2QA4Q

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 2qa4Q00
1Q86R 3G6EQ 3CC2Q 1VQNQ 3CMEQ 3CCQQ 3G71Q 3CC4Q 1Q7YR 1VQ4Q 1JJ2P 3CCVQ 1QVFP 1K9MR 1K73R 1VQOQ 2QEXQ 3CCUQ 3G4SQ 3OW2P 1VQMQ 3CC7Q 3CCRQ 3CXCP 1VQPQ 3CCSQ 1KD1R 1M90R 1YI2Q 1YJ9Q 1W2BP 1QVGP 1YIJQ 1YITQ 1VQLQ 2OTLQ 1YJWQ 1YHQQ 1KC8R 1VQKQ 3CD6Q 3I56Q 3CMAQ 2QA4Q 3I55Q 1YJNQ 1Q81R 1K8AR 1Q82R 1KQSP 1VQ5Q 3CCEQ 1VQ6Q 3CCJQ 1NJIR 1VQ7Q 1VQ9Q 3CPWP 1S72Q 1VQ8Q 3CCMQ 1N8RR 1M1KR 3CCLQ 2OTJQ
chains in the Genus database with same CATH superfamily
2FRYA 4D6WA 1FMVA 1N27A 1Z9QA 4M7AC 3UATA 1A0NB 2QEXQ 1RAAB 4LXCA 3SWNC 2LNVA 2QK0A 2HSPA 3DLLA 1Q82R 1KQSP 1O9SA 1BYMA 1TS9A 1VUBA 4QVZA 4FL6A 2KR3A 2QASA 4KH1B 5A2QE 1H3ZA 2QQ9A 1RI0A 2DJZA 3R6OA 4WF2A 2JVVA 3CQTA 4QVDA 5IH2A 4B6MA 4FT2A 3QJ6A 4HXJA 3OA6A 1QP2A 3G1JA 3M55A 1PD1A 2CH4W 1VQ9T 4Z8AA 1QMCA 4XTWA 3JCMd 2KRSA 1YJWA 3TREA 1RAHB 3V8KA 3JCMV 4C0ZA 3SB2A 3CCRQ 4ZGEB 4J9EA 2FHDA 4ZNXA 1YJ9Q 5A0DA 5D6XA 2DTIA 3CCST 5A0LA 4HCBA 1ZUUA 2EQMA 2GNCA 5KYXB 3EG1A 1VQMA 5J26A 3VUBA 4BI8B 2ZCFB 1M9SA 2RB6A 1NYFA 3C0CA 5LJ5h 3OS0A 4A4HA 3SDZA 2RQVA 1YFNA 1NYGA 1PRLC 4IIOA 3HL8A 4C8QE 4OGEA 3KFVA 4E6RA 3FB9A 2FPFA 4C0GA 4JS5A 3EG2A 1WHGA 3OYJA 4CI0C 3OSSC 3CPFA 3C4SA 3REAB 3G6ET 4HT9A 4L59A 3ME9A 2K3XA 5GANe 4BE2A 1AD5A 1PSEA 4E7SA 1KHCA 3CCJA 1SEMA 4A53A 1X6OA 2H8HA 2COYA 1PG5B 4ANJA 4LN2A 4C92G 5GAMg 2FZGB 2YLCA 4M77E 1CKAA 2DTOA 2DMOA 1K8AU 2JW4A 4M77D 3QO3A 3LGLA 4BE1A 5L8RE 1JQQA 1X43A 3V7SA 2MF2A 2IIMA 4J6WA 4LDVA 2HKNA 1LJOA 3MEAA 1AHJB 5GJVB 2A37A 2HKQB 1YITT 1YJNQ 1PRMC 2V8JA 4M78A 2JNGA 4MZMA 1MHNA 2DD5A 3NTKA 4M7DF 1KQ2A 2KT1A 3CCQQ 3OS1A 1S1NA 5KYYB 2J7IA 2XICA 3H9NA 5DLQE 1BI1A 2ZGWA 4MMLA 3CC4T 3QBYA 2EYYA 4AG2C 1IGUA 5GAN5 4ELYC 4F7UF 4J6YA 4JLGA 3GPLA 2CP0A 1HK9A 2FZCB 2G6FX 2ESWA 4BACA 3LLRA 2O01E 1KC8U 1UTIA 1RUWA 4DOVA 1RL2A 3HFOA 2RI5A 4J9GA 2KMTA 2L0AA 2RI3A 1PNJA 3WVDB 1VQ5A 3JCMc 5LJ3d 4OMNA 4A4FA 2MYSA 3BE3A 3CCMA 1VQPT 4ZGJB 1JJ2A 3E9FA 1K8AR 4FW1A 5LJ5e 1U5SA 2JJ9A 2LT4A 4J9CA 2KVQG 1GBRA 3OS2A 5LJ3f 1ZSZC 1D1CA 1QCNA 5KCOA 1VQ7T 3L42A 3CC2Q 3OYLA 3CCLT 5GAN6 3RKYA 1M1KU 3FLGA 1HYOA 3M5AA 4Q5WA 1YI2Q 2LP5A 5GMKh 1F1BB 1GFDA 2OTLT 1N9RA 4DBFA 5KYUA 1LNXA 2CH4A 1M8MA 1VQ8Q 2MCNA 2MOXA 4Z89A 5I2SA 3EHRA 1VQKA 4B9WA 1W70A 2ZPIB 1PCXA 2X51A 3DKMA 2J06A 2LQWA 2JMAA 4RTVA 4F14A 1G3TA 5EC7A 1YCYA 3EAEA 2EYXA 2R58A 2DRKA 2KSSA 4IUTA 1I0CA 3CCET 4GY5A 1I5OB 3OS5A 2KEAA 3RMQA 3S6WA 1G5VA 1LVKA 1WHJA 4O5VA 3QZ9B 5CQYA 3OYGA 1OPKA 4LE9A 1YCSB 1TUGB 2WSCE 3LH0A 1GCPA 3M53A 1SSHA 2NUTA 2EIFA 3F70A 1QQJA 1TU0B 4M75A 1M1KR 2DL4A 5IXFA 1D3BB 2DK3A 1VQ4Q 4C5EA 4ESRA 3EG9A 1AWXA 3CCUQ 4XTYA 2K7AA 4PKCC 3CCSQ 1VQ9A 3RKXA 1X01A 1JU5C 1W6XA 3H8ZA 1QWEA 4M7AA 1MMGA 3OYBA 2CP5A 3EH2A 3Q1JA 3EFOA 3SWNA 2X9HA 2E65A 1R8OB 1OZ3A 4JDSA 2HQEA 4RKUE 5D6YA 2Y4XA 5GAMh 2A3LA 3LWIA 1Q81U 2LZ6B 2X3XD 3TSZA 2HQXA 3ZL7C 2KAFA 4OB1B 3TQ7P 1W2BA 2BIVA 3REBB 1K73U 2KGTA 3FRNA 3L1AA 4JRQA 1D09B 2QGGA 3CXCS 3IQLA 4HVVA 1T3SA 1AOJA 3VS6A 1NLOC 4JPBW 2QDYB 3QJYA 2XDPA 4DQ2A 2KY9A 5GMKe 5DM7R 4F04B 3PIOA 3OYEA 3JCMP 5I21A 4C92D 2Z0WA 2EQUA 1DJ7B 3QKJA 1OI1A 1RLQC 3G6EA 1UHCA 4FT4A 5LJ3j 2JXBA 1YJWT 1PD0A 1G83A 5GMKi 4M78E 2DYBA 5GAOq 3L2UA 2XI9A 5CKHA 5HK0A 5HKCA 3GOXA 4Y28E 2VYTA 3PIPA 1QVFP 4J9FA 4A4GA 1BI0A 4BY6B 2LJ0A 4E7HA 1AZEA 1VQMT 3AHUA 4M7DC 4N4IA 1WXBA 3A8HB 3V7RA 3VV0A 2FG0A 3OW2S 5GAMf 3TSWA 1Q81R 4C92C 1VQNQ 4IKFA 2H3EB 3A8GB 1BI3A 4HVUA 1N8RC 1RAIB 3X24B 1YNZA 3GP8A 3CC4Q 1YITA 3H0IA 1K73R 2K9GA 3CMAA 1EFNA 3RMSA 4LDYA 3M4YA 3S3MA 1OOTA 1R0BG 2K79A 2HBPA 3CMEA 5L23A 3OMGA 3KBGA 2RJEA 3JSCA 1E6HA 4J7IA 2M1HA 2JN0A 2H3JA 3NHNA 3P8HA 3CBMA 3HFNA 4KRTA 3PMTA 4JLIA 1X6BA 2EJ9A 3PMIA 3JB9G 4NL2A 1UE9A 4LD9K 3CC7Q 5GAOn 3L2RA 4MDWA 3D7SB 2EW3A 3J81E 2M0OA 5GAMe 4R56A 2EKHA 1BI2A 1M90U 1Q82C 2ZPFB 1I5LA 2O4XA 1BIAA 2ED0A 3CCLQ 2JMCA 4DEXA 1X6GA 4ZTFA 2EJFA 3L2ZA 1B07A 4ZN3A 4OMFB 2AKKA 2ED1A 3NGPA 4QQ6A 4JJCA 1S72A 1VQ7A 1YBYA 4PFZA 2OTLQ 3VS5A 2E3IA 3S3OA 1NG2A 1K9AA 1K76A 4N4HA 3JB9F 2XDBA 3P8DA 5FRNA 1VQOA 4WTOB 4XU0A 2ROLA 1NPPA 4M75B 4RMOA 3C94A 1TSFA 1VYTA 1AWJA 2RQTA 3CD6A 1LPLA 3NFCA 3X25B 2PU9B 1M3BA 3URGA 3JAME 1B3QA 4M7AB 3J80E 1YHQQ 2C0OA 5GAOp 1N5ZA 4C8QF 3MEVA 3CCVA 2YUPA 3CCEQ 1AWWA 1X2QA 1TH7A 3G4SA 1BCMA 2GQIA 4M75E 2XHCA 1VQ5T 4J7FA 2RJFA 1UHFA 5LJ3g 3CCMT 4PJOB 2A0FB 2VXEA 1U1SA 1ZSZA 2GFUA 5CKBA 4RTTA 5FU6B 1LCKA 1Q95G 4MMKA 4ME7A 1G2BA 5D6WA 4RTWA 3EH1A 1V29B 4DOWA 1TWBA 3VS0A 5FU7B 3BFMA 4EMHA 2A7YA 2YUOA 1VYVA 1N6AA 2A36A 1WNLA 2RK1A 2LX9A 3M59A 1I81A 3LX7A 1VIEA 2ZPGB 3RIRA 1VQKT 2W10A 4O6JA 1UGPB 2FEIA 5AYFA 2FO0A 3VYGA 2ZZDA 1XTDA 3G71Q 4HCCA 2RQWA 2G3RA 3SD4A 1U06A 2KQWA 4CC2A 3CPWA 1Y96B 1JXMA 2YXYA 4RG2A 4AFUC 3OYNA 1SG5A 3L2VA 2NWMA 4BI3A 1UB4A 2D8HA 2KBTA 1Y7XA 3EHQA 3MHXA 1YN8A 2D0NA 2DZ9A 4HVWA 2HAXA 3QDFA 1HD3A 1NM7A 3MPUB 2CT4A 1KQ1A 1I07A 1YJWQ 1H641 1NBEB 2MI6A 4MDXA 2CSIA 2WSEE 2QEXA 3RUXA 1PSFA 2GCXA 2DIGA 2LX7A 1G3YA 2VC8A 1KSWA 1ARKA 4K11A 5FWBA 3M58A 2DBKA 3OYFA 5GAOm 5CKFA 4C8QB 2V1RA 2E1HA 1K8AC 2M02A 1OU8A 4IURA 1K0XA 1TTHB 3JCMf 2MWPA 3OB9A 3M56A 3GLXA 1QW1A 1K0SA 1KHIA 1WXTA 4OMPA 2DIQA 4DBQA 1Y0MA 1XNIA 2DXTA 3TVTA 4GLMA 1KQSA 2O88A 5CIUA 1MUZA 1NZ9A 1NEBA 1I4K1 4M77B 3CCJQ 3LW5E 3ZEHA 3WXMB 2K6DA 2PQWA 1IHVA 2YUNA 1YJ9A 2DBMA 5HK3A 1VQLA 2A28A 2RJDA 2DD4A 3CBOA 4JUVA 1VOMA 2J6KA 2X4WA 1Q7YU 1IGQA 1PM3A 4M7DG 2EQJA 1M2VA 1GXIE 2JZ2A 1VQ6Q 1WHKA 4M7DA 1JO8A 3ZFJA 2HMAA 2V8IA 2XK0A 4F7UG 2YRVA 3FJPA 4C92A 2CYZB 2RM4A 4E2FB 1C6VX 1QLYA 5LJ3h 1ZSZB 1ZHIA 2QQSA 2QA4A 2XD0A 1I1JA 1D1AA 4XQ3A 5KE3A 2K5FA 2KE9A 1QCOA 1OQKA 4PJLA 2L3RA 3QHSA 3CMAT 2HDAA 1M1KC 1WXUA 3PNWC 1EX4A 2EQIA 4FYXB 1G3SA 1BU1A 3VS7A 5I22A 1RACB 1QCFA 3UDCA 3CMET 4BI4A 5LJ5d 2IVWA 1ZUYA 2DZCA 4E7ZA 4NOYA 1JJ2S 4HT8A 1FYNA 1K9MU 3EFRA 2F2WA 2PUOB 1VQ5Q 4FSXA 3O5ZA 3MP8A 4IUPA 3CCMQ 4E7IA 5GMKl 1ZQ1A 1EIFA 2DL7A 3WVEB 1Q7YR 1WDXA 1KIKA 2DE0X 1YJNA 2M9UA 3MJXA 3THKA 2JS0A 2CZ0B 2C06A 2VUBA 2J6OA 2OTJA 1ABOA 4E7JA 3CCQA 4HA8A 5FWCA 4AFSC 1OYXA 4OMLA 1S72T 4II1A 4J9DA 4HKEA 3KXTA 2M0YA 3VS4A 2C0TA 1BCOA 3I55A 1VQOT 4JZ3A 1AVZC 4PFOA 1B34A 2VKNA 3OY9A 1JXOA 1PHTA 3CD6T 3X26B 2GTOA 4E47A 4ZN1A 1YWOA 1KFZA 1UGVA 4PL6A 1AEYA 2LCSA 2XDDA 3JCMW 1IXDA 4AT1B 2QTVA 3CCVT 2QQBA 3I35A 3A1PA 2RHUA 4ZGDB 4LUEA 2K4YA 3G4ST 1HSQA 2FL7A 2BKDN 1PKSA 4C5HA 3CC2A 3BW1A 3JB9I 1YIJT 1KC8R 1Q81C 2YUQA 1NPRA 2QDLA 3I56T 3EGDA 1JRIA 2F2VA 2PVOB 1MNEA 1BIBA 5LJ3e 2AZSA 3ASKA 1YI2A 3SHWA 1H92A 2QQAA 3RERA 3HP9A 1K73C 1SHGA 2HNIA 3G7ZA 4N0AC 1Q86U 2K57A 1JEGA 4M4ZA 1VQ8A 2JM9A 2D9TA 3J7AF 2CZ1B 2VXFA 4XU1A 4KT0E 2DERA 3L2QA 2D0QB 1VQ9Q 1W2BS 2C0IA 3GNGA 4BE0A 1U3OA 3LYIA 4XTZA 4C0DC 1M3CA 5GAN3 5CVIA 2XIDA 3KUFA 5A0GA 3PE0A 1M3AA 2F2XA 3X28B 2DL5A 2DO3A 3AT1B 2SRCA 1AWOA 2E6ZA 1OZ2A 1WFWA 1YP5A 2R5AA 2E5QA 5GAN7 1WJRA 5C6SA 3LH5A 3OMCA 3OSVA 5GJWB 3PVQA 5GAN2 3CXCP 4LNPA 1UEBA 1GBQA 3QWXX 2DEQA 1TOVA 1VQ4A 4PJOG 1MGQA 3QYHB 4BUGA 2XKOC 4QQDA 1SSFA 3CCUA 3HRTA 2Y4YA 4M78B 4M7DE 2VVKA 2X4XA 3T9NA 1Q86R 3G6EQ 4M75F 4RCCA 3EGXA 1X75C 2KDSA 4PK4A 3FJ5A 1RAEB 4C92E 2XU8A 3MO8A 2CP7A 5IT9E 4M7DD 1XJWB 2VGMA 1MMNA 2QEXT 3FEOA 2L8DA 4M7AF 1QVPA 5GAN8 2DKGA 2E70A 3JCMg 2MAMA 2MMPA 3C95A 3VYHB 4Y92A 1PWTA 4BD3A 1P92A 2WSFE 5J3BA 2L89A 2QAZA 5I2MA 4PJOF 2RH2A 2QTXA 4J9BA 3OW2P 1M90C 2P4RA 2WACA 4QVCA 1BK2A 2AHJB 3QPHA 4PLLA 2HD0A 1ABQA 3S3NA 1YITQ 1RAFB 3H41A 4A63B 2BZ8A 2E4HA 2D8JA 3BDUA 2HBWA 1TUCA 2DVJA 4QKUA 2W0ZA 1UJYA 4FIBA 2EBPA 5KCHA 3X20B 4E7LA 2NUZA 3UF4A 2GFAA 3RDVA 2RQUA 3A8LB 4C0FA 1CSKA 2LTOA 1D0XA 2CREA 2RHIA 3NTHA 4EDUA 4B9XA 3CCRT 1ZBXA 2QI2A 1YJ9T 1RAGB 4QQGA 1G8XA 1VQLT 1M5Q1 1WA7A 1D0ZA 1SRLA 5KYUB 1SHFA 5CO7A 2XMFA 3TU4K 2RJCA 1WJSA 2DM1A 3RNJA 1VA7A 2HSEB 1OEBA 2RPNA 1VQNA 5CKEA 3META 2O2OA 1VQPQ 3E1SA 1N9SA 1NE8A 2F69A 2EYWA 1HJDA 2LJ1A 5IXBA 2DFUA 2BZXA 2HL5C 2YHTA 3RKWA 2E41A 2QA4T 2DYIA 1VQ7Q 2FVUA 2J05A 4EMKC 4OGCA 1T0JA 3FDRA 1FXXA 4XU2A 4KULA 3L2WA 3OQ5A 4C8QG 4LDWA 2AK5A 5KYWA 3V8JA 2RMOA 3OYKA 1UUEA 1KG1A 1PC0A 3VKIA 3M0RA 2M16A 3UPUA 2NUTB 4AFZC 5KYXA 1Y71A 4BY6C 1IHWA 3CC7A 3M0PA 3H0HA 2OAUA 4OMOA 7AT1B 2K5IA 2GF7A 2HL3A 1M27C 3EG9B 3OYDA 3G4SQ 2JTFA 3DLMA 1BB9A 1WYXA 4C5IA 4AFQC 2KYMA 1RLPC 2F5TX 1OX8A 1X69A 3CBPA 4X34A 4DA4A 1NLPC 1WGSA 3BY7A 1TUDA 3EFOB 3SWNB 4Z88A 1YJNT 2ZPBB 3UWNA 4KGVB 1V76A 4FSSA 4DBRA 2DILA 4A4KA 3LWHA 2OTJT 1YIJA 4KGXB 2JTMA 3CCQT 4C5GA 1QVGA 3I56A 4V2SA 1ACMB 1M90R 1R0CB 2QGFB 3VS1A 4PFPA 1V1CA 3A8OB 1SKUB 2NUPA 2FRWA 4DEYA 2KI7A 1BKBA 3BDLA 5LL6S 3I55T 2YT6A 4M77F 2AKLA 1FWZA 3PT9A 2KXCA 3EGUA 4RCBA 1WHHA 3C12A 5EG2A 3GBQA 3I5SA 5AT1B 3CPWS 2VGNA 2E6NA 1I8FA 3RESA 5M9OA 1UECA 3R6NA 2DL3A 2FB7A 1H3HA 3JB9H 1R77A 1UGRB 4CRIA 3M0QA 2HEQA 4PLIA 2LDMA 4UC4A 1ZA2B 3JCMh 2RI2A 5KYYA 3CC2T 3A8MB 2EFIA 3HRUA 3O8VA 2HQHA 2CP6A 1OX9A 4RTXA 3OYHA 2YLBA 1O75A 4Z02A 2ECZA 4EMGA 3VS2A 2BUDA 2A08A 1IRXA 1YI2T 3HRSA 2CGHA 4N0AA 2LVMA 3QWYA 1KD1U 4F16A 4IIMA 2BTTA 4MZPA 3CEYA 2NLUA 4JZ4A 1VQ8T 5FLXE 1IB8A 1NJIU 4OB3B 5FW9A 2P0PA 2LJ3A 4AG1C 3G71A 5FROA 3H0FA 1VYUA 4PJOC 1WQ7A 4HCKA 2OX7A 2YWWA 2GQVA 3JCMb 4PJMA 1M1FA 1Q7YC 2K2VA 1WX6A 2COWA 2LNHB 4X9DA 5FU6C 1KQSS 2NYSA 1WHMA 3ZBDA 1VQMQ 3QIIA 4JS4A 4NS5A 1J3TA 4RTUA 2RHXA 3HHTB 2BZYA 2DJQA 5GANd 5FU7C 2AT1B 2O4XB 5IN1A 2YDLA 1OPLA 2GBQA 2EPDA 4LD6A 4A54A 1VQ4T 1WI7A 5GANf 1GL5A 2IPOB 4QW2A 5KYWB 1WQWA 2YRCA 1UG1A 3CCUT 1KD1R 1K4US 3HPWA 3OYCA 2K2MA 2R57A 2X4YA 1VQLQ 2P0KA 2RF0A 2RHZA 4R0KA 2L2PA 4ELZC 2OAWA 2YRDA 1RADB 1NJIR 2E64A 3INZA 3CCRA 1C1AA 6AT1B 3JB9D 1K9MC 1BBZA 2AIRB 4PNOA 1WLPB 2F1LA 4J5YA 4XK8E 4J6XA 2DTHA 2OI3A 1KC8C 3PFSA 2RQRA 2SEMA 2QA4Q 3JCMe 1M30A 2LQNA 2ZAEA 3VJPA 2CZ6B 3OYAA 2D6FA 1PKTA 4C8QD 1D3BA 4XAXB 2DX1A 4OP0A 4EPCA 1IZ6A 1Z9ZA 1G3WA 4F7UA 4A4EA 4ZTJA 3MKDA 2B8AA 2NUPB 2QG9B 3OYMA 4PJJA 5HY6A 5IHKA 5KYNA 1JJ2P 5DY9A 2MIOA 4FW2A 1E6GA 5ECAA 2HCKA 1M4ZA 4C8QC 2PZ1A 1XOVA 2ROTA 1VQ6A 3GNFB 3OBYA 2MK5A 3JCMJ 4M78G 4FYWB 4QT7A 4XTXA 1ZSGA 2F5KA 2QXFA 1JB0E 3HSBA 2VB6A 3OBWA 1VQNT 5LJ5f 1ZUKA 3MEWA 2RA2A 3LGFA 2OTJQ 2RHYA 3JB9J 1MMDA 2L3SA 2CS7A 2JT4A 4C92F 4AMCA 3I5RA 2LCCA 1WJQA 4M77C 2KRNA 4EMKA 4KH0B 1WHLA 4BDZA 4RUGA 3M0SA 3E9GA 4FU6A 2Y90A 1AZGB 3I55Q 3FC3A 4F17A 1Q86C 4M78F 2RO0A 1D1BA 1EZZB 2FYKA 2DVEA 1WZOA 2EGEA 4RG8A 4KUIA 1YWPA 4IUVA 2JS2A 4C0DB 2RNAA 4P5NA 3CC7T 4KGZB 1VQKQ 2VWFA 2LQ8A 1IREB 5GANj 1GCQC 2V1QA 2EYQA 3E2UA 5FRMA 1UGQB 2EVRA 2DAQA 1SF9A 2L3PA 1K9MR 1T3LA 3ER0A 2DXCA 2MPXC 9ATCB 3TCJA 1HXDA 2DETA 2MWOA 4RTYA 2DF6A 1GFCA 2LQKA 3M57A 2CP2A 3M4GA 2LC4A 3I9QA 5GMKm 5IAYA 1AT1B 2QQRA 3UT1A 1RABB 3UA7A 1ZA1B 3VS3A 2VV5A 3HTRA 4KBMB 1W2BP 5CAIA 1TXQA 4FYVB 1YHQT 5IHIA 2JTEA 2RD1A 1ZLMA 2BE9B 4BDYA 2LT1A 3HKSA 4CC7A 1FMKA 4IUQA 2I0NA 3JV3A 2L5QA 1LOJA 1U8RA 2RN8A 4M75G 3SFMA 1M2VB 1NEGA 2CKKA 2KRMA 1UFFA 5HCKA 4FM4B 3M9QA 2ENMA 4M7DB 2CUBA 3OYIA 3PVLA 1CKBA 4LDUA 4C92B 4M7AG 4FYYB 2E5KA 2GGRA 1OU9A 2PTKA 4F7UB 4Y91A 2COZA 2PVGB 1SRMA 2DA9A 5LJ5j 3MP1A 4FCYA 4CC3A 3P8BB 4RTZA 3QDRB 2JUFA 4IUUA 1QP3A 3PGGA 4JRKA 1XQHA 2B86A 2ZPEB 2CT3A 3CCSA 4PJOA 4DBHA 4XTUA 1E7OA 2FPDA 2JOYA 2O9SA 3M54A 3G71T 2DLPA 2J6FA 2ATCB 4MZTA 3RBBB 8AT1B 1MV0B 4F7UE 2GTJA 2BE7D 2X35A 3GF5A 4ORZA 2P4TA 1QWFA 4CC4B 2CZ7B 2O9VA 4D8KA 2ZPHB 2EJGA 2M51A 3ULRB 2CDTA 5CK9A 2PVDB 4NL3A 5GANg 4X1VA 2PNIA 2LCLA 2EQKA 1Y57A 2AZVA 2FZKB 4EMKB 2X4JA 4WCIA 2DL8A 3EG0A 2K3YA 2I2LA 1X27A 3CMAQ 2KNBB 1U1TA 3M0UA 8ATCB 4LDXA 2E12A 3FIFA 1IO6A 4J83A 3MP6A 4JJBA 2YSQA 1MMAA 3CXCA 5GAMd 3CMEQ 2KXDA 5D7UA 5KH6A 2XG8D 3V8LA 4X9CA 4JJDA 4M78D 2CSQA 2HZYA 3JCMQ 1B34B 1Y96A 1QVFS 3A5ZB 1K1ZA 1MV3A 1FMWA 4J8OA 2DRMA 4OMMA 2EAYA 3DB3A 5CQXA 5GAN4 1B7TA 5CKDA 3H6ZA 4L5GA 3EG3A 3EFSA 2EKOA 3UA6A 1OV3A 1D0YA 2KYBA 4M78C 2DXBA 1VIFA 1TG0A 1QKXA 2OJ2A 4BB7A 3VU3C 3CC4A 3OYYA 5KE2A 2K3BA 1S72Q 3QZ5B 1QVFA 1C0MA 1X2KA 3CCJT 3EGDB 3OW2A 3QXEB 2E10A 3DB4A 1RI9A 1VQOQ 2P84A 1W1FA 4E7KA 2X3WD 3TEEA 4HCZA 1QVGP 3QUIA 4C8QA 4YTLA 4XU3A 3JRZA 2R5MA 1H8KA 2V8KA 3CD6Q 3M0TA 4L6V5 1VQ6T 1GRIA 4OB2B 2O31A 2JM8A 4N4GA 5LJ5g 1VQPA 1QVGS 3QSUA 4XTVA 5GMKj 4PJNA 4TVRA 3SEMA 3CCVQ 3MEUA 1N8RU 1UGSB 2KK4A 4M77G 5IHNA 1T0HA 1YIJQ 3CCLA 4GBQA 3U23A 3NPFA 3I56Q 4M77A 2K5LA 4J9HA 1OULA 2CUDA 2PUKB 3VUZA 2LRQA 2OTLA 2KROA 3GIBA 3NTIA 4R55A 2L3QA 1KK7A 2DXUA 2QYZA 2D1XA 3NMZC 2DEUA 1KD1C 3VRZA 4OMQA 4LUDA 2LMJA 1WIEA 1KJWA 2VASA 1JBMA 1NJIC 4J9IA 1ZBJA 2CP3A 3CPWP 5GAOr 2DPPB 1FX7A 5CCAA 1M8VA 2EWNA 4EIKA 1Q82U 3EGXB 2EYZA 4JJNK 3JCMX 1YHQA 4OVAA 2KT8A 4VUBA 3V7CA 4M75D 3CCEA 1GCQA 2ABLA 1M2OA 1WPYA 2EGCA 4M7AE 1W4SA 4OB0B 1Y07A 1ZX6A 3N5BB 4OF1A 3VRYA 5I11A 1UDLA 4JRPA 1MNDA 1N8RR 4M7AD 2EGAA 1SPKA 2P0QA 5CR2A 2RK2A 5J39A 4PJOE 1UJ0A 5DLOA 2E3HA 3E19A 3PTAA 5C0MA 3MCAB 2IG0A 4GLKA 5GAOl 3A98A 4ATOA 5GAMj 4D8DA 4JRIA 3QYGB 5GANh 4PJOD 4M75C 3QG1A 2V26A 1M1GA 3RR6A 2DNUA 2FPEA 4KUDK 1QKWA
chains in the Genus database with same CATH topology
1Q86R 3G6EQ 3CC2Q 1VQNQ 3CMEQ 3CCQQ 3G71Q 3CC4Q 1Q7YR 1VQ4Q 1JJ2P 3CCVQ 1QVFP 1K9MR 1K73R 1VQOQ 2QEXQ 3CCUQ 3G4SQ 3OW2P 1VQMQ 3CC7Q 3CCRQ 3CXCP 1VQPQ 3CCSQ 1KD1R 1M90R 1YI2Q 1YJ9Q 1W2BP 1QVGP 1YIJQ 1YITQ 1VQLQ 2OTLQ 1YJWQ 1YHQQ 1KC8R 1VQKQ 3CD6Q 3I56Q 3CMAQ 2QA4Q 3I55Q 1YJNQ 1Q81R 1K8AR 1Q82R 1KQSP 1VQ5Q 3CCEQ 1VQ6Q 3CCJQ 1NJIR 1VQ7Q 1VQ9Q 3CPWP 1S72Q 1VQ8Q 3CCMQ 1N8RR 1M1KR 3CCLQ 2OTJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 R;  3G6E Q;  3CC2 Q;  1VQN Q;  3CME Q;  3CCQ Q;  3G71 Q;  3CC4 Q;  1Q7Y R;  1VQ4 Q;  1JJ2 P;  3CCV Q;  1QVF P;  1K9M R;  1K73 R;  1VQO Q;  2QEX Q;  3CCU Q;  3G4S Q;  3OW2 P;  1VQM Q;  3CC7 Q;  3CCR Q;  3CXC P;  1VQP Q;  3CCS Q;  1KD1 R;  1M90 R;  1YI2 Q;  1YJ9 Q;  1W2B P;  1QVG P;  1YIJ Q;  1YIT Q;  1VQL Q;  2OTL Q;  1YJW Q;  1YHQ Q;  1KC8 R;  1VQK Q;  3CD6 Q;  3I56 Q;  3CMA Q;  2QA4 Q;  3I55 Q;  1YJN Q;  1Q81 R;  1K8A R;  1Q82 R;  1KQS P;  1VQ5 Q;  3CCE Q;  1VQ6 Q;  3CCJ Q;  1NJI R;  1VQ7 Q;  1VQ9 Q;  3CPW P;  1S72 Q;  1VQ8 Q;  3CCM Q;  1N8R R;  1M1K R;  3CCL Q;  2OTJ Q; 
#chains in the Genus database with same CATH topology
 2FRY A;  4D6W A;  1FMV A;  1N27 A;  1Z9Q A;  4M7A C;  3UAT A;  1A0N B;  2QEX Q;  1RAA B;  4LXC A;  3SWN C;  2LNV A;  2QK0 A;  2HSP A;  3DLL A;  1Q82 R;  1KQS P;  1O9S A;  1BYM A;  1TS9 A;  1VUB A;  4QVZ A;  4FL6 A;  2KR3 A;  2QAS A;  4KH1 B;  5A2Q E;  1H3Z A;  2QQ9 A;  1RI0 A;  2DJZ A;  3R6O A;  4WF2 A;  2JVV A;  3CQT A;  4QVD A;  5IH2 A;  4B6M A;  4FT2 A;  3QJ6 A;  4HXJ A;  3OA6 A;  1QP2 A;  3G1J A;  3M55 A;  1PD1 A;  2CH4 W;  1VQ9 T;  4Z8A A;  1QMC A;  4XTW A;  3JCM d;  2KRS A;  1YJW A;  3TRE A;  1RAH B;  3V8K A;  3JCM V;  4C0Z A;  3SB2 A;  3CCR Q;  4ZGE B;  4J9E A;  2FHD A;  4ZNX A;  1YJ9 Q;  5A0D A;  5D6X A;  2DTI A;  3CCS T;  5A0L A;  4HCB A;  1ZUU A;  2EQM A;  2GNC A;  5KYX B;  3EG1 A;  1VQM A;  5J26 A;  3VUB A;  4BI8 B;  2ZCF B;  1M9S A;  2RB6 A;  1NYF A;  3C0C A;  5LJ5 h;  3OS0 A;  4A4H A;  3SDZ A;  2RQV A;  1YFN A;  1NYG A;  1PRL C;  4IIO A;  3HL8 A;  4C8Q E;  4OGE A;  3KFV A;  4E6R A;  3FB9 A;  2FPF A;  4C0G A;  4JS5 A;  3EG2 A;  1WHG A;  3OYJ A;  4CI0 C;  3OSS C;  3CPF A;  3C4S A;  3REA B;  3G6E T;  4HT9 A;  4L59 A;  3ME9 A;  2K3X A;  5GAN e;  4BE2 A;  1AD5 A;  1PSE A;  4E7S A;  1KHC A;  3CCJ A;  1SEM A;  4A53 A;  1X6O A;  2H8H A;  2COY A;  1PG5 B;  4ANJ A;  4LN2 A;  4C92 G;  5GAM g;  2FZG B;  2YLC A;  4M77 E;  1CKA A;  2DTO A;  2DMO A;  1K8A U;  2JW4 A;  4M77 D;  3QO3 A;  3LGL A;  4BE1 A;  5L8R E;  1JQQ A;  1X43 A;  3V7S A;  2MF2 A;  2IIM A;  4J6W A;  4LDV A;  2HKN A;  1LJO A;  3MEA A;  1AHJ B;  5GJV B;  2A37 A;  2HKQ B;  1YIT T;  1YJN Q;  1PRM C;  2V8J A;  4M78 A;  2JNG A;  4MZM A;  1MHN A;  2DD5 A;  3NTK A;  4M7D F;  1KQ2 A;  2KT1 A;  3CCQ Q;  3OS1 A;  1S1N A;  5KYY B;  2J7I A;  2XIC A;  3H9N A;  5DLQ E;  1BI1 A;  2ZGW A;  4MML A;  3CC4 T;  3QBY A;  2EYY A;  4AG2 C;  1IGU A;  5GAN 5;  4ELY C;  4F7U F;  4J6Y A;  4JLG A;  3GPL A;  2CP0 A;  1HK9 A;  2FZC B;  2G6F X;  2ESW A;  4BAC A;  3LLR A;  2O01 E;  1KC8 U;  1UTI A;  1RUW A;  4DOV A;  1RL2 A;  3HFO A;  2RI5 A;  4J9G A;  2KMT A;  2L0A A;  2RI3 A;  1PNJ A;  3WVD B;  1VQ5 A;  3JCM c;  5LJ3 d;  4OMN A;  4A4F A;  2MYS A;  3BE3 A;  3CCM A;  1VQP T;  4ZGJ B;  1JJ2 A;  3E9F A;  1K8A R;  4FW1 A;  5LJ5 e;  1U5S A;  2JJ9 A;  2LT4 A;  4J9C A;  2KVQ G;  1GBR A;  3OS2 A;  5LJ3 f;  1ZSZ C;  1D1C A;  1QCN A;  5KCO A;  1VQ7 T;  3L42 A;  3CC2 Q;  3OYL A;  3CCL T;  5GAN 6;  3RKY A;  1M1K U;  3FLG A;  1HYO A;  3M5A A;  4Q5W A;  1YI2 Q;  2LP5 A;  5GMK h;  1F1B B;  1GFD A;  2OTL T;  1N9R A;  4DBF A;  5KYU A;  1LNX A;  2CH4 A;  1M8M A;  1VQ8 Q;  2MCN A;  2MOX A;  4Z89 A;  5I2S A;  3EHR A;  1VQK A;  4B9W A;  1W70 A;  2ZPI B;  1PCX A;  2X51 A;  3DKM A;  2J06 A;  2LQW A;  2JMA A;  4RTV A;  4F14 A;  1G3T A;  5EC7 A;  1YCY A;  3EAE A;  2EYX A;  2R58 A;  2DRK A;  2KSS A;  4IUT A;  1I0C A;  3CCE T;  4GY5 A;  1I5O B;  3OS5 A;  2KEA A;  3RMQ A;  3S6W A;  1G5V A;  1LVK A;  1WHJ A;  4O5V A;  3QZ9 B;  5CQY A;  3OYG A;  1OPK A;  4LE9 A;  1YCS B;  1TUG B;  2WSC E;  3LH0 A;  1GCP A;  3M53 A;  1SSH A;  2NUT A;  2EIF A;  3F70 A;  1QQJ A;  1TU0 B;  4M75 A;  1M1K R;  2DL4 A;  5IXF A;  1D3B B;  2DK3 A;  1VQ4 Q;  4C5E A;  4ESR A;  3EG9 A;  1AWX A;  3CCU Q;  4XTY A;  2K7A A;  4PKC C;  3CCS Q;  1VQ9 A;  3RKX A;  1X01 A;  1JU5 C;  1W6X A;  3H8Z A;  1QWE A;  4M7A A;  1MMG A;  3OYB A;  2CP5 A;  3EH2 A;  3Q1J A;  3EFO A;  3SWN A;  2X9H A;  2E65 A;  1R8O B;  1OZ3 A;  4JDS A;  2HQE A;  4RKU E;  5D6Y A;  2Y4X A;  5GAM h;  2A3L A;  3LWI A;  1Q81 U;  2LZ6 B;  2X3X D;  3TSZ A;  2HQX A;  3ZL7 C;  2KAF A;  4OB1 B;  3TQ7 P;  1W2B A;  2BIV A;  3REB B;  1K73 U;  2KGT A;  3FRN A;  3L1A A;  4JRQ A;  1D09 B;  2QGG A;  3CXC S;  3IQL A;  4HVV A;  1T3S A;  1AOJ A;  3VS6 A;  1NLO C;  4JPB W;  2QDY B;  3QJY A;  2XDP A;  4DQ2 A;  2KY9 A;  5GMK e;  5DM7 R;  4F04 B;  3PIO A;  3OYE A;  3JCM P;  5I21 A;  4C92 D;  2Z0W A;  2EQU A;  1DJ7 B;  3QKJ A;  1OI1 A;  1RLQ C;  3G6E A;  1UHC A;  4FT4 A;  5LJ3 j;  2JXB A;  1YJW T;  1PD0 A;  1G83 A;  5GMK i;  4M78 E;  2DYB A;  5GAO q;  3L2U A;  2XI9 A;  5CKH A;  5HK0 A;  5HKC A;  3GOX A;  4Y28 E;  2VYT A;  3PIP A;  1QVF P;  4J9F A;  4A4G A;  1BI0 A;  4BY6 B;  2LJ0 A;  4E7H A;  1AZE A;  1VQM T;  3AHU A;  4M7D C;  4N4I A;  1WXB A;  3A8H B;  3V7R A;  3VV0 A;  2FG0 A;  3OW2 S;  5GAM f;  3TSW A;  1Q81 R;  4C92 C;  1VQN Q;  4IKF A;  2H3E B;  3A8G B;  1BI3 A;  4HVU A;  1N8R C;  1RAI B;  3X24 B;  1YNZ A;  3GP8 A;  3CC4 Q;  1YIT A;  3H0I A;  1K73 R;  2K9G A;  3CMA A;  1EFN A;  3RMS A;  4LDY A;  3M4Y A;  3S3M A;  1OOT A;  1R0B G;  2K79 A;  2HBP A;  3CME A;  5L23 A;  3OMG A;  3KBG A;  2RJE A;  3JSC A;  1E6H A;  4J7I A;  2M1H A;  2JN0 A;  2H3J A;  3NHN A;  3P8H A;  3CBM A;  3HFN A;  4KRT A;  3PMT A;  4JLI A;  1X6B A;  2EJ9 A;  3PMI A;  3JB9 G;  4NL2 A;  1UE9 A;  4LD9 K;  3CC7 Q;  5GAO n;  3L2R A;  4MDW A;  3D7S B;  2EW3 A;  3J81 E;  2M0O A;  5GAM e;  4R56 A;  2EKH A;  1BI2 A;  1M90 U;  1Q82 C;  2ZPF B;  1I5L A;  2O4X A;  1BIA A;  2ED0 A;  3CCL Q;  2JMC A;  4DEX A;  1X6G A;  4ZTF A;  2EJF A;  3L2Z A;  1B07 A;  4ZN3 A;  4OMF B;  2AKK A;  2ED1 A;  3NGP A;  4QQ6 A;  4JJC A;  1S72 A;  1VQ7 A;  1YBY A;  4PFZ A;  2OTL Q;  3VS5 A;  2E3I A;  3S3O A;  1NG2 A;  1K9A A;  1K76 A;  4N4H A;  3JB9 F;  2XDB A;  3P8D A;  5FRN A;  1VQO A;  4WTO B;  4XU0 A;  2ROL A;  1NPP A;  4M75 B;  4RMO A;  3C94 A;  1TSF A;  1VYT A;  1AWJ A;  2RQT A;  3CD6 A;  1LPL A;  3NFC A;  3X25 B;  2PU9 B;  1M3B A;  3URG A;  3JAM E;  1B3Q A;  4M7A B;  3J80 E;  1YHQ Q;  2C0O A;  5GAO p;  1N5Z A;  4C8Q F;  3MEV A;  3CCV A;  2YUP A;  3CCE Q;  1AWW A;  1X2Q A;  1TH7 A;  3G4S A;  1BCM A;  2GQI A;  4M75 E;  2XHC A;  1VQ5 T;  4J7F A;  2RJF A;  1UHF A;  5LJ3 g;  3CCM T;  4PJO B;  2A0F B;  2VXE A;  1U1S A;  1ZSZ A;  2GFU A;  5CKB A;  4RTT A;  5FU6 B;  1LCK A;  1Q95 G;  4MMK A;  4ME7 A;  1G2B A;  5D6W A;  4RTW A;  3EH1 A;  1V29 B;  4DOW A;  1TWB A;  3VS0 A;  5FU7 B;  3BFM A;  4EMH A;  2A7Y A;  2YUO A;  1VYV A;  1N6A A;  2A36 A;  1WNL A;  2RK1 A;  2LX9 A;  3M59 A;  1I81 A;  3LX7 A;  1VIE A;  2ZPG B;  3RIR A;  1VQK T;  2W10 A;  4O6J A;  1UGP B;  2FEI A;  5AYF A;  2FO0 A;  3VYG A;  2ZZD A;  1XTD A;  3G71 Q;  4HCC A;  2RQW A;  2G3R A;  3SD4 A;  1U06 A;  2KQW A;  4CC2 A;  3CPW A;  1Y96 B;  1JXM A;  2YXY A;  4RG2 A;  4AFU C;  3OYN A;  1SG5 A;  3L2V A;  2NWM A;  4BI3 A;  1UB4 A;  2D8H A;  2KBT A;  1Y7X A;  3EHQ A;  3MHX A;  1YN8 A;  2D0N A;  2DZ9 A;  4HVW A;  2HAX A;  3QDF A;  1HD3 A;  1NM7 A;  3MPU B;  2CT4 A;  1KQ1 A;  1I07 A;  1YJW Q;  1H64 1;  1NBE B;  2MI6 A;  4MDX A;  2CSI A;  2WSE E;  2QEX A;  3RUX A;  1PSF A;  2GCX A;  2DIG A;  2LX7 A;  1G3Y A;  2VC8 A;  1KSW A;  1ARK A;  4K11 A;  5FWB A;  3M58 A;  2DBK A;  3OYF A;  5GAO m;  5CKF A;  4C8Q B;  2V1R A;  2E1H A;  1K8A C;  2M02 A;  1OU8 A;  4IUR A;  1K0X A;  1TTH B;  3JCM f;  2MWP A;  3OB9 A;  3M56 A;  3GLX A;  1QW1 A;  1K0S A;  1KHI A;  1WXT A;  4OMP A;  2DIQ A;  4DBQ A;  1Y0M A;  1XNI A;  2DXT A;  3TVT A;  4GLM A;  1KQS A;  2O88 A;  5CIU A;  1MUZ A;  1NZ9 A;  1NEB A;  1I4K 1;  4M77 B;  3CCJ Q;  3LW5 E;  3ZEH A;  3WXM B;  2K6D A;  2PQW A;  1IHV A;  2YUN A;  1YJ9 A;  2DBM A;  5HK3 A;  1VQL A;  2A28 A;  2RJD A;  2DD4 A;  3CBO A;  4JUV A;  1VOM A;  2J6K A;  2X4W A;  1Q7Y U;  1IGQ A;  1PM3 A;  4M7D G;  2EQJ A;  1M2V A;  1GXI E;  2JZ2 A;  1VQ6 Q;  1WHK A;  4M7D A;  1JO8 A;  3ZFJ A;  2HMA A;  2V8I A;  2XK0 A;  4F7U G;  2YRV A;  3FJP A;  4C92 A;  2CYZ B;  2RM4 A;  4E2F B;  1C6V X;  1QLY A;  5LJ3 h;  1ZSZ B;  1ZHI A;  2QQS A;  2QA4 A;  2XD0 A;  1I1J A;  1D1A A;  4XQ3 A;  5KE3 A;  2K5F A;  2KE9 A;  1QCO A;  1OQK A;  4PJL A;  2L3R A;  3QHS A;  3CMA T;  2HDA A;  1M1K C;  1WXU A;  3PNW C;  1EX4 A;  2EQI A;  4FYX B;  1G3S A;  1BU1 A;  3VS7 A;  5I22 A;  1RAC B;  1QCF A;  3UDC A;  3CME T;  4BI4 A;  5LJ5 d;  2IVW A;  1ZUY A;  2DZC A;  4E7Z A;  4NOY A;  1JJ2 S;  4HT8 A;  1FYN A;  1K9M U;  3EFR A;  2F2W A;  2PUO B;  1VQ5 Q;  4FSX A;  3O5Z A;  3MP8 A;  4IUP A;  3CCM Q;  4E7I A;  5GMK l;  1ZQ1 A;  1EIF A;  2DL7 A;  3WVE B;  1Q7Y R;  1WDX A;  1KIK A;  2DE0 X;  1YJN A;  2M9U A;  3MJX A;  3THK A;  2JS0 A;  2CZ0 B;  2C06 A;  2VUB A;  2J6O A;  2OTJ A;  1ABO A;  4E7J A;  3CCQ A;  4HA8 A;  5FWC A;  4AFS C;  1OYX A;  4OML A;  1S72 T;  4II1 A;  4J9D A;  4HKE A;  3KXT A;  2M0Y A;  3VS4 A;  2C0T A;  1BCO A;  3I55 A;  1VQO T;  4JZ3 A;  1AVZ C;  4PFO A;  1B34 A;  2VKN A;  3OY9 A;  1JXO A;  1PHT A;  3CD6 T;  3X26 B;  2GTO A;  4E47 A;  4ZN1 A;  1YWO A;  1KFZ A;  1UGV A;  4PL6 A;  1AEY A;  2LCS A;  2XDD A;  3JCM W;  1IXD A;  4AT1 B;  2QTV A;  3CCV T;  2QQB A;  3I35 A;  3A1P A;  2RHU A;  4ZGD B;  4LUE A;  2K4Y A;  3G4S T;  1HSQ A;  2FL7 A;  2BKD N;  1PKS A;  4C5H A;  3CC2 A;  3BW1 A;  3JB9 I;  1YIJ T;  1KC8 R;  1Q81 C;  2YUQ A;  1NPR A;  2QDL A;  3I56 T;  3EGD A;  1JRI A;  2F2V A;  2PVO B;  1MNE A;  1BIB A;  5LJ3 e;  2AZS A;  3ASK A;  1YI2 A;  3SHW A;  1H92 A;  2QQA A;  3RER A;  3HP9 A;  1K73 C;  1SHG A;  2HNI A;  3G7Z A;  4N0A C;  1Q86 U;  2K57 A;  1JEG A;  4M4Z A;  1VQ8 A;  2JM9 A;  2D9T A;  3J7A F;  2CZ1 B;  2VXF A;  4XU1 A;  4KT0 E;  2DER A;  3L2Q A;  2D0Q B;  1VQ9 Q;  1W2B S;  2C0I A;  3GNG A;  4BE0 A;  1U3O A;  3LYI A;  4XTZ A;  4C0D C;  1M3C A;  5GAN 3;  5CVI A;  2XID A;  3KUF A;  5A0G A;  3PE0 A;  1M3A A;  2F2X A;  3X28 B;  2DL5 A;  2DO3 A;  3AT1 B;  2SRC A;  1AWO A;  2E6Z A;  1OZ2 A;  1WFW A;  1YP5 A;  2R5A A;  2E5Q A;  5GAN 7;  1WJR A;  5C6S A;  3LH5 A;  3OMC A;  3OSV A;  5GJW B;  3PVQ A;  5GAN 2;  3CXC P;  4LNP A;  1UEB A;  1GBQ A;  3QWX X;  2DEQ A;  1TOV A;  1VQ4 A;  4PJO G;  1MGQ A;  3QYH B;  4BUG A;  2XKO C;  4QQD A;  1SSF A;  3CCU A;  3HRT A;  2Y4Y A;  4M78 B;  4M7D E;  2VVK A;  2X4X A;  3T9N A;  1Q86 R;  3G6E Q;  4M75 F;  4RCC A;  3EGX A;  1X75 C;  2KDS A;  4PK4 A;  3FJ5 A;  1RAE B;  4C92 E;  2XU8 A;  3MO8 A;  2CP7 A;  5IT9 E;  4M7D D;  1XJW B;  2VGM A;  1MMN A;  2QEX T;  3FEO A;  2L8D A;  4M7A F;  1QVP A;  5GAN 8;  2DKG A;  2E70 A;  3JCM g;  2MAM A;  2MMP A;  3C95 A;  3VYH B;  4Y92 A;  1PWT A;  4BD3 A;  1P92 A;  2WSF E;  5J3B A;  2L89 A;  2QAZ A;  5I2M A;  4PJO F;  2RH2 A;  2QTX A;  4J9B A;  3OW2 P;  1M90 C;  2P4R A;  2WAC A;  4QVC A;  1BK2 A;  2AHJ B;  3QPH A;  4PLL A;  2HD0 A;  1ABQ A;  3S3N A;  1YIT Q;  1RAF B;  3H41 A;  4A63 B;  2BZ8 A;  2E4H A;  2D8J A;  3BDU A;  2HBW A;  1TUC A;  2DVJ A;  4QKU A;  2W0Z A;  1UJY A;  4FIB A;  2EBP A;  5KCH A;  3X20 B;  4E7L A;  2NUZ A;  3UF4 A;  2GFA A;  3RDV A;  2RQU A;  3A8L B;  4C0F A;  1CSK A;  2LTO A;  1D0X A;  2CRE A;  2RHI A;  3NTH A;  4EDU A;  4B9X A;  3CCR T;  1ZBX A;  2QI2 A;  1YJ9 T;  1RAG B;  4QQG A;  1G8X A;  1VQL T;  1M5Q 1;  1WA7 A;  1D0Z A;  1SRL A;  5KYU B;  1SHF A;  5CO7 A;  2XMF A;  3TU4 K;  2RJC A;  1WJS A;  2DM1 A;  3RNJ A;  1VA7 A;  2HSE B;  1OEB A;  2RPN A;  1VQN A;  5CKE A;  3MET A;  2O2O A;  1VQP Q;  3E1S A;  1N9S A;  1NE8 A;  2F69 A;  2EYW A;  1HJD A;  2LJ1 A;  5IXB A;  2DFU A;  2BZX A;  2HL5 C;  2YHT A;  3RKW A;  2E41 A;  2QA4 T;  2DYI A;  1VQ7 Q;  2FVU A;  2J05 A;  4EMK C;  4OGC A;  1T0J A;  3FDR A;  1FXX A;  4XU2 A;  4KUL A;  3L2W A;  3OQ5 A;  4C8Q G;  4LDW A;  2AK5 A;  5KYW A;  3V8J A;  2RMO A;  3OYK A;  1UUE A;  1KG1 A;  1PC0 A;  3VKI A;  3M0R A;  2M16 A;  3UPU A;  2NUT B;  4AFZ C;  5KYX A;  1Y71 A;  4BY6 C;  1IHW A;  3CC7 A;  3M0P A;  3H0H A;  2OAU A;  4OMO A;  7AT1 B;  2K5I A;  2GF7 A;  2HL3 A;  1M27 C;  3EG9 B;  3OYD A;  3G4S Q;  2JTF A;  3DLM A;  1BB9 A;  1WYX A;  4C5I A;  4AFQ C;  2KYM A;  1RLP C;  2F5T X;  1OX8 A;  1X69 A;  3CBP A;  4X34 A;  4DA4 A;  1NLP C;  1WGS A;  3BY7 A;  1TUD A;  3EFO B;  3SWN B;  4Z88 A;  1YJN T;  2ZPB B;  3UWN A;  4KGV B;  1V76 A;  4FSS A;  4DBR A;  2DIL A;  4A4K A;  3LWH A;  2OTJ T;  1YIJ A;  4KGX B;  2JTM A;  3CCQ T;  4C5G A;  1QVG A;  3I56 A;  4V2S A;  1ACM B;  1M90 R;  1R0C B;  2QGF B;  3VS1 A;  4PFP A;  1V1C A;  3A8O B;  1SKU B;  2NUP A;  2FRW A;  4DEY A;  2KI7 A;  1BKB A;  3BDL A;  5LL6 S;  3I55 T;  2YT6 A;  4M77 F;  2AKL A;  1FWZ A;  3PT9 A;  2KXC A;  3EGU A;  4RCB A;  1WHH A;  3C12 A;  5EG2 A;  3GBQ A;  3I5S A;  5AT1 B;  3CPW S;  2VGN A;  2E6N A;  1I8F A;  3RES A;  5M9O A;  1UEC A;  3R6N A;  2DL3 A;  2FB7 A;  1H3H A;  3JB9 H;  1R77 A;  1UGR B;  4CRI A;  3M0Q A;  2HEQ A;  4PLI A;  2LDM A;  4UC4 A;  1ZA2 B;  3JCM h;  2RI2 A;  5KYY A;  3CC2 T;  3A8M B;  2EFI A;  3HRU A;  3O8V A;  2HQH A;  2CP6 A;  1OX9 A;  4RTX A;  3OYH A;  2YLB A;  1O75 A;  4Z02 A;  2ECZ A;  4EMG A;  3VS2 A;  2BUD A;  2A08 A;  1IRX A;  1YI2 T;  3HRS A;  2CGH A;  4N0A A;  2LVM A;  3QWY A;  1KD1 U;  4F16 A;  4IIM A;  2BTT A;  4MZP A;  3CEY A;  2NLU A;  4JZ4 A;  1VQ8 T;  5FLX E;  1IB8 A;  1NJI U;  4OB3 B;  5FW9 A;  2P0P A;  2LJ3 A;  4AG1 C;  3G71 A;  5FRO A;  3H0F A;  1VYU A;  4PJO C;  1WQ7 A;  4HCK A;  2OX7 A;  2YWW A;  2GQV A;  3JCM b;  4PJM A;  1M1F A;  1Q7Y C;  2K2V A;  1WX6 A;  2COW A;  2LNH B;  4X9D A;  5FU6 C;  1KQS S;  2NYS A;  1WHM A;  3ZBD A;  1VQM Q;  3QII A;  4JS4 A;  4NS5 A;  1J3T A;  4RTU A;  2RHX A;  3HHT B;  2BZY A;  2DJQ A;  5GAN d;  5FU7 C;  2AT1 B;  2O4X B;  5IN1 A;  2YDL A;  1OPL A;  2GBQ A;  2EPD A;  4LD6 A;  4A54 A;  1VQ4 T;  1WI7 A;  5GAN f;  1GL5 A;  2IPO B;  4QW2 A;  5KYW B;  1WQW A;  2YRC A;  1UG1 A;  3CCU T;  1KD1 R;  1K4U S;  3HPW A;  3OYC A;  2K2M A;  2R57 A;  2X4Y A;  1VQL Q;  2P0K A;  2RF0 A;  2RHZ A;  4R0K A;  2L2P A;  4ELZ C;  2OAW A;  2YRD A;  1RAD B;  1NJI R;  2E64 A;  3INZ A;  3CCR A;  1C1A A;  6AT1 B;  3JB9 D;  1K9M C;  1BBZ A;  2AIR B;  4PNO A;  1WLP B;  2F1L A;  4J5Y A;  4XK8 E;  4J6X A;  2DTH A;  2OI3 A;  1KC8 C;  3PFS A;  2RQR A;  2SEM A;  2QA4 Q;  3JCM e;  1M30 A;  2LQN A;  2ZAE A;  3VJP A;  2CZ6 B;  3OYA A;  2D6F A;  1PKT A;  4C8Q D;  1D3B A;  4XAX B;  2DX1 A;  4OP0 A;  4EPC A;  1IZ6 A;  1Z9Z A;  1G3W A;  4F7U A;  4A4E A;  4ZTJ A;  3MKD A;  2B8A A;  2NUP B;  2QG9 B;  3OYM A;  4PJJ A;  5HY6 A;  5IHK A;  5KYN A;  1JJ2 P;  5DY9 A;  2MIO A;  4FW2 A;  1E6G A;  5ECA A;  2HCK A;  1M4Z A;  4C8Q C;  2PZ1 A;  1XOV A;  2ROT A;  1VQ6 A;  3GNF B;  3OBY A;  2MK5 A;  3JCM J;  4M78 G;  4FYW B;  4QT7 A;  4XTX A;  1ZSG A;  2F5K A;  2QXF A;  1JB0 E;  3HSB A;  2VB6 A;  3OBW A;  1VQN T;  5LJ5 f;  1ZUK A;  3MEW A;  2RA2 A;  3LGF A;  2OTJ Q;  2RHY A;  3JB9 J;  1MMD A;  2L3S A;  2CS7 A;  2JT4 A;  4C92 F;  4AMC A;  3I5R A;  2LCC A;  1WJQ A;  4M77 C;  2KRN A;  4EMK A;  4KH0 B;  1WHL A;  4BDZ A;  4RUG A;  3M0S A;  3E9G A;  4FU6 A;  2Y90 A;  1AZG B;  3I55 Q;  3FC3 A;  4F17 A;  1Q86 C;  4M78 F;  2RO0 A;  1D1B A;  1EZZ B;  2FYK A;  2DVE A;  1WZO A;  2EGE A;  4RG8 A;  4KUI A;  1YWP A;  4IUV A;  2JS2 A;  4C0D B;  2RNA A;  4P5N A;  3CC7 T;  4KGZ B;  1VQK Q;  2VWF A;  2LQ8 A;  1IRE B;  5GAN j;  1GCQ C;  2V1Q A;  2EYQ A;  3E2U A;  5FRM A;  1UGQ B;  2EVR A;  2DAQ A;  1SF9 A;  2L3P A;  1K9M R;  1T3L A;  3ER0 A;  2DXC A;  2MPX C;  9ATC B;  3TCJ A;  1HXD A;  2DET A;  2MWO A;  4RTY A;  2DF6 A;  1GFC A;  2LQK A;  3M57 A;  2CP2 A;  3M4G A;  2LC4 A;  3I9Q A;  5GMK m;  5IAY A;  1AT1 B;  2QQR A;  3UT1 A;  1RAB B;  3UA7 A;  1ZA1 B;  3VS3 A;  2VV5 A;  3HTR A;  4KBM B;  1W2B P;  5CAI A;  1TXQ A;  4FYV B;  1YHQ T;  5IHI A;  2JTE A;  2RD1 A;  1ZLM A;  2BE9 B;  4BDY A;  2LT1 A;  3HKS A;  4CC7 A;  1FMK A;  4IUQ A;  2I0N A;  3JV3 A;  2L5Q A;  1LOJ A;  1U8R A;  2RN8 A;  4M75 G;  3SFM A;  1M2V B;  1NEG A;  2CKK A;  2KRM A;  1UFF A;  5HCK A;  4FM4 B;  3M9Q A;  2ENM A;  4M7D B;  2CUB A;  3OYI A;  3PVL A;  1CKB A;  4LDU A;  4C92 B;  4M7A G;  4FYY B;  2E5K A;  2GGR A;  1OU9 A;  2PTK A;  4F7U B;  4Y91 A;  2COZ A;  2PVG B;  1SRM A;  2DA9 A;  5LJ5 j;  3MP1 A;  4FCY A;  4CC3 A;  3P8B B;  4RTZ A;  3QDR B;  2JUF A;  4IUU A;  1QP3 A;  3PGG A;  4JRK A;  1XQH A;  2B86 A;  2ZPE B;  2CT3 A;  3CCS A;  4PJO A;  4DBH A;  4XTU A;  1E7O A;  2FPD A;  2JOY A;  2O9S A;  3M54 A;  3G71 T;  2DLP A;  2J6F A;  2ATC B;  4MZT A;  3RBB B;  8AT1 B;  1MV0 B;  4F7U E;  2GTJ A;  2BE7 D;  2X35 A;  3GF5 A;  4ORZ A;  2P4T A;  1QWF A;  4CC4 B;  2CZ7 B;  2O9V A;  4D8K A;  2ZPH B;  2EJG A;  2M51 A;  3ULR B;  2CDT A;  5CK9 A;  2PVD B;  4NL3 A;  5GAN g;  4X1V A;  2PNI A;  2LCL A;  2EQK A;  1Y57 A;  2AZV A;  2FZK B;  4EMK B;  2X4J A;  4WCI A;  2DL8 A;  3EG0 A;  2K3Y A;  2I2L A;  1X27 A;  3CMA Q;  2KNB B;  1U1T A;  3M0U A;  8ATC B;  4LDX A;  2E12 A;  3FIF A;  1IO6 A;  4J83 A;  3MP6 A;  4JJB A;  2YSQ A;  1MMA A;  3CXC A;  5GAM d;  3CME Q;  2KXD A;  5D7U A;  5KH6 A;  2XG8 D;  3V8L A;  4X9C A;  4JJD A;  4M78 D;  2CSQ A;  2HZY A;  3JCM Q;  1B34 B;  1Y96 A;  1QVF S;  3A5Z B;  1K1Z A;  1MV3 A;  1FMW A;  4J8O A;  2DRM A;  4OMM A;  2EAY A;  3DB3 A;  5CQX A;  5GAN 4;  1B7T A;  5CKD A;  3H6Z A;  4L5G A;  3EG3 A;  3EFS A;  2EKO A;  3UA6 A;  1OV3 A;  1D0Y A;  2KYB A;  4M78 C;  2DXB A;  1VIF A;  1TG0 A;  1QKX A;  2OJ2 A;  4BB7 A;  3VU3 C;  3CC4 A;  3OYY A;  5KE2 A;  2K3B A;  1S72 Q;  3QZ5 B;  1QVF A;  1C0M A;  1X2K A;  3CCJ T;  3EGD B;  3OW2 A;  3QXE B;  2E10 A;  3DB4 A;  1RI9 A;  1VQO Q;  2P84 A;  1W1F A;  4E7K A;  2X3W D;  3TEE A;  4HCZ A;  1QVG P;  3QUI A;  4C8Q A;  4YTL A;  4XU3 A;  3JRZ A;  2R5M A;  1H8K A;  2V8K A;  3CD6 Q;  3M0T A;  4L6V 5;  1VQ6 T;  1GRI A;  4OB2 B;  2O31 A;  2JM8 A;  4N4G A;  5LJ5 g;  1VQP A;  1QVG S;  3QSU A;  4XTV A;  5GMK j;  4PJN A;  4TVR A;  3SEM A;  3CCV Q;  3MEU A;  1N8R U;  1UGS B;  2KK4 A;  4M77 G;  5IHN A;  1T0H A;  1YIJ Q;  3CCL A;  4GBQ A;  3U23 A;  3NPF A;  3I56 Q;  4M77 A;  2K5L A;  4J9H A;  1OUL A;  2CUD A;  2PUK B;  3VUZ A;  2LRQ A;  2OTL A;  2KRO A;  3GIB A;  3NTI A;  4R55 A;  2L3Q A;  1KK7 A;  2DXU A;  2QYZ A;  2D1X A;  3NMZ C;  2DEU A;  1KD1 C;  3VRZ A;  4OMQ A;  4LUD A;  2LMJ A;  1WIE A;  1KJW A;  2VAS A;  1JBM A;  1NJI C;  4J9I A;  1ZBJ A;  2CP3 A;  3CPW P;  5GAO r;  2DPP B;  1FX7 A;  5CCA A;  1M8V A;  2EWN A;  4EIK A;  1Q82 U;  3EGX B;  2EYZ A;  4JJN K;  3JCM X;  1YHQ A;  4OVA A;  2KT8 A;  4VUB A;  3V7C A;  4M75 D;  3CCE A;  1GCQ A;  2ABL A;  1M2O A;  1WPY A;  2EGC A;  4M7A E;  1W4S A;  4OB0 B;  1Y07 A;  1ZX6 A;  3N5B B;  4OF1 A;  3VRY A;  5I11 A;  1UDL A;  4JRP A;  1MND A;  1N8R R;  4M7A D;  2EGA A;  1SPK A;  2P0Q A;  5CR2 A;  2RK2 A;  5J39 A;  4PJO E;  1UJ0 A;  5DLO A;  2E3H A;  3E19 A;  3PTA A;  5C0M A;  3MCA B;  2IG0 A;  4GLK A;  5GAO l;  3A98 A;  4ATO A;  5GAM j;  4D8D A;  4JRI A;  3QYG B;  5GAN h;  4PJO D;  4M75 C;  3QG1 A;  2V26 A;  1M1G A;  3RR6 A;  2DNU A;  2FPE A;  4KUD K;  1QKW A; 
#chains in the Genus database with same CATH homology
 1Q86 R;  3G6E Q;  3CC2 Q;  1VQN Q;  3CME Q;  3CCQ Q;  3G71 Q;  3CC4 Q;  1Q7Y R;  1VQ4 Q;  1JJ2 P;  3CCV Q;  1QVF P;  1K9M R;  1K73 R;  1VQO Q;  2QEX Q;  3CCU Q;  3G4S Q;  3OW2 P;  1VQM Q;  3CC7 Q;  3CCR Q;  3CXC P;  1VQP Q;  3CCS Q;  1KD1 R;  1M90 R;  1YI2 Q;  1YJ9 Q;  1W2B P;  1QVG P;  1YIJ Q;  1YIT Q;  1VQL Q;  2OTL Q;  1YJW Q;  1YHQ Q;  1KC8 R;  1VQK Q;  3CD6 Q;  3I56 Q;  3CMA Q;  2QA4 Q;  3I55 Q;  1YJN Q;  1Q81 R;  1K8A R;  1Q82 R;  1KQS P;  1VQ5 Q;  3CCE Q;  1VQ6 Q;  3CCJ Q;  1NJI R;  1VQ7 Q;  1VQ9 Q;  3CPW P;  1S72 Q;  1VQ8 Q;  3CCM Q;  1N8R R;  1M1K R;  3CCL Q;  2OTJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...