1V1CA

Solution structure of the sh3 domain of obscurin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
b'IFDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRLKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBSCURIN
publication title Solution Structure of the SH3 Domain of Obscurin
rcsb
source organism Homo sapiens
molecule tags Sh3-domain
total genus 4
structure length 68
sequence length 68
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1v1cA00
1SSHA 2JTEA 2RQTA 2KRNA 2DL4A 2GQIA 4WCIA 3UA7A 1YNZA 1MV3A 1YCSB 2DL7A 1AZGB 1U5SA 2JXBA 4F14A 1LCKA 2KRSA 1I0CA 1RLPC 4J9FA 2FRYA 1GCPA 3LH5A 3NMZC 4GBQA 3UATA 1CSKA 2F2VA 4J9EA 2PZ1A 3ULRB 3RNJA 2EYYA 2FG0A 3VRZA 3VS1A 4JZ3A 5GJVB 2JM9A 2SEMA 1OEBA 1BBZA 3EHRA 3SEMA 2VWFA 1GFDA 2RQWA 1YWOA 2YUQA 1PRLC 1T0JA 2K7AA 4F17A 3QWYA 2JW4A 2DJQA 1Y0MA 1X2KA 1FYNA 2HSPA 2QDLA 1WXUA 2JS0A 1TG0A 4J9DA 1PKSA 2L3SA 2MCNA 1UDLA 1WA7A 2DL5A 2E5KA 4D8DA 1B3QA 1SHFA 2MOXA 4ESRA 1NLPC 4JPBW 1QKXA 2CUDA 2J6KA 3TVTA 2DBMA 4LNPA 1OOTA 1QWEA 1K4US 4HCKA 2LJ0A 1KFZA 1S1NA 2KEAA 1IO6A 2BZ8A 5ECAA 4E6RA 1NEBA 1HD3A 1CKBA 3M0UA 4RTUA 2JS2A 1UECA 1YN8A 2J6OA 5IH2A 1K1ZA 3UA6A 2RQVA 2PNIA 2ECZA 2OI3A 1JXMA 1NG2A 3PVLA 4CC2A 5L23A 1QCFA 2JT4A 1BK2A 2DL8A 1AWOA 4RTWA 2CT4A 4QT7A 2C0IA 1ARKA 3GBQA 1WI7A 2NUZA 1FMKA 4EIKA 2RNAA 1VYTA 2EW3A 2KNBB 2X3WD 1YWPA 4RTYA 2EYWA 3UF4A 2O2OA 4KRTA 1M3AA 2GBQA 1W6XA 2RMOA 3EG0A 4CC3A 1WFWA 2ROLA 2ED1A 5IXBA 1AEYA 2O9SA 2FRWA 1BB9A 2KYBA 2KT8A 4OMPA 1MUZA 3VRYA 2JMAA 2L3QA 2J05A 2KE9A 4LUEA 3VS7A 2DL3A 1W1FA 2CT3A 1UHCA 1MV0B 1GBRA 1I07A 1UUEA 2NWMA 1G2BA 4AFZC 1RI9A 3M0QA 2J6FA 2VVKA 4OMMA 4RTTA 1E6HA 2LJ1A 4AFSC 4HXJA 2DMOA 2KROA 3C0CA 1ZLMA 2L2PA 2AZSA 4DEYA 1N5ZA 1TUDA 1SPKA 1UJYA 1AZEA 2EGAA 3NGPA 1ZX6A 3EG3A 1GRIA 4J9IA 5IHKA 4X1VA 5GJWB 1KJWA 2RQUA 4D8KA 2BTTA 2KRMA 2V1QA 2KXCA 1X6GA 1PWTA 1Z9ZA 1PKTA 4HVWA 2B86A 3REAB 2A28A 1X2QA 4LUDA 4LN2A 2F2XA 4A63B 3A98A 2M0YA 3EG1A 1VA7A 1UTIA 4DEXA 3VS0A 1GCQC 2D8HA 2KGTA 3H0IA 2ESWA 2D1XA 2W10A 1JU5C 3SHWA 1GFCA 1PHTA 2K79A 3H41A 1X43A 2D0NA 1ABQA 1UHFA 1AWJA 4AG2C 2P4RA 1PRMC 1WIEA 1JO8A 2L3PA 4IIMA 2EYXA 1GCQA 2XMFA 2ENMA 2EQIA 3VS5A 2EPDA 1K76A 2O88A 3CQTA 4JJDA 2K6DA 4HVVA 2YDLA 1NM7A 1ZUYA 4Z8AA 1SRLA 2AZVA 2DA9A 1XOVA 3VS6A 1T3SA 2ABLA 2DF6A 4M4ZA 5IXFA 1HJDA 2YUOA 1UG1A 4Z89A 2OJ2A 2LNHB 4LE9A 4ZNXA 1ABOA 4K11A 3IQLA 2DRKA 2GNCA 1M27C 2LMJA 2IIMA 3NPFA 1UGVA 4OMLA 2X3XD 1ZUKA 2AKLA 5HCKA 1Y57A 1WYXA 2LQNA 2LCSA 4CC7A 2KR3A 2HCKA 4JJCA 2RN8A 3VS2A 1ZUUA 4RTZA 1AWXA 5FWBA 2PTKA 1ZSGA 1M30A 1AD5A 2KT1A 2C0TA 3EHQA 1G83A 2O9VA 3H0HA 4CC4B 3EG2A 4JJBA 1U06A 1VYUA 2DYBA 2K9GA 4J9HA 1KIKA 2MIOA 2EVRA 2GGRA 2A08A 1RUWA 2W0ZA 4RUGA 1X69A 3JV3A 2L0AA 1NYGA 1RLQC 2FEIA 1M8MA 2DNUA 3M0SA 4IIOA 4J9CA 4RTVA 3TSZA 1UFFA 3M0TA 2VKNA 2YUPA 1M3CA 3KFVA 2CDTA 2JM8A 3M0PA 4Z88A 2CH4W 2OAWA 2EGEA 1SRMA 3RBBB 1J3TA 3I5SA 5FWCA 3REBB 1VYVA 4HVUA 1E6GA 2EGCA 1H92A 1WXBA 1K0XA 2I0NA 2K2MA 3NHNA 2M51A 1M3BA 2LQWA 3TSWA 1B07A 2C0OA 2DVJA 2DILA 2FPDA 1JEGA 2LP5A 2O31A 2RQRA 2EYZA 4ORZA 2LJ3A 1WDXA 2A36A 2ED0A 2YT6A 2FO0A 1EFNA 1GL5A 2AKKA 1YP5A 5FW9A 2KBTA 1NYFA 1JXOA 1WXTA 2CSQA 2AK5A 2CH4A 3M0RA 3PE0A 1I1JA 3O5ZA 2DX1A 2BZYA 1H8KA 2LX7A 1NLOC 2GTJA 2HBWA 4AFQC 2YSQA 2BZXA 1OV3A 3EGUA 1NEGA 2J7IA 1V1CA 2RF0A 2V1RA 2DM1A 4R0KA 4J9BA 2DBKA 1H3HA 1PNJA 3VS3A 2RPNA 2DRMA 1WLPB 2FPFA 3I5RA 4Y92A 4RTXA 1SHGA 1KSWA 2A37A 1CKAA 2EBPA 1JQQA 3VS4A 4FSSA 2F2WA 4AG1C 4F16A 1U3OA 3I35A 1WX6A 4JZ4A 2EKHA 4AFUC 1QKWA 1Z9QA 5EC7A 2SRCA 1T3LA 2JMCA 3U23A 1K0SA 5IHIA 2G6FX 2ROTA 1X6BA 1A0NB 1E7OA 2LZ6B 5IHNA 2DLPA 5I22A 2DE0X 1OPLA 2H8HA 3QWXX 2CSIA 2YUNA 1AOJA 4OMQA 1SEMA 3R6NA 1QLYA 3H0FA 4J9GA 1QWFA 4OMOA 1UJ0A 2HEQA 3PVQA 3THKA 2K3BA 2GTOA 1TUCA 2KXDA 3FJ5A 4GLMA 2CREA 4OMNA 1AWWA 1AVZC 3I9QA 1X27A 5I11A 1K9AA 1W70A 2CUBA 1BU1A 1OPKA 3ZL7C 1T0HA 1GBQA 2KYMA 2J06A 2FPEA 1UE9A 1ZBJA 1HSQA 2HDAA 2D8JA
chains in the Genus database with same CATH superfamily
4DA4A 3ER0A 1SSHA 2LTOA 5HK3A 2RQTA 5GMKe 1VIFA 2QASA 2VB6A 2DL4A 2LVMA 2QQRA 3UPUA 2DTIA 2DL7A 4RCBA 1I0CA 1RLPC 4XTWA 1YJWT 5LJ5g 1TS9A 2F2VA 4ZGDB 2OTLT 1TTHB 1I5LA 1IZ6A 5HK0A 4FYWB 4FYYB 3EHRA 3SEMA 2P84A 2O01E 1PRLC 1T0JA 4F17A 3QZ5B 2XDDA 2E5QA 3X24B 3QWYA 3CXCS 3HFNA 3CCRT 2HSPA 5LJ5d 1M1FA 1TG0A 1PKSA 1Q81C 1UDLA 1WA7A 3KBGA 2HL5C 3LGLA 1SHFA 2MOXA 2FB7A 3CPWP 4JPBW 2XKOC 1B7TA 2LT4A 1K73R 2CUDA 5DLOA 2XICA 1O75A 2K5LA 1QWEA 1K4US 3OYYA 1VOMA 5FU6C 1S1NA 1M1KU 1VQ9Q 2YLCA 5ECAA 4C0DB 2RJDA 1NEBA 3CCMT 3HKSA 3G1JA 1UECA 1TH7A 5J39A 2OI3A 3DB4A 5J26A 2G3RA 5FU7C 1BK2A 1X6OA 2MAMA 2DL8A 3L1AA 4QT7A 2CZ6B 3GNGA 2HZYA 4HCBA 2EW3A 5GAMj 2X3WD 3C94A 1YWPA 2R5MA 2EYWA 2O2OA 1M3AA 2HD0A 2DO3A 3DLMA 4F7UA 2JNGA 3JB9J 4C92C 2FRWA 2NYSA 2KT8A 1ZSZC 2YXYA 2E64A 3QDFA 3ZFJA 4LUEA 4Q5WA 1W1FA 3CMAQ 3CCEA 5CR2A 3QJYA 1MV0B 3OYNA 1VQ8A 4J6XA 3RERA 1SKUB 4E7ZA 3GP8A 1QW1A 2J6FA 3CCSQ 2VVKA 2I2LA 2E12A 2PVDB 3CEYA 1S72Q 4ZTFA 5GAMe 3EGXB 2KROA 4XTVA 3C0CA 2R57A 5GMKh 2AZSA 3CPFA 3PT9A 1N5ZA 1TUDA 1AZEA 2EQMA 4J9IA 3EG3A 2ZZDA 2AIRB 1U1TA 4XTYA 4ELYC 2RQUA 4II1A 4D8KA 2VV5A 3RMSA 2EJGA 2KXCA 5GAN5 3P8BB 2DEQA 4OB1B 3SDZA 4HVWA 4HKEA 3REAB 2NUPB 4E7IA 2DYIA 2F2XA 1I4K1 4ELZC 1MHNA 2M0YA 1WPYA 2CZ1B 1VA7A 3VS0A 1YCYA 1LPLA 2EJ9A 2KGTA 2ESWA 4ZTJA 3CCUA 1PSFA 2K79A 2PVGB 3H41A 3J80E 2EQJA 4PK4A 4AG2C 1BI3A 1WQWA 2QA4Q 2MK5A 2P4TA 4IIMA 4M75G 3OS2A 1TWBA 2JZ2A 2VXFA 4PJOE 2XMFA 1UB4A 2CP2A 1XTDA 4E7LA 3CQTA 1MMDA 3JCMJ 4HVVA 2WACA 2QEXQ 2QTXA 1BI1A 2MMPA 4TVRA 4Z8AA 3GNFB 3HPWA 3TEEA 1HJDA 4ME7A 1ACMB 1SSFA 1UG1A 1M1KC 1IB8A 2OJ2A 4E7JA 4JJNK 4M75B 4OGEA 2QAZA 3RKXA 3JB9H 3IQLA 2H3EB 2XK0A 4PJOG 5CO7A 3M57A 4OMLA 5GAOq 2X3XD 1VQ7Q 1VQPQ 2HSEB 2E4HA 4LDWA 1Y57A 1BI2A 5D6YA 2E70A 3E19A 5HY6A 2KR3A 2RJEA 3EFOB 4RKUE 1AWXA 5FWBA 2PTKA 3MEWA 2QQBA 4AMCA 1JJ2P 4C0ZA 3H0HA 3HFOA 3EG2A 3VYHB 1WGSA 2L3RA 2QQAA 2MWOA 1KIKA 4PJOB 2MIOA 4FYXB 1C6VX 4M75A 5GAN2 3WVEB 2W0ZA 3JV3A 2L0AA 1U8RA 4J9CA 2FEIA 1Q82U 2DNUA 3M0SA 4JLIA 3R6OA 4RG8A 5GAMh 1JBMA 1M3CA 1D09B 3CD6A 2BE9B 3M0PA 1N9RA 3V7RA 4P5NA 3RBBB 2BKDN 1VQOQ 1J3TA 3I5SA 5FWCA 1BIBA 2M0OA 3CCET 1YJNA 1I5OB 1VQ8T 3CCJQ 3OBWA 4C8QF 1M3BA 1G3YA 2LNVA 3CC7Q 2RI5A 2AT1B 2DVJA 1YBYA 1BIAA 1ZQ1A 2GCXA 1G8XA 2OTJQ 1H641 4DOVA 1JEGA 1G3WA 2RQRA 1VQ4A 1IREB 3X20B 2RHXA 1NPRA 4EPCA 2ED0A 3WXMB 4LDUA 1VQLA 1FMVA 1EFNA 2FO0A 1Y96B 1RAFB 4QQGA 1GL5A 4NL2A 3P8DA 1VQ6Q 2FL7A 3M0RA 3AT1B 3CC4Q 3O5ZA 2X51A 2JTFA 2R58A 3V8JA 3OYCA 1LJOA 3M54A 2BZXA 5FLXE 1NEGA 2RF0A 1OZ2A 3O8VA 4JRIA 4LDYA 1OZ3A 3CCUT 4FYVB 3G7ZA 4QVZA 1BCMA 2V26A 4XU1A 1Y96A 3VS4A 4FSSA 3A8MB 1D1AA 4X9CA 5GANe 4A4GA 1MGQA 5KCHA 4FIBA 2SRCA 4C0DC 3JCMQ 1T3LA 1YITA 2JMCA 1PD0A 5IHIA 3UWNA 4A53A 2OTLQ 2P0PA 1RAGB 1YJ9A 3HTRA 5IHNA 2DLPA 2WSCE 2DE0X 2ATCB 2DPPB 3QWXX 4M77G 2DXCA 4OMFB 3R6NA 3CXCA 2KDSA 4N4IA 1QWFA 3JCMe 1M90C 2YRCA 2D6FA 3THKA 2K3BA 2GTOA 3CCRQ 4OMNA 4GLMA 1AWWA 3I9QA 1OX9A 2VC8A 1PM3A 1K9AA 5HKCA 2RK1A 1K9MC 1M1KR 1OPKA 1KHIA 5GAN4 5CQXA 1UE9A 4PFOA 2C06A 1ZBJA 1HSQA 1W4SA 3EG0A 5KYXA 4M77B 2COZA 2KRNA 3UA7A 4MMLA 1ZSZA 1MV3A 4LDXA 5LJ5h 2HKQB 5GAMg 4Y91A 1AZGB 1U5SA 4M7AD 5FRNA 3CCMQ 7AT1B 4QQ6A 5LJ5f 3JRZA 4J9FA 1GCPA 2ZPIB 1KC8U 5KYNA 3LH5A 3M5AA 1Q82C 4JRPA 3RESA 3G71A 3LH0A 1NJIC 2PZ1A 2EYYA 1YIJA 1QCOA 2IVWA 5GJVB 3UT1A 2SEMA 1BBZA 3L2VA 3VKIA 1GFDA 2RQWA 4QVCA 4BDYA 1YWOA 5GAMd 3VYGA 3CD6T 2K7AA 5A0DA 4M77A 2DJQA 2M02A 4J9DA 5GAOn 2KAFA 3D7SB 1MMNA 2E5KA 4M75D 2LDMA 1VQNA 4ESRA 2D0QB 4BE0A 1QKXA 2Y4YA 2J6KA 4C8QC 4BY6C 4B9WA 1D1BA 4J5YA 1OOTA 3CPWA 4NS5A 3LWIA 2RM4A 4HCZA 1KFZA 2DZ9A 2HQEA 1VQ4T 1WJRA 2LRQA 5CK9A 1CKBA 4OB2B 1VQLT 2JS2A 2DERA 1YN8A 2J6OA 4B6MA 1K1ZA 2X4YA 2HQHA 2M1HA 2RQVA 3A5ZB 4RG2A 1JXMA 1NG2A 4CC2A 5L23A 4IUPA 2JOYA 4CRIA 4RTWA 1Q86R 1AWOA 1OULA 3MEAA 4D6WA 1WJQA 3OY9A 1ARKA 4WF2A 1WHGA 1N9SA 1BKBA 2IPOB 4J7IA 2JTMA 2NUZA 2HBPA 4RTYA 4C5HA 3NTHA 3QYGB 1W6XA 5FROA 4CC3A 1WFWA 2ROLA 2X9HA 5GAN3 2ED1A 5IXBA 1AEYA 1PD1A 1M2VB 1M2OA 5GMKm 2CGHA 1IGUA 1B34A 3QSUA 2GFAA 1MUZA 1OYXA 3VRYA 2JMAA 3PMIA 3JCMh 3S6WA 2L3QA 1SG5A 3E2UA 4E2FB 2KE9A 3VS7A 5A0LA 1YHQA 2CT3A 3JCMP 1GBRA 1YITT 1WNLA 2KK4A 1WQ7A 1RI9A 3LLRA 5A0GA 1UGQB 4GLKA 1YJ9T 4NL3A 4MDWA 4R55A 2LJ1A 4AFSC 4F7UE 3FIFA 1ZLMA 3ME9A 4XU3A 1UJYA 4C0GA 2EGAA 1WHHA 1M2VA 2EYQA 1IHVA 1HYOA 3GLXA 1M90R 2V1QA 1YFNA 2GQVA 4FW1A 1X6GA 6AT1B 1G3SA 1Z9ZA 5CIUA 3L42A 4LD6A 5CAIA 2B86A 1K9MR 4LUDA 4PJMA 4FT4A 4F7UG 3UDCA 1KC8C 2E3IA 3A98A 2ZPFB 1ZBXA 5DY9A 1K8AU 1GCQC 4Y28E 1DJ7B 2PQWA 3HRUA 2YWWA 1WHKA 1PHTA 4MZTA 1ABQA 3G71T 3EAEA 1KK7A 2KI7A 1PRMC 1WIEA 1X75C 1JO8A 1YIJT 3CCLQ 2RHIA 3CCVQ 1Q82R 4EDUA 5LL6S 4F7UB 1NJIR 3MP1A 2MYSA 1OX8A 1K76A 3PIPA 2AZVA 2DA9A 4M7DC 3VS6A 4JS5A 3TREA 1QCNA 5IXFA 4JRQA 1C1AA 1VQNT 2YUOA 2F69A 4Z89A 1M9SA 3CCQA 4LE9A 3QHSA 4N4GA 4ZNXA 3VU3C 4K11A 3CCEQ 1MNDA 1VQ8Q 3JAME 5GANg 3NPFA 1UGVA 3EFRA 2D9TA 3J7AF 4M77D 2DAQA 3LX7A 5HCKA 1WYXA 4Z02A 5GMKi 2LQNA 3SWNC 4DBHA 4E7SA 2KY9A 2BUDA 2DETA 5KYYA 3OS0A 1M30A 1AD5A 2KT1A 2O9VA 4M7AE 1R0CB 3JCMV 3CC2T 1IGQA 1U06A 1VYUA 3JCMg 4A4FA 4KH1B 5GANd 3JCMX 3CPWS 1JJ2A 3ZBDA 3RMQA 2A08A 4RMOA 1KD1U 2E6NA 4RUGA 3MP8A 2DXTA 1RLQC 2V8JA 1AT1B 1M8MA 2OAUA 3TSZA 1LVKA 4XTZA 3M58A 2RH2A 1KQ1A 5LJ3j 2CH4W 3JCMd 4M7AG 4LD9K 3REBB 1VYVA 3CCUQ 2EQUA 5CQYA 3LW5E 1YHQT 4JLGA 5L8RE 3OSSC 4BDZA 4M75E 1KQSA 3I55Q 3I56A 3NHNA 3NTKA 4N0AA 4IKFA 2RK2A 3JSCA 1B07A 3PTAA 1EX4A 3JB9I 2PU9B 2VUBA 4DOWA 1WJSA 4FU6A 2LP5A 2O31A 3OSVA 1FMWA 4ORZA 2OX7A 2RHUA 4IUTA 2VASA 2YT6A 4M7AB 5LJ3e 4XK8E 5AYFA 2AKKA 3TCJA 5FW9A 3ASKA 4MZMA 1JXOA 2CH4A 1VQMQ 2K2VA 4F7UF 2WSEE 4HT8A 4MMKA 1I1JA 2BIVA 1W2BP 3J81E 2K3XA 2DX1A 1K8AC 2JVVA 2BZYA 2F5TX 2RHZA 2Y90A 2LX7A 2XI9A 3FC3A 1NLOC 5CKEA 1AHJB 3OW2P 2HBWA 2A3LA 2YSQA 2A7YA 2HQXA 1OV3A 3EGUA 4L5GA 3MO8A 2V1RA 4C5EA 4PLIA 1H3HA 4DBFA 4ATOA 3VS3A 2QI2A 2RPNA 2K3YA 2XDBA 4M7AA 3I5RA 4Y92A 4RTXA 2KSSA 2B8AA 1Q81R 1I81A 2HMAA 3OYAA 1CKAA 3OYGA 1JQQA 4C8QA 5GAOm 3I35A 1WX6A 5EC7A 4EMKC 3OB9A 3DKMA 8ATCB 1K0SA 1NE8A 2COYA 1RI0A 4J6YA 1OPLA 1KHCA 4OMQA 3G4SA 3HL8A 4KGZB 3CD6Q 1QLYA 1QQJA 2L89A 3CCQT 2HEQA 3PVQA 3MP6A 1TSFA 3RR6A 3JCMc 5I11A 2CUBA 2YHTA 2E1HA 3TU4K 3ZL7C 1T0HA 4PJLA 1GBQA 3NFCA 2FZGB 4GY5A 1W2BS 1X01A 1FXXA 3PE0A 3GF5A 2JTEA 1VQPA 5GAMf 4WCIA 3RKWA 2ZPGB 1K73U 3OW2S 1Q95G 4PNOA 1KQSP 1YCSB 2QYZA 4HT9A 2LX9A 2V8IA 1KD1C 2JXBA 1VQLQ 2FRYA 1SF9A 4M78A 4GBQA 3UATA 1N8RU 1CSKA 5I2MA 3QG1A 4O5VA 3INZA 3HP9A 1OEBA 3CMEA 1P92A 2PUKB 3OYDA 2JUFA 2CP6A 5KYUA 1QVFP 4BACA 4LDVA 2RB6A 3URGA 5I2SA 1PG5B 2JW4A 1Y0MA 5DLQE 4FL6A 5GANj 2MCNA 5LJ3h 1JJ2S 2DL5A 3P8HA 4D8DA 1B3QA 4DBQA 5KE3A 4IUUA 3GIBA 3I56T 4HCCA 2E6ZA 4J6WA 2QXFA 2CP0A 3OMCA 2RJCA 4HCKA 3OYJA 3MPUB 2KEAA 5FU7B 1YITQ 1VQ5A 2WSFE 2LC4A 2OTJA 4M77E 4M75F 1HD3A 1RL2A 1YJ9Q 1D0YA 3C12A 4XQ3A 3UA6A 2PNIA 2ECZA 3PIOA 2XDPA 3V8KA 2LT1A 1KQSS 2ZPBB 1YJWQ 3L2ZA 2EWNA 2JT4A 4FT2A 5KYXB 2IG0A 4X9DA 3CC4A 4KT0E 2CT4A 1ZSZB 1K8AR 4M7DA 1N27A 3JCMb 4PJOF 1GXIE 2K57A 4KRTA 2RA2A 2E41A 2RMOA 2CS7A 4LXCA 2KYBA 4OMPA 2HNIA 5EG2A 4MDXA 3BDLA 1ZA1B 3CBMA 2QTVA 1G3TA 3OQ5A 1UUEA 2NWMA 4BE2A 4AFZC 4BUGA 3M0QA 3H6ZA 4OMMA 2K5IA 4C92A 3S3OA 3RKYA 3SWNA 3EG9A 1E6HA 1QMCA 2FYKA 2OTLA 2DMOA 1FX7A 3G4ST 4XAXB 2L2PA 5GAOl 2JN0A 1R8OB 3BFMA 1RABB 1SPKA 4C8QD 3QKJA 1ZX6A 4HA8A 4MZPA 4X1VA 5GJWB 3RDVA 1KJWA 1UEBA 4IURA 4JRKA 2DZCA 2DK3A 4OB3B 4QVDA 2BTTA 4PLLA 1MNEA 1OU8A 1VQNQ 2GFUA 3OYHA 1D3BA 4C0FA 1RAEB 4L6V5 3QZ9B 1V76A 4UC4A 2A28A 1X2QA 1VQPT 1YI2A 4FM4B 2RHYA 4A63B 1N8RC 5GAN7 2M9UA 3MJXA 2PVOB 3C4SA 1YJNT 4DEXA 2VGMA 1RAHB 1OU9A 3H0IA 2D1XA 2W10A 3X28B 3SFMA 4BD3A 2ZGWA 4QQDA 5LJ3g 1KD1R 2VGNA 3CC2Q 2EYXA 1MMGA 3CMET 1D0XA 2ENMA 2EQIA 3VS5A 2EPDA 2K5FA 2O88A 1B34B 5KYWA 4BE1A 4QKUA 2K6DA 1NM7A 1BYMA 1ZUYA 1M5Q1 2YRDA 3C95A 3RUXA 1SRLA 3Q1JA 3QJ6A 1Y07A 5A2QE 4M78D 2MWPA 1EIFA 1T3SA 2ABLA 5LJ3d 3DB3A 4X34A 2DF6A 4M4ZA 4JDSA 2CP5A 5GAOr 1UGSB 5GANh 2LNHB 2O4XA 1ABOA 4ANJA 5GANf 1YHQQ 3BY7A 1KG1A 3V8LA 3OA6A 2DRKA 4BI3A 5IAYA 3RIRA 3G6EA 2YRVA 3MKDA 1M27C 2LMJA 1R77A 3FLGA 2V8KA 4L59A 2IIMA 1VQ5T 3OBYA 3JB9D 5D7UA 2OTJT 2KVQG 5CVIA 4M75C 3V7CA 2LCSA 3QXEB 2RN8A 3VUZA 1ZUUA 4RTZA 3QIIA 2C0TA 4A4EA 3EHQA 4RCCA 3JCMf 3N5BB 9ATCB 4JJBA 1MMAA 4M77F 2DYBA 4EMKA 3OYMA 4J9HA 1VQKA 1TU0B 3CC4T 2EVRA 3HHTB 3BE3A 5C0MA 3X26B 1RUWA 1X69A 2MPXC 1V29B 2E10A 3M4GA 3OYEA 1NYGA 3X25B 3OS5A 3M0TA 3HSBA 2VKNA 2JJ9A 4PJOC 1FWZA 2CDTA 2CP7A 2QGFB 2E3HA 4Z88A 5I21A 1E6GA 2EGCA 1WXBA 4VUBA 1UGRB 1ZA2B 2I0NA 2M51A 4M7DD 2XG8D 4FSXA 3GOXA 2LQWA 5KH6A 3TSWA 2C0OA 2DILA 3M4YA 4R56A 3SB2A 3L2WA 1M4ZA 1WDXA 1WHMA 4KULA 2KBTA 1NYFA 1WXTA 4A54A 2CSQA 1ZHIA 3QDRB 4PFZA 3CCQQ 2X4JA 4FCYA 4C92D 1PCXA 1H8KA 1W2BA 1YI2T 2GTJA 4AFQC 5KYYB 1QP3A 2J7IA 1V1CA 3QUIA 2DM1A 4J9BA 4KBMB 2DBKA 3OW2A 3E9GA 2HL3A 1JB0E 3MEVA 2VYTA 1WLPB 1N8RR 2CZ0B 2QQ9A 1VIEA 5GAN6 4PL6A 1SHGA 5CKDA 2A37A 3MHXA 2QK0A 5D6XA 1I8FA 4JZ4A 2EKHA 3A8OB 1N6AA 4OB0B 1QKWA 1Z9QA 3PMTA 3CCLA 1VQ9A 3CCVA 2DVEA 1QVGA 1M8VA 2LZ6B 2CZ7B 2H8HA 2YUNA 2CKKA 4J8OA 1SEMA 4C5GA 2DJZA 3OS1A 3ZEHA 2ZAEA 4C8QE 1UJ0A 1TUCA 2KXDA 2P0KA 4OGCA 1Y7XA 3M53A 2DD4A 2CREA 1AVZC 2EQKA 2FZKB 1TOVA 4XTUA 2XD0A 2X4XA 1W70A 3G6ET 3DLLA 3I56Q 4KUIA 2KYMA 2ZCFB 2KMTA 2HDAA 3OYLA 1D0ZA 2DD5A 2GQIA 3MEUA 1YNZA 3TQ7P 4BB7A 4C8QG 4F14A 1LCKA 4JS4A 2KRSA 3CMAA 4OP0A 1TXQA 3NMZC 2F1LA 1VQKT 4M77C 4J9EA 1M1GA 3ULRB 3RNJA 2FG0A 3VS1A 3VRZA 3CCSA 1RACB 5GMKl 1BCOA 2EKOA 4JZ3A 3H8ZA 2JM9A 1QP2A 2VWFA 3OMGA 1S72A 2XIDA 3BDUA 3AHUA 4KUDK 2YUQA 1Q86U 4C8QB 4BY6B 1QVFA 4B9XA 5CKHA 4FW2A 1X2KA 1FYNA 2QDLA 4M78E 1WXUA 2JS0A 2ZPEB 3H9NA 2L3SA 3EGXA 3CBPA 2R5AA 5FRMA 4N4HA 1NLPC 2QGGA 3EGDB 3VV0A 3TVTA 2DBMA 3I55A 1H3ZA 4LNPA 2F5KA 2LJ0A 3L2RA 1IO6A 2BZ8A 4E6RA 1KC8R 3MCAB 3SD4A 4BI4A 1O9SA 3HRSA 2QQSA 2H3JA 1XJWB 2RI3A 3M0UA 4RTUA 3T9NA 1Q7YU 3E9FA 2E65A 1OI1A 5IH2A 2NUPA 4M78G 3G4SQ 3A8LB 1WHLA 3WVDB 3OYKA 2GF7A 1QVGP 2QA4A 3PVLA 4OVAA 3OYIA 1QCFA 2DXUA 1VQMA 4PJNA 1TUGB 1NBEB 1KQ2A 2A0FB 3KUFA 2C0IA 3EGDA 3GBQA 3M59A 4NOYA 1WI7A 1FMKA 4EIKA 3JB9G 2RNAA 2QEXA 1VYTA 2KNBB 1M90U 3FEOA 5GAOp 4M78B 4IUQA 3UF4A 3FRNA 2GBQA 3GPLA 2O9SA 4DQ2A 5LJ5j 1BB9A 1K9MU 1YJNQ 2MF2A 2J05A 1F1BB 2DL3A 2X4WA 1UHCA 3E1SA 5KYUB 1I07A 2QDYB 3CCLT 1G2BA 3LGFA 1VQ9T 3CCVT 1LOJA 1VQ7A 4M7DE 2CYZB 4RTTA 3CMEQ 1VQ4Q 4HXJA 5KCOA 4DEYA 1U1SA 1G5VA 1NJIU 5LJ5e 2EIFA 3NGPA 4KH0B 5IHKA 1GRIA 3S3NA 4ZN3A 4BI8B 2QG9B 4CI0C 3F70A 3EFOA 2KRMA 4PJJA 2RO0A 4M7AF 5C6SA 1HXDA 1QVGS 1PWTA 4C92E 4M7DG 4ZN1A 2P0QA 1PKTA 4YTLA 3QYHB 2DKGA 4PJOA 4LN2A 1BI0A 5M9OA 1WHJA 1VQ5Q 1NPPA 3EG1A 5FU6B 2DTOA 1UTIA 1JRIA 2D8HA 1VQOA 2XHCA 2L8DA 3A8HB 1JU5C 5LJ3f 3SHWA 3CMAT 1GFCA 4ZGEB 1X43A 4E7HA 2D0NA 1UHFA 3CCJA 1AWJA 1R0BG 4XU2A 2DTHA 2P4RA 2RD1A 5J3BA 3CCST 4M7DB 2L3PA 4QW2A 4C92G 3CC7A 1Q86C 2DIGA 3OYFA 4C5IA 1Y71A 2K4YA 1GCQA 1S72T 3QBYA 3FDRA 3A8GB 4JJDA 3V7SA 2YDLA 3PGGA 1RAIB 1XOVA 3VUBA 3VJPA 2VXEA 3M56A 4XTXA 1VQ6A 2LQKA 2DEUA 3JCMW 2RI2A 5CCAA 4C92B 3SWNB 3EG9B 3I55T 1Q7YC 2GNCA 3EH1A 3NTIA 4M78F 3KXTA 1EZZB 1D1CA 1ZUKA 2AKLA 1HK9A 2PUOB 3PFSA 1QVFS 2M16A 4OF1A 5IT9E 4CC7A 2HCKA 4JJCA 4KGXB 3VS2A 5AT1B 1ZSGA 1D3BB 1G83A 2QA4T 3G71Q 4CC4B 3OYBA 3JB9F 1VQMT 2K9GA 2Z0WA 1YJWA 3M55A 1YIJQ 4JUVA 2GGRA 1QVPA 2DIQA 3FJPA 4O6JA 2KQWA 2L5QA 2QEXT 2AHJB 4DBRA 4J7FA 4RTVA 4IIOA 5GAN8 2MI6A 1XNIA 1UFFA 1YI2Q 2YUPA 4N0AC 3KFVA 4ZGJB 2JM8A 4IUVA 2OAWA 2EGEA 1SRMA 3CCRA 1IRXA 1XQHA 4HVUA 1K73C 3EH2A 1H92A 1UGPB 4F04B 1C0MA 3FB9A 2EJFA 1K0XA 5KYWB 5D6WA 2K2MA 1VQ7T 4E47A 1Q81U 8AT1B 5DM7R 2FPDA 3A1PA 4XU0A 2LQ8A 2EYZA 2NUTB 2LJ3A 2A36A 3CCMA 2O4XB 2EAYA 4J83A 2FVUA 4PKCC 1NZ9A 4M7DF 1IHWA 1YP5A 4EMGA 3META 2AK5A 3QO3A 2LCLA 3EFSA 2HKNA 2RJFA 2CP3A 4EMHA 4M7AC 3G6EQ 3BW1A 3LWHA 1PC0A 4R0KA 3LYIA 1VQOT 1PNJA 2EFIA 5CKBA 4EMKB 3CBOA 4C92F 2DRMA 2NUTA 5KE2A 2FPFA 4WTOB 2Y4XA 1OQKA 3CCJT 3QPHA 1KSWA 2EBPA 1RAAB 2NLUA 1LNXA 2F2WA 4AG1C 3CC7T 2LCCA 1U3OA 4F16A 2BE7D 4V2SA 3L2QA 4AFUC 4PJOD 1VQKQ 4A4HA 3CC2A 3U23A 2COWA 2G6FX 2ROTA 1X6BA 1A0NB 1RADB 1E7OA 2XU8A 3M9QA 3CXCP 5I22A 5GMKj 5IN1A 1IXDA 1VUBA 3S3MA 2CSIA 1AOJA 1WZOA 2ZPHB 4A4KA 1VQ6T 2HAXA 2FZCB 2X35A 4AT1B 3H0FA 4J9GA 1PSEA 4OMOA 2YLBA 3FJ5A 2DXBA 1X27A 4PFPA 4KGVB 3HRTA 1BU1A 2FHDA 4E7KA 3L2UA 2J06A 2DFUA 2FPEA 4M78C 5CKFA 1Q7YR 2D8JA 3PNWC
chains in the Genus database with same CATH topology
1SSHA 2JTEA 2RQTA 2KRNA 2DL4A 2GQIA 4WCIA 3UA7A 1YNZA 1MV3A 1YCSB 2DL7A 1AZGB 1U5SA 2JXBA 4F14A 1LCKA 2KRSA 1I0CA 1RLPC 4J9FA 2FRYA 1GCPA 3LH5A 3NMZC 4GBQA 3UATA 1CSKA 2F2VA 4J9EA 2PZ1A 3ULRB 3RNJA 2EYYA 2FG0A 3VRZA 3VS1A 4JZ3A 5GJVB 2JM9A 2SEMA 1OEBA 1BBZA 3EHRA 3SEMA 2VWFA 1GFDA 2RQWA 1YWOA 2YUQA 1PRLC 1T0JA 2K7AA 4F17A 3QWYA 2JW4A 2DJQA 1Y0MA 1X2KA 1FYNA 2HSPA 2QDLA 1WXUA 2JS0A 1TG0A 4J9DA 1PKSA 2L3SA 2MCNA 1UDLA 1WA7A 2DL5A 2E5KA 4D8DA 1B3QA 1SHFA 2MOXA 4ESRA 1NLPC 4JPBW 1QKXA 2CUDA 2J6KA 3TVTA 2DBMA 4LNPA 1OOTA 1QWEA 1K4US 4HCKA 2LJ0A 1KFZA 1S1NA 2KEAA 1IO6A 2BZ8A 5ECAA 4E6RA 1NEBA 1HD3A 1CKBA 3M0UA 4RTUA 2JS2A 1UECA 1YN8A 2J6OA 5IH2A 1K1ZA 3UA6A 2RQVA 2PNIA 2ECZA 2OI3A 1JXMA 1NG2A 3PVLA 4CC2A 5L23A 1QCFA 2JT4A 1BK2A 2DL8A 1AWOA 4RTWA 2CT4A 4QT7A 2C0IA 1ARKA 3GBQA 1WI7A 2NUZA 1FMKA 4EIKA 2RNAA 1VYTA 2EW3A 2KNBB 2X3WD 1YWPA 4RTYA 2EYWA 3UF4A 2O2OA 4KRTA 1M3AA 2GBQA 1W6XA 2RMOA 3EG0A 4CC3A 1WFWA 2ROLA 2ED1A 5IXBA 1AEYA 2O9SA 2FRWA 1BB9A 2KYBA 2KT8A 4OMPA 1MUZA 3VRYA 2JMAA 2L3QA 2J05A 2KE9A 4LUEA 3VS7A 2DL3A 1W1FA 2CT3A 1UHCA 1MV0B 1GBRA 1I07A 1UUEA 2NWMA 1G2BA 4AFZC 1RI9A 3M0QA 2J6FA 2VVKA 4OMMA 4RTTA 1E6HA 2LJ1A 4AFSC 4HXJA 2DMOA 2KROA 3C0CA 1ZLMA 2L2PA 2AZSA 4DEYA 1N5ZA 1TUDA 1SPKA 1UJYA 1AZEA 2EGAA 3NGPA 1ZX6A 3EG3A 1GRIA 4J9IA 5IHKA 4X1VA 5GJWB 1KJWA 2RQUA 4D8KA 2BTTA 2KRMA 2V1QA 2KXCA 1X6GA 1PWTA 1Z9ZA 1PKTA 4HVWA 2B86A 3REAB 2A28A 1X2QA 4LUDA 4LN2A 2F2XA 4A63B 3A98A 2M0YA 3EG1A 1VA7A 1UTIA 4DEXA 3VS0A 1GCQC 2D8HA 2KGTA 3H0IA 2ESWA 2D1XA 2W10A 1JU5C 3SHWA 1GFCA 1PHTA 2K79A 3H41A 1X43A 2D0NA 1ABQA 1UHFA 1AWJA 4AG2C 2P4RA 1PRMC 1WIEA 1JO8A 2L3PA 4IIMA 2EYXA 1GCQA 2XMFA 2ENMA 2EQIA 3VS5A 2EPDA 1K76A 2O88A 3CQTA 4JJDA 2K6DA 4HVVA 2YDLA 1NM7A 1ZUYA 4Z8AA 1SRLA 2AZVA 2DA9A 1XOVA 3VS6A 1T3SA 2ABLA 2DF6A 4M4ZA 5IXFA 1HJDA 2YUOA 1UG1A 4Z89A 2OJ2A 2LNHB 4LE9A 4ZNXA 1ABOA 4K11A 3IQLA 2DRKA 2GNCA 1M27C 2LMJA 2IIMA 3NPFA 1UGVA 4OMLA 2X3XD 1ZUKA 2AKLA 5HCKA 1Y57A 1WYXA 2LQNA 2LCSA 4CC7A 2KR3A 2HCKA 4JJCA 2RN8A 3VS2A 1ZUUA 4RTZA 1AWXA 5FWBA 2PTKA 1ZSGA 1M30A 1AD5A 2KT1A 2C0TA 3EHQA 1G83A 2O9VA 3H0HA 4CC4B 3EG2A 4JJBA 1U06A 1VYUA 2DYBA 2K9GA 4J9HA 1KIKA 2MIOA 2EVRA 2GGRA 2A08A 1RUWA 2W0ZA 4RUGA 1X69A 3JV3A 2L0AA 1NYGA 1RLQC 2FEIA 1M8MA 2DNUA 3M0SA 4IIOA 4J9CA 4RTVA 3TSZA 1UFFA 3M0TA 2VKNA 2YUPA 1M3CA 3KFVA 2CDTA 2JM8A 3M0PA 4Z88A 2CH4W 2OAWA 2EGEA 1SRMA 3RBBB 1J3TA 3I5SA 5FWCA 3REBB 1VYVA 4HVUA 1E6GA 2EGCA 1H92A 1WXBA 1K0XA 2I0NA 2K2MA 3NHNA 2M51A 1M3BA 2LQWA 3TSWA 1B07A 2C0OA 2DVJA 2DILA 2FPDA 1JEGA 2LP5A 2O31A 2RQRA 2EYZA 4ORZA 2LJ3A 1WDXA 2A36A 2ED0A 2YT6A 2FO0A 1EFNA 1GL5A 2AKKA 1YP5A 5FW9A 2KBTA 1NYFA 1JXOA 1WXTA 2CSQA 2AK5A 2CH4A 3M0RA 3PE0A 1I1JA 3O5ZA 2DX1A 2BZYA 1H8KA 2LX7A 1NLOC 2GTJA 2HBWA 4AFQC 2YSQA 2BZXA 1OV3A 3EGUA 1NEGA 2J7IA 1V1CA 2RF0A 2V1RA 2DM1A 4R0KA 4J9BA 2DBKA 1H3HA 1PNJA 3VS3A 2RPNA 2DRMA 1WLPB 2FPFA 3I5RA 4Y92A 4RTXA 1SHGA 1KSWA 2A37A 1CKAA 2EBPA 1JQQA 3VS4A 4FSSA 2F2WA 4AG1C 4F16A 1U3OA 3I35A 1WX6A 4JZ4A 2EKHA 4AFUC 1QKWA 1Z9QA 5EC7A 2SRCA 1T3LA 2JMCA 3U23A 1K0SA 5IHIA 2G6FX 2ROTA 1X6BA 1A0NB 1E7OA 2LZ6B 5IHNA 2DLPA 5I22A 2DE0X 1OPLA 2H8HA 3QWXX 2CSIA 2YUNA 1AOJA 4OMQA 1SEMA 3R6NA 1QLYA 3H0FA 4J9GA 1QWFA 4OMOA 1UJ0A 2HEQA 3PVQA 3THKA 2K3BA 2GTOA 1TUCA 2KXDA 3FJ5A 4GLMA 2CREA 4OMNA 1AWWA 1AVZC 3I9QA 1X27A 5I11A 1K9AA 1W70A 2CUBA 1BU1A 1OPKA 3ZL7C 1T0HA 1GBQA 2KYMA 2J06A 2FPEA 1UE9A 1ZBJA 1HSQA 2HDAA 2D8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSH A;  2JTE A;  2RQT A;  2KRN A;  2DL4 A;  2GQI A;  4WCI A;  3UA7 A;  1YNZ A;  1MV3 A;  1YCS B;  2DL7 A;  1AZG B;  1U5S A;  2JXB A;  4F14 A;  1LCK A;  2KRS A;  1I0C A;  1RLP C;  4J9F A;  2FRY A;  1GCP A;  3LH5 A;  3NMZ C;  4GBQ A;  3UAT A;  1CSK A;  2F2V A;  4J9E A;  2PZ1 A;  3ULR B;  3RNJ A;  2EYY A;  2FG0 A;  3VRZ A;  3VS1 A;  4JZ3 A;  5GJV B;  2JM9 A;  2SEM A;  1OEB A;  1BBZ A;  3EHR A;  3SEM A;  2VWF A;  1GFD A;  2RQW A;  1YWO A;  2YUQ A;  1PRL C;  1T0J A;  2K7A A;  4F17 A;  3QWY A;  2JW4 A;  2DJQ A;  1Y0M A;  1X2K A;  1FYN A;  2HSP A;  2QDL A;  1WXU A;  2JS0 A;  1TG0 A;  4J9D A;  1PKS A;  2L3S A;  2MCN A;  1UDL A;  1WA7 A;  2DL5 A;  2E5K A;  4D8D A;  1B3Q A;  1SHF A;  2MOX A;  4ESR A;  1NLP C;  4JPB W;  1QKX A;  2CUD A;  2J6K A;  3TVT A;  2DBM A;  4LNP A;  1OOT A;  1QWE A;  1K4U S;  4HCK A;  2LJ0 A;  1KFZ A;  1S1N A;  2KEA A;  1IO6 A;  2BZ8 A;  5ECA A;  4E6R A;  1NEB A;  1HD3 A;  1CKB A;  3M0U A;  4RTU A;  2JS2 A;  1UEC A;  1YN8 A;  2J6O A;  5IH2 A;  1K1Z A;  3UA6 A;  2RQV A;  2PNI A;  2ECZ A;  2OI3 A;  1JXM A;  1NG2 A;  3PVL A;  4CC2 A;  5L23 A;  1QCF A;  2JT4 A;  1BK2 A;  2DL8 A;  1AWO A;  4RTW A;  2CT4 A;  4QT7 A;  2C0I A;  1ARK A;  3GBQ A;  1WI7 A;  2NUZ A;  1FMK A;  4EIK A;  2RNA A;  1VYT A;  2EW3 A;  2KNB B;  2X3W D;  1YWP A;  4RTY A;  2EYW A;  3UF4 A;  2O2O A;  4KRT A;  1M3A A;  2GBQ A;  1W6X A;  2RMO A;  3EG0 A;  4CC3 A;  1WFW A;  2ROL A;  2ED1 A;  5IXB A;  1AEY A;  2O9S A;  2FRW A;  1BB9 A;  2KYB A;  2KT8 A;  4OMP A;  1MUZ A;  3VRY A;  2JMA A;  2L3Q A;  2J05 A;  2KE9 A;  4LUE A;  3VS7 A;  2DL3 A;  1W1F A;  2CT3 A;  1UHC A;  1MV0 B;  1GBR A;  1I07 A;  1UUE A;  2NWM A;  1G2B A;  4AFZ C;  1RI9 A;  3M0Q A;  2J6F A;  2VVK A;  4OMM A;  4RTT A;  1E6H A;  2LJ1 A;  4AFS C;  4HXJ A;  2DMO A;  2KRO A;  3C0C A;  1ZLM A;  2L2P A;  2AZS A;  4DEY A;  1N5Z A;  1TUD A;  1SPK A;  1UJY A;  1AZE A;  2EGA A;  3NGP A;  1ZX6 A;  3EG3 A;  1GRI A;  4J9I A;  5IHK A;  4X1V A;  5GJW B;  1KJW A;  2RQU A;  4D8K A;  2BTT A;  2KRM A;  2V1Q A;  2KXC A;  1X6G A;  1PWT A;  1Z9Z A;  1PKT A;  4HVW A;  2B86 A;  3REA B;  2A28 A;  1X2Q A;  4LUD A;  4LN2 A;  2F2X A;  4A63 B;  3A98 A;  2M0Y A;  3EG1 A;  1VA7 A;  1UTI A;  4DEX A;  3VS0 A;  1GCQ C;  2D8H A;  2KGT A;  3H0I A;  2ESW A;  2D1X A;  2W10 A;  1JU5 C;  3SHW A;  1GFC A;  1PHT A;  2K79 A;  3H41 A;  1X43 A;  2D0N A;  1ABQ A;  1UHF A;  1AWJ A;  4AG2 C;  2P4R A;  1PRM C;  1WIE A;  1JO8 A;  2L3P A;  4IIM A;  2EYX A;  1GCQ A;  2XMF A;  2ENM A;  2EQI A;  3VS5 A;  2EPD A;  1K76 A;  2O88 A;  3CQT A;  4JJD A;  2K6D A;  4HVV A;  2YDL A;  1NM7 A;  1ZUY A;  4Z8A A;  1SRL A;  2AZV A;  2DA9 A;  1XOV A;  3VS6 A;  1T3S A;  2ABL A;  2DF6 A;  4M4Z A;  5IXF A;  1HJD A;  2YUO A;  1UG1 A;  4Z89 A;  2OJ2 A;  2LNH B;  4LE9 A;  4ZNX A;  1ABO A;  4K11 A;  3IQL A;  2DRK A;  2GNC A;  1M27 C;  2LMJ A;  2IIM A;  3NPF A;  1UGV A;  4OML A;  2X3X D;  1ZUK A;  2AKL A;  5HCK A;  1Y57 A;  1WYX A;  2LQN A;  2LCS A;  4CC7 A;  2KR3 A;  2HCK A;  4JJC A;  2RN8 A;  3VS2 A;  1ZUU A;  4RTZ A;  1AWX A;  5FWB A;  2PTK A;  1ZSG A;  1M30 A;  1AD5 A;  2KT1 A;  2C0T A;  3EHQ A;  1G83 A;  2O9V A;  3H0H A;  4CC4 B;  3EG2 A;  4JJB A;  1U06 A;  1VYU A;  2DYB A;  2K9G A;  4J9H A;  1KIK A;  2MIO A;  2EVR A;  2GGR A;  2A08 A;  1RUW A;  2W0Z A;  4RUG A;  1X69 A;  3JV3 A;  2L0A A;  1NYG A;  1RLQ C;  2FEI A;  1M8M A;  2DNU A;  3M0S A;  4IIO A;  4J9C A;  4RTV A;  3TSZ A;  1UFF A;  3M0T A;  2VKN A;  2YUP A;  1M3C A;  3KFV A;  2CDT A;  2JM8 A;  3M0P A;  4Z88 A;  2CH4 W;  2OAW A;  2EGE A;  1SRM A;  3RBB B;  1J3T A;  3I5S A;  5FWC A;  3REB B;  1VYV A;  4HVU A;  1E6G A;  2EGC A;  1H92 A;  1WXB A;  1K0X A;  2I0N A;  2K2M A;  3NHN A;  2M51 A;  1M3B A;  2LQW A;  3TSW A;  1B07 A;  2C0O A;  2DVJ A;  2DIL A;  2FPD A;  1JEG A;  2LP5 A;  2O31 A;  2RQR A;  2EYZ A;  4ORZ A;  2LJ3 A;  1WDX A;  2A36 A;  2ED0 A;  2YT6 A;  2FO0 A;  1EFN A;  1GL5 A;  2AKK A;  1YP5 A;  5FW9 A;  2KBT A;  1NYF A;  1JXO A;  1WXT A;  2CSQ A;  2AK5 A;  2CH4 A;  3M0R A;  3PE0 A;  1I1J A;  3O5Z A;  2DX1 A;  2BZY A;  1H8K A;  2LX7 A;  1NLO C;  2GTJ A;  2HBW A;  4AFQ C;  2YSQ A;  2BZX A;  1OV3 A;  3EGU A;  1NEG A;  2J7I A;  1V1C A;  2RF0 A;  2V1R A;  2DM1 A;  4R0K A;  4J9B A;  2DBK A;  1H3H A;  1PNJ A;  3VS3 A;  2RPN A;  2DRM A;  1WLP B;  2FPF A;  3I5R A;  4Y92 A;  4RTX A;  1SHG A;  1KSW A;  2A37 A;  1CKA A;  2EBP A;  1JQQ A;  3VS4 A;  4FSS A;  2F2W A;  4AG1 C;  4F16 A;  1U3O A;  3I35 A;  1WX6 A;  4JZ4 A;  2EKH A;  4AFU C;  1QKW A;  1Z9Q A;  5EC7 A;  2SRC A;  1T3L A;  2JMC A;  3U23 A;  1K0S A;  5IHI A;  2G6F X;  2ROT A;  1X6B A;  1A0N B;  1E7O A;  2LZ6 B;  5IHN A;  2DLP A;  5I22 A;  2DE0 X;  1OPL A;  2H8H A;  3QWX X;  2CSI A;  2YUN A;  1AOJ A;  4OMQ A;  1SEM A;  3R6N A;  1QLY A;  3H0F A;  4J9G A;  1QWF A;  4OMO A;  1UJ0 A;  2HEQ A;  3PVQ A;  3THK A;  2K3B A;  2GTO A;  1TUC A;  2KXD A;  3FJ5 A;  4GLM A;  2CRE A;  4OMN A;  1AWW A;  1AVZ C;  3I9Q A;  1X27 A;  5I11 A;  1K9A A;  1W70 A;  2CUB A;  1BU1 A;  1OPK A;  3ZL7 C;  1T0H A;  1GBQ A;  2KYM A;  2J06 A;  2FPE A;  1UE9 A;  1ZBJ A;  1HSQ A;  2HDA A;  2D8J A; 
#chains in the Genus database with same CATH topology
 4DA4 A;  3ER0 A;  1SSH A;  2LTO A;  5HK3 A;  2RQT A;  5GMK e;  1VIF A;  2QAS A;  2VB6 A;  2DL4 A;  2LVM A;  2QQR A;  3UPU A;  2DTI A;  2DL7 A;  4RCB A;  1I0C A;  1RLP C;  4XTW A;  1YJW T;  5LJ5 g;  1TS9 A;  2F2V A;  4ZGD B;  2OTL T;  1TTH B;  1I5L A;  1IZ6 A;  5HK0 A;  4FYW B;  4FYY B;  3EHR A;  3SEM A;  2P84 A;  2O01 E;  1PRL C;  1T0J A;  4F17 A;  3QZ5 B;  2XDD A;  2E5Q A;  3X24 B;  3QWY A;  3CXC S;  3HFN A;  3CCR T;  2HSP A;  5LJ5 d;  1M1F A;  1TG0 A;  1PKS A;  1Q81 C;  1UDL A;  1WA7 A;  3KBG A;  2HL5 C;  3LGL A;  1SHF A;  2MOX A;  2FB7 A;  3CPW P;  4JPB W;  2XKO C;  1B7T A;  2LT4 A;  1K73 R;  2CUD A;  5DLO A;  2XIC A;  1O75 A;  2K5L A;  1QWE A;  1K4U S;  3OYY A;  1VOM A;  5FU6 C;  1S1N A;  1M1K U;  1VQ9 Q;  2YLC A;  5ECA A;  4C0D B;  2RJD A;  1NEB A;  3CCM T;  3HKS A;  3G1J A;  1UEC A;  1TH7 A;  5J39 A;  2OI3 A;  3DB4 A;  5J26 A;  2G3R A;  5FU7 C;  1BK2 A;  1X6O A;  2MAM A;  2DL8 A;  3L1A A;  4QT7 A;  2CZ6 B;  3GNG A;  2HZY A;  4HCB A;  2EW3 A;  5GAM j;  2X3W D;  3C94 A;  1YWP A;  2R5M A;  2EYW A;  2O2O A;  1M3A A;  2HD0 A;  2DO3 A;  3DLM A;  4F7U A;  2JNG A;  3JB9 J;  4C92 C;  2FRW A;  2NYS A;  2KT8 A;  1ZSZ C;  2YXY A;  2E64 A;  3QDF A;  3ZFJ A;  4LUE A;  4Q5W A;  1W1F A;  3CMA Q;  3CCE A;  5CR2 A;  3QJY A;  1MV0 B;  3OYN A;  1VQ8 A;  4J6X A;  3RER A;  1SKU B;  4E7Z A;  3GP8 A;  1QW1 A;  2J6F A;  3CCS Q;  2VVK A;  2I2L A;  2E12 A;  2PVD B;  3CEY A;  1S72 Q;  4ZTF A;  5GAM e;  3EGX B;  2KRO A;  4XTV A;  3C0C A;  2R57 A;  5GMK h;  2AZS A;  3CPF A;  3PT9 A;  1N5Z A;  1TUD A;  1AZE A;  2EQM A;  4J9I A;  3EG3 A;  2ZZD A;  2AIR B;  1U1T A;  4XTY A;  4ELY C;  2RQU A;  4II1 A;  4D8K A;  2VV5 A;  3RMS A;  2EJG A;  2KXC A;  5GAN 5;  3P8B B;  2DEQ A;  4OB1 B;  3SDZ A;  4HVW A;  4HKE A;  3REA B;  2NUP B;  4E7I A;  2DYI A;  2F2X A;  1I4K 1;  4ELZ C;  1MHN A;  2M0Y A;  1WPY A;  2CZ1 B;  1VA7 A;  3VS0 A;  1YCY A;  1LPL A;  2EJ9 A;  2KGT A;  2ESW A;  4ZTJ A;  3CCU A;  1PSF A;  2K79 A;  2PVG B;  3H41 A;  3J80 E;  2EQJ A;  4PK4 A;  4AG2 C;  1BI3 A;  1WQW A;  2QA4 Q;  2MK5 A;  2P4T A;  4IIM A;  4M75 G;  3OS2 A;  1TWB A;  2JZ2 A;  2VXF A;  4PJO E;  2XMF A;  1UB4 A;  2CP2 A;  1XTD A;  4E7L A;  3CQT A;  1MMD A;  3JCM J;  4HVV A;  2WAC A;  2QEX Q;  2QTX A;  1BI1 A;  2MMP A;  4TVR A;  4Z8A A;  3GNF B;  3HPW A;  3TEE A;  1HJD A;  4ME7 A;  1ACM B;  1SSF A;  1UG1 A;  1M1K C;  1IB8 A;  2OJ2 A;  4E7J A;  4JJN K;  4M75 B;  4OGE A;  2QAZ A;  3RKX A;  3JB9 H;  3IQL A;  2H3E B;  2XK0 A;  4PJO G;  5CO7 A;  3M57 A;  4OML A;  5GAO q;  2X3X D;  1VQ7 Q;  1VQP Q;  2HSE B;  2E4H A;  4LDW A;  1Y57 A;  1BI2 A;  5D6Y A;  2E70 A;  3E19 A;  5HY6 A;  2KR3 A;  2RJE A;  3EFO B;  4RKU E;  1AWX A;  5FWB A;  2PTK A;  3MEW A;  2QQB A;  4AMC A;  1JJ2 P;  4C0Z A;  3H0H A;  3HFO A;  3EG2 A;  3VYH B;  1WGS A;  2L3R A;  2QQA A;  2MWO A;  1KIK A;  4PJO B;  2MIO A;  4FYX B;  1C6V X;  4M75 A;  5GAN 2;  3WVE B;  2W0Z A;  3JV3 A;  2L0A A;  1U8R A;  4J9C A;  2FEI A;  1Q82 U;  2DNU A;  3M0S A;  4JLI A;  3R6O A;  4RG8 A;  5GAM h;  1JBM A;  1M3C A;  1D09 B;  3CD6 A;  2BE9 B;  3M0P A;  1N9R A;  3V7R A;  4P5N A;  3RBB B;  2BKD N;  1VQO Q;  1J3T A;  3I5S A;  5FWC A;  1BIB A;  2M0O A;  3CCE T;  1YJN A;  1I5O B;  1VQ8 T;  3CCJ Q;  3OBW A;  4C8Q F;  1M3B A;  1G3Y A;  2LNV A;  3CC7 Q;  2RI5 A;  2AT1 B;  2DVJ A;  1YBY A;  1BIA A;  1ZQ1 A;  2GCX A;  1G8X A;  2OTJ Q;  1H64 1;  4DOV A;  1JEG A;  1G3W A;  2RQR A;  1VQ4 A;  1IRE B;  3X20 B;  2RHX A;  1NPR A;  4EPC A;  2ED0 A;  3WXM B;  4LDU A;  1VQL A;  1FMV A;  1EFN A;  2FO0 A;  1Y96 B;  1RAF B;  4QQG A;  1GL5 A;  4NL2 A;  3P8D A;  1VQ6 Q;  2FL7 A;  3M0R A;  3AT1 B;  3CC4 Q;  3O5Z A;  2X51 A;  2JTF A;  2R58 A;  3V8J A;  3OYC A;  1LJO A;  3M54 A;  2BZX A;  5FLX E;  1NEG A;  2RF0 A;  1OZ2 A;  3O8V A;  4JRI A;  4LDY A;  1OZ3 A;  3CCU T;  4FYV B;  3G7Z A;  4QVZ A;  1BCM A;  2V26 A;  4XU1 A;  1Y96 A;  3VS4 A;  4FSS A;  3A8M B;  1D1A A;  4X9C A;  5GAN e;  4A4G A;  1MGQ A;  5KCH A;  4FIB A;  2SRC A;  4C0D C;  3JCM Q;  1T3L A;  1YIT A;  2JMC A;  1PD0 A;  5IHI A;  3UWN A;  4A53 A;  2OTL Q;  2P0P A;  1RAG B;  1YJ9 A;  3HTR A;  5IHN A;  2DLP A;  2WSC E;  2DE0 X;  2ATC B;  2DPP B;  3QWX X;  4M77 G;  2DXC A;  4OMF B;  3R6N A;  3CXC A;  2KDS A;  4N4I A;  1QWF A;  3JCM e;  1M90 C;  2YRC A;  2D6F A;  3THK A;  2K3B A;  2GTO A;  3CCR Q;  4OMN A;  4GLM A;  1AWW A;  3I9Q A;  1OX9 A;  2VC8 A;  1PM3 A;  1K9A A;  5HKC A;  2RK1 A;  1K9M C;  1M1K R;  1OPK A;  1KHI A;  5GAN 4;  5CQX A;  1UE9 A;  4PFO A;  2C06 A;  1ZBJ A;  1HSQ A;  1W4S A;  3EG0 A;  5KYX A;  4M77 B;  2COZ A;  2KRN A;  3UA7 A;  4MML A;  1ZSZ A;  1MV3 A;  4LDX A;  5LJ5 h;  2HKQ B;  5GAM g;  4Y91 A;  1AZG B;  1U5S A;  4M7A D;  5FRN A;  3CCM Q;  7AT1 B;  4QQ6 A;  5LJ5 f;  3JRZ A;  4J9F A;  1GCP A;  2ZPI B;  1KC8 U;  5KYN A;  3LH5 A;  3M5A A;  1Q82 C;  4JRP A;  3RES A;  3G71 A;  3LH0 A;  1NJI C;  2PZ1 A;  2EYY A;  1YIJ A;  1QCO A;  2IVW A;  5GJV B;  3UT1 A;  2SEM A;  1BBZ A;  3L2V A;  3VKI A;  1GFD A;  2RQW A;  4QVC A;  4BDY A;  1YWO A;  5GAM d;  3VYG A;  3CD6 T;  2K7A A;  5A0D A;  4M77 A;  2DJQ A;  2M02 A;  4J9D A;  5GAO n;  2KAF A;  3D7S B;  1MMN A;  2E5K A;  4M75 D;  2LDM A;  1VQN A;  4ESR A;  2D0Q B;  4BE0 A;  1QKX A;  2Y4Y A;  2J6K A;  4C8Q C;  4BY6 C;  4B9W A;  1D1B A;  4J5Y A;  1OOT A;  3CPW A;  4NS5 A;  3LWI A;  2RM4 A;  4HCZ A;  1KFZ A;  2DZ9 A;  2HQE A;  1VQ4 T;  1WJR A;  2LRQ A;  5CK9 A;  1CKB A;  4OB2 B;  1VQL T;  2JS2 A;  2DER A;  1YN8 A;  2J6O A;  4B6M A;  1K1Z A;  2X4Y A;  2HQH A;  2M1H A;  2RQV A;  3A5Z B;  4RG2 A;  1JXM A;  1NG2 A;  4CC2 A;  5L23 A;  4IUP A;  2JOY A;  4CRI A;  4RTW A;  1Q86 R;  1AWO A;  1OUL A;  3MEA A;  4D6W A;  1WJQ A;  3OY9 A;  1ARK A;  4WF2 A;  1WHG A;  1N9S A;  1BKB A;  2IPO B;  4J7I A;  2JTM A;  2NUZ A;  2HBP A;  4RTY A;  4C5H A;  3NTH A;  3QYG B;  1W6X A;  5FRO A;  4CC3 A;  1WFW A;  2ROL A;  2X9H A;  5GAN 3;  2ED1 A;  5IXB A;  1AEY A;  1PD1 A;  1M2V B;  1M2O A;  5GMK m;  2CGH A;  1IGU A;  1B34 A;  3QSU A;  2GFA A;  1MUZ A;  1OYX A;  3VRY A;  2JMA A;  3PMI A;  3JCM h;  3S6W A;  2L3Q A;  1SG5 A;  3E2U A;  4E2F B;  2KE9 A;  3VS7 A;  5A0L A;  1YHQ A;  2CT3 A;  3JCM P;  1GBR A;  1YIT T;  1WNL A;  2KK4 A;  1WQ7 A;  1RI9 A;  3LLR A;  5A0G A;  1UGQ B;  4GLK A;  1YJ9 T;  4NL3 A;  4MDW A;  4R55 A;  2LJ1 A;  4AFS C;  4F7U E;  3FIF A;  1ZLM A;  3ME9 A;  4XU3 A;  1UJY A;  4C0G A;  2EGA A;  1WHH A;  1M2V A;  2EYQ A;  1IHV A;  1HYO A;  3GLX A;  1M90 R;  2V1Q A;  1YFN A;  2GQV A;  4FW1 A;  1X6G A;  6AT1 B;  1G3S A;  1Z9Z A;  5CIU A;  3L42 A;  4LD6 A;  5CAI A;  2B86 A;  1K9M R;  4LUD A;  4PJM A;  4FT4 A;  4F7U G;  3UDC A;  1KC8 C;  2E3I A;  3A98 A;  2ZPF B;  1ZBX A;  5DY9 A;  1K8A U;  1GCQ C;  4Y28 E;  1DJ7 B;  2PQW A;  3HRU A;  2YWW A;  1WHK A;  1PHT A;  4MZT A;  1ABQ A;  3G71 T;  3EAE A;  1KK7 A;  2KI7 A;  1PRM C;  1WIE A;  1X75 C;  1JO8 A;  1YIJ T;  3CCL Q;  2RHI A;  3CCV Q;  1Q82 R;  4EDU A;  5LL6 S;  4F7U B;  1NJI R;  3MP1 A;  2MYS A;  1OX8 A;  1K76 A;  3PIP A;  2AZV A;  2DA9 A;  4M7D C;  3VS6 A;  4JS5 A;  3TRE A;  1QCN A;  5IXF A;  4JRQ A;  1C1A A;  1VQN T;  2YUO A;  2F69 A;  4Z89 A;  1M9S A;  3CCQ A;  4LE9 A;  3QHS A;  4N4G A;  4ZNX A;  3VU3 C;  4K11 A;  3CCE Q;  1MND A;  1VQ8 Q;  3JAM E;  5GAN g;  3NPF A;  1UGV A;  3EFR A;  2D9T A;  3J7A F;  4M77 D;  2DAQ A;  3LX7 A;  5HCK A;  1WYX A;  4Z02 A;  5GMK i;  2LQN A;  3SWN C;  4DBH A;  4E7S A;  2KY9 A;  2BUD A;  2DET A;  5KYY A;  3OS0 A;  1M30 A;  1AD5 A;  2KT1 A;  2O9V A;  4M7A E;  1R0C B;  3JCM V;  3CC2 T;  1IGQ A;  1U06 A;  1VYU A;  3JCM g;  4A4F A;  4KH1 B;  5GAN d;  3JCM X;  3CPW S;  1JJ2 A;  3ZBD A;  3RMQ A;  2A08 A;  4RMO A;  1KD1 U;  2E6N A;  4RUG A;  3MP8 A;  2DXT A;  1RLQ C;  2V8J A;  1AT1 B;  1M8M A;  2OAU A;  3TSZ A;  1LVK A;  4XTZ A;  3M58 A;  2RH2 A;  1KQ1 A;  5LJ3 j;  2CH4 W;  3JCM d;  4M7A G;  4LD9 K;  3REB B;  1VYV A;  3CCU Q;  2EQU A;  5CQY A;  3LW5 E;  1YHQ T;  4JLG A;  5L8R E;  3OSS C;  4BDZ A;  4M75 E;  1KQS A;  3I55 Q;  3I56 A;  3NHN A;  3NTK A;  4N0A A;  4IKF A;  2RK2 A;  3JSC A;  1B07 A;  3PTA A;  1EX4 A;  3JB9 I;  2PU9 B;  2VUB A;  4DOW A;  1WJS A;  4FU6 A;  2LP5 A;  2O31 A;  3OSV A;  1FMW A;  4ORZ A;  2OX7 A;  2RHU A;  4IUT A;  2VAS A;  2YT6 A;  4M7A B;  5LJ3 e;  4XK8 E;  5AYF A;  2AKK A;  3TCJ A;  5FW9 A;  3ASK A;  4MZM A;  1JXO A;  2CH4 A;  1VQM Q;  2K2V A;  4F7U F;  2WSE E;  4HT8 A;  4MMK A;  1I1J A;  2BIV A;  1W2B P;  3J81 E;  2K3X A;  2DX1 A;  1K8A C;  2JVV A;  2BZY A;  2F5T X;  2RHZ A;  2Y90 A;  2LX7 A;  2XI9 A;  3FC3 A;  1NLO C;  5CKE A;  1AHJ B;  3OW2 P;  2HBW A;  2A3L A;  2YSQ A;  2A7Y A;  2HQX A;  1OV3 A;  3EGU A;  4L5G A;  3MO8 A;  2V1R A;  4C5E A;  4PLI A;  1H3H A;  4DBF A;  4ATO A;  3VS3 A;  2QI2 A;  2RPN A;  2K3Y A;  2XDB A;  4M7A A;  3I5R A;  4Y92 A;  4RTX A;  2KSS A;  2B8A A;  1Q81 R;  1I81 A;  2HMA A;  3OYA A;  1CKA A;  3OYG A;  1JQQ A;  4C8Q A;  5GAO m;  3I35 A;  1WX6 A;  5EC7 A;  4EMK C;  3OB9 A;  3DKM A;  8ATC B;  1K0S A;  1NE8 A;  2COY A;  1RI0 A;  4J6Y A;  1OPL A;  1KHC A;  4OMQ A;  3G4S A;  3HL8 A;  4KGZ B;  3CD6 Q;  1QLY A;  1QQJ A;  2L89 A;  3CCQ T;  2HEQ A;  3PVQ A;  3MP6 A;  1TSF A;  3RR6 A;  3JCM c;  5I11 A;  2CUB A;  2YHT A;  2E1H A;  3TU4 K;  3ZL7 C;  1T0H A;  4PJL A;  1GBQ A;  3NFC A;  2FZG B;  4GY5 A;  1W2B S;  1X01 A;  1FXX A;  3PE0 A;  3GF5 A;  2JTE A;  1VQP A;  5GAM f;  4WCI A;  3RKW A;  2ZPG B;  1K73 U;  3OW2 S;  1Q95 G;  4PNO A;  1KQS P;  1YCS B;  2QYZ A;  4HT9 A;  2LX9 A;  2V8I A;  1KD1 C;  2JXB A;  1VQL Q;  2FRY A;  1SF9 A;  4M78 A;  4GBQ A;  3UAT A;  1N8R U;  1CSK A;  5I2M A;  3QG1 A;  4O5V A;  3INZ A;  3HP9 A;  1OEB A;  3CME A;  1P92 A;  2PUK B;  3OYD A;  2JUF A;  2CP6 A;  5KYU A;  1QVF P;  4BAC A;  4LDV A;  2RB6 A;  3URG A;  5I2S A;  1PG5 B;  2JW4 A;  1Y0M A;  5DLQ E;  4FL6 A;  5GAN j;  2MCN A;  5LJ3 h;  1JJ2 S;  2DL5 A;  3P8H A;  4D8D A;  1B3Q A;  4DBQ A;  5KE3 A;  4IUU A;  3GIB A;  3I56 T;  4HCC A;  2E6Z A;  4J6W A;  2QXF A;  2CP0 A;  3OMC A;  2RJC A;  4HCK A;  3OYJ A;  3MPU B;  2KEA A;  5FU7 B;  1YIT Q;  1VQ5 A;  2WSF E;  2LC4 A;  2OTJ A;  4M77 E;  4M75 F;  1HD3 A;  1RL2 A;  1YJ9 Q;  1D0Y A;  3C12 A;  4XQ3 A;  3UA6 A;  2PNI A;  2ECZ A;  3PIO A;  2XDP A;  3V8K A;  2LT1 A;  1KQS S;  2ZPB B;  1YJW Q;  3L2Z A;  2EWN A;  2JT4 A;  4FT2 A;  5KYX B;  2IG0 A;  4X9D A;  3CC4 A;  4KT0 E;  2CT4 A;  1ZSZ B;  1K8A R;  4M7D A;  1N27 A;  3JCM b;  4PJO F;  1GXI E;  2K57 A;  4KRT A;  2RA2 A;  2E41 A;  2RMO A;  2CS7 A;  4LXC A;  2KYB A;  4OMP A;  2HNI A;  5EG2 A;  4MDX A;  3BDL A;  1ZA1 B;  3CBM A;  2QTV A;  1G3T A;  3OQ5 A;  1UUE A;  2NWM A;  4BE2 A;  4AFZ C;  4BUG A;  3M0Q A;  3H6Z A;  4OMM A;  2K5I A;  4C92 A;  3S3O A;  3RKY A;  3SWN A;  3EG9 A;  1E6H A;  1QMC A;  2FYK A;  2OTL A;  2DMO A;  1FX7 A;  3G4S T;  4XAX B;  2L2P A;  5GAO l;  2JN0 A;  1R8O B;  3BFM A;  1RAB B;  1SPK A;  4C8Q D;  3QKJ A;  1ZX6 A;  4HA8 A;  4MZP A;  4X1V A;  5GJW B;  3RDV A;  1KJW A;  1UEB A;  4IUR A;  4JRK A;  2DZC A;  2DK3 A;  4OB3 B;  4QVD A;  2BTT A;  4PLL A;  1MNE A;  1OU8 A;  1VQN Q;  2GFU A;  3OYH A;  1D3B A;  4C0F A;  1RAE B;  4L6V 5;  3QZ9 B;  1V76 A;  4UC4 A;  2A28 A;  1X2Q A;  1VQP T;  1YI2 A;  4FM4 B;  2RHY A;  4A63 B;  1N8R C;  5GAN 7;  2M9U A;  3MJX A;  2PVO B;  3C4S A;  1YJN T;  4DEX A;  2VGM A;  1RAH B;  1OU9 A;  3H0I A;  2D1X A;  2W10 A;  3X28 B;  3SFM A;  4BD3 A;  2ZGW A;  4QQD A;  5LJ3 g;  1KD1 R;  2VGN A;  3CC2 Q;  2EYX A;  1MMG A;  3CME T;  1D0X A;  2ENM A;  2EQI A;  3VS5 A;  2EPD A;  2K5F A;  2O88 A;  1B34 B;  5KYW A;  4BE1 A;  4QKU A;  2K6D A;  1NM7 A;  1BYM A;  1ZUY A;  1M5Q 1;  2YRD A;  3C95 A;  3RUX A;  1SRL A;  3Q1J A;  3QJ6 A;  1Y07 A;  5A2Q E;  4M78 D;  2MWP A;  1EIF A;  1T3S A;  2ABL A;  5LJ3 d;  3DB3 A;  4X34 A;  2DF6 A;  4M4Z A;  4JDS A;  2CP5 A;  5GAO r;  1UGS B;  5GAN h;  2LNH B;  2O4X A;  1ABO A;  4ANJ A;  5GAN f;  1YHQ Q;  3BY7 A;  1KG1 A;  3V8L A;  3OA6 A;  2DRK A;  4BI3 A;  5IAY A;  3RIR A;  3G6E A;  2YRV A;  3MKD A;  1M27 C;  2LMJ A;  1R77 A;  3FLG A;  2V8K A;  4L59 A;  2IIM A;  1VQ5 T;  3OBY A;  3JB9 D;  5D7U A;  2OTJ T;  2KVQ G;  5CVI A;  4M75 C;  3V7C A;  2LCS A;  3QXE B;  2RN8 A;  3VUZ A;  1ZUU A;  4RTZ A;  3QII A;  2C0T A;  4A4E A;  3EHQ A;  4RCC A;  3JCM f;  3N5B B;  9ATC B;  4JJB A;  1MMA A;  4M77 F;  2DYB A;  4EMK A;  3OYM A;  4J9H A;  1VQK A;  1TU0 B;  3CC4 T;  2EVR A;  3HHT B;  3BE3 A;  5C0M A;  3X26 B;  1RUW A;  1X69 A;  2MPX C;  1V29 B;  2E10 A;  3M4G A;  3OYE A;  1NYG A;  3X25 B;  3OS5 A;  3M0T A;  3HSB A;  2VKN A;  2JJ9 A;  4PJO C;  1FWZ A;  2CDT A;  2CP7 A;  2QGF B;  2E3H A;  4Z88 A;  5I21 A;  1E6G A;  2EGC A;  1WXB A;  4VUB A;  1UGR B;  1ZA2 B;  2I0N A;  2M51 A;  4M7D D;  2XG8 D;  4FSX A;  3GOX A;  2LQW A;  5KH6 A;  3TSW A;  2C0O A;  2DIL A;  3M4Y A;  4R56 A;  3SB2 A;  3L2W A;  1M4Z A;  1WDX A;  1WHM A;  4KUL A;  2KBT A;  1NYF A;  1WXT A;  4A54 A;  2CSQ A;  1ZHI A;  3QDR B;  4PFZ A;  3CCQ Q;  2X4J A;  4FCY A;  4C92 D;  1PCX A;  1H8K A;  1W2B A;  1YI2 T;  2GTJ A;  4AFQ C;  5KYY B;  1QP3 A;  2J7I A;  1V1C A;  3QUI A;  2DM1 A;  4J9B A;  4KBM B;  2DBK A;  3OW2 A;  3E9G A;  2HL3 A;  1JB0 E;  3MEV A;  2VYT A;  1WLP B;  1N8R R;  2CZ0 B;  2QQ9 A;  1VIE A;  5GAN 6;  4PL6 A;  1SHG A;  5CKD A;  2A37 A;  3MHX A;  2QK0 A;  5D6X A;  1I8F A;  4JZ4 A;  2EKH A;  3A8O B;  1N6A A;  4OB0 B;  1QKW A;  1Z9Q A;  3PMT A;  3CCL A;  1VQ9 A;  3CCV A;  2DVE A;  1QVG A;  1M8V A;  2LZ6 B;  2CZ7 B;  2H8H A;  2YUN A;  2CKK A;  4J8O A;  1SEM A;  4C5G A;  2DJZ A;  3OS1 A;  3ZEH A;  2ZAE A;  4C8Q E;  1UJ0 A;  1TUC A;  2KXD A;  2P0K A;  4OGC A;  1Y7X A;  3M53 A;  2DD4 A;  2CRE A;  1AVZ C;  2EQK A;  2FZK B;  1TOV A;  4XTU A;  2XD0 A;  2X4X A;  1W70 A;  3G6E T;  3DLL A;  3I56 Q;  4KUI A;  2KYM A;  2ZCF B;  2KMT A;  2HDA A;  3OYL A;  1D0Z A;  2DD5 A;  2GQI A;  3MEU A;  1YNZ A;  3TQ7 P;  4BB7 A;  4C8Q G;  4F14 A;  1LCK A;  4JS4 A;  2KRS A;  3CMA A;  4OP0 A;  1TXQ A;  3NMZ C;  2F1L A;  1VQK T;  4M77 C;  4J9E A;  1M1G A;  3ULR B;  3RNJ A;  2FG0 A;  3VS1 A;  3VRZ A;  3CCS A;  1RAC B;  5GMK l;  1BCO A;  2EKO A;  4JZ3 A;  3H8Z A;  2JM9 A;  1QP2 A;  2VWF A;  3OMG A;  1S72 A;  2XID A;  3BDU A;  3AHU A;  4KUD K;  2YUQ A;  1Q86 U;  4C8Q B;  4BY6 B;  1QVF A;  4B9X A;  5CKH A;  4FW2 A;  1X2K A;  1FYN A;  2QDL A;  4M78 E;  1WXU A;  2JS0 A;  2ZPE B;  3H9N A;  2L3S A;  3EGX A;  3CBP A;  2R5A A;  5FRM A;  4N4H A;  1NLP C;  2QGG A;  3EGD B;  3VV0 A;  3TVT A;  2DBM A;  3I55 A;  1H3Z A;  4LNP A;  2F5K A;  2LJ0 A;  3L2R A;  1IO6 A;  2BZ8 A;  4E6R A;  1KC8 R;  3MCA B;  3SD4 A;  4BI4 A;  1O9S A;  3HRS A;  2QQS A;  2H3J A;  1XJW B;  2RI3 A;  3M0U A;  4RTU A;  3T9N A;  1Q7Y U;  3E9F A;  2E65 A;  1OI1 A;  5IH2 A;  2NUP A;  4M78 G;  3G4S Q;  3A8L B;  1WHL A;  3WVD B;  3OYK A;  2GF7 A;  1QVG P;  2QA4 A;  3PVL A;  4OVA A;  3OYI A;  1QCF A;  2DXU A;  1VQM A;  4PJN A;  1TUG B;  1NBE B;  1KQ2 A;  2A0F B;  3KUF A;  2C0I A;  3EGD A;  3GBQ A;  3M59 A;  4NOY A;  1WI7 A;  1FMK A;  4EIK A;  3JB9 G;  2RNA A;  2QEX A;  1VYT A;  2KNB B;  1M90 U;  3FEO A;  5GAO p;  4M78 B;  4IUQ A;  3UF4 A;  3FRN A;  2GBQ A;  3GPL A;  2O9S A;  4DQ2 A;  5LJ5 j;  1BB9 A;  1K9M U;  1YJN Q;  2MF2 A;  2J05 A;  1F1B B;  2DL3 A;  2X4W A;  1UHC A;  3E1S A;  5KYU B;  1I07 A;  2QDY B;  3CCL T;  1G2B A;  3LGF A;  1VQ9 T;  3CCV T;  1LOJ A;  1VQ7 A;  4M7D E;  2CYZ B;  4RTT A;  3CME Q;  1VQ4 Q;  4HXJ A;  5KCO A;  4DEY A;  1U1S A;  1G5V A;  1NJI U;  5LJ5 e;  2EIF A;  3NGP A;  4KH0 B;  5IHK A;  1GRI A;  3S3N A;  4ZN3 A;  4BI8 B;  2QG9 B;  4CI0 C;  3F70 A;  3EFO A;  2KRM A;  4PJJ A;  2RO0 A;  4M7A F;  5C6S A;  1HXD A;  1QVG S;  1PWT A;  4C92 E;  4M7D G;  4ZN1 A;  2P0Q A;  1PKT A;  4YTL A;  3QYH B;  2DKG A;  4PJO A;  4LN2 A;  1BI0 A;  5M9O A;  1WHJ A;  1VQ5 Q;  1NPP A;  3EG1 A;  5FU6 B;  2DTO A;  1UTI A;  1JRI A;  2D8H A;  1VQO A;  2XHC A;  2L8D A;  3A8H B;  1JU5 C;  5LJ3 f;  3SHW A;  3CMA T;  1GFC A;  4ZGE B;  1X43 A;  4E7H A;  2D0N A;  1UHF A;  3CCJ A;  1AWJ A;  1R0B G;  4XU2 A;  2DTH A;  2P4R A;  2RD1 A;  5J3B A;  3CCS T;  4M7D B;  2L3P A;  4QW2 A;  4C92 G;  3CC7 A;  1Q86 C;  2DIG A;  3OYF A;  4C5I A;  1Y71 A;  2K4Y A;  1GCQ A;  1S72 T;  3QBY A;  3FDR A;  3A8G B;  4JJD A;  3V7S A;  2YDL A;  3PGG A;  1RAI B;  1XOV A;  3VUB A;  3VJP A;  2VXE A;  3M56 A;  4XTX A;  1VQ6 A;  2LQK A;  2DEU A;  3JCM W;  2RI2 A;  5CCA A;  4C92 B;  3SWN B;  3EG9 B;  3I55 T;  1Q7Y C;  2GNC A;  3EH1 A;  3NTI A;  4M78 F;  3KXT A;  1EZZ B;  1D1C A;  1ZUK A;  2AKL A;  1HK9 A;  2PUO B;  3PFS A;  1QVF S;  2M16 A;  4OF1 A;  5IT9 E;  4CC7 A;  2HCK A;  4JJC A;  4KGX B;  3VS2 A;  5AT1 B;  1ZSG A;  1D3B B;  1G83 A;  2QA4 T;  3G71 Q;  4CC4 B;  3OYB A;  3JB9 F;  1VQM T;  2K9G A;  2Z0W A;  1YJW A;  3M55 A;  1YIJ Q;  4JUV A;  2GGR A;  1QVP A;  2DIQ A;  3FJP A;  4O6J A;  2KQW A;  2L5Q A;  2QEX T;  2AHJ B;  4DBR A;  4J7F A;  4RTV A;  4IIO A;  5GAN 8;  2MI6 A;  1XNI A;  1UFF A;  1YI2 Q;  2YUP A;  4N0A C;  3KFV A;  4ZGJ B;  2JM8 A;  4IUV A;  2OAW A;  2EGE A;  1SRM A;  3CCR A;  1IRX A;  1XQH A;  4HVU A;  1K73 C;  3EH2 A;  1H92 A;  1UGP B;  4F04 B;  1C0M A;  3FB9 A;  2EJF A;  1K0X A;  5KYW B;  5D6W A;  2K2M A;  1VQ7 T;  4E47 A;  1Q81 U;  8AT1 B;  5DM7 R;  2FPD A;  3A1P A;  4XU0 A;  2LQ8 A;  2EYZ A;  2NUT B;  2LJ3 A;  2A36 A;  3CCM A;  2O4X B;  2EAY A;  4J83 A;  2FVU A;  4PKC C;  1NZ9 A;  4M7D F;  1IHW A;  1YP5 A;  4EMG A;  3MET A;  2AK5 A;  3QO3 A;  2LCL A;  3EFS A;  2HKN A;  2RJF A;  2CP3 A;  4EMH A;  4M7A C;  3G6E Q;  3BW1 A;  3LWH A;  1PC0 A;  4R0K A;  3LYI A;  1VQO T;  1PNJ A;  2EFI A;  5CKB A;  4EMK B;  3CBO A;  4C92 F;  2DRM A;  2NUT A;  5KE2 A;  2FPF A;  4WTO B;  2Y4X A;  1OQK A;  3CCJ T;  3QPH A;  1KSW A;  2EBP A;  1RAA B;  2NLU A;  1LNX A;  2F2W A;  4AG1 C;  3CC7 T;  2LCC A;  1U3O A;  4F16 A;  2BE7 D;  4V2S A;  3L2Q A;  4AFU C;  4PJO D;  1VQK Q;  4A4H A;  3CC2 A;  3U23 A;  2COW A;  2G6F X;  2ROT A;  1X6B A;  1A0N B;  1RAD B;  1E7O A;  2XU8 A;  3M9Q A;  3CXC P;  5I22 A;  5GMK j;  5IN1 A;  1IXD A;  1VUB A;  3S3M A;  2CSI A;  1AOJ A;  1WZO A;  2ZPH B;  4A4K A;  1VQ6 T;  2HAX A;  2FZC B;  2X35 A;  4AT1 B;  3H0F A;  4J9G A;  1PSE A;  4OMO A;  2YLB A;  3FJ5 A;  2DXB A;  1X27 A;  4PFP A;  4KGV B;  3HRT A;  1BU1 A;  2FHD A;  4E7K A;  3L2U A;  2J06 A;  2DFU A;  2FPE A;  4M78 C;  5CKF A;  1Q7Y R;  2D8J A;  3PNW C; 
#chains in the Genus database with same CATH homology
 1SSH A;  2JTE A;  2RQT A;  2KRN A;  2DL4 A;  2GQI A;  4WCI A;  3UA7 A;  1YNZ A;  1MV3 A;  1YCS B;  2DL7 A;  1AZG B;  1U5S A;  2JXB A;  4F14 A;  1LCK A;  2KRS A;  1I0C A;  1RLP C;  4J9F A;  2FRY A;  1GCP A;  3LH5 A;  3NMZ C;  4GBQ A;  3UAT A;  1CSK A;  2F2V A;  4J9E A;  2PZ1 A;  3ULR B;  3RNJ A;  2EYY A;  2FG0 A;  3VRZ A;  3VS1 A;  4JZ3 A;  5GJV B;  2JM9 A;  2SEM A;  1OEB A;  1BBZ A;  3EHR A;  3SEM A;  2VWF A;  1GFD A;  2RQW A;  1YWO A;  2YUQ A;  1PRL C;  1T0J A;  2K7A A;  4F17 A;  3QWY A;  2JW4 A;  2DJQ A;  1Y0M A;  1X2K A;  1FYN A;  2HSP A;  2QDL A;  1WXU A;  2JS0 A;  1TG0 A;  4J9D A;  1PKS A;  2L3S A;  2MCN A;  1UDL A;  1WA7 A;  2DL5 A;  2E5K A;  4D8D A;  1B3Q A;  1SHF A;  2MOX A;  4ESR A;  1NLP C;  4JPB W;  1QKX A;  2CUD A;  2J6K A;  3TVT A;  2DBM A;  4LNP A;  1OOT A;  1QWE A;  1K4U S;  4HCK A;  2LJ0 A;  1KFZ A;  1S1N A;  2KEA A;  1IO6 A;  2BZ8 A;  5ECA A;  4E6R A;  1NEB A;  1HD3 A;  1CKB A;  3M0U A;  4RTU A;  2JS2 A;  1UEC A;  1YN8 A;  2J6O A;  5IH2 A;  1K1Z A;  3UA6 A;  2RQV A;  2PNI A;  2ECZ A;  2OI3 A;  1JXM A;  1NG2 A;  3PVL A;  4CC2 A;  5L23 A;  1QCF A;  2JT4 A;  1BK2 A;  2DL8 A;  1AWO A;  4RTW A;  2CT4 A;  4QT7 A;  2C0I A;  1ARK A;  3GBQ A;  1WI7 A;  2NUZ A;  1FMK A;  4EIK A;  2RNA A;  1VYT A;  2EW3 A;  2KNB B;  2X3W D;  1YWP A;  4RTY A;  2EYW A;  3UF4 A;  2O2O A;  4KRT A;  1M3A A;  2GBQ A;  1W6X A;  2RMO A;  3EG0 A;  4CC3 A;  1WFW A;  2ROL A;  2ED1 A;  5IXB A;  1AEY A;  2O9S A;  2FRW A;  1BB9 A;  2KYB A;  2KT8 A;  4OMP A;  1MUZ A;  3VRY A;  2JMA A;  2L3Q A;  2J05 A;  2KE9 A;  4LUE A;  3VS7 A;  2DL3 A;  1W1F A;  2CT3 A;  1UHC A;  1MV0 B;  1GBR A;  1I07 A;  1UUE A;  2NWM A;  1G2B A;  4AFZ C;  1RI9 A;  3M0Q A;  2J6F A;  2VVK A;  4OMM A;  4RTT A;  1E6H A;  2LJ1 A;  4AFS C;  4HXJ A;  2DMO A;  2KRO A;  3C0C A;  1ZLM A;  2L2P A;  2AZS A;  4DEY A;  1N5Z A;  1TUD A;  1SPK A;  1UJY A;  1AZE A;  2EGA A;  3NGP A;  1ZX6 A;  3EG3 A;  1GRI A;  4J9I A;  5IHK A;  4X1V A;  5GJW B;  1KJW A;  2RQU A;  4D8K A;  2BTT A;  2KRM A;  2V1Q A;  2KXC A;  1X6G A;  1PWT A;  1Z9Z A;  1PKT A;  4HVW A;  2B86 A;  3REA B;  2A28 A;  1X2Q A;  4LUD A;  4LN2 A;  2F2X A;  4A63 B;  3A98 A;  2M0Y A;  3EG1 A;  1VA7 A;  1UTI A;  4DEX A;  3VS0 A;  1GCQ C;  2D8H A;  2KGT A;  3H0I A;  2ESW A;  2D1X A;  2W10 A;  1JU5 C;  3SHW A;  1GFC A;  1PHT A;  2K79 A;  3H41 A;  1X43 A;  2D0N A;  1ABQ A;  1UHF A;  1AWJ A;  4AG2 C;  2P4R A;  1PRM C;  1WIE A;  1JO8 A;  2L3P A;  4IIM A;  2EYX A;  1GCQ A;  2XMF A;  2ENM A;  2EQI A;  3VS5 A;  2EPD A;  1K76 A;  2O88 A;  3CQT A;  4JJD A;  2K6D A;  4HVV A;  2YDL A;  1NM7 A;  1ZUY A;  4Z8A A;  1SRL A;  2AZV A;  2DA9 A;  1XOV A;  3VS6 A;  1T3S A;  2ABL A;  2DF6 A;  4M4Z A;  5IXF A;  1HJD A;  2YUO A;  1UG1 A;  4Z89 A;  2OJ2 A;  2LNH B;  4LE9 A;  4ZNX A;  1ABO A;  4K11 A;  3IQL A;  2DRK A;  2GNC A;  1M27 C;  2LMJ A;  2IIM A;  3NPF A;  1UGV A;  4OML A;  2X3X D;  1ZUK A;  2AKL A;  5HCK A;  1Y57 A;  1WYX A;  2LQN A;  2LCS A;  4CC7 A;  2KR3 A;  2HCK A;  4JJC A;  2RN8 A;  3VS2 A;  1ZUU A;  4RTZ A;  1AWX A;  5FWB A;  2PTK A;  1ZSG A;  1M30 A;  1AD5 A;  2KT1 A;  2C0T A;  3EHQ A;  1G83 A;  2O9V A;  3H0H A;  4CC4 B;  3EG2 A;  4JJB A;  1U06 A;  1VYU A;  2DYB A;  2K9G A;  4J9H A;  1KIK A;  2MIO A;  2EVR A;  2GGR A;  2A08 A;  1RUW A;  2W0Z A;  4RUG A;  1X69 A;  3JV3 A;  2L0A A;  1NYG A;  1RLQ C;  2FEI A;  1M8M A;  2DNU A;  3M0S A;  4IIO A;  4J9C A;  4RTV A;  3TSZ A;  1UFF A;  3M0T A;  2VKN A;  2YUP A;  1M3C A;  3KFV A;  2CDT A;  2JM8 A;  3M0P A;  4Z88 A;  2CH4 W;  2OAW A;  2EGE A;  1SRM A;  3RBB B;  1J3T A;  3I5S A;  5FWC A;  3REB B;  1VYV A;  4HVU A;  1E6G A;  2EGC A;  1H92 A;  1WXB A;  1K0X A;  2I0N A;  2K2M A;  3NHN A;  2M51 A;  1M3B A;  2LQW A;  3TSW A;  1B07 A;  2C0O A;  2DVJ A;  2DIL A;  2FPD A;  1JEG A;  2LP5 A;  2O31 A;  2RQR A;  2EYZ A;  4ORZ A;  2LJ3 A;  1WDX A;  2A36 A;  2ED0 A;  2YT6 A;  2FO0 A;  1EFN A;  1GL5 A;  2AKK A;  1YP5 A;  5FW9 A;  2KBT A;  1NYF A;  1JXO A;  1WXT A;  2CSQ A;  2AK5 A;  2CH4 A;  3M0R A;  3PE0 A;  1I1J A;  3O5Z A;  2DX1 A;  2BZY A;  1H8K A;  2LX7 A;  1NLO C;  2GTJ A;  2HBW A;  4AFQ C;  2YSQ A;  2BZX A;  1OV3 A;  3EGU A;  1NEG A;  2J7I A;  1V1C A;  2RF0 A;  2V1R A;  2DM1 A;  4R0K A;  4J9B A;  2DBK A;  1H3H A;  1PNJ A;  3VS3 A;  2RPN A;  2DRM A;  1WLP B;  2FPF A;  3I5R A;  4Y92 A;  4RTX A;  1SHG A;  1KSW A;  2A37 A;  1CKA A;  2EBP A;  1JQQ A;  3VS4 A;  4FSS A;  2F2W A;  4AG1 C;  4F16 A;  1U3O A;  3I35 A;  1WX6 A;  4JZ4 A;  2EKH A;  4AFU C;  1QKW A;  1Z9Q A;  5EC7 A;  2SRC A;  1T3L A;  2JMC A;  3U23 A;  1K0S A;  5IHI A;  2G6F X;  2ROT A;  1X6B A;  1A0N B;  1E7O A;  2LZ6 B;  5IHN A;  2DLP A;  5I22 A;  2DE0 X;  1OPL A;  2H8H A;  3QWX X;  2CSI A;  2YUN A;  1AOJ A;  4OMQ A;  1SEM A;  3R6N A;  1QLY A;  3H0F A;  4J9G A;  1QWF A;  4OMO A;  1UJ0 A;  2HEQ A;  3PVQ A;  3THK A;  2K3B A;  2GTO A;  1TUC A;  2KXD A;  3FJ5 A;  4GLM A;  2CRE A;  4OMN A;  1AWW A;  1AVZ C;  3I9Q A;  1X27 A;  5I11 A;  1K9A A;  1W70 A;  2CUB A;  1BU1 A;  1OPK A;  3ZL7 C;  1T0H A;  1GBQ A;  2KYM A;  2J06 A;  2FPE A;  1UE9 A;  1ZBJ A;  1HSQ A;  2HDA A;  2D8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...