2QA4Q

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 2qa4Q00
3CCUQ 3CC7Q 1YJ9Q 2QEXQ 1VQMQ 1Q82R 3I55Q 1YJNQ 1K9MR 1VQ4Q 2QA4Q 3G4SQ 2OTJQ 1YI2Q 1YIJQ 1KC8R 1KD1R 1KQSP 1W2BP 1VQPQ 1VQ7Q 1M90R 3CMAQ 3CCRQ 3CCJQ 1VQKQ 3CCEQ 1QVFP 3CCQQ 3CPWP 1K8AR 1JJ2P 3I56Q 1YJWQ 3CMEQ 3CCVQ 1K73R 3G71Q 3CCMQ 1YITQ 1VQ9Q 3CCSQ 1NJIR 3CC4Q 1VQLQ 3CD6Q 1VQNQ 1M1KR 3G6EQ 1VQ6Q 1Q86R 1Q81R 1VQ5Q 2OTLQ 1S72Q 1YHQQ 1Q7YR 3CC2Q 3CCLQ 1VQ8Q 1QVGP 3CXCP 1N8RR 1VQOQ 3OW2P
chains in the Genus database with same CATH superfamily
1VQ5A 2RM4A 1K0XA 4EPCA 1M2VA 1SF9A 4YTLA 4KH1B 1Y57A 1B34B 2DL5A 4NS5A 4C0DC 2XKOC 4OGCA 2DKGA 2AZSA 5I11A 3EG2A 2BE7D 2XIDA 5GAMf 4M75A 4N0AC 3CCRA 3EGDA 3QSUA 5HK3A 1X43A 2EQKA 4C8QA 1K9MU 1BI0A 1KC8U 2YUPA 3AT1B 1G3WA 1M3BA 2E3HA 2JMAA 4PJJA 2QDLA 4LUDA 2DFUA 4ZGEB 5GAMj 5C0MA 4HVUA 4JUVA 2DXTA 3UDCA 4Y28E 2FPFA 1UHCA 2JM9A 3GIBA 3LX7A 2JT4A 5FWBA 1FMVA 3VU3C 3KBGA 5I22A 2VC8A 1GCQC 2V1RA 1NLOC 2P0QA 2L2PA 1PD0A 4HVWA 3G71A 5FWCA 4C92F 2EQJA 1BKBA 5GANf 2ED0A 5DLQE 1ZBJA 2HSEB 1W2BP 4XQ3A 4J9BA 4C5EA 3M55A 2HAXA 2RHZA 3OS5A 1RLPC 4WF2A 3QO3A 3V7CA 2DD4A 4J9GA 1U5SA 1MHNA 3QZ5B 3I9QA 2XI9A 1PM3A 4F16A 4QKUA 1CKAA 1ZA1B 2GGRA 2X51A 2QEXQ 4PNOA 4J83A 3C12A 4RTZA 1ARKA 2K5FA 3G1JA 1N9RA 3CCET 1E6HA 2LQWA 2M0OA 3CPWP 3MEVA 3JB9F 3VV0A 2NUPB 5D6WA 1PC0A 2DIGA 3RKXA 3EH1A 2CP3A 2OTLT 1OZ2A 3NHNA 3D7SB 1AZEA 4RCBA 2EYYA 3VRZA 1VQ7Q 4BB7A 2COWA 4C5HA 3SWNB 1Q86U 1AT1B 2AIRB 1OEBA 3URGA 1WXTA 1WHGA 3EGUA 3EHQA 1ZHIA 3M56A 5IHIA 3LH0A 3MEWA 4HVVA 2DIQA 1C0MA 3UF4A 1Z9ZA 4A4KA 5FU7B 1YFNA 2NWMA 1K73C 4M77E 1JO8A 5IAYA 2A28A 2JTEA 3CCJQ 3JCMP 2HCKA 2JS2A 3CXCA 4RG8A 5M9OA 2NLUA 3OYJA 3CCMT 4M7DC 4Z89A 2PVOB 1Q82C 1YHQQ 3NPFA 2V8JA 3PNWC 1TU0B 2EJGA 2EYQA 1ZLMA 3H41A 2QK0A 3INZA 1G3TA 1T3SA 3JCMW 2L3QA 3OQ5A 2P4TA 4M7DD 3CCQQ 3LGLA 4PLIA 2I2LA 4F7UB 8AT1B 1UECA 2GQIA 5IT9E 3JCMe 1VQ9T 1NJIU 1S72Q 4BI3A 1B34A 1M3AA 1PSEA 3PVQA 1SPKA 1AWJA 1NEBA 2QA4Q 1BBZA 3ULRB 2OTJT 1PWTA 1YI2T 4QQDA 5J3BA 3CPFA 1G83A 2E6ZA 1G5VA 2C0TA 2MOXA 1YIJA 2L0AA 2ZZDA 4VUBA 4XU0A 4IURA 3CMEQ 4XTVA 4N4IA 1RL2A 3S6WA 1AZGB 3EHRA 4M75G 3I56A 4IKFA 2YWWA 1JBMA 4NL3A 3CCSA 5A2QE 4FT2A 1TTHB 4C8QG 2PNIA 5GAN8 2CH4A 4J6WA 4ZN1A 2WSEE 3G4ST 3PT9A 1O9SA 3RR6A 2JS0A 1UJYA 5FU7C 4BDZA 5LJ3g 3Q1JA 1K73R 3META 3CCVQ 3L2RA 3E9FA 1Q7YU 2OAUA 3V8LA 4FYVB 2E5KA 2FVUA 4RTYA 4LDWA 2RPNA 3CCUQ 1Q82R 2HKQB 1YWOA 2FL7A 1TS9A 1RUWA 1YNZA 2HDAA 3CMAT 5LJ3d 1PG5B 2KAFA 5D7UA 4JZ3A 3LLRA 4X9CA 4OMFB 2JUFA 2MYSA 3PMTA 3ASKA 1VQ6Q 3UT1A 3OYMA 2AT1B 2LT1A 2O2OA 2IVWA 4Y92A 1VQ8T 4PJLA 2MI6A 1VQMT 2HEQA 2XICA 4PJOB 3J7AF 3M54A 2LNVA 4XTXA 3JCMX 2MWPA 2NUPA 3VS6A 1K8AR 4QVZA 2HSPA 1WXBA 4OB1B 5LJ5g 2VXFA 2K6DA 2D9TA 3UA7A 3EG9B 1RAFB 4L59A 3VS7A 1JB0E 4RKUE 4DBHA 3M4YA 3M9QA 4J6XA 2DYIA 2KI7A 4CC2A 2DZ9A 1KG1A 2JNGA 1NYFA 2B8AA 3SWNA 2RK2A 2XK0A 3RDVA 1QCFA 1BCOA 5LJ5d 4PJMA 1X2KA 2EBPA 2MAMA 5KYNA 4FU6A 2K57A 1BI1A 2DK3A 1VQ5T 3VJPA 1KFZA 1KHCA 4MZMA 3FDRA 4E47A 1WJRA 1X69A 1VQ4T 2KXCA 1W1FA 1I5LA 2GFAA 3CBOA 2YXYA 5ECAA 2H8HA 2P0KA 3CCRT 1PSFA 1ZX6A 3DB4A 1BI3A 3VS3A 4M7AE 4XU2A 4JS5A 3PIPA 3VS4A 3CCEA 2EW3A 3HTRA 4L6V5 1YCSB 4M78B 2E4HA 2RJCA 4FCYA 3UATA 1TUDA 4Q5WA 5GMKm 3GOXA 1WQ7A 1TG0A 2ABLA 2XHCA 1EIFA 2OJ2A 1NEGA 1U3OA 1OYXA 4F7UA 3VKIA 3OW2S 3A8MB 2LQNA 3G71Q 4BE2A 1OPLA 1WIEA 2HBPA 3JCMf 2DX1A 1LVKA 2VUBA 3E2UA 4C92C 2NUZA 5DY9A 1OZ3A 1I5OB 3X20B 2YUQA 2DETA 3SD4A 5J26A 2K2VA 3A5ZB 1YCYA 4J7IA 3QDRB 1M1KU 1IO6A 2VGMA 5CR2A 1JU5C 1M1GA 4JJCA 3CC4T 4ELZC 4C92D 2RK1A 4M75B 1H8KA 3EFSA 2K3BA 5GAOm 2LZ6B 3EGXB 4Y91A 1VQOT 3L1AA 4MZTA 4C8QE 1IHWA 2FPDA 2DTOA 1GBQA 1KQ1A 3O8VA 5CO7A 1RAHB 2QQSA 4J9DA 2CZ6B 1QQJA 5FROA 1D1BA 4ELYC 1U1SA 2V1QA 4C0GA 1KD1C 4RTTA 5GANe 1PD1A 2RHIA 1I4K1 3JB9D 2HZYA 2YSQA 4EDUA 5IXBA 2OTJA 2A36A 2YLCA 2LDMA 4F17A 3LWIA 5LJ3h 5DLOA 2OAWA 1YWPA 2P0PA 1N9SA 1OU8A 2E1HA 4ME7A 1VIEA 2J6FA 5CCAA 2O01E 2ZCFB 4DBFA 2RD1A 3RESA 1SSHA 3REAB 4MDXA 4PJOA 3I5SA 1YJNT 1UGVA 4J9CA 2RI3A 2BZ8A 3EFRA 4XTZA 2EYWA 3U23A 5FRNA 3G4SA 4C92A 3TU4K 2M0YA 2DBMA 3JV3A 2JZ2A 3EG9A 4JRIA 2DL8A 3ER0A 4F14A 3OYHA 2F2VA 3G6EQ 4ZTFA 4C0DB 1G3SA 1MV3A 9ATCB 1I1JA 3PE0A 3NFCA 3CC7T 4KRTA 3THKA 3MJXA 3P8HA 1G2BA 3QPHA 2BUDA 4M77F 1D3BA 1OQKA 3NTKA 1R0CB 5LJ5h 1UJ0A 2BE9B 4WTOB 2R57A 4E7LA 5CKDA 5GAMg 1QVFA 1UGPB 4CRIA 4ESRA 1JJ2S 5I21A 2E64A 2EJ9A 1KD1R 4PFPA 2R58A 2K9GA 2KMTA 3A1PA 4P5NA 2FO0A 2KE9A 4J9HA 2LJ1A 2COZA 2VGNA 3I56T 3TREA 3GBQA 3UA6A 3SEMA 4DA4A 2EAYA 3CCST 1X01A 1ZBXA 1M3CA 1Y96B 4M78A 4LE9A 1WJQA 3BDUA 5GAMd 3QKJA 4B9XA 1TWBA 3R6OA 1SEMA 4FL6A 1UGQB 4N4GA 5IHKA 2K79A 1YJ9Q 4O6JA 1R0BG 2GCXA 1K4US 1WPYA 4N4HA 5FU6B 2CH4W 4J5YA 4V2SA 1G8XA 3JB9H 2XU8A 4F7UG 1AD5A 2DE0X 4J9IA 1P92A 1MV0B 2BIVA 2C0OA 1M9SA 5GJWB 4RTXA 1VQ4A 3HFNA 2LMJA 1T0HA 1YJWQ 2F2XA 1AEYA 2L8DA 2EPDA 3AHUA 2D0NA 1IRXA 3EGXA 1NLPC 2O4XA 5GMKh 4HT9A 3OSSC 4UC4A 1IGUA 4CC7A 1H641 3VS1A 3JB9I 2DYBA 5KE3A 5GMKl 1R77A 4GY5A 2PVDB 1MMAA 1RAEB 4BY6B 5CQXA 4II1A 1CKBA 3E9GA 4HKEA 4E7HA 3S3MA 1U8RA 3M58A 3NTIA 2DL4A 1QVFS 2HD0A 2F2WA 2VASA 2O31A 2A0FB 8ATCB 2H3EB 3E19A 4XAXB 2LNHB 4AFZC 1LJOA 1K73U 1M4ZA 2QQRA 2KT8A 4M7DB 2QXFA 2LX9A 2RQRA 2PZ1A 5GANj 1N8RC 5FU6C 2WACA 3QG1A 2DL7A 1Q81R 3ZFJA 1AOJA 1YITA 1UHFA 1A0NB 3H0HA 1N6AA 2CZ0B 3CC4A 5GAOl 1M27C 1M90U 1FMKA 2DXUA 2MMPA 5CKFA 4PJOG 1VQOA 2K7AA 1V76A 3PTAA 4QQ6A 3FC3A 3KXTA 5GAN2 1WHKA 4IUQA 2K5IA 2EYZA 2P4RA 5AYFA 4C92G 4KGVB 2YRDA 2OTLQ 5HK0A 1NM7A 1RADB 3PGGA 1LCKA 1MMGA 2V8IA 4N0AA 3ZEHA 4A54A 1K8AU 3DLMA 1KK7A 2Z0WA 3OYYA 1XNIA 2B86A 1VQPA 4CC4B 2CYZB 4RMOA 2LT4A 3OBWA 2DF6A 2FB7A 4M7AF 1X75C 2EGEA 1AVZC 4BY6C 3HRSA 1SHFA 2BKDN 3MCAB 1TOVA 5GAN6 4QVDA 1PKSA 3I55T 2RO0A 1BIAA 3PVLA 3RERA 5KE2A 1GCQA 1QVGS 1AWWA 1YJNA 2D8JA 2GTOA 3CCMQ 3GF5A 4HCKA 4DBQA 2QDYB 3JCMQ 1GXIE 1Y96A 2K2MA 2E10A 4DEXA 4CC3A 5KCOA 4BE0A 1HYOA 3OYAA 1RAGB 4OB0B 4M78G 2YRCA 1HK9A 4ORZA 1HSQA 5GAMh 2H3JA 1QP3A 4E7IA 2RJFA 2KY9A 3JAME 2DTIA 2JM8A 3OBYA 2A08A 1XQHA 1XTDA 4OB2B 2ZPIB 4L5GA 3CC7A 3CCJT 3X26B 1X6GA 1VQ9Q 2COYA 1WX6A 4JPBW 1NPRA 2RN8A 4F7UE 1C6VX 2FHDA 2RHYA 1UDLA 3VYHB 2X9HA 4HCZA 2C06A 5A0GA 2OTJQ 1OX8A 1YI2Q 3L42A 2CKKA 3A8OB 3UPUA 4C8QF 7AT1B 5KYWB 1JXMA 4ATOA 3CCQT 4EMGA 2CS7A 4JRQA 5HY6A 1IREB 3UWNA 2BTTA 2KDSA 4B9WA 4KGZB 4OVAA 1WI7A 2CZ1B 2D0QB 2LCLA 4TVRA 1PKTA 3OMGA 3PIOA 1MNDA 3KUFA 2HBWA 1RAAB 4FYWB 1T3LA 2M51A 2QA4T 2FZGB 1U1TA 3TVTA 2FG0A 4FSSA 4OB3B 2DEUA 3CMET 1G3YA 3I35A 2VYTA 4HXJA 1VQNQ 1LNXA 5AT1B 2RQTA 2CZ7B 1ZSGA 2PVGB 2YLBA 2E12A 4AG2C 3X25B 5GMKi 2F69A 3WXMB 4A63B 1VA7A 2FZCB 1H92A 3CC2A 2CT4A 4JZ4A 4D8DA 4M7DA 5GAOr 1WYXA 1GL5A 3CMAQ 1QVFP 2CGHA 3RMQA 4OP0A 4M77C 3OW2A 1M1FA 4RTVA 3VUZA 2MF2A 3CD6A 1SG5A 4DOWA 3OS2A 1VQ8Q 2ZPFB 4KT0E 3CCUT 1VQMQ 4JJDA 4M77D 4EMHA 2E3IA 1WDXA 2K3YA 4PJOE 4D8KA 2RF0A 3QJYA 1WJSA 4JJNK 4RTUA 2V8KA 4C92B 1VQLQ 5GAOn 1JXOA 3NTHA 1VQ6T 4J8OA 3V8KA 4ANJA 1X6OA 4OMOA 4JS4A 3GLXA 2EQUA 1VIFA 2ZPEB 2DL3A 2YHTA 3JCMg 1D09B 3OYCA 1OOTA 2KQWA 4EMKC 2ZPBB 2VVKA 3CEYA 2VWFA 4MMKA 5GAN7 2DJQA 4PLLA 2X3WD 3X28B 2F5KA 4FYYB 5IXFA 1D3BB 4J6YA 4LDVA 5D6XA 4KUIA 2RNAA 1VQ5Q 4NL2A 3JSCA 3RUXA 2O9VA 1ZUYA 2KRMA 1PNJA 3C0CA 2RA2A 1D0ZA 5LJ3f 1QP2A 4J9EA 3CCRQ 1D0XA 1MMDA 1KQ2A 1Q7YC 1XOVA 3EFOB 4R0KA 3C94A 3GNFB 1KD1U 4LDXA 2XDBA 1K76A 4M78E 5I2SA 5KYUA 3X24B 1K0SA 1NZ9A 3BW1A 3C4SA 4LXCA 4M4ZA 1VQKT 3HRUA 1FMWA 1ACMB 3L2ZA 3A8GB 3HKSA 2GF7A 1TUCA 4PFOA 2J06A 3HL8A 4BUGA 2ATCB 1MGQA 3BDLA 2VXEA 3ZL7C 1UB4A 5KYWA 5CKBA 4Z88A 3I55A 4KUDK 1VQ7A 1YITT 3CC4Q 1M30A 4XTYA 1D0YA 4RUGA 4OMNA 3V7RA 3EG3A 2EWNA 4M75E 4KBMB 2X4WA 3M0RA 1JJ2A 1NPPA 3LW5E 3OYFA 2O4XB 2CREA 2LVMA 2DVJA 1UEBA 2JJ9A 3JB9J 4FW2A 2YUOA 1FXXA 3OYNA 3M0QA 3CCJA 4LDUA 3OSVA 2DVEA 1Y7XA 2X4XA 1Q7YR 2MPXC 2XG8D 2RI2A 3M59A 1RLQC 2OI3A 3MP6A 3CBPA 1WHHA 1YHQA 2LJ3A 2WSFE 1WHLA 2JN0A 2MWOA 3PMIA 4M7DG 4D6WA 1BB9A 1F1BB 1VQPT 4ZTJA 4OMPA 4F04B 4KH0B 2QGGA 3EH2A 2ENMA 4DQ2A 2KBTA 2E6NA 3QIIA 2XDDA 1X2QA 3FRNA 3CCQA 4M7AC 3MP1A 1W2BS 2ROLA 3N5BB 2KT1A 3VS0A 1RABB 3S3OA 1S72A 3TSZA 1YJNQ 1VYUA 2LRQA 1B07A 3MKDA 4LDYA 1M5Q1 1WQWA 3QZ9B 3VYGA 2QA4A 1Q81U 2G6FX 4M7AD 3TSWA 5D6YA 4KGXB 1RI0A 3FLGA 2VB6A 4RTWA 2BZYA 4A53A 1IB8A 1DJ7B 2Y90A 3CMEA 1Y0MA 3A8LB 5CAIA 3WVDB 3CPWS 3CCLT 1CSKA 1WGSA 3CC7Q 1QW1A 2CT3A 3FJPA 2EKHA 3G7ZA 3P8DA 1M1KC 4IIMA 5KH6A 2FYKA 4IUPA 3OYBA 3L2UA 3ZBDA 2W10A 2DRMA 4JJBA 3L2QA 2QQBA 2RQUA 1KQSA 4IUVA 3CCVA 4IUUA 2RQWA 2DXBA 3H8ZA 1GRIA 1RI9A 1M8MA 3P8BB 3JCMh 4AFQC 1WNLA 1YIJQ 1U06A 3LWHA 2KK4A 4C8QC 3L2WA 3CCUA 2I0NA 2CP5A 2EGAA 2MIOA 3OYEA 2G3RA 1NE8A 1X6BA 4ZGDB 3OYLA 1Y71A 3I56Q 1W70A 3HPWA 3EFOA 2SRCA 3CCSQ 4AFSC 2DNUA 3R6NA 2BZXA 1BCMA 3MP8A 4F7UF 1E7OA 5GAOq 2CP7A 3GPLA 1VQ6A 4GLKA 4C8QD 2RI5A 2M1HA 1WHMA 4M7AA 2RMOA 1ZSZB 5GANg 4J9FA 1GCPA 2FRWA 3H6ZA 1VOMA 1Q95G 2EJFA 1UFFA 4MMLA 4C0FA 2M02A 5EC7A 3CC2T 3OW2P 3H0FA 1YJ9T 3TEEA 3HRTA 4JDSA 2PUOB 2X4JA 3QDFA 1QVPA 3QHSA 5IN1A 5GANd 3MHXA 3HSBA 2CP2A 1IZ6A 3GP8A 3CD6T 1EZZB 1UGSB 1WXUA 2ECZA 2RQVA 2KYMA 2ED1A 4QT7A 2ESWA 1GFCA 1J3TA 5KYYA 2JVVA 1EFNA 5J39A 3RIRA 3DKMA 1IXDA 3QWXX 1JQQA 3EG1A 1QVGA 3VS5A 1YJWT 4IUTA 5HKCA 3QUIA 1FWZA 2RHUA 3GNGA 2YDLA 1VQKA 2LQKA 1KQSS 2GFUA 3FIFA 4HA8A 2PUKB 3OYDA 3HHTB 1OPKA 4BI8B 4E7ZA 2HL3A 1M2OA 1M8VA 3H9NA 2L89A 4IIOA 5A0DA 5I2MA 2D8HA 1HJDA 1QLYA 4M7DE 4HT8A 4PJOF 3O5ZA 2DRKA 3HP9A 1ZSZC 2JXBA 3NGPA 3MPUB 2D6FA 1H3HA 2IPOB 1Q82U 5L8RE 2EYXA 3M0SA 2MCNA 2FRYA 1BK2A 2LP5A 3OYKA 1QCOA 4JRKA 2E41A 1AHJB 2QTVA 2YRVA 1AWXA 2PU9B 2EFIA 1MNEA 4J7FA 3CCEQ 1ABOA 1V29B 2ZPHB 4JLIA 1Z9QA 4R55A 1E6GA 2NYSA 2C0IA 1JEGA 4FYXB 1MUZA 1B3QA 2HQEA 1N27A 5L23A 5GAN5 5FRMA 2QEXT 4DBRA 4Z8AA 1LOJA 2AKKA 4HCCA 4XTWA 2F5TX 2J7IA 1PRMC 4A4FA 5FLXE 3V8JA 4PJNA 1VUBA 1W4SA 2E65A 2ZGWA 2CDTA 5LL6S 1YP5A 1K9MC 3OMCA 1KC8C 1QMCA 2A37A 5GAN4 3I55Q 2HNIA 3KFVA 5LJ3e 5CK9A 3JB9G 1ZA2B 4M78F 2KSSA 2DD5A 2FZKB 1VQ7T 4GBQA 2PQWA 1JJ2P 4BI4A 1Y07A 4JRPA 3SDZA 5CQYA 2EQIA 5A0LA 2RJEA 1K9AA 4E7JA 1QWEA 4E6RA 2YUNA 1N8RR 5KCHA 4M77B 1YN8A 2PTKA 1ZSZA 3CCLA 4PK4A 2DJZA 5KYUB 4M7AG 3CQTA 1C1AA 2DLPA 2X4YA 2Y4XA 2EQMA 1NBEB 2QASA 2DPPB 1YHQT 3G6EA 1V1CA 1M90C 1PHTA 4DEYA 4M75F 3C95A 3M5AA 4OF1A 2A7YA 3DB3A 5LJ5e 1OX9A 5IHNA 2XDPA 2QGFB 1R8OB 2DXCA 2MK5A 5GANh 1BIBA 2E70A 1GFDA 1OU9A 2E5QA 4EMKB 3QYGB 5KYXB 1S72T 1W6XA 2DMOA 3OYIA 1XJWB 1TUGB 2XD0A 2DBKA 1K8AC 1K9MR 3G4SQ 1KC8R 4OMMA 2O9SA 2RB6A 1JRIA 3RKYA 3TCJA 1IHVA 2WSCE 1VYTA 3S3NA 1Q86C 1S1NA 4C5IA 2CP6A 3SWNC 1QKWA 4A4EA 1PRLC 1D1CA 3J81E 1UUEA 1SHGA 4K11A 3H0IA 1AWOA 2SEMA 5EG2A 1KQSP 3VUBA 3OB9A 1GBRA 2QAZA 3M0PA 1YJ9A 2RH2A 4PKCC 2J6KA 2EKOA 2DM1A 2O88A 4EIKA 2DZCA 3NMZC 2D1XA 1MMNA 3CCVT 2L3PA 1VQNT 4PL6A 3RNJA 4A4GA 4XK8E 2KYBA 1SRLA 4LD9K 4AG1C 3OYGA 2OX7A 1TH7A 4QVCA 2HL5C 2KXDA 1YBYA 3EAEA 4OMLA 5FW9A 2GNCA 3JCMV 3T9NA 1EX4A 2W0ZA 2NUTB 1M90R 2LCSA 4C0ZA 3IQLA 5GMKe 1KHIA 3CXCS 1SSFA 4X9DA 2FPEA 4E7KA 3M57A 5CKEA 2HQXA 1NJIC 3RMSA 3WVEB 4C92E 1YJWA 4LUEA 4DOVA 3LH5A 3MEUA 4AMCA 2RHXA 4A4HA 2HQHA 4RCCA 4X1VA 2KVQG 3JCMc 4ZN3A 1VQLT 5GAOp 1RAIB 1Q86R 2QQAA 3HFOA 5GJVB 2K4YA 2DEQA 1WZOA 2LTOA 3J80E 4BDYA 3JCMd 4C5GA 3MEAA 1RACB 4CI0C 3JCMJ 4WCIA 1VQ4Q 2QG9B 3FB9A 3OS0A 3QYHB 4FIBA 5HCKA 1O75A 4PFZA 2AHJB 3CBMA 3FJ5A 1N5ZA 3I5RA 5LJ3j 4BD3A 5CIUA 3TQ7P 1W2BA 5CVIA 3LGFA 1QVGP 2DA9A 2QYZA 4GLMA 3M53A 1T0JA 4M77A 3M0UA 2GQVA 1TSFA 2KR3A 2DILA 4FT4A 1UTIA 1WFWA 4LN2A 2EGCA 1VQKQ 4M7AB 2QEXA 1BU1A 1X27A 2AKLA 4FM4B 2L3SA 1IGQA 2J05A 2RJDA 1ZUKA 1NG2A 1BI2A 3BY7A 1HD3A 1TXQA 2LX7A 3CPWA 4Z02A 1NJIR 1VYVA 1UG1A 2OTLA 3QXEB 1ZUUA 2LC4A 3BE3A 2LJ0A 2EVRA 4QW2A 5LJ5f 2LCCA 3BFMA 2QI2A 2GTJA 2CSQA 1YITQ 1WA7A 3SFMA 4PJOC 4EMKA 3G71T 1WHJA 5KYXA 5LJ5j 1UGRB 2AK5A 4ZGJB 4E7SA 2KRNA 2F1LA 3SHWA 1WLPB 2J6OA 1I07A 1VQOQ 4MDWA 4HCBA 2A3LA 4AT1B 1H3ZA 4LNPA 1M2VB 5KYYB 2P84A 2IIMA 2JTFA 3SB2A 2CP0A 4PJOD 1OULA 3M0TA 2JMCA 2CSIA 2DTHA 5GAMe 4X34A 4M7DF 4BE1A 5DM7R 1I8FA 1SRMA 1FX7A 3CCMA 1ABQA 3EGDB 3F70A 3L2VA 4C8QB 3M4GA 1K1ZA 2KGTA 2K5LA 1VQPQ 2V26A 4O5VA 2DERA 4NOYA 6AT1B 1UE9A 3OY9A 1KIKA 3OA6A 3JRZA 4E2FB 1NYGA 2KEAA 2KROA 2FEIA 3LYIA 1VQ9A 4JLGA 5CKHA 3FEOA 2IG0A 1HXDA 4MZPA 2K3XA 2X3XD 2ZPGB 2NUTA 4M78C 1PCXA 2XMFA 2L5QA 4FW1A 2M9UA 1YI2A 2GBQA 4XU3A 1QCNA 4XTUA 3DLLA 4RG2A 2ZAEA 1LPLA 3CCLQ 1BYMA 3CXCP 2HMAA 5GMKj 4M78D 2X35A 1B7TA 1OV3A 3A8HB 2JTMA 2EIFA 4KULA 3QBYA 2Y4YA 2KNBB 3V7SA 3E1SA 5C6SA 4BACA 2VKNA 3G6ET 2DO3A 4B6MA 5GAN3 3REBB 1VQNA 1D1AA 2LQ8A 2QTXA 2YT6A 2HKNA 4M75C 4XU1A 2DAQA 1QWFA 2ROTA 3QWYA 3MO8A 3RBBB 3CMAA 2VV5A 3QJ6A 1I81A 3VS2A 3EG0A 4M75D 3VRYA 2JW4A 2R5MA 2R5AA 2CUBA 1I0CA 4M77G 1ZQ1A 1YIJT 1VQ8A 4LD6A 1VQMA 4ZNXA 3ME9A 2JOYA 3JCMb 1N8RU 1FYNA 4R56A 1OI1A 5IH2A 3RKWA 3CC2Q 1VQLA 3A98A 1QKXA 1KSWA 4QQGA 4OMQA 2L3RA 4FSXA 4AFUC 1Q81C 3OS1A 3CD6Q 1M1KR 3PFSA 2KRSA 1SKUB 1KJWA 2QQ9A 2M16A 2AZVA 4OGEA 2CUDA
chains in the Genus database with same CATH topology
3CCUQ 3CC7Q 1YJ9Q 2QEXQ 1VQMQ 1Q82R 3I55Q 1YJNQ 1K9MR 1VQ4Q 2QA4Q 3G4SQ 2OTJQ 1YI2Q 1YIJQ 1KC8R 1KD1R 1KQSP 1W2BP 1VQPQ 1VQ7Q 1M90R 3CMAQ 3CCRQ 3CCJQ 1VQKQ 3CCEQ 1QVFP 3CCQQ 3CPWP 1K8AR 1JJ2P 3I56Q 1YJWQ 3CMEQ 3CCVQ 1K73R 3G71Q 3CCMQ 1YITQ 1VQ9Q 3CCSQ 1NJIR 3CC4Q 1VQLQ 3CD6Q 1VQNQ 1M1KR 3G6EQ 1VQ6Q 1Q86R 1Q81R 1VQ5Q 2OTLQ 1S72Q 1YHQQ 1Q7YR 3CC2Q 3CCLQ 1VQ8Q 1QVGP 3CXCP 1N8RR 1VQOQ 3OW2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU Q;  3CC7 Q;  1YJ9 Q;  2QEX Q;  1VQM Q;  1Q82 R;  3I55 Q;  1YJN Q;  1K9M R;  1VQ4 Q;  2QA4 Q;  3G4S Q;  2OTJ Q;  1YI2 Q;  1YIJ Q;  1KC8 R;  1KD1 R;  1KQS P;  1W2B P;  1VQP Q;  1VQ7 Q;  1M90 R;  3CMA Q;  3CCR Q;  3CCJ Q;  1VQK Q;  3CCE Q;  1QVF P;  3CCQ Q;  3CPW P;  1K8A R;  1JJ2 P;  3I56 Q;  1YJW Q;  3CME Q;  3CCV Q;  1K73 R;  3G71 Q;  3CCM Q;  1YIT Q;  1VQ9 Q;  3CCS Q;  1NJI R;  3CC4 Q;  1VQL Q;  3CD6 Q;  1VQN Q;  1M1K R;  3G6E Q;  1VQ6 Q;  1Q86 R;  1Q81 R;  1VQ5 Q;  2OTL Q;  1S72 Q;  1YHQ Q;  1Q7Y R;  3CC2 Q;  3CCL Q;  1VQ8 Q;  1QVG P;  3CXC P;  1N8R R;  1VQO Q;  3OW2 P; 
#chains in the Genus database with same CATH topology
 1VQ5 A;  2RM4 A;  1K0X A;  4EPC A;  1M2V A;  1SF9 A;  4YTL A;  4KH1 B;  1Y57 A;  1B34 B;  2DL5 A;  4NS5 A;  4C0D C;  2XKO C;  4OGC A;  2DKG A;  2AZS A;  5I11 A;  3EG2 A;  2BE7 D;  2XID A;  5GAM f;  4M75 A;  4N0A C;  3CCR A;  3EGD A;  3QSU A;  5HK3 A;  1X43 A;  2EQK A;  4C8Q A;  1K9M U;  1BI0 A;  1KC8 U;  2YUP A;  3AT1 B;  1G3W A;  1M3B A;  2E3H A;  2JMA A;  4PJJ A;  2QDL A;  4LUD A;  2DFU A;  4ZGE B;  5GAM j;  5C0M A;  4HVU A;  4JUV A;  2DXT A;  3UDC A;  4Y28 E;  2FPF A;  1UHC A;  2JM9 A;  3GIB A;  3LX7 A;  2JT4 A;  5FWB A;  1FMV A;  3VU3 C;  3KBG A;  5I22 A;  2VC8 A;  1GCQ C;  2V1R A;  1NLO C;  2P0Q A;  2L2P A;  1PD0 A;  4HVW A;  3G71 A;  5FWC A;  4C92 F;  2EQJ A;  1BKB A;  5GAN f;  2ED0 A;  5DLQ E;  1ZBJ A;  2HSE B;  1W2B P;  4XQ3 A;  4J9B A;  4C5E A;  3M55 A;  2HAX A;  2RHZ A;  3OS5 A;  1RLP C;  4WF2 A;  3QO3 A;  3V7C A;  2DD4 A;  4J9G A;  1U5S A;  1MHN A;  3QZ5 B;  3I9Q A;  2XI9 A;  1PM3 A;  4F16 A;  4QKU A;  1CKA A;  1ZA1 B;  2GGR A;  2X51 A;  2QEX Q;  4PNO A;  4J83 A;  3C12 A;  4RTZ A;  1ARK A;  2K5F A;  3G1J A;  1N9R A;  3CCE T;  1E6H A;  2LQW A;  2M0O A;  3CPW P;  3MEV A;  3JB9 F;  3VV0 A;  2NUP B;  5D6W A;  1PC0 A;  2DIG A;  3RKX A;  3EH1 A;  2CP3 A;  2OTL T;  1OZ2 A;  3NHN A;  3D7S B;  1AZE A;  4RCB A;  2EYY A;  3VRZ A;  1VQ7 Q;  4BB7 A;  2COW A;  4C5H A;  3SWN B;  1Q86 U;  1AT1 B;  2AIR B;  1OEB A;  3URG A;  1WXT A;  1WHG A;  3EGU A;  3EHQ A;  1ZHI A;  3M56 A;  5IHI A;  3LH0 A;  3MEW A;  4HVV A;  2DIQ A;  1C0M A;  3UF4 A;  1Z9Z A;  4A4K A;  5FU7 B;  1YFN A;  2NWM A;  1K73 C;  4M77 E;  1JO8 A;  5IAY A;  2A28 A;  2JTE A;  3CCJ Q;  3JCM P;  2HCK A;  2JS2 A;  3CXC A;  4RG8 A;  5M9O A;  2NLU A;  3OYJ A;  3CCM T;  4M7D C;  4Z89 A;  2PVO B;  1Q82 C;  1YHQ Q;  3NPF A;  2V8J A;  3PNW C;  1TU0 B;  2EJG A;  2EYQ A;  1ZLM A;  3H41 A;  2QK0 A;  3INZ A;  1G3T A;  1T3S A;  3JCM W;  2L3Q A;  3OQ5 A;  2P4T A;  4M7D D;  3CCQ Q;  3LGL A;  4PLI A;  2I2L A;  4F7U B;  8AT1 B;  1UEC A;  2GQI A;  5IT9 E;  3JCM e;  1VQ9 T;  1NJI U;  1S72 Q;  4BI3 A;  1B34 A;  1M3A A;  1PSE A;  3PVQ A;  1SPK A;  1AWJ A;  1NEB A;  2QA4 Q;  1BBZ A;  3ULR B;  2OTJ T;  1PWT A;  1YI2 T;  4QQD A;  5J3B A;  3CPF A;  1G83 A;  2E6Z A;  1G5V A;  2C0T A;  2MOX A;  1YIJ A;  2L0A A;  2ZZD A;  4VUB A;  4XU0 A;  4IUR A;  3CME Q;  4XTV A;  4N4I A;  1RL2 A;  3S6W A;  1AZG B;  3EHR A;  4M75 G;  3I56 A;  4IKF A;  2YWW A;  1JBM A;  4NL3 A;  3CCS A;  5A2Q E;  4FT2 A;  1TTH B;  4C8Q G;  2PNI A;  5GAN 8;  2CH4 A;  4J6W A;  4ZN1 A;  2WSE E;  3G4S T;  3PT9 A;  1O9S A;  3RR6 A;  2JS0 A;  1UJY A;  5FU7 C;  4BDZ A;  5LJ3 g;  3Q1J A;  1K73 R;  3MET A;  3CCV Q;  3L2R A;  3E9F A;  1Q7Y U;  2OAU A;  3V8L A;  4FYV B;  2E5K A;  2FVU A;  4RTY A;  4LDW A;  2RPN A;  3CCU Q;  1Q82 R;  2HKQ B;  1YWO A;  2FL7 A;  1TS9 A;  1RUW A;  1YNZ A;  2HDA A;  3CMA T;  5LJ3 d;  1PG5 B;  2KAF A;  5D7U A;  4JZ3 A;  3LLR A;  4X9C A;  4OMF B;  2JUF A;  2MYS A;  3PMT A;  3ASK A;  1VQ6 Q;  3UT1 A;  3OYM A;  2AT1 B;  2LT1 A;  2O2O A;  2IVW A;  4Y92 A;  1VQ8 T;  4PJL A;  2MI6 A;  1VQM T;  2HEQ A;  2XIC A;  4PJO B;  3J7A F;  3M54 A;  2LNV A;  4XTX A;  3JCM X;  2MWP A;  2NUP A;  3VS6 A;  1K8A R;  4QVZ A;  2HSP A;  1WXB A;  4OB1 B;  5LJ5 g;  2VXF A;  2K6D A;  2D9T A;  3UA7 A;  3EG9 B;  1RAF B;  4L59 A;  3VS7 A;  1JB0 E;  4RKU E;  4DBH A;  3M4Y A;  3M9Q A;  4J6X A;  2DYI A;  2KI7 A;  4CC2 A;  2DZ9 A;  1KG1 A;  2JNG A;  1NYF A;  2B8A A;  3SWN A;  2RK2 A;  2XK0 A;  3RDV A;  1QCF A;  1BCO A;  5LJ5 d;  4PJM A;  1X2K A;  2EBP A;  2MAM A;  5KYN A;  4FU6 A;  2K57 A;  1BI1 A;  2DK3 A;  1VQ5 T;  3VJP A;  1KFZ A;  1KHC A;  4MZM A;  3FDR A;  4E47 A;  1WJR A;  1X69 A;  1VQ4 T;  2KXC A;  1W1F A;  1I5L A;  2GFA A;  3CBO A;  2YXY A;  5ECA A;  2H8H A;  2P0K A;  3CCR T;  1PSF A;  1ZX6 A;  3DB4 A;  1BI3 A;  3VS3 A;  4M7A E;  4XU2 A;  4JS5 A;  3PIP A;  3VS4 A;  3CCE A;  2EW3 A;  3HTR A;  4L6V 5;  1YCS B;  4M78 B;  2E4H A;  2RJC A;  4FCY A;  3UAT A;  1TUD A;  4Q5W A;  5GMK m;  3GOX A;  1WQ7 A;  1TG0 A;  2ABL A;  2XHC A;  1EIF A;  2OJ2 A;  1NEG A;  1U3O A;  1OYX A;  4F7U A;  3VKI A;  3OW2 S;  3A8M B;  2LQN A;  3G71 Q;  4BE2 A;  1OPL A;  1WIE A;  2HBP A;  3JCM f;  2DX1 A;  1LVK A;  2VUB A;  3E2U A;  4C92 C;  2NUZ A;  5DY9 A;  1OZ3 A;  1I5O B;  3X20 B;  2YUQ A;  2DET A;  3SD4 A;  5J26 A;  2K2V A;  3A5Z B;  1YCY A;  4J7I A;  3QDR B;  1M1K U;  1IO6 A;  2VGM A;  5CR2 A;  1JU5 C;  1M1G A;  4JJC A;  3CC4 T;  4ELZ C;  4C92 D;  2RK1 A;  4M75 B;  1H8K A;  3EFS A;  2K3B A;  5GAO m;  2LZ6 B;  3EGX B;  4Y91 A;  1VQO T;  3L1A A;  4MZT A;  4C8Q E;  1IHW A;  2FPD A;  2DTO A;  1GBQ A;  1KQ1 A;  3O8V A;  5CO7 A;  1RAH B;  2QQS A;  4J9D A;  2CZ6 B;  1QQJ A;  5FRO A;  1D1B A;  4ELY C;  1U1S A;  2V1Q A;  4C0G A;  1KD1 C;  4RTT A;  5GAN e;  1PD1 A;  2RHI A;  1I4K 1;  3JB9 D;  2HZY A;  2YSQ A;  4EDU A;  5IXB A;  2OTJ A;  2A36 A;  2YLC A;  2LDM A;  4F17 A;  3LWI A;  5LJ3 h;  5DLO A;  2OAW A;  1YWP A;  2P0P A;  1N9S A;  1OU8 A;  2E1H A;  4ME7 A;  1VIE A;  2J6F A;  5CCA A;  2O01 E;  2ZCF B;  4DBF A;  2RD1 A;  3RES A;  1SSH A;  3REA B;  4MDX A;  4PJO A;  3I5S A;  1YJN T;  1UGV A;  4J9C A;  2RI3 A;  2BZ8 A;  3EFR A;  4XTZ A;  2EYW A;  3U23 A;  5FRN A;  3G4S A;  4C92 A;  3TU4 K;  2M0Y A;  2DBM A;  3JV3 A;  2JZ2 A;  3EG9 A;  4JRI A;  2DL8 A;  3ER0 A;  4F14 A;  3OYH A;  2F2V A;  3G6E Q;  4ZTF A;  4C0D B;  1G3S A;  1MV3 A;  9ATC B;  1I1J A;  3PE0 A;  3NFC A;  3CC7 T;  4KRT A;  3THK A;  3MJX A;  3P8H A;  1G2B A;  3QPH A;  2BUD A;  4M77 F;  1D3B A;  1OQK A;  3NTK A;  1R0C B;  5LJ5 h;  1UJ0 A;  2BE9 B;  4WTO B;  2R57 A;  4E7L A;  5CKD A;  5GAM g;  1QVF A;  1UGP B;  4CRI A;  4ESR A;  1JJ2 S;  5I21 A;  2E64 A;  2EJ9 A;  1KD1 R;  4PFP A;  2R58 A;  2K9G A;  2KMT A;  3A1P A;  4P5N A;  2FO0 A;  2KE9 A;  4J9H A;  2LJ1 A;  2COZ A;  2VGN A;  3I56 T;  3TRE A;  3GBQ A;  3UA6 A;  3SEM A;  4DA4 A;  2EAY A;  3CCS T;  1X01 A;  1ZBX A;  1M3C A;  1Y96 B;  4M78 A;  4LE9 A;  1WJQ A;  3BDU A;  5GAM d;  3QKJ A;  4B9X A;  1TWB A;  3R6O A;  1SEM A;  4FL6 A;  1UGQ B;  4N4G A;  5IHK A;  2K79 A;  1YJ9 Q;  4O6J A;  1R0B G;  2GCX A;  1K4U S;  1WPY A;  4N4H A;  5FU6 B;  2CH4 W;  4J5Y A;  4V2S A;  1G8X A;  3JB9 H;  2XU8 A;  4F7U G;  1AD5 A;  2DE0 X;  4J9I A;  1P92 A;  1MV0 B;  2BIV A;  2C0O A;  1M9S A;  5GJW B;  4RTX A;  1VQ4 A;  3HFN A;  2LMJ A;  1T0H A;  1YJW Q;  2F2X A;  1AEY A;  2L8D A;  2EPD A;  3AHU A;  2D0N A;  1IRX A;  3EGX A;  1NLP C;  2O4X A;  5GMK h;  4HT9 A;  3OSS C;  4UC4 A;  1IGU A;  4CC7 A;  1H64 1;  3VS1 A;  3JB9 I;  2DYB A;  5KE3 A;  5GMK l;  1R77 A;  4GY5 A;  2PVD B;  1MMA A;  1RAE B;  4BY6 B;  5CQX A;  4II1 A;  1CKB A;  3E9G A;  4HKE A;  4E7H A;  3S3M A;  1U8R A;  3M58 A;  3NTI A;  2DL4 A;  1QVF S;  2HD0 A;  2F2W A;  2VAS A;  2O31 A;  2A0F B;  8ATC B;  2H3E B;  3E19 A;  4XAX B;  2LNH B;  4AFZ C;  1LJO A;  1K73 U;  1M4Z A;  2QQR A;  2KT8 A;  4M7D B;  2QXF A;  2LX9 A;  2RQR A;  2PZ1 A;  5GAN j;  1N8R C;  5FU6 C;  2WAC A;  3QG1 A;  2DL7 A;  1Q81 R;  3ZFJ A;  1AOJ A;  1YIT A;  1UHF A;  1A0N B;  3H0H A;  1N6A A;  2CZ0 B;  3CC4 A;  5GAO l;  1M27 C;  1M90 U;  1FMK A;  2DXU A;  2MMP A;  5CKF A;  4PJO G;  1VQO A;  2K7A A;  1V76 A;  3PTA A;  4QQ6 A;  3FC3 A;  3KXT A;  5GAN 2;  1WHK A;  4IUQ A;  2K5I A;  2EYZ A;  2P4R A;  5AYF A;  4C92 G;  4KGV B;  2YRD A;  2OTL Q;  5HK0 A;  1NM7 A;  1RAD B;  3PGG A;  1LCK A;  1MMG A;  2V8I A;  4N0A A;  3ZEH A;  4A54 A;  1K8A U;  3DLM A;  1KK7 A;  2Z0W A;  3OYY A;  1XNI A;  2B86 A;  1VQP A;  4CC4 B;  2CYZ B;  4RMO A;  2LT4 A;  3OBW A;  2DF6 A;  2FB7 A;  4M7A F;  1X75 C;  2EGE A;  1AVZ C;  4BY6 C;  3HRS A;  1SHF A;  2BKD N;  3MCA B;  1TOV A;  5GAN 6;  4QVD A;  1PKS A;  3I55 T;  2RO0 A;  1BIA A;  3PVL A;  3RER A;  5KE2 A;  1GCQ A;  1QVG S;  1AWW A;  1YJN A;  2D8J A;  2GTO A;  3CCM Q;  3GF5 A;  4HCK A;  4DBQ A;  2QDY B;  3JCM Q;  1GXI E;  1Y96 A;  2K2M A;  2E10 A;  4DEX A;  4CC3 A;  5KCO A;  4BE0 A;  1HYO A;  3OYA A;  1RAG B;  4OB0 B;  4M78 G;  2YRC A;  1HK9 A;  4ORZ A;  1HSQ A;  5GAM h;  2H3J A;  1QP3 A;  4E7I A;  2RJF A;  2KY9 A;  3JAM E;  2DTI A;  2JM8 A;  3OBY A;  2A08 A;  1XQH A;  1XTD A;  4OB2 B;  2ZPI B;  4L5G A;  3CC7 A;  3CCJ T;  3X26 B;  1X6G A;  1VQ9 Q;  2COY A;  1WX6 A;  4JPB W;  1NPR A;  2RN8 A;  4F7U E;  1C6V X;  2FHD A;  2RHY A;  1UDL A;  3VYH B;  2X9H A;  4HCZ A;  2C06 A;  5A0G A;  2OTJ Q;  1OX8 A;  1YI2 Q;  3L42 A;  2CKK A;  3A8O B;  3UPU A;  4C8Q F;  7AT1 B;  5KYW B;  1JXM A;  4ATO A;  3CCQ T;  4EMG A;  2CS7 A;  4JRQ A;  5HY6 A;  1IRE B;  3UWN A;  2BTT A;  2KDS A;  4B9W A;  4KGZ B;  4OVA A;  1WI7 A;  2CZ1 B;  2D0Q B;  2LCL A;  4TVR A;  1PKT A;  3OMG A;  3PIO A;  1MND A;  3KUF A;  2HBW A;  1RAA B;  4FYW B;  1T3L A;  2M51 A;  2QA4 T;  2FZG B;  1U1T A;  3TVT A;  2FG0 A;  4FSS A;  4OB3 B;  2DEU A;  3CME T;  1G3Y A;  3I35 A;  2VYT A;  4HXJ A;  1VQN Q;  1LNX A;  5AT1 B;  2RQT A;  2CZ7 B;  1ZSG A;  2PVG B;  2YLB A;  2E12 A;  4AG2 C;  3X25 B;  5GMK i;  2F69 A;  3WXM B;  4A63 B;  1VA7 A;  2FZC B;  1H92 A;  3CC2 A;  2CT4 A;  4JZ4 A;  4D8D A;  4M7D A;  5GAO r;  1WYX A;  1GL5 A;  3CMA Q;  1QVF P;  2CGH A;  3RMQ A;  4OP0 A;  4M77 C;  3OW2 A;  1M1F A;  4RTV A;  3VUZ A;  2MF2 A;  3CD6 A;  1SG5 A;  4DOW A;  3OS2 A;  1VQ8 Q;  2ZPF B;  4KT0 E;  3CCU T;  1VQM Q;  4JJD A;  4M77 D;  4EMH A;  2E3I A;  1WDX A;  2K3Y A;  4PJO E;  4D8K A;  2RF0 A;  3QJY A;  1WJS A;  4JJN K;  4RTU A;  2V8K A;  4C92 B;  1VQL Q;  5GAO n;  1JXO A;  3NTH A;  1VQ6 T;  4J8O A;  3V8K A;  4ANJ A;  1X6O A;  4OMO A;  4JS4 A;  3GLX A;  2EQU A;  1VIF A;  2ZPE B;  2DL3 A;  2YHT A;  3JCM g;  1D09 B;  3OYC A;  1OOT A;  2KQW A;  4EMK C;  2ZPB B;  2VVK A;  3CEY A;  2VWF A;  4MMK A;  5GAN 7;  2DJQ A;  4PLL A;  2X3W D;  3X28 B;  2F5K A;  4FYY B;  5IXF A;  1D3B B;  4J6Y A;  4LDV A;  5D6X A;  4KUI A;  2RNA A;  1VQ5 Q;  4NL2 A;  3JSC A;  3RUX A;  2O9V A;  1ZUY A;  2KRM A;  1PNJ A;  3C0C A;  2RA2 A;  1D0Z A;  5LJ3 f;  1QP2 A;  4J9E A;  3CCR Q;  1D0X A;  1MMD A;  1KQ2 A;  1Q7Y C;  1XOV A;  3EFO B;  4R0K A;  3C94 A;  3GNF B;  1KD1 U;  4LDX A;  2XDB A;  1K76 A;  4M78 E;  5I2S A;  5KYU A;  3X24 B;  1K0S A;  1NZ9 A;  3BW1 A;  3C4S A;  4LXC A;  4M4Z A;  1VQK T;  3HRU A;  1FMW A;  1ACM B;  3L2Z A;  3A8G B;  3HKS A;  2GF7 A;  1TUC A;  4PFO A;  2J06 A;  3HL8 A;  4BUG A;  2ATC B;  1MGQ A;  3BDL A;  2VXE A;  3ZL7 C;  1UB4 A;  5KYW A;  5CKB A;  4Z88 A;  3I55 A;  4KUD K;  1VQ7 A;  1YIT T;  3CC4 Q;  1M30 A;  4XTY A;  1D0Y A;  4RUG A;  4OMN A;  3V7R A;  3EG3 A;  2EWN A;  4M75 E;  4KBM B;  2X4W A;  3M0R A;  1JJ2 A;  1NPP A;  3LW5 E;  3OYF A;  2O4X B;  2CRE A;  2LVM A;  2DVJ A;  1UEB A;  2JJ9 A;  3JB9 J;  4FW2 A;  2YUO A;  1FXX A;  3OYN A;  3M0Q A;  3CCJ A;  4LDU A;  3OSV A;  2DVE A;  1Y7X A;  2X4X A;  1Q7Y R;  2MPX C;  2XG8 D;  2RI2 A;  3M59 A;  1RLQ C;  2OI3 A;  3MP6 A;  3CBP A;  1WHH A;  1YHQ A;  2LJ3 A;  2WSF E;  1WHL A;  2JN0 A;  2MWO A;  3PMI A;  4M7D G;  4D6W A;  1BB9 A;  1F1B B;  1VQP T;  4ZTJ A;  4OMP A;  4F04 B;  4KH0 B;  2QGG A;  3EH2 A;  2ENM A;  4DQ2 A;  2KBT A;  2E6N A;  3QII A;  2XDD A;  1X2Q A;  3FRN A;  3CCQ A;  4M7A C;  3MP1 A;  1W2B S;  2ROL A;  3N5B B;  2KT1 A;  3VS0 A;  1RAB B;  3S3O A;  1S72 A;  3TSZ A;  1YJN Q;  1VYU A;  2LRQ A;  1B07 A;  3MKD A;  4LDY A;  1M5Q 1;  1WQW A;  3QZ9 B;  3VYG A;  2QA4 A;  1Q81 U;  2G6F X;  4M7A D;  3TSW A;  5D6Y A;  4KGX B;  1RI0 A;  3FLG A;  2VB6 A;  4RTW A;  2BZY A;  4A53 A;  1IB8 A;  1DJ7 B;  2Y90 A;  3CME A;  1Y0M A;  3A8L B;  5CAI A;  3WVD B;  3CPW S;  3CCL T;  1CSK A;  1WGS A;  3CC7 Q;  1QW1 A;  2CT3 A;  3FJP A;  2EKH A;  3G7Z A;  3P8D A;  1M1K C;  4IIM A;  5KH6 A;  2FYK A;  4IUP A;  3OYB A;  3L2U A;  3ZBD A;  2W10 A;  2DRM A;  4JJB A;  3L2Q A;  2QQB A;  2RQU A;  1KQS A;  4IUV A;  3CCV A;  4IUU A;  2RQW A;  2DXB A;  3H8Z A;  1GRI A;  1RI9 A;  1M8M A;  3P8B B;  3JCM h;  4AFQ C;  1WNL A;  1YIJ Q;  1U06 A;  3LWH A;  2KK4 A;  4C8Q C;  3L2W A;  3CCU A;  2I0N A;  2CP5 A;  2EGA A;  2MIO A;  3OYE A;  2G3R A;  1NE8 A;  1X6B A;  4ZGD B;  3OYL A;  1Y71 A;  3I56 Q;  1W70 A;  3HPW A;  3EFO A;  2SRC A;  3CCS Q;  4AFS C;  2DNU A;  3R6N A;  2BZX A;  1BCM A;  3MP8 A;  4F7U F;  1E7O A;  5GAO q;  2CP7 A;  3GPL A;  1VQ6 A;  4GLK A;  4C8Q D;  2RI5 A;  2M1H A;  1WHM A;  4M7A A;  2RMO A;  1ZSZ B;  5GAN g;  4J9F A;  1GCP A;  2FRW A;  3H6Z A;  1VOM A;  1Q95 G;  2EJF A;  1UFF A;  4MML A;  4C0F A;  2M02 A;  5EC7 A;  3CC2 T;  3OW2 P;  3H0F A;  1YJ9 T;  3TEE A;  3HRT A;  4JDS A;  2PUO B;  2X4J A;  3QDF A;  1QVP A;  3QHS A;  5IN1 A;  5GAN d;  3MHX A;  3HSB A;  2CP2 A;  1IZ6 A;  3GP8 A;  3CD6 T;  1EZZ B;  1UGS B;  1WXU A;  2ECZ A;  2RQV A;  2KYM A;  2ED1 A;  4QT7 A;  2ESW A;  1GFC A;  1J3T A;  5KYY A;  2JVV A;  1EFN A;  5J39 A;  3RIR A;  3DKM A;  1IXD A;  3QWX X;  1JQQ A;  3EG1 A;  1QVG A;  3VS5 A;  1YJW T;  4IUT A;  5HKC A;  3QUI A;  1FWZ A;  2RHU A;  3GNG A;  2YDL A;  1VQK A;  2LQK A;  1KQS S;  2GFU A;  3FIF A;  4HA8 A;  2PUK B;  3OYD A;  3HHT B;  1OPK A;  4BI8 B;  4E7Z A;  2HL3 A;  1M2O A;  1M8V A;  3H9N A;  2L89 A;  4IIO A;  5A0D A;  5I2M A;  2D8H A;  1HJD A;  1QLY A;  4M7D E;  4HT8 A;  4PJO F;  3O5Z A;  2DRK A;  3HP9 A;  1ZSZ C;  2JXB A;  3NGP A;  3MPU B;  2D6F A;  1H3H A;  2IPO B;  1Q82 U;  5L8R E;  2EYX A;  3M0S A;  2MCN A;  2FRY A;  1BK2 A;  2LP5 A;  3OYK A;  1QCO A;  4JRK A;  2E41 A;  1AHJ B;  2QTV A;  2YRV A;  1AWX A;  2PU9 B;  2EFI A;  1MNE A;  4J7F A;  3CCE Q;  1ABO A;  1V29 B;  2ZPH B;  4JLI A;  1Z9Q A;  4R55 A;  1E6G A;  2NYS A;  2C0I A;  1JEG A;  4FYX B;  1MUZ A;  1B3Q A;  2HQE A;  1N27 A;  5L23 A;  5GAN 5;  5FRM A;  2QEX T;  4DBR A;  4Z8A A;  1LOJ A;  2AKK A;  4HCC A;  4XTW A;  2F5T X;  2J7I A;  1PRM C;  4A4F A;  5FLX E;  3V8J A;  4PJN A;  1VUB A;  1W4S A;  2E65 A;  2ZGW A;  2CDT A;  5LL6 S;  1YP5 A;  1K9M C;  3OMC A;  1KC8 C;  1QMC A;  2A37 A;  5GAN 4;  3I55 Q;  2HNI A;  3KFV A;  5LJ3 e;  5CK9 A;  3JB9 G;  1ZA2 B;  4M78 F;  2KSS A;  2DD5 A;  2FZK B;  1VQ7 T;  4GBQ A;  2PQW A;  1JJ2 P;  4BI4 A;  1Y07 A;  4JRP A;  3SDZ A;  5CQY A;  2EQI A;  5A0L A;  2RJE A;  1K9A A;  4E7J A;  1QWE A;  4E6R A;  2YUN A;  1N8R R;  5KCH A;  4M77 B;  1YN8 A;  2PTK A;  1ZSZ A;  3CCL A;  4PK4 A;  2DJZ A;  5KYU B;  4M7A G;  3CQT A;  1C1A A;  2DLP A;  2X4Y A;  2Y4X A;  2EQM A;  1NBE B;  2QAS A;  2DPP B;  1YHQ T;  3G6E A;  1V1C A;  1M90 C;  1PHT A;  4DEY A;  4M75 F;  3C95 A;  3M5A A;  4OF1 A;  2A7Y A;  3DB3 A;  5LJ5 e;  1OX9 A;  5IHN A;  2XDP A;  2QGF B;  1R8O B;  2DXC A;  2MK5 A;  5GAN h;  1BIB A;  2E70 A;  1GFD A;  1OU9 A;  2E5Q A;  4EMK B;  3QYG B;  5KYX B;  1S72 T;  1W6X A;  2DMO A;  3OYI A;  1XJW B;  1TUG B;  2XD0 A;  2DBK A;  1K8A C;  1K9M R;  3G4S Q;  1KC8 R;  4OMM A;  2O9S A;  2RB6 A;  1JRI A;  3RKY A;  3TCJ A;  1IHV A;  2WSC E;  1VYT A;  3S3N A;  1Q86 C;  1S1N A;  4C5I A;  2CP6 A;  3SWN C;  1QKW A;  4A4E A;  1PRL C;  1D1C A;  3J81 E;  1UUE A;  1SHG A;  4K11 A;  3H0I A;  1AWO A;  2SEM A;  5EG2 A;  1KQS P;  3VUB A;  3OB9 A;  1GBR A;  2QAZ A;  3M0P A;  1YJ9 A;  2RH2 A;  4PKC C;  2J6K A;  2EKO A;  2DM1 A;  2O88 A;  4EIK A;  2DZC A;  3NMZ C;  2D1X A;  1MMN A;  3CCV T;  2L3P A;  1VQN T;  4PL6 A;  3RNJ A;  4A4G A;  4XK8 E;  2KYB A;  1SRL A;  4LD9 K;  4AG1 C;  3OYG A;  2OX7 A;  1TH7 A;  4QVC A;  2HL5 C;  2KXD A;  1YBY A;  3EAE A;  4OML A;  5FW9 A;  2GNC A;  3JCM V;  3T9N A;  1EX4 A;  2W0Z A;  2NUT B;  1M90 R;  2LCS A;  4C0Z A;  3IQL A;  5GMK e;  1KHI A;  3CXC S;  1SSF A;  4X9D A;  2FPE A;  4E7K A;  3M57 A;  5CKE A;  2HQX A;  1NJI C;  3RMS A;  3WVE B;  4C92 E;  1YJW A;  4LUE A;  4DOV A;  3LH5 A;  3MEU A;  4AMC A;  2RHX A;  4A4H A;  2HQH A;  4RCC A;  4X1V A;  2KVQ G;  3JCM c;  4ZN3 A;  1VQL T;  5GAO p;  1RAI B;  1Q86 R;  2QQA A;  3HFO A;  5GJV B;  2K4Y A;  2DEQ A;  1WZO A;  2LTO A;  3J80 E;  4BDY A;  3JCM d;  4C5G A;  3MEA A;  1RAC B;  4CI0 C;  3JCM J;  4WCI A;  1VQ4 Q;  2QG9 B;  3FB9 A;  3OS0 A;  3QYH B;  4FIB A;  5HCK A;  1O75 A;  4PFZ A;  2AHJ B;  3CBM A;  3FJ5 A;  1N5Z A;  3I5R A;  5LJ3 j;  4BD3 A;  5CIU A;  3TQ7 P;  1W2B A;  5CVI A;  3LGF A;  1QVG P;  2DA9 A;  2QYZ A;  4GLM A;  3M53 A;  1T0J A;  4M77 A;  3M0U A;  2GQV A;  1TSF A;  2KR3 A;  2DIL A;  4FT4 A;  1UTI A;  1WFW A;  4LN2 A;  2EGC A;  1VQK Q;  4M7A B;  2QEX A;  1BU1 A;  1X27 A;  2AKL A;  4FM4 B;  2L3S A;  1IGQ A;  2J05 A;  2RJD A;  1ZUK A;  1NG2 A;  1BI2 A;  3BY7 A;  1HD3 A;  1TXQ A;  2LX7 A;  3CPW A;  4Z02 A;  1NJI R;  1VYV A;  1UG1 A;  2OTL A;  3QXE B;  1ZUU A;  2LC4 A;  3BE3 A;  2LJ0 A;  2EVR A;  4QW2 A;  5LJ5 f;  2LCC A;  3BFM A;  2QI2 A;  2GTJ A;  2CSQ A;  1YIT Q;  1WA7 A;  3SFM A;  4PJO C;  4EMK A;  3G71 T;  1WHJ A;  5KYX A;  5LJ5 j;  1UGR B;  2AK5 A;  4ZGJ B;  4E7S A;  2KRN A;  2F1L A;  3SHW A;  1WLP B;  2J6O A;  1I07 A;  1VQO Q;  4MDW A;  4HCB A;  2A3L A;  4AT1 B;  1H3Z A;  4LNP A;  1M2V B;  5KYY B;  2P84 A;  2IIM A;  2JTF A;  3SB2 A;  2CP0 A;  4PJO D;  1OUL A;  3M0T A;  2JMC A;  2CSI A;  2DTH A;  5GAM e;  4X34 A;  4M7D F;  4BE1 A;  5DM7 R;  1I8F A;  1SRM A;  1FX7 A;  3CCM A;  1ABQ A;  3EGD B;  3F70 A;  3L2V A;  4C8Q B;  3M4G A;  1K1Z A;  2KGT A;  2K5L A;  1VQP Q;  2V26 A;  4O5V A;  2DER A;  4NOY A;  6AT1 B;  1UE9 A;  3OY9 A;  1KIK A;  3OA6 A;  3JRZ A;  4E2F B;  1NYG A;  2KEA A;  2KRO A;  2FEI A;  3LYI A;  1VQ9 A;  4JLG A;  5CKH A;  3FEO A;  2IG0 A;  1HXD A;  4MZP A;  2K3X A;  2X3X D;  2ZPG B;  2NUT A;  4M78 C;  1PCX A;  2XMF A;  2L5Q A;  4FW1 A;  2M9U A;  1YI2 A;  2GBQ A;  4XU3 A;  1QCN A;  4XTU A;  3DLL A;  4RG2 A;  2ZAE A;  1LPL A;  3CCL Q;  1BYM A;  3CXC P;  2HMA A;  5GMK j;  4M78 D;  2X35 A;  1B7T A;  1OV3 A;  3A8H B;  2JTM A;  2EIF A;  4KUL A;  3QBY A;  2Y4Y A;  2KNB B;  3V7S A;  3E1S A;  5C6S A;  4BAC A;  2VKN A;  3G6E T;  2DO3 A;  4B6M A;  5GAN 3;  3REB B;  1VQN A;  1D1A A;  2LQ8 A;  2QTX A;  2YT6 A;  2HKN A;  4M75 C;  4XU1 A;  2DAQ A;  1QWF A;  2ROT A;  3QWY A;  3MO8 A;  3RBB B;  3CMA A;  2VV5 A;  3QJ6 A;  1I81 A;  3VS2 A;  3EG0 A;  4M75 D;  3VRY A;  2JW4 A;  2R5M A;  2R5A A;  2CUB A;  1I0C A;  4M77 G;  1ZQ1 A;  1YIJ T;  1VQ8 A;  4LD6 A;  1VQM A;  4ZNX A;  3ME9 A;  2JOY A;  3JCM b;  1N8R U;  1FYN A;  4R56 A;  1OI1 A;  5IH2 A;  3RKW A;  3CC2 Q;  1VQL A;  3A98 A;  1QKX A;  1KSW A;  4QQG A;  4OMQ A;  2L3R A;  4FSX A;  4AFU C;  1Q81 C;  3OS1 A;  3CD6 Q;  1M1K R;  3PFS A;  2KRS A;  1SKU B;  1KJW A;  2QQ9 A;  2M16 A;  2AZV A;  4OGE A;  2CUD A; 
#chains in the Genus database with same CATH homology
 3CCU Q;  3CC7 Q;  1YJ9 Q;  2QEX Q;  1VQM Q;  1Q82 R;  3I55 Q;  1YJN Q;  1K9M R;  1VQ4 Q;  2QA4 Q;  3G4S Q;  2OTJ Q;  1YI2 Q;  1YIJ Q;  1KC8 R;  1KD1 R;  1KQS P;  1W2B P;  1VQP Q;  1VQ7 Q;  1M90 R;  3CMA Q;  3CCR Q;  3CCJ Q;  1VQK Q;  3CCE Q;  1QVF P;  3CCQ Q;  3CPW P;  1K8A R;  1JJ2 P;  3I56 Q;  1YJW Q;  3CME Q;  3CCV Q;  1K73 R;  3G71 Q;  3CCM Q;  1YIT Q;  1VQ9 Q;  3CCS Q;  1NJI R;  3CC4 Q;  1VQL Q;  3CD6 Q;  1VQN Q;  1M1K R;  3G6E Q;  1VQ6 Q;  1Q86 R;  1Q81 R;  1VQ5 Q;  2OTL Q;  1S72 Q;  1YHQ Q;  1Q7Y R;  3CC2 Q;  3CCL Q;  1VQ8 Q;  1QVG P;  3CXC P;  1N8R R;  1VQO Q;  3OW2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...