5GAMh

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
82
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 82
sequence length 109
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamh00
5DY9A 4EMKA 2EAYA 2RB6A 5GANj 5LJ5j 1M8VA 4PJOE 3PGGA 5I21A 3BFMA 4C92E 3L2ZA 5GAOl 5GAN5 4HA8A 4RCCA 1Y96A 4M75G 4M75A 3V8LA 3HFNA 3V8JA 3JCMe 5GAN3 4RCBA 5LJ3e 2QTXA 5GAMf 4M7AA 4C8QD 2E65A 4XTZA 2EJFA 3BDUA 4J6XA 4J6YA 2Y90A 1I81A 4XU1A 4N0AC 2DXTA 1X01A 4C92A 4M7DF 5GMKm 4PJOA 2DEQA 4M77F 4XU0A 3SWNA 3V7CA 4MMLA 5GAMj 2DZ9A 5GAN7 4M7DB 2VXFA 4HT9A 4M78G 2I2LA 3JCMg 4M75D 4C8QB 5GMKl 5GAMh 4C8QG 5LJ3g 2RA2A 1TH7A 5GAOm 5GAN4 3HSBA 1D3BA 4JRIA 4JLIA 1I5LA 2RD1A 2DZCA 3FB9A 5GAOn 4F7UE 5GANh 5LJ5h 2EJGA 4M75B 4C92D 5LJ5e 4XTWA 5GAOq 1HXDA 1M5Q1 3JCMP 4M7DC 3AHUA 4M77C 2HNIA 4EMGA 1BIAA 4M78D 4M7AE 2E41A 3V8KA 5GAN2 4EMHA 3JCMd 4M7AG 3FIFA 3RUXA 5GAOp 3JCMW 2VC8A 1B34A 5LJ3d 5GANg 3JB9I 4OP0A 4XQ3A 3JB9H 3EFRA 4C92B 4M78F 4PJOG 4QVDA 3JCMc 4A53A 4C92G 3RESA 2RM4A 4F7UA 3JCMX 4C8QF 3JB9J 4M77A 4M78B 3JCMb 2YLBA 3INZA 4A54A 3VU3C 4NOYA 5GAMe 1WQ7A 2DVEA 5GAN6 4EMKB 4N0AA 3RIRA 5GMKj 4M75F 4M7AD 2DTIA 3RKYA 5GMKh 4M7DE 4XTXA 1Y96B 4PJOD 5GANe 4M7AF 1WPYA 4M77E 4NL2A 1KQ2A 4M78C 3QO3A 4XU2A 3RERA 2YHTA 3FJPA 4C8QC 4PJOF 3JB9D 3L1AA 4M7AB 2DXUA 1LOJA 3M4GA 4C92F 4QVCA 5GAMg 3QSUA 2E64A 4V2SA 2EWNA 4WF2A 5GMKi 4PJOB 1LNXA 1HK9A 2JN0A 2DTOA 4F7UB 4F7UG 1I8FA 1I4K1 4Y91A 4M7DA 1JBMA 3JCMf 3QHSA 2YLCA 4M75C 2FYKA 1LJOA 4M77G 4X9DA 1BIBA 4JRKA 5LJ3f 3RKWA 3HFOA 4DQ2A 4PNOA 3JB9G 5LJ5g 4HT8A 3RKXA 3EFSA 2E1HA 4M7AC 4XTVA 1MGQA 4XU3A 1D3BB 3JCMQ 1N9RA 4J6WA 1U1TA 2DJZA 3BW1A 5GAMd 5LJ3j 4PJOC 4C92C 1KQ1A 4NL3A 3JCMh 3V7SA 4M78E 1WNLA 5LJ3h 1U1SA 3SWNC 2FB7A 5GMKe 1JRIA 3JCMV 3QUIA 2DTHA 4C8QE 4M7DD 1YCYA 1H641 4M77D 5GANd 5LJ5d 2EJ9A 4F7UF 1WQWA 2E10A 3SWNB 1B34B 4EMKC 3BY7A 3GIBA 5GANf 4XTYA 3SB2A 5LJ5f 3JB9F 5GAOr 4JUVA 2K57A 4M75E 5GAN8 4M78A 1N9SA 4M7DG 2DKGA 5CAIA 4MMKA 2VXEA 4M77B 4XTUA 3V7RA 3JCMJ 4J5YA 4C8QA 2CGHA 2ZGWA 4X9CA
chains in the Genus database with same CATH superfamily
5IXBA 4E7ZA 3PGGA 3I35A 5KYUB 2JXBA 4HA8A 4RCCA 3X20B 4R0KA 1K8AC 4RCBA 4OMFB 1JEGA 1EX4A 4LDWA 5KYXA 3L2WA 1GBQA 4XU1A 3DB4A 3PMTA 1YJNQ 3G1JA 2D0NA 2DJQA 1ZA2B 1K0SA 2QQ9A 1BU1A 4BI8B 1M1FA 2EJGA 1ZQ1A 3VS0A 3CXCP 1KFZA 2FRWA 3V8KA 2LCLA 2ED0A 2DNUA 3CCQA 1WJSA 3JCMc 1F1BB 2ESWA 3JB9J 1X6BA 4PJLA 2PZ1A 1K9MU 2B86A 2NUTA 4EMKB 3LWHA 3CCJA 1QQJA 2XD0A 1S72T 1QW1A 5GMKh 2FO0A 2D8JA 4KRTA 3RERA 1TOVA 3FJPA 2P0QA 1YCSB 2K79A 3QSUA 2EWNA 3LX7A 3L2UA 1I4K1 3ER0A 1X6GA 4M75C 4M77G 1VQLA 3QWXX 1UE9A 1SPKA 2E5QA 2E3IA 5CQXA 1VQNA 1M1GA 2Y4YA 1M1KR 4M77D 2JS0A 2XIDA 3G6EA 3NTKA 2EQKA 2CUDA 3N5BB 3V7RA 2RK1A 4LDXA 3RBBB 3HL8A 4X9CA 3GOXA 4O5VA 1N8RC 3OYMA 1HJDA 2RQTA 2AIRB 9ATCB 4JRPA 1T0JA 1KC8R 1BCOA 2QQSA 3M5AA 4M7AA 4C8QD 1DJ7B 5A2QE 2QYZA 3CCVA 2M1HA 4E7IA 1X27A 4M7DB 3CCMQ 2L2PA 2RA2A 2VVKA 4JRIA 3EGXB 1YJ9T 5LJ5h 3VS4A 4JZ3A 2RMOA 4C0DC 2V1QA 3JCMW 1B34A 1D0ZA 3NTHA 2AHJB 4EIKA 3JB9H 1VQOQ 4XK8E 3SEMA 4ZGJB 3HRUA 5HCKA 4B6MA 3QXEB 3VU3C 2PUKB 2PVDB 4M75F 2VASA 1BBZA 1D1AA 1YWOA 3RKYA 4OB2B 1X2QA 1JJ2P 4AG2C 2K7AA 2XG8D 4M78C 3H6ZA 2GGRA 1VQ4Q 2A36A 2JN0A 1XTDA 3CMEQ 5GJVB 3SDZA 2DFUA 1BIBA 1YITQ 2RQRA 1RUWA 1Y57A 1YIJA 1BI2A 2LT1A 2NUZA 4XU3A 1AWOA 3OYDA 5HY6A 2DAQA 3QUIA 4M7DD 1P92A 4WTOB 1TTHB 2JNGA 4KGVB 5GAOr 4XTUA 3JCMJ 2AKLA 1RAHB 3BDLA 1G3WA 2HBPA 1KHCA 2EAYA 2JJ9A 4PK4A 3OW2P 2ZPHB 1RLQC 2Z0WA 2YUOA 3CCRQ 1KD1R 2D6FA 2CSIA 5GAN3 2QAZA 1KIKA 5LJ3e 5CVIA 2JZ2A 2KBTA 1SHGA 3X28B 5D6WA 3H0IA 4EPCA 2QA4Q 1QKWA 2QGFB 3OBYA 3SWNA 2JOYA 2BUDA 4HT9A 5GMKl 1VQ8A 3G4ST 4PLLA 5DLQE 4BDYA 5FU7C 3EG9A 1WIEA 1M90R 1UUEA 4F7UE 3MCAB 2JMCA 2O9VA 1NJIU 1WJRA 2HBWA 4IUVA 4M77C 2OTJT 4EMHA 2LQWA 2RHZA 2L3PA 4M78F 4C92G 2EIFA 1G3YA 5IHNA 4M77A 2XDDA 2K3YA 1VQMA 1RLPC 1VQ7A 3Q1JA 2YT6A 1Y7XA 2J6FA 4KBMB 4XAXB 2NUPA 2G3RA 1ACMB 4CI0C 2EYXA 2DL8A 3L42A 3G71A 4C8QC 1M30A 1NYFA 4J7FA 5GAMg 5KYWB 1IO6A 4QW2A 2LVMA 3VS6A 1VUBA 1XOVA 3LYIA 1U5SA 4QVZA 2AZSA 1ZSZB 4FIBA 2KE9A 3JCMh 2E5KA 1UTIA 5L23A 2FB7A 3QZ9B 4OF1A 5GANd 4MZMA 2RJFA 2VV5A 3CCSQ 1C0MA 2ROLA 1I0CA 3UA6A 1QVGA 2L3RA 3QYGB 4DBRA 2DD4A 2K3BA 3L2QA 5C6SA 3KXTA 2CREA 4J5YA 4D8KA 1D1BA 4QT7A 2FPFA 2L0AA 1PD0A 2CH4A 2L5QA 1G5VA 4IIOA 2GQVA 5D7UA 2HD0A 2DL4A 3HFNA 2GBQA 2X35A 2BZ8A 4KT0E 5GAMf 1K8AR 2L3QA 2RH2A 5CKHA 3H9NA 1YJNA 4M77F 2LC4A 4Z02A 4BE0A 1TH7A 4OGEA 3CC7Q 1VQ5Q 2A28A 1VQ6Q 1HSQA 3PT9A 2DE0X 3NHNA 4KGXB 5LJ5e 4Q5WA 1H92A 4M7DC 4BI3A 2OAUA 4LDYA 3NTIA 2F2XA 1EIFA 1AD5A 3MP6A 3I55Q 4XQ3A 2RM4A 3JCMX 4C8QF 2PUOB 2RI3A 1G3TA 2ZPBB 2YLBA 1WHKA 3CD6Q 4KUIA 2CDTA 3J81E 3RIRA 4AFSC 5CKDA 2K2MA 1QVFP 3HKSA 4LE9A 1MHNA 4ELZC 3CCEQ 1O9SA 3MHXA 2HL3A 4IUUA 1A0NB 4FU6A 1WYXA 5GMKi 2K9GA 3META 2MYSA 1IGQA 2JUFA 4L6V5 1YHQT 3PFSA 4FYYB 1KHIA 1EFNA 1YFNA 4LNPA 3M59A 1G8XA 1YJWT 1VQKT 2BKDN 2ZPFB 1VYUA 1NZ9A 3JSCA 1Q86U 4MMKA 2QQBA 1GFCA 4AT1B 4OMNA 4RMOA 5AYFA 2WSCE 1N8RR 3CXCS 1G2BA 4RKUE 5CK9A 4XTZA 3BDUA 1PKSA 4M7DF 1ZBJA 3CBMA 4AFUC 4C92A 4Z8AA 3CCMA 2RNAA 4HCBA 1JXMA 4Z88A 2LQ8A 2E3HA 2QXFA 1WA7A 2LNVA 3E2UA 1NPPA 4MZPA 2XDBA 1YI2T 2K4YA 4FW2A 4D8DA 3OYJA 1KD1C 3TVTA 1H3HA 4RTYA 1EZZB 1HXDA 1AEYA 1W2BA 2DXCA 2HNIA 4EMGA 1BIAA 1VQOA 2KK4A 3WVEB 1S1NA 4CC4B 3INZA 2CP3A 3FLGA 3M53A 2ZPEB 2DVEA 3OSSC 4JLGA 2AKKA 1X2KA 2EKHA 5A0DA 3RMSA 1FMVA 1VQ4A 3CCQT 3CMEA 3CCUT 2RN8A 3CC4A 1YITA 3ZL7C 4IKFA 1JBMA 2JS2A 5LJ5g 3M9QA 4JRKA 5CO7A 1T3SA 2M51A 4IURA 3CCJT 2EVRA 4ANJA 2VYTA 1ZSGA 1X69A 4NL3A 4IUPA 2DTHA 3C95A 3X25B 3F70A 3J80E 1YJ9Q 1SSHA 2FHDA 1BCMA 4LUEA 3HTRA 1Q7YU 3QDRB 3OYKA 2LQKA 3CCRA 2X4JA 3VV0A 4E7SA 1D0YA 4GBQA 5GAN5 4KH0B 1Y96A 4J8OA 3V8JA 2GQIA 2HSEB 1IRXA 1QCNA 4OB1B 2QTXA 2QA4A 2K2VA 1FXXA 3OYHA 3OY9A 3DLLA 3EGDA 4M78G 3VUBA 4ZTFA 3HRSA 1M2VA 2EGAA 2DZCA 3R6OA 4MDXA 1JJ2S 4JJBA 2LCSA 4LN2A 2DILA 3VS2A 2DETA 1M5Q1 2L8DA 2QQAA 1TSFA 4M78D 1W4SA 3URGA 4NS5A 3I9QA 3RMQA 1KJWA 4C0FA 2FEIA 3GLXA 2JMAA 1UECA 2PNIA 3PTAA 1UGPB 4OGCA 2ZZDA 3OYBA 5KE3A 4QQ6A 1K9MC 3GNGA 2V8KA 3UF4A 1QCFA 4PKCC 1NEGA 3VS1A 2K3XA 4E47A 4OMQA 3OYYA 5IAYA 3L1AA 1GFDA 1M2OA 1Q82U 3TU4K 1UFFA 1AHJB 1IB8A 4PJNA 3TREA 5I22A 3EAEA 4KH1B 5KYYA 1VYTA 3OW2S 2J05A 2NUPB 3FDRA 4PJJA 4JJCA 1D3BB 3VS5A 4ZTJA 5LJ3j 3CCSA 3G4SQ 1U1SA 1IZ6A 2GFAA 1W6XA 3MO8A 1YCYA 4C0ZA 1BKBA 3E9GA 1K73U 1PHTA 1VQPA 2EGCA 2CZ1B 2IPOB 4GLKA 2LT4A 5GANf 2EYZA 1T3LA 2DRMA 2L3SA 4OB3B 2XI9A 2OTJQ 1OZ2A 4DA4A 4UC4A 2CZ7B 1H8KA 3L2VA 4PJOE 3KUFA 4M75A 1WXTA 3QG1A 3DB3A 3CCLT 1X6OA 2E6NA 2E4HA 1MMDA 2DEQA 2XU8A 2AZVA 2OTLT 5FWCA 3JCMg 3CC7A 1VQ5A 1VQ6A 4C8QG 3MP1A 3HSBA 1QKXA 4PFPA 1IXDA 1VQ9A 3FB9A 3LGLA 5KCOA 4P5NA 4JS4A 3I55A 1WI7A 1MNEA 3HHTB 1QWEA 2C0OA 3M58A 5GAOp 4RTXA 2M16A 5LJ3d 4OP0A 2WACA 1VQ8T 1U3OA 2RJCA 3CD6A 3LWIA 2HDAA 2P84A 1ZUYA 4FT2A 1GRIA 5GAMe 1SRMA 1TG0A 2YUPA 3QBYA 1TU0B 1VYVA 5CQYA 4PJMA 4GLMA 2C06A 4OVAA 4JS5A 1AT1B 3GPLA 2DK3A 1WHLA 1N5ZA 3M4GA 2CUBA 1VQMT 1VQ7T 2CH4W 5IHIA 2QEXQ 2JVVA 3JCMf 4Y92A 2J6OA 3OS0A 4DBFA 1Q86R 2LRQA 4R56A 3NGPA 2VUBA 1M27C 1XQHA 2E1HA 3ZFJA 3CPWA 1U1TA 4FW1A 2VWFA 3V7SA 4JZ4A 2QDYB 3JCMV 2P4TA 2BZYA 1VA7A 4F7UF 2ROTA 3CC2T 1CKAA 2DLPA 2EYYA 4M78A 4M7DG 5CAIA 3O8VA 2KVQG 5FU6B 2FL7A 4BB7A 2W0ZA 1AZEA 5LJ5j 2VB6A 3L2ZA 2CP7A 1OX9A 4ZGEB 4FCYA 1ZBXA 5FW9A 3MPUB 4J7IA 3KFVA 2ZPIB 2MAMA 3GBQA 2LJ1A 2I2LA 2M02A 5LL6S 1WXBA 3EHRA 1QVGP 4JLIA 1QVFS 3EFOA 5GANh 3OYFA 2PVGB 3O5ZA 3JCMP 1NJIC 3E9FA 1IHVA 1Q81U 1YHQQ 4PL6A 4C5EA 2EGEA 4C92B 1QVPA 2JTEA 2P0PA 2COYA 1YJWQ 2XKOC 2BTTA 3MKDA 2LX7A 4DEXA 4AMCA 2HMAA 2CZ6B 1FWZA 2GTJA 1VQKQ 5KYUA 1UJ0A 4E6RA 1KQSA 4PFZA 1PCXA 2MIOA 1VIFA 4XTXA 3A8OB 2QG9B 2YHTA 3X26B 3PIPA 4QVCA 3UWNA 4PJOB 2OX7A 1JB0E 4HCZA 2QTVA 2A3LA 3I56T 3ZEHA 4ZN1A 4HCCA 2XDPA 1FX7A 4KULA 4K11A 1AZGB 1NE8A 1SKUB 4J9FA 5GMKe 1YJ9A 1JRIA 2VGMA 1YI2Q 2QQRA 2YDLA 3SD4A 3A8LB 4E7LA 1KSWA 1OU8A 1K9AA 3QIIA 3T9NA 4EMKC 2C0TA 2HQHA 1M8MA 2DIGA 5EG2A 4C8QA 2O4XB 2ZGWA 2KMTA 2KRMA 4M7AE 1B07A 5L8RE 4EMKA 5DM7R 1RI9A 2ATCB 3PE0A 5GAOl 3BFMA 1RADB 1KK7A 4ELYC 3V8LA 3U23A 2D1XA 4BD3A 2F2WA 3JRZA 2ECZA 2I0NA 6AT1B 3EG3A 5FWBA 2E65A 2E6ZA 4C5HA 2GCXA 2Y90A 4N0AC 3ASKA 3CMAT 3QJ6A 2PQWA 2MWPA 4CC7A 3P8BB 3CCUQ 3I5SA 5IH2A 5CKBA 3QDFA 2JM9A 2IG0A 4ZN3A 1FMWA 1QLYA 4RTZA 3NPFA 4VUBA 5GAOq 3QWYA 2COZA 4BY6B 1JQQA 3CCMT 2YRDA 3RUXA 4JDSA 3M54A 1AOJA 1QCOA 2YXYA 2QDLA 4JJNK 3RESA 2MWOA 4IIMA 4FSXA 8AT1B 3OS2A 5EC7A 1GCQC 1PRLC 1PRMC 2BE7D 1K9MR 4OB0B 2DTIA 1PWTA 1Y71A 2DL7A 1C1AA 4A63B 5KYXB 1BI0A 3UPUA 3S3NA 4HVWA 5A0GA 2DTOA 1W2BP 5M9OA 3C4SA 4M7DA 3S3MA 3WVDB 4X1VA 5FROA 3X24B 3P8DA 3HFOA 2MF2A 1V76A 4XTVA 3EGXA 2KYBA 1B7TA 1M1KU 2K5IA 4MDWA 3WXMB 2D0QB 1WNLA 3CMET 3THKA 1AVZC 3H41A 4N4HA 3CC4T 1PSFA 2ZPGB 5KYNA 1PSEA 4HVVA 4LUDA 4E7HA 3M0TA 4JJDA 1WQWA 3M0UA 4J9IA 2OTJA 1YWPA 5GAN8 2KROA 2PVOB 1N9SA 1Q86C 1M3CA 2KXDA 4A4KA 2RJDA 2SRCA 1XNIA 1QP3A 2NUTB 3DKMA 4R55A 1KC8U 1OYXA 4X34A 1YNZA 5I11A 2EJFA 2HKQB 4J6YA 1I81A 5I2SA 3ULRB 1OI1A 2RF0A 4ORZA 2J7IA 4CC3A 5GAOm 3L2RA 1OPKA 4RTTA 3M0SA 1NYGA 1AWXA 4M75B 3OA6A 2QGGA 1LPLA 2HCKA 3MJXA 1B3QA 1NM7A 4KGZB 2E70A 2DF6A 1S72Q 2HQEA 2ABLA 3TSZA 1VIEA 4JPBW 2DBMA 3DLMA 1WQ7A 1BI1A 3MEWA 3CEYA 5AT1B 1R0CB 3OMCA 3UDCA 4M7AB 1LOJA 2QEXA 1Y07A 3KBGA 1I8FA 4F7UG 4PFOA 3CQTA 3NFCA 4HT8A 4PNOA 1M3AA 3CCLQ 2CT3A 2FVUA 1FMKA 1M4ZA 2HZYA 2X3WD 1GXIE 2ZCFB 1N9RA 4J9DA 4PJOC 2OTLQ 1KQ1A 2GFUA 1KG1A 2HL5C 1Y0MA 4F14A 4KUDK 2E10A 2KT1A 1B34B 3M55A 3GIBA 2HKNA 2KI7A 1Q7YC 2KRNA 2A08A 3ME9A 3C0CA 2A7YA 4F04B 3CCST 1M8VA 1YN8A 2EYWA 3HP9A 2GNCA 1M3BA 1VQPT 2P4RA 1RL2A 3JCMe 2V8IA 1WLPB 1WHGA 1ZSZC 4J6XA 2EBPA 1VQLT 2FRYA 5GAMj 5GAN7 3QPHA 4MMLA 4RTUA 2H3JA 3BE3A 4RG2A 2EQJA 1M90U 3GNFB 1VQNT 1VQ7Q 1PNJA 2JW4A 3R6NA 3M4YA 1YHQA 3EH2A 3LH0A 3QZ5B 1NEBA 3FC3A 3S3OA 1NJIR 2LTOA 3A5ZB 2DEUA 4IUQA 3REBB 1YJWA 2R57A 3G6ET 3JB9I 1E6GA 5CR2A 3CC7T 1VQ6T 1LCKA 1ZUUA 4FYXB 2DL5A 2DRKA 3OYCA 1VQ9T 3TSWA 2RHUA 4J9BA 3H0FA 3FEOA 5C0MA 5CKEA 3CC2Q 1K4US 3TQ7P 1RABB 2HEQA 4ME7A 2CP2A 5ECAA 5DLOA 2DYBA 3CCVT 2V1RA 4PJOF 3JB9D 3CD6T 4AFQC 3VUZA 2CKKA 2LJ3A 4OMMA 3VYGA 1WXUA 2E64A 4WF2A 1Q82C 1I07A 1LNXA 1RACB 3HPWA 2KAFA 4Y91A 2DVJA 4EDUA 3QHSA 2LJ0A 2YLCA 3SWNB 5GANg 2FZKB 3REAB 3EG1A 2RPNA 1OX8A 3PNWC 4DBHA 3JCMQ 5GAMd 2IIMA 1UEBA 3EG9B 5A0LA 1NBEB 1YI2A 1UGVA 1R77A 3M0QA 2KXCA 5LJ3h 1IGUA 5CIUA 2OAWA 4E7JA 5FU7B 1K73C 1BI3A 1MNDA 3OYGA 2CZ0B 8ATCB 2RQVA 1ZLMA 3SB2A 2M9UA 2X4WA 2CYZB 4M77B 1E6HA 4L59A 4C5GA 1QVGS 2SEMA 5DY9A 2KR3A 1IREB 4C92E 1CSKA 1K8AU 2QK0A 1OULA 3M56A 3CPWP 2F1LA 2DO3A 3CCUA 3J7AF 1ZHIA 4LXCA 2X51A 4C8QB 1YIJT 1Z9ZA 1UHFA 2RD1A 2BE9B 3VYHB 3LW5E 3CBPA 3I56Q 1WFWA 2YWWA 2QASA 5I2MA 4N4GA 4GY5A 3EFRA 2O9SA 1HD3A 4F7UA 2G6FX 3TEEA 2DM1A 3JCMb 2LX9A 2R5AA 2NYSA 2KT8A 1UB4A 3MEAA 5GMKj 2HQXA 4HVUA 3HRTA 3EG0A 2X3XD 4XU2A 2EQUA 1UG1A 2DXUA 3PVQA 4QKUA 3TCJA 3PIOA 3OS5A 1N6AA 4A4FA 4QQDA 2XICA 3OBWA 4HKEA 3SHWA 2LDMA 2FZGB 1R0BG 4DQ2A 2M0OA 3EFSA 4OMPA 4M7AC 2K5LA 2F5TX 3CMAQ 4BE2A 1E7OA 1UGRB 3CCEA 4J6WA 1HYOA 2J06A 3M0RA 3OYNA 2JTFA 1Q95G 1H641 1R8OB 2O01E 1VOMA 2RO0A 1KQSP 3E19A 1SRLA 1Z9QA 2YSQA 3M0PA 4Y28E 1SF9A 1W1FA 1WZOA 3VS7A 2RHIA 3CXCA 5CKFA 3A8MB 1N8RU 5KH6A 5I21A 2H8HA 3G71T 1QWFA 2EYQA 2KSSA 3FRNA 4C5IA 4FM4B 4DOWA 3EHQA 5D6XA 1RAIB 4ESRA 5IHKA 4FSSA 1C6VX 4XU0A 4ZNXA 2DZ9A 2VXFA 1K76A 2R58A 1GCPA 2DBKA 5GAN4 1PM3A 4MZTA 1I5LA 1ZUKA 4QQGA 3UATA 2X4XA 1CKBA 2RJEA 3E1SA 3VRYA 5HK3A 2KQWA 1S72A 1Q81C 2V8JA 2DMOA 5GAN2 2COWA 3VS3A 3FIFA 1SSFA 1ARKA 1W2BS 4A53A 3OS1A 3CC4Q 1I5OB 4M4ZA 2OJ2A 2EFIA 4CC2A 4F17A 3M57A 4M7AF 1M9SA 1JXOA 3QO3A 4LD6A 3OYLA 1WDXA 2FPDA 1YJNT 2DA9A 1ABQA 4V2SA 4RTWA 3CCLA 2AT1B 4HCKA 1GBRA 2MOXA 1G3SA 1OOTA 1LJOA 2DPPB 1V29B 2AK5A 1D09B 2DL3A 2OTLA 1D1CA 2E12A 1MGQA 2W10A 2DJZA 1K0XA 1OU9A 3SWNC 4WCIA 1NLOC 5LJ5d 2EJ9A 4FYWB 3BY7A 1NPRA 2XMFA 5CCAA 3JB9F 4M75E 2K57A 2K5FA 2DERA 3RR6A 2A0FB 1Q7YR 2RB6A 2QI2A 5GANj 2H3EB 1GL5A 1TS9A 3JAME 2J6KA 3FJ5A 4TVRA 5FRNA 3C12A 4HXJA 2LNHB 1JO8A 2DXTA 1OZ3A 1WHJA 3V7CA 2P0KA 2RQUA 3OMGA 1JJ2A 5FLXE 2DX1A 2VGNA 2F69A 4F16A 1D3BA 1TUCA 5J39A 1MV3A 1LVKA 5J3BA 4C92D 3PMIA 3AHUA 3RNJA 2D9TA 3PVLA 1AWWA 2E41A 3OB9A 3OYEA 4BACA 4E7KA 2MK5A 4PJOG 1SHFA 4BUGA 1U8RA 2CP0A 3MEUA 3CC2A 2RI2A 2EW3A 1WHHA 3CCQQ 4J9HA 4NOYA 3H8ZA 5GAN6 2YRCA 4N0AA 3C94A 2BIVA 2D8HA 2DIQA 1QMCA 1RAAB 4PJOD 1Y96B 1OQKA 1WPYA 3CCJQ 4OMOA 5KE2A 3IQLA 3JV3A 4B9WA 4IUTA 5D6YA 3OW2A 1VQPQ 1Q82R 1BYMA 4PLIA 3OQ5A 4CRIA 3EGDB 1XJWB 1TWBA 1PKTA 4FT4A 1VQLQ 1AWJA 1N27A 2JTMA 1M2VB 3QYHB 2BZXA 3VJPA 4C0GA 2FZCB 2GF7A 1W70A 3AT1B 3D7SB 1M1KC 1VQOT 4M78E 2QEXT 4AG1C 1VQNQ 3UA7A 1GCQA 1O75A 2CS7A 2LQNA 2X4YA 1RI0A 1K73R 5FRMA 4JUVA 4RG8A 4DEYA 5IXFA 3G6EQ 4BE1A 1ABOA 2FPEA 1WX6A 3P8HA 1UGSB 2ENMA 2WSFE 3G4SA 1VQ4T 1UDLA 2GTOA 3EH1A 1MMAA 2B8AA 1WJQA 2O2OA 1KC8C 1VQ9Q 4OMLA 2PTKA 1YITT 2KEAA 2LCCA 2X9HA 1X01A 2OI3A 5GMKm 1UGQB 3CCVQ 4AFZC 1K1ZA 4ATOA 4A4HA 4DOVA 5LJ3g 2CSQA 5KYYB 3OYIA 3EGUA 3I56A 5KCHA 5HK0A 5GAOn 2XHCA 4RTVA 1V1CA 1WHMA 1FYNA 1PC0A 4A4EA 3MP8A 3JCMd 2EKOA 5FU6C 1UJYA 2K6DA 4Z89A 2FG0A 1OPLA 4QVDA 2RHXA 3CCRT 2PU9B 2F2VA 2C0IA 3GP8A 3UT1A 3A98A 1PD1A 1MUZA 1D0XA 2DYIA 2NWMA 2QA4T 5GANe 4M77E 4NL2A 1KQ2A 1T0HA 4LDUA 5J26A 2M0YA 2YRVA 3LGFA 2IVWA 4F7UB 3LLRA 2DD5A 2Y4XA 2FYKA 4X9DA 3CMAA 5LJ3f 1ZX6A 4DBQA 5HKCA 3RKXA 1H3ZA 4E2FB 2KRSA 4J83A 1TUDA 2MPXC 2O31A 3BW1A 4C92C 1RAFB 1OEBA 2WSEE 2L89A 1YIJQ 4J9GA 4C8QE 3CPWS 2V26A 4FL6A 1WGSA 5IN1A 2HAXA 2O88A 2KDSA 4XTYA 4J9EA 2CP5A 1OV3A 1MMNA 3LH5A 2CGHA 2VC8A 2JM8A 4A4GA 2XK0A 2JT4A 4YTLA 2KYMA 3VKIA 4M75G 1RAGB 4J9CA 3VRZA 1MV0B 3H0HA 5IT9E 4BI4A 2RK2A 2YUQA 4PJOA 3NMZC 4II1A 2RI5A 3OYAA 1SEMA 3G7ZA 1QVFA 1SG5A 4C0DB 2KGTA 4M75D 1TXQA 5GAMh 2A37A 3QJYA 1M90C 2R5MA 2EPDA 3ZBDA 1VQ8Q 1KD1U 3CBOA 3RDVA 4XTWA 2MCNA 2RQWA 4M7AG 5KYWA 3S6WA 2CP6A 4B9XA 1Q81R 1U06A 1RAEB 3A1PA 7AT1B 1NG2A 1BK2A 2O4XA 4M78B 5GJWB 4A54A 1X75C 1ZSZA 1G83A 2ED1A 1VQMQ 1MMGA 2RHYA 4M7AD 2DXBA 1IHWA 2MI6A 4M7DE 2ZAEA 1BB9A 4N4IA 4BDZA 3GF5A 2HSPA 1KQSS 2F5KA 4C92F 3EG2A 2YUNA 2NLUA 1UHCA 1J3TA 3A8GB 2EQIA 3G71Q 1HK9A 1YP5A 1TUGB 4JRQA 1VQ5T 1VQKA 1JU5C 4FYVB 3SFMA 3A8HB 1YBYA 3RKWA 3JB9G 3CPFA 1I1JA 4O6JA 4RUGA 4ZGDB 4BY6C 2VKNA 3OSVA 2EQMA 1NLPC 2LMJA 4LDVA 3I55T 1PG5B 3MEVA 3EFOB 3QKJA 2LP5A 4L5GA 2CT4A 2MMPA 1ZA1B 3I5RA 5LJ5f 2LZ6B 2DKGA 4D6WA 2KNBB 2VXEA 4LD9K 3CCET 2KY9A 1QP2A 1X43A
chains in the Genus database with same CATH topology
5L8RE 4EMKA 2RHIA 3CXCA 5CKFA 3A8MB 5DM7R 1N8RU 5KH6A 4RMOA 3PGGA 5I21A 3BFMA 5AYFA 5GAOl 2WSCE 4HA8A 4RCCA 4ELYC 3V8LA 3X20B 3G71T 3CXCS 4BD3A 1K8AC 3JRZA 2EYQA 2KSSA 4RCBA 3FRNA 4OMFB 4C5IA 4FM4B 4LDWA 4RKUE 5CK9A 2E65A 2E6ZA 4C5HA 2GCXA 4XTZA 3L2WA 3BDUA 4DOWA 2Y90A 4XU1A 4N0AC 3CBMA 4C92A 3ASKA 3DB4A 4M7DF 3CCMA 3CMAT 2ZGWA 3QJ6A 5D6XA 4HCBA 2PQWA 4XU0A 2LQ8A 3PMTA 2DZ9A 2VXFA 2QXFA 2MWPA 3P8BB 2LNVA 2R58A 5CKBA 1NPPA 4MZPA 5GAN4 2XDBA 1YI2T 2IG0A 2K4YA 4MZTA 4ZN3A 3OYJA 1I5LA 2QQ9A 4QQGA 4BI8B 1KD1C 2X4XA 1M1FA 2EJGA 1ZQ1A 4VUBA 5GAOq 2RJEA 1HXDA 1W2BA 3E1SA 5HK3A 2DXCA 2HNIA 2KQWA 1BIAA 4EMGA 4BY6B 3CCMT 1VQOA 2KK4A 2V8JA 3V8KA 2LCLA 5GAN2 1S72A 1Q81C 3FIFA 1SSFA 4JDSA 3RUXA 3M54A 3WVEB 1W2BS 3CCQA 1WJSA 3JCMc 4A53A 4JJNK 3RESA 2MWOA 3OS1A 3JB9J 4FSXA 3INZA 3FLGA 3M53A 3OS2A 2ZPEB 1K9MU 2DVEA 3OSSC 4EMKB 4JLGA 3LWHA 3CCJA 2XD0A 4OB0B 2DTIA 2EFIA 1S72T 1QW1A 5GMKh 3M57A 4M7AF 5A0DA 3RMSA 1M9SA 3QO3A 1VQ4A 3RERA 4LD6A 3OYLA 3FJPA 3CCQT 2P0QA 1Y71A 3CMEA 3CCUT 1YJNT 3QSUA 4V2SA 1BI0A 3UPUA 2EWNA 3S3NA 5A0GA 3CC4A 3LX7A 1YITA 2DTOA 3CCLA 3L2UA 4IKFA 1I4K1 3C4SA 5M9OA 1G3SA 1JBMA 3ER0A 3WVDB 3S3MA 4M7DA 4M75C 4M77G 1LJOA 2DPPB 5FROA 3M9QA 3P8DA 1V29B 4JRKA 3HFOA 4IURA 5CO7A 3X24B 5LJ5g 3CCJT 2MF2A 2OTLA 2E12A 2E5QA 4XTVA 1MGQA 2VYTA 5CQXA 1M1KU 2DJZA 2K5IA 1VQNA 1M1GA 2Y4YA 4MDWA 3WXMB 4NL3A 4IUPA 2D0QB 1WNLA 3CMET 4N4HA 3SWNC 3CC4T 2DTHA 1PSFA 2ZPGB 3C95A 4M77D 1PSEA 3X25B 5LJ5d 2EJ9A 4E7HA 2XIDA 3F70A 3J80E 1WQWA 1VQ5A 2KY9A 2FHDA 3BY7A 2OTJA 1NPRA 5CCAA 3JB9F 4M75E 2K57A 5GAN8 2K5FA 2PVOB 2EQKA 1N9SA 3NTKA 3N5BB 3G6EA 3V7RA 1Q7YU 1Q86C 2RK1A 3QDRB 4A4KA 3OYKA 4LDXA 2RJDA 2LQKA 3HL8A 4X9CA 3GOXA 2RB6A 2QI2A 5GANj 3CCRA 2X4JA 1XNIA 1QP3A 3DKMA 4R55A 4O5VA 1N8RC 3VV0A 3OYMA 3JAME 5GAN5 1Y96A 1KC8U 4J8OA 3V8JA 4JRPA 1OYXA 4TVRA 4OB1B 4X34A 5FRNA 3C12A 2QTXA 2QA4A 2QQSA 3M5AA 1VQLA 4M7AA 4C8QD 1DJ7B 5A2QE 3CCVA 2K2VA 2EJFA 1FXXA 2M1HA 4J6YA 1I81A 2DXTA 1OZ3A 3OYHA 3OY9A 5I2SA 4E7IA 1OI1A 3V7CA 3DLLA 4M7DB 2P0KA 4M78G 3VUBA 3OMGA 4ZTFA 1JJ2A 5FLXE 2RA2A 5GAOm 3L2RA 2VGNA 3HRSA 2F69A 1D3BA 4JRIA 2DZCA 3R6OA 4MDXA 5J39A 1YJ9T 1JJ2S 5LJ5h 4M75B 5J3BA 4C92D 3OA6A 1M5Q1 4C0DC 3PMIA 2L8DA 3AHUA 2QQAA 2D9TA 4M78D 1W4SA 2E41A 3URGA 4NS5A 3JCMW 1B34A 3OB9A 2E70A 3NTHA 3OYEA 2AHJB 4BACA 4E7KA 4PJOG 3RMQA 4XK8E 3CCET 4C0FA 2HQEA 3JB9H 4BUGA 1U8RA 4ZGJB 3GLXA 3HRUA 3MEUA 3CC2A 2RI2A 1VIEA 3PTAA 1UGPB 4OGCA 2ZZDA 3OYBA 3QXEB 3VU3C 5KE3A 4NOYA 3DLMA 3H8ZA 1WQ7A 2PUKB 5GAN6 4QQ6A 1K9MC 3GNGA 2V8KA 4N0AA 1BI1A 3C94A 3MEWA 4PKCC 2PVDB 3CEYA 2BIVA 4M75F 2DIQA 3RKYA 4OB2B 4PJOD 1Y96B 2K3XA 1WPYA 2XG8D 4M78C 4E47A 3OYYA 5IAYA 3H6ZA 3OMCA 3UDCA 5KE2A 3L1AA 4M7AB 1LOJA 2QEXA 1Q82U 3TU4K 4B9WA 4IUTA 5D6YA 3OW2A 2JN0A 1AHJB 1XTDA 1Y07A 3KBGA 1I8FA 4F7UG 1BYMA 4PLIA 3OQ5A 3TREA 4CRIA 3EAEA 3SDZA 1BIBA 4HT8A 3NFCA 4PNOA 3OW2S 2FVUA 4FT4A 3JCMf 3FDRA 1M4ZA 1YIJA 1N27A 1BI2A 2LT1A 4XU3A 1D3BB 2JTMA 1GXIE 2ZCFB 1N9RA 3QYHB 3VJPA 4C0GA 3OYDA 4ZTJA 2GF7A 5LJ3j 5HY6A 2DAQA 1KQ1A 2GFUA 1M1KC 4PJOC 3CCSA 1VQOT 1KG1A 4M78E 2QEXT 1U1SA 1IZ6A 2GFAA 3QUIA 4M7DD 1P92A 3MO8A 1YCYA 4C0ZA 1O75A 1BKBA 3E9GA 1K73U 2CS7A 1VQPA 2X4YA 4KUDK 2CZ1B 2E10A 1B34B 1RI0A 3M55A 4GLKA 2JNGA 2LT4A 3GIBA 5GANf 5FRMA 5GAOr 4JUVA 4RG8A 4XTUA 4OB3B 1Q7YC 3JCMJ 2XI9A 3BDLA 1G3WA 1OZ2A 4DA4A 3ME9A 2HBPA 1KHCA 2EAYA 4BE1A 2OTJT 2A7YA 3CCST 4UC4A 1M8VA 2CZ7B 3L2VA 4PJOE 2ZPHB 3HP9A 3P8HA 1UGSB 3G4SA 2WSFE 1VQ4T 3KUFA 4M75A 1KC8C 2B8AA 2D6FA 1WJQA 1VQPT 1RL2A 3QG1A 3JCMe 5GAN3 2V8IA 3DB3A 5LJ3e 5CVIA 2JZ2A 1YITT 3X28B 3CCLT 1X6OA 5D6WA 2E6NA 4J6XA 2LCCA 1X01A 4EPCA 1UGQB 5GMKm 1VQLT 2DEQA 2XU8A 3OBYA 3SWNA 5GAMj 2JOYA 2BUDA 3QPHA 4MMLA 5GAN7 4ATOA 2OTLT 4HT9A 4A4HA 4DOVA 3JCMg 5GMKl 1VQ8A 3CC7A 2H3JA 4RG2A 4C8QG 5LJ3g 4PLLA 2EQJA 5DLQE 3MP1A 3G4ST 3GNFB 3OYIA 1M90U 1VQNT 3HSBA 4BDYA 3I56A 5KCHA 5FU7C 1VQ9A 5HK0A 3FB9A 5GAOn 4F7UE 2XHCA 3MCAB 3M4YA 1YHQA 3LGLA 3LH0A 5KCOA 1NJIU 1WJRA 3QZ5B 4P5NA 4JS4A 3I55A 4IUVA 3FC3A 3S3OA 4M77C 3HHTB 2LTOA 3A5ZB 4A4EA 4EMHA 3M58A 3MP8A 2EKOA 4IUQA 5FU6C 3JCMd 2M16A 2R57A 5LJ3d 5GAOp 3JB9I 3G6ET 4OP0A 2RHZA 2WACA 1YJWA 4QVDA 4M78F 5CR2A 1VQ8T 4C92G 2RJCA 3CC7T 1VQ6T 3CD6A 2EIFA 1G3YA 4M77A 3LWIA 2XDDA 2K3YA 1VQMA 1VQ7A 3OYCA 2RHXA 3Q1JA 3CCRT 1VQ9T 1Y7XA 2PU9B 4FT2A 4KBMB 2RHUA 4XAXB 3FEOA 5GAMe 5CKEA 5C0MA 3GP8A 2G3RA 3UT1A 3QBYA 4CI0C 5CQYA 4ME7A 2C06A 5DLOA 2QA4T 4OVAA 5GANe 4JS5A 4M77E 4NL2A 1KQ2A 3CCVT 3L42A 3GPLA 2DK3A 3G71A 4LDUA 4C8QC 4PJOF 3JB9D 3CD6T 4J7FA 5GAMg 3M4GA 5J26A 3VUZA 2CKKA 3VYGA 2E64A 4QW2A 2YRVA 4WF2A 1VQMT 1Q82C 1VQ7T 3LGFA 2IVWA 1LNXA 4F7UB 3HPWA 2LVMA 3LLRA 2DD5A 2KAFA 4Y91A 2Y4XA 2JVVA 1VUBA 1XOVA 2YLCA 3QHSA 2FYKA 3LYIA 4X9DA 3SWNB 4QVZA 5LJ3f 5GANg 3OS0A 3CMAA 2LRQA 4R56A 5HKCA 3RKXA 1H3ZA 2VUBA 1XQHA 2E1HA 3PNWC 4J83A 3ZFJA 3CPWA 3JCMQ 4FIBA 5GAMd 1U1TA 1UEBA 3BW1A 5A0LA 1YI2A 4C92C 2WSEE 3JCMh 3V7SA 2L89A 5LJ3h 2FB7A 3QZ9B 2QDYB 3JCMV 4C8QE 2P4TA 4OF1A 3CPWS 5CIUA 5GANd 4MZMA 2RJFA 2VV5A 4E7JA 5FU7B 4FL6A 1K73C 4F7UF 1WGSA 5IN1A 2HAXA 1BI3A 3OYGA 2CZ0B 3CC2T 2KDSA 1QVGA 2L3RA 3QYGB 4XTYA 3SB2A 2M9UA 2DD4A 2X4WA 4M78A 3L2QA 5C6SA 2CYZB 5CAIA 4M7DG 4M77B 3KXTA 4J5YA 4L59A 2CGHA 2VC8A 3O8VA 4C5GA 2KVQG 1QVGS 5DY9A 5FU6B 2FL7A 4BB7A 4A4GA 2XK0A 2L5QA 5LJ5j 1G5VA 1IREB 4YTLA 2GQVA 4C92E 3VKIA 3L2ZA 2HD0A 4M75G 1K8AU 3HFNA 4ZGEB 2X35A 1ZBXA 5IT9E 4BI4A 2RK2A 4KT0E 5GAMf 3M56A 2DO3A 2RH2A 4PJOA 4J7IA 5CKHA 1YJNA 3CCUA 4II1A 3J7AF 2ZPIB 4M77F 2RI5A 1ZHIA 2MAMA 3OYAA 3G7ZA 1QVFA 2LC4A 4Z02A 4C0DB 2I2LA 4BE0A 4M75D 4C8QB 5GAMh 1YIJT 5LL6S 1TH7A 3QJYA 4OGEA 1M90C 2R5MA 3ZBDA 4JLIA 1QVFS 2RD1A 1KD1U 3CBOA 3PT9A 5GANh 3VYHB 3OYFA 3LW5E 3CBPA 2PVGB 5LJ5e 4XTWA 4Q5WA 4M7DC 3JCMP 1NJIC 3E9FA 4BI3A 2OAUA 1Q81U 4LDYA 3NTIA 4EDUA 4PL6A 5I2MA 4M7AG 1EIFA 4C5EA 4N4GA 3MP6A 3S6WA 4B9XA 1VQ6A 4GY5A 4XQ3A 3EFRA 1QVPA 4C92B 4F7UA 2RM4A 3JCMX 4C8QF 2P0PA 2PUOB 2RI3A 1G3TA 2ZPBB 3TEEA 2XKOC 2O4XA 4M78B 3JCMb 2LX9A 2YLBA 1YHQT 4A54A 4KUIA 2CZ6B 1FWZA 1X75C 2R5AA 3J81E 1UB4A 3MEAA 3RIRA 2RHYA 5CKDA 5GMKj 4M7AD 2HQXA 1KQSA 3HKSA 2DXBA 3HRTA 2MI6A 4M7DE 1MHNA 1VIFA 4XTXA 4ELZC 3A8OB 1O9SA 4N4IA 4XU2A 4BDZA 3MHXA 3GF5A 2EQUA 2YHTA 3X26B 1KQSS 2F5KA 4IUUA 3PIPA 2DXUA 3TCJA 4C92F 4QVCA 3PIOA 2NLUA 3OS5A 1N6AA 4A4FA 4FU6A 4QQDA 2XICA 3A8GB 3UWNA 5GMKi 4PJOB 1HK9A 1JB0E 3OBWA 4HCZA 4HKEA 3META 1VQ5T 4JRQA 1VQKA 3SFMA 2A3LA 3A8HB 1YBYA 2LDMA 3RKWA 4DQ2A 3ZEHA 3I56T 3CPFA 3JB9G 4ZN1A 2M0OA 3EFSA 4O6JA 4ZGDB 4HCCA 4M7AC 2JUFA 2K5LA 4L6V5 2XDPA 3OSVA 2EQMA 1FX7A 2F5TX 4LDVA 4BY6C 4BE2A 1UGRB 4KULA 3CCEA 4J6WA 3PFSA 1NE8A 3I55T 3MEVA 3OYNA 2JTFA 1KHIA 3QKJA 5GMKe 1YJ9A 1JRIA 3M59A 2VGMA 1YJWT 1H641 2QQRA 1R8OB 2O01E 3SD4A 4L5GA 3A8LB 4E7LA 2RO0A 1VQKT 2MMPA 2BKDN 2ZPFB 3E19A 3QIIA 3T9NA 4EMKC 1NZ9A 5LJ5f 3JSCA 1Q86U 2DIGA 2DKGA 4MMKA 2VXEA 5EG2A 4D6WA 4LD9K 4Y28E 4C8QA 2O4XB 1QP2A 2KMTA 2QQBA 4M7AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DY9 A;  4EMK A;  2EAY A;  2RB6 A;  5GAN j;  5LJ5 j;  1M8V A;  4PJO E;  3PGG A;  5I21 A;  3BFM A;  4C92 E;  3L2Z A;  5GAO l;  5GAN 5;  4HA8 A;  4RCC A;  1Y96 A;  4M75 G;  4M75 A;  3V8L A;  3HFN A;  3V8J A;  3JCM e;  5GAN 3;  4RCB A;  5LJ3 e;  2QTX A;  5GAM f;  4M7A A;  4C8Q D;  2E65 A;  4XTZ A;  2EJF A;  3BDU A;  4J6X A;  4J6Y A;  2Y90 A;  1I81 A;  4XU1 A;  4N0A C;  2DXT A;  1X01 A;  4C92 A;  4M7D F;  5GMK m;  4PJO A;  2DEQ A;  4M77 F;  4XU0 A;  3SWN A;  3V7C A;  4MML A;  5GAM j;  2DZ9 A;  5GAN 7;  4M7D B;  2VXF A;  4HT9 A;  4M78 G;  2I2L A;  3JCM g;  4M75 D;  4C8Q B;  5GMK l;  5GAM h;  4C8Q G;  5LJ3 g;  2RA2 A;  1TH7 A;  5GAO m;  5GAN 4;  3HSB A;  1D3B A;  4JRI A;  4JLI A;  1I5L A;  2RD1 A;  2DZC A;  3FB9 A;  5GAO n;  4F7U E;  5GAN h;  5LJ5 h;  2EJG A;  4M75 B;  4C92 D;  5LJ5 e;  4XTW A;  5GAO q;  1HXD A;  1M5Q 1;  3JCM P;  4M7D C;  3AHU A;  4M77 C;  2HNI A;  4EMG A;  1BIA A;  4M78 D;  4M7A E;  2E41 A;  3V8K A;  5GAN 2;  4EMH A;  3JCM d;  4M7A G;  3FIF A;  3RUX A;  5GAO p;  3JCM W;  2VC8 A;  1B34 A;  5LJ3 d;  5GAN g;  3JB9 I;  4OP0 A;  4XQ3 A;  3JB9 H;  3EFR A;  4C92 B;  4M78 F;  4PJO G;  4QVD A;  3JCM c;  4A53 A;  4C92 G;  3RES A;  2RM4 A;  4F7U A;  3JCM X;  4C8Q F;  3JB9 J;  4M77 A;  4M78 B;  3JCM b;  2YLB A;  3INZ A;  4A54 A;  3VU3 C;  4NOY A;  5GAM e;  1WQ7 A;  2DVE A;  5GAN 6;  4EMK B;  4N0A A;  3RIR A;  5GMK j;  4M75 F;  4M7A D;  2DTI A;  3RKY A;  5GMK h;  4M7D E;  4XTX A;  1Y96 B;  4PJO D;  5GAN e;  4M7A F;  1WPY A;  4M77 E;  4NL2 A;  1KQ2 A;  4M78 C;  3QO3 A;  4XU2 A;  3RER A;  2YHT A;  3FJP A;  4C8Q C;  4PJO F;  3JB9 D;  3L1A A;  4M7A B;  2DXU A;  1LOJ A;  3M4G A;  4C92 F;  4QVC A;  5GAM g;  3QSU A;  2E64 A;  4V2S A;  2EWN A;  4WF2 A;  5GMK i;  4PJO B;  1LNX A;  1HK9 A;  2JN0 A;  2DTO A;  4F7U B;  4F7U G;  1I8F A;  1I4K 1;  4Y91 A;  4M7D A;  1JBM A;  3JCM f;  3QHS A;  2YLC A;  4M75 C;  2FYK A;  1LJO A;  4M77 G;  4X9D A;  1BIB A;  4JRK A;  5LJ3 f;  3RKW A;  3HFO A;  4DQ2 A;  4PNO A;  3JB9 G;  5LJ5 g;  4HT8 A;  3RKX A;  3EFS A;  2E1H A;  4M7A C;  4XTV A;  1MGQ A;  4XU3 A;  1D3B B;  3JCM Q;  1N9R A;  4J6W A;  1U1T A;  2DJZ A;  3BW1 A;  5GAM d;  5LJ3 j;  4PJO C;  4C92 C;  1KQ1 A;  4NL3 A;  3JCM h;  3V7S A;  4M78 E;  1WNL A;  5LJ3 h;  1U1S A;  3SWN C;  2FB7 A;  5GMK e;  1JRI A;  3JCM V;  3QUI A;  2DTH A;  4C8Q E;  4M7D D;  1YCY A;  1H64 1;  4M77 D;  5GAN d;  5LJ5 d;  2EJ9 A;  4F7U F;  1WQW A;  2E10 A;  3SWN B;  1B34 B;  4EMK C;  3BY7 A;  3GIB A;  5GAN f;  4XTY A;  3SB2 A;  5LJ5 f;  3JB9 F;  5GAO r;  4JUV A;  2K57 A;  4M75 E;  5GAN 8;  4M78 A;  1N9S A;  4M7D G;  2DKG A;  5CAI A;  4MMK A;  2VXE A;  4M77 B;  4XTU A;  3V7R A;  3JCM J;  4J5Y A;  4C8Q A;  2CGH A;  2ZGW A;  4X9C A; 
#chains in the Genus database with same CATH topology
 5IXB A;  4E7Z A;  3PGG A;  3I35 A;  5KYU B;  2JXB A;  4HA8 A;  4RCC A;  3X20 B;  4R0K A;  1K8A C;  4RCB A;  4OMF B;  1JEG A;  1EX4 A;  4LDW A;  5KYX A;  3L2W A;  1GBQ A;  4XU1 A;  3DB4 A;  3PMT A;  1YJN Q;  3G1J A;  2D0N A;  2DJQ A;  1ZA2 B;  1K0S A;  2QQ9 A;  1BU1 A;  4BI8 B;  1M1F A;  2EJG A;  1ZQ1 A;  3VS0 A;  3CXC P;  1KFZ A;  2FRW A;  3V8K A;  2LCL A;  2ED0 A;  2DNU A;  3CCQ A;  1WJS A;  3JCM c;  1F1B B;  2ESW A;  3JB9 J;  1X6B A;  4PJL A;  2PZ1 A;  1K9M U;  2B86 A;  2NUT A;  4EMK B;  3LWH A;  3CCJ A;  1QQJ A;  2XD0 A;  1S72 T;  1QW1 A;  5GMK h;  2FO0 A;  2D8J A;  4KRT A;  3RER A;  1TOV A;  3FJP A;  2P0Q A;  1YCS B;  2K79 A;  3QSU A;  2EWN A;  3LX7 A;  3L2U A;  1I4K 1;  3ER0 A;  1X6G A;  4M75 C;  4M77 G;  1VQL A;  3QWX X;  1UE9 A;  1SPK A;  2E5Q A;  2E3I A;  5CQX A;  1VQN A;  1M1G A;  2Y4Y A;  1M1K R;  4M77 D;  2JS0 A;  2XID A;  3G6E A;  3NTK A;  2EQK A;  2CUD A;  3N5B B;  3V7R A;  2RK1 A;  4LDX A;  3RBB B;  3HL8 A;  4X9C A;  3GOX A;  4O5V A;  1N8R C;  3OYM A;  1HJD A;  2RQT A;  2AIR B;  9ATC B;  4JRP A;  1T0J A;  1KC8 R;  1BCO A;  2QQS A;  3M5A A;  4M7A A;  4C8Q D;  1DJ7 B;  5A2Q E;  2QYZ A;  3CCV A;  2M1H A;  4E7I A;  1X27 A;  4M7D B;  3CCM Q;  2L2P A;  2RA2 A;  2VVK A;  4JRI A;  3EGX B;  1YJ9 T;  5LJ5 h;  3VS4 A;  4JZ3 A;  2RMO A;  4C0D C;  2V1Q A;  3JCM W;  1B34 A;  1D0Z A;  3NTH A;  2AHJ B;  4EIK A;  3JB9 H;  1VQO Q;  4XK8 E;  3SEM A;  4ZGJ B;  3HRU A;  5HCK A;  4B6M A;  3QXE B;  3VU3 C;  2PUK B;  2PVD B;  4M75 F;  2VAS A;  1BBZ A;  1D1A A;  1YWO A;  3RKY A;  4OB2 B;  1X2Q A;  1JJ2 P;  4AG2 C;  2K7A A;  2XG8 D;  4M78 C;  3H6Z A;  2GGR A;  1VQ4 Q;  2A36 A;  2JN0 A;  1XTD A;  3CME Q;  5GJV B;  3SDZ A;  2DFU A;  1BIB A;  1YIT Q;  2RQR A;  1RUW A;  1Y57 A;  1YIJ A;  1BI2 A;  2LT1 A;  2NUZ A;  4XU3 A;  1AWO A;  3OYD A;  5HY6 A;  2DAQ A;  3QUI A;  4M7D D;  1P92 A;  4WTO B;  1TTH B;  2JNG A;  4KGV B;  5GAO r;  4XTU A;  3JCM J;  2AKL A;  1RAH B;  3BDL A;  1G3W A;  2HBP A;  1KHC A;  2EAY A;  2JJ9 A;  4PK4 A;  3OW2 P;  2ZPH B;  1RLQ C;  2Z0W A;  2YUO A;  3CCR Q;  1KD1 R;  2D6F A;  2CSI A;  5GAN 3;  2QAZ A;  1KIK A;  5LJ3 e;  5CVI A;  2JZ2 A;  2KBT A;  1SHG A;  3X28 B;  5D6W A;  3H0I A;  4EPC A;  2QA4 Q;  1QKW A;  2QGF B;  3OBY A;  3SWN A;  2JOY A;  2BUD A;  4HT9 A;  5GMK l;  1VQ8 A;  3G4S T;  4PLL A;  5DLQ E;  4BDY A;  5FU7 C;  3EG9 A;  1WIE A;  1M90 R;  1UUE A;  4F7U E;  3MCA B;  2JMC A;  2O9V A;  1NJI U;  1WJR A;  2HBW A;  4IUV A;  4M77 C;  2OTJ T;  4EMH A;  2LQW A;  2RHZ A;  2L3P A;  4M78 F;  4C92 G;  2EIF A;  1G3Y A;  5IHN A;  4M77 A;  2XDD A;  2K3Y A;  1VQM A;  1RLP C;  1VQ7 A;  3Q1J A;  2YT6 A;  1Y7X A;  2J6F A;  4KBM B;  4XAX B;  2NUP A;  2G3R A;  1ACM B;  4CI0 C;  2EYX A;  2DL8 A;  3L42 A;  3G71 A;  4C8Q C;  1M30 A;  1NYF A;  4J7F A;  5GAM g;  5KYW B;  1IO6 A;  4QW2 A;  2LVM A;  3VS6 A;  1VUB A;  1XOV A;  3LYI A;  1U5S A;  4QVZ A;  2AZS A;  1ZSZ B;  4FIB A;  2KE9 A;  3JCM h;  2E5K A;  1UTI A;  5L23 A;  2FB7 A;  3QZ9 B;  4OF1 A;  5GAN d;  4MZM A;  2RJF A;  2VV5 A;  3CCS Q;  1C0M A;  2ROL A;  1I0C A;  3UA6 A;  1QVG A;  2L3R A;  3QYG B;  4DBR A;  2DD4 A;  2K3B A;  3L2Q A;  5C6S A;  3KXT A;  2CRE A;  4J5Y A;  4D8K A;  1D1B A;  4QT7 A;  2FPF A;  2L0A A;  1PD0 A;  2CH4 A;  2L5Q A;  1G5V A;  4IIO A;  2GQV A;  5D7U A;  2HD0 A;  2DL4 A;  3HFN A;  2GBQ A;  2X35 A;  2BZ8 A;  4KT0 E;  5GAM f;  1K8A R;  2L3Q A;  2RH2 A;  5CKH A;  3H9N A;  1YJN A;  4M77 F;  2LC4 A;  4Z02 A;  4BE0 A;  1TH7 A;  4OGE A;  3CC7 Q;  1VQ5 Q;  2A28 A;  1VQ6 Q;  1HSQ A;  3PT9 A;  2DE0 X;  3NHN A;  4KGX B;  5LJ5 e;  4Q5W A;  1H92 A;  4M7D C;  4BI3 A;  2OAU A;  4LDY A;  3NTI A;  2F2X A;  1EIF A;  1AD5 A;  3MP6 A;  3I55 Q;  4XQ3 A;  2RM4 A;  3JCM X;  4C8Q F;  2PUO B;  2RI3 A;  1G3T A;  2ZPB B;  2YLB A;  1WHK A;  3CD6 Q;  4KUI A;  2CDT A;  3J81 E;  3RIR A;  4AFS C;  5CKD A;  2K2M A;  1QVF P;  3HKS A;  4LE9 A;  1MHN A;  4ELZ C;  3CCE Q;  1O9S A;  3MHX A;  2HL3 A;  4IUU A;  1A0N B;  4FU6 A;  1WYX A;  5GMK i;  2K9G A;  3MET A;  2MYS A;  1IGQ A;  2JUF A;  4L6V 5;  1YHQ T;  3PFS A;  4FYY B;  1KHI A;  1EFN A;  1YFN A;  4LNP A;  3M59 A;  1G8X A;  1YJW T;  1VQK T;  2BKD N;  2ZPF B;  1VYU A;  1NZ9 A;  3JSC A;  1Q86 U;  4MMK A;  2QQB A;  1GFC A;  4AT1 B;  4OMN A;  4RMO A;  5AYF A;  2WSC E;  1N8R R;  3CXC S;  1G2B A;  4RKU E;  5CK9 A;  4XTZ A;  3BDU A;  1PKS A;  4M7D F;  1ZBJ A;  3CBM A;  4AFU C;  4C92 A;  4Z8A A;  3CCM A;  2RNA A;  4HCB A;  1JXM A;  4Z88 A;  2LQ8 A;  2E3H A;  2QXF A;  1WA7 A;  2LNV A;  3E2U A;  1NPP A;  4MZP A;  2XDB A;  1YI2 T;  2K4Y A;  4FW2 A;  4D8D A;  3OYJ A;  1KD1 C;  3TVT A;  1H3H A;  4RTY A;  1EZZ B;  1HXD A;  1AEY A;  1W2B A;  2DXC A;  2HNI A;  4EMG A;  1BIA A;  1VQO A;  2KK4 A;  3WVE B;  1S1N A;  4CC4 B;  3INZ A;  2CP3 A;  3FLG A;  3M53 A;  2ZPE B;  2DVE A;  3OSS C;  4JLG A;  2AKK A;  1X2K A;  2EKH A;  5A0D A;  3RMS A;  1FMV A;  1VQ4 A;  3CCQ T;  3CME A;  3CCU T;  2RN8 A;  3CC4 A;  1YIT A;  3ZL7 C;  4IKF A;  1JBM A;  2JS2 A;  5LJ5 g;  3M9Q A;  4JRK A;  5CO7 A;  1T3S A;  2M51 A;  4IUR A;  3CCJ T;  2EVR A;  4ANJ A;  2VYT A;  1ZSG A;  1X69 A;  4NL3 A;  4IUP A;  2DTH A;  3C95 A;  3X25 B;  3F70 A;  3J80 E;  1YJ9 Q;  1SSH A;  2FHD A;  1BCM A;  4LUE A;  3HTR A;  1Q7Y U;  3QDR B;  3OYK A;  2LQK A;  3CCR A;  2X4J A;  3VV0 A;  4E7S A;  1D0Y A;  4GBQ A;  5GAN 5;  4KH0 B;  1Y96 A;  4J8O A;  3V8J A;  2GQI A;  2HSE B;  1IRX A;  1QCN A;  4OB1 B;  2QTX A;  2QA4 A;  2K2V A;  1FXX A;  3OYH A;  3OY9 A;  3DLL A;  3EGD A;  4M78 G;  3VUB A;  4ZTF A;  3HRS A;  1M2V A;  2EGA A;  2DZC A;  3R6O A;  4MDX A;  1JJ2 S;  4JJB A;  2LCS A;  4LN2 A;  2DIL A;  3VS2 A;  2DET A;  1M5Q 1;  2L8D A;  2QQA A;  1TSF A;  4M78 D;  1W4S A;  3URG A;  4NS5 A;  3I9Q A;  3RMQ A;  1KJW A;  4C0F A;  2FEI A;  3GLX A;  2JMA A;  1UEC A;  2PNI A;  3PTA A;  1UGP B;  4OGC A;  2ZZD A;  3OYB A;  5KE3 A;  4QQ6 A;  1K9M C;  3GNG A;  2V8K A;  3UF4 A;  1QCF A;  4PKC C;  1NEG A;  3VS1 A;  2K3X A;  4E47 A;  4OMQ A;  3OYY A;  5IAY A;  3L1A A;  1GFD A;  1M2O A;  1Q82 U;  3TU4 K;  1UFF A;  1AHJ B;  1IB8 A;  4PJN A;  3TRE A;  5I22 A;  3EAE A;  4KH1 B;  5KYY A;  1VYT A;  3OW2 S;  2J05 A;  2NUP B;  3FDR A;  4PJJ A;  4JJC A;  1D3B B;  3VS5 A;  4ZTJ A;  5LJ3 j;  3CCS A;  3G4S Q;  1U1S A;  1IZ6 A;  2GFA A;  1W6X A;  3MO8 A;  1YCY A;  4C0Z A;  1BKB A;  3E9G A;  1K73 U;  1PHT A;  1VQP A;  2EGC A;  2CZ1 B;  2IPO B;  4GLK A;  2LT4 A;  5GAN f;  2EYZ A;  1T3L A;  2DRM A;  2L3S A;  4OB3 B;  2XI9 A;  2OTJ Q;  1OZ2 A;  4DA4 A;  4UC4 A;  2CZ7 B;  1H8K A;  3L2V A;  4PJO E;  3KUF A;  4M75 A;  1WXT A;  3QG1 A;  3DB3 A;  3CCL T;  1X6O A;  2E6N A;  2E4H A;  1MMD A;  2DEQ A;  2XU8 A;  2AZV A;  2OTL T;  5FWC A;  3JCM g;  3CC7 A;  1VQ5 A;  1VQ6 A;  4C8Q G;  3MP1 A;  3HSB A;  1QKX A;  4PFP A;  1IXD A;  1VQ9 A;  3FB9 A;  3LGL A;  5KCO A;  4P5N A;  4JS4 A;  3I55 A;  1WI7 A;  1MNE A;  3HHT B;  1QWE A;  2C0O A;  3M58 A;  5GAO p;  4RTX A;  2M16 A;  5LJ3 d;  4OP0 A;  2WAC A;  1VQ8 T;  1U3O A;  2RJC A;  3CD6 A;  3LWI A;  2HDA A;  2P84 A;  1ZUY A;  4FT2 A;  1GRI A;  5GAM e;  1SRM A;  1TG0 A;  2YUP A;  3QBY A;  1TU0 B;  1VYV A;  5CQY A;  4PJM A;  4GLM A;  2C06 A;  4OVA A;  4JS5 A;  1AT1 B;  3GPL A;  2DK3 A;  1WHL A;  1N5Z A;  3M4G A;  2CUB A;  1VQM T;  1VQ7 T;  2CH4 W;  5IHI A;  2QEX Q;  2JVV A;  3JCM f;  4Y92 A;  2J6O A;  3OS0 A;  4DBF A;  1Q86 R;  2LRQ A;  4R56 A;  3NGP A;  2VUB A;  1M27 C;  1XQH A;  2E1H A;  3ZFJ A;  3CPW A;  1U1T A;  4FW1 A;  2VWF A;  3V7S A;  4JZ4 A;  2QDY B;  3JCM V;  2P4T A;  2BZY A;  1VA7 A;  4F7U F;  2ROT A;  3CC2 T;  1CKA A;  2DLP A;  2EYY A;  4M78 A;  4M7D G;  5CAI A;  3O8V A;  2KVQ G;  5FU6 B;  2FL7 A;  4BB7 A;  2W0Z A;  1AZE A;  5LJ5 j;  2VB6 A;  3L2Z A;  2CP7 A;  1OX9 A;  4ZGE B;  4FCY A;  1ZBX A;  5FW9 A;  3MPU B;  4J7I A;  3KFV A;  2ZPI B;  2MAM A;  3GBQ A;  2LJ1 A;  2I2L A;  2M02 A;  5LL6 S;  1WXB A;  3EHR A;  1QVG P;  4JLI A;  1QVF S;  3EFO A;  5GAN h;  3OYF A;  2PVG B;  3O5Z A;  3JCM P;  1NJI C;  3E9F A;  1IHV A;  1Q81 U;  1YHQ Q;  4PL6 A;  4C5E A;  2EGE A;  4C92 B;  1QVP A;  2JTE A;  2P0P A;  2COY A;  1YJW Q;  2XKO C;  2BTT A;  3MKD A;  2LX7 A;  4DEX A;  4AMC A;  2HMA A;  2CZ6 B;  1FWZ A;  2GTJ A;  1VQK Q;  5KYU A;  1UJ0 A;  4E6R A;  1KQS A;  4PFZ A;  1PCX A;  2MIO A;  1VIF A;  4XTX A;  3A8O B;  2QG9 B;  2YHT A;  3X26 B;  3PIP A;  4QVC A;  3UWN A;  4PJO B;  2OX7 A;  1JB0 E;  4HCZ A;  2QTV A;  2A3L A;  3I56 T;  3ZEH A;  4ZN1 A;  4HCC A;  2XDP A;  1FX7 A;  4KUL A;  4K11 A;  1AZG B;  1NE8 A;  1SKU B;  4J9F A;  5GMK e;  1YJ9 A;  1JRI A;  2VGM A;  1YI2 Q;  2QQR A;  2YDL A;  3SD4 A;  3A8L B;  4E7L A;  1KSW A;  1OU8 A;  1K9A A;  3QII A;  3T9N A;  4EMK C;  2C0T A;  2HQH A;  1M8M A;  2DIG A;  5EG2 A;  4C8Q A;  2O4X B;  2ZGW A;  2KMT A;  2KRM A;  4M7A E;  1B07 A;  5L8R E;  4EMK A;  5DM7 R;  1RI9 A;  2ATC B;  3PE0 A;  5GAO l;  3BFM A;  1RAD B;  1KK7 A;  4ELY C;  3V8L A;  3U23 A;  2D1X A;  4BD3 A;  2F2W A;  3JRZ A;  2ECZ A;  2I0N A;  6AT1 B;  3EG3 A;  5FWB A;  2E65 A;  2E6Z A;  4C5H A;  2GCX A;  2Y90 A;  4N0A C;  3ASK A;  3CMA T;  3QJ6 A;  2PQW A;  2MWP A;  4CC7 A;  3P8B B;  3CCU Q;  3I5S A;  5IH2 A;  5CKB A;  3QDF A;  2JM9 A;  2IG0 A;  4ZN3 A;  1FMW A;  1QLY A;  4RTZ A;  3NPF A;  4VUB A;  5GAO q;  3QWY A;  2COZ A;  4BY6 B;  1JQQ A;  3CCM T;  2YRD A;  3RUX A;  4JDS A;  3M54 A;  1AOJ A;  1QCO A;  2YXY A;  2QDL A;  4JJN K;  3RES A;  2MWO A;  4IIM A;  4FSX A;  8AT1 B;  3OS2 A;  5EC7 A;  1GCQ C;  1PRL C;  1PRM C;  2BE7 D;  1K9M R;  4OB0 B;  2DTI A;  1PWT A;  1Y71 A;  2DL7 A;  1C1A A;  4A63 B;  5KYX B;  1BI0 A;  3UPU A;  3S3N A;  4HVW A;  5A0G A;  2DTO A;  1W2B P;  5M9O A;  3C4S A;  4M7D A;  3S3M A;  3WVD B;  4X1V A;  5FRO A;  3X24 B;  3P8D A;  3HFO A;  2MF2 A;  1V76 A;  4XTV A;  3EGX A;  2KYB A;  1B7T A;  1M1K U;  2K5I A;  4MDW A;  3WXM B;  2D0Q B;  1WNL A;  3CME T;  3THK A;  1AVZ C;  3H41 A;  4N4H A;  3CC4 T;  1PSF A;  2ZPG B;  5KYN A;  1PSE A;  4HVV A;  4LUD A;  4E7H A;  3M0T A;  4JJD A;  1WQW A;  3M0U A;  4J9I A;  2OTJ A;  1YWP A;  5GAN 8;  2KRO A;  2PVO B;  1N9S A;  1Q86 C;  1M3C A;  2KXD A;  4A4K A;  2RJD A;  2SRC A;  1XNI A;  1QP3 A;  2NUT B;  3DKM A;  4R55 A;  1KC8 U;  1OYX A;  4X34 A;  1YNZ A;  5I11 A;  2EJF A;  2HKQ B;  4J6Y A;  1I81 A;  5I2S A;  3ULR B;  1OI1 A;  2RF0 A;  4ORZ A;  2J7I A;  4CC3 A;  5GAO m;  3L2R A;  1OPK A;  4RTT A;  3M0S A;  1NYG A;  1AWX A;  4M75 B;  3OA6 A;  2QGG A;  1LPL A;  2HCK A;  3MJX A;  1B3Q A;  1NM7 A;  4KGZ B;  2E70 A;  2DF6 A;  1S72 Q;  2HQE A;  2ABL A;  3TSZ A;  1VIE A;  4JPB W;  2DBM A;  3DLM A;  1WQ7 A;  1BI1 A;  3MEW A;  3CEY A;  5AT1 B;  1R0C B;  3OMC A;  3UDC A;  4M7A B;  1LOJ A;  2QEX A;  1Y07 A;  3KBG A;  1I8F A;  4F7U G;  4PFO A;  3CQT A;  3NFC A;  4HT8 A;  4PNO A;  1M3A A;  3CCL Q;  2CT3 A;  2FVU A;  1FMK A;  1M4Z A;  2HZY A;  2X3W D;  1GXI E;  2ZCF B;  1N9R A;  4J9D A;  4PJO C;  2OTL Q;  1KQ1 A;  2GFU A;  1KG1 A;  2HL5 C;  1Y0M A;  4F14 A;  4KUD K;  2E10 A;  2KT1 A;  1B34 B;  3M55 A;  3GIB A;  2HKN A;  2KI7 A;  1Q7Y C;  2KRN A;  2A08 A;  3ME9 A;  3C0C A;  2A7Y A;  4F04 B;  3CCS T;  1M8V A;  1YN8 A;  2EYW A;  3HP9 A;  2GNC A;  1M3B A;  1VQP T;  2P4R A;  1RL2 A;  3JCM e;  2V8I A;  1WLP B;  1WHG A;  1ZSZ C;  4J6X A;  2EBP A;  1VQL T;  2FRY A;  5GAM j;  5GAN 7;  3QPH A;  4MML A;  4RTU A;  2H3J A;  3BE3 A;  4RG2 A;  2EQJ A;  1M90 U;  3GNF B;  1VQN T;  1VQ7 Q;  1PNJ A;  2JW4 A;  3R6N A;  3M4Y A;  1YHQ A;  3EH2 A;  3LH0 A;  3QZ5 B;  1NEB A;  3FC3 A;  3S3O A;  1NJI R;  2LTO A;  3A5Z B;  2DEU A;  4IUQ A;  3REB B;  1YJW A;  2R57 A;  3G6E T;  3JB9 I;  1E6G A;  5CR2 A;  3CC7 T;  1VQ6 T;  1LCK A;  1ZUU A;  4FYX B;  2DL5 A;  2DRK A;  3OYC A;  1VQ9 T;  3TSW A;  2RHU A;  4J9B A;  3H0F A;  3FEO A;  5C0M A;  5CKE A;  3CC2 Q;  1K4U S;  3TQ7 P;  1RAB B;  2HEQ A;  4ME7 A;  2CP2 A;  5ECA A;  5DLO A;  2DYB A;  3CCV T;  2V1R A;  4PJO F;  3JB9 D;  3CD6 T;  4AFQ C;  3VUZ A;  2CKK A;  2LJ3 A;  4OMM A;  3VYG A;  1WXU A;  2E64 A;  4WF2 A;  1Q82 C;  1I07 A;  1LNX A;  1RAC B;  3HPW A;  2KAF A;  4Y91 A;  2DVJ A;  4EDU A;  3QHS A;  2LJ0 A;  2YLC A;  3SWN B;  5GAN g;  2FZK B;  3REA B;  3EG1 A;  2RPN A;  1OX8 A;  3PNW C;  4DBH A;  3JCM Q;  5GAM d;  2IIM A;  1UEB A;  3EG9 B;  5A0L A;  1NBE B;  1YI2 A;  1UGV A;  1R77 A;  3M0Q A;  2KXC A;  5LJ3 h;  1IGU A;  5CIU A;  2OAW A;  4E7J A;  5FU7 B;  1K73 C;  1BI3 A;  1MND A;  3OYG A;  2CZ0 B;  8ATC B;  2RQV A;  1ZLM A;  3SB2 A;  2M9U A;  2X4W A;  2CYZ B;  4M77 B;  1E6H A;  4L59 A;  4C5G A;  1QVG S;  2SEM A;  5DY9 A;  2KR3 A;  1IRE B;  4C92 E;  1CSK A;  1K8A U;  2QK0 A;  1OUL A;  3M56 A;  3CPW P;  2F1L A;  2DO3 A;  3CCU A;  3J7A F;  1ZHI A;  4LXC A;  2X51 A;  4C8Q B;  1YIJ T;  1Z9Z A;  1UHF A;  2RD1 A;  2BE9 B;  3VYH B;  3LW5 E;  3CBP A;  3I56 Q;  1WFW A;  2YWW A;  2QAS A;  5I2M A;  4N4G A;  4GY5 A;  3EFR A;  2O9S A;  1HD3 A;  4F7U A;  2G6F X;  3TEE A;  2DM1 A;  3JCM b;  2LX9 A;  2R5A A;  2NYS A;  2KT8 A;  1UB4 A;  3MEA A;  5GMK j;  2HQX A;  4HVU A;  3HRT A;  3EG0 A;  2X3X D;  4XU2 A;  2EQU A;  1UG1 A;  2DXU A;  3PVQ A;  4QKU A;  3TCJ A;  3PIO A;  3OS5 A;  1N6A A;  4A4F A;  4QQD A;  2XIC A;  3OBW A;  4HKE A;  3SHW A;  2LDM A;  2FZG B;  1R0B G;  4DQ2 A;  2M0O A;  3EFS A;  4OMP A;  4M7A C;  2K5L A;  2F5T X;  3CMA Q;  4BE2 A;  1E7O A;  1UGR B;  3CCE A;  4J6W A;  1HYO A;  2J06 A;  3M0R A;  3OYN A;  2JTF A;  1Q95 G;  1H64 1;  1R8O B;  2O01 E;  1VOM A;  2RO0 A;  1KQS P;  3E19 A;  1SRL A;  1Z9Q A;  2YSQ A;  3M0P A;  4Y28 E;  1SF9 A;  1W1F A;  1WZO A;  3VS7 A;  2RHI A;  3CXC A;  5CKF A;  3A8M B;  1N8R U;  5KH6 A;  5I21 A;  2H8H A;  3G71 T;  1QWF A;  2EYQ A;  2KSS A;  3FRN A;  4C5I A;  4FM4 B;  4DOW A;  3EHQ A;  5D6X A;  1RAI B;  4ESR A;  5IHK A;  4FSS A;  1C6V X;  4XU0 A;  4ZNX A;  2DZ9 A;  2VXF A;  1K76 A;  2R58 A;  1GCP A;  2DBK A;  5GAN 4;  1PM3 A;  4MZT A;  1I5L A;  1ZUK A;  4QQG A;  3UAT A;  2X4X A;  1CKB A;  2RJE A;  3E1S A;  3VRY A;  5HK3 A;  2KQW A;  1S72 A;  1Q81 C;  2V8J A;  2DMO A;  5GAN 2;  2COW A;  3VS3 A;  3FIF A;  1SSF A;  1ARK A;  1W2B S;  4A53 A;  3OS1 A;  3CC4 Q;  1I5O B;  4M4Z A;  2OJ2 A;  2EFI A;  4CC2 A;  4F17 A;  3M57 A;  4M7A F;  1M9S A;  1JXO A;  3QO3 A;  4LD6 A;  3OYL A;  1WDX A;  2FPD A;  1YJN T;  2DA9 A;  1ABQ A;  4V2S A;  4RTW A;  3CCL A;  2AT1 B;  4HCK A;  1GBR A;  2MOX A;  1G3S A;  1OOT A;  1LJO A;  2DPP B;  1V29 B;  2AK5 A;  1D09 B;  2DL3 A;  2OTL A;  1D1C A;  2E12 A;  1MGQ A;  2W10 A;  2DJZ A;  1K0X A;  1OU9 A;  3SWN C;  4WCI A;  1NLO C;  5LJ5 d;  2EJ9 A;  4FYW B;  3BY7 A;  1NPR A;  2XMF A;  5CCA A;  3JB9 F;  4M75 E;  2K57 A;  2K5F A;  2DER A;  3RR6 A;  2A0F B;  1Q7Y R;  2RB6 A;  2QI2 A;  5GAN j;  2H3E B;  1GL5 A;  1TS9 A;  3JAM E;  2J6K A;  3FJ5 A;  4TVR A;  5FRN A;  3C12 A;  4HXJ A;  2LNH B;  1JO8 A;  2DXT A;  1OZ3 A;  1WHJ A;  3V7C A;  2P0K A;  2RQU A;  3OMG A;  1JJ2 A;  5FLX E;  2DX1 A;  2VGN A;  2F69 A;  4F16 A;  1D3B A;  1TUC A;  5J39 A;  1MV3 A;  1LVK A;  5J3B A;  4C92 D;  3PMI A;  3AHU A;  3RNJ A;  2D9T A;  3PVL A;  1AWW A;  2E41 A;  3OB9 A;  3OYE A;  4BAC A;  4E7K A;  2MK5 A;  4PJO G;  1SHF A;  4BUG A;  1U8R A;  2CP0 A;  3MEU A;  3CC2 A;  2RI2 A;  2EW3 A;  1WHH A;  3CCQ Q;  4J9H A;  4NOY A;  3H8Z A;  5GAN 6;  2YRC A;  4N0A A;  3C94 A;  2BIV A;  2D8H A;  2DIQ A;  1QMC A;  1RAA B;  4PJO D;  1Y96 B;  1OQK A;  1WPY A;  3CCJ Q;  4OMO A;  5KE2 A;  3IQL A;  3JV3 A;  4B9W A;  4IUT A;  5D6Y A;  3OW2 A;  1VQP Q;  1Q82 R;  1BYM A;  4PLI A;  3OQ5 A;  4CRI A;  3EGD B;  1XJW B;  1TWB A;  1PKT A;  4FT4 A;  1VQL Q;  1AWJ A;  1N27 A;  2JTM A;  1M2V B;  3QYH B;  2BZX A;  3VJP A;  4C0G A;  2FZC B;  2GF7 A;  1W70 A;  3AT1 B;  3D7S B;  1M1K C;  1VQO T;  4M78 E;  2QEX T;  4AG1 C;  1VQN Q;  3UA7 A;  1GCQ A;  1O75 A;  2CS7 A;  2LQN A;  2X4Y A;  1RI0 A;  1K73 R;  5FRM A;  4JUV A;  4RG8 A;  4DEY A;  5IXF A;  3G6E Q;  4BE1 A;  1ABO A;  2FPE A;  1WX6 A;  3P8H A;  1UGS B;  2ENM A;  2WSF E;  3G4S A;  1VQ4 T;  1UDL A;  2GTO A;  3EH1 A;  1MMA A;  2B8A A;  1WJQ A;  2O2O A;  1KC8 C;  1VQ9 Q;  4OML A;  2PTK A;  1YIT T;  2KEA A;  2LCC A;  2X9H A;  1X01 A;  2OI3 A;  5GMK m;  1UGQ B;  3CCV Q;  4AFZ C;  1K1Z A;  4ATO A;  4A4H A;  4DOV A;  5LJ3 g;  2CSQ A;  5KYY B;  3OYI A;  3EGU A;  3I56 A;  5KCH A;  5HK0 A;  5GAO n;  2XHC A;  4RTV A;  1V1C A;  1WHM A;  1FYN A;  1PC0 A;  4A4E A;  3MP8 A;  3JCM d;  2EKO A;  5FU6 C;  1UJY A;  2K6D A;  4Z89 A;  2FG0 A;  1OPL A;  4QVD A;  2RHX A;  3CCR T;  2PU9 B;  2F2V A;  2C0I A;  3GP8 A;  3UT1 A;  3A98 A;  1PD1 A;  1MUZ A;  1D0X A;  2DYI A;  2NWM A;  2QA4 T;  5GAN e;  4M77 E;  4NL2 A;  1KQ2 A;  1T0H A;  4LDU A;  5J26 A;  2M0Y A;  2YRV A;  3LGF A;  2IVW A;  4F7U B;  3LLR A;  2DD5 A;  2Y4X A;  2FYK A;  4X9D A;  3CMA A;  5LJ3 f;  1ZX6 A;  4DBQ A;  5HKC A;  3RKX A;  1H3Z A;  4E2F B;  2KRS A;  4J83 A;  1TUD A;  2MPX C;  2O31 A;  3BW1 A;  4C92 C;  1RAF B;  1OEB A;  2WSE E;  2L89 A;  1YIJ Q;  4J9G A;  4C8Q E;  3CPW S;  2V26 A;  4FL6 A;  1WGS A;  5IN1 A;  2HAX A;  2O88 A;  2KDS A;  4XTY A;  4J9E A;  2CP5 A;  1OV3 A;  1MMN A;  3LH5 A;  2CGH A;  2VC8 A;  2JM8 A;  4A4G A;  2XK0 A;  2JT4 A;  4YTL A;  2KYM A;  3VKI A;  4M75 G;  1RAG B;  4J9C A;  3VRZ A;  1MV0 B;  3H0H A;  5IT9 E;  4BI4 A;  2RK2 A;  2YUQ A;  4PJO A;  3NMZ C;  4II1 A;  2RI5 A;  3OYA A;  1SEM A;  3G7Z A;  1QVF A;  1SG5 A;  4C0D B;  2KGT A;  4M75 D;  1TXQ A;  5GAM h;  2A37 A;  3QJY A;  1M90 C;  2R5M A;  2EPD A;  3ZBD A;  1VQ8 Q;  1KD1 U;  3CBO A;  3RDV A;  4XTW A;  2MCN A;  2RQW A;  4M7A G;  5KYW A;  3S6W A;  2CP6 A;  4B9X A;  1Q81 R;  1U06 A;  1RAE B;  3A1P A;  7AT1 B;  1NG2 A;  1BK2 A;  2O4X A;  4M78 B;  5GJW B;  4A54 A;  1X75 C;  1ZSZ A;  1G83 A;  2ED1 A;  1VQM Q;  1MMG A;  2RHY A;  4M7A D;  2DXB A;  1IHW A;  2MI6 A;  4M7D E;  2ZAE A;  1BB9 A;  4N4I A;  4BDZ A;  3GF5 A;  2HSP A;  1KQS S;  2F5K A;  4C92 F;  3EG2 A;  2YUN A;  2NLU A;  1UHC A;  1J3T A;  3A8G B;  2EQI A;  3G71 Q;  1HK9 A;  1YP5 A;  1TUG B;  4JRQ A;  1VQ5 T;  1VQK A;  1JU5 C;  4FYV B;  3SFM A;  3A8H B;  1YBY A;  3RKW A;  3JB9 G;  3CPF A;  1I1J A;  4O6J A;  4RUG A;  4ZGD B;  4BY6 C;  2VKN A;  3OSV A;  2EQM A;  1NLP C;  2LMJ A;  4LDV A;  3I55 T;  1PG5 B;  3MEV A;  3EFO B;  3QKJ A;  2LP5 A;  4L5G A;  2CT4 A;  2MMP A;  1ZA1 B;  3I5R A;  5LJ5 f;  2LZ6 B;  2DKG A;  4D6W A;  2KNB B;  2VXE A;  4LD9 K;  3CCE T;  2KY9 A;  1QP2 A;  1X43 A; 
#chains in the Genus database with same CATH homology
 5L8R E;  4EMK A;  2RHI A;  3CXC A;  5CKF A;  3A8M B;  5DM7 R;  1N8R U;  5KH6 A;  4RMO A;  3PGG A;  5I21 A;  3BFM A;  5AYF A;  5GAO l;  2WSC E;  4HA8 A;  4RCC A;  4ELY C;  3V8L A;  3X20 B;  3G71 T;  3CXC S;  4BD3 A;  1K8A C;  3JRZ A;  2EYQ A;  2KSS A;  4RCB A;  3FRN A;  4OMF B;  4C5I A;  4FM4 B;  4LDW A;  4RKU E;  5CK9 A;  2E65 A;  2E6Z A;  4C5H A;  2GCX A;  4XTZ A;  3L2W A;  3BDU A;  4DOW A;  2Y90 A;  4XU1 A;  4N0A C;  3CBM A;  4C92 A;  3ASK A;  3DB4 A;  4M7D F;  3CCM A;  3CMA T;  2ZGW A;  3QJ6 A;  5D6X A;  4HCB A;  2PQW A;  4XU0 A;  2LQ8 A;  3PMT A;  2DZ9 A;  2VXF A;  2QXF A;  2MWP A;  3P8B B;  2LNV A;  2R58 A;  5CKB A;  1NPP A;  4MZP A;  5GAN 4;  2XDB A;  1YI2 T;  2IG0 A;  2K4Y A;  4MZT A;  4ZN3 A;  3OYJ A;  1I5L A;  2QQ9 A;  4QQG A;  4BI8 B;  1KD1 C;  2X4X A;  1M1F A;  2EJG A;  1ZQ1 A;  4VUB A;  5GAO q;  2RJE A;  1HXD A;  1W2B A;  3E1S A;  5HK3 A;  2DXC A;  2HNI A;  2KQW A;  1BIA A;  4EMG A;  4BY6 B;  3CCM T;  1VQO A;  2KK4 A;  2V8J A;  3V8K A;  2LCL A;  5GAN 2;  1S72 A;  1Q81 C;  3FIF A;  1SSF A;  4JDS A;  3RUX A;  3M54 A;  3WVE B;  1W2B S;  3CCQ A;  1WJS A;  3JCM c;  4A53 A;  4JJN K;  3RES A;  2MWO A;  3OS1 A;  3JB9 J;  4FSX A;  3INZ A;  3FLG A;  3M53 A;  3OS2 A;  2ZPE B;  1K9M U;  2DVE A;  3OSS C;  4EMK B;  4JLG A;  3LWH A;  3CCJ A;  2XD0 A;  4OB0 B;  2DTI A;  2EFI A;  1S72 T;  1QW1 A;  5GMK h;  3M57 A;  4M7A F;  5A0D A;  3RMS A;  1M9S A;  3QO3 A;  1VQ4 A;  3RER A;  4LD6 A;  3OYL A;  3FJP A;  3CCQ T;  2P0Q A;  1Y71 A;  3CME A;  3CCU T;  1YJN T;  3QSU A;  4V2S A;  1BI0 A;  3UPU A;  2EWN A;  3S3N A;  5A0G A;  3CC4 A;  3LX7 A;  1YIT A;  2DTO A;  3CCL A;  3L2U A;  4IKF A;  1I4K 1;  3C4S A;  5M9O A;  1G3S A;  1JBM A;  3ER0 A;  3WVD B;  3S3M A;  4M7D A;  4M75 C;  4M77 G;  1LJO A;  2DPP B;  5FRO A;  3M9Q A;  3P8D A;  1V29 B;  4JRK A;  3HFO A;  4IUR A;  5CO7 A;  3X24 B;  5LJ5 g;  3CCJ T;  2MF2 A;  2OTL A;  2E12 A;  2E5Q A;  4XTV A;  1MGQ A;  2VYT A;  5CQX A;  1M1K U;  2DJZ A;  2K5I A;  1VQN A;  1M1G A;  2Y4Y A;  4MDW A;  3WXM B;  4NL3 A;  4IUP A;  2D0Q B;  1WNL A;  3CME T;  4N4H A;  3SWN C;  3CC4 T;  2DTH A;  1PSF A;  2ZPG B;  3C95 A;  4M77 D;  1PSE A;  3X25 B;  5LJ5 d;  2EJ9 A;  4E7H A;  2XID A;  3F70 A;  3J80 E;  1WQW A;  1VQ5 A;  2KY9 A;  2FHD A;  3BY7 A;  2OTJ A;  1NPR A;  5CCA A;  3JB9 F;  4M75 E;  2K57 A;  5GAN 8;  2K5F A;  2PVO B;  2EQK A;  1N9S A;  3NTK A;  3N5B B;  3G6E A;  3V7R A;  1Q7Y U;  1Q86 C;  2RK1 A;  3QDR B;  4A4K A;  3OYK A;  4LDX A;  2RJD A;  2LQK A;  3HL8 A;  4X9C A;  3GOX A;  2RB6 A;  2QI2 A;  5GAN j;  3CCR A;  2X4J A;  1XNI A;  1QP3 A;  3DKM A;  4R55 A;  4O5V A;  1N8R C;  3VV0 A;  3OYM A;  3JAM E;  5GAN 5;  1Y96 A;  1KC8 U;  4J8O A;  3V8J A;  4JRP A;  1OYX A;  4TVR A;  4OB1 B;  4X34 A;  5FRN A;  3C12 A;  2QTX A;  2QA4 A;  2QQS A;  3M5A A;  1VQL A;  4M7A A;  4C8Q D;  1DJ7 B;  5A2Q E;  3CCV A;  2K2V A;  2EJF A;  1FXX A;  2M1H A;  4J6Y A;  1I81 A;  2DXT A;  1OZ3 A;  3OYH A;  3OY9 A;  5I2S A;  4E7I A;  1OI1 A;  3V7C A;  3DLL A;  4M7D B;  2P0K A;  4M78 G;  3VUB A;  3OMG A;  4ZTF A;  1JJ2 A;  5FLX E;  2RA2 A;  5GAO m;  3L2R A;  2VGN A;  3HRS A;  2F69 A;  1D3B A;  4JRI A;  2DZC A;  3R6O A;  4MDX A;  5J39 A;  1YJ9 T;  1JJ2 S;  5LJ5 h;  4M75 B;  5J3B A;  4C92 D;  3OA6 A;  1M5Q 1;  4C0D C;  3PMI A;  2L8D A;  3AHU A;  2QQA A;  2D9T A;  4M78 D;  1W4S A;  2E41 A;  3URG A;  4NS5 A;  3JCM W;  1B34 A;  3OB9 A;  2E70 A;  3NTH A;  3OYE A;  2AHJ B;  4BAC A;  4E7K A;  4PJO G;  3RMQ A;  4XK8 E;  3CCE T;  4C0F A;  2HQE A;  3JB9 H;  4BUG A;  1U8R A;  4ZGJ B;  3GLX A;  3HRU A;  3MEU A;  3CC2 A;  2RI2 A;  1VIE A;  3PTA A;  1UGP B;  4OGC A;  2ZZD A;  3OYB A;  3QXE B;  3VU3 C;  5KE3 A;  4NOY A;  3DLM A;  3H8Z A;  1WQ7 A;  2PUK B;  5GAN 6;  4QQ6 A;  1K9M C;  3GNG A;  2V8K A;  4N0A A;  1BI1 A;  3C94 A;  3MEW A;  4PKC C;  2PVD B;  3CEY A;  2BIV A;  4M75 F;  2DIQ A;  3RKY A;  4OB2 B;  4PJO D;  1Y96 B;  2K3X A;  1WPY A;  2XG8 D;  4M78 C;  4E47 A;  3OYY A;  5IAY A;  3H6Z A;  3OMC A;  3UDC A;  5KE2 A;  3L1A A;  4M7A B;  1LOJ A;  2QEX A;  1Q82 U;  3TU4 K;  4B9W A;  4IUT A;  5D6Y A;  3OW2 A;  2JN0 A;  1AHJ B;  1XTD A;  1Y07 A;  3KBG A;  1I8F A;  4F7U G;  1BYM A;  4PLI A;  3OQ5 A;  3TRE A;  4CRI A;  3EAE A;  3SDZ A;  1BIB A;  4HT8 A;  3NFC A;  4PNO A;  3OW2 S;  2FVU A;  4FT4 A;  3JCM f;  3FDR A;  1M4Z A;  1YIJ A;  1N27 A;  1BI2 A;  2LT1 A;  4XU3 A;  1D3B B;  2JTM A;  1GXI E;  2ZCF B;  1N9R A;  3QYH B;  3VJP A;  4C0G A;  3OYD A;  4ZTJ A;  2GF7 A;  5LJ3 j;  5HY6 A;  2DAQ A;  1KQ1 A;  2GFU A;  1M1K C;  4PJO C;  3CCS A;  1VQO T;  1KG1 A;  4M78 E;  2QEX T;  1U1S A;  1IZ6 A;  2GFA A;  3QUI A;  4M7D D;  1P92 A;  3MO8 A;  1YCY A;  4C0Z A;  1O75 A;  1BKB A;  3E9G A;  1K73 U;  2CS7 A;  1VQP A;  2X4Y A;  4KUD K;  2CZ1 B;  2E10 A;  1B34 B;  1RI0 A;  3M55 A;  4GLK A;  2JNG A;  2LT4 A;  3GIB A;  5GAN f;  5FRM A;  5GAO r;  4JUV A;  4RG8 A;  4XTU A;  4OB3 B;  1Q7Y C;  3JCM J;  2XI9 A;  3BDL A;  1G3W A;  1OZ2 A;  4DA4 A;  3ME9 A;  2HBP A;  1KHC A;  2EAY A;  4BE1 A;  2OTJ T;  2A7Y A;  3CCS T;  4UC4 A;  1M8V A;  2CZ7 B;  3L2V A;  4PJO E;  2ZPH B;  3HP9 A;  3P8H A;  1UGS B;  3G4S A;  2WSF E;  1VQ4 T;  3KUF A;  4M75 A;  1KC8 C;  2B8A A;  2D6F A;  1WJQ A;  1VQP T;  1RL2 A;  3QG1 A;  3JCM e;  5GAN 3;  2V8I A;  3DB3 A;  5LJ3 e;  5CVI A;  2JZ2 A;  1YIT T;  3X28 B;  3CCL T;  1X6O A;  5D6W A;  2E6N A;  4J6X A;  2LCC A;  1X01 A;  4EPC A;  1UGQ B;  5GMK m;  1VQL T;  2DEQ A;  2XU8 A;  3OBY A;  3SWN A;  5GAM j;  2JOY A;  2BUD A;  3QPH A;  4MML A;  5GAN 7;  4ATO A;  2OTL T;  4HT9 A;  4A4H A;  4DOV A;  3JCM g;  5GMK l;  1VQ8 A;  3CC7 A;  2H3J A;  4RG2 A;  4C8Q G;  5LJ3 g;  4PLL A;  2EQJ A;  5DLQ E;  3MP1 A;  3G4S T;  3GNF B;  3OYI A;  1M90 U;  1VQN T;  3HSB A;  4BDY A;  3I56 A;  5KCH A;  5FU7 C;  1VQ9 A;  5HK0 A;  3FB9 A;  5GAO n;  4F7U E;  2XHC A;  3MCA B;  3M4Y A;  1YHQ A;  3LGL A;  3LH0 A;  5KCO A;  1NJI U;  1WJR A;  3QZ5 B;  4P5N A;  4JS4 A;  3I55 A;  4IUV A;  3FC3 A;  3S3O A;  4M77 C;  3HHT B;  2LTO A;  3A5Z B;  4A4E A;  4EMH A;  3M58 A;  3MP8 A;  2EKO A;  4IUQ A;  5FU6 C;  3JCM d;  2M16 A;  2R57 A;  5LJ3 d;  5GAO p;  3JB9 I;  3G6E T;  4OP0 A;  2RHZ A;  2WAC A;  1YJW A;  4QVD A;  4M78 F;  5CR2 A;  1VQ8 T;  4C92 G;  2RJC A;  3CC7 T;  1VQ6 T;  3CD6 A;  2EIF A;  1G3Y A;  4M77 A;  3LWI A;  2XDD A;  2K3Y A;  1VQM A;  1VQ7 A;  3OYC A;  2RHX A;  3Q1J A;  3CCR T;  1VQ9 T;  1Y7X A;  2PU9 B;  4FT2 A;  4KBM B;  2RHU A;  4XAX B;  3FEO A;  5GAM e;  5CKE A;  5C0M A;  3GP8 A;  2G3R A;  3UT1 A;  3QBY A;  4CI0 C;  5CQY A;  4ME7 A;  2C06 A;  5DLO A;  2QA4 T;  4OVA A;  5GAN e;  4JS5 A;  4M77 E;  4NL2 A;  1KQ2 A;  3CCV T;  3L42 A;  3GPL A;  2DK3 A;  3G71 A;  4LDU A;  4C8Q C;  4PJO F;  3JB9 D;  3CD6 T;  4J7F A;  5GAM g;  3M4G A;  5J26 A;  3VUZ A;  2CKK A;  3VYG A;  2E64 A;  4QW2 A;  2YRV A;  4WF2 A;  1VQM T;  1Q82 C;  1VQ7 T;  3LGF A;  2IVW A;  1LNX A;  4F7U B;  3HPW A;  2LVM A;  3LLR A;  2DD5 A;  2KAF A;  4Y91 A;  2Y4X A;  2JVV A;  1VUB A;  1XOV A;  2YLC A;  3QHS A;  2FYK A;  3LYI A;  4X9D A;  3SWN B;  4QVZ A;  5LJ3 f;  5GAN g;  3OS0 A;  3CMA A;  2LRQ A;  4R56 A;  5HKC A;  3RKX A;  1H3Z A;  2VUB A;  1XQH A;  2E1H A;  3PNW C;  4J83 A;  3ZFJ A;  3CPW A;  3JCM Q;  4FIB A;  5GAM d;  1U1T A;  1UEB A;  3BW1 A;  5A0L A;  1YI2 A;  4C92 C;  2WSE E;  3JCM h;  3V7S A;  2L89 A;  5LJ3 h;  2FB7 A;  3QZ9 B;  2QDY B;  3JCM V;  4C8Q E;  2P4T A;  4OF1 A;  3CPW S;  5CIU A;  5GAN d;  4MZM A;  2RJF A;  2VV5 A;  4E7J A;  5FU7 B;  4FL6 A;  1K73 C;  4F7U F;  1WGS A;  5IN1 A;  2HAX A;  1BI3 A;  3OYG A;  2CZ0 B;  3CC2 T;  2KDS A;  1QVG A;  2L3R A;  3QYG B;  4XTY A;  3SB2 A;  2M9U A;  2DD4 A;  2X4W A;  4M78 A;  3L2Q A;  5C6S A;  2CYZ B;  5CAI A;  4M7D G;  4M77 B;  3KXT A;  4J5Y A;  4L59 A;  2CGH A;  2VC8 A;  3O8V A;  4C5G A;  2KVQ G;  1QVG S;  5DY9 A;  5FU6 B;  2FL7 A;  4BB7 A;  4A4G A;  2XK0 A;  2L5Q A;  5LJ5 j;  1G5V A;  1IRE B;  4YTL A;  2GQV A;  4C92 E;  3VKI A;  3L2Z A;  2HD0 A;  4M75 G;  1K8A U;  3HFN A;  4ZGE B;  2X35 A;  1ZBX A;  5IT9 E;  4BI4 A;  2RK2 A;  4KT0 E;  5GAM f;  3M56 A;  2DO3 A;  2RH2 A;  4PJO A;  4J7I A;  5CKH A;  1YJN A;  3CCU A;  4II1 A;  3J7A F;  2ZPI B;  4M77 F;  2RI5 A;  1ZHI A;  2MAM A;  3OYA A;  3G7Z A;  1QVF A;  2LC4 A;  4Z02 A;  4C0D B;  2I2L A;  4BE0 A;  4M75 D;  4C8Q B;  5GAM h;  1YIJ T;  5LL6 S;  1TH7 A;  3QJY A;  4OGE A;  1M90 C;  2R5M A;  3ZBD A;  4JLI A;  1QVF S;  2RD1 A;  1KD1 U;  3CBO A;  3PT9 A;  5GAN h;  3VYH B;  3OYF A;  3LW5 E;  3CBP A;  2PVG B;  5LJ5 e;  4XTW A;  4Q5W A;  4M7D C;  3JCM P;  1NJI C;  3E9F A;  4BI3 A;  2OAU A;  1Q81 U;  4LDY A;  3NTI A;  4EDU A;  4PL6 A;  5I2M A;  4M7A G;  1EIF A;  4C5E A;  4N4G A;  3MP6 A;  3S6W A;  4B9X A;  1VQ6 A;  4GY5 A;  4XQ3 A;  3EFR A;  1QVP A;  4C92 B;  4F7U A;  2RM4 A;  3JCM X;  4C8Q F;  2P0P A;  2PUO B;  2RI3 A;  1G3T A;  2ZPB B;  3TEE A;  2XKO C;  2O4X A;  4M78 B;  3JCM b;  2LX9 A;  2YLB A;  1YHQ T;  4A54 A;  4KUI A;  2CZ6 B;  1FWZ A;  1X75 C;  2R5A A;  3J81 E;  1UB4 A;  3MEA A;  3RIR A;  2RHY A;  5CKD A;  5GMK j;  4M7A D;  2HQX A;  1KQS A;  3HKS A;  2DXB A;  3HRT A;  2MI6 A;  4M7D E;  1MHN A;  1VIF A;  4XTX A;  4ELZ C;  3A8O B;  1O9S A;  4N4I A;  4XU2 A;  4BDZ A;  3MHX A;  3GF5 A;  2EQU A;  2YHT A;  3X26 B;  1KQS S;  2F5K A;  4IUU A;  3PIP A;  2DXU A;  3TCJ A;  4C92 F;  4QVC A;  3PIO A;  2NLU A;  3OS5 A;  1N6A A;  4A4F A;  4FU6 A;  4QQD A;  2XIC A;  3A8G B;  3UWN A;  5GMK i;  4PJO B;  1HK9 A;  1JB0 E;  3OBW A;  4HCZ A;  4HKE A;  3MET A;  1VQ5 T;  4JRQ A;  1VQK A;  3SFM A;  2A3L A;  3A8H B;  1YBY A;  2LDM A;  3RKW A;  4DQ2 A;  3ZEH A;  3I56 T;  3CPF A;  3JB9 G;  4ZN1 A;  2M0O A;  3EFS A;  4O6J A;  4ZGD B;  4HCC A;  4M7A C;  2JUF A;  2K5L A;  4L6V 5;  2XDP A;  3OSV A;  2EQM A;  1FX7 A;  2F5T X;  4LDV A;  4BY6 C;  4BE2 A;  1UGR B;  4KUL A;  3CCE A;  4J6W A;  3PFS A;  1NE8 A;  3I55 T;  3MEV A;  3OYN A;  2JTF A;  1KHI A;  3QKJ A;  5GMK e;  1YJ9 A;  1JRI A;  3M59 A;  2VGM A;  1YJW T;  1H64 1;  2QQR A;  1R8O B;  2O01 E;  3SD4 A;  4L5G A;  3A8L B;  4E7L A;  2RO0 A;  1VQK T;  2MMP A;  2BKD N;  2ZPF B;  3E19 A;  3QII A;  3T9N A;  4EMK C;  1NZ9 A;  5LJ5 f;  3JSC A;  1Q86 U;  2DIG A;  2DKG A;  4MMK A;  2VXE A;  5EG2 A;  4D6W A;  4LD9 K;  4Y28 E;  4C8Q A;  2O4X B;  1QP2 A;  2KMT A;  2QQB A;  4M7A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...