2QA4Q

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 2qa4Q00
3CMEQ 1YJ9Q 2QA4Q 1Q86R 3CCEQ 1Q81R 3CCJQ 1K73R 3CCVQ 1YIJQ 1NJIR 1M90R 1VQ5Q 1QVFP 3CCLQ 1VQMQ 1YITQ 1QVGP 3CPWP 1Q82R 1VQ9Q 1VQ7Q 1YI2Q 3CXCP 3CCQQ 3CCUQ 3CCMQ 1JJ2P 2OTLQ 1S72Q 1KC8R 1VQ4Q 3I56Q 3CD6Q 3OW2P 3G4SQ 1YJNQ 1YHQQ 3CMAQ 3G71Q 3CC4Q 1VQ8Q 1VQ6Q 1VQNQ 3CCSQ 3CC2Q 1KQSP 3CC7Q 3I55Q 1M1KR 1VQKQ 1YJWQ 1K8AR 2OTJQ 1VQOQ 1KD1R 1W2BP 1Q7YR 1VQPQ 3G6EQ 2QEXQ 3CCRQ 1N8RR 1VQLQ 1K9MR
chains in the Genus database with same CATH superfamily
2NLUA 2C0IA 2P4RA 3OW2S 3TEEA 2EJ9A 2LC4A 3CMEA 1YITQ 3FEOA 1UGPB 4DBHA 2DVJA 2L3QA 2FZCB 1VQOT 1VQKA 5EC7A 1GCQA 2JTEA 2X4YA 3HPWA 3CD6T 2DVEA 5CR2A 4PJJA 5LJ3g 1D3BA 1RUWA 1K73R 1I4K1 1NJIR 2V8JA 2HBWA 3A98A 3DKMA 3EG9B 3MJXA 4F17A 5FROA 5GAN8 2EW3A 3CCSA 1IXDA 1MGQA 2O4XA 2XDDA 2QQAA 3D7SB 5KCOA 4RUGA 4KH0B 2FVUA 1BCOA 3M0SA 2A7YA 2RD1A 4LUDA 1I0CA 3PMIA 4M75E 4MMLA 3L2WA 2RF0A 2KGTA 1WHHA 1RI9A 1BIBA 4C8QF 1K0XA 2K6DA 1WZOA 3JB9J 3OMCA 1OI1A 1M27C 2RH2A 2F2VA 1WHGA 1B34B 1X6BA 1IO6A 3X28B 1ZBXA 3QJYA 4DOWA 4XQ3A 4V2SA 1IGQA 1D0XA 1E6GA 1AZGB 5A2QE 3VS5A 5CIUA 1VIEA 2JMAA 1KHIA 1SKUB 2MMPA 3CCEQ 1OV3A 3HFOA 1BCMA 1QKWA 2EQUA 4RMOA 1WFWA 3VUZA 1ZUKA 1NJIC 5DLQE 2JJ9A 2LQKA 3CCQQ 1GBQA 1VQNT 3DB3A 3JSCA 3VV0A 1KC8R 1BU1A 5CO7A 4X9DA 4FT2A 1WPYA 1NEBA 4BDYA 1RACB 2EYYA 3QG1A 2P0PA 2QQBA 1JJ2A 3L1AA 2XK0A 1YI2A 3L2VA 3G6EQ 5I11A 2M0OA 3OYLA 4E2FB 1R0BG 5GAOq 1F1BB 1KK7A 1VQPT 1QCOA 3EG0A 4E7JA 2RQTA 4QQDA 3ZFJA 4AT1B 2JNGA 3M9QA 2CUBA 1QWFA 5KYYA 2O88A 4JRIA 3LGFA 1WLPB 1FMVA 2ED0A 3CC7A 4X34A 3KUFA 1Q86C 1H8KA 1SPKA 4EMKC 3CBMA 4MMKA 4A4EA 5GAMf 3OS2A 2KMTA 3CD6A 4FW2A 1VQ7Q 2ZPFB 2DAQA 1M2VB 2JW4A 2ENMA 3S6WA 3C0CA 2MOXA 2E10A 2EGAA 2FHDA 3GP8A 4XK8E 2KXCA 1M1KR 2JN0A 1MMDA 5CKDA 1TUDA 1M1FA 2K3YA 1NLOC 5LJ5h 1I07A 1UHCA 1WA7A 2JTMA 2HAXA 2MPXC 3QUIA 1W2BA 2DL4A 4KT0E 4C0DB 2R57A 1UJ0A 1B34A 1RAAB 4E47A 1VQ6T 4RG2A 5LJ3e 3OYIA 1X2QA 5CQYA 2DIGA 5GMKj 1H3ZA 2W10A 4PJNA 3VS4A 4IURA 4C92A 3CMAQ 4QQGA 5FU7B 5FLXE 3CCUA 1OPKA 4PJLA 2RK1A 1VQPQ 2GFAA 1HK9A 1M4ZA 3M54A 3CCQT 3PTAA 1VQ5Q 4PFOA 1YNZA 2ZPIB 3CCET 2HKNA 3ZL7C 1E7OA 3EG3A 3BFMA 1BI0A 5J39A 3CC2A 4WCIA 3CCVA 5ECAA 1K9MC 3JCMW 3NTIA 3QJ6A 3V8LA 4N4GA 3JCMf 1W2BP 2XD0A 1MHNA 3RESA 2E6ZA 3LX7A 3VYHB 1Q95G 4RCBA 2IG0A 4J9HA 5GAN3 2RHZA 5KH6A 3FB9A 1K8AU 2HL3A 1KG1A 1YJ9A 4M4ZA 4Z89A 1W2BS 1ACMB 4M7DG 3OYNA 1O9SA 4KBMB 2XHCA 1D09B 1BKBA 1I1JA 2OTJQ 1YP5A 1ZLMA 1VQ9A 4C8QB 5IT9E 1K0SA 1VQMQ 2X4JA 2MI6A 2GTOA 3M55A 3M0QA 2ZAEA 3SWNA 2QQSA 1JQQA 2JMCA 1SRMA 1PC0A 5GAOr 4M78G 5FWCA 4M7DC 1B07A 4XTUA 2ROLA 3C4SA 4RTWA 1VQLA 2FZKB 1S72T 1QLYA 2M9UA 1VYTA 2VC8A 1IB8A 1QVPA 3CPFA 2CH4A 5GAOm 4O6JA 3DLLA 4LN2A 1OZ2A 1LPLA 3CMAT 1S72Q 4XTXA 4QQ6A 1YCSB 3UT1A 2W0ZA 4BI8B 1K8AR 1UE9A 2QXFA 3CQTA 3REAB 4C0DC 2QEXQ 4M78C 2ZPBB 3CMET 3M53A 1UGVA 5IHKA 2CDTA 2X3XD 4QVZA 1Y0MA 1YIJT 1QCNA 3CCJT 2WSEE 3EG9A 2FL7A 1NYFA 2H8HA 2I0NA 2KYBA 1RAHB 3HRTA 3CCUT 2YXYA 2MYSA 2ABLA 4M7AA 2FEIA 1YJNA 1Q81C 2M0YA 5EG2A 2EQJA 1OOTA 2JS0A 2BIVA 5GAN7 4ATOA 1U8RA 3CCMA 3CCMQ 1QVFA 2FYKA 1VQ8A 3SEMA 2FB7A 2MWPA 2NUPB 1UGRB 1WXUA 3EGXB 3M59A 1BI3A 2GFUA 3URGA 2OAUA 4VUBA 3V8KA 3G6ET 1TOVA 2PZ1A 1FWZA 4BUGA 3OYJA 4N0AC 1JXOA 2RI5A 3L2RA 4EMKA 1RADB 4JPBW 2CKKA 3O8VA 5KE3A 2R58A 5IN1A 2F2XA 2D6FA 2VKNA 1NE8A 2YT6A 2L3SA 1NM7A 2DRKA 2QEXA 1RLQC 1WGSA 1VQ4A 2XIDA 1WHMA 1XTDA 4JLIA 3OYMA 4XTVA 2DF6A 2OTLA 1C1AA 4M78F 2O31A 3CPWP 4FYXB 4LDUA 4D8DA 2DKGA 3JCMh 1W6XA 2CP2A 2VWFA 1KHCA 1Q7YR 2K79A 1QVGA 3O5ZA 1B3QA 3H6ZA 1Y96A 5LJ5d 1VQ7T 2M51A 3R6NA 5I2SA 1IRXA 2JM8A 4C0FA 2DXBA 2RHUA 4PJOE 3QDFA 2DZCA 2OAWA 1WHJA 2ATCB 3JB9G 1YFNA 5KYUA 3CC7T 2LX9A 1ZSZA 4OP0A 3DLMA 5FRMA 2LCLA 1VYUA 2HEQA 2RM4A 2CUDA 4Z88A 2QK0A 4JLGA 4C5IA 2PQWA 2BKDN 5GANe 5GAN2 3PIPA 2HL5C 3CCLQ 1UTIA 4K11A 2BE9B 2BZYA 3M4YA 1NPRA 2OJ2A 2LNVA 3EAEA 3P8HA 3X20B 3E9FA 3JAME 1KSWA 4EMGA 2A0FB 3UA6A 2DMOA 2LCCA 2V1QA 2X35A 3BDUA 5LJ3h 2KEAA 3OS1A 2HCKA 2MCNA 2QTXA 3X26B 3I55A 1WI7A 1WJRA 3E1SA 1IGUA 3H0FA 3ULRB 1V29B 3ME9A 4FSXA 3SWNB 3G7ZA 1GXIE 3M5AA 4RTUA 1N8RU 5GAMd 1C6VX 2CREA 4E7ZA 1KD1U 3EH1A 2KR3A 3KBGA 1VOMA 4ZTFA 2E12A 2DRMA 2FPFA 2MIOA 3CCRA 2KDSA 3JCMX 1EFNA 2LT4A 1N8RC 4M7DF 4N0AA 1S1NA 2NUPA 2BUDA 5DM7R 1UJYA 2CYZB 2COZA 2EAYA 4J7IA 4PK4A 2LX7A 1AD5A 3E9GA 4OMMA 3M56A 1T0HA 3JB9H 2M1HA 1YJWA 4DEYA 2EQIA 4DOVA 1YCYA 2CZ1B 3LYIA 2AK5A 5CKHA 2AZVA 1M90U 2ZCFB 1M1KC 1D0ZA 2J6OA 2C0TA 3CD6Q 4QVDA 4OMFB 3S3NA 3GOXA 3S3MA 4JRKA 1QMCA 2V1RA 3P8BB 2K5LA 3THKA 4A4GA 2L3RA 3QXEB 3M0UA 3J80E 4F7UA 2NUTB 1GRIA 1TUCA 4C8QE 1WHLA 2E5QA 2OTLQ 1T0JA 2NWMA 4OB3B 5FU6B 2KY9A 4GBQA 5DY9A 1VQNQ 1SF9A 5GMKl 2I2LA 3G4SA 5GAMh 1KQ2A 1T3SA 3MP8A 3H0IA 4E7IA 1CSKA 3EHQA 4DBQA 4PJOD 4CC4B 1FYNA 3OYEA 3BDLA 4J6WA 4LNPA 1YJWT 1N5ZA 2ESWA 2HQEA 4PJOC 5KE2A 2KQWA 3CCQA 2X4XA 5AT1B 1Q86U 3F70A 2KRNA 2KROA 3SFMA 4LDXA 3M57A 3FRNA 4A53A 2F69A 3OYDA 2VV5A 4M7AG 4MZPA 4M77C 2QGFB 3UWNA 2RI2A 4M75G 2DTIA 2MF2A 2K3XA 1IZ6A 1TG0A 2QTVA 2VGMA 2K3BA 3G4ST 1PRMC 2HQHA 4M75D 4J9FA 3HRSA 3FDRA 2F5KA 3PT9A 3CXCS 1ZQ1A 3LLRA 4FL6A 2DNUA 4JRPA 3RBBB 2CP0A 1YHQA 2K5IA 5HCKA 4M77A 1GCPA 1MMGA 2HSEB 2YSQA 2EYZA 1PKSA 2VUBA 2Y90A 1B7TA 2DM1A 4HVUA 4ZGEB 2JVVA 3M4GA 3G4SQ 1NLPC 5CKEA 1IHVA 3GPLA 2RB6A 4HCBA 1AOJA 4PJMA 5LJ5g 5I21A 4JS5A 3VU3C 2DETA 5HK0A 1KQSS 4DBRA 5KCHA 2AKKA 3NTKA 3GIBA 1RLPC 5A0LA 2DL7A 2EVRA 1VQ8T 3I55Q 1PD0A 1BB9A 4GLMA 2KYMA 3WVEB 2DYIA 4IKFA 1NBEB 1TU0B 5HK3A 1G83A 2D0NA 2Y4XA 3JB9F 4JRQA 4JUVA 3QYHB 2O4XB 2EGCA 4FT4A 2VXFA 4FYVB 5A0GA 1GCQC 1PG5B 1LNXA 4C0ZA 2CP5A 2YUQA 1N8RR 4PNOA 3JCMe 2PVOB 1RL2A 2P84A 1YITT 2RN8A 1Q7YC 2G3RA 5KYWB 4JJDA 4C8QD 4EMKB 2YRDA 1MNEA 3AHUA 2QI2A 2IIMA 1QCFA 3M0TA 5GAOn 5KYYB 1OX9A 4M7AF 2A3LA 3OSSC 3V8JA 2XDPA 4ZNXA 4KGXB 1YI2T 3QKJA 4F04B 1Q7YU 1YN8A 4MZTA 3SHWA 4BI3A 1OU9A 1SRLA 3EGXA 1RAIB 4HVVA 4LUEA 4RG8A 4E7SA 2RJEA 2WSCE 5FU7C 5CK9A 2LQ8A 5HKCA 2VXEA 1M8VA 2K4YA 2RQRA 1YHQT 1VQ5A 4HKEA 4C5EA 3NTHA 2PUKB 4ELZC 2LJ1A 1LOJA 1PRLC 1U3OA 3ASKA 1XQHA 1K9MR 4QKUA 1NZ9A 3OBWA 4IUPA 4XTZA 3SWNC 3CCST 3V7SA 1M2OA 2DTOA 4FCYA 1QQJA 1VQ4T 1QKXA 4F16A 4J9BA 4NOYA 2XDBA 1M30A 3RNJA 1QW1A 2EYQA 3QWXX 2V8IA 1BBZA 3CCRT 1U1TA 4FYYB 2ZGWA 4C92E 2F1LA 3TQ7P 3VS6A 2CP7A 1U5SA 3VS7A 2HBPA 1A0NB 1PWTA 3QHSA 4CC2A 5J3BA 4WTOB 4IIMA 5L23A 1K4US 4LDYA 4BI4A 4Q5WA 3CC7Q 2B8AA 1MV3A 3HHTB 1ZSZB 5CKFA 1D3BB 2QYZA 3FC3A 3PE0A 2EKHA 2EYWA 1PCXA 1SEMA 1UGSB 4XU2A 3OS5A 4PJOB 1K8AC 3CC2T 4AFQC 4C5GA 2QQRA 1WJSA 1VQ4Q 2O9VA 1N9SA 4HT8A 1M1GA 2DA9A 1VQ8Q 1I5OB 3GF5A 2ROTA 3BY7A 1W1FA 4OVAA 1E6HA 4QVCA 2RNAA 1AZEA 1KC8U 3QSUA 2A36A 2ZPEB 4M77B 1G2BA 1PM3A 3J81E 5GMKi 2KRMA 5FWBA 1GFCA 2OX7A 3OYBA 1N6AA 3L42A 4Y28E 2GNCA 2DYBA 2DXCA 4R0KA 5GAN4 3CCJA 3I56A 5CQXA 1OZ3A 4CI0C 3HKSA 3KXTA 2RHXA 3EHRA 2CS7A 3PFSA 4D6WA 3OYCA 1WQ7A 2DL3A 1RAFB 1VQ5T 3C94A 2WACA 2YDLA 2D1XA 5LJ5j 1OU8A 2JOYA 1U1SA 1M3BA 4X9CA 1YJNQ 2EQKA 3RR6A 3PVQA 1LVKA 4M75C 4DA4A 4C8QC 5GAOp 1X69A 2X3WD 3CCMT 4A63B 4CRIA 2HZYA 4ELYC 5IHIA 1ARKA 3UA7A 1X2KA 2DXTA 4ME7A 4M7DA 1WXBA 2J6FA 2Y4YA 2OTJA 4A54A 1BI2A 4AFSC 3TU4K 1MMNA 3V7RA 1XNIA 5LJ3j 3MP6A 4ZGDB 2OI3A 4KRTA 4C92F 1Y71A 2EYXA 5I2MA 3RKYA 3LWHA 2K57A 2A08A 3PIOA 4JJBA 1YITA 2VYTA 2LJ3A 4IUQA 1VQOA 4Y92A 3RIRA 2YWWA 3EFSA 3OW2P 1D1AA 2L2PA 3CC2Q 2ECZA 2KVQG 2LVMA 4BE0A 4E7HA 1O75A 2ZZDA 3DB4A 3CCVT 3OS0A 4EDUA 2H3JA 1G8XA 4HCCA 2O2OA 1MNDA 4FYWB 7AT1B 2DX1A 1D1BA 1UEBA 4OMLA 2KT1A 3CPWA 1N9RA 4ZN3A 2PNIA 1SG5A 1WYXA 1TS9A 4M7AD 2GQIA 2RQUA 3OY9A 1IREB 1OULA 1M1KU 3CCRQ 4E7KA 3MEUA 4Z02A 2QQ9A 3H8ZA 1YJ9Q 2CZ7B 4PJOG 4J9DA 4JJCA 1I8FA 2AHJB 3S3OA 4OMNA 1X27A 1TH7A 2D8HA 3EH2A 3LGLA 2C06A 2MAMA 4FSSA 8ATCB 4C0GA 5GAN5 5CVIA 5GMKh 3L2UA 2M02A 2YRCA 5GAMg 3HP9A 4RTZA 2XU8A 3AT1B 1RAEB 1JO8A 1VQKT 2QA4T 4UC4A 3A8MB 1V1CA 4RKUE 1QWEA 3BW1A 3VS0A 3V7CA 2RHYA 1YHQQ 2XG8D 2DL8A 2E70A 3OYHA 2COWA 5GAMe 2JUFA 3RKWA 4NL3A 1M8MA 2KT8A 3CCEA 3C12A 4F7UE 4M77F 4F7UB 2PVDB 3TVTA 1G3YA 5FU6C 1IHWA 2DXUA 1EX4A 1YI2Q 2O01E 3A8HB 1ABQA 1KC8C 3G71T 2F5TX 2AZSA 4ESRA 4M77E 4B6MA 1AWXA 4Z8AA 1VYVA 2JTFA 4L59A 3EGDA 3P8DA 3N5BB 4P5NA 3META 3KFVA 1YJ9T 3MEWA 4C5HA 2DD4A 3GLXA 1Y96B 2E3HA 2M16A 1R8OB 1G3WA 2NYSA 5GAN6 2KRSA 4M7DB 4BE2A 4PFZA 4B9WA 4N4IA 1V76A 1TWBA 1ZX6A 1JJ2S 1JXMA 1K73C 4AFUC 4AG2C 3FIFA 1FX7A 1T3LA 3JCMc 3I55T 4XTYA 2EKOA 5IXFA 2RJDA 1KFZA 4B9XA 3I35A 1JJ2P 2JZ2A 2K5FA 3LH0A 3J7AF 4EPCA 2LQWA 3IQLA 1D1CA 3PMTA 1YWOA 3MKDA 4IUVA 1VQLQ 1JBMA 3FJ5A 4R55A 2X4WA 3JCMg 1RAGB 1AVZC 3MP1A 3FJPA 1YBYA 3I5RA 4KH1B 1AWOA 2LTOA 4ORZA 1OPLA 3OBYA 1K9AA 2CSQA 2YHTA 2K7AA 1QP2A 1G3TA 1BIAA 2KSSA 4QT7A 1NG2A 2RA2A 3EFOA 2FZGB 4IUUA 5IXBA 2DEQA 4JJNK 5M9OA 1QVGP 4HCZA 3JRZA 2YUOA 3ZEHA 1KQ1A 3MHXA 3HRUA 1S72A 4M7AB 2CZ0B 2RQWA 5KYUB 2ZPGB 1M90C 1X01A 3CCLT 1QVGS 2P0KA 2KAFA 1X43A 1VA7A 4Y91A 2VASA 3QPHA 1Q82R 2YUPA 4IIOA 4TVRA 4BDZA 2DLPA 4LXCA 3JCMJ 5FW9A 2DTHA 3JCMb 3JB9D 3OA6A 2EWNA 2L89A 2LT1A 2RI3A 1CKAA 3MO8A 1R77A 4M7DD 3JCMd 4C92C 3JCMP 1VQKQ 6AT1B 5J26A 1TTHB 2LMJA 1VQPA 3NHNA 2LZ6B 5FRNA 1TUGB 3CMAA 1X6OA 3L2ZA 3VJPA 4ZN1A 2XICA 2G6FX 2VB6A 3CCLA 3R6OA 2V8KA 4M7DE 4D8KA 1QVFS 1WJQA 4CC3A 4HT9A 2QGGA 1Q86R 1WX6A 2KK4A 1K1ZA 5HY6A 4N4HA 3CBOA 2YLBA 2CH4W 3NMZC 4FIBA 4C8QA 1VQ9Q 2PU9B 1R0CB 3SD4A 2KI7A 1OYXA 2PVGB 5LL6S 1PHTA 1SHFA 2QDYB 1WHKA 3TSWA 2X51A 4JS4A 2A28A 3PGGA 4BE1A 1Y7XA 2LQNA 4JZ4A 2JS2A 2IVWA 1JEGA 4AG1C 3GNFB 2GTJA 2WSFE 2YLCA 5KYXA 1U06A 1J3TA 3HSBA 4E7LA 4PJOA 3MEAA 2XKOC 3EGUA 1ZUYA 1PSEA 1Z9ZA 2D8JA 1UFFA 3CC4A 2GGRA 2L0AA 4RTYA 1W4SA 2DK3A 5CCAA 3A1PA 2EJFA 4ANJA 4PKCC 1VQLT 2QG9B 1H3HA 1M90R 2COYA 2Z0WA 4M77D 3CXCP 2DL5A 3A5ZB 3SB2A 3CCUQ 3I9QA 4QW2A 2FPDA 4LD6A 4WF2A 3RERA 1VQ7A 4RCCA 3VYGA 1BI1A 3QO3A 2L3PA 4PL6A 2OTLT 4ZTJA 3WXMB 3OYYA 1UG1A 4J6YA 4M78D 5DLOA 1K76A 1YIJA 1ZA1B 2ED1A 5IH2A 4J9EA 2D9TA 1X6GA 2LJ0A 3RMSA 3CC4Q 3VUBA 1KQSP 2XI9A 5GANd 1VQ9T 2ZPHB 5LJ3f 2DBMA 3CXCA 1UHFA 2V26A 2DFUA 4OMQA 3UATA 4PLIA 3U23A 5I22A 4RTXA 2DJZA 4HA8A 2GF7A 3M58A 3C95A 2RQVA 3MPUB 2KBTA 1CKBA 3GNGA 1Y07A 1K73U 2J06A 2E64A 4M7AE 3OYGA 1YIJQ 3JV3A 3WVDB 2AT1B 2QAZA 4OMOA 4C92D 3QZ9B 5KYWA 1VUBA 4MZMA 3GBQA 3G71A 2L8DA 2R5MA 2QDLA 3VKIA 2RJFA 1OQKA 4L5GA 3ZBDA 4J6XA 4AMCA 2GCXA 2SEMA 3L2QA 2KNBB 3OYFA 2R5AA 2E5KA 1SHGA 2C0OA 2AIRB 4EIKA 4KULA 1UUEA 3X24B 1SSFA 1MMAA 1LJOA 2CGHA 2FO0A 4C92B 3OYKA 4AFZC 3LWIA 2DZ9A 4XU0A 5GANh 3HFNA 3QWYA 1AHJB 4OB2B 3H0HA 1VQNA 1RABB 2JM9A 5GANf 1Q82U 3OB9A 2HMAA 5LJ3d 3T9NA 5GJVB 4HCKA 4XTWA 2LDMA 3A8GB 2DERA 2VGNA 2JXBA 4J9GA 4BY6B 1AWJA 2BE7D 2EPDA 4OGEA 2QASA 3CCSQ 1M2VA 1WDXA 1W70A 1HJDA 1BYMA 1M3CA 2E3IA 4BD3A 4PLLA 2QA4Q 4NS5A 2H3EB 3CCVQ 2CZ6B 2LRQA 1AT1B 4M75B 2EFIA 2CSIA 4BY6C 1SSHA 3VS3A 2E41A 5GANg 1JU5C 5GAMj 2DJQA 3CPWS 5A0DA 4BACA 1Q81U 1GFDA 3INZA 1YJWQ 4L6V5 3A8OB 1FMWA 3OQ5A 2A37A 2RK2A 2IPOB 4XU1A 1XOVA 5CKBA 3CMEQ 2XMFA 1Q81R 3TREA 4MDWA 4XAXB 4ZGJB 3UF4A 2E65A 4GY5A 3X25B 3FLGA 3NFCA 1JB0E 1G3SA 4C92G 4KUIA 4DQ2A 4O5VA 5IHNA 3VRZA 1PNJA 2MWOA 2D0QB 9ATCB 2HNIA 3CC4T 1G5VA 3HTRA 3NPFA 4M78B 4NL2A 1M9SA 1ZSGA 1MV0B 2EJGA 3G1JA 4J9CA 2RPNA 1QVFP 3BE3A 1LCKA 2DEUA 1I5LA 4CC7A 2SRCA 1YJNT 3PNWC 4RTVA 2LNHB 1HD3A 1EIFA 3G71Q 1WXTA 4E6RA 3LH5A 2CP6A 2RO0A 4EMHA 1VQMT 3I56T 2HDAA 2EQMA 2LP5A 4IUTA 3UDCA 1KD1C 4KGVB 5LJ5f 2L5QA 3EG2A 4BB7A 1VQ6A 3JB9I 3OMGA 2DILA 2OTJT 3Q1JA 2DO3A 1MUZA 3EGDB 2HD0A 4M75A 4XU3A 1KQSA 2NUTA 3MCAB 5GJWB 1OEBA 3M0PA 3RUXA 1PD1A 4J5YA 3G6EA 2CT4A 3OSVA 4F14A 4A4HA 4F7UF 2E1HA 1HSQA 3SDZA 3CCJQ 3QIIA 2O9SA 2X9HA 4J8OA 2HKQB 1ZUUA 4MDXA 1FXXA 2DIQA 1Z9QA 2YUNA 3QDRB 5KYXB 4LDWA 2EGEA 4YTLA 5LJ5e 1QP3A 8AT1B 1XJWB 2YRVA 1KD1R 2J6KA 4LDVA 1NYGA 2BZXA 4J7FA 4HVWA 1NPPA 1PKTA 3NGPA 1K9MU 2FPEA 3QZ5B 3JCMV 2KE9A 4FW1A 4LD9K 1YWPA 2LCSA 1HYOA 2CP3A 1HXDA 2BTTA 2NUZA 5C6SA 2JT4A 4GLKA 1VQ6Q 4OF1A 1BK2A 3RMQA 3ER0A 2EIFA 2HSPA 3QYGB 5D7UA 3I5SA 2K9GA 2RJCA 4HXJA 4RTTA 5AYFA 3TSZA 3CEYA 3VRYA 4OB0B 1ZHIA 1ABOA 1DJ7B 3TCJA 3VS2A 4KGZB 3JCMQ 2K2VA 4JDSA 4OMPA 2GQVA 2FG0A 4KUDK 2BZ8A 5L8RE 2FRYA 4DBFA 1M3AA 5D6XA 1TXQA 2DD5A 2E4HA 3OYAA 1FMKA 3QBYA 4LE9A 3EFRA 2MK5A 2P0QA 4FU6A 3MEVA 1I81A 1PSFA 2AKLA 2J7IA 3UPUA 2RHIA 5D6YA 1WNLA 1H641 2EBPA 4DEXA 2RMOA 1VQOQ 4J83A 1M5Q1 3PVLA 5IAYA 5GAOl 2DBKA 4A4KA 1ZSZC 1X75C 1AEYA 3LW5E 2P4TA 1ZBJA 1ZA2B 5GANj 4M75F 4J9IA 4PJOF 1KJWA 1JRIA 2E6NA 2DE0X 1TSFA 2FRWA 3REBB 3H41A 4A4FA 1N27A 4OGCA 4PFPA 4F7UG 4C8QG 4OB1B 1RI0A 2PTKA 2CT3A 3OW2A 3EFOB 3H9NA 4JZ3A 1KIKA 3EG1A 1GL5A 1UGQB 4X1VA 1NJIU 5D6WA 2F2WA 3A8LB 3CBPA 4M78E 5C0MA 4M77G 2KXDA 1WIEA 1UB4A 4M7AC 1Q82C 5CAIA 1UECA 1VIFA 2J05A 1GBRA 5GMKe 3M0RA 3VS1A 2B86A 4R56A 2PUOB 5GMKm 1OX8A 1AWWA 2DPPB 2K2MA 1P92A 2GBQA 3RKXA 1D0YA 4II1A 1EZZB 3E2UA 1H92A 4M78A 3HL8A 1C0MA 1WQWA 3E19A 5KYNA 2QEXT 1VQMA 3I56Q 2HQXA 1Y57A 3RDVA 1NEGA 2VVKA 4FM4B 2QA4A 1UDLA
chains in the Genus database with same CATH topology
3CMEQ 1YJ9Q 2QA4Q 1Q86R 3CCEQ 1Q81R 3CCJQ 1K73R 3CCVQ 1YIJQ 1NJIR 1M90R 1VQ5Q 1QVFP 3CCLQ 1VQMQ 1YITQ 1QVGP 3CPWP 1Q82R 1VQ9Q 1VQ7Q 1YI2Q 3CXCP 3CCQQ 3CCUQ 3CCMQ 1JJ2P 2OTLQ 1S72Q 1KC8R 1VQ4Q 3I56Q 3CD6Q 3OW2P 3G4SQ 1YJNQ 1YHQQ 3CMAQ 3G71Q 3CC4Q 1VQ8Q 1VQ6Q 1VQNQ 3CCSQ 3CC2Q 1KQSP 3CC7Q 3I55Q 1M1KR 1VQKQ 1YJWQ 1K8AR 2OTJQ 1VQOQ 1KD1R 1W2BP 1Q7YR 1VQPQ 3G6EQ 2QEXQ 3CCRQ 1N8RR 1VQLQ 1K9MR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME Q;  1YJ9 Q;  2QA4 Q;  1Q86 R;  3CCE Q;  1Q81 R;  3CCJ Q;  1K73 R;  3CCV Q;  1YIJ Q;  1NJI R;  1M90 R;  1VQ5 Q;  1QVF P;  3CCL Q;  1VQM Q;  1YIT Q;  1QVG P;  3CPW P;  1Q82 R;  1VQ9 Q;  1VQ7 Q;  1YI2 Q;  3CXC P;  3CCQ Q;  3CCU Q;  3CCM Q;  1JJ2 P;  2OTL Q;  1S72 Q;  1KC8 R;  1VQ4 Q;  3I56 Q;  3CD6 Q;  3OW2 P;  3G4S Q;  1YJN Q;  1YHQ Q;  3CMA Q;  3G71 Q;  3CC4 Q;  1VQ8 Q;  1VQ6 Q;  1VQN Q;  3CCS Q;  3CC2 Q;  1KQS P;  3CC7 Q;  3I55 Q;  1M1K R;  1VQK Q;  1YJW Q;  1K8A R;  2OTJ Q;  1VQO Q;  1KD1 R;  1W2B P;  1Q7Y R;  1VQP Q;  3G6E Q;  2QEX Q;  3CCR Q;  1N8R R;  1VQL Q;  1K9M R; 
#chains in the Genus database with same CATH topology
 2NLU A;  2C0I A;  2P4R A;  3OW2 S;  3TEE A;  2EJ9 A;  2LC4 A;  3CME A;  1YIT Q;  3FEO A;  1UGP B;  4DBH A;  2DVJ A;  2L3Q A;  2FZC B;  1VQO T;  1VQK A;  5EC7 A;  1GCQ A;  2JTE A;  2X4Y A;  3HPW A;  3CD6 T;  2DVE A;  5CR2 A;  4PJJ A;  5LJ3 g;  1D3B A;  1RUW A;  1K73 R;  1I4K 1;  1NJI R;  2V8J A;  2HBW A;  3A98 A;  3DKM A;  3EG9 B;  3MJX A;  4F17 A;  5FRO A;  5GAN 8;  2EW3 A;  3CCS A;  1IXD A;  1MGQ A;  2O4X A;  2XDD A;  2QQA A;  3D7S B;  5KCO A;  4RUG A;  4KH0 B;  2FVU A;  1BCO A;  3M0S A;  2A7Y A;  2RD1 A;  4LUD A;  1I0C A;  3PMI A;  4M75 E;  4MML A;  3L2W A;  2RF0 A;  2KGT A;  1WHH A;  1RI9 A;  1BIB A;  4C8Q F;  1K0X A;  2K6D A;  1WZO A;  3JB9 J;  3OMC A;  1OI1 A;  1M27 C;  2RH2 A;  2F2V A;  1WHG A;  1B34 B;  1X6B A;  1IO6 A;  3X28 B;  1ZBX A;  3QJY A;  4DOW A;  4XQ3 A;  4V2S A;  1IGQ A;  1D0X A;  1E6G A;  1AZG B;  5A2Q E;  3VS5 A;  5CIU A;  1VIE A;  2JMA A;  1KHI A;  1SKU B;  2MMP A;  3CCE Q;  1OV3 A;  3HFO A;  1BCM A;  1QKW A;  2EQU A;  4RMO A;  1WFW A;  3VUZ A;  1ZUK A;  1NJI C;  5DLQ E;  2JJ9 A;  2LQK A;  3CCQ Q;  1GBQ A;  1VQN T;  3DB3 A;  3JSC A;  3VV0 A;  1KC8 R;  1BU1 A;  5CO7 A;  4X9D A;  4FT2 A;  1WPY A;  1NEB A;  4BDY A;  1RAC B;  2EYY A;  3QG1 A;  2P0P A;  2QQB A;  1JJ2 A;  3L1A A;  2XK0 A;  1YI2 A;  3L2V A;  3G6E Q;  5I11 A;  2M0O A;  3OYL A;  4E2F B;  1R0B G;  5GAO q;  1F1B B;  1KK7 A;  1VQP T;  1QCO A;  3EG0 A;  4E7J A;  2RQT A;  4QQD A;  3ZFJ A;  4AT1 B;  2JNG A;  3M9Q A;  2CUB A;  1QWF A;  5KYY A;  2O88 A;  4JRI A;  3LGF A;  1WLP B;  1FMV A;  2ED0 A;  3CC7 A;  4X34 A;  3KUF A;  1Q86 C;  1H8K A;  1SPK A;  4EMK C;  3CBM A;  4MMK A;  4A4E A;  5GAM f;  3OS2 A;  2KMT A;  3CD6 A;  4FW2 A;  1VQ7 Q;  2ZPF B;  2DAQ A;  1M2V B;  2JW4 A;  2ENM A;  3S6W A;  3C0C A;  2MOX A;  2E10 A;  2EGA A;  2FHD A;  3GP8 A;  4XK8 E;  2KXC A;  1M1K R;  2JN0 A;  1MMD A;  5CKD A;  1TUD A;  1M1F A;  2K3Y A;  1NLO C;  5LJ5 h;  1I07 A;  1UHC A;  1WA7 A;  2JTM A;  2HAX A;  2MPX C;  3QUI A;  1W2B A;  2DL4 A;  4KT0 E;  4C0D B;  2R57 A;  1UJ0 A;  1B34 A;  1RAA B;  4E47 A;  1VQ6 T;  4RG2 A;  5LJ3 e;  3OYI A;  1X2Q A;  5CQY A;  2DIG A;  5GMK j;  1H3Z A;  2W10 A;  4PJN A;  3VS4 A;  4IUR A;  4C92 A;  3CMA Q;  4QQG A;  5FU7 B;  5FLX E;  3CCU A;  1OPK A;  4PJL A;  2RK1 A;  1VQP Q;  2GFA A;  1HK9 A;  1M4Z A;  3M54 A;  3CCQ T;  3PTA A;  1VQ5 Q;  4PFO A;  1YNZ A;  2ZPI B;  3CCE T;  2HKN A;  3ZL7 C;  1E7O A;  3EG3 A;  3BFM A;  1BI0 A;  5J39 A;  3CC2 A;  4WCI A;  3CCV A;  5ECA A;  1K9M C;  3JCM W;  3NTI A;  3QJ6 A;  3V8L A;  4N4G A;  3JCM f;  1W2B P;  2XD0 A;  1MHN A;  3RES A;  2E6Z A;  3LX7 A;  3VYH B;  1Q95 G;  4RCB A;  2IG0 A;  4J9H A;  5GAN 3;  2RHZ A;  5KH6 A;  3FB9 A;  1K8A U;  2HL3 A;  1KG1 A;  1YJ9 A;  4M4Z A;  4Z89 A;  1W2B S;  1ACM B;  4M7D G;  3OYN A;  1O9S A;  4KBM B;  2XHC A;  1D09 B;  1BKB A;  1I1J A;  2OTJ Q;  1YP5 A;  1ZLM A;  1VQ9 A;  4C8Q B;  5IT9 E;  1K0S A;  1VQM Q;  2X4J A;  2MI6 A;  2GTO A;  3M55 A;  3M0Q A;  2ZAE A;  3SWN A;  2QQS A;  1JQQ A;  2JMC A;  1SRM A;  1PC0 A;  5GAO r;  4M78 G;  5FWC A;  4M7D C;  1B07 A;  4XTU A;  2ROL A;  3C4S A;  4RTW A;  1VQL A;  2FZK B;  1S72 T;  1QLY A;  2M9U A;  1VYT A;  2VC8 A;  1IB8 A;  1QVP A;  3CPF A;  2CH4 A;  5GAO m;  4O6J A;  3DLL A;  4LN2 A;  1OZ2 A;  1LPL A;  3CMA T;  1S72 Q;  4XTX A;  4QQ6 A;  1YCS B;  3UT1 A;  2W0Z A;  4BI8 B;  1K8A R;  1UE9 A;  2QXF A;  3CQT A;  3REA B;  4C0D C;  2QEX Q;  4M78 C;  2ZPB B;  3CME T;  3M53 A;  1UGV A;  5IHK A;  2CDT A;  2X3X D;  4QVZ A;  1Y0M A;  1YIJ T;  1QCN A;  3CCJ T;  2WSE E;  3EG9 A;  2FL7 A;  1NYF A;  2H8H A;  2I0N A;  2KYB A;  1RAH B;  3HRT A;  3CCU T;  2YXY A;  2MYS A;  2ABL A;  4M7A A;  2FEI A;  1YJN A;  1Q81 C;  2M0Y A;  5EG2 A;  2EQJ A;  1OOT A;  2JS0 A;  2BIV A;  5GAN 7;  4ATO A;  1U8R A;  3CCM A;  3CCM Q;  1QVF A;  2FYK A;  1VQ8 A;  3SEM A;  2FB7 A;  2MWP A;  2NUP B;  1UGR B;  1WXU A;  3EGX B;  3M59 A;  1BI3 A;  2GFU A;  3URG A;  2OAU A;  4VUB A;  3V8K A;  3G6E T;  1TOV A;  2PZ1 A;  1FWZ A;  4BUG A;  3OYJ A;  4N0A C;  1JXO A;  2RI5 A;  3L2R A;  4EMK A;  1RAD B;  4JPB W;  2CKK A;  3O8V A;  5KE3 A;  2R58 A;  5IN1 A;  2F2X A;  2D6F A;  2VKN A;  1NE8 A;  2YT6 A;  2L3S A;  1NM7 A;  2DRK A;  2QEX A;  1RLQ C;  1WGS A;  1VQ4 A;  2XID A;  1WHM A;  1XTD A;  4JLI A;  3OYM A;  4XTV A;  2DF6 A;  2OTL A;  1C1A A;  4M78 F;  2O31 A;  3CPW P;  4FYX B;  4LDU A;  4D8D A;  2DKG A;  3JCM h;  1W6X A;  2CP2 A;  2VWF A;  1KHC A;  1Q7Y R;  2K79 A;  1QVG A;  3O5Z A;  1B3Q A;  3H6Z A;  1Y96 A;  5LJ5 d;  1VQ7 T;  2M51 A;  3R6N A;  5I2S A;  1IRX A;  2JM8 A;  4C0F A;  2DXB A;  2RHU A;  4PJO E;  3QDF A;  2DZC A;  2OAW A;  1WHJ A;  2ATC B;  3JB9 G;  1YFN A;  5KYU A;  3CC7 T;  2LX9 A;  1ZSZ A;  4OP0 A;  3DLM A;  5FRM A;  2LCL A;  1VYU A;  2HEQ A;  2RM4 A;  2CUD A;  4Z88 A;  2QK0 A;  4JLG A;  4C5I A;  2PQW A;  2BKD N;  5GAN e;  5GAN 2;  3PIP A;  2HL5 C;  3CCL Q;  1UTI A;  4K11 A;  2BE9 B;  2BZY A;  3M4Y A;  1NPR A;  2OJ2 A;  2LNV A;  3EAE A;  3P8H A;  3X20 B;  3E9F A;  3JAM E;  1KSW A;  4EMG A;  2A0F B;  3UA6 A;  2DMO A;  2LCC A;  2V1Q A;  2X35 A;  3BDU A;  5LJ3 h;  2KEA A;  3OS1 A;  2HCK A;  2MCN A;  2QTX A;  3X26 B;  3I55 A;  1WI7 A;  1WJR A;  3E1S A;  1IGU A;  3H0F A;  3ULR B;  1V29 B;  3ME9 A;  4FSX A;  3SWN B;  3G7Z A;  1GXI E;  3M5A A;  4RTU A;  1N8R U;  5GAM d;  1C6V X;  2CRE A;  4E7Z A;  1KD1 U;  3EH1 A;  2KR3 A;  3KBG A;  1VOM A;  4ZTF A;  2E12 A;  2DRM A;  2FPF A;  2MIO A;  3CCR A;  2KDS A;  3JCM X;  1EFN A;  2LT4 A;  1N8R C;  4M7D F;  4N0A A;  1S1N A;  2NUP A;  2BUD A;  5DM7 R;  1UJY A;  2CYZ B;  2COZ A;  2EAY A;  4J7I A;  4PK4 A;  2LX7 A;  1AD5 A;  3E9G A;  4OMM A;  3M56 A;  1T0H A;  3JB9 H;  2M1H A;  1YJW A;  4DEY A;  2EQI A;  4DOV A;  1YCY A;  2CZ1 B;  3LYI A;  2AK5 A;  5CKH A;  2AZV A;  1M90 U;  2ZCF B;  1M1K C;  1D0Z A;  2J6O A;  2C0T A;  3CD6 Q;  4QVD A;  4OMF B;  3S3N A;  3GOX A;  3S3M A;  4JRK A;  1QMC A;  2V1R A;  3P8B B;  2K5L A;  3THK A;  4A4G A;  2L3R A;  3QXE B;  3M0U A;  3J80 E;  4F7U A;  2NUT B;  1GRI A;  1TUC A;  4C8Q E;  1WHL A;  2E5Q A;  2OTL Q;  1T0J A;  2NWM A;  4OB3 B;  5FU6 B;  2KY9 A;  4GBQ A;  5DY9 A;  1VQN Q;  1SF9 A;  5GMK l;  2I2L A;  3G4S A;  5GAM h;  1KQ2 A;  1T3S A;  3MP8 A;  3H0I A;  4E7I A;  1CSK A;  3EHQ A;  4DBQ A;  4PJO D;  4CC4 B;  1FYN A;  3OYE A;  3BDL A;  4J6W A;  4LNP A;  1YJW T;  1N5Z A;  2ESW A;  2HQE A;  4PJO C;  5KE2 A;  2KQW A;  3CCQ A;  2X4X A;  5AT1 B;  1Q86 U;  3F70 A;  2KRN A;  2KRO A;  3SFM A;  4LDX A;  3M57 A;  3FRN A;  4A53 A;  2F69 A;  3OYD A;  2VV5 A;  4M7A G;  4MZP A;  4M77 C;  2QGF B;  3UWN A;  2RI2 A;  4M75 G;  2DTI A;  2MF2 A;  2K3X A;  1IZ6 A;  1TG0 A;  2QTV A;  2VGM A;  2K3B A;  3G4S T;  1PRM C;  2HQH A;  4M75 D;  4J9F A;  3HRS A;  3FDR A;  2F5K A;  3PT9 A;  3CXC S;  1ZQ1 A;  3LLR A;  4FL6 A;  2DNU A;  4JRP A;  3RBB B;  2CP0 A;  1YHQ A;  2K5I A;  5HCK A;  4M77 A;  1GCP A;  1MMG A;  2HSE B;  2YSQ A;  2EYZ A;  1PKS A;  2VUB A;  2Y90 A;  1B7T A;  2DM1 A;  4HVU A;  4ZGE B;  2JVV A;  3M4G A;  3G4S Q;  1NLP C;  5CKE A;  1IHV A;  3GPL A;  2RB6 A;  4HCB A;  1AOJ A;  4PJM A;  5LJ5 g;  5I21 A;  4JS5 A;  3VU3 C;  2DET A;  5HK0 A;  1KQS S;  4DBR A;  5KCH A;  2AKK A;  3NTK A;  3GIB A;  1RLP C;  5A0L A;  2DL7 A;  2EVR A;  1VQ8 T;  3I55 Q;  1PD0 A;  1BB9 A;  4GLM A;  2KYM A;  3WVE B;  2DYI A;  4IKF A;  1NBE B;  1TU0 B;  5HK3 A;  1G83 A;  2D0N A;  2Y4X A;  3JB9 F;  4JRQ A;  4JUV A;  3QYH B;  2O4X B;  2EGC A;  4FT4 A;  2VXF A;  4FYV B;  5A0G A;  1GCQ C;  1PG5 B;  1LNX A;  4C0Z A;  2CP5 A;  2YUQ A;  1N8R R;  4PNO A;  3JCM e;  2PVO B;  1RL2 A;  2P84 A;  1YIT T;  2RN8 A;  1Q7Y C;  2G3R A;  5KYW B;  4JJD A;  4C8Q D;  4EMK B;  2YRD A;  1MNE A;  3AHU A;  2QI2 A;  2IIM A;  1QCF A;  3M0T A;  5GAO n;  5KYY B;  1OX9 A;  4M7A F;  2A3L A;  3OSS C;  3V8J A;  2XDP A;  4ZNX A;  4KGX B;  1YI2 T;  3QKJ A;  4F04 B;  1Q7Y U;  1YN8 A;  4MZT A;  3SHW A;  4BI3 A;  1OU9 A;  1SRL A;  3EGX A;  1RAI B;  4HVV A;  4LUE A;  4RG8 A;  4E7S A;  2RJE A;  2WSC E;  5FU7 C;  5CK9 A;  2LQ8 A;  5HKC A;  2VXE A;  1M8V A;  2K4Y A;  2RQR A;  1YHQ T;  1VQ5 A;  4HKE A;  4C5E A;  3NTH A;  2PUK B;  4ELZ C;  2LJ1 A;  1LOJ A;  1PRL C;  1U3O A;  3ASK A;  1XQH A;  1K9M R;  4QKU A;  1NZ9 A;  3OBW A;  4IUP A;  4XTZ A;  3SWN C;  3CCS T;  3V7S A;  1M2O A;  2DTO A;  4FCY A;  1QQJ A;  1VQ4 T;  1QKX A;  4F16 A;  4J9B A;  4NOY A;  2XDB A;  1M30 A;  3RNJ A;  1QW1 A;  2EYQ A;  3QWX X;  2V8I A;  1BBZ A;  3CCR T;  1U1T A;  4FYY B;  2ZGW A;  4C92 E;  2F1L A;  3TQ7 P;  3VS6 A;  2CP7 A;  1U5S A;  3VS7 A;  2HBP A;  1A0N B;  1PWT A;  3QHS A;  4CC2 A;  5J3B A;  4WTO B;  4IIM A;  5L23 A;  1K4U S;  4LDY A;  4BI4 A;  4Q5W A;  3CC7 Q;  2B8A A;  1MV3 A;  3HHT B;  1ZSZ B;  5CKF A;  1D3B B;  2QYZ A;  3FC3 A;  3PE0 A;  2EKH A;  2EYW A;  1PCX A;  1SEM A;  1UGS B;  4XU2 A;  3OS5 A;  4PJO B;  1K8A C;  3CC2 T;  4AFQ C;  4C5G A;  2QQR A;  1WJS A;  1VQ4 Q;  2O9V A;  1N9S A;  4HT8 A;  1M1G A;  2DA9 A;  1VQ8 Q;  1I5O B;  3GF5 A;  2ROT A;  3BY7 A;  1W1F A;  4OVA A;  1E6H A;  4QVC A;  2RNA A;  1AZE A;  1KC8 U;  3QSU A;  2A36 A;  2ZPE B;  4M77 B;  1G2B A;  1PM3 A;  3J81 E;  5GMK i;  2KRM A;  5FWB A;  1GFC A;  2OX7 A;  3OYB A;  1N6A A;  3L42 A;  4Y28 E;  2GNC A;  2DYB A;  2DXC A;  4R0K A;  5GAN 4;  3CCJ A;  3I56 A;  5CQX A;  1OZ3 A;  4CI0 C;  3HKS A;  3KXT A;  2RHX A;  3EHR A;  2CS7 A;  3PFS A;  4D6W A;  3OYC A;  1WQ7 A;  2DL3 A;  1RAF B;  1VQ5 T;  3C94 A;  2WAC A;  2YDL A;  2D1X A;  5LJ5 j;  1OU8 A;  2JOY A;  1U1S A;  1M3B A;  4X9C A;  1YJN Q;  2EQK A;  3RR6 A;  3PVQ A;  1LVK A;  4M75 C;  4DA4 A;  4C8Q C;  5GAO p;  1X69 A;  2X3W D;  3CCM T;  4A63 B;  4CRI A;  2HZY A;  4ELY C;  5IHI A;  1ARK A;  3UA7 A;  1X2K A;  2DXT A;  4ME7 A;  4M7D A;  1WXB A;  2J6F A;  2Y4Y A;  2OTJ A;  4A54 A;  1BI2 A;  4AFS C;  3TU4 K;  1MMN A;  3V7R A;  1XNI A;  5LJ3 j;  3MP6 A;  4ZGD B;  2OI3 A;  4KRT A;  4C92 F;  1Y71 A;  2EYX A;  5I2M A;  3RKY A;  3LWH A;  2K57 A;  2A08 A;  3PIO A;  4JJB A;  1YIT A;  2VYT A;  2LJ3 A;  4IUQ A;  1VQO A;  4Y92 A;  3RIR A;  2YWW A;  3EFS A;  3OW2 P;  1D1A A;  2L2P A;  3CC2 Q;  2ECZ A;  2KVQ G;  2LVM A;  4BE0 A;  4E7H A;  1O75 A;  2ZZD A;  3DB4 A;  3CCV T;  3OS0 A;  4EDU A;  2H3J A;  1G8X A;  4HCC A;  2O2O A;  1MND A;  4FYW B;  7AT1 B;  2DX1 A;  1D1B A;  1UEB A;  4OML A;  2KT1 A;  3CPW A;  1N9R A;  4ZN3 A;  2PNI A;  1SG5 A;  1WYX A;  1TS9 A;  4M7A D;  2GQI A;  2RQU A;  3OY9 A;  1IRE B;  1OUL A;  1M1K U;  3CCR Q;  4E7K A;  3MEU A;  4Z02 A;  2QQ9 A;  3H8Z A;  1YJ9 Q;  2CZ7 B;  4PJO G;  4J9D A;  4JJC A;  1I8F A;  2AHJ B;  3S3O A;  4OMN A;  1X27 A;  1TH7 A;  2D8H A;  3EH2 A;  3LGL A;  2C06 A;  2MAM A;  4FSS A;  8ATC B;  4C0G A;  5GAN 5;  5CVI A;  5GMK h;  3L2U A;  2M02 A;  2YRC A;  5GAM g;  3HP9 A;  4RTZ A;  2XU8 A;  3AT1 B;  1RAE B;  1JO8 A;  1VQK T;  2QA4 T;  4UC4 A;  3A8M B;  1V1C A;  4RKU E;  1QWE A;  3BW1 A;  3VS0 A;  3V7C A;  2RHY A;  1YHQ Q;  2XG8 D;  2DL8 A;  2E70 A;  3OYH A;  2COW A;  5GAM e;  2JUF A;  3RKW A;  4NL3 A;  1M8M A;  2KT8 A;  3CCE A;  3C12 A;  4F7U E;  4M77 F;  4F7U B;  2PVD B;  3TVT A;  1G3Y A;  5FU6 C;  1IHW A;  2DXU A;  1EX4 A;  1YI2 Q;  2O01 E;  3A8H B;  1ABQ A;  1KC8 C;  3G71 T;  2F5T X;  2AZS A;  4ESR A;  4M77 E;  4B6M A;  1AWX A;  4Z8A A;  1VYV A;  2JTF A;  4L59 A;  3EGD A;  3P8D A;  3N5B B;  4P5N A;  3MET A;  3KFV A;  1YJ9 T;  3MEW A;  4C5H A;  2DD4 A;  3GLX A;  1Y96 B;  2E3H A;  2M16 A;  1R8O B;  1G3W A;  2NYS A;  5GAN 6;  2KRS A;  4M7D B;  4BE2 A;  4PFZ A;  4B9W A;  4N4I A;  1V76 A;  1TWB A;  1ZX6 A;  1JJ2 S;  1JXM A;  1K73 C;  4AFU C;  4AG2 C;  3FIF A;  1FX7 A;  1T3L A;  3JCM c;  3I55 T;  4XTY A;  2EKO A;  5IXF A;  2RJD A;  1KFZ A;  4B9X A;  3I35 A;  1JJ2 P;  2JZ2 A;  2K5F A;  3LH0 A;  3J7A F;  4EPC A;  2LQW A;  3IQL A;  1D1C A;  3PMT A;  1YWO A;  3MKD A;  4IUV A;  1VQL Q;  1JBM A;  3FJ5 A;  4R55 A;  2X4W A;  3JCM g;  1RAG B;  1AVZ C;  3MP1 A;  3FJP A;  1YBY A;  3I5R A;  4KH1 B;  1AWO A;  2LTO A;  4ORZ A;  1OPL A;  3OBY A;  1K9A A;  2CSQ A;  2YHT A;  2K7A A;  1QP2 A;  1G3T A;  1BIA A;  2KSS A;  4QT7 A;  1NG2 A;  2RA2 A;  3EFO A;  2FZG B;  4IUU A;  5IXB A;  2DEQ A;  4JJN K;  5M9O A;  1QVG P;  4HCZ A;  3JRZ A;  2YUO A;  3ZEH A;  1KQ1 A;  3MHX A;  3HRU A;  1S72 A;  4M7A B;  2CZ0 B;  2RQW A;  5KYU B;  2ZPG B;  1M90 C;  1X01 A;  3CCL T;  1QVG S;  2P0K A;  2KAF A;  1X43 A;  1VA7 A;  4Y91 A;  2VAS A;  3QPH A;  1Q82 R;  2YUP A;  4IIO A;  4TVR A;  4BDZ A;  2DLP A;  4LXC A;  3JCM J;  5FW9 A;  2DTH A;  3JCM b;  3JB9 D;  3OA6 A;  2EWN A;  2L89 A;  2LT1 A;  2RI3 A;  1CKA A;  3MO8 A;  1R77 A;  4M7D D;  3JCM d;  4C92 C;  3JCM P;  1VQK Q;  6AT1 B;  5J26 A;  1TTH B;  2LMJ A;  1VQP A;  3NHN A;  2LZ6 B;  5FRN A;  1TUG B;  3CMA A;  1X6O A;  3L2Z A;  3VJP A;  4ZN1 A;  2XIC A;  2G6F X;  2VB6 A;  3CCL A;  3R6O A;  2V8K A;  4M7D E;  4D8K A;  1QVF S;  1WJQ A;  4CC3 A;  4HT9 A;  2QGG A;  1Q86 R;  1WX6 A;  2KK4 A;  1K1Z A;  5HY6 A;  4N4H A;  3CBO A;  2YLB A;  2CH4 W;  3NMZ C;  4FIB A;  4C8Q A;  1VQ9 Q;  2PU9 B;  1R0C B;  3SD4 A;  2KI7 A;  1OYX A;  2PVG B;  5LL6 S;  1PHT A;  1SHF A;  2QDY B;  1WHK A;  3TSW A;  2X51 A;  4JS4 A;  2A28 A;  3PGG A;  4BE1 A;  1Y7X A;  2LQN A;  4JZ4 A;  2JS2 A;  2IVW A;  1JEG A;  4AG1 C;  3GNF B;  2GTJ A;  2WSF E;  2YLC A;  5KYX A;  1U06 A;  1J3T A;  3HSB A;  4E7L A;  4PJO A;  3MEA A;  2XKO C;  3EGU A;  1ZUY A;  1PSE A;  1Z9Z A;  2D8J A;  1UFF A;  3CC4 A;  2GGR A;  2L0A A;  4RTY A;  1W4S A;  2DK3 A;  5CCA A;  3A1P A;  2EJF A;  4ANJ A;  4PKC C;  1VQL T;  2QG9 B;  1H3H A;  1M90 R;  2COY A;  2Z0W A;  4M77 D;  3CXC P;  2DL5 A;  3A5Z B;  3SB2 A;  3CCU Q;  3I9Q A;  4QW2 A;  2FPD A;  4LD6 A;  4WF2 A;  3RER A;  1VQ7 A;  4RCC A;  3VYG A;  1BI1 A;  3QO3 A;  2L3P A;  4PL6 A;  2OTL T;  4ZTJ A;  3WXM B;  3OYY A;  1UG1 A;  4J6Y A;  4M78 D;  5DLO A;  1K76 A;  1YIJ A;  1ZA1 B;  2ED1 A;  5IH2 A;  4J9E A;  2D9T A;  1X6G A;  2LJ0 A;  3RMS A;  3CC4 Q;  3VUB A;  1KQS P;  2XI9 A;  5GAN d;  1VQ9 T;  2ZPH B;  5LJ3 f;  2DBM A;  3CXC A;  1UHF A;  2V26 A;  2DFU A;  4OMQ A;  3UAT A;  4PLI A;  3U23 A;  5I22 A;  4RTX A;  2DJZ A;  4HA8 A;  2GF7 A;  3M58 A;  3C95 A;  2RQV A;  3MPU B;  2KBT A;  1CKB A;  3GNG A;  1Y07 A;  1K73 U;  2J06 A;  2E64 A;  4M7A E;  3OYG A;  1YIJ Q;  3JV3 A;  3WVD B;  2AT1 B;  2QAZ A;  4OMO A;  4C92 D;  3QZ9 B;  5KYW A;  1VUB A;  4MZM A;  3GBQ A;  3G71 A;  2L8D A;  2R5M A;  2QDL A;  3VKI A;  2RJF A;  1OQK A;  4L5G A;  3ZBD A;  4J6X A;  4AMC A;  2GCX A;  2SEM A;  3L2Q A;  2KNB B;  3OYF A;  2R5A A;  2E5K A;  1SHG A;  2C0O A;  2AIR B;  4EIK A;  4KUL A;  1UUE A;  3X24 B;  1SSF A;  1MMA A;  1LJO A;  2CGH A;  2FO0 A;  4C92 B;  3OYK A;  4AFZ C;  3LWI A;  2DZ9 A;  4XU0 A;  5GAN h;  3HFN A;  3QWY A;  1AHJ B;  4OB2 B;  3H0H A;  1VQN A;  1RAB B;  2JM9 A;  5GAN f;  1Q82 U;  3OB9 A;  2HMA A;  5LJ3 d;  3T9N A;  5GJV B;  4HCK A;  4XTW A;  2LDM A;  3A8G B;  2DER A;  2VGN A;  2JXB A;  4J9G A;  4BY6 B;  1AWJ A;  2BE7 D;  2EPD A;  4OGE A;  2QAS A;  3CCS Q;  1M2V A;  1WDX A;  1W70 A;  1HJD A;  1BYM A;  1M3C A;  2E3I A;  4BD3 A;  4PLL A;  2QA4 Q;  4NS5 A;  2H3E B;  3CCV Q;  2CZ6 B;  2LRQ A;  1AT1 B;  4M75 B;  2EFI A;  2CSI A;  4BY6 C;  1SSH A;  3VS3 A;  2E41 A;  5GAN g;  1JU5 C;  5GAM j;  2DJQ A;  3CPW S;  5A0D A;  4BAC A;  1Q81 U;  1GFD A;  3INZ A;  1YJW Q;  4L6V 5;  3A8O B;  1FMW A;  3OQ5 A;  2A37 A;  2RK2 A;  2IPO B;  4XU1 A;  1XOV A;  5CKB A;  3CME Q;  2XMF A;  1Q81 R;  3TRE A;  4MDW A;  4XAX B;  4ZGJ B;  3UF4 A;  2E65 A;  4GY5 A;  3X25 B;  3FLG A;  3NFC A;  1JB0 E;  1G3S A;  4C92 G;  4KUI A;  4DQ2 A;  4O5V A;  5IHN A;  3VRZ A;  1PNJ A;  2MWO A;  2D0Q B;  9ATC B;  2HNI A;  3CC4 T;  1G5V A;  3HTR A;  3NPF A;  4M78 B;  4NL2 A;  1M9S A;  1ZSG A;  1MV0 B;  2EJG A;  3G1J A;  4J9C A;  2RPN A;  1QVF P;  3BE3 A;  1LCK A;  2DEU A;  1I5L A;  4CC7 A;  2SRC A;  1YJN T;  3PNW C;  4RTV A;  2LNH B;  1HD3 A;  1EIF A;  3G71 Q;  1WXT A;  4E6R A;  3LH5 A;  2CP6 A;  2RO0 A;  4EMH A;  1VQM T;  3I56 T;  2HDA A;  2EQM A;  2LP5 A;  4IUT A;  3UDC A;  1KD1 C;  4KGV B;  5LJ5 f;  2L5Q A;  3EG2 A;  4BB7 A;  1VQ6 A;  3JB9 I;  3OMG A;  2DIL A;  2OTJ T;  3Q1J A;  2DO3 A;  1MUZ A;  3EGD B;  2HD0 A;  4M75 A;  4XU3 A;  1KQS A;  2NUT A;  3MCA B;  5GJW B;  1OEB A;  3M0P A;  3RUX A;  1PD1 A;  4J5Y A;  3G6E A;  2CT4 A;  3OSV A;  4F14 A;  4A4H A;  4F7U F;  2E1H A;  1HSQ A;  3SDZ A;  3CCJ Q;  3QII A;  2O9S A;  2X9H A;  4J8O A;  2HKQ B;  1ZUU A;  4MDX A;  1FXX A;  2DIQ A;  1Z9Q A;  2YUN A;  3QDR B;  5KYX B;  4LDW A;  2EGE A;  4YTL A;  5LJ5 e;  1QP3 A;  8AT1 B;  1XJW B;  2YRV A;  1KD1 R;  2J6K A;  4LDV A;  1NYG A;  2BZX A;  4J7F A;  4HVW A;  1NPP A;  1PKT A;  3NGP A;  1K9M U;  2FPE A;  3QZ5 B;  3JCM V;  2KE9 A;  4FW1 A;  4LD9 K;  1YWP A;  2LCS A;  1HYO A;  2CP3 A;  1HXD A;  2BTT A;  2NUZ A;  5C6S A;  2JT4 A;  4GLK A;  1VQ6 Q;  4OF1 A;  1BK2 A;  3RMQ A;  3ER0 A;  2EIF A;  2HSP A;  3QYG B;  5D7U A;  3I5S A;  2K9G A;  2RJC A;  4HXJ A;  4RTT A;  5AYF A;  3TSZ A;  3CEY A;  3VRY A;  4OB0 B;  1ZHI A;  1ABO A;  1DJ7 B;  3TCJ A;  3VS2 A;  4KGZ B;  3JCM Q;  2K2V A;  4JDS A;  4OMP A;  2GQV A;  2FG0 A;  4KUD K;  2BZ8 A;  5L8R E;  2FRY A;  4DBF A;  1M3A A;  5D6X A;  1TXQ A;  2DD5 A;  2E4H A;  3OYA A;  1FMK A;  3QBY A;  4LE9 A;  3EFR A;  2MK5 A;  2P0Q A;  4FU6 A;  3MEV A;  1I81 A;  1PSF A;  2AKL A;  2J7I A;  3UPU A;  2RHI A;  5D6Y A;  1WNL A;  1H64 1;  2EBP A;  4DEX A;  2RMO A;  1VQO Q;  4J83 A;  1M5Q 1;  3PVL A;  5IAY A;  5GAO l;  2DBK A;  4A4K A;  1ZSZ C;  1X75 C;  1AEY A;  3LW5 E;  2P4T A;  1ZBJ A;  1ZA2 B;  5GAN j;  4M75 F;  4J9I A;  4PJO F;  1KJW A;  1JRI A;  2E6N A;  2DE0 X;  1TSF A;  2FRW A;  3REB B;  3H41 A;  4A4F A;  1N27 A;  4OGC A;  4PFP A;  4F7U G;  4C8Q G;  4OB1 B;  1RI0 A;  2PTK A;  2CT3 A;  3OW2 A;  3EFO B;  3H9N A;  4JZ3 A;  1KIK A;  3EG1 A;  1GL5 A;  1UGQ B;  4X1V A;  1NJI U;  5D6W A;  2F2W A;  3A8L B;  3CBP A;  4M78 E;  5C0M A;  4M77 G;  2KXD A;  1WIE A;  1UB4 A;  4M7A C;  1Q82 C;  5CAI A;  1UEC A;  1VIF A;  2J05 A;  1GBR A;  5GMK e;  3M0R A;  3VS1 A;  2B86 A;  4R56 A;  2PUO B;  5GMK m;  1OX8 A;  1AWW A;  2DPP B;  2K2M A;  1P92 A;  2GBQ A;  3RKX A;  1D0Y A;  4II1 A;  1EZZ B;  3E2U A;  1H92 A;  4M78 A;  3HL8 A;  1C0M A;  1WQW A;  3E19 A;  5KYN A;  2QEX T;  1VQM A;  3I56 Q;  2HQX A;  1Y57 A;  3RDV A;  1NEG A;  2VVK A;  4FM4 B;  2QA4 A;  1UDL A; 
#chains in the Genus database with same CATH homology
 3CME Q;  1YJ9 Q;  2QA4 Q;  1Q86 R;  3CCE Q;  1Q81 R;  3CCJ Q;  1K73 R;  3CCV Q;  1YIJ Q;  1NJI R;  1M90 R;  1VQ5 Q;  1QVF P;  3CCL Q;  1VQM Q;  1YIT Q;  1QVG P;  3CPW P;  1Q82 R;  1VQ9 Q;  1VQ7 Q;  1YI2 Q;  3CXC P;  3CCQ Q;  3CCU Q;  3CCM Q;  1JJ2 P;  2OTL Q;  1S72 Q;  1KC8 R;  1VQ4 Q;  3I56 Q;  3CD6 Q;  3OW2 P;  3G4S Q;  1YJN Q;  1YHQ Q;  3CMA Q;  3G71 Q;  3CC4 Q;  1VQ8 Q;  1VQ6 Q;  1VQN Q;  3CCS Q;  3CC2 Q;  1KQS P;  3CC7 Q;  3I55 Q;  1M1K R;  1VQK Q;  1YJW Q;  1K8A R;  2OTJ Q;  1VQO Q;  1KD1 R;  1W2B P;  1Q7Y R;  1VQP Q;  3G6E Q;  2QEX Q;  3CCR Q;  1N8R R;  1VQL Q;  1K9M R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...