4JPBW

The structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
140
Chain Sequence
b'LKEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheA
publication title The 3.2 angstrom resolution structure of a receptor: CheA:CheW signaling complex defines overlapping binding sites and key residue interactions within bacterial chemosensory arrays.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Immune system
total genus 28
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jpbW01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 4jpbW02
4Y92A 2EGEA 3ULRB 4R0KA 3NPFA 2SRCA 2CT3A 4X1VA 2SEMA 1M27C 4LE9A 2ED0A 2LNHB 1UG1A 2BZXA 2O88A 2X3WD 4FSSA 3ZL7C 2DE0X 1E6HA 2M0YA 2BZ8A 2NWMA 5FWCA 1VYUA 2RQTA 5GJVB 1W1FA 2ABLA 1TUCA 1JO8A 2MIOA 1YP5A 4RUGA 1AEYA 2BTTA 2RNAA 3C0CA 2KEAA 1SSHA 4Z8AA 3QWYA 1RI9A 3EG0A 1UFFA 2BZYA 1X69A 3RNJA 1UGVA 1AWXA 1U5SA 5IXBA 4OMNA 1NG2A 2JM9A 3VS0A 4J9CA 2LZ6B 4OMMA 2FO0A 1HJDA 4IIOA 4CC4B 1G83A 2DA9A 4OMLA 2EGAA 2RF0A 2MOXA 2K9GA 4AG1C 2GNCA 2KXCA 2LJ1A 1PNJA 1QWEA 2CREA 1TUDA 1GBQA 3A98A 2KRMA 1AD5A 4LN2A 1I1JA 1ZUKA 4LUDA 1QLYA 2K7AA 2X3XD 1AZEA 3U23A 1GRIA 2L0AA 1K1ZA 3M0RA 2EYZA 2KGTA 3FJ5A 4J9HA 3SHWA 1WA7A 2KR3A 2DRMA 5GJWB 4AFUC 1KIKA 1EFNA 1CKBA 4LUEA 3GBQA 1K0XA 1UJYA 2A36A 4AFSC 2OAWA 1JXMA 1X2QA 3CQTA 1VYTA 2MCNA 1CKAA 2KT1A 2B86A 3VS4A 4WCIA 3R6NA 2G6FX 1G2BA 1JQQA 3VS6A 1T0JA 4OMOA 4RTUA 2LQNA 3M0PA 1UUEA 2VWFA 4J9IA 1WX6A 1H92A 1B07A 1UJ0A 3EHQA 5IHKA 4JJDA 5FWBA 1IO6A 4K11A 2FEIA 2W10A 3NGPA 1ZUYA 2KNBB 1QWFA 4GBQA 1M3BA 2DX1A 5IH2A 5IHNA 2O9SA 1X2KA 2FPDA 2EPDA 2C0OA 1GFDA 2AZVA 1AVZC 5FW9A 3I5RA 3M0QA 4JPBW 2DILA 4Z89A 1PKSA 1E6GA 2ENMA 4JZ3A 2YUOA 1WXUA 4EIKA 2O9VA 2KYBA 3NMZC 2O2OA 4J9FA 1X6BA 2KE9A 5ECAA 4DEYA 2CSIA 1LCKA 1UTIA 1Z9QA 3KFVA 1M3CA 2KXDA 1I0CA 2HBWA 2JS0A 3REAB 2AKKA 2DYBA 1HSQA 2IIMA 2KBTA 1OPLA 2HSPA 1A0NB 4ZNXA 2HEQA 4ORZA 4RTVA 2D1XA 3VRYA 2RQUA 2LQWA 3H41A 1K9AA 1UE9A 1WXTA 2RN8A 4Z88A 4J9EA 2K2MA 1SRMA 1JU5C 3TSWA 2RQRA 3EGUA 1Y57A 2DL3A 4RTXA 1NLOC 2YUNA 2XMFA 1MV3A 2CSQA 2LMJA 1H3HA 1OOTA 1NLPC 1UHCA 1NEBA 1GCQC 4D8DA 2LJ0A 1OEBA 4RTYA 1KJWA 2DM1A 1OPKA 2A28A 2ESWA 2LCSA 1AWOA 1K0SA 2A08A 1K76A 4LNPA 2QDLA 2KRNA 2EGCA 2AKLA 2YSQA 2FG0A 2GTOA 2EYYA 2OI3A 1I07A 2DBKA 3PVLA 2I0NA 2ECZA 2PZ1A 2H8HA 2EQIA 2J7IA 1SHFA 3SEMA 1NYGA 1GCPA 2JTEA 4RTWA 3VS2A 2DVJA 2DNUA 2HDAA 1ABOA 2CH4W 1V1CA 1WLPB 4E6RA 1T0HA 2EVRA 3TVTA 2J6FA 3LH5A 1RLQC 2KRSA 2DL4A 4M4ZA 2JMAA 1MV0B 4J9DA 2C0IA 1S1NA 2GTJA 1U06A 4JJCA 4JJBA 2LP5A 2RQWA 4CC3A 3RBBB 1SHGA 3VS1A 2CUDA 4F16A 2DF6A 1RUWA 3REBB 2FRYA 2L3PA 1RLPC 1VYVA 2F2XA 2CDTA 4QT7A 4IIMA 4J9GA 1SRLA 1PKTA 3UF4A 2YT6A 2KT8A 2FRWA 2LJ3A 4A63B 2GGRA 2E5KA 2AK5A 3I9QA 5L23A 1W6XA 2F2WA 4OMQA 3JV3A 1E7OA 2K6DA 1ZSGA 1YN8A 3TSZA 2JT4A 3EG2A 4HVWA 3M0UA 2ROLA 4AFZC 2DJQA 1ZUUA 4ESRA 3UATA 4F14A 1ARKA 1T3LA 2EYXA 1FYNA 3H0IA 1FMKA 1KSWA 1X6GA 1VA7A 1MUZA 1YWOA 4JZ4A 5IXFA 2HCKA 2DBMA 2A37A 1X43A 1PWTA 2L3SA 5IHIA 1QKXA 1M30A 3NHNA 1OV3A 1ZBJA 1BBZA 1BB9A 2YUPA 2DL7A 1H8KA 3VS5A 1ABQA 2JM8A 2JW4A 2O31A 4OMPA 1CSKA 2EW3A 4RTZA 2AZSA 2EKHA 2K3BA 4HCKA 1WXBA 3I5SA 2DMOA 1JEGA 2GBQA 1WFWA 2C0TA 2D8JA 1Z9ZA 2VKNA 2ROTA 2DLPA 2KYMA 2DL8A 2OJ2A 1UHFA 1WYXA 3O5ZA 4CC7A 2YDLA 3QWXX 2EBPA 2J6OA 5HCKA 3PVQA 1SEMA 2PTKA 4KRTA 1UDLA 5EC7A 4AFQC 4HVUA 5I11A 2FPFA 1M8MA 1WI7A 2LX7A 4HXJA 1AOJA 1N5ZA 3VRZA 3VS3A 1J3TA 3M0SA 1NEGA 1QKWA 1YCSB 2D0NA 1PRMC 1KFZA 2CH4A 2V1QA 1BU1A 2EYWA 3EG3A 1NYFA 1YNZA 2RQVA 3UA7A 2DL5A 1NM7A 3THKA 3UA6A 4HVVA 2J05A 2W0ZA 3EHRA 4RTTA 1T3SA 2P4RA 2PNIA 1XOVA 1ZLMA 3I35A 1BK2A 2VVKA 1K4US 1WDXA 2ED1A 2L3QA 2JXBA 1AZGB 1QCFA 2RPNA 1U3OA 2M51A 1AWJA 1HD3A 2YUQA 4F17A 2D8HA 3EG1A 1W70A 1X27A 1GBRA 4CC2A 3H0FA 2L2PA 1WIEA 4DEXA 4J9BA 1M3AA 3VS7A 2CUBA 1TG0A 2JMCA 1AWWA 2DRKA 4AG2C 1GL5A 1ZX6A 1YWPA 2J6KA 2JS2A 2K79A 2FPEA 2GQIA 2J06A 4GLMA 1JXOA 1Y0MA 1PHTA 3IQLA 1GCQA 3PE0A 1PRLC 2RMOA 2NUZA 3M0TA 1SPKA 2KROA 3H0HA 1B3QA 4D8KA 1UECA 2F2VA 1GFCA 2CT4A 2V1RA 5I22A
chains in the Genus database with same CATH superfamily
1N8RC 3ULRB 1X6OA 1BCPD 3NPFA 1XPOA 2EKOA 1MJCA 2K04A 2WAQE 4N0AC 2LNHB 2HL3A 4ATOA 1B53A 4YWMA 2O88A 3DEOA 4RCBA 2EYOA 2CW0C 3WVEB 1EQVA 2YLCA 2DE0X 4C8QB 3MP1A 5DAUA 1E6HA 2L8DA 2M0YA 2VZAA 3BDCA 4OX9Q 2PQAA 4C3HG 2RO0A 1JB0E 2RQTA 4FYXB 2HIXA 4HR7B 5GJVB 1B1ZA 5IWAL 4K0KL 2L55A 2DZCA 1L1OA 3CC7A 4PJOD 1VS0A 3FLGA 4IJLA 2Q8IB 1PSFA 1P8LA 3PMFA 2ZPFB 4RUGA 5GAOr 3MFGA 4A3IG 1JWMD 1K9MC 6AT1B 2RHZA 5J22A 4A3EH 3W3AA 3CCST 1CSPA 2ZAEA 2B2UC 4JBWA 1V8QA 3RKXA 4HIKA 3PO2G 2CP0A 1HZCA 3GTOH 1T5XD 2CP2A 1I3QH 4Q5WA 4NDXA 1EYAA 4E7HA 4LF7L 1LT5D 2F0OA 2GFAA 3QWYA 3LWEA 1RI9A 2JN0A 3NEMA 4CI0C 4DGZA 1D7QA 3SE0A 2K2VA 4IFDJ 1YIJT 3J7A5 1JMCA 4LDYA 1RL2A 2X6GA 1M1KC 1RAHB 1TIID 2ZPGB 5J39A 4LF8Q 4KGZB 5C44H 4J9CA 2LZ6B 3H3VI 3SK5A 4LFAL 2FO0A 3PQIA 4OGQC 3UE0A 2Y4YA 3HGBA 2ID0A 3K0YA 3OSOA 4CC4B 2RI5A 4DV0L 1PH4A 1QCOA 1HFGA 4A75A 1AN8A 2DKGA 4E7LA 5JAVA 3F1ZA 2K9GA 4A3EG 3NFCA 2KXCA 3CCUA 1QJOA 4C3JB 1G6ZA 1OU8A 2VY3A 3J80L 1QWEA 3DKMA 2ZTEA 1I94L 1B4OA 1WTWA 1ET9A 2PYKA 1GBQA 3W1BA 4LN2A 2QA4A 4LUDA 3AB9A 1WJQA 3MC0B 4YHHL 3IFDA 1GHKA 2F52A 1NSNS 2PZWA 5IP9H 1AT1B 1C6VX 3AFPA 2EY1A 1CZWA 1RTNA 3FB9A 5IWAQ 1MMAA 2L0AA 4K0KQ 4LXCA 1K1ZA 1JR0D 3GLXA 1ILQA 3SK4A 5IYBH 3VYSA 2D0PA 5FK9C 5GJWB 1F2ZA 1X3FA 4C92B 2IPKD 1HXDA 3SWNA 1RJTA 4J6XA 4R4QA 5JVG3 1VQ4A 2JXMB 4AYBG 2P0QA 4QQGA 1X2QA 3NTHA 3S15B 3VYRA 1CKAA 5GAMg 4GZYC 4KJOA 4DAPA 5M3FH 3H9NA 2OX7A 4BDZA 3QJ6A 2L3RA 4HCBA 2COZA 1NZ9A 1EYDA 1NY4A 2JA7H 4RHSA 3VS6A 3X24B 1T0JA 1EY4A 1LTTD 3D6WA 3DB3A 3M59A 5KRUA 4WFN3 5LMNL 3H09A 3HKZG 1HR0W 2R92B 1CHQD 5IP9G 3VYUA 2K5WA 3V2TA 2VWFA 4LFAQ 4QQBX 1UUPA 3OYNA 4YWLA 5CAIA 5JEAJ 1IB8A 3OWEB 1EIYB 2MAMA 5IYBG 4M7DA 1PTOH 1SE2A 3CC7Q 1V1OA 4DV0Q 2SEBD 4VUBA 5DM63 3HHTB 4JJDA 2RDFA 3EA6A 4DXGA 4BWGB 1IO6A 1OQKA 2C5CA 3GTMB 1LTRD 4P72A 2P0KA 2KNBB 1QWFA 1VQNA 1IRXA 3LX0A 1I94Q 4OO1I 1FGBD 1M3BA 2DX1A 5IH2A 1K3RA 3C3LA 5IHNA 2H3EB 2FB7A 1TS4A 4YHHQ 1MMNA 2QXFA 4A3FB 2AZVA 1VQHA 5K5PA 3JCMJ 3MXNB 3BDOA 5FW9A 1SSFA 5GMKi 3M0QA 1D0XA 3VV0A 1BO0A 2EOTA 1E6GA 4LF4L 2ENMA 3N5BB 3K7AH 3X25B 2EYMA 2DAQA 1OXSC 4HJ8A 1U4PA 1WI5A 2HUGA 1N33Q 2F3VA 1S5DD 3GV6A 3HFZB 2K3XA 1M2VB 2MHVA 1TUGB 1LACA 5D3DA 4C3IH 4M75D 1IBLL 2CSIA 4MDXA 2PVGB 4EMHA 1WD0A 2XU8A 5FJ8H 2BA1A 2Z8LA 5LJ5j 1FL0A 4MTKA 3G6JB 1M3CA 3RN5A 2R5MA 1TWAB 2AQ1B 3H3VC 3GTQH 2AKKA 5LMNQ 1HSQA 4JI4Q 1TH7A 2KBTA 2R61A 3X3MA 4DR4Q 2HSPA 2OQKA 2GF7A 1A0NB 1C48A 1E24A 2HDLA 2Z0SA 1EQRA 2DTIA 1UE1A 4C1NI 5H1SE 5I4DA 1WJRA 2D1XA 3VRYA 4KLKA 1KD1R 1KD1U 1UAPA 1K9AA 5LJ5h 3ITPA 1UE9A 2OXPA 5C4XH 3J81c 4EDUA 4Z88A 4J9EA 1SRMA 1TS9A 2BUDA 1VQKA 4DR5Q 3HOVB 3EGUA 5FO9B 4RTXA 3CMEA 2E6NA 2R7ZG 2YUNA 3UDCA 1VQ4Q 2PNHA 2JK8A 3S24A 4A3GH 2RI3A 5DM73 1S72T 4PLIA 5FJ8G 1D0ZA 4B3RL 1PM3A 1U4RA 5GAOp 1QZGA 1MIUA 2E76C 5IGCA 1NLPC 1NBEB 1LTAD 4C1NK 4E7SA 1GCQC 3K59A 1YI2A 4TQUS 3BZCA 2F0KA 1CKOA 4M75G 2OEOA 5LL6S 3URYA 1OPKA 4E7ZA 1W3SA 4JRIA 1K0SA 2QASA 2RSNA 4XTYA 5CKEA 2A08A 4OB0B 5E1FA 1HQRD 1KHIA 2XK0A 3MAQA 2FZKB 2AKLA 4PNOA 4II1A 2RA4A 4CHTB 1IBLQ 1RCVD 4XT1B 4ME3A 1XJWB 3SR1A 4C0DB 2FJ2A 3C1FA 2I0NA 2X4JA 2ECZA 1OXVA 2QGGA 4A3GG 3OYYA 2H8HA 1XTCD 3E5SA 4UPAA 3TZDA 4FF3A 1SHFA 3MHXA 5A2QE 1ZQ1A 4AMCA 1YJNT 1I50H 5M3MH 5M5XB 1G6PA 1KDCA 3JB9D 1J9OA 4RTWA 2JEBI 1NR4A 3KLSA 1H9SA 3VS2A 4ME5A 2CH4W 1QQJA 2KCNA 1TS2A 4L5SA 5EGTA 2YU9B 5KYYA 5NUCA 3GTGB 1QNKA 5KYXB 1U0LA 4WRDA 2J6FA 4ZQ3A 4Y91A 3MWYW 1Z47A 2X9HA 1Y1VB 3S1NH 2PU9B 4YCUA 1V76A 4KHZA 4QL5A 4M4ZA 1EQTA 4HJ5A 2OWOA 4EQ5A 1S1NA 2GTJA 3SFMA 3KDFA 1D3BB 4RCOA 3JCMd 2A7YA 1U06A 4KGXB 1KQ1A 2LP5A 1Q82R 1Q82U 2ASBA 3CCSA 1SHGA 3VS1A 1VQPT 1I8FA 4IUVA 4BY6C 2CUDA 1CKNA 4HMJA 4MZPA 5M3MG 5KNCA 4K14A 1BKBA 5GAN5 4LK1C 1M1FA 1AFPA 4DN4M 3MXGA 3GP7A 2BCOA 1X9NA 1VYVA 3FC3A 1HZBA 2RDHA 1LABA 2CDTA 3F2DA 4C3HB 4QT7A 2MJ8A 5JJLA 2LRQA 2VV5A 3S1RB 2ATCB 4ULLA 1YIJA 2HCIA 4V0BA 3NELA 1ML0D 2CP5A 2Q2IA 2YYZA 4A3IB 4X9CA 3HOYB 4M7AA 2LJ3A 1SNCA 4J8QA 3L1AA 4PJLA 2GGRA 1IZ6A 3I9QA 5L23A 1W6XA 2KHJA 4IPGA 3W5OA 3OSVA 4M78A 3LNNA 3J81j 4JI3Q 1VQKQ 2L5TA 2ATWA 4BXXH 4EMGA 3JC66 4DK6C 2RHSB 2VXEA 1ZSGA 4L5GA 2D5DA 3R2TA 2H1EA 1YN8A 2XG8D 1G3YA 5GMKl 1SE4A 1X3PA 4YTLA 2PQAB 4QGUA 4A3MH 2JT4A 3SVMA 3EG2A 4JDSA 1WVLA 1KRTA 2PMZE 4DAYA 1E0BA 2EYHA 3M0UA 5CO7A 4M77F 4BI8B 1C7YA 3A8HB 4BI3A 4M7AG 2X35A 1WOCA 2IWHA 3UATA 1B44D 3J80c 4M77E 4XTVA 3A8JE 3NWTA 1QVGA 4GOPB 4A3KH 1T3LA 1Y71A 2EYXA 4M78G 1R9TB 4HMIA 1GM5A 1WHGA 4KTAA 3S2HH 1FMKA 3T13A 4JI5L 4KMUC 3EGXA 3TZUA 1WTOA 2OTLQ 3I55T 2NYSA 2EXZA 1ZHIA 5IXFA 4A3EB 2A37A 4ZN1A 4CBVA 3QZ9B 1ICWA 1WCMH 2L3SA 1ZYRD 3UDXA 3GTOB 1QKXA 1LLRD 4BXXG 1M30A 1OV3A 1BBZA 1N34L 5A35A 4O1NA 3RD4A 5IN1A 1ONLA 2JM8A 2O31A 4OMPA 3CW2C 4FF2A 1E7ZA 1EFWA 2IPOB 4RTZA 1VQ6A 4A3JH 4BS9A 2EKHA 1YITT 1S5BD 1U4MA 2C9OA 2F69A 2F3IA 5C3WA 5EPJA 2A73B 1NAPA 2DD4A 3GDEA 2DMOA 2CWPA 5JJZA 2F03A 3TN2A 2GBQA 4DAMA 2C0TA 2D8JA 3R3OA 4A3KG 1HA6A 2LY7A 3TS0A 4G7HC 1Q86R 4IUPA 1Q86U 2ROTA 3FRPB 2DLPA 3DHQA 1SRUA 4HIDA 1GVPA 2X6LA 3RUZA 3O5ZA 5GANj 4HJAA 1WJSA 3M5AA 3QWXX 4MMKA 1H9JA 1GOZA 1PFNA 2CCZA 2J6OA 3VA5A 4FO2A 2F4VQ 2OT2A 3CCEQ 1SEMA 4S3SA 4UP7A 1AZPA 3K0XA 3A8IE 3N52A 1VMCA 1IREB 3HKZB 5EC7A 4AFQC 3EIVA 4A4IA 4OP0A 4A3JG 4QY7A 5BR8L 2RSOA 3VS3A 2EY5A 3SWNB 1J3TA 3NP8A 1U9RA 5GANh 2P84A 1RACB 1M2OA 1PSEA 4GLKA 3M0SA 4JI5Q 4EQOA 4HKEA 1KFZA 3QPHA 1KD1C 3UWNA 4A3DG 2C35B 3I56A 2CKKA 4DAVA 2EYWA 2FINB 2IL8A 1NYFA 1H95A 4ELYC 1B9MA 1N34Q 1QVGS 3VUBA 2DL5A 1VQLT 1HTLD 3UA6A 4K2KA 4WJ4A 4HVVA 4KH1B 4XYOA 4AQYL 1PC0A 2N8NA 3Q1JA 3OYBA 5EPLA 1M90R 2I0QA 1M90U 1M4VA 2QEJC 1STEA 3I35A 1BK2A 3UPUA 1K4US 1SR3A 1WDXA 2ED1A 3PGGA 4F7UF 1JJ2P 3D7SB 2F0UA 3KF8B 5BN5A 1AZGB 1LTGD 1PRTB 2NLUA 3C95A 4NL2A 1PTOB 2H5XA 4UDUC 4F7UE 3CRLC 2LCCA 3CRKC 3GV3A 2D8HA 3EG1A 3QBYA 1EIGA 3CC2T 1X27A 1PVOA 1GBRA 3H0FA 2L2PA 1WIEA 3RIRA 3JCMf 4JUVA 4DEXA 2D2CC 4K5WA 3MP6A 2E12A 1KQSA 3HSBA 5LMUL 3MXUA 1VQDA 3VS7A 4RKBA 2AMCB 2OCEA 1BI0A 4JRPA 1RAAB 2RJEA 2V8IA 4E6IA 2DRKA 4C5IA 1MGQA 3QIIA 3CC4Q 3PUXA 4DR6L 1PDQA 1ACMB 1OI1A 3JCMg 2DD5A 4HJ7A 2K5DA 5BR8Q 2JS2A 2DJGC 1QB5D 2AHOB 2K79A 4X3UA 3TU4K 4DA4A 2SOBA 3K7AB 3C12A 1TY2A 1UE6A 2L1BA 1QCBD 4QVZA 2R7FA 5M5WH 1LOJA 2NN6H 1JXOA 4IFDI 4C3IB 2EJGA 2R58A 1OX9A 3IQLA 2JA6G 1Q81C 3OYCA 2ZJQA 1O80A 1KC8R 1D1IA 1KC8U 3PMIA 4K2LA 2NUZA 3SXHA 1DOMA 4YCVA 2HCCA 1HNWL 3GTQB 4AQYQ 5KCOA 4BY7H 3M55A 1Q82C 4GN3B 1YJNA 4JBMA 1WTHA 2DGYA 1UE5A 2MYSA 3A56A 1Y69U 2CT4A 2V1RA 3MPUB 1DOLA 3AHUA 3U9OA 2JA8G 4M75B 4FSXA 2AQ3B 2WAQG 2YTXA 3O8VA 1V43A 5GADC 2K4KA 3M58A 1SYDA 4Y92A 1MHWC 1RAGB 1AHJB 2DVEA 3V96A 4V2SA 2CT3A 4X1VA 5IGGA 1G8ZD 2Z6BA 4G7ZC 3S1QH 4J8OA 4Z9CB 5E4WC 3VYGA 2JVVA 2SEMA 2NN6G 1BXTA 3DUZA 4DBQA 3D4RA 3VU3C 1M5Q1 2ED0A 3OTOL 2NUCA 1A8VA 4BDYA 2VB2X 1TOVA 1Q46A 3MXNA 4A3GB 1F1BB 5LMUQ 3ZL7C 3A8KE 1IL2A 1G3WA 2N49A 4A3CH 2G3RA 2MF2A 4N9TA 5FWCA 4PKCC 2A69C 4DR6Q 1VYUA 1Y8OB 2DO3A 5IP7H 1JWUD 4BY7G 2CVRA 1H641 2ABLA 2M1HA 3V8LA 5I2SA 2QQAA 3FEOA 5LJ5d 3PV0A 1M2VA 1C0MA 4OB3B 4B6MA 1AZQA 3HOWH 5EQ0A 2EZVA 1VUBA 1OULA 1TWAH 3J81i 3J7ZC 2ZPEB 3S6WA 1KQSS 2A74C 3U4ZA 1OX8A 5DM7R 1B7YB 8ATCB 4RMOA 5AJ3L 2D0QB 4Y28E 1I4K1 3KUPA 4FF1A 2VUBA 4JI7Q 5CV7A 3PF5A 3ONAB 2DIGA 4M8AA 1RTOA 4Z8AA 2WACA 1H9SB 1STGA 1I4QA 2RHQB 1HNWQ 3DM1A 1YNNC 2L5QA 1I50B 1CKMA 5M3MB 1UGVA 1EU4A 4O5VA 1IW7C 2K14A 1S72Q 1NG2A 3VS0A 1VQAA 3TBIB 1JE5A 4NXML 1JE4A 1HJDA 2R7DA 3I4MH 5K36G 1GUOA 5CORA 3M9BA 1TWGH 1TKWB 1AW7A 1G83A 2XTIA 4EGVA 2VASA 2EGAA 3PTAA 2PO4A 2BOSA 3KDFB 3KLWA 2MMPA 1JJCB 2RF0A 2MOXA 4BE2A 5I6WA 2HL5C 4AG1C 3S3MA 4OGCA 2GNCA 1KAWA 2MGSA 4IZ8A 3S1NB 2LJ1A 4HTHA 3Q0AA 3OTOQ 3X26B 5C0MA 2K28A 3VR6A 2B2VA 2V8KA 1ZSZB 1ZKOA 3M56A 1I1JA 4G7OC 2ZPIB 2N78A 4KHVA 1Q86C 1QLYA 1DXMA 1XNRL 1P92A 3V05A 1C0AA 2C06A 1BBUA 4DV1L 1FJGL 2Z4IA 4C0FA 2UXCL 1SNOA 2G5DA 4KT0E 2M02A 2I46A 1M9SA 4OWXB 3I90A 1KABA 3S2DH 4JBJA 3MA2B 1YFNA 3FJ5A 4J9HA 4M7AB 1MSGA 1O7ZA 3I4MG 2KR3A 2DRMA 4C8QF 4LUEA 4XXEA 1GXIE 4M78B 3GBQA 2GA4B 3QYHB 2EYJA 1LT6D 3NPPA 5AJ3Q 4C8QE 1G291 4TSSA 4X3TA 2LS01 3VYHB 5I2XA 5GMKe 2MCNA 3UDGA 2KT1A 3OIPA 2WINB 1XMQL 1L1OC 2A6ED 2YU9H 3SEBA 2VGMA 3FJPA 3FKIG 1S5ED 2B86A 1B2TA 2L89A 1VMPA 3R6NA 2V4DA 3HP3A 1FYCA 3AYHB 4DV4L 4MTNA 3M4YA 4EMKA 2F0VA 1EWHA 1QZHA 3QHSA 3M0PA 5KYXA 5LL6X 4NXMQ 1EY7A 1ESRA 2P4TA 3CBPA 1RD9D 3GQBA 1VQPQ 1WPYA 5HURA 3HOUH 3IL8A 2EY2A 1WD1A 2DIQA 1UJ0A 1ZA2B 5FRNA 3P20A 4NPSA 4XQQA 3OYFA 1W4SA 2KEEA 1RKNA 5IHKA 1HZAA 1NE3A 2N88A 4A3KB 2FEIA 1M90C 1A3VA 2R3ZA 1X54A 4Y52H 1ZUYA 2BE7D 3LGLA 2AWOA 4GBQA 4XU1A 3L9AX 3U50C 3S2HB 5DEHA 2V8JA 2NVTH 1DD2A 3G7ZA 1JICA 1X2KA 2UUBQ 3S1RH 4LAAA 3HS0C 2M9UA 3HKSA 2C0OA 2B2YA 4GNXA 1FMWA 4PG3A 1XNRQ 2OTLT 4A53A 5ELBA 3TS2A 1WCMB 4LUOA 4A3IH 1HR0L 1FJGQ 4DV1Q 2UXCQ 5JJKA 2I5HA 1VOMA 2M0OA 2BA0A 3A5UA 1LT4D 3I5RA 2DILA 4Z89A 5CV5A 2LCLA 3OPOA 1VQLA 3QOLA 1AEXA 2BDNA 1FMVA 4BUGA 1BR9A 3QIAA 1GXDC 4N8FA 3GTJH 2KYBA 3H8ZA 2PVOB 3BZKA 4DV2Q 5FU7C 2EPBA 1G51A 1N9WA 2KE9A 2NVQH 3J80i 3S9WA 3QDFA 3PNWC 5GAN8 1MKHA 2MUYA 3HZXA 4KD3A 4FU6A 3BVGA 4DFAA 5G3LF 2SNSA 1LTID 3S3OA 2PI2A 3IKJA 5IGBA 1XMQQ 1Z9QA 4HEDA 4A3DB 2MPXC 1LNXA 5GAN3 3LWUA 3S16H 2JS0A 4C92F 3D3RA 4DV4Q 2DXUA 3OS1A 1F9QA 1L2FA 1F2MA 5I21A 1W6KA 1EY0A 2XVSA 5EKIA 3I55Q 3VR5A 1R9TH 1OPLA 4C92E 4XU2A 3OYKA 3V7SA 4M77C 2OQ0A 4DUYL 2ZPHB 5I2MA 2RHIA 4GOPA 3B6YA 4DUZL 2RQUA 3P8HA 3KJPA 3CCET 1G8XA 2KSSA 3A54A 5LJ3j 1WXTA 2RN8A 2M2LA 2RF4A 3P8DA 2X69A 2JJQA 5LJ5f 3TRZA 1JBMA 2P0PA 4IQZA 2RQRA 3JAME 1Y57A 1YITQ 2A68D 1BCMA 1UB4A 2A6HC 3ZBDA 1ET6A 3A55A 3QG1A 5EKKA 2DXBA 1LPLA 5CKBA 5GAN7 3H91A 4ZYSA 2X4WA 2CHBD 2XMFA 1GUGA 3M85A 4K5XA 1JB7A 4KHPL 4PJOA 5FU6B 4M7DC 3G71T 5LJ5g 4NMZA 2HDMA 2F0DA 1OOTA 1HR0Q 5GAGC 3C46A 1CQFA 2IVWA 2QDYB 4X34A 5LJ3h 4LF6L 2YWWA 1E2VA 1JQYD 1O78A 1QUQA 1WTPA 2LJ0A 1IYVA 2QQRA 4A4HA 2KA7A 4FNFA 1OEBA 5CV8A 3N6RA 1BIBA 2DM1A 2HZYA 5D7UA 5CC4A 2B8GA 2R6GA 5C0XH 1P16A 1AWOA 1GO3E 3OYIA 3CCVQ 2DETA 1K76A 3OYJA 1UWVA 2JE6I 4CDDC 2QDLA 5GANd 2KRNA 3M53A 4ZK9B 3CMAT 1D5MC 1DJ7B 2YSQA 3D0FA 2DY7A 2EYYA 5I9PA 2OI3A 5AFWA 4JG2A 5KYIA 2DBKA 4PJOG 4UHVA 4A4GA 4GLXA 2PW7A 3NHHA 1D5XC 2CW0D 3K80C 2EQIA 2J7IA 5A2QL 2JA6B 1RI0A 1NYGA 3OB9A 4RA8A 3OIQA 3LX7A 3CCQQ 2JTEA 1WFQA 3UDIA 1QVFA 2I5LX 4ZN3A 3F2BA 2E64A 1F9PA 2AQ2B 5IYDH 2DNUA 4ZLTF 1ABOA 2J4XA 4JOIC 4DUYQ 2ICIA 4RMFA 4FDBA 1V1CA 1WLPB 4DUZQ 1T0HA 3UDFA 4PFOA 2EVRA 4M77D 3LH5A 3D4WA 1VQLQ 5C0XG 2JA8B 3CC4T 3Q22A 3HRTA 4DK1A 3S17B 4N0AA 4L59A 1I5OB 4LF7Q 2K5HA 4QUCA 1R8OB 5E4XA 1CA6A 2DTOA 3CP0A 3SK8A 1LVKA 2O4XA 5M5WB 2RA2A 4KHPQ 3M4PA 3OY9A 4CC3A 1O7YA 1D5ZC 3RR5A 1E1OA 1HZ9A 4DNIA 2UXBL 3EBEA 3KLRA 2UUAL 2MK5A 3M4GA 1WHJA 3JCMP 9ATCB 4V190 1YHQQ 1RLPC 3CC2Q 5IYDG 1LT3D 4A3BH 2TSSA 4IIMA 2FZCB 1SRLA 4BY7B 3RKWA 2DERA 3KF8A 1EIFA 4BI4A 3PGZA 2YT6A 4J7IA 3NXWA 1WTQA 2BIVA 2FRWA 4X65L 2E5KA 2KI7A 5GAN6 1G5VA 1O75A 4OMQA 4N4HA 4J1MA 4KJNA 3T9NA 1MMGA 2LKVA 3HG9A 1QMCA 3T53B 3S1QB 1YVCA 2KBNA 1E7OA 3TEEA 2F0NA 5M5YH 1IBKL 2GN5A 5C3XA 4MHEA 3ERSX 4PNYA 4LF9L 3NTIA 2JA9A 5KYWB 1VQMT 4C5HA 4U673 3CCJQ 1B34B 4JI2L 2JTFA 4X6AH 4JV5L 4A3BG 2AHJB 4J83A 2ROLA 1K73R 1K73U 4AFZC 2NYZD 4RGTA 3ULPA 4KBMB 2NTTA 4LF5L 2KCTA 3MEFA 1EWIA 2KHIA 2R7ZH 1IXRA 1N27A 1H9MA 4I65A 4O6JA 2L4NA 4RHRA 1PD0A 3LWIA 4DR2L 2MWPA 1QVFS 1SNDA 3STBD 3HOWB 3GNFB 1NR2A 1VA7A 3HFNA 4NOYA 1X3QA 1MUZA 2IG0A 1TU2B 4GLAC 2UXDL 2HCKA 4PFZA 3X28B 2UXBQ 2DUDA 2EYFA 3WOEA 2RHUA 2IJ0A 4PV1C 1N6AA 2ZJRA 1PWTA 3CPWA 4P75A 2UUAQ 3TP7A 1QOHA 3H6ZA 4IUQA 2CP3A 4JI8L 4BA2I 1YJWT 2GVAA 1T5EA 1UGSB 2JW4A 4B3ML 3KXTA 5KNDA 4M75A 3LWHA 2I5MX 4DBHA 2AZSA 5LJ5e 2EJMA 4IALA 2DPPB 2K3BA 4DNRB 4HCKA 2Q8RE 5CV9A 3PMTA 1CZGA 1N32L 3MEUA 3I4MB 3SB2A 4X65Q 1QILA 5CIUA 2VKNA 3BDUA 1TWGB 3HEJA 1V1QA 1PYSB 1Q95G 1IBKQ 3CCMQ 2OJ2A 3K5NA 1UHFA 1F9SA 3E2UA 1AE2A 3J7AV 4GS3A 2YDLA 2LC4A 2EBPA 4LF9Q 3FKIB 1Y8PB 3NSWA 5HCKA 2QTXA 4LF4Q 1OU9A 4OHJA 2PTKA 4DBRA 4JI2Q 1QG7A 3I91A 2KENA 4LD9K 3T16A 4JV5Q 2I07B 4PZ8A 3OYDA 3K5OA 4B08A 4LF5Q 3C2PA 2OTLA 4R4TA 4R4CA 2FPFA 2Z0WA 3SHLA 1WI7A 2LX7A 3I4NH 5FO8B 1I81A 2K33A 1XNQL 4IO9A 1A3TA 4E7IA 3U58A 2L12A 4DR2Q 3S2DB 2EWNA 2IW3A 2EY6A 3WOFA 2R57A 4TRDA 1WHHA 4FXKC 1MI2A 1BQQT 3KYHC 1YCSB 4JVZA 2D0NA 5GANf 4UAIA 5F2DA 2CS7A 3G6EQ 2UXDQ 4OWTB 3QUIA 2D9TA 5CKDA 1EQQA 1ASZA 3TQ7P 1NMFA 3JB9J 4LDVA 5GAMj 3F2UA 4L5RC 1YNZA 4EMKB 4JI8Q 1YBYA 3QB3A 2Q2HA 1QVCA 1W2BA 1PZJD 1PFBA 4F7UG 3EHRA 2W0ZA 3EFOB 4RTTA 1K3BC 2L9HA 1T3SA 2E10A 3JB9H 2KVMA 2OAUA 1YNXA 2ZZDA 4A3CG 1PH3A 4XU3A 4DPGA 5HY6A 3PUYA 3CPWS 3KJOA 1N32Q 3OYHA 3I4NG 1R4QB 1YHBA 3HOUB 2XRSD 1X3GA 5CKHA 2CFMA 5GAMh 1U3OA 2M51A 2AUKA 3S14H 4B3RQ 1AWJA 3CCEA 2GQVA 2PW5A 3QO3A 5CR2A 1W70A 1ZSZA 2DK3A 1QVGP 1Q1EA 4GNXB 1RIPA 3TP5A 2UUCL 1Y7XA 3BW1A 1IBML 4J9BA 1SJED 2NVTB 4ELZC 2HIVA 3Q6SA 5HK3A 3X20B 1IL8A 4POFA 2EQUA 1GKHA 4AT1B 3JRZA 3D4DA 4EX5A 1TG0A 1AWWA 2D0OA 5CV6A 1RDPD 1ZX6A 2JTMA 1EZ8A 4ZAIA 1FR3A 1XNQQ 2RJDA 3SD4A 3JB9G 4C8QC 3RERA 2FPEA 3BVMA 3BYTB 2Q8TA 2EJFC 2KHSA 2HSEB 2M00A 3GTJB 3PO2B 3DLLA 2GQIA 2JQOA 3MKDA 4FP5D 4XQJA 2NVQB 3TCJA 3DWAA 4LDWA 2DFUA 1EEID 2JJ9A 1KIXA 1GCQA 5CV4A 3RN2A 4A3LG 1PRLC 4N4GA 4E7JA 4DOVA 3CCRQ 2WIIB 1BBXC 1BCPB 2HT1A 3M0TA 3K81C 2KROA 2XRQD 4EQPA 3GF5A 3S16B 1VQ9Q 2HKQB 1IHWA 4O0AA 4CJ2C 1G3SA 4R8NA 2L0CA 2LVMA 1BDOA 1IYUA 4BE0A 4DNTB 5IYCH 3PF4A 4OONA 3T56B 4JI0L 4OXPA 3CCLQ 4AH6A 2HD0A 1SYBA 2RD1A 4OELB 2HQEA 2VGNA 4RKLA 2EQJA 3C1EA 1W2BS 3BFMA 4P71A 3CD6Q 4M7DF 1M27C 1LO5D 2YTYA 4B9WA 4LMQD 3CC4A 3LH0A 4PJOB 2B3GA 1UG1A 3E9FA 3OMGA 4MIUA 1RODA 4QJFA 4M7DE 5FO7B 1YJ9Q 1DZ1A 2X3WD 2XSCA 1OZ2A 2E6ZA 1PRTF 3GTPH 1HXYD 1PTOF 4B3TL 1QUQB 2JA5H 1DYQA 2NWMA 1WYDA 3EQLC 2VXFA 1A2TA 4PJMA 2JZ2A 1ESFA 4DR3L 1W1FA 3ASKA 3JCMW 2K01A 2Q2UA 4ANJA 3MEWA 1HH2P 4OGEA 5I2YA 1YP5A 1OXUA 4BY1H 4A3DH 1MD2D 2DZ9A 4X9DA 2QEXQ 1VDZA 2QDBA 4AYBB 5IYCG 4XTWA 2BTTA 3H0GG 1NCVA 4C8QD 2RNAA 1STYA 1JB3A 2KEAA 3DM3A 3M4QA 3MHBA 3QXEB 2FMCA 3R2IA 2KMTA 2XIDA 3CCVT 1FVIA 1J5EL 1SSHA 2NZOA 4K6DA 5FOBB 4C92C 2K5NA 5KYLA 1QNUA 1O7IA 5ELEA 3LGJA 1UFFA 4KUIA 4OIJA 1I6HB 2E1HA 2BZYA 2JNGA 2E8GA 1XWEA 3NUCA 3EFSA 2JA5G 1AWXA 1U5SA 4RH6A 5IXBA 2BH8A 3A0JA 3ZJYC 4FVMA 3VKIA 1KQSP 1VQ8Q 3CCQT 5GANe 3G71Q 2XKOC 2MI6A 4JI0Q 1HJPA 4BY1G 1HRJA 4L6TB 4APVA 2DA9A 2JOYA 1VQ7Q 3AT1B 3KOJA 4BBSH 4LDXA 3T1YL 2O4XB 4QIWE 2VS1A 2BH2A 2O5IC 2CZ7B 3SDZA 2AIRB 3J7YW 2CZ6B 4OO1H 1A63A 1F77A 5A0LA 2CREA 2ZPBB 1LYLA 2KRMA 5D6WA 4PQXA 1SKUB 1BBWA 1ZUKA 3CMAQ 1JCKB 1PFMA 2QILA 4B3TQ 2HQHA 2DEUA 4IURA 2X3XD 1AZEA 2EAYA 5KCHA 5AYFA 4BE1A 3U23A 1JOQA 1GRIA 1EEFD 2K5VA 4IN3A 4LD6A 5T1GA 4DU9A 1MSHA 3TP8A 4UY8C 2LMCB 4A3BB 4GN5A 1KL9A 5KYUA 1YJWA 4C0ZA 2KGTA 3RLNA 2EXDA 3HRUA 1KIKA 4AFUC 1YHQT 2RJCA 3PCOB 4XAXB 2JA6H 1CKBA 2EIFA 4IOAA 2F0PA 3HOZH 1UJYA 4AFSC 1EWCA 4BBSG 3M3YB 5D14A 1XTDA 1JXMA 1YEZA 4H7BA 3H15A 5HK0A 2CQAA 3TSSA 5G3LD 2KAFA 4ZGEB 2RVLA 4OO1G 1Z6HA 1S72A 2NUTA 4LUZA 1A62A 3VS4A 1YZ6A 3PO3H 4O42A 5CBAE 2AT1B 4QCLA 5M5YB 1G2BA 4JS5A 4FYDA 3PUWA 2Y0SG 2JA8H 3RMSA 4C92D 5FLXE 4U68A 2LQNA 2XI9A 2E74C 4PZ6A 5EKLA 4MDWA 4RGNA 1Q12A 5EJWA 3S17H 4IJHA 3UE1A 3M4OH 1JRIA 8AT1B 3I72A 5HKCA 1ZXTA 1WX6A 1ENCA 1H92A 1B07A 1RADB 4C2MH 3CCJT 4KY5A 1PH7A 1C9OA 1X32A 3EGDA 5KEEA 3T1YQ 2J7ZA 2R7ZB 4DR1L 1AH9A 4PLLA 1QW1A 4HA8A 1O9SA 4K11A 1X56A 3JAMi 2RHXA 3HOZG 4FYVB 5EBCA 1TWFH 2XNAC 2KECA 2Z9HA 2MWOA 4XTUA 2D9UA 1H9RA 4DQ2A 1XX8A 2K32A 2FPDA 4ZGDB 1S5FD 4ODGA 2EPDA 2COYA 2K4YA 2K6AA 4H0LC 2R5AA 3ULLA 3PO3G 2LX9A 1PH8A 1AVZC 5BN4A 5IT9E 2Z6KA 1WHMA 2YHTA 1BI3A 1PKSA 3QR8A 2IT1A 5I6YA 4JZ3A 3GP8A 1OTCA 2YUOA 2SNMA 1WXUA 1PFSA 3AU7A 2B2VC 4X64L 4HJ9A 3NMZC 2O2OA 1VQMQ 4J9FA 1Q90A 2VYTA 3JSCA 1X6BA 3GTLH 3EROA 4KK7A 4DEYA 2F0IA 2DTHA 4E7KA 4OEMB 2M9VA 1IKLA 4BB7A 4M7AF 1PYWD 4IPHA 5ELFA 5KIXA 4XIGS 5KYWA 1I0CA 1VQPA 2KCCA 2HBWA 3T4AC 4GKJL 3REAB 2QA4T 1B34A 4M7AE 2FXQA 4M78F 3ZYYX 4H02A 4YY3L 4K8IA 4C0DC 3R8BA 5K36H 1KG1A 3K57A 3T51B 1I4RA 5IODA 3CCMT 4M78E 1HA5A 1UGRB 4KY6A 4J5YA 1SROA 1T9HA 2HEQA 4ORZA 2K03A 4BD3A 1D1BA 3LLRA 3URGA 4OL7A 4LJZC 4OF1A 3V8JA 2LQWA 3H41A 3L2QA 1DM0B 1YJWQ 1BUVT 4H44C 4DR1Q 2YLBA 3I4NB 1JU5C 2WSFE 3OW2A 3JAML 3L2ZA 4XU0A 2WB1E 5J26A 1Q8IA 1EOTA 2B2TA 3QOJA 2PUKB 1NLOC 2ZCFB 3E0EA 3NWSA 1TT2A 1U1TA 4B9XA 2B29A 5ELNA 1BVSA 4RGOS 3E3XA 1YCYA 1UNSA 1I4HA 4XTCS 1MV3A 2CSQA 4A54A 4BA1I 1N36L 1II3A 3NENA 1N9RA 1MHNA 1UHCA 3G6ET 2CWAA 4IOCA 1EYGA 3VUZA 1KNAA 4D8DA 1G2SA 5KH6A 4LFCL 3K5LA 2F0HA 2WKDA 3HL8A 3M57A 1KJWA 1OZ3A 1FNUA 2BKDN 1WHKA 2HAXA 3L2WA 3NE5B 4BBRG 2LCSA 2A28A 1L0YB 3L0OA 2IX1A 5C5MA 3C4SA 1OXXK 4DKAC 1A6XA 3FKIH 3CXCA 3EVQA 2GTOA 1UGQB 3NK9A 3MEVA 1VQFA 1I07A 2F0EA 2MO1A 3I55A 3MZ5A 3PIPA 2L11A 3S14B 3PVLA 1PCXA 2WSCE 2PNRC 5C4HA 2PZ1A 5JOBA 3G48A 4GKJQ 1I4GA 2YV5A 5T1IA 4J7FA 1Z9FA 4YY3Q 2XWBB 1CUKA 3TREA 2A69D 1V9PA 2NUPA 3A1PA 1SMXA 2E2JH 2B63H 4Z02A 4NS5A 3ZEHA 3EAEA 4CJ0B 1S5CD 1NTGA 4R56A 4MZTA 1YITA 3BZDB 3TDQA 1B70B 2RH2A 4F88A 4KULA 4F7XA 2KRSA 4ZGJB 1A15A 1GD7A 2HQXA 4UP8A 1FGUA 5GAMd 1MV0B 4IKFA 1WHLA 1TY0A 2C0IA 3ERQA 1BCPC 1A2UA 3HTRA 7AT1B 4HN7A 4YIJA 1C1AA 1SE3A 3BG3A 1A3UA 3HOVG 2RQXA 4JJCA 4JJBA 1H9KA 1MNDA 1WQ7A 2LNVA 4GOPC 3RBBB 3BVZA 1N36Q 4A4EA 1ICFB 4F16A 1YNND 2DF6A 4JK1C 1GUTA 3JCMh 3CCVA 5J1ZA 2PCFB 1IW7D 3EFOA 3PIP3 1S40A 4LFCQ 4JYAL 2L3PA 2YXYA 3C94A 4X3KA 3OW2S 2QF7A 2F2XA 4NKLA 3CAMA 2B63G 4A93G 3CCRT 3PUZA 4QKUA 1WQWA 3CEYA 2B2WA 5IGDA 4EQNA 4PJNA 2RJFA 5D6XA 1SYGA 5FLMH 4J6YA 1H3ZA 3GOXA 3LYIA 1STAA 2V1CC 2BDOA 2KT8A 3D31A 1VQ9T 4FXGC 1M4ZA 3VJPA 2OTJT 1D6EC 4CDCC 3CCQA 4A63B 2DXTA 2PZTA 1DJRD 2AK5A 3H0GB 2WV6D 3QDRB 2F2WA 2ALYB 1K8OA 1PZID 2KEDA 3W2DA 2K5FA 3JV3A 3V8KA 1VQOT 1Y14B 3O13A 4LNQA 1Y8NB 2MO0A 1BI1A 3A5ZB 3CCLT 1HTPA 5KNBA 1KRSA 3OS2A 3W1GA 3JCMX 4QF4A 4DXFA 1C4QA 2M16A 1LUZA 1VQGA 3MTSA 3CD6T 1WGSA 5DY9A 3CXCS 3GTPB 2JA5B 2FHDA 4HVWA 4XYQA 1BYMA 5IGFA 2RHYA 1YJ9T 5CYUA 1SYEA 4ESRA 1Q8KA 2LSSA 5ELCA 3GTKH 2VC8A 4PL6A 1XYIA 5TSSA 3BE3A 3E9IA 5FLMG 1MGSA 3HRZC 1FYNA 4G57A 2O01E 4BY1B 4BY6B 5E7NA 4KUDK 3V7RA 1KTKA 1Y1VG 2CYZB 2EFIA 1YWOA 4JZ4A 1YHQA 2KQWA 3KUFA 3CC2A 1DOKA 2DBMA 4F04B 3I3CA 1D2BA 2QEXT 3SWNC 1X43A 5GAOq 2RB6A 1GUNA 3IRBA 4HCSA 3OYLA 1L0WA 1B50A 5A0GA 2Y90A 1KAAA 2NVXH 5CKFA 4JYAQ 1BIAA 4MZMA 1KC8C 3VS5A 1I6VC 1ABQA 2F0QA 4C0GA 3NQTA 4JW0A 3RZOH 1HUNA 1CSKA 2EW3A 1V1PA 5D3IB 1XQHA 4RAUC 1VQ5Q 2E3IA 1QVFP 3I8ZA 2AWNA 1WXBA 1Y1WH 3IAYA 2LFNA 2LDMA 4CKEA 1JEGA 3S1MH 1I5FA 1SFOH 1GHJA 1Z9ZA 3MJXA 1NJIR 1NJIU 4FW1A 3L3OC 1VQ8T 2F0WA 4FYWB 1NMGA 4KI0A 1V29B 4FW2A 3HOYG 2QG9B 1HYOA 3CCJA 5C0XJ 4RG8A 4BBSB 1PV4A 2KYMA 2DL8A 3BDLA 5EBDA 1BNZA 2IX3A 2VNUD 1CSQA 1WYXA 4LDUA 1VQ7T 3WDNA 4CC7A 1PRTC 5LJ3e 2KUMA 1PTOC 1NPRA 3E9GA 4RFBA 2IY5B 1TR5A 4R55A 3RLFA 1EY9A 1HNZL 2Y0SB 4J6HA 1UDLA 2E3HA 4PJJA 1HFNA 3KBGA 1EY5A 4HVUA 5KYUB 5FRMA 3GO5A 3KLSX 5CQYA 1N9SA 1VF5C 1K83H 1M8MA 3KF6B 4DV3L 1PG5B 1AOJA 4HXJA 1K8AR 3OYAA 1K8AU 5GAEC 1Y1WG 1EOVA 3K5MA 4A3JB 5IY0A 1QP3A 2QAZA 2X4XA 1I6HH 1NEGA 2XICA 2F0FA 2DXCA 1CQVA 3BYYB 3MEAA 2CH4A 2NUTB 2IX0A 2V1QA 2N3SA 2NVYH 3HOZB 4IFDH 1IKMA 2AKWB 4KKUA 3CQZH 3ND8A 1BU1A 2VB6A 4BACA 3FVQA 2RQVA 1BCOA 1SNMA 2VB3X 4DF7A 4NL3A 3PO3B 4L6V5 2CQOA 5M9OA 1EY6A 5GAN2 4HIMA 4CRIA 2WAQB 3G4SQ 3I73A 3BU2A 2J05A 2TMPA 2P4RA 4X66L 3M7NA 3M4OB 1KQ2A 4CDEC 2O2LD 3TMEA 3EGDB 3CCMA 4FF4A 4QVDA 1QVPA 2I2LA 3ZFJA 2L3QA 3VDYA 4CKCA 1QCFA 2RPNA 2NZ1D 5C44G 4C2MB 1UGPB 2A6HD 2YUQA 1RF2D 3RDVA 4XQ3A 2Z4HA 3E9HA 2BE9B 4L5QA 5GAMf 4ZRZA 4M75C 4CGYB 2KJXA 4LF6Q 3J81E 5CQXA 2XDDA 1NNXA 4M7DD 2F0MA 2NWGA 3I4OA 1N33L 4IFDG 1AE3A 1TWFB 4XT3B 3RNUA 2E2IH 2D6FA 1M3AA 4M77A 2SDFA 3RUXA 1E3PA 3DLMA 4Y7NH 1HNZQ 1PRTD 1PTOD 2B2UA 2JMCA 2F3WA 4R4IA 1KHCA 3CPWP 4AG2C 1VQ6T 2FL7A 1GL5A 3NBHA 3PSIA 3M3YH 1YWPA 2J6KA 3FDRA 1IGQA 3G6EA 4TVRA 1CT1D 2K50A 3JAMc 3KBXA 1G2TA 2COWA 1KLUD 2RKSA 4DV3Q 4ZTFA 2K5IA 4C5EA 4JI4L 4DR4L 2PZUA 4JI6L 5C5LA 3H6MA 1LTBD 1SYFA 3EFXD 4IPCA 2ICEC 2RK2A 2QGFB 2ZTCA 2J06A 3GTLB 4PMCA 2YRVA 4M77G 1Y0MA 2ZTDA 1PHTA 3PE0A 1F2YA 1VIEA 2OF1A 3IFTA 4HSVA 4RWSC 3AMUA 4DR5L 4P73A 3GNGA 1WTVA 2BE5C 3Q24A 5JEAH 1SPKA 3E19A 1JOOA 3H0HA 2XHCA 1U8RA 2EYLA 3OW7A 2DN8A 4D8KA 2EYPA 1HHVA 3X3NA 4CKBA 3CKIB 5M3FG 1MNEA 3HPWA 1X65A 4JC0A 1DGSA 4X66Q 2JA7G 2ZT9C 4DV5L 5I22A 2RM4A 4RG2A 4BBRB 1TTHB 4FIBA 4M7DG 2MPMA 2EGEA 1K8MA 4R0KA 1PH2A 3PUVA 2SRCA 1EYCA 2HHHL 2R93H 2EQMA 1M1GA 3LGFA 2HNIA 4O2DA 5HGQA 3OBWA 4LE9A 1C8CA 3CPFA 3I56T 1CI3M 3K6OA 3OYMA 2BZXA 1CHPD 4QB4A 2JUFA 3DEPA 1JJGA 4JOIA 4FSSA 3MEHA 4PFPA 3WXMB 4J15A 3CCUQ 2BZ8A 4OB1B 1RHPA 2ZXOA 3FPUB 5JEAG 1JORA 3NTKA 1EX4A 4JRQA 2P5ZX 1GJXA 1Q3LA 1ZSZC 4ME7A 3GIBA 1LV9A 1NBWA 1TUCA 1JO8A 4QQDA 1SXTA 4DK3C 2KDSA 2QA4Q 1IHZA 2F0LA 2MIOA 1DCZA 3F70A 4JI6Q 1JT8A 5GAOm 2F0SA 1W2BP 1SDFA 4ZKCB 1E1TA 1AEYA 2Y4XA 3CCRA 1E2WA 1X75C 1QE6A 3C0CA 3NBIA 4L5TA 5CGKA 2NN6I 1D0YA 4OIKA 2R93G 1K28A 4M7AC 3HFOA 1VQ9A 1OXTA 2ZXPA 2OTJA 2VUMH 2LT1A 2E2HH 5ISRA 2WFWA 1PHJA 1STHA 4M78C 4C3IG 3EG0A 5A0DA 2NUPB 4JJNK 4N8X1 4NB3A 4JI1L 1PZKD 2O5JC 1VQOA 2EQSA 3PIOA 4P74A 1X69A 3RNJA 2BE5D 3CCLA 4RKUE 4F7UA 1Y96B 3K8AA 4OMNA 2PI2E 1EZ6A 4FYYB 2JM9A 1CM9A 2ENBA 5EAYA 3T1HL 2E2JB 1WNLA 2B63B 4A93B 4OMMA 5GROA 4DV5Q 3CD6A 4IIOA 2QTVA 5KYNA 2Q2TA 3JCMb 3EFRA 1BCPF 5LHY1 2UU9L 3ND9A 4OMLA 1STBA 1Y07A 1YJ9A 4R1JA 2CKZB 2HHHQ 3KK7A 4KKSA 1IHVA 1F2LA 1UEBA 1X01A 3VYTA 3MP8A 1PNJA 5GANg 3A8GB 3QSUA 2A1AA 3J80E 2DY8A 3U4VA 5C4XG 2FHTA 5C6SA 1ASYA 4B3MQ 1TUDA 3A98A 5KE3A 2A0FB 2VUMG 2E70A 1AD5A 1NJIC 4CDFC 4QUFA 3L42A 4TKOB 4JI3L 4PMWA 2CGHA 2K7AA 1PH6A 3L2VA 3CF5A 1PH1A 4FT4A 3L2RA 3WWVA 2V26A 1BI2A 2QEXA 1VQNQ 3AQQA 4GN4B 4HAEA 5LMNW 1VQJA 1HK9A 4E2FB 3H3VH 4PJOF 3MO8A 5C6AA 4A4KA 2D62A 4A76A 3M0RA 1SSOA 1EL0A 1GUSA 5GAMe 2EYZA 1Q7YR 4PJOE 1Q7YU 2E5QA 1HPCA 4FCYA 3SHWA 1NUCA 1WA7A 2FFKB 1YNJC 3PIO3 3A8MB 1I5LA 2E75C 3F8TA 1EFNA 1Q1BA 2QYZA 4A3LH 1K0XA 4LFBL 2A36A 3M7GA 3PFSA 2OAWA 3CQTA 1TWHB 1VYTA 1XXGA 2DJFC 1K8AC 1R0BG 1Q81R 4M1UB 1Q81U 1B9NA 1FNVA 3RMHA 3U9SA 5IIFA 1KXLA 2GVBA 1VQ8A 2RK1A 3P7JA 4M7AD 4WCIA 3G71A 4JI1Q 1ZYRC 2G6FX 1JQQA 3DMUA 5FLXL 4OMOA 4HCEA 5KE2A 2YRDA 2PVDB 4ID6A 5DNFA 4AYBE 4RTUA 4M78D 1E2ZA 4IUTA 3OYGA 1SBBB 1VQ7A 3JCMQ 3DXJC 3Q23A 1G91A 3T1HQ 1UUEA 4QQ6A 4J9IA 3D6CA 1UE7A 3EG9A 4DBFA 5CMDA 3R6OA 1O7LA 4F8MA 2ES2A 5C3EH 2UU9Q 3EHQA 3GTKB 3HKZE 4DV6L 1WZOA 4D6WA 3CMAA 3QO2A 5FWBA 5CCAA 4JS4A 2JP1A 1YHAA 2W10A 3TQYA 3NGPA 3META 1J6QA 2F0GA 2FVUA 1VQIA 4IUUA 2XWJB 1ILPA 1TSFA 2ZM6L 2O9SA 3E6ZX 3F2CA 3RR6A 4NXNL 2GFUA 2OTJQ 2E2DC 1GFDA 2QW7A 1RABB 1TVXA 5EG2A 3VR4A 1L0XB 1V1PB 3ULJA 3CMEQ 5IT9L 2CP7A 1VQOQ 3CBOA 4JPBW 3FP9A 4ILWA 1KNEA 3H0GH 2NVXB 3HOXH 1TU0B 1FD7D 5FU6C 3RZOB 5C4JH 3HP9A 1TWCH 2A19A 2F4VL 2LTOA 4EIKA 2VW9A 2MFIA 1B3AA 2O9VA 4KY7A 5C3EG 4C5GA 1L1OB 4DA2A 3RZDH 2UUCQ 1WTRA 4K6LA 1YI2Q 4FL6A 5ECAA 4LFBQ 1Y1WB 1IBMQ 1STNA 4QW2A 1VQ5T 1YNJD 3RMQA 4I7AA 3S1MB 3PT9A 3P8BB 1SFOB 1AP0A 2K05A 2ZJPA 1LCKA 3OSSC 2E41A 3OYEA 2LXJA 1UTIA 3ME9A 4KH0B 2PQWA 1EU3A 3KFVA 3QKJA 2KXDA 5L8RE 3UI2A 1PA6A 1K0RA 2XIWA 4QVCA 2DYBA 1SNQA 2IIMA 3H94A 1B8AA 1BF4A 4ZTJA 1CK1A 1TXQA 1WTXA 1ZBXA 1HNXL 2E65A 4ZNXA 2HMAA 1D09B 1R0CB 3OA6A 1E22A 1I3QB 2WB1G 4RTVA 2YRCA 2EVBA 2RCFA 1KLGD 4HSPA 3HOXG 1K73C 2K75A 1PH9A 1RAFB 4NP5A 4A3MG 2A3LA 1BOSA 2JEAI 3KFUA 4XK8E 4DV6Q 1K83B 1U5KA 3S3NA 2K2MA 3EH1A 3ER0A 1PMRA 2HKNA 2Z1CA 4P2CB 5C44B 1SAPA 3TSWA 2GCXA 2DL3A 5GQOA 1TS5A 2EYQA 1I4XA 4HIOA 2CZ0B 1UEAB 1SYCA 2ZM6Q 4ZKBB 4KN7C 2K5QA 5LJ3d 3BJUA 4MN3A 4NXNQ 3CBMA 4N4IA 3OHXC 2NVYB 4Q0FA 4ZUIA 2LMJA 1H3HA 4JRKA 4XDXA 3CQZB 4JLIA 1HCZA 1SE8A 2EJGC 1VQMA 1JWSD 1NEBA 5FU7B 1EFID 3ICEA 4C8QA 1WJJA 3SGIA 3V7CA 2A8VA 1WCMG 2EJFA 4RTYA 3CCSQ 2K1BA 2ESWA 2FYKA 2WSEE 4LNPA 2YTVA 5AT1B 1EUJA 2EGCA 3FIFA 4M75F 3G4ST 2JYOA 4RCCA 5GAN4 2LXKA 2FG0A 2PMZB 3BS1A 1IYJB 4RGMA 4X3SA 4LUVA 2Z6KC 4M75E 1B7TA 1YIJQ 4HCCA 4F87A 1RAIB 3D8GA 3MXPA 4M77B 3FMCA 1X55A 4AIMA 2QGQA 4DR3Q 1A0IA 3SEMA 2F0JA 4C8QG 1GCPA 5CBEE 3Q8DA 2IHEA 4LWCA 1NE8A 1TQOA 2E2IB 2KQ3A 2LQKA 3NBHB 1EZZB 2DVJA 2DYIA 1QP2A 2HDAA 1IXDA 1D8LA 1U4LA 1HNXQ 4Y7NB 3FPPA 3KF6A 5M3FB 4E6RA 2XD0A 3TVTA 3DWQA 4OMFB 2JA7B 2QK0A 1RLQC 2L15A 4KD4A 2QCPX 3VA7A 1J5EQ 2PPBC 2MP1A 2VQEL 3A8OB 2DL4A 4C3JH 4M7DB 2JMAA 2QI2A 2QQSA 4J9DA 3K58A 4WF2A 3OBYA 4P5NA 1G3TA 2NB0A 1PLFA 1TWBA 3A7LA 2IHFA 1JOKA 2RQWA 2F1LA 3RESA 4XQNA 4POGA 2XGTA 1VQCA 2DNEA 1RUWA 4B3SL 4G4KA 1F9RA 3REBB 3E0JA 2KOLA 2FRYA 3CC7T 4YWKA 4ABNA 3RLOA 4EVOA 3OS5A 2B39A 1N8RR 1N8RU 1SF9A 2B2TC 1PH5A 4J9GA 3BY7A 3A7AB 3QWNA 1PKTA 4DR7L 4H13C 3UF4A 5C0XI 3QJYA 3MCAB 4XTXA 4A4FA 2JSOA 4R4OA 4Q5VA 4DV7L 1CFMA 2RDGA 3WVDB 4R9WA 3S15H 3QYGB 4LW1A 1CA5A 1VQ6Q 4C3JG 4C92A 1FWZA 2EDGA 4KV6A 1EIHA 3FEWX 2H4OA 1Q7YC 2DJZA 3EH2A 2K57A 4N9PA 4J6WA 2CP6A 2R93B 2K6DA 3JCMc 3A8LB 3MFYA 3JB9F 3OW2P 5E3FA 3VR3A 1R77A 1ZA1B 1SLJA 2R92H 3RKYA 3TSZA 2XDBA 3CHBD 4IPDA 5CVIA 4JCVE 2G9DA 4JI7L 3AFQA 1K9MR 1JJ2A 1K9MU 1PD1A 2MQHA 3HRSA 4WJWA 3OQ5A 1I4PA 3P75A 4QIWB 2DJQA 2XDPA 3GD7A 1ZUUA 2K5LA 4ZUJA 1J8IA 2EE1A 2KY9A 1IGUA 5IGEA 5ELOA 3CCUT 1MJEA 4C92G 2VQEQ 4F14A 1ARKA 5CK9A 4I7ZC 3GTMH 2ZGWA 2FMMA 3VR2A 3H0IA 2F4IA 4WORA 5IOCA 4FM4B 1KSWA 4XTZA 1SEBD 2K52A 3FHWA 5J3BA 4RCNA 1XPUA 1KK7A 1X6GA 4K5VA 3L7ZC 1M1KR 1Z7TA 1M1KU 4GY5A 1XJVA 5C4XB 4A3FH 1D1AA 3CXCP 5IHIA 5COYA 1LTLA 2QQBA 3NHNA 4B3SQ 2VUMB 2R92G 1ZBJA 2YUPA 1BB9A 1D1KA 4BBRH 2E2HB 4F7UB 1VIFA 1H8KA 2DL7A 4MMLA 2AUJD 5JPMC 1VQBA 3AEVA 4OB2B 2B8AA 1MMDA 3I56Q 2VL6A 2ZXRA 5I9OA 1KDAA 4DK0A 4GLVB 3FRNA 4DR7Q 4EMKC 3OMCA 2QKIC 4PZ7A 5GAOn 1VQ4T 2CZ1B 3I5SA 5GAHC 4DV7Q 3L2PA 2KVQG 2HQLA 5EPKA 1WFWA 1M8VA 5FROA 4K8JA 3TEHB 2NTSA 2G9HD 3OOCA 4KGVB 5FLXc 1MBYA 4PK4A 3FDTA 1FX7A 1NPPA 2B2WC 4FXDA 4RG1A 2QQ9A 1VQEA 3GPLA 1XPRA 3OS0A 2A6EC 1D1CA 2J0TD 1JC7A 4A3FG 2DEQA 5LJ3f 4HT9A 3PVQA 1LM0A 4QMGA 5C4ZA 4X64Q 4JBKA 3EJIA 4KRTA 1HQMC 2B2YC 4GNXC 2XN9C 2KK4A 5I11A 4DOWA 3G7LA 2F5KA 4PMBA 4L63B 3K7UC 3UT1A 5LJ3g 4L8JA 2E5LL 4X62L 5KYYB 1VCIA 1N5ZA 3VRZA 1VQNT 3HOVH 2E4HA 1SNPA 3INZA 2HD3A 1TS3A 3HOUG 1ENAA 1OO9B 3NQIA 3PO2H 5IP7G 2DNCA 1LJOA 4WJ3M 1QKWA 1PRMC 1PYBA 2WP8J 1JJ2S 2EQKA 5IT9c 1XMOL 3HOWG 2H3JA 1SMYC 2F1MA 1QCNA 2X51A 4UC4A 1VQ5A 1KDBA 4A93H 4OWWB 3EG3A 5HGTA 4KN4C 5GMKm 2LT4A 3UA7A 1PXUA 4GKKL 1Y96A 3M54A 3E1SA 1CKNB 5JPNC 5JJIA 1NM7A 3THKA 3R93A 3EG9B 1R4PB 2NZHA 2RBMA 2B8FA 2UUBL 1RAEB 4NW2A 2A5HA 1S4ZA 2RCNA 5GMKj 4ZCKA 3SK6A 2PNIA 5DLQE 5CR3A 4WTOB 1XOVA 1LTSD 2EJ9A 1ZLMA 1DONA 2VVKA 5GAOl 3A74A 5D65A 2VQFL 2JXBA 5C3EB 3EN2A 1YJNQ 1XNIA 1X3EA 1S3OA 3J7AF 1HD3A 1FXXA 3I7FA 4MNOA 4F17A 4DV2L 3CU7A 5D6YA 1CTMA 4R8IA 2LQ8A 2N55A 5M5XH 3J81L 5IAYA 4CC2A 3JCMe 3OWFA 1ZEQX 4JLGA 3I2ZA 4OVAA 4EPCA 2WKCA 2X4YA 5BN3A 5GMKh 2RI2A 3G1JA 2F0TA 2F5TX 2FZGB 5JVH3 3I70A 2CUBA 4OX9L 4HCZA 1SN8A 4PJOC 3GTGH 3STBC 1TXYA 1EY8A 4E47A 1TWHH 2WB1B 3TP6A 1VQKT 1Y1VH 2NBFA 4DAYB 2KCMA 1SJHD 3DB4A 4X62Q 2E5LQ 1ENFA 3HOXB 3CMET 4A3MB 5C4JB 1TWCB 2JN4A 3QZ5B 2HBPA 5FKAC 3MVVA 3RZDB 5IE8A 4CJ1B 4TVAB 5KGUA 4GLMA 4MZ9A 2Y0SE 1GUWA 1XMOQ 2PQEA 5DLOA 3I4LA 1QWYA 2A68C 3EGXB 1D3BA 3G4SA 1YI2T 2RMOA 3M9QA 2K7VA 2PUOB 3DWPA 3L2UA 3LW5E 1OYXA 4GKKQ 1SMYD 4YCWA 4ALPA 5L37A 1SG5A 4IUNA 1M8AA 4C3HH 5ELDA 1W6JA 1B3QA 1U1SA 4C56C 4UP9A 4FT2A 1UECA 1K8GA 4LF8L 4HT8A 2MNAA 1FNWA 2F2VA 1GFCA 4KKTA 2VXWA 3P1HA 3HOYH 3JB9I 3JCMV 1VF7A 2K3YA 2VQFQ 1HUMA
chains in the Genus database with same CATH topology
4Y92A 2EGEA 3ULRB 4R0KA 3NPFA 2SRCA 2CT3A 4X1VA 2SEMA 1M27C 4LE9A 2ED0A 2LNHB 1UG1A 2BZXA 2O88A 2X3WD 4FSSA 3ZL7C 2DE0X 1E6HA 2M0YA 2BZ8A 2NWMA 5FWCA 1VYUA 2RQTA 5GJVB 1W1FA 2ABLA 1TUCA 1JO8A 2MIOA 1YP5A 4RUGA 1AEYA 2BTTA 2RNAA 3C0CA 2KEAA 1SSHA 4Z8AA 3QWYA 1RI9A 3EG0A 1UFFA 2BZYA 1X69A 3RNJA 1UGVA 1AWXA 1U5SA 5IXBA 4OMNA 1NG2A 2JM9A 3VS0A 4J9CA 2LZ6B 4OMMA 2FO0A 1HJDA 4IIOA 4CC4B 1G83A 2DA9A 4OMLA 2EGAA 2RF0A 2MOXA 2K9GA 4AG1C 2GNCA 2KXCA 2LJ1A 1PNJA 1QWEA 2CREA 1TUDA 1GBQA 3A98A 2KRMA 1AD5A 4LN2A 1I1JA 1ZUKA 4LUDA 1QLYA 2K7AA 2X3XD 1AZEA 3U23A 1GRIA 2L0AA 1K1ZA 3M0RA 2EYZA 2KGTA 3FJ5A 4J9HA 3SHWA 1WA7A 2KR3A 2DRMA 5GJWB 4AFUC 1KIKA 1EFNA 1CKBA 4LUEA 3GBQA 1K0XA 1UJYA 2A36A 4AFSC 2OAWA 1JXMA 1X2QA 3CQTA 1VYTA 2MCNA 1CKAA 2KT1A 2B86A 3VS4A 4WCIA 3R6NA 2G6FX 1G2BA 1JQQA 3VS6A 1T0JA 4OMOA 4RTUA 2LQNA 3M0PA 1UUEA 2VWFA 4J9IA 1WX6A 1H92A 1B07A 1UJ0A 3EHQA 5IHKA 4JJDA 5FWBA 1IO6A 4K11A 2FEIA 2W10A 3NGPA 1ZUYA 2KNBB 1QWFA 4GBQA 1M3BA 2DX1A 5IH2A 5IHNA 2O9SA 1X2KA 2FPDA 2EPDA 2C0OA 1GFDA 2AZVA 1AVZC 5FW9A 3I5RA 3M0QA 4JPBW 2DILA 4Z89A 1PKSA 1E6GA 2ENMA 4JZ3A 2YUOA 1WXUA 4EIKA 2O9VA 2KYBA 3NMZC 2O2OA 4J9FA 1X6BA 2KE9A 5ECAA 4DEYA 2CSIA 1LCKA 1UTIA 1Z9QA 3KFVA 1M3CA 2KXDA 1I0CA 2HBWA 2JS0A 3REAB 2AKKA 2DYBA 1HSQA 2IIMA 2KBTA 1OPLA 2HSPA 1A0NB 4ZNXA 2HEQA 4ORZA 4RTVA 2D1XA 3VRYA 2RQUA 2LQWA 3H41A 1K9AA 1UE9A 1WXTA 2RN8A 4Z88A 4J9EA 2K2MA 1SRMA 1JU5C 3TSWA 2RQRA 3EGUA 1Y57A 2DL3A 4RTXA 1NLOC 2YUNA 2XMFA 1MV3A 2CSQA 2LMJA 1H3HA 1OOTA 1NLPC 1UHCA 1NEBA 1GCQC 4D8DA 2LJ0A 1OEBA 4RTYA 1KJWA 2DM1A 1OPKA 2A28A 2ESWA 2LCSA 1AWOA 1K0SA 2A08A 1K76A 4LNPA 2QDLA 2KRNA 2EGCA 2AKLA 2YSQA 2FG0A 2GTOA 2EYYA 2OI3A 1I07A 2DBKA 3PVLA 2I0NA 2ECZA 2PZ1A 2H8HA 2EQIA 2J7IA 1SHFA 3SEMA 1NYGA 1GCPA 2JTEA 4RTWA 3VS2A 2DVJA 2DNUA 2HDAA 1ABOA 2CH4W 1V1CA 1WLPB 4E6RA 1T0HA 2EVRA 3TVTA 2J6FA 3LH5A 1RLQC 2KRSA 2DL4A 4M4ZA 2JMAA 1MV0B 4J9DA 2C0IA 1S1NA 2GTJA 1U06A 4JJCA 4JJBA 2LP5A 2RQWA 4CC3A 3RBBB 1SHGA 3VS1A 2CUDA 4F16A 2DF6A 1RUWA 3REBB 2FRYA 2L3PA 1RLPC 1VYVA 2F2XA 2CDTA 4QT7A 4IIMA 4J9GA 1SRLA 1PKTA 3UF4A 2YT6A 2KT8A 2FRWA 2LJ3A 4A63B 2GGRA 2E5KA 2AK5A 3I9QA 5L23A 1W6XA 2F2WA 4OMQA 3JV3A 1E7OA 2K6DA 1ZSGA 1YN8A 3TSZA 2JT4A 3EG2A 4HVWA 3M0UA 2ROLA 4AFZC 2DJQA 1ZUUA 4ESRA 3UATA 4F14A 1ARKA 1T3LA 2EYXA 1FYNA 3H0IA 1FMKA 1KSWA 1X6GA 1VA7A 1MUZA 1YWOA 4JZ4A 5IXFA 2HCKA 2DBMA 2A37A 1X43A 1PWTA 2L3SA 5IHIA 1QKXA 1M30A 3NHNA 1OV3A 1ZBJA 1BBZA 1BB9A 2YUPA 2DL7A 1H8KA 3VS5A 1ABQA 2JM8A 2JW4A 2O31A 4OMPA 1CSKA 2EW3A 4RTZA 2AZSA 2EKHA 2K3BA 4HCKA 1WXBA 3I5SA 2DMOA 1JEGA 2GBQA 1WFWA 2C0TA 2D8JA 1Z9ZA 2VKNA 2ROTA 2DLPA 2KYMA 2DL8A 2OJ2A 1UHFA 1WYXA 3O5ZA 4CC7A 2YDLA 3QWXX 2EBPA 2J6OA 5HCKA 3PVQA 1SEMA 2PTKA 4KRTA 1UDLA 5EC7A 4AFQC 4HVUA 5I11A 2FPFA 1M8MA 1WI7A 2LX7A 4HXJA 1AOJA 1N5ZA 3VRZA 3VS3A 1J3TA 3M0SA 1NEGA 1QKWA 1YCSB 2D0NA 1PRMC 1KFZA 2CH4A 2V1QA 1BU1A 2EYWA 3EG3A 1NYFA 1YNZA 2RQVA 3UA7A 2DL5A 1NM7A 3THKA 3UA6A 4HVVA 2J05A 2W0ZA 3EHRA 4RTTA 1T3SA 2P4RA 2PNIA 1XOVA 1ZLMA 3I35A 1BK2A 2VVKA 1K4US 1WDXA 2ED1A 2L3QA 2JXBA 1AZGB 1QCFA 2RPNA 1U3OA 2M51A 1AWJA 1HD3A 2YUQA 4F17A 2D8HA 3EG1A 1W70A 1X27A 1GBRA 4CC2A 3H0FA 2L2PA 1WIEA 4DEXA 4J9BA 1M3AA 3VS7A 2CUBA 1TG0A 2JMCA 1AWWA 2DRKA 4AG2C 1GL5A 1ZX6A 1YWPA 2J6KA 2JS2A 2K79A 2FPEA 2GQIA 2J06A 4GLMA 1JXOA 1Y0MA 1PHTA 3IQLA 1GCQA 3PE0A 1PRLC 2RMOA 2NUZA 3M0TA 1SPKA 2KROA 3H0HA 1B3QA 4D8KA 1UECA 2F2VA 1GFCA 2CT4A 2V1RA 5I22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y92 A;  2EGE A;  3ULR B;  4R0K A;  3NPF A;  2SRC A;  2CT3 A;  4X1V A;  2SEM A;  1M27 C;  4LE9 A;  2ED0 A;  2LNH B;  1UG1 A;  2BZX A;  2O88 A;  2X3W D;  4FSS A;  3ZL7 C;  2DE0 X;  1E6H A;  2M0Y A;  2BZ8 A;  2NWM A;  5FWC A;  1VYU A;  2RQT A;  5GJV B;  1W1F A;  2ABL A;  1TUC A;  1JO8 A;  2MIO A;  1YP5 A;  4RUG A;  1AEY A;  2BTT A;  2RNA A;  3C0C A;  2KEA A;  1SSH A;  4Z8A A;  3QWY A;  1RI9 A;  3EG0 A;  1UFF A;  2BZY A;  1X69 A;  3RNJ A;  1UGV A;  1AWX A;  1U5S A;  5IXB A;  4OMN A;  1NG2 A;  2JM9 A;  3VS0 A;  4J9C A;  2LZ6 B;  4OMM A;  2FO0 A;  1HJD A;  4IIO A;  4CC4 B;  1G83 A;  2DA9 A;  4OML A;  2EGA A;  2RF0 A;  2MOX A;  2K9G A;  4AG1 C;  2GNC A;  2KXC A;  2LJ1 A;  1PNJ A;  1QWE A;  2CRE A;  1TUD A;  1GBQ A;  3A98 A;  2KRM A;  1AD5 A;  4LN2 A;  1I1J A;  1ZUK A;  4LUD A;  1QLY A;  2K7A A;  2X3X D;  1AZE A;  3U23 A;  1GRI A;  2L0A A;  1K1Z A;  3M0R A;  2EYZ A;  2KGT A;  3FJ5 A;  4J9H A;  3SHW A;  1WA7 A;  2KR3 A;  2DRM A;  5GJW B;  4AFU C;  1KIK A;  1EFN A;  1CKB A;  4LUE A;  3GBQ A;  1K0X A;  1UJY A;  2A36 A;  4AFS C;  2OAW A;  1JXM A;  1X2Q A;  3CQT A;  1VYT A;  2MCN A;  1CKA A;  2KT1 A;  2B86 A;  3VS4 A;  4WCI A;  3R6N A;  2G6F X;  1G2B A;  1JQQ A;  3VS6 A;  1T0J A;  4OMO A;  4RTU A;  2LQN A;  3M0P A;  1UUE A;  2VWF A;  4J9I A;  1WX6 A;  1H92 A;  1B07 A;  1UJ0 A;  3EHQ A;  5IHK A;  4JJD A;  5FWB A;  1IO6 A;  4K11 A;  2FEI A;  2W10 A;  3NGP A;  1ZUY A;  2KNB B;  1QWF A;  4GBQ A;  1M3B A;  2DX1 A;  5IH2 A;  5IHN A;  2O9S A;  1X2K A;  2FPD A;  2EPD A;  2C0O A;  1GFD A;  2AZV A;  1AVZ C;  5FW9 A;  3I5R A;  3M0Q A;  4JPB W;  2DIL A;  4Z89 A;  1PKS A;  1E6G A;  2ENM A;  4JZ3 A;  2YUO A;  1WXU A;  4EIK A;  2O9V A;  2KYB A;  3NMZ C;  2O2O A;  4J9F A;  1X6B A;  2KE9 A;  5ECA A;  4DEY A;  2CSI A;  1LCK A;  1UTI A;  1Z9Q A;  3KFV A;  1M3C A;  2KXD A;  1I0C A;  2HBW A;  2JS0 A;  3REA B;  2AKK A;  2DYB A;  1HSQ A;  2IIM A;  2KBT A;  1OPL A;  2HSP A;  1A0N B;  4ZNX A;  2HEQ A;  4ORZ A;  4RTV A;  2D1X A;  3VRY A;  2RQU A;  2LQW A;  3H41 A;  1K9A A;  1UE9 A;  1WXT A;  2RN8 A;  4Z88 A;  4J9E A;  2K2M A;  1SRM A;  1JU5 C;  3TSW A;  2RQR A;  3EGU A;  1Y57 A;  2DL3 A;  4RTX A;  1NLO C;  2YUN A;  2XMF A;  1MV3 A;  2CSQ A;  2LMJ A;  1H3H A;  1OOT A;  1NLP C;  1UHC A;  1NEB A;  1GCQ C;  4D8D A;  2LJ0 A;  1OEB A;  4RTY A;  1KJW A;  2DM1 A;  1OPK A;  2A28 A;  2ESW A;  2LCS A;  1AWO A;  1K0S A;  2A08 A;  1K76 A;  4LNP A;  2QDL A;  2KRN A;  2EGC A;  2AKL A;  2YSQ A;  2FG0 A;  2GTO A;  2EYY A;  2OI3 A;  1I07 A;  2DBK A;  3PVL A;  2I0N A;  2ECZ A;  2PZ1 A;  2H8H A;  2EQI A;  2J7I A;  1SHF A;  3SEM A;  1NYG A;  1GCP A;  2JTE A;  4RTW A;  3VS2 A;  2DVJ A;  2DNU A;  2HDA A;  1ABO A;  2CH4 W;  1V1C A;  1WLP B;  4E6R A;  1T0H A;  2EVR A;  3TVT A;  2J6F A;  3LH5 A;  1RLQ C;  2KRS A;  2DL4 A;  4M4Z A;  2JMA A;  1MV0 B;  4J9D A;  2C0I A;  1S1N A;  2GTJ A;  1U06 A;  4JJC A;  4JJB A;  2LP5 A;  2RQW A;  4CC3 A;  3RBB B;  1SHG A;  3VS1 A;  2CUD A;  4F16 A;  2DF6 A;  1RUW A;  3REB B;  2FRY A;  2L3P A;  1RLP C;  1VYV A;  2F2X A;  2CDT A;  4QT7 A;  4IIM A;  4J9G A;  1SRL A;  1PKT A;  3UF4 A;  2YT6 A;  2KT8 A;  2FRW A;  2LJ3 A;  4A63 B;  2GGR A;  2E5K A;  2AK5 A;  3I9Q A;  5L23 A;  1W6X A;  2F2W A;  4OMQ A;  3JV3 A;  1E7O A;  2K6D A;  1ZSG A;  1YN8 A;  3TSZ A;  2JT4 A;  3EG2 A;  4HVW A;  3M0U A;  2ROL A;  4AFZ C;  2DJQ A;  1ZUU A;  4ESR A;  3UAT A;  4F14 A;  1ARK A;  1T3L A;  2EYX A;  1FYN A;  3H0I A;  1FMK A;  1KSW A;  1X6G A;  1VA7 A;  1MUZ A;  1YWO A;  4JZ4 A;  5IXF A;  2HCK A;  2DBM A;  2A37 A;  1X43 A;  1PWT A;  2L3S A;  5IHI A;  1QKX A;  1M30 A;  3NHN A;  1OV3 A;  1ZBJ A;  1BBZ A;  1BB9 A;  2YUP A;  2DL7 A;  1H8K A;  3VS5 A;  1ABQ A;  2JM8 A;  2JW4 A;  2O31 A;  4OMP A;  1CSK A;  2EW3 A;  4RTZ A;  2AZS A;  2EKH A;  2K3B A;  4HCK A;  1WXB A;  3I5S A;  2DMO A;  1JEG A;  2GBQ A;  1WFW A;  2C0T A;  2D8J A;  1Z9Z A;  2VKN A;  2ROT A;  2DLP A;  2KYM A;  2DL8 A;  2OJ2 A;  1UHF A;  1WYX A;  3O5Z A;  4CC7 A;  2YDL A;  3QWX X;  2EBP A;  2J6O A;  5HCK A;  3PVQ A;  1SEM A;  2PTK A;  4KRT A;  1UDL A;  5EC7 A;  4AFQ C;  4HVU A;  5I11 A;  2FPF A;  1M8M A;  1WI7 A;  2LX7 A;  4HXJ A;  1AOJ A;  1N5Z A;  3VRZ A;  3VS3 A;  1J3T A;  3M0S A;  1NEG A;  1QKW A;  1YCS B;  2D0N A;  1PRM C;  1KFZ A;  2CH4 A;  2V1Q A;  1BU1 A;  2EYW A;  3EG3 A;  1NYF A;  1YNZ A;  2RQV A;  3UA7 A;  2DL5 A;  1NM7 A;  3THK A;  3UA6 A;  4HVV A;  2J05 A;  2W0Z A;  3EHR A;  4RTT A;  1T3S A;  2P4R A;  2PNI A;  1XOV A;  1ZLM A;  3I35 A;  1BK2 A;  2VVK A;  1K4U S;  1WDX A;  2ED1 A;  2L3Q A;  2JXB A;  1AZG B;  1QCF A;  2RPN A;  1U3O A;  2M51 A;  1AWJ A;  1HD3 A;  2YUQ A;  4F17 A;  2D8H A;  3EG1 A;  1W70 A;  1X27 A;  1GBR A;  4CC2 A;  3H0F A;  2L2P A;  1WIE A;  4DEX A;  4J9B A;  1M3A A;  3VS7 A;  2CUB A;  1TG0 A;  2JMC A;  1AWW A;  2DRK A;  4AG2 C;  1GL5 A;  1ZX6 A;  1YWP A;  2J6K A;  2JS2 A;  2K79 A;  2FPE A;  2GQI A;  2J06 A;  4GLM A;  1JXO A;  1Y0M A;  1PHT A;  3IQL A;  1GCQ A;  3PE0 A;  1PRL C;  2RMO A;  2NUZ A;  3M0T A;  1SPK A;  2KRO A;  3H0H A;  1B3Q A;  4D8K A;  1UEC A;  2F2V A;  1GFC A;  2CT4 A;  2V1R A;  5I22 A; 
#chains in the Genus database with same CATH topology
 1N8R C;  3ULR B;  1X6O A;  1BCP D;  3NPF A;  1XPO A;  2EKO A;  1MJC A;  2K04 A;  2WAQ E;  4N0A C;  2LNH B;  2HL3 A;  4ATO A;  1B53 A;  4YWM A;  2O88 A;  3DEO A;  4RCB A;  2EYO A;  2CW0 C;  3WVE B;  1EQV A;  2YLC A;  2DE0 X;  4C8Q B;  3MP1 A;  5DAU A;  1E6H A;  2L8D A;  2M0Y A;  2VZA A;  3BDC A;  4OX9 Q;  2PQA A;  4C3H G;  2RO0 A;  1JB0 E;  2RQT A;  4FYX B;  2HIX A;  4HR7 B;  5GJV B;  1B1Z A;  5IWA L;  4K0K L;  2L55 A;  2DZC A;  1L1O A;  3CC7 A;  4PJO D;  1VS0 A;  3FLG A;  4IJL A;  2Q8I B;  1PSF A;  1P8L A;  3PMF A;  2ZPF B;  4RUG A;  5GAO r;  3MFG A;  4A3I G;  1JWM D;  1K9M C;  6AT1 B;  2RHZ A;  5J22 A;  4A3E H;  3W3A A;  3CCS T;  1CSP A;  2ZAE A;  2B2U C;  4JBW A;  1V8Q A;  3RKX A;  4HIK A;  3PO2 G;  2CP0 A;  1HZC A;  3GTO H;  1T5X D;  2CP2 A;  1I3Q H;  4Q5W A;  4NDX A;  1EYA A;  4E7H A;  4LF7 L;  1LT5 D;  2F0O A;  2GFA A;  3QWY A;  3LWE A;  1RI9 A;  2JN0 A;  3NEM A;  4CI0 C;  4DGZ A;  1D7Q A;  3SE0 A;  2K2V A;  4IFD J;  1YIJ T;  3J7A 5;  1JMC A;  4LDY A;  1RL2 A;  2X6G A;  1M1K C;  1RAH B;  1TII D;  2ZPG B;  5J39 A;  4LF8 Q;  4KGZ B;  5C44 H;  4J9C A;  2LZ6 B;  3H3V I;  3SK5 A;  4LFA L;  2FO0 A;  3PQI A;  4OGQ C;  3UE0 A;  2Y4Y A;  3HGB A;  2ID0 A;  3K0Y A;  3OSO A;  4CC4 B;  2RI5 A;  4DV0 L;  1PH4 A;  1QCO A;  1HFG A;  4A75 A;  1AN8 A;  2DKG A;  4E7L A;  5JAV A;  3F1Z A;  2K9G A;  4A3E G;  3NFC A;  2KXC A;  3CCU A;  1QJO A;  4C3J B;  1G6Z A;  1OU8 A;  2VY3 A;  3J80 L;  1QWE A;  3DKM A;  2ZTE A;  1I94 L;  1B4O A;  1WTW A;  1ET9 A;  2PYK A;  1GBQ A;  3W1B A;  4LN2 A;  2QA4 A;  4LUD A;  3AB9 A;  1WJQ A;  3MC0 B;  4YHH L;  3IFD A;  1GHK A;  2F52 A;  1NSN S;  2PZW A;  5IP9 H;  1AT1 B;  1C6V X;  3AFP A;  2EY1 A;  1CZW A;  1RTN A;  3FB9 A;  5IWA Q;  1MMA A;  2L0A A;  4K0K Q;  4LXC A;  1K1Z A;  1JR0 D;  3GLX A;  1ILQ A;  3SK4 A;  5IYB H;  3VYS A;  2D0P A;  5FK9 C;  5GJW B;  1F2Z A;  1X3F A;  4C92 B;  2IPK D;  1HXD A;  3SWN A;  1RJT A;  4J6X A;  4R4Q A;  5JVG 3;  1VQ4 A;  2JXM B;  4AYB G;  2P0Q A;  4QQG A;  1X2Q A;  3NTH A;  3S15 B;  3VYR A;  1CKA A;  5GAM g;  4GZY C;  4KJO A;  4DAP A;  5M3F H;  3H9N A;  2OX7 A;  4BDZ A;  3QJ6 A;  2L3R A;  4HCB A;  2COZ A;  1NZ9 A;  1EYD A;  1NY4 A;  2JA7 H;  4RHS A;  3VS6 A;  3X24 B;  1T0J A;  1EY4 A;  1LTT D;  3D6W A;  3DB3 A;  3M59 A;  5KRU A;  4WFN 3;  5LMN L;  3H09 A;  3HKZ G;  1HR0 W;  2R92 B;  1CHQ D;  5IP9 G;  3VYU A;  2K5W A;  3V2T A;  2VWF A;  4LFA Q;  4QQB X;  1UUP A;  3OYN A;  4YWL A;  5CAI A;  5JEA J;  1IB8 A;  3OWE B;  1EIY B;  2MAM A;  5IYB G;  4M7D A;  1PTO H;  1SE2 A;  3CC7 Q;  1V1O A;  4DV0 Q;  2SEB D;  4VUB A;  5DM6 3;  3HHT B;  4JJD A;  2RDF A;  3EA6 A;  4DXG A;  4BWG B;  1IO6 A;  1OQK A;  2C5C A;  3GTM B;  1LTR D;  4P72 A;  2P0K A;  2KNB B;  1QWF A;  1VQN A;  1IRX A;  3LX0 A;  1I94 Q;  4OO1 I;  1FGB D;  1M3B A;  2DX1 A;  5IH2 A;  1K3R A;  3C3L A;  5IHN A;  2H3E B;  2FB7 A;  1TS4 A;  4YHH Q;  1MMN A;  2QXF A;  4A3F B;  2AZV A;  1VQH A;  5K5P A;  3JCM J;  3MXN B;  3BDO A;  5FW9 A;  1SSF A;  5GMK i;  3M0Q A;  1D0X A;  3VV0 A;  1BO0 A;  2EOT A;  1E6G A;  4LF4 L;  2ENM A;  3N5B B;  3K7A H;  3X25 B;  2EYM A;  2DAQ A;  1OXS C;  4HJ8 A;  1U4P A;  1WI5 A;  2HUG A;  1N33 Q;  2F3V A;  1S5D D;  3GV6 A;  3HFZ B;  2K3X A;  1M2V B;  2MHV A;  1TUG B;  1LAC A;  5D3D A;  4C3I H;  4M75 D;  1IBL L;  2CSI A;  4MDX A;  2PVG B;  4EMH A;  1WD0 A;  2XU8 A;  5FJ8 H;  2BA1 A;  2Z8L A;  5LJ5 j;  1FL0 A;  4MTK A;  3G6J B;  1M3C A;  3RN5 A;  2R5M A;  1TWA B;  2AQ1 B;  3H3V C;  3GTQ H;  2AKK A;  5LMN Q;  1HSQ A;  4JI4 Q;  1TH7 A;  2KBT A;  2R61 A;  3X3M A;  4DR4 Q;  2HSP A;  2OQK A;  2GF7 A;  1A0N B;  1C48 A;  1E24 A;  2HDL A;  2Z0S A;  1EQR A;  2DTI A;  1UE1 A;  4C1N I;  5H1S E;  5I4D A;  1WJR A;  2D1X A;  3VRY A;  4KLK A;  1KD1 R;  1KD1 U;  1UAP A;  1K9A A;  5LJ5 h;  3ITP A;  1UE9 A;  2OXP A;  5C4X H;  3J81 c;  4EDU A;  4Z88 A;  4J9E A;  1SRM A;  1TS9 A;  2BUD A;  1VQK A;  4DR5 Q;  3HOV B;  3EGU A;  5FO9 B;  4RTX A;  3CME A;  2E6N A;  2R7Z G;  2YUN A;  3UDC A;  1VQ4 Q;  2PNH A;  2JK8 A;  3S24 A;  4A3G H;  2RI3 A;  5DM7 3;  1S72 T;  4PLI A;  5FJ8 G;  1D0Z A;  4B3R L;  1PM3 A;  1U4R A;  5GAO p;  1QZG A;  1MIU A;  2E76 C;  5IGC A;  1NLP C;  1NBE B;  1LTA D;  4C1N K;  4E7S A;  1GCQ C;  3K59 A;  1YI2 A;  4TQU S;  3BZC A;  2F0K A;  1CKO A;  4M75 G;  2OEO A;  5LL6 S;  3URY A;  1OPK A;  4E7Z A;  1W3S A;  4JRI A;  1K0S A;  2QAS A;  2RSN A;  4XTY A;  5CKE A;  2A08 A;  4OB0 B;  5E1F A;  1HQR D;  1KHI A;  2XK0 A;  3MAQ A;  2FZK B;  2AKL A;  4PNO A;  4II1 A;  2RA4 A;  4CHT B;  1IBL Q;  1RCV D;  4XT1 B;  4ME3 A;  1XJW B;  3SR1 A;  4C0D B;  2FJ2 A;  3C1F A;  2I0N A;  2X4J A;  2ECZ A;  1OXV A;  2QGG A;  4A3G G;  3OYY A;  2H8H A;  1XTC D;  3E5S A;  4UPA A;  3TZD A;  4FF3 A;  1SHF A;  3MHX A;  5A2Q E;  1ZQ1 A;  4AMC A;  1YJN T;  1I50 H;  5M3M H;  5M5X B;  1G6P A;  1KDC A;  3JB9 D;  1J9O A;  4RTW A;  2JEB I;  1NR4 A;  3KLS A;  1H9S A;  3VS2 A;  4ME5 A;  2CH4 W;  1QQJ A;  2KCN A;  1TS2 A;  4L5S A;  5EGT A;  2YU9 B;  5KYY A;  5NUC A;  3GTG B;  1QNK A;  5KYX B;  1U0L A;  4WRD A;  2J6F A;  4ZQ3 A;  4Y91 A;  3MWY W;  1Z47 A;  2X9H A;  1Y1V B;  3S1N H;  2PU9 B;  4YCU A;  1V76 A;  4KHZ A;  4QL5 A;  4M4Z A;  1EQT A;  4HJ5 A;  2OWO A;  4EQ5 A;  1S1N A;  2GTJ A;  3SFM A;  3KDF A;  1D3B B;  4RCO A;  3JCM d;  2A7Y A;  1U06 A;  4KGX B;  1KQ1 A;  2LP5 A;  1Q82 R;  1Q82 U;  2ASB A;  3CCS A;  1SHG A;  3VS1 A;  1VQP T;  1I8F A;  4IUV A;  4BY6 C;  2CUD A;  1CKN A;  4HMJ A;  4MZP A;  5M3M G;  5KNC A;  4K14 A;  1BKB A;  5GAN 5;  4LK1 C;  1M1F A;  1AFP A;  4DN4 M;  3MXG A;  3GP7 A;  2BCO A;  1X9N A;  1VYV A;  3FC3 A;  1HZB A;  2RDH A;  1LAB A;  2CDT A;  3F2D A;  4C3H B;  4QT7 A;  2MJ8 A;  5JJL A;  2LRQ A;  2VV5 A;  3S1R B;  2ATC B;  4ULL A;  1YIJ A;  2HCI A;  4V0B A;  3NEL A;  1ML0 D;  2CP5 A;  2Q2I A;  2YYZ A;  4A3I B;  4X9C A;  3HOY B;  4M7A A;  2LJ3 A;  1SNC A;  4J8Q A;  3L1A A;  4PJL A;  2GGR A;  1IZ6 A;  3I9Q A;  5L23 A;  1W6X A;  2KHJ A;  4IPG A;  3W5O A;  3OSV A;  4M78 A;  3LNN A;  3J81 j;  4JI3 Q;  1VQK Q;  2L5T A;  2ATW A;  4BXX H;  4EMG A;  3JC6 6;  4DK6 C;  2RHS B;  2VXE A;  1ZSG A;  4L5G A;  2D5D A;  3R2T A;  2H1E A;  1YN8 A;  2XG8 D;  1G3Y A;  5GMK l;  1SE4 A;  1X3P A;  4YTL A;  2PQA B;  4QGU A;  4A3M H;  2JT4 A;  3SVM A;  3EG2 A;  4JDS A;  1WVL A;  1KRT A;  2PMZ E;  4DAY A;  1E0B A;  2EYH A;  3M0U A;  5CO7 A;  4M77 F;  4BI8 B;  1C7Y A;  3A8H B;  4BI3 A;  4M7A G;  2X35 A;  1WOC A;  2IWH A;  3UAT A;  1B44 D;  3J80 c;  4M77 E;  4XTV A;  3A8J E;  3NWT A;  1QVG A;  4GOP B;  4A3K H;  1T3L A;  1Y71 A;  2EYX A;  4M78 G;  1R9T B;  4HMI A;  1GM5 A;  1WHG A;  4KTA A;  3S2H H;  1FMK A;  3T13 A;  4JI5 L;  4KMU C;  3EGX A;  3TZU A;  1WTO A;  2OTL Q;  3I55 T;  2NYS A;  2EXZ A;  1ZHI A;  5IXF A;  4A3E B;  2A37 A;  4ZN1 A;  4CBV A;  3QZ9 B;  1ICW A;  1WCM H;  2L3S A;  1ZYR D;  3UDX A;  3GTO B;  1QKX A;  1LLR D;  4BXX G;  1M30 A;  1OV3 A;  1BBZ A;  1N34 L;  5A35 A;  4O1N A;  3RD4 A;  5IN1 A;  1ONL A;  2JM8 A;  2O31 A;  4OMP A;  3CW2 C;  4FF2 A;  1E7Z A;  1EFW A;  2IPO B;  4RTZ A;  1VQ6 A;  4A3J H;  4BS9 A;  2EKH A;  1YIT T;  1S5B D;  1U4M A;  2C9O A;  2F69 A;  2F3I A;  5C3W A;  5EPJ A;  2A73 B;  1NAP A;  2DD4 A;  3GDE A;  2DMO A;  2CWP A;  5JJZ A;  2F03 A;  3TN2 A;  2GBQ A;  4DAM A;  2C0T A;  2D8J A;  3R3O A;  4A3K G;  1HA6 A;  2LY7 A;  3TS0 A;  4G7H C;  1Q86 R;  4IUP A;  1Q86 U;  2ROT A;  3FRP B;  2DLP A;  3DHQ A;  1SRU A;  4HID A;  1GVP A;  2X6L A;  3RUZ A;  3O5Z A;  5GAN j;  4HJA A;  1WJS A;  3M5A A;  3QWX X;  4MMK A;  1H9J A;  1GOZ A;  1PFN A;  2CCZ A;  2J6O A;  3VA5 A;  4FO2 A;  2F4V Q;  2OT2 A;  3CCE Q;  1SEM A;  4S3S A;  4UP7 A;  1AZP A;  3K0X A;  3A8I E;  3N52 A;  1VMC A;  1IRE B;  3HKZ B;  5EC7 A;  4AFQ C;  3EIV A;  4A4I A;  4OP0 A;  4A3J G;  4QY7 A;  5BR8 L;  2RSO A;  3VS3 A;  2EY5 A;  3SWN B;  1J3T A;  3NP8 A;  1U9R A;  5GAN h;  2P84 A;  1RAC B;  1M2O A;  1PSE A;  4GLK A;  3M0S A;  4JI5 Q;  4EQO A;  4HKE A;  1KFZ A;  3QPH A;  1KD1 C;  3UWN A;  4A3D G;  2C35 B;  3I56 A;  2CKK A;  4DAV A;  2EYW A;  2FIN B;  2IL8 A;  1NYF A;  1H95 A;  4ELY C;  1B9M A;  1N34 Q;  1QVG S;  3VUB A;  2DL5 A;  1VQL T;  1HTL D;  3UA6 A;  4K2K A;  4WJ4 A;  4HVV A;  4KH1 B;  4XYO A;  4AQY L;  1PC0 A;  2N8N A;  3Q1J A;  3OYB A;  5EPL A;  1M90 R;  2I0Q A;  1M90 U;  1M4V A;  2QEJ C;  1STE A;  3I35 A;  1BK2 A;  3UPU A;  1K4U S;  1SR3 A;  1WDX A;  2ED1 A;  3PGG A;  4F7U F;  1JJ2 P;  3D7S B;  2F0U A;  3KF8 B;  5BN5 A;  1AZG B;  1LTG D;  1PRT B;  2NLU A;  3C95 A;  4NL2 A;  1PTO B;  2H5X A;  4UDU C;  4F7U E;  3CRL C;  2LCC A;  3CRK C;  3GV3 A;  2D8H A;  3EG1 A;  3QBY A;  1EIG A;  3CC2 T;  1X27 A;  1PVO A;  1GBR A;  3H0F A;  2L2P A;  1WIE A;  3RIR A;  3JCM f;  4JUV A;  4DEX A;  2D2C C;  4K5W A;  3MP6 A;  2E12 A;  1KQS A;  3HSB A;  5LMU L;  3MXU A;  1VQD A;  3VS7 A;  4RKB A;  2AMC B;  2OCE A;  1BI0 A;  4JRP A;  1RAA B;  2RJE A;  2V8I A;  4E6I A;  2DRK A;  4C5I A;  1MGQ A;  3QII A;  3CC4 Q;  3PUX A;  4DR6 L;  1PDQ A;  1ACM B;  1OI1 A;  3JCM g;  2DD5 A;  4HJ7 A;  2K5D A;  5BR8 Q;  2JS2 A;  2DJG C;  1QB5 D;  2AHO B;  2K79 A;  4X3U A;  3TU4 K;  4DA4 A;  2SOB A;  3K7A B;  3C12 A;  1TY2 A;  1UE6 A;  2L1B A;  1QCB D;  4QVZ A;  2R7F A;  5M5W H;  1LOJ A;  2NN6 H;  1JXO A;  4IFD I;  4C3I B;  2EJG A;  2R58 A;  1OX9 A;  3IQL A;  2JA6 G;  1Q81 C;  3OYC A;  2ZJQ A;  1O80 A;  1KC8 R;  1D1I A;  1KC8 U;  3PMI A;  4K2L A;  2NUZ A;  3SXH A;  1DOM A;  4YCV A;  2HCC A;  1HNW L;  3GTQ B;  4AQY Q;  5KCO A;  4BY7 H;  3M55 A;  1Q82 C;  4GN3 B;  1YJN A;  4JBM A;  1WTH A;  2DGY A;  1UE5 A;  2MYS A;  3A56 A;  1Y69 U;  2CT4 A;  2V1R A;  3MPU B;  1DOL A;  3AHU A;  3U9O A;  2JA8 G;  4M75 B;  4FSX A;  2AQ3 B;  2WAQ G;  2YTX A;  3O8V A;  1V43 A;  5GAD C;  2K4K A;  3M58 A;  1SYD A;  4Y92 A;  1MHW C;  1RAG B;  1AHJ B;  2DVE A;  3V96 A;  4V2S A;  2CT3 A;  4X1V A;  5IGG A;  1G8Z D;  2Z6B A;  4G7Z C;  3S1Q H;  4J8O A;  4Z9C B;  5E4W C;  3VYG A;  2JVV A;  2SEM A;  2NN6 G;  1BXT A;  3DUZ A;  4DBQ A;  3D4R A;  3VU3 C;  1M5Q 1;  2ED0 A;  3OTO L;  2NUC A;  1A8V A;  4BDY A;  2VB2 X;  1TOV A;  1Q46 A;  3MXN A;  4A3G B;  1F1B B;  5LMU Q;  3ZL7 C;  3A8K E;  1IL2 A;  1G3W A;  2N49 A;  4A3C H;  2G3R A;  2MF2 A;  4N9T A;  5FWC A;  4PKC C;  2A69 C;  4DR6 Q;  1VYU A;  1Y8O B;  2DO3 A;  5IP7 H;  1JWU D;  4BY7 G;  2CVR A;  1H64 1;  2ABL A;  2M1H A;  3V8L A;  5I2S A;  2QQA A;  3FEO A;  5LJ5 d;  3PV0 A;  1M2V A;  1C0M A;  4OB3 B;  4B6M A;  1AZQ A;  3HOW H;  5EQ0 A;  2EZV A;  1VUB A;  1OUL A;  1TWA H;  3J81 i;  3J7Z C;  2ZPE B;  3S6W A;  1KQS S;  2A74 C;  3U4Z A;  1OX8 A;  5DM7 R;  1B7Y B;  8ATC B;  4RMO A;  5AJ3 L;  2D0Q B;  4Y28 E;  1I4K 1;  3KUP A;  4FF1 A;  2VUB A;  4JI7 Q;  5CV7 A;  3PF5 A;  3ONA B;  2DIG A;  4M8A A;  1RTO A;  4Z8A A;  2WAC A;  1H9S B;  1STG A;  1I4Q A;  2RHQ B;  1HNW Q;  3DM1 A;  1YNN C;  2L5Q A;  1I50 B;  1CKM A;  5M3M B;  1UGV A;  1EU4 A;  4O5V A;  1IW7 C;  2K14 A;  1S72 Q;  1NG2 A;  3VS0 A;  1VQA A;  3TBI B;  1JE5 A;  4NXM L;  1JE4 A;  1HJD A;  2R7D A;  3I4M H;  5K36 G;  1GUO A;  5COR A;  3M9B A;  1TWG H;  1TKW B;  1AW7 A;  1G83 A;  2XTI A;  4EGV A;  2VAS A;  2EGA A;  3PTA A;  2PO4 A;  2BOS A;  3KDF B;  3KLW A;  2MMP A;  1JJC B;  2RF0 A;  2MOX A;  4BE2 A;  5I6W A;  2HL5 C;  4AG1 C;  3S3M A;  4OGC A;  2GNC A;  1KAW A;  2MGS A;  4IZ8 A;  3S1N B;  2LJ1 A;  4HTH A;  3Q0A A;  3OTO Q;  3X26 B;  5C0M A;  2K28 A;  3VR6 A;  2B2V A;  2V8K A;  1ZSZ B;  1ZKO A;  3M56 A;  1I1J A;  4G7O C;  2ZPI B;  2N78 A;  4KHV A;  1Q86 C;  1QLY A;  1DXM A;  1XNR L;  1P92 A;  3V05 A;  1C0A A;  2C06 A;  1BBU A;  4DV1 L;  1FJG L;  2Z4I A;  4C0F A;  2UXC L;  1SNO A;  2G5D A;  4KT0 E;  2M02 A;  2I46 A;  1M9S A;  4OWX B;  3I90 A;  1KAB A;  3S2D H;  4JBJ A;  3MA2 B;  1YFN A;  3FJ5 A;  4J9H A;  4M7A B;  1MSG A;  1O7Z A;  3I4M G;  2KR3 A;  2DRM A;  4C8Q F;  4LUE A;  4XXE A;  1GXI E;  4M78 B;  3GBQ A;  2GA4 B;  3QYH B;  2EYJ A;  1LT6 D;  3NPP A;  5AJ3 Q;  4C8Q E;  1G29 1;  4TSS A;  4X3T A;  2LS0 1;  3VYH B;  5I2X A;  5GMK e;  2MCN A;  3UDG A;  2KT1 A;  3OIP A;  2WIN B;  1XMQ L;  1L1O C;  2A6E D;  2YU9 H;  3SEB A;  2VGM A;  3FJP A;  3FKI G;  1S5E D;  2B86 A;  1B2T A;  2L89 A;  1VMP A;  3R6N A;  2V4D A;  3HP3 A;  1FYC A;  3AYH B;  4DV4 L;  4MTN A;  3M4Y A;  4EMK A;  2F0V A;  1EWH A;  1QZH A;  3QHS A;  3M0P A;  5KYX A;  5LL6 X;  4NXM Q;  1EY7 A;  1ESR A;  2P4T A;  3CBP A;  1RD9 D;  3GQB A;  1VQP Q;  1WPY A;  5HUR A;  3HOU H;  3IL8 A;  2EY2 A;  1WD1 A;  2DIQ A;  1UJ0 A;  1ZA2 B;  5FRN A;  3P20 A;  4NPS A;  4XQQ A;  3OYF A;  1W4S A;  2KEE A;  1RKN A;  5IHK A;  1HZA A;  1NE3 A;  2N88 A;  4A3K B;  2FEI A;  1M90 C;  1A3V A;  2R3Z A;  1X54 A;  4Y52 H;  1ZUY A;  2BE7 D;  3LGL A;  2AWO A;  4GBQ A;  4XU1 A;  3L9A X;  3U50 C;  3S2H B;  5DEH A;  2V8J A;  2NVT H;  1DD2 A;  3G7Z A;  1JIC A;  1X2K A;  2UUB Q;  3S1R H;  4LAA A;  3HS0 C;  2M9U A;  3HKS A;  2C0O A;  2B2Y A;  4GNX A;  1FMW A;  4PG3 A;  1XNR Q;  2OTL T;  4A53 A;  5ELB A;  3TS2 A;  1WCM B;  4LUO A;  4A3I H;  1HR0 L;  1FJG Q;  4DV1 Q;  2UXC Q;  5JJK A;  2I5H A;  1VOM A;  2M0O A;  2BA0 A;  3A5U A;  1LT4 D;  3I5R A;  2DIL A;  4Z89 A;  5CV5 A;  2LCL A;  3OPO A;  1VQL A;  3QOL A;  1AEX A;  2BDN A;  1FMV A;  4BUG A;  1BR9 A;  3QIA A;  1GXD C;  4N8F A;  3GTJ H;  2KYB A;  3H8Z A;  2PVO B;  3BZK A;  4DV2 Q;  5FU7 C;  2EPB A;  1G51 A;  1N9W A;  2KE9 A;  2NVQ H;  3J80 i;  3S9W A;  3QDF A;  3PNW C;  5GAN 8;  1MKH A;  2MUY A;  3HZX A;  4KD3 A;  4FU6 A;  3BVG A;  4DFA A;  5G3L F;  2SNS A;  1LTI D;  3S3O A;  2PI2 A;  3IKJ A;  5IGB A;  1XMQ Q;  1Z9Q A;  4HED A;  4A3D B;  2MPX C;  1LNX A;  5GAN 3;  3LWU A;  3S16 H;  2JS0 A;  4C92 F;  3D3R A;  4DV4 Q;  2DXU A;  3OS1 A;  1F9Q A;  1L2F A;  1F2M A;  5I21 A;  1W6K A;  1EY0 A;  2XVS A;  5EKI A;  3I55 Q;  3VR5 A;  1R9T H;  1OPL A;  4C92 E;  4XU2 A;  3OYK A;  3V7S A;  4M77 C;  2OQ0 A;  4DUY L;  2ZPH B;  5I2M A;  2RHI A;  4GOP A;  3B6Y A;  4DUZ L;  2RQU A;  3P8H A;  3KJP A;  3CCE T;  1G8X A;  2KSS A;  3A54 A;  5LJ3 j;  1WXT A;  2RN8 A;  2M2L A;  2RF4 A;  3P8D A;  2X69 A;  2JJQ A;  5LJ5 f;  3TRZ A;  1JBM A;  2P0P A;  4IQZ A;  2RQR A;  3JAM E;  1Y57 A;  1YIT Q;  2A68 D;  1BCM A;  1UB4 A;  2A6H C;  3ZBD A;  1ET6 A;  3A55 A;  3QG1 A;  5EKK A;  2DXB A;  1LPL A;  5CKB A;  5GAN 7;  3H91 A;  4ZYS A;  2X4W A;  2CHB D;  2XMF A;  1GUG A;  3M85 A;  4K5X A;  1JB7 A;  4KHP L;  4PJO A;  5FU6 B;  4M7D C;  3G71 T;  5LJ5 g;  4NMZ A;  2HDM A;  2F0D A;  1OOT A;  1HR0 Q;  5GAG C;  3C46 A;  1CQF A;  2IVW A;  2QDY B;  4X34 A;  5LJ3 h;  4LF6 L;  2YWW A;  1E2V A;  1JQY D;  1O78 A;  1QUQ A;  1WTP A;  2LJ0 A;  1IYV A;  2QQR A;  4A4H A;  2KA7 A;  4FNF A;  1OEB A;  5CV8 A;  3N6R A;  1BIB A;  2DM1 A;  2HZY A;  5D7U A;  5CC4 A;  2B8G A;  2R6G A;  5C0X H;  1P16 A;  1AWO A;  1GO3 E;  3OYI A;  3CCV Q;  2DET A;  1K76 A;  3OYJ A;  1UWV A;  2JE6 I;  4CDD C;  2QDL A;  5GAN d;  2KRN A;  3M53 A;  4ZK9 B;  3CMA T;  1D5M C;  1DJ7 B;  2YSQ A;  3D0F A;  2DY7 A;  2EYY A;  5I9P A;  2OI3 A;  5AFW A;  4JG2 A;  5KYI A;  2DBK A;  4PJO G;  4UHV A;  4A4G A;  4GLX A;  2PW7 A;  3NHH A;  1D5X C;  2CW0 D;  3K80 C;  2EQI A;  2J7I A;  5A2Q L;  2JA6 B;  1RI0 A;  1NYG A;  3OB9 A;  4RA8 A;  3OIQ A;  3LX7 A;  3CCQ Q;  2JTE A;  1WFQ A;  3UDI A;  1QVF A;  2I5L X;  4ZN3 A;  3F2B A;  2E64 A;  1F9P A;  2AQ2 B;  5IYD H;  2DNU A;  4ZLT F;  1ABO A;  2J4X A;  4JOI C;  4DUY Q;  2ICI A;  4RMF A;  4FDB A;  1V1C A;  1WLP B;  4DUZ Q;  1T0H A;  3UDF A;  4PFO A;  2EVR A;  4M77 D;  3LH5 A;  3D4W A;  1VQL Q;  5C0X G;  2JA8 B;  3CC4 T;  3Q22 A;  3HRT A;  4DK1 A;  3S17 B;  4N0A A;  4L59 A;  1I5O B;  4LF7 Q;  2K5H A;  4QUC A;  1R8O B;  5E4X A;  1CA6 A;  2DTO A;  3CP0 A;  3SK8 A;  1LVK A;  2O4X A;  5M5W B;  2RA2 A;  4KHP Q;  3M4P A;  3OY9 A;  4CC3 A;  1O7Y A;  1D5Z C;  3RR5 A;  1E1O A;  1HZ9 A;  4DNI A;  2UXB L;  3EBE A;  3KLR A;  2UUA L;  2MK5 A;  3M4G A;  1WHJ A;  3JCM P;  9ATC B;  4V19 0;  1YHQ Q;  1RLP C;  3CC2 Q;  5IYD G;  1LT3 D;  4A3B H;  2TSS A;  4IIM A;  2FZC B;  1SRL A;  4BY7 B;  3RKW A;  2DER A;  3KF8 A;  1EIF A;  4BI4 A;  3PGZ A;  2YT6 A;  4J7I A;  3NXW A;  1WTQ A;  2BIV A;  2FRW A;  4X65 L;  2E5K A;  2KI7 A;  5GAN 6;  1G5V A;  1O75 A;  4OMQ A;  4N4H A;  4J1M A;  4KJN A;  3T9N A;  1MMG A;  2LKV A;  3HG9 A;  1QMC A;  3T53 B;  3S1Q B;  1YVC A;  2KBN A;  1E7O A;  3TEE A;  2F0N A;  5M5Y H;  1IBK L;  2GN5 A;  5C3X A;  4MHE A;  3ERS X;  4PNY A;  4LF9 L;  3NTI A;  2JA9 A;  5KYW B;  1VQM T;  4C5H A;  4U67 3;  3CCJ Q;  1B34 B;  4JI2 L;  2JTF A;  4X6A H;  4JV5 L;  4A3B G;  2AHJ B;  4J83 A;  2ROL A;  1K73 R;  1K73 U;  4AFZ C;  2NYZ D;  4RGT A;  3ULP A;  4KBM B;  2NTT A;  4LF5 L;  2KCT A;  3MEF A;  1EWI A;  2KHI A;  2R7Z H;  1IXR A;  1N27 A;  1H9M A;  4I65 A;  4O6J A;  2L4N A;  4RHR A;  1PD0 A;  3LWI A;  4DR2 L;  2MWP A;  1QVF S;  1SND A;  3STB D;  3HOW B;  3GNF B;  1NR2 A;  1VA7 A;  3HFN A;  4NOY A;  1X3Q A;  1MUZ A;  2IG0 A;  1TU2 B;  4GLA C;  2UXD L;  2HCK A;  4PFZ A;  3X28 B;  2UXB Q;  2DUD A;  2EYF A;  3WOE A;  2RHU A;  2IJ0 A;  4PV1 C;  1N6A A;  2ZJR A;  1PWT A;  3CPW A;  4P75 A;  2UUA Q;  3TP7 A;  1QOH A;  3H6Z A;  4IUQ A;  2CP3 A;  4JI8 L;  4BA2 I;  1YJW T;  2GVA A;  1T5E A;  1UGS B;  2JW4 A;  4B3M L;  3KXT A;  5KND A;  4M75 A;  3LWH A;  2I5M X;  4DBH A;  2AZS A;  5LJ5 e;  2EJM A;  4IAL A;  2DPP B;  2K3B A;  4DNR B;  4HCK A;  2Q8R E;  5CV9 A;  3PMT A;  1CZG A;  1N32 L;  3MEU A;  3I4M B;  3SB2 A;  4X65 Q;  1QIL A;  5CIU A;  2VKN A;  3BDU A;  1TWG B;  3HEJ A;  1V1Q A;  1PYS B;  1Q95 G;  1IBK Q;  3CCM Q;  2OJ2 A;  3K5N A;  1UHF A;  1F9S A;  3E2U A;  1AE2 A;  3J7A V;  4GS3 A;  2YDL A;  2LC4 A;  2EBP A;  4LF9 Q;  3FKI B;  1Y8P B;  3NSW A;  5HCK A;  2QTX A;  4LF4 Q;  1OU9 A;  4OHJ A;  2PTK A;  4DBR A;  4JI2 Q;  1QG7 A;  3I91 A;  2KEN A;  4LD9 K;  3T16 A;  4JV5 Q;  2I07 B;  4PZ8 A;  3OYD A;  3K5O A;  4B08 A;  4LF5 Q;  3C2P A;  2OTL A;  4R4T A;  4R4C A;  2FPF A;  2Z0W A;  3SHL A;  1WI7 A;  2LX7 A;  3I4N H;  5FO8 B;  1I81 A;  2K33 A;  1XNQ L;  4IO9 A;  1A3T A;  4E7I A;  3U58 A;  2L12 A;  4DR2 Q;  3S2D B;  2EWN A;  2IW3 A;  2EY6 A;  3WOF A;  2R57 A;  4TRD A;  1WHH A;  4FXK C;  1MI2 A;  1BQQ T;  3KYH C;  1YCS B;  4JVZ A;  2D0N A;  5GAN f;  4UAI A;  5F2D A;  2CS7 A;  3G6E Q;  2UXD Q;  4OWT B;  3QUI A;  2D9T A;  5CKD A;  1EQQ A;  1ASZ A;  3TQ7 P;  1NMF A;  3JB9 J;  4LDV A;  5GAM j;  3F2U A;  4L5R C;  1YNZ A;  4EMK B;  4JI8 Q;  1YBY A;  3QB3 A;  2Q2H A;  1QVC A;  1W2B A;  1PZJ D;  1PFB A;  4F7U G;  3EHR A;  2W0Z A;  3EFO B;  4RTT A;  1K3B C;  2L9H A;  1T3S A;  2E10 A;  3JB9 H;  2KVM A;  2OAU A;  1YNX A;  2ZZD A;  4A3C G;  1PH3 A;  4XU3 A;  4DPG A;  5HY6 A;  3PUY A;  3CPW S;  3KJO A;  1N32 Q;  3OYH A;  3I4N G;  1R4Q B;  1YHB A;  3HOU B;  2XRS D;  1X3G A;  5CKH A;  2CFM A;  5GAM h;  1U3O A;  2M51 A;  2AUK A;  3S14 H;  4B3R Q;  1AWJ A;  3CCE A;  2GQV A;  2PW5 A;  3QO3 A;  5CR2 A;  1W70 A;  1ZSZ A;  2DK3 A;  1QVG P;  1Q1E A;  4GNX B;  1RIP A;  3TP5 A;  2UUC L;  1Y7X A;  3BW1 A;  1IBM L;  4J9B A;  1SJE D;  2NVT B;  4ELZ C;  2HIV A;  3Q6S A;  5HK3 A;  3X20 B;  1IL8 A;  4POF A;  2EQU A;  1GKH A;  4AT1 B;  3JRZ A;  3D4D A;  4EX5 A;  1TG0 A;  1AWW A;  2D0O A;  5CV6 A;  1RDP D;  1ZX6 A;  2JTM A;  1EZ8 A;  4ZAI A;  1FR3 A;  1XNQ Q;  2RJD A;  3SD4 A;  3JB9 G;  4C8Q C;  3RER A;  2FPE A;  3BVM A;  3BYT B;  2Q8T A;  2EJF C;  2KHS A;  2HSE B;  2M00 A;  3GTJ B;  3PO2 B;  3DLL A;  2GQI A;  2JQO A;  3MKD A;  4FP5 D;  4XQJ A;  2NVQ B;  3TCJ A;  3DWA A;  4LDW A;  2DFU A;  1EEI D;  2JJ9 A;  1KIX A;  1GCQ A;  5CV4 A;  3RN2 A;  4A3L G;  1PRL C;  4N4G A;  4E7J A;  4DOV A;  3CCR Q;  2WII B;  1BBX C;  1BCP B;  2HT1 A;  3M0T A;  3K81 C;  2KRO A;  2XRQ D;  4EQP A;  3GF5 A;  3S16 B;  1VQ9 Q;  2HKQ B;  1IHW A;  4O0A A;  4CJ2 C;  1G3S A;  4R8N A;  2L0C A;  2LVM A;  1BDO A;  1IYU A;  4BE0 A;  4DNT B;  5IYC H;  3PF4 A;  4OON A;  3T56 B;  4JI0 L;  4OXP A;  3CCL Q;  4AH6 A;  2HD0 A;  1SYB A;  2RD1 A;  4OEL B;  2HQE A;  2VGN A;  4RKL A;  2EQJ A;  3C1E A;  1W2B S;  3BFM A;  4P71 A;  3CD6 Q;  4M7D F;  1M27 C;  1LO5 D;  2YTY A;  4B9W A;  4LMQ D;  3CC4 A;  3LH0 A;  4PJO B;  2B3G A;  1UG1 A;  3E9F A;  3OMG A;  4MIU A;  1ROD A;  4QJF A;  4M7D E;  5FO7 B;  1YJ9 Q;  1DZ1 A;  2X3W D;  2XSC A;  1OZ2 A;  2E6Z A;  1PRT F;  3GTP H;  1HXY D;  1PTO F;  4B3T L;  1QUQ B;  2JA5 H;  1DYQ A;  2NWM A;  1WYD A;  3EQL C;  2VXF A;  1A2T A;  4PJM A;  2JZ2 A;  1ESF A;  4DR3 L;  1W1F A;  3ASK A;  3JCM W;  2K01 A;  2Q2U A;  4ANJ A;  3MEW A;  1HH2 P;  4OGE A;  5I2Y A;  1YP5 A;  1OXU A;  4BY1 H;  4A3D H;  1MD2 D;  2DZ9 A;  4X9D A;  2QEX Q;  1VDZ A;  2QDB A;  4AYB B;  5IYC G;  4XTW A;  2BTT A;  3H0G G;  1NCV A;  4C8Q D;  2RNA A;  1STY A;  1JB3 A;  2KEA A;  3DM3 A;  3M4Q A;  3MHB A;  3QXE B;  2FMC A;  3R2I A;  2KMT A;  2XID A;  3CCV T;  1FVI A;  1J5E L;  1SSH A;  2NZO A;  4K6D A;  5FOB B;  4C92 C;  2K5N A;  5KYL A;  1QNU A;  1O7I A;  5ELE A;  3LGJ A;  1UFF A;  4KUI A;  4OIJ A;  1I6H B;  2E1H A;  2BZY A;  2JNG A;  2E8G A;  1XWE A;  3NUC A;  3EFS A;  2JA5 G;  1AWX A;  1U5S A;  4RH6 A;  5IXB A;  2BH8 A;  3A0J A;  3ZJY C;  4FVM A;  3VKI A;  1KQS P;  1VQ8 Q;  3CCQ T;  5GAN e;  3G71 Q;  2XKO C;  2MI6 A;  4JI0 Q;  1HJP A;  4BY1 G;  1HRJ A;  4L6T B;  4APV A;  2DA9 A;  2JOY A;  1VQ7 Q;  3AT1 B;  3KOJ A;  4BBS H;  4LDX A;  3T1Y L;  2O4X B;  4QIW E;  2VS1 A;  2BH2 A;  2O5I C;  2CZ7 B;  3SDZ A;  2AIR B;  3J7Y W;  2CZ6 B;  4OO1 H;  1A63 A;  1F77 A;  5A0L A;  2CRE A;  2ZPB B;  1LYL A;  2KRM A;  5D6W A;  4PQX A;  1SKU B;  1BBW A;  1ZUK A;  3CMA Q;  1JCK B;  1PFM A;  2QIL A;  4B3T Q;  2HQH A;  2DEU A;  4IUR A;  2X3X D;  1AZE A;  2EAY A;  5KCH A;  5AYF A;  4BE1 A;  3U23 A;  1JOQ A;  1GRI A;  1EEF D;  2K5V A;  4IN3 A;  4LD6 A;  5T1G A;  4DU9 A;  1MSH A;  3TP8 A;  4UY8 C;  2LMC B;  4A3B B;  4GN5 A;  1KL9 A;  5KYU A;  1YJW A;  4C0Z A;  2KGT A;  3RLN A;  2EXD A;  3HRU A;  1KIK A;  4AFU C;  1YHQ T;  2RJC A;  3PCO B;  4XAX B;  2JA6 H;  1CKB A;  2EIF A;  4IOA A;  2F0P A;  3HOZ H;  1UJY A;  4AFS C;  1EWC A;  4BBS G;  3M3Y B;  5D14 A;  1XTD A;  1JXM A;  1YEZ A;  4H7B A;  3H15 A;  5HK0 A;  2CQA A;  3TSS A;  5G3L D;  2KAF A;  4ZGE B;  2RVL A;  4OO1 G;  1Z6H A;  1S72 A;  2NUT A;  4LUZ A;  1A62 A;  3VS4 A;  1YZ6 A;  3PO3 H;  4O42 A;  5CBA E;  2AT1 B;  4QCL A;  5M5Y B;  1G2B A;  4JS5 A;  4FYD A;  3PUW A;  2Y0S G;  2JA8 H;  3RMS A;  4C92 D;  5FLX E;  4U68 A;  2LQN A;  2XI9 A;  2E74 C;  4PZ6 A;  5EKL A;  4MDW A;  4RGN A;  1Q12 A;  5EJW A;  3S17 H;  4IJH A;  3UE1 A;  3M4O H;  1JRI A;  8AT1 B;  3I72 A;  5HKC A;  1ZXT A;  1WX6 A;  1ENC A;  1H92 A;  1B07 A;  1RAD B;  4C2M H;  3CCJ T;  4KY5 A;  1PH7 A;  1C9O A;  1X32 A;  3EGD A;  5KEE A;  3T1Y Q;  2J7Z A;  2R7Z B;  4DR1 L;  1AH9 A;  4PLL A;  1QW1 A;  4HA8 A;  1O9S A;  4K11 A;  1X56 A;  3JAM i;  2RHX A;  3HOZ G;  4FYV B;  5EBC A;  1TWF H;  2XNA C;  2KEC A;  2Z9H A;  2MWO A;  4XTU A;  2D9U A;  1H9R A;  4DQ2 A;  1XX8 A;  2K32 A;  2FPD A;  4ZGD B;  1S5F D;  4ODG A;  2EPD A;  2COY A;  2K4Y A;  2K6A A;  4H0L C;  2R5A A;  3ULL A;  3PO3 G;  2LX9 A;  1PH8 A;  1AVZ C;  5BN4 A;  5IT9 E;  2Z6K A;  1WHM A;  2YHT A;  1BI3 A;  1PKS A;  3QR8 A;  2IT1 A;  5I6Y A;  4JZ3 A;  3GP8 A;  1OTC A;  2YUO A;  2SNM A;  1WXU A;  1PFS A;  3AU7 A;  2B2V C;  4X64 L;  4HJ9 A;  3NMZ C;  2O2O A;  1VQM Q;  4J9F A;  1Q90 A;  2VYT A;  3JSC A;  1X6B A;  3GTL H;  3ERO A;  4KK7 A;  4DEY A;  2F0I A;  2DTH A;  4E7K A;  4OEM B;  2M9V A;  1IKL A;  4BB7 A;  4M7A F;  1PYW D;  4IPH A;  5ELF A;  5KIX A;  4XIG S;  5KYW A;  1I0C A;  1VQP A;  2KCC A;  2HBW A;  3T4A C;  4GKJ L;  3REA B;  2QA4 T;  1B34 A;  4M7A E;  2FXQ A;  4M78 F;  3ZYY X;  4H02 A;  4YY3 L;  4K8I A;  4C0D C;  3R8B A;  5K36 H;  1KG1 A;  3K57 A;  3T51 B;  1I4R A;  5IOD A;  3CCM T;  4M78 E;  1HA5 A;  1UGR B;  4KY6 A;  4J5Y A;  1SRO A;  1T9H A;  2HEQ A;  4ORZ A;  2K03 A;  4BD3 A;  1D1B A;  3LLR A;  3URG A;  4OL7 A;  4LJZ C;  4OF1 A;  3V8J A;  2LQW A;  3H41 A;  3L2Q A;  1DM0 B;  1YJW Q;  1BUV T;  4H44 C;  4DR1 Q;  2YLB A;  3I4N B;  1JU5 C;  2WSF E;  3OW2 A;  3JAM L;  3L2Z A;  4XU0 A;  2WB1 E;  5J26 A;  1Q8I A;  1EOT A;  2B2T A;  3QOJ A;  2PUK B;  1NLO C;  2ZCF B;  3E0E A;  3NWS A;  1TT2 A;  1U1T A;  4B9X A;  2B29 A;  5ELN A;  1BVS A;  4RGO S;  3E3X A;  1YCY A;  1UNS A;  1I4H A;  4XTC S;  1MV3 A;  2CSQ A;  4A54 A;  4BA1 I;  1N36 L;  1II3 A;  3NEN A;  1N9R A;  1MHN A;  1UHC A;  3G6E T;  2CWA A;  4IOC A;  1EYG A;  3VUZ A;  1KNA A;  4D8D A;  1G2S A;  5KH6 A;  4LFC L;  3K5L A;  2F0H A;  2WKD A;  3HL8 A;  3M57 A;  1KJW A;  1OZ3 A;  1FNU A;  2BKD N;  1WHK A;  2HAX A;  3L2W A;  3NE5 B;  4BBR G;  2LCS A;  2A28 A;  1L0Y B;  3L0O A;  2IX1 A;  5C5M A;  3C4S A;  1OXX K;  4DKA C;  1A6X A;  3FKI H;  3CXC A;  3EVQ A;  2GTO A;  1UGQ B;  3NK9 A;  3MEV A;  1VQF A;  1I07 A;  2F0E A;  2MO1 A;  3I55 A;  3MZ5 A;  3PIP A;  2L11 A;  3S14 B;  3PVL A;  1PCX A;  2WSC E;  2PNR C;  5C4H A;  2PZ1 A;  5JOB A;  3G48 A;  4GKJ Q;  1I4G A;  2YV5 A;  5T1I A;  4J7F A;  1Z9F A;  4YY3 Q;  2XWB B;  1CUK A;  3TRE A;  2A69 D;  1V9P A;  2NUP A;  3A1P A;  1SMX A;  2E2J H;  2B63 H;  4Z02 A;  4NS5 A;  3ZEH A;  3EAE A;  4CJ0 B;  1S5C D;  1NTG A;  4R56 A;  4MZT A;  1YIT A;  3BZD B;  3TDQ A;  1B70 B;  2RH2 A;  4F88 A;  4KUL A;  4F7X A;  2KRS A;  4ZGJ B;  1A15 A;  1GD7 A;  2HQX A;  4UP8 A;  1FGU A;  5GAM d;  1MV0 B;  4IKF A;  1WHL A;  1TY0 A;  2C0I A;  3ERQ A;  1BCP C;  1A2U A;  3HTR A;  7AT1 B;  4HN7 A;  4YIJ A;  1C1A A;  1SE3 A;  3BG3 A;  1A3U A;  3HOV G;  2RQX A;  4JJC A;  4JJB A;  1H9K A;  1MND A;  1WQ7 A;  2LNV A;  4GOP C;  3RBB B;  3BVZ A;  1N36 Q;  4A4E A;  1ICF B;  4F16 A;  1YNN D;  2DF6 A;  4JK1 C;  1GUT A;  3JCM h;  3CCV A;  5J1Z A;  2PCF B;  1IW7 D;  3EFO A;  3PIP 3;  1S40 A;  4LFC Q;  4JYA L;  2L3P A;  2YXY A;  3C94 A;  4X3K A;  3OW2 S;  2QF7 A;  2F2X A;  4NKL A;  3CAM A;  2B63 G;  4A93 G;  3CCR T;  3PUZ A;  4QKU A;  1WQW A;  3CEY A;  2B2W A;  5IGD A;  4EQN A;  4PJN A;  2RJF A;  5D6X A;  1SYG A;  5FLM H;  4J6Y A;  1H3Z A;  3GOX A;  3LYI A;  1STA A;  2V1C C;  2BDO A;  2KT8 A;  3D31 A;  1VQ9 T;  4FXG C;  1M4Z A;  3VJP A;  2OTJ T;  1D6E C;  4CDC C;  3CCQ A;  4A63 B;  2DXT A;  2PZT A;  1DJR D;  2AK5 A;  3H0G B;  2WV6 D;  3QDR B;  2F2W A;  2ALY B;  1K8O A;  1PZI D;  2KED A;  3W2D A;  2K5F A;  3JV3 A;  3V8K A;  1VQO T;  1Y14 B;  3O13 A;  4LNQ A;  1Y8N B;  2MO0 A;  1BI1 A;  3A5Z B;  3CCL T;  1HTP A;  5KNB A;  1KRS A;  3OS2 A;  3W1G A;  3JCM X;  4QF4 A;  4DXF A;  1C4Q A;  2M16 A;  1LUZ A;  1VQG A;  3MTS A;  3CD6 T;  1WGS A;  5DY9 A;  3CXC S;  3GTP B;  2JA5 B;  2FHD A;  4HVW A;  4XYQ A;  1BYM A;  5IGF A;  2RHY A;  1YJ9 T;  5CYU A;  1SYE A;  4ESR A;  1Q8K A;  2LSS A;  5ELC A;  3GTK H;  2VC8 A;  4PL6 A;  1XYI A;  5TSS A;  3BE3 A;  3E9I A;  5FLM G;  1MGS A;  3HRZ C;  1FYN A;  4G57 A;  2O01 E;  4BY1 B;  4BY6 B;  5E7N A;  4KUD K;  3V7R A;  1KTK A;  1Y1V G;  2CYZ B;  2EFI A;  1YWO A;  4JZ4 A;  1YHQ A;  2KQW A;  3KUF A;  3CC2 A;  1DOK A;  2DBM A;  4F04 B;  3I3C A;  1D2B A;  2QEX T;  3SWN C;  1X43 A;  5GAO q;  2RB6 A;  1GUN A;  3IRB A;  4HCS A;  3OYL A;  1L0W A;  1B50 A;  5A0G A;  2Y90 A;  1KAA A;  2NVX H;  5CKF A;  4JYA Q;  1BIA A;  4MZM A;  1KC8 C;  3VS5 A;  1I6V C;  1ABQ A;  2F0Q A;  4C0G A;  3NQT A;  4JW0 A;  3RZO H;  1HUN A;  1CSK A;  2EW3 A;  1V1P A;  5D3I B;  1XQH A;  4RAU C;  1VQ5 Q;  2E3I A;  1QVF P;  3I8Z A;  2AWN A;  1WXB A;  1Y1W H;  3IAY A;  2LFN A;  2LDM A;  4CKE A;  1JEG A;  3S1M H;  1I5F A;  1SFO H;  1GHJ A;  1Z9Z A;  3MJX A;  1NJI R;  1NJI U;  4FW1 A;  3L3O C;  1VQ8 T;  2F0W A;  4FYW B;  1NMG A;  4KI0 A;  1V29 B;  4FW2 A;  3HOY G;  2QG9 B;  1HYO A;  3CCJ A;  5C0X J;  4RG8 A;  4BBS B;  1PV4 A;  2KYM A;  2DL8 A;  3BDL A;  5EBD A;  1BNZ A;  2IX3 A;  2VNU D;  1CSQ A;  1WYX A;  4LDU A;  1VQ7 T;  3WDN A;  4CC7 A;  1PRT C;  5LJ3 e;  2KUM A;  1PTO C;  1NPR A;  3E9G A;  4RFB A;  2IY5 B;  1TR5 A;  4R55 A;  3RLF A;  1EY9 A;  1HNZ L;  2Y0S B;  4J6H A;  1UDL A;  2E3H A;  4PJJ A;  1HFN A;  3KBG A;  1EY5 A;  4HVU A;  5KYU B;  5FRM A;  3GO5 A;  3KLS X;  5CQY A;  1N9S A;  1VF5 C;  1K83 H;  1M8M A;  3KF6 B;  4DV3 L;  1PG5 B;  1AOJ A;  4HXJ A;  1K8A R;  3OYA A;  1K8A U;  5GAE C;  1Y1W G;  1EOV A;  3K5M A;  4A3J B;  5IY0 A;  1QP3 A;  2QAZ A;  2X4X A;  1I6H H;  1NEG A;  2XIC A;  2F0F A;  2DXC A;  1CQV A;  3BYY B;  3MEA A;  2CH4 A;  2NUT B;  2IX0 A;  2V1Q A;  2N3S A;  2NVY H;  3HOZ B;  4IFD H;  1IKM A;  2AKW B;  4KKU A;  3CQZ H;  3ND8 A;  1BU1 A;  2VB6 A;  4BAC A;  3FVQ A;  2RQV A;  1BCO A;  1SNM A;  2VB3 X;  4DF7 A;  4NL3 A;  3PO3 B;  4L6V 5;  2CQO A;  5M9O A;  1EY6 A;  5GAN 2;  4HIM A;  4CRI A;  2WAQ B;  3G4S Q;  3I73 A;  3BU2 A;  2J05 A;  2TMP A;  2P4R A;  4X66 L;  3M7N A;  3M4O B;  1KQ2 A;  4CDE C;  2O2L D;  3TME A;  3EGD B;  3CCM A;  4FF4 A;  4QVD A;  1QVP A;  2I2L A;  3ZFJ A;  2L3Q A;  3VDY A;  4CKC A;  1QCF A;  2RPN A;  2NZ1 D;  5C44 G;  4C2M B;  1UGP B;  2A6H D;  2YUQ A;  1RF2 D;  3RDV A;  4XQ3 A;  2Z4H A;  3E9H A;  2BE9 B;  4L5Q A;  5GAM f;  4ZRZ A;  4M75 C;  4CGY B;  2KJX A;  4LF6 Q;  3J81 E;  5CQX A;  2XDD A;  1NNX A;  4M7D D;  2F0M A;  2NWG A;  3I4O A;  1N33 L;  4IFD G;  1AE3 A;  1TWF B;  4XT3 B;  3RNU A;  2E2I H;  2D6F A;  1M3A A;  4M77 A;  2SDF A;  3RUX A;  1E3P A;  3DLM A;  4Y7N H;  1HNZ Q;  1PRT D;  1PTO D;  2B2U A;  2JMC A;  2F3W A;  4R4I A;  1KHC A;  3CPW P;  4AG2 C;  1VQ6 T;  2FL7 A;  1GL5 A;  3NBH A;  3PSI A;  3M3Y H;  1YWP A;  2J6K A;  3FDR A;  1IGQ A;  3G6E A;  4TVR A;  1CT1 D;  2K50 A;  3JAM c;  3KBX A;  1G2T A;  2COW A;  1KLU D;  2RKS A;  4DV3 Q;  4ZTF A;  2K5I A;  4C5E A;  4JI4 L;  4DR4 L;  2PZU A;  4JI6 L;  5C5L A;  3H6M A;  1LTB D;  1SYF A;  3EFX D;  4IPC A;  2ICE C;  2RK2 A;  2QGF B;  2ZTC A;  2J06 A;  3GTL B;  4PMC A;  2YRV A;  4M77 G;  1Y0M A;  2ZTD A;  1PHT A;  3PE0 A;  1F2Y A;  1VIE A;  2OF1 A;  3IFT A;  4HSV A;  4RWS C;  3AMU A;  4DR5 L;  4P73 A;  3GNG A;  1WTV A;  2BE5 C;  3Q24 A;  5JEA H;  1SPK A;  3E19 A;  1JOO A;  3H0H A;  2XHC A;  1U8R A;  2EYL A;  3OW7 A;  2DN8 A;  4D8K A;  2EYP A;  1HHV A;  3X3N A;  4CKB A;  3CKI B;  5M3F G;  1MNE A;  3HPW A;  1X65 A;  4JC0 A;  1DGS A;  4X66 Q;  2JA7 G;  2ZT9 C;  4DV5 L;  5I22 A;  2RM4 A;  4RG2 A;  4BBR B;  1TTH B;  4FIB A;  4M7D G;  2MPM A;  2EGE A;  1K8M A;  4R0K A;  1PH2 A;  3PUV A;  2SRC A;  1EYC A;  2HHH L;  2R93 H;  2EQM A;  1M1G A;  3LGF A;  2HNI A;  4O2D A;  5HGQ A;  3OBW A;  4LE9 A;  1C8C A;  3CPF A;  3I56 T;  1CI3 M;  3K6O A;  3OYM A;  2BZX A;  1CHP D;  4QB4 A;  2JUF A;  3DEP A;  1JJG A;  4JOI A;  4FSS A;  3MEH A;  4PFP A;  3WXM B;  4J15 A;  3CCU Q;  2BZ8 A;  4OB1 B;  1RHP A;  2ZXO A;  3FPU B;  5JEA G;  1JOR A;  3NTK A;  1EX4 A;  4JRQ A;  2P5Z X;  1GJX A;  1Q3L A;  1ZSZ C;  4ME7 A;  3GIB A;  1LV9 A;  1NBW A;  1TUC A;  1JO8 A;  4QQD A;  1SXT A;  4DK3 C;  2KDS A;  2QA4 Q;  1IHZ A;  2F0L A;  2MIO A;  1DCZ A;  3F70 A;  4JI6 Q;  1JT8 A;  5GAO m;  2F0S A;  1W2B P;  1SDF A;  4ZKC B;  1E1T A;  1AEY A;  2Y4X A;  3CCR A;  1E2W A;  1X75 C;  1QE6 A;  3C0C A;  3NBI A;  4L5T A;  5CGK A;  2NN6 I;  1D0Y A;  4OIK A;  2R93 G;  1K28 A;  4M7A C;  3HFO A;  1VQ9 A;  1OXT A;  2ZXP A;  2OTJ A;  2VUM H;  2LT1 A;  2E2H H;  5ISR A;  2WFW A;  1PHJ A;  1STH A;  4M78 C;  4C3I G;  3EG0 A;  5A0D A;  2NUP B;  4JJN K;  4N8X 1;  4NB3 A;  4JI1 L;  1PZK D;  2O5J C;  1VQO A;  2EQS A;  3PIO A;  4P74 A;  1X69 A;  3RNJ A;  2BE5 D;  3CCL A;  4RKU E;  4F7U A;  1Y96 B;  3K8A A;  4OMN A;  2PI2 E;  1EZ6 A;  4FYY B;  2JM9 A;  1CM9 A;  2ENB A;  5EAY A;  3T1H L;  2E2J B;  1WNL A;  2B63 B;  4A93 B;  4OMM A;  5GRO A;  4DV5 Q;  3CD6 A;  4IIO A;  2QTV A;  5KYN A;  2Q2T A;  3JCM b;  3EFR A;  1BCP F;  5LHY 1;  2UU9 L;  3ND9 A;  4OML A;  1STB A;  1Y07 A;  1YJ9 A;  4R1J A;  2CKZ B;  2HHH Q;  3KK7 A;  4KKS A;  1IHV A;  1F2L A;  1UEB A;  1X01 A;  3VYT A;  3MP8 A;  1PNJ A;  5GAN g;  3A8G B;  3QSU A;  2A1A A;  3J80 E;  2DY8 A;  3U4V A;  5C4X G;  2FHT A;  5C6S A;  1ASY A;  4B3M Q;  1TUD A;  3A98 A;  5KE3 A;  2A0F B;  2VUM G;  2E70 A;  1AD5 A;  1NJI C;  4CDF C;  4QUF A;  3L42 A;  4TKO B;  4JI3 L;  4PMW A;  2CGH A;  2K7A A;  1PH6 A;  3L2V A;  3CF5 A;  1PH1 A;  4FT4 A;  3L2R A;  3WWV A;  2V26 A;  1BI2 A;  2QEX A;  1VQN Q;  3AQQ A;  4GN4 B;  4HAE A;  5LMN W;  1VQJ A;  1HK9 A;  4E2F B;  3H3V H;  4PJO F;  3MO8 A;  5C6A A;  4A4K A;  2D62 A;  4A76 A;  3M0R A;  1SSO A;  1EL0 A;  1GUS A;  5GAM e;  2EYZ A;  1Q7Y R;  4PJO E;  1Q7Y U;  2E5Q A;  1HPC A;  4FCY A;  3SHW A;  1NUC A;  1WA7 A;  2FFK B;  1YNJ C;  3PIO 3;  3A8M B;  1I5L A;  2E75 C;  3F8T A;  1EFN A;  1Q1B A;  2QYZ A;  4A3L H;  1K0X A;  4LFB L;  2A36 A;  3M7G A;  3PFS A;  2OAW A;  3CQT A;  1TWH B;  1VYT A;  1XXG A;  2DJF C;  1K8A C;  1R0B G;  1Q81 R;  4M1U B;  1Q81 U;  1B9N A;  1FNV A;  3RMH A;  3U9S A;  5IIF A;  1KXL A;  2GVB A;  1VQ8 A;  2RK1 A;  3P7J A;  4M7A D;  4WCI A;  3G71 A;  4JI1 Q;  1ZYR C;  2G6F X;  1JQQ A;  3DMU A;  5FLX L;  4OMO A;  4HCE A;  5KE2 A;  2YRD A;  2PVD B;  4ID6 A;  5DNF A;  4AYB E;  4RTU A;  4M78 D;  1E2Z A;  4IUT A;  3OYG A;  1SBB B;  1VQ7 A;  3JCM Q;  3DXJ C;  3Q23 A;  1G91 A;  3T1H Q;  1UUE A;  4QQ6 A;  4J9I A;  3D6C A;  1UE7 A;  3EG9 A;  4DBF A;  5CMD A;  3R6O A;  1O7L A;  4F8M A;  2ES2 A;  5C3E H;  2UU9 Q;  3EHQ A;  3GTK B;  3HKZ E;  4DV6 L;  1WZO A;  4D6W A;  3CMA A;  3QO2 A;  5FWB A;  5CCA A;  4JS4 A;  2JP1 A;  1YHA A;  2W10 A;  3TQY A;  3NGP A;  3MET A;  1J6Q A;  2F0G A;  2FVU A;  1VQI A;  4IUU A;  2XWJ B;  1ILP A;  1TSF A;  2ZM6 L;  2O9S A;  3E6Z X;  3F2C A;  3RR6 A;  4NXN L;  2GFU A;  2OTJ Q;  2E2D C;  1GFD A;  2QW7 A;  1RAB B;  1TVX A;  5EG2 A;  3VR4 A;  1L0X B;  1V1P B;  3ULJ A;  3CME Q;  5IT9 L;  2CP7 A;  1VQO Q;  3CBO A;  4JPB W;  3FP9 A;  4ILW A;  1KNE A;  3H0G H;  2NVX B;  3HOX H;  1TU0 B;  1FD7 D;  5FU6 C;  3RZO B;  5C4J H;  3HP9 A;  1TWC H;  2A19 A;  2F4V L;  2LTO A;  4EIK A;  2VW9 A;  2MFI A;  1B3A A;  2O9V A;  4KY7 A;  5C3E G;  4C5G A;  1L1O B;  4DA2 A;  3RZD H;  2UUC Q;  1WTR A;  4K6L A;  1YI2 Q;  4FL6 A;  5ECA A;  4LFB Q;  1Y1W B;  1IBM Q;  1STN A;  4QW2 A;  1VQ5 T;  1YNJ D;  3RMQ A;  4I7A A;  3S1M B;  3PT9 A;  3P8B B;  1SFO B;  1AP0 A;  2K05 A;  2ZJP A;  1LCK A;  3OSS C;  2E41 A;  3OYE A;  2LXJ A;  1UTI A;  3ME9 A;  4KH0 B;  2PQW A;  1EU3 A;  3KFV A;  3QKJ A;  2KXD A;  5L8R E;  3UI2 A;  1PA6 A;  1K0R A;  2XIW A;  4QVC A;  2DYB A;  1SNQ A;  2IIM A;  3H94 A;  1B8A A;  1BF4 A;  4ZTJ A;  1CK1 A;  1TXQ A;  1WTX A;  1ZBX A;  1HNX L;  2E65 A;  4ZNX A;  2HMA A;  1D09 B;  1R0C B;  3OA6 A;  1E22 A;  1I3Q B;  2WB1 G;  4RTV A;  2YRC A;  2EVB A;  2RCF A;  1KLG D;  4HSP A;  3HOX G;  1K73 C;  2K75 A;  1PH9 A;  1RAF B;  4NP5 A;  4A3M G;  2A3L A;  1BOS A;  2JEA I;  3KFU A;  4XK8 E;  4DV6 Q;  1K83 B;  1U5K A;  3S3N A;  2K2M A;  3EH1 A;  3ER0 A;  1PMR A;  2HKN A;  2Z1C A;  4P2C B;  5C44 B;  1SAP A;  3TSW A;  2GCX A;  2DL3 A;  5GQO A;  1TS5 A;  2EYQ A;  1I4X A;  4HIO A;  2CZ0 B;  1UEA B;  1SYC A;  2ZM6 Q;  4ZKB B;  4KN7 C;  2K5Q A;  5LJ3 d;  3BJU A;  4MN3 A;  4NXN Q;  3CBM A;  4N4I A;  3OHX C;  2NVY B;  4Q0F A;  4ZUI A;  2LMJ A;  1H3H A;  4JRK A;  4XDX A;  3CQZ B;  4JLI A;  1HCZ A;  1SE8 A;  2EJG C;  1VQM A;  1JWS D;  1NEB A;  5FU7 B;  1EFI D;  3ICE A;  4C8Q A;  1WJJ A;  3SGI A;  3V7C A;  2A8V A;  1WCM G;  2EJF A;  4RTY A;  3CCS Q;  2K1B A;  2ESW A;  2FYK A;  2WSE E;  4LNP A;  2YTV A;  5AT1 B;  1EUJ A;  2EGC A;  3FIF A;  4M75 F;  3G4S T;  2JYO A;  4RCC A;  5GAN 4;  2LXK A;  2FG0 A;  2PMZ B;  3BS1 A;  1IYJ B;  4RGM A;  4X3S A;  4LUV A;  2Z6K C;  4M75 E;  1B7T A;  1YIJ Q;  4HCC A;  4F87 A;  1RAI B;  3D8G A;  3MXP A;  4M77 B;  3FMC A;  1X55 A;  4AIM A;  2QGQ A;  4DR3 Q;  1A0I A;  3SEM A;  2F0J A;  4C8Q G;  1GCP A;  5CBE E;  3Q8D A;  2IHE A;  4LWC A;  1NE8 A;  1TQO A;  2E2I B;  2KQ3 A;  2LQK A;  3NBH B;  1EZZ B;  2DVJ A;  2DYI A;  1QP2 A;  2HDA A;  1IXD A;  1D8L A;  1U4L A;  1HNX Q;  4Y7N B;  3FPP A;  3KF6 A;  5M3F B;  4E6R A;  2XD0 A;  3TVT A;  3DWQ A;  4OMF B;  2JA7 B;  2QK0 A;  1RLQ C;  2L15 A;  4KD4 A;  2QCP X;  3VA7 A;  1J5E Q;  2PPB C;  2MP1 A;  2VQE L;  3A8O B;  2DL4 A;  4C3J H;  4M7D B;  2JMA A;  2QI2 A;  2QQS A;  4J9D A;  3K58 A;  4WF2 A;  3OBY A;  4P5N A;  1G3T A;  2NB0 A;  1PLF A;  1TWB A;  3A7L A;  2IHF A;  1JOK A;  2RQW A;  2F1L A;  3RES A;  4XQN A;  4POG A;  2XGT A;  1VQC A;  2DNE A;  1RUW A;  4B3S L;  4G4K A;  1F9R A;  3REB B;  3E0J A;  2KOL A;  2FRY A;  3CC7 T;  4YWK A;  4ABN A;  3RLO A;  4EVO A;  3OS5 A;  2B39 A;  1N8R R;  1N8R U;  1SF9 A;  2B2T C;  1PH5 A;  4J9G A;  3BY7 A;  3A7A B;  3QWN A;  1PKT A;  4DR7 L;  4H13 C;  3UF4 A;  5C0X I;  3QJY A;  3MCA B;  4XTX A;  4A4F A;  2JSO A;  4R4O A;  4Q5V A;  4DV7 L;  1CFM A;  2RDG A;  3WVD B;  4R9W A;  3S15 H;  3QYG B;  4LW1 A;  1CA5 A;  1VQ6 Q;  4C3J G;  4C92 A;  1FWZ A;  2EDG A;  4KV6 A;  1EIH A;  3FEW X;  2H4O A;  1Q7Y C;  2DJZ A;  3EH2 A;  2K57 A;  4N9P A;  4J6W A;  2CP6 A;  2R93 B;  2K6D A;  3JCM c;  3A8L B;  3MFY A;  3JB9 F;  3OW2 P;  5E3F A;  3VR3 A;  1R77 A;  1ZA1 B;  1SLJ A;  2R92 H;  3RKY A;  3TSZ A;  2XDB A;  3CHB D;  4IPD A;  5CVI A;  4JCV E;  2G9D A;  4JI7 L;  3AFQ A;  1K9M R;  1JJ2 A;  1K9M U;  1PD1 A;  2MQH A;  3HRS A;  4WJW A;  3OQ5 A;  1I4P A;  3P75 A;  4QIW B;  2DJQ A;  2XDP A;  3GD7 A;  1ZUU A;  2K5L A;  4ZUJ A;  1J8I A;  2EE1 A;  2KY9 A;  1IGU A;  5IGE A;  5ELO A;  3CCU T;  1MJE A;  4C92 G;  2VQE Q;  4F14 A;  1ARK A;  5CK9 A;  4I7Z C;  3GTM H;  2ZGW A;  2FMM A;  3VR2 A;  3H0I A;  2F4I A;  4WOR A;  5IOC A;  4FM4 B;  1KSW A;  4XTZ A;  1SEB D;  2K52 A;  3FHW A;  5J3B A;  4RCN A;  1XPU A;  1KK7 A;  1X6G A;  4K5V A;  3L7Z C;  1M1K R;  1Z7T A;  1M1K U;  4GY5 A;  1XJV A;  5C4X B;  4A3F H;  1D1A A;  3CXC P;  5IHI A;  5COY A;  1LTL A;  2QQB A;  3NHN A;  4B3S Q;  2VUM B;  2R92 G;  1ZBJ A;  2YUP A;  1BB9 A;  1D1K A;  4BBR H;  2E2H B;  4F7U B;  1VIF A;  1H8K A;  2DL7 A;  4MML A;  2AUJ D;  5JPM C;  1VQB A;  3AEV A;  4OB2 B;  2B8A A;  1MMD A;  3I56 Q;  2VL6 A;  2ZXR A;  5I9O A;  1KDA A;  4DK0 A;  4GLV B;  3FRN A;  4DR7 Q;  4EMK C;  3OMC A;  2QKI C;  4PZ7 A;  5GAO n;  1VQ4 T;  2CZ1 B;  3I5S A;  5GAH C;  4DV7 Q;  3L2P A;  2KVQ G;  2HQL A;  5EPK A;  1WFW A;  1M8V A;  5FRO A;  4K8J A;  3TEH B;  2NTS A;  2G9H D;  3OOC A;  4KGV B;  5FLX c;  1MBY A;  4PK4 A;  3FDT A;  1FX7 A;  1NPP A;  2B2W C;  4FXD A;  4RG1 A;  2QQ9 A;  1VQE A;  3GPL A;  1XPR A;  3OS0 A;  2A6E C;  1D1C A;  2J0T D;  1JC7 A;  4A3F G;  2DEQ A;  5LJ3 f;  4HT9 A;  3PVQ A;  1LM0 A;  4QMG A;  5C4Z A;  4X64 Q;  4JBK A;  3EJI A;  4KRT A;  1HQM C;  2B2Y C;  4GNX C;  2XN9 C;  2KK4 A;  5I11 A;  4DOW A;  3G7L A;  2F5K A;  4PMB A;  4L63 B;  3K7U C;  3UT1 A;  5LJ3 g;  4L8J A;  2E5L L;  4X62 L;  5KYY B;  1VCI A;  1N5Z A;  3VRZ A;  1VQN T;  3HOV H;  2E4H A;  1SNP A;  3INZ A;  2HD3 A;  1TS3 A;  3HOU G;  1ENA A;  1OO9 B;  3NQI A;  3PO2 H;  5IP7 G;  2DNC A;  1LJO A;  4WJ3 M;  1QKW A;  1PRM C;  1PYB A;  2WP8 J;  1JJ2 S;  2EQK A;  5IT9 c;  1XMO L;  3HOW G;  2H3J A;  1SMY C;  2F1M A;  1QCN A;  2X51 A;  4UC4 A;  1VQ5 A;  1KDB A;  4A93 H;  4OWW B;  3EG3 A;  5HGT A;  4KN4 C;  5GMK m;  2LT4 A;  3UA7 A;  1PXU A;  4GKK L;  1Y96 A;  3M54 A;  3E1S A;  1CKN B;  5JPN C;  5JJI A;  1NM7 A;  3THK A;  3R93 A;  3EG9 B;  1R4P B;  2NZH A;  2RBM A;  2B8F A;  2UUB L;  1RAE B;  4NW2 A;  2A5H A;  1S4Z A;  2RCN A;  5GMK j;  4ZCK A;  3SK6 A;  2PNI A;  5DLQ E;  5CR3 A;  4WTO B;  1XOV A;  1LTS D;  2EJ9 A;  1ZLM A;  1DON A;  2VVK A;  5GAO l;  3A74 A;  5D65 A;  2VQF L;  2JXB A;  5C3E B;  3EN2 A;  1YJN Q;  1XNI A;  1X3E A;  1S3O A;  3J7A F;  1HD3 A;  1FXX A;  3I7F A;  4MNO A;  4F17 A;  4DV2 L;  3CU7 A;  5D6Y A;  1CTM A;  4R8I A;  2LQ8 A;  2N55 A;  5M5X H;  3J81 L;  5IAY A;  4CC2 A;  3JCM e;  3OWF A;  1ZEQ X;  4JLG A;  3I2Z A;  4OVA A;  4EPC A;  2WKC A;  2X4Y A;  5BN3 A;  5GMK h;  2RI2 A;  3G1J A;  2F0T A;  2F5T X;  2FZG B;  5JVH 3;  3I70 A;  2CUB A;  4OX9 L;  4HCZ A;  1SN8 A;  4PJO C;  3GTG H;  3STB C;  1TXY A;  1EY8 A;  4E47 A;  1TWH H;  2WB1 B;  3TP6 A;  1VQK T;  1Y1V H;  2NBF A;  4DAY B;  2KCM A;  1SJH D;  3DB4 A;  4X62 Q;  2E5L Q;  1ENF A;  3HOX B;  3CME T;  4A3M B;  5C4J B;  1TWC B;  2JN4 A;  3QZ5 B;  2HBP A;  5FKA C;  3MVV A;  3RZD B;  5IE8 A;  4CJ1 B;  4TVA B;  5KGU A;  4GLM A;  4MZ9 A;  2Y0S E;  1GUW A;  1XMO Q;  2PQE A;  5DLO A;  3I4L A;  1QWY A;  2A68 C;  3EGX B;  1D3B A;  3G4S A;  1YI2 T;  2RMO A;  3M9Q A;  2K7V A;  2PUO B;  3DWP A;  3L2U A;  3LW5 E;  1OYX A;  4GKK Q;  1SMY D;  4YCW A;  4ALP A;  5L37 A;  1SG5 A;  4IUN A;  1M8A A;  4C3H H;  5ELD A;  1W6J A;  1B3Q A;  1U1S A;  4C56 C;  4UP9 A;  4FT2 A;  1UEC A;  1K8G A;  4LF8 L;  4HT8 A;  2MNA A;  1FNW A;  2F2V A;  1GFC A;  4KKT A;  2VXW A;  3P1H A;  3HOY H;  3JB9 I;  3JCM V;  1VF7 A;  2K3Y A;  2VQF Q;  1HUM A; 
#chains in the Genus database with same CATH homology
 4Y92 A;  2EGE A;  3ULR B;  4R0K A;  3NPF A;  2SRC A;  2CT3 A;  4X1V A;  2SEM A;  1M27 C;  4LE9 A;  2ED0 A;  2LNH B;  1UG1 A;  2BZX A;  2O88 A;  2X3W D;  4FSS A;  3ZL7 C;  2DE0 X;  1E6H A;  2M0Y A;  2BZ8 A;  2NWM A;  5FWC A;  1VYU A;  2RQT A;  5GJV B;  1W1F A;  2ABL A;  1TUC A;  1JO8 A;  2MIO A;  1YP5 A;  4RUG A;  1AEY A;  2BTT A;  2RNA A;  3C0C A;  2KEA A;  1SSH A;  4Z8A A;  3QWY A;  1RI9 A;  3EG0 A;  1UFF A;  2BZY A;  1X69 A;  3RNJ A;  1UGV A;  1AWX A;  1U5S A;  5IXB A;  4OMN A;  1NG2 A;  2JM9 A;  3VS0 A;  4J9C A;  2LZ6 B;  4OMM A;  2FO0 A;  1HJD A;  4IIO A;  4CC4 B;  1G83 A;  2DA9 A;  4OML A;  2EGA A;  2RF0 A;  2MOX A;  2K9G A;  4AG1 C;  2GNC A;  2KXC A;  2LJ1 A;  1PNJ A;  1QWE A;  2CRE A;  1TUD A;  1GBQ A;  3A98 A;  2KRM A;  1AD5 A;  4LN2 A;  1I1J A;  1ZUK A;  4LUD A;  1QLY A;  2K7A A;  2X3X D;  1AZE A;  3U23 A;  1GRI A;  2L0A A;  1K1Z A;  3M0R A;  2EYZ A;  2KGT A;  3FJ5 A;  4J9H A;  3SHW A;  1WA7 A;  2KR3 A;  2DRM A;  5GJW B;  4AFU C;  1KIK A;  1EFN A;  1CKB A;  4LUE A;  3GBQ A;  1K0X A;  1UJY A;  2A36 A;  4AFS C;  2OAW A;  1JXM A;  1X2Q A;  3CQT A;  1VYT A;  2MCN A;  1CKA A;  2KT1 A;  2B86 A;  3VS4 A;  4WCI A;  3R6N A;  2G6F X;  1G2B A;  1JQQ A;  3VS6 A;  1T0J A;  4OMO A;  4RTU A;  2LQN A;  3M0P A;  1UUE A;  2VWF A;  4J9I A;  1WX6 A;  1H92 A;  1B07 A;  1UJ0 A;  3EHQ A;  5IHK A;  4JJD A;  5FWB A;  1IO6 A;  4K11 A;  2FEI A;  2W10 A;  3NGP A;  1ZUY A;  2KNB B;  1QWF A;  4GBQ A;  1M3B A;  2DX1 A;  5IH2 A;  5IHN A;  2O9S A;  1X2K A;  2FPD A;  2EPD A;  2C0O A;  1GFD A;  2AZV A;  1AVZ C;  5FW9 A;  3I5R A;  3M0Q A;  4JPB W;  2DIL A;  4Z89 A;  1PKS A;  1E6G A;  2ENM A;  4JZ3 A;  2YUO A;  1WXU A;  4EIK A;  2O9V A;  2KYB A;  3NMZ C;  2O2O A;  4J9F A;  1X6B A;  2KE9 A;  5ECA A;  4DEY A;  2CSI A;  1LCK A;  1UTI A;  1Z9Q A;  3KFV A;  1M3C A;  2KXD A;  1I0C A;  2HBW A;  2JS0 A;  3REA B;  2AKK A;  2DYB A;  1HSQ A;  2IIM A;  2KBT A;  1OPL A;  2HSP A;  1A0N B;  4ZNX A;  2HEQ A;  4ORZ A;  4RTV A;  2D1X A;  3VRY A;  2RQU A;  2LQW A;  3H41 A;  1K9A A;  1UE9 A;  1WXT A;  2RN8 A;  4Z88 A;  4J9E A;  2K2M A;  1SRM A;  1JU5 C;  3TSW A;  2RQR A;  3EGU A;  1Y57 A;  2DL3 A;  4RTX A;  1NLO C;  2YUN A;  2XMF A;  1MV3 A;  2CSQ A;  2LMJ A;  1H3H A;  1OOT A;  1NLP C;  1UHC A;  1NEB A;  1GCQ C;  4D8D A;  2LJ0 A;  1OEB A;  4RTY A;  1KJW A;  2DM1 A;  1OPK A;  2A28 A;  2ESW A;  2LCS A;  1AWO A;  1K0S A;  2A08 A;  1K76 A;  4LNP A;  2QDL A;  2KRN A;  2EGC A;  2AKL A;  2YSQ A;  2FG0 A;  2GTO A;  2EYY A;  2OI3 A;  1I07 A;  2DBK A;  3PVL A;  2I0N A;  2ECZ A;  2PZ1 A;  2H8H A;  2EQI A;  2J7I A;  1SHF A;  3SEM A;  1NYG A;  1GCP A;  2JTE A;  4RTW A;  3VS2 A;  2DVJ A;  2DNU A;  2HDA A;  1ABO A;  2CH4 W;  1V1C A;  1WLP B;  4E6R A;  1T0H A;  2EVR A;  3TVT A;  2J6F A;  3LH5 A;  1RLQ C;  2KRS A;  2DL4 A;  4M4Z A;  2JMA A;  1MV0 B;  4J9D A;  2C0I A;  1S1N A;  2GTJ A;  1U06 A;  4JJC A;  4JJB A;  2LP5 A;  2RQW A;  4CC3 A;  3RBB B;  1SHG A;  3VS1 A;  2CUD A;  4F16 A;  2DF6 A;  1RUW A;  3REB B;  2FRY A;  2L3P A;  1RLP C;  1VYV A;  2F2X A;  2CDT A;  4QT7 A;  4IIM A;  4J9G A;  1SRL A;  1PKT A;  3UF4 A;  2YT6 A;  2KT8 A;  2FRW A;  2LJ3 A;  4A63 B;  2GGR A;  2E5K A;  2AK5 A;  3I9Q A;  5L23 A;  1W6X A;  2F2W A;  4OMQ A;  3JV3 A;  1E7O A;  2K6D A;  1ZSG A;  1YN8 A;  3TSZ A;  2JT4 A;  3EG2 A;  4HVW A;  3M0U A;  2ROL A;  4AFZ C;  2DJQ A;  1ZUU A;  4ESR A;  3UAT A;  4F14 A;  1ARK A;  1T3L A;  2EYX A;  1FYN A;  3H0I A;  1FMK A;  1KSW A;  1X6G A;  1VA7 A;  1MUZ A;  1YWO A;  4JZ4 A;  5IXF A;  2HCK A;  2DBM A;  2A37 A;  1X43 A;  1PWT A;  2L3S A;  5IHI A;  1QKX A;  1M30 A;  3NHN A;  1OV3 A;  1ZBJ A;  1BBZ A;  1BB9 A;  2YUP A;  2DL7 A;  1H8K A;  3VS5 A;  1ABQ A;  2JM8 A;  2JW4 A;  2O31 A;  4OMP A;  1CSK A;  2EW3 A;  4RTZ A;  2AZS A;  2EKH A;  2K3B A;  4HCK A;  1WXB A;  3I5S A;  2DMO A;  1JEG A;  2GBQ A;  1WFW A;  2C0T A;  2D8J A;  1Z9Z A;  2VKN A;  2ROT A;  2DLP A;  2KYM A;  2DL8 A;  2OJ2 A;  1UHF A;  1WYX A;  3O5Z A;  4CC7 A;  2YDL A;  3QWX X;  2EBP A;  2J6O A;  5HCK A;  3PVQ A;  1SEM A;  2PTK A;  4KRT A;  1UDL A;  5EC7 A;  4AFQ C;  4HVU A;  5I11 A;  2FPF A;  1M8M A;  1WI7 A;  2LX7 A;  4HXJ A;  1AOJ A;  1N5Z A;  3VRZ A;  3VS3 A;  1J3T A;  3M0S A;  1NEG A;  1QKW A;  1YCS B;  2D0N A;  1PRM C;  1KFZ A;  2CH4 A;  2V1Q A;  1BU1 A;  2EYW A;  3EG3 A;  1NYF A;  1YNZ A;  2RQV A;  3UA7 A;  2DL5 A;  1NM7 A;  3THK A;  3UA6 A;  4HVV A;  2J05 A;  2W0Z A;  3EHR A;  4RTT A;  1T3S A;  2P4R A;  2PNI A;  1XOV A;  1ZLM A;  3I35 A;  1BK2 A;  2VVK A;  1K4U S;  1WDX A;  2ED1 A;  2L3Q A;  2JXB A;  1AZG B;  1QCF A;  2RPN A;  1U3O A;  2M51 A;  1AWJ A;  1HD3 A;  2YUQ A;  4F17 A;  2D8H A;  3EG1 A;  1W70 A;  1X27 A;  1GBR A;  4CC2 A;  3H0F A;  2L2P A;  1WIE A;  4DEX A;  4J9B A;  1M3A A;  3VS7 A;  2CUB A;  1TG0 A;  2JMC A;  1AWW A;  2DRK A;  4AG2 C;  1GL5 A;  1ZX6 A;  1YWP A;  2J6K A;  2JS2 A;  2K79 A;  2FPE A;  2GQI A;  2J06 A;  4GLM A;  1JXO A;  1Y0M A;  1PHT A;  3IQL A;  1GCQ A;  3PE0 A;  1PRL C;  2RMO A;  2NUZ A;  3M0T A;  1SPK A;  2KRO A;  3H0H A;  1B3Q A;  4D8K A;  1UEC A;  2F2V A;  1GFC A;  2CT4 A;  2V1R A;  5I22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...