2YUQA

Solution structure of the sh3 domain of human tyrosine-protein kinase itk/tsk
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
85
structure length
85
Chain Sequence
GSSGSSGEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Solution structure of the SH3 domain of human Tyrosine-protein kinase ITK/TSK
rcsb
source organism Homo sapiens
total genus 7
structure length 85
sequence length 85
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yuqA01
1AZGB 2DE0X 2X3WD 2DL4A 2DM1A 2F2VA 2HDAA 1ZUUA 2YT6A 2CH4W 3VS2A 4LUDA 1H8KA 2EPDA 2L0AA 1UDLA 2AKLA 1AD5A 1B3QA 2B86A 2DBKA 1TG0A 4J9IA 2D8HA 2LNHB 2DILA 2YDLA 5FW9A 2GNCA 4HVUA 2O31A 3H0IA 3THKA 1QWFA 1ZUYA 2L3SA 1H3HA 2LJ3A 2O88A 3VS3A 4J9BA 2KNBB 2PTKA 1T0JA 2EYZA 1W70A 2ROLA 2DF6A 4FSSA 4F14A 2K7AA 4RTZA 1OPLA 2F2XA 2MIOA 3TVTA 3SEMA 2K3BA 1NYGA 3M0QA 3EG3A 4J9EA 2ED0A 1CKBA 4AG2C 1JXMA 3GBQA 1GFCA 4QT7A 1VYTA 2GBQA 1GBRA 2EYXA 3REAB 1U3OA 2P4RA 3VS7A 2LQWA 4CC2A 2KRNA 3EG1A 2W10A 2CUDA 3NGPA 3VS6A 1ARKA 4ESRA 1TUDA 2YUOA 2K6DA 3I35A 2OJ2A 4J9DA 1RI9A 2CDTA 2J6FA 1K76A 1X27A 2H8HA 3EHRA 2JTEA 1JXOA 2KYMA 2RQTA 1ZSGA 1AWOA 2DBMA 2KYBA 2FRWA 1M3AA 1M3CA 5HCKA 1NM7A 1RLPC 5IHIA 1TUCA 2KGTA 2V1RA 4IIOA 1WI7A 2JXBA 4Z89A 2EVRA 2RMOA 1K0XA 2JM9A 4E6RA 3M0UA 4Z8AA 4HVWA 3M0PA 3ZL7C 2EYWA 2I0NA 5I22A 1T3SA 3UA6A 3QWXX 2DL8A 5FWCA 2KEAA 3PE0A 3I5RA 2M0YA 4GLMA 1FMKA 2GQIA 2M51A 2KE9A 2EYYA 1NEGA 1PRMC 4J9HA 5GJWB 1WLPB 2V1QA 2HSPA 2L2PA 1X2QA 1H92A 1E7OA 1WXUA 3TSZA 4JPBW 2DVJA 2O9SA 3NPFA 1WX6A 3C0CA 1ZLMA 2RPNA 2BZXA 1K1ZA 1U5SA 2ABLA 3I5SA 2IIMA 2JM8A 2RQRA 2EGCA 2LCSA 2C0TA 1SRLA 3PVLA 4OMNA 4HXJA 2YUNA 2FPEA 5FWBA 4AFSC 1NLPC 4OMLA 4J9CA 2O9VA 2HBWA 1KIKA 2K9GA 3SHWA 1M3BA 1CKAA 1NLOC 1I0CA 1G83A 1E6HA 1GCQA 2A08A 2L3PA 4GBQA 2J6OA 3NHNA 2XMFA 4KRTA 2F2WA 1WA7A 2SRCA 3UA7A 1JQQA 3RBBB 3TSWA 2JT4A 2O2OA 1JEGA 2KXDA 1M8MA 1B07A 2RQUA 1GCQC 2FPFA 2J6KA 1OOTA 4JZ4A 1SRMA 1WYXA 4RTWA 2GTOA 5ECAA 2G6FX 1CSKA 2EGEA 2DJQA 2ECZA 1OPKA 2ESWA 1PRLC 3UATA 2ED1A 4OMPA 4LN2A 2DLPA 2DRMA 2J7IA 4JJDA 1UTIA 4RTUA 3VS0A 1ABQA 2KT1A 2FPDA 3FJ5A 2C0OA 1VYVA 2CT4A 2VWFA 1X6GA 1SSHA 4M4ZA 4AG1C 5IXBA 2L3QA 3EG0A 2CH4A 2KT8A 1QKWA 4RTTA 5IHNA 2LZ6B 1KSWA 1SPKA 1PWTA 2EW3A 4R0KA 1UECA 1HD3A 2LJ1A 3UF4A 3VS4A 1I07A 1K9AA 1G2BA 1WXBA 1PKTA 1W6XA 1S1NA 4ORZA 1QCFA 2SEMA 2CUBA 3EG2A 1E6GA 2EQIA 2MCNA 2RNAA 3M0SA 5GJVB 1BBZA 1KJWA 2VKNA 3VRZA 4AFZC 1AVZC 4WCIA 1AZEA 3LH5A 2RQVA 2JMAA 1YP5A 4HCKA 2CT3A 1UE9A 3PVQA 3M0RA 4HVVA 5IXFA 2CSQA 2K2MA 3U23A 4AFQC 1ZX6A 2AZSA 1LCKA 1AWWA 3ULRB 2JMCA 1BU1A 1M27C 2LX7A 4EIKA 3CQTA 4RTVA 1X69A 2D1XA 4DEYA 2C0IA 1NG2A 3I9QA 4Z88A 1GL5A 1N5ZA 2JW4A 1GBQA 1U06A 1WXTA 3M0TA 1YNZA 2RN8A 4OMMA 2K79A 5IHKA 4J9GA 2A36A 1X43A 3QWYA 4RTYA 1OEBA 2YUQA 1Z9QA 1UHCA 1X2KA 4D8DA 1GCPA 2OI3A 2PZ1A 1ZBJA 2DA9A 5EC7A 4A63B 2NUZA 1AEYA 2KR3A 2DX1A 4Y92A 3REBB 3H41A 1K4US 2QDLA 2GTJA 1VA7A 1J3TA 3RNJA 3EGUA 1YN8A 1KFZA 2DL3A 2KRSA 4CC3A 1RLQC 1Y0MA 2X3XD 1QKXA 2EBPA 2YSQA 1NYFA 2AK5A 3KFVA 1W1FA 1UHFA 2GGRA 2LMJA 2KROA 4IIMA 2BZYA 1AWJA 4AFUC 3VS1A 4ZNXA 4F17A 4RUGA 1HJDA 4LE9A 2DNUA 2AKKA 1OV3A 1UG1A 2D8JA 2EKHA 4JZ3A 1WIEA 3R6NA 1QLYA 1UUEA 2VVKA 1YCSB 5IH2A 2D0NA 2RQWA 4D8KA 1RUWA 2KRMA 4OMQA 1T0HA 2KBTA 2LP5A 2CSIA 2FRYA 2DL7A 2PNIA 1M30A 1Z9ZA 1SHGA 1UJ0A 1GFDA 1WFWA 2HEQA 1HSQA 2OAWA 4JJCA 2E5KA 2LQNA 4CC4B 1BB9A 1JU5C 1MV3A 1UJYA 3IQLA 1UFFA 2BTTA 2J06A 4X1VA 1XOVA 1VYUA 3VRYA 2YUPA 4F16A 2RF0A 2JS2A 1I1JA 2NWMA 3NMZC 1X6BA 4DEXA 1A0NB 2A37A 1YWPA 1SEMA 1K0SA 1QWEA 1YWOA 1ABOA 1PHTA 2DYBA 1PKSA 4OMOA 3H0FA 2A28A 1PNJA 3JV3A 1T3LA 2CREA 1IO6A 3EHQA 2W0ZA 1AWXA 3H0HA 4JJBA 5L23A 3O5ZA 5I11A 4RTXA 2LJ0A 1UGVA 1SHFA 1ZUKA 1FYNA 2DMOA 2FEIA 4K11A 4LUEA 1JO8A 1WDXA 2BZ8A 2FO0A 1EFNA 2ROTA 2DRKA 4J9FA 1V1CA 1GRIA 1BK2A 3A98A 1NEBA 2J05A 3VS5A 2JS0A 4LNPA 2FG0A 2DL5A 1MUZA 2EGAA 1Y57A 4CC7A 1MV0B 2MOXA 2AZVA 1AOJA 2HCKA 2ENMA 2KXCA
chains in the Genus database with same CATH superfamily
2CZ0B 3CCVQ 2X3WD 3I56A 2DM1A 5GAOl 2F2VA 2HDAA 2F1LA 4DQ2A 4A4KA 2PVOB 3VS2A 3PIOA 4E7KA 1YI2Q 4NL3A 5KYXB 1KD1C 2D8HA 5FW9A 2YDLA 2OTLA 2GNCA 1GXIE 4LDXA 1Y7XA 2KI7A 4J6XA 2DO3A 2Y90A 1XNIA 5KE3A 3VKIA 3CCUT 2O88A 2PUOB 5KYXA 1K8AR 4F04B 3MP6A 1T0JA 3EGDA 3TEEA 3CCRA 2ROLA 2DF6A 4E7HA 4NOYA 3TCJA 4FM4B 2VUBA 4F14A 1YCYA 4XU0A 1RACB 7AT1B 2L89A 3A5ZB 3OYEA 2OAUA 2HQXA 3SEMA 2K3BA 2QQ9A 3HFNA 4J9EA 2EQMA 3N5BB 1XJWB 2LT1A 4AG2C 4B9XA 4QT7A 5FRNA 1VYTA 3REAB 3UT1A 4M7DF 1VQ5Q 4PJJA 2CUDA 3NGPA 3JB9G 3OS5A 2K6DA 2NYSA 1NJIR 4MDWA 4J9DA 2QTVA 2H8HA 1JXOA 2A7YA 4HCBA 1AWOA 1M3AA 5HCKA 1RLPC 1M90C 3VV0A 5FLXE 2KGTA 2RA2A 4M75B 1WI7A 3CD6Q 3RDVA 1QP3A 3M5AA 2JM9A 2OX7A 4BI8B 4E6RA 3M0UA 4JS4A 3JCMP 1MNDA 2EYWA 2YWWA 3SWNC 1D1BA 4M75A 1FMVA 4OP0A 2AIRB 3UA6A 2P0KA 2DL8A 3CC4T 3HKSA 3PE0A 4A54A 3I5RA 2M0YA 3PIPA 3G4SQ 2CP5A 3M53A 4IURA 3CC4A 5A0LA 2KE9A 2P84A 5A2QE 1MMDA 1PRMC 1WLPB 2V1QA 4OGEA 1QCNA 2JOYA 1X2QA 2DXBA 3BE3A 4J7IA 2DVJA 2PVGB 1YFNA 4XTYA 3ZEHA 2AT1B 2F5KA 3CCQQ 4C0ZA 5GMKi 2ABLA 4M7DD 4ME7A 1K9MC 2YRVA 2IIMA 1Q81U 2HAXA 1YBYA 2GF7A 2C0TA 2X4JA 4EPCA 5CKHA 1VQLA 1IXDA 4PJOD 1SRLA 2LX9A 1P92A 3LWHA 2YUNA 2FPEA 2M0OA 4IKFA 2QYZA 3L1AA 4C0DC 2O9VA 3KXTA 2VB6A 4B6MA 4M77B 2X4YA 3SHWA 1CKAA 1I0CA 3CC2T 2RI5A 1WZOA 2A08A 2LRQA 4KRTA 4DBHA 3FB9A 3OS0A 1D1CA 1YJ9T 4ELZC 1KQSS 4M78B 4N4HA 1VOMA 4JS5A 4F7UE 2QA4Q 1YJ9A 4P5NA 4QVZA 1WYXA 3PNWC 2GTOA 4ZGEB 4M78A 3OYCA 2EAYA 3A8HB 2CP2A 2EGEA 2ESWA 2LNVA 4OMPA 2DEQA 1X75C 1YJWT 4RKUE 4MMKA 1UTIA 4CRIA 2DYIA 2K4YA 2FPDA 3FJ5A 2X35A 4BI4A 1VYVA 3P8HA 1SSHA 1RAAB 3TU4K 1H3ZA 5IXBA 3C4SA 3OMGA 4J6YA 3VJPA 4RTTA 5IHNA 4M7DC 3CXCS 3L2ZA 5D6YA 1KSWA 1PWTA 3HHTB 2EW3A 1QVGP 2MK5A 4XAXB 1YHQT 4PJOC 4GLKA 3UF4A 4C8QD 2D0QB 5GAOm 1PC0A 2KQWA 1G2BA 1YHQA 3M58A 3V7CA 4EMKC 1VQNT 3EG2A 4MDXA 5GJVB 2HKNA 1BBZA 1WJSA 4F7UB 3CCJQ 3VRZA 3LW5E 3NTIA 4WCIA 1VQNA 2RQVA 1YP5A 5LJ3h 2E3HA 2CT3A 4M75F 4F7UA 2AZSA 4E7LA 3CMAT 1S72Q 2DZCA 3OYBA 3S3MA 2LX7A 4EIKA 3CQTA 3CPWS 3CMAA 2D1XA 1OYXA 2C0IA 4YTLA 1B34A 3GOXA 1GBQA 2NUPA 3EFOB 1YNZA 5FRMA 3HRTA 5LJ3d 2RHUA 2FL7A 2K79A 1X43A 5LJ3e 4FU6A 4JRPA 3EFOA 1UHCA 1X2KA 4E2FB 2OI3A 1I4K1 1Q7YU 1EX4A 1M1KR 2IG0A 4A63B 1K73R 2LTOA 2NUZA 3I56Q 1AEYA 2C06A 1WHKA 5HKCA 4XQ3A 2DX1A 4TVRA 3H41A 4QQDA 2JN0A 3UWNA 1J3TA 3OYLA 3RNJA 1YN8A 4C8QC 1BI0A 2DL3A 1N9RA 4LDUA 2OTLQ 5D6XA 5D6WA 1NYFA 3KFVA 2KROA 4IIMA 1F1BB 1KHCA 4BE1A 2BZYA 4F17A 4RUGA 3L2VA 3CCRQ 4M77F 1RAGB 2DAQA 4M7AE 1OV3A 5FU6B 3LH0A 2VGMA 3PTAA 1YCSB 4M78F 2QEXT 4E47A 4HT8A 2RQWA 1RUWA 1WQ7A 2QDYB 4LDYA 1T0HA 2K3XA 4OMQA 3OYAA 4ZN3A 2JZ2A 3OYJA 1LNXA 2O01E 1D1AA 3OYMA 4IUUA 3OW2S 5J39A 1OULA 4L59A 4A4GA 2E5KA 2ZPIB 3CBPA 1BB9A 1JU5C 3V8LA 1UJYA 3X28B 4RG8A 4JRIA 1XOVA 3RESA 4FW1A 2RF0A 5DY9A 1AHJB 4HKEA 3BDUA 4DEXA 1YWPA 1XTDA 2MWPA 3OYDA 1PHTA 4JRKA 5HK3A 3H0FA 1M8VA 2CREA 2K2VA 2CP6A 3G7ZA 2W0ZA 4F7UF 4M77G 3H0HA 1FXXA 4RTXA 3CC4Q 3GNGA 1SHFA 3CMET 2DMOA 2V8KA 4KUDK 1WHMA 3QO3A 3JCMV 1EFNA 5A0DA 1U1TA 2E6ZA 4J9FA 4JUVA 1VQ9A 1G3SA 4PJLA 3MPUB 2PU9B 2QQRA 3JCMf 2Y4XA 4C5HA 4KT0E 2DL5A 1QMCA 3QZ5B 1BKBA 3RMQA 5IN1A 1Y57A 4CC7A 1MV0B 4C5EA 2WACA 2AZVA 2E4HA 2DE0X 2X9HA 1VQLQ 2VXEA 3OYKA 1D0ZA 1ZUUA 2YT6A 1Q7YC 1YIJT 4LUDA 2EPDA 1UDLA 2QGFB 1WJQA 3F70A 1B3QA 5LL6S 2DBKA 2RO0A 3QJYA 5GAMh 4HVUA 3THKA 2BE9B 1QWFA 1ZUYA 2XDDA 2COWA 1I81A 2CP7A 2HL3A 2PTKA 1ZHIA 2HL5C 2EYZA 2XICA 2M9UA 3ZBDA 3JRZA 4BE2A 4FSSA 1JJ2S 3INZA 1M1FA 2R58A 1YJ9Q 5CKDA 2BKDN 2K7AA 4RTZA 4EMGA 2K5FA 1ZSZB 3EG3A 5GAMd 1YJNT 5GAMe 1G3YA 2GBQA 1ZSZA 3WXMB 4FYYB 2P0PA 4JLGA 4CC2A 2KRNA 1WHHA 1ARKA 4R56A 4E7ZA 3I35A 2EFIA 3META 2DTIA 2EIFA 2XIDA 5GMKh 1C0MA 1RI9A 2CDTA 3CCMT 2COYA 2FZCB 1M1KU 1K73U 3EHRA 1JB0E 1VQPT 1N8RC 2KYMA 2RQTA 1ZSGA 4C0GA 3OYYA 2VV5A 4FYXB 5GAN3 5GAN2 3PGGA 1YHQQ 1VQPA 4Q5WA 4FCYA 4PLIA 1Q95G 2BE7D 1VQKT 4IIOA 3VYHB 2EVRA 3ER0A 3GP8A 3URGA 4HVWA 1VQNQ 3P8DA 3D7SB 3VU3C 1D0YA 5I22A 5GMKe 5GAOr 4O6JA 5FWCA 3M4YA 5CQXA 2KEAA 3CCLT 1TTHB 3DKMA 1PD0A 1FMKA 2V8JA 3CMAQ 2LDMA 1KC8R 1NEGA 4UC4A 4IUTA 4J9HA 2HSPA 2L2PA 2MMPA 4C5IA 2RD1A 1WXUA 3TSZA 2HD0A 5GANh 3JCMW 4MZMA 1MNEA 2O9SA 1WX6A 3C0CA 2LVMA 3ZFJA 1KQSP 3WVEB 2EYQA 1G3WA 2RQRA 4E7IA 1TSFA 5GAOn 4PLLA 5AT1B 3FRNA 2ZAEA 4OMNA 4MZPA 4HXJA 1C6VX 1DJ7B 1RAHB 3TREA 5GANd 1NLPC 1QCOA 4Y91A 4J9CA 5GANe 2HBWA 5C0MA 5FU7C 2XD0A 1NLOC 2ZPFB 3G71T 1Q82R 1G83A 4M75E 4OMFB 4PK4A 2YHTA 1GCQA 5LJ3g 3V7RA 5LJ5h 3CCUA 2O4XB 2J6OA 3NHNA 3OSVA 2F2WA 5IT9E 1JQQA 5J26A 3CXCP 3RBBB 3TSWA 1Q86C 3QDFA 1VQ7T 2O4XA 2FPFA 2J6KA 1R0CB 2L5QA 2DJZA 4JZ4A 1SRMA 2RJCA 3A8MB 3M57A 3H9NA 2G6FX 1CSKA 1OX9A 2CZ6B 2DJQA 2ECZA 4E7JA 4LN2A 4M7AD 2J7IA 3M54A 5LJ5d 4RTUA 1M9SA 5LJ5e 3DB3A 2KT1A 2KMTA 1D09B 2C0OA 1TUGB 1X6GA 1MMNA 3JB9D 1N9SA 1SG5A 1TU0B 4AG1C 2G3RA 3I55T 5GAN8 2KT8A 1OU8A 3SFMA 3I55A 1SPKA 1R8OB 4ZTFA 1PD1A 3CPWP 5KYNA 4J7FA 4HCCA 1I07A 4OB3B 1I5LA 2MWOA 3FDRA 1IRXA 1WXBA 2EJ9A 4FL6A 8ATCB 3X20B 2FB7A 1BYMA 4OVAA 3M0SA 2FYKA 2WSCE 4M77E 1KQSA 1VIEA 2JMAA 4BI3A 5CKFA 1SKUB 4PL6A 2K2MA 3U23A 3BW1A 1LCKA 2CYZB 2E65A 1PSEA 4M78E 2HBPA 4LDVA 3HRSA 1M27C 3MCAB 4RTVA 1BI1A 2H3JA 3QBYA 1VQ9Q 2JW4A 3NTHA 3EH1A 3AHUA 4M7AC 3M0TA 3EH2A 2RN8A 4OMMA 1RI0A 5IHKA 2A36A 3QWYA 2MI6A 2YUQA 5KCOA 2RI2A 1Z9QA 4D8DA 1GCPA 2PZ1A 1ZBJA 1X01A 2DA9A 5EC7A 4JLIA 1WPYA 4C0FA 2KR3A 5C6SA 4Y92A 3REBB 3H8ZA 1VA7A 4IUVA 9ATCB 3A8GB 2QI2A 4PJOG 1LOJA 4CC3A 2DEUA 3S3NA 2R5MA 1Y0MA 3GNFB 4N4GA 5CVIA 1QKXA 2BUDA 4XU3A 2OTJT 3OW2P 2YSQA 1WGSA 4M77A 4HCZA 1VQ8T 3CC2A 2OTJA 4AFUC 3VS1A 4ZNXA 1IHVA 2IVWA 3V7SA 3PT9A 2EJFA 5DLOA 3GF5A 1VQ6T 4GY5A 1UG1A 2D8JA 1O9SA 1UUEA 4II1A 1M1GA 4N4IA 1V76A 3KBGA 2KRMA 1YJWA 1OX8A 4XK8E 2CSIA 1O75A 1Z9ZA 1SHGA 1GFDA 4BY6C 4R55A 2NLUA 1UGRB 3A8LB 5KE2A 4DBFA 3GLXA 2E5QA 4PFOA 4JJCA 3E19A 1IHWA 4PFPA 3SDZA 1UFFA 4DBQA 2RHIA 1PM3A 4EMHA 1KD1R 2BTTA 1NPPA 4V2SA 1MHNA 4X1VA 1W2BS 1VYUA 5KYUB 1IZ6A 3BDLA 1I1JA 4XTVA 5GAMg 2NWMA 3GIBA 1SEMA 3RERA 1QP2A 2MAMA 2ZPGB 1YWOA 3HP9A 1ZBXA 1K8AU 4OMOA 2FHDA 3JV3A 1YITT 3R6OA 1NE8A 1IO6A 3QDRB 3EHQA 1AWXA 1PG5B 5M9OA 3O5ZA 5I11A 2PUKB 1N27A 4K11A 3MP8A 1VQMT 2BZ8A 5HY6A 2FO0A 2ROTA 1ACMB 1GRIA 2VYTA 1VQMA 1NEBA 2J05A 3VS5A 3HTRA 1KQ2A 5AYFA 4OB1B 2EGAA 5FROA 3NFCA 2DXTA 3QZ9B 4RG2A 1JJ2P 3LYIA 2GFUA 1NJIU 3VUBA 3CCVT 1M90R 4QW2A 2DL4A 2LQKA 1Q81C 3QJ6A 1H8KA 3QYHB 5GAN5 1IGQA 2L0AA 5KH6A 2COZA 2B86A 1YI2T 1TG0A 4J9IA 2LNHB 2DILA 2DPPB 2O31A 3H0IA 2L3SA 1H3HA 2LJ3A 3CCUQ 3VS3A 5DLQE 1QVGA 2DXCA 2HMAA 1W70A 3MHXA 2PQWA 4MZTA 4M75D 1PCXA 2X4WA 4FYVB 5GAN6 3EGXB 1OPLA 2F2XA 4XTWA 3SB2A 4C92G 2XDBA 1MMAA 3EGXA 2QEXA 1BI2A 2EQUA 5GANg 2H3EB 1GBRA 1IGUA 1U3OA 1K9MR 2MPXC 2P4RA 5CQYA 4OB0B 2LQWA 3RIRA 4Y28E 3UDCA 3C95A 2YXYA 4FW2A 2RB6A 4DA4A 3I55Q 2P4TA 2DXUA 1X27A 4JRQA 3P8BB 2LC4A 3SWNB 2JTEA 3VUZA 4FT2A 2KYBA 2FRWA 3FEOA 3SWNA 4Z89A 2RMOA 1K0XA 1TXQA 5LJ5g 4XTXA 4LD6A 3LWIA 1JJ2A 1T3SA 2RK2A 2ZPEB 4FSXA 5L8RE 4M77D 5GAN7 4M75C 3QG1A 5I21A 1K8AC 4FYWB 3EAEA 2QK0A 2RK1A 4A4FA 3CMEA 2GQIA 2M51A 2NUTB 1JBMA 3HPWA 5GJWB 1SSFA 4M78D 3QIIA 1TWBA 1H92A 2HQHA 4JPBW 1AT1B 3NPFA 1IREB 2A0FB 4J5YA 4C0DB 2BZXA 1K1ZA 2Y4YA 3I5SA 3G6ET 2JM8A 2EGCA 2CP0A 2LCSA 2K57A 2EKOA 2RJEA 3PVLA 2P0QA 3G6EA 4BB7A 2JUFA 2HQEA 1YIJA 1NJIC 1V29B 4AFSC 2E6NA 4OMLA 1KIKA 1I5OB 3OS1A 3QKJA 3OYHA 3O8VA 3CC2Q 1E6HA 2FVUA 2OTJQ 2XMFA 2SRCA 3UA7A 1RADB 2JT4A 1JEGA 3S3OA 2CS7A 2KXDA 1B07A 3M9QA 3MEAA 4M77C 3DLLA 3CCET 5ECAA 3JCMQ 1LPLA 2ED1A 3L2QA 2DLPA 1YJWQ 3CCEA 2DRMA 1YJNA 1G3TA 1M2VB 2R57A 3FJPA 4M78C 4JJNK 2VXFA 4PJOB 5GAOq 1M2VA 4J83A 2EQJA 4M4ZA 4EMKB 2L3QA 3EG0A 2VASA 4PJOA 3JCMh 4XU1A 3CCST 4D6WA 5DM7R 3A1PA 4EMKA 3CCMA 3HRUA 1RAFB 4L6V5 2QASA 1VQOT 1M90U 3RKXA 3VYGA 3CCSA 3J7AF 4ZGDB 2DKGA 2KAFA 1PKTA 3J81E 1S1NA 1VQOA 3CC7T 2E10A 1QCFA 1OZ3A 1VQKA 2EQIA 2FZKB 2MCNA 2RNAA 3M55A 1KJWA 2VKNA 4QQ6A 4AFZC 1AVZC 3CC7A 3M59A 3QHSA 3TQ7P 3JCMd 4JDSA 3JCMe 4HCKA 1UE9A 3M0RA 2DD4A 2RHYA 1N6AA 2CSQA 4AFQC 2YRDA 3OYIA 4AMCA 3CCLA 1C1AA 1Y71A 1BU1A 3WVDB 2DFUA 4XU2A 1NG2A 1GL5A 1N5ZA 1BIAA 1U06A 2DIQA 1WXTA 3JB9J 3OBYA 1OEBA 3V8JA 3RR6A 3OYFA 1K9MU 3JAME 2B8AA 4FT4A 4X9CA 3QYGB 1K4US 3RMSA 2GTJA 2LCLA 3JSCA 1KK7A 2HNIA 2XKOC 3MEWA 3EGUA 2JNGA 1QVFS 2HKQB 1RAIB 2DVEA 4BD3A 1RLQC 1ZA2B 5D7UA 1RL2A 3CEYA 3MEVA 2OTLT 2AK5A 1W1FA 3G71A 5KYWB 2GGRA 2LMJA 1AWJA 2CP3A 4AT1B 4ZN1A 1HYOA 3EGDB 4LDWA 1HJDA 3OA6A 5KYWA 3CCRT 2YLCA 5CKEA 1TOVA 4C92E 1VQ7A 2DNUA 4BDZA 1W2BP 4KGXB 1VQ4T 1SF9A 1VIFA 2CZ7B 4JZ3A 3J80E 1G8XA 1WIEA 3CBOA 1LJOA 2VVKA 3LGFA 4KH1B 2QEXQ 2D0NA 1R0BG 1VQ4A 3QUIA 4D8KA 1UGPB 2KBTA 2LP5A 2FRYA 5IAYA 2DL7A 2PNIA 1M30A 4M7AG 1IB8A 1R77A 1UGQB 1WFWA 2HEQA 1HSQA 5FU6C 3E1SA 2KK4A 1Q7YR 2LQNA 2JVVA 4CC4B 5CAIA 1MV3A 2ZPHB 3JCMb 5GMKl 4PJOF 2LQ8A 4QVCA 2HSEB 2D6FA 1M1KC 1K73C 3H6ZA 3EFSA 2YUPA 1FMWA 3PFSA 4CI0C 4F16A 3QXEB 1ZA1B 3V8KA 2VGNA 3NMZC 2RHXA 1A0NB 1WHLA 3C12A 3JB9I 1WQWA 2RH2A 2F69A 4C92B 5J3BA 1ABOA 1PKSA 2A28A 1PNJA 1T3LA 4C92A 1H641 2ZGWA 4N0AA 2K5LA 4JJBA 3JB9H 4ELYC 4NS5A 4QVDA 2XK0A 2LJ0A 1UGVA 3CMEQ 1FYNA 4LUEA 4BACA 5A0GA 1WJRA 4BDYA 2DRKA 1V1CA 2L8DA 2M1HA 3A98A 1BK2A 2JS0A 2Z0WA 3CXCA 4B9WA 2V8IA 4OGCA 2QQSA 3FLGA 1WHGA 2XDPA 2E12A 4IUPA 4X9DA 3OQ5A 1N8RR 4M7DG 1AOJA 1NBEB 2MF2A 1EZZB 1AZGB 1BI3A 1W2BA 1VQLT 4C8QF 5LJ3j 5HK0A 3G6EQ 1VUBA 2CH4W 1YIJQ 2ZCFB 4VUBA 2AKLA 2ZPBB 1AD5A 1Y96B 2DETA 5LJ3f 5CKBA 2E70A 1VQ8A 1Y96A 2XU8A 2X4XA 4J9BA 2KNBB 4PNOA 3G1JA 3CPWA 2QAZA 4OF1A 1W4SA 3RKWA 4A4EA 1OZ2A 2MIOA 1VQ6A 2RHZA 1TS9A 4NL2A 3OYNA 3TVTA 1NYGA 3M0QA 3UPUA 2ED0A 1KC8U 1CKBA 3CCEQ 1YJNQ 1JXMA 3GBQA 1GFCA 4EDUA 2EYXA 3T9NA 4RMOA 3OB9A 3VS7A 3EG1A 2AHJB 2W10A 5I2SA 3VS6A 4ESRA 2KVQG 1TUDA 2YUOA 2DTHA 1ZSZC 2OJ2A 1QW1A 3OYGA 2GCXA 3L42A 4BUGA 2J6FA 1U1SA 2JJ9A 3CCMQ 1K76A 1OQKA 1VQPQ 3CCSQ 4C8QG 2DBMA 6AT1B 1OI1A 1XQHA 1M3CA 1NM7A 5KYUA 5IHIA 2LCCA 4C5GA 1TUCA 1VQOQ 3BFMA 1VQKQ 5KCHA 4HT9A 3HSBA 2V1RA 2JXBA 2RI3A 2M16A 4HA8A 1Q82U 1Q86R 4KGZB 4Z8AA 3CC7Q 3M0PA 4LD9K 4J6WA 3ZL7C 5CR2A 2I0NA 3QWXX 1YITA 2EWNA 3CCLQ 4C92F 2QXFA 3RKYA 1FWZA 4GLMA 1WNLA 4ATOA 3MO8A 3OW2A 2EYYA 3MP1A 4KH0B 4X34A 1D3BB 2D9TA 2NUPB 1E7OA 1EIFA 1D3BA 2RJDA 3GPLA 1ZLMA 2RPNA 1RABB 2ZZDA 2DIGA 3JCMg 1U5SA 3EG9B 2MYSA 4KUIA 1HXDA 5FU7B 3L2UA 4BE0A 3CCVA 2DD5A 4PKCC 3EG9A 2LT4A 3S6WA 5GMKm 3LX7A 4IUQA 3E2UA 5FWBA 5CK9A 2R5AA 1YI2A 2E41A 2K9GA 3PMIA 2IPOB 5EG2A 1M4ZA 3G71Q 1M3BA 3E9GA 4O5VA 2L3PA 3LGLA 4GBQA 1WA7A 2X51A 2K5IA 2O2OA 1VQ7Q 1M8MA 2RQUA 1GCQC 1TH7A 3OS2A 3CBMA 1OOTA 1BIBA 4RTWA 4M75G 2CKKA 1BCMA 4FIBA 8AT1B 3JCMX 1OPKA 1PRLC 3UATA 5CCAA 1VQ4Q 4ANJA 4C92D 1VQ5T 3JCMc 4ZTJA 3QPHA 2DK3A 3KUFA 4JJDA 4DOWA 3JCMJ 5KYYB 3VS0A 1VQ5A 1KC8C 1ABQA 4DOVA 2CT4A 2VWFA 2FZGB 2YRCA 1UGSB 5KYYA 5GAMj 2DTOA 3L2RA 2CH4A 2WSFE 1QKWA 1KHIA 2LZ6B 3C94A 1N8RU 1X6OA 3ME9A 4KBMB 3OY9A 4RCCA 1KQ1A 4R0KA 1UECA 1HD3A 2LJ1A 5GAMf 3VS4A 1KG1A 3QSUA 2E1HA 3CD6T 1K9AA 3M4GA 2F5TX 2E64A 1W6XA 4ORZA 2SEMA 2CUBA 3BY7A 1E6GA 5CO7A 3CD6A 4XTUA 2GFAA 4LXCA 2ATCB 1AZEA 3LH5A 1MGQA 4XTZA 3AT1B 3PVQA 3MKDA 4HVVA 5IXFA 4M7AB 3G4ST 1Q82C 1ZX6A 4WTOB 1AWWA 4J8OA 1FX7A 3ULRB 2JMCA 3G4SA 3EFRA 4M7AA 2XI9A 5CIUA 4QKUA 2BIVA 5GAOp 1QVGS 1QVFP 2CGHA 5GMKj 1X69A 2NUTA 3OBWA 4DEYA 4PJNA 2QGGA 3I9QA 4Z88A 2HZYA 1VQ9T 2VC8A 4C92C 3MJXA 4N0AC 4MMLA 4M7DE 4M78G 3CCQT 4J9GA 4RTYA 1M5Q1 3OSSC 1G5VA 4PJOE 4L5GA 3OMCA 1OU9A 3CCQA 1RAEB 3FIFA 5GAN4 1PSFA 2QDLA 1KD1U 3ASKA 2QG9B 5I2MA 1NPRA 1KFZA 2KRSA 1M2OA 2RJFA 2X3XD 1UB4A 3MEUA 4DBRA 2EBPA 1VQ8Q 1UHFA 1Y07A 1HK9A 2A3LA 4KGVB 4KULA 2WSEE 3A8OB 1WHJA 2QA4T 5GANj 3HFOA 1Q86U 3RUXA 2GQVA 3NTKA 2L3RA 2KY9A 3X26B 2CZ1B 2DERA 1MMGA 4LE9A 1UEBA 4BY6B 2QA4A 1LVKA 2AKKA 1VQ6Q 1D0XA 1NZ9A 4M7DB 2RM4A 2EKHA 5GANf 3R6NA 1QLYA 3CPFA 3DB4A 4Z02A 4F7UG 5IH2A 2YLBA 3M56A 2XHCA 4M7DA 4WF2A 3X24B 1QVPA 1UJ0A 4RCBA 1Q81R 2OAWA 4C8QE 2XG8D 3HL8A 3SD4A 2KDSA 3DLMA 5LJ5j 2JTMA 3IQLA 1QVFA 2J06A 4QQGA 3VRYA 2E3IA 5LJ5f 2M02A 3CCJT 2DZ9A 2JS2A 2V26A 4ZGJB 1X6BA 4OB2B 2A37A 3X25B 2QTXA 3CCJA 1K0SA 1QWEA 1QQJA 3Q1JA 2QQBA 1JRIA 2DYBA 2JTFA 1YITQ 4A53A 2QQAA 1S72T 2EJGA 5L23A 2I2LA 1BCOA 1ZQ1A 1S72A 1ZUKA 2FEIA 1JO8A 4A4HA 1WDXA 1VQMQ 4PFZA 4M7AF 3L2WA 2K3YA 3E9FA 1U8RA 2PVDB 4C8QB 4PJMA 3FC3A 4E7SA 4LNPA 3JB9F 2FG0A 2KSSA 1B34B 1MUZA 3LLRA 1I8FA 4C8QA 1B7TA 3I56T 2MOXA 3PMTA 2HCKA 2EQKA 2ENMA 2KXCA
chains in the Genus database with same CATH topology
1AZGB 2DE0X 2X3WD 2DL4A 2DM1A 2F2VA 2HDAA 1ZUUA 2YT6A 2CH4W 3VS2A 4LUDA 1H8KA 2EPDA 2L0AA 1UDLA 2AKLA 1AD5A 1B3QA 2B86A 2DBKA 1TG0A 4J9IA 2D8HA 2LNHB 2DILA 2YDLA 5FW9A 2GNCA 4HVUA 2O31A 3H0IA 3THKA 1QWFA 1ZUYA 2L3SA 1H3HA 2LJ3A 2O88A 3VS3A 4J9BA 2KNBB 2PTKA 1T0JA 2EYZA 1W70A 2ROLA 2DF6A 4FSSA 4F14A 2K7AA 4RTZA 1OPLA 2F2XA 2MIOA 3TVTA 3SEMA 2K3BA 1NYGA 3M0QA 3EG3A 4J9EA 2ED0A 1CKBA 4AG2C 1JXMA 3GBQA 1GFCA 4QT7A 1VYTA 2GBQA 1GBRA 2EYXA 3REAB 1U3OA 2P4RA 3VS7A 2LQWA 4CC2A 2KRNA 3EG1A 2W10A 2CUDA 3NGPA 3VS6A 1ARKA 4ESRA 1TUDA 2YUOA 2K6DA 3I35A 2OJ2A 4J9DA 1RI9A 2CDTA 2J6FA 1K76A 1X27A 2H8HA 3EHRA 2JTEA 1JXOA 2KYMA 2RQTA 1ZSGA 1AWOA 2DBMA 2KYBA 2FRWA 1M3AA 1M3CA 5HCKA 1NM7A 1RLPC 5IHIA 1TUCA 2KGTA 2V1RA 4IIOA 1WI7A 2JXBA 4Z89A 2EVRA 2RMOA 1K0XA 2JM9A 4E6RA 3M0UA 4Z8AA 4HVWA 3M0PA 3ZL7C 2EYWA 2I0NA 5I22A 1T3SA 3UA6A 3QWXX 2DL8A 5FWCA 2KEAA 3PE0A 3I5RA 2M0YA 4GLMA 1FMKA 2GQIA 2M51A 2KE9A 2EYYA 1NEGA 1PRMC 4J9HA 5GJWB 1WLPB 2V1QA 2HSPA 2L2PA 1X2QA 1H92A 1E7OA 1WXUA 3TSZA 4JPBW 2DVJA 2O9SA 3NPFA 1WX6A 3C0CA 1ZLMA 2RPNA 2BZXA 1K1ZA 1U5SA 2ABLA 3I5SA 2IIMA 2JM8A 2RQRA 2EGCA 2LCSA 2C0TA 1SRLA 3PVLA 4OMNA 4HXJA 2YUNA 2FPEA 5FWBA 4AFSC 1NLPC 4OMLA 4J9CA 2O9VA 2HBWA 1KIKA 2K9GA 3SHWA 1M3BA 1CKAA 1NLOC 1I0CA 1G83A 1E6HA 1GCQA 2A08A 2L3PA 4GBQA 2J6OA 3NHNA 2XMFA 4KRTA 2F2WA 1WA7A 2SRCA 3UA7A 1JQQA 3RBBB 3TSWA 2JT4A 2O2OA 1JEGA 2KXDA 1M8MA 1B07A 2RQUA 1GCQC 2FPFA 2J6KA 1OOTA 4JZ4A 1SRMA 1WYXA 4RTWA 2GTOA 5ECAA 2G6FX 1CSKA 2EGEA 2DJQA 2ECZA 1OPKA 2ESWA 1PRLC 3UATA 2ED1A 4OMPA 4LN2A 2DLPA 2DRMA 2J7IA 4JJDA 1UTIA 4RTUA 3VS0A 1ABQA 2KT1A 2FPDA 3FJ5A 2C0OA 1VYVA 2CT4A 2VWFA 1X6GA 1SSHA 4M4ZA 4AG1C 5IXBA 2L3QA 3EG0A 2CH4A 2KT8A 1QKWA 4RTTA 5IHNA 2LZ6B 1KSWA 1SPKA 1PWTA 2EW3A 4R0KA 1UECA 1HD3A 2LJ1A 3UF4A 3VS4A 1I07A 1K9AA 1G2BA 1WXBA 1PKTA 1W6XA 1S1NA 4ORZA 1QCFA 2SEMA 2CUBA 3EG2A 1E6GA 2EQIA 2MCNA 2RNAA 3M0SA 5GJVB 1BBZA 1KJWA 2VKNA 3VRZA 4AFZC 1AVZC 4WCIA 1AZEA 3LH5A 2RQVA 2JMAA 1YP5A 4HCKA 2CT3A 1UE9A 3PVQA 3M0RA 4HVVA 5IXFA 2CSQA 2K2MA 3U23A 4AFQC 1ZX6A 2AZSA 1LCKA 1AWWA 3ULRB 2JMCA 1BU1A 1M27C 2LX7A 4EIKA 3CQTA 4RTVA 1X69A 2D1XA 4DEYA 2C0IA 1NG2A 3I9QA 4Z88A 1GL5A 1N5ZA 2JW4A 1GBQA 1U06A 1WXTA 3M0TA 1YNZA 2RN8A 4OMMA 2K79A 5IHKA 4J9GA 2A36A 1X43A 3QWYA 4RTYA 1OEBA 2YUQA 1Z9QA 1UHCA 1X2KA 4D8DA 1GCPA 2OI3A 2PZ1A 1ZBJA 2DA9A 5EC7A 4A63B 2NUZA 1AEYA 2KR3A 2DX1A 4Y92A 3REBB 3H41A 1K4US 2QDLA 2GTJA 1VA7A 1J3TA 3RNJA 3EGUA 1YN8A 1KFZA 2DL3A 2KRSA 4CC3A 1RLQC 1Y0MA 2X3XD 1QKXA 2EBPA 2YSQA 1NYFA 2AK5A 3KFVA 1W1FA 1UHFA 2GGRA 2LMJA 2KROA 4IIMA 2BZYA 1AWJA 4AFUC 3VS1A 4ZNXA 4F17A 4RUGA 1HJDA 4LE9A 2DNUA 2AKKA 1OV3A 1UG1A 2D8JA 2EKHA 4JZ3A 1WIEA 3R6NA 1QLYA 1UUEA 2VVKA 1YCSB 5IH2A 2D0NA 2RQWA 4D8KA 1RUWA 2KRMA 4OMQA 1T0HA 2KBTA 2LP5A 2CSIA 2FRYA 2DL7A 2PNIA 1M30A 1Z9ZA 1SHGA 1UJ0A 1GFDA 1WFWA 2HEQA 1HSQA 2OAWA 4JJCA 2E5KA 2LQNA 4CC4B 1BB9A 1JU5C 1MV3A 1UJYA 3IQLA 1UFFA 2BTTA 2J06A 4X1VA 1XOVA 1VYUA 3VRYA 2YUPA 4F16A 2RF0A 2JS2A 1I1JA 2NWMA 3NMZC 1X6BA 4DEXA 1A0NB 2A37A 1YWPA 1SEMA 1K0SA 1QWEA 1YWOA 1ABOA 1PHTA 2DYBA 1PKSA 4OMOA 3H0FA 2A28A 1PNJA 3JV3A 1T3LA 2CREA 1IO6A 3EHQA 2W0ZA 1AWXA 3H0HA 4JJBA 5L23A 3O5ZA 5I11A 4RTXA 2LJ0A 1UGVA 1SHFA 1ZUKA 1FYNA 2DMOA 2FEIA 4K11A 4LUEA 1JO8A 1WDXA 2BZ8A 2FO0A 1EFNA 2ROTA 2DRKA 4J9FA 1V1CA 1GRIA 1BK2A 3A98A 1NEBA 2J05A 3VS5A 2JS0A 4LNPA 2FG0A 2DL5A 1MUZA 2EGAA 1Y57A 4CC7A 1MV0B 2MOXA 2AZVA 1AOJA 2HCKA 2ENMA 2KXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AZG B;  2DE0 X;  2X3W D;  2DL4 A;  2DM1 A;  2F2V A;  2HDA A;  1ZUU A;  2YT6 A;  2CH4 W;  3VS2 A;  4LUD A;  1H8K A;  2EPD A;  2L0A A;  1UDL A;  2AKL A;  1AD5 A;  1B3Q A;  2B86 A;  2DBK A;  1TG0 A;  4J9I A;  2D8H A;  2LNH B;  2DIL A;  2YDL A;  5FW9 A;  2GNC A;  4HVU A;  2O31 A;  3H0I A;  3THK A;  1QWF A;  1ZUY A;  2L3S A;  1H3H A;  2LJ3 A;  2O88 A;  3VS3 A;  4J9B A;  2KNB B;  2PTK A;  1T0J A;  2EYZ A;  1W70 A;  2ROL A;  2DF6 A;  4FSS A;  4F14 A;  2K7A A;  4RTZ A;  1OPL A;  2F2X A;  2MIO A;  3TVT A;  3SEM A;  2K3B A;  1NYG A;  3M0Q A;  3EG3 A;  4J9E A;  2ED0 A;  1CKB A;  4AG2 C;  1JXM A;  3GBQ A;  1GFC A;  4QT7 A;  1VYT A;  2GBQ A;  1GBR A;  2EYX A;  3REA B;  1U3O A;  2P4R A;  3VS7 A;  2LQW A;  4CC2 A;  2KRN A;  3EG1 A;  2W10 A;  2CUD A;  3NGP A;  3VS6 A;  1ARK A;  4ESR A;  1TUD A;  2YUO A;  2K6D A;  3I35 A;  2OJ2 A;  4J9D A;  1RI9 A;  2CDT A;  2J6F A;  1K76 A;  1X27 A;  2H8H A;  3EHR A;  2JTE A;  1JXO A;  2KYM A;  2RQT A;  1ZSG A;  1AWO A;  2DBM A;  2KYB A;  2FRW A;  1M3A A;  1M3C A;  5HCK A;  1NM7 A;  1RLP C;  5IHI A;  1TUC A;  2KGT A;  2V1R A;  4IIO A;  1WI7 A;  2JXB A;  4Z89 A;  2EVR A;  2RMO A;  1K0X A;  2JM9 A;  4E6R A;  3M0U A;  4Z8A A;  4HVW A;  3M0P A;  3ZL7 C;  2EYW A;  2I0N A;  5I22 A;  1T3S A;  3UA6 A;  3QWX X;  2DL8 A;  5FWC A;  2KEA A;  3PE0 A;  3I5R A;  2M0Y A;  4GLM A;  1FMK A;  2GQI A;  2M51 A;  2KE9 A;  2EYY A;  1NEG A;  1PRM C;  4J9H A;  5GJW B;  1WLP B;  2V1Q A;  2HSP A;  2L2P A;  1X2Q A;  1H92 A;  1E7O A;  1WXU A;  3TSZ A;  4JPB W;  2DVJ A;  2O9S A;  3NPF A;  1WX6 A;  3C0C A;  1ZLM A;  2RPN A;  2BZX A;  1K1Z A;  1U5S A;  2ABL A;  3I5S A;  2IIM A;  2JM8 A;  2RQR A;  2EGC A;  2LCS A;  2C0T A;  1SRL A;  3PVL A;  4OMN A;  4HXJ A;  2YUN A;  2FPE A;  5FWB A;  4AFS C;  1NLP C;  4OML A;  4J9C A;  2O9V A;  2HBW A;  1KIK A;  2K9G A;  3SHW A;  1M3B A;  1CKA A;  1NLO C;  1I0C A;  1G83 A;  1E6H A;  1GCQ A;  2A08 A;  2L3P A;  4GBQ A;  2J6O A;  3NHN A;  2XMF A;  4KRT A;  2F2W A;  1WA7 A;  2SRC A;  3UA7 A;  1JQQ A;  3RBB B;  3TSW A;  2JT4 A;  2O2O A;  1JEG A;  2KXD A;  1M8M A;  1B07 A;  2RQU A;  1GCQ C;  2FPF A;  2J6K A;  1OOT A;  4JZ4 A;  1SRM A;  1WYX A;  4RTW A;  2GTO A;  5ECA A;  2G6F X;  1CSK A;  2EGE A;  2DJQ A;  2ECZ A;  1OPK A;  2ESW A;  1PRL C;  3UAT A;  2ED1 A;  4OMP A;  4LN2 A;  2DLP A;  2DRM A;  2J7I A;  4JJD A;  1UTI A;  4RTU A;  3VS0 A;  1ABQ A;  2KT1 A;  2FPD A;  3FJ5 A;  2C0O A;  1VYV A;  2CT4 A;  2VWF A;  1X6G A;  1SSH A;  4M4Z A;  4AG1 C;  5IXB A;  2L3Q A;  3EG0 A;  2CH4 A;  2KT8 A;  1QKW A;  4RTT A;  5IHN A;  2LZ6 B;  1KSW A;  1SPK A;  1PWT A;  2EW3 A;  4R0K A;  1UEC A;  1HD3 A;  2LJ1 A;  3UF4 A;  3VS4 A;  1I07 A;  1K9A A;  1G2B A;  1WXB A;  1PKT A;  1W6X A;  1S1N A;  4ORZ A;  1QCF A;  2SEM A;  2CUB A;  3EG2 A;  1E6G A;  2EQI A;  2MCN A;  2RNA A;  3M0S A;  5GJV B;  1BBZ A;  1KJW A;  2VKN A;  3VRZ A;  4AFZ C;  1AVZ C;  4WCI A;  1AZE A;  3LH5 A;  2RQV A;  2JMA A;  1YP5 A;  4HCK A;  2CT3 A;  1UE9 A;  3PVQ A;  3M0R A;  4HVV A;  5IXF A;  2CSQ A;  2K2M A;  3U23 A;  4AFQ C;  1ZX6 A;  2AZS A;  1LCK A;  1AWW A;  3ULR B;  2JMC A;  1BU1 A;  1M27 C;  2LX7 A;  4EIK A;  3CQT A;  4RTV A;  1X69 A;  2D1X A;  4DEY A;  2C0I A;  1NG2 A;  3I9Q A;  4Z88 A;  1GL5 A;  1N5Z A;  2JW4 A;  1GBQ A;  1U06 A;  1WXT A;  3M0T A;  1YNZ A;  2RN8 A;  4OMM A;  2K79 A;  5IHK A;  4J9G A;  2A36 A;  1X43 A;  3QWY A;  4RTY A;  1OEB A;  2YUQ A;  1Z9Q A;  1UHC A;  1X2K A;  4D8D A;  1GCP A;  2OI3 A;  2PZ1 A;  1ZBJ A;  2DA9 A;  5EC7 A;  4A63 B;  2NUZ A;  1AEY A;  2KR3 A;  2DX1 A;  4Y92 A;  3REB B;  3H41 A;  1K4U S;  2QDL A;  2GTJ A;  1VA7 A;  1J3T A;  3RNJ A;  3EGU A;  1YN8 A;  1KFZ A;  2DL3 A;  2KRS A;  4CC3 A;  1RLQ C;  1Y0M A;  2X3X D;  1QKX A;  2EBP A;  2YSQ A;  1NYF A;  2AK5 A;  3KFV A;  1W1F A;  1UHF A;  2GGR A;  2LMJ A;  2KRO A;  4IIM A;  2BZY A;  1AWJ A;  4AFU C;  3VS1 A;  4ZNX A;  4F17 A;  4RUG A;  1HJD A;  4LE9 A;  2DNU A;  2AKK A;  1OV3 A;  1UG1 A;  2D8J A;  2EKH A;  4JZ3 A;  1WIE A;  3R6N A;  1QLY A;  1UUE A;  2VVK A;  1YCS B;  5IH2 A;  2D0N A;  2RQW A;  4D8K A;  1RUW A;  2KRM A;  4OMQ A;  1T0H A;  2KBT A;  2LP5 A;  2CSI A;  2FRY A;  2DL7 A;  2PNI A;  1M30 A;  1Z9Z A;  1SHG A;  1UJ0 A;  1GFD A;  1WFW A;  2HEQ A;  1HSQ A;  2OAW A;  4JJC A;  2E5K A;  2LQN A;  4CC4 B;  1BB9 A;  1JU5 C;  1MV3 A;  1UJY A;  3IQL A;  1UFF A;  2BTT A;  2J06 A;  4X1V A;  1XOV A;  1VYU A;  3VRY A;  2YUP A;  4F16 A;  2RF0 A;  2JS2 A;  1I1J A;  2NWM A;  3NMZ C;  1X6B A;  4DEX A;  1A0N B;  2A37 A;  1YWP A;  1SEM A;  1K0S A;  1QWE A;  1YWO A;  1ABO A;  1PHT A;  2DYB A;  1PKS A;  4OMO A;  3H0F A;  2A28 A;  1PNJ A;  3JV3 A;  1T3L A;  2CRE A;  1IO6 A;  3EHQ A;  2W0Z A;  1AWX A;  3H0H A;  4JJB A;  5L23 A;  3O5Z A;  5I11 A;  4RTX A;  2LJ0 A;  1UGV A;  1SHF A;  1ZUK A;  1FYN A;  2DMO A;  2FEI A;  4K11 A;  4LUE A;  1JO8 A;  1WDX A;  2BZ8 A;  2FO0 A;  1EFN A;  2ROT A;  2DRK A;  4J9F A;  1V1C A;  1GRI A;  1BK2 A;  3A98 A;  1NEB A;  2J05 A;  3VS5 A;  2JS0 A;  4LNP A;  2FG0 A;  2DL5 A;  1MUZ A;  2EGA A;  1Y57 A;  4CC7 A;  1MV0 B;  2MOX A;  2AZV A;  1AOJ A;  2HCK A;  2ENM A;  2KXC A; 
#chains in the Genus database with same CATH topology
 2CZ0 B;  3CCV Q;  2X3W D;  3I56 A;  2DM1 A;  5GAO l;  2F2V A;  2HDA A;  2F1L A;  4DQ2 A;  4A4K A;  2PVO B;  3VS2 A;  3PIO A;  4E7K A;  1YI2 Q;  4NL3 A;  5KYX B;  1KD1 C;  2D8H A;  5FW9 A;  2YDL A;  2OTL A;  2GNC A;  1GXI E;  4LDX A;  1Y7X A;  2KI7 A;  4J6X A;  2DO3 A;  2Y90 A;  1XNI A;  5KE3 A;  3VKI A;  3CCU T;  2O88 A;  2PUO B;  5KYX A;  1K8A R;  4F04 B;  3MP6 A;  1T0J A;  3EGD A;  3TEE A;  3CCR A;  2ROL A;  2DF6 A;  4E7H A;  4NOY A;  3TCJ A;  4FM4 B;  2VUB A;  4F14 A;  1YCY A;  4XU0 A;  1RAC B;  7AT1 B;  2L89 A;  3A5Z B;  3OYE A;  2OAU A;  2HQX A;  3SEM A;  2K3B A;  2QQ9 A;  3HFN A;  4J9E A;  2EQM A;  3N5B B;  1XJW B;  2LT1 A;  4AG2 C;  4B9X A;  4QT7 A;  5FRN A;  1VYT A;  3REA B;  3UT1 A;  4M7D F;  1VQ5 Q;  4PJJ A;  2CUD A;  3NGP A;  3JB9 G;  3OS5 A;  2K6D A;  2NYS A;  1NJI R;  4MDW A;  4J9D A;  2QTV A;  2H8H A;  1JXO A;  2A7Y A;  4HCB A;  1AWO A;  1M3A A;  5HCK A;  1RLP C;  1M90 C;  3VV0 A;  5FLX E;  2KGT A;  2RA2 A;  4M75 B;  1WI7 A;  3CD6 Q;  3RDV A;  1QP3 A;  3M5A A;  2JM9 A;  2OX7 A;  4BI8 B;  4E6R A;  3M0U A;  4JS4 A;  3JCM P;  1MND A;  2EYW A;  2YWW A;  3SWN C;  1D1B A;  4M75 A;  1FMV A;  4OP0 A;  2AIR B;  3UA6 A;  2P0K A;  2DL8 A;  3CC4 T;  3HKS A;  3PE0 A;  4A54 A;  3I5R A;  2M0Y A;  3PIP A;  3G4S Q;  2CP5 A;  3M53 A;  4IUR A;  3CC4 A;  5A0L A;  2KE9 A;  2P84 A;  5A2Q E;  1MMD A;  1PRM C;  1WLP B;  2V1Q A;  4OGE A;  1QCN A;  2JOY A;  1X2Q A;  2DXB A;  3BE3 A;  4J7I A;  2DVJ A;  2PVG B;  1YFN A;  4XTY A;  3ZEH A;  2AT1 B;  2F5K A;  3CCQ Q;  4C0Z A;  5GMK i;  2ABL A;  4M7D D;  4ME7 A;  1K9M C;  2YRV A;  2IIM A;  1Q81 U;  2HAX A;  1YBY A;  2GF7 A;  2C0T A;  2X4J A;  4EPC A;  5CKH A;  1VQL A;  1IXD A;  4PJO D;  1SRL A;  2LX9 A;  1P92 A;  3LWH A;  2YUN A;  2FPE A;  2M0O A;  4IKF A;  2QYZ A;  3L1A A;  4C0D C;  2O9V A;  3KXT A;  2VB6 A;  4B6M A;  4M77 B;  2X4Y A;  3SHW A;  1CKA A;  1I0C A;  3CC2 T;  2RI5 A;  1WZO A;  2A08 A;  2LRQ A;  4KRT A;  4DBH A;  3FB9 A;  3OS0 A;  1D1C A;  1YJ9 T;  4ELZ C;  1KQS S;  4M78 B;  4N4H A;  1VOM A;  4JS5 A;  4F7U E;  2QA4 Q;  1YJ9 A;  4P5N A;  4QVZ A;  1WYX A;  3PNW C;  2GTO A;  4ZGE B;  4M78 A;  3OYC A;  2EAY A;  3A8H B;  2CP2 A;  2EGE A;  2ESW A;  2LNV A;  4OMP A;  2DEQ A;  1X75 C;  1YJW T;  4RKU E;  4MMK A;  1UTI A;  4CRI A;  2DYI A;  2K4Y A;  2FPD A;  3FJ5 A;  2X35 A;  4BI4 A;  1VYV A;  3P8H A;  1SSH A;  1RAA B;  3TU4 K;  1H3Z A;  5IXB A;  3C4S A;  3OMG A;  4J6Y A;  3VJP A;  4RTT A;  5IHN A;  4M7D C;  3CXC S;  3L2Z A;  5D6Y A;  1KSW A;  1PWT A;  3HHT B;  2EW3 A;  1QVG P;  2MK5 A;  4XAX B;  1YHQ T;  4PJO C;  4GLK A;  3UF4 A;  4C8Q D;  2D0Q B;  5GAO m;  1PC0 A;  2KQW A;  1G2B A;  1YHQ A;  3M58 A;  3V7C A;  4EMK C;  1VQN T;  3EG2 A;  4MDX A;  5GJV B;  2HKN A;  1BBZ A;  1WJS A;  4F7U B;  3CCJ Q;  3VRZ A;  3LW5 E;  3NTI A;  4WCI A;  1VQN A;  2RQV A;  1YP5 A;  5LJ3 h;  2E3H A;  2CT3 A;  4M75 F;  4F7U A;  2AZS A;  4E7L A;  3CMA T;  1S72 Q;  2DZC A;  3OYB A;  3S3M A;  2LX7 A;  4EIK A;  3CQT A;  3CPW S;  3CMA A;  2D1X A;  1OYX A;  2C0I A;  4YTL A;  1B34 A;  3GOX A;  1GBQ A;  2NUP A;  3EFO B;  1YNZ A;  5FRM A;  3HRT A;  5LJ3 d;  2RHU A;  2FL7 A;  2K79 A;  1X43 A;  5LJ3 e;  4FU6 A;  4JRP A;  3EFO A;  1UHC A;  1X2K A;  4E2F B;  2OI3 A;  1I4K 1;  1Q7Y U;  1EX4 A;  1M1K R;  2IG0 A;  4A63 B;  1K73 R;  2LTO A;  2NUZ A;  3I56 Q;  1AEY A;  2C06 A;  1WHK A;  5HKC A;  4XQ3 A;  2DX1 A;  4TVR A;  3H41 A;  4QQD A;  2JN0 A;  3UWN A;  1J3T A;  3OYL A;  3RNJ A;  1YN8 A;  4C8Q C;  1BI0 A;  2DL3 A;  1N9R A;  4LDU A;  2OTL Q;  5D6X A;  5D6W A;  1NYF A;  3KFV A;  2KRO A;  4IIM A;  1F1B B;  1KHC A;  4BE1 A;  2BZY A;  4F17 A;  4RUG A;  3L2V A;  3CCR Q;  4M77 F;  1RAG B;  2DAQ A;  4M7A E;  1OV3 A;  5FU6 B;  3LH0 A;  2VGM A;  3PTA A;  1YCS B;  4M78 F;  2QEX T;  4E47 A;  4HT8 A;  2RQW A;  1RUW A;  1WQ7 A;  2QDY B;  4LDY A;  1T0H A;  2K3X A;  4OMQ A;  3OYA A;  4ZN3 A;  2JZ2 A;  3OYJ A;  1LNX A;  2O01 E;  1D1A A;  3OYM A;  4IUU A;  3OW2 S;  5J39 A;  1OUL A;  4L59 A;  4A4G A;  2E5K A;  2ZPI B;  3CBP A;  1BB9 A;  1JU5 C;  3V8L A;  1UJY A;  3X28 B;  4RG8 A;  4JRI A;  1XOV A;  3RES A;  4FW1 A;  2RF0 A;  5DY9 A;  1AHJ B;  4HKE A;  3BDU A;  4DEX A;  1YWP A;  1XTD A;  2MWP A;  3OYD A;  1PHT A;  4JRK A;  5HK3 A;  3H0F A;  1M8V A;  2CRE A;  2K2V A;  2CP6 A;  3G7Z A;  2W0Z A;  4F7U F;  4M77 G;  3H0H A;  1FXX A;  4RTX A;  3CC4 Q;  3GNG A;  1SHF A;  3CME T;  2DMO A;  2V8K A;  4KUD K;  1WHM A;  3QO3 A;  3JCM V;  1EFN A;  5A0D A;  1U1T A;  2E6Z A;  4J9F A;  4JUV A;  1VQ9 A;  1G3S A;  4PJL A;  3MPU B;  2PU9 B;  2QQR A;  3JCM f;  2Y4X A;  4C5H A;  4KT0 E;  2DL5 A;  1QMC A;  3QZ5 B;  1BKB A;  3RMQ A;  5IN1 A;  1Y57 A;  4CC7 A;  1MV0 B;  4C5E A;  2WAC A;  2AZV A;  2E4H A;  2DE0 X;  2X9H A;  1VQL Q;  2VXE A;  3OYK A;  1D0Z A;  1ZUU A;  2YT6 A;  1Q7Y C;  1YIJ T;  4LUD A;  2EPD A;  1UDL A;  2QGF B;  1WJQ A;  3F70 A;  1B3Q A;  5LL6 S;  2DBK A;  2RO0 A;  3QJY A;  5GAM h;  4HVU A;  3THK A;  2BE9 B;  1QWF A;  1ZUY A;  2XDD A;  2COW A;  1I81 A;  2CP7 A;  2HL3 A;  2PTK A;  1ZHI A;  2HL5 C;  2EYZ A;  2XIC A;  2M9U A;  3ZBD A;  3JRZ A;  4BE2 A;  4FSS A;  1JJ2 S;  3INZ A;  1M1F A;  2R58 A;  1YJ9 Q;  5CKD A;  2BKD N;  2K7A A;  4RTZ A;  4EMG A;  2K5F A;  1ZSZ B;  3EG3 A;  5GAM d;  1YJN T;  5GAM e;  1G3Y A;  2GBQ A;  1ZSZ A;  3WXM B;  4FYY B;  2P0P A;  4JLG A;  4CC2 A;  2KRN A;  1WHH A;  1ARK A;  4R56 A;  4E7Z A;  3I35 A;  2EFI A;  3MET A;  2DTI A;  2EIF A;  2XID A;  5GMK h;  1C0M A;  1RI9 A;  2CDT A;  3CCM T;  2COY A;  2FZC B;  1M1K U;  1K73 U;  3EHR A;  1JB0 E;  1VQP T;  1N8R C;  2KYM A;  2RQT A;  1ZSG A;  4C0G A;  3OYY A;  2VV5 A;  4FYX B;  5GAN 3;  5GAN 2;  3PGG A;  1YHQ Q;  1VQP A;  4Q5W A;  4FCY A;  4PLI A;  1Q95 G;  2BE7 D;  1VQK T;  4IIO A;  3VYH B;  2EVR A;  3ER0 A;  3GP8 A;  3URG A;  4HVW A;  1VQN Q;  3P8D A;  3D7S B;  3VU3 C;  1D0Y A;  5I22 A;  5GMK e;  5GAO r;  4O6J A;  5FWC A;  3M4Y A;  5CQX A;  2KEA A;  3CCL T;  1TTH B;  3DKM A;  1PD0 A;  1FMK A;  2V8J A;  3CMA Q;  2LDM A;  1KC8 R;  1NEG A;  4UC4 A;  4IUT A;  4J9H A;  2HSP A;  2L2P A;  2MMP A;  4C5I A;  2RD1 A;  1WXU A;  3TSZ A;  2HD0 A;  5GAN h;  3JCM W;  4MZM A;  1MNE A;  2O9S A;  1WX6 A;  3C0C A;  2LVM A;  3ZFJ A;  1KQS P;  3WVE B;  2EYQ A;  1G3W A;  2RQR A;  4E7I A;  1TSF A;  5GAO n;  4PLL A;  5AT1 B;  3FRN A;  2ZAE A;  4OMN A;  4MZP A;  4HXJ A;  1C6V X;  1DJ7 B;  1RAH B;  3TRE A;  5GAN d;  1NLP C;  1QCO A;  4Y91 A;  4J9C A;  5GAN e;  2HBW A;  5C0M A;  5FU7 C;  2XD0 A;  1NLO C;  2ZPF B;  3G71 T;  1Q82 R;  1G83 A;  4M75 E;  4OMF B;  4PK4 A;  2YHT A;  1GCQ A;  5LJ3 g;  3V7R A;  5LJ5 h;  3CCU A;  2O4X B;  2J6O A;  3NHN A;  3OSV A;  2F2W A;  5IT9 E;  1JQQ A;  5J26 A;  3CXC P;  3RBB B;  3TSW A;  1Q86 C;  3QDF A;  1VQ7 T;  2O4X A;  2FPF A;  2J6K A;  1R0C B;  2L5Q A;  2DJZ A;  4JZ4 A;  1SRM A;  2RJC A;  3A8M B;  3M57 A;  3H9N A;  2G6F X;  1CSK A;  1OX9 A;  2CZ6 B;  2DJQ A;  2ECZ A;  4E7J A;  4LN2 A;  4M7A D;  2J7I A;  3M54 A;  5LJ5 d;  4RTU A;  1M9S A;  5LJ5 e;  3DB3 A;  2KT1 A;  2KMT A;  1D09 B;  2C0O A;  1TUG B;  1X6G A;  1MMN A;  3JB9 D;  1N9S A;  1SG5 A;  1TU0 B;  4AG1 C;  2G3R A;  3I55 T;  5GAN 8;  2KT8 A;  1OU8 A;  3SFM A;  3I55 A;  1SPK A;  1R8O B;  4ZTF A;  1PD1 A;  3CPW P;  5KYN A;  4J7F A;  4HCC A;  1I07 A;  4OB3 B;  1I5L A;  2MWO A;  3FDR A;  1IRX A;  1WXB A;  2EJ9 A;  4FL6 A;  8ATC B;  3X20 B;  2FB7 A;  1BYM A;  4OVA A;  3M0S A;  2FYK A;  2WSC E;  4M77 E;  1KQS A;  1VIE A;  2JMA A;  4BI3 A;  5CKF A;  1SKU B;  4PL6 A;  2K2M A;  3U23 A;  3BW1 A;  1LCK A;  2CYZ B;  2E65 A;  1PSE A;  4M78 E;  2HBP A;  4LDV A;  3HRS A;  1M27 C;  3MCA B;  4RTV A;  1BI1 A;  2H3J A;  3QBY A;  1VQ9 Q;  2JW4 A;  3NTH A;  3EH1 A;  3AHU A;  4M7A C;  3M0T A;  3EH2 A;  2RN8 A;  4OMM A;  1RI0 A;  5IHK A;  2A36 A;  3QWY A;  2MI6 A;  2YUQ A;  5KCO A;  2RI2 A;  1Z9Q A;  4D8D A;  1GCP A;  2PZ1 A;  1ZBJ A;  1X01 A;  2DA9 A;  5EC7 A;  4JLI A;  1WPY A;  4C0F A;  2KR3 A;  5C6S A;  4Y92 A;  3REB B;  3H8Z A;  1VA7 A;  4IUV A;  9ATC B;  3A8G B;  2QI2 A;  4PJO G;  1LOJ A;  4CC3 A;  2DEU A;  3S3N A;  2R5M A;  1Y0M A;  3GNF B;  4N4G A;  5CVI A;  1QKX A;  2BUD A;  4XU3 A;  2OTJ T;  3OW2 P;  2YSQ A;  1WGS A;  4M77 A;  4HCZ A;  1VQ8 T;  3CC2 A;  2OTJ A;  4AFU C;  3VS1 A;  4ZNX A;  1IHV A;  2IVW A;  3V7S A;  3PT9 A;  2EJF A;  5DLO A;  3GF5 A;  1VQ6 T;  4GY5 A;  1UG1 A;  2D8J A;  1O9S A;  1UUE A;  4II1 A;  1M1G A;  4N4I A;  1V76 A;  3KBG A;  2KRM A;  1YJW A;  1OX8 A;  4XK8 E;  2CSI A;  1O75 A;  1Z9Z A;  1SHG A;  1GFD A;  4BY6 C;  4R55 A;  2NLU A;  1UGR B;  3A8L B;  5KE2 A;  4DBF A;  3GLX A;  2E5Q A;  4PFO A;  4JJC A;  3E19 A;  1IHW A;  4PFP A;  3SDZ A;  1UFF A;  4DBQ A;  2RHI A;  1PM3 A;  4EMH A;  1KD1 R;  2BTT A;  1NPP A;  4V2S A;  1MHN A;  4X1V A;  1W2B S;  1VYU A;  5KYU B;  1IZ6 A;  3BDL A;  1I1J A;  4XTV A;  5GAM g;  2NWM A;  3GIB A;  1SEM A;  3RER A;  1QP2 A;  2MAM A;  2ZPG B;  1YWO A;  3HP9 A;  1ZBX A;  1K8A U;  4OMO A;  2FHD A;  3JV3 A;  1YIT T;  3R6O A;  1NE8 A;  1IO6 A;  3QDR B;  3EHQ A;  1AWX A;  1PG5 B;  5M9O A;  3O5Z A;  5I11 A;  2PUK B;  1N27 A;  4K11 A;  3MP8 A;  1VQM T;  2BZ8 A;  5HY6 A;  2FO0 A;  2ROT A;  1ACM B;  1GRI A;  2VYT A;  1VQM A;  1NEB A;  2J05 A;  3VS5 A;  3HTR A;  1KQ2 A;  5AYF A;  4OB1 B;  2EGA A;  5FRO A;  3NFC A;  2DXT A;  3QZ9 B;  4RG2 A;  1JJ2 P;  3LYI A;  2GFU A;  1NJI U;  3VUB A;  3CCV T;  1M90 R;  4QW2 A;  2DL4 A;  2LQK A;  1Q81 C;  3QJ6 A;  1H8K A;  3QYH B;  5GAN 5;  1IGQ A;  2L0A A;  5KH6 A;  2COZ A;  2B86 A;  1YI2 T;  1TG0 A;  4J9I A;  2LNH B;  2DIL A;  2DPP B;  2O31 A;  3H0I A;  2L3S A;  1H3H A;  2LJ3 A;  3CCU Q;  3VS3 A;  5DLQ E;  1QVG A;  2DXC A;  2HMA A;  1W70 A;  3MHX A;  2PQW A;  4MZT A;  4M75 D;  1PCX A;  2X4W A;  4FYV B;  5GAN 6;  3EGX B;  1OPL A;  2F2X A;  4XTW A;  3SB2 A;  4C92 G;  2XDB A;  1MMA A;  3EGX A;  2QEX A;  1BI2 A;  2EQU A;  5GAN g;  2H3E B;  1GBR A;  1IGU A;  1U3O A;  1K9M R;  2MPX C;  2P4R A;  5CQY A;  4OB0 B;  2LQW A;  3RIR A;  4Y28 E;  3UDC A;  3C95 A;  2YXY A;  4FW2 A;  2RB6 A;  4DA4 A;  3I55 Q;  2P4T A;  2DXU A;  1X27 A;  4JRQ A;  3P8B B;  2LC4 A;  3SWN B;  2JTE A;  3VUZ A;  4FT2 A;  2KYB A;  2FRW A;  3FEO A;  3SWN A;  4Z89 A;  2RMO A;  1K0X A;  1TXQ A;  5LJ5 g;  4XTX A;  4LD6 A;  3LWI A;  1JJ2 A;  1T3S A;  2RK2 A;  2ZPE B;  4FSX A;  5L8R E;  4M77 D;  5GAN 7;  4M75 C;  3QG1 A;  5I21 A;  1K8A C;  4FYW B;  3EAE A;  2QK0 A;  2RK1 A;  4A4F A;  3CME A;  2GQI A;  2M51 A;  2NUT B;  1JBM A;  3HPW A;  5GJW B;  1SSF A;  4M78 D;  3QII A;  1TWB A;  1H92 A;  2HQH A;  4JPB W;  1AT1 B;  3NPF A;  1IRE B;  2A0F B;  4J5Y A;  4C0D B;  2BZX A;  1K1Z A;  2Y4Y A;  3I5S A;  3G6E T;  2JM8 A;  2EGC A;  2CP0 A;  2LCS A;  2K57 A;  2EKO A;  2RJE A;  3PVL A;  2P0Q A;  3G6E A;  4BB7 A;  2JUF A;  2HQE A;  1YIJ A;  1NJI C;  1V29 B;  4AFS C;  2E6N A;  4OML A;  1KIK A;  1I5O B;  3OS1 A;  3QKJ A;  3OYH A;  3O8V A;  3CC2 Q;  1E6H A;  2FVU A;  2OTJ Q;  2XMF A;  2SRC A;  3UA7 A;  1RAD B;  2JT4 A;  1JEG A;  3S3O A;  2CS7 A;  2KXD A;  1B07 A;  3M9Q A;  3MEA A;  4M77 C;  3DLL A;  3CCE T;  5ECA A;  3JCM Q;  1LPL A;  2ED1 A;  3L2Q A;  2DLP A;  1YJW Q;  3CCE A;  2DRM A;  1YJN A;  1G3T A;  1M2V B;  2R57 A;  3FJP A;  4M78 C;  4JJN K;  2VXF A;  4PJO B;  5GAO q;  1M2V A;  4J83 A;  2EQJ A;  4M4Z A;  4EMK B;  2L3Q A;  3EG0 A;  2VAS A;  4PJO A;  3JCM h;  4XU1 A;  3CCS T;  4D6W A;  5DM7 R;  3A1P A;  4EMK A;  3CCM A;  3HRU A;  1RAF B;  4L6V 5;  2QAS A;  1VQO T;  1M90 U;  3RKX A;  3VYG A;  3CCS A;  3J7A F;  4ZGD B;  2DKG A;  2KAF A;  1PKT A;  3J81 E;  1S1N A;  1VQO A;  3CC7 T;  2E10 A;  1QCF A;  1OZ3 A;  1VQK A;  2EQI A;  2FZK B;  2MCN A;  2RNA A;  3M55 A;  1KJW A;  2VKN A;  4QQ6 A;  4AFZ C;  1AVZ C;  3CC7 A;  3M59 A;  3QHS A;  3TQ7 P;  3JCM d;  4JDS A;  3JCM e;  4HCK A;  1UE9 A;  3M0R A;  2DD4 A;  2RHY A;  1N6A A;  2CSQ A;  4AFQ C;  2YRD A;  3OYI A;  4AMC A;  3CCL A;  1C1A A;  1Y71 A;  1BU1 A;  3WVD B;  2DFU A;  4XU2 A;  1NG2 A;  1GL5 A;  1N5Z A;  1BIA A;  1U06 A;  2DIQ A;  1WXT A;  3JB9 J;  3OBY A;  1OEB A;  3V8J A;  3RR6 A;  3OYF A;  1K9M U;  3JAM E;  2B8A A;  4FT4 A;  4X9C A;  3QYG B;  1K4U S;  3RMS A;  2GTJ A;  2LCL A;  3JSC A;  1KK7 A;  2HNI A;  2XKO C;  3MEW A;  3EGU A;  2JNG A;  1QVF S;  2HKQ B;  1RAI B;  2DVE A;  4BD3 A;  1RLQ C;  1ZA2 B;  5D7U A;  1RL2 A;  3CEY A;  3MEV A;  2OTL T;  2AK5 A;  1W1F A;  3G71 A;  5KYW B;  2GGR A;  2LMJ A;  1AWJ A;  2CP3 A;  4AT1 B;  4ZN1 A;  1HYO A;  3EGD B;  4LDW A;  1HJD A;  3OA6 A;  5KYW A;  3CCR T;  2YLC A;  5CKE A;  1TOV A;  4C92 E;  1VQ7 A;  2DNU A;  4BDZ A;  1W2B P;  4KGX B;  1VQ4 T;  1SF9 A;  1VIF A;  2CZ7 B;  4JZ3 A;  3J80 E;  1G8X A;  1WIE A;  3CBO A;  1LJO A;  2VVK A;  3LGF A;  4KH1 B;  2QEX Q;  2D0N A;  1R0B G;  1VQ4 A;  3QUI A;  4D8K A;  1UGP B;  2KBT A;  2LP5 A;  2FRY A;  5IAY A;  2DL7 A;  2PNI A;  1M30 A;  4M7A G;  1IB8 A;  1R77 A;  1UGQ B;  1WFW A;  2HEQ A;  1HSQ A;  5FU6 C;  3E1S A;  2KK4 A;  1Q7Y R;  2LQN A;  2JVV A;  4CC4 B;  5CAI A;  1MV3 A;  2ZPH B;  3JCM b;  5GMK l;  4PJO F;  2LQ8 A;  4QVC A;  2HSE B;  2D6F A;  1M1K C;  1K73 C;  3H6Z A;  3EFS A;  2YUP A;  1FMW A;  3PFS A;  4CI0 C;  4F16 A;  3QXE B;  1ZA1 B;  3V8K A;  2VGN A;  3NMZ C;  2RHX A;  1A0N B;  1WHL A;  3C12 A;  3JB9 I;  1WQW A;  2RH2 A;  2F69 A;  4C92 B;  5J3B A;  1ABO A;  1PKS A;  2A28 A;  1PNJ A;  1T3L A;  4C92 A;  1H64 1;  2ZGW A;  4N0A A;  2K5L A;  4JJB A;  3JB9 H;  4ELY C;  4NS5 A;  4QVD A;  2XK0 A;  2LJ0 A;  1UGV A;  3CME Q;  1FYN A;  4LUE A;  4BAC A;  5A0G A;  1WJR A;  4BDY A;  2DRK A;  1V1C A;  2L8D A;  2M1H A;  3A98 A;  1BK2 A;  2JS0 A;  2Z0W A;  3CXC A;  4B9W A;  2V8I A;  4OGC A;  2QQS A;  3FLG A;  1WHG A;  2XDP A;  2E12 A;  4IUP A;  4X9D A;  3OQ5 A;  1N8R R;  4M7D G;  1AOJ A;  1NBE B;  2MF2 A;  1EZZ B;  1AZG B;  1BI3 A;  1W2B A;  1VQL T;  4C8Q F;  5LJ3 j;  5HK0 A;  3G6E Q;  1VUB A;  2CH4 W;  1YIJ Q;  2ZCF B;  4VUB A;  2AKL A;  2ZPB B;  1AD5 A;  1Y96 B;  2DET A;  5LJ3 f;  5CKB A;  2E70 A;  1VQ8 A;  1Y96 A;  2XU8 A;  2X4X A;  4J9B A;  2KNB B;  4PNO A;  3G1J A;  3CPW A;  2QAZ A;  4OF1 A;  1W4S A;  3RKW A;  4A4E A;  1OZ2 A;  2MIO A;  1VQ6 A;  2RHZ A;  1TS9 A;  4NL2 A;  3OYN A;  3TVT A;  1NYG A;  3M0Q A;  3UPU A;  2ED0 A;  1KC8 U;  1CKB A;  3CCE Q;  1YJN Q;  1JXM A;  3GBQ A;  1GFC A;  4EDU A;  2EYX A;  3T9N A;  4RMO A;  3OB9 A;  3VS7 A;  3EG1 A;  2AHJ B;  2W10 A;  5I2S A;  3VS6 A;  4ESR A;  2KVQ G;  1TUD A;  2YUO A;  2DTH A;  1ZSZ C;  2OJ2 A;  1QW1 A;  3OYG A;  2GCX A;  3L42 A;  4BUG A;  2J6F A;  1U1S A;  2JJ9 A;  3CCM Q;  1K76 A;  1OQK A;  1VQP Q;  3CCS Q;  4C8Q G;  2DBM A;  6AT1 B;  1OI1 A;  1XQH A;  1M3C A;  1NM7 A;  5KYU A;  5IHI A;  2LCC A;  4C5G A;  1TUC A;  1VQO Q;  3BFM A;  1VQK Q;  5KCH A;  4HT9 A;  3HSB A;  2V1R A;  2JXB A;  2RI3 A;  2M16 A;  4HA8 A;  1Q82 U;  1Q86 R;  4KGZ B;  4Z8A A;  3CC7 Q;  3M0P A;  4LD9 K;  4J6W A;  3ZL7 C;  5CR2 A;  2I0N A;  3QWX X;  1YIT A;  2EWN A;  3CCL Q;  4C92 F;  2QXF A;  3RKY A;  1FWZ A;  4GLM A;  1WNL A;  4ATO A;  3MO8 A;  3OW2 A;  2EYY A;  3MP1 A;  4KH0 B;  4X34 A;  1D3B B;  2D9T A;  2NUP B;  1E7O A;  1EIF A;  1D3B A;  2RJD A;  3GPL A;  1ZLM A;  2RPN A;  1RAB B;  2ZZD A;  2DIG A;  3JCM g;  1U5S A;  3EG9 B;  2MYS A;  4KUI A;  1HXD A;  5FU7 B;  3L2U A;  4BE0 A;  3CCV A;  2DD5 A;  4PKC C;  3EG9 A;  2LT4 A;  3S6W A;  5GMK m;  3LX7 A;  4IUQ A;  3E2U A;  5FWB A;  5CK9 A;  2R5A A;  1YI2 A;  2E41 A;  2K9G A;  3PMI A;  2IPO B;  5EG2 A;  1M4Z A;  3G71 Q;  1M3B A;  3E9G A;  4O5V A;  2L3P A;  3LGL A;  4GBQ A;  1WA7 A;  2X51 A;  2K5I A;  2O2O A;  1VQ7 Q;  1M8M A;  2RQU A;  1GCQ C;  1TH7 A;  3OS2 A;  3CBM A;  1OOT A;  1BIB A;  4RTW A;  4M75 G;  2CKK A;  1BCM A;  4FIB A;  8AT1 B;  3JCM X;  1OPK A;  1PRL C;  3UAT A;  5CCA A;  1VQ4 Q;  4ANJ A;  4C92 D;  1VQ5 T;  3JCM c;  4ZTJ A;  3QPH A;  2DK3 A;  3KUF A;  4JJD A;  4DOW A;  3JCM J;  5KYY B;  3VS0 A;  1VQ5 A;  1KC8 C;  1ABQ A;  4DOV A;  2CT4 A;  2VWF A;  2FZG B;  2YRC A;  1UGS B;  5KYY A;  5GAM j;  2DTO A;  3L2R A;  2CH4 A;  2WSF E;  1QKW A;  1KHI A;  2LZ6 B;  3C94 A;  1N8R U;  1X6O A;  3ME9 A;  4KBM B;  3OY9 A;  4RCC A;  1KQ1 A;  4R0K A;  1UEC A;  1HD3 A;  2LJ1 A;  5GAM f;  3VS4 A;  1KG1 A;  3QSU A;  2E1H A;  3CD6 T;  1K9A A;  3M4G A;  2F5T X;  2E64 A;  1W6X A;  4ORZ A;  2SEM A;  2CUB A;  3BY7 A;  1E6G A;  5CO7 A;  3CD6 A;  4XTU A;  2GFA A;  4LXC A;  2ATC B;  1AZE A;  3LH5 A;  1MGQ A;  4XTZ A;  3AT1 B;  3PVQ A;  3MKD A;  4HVV A;  5IXF A;  4M7A B;  3G4S T;  1Q82 C;  1ZX6 A;  4WTO B;  1AWW A;  4J8O A;  1FX7 A;  3ULR B;  2JMC A;  3G4S A;  3EFR A;  4M7A A;  2XI9 A;  5CIU A;  4QKU A;  2BIV A;  5GAO p;  1QVG S;  1QVF P;  2CGH A;  5GMK j;  1X69 A;  2NUT A;  3OBW A;  4DEY A;  4PJN A;  2QGG A;  3I9Q A;  4Z88 A;  2HZY A;  1VQ9 T;  2VC8 A;  4C92 C;  3MJX A;  4N0A C;  4MML A;  4M7D E;  4M78 G;  3CCQ T;  4J9G A;  4RTY A;  1M5Q 1;  3OSS C;  1G5V A;  4PJO E;  4L5G A;  3OMC A;  1OU9 A;  3CCQ A;  1RAE B;  3FIF A;  5GAN 4;  1PSF A;  2QDL A;  1KD1 U;  3ASK A;  2QG9 B;  5I2M A;  1NPR A;  1KFZ A;  2KRS A;  1M2O A;  2RJF A;  2X3X D;  1UB4 A;  3MEU A;  4DBR A;  2EBP A;  1VQ8 Q;  1UHF A;  1Y07 A;  1HK9 A;  2A3L A;  4KGV B;  4KUL A;  2WSE E;  3A8O B;  1WHJ A;  2QA4 T;  5GAN j;  3HFO A;  1Q86 U;  3RUX A;  2GQV A;  3NTK A;  2L3R A;  2KY9 A;  3X26 B;  2CZ1 B;  2DER A;  1MMG A;  4LE9 A;  1UEB A;  4BY6 B;  2QA4 A;  1LVK A;  2AKK A;  1VQ6 Q;  1D0X A;  1NZ9 A;  4M7D B;  2RM4 A;  2EKH A;  5GAN f;  3R6N A;  1QLY A;  3CPF A;  3DB4 A;  4Z02 A;  4F7U G;  5IH2 A;  2YLB A;  3M56 A;  2XHC A;  4M7D A;  4WF2 A;  3X24 B;  1QVP A;  1UJ0 A;  4RCB A;  1Q81 R;  2OAW A;  4C8Q E;  2XG8 D;  3HL8 A;  3SD4 A;  2KDS A;  3DLM A;  5LJ5 j;  2JTM A;  3IQL A;  1QVF A;  2J06 A;  4QQG A;  3VRY A;  2E3I A;  5LJ5 f;  2M02 A;  3CCJ T;  2DZ9 A;  2JS2 A;  2V26 A;  4ZGJ B;  1X6B A;  4OB2 B;  2A37 A;  3X25 B;  2QTX A;  3CCJ A;  1K0S A;  1QWE A;  1QQJ A;  3Q1J A;  2QQB A;  1JRI A;  2DYB A;  2JTF A;  1YIT Q;  4A53 A;  2QQA A;  1S72 T;  2EJG A;  5L23 A;  2I2L A;  1BCO A;  1ZQ1 A;  1S72 A;  1ZUK A;  2FEI A;  1JO8 A;  4A4H A;  1WDX A;  1VQM Q;  4PFZ A;  4M7A F;  3L2W A;  2K3Y A;  3E9F A;  1U8R A;  2PVD B;  4C8Q B;  4PJM A;  3FC3 A;  4E7S A;  4LNP A;  3JB9 F;  2FG0 A;  2KSS A;  1B34 B;  1MUZ A;  3LLR A;  1I8F A;  4C8Q A;  1B7T A;  3I56 T;  2MOX A;  3PMT A;  2HCK A;  2EQK A;  2ENM A;  2KXC A; 
#chains in the Genus database with same CATH homology
 1AZG B;  2DE0 X;  2X3W D;  2DL4 A;  2DM1 A;  2F2V A;  2HDA A;  1ZUU A;  2YT6 A;  2CH4 W;  3VS2 A;  4LUD A;  1H8K A;  2EPD A;  2L0A A;  1UDL A;  2AKL A;  1AD5 A;  1B3Q A;  2B86 A;  2DBK A;  1TG0 A;  4J9I A;  2D8H A;  2LNH B;  2DIL A;  2YDL A;  5FW9 A;  2GNC A;  4HVU A;  2O31 A;  3H0I A;  3THK A;  1QWF A;  1ZUY A;  2L3S A;  1H3H A;  2LJ3 A;  2O88 A;  3VS3 A;  4J9B A;  2KNB B;  2PTK A;  1T0J A;  2EYZ A;  1W70 A;  2ROL A;  2DF6 A;  4FSS A;  4F14 A;  2K7A A;  4RTZ A;  1OPL A;  2F2X A;  2MIO A;  3TVT A;  3SEM A;  2K3B A;  1NYG A;  3M0Q A;  3EG3 A;  4J9E A;  2ED0 A;  1CKB A;  4AG2 C;  1JXM A;  3GBQ A;  1GFC A;  4QT7 A;  1VYT A;  2GBQ A;  1GBR A;  2EYX A;  3REA B;  1U3O A;  2P4R A;  3VS7 A;  2LQW A;  4CC2 A;  2KRN A;  3EG1 A;  2W10 A;  2CUD A;  3NGP A;  3VS6 A;  1ARK A;  4ESR A;  1TUD A;  2YUO A;  2K6D A;  3I35 A;  2OJ2 A;  4J9D A;  1RI9 A;  2CDT A;  2J6F A;  1K76 A;  1X27 A;  2H8H A;  3EHR A;  2JTE A;  1JXO A;  2KYM A;  2RQT A;  1ZSG A;  1AWO A;  2DBM A;  2KYB A;  2FRW A;  1M3A A;  1M3C A;  5HCK A;  1NM7 A;  1RLP C;  5IHI A;  1TUC A;  2KGT A;  2V1R A;  4IIO A;  1WI7 A;  2JXB A;  4Z89 A;  2EVR A;  2RMO A;  1K0X A;  2JM9 A;  4E6R A;  3M0U A;  4Z8A A;  4HVW A;  3M0P A;  3ZL7 C;  2EYW A;  2I0N A;  5I22 A;  1T3S A;  3UA6 A;  3QWX X;  2DL8 A;  5FWC A;  2KEA A;  3PE0 A;  3I5R A;  2M0Y A;  4GLM A;  1FMK A;  2GQI A;  2M51 A;  2KE9 A;  2EYY A;  1NEG A;  1PRM C;  4J9H A;  5GJW B;  1WLP B;  2V1Q A;  2HSP A;  2L2P A;  1X2Q A;  1H92 A;  1E7O A;  1WXU A;  3TSZ A;  4JPB W;  2DVJ A;  2O9S A;  3NPF A;  1WX6 A;  3C0C A;  1ZLM A;  2RPN A;  2BZX A;  1K1Z A;  1U5S A;  2ABL A;  3I5S A;  2IIM A;  2JM8 A;  2RQR A;  2EGC A;  2LCS A;  2C0T A;  1SRL A;  3PVL A;  4OMN A;  4HXJ A;  2YUN A;  2FPE A;  5FWB A;  4AFS C;  1NLP C;  4OML A;  4J9C A;  2O9V A;  2HBW A;  1KIK A;  2K9G A;  3SHW A;  1M3B A;  1CKA A;  1NLO C;  1I0C A;  1G83 A;  1E6H A;  1GCQ A;  2A08 A;  2L3P A;  4GBQ A;  2J6O A;  3NHN A;  2XMF A;  4KRT A;  2F2W A;  1WA7 A;  2SRC A;  3UA7 A;  1JQQ A;  3RBB B;  3TSW A;  2JT4 A;  2O2O A;  1JEG A;  2KXD A;  1M8M A;  1B07 A;  2RQU A;  1GCQ C;  2FPF A;  2J6K A;  1OOT A;  4JZ4 A;  1SRM A;  1WYX A;  4RTW A;  2GTO A;  5ECA A;  2G6F X;  1CSK A;  2EGE A;  2DJQ A;  2ECZ A;  1OPK A;  2ESW A;  1PRL C;  3UAT A;  2ED1 A;  4OMP A;  4LN2 A;  2DLP A;  2DRM A;  2J7I A;  4JJD A;  1UTI A;  4RTU A;  3VS0 A;  1ABQ A;  2KT1 A;  2FPD A;  3FJ5 A;  2C0O A;  1VYV A;  2CT4 A;  2VWF A;  1X6G A;  1SSH A;  4M4Z A;  4AG1 C;  5IXB A;  2L3Q A;  3EG0 A;  2CH4 A;  2KT8 A;  1QKW A;  4RTT A;  5IHN A;  2LZ6 B;  1KSW A;  1SPK A;  1PWT A;  2EW3 A;  4R0K A;  1UEC A;  1HD3 A;  2LJ1 A;  3UF4 A;  3VS4 A;  1I07 A;  1K9A A;  1G2B A;  1WXB A;  1PKT A;  1W6X A;  1S1N A;  4ORZ A;  1QCF A;  2SEM A;  2CUB A;  3EG2 A;  1E6G A;  2EQI A;  2MCN A;  2RNA A;  3M0S A;  5GJV B;  1BBZ A;  1KJW A;  2VKN A;  3VRZ A;  4AFZ C;  1AVZ C;  4WCI A;  1AZE A;  3LH5 A;  2RQV A;  2JMA A;  1YP5 A;  4HCK A;  2CT3 A;  1UE9 A;  3PVQ A;  3M0R A;  4HVV A;  5IXF A;  2CSQ A;  2K2M A;  3U23 A;  4AFQ C;  1ZX6 A;  2AZS A;  1LCK A;  1AWW A;  3ULR B;  2JMC A;  1BU1 A;  1M27 C;  2LX7 A;  4EIK A;  3CQT A;  4RTV A;  1X69 A;  2D1X A;  4DEY A;  2C0I A;  1NG2 A;  3I9Q A;  4Z88 A;  1GL5 A;  1N5Z A;  2JW4 A;  1GBQ A;  1U06 A;  1WXT A;  3M0T A;  1YNZ A;  2RN8 A;  4OMM A;  2K79 A;  5IHK A;  4J9G A;  2A36 A;  1X43 A;  3QWY A;  4RTY A;  1OEB A;  2YUQ A;  1Z9Q A;  1UHC A;  1X2K A;  4D8D A;  1GCP A;  2OI3 A;  2PZ1 A;  1ZBJ A;  2DA9 A;  5EC7 A;  4A63 B;  2NUZ A;  1AEY A;  2KR3 A;  2DX1 A;  4Y92 A;  3REB B;  3H41 A;  1K4U S;  2QDL A;  2GTJ A;  1VA7 A;  1J3T A;  3RNJ A;  3EGU A;  1YN8 A;  1KFZ A;  2DL3 A;  2KRS A;  4CC3 A;  1RLQ C;  1Y0M A;  2X3X D;  1QKX A;  2EBP A;  2YSQ A;  1NYF A;  2AK5 A;  3KFV A;  1W1F A;  1UHF A;  2GGR A;  2LMJ A;  2KRO A;  4IIM A;  2BZY A;  1AWJ A;  4AFU C;  3VS1 A;  4ZNX A;  4F17 A;  4RUG A;  1HJD A;  4LE9 A;  2DNU A;  2AKK A;  1OV3 A;  1UG1 A;  2D8J A;  2EKH A;  4JZ3 A;  1WIE A;  3R6N A;  1QLY A;  1UUE A;  2VVK A;  1YCS B;  5IH2 A;  2D0N A;  2RQW A;  4D8K A;  1RUW A;  2KRM A;  4OMQ A;  1T0H A;  2KBT A;  2LP5 A;  2CSI A;  2FRY A;  2DL7 A;  2PNI A;  1M30 A;  1Z9Z A;  1SHG A;  1UJ0 A;  1GFD A;  1WFW A;  2HEQ A;  1HSQ A;  2OAW A;  4JJC A;  2E5K A;  2LQN A;  4CC4 B;  1BB9 A;  1JU5 C;  1MV3 A;  1UJY A;  3IQL A;  1UFF A;  2BTT A;  2J06 A;  4X1V A;  1XOV A;  1VYU A;  3VRY A;  2YUP A;  4F16 A;  2RF0 A;  2JS2 A;  1I1J A;  2NWM A;  3NMZ C;  1X6B A;  4DEX A;  1A0N B;  2A37 A;  1YWP A;  1SEM A;  1K0S A;  1QWE A;  1YWO A;  1ABO A;  1PHT A;  2DYB A;  1PKS A;  4OMO A;  3H0F A;  2A28 A;  1PNJ A;  3JV3 A;  1T3L A;  2CRE A;  1IO6 A;  3EHQ A;  2W0Z A;  1AWX A;  3H0H A;  4JJB A;  5L23 A;  3O5Z A;  5I11 A;  4RTX A;  2LJ0 A;  1UGV A;  1SHF A;  1ZUK A;  1FYN A;  2DMO A;  2FEI A;  4K11 A;  4LUE A;  1JO8 A;  1WDX A;  2BZ8 A;  2FO0 A;  1EFN A;  2ROT A;  2DRK A;  4J9F A;  1V1C A;  1GRI A;  1BK2 A;  3A98 A;  1NEB A;  2J05 A;  3VS5 A;  2JS0 A;  4LNP A;  2FG0 A;  2DL5 A;  1MUZ A;  2EGA A;  1Y57 A;  4CC7 A;  1MV0 B;  2MOX A;  2AZV A;  1AOJ A;  2HCK A;  2ENM A;  2KXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...