZ A;  1ZBJ A;  1Z9Z A;  1QWF A;  1ABO A;  4CC4 B;  1UTI A;  3PVL A;  2L3S A;  3EG0 A;  2KR3 A;  4GBQ A;  4GLM A;  2EYX A; 
#chains in the Genus database with same CATH topology
 1VQJ A;  4N8X 1;  2WAC A;  2MFI A;  4Y91 A;  2B8A A;  1L1O C;  3FVQ A;  2G9H D;  1EX4 A;  3KBX A;  3M4O H;  1JMC A;  3R6O A;  3QWN A;  4RGT A;  4UY8 C;  2K9G A;  4MN3 A;  3OS1 A;  1T0J A;  1VQ4 T;  1K9M U;  2X4Y A;  4EX5 A;  4IUT A;  4CC2 A;  3JCM X;  4JI8 L;  2JA5 B;  3KJO A;  1JWS D;  3M3Y H;  3J80 L;  4L8J A;  4JBK A;  1YNX A;  2SOB A;  5H1S E;  3EA6 A;  3I4L A;  4XT3 B;  3I56 T;  4DR1 L;  4JS4 A;  3NWS A;  3OS2 A;  2O2L D;  1SNQ A;  5LJ3 g;  2UXC L;  2RK1 A;  5EBD A;  4YY3 Q;  5C44 G;  4J6H A;  1VQN A;  3X3M A;  1M9S A;  1VYU A;  1FYC A;  2YRC A;  3CCE Q;  4K8I A;  1E2W A;  3TP7 A;  4B3T Q;  4BA2 I;  1HNX Q;  4C0G A;  4H13 C;  4QIW E;  4KRT A;  1PYW D;  4BS9 A;  4NXM Q;  2D0P A;  1S72 Q;  2CGH A;  3CKI B;  4EQP A;  2BUD A;  2PUO B;  2O88 A;  3RER A;  3U4V A;  3RES A;  2K5V A;  1VQ5 A;  2LT1 A;  2GVB A;  4HIO A;  1G2B A;  4K0K Q;  4RWS C;  1YJ9 A;  4XQQ A;  1QVP A;  2NUT B;  1S5B D;  2A6H C;  3U9O A;  3UDG A;  2EFI A;  3N52 A;  2M1H A;  1EL0 A;  3DKM A;  1BQQ T;  1QZG A;  3X26 B;  4I65 A;  4KD4 A;  3T53 B;  1F2Y A;  1PHT A;  3EHQ A;  1GUO A;  2K7V A;  2KHJ A;  4A93 H;  4OB2 B;  2KEE A;  1FVI A;  3NMZ C;  3M54 A;  2LFN A;  5IHN A;  1BXT A;  4O6J A;  2FO0 A;  4R0K A;  1PDQ A;  1VQI A;  4A3I H;  4LDV A;  5CCA A;  2F0F A;  4GN3 B;  2R7Z B;  2E4H A;  3J81 j;  4BXX G;  5CKD A;  2K4K A;  3VYU A;  2ED0 A;  4ELY C;  1X9N A;  2NYZ D;  5J39 A;  1CM9 A;  2BE5 D;  4HMI A;  2K01 A;  3NBI A;  3CC2 Q;  4M78 C;  1KQS S;  4UPA A;  3ULP A;  1VMC A;  5IT9 L;  3R6N A;  5LJ5 h;  5IP7 G;  2I0N A;  1BU1 A;  2D5D A;  4FCY A;  4HCE A;  4QGU A;  4YHH Q;  2JMC A;  4JI3 L;  4ALP A;  1PYB A;  3ERS X;  1QLY A;  1OPK A;  1K3B C;  4FXD A;  2Q8T A;  3SEB A;  2ROT A;  2OTJ A;  3HRT A;  4XTC S;  3E5S A;  4GOP C;  2LDM A;  1CTM A;  2GCX A;  2CSQ A;  4FXG C;  1Q86 U;  4A3D B;  3LWU A;  2XN9 C;  3OYB A;  4DAY B;  1D8L A;  3CMA A;  3H94 A;  3SB2 A;  1ONL A;  4BB7 A;  1VQ6 T;  2WSF E;  2B8G A;  4DR6 L;  4HCK A;  5FWB A;  2R7F A;  2RBM A;  2YTX A;  1TWB A;  4PLL A;  1E1O A;  4BI8 B;  3I5S A;  3W1G A;  3MET A;  2ZJP A;  3HEJ A;  4ULL A;  2CUB A;  2NVY B;  4K5X A;  2COY A;  3TBI B;  1UHF A;  2HSE B;  3BYT B;  4QQB X;  1ZLM A;  2JTM A;  2VYT A;  1FD7 D;  4DN4 M;  4JZ3 A;  4F04 B;  1E22 A;  3HZX A;  4KGZ B;  2B63 H;  1Y7X A;  4N4H A;  4AFS C;  3RR5 A;  1I5F A;  3E0J A;  3H3V H;  3OS0 A;  1K73 U;  1UUP A;  5AJ3 L;  2X4X A;  3GDE A;  3OYY A;  3G6E A;  1M90 C;  5D6W A;  1X2Q A;  1AEY A;  4DV1 L;  2CSI A;  3GNG A;  4CDE C;  2LQ8 A;  4OMQ A;  5I21 A;  1CQF A;  4O2D A;  3JB9 F;  2C35 B;  1EY7 A;  2VW9 A;  1Y07 A;  2G3R A;  3KDF B;  3I2Z A;  2RF0 A;  3VDY A;  3JAM L;  3RR6 A;  1D1B A;  3GNF B;  4AMC A;  4B3S Q;  4ZK9 B;  3F2C A;  2R93 G;  1PD0 A;  3Q24 A;  5EJW A;  4CKE A;  1JB7 A;  2F5K A;  1Y14 B;  1QB5 D;  4P2C B;  3EFR A;  4N0A C;  4E7I A;  3K0Y A;  2XTI A;  2X51 A;  3HRZ C;  3VYH B;  4L5G A;  3SWN C;  1PH8 A;  1IL2 A;  5FU7 C;  2MP1 A;  3KYH C;  2PNH A;  1PXU A;  4IKF A;  4FXK C;  3ULR B;  3S1R H;  2MWO A;  4BY1 G;  2LTO A;  1KAB A;  5GAN 8;  5JAV A;  1SNC A;  4X3T A;  3M58 A;  3CCM T;  5KYW A;  1SYG A;  5IYB H;  2DK3 A;  5JJK A;  2IX3 A;  5I2Y A;  5DEH A;  1A0I A;  3RZO H;  3S2H H;  1FX7 A;  4D8K A;  1J8I A;  2EVB A;  1HD3 A;  5I6W A;  1STB A;  1VQ8 A;  3FMC A;  1GHK A;  4M75 F;  1OV3 A;  1Y0M A;  3EGD B;  1AW7 A;  3OYE A;  4LUD A;  3FEW X;  4LF7 Q;  5E4X A;  2KMT A;  4JI4 Q;  3A5U A;  3HFN A;  3REB B;  1WXT A;  4OMM A;  3H0G G;  3G7Z A;  2DRM A;  4JUV A;  1I6V C;  5GAD C;  5IYD H;  2PUK B;  2B2W C;  1UGV A;  2L15 A;  1YNJ D;  2PZT A;  4A93 B;  2IT1 A;  1G6Z A;  1WGS A;  5C4H A;  3I9Q A;  2DXB A;  1NLO C;  3UA7 A;  1DYQ A;  2ZPI B;  1TS3 A;  1XX8 A;  2WFW A;  3RN5 A;  3PF4 A;  3CCV A;  4A3I B;  1CZG A;  3A8H B;  1F2Z A;  3C1E A;  1Q81 U;  1VIE A;  1R9T H;  1R0C B;  2P4T A;  3AT1 B;  3D7S B;  1EY6 A;  1PZJ D;  2EYF A;  3GTM H;  5GAN 6;  3CXC S;  1A8V A;  2NTS A;  4PNY A;  2QEX T;  1PFB A;  5HY6 A;  1BBZ A;  4ZUI A;  2F0V A;  3PSI A;  3CHB D;  3HOW H;  4B3T L;  1KQ2 A;  1HNX L;  3QWX X;  4XTX A;  5K36 G;  4NXM L;  2PI2 E;  2EDG A;  1WI7 A;  2KRS A;  2L89 A;  2K7A A;  1VQP A;  2JNG A;  1YI2 Q;  1Q3L A;  3D6W A;  2N78 A;  1WTW A;  5LMN Q;  1DXM A;  1EY8 A;  2WAQ E;  4O42 A;  3VS0 A;  1MNE A;  2L55 A;  2XGT A;  1HYO A;  5GAM f;  4HSV A;  3EIV A;  2F4V Q;  5AYF A;  1EFW A;  2EWN A;  1B3Q A;  4J9E A;  2EPB A;  4EQO A;  1JJ2 S;  1W2B P;  5J26 A;  4ME7 A;  4DFA A;  4OGC A;  5IYC G;  4L59 A;  2GNC A;  4M75 A;  2NN6 G;  3OSV A;  3BVM A;  4C1N I;  3H41 A;  1TXQ A;  1IHW A;  2F4I A;  3U4Z A;  2DEQ A;  4JRI A;  3CCQ T;  1BK2 A;  2K03 A;  2B63 B;  3I35 A;  2G9D A;  4IUV A;  2PQA A;  4KHZ A;  5LJ5 g;  1G8Z D;  1MD2 D;  2EY5 A;  3S15 B;  2JK8 A;  2RHS B;  4DR2 Q;  3K80 C;  2E65 A;  2J06 A;  4JC0 A;  4GNX C;  1M27 C;  2HQX A;  5I22 A;  1TS4 A;  3OQ5 A;  2KRO A;  1SR3 A;  2ZPH B;  3NEM A;  3WVD B;  4A3G H;  1Q86 C;  5C4X H;  2V1R A;  1VQ4 A;  1HCZ A;  3QKJ A;  1AT1 B;  2OT2 A;  3NXW A;  2DE0 X;  2PVG B;  3MFG A;  1G91 A;  4PJM A;  2LMJ A;  3LGJ A;  5KYU A;  1FNW A;  4LDY A;  1UWV A;  1JE4 A;  1VF5 C;  3I56 A;  3OYD A;  3A56 A;  3RIR A;  1AN8 A;  5LMU Q;  4A3G B;  4LFC Q;  3S1R B;  3TRZ A;  3OYM A;  2RSN A;  2VUM G;  1SE3 A;  2K5F A;  3OBW A;  4JI0 L;  2EQM A;  3A7L A;  2ZPG B;  2K04 A;  2Y4X A;  1LT4 D;  4M7D F;  4A3C H;  4JI5 L;  1XPO A;  1IKL A;  1E6H A;  4M78 E;  4KD3 A;  4C8Q D;  1NMF A;  3RZO B;  1M4Z A;  2CH4 W;  4A3M H;  3X24 B;  3S2H B;  3T1Y Q;  5IOD A;  4KKT A;  1NR2 A;  2TMP A;  1NR4 A;  3G7L A;  3UI2 A;  3K57 A;  3PO3 H;  1K4U S;  2ENB A;  1U9R A;  5CV5 A;  4TRD A;  1B9M A;  4L6T B;  5KYI A;  2Q2U A;  3AEV A;  3S14 H;  3BY7 A;  1CHP D;  4G7H C;  4M77 F;  4Z8A A;  5IN1 A;  4IOA A;  1GUG A;  5D14 A;  2KEN A;  3TSS A;  2HHH Q;  2ICI A;  4OB1 B;  1ILQ A;  2LCL A;  1X3Q A;  1C1A A;  1QVG A;  3PVQ A;  5GJV B;  4ZGJ B;  1QVF P;  3I7F A;  1E3P A;  2F0H A;  3KUP A;  5HK3 A;  1R9T B;  5IGE A;  3VU3 C;  1EIY B;  3S2D H;  1VQ7 T;  1H9M A;  3NHN A;  3LWI A;  2AMC B;  2J7I A;  1EIF A;  2GFA A;  4RTV A;  5FU6 B;  1K8A R;  1XTD A;  3RKW A;  2E3I A;  1X6B A;  3CCS Q;  2N3S A;  4G57 A;  2B8F A;  2NWM A;  4H02 A;  1HQM C;  3SR1 A;  3UDF A;  1RI0 A;  2LQN A;  4LF6 L;  2JA7 H;  3HOW B;  2H5X A;  3A8I E;  3VYG A;  1STH A;  2MCN A;  2DFU A;  2HD0 A;  3BDL A;  4JJC A;  4ZQ3 A;  2V8J A;  3QB3 A;  1AH9 A;  1KC8 C;  3CQT A;  4P71 A;  1A15 A;  1E2V A;  2VQF Q;  2H3E B;  2L3R A;  3OYL A;  3L7Z C;  2MNA A;  4JI4 L;  4LF7 L;  2F69 A;  3A74 A;  4ZAI A;  4YTL A;  4EMK A;  4X64 L;  2QYZ A;  2GTJ A;  4M7D A;  5JEA G;  2B3G A;  3J81 L;  4DBR A;  4JG2 A;  3CPW A;  5CKH A;  3MEW A;  2WB1 G;  5CK9 A;  2JM9 A;  2X6L A;  1N36 Q;  1GCQ A;  1X43 A;  4K11 A;  4A3B H;  2K28 A;  5C3E H;  2KNB B;  3BE3 A;  1Q81 C;  3HOZ H;  1FXX A;  2EIF A;  3QWY A;  3L1A A;  4PJO D;  2K5Q A;  4ILW A;  5KCH A;  2AWN A;  1XNQ L;  3M4G A;  4M7A D;  1JQY D;  1X2K A;  1V1P B;  4XU2 A;  1A62 A;  1ICW A;  4A3K H;  1SMX A;  4GN5 A;  3P8B B;  4OF1 A;  3V2T A;  2IHF A;  3HOU G;  3TP6 A;  3SWN A;  4M77 A;  2Z0W A;  2NB0 A;  5M3F H;  1MKH A;  1LO5 D;  5BN3 A;  3DEO A;  3SDZ A;  2Q8R E;  1R8O B;  1K83 H;  3NPP A;  4IUR A;  4QL5 A;  3JCM Q;  2EGE A;  2DJG C;  2EW3 A;  3UF4 A;  2PVO B;  1KQS P;  1LTR D;  4HJ9 A;  3H3V I;  4DAP A;  2K3X A;  3HOV B;  5BN5 A;  4OO1 G;  2K2V A;  1HSQ A;  3PUY A;  4FIB A;  3H91 A;  5C4X B;  4C8Q B;  4KY7 A;  5KYN A;  3M57 A;  2HKN A;  2O4X A;  2DKG A;  1BI3 A;  1N8R R;  2F0L A;  3H0H A;  2MAM A;  5CV6 A;  1RKN A;  5LMN L;  3CD6 T;  1CZW A;  1QNU A;  2JA6 G;  5AT1 B;  1SN8 A;  2JJQ A;  3CCE T;  2X6G A;  5IHK A;  2F4V L;  2DPP B;  1A3U A;  2IWH A;  3LX7 A;  3GTO H;  1UUE A;  4JJN K;  2IJ0 A;  2MUY A;  3K7A H;  3CCM A;  2BDO A;  2A1A A;  2DNE A;  4NPS A;  2YU9 H;  3VA5 A;  2DVJ A;  2F0T A;  1U06 A;  2NUT A;  3R2I A;  2MI6 A;  1AWO A;  3JB9 G;  1FL0 A;  2AIR B;  1OU9 A;  1S5C D;  1NJI R;  3QR8 A;  1RDP D;  4Y52 H;  2B2W A;  1JXM A;  2ZCF B;  3BDU A;  1S3O A;  1Q7Y C;  1E1T A;  3LNN A;  3UE1 A;  2MIO A;  2FHD A;  4A3M B;  5DAU A;  4DV3 L;  2PQE A;  1MSH A;  4C3H B;  4CKC A;  1IYU A;  1VQK A;  3PO3 B;  2YUN A;  2EYO A;  2ECZ A;  4DR2 L;  5D3I B;  1R4P B;  3BZC A;  3ONA B;  4PL6 A;  1RAI B;  2A69 D;  2WKC A;  2JN0 A;  2XD0 A;  2RB6 A;  3S14 B;  3JCM h;  1NMG A;  1QQJ A;  4HVV A;  5JJL A;  2CP3 A;  2R58 A;  2L8D A;  2EQK A;  3QXE B;  3PO2 G;  1RTO A;  1MND A;  3O5Z A;  4MHE A;  2OI3 A;  3J80 E;  2B86 A;  2X4W A;  4FF1 A;  3I4O A;  1CK1 A;  1X27 A;  1VQ6 Q;  2L9H A;  2K32 A;  2QQ9 A;  3MXN A;  4C5G A;  4DPG A;  3I4M H;  7AT1 B;  3PGZ A;  3RZD H;  4AG1 C;  5LMU L;  3K0X A;  1SE2 A;  1QWE A;  1XTC D;  1K8O A;  4LFC L;  4M75 G;  2QEX A;  1PTO C;  1I50 H;  1QCB D;  4MIU A;  3S2D B;  1W6K A;  3I91 A;  3G71 Q;  3GLX A;  2JN4 A;  2H4O A;  3EN2 A;  1KD1 U;  1XJW B;  1GCP A;  5J3B A;  1HXY D;  4BY7 G;  2JA7 B;  5G3L D;  1AVZ C;  4LMQ D;  3E19 A;  2MGS A;  3T1Y L;  1IRX A;  3OHX C;  4XQ3 A;  3LWE A;  5IE8 A;  2KJX A;  2DET A;  4PJO B;  1PYS B;  1GFC A;  3J7A 5;  1YFN A;  4M7A B;  1RF2 D;  2LJ3 A;  4J7F A;  3K5L A;  1RAA B;  4NL2 A;  1D0Z A;  4NL3 A;  4G4K A;  3E9I A;  4I7Z C;  2YDL A;  2RJC A;  2EQI A;  1ASZ A;  4QJF A;  1IYV A;  1Z9F A;  2ZJR A;  1O7Z A;  3EFS A;  4ORZ A;  3TRE A;  4GNX A;  2OAU A;  3MCA B;  2IHE A;  4DR4 L;  3GTJ H;  1BBU A;  4KGX B;  4L63 B;  3CCJ Q;  5KE2 A;  4Y28 E;  3CCR Q;  1U4L A;  1EYC A;  3Q23 A;  1LCK A;  2VZA A;  1ZKO A;  2ZTE A;  5C3E B;  4A3B B;  3CCQ A;  3HOZ B;  1B53 A;  2VKN A;  3KDF A;  1GKH A;  5A0G A;  2IX0 A;  2K50 A;  2R92 B;  1B44 D;  1MUZ A;  2IPO B;  3JC6 6;  4OMN A;  4A3K B;  4DKA C;  2CUD A;  5FK9 C;  3HP9 A;  1KL9 A;  5FJ8 G;  1XNI A;  4KUD K;  5M3F B;  1W4S A;  4RG8 A;  4QW2 A;  1F2M A;  1K83 B;  2ALY B;  2L1B A;  3CXC P;  1N34 Q;  3TP5 A;  1Q82 U;  2LQK A;  5GMK i;  5IP9 G;  4ZUJ A;  1E7O A;  3JCM P;  3I70 A;  4PG3 A;  1AEX A;  4OB3 B;  2LX9 A;  3CP0 A;  2EYJ A;  1IBM Q;  2M9U A;  1I0C A;  4NXN Q;  3IFD A;  1X6O A;  2HBW A;  3H09 A;  4LF4 L;  2D0O A;  2NUZ A;  4JYA L;  1W3S A;  3GTO B;  1QWF A;  1ABO A;  3ZFJ A;  4CC4 B;  4F88 A;  2NTT A;  1XJV A;  1UGS B;  1QWY A;  4QY7 A;  1N36 L;  1PRT C;  2YU9 B;  3EG0 A;  2I07 B;  3W2D A;  2K52 A;  3DWA A;  4G7Z C;  2LNV A;  4GLM A;  3BFM A;  1XMO L;  3PMF A;  4JVZ A;  5T1G A;  1RLP C;  1JJ2 P;  2ESW A;  1KRT A;  1WYX A;  2K1B A;  3PMT A;  1WVL A;  1G3W A;  3E1S A;  1VUB A;  2RI2 A;  2EOT A;  5C3W A;  1OUL A;  3PIP 3;  2M0Y A;  3GIB A;  4A3F H;  4EGV A;  4R4T A;  4CC7 A;  1EWC A;  4IPG A;  3MHB A;  2KAF A;  2UUC L;  3CW2 C;  3FDT A;  1MGS A;  4IN3 A;  1V9P A;  3JAM E;  2VY3 A;  3T1H Q;  3QG1 A;  2JS2 A;  1YJW A;  2ZT9 C;  4AQY Q;  4QVC A;  1UE6 A;  2HIX A;  3FPU B;  3S1N H;  2MK5 A;  3M4Q A;  3KK7 A;  4M7D G;  5LJ3 h;  1HJD A;  1JOO A;  2OWO A;  2K3B A;  2RI5 A;  4F87 A;  3K7U C;  3PTA A;  1OXV A;  3I4M B;  5NUC A;  1LTG D;  3RZD B;  4DR5 Q;  2CT4 A;  1VQ7 A;  3VS1 A;  4C0F A;  3STB C;  4D8D A;  2A68 C;  2FL7 A;  4JLI A;  2EJM A;  5COY A;  1XNR Q;  4H0L C;  1RAD B;  1W1F A;  1M30 A;  2QGF B;  4C0D B;  1YI2 T;  1CUK A;  2M9V A;  3FKI B;  1J9O A;  1EU4 A;  2JA5 G;  4C56 C;  3MEU A;  2F0D A;  1TWH B;  2JT4 A;  1HZB A;  4DQ2 A;  2K79 A;  2KYB A;  2FMM A;  3UWN A;  5D65 A;  5HKC A;  4QF4 A;  3T16 A;  3VR5 A;  2XIC A;  1ARK A;  1TWG H;  2HD3 A;  4PZ8 A;  1EIH A;  2JVV A;  3M56 A;  1QOH A;  3JCM g;  4BBR H;  1I5O B;  2J6F A;  2DM1 A;  2MMP A;  2P0K A;  2CWP A;  4MZ9 A;  4U67 3;  1QKX A;  2WV6 D;  4DV7 L;  4RG2 A;  1PH1 A;  1WHK A;  3C0C A;  2A74 C;  1SHG A;  1WTH A;  5I6Y A;  3A8L B;  4LF5 L;  1WHL A;  1Q1E A;  2MJ8 A;  2DD5 A;  1CKN A;  1YNZ A;  4TSS A;  1KJW A;  2WAQ B;  3VA7 A;  2HQL A;  2KCN A;  3HFZ B;  2C0I A;  4WFN 3;  5HCK A;  3VS2 A;  3NUC A;  2D9T A;  5LJ5 j;  1OZ3 A;  2BH2 A;  2ROL A;  1EQR A;  3O13 A;  1D2B A;  4FM4 B;  2RK2 A;  1IW7 D;  1RUW A;  4G7O C;  1JCK B;  1VF7 A;  2A5H A;  4RAU C;  2VAS A;  3HG9 A;  4HVW A;  2F3I A;  2R7Z G;  1KAW A;  4JPB W;  1NBE B;  2EBP A;  2Y90 A;  1K0X A;  2DA9 A;  2P5Z X;  1Z9Q A;  3PNW C;  2F0U A;  2B2T A;  4LF9 Q;  1YBY A;  4B3R Q;  2R7D A;  3KJP A;  1BI1 A;  1CQV A;  2NZH A;  3M9B A;  4HA8 A;  5C0X J;  1SRL A;  4AYB G;  1K9A A;  5JEA J;  4C3J H;  1TTH B;  2L4N A;  4KY5 A;  1I4K 1;  4DEX A;  1UE9 A;  1S72 A;  2RN8 A;  4FYY B;  5EAY A;  1Y1W G;  1ROD A;  1BUV T;  2CQO A;  3GQB A;  2ZZD A;  1ZSZ B;  3M0P A;  2RO0 A;  2CKK A;  4QQG A;  1M1K R;  1UEA B;  2PO4 A;  4DGZ A;  5GAE C;  2C9O A;  2KUM A;  4HAE A;  1VQO Q;  3KFV A;  1IHZ A;  4ODG A;  3IQL A;  3RKY A;  4ZCK A;  4A3D G;  5GAM d;  3MA2 B;  2PTK A;  3ZEH A;  2VV5 A;  5CV8 A;  2CW0 C;  4RGO S;  5CBE E;  4IUP A;  2K3Y A;  4JRQ A;  1ZUY A;  3CCL Q;  2IIM A;  1YZ6 A;  3E0E A;  3NEL A;  4RCO A;  1NY4 A;  1QP3 A;  4J9F A;  2HCI A;  2UXB Q;  4C3I H;  4A3F B;  1CSP A;  2E70 A;  3MXU A;  1Y8O B;  3S17 B;  2HDA A;  2FFK B;  4J1M A;  4C8Q F;  2D8H A;  1C48 A;  2IPK D;  4EMG A;  1NSN S;  3AMU A;  1JU5 C;  1A3T A;  5CR3 A;  2EYM A;  1P92 A;  2KI7 A;  1SKU B;  2VB6 A;  3H9N A;  4C0Z A;  1SRO A;  4A4G A;  2VGN A;  3CC2 A;  1LTS D;  1HH2 P;  4POF A;  4JI7 Q;  2QDB A;  2I5M X;  3S1N B;  4L6V 5;  3INZ A;  3KBG A;  4RTX A;  3N6R A;  1ZSG A;  4JBW A;  1TII D;  1KFZ A;  2PW7 A;  4B3M Q;  3S1M B;  1Y1V G;  2FIN B;  1MSG A;  2I5H A;  4NXN L;  1PRM C;  5GQO A;  5ELF A;  3I55 Q;  1Q1B A;  3CU7 A;  3K5O A;  4ZN3 A;  2DTH A;  2JTE A;  4R1J A;  4CDD C;  2PNR C;  1GRI A;  2DIQ A;  2DBM A;  2QA4 Q;  2I5L X;  1L0W A;  1FJG Q;  1PLF A;  1I3Q H;  4WJW A;  1CA5 A;  1FMK A;  1ZYR D;  2D62 A;  2E12 A;  2JYO A;  5GAN 5;  4K6L A;  2A08 A;  1GM5 A;  1PH4 A;  1W2B A;  1QMC A;  2FMC A;  4M75 C;  1TVX A;  3NE5 B;  1JR0 D;  1JB0 E;  4K6D A;  2P0P A;  1RLQ C;  4OIK A;  2BE7 D;  4K2K A;  4C92 D;  1TWG B;  2B2Y A;  3TU4 K;  1YEZ A;  1PSE A;  1C7Y A;  4XQJ A;  3T51 B;  3UAT A;  4BBR B;  2JUF A;  3FJP A;  4DBH A;  2HUG A;  1PD1 A;  2KYM A;  2L5T A;  4GS3 A;  4MML A;  2WSE E;  2MWP A;  1OTC A;  4AQY L;  2ID0 A;  1X32 A;  2XSC A;  1S5F D;  5E7N A;  4X1V A;  2K75 A;  4YWM A;  4LFA Q;  1MGQ A;  1BBX C;  3CD6 Q;  4LDU A;  1EY5 A;  1DON A;  1WCM H;  5A0L A;  1WXB A;  4LUV A;  1A63 A;  1WFW A;  4HCS A;  4KUI A;  1K8G A;  3M0R A;  4FYV B;  4FYD A;  1SSH A;  4DR5 L;  2RDG A;  4PJN A;  4BE0 A;  3OSS C;  1SNM A;  4MTK A;  2N55 A;  1PH6 A;  1XNR L;  1PCX A;  1X3F A;  2F0M A;  1B34 B;  5FU7 B;  1ZA1 B;  3RBB B;  1YWO A;  2V4D A;  1PWT A;  1VQC A;  1QCF A;  1BKB A;  4PJO F;  1D5M C;  3S9W A;  4A93 G;  2BA1 A;  5EG2 A;  3OY9 A;  4M7A F;  3VS3 A;  1LTL A;  2EYZ A;  5GAN h;  2M2L A;  5J1Z A;  4OWX B;  1PMR A;  2CP7 A;  2A6E D;  2LKV A;  1X65 A;  2JQO A;  2XWB B;  4AH6 A;  4X65 Q;  2HBP A;  1BBW A;  1T0H A;  2DER A;  1LTA D;  2NBF A;  2F0O A;  4DV4 Q;  1TWF H;  2CFM A;  3ZBD A;  3MP1 A;  2BZX A;  4IFD J;  3TSW A;  3S3N A;  5FLM G;  1MIU A;  1EQQ A;  2KRN A;  2QXF A;  3GBQ A;  2F1L A;  2OAW A;  5FLX E;  3J81 E;  1I1J A;  3L2Q A;  2GN5 A;  3HSB A;  4M1U B;  2B39 A;  3GTK H;  4BBS G;  2K6D A;  5GAN 3;  1KNE A;  3OB9 A;  2EKH A;  2FPE A;  5M3M H;  3OMC A;  2K5N A;  4L5Q A;  2Y4Y A;  3KF6 B;  4PK4 A;  1OX9 A;  4AFU C;  1WJQ A;  3M59 A;  1SHF A;  1WJR A;  1DGS A;  2PMZ E;  4F7U B;  5BR8 Q;  2DIL A;  1PZK D;  5JOB A;  4PFO A;  4KH0 B;  3SK4 A;  1AWX A;  3EG9 A;  3QOJ A;  4RMF A;  1I4Q A;  3I8Z A;  1QVF A;  1CSK A;  2ZJQ A;  4C3I B;  3J80 c;  4WRD A;  4Z89 A;  5GRO A;  3ND8 A;  3RMS A;  3P75 A;  2FG0 A;  3GV6 A;  3MFY A;  5ELD A;  3F2B A;  1RI9 A;  4ZKC B;  2DXT A;  4MZP A;  1IBL L;  1IXR A;  5CR2 A;  3S3M A;  3K59 A;  2YRD A;  2B63 G;  4BXX H;  3J80 i;  1YIJ Q;  3G71 T;  1J6Q A;  1WDX A;  3G4S T;  4OMO A;  1KK7 A;  5GAH C;  2J6K A;  1SNO A;  3X28 B;  1YHA A;  4C92 B;  5IP7 H;  4JDS A;  3TVT A;  2ZXO A;  2DIG A;  1XMQ Q;  2RDF A;  4EMK C;  1TWC H;  1X56 A;  4O0A A;  3C1F A;  4APV A;  2LZ6 B;  4B6M A;  1YI2 A;  4M7D C;  2N88 A;  1U4M A;  3JCM e;  1RAF B;  3DB4 A;  4ELZ C;  4BAC A;  1M90 R;  3ZJY C;  2RHY A;  4QKU A;  1GJX A;  4A53 A;  1I3Q B;  1FNU A;  1Z7T A;  2GA4 B;  1GCQ C;  3M4O B;  4A3G G;  1BCP F;  3A0J A;  2CZ0 B;  2FEI A;  3LGF A;  1Q90 A;  2J0T D;  2XG8 D;  1SYD A;  5IY0 A;  2BH8 A;  1BIB A;  1Y96 B;  3CCJ T;  5DM6 3;  3CCR T;  2GBQ A;  1Q8I A;  1YCS B;  1LTT D;  2V8K A;  1N5Z A;  5M5W H;  2ES2 A;  5G3L F;  5IYB G;  2L3Q A;  4M77 C;  4HID A;  1G8X A;  1G2T A;  1EOT A;  1ET9 A;  1OXS C;  1SNP A;  1STA A;  4NMZ A;  4C5I A;  4DV5 Q;  3BG3 A;  1TS5 A;  2CT3 A;  2ASB A;  3QPH A;  1HTP A;  5KYX B;  2QEJ C;  5CC4 A;  4FSS A;  2E64 A;  3CRL C;  4B3M L;  3QYG B;  1KQS A;  2PZU A;  1QJO A;  5C6A A;  1KQ1 A;  2ZM6 Q;  1HR0 L;  3P8H A;  4KJO A;  3KFU A;  4DUY Q;  4ABN A;  4O5V A;  3M85 A;  4RKL A;  5IYD G;  1KDA A;  1FJG L;  1OEB A;  2A3L A;  1L2F A;  4OWW B;  4HIM A;  1KC8 U;  3EJI A;  4FT2 A;  1Y8P B;  2GQI A;  2XKO C;  3M4Y A;  1IZ6 A;  2DLP A;  3A8O B;  1GOZ A;  3MXG A;  2EYY A;  3Q0A A;  1Y1W H;  3MPU B;  2OX7 A;  3MP6 A;  3AHU A;  1K9M R;  4MDX A;  5CIU A;  5EQ0 A;  1JBM A;  1E2Z A;  2KT8 A;  2B2V A;  3WOE A;  5CBA E;  2NUP B;  2LXJ A;  4AFZ C;  1TWF B;  2CVR A;  4LNQ A;  3OYF A;  2WIN B;  2OQ0 A;  2EE1 A;  1H9R A;  1M2V B;  2BDN A;  4JOI A;  2QDY B;  2OXP A;  4DNR B;  3NTH A;  4OMF B;  5CQY A;  5IGD A;  1QCN A;  5C5L A;  3J7Z C;  2Z0S A;  3HOW G;  3GTK B;  1LT5 D;  4YY3 L;  2EPD A;  5M3M B;  2JW4 A;  1HFN A;  3MAQ A;  1O7Y A;  1Y69 U;  4NOY A;  1XQH A;  2CWA A;  3QZ5 B;  3NEN A;  3FRN A;  1D3B B;  2DUD A;  3V8J A;  3M53 A;  2Y0S B;  1PHJ A;  2UU9 Q;  3TSZ A;  3SHW A;  1E24 A;  4FYW B;  2PZ1 A;  4M75 E;  4Q5W A;  3JAM c;  4A3E G;  3URY A;  2DL7 A;  5JJZ A;  1K0S A;  3H0G H;  1ZBX A;  1F9S A;  4K0K L;  4RTY A;  5GAN g;  1J5E Q;  3CME Q;  4RG1 A;  1KG1 A;  4AG2 C;  3S1Q H;  3ICE A;  3THK A;  1G5V A;  3BS1 A;  1WFQ A;  3JAM i;  3OBY A;  1FNV A;  1WI5 A;  2Z8L A;  3EBE A;  4KLK A;  1VQE A;  2AHJ B;  1M4V A;  2DNU A;  4P72 A;  3T4A C;  3H6M A;  4X65 L;  3HP3 A;  2K33 A;  2JZ2 A;  3CC7 A;  3CCS A;  1MMA A;  4DV4 L;  5FOB B;  2HQE A;  1DM0 B;  1ZEQ X;  3EH1 A;  2QQB A;  5CQX A;  3A55 A;  3EFO B;  2HCC A;  3TS0 A;  4H44 C;  4TVR A;  3GOX A;  2QK0 A;  1TWC B;  3JRZ A;  1SBB B;  1NTG A;  1NAP A;  1Q7Y U;  5KND A;  4CDC C;  1Z47 A;  1AE2 A;  4C1N K;  3HOV G;  1M3C A;  1QVC A;  2L0C A;  3T9N A;  5C4X G;  4QVD A;  4X62 Q;  4C8Q G;  5D3D A;  4YHH L;  2ZGW A;  2LMC B;  3B6Y A;  5IOC A;  5IAY A;  3BYY B;  2O2O A;  5BR8 L;  5LJ3 e;  2MPX C;  1NYF A;  3K58 A;  4QQ6 A;  2DXC A;  1Q86 R;  1LUZ A;  4LF8 Q;  3KXT A;  2UUB Q;  4ME5 A;  1SSF A;  5CAI A;  3U23 A;  2Z9H A;  2DL3 A;  3T56 B;  1U4R A;  3QOL A;  1LAC A;  3OTO Q;  5M5W B;  3LW5 E;  1BCO A;  3VV0 A;  3E9F A;  3QUI A;  4A3C G;  4P5N A;  1A2U A;  2M00 A;  2NN6 H;  3C4S A;  4JS5 A;  2RA2 A;  1B7Y B;  2UXD Q;  3G48 A;  4KY6 A;  1FR3 A;  2X3X D;  3S24 A;  4A3J H;  2BA0 A;  4A3M G;  4F7X A;  2F0W A;  3UE0 A;  1G83 A;  3HTR A;  4C3H G;  3P20 A;  3CXC A;  4O1N A;  3RLN A;  3PO3 G;  4LXC A;  1NYG A;  1H9J A;  1GUW A;  3MXP A;  4BI4 A;  3GV3 A;  4CGY B;  1K73 R;  4DBF A;  1DOK A;  1BIA A;  1WPY A;  4N4G A;  1XMQ L;  1N9S A;  2CZ1 B;  2L2P A;  1F77 A;  4M8A A;  4BY6 C;  4EPC A;  4RGM A;  2DMO A;  2DYI A;  1SE4 A;  5GAG C;  5IXB A;  1HK9 A;  3JSC A;  3CPW S;  5LHY 1;  3MEV A;  5DM7 R;  2ZPF B;  1GHJ A;  1H9S A;  2EAY A;  3MKD A;  2BE5 C;  4IJH A;  1AZQ A;  3D6C A;  5D6X A;  2K4Y A;  3G1J A;  3NPF A;  4IIM A;  1X54 A;  4PZ7 A;  1ICF B;  1WHJ A;  2E5L Q;  4E47 A;  3J7A F;  3QYH B;  4B3S L;  1B1Z A;  1CKB A;  1JRI A;  4KGV B;  1RHP A;  3PIO 3;  1TT2 A;  4RKB A;  2KRM A;  1VQH A;  3P7J A;  4PMW A;  4XYQ A;  1VQO T;  2MO0 A;  1DZ1 A;  2ZTC A;  4FF4 A;  1I81 A;  1NG2 A;  3LLR A;  2PCF B;  4FW2 A;  2YYZ A;  4J8Q A;  1WQ7 A;  5GMK h;  4LJZ C;  4PMB A;  3U50 C;  2VQE Q;  5D7U A;  2JA7 G;  3D8G A;  2DTI A;  2OQK A;  4E7S A;  1A3V A;  4YIJ A;  3SFM A;  3GTM B;  2O5J C;  3CCL T;  1UGP B;  2R6G A;  4LN2 A;  2BCO A;  2SDF A;  1PV4 A;  2JMA A;  4PJO G;  3LX0 A;  4PV1 C;  3W3A A;  4M7D E;  1EFN A;  4Z02 A;  4M7A G;  2NUC A;  1PH5 A;  5EPK A;  1HHV A;  5GMK m;  1SG5 A;  4VUB A;  4FDB A;  1X3G A;  2A8V A;  3D4W A;  4A63 B;  4DOW A;  1AZP A;  4DU9 A;  2R5A A;  1HNW Q;  4E7H A;  4L5R C;  5BN4 A;  3EGX B;  3H0G B;  3JCM b;  1VQ6 A;  2E6N A;  1XOV A;  2A73 B;  1VQ9 Q;  4F16 A;  5C3E G;  4A3B G;  3M3Y B;  4E7Z A;  5E4W C;  4DV0 Q;  1KDC A;  1HFG A;  3HOZ G;  1Q46 A;  3I73 A;  1I6H H;  1Z6H A;  3EG3 A;  4KUL A;  4XU0 A;  4OON A;  5EPJ A;  3I55 T;  1AP0 A;  1ZBJ A;  2JJ9 A;  4M77 E;  1Z9Z A;  2RI3 A;  2LSS A;  3G71 A;  3KLR A;  2H1E A;  5FRO A;  3VR4 A;  2QA4 T;  1DCZ A;  4CHT B;  4A3K G;  2R92 G;  1EYD A;  2L3S A;  1EEF D;  1JIC A;  2Q2T A;  2O5I C;  1SMY D;  2LRQ A;  1EY0 A;  2RSO A;  2WKD A;  3OW2 S;  5M3F G;  1V29 B;  3C95 A;  3HOY H;  3FHW A;  4OHJ A;  1UGR B;  2A37 A;  1C9O A;  4F7U F;  1LT3 D;  1SSO A;  2KOL A;  4ZTF A;  3STB D;  3H3V C;  1N9W A;  1NZ9 A;  1D5X C;  3KF8 B;  4P74 A;  1MJE A;  2J6O A;  1ET6 A;  1EYA A;  1A2T A;  5EKI A;  2FPD A;  1K8M A;  3OSO A;  2PU9 B;  1UGQ B;  3TQY A;  4CBV A;  5C0X H;  3CCJ A;  3CCR A;  4J9B A;  2NZO A;  5JEA H;  1WNL A;  2SRC A;  3L2W A;  4NS5 A;  5JJI A;  1B07 A;  4FYX B;  1XWE A;  2M16 A;  1N33 Q;  2HZY A;  4Z88 A;  2VVK A;  3VS6 A;  2EXZ A;  4KN4 C;  3EG2 A;  1KDB A;  2QKI C;  3ZYY X;  4KKS A;  4X66 Q;  2KVM A;  4HIK A;  2YUQ A;  2E75 C;  3KOJ A;  1OO9 B;  3Q6S A;  3IL8 A;  4C92 F;  4A3J B;  3TME A;  5LJ3 j;  5I11 A;  3PT9 A;  4J6X A;  4A75 A;  1NE3 A;  4JI6 Q;  4JV5 Q;  2B2T C;  3HOU H;  1Y8N B;  2C06 A;  2Z6K C;  4QMG A;  5KRU A;  1GD7 A;  3NTI A;  5IWA Q;  4AYB E;  3EHR A;  3CCU Q;  1YNJ C;  1PNJ A;  1HA5 A;  3DMU A;  1AFP A;  2QG9 B;  1UEC A;  2VL6 A;  2QCP X;  3M55 A;  4FT4 A;  1JEG A;  4KHV A;  2C0T A;  4RTW A;  1BF4 A;  1LT6 D;  4OO1 H;  4ZGE B;  3PUV A;  3SK8 A;  4X62 L;  5KGU A;  3OYN A;  1WXU A;  2RD1 A;  1RD9 D;  1B8A A;  3TZU A;  5ELO A;  3N5B B;  4AFQ C;  3SK5 A;  3NQI A;  4DV2 Q;  4GLX A;  3OW7 A;  4QIW B;  1TUD A;  5FLX c;  3J81 c;  3I4M G;  2H8H A;  3KF6 A;  2QW7 A;  2UUB L;  3L42 A;  2QQS A;  1AZG B;  5A0D A;  1NJI C;  1GL5 A;  4F7U A;  4UP8 A;  4DAM A;  4N9T A;  3OTO L;  3HKZ E;  2YTV A;  1KHI A;  3FKI G;  3J81 i;  2LJ0 A;  2EJ9 A;  1KLU D;  2CS7 A;  1VQB A;  5KCO A;  2KA7 A;  4A4I A;  4FNF A;  3DHQ A;  1RIP A;  5LJ5 d;  2NLU A;  2XVS A;  4K14 A;  2GGR A;  4DAY A;  5FU6 C;  4BD3 A;  2DXU A;  3G4S Q;  2EY1 A;  1SJH D;  3ITP A;  3ULJ A;  1ILP A;  3OIP A;  1MMD A;  3NTK A;  4J6W A;  1B50 A;  1BYM A;  1TUG B;  2DL8 A;  3OYH A;  2JA8 H;  1WTP A;  1JE5 A;  3BZD B;  1LM0 A;  1EZZ B;  4V19 0;  4JJD A;  2OTL T;  1BDO A;  1T5X D;  4NW2 A;  1YIJ T;  4C92 A;  1D1A A;  5JVH 3;  4C5E A;  4I7A A;  4RHR A;  1WJS A;  3F2U A;  4RKU E;  1NEB A;  2CZ6 B;  4PFP A;  5LJ5 e;  3CC4 T;  2BZY A;  2CCZ A;  4ME3 A;  3SXH A;  1U5S A;  2E5L L;  1JOQ A;  1K3R A;  3TEE A;  3GP8 A;  3O8V A;  1A0N B;  2HHH L;  4E7L A;  5CV7 A;  2HDM A;  1R4Q B;  2RQR A;  5GAM g;  2IL8 A;  4JI2 Q;  4OXP A;  1QUQ B;  3AYH B;  2B2Y C;  1UB4 A;  2DX1 A;  1H95 A;  2VXW A;  2VQE L;  3HOY B;  3MZ5 A;  2ZAE A;  5LJ3 f;  5M5Y H;  5IT9 E;  4BY7 H;  1D0X A;  1EZ8 A;  4CI0 C;  1HUN A;  1I4G A;  2D8J A;  4EMH A;  5IHI A;  1UE5 A;  1YHQ Q;  1XPU A;  1CKM A;  3CQZ H;  2BKD N;  1ESR A;  4GZY C;  2NYS A;  2RMO A;  3ZL7 C;  1WLP B;  4B9W A;  1X69 A;  2CDT A;  1OXU A;  2RHZ A;  1L0Y B;  1HUM A;  1AOJ A;  2VXF A;  2FHT A;  4IFD H;  4Y7N H;  2LVM A;  2VB3 X;  4C8Q C;  3MWY W;  1YCY A;  4IJL A;  2VQF L;  3M4P A;  5L8R E;  1R77 A;  2J05 A;  4R55 A;  4IIO A;  5C4J H;  4A4F A;  1M2O A;  3EGD A;  3X3N A;  3TCJ A;  3RKX A;  4FO2 A;  5M5X H;  2QF7 A;  4DR7 Q;  3VRZ A;  4R4I A;  1LVK A;  3K7A B;  1HQR D;  2NVX H;  2E6Z A;  2DRK A;  1JWU D;  1OYX A;  2DNC A;  2I2L A;  2DYB A;  2PVD B;  1IHV A;  4A3F G;  3CEY A;  4AT1 B;  4IQZ A;  3HRS A;  1L0X B;  3AFP A;  2QTV A;  2XWJ B;  1VQK Q;  4L5T A;  3FB9 A;  2DZ9 A;  1LYL A;  1BR9 A;  3M0T A;  4PJJ A;  1V1O A;  2F0J A;  3HOX H;  2NVT H;  2VGM A;  2NVQ H;  3HGB A;  4PFZ A;  2B2U A;  3RNJ A;  5L23 A;  3OYK A;  1XPR A;  2RKS A;  2A6H D;  4JLG A;  5CKF A;  5ELN A;  1BNZ A;  5K5P A;  4DK0 A;  5GAO l;  4JZ4 A;  1VIF A;  1JJG A;  2HEQ A;  1B3A A;  2KBN A;  2JP1 A;  3HKS A;  3GTQ H;  2K5H A;  4JJB A;  3U58 A;  1N33 L;  1YNN C;  4DEY A;  3HS0 C;  2ENM A;  5KNB A;  1ACM B;  1MV0 B;  2YWW A;  2AWO A;  1PA6 A;  5EC7 A;  3L2Z A;  3Q1J A;  3NFC A;  3CCL A;  1DJR D;  3LYI A;  4PQX A;  1I50 B;  3NHH A;  1CHQ D;  4JI8 Q;  3FPP A;  1B9N A;  4HMJ A;  3ERO A;  4E7K A;  1UJY A;  4M78 D;  1PH7 A;  3T13 A;  2IY5 B;  1PSF A;  4XTY A;  4JV5 L;  2KCC A;  4ZYS A;  3CME T;  5TSS A;  2UXC Q;  2VUB A;  4BBR G;  1KNA A;  1O9S A;  3OPO A;  2E5Q A;  4RFB A;  4BE2 A;  2JA8 B;  2FVU A;  3QZ9 B;  4A54 A;  4PJO C;  2ABL A;  4M7A C;  3EFO A;  1E7Z A;  1ESF A;  5C4Z A;  2X9H A;  1SPK A;  2FYK A;  4DAV A;  1SND A;  5GAN j;  1HNZ Q;  3I55 A;  3A8J E;  3OWE B;  1U1S A;  2QA4 A;  4K5V A;  3GTJ B;  2CP6 A;  3CPW P;  4II1 A;  3G6E T;  3F70 A;  1L1O B;  1GUT A;  4IAL A;  2CP2 A;  2PW5 A;  4GN4 B;  2QQA A;  4KJN A;  4XDX A;  2H3J A;  4XTW A;  3H6Z A;  4J7I A;  3QBY A;  2RCF A;  3AQQ A;  3NBH B;  2JA5 H;  2LS0 1;  1KD1 R;  5M5Y B;  2PQA B;  3TEH B;  4BY7 B;  2F52 A;  4ZNX A;  5CGK A;  1JC7 A;  4OGE A;  2N49 A;  2XHC A;  1T5E A;  1VQL Q;  1I4P A;  3LH0 A;  3CQZ B;  2D0N A;  4HTH A;  5F2D A;  5A2Q L;  1PVO A;  5I2S A;  1JJC B;  5KH6 A;  4PKC C;  4LD9 K;  2V1Q A;  1ZA2 B;  4C3J G;  2E2J H;  1TSF A;  3REA B;  4QB4 A;  2GQV A;  4FU6 A;  1YJN Q;  2Z6K A;  4CKB A;  2EKO A;  3CD6 A;  1YVC A;  4Y7N B;  1CI3 M;  2OEO A;  4A4K A;  1UE7 A;  5KYU B;  3CCE A;  1M8M A;  5EBC A;  4LD6 A;  3DEP A;  1D5Z C;  5JPN C;  1N27 A;  2WSC E;  5M9O A;  1SEB D;  1JO8 A;  4M77 D;  2V1C C;  3K6O A;  5C4J B;  4F7U G;  1VQ8 T;  3GTG H;  5KNC A;  5C0X I;  5M5X B;  1IRE B;  1RAC B;  2P0Q A;  2CKZ B;  3M0U A;  2A69 C;  2LJ1 A;  2NVX B;  4HSP A;  2EJG A;  1X3E A;  1HR0 W;  2B2V C;  2YV5 A;  4JI2 L;  4C3I G;  1K76 A;  4DK1 A;  2F0P A;  1KIK A;  1O75 A;  5FRN A;  1KSW A;  4RH6 A;  4JOI C;  2KT1 A;  3D0F A;  2RJD A;  4ZRZ A;  4X3U A;  4A3L H;  2NWG A;  2NVQ B;  3HOX B;  2NVT B;  1NUC A;  3OW2 P;  3PUW A;  1TWA H;  1Q82 R;  4YCW A;  1UJ0 A;  2LX7 A;  1BCP C;  3K81 C;  5FO7 B;  1JOR A;  2OJ2 A;  1N34 L;  5AJ3 Q;  3FRP B;  4M78 B;  4DXG A;  3AB9 A;  3RLO A;  1M1K C;  1K28 A;  4C92 G;  3C3L A;  3TQ7 P;  4DV1 Q;  4UHV A;  5COR A;  4JRP A;  2E2H H;  4CDF C;  4J83 A;  3S16 H;  3TS2 A;  3FC3 A;  1IBM L;  3GTQ B;  3DLM A;  2GFU A;  1WOC A;  4OO1 I;  4K5W A;  5KIX A;  2EZV A;  1NNX A;  2AQ1 B;  4GOP B;  3GF5 A;  3TP8 A;  3I4N H;  2F0I A;  3UDX A;  2RQT A;  4IO9 A;  1T3L A;  1MBY A;  2LXK A;  3AU7 A;  1T3S A;  1MMG A;  1GUS A;  5C3X A;  3JB9 J;  2XIW A;  1D7Q A;  2F0Q A;  1QG7 A;  1VQM Q;  2JXB A;  4C0D C;  2HAX A;  4OL7 A;  5L37 A;  4XU1 A;  1MHW C;  1MI2 A;  2P84 A;  3OYI A;  3VR2 A;  5GAO q;  4B9X A;  1VQ9 T;  4BDY A;  3H0I A;  4HT8 A;  3I5R A;  4E2F B;  2ATW A;  3VYR A;  1C0M A;  4F17 A;  4DR3 Q;  5LJ5 f;  5DM7 3;  1YIJ A;  4QT7 A;  1YIT Q;  1SYB A;  3ERQ A;  1F9P A;  1V1P A;  2HMA A;  3VUZ A;  1PFN A;  4CRI A;  4EMK B;  4C8Q E;  4MDW A;  1DOL A;  4HR7 B;  4ANJ A;  1LPL A;  2DBK A;  1IGQ A;  2SEM A;  3T1H L;  4NB3 A;  1TKW B;  1Y1V H;  2XRS D;  2JM8 A;  4DOV A;  4LUZ A;  1S40 A;  2EGC A;  3L2P A;  5JVG 3;  1UNS A;  2RM4 A;  3M7G A;  3D3R A;  1ENA A;  2YLB A;  2DO3 A;  1P16 A;  4Z9C B;  2EGA A;  2X3W D;  5C5M A;  2ZXP A;  1QVF S;  3QIA A;  2RHU A;  1TY2 A;  1ML0 D;  2UUA Q;  4L5S A;  1RJT A;  1VQG A;  4C8Q A;  5E1F A;  4WF2 A;  1EOV A;  3M5A A;  4HED A;  3D4R A;  3QJ6 A;  1JXO A;  4NP5 A;  4EVO A;  2SNM A;  3SWN B;  1O78 A;  3A5Z B;  4M77 B;  3H0F A;  1X6G A;  2E2I H;  4OB0 B;  3WXM B;  3EAE A;  3SVM A;  3W5O A;  4QVZ A;  3IAY A;  3BU2 A;  4A3I G;  1WD0 A;  2E2J B;  2O9V A;  2RH2 A;  4DV6 Q;  3GTL H;  8AT1 B;  2P4R A;  2O4X B;  4X34 A;  1K0R A;  3D31 A;  4C3J B;  5M3M G;  3KLS X;  4N8F A;  4R4O A;  3DB3 A;  4TVA B;  5C44 H;  5KYY B;  1HNZ L;  3P8D A;  1TUC A;  3IKJ A;  3CCU T;  5ECA A;  1PH2 A;  4IFD I;  3GTG B;  1AWW A;  2EXD A;  2Y0S G;  1ZSZ C;  1M3A A;  2A36 A;  4A4E A;  3F2D A;  1QE6 A;  2K57 A;  2EQU A;  1AE3 A;  4NDX A;  4YWK A;  4EQN A;  1QW1 A;  2PYK A;  3OOC A;  5GAO p;  3RMH A;  4POG A;  2FZC B;  1S1N A;  5ELB A;  1WHM A;  2E76 C;  3OWF A;  2R5M A;  3V7S A;  3JCM J;  4ZKB B;  2L0A A;  3JCM V;  1CSQ A;  3JCM d;  4JCV E;  4DNI A;  4J5Y A;  2VNU D;  2RQV A;  3DWP A;  4BUG A;  4PJO E;  9ATC B;  1TWA B;  4X3K A;  2L3P A;  3ND9 A;  3FEO A;  6AT1 B;  4OIJ A;  4M7A E;  2JSO A;  2FPF A;  1EY9 A;  5FLM H;  1RCV D;  4QQD A;  4AYB B;  4LF9 L;  2OTL Q;  2LQW A;  4JBM A;  4MTN A;  2E2H B;  2C0O A;  2XDB A;  4B3R L;  3S16 B;  3VS4 A;  4J9D A;  1ZUU A;  2LNH B;  3I90 A;  4BBS H;  2QIL A;  4CJ2 C;  3V7C A;  3MXN B;  2KCM A;  3TDQ A;  4KHP Q;  1D1C A;  3CC4 Q;  1I07 A;  4PJO A;  2ATC B;  3PE0 A;  1OU8 A;  3I4N B;  4M7A A;  1C0A A;  1G29 1;  8ATC B;  4U68 A;  1V76 A;  2F3V A;  3PGG A;  2WB1 E;  2KQ3 A;  2YRV A;  2HSP A;  3CME A;  3EFX D;  4E6R A;  5LL6 S;  3RN2 A;  1U5K A;  2D6F A;  3RUX A;  2KGT A;  3HKZ B;  4JI0 Q;  4ID6 A;  1YHB A;  4RMO A;  1II3 A;  3QO2 A;  2YT6 A;  4JI5 Q;  1QIL A;  2UXB L;  2F5T X;  2A19 A;  3ASK A;  1QUQ A;  4DBQ A;  5FKA C;  2JEA I;  4XK8 E;  3BDC A;  5I2X A;  1U0L A;  2Q2I A;  3FDR A;  4EDU A;  3URG A;  4WOR A;  3S15 H;  1B2T A;  4LUE A;  1CFM A;  3PIO A;  1TXY A;  2F0G A;  4GNX B;  1Y1V B;  1VQN Q;  2AKK A;  1IW7 C;  4JI7 L;  2HL5 C;  3OYJ A;  1SFO H;  5IT9 c;  1WZO A;  4XYO A;  3DWQ A;  5GAO n;  2WII B;  1JWM D;  1WCM B;  1YHQ T;  1ASY A;  5GAM j;  1TS2 A;  4RHS A;  5GMK j;  5HGQ A;  1ABQ A;  2E41 A;  2EVR A;  2W10 A;  4NKL A;  1SEM A;  1QZH A;  1VQ5 Q;  1G2S A;  1YJ9 Q;  2RDH A;  3I72 A;  1OOT A;  1GO3 E;  1LJO A;  3UDI A;  2XDD A;  1M3B A;  1KIX A;  3MEA A;  2HT1 A;  2R93 H;  4KK7 A;  1IYJ B;  2E2I B;  1CT1 D;  4XU3 A;  5FO9 B;  3E9G A;  1UFF A;  2D1X A;  3EGU A;  3NP8 A;  3VR6 A;  3WWV A;  2E5K A;  3J7A V;  4DR3 L;  2FRW A;  2SEB D;  2EY6 A;  1K8A U;  5LMN W;  4A76 A;  4CJ1 B;  4LF6 Q;  4XT1 B;  4BY1 H;  3GTL B;  4OX9 Q;  3L2U A;  2HIV A;  2YXY A;  1UTI A;  2BIV A;  3PVL A;  1I5L A;  5IGF A;  2KR3 A;  5C44 B;  1N6A A;  3UT1 A;  4J9G A;  4GBQ A;  3VUB A;  4BY6 B;  1BOS A;  2EYX A;  1KTK A;  4A4H A;  1VQK T;  1S5D D;  1U4P A;  4IOC A;  4LFA L;  2HQH A;  1U8R A;  3RNU A;  3BJU A;  4X64 Q;  4OMP A;  2WP8 J;  4LK1 C;  2O01 E;  2JOY A;  4XTZ A;  1K9M C;  2OTJ Q;  2UUA L;  1LTI D;  1F9Q A;  1HRJ A;  4XQN A;  2L5Q A;  1HXD A;  1G51 A;  4YWL A;  3UA6 A;  1DD2 A;  1SYC A;  3DXJ C;  2PZW A;  5T1I A;  3CMA Q;  3PMI A;  2BOS A;  1XNQ Q;  1UG1 A;  1PTO H;  2QTX A;  2F0N A;  4WJ3 M;  1C4Q A;  3M0S A;  4X9D A;  5HGT A;  5AFW A;  1M1G A;  4WTO B;  2G6F X;  1SJE D;  3M7N A;  4IUN A;  1OPL A;  3H8Z A;  4YCV A;  5CVI A;  5LJ3 d;  3CF5 A;  1OQK A;  1UAP A;  1AHJ B;  4DV6 L;  1ZYR C;  4PMC A;  1H9K A;  2RHI A;  1SE8 A;  1RAE B;  1EEI D;  4XIG S;  4LNP A;  2KEA A;  3TZD A;  1WTQ A;  3F8T A;  2F3W A;  4C2M H;  3C2P A;  3VKI A;  4BBS B;  1PFM A;  4HJA A;  3PUX A;  1EZ6 A;  1VOM A;  4C92 C;  1IBK Q;  1VS0 A;  1VA7 A;  2LP5 A;  2FZG B;  3QDF A;  3G6E Q;  4XAX B;  1PTO D;  2N8N A;  3EQL C;  4LWC A;  3RMQ A;  5K36 H;  1VDZ A;  2AUK A;  3VRY A;  4PZ6 A;  1N8R U;  4AIM A;  1WA7 A;  4A3E H;  5CYU A;  1VQ9 A;  3A98 A;  2HKQ B;  2CH4 A;  2V26 A;  4OVA A;  4EIK A;  2FRY A;  2YSQ A;  2F2W A;  1QNK A;  4LFB Q;  5KE3 A;  1QVG S;  2PI2 A;  3QO3 A;  1EU3 A;  1L1O A;  1IGU A;  4KT0 E;  4J9I A;  3SEM A;  3CRK C;  3TN2 A;  2AKL A;  2EQJ A;  5CV4 A;  1FWZ A;  4M78 F;  1PH3 A;  5IGC A;  4HXJ A;  2CP0 A;  1W6X A;  2CYZ B;  2YUO A;  5GAO r;  2AK5 A;  4A3J G;  3QJY A;  3SK6 A;  1V8Q A;  2COW A;  4ZN1 A;  1NJI U;  4IPC A;  3NBH A;  4DF7 A;  4KKU A;  1TU0 B;  1CKA A;  5IYC H;  4DV3 Q;  1WTO A;  1GXD C;  4JK1 C;  1AZE A;  1CKO A;  2HDL A;  3VYT A;  1VQD A;  4FF3 A;  1CA6 A;  3A1P A;  1V43 A;  3MO8 A;  3K5N A;  1SFO B;  1GUN A;  2A6E C;  4IPD A;  1CKN B;  2KDS A;  3HOV H;  1VQL T;  3L2V A;  1VQ8 Q;  2FXQ A;  4KHP L;  1HJP A;  2JA9 A;  2R3Z A;  4OEM B;  2B29 A;  1STE A;  4P73 A;  4RCB A;  1MV3 A;  2JXM B;  1GBQ A;  1ZQ1 A;  5FWC A;  2LY7 A;  4Q5V A;  1YJN T;  2IVW A;  3RLF A;  2MF2 A;  2YTY A;  4RTT A;  5CMD A;  3L9A X;  2R93 B;  1ZSZ A;  2PNI A;  2K2M A;  5I9O A;  3OA6 A;  2MPM A;  2JTF A;  4GKK Q;  4KI0 A;  1Y1W B;  2M51 A;  1NLP C;  3A8K E;  4TQU S;  1U1T A;  2IG0 A;  4RUG A;  4RTZ A;  1LLR D;  3EG1 A;  1E0B A;  2VUM H;  4ESR A;  3OYC A;  3CCV Q;  1JJ2 A;  4BY1 B;  1K73 C;  4F8M A;  5DNF A;  4R8I A;  4RTU A;  4X6A H;  2LCS A;  2F0K A;  5GAM h;  2QGG A;  3CCU A;  2KEC A;  4C3H H;  1LNX A;  2BZ8 A;  2MOX A;  2B2U C;  2KSS A;  2V8I A;  3ER0 A;  3L3O C;  3NK9 A;  4DV5 L;  2XID A;  1NBW A;  1OXT A;  1LTB D;  3AFQ A;  4HCC A;  5JPM C;  2FB7 A;  1RTN A;  3UPU A;  1PRT D;  4BI3 A;  3KLW A;  2F0S A;  4RCC A;  3IFT A;  1PKS A;  1I4H A;  2AQ2 B;  4DK3 C;  4M78 A;  4R8N A;  2R57 A;  1MJC A;  2ZM6 L;  4DR4 Q;  2X69 A;  1B7T A;  1SF9 A;  5IGG A;  2TSS A;  1W70 A;  1YWP A;  3VS5 A;  1YJW T;  1VQP Q;  1EFI D;  3E6Z X;  3F1Z A;  3QII A;  3KLS A;  4DUY L;  4RGN A;  4J9H A;  1KC8 R;  1FMW A;  2EY2 A;  5A2Q E;  1WIE A;  2XMF A;  4GOP A;  2W0Z A;  3PUZ A;  4KTA A;  2F2V A;  3JCM W;  2ICE C;  1PTO B;  4FW1 A;  1UHC A;  3PFS A;  3U9S A;  2F1M A;  3S1Q B;  2ZPE B;  1K8A C;  1XXG A;  2RQX A;  2RF4 A;  1G3Y A;  3FIF A;  3CC7 Q;  5I2M A;  4OP0 A;  3HOY G;  3GP7 A;  3G4S A;  3JCM f;  5C6S A;  4OX9 L;  5CKB A;  2FJ2 A;  1VQM T;  2YHT A;  1Q81 R;  1YNN D;  4C2M B;  2PPB C;  1HA6 A;  1C6V X;  4JI1 Q;  3I3C A;  1H92 A;  3M9Q A;  2NZ1 D;  4V0B A;  1BI2 A;  3MEH A;  2A68 D;  1KXL A;  1H8K A;  3WDN A;  2D0Q B;  5C0X G;  5GMK l;  2D9U A;  4LF4 Q;  1YIT T;  4UP7 A;  1ZUK A;  4A3E B;  1X75 C;  1BB9 A;  3S6W A;  4XTV A;  2J7Z A;  3EVQ A;  5EPL A;  5FLX L;  3PIP A;  4JYA Q;  1VQ4 Q;  2RNA A;  1EWH A;  4HJ8 A;  2UU9 L;  3VYS A;  3ULL A;  3RUZ A;  4WCI A;  4FL6 A;  4BA1 I;  2XK0 A;  2DZC A;  1XMO Q;  1R0B G;  2EJF C;  3MJX A;  3I56 Q;  3MP8 A;  1DJ7 B;  4LE9 A;  2F0E A;  3NSW A;  3R3O A;  1J5E L;  1SAP A;  1WTR A;  2MQH A;  3LGL A;  3OYA A;  2R92 H;  3VJP A;  1PZI D;  4QCL A;  2DVE A;  2KCT A;  4N0A A;  5FO8 B;  3RD4 A;  1N32 Q;  2E10 A;  1ENF A;  1B34 A;  4PNO A;  3HFO A;  3IRB A;  2UUC Q;  2F2X A;  4DXF A;  4LW1 A;  3OMG A;  2DD4 A;  1YHQ A;  4DA2 A;  2AZS A;  2AHO B;  4B08 A;  1YP5 A;  3K5M A;  4GKJ Q;  4JBJ A;  5IIF A;  2CRE A;  1VYT A;  1TR5 A;  1IBK L;  1Q7Y R;  1VYV A;  3E9H A;  1N8R C;  3L2R A;  4F7U E;  1X3P A;  2VXE A;  4N9P A;  1H64 1;  3X25 B;  4K2L A;  1ZX6 A;  5IGB A;  1T9H A;  3PF5 A;  1MMN A;  2DJQ A;  5GAN d;  1FGU A;  5KYY A;  2RHQ B;  1RAG B;  2ED1 A;  4ATO A;  2DY8 A;  4MZM A;  2KHI A;  3SGI A;  1H3Z A;  2BE9 B;  2EJG C;  1S72 T;  4OGQ C;  5DY9 A;  4LFB L;  1PRT B;  3A7A B;  2JA6 H;  1SYE A;  4LF8 L;  3PV0 A;  1HZA A;  1QCO A;  3M0Q A;  1BVS A;  2C5C A;  3CAM A;  4MNO A;  2E74 C;  1D1K A;  1IB8 A;  1NPP A;  1KLG D;  1Q12 A;  5KYL A;  3GTP H;  2VUM B;  1M8A A;  2DJF C;  1STG A;  4FP5 D;  1YN8 A;  3JB9 H;  2KXC A;  2UXD L;  2DL4 A;  2XDP A;  1X01 A;  3HL8 A;  3QHS A;  3OW2 A;  1I4X A;  2K6A A;  3MVV A;  5ELC A;  3Q22 A;  1M5Q 1;  4C92 E;  2JA8 G;  5GAN e;  3NGP A;  2BTT A;  1H3H A;  2DN8 A;  4DV7 Q;  4P75 A;  2XI9 A;  2ZTD A;  1O80 A;  4CJ0 B;  4LDW A;  2CW0 D;  2JE6 I;  3DM3 A;  2IW3 A;  3EG9 B;  3CC2 T;  2R61 A;  4LF5 Q;  1D09 B;  4OWT B;  5EGT A;  1FMV A;  2X4J A;  4X3S A;  4HCZ A;  3JB9 D;  2RHX A;  3MHX A;  1LOJ A;  3J7Y W;  2OCE A;  3PO2 H;  4GLV B;  1OX8 A;  4J15 A;  4EQ5 A;  2EYP A;  1PC0 A;  4KH1 B;  4PLI A;  3S3O A;  1BCP D;  2PMZ B;  4GKK L;  1I6H B;  4TKO B;  5FW9 A;  1KAA A;  2AT1 B;  2WAQ G;  3FKI H;  3BZK A;  4ZTJ A;  4QUC A;  1TWH H;  1B70 B;  2KK4 A;  1VMP A;  5I4D A;  3GPL A;  1GFD A;  2Z4I A;  2EYH A;  1JB3 A;  5C0M A;  1PM3 A;  2G5D A;  2K5D A;  2F03 A;  4DUZ Q;  5ELE A;  3MEF A;  1Y96 A;  4V2S A;  3K8A A;  4DA4 A;  1HZC A;  1F9R A;  5I9P A;  1FGB D;  1GVP A;  4IFD G;  1EWI A;  1XYI A;  1EQT A;  4MMK A;  5GAN 7;  2I46 A;  1TU2 B;  4M75 D;  3P1H A;  1ZHI A;  2RJF A;  2COZ A;  5KYX A;  2LC4 A;  1B4O A;  1M1F A;  4LAA A;  1VQN T;  1M1K U;  1EUJ A;  3R8B A;  1HNW L;  1NEG A;  2QAZ A;  1Q8K A;  1I94 Q;  1G6P A;  1BO0 A;  2WB1 B;  1Q95 G;  4XXE A;  2GF7 A;  4X9C A;  2KY9 A;  3C46 A;  4DV0 L;  3CCM Q;  1VQA A;  1I4R A;  3DM1 A;  1JQQ A;  3LH5 A;  1FYN A;  3A8G B;  4IPH A;  4ZLT F;  1A6X A;  4HVU A;  4K8J A;  2Z4H A;  1VQ5 T;  5KYW B;  3RDV A;  2KBT A;  3DLL A;  1SYF A;  1YJ9 T;  5E3F A;  2DTO A;  1F2L A;  2HL3 A;  1VQL A;  1TH7 A;  3NWT A;  5EKL A;  3HOU B;  3HOX G;  5ISR A;  2A7Y A;  1WYD A;  5FJ8 H;  4OEL B;  3WVE B;  2AZV A;  5GAO m;  2K5W A;  2NN6 I;  1RL2 A;  5CO7 A;  4YCU A;  4JI1 L;  2NUP A;  5CV9 A;  1EYG A;  4WJ4 A;  2HNI A;  1KHC A;  4M78 G;  1YJN A;  4UP9 A;  4FF2 A;  2X35 A;  2KVQ G;  1M2V A;  5IP9 H;  2M02 A;  1D1I A;  2Y0S E;  1O7I A;  3E3X A;  1WHH A;  4HT9 A;  2J4X A;  3A8M B;  3A54 A;  4UC4 A;  4N4I A;  1TS9 A;  2M0O A;  1GXI E;  1LV9 A;  1SRU A;  1TG0 A;  2JA6 B;  4KBM B;  2JS0 A;  3QSU A;  1HPC A;  2K5I A;  3OYG A;  1ZXT A;  1VQO A;  2KXD A;  1D3B A;  3W1B A;  3GTP B;  4X66 L;  3H15 A;  1QVG P;  1PKT A;  2QI2 A;  5HK0 A;  2QEX Q;  2KHS A;  2Z6B A;  2Q8I B;  1WTV A;  2MHV A;  2Q2H A;  2VWF A;  2OTJ T;  2K05 A;  1NPR A;  1N32 L;  2EYQ A;  3S17 H;  1NCV A;  1BCP B;  4UDU C;  3HRU A;  4R9W A;  4RCN A;  4DR1 Q;  2L11 A;  4JI6 L;  3CMA T;  4J9C A;  5DLQ E;  2LT4 A;  4E7J A;  4GKJ L;  2L12 A;  4HN7 A;  2XRQ D;  5IWA L;  2RCN A;  1UEB A;  2EQS A;  2KED A;  1BCM A;  3PCO B;  1WTX A;  1NE8 A;  2QQR A;  2VC8 A;  3BDO A;  3E2U A;  2QDL A;  3ME9 A;  1P8L A;  1STN A;  2D2C C;  2K14 A;  3L0O A;  4GLA C;  4RA8 A;  2EYW A;  1SMY C;  3S1M H;  2SNS A;  4HKE A;  1SDF A;  4S3S A;  5D6Y A;  3DUZ A;  3X20 B;  2ZPB B;  3PO2 B;  3V8K A;  2OF1 A;  4PJL A;  2AUJ D;  2YUP A;  4DV2 L;  1ENC A;  2DAQ A;  1U3O A;  1UE1 A;  1TQO A;  1NM7 A;  5IH2 A;  1SLJ A;  2O31 A;  3CCQ Q;  1VQM A;  3MC0 B;  4BWG B;  4QUF A;  4M75 B;  4LDX A;  3MTS A;  2ZXR A;  1DOM A;  4HJ5 A;  2CP5 A;  2DL5 A;  3OS5 A;  4KMU C;  4M77 G;  2FZK B;  1PG5 B;  1IL8 A;  1KRS A;  3V96 A;  3OIQ A;  2RPN A;  5KEE A;  2A28 A;  5DLO A;  1J3T A;  4BDZ A;  2EJF A;  3EH2 A;  3FJ5 A;  5GJW B;  1V1Q A;  1IO6 A;  1WJJ A;  4IZ8 A;  1WX6 A;  4ZGD B;  3V7R A;  2DGY A;  4JW0 A;  4R4C A;  3VR3 A;  4M7D D;  3G6J B;  2DY7 A;  1YIT A;  4R56 A;  1EY4 A;  4GY5 A;  2KQW A;  1OI1 A;  3FP9 A;  2A0F B;  1PRL C;  3SE0 A;  5A35 A;  4D6W A;  2QGQ A;  3JCM c;  4GLK A;  3R2T A;  2VS1 A;  1PTO F;  1O7L A;  5CKE A;  4MZT A;  2CQA A;  1Y71 A;  1HTL D;  2EYL A;  3CBP A;  5EKK A;  1Y57 A;  4JI3 Q;  2RQW A;  2RJE A;  3R93 A;  4XTU A;  2CZ7 B;  1SRM A;  2DF6 A;  4DNT B;  5LL6 X;  3PQI A;  2XNA C;  4BE1 A;  2IX1 A;  2CHB D;  1RAB B;  4H7B A;  1KD1 C;  3C94 A;  4J8O A;  1QP2 A;  2MYS A;  4CC3 A;  5GAN 4;  1W2B S;  1VQF A;  1S4Z A;  4UAI A;  1E6G A;  1D6E C;  4HJ7 A;  1WQW A;  1VCI A;  3GD7 A;  4DK6 C;  4DR6 Q;  3HPW A;  2HCK A;  1QKW A;  1HZ9 A;  2LCC A;  4A3L G;  1IBL Q;  2VB2 X;  5FRM A;  1C8C A;  1X55 A;  4DUZ L;  4IUU A;  1WD1 A;  4LUO A;  2PQW A;  2XU8 A;  2AKW B;  4Y92 A;  1PH9 A;  4M4Z A;  1K1Z A;  4JRK A;  1JOK A;  1JT8 A;  2R7Z H;  3SHL A;  1N9R A;  3UDC A;  4FVM A;  1PFS A;  5IXF A;  2QAS A;  4Q0F A;  1I8F A;  3CCV T;  2E3H A;  4FSX A;  1H9S B;  1MHN A;  3KUF A;  2KE9 A;  1YJW Q;  1GBR A;  4IUQ A;  1F1B B;  1STY A;  3JV3 A;  1W6J A;  3D4D A;  2O9S A;  1SXT A;  3I4N G;  1M90 U;  3CPF A;  2GTO A;  1D0Y A;  1V1C A;  5GAN f;  5GAN 2;  3NQT A;  4KV6 A;  1I94 L;  3BW1 A;  1LAB A;  2RVL A;  2E1H A;  1VQ7 Q;  1AD5 A;  1AWJ A;  3CBO A;  1S5E D;  1RAH B;  1IKM A;  4DR7 L;  3SD4 A;  4A3D H;  2DJZ A;  2RQU A;  3CBM A;  3EGX A;  1VQP T;  2E2D C;  2GVA A;  3BVZ A;  3HKZ G;  4R4Q A;  4E6I A;  1Q82 C;  1M8V A;  4F14 A;  3WOF A;  4HCB A;  1TY0 A;  2AQ3 B;  3QDR B;  5HUR A;  3VS7 A;  3HHT B;  2YLC A;  3C12 A;  4KN7 C;  3V8L A;  3JB9 I;  1WHG A;  2NVY H;  2Z1C A;  5J22 A;  2OTL A;  2JEB I;  3LWH A;  1UDL A;  2K5L A;  4J6Y A;  4C5H A;  5GAM e;  3CCS T;  3CC7 T;  1G3S A;  4OML A;  5GMK e;  1IXD A;  1PRT F;  2E8G A;  1EQV A;  3FLG A;  2I0Q A;  1HR0 Q;  2RA4 A;  3Q8D A;  1TOV A;  1OXX K;  2DEU A;  3CC4 A;  4M7D B;  1WCM G;  1OZ2 A;  1BI0 A;  1G3T A;  3V05 A;  1EIG A;  3GO5 A;  3BVG A;  3KF8 A;  2MO1 A; 
#chains in the Genus database with same CATH homology
 1RLP C;  2A37 A;  2ESW A;  1WYX A;  4OMP A;  2M0Y A;  2K9G A;  1T0J A;  4CC7 A;  2J6O A;  4CC2 A;  2FPD A;  3UA6 A;  2JS2 A;  4J9B A;  2SRC A;  1UG1 A;  1B07 A;  3M0S A;  4Z88 A;  2VVK A;  3VS6 A;  1HJD A;  2K3B A;  3EG2 A;  2G6F X;  1OPL A;  2YUQ A;  1VYU A;  2CT4 A;  4KRT A;  3VS1 A;  4LNP A;  4D8D A;  2KEA A;  5I11 A;  2O88 A;  1W1F A;  1M30 A;  1G2B A;  3EHR A;  1VA7 A;  2JT4 A;  2LP5 A;  1PNJ A;  2K79 A;  2KYB A;  1UEC A;  3VRY A;  1WA7 A;  1JEG A;  2C0T A;  4RTW A;  1PHT A;  1ARK A;  3EHQ A;  3A98 A;  4EIK A;  2CH4 A;  1WXU A;  2FRY A;  2F2W A;  2YSQ A;  2J6F A;  2DM1 A;  3NMZ C;  4AFQ C;  5IHN A;  3SEM A;  4J9I A;  1QKX A;  2FO0 A;  4R0K A;  1TUD A;  2AKL A;  2H8H A;  4HXJ A;  1W6X A;  2YUO A;  3C0C A;  2AK5 A;  1AZG B;  2ED0 A;  1GL5 A;  1SHG A;  1CKA A;  3R6N A;  2LJ0 A;  1AZE A;  2I0N A;  1BU1 A;  1YNZ A;  1KJW A;  2JMC A;  1QLY A;  1OPK A;  2GGR A;  2C0I A;  2ROT A;  5HCK A;  3VS2 A;  2ROL A;  2CSQ A;  1RUW A;  2DL8 A;  1MV3 A;  4HVW A;  1GBQ A;  4HCK A;  5FWB A;  5FWC A;  4JPB W;  2EBP A;  1K0X A;  2DA9 A;  4JJD A;  1Z9Q A;  3I5S A;  4RTT A;  2CUB A;  2PNI A;  1UHF A;  2K2M A;  1NEB A;  1SRL A;  1K9A A;  1ZLM A;  4DEX A;  2M51 A;  1NLP C;  2BZY A;  4JZ3 A;  1UE9 A;  4RUG A;  2RN8 A;  1U5S A;  3EG1 A;  4RTZ A;  4ESR A;  4AFS C;  1A0N B;  3M0P A;  4RTU A;  2LCS A;  2RQR A;  3KFV A;  2BZ8 A;  2DX1 A;  1X2Q A;  2MOX A;  3IQL A;  2CSI A;  1AEY A;  4OMQ A;  2PTK A;  1ZUY A;  2IIM A;  2D8J A;  1PKS A;  5IHI A;  4J9F A;  2RF0 A;  1W70 A;  1YWP A;  2HDA A;  2RMO A;  3VS5 A;  2D8H A;  3ZL7 C;  1WLP B;  1JU5 C;  4J9H A;  1X69 A;  2CDT A;  1AOJ A;  1WIE A;  3ULR B;  2XMF A;  2W0Z A;  2F2V A;  2J05 A;  1UHC A;  4RTX A;  1ZSG A;  4IIO A;  1KFZ A;  1PRM C;  3VRZ A;  4D8K A;  2JTE A;  1HD3 A;  1GRI A;  2DRK A;  2DBM A;  1OV3 A;  1Y0M A;  4LUD A;  2DYB A;  1FMK A;  1H92 A;  2A08 A;  3REB B;  1WXT A;  1H8K A;  4OMM A;  3M0T A;  1RLQ C;  2DRM A;  1ZUK A;  1BB9 A;  1UGV A;  3RNJ A;  5L23 A;  3I9Q A;  1NLO C;  2RNA A;  3UAT A;  3UA7 A;  4WCI A;  2KYM A;  4JZ4 A;  2HEQ A;  4LE9 A;  4JJB A;  4X1V A;  4DEY A;  2ENM A;  1BBZ A;  1MV0 B;  1WXB A;  5EC7 A;  1WFW A;  3M0R A;  1SSH A;  2F2X A;  3QWX X;  2AZS A;  1UJY A;  1YP5 A;  1WI7 A;  2KRS A;  2K7A A;  3RBB B;  1YWO A;  1PWT A;  1VYT A;  1QCF A;  2CRE A;  1VYV A;  3VS3 A;  2EYZ A;  3VS0 A;  1ZX6 A;  1B3Q A;  2ABL A;  2DJQ A;  4J9E A;  1T0H A;  2ED1 A;  1SPK A;  2BZX A;  3TSW A;  2GNC A;  2KRN A;  3GBQ A;  2OAW A;  1I1J A;  3H41 A;  4J9G A;  3M0Q A;  1BK2 A;  2K6D A;  3I35 A;  2EKH A;  2FPE A;  1YN8 A;  4AFU C;  2J06 A;  1SHF A;  2KXC A;  2DL4 A;  1M27 C;  5I22 A;  2DIL A;  2KRO A;  3NGP A;  1AWX A;  4ZNX A;  2BTT A;  1H3H A;  2V1R A;  1CSK A;  2DE0 X;  2D0N A;  4Z89 A;  2LMJ A;  2FG0 A;  1RI9 A;  2V1Q A;  3REA B;  1M8M A;  1WDX A;  4OMO A;  1JO8 A;  5FW9 A;  2J6K A;  1E6H A;  3TVT A;  2CH4 W;  3M0U A;  2LJ1 A;  2LZ6 B;  1GFD A;  1K76 A;  1K4U S;  1GCQ C;  1KIK A;  1KSW A;  2KT1 A;  2FEI A;  4Z8A A;  2GBQ A;  1YCS B;  1UJ0 A;  1N5Z A;  2LX7 A;  2OJ2 A;  2L3Q A;  3PVQ A;  5GJV B;  1NEG A;  2CT3 A;  3NHN A;  2J7I A;  4FSS A;  4RTV A;  1X6B A;  1JQQ A;  2NWM A;  3LH5 A;  1FYN A;  2LQN A;  2RQT A;  4HVU A;  1T3L A;  2KBT A;  1T3S A;  2MCN A;  4JJC A;  2JXB A;  1OEB A;  3CQT A;  2AZV A;  2GQI A;  3H0I A;  3I5R A;  2DLP A;  4F17 A;  2EYY A;  2GTJ A;  2KT8 A;  4QT7 A;  4AFZ C;  2JM9 A;  1GCQ A;  1X43 A;  4K11 A;  2KNB B;  2DBK A;  1TG0 A;  2SEM A;  2JS0 A;  3QWY A;  2JM8 A;  2EGC A;  1X2K A;  2KXD A;  2EPD A;  2JW4 A;  1PKT A;  2EGA A;  2X3W D;  2VWF A;  1JXO A;  2EGE A;  3TSZ A;  2EW3 A;  3UF4 A;  3SHW A;  2PZ1 A;  3H0F A;  4J9C A;  2DL7 A;  1HSQ A;  1K0S A;  1X6G A;  4RTY A;  3H0H A;  2QDL A;  4AG2 C;  3THK A;  2EYW A;  2O9V A;  5IHK A;  2DNU A;  1UUE A;  2P4R A;  2DVJ A;  1U06 A;  2YUP A;  1AWO A;  1U3O A;  1NM7 A;  1TUC A;  5ECA A;  5IH2 A;  1AWW A;  1JXM A;  2O31 A;  2A36 A;  1M3A A;  2MIO A;  2DL5 A;  1M3C A;  2RPN A;  2YUN A;  2A28 A;  2ECZ A;  1J3T A;  5GJW B;  3FJ5 A;  1IO6 A;  1WX6 A;  1S1N A;  2O2O A;  4HVV A;  1NYF A;  2L0A A;  1PRL C;  3U23 A;  2DL3 A;  3O5Z A;  2OI3 A;  2RQV A;  2B86 A;  2L3P A;  1X27 A;  2FPF A;  4AG1 C;  1Y57 A;  2LQW A;  2RQW A;  1QWE A;  2C0O A;  2X3X D;  3VS4 A;  1SRM A;  2DF6 A;  4J9D A;  1ZUU A;  2LNH B;  1G83 A;  1NYG A;  1GCP A;  1I07 A;  4CC3 A;  3PE0 A;  1E6G A;  1AVZ C;  2L2P A;  2HCK A;  1QKW A;  2DMO A;  2HSP A;  5IXB A;  1GFC A;  4E6R A;  2KGT A;  2LJ3 A;  4Y92 A;  4M4Z A;  1K1Z A;  2YDL A;  2EQI A;  2YT6 A;  3NPF A;  4IIM A;  5IXF A;  4ORZ A;  1CKB A;  2KE9 A;  1GBR A;  2KRM A;  1LCK A;  3JV3 A;  1NG2 A;  4LUE A;  2O9S A;  2VKN A;  2AKK A;  2GTO A;  1V1C A;  1MUZ A;  4LN2 A;  4OMN A;  1AD5 A;  2JMA A;  2CUD A;  1AWJ A;  1EFN A;  1ABQ A;  2EVR A;  2RQU A;  2W10 A;  1SEM A;  4F14 A;  4A63 B;  1OOT A;  3VS7 A;  1E7O A;  1M3B A;  1XOV A;  4F16 A;  1UFF A;  2D1X A;  3EGU A;  1I0C A;  1UDL A;  2E5K A;  4OML A;  2HBW A;  3EG3 A;  2FRW A;  2NUZ A;  1ZBJ A;  1Z9Z A;  1QWF A;  1ABO A;  4CC4 B;  1UTI A;  3PVL A;  2L3S A;  3EG0 A;  2KR3 A;  4GBQ A;  4GLM A;  2EYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...