1V1CA

Solution structure of the sh3 domain of obscurin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
IFDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the SH3 Domain of Obscurin
rcsb
source organism Homo sapiens
molecule tags Sh3-domain
molecule keywords OBSCURIN
total genus 4
structure length 68
sequence length 68
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1v1cA00
4HVUA 2YUQA 1AVZC 1UFFA 2F2WA 2JM9A 3LH5A 2JTEA 2AKLA 1G83A 1I07A 1WYXA 2LJ3A 1TG0A 2J7IA 2LJ1A 2KYBA 2KRSA 1M27C 1W6XA 2O31A 4RTXA 3REBB 2EYYA 1K0XA 2K3BA 1H8KA 1T0JA 4A63B 1OOTA 1WI7A 3EG3A 1BB9A 2RQVA 3I35A 4RUGA 3QWXX 5HCKA 2HBWA 2VWFA 1N5ZA 5ECAA 2GGRA 5FWCA 3A98A 2AZVA 1TUCA 1BBZA 2F2VA 2DL7A 2YUPA 2A36A 1GCQC 2RPNA 4D8KA 3ZL7C 1X6BA 2YT6A 2OJ2A 1H3HA 1YNZA 1B3QA 4ZNXA 2CUBA 2D0NA 1VYTA 1B07A 2O9VA 2A37A 2K2MA 2EYXA 2FEIA 2RQTA 1NEBA 3H0FA 4JZ3A 3VS4A 4KRTA 3RNJA 5IHNA 2BZXA 2K79A 1PKTA 2PNIA 1JEGA 1MV0B 1PRMC 4RTTA 2KNBB 4LNPA 2J6OA 1GFDA 1X6GA 1GBQA 1RLPC 4F14A 3VS5A 1T0HA 2EVRA 5EC7A 2KXCA 2O88A 4OMPA 2LZ6B 2DM1A 2W10A 1NG2A 1ARKA 1OEBA 2YSQA 3H41A 4RTUA 2AK5A 2HDAA 3JV3A 1OPKA 1GCPA 1WX6A 1UHCA 4ESRA 2ECZA 2EPDA 3TSZA 2DLPA 1JU5C 4M4ZA 2ED1A 1J3TA 2AZSA 2NWMA 1UG1A 2D8JA 2A08A 2HCKA 2FO0A 2X3XD 3NPFA 3RBBB 4AG1C 3M0RA 1M3AA 3VS2A 5IHIA 2MCNA 2RQWA 1PKSA 2GBQA 2O9SA 1ABOA 2DNUA 1ZUUA 1SEMA 4CC2A 4J9FA 4J9BA 2FPFA 1SRMA 1ZLMA 2ROLA 4HCKA 5IH2A 3M0UA 1SSHA 1UE9A 4FSSA 3EGUA 2DL8A 3R6NA 1MV3A 3VS0A 2FG0A 2L2PA 1AOJA 1AWWA 2RF0A 1I1JA 1WA7A 2KEAA 3NHNA 2CSIA 2VKNA 1M30A 2BTTA 4RTVA 4D8DA 2L0AA 2RMOA 5L23A 2DYBA 1X27A 3NMZC 2DMOA 3O5ZA 3PVLA 1GCQA 2V1QA 1WDXA 2DA9A 4OMMA 2JMAA 2YUOA 2DBKA 2LQNA 2BZ8A 4HVWA 1AD5A 2JM8A 4OMQA 4JJBA 3TVTA 2J06A 2KROA 1YP5A 1GFCA 1NLOC 2DX1A 3UF4A 4DEYA 3SHWA 2KBTA 1M8MA 4IIOA 4JJCA 2DBMA 4RTWA 2GNCA 4GLMA 4J9DA 1HD3A 2HEQA 4ORZA 1U3OA 2DVJA 2PTKA 1GRIA 3VRZA 4R0KA 3H0HA 2YUNA 1ZSGA 1KIKA 1WFWA 2LNHB 1UJ0A 2B86A 1ABQA 4OMNA 1RUWA 2D1XA 2CREA 4J9IA 1M3CA 3EHRA 1PNJA 2LMJA 3FJ5A 1E6HA 2CUDA 2NUZA 2FPEA 2CH4W 4QT7A 2I0NA 3KFVA 2C0IA 4F17A 1JXOA 1Z9ZA 1S1NA 1QWFA 1KSWA 2KT8A 1MUZA 1UUEA 2VVKA 2CT4A 1QLYA 2F2XA 1JXMA 4HXJA 2CT3A 2EGAA 2M51A 4K11A 5IHKA 1ZUYA 2DL4A 3REAB 1HSQA 2EYZA 3C0CA 3UATA 3PVQA 1H92A 1AWJA 3I5SA 1K4US 2FRWA 1K9AA 1X2QA 2JS0A 1UGVA 2OI3A 4AFZC 2D8HA 1QKXA 4E6RA 1OV3A 1BU1A 1CKBA 2RNAA 2KE9A 2ED0A 2L3PA 1WXBA 4CC4B 2MOXA 1U5SA 1UDLA 3IQLA 4JPBW 2DILA 2FRYA 2KRMA 3U23A 5IXFA 2QDLA 1GL5A 2JS2A 1GBRA 5I22A 1BK2A 3QWYA 2EGCA 3SEMA 2KT1A 5I11A 3VS6A 1QWEA 2EQIA 2DF6A 2EYWA 1EFNA 2KR3A 4Y92A 3VS7A 2P4RA 2L3SA 3M0QA 1YN8A 1T3SA 2L3QA 2MIOA 1SRLA 1ZBJA 1JO8A 2RQUA 1AZEA 4DEXA 3GBQA 4Z89A 1VYVA 3CQTA 2EW3A 1ZUKA 2CH4A 1OPLA 4AFUC 2CSQA 2ABLA 2J6FA 1M3BA 3VS1A 4AG2C 1W70A 1ZX6A 1IO6A 1T3LA 4IIMA 1NM7A 1LCKA 2E5KA 1X43A 3EHQA 4Z8AA 4LUDA 2RQRA 4RTZA 2DRKA 1WXTA 2X3WD 3UA7A 1VYUA 1NLPC 1TUDA 3PE0A 2KRNA 1SHFA 2DJQA 2KXDA 2GTOA 2C0TA 1CKAA 3I9QA 2K7AA 5GJWB 1G2BA 1NEGA 2W0ZA 1WIEA 4HVVA 4Z88A 4CC7A 4RTYA 2K6DA 1YCSB 2IIMA 2KGTA 2CDTA 4F16A 2G6FX 1RI9A 1YWPA 1I0CA 2V1RA 2JXBA 1VA7A 1PHTA 2H8HA 2EBPA 1WXUA 1FYNA 5GJVB 1K1ZA 3M0PA 2JMCA 1U06A 1UECA 1W1FA 3THKA 1RLQC 2M0YA 1AZGB 3NGPA 4J9CA 2LP5A 1Y0MA 3M0TA 2DL3A 2O2OA 1K76A 2YDLA 5FWBA 3EG0A 3EG2A 1E7OA 2DE0X 2EGEA 2JT4A 4X1VA 3ULRB 2ENMA 1E6GA 2C0OA 1YWOA 2LX7A 3UA6A 1X69A 3I5RA 5IXBA 3VRYA 2JW4A 1FMKA 4LUEA 1UTIA 2LQWA 2A28A 2FPDA 2GTJA 1WLPB 2DRMA 1JQQA 2K9GA 2LJ0A 1PWTA 4LN2A 3VS3A 3M0SA 1CSKA 2KYMA 2HSPA 1QKWA 4J9HA 4EIKA 1Z9QA 3TSWA 1X2KA 4LE9A 1SPKA 1V1CA 1AWOA 1AWXA 4GBQA 1KJWA 1NYGA 2GQIA 1UHFA 2ROTA 4J9GA 2EKHA 2SEMA 2ESWA 4JJDA 1PRLC 1KFZA 2OAWA 2PZ1A 1UJYA 1SHGA 2SRCA 1AEYA 1A0NB 2LCSA 2DL5A 4J9EA 1QCFA 4JZ4A 4WCIA 2AKKA 2XMFA 1K0SA 1HJDA 2J05A 5FW9A 1XOVA 4CC3A 1Y57A 2RN8A 2BZYA 4OMLA 4AFQC 3H0IA 4OMOA 4AFSC 2J6KA 1NYFA 3EG1A
chains in the Genus database with same CATH superfamily
4JS4A 4M7DC 1KC8R 2YUQA 4IUQA 4F04B 3LH5A 4XU0A 1K8AR 1ZQ1A 2LJ3A 3RKXA 4ZTFA 2C06A 2ZPEB 2O31A 3RMSA 3G4ST 1K0XA 2K3BA 1YFNA 1JBMA 1H8KA 4XTZA 4N0AA 1WHLA 1OOTA 2EQMA 2QQ9A 1ZBXA 2MI6A 3I35A 5FU7B 4XQ3A 3X24B 3OYYA 3OMGA 1BCMA 3PT9A 4E7LA 1YBYA 3ZFJA 2OTLQ 3X28B 2O4XA 1X01A 3J80E 1N6AA 2E64A 3T9NA 2LC4A 3M56A 5GANd 2LVMA 2YT6A 2EFIA 5KYUB 4BACA 4ZNXA 1VQPQ 1MMGA 2NUTB 2P0QA 2D0NA 3META 1VYTA 1B07A 2O9VA 3A8LB 4E2FB 2EYXA 2FEIA 5A2QE 3H0FA 3EFRA 4UC4A 2K3XA 2Y4YA 3QBYA 2QQBA 4X34A 1MV0B 1PRMC 4RTTA 3CC4T 4FW1A 1SG5A 4LNPA 2BIVA 1TUGB 1YHQQ 4A54A 2BE7D 3C12A 3VS5A 2YHTA 3BE3A 2KXCA 2OTJT 4OMPA 1WHGA 2W10A 1ARKA 2E3HA 4E7ZA 1OEBA 4J7IA 4EMKC 4IURA 4LDWA 1OULA 4ESRA 2ECZA 5GAOl 4RG2A 1C0MA 2DERA 2NWMA 1UG1A 3HP9A 3RUXA 4XAXB 1VQKQ 3VUZA 2D8JA 3CCEA 3HTRA 2BKDN 3MO8A 1JJ2A 3CCRA 4AG1C 3VS2A 4KBMB 1PKSA 2COYA 2LRQA 3RERA 4ZN1A 2DZCA 1ABOA 4J9FA 5FU6B 4J9BA 4B9WA 2QGGA 1QVGP 5J3BA 1SRMA 2DXUA 2ROLA 5IH2A 5LJ3j 2P0PA 1UE9A 1LPLA 5FRNA 4PJOE 3EGUA 2DL8A 1QP2A 4GLKA 3VS0A 4OMFB 1QCNA 1VUBA 1RL2A 1YITT 2O4XB 3OYNA 2QQRA 2RHZA 2VKNA 2BTTA 1KHIA 2E5QA 2RMOA 2DYBA 4YTLA 2I2LA 1RAEB 2CP5A 1X27A 3PVLA 2RHYA 3CCJT 4FT2A 4OMMA 3G4SA 2DEQA 2YUOA 2E4HA 2RHIA 1AD5A 3M4YA 3V7CA 5EG2A 3CBPA 4JJBA 1Q81C 3LGFA 3EFSA 1GFCA 1NJIR 3UF4A 4HKEA 2HQEA 1D0XA 4L59A 3NFCA 2P4TA 3TQ7P 1UEBA 2CP2A 3NTHA 3FB9A 2QAZA 1XJWB 2JJ9A 1M1KC 3E2UA 1I4K1 2PTKA 1VQLQ 4A53A 3CMEA 3CCUA 4R0KA 3G6EA 4WTOB 4OB1B 4ZGDB 1KG1A 1VQOT 1RAGB 2PQWA 4BI8B 5FROA 2B86A 1ABQA 1PG5B 2CKKA 3OYDA 3I55Q 3H6ZA 4F7UE 2D1XA 3OQ5A 2CREA 3L42A 1M3CA 3PNWC 3OYHA 1IREB 1OZ2A 3WVDB 1XQHA 3KFVA 3Q1JA 3BDUA 1JXOA 3MEVA 1QWFA 5HK3A 1YJNA 1Y96A 1MUZA 2VVKA 5LJ3f 3SFMA 3OY9A 3QKJA 5GAMh 4K11A 5IHKA 3G71T 3C94A 1S72T 2M9UA 3JB9F 1HSQA 3C0CA 1RAFB 1VQ7T 1AWJA 3I5SA 3HHTB 4R56A 1H3ZA 3QJ6A 2E10A 3R6OA 1M1FA 2KVQG 4M7DB 2A0FB 3CPWS 3S6WA 1QKXA 2ZPBB 3MP1A 3A8MB 3MP6A 4JRPA 1U5SA 1UDLA 5GMKh 4C92A 3FLGA 1GL5A 3A8GB 2NUTA 3INZA 2X51A 4ANJA 4KGXB 4R55A 3QWYA 3BW1A 3SEMA 2KT1A 4M78F 3MEUA 3VS6A 4LDYA 2EQIA 2XHCA 3GPLA 2EYWA 3EG9A 3OYIA 3VS7A 2P4RA 4E7SA 5GAMf 3CEYA 1QVFP 2ZPGB 2L3QA 5GAN2 4OP0A 4DBFA 1SRLA 2HKNA 1VQ9T 3GBQA 2XDPA 1ZUKA 5GMKm 2CSQA 2DTOA 4II1A 2J6FA 4M78D 2MYSA 3BY7A 2XKOC 1M3BA 1KK7A 2FYKA 4XU1A 1T3LA 2DD4A 4Z8AA 4RTZA 2DRKA 1BI0A 3CCVA 2V8KA 3MEWA 1FMWA 2RK2A 3P8DA 2DJQA 4FYVB 4JRIA 3CPWA 4B6MA 4PFOA 4J5YA 3GLXA 3L2RA 4HVVA 4XTYA 4Z88A 2HQXA 2ATCB 4RTYA 1R0BG 3HRSA 4J7FA 3MKDA 5KH6A 2O01E 1I0CA 2V1RA 2JXBA 2F1LA 4M78E 2DYIA 1K9MC 3JB9J 1YJNQ 2RI5A 1FYNA 2YRDA 1K1ZA 5L8RE 2JMCA 3M58A 2QI2A 4WF2A 4N4GA 2MWPA 1K76A 3EG2A 2EAYA 1QVGA 1E7OA 2DE0X 2EGEA 4X1VA 1U1TA 1VQKA 4PJOG 1W2BP 2DIGA 4M7AD 1ZHIA 2ZPFB 3DB4A 2E41A 2HL5C 1TU0B 1K8AC 3EFOA 1UGRB 2F5KA 5CIUA 3H9NA 1V76A 2FZGB 4M75G 2XD0A 1FMKA 3O8VA 1Q81R 1VQ4T 5CR2A 2LQWA 2X9HA 1TS9A 1WLPB 2RB6A 2QQAA 5I2SA 3EGDB 1OI1A 2FZKB 3QYGB 2LJ0A 2FB7A 1ZSZC 4F7UF 4J9HA 3CCET 4C8QF 4M77B 1SPKA 1V1CA 1AWXA 2CZ6B 1WZOA 4Y91A 1NYGA 1BI3A 1R0CB 2K57A 2M1HA 2SEMA 3VV0A 1WQWA 2QEXA 2DPPB 2OAWA 2PZ1A 4XTXA 2IG0A 4C0FA 2YRVA 2E65A 2CZ1B 5CK9A 2YLBA 4RKUE 1HJDA 5FW9A 1Y57A 3JB9G 4OMLA 4RCBA 2H3EB 3H0IA 1OU9A 1KD1U 1OU8A 2K2VA 2DD5A 2M0OA 2J6KA 3RESA 3GF5A 1UFFA 2F2WA 6AT1B 2JM9A 2JTEA 3CC7A 2AKLA 2K5LA 1WYXA 1TG0A 1HXDA 1QVPA 1Q7YC 4M7DA 2KYBA 2JVVA 3PTAA 5LJ3d 4RTXA 3J7AF 3A5ZB 5A0GA 2ZPIB 3EH1A 1GXIE 4C5EA 2JUFA 1T0JA 4A63B 1WPYA 4KH1B 4J83A 4HT9A 3AHUA 2HBWA 2VWFA 4C8QG 1N5ZA 4PJNA 3PIPA 3CCQA 2GGRA 4AT1B 1Y7XA 3A8OB 1BIBA 2RM4A 5CKDA 5GAN4 4OB2B 1KQSA 1NE8A 4ZTJA 1YCYA 3JSCA 3L2QA 1X6BA 4LDVA 2MPXC 1QVFA 1IHWA 1H3HA 1YNZA 2XU8A 1EZZB 1OZ3A 1TH7A 1VQLA 2COZA 1PSFA 2RQTA 1NEBA 5CQYA 1IGUA 4M7AC 4KULA 4JZ3A 4KRTA 4BB7A 2EJFA 3LH0A 4N4HA 3RNJA 1WHKA 5IHNA 1K8AU 4FIBA 2BZXA 1PKTA 3V8JA 2VC8A 1JEGA 3GIBA 1KC8U 4RMOA 2VV5A 3PIOA 2LQKA 4CRIA 4C8QA 2RJEA 1GFDA 1RLPC 1T0HA 4A4FA 3I56T 1NG2A 4RTUA 1N8RR 1VQNA 3JV3A 2K3YA 3TEEA 3CCJQ 3OS0A 2QXFA 2RI3A 1H641 1WX6A 2LNVA 5GANj 3PMTA 1G3TA 5KE2A 4M4ZA 2ED1A 3OYFA 4BE2A 3PFSA 2A08A 2DKGA 2H3JA 2HCKA 2X3XD 3CCLA 3M4GA 1NPRA 2DK3A 3RBBB 4PNOA 3X26B 3DLMA 3M0RA 2ZCFB 1M3AA 5IHIA 2MCNA 1YJ9T 1M5Q1 2IPOB 1PC0A 1Q7YR 4FYWB 1VQ9A 1ZUUA 1SEMA 1UB4A 5DM7R 4HCKA 3UPUA 4JDSA 2BUDA 1C6VX 2JZ2A 1WGSA 3L2WA 3R6NA 1MV3A 4MMKA 2YXYA 2FG0A 2L2PA 3JCMd 4PJOD 2RF0A 4BUGA 4M7AF 1NBEB 1M2OA 4PJOB 4HCCA 1Q86C 4RTVA 4IUUA 3QIIA 1ZSZA 3CCUT 3J81E 3ME9A 5KYWB 1WDXA 2DA9A 1D1AA 2JMAA 3CCMT 2DBKA 2LQNA 4HVWA 1LVKA 1N27A 2JM8A 2KROA 4C92G 3EH2A 5GAOp 4DEYA 1M1GA 2QTVA 1M8MA 3L2ZA 2D9TA 4IIOA 4JJCA 5GAOm 2PVGB 1VQ5A 1KD1R 5IAYA 1EX4A 4J9DA 1HD3A 2HEQA 4ORZA 1U3OA 4BD3A 4C8QB 2FL7A 2LTOA 5FU6C 3VRZA 2AT1B 3CD6A 2DXTA 1G3YA 1WFWA 1UJ0A 3JCMf 4IUPA 3CC7Q 1RUWA 1BIAA 2D0QB 5CKHA 3I55T 1M1KU 2CUDA 3JRZA 3QSUA 2OTLT 2I0NA 1PD1A 4GY5A 2HMAA 4JUVA 1Z9ZA 2KT8A 3ASKA 3OYGA 1Q82C 3OYAA 2CT4A 1P92A 1JXMA 3M5AA 2CT3A 2P0KA 1VQNT 3OYBA 2QEXQ 3UATA 4BE0A 1K4US 1Q82U 1K9AA 3CCLQ 2CYZB 5D6WA 1UGVA 2D8HA 1TTHB 1Q95G 5KYNA 5J26A 2KE9A 1RI0A 3CXCS 2QA4A 4DBQA 2FRYA 3V8LA 1M9SA 5IXFA 5GAOq 4FW2A 1MMNA 2JS2A 2MMPA 2XIDA 2RO0A 3QJYA 2G3RA 5KYXA 3CCVT 3G1JA 5I11A 2DF6A 2MF2A 1WHHA 4M7AA 1QVFS 3HPWA 3OS2A 5AT1B 4RCCA 1YITQ 2VASA 1VQ6A 2EIFA 5GMKl 4M75E 3FRNA 1Q7YU 2NUPA 3RKWA 5KCHA 1JJ2P 3CQTA 1VQ5Q 2CH4A 1OPLA 2E70A 2DO3A 5DLQE 1VIFA 1ZX6A 5HY6A 2E5KA 2A7YA 5CAIA 4PJOC 3LYIA 4XTVA 1VYUA 1TUDA 1VQKT 1SHFA 2GTOA 2XDDA 4MZPA 2W0ZA 3X20B 4CC7A 3CC4A 1B7TA 1M90C 3CBMA 2CDTA 1VQ5T 2G6FX 4VUBA 2EBPA 1WXUA 1RAAB 2OTJQ 4HCZA 3OYCA 5GMKe 3OYEA 1W1FA 1YHQT 4J9CA 3GNFB 3NGPA 1Y0MA 2EQKA 2O2OA 5FWBA 1FMVA 3CCVQ 4KGVB 4D6WA 2JT4A 3I56A 2EJGA 4ELZC 3P8HA 3CCRT 5KYWA 1YWOA 1VQPT 1O75A 1X69A 3M57A 4LUEA 1UTIA 2QEXT 1OX8A 4C92E 3EGDA 1D09B 4JLIA 4BI4A 2K9GA 3GNGA 4LN2A 2GFUA 3VS3A 2NUPB 3OW2S 1CSKA 2KYMA 3M55A 2QQSA 4A4EA 4QQ6A 3TSWA 1X6OA 4LE9A 2DVEA 4KUDK 1RAIB 1KJWA 3G4SQ 3HKSA 3N5BB 2ROTA 1WJQA 4KH0B 4M75C 4E47A 1M2VA 1R77A 1K73U 4M77E 3CC7T 3CXCP 5CQXA 4X9DA 4JJDA 2FVUA 1SHGA 3CCMA 2HQHA 1A0NB 2LCSA 3VYGA 5GAN8 4CI0C 4J9EA 3CCRQ 1QCFA 5KYUA 3RKYA 3TU4K 2MK5A 1X75C 1XOVA 1BI2A 3OSVA 2RN8A 3CMET 4AFQC 2PVDB 4OMOA 3AT1B 4AFSC 2HBPA 4MZTA 4EDUA 2ZPHB 3RMQA 3JCMV 1VIEA 4Y28E 3VKIA 1G83A 3G7ZA 2AIRB 4M78B 5GAOn 1Q86U 2LJ1A 1Y07A 2KRSA 4C5HA 3SWNC 1W6XA 4M7AG 3VJPA 4ZN3A 3CCUQ 3QXEB 3REBB 2HD0A 1I8FA 3CD6Q 2WSEE 1UGPB 3EG3A 1WI7A 1RABB 2BE9B 2L8DA 4RUGA 4LD9K 5FLXE 4DQ2A 5FWCA 2XI9A 2CZ0B 2AZVA 1IGQA 1VQ8A 1TUCA 4M7AB 4J6WA 3F70A 1BKBA 2DL7A 2YUPA 1K9MR 3L2UA 4D8KA 3EAEA 1YJ9Q 3HRUA 2OJ2A 1KQSP 2GCXA 3M54A 1B3QA 2K5IA 3E9FA 3KUFA 2XK0A 2E6NA 2CUBA 3BFMA 5GANe 4PJOF 4C92F 1MMAA 1WQ7A 2K2MA 5CKEA 4C5IA 3VS4A 3OBWA 3NTKA 5GANf 3PMIA 2K79A 1DJ7B 4NOYA 8ATCB 2X4XA 4MDXA 4C0ZA 2KNBB 1BI1A 2XICA 2E12A 1YITA 1VQ6Q 4C8QC 4HT8A 4FYXB 3I56Q 2QA4Q 2J6OA 4PJOA 1X6GA 3QO3A 5I2MA 4F14A 1D1BA 2O88A 2LZ6B 2DM1A 3E19A 4QQDA 3CCLT 3H41A 2AK5A 2KK4A 3CCJA 1IHVA 1WNLA 1VQMQ 1SKUB 4QVZA 1D1CA 3CCSQ 1VQNQ 3RDVA 1QCOA 1HK9A 3TSZA 3DB3A 3KXTA 4M78A 2EWNA 3NPFA 8AT1B 4X9CA 1EIFA 1WHJA 3L2VA 4QVCA 3MP8A 4CC2A 2MWOA 2LT1A 3MJXA 4L5GA 1YI2T 4FL6A 1M2VB 3M0UA 4FSSA 1MNEA 2ZAEA 2HSEB 1UGSB 3TREA 1AOJA 1AWWA 2HL3A 2JTFA 1WA7A 2KEAA 3NHNA 5CKFA 4V2SA 5LJ5h 2X4WA 3JAME 5IN1A 9ATCB 2L0AA 2DMOA 3O5ZA 1YHQA 1GCQA 4NL3A 3D7SB 4N4IA 2HNIA 2BZ8A 1C1AA 1QP3A 4C0DB 4OMQA 4C0GA 4EMKB 2J06A 1YP5A 4M77D 5GAMj 1NLOC 3FDRA 3SHWA 3JCMe 2DFUA 3CCMQ 4OB0B 3OA6A 2DBMA 4RTWA 2DZ9A 2GNCA 5IT9E 4PK4A 2PUKB 1WHMA 5C6SA 1YIJA 4O5VA 2DVJA 1PSEA 5DLOA 1GRIA 2F5TX 2Y4XA 2YUNA 5I21A 1KIKA 4C92D 2CP6A 4C8QE 2LNHB 2VGMA 4O6JA 1N8RU 4OMNA 2IVWA 4JLGA 1N9SA 4E7KA 1OQKA 4J9IA 3S3NA 2VGNA 1NPPA 2LMJA 3FJ5A 2FPEA 4C92C 1RAHB 2KMTA 1KC8C 2C0IA 2QTXA 3CCEQ 1BCOA 4F17A 3JCMW 4F7UB 1QQJA 1OYXA 5A0DA 4JS5A 1KSWA 1YJWT 4BY6C 5GAN3 1YIJQ 3JCMb 4M77F 1QLYA 2KAFA 2CP3A 2F2XA 4HXJA 1I5LA 3LX7A 2M51A 4M75A 2YRCA 2EYZA 1NJIU 2CP7A 1X2QA 4C5GA 1OV3A 3E1SA 3A1PA 1WXBA 4CC4B 2MOXA 4E7HA 3IQLA 4JPBW 2CP0A 1I5OB 2KRMA 4MDWA 2QDLA 3QPHA 5I22A 1BK2A 2VXFA 2P84A 3HRTA 1Q82R 2RK1A 3L1AA 2RD1A 4PJJA 2L3SA 3CPFA 5A0LA 3M0QA 4HA8A 4PFPA 1G8XA 5KE3A 1IB8A 1YJNT 1ZBJA 1JO8A 2LT4A 2RQUA 1AZEA 1MNDA 4Z89A 1VOMA 2EW3A 2PUOB 3JB9I 2OTJA 5LJ3h 1QMCA 3FJPA 3VS1A 4AG2C 3GOXA 5LL6S 4IIMA 1PM3A 1D3BB 4LUDA 2RQRA 3HSBA 2X3WD 3UA7A 2AHJB 2KQWA 3PE0A 2DIQA 2WACA 1CKAA 3I9QA 2K7AA 5GAN5 1WIEA 3OW2A 5LJ5e 3M53A 1RI9A 2L3RA 1YWPA 1VQ9Q 1VA7A 3SDZA 5GJVB 4KT0E 3M0PA 4C8QD 1UECA 3OMCA 4KUIA 1RLQC 3SB2A 2LP5A 3M0TA 1VQMA 3GP8A 2YDLA 4BDZA 5D6YA 5KYYB 2RJCA 4F7UG 3SD4A 2FHDA 5KYYA 1F1BB 2VUBA 3ULRB 1ACMB 4M75F 1MMDA 2GFAA 2ENMA 1E6GA 3QDRB 2KI7A 1AHJB 4M77A 3CC2A 4IUTA 5D6XA 3UA6A 3I5RA 3QYHB 4PJMA 5IXBA 2CZ7B 4Z02A 4ATOA 5M9OA 1VQ7Q 2A28A 2FPDA 1S72Q 2RA2A 2GTJA 4JRKA 3G71Q 4M75D 3JB9D 3KBGA 3M0SA 4ZGEB 4XK8E 3ER0A 5FRMA 2HSPA 3P8BB 1YI2A 1Z9QA 2KDSA 1X2KA 2COWA 3CMAT 3QUIA 3PGGA 1AWOA 3TCJA 3G6ET 4GBQA 3MHXA 5FU7C 2R5AA 4FYYB 2GQIA 1UHFA 2Z0WA 2DAQA 1VQ4Q 2KY9A 4J9GA 2EKHA 2DTHA 4DA4A 2ESWA 3JCMg 1KFZA 1KQ2A 3BDLA 4A4KA 3JCMh 4DOWA 1VQ8Q 1UJYA 3ZEHA 2SRCA 1PD0A 1VQLT 2GF7A 2DL5A 5GAMd 3FC3A 1ZA2B 2AKKA 2XMFA 1M8VA 2R57A 1TSFA 2J05A 2CGHA 5LJ5j 4OGEA 2F69A 2JTMA 5CCAA 3OYKA 5D7UA 1S72A 5AYFA 1NYFA 1AT1B 2E1HA 1VQ8T 1VQ7A 4HVUA 1AVZC 4EMHA 2QDYB 3S3MA 4BE1A 1I07A 4LDXA 2EQJA 2HAXA 2DJZA 2J7IA 2NYSA 2HZYA 4DBRA 1BYMA 4OF1A 3DKMA 3SWNA 1M27C 2VYTA 4TVRA 3FEOA 1W4SA 1XNIA 4FT4A 2EYYA 3OSSC 3OS1A 3G6EQ 2MAMA 1K73C 5GAMe 3CMAQ 4N0AC 1YIJT 1BB9A 2RQVA 3UWNA 5KYXB 3QWXX 5HCKA 2LX9A 2X35A 5ECAA 1K9MU 2LCCA 4A4HA 3A98A 2OAUA 1BBZA 2F2VA 5LJ5g 2RJFA 2A36A 1GCQC 2LQ8A 2RPNA 4M7DG 2QASA 3ZL7C 4EMGA 4M7AE 3OS5A 4PKCC 2A37A 1JB0E 1YJWA 4XU2A 2KSSA 1Q86R 1Y71A 1KHCA 2PNIA 3SWNB 4QKUA 4ELYC 1GBQA 4QW2A 2EVRA 5EC7A 1RADB 3CMAA 3OW2P 2DXCA 2YSQA 2A3LA 2PU9B 3QZ5B 4P5NA 2HDAA 5GAN6 5GMKi 2M16A 1OPKA 2GQVA 4QVDA 1GCPA 1UHCA 2EPDA 2DLPA 1JU5C 1J3TA 1G3SA 2ZGWA 2AZSA 5KCOA 3A8HB 2Y90A 4ME7A 4FU6A 4JJNK 2FO0A 1M90U 1K73R 1R8OB 5CVIA 2LCLA 2GBQA 2RQWA 4MMLA 4NS5A 2O9SA 1D0ZA 2X4YA 1YI2Q 1W2BS 2DNUA 1D3BA 7AT1B 2FPFA 1ZLMA 1MGQA 1SSHA 1N9RA 2XG8D 1VQOQ 3V7SA 1D0YA 3CXCA 1MHNA 3QDFA 1FXXA 4Q5WA 1FX7A 2DEUA 1TOVA 1WJSA 1U1SA 1I1JA 2K5FA 2NLUA 2CSIA 2PVOB 1M30A 3X25B 2QG9B 3VU3C 4D8DA 3MEAA 4LDUA 4OVAA 3UT1A 5L23A 3HL8A 3NMZC 3CCST 2V1QA 3JCMX 4XTWA 5C0MA 5DY9A 1O9SA 1OX9A 3TVTA 3C4SA 4M7DD 2DX1A 3JCMP 4E7JA 3RR6A 2KBTA 5HK0A 3OYLA 3M9QA 4DBHA 1YJ9A 1JJ2S 4GLMA 1B34B 4J6XA 4PL6A 5LJ3g 2ZZDA 2FZCB 1G3WA 1LNXA 2DXBA 3C95A 1YJWQ 3H0HA 4PFZA 2EQUA 1I81A 1ZSGA 4J6YA 3OYJA 1IXDA 2VB6A 1ZA1B 1U8RA 3MCAB 2R58A 3EHRA 1PNJA 1E6HA 2NUZA 3JCMJ 2CH4W 1SSFA 1TWBA 4QT7A 3LLRA 1M4ZA 1S1NA 3QG1A 3QHSA 4BDYA 1UUEA 4XU3A 3JB9H 5LJ5d 3QZ9B 1ZSZB 3EGXA 4KGZB 4M7DE 2EGAA 2B8AA 2VXEA 2RI2A 1ZUYA 3JCMc 2DL4A 3REAB 3CCQT 3PVQA 1H92A 1VQOA 2FRWA 2OX7A 1SF9A 2JS0A 2OI3A 4AFZC 2DETA 4E6RA 1BU1A 1CKBA 2RNAA 1WJRA 5CO7A 1RACB 3JCMQ 2ED0A 2L3PA 2V8IA 5GMKj 4F7UA 3CC4Q 1NZ9A 1TXQA 2DILA 3U23A 2RHXA 4QQGA 4AMCA 1JRIA 2WSCE 3CBOA 5LJ3e 1Q81U 1GBRA 4OB3B 4EMKA 4LD6A 3CMEQ 4B9XA 4L6V5 2EGCA 2V26A 4RG8A 1QWEA 4M77G 3I55A 4C0DC 3EG1A 1EFNA 2KR3A 4Y92A 4HCBA 5J39A 1YN8A 1T3SA 2RJDA 4M78G 4EPCA 1G5VA 2MIOA 3OYMA 1LOJA 1KQ1A 2EJ9A 2RH2A 4DEXA 3EFOB 1VYVA 5LJ5f 3CC2Q 4AFUC 2ABLA 2QK0A 1W70A 1IO6A 4M75B 1M90R 1NM7A 1LCKA 3EHQA 1X43A 4PJLA 5GANh 1WXTA 5GANg 3V7RA 3MPUB 1M1KR 2JNGA 3CPWP 2K4YA 2YWWA 4E7IA 1NLPC 4FM4B 3OB9A 3URGA 2KRNA 2KXDA 2C0TA 2DTIA 1KQSS 5GJWB 1G2BA 1NEGA 2EYQA 2K6DA 4BI3A 3FIFA 1YCSB 2IIMA 2KGTA 1VQMT 3CC2T 4F16A 1NJIC 3OBYA 2XDBA 1PHTA 2H8HA 3LGLA 1U06A 3THKA 4DOVA 2M0YA 1AZGB 2QA4T 4BY6B 2L89A 2DL3A 5GAMg 1VQ6T 2R5MA 2JN0A 3WXMB 4IKFA 4J8OA 3EG0A 1W2BA 3VUBA 3M59A 3ZBDA 2QGFB 3LWIA 4XTUA 1V29B 4LXCA 1IRXA 2C0OA 1N8RC 1PCXA 2D6FA 2JOYA 3H8ZA 2LX7A 4MZMA 4C92B 4M7DF 3VRYA 2JW4A 4OGCA 3S3OA 2M02A 2HKQB 3CCQQ 1FWZA 4PLLA 2QYZA 3EG9B 2DRMA 3HFNA 4A4GA 1JQQA 2WSFE 1HYOA 2E3IA 1PWTA 4ZGJB 1QW1A 1QKWA 2X4JA 4EIKA 3RIRA 1LJOA 1IZ6A 3WVEB 1B34A 2E6ZA 5GAN7 3CD6T 3LW5E 1Y96B 3VYHB 3LWHA 2V8JA 1XTDA 5HKCA 4FCYA 1UGQB 1VQ4A 1PRLC 4JRQA 2EKOA 3G71A 2OTLA 4M77C 4IUVA 3V8KA 4FSXA 2LDMA 1AEYA 2RHUA 5GAOr 3E9GA 1VQPA 2L5QA 4JZ4A 4WCIA 1K0SA 3NTIA 2CS7A 4M78C 4CC3A 3DLLA 3HFOA 2BZYA 1QVGS 5CKBA 4PLIA 1KD1C 2YLCA 3CCSA 3UDCA 4NL2A 3EGXB
chains in the Genus database with same CATH topology
4HVUA 2YUQA 1AVZC 1UFFA 2F2WA 2JM9A 3LH5A 2JTEA 2AKLA 1G83A 1I07A 1WYXA 2LJ3A 1TG0A 2J7IA 2LJ1A 2KYBA 2KRSA 1M27C 1W6XA 2O31A 4RTXA 3REBB 2EYYA 1K0XA 2K3BA 1H8KA 1T0JA 4A63B 1OOTA 1WI7A 3EG3A 1BB9A 2RQVA 3I35A 4RUGA 3QWXX 5HCKA 2HBWA 2VWFA 1N5ZA 5ECAA 2GGRA 5FWCA 3A98A 2AZVA 1TUCA 1BBZA 2F2VA 2DL7A 2YUPA 2A36A 1GCQC 2RPNA 4D8KA 3ZL7C 1X6BA 2YT6A 2OJ2A 1H3HA 1YNZA 1B3QA 4ZNXA 2CUBA 2D0NA 1VYTA 1B07A 2O9VA 2A37A 2K2MA 2EYXA 2FEIA 2RQTA 1NEBA 3H0FA 4JZ3A 3VS4A 4KRTA 3RNJA 5IHNA 2BZXA 2K79A 1PKTA 2PNIA 1JEGA 1MV0B 1PRMC 4RTTA 2KNBB 4LNPA 2J6OA 1GFDA 1X6GA 1GBQA 1RLPC 4F14A 3VS5A 1T0HA 2EVRA 5EC7A 2KXCA 2O88A 4OMPA 2LZ6B 2DM1A 2W10A 1NG2A 1ARKA 1OEBA 2YSQA 3H41A 4RTUA 2AK5A 2HDAA 3JV3A 1OPKA 1GCPA 1WX6A 1UHCA 4ESRA 2ECZA 2EPDA 3TSZA 2DLPA 1JU5C 4M4ZA 2ED1A 1J3TA 2AZSA 2NWMA 1UG1A 2D8JA 2A08A 2HCKA 2FO0A 2X3XD 3NPFA 3RBBB 4AG1C 3M0RA 1M3AA 3VS2A 5IHIA 2MCNA 2RQWA 1PKSA 2GBQA 2O9SA 1ABOA 2DNUA 1ZUUA 1SEMA 4CC2A 4J9FA 4J9BA 2FPFA 1SRMA 1ZLMA 2ROLA 4HCKA 5IH2A 3M0UA 1SSHA 1UE9A 4FSSA 3EGUA 2DL8A 3R6NA 1MV3A 3VS0A 2FG0A 2L2PA 1AOJA 1AWWA 2RF0A 1I1JA 1WA7A 2KEAA 3NHNA 2CSIA 2VKNA 1M30A 2BTTA 4RTVA 4D8DA 2L0AA 2RMOA 5L23A 2DYBA 1X27A 3NMZC 2DMOA 3O5ZA 3PVLA 1GCQA 2V1QA 1WDXA 2DA9A 4OMMA 2JMAA 2YUOA 2DBKA 2LQNA 2BZ8A 4HVWA 1AD5A 2JM8A 4OMQA 4JJBA 3TVTA 2J06A 2KROA 1YP5A 1GFCA 1NLOC 2DX1A 3UF4A 4DEYA 3SHWA 2KBTA 1M8MA 4IIOA 4JJCA 2DBMA 4RTWA 2GNCA 4GLMA 4J9DA 1HD3A 2HEQA 4ORZA 1U3OA 2DVJA 2PTKA 1GRIA 3VRZA 4R0KA 3H0HA 2YUNA 1ZSGA 1KIKA 1WFWA 2LNHB 1UJ0A 2B86A 1ABQA 4OMNA 1RUWA 2D1XA 2CREA 4J9IA 1M3CA 3EHRA 1PNJA 2LMJA 3FJ5A 1E6HA 2CUDA 2NUZA 2FPEA 2CH4W 4QT7A 2I0NA 3KFVA 2C0IA 4F17A 1JXOA 1Z9ZA 1S1NA 1QWFA 1KSWA 2KT8A 1MUZA 1UUEA 2VVKA 2CT4A 1QLYA 2F2XA 1JXMA 4HXJA 2CT3A 2EGAA 2M51A 4K11A 5IHKA 1ZUYA 2DL4A 3REAB 1HSQA 2EYZA 3C0CA 3UATA 3PVQA 1H92A 1AWJA 3I5SA 1K4US 2FRWA 1K9AA 1X2QA 2JS0A 1UGVA 2OI3A 4AFZC 2D8HA 1QKXA 4E6RA 1OV3A 1BU1A 1CKBA 2RNAA 2KE9A 2ED0A 2L3PA 1WXBA 4CC4B 2MOXA 1U5SA 1UDLA 3IQLA 4JPBW 2DILA 2FRYA 2KRMA 3U23A 5IXFA 2QDLA 1GL5A 2JS2A 1GBRA 5I22A 1BK2A 3QWYA 2EGCA 3SEMA 2KT1A 5I11A 3VS6A 1QWEA 2EQIA 2DF6A 2EYWA 1EFNA 2KR3A 4Y92A 3VS7A 2P4RA 2L3SA 3M0QA 1YN8A 1T3SA 2L3QA 2MIOA 1SRLA 1ZBJA 1JO8A 2RQUA 1AZEA 4DEXA 3GBQA 4Z89A 1VYVA 3CQTA 2EW3A 1ZUKA 2CH4A 1OPLA 4AFUC 2CSQA 2ABLA 2J6FA 1M3BA 3VS1A 4AG2C 1W70A 1ZX6A 1IO6A 1T3LA 4IIMA 1NM7A 1LCKA 2E5KA 1X43A 3EHQA 4Z8AA 4LUDA 2RQRA 4RTZA 2DRKA 1WXTA 2X3WD 3UA7A 1VYUA 1NLPC 1TUDA 3PE0A 2KRNA 1SHFA 2DJQA 2KXDA 2GTOA 2C0TA 1CKAA 3I9QA 2K7AA 5GJWB 1G2BA 1NEGA 2W0ZA 1WIEA 4HVVA 4Z88A 4CC7A 4RTYA 2K6DA 1YCSB 2IIMA 2KGTA 2CDTA 4F16A 2G6FX 1RI9A 1YWPA 1I0CA 2V1RA 2JXBA 1VA7A 1PHTA 2H8HA 2EBPA 1WXUA 1FYNA 5GJVB 1K1ZA 3M0PA 2JMCA 1U06A 1UECA 1W1FA 3THKA 1RLQC 2M0YA 1AZGB 3NGPA 4J9CA 2LP5A 1Y0MA 3M0TA 2DL3A 2O2OA 1K76A 2YDLA 5FWBA 3EG0A 3EG2A 1E7OA 2DE0X 2EGEA 2JT4A 4X1VA 3ULRB 2ENMA 1E6GA 2C0OA 1YWOA 2LX7A 3UA6A 1X69A 3I5RA 5IXBA 3VRYA 2JW4A 1FMKA 4LUEA 1UTIA 2LQWA 2A28A 2FPDA 2GTJA 1WLPB 2DRMA 1JQQA 2K9GA 2LJ0A 1PWTA 4LN2A 3VS3A 3M0SA 1CSKA 2KYMA 2HSPA 1QKWA 4J9HA 4EIKA 1Z9QA 3TSWA 1X2KA 4LE9A 1SPKA 1V1CA 1AWOA 1AWXA 4GBQA 1KJWA 1NYGA 2GQIA 1UHFA 2ROTA 4J9GA 2EKHA 2SEMA 2ESWA 4JJDA 1PRLC 1KFZA 2OAWA 2PZ1A 1UJYA 1SHGA 2SRCA 1AEYA 1A0NB 2LCSA 2DL5A 4J9EA 1QCFA 4JZ4A 4WCIA 2AKKA 2XMFA 1K0SA 1HJDA 2J05A 5FW9A 1XOVA 4CC3A 1Y57A 2RN8A 2BZYA 4OMLA 4AFQC 3H0IA 4OMOA 4AFSC 2J6KA 1NYFA 3EG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVU A;  2YUQ A;  1AVZ C;  1UFF A;  2F2W A;  2JM9 A;  3LH5 A;  2JTE A;  2AKL A;  1G83 A;  1I07 A;  1WYX A;  2LJ3 A;  1TG0 A;  2J7I A;  2LJ1 A;  2KYB A;  2KRS A;  1M27 C;  1W6X A;  2O31 A;  4RTX A;  3REB B;  2EYY A;  1K0X A;  2K3B A;  1H8K A;  1T0J A;  4A63 B;  1OOT A;  1WI7 A;  3EG3 A;  1BB9 A;  2RQV A;  3I35 A;  4RUG A;  3QWX X;  5HCK A;  2HBW A;  2VWF A;  1N5Z A;  5ECA A;  2GGR A;  5FWC A;  3A98 A;  2AZV A;  1TUC A;  1BBZ A;  2F2V A;  2DL7 A;  2YUP A;  2A36 A;  1GCQ C;  2RPN A;  4D8K A;  3ZL7 C;  1X6B A;  2YT6 A;  2OJ2 A;  1H3H A;  1YNZ A;  1B3Q A;  4ZNX A;  2CUB A;  2D0N A;  1VYT A;  1B07 A;  2O9V A;  2A37 A;  2K2M A;  2EYX A;  2FEI A;  2RQT A;  1NEB A;  3H0F A;  4JZ3 A;  3VS4 A;  4KRT A;  3RNJ A;  5IHN A;  2BZX A;  2K79 A;  1PKT A;  2PNI A;  1JEG A;  1MV0 B;  1PRM C;  4RTT A;  2KNB B;  4LNP A;  2J6O A;  1GFD A;  1X6G A;  1GBQ A;  1RLP C;  4F14 A;  3VS5 A;  1T0H A;  2EVR A;  5EC7 A;  2KXC A;  2O88 A;  4OMP A;  2LZ6 B;  2DM1 A;  2W10 A;  1NG2 A;  1ARK A;  1OEB A;  2YSQ A;  3H41 A;  4RTU A;  2AK5 A;  2HDA A;  3JV3 A;  1OPK A;  1GCP A;  1WX6 A;  1UHC A;  4ESR A;  2ECZ A;  2EPD A;  3TSZ A;  2DLP A;  1JU5 C;  4M4Z A;  2ED1 A;  1J3T A;  2AZS A;  2NWM A;  1UG1 A;  2D8J A;  2A08 A;  2HCK A;  2FO0 A;  2X3X D;  3NPF A;  3RBB B;  4AG1 C;  3M0R A;  1M3A A;  3VS2 A;  5IHI A;  2MCN A;  2RQW A;  1PKS A;  2GBQ A;  2O9S A;  1ABO A;  2DNU A;  1ZUU A;  1SEM A;  4CC2 A;  4J9F A;  4J9B A;  2FPF A;  1SRM A;  1ZLM A;  2ROL A;  4HCK A;  5IH2 A;  3M0U A;  1SSH A;  1UE9 A;  4FSS A;  3EGU A;  2DL8 A;  3R6N A;  1MV3 A;  3VS0 A;  2FG0 A;  2L2P A;  1AOJ A;  1AWW A;  2RF0 A;  1I1J A;  1WA7 A;  2KEA A;  3NHN A;  2CSI A;  2VKN A;  1M30 A;  2BTT A;  4RTV A;  4D8D A;  2L0A A;  2RMO A;  5L23 A;  2DYB A;  1X27 A;  3NMZ C;  2DMO A;  3O5Z A;  3PVL A;  1GCQ A;  2V1Q A;  1WDX A;  2DA9 A;  4OMM A;  2JMA A;  2YUO A;  2DBK A;  2LQN A;  2BZ8 A;  4HVW A;  1AD5 A;  2JM8 A;  4OMQ A;  4JJB A;  3TVT A;  2J06 A;  2KRO A;  1YP5 A;  1GFC A;  1NLO C;  2DX1 A;  3UF4 A;  4DEY A;  3SHW A;  2KBT A;  1M8M A;  4IIO A;  4JJC A;  2DBM A;  4RTW A;  2GNC A;  4GLM A;  4J9D A;  1HD3 A;  2HEQ A;  4ORZ A;  1U3O A;  2DVJ A;  2PTK A;  1GRI A;  3VRZ A;  4R0K A;  3H0H A;  2YUN A;  1ZSG A;  1KIK A;  1WFW A;  2LNH B;  1UJ0 A;  2B86 A;  1ABQ A;  4OMN A;  1RUW A;  2D1X A;  2CRE A;  4J9I A;  1M3C A;  3EHR A;  1PNJ A;  2LMJ A;  3FJ5 A;  1E6H A;  2CUD A;  2NUZ A;  2FPE A;  2CH4 W;  4QT7 A;  2I0N A;  3KFV A;  2C0I A;  4F17 A;  1JXO A;  1Z9Z A;  1S1N A;  1QWF A;  1KSW A;  2KT8 A;  1MUZ A;  1UUE A;  2VVK A;  2CT4 A;  1QLY A;  2F2X A;  1JXM A;  4HXJ A;  2CT3 A;  2EGA A;  2M51 A;  4K11 A;  5IHK A;  1ZUY A;  2DL4 A;  3REA B;  1HSQ A;  2EYZ A;  3C0C A;  3UAT A;  3PVQ A;  1H92 A;  1AWJ A;  3I5S A;  1K4U S;  2FRW A;  1K9A A;  1X2Q A;  2JS0 A;  1UGV A;  2OI3 A;  4AFZ C;  2D8H A;  1QKX A;  4E6R A;  1OV3 A;  1BU1 A;  1CKB A;  2RNA A;  2KE9 A;  2ED0 A;  2L3P A;  1WXB A;  4CC4 B;  2MOX A;  1U5S A;  1UDL A;  3IQL A;  4JPB W;  2DIL A;  2FRY A;  2KRM A;  3U23 A;  5IXF A;  2QDL A;  1GL5 A;  2JS2 A;  1GBR A;  5I22 A;  1BK2 A;  3QWY A;  2EGC A;  3SEM A;  2KT1 A;  5I11 A;  3VS6 A;  1QWE A;  2EQI A;  2DF6 A;  2EYW A;  1EFN A;  2KR3 A;  4Y92 A;  3VS7 A;  2P4R A;  2L3S A;  3M0Q A;  1YN8 A;  1T3S A;  2L3Q A;  2MIO A;  1SRL A;  1ZBJ A;  1JO8 A;  2RQU A;  1AZE A;  4DEX A;  3GBQ A;  4Z89 A;  1VYV A;  3CQT A;  2EW3 A;  1ZUK A;  2CH4 A;  1OPL A;  4AFU C;  2CSQ A;  2ABL A;  2J6F A;  1M3B A;  3VS1 A;  4AG2 C;  1W70 A;  1ZX6 A;  1IO6 A;  1T3L A;  4IIM A;  1NM7 A;  1LCK A;  2E5K A;  1X43 A;  3EHQ A;  4Z8A A;  4LUD A;  2RQR A;  4RTZ A;  2DRK A;  1WXT A;  2X3W D;  3UA7 A;  1VYU A;  1NLP C;  1TUD A;  3PE0 A;  2KRN A;  1SHF A;  2DJQ A;  2KXD A;  2GTO A;  2C0T A;  1CKA A;  3I9Q A;  2K7A A;  5GJW B;  1G2B A;  1NEG A;  2W0Z A;  1WIE A;  4HVV A;  4Z88 A;  4CC7 A;  4RTY A;  2K6D A;  1YCS B;  2IIM A;  2KGT A;  2CDT A;  4F16 A;  2G6F X;  1RI9 A;  1YWP A;  1I0C A;  2V1R A;  2JXB A;  1VA7 A;  1PHT A;  2H8H A;  2EBP A;  1WXU A;  1FYN A;  5GJV B;  1K1Z A;  3M0P A;  2JMC A;  1U06 A;  1UEC A;  1W1F A;  3THK A;  1RLQ C;  2M0Y A;  1AZG B;  3NGP A;  4J9C A;  2LP5 A;  1Y0M A;  3M0T A;  2DL3 A;  2O2O A;  1K76 A;  2YDL A;  5FWB A;  3EG0 A;  3EG2 A;  1E7O A;  2DE0 X;  2EGE A;  2JT4 A;  4X1V A;  3ULR B;  2ENM A;  1E6G A;  2C0O A;  1YWO A;  2LX7 A;  3UA6 A;  1X69 A;  3I5R A;  5IXB A;  3VRY A;  2JW4 A;  1FMK A;  4LUE A;  1UTI A;  2LQW A;  2A28 A;  2FPD A;  2GTJ A;  1WLP B;  2DRM A;  1JQQ A;  2K9G A;  2LJ0 A;  1PWT A;  4LN2 A;  3VS3 A;  3M0S A;  1CSK A;  2KYM A;  2HSP A;  1QKW A;  4J9H A;  4EIK A;  1Z9Q A;  3TSW A;  1X2K A;  4LE9 A;  1SPK A;  1V1C A;  1AWO A;  1AWX A;  4GBQ A;  1KJW A;  1NYG A;  2GQI A;  1UHF A;  2ROT A;  4J9G A;  2EKH A;  2SEM A;  2ESW A;  4JJD A;  1PRL C;  1KFZ A;  2OAW A;  2PZ1 A;  1UJY A;  1SHG A;  2SRC A;  1AEY A;  1A0N B;  2LCS A;  2DL5 A;  4J9E A;  1QCF A;  4JZ4 A;  4WCI A;  2AKK A;  2XMF A;  1K0S A;  1HJD A;  2J05 A;  5FW9 A;  1XOV A;  4CC3 A;  1Y57 A;  2RN8 A;  2BZY A;  4OML A;  4AFQ C;  3H0I A;  4OMO A;  4AFS C;  2J6K A;  1NYF A;  3EG1 A; 
#chains in the Genus database with same CATH topology
 4JS4 A;  4M7D C;  1KC8 R;  2YUQ A;  4IUQ A;  4F04 B;  3LH5 A;  4XU0 A;  1K8A R;  1ZQ1 A;  2LJ3 A;  3RKX A;  4ZTF A;  2C06 A;  2ZPE B;  2O31 A;  3RMS A;  3G4S T;  1K0X A;  2K3B A;  1YFN A;  1JBM A;  1H8K A;  4XTZ A;  4N0A A;  1WHL A;  1OOT A;  2EQM A;  2QQ9 A;  1ZBX A;  2MI6 A;  3I35 A;  5FU7 B;  4XQ3 A;  3X24 B;  3OYY A;  3OMG A;  1BCM A;  3PT9 A;  4E7L A;  1YBY A;  3ZFJ A;  2OTL Q;  3X28 B;  2O4X A;  1X01 A;  3J80 E;  1N6A A;  2E64 A;  3T9N A;  2LC4 A;  3M56 A;  5GAN d;  2LVM A;  2YT6 A;  2EFI A;  5KYU B;  4BAC A;  4ZNX A;  1VQP Q;  1MMG A;  2NUT B;  2P0Q A;  2D0N A;  3MET A;  1VYT A;  1B07 A;  2O9V A;  3A8L B;  4E2F B;  2EYX A;  2FEI A;  5A2Q E;  3H0F A;  3EFR A;  4UC4 A;  2K3X A;  2Y4Y A;  3QBY A;  2QQB A;  4X34 A;  1MV0 B;  1PRM C;  4RTT A;  3CC4 T;  4FW1 A;  1SG5 A;  4LNP A;  2BIV A;  1TUG B;  1YHQ Q;  4A54 A;  2BE7 D;  3C12 A;  3VS5 A;  2YHT A;  3BE3 A;  2KXC A;  2OTJ T;  4OMP A;  1WHG A;  2W10 A;  1ARK A;  2E3H A;  4E7Z A;  1OEB A;  4J7I A;  4EMK C;  4IUR A;  4LDW A;  1OUL A;  4ESR A;  2ECZ A;  5GAO l;  4RG2 A;  1C0M A;  2DER A;  2NWM A;  1UG1 A;  3HP9 A;  3RUX A;  4XAX B;  1VQK Q;  3VUZ A;  2D8J A;  3CCE A;  3HTR A;  2BKD N;  3MO8 A;  1JJ2 A;  3CCR A;  4AG1 C;  3VS2 A;  4KBM B;  1PKS A;  2COY A;  2LRQ A;  3RER A;  4ZN1 A;  2DZC A;  1ABO A;  4J9F A;  5FU6 B;  4J9B A;  4B9W A;  2QGG A;  1QVG P;  5J3B A;  1SRM A;  2DXU A;  2ROL A;  5IH2 A;  5LJ3 j;  2P0P A;  1UE9 A;  1LPL A;  5FRN A;  4PJO E;  3EGU A;  2DL8 A;  1QP2 A;  4GLK A;  3VS0 A;  4OMF B;  1QCN A;  1VUB A;  1RL2 A;  1YIT T;  2O4X B;  3OYN A;  2QQR A;  2RHZ A;  2VKN A;  2BTT A;  1KHI A;  2E5Q A;  2RMO A;  2DYB A;  4YTL A;  2I2L A;  1RAE B;  2CP5 A;  1X27 A;  3PVL A;  2RHY A;  3CCJ T;  4FT2 A;  4OMM A;  3G4S A;  2DEQ A;  2YUO A;  2E4H A;  2RHI A;  1AD5 A;  3M4Y A;  3V7C A;  5EG2 A;  3CBP A;  4JJB A;  1Q81 C;  3LGF A;  3EFS A;  1GFC A;  1NJI R;  3UF4 A;  4HKE A;  2HQE A;  1D0X A;  4L59 A;  3NFC A;  2P4T A;  3TQ7 P;  1UEB A;  2CP2 A;  3NTH A;  3FB9 A;  2QAZ A;  1XJW B;  2JJ9 A;  1M1K C;  3E2U A;  1I4K 1;  2PTK A;  1VQL Q;  4A53 A;  3CME A;  3CCU A;  4R0K A;  3G6E A;  4WTO B;  4OB1 B;  4ZGD B;  1KG1 A;  1VQO T;  1RAG B;  2PQW A;  4BI8 B;  5FRO A;  2B86 A;  1ABQ A;  1PG5 B;  2CKK A;  3OYD A;  3I55 Q;  3H6Z A;  4F7U E;  2D1X A;  3OQ5 A;  2CRE A;  3L42 A;  1M3C A;  3PNW C;  3OYH A;  1IRE B;  1OZ2 A;  3WVD B;  1XQH A;  3KFV A;  3Q1J A;  3BDU A;  1JXO A;  3MEV A;  1QWF A;  5HK3 A;  1YJN A;  1Y96 A;  1MUZ A;  2VVK A;  5LJ3 f;  3SFM A;  3OY9 A;  3QKJ A;  5GAM h;  4K11 A;  5IHK A;  3G71 T;  3C94 A;  1S72 T;  2M9U A;  3JB9 F;  1HSQ A;  3C0C A;  1RAF B;  1VQ7 T;  1AWJ A;  3I5S A;  3HHT B;  4R56 A;  1H3Z A;  3QJ6 A;  2E10 A;  3R6O A;  1M1F A;  2KVQ G;  4M7D B;  2A0F B;  3CPW S;  3S6W A;  1QKX A;  2ZPB B;  3MP1 A;  3A8M B;  3MP6 A;  4JRP A;  1U5S A;  1UDL A;  5GMK h;  4C92 A;  3FLG A;  1GL5 A;  3A8G B;  2NUT A;  3INZ A;  2X51 A;  4ANJ A;  4KGX B;  4R55 A;  3QWY A;  3BW1 A;  3SEM A;  2KT1 A;  4M78 F;  3MEU A;  3VS6 A;  4LDY A;  2EQI A;  2XHC A;  3GPL A;  2EYW A;  3EG9 A;  3OYI A;  3VS7 A;  2P4R A;  4E7S A;  5GAM f;  3CEY A;  1QVF P;  2ZPG B;  2L3Q A;  5GAN 2;  4OP0 A;  4DBF A;  1SRL A;  2HKN A;  1VQ9 T;  3GBQ A;  2XDP A;  1ZUK A;  5GMK m;  2CSQ A;  2DTO A;  4II1 A;  2J6F A;  4M78 D;  2MYS A;  3BY7 A;  2XKO C;  1M3B A;  1KK7 A;  2FYK A;  4XU1 A;  1T3L A;  2DD4 A;  4Z8A A;  4RTZ A;  2DRK A;  1BI0 A;  3CCV A;  2V8K A;  3MEW A;  1FMW A;  2RK2 A;  3P8D A;  2DJQ A;  4FYV B;  4JRI A;  3CPW A;  4B6M A;  4PFO A;  4J5Y A;  3GLX A;  3L2R A;  4HVV A;  4XTY A;  4Z88 A;  2HQX A;  2ATC B;  4RTY A;  1R0B G;  3HRS A;  4J7F A;  3MKD A;  5KH6 A;  2O01 E;  1I0C A;  2V1R A;  2JXB A;  2F1L A;  4M78 E;  2DYI A;  1K9M C;  3JB9 J;  1YJN Q;  2RI5 A;  1FYN A;  2YRD A;  1K1Z A;  5L8R E;  2JMC A;  3M58 A;  2QI2 A;  4WF2 A;  4N4G A;  2MWP A;  1K76 A;  3EG2 A;  2EAY A;  1QVG A;  1E7O A;  2DE0 X;  2EGE A;  4X1V A;  1U1T A;  1VQK A;  4PJO G;  1W2B P;  2DIG A;  4M7A D;  1ZHI A;  2ZPF B;  3DB4 A;  2E41 A;  2HL5 C;  1TU0 B;  1K8A C;  3EFO A;  1UGR B;  2F5K A;  5CIU A;  3H9N A;  1V76 A;  2FZG B;  4M75 G;  2XD0 A;  1FMK A;  3O8V A;  1Q81 R;  1VQ4 T;  5CR2 A;  2LQW A;  2X9H A;  1TS9 A;  1WLP B;  2RB6 A;  2QQA A;  5I2S A;  3EGD B;  1OI1 A;  2FZK B;  3QYG B;  2LJ0 A;  2FB7 A;  1ZSZ C;  4F7U F;  4J9H A;  3CCE T;  4C8Q F;  4M77 B;  1SPK A;  1V1C A;  1AWX A;  2CZ6 B;  1WZO A;  4Y91 A;  1NYG A;  1BI3 A;  1R0C B;  2K57 A;  2M1H A;  2SEM A;  3VV0 A;  1WQW A;  2QEX A;  2DPP B;  2OAW A;  2PZ1 A;  4XTX A;  2IG0 A;  4C0F A;  2YRV A;  2E65 A;  2CZ1 B;  5CK9 A;  2YLB A;  4RKU E;  1HJD A;  5FW9 A;  1Y57 A;  3JB9 G;  4OML A;  4RCB A;  2H3E B;  3H0I A;  1OU9 A;  1KD1 U;  1OU8 A;  2K2V A;  2DD5 A;  2M0O A;  2J6K A;  3RES A;  3GF5 A;  1UFF A;  2F2W A;  6AT1 B;  2JM9 A;  2JTE A;  3CC7 A;  2AKL A;  2K5L A;  1WYX A;  1TG0 A;  1HXD A;  1QVP A;  1Q7Y C;  4M7D A;  2KYB A;  2JVV A;  3PTA A;  5LJ3 d;  4RTX A;  3J7A F;  3A5Z B;  5A0G A;  2ZPI B;  3EH1 A;  1GXI E;  4C5E A;  2JUF A;  1T0J A;  4A63 B;  1WPY A;  4KH1 B;  4J83 A;  4HT9 A;  3AHU A;  2HBW A;  2VWF A;  4C8Q G;  1N5Z A;  4PJN A;  3PIP A;  3CCQ A;  2GGR A;  4AT1 B;  1Y7X A;  3A8O B;  1BIB A;  2RM4 A;  5CKD A;  5GAN 4;  4OB2 B;  1KQS A;  1NE8 A;  4ZTJ A;  1YCY A;  3JSC A;  3L2Q A;  1X6B A;  4LDV A;  2MPX C;  1QVF A;  1IHW A;  1H3H A;  1YNZ A;  2XU8 A;  1EZZ B;  1OZ3 A;  1TH7 A;  1VQL A;  2COZ A;  1PSF A;  2RQT A;  1NEB A;  5CQY A;  1IGU A;  4M7A C;  4KUL A;  4JZ3 A;  4KRT A;  4BB7 A;  2EJF A;  3LH0 A;  4N4H A;  3RNJ A;  1WHK A;  5IHN A;  1K8A U;  4FIB A;  2BZX A;  1PKT A;  3V8J A;  2VC8 A;  1JEG A;  3GIB A;  1KC8 U;  4RMO A;  2VV5 A;  3PIO A;  2LQK A;  4CRI A;  4C8Q A;  2RJE A;  1GFD A;  1RLP C;  1T0H A;  4A4F A;  3I56 T;  1NG2 A;  4RTU A;  1N8R R;  1VQN A;  3JV3 A;  2K3Y A;  3TEE A;  3CCJ Q;  3OS0 A;  2QXF A;  2RI3 A;  1H64 1;  1WX6 A;  2LNV A;  5GAN j;  3PMT A;  1G3T A;  5KE2 A;  4M4Z A;  2ED1 A;  3OYF A;  4BE2 A;  3PFS A;  2A08 A;  2DKG A;  2H3J A;  2HCK A;  2X3X D;  3CCL A;  3M4G A;  1NPR A;  2DK3 A;  3RBB B;  4PNO A;  3X26 B;  3DLM A;  3M0R A;  2ZCF B;  1M3A A;  5IHI A;  2MCN A;  1YJ9 T;  1M5Q 1;  2IPO B;  1PC0 A;  1Q7Y R;  4FYW B;  1VQ9 A;  1ZUU A;  1SEM A;  1UB4 A;  5DM7 R;  4HCK A;  3UPU A;  4JDS A;  2BUD A;  1C6V X;  2JZ2 A;  1WGS A;  3L2W A;  3R6N A;  1MV3 A;  4MMK A;  2YXY A;  2FG0 A;  2L2P A;  3JCM d;  4PJO D;  2RF0 A;  4BUG A;  4M7A F;  1NBE B;  1M2O A;  4PJO B;  4HCC A;  1Q86 C;  4RTV A;  4IUU A;  3QII A;  1ZSZ A;  3CCU T;  3J81 E;  3ME9 A;  5KYW B;  1WDX A;  2DA9 A;  1D1A A;  2JMA A;  3CCM T;  2DBK A;  2LQN A;  4HVW A;  1LVK A;  1N27 A;  2JM8 A;  2KRO A;  4C92 G;  3EH2 A;  5GAO p;  4DEY A;  1M1G A;  2QTV A;  1M8M A;  3L2Z A;  2D9T A;  4IIO A;  4JJC A;  5GAO m;  2PVG B;  1VQ5 A;  1KD1 R;  5IAY A;  1EX4 A;  4J9D A;  1HD3 A;  2HEQ A;  4ORZ A;  1U3O A;  4BD3 A;  4C8Q B;  2FL7 A;  2LTO A;  5FU6 C;  3VRZ A;  2AT1 B;  3CD6 A;  2DXT A;  1G3Y A;  1WFW A;  1UJ0 A;  3JCM f;  4IUP A;  3CC7 Q;  1RUW A;  1BIA A;  2D0Q B;  5CKH A;  3I55 T;  1M1K U;  2CUD A;  3JRZ A;  3QSU A;  2OTL T;  2I0N A;  1PD1 A;  4GY5 A;  2HMA A;  4JUV A;  1Z9Z A;  2KT8 A;  3ASK A;  3OYG A;  1Q82 C;  3OYA A;  2CT4 A;  1P92 A;  1JXM A;  3M5A A;  2CT3 A;  2P0K A;  1VQN T;  3OYB A;  2QEX Q;  3UAT A;  4BE0 A;  1K4U S;  1Q82 U;  1K9A A;  3CCL Q;  2CYZ B;  5D6W A;  1UGV A;  2D8H A;  1TTH B;  1Q95 G;  5KYN A;  5J26 A;  2KE9 A;  1RI0 A;  3CXC S;  2QA4 A;  4DBQ A;  2FRY A;  3V8L A;  1M9S A;  5IXF A;  5GAO q;  4FW2 A;  1MMN A;  2JS2 A;  2MMP A;  2XID A;  2RO0 A;  3QJY A;  2G3R A;  5KYX A;  3CCV T;  3G1J A;  5I11 A;  2DF6 A;  2MF2 A;  1WHH A;  4M7A A;  1QVF S;  3HPW A;  3OS2 A;  5AT1 B;  4RCC A;  1YIT Q;  2VAS A;  1VQ6 A;  2EIF A;  5GMK l;  4M75 E;  3FRN A;  1Q7Y U;  2NUP A;  3RKW A;  5KCH A;  1JJ2 P;  3CQT A;  1VQ5 Q;  2CH4 A;  1OPL A;  2E70 A;  2DO3 A;  5DLQ E;  1VIF A;  1ZX6 A;  5HY6 A;  2E5K A;  2A7Y A;  5CAI A;  4PJO C;  3LYI A;  4XTV A;  1VYU A;  1TUD A;  1VQK T;  1SHF A;  2GTO A;  2XDD A;  4MZP A;  2W0Z A;  3X20 B;  4CC7 A;  3CC4 A;  1B7T A;  1M90 C;  3CBM A;  2CDT A;  1VQ5 T;  2G6F X;  4VUB A;  2EBP A;  1WXU A;  1RAA B;  2OTJ Q;  4HCZ A;  3OYC A;  5GMK e;  3OYE A;  1W1F A;  1YHQ T;  4J9C A;  3GNF B;  3NGP A;  1Y0M A;  2EQK A;  2O2O A;  5FWB A;  1FMV A;  3CCV Q;  4KGV B;  4D6W A;  2JT4 A;  3I56 A;  2EJG A;  4ELZ C;  3P8H A;  3CCR T;  5KYW A;  1YWO A;  1VQP T;  1O75 A;  1X69 A;  3M57 A;  4LUE A;  1UTI A;  2QEX T;  1OX8 A;  4C92 E;  3EGD A;  1D09 B;  4JLI A;  4BI4 A;  2K9G A;  3GNG A;  4LN2 A;  2GFU A;  3VS3 A;  2NUP B;  3OW2 S;  1CSK A;  2KYM A;  3M55 A;  2QQS A;  4A4E A;  4QQ6 A;  3TSW A;  1X6O A;  4LE9 A;  2DVE A;  4KUD K;  1RAI B;  1KJW A;  3G4S Q;  3HKS A;  3N5B B;  2ROT A;  1WJQ A;  4KH0 B;  4M75 C;  4E47 A;  1M2V A;  1R77 A;  1K73 U;  4M77 E;  3CC7 T;  3CXC P;  5CQX A;  4X9D A;  4JJD A;  2FVU A;  1SHG A;  3CCM A;  2HQH A;  1A0N B;  2LCS A;  3VYG A;  5GAN 8;  4CI0 C;  4J9E A;  3CCR Q;  1QCF A;  5KYU A;  3RKY A;  3TU4 K;  2MK5 A;  1X75 C;  1XOV A;  1BI2 A;  3OSV A;  2RN8 A;  3CME T;  4AFQ C;  2PVD B;  4OMO A;  3AT1 B;  4AFS C;  2HBP A;  4MZT A;  4EDU A;  2ZPH B;  3RMQ A;  3JCM V;  1VIE A;  4Y28 E;  3VKI A;  1G83 A;  3G7Z A;  2AIR B;  4M78 B;  5GAO n;  1Q86 U;  2LJ1 A;  1Y07 A;  2KRS A;  4C5H A;  3SWN C;  1W6X A;  4M7A G;  3VJP A;  4ZN3 A;  3CCU Q;  3QXE B;  3REB B;  2HD0 A;  1I8F A;  3CD6 Q;  2WSE E;  1UGP B;  3EG3 A;  1WI7 A;  1RAB B;  2BE9 B;  2L8D A;  4RUG A;  4LD9 K;  5FLX E;  4DQ2 A;  5FWC A;  2XI9 A;  2CZ0 B;  2AZV A;  1IGQ A;  1VQ8 A;  1TUC A;  4M7A B;  4J6W A;  3F70 A;  1BKB A;  2DL7 A;  2YUP A;  1K9M R;  3L2U A;  4D8K A;  3EAE A;  1YJ9 Q;  3HRU A;  2OJ2 A;  1KQS P;  2GCX A;  3M54 A;  1B3Q A;  2K5I A;  3E9F A;  3KUF A;  2XK0 A;  2E6N A;  2CUB A;  3BFM A;  5GAN e;  4PJO F;  4C92 F;  1MMA A;  1WQ7 A;  2K2M A;  5CKE A;  4C5I A;  3VS4 A;  3OBW A;  3NTK A;  5GAN f;  3PMI A;  2K79 A;  1DJ7 B;  4NOY A;  8ATC B;  2X4X A;  4MDX A;  4C0Z A;  2KNB B;  1BI1 A;  2XIC A;  2E12 A;  1YIT A;  1VQ6 Q;  4C8Q C;  4HT8 A;  4FYX B;  3I56 Q;  2QA4 Q;  2J6O A;  4PJO A;  1X6G A;  3QO3 A;  5I2M A;  4F14 A;  1D1B A;  2O88 A;  2LZ6 B;  2DM1 A;  3E19 A;  4QQD A;  3CCL T;  3H41 A;  2AK5 A;  2KK4 A;  3CCJ A;  1IHV A;  1WNL A;  1VQM Q;  1SKU B;  4QVZ A;  1D1C A;  3CCS Q;  1VQN Q;  3RDV A;  1QCO A;  1HK9 A;  3TSZ A;  3DB3 A;  3KXT A;  4M78 A;  2EWN A;  3NPF A;  8AT1 B;  4X9C A;  1EIF A;  1WHJ A;  3L2V A;  4QVC A;  3MP8 A;  4CC2 A;  2MWO A;  2LT1 A;  3MJX A;  4L5G A;  1YI2 T;  4FL6 A;  1M2V B;  3M0U A;  4FSS A;  1MNE A;  2ZAE A;  2HSE B;  1UGS B;  3TRE A;  1AOJ A;  1AWW A;  2HL3 A;  2JTF A;  1WA7 A;  2KEA A;  3NHN A;  5CKF A;  4V2S A;  5LJ5 h;  2X4W A;  3JAM E;  5IN1 A;  9ATC B;  2L0A A;  2DMO A;  3O5Z A;  1YHQ A;  1GCQ A;  4NL3 A;  3D7S B;  4N4I A;  2HNI A;  2BZ8 A;  1C1A A;  1QP3 A;  4C0D B;  4OMQ A;  4C0G A;  4EMK B;  2J06 A;  1YP5 A;  4M77 D;  5GAM j;  1NLO C;  3FDR A;  3SHW A;  3JCM e;  2DFU A;  3CCM Q;  4OB0 B;  3OA6 A;  2DBM A;  4RTW A;  2DZ9 A;  2GNC A;  5IT9 E;  4PK4 A;  2PUK B;  1WHM A;  5C6S A;  1YIJ A;  4O5V A;  2DVJ A;  1PSE A;  5DLO A;  1GRI A;  2F5T X;  2Y4X A;  2YUN A;  5I21 A;  1KIK A;  4C92 D;  2CP6 A;  4C8Q E;  2LNH B;  2VGM A;  4O6J A;  1N8R U;  4OMN A;  2IVW A;  4JLG A;  1N9S A;  4E7K A;  1OQK A;  4J9I A;  3S3N A;  2VGN A;  1NPP A;  2LMJ A;  3FJ5 A;  2FPE A;  4C92 C;  1RAH B;  2KMT A;  1KC8 C;  2C0I A;  2QTX A;  3CCE Q;  1BCO A;  4F17 A;  3JCM W;  4F7U B;  1QQJ A;  1OYX A;  5A0D A;  4JS5 A;  1KSW A;  1YJW T;  4BY6 C;  5GAN 3;  1YIJ Q;  3JCM b;  4M77 F;  1QLY A;  2KAF A;  2CP3 A;  2F2X A;  4HXJ A;  1I5L A;  3LX7 A;  2M51 A;  4M75 A;  2YRC A;  2EYZ A;  1NJI U;  2CP7 A;  1X2Q A;  4C5G A;  1OV3 A;  3E1S A;  3A1P A;  1WXB A;  4CC4 B;  2MOX A;  4E7H A;  3IQL A;  4JPB W;  2CP0 A;  1I5O B;  2KRM A;  4MDW A;  2QDL A;  3QPH A;  5I22 A;  1BK2 A;  2VXF A;  2P84 A;  3HRT A;  1Q82 R;  2RK1 A;  3L1A A;  2RD1 A;  4PJJ A;  2L3S A;  3CPF A;  5A0L A;  3M0Q A;  4HA8 A;  4PFP A;  1G8X A;  5KE3 A;  1IB8 A;  1YJN T;  1ZBJ A;  1JO8 A;  2LT4 A;  2RQU A;  1AZE A;  1MND A;  4Z89 A;  1VOM A;  2EW3 A;  2PUO B;  3JB9 I;  2OTJ A;  5LJ3 h;  1QMC A;  3FJP A;  3VS1 A;  4AG2 C;  3GOX A;  5LL6 S;  4IIM A;  1PM3 A;  1D3B B;  4LUD A;  2RQR A;  3HSB A;  2X3W D;  3UA7 A;  2AHJ B;  2KQW A;  3PE0 A;  2DIQ A;  2WAC A;  1CKA A;  3I9Q A;  2K7A A;  5GAN 5;  1WIE A;  3OW2 A;  5LJ5 e;  3M53 A;  1RI9 A;  2L3R A;  1YWP A;  1VQ9 Q;  1VA7 A;  3SDZ A;  5GJV B;  4KT0 E;  3M0P A;  4C8Q D;  1UEC A;  3OMC A;  4KUI A;  1RLQ C;  3SB2 A;  2LP5 A;  3M0T A;  1VQM A;  3GP8 A;  2YDL A;  4BDZ A;  5D6Y A;  5KYY B;  2RJC A;  4F7U G;  3SD4 A;  2FHD A;  5KYY A;  1F1B B;  2VUB A;  3ULR B;  1ACM B;  4M75 F;  1MMD A;  2GFA A;  2ENM A;  1E6G A;  3QDR B;  2KI7 A;  1AHJ B;  4M77 A;  3CC2 A;  4IUT A;  5D6X A;  3UA6 A;  3I5R A;  3QYH B;  4PJM A;  5IXB A;  2CZ7 B;  4Z02 A;  4ATO A;  5M9O A;  1VQ7 Q;  2A28 A;  2FPD A;  1S72 Q;  2RA2 A;  2GTJ A;  4JRK A;  3G71 Q;  4M75 D;  3JB9 D;  3KBG A;  3M0S A;  4ZGE B;  4XK8 E;  3ER0 A;  5FRM A;  2HSP A;  3P8B B;  1YI2 A;  1Z9Q A;  2KDS A;  1X2K A;  2COW A;  3CMA T;  3QUI A;  3PGG A;  1AWO A;  3TCJ A;  3G6E T;  4GBQ A;  3MHX A;  5FU7 C;  2R5A A;  4FYY B;  2GQI A;  1UHF A;  2Z0W A;  2DAQ A;  1VQ4 Q;  2KY9 A;  4J9G A;  2EKH A;  2DTH A;  4DA4 A;  2ESW A;  3JCM g;  1KFZ A;  1KQ2 A;  3BDL A;  4A4K A;  3JCM h;  4DOW A;  1VQ8 Q;  1UJY A;  3ZEH A;  2SRC A;  1PD0 A;  1VQL T;  2GF7 A;  2DL5 A;  5GAM d;  3FC3 A;  1ZA2 B;  2AKK A;  2XMF A;  1M8V A;  2R57 A;  1TSF A;  2J05 A;  2CGH A;  5LJ5 j;  4OGE A;  2F69 A;  2JTM A;  5CCA A;  3OYK A;  5D7U A;  1S72 A;  5AYF A;  1NYF A;  1AT1 B;  2E1H A;  1VQ8 T;  1VQ7 A;  4HVU A;  1AVZ C;  4EMH A;  2QDY B;  3S3M A;  4BE1 A;  1I07 A;  4LDX A;  2EQJ A;  2HAX A;  2DJZ A;  2J7I A;  2NYS A;  2HZY A;  4DBR A;  1BYM A;  4OF1 A;  3DKM A;  3SWN A;  1M27 C;  2VYT A;  4TVR A;  3FEO A;  1W4S A;  1XNI A;  4FT4 A;  2EYY A;  3OSS C;  3OS1 A;  3G6E Q;  2MAM A;  1K73 C;  5GAM e;  3CMA Q;  4N0A C;  1YIJ T;  1BB9 A;  2RQV A;  3UWN A;  5KYX B;  3QWX X;  5HCK A;  2LX9 A;  2X35 A;  5ECA A;  1K9M U;  2LCC A;  4A4H A;  3A98 A;  2OAU A;  1BBZ A;  2F2V A;  5LJ5 g;  2RJF A;  2A36 A;  1GCQ C;  2LQ8 A;  2RPN A;  4M7D G;  2QAS A;  3ZL7 C;  4EMG A;  4M7A E;  3OS5 A;  4PKC C;  2A37 A;  1JB0 E;  1YJW A;  4XU2 A;  2KSS A;  1Q86 R;  1Y71 A;  1KHC A;  2PNI A;  3SWN B;  4QKU A;  4ELY C;  1GBQ A;  4QW2 A;  2EVR A;  5EC7 A;  1RAD B;  3CMA A;  3OW2 P;  2DXC A;  2YSQ A;  2A3L A;  2PU9 B;  3QZ5 B;  4P5N A;  2HDA A;  5GAN 6;  5GMK i;  2M16 A;  1OPK A;  2GQV A;  4QVD A;  1GCP A;  1UHC A;  2EPD A;  2DLP A;  1JU5 C;  1J3T A;  1G3S A;  2ZGW A;  2AZS A;  5KCO A;  3A8H B;  2Y90 A;  4ME7 A;  4FU6 A;  4JJN K;  2FO0 A;  1M90 U;  1K73 R;  1R8O B;  5CVI A;  2LCL A;  2GBQ A;  2RQW A;  4MML A;  4NS5 A;  2O9S A;  1D0Z A;  2X4Y A;  1YI2 Q;  1W2B S;  2DNU A;  1D3B A;  7AT1 B;  2FPF A;  1ZLM A;  1MGQ A;  1SSH A;  1N9R A;  2XG8 D;  1VQO Q;  3V7S A;  1D0Y A;  3CXC A;  1MHN A;  3QDF A;  1FXX A;  4Q5W A;  1FX7 A;  2DEU A;  1TOV A;  1WJS A;  1U1S A;  1I1J A;  2K5F A;  2NLU A;  2CSI A;  2PVO B;  1M30 A;  3X25 B;  2QG9 B;  3VU3 C;  4D8D A;  3MEA A;  4LDU A;  4OVA A;  3UT1 A;  5L23 A;  3HL8 A;  3NMZ C;  3CCS T;  2V1Q A;  3JCM X;  4XTW A;  5C0M A;  5DY9 A;  1O9S A;  1OX9 A;  3TVT A;  3C4S A;  4M7D D;  2DX1 A;  3JCM P;  4E7J A;  3RR6 A;  2KBT A;  5HK0 A;  3OYL A;  3M9Q A;  4DBH A;  1YJ9 A;  1JJ2 S;  4GLM A;  1B34 B;  4J6X A;  4PL6 A;  5LJ3 g;  2ZZD A;  2FZC B;  1G3W A;  1LNX A;  2DXB A;  3C95 A;  1YJW Q;  3H0H A;  4PFZ A;  2EQU A;  1I81 A;  1ZSG A;  4J6Y A;  3OYJ A;  1IXD A;  2VB6 A;  1ZA1 B;  1U8R A;  3MCA B;  2R58 A;  3EHR A;  1PNJ A;  1E6H A;  2NUZ A;  3JCM J;  2CH4 W;  1SSF A;  1TWB A;  4QT7 A;  3LLR A;  1M4Z A;  1S1N A;  3QG1 A;  3QHS A;  4BDY A;  1UUE A;  4XU3 A;  3JB9 H;  5LJ5 d;  3QZ9 B;  1ZSZ B;  3EGX A;  4KGZ B;  4M7D E;  2EGA A;  2B8A A;  2VXE A;  2RI2 A;  1ZUY A;  3JCM c;  2DL4 A;  3REA B;  3CCQ T;  3PVQ A;  1H92 A;  1VQO A;  2FRW A;  2OX7 A;  1SF9 A;  2JS0 A;  2OI3 A;  4AFZ C;  2DET A;  4E6R A;  1BU1 A;  1CKB A;  2RNA A;  1WJR A;  5CO7 A;  1RAC B;  3JCM Q;  2ED0 A;  2L3P A;  2V8I A;  5GMK j;  4F7U A;  3CC4 Q;  1NZ9 A;  1TXQ A;  2DIL A;  3U23 A;  2RHX A;  4QQG A;  4AMC A;  1JRI A;  2WSC E;  3CBO A;  5LJ3 e;  1Q81 U;  1GBR A;  4OB3 B;  4EMK A;  4LD6 A;  3CME Q;  4B9X A;  4L6V 5;  2EGC A;  2V26 A;  4RG8 A;  1QWE A;  4M77 G;  3I55 A;  4C0D C;  3EG1 A;  1EFN A;  2KR3 A;  4Y92 A;  4HCB A;  5J39 A;  1YN8 A;  1T3S A;  2RJD A;  4M78 G;  4EPC A;  1G5V A;  2MIO A;  3OYM A;  1LOJ A;  1KQ1 A;  2EJ9 A;  2RH2 A;  4DEX A;  3EFO B;  1VYV A;  5LJ5 f;  3CC2 Q;  4AFU C;  2ABL A;  2QK0 A;  1W70 A;  1IO6 A;  4M75 B;  1M90 R;  1NM7 A;  1LCK A;  3EHQ A;  1X43 A;  4PJL A;  5GAN h;  1WXT A;  5GAN g;  3V7R A;  3MPU B;  1M1K R;  2JNG A;  3CPW P;  2K4Y A;  2YWW A;  4E7I A;  1NLP C;  4FM4 B;  3OB9 A;  3URG A;  2KRN A;  2KXD A;  2C0T A;  2DTI A;  1KQS S;  5GJW B;  1G2B A;  1NEG A;  2EYQ A;  2K6D A;  4BI3 A;  3FIF A;  1YCS B;  2IIM A;  2KGT A;  1VQM T;  3CC2 T;  4F16 A;  1NJI C;  3OBY A;  2XDB A;  1PHT A;  2H8H A;  3LGL A;  1U06 A;  3THK A;  4DOV A;  2M0Y A;  1AZG B;  2QA4 T;  4BY6 B;  2L89 A;  2DL3 A;  5GAM g;  1VQ6 T;  2R5M A;  2JN0 A;  3WXM B;  4IKF A;  4J8O A;  3EG0 A;  1W2B A;  3VUB A;  3M59 A;  3ZBD A;  2QGF B;  3LWI A;  4XTU A;  1V29 B;  4LXC A;  1IRX A;  2C0O A;  1N8R C;  1PCX A;  2D6F A;  2JOY A;  3H8Z A;  2LX7 A;  4MZM A;  4C92 B;  4M7D F;  3VRY A;  2JW4 A;  4OGC A;  3S3O A;  2M02 A;  2HKQ B;  3CCQ Q;  1FWZ A;  4PLL A;  2QYZ A;  3EG9 B;  2DRM A;  3HFN A;  4A4G A;  1JQQ A;  2WSF E;  1HYO A;  2E3I A;  1PWT A;  4ZGJ B;  1QW1 A;  1QKW A;  2X4J A;  4EIK A;  3RIR A;  1LJO A;  1IZ6 A;  3WVE B;  1B34 A;  2E6Z A;  5GAN 7;  3CD6 T;  3LW5 E;  1Y96 B;  3VYH B;  3LWH A;  2V8J A;  1XTD A;  5HKC A;  4FCY A;  1UGQ B;  1VQ4 A;  1PRL C;  4JRQ A;  2EKO A;  3G71 A;  2OTL A;  4M77 C;  4IUV A;  3V8K A;  4FSX A;  2LDM A;  1AEY A;  2RHU A;  5GAO r;  3E9G A;  1VQP A;  2L5Q A;  4JZ4 A;  4WCI A;  1K0S A;  3NTI A;  2CS7 A;  4M78 C;  4CC3 A;  3DLL A;  3HFO A;  2BZY A;  1QVG S;  5CKB A;  4PLI A;  1KD1 C;  2YLC A;  3CCS A;  3UDC A;  4NL2 A;  3EGX B; 
#chains in the Genus database with same CATH homology
 4HVU A;  2YUQ A;  1AVZ C;  1UFF A;  2F2W A;  2JM9 A;  3LH5 A;  2JTE A;  2AKL A;  1G83 A;  1I07 A;  1WYX A;  2LJ3 A;  1TG0 A;  2J7I A;  2LJ1 A;  2KYB A;  2KRS A;  1M27 C;  1W6X A;  2O31 A;  4RTX A;  3REB B;  2EYY A;  1K0X A;  2K3B A;  1H8K A;  1T0J A;  4A63 B;  1OOT A;  1WI7 A;  3EG3 A;  1BB9 A;  2RQV A;  3I35 A;  4RUG A;  3QWX X;  5HCK A;  2HBW A;  2VWF A;  1N5Z A;  5ECA A;  2GGR A;  5FWC A;  3A98 A;  2AZV A;  1TUC A;  1BBZ A;  2F2V A;  2DL7 A;  2YUP A;  2A36 A;  1GCQ C;  2RPN A;  4D8K A;  3ZL7 C;  1X6B A;  2YT6 A;  2OJ2 A;  1H3H A;  1YNZ A;  1B3Q A;  4ZNX A;  2CUB A;  2D0N A;  1VYT A;  1B07 A;  2O9V A;  2A37 A;  2K2M A;  2EYX A;  2FEI A;  2RQT A;  1NEB A;  3H0F A;  4JZ3 A;  3VS4 A;  4KRT A;  3RNJ A;  5IHN A;  2BZX A;  2K79 A;  1PKT A;  2PNI A;  1JEG A;  1MV0 B;  1PRM C;  4RTT A;  2KNB B;  4LNP A;  2J6O A;  1GFD A;  1X6G A;  1GBQ A;  1RLP C;  4F14 A;  3VS5 A;  1T0H A;  2EVR A;  5EC7 A;  2KXC A;  2O88 A;  4OMP A;  2LZ6 B;  2DM1 A;  2W10 A;  1NG2 A;  1ARK A;  1OEB A;  2YSQ A;  3H41 A;  4RTU A;  2AK5 A;  2HDA A;  3JV3 A;  1OPK A;  1GCP A;  1WX6 A;  1UHC A;  4ESR A;  2ECZ A;  2EPD A;  3TSZ A;  2DLP A;  1JU5 C;  4M4Z A;  2ED1 A;  1J3T A;  2AZS A;  2NWM A;  1UG1 A;  2D8J A;  2A08 A;  2HCK A;  2FO0 A;  2X3X D;  3NPF A;  3RBB B;  4AG1 C;  3M0R A;  1M3A A;  3VS2 A;  5IHI A;  2MCN A;  2RQW A;  1PKS A;  2GBQ A;  2O9S A;  1ABO A;  2DNU A;  1ZUU A;  1SEM A;  4CC2 A;  4J9F A;  4J9B A;  2FPF A;  1SRM A;  1ZLM A;  2ROL A;  4HCK A;  5IH2 A;  3M0U A;  1SSH A;  1UE9 A;  4FSS A;  3EGU A;  2DL8 A;  3R6N A;  1MV3 A;  3VS0 A;  2FG0 A;  2L2P A;  1AOJ A;  1AWW A;  2RF0 A;  1I1J A;  1WA7 A;  2KEA A;  3NHN A;  2CSI A;  2VKN A;  1M30 A;  2BTT A;  4RTV A;  4D8D A;  2L0A A;  2RMO A;  5L23 A;  2DYB A;  1X27 A;  3NMZ C;  2DMO A;  3O5Z A;  3PVL A;  1GCQ A;  2V1Q A;  1WDX A;  2DA9 A;  4OMM A;  2JMA A;  2YUO A;  2DBK A;  2LQN A;  2BZ8 A;  4HVW A;  1AD5 A;  2JM8 A;  4OMQ A;  4JJB A;  3TVT A;  2J06 A;  2KRO A;  1YP5 A;  1GFC A;  1NLO C;  2DX1 A;  3UF4 A;  4DEY A;  3SHW A;  2KBT A;  1M8M A;  4IIO A;  4JJC A;  2DBM A;  4RTW A;  2GNC A;  4GLM A;  4J9D A;  1HD3 A;  2HEQ A;  4ORZ A;  1U3O A;  2DVJ A;  2PTK A;  1GRI A;  3VRZ A;  4R0K A;  3H0H A;  2YUN A;  1ZSG A;  1KIK A;  1WFW A;  2LNH B;  1UJ0 A;  2B86 A;  1ABQ A;  4OMN A;  1RUW A;  2D1X A;  2CRE A;  4J9I A;  1M3C A;  3EHR A;  1PNJ A;  2LMJ A;  3FJ5 A;  1E6H A;  2CUD A;  2NUZ A;  2FPE A;  2CH4 W;  4QT7 A;  2I0N A;  3KFV A;  2C0I A;  4F17 A;  1JXO A;  1Z9Z A;  1S1N A;  1QWF A;  1KSW A;  2KT8 A;  1MUZ A;  1UUE A;  2VVK A;  2CT4 A;  1QLY A;  2F2X A;  1JXM A;  4HXJ A;  2CT3 A;  2EGA A;  2M51 A;  4K11 A;  5IHK A;  1ZUY A;  2DL4 A;  3REA B;  1HSQ A;  2EYZ A;  3C0C A;  3UAT A;  3PVQ A;  1H92 A;  1AWJ A;  3I5S A;  1K4U S;  2FRW A;  1K9A A;  1X2Q A;  2JS0 A;  1UGV A;  2OI3 A;  4AFZ C;  2D8H A;  1QKX A;  4E6R A;  1OV3 A;  1BU1 A;  1CKB A;  2RNA A;  2KE9 A;  2ED0 A;  2L3P A;  1WXB A;  4CC4 B;  2MOX A;  1U5S A;  1UDL A;  3IQL A;  4JPB W;  2DIL A;  2FRY A;  2KRM A;  3U23 A;  5IXF A;  2QDL A;  1GL5 A;  2JS2 A;  1GBR A;  5I22 A;  1BK2 A;  3QWY A;  2EGC A;  3SEM A;  2KT1 A;  5I11 A;  3VS6 A;  1QWE A;  2EQI A;  2DF6 A;  2EYW A;  1EFN A;  2KR3 A;  4Y92 A;  3VS7 A;  2P4R A;  2L3S A;  3M0Q A;  1YN8 A;  1T3S A;  2L3Q A;  2MIO A;  1SRL A;  1ZBJ A;  1JO8 A;  2RQU A;  1AZE A;  4DEX A;  3GBQ A;  4Z89 A;  1VYV A;  3CQT A;  2EW3 A;  1ZUK A;  2CH4 A;  1OPL A;  4AFU C;  2CSQ A;  2ABL A;  2J6F A;  1M3B A;  3VS1 A;  4AG2 C;  1W70 A;  1ZX6 A;  1IO6 A;  1T3L A;  4IIM A;  1NM7 A;  1LCK A;  2E5K A;  1X43 A;  3EHQ A;  4Z8A A;  4LUD A;  2RQR A;  4RTZ A;  2DRK A;  1WXT A;  2X3W D;  3UA7 A;  1VYU A;  1NLP C;  1TUD A;  3PE0 A;  2KRN A;  1SHF A;  2DJQ A;  2KXD A;  2GTO A;  2C0T A;  1CKA A;  3I9Q A;  2K7A A;  5GJW B;  1G2B A;  1NEG A;  2W0Z A;  1WIE A;  4HVV A;  4Z88 A;  4CC7 A;  4RTY A;  2K6D A;  1YCS B;  2IIM A;  2KGT A;  2CDT A;  4F16 A;  2G6F X;  1RI9 A;  1YWP A;  1I0C A;  2V1R A;  2JXB A;  1VA7 A;  1PHT A;  2H8H A;  2EBP A;  1WXU A;  1FYN A;  5GJV B;  1K1Z A;  3M0P A;  2JMC A;  1U06 A;  1UEC A;  1W1F A;  3THK A;  1RLQ C;  2M0Y A;  1AZG B;  3NGP A;  4J9C A;  2LP5 A;  1Y0M A;  3M0T A;  2DL3 A;  2O2O A;  1K76 A;  2YDL A;  5FWB A;  3EG0 A;  3EG2 A;  1E7O A;  2DE0 X;  2EGE A;  2JT4 A;  4X1V A;  3ULR B;  2ENM A;  1E6G A;  2C0O A;  1YWO A;  2LX7 A;  3UA6 A;  1X69 A;  3I5R A;  5IXB A;  3VRY A;  2JW4 A;  1FMK A;  4LUE A;  1UTI A;  2LQW A;  2A28 A;  2FPD A;  2GTJ A;  1WLP B;  2DRM A;  1JQQ A;  2K9G A;  2LJ0 A;  1PWT A;  4LN2 A;  3VS3 A;  3M0S A;  1CSK A;  2KYM A;  2HSP A;  1QKW A;  4J9H A;  4EIK A;  1Z9Q A;  3TSW A;  1X2K A;  4LE9 A;  1SPK A;  1V1C A;  1AWO A;  1AWX A;  4GBQ A;  1KJW A;  1NYG A;  2GQI A;  1UHF A;  2ROT A;  4J9G A;  2EKH A;  2SEM A;  2ESW A;  4JJD A;  1PRL C;  1KFZ A;  2OAW A;  2PZ1 A;  1UJY A;  1SHG A;  2SRC A;  1AEY A;  1A0N B;  2LCS A;  2DL5 A;  4J9E A;  1QCF A;  4JZ4 A;  4WCI A;  2AKK A;  2XMF A;  1K0S A;  1HJD A;  2J05 A;  5FW9 A;  1XOV A;  4CC3 A;  1Y57 A;  2RN8 A;  2BZY A;  4OML A;  4AFQ C;  3H0I A;  4OMO A;  4AFS C;  2J6K A;  1NYF A;  3EG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...