1V1CA

Solution structure of the sh3 domain of obscurin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
IFDIYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the SH3 Domain of Obscurin
rcsb
source organism Homo sapiens
molecule tags Sh3-domain
molecule keywords OBSCURIN
total genus 4
structure length 68
sequence length 68
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1v1cA00
1QWFA 2K7AA 4LNPA 2EGCA 2RQRA 2EYWA 5IHNA 2FPFA 1ZUKA 1X2QA 5FWBA 1UG1A 1XOVA 3CQTA 2DL7A 1RI9A 2JW4A 3EHQA 2CUDA 4EIKA 2ED0A 1GBRA 3I5SA 1UJ0A 2DRMA 2A08A 2DLPA 3UA7A 2YUQA 3NPFA 2KBTA 1AZEA 2A28A 1TUCA 1M3AA 1K9AA 2ROTA 2M0YA 2BZYA 3RBBB 2O9VA 3TSZA 2MIOA 1KFZA 4RTYA 3EGUA 2SEMA 2DM1A 3REAB 2O9SA 5IXBA 1PHTA 1WI7A 4HVUA 3H0IA 2AKKA 4LUEA 1ABQA 2MCNA 2RPNA 2YUOA 4ESRA 1CKAA 5HCKA 1M3CA 2MOXA 3ZL7C 2JMCA 4HCKA 3I5RA 2D8HA 4J9DA 2KRSA 2L0AA 4JPBW 4JJCA 1YWOA 2ENMA 3H41A 2KXCA 2I0NA 2CH4A 1M27C 4LE9A 2LQNA 3UATA 5IXFA 3VS6A 1U06A 2W0ZA 3NHNA 1E6HA 2KYBA 4GLMA 1GBQA 2DMOA 1YP5A 3C0CA 2C0TA 1GRIA 2GTJA 3QWYA 4ZNXA 2CT4A 2DYBA 1CKBA 4D8KA 1AWOA 2ECZA 2YDLA 4JZ3A 2EW3A 1X27A 5FWCA 3TSWA 2YT6A 1T0JA 1FMKA 1AWXA 2J6OA 2KYMA 1WIEA 2EGAA 2C0OA 2ROLA 2DVJA 2ED1A 3VS4A 4M4ZA 1SHGA 2RQVA 2K6DA 2RNAA 3I35A 4WCIA 2LZ6B 2K2MA 2PZ1A 4J9FA 1W70A 1KSWA 4RTVA 4J9HA 3EG1A 2CREA 1X69A 1UJYA 2V1QA 4CC4B 5IHKA 1NM7A 1W6XA 3VS2A 1ARKA 2KROA 3H0FA 2JS2A 2K9GA 2D1XA 4HXJA 4QT7A 2J7IA 2M51A 2DL5A 1AWWA 2L3QA 3NGPA 4LUDA 4FSSA 1VYUA 1JXOA 2RQTA 4CC3A 4AFSC 3JV3A 1X6GA 1UHFA 3VS7A 2KT8A 1Z9QA 1J3TA 2JTEA 2EPDA 2K79A 1GFCA 4RTXA 2HCKA 2RQWA 2ABLA 4JZ4A 1SPKA 1PNJA 1UGVA 4JJBA 1PWTA 3H0HA 2H8HA 3VRZA 1UHCA 3VS1A 1RUWA 2LJ1A 4JJDA 3FJ5A 2EBPA 4J9EA 1H3HA 2DBKA 5IHIA 2EYXA 2L2PA 1PRMC 3UA6A 1GCQC 2CH4W 3U23A 1JO8A 1B3QA 2JT4A 4KRTA 1I0CA 1WXTA 4HVVA 2XMFA 2EVRA 3PVLA 4F14A 2JM8A 2GBQA 1WYXA 2PTKA 3EG0A 4F17A 2CSQA 2FRYA 3REBB 1UTIA 1QKWA 2EYZA 2DL4A 1SSHA 2JXBA 2P4RA 1ZSGA 2X3WD 2HSPA 1E7OA 3RNJA 4OMPA 1BB9A 2X3XD 1UUEA 1NYFA 3VRYA 1OPKA 2CDTA 4E6RA 1N5ZA 2J6KA 2NWMA 1UDLA 3M0PA 3A98A 4OMMA 2J06A 3M0UA 2OJ2A 1G2BA 3SEMA 1AZGB 1K0SA 2KEAA 2L3PA 2J6FA 1JXMA 1FYNA 2V1RA 1QCFA 4OMNA 1YNZA 1I07A 1YCSB 4LN2A 2YUNA 1U5SA 2JM9A 1WA7A 2OAWA 2DE0X 2JMAA 5FW9A 1NLOC 4OMQA 3VS5A 4CC7A 2O88A 3THKA 1BU1A 2YSQA 3EG2A 5I22A 3KFVA 2RF0A 3I9QA 2KR3A 2LNHB 1YN8A 3O5ZA 4AFZC 4GBQA 1OPLA 1ABOA 4J9BA 2LQWA 3IQLA 5IH2A 2HEQA 1ZUYA 2G6FX 1OV3A 1MV0B 1A0NB 1HD3A 1K0XA 2CSIA 1NLPC 1M8MA 2VKNA 1H92A 5ECAA 1OEBA 2QDLA 2B86A 4AFQC 2K3BA 1WLPB 2DNUA 1AD5A 1YWPA 2FRWA 1GCPA 1M3BA 3PVQA 2HBWA 1WFWA 2AKLA 5GJWB 1KIKA 4RTWA 2CUBA 4J9GA 2KRNA 1KJWA 1IO6A 2JS0A 1GCQA 1G83A 4J9IA 1V1CA 2DBMA 2DJQA 2IIMA 1SEMA 2A36A 2EGEA 1K4US 2SRCA 2DL3A 3EHRA 4K11A 1UFFA 1WXBA 3QWXX 1RLQC 1MUZA 1ZBJA 2LCSA 2GGRA 2AZVA 3PE0A 2J05A 4CC2A 1Z9ZA 5EC7A 2BTTA 3SHWA 1W1FA 2DX1A 2AZSA 1HJDA 2LJ0A 4DEYA 1AOJA 2FPEA 1K1ZA 1T3SA 5GJVB 2DRKA 4RTUA 4Z8AA 1NEBA 2EYYA 1UECA 4ORZA 2A37A 2L3SA 3LH5A 4OMLA 1NYGA 2ESWA 5L23A 2C0IA 2DILA 1BK2A 1SHFA 2RMOA 1GL5A 4IIOA 2FEIA 1OOTA 4J9CA 2W10A 2BZXA 3R6NA 3M0TA 3M0SA 2D8JA 2EQIA 1I1JA 1PRLC 1AVZC 1WDXA 4RTTA 4AG1C 1Y0MA 2LJ3A 4Y92A 1JU5C 2F2VA 2KGTA 3NMZC 1X43A 3ULRB 4AG2C 2EKHA 2D0NA 4OMOA 2AK5A 2HDAA 2F2WA 3VS3A 1WX6A 1NEGA 1T0HA 4R0KA 1RLPC 2E5KA 2FO0A 1GFDA 2GTOA 1Y57A 3VS0A 1AWJA 1ZLMA 5I11A 2DA9A 1BBZA 1K76A 2RN8A 2VWFA 1QLYA 1NG2A 2GNCA 1JQQA 2DF6A 2CT3A 1HSQA 3GBQA 2FPDA 1QWEA 2YUPA 1SRLA 1X2KA 2F2XA 4RUGA 4RTZA 1TUDA 4AFUC 1S1NA 1E6GA 2KXDA 1MV3A 4DEXA 2KT1A 4D8DA 2OI3A 1PKTA 1UE9A 3TVTA 2KNBB 4HVWA 2DL8A 4F16A 2O31A 3EG3A 2FG0A 2GQIA 1QKXA 3M0QA 1SRMA 1T3LA 2LX7A 1CSKA 4X1VA 1ZX6A 4Z88A 1VA7A 1EFNA 2PNIA 4A63B 1WXUA 1VYTA 2NUZA 2VVKA 1H8KA 1ZUUA 1X6BA 3M0RA 4Z89A 1JEGA 1PKSA 2O2OA 4IIMA 3UF4A 2LMJA 1U3OA 1B07A 1LCKA 2RQUA 1M30A 2LP5A 2KE9A 1TG0A 1VYVA 2KRMA 2BZ8A 1AEYA
chains in the Genus database with same CATH superfamily
1OU8A 1KHIA 4LNPA 3TQ7P 5GMKi 1VQOQ 2FPFA 3OBYA 1VQMT 1XOVA 3MEAA 2MMPA 2DKGA 2WACA 1UEBA 5D6YA 3EHQA 2OX7A 1OI1A 2ED0A 3URGA 2A08A 2HZYA 3OYEA 3UA7A 1N8RR 4GLKA 4QVCA 4CI0C 3X24B 1TUCA 2L3RA 4AT1B 1UB4A 1JJ2P 2MIOA 2HKNA 3EGDA 1Q7YR 3REAB 2O9SA 1TXQA 1WI7A 1D0ZA 2WSFE 4DBRA 1K8AR 2RPNA 5FU6B 1VQPQ 4ESRA 1M3CA 3I5RA 2D8HA 5IN1A 1TWBA 1WHGA 2L0AA 4ZGJB 3H41A 4ME7A 1VQ6Q 1D0XA 2KSSA 5I21A 2G3RA 2QK0A 1HK9A 2W0ZA 5KYXB 3L42A 4M75D 1M90R 4OB2B 3JCMf 1GBQA 2DMOA 3CPFA 2RJFA 1TU0B 1RAEB 5FWCA 3TSWA 1QVFS 2XK0A 4XAXB 5GANh 4FYXB 4ZTJA 2KYMA 4FCYA 4BE2A 1WIEA 4FYYB 4ELYC 4BD3A 4M4ZA 5LJ5f 5A2QE 2RQVA 2RNAA 4NL2A 1IGQA 2D6FA 2PZ1A 4J9FA 1VQ6T 3JCMW 1UGPB 3JCMc 2O4XA 2HSEB 4PJOA 3E9FA 3EG1A 2X4YA 3RMQA 2DEUA 1UJYA 2V1QA 4CC4B 1BYMA 2L89A 1NM7A 1W6XA 2ZGWA 1ARKA 3CPWS 3H0FA 2JVVA 3CBMA 1YFNA 3OYLA 4FIBA 4WF2A 3JCMX 4QVDA 3OY9A 3VKIA 2LQ8A 1MNDA 3J80E 2DL5A 4M7DD 4LUDA 4X9DA 1O9SA 4M75B 2XI9A 3QUIA 3E1SA 1OX8A 1Z9QA 1YJNA 2JTEA 2RK1A 2K79A 1GFCA 2RQWA 4XQ3A 2ABLA 4FW2A 2LT1A 1YJ9A 3VRZA 3X25B 3VS1A 1LJOA 1WQ7A 1Q81U 1OULA 4A54A 2DTIA 2K4YA 5IHIA 2EYXA 3FIFA 2L2PA 3I56Q 4BI8B 1BI3A 1B3QA 1VIFA 4OMFB 1MHNA 3G1JA 2YWWA 4ZN3A 1YIJQ 3PMTA 2FVUA 3EFOA 1VQLA 1IGUA 3PVLA 2EYQA 3L2ZA 2LRQA 1HYOA 3OW2S 2EQJA 1ZQ1A 4F17A 3VUZA 4M77B 1UTIA 3GOXA 4E7HA 2P4RA 2X3WD 2HSPA 1YJ9T 2X3XD 1M1KR 1BKBA 4MZTA 3VRYA 2XDDA 4LD6A 4IUUA 2LQKA 1UDLA 2HQEA 3M0PA 2H3JA 1Y96A 2Y4YA 3A98A 2J06A 4QW2A 3VUBA 3JCMe 5DM7R 2KY9A 3VYGA 1JXMA 5CCAA 3HFNA 3P8HA 1H641 1YJNT 1YCSB 1GXIE 4LN2A 1D1AA 1M1GA 2V26A 2QGFB 3HP9A 2JNGA 3KFVA 4KGXB 2KR3A 5GANe 3MP1A 4M7DE 3O5ZA 1G8XA 3SWNB 2R57A 1YI2Q 4XTWA 2EQKA 3MP6A 2DD5A 1AT1B 2G6FX 1JBMA 1MV0B 4JLIA 4FW1A 4C8QA 5DY9A 1NJIU 1K0XA 5LJ5d 3ZFJA 1M8MA 4MMLA 4IKFA 1QVGP 1OEBA 3QYGB 2K3BA 3PIPA 1YWPA 3CCJT 4F7UG 2FRWA 4DA4A 2AKLA 4RG2A 2DK3A 3M4GA 3GPLA 4M7AF 3CCSA 2QYZA 2CP2A 4KH1B 5J26A 1D1BA 2PVOB 2VV5A 3WXMB 1YI2T 2DTHA 1LNXA 2CYZB 1G83A 2DBMA 4XU0A 2CP3A 2EGEA 3EGDB 2LTOA 1NBEB 9ATCB 2SRCA 2DL3A 4K11A 3A8LB 1UFFA 1R77A 1R8OB 3I55T 4CC2A 1RACB 2BTTA 5EC7A 1W1FA 1Q82U 1FWZA 2MI6A 2PU9B 2VGMA 2ZPGB 2LJ0A 3JB9I 2M16A 4ANJA 1X6OA 5GMKl 2FPEA 4Y28E 1VQ7Q 3JRZA 2H3EB 1T3SA 1SF9A 5GJVB 1EIFA 1Y7XA 1PSEA 2LC4A 1WHLA 3LH5A 1D0YA 5FLXE 5HKCA 1VQKA 3EH2A 4M7AD 2DILA 2RI2A 4C92E 5KYYA 4M78B 1OOTA 3Q1JA 2YRCA 3EFOB 3LWIA 2ZZDA 3GNFB 2RI3A 1I1JA 1AVZC 1PCXA 3M55A 4L6V5 3RKYA 1JU5C 2R58A 3QBYA 2F2VA 1X43A 3ULRB 4AG2C 1C1AA 1WJQA 4OMOA 2DXUA 2AK5A 2HDAA 1YIJT 5LJ5h 2F2WA 3JCMV 4FT2A 2Y90A 3VS3A 3EFSA 1WX6A 1NEGA 2RI5A 5LJ3d 4R0KA 2VYTA 3JAME 1RLPC 2GFUA 2FO0A 2GTOA 5I11A 3GLXA 1BBZA 1RAFB 2X4XA 1KD1U 2DTOA 2R5AA 3BFMA 3KUFA 5EG2A 2HQXA 2MAMA 3J7AF 3JCMh 4N0AA 3LYIA 2CT3A 2HL3A 3GBQA 2FPDA 1SRLA 4QKUA 4RTZA 1LOJA 1MV3A 4XTZA 1PD0A 4PJMA 3QO3A 1VIEA 5GAMj 2KT1A 3UDCA 2LCCA 2OI3A 3VYHB 3CCUQ 1WHJA 1UGRB 1M8VA 3ME9A 2FL7A 2QQ9A 4F16A 4PJLA 4GY5A 3QSUA 2DJZA 2GQIA 3CCUA 2LNVA 4RCBA 3M0QA 1M1KU 4HCBA 2LX7A 2MWPA 5FU7B 4X1VA 4F7UA 3G71A 3MP8A 1ZHIA 2RJDA 4PJOB 3OYIA 3LX7A 5AYFA 3UPUA 5GAOl 1H8KA 5KE2A 2CP0A 3OS2A 3CCRT 4Q5WA 3UF4A 1Q86R 2ATCB 5CVIA 3G4ST 4M77G 2E6ZA 4C8QG 2OTJA 4LXCA 1VQ5T 3JSCA 1TG0A 4JS4A 4C5HA 1QWFA 1YJWA 4M7DG 3QDFA 5IHNA 5FWBA 3DB4A 1O75A 3A8GB 3QYHB 3J81E 1ZA1B 1RABB 1Y96B 2DRMA 3S3MA 2E41A 5KYWA 5LJ3j 2PQWA 2LVMA 1RAIB 2KBTA 2VXFA 2A28A 1M3AA 2XU8A 1QVGA 2RK2A 2M0YA 2BZYA 5J39A 3RBBB 1WNLA 4EMKA 1KFZA 4RTYA 4TVRA 5GANg 4JRKA 1HXDA 5LJ3h 1YHQQ 3LWHA 2E1HA 2SEMA 2DM1A 2ZPFB 1VQ8T 5LJ3g 2MCNA 1ABQA 4M77E 5CKEA 1CKAA 2XDPA 3OYHA 4J9DA 5KCHA 4IURA 4JPBW 2DZCA 4EMKC 4PJOE 1YWOA 2ENMA 3JCMb 4BACA 1VQLQ 1N9RA 5M9OA 2E64A 4PFZA 4E7SA 3P8DA 4LE9A 1W2BP 5IXFA 3VS6A 2L8DA 4M78F 4GLMA 5GMKh 3EGXA 3QWYA 2CT4A 1CKBA 2YDLA 4JZ3A 4FYVB 3OMCA 2CZ7B 1T0JA 1FXXA 2YRDA 3OQ5A 1FMKA 1AWXA 2J6OA 3CCVA 1VQMQ 4P5NA 2EGAA 3CCVT 2C0OA 3M59A 4MZMA 2ED1A 3VS4A 2VGNA 4F7UF 2VUBA 1ZSZC 1NE8A 2K6DA 5LJ3f 4WCIA 2K2MA 1M90U 1YIJA 1KSWA 4A4FA 1Y71A 1WJRA 4D6WA 3L1AA 1Q95G 3G6EA 4IUQA 2QAZA 2VXEA 2XG8D 3DLMA 1F1BB 2JS2A 2K9GA 1JRIA 1SG5A 5GMKj 1M2VB 4HXJA 1DJ7B 2CP7A 1VQPA 4M7DC 2M51A 1AWWA 2YRVA 3NGPA 4FSSA 1VYUA 2RQTA 3FRNA 3V8JA 4AFSC 3JV3A 2JN0A 1UHFA 4C8QC 1J3TA 4RTXA 1KG1A 2P84A 2VC8A 5KE3A 3L2WA 4JZ4A 1SPKA 4PJOG 4BDYA 3GF5A 1UGVA 3DLLA 5FU7C 2ZAEA 3E19A 4KT0E 2OTJT 4JJDA 1RL2A 1H3HA 3CPWP 1RAHB 2OTLT 2QA4T 2X51A 1GCQC 2CH4W 4N4HA 3O8VA 1B34B 3EFRA 3U23A 1Q86C 2JT4A 5CO7A 3AHUA 1WXTA 4C8QF 1KHCA 5FU6C 3X26B 3OYJA 2K3YA 3T9NA 3A1PA 2PTKA 2MPXC 2GCXA 1QKWA 2EYZA 1SSHA 2KVQG 4OB3B 1C6VX 1E7OA 4FL6A 4OMPA 3RNJA 1BB9A 8AT1B 3CCUT 4PLIA 4E6RA 1N5ZA 2E70A 4ZGDB 3CCSQ 3HHTB 1C0MA 1JJ2S 2OJ2A 1OZ3A 1G2BA 2EKOA 3SEMA 1AZGB 2KEAA 4KBMB 5L8RE 2R5MA 1FYNA 1M2OA 1IHVA 1YNZA 1VQ8Q 4KUDK 2DIQA 1I07A 2F5KA 3OYYA 2F5TX 4DOWA 5IT9E 3M57A 2EQUA 2K5FA 2QEXT 3EAEA 1NLOC 1P92A 3FJPA 5GAMh 2O88A 3BE3A 4PJNA 4KH0B 3I9QA 1IRXA 4BB7A 4C8QD 3QHSA 1OPLA 3INZA 1UGSB 4KULA 5IH2A 1VQKQ 1VQ5Q 3EG9A 3CCMQ 3TREA 2PVDB 1XNIA 2P0PA 3HFOA 1MMNA 5J3BA 2CSIA 1NLPC 1ZSZA 3L2UA 2RHUA 2VKNA 3LLRA 3H8ZA 4JRIA 3QPHA 1WHMA 2B86A 5LJ5j 1YHQT 1K9MR 1AD5A 2OTLA 5GAOm 3M54A 1GCPA 1QP2A 3PVQA 1VQKT 2HBWA 3OYNA 5GJWB 1VQ7T 1KIKA 3CD6A 2XD0A 4J9GA 2KRNA 4ZN1A 5A0LA 4C92D 3CMAQ 3CD6Q 4IUPA 1V1CA 2NUPA 2DERA 3OS1A 1N27A 1SEMA 8ATCB 1M1KC 4QQGA 3OYBA 2LT4A 3EH1A 4Y91A 3EHRA 2P0QA 3I55A 3CPWA 4C92G 2GGRA 3UT1A 3CCQQ 4M7DF 4RCCA 1WJSA 2QTVA 4BDZA 1YBYA 2AZSA 1HJDA 5CQYA 5GAMd 1MNEA 3JB9D 1Q86U 4C5EA 2HAXA 2XHCA 1BIAA 5HK0A 1VUBA 5GAN3 2DRKA 5CKDA 4RTUA 4E7KA 5CKBA 1M90C 3CMET 5GANj 2YHTA 3CCRQ 1BIBA 5CKHA 2XICA 2ESWA 4N4GA 1U1SA 1I5OB 3FEOA 4DOVA 1YITA 1BK2A 3KXTA 1SHFA 4KUIA 2FEIA 2O01E 2BZXA 5CIUA 3M0SA 3OYMA 3CCLA 5C6SA 1Y0MA 4XTUA 4Y92A 1XQHA 1OZ2A 4ELZC 2KAFA 3CCLQ 2IVWA 5GAN5 1YJWQ 3CMAT 4FYWB 2K3XA 1IZ6A 1KQSP 1X75C 5GAN6 1D1CA 4A4EA 3CCJQ 4LD9K 3RKXA 1KK7A 2RN8A 2VWFA 1QLYA 3BY7A 1NG2A 4PKCC 5DLOA 2GNCA 3M53A 3NFCA 3M9QA 1JQQA 2E4HA 1KC8C 2PUOB 3DB3A 2KI7A 2YUPA 4J6WA 2F2XA 1BI2A 4MZPA 4XK8E 1S1NA 5CR2A 2DO3A 1FMWA 3CXCS 4DBFA 1PKTA 2COYA 3CCQT 1FMVA 3MPUB 2GFAA 1TTHB 3RUXA 1S72A 2ZPBB 4J8OA 5GANf 1SRMA 3A8HB 1T3LA 3JB9J 4EMGA 3PNWC 4Z88A 2DFUA 2PNIA 3ZEHA 1RI0A 1EX4A 3FC3A 2ZPIB 4C0FA 1IHWA 4Z89A 2E5QA 3G6EQ 3QIIA 2O2OA 4IIMA 4RKUE 4O6JA 1I8FA 1LCKA 1M30A 2KE9A 2HBPA 1VYVA 2KRMA 2RM4A 1YJWT 1AEYA 1M4ZA 2K7AA 2RQRA 2EYWA 1VQPT 4E47A 3V7SA 3PGGA 1UG1A 3CQTA 1RI9A 4N4IA 2JW4A 3CXCP 5CQXA 2CUDA 1K9MC 7AT1B 3N5BB 2DLPA 5KH6A 3LH0A 4OP0A 4PFPA 2JUFA 3JCMd 4HKEA 3CC2A 3A8OB 4BI4A 1VQ9T 3RERA 2DD4A 4E7ZA 3CMAA 2FB7A 1G3SA 3CC7Q 3EGUA 4YTLA 1BI0A 3HKSA 1PHTA 4A4KA 2MYSA 3H0IA 2FZKB 2AKKA 4LUEA 1EZZB 1K9MU 4O5VA 1KC8U 5HCKA 4B9XA 3ZL7C 4HCKA 3E9GA 3X20B 2XDBA 4JJCA 4PK4A 2I0NA 2EQMA 3GIBA 2QASA 3VV0A 1YITT 2DZ9A 3M56A 3E2UA 2DXCA 3QG1A 2LQNA 2BKDN 3HPWA 1E6HA 1M9SA 2KYBA 1VQ6A 1YP5A 3C0CA 2C0TA 4ZNXA 3JB9H 2B8AA 2VASA 4LDYA 4D8KA 1AWOA 2ECZA 2ZCFB 2EW3A 1X27A 3PFSA 2YT6A 4L5GA 2NYSA 4X9CA 1I4K1 4JRQA 4JJNK 2ROLA 4RG8A 2DVJA 3SFMA 3A8MB 4E7IA 3OYFA 4F04B 2F69A 1SHGA 2X9HA 3OW2P 2IG0A 2LZ6B 5GAOr 1W70A 1U8RA 3QJ6A 3TCJA 2EFIA 1IXDA 2CREA 3EG9B 1VQ4A 2HD0A 5C0MA 1QQJA 2ZPHB 5IHKA 2OTJQ 3VS2A 3MO8A 2HMAA 3BW1A 4BI3A 1VQ4Q 1N9SA 2NUTA 3R6OA 3LGLA 4QT7A 1KQSA 2J7IA 3M58A 2CKKA 5KYUB 4DQ2A 1JXOA 2IPOB 4NS5A 4CC3A 3CC4A 3RIRA 3L2QA 1W2BA 2KT8A 4BE1A 2EPDA 3RDVA 2HCKA 1PNJA 3DKMA 1R0CB 1VQNQ 1PD1A 3I56A 2DIGA 1RUWA 3FJ5A 3FDRA 4J9EA 2EJFA 1VQNA 2HKQB 1PRMC 3QZ5B 1JO8A 2HNIA 4J83A 1D3BB 1K8AU 3PIOA 2MWOA 4EDUA 1I0CA 4HVVA 4M77F 2XMFA 4AMCA 2HL5C 3I55Q 1K73C 1WYXA 1TH7A 2QXFA 5AT1B 2FRYA 3C94A 3REBB 2DL4A 3OSSC 2Y4XA 1ZSGA 2AHJB 2QQAA 1BCOA 1UUEA 1NYFA 5KYUA 1RAGB 2CDTA 1VQOT 4OF1A 4M7AB 2QTXA 4PL6A 5HK3A 1QVGS 2DETA 4MDWA 2BUDA 3RESA 1K0SA 5D7UA 2BIVA 2J6FA 3L2RA 2V1RA 2FZCB 1QCFA 4OMNA 5GAOn 3ASKA 2YUNA 1WA7A 4FSXA 3CC4T 2VB6A 2JMAA 5FW9A 2HQHA 3VS5A 4M7AG 3THKA 4M75G 2YSQA 3EG2A 3AT1B 4A4GA 4LDXA 2RF0A 2QA4A 2RHIA 1YN8A 4EMHA 3UWNA 1KD1R 4GBQA 4FT4A 1NZ9A 2LQWA 4VUBA 3S3NA 3CCEQ 5CAIA 5GAN7 1OV3A 1KC8R 1A0NB 3JB9G 1HD3A 1VQ4T 2C06A 4OB1B 4QQDA 1QCNA 2BE9B 5ECAA 4II1A 3OBWA 4AFQC 5KCOA 3CC7T 2L5QA 2NUTB 4C8QB 1M3BA 1WFWA 2CUBA 2E3HA 2CZ0B 4KGZB 4C92C 3C4SA 4E2FB 4M75E 4M7AE 4XTVA 4V2SA 3V8LA 1S72Q 4WTOB 4PJOD 1GCQA 3EGXB 4J9IA 2IIMA 2DJQA 2A36A 2AT1B 3NTIA 1QMCA 1K4US 2V8KA 3CBPA 3V7CA 1M2VA 3QWXX 2JJ9A 2RB6A 2LCSA 1MUZA 1ZBJA 4KGVB 1U1TA 3PE0A 2J05A 1QCOA 1VQ9Q 1R0BG 2DX1A 2I2LA 4DBHA 1KQ1A 1AOJA 3MHXA 4PJJA 2PVGB 1VQ9A 2RHYA 1K1ZA 3PMIA 3CC4Q 4Z8AA 2RJEA 1UECA 2RA2A 2CS7A 2A37A 1RAAB 1YJNQ 3OA6A 3C12A 1QVFA 1NYGA 4M7DA 1I5LA 1BI1A 1TUGB 2RMOA 4IIOA 2DAQA 4M77A 2W10A 3BDLA 3R6NA 3CC2T 1VQ8A 2D8JA 2EQIA 4C8QE 4RTTA 4AG1C 4EPCA 2LJ3A 4HCCA 4LDWA 4C0ZA 2BE7D 3V8KA 5LJ5g 1MMDA 2RHXA 3CC7A 2D0NA 1K8AC 4XU1A 3JB9F 1N6AA 4J6YA 2DEQA 1VOMA 4IUVA 5HY6A 4M78C 2DYIA 3HSBA 1GFDA 3ER0A 1XJWB 2DA9A 2QQSA 3VU3C 2DVEA 1WPYA 2COZA 1S72T 2KK4A 2E6NA 2DF6A 1HSQA 1WZOA 5LL6S 4XTXA 1QWEA 3CCQA 4RUGA 2CZ6B 1TUDA 2KXDA 1SKUB 4MDXA 4PJOC 1JJ2A 5LJ3e 4D8DA 1Q81C 3MCAB 3GP8A 3TVTA 4HVWA 3HRUA 1I81A 2O31A 4BY6C 2WSCE 5DLQE 3CCRA 1QKXA 5GAOp 5D6XA 3MEVA 1CSKA 3G4SA 3A5ZB 1EFNA 4A63B 1TSFA 1BCMA 2FHDA 2VVKA 2D0QB 1ZUUA 1PKSA 3JCMJ 2ZPEB 2MK5A 2EJGA 2LMJA 1U3OA 1B07A 4ATOA 3META 4J5YA 3V7RA 3OW2A 2EGCA 5GAN8 1ZUKA 3QKJA 1D09B 1X2QA 1MGQA 1YCYA 2E65A 2DL7A 4UC4A 3OSVA 1VQNT 3MEUA 1G3WA 4EIKA 2A3LA 3HRTA 1GBRA 3I5SA 1UJ0A 4M75A 4M7AA 3CMEA 4C5GA 2YUQA 3NPFA 3CCLT 1AZEA 1SSFA 1K9AA 2ROTA 3D7SB 4M78D 2O9VA 4PJOF 3TSZA 2X4JA 1M5Q1 4PFOA 5IXBA 1FX7A 4HVUA 2NUPB 3I56T 4M78E 2M02A 2YUOA 2GQVA 2MOXA 5KYNA 2JMCA 2KMTA 2EWNA 2JTMA 1QW1A 2Z0WA 4ZGEB 3PT9A 2KRSA 3P8BB 4M77C 2KXCA 1NJIC 4R55A 2CH4A 5IAYA 1M27C 2JZ2A 4B6MA 5A0DA 3OYDA 3UATA 1U06A 4C0DC 3NHNA 1UGQB 3CCMA 3CCET 1VQ7A 3CEYA 1GRIA 2GTJA 3M5AA 4M75C 1YJ9Q 1OX9A 3QXEB 2RH2A 2DYBA 4N0AC 3CCMT 4M75F 3S6WA 4X34A 4J7IA 5GAMe 1K73R 4F7UB 2V8JA 4XU3A 1PM3A 5GANd 4NL3A 1TS9A 3I35A 1V29B 4M7DB 1M1FA 3BDUA 4OGEA 4RTVA 3QZ9B 3ZBDA 2COWA 4J9HA 3CCST 3QJYA 3WVEB 3LW5E 3PTAA 1X69A 3G6ET 1N8RC 2QEXA 3CBOA 2KROA 3GNGA 4JDSA 1ZBXA 4R56A 1KD1C 2D1XA 4Z02A 5CK9A 4OVAA 2L3QA 1OQKA 3MEWA 1PSFA 1Y07A 2K5LA 1NPPA 2E3IA 1X6GA 3VS7A 4BY6B 3JCMP 3CXCA 2EIFA 2WSEE 3L2VA 2QQBA 3CC2Q 1AHJB 4B9WA 4J7FA 4JJBA 1PWTA 3H0HA 2H8HA 1UHCA 3OYAA 5GAN2 2LJ1A 2DXBA 3VJPA 1JB0E 2EBPA 2D9TA 4JLGA 2QG9B 4M77D 1Q7YC 2DBKA 2NLUA 3G4SQ 3UA6A 3MJXA 3RKWA 3SD4A 3TU4K 1G3TA 4KRTA 5I2SA 3HL8A 2K5IA 3SWNA 2EVRA 2OAUA 3SWNC 2E12A 4HA8A 4F14A 1H3ZA 2JM8A 2GBQA 2JTFA 3NTHA 3OYCA 3EG0A 2EAYA 2CSQA 1NPRA 3MKDA 1B7TA 2CP6A 4MMKA 2JXBA 1QVPA 2CGHA 1IB8A 4XU2A 2A0FB 4A53A 1QVFP 3OS0A 2X35A 4HT9A 1OPKA 6AT1B 4C92F 4BUGA 2J6KA 2NWMA 4OMMA 3M0UA 1ZA2B 5GAOq 4HT8A 5GAMf 2QDYB 2L3PA 1VQLT 5FROA 2RHZA 3WVDB 2PUKB 3LGFA 1B34A 4IUTA 3SB2A 2DPPB 1U5SA 2JM9A 5GAMg 2OAWA 4F7UE 3X28B 2DE0X 4BE0A 4CC7A 4OMQA 1PG5B 1BU1A 5KYWB 2FYKA 5I22A 2CZ1B 4C0DB 4PNOA 3SDZA 2CP5A 1VQ5A 2LNHB 1Q82C 4AFZC 4HCZA 4JUVA 5GMKm 4J9BA 1ABOA 1N8RU 3IQLA 2DXTA 2M1HA 2A7YA 2HEQA 1RADB 5GMKe 1ZUYA 4LDUA 1WQWA 1VQOA 3F70A 2F1LA 1G3YA 1V76A 3OB9A 2XIDA 2OTLQ 3HTRA 2EJ9A 4ZTFA 1Q7YU 3OYKA 1H92A 2QDLA 1Q81R 1WLPB 2FZGB 1LVKA 2DNUA 2LDMA 3H9NA 4OB0B 4RTWA 4RMOA 2X4WA 1KJWA 2K2VA 3FB9A 1IO6A 2JS0A 4NOYA 1WHKA 1PC0A 4C0GA 3G71Q 2P0KA 1MMAA 1W4SA 1OYXA 1WXBA 1IREB 3OYGA 1RLQC 2AZVA 4XTYA 2P4TA 1Z9ZA 2M9UA 3SHWA 1KQSS 4J6XA 3OMGA 4QQ6A 4DEYA 3HRSA 1MMGA 2O4XB 1D3BA 4DBQA 2QA4Q 1KQ2A 1YITQ 1NEBA 1QP3A 1W2BS 2AIRB 2EYYA 1ACMB 4ORZA 2L3SA 2K57A 4OMLA 4QVZA 5GAN4 2QQRA 5L23A 2C0IA 3CMEQ 3JCMQ 3M4YA 5CKFA 4M78G 2QGGA 4M7AC 1GL5A 4J9CA 3NTKA 5LJ5e 3M0TA 3RMSA 4FU6A 1G5VA 1PRLC 1WDXA 3CD6T 5A0GA 4JS5A 5KYYB 2KGTA 3NMZC 2XKOC 5KYXA 2JOYA 2YLCA 2EKHA 1YHQA 1WHHA 1LPLA 4EMKB 5I2MA 2E10A 2V8IA 1T0HA 2LCLA 2E5KA 4JRPA 2KQWA 1YI2A 4A4HA 1Y57A 3CCEA 3VS0A 3G71T 1AWJA 4PLLA 1ZLMA 1NJIR 3H6ZA 1K76A 2RJCA 3JCMg 3KBGA 3C95A 4E7LA 2RD1A 4C5IA 1X01A 2YXYA 2MF2A 3RR6A 3CCJA 5FRMA 1TOVA 1X2KA 4C92A 4LDVA 4AFUC 4CRIA 1E6GA 4OGCA 1XTDA 2QI2A 4DEXA 3S3OA 1UE9A 1ZSZB 2KNBB 2DL8A 3CCVQ 1VQMA 2M0OA 2GF7A 3EG3A 2FG0A 1WGSA 2YLBA 4E7JA 4C92B 1K73U 1ZX6A 3OS5A 1VA7A 4FM4B 4L59A 3TEEA 3QDRB 1WXUA 1VYTA 2NUZA 5FRNA 1Q82R 2RO0A 1X6BA 3M0RA 2KDSA 1JEGA 5D6WA 3G7ZA 2QEXQ 2LX9A 4M78A 2RQUA 1OU9A 2LP5A 3FLGA 2BZ8A
chains in the Genus database with same CATH topology
1QWFA 2K7AA 4LNPA 2EGCA 2RQRA 2EYWA 5IHNA 2FPFA 1ZUKA 1X2QA 5FWBA 1UG1A 1XOVA 3CQTA 2DL7A 1RI9A 2JW4A 3EHQA 2CUDA 4EIKA 2ED0A 1GBRA 3I5SA 1UJ0A 2DRMA 2A08A 2DLPA 3UA7A 2YUQA 3NPFA 2KBTA 1AZEA 2A28A 1TUCA 1M3AA 1K9AA 2ROTA 2M0YA 2BZYA 3RBBB 2O9VA 3TSZA 2MIOA 1KFZA 4RTYA 3EGUA 2SEMA 2DM1A 3REAB 2O9SA 5IXBA 1PHTA 1WI7A 4HVUA 3H0IA 2AKKA 4LUEA 1ABQA 2MCNA 2RPNA 2YUOA 4ESRA 1CKAA 5HCKA 1M3CA 2MOXA 3ZL7C 2JMCA 4HCKA 3I5RA 2D8HA 4J9DA 2KRSA 2L0AA 4JPBW 4JJCA 1YWOA 2ENMA 3H41A 2KXCA 2I0NA 2CH4A 1M27C 4LE9A 2LQNA 3UATA 5IXFA 3VS6A 1U06A 2W0ZA 3NHNA 1E6HA 2KYBA 4GLMA 1GBQA 2DMOA 1YP5A 3C0CA 2C0TA 1GRIA 2GTJA 3QWYA 4ZNXA 2CT4A 2DYBA 1CKBA 4D8KA 1AWOA 2ECZA 2YDLA 4JZ3A 2EW3A 1X27A 5FWCA 3TSWA 2YT6A 1T0JA 1FMKA 1AWXA 2J6OA 2KYMA 1WIEA 2EGAA 2C0OA 2ROLA 2DVJA 2ED1A 3VS4A 4M4ZA 1SHGA 2RQVA 2K6DA 2RNAA 3I35A 4WCIA 2LZ6B 2K2MA 2PZ1A 4J9FA 1W70A 1KSWA 4RTVA 4J9HA 3EG1A 2CREA 1X69A 1UJYA 2V1QA 4CC4B 5IHKA 1NM7A 1W6XA 3VS2A 1ARKA 2KROA 3H0FA 2JS2A 2K9GA 2D1XA 4HXJA 4QT7A 2J7IA 2M51A 2DL5A 1AWWA 2L3QA 3NGPA 4LUDA 4FSSA 1VYUA 1JXOA 2RQTA 4CC3A 4AFSC 3JV3A 1X6GA 1UHFA 3VS7A 2KT8A 1Z9QA 1J3TA 2JTEA 2EPDA 2K79A 1GFCA 4RTXA 2HCKA 2RQWA 2ABLA 4JZ4A 1SPKA 1PNJA 1UGVA 4JJBA 1PWTA 3H0HA 2H8HA 3VRZA 1UHCA 3VS1A 1RUWA 2LJ1A 4JJDA 3FJ5A 2EBPA 4J9EA 1H3HA 2DBKA 5IHIA 2EYXA 2L2PA 1PRMC 3UA6A 1GCQC 2CH4W 3U23A 1JO8A 1B3QA 2JT4A 4KRTA 1I0CA 1WXTA 4HVVA 2XMFA 2EVRA 3PVLA 4F14A 2JM8A 2GBQA 1WYXA 2PTKA 3EG0A 4F17A 2CSQA 2FRYA 3REBB 1UTIA 1QKWA 2EYZA 2DL4A 1SSHA 2JXBA 2P4RA 1ZSGA 2X3WD 2HSPA 1E7OA 3RNJA 4OMPA 1BB9A 2X3XD 1UUEA 1NYFA 3VRYA 1OPKA 2CDTA 4E6RA 1N5ZA 2J6KA 2NWMA 1UDLA 3M0PA 3A98A 4OMMA 2J06A 3M0UA 2OJ2A 1G2BA 3SEMA 1AZGB 1K0SA 2KEAA 2L3PA 2J6FA 1JXMA 1FYNA 2V1RA 1QCFA 4OMNA 1YNZA 1I07A 1YCSB 4LN2A 2YUNA 1U5SA 2JM9A 1WA7A 2OAWA 2DE0X 2JMAA 5FW9A 1NLOC 4OMQA 3VS5A 4CC7A 2O88A 3THKA 1BU1A 2YSQA 3EG2A 5I22A 3KFVA 2RF0A 3I9QA 2KR3A 2LNHB 1YN8A 3O5ZA 4AFZC 4GBQA 1OPLA 1ABOA 4J9BA 2LQWA 3IQLA 5IH2A 2HEQA 1ZUYA 2G6FX 1OV3A 1MV0B 1A0NB 1HD3A 1K0XA 2CSIA 1NLPC 1M8MA 2VKNA 1H92A 5ECAA 1OEBA 2QDLA 2B86A 4AFQC 2K3BA 1WLPB 2DNUA 1AD5A 1YWPA 2FRWA 1GCPA 1M3BA 3PVQA 2HBWA 1WFWA 2AKLA 5GJWB 1KIKA 4RTWA 2CUBA 4J9GA 2KRNA 1KJWA 1IO6A 2JS0A 1GCQA 1G83A 4J9IA 1V1CA 2DBMA 2DJQA 2IIMA 1SEMA 2A36A 2EGEA 1K4US 2SRCA 2DL3A 3EHRA 4K11A 1UFFA 1WXBA 3QWXX 1RLQC 1MUZA 1ZBJA 2LCSA 2GGRA 2AZVA 3PE0A 2J05A 4CC2A 1Z9ZA 5EC7A 2BTTA 3SHWA 1W1FA 2DX1A 2AZSA 1HJDA 2LJ0A 4DEYA 1AOJA 2FPEA 1K1ZA 1T3SA 5GJVB 2DRKA 4RTUA 4Z8AA 1NEBA 2EYYA 1UECA 4ORZA 2A37A 2L3SA 3LH5A 4OMLA 1NYGA 2ESWA 5L23A 2C0IA 2DILA 1BK2A 1SHFA 2RMOA 1GL5A 4IIOA 2FEIA 1OOTA 4J9CA 2W10A 2BZXA 3R6NA 3M0TA 3M0SA 2D8JA 2EQIA 1I1JA 1PRLC 1AVZC 1WDXA 4RTTA 4AG1C 1Y0MA 2LJ3A 4Y92A 1JU5C 2F2VA 2KGTA 3NMZC 1X43A 3ULRB 4AG2C 2EKHA 2D0NA 4OMOA 2AK5A 2HDAA 2F2WA 3VS3A 1WX6A 1NEGA 1T0HA 4R0KA 1RLPC 2E5KA 2FO0A 1GFDA 2GTOA 1Y57A 3VS0A 1AWJA 1ZLMA 5I11A 2DA9A 1BBZA 1K76A 2RN8A 2VWFA 1QLYA 1NG2A 2GNCA 1JQQA 2DF6A 2CT3A 1HSQA 3GBQA 2FPDA 1QWEA 2YUPA 1SRLA 1X2KA 2F2XA 4RUGA 4RTZA 1TUDA 4AFUC 1S1NA 1E6GA 2KXDA 1MV3A 4DEXA 2KT1A 4D8DA 2OI3A 1PKTA 1UE9A 3TVTA 2KNBB 4HVWA 2DL8A 4F16A 2O31A 3EG3A 2FG0A 2GQIA 1QKXA 3M0QA 1SRMA 1T3LA 2LX7A 1CSKA 4X1VA 1ZX6A 4Z88A 1VA7A 1EFNA 2PNIA 4A63B 1WXUA 1VYTA 2NUZA 2VVKA 1H8KA 1ZUUA 1X6BA 3M0RA 4Z89A 1JEGA 1PKSA 2O2OA 4IIMA 3UF4A 2LMJA 1U3OA 1B07A 1LCKA 2RQUA 1M30A 2LP5A 2KE9A 1TG0A 1VYVA 2KRMA 2BZ8A 1AEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QWF A;  2K7A A;  4LNP A;  2EGC A;  2RQR A;  2EYW A;  5IHN A;  2FPF A;  1ZUK A;  1X2Q A;  5FWB A;  1UG1 A;  1XOV A;  3CQT A;  2DL7 A;  1RI9 A;  2JW4 A;  3EHQ A;  2CUD A;  4EIK A;  2ED0 A;  1GBR A;  3I5S A;  1UJ0 A;  2DRM A;  2A08 A;  2DLP A;  3UA7 A;  2YUQ A;  3NPF A;  2KBT A;  1AZE A;  2A28 A;  1TUC A;  1M3A A;  1K9A A;  2ROT A;  2M0Y A;  2BZY A;  3RBB B;  2O9V A;  3TSZ A;  2MIO A;  1KFZ A;  4RTY A;  3EGU A;  2SEM A;  2DM1 A;  3REA B;  2O9S A;  5IXB A;  1PHT A;  1WI7 A;  4HVU A;  3H0I A;  2AKK A;  4LUE A;  1ABQ A;  2MCN A;  2RPN A;  2YUO A;  4ESR A;  1CKA A;  5HCK A;  1M3C A;  2MOX A;  3ZL7 C;  2JMC A;  4HCK A;  3I5R A;  2D8H A;  4J9D A;  2KRS A;  2L0A A;  4JPB W;  4JJC A;  1YWO A;  2ENM A;  3H41 A;  2KXC A;  2I0N A;  2CH4 A;  1M27 C;  4LE9 A;  2LQN A;  3UAT A;  5IXF A;  3VS6 A;  1U06 A;  2W0Z A;  3NHN A;  1E6H A;  2KYB A;  4GLM A;  1GBQ A;  2DMO A;  1YP5 A;  3C0C A;  2C0T A;  1GRI A;  2GTJ A;  3QWY A;  4ZNX A;  2CT4 A;  2DYB A;  1CKB A;  4D8K A;  1AWO A;  2ECZ A;  2YDL A;  4JZ3 A;  2EW3 A;  1X27 A;  5FWC A;  3TSW A;  2YT6 A;  1T0J A;  1FMK A;  1AWX A;  2J6O A;  2KYM A;  1WIE A;  2EGA A;  2C0O A;  2ROL A;  2DVJ A;  2ED1 A;  3VS4 A;  4M4Z A;  1SHG A;  2RQV A;  2K6D A;  2RNA A;  3I35 A;  4WCI A;  2LZ6 B;  2K2M A;  2PZ1 A;  4J9F A;  1W70 A;  1KSW A;  4RTV A;  4J9H A;  3EG1 A;  2CRE A;  1X69 A;  1UJY A;  2V1Q A;  4CC4 B;  5IHK A;  1NM7 A;  1W6X A;  3VS2 A;  1ARK A;  2KRO A;  3H0F A;  2JS2 A;  2K9G A;  2D1X A;  4HXJ A;  4QT7 A;  2J7I A;  2M51 A;  2DL5 A;  1AWW A;  2L3Q A;  3NGP A;  4LUD A;  4FSS A;  1VYU A;  1JXO A;  2RQT A;  4CC3 A;  4AFS C;  3JV3 A;  1X6G A;  1UHF A;  3VS7 A;  2KT8 A;  1Z9Q A;  1J3T A;  2JTE A;  2EPD A;  2K79 A;  1GFC A;  4RTX A;  2HCK A;  2RQW A;  2ABL A;  4JZ4 A;  1SPK A;  1PNJ A;  1UGV A;  4JJB A;  1PWT A;  3H0H A;  2H8H A;  3VRZ A;  1UHC A;  3VS1 A;  1RUW A;  2LJ1 A;  4JJD A;  3FJ5 A;  2EBP A;  4J9E A;  1H3H A;  2DBK A;  5IHI A;  2EYX A;  2L2P A;  1PRM C;  3UA6 A;  1GCQ C;  2CH4 W;  3U23 A;  1JO8 A;  1B3Q A;  2JT4 A;  4KRT A;  1I0C A;  1WXT A;  4HVV A;  2XMF A;  2EVR A;  3PVL A;  4F14 A;  2JM8 A;  2GBQ A;  1WYX A;  2PTK A;  3EG0 A;  4F17 A;  2CSQ A;  2FRY A;  3REB B;  1UTI A;  1QKW A;  2EYZ A;  2DL4 A;  1SSH A;  2JXB A;  2P4R A;  1ZSG A;  2X3W D;  2HSP A;  1E7O A;  3RNJ A;  4OMP A;  1BB9 A;  2X3X D;  1UUE A;  1NYF A;  3VRY A;  1OPK A;  2CDT A;  4E6R A;  1N5Z A;  2J6K A;  2NWM A;  1UDL A;  3M0P A;  3A98 A;  4OMM A;  2J06 A;  3M0U A;  2OJ2 A;  1G2B A;  3SEM A;  1AZG B;  1K0S A;  2KEA A;  2L3P A;  2J6F A;  1JXM A;  1FYN A;  2V1R A;  1QCF A;  4OMN A;  1YNZ A;  1I07 A;  1YCS B;  4LN2 A;  2YUN A;  1U5S A;  2JM9 A;  1WA7 A;  2OAW A;  2DE0 X;  2JMA A;  5FW9 A;  1NLO C;  4OMQ A;  3VS5 A;  4CC7 A;  2O88 A;  3THK A;  1BU1 A;  2YSQ A;  3EG2 A;  5I22 A;  3KFV A;  2RF0 A;  3I9Q A;  2KR3 A;  2LNH B;  1YN8 A;  3O5Z A;  4AFZ C;  4GBQ A;  1OPL A;  1ABO A;  4J9B A;  2LQW A;  3IQL A;  5IH2 A;  2HEQ A;  1ZUY A;  2G6F X;  1OV3 A;  1MV0 B;  1A0N B;  1HD3 A;  1K0X A;  2CSI A;  1NLP C;  1M8M A;  2VKN A;  1H92 A;  5ECA A;  1OEB A;  2QDL A;  2B86 A;  4AFQ C;  2K3B A;  1WLP B;  2DNU A;  1AD5 A;  1YWP A;  2FRW A;  1GCP A;  1M3B A;  3PVQ A;  2HBW A;  1WFW A;  2AKL A;  5GJW B;  1KIK A;  4RTW A;  2CUB A;  4J9G A;  2KRN A;  1KJW A;  1IO6 A;  2JS0 A;  1GCQ A;  1G83 A;  4J9I A;  1V1C A;  2DBM A;  2DJQ A;  2IIM A;  1SEM A;  2A36 A;  2EGE A;  1K4U S;  2SRC A;  2DL3 A;  3EHR A;  4K11 A;  1UFF A;  1WXB A;  3QWX X;  1RLQ C;  1MUZ A;  1ZBJ A;  2LCS A;  2GGR A;  2AZV A;  3PE0 A;  2J05 A;  4CC2 A;  1Z9Z A;  5EC7 A;  2BTT A;  3SHW A;  1W1F A;  2DX1 A;  2AZS A;  1HJD A;  2LJ0 A;  4DEY A;  1AOJ A;  2FPE A;  1K1Z A;  1T3S A;  5GJV B;  2DRK A;  4RTU A;  4Z8A A;  1NEB A;  2EYY A;  1UEC A;  4ORZ A;  2A37 A;  2L3S A;  3LH5 A;  4OML A;  1NYG A;  2ESW A;  5L23 A;  2C0I A;  2DIL A;  1BK2 A;  1SHF A;  2RMO A;  1GL5 A;  4IIO A;  2FEI A;  1OOT A;  4J9C A;  2W10 A;  2BZX A;  3R6N A;  3M0T A;  3M0S A;  2D8J A;  2EQI A;  1I1J A;  1PRL C;  1AVZ C;  1WDX A;  4RTT A;  4AG1 C;  1Y0M A;  2LJ3 A;  4Y92 A;  1JU5 C;  2F2V A;  2KGT A;  3NMZ C;  1X43 A;  3ULR B;  4AG2 C;  2EKH A;  2D0N A;  4OMO A;  2AK5 A;  2HDA A;  2F2W A;  3VS3 A;  1WX6 A;  1NEG A;  1T0H A;  4R0K A;  1RLP C;  2E5K A;  2FO0 A;  1GFD A;  2GTO A;  1Y57 A;  3VS0 A;  1AWJ A;  1ZLM A;  5I11 A;  2DA9 A;  1BBZ A;  1K76 A;  2RN8 A;  2VWF A;  1QLY A;  1NG2 A;  2GNC A;  1JQQ A;  2DF6 A;  2CT3 A;  1HSQ A;  3GBQ A;  2FPD A;  1QWE A;  2YUP A;  1SRL A;  1X2K A;  2F2X A;  4RUG A;  4RTZ A;  1TUD A;  4AFU C;  1S1N A;  1E6G A;  2KXD A;  1MV3 A;  4DEX A;  2KT1 A;  4D8D A;  2OI3 A;  1PKT A;  1UE9 A;  3TVT A;  2KNB B;  4HVW A;  2DL8 A;  4F16 A;  2O31 A;  3EG3 A;  2FG0 A;  2GQI A;  1QKX A;  3M0Q A;  1SRM A;  1T3L A;  2LX7 A;  1CSK A;  4X1V A;  1ZX6 A;  4Z88 A;  1VA7 A;  1EFN A;  2PNI A;  4A63 B;  1WXU A;  1VYT A;  2NUZ A;  2VVK A;  1H8K A;  1ZUU A;  1X6B A;  3M0R A;  4Z89 A;  1JEG A;  1PKS A;  2O2O A;  4IIM A;  3UF4 A;  2LMJ A;  1U3O A;  1B07 A;  1LCK A;  2RQU A;  1M30 A;  2LP5 A;  2KE9 A;  1TG0 A;  1VYV A;  2KRM A;  2BZ8 A;  1AEY A; 
#chains in the Genus database with same CATH topology
 1OU8 A;  1KHI A;  4LNP A;  3TQ7 P;  5GMK i;  1VQO Q;  2FPF A;  3OBY A;  1VQM T;  1XOV A;  3MEA A;  2MMP A;  2DKG A;  2WAC A;  1UEB A;  5D6Y A;  3EHQ A;  2OX7 A;  1OI1 A;  2ED0 A;  3URG A;  2A08 A;  2HZY A;  3OYE A;  3UA7 A;  1N8R R;  4GLK A;  4QVC A;  4CI0 C;  3X24 B;  1TUC A;  2L3R A;  4AT1 B;  1UB4 A;  1JJ2 P;  2MIO A;  2HKN A;  3EGD A;  1Q7Y R;  3REA B;  2O9S A;  1TXQ A;  1WI7 A;  1D0Z A;  2WSF E;  4DBR A;  1K8A R;  2RPN A;  5FU6 B;  1VQP Q;  4ESR A;  1M3C A;  3I5R A;  2D8H A;  5IN1 A;  1TWB A;  1WHG A;  2L0A A;  4ZGJ B;  3H41 A;  4ME7 A;  1VQ6 Q;  1D0X A;  2KSS A;  5I21 A;  2G3R A;  2QK0 A;  1HK9 A;  2W0Z A;  5KYX B;  3L42 A;  4M75 D;  1M90 R;  4OB2 B;  3JCM f;  1GBQ A;  2DMO A;  3CPF A;  2RJF A;  1TU0 B;  1RAE B;  5FWC A;  3TSW A;  1QVF S;  2XK0 A;  4XAX B;  5GAN h;  4FYX B;  4ZTJ A;  2KYM A;  4FCY A;  4BE2 A;  1WIE A;  4FYY B;  4ELY C;  4BD3 A;  4M4Z A;  5LJ5 f;  5A2Q E;  2RQV A;  2RNA A;  4NL2 A;  1IGQ A;  2D6F A;  2PZ1 A;  4J9F A;  1VQ6 T;  3JCM W;  1UGP B;  3JCM c;  2O4X A;  2HSE B;  4PJO A;  3E9F A;  3EG1 A;  2X4Y A;  3RMQ A;  2DEU A;  1UJY A;  2V1Q A;  4CC4 B;  1BYM A;  2L89 A;  1NM7 A;  1W6X A;  2ZGW A;  1ARK A;  3CPW S;  3H0F A;  2JVV A;  3CBM A;  1YFN A;  3OYL A;  4FIB A;  4WF2 A;  3JCM X;  4QVD A;  3OY9 A;  3VKI A;  2LQ8 A;  1MND A;  3J80 E;  2DL5 A;  4M7D D;  4LUD A;  4X9D A;  1O9S A;  4M75 B;  2XI9 A;  3QUI A;  3E1S A;  1OX8 A;  1Z9Q A;  1YJN A;  2JTE A;  2RK1 A;  2K79 A;  1GFC A;  2RQW A;  4XQ3 A;  2ABL A;  4FW2 A;  2LT1 A;  1YJ9 A;  3VRZ A;  3X25 B;  3VS1 A;  1LJO A;  1WQ7 A;  1Q81 U;  1OUL A;  4A54 A;  2DTI A;  2K4Y A;  5IHI A;  2EYX A;  3FIF A;  2L2P A;  3I56 Q;  4BI8 B;  1BI3 A;  1B3Q A;  1VIF A;  4OMF B;  1MHN A;  3G1J A;  2YWW A;  4ZN3 A;  1YIJ Q;  3PMT A;  2FVU A;  3EFO A;  1VQL A;  1IGU A;  3PVL A;  2EYQ A;  3L2Z A;  2LRQ A;  1HYO A;  3OW2 S;  2EQJ A;  1ZQ1 A;  4F17 A;  3VUZ A;  4M77 B;  1UTI A;  3GOX A;  4E7H A;  2P4R A;  2X3W D;  2HSP A;  1YJ9 T;  2X3X D;  1M1K R;  1BKB A;  4MZT A;  3VRY A;  2XDD A;  4LD6 A;  4IUU A;  2LQK A;  1UDL A;  2HQE A;  3M0P A;  2H3J A;  1Y96 A;  2Y4Y A;  3A98 A;  2J06 A;  4QW2 A;  3VUB A;  3JCM e;  5DM7 R;  2KY9 A;  3VYG A;  1JXM A;  5CCA A;  3HFN A;  3P8H A;  1H64 1;  1YJN T;  1YCS B;  1GXI E;  4LN2 A;  1D1A A;  1M1G A;  2V26 A;  2QGF B;  3HP9 A;  2JNG A;  3KFV A;  4KGX B;  2KR3 A;  5GAN e;  3MP1 A;  4M7D E;  3O5Z A;  1G8X A;  3SWN B;  2R57 A;  1YI2 Q;  4XTW A;  2EQK A;  3MP6 A;  2DD5 A;  1AT1 B;  2G6F X;  1JBM A;  1MV0 B;  4JLI A;  4FW1 A;  4C8Q A;  5DY9 A;  1NJI U;  1K0X A;  5LJ5 d;  3ZFJ A;  1M8M A;  4MML A;  4IKF A;  1QVG P;  1OEB A;  3QYG B;  2K3B A;  3PIP A;  1YWP A;  3CCJ T;  4F7U G;  2FRW A;  4DA4 A;  2AKL A;  4RG2 A;  2DK3 A;  3M4G A;  3GPL A;  4M7A F;  3CCS A;  2QYZ A;  2CP2 A;  4KH1 B;  5J26 A;  1D1B A;  2PVO B;  2VV5 A;  3WXM B;  1YI2 T;  2DTH A;  1LNX A;  2CYZ B;  1G83 A;  2DBM A;  4XU0 A;  2CP3 A;  2EGE A;  3EGD B;  2LTO A;  1NBE B;  9ATC B;  2SRC A;  2DL3 A;  4K11 A;  3A8L B;  1UFF A;  1R77 A;  1R8O B;  3I55 T;  4CC2 A;  1RAC B;  2BTT A;  5EC7 A;  1W1F A;  1Q82 U;  1FWZ A;  2MI6 A;  2PU9 B;  2VGM A;  2ZPG B;  2LJ0 A;  3JB9 I;  2M16 A;  4ANJ A;  1X6O A;  5GMK l;  2FPE A;  4Y28 E;  1VQ7 Q;  3JRZ A;  2H3E B;  1T3S A;  1SF9 A;  5GJV B;  1EIF A;  1Y7X A;  1PSE A;  2LC4 A;  1WHL A;  3LH5 A;  1D0Y A;  5FLX E;  5HKC A;  1VQK A;  3EH2 A;  4M7A D;  2DIL A;  2RI2 A;  4C92 E;  5KYY A;  4M78 B;  1OOT A;  3Q1J A;  2YRC A;  3EFO B;  3LWI A;  2ZZD A;  3GNF B;  2RI3 A;  1I1J A;  1AVZ C;  1PCX A;  3M55 A;  4L6V 5;  3RKY A;  1JU5 C;  2R58 A;  3QBY A;  2F2V A;  1X43 A;  3ULR B;  4AG2 C;  1C1A A;  1WJQ A;  4OMO A;  2DXU A;  2AK5 A;  2HDA A;  1YIJ T;  5LJ5 h;  2F2W A;  3JCM V;  4FT2 A;  2Y90 A;  3VS3 A;  3EFS A;  1WX6 A;  1NEG A;  2RI5 A;  5LJ3 d;  4R0K A;  2VYT A;  3JAM E;  1RLP C;  2GFU A;  2FO0 A;  2GTO A;  5I11 A;  3GLX A;  1BBZ A;  1RAF B;  2X4X A;  1KD1 U;  2DTO A;  2R5A A;  3BFM A;  3KUF A;  5EG2 A;  2HQX A;  2MAM A;  3J7A F;  3JCM h;  4N0A A;  3LYI A;  2CT3 A;  2HL3 A;  3GBQ A;  2FPD A;  1SRL A;  4QKU A;  4RTZ A;  1LOJ A;  1MV3 A;  4XTZ A;  1PD0 A;  4PJM A;  3QO3 A;  1VIE A;  5GAM j;  2KT1 A;  3UDC A;  2LCC A;  2OI3 A;  3VYH B;  3CCU Q;  1WHJ A;  1UGR B;  1M8V A;  3ME9 A;  2FL7 A;  2QQ9 A;  4F16 A;  4PJL A;  4GY5 A;  3QSU A;  2DJZ A;  2GQI A;  3CCU A;  2LNV A;  4RCB A;  3M0Q A;  1M1K U;  4HCB A;  2LX7 A;  2MWP A;  5FU7 B;  4X1V A;  4F7U A;  3G71 A;  3MP8 A;  1ZHI A;  2RJD A;  4PJO B;  3OYI A;  3LX7 A;  5AYF A;  3UPU A;  5GAO l;  1H8K A;  5KE2 A;  2CP0 A;  3OS2 A;  3CCR T;  4Q5W A;  3UF4 A;  1Q86 R;  2ATC B;  5CVI A;  3G4S T;  4M77 G;  2E6Z A;  4C8Q G;  2OTJ A;  4LXC A;  1VQ5 T;  3JSC A;  1TG0 A;  4JS4 A;  4C5H A;  1QWF A;  1YJW A;  4M7D G;  3QDF A;  5IHN A;  5FWB A;  3DB4 A;  1O75 A;  3A8G B;  3QYH B;  3J81 E;  1ZA1 B;  1RAB B;  1Y96 B;  2DRM A;  3S3M A;  2E41 A;  5KYW A;  5LJ3 j;  2PQW A;  2LVM A;  1RAI B;  2KBT A;  2VXF A;  2A28 A;  1M3A A;  2XU8 A;  1QVG A;  2RK2 A;  2M0Y A;  2BZY A;  5J39 A;  3RBB B;  1WNL A;  4EMK A;  1KFZ A;  4RTY A;  4TVR A;  5GAN g;  4JRK A;  1HXD A;  5LJ3 h;  1YHQ Q;  3LWH A;  2E1H A;  2SEM A;  2DM1 A;  2ZPF B;  1VQ8 T;  5LJ3 g;  2MCN A;  1ABQ A;  4M77 E;  5CKE A;  1CKA A;  2XDP A;  3OYH A;  4J9D A;  5KCH A;  4IUR A;  4JPB W;  2DZC A;  4EMK C;  4PJO E;  1YWO A;  2ENM A;  3JCM b;  4BAC A;  1VQL Q;  1N9R A;  5M9O A;  2E64 A;  4PFZ A;  4E7S A;  3P8D A;  4LE9 A;  1W2B P;  5IXF A;  3VS6 A;  2L8D A;  4M78 F;  4GLM A;  5GMK h;  3EGX A;  3QWY A;  2CT4 A;  1CKB A;  2YDL A;  4JZ3 A;  4FYV B;  3OMC A;  2CZ7 B;  1T0J A;  1FXX A;  2YRD A;  3OQ5 A;  1FMK A;  1AWX A;  2J6O A;  3CCV A;  1VQM Q;  4P5N A;  2EGA A;  3CCV T;  2C0O A;  3M59 A;  4MZM A;  2ED1 A;  3VS4 A;  2VGN A;  4F7U F;  2VUB A;  1ZSZ C;  1NE8 A;  2K6D A;  5LJ3 f;  4WCI A;  2K2M A;  1M90 U;  1YIJ A;  1KSW A;  4A4F A;  1Y71 A;  1WJR A;  4D6W A;  3L1A A;  1Q95 G;  3G6E A;  4IUQ A;  2QAZ A;  2VXE A;  2XG8 D;  3DLM A;  1F1B B;  2JS2 A;  2K9G A;  1JRI A;  1SG5 A;  5GMK j;  1M2V B;  4HXJ A;  1DJ7 B;  2CP7 A;  1VQP A;  4M7D C;  2M51 A;  1AWW A;  2YRV A;  3NGP A;  4FSS A;  1VYU A;  2RQT A;  3FRN A;  3V8J A;  4AFS C;  3JV3 A;  2JN0 A;  1UHF A;  4C8Q C;  1J3T A;  4RTX A;  1KG1 A;  2P84 A;  2VC8 A;  5KE3 A;  3L2W A;  4JZ4 A;  1SPK A;  4PJO G;  4BDY A;  3GF5 A;  1UGV A;  3DLL A;  5FU7 C;  2ZAE A;  3E19 A;  4KT0 E;  2OTJ T;  4JJD A;  1RL2 A;  1H3H A;  3CPW P;  1RAH B;  2OTL T;  2QA4 T;  2X51 A;  1GCQ C;  2CH4 W;  4N4H A;  3O8V A;  1B34 B;  3EFR A;  3U23 A;  1Q86 C;  2JT4 A;  5CO7 A;  3AHU A;  1WXT A;  4C8Q F;  1KHC A;  5FU6 C;  3X26 B;  3OYJ A;  2K3Y A;  3T9N A;  3A1P A;  2PTK A;  2MPX C;  2GCX A;  1QKW A;  2EYZ A;  1SSH A;  2KVQ G;  4OB3 B;  1C6V X;  1E7O A;  4FL6 A;  4OMP A;  3RNJ A;  1BB9 A;  8AT1 B;  3CCU T;  4PLI A;  4E6R A;  1N5Z A;  2E70 A;  4ZGD B;  3CCS Q;  3HHT B;  1C0M A;  1JJ2 S;  2OJ2 A;  1OZ3 A;  1G2B A;  2EKO A;  3SEM A;  1AZG B;  2KEA A;  4KBM B;  5L8R E;  2R5M A;  1FYN A;  1M2O A;  1IHV A;  1YNZ A;  1VQ8 Q;  4KUD K;  2DIQ A;  1I07 A;  2F5K A;  3OYY A;  2F5T X;  4DOW A;  5IT9 E;  3M57 A;  2EQU A;  2K5F A;  2QEX T;  3EAE A;  1NLO C;  1P92 A;  3FJP A;  5GAM h;  2O88 A;  3BE3 A;  4PJN A;  4KH0 B;  3I9Q A;  1IRX A;  4BB7 A;  4C8Q D;  3QHS A;  1OPL A;  3INZ A;  1UGS B;  4KUL A;  5IH2 A;  1VQK Q;  1VQ5 Q;  3EG9 A;  3CCM Q;  3TRE A;  2PVD B;  1XNI A;  2P0P A;  3HFO A;  1MMN A;  5J3B A;  2CSI A;  1NLP C;  1ZSZ A;  3L2U A;  2RHU A;  2VKN A;  3LLR A;  3H8Z A;  4JRI A;  3QPH A;  1WHM A;  2B86 A;  5LJ5 j;  1YHQ T;  1K9M R;  1AD5 A;  2OTL A;  5GAO m;  3M54 A;  1GCP A;  1QP2 A;  3PVQ A;  1VQK T;  2HBW A;  3OYN A;  5GJW B;  1VQ7 T;  1KIK A;  3CD6 A;  2XD0 A;  4J9G A;  2KRN A;  4ZN1 A;  5A0L A;  4C92 D;  3CMA Q;  3CD6 Q;  4IUP A;  1V1C A;  2NUP A;  2DER A;  3OS1 A;  1N27 A;  1SEM A;  8ATC B;  1M1K C;  4QQG A;  3OYB A;  2LT4 A;  3EH1 A;  4Y91 A;  3EHR A;  2P0Q A;  3I55 A;  3CPW A;  4C92 G;  2GGR A;  3UT1 A;  3CCQ Q;  4M7D F;  4RCC A;  1WJS A;  2QTV A;  4BDZ A;  1YBY A;  2AZS A;  1HJD A;  5CQY A;  5GAM d;  1MNE A;  3JB9 D;  1Q86 U;  4C5E A;  2HAX A;  2XHC A;  1BIA A;  5HK0 A;  1VUB A;  5GAN 3;  2DRK A;  5CKD A;  4RTU A;  4E7K A;  5CKB A;  1M90 C;  3CME T;  5GAN j;  2YHT A;  3CCR Q;  1BIB A;  5CKH A;  2XIC A;  2ESW A;  4N4G A;  1U1S A;  1I5O B;  3FEO A;  4DOV A;  1YIT A;  1BK2 A;  3KXT A;  1SHF A;  4KUI A;  2FEI A;  2O01 E;  2BZX A;  5CIU A;  3M0S A;  3OYM A;  3CCL A;  5C6S A;  1Y0M A;  4XTU A;  4Y92 A;  1XQH A;  1OZ2 A;  4ELZ C;  2KAF A;  3CCL Q;  2IVW A;  5GAN 5;  1YJW Q;  3CMA T;  4FYW B;  2K3X A;  1IZ6 A;  1KQS P;  1X75 C;  5GAN 6;  1D1C A;  4A4E A;  3CCJ Q;  4LD9 K;  3RKX A;  1KK7 A;  2RN8 A;  2VWF A;  1QLY A;  3BY7 A;  1NG2 A;  4PKC C;  5DLO A;  2GNC A;  3M53 A;  3NFC A;  3M9Q A;  1JQQ A;  2E4H A;  1KC8 C;  2PUO B;  3DB3 A;  2KI7 A;  2YUP A;  4J6W A;  2F2X A;  1BI2 A;  4MZP A;  4XK8 E;  1S1N A;  5CR2 A;  2DO3 A;  1FMW A;  3CXC S;  4DBF A;  1PKT A;  2COY A;  3CCQ T;  1FMV A;  3MPU B;  2GFA A;  1TTH B;  3RUX A;  1S72 A;  2ZPB B;  4J8O A;  5GAN f;  1SRM A;  3A8H B;  1T3L A;  3JB9 J;  4EMG A;  3PNW C;  4Z88 A;  2DFU A;  2PNI A;  3ZEH A;  1RI0 A;  1EX4 A;  3FC3 A;  2ZPI B;  4C0F A;  1IHW A;  4Z89 A;  2E5Q A;  3G6E Q;  3QII A;  2O2O A;  4IIM A;  4RKU E;  4O6J A;  1I8F A;  1LCK A;  1M30 A;  2KE9 A;  2HBP A;  1VYV A;  2KRM A;  2RM4 A;  1YJW T;  1AEY A;  1M4Z A;  2K7A A;  2RQR A;  2EYW A;  1VQP T;  4E47 A;  3V7S A;  3PGG A;  1UG1 A;  3CQT A;  1RI9 A;  4N4I A;  2JW4 A;  3CXC P;  5CQX A;  2CUD A;  1K9M C;  7AT1 B;  3N5B B;  2DLP A;  5KH6 A;  3LH0 A;  4OP0 A;  4PFP A;  2JUF A;  3JCM d;  4HKE A;  3CC2 A;  3A8O B;  4BI4 A;  1VQ9 T;  3RER A;  2DD4 A;  4E7Z A;  3CMA A;  2FB7 A;  1G3S A;  3CC7 Q;  3EGU A;  4YTL A;  1BI0 A;  3HKS A;  1PHT A;  4A4K A;  2MYS A;  3H0I A;  2FZK B;  2AKK A;  4LUE A;  1EZZ B;  1K9M U;  4O5V A;  1KC8 U;  5HCK A;  4B9X A;  3ZL7 C;  4HCK A;  3E9G A;  3X20 B;  2XDB A;  4JJC A;  4PK4 A;  2I0N A;  2EQM A;  3GIB A;  2QAS A;  3VV0 A;  1YIT T;  2DZ9 A;  3M56 A;  3E2U A;  2DXC A;  3QG1 A;  2LQN A;  2BKD N;  3HPW A;  1E6H A;  1M9S A;  2KYB A;  1VQ6 A;  1YP5 A;  3C0C A;  2C0T A;  4ZNX A;  3JB9 H;  2B8A A;  2VAS A;  4LDY A;  4D8K A;  1AWO A;  2ECZ A;  2ZCF B;  2EW3 A;  1X27 A;  3PFS A;  2YT6 A;  4L5G A;  2NYS A;  4X9C A;  1I4K 1;  4JRQ A;  4JJN K;  2ROL A;  4RG8 A;  2DVJ A;  3SFM A;  3A8M B;  4E7I A;  3OYF A;  4F04 B;  2F69 A;  1SHG A;  2X9H A;  3OW2 P;  2IG0 A;  2LZ6 B;  5GAO r;  1W70 A;  1U8R A;  3QJ6 A;  3TCJ A;  2EFI A;  1IXD A;  2CRE A;  3EG9 B;  1VQ4 A;  2HD0 A;  5C0M A;  1QQJ A;  2ZPH B;  5IHK A;  2OTJ Q;  3VS2 A;  3MO8 A;  2HMA A;  3BW1 A;  4BI3 A;  1VQ4 Q;  1N9S A;  2NUT A;  3R6O A;  3LGL A;  4QT7 A;  1KQS A;  2J7I A;  3M58 A;  2CKK A;  5KYU B;  4DQ2 A;  1JXO A;  2IPO B;  4NS5 A;  4CC3 A;  3CC4 A;  3RIR A;  3L2Q A;  1W2B A;  2KT8 A;  4BE1 A;  2EPD A;  3RDV A;  2HCK A;  1PNJ A;  3DKM A;  1R0C B;  1VQN Q;  1PD1 A;  3I56 A;  2DIG A;  1RUW A;  3FJ5 A;  3FDR A;  4J9E A;  2EJF A;  1VQN A;  2HKQ B;  1PRM C;  3QZ5 B;  1JO8 A;  2HNI A;  4J83 A;  1D3B B;  1K8A U;  3PIO A;  2MWO A;  4EDU A;  1I0C A;  4HVV A;  4M77 F;  2XMF A;  4AMC A;  2HL5 C;  3I55 Q;  1K73 C;  1WYX A;  1TH7 A;  2QXF A;  5AT1 B;  2FRY A;  3C94 A;  3REB B;  2DL4 A;  3OSS C;  2Y4X A;  1ZSG A;  2AHJ B;  2QQA A;  1BCO A;  1UUE A;  1NYF A;  5KYU A;  1RAG B;  2CDT A;  1VQO T;  4OF1 A;  4M7A B;  2QTX A;  4PL6 A;  5HK3 A;  1QVG S;  2DET A;  4MDW A;  2BUD A;  3RES A;  1K0S A;  5D7U A;  2BIV A;  2J6F A;  3L2R A;  2V1R A;  2FZC B;  1QCF A;  4OMN A;  5GAO n;  3ASK A;  2YUN A;  1WA7 A;  4FSX A;  3CC4 T;  2VB6 A;  2JMA A;  5FW9 A;  2HQH A;  3VS5 A;  4M7A G;  3THK A;  4M75 G;  2YSQ A;  3EG2 A;  3AT1 B;  4A4G A;  4LDX A;  2RF0 A;  2QA4 A;  2RHI A;  1YN8 A;  4EMH A;  3UWN A;  1KD1 R;  4GBQ A;  4FT4 A;  1NZ9 A;  2LQW A;  4VUB A;  3S3N A;  3CCE Q;  5CAI A;  5GAN 7;  1OV3 A;  1KC8 R;  1A0N B;  3JB9 G;  1HD3 A;  1VQ4 T;  2C06 A;  4OB1 B;  4QQD A;  1QCN A;  2BE9 B;  5ECA A;  4II1 A;  3OBW A;  4AFQ C;  5KCO A;  3CC7 T;  2L5Q A;  2NUT B;  4C8Q B;  1M3B A;  1WFW A;  2CUB A;  2E3H A;  2CZ0 B;  4KGZ B;  4C92 C;  3C4S A;  4E2F B;  4M75 E;  4M7A E;  4XTV A;  4V2S A;  3V8L A;  1S72 Q;  4WTO B;  4PJO D;  1GCQ A;  3EGX B;  4J9I A;  2IIM A;  2DJQ A;  2A36 A;  2AT1 B;  3NTI A;  1QMC A;  1K4U S;  2V8K A;  3CBP A;  3V7C A;  1M2V A;  3QWX X;  2JJ9 A;  2RB6 A;  2LCS A;  1MUZ A;  1ZBJ A;  4KGV B;  1U1T A;  3PE0 A;  2J05 A;  1QCO A;  1VQ9 Q;  1R0B G;  2DX1 A;  2I2L A;  4DBH A;  1KQ1 A;  1AOJ A;  3MHX A;  4PJJ A;  2PVG B;  1VQ9 A;  2RHY A;  1K1Z A;  3PMI A;  3CC4 Q;  4Z8A A;  2RJE A;  1UEC A;  2RA2 A;  2CS7 A;  2A37 A;  1RAA B;  1YJN Q;  3OA6 A;  3C12 A;  1QVF A;  1NYG A;  4M7D A;  1I5L A;  1BI1 A;  1TUG B;  2RMO A;  4IIO A;  2DAQ A;  4M77 A;  2W10 A;  3BDL A;  3R6N A;  3CC2 T;  1VQ8 A;  2D8J A;  2EQI A;  4C8Q E;  4RTT A;  4AG1 C;  4EPC A;  2LJ3 A;  4HCC A;  4LDW A;  4C0Z A;  2BE7 D;  3V8K A;  5LJ5 g;  1MMD A;  2RHX A;  3CC7 A;  2D0N A;  1K8A C;  4XU1 A;  3JB9 F;  1N6A A;  4J6Y A;  2DEQ A;  1VOM A;  4IUV A;  5HY6 A;  4M78 C;  2DYI A;  3HSB A;  1GFD A;  3ER0 A;  1XJW B;  2DA9 A;  2QQS A;  3VU3 C;  2DVE A;  1WPY A;  2COZ A;  1S72 T;  2KK4 A;  2E6N A;  2DF6 A;  1HSQ A;  1WZO A;  5LL6 S;  4XTX A;  1QWE A;  3CCQ A;  4RUG A;  2CZ6 B;  1TUD A;  2KXD A;  1SKU B;  4MDX A;  4PJO C;  1JJ2 A;  5LJ3 e;  4D8D A;  1Q81 C;  3MCA B;  3GP8 A;  3TVT A;  4HVW A;  3HRU A;  1I81 A;  2O31 A;  4BY6 C;  2WSC E;  5DLQ E;  3CCR A;  1QKX A;  5GAO p;  5D6X A;  3MEV A;  1CSK A;  3G4S A;  3A5Z B;  1EFN A;  4A63 B;  1TSF A;  1BCM A;  2FHD A;  2VVK A;  2D0Q B;  1ZUU A;  1PKS A;  3JCM J;  2ZPE B;  2MK5 A;  2EJG A;  2LMJ A;  1U3O A;  1B07 A;  4ATO A;  3MET A;  4J5Y A;  3V7R A;  3OW2 A;  2EGC A;  5GAN 8;  1ZUK A;  3QKJ A;  1D09 B;  1X2Q A;  1MGQ A;  1YCY A;  2E65 A;  2DL7 A;  4UC4 A;  3OSV A;  1VQN T;  3MEU A;  1G3W A;  4EIK A;  2A3L A;  3HRT A;  1GBR A;  3I5S A;  1UJ0 A;  4M75 A;  4M7A A;  3CME A;  4C5G A;  2YUQ A;  3NPF A;  3CCL T;  1AZE A;  1SSF A;  1K9A A;  2ROT A;  3D7S B;  4M78 D;  2O9V A;  4PJO F;  3TSZ A;  2X4J A;  1M5Q 1;  4PFO A;  5IXB A;  1FX7 A;  4HVU A;  2NUP B;  3I56 T;  4M78 E;  2M02 A;  2YUO A;  2GQV A;  2MOX A;  5KYN A;  2JMC A;  2KMT A;  2EWN A;  2JTM A;  1QW1 A;  2Z0W A;  4ZGE B;  3PT9 A;  2KRS A;  3P8B B;  4M77 C;  2KXC A;  1NJI C;  4R55 A;  2CH4 A;  5IAY A;  1M27 C;  2JZ2 A;  4B6M A;  5A0D A;  3OYD A;  3UAT A;  1U06 A;  4C0D C;  3NHN A;  1UGQ B;  3CCM A;  3CCE T;  1VQ7 A;  3CEY A;  1GRI A;  2GTJ A;  3M5A A;  4M75 C;  1YJ9 Q;  1OX9 A;  3QXE B;  2RH2 A;  2DYB A;  4N0A C;  3CCM T;  4M75 F;  3S6W A;  4X34 A;  4J7I A;  5GAM e;  1K73 R;  4F7U B;  2V8J A;  4XU3 A;  1PM3 A;  5GAN d;  4NL3 A;  1TS9 A;  3I35 A;  1V29 B;  4M7D B;  1M1F A;  3BDU A;  4OGE A;  4RTV A;  3QZ9 B;  3ZBD A;  2COW A;  4J9H A;  3CCS T;  3QJY A;  3WVE B;  3LW5 E;  3PTA A;  1X69 A;  3G6E T;  1N8R C;  2QEX A;  3CBO A;  2KRO A;  3GNG A;  4JDS A;  1ZBX A;  4R56 A;  1KD1 C;  2D1X A;  4Z02 A;  5CK9 A;  4OVA A;  2L3Q A;  1OQK A;  3MEW A;  1PSF A;  1Y07 A;  2K5L A;  1NPP A;  2E3I A;  1X6G A;  3VS7 A;  4BY6 B;  3JCM P;  3CXC A;  2EIF A;  2WSE E;  3L2V A;  2QQB A;  3CC2 Q;  1AHJ B;  4B9W A;  4J7F A;  4JJB A;  1PWT A;  3H0H A;  2H8H A;  1UHC A;  3OYA A;  5GAN 2;  2LJ1 A;  2DXB A;  3VJP A;  1JB0 E;  2EBP A;  2D9T A;  4JLG A;  2QG9 B;  4M77 D;  1Q7Y C;  2DBK A;  2NLU A;  3G4S Q;  3UA6 A;  3MJX A;  3RKW A;  3SD4 A;  3TU4 K;  1G3T A;  4KRT A;  5I2S A;  3HL8 A;  2K5I A;  3SWN A;  2EVR A;  2OAU A;  3SWN C;  2E12 A;  4HA8 A;  4F14 A;  1H3Z A;  2JM8 A;  2GBQ A;  2JTF A;  3NTH A;  3OYC A;  3EG0 A;  2EAY A;  2CSQ A;  1NPR A;  3MKD A;  1B7T A;  2CP6 A;  4MMK A;  2JXB A;  1QVP A;  2CGH A;  1IB8 A;  4XU2 A;  2A0F B;  4A53 A;  1QVF P;  3OS0 A;  2X35 A;  4HT9 A;  1OPK A;  6AT1 B;  4C92 F;  4BUG A;  2J6K A;  2NWM A;  4OMM A;  3M0U A;  1ZA2 B;  5GAO q;  4HT8 A;  5GAM f;  2QDY B;  2L3P A;  1VQL T;  5FRO A;  2RHZ A;  3WVD B;  2PUK B;  3LGF A;  1B34 A;  4IUT A;  3SB2 A;  2DPP B;  1U5S A;  2JM9 A;  5GAM g;  2OAW A;  4F7U E;  3X28 B;  2DE0 X;  4BE0 A;  4CC7 A;  4OMQ A;  1PG5 B;  1BU1 A;  5KYW B;  2FYK A;  5I22 A;  2CZ1 B;  4C0D B;  4PNO A;  3SDZ A;  2CP5 A;  1VQ5 A;  2LNH B;  1Q82 C;  4AFZ C;  4HCZ A;  4JUV A;  5GMK m;  4J9B A;  1ABO A;  1N8R U;  3IQL A;  2DXT A;  2M1H A;  2A7Y A;  2HEQ A;  1RAD B;  5GMK e;  1ZUY A;  4LDU A;  1WQW A;  1VQO A;  3F70 A;  2F1L A;  1G3Y A;  1V76 A;  3OB9 A;  2XID A;  2OTL Q;  3HTR A;  2EJ9 A;  4ZTF A;  1Q7Y U;  3OYK A;  1H92 A;  2QDL A;  1Q81 R;  1WLP B;  2FZG B;  1LVK A;  2DNU A;  2LDM A;  3H9N A;  4OB0 B;  4RTW A;  4RMO A;  2X4W A;  1KJW A;  2K2V A;  3FB9 A;  1IO6 A;  2JS0 A;  4NOY A;  1WHK A;  1PC0 A;  4C0G A;  3G71 Q;  2P0K A;  1MMA A;  1W4S A;  1OYX A;  1WXB A;  1IRE B;  3OYG A;  1RLQ C;  2AZV A;  4XTY A;  2P4T A;  1Z9Z A;  2M9U A;  3SHW A;  1KQS S;  4J6X A;  3OMG A;  4QQ6 A;  4DEY A;  3HRS A;  1MMG A;  2O4X B;  1D3B A;  4DBQ A;  2QA4 Q;  1KQ2 A;  1YIT Q;  1NEB A;  1QP3 A;  1W2B S;  2AIR B;  2EYY A;  1ACM B;  4ORZ A;  2L3S A;  2K57 A;  4OML A;  4QVZ A;  5GAN 4;  2QQR A;  5L23 A;  2C0I A;  3CME Q;  3JCM Q;  3M4Y A;  5CKF A;  4M78 G;  2QGG A;  4M7A C;  1GL5 A;  4J9C A;  3NTK A;  5LJ5 e;  3M0T A;  3RMS A;  4FU6 A;  1G5V A;  1PRL C;  1WDX A;  3CD6 T;  5A0G A;  4JS5 A;  5KYY B;  2KGT A;  3NMZ C;  2XKO C;  5KYX A;  2JOY A;  2YLC A;  2EKH A;  1YHQ A;  1WHH A;  1LPL A;  4EMK B;  5I2M A;  2E10 A;  2V8I A;  1T0H A;  2LCL A;  2E5K A;  4JRP A;  2KQW A;  1YI2 A;  4A4H A;  1Y57 A;  3CCE A;  3VS0 A;  3G71 T;  1AWJ A;  4PLL A;  1ZLM A;  1NJI R;  3H6Z A;  1K76 A;  2RJC A;  3JCM g;  3KBG A;  3C95 A;  4E7L A;  2RD1 A;  4C5I A;  1X01 A;  2YXY A;  2MF2 A;  3RR6 A;  3CCJ A;  5FRM A;  1TOV A;  1X2K A;  4C92 A;  4LDV A;  4AFU C;  4CRI A;  1E6G A;  4OGC A;  1XTD A;  2QI2 A;  4DEX A;  3S3O A;  1UE9 A;  1ZSZ B;  2KNB B;  2DL8 A;  3CCV Q;  1VQM A;  2M0O A;  2GF7 A;  3EG3 A;  2FG0 A;  1WGS A;  2YLB A;  4E7J A;  4C92 B;  1K73 U;  1ZX6 A;  3OS5 A;  1VA7 A;  4FM4 B;  4L59 A;  3TEE A;  3QDR B;  1WXU A;  1VYT A;  2NUZ A;  5FRN A;  1Q82 R;  2RO0 A;  1X6B A;  3M0R A;  2KDS A;  1JEG A;  5D6W A;  3G7Z A;  2QEX Q;  2LX9 A;  4M78 A;  2RQU A;  1OU9 A;  2LP5 A;  3FLG A;  2BZ8 A; 
#chains in the Genus database with same CATH homology
 1QWF A;  2K7A A;  4LNP A;  2EGC A;  2RQR A;  2EYW A;  5IHN A;  2FPF A;  1ZUK A;  1X2Q A;  5FWB A;  1UG1 A;  1XOV A;  3CQT A;  2DL7 A;  1RI9 A;  2JW4 A;  3EHQ A;  2CUD A;  4EIK A;  2ED0 A;  1GBR A;  3I5S A;  1UJ0 A;  2DRM A;  2A08 A;  2DLP A;  3UA7 A;  2YUQ A;  3NPF A;  2KBT A;  1AZE A;  2A28 A;  1TUC A;  1M3A A;  1K9A A;  2ROT A;  2M0Y A;  2BZY A;  3RBB B;  2O9V A;  3TSZ A;  2MIO A;  1KFZ A;  4RTY A;  3EGU A;  2SEM A;  2DM1 A;  3REA B;  2O9S A;  5IXB A;  1PHT A;  1WI7 A;  4HVU A;  3H0I A;  2AKK A;  4LUE A;  1ABQ A;  2MCN A;  2RPN A;  2YUO A;  4ESR A;  1CKA A;  5HCK A;  1M3C A;  2MOX A;  3ZL7 C;  2JMC A;  4HCK A;  3I5R A;  2D8H A;  4J9D A;  2KRS A;  2L0A A;  4JPB W;  4JJC A;  1YWO A;  2ENM A;  3H41 A;  2KXC A;  2I0N A;  2CH4 A;  1M27 C;  4LE9 A;  2LQN A;  3UAT A;  5IXF A;  3VS6 A;  1U06 A;  2W0Z A;  3NHN A;  1E6H A;  2KYB A;  4GLM A;  1GBQ A;  2DMO A;  1YP5 A;  3C0C A;  2C0T A;  1GRI A;  2GTJ A;  3QWY A;  4ZNX A;  2CT4 A;  2DYB A;  1CKB A;  4D8K A;  1AWO A;  2ECZ A;  2YDL A;  4JZ3 A;  2EW3 A;  1X27 A;  5FWC A;  3TSW A;  2YT6 A;  1T0J A;  1FMK A;  1AWX A;  2J6O A;  2KYM A;  1WIE A;  2EGA A;  2C0O A;  2ROL A;  2DVJ A;  2ED1 A;  3VS4 A;  4M4Z A;  1SHG A;  2RQV A;  2K6D A;  2RNA A;  3I35 A;  4WCI A;  2LZ6 B;  2K2M A;  2PZ1 A;  4J9F A;  1W70 A;  1KSW A;  4RTV A;  4J9H A;  3EG1 A;  2CRE A;  1X69 A;  1UJY A;  2V1Q A;  4CC4 B;  5IHK A;  1NM7 A;  1W6X A;  3VS2 A;  1ARK A;  2KRO A;  3H0F A;  2JS2 A;  2K9G A;  2D1X A;  4HXJ A;  4QT7 A;  2J7I A;  2M51 A;  2DL5 A;  1AWW A;  2L3Q A;  3NGP A;  4LUD A;  4FSS A;  1VYU A;  1JXO A;  2RQT A;  4CC3 A;  4AFS C;  3JV3 A;  1X6G A;  1UHF A;  3VS7 A;  2KT8 A;  1Z9Q A;  1J3T A;  2JTE A;  2EPD A;  2K79 A;  1GFC A;  4RTX A;  2HCK A;  2RQW A;  2ABL A;  4JZ4 A;  1SPK A;  1PNJ A;  1UGV A;  4JJB A;  1PWT A;  3H0H A;  2H8H A;  3VRZ A;  1UHC A;  3VS1 A;  1RUW A;  2LJ1 A;  4JJD A;  3FJ5 A;  2EBP A;  4J9E A;  1H3H A;  2DBK A;  5IHI A;  2EYX A;  2L2P A;  1PRM C;  3UA6 A;  1GCQ C;  2CH4 W;  3U23 A;  1JO8 A;  1B3Q A;  2JT4 A;  4KRT A;  1I0C A;  1WXT A;  4HVV A;  2XMF A;  2EVR A;  3PVL A;  4F14 A;  2JM8 A;  2GBQ A;  1WYX A;  2PTK A;  3EG0 A;  4F17 A;  2CSQ A;  2FRY A;  3REB B;  1UTI A;  1QKW A;  2EYZ A;  2DL4 A;  1SSH A;  2JXB A;  2P4R A;  1ZSG A;  2X3W D;  2HSP A;  1E7O A;  3RNJ A;  4OMP A;  1BB9 A;  2X3X D;  1UUE A;  1NYF A;  3VRY A;  1OPK A;  2CDT A;  4E6R A;  1N5Z A;  2J6K A;  2NWM A;  1UDL A;  3M0P A;  3A98 A;  4OMM A;  2J06 A;  3M0U A;  2OJ2 A;  1G2B A;  3SEM A;  1AZG B;  1K0S A;  2KEA A;  2L3P A;  2J6F A;  1JXM A;  1FYN A;  2V1R A;  1QCF A;  4OMN A;  1YNZ A;  1I07 A;  1YCS B;  4LN2 A;  2YUN A;  1U5S A;  2JM9 A;  1WA7 A;  2OAW A;  2DE0 X;  2JMA A;  5FW9 A;  1NLO C;  4OMQ A;  3VS5 A;  4CC7 A;  2O88 A;  3THK A;  1BU1 A;  2YSQ A;  3EG2 A;  5I22 A;  3KFV A;  2RF0 A;  3I9Q A;  2KR3 A;  2LNH B;  1YN8 A;  3O5Z A;  4AFZ C;  4GBQ A;  1OPL A;  1ABO A;  4J9B A;  2LQW A;  3IQL A;  5IH2 A;  2HEQ A;  1ZUY A;  2G6F X;  1OV3 A;  1MV0 B;  1A0N B;  1HD3 A;  1K0X A;  2CSI A;  1NLP C;  1M8M A;  2VKN A;  1H92 A;  5ECA A;  1OEB A;  2QDL A;  2B86 A;  4AFQ C;  2K3B A;  1WLP B;  2DNU A;  1AD5 A;  1YWP A;  2FRW A;  1GCP A;  1M3B A;  3PVQ A;  2HBW A;  1WFW A;  2AKL A;  5GJW B;  1KIK A;  4RTW A;  2CUB A;  4J9G A;  2KRN A;  1KJW A;  1IO6 A;  2JS0 A;  1GCQ A;  1G83 A;  4J9I A;  1V1C A;  2DBM A;  2DJQ A;  2IIM A;  1SEM A;  2A36 A;  2EGE A;  1K4U S;  2SRC A;  2DL3 A;  3EHR A;  4K11 A;  1UFF A;  1WXB A;  3QWX X;  1RLQ C;  1MUZ A;  1ZBJ A;  2LCS A;  2GGR A;  2AZV A;  3PE0 A;  2J05 A;  4CC2 A;  1Z9Z A;  5EC7 A;  2BTT A;  3SHW A;  1W1F A;  2DX1 A;  2AZS A;  1HJD A;  2LJ0 A;  4DEY A;  1AOJ A;  2FPE A;  1K1Z A;  1T3S A;  5GJV B;  2DRK A;  4RTU A;  4Z8A A;  1NEB A;  2EYY A;  1UEC A;  4ORZ A;  2A37 A;  2L3S A;  3LH5 A;  4OML A;  1NYG A;  2ESW A;  5L23 A;  2C0I A;  2DIL A;  1BK2 A;  1SHF A;  2RMO A;  1GL5 A;  4IIO A;  2FEI A;  1OOT A;  4J9C A;  2W10 A;  2BZX A;  3R6N A;  3M0T A;  3M0S A;  2D8J A;  2EQI A;  1I1J A;  1PRL C;  1AVZ C;  1WDX A;  4RTT A;  4AG1 C;  1Y0M A;  2LJ3 A;  4Y92 A;  1JU5 C;  2F2V A;  2KGT A;  3NMZ C;  1X43 A;  3ULR B;  4AG2 C;  2EKH A;  2D0N A;  4OMO A;  2AK5 A;  2HDA A;  2F2W A;  3VS3 A;  1WX6 A;  1NEG A;  1T0H A;  4R0K A;  1RLP C;  2E5K A;  2FO0 A;  1GFD A;  2GTO A;  1Y57 A;  3VS0 A;  1AWJ A;  1ZLM A;  5I11 A;  2DA9 A;  1BBZ A;  1K76 A;  2RN8 A;  2VWF A;  1QLY A;  1NG2 A;  2GNC A;  1JQQ A;  2DF6 A;  2CT3 A;  1HSQ A;  3GBQ A;  2FPD A;  1QWE A;  2YUP A;  1SRL A;  1X2K A;  2F2X A;  4RUG A;  4RTZ A;  1TUD A;  4AFU C;  1S1N A;  1E6G A;  2KXD A;  1MV3 A;  4DEX A;  2KT1 A;  4D8D A;  2OI3 A;  1PKT A;  1UE9 A;  3TVT A;  2KNB B;  4HVW A;  2DL8 A;  4F16 A;  2O31 A;  3EG3 A;  2FG0 A;  2GQI A;  1QKX A;  3M0Q A;  1SRM A;  1T3L A;  2LX7 A;  1CSK A;  4X1V A;  1ZX6 A;  4Z88 A;  1VA7 A;  1EFN A;  2PNI A;  4A63 B;  1WXU A;  1VYT A;  2NUZ A;  2VVK A;  1H8K A;  1ZUU A;  1X6B A;  3M0R A;  4Z89 A;  1JEG A;  1PKS A;  2O2O A;  4IIM A;  3UF4 A;  2LMJ A;  1U3O A;  1B07 A;  1LCK A;  2RQU A;  1M30 A;  2LP5 A;  2KE9 A;  1TG0 A;  1VYV A;  2KRM A;  2BZ8 A;  1AEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...