4JPBW

The structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
140
Chain Sequence
LKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheA
publication title The 3.2 angstrom resolution structure of a receptor: CheA:CheW signaling complex defines overlapping binding sites and key residue interactions within bacterial chemosensory arrays.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Immune system
total genus 28
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jpbW01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 4jpbW02
1CKBA 1W6XA 2I0NA 2KGTA 2BZXA 2DE0X 3FJ5A 3M0RA 3TSWA 4RTUA 1HD3A 4LUEA 4AG2C 3TSZA 2MOXA 2J6FA 2JMAA 2CT4A 1ARKA 4RTYA 1AWJA 1TUDA 2X3XD 2BTTA 1ZUYA 1TUCA 3LH5A 2LQNA 2RMOA 1GCPA 2KRMA 3VS5A 2V1RA 2FPEA 2CH4W 2VWFA 2KXCA 5ECAA 2JT4A 2VKNA 2F2WA 1AWOA 2EGAA 3EG1A 2DMOA 1W70A 3A98A 1GRIA 2KRSA 3I5RA 1K0SA 2C0IA 3EG3A 1OOTA 1IO6A 3C0CA 1BU1A 1SHFA 2W0ZA 4AFQC 1ZUUA 1SEMA 4J9IA 4LUDA 2O9SA 4AFSC 4F17A 1UGVA 2KROA 2DL8A 4J9DA 4EIKA 3VS4A 2YUNA 2FO0A 4OMMA 1XOVA 1KJWA 1BK2A 1MV3A 4HVVA 3NMZC 2HBWA 4J9HA 1H92A 1OEBA 3EG0A 1HSQA 2O2OA 4RTWA 1M27C 1WXTA 2CSIA 5IXBA 1KFZA 1WA7A 2DBKA 2W10A 2A37A 1HJDA 1CKAA 4F16A 1U3OA 3SEMA 2D8HA 4HVUA 2J05A 2DVJA 2FPDA 1FYNA 1PHTA 2IIMA 1UJ0A 2L2PA 2F2VA 1NEGA 2BZ8A 4JZ3A 2NUZA 5IHKA 2O31A 1NLPC 2YUQA 1UECA 4DEYA 1Y57A 2KRNA 2DJQA 3VS7A 1SSHA 1SRLA 3REBB 1K4US 2V1QA 2K6DA 4J9EA 4ORZA 1X2QA 4JJBA 2GNCA 5IXFA 2ESWA 1AD5A 2DF6A 2DX1A 1PRLC 1T3SA 2KT8A 1ZX6A 2HCKA 2AZVA 5FWBA 1X69A 2SEMA 5HCKA 3VS6A 2RF0A 3ZL7C 4IIMA 5FW9A 1JEGA 2J6KA 3VS3A 4R0KA 1I0CA 2GTOA 1NLOC 1KSWA 2MIOA 2MCNA 1YN8A 2GTJA 2DA9A 1V1CA 2AZSA 1OV3A 2K7AA 5I11A 1WFWA 2EBPA 1I07A 1SHGA 3EGUA 3H41A 2EYXA 1ZLMA 2J7IA 4D8KA 2YSQA 2HEQA 1WXUA 2DL5A 1GCQC 1NYFA 1NEBA 2VVKA 2DRMA 3IQLA 1AEYA 4AFUC 2M0YA 2GBQA 1K76A 3UA6A 2CT3A 1QWFA 2JMCA 1K9AA 1VA7A 2EKHA 2DRKA 2JM8A 2LX7A 3I5SA 4OMOA 1JXOA 3R6NA 2RQUA 1NYGA 2KXDA 3VRYA 4J9GA 2ECZA 2EVRA 4CC7A 1JU5C 4CC3A 5EC7A 4D8DA 2LJ1A 2RQWA 1H3HA 1LCKA 1MUZA 3GBQA 2DNUA 1T0JA 2A08A 1AOJA 2K3BA 4CC4B 1TG0A 2FG0A 2L3PA 3H0HA 2ED1A 2C0OA 1NM7A 4K11A 1RUWA 1K0XA 1B07A 1ABOA 1YWOA 3CQTA 1OPLA 4ZNXA 2DYBA 2EW3A 2AK5A 1JQQA 3PVQA 4RTVA 1UTIA 1BBZA 2SRCA 1X6GA 3JV3A 4AG1C 4F14A 1GBQA 1Z9ZA 3NGPA 1M30A 3M0TA 1PKTA 1G2BA 2ROLA 3M0UA 5I22A 2K79A 3H0IA 1UFFA 2LP5A 1WIEA 1M3BA 1K1ZA 2LCSA 1YNZA 1X27A 3THKA 1UDLA 2AKLA 2C0TA 1E6GA 4AFZC 4OMLA 4OMNA 2KE9A 2LJ3A 2L3QA 2M51A 1VYTA 2OAWA 4IIOA 2RQVA 2DM1A 2YUOA 3H0FA 4A63B 3ULRB 3RNJA 2D8JA 2EYYA 2YDLA 4RUGA 1YP5A 1WYXA 3I9QA 1NG2A 1EFNA 4RTXA 2QDLA 2F2XA 2J06A 5IHIA 1ZSGA 4LN2A 1H8KA 4Z88A 1SRMA 2XMFA 3UATA 1WI7A 1AWXA 1QCFA 2HSPA 5GJVB 1UJYA 2KBTA 2LZ6B 2OJ2A 1ZBJA 1E6HA 2EGEA 2KNBB 1WX6A 1BB9A 2K2MA 2DLPA 4JZ4A 2NWMA 1UUEA 3VS2A 3SHWA 2DBMA 4E6RA 4JJDA 2JS2A 2LJ0A 2H8HA 4QT7A 4JJCA 2HDAA 4FSSA 1GFDA 1QKXA 3NHNA 1RLPC 3O5ZA 1RI9A 4RTTA 2EGCA 2B86A 2CUDA 2RPNA 2X3WD 4JPBW 3QWYA 1VYUA 2D0NA 4CC2A 2AKKA 3EG2A 2PNIA 3I35A 4J9BA 4X1VA 4GBQA 2YUPA 2E5KA 2LMJA 1UHCA 2CUBA 2PZ1A 2RN8A 2JTEA 1W1FA 2FEIA 1E7OA 1T3LA 1Z9QA 1UE9A 5L23A 4ESRA 1T0HA 1Y0MA 1OPKA 1AVZC 4J9CA 2DL7A 4Z8AA 2JXBA 2K9GA 2CSQA 2RQRA 2P4RA 1B3QA 2PTKA 1CSKA 1X6BA 2O88A 1M3CA 1FMKA 3UF4A 1ZUKA 5GJWB 4HCKA 2GGRA 4HXJA 4GLMA 1G83A 3QWXX 1QWEA 3VRZA 4LE9A 2YT6A 4DEXA 1PWTA 2CREA 1M3AA 3VS1A 2A36A 1I1JA 2FRYA 2CDTA 3M0SA 2ED0A 3EHQA 2KYMA 1X2KA 2DL4A 3EHRA 3UA7A 2DL3A 1QLYA 1U06A 4OMPA 3RBBB 2L0AA 1YCSB 1GFCA 4RTZA 2KYBA 2ENMA 3KFVA 2DILA 2EYZA 4OMQA 1WLPB 5FWCA 2J6OA 1GL5A 1A0NB 1S1NA 4WCIA 2CH4A 3REAB 3TVTA 2L3SA 2FPFA 2LNHB 1PKSA 1AZEA 2ABLA 1VYVA 3PVLA 2G6FX 2RQTA 4HVWA 1N5ZA 2OI3A 3VS0A 1WDXA 2LQWA 3M0QA 1M8MA 1SPKA 2O9VA 4Y92A 5IH2A 2BZYA 2FRWA 2D1XA 3PE0A 2JS0A 2EPDA 1MV0B 1UHFA 1UG1A 5IHNA 1AWWA 3M0PA 2GQIA 4KRTA 3U23A 2KEAA 1GCQA 1YWPA 2JM9A 2JW4A 2KT1A 2EYWA 2ROTA 1WXBA 2A28A 4LNPA 2EQIA 4M4ZA 1ABQA 1KIKA 1RLQC 3NPFA 1QKWA 2KR3A 1JXMA 1J3TA 4J9FA 1PNJA 1U5SA 1AZGB 4Z89A 1GBRA 2RNAA 1JO8A 1X43A 1PRMC
chains in the Genus database with same CATH superfamily
2LS01 3CXCA 2I0NA 1B44D 2BH2A 4IQZA 4OWTB 4FW2A 2RDGA 3S14H 3S9WA 1SDFA 2I2LA 3OYKA 3GPLA 2EE1A 1ET9A 1TWCH 2F0JA 1MJCA 1SNQA 2NTTA 4PV1C 1N33Q 3TSWA 2ZJPA 4HAEA 3SR1A 4A3IG 3HKSA 3IFDA 1TY0A 4DV6Q 2AUKA 4NS5A 4IO9A 2KOLA 3NBHB 4GZYC 2IX3A 1EQQA 3QYGB 5EQ0A 4M77D 1KLUD 2YRDA 2EYHA 2P5ZX 4ZLTF 5K36G 4II1A 1I6HH 2UUBL 2R7DA 1X56A 2UUAL 1SE4A 1BNZA 1IBLQ 2X6GA 3OYIA 1A3UA 1VQ4Q 1ARKA 2IL8A 3P7JA 1U4PA 5F2DA 2X3XD 2BTTA 2J4XA 2CQAA 1EZ8A 2F0KA 2ZPBB 2VS1A 4M77A 1BI2A 2XRQD 1STHA 5DM7R 1WTXA 2R7ZB 5LMNW 3QJ6A 1Q86U 1Q7YR 1DXMA 4JLGA 1OXSC 2R3ZA 3PUZA 3EQLC 1W2BS 4RMOA 1VMCA 1M4ZA 1JJ2P 1PA6A 2XU8A 2F2WA 3EG1A 5CYUA 3A98A 1YITQ 4X3KA 5LMNQ 4MZTA 3HOVB 5C44B 3WDNA 1JJ2A 3K58A 3EG3A 1OOTA 3CCJQ 4IFDG 3FDRA 1MD2D 4ZCKA 1PLFA 3D0FA 2MI6A 3ME9A 2EJFC 2KI7A 4GLAC 1XNQQ 3CBOA 4M78G 4J9IA 4M7AE 3GP7A 1D8LA 1NPRA 4LF4L 1S40A 1X75C 1LTTD 2LY7A 1JQYD 1P92A 4QUCA 1LLRD 4BY6C 4R8NA 4YIJA 3EAEA 3I2ZA 1Q3LA 3G4SA 2YUNA 2FO0A 1ENCA 2BE5D 1I5FA 3MXPA 1VQ5A 1KJWA 3M9BA 1PFNA 4BY1G 4KJNA 5IP7G 4J9HA 3OSOA 3HOYG 1M9SA 4FP5D 1HSQA 3HP3A 2CSIA 5IXBA 4RGNA 2L4NA 2NUTA 4YCVA 1QZGA 3MO8A 3L2WA 2BE7D 4ZGDB 2X9HA 1YJWQ 4YY3Q 2DJFC 4QIWB 2MP1A 2XIDA 1HJDA 4RGOS 1CK1A 4CJ1B 2WP8J 1EWIA 1U3OA 2PPBC 3SEMA 4PMWA 4HVUA 2B8GA 3ULJA 4GN4B 3ERSX 2JN0A 3CCUT 4DFAA 1YNND 3LGLA 5IE8A 3OWEB 4DUZL 3E3XA 2R93H 1EL0A 3VJPA 2F2VA 4M77C 2ZTCA 5C3WA 2E70A 2PVDB 3A8LB 4K14A 4DV0L 1HJPA 4PG3A 4DKAC 1E24A 1W2BP 4C3IB 2D0PA 2NUZA 3BG3A 2VXWA 2JXMB 4R8IA 4GNXA 2JA7G 5IGDA 2O31A 1NLPC 2EYQA 2HCCA 3V05A 5C4JH 1JJCB 3GTJH 4DUYL 1FJGQ 2UU9Q 2IPKD 1W2BA 5M5XB 2QA4T 2KENA 3CQZB 3A8MB 4C5EA 2MHVA 4CKCA 4ALPA 4FW1A 1PH3A 4JYAL 2PQAA 1OI1A 5M3FB 3J80L 2K6DA 1JCKB 4GKJL 1X2QA 3FEWX 2OTJA 4C8QA 2GNCA 2ESWA 1AD5A 1BI3A 3OW2S 2QGQA 3GTGH 1VQNT 4L5TA 3C1FA 3F8TA 4NP5A 2KT8A 2NB0A 4K0KL 2QQ9A 2HCKA 1AEXA 1TXYA 1YNXA 3EA6A 3RKWA 3S17B 3VS6A 5JEAJ 2RF0A 3L9AX 2XDPA 2H3EB 1KTKA 2ZZDA 3EH2A 3OS1A 1FNVA 5IYDG 3IKJA 2WAQB 5HURA 2JA5G 4QCLA 2ZPFB 4LFBQ 4NXNQ 4C0ZA 1UNSA 3DEOA 1LT5D 4DR7L 2E74C 2O4XA 1I0CA 4ELYC 1PTOF 3H91A 1GVPA 4C3HB 2ZJQA 5KYIA 3S1MB 3LGFA 4M78F 2MCNA 4ZN1A 3HSBA 4NW2A 4A3KG 2GTJA 2ES2A 2DA9A 3X3MA 3GD7A 3SK6A 4KH0B 2L55A 1G3TA 1GM5A 2CKZB 3E0JA 1XNRQ 1D0YA 1WFWA 2SEBD 4XTYA 3E6ZX 3RKYA 4HEDA 4A3GB 3NENA 2XICA 4IKFA 2B2UA 3V7RA 1GUNA 4GNXC 4KD4A 1D1CA 3FEOA 2ZJRA 1GUTA 3TCJA 5E7NA 2ZTEA 1CI3M 2IHFA 2QF7A 3H41A 2WSEE 1FWZA 1ZLMA 1EYAA 5JVG3 1WZOA 3G6EA 2WB1E 4X3TA 2K5FA 1ICFB 4Z02A 4GLKA 1UE5A 4MTKA 4B3RL 1GCQC 1J5EL 3CCEQ 1SFOH 5IGFA 4XTZA 1NYFA 2QILA 3OW2P 1V1PA 3AQQA 4I7ZC 4L5RC 3IQLA 5JJIA 4C8QC 2NYSA 2MF2A 2EYJA 1K76A 3X3NA 3A0JA 1FD7D 4MDXA 2CT3A 4AYBG 4OMOA 4PZ8A 2JM8A 3F2UA 3L42A 3OW2A 2PZUA 4JI2L 1TWCB 3VYGA 2Z4HA 1IBMQ 5KYNA 2F0IA 4GN5A 4PJLA 1IBKL 1C7YA 2KXDA 1XPUA 3VR6A 5FOBB 1J6QA 2EVRA 3HFZB 1VQ6T 1UWVA 2K6AA 4D8DA 3CCMT 4X62Q 1K9MC 1I6HB 5GANf 2RVLA 2GVAA 1I50B 2KBNA 5DM63 1MUZA 2X4JA 4M1UB 4DV5L 1QVGS 2QXFA 3GBQA 3BDCA 4J6HA 4DN4M 2DNUA 1OTCA 3S1NH 1T0JA 4BI8B 4CC4B 4QQ6A 2ZXRA 3H0HA 2JN4A 3OYAA 4B3SL 5CVIA 4MMKA 4V190 3ZFJA 3JRZA 1S72A 4PMBA 5FO8B 4R1JA 4B3TL 5KE3A 2M9VA 2RQXA 4LUVA 1EWHA 4OHJA 4UPAA 1QZHA 3Q1JA 1BCPC 4I65A 3KDFB 3KJPA 3SGIA 4UAIA 2CGHA 3HRSA 2KUMA 4UHVA 1ABOA 2DK3A 5C3EB 4JI0L 1D6EC 1KK7A 3L2ZA 4ZTJA 1JOOA 4XQJA 4M7DB 5AJ3Q 3L2QA 5LJ5f 1VQ7T 3J7A5 2WSFE 4V0BA 4ZNXA 1Y1VH 2HHHL 2JYOA 3ASKA 4RTVA 2CHBD 2Q2UA 1K83H 2N78A 4L6TB 3JV3A 4KI0A 2KEEA 4TRDA 4AG1C 4QQBX 3CCVQ 1VQMT 4F14A 3CC2Q 2K04A 2Z0WA 2DVEA 1I4HA 1KLGD 3NFCA 4H7BA 1JWMD 2E75C 5GMKh 1VQKA 1DGSA 2CYZB 5EGTA 3OTOQ 5DAUA 3MEAA 4X66L 2K5IA 3SHLA 3AMUA 1X9NA 3CCRT 1PDQA 3GTQH 1HNXL 4VUBA 2Q2HA 2LP5A 5FU7C 5GANj 3K8AA 5C5MA 3K6OA 2VGMA 1MHWC 3D4WA 3FJPA 3FP9A 3TQ7P 2AKLA 5IOCA 3NUCA 1QVGP 3BJUA 4EQOA 3K7AH 3A8OB 4NB3A 2DIQA 2QQSA 3CCLA 5C3XA 5LJ3g 1VQGA 3J81c 5D6XA 4IIOA 2DEUA 2RQVA 2VB3X 3I4MG 1C0AA 5EKIA 4BBRG 4C0GA 2ID0A 1SF9A 3ULRB 4CI0C 1R9TB 2JA6G 2D8JA 1PSEA 1QVGA 2EYYA 4RUGA 1OZ3A 3FHWA 5FKAC 2R93B 3ERQA 1KIXA 3RN5A 4RTXA 5GAOq 4LDVA 1NR4A 3UI2A 2DD4A 1K3RA 4YCWA 5IGGA 1PHJA 2H3JA 2IJ0A 1M1KR 3RMQA 2RHXA 1NBWA 4HJ5A 1M90C 2IWHA 4IJHA 4KLKA 1IHZA 1H8KA 1IW7D 4Z88A 2N3SA 1EFWA 1D5XC 3A8KE 2R5MA 1AWXA 1LTID 5KIXA 3FLGA 4EMGA 3M4GA 2Y4XA 3H15A 1UJYA 1K8AU 1BO0A 2V26A 5GMKl 4XTUA 3NELA 2ZXPA 3V8LA 4X64Q 4M78E 3UE0A 5CMDA 3AT1B 2K2MA 1N8RC 1IL8A 4P5NA 4X3SA 2CP0A 1LTLA 2VGNA 3VS2A 3SHWA 3OYLA 2DBMA 2QGFB 4E6RA 1FJGL 2JS2A 2ZAEA 3CD6Q 2EXDA 2PYKA 4PNYA 1NY4A 3IL8A 1OQKA 4KV6A 4C1NI 1H3ZA 1OXTA 2FMCA 3GTGB 4M75D 2E4HA 3MHBA 2MGSA 2HL5C 3NEMA 4DNRB 4FSSA 3W5OA 3G4SQ 1GFDA 1HNWL 2LFNA 1RLPC 2ICIA 4CKEA 1VQ5Q 3GNGA 2HUGA 2KA7A 2I46A 4XK8E 2E76C 2B86A 2M9UA 2OF1A 1K9MU 1BDOA 1PTOH 3B6YA 2CUDA 2RPNA 2RCFA 4PZ6A 4FNFA 3SK5A 1S5BD 3EG9B 2FB7A 2LDMA 4J9BA 2DTHA 3I35A 4X1VA 2OCEA 4HMJA 3JCMW 2CP5A 2BOSA 1K8OA 4GBQA 2L89A 5GMKe 4JI7L 1V1OA 2LMJA 5GAN8 4A93B 5JAVA 3K0YA 3CMAT 1LV9A 1WTHA 3DLMA 2RN8A 2JTEA 2F0DA 1T3LA 4J7IA 2IX1A 4A3DB 5L23A 4KBMB 4TVAB 1STYA 3C4SA 5IP7H 1D0ZA 3HOYH 3PGGA 3OYNA 5NUCA 2VXFA 2JTFA 1IKLA 2EPBA 2L12A 4HN7A 1RTNA 5I9OA 2PI2A 4EGVA 3FPUB 2EJ9A 4B9XA 4NOYA 4N0AA 3E19A 4JI0Q 3TDQA 4RKBA 4C0DB 1CSKA 2O88A 1Q86R 4FF1A 1FMKA 4ZKCB 2WSCE 3UF4A 1STBA 4OB2B 5A0GA 3RR5A 2E10A 3AHUA 5KCHA 1MNDA 3MP1A 2QEXT 1N9WA 1B34B 1K73U 1KQSS 2A69C 5JEAH 3HGBA 1Z7TA 4DF7A 1JE5A 1DOLA 3OYCA 1IHVA 1F77A 3QWXX 1SR3A 1G6PA 1VQ9Q 3S2DB 3I72A 1PFSA 1ZSZA 4L5GA 1LM0A 4OWXB 3CHBD 4X65Q 3I91A 4CJ0B 4P75A 2JA7H 1VQ4A 2O2LD 2XK0A 4YTLA 2L11A 3PV0A 3LH0A 1B53A 1M3AA 1I1JA 2FVUA 4PJOG 3EHQA 3EHRA 2KYMA 1X2KA 2XN9C 1JMCA 2DL3A 5CKBA 2Z6BA 4BA1I 1N34L 1YCSB 1N9SA 4J1MA 3J81i 4TSSA 3SVMA 2ZM6Q 4RTZA 4KKSA 5FRMA 2JEAI 2FHTA 2KYBA 3N6RA 3KFVA 4PLLA 2ZT9C 2E2HH 1WLPB 2RB6A 4FO2A 4Y7NB 5FWCA 5KCOA 4NXMQ 1YITA 3E9HA 1GXIE 1GUSA 1GL5A 2ZPGB 2HDMA 4UY8C 4C92G 4ZTFA 2ZTDA 2F69A 4LNQA 4WCIA 3TVTA 3S1NB 3OBWA 1PM3A 2RHUA 3MHXA 5GAMf 3E9IA 4JV5Q 3CCJA 1SNMA 3A8IE 4K5VA 2G6FX 2RQTA 3I55T 1KC8C 3RKXA 2QCPX 2XDDA 5J1ZA 2RO0A 2PUOB 3I4OA 4DR4L 1M90U 1O7YA 4OMFB 3RDVA 5CCAA 2VYTA 1SPKA 1TT2A 4NPSA 2JA5H 3ND8A 2BZYA 2OTLQ 3W1BA 2O01E 4PFOA 1TTHB 4N0AC 4LFAL 1E3PA 4HMIA 2OEOA 2EPDA 2E6NA 1TH7A 1AW7A 1EFID 1MV0B 2CP7A 1Y1VB 2EY2A 4A3KH 1KQSP 4O2DA 4N8FA 3U23A 4K8JA 2L8DA 5CV9A 3KF8B 1VQBA 5C4HA 1G3YA 1ZQ1A 1K83B 1YWPA 3G6EQ 1FMVA 1NSNS 1YJWA 2HNIA 2JM9A 4BI4A 1X32A 3QKJA 2RDHA 2KT1A 4RG1A 1KQ1A 4E7IA 1KQSA 3P8DA 4A3BH 5C4ZA 3HRZC 2MPXC 3T53B 1RJTA 4AYBE 1HA5A 3TP8A 1OXVA 3HOXG 3RIRA 1JE4A 2A28A 1CUKA 3RUZA 4JI5Q 4M4ZA 4FSXA 1DOKA 3J7AV 2Z9HA 5KGUA 1KIKA 2LMCB 1R4PB 1TWBA 4LF9L 4XXEA 3GTQB 1QKWA 3Q8DA 3CPFA 2PQEA 4MZMA 2BIVA 1PNJA 4ULLA 5M3MH 5LJ3e 4ME3A 5KYXB 1NR2A 3JAMc 4M7DD 4Z89A 1GBRA 2K5LA 2RNAA 5GAMj 5DNFA 4DAYB 3PF4A 1JO8A 3OYDA 2B2WC 2WV6D 1PRMC 2QQAA 1CKBA 1Z47A 3NWSA 4BE1A 2MAMA 2R58A 4DV3L 1HA6A 4EVOA 3EROA 3K7AB 3M0RA 3KDFA 2HAXA 4EMHA 3A55A 1ESRA 2FYKA 2LCLA 2RHQB 1IB8A 5M3MG 4RTUA 2F52A 4B3ML 1V1QA 4M7DA 1OULA 1VQPT 3OSVA 3TS2A 2C06A 1PG5B 2MJ8A 5D6YA 3PUYA 4PJOF 1Y14B 4X34A 4DV1Q 4QMGA 2EYOA 1XXGA 1QQJA 4LDWA 3CMET 2PQAB 2J6FA 2PU9B 3FKIB 2A68D 1D7QA 3HOUB 3QYHB 2F3WA 2CT4A 4DK6C 4RTYA 4OB0B 3ULPA 1AWJA 1TUDA 1N32Q 3RZOB 2EY5A 3UDXA 1Y69U 4C92F 3NHHA 1GCPA 4UP9A 4NL2A 2V1RA 4M7AD 2FPEA 1EOVA 5IWAL 1NZ9A 1SAPA 3EGXB 1ILQA 1AWOA 2F03A 1Q82C 2YHTA 1RKNA 4P74A 1ENFA 1F9PA 3JB9G 3FRNA 1PYBA 1K0SA 2F3VA 2C0IA 3UDFA 4DNTB 1TOVA 2J7ZA 1LUZA 3H3VI 2HQHA 3MTSA 4C5IA 4F7UB 1BU1A 4X9DA 2GN5A 7AT1B 3PMIA 2RD1A 2I5LX 3DWQA 5I4DA 1X55A 3JCMh 3M58A 4LUDA 2O9SA 2A8VA 3SXHA 1Y8PB 4F17A 2SDFA 3J80E 3FVQA 3U4ZA 2KROA 2DYIA 1WI5A 3VUZA 3MPUB 4J9DA 3CC4T 1CM9A 1L0YB 3QR8A 3UE1A 2UUBQ 1YFNA 2OWOA 4OWWB 1RACB 5FLXc 2UUAQ 1KC8U 4CDCC 2XIWA 1KDCA 1WTRA 1VQOT 4CGYB 2NVYH 2HBWA 1H92A 3BFMA 1M2OA 5IY0A 3CCEA 1GUOA 3ZYYX 4DGZA 1Y1WG 1M1GA 2XI9A 5BR8L 1M27C 4M7DC 4HJ8A 2F0LA 2Y90A 1WHJA 1VQLT 1MI2A 2F0NA 1KFZA 3L7ZC 2IHEA 4X6AH 1O9SA 1WA7A 2DBKA 3VYUA 2VASA 4N8X1 3NTIA 4OVAA 5C4XG 3S1QH 1NMGA 1YI2T 3I4MH 4OX9L 2J05A 2FPDA 4BBRH 1PH5A 3PO3H 1FYNA 1PHTA 3SDZA 1N36L 3QIIA 3GP8A 1UJ0A 1OYXA 2L2PA 5AYFA 1NEGA 3JB9I 4KKTA 3C2PA 1ZHIA 1D5ZC 1KAWA 2Z0SA 2UXDQ 4A3EG 3NTHA 4M77G 4LF4Q 2A73B 3PO2H 2YUQA 1PRTD 4K2LA 1RDPD 1R8OB 1VOMA 3TU4K 2FZCB 1NJIU 4A4IA 3OY9A 3G71Q 2B63B 3EG9A 3JAMi 3VS7A 2MO0A 1FGUA 1C8CA 5HKCA 4FVMA 3HFNA 2V8JA 2X4YA 1K4US 3OYYA 5EAYA 2EYLA 2FFKB 4LF6L 3RMHA 2N88A 3EFSA 5DLOA 2E1HA 4BB7A 3W3AA 4QVDA 2R7FA 2DX1A 1MMDA 1BVSA 4GLVB 1T3SA 1BI1A 1HTPA 3T51B 1WTVA 3M5AA 1E2VA 4ZKBB 3PNWC 3SWNA 3CC7T 2B29A 2VUMB 5FWBA 4WJ4A 1CA6A 1Y96B 3OA6A 2MQHA 4BBSH 2SEMA 5HCKA 3ZL7C 5I2SA 3LX0A 5A35A 5FW9A 1Y8NB 2EKOA 2PMZB 4MHEA 3NK9A 4DUZQ 1PVOA 3CC2A 1AHJB 2Y0SB 3NTKA 2IG0A 4KUDK 3JB9F 2D6FA 2M0OA 2MWPA 3LX7A 3JCMV 2B2YA 2F0MA 4DV0Q 4RCCA 4K5XA 1B34A 4L59A 4HCSA 4RGMA 3OS5A 1UE7A 3CCUQ 2XD0A 5GAHC 4BD3A 1PH2A 3QB3A 1T9HA 1NLOC 3H0GG 5EPKA 3HKZG 4R56A 2MIOA 1HFNA 4KTAA 3J7ZC 1YN8A 3AEVA 3WOFA 5A2QL 5BN4A 4MIUA 3PSIA 2F5KA 3M4YA 4JYAQ 4ELZC 1VQKT 1KAAA 2BUDA 3HZXA 4UP8A 1V8QA 2EZVA 3I90A 4GKJQ 5I11A 1N27A 3PIPA 2KECA 2EJGC 1K8AR 2EJMA 4Q0FA 1EX4A 3A7LA 1QE6A 1F9RA 2EBPA 3HRUA 1I94L 1RCVD 2JA8B 4A3BB 1SHGA 3KJOA 3E2UA 1PZKD 2NUCA 4PJOE 2EY1A 4RKUE 3TP5A 2KCTA 2LXKA 2VY3A 2VQFL 3EGUA 3C1EA 3PCOB 1LTSD 1IYJB 3QSUA 2P0QA 2YSQA 4J6YA 4A53A 3JCMJ 4DR3Q 4JI4Q 4C0FA 1IYVA 2K01A 2TSSA 3LWEA 3I8ZA 3A1PA 4QVCA 4KK7A 1B70B 2M0YA 4C92E 1EY9A 3RLOA 4A3FH 3MFGA 4DBHA 4EMKC 1K9MR 3P8BB 3E1SA 3PGZA 8AT1B 4DR7Q 2X6LA 2JMCA 1SYGA 3RLNA 4JI3L 3I4NH 2F0QA 4C8QG 2WINB 4LWCA 4HA8A 1ET6A 4N9PA 2L1BA 4M77F 3MP6A 4ZAIA 1NBEB 4IN3A 4DR2L 2HCIA 4C0DC 3JCMd 1JICA 4XQ3A 1HPCA 5ELBA 4C3JH 3H6ZA 1JU5C 4CC3A 3CD6A 1MBYA 3D6WA 4L8JA 5ELCA 1IL2A 1QWYA 2NUPB 2B2YC 2R61A 4JCVE 2RQWA 1GKHA 2EQSA 2HQXA 2EXZA 2KQ3A 1H3HA 3KF8A 4H02A 4DAPA 2COZA 3S15H 1OZ2A 3U9OA 3TS0A 4KD3A 2A08A 4FXDA 1TG0A 3M4QA 2FG0A 4XU3A 3S3OA 1TWGB 1Q46A 4XTWA 3SEBA 3VR4A 4DA2A 2RI2A 3LYIA 2KSSA 5K5PA 5KEEA 1UUPA 4O1NA 1RUWA 1DCZA 1K0XA 4B3RQ 3PIOA 3X28B 5KYLA 2QQRA 4A3JB 1ML0D 5D65A 1JC7A 1II3A 1K73R 4OONA 4LFBL 2JK8A 1YCYA 3OYHA 3X20B 2OX7A 5KYXA 3P20A 2NZHA 1JQQA 4M75B 4IFDJ 4DAYA 4H44C 2YLBA 1MSHA 2HQEA 4DR1Q 4JI2Q 4QB4A 1FNUA 3NQIA 2MK5A 4KHZA 2RA4A 4KY6A 4ZN3A 2KHIA 2HIVA 2LQKA 3OW7A 1IBKQ 1N6AA 2JTMA 1W4SA 4HSVA 4NKLA 2HQLA 3BU2A 4IFDI 2LT4A 1BIBA 5IYBG 3R6OA 5GAGC 1M30A 3META 2FL7A 4OIJA 1R77A 2O5JC 2NVQB 4ID6A 3M0TA 4DV5Q 3INZA 3V7CA 3UDCA 3U50C 2ROLA 3A8GB 4JRQA 1VQ6Q 3GTMH 4R55A 1YIJA 3IFTA 1G3WA 2K79A 2RSNA 3CCMQ 5CV4A 2NYZD 3PIO3 3HOZG 2LCCA 1VQ9A 1PYSB 2RJCA 5JJLA 1WIEA 2EQMA 2KAFA 1K1ZA 4J7FA 2LCSA 4B6MA 2NN6G 4RGTA 5C6AA 1X27A 5CQXA 3THKA 4XQQA 1UDLA 2XHCA 2C0TA 4LF5Q 2ZXOA 1A6XA 1AN8A 5GAN4 3KOJA 4FXKC 5KH6A 4ZUJA 2Q8IB 2XKOC 1M90R 4BACA 1TWAB 2YXYA 3H3VH 3S1QB 1B7YB 3PQIA 2UXDL 3H0FA 1ZSZB 1FL0A 4A63B 3EGXA 3A54A 1PXUA 1TUGB 5DEHA 2ZPEB 4AIMA 5KYUA 1G5VA 1PTOD 3M54A 4IUVA 1G8XA 2CS7A 2YDLA 3BZCA 1YP5A 3LGJA 3I9QA 1NG2A 4M78D 1U5KA 2JP1A 3NQTA 3MVVA 1V9PA 1WCMB 4GOPB 1Z6HA 1VQ7Q 4C8QF 4GN3B 4R9WA 2J06A 3JCMX 4IURA 2LT1A 1H9RA 1KL9A 1Q81C 1YZ6A 2BE5C 4AQYL 3S1RH 1ZSGA 4CKBA 4F7UA 2R92H 1SNOA 3PO2B 1I4PA 3UATA 4PNOA 1I3QH 1YVCA 1WI7A 1QCFA 4M78A 1RTOA 1IZ6A 4X66Q 2JA9A 1EY7A 1VQMQ 2COWA 3F70A 2E3HA 2BA0A 2OJ2A 2MPMA 4DQ2A 2VL6A 1ZBJA 5TSSA 2RHIA 1HNXQ 2CZ1B 2KNBB 3BVMA 1H9MA 1KHCA 4JZ4A 2OTLA 1YEZA 2NWMA 4N4IA 1UUEA 1X6OA 1IXDA 4WF2A 5GROA 4QUFA 1YJNT 2RM4A 3H8ZA 3PMTA 2QTXA 1RAAB 5ELEA 4JJCA 2B3GA 1A0IA 1J8IA 5M5WH 3L2RA 4CJ2C 1YNNC 1UGSB 3JB9H 2CW0D 4A3MH 1PCXA 3G6JB 2EGCA 1DJRD 4LJZC 5ELFA 4OO1H 4BBSB 1VQ8T 4KHPQ 4LF7L 3PFSA 1BCPF 2KCNA 1WGSA 2MO1A 4BY7H 5C0MA 1LT4D 3V8KA 2D0NA 1TS5A 3TQYA 4CC2A 3ZBDA 2AKKA 3EG2A 1NPPA 1IYUA 1Q8KA 1SBBB 4A3CH 3GTLH 3S2HH 3CCQA 3BYTB 4FF4A 5DM73 5D7UA 2E5KA 5IGCA 4IUTA 3TSSA 1Z9QA 3HS0C 1UE9A 5IT9E 3Q24A 4HJ7A 2K5DA 4IOAA 2R7ZG 4ESRA 1T0HA 4J83A 1Y1WH 2PQWA 1F2ZA 4Z8AA 3EIVA 1LACA 2DGYA 4M77E 1GUGA 5C5LA 2HIXA 2QW7A 2CSQA 2RQRA 2DJGC 1X65A 2P4RA 1B9NA 3O13A 1EU4A 4XTVA 1X3EA 2H4OA 1X6BA 4OGCA 1D09B 4OGEA 3STBD 3RZDH 4FF2A 3HOVG 5C44G 3L2PA 1YNJD 3NBIA 1YHQT 4DV4Q 1HNWQ 3C95A 5GJWB 1SYCA 3GQBA 2GGRA 2CKKA 2YU9H 5IYCG 3K59A 3KXTA 3CF5A 1Q7YC 2GFAA 1IXRA 1SNDA 1Y96A 4LE9A 5IP9G 4DOWA 3C46A 3HP9A 3S24A 1B4OA 4A3EH 2E2IH 2YYZA 3JCMc 4DEXA 1CKNA 4A3FB 1PWTA 2B2UC 3VS1A 3I70A 2V1CC 2A36A 2FRYA 3QPHA 3I4NB 2HBPA 2ED0A 3I73A 5H1SE 1BR9A 1ICWA 1S4ZA 1S5CD 4JBMA 2E12A 3KUFA 2BCOA 2ZPHB 3VKIA 2L0AA 2KVQG 5ELNA 4E7ZA 4POGA 3GTPH 1KC8R 2AKWB 2TMPA 1EQVA 2A3LA 2JEBI 2O5IC 1B8AA 1VQIA 4WJWA 2ENMA 3BZKA 4U673 4FYDA 4C3JB 4OMQA 4NL3A 2A1AA 2HL3A 1VUBA 3CMAQ 1BBXC 3GTOH 3K57A 2EQKA 4XT3B 1WD1A 5CK9A 4PFPA 3EJIA 1B1ZA 1OU9A 4JRPA 1A0NB 2KCMA 1S1NA 3HKZE 5CC4A 3S15B 3REAB 2K1BA 2K05A 5CIUA 2FPFA 3MEUA 4E7JA 4B08A 3QWNA 1HHVA 2ABLA 2XG8D 1SYDA 5I6YA 4ATOA 4CRIA 2XSCA 2UXBQ 4KHVA 1CA5A 4C3IG 4BY7G 2FHDA 1VQEA 1RD9D 4K6LA 2LQWA 5KYWB 1BCOA 4Y92A 1E0BA 5IH2A 2X4WA 4A4GA 4BDYA 4M7AB 1O7IA 4HTHA 3AFQA 2UXCL 3KLWA 2RJDA 3CPWS 4XIGS 3SD4A 4V2SA 1GJXA 2CP2A 1JWUD 1PD0A 3FB9A 5IHNA 5GANh 1AWWA 2JSOA 3M0PA 4IUNA 4A3IH 1WTOA 2GVBA 1G91A 4KRTA 1HR0L 2KEAA 3FIFA 5M3FG 1O75A 1NJIR 4J8QA 1N34Q 1TR5A 4B9WA 5LJ5j 2DEQA 4DAMA 1S5ED 1Q8IA 3DKMA 4C1NK 1A3TA 5K36H 1HUNA 4LUOA 4FT2A 5I21A 2VQEL 3NWTA 2K57A 1X01A 3HTRA 5BN3A 1XQHA 5J39A 1XWEA 4J6XA 4QW2A 5C4JB 1VIFA 1PH1A 4C8QE 3GTJB 1RL2A 1OXXK 5LMUL 2EQIA 3OWFA 1ABQA 2CZ7B 4K0KQ 2NUPA 2KVMA 3QDRB 3NPFA 1LO5D 4QY7A 3K80C 4RH6A 3GTMB 2PVGB 3K5OA 2KR3A 1J3TA 4KKUA 3MP8A 1AZQA 1G8ZD 4J9FA 2WAQG 4G7HC 1HTLD 1DONA 1U5SA 2B2TA 4KY5A 4DR4Q 2E41A 3SB2A 4DXGA 3LWUA 1SROA 3PF5A 1LTBD 1D1AA 1W6XA 1F2LA 3BW1A 3I55Q 3G71A 2AMCB 4C3HG 3RNUA 4LFAQ 5CV5A 4A3LG 5LJ3f 1QP3A 1SJED 3I4LA 2MFIA 2NVTH 1EIFA 1IBML 4IFDH 2AWNA 1NE8A 1XMQL 4XYQA 3MAQA 2DKGA 2LNVA 5T1GA 4R4IA 4M75A 1QVCA 5GMKm 4GKKL 1HD3A 4A3GG 1YJ9T 4X62L 1ZYRD 2N8NA 2HZYA 3VR2A 4EQNA 2AHJB 2RJFA 1EQTA 3CPWP 2KDSA 3WVEB 2EDGA 4DR5L 1PRTB 4C56C 2R92B 2AQ1B 1Q7YU 1T5EA 2EWNA 1I3QB 3VYHB 1OXUA 4M8AA 4BY1H 1U4RA 1TUCA 4LDUA 3JCMQ 2OQ0A 3CPWA 2RMOA 4LF9Q 4K6DA 1UB4A 1TSFA 1WQWA 3VS5A 2DXBA 3SWNB 1ASZA 1QCBD 1MIUA 2CH4W 2KXCA 3CCUA 4RCBA 5ECAA 2F0OA 4J8OA 2JT4A 2EAYA 1O80A 2VKNA 4JBWA 5L37A 2F1MA 4HR7B 3VA7A 1VQDA 2Q8RE 1FX7A 4DV7L 4RG8A 2RK2A 4FXGC 1GRIA 4YWKA 2OQKA 3CCVT 2F4VL 1J9OA 2KRSA 4HCZA 4DV3Q 1EZZB 3I5RA 5KYYB 4H13C 5M5WB 4CBVA 2QASA 2RJEA 4CDFC 1FR3A 1CZGA 4A3MB 5GANe 3S3NA 1PSFA 1AT1B 1YIJQ 4B3MQ 3DEPA 3K7UC 4HJAA 1SHFA 2W0ZA 4TKOB 1ZUUA 2QA4A 5GAOl 2B2VA 1H9SB 2K5QA 3FRPB 1AE3A 5COYA 1SFOB 1GO3E 1U4LA 1UGVA 5LJ3j 2DL8A 1IW7C 4IPHA 3OYEA 3SK8A 3CCSQ 1LJOA 1QILA 3X26B 4JI8L 2LRQA 3DB3A 4GOPA 1VQPQ 1XOVA 4FU6A 1WOCA 3CW2C 3CBMA 3PUWA 1BK2A 4BUGA 5GAN2 1EOTA 3KK7A 3WOEA 2PVOB 1U1TA 5I2MA 3T1HL 3EG0A 1KQ2A 3EVQA 1SNCA 2KQWA 3CMEQ 2WB1B 5C3EG 3M4OH 5IWAQ 4M75C 5CORA 2LXJA 4M7DG 3FMCA 2R5AA 2R57A 2W10A 2A37A 2A6HD 2HKQB 2HKNA 4RWSC 1LTGD 5IT9L 1WFQA 3BS1A 3VYTA 1JOQA 4F16A 1WHMA 4N9TA 1CQVA 2XRSD 2D8HA 4EDUA 1D3BB 2E2DC 2RBMA 3MC0B 2IIMA 1PYWD 1MMAA 1ZA2B 3I56Q 1EY8A 2JA6H 4HIKA 2HHHQ 3TZUA 5FLMG 2YU9B 5A2QE 2QI2A 5IYDH 3X24B 1DD2A 2L0CA 3G7LA 1WJSA 3U4VA 1S3OA 4DBFA 5IHKA 1VMPA 2PNHA 2F0PA 3VR5A 3L3OC 1QUQB 3F2CA 2DZCA 2DD5A 3D4RA 1UECA 2YRCA 4JS5A 1EEID 3GV6A 4KN7C 1Y57A 3JCMg 1JT8A 1AH9A 1LTRD 2EYMA 1IREB 1N8RU 4EX5A 5GANd 3V8JA 1SN8A 2XWJB 4JS4A 4PJMA 3ZEHA 4OGQC 1HZCA 1BIAA 1SRLA 2SOBA 3REBB 3HPWA 4U68A 3CC4Q 3QHSA 2V1QA 3G4ST 2G9HD 2KHSA 2OT2A 4LDXA 5BR8Q 1WD0A 4JJBA 1VQ5T 2K32A 3E5SA 4DXFA 2B2VC 3QG1A 2DF6A 1ZKOA 2NWGA 1ZSZC 4TQUS 3BVZA 1VQOQ 1SG5A 1VQHA 3KBGA 3OOCA 3F1ZA 3EFOA 1ZX6A 3CCQQ 4HT8A 4F7XA 1PV4A 2E5LL 2AZVA 1JB0E 3H9NA 1SRUA 4GOPC 1X69A 3A8JE 3NSWA 4OX9Q 2R93G 1VQLQ 5LJ5d 3D31A 1N36Q 3MEFA 2P4TA 3R8BA 3OPOA 3MEVA 3GNFB 3R3OA 4BE0A 4BDZA 3QOLA 1XJVA 6AT1B 1YI2Q 5GQOA 4C5HA 1VS0A 3T1YQ 4LK1C 1C9OA 2K5HA 5GAOp 1BCMA 2LTOA 4PJOD 4E2FB 1VQ6A 1AZPA 1KSWA 5EJWA 3CCMA 1SMXA 1M8AA 3OYGA 4A3IB 4A4EA 1M4VA 4LD6A 1FMWA 3F2DA 1V1CA 2AZSA 2J0TD 5CV6A 5GADC 4A75A 2H1EA 3UDIA 2R7ZH 5JJKA 5GAMh 3KUPA 5LL6X 4OEMB 3VA5A 2AT1B 3OYBA 1NNXA 5IIFA 1JB7A 2RHZA 4FYXB 4HKEA 1M1KC 2RHYA 1S5FD 4PJOA 4KY7A 3RLFA 4LF6Q 4C92D 4C5GA 1RI0A 1SMYD 4WFN3 1CZWA 2GFUA 1OO9B 3C94A 5IODA 3K0XA 3HOVH 5C44H 2A6ED 5HGQA 2OTJT 3KLRA 3SK4A 2IW3A 5D3DA 1TKWB 1VIEA 5CQYA 4M7DF 2HSEB 4JOIA 4QGUA 2J7IA 4G4KA 1A63A 5IYCH 1VQ7A 4YWLA 4C92A 3A56A 2FZKB 1F2MA 5EKKA 1CKMA 1P8LA 4J5YA 4QIWE 1NEBA 2VVKA 3CC7Q 1AEYA 4AFUC 5KYUB 1X54A 4ZQ3A 4WJ3M 3FPPA 1D0XA 4CDDC 5KRUA 4A93G 2UUCL 3UA6A 1SYFA 5C0XG 3NMZC 4QQGA 3I5SA 1VA7A 2P0PA 2DRKA 4Y28E 5KYWA 1VQMA 5FJ8G 1JXOA 2NZ1D 3J80c 4A3DG 2RSOA 4M7AA 1YBYA 4Q5WA 1KDBA 3J81L 1NYGA 3VRYA 2B39A 1PTOB 3OSSC 3HFOA 3DXJC 2Z8LA 4M78B 5EC7A 1KNAA 2MUYA 2A7YA 1GUWA 1D1KA 4APVA 4BE2A 2PI2E 2D0QB 1I94Q 5ISRA 3R2TA 2K3BA 2L3PA 1H641 2DPPB 2OTLT 1H9KA 4IPDA 2VQFQ 4BY1B 3VU3C 2RF4A 2C0OA 1NM7A 4HCCA 5CBAE 4K11A 3HOYB 5GAOn 2IT1A 1G3SA 2WKDA 3PMFA 4JDSA 1D1BA 2CFMA 4GLXA 4EPCA 3CQTA 4AH6A 1TS4A 5T1IA 1HNZL 5FROA 3G6ET 3JB9J 1JORA 5M5XH 1OPLA 1HFGA 5HK3A 4JI3Q 2EY6A 3PVQA 4A4KA 5EKLA 5C0XI 5JVH3 3A74A 2NBFA 2F0UA 1PFBA 1X6GA 1OX9A 3QZ9B 2WAQE 3OHXC 1QVFP 3U9SA 1JJGA 4JOIC 4DR2Q 3Q22A 5GAMe 1A2UA 4N4HA 2Q2IA 1BUVT 1GBQA 4WRDA 5D3IB 2A68C 2D9UA 4YHHL 3VYSA 3NGPA 5E4WC 2JA7B 2X69A 3J81j 1QVFA 1LT6D 3HHTB 2PCFB 4JI5L 1FGBD 2BA1A 5G3LD 2I07B 1QJOA 3KFUA 3QZ5B 5ELDA 2PW5A 5CGKA 4R4TA 4DPGA 3S17H 2FJ2A 1Y71A 2LC4A 5I22A 5JJZA 3RN2A 3WXMB 2BH8A 2YTVA 3ND9A 4JW0A 1UFFA 4DV2L 4M7AC 4BXXG 3BDUA 4IALA 1M3BA 4PMCA 2NLUA 1YNZA 3VV0A 5FRNA 4WTOB 3VUBA 2QTVA 2E2HB 1BBUA 1E6GA 3QUIA 5GAN5 1S72T 4ME7A 1A15A 4RCNA 5CV7A 4AT1B 1TS9A 4QJFA 8ATCB 2LJ3A 3N5BB 1LPLA 2L3QA 3EGDA 4XU2A 3JB9D 2KCCA 3I7FA 4L63B 4C3HH 2OAWA 1OX8A 3A5UA 1Y1VG 2DM1A 3S1MH 2K4KA 3H09A 1KD1C 4DR6L 4IOCA 1F2YA 4F04B 1CKNB 4LAAA 3M7GA 2IX0A 2BDOA 1KNEA 3NE5B 2YV5A 2K7VA 1EFNA 1M5Q1 2DAQA 2K2VA 4PLIA 3CMAA 1V43A 5KYYA 3QXEB 3JCMe 4XAXB 2JA5B 4QVZA 1I5LA 1Z9FA 4JUVA 1U9RA 4P72A 5IHIA 3EFXD 2IPOB 4LN2A 2ATWA 2IY5B 2JUFA 1RODA 2XNAC 5M5YH 4DUYQ 1SRMA 3ONAB 1H9SA 2DXCA 4LF8L 2GQVA 2EYPA 3C12A 4KGXB 1CFMA 5KE2A 4ZGJB 1NAPA 3DM3A 5GJVB 1W6JA 1K0RA 3K5NA 4A3KB 2F0VA 2EJFA 1SKUB 4XU0A 1E6HA 2EGEA 5GAMd 1WX6A 1RAFB 1Q82U 2OAUA 5E3FA 2HMAA 3HG9A 1ZXTA 2QA4Q 5FO9B 4JJDA 2LJ0A 2NVXH 4QT7A 5CKHA 4KJOA 3GV3A 1QCOA 2RCNA 2JZ2A 4KGZB 4PQXA 4EQPA 1QKXA 3E9GA 3NHNA 3PUXA 3O5ZA 2B8AA 3P1HA 2D62A 4RTTA 1KRSA 3HEJA 3D3RA 1O78A 4JI6Q 5CR2A 1VQNQ 1BXTA 3CCLT 4JPBW 5I6WA 1D3BA 3LWIA 1PRTC 1SE8A 4Y52H 4M7DE 1WQ7A 3G48A 4DNIA 4DAVA 2PNIA 3OYMA 1I50H 5CKFA 3FKIG 4MTNA 3GF5A 2DERA 4AQYQ 1EYGA 3HOUG 4D6WA 2YUPA 2I0QA 3BZDB 4AYBB 2K14A 2CUBA 2PZ1A 4Y91A 3SWNC 1W1FA 2FEIA 1E7OA 1MNEA 4JI1L 4HT9A 1QUQA 1E1OA 3LWHA 1PH4A 1SE3A 1Y0MA 1OPKA 1S5DD 3PIP3 4P2CB 2K03A 2JXBA 3ZJYC 2K9GA 1XMOL 2ATCB 5C3EH 3I55A 2EOTA 3L2VA 2K52A 2C9OA 3E0EA 2JJ9A 3K5MA 1EY6A 1MMNA 1I4RA 2LKVA 4IZ8A 1M3CA 4MZPA 5DY9A 3KLSA 4L5SA 2QQBA 5I9PA 5D6WA 1HYOA 1QB5D 1R0BG 1W6KA 1ZUKA 1NUCA 3LNNA 4HCKA 1E7ZA 1XTDA 2E3IA 2PO4A 1YJNQ 4F7UG 2XTIA 2M00A 5CO7A 1EUJA 1WHHA 3G71T 3VRZA 1G83A 5FLMH 1DJ7B 5GMKi 1IHWA 4J15A 5JOBA 1J5EQ 4LF7Q 3HOWG 4GS3A 3JCMP 3TEHB 1MGQA 3CBPA 1PH6A 1I4QA 4H0LC 3F2BA 3W2DA 4LW1A 4GY5A 2CREA 1G6ZA 4FCYA 1JRIA 2YWWA 5IAYA 1VQ8Q 4ME5A 3JAML 5EPJA 5EBDA 2G5DA 4G57A 1TWFH 4IUUA 3M0SA 1DYQA 3MXGA 3URYA 4OMPA 1U06A 4HIOA 4JJNK 4XT1B 1GFCA 2JE6I 5JPNC 1KG1A 1STEA 4IPGA 2Y4YA 1XPOA 4JRKA 2EYZA 1HH2P 3PTAA 4FM4B 4JI6L 2J6OA 2V8KA 3BE3A 3L2UA 1KD1U 2DXUA 2RH2A 2F5TX 3HOXH 1L1OB 2CH4A 2XVSA 1MKHA 2DN8A 3TP6A 4LMQD 2JNGA 2LNHB 3MEHA 1SEBD 4R4CA 2Q8TA 1AZEA 5J3BA 3PVLA 1VYVA 4E7SA 1B3AA 2HDLA 3CRLC 1R9TH 2NVYB 4B3SQ 4HVWA 4Q5VA 2DY7A 5JEAG 3OYJA 4B3TQ 1KXLA 1BI0A 3RR6A 1N5ZA 2OI3A 3GDEA 3KLSX 4LFCL 3A5ZB 3VDYA 4NMZA 1M2VA 1WDXA 1UGPB 3M0QA 1BBWA 3CCSA 5EPLA 3R2IA 1NCVA 3QIAA 1A8VA 4E47A 5CKDA 1YHQQ 1VF7A 4JBKA 1VQPA 4C2MH 2KY9A 2DNCA 4C8QD 3PE0A 5IGEA 2JS0A 1N33L 3M9QA 2B63G 3TZDA 3KF6B 1HK9A 2P84A 3I4MB 1UG1A 2L3RA 1EWCA 1LYLA 1Q1EA 2OXPA 4BBRB 5BN5A 1GHKA 2CP6A 2GQIA 2A5HA 2IVWA 3CMEA 4FIBA 1VQ4T 1E22A 1GCQA 3L1AA 2COYA 3BDLA 1U4MA 2YTYA 1XNIA 1EIYB 2JW4A 1PFMA 1N8RR 4RFBA 2F1LA 4CDEC 2EYWA 5EG2A 2H5XA 2ROTA 1IBLL 4JRIA 4KUIA 2EFIA 4HSPA 3TN2A 1HXDA 1GHJA 2VUMG 3ICEA 4LNPA 3URGA 3I56A 3DMUA 3GO5A 1TVXA 1I5OB 2N49A 2K5VA 4FYYB 1YITT 1OU8A 2DXTA 4YCUA 1JXMA 5FLXL 3GIBA 2Y0SG 4DR3L 4P71A 4JI4L 1WJQA 3IRBA 3RD4A 1LVKA 5L8RE 3FC3A 2QDBA 3H94A 2I5MX 1AZGB 1RHPA 2R6GA 1RABB 3CCJT 2PZWA 1TU0B 1SJHD 2NN6I 3NP8A 3CCRQ 1BCPD 1HR0W 4F7UF 4IPCA 2KGTA 5LMNL 2BZXA 2DE0X 4A93H 5C0XH 2UXCQ 4PL6A 5CV8A 3FJ5A 5FJ8H 4ZYSA 1PH7A 4A3DH 4FYVB 4PK4A 2PUKB 4E7KA 1H95A 3Q6SA 3CC4A 1D5MC 2PW7A 1XNQL 1HR0Q 1EY5A 2F0GA 3M85A 1E2ZA 5IT9c 2ICEC 1K8MA 1VQOA 5GANg 1Q90A 4LUEA 4AG2C 1EYCA 4BA2I 3TSZA 2DO3A 2DETA 4A3BG 2JA8G 2MOXA 2VQEQ 3EFRA 4DK0A 5CAIA 2JMAA 1TQOA 5C6SA 1EZ6A 2KMTA 4JBJA 1HZAA 1G291 2CWPA 2E6ZA 1YJWT 2AWOA 1VQLA 2M16A 5M5YB 5LMUQ 2M2LA 3C3LA 1GD7A 1ZA1B 1ZUYA 5E1FA 3LH5A 2LQNA 2KRMA 3AYHB 3EFOB 3UWNA 4A54A 1YI2A 4RHRA 3S2DH 3D7SB 3BDOA 4E6IA 1BKBA 4YY3L 4QF4A 1K8AC 2VWFA 1CSQA 3O8VA 3P75A 1ENAA 2KK4A 4NDXA 4G7OC 3RESA 1PZID 5LJ5g 1IGUA 2EGAA 2NVXB 2DMOA 1W70A 2C35B 5C4XH 2MMPA 3QBYA 1PTOC 3M7NA 2Z4IA 4DR1L 4M78C 3GLXA 1KRTA 1IO6A 3C0CA 1X3QA 1N9RA 2CWAA 4ABNA 4AFQC 1XMQQ 2EVBA 4KH1B 1SEMA 1WTQA 3OIQA 2GA4B 2A0FB 5ELOA 3DB4A 3ER0A 4AFSC 2FMMA 4Y7NH 1I8FA 4GKKQ 4EQ5A 1JB3A 2GF7A 4EIKA 2I5HA 2YLCA 1ONLA 3NPPA 3VS4A 4OMMA 4IJLA 2D5DA 4XTCS 2UU9L 4JI7Q 2EQUA 3U58A 2Z1CA 3J7YW 4DR5Q 4IUPA 3VYRA 1ASYA 2MNAA 2RK1A 4PJOB 1MV3A 4HVVA 3BY7A 1YJ9Q 1OEBA 3K81C 4BXXH 2O2OA 1PMRA 2JQOA 4RTWA 1WXTA 4MMLA 3CC7A 2D0OA 1C6VX 4A3JG 1TXQA 4LF5L 1PD1A 3S16H 2DY8A 2CW0C 2L9HA 4C92B 4DV7Q 1CKAA 4OF1A 4JK1C 2DFUA 5GMKj 1I4GA 4M75G 5FU6B 2F4VQ 2DVJA 2AQ3B 4HCEA 2QDYB 3JSCA 1C0MA 3RMSA 3KBXA 4FT4A 1Q81U 1B7TA 2BZ8A 3RUXA 3CP0A 1QP2A 1ACMB 4JZ3A 2X51A 4YWMA 3OS2A 2CVRA 3N52A 4G7ZC 4NXNL 1WHGA 1K73C 1FYCA 3OIPA 4MNOA 2QEXQ 1MMGA 1UE6A 1LT3D 3NBHA 2PNRC 4DEYA 1UE1A 3G1JA 2M02A 3H0GH 5IN1A 2KRNA 4JI8Q 2DJQA 5I2XA 2K5WA 4QQDA 4FYWB 1KDAA 3DHQA 5JPMC 3UPUA 1TWFB 1Q12A 1SSHA 3DUZA 3T1HQ 3M3YH 1XNRL 2LQ8A 4J9EA 4ORZA 4DBRA 1X3PA 2F3IA 4DA4A 1WJJA 4J6WA 3GTKH 1V29B 5IXFA 1VDZA 2HD3A 4CHTB 4PKCC 1QVPA 4WORA 1PRLC 3STBC 3CKIB 1WTWA 3S6WA 1I4XA 3CCET 1YNJC 5DLQE 3M59A 2QKIC 3ULLA 3A8HB 1EY4A 4LUZA 1U0LA 3HL8A 2DNEA 3HOXB 3QJYA 3QOJA 4XYOA 3M53A 2VUBA 3PO3G 1E2WA 2VW9A 5CBEE 5LJ5h 4L6V5 2BE9B 4IIMA 3S14B 4KHPL 3TMEA 1YHBA 1LTAD 1QMCA 1JWSD 1WCMG 4HIDA 4PFZA 4ZUIA 2A69D 1JEGA 4ILWA 3MEWA 3J81E 2J6KA 1XJWB 5HGTA 3ITPA 1L0WA 3VS3A 1DM0B 4R0KA 3DM1A 3FKIH 3PO2G 1L2FA 1LOJA 3HOUH 1U8RA 2GTOA 4C2MB 2FINB 4JG2A 3E9FA 3V96A 1BOSA 3RZOH 1SYEA 2DTIA 4F7UE 4LXCA 1A62A 5HK0A 3CRKC 1JOKA 4Z9CB 5M3MB 2D9TA 1IGQA 2F0SA 1OV3A 1PZJD 2RA2A 3V7SA 1T5XD 1UEAB 1C48A 4OL7A 5GAOr 2K7AA 3M57A 3PO3B 4ODGA 1F1BB 3S1RB 1TWHH 1I07A 3A7AB 4XTXA 3DWPA 1Q82R 1HQMC 4DV4L 1JR0D 1O7ZA 2E5LQ 1HRJA 4BBSG 2EYXA 2QG9B 1WTPA 2CCZA 4D8KA 2CQOA 1NTGA 3EGDB 4R4QA 2HEQA 1WXUA 2DL5A 2HD0A 1L1OA 2ZCFB 4OB3B 2KHJA 1G2TA 1RAEB 1UGRB 4M75F 5LL6S 2F4IA 4OP0A 2LSSA 2V4DA 3MXNB 1BF4A 3HOWH 2DRMA 2CZ0B 3MCAB 5J26A 1EEFD 5AJ3L 2GBQA 2L5QA 3CEYA 4A4FA 3OBYA 1U1SA 3TRZA 1QWFA 2EKHA 1K9AA 3TREA 2LX7A 4JLIA 3CC2T 1NE3A 2VB2X 3R6NA 1W3SA 1VQFA 4MN3A 2G9DA 2L15A 2FXQA 3BVGA 4DK1A 4EMKB 2RQUA 2YTXA 1PH8A 3T16A 3I3CA 4J9GA 2ECZA 2JVVA 4CC7A 3KF6A 4BY7B 3X25B 2B2TC 4JVZA 4PZ7A 4ZRZA 5IYBH 2LJ1A 4S3SA 3G7ZA 1L0XB 2WACA 3QO3A 1LCKA 1X3FA 1WYDA 2N55A 3BYYB 5GAMg 3OTOL 3GTLB 3S2HB 1IRXA 1AOJA 1M8VA 3EBEA 1X3GA 2WKCA 4HJ9A 1VQNA 4HCBA 4BY6B 4AMCA 3T4AC 2JOYA 2ED1A 1A2TA 3HOZH 5LJ5e 2UXBL 4BI3A 2NN6H 1Y1WB 5AFWA 5LJ3h 2CZ6B 3EN2A 2GCXA 2DJZA 2K3YA 2QAZA 1HUMA 2ASBA 1B07A 4UDUC 3TP7A 1XPRA 2DUDA 1KHIA 2OTJQ 1YWOA 4A3FG 1FXXA 3OB9A 3OQ5A 5GAOm 1EIHA 3MA2B 5KNBA 5LHY1 1WHKA 1H9JA 4F88A 2UUCQ 5C4XB 2DYBA 2EW3A 4KULA 2AK5A 2B63H 1FVIA 4OB1B 4KMUC 3I4NG 1B50A 2RKSA 3DWAA 2YRVA 5EBCA 2PMZE 3MFYA 1UTIA 1RAIB 3PT9A 1RIPA 1BBZA 2SRCA 2Y0SE 1MJEA 1AP0A 4DK3C 4XQNA 1Y7XA 1ZYRC 5IGBA 4C3JG 4F87A 2AIRB 1L1OC 2A19A 3L0OA 2B2WA 3T13A 1WPYA 1Z9ZA 4RMFA 2P0KA 1UAPA 4A3EB 3OS0A 1XX8A 4M77B 2E2IB 2NZOA 1BYMA 2WIIB 5FK9C 1Q1BA 1HZBA 1E1TA 2RHSB 4XU1A 2VUMH 2QEJC 1SSFA 1PKTA 2A74C 1G2BA 1RAGB 4TVRA 4X9CA 3CD6T 2WFWA 1YJNA 1HQRD 4QL5A 3M0UA 4FL6A 1CT1D 3SE0A 2E2JH 2G3RA 3H0IA 4X64L 2E5QA 4X3UA 1KD1R 3R93A 1CQFA 1CKOA 3GTPB 2VXEA 5KNDA 2AHOB 3MJXA 5M9OA 2BKDN 3TBIB 4M7AG 1STNA 3GOXA 1G51A 2NTSA 3GTOB 4AFZC 4OMLA 2PZTA 1ZBXA 4OMNA 1VQ8A 2KE9A 4IUQA 3UDGA 2LX9A 1STGA 1HNZQ 2M51A 3RERA 3S16B 1VYTA 1O7LA 2ZGWA 1D2BA 2YUOA 5GAN7 1TY2A 3AFPA 3RNJA 4POFA 4PJNA 3S3MA 2CP3A 2X4XA 1WYXA 1RF2D 1RADB 2K3XA 2QDLA 2QGGA 2F2XA 4OIKA 9ATCB 3LW5E 4YHHQ 2JA8H 4FDBA 4RKLA 2V8IA 2F0WA 1XTCD 3V2TA 2XMFA 5GAN6 3H6MA 1CHQD 2NUTB 3H0GB 3HKZB 4KGVB 2HSPA 3JCMf 1C1AA 2KBTA 2LZ6B 2K28A 1B9MA 1NJIC 2K50A 3MZ5A 4F8MA 1ILPA 3M4PA 4DV2Q 1BB9A 2DLPA 3M3YB 1YHQA 1FNWA 4KT0E 3MWYW 1K3BC 4MDWA 2XDBA 2A6HC 1EY0A 4DBQA 2C5CA 1K8GA 5CKEA 2ZPIB 1YIJT 1QNUA 1RAHB 2H8HA 3GTKB 2HDAA 1VQ9T 2LVMA 4O6JA 1A3VA 4OELB 1PH9A 4LDYA 1M2VB 1NMFA 3MKDA 1F9QA 1ZEQX 4DU9A 4O42A 2VNUD 4R4OA 1IKMA 1STAA 3CCST 1RI9A 1MGSA 3JAME 4GNXB 4DR6Q 3M55A 1S72Q 4P73A 1QVFS 1D1IA 2X3WD 5A0LA 4E7HA 3QWYA 5GAN3 1SLJA 1TS2A 5IP9H 2Z6KA 4X65L 1VYUA 1JBMA 3M56A 1WNLA 2EQJA 2EIFA 1CSPA 1G2SA 5A0DA 4A76A 1AE2A 1YHAA 2R92G 1SYBA 4M75E 3AB9A 1UHCA 1LNXA 3Q23A 1UGQB 4LF8Q 3CAMA 4C8QB 2XGTA 1TWGH 1VCIA 1BQQT 2BDNA 3PUVA 2NVTB 3WVDB 1TU2B 2ZM6L 1AVZC 4UP7A 4J9CA 1CTMA 2DL7A 2KJXA 4A3JH 3CCRA 2DZ9A 5HY6A 1SSOA 4NXML 4ZK9B 2MWOA 3I56T 1I81A 1EIGA 1HXYD 1QNKA 1EU3A 2HT1A 1GXDC 1B3QA 2M1HA 2PTKA 2SNMA 2VC8A 3MXUA 1VQKQ 1TWHB 4O0AA 4OXPA 4JV5L 3OMCA 2VZAA 3UT1A 4BWGB 4M7AF 3Q0AA 4A3MG 3JCMb 2F0TA 1B2TA 1VF5C 3VR3A 1EQRA 2E8GA 4OO1G 4HXJA 2XWBB 2FZGB 3QDFA 4C3IH 2DIGA 2O4XB 1EYDA 5LJ3d 3QO2A 4GLMA 1QG7A 1QWEA 4L5QA 2QK0A 3D8GA 5I2YA 3HOWB 1AFPA 2YT6A 4RG2A 4PJOC 1Q86C 1HCZA 5C0XJ 2NVQH 4A3CG 3RZDB 1M1FA 1BCPB 1VQJA 3CQZH 2CDTA 3LLRA 3CCLQ 2DL4A 3UA7A 1QLYA 4E7LA 4JI1Q 3RBBB 1ESFA 5M3FH 2D2CC 3P8HA 2K33A 3CCQT 1QOHA 5KNCA 4BS9A 2Q2TA 2JJQA 2WB1G 3CXCS 4C92C 3J7AF 5FLXE 2DILA 1SMYC 5GAEC 5FU6C 4DV6L 1XMOQ 2RI5A 4ANJA 2Z6KC 3W1GA 1SE2A 1VQCA 2A6EC 1TWAH 2RDFA 3D4DA 2K5NA 2L3SA 2DTOA 2KEDA 3D6CA 4UC4A 5CR3A 4K5WA 1WHLA 1PKSA 5D14A 1QCNA 2E65A 1MSGA 1V1PB 2ENBA 4KN4C 3WWVA 4RA8A 2RI3A 3DLLA 1DOMA 4ZGEB 3FDTA 1Q95G 4FF3A 3HOZB 3AU7A 1WCMH 2AQ2B 1UEBA 1I6VC 3VS0A 2F0EA 2EJGA 1SXTA 1M8MA 2O9VA 1TS3A 2K75A 4OO1I 3T1YL 4DOVA 1R4QB 4MZ9A 2FRWA 1Y07A 5FU7B 3M4OB 4PJJA 2D1XA 1Q81R 4A4HA 2F0HA 2VV5A 5AT1B 1I4K1 3NXWA 2EYFA 3JC66 3MXNA 1P16A 4A3LH 4RAUC 5J22A 1YJ9A 1UHFA 2L5TA 3SFMA 4HIMA 1LABA 3KYHC 5E4XA 2E64A 1M1KU 5FO7B 2AUJD 2JA6B 4K8IA 2MYSA 1HZ9A 1PRTF 1C4QA 1MHNA 1K28A 1F9SA 3OMGA 2F0FA 3OYFA 4O5VA 4K2KA 4A3GH 4DV1L 1R0CB 5G3LF 3HRTA 3K5LA 2SNSA 2ALYB 4EMKA 1DZ1A 1QW1A 1JJ2S 1V76A 2B8FA 1WVLA 1VQAA 1PC0A 1KABA 1WXBA 1XYIA 1N32L 3EH1A 4I7AA 4JC0A 2K4YA 3TEEA 1CHPD 4RHSA 1RLQC 2X35A 4LD9K 2E2JB 3CU7A 1Y8OB 4XDXA 3CXCP 1SNPA 3CCVA 1TIID 4RCOA 3J80i 3T56B 3T9NA 2VB6A 3IAYA 4LFCQ 1WJRA 2QEXA 3H3VC 4QKUA 1GOZA 2QYZA 4N4GA 1X43A
chains in the Genus database with same CATH topology
1CKBA 1W6XA 2I0NA 2KGTA 2BZXA 2DE0X 3FJ5A 3M0RA 3TSWA 4RTUA 1HD3A 4LUEA 4AG2C 3TSZA 2MOXA 2J6FA 2JMAA 2CT4A 1ARKA 4RTYA 1AWJA 1TUDA 2X3XD 2BTTA 1ZUYA 1TUCA 3LH5A 2LQNA 2RMOA 1GCPA 2KRMA 3VS5A 2V1RA 2FPEA 2CH4W 2VWFA 2KXCA 5ECAA 2JT4A 2VKNA 2F2WA 1AWOA 2EGAA 3EG1A 2DMOA 1W70A 3A98A 1GRIA 2KRSA 3I5RA 1K0SA 2C0IA 3EG3A 1OOTA 1IO6A 3C0CA 1BU1A 1SHFA 2W0ZA 4AFQC 1ZUUA 1SEMA 4J9IA 4LUDA 2O9SA 4AFSC 4F17A 1UGVA 2KROA 2DL8A 4J9DA 4EIKA 3VS4A 2YUNA 2FO0A 4OMMA 1XOVA 1KJWA 1BK2A 1MV3A 4HVVA 3NMZC 2HBWA 4J9HA 1H92A 1OEBA 3EG0A 1HSQA 2O2OA 4RTWA 1M27C 1WXTA 2CSIA 5IXBA 1KFZA 1WA7A 2DBKA 2W10A 2A37A 1HJDA 1CKAA 4F16A 1U3OA 3SEMA 2D8HA 4HVUA 2J05A 2DVJA 2FPDA 1FYNA 1PHTA 2IIMA 1UJ0A 2L2PA 2F2VA 1NEGA 2BZ8A 4JZ3A 2NUZA 5IHKA 2O31A 1NLPC 2YUQA 1UECA 4DEYA 1Y57A 2KRNA 2DJQA 3VS7A 1SSHA 1SRLA 3REBB 1K4US 2V1QA 2K6DA 4J9EA 4ORZA 1X2QA 4JJBA 2GNCA 5IXFA 2ESWA 1AD5A 2DF6A 2DX1A 1PRLC 1T3SA 2KT8A 1ZX6A 2HCKA 2AZVA 5FWBA 1X69A 2SEMA 5HCKA 3VS6A 2RF0A 3ZL7C 4IIMA 5FW9A 1JEGA 2J6KA 3VS3A 4R0KA 1I0CA 2GTOA 1NLOC 1KSWA 2MIOA 2MCNA 1YN8A 2GTJA 2DA9A 1V1CA 2AZSA 1OV3A 2K7AA 5I11A 1WFWA 2EBPA 1I07A 1SHGA 3EGUA 3H41A 2EYXA 1ZLMA 2J7IA 4D8KA 2YSQA 2HEQA 1WXUA 2DL5A 1GCQC 1NYFA 1NEBA 2VVKA 2DRMA 3IQLA 1AEYA 4AFUC 2M0YA 2GBQA 1K76A 3UA6A 2CT3A 1QWFA 2JMCA 1K9AA 1VA7A 2EKHA 2DRKA 2JM8A 2LX7A 3I5SA 4OMOA 1JXOA 3R6NA 2RQUA 1NYGA 2KXDA 3VRYA 4J9GA 2ECZA 2EVRA 4CC7A 1JU5C 4CC3A 5EC7A 4D8DA 2LJ1A 2RQWA 1H3HA 1LCKA 1MUZA 3GBQA 2DNUA 1T0JA 2A08A 1AOJA 2K3BA 4CC4B 1TG0A 2FG0A 2L3PA 3H0HA 2ED1A 2C0OA 1NM7A 4K11A 1RUWA 1K0XA 1B07A 1ABOA 1YWOA 3CQTA 1OPLA 4ZNXA 2DYBA 2EW3A 2AK5A 1JQQA 3PVQA 4RTVA 1UTIA 1BBZA 2SRCA 1X6GA 3JV3A 4AG1C 4F14A 1GBQA 1Z9ZA 3NGPA 1M30A 3M0TA 1PKTA 1G2BA 2ROLA 3M0UA 5I22A 2K79A 3H0IA 1UFFA 2LP5A 1WIEA 1M3BA 1K1ZA 2LCSA 1YNZA 1X27A 3THKA 1UDLA 2AKLA 2C0TA 1E6GA 4AFZC 4OMLA 4OMNA 2KE9A 2LJ3A 2L3QA 2M51A 1VYTA 2OAWA 4IIOA 2RQVA 2DM1A 2YUOA 3H0FA 4A63B 3ULRB 3RNJA 2D8JA 2EYYA 2YDLA 4RUGA 1YP5A 1WYXA 3I9QA 1NG2A 1EFNA 4RTXA 2QDLA 2F2XA 2J06A 5IHIA 1ZSGA 4LN2A 1H8KA 4Z88A 1SRMA 2XMFA 3UATA 1WI7A 1AWXA 1QCFA 2HSPA 5GJVB 1UJYA 2KBTA 2LZ6B 2OJ2A 1ZBJA 1E6HA 2EGEA 2KNBB 1WX6A 1BB9A 2K2MA 2DLPA 4JZ4A 2NWMA 1UUEA 3VS2A 3SHWA 2DBMA 4E6RA 4JJDA 2JS2A 2LJ0A 2H8HA 4QT7A 4JJCA 2HDAA 4FSSA 1GFDA 1QKXA 3NHNA 1RLPC 3O5ZA 1RI9A 4RTTA 2EGCA 2B86A 2CUDA 2RPNA 2X3WD 4JPBW 3QWYA 1VYUA 2D0NA 4CC2A 2AKKA 3EG2A 2PNIA 3I35A 4J9BA 4X1VA 4GBQA 2YUPA 2E5KA 2LMJA 1UHCA 2CUBA 2PZ1A 2RN8A 2JTEA 1W1FA 2FEIA 1E7OA 1T3LA 1Z9QA 1UE9A 5L23A 4ESRA 1T0HA 1Y0MA 1OPKA 1AVZC 4J9CA 2DL7A 4Z8AA 2JXBA 2K9GA 2CSQA 2RQRA 2P4RA 1B3QA 2PTKA 1CSKA 1X6BA 2O88A 1M3CA 1FMKA 3UF4A 1ZUKA 5GJWB 4HCKA 2GGRA 4HXJA 4GLMA 1G83A 3QWXX 1QWEA 3VRZA 4LE9A 2YT6A 4DEXA 1PWTA 2CREA 1M3AA 3VS1A 2A36A 1I1JA 2FRYA 2CDTA 3M0SA 2ED0A 3EHQA 2KYMA 1X2KA 2DL4A 3EHRA 3UA7A 2DL3A 1QLYA 1U06A 4OMPA 3RBBB 2L0AA 1YCSB 1GFCA 4RTZA 2KYBA 2ENMA 3KFVA 2DILA 2EYZA 4OMQA 1WLPB 5FWCA 2J6OA 1GL5A 1A0NB 1S1NA 4WCIA 2CH4A 3REAB 3TVTA 2L3SA 2FPFA 2LNHB 1PKSA 1AZEA 2ABLA 1VYVA 3PVLA 2G6FX 2RQTA 4HVWA 1N5ZA 2OI3A 3VS0A 1WDXA 2LQWA 3M0QA 1M8MA 1SPKA 2O9VA 4Y92A 5IH2A 2BZYA 2FRWA 2D1XA 3PE0A 2JS0A 2EPDA 1MV0B 1UHFA 1UG1A 5IHNA 1AWWA 3M0PA 2GQIA 4KRTA 3U23A 2KEAA 1GCQA 1YWPA 2JM9A 2JW4A 2KT1A 2EYWA 2ROTA 1WXBA 2A28A 4LNPA 2EQIA 4M4ZA 1ABQA 1KIKA 1RLQC 3NPFA 1QKWA 2KR3A 1JXMA 1J3TA 4J9FA 1PNJA 1U5SA 1AZGB 4Z89A 1GBRA 2RNAA 1JO8A 1X43A 1PRMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKB A;  1W6X A;  2I0N A;  2KGT A;  2BZX A;  2DE0 X;  3FJ5 A;  3M0R A;  3TSW A;  4RTU A;  1HD3 A;  4LUE A;  4AG2 C;  3TSZ A;  2MOX A;  2J6F A;  2JMA A;  2CT4 A;  1ARK A;  4RTY A;  1AWJ A;  1TUD A;  2X3X D;  2BTT A;  1ZUY A;  1TUC A;  3LH5 A;  2LQN A;  2RMO A;  1GCP A;  2KRM A;  3VS5 A;  2V1R A;  2FPE A;  2CH4 W;  2VWF A;  2KXC A;  5ECA A;  2JT4 A;  2VKN A;  2F2W A;  1AWO A;  2EGA A;  3EG1 A;  2DMO A;  1W70 A;  3A98 A;  1GRI A;  2KRS A;  3I5R A;  1K0S A;  2C0I A;  3EG3 A;  1OOT A;  1IO6 A;  3C0C A;  1BU1 A;  1SHF A;  2W0Z A;  4AFQ C;  1ZUU A;  1SEM A;  4J9I A;  4LUD A;  2O9S A;  4AFS C;  4F17 A;  1UGV A;  2KRO A;  2DL8 A;  4J9D A;  4EIK A;  3VS4 A;  2YUN A;  2FO0 A;  4OMM A;  1XOV A;  1KJW A;  1BK2 A;  1MV3 A;  4HVV A;  3NMZ C;  2HBW A;  4J9H A;  1H92 A;  1OEB A;  3EG0 A;  1HSQ A;  2O2O A;  4RTW A;  1M27 C;  1WXT A;  2CSI A;  5IXB A;  1KFZ A;  1WA7 A;  2DBK A;  2W10 A;  2A37 A;  1HJD A;  1CKA A;  4F16 A;  1U3O A;  3SEM A;  2D8H A;  4HVU A;  2J05 A;  2DVJ A;  2FPD A;  1FYN A;  1PHT A;  2IIM A;  1UJ0 A;  2L2P A;  2F2V A;  1NEG A;  2BZ8 A;  4JZ3 A;  2NUZ A;  5IHK A;  2O31 A;  1NLP C;  2YUQ A;  1UEC A;  4DEY A;  1Y57 A;  2KRN A;  2DJQ A;  3VS7 A;  1SSH A;  1SRL A;  3REB B;  1K4U S;  2V1Q A;  2K6D A;  4J9E A;  4ORZ A;  1X2Q A;  4JJB A;  2GNC A;  5IXF A;  2ESW A;  1AD5 A;  2DF6 A;  2DX1 A;  1PRL C;  1T3S A;  2KT8 A;  1ZX6 A;  2HCK A;  2AZV A;  5FWB A;  1X69 A;  2SEM A;  5HCK A;  3VS6 A;  2RF0 A;  3ZL7 C;  4IIM A;  5FW9 A;  1JEG A;  2J6K A;  3VS3 A;  4R0K A;  1I0C A;  2GTO A;  1NLO C;  1KSW A;  2MIO A;  2MCN A;  1YN8 A;  2GTJ A;  2DA9 A;  1V1C A;  2AZS A;  1OV3 A;  2K7A A;  5I11 A;  1WFW A;  2EBP A;  1I07 A;  1SHG A;  3EGU A;  3H41 A;  2EYX A;  1ZLM A;  2J7I A;  4D8K A;  2YSQ A;  2HEQ A;  1WXU A;  2DL5 A;  1GCQ C;  1NYF A;  1NEB A;  2VVK A;  2DRM A;  3IQL A;  1AEY A;  4AFU C;  2M0Y A;  2GBQ A;  1K76 A;  3UA6 A;  2CT3 A;  1QWF A;  2JMC A;  1K9A A;  1VA7 A;  2EKH A;  2DRK A;  2JM8 A;  2LX7 A;  3I5S A;  4OMO A;  1JXO A;  3R6N A;  2RQU A;  1NYG A;  2KXD A;  3VRY A;  4J9G A;  2ECZ A;  2EVR A;  4CC7 A;  1JU5 C;  4CC3 A;  5EC7 A;  4D8D A;  2LJ1 A;  2RQW A;  1H3H A;  1LCK A;  1MUZ A;  3GBQ A;  2DNU A;  1T0J A;  2A08 A;  1AOJ A;  2K3B A;  4CC4 B;  1TG0 A;  2FG0 A;  2L3P A;  3H0H A;  2ED1 A;  2C0O A;  1NM7 A;  4K11 A;  1RUW A;  1K0X A;  1B07 A;  1ABO A;  1YWO A;  3CQT A;  1OPL A;  4ZNX A;  2DYB A;  2EW3 A;  2AK5 A;  1JQQ A;  3PVQ A;  4RTV A;  1UTI A;  1BBZ A;  2SRC A;  1X6G A;  3JV3 A;  4AG1 C;  4F14 A;  1GBQ A;  1Z9Z A;  3NGP A;  1M30 A;  3M0T A;  1PKT A;  1G2B A;  2ROL A;  3M0U A;  5I22 A;  2K79 A;  3H0I A;  1UFF A;  2LP5 A;  1WIE A;  1M3B A;  1K1Z A;  2LCS A;  1YNZ A;  1X27 A;  3THK A;  1UDL A;  2AKL A;  2C0T A;  1E6G A;  4AFZ C;  4OML A;  4OMN A;  2KE9 A;  2LJ3 A;  2L3Q A;  2M51 A;  1VYT A;  2OAW A;  4IIO A;  2RQV A;  2DM1 A;  2YUO A;  3H0F A;  4A63 B;  3ULR B;  3RNJ A;  2D8J A;  2EYY A;  2YDL A;  4RUG A;  1YP5 A;  1WYX A;  3I9Q A;  1NG2 A;  1EFN A;  4RTX A;  2QDL A;  2F2X A;  2J06 A;  5IHI A;  1ZSG A;  4LN2 A;  1H8K A;  4Z88 A;  1SRM A;  2XMF A;  3UAT A;  1WI7 A;  1AWX A;  1QCF A;  2HSP A;  5GJV B;  1UJY A;  2KBT A;  2LZ6 B;  2OJ2 A;  1ZBJ A;  1E6H A;  2EGE A;  2KNB B;  1WX6 A;  1BB9 A;  2K2M A;  2DLP A;  4JZ4 A;  2NWM A;  1UUE A;  3VS2 A;  3SHW A;  2DBM A;  4E6R A;  4JJD A;  2JS2 A;  2LJ0 A;  2H8H A;  4QT7 A;  4JJC A;  2HDA A;  4FSS A;  1GFD A;  1QKX A;  3NHN A;  1RLP C;  3O5Z A;  1RI9 A;  4RTT A;  2EGC A;  2B86 A;  2CUD A;  2RPN A;  2X3W D;  4JPB W;  3QWY A;  1VYU A;  2D0N A;  4CC2 A;  2AKK A;  3EG2 A;  2PNI A;  3I35 A;  4J9B A;  4X1V A;  4GBQ A;  2YUP A;  2E5K A;  2LMJ A;  1UHC A;  2CUB A;  2PZ1 A;  2RN8 A;  2JTE A;  1W1F A;  2FEI A;  1E7O A;  1T3L A;  1Z9Q A;  1UE9 A;  5L23 A;  4ESR A;  1T0H A;  1Y0M A;  1OPK A;  1AVZ C;  4J9C A;  2DL7 A;  4Z8A A;  2JXB A;  2K9G A;  2CSQ A;  2RQR A;  2P4R A;  1B3Q A;  2PTK A;  1CSK A;  1X6B A;  2O88 A;  1M3C A;  1FMK A;  3UF4 A;  1ZUK A;  5GJW B;  4HCK A;  2GGR A;  4HXJ A;  4GLM A;  1G83 A;  3QWX X;  1QWE A;  3VRZ A;  4LE9 A;  2YT6 A;  4DEX A;  1PWT A;  2CRE A;  1M3A A;  3VS1 A;  2A36 A;  1I1J A;  2FRY A;  2CDT A;  3M0S A;  2ED0 A;  3EHQ A;  2KYM A;  1X2K A;  2DL4 A;  3EHR A;  3UA7 A;  2DL3 A;  1QLY A;  1U06 A;  4OMP A;  3RBB B;  2L0A A;  1YCS B;  1GFC A;  4RTZ A;  2KYB A;  2ENM A;  3KFV A;  2DIL A;  2EYZ A;  4OMQ A;  1WLP B;  5FWC A;  2J6O A;  1GL5 A;  1A0N B;  1S1N A;  4WCI A;  2CH4 A;  3REA B;  3TVT A;  2L3S A;  2FPF A;  2LNH B;  1PKS A;  1AZE A;  2ABL A;  1VYV A;  3PVL A;  2G6F X;  2RQT A;  4HVW A;  1N5Z A;  2OI3 A;  3VS0 A;  1WDX A;  2LQW A;  3M0Q A;  1M8M A;  1SPK A;  2O9V A;  4Y92 A;  5IH2 A;  2BZY A;  2FRW A;  2D1X A;  3PE0 A;  2JS0 A;  2EPD A;  1MV0 B;  1UHF A;  1UG1 A;  5IHN A;  1AWW A;  3M0P A;  2GQI A;  4KRT A;  3U23 A;  2KEA A;  1GCQ A;  1YWP A;  2JM9 A;  2JW4 A;  2KT1 A;  2EYW A;  2ROT A;  1WXB A;  2A28 A;  4LNP A;  2EQI A;  4M4Z A;  1ABQ A;  1KIK A;  1RLQ C;  3NPF A;  1QKW A;  2KR3 A;  1JXM A;  1J3T A;  4J9F A;  1PNJ A;  1U5S A;  1AZG B;  4Z89 A;  1GBR A;  2RNA A;  1JO8 A;  1X43 A;  1PRM C; 
#chains in the Genus database with same CATH topology
 2LS0 1;  3CXC A;  2I0N A;  1B44 D;  2BH2 A;  4IQZ A;  4OWT B;  4FW2 A;  2RDG A;  3S14 H;  3S9W A;  1SDF A;  2I2L A;  3OYK A;  3GPL A;  2EE1 A;  1ET9 A;  1TWC H;  2F0J A;  1MJC A;  1SNQ A;  2NTT A;  4PV1 C;  1N33 Q;  3TSW A;  2ZJP A;  4HAE A;  3SR1 A;  4A3I G;  3HKS A;  3IFD A;  1TY0 A;  4DV6 Q;  2AUK A;  4NS5 A;  4IO9 A;  2KOL A;  3NBH B;  4GZY C;  2IX3 A;  1EQQ A;  3QYG B;  5EQ0 A;  4M77 D;  1KLU D;  2YRD A;  2EYH A;  2P5Z X;  4ZLT F;  5K36 G;  4II1 A;  1I6H H;  2UUB L;  2R7D A;  1X56 A;  2UUA L;  1SE4 A;  1BNZ A;  1IBL Q;  2X6G A;  3OYI A;  1A3U A;  1VQ4 Q;  1ARK A;  2IL8 A;  3P7J A;  1U4P A;  5F2D A;  2X3X D;  2BTT A;  2J4X A;  2CQA A;  1EZ8 A;  2F0K A;  2ZPB B;  2VS1 A;  4M77 A;  1BI2 A;  2XRQ D;  1STH A;  5DM7 R;  1WTX A;  2R7Z B;  5LMN W;  3QJ6 A;  1Q86 U;  1Q7Y R;  1DXM A;  4JLG A;  1OXS C;  2R3Z A;  3PUZ A;  3EQL C;  1W2B S;  4RMO A;  1VMC A;  1M4Z A;  1JJ2 P;  1PA6 A;  2XU8 A;  2F2W A;  3EG1 A;  5CYU A;  3A98 A;  1YIT Q;  4X3K A;  5LMN Q;  4MZT A;  3HOV B;  5C44 B;  3WDN A;  1JJ2 A;  3K58 A;  3EG3 A;  1OOT A;  3CCJ Q;  4IFD G;  3FDR A;  1MD2 D;  4ZCK A;  1PLF A;  3D0F A;  2MI6 A;  3ME9 A;  2EJF C;  2KI7 A;  4GLA C;  1XNQ Q;  3CBO A;  4M78 G;  4J9I A;  4M7A E;  3GP7 A;  1D8L A;  1NPR A;  4LF4 L;  1S40 A;  1X75 C;  1LTT D;  2LY7 A;  1JQY D;  1P92 A;  4QUC A;  1LLR D;  4BY6 C;  4R8N A;  4YIJ A;  3EAE A;  3I2Z A;  1Q3L A;  3G4S A;  2YUN A;  2FO0 A;  1ENC A;  2BE5 D;  1I5F A;  3MXP A;  1VQ5 A;  1KJW A;  3M9B A;  1PFN A;  4BY1 G;  4KJN A;  5IP7 G;  4J9H A;  3OSO A;  3HOY G;  1M9S A;  4FP5 D;  1HSQ A;  3HP3 A;  2CSI A;  5IXB A;  4RGN A;  2L4N A;  2NUT A;  4YCV A;  1QZG A;  3MO8 A;  3L2W A;  2BE7 D;  4ZGD B;  2X9H A;  1YJW Q;  4YY3 Q;  2DJF C;  4QIW B;  2MP1 A;  2XID A;  1HJD A;  4RGO S;  1CK1 A;  4CJ1 B;  2WP8 J;  1EWI A;  1U3O A;  2PPB C;  3SEM A;  4PMW A;  4HVU A;  2B8G A;  3ULJ A;  4GN4 B;  3ERS X;  2JN0 A;  3CCU T;  4DFA A;  1YNN D;  3LGL A;  5IE8 A;  3OWE B;  4DUZ L;  3E3X A;  2R93 H;  1EL0 A;  3VJP A;  2F2V A;  4M77 C;  2ZTC A;  5C3W A;  2E70 A;  2PVD B;  3A8L B;  4K14 A;  4DV0 L;  1HJP A;  4PG3 A;  4DKA C;  1E24 A;  1W2B P;  4C3I B;  2D0P A;  2NUZ A;  3BG3 A;  2VXW A;  2JXM B;  4R8I A;  4GNX A;  2JA7 G;  5IGD A;  2O31 A;  1NLP C;  2EYQ A;  2HCC A;  3V05 A;  5C4J H;  1JJC B;  3GTJ H;  4DUY L;  1FJG Q;  2UU9 Q;  2IPK D;  1W2B A;  5M5X B;  2QA4 T;  2KEN A;  3CQZ B;  3A8M B;  4C5E A;  2MHV A;  4CKC A;  4ALP A;  4FW1 A;  1PH3 A;  4JYA L;  2PQA A;  1OI1 A;  5M3F B;  3J80 L;  2K6D A;  1JCK B;  4GKJ L;  1X2Q A;  3FEW X;  2OTJ A;  4C8Q A;  2GNC A;  2ESW A;  1AD5 A;  1BI3 A;  3OW2 S;  2QGQ A;  3GTG H;  1VQN T;  4L5T A;  3C1F A;  3F8T A;  4NP5 A;  2KT8 A;  2NB0 A;  4K0K L;  2QQ9 A;  2HCK A;  1AEX A;  1TXY A;  1YNX A;  3EA6 A;  3RKW A;  3S17 B;  3VS6 A;  5JEA J;  2RF0 A;  3L9A X;  2XDP A;  2H3E B;  1KTK A;  2ZZD A;  3EH2 A;  3OS1 A;  1FNV A;  5IYD G;  3IKJ A;  2WAQ B;  5HUR A;  2JA5 G;  4QCL A;  2ZPF B;  4LFB Q;  4NXN Q;  4C0Z A;  1UNS A;  3DEO A;  1LT5 D;  4DR7 L;  2E74 C;  2O4X A;  1I0C A;  4ELY C;  1PTO F;  3H91 A;  1GVP A;  4C3H B;  2ZJQ A;  5KYI A;  3S1M B;  3LGF A;  4M78 F;  2MCN A;  4ZN1 A;  3HSB A;  4NW2 A;  4A3K G;  2GTJ A;  2ES2 A;  2DA9 A;  3X3M A;  3GD7 A;  3SK6 A;  4KH0 B;  2L55 A;  1G3T A;  1GM5 A;  2CKZ B;  3E0J A;  1XNR Q;  1D0Y A;  1WFW A;  2SEB D;  4XTY A;  3E6Z X;  3RKY A;  4HED A;  4A3G B;  3NEN A;  2XIC A;  4IKF A;  2B2U A;  3V7R A;  1GUN A;  4GNX C;  4KD4 A;  1D1C A;  3FEO A;  2ZJR A;  1GUT A;  3TCJ A;  5E7N A;  2ZTE A;  1CI3 M;  2IHF A;  2QF7 A;  3H41 A;  2WSE E;  1FWZ A;  1ZLM A;  1EYA A;  5JVG 3;  1WZO A;  3G6E A;  2WB1 E;  4X3T A;  2K5F A;  1ICF B;  4Z02 A;  4GLK A;  1UE5 A;  4MTK A;  4B3R L;  1GCQ C;  1J5E L;  3CCE Q;  1SFO H;  5IGF A;  4XTZ A;  1NYF A;  2QIL A;  3OW2 P;  1V1P A;  3AQQ A;  4I7Z C;  4L5R C;  3IQL A;  5JJI A;  4C8Q C;  2NYS A;  2MF2 A;  2EYJ A;  1K76 A;  3X3N A;  3A0J A;  1FD7 D;  4MDX A;  2CT3 A;  4AYB G;  4OMO A;  4PZ8 A;  2JM8 A;  3F2U A;  3L42 A;  3OW2 A;  2PZU A;  4JI2 L;  1TWC B;  3VYG A;  2Z4H A;  1IBM Q;  5KYN A;  2F0I A;  4GN5 A;  4PJL A;  1IBK L;  1C7Y A;  2KXD A;  1XPU A;  3VR6 A;  5FOB B;  1J6Q A;  2EVR A;  3HFZ B;  1VQ6 T;  1UWV A;  2K6A A;  4D8D A;  3CCM T;  4X62 Q;  1K9M C;  1I6H B;  5GAN f;  2RVL A;  2GVA A;  1I50 B;  2KBN A;  5DM6 3;  1MUZ A;  2X4J A;  4M1U B;  4DV5 L;  1QVG S;  2QXF A;  3GBQ A;  3BDC A;  4J6H A;  4DN4 M;  2DNU A;  1OTC A;  3S1N H;  1T0J A;  4BI8 B;  4CC4 B;  4QQ6 A;  2ZXR A;  3H0H A;  2JN4 A;  3OYA A;  4B3S L;  5CVI A;  4MMK A;  4V19 0;  3ZFJ A;  3JRZ A;  1S72 A;  4PMB A;  5FO8 B;  4R1J A;  4B3T L;  5KE3 A;  2M9V A;  2RQX A;  4LUV A;  1EWH A;  4OHJ A;  4UPA A;  1QZH A;  3Q1J A;  1BCP C;  4I65 A;  3KDF B;  3KJP A;  3SGI A;  4UAI A;  2CGH A;  3HRS A;  2KUM A;  4UHV A;  1ABO A;  2DK3 A;  5C3E B;  4JI0 L;  1D6E C;  1KK7 A;  3L2Z A;  4ZTJ A;  1JOO A;  4XQJ A;  4M7D B;  5AJ3 Q;  3L2Q A;  5LJ5 f;  1VQ7 T;  3J7A 5;  2WSF E;  4V0B A;  4ZNX A;  1Y1V H;  2HHH L;  2JYO A;  3ASK A;  4RTV A;  2CHB D;  2Q2U A;  1K83 H;  2N78 A;  4L6T B;  3JV3 A;  4KI0 A;  2KEE A;  4TRD A;  4AG1 C;  4QQB X;  3CCV Q;  1VQM T;  4F14 A;  3CC2 Q;  2K04 A;  2Z0W A;  2DVE A;  1I4H A;  1KLG D;  3NFC A;  4H7B A;  1JWM D;  2E75 C;  5GMK h;  1VQK A;  1DGS A;  2CYZ B;  5EGT A;  3OTO Q;  5DAU A;  3MEA A;  4X66 L;  2K5I A;  3SHL A;  3AMU A;  1X9N A;  3CCR T;  1PDQ A;  3GTQ H;  1HNX L;  4VUB A;  2Q2H A;  2LP5 A;  5FU7 C;  5GAN j;  3K8A A;  5C5M A;  3K6O A;  2VGM A;  1MHW C;  3D4W A;  3FJP A;  3FP9 A;  3TQ7 P;  2AKL A;  5IOC A;  3NUC A;  1QVG P;  3BJU A;  4EQO A;  3K7A H;  3A8O B;  4NB3 A;  2DIQ A;  2QQS A;  3CCL A;  5C3X A;  5LJ3 g;  1VQG A;  3J81 c;  5D6X A;  4IIO A;  2DEU A;  2RQV A;  2VB3 X;  3I4M G;  1C0A A;  5EKI A;  4BBR G;  4C0G A;  2ID0 A;  1SF9 A;  3ULR B;  4CI0 C;  1R9T B;  2JA6 G;  2D8J A;  1PSE A;  1QVG A;  2EYY A;  4RUG A;  1OZ3 A;  3FHW A;  5FKA C;  2R93 B;  3ERQ A;  1KIX A;  3RN5 A;  4RTX A;  5GAO q;  4LDV A;  1NR4 A;  3UI2 A;  2DD4 A;  1K3R A;  4YCW A;  5IGG A;  1PHJ A;  2H3J A;  2IJ0 A;  1M1K R;  3RMQ A;  2RHX A;  1NBW A;  4HJ5 A;  1M90 C;  2IWH A;  4IJH A;  4KLK A;  1IHZ A;  1H8K A;  1IW7 D;  4Z88 A;  2N3S A;  1EFW A;  1D5X C;  3A8K E;  2R5M A;  1AWX A;  1LTI D;  5KIX A;  3FLG A;  4EMG A;  3M4G A;  2Y4X A;  3H15 A;  1UJY A;  1K8A U;  1BO0 A;  2V26 A;  5GMK l;  4XTU A;  3NEL A;  2ZXP A;  3V8L A;  4X64 Q;  4M78 E;  3UE0 A;  5CMD A;  3AT1 B;  2K2M A;  1N8R C;  1IL8 A;  4P5N A;  4X3S A;  2CP0 A;  1LTL A;  2VGN A;  3VS2 A;  3SHW A;  3OYL A;  2DBM A;  2QGF B;  4E6R A;  1FJG L;  2JS2 A;  2ZAE A;  3CD6 Q;  2EXD A;  2PYK A;  4PNY A;  1NY4 A;  3IL8 A;  1OQK A;  4KV6 A;  4C1N I;  1H3Z A;  1OXT A;  2FMC A;  3GTG B;  4M75 D;  2E4H A;  3MHB A;  2MGS A;  2HL5 C;  3NEM A;  4DNR B;  4FSS A;  3W5O A;  3G4S Q;  1GFD A;  1HNW L;  2LFN A;  1RLP C;  2ICI A;  4CKE A;  1VQ5 Q;  3GNG A;  2HUG A;  2KA7 A;  2I46 A;  4XK8 E;  2E76 C;  2B86 A;  2M9U A;  2OF1 A;  1K9M U;  1BDO A;  1PTO H;  3B6Y A;  2CUD A;  2RPN A;  2RCF A;  4PZ6 A;  4FNF A;  3SK5 A;  1S5B D;  3EG9 B;  2FB7 A;  2LDM A;  4J9B A;  2DTH A;  3I35 A;  4X1V A;  2OCE A;  4HMJ A;  3JCM W;  2CP5 A;  2BOS A;  1K8O A;  4GBQ A;  2L89 A;  5GMK e;  4JI7 L;  1V1O A;  2LMJ A;  5GAN 8;  4A93 B;  5JAV A;  3K0Y A;  3CMA T;  1LV9 A;  1WTH A;  3DLM A;  2RN8 A;  2JTE A;  2F0D A;  1T3L A;  4J7I A;  2IX1 A;  4A3D B;  5L23 A;  4KBM B;  4TVA B;  1STY A;  3C4S A;  5IP7 H;  1D0Z A;  3HOY H;  3PGG A;  3OYN A;  5NUC A;  2VXF A;  2JTF A;  1IKL A;  2EPB A;  2L12 A;  4HN7 A;  1RTN A;  5I9O A;  2PI2 A;  4EGV A;  3FPU B;  2EJ9 A;  4B9X A;  4NOY A;  4N0A A;  3E19 A;  4JI0 Q;  3TDQ A;  4RKB A;  4C0D B;  1CSK A;  2O88 A;  1Q86 R;  4FF1 A;  1FMK A;  4ZKC B;  2WSC E;  3UF4 A;  1STB A;  4OB2 B;  5A0G A;  3RR5 A;  2E10 A;  3AHU A;  5KCH A;  1MND A;  3MP1 A;  2QEX T;  1N9W A;  1B34 B;  1K73 U;  1KQS S;  2A69 C;  5JEA H;  3HGB A;  1Z7T A;  4DF7 A;  1JE5 A;  1DOL A;  3OYC A;  1IHV A;  1F77 A;  3QWX X;  1SR3 A;  1G6P A;  1VQ9 Q;  3S2D B;  3I72 A;  1PFS A;  1ZSZ A;  4L5G A;  1LM0 A;  4OWX B;  3CHB D;  4X65 Q;  3I91 A;  4CJ0 B;  4P75 A;  2JA7 H;  1VQ4 A;  2O2L D;  2XK0 A;  4YTL A;  2L11 A;  3PV0 A;  3LH0 A;  1B53 A;  1M3A A;  1I1J A;  2FVU A;  4PJO G;  3EHQ A;  3EHR A;  2KYM A;  1X2K A;  2XN9 C;  1JMC A;  2DL3 A;  5CKB A;  2Z6B A;  4BA1 I;  1N34 L;  1YCS B;  1N9S A;  4J1M A;  3J81 i;  4TSS A;  3SVM A;  2ZM6 Q;  4RTZ A;  4KKS A;  5FRM A;  2JEA I;  2FHT A;  2KYB A;  3N6R A;  3KFV A;  4PLL A;  2ZT9 C;  2E2H H;  1WLP B;  2RB6 A;  4FO2 A;  4Y7N B;  5FWC A;  5KCO A;  4NXM Q;  1YIT A;  3E9H A;  1GXI E;  1GUS A;  1GL5 A;  2ZPG B;  2HDM A;  4UY8 C;  4C92 G;  4ZTF A;  2ZTD A;  2F69 A;  4LNQ A;  4WCI A;  3TVT A;  3S1N B;  3OBW A;  1PM3 A;  2RHU A;  3MHX A;  5GAM f;  3E9I A;  4JV5 Q;  3CCJ A;  1SNM A;  3A8I E;  4K5V A;  2G6F X;  2RQT A;  3I55 T;  1KC8 C;  3RKX A;  2QCP X;  2XDD A;  5J1Z A;  2RO0 A;  2PUO B;  3I4O A;  4DR4 L;  1M90 U;  1O7Y A;  4OMF B;  3RDV A;  5CCA A;  2VYT A;  1SPK A;  1TT2 A;  4NPS A;  2JA5 H;  3ND8 A;  2BZY A;  2OTL Q;  3W1B A;  2O01 E;  4PFO A;  1TTH B;  4N0A C;  4LFA L;  1E3P A;  4HMI A;  2OEO A;  2EPD A;  2E6N A;  1TH7 A;  1AW7 A;  1EFI D;  1MV0 B;  2CP7 A;  1Y1V B;  2EY2 A;  4A3K H;  1KQS P;  4O2D A;  4N8F A;  3U23 A;  4K8J A;  2L8D A;  5CV9 A;  3KF8 B;  1VQB A;  5C4H A;  1G3Y A;  1ZQ1 A;  1K83 B;  1YWP A;  3G6E Q;  1FMV A;  1NSN S;  1YJW A;  2HNI A;  2JM9 A;  4BI4 A;  1X32 A;  3QKJ A;  2RDH A;  2KT1 A;  4RG1 A;  1KQ1 A;  4E7I A;  1KQS A;  3P8D A;  4A3B H;  5C4Z A;  3HRZ C;  2MPX C;  3T53 B;  1RJT A;  4AYB E;  1HA5 A;  3TP8 A;  1OXV A;  3HOX G;  3RIR A;  1JE4 A;  2A28 A;  1CUK A;  3RUZ A;  4JI5 Q;  4M4Z A;  4FSX A;  1DOK A;  3J7A V;  2Z9H A;  5KGU A;  1KIK A;  2LMC B;  1R4P B;  1TWB A;  4LF9 L;  4XXE A;  3GTQ B;  1QKW A;  3Q8D A;  3CPF A;  2PQE A;  4MZM A;  2BIV A;  1PNJ A;  4ULL A;  5M3M H;  5LJ3 e;  4ME3 A;  5KYX B;  1NR2 A;  3JAM c;  4M7D D;  4Z89 A;  1GBR A;  2K5L A;  2RNA A;  5GAM j;  5DNF A;  4DAY B;  3PF4 A;  1JO8 A;  3OYD A;  2B2W C;  2WV6 D;  1PRM C;  2QQA A;  1CKB A;  1Z47 A;  3NWS A;  4BE1 A;  2MAM A;  2R58 A;  4DV3 L;  1HA6 A;  4EVO A;  3ERO A;  3K7A B;  3M0R A;  3KDF A;  2HAX A;  4EMH A;  3A55 A;  1ESR A;  2FYK A;  2LCL A;  2RHQ B;  1IB8 A;  5M3M G;  4RTU A;  2F52 A;  4B3M L;  1V1Q A;  4M7D A;  1OUL A;  1VQP T;  3OSV A;  3TS2 A;  2C06 A;  1PG5 B;  2MJ8 A;  5D6Y A;  3PUY A;  4PJO F;  1Y14 B;  4X34 A;  4DV1 Q;  4QMG A;  2EYO A;  1XXG A;  1QQJ A;  4LDW A;  3CME T;  2PQA B;  2J6F A;  2PU9 B;  3FKI B;  2A68 D;  1D7Q A;  3HOU B;  3QYH B;  2F3W A;  2CT4 A;  4DK6 C;  4RTY A;  4OB0 B;  3ULP A;  1AWJ A;  1TUD A;  1N32 Q;  3RZO B;  2EY5 A;  3UDX A;  1Y69 U;  4C92 F;  3NHH A;  1GCP A;  4UP9 A;  4NL2 A;  2V1R A;  4M7A D;  2FPE A;  1EOV A;  5IWA L;  1NZ9 A;  1SAP A;  3EGX B;  1ILQ A;  1AWO A;  2F03 A;  1Q82 C;  2YHT A;  1RKN A;  4P74 A;  1ENF A;  1F9P A;  3JB9 G;  3FRN A;  1PYB A;  1K0S A;  2F3V A;  2C0I A;  3UDF A;  4DNT B;  1TOV A;  2J7Z A;  1LUZ A;  3H3V I;  2HQH A;  3MTS A;  4C5I A;  4F7U B;  1BU1 A;  4X9D A;  2GN5 A;  7AT1 B;  3PMI A;  2RD1 A;  2I5L X;  3DWQ A;  5I4D A;  1X55 A;  3JCM h;  3M58 A;  4LUD A;  2O9S A;  2A8V A;  3SXH A;  1Y8P B;  4F17 A;  2SDF A;  3J80 E;  3FVQ A;  3U4Z A;  2KRO A;  2DYI A;  1WI5 A;  3VUZ A;  3MPU B;  4J9D A;  3CC4 T;  1CM9 A;  1L0Y B;  3QR8 A;  3UE1 A;  2UUB Q;  1YFN A;  2OWO A;  4OWW B;  1RAC B;  5FLX c;  2UUA Q;  1KC8 U;  4CDC C;  2XIW A;  1KDC A;  1WTR A;  1VQO T;  4CGY B;  2NVY H;  2HBW A;  1H92 A;  3BFM A;  1M2O A;  5IY0 A;  3CCE A;  1GUO A;  3ZYY X;  4DGZ A;  1Y1W G;  1M1G A;  2XI9 A;  5BR8 L;  1M27 C;  4M7D C;  4HJ8 A;  2F0L A;  2Y90 A;  1WHJ A;  1VQL T;  1MI2 A;  2F0N A;  1KFZ A;  3L7Z C;  2IHE A;  4X6A H;  1O9S A;  1WA7 A;  2DBK A;  3VYU A;  2VAS A;  4N8X 1;  3NTI A;  4OVA A;  5C4X G;  3S1Q H;  1NMG A;  1YI2 T;  3I4M H;  4OX9 L;  2J05 A;  2FPD A;  4BBR H;  1PH5 A;  3PO3 H;  1FYN A;  1PHT A;  3SDZ A;  1N36 L;  3QII A;  3GP8 A;  1UJ0 A;  1OYX A;  2L2P A;  5AYF A;  1NEG A;  3JB9 I;  4KKT A;  3C2P A;  1ZHI A;  1D5Z C;  1KAW A;  2Z0S A;  2UXD Q;  4A3E G;  3NTH A;  4M77 G;  4LF4 Q;  2A73 B;  3PO2 H;  2YUQ A;  1PRT D;  4K2L A;  1RDP D;  1R8O B;  1VOM A;  3TU4 K;  2FZC B;  1NJI U;  4A4I A;  3OY9 A;  3G71 Q;  2B63 B;  3EG9 A;  3JAM i;  3VS7 A;  2MO0 A;  1FGU A;  1C8C A;  5HKC A;  4FVM A;  3HFN A;  2V8J A;  2X4Y A;  1K4U S;  3OYY A;  5EAY A;  2EYL A;  2FFK B;  4LF6 L;  3RMH A;  2N88 A;  3EFS A;  5DLO A;  2E1H A;  4BB7 A;  3W3A A;  4QVD A;  2R7F A;  2DX1 A;  1MMD A;  1BVS A;  4GLV B;  1T3S A;  1BI1 A;  1HTP A;  3T51 B;  1WTV A;  3M5A A;  1E2V A;  4ZKB B;  3PNW C;  3SWN A;  3CC7 T;  2B29 A;  2VUM B;  5FWB A;  4WJ4 A;  1CA6 A;  1Y96 B;  3OA6 A;  2MQH A;  4BBS H;  2SEM A;  5HCK A;  3ZL7 C;  5I2S A;  3LX0 A;  5A35 A;  5FW9 A;  1Y8N B;  2EKO A;  2PMZ B;  4MHE A;  3NK9 A;  4DUZ Q;  1PVO A;  3CC2 A;  1AHJ B;  2Y0S B;  3NTK A;  2IG0 A;  4KUD K;  3JB9 F;  2D6F A;  2M0O A;  2MWP A;  3LX7 A;  3JCM V;  2B2Y A;  2F0M A;  4DV0 Q;  4RCC A;  4K5X A;  1B34 A;  4L59 A;  4HCS A;  4RGM A;  3OS5 A;  1UE7 A;  3CCU Q;  2XD0 A;  5GAH C;  4BD3 A;  1PH2 A;  3QB3 A;  1T9H A;  1NLO C;  3H0G G;  5EPK A;  3HKZ G;  4R56 A;  2MIO A;  1HFN A;  4KTA A;  3J7Z C;  1YN8 A;  3AEV A;  3WOF A;  5A2Q L;  5BN4 A;  4MIU A;  3PSI A;  2F5K A;  3M4Y A;  4JYA Q;  4ELZ C;  1VQK T;  1KAA A;  2BUD A;  3HZX A;  4UP8 A;  1V8Q A;  2EZV A;  3I90 A;  4GKJ Q;  5I11 A;  1N27 A;  3PIP A;  2KEC A;  2EJG C;  1K8A R;  2EJM A;  4Q0F A;  1EX4 A;  3A7L A;  1QE6 A;  1F9R A;  2EBP A;  3HRU A;  1I94 L;  1RCV D;  2JA8 B;  4A3B B;  1SHG A;  3KJO A;  3E2U A;  1PZK D;  2NUC A;  4PJO E;  2EY1 A;  4RKU E;  3TP5 A;  2KCT A;  2LXK A;  2VY3 A;  2VQF L;  3EGU A;  3C1E A;  3PCO B;  1LTS D;  1IYJ B;  3QSU A;  2P0Q A;  2YSQ A;  4J6Y A;  4A53 A;  3JCM J;  4DR3 Q;  4JI4 Q;  4C0F A;  1IYV A;  2K01 A;  2TSS A;  3LWE A;  3I8Z A;  3A1P A;  4QVC A;  4KK7 A;  1B70 B;  2M0Y A;  4C92 E;  1EY9 A;  3RLO A;  4A3F H;  3MFG A;  4DBH A;  4EMK C;  1K9M R;  3P8B B;  3E1S A;  3PGZ A;  8AT1 B;  4DR7 Q;  2X6L A;  2JMC A;  1SYG A;  3RLN A;  4JI3 L;  3I4N H;  2F0Q A;  4C8Q G;  2WIN B;  4LWC A;  4HA8 A;  1ET6 A;  4N9P A;  2L1B A;  4M77 F;  3MP6 A;  4ZAI A;  1NBE B;  4IN3 A;  4DR2 L;  2HCI A;  4C0D C;  3JCM d;  1JIC A;  4XQ3 A;  1HPC A;  5ELB A;  4C3J H;  3H6Z A;  1JU5 C;  4CC3 A;  3CD6 A;  1MBY A;  3D6W A;  4L8J A;  5ELC A;  1IL2 A;  1QWY A;  2NUP B;  2B2Y C;  2R61 A;  4JCV E;  2RQW A;  1GKH A;  2EQS A;  2HQX A;  2EXZ A;  2KQ3 A;  1H3H A;  3KF8 A;  4H02 A;  4DAP A;  2COZ A;  3S15 H;  1OZ2 A;  3U9O A;  3TS0 A;  4KD3 A;  2A08 A;  4FXD A;  1TG0 A;  3M4Q A;  2FG0 A;  4XU3 A;  3S3O A;  1TWG B;  1Q46 A;  4XTW A;  3SEB A;  3VR4 A;  4DA2 A;  2RI2 A;  3LYI A;  2KSS A;  5K5P A;  5KEE A;  1UUP A;  4O1N A;  1RUW A;  1DCZ A;  1K0X A;  4B3R Q;  3PIO A;  3X28 B;  5KYL A;  2QQR A;  4A3J B;  1ML0 D;  5D65 A;  1JC7 A;  1II3 A;  1K73 R;  4OON A;  4LFB L;  2JK8 A;  1YCY A;  3OYH A;  3X20 B;  2OX7 A;  5KYX A;  3P20 A;  2NZH A;  1JQQ A;  4M75 B;  4IFD J;  4DAY A;  4H44 C;  2YLB A;  1MSH A;  2HQE A;  4DR1 Q;  4JI2 Q;  4QB4 A;  1FNU A;  3NQI A;  2MK5 A;  4KHZ A;  2RA4 A;  4KY6 A;  4ZN3 A;  2KHI A;  2HIV A;  2LQK A;  3OW7 A;  1IBK Q;  1N6A A;  2JTM A;  1W4S A;  4HSV A;  4NKL A;  2HQL A;  3BU2 A;  4IFD I;  2LT4 A;  1BIB A;  5IYB G;  3R6O A;  5GAG C;  1M30 A;  3MET A;  2FL7 A;  4OIJ A;  1R77 A;  2O5J C;  2NVQ B;  4ID6 A;  3M0T A;  4DV5 Q;  3INZ A;  3V7C A;  3UDC A;  3U50 C;  2ROL A;  3A8G B;  4JRQ A;  1VQ6 Q;  3GTM H;  4R55 A;  1YIJ A;  3IFT A;  1G3W A;  2K79 A;  2RSN A;  3CCM Q;  5CV4 A;  2NYZ D;  3PIO 3;  3HOZ G;  2LCC A;  1VQ9 A;  1PYS B;  2RJC A;  5JJL A;  1WIE A;  2EQM A;  2KAF A;  1K1Z A;  4J7F A;  2LCS A;  4B6M A;  2NN6 G;  4RGT A;  5C6A A;  1X27 A;  5CQX A;  3THK A;  4XQQ A;  1UDL A;  2XHC A;  2C0T A;  4LF5 Q;  2ZXO A;  1A6X A;  1AN8 A;  5GAN 4;  3KOJ A;  4FXK C;  5KH6 A;  4ZUJ A;  2Q8I B;  2XKO C;  1M90 R;  4BAC A;  1TWA B;  2YXY A;  3H3V H;  3S1Q B;  1B7Y B;  3PQI A;  2UXD L;  3H0F A;  1ZSZ B;  1FL0 A;  4A63 B;  3EGX A;  3A54 A;  1PXU A;  1TUG B;  5DEH A;  2ZPE B;  4AIM A;  5KYU A;  1G5V A;  1PTO D;  3M54 A;  4IUV A;  1G8X A;  2CS7 A;  2YDL A;  3BZC A;  1YP5 A;  3LGJ A;  3I9Q A;  1NG2 A;  4M78 D;  1U5K A;  2JP1 A;  3NQT A;  3MVV A;  1V9P A;  1WCM B;  4GOP B;  1Z6H A;  1VQ7 Q;  4C8Q F;  4GN3 B;  4R9W A;  2J06 A;  3JCM X;  4IUR A;  2LT1 A;  1H9R A;  1KL9 A;  1Q81 C;  1YZ6 A;  2BE5 C;  4AQY L;  3S1R H;  1ZSG A;  4CKB A;  4F7U A;  2R92 H;  1SNO A;  3PO2 B;  1I4P A;  3UAT A;  4PNO A;  1I3Q H;  1YVC A;  1WI7 A;  1QCF A;  4M78 A;  1RTO A;  1IZ6 A;  4X66 Q;  2JA9 A;  1EY7 A;  1VQM Q;  2COW A;  3F70 A;  2E3H A;  2BA0 A;  2OJ2 A;  2MPM A;  4DQ2 A;  2VL6 A;  1ZBJ A;  5TSS A;  2RHI A;  1HNX Q;  2CZ1 B;  2KNB B;  3BVM A;  1H9M A;  1KHC A;  4JZ4 A;  2OTL A;  1YEZ A;  2NWM A;  4N4I A;  1UUE A;  1X6O A;  1IXD A;  4WF2 A;  5GRO A;  4QUF A;  1YJN T;  2RM4 A;  3H8Z A;  3PMT A;  2QTX A;  1RAA B;  5ELE A;  4JJC A;  2B3G A;  1A0I A;  1J8I A;  5M5W H;  3L2R A;  4CJ2 C;  1YNN C;  1UGS B;  3JB9 H;  2CW0 D;  4A3M H;  1PCX A;  3G6J B;  2EGC A;  1DJR D;  4LJZ C;  5ELF A;  4OO1 H;  4BBS B;  1VQ8 T;  4KHP Q;  4LF7 L;  3PFS A;  1BCP F;  2KCN A;  1WGS A;  2MO1 A;  4BY7 H;  5C0M A;  1LT4 D;  3V8K A;  2D0N A;  1TS5 A;  3TQY A;  4CC2 A;  3ZBD A;  2AKK A;  3EG2 A;  1NPP A;  1IYU A;  1Q8K A;  1SBB B;  4A3C H;  3GTL H;  3S2H H;  3CCQ A;  3BYT B;  4FF4 A;  5DM7 3;  5D7U A;  2E5K A;  5IGC A;  4IUT A;  3TSS A;  1Z9Q A;  3HS0 C;  1UE9 A;  5IT9 E;  3Q24 A;  4HJ7 A;  2K5D A;  4IOA A;  2R7Z G;  4ESR A;  1T0H A;  4J83 A;  1Y1W H;  2PQW A;  1F2Z A;  4Z8A A;  3EIV A;  1LAC A;  2DGY A;  4M77 E;  1GUG A;  5C5L A;  2HIX A;  2QW7 A;  2CSQ A;  2RQR A;  2DJG C;  1X65 A;  2P4R A;  1B9N A;  3O13 A;  1EU4 A;  4XTV A;  1X3E A;  2H4O A;  1X6B A;  4OGC A;  1D09 B;  4OGE A;  3STB D;  3RZD H;  4FF2 A;  3HOV G;  5C44 G;  3L2P A;  1YNJ D;  3NBI A;  1YHQ T;  4DV4 Q;  1HNW Q;  3C95 A;  5GJW B;  1SYC A;  3GQB A;  2GGR A;  2CKK A;  2YU9 H;  5IYC G;  3K59 A;  3KXT A;  3CF5 A;  1Q7Y C;  2GFA A;  1IXR A;  1SND A;  1Y96 A;  4LE9 A;  5IP9 G;  4DOW A;  3C46 A;  3HP9 A;  3S24 A;  1B4O A;  4A3E H;  2E2I H;  2YYZ A;  3JCM c;  4DEX A;  1CKN A;  4A3F B;  1PWT A;  2B2U C;  3VS1 A;  3I70 A;  2V1C C;  2A36 A;  2FRY A;  3QPH A;  3I4N B;  2HBP A;  2ED0 A;  3I73 A;  5H1S E;  1BR9 A;  1ICW A;  1S4Z A;  1S5C D;  4JBM A;  2E12 A;  3KUF A;  2BCO A;  2ZPH B;  3VKI A;  2L0A A;  2KVQ G;  5ELN A;  4E7Z A;  4POG A;  3GTP H;  1KC8 R;  2AKW B;  2TMP A;  1EQV A;  2A3L A;  2JEB I;  2O5I C;  1B8A A;  1VQI A;  4WJW A;  2ENM A;  3BZK A;  4U67 3;  4FYD A;  4C3J B;  4OMQ A;  4NL3 A;  2A1A A;  2HL3 A;  1VUB A;  3CMA Q;  1BBX C;  3GTO H;  3K57 A;  2EQK A;  4XT3 B;  1WD1 A;  5CK9 A;  4PFP A;  3EJI A;  1B1Z A;  1OU9 A;  4JRP A;  1A0N B;  2KCM A;  1S1N A;  3HKZ E;  5CC4 A;  3S15 B;  3REA B;  2K1B A;  2K05 A;  5CIU A;  2FPF A;  3MEU A;  4E7J A;  4B08 A;  3QWN A;  1HHV A;  2ABL A;  2XG8 D;  1SYD A;  5I6Y A;  4ATO A;  4CRI A;  2XSC A;  2UXB Q;  4KHV A;  1CA5 A;  4C3I G;  4BY7 G;  2FHD A;  1VQE A;  1RD9 D;  4K6L A;  2LQW A;  5KYW B;  1BCO A;  4Y92 A;  1E0B A;  5IH2 A;  2X4W A;  4A4G A;  4BDY A;  4M7A B;  1O7I A;  4HTH A;  3AFQ A;  2UXC L;  3KLW A;  2RJD A;  3CPW S;  4XIG S;  3SD4 A;  4V2S A;  1GJX A;  2CP2 A;  1JWU D;  1PD0 A;  3FB9 A;  5IHN A;  5GAN h;  1AWW A;  2JSO A;  3M0P A;  4IUN A;  4A3I H;  1WTO A;  2GVB A;  1G91 A;  4KRT A;  1HR0 L;  2KEA A;  3FIF A;  5M3F G;  1O75 A;  1NJI R;  4J8Q A;  1N34 Q;  1TR5 A;  4B9W A;  5LJ5 j;  2DEQ A;  4DAM A;  1S5E D;  1Q8I A;  3DKM A;  4C1N K;  1A3T A;  5K36 H;  1HUN A;  4LUO A;  4FT2 A;  5I21 A;  2VQE L;  3NWT A;  2K57 A;  1X01 A;  3HTR A;  5BN3 A;  1XQH A;  5J39 A;  1XWE A;  4J6X A;  4QW2 A;  5C4J B;  1VIF A;  1PH1 A;  4C8Q E;  3GTJ B;  1RL2 A;  1OXX K;  5LMU L;  2EQI A;  3OWF A;  1ABQ A;  2CZ7 B;  4K0K Q;  2NUP A;  2KVM A;  3QDR B;  3NPF A;  1LO5 D;  4QY7 A;  3K80 C;  4RH6 A;  3GTM B;  2PVG B;  3K5O A;  2KR3 A;  1J3T A;  4KKU A;  3MP8 A;  1AZQ A;  1G8Z D;  4J9F A;  2WAQ G;  4G7H C;  1HTL D;  1DON A;  1U5S A;  2B2T A;  4KY5 A;  4DR4 Q;  2E41 A;  3SB2 A;  4DXG A;  3LWU A;  1SRO A;  3PF5 A;  1LTB D;  1D1A A;  1W6X A;  1F2L A;  3BW1 A;  3I55 Q;  3G71 A;  2AMC B;  4C3H G;  3RNU A;  4LFA Q;  5CV5 A;  4A3L G;  5LJ3 f;  1QP3 A;  1SJE D;  3I4L A;  2MFI A;  2NVT H;  1EIF A;  1IBM L;  4IFD H;  2AWN A;  1NE8 A;  1XMQ L;  4XYQ A;  3MAQ A;  2DKG A;  2LNV A;  5T1G A;  4R4I A;  4M75 A;  1QVC A;  5GMK m;  4GKK L;  1HD3 A;  4A3G G;  1YJ9 T;  4X62 L;  1ZYR D;  2N8N A;  2HZY A;  3VR2 A;  4EQN A;  2AHJ B;  2RJF A;  1EQT A;  3CPW P;  2KDS A;  3WVE B;  2EDG A;  4DR5 L;  1PRT B;  4C56 C;  2R92 B;  2AQ1 B;  1Q7Y U;  1T5E A;  2EWN A;  1I3Q B;  3VYH B;  1OXU A;  4M8A A;  4BY1 H;  1U4R A;  1TUC A;  4LDU A;  3JCM Q;  2OQ0 A;  3CPW A;  2RMO A;  4LF9 Q;  4K6D A;  1UB4 A;  1TSF A;  1WQW A;  3VS5 A;  2DXB A;  3SWN B;  1ASZ A;  1QCB D;  1MIU A;  2CH4 W;  2KXC A;  3CCU A;  4RCB A;  5ECA A;  2F0O A;  4J8O A;  2JT4 A;  2EAY A;  1O80 A;  2VKN A;  4JBW A;  5L37 A;  2F1M A;  4HR7 B;  3VA7 A;  1VQD A;  2Q8R E;  1FX7 A;  4DV7 L;  4RG8 A;  2RK2 A;  4FXG C;  1GRI A;  4YWK A;  2OQK A;  3CCV T;  2F4V L;  1J9O A;  2KRS A;  4HCZ A;  4DV3 Q;  1EZZ B;  3I5R A;  5KYY B;  4H13 C;  5M5W B;  4CBV A;  2QAS A;  2RJE A;  4CDF C;  1FR3 A;  1CZG A;  4A3M B;  5GAN e;  3S3N A;  1PSF A;  1AT1 B;  1YIJ Q;  4B3M Q;  3DEP A;  3K7U C;  4HJA A;  1SHF A;  2W0Z A;  4TKO B;  1ZUU A;  2QA4 A;  5GAO l;  2B2V A;  1H9S B;  2K5Q A;  3FRP B;  1AE3 A;  5COY A;  1SFO B;  1GO3 E;  1U4L A;  1UGV A;  5LJ3 j;  2DL8 A;  1IW7 C;  4IPH A;  3OYE A;  3SK8 A;  3CCS Q;  1LJO A;  1QIL A;  3X26 B;  4JI8 L;  2LRQ A;  3DB3 A;  4GOP A;  1VQP Q;  1XOV A;  4FU6 A;  1WOC A;  3CW2 C;  3CBM A;  3PUW A;  1BK2 A;  4BUG A;  5GAN 2;  1EOT A;  3KK7 A;  3WOE A;  2PVO B;  1U1T A;  5I2M A;  3T1H L;  3EG0 A;  1KQ2 A;  3EVQ A;  1SNC A;  2KQW A;  3CME Q;  2WB1 B;  5C3E G;  3M4O H;  5IWA Q;  4M75 C;  5COR A;  2LXJ A;  4M7D G;  3FMC A;  2R5A A;  2R57 A;  2W10 A;  2A37 A;  2A6H D;  2HKQ B;  2HKN A;  4RWS C;  1LTG D;  5IT9 L;  1WFQ A;  3BS1 A;  3VYT A;  1JOQ A;  4F16 A;  1WHM A;  4N9T A;  1CQV A;  2XRS D;  2D8H A;  4EDU A;  1D3B B;  2E2D C;  2RBM A;  3MC0 B;  2IIM A;  1PYW D;  1MMA A;  1ZA2 B;  3I56 Q;  1EY8 A;  2JA6 H;  4HIK A;  2HHH Q;  3TZU A;  5FLM G;  2YU9 B;  5A2Q E;  2QI2 A;  5IYD H;  3X24 B;  1DD2 A;  2L0C A;  3G7L A;  1WJS A;  3U4V A;  1S3O A;  4DBF A;  5IHK A;  1VMP A;  2PNH A;  2F0P A;  3VR5 A;  3L3O C;  1QUQ B;  3F2C A;  2DZC A;  2DD5 A;  3D4R A;  1UEC A;  2YRC A;  4JS5 A;  1EEI D;  3GV6 A;  4KN7 C;  1Y57 A;  3JCM g;  1JT8 A;  1AH9 A;  1LTR D;  2EYM A;  1IRE B;  1N8R U;  4EX5 A;  5GAN d;  3V8J A;  1SN8 A;  2XWJ B;  4JS4 A;  4PJM A;  3ZEH A;  4OGQ C;  1HZC A;  1BIA A;  1SRL A;  2SOB A;  3REB B;  3HPW A;  4U68 A;  3CC4 Q;  3QHS A;  2V1Q A;  3G4S T;  2G9H D;  2KHS A;  2OT2 A;  4LDX A;  5BR8 Q;  1WD0 A;  4JJB A;  1VQ5 T;  2K32 A;  3E5S A;  4DXF A;  2B2V C;  3QG1 A;  2DF6 A;  1ZKO A;  2NWG A;  1ZSZ C;  4TQU S;  3BVZ A;  1VQO Q;  1SG5 A;  1VQH A;  3KBG A;  3OOC A;  3F1Z A;  3EFO A;  1ZX6 A;  3CCQ Q;  4HT8 A;  4F7X A;  1PV4 A;  2E5L L;  2AZV A;  1JB0 E;  3H9N A;  1SRU A;  4GOP C;  1X69 A;  3A8J E;  3NSW A;  4OX9 Q;  2R93 G;  1VQL Q;  5LJ5 d;  3D31 A;  1N36 Q;  3MEF A;  2P4T A;  3R8B A;  3OPO A;  3MEV A;  3GNF B;  3R3O A;  4BE0 A;  4BDZ A;  3QOL A;  1XJV A;  6AT1 B;  1YI2 Q;  5GQO A;  4C5H A;  1VS0 A;  3T1Y Q;  4LK1 C;  1C9O A;  2K5H A;  5GAO p;  1BCM A;  2LTO A;  4PJO D;  4E2F B;  1VQ6 A;  1AZP A;  1KSW A;  5EJW A;  3CCM A;  1SMX A;  1M8A A;  3OYG A;  4A3I B;  4A4E A;  1M4V A;  4LD6 A;  1FMW A;  3F2D A;  1V1C A;  2AZS A;  2J0T D;  5CV6 A;  5GAD C;  4A75 A;  2H1E A;  3UDI A;  2R7Z H;  5JJK A;  5GAM h;  3KUP A;  5LL6 X;  4OEM B;  3VA5 A;  2AT1 B;  3OYB A;  1NNX A;  5IIF A;  1JB7 A;  2RHZ A;  4FYX B;  4HKE A;  1M1K C;  2RHY A;  1S5F D;  4PJO A;  4KY7 A;  3RLF A;  4LF6 Q;  4C92 D;  4C5G A;  1RI0 A;  1SMY D;  4WFN 3;  1CZW A;  2GFU A;  1OO9 B;  3C94 A;  5IOD A;  3K0X A;  3HOV H;  5C44 H;  2A6E D;  5HGQ A;  2OTJ T;  3KLR A;  3SK4 A;  2IW3 A;  5D3D A;  1TKW B;  1VIE A;  5CQY A;  4M7D F;  2HSE B;  4JOI A;  4QGU A;  2J7I A;  4G4K A;  1A63 A;  5IYC H;  1VQ7 A;  4YWL A;  4C92 A;  3A56 A;  2FZK B;  1F2M A;  5EKK A;  1CKM A;  1P8L A;  4J5Y A;  4QIW E;  1NEB A;  2VVK A;  3CC7 Q;  1AEY A;  4AFU C;  5KYU B;  1X54 A;  4ZQ3 A;  4WJ3 M;  3FPP A;  1D0X A;  4CDD C;  5KRU A;  4A93 G;  2UUC L;  3UA6 A;  1SYF A;  5C0X G;  3NMZ C;  4QQG A;  3I5S A;  1VA7 A;  2P0P A;  2DRK A;  4Y28 E;  5KYW A;  1VQM A;  5FJ8 G;  1JXO A;  2NZ1 D;  3J80 c;  4A3D G;  2RSO A;  4M7A A;  1YBY A;  4Q5W A;  1KDB A;  3J81 L;  1NYG A;  3VRY A;  2B39 A;  1PTO B;  3OSS C;  3HFO A;  3DXJ C;  2Z8L A;  4M78 B;  5EC7 A;  1KNA A;  2MUY A;  2A7Y A;  1GUW A;  1D1K A;  4APV A;  4BE2 A;  2PI2 E;  2D0Q B;  1I94 Q;  5ISR A;  3R2T A;  2K3B A;  2L3P A;  1H64 1;  2DPP B;  2OTL T;  1H9K A;  4IPD A;  2VQF Q;  4BY1 B;  3VU3 C;  2RF4 A;  2C0O A;  1NM7 A;  4HCC A;  5CBA E;  4K11 A;  3HOY B;  5GAO n;  2IT1 A;  1G3S A;  2WKD A;  3PMF A;  4JDS A;  1D1B A;  2CFM A;  4GLX A;  4EPC A;  3CQT A;  4AH6 A;  1TS4 A;  5T1I A;  1HNZ L;  5FRO A;  3G6E T;  3JB9 J;  1JOR A;  5M5X H;  1OPL A;  1HFG A;  5HK3 A;  4JI3 Q;  2EY6 A;  3PVQ A;  4A4K A;  5EKL A;  5C0X I;  5JVH 3;  3A74 A;  2NBF A;  2F0U A;  1PFB A;  1X6G A;  1OX9 A;  3QZ9 B;  2WAQ E;  3OHX C;  1QVF P;  3U9S A;  1JJG A;  4JOI C;  4DR2 Q;  3Q22 A;  5GAM e;  1A2U A;  4N4H A;  2Q2I A;  1BUV T;  1GBQ A;  4WRD A;  5D3I B;  2A68 C;  2D9U A;  4YHH L;  3VYS A;  3NGP A;  5E4W C;  2JA7 B;  2X69 A;  3J81 j;  1QVF A;  1LT6 D;  3HHT B;  2PCF B;  4JI5 L;  1FGB D;  2BA1 A;  5G3L D;  2I07 B;  1QJO A;  3KFU A;  3QZ5 B;  5ELD A;  2PW5 A;  5CGK A;  4R4T A;  4DPG A;  3S17 H;  2FJ2 A;  1Y71 A;  2LC4 A;  5I22 A;  5JJZ A;  3RN2 A;  3WXM B;  2BH8 A;  2YTV A;  3ND9 A;  4JW0 A;  1UFF A;  4DV2 L;  4M7A C;  4BXX G;  3BDU A;  4IAL A;  1M3B A;  4PMC A;  2NLU A;  1YNZ A;  3VV0 A;  5FRN A;  4WTO B;  3VUB A;  2QTV A;  2E2H B;  1BBU A;  1E6G A;  3QUI A;  5GAN 5;  1S72 T;  4ME7 A;  1A15 A;  4RCN A;  5CV7 A;  4AT1 B;  1TS9 A;  4QJF A;  8ATC B;  2LJ3 A;  3N5B B;  1LPL A;  2L3Q A;  3EGD A;  4XU2 A;  3JB9 D;  2KCC A;  3I7F A;  4L63 B;  4C3H H;  2OAW A;  1OX8 A;  3A5U A;  1Y1V G;  2DM1 A;  3S1M H;  2K4K A;  3H09 A;  1KD1 C;  4DR6 L;  4IOC A;  1F2Y A;  4F04 B;  1CKN B;  4LAA A;  3M7G A;  2IX0 A;  2BDO A;  1KNE A;  3NE5 B;  2YV5 A;  2K7V A;  1EFN A;  1M5Q 1;  2DAQ A;  2K2V A;  4PLI A;  3CMA A;  1V43 A;  5KYY A;  3QXE B;  3JCM e;  4XAX B;  2JA5 B;  4QVZ A;  1I5L A;  1Z9F A;  4JUV A;  1U9R A;  4P72 A;  5IHI A;  3EFX D;  2IPO B;  4LN2 A;  2ATW A;  2IY5 B;  2JUF A;  1ROD A;  2XNA C;  5M5Y H;  4DUY Q;  1SRM A;  3ONA B;  1H9S A;  2DXC A;  4LF8 L;  2GQV A;  2EYP A;  3C12 A;  4KGX B;  1CFM A;  5KE2 A;  4ZGJ B;  1NAP A;  3DM3 A;  5GJV B;  1W6J A;  1K0R A;  3K5N A;  4A3K B;  2F0V A;  2EJF A;  1SKU B;  4XU0 A;  1E6H A;  2EGE A;  5GAM d;  1WX6 A;  1RAF B;  1Q82 U;  2OAU A;  5E3F A;  2HMA A;  3HG9 A;  1ZXT A;  2QA4 Q;  5FO9 B;  4JJD A;  2LJ0 A;  2NVX H;  4QT7 A;  5CKH A;  4KJO A;  3GV3 A;  1QCO A;  2RCN A;  2JZ2 A;  4KGZ B;  4PQX A;  4EQP A;  1QKX A;  3E9G A;  3NHN A;  3PUX A;  3O5Z A;  2B8A A;  3P1H A;  2D62 A;  4RTT A;  1KRS A;  3HEJ A;  3D3R A;  1O78 A;  4JI6 Q;  5CR2 A;  1VQN Q;  1BXT A;  3CCL T;  4JPB W;  5I6W A;  1D3B A;  3LWI A;  1PRT C;  1SE8 A;  4Y52 H;  4M7D E;  1WQ7 A;  3G48 A;  4DNI A;  4DAV A;  2PNI A;  3OYM A;  1I50 H;  5CKF A;  3FKI G;  4MTN A;  3GF5 A;  2DER A;  4AQY Q;  1EYG A;  3HOU G;  4D6W A;  2YUP A;  2I0Q A;  3BZD B;  4AYB B;  2K14 A;  2CUB A;  2PZ1 A;  4Y91 A;  3SWN C;  1W1F A;  2FEI A;  1E7O A;  1MNE A;  4JI1 L;  4HT9 A;  1QUQ A;  1E1O A;  3LWH A;  1PH4 A;  1SE3 A;  1Y0M A;  1OPK A;  1S5D D;  3PIP 3;  4P2C B;  2K03 A;  2JXB A;  3ZJY C;  2K9G A;  1XMO L;  2ATC B;  5C3E H;  3I55 A;  2EOT A;  3L2V A;  2K52 A;  2C9O A;  3E0E A;  2JJ9 A;  3K5M A;  1EY6 A;  1MMN A;  1I4R A;  2LKV A;  4IZ8 A;  1M3C A;  4MZP A;  5DY9 A;  3KLS A;  4L5S A;  2QQB A;  5I9P A;  5D6W A;  1HYO A;  1QB5 D;  1R0B G;  1W6K A;  1ZUK A;  1NUC A;  3LNN A;  4HCK A;  1E7Z A;  1XTD A;  2E3I A;  2PO4 A;  1YJN Q;  4F7U G;  2XTI A;  2M00 A;  5CO7 A;  1EUJ A;  1WHH A;  3G71 T;  3VRZ A;  1G83 A;  5FLM H;  1DJ7 B;  5GMK i;  1IHW A;  4J15 A;  5JOB A;  1J5E Q;  4LF7 Q;  3HOW G;  4GS3 A;  3JCM P;  3TEH B;  1MGQ A;  3CBP A;  1PH6 A;  1I4Q A;  4H0L C;  3F2B A;  3W2D A;  4LW1 A;  4GY5 A;  2CRE A;  1G6Z A;  4FCY A;  1JRI A;  2YWW A;  5IAY A;  1VQ8 Q;  4ME5 A;  3JAM L;  5EPJ A;  5EBD A;  2G5D A;  4G57 A;  1TWF H;  4IUU A;  3M0S A;  1DYQ A;  3MXG A;  3URY A;  4OMP A;  1U06 A;  4HIO A;  4JJN K;  4XT1 B;  1GFC A;  2JE6 I;  5JPN C;  1KG1 A;  1STE A;  4IPG A;  2Y4Y A;  1XPO A;  4JRK A;  2EYZ A;  1HH2 P;  3PTA A;  4FM4 B;  4JI6 L;  2J6O A;  2V8K A;  3BE3 A;  3L2U A;  1KD1 U;  2DXU A;  2RH2 A;  2F5T X;  3HOX H;  1L1O B;  2CH4 A;  2XVS A;  1MKH A;  2DN8 A;  3TP6 A;  4LMQ D;  2JNG A;  2LNH B;  3MEH A;  1SEB D;  4R4C A;  2Q8T A;  1AZE A;  5J3B A;  3PVL A;  1VYV A;  4E7S A;  1B3A A;  2HDL A;  3CRL C;  1R9T H;  2NVY B;  4B3S Q;  4HVW A;  4Q5V A;  2DY7 A;  5JEA G;  3OYJ A;  4B3T Q;  1KXL A;  1BI0 A;  3RR6 A;  1N5Z A;  2OI3 A;  3GDE A;  3KLS X;  4LFC L;  3A5Z B;  3VDY A;  4NMZ A;  1M2V A;  1WDX A;  1UGP B;  3M0Q A;  1BBW A;  3CCS A;  5EPL A;  3R2I A;  1NCV A;  3QIA A;  1A8V A;  4E47 A;  5CKD A;  1YHQ Q;  1VF7 A;  4JBK A;  1VQP A;  4C2M H;  2KY9 A;  2DNC A;  4C8Q D;  3PE0 A;  5IGE A;  2JS0 A;  1N33 L;  3M9Q A;  2B63 G;  3TZD A;  3KF6 B;  1HK9 A;  2P84 A;  3I4M B;  1UG1 A;  2L3R A;  1EWC A;  1LYL A;  1Q1E A;  2OXP A;  4BBR B;  5BN5 A;  1GHK A;  2CP6 A;  2GQI A;  2A5H A;  2IVW A;  3CME A;  4FIB A;  1VQ4 T;  1E22 A;  1GCQ A;  3L1A A;  2COY A;  3BDL A;  1U4M A;  2YTY A;  1XNI A;  1EIY B;  2JW4 A;  1PFM A;  1N8R R;  4RFB A;  2F1L A;  4CDE C;  2EYW A;  5EG2 A;  2H5X A;  2ROT A;  1IBL L;  4JRI A;  4KUI A;  2EFI A;  4HSP A;  3TN2 A;  1HXD A;  1GHJ A;  2VUM G;  3ICE A;  4LNP A;  3URG A;  3I56 A;  3DMU A;  3GO5 A;  1TVX A;  1I5O B;  2N49 A;  2K5V A;  4FYY B;  1YIT T;  1OU8 A;  2DXT A;  4YCU A;  1JXM A;  5FLX L;  3GIB A;  2Y0S G;  4DR3 L;  4P71 A;  4JI4 L;  1WJQ A;  3IRB A;  3RD4 A;  1LVK A;  5L8R E;  3FC3 A;  2QDB A;  3H94 A;  2I5M X;  1AZG B;  1RHP A;  2R6G A;  1RAB B;  3CCJ T;  2PZW A;  1TU0 B;  1SJH D;  2NN6 I;  3NP8 A;  3CCR Q;  1BCP D;  1HR0 W;  4F7U F;  4IPC A;  2KGT A;  5LMN L;  2BZX A;  2DE0 X;  4A93 H;  5C0X H;  2UXC Q;  4PL6 A;  5CV8 A;  3FJ5 A;  5FJ8 H;  4ZYS A;  1PH7 A;  4A3D H;  4FYV B;  4PK4 A;  2PUK B;  4E7K A;  1H95 A;  3Q6S A;  3CC4 A;  1D5M C;  2PW7 A;  1XNQ L;  1HR0 Q;  1EY5 A;  2F0G A;  3M85 A;  1E2Z A;  5IT9 c;  2ICE C;  1K8M A;  1VQO A;  5GAN g;  1Q90 A;  4LUE A;  4AG2 C;  1EYC A;  4BA2 I;  3TSZ A;  2DO3 A;  2DET A;  4A3B G;  2JA8 G;  2MOX A;  2VQE Q;  3EFR A;  4DK0 A;  5CAI A;  2JMA A;  1TQO A;  5C6S A;  1EZ6 A;  2KMT A;  4JBJ A;  1HZA A;  1G29 1;  2CWP A;  2E6Z A;  1YJW T;  2AWO A;  1VQL A;  2M16 A;  5M5Y B;  5LMU Q;  2M2L A;  3C3L A;  1GD7 A;  1ZA1 B;  1ZUY A;  5E1F A;  3LH5 A;  2LQN A;  2KRM A;  3AYH B;  3EFO B;  3UWN A;  4A54 A;  1YI2 A;  4RHR A;  3S2D H;  3D7S B;  3BDO A;  4E6I A;  1BKB A;  4YY3 L;  4QF4 A;  1K8A C;  2VWF A;  1CSQ A;  3O8V A;  3P75 A;  1ENA A;  2KK4 A;  4NDX A;  4G7O C;  3RES A;  1PZI D;  5LJ5 g;  1IGU A;  2EGA A;  2NVX B;  2DMO A;  1W70 A;  2C35 B;  5C4X H;  2MMP A;  3QBY A;  1PTO C;  3M7N A;  2Z4I A;  4DR1 L;  4M78 C;  3GLX A;  1KRT A;  1IO6 A;  3C0C A;  1X3Q A;  1N9R A;  2CWA A;  4ABN A;  4AFQ C;  1XMQ Q;  2EVB A;  4KH1 B;  1SEM A;  1WTQ A;  3OIQ A;  2GA4 B;  2A0F B;  5ELO A;  3DB4 A;  3ER0 A;  4AFS C;  2FMM A;  4Y7N H;  1I8F A;  4GKK Q;  4EQ5 A;  1JB3 A;  2GF7 A;  4EIK A;  2I5H A;  2YLC A;  1ONL A;  3NPP A;  3VS4 A;  4OMM A;  4IJL A;  2D5D A;  4XTC S;  2UU9 L;  4JI7 Q;  2EQU A;  3U58 A;  2Z1C A;  3J7Y W;  4DR5 Q;  4IUP A;  3VYR A;  1ASY A;  2MNA A;  2RK1 A;  4PJO B;  1MV3 A;  4HVV A;  3BY7 A;  1YJ9 Q;  1OEB A;  3K81 C;  4BXX H;  2O2O A;  1PMR A;  2JQO A;  4RTW A;  1WXT A;  4MML A;  3CC7 A;  2D0O A;  1C6V X;  4A3J G;  1TXQ A;  4LF5 L;  1PD1 A;  3S16 H;  2DY8 A;  2CW0 C;  2L9H A;  4C92 B;  4DV7 Q;  1CKA A;  4OF1 A;  4JK1 C;  2DFU A;  5GMK j;  1I4G A;  4M75 G;  5FU6 B;  2F4V Q;  2DVJ A;  2AQ3 B;  4HCE A;  2QDY B;  3JSC A;  1C0M A;  3RMS A;  3KBX A;  4FT4 A;  1Q81 U;  1B7T A;  2BZ8 A;  3RUX A;  3CP0 A;  1QP2 A;  1ACM B;  4JZ3 A;  2X51 A;  4YWM A;  3OS2 A;  2CVR A;  3N52 A;  4G7Z C;  4NXN L;  1WHG A;  1K73 C;  1FYC A;  3OIP A;  4MNO A;  2QEX Q;  1MMG A;  1UE6 A;  1LT3 D;  3NBH A;  2PNR C;  4DEY A;  1UE1 A;  3G1J A;  2M02 A;  3H0G H;  5IN1 A;  2KRN A;  4JI8 Q;  2DJQ A;  5I2X A;  2K5W A;  4QQD A;  4FYW B;  1KDA A;  3DHQ A;  5JPM C;  3UPU A;  1TWF B;  1Q12 A;  1SSH A;  3DUZ A;  3T1H Q;  3M3Y H;  1XNR L;  2LQ8 A;  4J9E A;  4ORZ A;  4DBR A;  1X3P A;  2F3I A;  4DA4 A;  1WJJ A;  4J6W A;  3GTK H;  1V29 B;  5IXF A;  1VDZ A;  2HD3 A;  4CHT B;  4PKC C;  1QVP A;  4WOR A;  1PRL C;  3STB C;  3CKI B;  1WTW A;  3S6W A;  1I4X A;  3CCE T;  1YNJ C;  5DLQ E;  3M59 A;  2QKI C;  3ULL A;  3A8H B;  1EY4 A;  4LUZ A;  1U0L A;  3HL8 A;  2DNE A;  3HOX B;  3QJY A;  3QOJ A;  4XYO A;  3M53 A;  2VUB A;  3PO3 G;  1E2W A;  2VW9 A;  5CBE E;  5LJ5 h;  4L6V 5;  2BE9 B;  4IIM A;  3S14 B;  4KHP L;  3TME A;  1YHB A;  1LTA D;  1QMC A;  1JWS D;  1WCM G;  4HID A;  4PFZ A;  4ZUI A;  2A69 D;  1JEG A;  4ILW A;  3MEW A;  3J81 E;  2J6K A;  1XJW B;  5HGT A;  3ITP A;  1L0W A;  3VS3 A;  1DM0 B;  4R0K A;  3DM1 A;  3FKI H;  3PO2 G;  1L2F A;  1LOJ A;  3HOU H;  1U8R A;  2GTO A;  4C2M B;  2FIN B;  4JG2 A;  3E9F A;  3V96 A;  1BOS A;  3RZO H;  1SYE A;  2DTI A;  4F7U E;  4LXC A;  1A62 A;  5HK0 A;  3CRK C;  1JOK A;  4Z9C B;  5M3M B;  2D9T A;  1IGQ A;  2F0S A;  1OV3 A;  1PZJ D;  2RA2 A;  3V7S A;  1T5X D;  1UEA B;  1C48 A;  4OL7 A;  5GAO r;  2K7A A;  3M57 A;  3PO3 B;  4ODG A;  1F1B B;  3S1R B;  1TWH H;  1I07 A;  3A7A B;  4XTX A;  3DWP A;  1Q82 R;  1HQM C;  4DV4 L;  1JR0 D;  1O7Z A;  2E5L Q;  1HRJ A;  4BBS G;  2EYX A;  2QG9 B;  1WTP A;  2CCZ A;  4D8K A;  2CQO A;  1NTG A;  3EGD B;  4R4Q A;  2HEQ A;  1WXU A;  2DL5 A;  2HD0 A;  1L1O A;  2ZCF B;  4OB3 B;  2KHJ A;  1G2T A;  1RAE B;  1UGR B;  4M75 F;  5LL6 S;  2F4I A;  4OP0 A;  2LSS A;  2V4D A;  3MXN B;  1BF4 A;  3HOW H;  2DRM A;  2CZ0 B;  3MCA B;  5J26 A;  1EEF D;  5AJ3 L;  2GBQ A;  2L5Q A;  3CEY A;  4A4F A;  3OBY A;  1U1S A;  3TRZ A;  1QWF A;  2EKH A;  1K9A A;  3TRE A;  2LX7 A;  4JLI A;  3CC2 T;  1NE3 A;  2VB2 X;  3R6N A;  1W3S A;  1VQF A;  4MN3 A;  2G9D A;  2L15 A;  2FXQ A;  3BVG A;  4DK1 A;  4EMK B;  2RQU A;  2YTX A;  1PH8 A;  3T16 A;  3I3C A;  4J9G A;  2ECZ A;  2JVV A;  4CC7 A;  3KF6 A;  4BY7 B;  3X25 B;  2B2T C;  4JVZ A;  4PZ7 A;  4ZRZ A;  5IYB H;  2LJ1 A;  4S3S A;  3G7Z A;  1L0X B;  2WAC A;  3QO3 A;  1LCK A;  1X3F A;  1WYD A;  2N55 A;  3BYY B;  5GAM g;  3OTO L;  3GTL B;  3S2H B;  1IRX A;  1AOJ A;  1M8V A;  3EBE A;  1X3G A;  2WKC A;  4HJ9 A;  1VQN A;  4HCB A;  4BY6 B;  4AMC A;  3T4A C;  2JOY A;  2ED1 A;  1A2T A;  3HOZ H;  5LJ5 e;  2UXB L;  4BI3 A;  2NN6 H;  1Y1W B;  5AFW A;  5LJ3 h;  2CZ6 B;  3EN2 A;  2GCX A;  2DJZ A;  2K3Y A;  2QAZ A;  1HUM A;  2ASB A;  1B07 A;  4UDU C;  3TP7 A;  1XPR A;  2DUD A;  1KHI A;  2OTJ Q;  1YWO A;  4A3F G;  1FXX A;  3OB9 A;  3OQ5 A;  5GAO m;  1EIH A;  3MA2 B;  5KNB A;  5LHY 1;  1WHK A;  1H9J A;  4F88 A;  2UUC Q;  5C4X B;  2DYB A;  2EW3 A;  4KUL A;  2AK5 A;  2B63 H;  1FVI A;  4OB1 B;  4KMU C;  3I4N G;  1B50 A;  2RKS A;  3DWA A;  2YRV A;  5EBC A;  2PMZ E;  3MFY A;  1UTI A;  1RAI B;  3PT9 A;  1RIP A;  1BBZ A;  2SRC A;  2Y0S E;  1MJE A;  1AP0 A;  4DK3 C;  4XQN A;  1Y7X A;  1ZYR C;  5IGB A;  4C3J G;  4F87 A;  2AIR B;  1L1O C;  2A19 A;  3L0O A;  2B2W A;  3T13 A;  1WPY A;  1Z9Z A;  4RMF A;  2P0K A;  1UAP A;  4A3E B;  3OS0 A;  1XX8 A;  4M77 B;  2E2I B;  2NZO A;  1BYM A;  2WII B;  5FK9 C;  1Q1B A;  1HZB A;  1E1T A;  2RHS B;  4XU1 A;  2VUM H;  2QEJ C;  1SSF A;  1PKT A;  2A74 C;  1G2B A;  1RAG B;  4TVR A;  4X9C A;  3CD6 T;  2WFW A;  1YJN A;  1HQR D;  4QL5 A;  3M0U A;  4FL6 A;  1CT1 D;  3SE0 A;  2E2J H;  2G3R A;  3H0I A;  4X64 L;  2E5Q A;  4X3U A;  1KD1 R;  3R93 A;  1CQF A;  1CKO A;  3GTP B;  2VXE A;  5KND A;  2AHO B;  3MJX A;  5M9O A;  2BKD N;  3TBI B;  4M7A G;  1STN A;  3GOX A;  1G51 A;  2NTS A;  3GTO B;  4AFZ C;  4OML A;  2PZT A;  1ZBX A;  4OMN A;  1VQ8 A;  2KE9 A;  4IUQ A;  3UDG A;  2LX9 A;  1STG A;  1HNZ Q;  2M51 A;  3RER A;  3S16 B;  1VYT A;  1O7L A;  2ZGW A;  1D2B A;  2YUO A;  5GAN 7;  1TY2 A;  3AFP A;  3RNJ A;  4POF A;  4PJN A;  3S3M A;  2CP3 A;  2X4X A;  1WYX A;  1RF2 D;  1RAD B;  2K3X A;  2QDL A;  2QGG A;  2F2X A;  4OIK A;  9ATC B;  3LW5 E;  4YHH Q;  2JA8 H;  4FDB A;  4RKL A;  2V8I A;  2F0W A;  1XTC D;  3V2T A;  2XMF A;  5GAN 6;  3H6M A;  1CHQ D;  2NUT B;  3H0G B;  3HKZ B;  4KGV B;  2HSP A;  3JCM f;  1C1A A;  2KBT A;  2LZ6 B;  2K28 A;  1B9M A;  1NJI C;  2K50 A;  3MZ5 A;  4F8M A;  1ILP A;  3M4P A;  4DV2 Q;  1BB9 A;  2DLP A;  3M3Y B;  1YHQ A;  1FNW A;  4KT0 E;  3MWY W;  1K3B C;  4MDW A;  2XDB A;  2A6H C;  1EY0 A;  4DBQ A;  2C5C A;  1K8G A;  5CKE A;  2ZPI B;  1YIJ T;  1QNU A;  1RAH B;  2H8H A;  3GTK B;  2HDA A;  1VQ9 T;  2LVM A;  4O6J A;  1A3V A;  4OEL B;  1PH9 A;  4LDY A;  1M2V B;  1NMF A;  3MKD A;  1F9Q A;  1ZEQ X;  4DU9 A;  4O42 A;  2VNU D;  4R4O A;  1IKM A;  1STA A;  3CCS T;  1RI9 A;  1MGS A;  3JAM E;  4GNX B;  4DR6 Q;  3M55 A;  1S72 Q;  4P73 A;  1QVF S;  1D1I A;  2X3W D;  5A0L A;  4E7H A;  3QWY A;  5GAN 3;  1SLJ A;  1TS2 A;  5IP9 H;  2Z6K A;  4X65 L;  1VYU A;  1JBM A;  3M56 A;  1WNL A;  2EQJ A;  2EIF A;  1CSP A;  1G2S A;  5A0D A;  4A76 A;  1AE2 A;  1YHA A;  2R92 G;  1SYB A;  4M75 E;  3AB9 A;  1UHC A;  1LNX A;  3Q23 A;  1UGQ B;  4LF8 Q;  3CAM A;  4C8Q B;  2XGT A;  1TWG H;  1VCI A;  1BQQ T;  2BDN A;  3PUV A;  2NVT B;  3WVD B;  1TU2 B;  2ZM6 L;  1AVZ C;  4UP7 A;  4J9C A;  1CTM A;  2DL7 A;  2KJX A;  4A3J H;  3CCR A;  2DZ9 A;  5HY6 A;  1SSO A;  4NXM L;  4ZK9 B;  2MWO A;  3I56 T;  1I81 A;  1EIG A;  1HXY D;  1QNK A;  1EU3 A;  2HT1 A;  1GXD C;  1B3Q A;  2M1H A;  2PTK A;  2SNM A;  2VC8 A;  3MXU A;  1VQK Q;  1TWH B;  4O0A A;  4OXP A;  4JV5 L;  3OMC A;  2VZA A;  3UT1 A;  4BWG B;  4M7A F;  3Q0A A;  4A3M G;  3JCM b;  2F0T A;  1B2T A;  1VF5 C;  3VR3 A;  1EQR A;  2E8G A;  4OO1 G;  4HXJ A;  2XWB B;  2FZG B;  3QDF A;  4C3I H;  2DIG A;  2O4X B;  1EYD A;  5LJ3 d;  3QO2 A;  4GLM A;  1QG7 A;  1QWE A;  4L5Q A;  2QK0 A;  3D8G A;  5I2Y A;  3HOW B;  1AFP A;  2YT6 A;  4RG2 A;  4PJO C;  1Q86 C;  1HCZ A;  5C0X J;  2NVQ H;  4A3C G;  3RZD B;  1M1F A;  1BCP B;  1VQJ A;  3CQZ H;  2CDT A;  3LLR A;  3CCL Q;  2DL4 A;  3UA7 A;  1QLY A;  4E7L A;  4JI1 Q;  3RBB B;  1ESF A;  5M3F H;  2D2C C;  3P8H A;  2K33 A;  3CCQ T;  1QOH A;  5KNC A;  4BS9 A;  2Q2T A;  2JJQ A;  2WB1 G;  3CXC S;  4C92 C;  3J7A F;  5FLX E;  2DIL A;  1SMY C;  5GAE C;  5FU6 C;  4DV6 L;  1XMO Q;  2RI5 A;  4ANJ A;  2Z6K C;  3W1G A;  1SE2 A;  1VQC A;  2A6E C;  1TWA H;  2RDF A;  3D4D A;  2K5N A;  2L3S A;  2DTO A;  2KED A;  3D6C A;  4UC4 A;  5CR3 A;  4K5W A;  1WHL A;  1PKS A;  5D14 A;  1QCN A;  2E65 A;  1MSG A;  1V1P B;  2ENB A;  4KN4 C;  3WWV A;  4RA8 A;  2RI3 A;  3DLL A;  1DOM A;  4ZGE B;  3FDT A;  1Q95 G;  4FF3 A;  3HOZ B;  3AU7 A;  1WCM H;  2AQ2 B;  1UEB A;  1I6V C;  3VS0 A;  2F0E A;  2EJG A;  1SXT A;  1M8M A;  2O9V A;  1TS3 A;  2K75 A;  4OO1 I;  3T1Y L;  4DOV A;  1R4Q B;  4MZ9 A;  2FRW A;  1Y07 A;  5FU7 B;  3M4O B;  4PJJ A;  2D1X A;  1Q81 R;  4A4H A;  2F0H A;  2VV5 A;  5AT1 B;  1I4K 1;  3NXW A;  2EYF A;  3JC6 6;  3MXN A;  1P16 A;  4A3L H;  4RAU C;  5J22 A;  1YJ9 A;  1UHF A;  2L5T A;  3SFM A;  4HIM A;  1LAB A;  3KYH C;  5E4X A;  2E64 A;  1M1K U;  5FO7 B;  2AUJ D;  2JA6 B;  4K8I A;  2MYS A;  1HZ9 A;  1PRT F;  1C4Q A;  1MHN A;  1K28 A;  1F9S A;  3OMG A;  2F0F A;  3OYF A;  4O5V A;  4K2K A;  4A3G H;  4DV1 L;  1R0C B;  5G3L F;  3HRT A;  3K5L A;  2SNS A;  2ALY B;  4EMK A;  1DZ1 A;  1QW1 A;  1JJ2 S;  1V76 A;  2B8F A;  1WVL A;  1VQA A;  1PC0 A;  1KAB A;  1WXB A;  1XYI A;  1N32 L;  3EH1 A;  4I7A A;  4JC0 A;  2K4Y A;  3TEE A;  1CHP D;  4RHS A;  1RLQ C;  2X35 A;  4LD9 K;  2E2J B;  3CU7 A;  1Y8O B;  4XDX A;  3CXC P;  1SNP A;  3CCV A;  1TII D;  4RCO A;  3J80 i;  3T56 B;  3T9N A;  2VB6 A;  3IAY A;  4LFC Q;  1WJR A;  2QEX A;  3H3V C;  4QKU A;  1GOZ A;  2QYZ A;  4N4G A;  1X43 A; 
#chains in the Genus database with same CATH homology
 1CKB A;  1W6X A;  2I0N A;  2KGT A;  2BZX A;  2DE0 X;  3FJ5 A;  3M0R A;  3TSW A;  4RTU A;  1HD3 A;  4LUE A;  4AG2 C;  3TSZ A;  2MOX A;  2J6F A;  2JMA A;  2CT4 A;  1ARK A;  4RTY A;  1AWJ A;  1TUD A;  2X3X D;  2BTT A;  1ZUY A;  1TUC A;  3LH5 A;  2LQN A;  2RMO A;  1GCP A;  2KRM A;  3VS5 A;  2V1R A;  2FPE A;  2CH4 W;  2VWF A;  2KXC A;  5ECA A;  2JT4 A;  2VKN A;  2F2W A;  1AWO A;  2EGA A;  3EG1 A;  2DMO A;  1W70 A;  3A98 A;  1GRI A;  2KRS A;  3I5R A;  1K0S A;  2C0I A;  3EG3 A;  1OOT A;  1IO6 A;  3C0C A;  1BU1 A;  1SHF A;  2W0Z A;  4AFQ C;  1ZUU A;  1SEM A;  4J9I A;  4LUD A;  2O9S A;  4AFS C;  4F17 A;  1UGV A;  2KRO A;  2DL8 A;  4J9D A;  4EIK A;  3VS4 A;  2YUN A;  2FO0 A;  4OMM A;  1XOV A;  1KJW A;  1BK2 A;  1MV3 A;  4HVV A;  3NMZ C;  2HBW A;  4J9H A;  1H92 A;  1OEB A;  3EG0 A;  1HSQ A;  2O2O A;  4RTW A;  1M27 C;  1WXT A;  2CSI A;  5IXB A;  1KFZ A;  1WA7 A;  2DBK A;  2W10 A;  2A37 A;  1HJD A;  1CKA A;  4F16 A;  1U3O A;  3SEM A;  2D8H A;  4HVU A;  2J05 A;  2DVJ A;  2FPD A;  1FYN A;  1PHT A;  2IIM A;  1UJ0 A;  2L2P A;  2F2V A;  1NEG A;  2BZ8 A;  4JZ3 A;  2NUZ A;  5IHK A;  2O31 A;  1NLP C;  2YUQ A;  1UEC A;  4DEY A;  1Y57 A;  2KRN A;  2DJQ A;  3VS7 A;  1SSH A;  1SRL A;  3REB B;  1K4U S;  2V1Q A;  2K6D A;  4J9E A;  4ORZ A;  1X2Q A;  4JJB A;  2GNC A;  5IXF A;  2ESW A;  1AD5 A;  2DF6 A;  2DX1 A;  1PRL C;  1T3S A;  2KT8 A;  1ZX6 A;  2HCK A;  2AZV A;  5FWB A;  1X69 A;  2SEM A;  5HCK A;  3VS6 A;  2RF0 A;  3ZL7 C;  4IIM A;  5FW9 A;  1JEG A;  2J6K A;  3VS3 A;  4R0K A;  1I0C A;  2GTO A;  1NLO C;  1KSW A;  2MIO A;  2MCN A;  1YN8 A;  2GTJ A;  2DA9 A;  1V1C A;  2AZS A;  1OV3 A;  2K7A A;  5I11 A;  1WFW A;  2EBP A;  1I07 A;  1SHG A;  3EGU A;  3H41 A;  2EYX A;  1ZLM A;  2J7I A;  4D8K A;  2YSQ A;  2HEQ A;  1WXU A;  2DL5 A;  1GCQ C;  1NYF A;  1NEB A;  2VVK A;  2DRM A;  3IQL A;  1AEY A;  4AFU C;  2M0Y A;  2GBQ A;  1K76 A;  3UA6 A;  2CT3 A;  1QWF A;  2JMC A;  1K9A A;  1VA7 A;  2EKH A;  2DRK A;  2JM8 A;  2LX7 A;  3I5S A;  4OMO A;  1JXO A;  3R6N A;  2RQU A;  1NYG A;  2KXD A;  3VRY A;  4J9G A;  2ECZ A;  2EVR A;  4CC7 A;  1JU5 C;  4CC3 A;  5EC7 A;  4D8D A;  2LJ1 A;  2RQW A;  1H3H A;  1LCK A;  1MUZ A;  3GBQ A;  2DNU A;  1T0J A;  2A08 A;  1AOJ A;  2K3B A;  4CC4 B;  1TG0 A;  2FG0 A;  2L3P A;  3H0H A;  2ED1 A;  2C0O A;  1NM7 A;  4K11 A;  1RUW A;  1K0X A;  1B07 A;  1ABO A;  1YWO A;  3CQT A;  1OPL A;  4ZNX A;  2DYB A;  2EW3 A;  2AK5 A;  1JQQ A;  3PVQ A;  4RTV A;  1UTI A;  1BBZ A;  2SRC A;  1X6G A;  3JV3 A;  4AG1 C;  4F14 A;  1GBQ A;  1Z9Z A;  3NGP A;  1M30 A;  3M0T A;  1PKT A;  1G2B A;  2ROL A;  3M0U A;  5I22 A;  2K79 A;  3H0I A;  1UFF A;  2LP5 A;  1WIE A;  1M3B A;  1K1Z A;  2LCS A;  1YNZ A;  1X27 A;  3THK A;  1UDL A;  2AKL A;  2C0T A;  1E6G A;  4AFZ C;  4OML A;  4OMN A;  2KE9 A;  2LJ3 A;  2L3Q A;  2M51 A;  1VYT A;  2OAW A;  4IIO A;  2RQV A;  2DM1 A;  2YUO A;  3H0F A;  4A63 B;  3ULR B;  3RNJ A;  2D8J A;  2EYY A;  2YDL A;  4RUG A;  1YP5 A;  1WYX A;  3I9Q A;  1NG2 A;  1EFN A;  4RTX A;  2QDL A;  2F2X A;  2J06 A;  5IHI A;  1ZSG A;  4LN2 A;  1H8K A;  4Z88 A;  1SRM A;  2XMF A;  3UAT A;  1WI7 A;  1AWX A;  1QCF A;  2HSP A;  5GJV B;  1UJY A;  2KBT A;  2LZ6 B;  2OJ2 A;  1ZBJ A;  1E6H A;  2EGE A;  2KNB B;  1WX6 A;  1BB9 A;  2K2M A;  2DLP A;  4JZ4 A;  2NWM A;  1UUE A;  3VS2 A;  3SHW A;  2DBM A;  4E6R A;  4JJD A;  2JS2 A;  2LJ0 A;  2H8H A;  4QT7 A;  4JJC A;  2HDA A;  4FSS A;  1GFD A;  1QKX A;  3NHN A;  1RLP C;  3O5Z A;  1RI9 A;  4RTT A;  2EGC A;  2B86 A;  2CUD A;  2RPN A;  2X3W D;  4JPB W;  3QWY A;  1VYU A;  2D0N A;  4CC2 A;  2AKK A;  3EG2 A;  2PNI A;  3I35 A;  4J9B A;  4X1V A;  4GBQ A;  2YUP A;  2E5K A;  2LMJ A;  1UHC A;  2CUB A;  2PZ1 A;  2RN8 A;  2JTE A;  1W1F A;  2FEI A;  1E7O A;  1T3L A;  1Z9Q A;  1UE9 A;  5L23 A;  4ESR A;  1T0H A;  1Y0M A;  1OPK A;  1AVZ C;  4J9C A;  2DL7 A;  4Z8A A;  2JXB A;  2K9G A;  2CSQ A;  2RQR A;  2P4R A;  1B3Q A;  2PTK A;  1CSK A;  1X6B A;  2O88 A;  1M3C A;  1FMK A;  3UF4 A;  1ZUK A;  5GJW B;  4HCK A;  2GGR A;  4HXJ A;  4GLM A;  1G83 A;  3QWX X;  1QWE A;  3VRZ A;  4LE9 A;  2YT6 A;  4DEX A;  1PWT A;  2CRE A;  1M3A A;  3VS1 A;  2A36 A;  1I1J A;  2FRY A;  2CDT A;  3M0S A;  2ED0 A;  3EHQ A;  2KYM A;  1X2K A;  2DL4 A;  3EHR A;  3UA7 A;  2DL3 A;  1QLY A;  1U06 A;  4OMP A;  3RBB B;  2L0A A;  1YCS B;  1GFC A;  4RTZ A;  2KYB A;  2ENM A;  3KFV A;  2DIL A;  2EYZ A;  4OMQ A;  1WLP B;  5FWC A;  2J6O A;  1GL5 A;  1A0N B;  1S1N A;  4WCI A;  2CH4 A;  3REA B;  3TVT A;  2L3S A;  2FPF A;  2LNH B;  1PKS A;  1AZE A;  2ABL A;  1VYV A;  3PVL A;  2G6F X;  2RQT A;  4HVW A;  1N5Z A;  2OI3 A;  3VS0 A;  1WDX A;  2LQW A;  3M0Q A;  1M8M A;  1SPK A;  2O9V A;  4Y92 A;  5IH2 A;  2BZY A;  2FRW A;  2D1X A;  3PE0 A;  2JS0 A;  2EPD A;  1MV0 B;  1UHF A;  1UG1 A;  5IHN A;  1AWW A;  3M0P A;  2GQI A;  4KRT A;  3U23 A;  2KEA A;  1GCQ A;  1YWP A;  2JM9 A;  2JW4 A;  2KT1 A;  2EYW A;  2ROT A;  1WXB A;  2A28 A;  4LNP A;  2EQI A;  4M4Z A;  1ABQ A;  1KIK A;  1RLQ C;  3NPF A;  1QKW A;  2KR3 A;  1JXM A;  1J3T A;  4J9F A;  1PNJ A;  1U5S A;  1AZG B;  4Z89 A;  1GBR A;  2RNA A;  1JO8 A;  1X43 A;  1PRM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...