1V1CA

Solution structure of the sh3 domain of obscurin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
IFDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBSCURIN
publication title Solution Structure of the SH3 Domain of Obscurin
rcsb
source organism Homo sapiens
molecule tags Sh3-domain
total genus 4
structure length 68
sequence length 68
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1v1cA00
3U23A 2W0ZA 1KIKA 2JMCA 2D1XA 1JEGA 5FWBA 1UDLA 2CUBA 2JM8A 2K2MA 4Z8AA 1GBRA 2JMAA 2O9SA 1JO8A 2A28A 1HSQA 4RTTA 3A98A 1Y0MA 3M0RA 1X6GA 1RUWA 1AWOA 1Y57A 1NG2A 3UF4A 4RTVA 2KRSA 1UGVA 2OAWA 2DJQA 4CC4B 1SHGA 3VS3A 2FEIA 2ABLA 2X3XD 1YP5A 2J06A 4M4ZA 4R0KA 2DBMA 1WI7A 1N5ZA 2A37A 2KYBA 1NLOC 1CKBA 5GJVB 2C0IA 2L2PA 1M3CA 1AWWA 5IXFA 2VKNA 1VYVA 2YUQA 1UFFA 4X1VA 2K79A 3O5ZA 1CSKA 1VYUA 1JXMA 4DEXA 1M30A 2O31A 3EG1A 2DM1A 1YN8A 4JZ4A 2KT1A 2FRYA 3UA6A 2YUPA 2D8JA 1G83A 1WX6A 1YWOA 2KXCA 2HDAA 1KJWA 3QWXX 4RTZA 1GCPA 3VS1A 1BBZA 3I5RA 2GNCA 1SPKA 3CQTA 3VS5A 4FSSA 2HSPA 2EYWA 2V1RA 2KNBB 2ED0A 5IHNA 1H3HA 4EIKA 1YWPA 1M8MA 2EGCA 1PWTA 1I1JA 4J9DA 5GJWB 2L3PA 2EQIA 1K4US 1MV0B 1UHCA 1OEBA 2JTEA 1K0SA 2V1QA 3EHRA 3NGPA 3SHWA 3RBBB 2J6FA 2LP5A 2AK5A 2J6OA 2EBPA 3EGUA 1RLPC 1UE9A 2KE9A 1U3OA 2L3SA 3H0IA 5I22A 3TSWA 3I35A 2IIMA 1K9AA 2GBQA 1ABQA 1ZUUA 2RQVA 3PVLA 4J9EA 3R6NA 2KXDA 1T3SA 1UECA 4KRTA 1ZLMA 2RQWA 2K7AA 2W10A 1MUZA 3EG0A 5I11A 2G6FX 1X2QA 2ENMA 2KT8A 4IIOA 1BB9A 2EYXA 3TVTA 1E6GA 1Z9QA 3LH5A 2O88A 5ECAA 1AOJA 1VYTA 4JJBA 1ABOA 1GCQC 1QWEA 1OPKA 1ZUKA 5IHIA 4D8KA 2PNIA 1NM7A 1ZBJA 4JPBW 2DA9A 3M0PA 2DL3A 4JJCA 1WYXA 1IO6A 1Z9ZA 4J9IA 4ZNXA 1EFNA 2FPDA 4CC7A 1SRMA 2M51A 2CSQA 2L3QA 4OMOA 1E7OA 1AEYA 2CT4A 3FJ5A 2D0NA 4LUDA 2ROTA 2KRMA 1QKXA 2EPDA 1UG1A 2ESWA 4DEYA 4JJDA 2CH4A 2A08A 1K76A 3KFVA 4HCKA 2EGEA 2K3BA 4AFQC 1UJYA 1A0NB 1W1FA 3UATA 2MOXA 1XOVA 2LCSA 2DVJA 3I9QA 1ZX6A 1QWFA 2KEAA 1V1CA 2HCKA 4LUEA 5L23A 1SEMA 1SHFA 4AG1C 2X3WD 2H8HA 1RI9A 2AKLA 4RTUA 3REBB 4IIMA 4F16A 1U5SA 4J9FA 1I0CA 1NEGA 3M0TA 1B07A 1M3AA 2J7IA 2C0OA 5HCKA 1BK2A 2GTOA 3SEMA 1NEBA 3M0QA 1WFWA 1GL5A 2DL5A 2EYZA 2JXBA 5IXBA 3VS4A 2GTJA 1K1ZA 3M0UA 1X43A 4RTWA 1X69A 1PRLC 1JU5C 3QWYA 2FPEA 2EVRA 2EGAA 1GFCA 2DE0X 1OPLA 5IH2A 1GBQA 4OMLA 1BU1A 1U06A 1H8KA 1H92A 3UA7A 1AVZC 4Z88A 2AKKA 4AFUC 1I07A 1MV3A 1ARKA 1GRIA 4Y92A 3GBQA 1TUCA 1S1NA 1X6BA 4GBQA 2CSIA 2A36A 2CUDA 1J3TA 2RQRA 1M3BA 4AG2C 2BZXA 3PVQA 2KROA 5IHKA 4HVVA 4ESRA 2FG0A 2NWMA 5EC7A 3NHNA 2SEMA 2F2WA 1UUEA 4ORZA 1QKWA 2K6DA 2J6KA 3VRYA 4WCIA 5FW9A 1ZSGA 2EKHA 3VRZA 2F2XA 2ROLA 1AWXA 3H41A 2D8HA 4CC2A 3EG3A 1TG0A 4LN2A 3NPFA 1HJDA 4F17A 4OMQA 3TSZA 4JZ3A 1W70A 1GCQA 2DX1A 2FO0A 2EW3A 2ED1A 1X2KA 2F2VA 4J9BA 2LX7A 3I5SA 2DF6A 2KR3A 4OMMA 1OV3A 1QCFA 1M27C 4LNPA 4AFZC 2DLPA 1QLYA 1VA7A 4K11A 2LZ6B 2O9VA 2DL4A 2ECZA 2LMJA 4F14A 2CT3A 2HEQA 4D8DA 1T0JA 1PHTA 4HXJA 4A63B 2RNAA 2I0NA 3VS6A 3EHQA 2GGRA 4GLMA 2YDLA 1WDXA 1SSHA 2JS2A 2RF0A 1UJ0A 2B86A 2DRMA 2OJ2A 2YUNA 2DNUA 1FMKA 3REAB 2FRWA 2OI3A 2P4RA 1NYGA 2HBWA 2DYBA 2MIOA 2MCNA 3IQLA 2QDLA 2GQIA 1PKSA 1OOTA 1WA7A 1FYNA 4RTYA 4E6RA 2BZ8A 1PNJA 1B3QA 1PRMC 3THKA 2YT6A 2CH4W 2K9GA 2E5KA 2LQWA 2KYMA 2AZSA 3RNJA 1PKTA 1UHFA 2SRCA 1NYFA 1KSWA 5FWCA 2YSQA 1TUDA 2C0TA 2DMOA 2LQNA 2CDTA 2KBTA 3VS2A 2DRKA 4OMPA 4RTXA 1GFDA 4OMNA 1AZGB 2RN8A 3EG2A 2J05A 4HVWA 3ULRB 3H0FA 4QT7A 2KGTA 2VWFA 2LJ3A 2JM9A 4Z89A 1SRLA 2JW4A 1WXTA 2BZYA 1YNZA 4AFSC 3NMZC 1E6HA 1X27A 1G2BA 4J9GA 1CKAA 2EYYA 2RPNA 2LNHB 2NUZA 1AZEA 2M0YA 2RQTA 2DL7A 1T3LA 2PZ1A 3JV3A 2RMOA 2BTTA 2KRNA 4J9CA 3M0SA 1HD3A 1RLQC 2RQUA 2XMFA 1YCSB 1W6XA 1AWJA 1WXBA 1KFZA 4CC3A 1WXUA 2L0AA 2DILA 2DL8A 2PTKA 1UTIA 1JQQA 2DBKA 1JXOA 3H0HA 2LJ1A 4HVUA 1AD5A 1WIEA 2YUOA 3VS0A 1K0XA 3ZL7C 4LE9A 2LJ0A 4RUGA 2O2OA 1LCKA 1NLPC 3PE0A 4J9HA 2AZVA 2JS0A 2FPFA 2JT4A 2CREA 1ZUYA 1T0HA 1WLPB 2VVKA 3VS7A 3C0CA
chains in the Genus database with same CATH superfamily
3JCMP 1KQSP 2W0ZA 3V7RA 1OU8A 1VQLA 3CCJQ 3DKMA 4B6MA 2FZKB 3FDRA 5FWBA 2JM8A 2K2MA 3QJYA 3QPHA 4F7UF 2A28A 2CZ1B 3OS5A 5DM7R 3G6ET 3A98A 2RB6A 3M0RA 4M7DG 1VQKT 1HK9A 2QK0A 3RUXA 2QG9B 3A8HB 3GNFB 3H8ZA 1UGVA 4BY6B 3JCMV 5DLQE 4PJOC 5A2QE 1KHCA 3TU4K 3CCQA 2YRDA 1SSFA 2X3XD 1C1AA 1YI2T 1YP5A 3QZ5B 2J06A 3HRUA 5LL6S 3EAEA 4JDSA 4OB3B 1M3CA 3HP9A 1VQ9Q 2ZAEA 4JJNK 4X1VA 3EH2A 4QKUA 3GF5A 3RIRA 4N4GA 2PVGB 2JTMA 4OGEA 3SDZA 1MMNA 2E5QA 1K73U 2HQXA 3RKXA 4JZ4A 1VQ9A 1N27A 2FRYA 4PL6A 3L2QA 4ANJA 4M77G 3G4SQ 3SWNB 3QIIA 3QWXX 1BBZA 1VQ7T 1OZ2A 3CCEA 3I5RA 2JUFA 2NUTA 1SPKA 1M4ZA 2ED0A 5AYFA 3TREA 4KH0B 4A4GA 1I5LA 3CEYA 1I1JA 3EFOB 4OB1B 1OEBA 3CCJT 3VYGA 3EHRA 1PSFA 2M16A 4BD3A 2VC8A 2BE7D 2AK5A 1D3BB 2EBPA 3EGUA 4ZTJA 4VUBA 1N8RU 4Q5WA 4ZN3A 2Y4XA 1K9AA 2EJ9A 1ZUUA 2RQVA 3R6NA 4M7DB 3KUFA 4C8QG 2QASA 2W10A 2ZGWA 4ZN1A 5I11A 1VQOQ 2G6FX 4E7LA 2RHYA 1X6OA 5CKBA 4C0DB 3I55Q 2C06A 2QA4A 1EX4A 2H3JA 2M9UA 4IIOA 5IT9E 1NBEB 5CKDA 5FROA 1GXIE 1E6GA 1Z9QA 2O88A 1AOJA 1U8RA 4TVRA 2OTLQ 2DXCA 5IHIA 3I55A 1Q86C 1RL2A 1NM7A 1ZBJA 5KE2A 1G3SA 3S3OA 2CP6A 1VQ9T 3KXTA 4B9WA 2EIFA 4CRIA 2FPDA 3EGXB 2HKNA 3PMIA 2DJZA 1BI2A 2PVOB 1AEYA 3HFNA 2CT4A 1PM3A 2O4XA 3FJ5A 1JJ2P 1BCOA 4DQ2A 4LUDA 3CD6Q 3KBGA 5KYUA 2ESWA 2LC4A 3G4ST 3M4YA 3CCVA 4M77B 4HCKA 2K5IA 2EGEA 4J6YA 1UJYA 2MOXA 3CD6A 2VASA 2LCSA 2DVJA 3I9QA 2ATCB 1VQMT 1QWFA 2D9TA 1M90U 2KEAA 3RESA 1V1CA 2HCKA 4LUEA 1SEMA 4AG1C 1OZ3A 1RI9A 3CCLT 3AT1B 3REBB 4E2FB 4IIMA 1WJSA 4HCBA 4LDVA 4C5IA 4F16A 3FC3A 1XNIA 3QHSA 5GANe 1NEGA 3M0TA 4C92D 1M3AA 2J7IA 5GAOn 4FSXA 1LVKA 1WQWA 2GTOA 1TWBA 1NEBA 2RJFA 1WFWA 3QBYA 1QCNA 2JXBA 1PC0A 3OYBA 7AT1B 1FX7A 1K1ZA 2VYTA 4C8QB 1X43A 1X69A 1VQOT 2EGAA 1OPLA 1KC8C 2MWOA 4OMLA 3M54A 5KYWB 2GFAA 2AKKA 2OTLT 4Z02A 5CKFA 2RQRA 1K73C 1VQ4Q 3CC4Q 4NOYA 1KK7A 4ESRA 1D0YA 2EFIA 5CKHA 4AMCA 2YRCA 2L3RA 4WCIA 1VQ4A 3VRZA 3CCRQ 1UGPB 3EG3A 3FB9A 4BI3A 1HYOA 3R6OA 2F2VA 1B34B 2LX7A 2QXFA 3I5SA 2KR3A 4QQ6A 3HPWA 1ZA2B 4LNPA 3PIOA 1K9MR 3OW2P 1XTDA 1VA7A 2F1LA 2LZ6B 4RKUE 4A4KA 2EQKA 2LMJA 5LJ3j 3PNWC 4F14A 2CT3A 1N8RC 2V8IA 3GOXA 4FT2A 1PHTA 2R58A 1S72T 2RNAA 3CMAQ 3EHQA 2M1HA 2PUOB 2RHZA 3OS1A 3MHXA 4GLMA 4HA8A 2RHUA 2JS2A 1ZQ1A 2V8KA 3JB9I 1LJOA 2KY9A 2DNUA 5GAMd 2HBWA 1WQ7A 1PCXA 1UEBA 3CMAA 5KE3A 3IQLA 2RD1A 5A0DA 1PKSA 1D0ZA 1WJRA 4M78C 4ME7A 4M75C 2DXBA 1QMCA 1PRMC 2CH4W 1U1TA 5GAN3 2COYA 3RNJA 2VXFA 2IVWA 4MZPA 4C0GA 5GAN6 3VS2A 2KBTA 5GAN5 2DAQA 2DRKA 1VQ4T 2RN8A 4LXCA 2J05A 3CC4T 5GMKe 2LCCA 3ULRB 2QQRA 1O75A 2KGTA 4PJOD 1QQJA 1V76A 5FLXE 1SRLA 5LJ5d 1WXTA 3CCRT 3A8OB 4AFSC 2CZ7B 3NMZC 3C4SA 4C92F 1KD1U 1VQ5Q 2XG8D 2RPNA 1JB0E 2LNHB 2NUZA 1WJQA 4C92E 1G3WA 1T3LA 5M9OA 2RJEA 1AWJA 1BI1A 2KI7A 4CC3A 4BY6C 1JQQA 3V8LA 1ZA1B 3CMEQ 1YITA 2K5FA 4A54A 1I8FA 4HVUA 1M1KR 4PJNA 3QXEB 4M7DF 4OB0B 3ZL7C 4LE9A 3CCMQ 1SF9A 2LJ0A 3SD4A 4FL6A 5CO7A 1ZUYA 1T0HA 1VIEA 2VVKA 4M7AA 2DEUA 2HNIA 3VS7A 2LCLA 2D1XA 1Y71A 2MPXC 1Q82R 2CUBA 2QEXT 1C6VX 2DXUA 3GIBA 3JRZA 2ZPBB 1Y0MA 5GAN4 4OP0A 2EWNA 2L8DA 1RI0A 1UGSB 2HQHA 4N0AC 2DZ9A 1NG2A 5HK0A 4RTVA 1QVGS 2HZYA 4CC4B 1SHGA 1VQ8Q 2DIQA 2E41A 2FEIA 4E7SA 3ZFJA 3RKWA 1UB4A 4M4ZA 3J81E 4R0KA 1VQ5T 1Q7YR 1KHIA 1WI7A 1N5ZA 1VQ8A 1KG1A 3A8GB 5KYXA 5GAMf 4BE1A 1NLOC 3QG1A 2NLUA 2VKNA 2QQAA 4M7DC 1JXMA 4IUVA 2AIRB 3EG1A 3CMET 1IZ6A 4J7IA 2MAMA 1U1SA 1YN8A 3OYCA 3RR6A 3GLXA 4BE2A 4C0DC 3JCMb 3UA6A 1ZHIA 2YUPA 3CCSQ 1G83A 1ZSZA 2RJCA 1QVFP 3VS1A 3WVEB 3CCMT 3JCMJ 1LOJA 3JB9G 4C8QF 3MO8A 2DIGA 2WSCE 3JSCA 2V1RA 2KNBB 5IHNA 3OY9A 4JS4A 2YHTA 1YWPA 1M8MA 3SB2A 4EIKA 4ZGEB 3P8HA 4XTUA 5D6WA 1SKUB 4PJOE 4J9DA 1MV0B 1Q86U 4L6V5 2DERA 4MZMA 1DJ7B 5LJ5f 2O4XB 3A5ZB 4EMHA 3SHWA 3RBBB 3DB4A 2LP5A 5KYUB 4XU2A 1U3OA 2L3SA 3H0IA 4M77C 2RK1A 2MF2A 3OMCA 3TSWA 2P0KA 1G5VA 3WXMB 1ABQA 3C12A 4J9EA 2JOYA 2F5TX 1UECA 1VQLQ 1ZLMA 2CKKA 2RQWA 5KYYA 4LD6A 1MUZA 1VQPQ 4DA4A 4O5VA 4LD9K 4ZGJB 3UWNA 1PD0A 3JCMW 3WVDB 5GAN7 2KT8A 2EYXA 3TVTA 3QZ9B 4ZTFA 3L2RA 1VQPA 1VYTA 1OPKA 2QAZA 2X4JA 3MEAA 4F7UE 4LDUA 5GAOp 2DL3A 3CCQQ 1WYXA 2RI2A 4C8QC 1G3YA 2X9HA 4NL3A 5DLOA 3VV0A 1E7OA 3OS0A 4E7JA 1Y96B 2L89A 2D0NA 2ROTA 2X35A 3CCST 3FIFA 4V2SA 1Y7XA 1UG1A 3TQ7P 4JJDA 4PLIA 1OI1A 2G3RA 5GANd 4KGVB 1AHJB 3KFVA 2K3BA 4AFQC 4RG2A 1KC8U 1A0NB 1W1FA 3S3MA 3DLMA 4XAXB 2HL3A 1WPYA 4FCYA 2RJDA 5A0LA 1QVPA 5L23A 3CCEQ 2X3WD 2AKLA 3CPFA 2R5AA 4EPCA 1U5SA 4J9FA 1I0CA 1IXDA 1VQ6A 2C0OA 1FMWA 1OULA 5HCKA 4DBQA 1BK2A 3SEMA 4C5EA 6AT1B 2NYSA 4MDXA 3MP1A 1VQLT 1GL5A 2DL5A 4M78D 3LYIA 3EH1A 4M75D 3M0UA 5HY6A 3E9FA 1RAAB 2ZPEB 1OU9A 5IH2A 2R57A 1BU1A 1U06A 1H92A 1IHWA 4Z88A 4RCBA 2XU8A 3CCUA 1MV3A 3CC7A 4IURA 3OSSC 1TUCA 1R0BG 2MK5A 2CUDA 2LX9A 1H3ZA 2BZXA 5I2SA 4M7AG 2DD4A 3CCQT 2KROA 4HVVA 2QA4Q 1I5OB 4ORZA 1UUEA 4JRQA 1M1FA 2DZCA 1RACB 3VRYA 1ZSGA 3VUBA 1AWXA 1QW1A 4XTXA 1TG0A 4OMQA 2E65A 4PJJA 1M2OA 1GCQA 2DX1A 1YJNA 1MHNA 1F1BB 4EDUA 2DEQA 2K3YA 1ACMB 4EMKA 1OV3A 2DETA 4AFZC 2DLPA 3JCMd 3OS2A 1QLYA 4II1A 4K11A 2E12A 2ZPGB 4E7IA 4DBFA 2EYQA 3JCMX 4R56A 4ATOA 1YJWA 2EQMA 1YJ9A 5KH6A 4QW2A 3CCVQ 2HSEB 1BIAA 4A63B 1Q81R 3CCET 3LLRA 5J26A 2DXTA 3INZA 3META 4MMKA 1RAEB 2DRMA 2FVUA 2YUNA 5GAMh 5GAMg 1FMKA 2LQKA 2MI6A 2OI3A 1NYGA 3P8BB 2DYBA 1JBMA 2MIOA 4JLIA 1BI3A 2QDLA 5I21A 3CBMA 2DVEA 2GQIA 4HCZA 4FYWB 2VXEA 1OOTA 4XK8E 8ATCB 1QVGA 1FYNA 1YBYA 2P4TA 2NUPB 3RERA 4XTYA 3OYEA 1VQNA 4ZGDB 2E5KA 2LQWA 3EFRA 2KYMA 2AZSA 2HMAA 1NYFA 5GANf 3JAME 2CDTA 1MNEA 4J6WA 2VUBA 4BUGA 4AT1B 1M90R 3H0FA 2QA4T 4O6JA 4M7AB 3ER0A 5LJ3e 1P92A 2JNGA 5LJ5g 5LJ5h 2JW4A 2QYZA 5KCHA 5A0GA 3I55T 3Q1JA 2EYYA 2KQWA 2BUDA 1AZEA 2DL7A 4M78F 3JV3A 4M75F 4M7DD 2BTTA 2MYSA 3QO3A 3M58A 1HD3A 1RLQC 4M78E 2A3LA 4M75E 1KFZA 2HQEA 3EG9A 1UTIA 1NJIR 2DD5A 1JXOA 4J8OA 2LJ1A 1LPLA 2M0OA 4DBRA 3G7ZA 1K8AR 3CCVT 5EG2A 4HT8A 4A4HA 1MNDA 3M57A 4FYVB 2YUOA 1WHKA 3UDCA 3VS0A 4YTLA 1K0XA 3CD6T 3OYAA 2E70A 2KK4A 4F04B 1K9MU 3QDRB 3MPUB 3OA6A 2X4XA 2COZA 3TCJA 4ELYC 2XK0A 2JMCA 1I4K1 3L2VA 2OTJA 3SWNA 4DOWA 2L5QA 1GBRA 2O9SA 1JO8A 4J5YA 2E6NA 4M77D 4R55A 1PSEA 1HSQA 1TUGB 3BDUA 1UGRB 3V7CA 3EGDB 4PFPA 4C92A 2Y90A 4B9XA 1X6GA 3CBPA 1Y57A 3UF4A 3OYNA 1C0MA 1YIJA 3G71A 1M9SA 2OAWA 1M2VA 1MGQA 3JCMe 1TU0B 2F5KA 5CQYA 4DBHA 2PQWA 1M5Q1 2PU9B 2DBMA 4BE0A 3URGA 1Y07A 2K4YA 2LDMA 1CKBA 5GJVB 4LDWA 3OQ5A 2L2PA 2YUQA 2K79A 2E1HA 3M9QA 1YHQQ 1CSKA 4C8QD 5KYYB 3L2WA 4DEXA 1VIFA 5J39A 1M30A 2O31A 2DM1A 4BACA 1YHQA 3CC2A 1YWOA 2KXCA 4NS5A 4KH1B 3I56Q 2DTOA 4XTWA 4BDYA 2GNCA 2COWA 2ZCFB 2FZCB 1YITQ 3VS5A 3HHTB 2HSPA 2EYWA 4FIBA 1TH7A 3TEEA 1H3HA 3I56A 2JJ9A 3HKSA 4A4EA 2L3PA 1K4US 1UHCA 2CP2A 5D6XA 3OBWA 4E47A 1M1KU 1D1CA 4JS5A 2J6FA 2J6OA 3CMAT 2KE9A 3MEUA 2XD0A 3I35A 4M7DE 3PVLA 2P0PA 2KXDA 3HRSA 1T3SA 3QKJA 4WTOB 5GMKm 3M5AA 4P5NA 3EG0A 1BKBA 1JRIA 4MZTA 1X2QA 2CZ6B 2ENMA 5FU6C 4C5GA 1NPPA 2QGFB 1Q82U 4RG8A 4QVDA 3AHUA 3LH5A 3OSVA 1JJ2S 3QYHB 2WSFE 4J83A 4D8KA 1BIBA 3PIPA 5GMKj 1M1GA 4JPBW 3OYGA 2DA9A 2NUTB 3M0PA 2E3HA 4J9IA 4ZNXA 1EFNA 2K3XA 4PJOA 1SRMA 2CSQA 1IB8A 4OMOA 5KYWA 5C6SA 4M77F 1LNXA 2MWPA 3M56A 2JVVA 2EPDA 4DEYA 4M77E 5GANg 5GANh 1Q7YU 2BIVA 2YRVA 2LNVA 1K9MC 2A08A 2P84A 4A53A 1VOMA 1D1AA 3L1AA 2Y4YA 3OMGA 4J6XA 2KAFA 2LT1A 3UATA 1R77A 4KGZB 1YITT 4QQGA 1XOVA 1V29B 1TS9A 2QTVA 2AHJB 2OX7A 3E2UA 5D6YA 1AT1B 2FZGB 3OYDA 2XDPA 1SHFA 4BI4A 1RAIB 3NTHA 4RTUA 1B34A 2HBPA 5GAN8 1R8OB 5C0MA 4M7AF 2E10A 3VKIA 5CR2A 2A7YA 3M0QA 2X4YA 4F7UA 2EYZA 4C8QE 3BDLA 5IXBA 3G6EA 2GTJA 3ZBDA 1W4SA 1VQKA 4XU1A 3RKYA 4RTWA 2RM4A 1PG5B 1PRLC 4BB7A 2QTXA 3QWYA 3OYKA 2EVRA 1GFCA 1YI2Q 1GBQA 3A1PA 5FRMA 1IRXA 4X34A 3UA7A 3QSUA 4AFUC 2K57A 3GBQA 3H9NA 1S1NA 1YI2A 4GBQA 2E3IA 1J3TA 1WHHA 1M3BA 2KVQG 4HKEA 4AG2C 2EKOA 2X51A 3PVQA 1I81A 5IHKA 2FG0A 2NWMA 1N9RA 1Q86R 2F2WA 3SFMA 2K6DA 2WACA 3V8JA 3OW2S 1VQ8T 4LDXA 3OBYA 1B7TA 4CC2A 1OX8A 4MDWA 3NPFA 4KBMB 4F17A 3TSZA 4BDZA 1OQKA 3E1SA 4JZ3A 2KDSA 1IGQA 4J7FA 4C92G 3CBOA 2EJGA 2ED1A 3ME9A 1QP3A 5GAMj 2DF6A 4UC4A 1M27C 4KGXB 3A8MB 3MEWA 1VQ7A 4PFOA 3JCMg 2YLCA 1M1KC 1D1BA 2DPPB 4M7AC 1TSFA 2KSSA 2DTHA 4QVCA 3X25B 2CZ0B 4OGCA 3NFCA 2HEQA 1T0JA 5I2MA 3LH0A 4NL2A 2ZZDA 5IAYA 2I0NA 2GGRA 4FYYB 2DYIA 1SSHA 2JTFA 3X26B 3CCJA 1WZOA 2RI3A 2OJ2A 1D09B 3REAB 2P4RA 3PT9A 5GMKh 2RHXA 3G1JA 1Q82C 5LJ3d 3EG9B 1KQ1A 2LTOA 4RTYA 5CVIA 4EMGA 2BZ8A 3H6ZA 5CKEA 1B3QA 3MKDA 3THKA 4PK4A 3C95A 2K9GA 3VJPA 5LJ5j 2DTIA 1VQ6Q 5FU6B 3VUZA 1PKTA 5FWCA 3BFMA 2E64A 1KC8R 2C0TA 2DMOA 4OMPA 4RTXA 1FWZA 1GFDA 4OMNA 4HVWA 2VGNA 3BY7A 2X4WA 3T9NA 1K73R 2BKDN 2JZ2A 2JM9A 4Z89A 1Q7YC 4X9DA 3CCUQ 1VQPT 4JUVA 3CC7Q 1O9SA 2DFUA 4PNOA 1X27A 1ZSZC 2E6ZA 3CXCS 1G2BA 2M0YA 3A8LB 2RQTA 4C92B 1UGQB 2P0QA 2RMOA 3G4SA 4J9CA 1VQMQ 2GCXA 2CP5A 1W6XA 1WXBA 2QQBA 3GPLA 1WXUA 2DL8A 2WSEE 2PTKA 4KUDK 2D0QB 4XTVA 1M2VB 1WHGA 1W2BS 1YJNQ 3CPWS 1VQMA 3CCLQ 3PGGA 2XDBA 1N8RR 2O01E 2F69A 4FYXB 4A4FA 3MEVA 3L42A 3PTAA 1LCKA 1NLPC 3CCLA 4PJMA 2FPFA 1YJWQ 2JT4A 1YJ9Q 2CREA 3X28B 5D7UA 1WLPB 2ZPFB 4PJOG 4PLLA 1NE8A 2KMTA 2QDYB 3U23A 1KIKA 3UT1A 1JEGA 1TTHB 1Q81U 1UDLA 1VQ6T 4Z8AA 2GF7A 1VQOA 1PD1A 2JMAA 4OF1A 4IKFA 4RTTA 1WHLA 1JJ2A 3JB9D 5GMKl 2VV5A 3LX7A 3J80E 1RUWA 3DLLA 2AT1B 5FU7C 2OTLA 1AWOA 1VQNQ 5AT1B 4M78A 3OB9A 2KRSA 4M75A 2JN0A 2DJQA 4RMOA 4OMFB 3VS3A 4BI8B 9ATCB 4JRPA 1WHMA 2GFUA 3CCUT 3CC7T 2RO0A 2ABLA 1BI0A 1G3TA 2A37A 1EIFA 4CI0C 5J3BA 1OYXA 4GY5A 2KYBA 1QVGP 2C0IA 3JB9J 4F7UG 1AWWA 2LQ8A 5IXFA 5L8RE 4GLKA 1VYVA 4XQ3A 1UFFA 4E7HA 1QVFS 1QP2A 3O5ZA 1VYUA 5LJ3f 1S72Q 4XU0A 1MMAA 2KT1A 1YJNT 4FU6A 2D8JA 4FW1A 1IREB 3BE3A 3VU3C 1WX6A 3V7SA 4RTZA 2HDAA 1KJWA 1GCPA 1S72A 1TXQA 1WHJA 3E19A 2RI5A 3CQTA 4FSSA 1RAFB 2HKQB 1YJWT 1YJ9T 2EJFA 2EGCA 1IGUA 1PWTA 5CAIA 4L59A 5GJWB 2Z0WA 2DKGA 2EQIA 1NJIU 1Y96A 4PJOB 1MMDA 1YCYA 4D6WA 2JTEA 1K0SA 2H3EB 1NPRA 2M02A 1K8AU 2V1QA 3NGPA 4Y28E 2ZPIB 1RLPC 1UE9A 2CP7A 1Q95G 3MP6A 1KQSS 5I22A 2IIMA 2GBQA 2HD0A 5KYXB 4WF2A 3GNGA 4KRTA 1FXXA 3FEOA 1VQNT 3LGFA 2OTJQ 2K7AA 5GMKi 1WNLA 3CC4A 3F70A 3OW2A 1BB9A 4FT4A 5ECAA 5CK9A 2BE9B 2V8JA 4JJBA 1ABOA 1GCQC 1ZSZB 3CCRA 5GANj 1QWEA 1ZUKA 1N6AA 3FJPA 2PNIA 1YIJQ 3G71Q 1QCOA 4OB2B 4EMKC 4N0AA 3OYHA 2FB7A 4F7UB 4JJCA 1NZ9A 1IO6A 1RAGB 1Z9ZA 3EFOA 3J7AF 2XKOC 3JCMf 4CC7A 2M51A 1RABB 2L3QA 3MP8A 1XJWB 4IUQA 2CS7A 5GAN2 3C94A 3JB9F 2KRMA 1QKXA 1D3BA 2IPOB 5GAOl 4IUUA 2CH4A 2K2VA 1K76A 2RHIA 2K5LA 3PFSA 4PFZA 4KUIA 1YFNA 5KYNA 3LWHA 4M7DA 1IHVA 2E4HA 1G8XA 3M59A 4M7AD 3OYMA 1ZX6A 2YXYA 1Q81C 3CC2Q 4IUTA 4LDYA 3X24B 2XIDA 1XQHA 3FLGA 2QEXQ 1OX9A 2H8HA 3L2UA 1MMGA 1VUBA 3ZEHA 5FRNA 2CP3A 1B07A 4L5GA 3E9GA 3N5BB 2RA2A 2QEXA 2B8AA 3M4GA 1X01A 4ELZC 2EQUA 2XI9A 2OTJT 3LGLA 3VS4A 5FU7B 3EGXA 4XU3A 2LRQA 1SG5A 1JU5C 2FPEA 4X9CA 2DE0X 2CYZB 2QI2A 1H8KA 1AVZC 3MCAB 1KD1R 1I07A 1KQ2A 3CXCA 1ARKA 1GRIA 4M77A 1M90C 4Y92A 3S6WA 2FL7A 1X75C 1X6BA 2CSIA 3G71T 1YIJT 2A36A 1N9SA 1VQ5A 2D6FA 3EFSA 4IUPA 1H641 3P8DA 3QJ6A 5EC7A 3QDFA 3NHNA 2NUPA 2SEMA 3CXCP 3HTRA 2DK3A 1QKWA 3D7SB 3QUIA 3RMSA 2J6KA 1W2BA 5FW9A 2EKHA 2F2XA 2ROLA 3H41A 2D8HA 3CPWA 4LN2A 3O8VA 1HJDA 3CMEA 3UPUA 1W70A 2QQSA 1M8VA 2XDDA 2CGHA 2FO0A 2PUKB 3QYGB 2EW3A 3BW1A 1X2KA 4J9BA 4KULA 1W2BP 1NJIC 4OMMA 4E7KA 1QCFA 1RADB 3DB3A 1WGSA 3CPWP 4M78G 3CCMA 2FYKA 1K8AC 4M75G 1BYMA 4C8QA 2O9VA 1YHQT 2DL4A 3CC2T 2ECZA 2QQ9A 2HL5C 3HSBA 3OYLA 5CQXA 4D8DA 3HL8A 3NTKA 4HXJA 4PKCC 3VS6A 3SWNC 3JB9H 2YDLA 2IG0A 1WDXA 3GP8A 2RF0A 2RH2A 1UJ0A 2B86A 2YWWA 3I56T 2FRWA 4C92C 4FM4B 2A0FB 3RMQA 2MCNA 4XTZA 1D0XA 2XHCA 8AT1B 2EQJA 2MMPA 5LJ3h 5LJ3g 4N4IA 2DO3A 4Y91A 1WA7A 2ZPHB 4JRIA 4E6RA 1PNJA 3OYFA 2YT6A 3ASKA 2V26A 2RK2A 5GAOq 2LVMA 5KCOA 2YLBA 1EZZB 2SRCA 1UHFA 1KSWA 2YSQA 2VB6A 2CP0A 1TUDA 2GQVA 4KT0E 3G6EQ 2LQNA 4E7ZA 3FRNA 5GAMe 1VQKQ 3OYYA 1AZGB 2PVDB 3EG2A 4M7AE 3M53A 4EMKB 1QVFA 3V8KA 4QT7A 4OVAA 2I2LA 5GAOr 3OYJA 2VWFA 2LJ3A 2QGGA 2EAYA 4HCCA 2BZYA 1HXDA 1YNZA 1E6HA 4C0ZA 3OYIA 1RAHB 4J9GA 3LWIA 5DY9A 1CKAA 3EGDA 3HFOA 3X20B 1R0CB 3S3NA 5IN1A 3LW5E 3CCSA 2PZ1A 4PJOF 2VGMA 3RDVA 2KRNA 3M0SA 2OAUA 2XMFA 2RQUA 1YCSB 4PJLA 4C5HA 2L0AA 4HT9A 2DILA 4M78B 5CIUA 2XICA 2DBKA 4M75B 3H0HA 3M55A 2FHDA 3HRTA 4DOVA 3JCMQ 3JCMc 1FMVA 4QQDA 2LT4A 5LJ5e 4N4HA 1AD5A 4C0FA 1WIEA 5HKCA 4JRKA 3VYHB 2R5MA 1VQ7Q 3NTIA 1BCMA 4JLGA 2HAXA 1KQSA 5CCAA 4RUGA 2O2OA 4FW2A 3MJXA 3PE0A 4J9HA 2AZVA 2JS0A 5HK3A 1TOVA 5GAOm 4RCCA 3L2ZA 1ZBXA 4QVZA 1KD1C 3PMTA 3JCMh 4MMLA 3C0CA
chains in the Genus database with same CATH topology
3U23A 2W0ZA 1KIKA 2JMCA 2D1XA 1JEGA 5FWBA 1UDLA 2CUBA 2JM8A 2K2MA 4Z8AA 1GBRA 2JMAA 2O9SA 1JO8A 2A28A 1HSQA 4RTTA 3A98A 1Y0MA 3M0RA 1X6GA 1RUWA 1AWOA 1Y57A 1NG2A 3UF4A 4RTVA 2KRSA 1UGVA 2OAWA 2DJQA 4CC4B 1SHGA 3VS3A 2FEIA 2ABLA 2X3XD 1YP5A 2J06A 4M4ZA 4R0KA 2DBMA 1WI7A 1N5ZA 2A37A 2KYBA 1NLOC 1CKBA 5GJVB 2C0IA 2L2PA 1M3CA 1AWWA 5IXFA 2VKNA 1VYVA 2YUQA 1UFFA 4X1VA 2K79A 3O5ZA 1CSKA 1VYUA 1JXMA 4DEXA 1M30A 2O31A 3EG1A 2DM1A 1YN8A 4JZ4A 2KT1A 2FRYA 3UA6A 2YUPA 2D8JA 1G83A 1WX6A 1YWOA 2KXCA 2HDAA 1KJWA 3QWXX 4RTZA 1GCPA 3VS1A 1BBZA 3I5RA 2GNCA 1SPKA 3CQTA 3VS5A 4FSSA 2HSPA 2EYWA 2V1RA 2KNBB 2ED0A 5IHNA 1H3HA 4EIKA 1YWPA 1M8MA 2EGCA 1PWTA 1I1JA 4J9DA 5GJWB 2L3PA 2EQIA 1K4US 1MV0B 1UHCA 1OEBA 2JTEA 1K0SA 2V1QA 3EHRA 3NGPA 3SHWA 3RBBB 2J6FA 2LP5A 2AK5A 2J6OA 2EBPA 3EGUA 1RLPC 1UE9A 2KE9A 1U3OA 2L3SA 3H0IA 5I22A 3TSWA 3I35A 2IIMA 1K9AA 2GBQA 1ABQA 1ZUUA 2RQVA 3PVLA 4J9EA 3R6NA 2KXDA 1T3SA 1UECA 4KRTA 1ZLMA 2RQWA 2K7AA 2W10A 1MUZA 3EG0A 5I11A 2G6FX 1X2QA 2ENMA 2KT8A 4IIOA 1BB9A 2EYXA 3TVTA 1E6GA 1Z9QA 3LH5A 2O88A 5ECAA 1AOJA 1VYTA 4JJBA 1ABOA 1GCQC 1QWEA 1OPKA 1ZUKA 5IHIA 4D8KA 2PNIA 1NM7A 1ZBJA 4JPBW 2DA9A 3M0PA 2DL3A 4JJCA 1WYXA 1IO6A 1Z9ZA 4J9IA 4ZNXA 1EFNA 2FPDA 4CC7A 1SRMA 2M51A 2CSQA 2L3QA 4OMOA 1E7OA 1AEYA 2CT4A 3FJ5A 2D0NA 4LUDA 2ROTA 2KRMA 1QKXA 2EPDA 1UG1A 2ESWA 4DEYA 4JJDA 2CH4A 2A08A 1K76A 3KFVA 4HCKA 2EGEA 2K3BA 4AFQC 1UJYA 1A0NB 1W1FA 3UATA 2MOXA 1XOVA 2LCSA 2DVJA 3I9QA 1ZX6A 1QWFA 2KEAA 1V1CA 2HCKA 4LUEA 5L23A 1SEMA 1SHFA 4AG1C 2X3WD 2H8HA 1RI9A 2AKLA 4RTUA 3REBB 4IIMA 4F16A 1U5SA 4J9FA 1I0CA 1NEGA 3M0TA 1B07A 1M3AA 2J7IA 2C0OA 5HCKA 1BK2A 2GTOA 3SEMA 1NEBA 3M0QA 1WFWA 1GL5A 2DL5A 2EYZA 2JXBA 5IXBA 3VS4A 2GTJA 1K1ZA 3M0UA 1X43A 4RTWA 1X69A 1PRLC 1JU5C 3QWYA 2FPEA 2EVRA 2EGAA 1GFCA 2DE0X 1OPLA 5IH2A 1GBQA 4OMLA 1BU1A 1U06A 1H8KA 1H92A 3UA7A 1AVZC 4Z88A 2AKKA 4AFUC 1I07A 1MV3A 1ARKA 1GRIA 4Y92A 3GBQA 1TUCA 1S1NA 1X6BA 4GBQA 2CSIA 2A36A 2CUDA 1J3TA 2RQRA 1M3BA 4AG2C 2BZXA 3PVQA 2KROA 5IHKA 4HVVA 4ESRA 2FG0A 2NWMA 5EC7A 3NHNA 2SEMA 2F2WA 1UUEA 4ORZA 1QKWA 2K6DA 2J6KA 3VRYA 4WCIA 5FW9A 1ZSGA 2EKHA 3VRZA 2F2XA 2ROLA 1AWXA 3H41A 2D8HA 4CC2A 3EG3A 1TG0A 4LN2A 3NPFA 1HJDA 4F17A 4OMQA 3TSZA 4JZ3A 1W70A 1GCQA 2DX1A 2FO0A 2EW3A 2ED1A 1X2KA 2F2VA 4J9BA 2LX7A 3I5SA 2DF6A 2KR3A 4OMMA 1OV3A 1QCFA 1M27C 4LNPA 4AFZC 2DLPA 1QLYA 1VA7A 4K11A 2LZ6B 2O9VA 2DL4A 2ECZA 2LMJA 4F14A 2CT3A 2HEQA 4D8DA 1T0JA 1PHTA 4HXJA 4A63B 2RNAA 2I0NA 3VS6A 3EHQA 2GGRA 4GLMA 2YDLA 1WDXA 1SSHA 2JS2A 2RF0A 1UJ0A 2B86A 2DRMA 2OJ2A 2YUNA 2DNUA 1FMKA 3REAB 2FRWA 2OI3A 2P4RA 1NYGA 2HBWA 2DYBA 2MIOA 2MCNA 3IQLA 2QDLA 2GQIA 1PKSA 1OOTA 1WA7A 1FYNA 4RTYA 4E6RA 2BZ8A 1PNJA 1B3QA 1PRMC 3THKA 2YT6A 2CH4W 2K9GA 2E5KA 2LQWA 2KYMA 2AZSA 3RNJA 1PKTA 1UHFA 2SRCA 1NYFA 1KSWA 5FWCA 2YSQA 1TUDA 2C0TA 2DMOA 2LQNA 2CDTA 2KBTA 3VS2A 2DRKA 4OMPA 4RTXA 1GFDA 4OMNA 1AZGB 2RN8A 3EG2A 2J05A 4HVWA 3ULRB 3H0FA 4QT7A 2KGTA 2VWFA 2LJ3A 2JM9A 4Z89A 1SRLA 2JW4A 1WXTA 2BZYA 1YNZA 4AFSC 3NMZC 1E6HA 1X27A 1G2BA 4J9GA 1CKAA 2EYYA 2RPNA 2LNHB 2NUZA 1AZEA 2M0YA 2RQTA 2DL7A 1T3LA 2PZ1A 3JV3A 2RMOA 2BTTA 2KRNA 4J9CA 3M0SA 1HD3A 1RLQC 2RQUA 2XMFA 1YCSB 1W6XA 1AWJA 1WXBA 1KFZA 4CC3A 1WXUA 2L0AA 2DILA 2DL8A 2PTKA 1UTIA 1JQQA 2DBKA 1JXOA 3H0HA 2LJ1A 4HVUA 1AD5A 1WIEA 2YUOA 3VS0A 1K0XA 3ZL7C 4LE9A 2LJ0A 4RUGA 2O2OA 1LCKA 1NLPC 3PE0A 4J9HA 2AZVA 2JS0A 2FPFA 2JT4A 2CREA 1ZUYA 1T0HA 1WLPB 2VVKA 3VS7A 3C0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U23 A;  2W0Z A;  1KIK A;  2JMC A;  2D1X A;  1JEG A;  5FWB A;  1UDL A;  2CUB A;  2JM8 A;  2K2M A;  4Z8A A;  1GBR A;  2JMA A;  2O9S A;  1JO8 A;  2A28 A;  1HSQ A;  4RTT A;  3A98 A;  1Y0M A;  3M0R A;  1X6G A;  1RUW A;  1AWO A;  1Y57 A;  1NG2 A;  3UF4 A;  4RTV A;  2KRS A;  1UGV A;  2OAW A;  2DJQ A;  4CC4 B;  1SHG A;  3VS3 A;  2FEI A;  2ABL A;  2X3X D;  1YP5 A;  2J06 A;  4M4Z A;  4R0K A;  2DBM A;  1WI7 A;  1N5Z A;  2A37 A;  2KYB A;  1NLO C;  1CKB A;  5GJV B;  2C0I A;  2L2P A;  1M3C A;  1AWW A;  5IXF A;  2VKN A;  1VYV A;  2YUQ A;  1UFF A;  4X1V A;  2K79 A;  3O5Z A;  1CSK A;  1VYU A;  1JXM A;  4DEX A;  1M30 A;  2O31 A;  3EG1 A;  2DM1 A;  1YN8 A;  4JZ4 A;  2KT1 A;  2FRY A;  3UA6 A;  2YUP A;  2D8J A;  1G83 A;  1WX6 A;  1YWO A;  2KXC A;  2HDA A;  1KJW A;  3QWX X;  4RTZ A;  1GCP A;  3VS1 A;  1BBZ A;  3I5R A;  2GNC A;  1SPK A;  3CQT A;  3VS5 A;  4FSS A;  2HSP A;  2EYW A;  2V1R A;  2KNB B;  2ED0 A;  5IHN A;  1H3H A;  4EIK A;  1YWP A;  1M8M A;  2EGC A;  1PWT A;  1I1J A;  4J9D A;  5GJW B;  2L3P A;  2EQI A;  1K4U S;  1MV0 B;  1UHC A;  1OEB A;  2JTE A;  1K0S A;  2V1Q A;  3EHR A;  3NGP A;  3SHW A;  3RBB B;  2J6F A;  2LP5 A;  2AK5 A;  2J6O A;  2EBP A;  3EGU A;  1RLP C;  1UE9 A;  2KE9 A;  1U3O A;  2L3S A;  3H0I A;  5I22 A;  3TSW A;  3I35 A;  2IIM A;  1K9A A;  2GBQ A;  1ABQ A;  1ZUU A;  2RQV A;  3PVL A;  4J9E A;  3R6N A;  2KXD A;  1T3S A;  1UEC A;  4KRT A;  1ZLM A;  2RQW A;  2K7A A;  2W10 A;  1MUZ A;  3EG0 A;  5I11 A;  2G6F X;  1X2Q A;  2ENM A;  2KT8 A;  4IIO A;  1BB9 A;  2EYX A;  3TVT A;  1E6G A;  1Z9Q A;  3LH5 A;  2O88 A;  5ECA A;  1AOJ A;  1VYT A;  4JJB A;  1ABO A;  1GCQ C;  1QWE A;  1OPK A;  1ZUK A;  5IHI A;  4D8K A;  2PNI A;  1NM7 A;  1ZBJ A;  4JPB W;  2DA9 A;  3M0P A;  2DL3 A;  4JJC A;  1WYX A;  1IO6 A;  1Z9Z A;  4J9I A;  4ZNX A;  1EFN A;  2FPD A;  4CC7 A;  1SRM A;  2M51 A;  2CSQ A;  2L3Q A;  4OMO A;  1E7O A;  1AEY A;  2CT4 A;  3FJ5 A;  2D0N A;  4LUD A;  2ROT A;  2KRM A;  1QKX A;  2EPD A;  1UG1 A;  2ESW A;  4DEY A;  4JJD A;  2CH4 A;  2A08 A;  1K76 A;  3KFV A;  4HCK A;  2EGE A;  2K3B A;  4AFQ C;  1UJY A;  1A0N B;  1W1F A;  3UAT A;  2MOX A;  1XOV A;  2LCS A;  2DVJ A;  3I9Q A;  1ZX6 A;  1QWF A;  2KEA A;  1V1C A;  2HCK A;  4LUE A;  5L23 A;  1SEM A;  1SHF A;  4AG1 C;  2X3W D;  2H8H A;  1RI9 A;  2AKL A;  4RTU A;  3REB B;  4IIM A;  4F16 A;  1U5S A;  4J9F A;  1I0C A;  1NEG A;  3M0T A;  1B07 A;  1M3A A;  2J7I A;  2C0O A;  5HCK A;  1BK2 A;  2GTO A;  3SEM A;  1NEB A;  3M0Q A;  1WFW A;  1GL5 A;  2DL5 A;  2EYZ A;  2JXB A;  5IXB A;  3VS4 A;  2GTJ A;  1K1Z A;  3M0U A;  1X43 A;  4RTW A;  1X69 A;  1PRL C;  1JU5 C;  3QWY A;  2FPE A;  2EVR A;  2EGA A;  1GFC A;  2DE0 X;  1OPL A;  5IH2 A;  1GBQ A;  4OML A;  1BU1 A;  1U06 A;  1H8K A;  1H92 A;  3UA7 A;  1AVZ C;  4Z88 A;  2AKK A;  4AFU C;  1I07 A;  1MV3 A;  1ARK A;  1GRI A;  4Y92 A;  3GBQ A;  1TUC A;  1S1N A;  1X6B A;  4GBQ A;  2CSI A;  2A36 A;  2CUD A;  1J3T A;  2RQR A;  1M3B A;  4AG2 C;  2BZX A;  3PVQ A;  2KRO A;  5IHK A;  4HVV A;  4ESR A;  2FG0 A;  2NWM A;  5EC7 A;  3NHN A;  2SEM A;  2F2W A;  1UUE A;  4ORZ A;  1QKW A;  2K6D A;  2J6K A;  3VRY A;  4WCI A;  5FW9 A;  1ZSG A;  2EKH A;  3VRZ A;  2F2X A;  2ROL A;  1AWX A;  3H41 A;  2D8H A;  4CC2 A;  3EG3 A;  1TG0 A;  4LN2 A;  3NPF A;  1HJD A;  4F17 A;  4OMQ A;  3TSZ A;  4JZ3 A;  1W70 A;  1GCQ A;  2DX1 A;  2FO0 A;  2EW3 A;  2ED1 A;  1X2K A;  2F2V A;  4J9B A;  2LX7 A;  3I5S A;  2DF6 A;  2KR3 A;  4OMM A;  1OV3 A;  1QCF A;  1M27 C;  4LNP A;  4AFZ C;  2DLP A;  1QLY A;  1VA7 A;  4K11 A;  2LZ6 B;  2O9V A;  2DL4 A;  2ECZ A;  2LMJ A;  4F14 A;  2CT3 A;  2HEQ A;  4D8D A;  1T0J A;  1PHT A;  4HXJ A;  4A63 B;  2RNA A;  2I0N A;  3VS6 A;  3EHQ A;  2GGR A;  4GLM A;  2YDL A;  1WDX A;  1SSH A;  2JS2 A;  2RF0 A;  1UJ0 A;  2B86 A;  2DRM A;  2OJ2 A;  2YUN A;  2DNU A;  1FMK A;  3REA B;  2FRW A;  2OI3 A;  2P4R A;  1NYG A;  2HBW A;  2DYB A;  2MIO A;  2MCN A;  3IQL A;  2QDL A;  2GQI A;  1PKS A;  1OOT A;  1WA7 A;  1FYN A;  4RTY A;  4E6R A;  2BZ8 A;  1PNJ A;  1B3Q A;  1PRM C;  3THK A;  2YT6 A;  2CH4 W;  2K9G A;  2E5K A;  2LQW A;  2KYM A;  2AZS A;  3RNJ A;  1PKT A;  1UHF A;  2SRC A;  1NYF A;  1KSW A;  5FWC A;  2YSQ A;  1TUD A;  2C0T A;  2DMO A;  2LQN A;  2CDT A;  2KBT A;  3VS2 A;  2DRK A;  4OMP A;  4RTX A;  1GFD A;  4OMN A;  1AZG B;  2RN8 A;  3EG2 A;  2J05 A;  4HVW A;  3ULR B;  3H0F A;  4QT7 A;  2KGT A;  2VWF A;  2LJ3 A;  2JM9 A;  4Z89 A;  1SRL A;  2JW4 A;  1WXT A;  2BZY A;  1YNZ A;  4AFS C;  3NMZ C;  1E6H A;  1X27 A;  1G2B A;  4J9G A;  1CKA A;  2EYY A;  2RPN A;  2LNH B;  2NUZ A;  1AZE A;  2M0Y A;  2RQT A;  2DL7 A;  1T3L A;  2PZ1 A;  3JV3 A;  2RMO A;  2BTT A;  2KRN A;  4J9C A;  3M0S A;  1HD3 A;  1RLQ C;  2RQU A;  2XMF A;  1YCS B;  1W6X A;  1AWJ A;  1WXB A;  1KFZ A;  4CC3 A;  1WXU A;  2L0A A;  2DIL A;  2DL8 A;  2PTK A;  1UTI A;  1JQQ A;  2DBK A;  1JXO A;  3H0H A;  2LJ1 A;  4HVU A;  1AD5 A;  1WIE A;  2YUO A;  3VS0 A;  1K0X A;  3ZL7 C;  4LE9 A;  2LJ0 A;  4RUG A;  2O2O A;  1LCK A;  1NLP C;  3PE0 A;  4J9H A;  2AZV A;  2JS0 A;  2FPF A;  2JT4 A;  2CRE A;  1ZUY A;  1T0H A;  1WLP B;  2VVK A;  3VS7 A;  3C0C A; 
#chains in the Genus database with same CATH topology
 3JCM P;  1KQS P;  2W0Z A;  3V7R A;  1OU8 A;  1VQL A;  3CCJ Q;  3DKM A;  4B6M A;  2FZK B;  3FDR A;  5FWB A;  2JM8 A;  2K2M A;  3QJY A;  3QPH A;  4F7U F;  2A28 A;  2CZ1 B;  3OS5 A;  5DM7 R;  3G6E T;  3A98 A;  2RB6 A;  3M0R A;  4M7D G;  1VQK T;  1HK9 A;  2QK0 A;  3RUX A;  2QG9 B;  3A8H B;  3GNF B;  3H8Z A;  1UGV A;  4BY6 B;  3JCM V;  5DLQ E;  4PJO C;  5A2Q E;  1KHC A;  3TU4 K;  3CCQ A;  2YRD A;  1SSF A;  2X3X D;  1C1A A;  1YI2 T;  1YP5 A;  3QZ5 B;  2J06 A;  3HRU A;  5LL6 S;  3EAE A;  4JDS A;  4OB3 B;  1M3C A;  3HP9 A;  1VQ9 Q;  2ZAE A;  4JJN K;  4X1V A;  3EH2 A;  4QKU A;  3GF5 A;  3RIR A;  4N4G A;  2PVG B;  2JTM A;  4OGE A;  3SDZ A;  1MMN A;  2E5Q A;  1K73 U;  2HQX A;  3RKX A;  4JZ4 A;  1VQ9 A;  1N27 A;  2FRY A;  4PL6 A;  3L2Q A;  4ANJ A;  4M77 G;  3G4S Q;  3SWN B;  3QII A;  3QWX X;  1BBZ A;  1VQ7 T;  1OZ2 A;  3CCE A;  3I5R A;  2JUF A;  2NUT A;  1SPK A;  1M4Z A;  2ED0 A;  5AYF A;  3TRE A;  4KH0 B;  4A4G A;  1I5L A;  3CEY A;  1I1J A;  3EFO B;  4OB1 B;  1OEB A;  3CCJ T;  3VYG A;  3EHR A;  1PSF A;  2M16 A;  4BD3 A;  2VC8 A;  2BE7 D;  2AK5 A;  1D3B B;  2EBP A;  3EGU A;  4ZTJ A;  4VUB A;  1N8R U;  4Q5W A;  4ZN3 A;  2Y4X A;  1K9A A;  2EJ9 A;  1ZUU A;  2RQV A;  3R6N A;  4M7D B;  3KUF A;  4C8Q G;  2QAS A;  2W10 A;  2ZGW A;  4ZN1 A;  5I11 A;  1VQO Q;  2G6F X;  4E7L A;  2RHY A;  1X6O A;  5CKB A;  4C0D B;  3I55 Q;  2C06 A;  2QA4 A;  1EX4 A;  2H3J A;  2M9U A;  4IIO A;  5IT9 E;  1NBE B;  5CKD A;  5FRO A;  1GXI E;  1E6G A;  1Z9Q A;  2O88 A;  1AOJ A;  1U8R A;  4TVR A;  2OTL Q;  2DXC A;  5IHI A;  3I55 A;  1Q86 C;  1RL2 A;  1NM7 A;  1ZBJ A;  5KE2 A;  1G3S A;  3S3O A;  2CP6 A;  1VQ9 T;  3KXT A;  4B9W A;  2EIF A;  4CRI A;  2FPD A;  3EGX B;  2HKN A;  3PMI A;  2DJZ A;  1BI2 A;  2PVO B;  1AEY A;  3HFN A;  2CT4 A;  1PM3 A;  2O4X A;  3FJ5 A;  1JJ2 P;  1BCO A;  4DQ2 A;  4LUD A;  3CD6 Q;  3KBG A;  5KYU A;  2ESW A;  2LC4 A;  3G4S T;  3M4Y A;  3CCV A;  4M77 B;  4HCK A;  2K5I A;  2EGE A;  4J6Y A;  1UJY A;  2MOX A;  3CD6 A;  2VAS A;  2LCS A;  2DVJ A;  3I9Q A;  2ATC B;  1VQM T;  1QWF A;  2D9T A;  1M90 U;  2KEA A;  3RES A;  1V1C A;  2HCK A;  4LUE A;  1SEM A;  4AG1 C;  1OZ3 A;  1RI9 A;  3CCL T;  3AT1 B;  3REB B;  4E2F B;  4IIM A;  1WJS A;  4HCB A;  4LDV A;  4C5I A;  4F16 A;  3FC3 A;  1XNI A;  3QHS A;  5GAN e;  1NEG A;  3M0T A;  4C92 D;  1M3A A;  2J7I A;  5GAO n;  4FSX A;  1LVK A;  1WQW A;  2GTO A;  1TWB A;  1NEB A;  2RJF A;  1WFW A;  3QBY A;  1QCN A;  2JXB A;  1PC0 A;  3OYB A;  7AT1 B;  1FX7 A;  1K1Z A;  2VYT A;  4C8Q B;  1X43 A;  1X69 A;  1VQO T;  2EGA A;  1OPL A;  1KC8 C;  2MWO A;  4OML A;  3M54 A;  5KYW B;  2GFA A;  2AKK A;  2OTL T;  4Z02 A;  5CKF A;  2RQR A;  1K73 C;  1VQ4 Q;  3CC4 Q;  4NOY A;  1KK7 A;  4ESR A;  1D0Y A;  2EFI A;  5CKH A;  4AMC A;  2YRC A;  2L3R A;  4WCI A;  1VQ4 A;  3VRZ A;  3CCR Q;  1UGP B;  3EG3 A;  3FB9 A;  4BI3 A;  1HYO A;  3R6O A;  2F2V A;  1B34 B;  2LX7 A;  2QXF A;  3I5S A;  2KR3 A;  4QQ6 A;  3HPW A;  1ZA2 B;  4LNP A;  3PIO A;  1K9M R;  3OW2 P;  1XTD A;  1VA7 A;  2F1L A;  2LZ6 B;  4RKU E;  4A4K A;  2EQK A;  2LMJ A;  5LJ3 j;  3PNW C;  4F14 A;  2CT3 A;  1N8R C;  2V8I A;  3GOX A;  4FT2 A;  1PHT A;  2R58 A;  1S72 T;  2RNA A;  3CMA Q;  3EHQ A;  2M1H A;  2PUO B;  2RHZ A;  3OS1 A;  3MHX A;  4GLM A;  4HA8 A;  2RHU A;  2JS2 A;  1ZQ1 A;  2V8K A;  3JB9 I;  1LJO A;  2KY9 A;  2DNU A;  5GAM d;  2HBW A;  1WQ7 A;  1PCX A;  1UEB A;  3CMA A;  5KE3 A;  3IQL A;  2RD1 A;  5A0D A;  1PKS A;  1D0Z A;  1WJR A;  4M78 C;  4ME7 A;  4M75 C;  2DXB A;  1QMC A;  1PRM C;  2CH4 W;  1U1T A;  5GAN 3;  2COY A;  3RNJ A;  2VXF A;  2IVW A;  4MZP A;  4C0G A;  5GAN 6;  3VS2 A;  2KBT A;  5GAN 5;  2DAQ A;  2DRK A;  1VQ4 T;  2RN8 A;  4LXC A;  2J05 A;  3CC4 T;  5GMK e;  2LCC A;  3ULR B;  2QQR A;  1O75 A;  2KGT A;  4PJO D;  1QQJ A;  1V76 A;  5FLX E;  1SRL A;  5LJ5 d;  1WXT A;  3CCR T;  3A8O B;  4AFS C;  2CZ7 B;  3NMZ C;  3C4S A;  4C92 F;  1KD1 U;  1VQ5 Q;  2XG8 D;  2RPN A;  1JB0 E;  2LNH B;  2NUZ A;  1WJQ A;  4C92 E;  1G3W A;  1T3L A;  5M9O A;  2RJE A;  1AWJ A;  1BI1 A;  2KI7 A;  4CC3 A;  4BY6 C;  1JQQ A;  3V8L A;  1ZA1 B;  3CME Q;  1YIT A;  2K5F A;  4A54 A;  1I8F A;  4HVU A;  1M1K R;  4PJN A;  3QXE B;  4M7D F;  4OB0 B;  3ZL7 C;  4LE9 A;  3CCM Q;  1SF9 A;  2LJ0 A;  3SD4 A;  4FL6 A;  5CO7 A;  1ZUY A;  1T0H A;  1VIE A;  2VVK A;  4M7A A;  2DEU A;  2HNI A;  3VS7 A;  2LCL A;  2D1X A;  1Y71 A;  2MPX C;  1Q82 R;  2CUB A;  2QEX T;  1C6V X;  2DXU A;  3GIB A;  3JRZ A;  2ZPB B;  1Y0M A;  5GAN 4;  4OP0 A;  2EWN A;  2L8D A;  1RI0 A;  1UGS B;  2HQH A;  4N0A C;  2DZ9 A;  1NG2 A;  5HK0 A;  4RTV A;  1QVG S;  2HZY A;  4CC4 B;  1SHG A;  1VQ8 Q;  2DIQ A;  2E41 A;  2FEI A;  4E7S A;  3ZFJ A;  3RKW A;  1UB4 A;  4M4Z A;  3J81 E;  4R0K A;  1VQ5 T;  1Q7Y R;  1KHI A;  1WI7 A;  1N5Z A;  1VQ8 A;  1KG1 A;  3A8G B;  5KYX A;  5GAM f;  4BE1 A;  1NLO C;  3QG1 A;  2NLU A;  2VKN A;  2QQA A;  4M7D C;  1JXM A;  4IUV A;  2AIR B;  3EG1 A;  3CME T;  1IZ6 A;  4J7I A;  2MAM A;  1U1S A;  1YN8 A;  3OYC A;  3RR6 A;  3GLX A;  4BE2 A;  4C0D C;  3JCM b;  3UA6 A;  1ZHI A;  2YUP A;  3CCS Q;  1G83 A;  1ZSZ A;  2RJC A;  1QVF P;  3VS1 A;  3WVE B;  3CCM T;  3JCM J;  1LOJ A;  3JB9 G;  4C8Q F;  3MO8 A;  2DIG A;  2WSC E;  3JSC A;  2V1R A;  2KNB B;  5IHN A;  3OY9 A;  4JS4 A;  2YHT A;  1YWP A;  1M8M A;  3SB2 A;  4EIK A;  4ZGE B;  3P8H A;  4XTU A;  5D6W A;  1SKU B;  4PJO E;  4J9D A;  1MV0 B;  1Q86 U;  4L6V 5;  2DER A;  4MZM A;  1DJ7 B;  5LJ5 f;  2O4X B;  3A5Z B;  4EMH A;  3SHW A;  3RBB B;  3DB4 A;  2LP5 A;  5KYU B;  4XU2 A;  1U3O A;  2L3S A;  3H0I A;  4M77 C;  2RK1 A;  2MF2 A;  3OMC A;  3TSW A;  2P0K A;  1G5V A;  3WXM B;  1ABQ A;  3C12 A;  4J9E A;  2JOY A;  2F5T X;  1UEC A;  1VQL Q;  1ZLM A;  2CKK A;  2RQW A;  5KYY A;  4LD6 A;  1MUZ A;  1VQP Q;  4DA4 A;  4O5V A;  4LD9 K;  4ZGJ B;  3UWN A;  1PD0 A;  3JCM W;  3WVD B;  5GAN 7;  2KT8 A;  2EYX A;  3TVT A;  3QZ9 B;  4ZTF A;  3L2R A;  1VQP A;  1VYT A;  1OPK A;  2QAZ A;  2X4J A;  3MEA A;  4F7U E;  4LDU A;  5GAO p;  2DL3 A;  3CCQ Q;  1WYX A;  2RI2 A;  4C8Q C;  1G3Y A;  2X9H A;  4NL3 A;  5DLO A;  3VV0 A;  1E7O A;  3OS0 A;  4E7J A;  1Y96 B;  2L89 A;  2D0N A;  2ROT A;  2X35 A;  3CCS T;  3FIF A;  4V2S A;  1Y7X A;  1UG1 A;  3TQ7 P;  4JJD A;  4PLI A;  1OI1 A;  2G3R A;  5GAN d;  4KGV B;  1AHJ B;  3KFV A;  2K3B A;  4AFQ C;  4RG2 A;  1KC8 U;  1A0N B;  1W1F A;  3S3M A;  3DLM A;  4XAX B;  2HL3 A;  1WPY A;  4FCY A;  2RJD A;  5A0L A;  1QVP A;  5L23 A;  3CCE Q;  2X3W D;  2AKL A;  3CPF A;  2R5A A;  4EPC A;  1U5S A;  4J9F A;  1I0C A;  1IXD A;  1VQ6 A;  2C0O A;  1FMW A;  1OUL A;  5HCK A;  4DBQ A;  1BK2 A;  3SEM A;  4C5E A;  6AT1 B;  2NYS A;  4MDX A;  3MP1 A;  1VQL T;  1GL5 A;  2DL5 A;  4M78 D;  3LYI A;  3EH1 A;  4M75 D;  3M0U A;  5HY6 A;  3E9F A;  1RAA B;  2ZPE B;  1OU9 A;  5IH2 A;  2R57 A;  1BU1 A;  1U06 A;  1H92 A;  1IHW A;  4Z88 A;  4RCB A;  2XU8 A;  3CCU A;  1MV3 A;  3CC7 A;  4IUR A;  3OSS C;  1TUC A;  1R0B G;  2MK5 A;  2CUD A;  2LX9 A;  1H3Z A;  2BZX A;  5I2S A;  4M7A G;  2DD4 A;  3CCQ T;  2KRO A;  4HVV A;  2QA4 Q;  1I5O B;  4ORZ A;  1UUE A;  4JRQ A;  1M1F A;  2DZC A;  1RAC B;  3VRY A;  1ZSG A;  3VUB A;  1AWX A;  1QW1 A;  4XTX A;  1TG0 A;  4OMQ A;  2E65 A;  4PJJ A;  1M2O A;  1GCQ A;  2DX1 A;  1YJN A;  1MHN A;  1F1B B;  4EDU A;  2DEQ A;  2K3Y A;  1ACM B;  4EMK A;  1OV3 A;  2DET A;  4AFZ C;  2DLP A;  3JCM d;  3OS2 A;  1QLY A;  4II1 A;  4K11 A;  2E12 A;  2ZPG B;  4E7I A;  4DBF A;  2EYQ A;  3JCM X;  4R56 A;  4ATO A;  1YJW A;  2EQM A;  1YJ9 A;  5KH6 A;  4QW2 A;  3CCV Q;  2HSE B;  1BIA A;  4A63 B;  1Q81 R;  3CCE T;  3LLR A;  5J26 A;  2DXT A;  3INZ A;  3MET A;  4MMK A;  1RAE B;  2DRM A;  2FVU A;  2YUN A;  5GAM h;  5GAM g;  1FMK A;  2LQK A;  2MI6 A;  2OI3 A;  1NYG A;  3P8B B;  2DYB A;  1JBM A;  2MIO A;  4JLI A;  1BI3 A;  2QDL A;  5I21 A;  3CBM A;  2DVE A;  2GQI A;  4HCZ A;  4FYW B;  2VXE A;  1OOT A;  4XK8 E;  8ATC B;  1QVG A;  1FYN A;  1YBY A;  2P4T A;  2NUP B;  3RER A;  4XTY A;  3OYE A;  1VQN A;  4ZGD B;  2E5K A;  2LQW A;  3EFR A;  2KYM A;  2AZS A;  2HMA A;  1NYF A;  5GAN f;  3JAM E;  2CDT A;  1MNE A;  4J6W A;  2VUB A;  4BUG A;  4AT1 B;  1M90 R;  3H0F A;  2QA4 T;  4O6J A;  4M7A B;  3ER0 A;  5LJ3 e;  1P92 A;  2JNG A;  5LJ5 g;  5LJ5 h;  2JW4 A;  2QYZ A;  5KCH A;  5A0G A;  3I55 T;  3Q1J A;  2EYY A;  2KQW A;  2BUD A;  1AZE A;  2DL7 A;  4M78 F;  3JV3 A;  4M75 F;  4M7D D;  2BTT A;  2MYS A;  3QO3 A;  3M58 A;  1HD3 A;  1RLQ C;  4M78 E;  2A3L A;  4M75 E;  1KFZ A;  2HQE A;  3EG9 A;  1UTI A;  1NJI R;  2DD5 A;  1JXO A;  4J8O A;  2LJ1 A;  1LPL A;  2M0O A;  4DBR A;  3G7Z A;  1K8A R;  3CCV T;  5EG2 A;  4HT8 A;  4A4H A;  1MND A;  3M57 A;  4FYV B;  2YUO A;  1WHK A;  3UDC A;  3VS0 A;  4YTL A;  1K0X A;  3CD6 T;  3OYA A;  2E70 A;  2KK4 A;  4F04 B;  1K9M U;  3QDR B;  3MPU B;  3OA6 A;  2X4X A;  2COZ A;  3TCJ A;  4ELY C;  2XK0 A;  2JMC A;  1I4K 1;  3L2V A;  2OTJ A;  3SWN A;  4DOW A;  2L5Q A;  1GBR A;  2O9S A;  1JO8 A;  4J5Y A;  2E6N A;  4M77 D;  4R55 A;  1PSE A;  1HSQ A;  1TUG B;  3BDU A;  1UGR B;  3V7C A;  3EGD B;  4PFP A;  4C92 A;  2Y90 A;  4B9X A;  1X6G A;  3CBP A;  1Y57 A;  3UF4 A;  3OYN A;  1C0M A;  1YIJ A;  3G71 A;  1M9S A;  2OAW A;  1M2V A;  1MGQ A;  3JCM e;  1TU0 B;  2F5K A;  5CQY A;  4DBH A;  2PQW A;  1M5Q 1;  2PU9 B;  2DBM A;  4BE0 A;  3URG A;  1Y07 A;  2K4Y A;  2LDM A;  1CKB A;  5GJV B;  4LDW A;  3OQ5 A;  2L2P A;  2YUQ A;  2K79 A;  2E1H A;  3M9Q A;  1YHQ Q;  1CSK A;  4C8Q D;  5KYY B;  3L2W A;  4DEX A;  1VIF A;  5J39 A;  1M30 A;  2O31 A;  2DM1 A;  4BAC A;  1YHQ A;  3CC2 A;  1YWO A;  2KXC A;  4NS5 A;  4KH1 B;  3I56 Q;  2DTO A;  4XTW A;  4BDY A;  2GNC A;  2COW A;  2ZCF B;  2FZC B;  1YIT Q;  3VS5 A;  3HHT B;  2HSP A;  2EYW A;  4FIB A;  1TH7 A;  3TEE A;  1H3H A;  3I56 A;  2JJ9 A;  3HKS A;  4A4E A;  2L3P A;  1K4U S;  1UHC A;  2CP2 A;  5D6X A;  3OBW A;  4E47 A;  1M1K U;  1D1C A;  4JS5 A;  2J6F A;  2J6O A;  3CMA T;  2KE9 A;  3MEU A;  2XD0 A;  3I35 A;  4M7D E;  3PVL A;  2P0P A;  2KXD A;  3HRS A;  1T3S A;  3QKJ A;  4WTO B;  5GMK m;  3M5A A;  4P5N A;  3EG0 A;  1BKB A;  1JRI A;  4MZT A;  1X2Q A;  2CZ6 B;  2ENM A;  5FU6 C;  4C5G A;  1NPP A;  2QGF B;  1Q82 U;  4RG8 A;  4QVD A;  3AHU A;  3LH5 A;  3OSV A;  1JJ2 S;  3QYH B;  2WSF E;  4J83 A;  4D8K A;  1BIB A;  3PIP A;  5GMK j;  1M1G A;  4JPB W;  3OYG A;  2DA9 A;  2NUT B;  3M0P A;  2E3H A;  4J9I A;  4ZNX A;  1EFN A;  2K3X A;  4PJO A;  1SRM A;  2CSQ A;  1IB8 A;  4OMO A;  5KYW A;  5C6S A;  4M77 F;  1LNX A;  2MWP A;  3M56 A;  2JVV A;  2EPD A;  4DEY A;  4M77 E;  5GAN g;  5GAN h;  1Q7Y U;  2BIV A;  2YRV A;  2LNV A;  1K9M C;  2A08 A;  2P84 A;  4A53 A;  1VOM A;  1D1A A;  3L1A A;  2Y4Y A;  3OMG A;  4J6X A;  2KAF A;  2LT1 A;  3UAT A;  1R77 A;  4KGZ B;  1YIT T;  4QQG A;  1XOV A;  1V29 B;  1TS9 A;  2QTV A;  2AHJ B;  2OX7 A;  3E2U A;  5D6Y A;  1AT1 B;  2FZG B;  3OYD A;  2XDP A;  1SHF A;  4BI4 A;  1RAI B;  3NTH A;  4RTU A;  1B34 A;  2HBP A;  5GAN 8;  1R8O B;  5C0M A;  4M7A F;  2E10 A;  3VKI A;  5CR2 A;  2A7Y A;  3M0Q A;  2X4Y A;  4F7U A;  2EYZ A;  4C8Q E;  3BDL A;  5IXB A;  3G6E A;  2GTJ A;  3ZBD A;  1W4S A;  1VQK A;  4XU1 A;  3RKY A;  4RTW A;  2RM4 A;  1PG5 B;  1PRL C;  4BB7 A;  2QTX A;  3QWY A;  3OYK A;  2EVR A;  1GFC A;  1YI2 Q;  1GBQ A;  3A1P A;  5FRM A;  1IRX A;  4X34 A;  3UA7 A;  3QSU A;  4AFU C;  2K57 A;  3GBQ A;  3H9N A;  1S1N A;  1YI2 A;  4GBQ A;  2E3I A;  1J3T A;  1WHH A;  1M3B A;  2KVQ G;  4HKE A;  4AG2 C;  2EKO A;  2X51 A;  3PVQ A;  1I81 A;  5IHK A;  2FG0 A;  2NWM A;  1N9R A;  1Q86 R;  2F2W A;  3SFM A;  2K6D A;  2WAC A;  3V8J A;  3OW2 S;  1VQ8 T;  4LDX A;  3OBY A;  1B7T A;  4CC2 A;  1OX8 A;  4MDW A;  3NPF A;  4KBM B;  4F17 A;  3TSZ A;  4BDZ A;  1OQK A;  3E1S A;  4JZ3 A;  2KDS A;  1IGQ A;  4J7F A;  4C92 G;  3CBO A;  2EJG A;  2ED1 A;  3ME9 A;  1QP3 A;  5GAM j;  2DF6 A;  4UC4 A;  1M27 C;  4KGX B;  3A8M B;  3MEW A;  1VQ7 A;  4PFO A;  3JCM g;  2YLC A;  1M1K C;  1D1B A;  2DPP B;  4M7A C;  1TSF A;  2KSS A;  2DTH A;  4QVC A;  3X25 B;  2CZ0 B;  4OGC A;  3NFC A;  2HEQ A;  1T0J A;  5I2M A;  3LH0 A;  4NL2 A;  2ZZD A;  5IAY A;  2I0N A;  2GGR A;  4FYY B;  2DYI A;  1SSH A;  2JTF A;  3X26 B;  3CCJ A;  1WZO A;  2RI3 A;  2OJ2 A;  1D09 B;  3REA B;  2P4R A;  3PT9 A;  5GMK h;  2RHX A;  3G1J A;  1Q82 C;  5LJ3 d;  3EG9 B;  1KQ1 A;  2LTO A;  4RTY A;  5CVI A;  4EMG A;  2BZ8 A;  3H6Z A;  5CKE A;  1B3Q A;  3MKD A;  3THK A;  4PK4 A;  3C95 A;  2K9G A;  3VJP A;  5LJ5 j;  2DTI A;  1VQ6 Q;  5FU6 B;  3VUZ A;  1PKT A;  5FWC A;  3BFM A;  2E64 A;  1KC8 R;  2C0T A;  2DMO A;  4OMP A;  4RTX A;  1FWZ A;  1GFD A;  4OMN A;  4HVW A;  2VGN A;  3BY7 A;  2X4W A;  3T9N A;  1K73 R;  2BKD N;  2JZ2 A;  2JM9 A;  4Z89 A;  1Q7Y C;  4X9D A;  3CCU Q;  1VQP T;  4JUV A;  3CC7 Q;  1O9S A;  2DFU A;  4PNO A;  1X27 A;  1ZSZ C;  2E6Z A;  3CXC S;  1G2B A;  2M0Y A;  3A8L B;  2RQT A;  4C92 B;  1UGQ B;  2P0Q A;  2RMO A;  3G4S A;  4J9C A;  1VQM Q;  2GCX A;  2CP5 A;  1W6X A;  1WXB A;  2QQB A;  3GPL A;  1WXU A;  2DL8 A;  2WSE E;  2PTK A;  4KUD K;  2D0Q B;  4XTV A;  1M2V B;  1WHG A;  1W2B S;  1YJN Q;  3CPW S;  1VQM A;  3CCL Q;  3PGG A;  2XDB A;  1N8R R;  2O01 E;  2F69 A;  4FYX B;  4A4F A;  3MEV A;  3L42 A;  3PTA A;  1LCK A;  1NLP C;  3CCL A;  4PJM A;  2FPF A;  1YJW Q;  2JT4 A;  1YJ9 Q;  2CRE A;  3X28 B;  5D7U A;  1WLP B;  2ZPF B;  4PJO G;  4PLL A;  1NE8 A;  2KMT A;  2QDY B;  3U23 A;  1KIK A;  3UT1 A;  1JEG A;  1TTH B;  1Q81 U;  1UDL A;  1VQ6 T;  4Z8A A;  2GF7 A;  1VQO A;  1PD1 A;  2JMA A;  4OF1 A;  4IKF A;  4RTT A;  1WHL A;  1JJ2 A;  3JB9 D;  5GMK l;  2VV5 A;  3LX7 A;  3J80 E;  1RUW A;  3DLL A;  2AT1 B;  5FU7 C;  2OTL A;  1AWO A;  1VQN Q;  5AT1 B;  4M78 A;  3OB9 A;  2KRS A;  4M75 A;  2JN0 A;  2DJQ A;  4RMO A;  4OMF B;  3VS3 A;  4BI8 B;  9ATC B;  4JRP A;  1WHM A;  2GFU A;  3CCU T;  3CC7 T;  2RO0 A;  2ABL A;  1BI0 A;  1G3T A;  2A37 A;  1EIF A;  4CI0 C;  5J3B A;  1OYX A;  4GY5 A;  2KYB A;  1QVG P;  2C0I A;  3JB9 J;  4F7U G;  1AWW A;  2LQ8 A;  5IXF A;  5L8R E;  4GLK A;  1VYV A;  4XQ3 A;  1UFF A;  4E7H A;  1QVF S;  1QP2 A;  3O5Z A;  1VYU A;  5LJ3 f;  1S72 Q;  4XU0 A;  1MMA A;  2KT1 A;  1YJN T;  4FU6 A;  2D8J A;  4FW1 A;  1IRE B;  3BE3 A;  3VU3 C;  1WX6 A;  3V7S A;  4RTZ A;  2HDA A;  1KJW A;  1GCP A;  1S72 A;  1TXQ A;  1WHJ A;  3E19 A;  2RI5 A;  3CQT A;  4FSS A;  1RAF B;  2HKQ B;  1YJW T;  1YJ9 T;  2EJF A;  2EGC A;  1IGU A;  1PWT A;  5CAI A;  4L59 A;  5GJW B;  2Z0W A;  2DKG A;  2EQI A;  1NJI U;  1Y96 A;  4PJO B;  1MMD A;  1YCY A;  4D6W A;  2JTE A;  1K0S A;  2H3E B;  1NPR A;  2M02 A;  1K8A U;  2V1Q A;  3NGP A;  4Y28 E;  2ZPI B;  1RLP C;  1UE9 A;  2CP7 A;  1Q95 G;  3MP6 A;  1KQS S;  5I22 A;  2IIM A;  2GBQ A;  2HD0 A;  5KYX B;  4WF2 A;  3GNG A;  4KRT A;  1FXX A;  3FEO A;  1VQN T;  3LGF A;  2OTJ Q;  2K7A A;  5GMK i;  1WNL A;  3CC4 A;  3F70 A;  3OW2 A;  1BB9 A;  4FT4 A;  5ECA A;  5CK9 A;  2BE9 B;  2V8J A;  4JJB A;  1ABO A;  1GCQ C;  1ZSZ B;  3CCR A;  5GAN j;  1QWE A;  1ZUK A;  1N6A A;  3FJP A;  2PNI A;  1YIJ Q;  3G71 Q;  1QCO A;  4OB2 B;  4EMK C;  4N0A A;  3OYH A;  2FB7 A;  4F7U B;  4JJC A;  1NZ9 A;  1IO6 A;  1RAG B;  1Z9Z A;  3EFO A;  3J7A F;  2XKO C;  3JCM f;  4CC7 A;  2M51 A;  1RAB B;  2L3Q A;  3MP8 A;  1XJW B;  4IUQ A;  2CS7 A;  5GAN 2;  3C94 A;  3JB9 F;  2KRM A;  1QKX A;  1D3B A;  2IPO B;  5GAO l;  4IUU A;  2CH4 A;  2K2V A;  1K76 A;  2RHI A;  2K5L A;  3PFS A;  4PFZ A;  4KUI A;  1YFN A;  5KYN A;  3LWH A;  4M7D A;  1IHV A;  2E4H A;  1G8X A;  3M59 A;  4M7A D;  3OYM A;  1ZX6 A;  2YXY A;  1Q81 C;  3CC2 Q;  4IUT A;  4LDY A;  3X24 B;  2XID A;  1XQH A;  3FLG A;  2QEX Q;  1OX9 A;  2H8H A;  3L2U A;  1MMG A;  1VUB A;  3ZEH A;  5FRN A;  2CP3 A;  1B07 A;  4L5G A;  3E9G A;  3N5B B;  2RA2 A;  2QEX A;  2B8A A;  3M4G A;  1X01 A;  4ELZ C;  2EQU A;  2XI9 A;  2OTJ T;  3LGL A;  3VS4 A;  5FU7 B;  3EGX A;  4XU3 A;  2LRQ A;  1SG5 A;  1JU5 C;  2FPE A;  4X9C A;  2DE0 X;  2CYZ B;  2QI2 A;  1H8K A;  1AVZ C;  3MCA B;  1KD1 R;  1I07 A;  1KQ2 A;  3CXC A;  1ARK A;  1GRI A;  4M77 A;  1M90 C;  4Y92 A;  3S6W A;  2FL7 A;  1X75 C;  1X6B A;  2CSI A;  3G71 T;  1YIJ T;  2A36 A;  1N9S A;  1VQ5 A;  2D6F A;  3EFS A;  4IUP A;  1H64 1;  3P8D A;  3QJ6 A;  5EC7 A;  3QDF A;  3NHN A;  2NUP A;  2SEM A;  3CXC P;  3HTR A;  2DK3 A;  1QKW A;  3D7S B;  3QUI A;  3RMS A;  2J6K A;  1W2B A;  5FW9 A;  2EKH A;  2F2X A;  2ROL A;  3H41 A;  2D8H A;  3CPW A;  4LN2 A;  3O8V A;  1HJD A;  3CME A;  3UPU A;  1W70 A;  2QQS A;  1M8V A;  2XDD A;  2CGH A;  2FO0 A;  2PUK B;  3QYG B;  2EW3 A;  3BW1 A;  1X2K A;  4J9B A;  4KUL A;  1W2B P;  1NJI C;  4OMM A;  4E7K A;  1QCF A;  1RAD B;  3DB3 A;  1WGS A;  3CPW P;  4M78 G;  3CCM A;  2FYK A;  1K8A C;  4M75 G;  1BYM A;  4C8Q A;  2O9V A;  1YHQ T;  2DL4 A;  3CC2 T;  2ECZ A;  2QQ9 A;  2HL5 C;  3HSB A;  3OYL A;  5CQX A;  4D8D A;  3HL8 A;  3NTK A;  4HXJ A;  4PKC C;  3VS6 A;  3SWN C;  3JB9 H;  2YDL A;  2IG0 A;  1WDX A;  3GP8 A;  2RF0 A;  2RH2 A;  1UJ0 A;  2B86 A;  2YWW A;  3I56 T;  2FRW A;  4C92 C;  4FM4 B;  2A0F B;  3RMQ A;  2MCN A;  4XTZ A;  1D0X A;  2XHC A;  8AT1 B;  2EQJ A;  2MMP A;  5LJ3 h;  5LJ3 g;  4N4I A;  2DO3 A;  4Y91 A;  1WA7 A;  2ZPH B;  4JRI A;  4E6R A;  1PNJ A;  3OYF A;  2YT6 A;  3ASK A;  2V26 A;  2RK2 A;  5GAO q;  2LVM A;  5KCO A;  2YLB A;  1EZZ B;  2SRC A;  1UHF A;  1KSW A;  2YSQ A;  2VB6 A;  2CP0 A;  1TUD A;  2GQV A;  4KT0 E;  3G6E Q;  2LQN A;  4E7Z A;  3FRN A;  5GAM e;  1VQK Q;  3OYY A;  1AZG B;  2PVD B;  3EG2 A;  4M7A E;  3M53 A;  4EMK B;  1QVF A;  3V8K A;  4QT7 A;  4OVA A;  2I2L A;  5GAO r;  3OYJ A;  2VWF A;  2LJ3 A;  2QGG A;  2EAY A;  4HCC A;  2BZY A;  1HXD A;  1YNZ A;  1E6H A;  4C0Z A;  3OYI A;  1RAH B;  4J9G A;  3LWI A;  5DY9 A;  1CKA A;  3EGD A;  3HFO A;  3X20 B;  1R0C B;  3S3N A;  5IN1 A;  3LW5 E;  3CCS A;  2PZ1 A;  4PJO F;  2VGM A;  3RDV A;  2KRN A;  3M0S A;  2OAU A;  2XMF A;  2RQU A;  1YCS B;  4PJL A;  4C5H A;  2L0A A;  4HT9 A;  2DIL A;  4M78 B;  5CIU A;  2XIC A;  2DBK A;  4M75 B;  3H0H A;  3M55 A;  2FHD A;  3HRT A;  4DOV A;  3JCM Q;  3JCM c;  1FMV A;  4QQD A;  2LT4 A;  5LJ5 e;  4N4H A;  1AD5 A;  4C0F A;  1WIE A;  5HKC A;  4JRK A;  3VYH B;  2R5M A;  1VQ7 Q;  3NTI A;  1BCM A;  4JLG A;  2HAX A;  1KQS A;  5CCA A;  4RUG A;  2O2O A;  4FW2 A;  3MJX A;  3PE0 A;  4J9H A;  2AZV A;  2JS0 A;  5HK3 A;  1TOV A;  5GAO m;  4RCC A;  3L2Z A;  1ZBX A;  4QVZ A;  1KD1 C;  3PMT A;  3JCM h;  4MML A;  3C0C A; 
#chains in the Genus database with same CATH homology
 3U23 A;  2W0Z A;  1KIK A;  2JMC A;  2D1X A;  1JEG A;  5FWB A;  1UDL A;  2CUB A;  2JM8 A;  2K2M A;  4Z8A A;  1GBR A;  2JMA A;  2O9S A;  1JO8 A;  2A28 A;  1HSQ A;  4RTT A;  3A98 A;  1Y0M A;  3M0R A;  1X6G A;  1RUW A;  1AWO A;  1Y57 A;  1NG2 A;  3UF4 A;  4RTV A;  2KRS A;  1UGV A;  2OAW A;  2DJQ A;  4CC4 B;  1SHG A;  3VS3 A;  2FEI A;  2ABL A;  2X3X D;  1YP5 A;  2J06 A;  4M4Z A;  4R0K A;  2DBM A;  1WI7 A;  1N5Z A;  2A37 A;  2KYB A;  1NLO C;  1CKB A;  5GJV B;  2C0I A;  2L2P A;  1M3C A;  1AWW A;  5IXF A;  2VKN A;  1VYV A;  2YUQ A;  1UFF A;  4X1V A;  2K79 A;  3O5Z A;  1CSK A;  1VYU A;  1JXM A;  4DEX A;  1M30 A;  2O31 A;  3EG1 A;  2DM1 A;  1YN8 A;  4JZ4 A;  2KT1 A;  2FRY A;  3UA6 A;  2YUP A;  2D8J A;  1G83 A;  1WX6 A;  1YWO A;  2KXC A;  2HDA A;  1KJW A;  3QWX X;  4RTZ A;  1GCP A;  3VS1 A;  1BBZ A;  3I5R A;  2GNC A;  1SPK A;  3CQT A;  3VS5 A;  4FSS A;  2HSP A;  2EYW A;  2V1R A;  2KNB B;  2ED0 A;  5IHN A;  1H3H A;  4EIK A;  1YWP A;  1M8M A;  2EGC A;  1PWT A;  1I1J A;  4J9D A;  5GJW B;  2L3P A;  2EQI A;  1K4U S;  1MV0 B;  1UHC A;  1OEB A;  2JTE A;  1K0S A;  2V1Q A;  3EHR A;  3NGP A;  3SHW A;  3RBB B;  2J6F A;  2LP5 A;  2AK5 A;  2J6O A;  2EBP A;  3EGU A;  1RLP C;  1UE9 A;  2KE9 A;  1U3O A;  2L3S A;  3H0I A;  5I22 A;  3TSW A;  3I35 A;  2IIM A;  1K9A A;  2GBQ A;  1ABQ A;  1ZUU A;  2RQV A;  3PVL A;  4J9E A;  3R6N A;  2KXD A;  1T3S A;  1UEC A;  4KRT A;  1ZLM A;  2RQW A;  2K7A A;  2W10 A;  1MUZ A;  3EG0 A;  5I11 A;  2G6F X;  1X2Q A;  2ENM A;  2KT8 A;  4IIO A;  1BB9 A;  2EYX A;  3TVT A;  1E6G A;  1Z9Q A;  3LH5 A;  2O88 A;  5ECA A;  1AOJ A;  1VYT A;  4JJB A;  1ABO A;  1GCQ C;  1QWE A;  1OPK A;  1ZUK A;  5IHI A;  4D8K A;  2PNI A;  1NM7 A;  1ZBJ A;  4JPB W;  2DA9 A;  3M0P A;  2DL3 A;  4JJC A;  1WYX A;  1IO6 A;  1Z9Z A;  4J9I A;  4ZNX A;  1EFN A;  2FPD A;  4CC7 A;  1SRM A;  2M51 A;  2CSQ A;  2L3Q A;  4OMO A;  1E7O A;  1AEY A;  2CT4 A;  3FJ5 A;  2D0N A;  4LUD A;  2ROT A;  2KRM A;  1QKX A;  2EPD A;  1UG1 A;  2ESW A;  4DEY A;  4JJD A;  2CH4 A;  2A08 A;  1K76 A;  3KFV A;  4HCK A;  2EGE A;  2K3B A;  4AFQ C;  1UJY A;  1A0N B;  1W1F A;  3UAT A;  2MOX A;  1XOV A;  2LCS A;  2DVJ A;  3I9Q A;  1ZX6 A;  1QWF A;  2KEA A;  1V1C A;  2HCK A;  4LUE A;  5L23 A;  1SEM A;  1SHF A;  4AG1 C;  2X3W D;  2H8H A;  1RI9 A;  2AKL A;  4RTU A;  3REB B;  4IIM A;  4F16 A;  1U5S A;  4J9F A;  1I0C A;  1NEG A;  3M0T A;  1B07 A;  1M3A A;  2J7I A;  2C0O A;  5HCK A;  1BK2 A;  2GTO A;  3SEM A;  1NEB A;  3M0Q A;  1WFW A;  1GL5 A;  2DL5 A;  2EYZ A;  2JXB A;  5IXB A;  3VS4 A;  2GTJ A;  1K1Z A;  3M0U A;  1X43 A;  4RTW A;  1X69 A;  1PRL C;  1JU5 C;  3QWY A;  2FPE A;  2EVR A;  2EGA A;  1GFC A;  2DE0 X;  1OPL A;  5IH2 A;  1GBQ A;  4OML A;  1BU1 A;  1U06 A;  1H8K A;  1H92 A;  3UA7 A;  1AVZ C;  4Z88 A;  2AKK A;  4AFU C;  1I07 A;  1MV3 A;  1ARK A;  1GRI A;  4Y92 A;  3GBQ A;  1TUC A;  1S1N A;  1X6B A;  4GBQ A;  2CSI A;  2A36 A;  2CUD A;  1J3T A;  2RQR A;  1M3B A;  4AG2 C;  2BZX A;  3PVQ A;  2KRO A;  5IHK A;  4HVV A;  4ESR A;  2FG0 A;  2NWM A;  5EC7 A;  3NHN A;  2SEM A;  2F2W A;  1UUE A;  4ORZ A;  1QKW A;  2K6D A;  2J6K A;  3VRY A;  4WCI A;  5FW9 A;  1ZSG A;  2EKH A;  3VRZ A;  2F2X A;  2ROL A;  1AWX A;  3H41 A;  2D8H A;  4CC2 A;  3EG3 A;  1TG0 A;  4LN2 A;  3NPF A;  1HJD A;  4F17 A;  4OMQ A;  3TSZ A;  4JZ3 A;  1W70 A;  1GCQ A;  2DX1 A;  2FO0 A;  2EW3 A;  2ED1 A;  1X2K A;  2F2V A;  4J9B A;  2LX7 A;  3I5S A;  2DF6 A;  2KR3 A;  4OMM A;  1OV3 A;  1QCF A;  1M27 C;  4LNP A;  4AFZ C;  2DLP A;  1QLY A;  1VA7 A;  4K11 A;  2LZ6 B;  2O9V A;  2DL4 A;  2ECZ A;  2LMJ A;  4F14 A;  2CT3 A;  2HEQ A;  4D8D A;  1T0J A;  1PHT A;  4HXJ A;  4A63 B;  2RNA A;  2I0N A;  3VS6 A;  3EHQ A;  2GGR A;  4GLM A;  2YDL A;  1WDX A;  1SSH A;  2JS2 A;  2RF0 A;  1UJ0 A;  2B86 A;  2DRM A;  2OJ2 A;  2YUN A;  2DNU A;  1FMK A;  3REA B;  2FRW A;  2OI3 A;  2P4R A;  1NYG A;  2HBW A;  2DYB A;  2MIO A;  2MCN A;  3IQL A;  2QDL A;  2GQI A;  1PKS A;  1OOT A;  1WA7 A;  1FYN A;  4RTY A;  4E6R A;  2BZ8 A;  1PNJ A;  1B3Q A;  1PRM C;  3THK A;  2YT6 A;  2CH4 W;  2K9G A;  2E5K A;  2LQW A;  2KYM A;  2AZS A;  3RNJ A;  1PKT A;  1UHF A;  2SRC A;  1NYF A;  1KSW A;  5FWC A;  2YSQ A;  1TUD A;  2C0T A;  2DMO A;  2LQN A;  2CDT A;  2KBT A;  3VS2 A;  2DRK A;  4OMP A;  4RTX A;  1GFD A;  4OMN A;  1AZG B;  2RN8 A;  3EG2 A;  2J05 A;  4HVW A;  3ULR B;  3H0F A;  4QT7 A;  2KGT A;  2VWF A;  2LJ3 A;  2JM9 A;  4Z89 A;  1SRL A;  2JW4 A;  1WXT A;  2BZY A;  1YNZ A;  4AFS C;  3NMZ C;  1E6H A;  1X27 A;  1G2B A;  4J9G A;  1CKA A;  2EYY A;  2RPN A;  2LNH B;  2NUZ A;  1AZE A;  2M0Y A;  2RQT A;  2DL7 A;  1T3L A;  2PZ1 A;  3JV3 A;  2RMO A;  2BTT A;  2KRN A;  4J9C A;  3M0S A;  1HD3 A;  1RLQ C;  2RQU A;  2XMF A;  1YCS B;  1W6X A;  1AWJ A;  1WXB A;  1KFZ A;  4CC3 A;  1WXU A;  2L0A A;  2DIL A;  2DL8 A;  2PTK A;  1UTI A;  1JQQ A;  2DBK A;  1JXO A;  3H0H A;  2LJ1 A;  4HVU A;  1AD5 A;  1WIE A;  2YUO A;  3VS0 A;  1K0X A;  3ZL7 C;  4LE9 A;  2LJ0 A;  4RUG A;  2O2O A;  1LCK A;  1NLP C;  3PE0 A;  4J9H A;  2AZV A;  2JS0 A;  2FPF A;  2JT4 A;  2CRE A;  1ZUY A;  1T0H A;  1WLP B;  2VVK A;  3VS7 A;  3C0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...