5GAMh

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
82
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
total genus 12
structure length 82
sequence length 109
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamh00
1H641 4J6YA 4XU0A 4M75F 4NOYA 3RKYA 5GAOp 3JB9H 1I81A 4F7UE 3RERA 2FB7A 3RKWA 3QO3A 3JCMf 3RESA 5DY9A 5GAMg 4PJOG 4PJOD 4M7DB 4N0AC 3QSUA 5GMKh 2YLBA 4M78C 3INZA 5GAN8 5GAMf 5GANh 4M75E 2CGHA 4M75A 4QVDA 1TH7A 5GAMj 1WQWA 2DXTA 4N0AA 4HT8A 1WNLA 4M77F 4C92D 1JBMA 4C92G 4M78E 3HFNA 4HT9A 2ZGWA 2E41A 4M78A 4XTVA 4XTUA 3JCMP 4XTXA 5GAOq 3JCMV 1WQ7A 3FIFA 1HK9A 4HA8A 4M77G 4M7AB 1B34A 3JCMd 2VXEA 2EJFA 3RUXA 4JRIA 1BIAA 3JCMX 5GAOr 3SWNB 4M7DC 2E65A 4M77E 3QHSA 4EMKB 4M77A 3BW1A 2RM4A 4DQ2A 5GAMd 1D3BA 5LJ5g 4PJOB 4OP0A 1LJOA 5GMKm 4M78F 5LJ3e 4M75G 4M75D 5GAOl 5GAN3 1BIBA 2RA2A 1N9RA 2DVEA 3HSBA 4X9CA 5LJ5f 4C8QB 3QUIA 5I21A 3AHUA 4M78D 4M78G 4MMLA 4PNOA 5LJ5j 4A54A 4RCCA 2VXFA 1JRIA 4C92B 3FJPA 2FYKA 3V7CA 4M7AC 1U1TA 5GMKl 1N9SA 5GAMe 2RB6A 4EMGA 3JCMQ 2VC8A 1Y96A 3BFMA 1YCYA 4JRKA 3SWNC 4F7UB 5GMKi 4M77D 4EMKC 3VU3C 4M7DF 5GANg 4J6WA 2DJZA 4PJOC 3BY7A 2QTXA 1MGQA 2DTIA 3JCMW 1I5LA 4M7AA 2I2LA 2EWNA 5LJ3h 3RKXA 3V7SA 5LJ5d 5GANf 5GMKj 2E10A 4M7DG 3SB2A 4C8QC 4M75B 1I8FA 4J6XA 5GANj 1LNXA 3JB9F 4RCBA 2E1HA 3L1AA 2EAYA 2YLCA 3HFOA 4XU2A 4QVCA 4M7DA 2DZ9A 4M7DE 4JLIA 3V8LA 3JCMe 4NL2A 3JCMg 4M7AF 4C8QA 5LJ3g 3JCMJ 5GAMh 3JB9G 3EFRA 1B34B 3PGGA 2JN0A 3V8JA 4XQ3A 3V7RA 4NL3A 2RD1A 4J5YA 4XU3A 1KQ1A 1U1SA 2DKGA 3L2ZA 4Y91A 5LJ5e 5GAN2 4M7AG 5LJ3f 4M7AD 2K57A 4X9DA 4M77B 4PJOF 1KQ2A 1X01A 1WPYA 5GANd 1D3BB 5LJ3j 3RIRA 4XTWA 4XU1A 4M7AE 4F7UA 4M75C 4JUVA 4V2SA 5GAN4 2EJ9A 4C8QF 2DTHA 2DZCA 4XTYA 3JCMb 2HNIA 1LOJA 3SWNA 4M7DD 5GAN5 2DTOA 5GAOn 4EMKA 4C92F 1I4K1 2DXUA 5GAN6 4PJOE 3V8KA 4C8QD 3JCMh 4C8QG 5GMKe 4PJOA 3FB9A 4XTZA 4WF2A 4C92C 5GAOm 1HXDA 4M78B 4EMHA 5GANe 3EFSA 1M8VA 5LJ3d 4F7UF 4C8QE 3JCMc 2DEQA 1Y96B 5LJ5h 5GAN7 2E64A 3JB9I 3JB9D 4M77C 3JB9J 1M5Q1 2EJGA 4C92E 4C92A 3M4GA 4F7UG 3GIBA 2YHTA 4A53A 4MMKA 5CAIA 2Y90A 3BDUA
chains in the Genus database with same CATH superfamily
5GAOp 3CCRQ 1QMCA 4NS5A 1NJIU 4DBFA 1WXUA 2CP2A 2GQVA 1I1JA 1TUGB 4KGVB 3OMGA 1SEMA 2KYMA 1H3HA 1UJYA 3OQ5A 1QP3A 3CCJQ 3HL8A 3FIFA 4HA8A 1YJNA 3CCMQ 3SWNB 2ZPHB 1Q81C 2EQIA 3G6ET 1D3BA 1IGUA 3PIOA 2QGFB 3N5BB 1ZA2B 5KCHA 2RK2A 4M78D 2OAUA 4D8KA 4C0GA 2L3QA 3VRZA 5GAOm 3CBOA 2PVGB 4RTZA 3O5ZA 5KCOA 4HVVA 5FW9A 2O88A 1ZQ1A 2CZ6B 4JDSA 3J81E 3EG3A 3JRZA 2E1HA 4DA4A 2NWMA 1WJSA 2CT4A 3X28B 1YJ9T 4KGZB 2L8DA 1ABQA 4VUBA 1CKAA 2WACA 3RBBB 5KH6A 4QVZA 4X9DA 3QWYA 2HCKA 5FU7C 3I56Q 5L8RE 1M1FA 3CCST 2O9VA 3ULRB 3CCJT 1YJWQ 1R77A 2DTOA 5IH2A 5D7UA 3RMQA 4DBRA 3C4SA 2DIGA 3CCMT 3OYMA 1BKBA 4D8DA 5LJ5h 1OULA 2NYSA 4M77C 1A0NB 1KJWA 2GTJA 1K8AR 4J9GA 3E9GA 4TVRA 2J06A 4XU0A 4M75F 2BZ8A 3OSVA 1SPKA 3QDRB 2QEXT 2RMOA 2HL3A 4E47A 2PQWA 1MHNA 2YLBA 4RG2A 4BE2A 1ZHIA 1VQ7A 2HQXA 1VUBA 2C0IA 2NUPA 1MV0B 1WXBA 2VVKA 2QXFA 4A4KA 3NHNA 3VYHB 4M7AB 1B34A 2VXEA 1V1CA 2D1XA 4AG1C 3VS4A 1G2BA 3CCLQ 2X35A 4EMKB 1WJRA 4J9CA 2HMAA 1UHCA 2RM4A 2M02A 4CRIA 4BD3A 1E7OA 1HYOA 2V8IA 1V29B 3EG9B 1VQMA 3E1SA 4JJNK 1ZBJA 1WYXA 4R55A 2KR3A 1AT1B 3I56T 4ELYC 3DKMA 4GBQA 1U1TA 1AEYA 4AFQC 3META 1YJWT 2EVRA 2AIRB 2CP5A 5GMKi 1NLOC 2YUPA 3LH0A 2LC4A 4M7DF 2KDSA 4RTWA 4ELZC 1PKSA 2XG8D 1C6VX 3L2QA 4M7DG 2GFUA 2PTKA 3I55Q 1M90C 3VS2A 2YLCA 3ZEHA 1M3CA 4OGCA 1I07A 1BB9A 4IUPA 2CP0A 1GBQA 1B07A 4PJOF 4ZTFA 2XD0A 1VQNQ 4ME7A 1QP2A 5DLQE 2RHUA 1X27A 1VQOA 2A28A 2DXUA 1BI3A 1M3BA 2EFIA 2LQKA 4JLGA 3R6NA 4UC4A 3OMCA 3QG1A 1PRMC 3CCLT 4FM4B 2E64A 3MEWA 3JB9D 4J9HA 1SRLA 2E5QA 1T0HA 1SRMA 1VQLQ 2L0AA 2JTFA 4ESRA 1EX4A 1JQQA 5KYWA 1J3TA 4E7ZA 3G71Q 2JNGA 4M75A 5GAMj 2GNCA 1Y71A 4Q5WA 5I2MA 3UA6A 1JJ2A 4HCKA 2BE7D 3AT1B 3JCMV 1WIEA 3I55T 1NG2A 1BIAA 3CQTA 1HJDA 2KROA 3JV3A 2RQRA 4KGXB 1ZUUA 4J7IA 5LL6S 2V1QA 2O01E 4OMFB 3GF5A 1OPLA 4FT2A 4BI4A 2IIMA 4ZGDB 1PC0A 4IKFA 4RUGA 2EYXA 5C6SA 4KH1B 4PKCC 2BUDA 5CIUA 2DBKA 3OSSC 2XDPA 4KULA 1KQSA 1VQKQ 4C8QC 1FMVA 2EYYA 1I8FA 2A37A 1K76A 1BYMA 2MOXA 4M7DA 1PKTA 3OYDA 1GCQA 3D7SB 4A63B 2LZ6B 2KT1A 3CC4Q 1D0YA 2RHXA 4OB3B 2IVWA 2DETA 3CCQQ 2K57A 2NUTB 1WPYA 2AKLA 3M54A 3CC2Q 2YSQA 2DO3A 4F7UA 5KYUB 3DLLA 1BU1A 2KGTA 1OYXA 1Q82U 3CMAQ 1WI7A 2D9TA 2E5KA 3QJ6A 1K0XA 3E19A 4FW1A 1CKBA 1MV3A 1Q7YR 1O75A 4PJOA 2LJ3A 2NUPB 2CUBA 2YWWA 1N5ZA 4O5VA 4MDXA 2OTJQ 5CKDA 5FU6B 3LWIA 1UUEA 2DVJA 2DEQA 1VQ8A 5J26A 2MCNA 2V8KA 1JO8A 3GIBA 2DXBA 3QWXX 3L2WA 2ZPFB 2DEUA 4E6RA 4F7UE 3S3OA 4F16A 4HXJA 5GAMg 1R8OB 3E2UA 3OYFA 3VS3A 5J39A 3FLGA 4KRTA 3CC7Q 3R6OA 5C0MA 1BCOA 3WXMB 4C92G 1N27A 4XTXA 3VS5A 2O4XB 2LCLA 3HP9A 2DIQA 3LYIA 4LE9A 4M77E 1OPKA 5GAOl 5GAN3 1I0CA 3CCQT 1M90U 5IHIA 1H92A 4WTOB 1ACMB 3EG2A 1OZ2A 2P4RA 4RMOA 2MPXC 3CMAT 2A08A 3BFMA 1YCYA 1Q81R 3UT1A 2RJEA 2DJZA 2F2VA 4BY6B 3C12A 3HRSA 4LNPA 1NJIC 2EPDA 1VQ4A 3J80E 5IXBA 2JT4A 2MI6A 4M7AF 4DOWA 2J6OA 2VWFA 2JN0A 2XHCA 2O31A 3CMEQ 2QA4Q 4M7AG 2CKKA 1B3QA 4HKEA 2DK3A 1YITA 6AT1B 1IXDA 4KT0E 3SWNA 3TU4K 1M1KR 1RAHB 3EH2A 3V8KA 1JU5C 4Z88A 4Y28E 1M8VA 2J05A 3M0UA 2HSPA 5LJ3d 1PWTA 2A0FB 3JB9I 3MEUA 2QYZA 2LP5A 1LNXA 2VASA 3RKYA 1M2OA 2LX7A 2MAMA 2CSQA 5DY9A 2P4TA 3OS0A 2KYBA 2D6FA 4HVWA 5IT9E 2QI2A 2CGHA 2X3WD 1BI1A 3UWNA 4ATOA 3HFNA 2E41A 4B6MA 2DJQA 1X2KA 1ZA1B 3OYNA 2P0QA 3PT9A 2AT1B 2ROLA 4E7LA 2HSEB 3MPUB 3I5SA 3P8HA 5GJVB 3OYBA 1U06A 2RA2A 2Z0WA 2DX1A 5FU6C 1PD1A 2HBWA 2DFUA 3L2UA 2FYKA 2PUOB 2GF7A 2EYWA 4F7UB 3VU3C 1OU9A 2H3JA 5KE3A 1G83A 1E6HA 5FU7B 1NEGA 1X6OA 1ZX6A 4QQDA 1JEGA 1JB0E 4AG2C 2X4JA 1VQ5A 1WGSA 4C8QA 2DPPB 4RTVA 2P0PA 4NL3A 4BI3A 3OW2A 4JJCA 2COWA 5LJ3f 2YUNA 4DBHA 4M77B 4HCBA 2JMCA 4LXCA 2HKNA 2EGEA 2QAZA 2X3XD 3CPFA 5HK0A 2W0ZA 5GAN4 3JAME 2DTHA 2ED1A 5FLXE 3CPWS 1VQ7T 1YCSB 4EMKA 5GAN6 1AVZC 1Q86U 3JCMh 3OYAA 4Z89A 3CXCS 2FZKB 3P8BB 3EG9A 5EG2A 3A8GB 4C8QE 1KHIA 3VS6A 3G6EQ 2JTEA 3PMTA 3EH1A 1AHJB 4BY6C 2QASA 1EIFA 4BE1A 1VQMT 1M2VB 2V8JA 1VYTA 1YWOA 2FB7A 3RESA 3EGXB 4N0AC 1UG1A 1OQKA 2FO0A 2VKNA 1TUDA 2AHJB 2CH4W 4HT8A 3H0FA 4C92D 1JBMA 4M78E 4LDYA 1KK7A 2MMPA 1VQPQ 2DE0X 2RHZA 2MWPA 4QQ6A 1YJ9Q 2E65A 1QVGS 1UGRB 4DQ2A 2K2MA 3H8ZA 2XICA 1NEBA 2DBMA 1NBEB 1PRLC 2CUDA 2KAFA 2CDTA 2CP6A 2WSEE 3CCUA 2AZSA 5KYYB 3CCSQ 2R5AA 2YUQA 1TUCA 3FJPA 3V7CA 1N9SA 3LW5E 5GAMe 3FEOA 1S72A 2DNUA 2CYZB 3QYHB 3M59A 1UB4A 3KUFA 1VQOT 7AT1B 1WZOA 4F04B 2ROTA 3NTHA 5GMKj 2OTLA 1W2BS 1TSFA 3GNGA 5GANj 4R56A 3EGUA 4XU2A 2VB6A 3L2RA 2LQWA 1FMKA 2LQ8A 3G7ZA 3HKSA 4XK8E 2RPNA 3LH5A 3OYKA 3JCMJ 3EFRA 3V8JA 2BZXA 2QEXQ 2YT6A 1AD5A 2LRQA 2DKGA 5CCAA 1UJ0A 4M7AD 5FWCA 2QGGA 1BK2A 1SF9A 3IQLA 2GBQA 2DZCA 3JCMb 4LDWA 2JXBA 5GAN5 1VQPT 1LPLA 3VS7A 1G3WA 1KC8C 1QVPA 4IURA 2VGMA 2YDLA 1RAAB 3SD4A 4LDVA 3CEYA 2YXYA 3JB9H 3HRTA 1TU0B 3RERA 1N8RR 1VYUA 3WVDB 1QVFP 1FX7A 1SHGA 3QJYA 5CQYA 2B86A 2JM8A 3GBQA 2DA9A 4JS5A 1WNLA 4J9DA 2CP3A 2KEAA 3MKDA 2AZVA 2D0QB 1XNIA 3HPWA 1P92A 4ORZA 1QLYA 2NUTA 5EC7A 1KIKA 2XDDA 2DRMA 1Q82C 2LVMA 5GMKm 5LJ3e 5KYUA 4M75G 2DVEA 1UE9A 4E7KA 1VIEA 4C8QB 2ATCB 1BBZA 2LNVA 1W6XA 2PNIA 1VQ6A 1M8MA 1WLPB 4J9IA 3EGDB 5IN1A 4FT4A 5GANg 2JS2A 2BZYA 1NYFA 1AZGB 3CCEA 2I2LA 2C0OA 1YIJQ 2O2OA 4KBMB 4DOVA 3CCVQ 4Z02A 1G5VA 2X4XA 2PU9B 3C0CA 4LD6A 3OYYA 2MIOA 1ABOA 1KD1C 2ZPGB 2EKHA 1H8KA 1VQ9A 3PGGA 3V7RA 1N6AA 2K5IA 4Y91A 5CK9A 1NJIR 2WSCE 2BKDN 3KXTA 2O4XA 2VUBA 1X75C 2EQUA 3UPUA 1UHFA 2IG0A 2K3BA 1ZUYA 4CC4B 4II1A 3X20B 3H0HA 4F7UF 3G4SA 2ECZA 3PTAA 1YI2A 4OB2B 3CPWP 4ANJA 1XOVA 1YP5A 2ZZDA 1M5Q1 4F7UG 3JCMg 1OU8A 1H641 3CXCP 2FG0A 1UFFA 2EIFA 1C1AA 2F2XA 1WHMA 3SFMA 4PJOG 2E6ZA 3HHTB 2F5TX 5KYXB 4LDXA 1WQWA 4N0AA 2E70A 4M77F 5FROA 4A4HA 1JXOA 5I2SA 3VS0A 4FCYA 2LJ0A 1YIJT 2HQEA 4M77G 1RUWA 3CCVT 1KG1A 2EJFA 1TS9A 4HCZA 1WHJA 1YWPA 5D6YA 1LVKA 1K9MU 1QCFA 4OP0A 1OI1A 3OS2A 1PM3A 2L5QA 4BB7A 3HSBA 1GRIA 2YRVA 3L2VA 5LJ5j 1AWOA 3M58A 1E6GA 2F2WA 2HL5C 1WHGA 1YITT 4C5GA 3EAEA 3VUBA 3GLXA 1I5LA 1U8RA 2ZPBB 1GXIE 2RF0A 1CSKA 3M55A 4FU6A 3HFOA 2QTVA 3NTIA 1VQ5Q 4QW2A 1KC8U 3OS1A 1QCOA 1W2BP 3CCRA 4GY5A 1X01A 2AK5A 2CSIA 4XU1A 1JJ2S 1OZ3A 3SDZA 1SSHA 3CBMA 1LOJA 1U5SA 1RI0A 1NYGA 2RI3A 5M9OA 1VIFA 2FRWA 3CCJA 4WF2A 4RTUA 2BIVA 4EMHA 4J8OA 1Y96B 1SKUB 1WA7A 4KH0B 1NM7A 4BDYA 3M4GA 4PJMA 3CCMA 1OEBA 3PFSA 4C0DB 4L5GA 2LNHB 1I81A 4PJLA 4YTLA 4OMNA 3MO8A 2E6NA 3NGPA 1OV3A 3QSUA 3QDFA 1OX9A 4M78C 3INZA 3OY9A 1G3YA 1WFWA 5CR2A 1KHCA 3F70A 1NE8A 1D1CA 3PIPA 2DXTA 1KQSS 3LLRA 4KUIA 3PVQA 1UGPB 3LWHA 1QKXA 1R0CB 2ZAEA 2LCSA 1UGVA 2R5MA 1RADB 1FXXA 4J83A 2QDLA 4M77A 5GAMd 1VQ5T 5LJ5g 4B9WA 4M75D 2CZ0B 1Q86C 2JUFA 1N9RA 1AZEA 1ZLMA 3QUIA 2OJ2A 2M1HA 2QQAA 1YNZA 1RLPC 3CCUQ 4FYYB 2W10A 2LQNA 1K73C 1KD1U 2V26A 2J6KA 3I56A 3OYIA 4E7IA 3J7AF 3VYGA 4MZTA 1YJWA 3PNWC 1YJNQ 2FEIA 1AWJA 1M2VA 2OTLQ 1UGQB 1MNEA 4OMLA 3L1AA 3RMSA 1U3OA 2EAYA 3EGXA 2PUKB 2LDMA 4LN2A 1QWFA 2X51A 5HY6A 1T3SA 2YRDA 5GAN2 3GOXA 1FMWA 4E7SA 2J7IA 3FDRA 2SRCA 2EJ9A 4C8QF 4X1VA 4M7DD 5IAYA 2HZYA 3M0QA 2MK5A 2BE9B 4C8QG 4CC3A 5GMKe 4BACA 5GANe 4MDWA 1TOVA 3JCMc 2K79A 2DL4A 3Q1JA 5KYYA 3URGA 2EJGA 3VRYA 2YHTA 3CCLA 2EQJA 2Y90A 4AFSC 1O9SA 1IRXA 1UTIA 4MZPA 3CCUT 4PJOD 1QVFA 1SHFA 1X6GA 1KC8R 4F14A 3MP6A 5GAMf 4JJDA 3A1PA 5HCKA 9ATCB 1K0SA 5FRNA 1YJNT 2XDBA 5J3BA 1WDXA 2X4YA 2OTLT 2EYQA 4JRIA 4QT7A 2VYTA 2DXCA 3KBGA 4FSXA 1MNDA 4PFZA 2QQ9A 2P84A 2DILA 3VKIA 1VQ7Q 4RKUE 2GQIA 1BCMA 3S3MA 1IREB 4C0DC 3JCMQ 1Z9ZA 1VQNA 3MEAA 5D6WA 1Q82R 2L3PA 5IHNA 3DLMA 1SG5A 2EWNA 1G8XA 2EGCA 2RQTA 4AFUC 5CO7A 4LDUA 3O8VA 4O6JA 3ZBDA 3OYJA 1RAEB 2QK0A 3TEEA 2DL5A 2K7AA 1VQMQ 3SHWA 1S1NA 2L89A 2RH2A 1ZSZB 1HSQA 4XQ3A 1VQLA 3M0TA 3H0IA 4JZ4A 3RIRA 2FVUA 5HKCA 3G71A 2KRMA 4RG8A 2EKOA 2K9GA 3E9FA 2QQRA 2KBTA 2RI5A 1I4K1 3QZ5B 3S6WA 1IZ6A 2R58A 1DJ7B 2QDYB 3HTRA 1NPPA 3EFSA 1JJ2P 1GL5A 3BE3A 4LUEA 3TVTA 4C92E 1IB8A 3BDUA 4NOYA 3EGDA 2HEQA 1M90R 4FSSA 2L3SA 1M1GA 2K5LA 1VQOQ 2ABLA 5KYNA 2DD4A 1K73U 1QKWA 2ZGWA 4M78A 5GJWB 1BI0A 4AMCA 3CCET 1WQ7A 5DLOA 4QKUA 2OX7A 2PVOB 3OA6A 3JCMX 2KY9A 1VQKA 3EHRA 3QHSA 2XMFA 3ZFJA 2KSSA 3OW2S 1D1BA 5D6XA 5I11A 4X9CA 1NLPC 4PFPA 2KMTA 3CC4A 2M9UA 1Q7YC 3UA7A 4FYWB 4IIOA 5AT1B 3CCQA 3QYGB 2H3EB 5DM7R 2Y4XA 3CC2A 1AWXA 2LT4A 2DF6A 4J6WA 2NLUA 3CMAA 1MGQA 2DTIA 4RTXA 3ER0A 1GCPA 1VOMA 3RKXA 1WXTA 4K11A 3G4ST 2KXCA 3JB9F 2OTJA 3M0SA 4JLIA 3FRNA 2JMAA 3SEMA 3X26B 4R0KA 3JB9G 2RHYA 4L6V5 5KYXA 2RD1A 5LJ5e 1W2BA 3L2ZA 2KRSA 2DRKA 1C0MA 4XTWA 4M75C 2JJ9A 5A2QE 1K9MC 2NUZA 3RR6A 1LCKA 2RNAA 4N4IA 3CC7A 3JSCA 4C8QD 2JZ2A 2CS7A 2K6DA 5A0DA 2QG9B 1UEBA 2YUOA 3JB9J 2DD5A 2EW3A 2GCXA 2CP7A 1T3LA 2HBPA 2LCCA 4FW2A 4PLIA 5AYFA 5CKFA 2OAWA 2QQSA 2DL3A 3MHXA 3NTKA 1M27C 1ZSZC 3QPHA 2A7YA 4HT9A 2BTTA 1M3AA 1VQ8Q 5IXFA 5I22A 2O9SA 3REBB 4M7DC 1GFDA 1GCQC 3VS1A 4BE0A 1YHQA 4LUDA 2JM9A 3CD6A 5FWBA 1M1KC 2JOYA 2K5FA 3AHUA 3VV0A 3CCRT 4MMLA 1W4SA 2RQWA 3OBYA 1JRIA 4C92B 3M9QA 3WVEB 4PJNA 3CMEA 2QA4A 1XJWB 1W1FA 4DEYA 1QQJA 1HD3A 1Y96A 4JRKA 3T9NA 4PJOC 1ZSGA 2KQWA 1Q86R 4C0ZA 4OGEA 1Y07A 2X4WA 3SB2A 4XAXB 2WSFE 2XKOC 2C06A 2RJDA 1K73R 2FPEA 4Z8AA 3H9NA 4HVUA 1NPRA 5GAMh 2KT8A 2J6FA 2F1LA 5CKBA 3GP8A 3CBPA 5GANd 1SSFA 4OMMA 1IGQA 1UECA 2RQVA 2KK4A 2V1RA 4XTYA 2Y4YA 3EG1A 2HDAA 1K9AA 2CT3A 2COZA 3UF4A 1VQ8T 1VQ4Q 3FB9A 4J9EA 4XTZA 3H6ZA 3OYGA 1ARKA 4IUTA 2KXDA 4M78B 4LD9K 2GTOA 1TWBA 2HKQB 2DLPA 4A4FA 2XK0A 4ZGJB 3A98A 1G3TA 4OF1A 2IPOB 3M0RA 2LTOA 1RLQC 1BI2A 1R0BG 3X24B 1YITQ 2CH4A 3TQ7P 1PSFA 2R57A 5HK3A 4F17A 3NPFA 1RACB 2FPFA 1Q7YU 1YFNA 3L42A 4XTVA 4XTUA 5GAOq 3M57A 3JCMd 2K2VA 1WJQA 2RO0A 2ED0A 3EFOB 4CC2A 3KFVA 3M56A 2D8HA 4JRQA 3OYLA 1BIBA 2XU8A 3A5ZB 3MP1A 4A54A 1PG5B 2EBPA 3OW2P 1M30A 1K1ZA 2VC8A 3SWNC 1VQ4T 3LX7A 5LJ3h 1XTDA 4FIBA 5GANf 1F1BB 4ZNXA 2FPDA 1X6BA 4RCBA 2HD0A 2HQHA 4RTTA 4GLKA 1MMGA 3V8LA 3G6EA 1VA7A 2JW4A 3OBWA 1QVGP 2FZCB 2JS0A 4FYVB 1U1SA 5CQXA 2B8AA 1D3BB 2EQMA 3QZ9B 4E2FB 2D8JA 1VYVA 2M0YA 4JUVA 1Q81U 4V2SA 1WHLA 2F69A 4J9FA 1D0XA 2SEMA 1RI9A 4C92C 1M4ZA 1PCXA 1VQPA 2RQUA 5ECAA 1YJ9A 4MMKA 1GFCA 3TCJA 3X25B 2OI3A 2ZCFB 3QKJA 4DBQA 2ZPIB 3RKWA 3JCMf 3MEVA 4DEXA 4JPBW 5GAN8 3CCSA 1KFZA 4M75E 4QVDA 1M1KU 3NFCA 1FYNA 1VQNT 3DB4A 1H3ZA 1X69A 4ZTJA 2KE9A 2KRNA 3PMIA 4JJBA 4FYXB 2ZPEB 1IO6A 1ZSZA 2PZ1A 3ASKA 5GAOr 5CKHA 4BI8B 3DB3A 3BW1A 3M5AA 2ENMA 4MZMA 4PLLA 4RTYA 2K3YA 1VQLT 4PNOA 4PFOA 2QEXA 2VXFA 2ESWA 4M7AC 4P5NA 3TSZA 3G71T 2RHIA 2RB6A 4JRPA 4EMGA 2A3LA 1RABB 4OB0B 4EMKC 5KE2A 2QTXA 4OMOA 4IUUA 4C5EA 5LJ5d 2COYA 1MUZA 3QBYA 1N8RC 4CI0C 1OOTA 3P8DA 4QVCA 4M7DE 4IUVA 4X34A 2CZ1B 2JTMA 3ZL7C 2KVQG 3PE0A 1B34B 5L23A 4XU3A 1KQ1A 1WHKA 4AFZC 2DMOA 3GPLA 3QXEB 1QCNA 3C94A 1S72Q 5LJ3j 3RDVA 3REAB 1K8AC 4D6WA 1PD0A 3EG0A 4PK4A 2HNIA 4C92F 4BUGA 4M4ZA 4PJOE 4J9BA 3MP8A 1AOJA 1WHHA 2DAQA 5A0GA 2DM1A 1NZ9A 2RJCA 5GAN7 1I5OB 1VQKT 4ZN3A 3M4YA 1IHVA 1RAFB 4WCIA 1IHWA 2F5KA 3A8HB 4OVAA 4A4EA 5CAIA 1K9MR 4Y92A 4J6YA 2LX9A 8AT1B 3CC4T 1PSEA 5IHKA 8ATCB 4OMPA 3ME9A 1MMDA 2G3RA 2DL8A 2FZGB 2MYSA 2H8HA 2CREA 4EIKA 1TXQA 1YBYA 3UATA 3CC2T 1GBRA 1RAGB 4GLMA 4OB1B 3JCMP 2MF2A 1TG0A 4C5HA 1HK9A 2I0NA 3LGLA 2DERA 3RUXA 3HRUA 2L2PA 1YIJA 2OTJT 3CCVA 1W70A 3OS5A 4M78F 2C0TA 3GNFB 3A8OB 1YHQQ 3OYEA 1V76A 5LJ5f 1KSWA 5I21A 1RL2A 2EQKA 2LT1A 2E12A 4IUQA 4M78G 1S72T 3CD6Q 3H41A 1Y57A 2M0OA 5GMKl 2YRCA 4AT1B 1Q95G 4M77D 3EHQA 5KYWB 5FRMA 3M0PA 2K3XA 4FL6A 3CC7T 1UGSB 3V7SA 3I55A 4M75B 2EYZA 4C0FA 2FL7A 1QWEA 1EZZB 2CZ7B 3PVLA 4IIMA 3MJXA 3JCMe 2L3RA 5LJ3g 2DYBA 3LGFA 1QVFS 2LJ1A 4J5YA 1ZBXA 2XI9A 3OB9A 1VQ6Q 1T0JA 2RJFA 3I5RA 1Y0MA 2RI2A 3UDCA 3CCEQ 4ZGEB 4EDUA 1AWWA 4PJJA 2VV5A 3A8LB 1WX6A 3RNJA 3U23A 1X43A 4E7HA 3TSWA 2PVDB 4N4GA 1VQ9Q 2EGAA 4C92A 1YHQT 4A53A 2VGNA 4JS4A 3NMZC 4EPCA 3CD6T 3QO3A 3MCAB 3C95A 1M9SA 1Y7XA 2GFAA 4M7DB 1PHTA 5GMKh 4BDZA 4KUDK 2DL7A 1MMAA 2LMJA 3CMET 2QA4T 1D09B 5GANh 4E7JA 1KD1R 2KI7A 4L59A 1TH7A 4OMQA 4HCCA 1B7TA 1QW1A 3CPWA 1D0ZA 1MMNA 2X9HA 3G4SQ 3THKA 1YI2Q 1EFNA 1OX8A 3CXCA 1XQHA 1G3SA 5CKEA 4PJOB 1LJOA 1RAIB 2AKKA 1ZUKA 3I9QA 1N8RU 4B9XA 1VQ6T 1PNJA 1Z9QA 4PL6A 5A0LA 4N4HA 2A36A 4RCCA 2GGRA 4QQGA 1D1AA 2FHDA 2JVVA 2KNBB 3M53A 2P0KA 3VJPA 3I35A 2G6FX 2E4HA 3BDLA 4CC7A 2MWOA 3BY7A 1JXMA 4M7AA 3JCMW 1K8AU 4J7FA 1KQSP 2E10A 3S3NA 1X2QA 4J6XA 1VQ9T 3QIIA 5CVIA 2D0NA 2DZ9A 4NL2A 3VUZA 3OYHA 2M16A 2E3HA 1QVGA 2K4YA 1UDLA 4A4GA 1K4US 1FWZA 1KQ2A 3FC3A 3G1JA 4JZ3A 2M51A 4M7AE 3TREA 1YN8A 2HAXA 3A8MB 2QQBA 2RN8A 3FJ5A 3EFOA 5GAOn 4ZN1A 2DYIA 2RK1A 1YI2T 2XIDA 3OYCA 4C5IA 1HXDA 1TTHB 2E3IA 2FRYA
chains in the Genus database with same CATH topology
3RKYA 5GAOp 4L5GA 1G3TA 4OF1A 2MAMA 1I81A 2LTOA 4NS5A 1NJIU 1BI2A 4YTLA 3X24B 5DY9A 3MO8A 2P4TA 3OS0A 2E6NA 2GQVA 3QSUA 1PSFA 2R57A 2D6FA 5HK3A 5IT9E 4M78C 3INZA 3OY9A 1G3YA 5CR2A 1KHCA 3F70A 3OMGA 1NE8A 2QI2A 2CGHA 1BI1A 3PIPA 3UWNA 2DXTA 1Q7YU 1KQSS 3LLRA 3OQ5A 4KUIA 1QP3A 3L42A 4ATOA 3HFNA 3LWHA 1UGPB 2E41A 3HL8A 4XTVA 4XTUA 5GAOq 3CCLA 3FIFA 4HA8A 3M57A 3JCMd 2K2VA 2R5MA 1WJQA 3OYNA 2RO0A 2P0QA 1YJNA 1FXXA 3SWNB 2ZPHB 3PT9A 4J83A 4M77A 1Q81C 3M56A 5GAMd 3G6ET 1VQ5T 1D3BA 5LJ5g 4JRQA 4E7LA 4B9WA 1YJ9A 3PIOA 4M75D 3P8HA 2CZ0B 3OYLA 1BIBA 2XU8A 2RA2A 2JUFA 1N9RA 3N5BB 5KCHA 3OYBA 1Q86C 2RK2A 3QUIA 5FU6C 2QQAA 2M1HA 4M78D 2OAUA 3A5ZB 3MP1A 4A54A 4C0GA 1K73C 3L2UA 1KD1U 2FYKA 2PUOB 2GF7A 2VC8A 3CBOA 2PVGB 3SWNC 4F7UB 5GAOm 3OYIA 3I56A 3VU3C 4E7IA 1VQ4T 3J7AF 3VYGA 2H3JA 4MZTA 3LX7A 1YJWA 5KE3A 3PNWC 5LJ3h 5KCOA 5FU7B 1XTDA 4FIBA 5GANf 1ZQ1A 2CZ6B 4JDSA 1UGQB 1X6OA 4QQDA 3J81E 3JRZA 4RCBA 2E1HA 3L1AA 2EAYA 1JB0E 2HD0A 3RMSA 4DA4A 1WJSA 4GLKA 2PUKB 2X4JA 3V8LA 3G6EA 2LDMA 1VQ5A 3X28B 1YJ9T 1WGSA 3OBWA 2DPPB 4C8QA 2L8DA 5HY6A 2P0PA 4VUBA 4NL3A 2WACA 4BI3A 3OW2A 5GAN2 1U1SA 5KH6A 4QVZA 5LJ3f 3GOXA 4X9DA 4M77B 5CQXA 2B8AA 1D3BB 2EQMA 3QZ9B 5FU7C 4HCBA 5L8RE 1M1FA 3CCST 3FDRA 3CPFA 4JUVA 1Q81U 5HK0A 2EJ9A 4C8QF 5GAN4 2DTHA 5FLXE 3JAME 3CPWS 3CCJT 1VQ7T 4M7DD 2DTOA 5IAYA 4EMKA 2F69A 5GAN6 1Q86U 3RMQA 3JCMh 4C8QG 5GMKe 3OYAA 3C4SA 3CXCS 4C92C 4BACA 1M4ZA 2DIGA 3P8BB 5GANe 4MDWA 5EG2A 3CCMT 3A8GB 4C8QE 3JCMc 3OYMA 1BKBA 1KHIA 5LJ5h 1VQPA 3PMTA 4M77C 3Q1JA 3URGA 2EJGA 1AHJB 2YHTA 3E9GA 2EQJA 4MMKA 1EIFA 2Y90A 4TVRA 4BY6C 4XU0A 4BE1A 3TCJA 4M75F 1VQMT 1O9SA 2V8JA 3X25B 2ZCFB 3QKJA 4MZPA 3OSVA 3CCUT 2FB7A 2ZPIB 3QDRB 3RKWA 3JCMf 3MEVA 3RESA 2QEXT 1QVFA 4PJOD 4N0AC 4E47A 2PQWA 1MHNA 2YLBA 4RG2A 5GAN8 3MP6A 3CCSA 5GAMf 2AHJB 4BE2A 1ZHIA 4M75E 1VQ7A 2HQXA 4QVDA 1VUBA 1M1KU 3NFCA 4HT8A 1VQNT 4C92D 1JBMA 5FRNA 4M78E 1YJNT 3DB4A 4LDYA 2QXFA 1H3ZA 2MMPA 4ZTJA 4A4KA 3PMIA 3VYHB 5J3BA 2XDBA 2X4YA 4M7AB 1B34A 2ZPEB 2VXEA 2OTLT 2EYQA 4JRIA 3ASKA 2RHZA 5GAOr 2MWPA 4QQ6A 1QVGS 2E65A 5CKHA 4BI8B 2VYTA 1UGRB 1WJRA 2DXCA 2RM4A 2X35A 3BW1A 3DB3A 3H8ZA 2XICA 3KBGA 3M5AA 4BD3A 4CRIA 4DQ2A 4MZMA 4FSXA 2V8IA 1V29B 1VQMA 2QQ9A 3E1SA 4PLLA 2KAFA 4JJNK 2WSEE 3CCUA 2K3YA 4R55A 1VQLT 4PNOA 2QEXA 2R5AA 2VXFA 3VKIA 3I56T 4RKUE 3FJPA 4ELYC 3DKMA 3V7CA 4M7AC 1U1TA 4P5NA 1N9SA 3LW5E 2RHIA 5GAMe 2RB6A 3FEOA 3G71T 3META 4JRPA 1IREB 4C0DC 4EMGA 3S3MA 2A3LA 3JCMQ 1YJWT 5GMKi 4OB0B 3LH0A 4EMKC 2LC4A 2CYZB 3MEAA 3QYHB 5D6WA 2KDSA 1UB4A 3KUFA 3M59A 5KE2A 3DLMA 1VQOT 2QTXA 4IUUA 4ELZC 2EWNA 2XG8D 3L2QA 4C5EA 4M7DF 5CO7A 5LJ5d 4LDUA 3NTHA 5GMKj 2OTLA 4M7DG 1W2BS 3O8VA 2GFUA 4O6JA 3ZBDA 3OYJA 3QBYA 3GNGA 5GANj 3TEEA 1N8RC 4CI0C 4R56A 1M90C 3P8DA 2YLCA 4XU2A 4QVCA 4M7DE 4IUVA 3ZEHA 4X34A 3L2RA 2CZ1B 2LQ8A 4OGCA 3CCJA 2JTMA 3G7ZA 2L89A 2RH2A 3HKSA 4XK8E 2KVQG 3OYKA 3JCMJ 3EFRA 1B34B 3V8JA 4XQ3A 2LRQA 4XU3A 1KQ1A 2DKGA 4IUPA 5CCAA 1VQLA 3GPLA 4M7AD 3QXEB 3C94A 4PJOF 4ZTFA 5LJ3j 2XD0A 3RIRA 2FVUA 1K8AC 5HKCA 4D6WA 3G71A 4RG8A 2EKOA 3E9FA 2DZCA 4ME7A 1QP2A 4LDWA 3JCMb 2HNIA 5GAN5 5DLQE 2RHUA 1VQOA 2QQRA 2RI5A 4C92F 1I4K1 2DXUA 4BUGA 1BI3A 1VQPT 4PJOE 3MP8A 2EFIA 3QZ5B 2LQKA 4JLGA 3S6WA 1IZ6A 2R58A 1DJ7B 1G3WA 2QDYB 1NPPA 2DAQA 3EFSA 4UC4A 1KC8C 3OMCA 5A0GA 1NZ9A 1QVPA 3QG1A 3CCLT 2RJCA 4FM4B 2E64A 5GAN7 3MEWA 3JB9D 1VQKT 4ZN3A 3M4YA 4IURA 2VGMA 4C92E 1S72A 2F5KA 3A8HB 2E5QA 4OVAA 4A4EA 5CAIA 3BDUA 4J6YA 4NOYA 3SD4A 2LX9A 4LDVA 3CEYA 3JB9H 2JTFA 3HRTA 3RERA 3CC4T 1PSEA 3WVDB 2JNGA 3ME9A 1FX7A 2G3RA 1M1GA 2K5LA 3QJYA 5CQYA 4M75A 1YBYA 5GAMj 3CC2T 1Y71A 4Q5WA 5I2MA 4JS5A 1WNLA 1JJ2A 2DD4A 4OB1B 1K73U 2ZGWA 4M78A 3JCMP 2MF2A 1BI0A 3CCET 3JCMV 4C5HA 1WQ7A 1HK9A 2D0QB 5DLOA 1XNIA 3LGLA 3I55T 3HPWA 2PVOB 3RUXA 3HRUA 1BIAA 3JCMX 2KY9A 3OA6A 1VQNA 1P92A 1VQKA 1YIJA 2OTJT 3QHSA 3ZFJA 2XDDA 2KSSA 3CCVA 1Q82C 3OW2S 2LVMA 3OS5A 5D6XA 5GMKm 4M78F 5LJ3e 3GNFB 4M75G 3A8OB 3OYEA 4J7IA 5LL6S 2DVEA 4X9CA 4E7KA 2O01E 1VIEA 4OMFB 5LJ5f 4C8QB 2KMTA 1RL2A 5I21A 3CC4A 2EQKA 2LT1A 2E12A 2M9UA 3GF5A 4IUQA 4M78G 1S72T 1Q7YC 4FT2A 2LNVA 4BI4A 3CCQA 3QYGB 4ZGDB 2M0OA 1VQ6A 5GMKl 5DM7R 4IKFA 5C6SA 2Y4XA 5IN1A 4PKCC 3CC2A 2LT4A 2BUDA 5CIUA 4M77D 5FRMA 4FT4A 4J6WA 5GANg 2K3XA 2NLUA 3OSSC 4FL6A 3CMAA 2XDPA 1MGQA 2DTIA 3CC7T 3CCEA 1UGSB 2I2LA 4KULA 3ER0A 3RKXA 3V7SA 1KQSA 3I55A 4KBMB 4C8QC 4M75B 4DOVA 3G4ST 4C0FA 1I8FA 2FL7A 3JB9F 2CZ7B 2OTJA 4Z02A 1BYMA 1G5VA 2X4XA 4M7DA 2PU9B 4JLIA 3FRNA 3OYDA 3JCMe 4LD6A 3OYYA 2L3RA 3X26B 1KD1C 2ZPGB 5LJ3g 3JB9G 1VQ9A 3LGFA 3PGGA 1QVFS 2RHYA 4L6V5 2RHXA 3V7RA 4OB3B 1N6AA 2IVWA 1W2BA 2RD1A 4J5YA 1ZBXA 2K5IA 2XI9A 3L2ZA 3OB9A 4Y91A 5LJ5e 2K57A 5CK9A 1WPYA 2WSCE 2BKDN 3M54A 3KXTA 2O4XA 2RJFA 4XTWA 2DO3A 2VUBA 4F7UA 3DLLA 4M75C 1X75C 2EQUA 5A2QE 1OYXA 2RI2A 1Q82U 1K9MC 3UDCA 2D9TA 3UPUA 3QJ6A 4ZGEB 3E19A 4ZGJB 4EDUA 4N4IA 3CC7A 2IG0A 1O75A 3JSCA 4C8QD 2VV5A 3A8LB 4PJOA 4O5VA 4II1A 3X20B 4MDXA 2JZ2A 4E7HA 5CKDA 5FU6B 2CS7A 3LWIA 4F7UF 3G4SA 2DEQA 3PTAA 1YI2A 4OB2B 5A0DA 1VQ8A 1UEBA 2PVDB 1XOVA 5J26A 2DD5A 2ZZDA 2GCXA 1M5Q1 2V8KA 4N4GA 3JB9J 4C92A 4F7UG 1YHQT 3GIBA 4A53A 2DXBA 3JCMg 2VGNA 1H641 3L2WA 2ZPFB 4JS4A 4F7UE 2HBPA 2LCCA 4EPCA 3S3OA 3CD6T 3QO3A 2EIFA 3SFMA 3MCAB 3C95A 5GAMg 1R8OB 4PJOG 1M9SA 1Y7XA 2GFAA 4PLIA 3OYFA 4M7DB 5GMKh 4BDZA 5AYFA 4KUDK 5J39A 2E6ZA 5CKFA 3CMET 2QA4T 5GANh 3FLGA 4E7JA 2QQSA 3HHTB 2F5TX 3MHXA 4L59A 1TH7A 3NTKA 3R6OA 5C0MA 4LDXA 1WQWA 3QPHA 4N0AA 2A7YA 2E70A 4M77F 5FROA 4A4HA 3WXMB 4C92G 4HCCA 4HT9A 1N27A 1QW1A 3CPWA 5I2SA 4XTXA 1YIJT 2O4XB 2LCLA 3HP9A 2HQEA 4M77G 1KG1A 3CCVT 2DIQA 3LYIA 2EJFA 4HCZA 3AHUA 3CXCA 4M7DC 1XQHA 4M77E 5D6YA 1G3SA 1K9MU 4BE0A 5CKEA 4PJOB 1YHQA 4OP0A 1LJOA 1OI1A 3OS2A 5GAOl 5GAN3 2L5QA 4BB7A 3CCQT 1N8RU 1M90U 3HSBA 3CD6A 4B9XA 1VQ6T 2YRVA 1M1KC 2JOYA 2K5FA 4PL6A 3VV0A 4N4HA 5A0LA 4MMLA 3L2VA 1W4SA 5LJ5j 3OBYA 3CCRT 4RCCA 1JRIA 4QQGA 3M58A 4C92B 3M9QA 3WVEB 1OZ2A 2FHDA 2JVVA 4RMOA 3CMEA 2QA4A 3M53A 1YITT 2P0KA 3VJPA 3CMAT 3BDLA 1Y96A 3BFMA 1YCYA 4JRKA 4C5GA 3T9NA 3UT1A 2RJEA 2MWOA 3EAEA 2DJZA 4PJOC 3BY7A 4BY6B 4M7AA 3JCMW 3VUBA 3GLXA 3C12A 1K8AU 2KQWA 1U8RA 3HRSA 2ZPBB 1NJIC 1I5LA 4J7FA 4C0ZA 4OGEA 1Y07A 2E10A 2X4WA 3SB2A 3S3NA 1GXIE 1VQ4A 3M55A 4FU6A 4J6XA 3J80E 4XAXB 2WSFE 2XKOC 2C06A 1VQ9T 2RJDA 3HFOA 3QIIA 5CVIA 2DZ9A 2MI6A 3NTIA 4NL2A 3VUZA 3OYHA 1NPRA 2M16A 4DOWA 4M7AF 4QW2A 1QVGA 5GAMh 1KC8U 2K4YA 2JN0A 2XHCA 3OS1A 4A4GA 5CKBA 3GP8A 1FWZA 4GY5A 3CCRA 4M7AG 3CBPA 1KQ2A 1X01A 5GANd 3FC3A 1SSFA 2CKKA 4HKEA 4XU1A 4M7AE 1JJ2S 2DK3A 1YITA 3TREA 2HAXA 3A8MB 1OZ3A 2QQBA 3SDZA 2KK4A 4XTYA 3CBMA 4KT0E 2Y4YA 1LOJA 3SWNA 3TU4K 5GAOn 4ZN1A 1RI0A 2RI3A 3V8KA 5M9OA 2RK1A 1YI2T 1VQ8T 1VIFA 2XIDA 3OYCA 4V2SA 3FB9A 4XTZA 4WF2A 3H6ZA 4C5IA 2BIVA 3OYGA 1HXDA 4IUTA 4M78B 4Y28E 4EMHA 4LD9K 1M8VA 5LJ3d 4J8OA 1Y96B 3JB9I 3MEUA 4BDYA 3M4GA 3CCMA 4EMKB 4A4FA 3PFSA 2XK0A 1LNXA 4C0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H64 1;  4J6Y A;  4XU0 A;  4M75 F;  4NOY A;  3RKY A;  5GAO p;  3JB9 H;  1I81 A;  4F7U E;  3RER A;  2FB7 A;  3RKW A;  3QO3 A;  3JCM f;  3RES A;  5DY9 A;  5GAM g;  4PJO G;  4PJO D;  4M7D B;  4N0A C;  3QSU A;  5GMK h;  2YLB A;  4M78 C;  3INZ A;  5GAN 8;  5GAM f;  5GAN h;  4M75 E;  2CGH A;  4M75 A;  4QVD A;  1TH7 A;  5GAM j;  1WQW A;  2DXT A;  4N0A A;  4HT8 A;  1WNL A;  4M77 F;  4C92 D;  1JBM A;  4C92 G;  4M78 E;  3HFN A;  4HT9 A;  2ZGW A;  2E41 A;  4M78 A;  4XTV A;  4XTU A;  3JCM P;  4XTX A;  5GAO q;  3JCM V;  1WQ7 A;  3FIF A;  1HK9 A;  4HA8 A;  4M77 G;  4M7A B;  1B34 A;  3JCM d;  2VXE A;  2EJF A;  3RUX A;  4JRI A;  1BIA A;  3JCM X;  5GAO r;  3SWN B;  4M7D C;  2E65 A;  4M77 E;  3QHS A;  4EMK B;  4M77 A;  3BW1 A;  2RM4 A;  4DQ2 A;  5GAM d;  1D3B A;  5LJ5 g;  4PJO B;  4OP0 A;  1LJO A;  5GMK m;  4M78 F;  5LJ3 e;  4M75 G;  4M75 D;  5GAO l;  5GAN 3;  1BIB A;  2RA2 A;  1N9R A;  2DVE A;  3HSB A;  4X9C A;  5LJ5 f;  4C8Q B;  3QUI A;  5I21 A;  3AHU A;  4M78 D;  4M78 G;  4MML A;  4PNO A;  5LJ5 j;  4A54 A;  4RCC A;  2VXF A;  1JRI A;  4C92 B;  3FJP A;  2FYK A;  3V7C A;  4M7A C;  1U1T A;  5GMK l;  1N9S A;  5GAM e;  2RB6 A;  4EMG A;  3JCM Q;  2VC8 A;  1Y96 A;  3BFM A;  1YCY A;  4JRK A;  3SWN C;  4F7U B;  5GMK i;  4M77 D;  4EMK C;  3VU3 C;  4M7D F;  5GAN g;  4J6W A;  2DJZ A;  4PJO C;  3BY7 A;  2QTX A;  1MGQ A;  2DTI A;  3JCM W;  1I5L A;  4M7A A;  2I2L A;  2EWN A;  5LJ3 h;  3RKX A;  3V7S A;  5LJ5 d;  5GAN f;  5GMK j;  2E10 A;  4M7D G;  3SB2 A;  4C8Q C;  4M75 B;  1I8F A;  4J6X A;  5GAN j;  1LNX A;  3JB9 F;  4RCB A;  2E1H A;  3L1A A;  2EAY A;  2YLC A;  3HFO A;  4XU2 A;  4QVC A;  4M7D A;  2DZ9 A;  4M7D E;  4JLI A;  3V8L A;  3JCM e;  4NL2 A;  3JCM g;  4M7A F;  4C8Q A;  5LJ3 g;  3JCM J;  5GAM h;  3JB9 G;  3EFR A;  1B34 B;  3PGG A;  2JN0 A;  3V8J A;  4XQ3 A;  3V7R A;  4NL3 A;  2RD1 A;  4J5Y A;  4XU3 A;  1KQ1 A;  1U1S A;  2DKG A;  3L2Z A;  4Y91 A;  5LJ5 e;  5GAN 2;  4M7A G;  5LJ3 f;  4M7A D;  2K57 A;  4X9D A;  4M77 B;  4PJO F;  1KQ2 A;  1X01 A;  1WPY A;  5GAN d;  1D3B B;  5LJ3 j;  3RIR A;  4XTW A;  4XU1 A;  4M7A E;  4F7U A;  4M75 C;  4JUV A;  4V2S A;  5GAN 4;  2EJ9 A;  4C8Q F;  2DTH A;  2DZC A;  4XTY A;  3JCM b;  2HNI A;  1LOJ A;  3SWN A;  4M7D D;  5GAN 5;  2DTO A;  5GAO n;  4EMK A;  4C92 F;  1I4K 1;  2DXU A;  5GAN 6;  4PJO E;  3V8K A;  4C8Q D;  3JCM h;  4C8Q G;  5GMK e;  4PJO A;  3FB9 A;  4XTZ A;  4WF2 A;  4C92 C;  5GAO m;  1HXD A;  4M78 B;  4EMH A;  5GAN e;  3EFS A;  1M8V A;  5LJ3 d;  4F7U F;  4C8Q E;  3JCM c;  2DEQ A;  1Y96 B;  5LJ5 h;  5GAN 7;  2E64 A;  3JB9 I;  3JB9 D;  4M77 C;  3JB9 J;  1M5Q 1;  2EJG A;  4C92 E;  4C92 A;  3M4G A;  4F7U G;  3GIB A;  2YHT A;  4A53 A;  4MMK A;  5CAI A;  2Y90 A;  3BDU A; 
#chains in the Genus database with same CATH topology
 5GAO p;  3CCR Q;  1QMC A;  4NS5 A;  1NJI U;  4DBF A;  1WXU A;  2CP2 A;  2GQV A;  1I1J A;  1TUG B;  4KGV B;  3OMG A;  1SEM A;  2KYM A;  1H3H A;  1UJY A;  3OQ5 A;  1QP3 A;  3CCJ Q;  3HL8 A;  3FIF A;  4HA8 A;  1YJN A;  3CCM Q;  3SWN B;  2ZPH B;  1Q81 C;  2EQI A;  3G6E T;  1D3B A;  1IGU A;  3PIO A;  2QGF B;  3N5B B;  1ZA2 B;  5KCH A;  2RK2 A;  4M78 D;  2OAU A;  4D8K A;  4C0G A;  2L3Q A;  3VRZ A;  5GAO m;  3CBO A;  2PVG B;  4RTZ A;  3O5Z A;  5KCO A;  4HVV A;  5FW9 A;  2O88 A;  1ZQ1 A;  2CZ6 B;  4JDS A;  3J81 E;  3EG3 A;  3JRZ A;  2E1H A;  4DA4 A;  2NWM A;  1WJS A;  2CT4 A;  3X28 B;  1YJ9 T;  4KGZ B;  2L8D A;  1ABQ A;  4VUB A;  1CKA A;  2WAC A;  3RBB B;  5KH6 A;  4QVZ A;  4X9D A;  3QWY A;  2HCK A;  5FU7 C;  3I56 Q;  5L8R E;  1M1F A;  3CCS T;  2O9V A;  3ULR B;  3CCJ T;  1YJW Q;  1R77 A;  2DTO A;  5IH2 A;  5D7U A;  3RMQ A;  4DBR A;  3C4S A;  2DIG A;  3CCM T;  3OYM A;  1BKB A;  4D8D A;  5LJ5 h;  1OUL A;  2NYS A;  4M77 C;  1A0N B;  1KJW A;  2GTJ A;  1K8A R;  4J9G A;  3E9G A;  4TVR A;  2J06 A;  4XU0 A;  4M75 F;  2BZ8 A;  3OSV A;  1SPK A;  3QDR B;  2QEX T;  2RMO A;  2HL3 A;  4E47 A;  2PQW A;  1MHN A;  2YLB A;  4RG2 A;  4BE2 A;  1ZHI A;  1VQ7 A;  2HQX A;  1VUB A;  2C0I A;  2NUP A;  1MV0 B;  1WXB A;  2VVK A;  2QXF A;  4A4K A;  3NHN A;  3VYH B;  4M7A B;  1B34 A;  2VXE A;  1V1C A;  2D1X A;  4AG1 C;  3VS4 A;  1G2B A;  3CCL Q;  2X35 A;  4EMK B;  1WJR A;  4J9C A;  2HMA A;  1UHC A;  2RM4 A;  2M02 A;  4CRI A;  4BD3 A;  1E7O A;  1HYO A;  2V8I A;  1V29 B;  3EG9 B;  1VQM A;  3E1S A;  4JJN K;  1ZBJ A;  1WYX A;  4R55 A;  2KR3 A;  1AT1 B;  3I56 T;  4ELY C;  3DKM A;  4GBQ A;  1U1T A;  1AEY A;  4AFQ C;  3MET A;  1YJW T;  2EVR A;  2AIR B;  2CP5 A;  5GMK i;  1NLO C;  2YUP A;  3LH0 A;  2LC4 A;  4M7D F;  2KDS A;  4RTW A;  4ELZ C;  1PKS A;  2XG8 D;  1C6V X;  3L2Q A;  4M7D G;  2GFU A;  2PTK A;  3I55 Q;  1M90 C;  3VS2 A;  2YLC A;  3ZEH A;  1M3C A;  4OGC A;  1I07 A;  1BB9 A;  4IUP A;  2CP0 A;  1GBQ A;  1B07 A;  4PJO F;  4ZTF A;  2XD0 A;  1VQN Q;  4ME7 A;  1QP2 A;  5DLQ E;  2RHU A;  1X27 A;  1VQO A;  2A28 A;  2DXU A;  1BI3 A;  1M3B A;  2EFI A;  2LQK A;  4JLG A;  3R6N A;  4UC4 A;  3OMC A;  3QG1 A;  1PRM C;  3CCL T;  4FM4 B;  2E64 A;  3MEW A;  3JB9 D;  4J9H A;  1SRL A;  2E5Q A;  1T0H A;  1SRM A;  1VQL Q;  2L0A A;  2JTF A;  4ESR A;  1EX4 A;  1JQQ A;  5KYW A;  1J3T A;  4E7Z A;  3G71 Q;  2JNG A;  4M75 A;  5GAM j;  2GNC A;  1Y71 A;  4Q5W A;  5I2M A;  3UA6 A;  1JJ2 A;  4HCK A;  2BE7 D;  3AT1 B;  3JCM V;  1WIE A;  3I55 T;  1NG2 A;  1BIA A;  3CQT A;  1HJD A;  2KRO A;  3JV3 A;  2RQR A;  4KGX B;  1ZUU A;  4J7I A;  5LL6 S;  2V1Q A;  2O01 E;  4OMF B;  3GF5 A;  1OPL A;  4FT2 A;  4BI4 A;  2IIM A;  4ZGD B;  1PC0 A;  4IKF A;  4RUG A;  2EYX A;  5C6S A;  4KH1 B;  4PKC C;  2BUD A;  5CIU A;  2DBK A;  3OSS C;  2XDP A;  4KUL A;  1KQS A;  1VQK Q;  4C8Q C;  1FMV A;  2EYY A;  1I8F A;  2A37 A;  1K76 A;  1BYM A;  2MOX A;  4M7D A;  1PKT A;  3OYD A;  1GCQ A;  3D7S B;  4A63 B;  2LZ6 B;  2KT1 A;  3CC4 Q;  1D0Y A;  2RHX A;  4OB3 B;  2IVW A;  2DET A;  3CCQ Q;  2K57 A;  2NUT B;  1WPY A;  2AKL A;  3M54 A;  3CC2 Q;  2YSQ A;  2DO3 A;  4F7U A;  5KYU B;  3DLL A;  1BU1 A;  2KGT A;  1OYX A;  1Q82 U;  3CMA Q;  1WI7 A;  2D9T A;  2E5K A;  3QJ6 A;  1K0X A;  3E19 A;  4FW1 A;  1CKB A;  1MV3 A;  1Q7Y R;  1O75 A;  4PJO A;  2LJ3 A;  2NUP B;  2CUB A;  2YWW A;  1N5Z A;  4O5V A;  4MDX A;  2OTJ Q;  5CKD A;  5FU6 B;  3LWI A;  1UUE A;  2DVJ A;  2DEQ A;  1VQ8 A;  5J26 A;  2MCN A;  2V8K A;  1JO8 A;  3GIB A;  2DXB A;  3QWX X;  3L2W A;  2ZPF B;  2DEU A;  4E6R A;  4F7U E;  3S3O A;  4F16 A;  4HXJ A;  5GAM g;  1R8O B;  3E2U A;  3OYF A;  3VS3 A;  5J39 A;  3FLG A;  4KRT A;  3CC7 Q;  3R6O A;  5C0M A;  1BCO A;  3WXM B;  4C92 G;  1N27 A;  4XTX A;  3VS5 A;  2O4X B;  2LCL A;  3HP9 A;  2DIQ A;  3LYI A;  4LE9 A;  4M77 E;  1OPK A;  5GAO l;  5GAN 3;  1I0C A;  3CCQ T;  1M90 U;  5IHI A;  1H92 A;  4WTO B;  1ACM B;  3EG2 A;  1OZ2 A;  2P4R A;  4RMO A;  2MPX C;  3CMA T;  2A08 A;  3BFM A;  1YCY A;  1Q81 R;  3UT1 A;  2RJE A;  2DJZ A;  2F2V A;  4BY6 B;  3C12 A;  3HRS A;  4LNP A;  1NJI C;  2EPD A;  1VQ4 A;  3J80 E;  5IXB A;  2JT4 A;  2MI6 A;  4M7A F;  4DOW A;  2J6O A;  2VWF A;  2JN0 A;  2XHC A;  2O31 A;  3CME Q;  2QA4 Q;  4M7A G;  2CKK A;  1B3Q A;  4HKE A;  2DK3 A;  1YIT A;  6AT1 B;  1IXD A;  4KT0 E;  3SWN A;  3TU4 K;  1M1K R;  1RAH B;  3EH2 A;  3V8K A;  1JU5 C;  4Z88 A;  4Y28 E;  1M8V A;  2J05 A;  3M0U A;  2HSP A;  5LJ3 d;  1PWT A;  2A0F B;  3JB9 I;  3MEU A;  2QYZ A;  2LP5 A;  1LNX A;  2VAS A;  3RKY A;  1M2O A;  2LX7 A;  2MAM A;  2CSQ A;  5DY9 A;  2P4T A;  3OS0 A;  2KYB A;  2D6F A;  4HVW A;  5IT9 E;  2QI2 A;  2CGH A;  2X3W D;  1BI1 A;  3UWN A;  4ATO A;  3HFN A;  2E41 A;  4B6M A;  2DJQ A;  1X2K A;  1ZA1 B;  3OYN A;  2P0Q A;  3PT9 A;  2AT1 B;  2ROL A;  4E7L A;  2HSE B;  3MPU B;  3I5S A;  3P8H A;  5GJV B;  3OYB A;  1U06 A;  2RA2 A;  2Z0W A;  2DX1 A;  5FU6 C;  1PD1 A;  2HBW A;  2DFU A;  3L2U A;  2FYK A;  2PUO B;  2GF7 A;  2EYW A;  4F7U B;  3VU3 C;  1OU9 A;  2H3J A;  5KE3 A;  1G83 A;  1E6H A;  5FU7 B;  1NEG A;  1X6O A;  1ZX6 A;  4QQD A;  1JEG A;  1JB0 E;  4AG2 C;  2X4J A;  1VQ5 A;  1WGS A;  4C8Q A;  2DPP B;  4RTV A;  2P0P A;  4NL3 A;  4BI3 A;  3OW2 A;  4JJC A;  2COW A;  5LJ3 f;  2YUN A;  4DBH A;  4M77 B;  4HCB A;  2JMC A;  4LXC A;  2HKN A;  2EGE A;  2QAZ A;  2X3X D;  3CPF A;  5HK0 A;  2W0Z A;  5GAN 4;  3JAM E;  2DTH A;  2ED1 A;  5FLX E;  3CPW S;  1VQ7 T;  1YCS B;  4EMK A;  5GAN 6;  1AVZ C;  1Q86 U;  3JCM h;  3OYA A;  4Z89 A;  3CXC S;  2FZK B;  3P8B B;  3EG9 A;  5EG2 A;  3A8G B;  4C8Q E;  1KHI A;  3VS6 A;  3G6E Q;  2JTE A;  3PMT A;  3EH1 A;  1AHJ B;  4BY6 C;  2QAS A;  1EIF A;  4BE1 A;  1VQM T;  1M2V B;  2V8J A;  1VYT A;  1YWO A;  2FB7 A;  3RES A;  3EGX B;  4N0A C;  1UG1 A;  1OQK A;  2FO0 A;  2VKN A;  1TUD A;  2AHJ B;  2CH4 W;  4HT8 A;  3H0F A;  4C92 D;  1JBM A;  4M78 E;  4LDY A;  1KK7 A;  2MMP A;  1VQP Q;  2DE0 X;  2RHZ A;  2MWP A;  4QQ6 A;  1YJ9 Q;  2E65 A;  1QVG S;  1UGR B;  4DQ2 A;  2K2M A;  3H8Z A;  2XIC A;  1NEB A;  2DBM A;  1NBE B;  1PRL C;  2CUD A;  2KAF A;  2CDT A;  2CP6 A;  2WSE E;  3CCU A;  2AZS A;  5KYY B;  3CCS Q;  2R5A A;  2YUQ A;  1TUC A;  3FJP A;  3V7C A;  1N9S A;  3LW5 E;  5GAM e;  3FEO A;  1S72 A;  2DNU A;  2CYZ B;  3QYH B;  3M59 A;  1UB4 A;  3KUF A;  1VQO T;  7AT1 B;  1WZO A;  4F04 B;  2ROT A;  3NTH A;  5GMK j;  2OTL A;  1W2B S;  1TSF A;  3GNG A;  5GAN j;  4R56 A;  3EGU A;  4XU2 A;  2VB6 A;  3L2R A;  2LQW A;  1FMK A;  2LQ8 A;  3G7Z A;  3HKS A;  4XK8 E;  2RPN A;  3LH5 A;  3OYK A;  3JCM J;  3EFR A;  3V8J A;  2BZX A;  2QEX Q;  2YT6 A;  1AD5 A;  2LRQ A;  2DKG A;  5CCA A;  1UJ0 A;  4M7A D;  5FWC A;  2QGG A;  1BK2 A;  1SF9 A;  3IQL A;  2GBQ A;  2DZC A;  3JCM b;  4LDW A;  2JXB A;  5GAN 5;  1VQP T;  1LPL A;  3VS7 A;  1G3W A;  1KC8 C;  1QVP A;  4IUR A;  2VGM A;  2YDL A;  1RAA B;  3SD4 A;  4LDV A;  3CEY A;  2YXY A;  3JB9 H;  3HRT A;  1TU0 B;  3RER A;  1N8R R;  1VYU A;  3WVD B;  1QVF P;  1FX7 A;  1SHG A;  3QJY A;  5CQY A;  2B86 A;  2JM8 A;  3GBQ A;  2DA9 A;  4JS5 A;  1WNL A;  4J9D A;  2CP3 A;  2KEA A;  3MKD A;  2AZV A;  2D0Q B;  1XNI A;  3HPW A;  1P92 A;  4ORZ A;  1QLY A;  2NUT A;  5EC7 A;  1KIK A;  2XDD A;  2DRM A;  1Q82 C;  2LVM A;  5GMK m;  5LJ3 e;  5KYU A;  4M75 G;  2DVE A;  1UE9 A;  4E7K A;  1VIE A;  4C8Q B;  2ATC B;  1BBZ A;  2LNV A;  1W6X A;  2PNI A;  1VQ6 A;  1M8M A;  1WLP B;  4J9I A;  3EGD B;  5IN1 A;  4FT4 A;  5GAN g;  2JS2 A;  2BZY A;  1NYF A;  1AZG B;  3CCE A;  2I2L A;  2C0O A;  1YIJ Q;  2O2O A;  4KBM B;  4DOV A;  3CCV Q;  4Z02 A;  1G5V A;  2X4X A;  2PU9 B;  3C0C A;  4LD6 A;  3OYY A;  2MIO A;  1ABO A;  1KD1 C;  2ZPG B;  2EKH A;  1H8K A;  1VQ9 A;  3PGG A;  3V7R A;  1N6A A;  2K5I A;  4Y91 A;  5CK9 A;  1NJI R;  2WSC E;  2BKD N;  3KXT A;  2O4X A;  2VUB A;  1X75 C;  2EQU A;  3UPU A;  1UHF A;  2IG0 A;  2K3B A;  1ZUY A;  4CC4 B;  4II1 A;  3X20 B;  3H0H A;  4F7U F;  3G4S A;  2ECZ A;  3PTA A;  1YI2 A;  4OB2 B;  3CPW P;  4ANJ A;  1XOV A;  1YP5 A;  2ZZD A;  1M5Q 1;  4F7U G;  3JCM g;  1OU8 A;  1H64 1;  3CXC P;  2FG0 A;  1UFF A;  2EIF A;  1C1A A;  2F2X A;  1WHM A;  3SFM A;  4PJO G;  2E6Z A;  3HHT B;  2F5T X;  5KYX B;  4LDX A;  1WQW A;  4N0A A;  2E70 A;  4M77 F;  5FRO A;  4A4H A;  1JXO A;  5I2S A;  3VS0 A;  4FCY A;  2LJ0 A;  1YIJ T;  2HQE A;  4M77 G;  1RUW A;  3CCV T;  1KG1 A;  2EJF A;  1TS9 A;  4HCZ A;  1WHJ A;  1YWP A;  5D6Y A;  1LVK A;  1K9M U;  1QCF A;  4OP0 A;  1OI1 A;  3OS2 A;  1PM3 A;  2L5Q A;  4BB7 A;  3HSB A;  1GRI A;  2YRV A;  3L2V A;  5LJ5 j;  1AWO A;  3M58 A;  1E6G A;  2F2W A;  2HL5 C;  1WHG A;  1YIT T;  4C5G A;  3EAE A;  3VUB A;  3GLX A;  1I5L A;  1U8R A;  2ZPB B;  1GXI E;  2RF0 A;  1CSK A;  3M55 A;  4FU6 A;  3HFO A;  2QTV A;  3NTI A;  1VQ5 Q;  4QW2 A;  1KC8 U;  3OS1 A;  1QCO A;  1W2B P;  3CCR A;  4GY5 A;  1X01 A;  2AK5 A;  2CSI A;  4XU1 A;  1JJ2 S;  1OZ3 A;  3SDZ A;  1SSH A;  3CBM A;  1LOJ A;  1U5S A;  1RI0 A;  1NYG A;  2RI3 A;  5M9O A;  1VIF A;  2FRW A;  3CCJ A;  4WF2 A;  4RTU A;  2BIV A;  4EMH A;  4J8O A;  1Y96 B;  1SKU B;  1WA7 A;  4KH0 B;  1NM7 A;  4BDY A;  3M4G A;  4PJM A;  3CCM A;  1OEB A;  3PFS A;  4C0D B;  4L5G A;  2LNH B;  1I81 A;  4PJL A;  4YTL A;  4OMN A;  3MO8 A;  2E6N A;  3NGP A;  1OV3 A;  3QSU A;  3QDF A;  1OX9 A;  4M78 C;  3INZ A;  3OY9 A;  1G3Y A;  1WFW A;  5CR2 A;  1KHC A;  3F70 A;  1NE8 A;  1D1C A;  3PIP A;  2DXT A;  1KQS S;  3LLR A;  4KUI A;  3PVQ A;  1UGP B;  3LWH A;  1QKX A;  1R0C B;  2ZAE A;  2LCS A;  1UGV A;  2R5M A;  1RAD B;  1FXX A;  4J83 A;  2QDL A;  4M77 A;  5GAM d;  1VQ5 T;  5LJ5 g;  4B9W A;  4M75 D;  2CZ0 B;  1Q86 C;  2JUF A;  1N9R A;  1AZE A;  1ZLM A;  3QUI A;  2OJ2 A;  2M1H A;  2QQA A;  1YNZ A;  1RLP C;  3CCU Q;  4FYY B;  2W10 A;  2LQN A;  1K73 C;  1KD1 U;  2V26 A;  2J6K A;  3I56 A;  3OYI A;  4E7I A;  3J7A F;  3VYG A;  4MZT A;  1YJW A;  3PNW C;  1YJN Q;  2FEI A;  1AWJ A;  1M2V A;  2OTL Q;  1UGQ B;  1MNE A;  4OML A;  3L1A A;  3RMS A;  1U3O A;  2EAY A;  3EGX A;  2PUK B;  2LDM A;  4LN2 A;  1QWF A;  2X51 A;  5HY6 A;  1T3S A;  2YRD A;  5GAN 2;  3GOX A;  1FMW A;  4E7S A;  2J7I A;  3FDR A;  2SRC A;  2EJ9 A;  4C8Q F;  4X1V A;  4M7D D;  5IAY A;  2HZY A;  3M0Q A;  2MK5 A;  2BE9 B;  4C8Q G;  4CC3 A;  5GMK e;  4BAC A;  5GAN e;  4MDW A;  1TOV A;  3JCM c;  2K79 A;  2DL4 A;  3Q1J A;  5KYY A;  3URG A;  2EJG A;  3VRY A;  2YHT A;  3CCL A;  2EQJ A;  2Y90 A;  4AFS C;  1O9S A;  1IRX A;  1UTI A;  4MZP A;  3CCU T;  4PJO D;  1QVF A;  1SHF A;  1X6G A;  1KC8 R;  4F14 A;  3MP6 A;  5GAM f;  4JJD A;  3A1P A;  5HCK A;  9ATC B;  1K0S A;  5FRN A;  1YJN T;  2XDB A;  5J3B A;  1WDX A;  2X4Y A;  2OTL T;  2EYQ A;  4JRI A;  4QT7 A;  2VYT A;  2DXC A;  3KBG A;  4FSX A;  1MND A;  4PFZ A;  2QQ9 A;  2P84 A;  2DIL A;  3VKI A;  1VQ7 Q;  4RKU E;  2GQI A;  1BCM A;  3S3M A;  1IRE B;  4C0D C;  3JCM Q;  1Z9Z A;  1VQN A;  3MEA A;  5D6W A;  1Q82 R;  2L3P A;  5IHN A;  3DLM A;  1SG5 A;  2EWN A;  1G8X A;  2EGC A;  2RQT A;  4AFU C;  5CO7 A;  4LDU A;  3O8V A;  4O6J A;  3ZBD A;  3OYJ A;  1RAE B;  2QK0 A;  3TEE A;  2DL5 A;  2K7A A;  1VQM Q;  3SHW A;  1S1N A;  2L89 A;  2RH2 A;  1ZSZ B;  1HSQ A;  4XQ3 A;  1VQL A;  3M0T A;  3H0I A;  4JZ4 A;  3RIR A;  2FVU A;  5HKC A;  3G71 A;  2KRM A;  4RG8 A;  2EKO A;  2K9G A;  3E9F A;  2QQR A;  2KBT A;  2RI5 A;  1I4K 1;  3QZ5 B;  3S6W A;  1IZ6 A;  2R58 A;  1DJ7 B;  2QDY B;  3HTR A;  1NPP A;  3EFS A;  1JJ2 P;  1GL5 A;  3BE3 A;  4LUE A;  3TVT A;  4C92 E;  1IB8 A;  3BDU A;  4NOY A;  3EGD A;  2HEQ A;  1M90 R;  4FSS A;  2L3S A;  1M1G A;  2K5L A;  1VQO Q;  2ABL A;  5KYN A;  2DD4 A;  1K73 U;  1QKW A;  2ZGW A;  4M78 A;  5GJW B;  1BI0 A;  4AMC A;  3CCE T;  1WQ7 A;  5DLO A;  4QKU A;  2OX7 A;  2PVO B;  3OA6 A;  3JCM X;  2KY9 A;  1VQK A;  3EHR A;  3QHS A;  2XMF A;  3ZFJ A;  2KSS A;  3OW2 S;  1D1B A;  5D6X A;  5I11 A;  4X9C A;  1NLP C;  4PFP A;  2KMT A;  3CC4 A;  2M9U A;  1Q7Y C;  3UA7 A;  4FYW B;  4IIO A;  5AT1 B;  3CCQ A;  3QYG B;  2H3E B;  5DM7 R;  2Y4X A;  3CC2 A;  1AWX A;  2LT4 A;  2DF6 A;  4J6W A;  2NLU A;  3CMA A;  1MGQ A;  2DTI A;  4RTX A;  3ER0 A;  1GCP A;  1VOM A;  3RKX A;  1WXT A;  4K11 A;  3G4S T;  2KXC A;  3JB9 F;  2OTJ A;  3M0S A;  4JLI A;  3FRN A;  2JMA A;  3SEM A;  3X26 B;  4R0K A;  3JB9 G;  2RHY A;  4L6V 5;  5KYX A;  2RD1 A;  5LJ5 e;  1W2B A;  3L2Z A;  2KRS A;  2DRK A;  1C0M A;  4XTW A;  4M75 C;  2JJ9 A;  5A2Q E;  1K9M C;  2NUZ A;  3RR6 A;  1LCK A;  2RNA A;  4N4I A;  3CC7 A;  3JSC A;  4C8Q D;  2JZ2 A;  2CS7 A;  2K6D A;  5A0D A;  2QG9 B;  1UEB A;  2YUO A;  3JB9 J;  2DD5 A;  2EW3 A;  2GCX A;  2CP7 A;  1T3L A;  2HBP A;  2LCC A;  4FW2 A;  4PLI A;  5AYF A;  5CKF A;  2OAW A;  2QQS A;  2DL3 A;  3MHX A;  3NTK A;  1M27 C;  1ZSZ C;  3QPH A;  2A7Y A;  4HT9 A;  2BTT A;  1M3A A;  1VQ8 Q;  5IXF A;  5I22 A;  2O9S A;  3REB B;  4M7D C;  1GFD A;  1GCQ C;  3VS1 A;  4BE0 A;  1YHQ A;  4LUD A;  2JM9 A;  3CD6 A;  5FWB A;  1M1K C;  2JOY A;  2K5F A;  3AHU A;  3VV0 A;  3CCR T;  4MML A;  1W4S A;  2RQW A;  3OBY A;  1JRI A;  4C92 B;  3M9Q A;  3WVE B;  4PJN A;  3CME A;  2QA4 A;  1XJW B;  1W1F A;  4DEY A;  1QQJ A;  1HD3 A;  1Y96 A;  4JRK A;  3T9N A;  4PJO C;  1ZSG A;  2KQW A;  1Q86 R;  4C0Z A;  4OGE A;  1Y07 A;  2X4W A;  3SB2 A;  4XAX B;  2WSF E;  2XKO C;  2C06 A;  2RJD A;  1K73 R;  2FPE A;  4Z8A A;  3H9N A;  4HVU A;  1NPR A;  5GAM h;  2KT8 A;  2J6F A;  2F1L A;  5CKB A;  3GP8 A;  3CBP A;  5GAN d;  1SSF A;  4OMM A;  1IGQ A;  1UEC A;  2RQV A;  2KK4 A;  2V1R A;  4XTY A;  2Y4Y A;  3EG1 A;  2HDA A;  1K9A A;  2CT3 A;  2COZ A;  3UF4 A;  1VQ8 T;  1VQ4 Q;  3FB9 A;  4J9E A;  4XTZ A;  3H6Z A;  3OYG A;  1ARK A;  4IUT A;  2KXD A;  4M78 B;  4LD9 K;  2GTO A;  1TWB A;  2HKQ B;  2DLP A;  4A4F A;  2XK0 A;  4ZGJ B;  3A98 A;  1G3T A;  4OF1 A;  2IPO B;  3M0R A;  2LTO A;  1RLQ C;  1BI2 A;  1R0B G;  3X24 B;  1YIT Q;  2CH4 A;  3TQ7 P;  1PSF A;  2R57 A;  5HK3 A;  4F17 A;  3NPF A;  1RAC B;  2FPF A;  1Q7Y U;  1YFN A;  3L42 A;  4XTV A;  4XTU A;  5GAO q;  3M57 A;  3JCM d;  2K2V A;  1WJQ A;  2RO0 A;  2ED0 A;  3EFO B;  4CC2 A;  3KFV A;  3M56 A;  2D8H A;  4JRQ A;  3OYL A;  1BIB A;  2XU8 A;  3A5Z B;  3MP1 A;  4A54 A;  1PG5 B;  2EBP A;  3OW2 P;  1M30 A;  1K1Z A;  2VC8 A;  3SWN C;  1VQ4 T;  3LX7 A;  5LJ3 h;  1XTD A;  4FIB A;  5GAN f;  1F1B B;  4ZNX A;  2FPD A;  1X6B A;  4RCB A;  2HD0 A;  2HQH A;  4RTT A;  4GLK A;  1MMG A;  3V8L A;  3G6E A;  1VA7 A;  2JW4 A;  3OBW A;  1QVG P;  2FZC B;  2JS0 A;  4FYV B;  1U1S A;  5CQX A;  2B8A A;  1D3B B;  2EQM A;  3QZ9 B;  4E2F B;  2D8J A;  1VYV A;  2M0Y A;  4JUV A;  1Q81 U;  4V2S A;  1WHL A;  2F69 A;  4J9F A;  1D0X A;  2SEM A;  1RI9 A;  4C92 C;  1M4Z A;  1PCX A;  1VQP A;  2RQU A;  5ECA A;  1YJ9 A;  4MMK A;  1GFC A;  3TCJ A;  3X25 B;  2OI3 A;  2ZCF B;  3QKJ A;  4DBQ A;  2ZPI B;  3RKW A;  3JCM f;  3MEV A;  4DEX A;  4JPB W;  5GAN 8;  3CCS A;  1KFZ A;  4M75 E;  4QVD A;  1M1K U;  3NFC A;  1FYN A;  1VQN T;  3DB4 A;  1H3Z A;  1X69 A;  4ZTJ A;  2KE9 A;  2KRN A;  3PMI A;  4JJB A;  4FYX B;  2ZPE B;  1IO6 A;  1ZSZ A;  2PZ1 A;  3ASK A;  5GAO r;  5CKH A;  4BI8 B;  3DB3 A;  3BW1 A;  3M5A A;  2ENM A;  4MZM A;  4PLL A;  4RTY A;  2K3Y A;  1VQL T;  4PNO A;  4PFO A;  2QEX A;  2VXF A;  2ESW A;  4M7A C;  4P5N A;  3TSZ A;  3G71 T;  2RHI A;  2RB6 A;  4JRP A;  4EMG A;  2A3L A;  1RAB B;  4OB0 B;  4EMK C;  5KE2 A;  2QTX A;  4OMO A;  4IUU A;  4C5E A;  5LJ5 d;  2COY A;  1MUZ A;  3QBY A;  1N8R C;  4CI0 C;  1OOT A;  3P8D A;  4QVC A;  4M7D E;  4IUV A;  4X34 A;  2CZ1 B;  2JTM A;  3ZL7 C;  2KVQ G;  3PE0 A;  1B34 B;  5L23 A;  4XU3 A;  1KQ1 A;  1WHK A;  4AFZ C;  2DMO A;  3GPL A;  3QXE B;  1QCN A;  3C94 A;  1S72 Q;  5LJ3 j;  3RDV A;  3REA B;  1K8A C;  4D6W A;  1PD0 A;  3EG0 A;  4PK4 A;  2HNI A;  4C92 F;  4BUG A;  4M4Z A;  4PJO E;  4J9B A;  3MP8 A;  1AOJ A;  1WHH A;  2DAQ A;  5A0G A;  2DM1 A;  1NZ9 A;  2RJC A;  5GAN 7;  1I5O B;  1VQK T;  4ZN3 A;  3M4Y A;  1IHV A;  1RAF B;  4WCI A;  1IHW A;  2F5K A;  3A8H B;  4OVA A;  4A4E A;  5CAI A;  1K9M R;  4Y92 A;  4J6Y A;  2LX9 A;  8AT1 B;  3CC4 T;  1PSE A;  5IHK A;  8ATC B;  4OMP A;  3ME9 A;  1MMD A;  2G3R A;  2DL8 A;  2FZG B;  2MYS A;  2H8H A;  2CRE A;  4EIK A;  1TXQ A;  1YBY A;  3UAT A;  3CC2 T;  1GBR A;  1RAG B;  4GLM A;  4OB1 B;  3JCM P;  2MF2 A;  1TG0 A;  4C5H A;  1HK9 A;  2I0N A;  3LGL A;  2DER A;  3RUX A;  3HRU A;  2L2P A;  1YIJ A;  2OTJ T;  3CCV A;  1W70 A;  3OS5 A;  4M78 F;  2C0T A;  3GNF B;  3A8O B;  1YHQ Q;  3OYE A;  1V76 A;  5LJ5 f;  1KSW A;  5I21 A;  1RL2 A;  2EQK A;  2LT1 A;  2E12 A;  4IUQ A;  4M78 G;  1S72 T;  3CD6 Q;  3H41 A;  1Y57 A;  2M0O A;  5GMK l;  2YRC A;  4AT1 B;  1Q95 G;  4M77 D;  3EHQ A;  5KYW B;  5FRM A;  3M0P A;  2K3X A;  4FL6 A;  3CC7 T;  1UGS B;  3V7S A;  3I55 A;  4M75 B;  2EYZ A;  4C0F A;  2FL7 A;  1QWE A;  1EZZ B;  2CZ7 B;  3PVL A;  4IIM A;  3MJX A;  3JCM e;  2L3R A;  5LJ3 g;  2DYB A;  3LGF A;  1QVF S;  2LJ1 A;  4J5Y A;  1ZBX A;  2XI9 A;  3OB9 A;  1VQ6 Q;  1T0J A;  2RJF A;  3I5R A;  1Y0M A;  2RI2 A;  3UDC A;  3CCE Q;  4ZGE B;  4EDU A;  1AWW A;  4PJJ A;  2VV5 A;  3A8L B;  1WX6 A;  3RNJ A;  3U23 A;  1X43 A;  4E7H A;  3TSW A;  2PVD B;  4N4G A;  1VQ9 Q;  2EGA A;  4C92 A;  1YHQ T;  4A53 A;  2VGN A;  4JS4 A;  3NMZ C;  4EPC A;  3CD6 T;  3QO3 A;  3MCA B;  3C95 A;  1M9S A;  1Y7X A;  2GFA A;  4M7D B;  1PHT A;  5GMK h;  4BDZ A;  4KUD K;  2DL7 A;  1MMA A;  2LMJ A;  3CME T;  2QA4 T;  1D09 B;  5GAN h;  4E7J A;  1KD1 R;  2KI7 A;  4L59 A;  1TH7 A;  4OMQ A;  4HCC A;  1B7T A;  1QW1 A;  3CPW A;  1D0Z A;  1MMN A;  2X9H A;  3G4S Q;  3THK A;  1YI2 Q;  1EFN A;  1OX8 A;  3CXC A;  1XQH A;  1G3S A;  5CKE A;  4PJO B;  1LJO A;  1RAI B;  2AKK A;  1ZUK A;  3I9Q A;  1N8R U;  4B9X A;  1VQ6 T;  1PNJ A;  1Z9Q A;  4PL6 A;  5A0L A;  4N4H A;  2A36 A;  4RCC A;  2GGR A;  4QQG A;  1D1A A;  2FHD A;  2JVV A;  2KNB B;  3M53 A;  2P0K A;  3VJP A;  3I35 A;  2G6F X;  2E4H A;  3BDL A;  4CC7 A;  2MWO A;  3BY7 A;  1JXM A;  4M7A A;  3JCM W;  1K8A U;  4J7F A;  1KQS P;  2E10 A;  3S3N A;  1X2Q A;  4J6X A;  1VQ9 T;  3QII A;  5CVI A;  2D0N A;  2DZ9 A;  4NL2 A;  3VUZ A;  3OYH A;  2M16 A;  2E3H A;  1QVG A;  2K4Y A;  1UDL A;  4A4G A;  1K4U S;  1FWZ A;  1KQ2 A;  3FC3 A;  3G1J A;  4JZ3 A;  2M51 A;  4M7A E;  3TRE A;  1YN8 A;  2HAX A;  3A8M B;  2QQB A;  2RN8 A;  3FJ5 A;  3EFO A;  5GAO n;  4ZN1 A;  2DYI A;  2RK1 A;  1YI2 T;  2XID A;  3OYC A;  4C5I A;  1HXD A;  1TTH B;  2E3I A;  2FRY A; 
#chains in the Genus database with same CATH homology
 3RKY A;  5GAO p;  4L5G A;  1G3T A;  4OF1 A;  2MAM A;  1I81 A;  2LTO A;  4NS5 A;  1NJI U;  1BI2 A;  4YTL A;  3X24 B;  5DY9 A;  3MO8 A;  2P4T A;  3OS0 A;  2E6N A;  2GQV A;  3QSU A;  1PSF A;  2R57 A;  2D6F A;  5HK3 A;  5IT9 E;  4M78 C;  3INZ A;  3OY9 A;  1G3Y A;  5CR2 A;  1KHC A;  3F70 A;  3OMG A;  1NE8 A;  2QI2 A;  2CGH A;  1BI1 A;  3PIP A;  3UWN A;  2DXT A;  1Q7Y U;  1KQS S;  3LLR A;  3OQ5 A;  4KUI A;  1QP3 A;  3L42 A;  4ATO A;  3HFN A;  3LWH A;  1UGP B;  2E41 A;  3HL8 A;  4XTV A;  4XTU A;  5GAO q;  3CCL A;  3FIF A;  4HA8 A;  3M57 A;  3JCM d;  2K2V A;  2R5M A;  1WJQ A;  3OYN A;  2RO0 A;  2P0Q A;  1YJN A;  1FXX A;  3SWN B;  2ZPH B;  3PT9 A;  4J83 A;  4M77 A;  1Q81 C;  3M56 A;  5GAM d;  3G6E T;  1VQ5 T;  1D3B A;  5LJ5 g;  4JRQ A;  4E7L A;  4B9W A;  1YJ9 A;  3PIO A;  4M75 D;  3P8H A;  2CZ0 B;  3OYL A;  1BIB A;  2XU8 A;  2RA2 A;  2JUF A;  1N9R A;  3N5B B;  5KCH A;  3OYB A;  1Q86 C;  2RK2 A;  3QUI A;  5FU6 C;  2QQA A;  2M1H A;  4M78 D;  2OAU A;  3A5Z B;  3MP1 A;  4A54 A;  4C0G A;  1K73 C;  3L2U A;  1KD1 U;  2FYK A;  2PUO B;  2GF7 A;  2VC8 A;  3CBO A;  2PVG B;  3SWN C;  4F7U B;  5GAO m;  3OYI A;  3I56 A;  3VU3 C;  4E7I A;  1VQ4 T;  3J7A F;  3VYG A;  2H3J A;  4MZT A;  3LX7 A;  1YJW A;  5KE3 A;  3PNW C;  5LJ3 h;  5KCO A;  5FU7 B;  1XTD A;  4FIB A;  5GAN f;  1ZQ1 A;  2CZ6 B;  4JDS A;  1UGQ B;  1X6O A;  4QQD A;  3J81 E;  3JRZ A;  4RCB A;  2E1H A;  3L1A A;  2EAY A;  1JB0 E;  2HD0 A;  3RMS A;  4DA4 A;  1WJS A;  4GLK A;  2PUK B;  2X4J A;  3V8L A;  3G6E A;  2LDM A;  1VQ5 A;  3X28 B;  1YJ9 T;  1WGS A;  3OBW A;  2DPP B;  4C8Q A;  2L8D A;  5HY6 A;  2P0P A;  4VUB A;  4NL3 A;  2WAC A;  4BI3 A;  3OW2 A;  5GAN 2;  1U1S A;  5KH6 A;  4QVZ A;  5LJ3 f;  3GOX A;  4X9D A;  4M77 B;  5CQX A;  2B8A A;  1D3B B;  2EQM A;  3QZ9 B;  5FU7 C;  4HCB A;  5L8R E;  1M1F A;  3CCS T;  3FDR A;  3CPF A;  4JUV A;  1Q81 U;  5HK0 A;  2EJ9 A;  4C8Q F;  5GAN 4;  2DTH A;  5FLX E;  3JAM E;  3CPW S;  3CCJ T;  1VQ7 T;  4M7D D;  2DTO A;  5IAY A;  4EMK A;  2F69 A;  5GAN 6;  1Q86 U;  3RMQ A;  3JCM h;  4C8Q G;  5GMK e;  3OYA A;  3C4S A;  3CXC S;  4C92 C;  4BAC A;  1M4Z A;  2DIG A;  3P8B B;  5GAN e;  4MDW A;  5EG2 A;  3CCM T;  3A8G B;  4C8Q E;  3JCM c;  3OYM A;  1BKB A;  1KHI A;  5LJ5 h;  1VQP A;  3PMT A;  4M77 C;  3Q1J A;  3URG A;  2EJG A;  1AHJ B;  2YHT A;  3E9G A;  2EQJ A;  4MMK A;  1EIF A;  2Y90 A;  4TVR A;  4BY6 C;  4XU0 A;  4BE1 A;  3TCJ A;  4M75 F;  1VQM T;  1O9S A;  2V8J A;  3X25 B;  2ZCF B;  3QKJ A;  4MZP A;  3OSV A;  3CCU T;  2FB7 A;  2ZPI B;  3QDR B;  3RKW A;  3JCM f;  3MEV A;  3RES A;  2QEX T;  1QVF A;  4PJO D;  4N0A C;  4E47 A;  2PQW A;  1MHN A;  2YLB A;  4RG2 A;  5GAN 8;  3MP6 A;  3CCS A;  5GAM f;  2AHJ B;  4BE2 A;  1ZHI A;  4M75 E;  1VQ7 A;  2HQX A;  4QVD A;  1VUB A;  1M1K U;  3NFC A;  4HT8 A;  1VQN T;  4C92 D;  1JBM A;  5FRN A;  4M78 E;  1YJN T;  3DB4 A;  4LDY A;  2QXF A;  1H3Z A;  2MMP A;  4ZTJ A;  4A4K A;  3PMI A;  3VYH B;  5J3B A;  2XDB A;  2X4Y A;  4M7A B;  1B34 A;  2ZPE B;  2VXE A;  2OTL T;  2EYQ A;  4JRI A;  3ASK A;  2RHZ A;  5GAO r;  2MWP A;  4QQ6 A;  1QVG S;  2E65 A;  5CKH A;  4BI8 B;  2VYT A;  1UGR B;  1WJR A;  2DXC A;  2RM4 A;  2X35 A;  3BW1 A;  3DB3 A;  3H8Z A;  2XIC A;  3KBG A;  3M5A A;  4BD3 A;  4CRI A;  4DQ2 A;  4MZM A;  4FSX A;  2V8I A;  1V29 B;  1VQM A;  2QQ9 A;  3E1S A;  4PLL A;  2KAF A;  4JJN K;  2WSE E;  3CCU A;  2K3Y A;  4R55 A;  1VQL T;  4PNO A;  2QEX A;  2R5A A;  2VXF A;  3VKI A;  3I56 T;  4RKU E;  3FJP A;  4ELY C;  3DKM A;  3V7C A;  4M7A C;  1U1T A;  4P5N A;  1N9S A;  3LW5 E;  2RHI A;  5GAM e;  2RB6 A;  3FEO A;  3G71 T;  3MET A;  4JRP A;  1IRE B;  4C0D C;  4EMG A;  3S3M A;  2A3L A;  3JCM Q;  1YJW T;  5GMK i;  4OB0 B;  3LH0 A;  4EMK C;  2LC4 A;  2CYZ B;  3MEA A;  3QYH B;  5D6W A;  2KDS A;  1UB4 A;  3KUF A;  3M59 A;  5KE2 A;  3DLM A;  1VQO T;  2QTX A;  4IUU A;  4ELZ C;  2EWN A;  2XG8 D;  3L2Q A;  4C5E A;  4M7D F;  5CO7 A;  5LJ5 d;  4LDU A;  3NTH A;  5GMK j;  2OTL A;  4M7D G;  1W2B S;  3O8V A;  2GFU A;  4O6J A;  3ZBD A;  3OYJ A;  3QBY A;  3GNG A;  5GAN j;  3TEE A;  1N8R C;  4CI0 C;  4R56 A;  1M90 C;  3P8D A;  2YLC A;  4XU2 A;  4QVC A;  4M7D E;  4IUV A;  3ZEH A;  4X34 A;  3L2R A;  2CZ1 B;  2LQ8 A;  4OGC A;  3CCJ A;  2JTM A;  3G7Z A;  2L89 A;  2RH2 A;  3HKS A;  4XK8 E;  2KVQ G;  3OYK A;  3JCM J;  3EFR A;  1B34 B;  3V8J A;  4XQ3 A;  2LRQ A;  4XU3 A;  1KQ1 A;  2DKG A;  4IUP A;  5CCA A;  1VQL A;  3GPL A;  4M7A D;  3QXE B;  3C94 A;  4PJO F;  4ZTF A;  5LJ3 j;  2XD0 A;  3RIR A;  2FVU A;  1K8A C;  5HKC A;  4D6W A;  3G71 A;  4RG8 A;  2EKO A;  3E9F A;  2DZC A;  4ME7 A;  1QP2 A;  4LDW A;  3JCM b;  2HNI A;  5GAN 5;  5DLQ E;  2RHU A;  1VQO A;  2QQR A;  2RI5 A;  4C92 F;  1I4K 1;  2DXU A;  4BUG A;  1BI3 A;  1VQP T;  4PJO E;  3MP8 A;  2EFI A;  3QZ5 B;  2LQK A;  4JLG A;  3S6W A;  1IZ6 A;  2R58 A;  1DJ7 B;  1G3W A;  2QDY B;  1NPP A;  2DAQ A;  3EFS A;  4UC4 A;  1KC8 C;  3OMC A;  5A0G A;  1NZ9 A;  1QVP A;  3QG1 A;  3CCL T;  2RJC A;  4FM4 B;  2E64 A;  5GAN 7;  3MEW A;  3JB9 D;  1VQK T;  4ZN3 A;  3M4Y A;  4IUR A;  2VGM A;  4C92 E;  1S72 A;  2F5K A;  3A8H B;  2E5Q A;  4OVA A;  4A4E A;  5CAI A;  3BDU A;  4J6Y A;  4NOY A;  3SD4 A;  2LX9 A;  4LDV A;  3CEY A;  3JB9 H;  2JTF A;  3HRT A;  3RER A;  3CC4 T;  1PSE A;  3WVD B;  2JNG A;  3ME9 A;  1FX7 A;  2G3R A;  1M1G A;  2K5L A;  3QJY A;  5CQY A;  4M75 A;  1YBY A;  5GAM j;  3CC2 T;  1Y71 A;  4Q5W A;  5I2M A;  4JS5 A;  1WNL A;  1JJ2 A;  2DD4 A;  4OB1 B;  1K73 U;  2ZGW A;  4M78 A;  3JCM P;  2MF2 A;  1BI0 A;  3CCE T;  3JCM V;  4C5H A;  1WQ7 A;  1HK9 A;  2D0Q B;  5DLO A;  1XNI A;  3LGL A;  3I55 T;  3HPW A;  2PVO B;  3RUX A;  3HRU A;  1BIA A;  3JCM X;  2KY9 A;  3OA6 A;  1VQN A;  1P92 A;  1VQK A;  1YIJ A;  2OTJ T;  3QHS A;  3ZFJ A;  2XDD A;  2KSS A;  3CCV A;  1Q82 C;  3OW2 S;  2LVM A;  3OS5 A;  5D6X A;  5GMK m;  4M78 F;  5LJ3 e;  3GNF B;  4M75 G;  3A8O B;  3OYE A;  4J7I A;  5LL6 S;  2DVE A;  4X9C A;  4E7K A;  2O01 E;  1VIE A;  4OMF B;  5LJ5 f;  4C8Q B;  2KMT A;  1RL2 A;  5I21 A;  3CC4 A;  2EQK A;  2LT1 A;  2E12 A;  2M9U A;  3GF5 A;  4IUQ A;  4M78 G;  1S72 T;  1Q7Y C;  4FT2 A;  2LNV A;  4BI4 A;  3CCQ A;  3QYG B;  4ZGD B;  2M0O A;  1VQ6 A;  5GMK l;  5DM7 R;  4IKF A;  5C6S A;  2Y4X A;  5IN1 A;  4PKC C;  3CC2 A;  2LT4 A;  2BUD A;  5CIU A;  4M77 D;  5FRM A;  4FT4 A;  4J6W A;  5GAN g;  2K3X A;  2NLU A;  3OSS C;  4FL6 A;  3CMA A;  2XDP A;  1MGQ A;  2DTI A;  3CC7 T;  3CCE A;  1UGS B;  2I2L A;  4KUL A;  3ER0 A;  3RKX A;  3V7S A;  1KQS A;  3I55 A;  4KBM B;  4C8Q C;  4M75 B;  4DOV A;  3G4S T;  4C0F A;  1I8F A;  2FL7 A;  3JB9 F;  2CZ7 B;  2OTJ A;  4Z02 A;  1BYM A;  1G5V A;  2X4X A;  4M7D A;  2PU9 B;  4JLI A;  3FRN A;  3OYD A;  3JCM e;  4LD6 A;  3OYY A;  2L3R A;  3X26 B;  1KD1 C;  2ZPG B;  5LJ3 g;  3JB9 G;  1VQ9 A;  3LGF A;  3PGG A;  1QVF S;  2RHY A;  4L6V 5;  2RHX A;  3V7R A;  4OB3 B;  1N6A A;  2IVW A;  1W2B A;  2RD1 A;  4J5Y A;  1ZBX A;  2K5I A;  2XI9 A;  3L2Z A;  3OB9 A;  4Y91 A;  5LJ5 e;  2K57 A;  5CK9 A;  1WPY A;  2WSC E;  2BKD N;  3M54 A;  3KXT A;  2O4X A;  2RJF A;  4XTW A;  2DO3 A;  2VUB A;  4F7U A;  3DLL A;  4M75 C;  1X75 C;  2EQU A;  5A2Q E;  1OYX A;  2RI2 A;  1Q82 U;  1K9M C;  3UDC A;  2D9T A;  3UPU A;  3QJ6 A;  4ZGE B;  3E19 A;  4ZGJ B;  4EDU A;  4N4I A;  3CC7 A;  2IG0 A;  1O75 A;  3JSC A;  4C8Q D;  2VV5 A;  3A8L B;  4PJO A;  4O5V A;  4II1 A;  3X20 B;  4MDX A;  2JZ2 A;  4E7H A;  5CKD A;  5FU6 B;  2CS7 A;  3LWI A;  4F7U F;  3G4S A;  2DEQ A;  3PTA A;  1YI2 A;  4OB2 B;  5A0D A;  1VQ8 A;  1UEB A;  2PVD B;  1XOV A;  5J26 A;  2DD5 A;  2ZZD A;  2GCX A;  1M5Q 1;  2V8K A;  4N4G A;  3JB9 J;  4C92 A;  4F7U G;  1YHQ T;  3GIB A;  4A53 A;  2DXB A;  3JCM g;  2VGN A;  1H64 1;  3L2W A;  2ZPF B;  4JS4 A;  4F7U E;  2HBP A;  2LCC A;  4EPC A;  3S3O A;  3CD6 T;  3QO3 A;  2EIF A;  3SFM A;  3MCA B;  3C95 A;  5GAM g;  1R8O B;  4PJO G;  1M9S A;  1Y7X A;  2GFA A;  4PLI A;  3OYF A;  4M7D B;  5GMK h;  4BDZ A;  5AYF A;  4KUD K;  5J39 A;  2E6Z A;  5CKF A;  3CME T;  2QA4 T;  5GAN h;  3FLG A;  4E7J A;  2QQS A;  3HHT B;  2F5T X;  3MHX A;  4L59 A;  1TH7 A;  3NTK A;  3R6O A;  5C0M A;  4LDX A;  1WQW A;  3QPH A;  4N0A A;  2A7Y A;  2E70 A;  4M77 F;  5FRO A;  4A4H A;  3WXM B;  4C92 G;  4HCC A;  4HT9 A;  1N27 A;  1QW1 A;  3CPW A;  5I2S A;  4XTX A;  1YIJ T;  2O4X B;  2LCL A;  3HP9 A;  2HQE A;  4M77 G;  1KG1 A;  3CCV T;  2DIQ A;  3LYI A;  2EJF A;  4HCZ A;  3AHU A;  3CXC A;  4M7D C;  1XQH A;  4M77 E;  5D6Y A;  1G3S A;  1K9M U;  4BE0 A;  5CKE A;  4PJO B;  1YHQ A;  4OP0 A;  1LJO A;  1OI1 A;  3OS2 A;  5GAO l;  5GAN 3;  2L5Q A;  4BB7 A;  3CCQ T;  1N8R U;  1M90 U;  3HSB A;  3CD6 A;  4B9X A;  1VQ6 T;  2YRV A;  1M1K C;  2JOY A;  2K5F A;  4PL6 A;  3VV0 A;  4N4H A;  5A0L A;  4MML A;  3L2V A;  1W4S A;  5LJ5 j;  3OBY A;  3CCR T;  4RCC A;  1JRI A;  4QQG A;  3M58 A;  4C92 B;  3M9Q A;  3WVE B;  1OZ2 A;  2FHD A;  2JVV A;  4RMO A;  3CME A;  2QA4 A;  3M53 A;  1YIT T;  2P0K A;  3VJP A;  3CMA T;  3BDL A;  1Y96 A;  3BFM A;  1YCY A;  4JRK A;  4C5G A;  3T9N A;  3UT1 A;  2RJE A;  2MWO A;  3EAE A;  2DJZ A;  4PJO C;  3BY7 A;  4BY6 B;  4M7A A;  3JCM W;  3VUB A;  3GLX A;  3C12 A;  1K8A U;  2KQW A;  1U8R A;  3HRS A;  2ZPB B;  1NJI C;  1I5L A;  4J7F A;  4C0Z A;  4OGE A;  1Y07 A;  2E10 A;  2X4W A;  3SB2 A;  3S3N A;  1GXI E;  1VQ4 A;  3M55 A;  4FU6 A;  4J6X A;  3J80 E;  4XAX B;  2WSF E;  2XKO C;  2C06 A;  1VQ9 T;  2RJD A;  3HFO A;  3QII A;  5CVI A;  2DZ9 A;  2MI6 A;  3NTI A;  4NL2 A;  3VUZ A;  3OYH A;  1NPR A;  2M16 A;  4DOW A;  4M7A F;  4QW2 A;  1QVG A;  5GAM h;  1KC8 U;  2K4Y A;  2JN0 A;  2XHC A;  3OS1 A;  4A4G A;  5CKB A;  3GP8 A;  1FWZ A;  4GY5 A;  3CCR A;  4M7A G;  3CBP A;  1KQ2 A;  1X01 A;  5GAN d;  3FC3 A;  1SSF A;  2CKK A;  4HKE A;  4XU1 A;  4M7A E;  1JJ2 S;  2DK3 A;  1YIT A;  3TRE A;  2HAX A;  3A8M B;  1OZ3 A;  2QQB A;  3SDZ A;  2KK4 A;  4XTY A;  3CBM A;  4KT0 E;  2Y4Y A;  1LOJ A;  3SWN A;  3TU4 K;  5GAO n;  4ZN1 A;  1RI0 A;  2RI3 A;  3V8K A;  5M9O A;  2RK1 A;  1YI2 T;  1VQ8 T;  1VIF A;  2XID A;  3OYC A;  4V2S A;  3FB9 A;  4XTZ A;  4WF2 A;  3H6Z A;  4C5I A;  2BIV A;  3OYG A;  1HXD A;  4IUT A;  4M78 B;  4Y28 E;  4EMH A;  4LD9 K;  1M8V A;  5LJ3 d;  4J8O A;  1Y96 B;  3JB9 I;  3MEU A;  4BDY A;  3M4G A;  3CCM A;  4EMK B;  4A4F A;  3PFS A;  2XK0 A;  1LNX A;  4C0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...