2QA4Q

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 2qa4Q00
1VQPQ 1KD1R 1Q7YR 1JJ2P 1VQKQ 3CCEQ 3CCQQ 1YJNQ 1VQ8Q 3CMEQ 1S72Q 2QA4Q 3CCRQ 3CCLQ 3CCUQ 3OW2P 1Q86R 1VQ7Q 3CC2Q 1KC8R 3CD6Q 1W2BP 1Q81R 1QVFP 3G4SQ 1K8AR 1YJ9Q 1M1KR 3CCMQ 1KQSP 3CCVQ 3CMAQ 1YI2Q 1YJWQ 1VQOQ 1M90R 2QEXQ 3CCSQ 1YHQQ 1YITQ 3CXCP 3G6EQ 1QVGP 1VQ5Q 1VQMQ 1NJIR 1K73R 2OTJQ 1VQNQ 2OTLQ 1VQLQ 3G71Q 1N8RR 1K9MR 1Q82R 3CC7Q 1VQ6Q 3CC4Q 3I56Q 3CCJQ 1VQ4Q 3CPWP 1YIJQ 3I55Q 1VQ9Q
chains in the Genus database with same CATH superfamily
4ELYC 5CR2A 3GBQA 4M78C 3U23A 5FROA 1UHFA 3C94A 2DXUA 4Z02A 3OYBA 3CMET 4N0AA 3THKA 2B8AA 2AZSA 4WCIA 1ARKA 4JRIA 4M78E 3RERA 2KRNA 1WHGA 5GAN3 5GAMj 2ENMA 2J05A 1UHCA 2FZGB 2EKHA 4XK8E 3X24B 3PGGA 1QCNA 4JJDA 3CEYA 3H0IA 3R6NA 1TOVA 4KT0E 1VYTA 1EFNA 2ZPBB 4J9IA 1IB8A 4ATOA 1GBQA 4JLIA 4OB3B 3GNGA 1QP3A 2L3PA 3EG9B 2GF7A 1Q81C 2PUKB 1K8AC 4HVVA 1RI0A 2LJ0A 5IHNA 3G71A 2E41A 1QMCA 1B34B 3L42A 4M78A 4ZGJB 4BDYA 1BI3A 3QZ5B 1PSEA 4Y28E 4AFUC 2I0NA 3L2QA 1QCFA 4PFOA 3QYHB 2J06A 2EQJA 3A98A 5KYWB 1UFFA 2L2PA 2RHXA 4E6RA 3TSZA 4Q5WA 2AZVA 1IZ6A 2NUTA 4AG2C 2E3HA 2QDLA 3EFOB 3PVLA 4M78G 1KD1C 2ROLA 1W2BS 4ZN1A 1WHLA 2XD0A 4R55A 3M4GA 3GP8A 1VQ5T 3EAEA 2BE7D 5C6SA 4PJOC 3VJPA 2EQUA 2KYMA 2CH4W 2YRCA 3CC2T 3NTKA 1GXIE 4OB1B 3CXCA 2EYQA 2RHUA 5KYUB 3CC4Q 1YJ9T 1QQJA 1MGQA 2D0QB 1H3HA 2QQSA 1UDLA 1S72Q 3M0TA 2DL4A 1VQ7Q 3RBBB 2FPFA 4PLIA 2X4XA 2VXEA 1M4ZA 3OW2A 1U1SA 1TSFA 4QVDA 5IHIA 2E6ZA 2IIMA 2X51A 4FU6A 1K8AU 3QSUA 4OMNA 3VS5A 1CKBA 2JM8A 1UGVA 4KUDK 1SHFA 1PHTA 1CSKA 1SF9A 1YITT 3S3MA 3O5ZA 5I21A 4M75C 1WJQA 4OMPA 3JB9G 4J5YA 3M4YA 2PTKA 1BCOA 3KXTA 3I35A 4ME7A 1YWPA 4PJOA 3HHTB 3JB9I 4WF2A 2HQHA 3LGLA 5D6WA 1V1CA 1NPRA 4GLKA 4M75E 5GAOm 2RN8A 3LGFA 3G1JA 3VUBA 3EH2A 2ZPIB 3DLMA 1KHIA 4ZTJA 3INZA 1NJIC 3JB9H 5FW9A 1KD1U 2QA4A 5L8RE 3KUFA 3PTAA 2DVJA 1XNIA 2COZA 1XJWB 4RTUA 3G4SA 2GFUA 1QVGA 3AT1B 4DBQA 4OB2B 1I0CA 2A08A 1VQNA 4LDUA 4XAXB 1EX4A 1BCMA 3OS2A 2DTOA 2LJ3A 2X3XD 3JRZA 1I5OB 3SWNA 3C95A 3UATA 1R0BG 2QAZA 2LT4A 1EIFA 2YWWA 4M75A 4OGEA 1D0ZA 1Y71A 1OU8A 4DOWA 2RI5A 3QUIA 2FEIA 3D7SB 1ZUYA 5FU7B 2KMTA 2V8JA 3X20B 3SFMA 1RABB 2VUBA 2HSPA 3OYYA 3M9QA 2PVDB 1VQMT 1SG5A 3UDCA 5FRMA 4L59A 2LNHB 2DBKA 3EG3A 3WXMB 2ZPFB 5EG2A 1QP2A 1K73C 2AKKA 1TWBA 3VS0A 3WVDB 1KQSP 2O4XB 2COYA 4LNPA 2K7AA 2EVRA 4IUQA 4M75G 2ESWA 4X34A 3NFCA 1KK7A 3FLGA 4JZ4A 3G6ET 1O9SA 1UEBA 2JMCA 2PVGB 3PFSA 1AWXA 4PL6A 1MV0B 1VQ4A 4B9XA 1Y7XA 1HXDA 3HTRA 3V8JA 1YI2Q 1IHWA 4A4GA 2FB7A 2YT6A 3VS2A 5CCAA 4C8QC 1M3BA 2LX9A 4BDZA 2BIVA 3HFNA 1Q82R 3BDUA 5ECAA 1KQ2A 1E6GA 3NPFA 1RUWA 1AZGB 3HPWA 4IUVA 2P4RA 1LPLA 2GNCA 2D8HA 1D3BB 5I2MA 4C8QE 1WJSA 2RHIA 1QVFA 2VWFA 4A4EA 1YFNA 2CH4A 1FX7A 4TVRA 4RKUE 5DLOA 3VS6A 3UA6A 1BK2A 3PVQA 1WHHA 4OGCA 3RESA 4BI4A 1V76A 2H8HA 3EGXB 1PD0A 2F2WA 3UA7A 3CC4T 4J6YA 2C0TA 9ATCB 1K0SA 4EMKC 1S72T 1UJ0A 2FO0A 1VQ7T 5KE2A 4C8QA 2RI2A 4C5HA 2DXTA 5KYXA 2DD4A 2LC4A 4A54A 2K2MA 2BE9B 3CC7A 3A1PA 1TH7A 2RM4A 1BKBA 1VQ9A 3CCEA 1M90R 1ZSZA 3LH0A 1VOMA 4YTLA 1RAFB 5M9OA 2GGRA 1SRLA 1NYFA 4MDWA 4OMFB 2BZ8A 5FWBA 1YIJQ 1RAGB 1D1BA 4RCBA 2O01E 2BKDN 3CMEQ 2ZPGB 2F2XA 5HK3A 5KH6A 4C8QG 4M7DF 1U5SA 5DM7R 1M2VA 2A7YA 2RI3A 4II1A 4OB0B 3OS5A 3P8HA 4R0KA 4EMKA 1M1KU 1RAHB 2NYSA 1VQ5A 4A63B 4E7SA 5IAYA 1JU5C 2RQVA 3J81E 1W2BP 4QQ6A 2CP6A 2ED1A 4PFZA 1X43A 3PE0A 4M7DB 4FL6A 2DZCA 5GAOn 1V29B 2GQVA 4Z8AA 2L3RA 3EG0A 1OQKA 2RMOA 5LJ3h 3LH5A 2Y4YA 3MKDA 1PG5B 1VQ8Q 4BE2A 2RHZA 1JXMA 4PNOA 4F7UF 1KC8R 4DBFA 2HL3A 2CUBA 2DRMA 3M58A 3VYGA 4CI0C 1VQOQ 2WSCE 2FHDA 4LUDA 2YRDA 4KUIA 1D1CA 3NGPA 4HVWA 2OX7A 1IXDA 1G3YA 3P8BB 5FLXE 3JCMb 3MP8A 2O31A 2DXBA 1QLYA 2VXFA 3V8LA 1U8RA 3I56A 1IHVA 3FJ5A 3I55A 1CKAA 1X01A 3PIPA 2KYBA 4M7DD 2CS7A 2EJ9A 4JDSA 5GANf 3JCMh 5GAN2 2E10A 3F70A 4BY6C 1VQPQ 1YI2T 3MEAA 4FT4A 3CXCS 3L2UA 1HYOA 4E7IA 3CC2Q 4J9FA 1N8RU 1PNJA 3TU4K 2Y90A 4ELZC 1K9MU 1YJ9Q 3O8VA 4KGXB 1WXTA 5GANg 1GBRA 2GBQA 1Y96B 2HKNA 2M9UA 3H0FA 3H41A 2BZXA 1PKSA 3DLLA 3MP1A 3OW2S 2YUOA 4C92C 2RJCA 1PRLC 1WYXA 3CPFA 1Q86C 3EHQA 2AKLA 1WDXA 2XK0A 2YHTA 2MF2A 5KYNA 2OAUA 1ACMB 3M53A 1NM7A 4RTWA 1GCQC 4JZ3A 4D8DA 4JJBA 1HSQA 5GMKi 4C92E 2KSSA 4AFQC 1QVPA 1YITQ 1M27C 2HBWA 5IT9E 4J9EA 1D09B 5J26A 2XDPA 3VYHB 3EFRA 3CCST 4F14A 1OOTA 3RIRA 5GAN8 4LDYA 3TSWA 2HMAA 5GANd 3CCMQ 8AT1B 5A0LA 1R77A 2V26A 1YHQQ 1Q7YC 4M78F 2MIOA 4N4GA 2FL7A 2OTJQ 1BIAA 3OS0A 4C92A 2ZPEB 2JS2A 4FT2A 2XMFA 4WTOB 1QVGS 5CIUA 5GANe 3X28B 2P84A 1JJ2A 1RAEB 5LJ3f 3EGDA 5AYFA 2K5FA 4J6WA 4LUEA 1YIJT 1GCQA 4F16A 3IQLA 1YJNT 4FSSA 4JPBW 4RG8A 2WSEE 4XU2A 4J9GA 4J9CA 2BUDA 2HBPA 2JM9A 5LJ3g 4FCYA 2DTHA 2AK5A 4C5GA 1Y0MA 4C92G 2DEQA 4LE9A 1FYNA 3M0SA 2NUTB 1ZX6A 1VQMQ 1WQ7A 3OYKA 3OYHA 2MWOA 2XG8D 5HY6A 3T9NA 1MMGA 4KGVB 1WI7A 3CPWA 1YN8A 2KBTA 4HCBA 1RAAB 3CC4A 6AT1B 3JB9F 2GQIA 5A0GA 5CQXA 1S72A 1N5ZA 1W6XA 3JCMc 1VQ7A 4IKFA 2A37A 1VQ8T 3G6EQ 1AVZC 2EQKA 1XTDA 1ZSGA 5FU6C 1PCXA 2CP2A 4N4HA 5LJ3d 3H6ZA 2EAYA 1KD1R 2RH2A 2QEXT 1VQOT 5I11A 1I07A 1PM3A 3VUZA 3E9GA 2EPDA 2K5LA 2IVWA 3FEOA 2ROTA 2XICA 4D8KA 2KT1A 5LJ3e 3ULRB 2E3IA 2QI2A 1BU1A 5GMKm 1K1ZA 1NE8A 2KEAA 4JRQA 1QVFS 3A8GB 5C0MA 4PJOF 1ZUKA 2EBPA 4RTXA 1E7OA 3ZL7C 2QXFA 3HKSA 1HJDA 2EFIA 4LDWA 3V7SA 5HK0A 2EYWA 3EG9A 1WHMA 2DL3A 1VQ6T 1RACB 1X2KA 3OYJA 2O9VA 2EYZA 3FB9A 1VQPT 2NLUA 2IG0A 2LTOA 5IH2A 1Q95G 2JMAA 1NLPC 4QQDA 2X4YA 1QKXA 1JEGA 4FYYB 3JCMd 4A4HA 2DX1A 1K76A 1H92A 3M0PA 4PJOB 3I5SA 1TG0A 3EHRA 4XU3A 2MCNA 1I4K1 1G8XA 7AT1B 2ABLA 2K3XA 4C0DC 2EW3A 2EYYA 2DL7A 2KT8A 3JCMe 2OI3A 3VS4A 2M16A 2FVUA 3JB9D 4M77F 3ER0A 4ANJA 4ESRA 1Q81U 1KG1A 2C06A 1MHNA 1UECA 2LX7A 1FXXA 4M75F 3MPUB 4C5IA 5GAN6 2ZAEA 2KI7A 3UT1A 2DA9A 5KE3A 3SWNC 1W1FA 3CBPA 2JS0A 3RDVA 2NWMA 2CT3A 2YUQA 1R8OB 2L8DA 3VS1A 4E7LA 1WA7A 3CMAQ 1U06A 2DMOA 4IURA 2EKOA 2KAFA 4D6WA 1DJ7B 4M77B 4B9WA 1NBEB 2YUPA 2JTEA 3CCMT 4PFPA 1IGQA 1TUCA 3VKIA 1YHQT 1AOJA 4PJOD 2OTJT 1C6VX 1D0XA 1QW1A 5HKCA 3C0CA 3CCJT 2J6OA 1O75A 2PQWA 4PJMA 3GNFB 2RB6A 1GRIA 4C0ZA 4C0GA 3OYCA 4MZTA 5D6XA 1UGRB 3JB9J 1C1AA 3OYAA 2MYSA 4AG1C 3KFVA 3MP6A 1VQKQ 2CSIA 1ZQ1A 2QQ9A 2DXCA 2GCXA 2JXBA 2K6DA 3QDRB 1WX6A 1WHKA 4AT1B 1WQWA 2C0OA 3BFMA 2DETA 3L2VA 1MMAA 4KRTA 2AIRB 1SRMA 3CXCP 1BBZA 3E9FA 4QKUA 1N6AA 2VC8A 3M0UA 3RR6A 2QQAA 2FPEA 4M77D 4A53A 2M1HA 3HL8A 3OA6A 1AEYA 3BDLA 3OW2P 4CC4B 3I9QA 1BI1A 4P5NA 5GANj 2C0IA 4K11A 2NUPA 1VQLT 4HCCA 4OVAA 5KCOA 3TVTA 2KNBB 2XDDA 4JRKA 3H8ZA 2IPOB 2OAWA 2LDMA 2CP5A 3GIBA 3DB3A 4ZGEB 1YJWT 1WXUA 2L3QA 3PMIA 1VUBA 4C8QF 4HT8A 2LJ1A 1M1KR 3H0HA 5GJVB 3NTHA 4OMMA 3FJPA 2J7IA 1N27A 2AT1B 3L2RA 2MMPA 2HKQB 5D6YA 3BY7A 4NL2A 4J9BA 2CKKA 4VUBA 4CC2A 2QTXA 2F69A 1NJIU 3JCMW 4HVUA 3PIOA 5A2QE 4OMQA 3HSBA 1G2BA 2DEUA 3I5RA 3OYFA 1YIJA 1M8VA 1ZSZC 4C8QB 2JW4A 3CMEA 5CVIA 1RLPC 2RJDA 5KYXB 1QVGP 2HQEA 1M2OA 4BD3A 1KIKA 1OX8A 1TUDA 4L6V5 3TEEA 3JV3A 2SEMA 3UPUA 1ZA1B 2P0KA 4MMKA 2CZ6B 2V8IA 2E1HA 2DE0X 4GLMA 1LVKA 2MOXA 5I22A 1YNZA 4HKEA 2RPNA 3P8DA 1TTHB 3CCSQ 2F1LA 2DLPA 1NEGA 1IREB 5LJ3j 1X2QA 4M7AF 1SKUB 3JAME 3OS1A 4CC3A 1MUZA 2JTMA 2LZ6B 2HSEB 2DM1A 4Y92A 1B3QA 1T0JA 2EQIA 1K73U 3CCLQ 1SHGA 4EMKB 1M8MA 2RJFA 1AHJB 2PU9B 1VQ8A 1GL5A 1JJ2S 1OV3A 4LD6A 4RTVA 4C8QD 3A8LB 2CP0A 1X6GA 1SSHA 2EGEA 4J6XA 1N8RR 3J80E 4KULA 2RK1A 4M7AB 1VQOA 2D9TA 2CGHA 1LOJA 4J8OA 1K9MR 2JNGA 3CMAT 4HCKA 1YJNQ 2FYKA 3GF5A 1UGQB 2QASA 3VRZA 1JRIA 3PMTA 3CD6Q 3M56A 5CAIA 1Y57A 2Y4XA 5LJ5h 2CZ1B 2LNVA 2VYTA 1U1TA 2RA2A 2SRCA 3EG1A 2QQRA 2W10A 2EGCA 1M1FA 3ZFJA 5KYYA 3CCQQ 4FW2A 1GFDA 2KRMA 3QJYA 1VQPA 1QVFP 3CPWS 3CC2A 4OP0A 3URGA 3DB4A 1VQKT 4NS5A 2VKNA 2YSQA 2KVQG 2LVMA 4IIOA 1YJ9A 1WXBA 5GAOr 4DQ2A 3E2UA 3HRTA 1XQHA 4M7AD 4FYVB 1I81A 1M5Q1 4PKCC 3PNWC 5CKDA 1K4US 4KH0B 1OULA 2KGTA 4A4KA 2K5IA 4J9DA 2X4WA 3VV0A 1I8FA 1ZHIA 3QG1A 5D7UA 2QEXQ 2BZYA 3QWXX 2CUDA 4N4IA 1RLQC 4NL3A 1YITA 2EQMA 2EJFA 3OYEA 2LQ8A 1UGPB 2M02A 1OZ2A 5CK9A 4F7UB 2R57A 3CCVQ 5GJWB 4OMOA 3MEVA 4X9DA 3VU3C 1ZBJA 2DAQA 2DJQA 1Y07A 3CCMA 4J7IA 1VQ6Q 3REAB 2A3LA 1WIEA 2CT4A 1WNLA 3LLRA 1YHQA 1KC8C 1MV3A 2QYZA 2RQUA 2G3RA 4RUGA 2OTJA 3V7CA 3L2WA 3CCRQ 2KQWA 2DKGA 3Q1JA 4OMLA 2QGGA 2A28A 4C92F 3E19A 1I1JA 1S1NA 2RJEA 4XTWA 5CQYA 3QKJA 3VS7A 4BY6B 5GMKl 3G4ST 1TUGB 2LCCA 1G3TA 1EZZB 3A8HB 2LRQA 1M1GA 1PWTA 5L23A 3QYGB 1ZA2B 1VQNT 3CQTA 5GMKh 1KFZA 4E7HA 2QGFB 3HFOA 4C92B 4MZMA 4DBHA 2G6FX 4KGZB 3DKMA 1PSFA 2MI6A 2LQNA 1HD3A 1M30A 1PD1A 2P4TA 4O5VA 4AMCA 4ZGDB 3HRUA 1D1AA 5DLQE 3EGDB 2X9HA 3M0QA 1VQMA 1X75C 4ZTFA 3TREA 5LJ5f 4ORZA 1W4SA 4FW1A 3CCUQ 1A0NB 2DTIA 2RF0A 4LDXA 4FYXB 2RQTA 4HA8A 4JUVA 1UE9A 2P0PA 1ZBXA 1SPKA 1QWFA 2RHYA 1GFCA 3CCLT 5FWCA 4UC4A 1HK9A 1OU9A 4IUUA 3CCJQ 4F04B 2DO3A 4LN2A 3MEWA 3G6EA 1TXQA 2YLBA 4KBMB 3OYNA 3RUXA 2QDYB 2CZ7B 3OYDA 3HP9A 1VQ4T 1FMKA 1VIFA 2F5KA 3N5BB 2DIQA 4E2FB 4C92D 1VYVA 1IO6A 2F2VA 3MJXA 4E7ZA 4Z89A 2E64A 3REBB 2HEQA 3LWIA 4M78B 2GTOA 3CD6T 2KDSA 4DOVA 4MMLA 4X1VA 3JCMP 1PC0A 2R5MA 4FIBA 4CC7A 5GAOl 4B6MA 4GY5A 1Q81R 1K8AR 4R56A 1SEMA 2HCKA 3M55A 3FC3A 4RTZA 1YBYA 3CCQT 2H3JA 1Q86U 2FG0A 1E6HA 5LJ5d 1VQLQ 1WHJA 1ABOA 1MMDA 3WVEB 3EGUA 1AT1B 2JZ2A 1ABQA 2K2VA 1YWOA 4BE1A 2KXDA 2ZPHB 3LW5E 1FMWA 1RI9A 4QW2A 2DBMA 3JCMf 2XI9A 3QXEB 5LJ5e 1P92A 4EDUA 1WFWA 1YJWQ 4E47A 1OYXA 4XTZA 2E4HA 1JB0E 4PJNA 2OTLQ 1G5VA 2VGMA 2EGAA 4GBQA 4M78D 1OX9A 4IIMA 3JCMg 2WACA 2CP3A 3MEUA 3QHSA 3QBYA 1G3WA 2DYIA 2O2OA 2M51A 3C12A 4LXCA 1AWJA 4QVCA 1B07A 3CC7T 4J83A 2V1QA 1Q7YU 1VQ9T 3CCET 2LCLA 1AWOA 5FU6B 1X27A 1YCYA 3R6OA 3ME9A 4A4FA 2DD5A 2K4YA 3CMAA 2KRSA 4DEXA 4EPCA 1JJ2P 3CCVT 5FRNA 3GLXA 5LL6S 4EMGA 1MNDA 1LCKA 1NYGA 5EC7A 2NUZA 2O88A 1J3TA 4AFZC 4DEYA 2LQWA 2COWA 4BB7A 5CKBA 5IXBA 3CCRT 1R0CB 1TS9A 1MNEA 1YP5A 2KK4A 1B34A 1BI2A 2DNUA 1NG2A 1RAIB 1W70A 3QO3A 1LJOA 3A8MB 5KCHA 2CDTA 3OBYA 3MHXA 2DERA 5GAMh 4IUPA 3RKYA 2HZYA 1H8KA 2E5KA 2X4JA 3CBOA 3S3NA 4AFSC 1VQKA 1QKWA 5KYWA 3OMCA 2L3SA 4JJCA 1H3ZA 2L89A 2L5QA 2V1RA 1T0HA 3G71Q 2RQWA 4EMHA 3X25B 3CPWP 3OSVA 3QZ9B 3LYIA 4PJOE 1SSFA 2HAXA 2LP5A 3EFOA 4MDXA 4C0DB 3SHWA 3PT9A 4HCZA 3ASKA 2H3EB 1VYUA 2VASA 4M4ZA 1NJIR 3CCUT 1KQSA 2PUOB 2QK0A 2RNAA 3SWNB 2DVEA 3EG2A 2Z0WA 1BYMA 4M77C 1NZ9A 5GMKe 2XIDA 4M75B 4E7JA 4ZNXA 3RNJA 4V2SA 1NPPA 1KSWA 3I56T 5KYUA 3I55T 1PRMC 5GAN4 4C5EA 2JOYA 2NUPB 4M77E 3V8KA 1YI2A 2YDLA 2EIFA 1IGUA 1KJWA 2VB6A 1KHCA 2KR3A 2BTTA 1BI0A 2K3YA 5J39A 2DFUA 4MZPA 1M3CA 4IUTA 1PKTA 1GCPA 3SDZA 3AHUA 2KY9A 1QWEA 1K73R 1ZLMA 2DK3A 3GPLA 4PJOG 3OYLA 2ZZDA 1JBMA 2GFAA 2CSQA 2HDAA 3TQ7P 1F1BB 2A36A 3OYMA 5FU7C 2M0OA 4M75D 4M77A 1OPLA 3OB9A 2YLCA 2KE9A 3LX7A 2XKOC 3RMQA 1AWWA 2ATCB 3CCSA 4XTYA 1MMNA 2ECZA 4KH1B 4ZN3A 2YRVA 4RG2A 4JS5A 1K0XA 1UB4A 4O6JA 2K9GA 2OTLT 3A8OB 1X6OA 2D1XA 3SEMA 5GAMf 4EIKA 3CCLA 1T3SA 4M77G 1WGSA 1ZUUA 4XU1A 4PJLA 2WSFE 5GAOp 3LWHA 3X26B 4QT7A 2JUFA 1G83A 2QA4Q 1JO8A 1T3LA 1NEBA 5GAMg 1VIEA 5DY9A 2E5QA 3G4SQ 1YJNA 4HT9A 4OF1A 4DA4A 5LJ5j 1KQ1A 3CD6A 5I2SA 1VQNQ 2W0ZA 8ATCB 3QPHA 3M59A 1WJRA 3BE3A 1H641 4FYWB 3A5ZB 4Y91A 2O4XA 3FDRA 1M1KC 1ZSZB 1X69A 2CP7A 3SD4A 5GAN7 1Z9ZA 3SB2A 1WZOA 3M0RA 2GTJA 2DL5A 2J6FA 3CCQA 3G7ZA 4J7FA 1Q82C 2D0NA 2FZCB 2QG9B 1D0YA 1W2BA 2RO0A 4LDVA 3V7RA 1UTIA 2I2LA 2XU8A 4RTYA 2D8JA 2JT4A 2O9SA 3OSSC 2E65A 4BE0A 5AT1B 1N9SA 1M2VB 1OEBA 3RMSA 5GAMd 4L5GA 2XDBA 2V8KA 2ZGWA 1OZ3A 3G71T 2R5AA 5GANh 2CZ0B 5CKEA 5KYYB 5IN1A 5J3BA 3KBGA 3GOXA 2E70A 3QIIA 4PK4A 1BIBA 3OYIA 5GAMe 1WPYA 4BI8B 3QDFA 1D3BA 2PNIA 2M0YA 2QEXA 1OI1A 1VQ4Q 3OYGA 2A0FB 2YUNA 2DZ9A 4M7AC 1RADB 2PVOB 1UG1A 4BI3A 2FRYA 4XTXA 3C4SA 1IRXA 3OY9A 4J9HA 3EGXA 3CCVA 4M7AE 1AD5A 4RTTA 2K3BA 2EJGA 1LNXA 2EYXA 2VVKA 3CBMA 2OJ2A 1M90C 1N9RA 1FMVA 4F17A 1VQ6A 2J6KA 2KROA 1U3OA 4Z88A 2JN0A 1WLPB 1N8RC 3CCRA 1K9MC 3NTIA 2CYZB 1M9SA 1YCSB 2LCSA 4FM4B 5CKHA 4M7DC 3TCJA 1JQQA 2L0AA 2K79A 3QJ6A 5A0DA 2QQBA 5GMKj 1K9AA 2YXYA 1UGSB 1Q82U 1C0MA 4M7AA 1BB9A 4RCCA 2HQXA 3EFSA 2E12A 1QCOA 4M7DE 4RMOA 4BUGA 2XHCA 2JTFA 2ED0A 3CC7Q 2KXCA 2X35A 3META 2QTVA 1G3SA 2CREA 2DRKA 2FPDA 1VQ9Q 3CCEQ 2EWNA 5CO7A 3JSCA 3UWNA 3VS3A 3FRNA 2RQRA 5IXFA 2B86A 4JJNK 4C0FA 3CCUA 2RK2A 2VV5A 2MWPA 4M7AG 4JRPA 3RKXA 4CRIA 1JXOA 1B7TA 1X6BA 4QVZA 1FWZA 2X3WD 4FSXA 4M7DA 5HCKA 2MK5A 4XTUA 4PLLA 2DYBA 1Q86R 2DF6A 2D6FA 3CCJA 1UUEA 2LMJA 5IHKA 2DILA 3EH1A 4F7UE 3L2ZA 1VQ5Q 2QA4T 4JLGA 4X9CA 3NHNA 5GAOq 1UJYA 2LQKA 1VA7A 2DL8A 1M90U 2DJZA 2AHJB 4JS4A 3ZBDA 2FZKB 3JCMX 2ZCFB 2K57A 3UF4A 3OQ5A 4DBRA 1Z9QA 4M7DG 2HD0A 4XTVA 2DPPB 3M54A 4F7UA 1KQSS 3OMGA 3S3OA 2PZ1A 1RL2A 1Q7YR 3H9NA 1VQLA 3ZEHA 3RKWA 3M5AA 3MO8A 3NMZC 4PJJA 1OPKA 3E1SA 3FIFA 4N0AC 1TU0B 4XU0A 3HRSA 2RD1A 2HL5C 1M3AA 3BW1A 4QQGA 1I5LA 5LJ5g 1XOVA 1YJWA 3I56Q 3VRYA 2HNIA 2MAMA 3I55Q 4HXJA 1Y96A 2VGNA 3MCAB 4BACA 2LT1A 2OTLA 2DIGA 3JCMJ 5GAN5 3J7AF 3QWYA 4F7UG 5CKFA 4NOYA 2JJ9A 2FRWA 3JCMV 1AZEA 2JVVA 3L1AA 4XQ3A 1NLOC 3S6WA 2R58A 3M57A 4E7KA 2E6NA 1KC8U 2P0QA 2MPXC 3OBWA 2F5TX 3JCMQ 4LD9K
chains in the Genus database with same CATH topology
1VQPQ 1KD1R 1Q7YR 1JJ2P 1VQKQ 3CCEQ 3CCQQ 1YJNQ 1VQ8Q 3CMEQ 1S72Q 2QA4Q 3CCRQ 3CCLQ 3CCUQ 3OW2P 1Q86R 1VQ7Q 3CC2Q 1KC8R 3CD6Q 1W2BP 1Q81R 1QVFP 3G4SQ 1K8AR 1YJ9Q 1M1KR 3CCMQ 1KQSP 3CCVQ 3CMAQ 1YI2Q 1YJWQ 1VQOQ 1M90R 2QEXQ 3CCSQ 1YHQQ 1YITQ 3CXCP 3G6EQ 1QVGP 1VQ5Q 1VQMQ 1NJIR 1K73R 2OTJQ 1VQNQ 2OTLQ 1VQLQ 3G71Q 1N8RR 1K9MR 1Q82R 3CC7Q 1VQ6Q 3CC4Q 3I56Q 3CCJQ 1VQ4Q 3CPWP 1YIJQ 3I55Q 1VQ9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP Q;  1KD1 R;  1Q7Y R;  1JJ2 P;  1VQK Q;  3CCE Q;  3CCQ Q;  1YJN Q;  1VQ8 Q;  3CME Q;  1S72 Q;  2QA4 Q;  3CCR Q;  3CCL Q;  3CCU Q;  3OW2 P;  1Q86 R;  1VQ7 Q;  3CC2 Q;  1KC8 R;  3CD6 Q;  1W2B P;  1Q81 R;  1QVF P;  3G4S Q;  1K8A R;  1YJ9 Q;  1M1K R;  3CCM Q;  1KQS P;  3CCV Q;  3CMA Q;  1YI2 Q;  1YJW Q;  1VQO Q;  1M90 R;  2QEX Q;  3CCS Q;  1YHQ Q;  1YIT Q;  3CXC P;  3G6E Q;  1QVG P;  1VQ5 Q;  1VQM Q;  1NJI R;  1K73 R;  2OTJ Q;  1VQN Q;  2OTL Q;  1VQL Q;  3G71 Q;  1N8R R;  1K9M R;  1Q82 R;  3CC7 Q;  1VQ6 Q;  3CC4 Q;  3I56 Q;  3CCJ Q;  1VQ4 Q;  3CPW P;  1YIJ Q;  3I55 Q;  1VQ9 Q; 
#chains in the Genus database with same CATH topology
 4ELY C;  5CR2 A;  3GBQ A;  4M78 C;  3U23 A;  5FRO A;  1UHF A;  3C94 A;  2DXU A;  4Z02 A;  3OYB A;  3CME T;  4N0A A;  3THK A;  2B8A A;  2AZS A;  4WCI A;  1ARK A;  4JRI A;  4M78 E;  3RER A;  2KRN A;  1WHG A;  5GAN 3;  5GAM j;  2ENM A;  2J05 A;  1UHC A;  2FZG B;  2EKH A;  4XK8 E;  3X24 B;  3PGG A;  1QCN A;  4JJD A;  3CEY A;  3H0I A;  3R6N A;  1TOV A;  4KT0 E;  1VYT A;  1EFN A;  2ZPB B;  4J9I A;  1IB8 A;  4ATO A;  1GBQ A;  4JLI A;  4OB3 B;  3GNG A;  1QP3 A;  2L3P A;  3EG9 B;  2GF7 A;  1Q81 C;  2PUK B;  1K8A C;  4HVV A;  1RI0 A;  2LJ0 A;  5IHN A;  3G71 A;  2E41 A;  1QMC A;  1B34 B;  3L42 A;  4M78 A;  4ZGJ B;  4BDY A;  1BI3 A;  3QZ5 B;  1PSE A;  4Y28 E;  4AFU C;  2I0N A;  3L2Q A;  1QCF A;  4PFO A;  3QYH B;  2J06 A;  2EQJ A;  3A98 A;  5KYW B;  1UFF A;  2L2P A;  2RHX A;  4E6R A;  3TSZ A;  4Q5W A;  2AZV A;  1IZ6 A;  2NUT A;  4AG2 C;  2E3H A;  2QDL A;  3EFO B;  3PVL A;  4M78 G;  1KD1 C;  2ROL A;  1W2B S;  4ZN1 A;  1WHL A;  2XD0 A;  4R55 A;  3M4G A;  3GP8 A;  1VQ5 T;  3EAE A;  2BE7 D;  5C6S A;  4PJO C;  3VJP A;  2EQU A;  2KYM A;  2CH4 W;  2YRC A;  3CC2 T;  3NTK A;  1GXI E;  4OB1 B;  3CXC A;  2EYQ A;  2RHU A;  5KYU B;  3CC4 Q;  1YJ9 T;  1QQJ A;  1MGQ A;  2D0Q B;  1H3H A;  2QQS A;  1UDL A;  1S72 Q;  3M0T A;  2DL4 A;  1VQ7 Q;  3RBB B;  2FPF A;  4PLI A;  2X4X A;  2VXE A;  1M4Z A;  3OW2 A;  1U1S A;  1TSF A;  4QVD A;  5IHI A;  2E6Z A;  2IIM A;  2X51 A;  4FU6 A;  1K8A U;  3QSU A;  4OMN A;  3VS5 A;  1CKB A;  2JM8 A;  1UGV A;  4KUD K;  1SHF A;  1PHT A;  1CSK A;  1SF9 A;  1YIT T;  3S3M A;  3O5Z A;  5I21 A;  4M75 C;  1WJQ A;  4OMP A;  3JB9 G;  4J5Y A;  3M4Y A;  2PTK A;  1BCO A;  3KXT A;  3I35 A;  4ME7 A;  1YWP A;  4PJO A;  3HHT B;  3JB9 I;  4WF2 A;  2HQH A;  3LGL A;  5D6W A;  1V1C A;  1NPR A;  4GLK A;  4M75 E;  5GAO m;  2RN8 A;  3LGF A;  3G1J A;  3VUB A;  3EH2 A;  2ZPI B;  3DLM A;  1KHI A;  4ZTJ A;  3INZ A;  1NJI C;  3JB9 H;  5FW9 A;  1KD1 U;  2QA4 A;  5L8R E;  3KUF A;  3PTA A;  2DVJ A;  1XNI A;  2COZ A;  1XJW B;  4RTU A;  3G4S A;  2GFU A;  1QVG A;  3AT1 B;  4DBQ A;  4OB2 B;  1I0C A;  2A08 A;  1VQN A;  4LDU A;  4XAX B;  1EX4 A;  1BCM A;  3OS2 A;  2DTO A;  2LJ3 A;  2X3X D;  3JRZ A;  1I5O B;  3SWN A;  3C95 A;  3UAT A;  1R0B G;  2QAZ A;  2LT4 A;  1EIF A;  2YWW A;  4M75 A;  4OGE A;  1D0Z A;  1Y71 A;  1OU8 A;  4DOW A;  2RI5 A;  3QUI A;  2FEI A;  3D7S B;  1ZUY A;  5FU7 B;  2KMT A;  2V8J A;  3X20 B;  3SFM A;  1RAB B;  2VUB A;  2HSP A;  3OYY A;  3M9Q A;  2PVD B;  1VQM T;  1SG5 A;  3UDC A;  5FRM A;  4L59 A;  2LNH B;  2DBK A;  3EG3 A;  3WXM B;  2ZPF B;  5EG2 A;  1QP2 A;  1K73 C;  2AKK A;  1TWB A;  3VS0 A;  3WVD B;  1KQS P;  2O4X B;  2COY A;  4LNP A;  2K7A A;  2EVR A;  4IUQ A;  4M75 G;  2ESW A;  4X34 A;  3NFC A;  1KK7 A;  3FLG A;  4JZ4 A;  3G6E T;  1O9S A;  1UEB A;  2JMC A;  2PVG B;  3PFS A;  1AWX A;  4PL6 A;  1MV0 B;  1VQ4 A;  4B9X A;  1Y7X A;  1HXD A;  3HTR A;  3V8J A;  1YI2 Q;  1IHW A;  4A4G A;  2FB7 A;  2YT6 A;  3VS2 A;  5CCA A;  4C8Q C;  1M3B A;  2LX9 A;  4BDZ A;  2BIV A;  3HFN A;  1Q82 R;  3BDU A;  5ECA A;  1KQ2 A;  1E6G A;  3NPF A;  1RUW A;  1AZG B;  3HPW A;  4IUV A;  2P4R A;  1LPL A;  2GNC A;  2D8H A;  1D3B B;  5I2M A;  4C8Q E;  1WJS A;  2RHI A;  1QVF A;  2VWF A;  4A4E A;  1YFN A;  2CH4 A;  1FX7 A;  4TVR A;  4RKU E;  5DLO A;  3VS6 A;  3UA6 A;  1BK2 A;  3PVQ A;  1WHH A;  4OGC A;  3RES A;  4BI4 A;  1V76 A;  2H8H A;  3EGX B;  1PD0 A;  2F2W A;  3UA7 A;  3CC4 T;  4J6Y A;  2C0T A;  9ATC B;  1K0S A;  4EMK C;  1S72 T;  1UJ0 A;  2FO0 A;  1VQ7 T;  5KE2 A;  4C8Q A;  2RI2 A;  4C5H A;  2DXT A;  5KYX A;  2DD4 A;  2LC4 A;  4A54 A;  2K2M A;  2BE9 B;  3CC7 A;  3A1P A;  1TH7 A;  2RM4 A;  1BKB A;  1VQ9 A;  3CCE A;  1M90 R;  1ZSZ A;  3LH0 A;  1VOM A;  4YTL A;  1RAF B;  5M9O A;  2GGR A;  1SRL A;  1NYF A;  4MDW A;  4OMF B;  2BZ8 A;  5FWB A;  1YIJ Q;  1RAG B;  1D1B A;  4RCB A;  2O01 E;  2BKD N;  3CME Q;  2ZPG B;  2F2X A;  5HK3 A;  5KH6 A;  4C8Q G;  4M7D F;  1U5S A;  5DM7 R;  1M2V A;  2A7Y A;  2RI3 A;  4II1 A;  4OB0 B;  3OS5 A;  3P8H A;  4R0K A;  4EMK A;  1M1K U;  1RAH B;  2NYS A;  1VQ5 A;  4A63 B;  4E7S A;  5IAY A;  1JU5 C;  2RQV A;  3J81 E;  1W2B P;  4QQ6 A;  2CP6 A;  2ED1 A;  4PFZ A;  1X43 A;  3PE0 A;  4M7D B;  4FL6 A;  2DZC A;  5GAO n;  1V29 B;  2GQV A;  4Z8A A;  2L3R A;  3EG0 A;  1OQK A;  2RMO A;  5LJ3 h;  3LH5 A;  2Y4Y A;  3MKD A;  1PG5 B;  1VQ8 Q;  4BE2 A;  2RHZ A;  1JXM A;  4PNO A;  4F7U F;  1KC8 R;  4DBF A;  2HL3 A;  2CUB A;  2DRM A;  3M58 A;  3VYG A;  4CI0 C;  1VQO Q;  2WSC E;  2FHD A;  4LUD A;  2YRD A;  4KUI A;  1D1C A;  3NGP A;  4HVW A;  2OX7 A;  1IXD A;  1G3Y A;  3P8B B;  5FLX E;  3JCM b;  3MP8 A;  2O31 A;  2DXB A;  1QLY A;  2VXF A;  3V8L A;  1U8R A;  3I56 A;  1IHV A;  3FJ5 A;  3I55 A;  1CKA A;  1X01 A;  3PIP A;  2KYB A;  4M7D D;  2CS7 A;  2EJ9 A;  4JDS A;  5GAN f;  3JCM h;  5GAN 2;  2E10 A;  3F70 A;  4BY6 C;  1VQP Q;  1YI2 T;  3MEA A;  4FT4 A;  3CXC S;  3L2U A;  1HYO A;  4E7I A;  3CC2 Q;  4J9F A;  1N8R U;  1PNJ A;  3TU4 K;  2Y90 A;  4ELZ C;  1K9M U;  1YJ9 Q;  3O8V A;  4KGX B;  1WXT A;  5GAN g;  1GBR A;  2GBQ A;  1Y96 B;  2HKN A;  2M9U A;  3H0F A;  3H41 A;  2BZX A;  1PKS A;  3DLL A;  3MP1 A;  3OW2 S;  2YUO A;  4C92 C;  2RJC A;  1PRL C;  1WYX A;  3CPF A;  1Q86 C;  3EHQ A;  2AKL A;  1WDX A;  2XK0 A;  2YHT A;  2MF2 A;  5KYN A;  2OAU A;  1ACM B;  3M53 A;  1NM7 A;  4RTW A;  1GCQ C;  4JZ3 A;  4D8D A;  4JJB A;  1HSQ A;  5GMK i;  4C92 E;  2KSS A;  4AFQ C;  1QVP A;  1YIT Q;  1M27 C;  2HBW A;  5IT9 E;  4J9E A;  1D09 B;  5J26 A;  2XDP A;  3VYH B;  3EFR A;  3CCS T;  4F14 A;  1OOT A;  3RIR A;  5GAN 8;  4LDY A;  3TSW A;  2HMA A;  5GAN d;  3CCM Q;  8AT1 B;  5A0L A;  1R77 A;  2V26 A;  1YHQ Q;  1Q7Y C;  4M78 F;  2MIO A;  4N4G A;  2FL7 A;  2OTJ Q;  1BIA A;  3OS0 A;  4C92 A;  2ZPE B;  2JS2 A;  4FT2 A;  2XMF A;  4WTO B;  1QVG S;  5CIU A;  5GAN e;  3X28 B;  2P84 A;  1JJ2 A;  1RAE B;  5LJ3 f;  3EGD A;  5AYF A;  2K5F A;  4J6W A;  4LUE A;  1YIJ T;  1GCQ A;  4F16 A;  3IQL A;  1YJN T;  4FSS A;  4JPB W;  4RG8 A;  2WSE E;  4XU2 A;  4J9G A;  4J9C A;  2BUD A;  2HBP A;  2JM9 A;  5LJ3 g;  4FCY A;  2DTH A;  2AK5 A;  4C5G A;  1Y0M A;  4C92 G;  2DEQ A;  4LE9 A;  1FYN A;  3M0S A;  2NUT B;  1ZX6 A;  1VQM Q;  1WQ7 A;  3OYK A;  3OYH A;  2MWO A;  2XG8 D;  5HY6 A;  3T9N A;  1MMG A;  4KGV B;  1WI7 A;  3CPW A;  1YN8 A;  2KBT A;  4HCB A;  1RAA B;  3CC4 A;  6AT1 B;  3JB9 F;  2GQI A;  5A0G A;  5CQX A;  1S72 A;  1N5Z A;  1W6X A;  3JCM c;  1VQ7 A;  4IKF A;  2A37 A;  1VQ8 T;  3G6E Q;  1AVZ C;  2EQK A;  1XTD A;  1ZSG A;  5FU6 C;  1PCX A;  2CP2 A;  4N4H A;  5LJ3 d;  3H6Z A;  2EAY A;  1KD1 R;  2RH2 A;  2QEX T;  1VQO T;  5I11 A;  1I07 A;  1PM3 A;  3VUZ A;  3E9G A;  2EPD A;  2K5L A;  2IVW A;  3FEO A;  2ROT A;  2XIC A;  4D8K A;  2KT1 A;  5LJ3 e;  3ULR B;  2E3I A;  2QI2 A;  1BU1 A;  5GMK m;  1K1Z A;  1NE8 A;  2KEA A;  4JRQ A;  1QVF S;  3A8G B;  5C0M A;  4PJO F;  1ZUK A;  2EBP A;  4RTX A;  1E7O A;  3ZL7 C;  2QXF A;  3HKS A;  1HJD A;  2EFI A;  4LDW A;  3V7S A;  5HK0 A;  2EYW A;  3EG9 A;  1WHM A;  2DL3 A;  1VQ6 T;  1RAC B;  1X2K A;  3OYJ A;  2O9V A;  2EYZ A;  3FB9 A;  1VQP T;  2NLU A;  2IG0 A;  2LTO A;  5IH2 A;  1Q95 G;  2JMA A;  1NLP C;  4QQD A;  2X4Y A;  1QKX A;  1JEG A;  4FYY B;  3JCM d;  4A4H A;  2DX1 A;  1K76 A;  1H92 A;  3M0P A;  4PJO B;  3I5S A;  1TG0 A;  3EHR A;  4XU3 A;  2MCN A;  1I4K 1;  1G8X A;  7AT1 B;  2ABL A;  2K3X A;  4C0D C;  2EW3 A;  2EYY A;  2DL7 A;  2KT8 A;  3JCM e;  2OI3 A;  3VS4 A;  2M16 A;  2FVU A;  3JB9 D;  4M77 F;  3ER0 A;  4ANJ A;  4ESR A;  1Q81 U;  1KG1 A;  2C06 A;  1MHN A;  1UEC A;  2LX7 A;  1FXX A;  4M75 F;  3MPU B;  4C5I A;  5GAN 6;  2ZAE A;  2KI7 A;  3UT1 A;  2DA9 A;  5KE3 A;  3SWN C;  1W1F A;  3CBP A;  2JS0 A;  3RDV A;  2NWM A;  2CT3 A;  2YUQ A;  1R8O B;  2L8D A;  3VS1 A;  4E7L A;  1WA7 A;  3CMA Q;  1U06 A;  2DMO A;  4IUR A;  2EKO A;  2KAF A;  4D6W A;  1DJ7 B;  4M77 B;  4B9W A;  1NBE B;  2YUP A;  2JTE A;  3CCM T;  4PFP A;  1IGQ A;  1TUC A;  3VKI A;  1YHQ T;  1AOJ A;  4PJO D;  2OTJ T;  1C6V X;  1D0X A;  1QW1 A;  5HKC A;  3C0C A;  3CCJ T;  2J6O A;  1O75 A;  2PQW A;  4PJM A;  3GNF B;  2RB6 A;  1GRI A;  4C0Z A;  4C0G A;  3OYC A;  4MZT A;  5D6X A;  1UGR B;  3JB9 J;  1C1A A;  3OYA A;  2MYS A;  4AG1 C;  3KFV A;  3MP6 A;  1VQK Q;  2CSI A;  1ZQ1 A;  2QQ9 A;  2DXC A;  2GCX A;  2JXB A;  2K6D A;  3QDR B;  1WX6 A;  1WHK A;  4AT1 B;  1WQW A;  2C0O A;  3BFM A;  2DET A;  3L2V A;  1MMA A;  4KRT A;  2AIR B;  1SRM A;  3CXC P;  1BBZ A;  3E9F A;  4QKU A;  1N6A A;  2VC8 A;  3M0U A;  3RR6 A;  2QQA A;  2FPE A;  4M77 D;  4A53 A;  2M1H A;  3HL8 A;  3OA6 A;  1AEY A;  3BDL A;  3OW2 P;  4CC4 B;  3I9Q A;  1BI1 A;  4P5N A;  5GAN j;  2C0I A;  4K11 A;  2NUP A;  1VQL T;  4HCC A;  4OVA A;  5KCO A;  3TVT A;  2KNB B;  2XDD A;  4JRK A;  3H8Z A;  2IPO B;  2OAW A;  2LDM A;  2CP5 A;  3GIB A;  3DB3 A;  4ZGE B;  1YJW T;  1WXU A;  2L3Q A;  3PMI A;  1VUB A;  4C8Q F;  4HT8 A;  2LJ1 A;  1M1K R;  3H0H A;  5GJV B;  3NTH A;  4OMM A;  3FJP A;  2J7I A;  1N27 A;  2AT1 B;  3L2R A;  2MMP A;  2HKQ B;  5D6Y A;  3BY7 A;  4NL2 A;  4J9B A;  2CKK A;  4VUB A;  4CC2 A;  2QTX A;  2F69 A;  1NJI U;  3JCM W;  4HVU A;  3PIO A;  5A2Q E;  4OMQ A;  3HSB A;  1G2B A;  2DEU A;  3I5R A;  3OYF A;  1YIJ A;  1M8V A;  1ZSZ C;  4C8Q B;  2JW4 A;  3CME A;  5CVI A;  1RLP C;  2RJD A;  5KYX B;  1QVG P;  2HQE A;  1M2O A;  4BD3 A;  1KIK A;  1OX8 A;  1TUD A;  4L6V 5;  3TEE A;  3JV3 A;  2SEM A;  3UPU A;  1ZA1 B;  2P0K A;  4MMK A;  2CZ6 B;  2V8I A;  2E1H A;  2DE0 X;  4GLM A;  1LVK A;  2MOX A;  5I22 A;  1YNZ A;  4HKE A;  2RPN A;  3P8D A;  1TTH B;  3CCS Q;  2F1L A;  2DLP A;  1NEG A;  1IRE B;  5LJ3 j;  1X2Q A;  4M7A F;  1SKU B;  3JAM E;  3OS1 A;  4CC3 A;  1MUZ A;  2JTM A;  2LZ6 B;  2HSE B;  2DM1 A;  4Y92 A;  1B3Q A;  1T0J A;  2EQI A;  1K73 U;  3CCL Q;  1SHG A;  4EMK B;  1M8M A;  2RJF A;  1AHJ B;  2PU9 B;  1VQ8 A;  1GL5 A;  1JJ2 S;  1OV3 A;  4LD6 A;  4RTV A;  4C8Q D;  3A8L B;  2CP0 A;  1X6G A;  1SSH A;  2EGE A;  4J6X A;  1N8R R;  3J80 E;  4KUL A;  2RK1 A;  4M7A B;  1VQO A;  2D9T A;  2CGH A;  1LOJ A;  4J8O A;  1K9M R;  2JNG A;  3CMA T;  4HCK A;  1YJN Q;  2FYK A;  3GF5 A;  1UGQ B;  2QAS A;  3VRZ A;  1JRI A;  3PMT A;  3CD6 Q;  3M56 A;  5CAI A;  1Y57 A;  2Y4X A;  5LJ5 h;  2CZ1 B;  2LNV A;  2VYT A;  1U1T A;  2RA2 A;  2SRC A;  3EG1 A;  2QQR A;  2W10 A;  2EGC A;  1M1F A;  3ZFJ A;  5KYY A;  3CCQ Q;  4FW2 A;  1GFD A;  2KRM A;  3QJY A;  1VQP A;  1QVF P;  3CPW S;  3CC2 A;  4OP0 A;  3URG A;  3DB4 A;  1VQK T;  4NS5 A;  2VKN A;  2YSQ A;  2KVQ G;  2LVM A;  4IIO A;  1YJ9 A;  1WXB A;  5GAO r;  4DQ2 A;  3E2U A;  3HRT A;  1XQH A;  4M7A D;  4FYV B;  1I81 A;  1M5Q 1;  4PKC C;  3PNW C;  5CKD A;  1K4U S;  4KH0 B;  1OUL A;  2KGT A;  4A4K A;  2K5I A;  4J9D A;  2X4W A;  3VV0 A;  1I8F A;  1ZHI A;  3QG1 A;  5D7U A;  2QEX Q;  2BZY A;  3QWX X;  2CUD A;  4N4I A;  1RLQ C;  4NL3 A;  1YIT A;  2EQM A;  2EJF A;  3OYE A;  2LQ8 A;  1UGP B;  2M02 A;  1OZ2 A;  5CK9 A;  4F7U B;  2R57 A;  3CCV Q;  5GJW B;  4OMO A;  3MEV A;  4X9D A;  3VU3 C;  1ZBJ A;  2DAQ A;  2DJQ A;  1Y07 A;  3CCM A;  4J7I A;  1VQ6 Q;  3REA B;  2A3L A;  1WIE A;  2CT4 A;  1WNL A;  3LLR A;  1YHQ A;  1KC8 C;  1MV3 A;  2QYZ A;  2RQU A;  2G3R A;  4RUG A;  2OTJ A;  3V7C A;  3L2W A;  3CCR Q;  2KQW A;  2DKG A;  3Q1J A;  4OML A;  2QGG A;  2A28 A;  4C92 F;  3E19 A;  1I1J A;  1S1N A;  2RJE A;  4XTW A;  5CQY A;  3QKJ A;  3VS7 A;  4BY6 B;  5GMK l;  3G4S T;  1TUG B;  2LCC A;  1G3T A;  1EZZ B;  3A8H B;  2LRQ A;  1M1G A;  1PWT A;  5L23 A;  3QYG B;  1ZA2 B;  1VQN T;  3CQT A;  5GMK h;  1KFZ A;  4E7H A;  2QGF B;  3HFO A;  4C92 B;  4MZM A;  4DBH A;  2G6F X;  4KGZ B;  3DKM A;  1PSF A;  2MI6 A;  2LQN A;  1HD3 A;  1M30 A;  1PD1 A;  2P4T A;  4O5V A;  4AMC A;  4ZGD B;  3HRU A;  1D1A A;  5DLQ E;  3EGD B;  2X9H A;  3M0Q A;  1VQM A;  1X75 C;  4ZTF A;  3TRE A;  5LJ5 f;  4ORZ A;  1W4S A;  4FW1 A;  3CCU Q;  1A0N B;  2DTI A;  2RF0 A;  4LDX A;  4FYX B;  2RQT A;  4HA8 A;  4JUV A;  1UE9 A;  2P0P A;  1ZBX A;  1SPK A;  1QWF A;  2RHY A;  1GFC A;  3CCL T;  5FWC A;  4UC4 A;  1HK9 A;  1OU9 A;  4IUU A;  3CCJ Q;  4F04 B;  2DO3 A;  4LN2 A;  3MEW A;  3G6E A;  1TXQ A;  2YLB A;  4KBM B;  3OYN A;  3RUX A;  2QDY B;  2CZ7 B;  3OYD A;  3HP9 A;  1VQ4 T;  1FMK A;  1VIF A;  2F5K A;  3N5B B;  2DIQ A;  4E2F B;  4C92 D;  1VYV A;  1IO6 A;  2F2V A;  3MJX A;  4E7Z A;  4Z89 A;  2E64 A;  3REB B;  2HEQ A;  3LWI A;  4M78 B;  2GTO A;  3CD6 T;  2KDS A;  4DOV A;  4MML A;  4X1V A;  3JCM P;  1PC0 A;  2R5M A;  4FIB A;  4CC7 A;  5GAO l;  4B6M A;  4GY5 A;  1Q81 R;  1K8A R;  4R56 A;  1SEM A;  2HCK A;  3M55 A;  3FC3 A;  4RTZ A;  1YBY A;  3CCQ T;  2H3J A;  1Q86 U;  2FG0 A;  1E6H A;  5LJ5 d;  1VQL Q;  1WHJ A;  1ABO A;  1MMD A;  3WVE B;  3EGU A;  1AT1 B;  2JZ2 A;  1ABQ A;  2K2V A;  1YWO A;  4BE1 A;  2KXD A;  2ZPH B;  3LW5 E;  1FMW A;  1RI9 A;  4QW2 A;  2DBM A;  3JCM f;  2XI9 A;  3QXE B;  5LJ5 e;  1P92 A;  4EDU A;  1WFW A;  1YJW Q;  4E47 A;  1OYX A;  4XTZ A;  2E4H A;  1JB0 E;  4PJN A;  2OTL Q;  1G5V A;  2VGM A;  2EGA A;  4GBQ A;  4M78 D;  1OX9 A;  4IIM A;  3JCM g;  2WAC A;  2CP3 A;  3MEU A;  3QHS A;  3QBY A;  1G3W A;  2DYI A;  2O2O A;  2M51 A;  3C12 A;  4LXC A;  1AWJ A;  4QVC A;  1B07 A;  3CC7 T;  4J83 A;  2V1Q A;  1Q7Y U;  1VQ9 T;  3CCE T;  2LCL A;  1AWO A;  5FU6 B;  1X27 A;  1YCY A;  3R6O A;  3ME9 A;  4A4F A;  2DD5 A;  2K4Y A;  3CMA A;  2KRS A;  4DEX A;  4EPC A;  1JJ2 P;  3CCV T;  5FRN A;  3GLX A;  5LL6 S;  4EMG A;  1MND A;  1LCK A;  1NYG A;  5EC7 A;  2NUZ A;  2O88 A;  1J3T A;  4AFZ C;  4DEY A;  2LQW A;  2COW A;  4BB7 A;  5CKB A;  5IXB A;  3CCR T;  1R0C B;  1TS9 A;  1MNE A;  1YP5 A;  2KK4 A;  1B34 A;  1BI2 A;  2DNU A;  1NG2 A;  1RAI B;  1W70 A;  3QO3 A;  1LJO A;  3A8M B;  5KCH A;  2CDT A;  3OBY A;  3MHX A;  2DER A;  5GAM h;  4IUP A;  3RKY A;  2HZY A;  1H8K A;  2E5K A;  2X4J A;  3CBO A;  3S3N A;  4AFS C;  1VQK A;  1QKW A;  5KYW A;  3OMC A;  2L3S A;  4JJC A;  1H3Z A;  2L89 A;  2L5Q A;  2V1R A;  1T0H A;  3G71 Q;  2RQW A;  4EMH A;  3X25 B;  3CPW P;  3OSV A;  3QZ9 B;  3LYI A;  4PJO E;  1SSF A;  2HAX A;  2LP5 A;  3EFO A;  4MDX A;  4C0D B;  3SHW A;  3PT9 A;  4HCZ A;  3ASK A;  2H3E B;  1VYU A;  2VAS A;  4M4Z A;  1NJI R;  3CCU T;  1KQS A;  2PUO B;  2QK0 A;  2RNA A;  3SWN B;  2DVE A;  3EG2 A;  2Z0W A;  1BYM A;  4M77 C;  1NZ9 A;  5GMK e;  2XID A;  4M75 B;  4E7J A;  4ZNX A;  3RNJ A;  4V2S A;  1NPP A;  1KSW A;  3I56 T;  5KYU A;  3I55 T;  1PRM C;  5GAN 4;  4C5E A;  2JOY A;  2NUP B;  4M77 E;  3V8K A;  1YI2 A;  2YDL A;  2EIF A;  1IGU A;  1KJW A;  2VB6 A;  1KHC A;  2KR3 A;  2BTT A;  1BI0 A;  2K3Y A;  5J39 A;  2DFU A;  4MZP A;  1M3C A;  4IUT A;  1PKT A;  1GCP A;  3SDZ A;  3AHU A;  2KY9 A;  1QWE A;  1K73 R;  1ZLM A;  2DK3 A;  3GPL A;  4PJO G;  3OYL A;  2ZZD A;  1JBM A;  2GFA A;  2CSQ A;  2HDA A;  3TQ7 P;  1F1B B;  2A36 A;  3OYM A;  5FU7 C;  2M0O A;  4M75 D;  4M77 A;  1OPL A;  3OB9 A;  2YLC A;  2KE9 A;  3LX7 A;  2XKO C;  3RMQ A;  1AWW A;  2ATC B;  3CCS A;  4XTY A;  1MMN A;  2ECZ A;  4KH1 B;  4ZN3 A;  2YRV A;  4RG2 A;  4JS5 A;  1K0X A;  1UB4 A;  4O6J A;  2K9G A;  2OTL T;  3A8O B;  1X6O A;  2D1X A;  3SEM A;  5GAM f;  4EIK A;  3CCL A;  1T3S A;  4M77 G;  1WGS A;  1ZUU A;  4XU1 A;  4PJL A;  2WSF E;  5GAO p;  3LWH A;  3X26 B;  4QT7 A;  2JUF A;  1G83 A;  2QA4 Q;  1JO8 A;  1T3L A;  1NEB A;  5GAM g;  1VIE A;  5DY9 A;  2E5Q A;  3G4S Q;  1YJN A;  4HT9 A;  4OF1 A;  4DA4 A;  5LJ5 j;  1KQ1 A;  3CD6 A;  5I2S A;  1VQN Q;  2W0Z A;  8ATC B;  3QPH A;  3M59 A;  1WJR A;  3BE3 A;  1H64 1;  4FYW B;  3A5Z B;  4Y91 A;  2O4X A;  3FDR A;  1M1K C;  1ZSZ B;  1X69 A;  2CP7 A;  3SD4 A;  5GAN 7;  1Z9Z A;  3SB2 A;  1WZO A;  3M0R A;  2GTJ A;  2DL5 A;  2J6F A;  3CCQ A;  3G7Z A;  4J7F A;  1Q82 C;  2D0N A;  2FZC B;  2QG9 B;  1D0Y A;  1W2B A;  2RO0 A;  4LDV A;  3V7R A;  1UTI A;  2I2L A;  2XU8 A;  4RTY A;  2D8J A;  2JT4 A;  2O9S A;  3OSS C;  2E65 A;  4BE0 A;  5AT1 B;  1N9S A;  1M2V B;  1OEB A;  3RMS A;  5GAM d;  4L5G A;  2XDB A;  2V8K A;  2ZGW A;  1OZ3 A;  3G71 T;  2R5A A;  5GAN h;  2CZ0 B;  5CKE A;  5KYY B;  5IN1 A;  5J3B A;  3KBG A;  3GOX A;  2E70 A;  3QII A;  4PK4 A;  1BIB A;  3OYI A;  5GAM e;  1WPY A;  4BI8 B;  3QDF A;  1D3B A;  2PNI A;  2M0Y A;  2QEX A;  1OI1 A;  1VQ4 Q;  3OYG A;  2A0F B;  2YUN A;  2DZ9 A;  4M7A C;  1RAD B;  2PVO B;  1UG1 A;  4BI3 A;  2FRY A;  4XTX A;  3C4S A;  1IRX A;  3OY9 A;  4J9H A;  3EGX A;  3CCV A;  4M7A E;  1AD5 A;  4RTT A;  2K3B A;  2EJG A;  1LNX A;  2EYX A;  2VVK A;  3CBM A;  2OJ2 A;  1M90 C;  1N9R A;  1FMV A;  4F17 A;  1VQ6 A;  2J6K A;  2KRO A;  1U3O A;  4Z88 A;  2JN0 A;  1WLP B;  1N8R C;  3CCR A;  1K9M C;  3NTI A;  2CYZ B;  1M9S A;  1YCS B;  2LCS A;  4FM4 B;  5CKH A;  4M7D C;  3TCJ A;  1JQQ A;  2L0A A;  2K79 A;  3QJ6 A;  5A0D A;  2QQB A;  5GMK j;  1K9A A;  2YXY A;  1UGS B;  1Q82 U;  1C0M A;  4M7A A;  1BB9 A;  4RCC A;  2HQX A;  3EFS A;  2E12 A;  1QCO A;  4M7D E;  4RMO A;  4BUG A;  2XHC A;  2JTF A;  2ED0 A;  3CC7 Q;  2KXC A;  2X35 A;  3MET A;  2QTV A;  1G3S A;  2CRE A;  2DRK A;  2FPD A;  1VQ9 Q;  3CCE Q;  2EWN A;  5CO7 A;  3JSC A;  3UWN A;  3VS3 A;  3FRN A;  2RQR A;  5IXF A;  2B86 A;  4JJN K;  4C0F A;  3CCU A;  2RK2 A;  2VV5 A;  2MWP A;  4M7A G;  4JRP A;  3RKX A;  4CRI A;  1JXO A;  1B7T A;  1X6B A;  4QVZ A;  1FWZ A;  2X3W D;  4FSX A;  4M7D A;  5HCK A;  2MK5 A;  4XTU A;  4PLL A;  2DYB A;  1Q86 R;  2DF6 A;  2D6F A;  3CCJ A;  1UUE A;  2LMJ A;  5IHK A;  2DIL A;  3EH1 A;  4F7U E;  3L2Z A;  1VQ5 Q;  2QA4 T;  4JLG A;  4X9C A;  3NHN A;  5GAO q;  1UJY A;  2LQK A;  1VA7 A;  2DL8 A;  1M90 U;  2DJZ A;  2AHJ B;  4JS4 A;  3ZBD A;  2FZK B;  3JCM X;  2ZCF B;  2K57 A;  3UF4 A;  3OQ5 A;  4DBR A;  1Z9Q A;  4M7D G;  2HD0 A;  4XTV A;  2DPP B;  3M54 A;  4F7U A;  1KQS S;  3OMG A;  3S3O A;  2PZ1 A;  1RL2 A;  1Q7Y R;  3H9N A;  1VQL A;  3ZEH A;  3RKW A;  3M5A A;  3MO8 A;  3NMZ C;  4PJJ A;  1OPK A;  3E1S A;  3FIF A;  4N0A C;  1TU0 B;  4XU0 A;  3HRS A;  2RD1 A;  2HL5 C;  1M3A A;  3BW1 A;  4QQG A;  1I5L A;  5LJ5 g;  1XOV A;  1YJW A;  3I56 Q;  3VRY A;  2HNI A;  2MAM A;  3I55 Q;  4HXJ A;  1Y96 A;  2VGN A;  3MCA B;  4BAC A;  2LT1 A;  2OTL A;  2DIG A;  3JCM J;  5GAN 5;  3J7A F;  3QWY A;  4F7U G;  5CKF A;  4NOY A;  2JJ9 A;  2FRW A;  3JCM V;  1AZE A;  2JVV A;  3L1A A;  4XQ3 A;  1NLO C;  3S6W A;  2R58 A;  3M57 A;  4E7K A;  2E6N A;  1KC8 U;  2P0Q A;  2MPX C;  3OBW A;  2F5T X;  3JCM Q;  4LD9 K; 
#chains in the Genus database with same CATH homology
 1VQP Q;  1KD1 R;  1Q7Y R;  1JJ2 P;  1VQK Q;  3CCE Q;  3CCQ Q;  1YJN Q;  1VQ8 Q;  3CME Q;  1S72 Q;  2QA4 Q;  3CCR Q;  3CCL Q;  3CCU Q;  3OW2 P;  1Q86 R;  1VQ7 Q;  3CC2 Q;  1KC8 R;  3CD6 Q;  1W2B P;  1Q81 R;  1QVF P;  3G4S Q;  1K8A R;  1YJ9 Q;  1M1K R;  3CCM Q;  1KQS P;  3CCV Q;  3CMA Q;  1YI2 Q;  1YJW Q;  1VQO Q;  1M90 R;  2QEX Q;  3CCS Q;  1YHQ Q;  1YIT Q;  3CXC P;  3G6E Q;  1QVG P;  1VQ5 Q;  1VQM Q;  1NJI R;  1K73 R;  2OTJ Q;  1VQN Q;  2OTL Q;  1VQL Q;  3G71 Q;  1N8R R;  1K9M R;  1Q82 R;  3CC7 Q;  1VQ6 Q;  3CC4 Q;  3I56 Q;  3CCJ Q;  1VQ4 Q;  3CPW P;  1YIJ Q;  3I55 Q;  1VQ9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...