1V1CA

Solution structure of the sh3 domain of obscurin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
IFDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sh3-domain
molecule keywords OBSCURIN
publication title Solution Structure of the SH3 Domain of Obscurin
rcsb
source organism Homo sapiens
total genus 4
structure length 68
sequence length 68
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1v1cA00
1X69A 2PTKA 3QWXX 1KFZA 2HDAA 2CREA 3REBB 2PNIA 1HSQA 2DLPA 2NWMA 2EVRA 1WA7A 2J6KA 1GBQA 2K79A 4HVUA 2ESWA 3VS4A 2KR3A 2BZ8A 2RQVA 2DBMA 2DNUA 2KE9A 2XMFA 1PRLC 2EW3A 2K7AA 3VS7A 3RBBB 1M8MA 1RUWA 2J05A 2HSPA 2DL8A 2MCNA 2JW4A 5FW9A 2FPEA 3LH5A 1S1NA 1JO8A 2V1RA 1Y0MA 4LNPA 5IHNA 3FJ5A 1CSKA 2DF6A 3IQLA 4RTWA 1GL5A 2F2WA 2KGTA 4F17A 2F2XA 1V1CA 2D8JA 2KXCA 4J9IA 1SRMA 4HVWA 5ECAA 1T3SA 2HBWA 1BB9A 3VS3A 2L3PA 5IH2A 3VS2A 1NYFA 2DM1A 1M3BA 1NEBA 1Y57A 2A37A 4DEYA 4LE9A 1I1JA 1X2KA 2SRCA 2JXBA 1WI7A 3M0RA 2DL3A 2L3QA 1GFDA 2FPFA 3I35A 4CC4B 2DBKA 1YP5A 2FO0A 1K76A 1ZBJA 1PHTA 2A36A 2KROA 4J9HA 2EQIA 3VS5A 2DILA 1OOTA 3I5RA 4Y92A 1E7OA 1WYXA 3H41A 1VYVA 1UUEA 2O88A 5IHIA 2J6OA 3EG3A 3EG2A 4J9DA 1AD5A 2GBQA 1SHGA 2ED0A 4D8KA 2RQWA 1AOJA 1JXMA 1AWWA 2I0NA 4JJDA 1H3HA 1K4US 2LNHB 2M0YA 3THKA 1OEBA 1VA7A 3O5ZA 1OPLA 5FWBA 4CC2A 1AWXA 4OMOA 3VS1A 3VRZA 3NPFA 2RN8A 4ORZA 2MIOA 1I07A 1NLPC 2CSIA 1TG0A 1SRLA 2GNCA 2NUZA 4F14A 4K11A 3TSZA 2GTJA 2KRNA 3PVLA 1SPKA 3NMZC 4CC7A 2EYYA 3SEMA 2CUBA 2CDTA 2L0AA 1BBZA 2O31A 3EG0A 3ZL7C 1W70A 4LUDA 1ZUUA 2EPDA 3SHWA 3VS0A 2LCSA 1T3LA 4EIKA 1PKTA 1GCQC 2D0NA 3GBQA 3NGPA 1X2QA 1AZGB 2FG0A 1W6XA 2RPNA 2X3WD 1AWJA 2GGRA 1QKXA 2DA9A 1XOVA 4OMPA 2W10A 4M4ZA 2GTOA 1NM7A 4ESRA 3M0PA 3REAB 4OMLA 1Z9ZA 2EGEA 2YUPA 1HD3A 2O9SA 1SEMA 2CH4W 1KSWA 5GJVB 1HJDA 2YUOA 2B86A 2RF0A 1K1ZA 1UJYA 1X6GA 2DRKA 1U06A 2F2VA 2ROLA 2ED1A 2L2PA 1WXUA 4AG1C 2DL7A 2JS0A 1CKBA 4RTVA 4AG2C 1OV3A 4J9EA 1YCSB 2O9VA 1JU5C 3UA6A 2KRSA 4IIMA 1QCFA 4CC3A 2LJ0A 1GRIA 1ZLMA 1PNJA 1NYGA 2CUDA 3R6NA 1KIKA 3TSWA 1UE9A 1YNZA 2AZVA 1YWOA 1UECA 2BZXA 1I0CA 4RTTA 3UA7A 2M51A 4IIOA 3H0IA 3I9QA 3M0QA 1PKSA 2VKNA 3M0TA 1QKWA 4FSSA 1N5ZA 1MUZA 2OAWA 1LCKA 3EHRA 2G6FX 2KXDA 1G2BA 1WFWA 1KJWA 2MOXA 4JZ4A 3M0UA 3NHNA 2AK5A 2EYXA 3CQTA 1U3OA 3UATA 2FPDA 1B07A 3PVQA 1X43A 1AVZC 2K6DA 2KEAA 1JEGA 4AFQC 1FYNA 2C0TA 1UHCA 1ZUYA 4GBQA 2YDLA 1RLPC 1YN8A 3KFVA 2JT4A 4Z88A 2LJ1A 2BTTA 2KYBA 2RQRA 2YT6A 2P4RA 5GJWB 1K0SA 2KT1A 1G83A 2X3XD 1VYUA 1WXTA 1UTIA 2KRMA 1E6GA 1M30A 2OJ2A 2YUNA 4GLMA 4WCIA 4D8DA 2JS2A 1WXBA 1ABOA 1SSHA 2JTEA 1UDLA 2RQTA 4J9GA 1AEYA 1NG2A 4JJBA 2SEMA 1IO6A 3H0HA 3ULRB 1J3TA 1M3CA 2E5KA 4J9FA 2LQWA 2DL5A 3A98A 5FWCA 1X6BA 4OMMA 2C0IA 4HCKA 2LJ3A 2CT3A 1QWEA 2DJQA 2EKHA 1B3QA 4Z89A 2IIMA 4HVVA 1T0JA 1AZEA 2JM8A 4RUGA 4JPBW 4HXJA 4OMQA 2HEQA 2RMOA 1GBRA 1MV0B 1K9AA 2OI3A 4OMNA 1ABQA 1FMKA 2VVKA 1U5SA 2JMAA 1UGVA 1PRMC 1QWFA 1JQQA 4RTZA 1E6HA 1ZSGA 2AKLA 5I22A 2ROTA 2YSQA 2YUQA 4LUEA 3EHQA 2KBTA 4J9BA 2PZ1A 1UFFA 1WIEA 2FRYA 4R0KA 5IXBA 5HCKA 1UHFA 2J7IA 2CH4A 2DVJA 1TUDA 2LX7A 2D8HA 1ZX6A 2DL4A 2EYZA 4AFSC 4LN2A 1YWPA 3U23A 2KNBB 1A0NB 1BK2A 2J06A 4QT7A 3C0CA 4Z8AA 2A08A 2EGCA 1CKAA 4JJCA 2LZ6B 2H8HA 2HCKA 2JMCA 1VYTA 4A63B 2O2OA 3VRYA 2A28A 1SHFA 2K9GA 2AKKA 4X1VA 2DX1A 4AFUC 2RQUA 4JZ3A 1M27C 2CT4A 2AZSA 2K2MA 3I5SA 2K3BA 5I11A 1GCPA 2EGAA 2CSQA 5EC7A 1W1FA 4J9CA 3H0FA 1UJ0A 1EFNA 3EG1A 4RTYA 1ARKA 3QWYA 2DRMA 4F16A 2RNAA 5IXFA 1GCQA 1H92A 2FRWA 1RLQC 1WDXA 2D1XA 2ENMA 3M0SA 3TVTA 1BU1A 2JM9A 1NEGA 2ECZA 1TUCA 2DYBA 1ZUKA 2QDLA 1RI9A 1T0HA 3JV3A 4RTUA 2J6FA 1WX6A 1QLYA 1Z9QA 2ABLA 1NLOC 2LP5A 1K0XA 1PWTA 2EBPA 2DE0X 2FEIA 1WLPB 4DEXA 1X27A 4RTXA 2DMOA 2W0ZA 3UF4A 2KT8A 2EYWA 5IHKA 2BZYA 1AWOA 2L3SA 3EGUA 4KRTA 5L23A 2GQIA 2KYMA 1OPKA 1MV3A 2V1QA 2C0OA 2LMJA 1JXOA 2LQNA 4ZNXA 4AFZC 4E6RA 1M3AA 3RNJA 3VS6A 3PE0A 1GFCA 2VWFA 1UG1A 1H8KA
chains in the Genus database with same CATH superfamily
3OYYA 5GANj 1VQ8Q 1Q82U 3RIRA 1HSQA 4C5IA 1C1AA 4Z02A 4OB0B 2RQVA 2KE9A 2COZA 1PRLC 2CP3A 2EW3A 2CYZB 1KC8R 2IPOB 1RUWA 2MCNA 1W2BA 2DETA 5FW9A 2COYA 3LH5A 1YJNT 2V1RA 2DJZA 4LNPA 2DK3A 1YITA 4M7DB 8ATCB 2DF6A 4C5GA 1PD0A 4KT0E 1GL5A 1Y96B 1JB0E 2EJ9A 4P5NA 4J9IA 2JVVA 1TU0B 1WPYA 2HAXA 3E2UA 5IH2A 1M4ZA 2GFUA 3EH2A 2DM1A 1BKBA 1Y57A 1VQKQ 1RAEB 4LE9A 1I1JA 1WI7A 5LJ3h 2CGHA 2ZPIB 5LJ5g 2L3QA 4A53A 2FPFA 5DLOA 3I35A 4FYWB 2E1HA 1ZBJA 2CZ1B 4PL6A 2EQIA 3VS5A 1MNDA 2DILA 1OOTA 2RJDA 2YRCA 1E7OA 5LJ5j 2EIFA 5KYUA 4L6V5 1YJ9Q 1SHGA 4D8KA 2JNGA 4JJDA 1VQ8T 1H3HA 1VQMA 1K4US 1QVPA 4C92C 1B34B 2HQXA 3ME9A 5IN1A 2RA2A 4Q5WA 3TU4K 4E7KA 2BIVA 2RK1A 3OMCA 3CCVQ 3LGLA 1ZBXA 2GQVA 1OPLA 4E7IA 4CC2A 4HCCA 1PD1A 1QVGA 2VB6A 3VS1A 3VRZA 5FU7B 2ZGWA 2QAZA 3CCJQ 1I07A 4EMKA 2QEXQ 3PNWC 1M90C 2CSIA 1SRLA 3CCMQ 2GNCA 2NUZA 5GANe 2OTJA 2DTIA 3PVLA 1SPKA 4CC7A 2DO3A 2DERA 2CUBA 4M78E 2JTMA 1BBZA 2O31A 1VQ6A 3ZL7C 2V26A 4PLLA 4M77E 4PJJA 3HPWA 4RG8A 2VXEA 5LJ3f 4EPCA 3GBQA 3CCUQ 3C4SA 1X2QA 1LPLA 4BI3A 3MEVA 1YFNA 1VQKT 1K73U 1OZ3A 1QKXA 1UEBA 1IHWA 4M4ZA 2P0QA 2GTOA 4PJOE 1NM7A 3HFNA 2JOYA 3NFCA 4M7AB 3DLMA 1N9RA 2JJ9A 1KSWA 3E9FA 5GJVB 4XTYA 3ZFJA 1HJDA 2KI7A 4C8QG 2RF0A 4PJOG 1WHHA 5C0MA 1WGSA 1U06A 2L8DA 2L2PA 4KGVB 1WXUA 2KK4A 2DXBA 4PJMA 1Q95G 1QW1A 4RTVA 1D1BA 2GF7A 5LL6S 1OV3A 1YJ9T 1YCSB 3UA6A 5GAMe 2KRSA 4IIMA 1RI0A 1QCFA 3JCMJ 3MO8A 2CUDA 3R6NA 2K5FA 1VQ5A 1BCOA 1YNZA 3OMGA 2P0KA 3SWNC 1Q86C 3UA7A 5CAIA 4DBQA 2HQHA 1VQPA 3I9QA 2RJCA 1PKSA 3M0TA 3CCVT 2OAWA 1G2BA 4C92D 1WFWA 3OW2S 3CCJT 2EYQA 2QEXT 4JZ4A 2D6FA 1TUGB 2M9UA 3CCMT 1B07A 2ZPGB 1X43A 1AVZC 2YHTA 2XDDA 3WXMB 4C92F 4MDXA 1JEGA 4PJNA 2K3YA 2OX7A 2YDLA 1D1AA 2RHYA 1K0SA 4NS5A 2E6NA 3FC3A 2KT1A 1G83A 2X3XD 3EGDB 2OJ2A 2RK2A 2YUNA 4E7ZA 3I56A 4M7DA 1SSHA 1G3YA 1Y7XA 2RQTA 5GAN6 3CCUT 4DBHA 2K2VA 2RHIA 1AT1B 4JJBA 1Y96A 1IRXA 3ULRB 4KULA 2GCXA 2RJEA 4HCKA 3KXTA 3INZA 2EWNA 2QQRA 1B3QA 4IUVA 2LNVA 2MMPA 2XK0A 4JLIA 4XQ3A 2OAUA 1AZEA 4KGZB 2K5IA 2EFIA 4HXJA 5GMKm 1QQJA 3OYJA 1M1KR 3CMEQ 1M90U 1MV0B 1RAAB 3HL8A 3CPWA 3JB9H 2CP7A 1S72Q 4OMNA 1ABQA 1OULA 2LT4A 2VVKA 3LX7A 1QWFA 2DVEA 3EFRA 4J6WA 1E6HA 1EX4A 1YJNA 3EGXB 4Y91A 4PJLA 2HKNA 3EHQA 3RDVA 2EQMA 1UFFA 1WJSA 1ACMB 1YIJQ 4R0KA 3V7RA 4F7UB 2ZPFB 3UDCA 5KE3A 1TUDA 2V8KA 3JCMV 4ELYC 1ZX6A 2DL4A 3V8LA 3G4SQ 4LN2A 5LJ5h 3EG9B 1JJ2P 2J06A 3C0CA 1B34A 4EMGA 3L2UA 3VU3C 2FZKB 2H8HA 1M5Q1 2VXFA 2O2OA 4XU1A 2A28A 1SHFA 5GANd 4X1VA 2AKKA 4D6WA 3OYNA 3FB9A 4AFUC 1BCMA 1M27C 2M1HA 2K3BA 2RI3A 3OYGA 4XK8E 5EC7A 1QCNA 3CBPA 1UJ0A 3EG1A 1ARKA 2LQ8A 1DJ7B 3KBGA 4MZTA 2X35A 2WSEE 1WDXA 1Q86U 4M75C 2D1XA 3M0SA 2LX9A 1NEGA 3C12A 4LDUA 1M90R 5LJ3j 2QDLA 2EAYA 1MMDA 2J6FA 4JS5A 4IKFA 4M78C 1HXDA 4M77C 2EBPA 1MHNA 4DEXA 4RMOA 4QW2A 2DMOA 2HD0A 3CMET 2P84A 3L2VA 3UF4A 1MMGA 3BDLA 2MF2A 1S72T 1VQOQ 1V76A 3EGUA 1ZA1B 3AT1B 2PUOB 1FMVA 1HK9A 4BY6B 2KYMA 5FRMA 3SD4A 5GAMd 2C0OA 4E7SA 3CC7Q 4AFZC 4E6RA 1M3AA 4C92E 3S3NA 3QWXX 5KCHA 1YIJT 2CREA 1VUBA 2FYKA 4C0DC 4OB1B 2AHJB 2EVRA 1WA7A 3JCMg 3QYGB 2J6KA 2AIRB 3MEUA 4HVUA 4C92G 2DNUA 3G4ST 1OX8A 4QVZA 4PKCC 2YXYA 3ASKA 4LDXA 1P92A 3TQ7P 4IUQA 2JN0A 3VS7A 1M8MA 2J05A 2HSPA 2DL8A 2JW4A 1YHQQ 1VQLQ 4M7DD 2FPEA 4FM4B 1S1NA 4N0AA 1JO8A 1Y0MA 3CMAA 5IHNA 3FJ5A 4QQGA 1VQKA 2ZCFB 5J3BA 2LVMA 2KAFA 2K3XA 4EMHA 4RTWA 4MDWA 2F2WA 2KGTA 3OSSC 3LGFA 4QQDA 4F17A 2F2XA 2LRQA 2QQAA 1SRMA 4OB2B 4HVWA 2E10A 4NL3A 2IVWA 3V7CA 2R58A 4PFZA 2HBWA 3A8GB 2HMAA 5KYWB 2X4XA 3VS3A 2L3PA 4MMKA 4BACA 3EGDA 1ZQ1A 3VS2A 1YJ9A 1KC8U 1NEBA 4YTLA 1C0MA 4X9DA 2A37A 1VQNQ 4DEYA 1QP3A 1X2KA 1D0XA 4A4FA 1LNXA 3OYHA 3OSVA 3M0RA 2NUTB 1KHCA 3QPHA 5AYFA 4HT9A 4C0ZA 4CC4B 2DBKA 1YP5A 1R0BG 1K76A 2A36A 4M75F 1VQOT 1B7TA 3MP6A 3I5RA 1WYXA 4XTXA 1MMAA 5GAN4 3CCJA 2D0QB 1VYVA 1ZSZB 2QEXA 2O88A 2QGGA 5IHIA 1TS9A 3OW2P 1FXXA 5LJ3e 3CC7T 3CCMA 3QDFA 5A2QE 4AMCA 1JXMA 2RHZA 5GAOq 4GLKA 4QQ6A 4DQ2A 3BY7A 1HYOA 4LDYA 1VA7A 3V7SA 3OA6A 3E19A 3EGXA 3CPFA 3MP1A 1AWXA 5AT1B 5GAOn 1NE8A 4FT4A 3NPFA 2RN8A 3LH0A 4ORZA 4WF2A 3CCUA 3UPUA 1YHQT 1D3BB 1VQLT 1K8AC 4F7UA 2DFUA 3M57A 2MWOA 1TG0A 3TCJA 3A1PA 2V8JA 1NJIC 1OX9A 1D1CA 1TH7A 3CCEQ 2CP5A 2E6ZA 2RM4A 1H3ZA 4R55A 3EG9A 4K11A 3GNGA 1KHIA 2QDYB 3NMZC 3JB9G 1Q7YR 2L0AA 3MEWA 1W70A 4PFPA 1IZ6A 2BE7D 1NBEB 2EPDA 3FRNA 3VS0A 3S3OA 1KQ1A 3DKMA 1H641 1SG5A 1GCQC 1SSFA 1I81A 3NGPA 1RL2A 2A3LA 2FG0A 1Q81R 2RPNA 2X3WD 4VUBA 4KH1B 3V8JA 2GGRA 2IG0A 1VQNT 3HTRA 2DA9A 4M7AD 1M1KC 1D0YA 4UC4A 4E7LA 3M0PA 1Z9ZA 3OY9A 1JJ2S 2YUPA 2YRDA 1HD3A 1UB4A 2EQJA 2HL3A 3HP9A 3JAME 4ZN3A 2LC4A 4M7AF 1SEMA 1M2VB 2YUOA 5GAN5 3RERA 2K5LA 4XTWA 2ZPBB 2PVOB 1IB8A 3L2RA 2JS0A 1CKBA 4HCZA 2MAMA 1WQ7A 2X4JA 4O5VA 4KGXB 2VV5A 1KIKA 4OP0A 2AZVA 4JRKA 1I0CA 2M51A 1M8VA 3M0QA 2VKNA 1BI0A 3OB9A 4E7JA 3SFMA 3TEEA 1FX7A 3T9NA 2KXDA 1SKUB 3QG1A 4AT1B 2EYXA 5D6WA 3CQTA 5D6YA 3M58A 3UATA 3PVQA 1KK7A 1IGQA 3CCET 5CO7A 4HCBA 2KEAA 4AFQC 2NLUA 1ZUYA 1RLPC 2KQWA 3KFVA 3KUFA 2JT4A 4Z88A 2LJ1A 3P8BB 2BTTA 2QI2A 5CKDA 1KD1R 2QTVA 1VIFA 1PSEA 2WACA 3VKIA 2JS2A 4IUTA 5M9OA 3JCMb 1WHMA 4HT8A 5FRNA 3CMEA 4J9GA 3JCMh 1NG2A 5KYXB 2XI9A 2F5KA 1S72A 4M75E 3P8HA 3PIPA 1YJWQ 3I55A 3H0HA 3X25B 1M3CA 1WJQA 4J9FA 2LQWA 2DL5A 5FWCA 2YRVA 4OMMA 5GAOm 2C0IA 1QMCA 4C8QB 4PJOB 5GAN8 4V2SA 1QWEA 2DJQA 4M75G 5KYWA 2EQUA 4Z89A 2IIMA 1YIJA 2ZPEB 3X20B 4BDZA 4XU0A 4TVRA 3OYAA 4M78G 4JPBW 2L5QA 3LYIA 2HSEB 1C6VX 4OMQA 4JJNK 3QSUA 4M77G 2HEQA 4OB3B 3A8MB 3G4SA 1WJRA 3L2ZA 1VQ4A 1AHJB 2NUTA 1G5VA 1UGVA 1JQQA 3X28B 4RTZA 3M56A 4IUPA 5LJ3d 2QGFB 2K4YA 1ZSGA 6AT1B 1K9MR 1VQ9Q 5I22A 2DD4A 2ROTA 2YUQA 2XICA 2CZ0B 4J9BA 5I21A 5FLXE 1RAIB 1WIEA 1ZSZA 5CK9A 3A5ZB 5HCKA 2E70A 3PFSA 2Y4XA 4ANJA 2BE9B 3PTAA 3WVEB 4EMKC 5KYYB 4BUGA 1M1GA 2KNBB 1BK2A 4QT7A 4JUVA 2RI5A 1U1TA 4JDSA 2A08A 4C5EA 2LT1A 2EGCA 4JJCA 4ZN1A 1M1KU 2CKKA 3CCQA 3AHUA 5CKHA 2CP6A 2MPXC 3VRYA 4PFOA 3H6ZA 2DX1A 3JCMf 2E5QA 2FHDA 1D3BA 2QK0A 2AZSA 3I5SA 4ZGJB 5I11A 5LJ5e 2Z0WA 5IAYA 3LLRA 5FU6B 7AT1B 2EGAA 3GNFB 3DLLA 4M7AE 1BI3A 1EFNA 2LDMA 2RH2A 3QWYA 5A0LA 2DRMA 4F16A 1YJWT 1VQOA 3HHTB 4E7HA 2RHXA 4M7AG 2L89A 2QTXA 3PT9A 1K8AR 5CQYA 2NUPB 3CC7A 4IUUA 1BIBA 3RESA 1ZUKA 3NTIA 1RI9A 1NJIR 4RTUA 1TTHB 1JJ2A 1WX6A 2LP5A 1Z9QA 1K0XA 2QA4Q 3WVDB 1R77A 2BKDN 5GAOp 5IHKA 5CR2A 2BZYA 3L2QA 1AWOA 2L3SA 2VASA 1BIAA 4KRTA 1ZA2B 1YHQA 4N4IA 1VQLA 3DB3A 1M2VA 2V1QA 3DB4A 4ZNXA 1VQ9T 3EFSA 3L42A 2QASA 3RNJA 3VS6A 3N5BB 3PE0A 1GFCA 2VWFA 1OYXA 1X69A 2PTKA 2HDAA 2CP2A 3REBB 3F70A 3UT1A 2K79A 1GBQA 3VS4A 3BW1A 3PMTA 1PM3A 2DD5A 9ATCB 2KR3A 4F04B 4LDVA 2K7AA 4C5HA 3R6OA 2MYSA 3RBBB 1WHKA 3S6WA 5J26A 1I5OB 3P8DA 3H8ZA 1Q7YC 5CQXA 2O4XB 4MZPA 5IT9E 2RHUA 1D09B 1VQNA 1RABB 1CSKA 2RI2A 2LTOA 3IQLA 3G71Q 2X4WA 1G8XA 1LJOA 4PK4A 4M7DC 4BD3A 2KXCA 3GOXA 1WHLA 1Q81C 4LD9K 2HBPA 1VOMA 4X9CA 3QHSA 1UGPB 4FT2A 4J5YA 3OBYA 1RAGB 3S3MA 2XD0A 2DAQA 4OF1A 4J7IA 5KH6A 2M16A 2SRCA 2JXBA 1Y07A 1N6AA 3G7ZA 5KYXA 3LWHA 2QA4T 2DL3A 3MHXA 3JRZA 4MMLA 2FO0A 4PNOA 3MJXA 4C8QA 3PMIA 4PJOA 2KROA 4J9HA 3TREA 1SF9A 4Y92A 4WTOB 4O6JA 2PU9B 3QJ6A 3HFOA 2J6OA 3EG3A 3OYFA 3EG2A 3VYGA 2GBQA 4C92B 2RQWA 1W2BS 1VQ8A 3CD6Q 1M9SA 1VQ5Q 2QXFA 3JB9I 2M0YA 2PUKB 3RMSA 1OEBA 1I8FA 2MI6A 4C0FA 4J83A 5FWBA 1XTDA 1MGQA 1UGRB 1Q82C 5GAMf 2CZ6B 1NLPC 1KD1C 4FL6A 1U8RA 4GY5A 5FU7C 5GAOl 1WNLA 5KYYA 4J6YA 4F14A 3G71T 2GTJA 5KCOA 2EYYA 3EG0A 5LJ5d 4LUDA 1ZUUA 3CC4Q 3OW2A 2LCSA 2A7YA 1PSFA 4BB7A 1RAHB 1AZGB 1TXQA 1U1SA 2FZCB 3BE3A 4A54A 1XQHA 4ELZC 3JSCA 4R56A 4JRIA 4LXCA 4M7DF 2FL7A 2G3RA 3CCSQ 5A0DA 2EJGA 3REAB 5CKBA 1RAFB 2EGEA 3EFOB 2DEUA 2O9SA 2DZCA 3A8OB 2CH4W 4M7AC 1BI2A 2B86A 1K1ZA 1UJYA 2NUPA 3HRUA 3LW5E 2DRKA 2F2VA 1Q7YU 2ROLA 2ED1A 1K9MC 1F1BB 2KMTA 4AG1C 3QUIA 2R5AA 4AG2C 1QVGS 2O9VA 1JU5C 2Y90A 3SWNB 1GRIA 4N4GA 1NYGA 3SDZA 4DOVA 4RG2A 1M2OA 1QVFS 3CD6T 3J7AF 5HK3A 1G3SA 1VQ5T 1Q81U 2BZXA 4RTTA 2LQKA 4IIOA 3VYHB 3H0IA 3CCVA 5DM7R 4A4EA 1PG5B 1QKWA 1KQ2A 4IURA 4C0GA 2XKOC 1MUZA 3ZBDA 5GAN3 1LCKA 3QDRB 2G6FX 3QZ9B 2EKOA 4N0AC 1KJWA 1X75C 1V29B 3H9NA 1R8OB 1YJWA 1U3OA 3MCAB 2FPDA 2QQSA 1PC0A 2K6DA 3PGGA 1UHCA 1N27A 5CIUA 1TWBA 3G6EQ 1EIFA 2P4RA 3NTHA 1WHGA 3RUXA 2O4XA 3CC4T 1UTIA 3OS2A 1E6GA 1M30A 4WCIA 4B6MA 3FJPA 3CEYA 1O75A 2F1LA 1AEYA 5D6XA 1XJWB 2SEMA 2H3JA 1IO6A 2F69A 3MKDA 4C8QD 4PJOD 1X6BA 4HA8A 3QO3A 3OS0A 1I5LA 5GANg 3CCST 3FIFA 1VQ9A 2CS7A 2ZAEA 1RADB 4C8QF 4QVDA 2DTOA 2E65A 5GMKl 2VGNA 4CI0C 3M55A 3OYKA 1TSFA 2DKGA 2P4TA 1K73C 3RMQA 1T0JA 3JCMe 1KD1U 2RMOA 1GBRA 4KBMB 3MEAA 5C6SA 1I4K1 3HSBA 3QXEB 1ZHIA 2Y4YA 3CXCP 3BDUA 2YSQA 4LUEA 4J8OA 3M54A 3JCMc 2FRYA 2XDPA 1UHFA 2J7IA 2CH4A 4FW1A 4C92A 1IHVA 2LX7A 4FSXA 2EYZA 1WZOA 1A0NB 4FYYB 1WQWA 4A4KA 1CKAA 5GAMg 2P0PA 3VUZA 4RKUE 4ZGEB 3HKSA 1VYTA 4A63B 1M1FA 2K9GA 2YLBA 3G6ET 2BUDA 2QQBA 3CMAQ 3CC2Q 4M7DE 4JZ3A 1N8RC 2CT4A 5GAMj 2DIQA 3LWIA 1KQSP 1GCPA 1K9MU 3M59A 3GP8A 2QA4A 1W4SA 4M7DG 2CSQA 1W1FA 4ZTJA 4J9CA 1NPRA 3J80E 2KY9A 3HRTA 4M75B 3META 5I2MA 1NZ9A 1UGQB 4N4HA 3GIBA 3CPWS 2FRWA 1RLQC 1Q82R 2M02A 3TVTA 2GFAA 2JM9A 4M78B 2ECZA 1TUCA 2HNIA 5J39A 2HKQB 4M77B 3JV3A 1VQ7Q 1FWZA 4A4HA 1QLYA 1W2BP 1NLOC 4PLIA 1PWTA 2QQ9A 3CCLQ 2DE0X 2FEIA 1WLPB 2PQWA 4BI8B 1X27A 2RD1A 2OTLQ 4KUDK 2KT8A 2EYWA 3X24B 2HZYA 2I2LA 2QG9B 4Y28E 3EFOA 5L23A 2GQIA 4XAXB 1OPKA 1MV3A 3URGA 2L3RA 1JXOA 2LQNA 1QVFA 4BY6C 4C0DB 1RACB 3CCRQ 1UG1A 4OMFB 3G71A 2VC8A 1KFZA 3ER0A 2DPPB 2PNIA 2DLPA 1G3TA 4JRQA 1K8AU 2NWMA 1GXIE 2D9TA 2ESWA 3SWNA 5HK0A 2BZ8A 1NJIU 2DBMA 1OU8A 2XMFA 4BI4A 2DYIA 1IXDA 2E4HA 2DXTA 4A4GA 1YI2Q 3RR6A 3D7SB 3EH1A 3CMAT 3CC2T 4KUIA 4DBRA 5I2SA 1LOJA 4F7UF 4DA4A 4C8QE 1V1CA 2D8JA 4E47A 5ECAA 1LVKA 3QBYA 2M0OA 1T3SA 3QIIA 4CRIA 1BB9A 1FMWA 2FZGB 2XIDA 2R57A 1NYFA 2NYSA 3OQ5A 4KH0B 1M3BA 3GF5A 3QYHB 1YITQ 2E64A 5HKCA 4BE0A 1QVGP 5GAN2 4JLGA 1VQ7T 3CD6A 1QVFP 2X4YA 5DLQE 5A0GA 3CCLT 1GFDA 2KVQG 3JCMd 2DEQA 2OTLT 2MWPA 1QP2A 1PHTA 5GMKi 3JCMP 1IGUA 4FYVB 3M4GA 2VUBA 3G1JA 4XU3A 5L8RE 3H41A 1UUEA 2VYTA 1IREB 1N8RU 4J9DA 1AD5A 2ED0A 4BE1A 1ZSZC 2K57A 1AOJA 1JRIA 3M53A 3JB9J 3CCRT 1NPPA 1R0CB 1AWWA 2E41A 2I0NA 4OGEA 3VUBA 2LNHB 2XU8A 8AT1B 3RKXA 2O01E 3THKA 5GANh 2QYZA 3O5ZA 3RKWA 2XDBA 3CC4A 2DIGA 1K73R 4OMOA 1VIEA 2WSCE 1X6OA 2MIOA 2JZ2A 1YI2T 4J7FA 4E2FB 2R5MA 3M5AA 2ATCB 2B8AA 1WHJA 5GAN7 3A8LB 4FYXB 3VV0A 3CCSA 3TSZA 4FU6A 2KRNA 1VQMQ 4NL2A 2YWWA 2LCLA 3C94A 2ZZDA 3SEMA 2CDTA 4JRPA 1OZ2A 3SHWA 3CXCS 2H3EB 1T3LA 4EIKA 4JS4A 1PKTA 2C06A 5DY9A 2D0NA 5KE2A 2EJFA 1X01A 2E3IA 3X26B 2E12A 4QKUA 5GMKj 1W6XA 1AWJA 1O9SA 1YITT 3I55Q 4OVAA 2PVDB 1XOVA 4OMPA 4LDWA 2OTJQ 3GPLA 2W10A 3JCMQ 4ESRA 5GAMh 4M75A 4OMLA 2XHCA 1VQ6Q 2KDSA 4B9WA 4XTZA 2FVUA 1N8RR 3J81E 1KC8C 3JCMX 3QKJA 3FEOA 4MZMA 3OYEA 4FCYA 3OYBA 4M78A 1G3WA 1X6GA 4M77A 5GANf 2WSFE 2DL7A 3E9GA 2RO0A 4J9EA 4ATOA 3A8HB 1KQSS 2A0FB 4CC3A 1VQ4Q 1YCYA 1ZLMA 2LJ0A 1PNJA 5FROA 4BE2A 3TSWA 1UE9A 2VGMA 2ZPHB 1UECA 1YWOA 4FW2A 3RKYA 3G6EA 3CBMA 3QZ5B 4HKEA 4F7UE 3M4YA 3OBWA 4XTUA 4FSSA 1N5ZA 3ZEHA 3EHRA 2X9HA 3JB9D 3L1AA 2MOXA 3OS1A 2DTHA 3M0UA 3OS5A 3NHNA 1EZZB 2AK5A 2HQEA 3E1SA 3FLGA 4F7UG 3CCEA 5LJ3g 3JB9F 1FYNA 2C0TA 4GBQA 3CCQQ 1VQMT 1YN8A 4II1A 4L5GA 3CPWP 3OYDA 2F5TX 2KYBA 2RQRA 5GJWB 2YT6A 1VQPQ 1JBMA 1VYUA 1WXTA 2KRMA 4GLMA 4D8DA 1WXBA 1ABOA 2JTEA 2PVGB 1UDLA 3MP8A 4LD6A 4OGCA 1OU9A 4B9XA 2KSSA 1OQKA 1J3TA 2E5KA 3A98A 5CKFA 3I55T 4M7AA 2JTFA 3GLXA 2X51A 4FIBA 2OTJT 3OYIA 5GAOr 2LJ3A 4ME7A 5CKEA 2CT3A 2EKHA 3O8VA 3PIOA 5LJ5f 1VQ6T 2COWA 4C8QC 4PJOC 5KYUB 4HVVA 1PCXA 3I56Q 2FB7A 4ZTFA 3OYMA 1BYMA 2JM8A 2V8IA 4RUGA 3FDRA 2MK5A 1K9AA 5GMKe 2XG8D 2OI3A 4XU2A 2AT1B 1FMKA 1U5SA 2DXCA 2JMAA 3Q1JA 1PRMC 1MNEA 2RB6A 1VQ4T 3SB2A 3OYLA 4EDUA 1Y71A 2YLCA 3M9QA 1YBYA 4BDYA 2AKLA 3NTKA 2KBTA 3CC2A 2PZ1A 3VJPA 4EMKB 5IXBA 1BI1A 3CBOA 4RCBA 2DVJA 5EG2A 2DXUA 2D8HA 2RJFA 4AFSC 1Q86R 1YWPA 3U23A 2E3HA 4Z8AA 3EAEA 3MPUB 2CP0A 1MMNA 4L59A 2LZ6B 2HCKA 2JMCA 1YJNQ 3CCQT 1UGSB 1VQPT 5CVIA 2RQUA 5HY6A 1VQ7A 2HL5C 4J6XA 2K2MA 3CCLA 1QCOA 5KYNA 3CXCA 4M75D 3HRSA 3H0FA 1OI1A 3UWNA 3BFMA 2OTLA 4RTYA 5FU6C 4X34A 2RNAA 1N9SA 4M78D 5IXFA 2LCCA 1GCQA 1H92A 2DZ9A 4M77D 2ENMA 3L2WA 1XNIA 2CZ7B 1BU1A 3V8KA 2DYBA 3C95A 4M78F 4DOWA 1T0HA 3CCRA 5D7UA 2ABLA 4M77F 3I56T 4DBFA 2JUFA 4NOYA 4RTXA 4XTVA 1D0ZA 2W0ZA 1KG1A 1TOVA 4ZGDB 3QJYA 5GMKh 3OYCA 5CCAA 2EQKA 4QVCA 1YI2A 1KQSA 2LMJA 4PJOF 4RCCA 3JCMW 1H8KA
chains in the Genus database with same CATH topology
1X69A 2PTKA 3QWXX 1KFZA 2HDAA 2CREA 3REBB 2PNIA 1HSQA 2DLPA 2NWMA 2EVRA 1WA7A 2J6KA 1GBQA 2K79A 4HVUA 2ESWA 3VS4A 2KR3A 2BZ8A 2RQVA 2DBMA 2DNUA 2KE9A 2XMFA 1PRLC 2EW3A 2K7AA 3VS7A 3RBBB 1M8MA 1RUWA 2J05A 2HSPA 2DL8A 2MCNA 2JW4A 5FW9A 2FPEA 3LH5A 1S1NA 1JO8A 2V1RA 1Y0MA 4LNPA 5IHNA 3FJ5A 1CSKA 2DF6A 3IQLA 4RTWA 1GL5A 2F2WA 2KGTA 4F17A 2F2XA 1V1CA 2D8JA 2KXCA 4J9IA 1SRMA 4HVWA 5ECAA 1T3SA 2HBWA 1BB9A 3VS3A 2L3PA 5IH2A 3VS2A 1NYFA 2DM1A 1M3BA 1NEBA 1Y57A 2A37A 4DEYA 4LE9A 1I1JA 1X2KA 2SRCA 2JXBA 1WI7A 3M0RA 2DL3A 2L3QA 1GFDA 2FPFA 3I35A 4CC4B 2DBKA 1YP5A 2FO0A 1K76A 1ZBJA 1PHTA 2A36A 2KROA 4J9HA 2EQIA 3VS5A 2DILA 1OOTA 3I5RA 4Y92A 1E7OA 1WYXA 3H41A 1VYVA 1UUEA 2O88A 5IHIA 2J6OA 3EG3A 3EG2A 4J9DA 1AD5A 2GBQA 1SHGA 2ED0A 4D8KA 2RQWA 1AOJA 1JXMA 1AWWA 2I0NA 4JJDA 1H3HA 1K4US 2LNHB 2M0YA 3THKA 1OEBA 1VA7A 3O5ZA 1OPLA 5FWBA 4CC2A 1AWXA 4OMOA 3VS1A 3VRZA 3NPFA 2RN8A 4ORZA 2MIOA 1I07A 1NLPC 2CSIA 1TG0A 1SRLA 2GNCA 2NUZA 4F14A 4K11A 3TSZA 2GTJA 2KRNA 3PVLA 1SPKA 3NMZC 4CC7A 2EYYA 3SEMA 2CUBA 2CDTA 2L0AA 1BBZA 2O31A 3EG0A 3ZL7C 1W70A 4LUDA 1ZUUA 2EPDA 3SHWA 3VS0A 2LCSA 1T3LA 4EIKA 1PKTA 1GCQC 2D0NA 3GBQA 3NGPA 1X2QA 1AZGB 2FG0A 1W6XA 2RPNA 2X3WD 1AWJA 2GGRA 1QKXA 2DA9A 1XOVA 4OMPA 2W10A 4M4ZA 2GTOA 1NM7A 4ESRA 3M0PA 3REAB 4OMLA 1Z9ZA 2EGEA 2YUPA 1HD3A 2O9SA 1SEMA 2CH4W 1KSWA 5GJVB 1HJDA 2YUOA 2B86A 2RF0A 1K1ZA 1UJYA 1X6GA 2DRKA 1U06A 2F2VA 2ROLA 2ED1A 2L2PA 1WXUA 4AG1C 2DL7A 2JS0A 1CKBA 4RTVA 4AG2C 1OV3A 4J9EA 1YCSB 2O9VA 1JU5C 3UA6A 2KRSA 4IIMA 1QCFA 4CC3A 2LJ0A 1GRIA 1ZLMA 1PNJA 1NYGA 2CUDA 3R6NA 1KIKA 3TSWA 1UE9A 1YNZA 2AZVA 1YWOA 1UECA 2BZXA 1I0CA 4RTTA 3UA7A 2M51A 4IIOA 3H0IA 3I9QA 3M0QA 1PKSA 2VKNA 3M0TA 1QKWA 4FSSA 1N5ZA 1MUZA 2OAWA 1LCKA 3EHRA 2G6FX 2KXDA 1G2BA 1WFWA 1KJWA 2MOXA 4JZ4A 3M0UA 3NHNA 2AK5A 2EYXA 3CQTA 1U3OA 3UATA 2FPDA 1B07A 3PVQA 1X43A 1AVZC 2K6DA 2KEAA 1JEGA 4AFQC 1FYNA 2C0TA 1UHCA 1ZUYA 4GBQA 2YDLA 1RLPC 1YN8A 3KFVA 2JT4A 4Z88A 2LJ1A 2BTTA 2KYBA 2RQRA 2YT6A 2P4RA 5GJWB 1K0SA 2KT1A 1G83A 2X3XD 1VYUA 1WXTA 1UTIA 2KRMA 1E6GA 1M30A 2OJ2A 2YUNA 4GLMA 4WCIA 4D8DA 2JS2A 1WXBA 1ABOA 1SSHA 2JTEA 1UDLA 2RQTA 4J9GA 1AEYA 1NG2A 4JJBA 2SEMA 1IO6A 3H0HA 3ULRB 1J3TA 1M3CA 2E5KA 4J9FA 2LQWA 2DL5A 3A98A 5FWCA 1X6BA 4OMMA 2C0IA 4HCKA 2LJ3A 2CT3A 1QWEA 2DJQA 2EKHA 1B3QA 4Z89A 2IIMA 4HVVA 1T0JA 1AZEA 2JM8A 4RUGA 4JPBW 4HXJA 4OMQA 2HEQA 2RMOA 1GBRA 1MV0B 1K9AA 2OI3A 4OMNA 1ABQA 1FMKA 2VVKA 1U5SA 2JMAA 1UGVA 1PRMC 1QWFA 1JQQA 4RTZA 1E6HA 1ZSGA 2AKLA 5I22A 2ROTA 2YSQA 2YUQA 4LUEA 3EHQA 2KBTA 4J9BA 2PZ1A 1UFFA 1WIEA 2FRYA 4R0KA 5IXBA 5HCKA 1UHFA 2J7IA 2CH4A 2DVJA 1TUDA 2LX7A 2D8HA 1ZX6A 2DL4A 2EYZA 4AFSC 4LN2A 1YWPA 3U23A 2KNBB 1A0NB 1BK2A 2J06A 4QT7A 3C0CA 4Z8AA 2A08A 2EGCA 1CKAA 4JJCA 2LZ6B 2H8HA 2HCKA 2JMCA 1VYTA 4A63B 2O2OA 3VRYA 2A28A 1SHFA 2K9GA 2AKKA 4X1VA 2DX1A 4AFUC 2RQUA 4JZ3A 1M27C 2CT4A 2AZSA 2K2MA 3I5SA 2K3BA 5I11A 1GCPA 2EGAA 2CSQA 5EC7A 1W1FA 4J9CA 3H0FA 1UJ0A 1EFNA 3EG1A 4RTYA 1ARKA 3QWYA 2DRMA 4F16A 2RNAA 5IXFA 1GCQA 1H92A 2FRWA 1RLQC 1WDXA 2D1XA 2ENMA 3M0SA 3TVTA 1BU1A 2JM9A 1NEGA 2ECZA 1TUCA 2DYBA 1ZUKA 2QDLA 1RI9A 1T0HA 3JV3A 4RTUA 2J6FA 1WX6A 1QLYA 1Z9QA 2ABLA 1NLOC 2LP5A 1K0XA 1PWTA 2EBPA 2DE0X 2FEIA 1WLPB 4DEXA 1X27A 4RTXA 2DMOA 2W0ZA 3UF4A 2KT8A 2EYWA 5IHKA 2BZYA 1AWOA 2L3SA 3EGUA 4KRTA 5L23A 2GQIA 2KYMA 1OPKA 1MV3A 2V1QA 2C0OA 2LMJA 1JXOA 2LQNA 4ZNXA 4AFZC 4E6RA 1M3AA 3RNJA 3VS6A 3PE0A 1GFCA 2VWFA 1UG1A 1H8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X69 A;  2PTK A;  3QWX X;  1KFZ A;  2HDA A;  2CRE A;  3REB B;  2PNI A;  1HSQ A;  2DLP A;  2NWM A;  2EVR A;  1WA7 A;  2J6K A;  1GBQ A;  2K79 A;  4HVU A;  2ESW A;  3VS4 A;  2KR3 A;  2BZ8 A;  2RQV A;  2DBM A;  2DNU A;  2KE9 A;  2XMF A;  1PRL C;  2EW3 A;  2K7A A;  3VS7 A;  3RBB B;  1M8M A;  1RUW A;  2J05 A;  2HSP A;  2DL8 A;  2MCN A;  2JW4 A;  5FW9 A;  2FPE A;  3LH5 A;  1S1N A;  1JO8 A;  2V1R A;  1Y0M A;  4LNP A;  5IHN A;  3FJ5 A;  1CSK A;  2DF6 A;  3IQL A;  4RTW A;  1GL5 A;  2F2W A;  2KGT A;  4F17 A;  2F2X A;  1V1C A;  2D8J A;  2KXC A;  4J9I A;  1SRM A;  4HVW A;  5ECA A;  1T3S A;  2HBW A;  1BB9 A;  3VS3 A;  2L3P A;  5IH2 A;  3VS2 A;  1NYF A;  2DM1 A;  1M3B A;  1NEB A;  1Y57 A;  2A37 A;  4DEY A;  4LE9 A;  1I1J A;  1X2K A;  2SRC A;  2JXB A;  1WI7 A;  3M0R A;  2DL3 A;  2L3Q A;  1GFD A;  2FPF A;  3I35 A;  4CC4 B;  2DBK A;  1YP5 A;  2FO0 A;  1K76 A;  1ZBJ A;  1PHT A;  2A36 A;  2KRO A;  4J9H A;  2EQI A;  3VS5 A;  2DIL A;  1OOT A;  3I5R A;  4Y92 A;  1E7O A;  1WYX A;  3H41 A;  1VYV A;  1UUE A;  2O88 A;  5IHI A;  2J6O A;  3EG3 A;  3EG2 A;  4J9D A;  1AD5 A;  2GBQ A;  1SHG A;  2ED0 A;  4D8K A;  2RQW A;  1AOJ A;  1JXM A;  1AWW A;  2I0N A;  4JJD A;  1H3H A;  1K4U S;  2LNH B;  2M0Y A;  3THK A;  1OEB A;  1VA7 A;  3O5Z A;  1OPL A;  5FWB A;  4CC2 A;  1AWX A;  4OMO A;  3VS1 A;  3VRZ A;  3NPF A;  2RN8 A;  4ORZ A;  2MIO A;  1I07 A;  1NLP C;  2CSI A;  1TG0 A;  1SRL A;  2GNC A;  2NUZ A;  4F14 A;  4K11 A;  3TSZ A;  2GTJ A;  2KRN A;  3PVL A;  1SPK A;  3NMZ C;  4CC7 A;  2EYY A;  3SEM A;  2CUB A;  2CDT A;  2L0A A;  1BBZ A;  2O31 A;  3EG0 A;  3ZL7 C;  1W70 A;  4LUD A;  1ZUU A;  2EPD A;  3SHW A;  3VS0 A;  2LCS A;  1T3L A;  4EIK A;  1PKT A;  1GCQ C;  2D0N A;  3GBQ A;  3NGP A;  1X2Q A;  1AZG B;  2FG0 A;  1W6X A;  2RPN A;  2X3W D;  1AWJ A;  2GGR A;  1QKX A;  2DA9 A;  1XOV A;  4OMP A;  2W10 A;  4M4Z A;  2GTO A;  1NM7 A;  4ESR A;  3M0P A;  3REA B;  4OML A;  1Z9Z A;  2EGE A;  2YUP A;  1HD3 A;  2O9S A;  1SEM A;  2CH4 W;  1KSW A;  5GJV B;  1HJD A;  2YUO A;  2B86 A;  2RF0 A;  1K1Z A;  1UJY A;  1X6G A;  2DRK A;  1U06 A;  2F2V A;  2ROL A;  2ED1 A;  2L2P A;  1WXU A;  4AG1 C;  2DL7 A;  2JS0 A;  1CKB A;  4RTV A;  4AG2 C;  1OV3 A;  4J9E A;  1YCS B;  2O9V A;  1JU5 C;  3UA6 A;  2KRS A;  4IIM A;  1QCF A;  4CC3 A;  2LJ0 A;  1GRI A;  1ZLM A;  1PNJ A;  1NYG A;  2CUD A;  3R6N A;  1KIK A;  3TSW A;  1UE9 A;  1YNZ A;  2AZV A;  1YWO A;  1UEC A;  2BZX A;  1I0C A;  4RTT A;  3UA7 A;  2M51 A;  4IIO A;  3H0I A;  3I9Q A;  3M0Q A;  1PKS A;  2VKN A;  3M0T A;  1QKW A;  4FSS A;  1N5Z A;  1MUZ A;  2OAW A;  1LCK A;  3EHR A;  2G6F X;  2KXD A;  1G2B A;  1WFW A;  1KJW A;  2MOX A;  4JZ4 A;  3M0U A;  3NHN A;  2AK5 A;  2EYX A;  3CQT A;  1U3O A;  3UAT A;  2FPD A;  1B07 A;  3PVQ A;  1X43 A;  1AVZ C;  2K6D A;  2KEA A;  1JEG A;  4AFQ C;  1FYN A;  2C0T A;  1UHC A;  1ZUY A;  4GBQ A;  2YDL A;  1RLP C;  1YN8 A;  3KFV A;  2JT4 A;  4Z88 A;  2LJ1 A;  2BTT A;  2KYB A;  2RQR A;  2YT6 A;  2P4R A;  5GJW B;  1K0S A;  2KT1 A;  1G83 A;  2X3X D;  1VYU A;  1WXT A;  1UTI A;  2KRM A;  1E6G A;  1M30 A;  2OJ2 A;  2YUN A;  4GLM A;  4WCI A;  4D8D A;  2JS2 A;  1WXB A;  1ABO A;  1SSH A;  2JTE A;  1UDL A;  2RQT A;  4J9G A;  1AEY A;  1NG2 A;  4JJB A;  2SEM A;  1IO6 A;  3H0H A;  3ULR B;  1J3T A;  1M3C A;  2E5K A;  4J9F A;  2LQW A;  2DL5 A;  3A98 A;  5FWC A;  1X6B A;  4OMM A;  2C0I A;  4HCK A;  2LJ3 A;  2CT3 A;  1QWE A;  2DJQ A;  2EKH A;  1B3Q A;  4Z89 A;  2IIM A;  4HVV A;  1T0J A;  1AZE A;  2JM8 A;  4RUG A;  4JPB W;  4HXJ A;  4OMQ A;  2HEQ A;  2RMO A;  1GBR A;  1MV0 B;  1K9A A;  2OI3 A;  4OMN A;  1ABQ A;  1FMK A;  2VVK A;  1U5S A;  2JMA A;  1UGV A;  1PRM C;  1QWF A;  1JQQ A;  4RTZ A;  1E6H A;  1ZSG A;  2AKL A;  5I22 A;  2ROT A;  2YSQ A;  2YUQ A;  4LUE A;  3EHQ A;  2KBT A;  4J9B A;  2PZ1 A;  1UFF A;  1WIE A;  2FRY A;  4R0K A;  5IXB A;  5HCK A;  1UHF A;  2J7I A;  2CH4 A;  2DVJ A;  1TUD A;  2LX7 A;  2D8H A;  1ZX6 A;  2DL4 A;  2EYZ A;  4AFS C;  4LN2 A;  1YWP A;  3U23 A;  2KNB B;  1A0N B;  1BK2 A;  2J06 A;  4QT7 A;  3C0C A;  4Z8A A;  2A08 A;  2EGC A;  1CKA A;  4JJC A;  2LZ6 B;  2H8H A;  2HCK A;  2JMC A;  1VYT A;  4A63 B;  2O2O A;  3VRY A;  2A28 A;  1SHF A;  2K9G A;  2AKK A;  4X1V A;  2DX1 A;  4AFU C;  2RQU A;  4JZ3 A;  1M27 C;  2CT4 A;  2AZS A;  2K2M A;  3I5S A;  2K3B A;  5I11 A;  1GCP A;  2EGA A;  2CSQ A;  5EC7 A;  1W1F A;  4J9C A;  3H0F A;  1UJ0 A;  1EFN A;  3EG1 A;  4RTY A;  1ARK A;  3QWY A;  2DRM A;  4F16 A;  2RNA A;  5IXF A;  1GCQ A;  1H92 A;  2FRW A;  1RLQ C;  1WDX A;  2D1X A;  2ENM A;  3M0S A;  3TVT A;  1BU1 A;  2JM9 A;  1NEG A;  2ECZ A;  1TUC A;  2DYB A;  1ZUK A;  2QDL A;  1RI9 A;  1T0H A;  3JV3 A;  4RTU A;  2J6F A;  1WX6 A;  1QLY A;  1Z9Q A;  2ABL A;  1NLO C;  2LP5 A;  1K0X A;  1PWT A;  2EBP A;  2DE0 X;  2FEI A;  1WLP B;  4DEX A;  1X27 A;  4RTX A;  2DMO A;  2W0Z A;  3UF4 A;  2KT8 A;  2EYW A;  5IHK A;  2BZY A;  1AWO A;  2L3S A;  3EGU A;  4KRT A;  5L23 A;  2GQI A;  2KYM A;  1OPK A;  1MV3 A;  2V1Q A;  2C0O A;  2LMJ A;  1JXO A;  2LQN A;  4ZNX A;  4AFZ C;  4E6R A;  1M3A A;  3RNJ A;  3VS6 A;  3PE0 A;  1GFC A;  2VWF A;  1UG1 A;  1H8K A; 
#chains in the Genus database with same CATH topology
 3OYY A;  5GAN j;  1VQ8 Q;  1Q82 U;  3RIR A;  1HSQ A;  4C5I A;  1C1A A;  4Z02 A;  4OB0 B;  2RQV A;  2KE9 A;  2COZ A;  1PRL C;  2CP3 A;  2EW3 A;  2CYZ B;  1KC8 R;  2IPO B;  1RUW A;  2MCN A;  1W2B A;  2DET A;  5FW9 A;  2COY A;  3LH5 A;  1YJN T;  2V1R A;  2DJZ A;  4LNP A;  2DK3 A;  1YIT A;  4M7D B;  8ATC B;  2DF6 A;  4C5G A;  1PD0 A;  4KT0 E;  1GL5 A;  1Y96 B;  1JB0 E;  2EJ9 A;  4P5N A;  4J9I A;  2JVV A;  1TU0 B;  1WPY A;  2HAX A;  3E2U A;  5IH2 A;  1M4Z A;  2GFU A;  3EH2 A;  2DM1 A;  1BKB A;  1Y57 A;  1VQK Q;  1RAE B;  4LE9 A;  1I1J A;  1WI7 A;  5LJ3 h;  2CGH A;  2ZPI B;  5LJ5 g;  2L3Q A;  4A53 A;  2FPF A;  5DLO A;  3I35 A;  4FYW B;  2E1H A;  1ZBJ A;  2CZ1 B;  4PL6 A;  2EQI A;  3VS5 A;  1MND A;  2DIL A;  1OOT A;  2RJD A;  2YRC A;  1E7O A;  5LJ5 j;  2EIF A;  5KYU A;  4L6V 5;  1YJ9 Q;  1SHG A;  4D8K A;  2JNG A;  4JJD A;  1VQ8 T;  1H3H A;  1VQM A;  1K4U S;  1QVP A;  4C92 C;  1B34 B;  2HQX A;  3ME9 A;  5IN1 A;  2RA2 A;  4Q5W A;  3TU4 K;  4E7K A;  2BIV A;  2RK1 A;  3OMC A;  3CCV Q;  3LGL A;  1ZBX A;  2GQV A;  1OPL A;  4E7I A;  4CC2 A;  4HCC A;  1PD1 A;  1QVG A;  2VB6 A;  3VS1 A;  3VRZ A;  5FU7 B;  2ZGW A;  2QAZ A;  3CCJ Q;  1I07 A;  4EMK A;  2QEX Q;  3PNW C;  1M90 C;  2CSI A;  1SRL A;  3CCM Q;  2GNC A;  2NUZ A;  5GAN e;  2OTJ A;  2DTI A;  3PVL A;  1SPK A;  4CC7 A;  2DO3 A;  2DER A;  2CUB A;  4M78 E;  2JTM A;  1BBZ A;  2O31 A;  1VQ6 A;  3ZL7 C;  2V26 A;  4PLL A;  4M77 E;  4PJJ A;  3HPW A;  4RG8 A;  2VXE A;  5LJ3 f;  4EPC A;  3GBQ A;  3CCU Q;  3C4S A;  1X2Q A;  1LPL A;  4BI3 A;  3MEV A;  1YFN A;  1VQK T;  1K73 U;  1OZ3 A;  1QKX A;  1UEB A;  1IHW A;  4M4Z A;  2P0Q A;  2GTO A;  4PJO E;  1NM7 A;  3HFN A;  2JOY A;  3NFC A;  4M7A B;  3DLM A;  1N9R A;  2JJ9 A;  1KSW A;  3E9F A;  5GJV B;  4XTY A;  3ZFJ A;  1HJD A;  2KI7 A;  4C8Q G;  2RF0 A;  4PJO G;  1WHH A;  5C0M A;  1WGS A;  1U06 A;  2L8D A;  2L2P A;  4KGV B;  1WXU A;  2KK4 A;  2DXB A;  4PJM A;  1Q95 G;  1QW1 A;  4RTV A;  1D1B A;  2GF7 A;  5LL6 S;  1OV3 A;  1YJ9 T;  1YCS B;  3UA6 A;  5GAM e;  2KRS A;  4IIM A;  1RI0 A;  1QCF A;  3JCM J;  3MO8 A;  2CUD A;  3R6N A;  2K5F A;  1VQ5 A;  1BCO A;  1YNZ A;  3OMG A;  2P0K A;  3SWN C;  1Q86 C;  3UA7 A;  5CAI A;  4DBQ A;  2HQH A;  1VQP A;  3I9Q A;  2RJC A;  1PKS A;  3M0T A;  3CCV T;  2OAW A;  1G2B A;  4C92 D;  1WFW A;  3OW2 S;  3CCJ T;  2EYQ A;  2QEX T;  4JZ4 A;  2D6F A;  1TUG B;  2M9U A;  3CCM T;  1B07 A;  2ZPG B;  1X43 A;  1AVZ C;  2YHT A;  2XDD A;  3WXM B;  4C92 F;  4MDX A;  1JEG A;  4PJN A;  2K3Y A;  2OX7 A;  2YDL A;  1D1A A;  2RHY A;  1K0S A;  4NS5 A;  2E6N A;  3FC3 A;  2KT1 A;  1G83 A;  2X3X D;  3EGD B;  2OJ2 A;  2RK2 A;  2YUN A;  4E7Z A;  3I56 A;  4M7D A;  1SSH A;  1G3Y A;  1Y7X A;  2RQT A;  5GAN 6;  3CCU T;  4DBH A;  2K2V A;  2RHI A;  1AT1 B;  4JJB A;  1Y96 A;  1IRX A;  3ULR B;  4KUL A;  2GCX A;  2RJE A;  4HCK A;  3KXT A;  3INZ A;  2EWN A;  2QQR A;  1B3Q A;  4IUV A;  2LNV A;  2MMP A;  2XK0 A;  4JLI A;  4XQ3 A;  2OAU A;  1AZE A;  4KGZ B;  2K5I A;  2EFI A;  4HXJ A;  5GMK m;  1QQJ A;  3OYJ A;  1M1K R;  3CME Q;  1M90 U;  1MV0 B;  1RAA B;  3HL8 A;  3CPW A;  3JB9 H;  2CP7 A;  1S72 Q;  4OMN A;  1ABQ A;  1OUL A;  2LT4 A;  2VVK A;  3LX7 A;  1QWF A;  2DVE A;  3EFR A;  4J6W A;  1E6H A;  1EX4 A;  1YJN A;  3EGX B;  4Y91 A;  4PJL A;  2HKN A;  3EHQ A;  3RDV A;  2EQM A;  1UFF A;  1WJS A;  1ACM B;  1YIJ Q;  4R0K A;  3V7R A;  4F7U B;  2ZPF B;  3UDC A;  5KE3 A;  1TUD A;  2V8K A;  3JCM V;  4ELY C;  1ZX6 A;  2DL4 A;  3V8L A;  3G4S Q;  4LN2 A;  5LJ5 h;  3EG9 B;  1JJ2 P;  2J06 A;  3C0C A;  1B34 A;  4EMG A;  3L2U A;  3VU3 C;  2FZK B;  2H8H A;  1M5Q 1;  2VXF A;  2O2O A;  4XU1 A;  2A28 A;  1SHF A;  5GAN d;  4X1V A;  2AKK A;  4D6W A;  3OYN A;  3FB9 A;  4AFU C;  1BCM A;  1M27 C;  2M1H A;  2K3B A;  2RI3 A;  3OYG A;  4XK8 E;  5EC7 A;  1QCN A;  3CBP A;  1UJ0 A;  3EG1 A;  1ARK A;  2LQ8 A;  1DJ7 B;  3KBG A;  4MZT A;  2X35 A;  2WSE E;  1WDX A;  1Q86 U;  4M75 C;  2D1X A;  3M0S A;  2LX9 A;  1NEG A;  3C12 A;  4LDU A;  1M90 R;  5LJ3 j;  2QDL A;  2EAY A;  1MMD A;  2J6F A;  4JS5 A;  4IKF A;  4M78 C;  1HXD A;  4M77 C;  2EBP A;  1MHN A;  4DEX A;  4RMO A;  4QW2 A;  2DMO A;  2HD0 A;  3CME T;  2P84 A;  3L2V A;  3UF4 A;  1MMG A;  3BDL A;  2MF2 A;  1S72 T;  1VQO Q;  1V76 A;  3EGU A;  1ZA1 B;  3AT1 B;  2PUO B;  1FMV A;  1HK9 A;  4BY6 B;  2KYM A;  5FRM A;  3SD4 A;  5GAM d;  2C0O A;  4E7S A;  3CC7 Q;  4AFZ C;  4E6R A;  1M3A A;  4C92 E;  3S3N A;  3QWX X;  5KCH A;  1YIJ T;  2CRE A;  1VUB A;  2FYK A;  4C0D C;  4OB1 B;  2AHJ B;  2EVR A;  1WA7 A;  3JCM g;  3QYG B;  2J6K A;  2AIR B;  3MEU A;  4HVU A;  4C92 G;  2DNU A;  3G4S T;  1OX8 A;  4QVZ A;  4PKC C;  2YXY A;  3ASK A;  4LDX A;  1P92 A;  3TQ7 P;  4IUQ A;  2JN0 A;  3VS7 A;  1M8M A;  2J05 A;  2HSP A;  2DL8 A;  2JW4 A;  1YHQ Q;  1VQL Q;  4M7D D;  2FPE A;  4FM4 B;  1S1N A;  4N0A A;  1JO8 A;  1Y0M A;  3CMA A;  5IHN A;  3FJ5 A;  4QQG A;  1VQK A;  2ZCF B;  5J3B A;  2LVM A;  2KAF A;  2K3X A;  4EMH A;  4RTW A;  4MDW A;  2F2W A;  2KGT A;  3OSS C;  3LGF A;  4QQD A;  4F17 A;  2F2X A;  2LRQ A;  2QQA A;  1SRM A;  4OB2 B;  4HVW A;  2E10 A;  4NL3 A;  2IVW A;  3V7C A;  2R58 A;  4PFZ A;  2HBW A;  3A8G B;  2HMA A;  5KYW B;  2X4X A;  3VS3 A;  2L3P A;  4MMK A;  4BAC A;  3EGD A;  1ZQ1 A;  3VS2 A;  1YJ9 A;  1KC8 U;  1NEB A;  4YTL A;  1C0M A;  4X9D A;  2A37 A;  1VQN Q;  4DEY A;  1QP3 A;  1X2K A;  1D0X A;  4A4F A;  1LNX A;  3OYH A;  3OSV A;  3M0R A;  2NUT B;  1KHC A;  3QPH A;  5AYF A;  4HT9 A;  4C0Z A;  4CC4 B;  2DBK A;  1YP5 A;  1R0B G;  1K76 A;  2A36 A;  4M75 F;  1VQO T;  1B7T A;  3MP6 A;  3I5R A;  1WYX A;  4XTX A;  1MMA A;  5GAN 4;  3CCJ A;  2D0Q B;  1VYV A;  1ZSZ B;  2QEX A;  2O88 A;  2QGG A;  5IHI A;  1TS9 A;  3OW2 P;  1FXX A;  5LJ3 e;  3CC7 T;  3CCM A;  3QDF A;  5A2Q E;  4AMC A;  1JXM A;  2RHZ A;  5GAO q;  4GLK A;  4QQ6 A;  4DQ2 A;  3BY7 A;  1HYO A;  4LDY A;  1VA7 A;  3V7S A;  3OA6 A;  3E19 A;  3EGX A;  3CPF A;  3MP1 A;  1AWX A;  5AT1 B;  5GAO n;  1NE8 A;  4FT4 A;  3NPF A;  2RN8 A;  3LH0 A;  4ORZ A;  4WF2 A;  3CCU A;  3UPU A;  1YHQ T;  1D3B B;  1VQL T;  1K8A C;  4F7U A;  2DFU A;  3M57 A;  2MWO A;  1TG0 A;  3TCJ A;  3A1P A;  2V8J A;  1NJI C;  1OX9 A;  1D1C A;  1TH7 A;  3CCE Q;  2CP5 A;  2E6Z A;  2RM4 A;  1H3Z A;  4R55 A;  3EG9 A;  4K11 A;  3GNG A;  1KHI A;  2QDY B;  3NMZ C;  3JB9 G;  1Q7Y R;  2L0A A;  3MEW A;  1W70 A;  4PFP A;  1IZ6 A;  2BE7 D;  1NBE B;  2EPD A;  3FRN A;  3VS0 A;  3S3O A;  1KQ1 A;  3DKM A;  1H64 1;  1SG5 A;  1GCQ C;  1SSF A;  1I81 A;  3NGP A;  1RL2 A;  2A3L A;  2FG0 A;  1Q81 R;  2RPN A;  2X3W D;  4VUB A;  4KH1 B;  3V8J A;  2GGR A;  2IG0 A;  1VQN T;  3HTR A;  2DA9 A;  4M7A D;  1M1K C;  1D0Y A;  4UC4 A;  4E7L A;  3M0P A;  1Z9Z A;  3OY9 A;  1JJ2 S;  2YUP A;  2YRD A;  1HD3 A;  1UB4 A;  2EQJ A;  2HL3 A;  3HP9 A;  3JAM E;  4ZN3 A;  2LC4 A;  4M7A F;  1SEM A;  1M2V B;  2YUO A;  5GAN 5;  3RER A;  2K5L A;  4XTW A;  2ZPB B;  2PVO B;  1IB8 A;  3L2R A;  2JS0 A;  1CKB A;  4HCZ A;  2MAM A;  1WQ7 A;  2X4J A;  4O5V A;  4KGX B;  2VV5 A;  1KIK A;  4OP0 A;  2AZV A;  4JRK A;  1I0C A;  2M51 A;  1M8V A;  3M0Q A;  2VKN A;  1BI0 A;  3OB9 A;  4E7J A;  3SFM A;  3TEE A;  1FX7 A;  3T9N A;  2KXD A;  1SKU B;  3QG1 A;  4AT1 B;  2EYX A;  5D6W A;  3CQT A;  5D6Y A;  3M58 A;  3UAT A;  3PVQ A;  1KK7 A;  1IGQ A;  3CCE T;  5CO7 A;  4HCB A;  2KEA A;  4AFQ C;  2NLU A;  1ZUY A;  1RLP C;  2KQW A;  3KFV A;  3KUF A;  2JT4 A;  4Z88 A;  2LJ1 A;  3P8B B;  2BTT A;  2QI2 A;  5CKD A;  1KD1 R;  2QTV A;  1VIF A;  1PSE A;  2WAC A;  3VKI A;  2JS2 A;  4IUT A;  5M9O A;  3JCM b;  1WHM A;  4HT8 A;  5FRN A;  3CME A;  4J9G A;  3JCM h;  1NG2 A;  5KYX B;  2XI9 A;  2F5K A;  1S72 A;  4M75 E;  3P8H A;  3PIP A;  1YJW Q;  3I55 A;  3H0H A;  3X25 B;  1M3C A;  1WJQ A;  4J9F A;  2LQW A;  2DL5 A;  5FWC A;  2YRV A;  4OMM A;  5GAO m;  2C0I A;  1QMC A;  4C8Q B;  4PJO B;  5GAN 8;  4V2S A;  1QWE A;  2DJQ A;  4M75 G;  5KYW A;  2EQU A;  4Z89 A;  2IIM A;  1YIJ A;  2ZPE B;  3X20 B;  4BDZ A;  4XU0 A;  4TVR A;  3OYA A;  4M78 G;  4JPB W;  2L5Q A;  3LYI A;  2HSE B;  1C6V X;  4OMQ A;  4JJN K;  3QSU A;  4M77 G;  2HEQ A;  4OB3 B;  3A8M B;  3G4S A;  1WJR A;  3L2Z A;  1VQ4 A;  1AHJ B;  2NUT A;  1G5V A;  1UGV A;  1JQQ A;  3X28 B;  4RTZ A;  3M56 A;  4IUP A;  5LJ3 d;  2QGF B;  2K4Y A;  1ZSG A;  6AT1 B;  1K9M R;  1VQ9 Q;  5I22 A;  2DD4 A;  2ROT A;  2YUQ A;  2XIC A;  2CZ0 B;  4J9B A;  5I21 A;  5FLX E;  1RAI B;  1WIE A;  1ZSZ A;  5CK9 A;  3A5Z B;  5HCK A;  2E70 A;  3PFS A;  2Y4X A;  4ANJ A;  2BE9 B;  3PTA A;  3WVE B;  4EMK C;  5KYY B;  4BUG A;  1M1G A;  2KNB B;  1BK2 A;  4QT7 A;  4JUV A;  2RI5 A;  1U1T A;  4JDS A;  2A08 A;  4C5E A;  2LT1 A;  2EGC A;  4JJC A;  4ZN1 A;  1M1K U;  2CKK A;  3CCQ A;  3AHU A;  5CKH A;  2CP6 A;  2MPX C;  3VRY A;  4PFO A;  3H6Z A;  2DX1 A;  3JCM f;  2E5Q A;  2FHD A;  1D3B A;  2QK0 A;  2AZS A;  3I5S A;  4ZGJ B;  5I11 A;  5LJ5 e;  2Z0W A;  5IAY A;  3LLR A;  5FU6 B;  7AT1 B;  2EGA A;  3GNF B;  3DLL A;  4M7A E;  1BI3 A;  1EFN A;  2LDM A;  2RH2 A;  3QWY A;  5A0L A;  2DRM A;  4F16 A;  1YJW T;  1VQO A;  3HHT B;  4E7H A;  2RHX A;  4M7A G;  2L89 A;  2QTX A;  3PT9 A;  1K8A R;  5CQY A;  2NUP B;  3CC7 A;  4IUU A;  1BIB A;  3RES A;  1ZUK A;  3NTI A;  1RI9 A;  1NJI R;  4RTU A;  1TTH B;  1JJ2 A;  1WX6 A;  2LP5 A;  1Z9Q A;  1K0X A;  2QA4 Q;  3WVD B;  1R77 A;  2BKD N;  5GAO p;  5IHK A;  5CR2 A;  2BZY A;  3L2Q A;  1AWO A;  2L3S A;  2VAS A;  1BIA A;  4KRT A;  1ZA2 B;  1YHQ A;  4N4I A;  1VQL A;  3DB3 A;  1M2V A;  2V1Q A;  3DB4 A;  4ZNX A;  1VQ9 T;  3EFS A;  3L42 A;  2QAS A;  3RNJ A;  3VS6 A;  3N5B B;  3PE0 A;  1GFC A;  2VWF A;  1OYX A;  1X69 A;  2PTK A;  2HDA A;  2CP2 A;  3REB B;  3F70 A;  3UT1 A;  2K79 A;  1GBQ A;  3VS4 A;  3BW1 A;  3PMT A;  1PM3 A;  2DD5 A;  9ATC B;  2KR3 A;  4F04 B;  4LDV A;  2K7A A;  4C5H A;  3R6O A;  2MYS A;  3RBB B;  1WHK A;  3S6W A;  5J26 A;  1I5O B;  3P8D A;  3H8Z A;  1Q7Y C;  5CQX A;  2O4X B;  4MZP A;  5IT9 E;  2RHU A;  1D09 B;  1VQN A;  1RAB B;  1CSK A;  2RI2 A;  2LTO A;  3IQL A;  3G71 Q;  2X4W A;  1G8X A;  1LJO A;  4PK4 A;  4M7D C;  4BD3 A;  2KXC A;  3GOX A;  1WHL A;  1Q81 C;  4LD9 K;  2HBP A;  1VOM A;  4X9C A;  3QHS A;  1UGP B;  4FT2 A;  4J5Y A;  3OBY A;  1RAG B;  3S3M A;  2XD0 A;  2DAQ A;  4OF1 A;  4J7I A;  5KH6 A;  2M16 A;  2SRC A;  2JXB A;  1Y07 A;  1N6A A;  3G7Z A;  5KYX A;  3LWH A;  2QA4 T;  2DL3 A;  3MHX A;  3JRZ A;  4MML A;  2FO0 A;  4PNO A;  3MJX A;  4C8Q A;  3PMI A;  4PJO A;  2KRO A;  4J9H A;  3TRE A;  1SF9 A;  4Y92 A;  4WTO B;  4O6J A;  2PU9 B;  3QJ6 A;  3HFO A;  2J6O A;  3EG3 A;  3OYF A;  3EG2 A;  3VYG A;  2GBQ A;  4C92 B;  2RQW A;  1W2B S;  1VQ8 A;  3CD6 Q;  1M9S A;  1VQ5 Q;  2QXF A;  3JB9 I;  2M0Y A;  2PUK B;  3RMS A;  1OEB A;  1I8F A;  2MI6 A;  4C0F A;  4J83 A;  5FWB A;  1XTD A;  1MGQ A;  1UGR B;  1Q82 C;  5GAM f;  2CZ6 B;  1NLP C;  1KD1 C;  4FL6 A;  1U8R A;  4GY5 A;  5FU7 C;  5GAO l;  1WNL A;  5KYY A;  4J6Y A;  4F14 A;  3G71 T;  2GTJ A;  5KCO A;  2EYY A;  3EG0 A;  5LJ5 d;  4LUD A;  1ZUU A;  3CC4 Q;  3OW2 A;  2LCS A;  2A7Y A;  1PSF A;  4BB7 A;  1RAH B;  1AZG B;  1TXQ A;  1U1S A;  2FZC B;  3BE3 A;  4A54 A;  1XQH A;  4ELZ C;  3JSC A;  4R56 A;  4JRI A;  4LXC A;  4M7D F;  2FL7 A;  2G3R A;  3CCS Q;  5A0D A;  2EJG A;  3REA B;  5CKB A;  1RAF B;  2EGE A;  3EFO B;  2DEU A;  2O9S A;  2DZC A;  3A8O B;  2CH4 W;  4M7A C;  1BI2 A;  2B86 A;  1K1Z A;  1UJY A;  2NUP A;  3HRU A;  3LW5 E;  2DRK A;  2F2V A;  1Q7Y U;  2ROL A;  2ED1 A;  1K9M C;  1F1B B;  2KMT A;  4AG1 C;  3QUI A;  2R5A A;  4AG2 C;  1QVG S;  2O9V A;  1JU5 C;  2Y90 A;  3SWN B;  1GRI A;  4N4G A;  1NYG A;  3SDZ A;  4DOV A;  4RG2 A;  1M2O A;  1QVF S;  3CD6 T;  3J7A F;  5HK3 A;  1G3S A;  1VQ5 T;  1Q81 U;  2BZX A;  4RTT A;  2LQK A;  4IIO A;  3VYH B;  3H0I A;  3CCV A;  5DM7 R;  4A4E A;  1PG5 B;  1QKW A;  1KQ2 A;  4IUR A;  4C0G A;  2XKO C;  1MUZ A;  3ZBD A;  5GAN 3;  1LCK A;  3QDR B;  2G6F X;  3QZ9 B;  2EKO A;  4N0A C;  1KJW A;  1X75 C;  1V29 B;  3H9N A;  1R8O B;  1YJW A;  1U3O A;  3MCA B;  2FPD A;  2QQS A;  1PC0 A;  2K6D A;  3PGG A;  1UHC A;  1N27 A;  5CIU A;  1TWB A;  3G6E Q;  1EIF A;  2P4R A;  3NTH A;  1WHG A;  3RUX A;  2O4X A;  3CC4 T;  1UTI A;  3OS2 A;  1E6G A;  1M30 A;  4WCI A;  4B6M A;  3FJP A;  3CEY A;  1O75 A;  2F1L A;  1AEY A;  5D6X A;  1XJW B;  2SEM A;  2H3J A;  1IO6 A;  2F69 A;  3MKD A;  4C8Q D;  4PJO D;  1X6B A;  4HA8 A;  3QO3 A;  3OS0 A;  1I5L A;  5GAN g;  3CCS T;  3FIF A;  1VQ9 A;  2CS7 A;  2ZAE A;  1RAD B;  4C8Q F;  4QVD A;  2DTO A;  2E65 A;  5GMK l;  2VGN A;  4CI0 C;  3M55 A;  3OYK A;  1TSF A;  2DKG A;  2P4T A;  1K73 C;  3RMQ A;  1T0J A;  3JCM e;  1KD1 U;  2RMO A;  1GBR A;  4KBM B;  3MEA A;  5C6S A;  1I4K 1;  3HSB A;  3QXE B;  1ZHI A;  2Y4Y A;  3CXC P;  3BDU A;  2YSQ A;  4LUE A;  4J8O A;  3M54 A;  3JCM c;  2FRY A;  2XDP A;  1UHF A;  2J7I A;  2CH4 A;  4FW1 A;  4C92 A;  1IHV A;  2LX7 A;  4FSX A;  2EYZ A;  1WZO A;  1A0N B;  4FYY B;  1WQW A;  4A4K A;  1CKA A;  5GAM g;  2P0P A;  3VUZ A;  4RKU E;  4ZGE B;  3HKS A;  1VYT A;  4A63 B;  1M1F A;  2K9G A;  2YLB A;  3G6E T;  2BUD A;  2QQB A;  3CMA Q;  3CC2 Q;  4M7D E;  4JZ3 A;  1N8R C;  2CT4 A;  5GAM j;  2DIQ A;  3LWI A;  1KQS P;  1GCP A;  1K9M U;  3M59 A;  3GP8 A;  2QA4 A;  1W4S A;  4M7D G;  2CSQ A;  1W1F A;  4ZTJ A;  4J9C A;  1NPR A;  3J80 E;  2KY9 A;  3HRT A;  4M75 B;  3MET A;  5I2M A;  1NZ9 A;  1UGQ B;  4N4H A;  3GIB A;  3CPW S;  2FRW A;  1RLQ C;  1Q82 R;  2M02 A;  3TVT A;  2GFA A;  2JM9 A;  4M78 B;  2ECZ A;  1TUC A;  2HNI A;  5J39 A;  2HKQ B;  4M77 B;  3JV3 A;  1VQ7 Q;  1FWZ A;  4A4H A;  1QLY A;  1W2B P;  1NLO C;  4PLI A;  1PWT A;  2QQ9 A;  3CCL Q;  2DE0 X;  2FEI A;  1WLP B;  2PQW A;  4BI8 B;  1X27 A;  2RD1 A;  2OTL Q;  4KUD K;  2KT8 A;  2EYW A;  3X24 B;  2HZY A;  2I2L A;  2QG9 B;  4Y28 E;  3EFO A;  5L23 A;  2GQI A;  4XAX B;  1OPK A;  1MV3 A;  3URG A;  2L3R A;  1JXO A;  2LQN A;  1QVF A;  4BY6 C;  4C0D B;  1RAC B;  3CCR Q;  1UG1 A;  4OMF B;  3G71 A;  2VC8 A;  1KFZ A;  3ER0 A;  2DPP B;  2PNI A;  2DLP A;  1G3T A;  4JRQ A;  1K8A U;  2NWM A;  1GXI E;  2D9T A;  2ESW A;  3SWN A;  5HK0 A;  2BZ8 A;  1NJI U;  2DBM A;  1OU8 A;  2XMF A;  4BI4 A;  2DYI A;  1IXD A;  2E4H A;  2DXT A;  4A4G A;  1YI2 Q;  3RR6 A;  3D7S B;  3EH1 A;  3CMA T;  3CC2 T;  4KUI A;  4DBR A;  5I2S A;  1LOJ A;  4F7U F;  4DA4 A;  4C8Q E;  1V1C A;  2D8J A;  4E47 A;  5ECA A;  1LVK A;  3QBY A;  2M0O A;  1T3S A;  3QII A;  4CRI A;  1BB9 A;  1FMW A;  2FZG B;  2XID A;  2R57 A;  1NYF A;  2NYS A;  3OQ5 A;  4KH0 B;  1M3B A;  3GF5 A;  3QYH B;  1YIT Q;  2E64 A;  5HKC A;  4BE0 A;  1QVG P;  5GAN 2;  4JLG A;  1VQ7 T;  3CD6 A;  1QVF P;  2X4Y A;  5DLQ E;  5A0G A;  3CCL T;  1GFD A;  2KVQ G;  3JCM d;  2DEQ A;  2OTL T;  2MWP A;  1QP2 A;  1PHT A;  5GMK i;  3JCM P;  1IGU A;  4FYV B;  3M4G A;  2VUB A;  3G1J A;  4XU3 A;  5L8R E;  3H41 A;  1UUE A;  2VYT A;  1IRE B;  1N8R U;  4J9D A;  1AD5 A;  2ED0 A;  4BE1 A;  1ZSZ C;  2K57 A;  1AOJ A;  1JRI A;  3M53 A;  3JB9 J;  3CCR T;  1NPP A;  1R0C B;  1AWW A;  2E41 A;  2I0N A;  4OGE A;  3VUB A;  2LNH B;  2XU8 A;  8AT1 B;  3RKX A;  2O01 E;  3THK A;  5GAN h;  2QYZ A;  3O5Z A;  3RKW A;  2XDB A;  3CC4 A;  2DIG A;  1K73 R;  4OMO A;  1VIE A;  2WSC E;  1X6O A;  2MIO A;  2JZ2 A;  1YI2 T;  4J7F A;  4E2F B;  2R5M A;  3M5A A;  2ATC B;  2B8A A;  1WHJ A;  5GAN 7;  3A8L B;  4FYX B;  3VV0 A;  3CCS A;  3TSZ A;  4FU6 A;  2KRN A;  1VQM Q;  4NL2 A;  2YWW A;  2LCL A;  3C94 A;  2ZZD A;  3SEM A;  2CDT A;  4JRP A;  1OZ2 A;  3SHW A;  3CXC S;  2H3E B;  1T3L A;  4EIK A;  4JS4 A;  1PKT A;  2C06 A;  5DY9 A;  2D0N A;  5KE2 A;  2EJF A;  1X01 A;  2E3I A;  3X26 B;  2E12 A;  4QKU A;  5GMK j;  1W6X A;  1AWJ A;  1O9S A;  1YIT T;  3I55 Q;  4OVA A;  2PVD B;  1XOV A;  4OMP A;  4LDW A;  2OTJ Q;  3GPL A;  2W10 A;  3JCM Q;  4ESR A;  5GAM h;  4M75 A;  4OML A;  2XHC A;  1VQ6 Q;  2KDS A;  4B9W A;  4XTZ A;  2FVU A;  1N8R R;  3J81 E;  1KC8 C;  3JCM X;  3QKJ A;  3FEO A;  4MZM A;  3OYE A;  4FCY A;  3OYB A;  4M78 A;  1G3W A;  1X6G A;  4M77 A;  5GAN f;  2WSF E;  2DL7 A;  3E9G A;  2RO0 A;  4J9E A;  4ATO A;  3A8H B;  1KQS S;  2A0F B;  4CC3 A;  1VQ4 Q;  1YCY A;  1ZLM A;  2LJ0 A;  1PNJ A;  5FRO A;  4BE2 A;  3TSW A;  1UE9 A;  2VGM A;  2ZPH B;  1UEC A;  1YWO A;  4FW2 A;  3RKY A;  3G6E A;  3CBM A;  3QZ5 B;  4HKE A;  4F7U E;  3M4Y A;  3OBW A;  4XTU A;  4FSS A;  1N5Z A;  3ZEH A;  3EHR A;  2X9H A;  3JB9 D;  3L1A A;  2MOX A;  3OS1 A;  2DTH A;  3M0U A;  3OS5 A;  3NHN A;  1EZZ B;  2AK5 A;  2HQE A;  3E1S A;  3FLG A;  4F7U G;  3CCE A;  5LJ3 g;  3JB9 F;  1FYN A;  2C0T A;  4GBQ A;  3CCQ Q;  1VQM T;  1YN8 A;  4II1 A;  4L5G A;  3CPW P;  3OYD A;  2F5T X;  2KYB A;  2RQR A;  5GJW B;  2YT6 A;  1VQP Q;  1JBM A;  1VYU A;  1WXT A;  2KRM A;  4GLM A;  4D8D A;  1WXB A;  1ABO A;  2JTE A;  2PVG B;  1UDL A;  3MP8 A;  4LD6 A;  4OGC A;  1OU9 A;  4B9X A;  2KSS A;  1OQK A;  1J3T A;  2E5K A;  3A98 A;  5CKF A;  3I55 T;  4M7A A;  2JTF A;  3GLX A;  2X51 A;  4FIB A;  2OTJ T;  3OYI A;  5GAO r;  2LJ3 A;  4ME7 A;  5CKE A;  2CT3 A;  2EKH A;  3O8V A;  3PIO A;  5LJ5 f;  1VQ6 T;  2COW A;  4C8Q C;  4PJO C;  5KYU B;  4HVV A;  1PCX A;  3I56 Q;  2FB7 A;  4ZTF A;  3OYM A;  1BYM A;  2JM8 A;  2V8I A;  4RUG A;  3FDR A;  2MK5 A;  1K9A A;  5GMK e;  2XG8 D;  2OI3 A;  4XU2 A;  2AT1 B;  1FMK A;  1U5S A;  2DXC A;  2JMA A;  3Q1J A;  1PRM C;  1MNE A;  2RB6 A;  1VQ4 T;  3SB2 A;  3OYL A;  4EDU A;  1Y71 A;  2YLC A;  3M9Q A;  1YBY A;  4BDY A;  2AKL A;  3NTK A;  2KBT A;  3CC2 A;  2PZ1 A;  3VJP A;  4EMK B;  5IXB A;  1BI1 A;  3CBO A;  4RCB A;  2DVJ A;  5EG2 A;  2DXU A;  2D8H A;  2RJF A;  4AFS C;  1Q86 R;  1YWP A;  3U23 A;  2E3H A;  4Z8A A;  3EAE A;  3MPU B;  2CP0 A;  1MMN A;  4L59 A;  2LZ6 B;  2HCK A;  2JMC A;  1YJN Q;  3CCQ T;  1UGS B;  1VQP T;  5CVI A;  2RQU A;  5HY6 A;  1VQ7 A;  2HL5 C;  4J6X A;  2K2M A;  3CCL A;  1QCO A;  5KYN A;  3CXC A;  4M75 D;  3HRS A;  3H0F A;  1OI1 A;  3UWN A;  3BFM A;  2OTL A;  4RTY A;  5FU6 C;  4X34 A;  2RNA A;  1N9S A;  4M78 D;  5IXF A;  2LCC A;  1GCQ A;  1H92 A;  2DZ9 A;  4M77 D;  2ENM A;  3L2W A;  1XNI A;  2CZ7 B;  1BU1 A;  3V8K A;  2DYB A;  3C95 A;  4M78 F;  4DOW A;  1T0H A;  3CCR A;  5D7U A;  2ABL A;  4M77 F;  3I56 T;  4DBF A;  2JUF A;  4NOY A;  4RTX A;  4XTV A;  1D0Z A;  2W0Z A;  1KG1 A;  1TOV A;  4ZGD B;  3QJY A;  5GMK h;  3OYC A;  5CCA A;  2EQK A;  4QVC A;  1YI2 A;  1KQS A;  2LMJ A;  4PJO F;  4RCC A;  3JCM W;  1H8K A; 
#chains in the Genus database with same CATH homology
 1X69 A;  2PTK A;  3QWX X;  1KFZ A;  2HDA A;  2CRE A;  3REB B;  2PNI A;  1HSQ A;  2DLP A;  2NWM A;  2EVR A;  1WA7 A;  2J6K A;  1GBQ A;  2K79 A;  4HVU A;  2ESW A;  3VS4 A;  2KR3 A;  2BZ8 A;  2RQV A;  2DBM A;  2DNU A;  2KE9 A;  2XMF A;  1PRL C;  2EW3 A;  2K7A A;  3VS7 A;  3RBB B;  1M8M A;  1RUW A;  2J05 A;  2HSP A;  2DL8 A;  2MCN A;  2JW4 A;  5FW9 A;  2FPE A;  3LH5 A;  1S1N A;  1JO8 A;  2V1R A;  1Y0M A;  4LNP A;  5IHN A;  3FJ5 A;  1CSK A;  2DF6 A;  3IQL A;  4RTW A;  1GL5 A;  2F2W A;  2KGT A;  4F17 A;  2F2X A;  1V1C A;  2D8J A;  2KXC A;  4J9I A;  1SRM A;  4HVW A;  5ECA A;  1T3S A;  2HBW A;  1BB9 A;  3VS3 A;  2L3P A;  5IH2 A;  3VS2 A;  1NYF A;  2DM1 A;  1M3B A;  1NEB A;  1Y57 A;  2A37 A;  4DEY A;  4LE9 A;  1I1J A;  1X2K A;  2SRC A;  2JXB A;  1WI7 A;  3M0R A;  2DL3 A;  2L3Q A;  1GFD A;  2FPF A;  3I35 A;  4CC4 B;  2DBK A;  1YP5 A;  2FO0 A;  1K76 A;  1ZBJ A;  1PHT A;  2A36 A;  2KRO A;  4J9H A;  2EQI A;  3VS5 A;  2DIL A;  1OOT A;  3I5R A;  4Y92 A;  1E7O A;  1WYX A;  3H41 A;  1VYV A;  1UUE A;  2O88 A;  5IHI A;  2J6O A;  3EG3 A;  3EG2 A;  4J9D A;  1AD5 A;  2GBQ A;  1SHG A;  2ED0 A;  4D8K A;  2RQW A;  1AOJ A;  1JXM A;  1AWW A;  2I0N A;  4JJD A;  1H3H A;  1K4U S;  2LNH B;  2M0Y A;  3THK A;  1OEB A;  1VA7 A;  3O5Z A;  1OPL A;  5FWB A;  4CC2 A;  1AWX A;  4OMO A;  3VS1 A;  3VRZ A;  3NPF A;  2RN8 A;  4ORZ A;  2MIO A;  1I07 A;  1NLP C;  2CSI A;  1TG0 A;  1SRL A;  2GNC A;  2NUZ A;  4F14 A;  4K11 A;  3TSZ A;  2GTJ A;  2KRN A;  3PVL A;  1SPK A;  3NMZ C;  4CC7 A;  2EYY A;  3SEM A;  2CUB A;  2CDT A;  2L0A A;  1BBZ A;  2O31 A;  3EG0 A;  3ZL7 C;  1W70 A;  4LUD A;  1ZUU A;  2EPD A;  3SHW A;  3VS0 A;  2LCS A;  1T3L A;  4EIK A;  1PKT A;  1GCQ C;  2D0N A;  3GBQ A;  3NGP A;  1X2Q A;  1AZG B;  2FG0 A;  1W6X A;  2RPN A;  2X3W D;  1AWJ A;  2GGR A;  1QKX A;  2DA9 A;  1XOV A;  4OMP A;  2W10 A;  4M4Z A;  2GTO A;  1NM7 A;  4ESR A;  3M0P A;  3REA B;  4OML A;  1Z9Z A;  2EGE A;  2YUP A;  1HD3 A;  2O9S A;  1SEM A;  2CH4 W;  1KSW A;  5GJV B;  1HJD A;  2YUO A;  2B86 A;  2RF0 A;  1K1Z A;  1UJY A;  1X6G A;  2DRK A;  1U06 A;  2F2V A;  2ROL A;  2ED1 A;  2L2P A;  1WXU A;  4AG1 C;  2DL7 A;  2JS0 A;  1CKB A;  4RTV A;  4AG2 C;  1OV3 A;  4J9E A;  1YCS B;  2O9V A;  1JU5 C;  3UA6 A;  2KRS A;  4IIM A;  1QCF A;  4CC3 A;  2LJ0 A;  1GRI A;  1ZLM A;  1PNJ A;  1NYG A;  2CUD A;  3R6N A;  1KIK A;  3TSW A;  1UE9 A;  1YNZ A;  2AZV A;  1YWO A;  1UEC A;  2BZX A;  1I0C A;  4RTT A;  3UA7 A;  2M51 A;  4IIO A;  3H0I A;  3I9Q A;  3M0Q A;  1PKS A;  2VKN A;  3M0T A;  1QKW A;  4FSS A;  1N5Z A;  1MUZ A;  2OAW A;  1LCK A;  3EHR A;  2G6F X;  2KXD A;  1G2B A;  1WFW A;  1KJW A;  2MOX A;  4JZ4 A;  3M0U A;  3NHN A;  2AK5 A;  2EYX A;  3CQT A;  1U3O A;  3UAT A;  2FPD A;  1B07 A;  3PVQ A;  1X43 A;  1AVZ C;  2K6D A;  2KEA A;  1JEG A;  4AFQ C;  1FYN A;  2C0T A;  1UHC A;  1ZUY A;  4GBQ A;  2YDL A;  1RLP C;  1YN8 A;  3KFV A;  2JT4 A;  4Z88 A;  2LJ1 A;  2BTT A;  2KYB A;  2RQR A;  2YT6 A;  2P4R A;  5GJW B;  1K0S A;  2KT1 A;  1G83 A;  2X3X D;  1VYU A;  1WXT A;  1UTI A;  2KRM A;  1E6G A;  1M30 A;  2OJ2 A;  2YUN A;  4GLM A;  4WCI A;  4D8D A;  2JS2 A;  1WXB A;  1ABO A;  1SSH A;  2JTE A;  1UDL A;  2RQT A;  4J9G A;  1AEY A;  1NG2 A;  4JJB A;  2SEM A;  1IO6 A;  3H0H A;  3ULR B;  1J3T A;  1M3C A;  2E5K A;  4J9F A;  2LQW A;  2DL5 A;  3A98 A;  5FWC A;  1X6B A;  4OMM A;  2C0I A;  4HCK A;  2LJ3 A;  2CT3 A;  1QWE A;  2DJQ A;  2EKH A;  1B3Q A;  4Z89 A;  2IIM A;  4HVV A;  1T0J A;  1AZE A;  2JM8 A;  4RUG A;  4JPB W;  4HXJ A;  4OMQ A;  2HEQ A;  2RMO A;  1GBR A;  1MV0 B;  1K9A A;  2OI3 A;  4OMN A;  1ABQ A;  1FMK A;  2VVK A;  1U5S A;  2JMA A;  1UGV A;  1PRM C;  1QWF A;  1JQQ A;  4RTZ A;  1E6H A;  1ZSG A;  2AKL A;  5I22 A;  2ROT A;  2YSQ A;  2YUQ A;  4LUE A;  3EHQ A;  2KBT A;  4J9B A;  2PZ1 A;  1UFF A;  1WIE A;  2FRY A;  4R0K A;  5IXB A;  5HCK A;  1UHF A;  2J7I A;  2CH4 A;  2DVJ A;  1TUD A;  2LX7 A;  2D8H A;  1ZX6 A;  2DL4 A;  2EYZ A;  4AFS C;  4LN2 A;  1YWP A;  3U23 A;  2KNB B;  1A0N B;  1BK2 A;  2J06 A;  4QT7 A;  3C0C A;  4Z8A A;  2A08 A;  2EGC A;  1CKA A;  4JJC A;  2LZ6 B;  2H8H A;  2HCK A;  2JMC A;  1VYT A;  4A63 B;  2O2O A;  3VRY A;  2A28 A;  1SHF A;  2K9G A;  2AKK A;  4X1V A;  2DX1 A;  4AFU C;  2RQU A;  4JZ3 A;  1M27 C;  2CT4 A;  2AZS A;  2K2M A;  3I5S A;  2K3B A;  5I11 A;  1GCP A;  2EGA A;  2CSQ A;  5EC7 A;  1W1F A;  4J9C A;  3H0F A;  1UJ0 A;  1EFN A;  3EG1 A;  4RTY A;  1ARK A;  3QWY A;  2DRM A;  4F16 A;  2RNA A;  5IXF A;  1GCQ A;  1H92 A;  2FRW A;  1RLQ C;  1WDX A;  2D1X A;  2ENM A;  3M0S A;  3TVT A;  1BU1 A;  2JM9 A;  1NEG A;  2ECZ A;  1TUC A;  2DYB A;  1ZUK A;  2QDL A;  1RI9 A;  1T0H A;  3JV3 A;  4RTU A;  2J6F A;  1WX6 A;  1QLY A;  1Z9Q A;  2ABL A;  1NLO C;  2LP5 A;  1K0X A;  1PWT A;  2EBP A;  2DE0 X;  2FEI A;  1WLP B;  4DEX A;  1X27 A;  4RTX A;  2DMO A;  2W0Z A;  3UF4 A;  2KT8 A;  2EYW A;  5IHK A;  2BZY A;  1AWO A;  2L3S A;  3EGU A;  4KRT A;  5L23 A;  2GQI A;  2KYM A;  1OPK A;  1MV3 A;  2V1Q A;  2C0O A;  2LMJ A;  1JXO A;  2LQN A;  4ZNX A;  4AFZ C;  4E6R A;  1M3A A;  3RNJ A;  3VS6 A;  3PE0 A;  1GFC A;  2VWF A;  1UG1 A;  1H8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...