5GAMh

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
82
Chain Sequence
b'MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 82
sequence length 109
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamh00
4F7UF 5LJ3g 3SB2A 4NL2A 2QTXA 2RM4A 5CAIA 4M7DC 2DZ9A 4MMLA 2FYKA 3RESA 5GAN5 4N0AC 2CGHA 3INZA 5GAN8 3JB9F 3JCMh 4M7AA 5GAOq 2E1HA 4XU3A 1BIAA 4M75D 4XTZA 4C92A 3JCMW 4C8QC 3V7SA 1WPYA 2Y90A 4M78A 4M7DD 4RCCA 4J6YA 3JCMV 5GMKj 1WQ7A 4EMGA 2RD1A 4M75G 3V7RA 5GMKi 4XTWA 5GANh 3EFSA 4M7DB 3RKYA 2ZGWA 4XU0A 2I2LA 5GAMg 4EMKC 5LJ3h 4M77F 4C8QD 5GAMj 2EJFA 5GAN7 4OP0A 4PJOA 4M75E 4M7DE 2DXTA 1HXDA 1D3BB 3JCMc 4C8QB 4F7UG 5LJ5j 3JCMP 3QO3A 5GAOl 4JRIA 2JN0A 2YLBA 2FB7A 4MMKA 2EAYA 1MGQA 2EWNA 5GMKl 3JB9D 3JB9I 4EMKB 4M77C 5LJ5e 1M5Q1 3SWNA 4A53A 4C8QE 5GAOr 4F7UE 4WF2A 2HNIA 4JLIA 2E65A 4J6XA 1M8VA 4DQ2A 4J5YA 4X9CA 5GAMd 5GAMf 3HFNA 4M78F 2YLCA 4XTVA 1I81A 1U1SA 2K57A 4F7UB 4M75A 2E41A 4M77D 4Y91A 5LJ5d 5GAN6 5GAN2 2E64A 4JUVA 5LJ5f 3RKWA 4M7DG 1YCYA 4N0AA 4M77B 3JCMJ 1Y96A 3V7CA 4PJOF 2DTOA 3RKXA 4RCBA 4XTXA 4C92C 5LJ5g 3EFRA 5GAOp 4M78C 1B34A 1KQ2A 4F7UA 3JCMe 4C8QG 3JB9H 1LNXA 2YHTA 1I8FA 2EJ9A 3VU3C 5GMKh 4HT8A 2VXEA 4XTUA 5GANe 1I5LA 1LOJA 3L2ZA 4M78D 2DVEA 4QVDA 4PJOC 2E10A 1KQ1A 3BY7A 4M7AB 5I21A 5GAMh 4XU2A 3RIRA 4J6WA 4NOYA 3RUXA 1N9RA 4C92B 3JB9G 4M7AF 4M78B 4C92F 1JRIA 3HFOA 5LJ5h 4HT9A 4M7DA 2DZCA 5GAOm 4HA8A 2VC8A 3QSUA 4PJOD 3BW1A 3JCMQ 3SWNC 4M78E 2VXFA 2RA2A 2DXUA 2DKGA 2DTHA 4M77G 3M4GA 5GMKm 4V2SA 4A54A 5GAN4 5GAOn 2DJZA 4NL3A 4PJOB 4PNOA 4M7AC 1H641 3FJPA 1BIBA 1U1TA 1D3BA 3V8LA 4C8QA 1N9SA 4M75C 1HK9A 3V8KA 4JRKA 5GANj 3AHUA 1WQWA 4M77E 3FB9A 5LJ3j 4PJOE 1X01A 3BDUA 1JBMA 4EMHA 4EMKA 4X9DA 4M7AD 3SWNB 1TH7A 2RB6A 3L1AA 4C92D 5LJ3e 4XTYA 3JCMd 5GAN3 4M7AG 2EJGA 3JCMf 4XQ3A 4C92G 3JB9J 4M78G 2DTIA 3V8JA 4M75B 3BFMA 1WNLA 1LJOA 4M75F 5GANd 3QHSA 4M7DF 5GANf 3HSBA 3QUIA 5DY9A 5LJ3d 2DEQA 3JCMg 5GMKe 5LJ3f 3JCMX 3RERA 4M7AE 4M77A 4C92E 1Y96B 3GIBA 4PJOG 3FIFA 3PGGA 4QVCA 3JCMb 5GANg 1B34B 4XU1A 4C8QF 5GAMe 1I4K1
chains in the Genus database with same CATH superfamily
3SFMA 1PWTA 1W2BA 2RM4A 3PMIA 1JXOA 3CCQA 2CUDA 3DLMA 1N8RU 5D6WA 3TCJA 3I56Q 3H8ZA 3H0IA 4M7DD 1VQ5T 2DRMA 1UGVA 4KRTA 2CP0A 3H0FA 3EFSA 1M27C 2I2LA 3BE3A 3OBYA 4PJOA 1X2KA 1WJSA 3EHQA 1VQMQ 2KRSA 4HXJA 1Q7YR 1K9MC 2KROA 4JRIA 1YCSB 2YLBA 2EAYA 1MGQA 3EFOB 1VQPA 3OYFA 1U3OA 5KYXB 3RMSA 1EFNA 2RK2A 3CCVQ 4E7ZA 2D8HA 4JJDA 3CD6A 1K0SA 1UHFA 1Y57A 3PTAA 2X9HA 2K3BA 2YUOA 5CQXA 4KGVB 3KBGA 1JJ2S 4A4GA 1F1BB 4C0GA 2ATCB 4PJJA 3C12A 4M78D 1IHWA 4Z02A 5IHNA 2LQNA 1K9MU 4RTWA 1JXMA 3EGDA 4BDYA 2GFAA 4MDWA 2E6ZA 4M7DA 3OYGA 4IUTA 1M2OA 1B07A 2KT8A 2Y4XA 2A37A 2O4XA 4JRKA 3L2VA 2XHCA 1NM7A 1X01A 4A4KA 4EMKA 1VQLT 1VQNQ 5GAN3 3EG9B 1TTHB 2NUTB 2GF7A 3CCRA 2KSSA 1K76A 4N4IA 3G6ET 3QHSA 3HSBA 3RERA 4PFPA 2KAFA 2COZA 4PKCC 3EG3A 1RI9A 3C4SA 4C8QF 1M4ZA 2OTJT 3CCMA 2A3LA 2PZ1A 3P8HA 3QDFA 2O9SA 1BU1A 2L3RA 3OMGA 2OAWA 1RUWA 3E19A 2HEQA 1JO8A 2EBPA 2J05A 1X27A 4M78A 3MP1A 2MWPA 3SDZA 1EIFA 1TG0A 1O75A 2DJQA 1VQ4T 4UC4A 4ZN1A 1IRXA 3PVLA 3LH0A 2K2MA 2GTJA 3HHTB 1D3BB 3R6OA 2B86A 5FROA 2F5TX 2LNHB 3DB3A 5GAOr 5D7UA 4J6XA 3ER0A 1PKSA 2VV5A 2YLCA 3CBMA 3OYHA 1YI2A 2BKDN 3JCMJ 3OYIA 1Y96A 4DA4A 1RAEB 2ZZDA 2K6DA 4F7UA 3JCMe 2JS0A 1K73R 1RABB 2E12A 1H92A 1M30A 3N5BB 3VS5A 1AVZC 2NUPB 1QCNA 2LC4A 3QYGB 4E7LA 2KNBB 1M2VA 1YJWQ 4LDXA 3QYHB 2FZKB 3BW1A 4Y28E 1Z9QA 2VXFA 5HK0A 1HYOA 2M1HA 4M77G 2DL7A 3LYIA 4NL3A 3RMQA 2DL8A 2X4JA 2QEXA 1I1JA 3NHNA 1UEBA 1Q81C 2QYZA 4M77E 1ACMB 3FC3A 3IQLA 4ELYC 4FT4A 1TH7A 4HCBA 4XTYA 3JCMd 2XMFA 5CKHA 1ZUYA 1WNLA 1VQLQ 1OOTA 3CMET 5L23A 3OYNA 1QKWA 2X35A 1K4US 1UGRB 4PJOG 4ZGEB 3M55A 1B34B 3G7ZA 5GAMe 2DEUA 3SB2A 1Q82U 1VQ8T 3OYKA 4MMLA 3VV0A 2QDYB 1D1CA 1AHJB 1X2QA 3CBOA 3WXMB 3OYLA 2RQRA 2PUKB 3JCMW 2Z0WA 1Q81U 2HL5C 1BI1A 4L5GA 2RNAA 2KEAA 2RHUA 1ZSZB 3PVQA 4ZGDB 4OMOA 1TS9A 3GP8A 3AT1B 5GAMj 5KCOA 2V8IA 1HXDA 4OMPA 2CP6A 2O88A 2K3YA 1C0MA 2FPDA 2KMTA 2ZPIB 4M77C 2F1LA 2PUOB 1XNIA 2E65A 1X75C 4YTLA 1VQ7A 5GAMd 2X4XA 3P8DA 1WJRA 4ATOA 1VQOA 3I5SA 3UATA 1RI0A 4FSSA 4E7JA 4M7DG 2WSEE 5FU6B 2FZGB 2RJCA 1T3LA 3H9NA 3CEYA 4RCBA 2EYXA 3OS5A 5HY6A 2ABLA 2VUBA 1AWJA 2GFUA 2FHDA 1OPKA 1E7OA 1AD5A 4PJOC 1PM3A 4NS5A 1NEBA 1OYXA 4C92F 4FM4B 4IURA 4PL6A 1N8RR 1UHCA 4RMOA 1QKXA 1YNZA 2NWMA 1UE9A 5C0MA 2QQBA 2QASA 3I55A 3CCJQ 1UFFA 1B3QA 1WI7A 4HKEA 3VYGA 5CCAA 4X9DA 1WHLA 1YHQA 2RK1A 2XU8A 1QVFP 3CCST 4M78G 4OMNA 1PG5B 4E7HA 2RHXA 5GANf 2KBTA 5I22A 2HBWA 5KCHA 3GIBA 3ZBDA 1GCPA 4M7DC 1ABOA 4RTXA 1UGSB 2OX7A 3RESA 3FDRA 3OSSC 3CCLA 3OW2A 5IH2A 3JCMh 4M7AA 4XTZA 1NPRA 3M53A 3CCUA 1IZ6A 2KGTA 1FMVA 3LWIA 1TUCA 4RCCA 4CI0C 3JCMV 2XICA 1QVGS 1H8KA 2P84A 1X43A 4XU0A 4EMKC 5CO7A 1K9MR 3OB9A 5J3BA 4F7UG 3I9QA 4A4HA 3OS2A 5HCKA 4LDYA 2JM9A 1CKBA 3SWNA 2R58A 4F7UE 4GBQA 4X9CA 2HCKA 4IIOA 1VA7A 3A8OB 2EYQA 3M0QA 5KYUB 4JUVA 2ED1A 1H3ZA 1PSEA 1HSQA 1JEGA 4DEXA 4ZGJB 4J9GA 4AG1C 5LJ5g 4M78C 3META 2EPDA 3H0HA 1VIFA 2EYZA 5HK3A 1WLPB 3ME9A 4HT8A 2AHJB 5A0DA 2LQ8A 3VRYA 1W70A 3L2ZA 4RTUA 3TU4K 2OTLT 5GAMh 2QI2A 4ELZC 4NOYA 4IUQA 4C5HA 3OW2S 1KD1C 3GNGA 3EGXB 4BE1A 2ZPHB 3LGFA 1TWBA 3NGPA 2RA2A 2DXUA 4DBQA 1OU9A 3CC2Q 1WDXA 4J9FA 3A8GB 2YT6A 2VGMA 3UPUA 2DXBA 3EFOA 2HKQB 3BDUA 1UG1A 1R0CB 5KYXA 2DETA 1Q95G 4MZTA 2WSCE 1VQ9T 2RQTA 4FYVB 2BZXA 3EH1A 3MCAB 4Y92A 4N4GA 4FYWB 2RH2A 1YJ9T 4KUDK 5FW9A 3O5ZA 3VS0A 1KD1U 1RAFB 2DVJA 4FT2A 4II1A 1NLOC 7AT1B 3JV3A 5LJ3g 2DIGA 4DEYA 1EX4A 3CMAA 2V8JA 1P92A 5DLOA 4HVVA 2H3JA 4XU3A 1XTDA 2DFUA 5FRMA 1SRMA 1WQ7A 3V7RA 5GMKi 4IUUA 2MCNA 3MHXA 2DE0X 3PNWC 1WHGA 5FU7B 3QO3A 1BI3A 2EWNA 2FG0A 2FVUA 2JVVA 2NLUA 1LVKA 2CSQA 2QQRA 3EG9A 1QLYA 2NUTA 4F14A 3L42A 2YRCA 1AZGB 1YI2Q 1VQMT 1M9SA 1C6VX 3VS4A 2EGEA 2RJDA 1QCFA 3V7CA 2DNUA 2VYTA 4OF1A 2DIQA 1LNXA 3TSWA 1I8FA 3NFCA 2OTJA 3T9NA 2BZ8A 4C0FA 2DAQA 3MPUB 1Q82R 4C92B 2KE9A 2QA4A 1T3SA 5GMKm 1IGUA 1Q81R 3MEUA 2HAXA 1W4SA 3UF4A 1KHCA 1M1FA 1D3BA 1VQ4A 2RN8A 3PIPA 3LLRA 3CCEA 3RDVA 2A36A 5A2QE 4LDWA 2QAZA 4M7AG 4XQ3A 1AWOA 3RR6A 1GBQA 4M75F 1VQ6A 2JS2A 4M7AE 5GMKe 3OA6A 1KQSP 3EG0A 1VQNT 3RBBB 4XAXB 2RQWA 1Y7XA 3G4ST 3TVTA 2NUPA 1YP5A 3E9FA 3QWYA 5GAN8 5A0GA 5J39A 5FRNA 1GFDA 1S72T 2DYIA 4OGEA 5GMKj 2CP3A 1UJYA 2ZGWA 4BE0A 4E7IA 4M77F 1TSFA 1YITA 1VQKQ 1E6GA 2HL3A 1PC0A 2CT4A 2HNIA 4BI8B 3CC7A 1VQ7Q 2DMOA 4DQ2A 4KH1B 2XDBA 3HFNA 1PHTA 1G5VA 4C5GA 2E64A 3VS2A 2KRMA 1EZZB 4IKFA 3DKMA 4PJOF 4XTXA 1SHGA 2E3IA 1B34A 3CMEA 2D8JA 4LDUA 4CRIA 2COWA 2RHZA 4QT7A 1M3BA 1MUZA 4EIKA 5GANe 1I5LA 1UGPB 1YJNA 1KQ1A 3HFOA 2DK3A 3EG1A 5IHKA 1YIJQ 1ZSZA 3G71T 3SWNC 4N4HA 2M16A 1M90C 2DJZA 2YUPA 5GANj 2M9UA 1PSFA 3V8KA 3GBQA 3LH5A 1JBMA 1YJWT 2LCSA 1W2BS 1KFZA 2HQEA 2WSFE 2IG0A 2M0OA 4J9EA 4MZMA 1OPLA 5GANd 4M7DF 4JZ3A 1K9AA 2Y4YA 5AYFA 2YUNA 3G1JA 1NG2A 2DYBA 3PGGA 1SKUB 2DL5A 5ECAA 2M0YA 5KYWB 3JSCA 3GF5A 3MJXA 3HP9A 4BUGA 1M90U 1Y71A 1G8XA 3L2UA 4E6RA 3TEEA 3GPLA 2HZYA 1K1ZA 3FLGA 1I0CA 2YUQA 3H6ZA 4D6WA 3G4SQ 3X25B 3RKYA 5GAMg 5CQYA 1S72Q 4DBHA 4RUGA 3E2UA 1AT1B 2GBQA 1ZHIA 2RI5A 2DD4A 5CKEA 3HPWA 5GMKl 3JB9D 1MNDA 4PJMA 2K5LA 4M78F 1NBEB 5EG2A 4R56A 1G3SA 2JTMA 2MF2A 1AOJA 1OI1A 3CCSA 3GLXA 5I2SA 1ZQ1A 5CKDA 4AG2C 3M4YA 2DLPA 5GMKh 1KD1R 2AKKA 1W1FA 4FW1A 1N9RA 4KULA 2RHIA 2JXBA 2F5KA 5GAOm 4JJNK 1ZA2B 1R8OB 2J6OA 2RMOA 1M3AA 3FJPA 1V29B 4PK4A 2KYMA 3G71Q 1TU0B 1MMNA 1MV0B 2QQSA 3L1AA 3M0SA 1NLPC 3A8MB 2YSQA 2YDLA 4M75B 1D1BA 1FMWA 1PCXA 1Q82C 3CCJT 1XJWB 3JCMb 3NTIA 1UECA 3OYJA 5CAIA 2CT3A 3L2RA 2PNIA 3VS7A 1GBRA 2DRKA 1OQKA 1X6OA 2QXFA 2COYA 5CIUA 1TOVA 2Y90A 2LT1A 4EMGA 5GANh 2OTLA 1VYVA 1W6XA 3C95A 4RTVA 3GNFB 2EJFA 2AZSA 2FRYA 3CCQT 3E1SA 2ECZA 4QVZA 1G3TA 4MMKA 3A98A 4OMLA 1YWOA 3HRUA 2L8DA 4A53A 4WF2A 4HVUA 2AKLA 2BIVA 2QK0A 1PNJA 2AT1B 1IO6A 2DILA 1LPLA 1BI0A 1RAIB 5LJ5f 1YCYA 4F16A 4BE2A 1VQ9A 4N0AA 4Z89A 4D8KA 3VS3A 1M3CA 1VIEA 3C0CA 1OX8A 1X69A 3NTKA 2A28A 1RLPC 4LD6A 4HCCA 1WHMA 2X3XD 2CDTA 4J6WA 4FYXB 1WXUA 5EC7A 2QA4Q 2KRNA 2R5MA 3CC4Q 2MPXC 3JCMQ 3TREA 4A54A 4OGCA 5GJVB 2GGRA 2EKHA 2JM8A 3CCEQ 1FWZA 4M7AD 1TXQA 3I56A 2ROTA 3CXCP 4LUDA 4B9XA 1MMDA 2JNGA 1AWWA 3CC2T 2CREA 2LNVA 3QIIA 5LJ3f 1G3WA 2JUFA 4GY5A 1X6GA 1QMCA 4QVCA 1VQMA 3MO8A 1PRLC 3UA7A 4IUVA 3VYHB 1K0XA 4NL2A 1ZSZC 2KVQG 1YWPA 3BDLA 1PKTA 4KUIA 3MEVA 4C0DB 8ATCB 3S3MA 3CCVA 2EQUA 4C92A 2MIOA 2CZ0B 4LDVA 1UB4A 1ZA1B 5DLQE 1OEBA 5I2MA 3CCMT 1IXDA 5KE3A 4OP0A 4C8QB 3M0UA 2A7YA 5GAOl 4J9HA 4DBRA 1YITQ 1TUDA 5FU6C 1IREB 4ANJA 2YXYA 3CCQQ 1I07A 4C8QE 3QDRB 3CC7Q 4BB7A 2FRWA 2M02A 1I81A 2E41A 3X28B 3HRSA 3QBYA 2D0NA 2MK5A 4BDZA 4HVWA 2X51A 4C5IA 1G3YA 1YN8A 1ABQA 4O5VA 1WZOA 3X20B 2CP7A 1QWFA 1VQNA 1VQPQ 3JB9G 1YI2T 5IN1A 4GLKA 1M90R 1PD1A 1SPKA 2DZCA 3EG2A 1ZSGA 3CD6Q 2K3XA 1T0HA 2SRCA 4V2SA 3M4GA 1D0YA 3REAB 1H641 1U1TA 1HK9A 1WHJA 3MEWA 4AMCA 1MMAA 5DM7R 4CC2A 2DX1A 3NTHA 9ATCB 4A4FA 2EJGA 3OYDA 3LX7A 3CPWP 3JB9J 2EYWA 4ME7A 1SG5A 2K79A 5L8RE 2QEXT 3RNJA 2RQUA 3EH2A 3JCMX 3M56A 5FWBA 1VQ5A 3OQ5A 1ZLMA 2CP5A 1BBZA 2IVWA 4ZTJA 3I35A 3OS1A 3M54A 2O01E 1B7TA 4JRPA 2L3SA 5KYYB 5GAOq 3M58A 2EGCA 2EQMA 1WPYA 1VUBA 3S3OA 3CCRQ 2LP5A 3LWHA 1NYFA 2BE9B 5CR2A 4F04B 1CSKA 4MZPA 1TUGB 3U23A 1Z9ZA 4CC3A 3KUFA 1YBYA 4BD3A 2D9TA 3OMCA 3CCMQ 1QVFA 3JB9I 2LCCA 4DBFA 4QW2A 3O8VA 4ZNXA 2DO3A 1XQHA 4LXCA 5GAN2 4RG8A 3M59A 1NEGA 3A5ZB 1KK7A 2C0IA 5KYNA 1FXXA 2EVRA 1VQKT 2MOXA 5I11A 5KYWA 5CVIA 1VQ7T 1OULA 1VQOT 1JJ2P 2JMCA 1N6AA 4XU2A 1K8AC 2CKKA 2ZPGB 2J6FA 1VQLA 4XK8E 1V76A 2HKNA 3QSUA 2PVGB 5D6XA 4BY6B 1VYUA 2DKGA 5GAN4 1D1AA 3G6EA 2PQWA 4BI3A 3KXTA 1IGQA 2LDMA 1UTIA 2DERA 1CKAA 2RO0A 4EMHA 4RG2A 2RB6A 1YIJT 1QVFS 5KH6A 4FYYB 4FCYA 4C92G 2G6FX 2YRDA 1MV3A 2OAUA 2XI9A 3BFMA 4LNPA 3OYYA 4JRQA 5DY9A 4C92E 3J7AF 1K8AU 4FIBA 3ASKA 2QEXQ 4M4ZA 2DZ9A 3OYEA 2DL3A 3EAEA 1ZBJA 1Q86C 4KGXB 5IHIA 2K7AA 4J6YA 2RD1A 3SHWA 3UDCA 2KXDA 1PD0A 2KYBA 2X4YA 4L59A 2CUBA 4PFOA 4PJNA 5LJ5j 4R55A 6AT1B 2JN0A 2GCXA 2IPOB 4L6V5 1AWXA 2LTOA 3VKIA 1KHIA 3M0PA 4E7KA 4OMQA 3OYMA 1RACB 5M9OA 1U5SA 3FJ5A 4M75A 5D6YA 5LJ5d 2K5IA 3ZL7C 4X34A 1SSHA 1Q86U 2FEIA 1WIEA 1RL2A 4R0KA 2K9GA 2H8HA 2LQKA 4C92C 1KQ2A 3CCJA 1MNEA 1Y07A 1O9SA 3J81E 2PVDB 3LW5E 3H41A 3KFVA 2DVEA 3BY7A 1D0ZA 3M9QA 1NJIR 2H3EB 2KXCA 2BTTA 4BACA 4OB0B 1VQOQ 1H3HA 1X6BA 4J8OA 5FLXE 4HT9A 2HMAA 4ESRA 2PTKA 3QKJA 3M5AA 2E5QA 3HKSA 4AFSC 1PRMC 3MP8A 4M7AC 1BIBA 2A0FB 3THKA 4AT1B 1N9SA 3AHUA 4QQ6A 2A08A 5LJ3j 2QGFB 3J80E 2ZPFB 2YRVA 1WA7A 2ESWA 4J9CA 1WGSA 1AZEA 1VQ8A 3REBB 2D6FA 1GXIE 1M1GA 3HRTA 1QCOA 2JT4A 5LJ3d 3EHRA 4LN2A 3JCMg 3TSZA 4RTYA 2W0ZA 1ZBXA 2ED0A 2PU9B 3ZEHA 2QTXA 2EQJA 4KT0E 2VASA 2CZ7B 3I55Q 5IAYA 4Q5WA 5GAN5 2CGHA 1YHQQ 2DM1A 2E70A 3L2QA 2M51A 4KH0B 2J7IA 1S1NA 1QWEA 4C8QD 2L3QA 3CMAT 3TQ7P 5GAN7 3WVDB 2LX7A 3URGA 4J7IA 1C1AA 1BI2A 1BCMA 4Z88A 1N27A 2DPPB 2LJ0A 2VKNA 2MMPA 4JLIA 3CCLQ 2HQXA 4CC7A 1BKBA 2R5AA 1UUEA 4XTVA 3CCUQ 3A8HB 2K57A 3CBPA 2C06A 1KQSA 1GFCA 1RLQC 2EKOA 2AZVA 4C5EA 1NPPA 3RKXA 3CC2A 3EFRA 3C94A 1IHVA 4B6MA 2O2OA 2JW4A 4FW2A 2MYSA 3F70A 5LJ5h 2DD5A 4HA8A 4JS4A 2EFIA 3DB4A 1OV3A 5GAOn 1MMGA 3MP6A 3NMZC 4C8QA 3E9GA 1KG1A 2CZ6B 3D7SB 3S6WA 2QA4T 2K5FA 3OY9A 3CC4T 4OB1B 2EIFA 4P5NA 3OYAA 1KQSS 1GL5A 1VQ5Q 3CCET 2CH4A 4F7UF 4AFQC 3PIOA 1AEYA 2RJEA 5KE2A 1VQ6T 3JB9F 3V7SA 1NE8A 3M0RA 3QJYA 4M75G 4XTWA 5KYUA 3X24B 1HJDA 1GRIA 5LJ3h 1QVGP 4QQGA 1SF9A 4M75E 2MAMA 2CS7A 1DJ7B 1GCQA 1QP2A 3OBWA 4JPBW 4CC4B 3CMAQ 1M1KC 2X4WA 1WXBA 2QQ9A 1U06A 4J5YA 3VJPA 5FWCA 1UJ0A 4JLGA 3EGXA 2L0AA 3RKWA 2L2PA 4DOVA 2OI3A 1QQJA 4M77B 1YITT 2RJFA 4OMFB 1VYTA 5CKFA 3OS0A 1KIKA 3JB9H 3CC7T 5IXFA 3FEOA 1NZ9A 5HKCA 2MI6A 1K8AR 2ZAEA 5IXBA 3CPFA 1SRLA 4QVDA 1ZUKA 5KYYA 4HCZA 3RUXA 2O9VA 3QPHA 2X3WD 3S3NA 1M1KU 2F2WA 1RAAB 2HDAA 3OW2P 3DLLA 1SSFA 4J9IA 4D8DA 2ZPBB 1J3TA 4PJOB 3G6EQ 1VQPT 1YJNT 3EGUA 2BZYA 1KSWA 4M75C 1YJ9A 3FB9A 4PJOE 3JRZA 2VGNA 4K11A 4C92D 3CD6T 2KI7A 4FSXA 2OTJQ 3OYBA 3A8LB 4ORZA 2XDPA 8AT1B 2P0QA 1N5ZA 3VS1A 3QZ5B 1JB0E 4FL6A 4HCKA 2O31A 4TVRA 3X26B 1FYNA 4EPCA 2DEQA 1NJIC 1HD3A 3JAME 3R6NA 2LRQA 2KQWA 4PLLA 3SEMA 3QXEB 2MWOA 1I4K1 1Q86R 1VQ4Q 2JMAA 2RF0A 2BUDA 1VQKA 1XOVA 4QQDA 2FYKA 2ROLA 1ARKA 1R77A 4AFZC 3OSVA 2NYSA 1KC8R 2V26A 3UA6A 4ZTFA 1QVPA 3EGDB 2F2VA 4M7DB 2FZCB 1VQ6Q 2JTFA 2DXCA 1OZ2A 5GJWB 3UT1A 1BB9A 2KK4A 4M7DE 2O4XB 2P4TA 4LE9A 1JQQA 2HSPA 1NJIU 1BK2A 4J9DA 4EMKB 1M5Q1 3CCRT 1Q7YC 3MEAA 1M8VA 4WTOB 1QVGA 4J9BA 3M0TA 2HQHA 2XIDA 1U1SA 1YIJA 4KGZB 2AIRB 2E5KA 2VVKA 4ZN3A 2XDDA 2L89A 4Z8AA 3L2WA 2ENMA 4OB2B 3NPFA 2DTOA 5GAOp 2LMJA 3VUZA 1UGQB 2NUZA 3MKDA 2XD0A 4PJLA 2LVMA 2P4RA 4C8QG 2OJ2A 2YHTA 2EJ9A 3VU3C 2EYYA 2EQIA 5I21A 3RIRA 2J6KA 4M7AF 1G2BA 4M78B 1JRIA 4J83A 2GTOA 2GQVA 1Q7YU 4M78E 2EGAA 2C0TA 2VB6A 4KBMB 3CMEQ 4E2FB 2WACA 2CZ1B 1SEMA 2KR3A 3LGLA 5LL6S 4JS5A 1YJNQ 2DA9A 1WJQA 2YWWA 3ZFJA 1WYXA 1VQ8Q 2VWFA 3G4SA 4JZ4A 2PVOB 1S72A 1RAHB 1Y96B 4C0DC 3FIFA 4F17A 2QTVA 4F7UB 1KJWA 1E6HA 4A4EA 5AT1B 1OZ3A 2L3PA 2C0OA 2KDSA 3OYCA 2RHYA 4OMMA 4BI4A 4RTTA 3INZA 2LX9A 2D0QB 4C8QC 1QW1A 1M2VB 1UDLA 1IB8A 4JJBA 2CSIA 2L5QA 2FL7A 2FPEA 4JDSA 2LZ6B 2JJ9A 2DXTA 2LJ3A 3JCMc 2XK0A 3JCMP 3CXCA 2CYZB 1Y0MA 1WHKA 3VRZA 4B9WA 3M57A 4PFZA 3QZ9B 3WVEB 3HTRA 4O6JA 5GAN6 1BCOA 5CK9A 4VUBA 2DBKA 2CP2A 4FU6A 2EQKA 2D1XA 3PMTA 3PE0A 3G71A 2QQAA 2GNCA 3FRNA 4EDUA 1WXTA 3ULRB 2VXEA 1LOJA 1K73C 1U8RA 1WHHA 1G83A 3PFSA 4LUEA 1YJWA 1GCQC 2FPFA 2VC8A 2CH4W 1VOMA 1V1CA 2DTHA 3CCSQ 1WX6A 1D0XA 1I5OB 5J26A 2KY9A 3PT9A 3CQTA 2V1QA 3CXCS 2B8AA 1OU8A 2V1RA 2XG8D 4PLIA 1RADB 1MHNA 3JCMf 1NYGA 1W2BP 3Q1JA 3QG1A 3QUIA 1K73U 3A1PA 5A0LA 3I5RA 4RTZA 3SD4A 5GANg 3I56T 1ZX6A 2RI2A 1FMKA 2LQWA 4OVAA 4N0AC 4E47A 4E7SA 2E1HA 2K4YA 1BIAA 2KT1A 4M75D 4RKUE 2RPNA 3QWXX 1D09B 1RAGB 2K2VA 2R57A 2BE7D 2E6NA 2FO0A 3GOXA 2HD0A 4J7FA 3I55T 1M1KR 2AK5A 2GQIA 4MDXA 4QKUA 1YHQT 3CCVT 2FB7A 3CPWA 2DF6A 5C6SA 3UWNA 2F69A 1YFNA 5LJ5e 4DOWA 3P8BB 2F2XA 2QDLA 3HL8A 5IT9E 5GAMf 2LCLA 4IIMA 2HBPA 5FU7C 2XKOC 4M77D 4Y91A 2LJ1A 3CC4A 2E4HA 1OX9A 1KC8C 2OTLQ 2DBMA 2HSEB 2RQVA 1FX7A 4GLMA 3CCLT 2RI3A 2IIMA 4AFUC 2P0KA 2J06A 4XTUA 4BY6C 3CCUT 1LCKA 2ZCFB 2JTEA 2E10A 4M7AB 1BYMA 4IUPA 2EW3A 4X1VA 2W10A 2LT4A 2G3RA 1SHFA 4WCIA 1R0BG 2V8KA 1QP3A 4PJOD 4LD9K 2DL4A 2I0NA 4C0ZA 1VQ9Q 4A63B 1N8RC 4PNOA 2QGGA 3V8LA 1YJ9Q 1KC8U 2ZPEB 1WQWA 4JJCA 3VUBA 2QG9B 1WFWA 3SWNB 1T0JA 3CPWS 5CKBA 2P0PA 4OB3B 5LJ3e 2JOYA 2E3HA 2DTIA 3V8JA 1A0NB 1LJOA 2JZ2A 1ZUUA 1JU5C 4M77A 1M8MA 2SEMA 1JJ2A 3VS6A 4XU1A 3QJ6A
chains in the Genus database with same CATH topology
4IUVA 3SFMA 4F7UF 3VYHB 5LJ3g 2DIGA 4NL2A 2KVQG 2RM4A 3PMIA 1W2BA 3CMAA 3CCQA 3PIOA 2V8JA 3BDLA 1P92A 5DLOA 3DLMA 4KUIA 1N8RU 2H3JA 3MEVA 2RJEA 5D6WA 4C0DB 3TCJA 5KE2A 3S3MA 3CCVA 1VQ6T 3JB9F 3H8ZA 4XU3A 2EQUA 4C92A 1XTDA 4M7DD 3V7SA 2CZ0B 1VQ5T 1NE8A 4LDVA 5FRMA 1UB4A 1WQ7A 3CCUA 3QJYA 4M75G 5DLQE 4IUUA 4XTWA 3V7RA 3EFSA 5GMKi 3X24B 2I2LA 5LJ3h 5I2MA 3CCMT 5KE3A 4QQGA 3OBYA 3MHXA 4OP0A 4PJOA 4M75E 2MAMA 3PNWC 1WJSA 4C8QB 2CS7A 5FU7B 2A7YA 3QO3A 5GAOl 1K9MC 1BI3A 4JRIA 2YLBA 1DJ7B 1QP2A 2EAYA 1MGQA 2EWNA 1VQPA 5FU6C 3OBWA 1IREB 1M1KC 2X4WA 2FVUA 3OYFA 4C8QE 3QDRB 2JVVA 2NLUA 3RMSA 2QQ9A 4BB7A 2RK2A 4J5YA 3VJPA 2QQRA 1I81A 3L42A 4JLGA 2E41A 3X28B 3HRSA 3QBYA 3CD6A 4BDZA 3RKWA 1VQMT 1M9SA 4DOVA 4M77B 2RJDA 3PTAA 1YITT 3V7CA 4C5IA 2RJFA 5CQXA 1G3YA 2VYTA 4OMFB 4OF1A 5CKFA 3KBGA 3OS0A 1JJ2S 4O5VA 2DIQA 1LNXA 3X20B 1I8FA 3CC7T 3JB9H 4A4GA 3FEOA 1NZ9A 4C0GA 3NFCA 5HKCA 2MI6A 1VQNA 3CPFA 3C12A 4M78D 2OTJA 4QVDA 3T9NA 4C0FA 2DAQA 3JB9G 4Z02A 1YI2T 4HCZA 5IN1A 3RUXA 4C92B 1K9MU 3QPHA 4GLKA 4BDYA 2GFAA 2QA4A 3S3NA 4MDWA 2E6ZA 1M1KU 4M7DA 2DZCA 3OYGA 3DLLA 2K3XA 1SSFA 4IUTA 4V2SA 2ZPBB 5GMKm 3M4GA 3MEUA 2HAXA 1W4SA 4PJOB 1VQPT 1H641 1KHCA 1M1FA 2Y4XA 1U1TA 1D3BA 1VQ4A 1YJNT 2O4XA 4M75C 1HK9A 3MEWA 4JRKA 3L2VA 3PIPA 3LLRA 1YJ9A 3FB9A 2XHCA 3CCEA 3JRZA 5DM7R 4PJOE 1X01A 2VGNA 4A4KA 4EMKA 5A2QE 1VQLT 3NTHA 4LDWA 4C92D 3CD6T 4FSXA 3OYBA 3A8LB 4A4FA 2XDPA 2EJGA 5GAN3 3OYDA 4M7AG 4XQ3A 3LX7A 3JB9J 2GF7A 4ME7A 2P0QA 3CCRA 2KSSA 4N4IA 5L8RE 3QZ5B 1JB0E 4FL6A 4M75F 3QHSA 4TVRA 3G6ET 2QEXT 3HSBA 1VQ6A 3X26B 4EPCA 2DEQA 3JCMX 3M56A 5GMKe 1NJIC 2KAFA 3RERA 3OA6A 4M7AE 4PKCC 1VQ5A 3OQ5A 3JAME 2LRQA 2KQWA 2IVWA 4ZTJA 3C4SA 4PLLA 1VQNT 3QXEB 2MWOA 4C8QF 1I4K1 1M4ZA 3OS1A 2OTJT 3CCMA 2A3LA 2BUDA 1VQKA 3M54A 1XOVA 3P8HA 4XAXB 2L3RA 4QQDA 2FYKA 2O01E 3OMGA 1Y7XA 3G4ST 4JRPA 3E9FA 3OSVA 5GAN8 3E19A 5A0GA 5J39A 5GAOq 5FRNA 1S72T 3M58A 2EQMA 4OGEA 1WPYA 4M78A 3MP1A 1QVPA 4ZTFA 1VUBA 2MWPA 3SDZA 5GMKj 1EIFA 3S3OA 4M7DB 1O75A 3LWHA 2ZGWA 4BE0A 4E7IA 2JTFA 2DXCA 1VQ4T 4UC4A 4M77F 1OZ2A 4ZN1A 3UT1A 5CR2A 4MZPA 3LH0A 2KK4A 4M7DE 3HHTB 1D3BB 3KUFA 3R6OA 1YBYA 2O4XB 2P4TA 5FROA 4BD3A 2F5TX 2D9TA 3OMCA 1NJIU 1YITA 1QVFA 3DB3A 3JB9I 4EMKB 1M5Q1 3CCRT 5GAOr 1Q7YC 4BI8B 2HNIA 3CC7A 4J6XA 3MEAA 1M8VA 3ER0A 2LCCA 4DQ2A 1QVGA 2VV5A 2XDBA 4QW2A 3HFNA 3O8VA 2YLCA 1G5VA 2XIDA 1U1SA 3CBMA 2DO3A 1XQHA 3OYHA 4C5GA 1YIJA 5GAN2 2E64A 4RG8A 3M59A 4ZN3A 1YI2A 2XDDA 2BKDN 4IKFA 3JCMJ 2L89A 3OYIA 1Y96A 3A5ZB 3L2WA 4OB2B 4DA4A 3QJ6A 3DKMA 1FXXA 1VQKT 2ZZDA 2DTOA 4PJOF 4XTXA 5GAOp 2XD0A 3VUZA 1B34A 1UGQB 4LDUA 4F7UA 3JCMe 5CVIA 2LVMA 4C8QG 4CRIA 3CMEA 2E12A 2YHTA 1VQ7T 2EJ9A 2RHZA 3VU3C 3N5BB 1VQOT 5GANe 1I5LA 1N6AA 1UGPB 1YJNA 2LC4A 1KQ1A 3QYGB 4E7LA 5I21A 4XU2A 3RIRA 4M7AF 1K8AC 4M78B 1JRIA 2CKKA 2ZPGB 3HFOA 1VQLA 4J83A 2DK3A 3QYHB 4LDXA 4XK8E 2GQVA 1Q7YU 3QSUA 3BW1A 2PVGB 4Y28E 5D6XA 3SWNC 4BY6B 4M78E 2VXFA 5HK0A 3G71T 2DKGA 2M1HA 4M77G 4N4HA 2M16A 5GAN4 1M90C 2DJZA 3LYIA 4NL3A 3RMQA 2X4JA 2QEXA 3G6EA 2PQWA 4KBMB 4BI3A 3KXTA 2LDMA 5GANj 1UEBA 2M9UA 1PSFA 3V8KA 1Q81C 2WACA 4M77E 3FC3A 4ELYC 2CZ1B 1JBMA 2RO0A 4EMHA 1YJWT 4RG2A 3LGLA 4FT4A 1TH7A 2RB6A 5LL6S 1YIJT 1W2BS 4JS5A 1QVFS 4HCBA 1WJQA 2HQEA 4XTYA 3ZFJA 5KH6A 3JCMd 5CKHA 4C92G 2WSFE 2OAUA 2XI9A 3G4SA 3BFMA 1WNLA 2IG0A 2M0OA 3OYYA 4MZMA 5GANd 4M7DF 4JRQA 5DY9A 2PVOB 3OYNA 2X35A 3CMET 1S72A 4C92E 1Y96B 2Y4YA 5AYFA 4C0DC 3J7AF 1UGRB 1K8AU 4FIBA 4PJOG 3FIFA 3PGGA 3M55A 4ZGEB 1B34B 3ASKA 3G7ZA 4F7UB 5GAMe 3JSCA 3GF5A 3SB2A 4A4EA 1Q82U 2DZ9A 1OZ3A 3HP9A 3OYEA 4MMLA 2KDSA 3EAEA 3OYKA 3OYCA 1VQ8T 2RHYA 2QDYB 3VV0A 4BUGA 1M90U 1Y71A 1Q86C 4BI4A 3L2UA 1AHJB 3CBOA 3WXMB 3INZA 3OYLA 3TEEA 2LX9A 2PUKB 3JCMW 2D0QB 1Q81U 4C8QC 1QW1A 3GPLA 1BI1A 4J6YA 3FLGA 2RD1A 4L5GA 3H6ZA 3UDCA 2RHUA 4D6WA 3X25B 3RKYA 4ZGDB 5GAMg 3GP8A 2X4YA 2L5QA 4L59A 5CQYA 2FL7A 4JDSA 5GAMj 5KCOA 2V8IA 2DXTA 1HXDA 1ZHIA 2RI5A 3JCMc 2XK0A 5LJ5j 4R55A 3JCMP 2K3YA 3CXCA 2CYZB 2DD4A 2JN0A 5CKEA 3HPWA 5GMKl 4B9WA 3JB9D 2KMTA 3M57A 2ZPIB 4M77C 2GCXA 2PUOB 4L6V5 1XNIA 2K5LA 2LTOA 2E65A 3VKIA 1X75C 4YTLA 1KHIA 1VQ7A 5GAMd 2X4XA 3P8DA 3QZ9B 1WJRA 3WVEB 3OYMA 4E7KA 1VQOA 4ATOA 4M78F 5M9OA 5EG2A 4R56A 1RI0A 4O6JA 4M75A 1G3SA 5D6YA 5LJ5d 5GAN6 5CK9A 2K5IA 4E7JA 4X34A 4M7DG 1Q86U 2JTMA 4VUBA 2MF2A 2WSEE 5FU6B 4FU6A 1OI1A 3CCSA 3GLXA 2RJCA 1RL2A 2EQKA 3CEYA 5I2SA 4RCBA 1ZQ1A 2LQKA 4C92C 3PMTA 5CKDA 1KQ2A 3OS5A 2QQAA 3M4YA 5HY6A 3G71A 3CCJA 1Y07A 3J81E 1O9SA 3FRNA 2VUBA 4EDUA 5GMKh 2PVDB 3LW5E 2VXEA 2GFUA 2FHDA 1LOJA 1K73C 1U8RA 2DVEA 4PJOC 3BY7A 3M9QA 4NS5A 1OYXA 1N9RA 4KULA 4BACA 4OB0B 2RHIA 3PFSA 4FM4B 4IURA 4J8OA 4C92F 1YJWA 5FLXE 2F5KA 4PL6A 4HT9A 5GAOm 4JJNK 2VC8A 2DTHA 1R8OB 4RMOA 3QKJA 3M5AA 2E5QA 3HKSA 3MP8A 4M7AC 3FJPA 1BIBA 1V29B 2QQBA 5C0MA 5J26A 2KY9A 1N9SA 3PT9A 3AHUA 4QQ6A 3I55A 5LJ3j 4HKEA 3J80E 3VYGA 2QQSA 5CCAA 2ZPFB 3CXCS 2YRVA 2B8AA 4X9DA 3L1AA 1YHQA 2RK1A 2XG8D 3A8MB 4PLIA 1WGSA 1MHNA 2XU8A 3JCMf 1VQ8A 3Q1JA 4M78G 3CCST 2D6FA 1GXIE 1M1GA 4M75B 3HRTA 4E7HA 3QG1A 2RHXA 5GANf 3QUIA 1K73U 5LJ3d 3JCMg 1Q82C 3CCJT 5KCHA 3GIBA 5A0LA 3ZBDA 1ZBXA 3SD4A 3JCMb 3NTIA 2PU9B 5GANg 3OYJA 3I56T 2RI2A 3ZEHA 2QTXA 2EQJA 4KT0E 5CAIA 4M7DC 2CZ7B 3L2RA 1UGSB 4OVAA 3RESA 3FDRA 3OSSC 5IAYA 4Q5WA 5GAN5 3CCLA 1X6OA 4N0AC 2CGHA 3OW2A 4E47A 3JCMh 4M7AA 2E1HA 2K4YA 1BIAA 2QXFA 4M75D 1NPRA 3M53A 4RKUE 1IZ6A 4XTZA 2Y90A 5CIUA 4CI0C 4RCCA 3LWIA 2E70A 3JCMV 3L2QA 2LT1A 4EMGA 2XICA 1QVGS 5GANh 2K2VA 2OTLA 2R57A 4XU0A 3C95A 4EMKC 2E6NA 3GOXA 5CO7A 2HD0A 3GNFB 4J7FA 4C8QD 3I55T 2EJFA 5GAN7 3CCQT 3WVDB 3CMAT 3E1SA 4MDXA 3URGA 3OB9A 4J7IA 1BI2A 4QVZA 5J3BA 4F7UG 1YHQT 3CCVT 1G3TA 2FB7A 4MMKA 4A4HA 1N27A 3OS2A 3CPWA 2DPPB 5C6SA 3UWNA 3HRUA 2F69A 4LDYA 5LJ5e 3SWNA 2L8DA 4A53A 2R58A 3P8BB 2MMPA 4WF2A 4JLIA 4DOWA 2HQXA 4F7UE 3HL8A 4X9CA 2BIVA 5GAMf 2LCLA 1BKBA 2R5AA 5IT9E 3A8OB 4XTVA 3A8HB 2HBPA 2K57A 2EYQA 1BI0A 3CBPA 2XKOC 5FU7C 4M77D 4Y91A 1KQSA 2C06A 3CC4A 4JUVA 5LJ5f 1H3ZA 1PSEA 1YCYA 1KC8C 2EKOA 4BE2A 1VQ9A 4N0AA 4ZGJB 4C5EA 1NPPA 3RKXA 5LJ5g 3CC2A 3EFRA 1VIEA 4M78C 3META 1VIFA 1FX7A 5HK3A 3CCLT 2RI3A 3NTKA 3ME9A 2P0KA 4HT8A 2AHJB 4XTUA 2LQ8A 3C94A 4BY6C 5A0DA 4LD6A 2ZCFB 3CCUT 3L2ZA 4HCCA 3TU4K 2E10A 4M7AB 5GAMh 2OTLT 3F70A 2QI2A 4J6WA 4IUPA 4NOYA 4ELZC 1BYMA 4IUQA 4C5HA 3OW2S 1KD1C 3GNGA 4BE1A 2ZPHB 2LT4A 2G3RA 3LGFA 5LJ5h 2DD5A 1QP3A 2R5MA 2V8KA 4HA8A 4PJOD 4LD9K 4JS4A 2EFIA 3JCMQ 3DB4A 2RA2A 2DXUA 3TREA 4C0ZA 4A54A 4OGCA 5GAOn 1N8RC 4PNOA 3MP6A 3V8LA 4C8QA 3E9GA 3A8GB 1KG1A 1KC8U 2ZPEB 1WQWA 2CZ6B 2VGMA 3UPUA 2DXBA 3VUBA 3BDUA 3S6WA 1FWZA 4M7AD 3SWNB 2QA4T 3CPWS 2K5FA 5CKBA 2P0PA 4OB3B 3OY9A 5LJ3e 2JOYA 3I56A 3CC4T 4OB1B 4MZTA 2EIFA 2WSCE 1VQ9T 2DTIA 4P5NA 3V8JA 3OYAA 4B9XA 1LJOA 2JNGA 3MCAB 2JZ2A 4N4GA 3CC2T 2LNVA 2RH2A 1KQSS 3QIIA 1YJ9T 5LJ3f 4KUDK 1G3WA 2JUFA 4GY5A 4M77A 3CCET 1KD1U 1JJ2A 4QVCA 4FT2A 4II1A 1VQMA 4XU1A 3MO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U F;  5LJ3 g;  3SB2 A;  4NL2 A;  2QTX A;  2RM4 A;  5CAI A;  4M7D C;  2DZ9 A;  4MML A;  2FYK A;  3RES A;  5GAN 5;  4N0A C;  2CGH A;  3INZ A;  5GAN 8;  3JB9 F;  3JCM h;  4M7A A;  5GAO q;  2E1H A;  4XU3 A;  1BIA A;  4M75 D;  4XTZ A;  4C92 A;  3JCM W;  4C8Q C;  3V7S A;  1WPY A;  2Y90 A;  4M78 A;  4M7D D;  4RCC A;  4J6Y A;  3JCM V;  5GMK j;  1WQ7 A;  4EMG A;  2RD1 A;  4M75 G;  3V7R A;  5GMK i;  4XTW A;  5GAN h;  3EFS A;  4M7D B;  3RKY A;  2ZGW A;  4XU0 A;  2I2L A;  5GAM g;  4EMK C;  5LJ3 h;  4M77 F;  4C8Q D;  5GAM j;  2EJF A;  5GAN 7;  4OP0 A;  4PJO A;  4M75 E;  4M7D E;  2DXT A;  1HXD A;  1D3B B;  3JCM c;  4C8Q B;  4F7U G;  5LJ5 j;  3JCM P;  3QO3 A;  5GAO l;  4JRI A;  2JN0 A;  2YLB A;  2FB7 A;  4MMK A;  2EAY A;  1MGQ A;  2EWN A;  5GMK l;  3JB9 D;  3JB9 I;  4EMK B;  4M77 C;  5LJ5 e;  1M5Q 1;  3SWN A;  4A53 A;  4C8Q E;  5GAO r;  4F7U E;  4WF2 A;  2HNI A;  4JLI A;  2E65 A;  4J6X A;  1M8V A;  4DQ2 A;  4J5Y A;  4X9C A;  5GAM d;  5GAM f;  3HFN A;  4M78 F;  2YLC A;  4XTV A;  1I81 A;  1U1S A;  2K57 A;  4F7U B;  4M75 A;  2E41 A;  4M77 D;  4Y91 A;  5LJ5 d;  5GAN 6;  5GAN 2;  2E64 A;  4JUV A;  5LJ5 f;  3RKW A;  4M7D G;  1YCY A;  4N0A A;  4M77 B;  3JCM J;  1Y96 A;  3V7C A;  4PJO F;  2DTO A;  3RKX A;  4RCB A;  4XTX A;  4C92 C;  5LJ5 g;  3EFR A;  5GAO p;  4M78 C;  1B34 A;  1KQ2 A;  4F7U A;  3JCM e;  4C8Q G;  3JB9 H;  1LNX A;  2YHT A;  1I8F A;  2EJ9 A;  3VU3 C;  5GMK h;  4HT8 A;  2VXE A;  4XTU A;  5GAN e;  1I5L A;  1LOJ A;  3L2Z A;  4M78 D;  2DVE A;  4QVD A;  4PJO C;  2E10 A;  1KQ1 A;  3BY7 A;  4M7A B;  5I21 A;  5GAM h;  4XU2 A;  3RIR A;  4J6W A;  4NOY A;  3RUX A;  1N9R A;  4C92 B;  3JB9 G;  4M7A F;  4M78 B;  4C92 F;  1JRI A;  3HFO A;  5LJ5 h;  4HT9 A;  4M7D A;  2DZC A;  5GAO m;  4HA8 A;  2VC8 A;  3QSU A;  4PJO D;  3BW1 A;  3JCM Q;  3SWN C;  4M78 E;  2VXF A;  2RA2 A;  2DXU A;  2DKG A;  2DTH A;  4M77 G;  3M4G A;  5GMK m;  4V2S A;  4A54 A;  5GAN 4;  5GAO n;  2DJZ A;  4NL3 A;  4PJO B;  4PNO A;  4M7A C;  1H64 1;  3FJP A;  1BIB A;  1U1T A;  1D3B A;  3V8L A;  4C8Q A;  1N9S A;  4M75 C;  1HK9 A;  3V8K A;  4JRK A;  5GAN j;  3AHU A;  1WQW A;  4M77 E;  3FB9 A;  5LJ3 j;  4PJO E;  1X01 A;  3BDU A;  1JBM A;  4EMH A;  4EMK A;  4X9D A;  4M7A D;  3SWN B;  1TH7 A;  2RB6 A;  3L1A A;  4C92 D;  5LJ3 e;  4XTY A;  3JCM d;  5GAN 3;  4M7A G;  2EJG A;  3JCM f;  4XQ3 A;  4C92 G;  3JB9 J;  4M78 G;  2DTI A;  3V8J A;  4M75 B;  3BFM A;  1WNL A;  1LJO A;  4M75 F;  5GAN d;  3QHS A;  4M7D F;  5GAN f;  3HSB A;  3QUI A;  5DY9 A;  5LJ3 d;  2DEQ A;  3JCM g;  5GMK e;  5LJ3 f;  3JCM X;  3RER A;  4M7A E;  4M77 A;  4C92 E;  1Y96 B;  3GIB A;  4PJO G;  3FIF A;  3PGG A;  4QVC A;  3JCM b;  5GAN g;  1B34 B;  4XU1 A;  4C8Q F;  5GAM e;  1I4K 1; 
#chains in the Genus database with same CATH topology
 3SFM A;  1PWT A;  1W2B A;  2RM4 A;  3PMI A;  1JXO A;  3CCQ A;  2CUD A;  3DLM A;  1N8R U;  5D6W A;  3TCJ A;  3I56 Q;  3H8Z A;  3H0I A;  4M7D D;  1VQ5 T;  2DRM A;  1UGV A;  4KRT A;  2CP0 A;  3H0F A;  3EFS A;  1M27 C;  2I2L A;  3BE3 A;  3OBY A;  4PJO A;  1X2K A;  1WJS A;  3EHQ A;  1VQM Q;  2KRS A;  4HXJ A;  1Q7Y R;  1K9M C;  2KRO A;  4JRI A;  1YCS B;  2YLB A;  2EAY A;  1MGQ A;  3EFO B;  1VQP A;  3OYF A;  1U3O A;  5KYX B;  3RMS A;  1EFN A;  2RK2 A;  3CCV Q;  4E7Z A;  2D8H A;  4JJD A;  3CD6 A;  1K0S A;  1UHF A;  1Y57 A;  3PTA A;  2X9H A;  2K3B A;  2YUO A;  5CQX A;  4KGV B;  3KBG A;  1JJ2 S;  4A4G A;  1F1B B;  4C0G A;  2ATC B;  4PJJ A;  3C12 A;  4M78 D;  1IHW A;  4Z02 A;  5IHN A;  2LQN A;  1K9M U;  4RTW A;  1JXM A;  3EGD A;  4BDY A;  2GFA A;  4MDW A;  2E6Z A;  4M7D A;  3OYG A;  4IUT A;  1M2O A;  1B07 A;  2KT8 A;  2Y4X A;  2A37 A;  2O4X A;  4JRK A;  3L2V A;  2XHC A;  1NM7 A;  1X01 A;  4A4K A;  4EMK A;  1VQL T;  1VQN Q;  5GAN 3;  3EG9 B;  1TTH B;  2NUT B;  2GF7 A;  3CCR A;  2KSS A;  1K76 A;  4N4I A;  3G6E T;  3QHS A;  3HSB A;  3RER A;  4PFP A;  2KAF A;  2COZ A;  4PKC C;  3EG3 A;  1RI9 A;  3C4S A;  4C8Q F;  1M4Z A;  2OTJ T;  3CCM A;  2A3L A;  2PZ1 A;  3P8H A;  3QDF A;  2O9S A;  1BU1 A;  2L3R A;  3OMG A;  2OAW A;  1RUW A;  3E19 A;  2HEQ A;  1JO8 A;  2EBP A;  2J05 A;  1X27 A;  4M78 A;  3MP1 A;  2MWP A;  3SDZ A;  1EIF A;  1TG0 A;  1O75 A;  2DJQ A;  1VQ4 T;  4UC4 A;  4ZN1 A;  1IRX A;  3PVL A;  3LH0 A;  2K2M A;  2GTJ A;  3HHT B;  1D3B B;  3R6O A;  2B86 A;  5FRO A;  2F5T X;  2LNH B;  3DB3 A;  5GAO r;  5D7U A;  4J6X A;  3ER0 A;  1PKS A;  2VV5 A;  2YLC A;  3CBM A;  3OYH A;  1YI2 A;  2BKD N;  3JCM J;  3OYI A;  1Y96 A;  4DA4 A;  1RAE B;  2ZZD A;  2K6D A;  4F7U A;  3JCM e;  2JS0 A;  1K73 R;  1RAB B;  2E12 A;  1H92 A;  1M30 A;  3N5B B;  3VS5 A;  1AVZ C;  2NUP B;  1QCN A;  2LC4 A;  3QYG B;  4E7L A;  2KNB B;  1M2V A;  1YJW Q;  4LDX A;  3QYH B;  2FZK B;  3BW1 A;  4Y28 E;  1Z9Q A;  2VXF A;  5HK0 A;  1HYO A;  2M1H A;  4M77 G;  2DL7 A;  3LYI A;  4NL3 A;  3RMQ A;  2DL8 A;  2X4J A;  2QEX A;  1I1J A;  3NHN A;  1UEB A;  1Q81 C;  2QYZ A;  4M77 E;  1ACM B;  3FC3 A;  3IQL A;  4ELY C;  4FT4 A;  1TH7 A;  4HCB A;  4XTY A;  3JCM d;  2XMF A;  5CKH A;  1ZUY A;  1WNL A;  1VQL Q;  1OOT A;  3CME T;  5L23 A;  3OYN A;  1QKW A;  2X35 A;  1K4U S;  1UGR B;  4PJO G;  4ZGE B;  3M55 A;  1B34 B;  3G7Z A;  5GAM e;  2DEU A;  3SB2 A;  1Q82 U;  1VQ8 T;  3OYK A;  4MML A;  3VV0 A;  2QDY B;  1D1C A;  1AHJ B;  1X2Q A;  3CBO A;  3WXM B;  3OYL A;  2RQR A;  2PUK B;  3JCM W;  2Z0W A;  1Q81 U;  2HL5 C;  1BI1 A;  4L5G A;  2RNA A;  2KEA A;  2RHU A;  1ZSZ B;  3PVQ A;  4ZGD B;  4OMO A;  1TS9 A;  3GP8 A;  3AT1 B;  5GAM j;  5KCO A;  2V8I A;  1HXD A;  4OMP A;  2CP6 A;  2O88 A;  2K3Y A;  1C0M A;  2FPD A;  2KMT A;  2ZPI B;  4M77 C;  2F1L A;  2PUO B;  1XNI A;  2E65 A;  1X75 C;  4YTL A;  1VQ7 A;  5GAM d;  2X4X A;  3P8D A;  1WJR A;  4ATO A;  1VQO A;  3I5S A;  3UAT A;  1RI0 A;  4FSS A;  4E7J A;  4M7D G;  2WSE E;  5FU6 B;  2FZG B;  2RJC A;  1T3L A;  3H9N A;  3CEY A;  4RCB A;  2EYX A;  3OS5 A;  5HY6 A;  2ABL A;  2VUB A;  1AWJ A;  2GFU A;  2FHD A;  1OPK A;  1E7O A;  1AD5 A;  4PJO C;  1PM3 A;  4NS5 A;  1NEB A;  1OYX A;  4C92 F;  4FM4 B;  4IUR A;  4PL6 A;  1N8R R;  1UHC A;  4RMO A;  1QKX A;  1YNZ A;  2NWM A;  1UE9 A;  5C0M A;  2QQB A;  2QAS A;  3I55 A;  3CCJ Q;  1UFF A;  1B3Q A;  1WI7 A;  4HKE A;  3VYG A;  5CCA A;  4X9D A;  1WHL A;  1YHQ A;  2RK1 A;  2XU8 A;  1QVF P;  3CCS T;  4M78 G;  4OMN A;  1PG5 B;  4E7H A;  2RHX A;  5GAN f;  2KBT A;  5I22 A;  2HBW A;  5KCH A;  3GIB A;  3ZBD A;  1GCP A;  4M7D C;  1ABO A;  4RTX A;  1UGS B;  2OX7 A;  3RES A;  3FDR A;  3OSS C;  3CCL A;  3OW2 A;  5IH2 A;  3JCM h;  4M7A A;  4XTZ A;  1NPR A;  3M53 A;  3CCU A;  1IZ6 A;  2KGT A;  1FMV A;  3LWI A;  1TUC A;  4RCC A;  4CI0 C;  3JCM V;  2XIC A;  1QVG S;  1H8K A;  2P84 A;  1X43 A;  4XU0 A;  4EMK C;  5CO7 A;  1K9M R;  3OB9 A;  5J3B A;  4F7U G;  3I9Q A;  4A4H A;  3OS2 A;  5HCK A;  4LDY A;  2JM9 A;  1CKB A;  3SWN A;  2R58 A;  4F7U E;  4GBQ A;  4X9C A;  2HCK A;  4IIO A;  1VA7 A;  3A8O B;  2EYQ A;  3M0Q A;  5KYU B;  4JUV A;  2ED1 A;  1H3Z A;  1PSE A;  1HSQ A;  1JEG A;  4DEX A;  4ZGJ B;  4J9G A;  4AG1 C;  5LJ5 g;  4M78 C;  3MET A;  2EPD A;  3H0H A;  1VIF A;  2EYZ A;  5HK3 A;  1WLP B;  3ME9 A;  4HT8 A;  2AHJ B;  5A0D A;  2LQ8 A;  3VRY A;  1W70 A;  3L2Z A;  4RTU A;  3TU4 K;  2OTL T;  5GAM h;  2QI2 A;  4ELZ C;  4NOY A;  4IUQ A;  4C5H A;  3OW2 S;  1KD1 C;  3GNG A;  3EGX B;  4BE1 A;  2ZPH B;  3LGF A;  1TWB A;  3NGP A;  2RA2 A;  2DXU A;  4DBQ A;  1OU9 A;  3CC2 Q;  1WDX A;  4J9F A;  3A8G B;  2YT6 A;  2VGM A;  3UPU A;  2DXB A;  3EFO A;  2HKQ B;  3BDU A;  1UG1 A;  1R0C B;  5KYX A;  2DET A;  1Q95 G;  4MZT A;  2WSC E;  1VQ9 T;  2RQT A;  4FYV B;  2BZX A;  3EH1 A;  3MCA B;  4Y92 A;  4N4G A;  4FYW B;  2RH2 A;  1YJ9 T;  4KUD K;  5FW9 A;  3O5Z A;  3VS0 A;  1KD1 U;  1RAF B;  2DVJ A;  4FT2 A;  4II1 A;  1NLO C;  7AT1 B;  3JV3 A;  5LJ3 g;  2DIG A;  4DEY A;  1EX4 A;  3CMA A;  2V8J A;  1P92 A;  5DLO A;  4HVV A;  2H3J A;  4XU3 A;  1XTD A;  2DFU A;  5FRM A;  1SRM A;  1WQ7 A;  3V7R A;  5GMK i;  4IUU A;  2MCN A;  3MHX A;  2DE0 X;  3PNW C;  1WHG A;  5FU7 B;  3QO3 A;  1BI3 A;  2EWN A;  2FG0 A;  2FVU A;  2JVV A;  2NLU A;  1LVK A;  2CSQ A;  2QQR A;  3EG9 A;  1QLY A;  2NUT A;  4F14 A;  3L42 A;  2YRC A;  1AZG B;  1YI2 Q;  1VQM T;  1M9S A;  1C6V X;  3VS4 A;  2EGE A;  2RJD A;  1QCF A;  3V7C A;  2DNU A;  2VYT A;  4OF1 A;  2DIQ A;  1LNX A;  3TSW A;  1I8F A;  3NFC A;  2OTJ A;  3T9N A;  2BZ8 A;  4C0F A;  2DAQ A;  3MPU B;  1Q82 R;  4C92 B;  2KE9 A;  2QA4 A;  1T3S A;  5GMK m;  1IGU A;  1Q81 R;  3MEU A;  2HAX A;  1W4S A;  3UF4 A;  1KHC A;  1M1F A;  1D3B A;  1VQ4 A;  2RN8 A;  3PIP A;  3LLR A;  3CCE A;  3RDV A;  2A36 A;  5A2Q E;  4LDW A;  2QAZ A;  4M7A G;  4XQ3 A;  1AWO A;  3RR6 A;  1GBQ A;  4M75 F;  1VQ6 A;  2JS2 A;  4M7A E;  5GMK e;  3OA6 A;  1KQS P;  3EG0 A;  1VQN T;  3RBB B;  4XAX B;  2RQW A;  1Y7X A;  3G4S T;  3TVT A;  2NUP A;  1YP5 A;  3E9F A;  3QWY A;  5GAN 8;  5A0G A;  5J39 A;  5FRN A;  1GFD A;  1S72 T;  2DYI A;  4OGE A;  5GMK j;  2CP3 A;  1UJY A;  2ZGW A;  4BE0 A;  4E7I A;  4M77 F;  1TSF A;  1YIT A;  1VQK Q;  1E6G A;  2HL3 A;  1PC0 A;  2CT4 A;  2HNI A;  4BI8 B;  3CC7 A;  1VQ7 Q;  2DMO A;  4DQ2 A;  4KH1 B;  2XDB A;  3HFN A;  1PHT A;  1G5V A;  4C5G A;  2E64 A;  3VS2 A;  2KRM A;  1EZZ B;  4IKF A;  3DKM A;  4PJO F;  4XTX A;  1SHG A;  2E3I A;  1B34 A;  3CME A;  2D8J A;  4LDU A;  4CRI A;  2COW A;  2RHZ A;  4QT7 A;  1M3B A;  1MUZ A;  4EIK A;  5GAN e;  1I5L A;  1UGP B;  1YJN A;  1KQ1 A;  3HFO A;  2DK3 A;  3EG1 A;  5IHK A;  1YIJ Q;  1ZSZ A;  3G71 T;  3SWN C;  4N4H A;  2M16 A;  1M90 C;  2DJZ A;  2YUP A;  5GAN j;  2M9U A;  1PSF A;  3V8K A;  3GBQ A;  3LH5 A;  1JBM A;  1YJW T;  2LCS A;  1W2B S;  1KFZ A;  2HQE A;  2WSF E;  2IG0 A;  2M0O A;  4J9E A;  4MZM A;  1OPL A;  5GAN d;  4M7D F;  4JZ3 A;  1K9A A;  2Y4Y A;  5AYF A;  2YUN A;  3G1J A;  1NG2 A;  2DYB A;  3PGG A;  1SKU B;  2DL5 A;  5ECA A;  2M0Y A;  5KYW B;  3JSC A;  3GF5 A;  3MJX A;  3HP9 A;  4BUG A;  1M90 U;  1Y71 A;  1G8X A;  3L2U A;  4E6R A;  3TEE A;  3GPL A;  2HZY A;  1K1Z A;  3FLG A;  1I0C A;  2YUQ A;  3H6Z A;  4D6W A;  3G4S Q;  3X25 B;  3RKY A;  5GAM g;  5CQY A;  1S72 Q;  4DBH A;  4RUG A;  3E2U A;  1AT1 B;  2GBQ A;  1ZHI A;  2RI5 A;  2DD4 A;  5CKE A;  3HPW A;  5GMK l;  3JB9 D;  1MND A;  4PJM A;  2K5L A;  4M78 F;  1NBE B;  5EG2 A;  4R56 A;  1G3S A;  2JTM A;  2MF2 A;  1AOJ A;  1OI1 A;  3CCS A;  3GLX A;  5I2S A;  1ZQ1 A;  5CKD A;  4AG2 C;  3M4Y A;  2DLP A;  5GMK h;  1KD1 R;  2AKK A;  1W1F A;  4FW1 A;  1N9R A;  4KUL A;  2RHI A;  2JXB A;  2F5K A;  5GAO m;  4JJN K;  1ZA2 B;  1R8O B;  2J6O A;  2RMO A;  1M3A A;  3FJP A;  1V29 B;  4PK4 A;  2KYM A;  3G71 Q;  1TU0 B;  1MMN A;  1MV0 B;  2QQS A;  3L1A A;  3M0S A;  1NLP C;  3A8M B;  2YSQ A;  2YDL A;  4M75 B;  1D1B A;  1FMW A;  1PCX A;  1Q82 C;  3CCJ T;  1XJW B;  3JCM b;  3NTI A;  1UEC A;  3OYJ A;  5CAI A;  2CT3 A;  3L2R A;  2PNI A;  3VS7 A;  1GBR A;  2DRK A;  1OQK A;  1X6O A;  2QXF A;  2COY A;  5CIU A;  1TOV A;  2Y90 A;  2LT1 A;  4EMG A;  5GAN h;  2OTL A;  1VYV A;  1W6X A;  3C95 A;  4RTV A;  3GNF B;  2EJF A;  2AZS A;  2FRY A;  3CCQ T;  3E1S A;  2ECZ A;  4QVZ A;  1G3T A;  4MMK A;  3A98 A;  4OML A;  1YWO A;  3HRU A;  2L8D A;  4A53 A;  4WF2 A;  4HVU A;  2AKL A;  2BIV A;  2QK0 A;  1PNJ A;  2AT1 B;  1IO6 A;  2DIL A;  1LPL A;  1BI0 A;  1RAI B;  5LJ5 f;  1YCY A;  4F16 A;  4BE2 A;  1VQ9 A;  4N0A A;  4Z89 A;  4D8K A;  3VS3 A;  1M3C A;  1VIE A;  3C0C A;  1OX8 A;  1X69 A;  3NTK A;  2A28 A;  1RLP C;  4LD6 A;  4HCC A;  1WHM A;  2X3X D;  2CDT A;  4J6W A;  4FYX B;  1WXU A;  5EC7 A;  2QA4 Q;  2KRN A;  2R5M A;  3CC4 Q;  2MPX C;  3JCM Q;  3TRE A;  4A54 A;  4OGC A;  5GJV B;  2GGR A;  2EKH A;  2JM8 A;  3CCE Q;  1FWZ A;  4M7A D;  1TXQ A;  3I56 A;  2ROT A;  3CXC P;  4LUD A;  4B9X A;  1MMD A;  2JNG A;  1AWW A;  3CC2 T;  2CRE A;  2LNV A;  3QII A;  5LJ3 f;  1G3W A;  2JUF A;  4GY5 A;  1X6G A;  1QMC A;  4QVC A;  1VQM A;  3MO8 A;  1PRL C;  3UA7 A;  4IUV A;  3VYH B;  1K0X A;  4NL2 A;  1ZSZ C;  2KVQ G;  1YWP A;  3BDL A;  1PKT A;  4KUI A;  3MEV A;  4C0D B;  8ATC B;  3S3M A;  3CCV A;  2EQU A;  4C92 A;  2MIO A;  2CZ0 B;  4LDV A;  1UB4 A;  1ZA1 B;  5DLQ E;  1OEB A;  5I2M A;  3CCM T;  1IXD A;  5KE3 A;  4OP0 A;  4C8Q B;  3M0U A;  2A7Y A;  5GAO l;  4J9H A;  4DBR A;  1YIT Q;  1TUD A;  5FU6 C;  1IRE B;  4ANJ A;  2YXY A;  3CCQ Q;  1I07 A;  4C8Q E;  3QDR B;  3CC7 Q;  4BB7 A;  2FRW A;  2M02 A;  1I81 A;  2E41 A;  3X28 B;  3HRS A;  3QBY A;  2D0N A;  2MK5 A;  4BDZ A;  4HVW A;  2X51 A;  4C5I A;  1G3Y A;  1YN8 A;  1ABQ A;  4O5V A;  1WZO A;  3X20 B;  2CP7 A;  1QWF A;  1VQN A;  1VQP Q;  3JB9 G;  1YI2 T;  5IN1 A;  4GLK A;  1M90 R;  1PD1 A;  1SPK A;  2DZC A;  3EG2 A;  1ZSG A;  3CD6 Q;  2K3X A;  1T0H A;  2SRC A;  4V2S A;  3M4G A;  1D0Y A;  3REA B;  1H64 1;  1U1T A;  1HK9 A;  1WHJ A;  3MEW A;  4AMC A;  1MMA A;  5DM7 R;  4CC2 A;  2DX1 A;  3NTH A;  9ATC B;  4A4F A;  2EJG A;  3OYD A;  3LX7 A;  3CPW P;  3JB9 J;  2EYW A;  4ME7 A;  1SG5 A;  2K79 A;  5L8R E;  2QEX T;  3RNJ A;  2RQU A;  3EH2 A;  3JCM X;  3M56 A;  5FWB A;  1VQ5 A;  3OQ5 A;  1ZLM A;  2CP5 A;  1BBZ A;  2IVW A;  4ZTJ A;  3I35 A;  3OS1 A;  3M54 A;  2O01 E;  1B7T A;  4JRP A;  2L3S A;  5KYY B;  5GAO q;  3M58 A;  2EGC A;  2EQM A;  1WPY A;  1VUB A;  3S3O A;  3CCR Q;  2LP5 A;  3LWH A;  1NYF A;  2BE9 B;  5CR2 A;  4F04 B;  1CSK A;  4MZP A;  1TUG B;  3U23 A;  1Z9Z A;  4CC3 A;  3KUF A;  1YBY A;  4BD3 A;  2D9T A;  3OMC A;  3CCM Q;  1QVF A;  3JB9 I;  2LCC A;  4DBF A;  4QW2 A;  3O8V A;  4ZNX A;  2DO3 A;  1XQH A;  4LXC A;  5GAN 2;  4RG8 A;  3M59 A;  1NEG A;  3A5Z B;  1KK7 A;  2C0I A;  5KYN A;  1FXX A;  2EVR A;  1VQK T;  2MOX A;  5I11 A;  5KYW A;  5CVI A;  1VQ7 T;  1OUL A;  1VQO T;  1JJ2 P;  2JMC A;  1N6A A;  4XU2 A;  1K8A C;  2CKK A;  2ZPG B;  2J6F A;  1VQL A;  4XK8 E;  1V76 A;  2HKN A;  3QSU A;  2PVG B;  5D6X A;  4BY6 B;  1VYU A;  2DKG A;  5GAN 4;  1D1A A;  3G6E A;  2PQW A;  4BI3 A;  3KXT A;  1IGQ A;  2LDM A;  1UTI A;  2DER A;  1CKA A;  2RO0 A;  4EMH A;  4RG2 A;  2RB6 A;  1YIJ T;  1QVF S;  5KH6 A;  4FYY B;  4FCY A;  4C92 G;  2G6F X;  2YRD A;  1MV3 A;  2OAU A;  2XI9 A;  3BFM A;  4LNP A;  3OYY A;  4JRQ A;  5DY9 A;  4C92 E;  3J7A F;  1K8A U;  4FIB A;  3ASK A;  2QEX Q;  4M4Z A;  2DZ9 A;  3OYE A;  2DL3 A;  3EAE A;  1ZBJ A;  1Q86 C;  4KGX B;  5IHI A;  2K7A A;  4J6Y A;  2RD1 A;  3SHW A;  3UDC A;  2KXD A;  1PD0 A;  2KYB A;  2X4Y A;  4L59 A;  2CUB A;  4PFO A;  4PJN A;  5LJ5 j;  4R55 A;  6AT1 B;  2JN0 A;  2GCX A;  2IPO B;  4L6V 5;  1AWX A;  2LTO A;  3VKI A;  1KHI A;  3M0P A;  4E7K A;  4OMQ A;  3OYM A;  1RAC B;  5M9O A;  1U5S A;  3FJ5 A;  4M75 A;  5D6Y A;  5LJ5 d;  2K5I A;  3ZL7 C;  4X34 A;  1SSH A;  1Q86 U;  2FEI A;  1WIE A;  1RL2 A;  4R0K A;  2K9G A;  2H8H A;  2LQK A;  4C92 C;  1KQ2 A;  3CCJ A;  1MNE A;  1Y07 A;  1O9S A;  3J81 E;  2PVD B;  3LW5 E;  3H41 A;  3KFV A;  2DVE A;  3BY7 A;  1D0Z A;  3M9Q A;  1NJI R;  2H3E B;  2KXC A;  2BTT A;  4BAC A;  4OB0 B;  1VQO Q;  1H3H A;  1X6B A;  4J8O A;  5FLX E;  4HT9 A;  2HMA A;  4ESR A;  2PTK A;  3QKJ A;  3M5A A;  2E5Q A;  3HKS A;  4AFS C;  1PRM C;  3MP8 A;  4M7A C;  1BIB A;  2A0F B;  3THK A;  4AT1 B;  1N9S A;  3AHU A;  4QQ6 A;  2A08 A;  5LJ3 j;  2QGF B;  3J80 E;  2ZPF B;  2YRV A;  1WA7 A;  2ESW A;  4J9C A;  1WGS A;  1AZE A;  1VQ8 A;  3REB B;  2D6F A;  1GXI E;  1M1G A;  3HRT A;  1QCO A;  2JT4 A;  5LJ3 d;  3EHR A;  4LN2 A;  3JCM g;  3TSZ A;  4RTY A;  2W0Z A;  1ZBX A;  2ED0 A;  2PU9 B;  3ZEH A;  2QTX A;  2EQJ A;  4KT0 E;  2VAS A;  2CZ7 B;  3I55 Q;  5IAY A;  4Q5W A;  5GAN 5;  2CGH A;  1YHQ Q;  2DM1 A;  2E70 A;  3L2Q A;  2M51 A;  4KH0 B;  2J7I A;  1S1N A;  1QWE A;  4C8Q D;  2L3Q A;  3CMA T;  3TQ7 P;  5GAN 7;  3WVD B;  2LX7 A;  3URG A;  4J7I A;  1C1A A;  1BI2 A;  1BCM A;  4Z88 A;  1N27 A;  2DPP B;  2LJ0 A;  2VKN A;  2MMP A;  4JLI A;  3CCL Q;  2HQX A;  4CC7 A;  1BKB A;  2R5A A;  1UUE A;  4XTV A;  3CCU Q;  3A8H B;  2K57 A;  3CBP A;  2C06 A;  1KQS A;  1GFC A;  1RLQ C;  2EKO A;  2AZV A;  4C5E A;  1NPP A;  3RKX A;  3CC2 A;  3EFR A;  3C94 A;  1IHV A;  4B6M A;  2O2O A;  2JW4 A;  4FW2 A;  2MYS A;  3F70 A;  5LJ5 h;  2DD5 A;  4HA8 A;  4JS4 A;  2EFI A;  3DB4 A;  1OV3 A;  5GAO n;  1MMG A;  3MP6 A;  3NMZ C;  4C8Q A;  3E9G A;  1KG1 A;  2CZ6 B;  3D7S B;  3S6W A;  2QA4 T;  2K5F A;  3OY9 A;  3CC4 T;  4OB1 B;  2EIF A;  4P5N A;  3OYA A;  1KQS S;  1GL5 A;  1VQ5 Q;  3CCE T;  2CH4 A;  4F7U F;  4AFQ C;  3PIO A;  1AEY A;  2RJE A;  5KE2 A;  1VQ6 T;  3JB9 F;  3V7S A;  1NE8 A;  3M0R A;  3QJY A;  4M75 G;  4XTW A;  5KYU A;  3X24 B;  1HJD A;  1GRI A;  5LJ3 h;  1QVG P;  4QQG A;  1SF9 A;  4M75 E;  2MAM A;  2CS7 A;  1DJ7 B;  1GCQ A;  1QP2 A;  3OBW A;  4JPB W;  4CC4 B;  3CMA Q;  1M1K C;  2X4W A;  1WXB A;  2QQ9 A;  1U06 A;  4J5Y A;  3VJP A;  5FWC A;  1UJ0 A;  4JLG A;  3EGX A;  2L0A A;  3RKW A;  2L2P A;  4DOV A;  2OI3 A;  1QQJ A;  4M77 B;  1YIT T;  2RJF A;  4OMF B;  1VYT A;  5CKF A;  3OS0 A;  1KIK A;  3JB9 H;  3CC7 T;  5IXF A;  3FEO A;  1NZ9 A;  5HKC A;  2MI6 A;  1K8A R;  2ZAE A;  5IXB A;  3CPF A;  1SRL A;  4QVD A;  1ZUK A;  5KYY A;  4HCZ A;  3RUX A;  2O9V A;  3QPH A;  2X3W D;  3S3N A;  1M1K U;  2F2W A;  1RAA B;  2HDA A;  3OW2 P;  3DLL A;  1SSF A;  4J9I A;  4D8D A;  2ZPB B;  1J3T A;  4PJO B;  3G6E Q;  1VQP T;  1YJN T;  3EGU A;  2BZY A;  1KSW A;  4M75 C;  1YJ9 A;  3FB9 A;  4PJO E;  3JRZ A;  2VGN A;  4K11 A;  4C92 D;  3CD6 T;  2KI7 A;  4FSX A;  2OTJ Q;  3OYB A;  3A8L B;  4ORZ A;  2XDP A;  8AT1 B;  2P0Q A;  1N5Z A;  3VS1 A;  3QZ5 B;  1JB0 E;  4FL6 A;  4HCK A;  2O31 A;  4TVR A;  3X26 B;  1FYN A;  4EPC A;  2DEQ A;  1NJI C;  1HD3 A;  3JAM E;  3R6N A;  2LRQ A;  2KQW A;  4PLL A;  3SEM A;  3QXE B;  2MWO A;  1I4K 1;  1Q86 R;  1VQ4 Q;  2JMA A;  2RF0 A;  2BUD A;  1VQK A;  1XOV A;  4QQD A;  2FYK A;  2ROL A;  1ARK A;  1R77 A;  4AFZ C;  3OSV A;  2NYS A;  1KC8 R;  2V26 A;  3UA6 A;  4ZTF A;  1QVP A;  3EGD B;  2F2V A;  4M7D B;  2FZC B;  1VQ6 Q;  2JTF A;  2DXC A;  1OZ2 A;  5GJW B;  3UT1 A;  1BB9 A;  2KK4 A;  4M7D E;  2O4X B;  2P4T A;  4LE9 A;  1JQQ A;  2HSP A;  1NJI U;  1BK2 A;  4J9D A;  4EMK B;  1M5Q 1;  3CCR T;  1Q7Y C;  3MEA A;  1M8V A;  4WTO B;  1QVG A;  4J9B A;  3M0T A;  2HQH A;  2XID A;  1U1S A;  1YIJ A;  4KGZ B;  2AIR B;  2E5K A;  2VVK A;  4ZN3 A;  2XDD A;  2L89 A;  4Z8A A;  3L2W A;  2ENM A;  4OB2 B;  3NPF A;  2DTO A;  5GAO p;  2LMJ A;  3VUZ A;  1UGQ B;  2NUZ A;  3MKD A;  2XD0 A;  4PJL A;  2LVM A;  2P4R A;  4C8Q G;  2OJ2 A;  2YHT A;  2EJ9 A;  3VU3 C;  2EYY A;  2EQI A;  5I21 A;  3RIR A;  2J6K A;  4M7A F;  1G2B A;  4M78 B;  1JRI A;  4J83 A;  2GTO A;  2GQV A;  1Q7Y U;  4M78 E;  2EGA A;  2C0T A;  2VB6 A;  4KBM B;  3CME Q;  4E2F B;  2WAC A;  2CZ1 B;  1SEM A;  2KR3 A;  3LGL A;  5LL6 S;  4JS5 A;  1YJN Q;  2DA9 A;  1WJQ A;  2YWW A;  3ZFJ A;  1WYX A;  1VQ8 Q;  2VWF A;  3G4S A;  4JZ4 A;  2PVO B;  1S72 A;  1RAH B;  1Y96 B;  4C0D C;  3FIF A;  4F17 A;  2QTV A;  4F7U B;  1KJW A;  1E6H A;  4A4E A;  5AT1 B;  1OZ3 A;  2L3P A;  2C0O A;  2KDS A;  3OYC A;  2RHY A;  4OMM A;  4BI4 A;  4RTT A;  3INZ A;  2LX9 A;  2D0Q B;  4C8Q C;  1QW1 A;  1M2V B;  1UDL A;  1IB8 A;  4JJB A;  2CSI A;  2L5Q A;  2FL7 A;  2FPE A;  4JDS A;  2LZ6 B;  2JJ9 A;  2DXT A;  2LJ3 A;  3JCM c;  2XK0 A;  3JCM P;  3CXC A;  2CYZ B;  1Y0M A;  1WHK A;  3VRZ A;  4B9W A;  3M57 A;  4PFZ A;  3QZ9 B;  3WVE B;  3HTR A;  4O6J A;  5GAN 6;  1BCO A;  5CK9 A;  4VUB A;  2DBK A;  2CP2 A;  4FU6 A;  2EQK A;  2D1X A;  3PMT A;  3PE0 A;  3G71 A;  2QQA A;  2GNC A;  3FRN A;  4EDU A;  1WXT A;  3ULR B;  2VXE A;  1LOJ A;  1K73 C;  1U8R A;  1WHH A;  1G83 A;  3PFS A;  4LUE A;  1YJW A;  1GCQ C;  2FPF A;  2VC8 A;  2CH4 W;  1VOM A;  1V1C A;  2DTH A;  3CCS Q;  1WX6 A;  1D0X A;  1I5O B;  5J26 A;  2KY9 A;  3PT9 A;  3CQT A;  2V1Q A;  3CXC S;  2B8A A;  1OU8 A;  2V1R A;  2XG8 D;  4PLI A;  1RAD B;  1MHN A;  3JCM f;  1NYG A;  1W2B P;  3Q1J A;  3QG1 A;  3QUI A;  1K73 U;  3A1P A;  5A0L A;  3I5R A;  4RTZ A;  3SD4 A;  5GAN g;  3I56 T;  1ZX6 A;  2RI2 A;  1FMK A;  2LQW A;  4OVA A;  4N0A C;  4E47 A;  4E7S A;  2E1H A;  2K4Y A;  1BIA A;  2KT1 A;  4M75 D;  4RKU E;  2RPN A;  3QWX X;  1D09 B;  1RAG B;  2K2V A;  2R57 A;  2BE7 D;  2E6N A;  2FO0 A;  3GOX A;  2HD0 A;  4J7F A;  3I55 T;  1M1K R;  2AK5 A;  2GQI A;  4MDX A;  4QKU A;  1YHQ T;  3CCV T;  2FB7 A;  3CPW A;  2DF6 A;  5C6S A;  3UWN A;  2F69 A;  1YFN A;  5LJ5 e;  4DOW A;  3P8B B;  2F2X A;  2QDL A;  3HL8 A;  5IT9 E;  5GAM f;  2LCL A;  4IIM A;  2HBP A;  5FU7 C;  2XKO C;  4M77 D;  4Y91 A;  2LJ1 A;  3CC4 A;  2E4H A;  1OX9 A;  1KC8 C;  2OTL Q;  2DBM A;  2HSE B;  2RQV A;  1FX7 A;  4GLM A;  3CCL T;  2RI3 A;  2IIM A;  4AFU C;  2P0K A;  2J06 A;  4XTU A;  4BY6 C;  3CCU T;  1LCK A;  2ZCF B;  2JTE A;  2E10 A;  4M7A B;  1BYM A;  4IUP A;  2EW3 A;  4X1V A;  2W10 A;  2LT4 A;  2G3R A;  1SHF A;  4WCI A;  1R0B G;  2V8K A;  1QP3 A;  4PJO D;  4LD9 K;  2DL4 A;  2I0N A;  4C0Z A;  1VQ9 Q;  4A63 B;  1N8R C;  4PNO A;  2QGG A;  3V8L A;  1YJ9 Q;  1KC8 U;  2ZPE B;  1WQW A;  4JJC A;  3VUB A;  2QG9 B;  1WFW A;  3SWN B;  1T0J A;  3CPW S;  5CKB A;  2P0P A;  4OB3 B;  5LJ3 e;  2JOY A;  2E3H A;  2DTI A;  3V8J A;  1A0N B;  1LJO A;  2JZ2 A;  1ZUU A;  1JU5 C;  4M77 A;  1M8M A;  2SEM A;  1JJ2 A;  3VS6 A;  4XU1 A;  3QJ6 A; 
#chains in the Genus database with same CATH homology
 4IUV A;  3SFM A;  4F7U F;  3VYH B;  5LJ3 g;  2DIG A;  4NL2 A;  2KVQ G;  2RM4 A;  3PMI A;  1W2B A;  3CMA A;  3CCQ A;  3PIO A;  2V8J A;  3BDL A;  1P92 A;  5DLO A;  3DLM A;  4KUI A;  1N8R U;  2H3J A;  3MEV A;  2RJE A;  5D6W A;  4C0D B;  3TCJ A;  5KE2 A;  3S3M A;  3CCV A;  1VQ6 T;  3JB9 F;  3H8Z A;  4XU3 A;  2EQU A;  4C92 A;  1XTD A;  4M7D D;  3V7S A;  2CZ0 B;  1VQ5 T;  1NE8 A;  4LDV A;  5FRM A;  1UB4 A;  1WQ7 A;  3CCU A;  3QJY A;  4M75 G;  5DLQ E;  4IUU A;  4XTW A;  3V7R A;  3EFS A;  5GMK i;  3X24 B;  2I2L A;  5LJ3 h;  5I2M A;  3CCM T;  5KE3 A;  4QQG A;  3OBY A;  3MHX A;  4OP0 A;  4PJO A;  4M75 E;  2MAM A;  3PNW C;  1WJS A;  4C8Q B;  2CS7 A;  5FU7 B;  2A7Y A;  3QO3 A;  5GAO l;  1K9M C;  1BI3 A;  4JRI A;  2YLB A;  1DJ7 B;  1QP2 A;  2EAY A;  1MGQ A;  2EWN A;  1VQP A;  5FU6 C;  3OBW A;  1IRE B;  1M1K C;  2X4W A;  2FVU A;  3OYF A;  4C8Q E;  3QDR B;  2JVV A;  2NLU A;  3RMS A;  2QQ9 A;  4BB7 A;  2RK2 A;  4J5Y A;  3VJP A;  2QQR A;  1I81 A;  3L42 A;  4JLG A;  2E41 A;  3X28 B;  3HRS A;  3QBY A;  3CD6 A;  4BDZ A;  3RKW A;  1VQM T;  1M9S A;  4DOV A;  4M77 B;  2RJD A;  3PTA A;  1YIT T;  3V7C A;  4C5I A;  2RJF A;  5CQX A;  1G3Y A;  2VYT A;  4OMF B;  4OF1 A;  5CKF A;  3KBG A;  3OS0 A;  1JJ2 S;  4O5V A;  2DIQ A;  1LNX A;  3X20 B;  1I8F A;  3CC7 T;  3JB9 H;  4A4G A;  3FEO A;  1NZ9 A;  4C0G A;  3NFC A;  5HKC A;  2MI6 A;  1VQN A;  3CPF A;  3C12 A;  4M78 D;  2OTJ A;  4QVD A;  3T9N A;  4C0F A;  2DAQ A;  3JB9 G;  4Z02 A;  1YI2 T;  4HCZ A;  5IN1 A;  3RUX A;  4C92 B;  1K9M U;  3QPH A;  4GLK A;  4BDY A;  2GFA A;  2QA4 A;  3S3N A;  4MDW A;  2E6Z A;  1M1K U;  4M7D A;  2DZC A;  3OYG A;  3DLL A;  2K3X A;  1SSF A;  4IUT A;  4V2S A;  2ZPB B;  5GMK m;  3M4G A;  3MEU A;  2HAX A;  1W4S A;  4PJO B;  1VQP T;  1H64 1;  1KHC A;  1M1F A;  2Y4X A;  1U1T A;  1D3B A;  1VQ4 A;  1YJN T;  2O4X A;  4M75 C;  1HK9 A;  3MEW A;  4JRK A;  3L2V A;  3PIP A;  3LLR A;  1YJ9 A;  3FB9 A;  2XHC A;  3CCE A;  3JRZ A;  5DM7 R;  4PJO E;  1X01 A;  2VGN A;  4A4K A;  4EMK A;  5A2Q E;  1VQL T;  3NTH A;  4LDW A;  4C92 D;  3CD6 T;  4FSX A;  3OYB A;  3A8L B;  4A4F A;  2XDP A;  2EJG A;  5GAN 3;  3OYD A;  4M7A G;  4XQ3 A;  3LX7 A;  3JB9 J;  2GF7 A;  4ME7 A;  2P0Q A;  3CCR A;  2KSS A;  4N4I A;  5L8R E;  3QZ5 B;  1JB0 E;  4FL6 A;  4M75 F;  3QHS A;  4TVR A;  3G6E T;  2QEX T;  3HSB A;  1VQ6 A;  3X26 B;  4EPC A;  2DEQ A;  3JCM X;  3M56 A;  5GMK e;  1NJI C;  2KAF A;  3RER A;  3OA6 A;  4M7A E;  4PKC C;  1VQ5 A;  3OQ5 A;  3JAM E;  2LRQ A;  2KQW A;  2IVW A;  4ZTJ A;  3C4S A;  4PLL A;  1VQN T;  3QXE B;  2MWO A;  4C8Q F;  1I4K 1;  1M4Z A;  3OS1 A;  2OTJ T;  3CCM A;  2A3L A;  2BUD A;  1VQK A;  3M54 A;  1XOV A;  3P8H A;  4XAX B;  2L3R A;  4QQD A;  2FYK A;  2O01 E;  3OMG A;  1Y7X A;  3G4S T;  4JRP A;  3E9F A;  3OSV A;  5GAN 8;  3E19 A;  5A0G A;  5J39 A;  5GAO q;  5FRN A;  1S72 T;  3M58 A;  2EQM A;  4OGE A;  1WPY A;  4M78 A;  3MP1 A;  1QVP A;  4ZTF A;  1VUB A;  2MWP A;  3SDZ A;  5GMK j;  1EIF A;  3S3O A;  4M7D B;  1O75 A;  3LWH A;  2ZGW A;  4BE0 A;  4E7I A;  2JTF A;  2DXC A;  1VQ4 T;  4UC4 A;  4M77 F;  1OZ2 A;  4ZN1 A;  3UT1 A;  5CR2 A;  4MZP A;  3LH0 A;  2KK4 A;  4M7D E;  3HHT B;  1D3B B;  3KUF A;  3R6O A;  1YBY A;  2O4X B;  2P4T A;  5FRO A;  4BD3 A;  2F5T X;  2D9T A;  3OMC A;  1NJI U;  1YIT A;  1QVF A;  3DB3 A;  3JB9 I;  4EMK B;  1M5Q 1;  3CCR T;  5GAO r;  1Q7Y C;  4BI8 B;  2HNI A;  3CC7 A;  4J6X A;  3MEA A;  1M8V A;  3ER0 A;  2LCC A;  4DQ2 A;  1QVG A;  2VV5 A;  2XDB A;  4QW2 A;  3HFN A;  3O8V A;  2YLC A;  1G5V A;  2XID A;  1U1S A;  3CBM A;  2DO3 A;  1XQH A;  3OYH A;  4C5G A;  1YIJ A;  5GAN 2;  2E64 A;  4RG8 A;  3M59 A;  4ZN3 A;  1YI2 A;  2XDD A;  2BKD N;  4IKF A;  3JCM J;  2L89 A;  3OYI A;  1Y96 A;  3A5Z B;  3L2W A;  4OB2 B;  4DA4 A;  3QJ6 A;  3DKM A;  1FXX A;  1VQK T;  2ZZD A;  2DTO A;  4PJO F;  4XTX A;  5GAO p;  2XD0 A;  3VUZ A;  1B34 A;  1UGQ B;  4LDU A;  4F7U A;  3JCM e;  5CVI A;  2LVM A;  4C8Q G;  4CRI A;  3CME A;  2E12 A;  2YHT A;  1VQ7 T;  2EJ9 A;  2RHZ A;  3VU3 C;  3N5B B;  1VQO T;  5GAN e;  1I5L A;  1N6A A;  1UGP B;  1YJN A;  2LC4 A;  1KQ1 A;  3QYG B;  4E7L A;  5I21 A;  4XU2 A;  3RIR A;  4M7A F;  1K8A C;  4M78 B;  1JRI A;  2CKK A;  2ZPG B;  3HFO A;  1VQL A;  4J83 A;  2DK3 A;  3QYH B;  4LDX A;  4XK8 E;  2GQV A;  1Q7Y U;  3QSU A;  3BW1 A;  2PVG B;  4Y28 E;  5D6X A;  3SWN C;  4BY6 B;  4M78 E;  2VXF A;  5HK0 A;  3G71 T;  2DKG A;  2M1H A;  4M77 G;  4N4H A;  2M16 A;  5GAN 4;  1M90 C;  2DJZ A;  3LYI A;  4NL3 A;  3RMQ A;  2X4J A;  2QEX A;  3G6E A;  2PQW A;  4KBM B;  4BI3 A;  3KXT A;  2LDM A;  5GAN j;  1UEB A;  2M9U A;  1PSF A;  3V8K A;  1Q81 C;  2WAC A;  4M77 E;  3FC3 A;  4ELY C;  2CZ1 B;  1JBM A;  2RO0 A;  4EMH A;  1YJW T;  4RG2 A;  3LGL A;  4FT4 A;  1TH7 A;  2RB6 A;  5LL6 S;  1YIJ T;  1W2B S;  4JS5 A;  1QVF S;  4HCB A;  1WJQ A;  2HQE A;  4XTY A;  3ZFJ A;  5KH6 A;  3JCM d;  5CKH A;  4C92 G;  2WSF E;  2OAU A;  2XI9 A;  3G4S A;  3BFM A;  1WNL A;  2IG0 A;  2M0O A;  3OYY A;  4MZM A;  5GAN d;  4M7D F;  4JRQ A;  5DY9 A;  2PVO B;  3OYN A;  2X35 A;  3CME T;  1S72 A;  4C92 E;  1Y96 B;  2Y4Y A;  5AYF A;  4C0D C;  3J7A F;  1UGR B;  1K8A U;  4FIB A;  4PJO G;  3FIF A;  3PGG A;  3M55 A;  4ZGE B;  1B34 B;  3ASK A;  3G7Z A;  4F7U B;  5GAM e;  3JSC A;  3GF5 A;  3SB2 A;  4A4E A;  1Q82 U;  2DZ9 A;  1OZ3 A;  3HP9 A;  3OYE A;  4MML A;  2KDS A;  3EAE A;  3OYK A;  3OYC A;  1VQ8 T;  2RHY A;  2QDY B;  3VV0 A;  4BUG A;  1M90 U;  1Y71 A;  1Q86 C;  4BI4 A;  3L2U A;  1AHJ B;  3CBO A;  3WXM B;  3INZ A;  3OYL A;  3TEE A;  2LX9 A;  2PUK B;  3JCM W;  2D0Q B;  1Q81 U;  4C8Q C;  1QW1 A;  3GPL A;  1BI1 A;  4J6Y A;  3FLG A;  2RD1 A;  4L5G A;  3H6Z A;  3UDC A;  2RHU A;  4D6W A;  3X25 B;  3RKY A;  4ZGD B;  5GAM g;  3GP8 A;  2X4Y A;  2L5Q A;  4L59 A;  5CQY A;  2FL7 A;  4JDS A;  5GAM j;  5KCO A;  2V8I A;  2DXT A;  1HXD A;  1ZHI A;  2RI5 A;  3JCM c;  2XK0 A;  5LJ5 j;  4R55 A;  3JCM P;  2K3Y A;  3CXC A;  2CYZ B;  2DD4 A;  2JN0 A;  5CKE A;  3HPW A;  5GMK l;  4B9W A;  3JB9 D;  2KMT A;  3M57 A;  2ZPI B;  4M77 C;  2GCX A;  2PUO B;  4L6V 5;  1XNI A;  2K5L A;  2LTO A;  2E65 A;  3VKI A;  1X75 C;  4YTL A;  1KHI A;  1VQ7 A;  5GAM d;  2X4X A;  3P8D A;  3QZ9 B;  1WJR A;  3WVE B;  3OYM A;  4E7K A;  1VQO A;  4ATO A;  4M78 F;  5M9O A;  5EG2 A;  4R56 A;  1RI0 A;  4O6J A;  4M75 A;  1G3S A;  5D6Y A;  5LJ5 d;  5GAN 6;  5CK9 A;  2K5I A;  4E7J A;  4X34 A;  4M7D G;  1Q86 U;  2JTM A;  4VUB A;  2MF2 A;  2WSE E;  5FU6 B;  4FU6 A;  1OI1 A;  3CCS A;  3GLX A;  2RJC A;  1RL2 A;  2EQK A;  3CEY A;  5I2S A;  4RCB A;  1ZQ1 A;  2LQK A;  4C92 C;  3PMT A;  5CKD A;  1KQ2 A;  3OS5 A;  2QQA A;  3M4Y A;  5HY6 A;  3G71 A;  3CCJ A;  1Y07 A;  3J81 E;  1O9S A;  3FRN A;  2VUB A;  4EDU A;  5GMK h;  2PVD B;  3LW5 E;  2VXE A;  2GFU A;  2FHD A;  1LOJ A;  1K73 C;  1U8R A;  2DVE A;  4PJO C;  3BY7 A;  3M9Q A;  4NS5 A;  1OYX A;  1N9R A;  4KUL A;  4BAC A;  4OB0 B;  2RHI A;  3PFS A;  4FM4 B;  4IUR A;  4J8O A;  4C92 F;  1YJW A;  5FLX E;  2F5K A;  4PL6 A;  4HT9 A;  5GAO m;  4JJN K;  2VC8 A;  2DTH A;  1R8O B;  4RMO A;  3QKJ A;  3M5A A;  2E5Q A;  3HKS A;  3MP8 A;  4M7A C;  3FJP A;  1BIB A;  1V29 B;  2QQB A;  5C0M A;  5J26 A;  2KY9 A;  1N9S A;  3PT9 A;  3AHU A;  4QQ6 A;  3I55 A;  5LJ3 j;  4HKE A;  3J80 E;  3VYG A;  2QQS A;  5CCA A;  2ZPF B;  3CXC S;  2YRV A;  2B8A A;  4X9D A;  3L1A A;  1YHQ A;  2RK1 A;  2XG8 D;  3A8M B;  4PLI A;  1WGS A;  1MHN A;  2XU8 A;  3JCM f;  1VQ8 A;  3Q1J A;  4M78 G;  3CCS T;  2D6F A;  1GXI E;  1M1G A;  4M75 B;  3HRT A;  4E7H A;  3QG1 A;  2RHX A;  5GAN f;  3QUI A;  1K73 U;  5LJ3 d;  3JCM g;  1Q82 C;  3CCJ T;  5KCH A;  3GIB A;  5A0L A;  3ZBD A;  1ZBX A;  3SD4 A;  3JCM b;  3NTI A;  2PU9 B;  5GAN g;  3OYJ A;  3I56 T;  2RI2 A;  3ZEH A;  2QTX A;  2EQJ A;  4KT0 E;  5CAI A;  4M7D C;  2CZ7 B;  3L2R A;  1UGS B;  4OVA A;  3RES A;  3FDR A;  3OSS C;  5IAY A;  4Q5W A;  5GAN 5;  3CCL A;  1X6O A;  4N0A C;  2CGH A;  3OW2 A;  4E47 A;  3JCM h;  4M7A A;  2E1H A;  2K4Y A;  1BIA A;  2QXF A;  4M75 D;  1NPR A;  3M53 A;  4RKU E;  1IZ6 A;  4XTZ A;  2Y90 A;  5CIU A;  4CI0 C;  4RCC A;  3LWI A;  2E70 A;  3JCM V;  3L2Q A;  2LT1 A;  4EMG A;  2XIC A;  1QVG S;  5GAN h;  2K2V A;  2OTL A;  2R57 A;  4XU0 A;  3C95 A;  4EMK C;  2E6N A;  3GOX A;  5CO7 A;  2HD0 A;  3GNF B;  4J7F A;  4C8Q D;  3I55 T;  2EJF A;  5GAN 7;  3CCQ T;  3WVD B;  3CMA T;  3E1S A;  4MDX A;  3URG A;  3OB9 A;  4J7I A;  1BI2 A;  4QVZ A;  5J3B A;  4F7U G;  1YHQ T;  3CCV T;  1G3T A;  2FB7 A;  4MMK A;  4A4H A;  1N27 A;  3OS2 A;  3CPW A;  2DPP B;  5C6S A;  3UWN A;  3HRU A;  2F69 A;  4LDY A;  5LJ5 e;  3SWN A;  2L8D A;  4A53 A;  2R58 A;  3P8B B;  2MMP A;  4WF2 A;  4JLI A;  4DOW A;  2HQX A;  4F7U E;  3HL8 A;  4X9C A;  2BIV A;  5GAM f;  2LCL A;  1BKB A;  2R5A A;  5IT9 E;  3A8O B;  4XTV A;  3A8H B;  2HBP A;  2K57 A;  2EYQ A;  1BI0 A;  3CBP A;  2XKO C;  5FU7 C;  4M77 D;  4Y91 A;  1KQS A;  2C06 A;  3CC4 A;  4JUV A;  5LJ5 f;  1H3Z A;  1PSE A;  1YCY A;  1KC8 C;  2EKO A;  4BE2 A;  1VQ9 A;  4N0A A;  4ZGJ B;  4C5E A;  1NPP A;  3RKX A;  5LJ5 g;  3CC2 A;  3EFR A;  1VIE A;  4M78 C;  3MET A;  1VIF A;  1FX7 A;  5HK3 A;  3CCL T;  2RI3 A;  3NTK A;  3ME9 A;  2P0K A;  4HT8 A;  2AHJ B;  4XTU A;  2LQ8 A;  3C94 A;  4BY6 C;  5A0D A;  4LD6 A;  2ZCF B;  3CCU T;  3L2Z A;  4HCC A;  3TU4 K;  2E10 A;  4M7A B;  5GAM h;  2OTL T;  3F70 A;  2QI2 A;  4J6W A;  4IUP A;  4NOY A;  4ELZ C;  1BYM A;  4IUQ A;  4C5H A;  3OW2 S;  1KD1 C;  3GNG A;  4BE1 A;  2ZPH B;  2LT4 A;  2G3R A;  3LGF A;  5LJ5 h;  2DD5 A;  1QP3 A;  2R5M A;  2V8K A;  4HA8 A;  4PJO D;  4LD9 K;  4JS4 A;  2EFI A;  3JCM Q;  3DB4 A;  2RA2 A;  2DXU A;  3TRE A;  4C0Z A;  4A54 A;  4OGC A;  5GAO n;  1N8R C;  4PNO A;  3MP6 A;  3V8L A;  4C8Q A;  3E9G A;  3A8G B;  1KG1 A;  1KC8 U;  2ZPE B;  1WQW A;  2CZ6 B;  2VGM A;  3UPU A;  2DXB A;  3VUB A;  3BDU A;  3S6W A;  1FWZ A;  4M7A D;  3SWN B;  2QA4 T;  3CPW S;  2K5F A;  5CKB A;  2P0P A;  4OB3 B;  3OY9 A;  5LJ3 e;  2JOY A;  3I56 A;  3CC4 T;  4OB1 B;  4MZT A;  2EIF A;  2WSC E;  1VQ9 T;  2DTI A;  4P5N A;  3V8J A;  3OYA A;  4B9X A;  1LJO A;  2JNG A;  3MCA B;  2JZ2 A;  4N4G A;  3CC2 T;  2LNV A;  2RH2 A;  1KQS S;  3QII A;  1YJ9 T;  5LJ3 f;  4KUD K;  1G3W A;  2JUF A;  4GY5 A;  4M77 A;  3CCE T;  1KD1 U;  1JJ2 A;  4QVC A;  4FT2 A;  4II1 A;  1VQM A;  4XU1 A;  3MO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...