2YUQA

Solution structure of the sh3 domain of human tyrosine-protein kinase itk/tsk
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
85
structure length
85
Chain Sequence
b'GSSGSSGEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Solution structure of the SH3 domain of human Tyrosine-protein kinase ITK/TSK
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 85
sequence length 85
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yuqA01
2O2OA 2LZ6B 1ZSGA 4ZNXA 1AOJA 1K0XA 2AKKA 2ECZA 2CSIA 4GLMA 5FW9A 4JZ3A 4E6RA 2DMOA 1X27A 4RUGA 1ZUYA 1H3HA 4AFUC 1UECA 3FJ5A 1CSKA 5ECAA 2OI3A 2ED1A 2LP5A 3O5ZA 2EQIA 3QWXX 1AWOA 1UG1A 2CT3A 2FRYA 2JMAA 3NPFA 2LJ0A 4J9IA 2NWMA 1I1JA 4X1VA 3R6NA 2M0YA 2J6OA 1ZX6A 2JS0A 2JT4A 1OOTA 2DYBA 5IXFA 1CKAA 2KRNA 2EBPA 1CKBA 1J3TA 2HDAA 2AZSA 1WLPB 4QT7A 3U23A 4EIKA 5IH2A 1GL5A 5IHNA 2YT6A 4ORZA 3I5SA 2SRCA 2W0ZA 3H0HA 1Z9QA 1S1NA 3KFVA 4D8DA 1X2KA 1KFZA 2ROLA 1YWOA 1GFDA 1K1ZA 4J9GA 2JXBA 3VS1A 2FRWA 2GGRA 3RNJA 2GTJA 2YUNA 3TSWA 1TUCA 1B3QA 1SPKA 5FWBA 4RTVA 2GNCA 1GCQC 1EFNA 3QWYA 2EGCA 4J9DA 1I07A 1M8MA 2DF6A 2RQUA 1QKWA 1T3LA 1NG2A 1WDXA 2L3QA 2J7IA 1SEMA 1ABQA 1LCKA 1RLQC 1WXUA 2CREA 2RMOA 2RQTA 1ZLMA 3UATA 1TG0A 4KRTA 2PTKA 1G2BA 2KYBA 2VWFA 2EVRA 4RTWA 4AFSC 2FEIA 3PVLA 2FPEA 4OMPA 2CT4A 1G83A 2F2WA 2CH4W 3H0IA 1YNZA 1TUDA 2ED0A 2EYXA 3M0SA 2CUDA 5EC7A 2EW3A 2I0NA 3VRZA 2K79A 2L3PA 2O88A 2HCKA 1ZUKA 2DE0X 2CSQA 1AVZC 2A37A 2L3SA 1X6GA 3M0QA 4JZ4A 2BZXA 3M0TA 1QWFA 1Y57A 2K3BA 1N5ZA 1VYVA 1UE9A 1BBZA 2K2MA 2RQVA 2DVJA 1JU5C 1T0JA 4FSSA 2JTEA 3REBB 1GBRA 4RTUA 4ESRA 3I5RA 2J6FA 1BK2A 4HCKA 4WCIA 3ZL7C 3VS5A 1X43A 2X3XD 2D8HA 3IQLA 1MV0B 2ENMA 2BTTA 2L2PA 4OMQA 3NGPA 1PRLC 2DM1A 4Z8AA 3TSZA 1FMKA 4F16A 5HCKA 2RPNA 4HVUA 2A28A 2RQRA 5I22A 4J9CA 1PNJA 1AZGB 2GBQA 2DILA 2F2VA 1AZEA 3UA7A 1OV3A 4D8KA 1NLPC 3RBBB 1RLPC 2H8HA 1VYTA 2J05A 2DBKA 2KR3A 3M0RA 2KRMA 1PWTA 1YN8A 5IXBA 2LQWA 3UA6A 2LNHB 4AFZC 2RNAA 3VS2A 1I0CA 1AWWA 2DA9A 2XMFA 2DJQA 3VRYA 2D8JA 5FWCA 2LQNA 4LUDA 4HXJA 1M3AA 3EG1A 1JXMA 1KSWA 1WYXA 2DL7A 2W10A 2KT1A 2EGAA 3EG3A 3EG2A 3VS3A 1WX6A 3VS0A 2JW4A 1NEBA 1W1FA 1QWEA 2KT8A 4AFQC 2C0TA 2MIOA 4DEXA 2C0OA 3H0FA 1PRMC 3VS4A 2C0IA 2DLPA 2DX1A 4DEYA 1SRLA 2GTOA 2RQWA 1UFFA 3PVQA 1AD5A 4J9BA 1GCQA 1K9AA 1SSHA 2CUBA 1YWPA 4OMMA 1GFCA 2DL3A 2NUZA 2VKNA 1U3OA 1XOVA 1NEGA 3M0UA 3C0CA 1X2QA 2EYWA 2SEMA 3SEMA 4F17A 2EYZA 1OEBA 1UDLA 4OMOA 2CDTA 4AG1C 4JJBA 1BU1A 1MUZA 2A36A 2HEQA 4Y92A 2B86A 1JQQA 4JJDA 1QCFA 4OMLA 2K7AA 4RTZA 2JM8A 2A08A 4CC7A 4RTTA 2LCSA 2PNIA 4HVWA 4JJCA 1UHFA 1E7OA 3JV3A 1VYUA 1ZBJA 4J9FA 1K4US 1AEYA 3LH5A 1X69A 1NM7A 2LJ3A 2O31A 1SHGA 2YUOA 5GJVB 1M27C 2L0AA 1NYGA 2YDLA 2DRKA 1U06A 2ROTA 1WIEA 1M30A 2EYYA 1PKTA 1K0SA 1BB9A 1KJWA 4OMNA 1X6BA 1W70A 2CH4A 3I9QA 3H41A 4JPBW 1PHTA 1UJ0A 2ABLA 3REAB 5I11A 1AWXA 2FO0A 4A63B 2RF0A 2E5KA 1OPKA 2IIMA 2HSPA 2F2XA 1U5SA 1FYNA 2YUPA 1QLYA 1E6HA 1Y0MA 2MOXA 2BZYA 2P4RA 3EG0A 3PE0A 4M4ZA 1RI9A 3VS7A 2DRMA 4IIOA 4LNPA 2K9GA 2KRSA 2YSQA 2EPDA 2FPDA 3GBQA 2JMCA 2D1XA 2BZ8A 1JEGA 2J6KA 5L23A 1UUEA 1JXOA 1M3CA 2DNUA 2KYMA 3NMZC 1B07A 1YCSB 2KXCA 4RTXA 1E6GA 1HD3A 1GBQA 2RN8A 1UJYA 2LX7A 1ZUUA 3EHRA 3CQTA 4F14A 2PZ1A 1WI7A 4R0KA 4CC4B 3SHWA 1SRMA 2AKLA 2FG0A 4LE9A 1Z9ZA 2AZVA 2LJ1A 2V1RA 2KNBB 1GRIA 1MV3A 1V1CA 1ARKA 2AK5A 3A98A 5IHIA 2KXDA 2X3WD 2JS2A 4CC2A 2ESWA 1A0NB 1JO8A 1GCPA 1WXBA 4CC3A 2KROA 4LUEA 1IO6A 2O9SA 3THKA 4Z89A 2KGTA 2GQIA 2KEAA 2D0NA 3NHNA 1RUWA 1WXTA 1W6XA 1HJDA 3I35A 5IHKA 1OPLA 3UF4A 1T0HA 1T3SA 1KIKA 4HVVA 1HSQA 3VS6A 1M3BA 2FPFA 2MCNA 2OAWA 4J9EA 2VVKA 4K11A 1QKXA 2OJ2A 2O9VA 1YP5A 2EKHA 4AG2C 3ULRB 2LMJA 1AWJA 4IIMA 4LN2A 4J9HA 2DL8A 2KE9A 3EHQA 2DL4A 2M51A 4GBQA 2QDLA 1UTIA 1UHCA 2EGEA 2K6DA 4RTYA 2V1QA 1K76A 1H92A 1WA7A 1ABOA 2HBWA 2JM9A 5GJWB 1NYFA 1WFWA 3M0PA 2DL5A 2G6FX 4Z88A 2J06A 3TVTA 2DBMA 1H8KA 1UGVA 1SHFA 2KBTA 1PKSA 1NLOC 1VA7A 2YUQA 3EGUA
chains in the Genus database with same CATH superfamily
1IRXA 3CC7Q 4ZNXA 1AOJA 4M78D 2ECZA 5FW9A 2RJFA 2DMOA 4C92E 1H3HA 4AFUC 3FJ5A 5FU6C 3JCMW 1CSKA 1MNEA 2ZPBB 2ED1A 2QTVA 2QQ9A 3M4GA 1AWOA 1UG1A 2CT3A 1RAHB 2NLUA 3NPFA 2YRCA 2NWMA 1KQSS 2OTJQ 5CIUA 2C06A 2M0YA 2J6OA 1ZX6A 3MPUB 1M1FA 5IXFA 3OSVA 3HRSA 3E9FA 2KRNA 2YLBA 4PL6A 3HL8A 3CMAT 2HDAA 2PUKB 3SFMA 5IH2A 2DKGA 1GL5A 1R0BG 2YT6A 3MP8A 1KK7A 1VQMA 2EIFA 3BE3A 2DJZA 4YTLA 2SRCA 1Z9QA 3M4YA 1S1NA 4KBMB 4M75G 1VQKA 3ER0A 1X2KA 1KFZA 2XDPA 4N4GA 5LJ3g 1YIJQ 2DXCA 5GAMj 1YJNT 4OGCA 4M75D 2K5FA 2X4YA 4M77B 4C5IA 4E7KA 1SPKA 1MNDA 1N9RA 3QWYA 1Q82R 4GLKA 3I56T 2RQUA 4JDSA 1T3LA 2L3QA 1WDXA 4F7UF 2J7IA 2BE7D 1WXUA 5GANd 2CREA 2RQTA 4M7AF 1KC8C 4ZTFA 4N4IA 3MHXA 3JB9G 2VWFA 2EVRA 4RTWA 3RIRA 4AFSC 3PVLA 2CH4W 2JJ9A 1YNZA 1TUDA 3PNWC 5LJ5j 3UWNA 4E7ZA 3JB9D 1QVGS 3CBOA 3R6OA 1M1KC 2K79A 3JCMe 3CC4Q 4XTWA 2DFUA 2L3RA 3H9NA 3V7RA 2R57A 5LJ3d 4C92G 1KC8U 3CCUQ 2K3BA 2JTMA 3QUIA 2RI5A 1UGSB 2K2MA 3DLLA 3UPUA 2DXUA 3C4SA 4C92D 3EH1A 2LC4A 3G4ST 4RTUA 1M1KU 3PTAA 3I5RA 2VUBA 5CKBA 5GAOm 1ZSZA 3CCEQ 3ZL7C 2XI9A 2X3XD 1QVFS 4PJOG 3HTRA 4Z8AA 1VQ8Q 2B8AA 1FMKA 4F16A 2RQRA 1I81A 3VYGA 4PJOD 3G6ET 1AZGB 1VQOA 3GLXA 4FSXA 1QCOA 1R77A 4AMCA 2F2VA 2L89A 2ZPHB 1D3BA 3OSSC 4M78C 4D8KA 1NPPA 2E70A 1KQ1A 4HKEA 4OP0A 2H8HA 1VYTA 2D6FA 4M77F 1VQ4Q 4BDZA 2K5LA 3WVEB 1FMWA 2DTOA 2LNHB 4JRKA 3LWIA 3CXCP 2X4XA 5GAOl 1BI3A 1ZA2B 3MP6A 4FIBA 1VQNT 2HKQB 3M55A 4LUDA 3CCVT 3EG1A 3EFOA 2P0PA 1K9MR 4C0GA 5GAMf 1PCXA 3MEUA 2EGAA 2XDDA 2KI7A 1IHVA 4MZPA 3VS0A 2JW4A 4AFQC 2C0TA 5DM7R 2E6ZA 2MIOA 3CMET 5HK0A 3VS4A 2QASA 3AT1B 4JS5A 5KYNA 1HXDA 1B34A 2GTOA 1SSFA 4IUVA 1ZA1B 2OTJA 1AD5A 4J9BA 3OYCA 3OQ5A 4IUUA 2CUBA 1YWPA 1TUGB 2VKNA 1U3OA 3M0UA 1NEGA 3C0CA 1X2QA 3OYFA 4FYYB 1OEBA 3J80E 1UDLA 4ATOA 2XIDA 5M9OA 2MK5A 1VQ6Q 3OBWA 3V7SA 2A36A 1JB0E 3L2WA 4JJDA 4OMLA 3SDZA 4RTZA 3QKJA 4JS4A 4HVWA 1YJ9Q 1UHFA 3OYJA 4DOVA 1YJWT 4J9FA 2JVVA 1NM7A 2LJ3A 1VQ9A 2E3HA 1NYGA 2DRKA 2ROTA 3UT1A 3CXCA 2ZPEB 1D1CA 1X6BA 2HQXA 4MDWA 3O8VA 1PHTA 3URGA 1TWBA 1G8XA 3M54A 1AWXA 1ZSZC 2A7YA 3DB3A 3LGLA 1I8FA 4LD9K 4RG2A 3CPWP 2F2XA 3CCRQ 1FYNA 1Y0MA 2MOXA 1LOJA 1AHJB 4C92C 5FU6B 5GAN8 3EG0A 2M02A 3VS7A 4V2SA 5FRMA 3M56A 5CVIA 1G3YA 4IIOA 3E2UA 1VQPA 5I21A 1G3WA 2CZ6B 3GBQA 4KUIA 1IZ6A 3CC4A 3OYLA 2X4JA 3NTIA 4OVAA 2QEXA 3G1JA 4DBFA 4BE1A 5L23A 2JN0A 1UUEA 3VYHB 3C12A 2EQJA 1JXOA 1M3CA 2KYMA 4M7DG 1B07A 1VQMT 2O01E 4PJOC 4RTXA 2O4XB 2HKNA 3LGFA 4ZTJA 4UC4A 4J6WA 1VQKT 3EHRA 3CQTA 2PZ1A 2F5KA 3JB9I 1Q82C 3CBMA 2AKLA 3EGDB 4M7DD 3JAME 2V1RA 2CP0A 2KNBB 1GRIA 3FLGA 4L6V5 4A53A 3CCEA 2AK5A 3A98A 3CD6Q 1BKBA 5IHIA 2JS2A 4LDXA 2ESWA 4B9WA 5IN1A 4ZGJB 1Y71A 5I2MA 4FU6A 4Q5WA 1WQ7A 4LUEA 3THKA 1Q82U 2GQIA 1W4SA 4M7DA 1K8AR 1RUWA 1WXTA 2BKDN 3M53A 3A8HB 3VUBA 2CP5A 5HY6A 3N5BB 3CBPA 5HK3A 1KIKA 1UGRB 5GAN5 2FPFA 3CPWA 2MCNA 5KYUB 1SG5A 2VVKA 4NL3A 2O9VA 2LT1A 1VQ4A 1N8RR 1TS9A 3JCMf 4FT2A 2EKHA 3ZBDA 2LMJA 1AWJA 1BYMA 4J9HA 3EHQA 1LVKA 2BUDA 3OYAA 2M51A 2PVDB 1HYOA 4JUVA 2V8KA 1D0ZA 4RTYA 7AT1B 5GANj 3OYHA 1S72Q 2RM4A 3INZA 1OYXA 2P84A 2JM9A 3ZEHA 4IKFA 3OW2P 1WFWA 1JJ2P 3RMQA 2DL5A 3M58A 1NZ9A 1QP2A 1H8KA 1UGVA 2XK0A 2KBTA 1Y96A 1PKSA 1QQJA 5LJ3j 1VA7A 1V76A 1TH7A 2LZ6B 2LNVA 1G5VA 3L2RA 1K0XA 1V29B 2CSIA 4JZ3A 4E6RA 3CCMQ 5I2SA 1VQOT 5C6SA 3NTKA 3OYKA 3JRZA 2PQWA 1P92A 1M8VA 4QKUA 3J81E 2E41A 2FRYA 2JMAA 4M78E 1VQ6A 1QCNA 1M90R 2A0FB 4L5GA 1K9MC 4F04B 1RADB 2VYTA 2JS0A 2DXBA 5CK9A 3OYDA 2XKOC 3EAEA 5CQYA 4IUTA 3G71A 4BI8B 5CAIA 1M2VB 2RH2A 3SWNA 1G3SA 1MGQA 4ZGDB 4PFPA 1J3TA 4FYVB 4QT7A 5KE2A 1K9MU 4E7LA 2EYQA 2W0ZA 5IAYA 5GAOq 1NBEB 3KFVA 3CCLQ 3FIFA 1YWOA 3CCRA 3S3MA 1NPRA 1SKUB 3RNJA 3OW2A 2OTJT 3JCMd 1JJ2A 2X9HA 4RTVA 4M7DC 2NUTB 3A8GB 1W2BS 1EFNA 2HL3A 1N9SA 4XU0A 3QJYA 1WHJA 1RAEB 4LD6A 3LX7A 1ZLMA 2RHYA 1TG0A 2PTKA 1FX7A 1G2BA 2KYBA 4M75B 4BDYA 2FPEA 4OMPA 2CT4A 2F2WA 5J26A 2ED0A 2EYXA 2CUDA 4J6YA 3QDRB 2I0NA 4KH0B 3VRZA 5A0GA 4C5EA 6AT1B 1VQ9T 2O88A 2HCKA 1OULA 1OZ3A 2DE0X 2KAFA 1X6GA 3M0QA 5CQXA 2CZ7B 2BZXA 3M0TA 5GAOr 2DVJA 1JBMA 1JU5C 1T0JA 1PD0A 3OBYA 1M5Q1 1KHCA 2E3IA 1VQ7Q 2RB6A 4KUDK 8ATCB 5LJ3f 2JTEA 3CC2Q 4ESRA 4C8QA 3HKSA 2K3YA 4XTXA 1WQWA 5KYWB 1BK2A 4HCKA 1KHIA 1N6AA 1RAGB 1X43A 3VS5A 3OYBA 1HK9A 1MV0B 1UGQB 4PLIA 2L2PA 2DM1A 3TSZA 4EMKB 4HVUA 3GOXA 1BCOA 4C92B 5I22A 4JRPA 1VQPT 3P8DA 1PNJA 4BUGA 3CC4T 2D0QB 2QEXT 2JOYA 3JCMc 4MZTA 2DXTA 4OMFB 3OMCA 2K3XA 4J83A 4BB7A 4X34A 4RG8A 2BE9B 3FEOA 3QZ5B 1AZEA 1TOVA 4ZGEB 3RBBB 1KQSP 1RLPC 4PJOE 1QW1A 5KYXB 2J05A 2KR3A 1S72A 2QQSA 3M0RA 5GMKm 1YN8A 5J39A 5FROA 2LCLA 1YHQQ 4PLLA 4PJOB 2RNAA 1VQLQ 1I0CA 1K8AC 3MEWA 2XMFA 3CCET 2G3RA 1UEBA 2D8JA 3ASKA 3TREA 2GFAA 1M3AA 2X35A 5CKHA 2HZYA 1KSWA 1WYXA 4QQDA 1JRIA 2DL7A 2W10A 2KT1A 4M75F 2V8IA 3NFCA 4JLGA 2IPOB 1N8RC 3CCMA 2KY9A 3L2QA 1K8AU 1PC0A 4OGEA 2AHJB 2CP2A 4LDWA 5D7UA 1YI2Q 3V8KA 3D7SB 1PG5B 2YXYA 2DX1A 4DEYA 1SRLA 3JSCA 4JJNK 1MMGA 2RQWA 5GMKl 1VQ4T 1GCQA 4DBQA 1PSFA 4FCYA 4OMMA 2DL3A 1N8RU 2NUZA 1IGQA 3JB9F 2EYWA 2SEMA 2EYZA 2K2VA 3CCSQ 4JJBA 1BU1A 1JQQA 2NUPA 1QCFA 3EH2A 2VB6A 3HRTA 2M16A 4M7AD 1RAFB 4XTVA 2QI2A 4NL2A 2K57A 4HCZA 1E7OA 1QVGP 1OQKA 3JV3A 1O75A 2QYZA 2RHIA 1K4US 1AEYA 4C92F 1X69A 1KQSA 4AT1B 4E47A 3BDUA 3KBGA 1RL2A 1NJIR 2YDLA 1U06A 4C0DC 5AYFA 4F7UA 3P8BB 1M30A 3HFOA 3PFSA 1K0SA 3JCMX 3CCJQ 1D1BA 1X6OA 1IHWA 1KJWA 4DQ2A 4HA8A 1M90C 4M7AA 2HD0A 3I9QA 3H41A 2MWOA 2QK0A 3BW1A 2RF0A 2E5KA 1B7TA 2D9TA 2E64A 4BI4A 2IIMA 2HSPA 3LYIA 2YUPA 1M4ZA 3HSBA 5CKFA 2BZYA 1VQ6T 5KH6A 1IB8A 1QVFP 5GAN3 2FZCB 3MEVA 2IG0A 3PE0A 1M90U 1RI9A 2DK3A 2MWPA 2H3JA 3G71T 2YSQA 2ZAEA 3OYGA 5GMKe 5A2QE 1RACB 2QG9B 3OB9A 3EGXB 1WHHA 3MEAA 4WTOB 1EX4A 1BIAA 1GXIE 3QSUA 3I56Q 1YITQ 4IURA 1VUBA 2KXCA 2DTIA 2RN8A 1NE8A 4HT8A 2LX7A 4R55A 4XAXB 1ZUUA 1WI7A 3PT9A 2EJFA 5KYYB 4KGVB 4LXCA 3CCRT 2FG0A 4LE9A 3CC7A 4J5YA 3RR6A 2COYA 1QVGA 1WJRA 2DAQA 2X3WD 1XNIA 5LJ5h 3RDVA 3C95A 1JO8A 4M7DE 1TSFA 1GCPA 3FC3A 3OYYA 4J6XA 1MHNA 2KROA 1ACMB 4JRIA 4IUPA 4Z89A 1BI1A 2KGTA 2DIQA 1W6XA 3I35A 4M77A 5CKEA 3FRNA 4P5NA 3G7ZA 1LJOA 1T3SA 1UGPB 3DLMA 1H3ZA 3HFNA 3MO8A 1HSQA 1D0XA 2VV5A 3LH0A 4EPCA 3QYHB 5GAN6 4KGZB 4DBHA 1VOMA 2WSCE 1FXXA 2ZCFB 2EWNA 1QVFA 5D6WA 2LTOA 1YHQA 2VGMA 5DY9A 1VQLA 1G3TA 4II1A 3LLRA 2XD0A 1UTIA 3A8MB 1SF9A 1UHCA 3F70A 4CI0C 1LNXA 3X24B 3E1SA 1H92A 2ZPFB 2DPPB 1WA7A 2EJGA 1YIJA 2MF2A 3SD4A 4FT4A 3A5ZB 3M5AA 4XU1A 2ZPIB 1FMVA 1NYFA 3CCQQ 3M59A 3JCMQ 5LL6S 4Z88A 4M7AC 1YI2A 4XU2A 3S6WA 2VXFA 2YUQA 2YHTA 5GAN7 1VQNQ 4GLMA 3H6ZA 1X27A 4RUGA 2V8JA 1UECA 5FRNA 5ECAA 2OI3A 3RKYA 2QA4Q 2EQIA 2AT1B 3QWXX 2CS7A 4QVDA 3E19A 2LJ0A 3CCSA 4BE2A 2E6NA 1S72T 4A4GA 2PVOB 4X1VA 3R6NA 3CCUA 1D09B 2CP6A 5LJ5g 2JT4A 3LWHA 2P4TA 4PK4A 2DYBA 2IVWA 4PJJA 1CKAA 5KCHA 2E4HA 2XDBA 1CKBA 2AZSA 3U23A 3TQ7P 4EIKA 3CCJA 4LDUA 2YRVA 3TU4K 3I5SA 4E7JA 2CYZB 3CCMT 4ME7A 2AIRB 4N0AA 5IT9E 3M57A 1VQ5Q 3NTHA 2GFUA 1C0MA 3RERA 3X28B 2E65A 1VQ8A 2COWA 2JXBA 3VS1A 3Q1JA 2Y4YA 2GTJA 3TSWA 1TUCA 1YJWQ 1OI1A 5FWBA 4M77C 2HAXA 2EGCA 4J9DA 1I07A 2HMAA 2DF6A 1QKWA 3AHUA 1Q86R 2JUFA 3QJ6A 1ABQA 1RLQC 2DZ9A 2RMOA 3UATA 2DEQA 4KRTA 2EQUA 1RI0A 1NJIC 2RK1A 5J3BA 2RO0A 1G83A 2E5QA 3PIOA 1YITA 3META 3L1AA 2MPXC 3JCMP 4BI3A 5GMKh 1Q81R 2CSQA 2A37A 3FJPA 1QWFA 1NJIU 1VYVA 4XTUA 1N27A 2I2LA 3FB9A 1BBZA 1QVPA 3VUZA 4HCBA 3EG9B 1PSEA 2RQVA 4C8QE 3PIPA 1WHLA 4C0DB 2DETA 3OS1A 3GP8A 3REBB 4B6MA 1GBRA 5HKCA 1Y07A 2RHZA 2J6FA 3BDLA 4J7IA 2VASA 3GNGA 3IQLA 4OB0B 1Y7XA 2ENMA 1VQKQ 2LVMA 1EIFA 4FW1A 4QQGA 3NGPA 1PRLC 4EMGA 2MYSA 1Q95G 1WHKA 5AT1B 3OA6A 2GBQA 2DTHA 4RCCA 2CZ1B 3I55Q 4M78B 5GAN2 2DILA 1YJ9A 2LRQA 4QQ6A 3UA7A 1OV3A 2HNIA 1NLPC 2M1HA 3PMIA 4X9CA 2FVUA 5IXBA 2LQWA 2YWWA 3VS2A 2JZ2A 4ZN3A 3CC7T 1H641 2DA9A 3CCQA 2O4XA 3VRYA 4TVRA 1X75C 2LQNA 1UB4A 1JXMA 3HHTB 1KG1A 3EGDA 4Z02A 4OB1B 2P0KA 2HQHA 2LCCA 2K5IA 3JCMb 3EG3A 3VS3A 1C1AA 1WX6A 5KCOA 4E7IA 1QMCA 2RA2A 1TU0B 2C0OA 3H0FA 1PRMC 2C0IA 1I4K1 2Y4XA 5GANh 2QA4A 2DLPA 5CCAA 5GAMe 1UFFA 3CPFA 3GF5A 3X25B 3PVQA 1MMDA 1W2BP 2VXEA 2E12A 2PUOB 2CKKA 1SSHA 4C8QG 4ELZC 1YHQT 1GFCA 1VQLT 1RAAB 5KYUA 4BY6C 4F17A 2CDTA 4OB2B 4AG1C 4E2FB 4C8QD 4PNOA 3V8LA 3MKDA 2HEQA 1PD1A 2B86A 2M9UA 3H8ZA 1YIJT 4CC7A 4RTTA 2LCSA 2CP3A 2PNIA 3MJXA 3RMSA 3CD6A 4JJCA 5LJ5e 1VYUA 2ZZDA 1ZBJA 1K73R 2DZCA 3LH5A 4F7UE 2O31A 1VQ5A 1YI2T 1WZOA 2ATCB 4M7AE 2RHXA 2YRDA 1O9SA 4M78F 4CRIA 4MDXA 2X4WA 2KSSA 2Y90A 2RJEA 2WACA 3FDRA 1ZSZB 1W70A 2CH4A 4JPBW 1XQHA 1UJ0A 2ABLA 3REAB 2HQEA 1OPKA 2R5MA 3MP1A 2RD1A 3CCST 2P4RA 4NOYA 4HCCA 8AT1B 1AT1B 2FHDA 1X01A 3CCUT 2DRMA 1D3BB 1FWZA 1YBYA 4LNPA 2EPDA 2PVGB 1WGSA 3SWNC 1W2BA 4XK8E 5D6YA 4M78A 3NMZC 2XU8A 4KH1B 1XJWB 3CCJT 1Q7YR 3OYEA 2RJCA 1E6GA 1HD3A 1M2VA 5GANg 1UJYA 2KDSA 3BFMA 4F14A 3EFOB 5CKDA 2M0OA 3SHWA 4CC4B 3HP9A 4DA4A 1VQ8T 1Q86C 2AZVA 2OTLQ 4PJNA 4PJMA 1EZZB 2XG8D 4M77E 3OS2A 1VQ9Q 1WXBA 2DYIA 2COZA 1IO6A 2O9SA 1B34B 2KEAA 2D0NA 3NHNA 5IHKA 1Q86U 3UF4A 1Q81C 2NUTA 4F7UG 3I55A 3T9NA 4L59A 3WXMB 4N4HA 2JTFA 1YITT 4M7AG 3VS6A 3VKIA 2WSFE 2LQ8A 1BI2A 2FB7A 2KK4A 2OAWA 1VIFA 3QXEB 1YP5A 2QGFB 4AG2C 5CO7A 3ULRB 3QHSA 4M75A 2WSEE 4LN2A 1OX8A 3LW5E 2DL8A 1Q81U 4GBQA 2Z0WA 2EGEA 3CCLA 2V1QA 1MMAA 1VQPQ 4A4EA 2QEXQ 4MZMA 2PU9B 3HRUA 2F1LA 2GQVA 2XICA 3M0PA 4C8QC 4EMHA 3HPWA 3ZFJA 3PMTA 3CMAQ 3KUFA 3TVTA 2KQWA 2DBMA 1SHFA 3M9QA 2DVEA 1D0YA 4JRQA 5FU7C 1WJQA 1NLOC 2DD4A 4PJOF 2CZ0B 3EGUA 2O2OA 1ZSGA 1XTDA 4WF2A 5KYWA 4EDUA 2AKKA 1ZHIA 1ZUYA 2H3EB 1YJ9T 4JLIA 2LP5A 4EMKA 3O5ZA 4C0FA 1YJNQ 4C92A 2FL7A 2KMTA 4DBRA 5GAMh 2OX7A 4J9IA 4DOWA 3QZ9B 2DIGA 1I1JA 1R8OB 1OOTA 4M77G 3CCQT 3CXCS 2EBPA 5KYXA 1VQ7A 1WLPB 1BCMA 4XTZA 3CC2A 1WNLA 3JB9J 4M77D 4QW2A 4PJOA 5IHNA 1MMNA 2HBPA 4ORZA 3H0HA 5GMKi 4D8DA 3VV0A 3QBYA 4OF1A 2ROLA 2QA4T 1GFDA 1K1ZA 4J9GA 2MMPA 2FRWA 2GGRA 3L42A 4M7DB 2YUNA 4KGXB 1B3QA 4MMLA 4Y91A 2GNCA 2L5QA 4FW2A 1BIBA 1GCQC 3DB4A 2EJ9A 3V7CA 1M8MA 3G4SQ 3OYIA 3S3OA 3X26B 4J7FA 1NG2A 1K73C 1WHGA 1SEMA 2R5AA 5CR2A 2HL5C 1LCKA 3OY9A 1KD1R 5GAOn 3QDFA 4XTYA 2LT4A 2FEIA 4FYXB 1WHMA 3H0IA 5LJ5f 4BY6B 3CD6T 3M0SA 3ME9A 4M75C 3RKWA 3P8HA 5KE3A 5EC7A 2EW3A 3VU3C 3DKMA 4HT9A 2L3PA 1VQ5T 1D1AA 3G6EQ 1K73U 3V8JA 3A8LB 1ZBXA 1ZUKA 2K4YA 3EFRA 2RI3A 1AVZC 3OS0A 2L3SA 3QYGB 4JZ4A 4VUBA 2OTLA 2FYKA 1Y57A 1N5ZA 4GY5A 3A1PA 1UE9A 4A54A 3G71Q 2EAYA 3OYNA 4XU3A 5GANe 2NYSA 5GAMg 1M1GA 1Y96B 4FSSA 5DLOA 2EQKA 3L2ZA 4QVCA 1RAIB 3CPWS 2R58A 4WCIA 2D8HA 2RHUA 3CCVQ 4KT0E 2BTTA 1Q7YC 5GAOp 4OMQA 5HCKA 5LJ3e 2RPNA 1RABB 3GPLA 2A28A 2DO3A 5GMKj 4J9CA 4EMKC 3QIIA 1U8RA 3RUXA 4QVZA 3CMEQ 2RJDA 4FYWB 3OYMA 1YFNA 2KVQG 2RK2A 2MAMA 3SWNB 3EFSA 1Q7YU 4J8OA 4M7DF 4FL6A 2DBKA 1U1TA 3EGXA 2ZGWA 2KRMA 1PWTA 5GAMd 3UA6A 4A4HA 4AFZC 2HSEB 2VC8A 1AWWA 2F5TX 4E7HA 4LDVA 4X9DA 2P0QA 5A0LA 2DJQA 3CMAA 5FWCA 4HXJA 4C5GA 4KULA 4E7SA 5KYYA 2A3LA 1C6VX 3JCMh 4BD3A 3JCMV 2LDMA 3EG2A 2QDYB 3RKXA 1NEBA 1W1FA 1QWEA 2KT8A 4DEXA 3I55T 4ELYC 5LJ5d 4BACA 1YJNA 1R0CB 4PKCC 3QG1A 1K9AA 2F69A 1IREB 5C0MA 2DERA 3I56A 1XOVA 3TEEA 2GF7A 3SEMA 2VGNA 4OMOA 5L8RE 3CCLT 3OMGA 2ZPGB 3C94A 3KXTA 1MUZA 4PFOA 4Y92A 3E9GA 9ATCB 2K7AA 2JM8A 2A08A 3QO3A 1WPYA 5A0DA 1F1BB 4LDYA 3OW2S 1IGUA 2YUOA 1SHGA 1TXQA 1JJ2S 1OU9A 5GJVB 1KC8R 3VJPA 1PM3A 1M27C 4C0ZA 2L0AA 2LQKA 1WIEA 2FZKB 2EYYA 4C8QB 1PKTA 1BB9A 1VQMQ 4OMNA 2LX9A 2FZGB 1LPLA 4C5HA 2E1HA 3OS5A 4O6JA 2DEUA 1M1KR 5FU7B 5I11A 2FO0A 4A63B 3G4SA 5DLQE 2MI6A 1U5SA 2OAUA 1QLYA 1E6HA 3SB2A 2QQRA 2DD5A 4PJLA 1IXDA 2QTXA 2RI2A 4M4ZA 4BE0A 2EQMA 4RMOA 3QPHA 3CEYA 1M9SA 3L2VA 2K9GA 1OU8A 2KRSA 2CP7A 2FPDA 2QGGA 2QAZA 3JCMg 3G6EA 2JMCA 1VQ7T 1DJ7B 2D1XA 2BZ8A 2E10A 1JEGA 2J6KA 3A8OB 3CC2T 2YLCA 3L2UA 2DNUA 4R56A 1QP3A 1YCSB 4O5VA 1GBQA 4Y28E 4R0KA 4N0AC 1SRMA 1VIEA 1Z9ZA 2LJ1A 1YCYA 3S3NA 1MV3A 1V1CA 1VQNA 4XQ3A 1ARKA 1KD1C 5EG2A 2KXDA 3JB9H 2V26A 2EKOA 3CCVA 4CC2A 1A0NB 4PFZA 3X20B 4B9XA 4CC3A 4RKUE 4A4KA 1KQ2A 1I5OB 3PGGA 1HJDA 1OPLA 3J7AF 4D6WA 1T0HA 2GCXA 3CMEA 1KD1U 3TCJA 4HVVA 4ANJA 1M3BA 3JCMJ 3RESA 2QQAA 4J9EA 4C8QF 4K11A 4M75E 1QKXA 2JNGA 2EFIA 2OJ2A 1WJSA 2QXFA 5LJ3h 3GIBA 1I5LA 2NUPB 1VQOQ 4IIMA 2OTLT 2KE9A 2DL4A 4MMKA 5D6XA 4RCBA 2QDLA 3GNFB 4IUQA 5FLXE 2K6DA 5GANf 1M2OA 1K76A 3UDCA 2XHCA 2L8DA 1ABOA 2CGHA 4OB3B 2QQBA 4NS5A 2BIVA 4F7UB 2HBWA 5GJWB 4ZN1A 1TTHB 1YJWA 1U1SA 2X51A 3MCAB 4M7AB 1ZQ1A 3BY7A 3EG9A 2G6FX 2J06A 5GAN4 4M78G 1OZ2A 4A4FA 1BI0A 3WVDB 1OX9A 4FM4B
chains in the Genus database with same CATH topology
2O2OA 2LZ6B 1ZSGA 4ZNXA 1AOJA 1K0XA 2AKKA 2ECZA 2CSIA 4GLMA 5FW9A 4JZ3A 4E6RA 2DMOA 1X27A 4RUGA 1ZUYA 1H3HA 4AFUC 1UECA 3FJ5A 1CSKA 5ECAA 2OI3A 2ED1A 2LP5A 3O5ZA 2EQIA 3QWXX 1AWOA 1UG1A 2CT3A 2FRYA 2JMAA 3NPFA 2LJ0A 4J9IA 2NWMA 1I1JA 4X1VA 3R6NA 2M0YA 2J6OA 1ZX6A 2JS0A 2JT4A 1OOTA 2DYBA 5IXFA 1CKAA 2KRNA 2EBPA 1CKBA 1J3TA 2HDAA 2AZSA 1WLPB 4QT7A 3U23A 4EIKA 5IH2A 1GL5A 5IHNA 2YT6A 4ORZA 3I5SA 2SRCA 2W0ZA 3H0HA 1Z9QA 1S1NA 3KFVA 4D8DA 1X2KA 1KFZA 2ROLA 1YWOA 1GFDA 1K1ZA 4J9GA 2JXBA 3VS1A 2FRWA 2GGRA 3RNJA 2GTJA 2YUNA 3TSWA 1TUCA 1B3QA 1SPKA 5FWBA 4RTVA 2GNCA 1GCQC 1EFNA 3QWYA 2EGCA 4J9DA 1I07A 1M8MA 2DF6A 2RQUA 1QKWA 1T3LA 1NG2A 1WDXA 2L3QA 2J7IA 1SEMA 1ABQA 1LCKA 1RLQC 1WXUA 2CREA 2RMOA 2RQTA 1ZLMA 3UATA 1TG0A 4KRTA 2PTKA 1G2BA 2KYBA 2VWFA 2EVRA 4RTWA 4AFSC 2FEIA 3PVLA 2FPEA 4OMPA 2CT4A 1G83A 2F2WA 2CH4W 3H0IA 1YNZA 1TUDA 2ED0A 2EYXA 3M0SA 2CUDA 5EC7A 2EW3A 2I0NA 3VRZA 2K79A 2L3PA 2O88A 2HCKA 1ZUKA 2DE0X 2CSQA 1AVZC 2A37A 2L3SA 1X6GA 3M0QA 4JZ4A 2BZXA 3M0TA 1QWFA 1Y57A 2K3BA 1N5ZA 1VYVA 1UE9A 1BBZA 2K2MA 2RQVA 2DVJA 1JU5C 1T0JA 4FSSA 2JTEA 3REBB 1GBRA 4RTUA 4ESRA 3I5RA 2J6FA 1BK2A 4HCKA 4WCIA 3ZL7C 3VS5A 1X43A 2X3XD 2D8HA 3IQLA 1MV0B 2ENMA 2BTTA 2L2PA 4OMQA 3NGPA 1PRLC 2DM1A 4Z8AA 3TSZA 1FMKA 4F16A 5HCKA 2RPNA 4HVUA 2A28A 2RQRA 5I22A 4J9CA 1PNJA 1AZGB 2GBQA 2DILA 2F2VA 1AZEA 3UA7A 1OV3A 4D8KA 1NLPC 3RBBB 1RLPC 2H8HA 1VYTA 2J05A 2DBKA 2KR3A 3M0RA 2KRMA 1PWTA 1YN8A 5IXBA 2LQWA 3UA6A 2LNHB 4AFZC 2RNAA 3VS2A 1I0CA 1AWWA 2DA9A 2XMFA 2DJQA 3VRYA 2D8JA 5FWCA 2LQNA 4LUDA 4HXJA 1M3AA 3EG1A 1JXMA 1KSWA 1WYXA 2DL7A 2W10A 2KT1A 2EGAA 3EG3A 3EG2A 3VS3A 1WX6A 3VS0A 2JW4A 1NEBA 1W1FA 1QWEA 2KT8A 4AFQC 2C0TA 2MIOA 4DEXA 2C0OA 3H0FA 1PRMC 3VS4A 2C0IA 2DLPA 2DX1A 4DEYA 1SRLA 2GTOA 2RQWA 1UFFA 3PVQA 1AD5A 4J9BA 1GCQA 1K9AA 1SSHA 2CUBA 1YWPA 4OMMA 1GFCA 2DL3A 2NUZA 2VKNA 1U3OA 1XOVA 1NEGA 3M0UA 3C0CA 1X2QA 2EYWA 2SEMA 3SEMA 4F17A 2EYZA 1OEBA 1UDLA 4OMOA 2CDTA 4AG1C 4JJBA 1BU1A 1MUZA 2A36A 2HEQA 4Y92A 2B86A 1JQQA 4JJDA 1QCFA 4OMLA 2K7AA 4RTZA 2JM8A 2A08A 4CC7A 4RTTA 2LCSA 2PNIA 4HVWA 4JJCA 1UHFA 1E7OA 3JV3A 1VYUA 1ZBJA 4J9FA 1K4US 1AEYA 3LH5A 1X69A 1NM7A 2LJ3A 2O31A 1SHGA 2YUOA 5GJVB 1M27C 2L0AA 1NYGA 2YDLA 2DRKA 1U06A 2ROTA 1WIEA 1M30A 2EYYA 1PKTA 1K0SA 1BB9A 1KJWA 4OMNA 1X6BA 1W70A 2CH4A 3I9QA 3H41A 4JPBW 1PHTA 1UJ0A 2ABLA 3REAB 5I11A 1AWXA 2FO0A 4A63B 2RF0A 2E5KA 1OPKA 2IIMA 2HSPA 2F2XA 1U5SA 1FYNA 2YUPA 1QLYA 1E6HA 1Y0MA 2MOXA 2BZYA 2P4RA 3EG0A 3PE0A 4M4ZA 1RI9A 3VS7A 2DRMA 4IIOA 4LNPA 2K9GA 2KRSA 2YSQA 2EPDA 2FPDA 3GBQA 2JMCA 2D1XA 2BZ8A 1JEGA 2J6KA 5L23A 1UUEA 1JXOA 1M3CA 2DNUA 2KYMA 3NMZC 1B07A 1YCSB 2KXCA 4RTXA 1E6GA 1HD3A 1GBQA 2RN8A 1UJYA 2LX7A 1ZUUA 3EHRA 3CQTA 4F14A 2PZ1A 1WI7A 4R0KA 4CC4B 3SHWA 1SRMA 2AKLA 2FG0A 4LE9A 1Z9ZA 2AZVA 2LJ1A 2V1RA 2KNBB 1GRIA 1MV3A 1V1CA 1ARKA 2AK5A 3A98A 5IHIA 2KXDA 2X3WD 2JS2A 4CC2A 2ESWA 1A0NB 1JO8A 1GCPA 1WXBA 4CC3A 2KROA 4LUEA 1IO6A 2O9SA 3THKA 4Z89A 2KGTA 2GQIA 2KEAA 2D0NA 3NHNA 1RUWA 1WXTA 1W6XA 1HJDA 3I35A 5IHKA 1OPLA 3UF4A 1T0HA 1T3SA 1KIKA 4HVVA 1HSQA 3VS6A 1M3BA 2FPFA 2MCNA 2OAWA 4J9EA 2VVKA 4K11A 1QKXA 2OJ2A 2O9VA 1YP5A 2EKHA 4AG2C 3ULRB 2LMJA 1AWJA 4IIMA 4LN2A 4J9HA 2DL8A 2KE9A 3EHQA 2DL4A 2M51A 4GBQA 2QDLA 1UTIA 1UHCA 2EGEA 2K6DA 4RTYA 2V1QA 1K76A 1H92A 1WA7A 1ABOA 2HBWA 2JM9A 5GJWB 1NYFA 1WFWA 3M0PA 2DL5A 2G6FX 4Z88A 2J06A 3TVTA 2DBMA 1H8KA 1UGVA 1SHFA 2KBTA 1PKSA 1NLOC 1VA7A 2YUQA 3EGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O2O A;  2LZ6 B;  1ZSG A;  4ZNX A;  1AOJ A;  1K0X A;  2AKK A;  2ECZ A;  2CSI A;  4GLM A;  5FW9 A;  4JZ3 A;  4E6R A;  2DMO A;  1X27 A;  4RUG A;  1ZUY A;  1H3H A;  4AFU C;  1UEC A;  3FJ5 A;  1CSK A;  5ECA A;  2OI3 A;  2ED1 A;  2LP5 A;  3O5Z A;  2EQI A;  3QWX X;  1AWO A;  1UG1 A;  2CT3 A;  2FRY A;  2JMA A;  3NPF A;  2LJ0 A;  4J9I A;  2NWM A;  1I1J A;  4X1V A;  3R6N A;  2M0Y A;  2J6O A;  1ZX6 A;  2JS0 A;  2JT4 A;  1OOT A;  2DYB A;  5IXF A;  1CKA A;  2KRN A;  2EBP A;  1CKB A;  1J3T A;  2HDA A;  2AZS A;  1WLP B;  4QT7 A;  3U23 A;  4EIK A;  5IH2 A;  1GL5 A;  5IHN A;  2YT6 A;  4ORZ A;  3I5S A;  2SRC A;  2W0Z A;  3H0H A;  1Z9Q A;  1S1N A;  3KFV A;  4D8D A;  1X2K A;  1KFZ A;  2ROL A;  1YWO A;  1GFD A;  1K1Z A;  4J9G A;  2JXB A;  3VS1 A;  2FRW A;  2GGR A;  3RNJ A;  2GTJ A;  2YUN A;  3TSW A;  1TUC A;  1B3Q A;  1SPK A;  5FWB A;  4RTV A;  2GNC A;  1GCQ C;  1EFN A;  3QWY A;  2EGC A;  4J9D A;  1I07 A;  1M8M A;  2DF6 A;  2RQU A;  1QKW A;  1T3L A;  1NG2 A;  1WDX A;  2L3Q A;  2J7I A;  1SEM A;  1ABQ A;  1LCK A;  1RLQ C;  1WXU A;  2CRE A;  2RMO A;  2RQT A;  1ZLM A;  3UAT A;  1TG0 A;  4KRT A;  2PTK A;  1G2B A;  2KYB A;  2VWF A;  2EVR A;  4RTW A;  4AFS C;  2FEI A;  3PVL A;  2FPE A;  4OMP A;  2CT4 A;  1G83 A;  2F2W A;  2CH4 W;  3H0I A;  1YNZ A;  1TUD A;  2ED0 A;  2EYX A;  3M0S A;  2CUD A;  5EC7 A;  2EW3 A;  2I0N A;  3VRZ A;  2K79 A;  2L3P A;  2O88 A;  2HCK A;  1ZUK A;  2DE0 X;  2CSQ A;  1AVZ C;  2A37 A;  2L3S A;  1X6G A;  3M0Q A;  4JZ4 A;  2BZX A;  3M0T A;  1QWF A;  1Y57 A;  2K3B A;  1N5Z A;  1VYV A;  1UE9 A;  1BBZ A;  2K2M A;  2RQV A;  2DVJ A;  1JU5 C;  1T0J A;  4FSS A;  2JTE A;  3REB B;  1GBR A;  4RTU A;  4ESR A;  3I5R A;  2J6F A;  1BK2 A;  4HCK A;  4WCI A;  3ZL7 C;  3VS5 A;  1X43 A;  2X3X D;  2D8H A;  3IQL A;  1MV0 B;  2ENM A;  2BTT A;  2L2P A;  4OMQ A;  3NGP A;  1PRL C;  2DM1 A;  4Z8A A;  3TSZ A;  1FMK A;  4F16 A;  5HCK A;  2RPN A;  4HVU A;  2A28 A;  2RQR A;  5I22 A;  4J9C A;  1PNJ A;  1AZG B;  2GBQ A;  2DIL A;  2F2V A;  1AZE A;  3UA7 A;  1OV3 A;  4D8K A;  1NLP C;  3RBB B;  1RLP C;  2H8H A;  1VYT A;  2J05 A;  2DBK A;  2KR3 A;  3M0R A;  2KRM A;  1PWT A;  1YN8 A;  5IXB A;  2LQW A;  3UA6 A;  2LNH B;  4AFZ C;  2RNA A;  3VS2 A;  1I0C A;  1AWW A;  2DA9 A;  2XMF A;  2DJQ A;  3VRY A;  2D8J A;  5FWC A;  2LQN A;  4LUD A;  4HXJ A;  1M3A A;  3EG1 A;  1JXM A;  1KSW A;  1WYX A;  2DL7 A;  2W10 A;  2KT1 A;  2EGA A;  3EG3 A;  3EG2 A;  3VS3 A;  1WX6 A;  3VS0 A;  2JW4 A;  1NEB A;  1W1F A;  1QWE A;  2KT8 A;  4AFQ C;  2C0T A;  2MIO A;  4DEX A;  2C0O A;  3H0F A;  1PRM C;  3VS4 A;  2C0I A;  2DLP A;  2DX1 A;  4DEY A;  1SRL A;  2GTO A;  2RQW A;  1UFF A;  3PVQ A;  1AD5 A;  4J9B A;  1GCQ A;  1K9A A;  1SSH A;  2CUB A;  1YWP A;  4OMM A;  1GFC A;  2DL3 A;  2NUZ A;  2VKN A;  1U3O A;  1XOV A;  1NEG A;  3M0U A;  3C0C A;  1X2Q A;  2EYW A;  2SEM A;  3SEM A;  4F17 A;  2EYZ A;  1OEB A;  1UDL A;  4OMO A;  2CDT A;  4AG1 C;  4JJB A;  1BU1 A;  1MUZ A;  2A36 A;  2HEQ A;  4Y92 A;  2B86 A;  1JQQ A;  4JJD A;  1QCF A;  4OML A;  2K7A A;  4RTZ A;  2JM8 A;  2A08 A;  4CC7 A;  4RTT A;  2LCS A;  2PNI A;  4HVW A;  4JJC A;  1UHF A;  1E7O A;  3JV3 A;  1VYU A;  1ZBJ A;  4J9F A;  1K4U S;  1AEY A;  3LH5 A;  1X69 A;  1NM7 A;  2LJ3 A;  2O31 A;  1SHG A;  2YUO A;  5GJV B;  1M27 C;  2L0A A;  1NYG A;  2YDL A;  2DRK A;  1U06 A;  2ROT A;  1WIE A;  1M30 A;  2EYY A;  1PKT A;  1K0S A;  1BB9 A;  1KJW A;  4OMN A;  1X6B A;  1W70 A;  2CH4 A;  3I9Q A;  3H41 A;  4JPB W;  1PHT A;  1UJ0 A;  2ABL A;  3REA B;  5I11 A;  1AWX A;  2FO0 A;  4A63 B;  2RF0 A;  2E5K A;  1OPK A;  2IIM A;  2HSP A;  2F2X A;  1U5S A;  1FYN A;  2YUP A;  1QLY A;  1E6H A;  1Y0M A;  2MOX A;  2BZY A;  2P4R A;  3EG0 A;  3PE0 A;  4M4Z A;  1RI9 A;  3VS7 A;  2DRM A;  4IIO A;  4LNP A;  2K9G A;  2KRS A;  2YSQ A;  2EPD A;  2FPD A;  3GBQ A;  2JMC A;  2D1X A;  2BZ8 A;  1JEG A;  2J6K A;  5L23 A;  1UUE A;  1JXO A;  1M3C A;  2DNU A;  2KYM A;  3NMZ C;  1B07 A;  1YCS B;  2KXC A;  4RTX A;  1E6G A;  1HD3 A;  1GBQ A;  2RN8 A;  1UJY A;  2LX7 A;  1ZUU A;  3EHR A;  3CQT A;  4F14 A;  2PZ1 A;  1WI7 A;  4R0K A;  4CC4 B;  3SHW A;  1SRM A;  2AKL A;  2FG0 A;  4LE9 A;  1Z9Z A;  2AZV A;  2LJ1 A;  2V1R A;  2KNB B;  1GRI A;  1MV3 A;  1V1C A;  1ARK A;  2AK5 A;  3A98 A;  5IHI A;  2KXD A;  2X3W D;  2JS2 A;  4CC2 A;  2ESW A;  1A0N B;  1JO8 A;  1GCP A;  1WXB A;  4CC3 A;  2KRO A;  4LUE A;  1IO6 A;  2O9S A;  3THK A;  4Z89 A;  2KGT A;  2GQI A;  2KEA A;  2D0N A;  3NHN A;  1RUW A;  1WXT A;  1W6X A;  1HJD A;  3I35 A;  5IHK A;  1OPL A;  3UF4 A;  1T0H A;  1T3S A;  1KIK A;  4HVV A;  1HSQ A;  3VS6 A;  1M3B A;  2FPF A;  2MCN A;  2OAW A;  4J9E A;  2VVK A;  4K11 A;  1QKX A;  2OJ2 A;  2O9V A;  1YP5 A;  2EKH A;  4AG2 C;  3ULR B;  2LMJ A;  1AWJ A;  4IIM A;  4LN2 A;  4J9H A;  2DL8 A;  2KE9 A;  3EHQ A;  2DL4 A;  2M51 A;  4GBQ A;  2QDL A;  1UTI A;  1UHC A;  2EGE A;  2K6D A;  4RTY A;  2V1Q A;  1K76 A;  1H92 A;  1WA7 A;  1ABO A;  2HBW A;  2JM9 A;  5GJW B;  1NYF A;  1WFW A;  3M0P A;  2DL5 A;  2G6F X;  4Z88 A;  2J06 A;  3TVT A;  2DBM A;  1H8K A;  1UGV A;  1SHF A;  2KBT A;  1PKS A;  1NLO C;  1VA7 A;  2YUQ A;  3EGU A; 
#chains in the Genus database with same CATH topology
 1IRX A;  3CC7 Q;  4ZNX A;  1AOJ A;  4M78 D;  2ECZ A;  5FW9 A;  2RJF A;  2DMO A;  4C92 E;  1H3H A;  4AFU C;  3FJ5 A;  5FU6 C;  3JCM W;  1CSK A;  1MNE A;  2ZPB B;  2ED1 A;  2QTV A;  2QQ9 A;  3M4G A;  1AWO A;  1UG1 A;  2CT3 A;  1RAH B;  2NLU A;  3NPF A;  2YRC A;  2NWM A;  1KQS S;  2OTJ Q;  5CIU A;  2C06 A;  2M0Y A;  2J6O A;  1ZX6 A;  3MPU B;  1M1F A;  5IXF A;  3OSV A;  3HRS A;  3E9F A;  2KRN A;  2YLB A;  4PL6 A;  3HL8 A;  3CMA T;  2HDA A;  2PUK B;  3SFM A;  5IH2 A;  2DKG A;  1GL5 A;  1R0B G;  2YT6 A;  3MP8 A;  1KK7 A;  1VQM A;  2EIF A;  3BE3 A;  2DJZ A;  4YTL A;  2SRC A;  1Z9Q A;  3M4Y A;  1S1N A;  4KBM B;  4M75 G;  1VQK A;  3ER0 A;  1X2K A;  1KFZ A;  2XDP A;  4N4G A;  5LJ3 g;  1YIJ Q;  2DXC A;  5GAM j;  1YJN T;  4OGC A;  4M75 D;  2K5F A;  2X4Y A;  4M77 B;  4C5I A;  4E7K A;  1SPK A;  1MND A;  1N9R A;  3QWY A;  1Q82 R;  4GLK A;  3I56 T;  2RQU A;  4JDS A;  1T3L A;  2L3Q A;  1WDX A;  4F7U F;  2J7I A;  2BE7 D;  1WXU A;  5GAN d;  2CRE A;  2RQT A;  4M7A F;  1KC8 C;  4ZTF A;  4N4I A;  3MHX A;  3JB9 G;  2VWF A;  2EVR A;  4RTW A;  3RIR A;  4AFS C;  3PVL A;  2CH4 W;  2JJ9 A;  1YNZ A;  1TUD A;  3PNW C;  5LJ5 j;  3UWN A;  4E7Z A;  3JB9 D;  1QVG S;  3CBO A;  3R6O A;  1M1K C;  2K79 A;  3JCM e;  3CC4 Q;  4XTW A;  2DFU A;  2L3R A;  3H9N A;  3V7R A;  2R57 A;  5LJ3 d;  4C92 G;  1KC8 U;  3CCU Q;  2K3B A;  2JTM A;  3QUI A;  2RI5 A;  1UGS B;  2K2M A;  3DLL A;  3UPU A;  2DXU A;  3C4S A;  4C92 D;  3EH1 A;  2LC4 A;  3G4S T;  4RTU A;  1M1K U;  3PTA A;  3I5R A;  2VUB A;  5CKB A;  5GAO m;  1ZSZ A;  3CCE Q;  3ZL7 C;  2XI9 A;  2X3X D;  1QVF S;  4PJO G;  3HTR A;  4Z8A A;  1VQ8 Q;  2B8A A;  1FMK A;  4F16 A;  2RQR A;  1I81 A;  3VYG A;  4PJO D;  3G6E T;  1AZG B;  1VQO A;  3GLX A;  4FSX A;  1QCO A;  1R77 A;  4AMC A;  2F2V A;  2L89 A;  2ZPH B;  1D3B A;  3OSS C;  4M78 C;  4D8K A;  1NPP A;  2E70 A;  1KQ1 A;  4HKE A;  4OP0 A;  2H8H A;  1VYT A;  2D6F A;  4M77 F;  1VQ4 Q;  4BDZ A;  2K5L A;  3WVE B;  1FMW A;  2DTO A;  2LNH B;  4JRK A;  3LWI A;  3CXC P;  2X4X A;  5GAO l;  1BI3 A;  1ZA2 B;  3MP6 A;  4FIB A;  1VQN T;  2HKQ B;  3M55 A;  4LUD A;  3CCV T;  3EG1 A;  3EFO A;  2P0P A;  1K9M R;  4C0G A;  5GAM f;  1PCX A;  3MEU A;  2EGA A;  2XDD A;  2KI7 A;  1IHV A;  4MZP A;  3VS0 A;  2JW4 A;  4AFQ C;  2C0T A;  5DM7 R;  2E6Z A;  2MIO A;  3CME T;  5HK0 A;  3VS4 A;  2QAS A;  3AT1 B;  4JS5 A;  5KYN A;  1HXD A;  1B34 A;  2GTO A;  1SSF A;  4IUV A;  1ZA1 B;  2OTJ A;  1AD5 A;  4J9B A;  3OYC A;  3OQ5 A;  4IUU A;  2CUB A;  1YWP A;  1TUG B;  2VKN A;  1U3O A;  3M0U A;  1NEG A;  3C0C A;  1X2Q A;  3OYF A;  4FYY B;  1OEB A;  3J80 E;  1UDL A;  4ATO A;  2XID A;  5M9O A;  2MK5 A;  1VQ6 Q;  3OBW A;  3V7S A;  2A36 A;  1JB0 E;  3L2W A;  4JJD A;  4OML A;  3SDZ A;  4RTZ A;  3QKJ A;  4JS4 A;  4HVW A;  1YJ9 Q;  1UHF A;  3OYJ A;  4DOV A;  1YJW T;  4J9F A;  2JVV A;  1NM7 A;  2LJ3 A;  1VQ9 A;  2E3H A;  1NYG A;  2DRK A;  2ROT A;  3UT1 A;  3CXC A;  2ZPE B;  1D1C A;  1X6B A;  2HQX A;  4MDW A;  3O8V A;  1PHT A;  3URG A;  1TWB A;  1G8X A;  3M54 A;  1AWX A;  1ZSZ C;  2A7Y A;  3DB3 A;  3LGL A;  1I8F A;  4LD9 K;  4RG2 A;  3CPW P;  2F2X A;  3CCR Q;  1FYN A;  1Y0M A;  2MOX A;  1LOJ A;  1AHJ B;  4C92 C;  5FU6 B;  5GAN 8;  3EG0 A;  2M02 A;  3VS7 A;  4V2S A;  5FRM A;  3M56 A;  5CVI A;  1G3Y A;  4IIO A;  3E2U A;  1VQP A;  5I21 A;  1G3W A;  2CZ6 B;  3GBQ A;  4KUI A;  1IZ6 A;  3CC4 A;  3OYL A;  2X4J A;  3NTI A;  4OVA A;  2QEX A;  3G1J A;  4DBF A;  4BE1 A;  5L23 A;  2JN0 A;  1UUE A;  3VYH B;  3C12 A;  2EQJ A;  1JXO A;  1M3C A;  2KYM A;  4M7D G;  1B07 A;  1VQM T;  2O01 E;  4PJO C;  4RTX A;  2O4X B;  2HKN A;  3LGF A;  4ZTJ A;  4UC4 A;  4J6W A;  1VQK T;  3EHR A;  3CQT A;  2PZ1 A;  2F5K A;  3JB9 I;  1Q82 C;  3CBM A;  2AKL A;  3EGD B;  4M7D D;  3JAM E;  2V1R A;  2CP0 A;  2KNB B;  1GRI A;  3FLG A;  4L6V 5;  4A53 A;  3CCE A;  2AK5 A;  3A98 A;  3CD6 Q;  1BKB A;  5IHI A;  2JS2 A;  4LDX A;  2ESW A;  4B9W A;  5IN1 A;  4ZGJ B;  1Y71 A;  5I2M A;  4FU6 A;  4Q5W A;  1WQ7 A;  4LUE A;  3THK A;  1Q82 U;  2GQI A;  1W4S A;  4M7D A;  1K8A R;  1RUW A;  1WXT A;  2BKD N;  3M53 A;  3A8H B;  3VUB A;  2CP5 A;  5HY6 A;  3N5B B;  3CBP A;  5HK3 A;  1KIK A;  1UGR B;  5GAN 5;  2FPF A;  3CPW A;  2MCN A;  5KYU B;  1SG5 A;  2VVK A;  4NL3 A;  2O9V A;  2LT1 A;  1VQ4 A;  1N8R R;  1TS9 A;  3JCM f;  4FT2 A;  2EKH A;  3ZBD A;  2LMJ A;  1AWJ A;  1BYM A;  4J9H A;  3EHQ A;  1LVK A;  2BUD A;  3OYA A;  2M51 A;  2PVD B;  1HYO A;  4JUV A;  2V8K A;  1D0Z A;  4RTY A;  7AT1 B;  5GAN j;  3OYH A;  1S72 Q;  2RM4 A;  3INZ A;  1OYX A;  2P84 A;  2JM9 A;  3ZEH A;  4IKF A;  3OW2 P;  1WFW A;  1JJ2 P;  3RMQ A;  2DL5 A;  3M58 A;  1NZ9 A;  1QP2 A;  1H8K A;  1UGV A;  2XK0 A;  2KBT A;  1Y96 A;  1PKS A;  1QQJ A;  5LJ3 j;  1VA7 A;  1V76 A;  1TH7 A;  2LZ6 B;  2LNV A;  1G5V A;  3L2R A;  1K0X A;  1V29 B;  2CSI A;  4JZ3 A;  4E6R A;  3CCM Q;  5I2S A;  1VQO T;  5C6S A;  3NTK A;  3OYK A;  3JRZ A;  2PQW A;  1P92 A;  1M8V A;  4QKU A;  3J81 E;  2E41 A;  2FRY A;  2JMA A;  4M78 E;  1VQ6 A;  1QCN A;  1M90 R;  2A0F B;  4L5G A;  1K9M C;  4F04 B;  1RAD B;  2VYT A;  2JS0 A;  2DXB A;  5CK9 A;  3OYD A;  2XKO C;  3EAE A;  5CQY A;  4IUT A;  3G71 A;  4BI8 B;  5CAI A;  1M2V B;  2RH2 A;  3SWN A;  1G3S A;  1MGQ A;  4ZGD B;  4PFP A;  1J3T A;  4FYV B;  4QT7 A;  5KE2 A;  1K9M U;  4E7L A;  2EYQ A;  2W0Z A;  5IAY A;  5GAO q;  1NBE B;  3KFV A;  3CCL Q;  3FIF A;  1YWO A;  3CCR A;  3S3M A;  1NPR A;  1SKU B;  3RNJ A;  3OW2 A;  2OTJ T;  3JCM d;  1JJ2 A;  2X9H A;  4RTV A;  4M7D C;  2NUT B;  3A8G B;  1W2B S;  1EFN A;  2HL3 A;  1N9S A;  4XU0 A;  3QJY A;  1WHJ A;  1RAE B;  4LD6 A;  3LX7 A;  1ZLM A;  2RHY A;  1TG0 A;  2PTK A;  1FX7 A;  1G2B A;  2KYB A;  4M75 B;  4BDY A;  2FPE A;  4OMP A;  2CT4 A;  2F2W A;  5J26 A;  2ED0 A;  2EYX A;  2CUD A;  4J6Y A;  3QDR B;  2I0N A;  4KH0 B;  3VRZ A;  5A0G A;  4C5E A;  6AT1 B;  1VQ9 T;  2O88 A;  2HCK A;  1OUL A;  1OZ3 A;  2DE0 X;  2KAF A;  1X6G A;  3M0Q A;  5CQX A;  2CZ7 B;  2BZX A;  3M0T A;  5GAO r;  2DVJ A;  1JBM A;  1JU5 C;  1T0J A;  1PD0 A;  3OBY A;  1M5Q 1;  1KHC A;  2E3I A;  1VQ7 Q;  2RB6 A;  4KUD K;  8ATC B;  5LJ3 f;  2JTE A;  3CC2 Q;  4ESR A;  4C8Q A;  3HKS A;  2K3Y A;  4XTX A;  1WQW A;  5KYW B;  1BK2 A;  4HCK A;  1KHI A;  1N6A A;  1RAG B;  1X43 A;  3VS5 A;  3OYB A;  1HK9 A;  1MV0 B;  1UGQ B;  4PLI A;  2L2P A;  2DM1 A;  3TSZ A;  4EMK B;  4HVU A;  3GOX A;  1BCO A;  4C92 B;  5I22 A;  4JRP A;  1VQP T;  3P8D A;  1PNJ A;  4BUG A;  3CC4 T;  2D0Q B;  2QEX T;  2JOY A;  3JCM c;  4MZT A;  2DXT A;  4OMF B;  3OMC A;  2K3X A;  4J83 A;  4BB7 A;  4X34 A;  4RG8 A;  2BE9 B;  3FEO A;  3QZ5 B;  1AZE A;  1TOV A;  4ZGE B;  3RBB B;  1KQS P;  1RLP C;  4PJO E;  1QW1 A;  5KYX B;  2J05 A;  2KR3 A;  1S72 A;  2QQS A;  3M0R A;  5GMK m;  1YN8 A;  5J39 A;  5FRO A;  2LCL A;  1YHQ Q;  4PLL A;  4PJO B;  2RNA A;  1VQL Q;  1I0C A;  1K8A C;  3MEW A;  2XMF A;  3CCE T;  2G3R A;  1UEB A;  2D8J A;  3ASK A;  3TRE A;  2GFA A;  1M3A A;  2X35 A;  5CKH A;  2HZY A;  1KSW A;  1WYX A;  4QQD A;  1JRI A;  2DL7 A;  2W10 A;  2KT1 A;  4M75 F;  2V8I A;  3NFC A;  4JLG A;  2IPO B;  1N8R C;  3CCM A;  2KY9 A;  3L2Q A;  1K8A U;  1PC0 A;  4OGE A;  2AHJ B;  2CP2 A;  4LDW A;  5D7U A;  1YI2 Q;  3V8K A;  3D7S B;  1PG5 B;  2YXY A;  2DX1 A;  4DEY A;  1SRL A;  3JSC A;  4JJN K;  1MMG A;  2RQW A;  5GMK l;  1VQ4 T;  1GCQ A;  4DBQ A;  1PSF A;  4FCY A;  4OMM A;  2DL3 A;  1N8R U;  2NUZ A;  1IGQ A;  3JB9 F;  2EYW A;  2SEM A;  2EYZ A;  2K2V A;  3CCS Q;  4JJB A;  1BU1 A;  1JQQ A;  2NUP A;  1QCF A;  3EH2 A;  2VB6 A;  3HRT A;  2M16 A;  4M7A D;  1RAF B;  4XTV A;  2QI2 A;  4NL2 A;  2K57 A;  4HCZ A;  1E7O A;  1QVG P;  1OQK A;  3JV3 A;  1O75 A;  2QYZ A;  2RHI A;  1K4U S;  1AEY A;  4C92 F;  1X69 A;  1KQS A;  4AT1 B;  4E47 A;  3BDU A;  3KBG A;  1RL2 A;  1NJI R;  2YDL A;  1U06 A;  4C0D C;  5AYF A;  4F7U A;  3P8B B;  1M30 A;  3HFO A;  3PFS A;  1K0S A;  3JCM X;  3CCJ Q;  1D1B A;  1X6O A;  1IHW A;  1KJW A;  4DQ2 A;  4HA8 A;  1M90 C;  4M7A A;  2HD0 A;  3I9Q A;  3H41 A;  2MWO A;  2QK0 A;  3BW1 A;  2RF0 A;  2E5K A;  1B7T A;  2D9T A;  2E64 A;  4BI4 A;  2IIM A;  2HSP A;  3LYI A;  2YUP A;  1M4Z A;  3HSB A;  5CKF A;  2BZY A;  1VQ6 T;  5KH6 A;  1IB8 A;  1QVF P;  5GAN 3;  2FZC B;  3MEV A;  2IG0 A;  3PE0 A;  1M90 U;  1RI9 A;  2DK3 A;  2MWP A;  2H3J A;  3G71 T;  2YSQ A;  2ZAE A;  3OYG A;  5GMK e;  5A2Q E;  1RAC B;  2QG9 B;  3OB9 A;  3EGX B;  1WHH A;  3MEA A;  4WTO B;  1EX4 A;  1BIA A;  1GXI E;  3QSU A;  3I56 Q;  1YIT Q;  4IUR A;  1VUB A;  2KXC A;  2DTI A;  2RN8 A;  1NE8 A;  4HT8 A;  2LX7 A;  4R55 A;  4XAX B;  1ZUU A;  1WI7 A;  3PT9 A;  2EJF A;  5KYY B;  4KGV B;  4LXC A;  3CCR T;  2FG0 A;  4LE9 A;  3CC7 A;  4J5Y A;  3RR6 A;  2COY A;  1QVG A;  1WJR A;  2DAQ A;  2X3W D;  1XNI A;  5LJ5 h;  3RDV A;  3C95 A;  1JO8 A;  4M7D E;  1TSF A;  1GCP A;  3FC3 A;  3OYY A;  4J6X A;  1MHN A;  2KRO A;  1ACM B;  4JRI A;  4IUP A;  4Z89 A;  1BI1 A;  2KGT A;  2DIQ A;  1W6X A;  3I35 A;  4M77 A;  5CKE A;  3FRN A;  4P5N A;  3G7Z A;  1LJO A;  1T3S A;  1UGP B;  3DLM A;  1H3Z A;  3HFN A;  3MO8 A;  1HSQ A;  1D0X A;  2VV5 A;  3LH0 A;  4EPC A;  3QYH B;  5GAN 6;  4KGZ B;  4DBH A;  1VOM A;  2WSC E;  1FXX A;  2ZCF B;  2EWN A;  1QVF A;  5D6W A;  2LTO A;  1YHQ A;  2VGM A;  5DY9 A;  1VQL A;  1G3T A;  4II1 A;  3LLR A;  2XD0 A;  1UTI A;  3A8M B;  1SF9 A;  1UHC A;  3F70 A;  4CI0 C;  1LNX A;  3X24 B;  3E1S A;  1H92 A;  2ZPF B;  2DPP B;  1WA7 A;  2EJG A;  1YIJ A;  2MF2 A;  3SD4 A;  4FT4 A;  3A5Z B;  3M5A A;  4XU1 A;  2ZPI B;  1FMV A;  1NYF A;  3CCQ Q;  3M59 A;  3JCM Q;  5LL6 S;  4Z88 A;  4M7A C;  1YI2 A;  4XU2 A;  3S6W A;  2VXF A;  2YUQ A;  2YHT A;  5GAN 7;  1VQN Q;  4GLM A;  3H6Z A;  1X27 A;  4RUG A;  2V8J A;  1UEC A;  5FRN A;  5ECA A;  2OI3 A;  3RKY A;  2QA4 Q;  2EQI A;  2AT1 B;  3QWX X;  2CS7 A;  4QVD A;  3E19 A;  2LJ0 A;  3CCS A;  4BE2 A;  2E6N A;  1S72 T;  4A4G A;  2PVO B;  4X1V A;  3R6N A;  3CCU A;  1D09 B;  2CP6 A;  5LJ5 g;  2JT4 A;  3LWH A;  2P4T A;  4PK4 A;  2DYB A;  2IVW A;  4PJJ A;  1CKA A;  5KCH A;  2E4H A;  2XDB A;  1CKB A;  2AZS A;  3U23 A;  3TQ7 P;  4EIK A;  3CCJ A;  4LDU A;  2YRV A;  3TU4 K;  3I5S A;  4E7J A;  2CYZ B;  3CCM T;  4ME7 A;  2AIR B;  4N0A A;  5IT9 E;  3M57 A;  1VQ5 Q;  3NTH A;  2GFU A;  1C0M A;  3RER A;  3X28 B;  2E65 A;  1VQ8 A;  2COW A;  2JXB A;  3VS1 A;  3Q1J A;  2Y4Y A;  2GTJ A;  3TSW A;  1TUC A;  1YJW Q;  1OI1 A;  5FWB A;  4M77 C;  2HAX A;  2EGC A;  4J9D A;  1I07 A;  2HMA A;  2DF6 A;  1QKW A;  3AHU A;  1Q86 R;  2JUF A;  3QJ6 A;  1ABQ A;  1RLQ C;  2DZ9 A;  2RMO A;  3UAT A;  2DEQ A;  4KRT A;  2EQU A;  1RI0 A;  1NJI C;  2RK1 A;  5J3B A;  2RO0 A;  1G83 A;  2E5Q A;  3PIO A;  1YIT A;  3MET A;  3L1A A;  2MPX C;  3JCM P;  4BI3 A;  5GMK h;  1Q81 R;  2CSQ A;  2A37 A;  3FJP A;  1QWF A;  1NJI U;  1VYV A;  4XTU A;  1N27 A;  2I2L A;  3FB9 A;  1BBZ A;  1QVP A;  3VUZ A;  4HCB A;  3EG9 B;  1PSE A;  2RQV A;  4C8Q E;  3PIP A;  1WHL A;  4C0D B;  2DET A;  3OS1 A;  3GP8 A;  3REB B;  4B6M A;  1GBR A;  5HKC A;  1Y07 A;  2RHZ A;  2J6F A;  3BDL A;  4J7I A;  2VAS A;  3GNG A;  3IQL A;  4OB0 B;  1Y7X A;  2ENM A;  1VQK Q;  2LVM A;  1EIF A;  4FW1 A;  4QQG A;  3NGP A;  1PRL C;  4EMG A;  2MYS A;  1Q95 G;  1WHK A;  5AT1 B;  3OA6 A;  2GBQ A;  2DTH A;  4RCC A;  2CZ1 B;  3I55 Q;  4M78 B;  5GAN 2;  2DIL A;  1YJ9 A;  2LRQ A;  4QQ6 A;  3UA7 A;  1OV3 A;  2HNI A;  1NLP C;  2M1H A;  3PMI A;  4X9C A;  2FVU A;  5IXB A;  2LQW A;  2YWW A;  3VS2 A;  2JZ2 A;  4ZN3 A;  3CC7 T;  1H64 1;  2DA9 A;  3CCQ A;  2O4X A;  3VRY A;  4TVR A;  1X75 C;  2LQN A;  1UB4 A;  1JXM A;  3HHT B;  1KG1 A;  3EGD A;  4Z02 A;  4OB1 B;  2P0K A;  2HQH A;  2LCC A;  2K5I A;  3JCM b;  3EG3 A;  3VS3 A;  1C1A A;  1WX6 A;  5KCO A;  4E7I A;  1QMC A;  2RA2 A;  1TU0 B;  2C0O A;  3H0F A;  1PRM C;  2C0I A;  1I4K 1;  2Y4X A;  5GAN h;  2QA4 A;  2DLP A;  5CCA A;  5GAM e;  1UFF A;  3CPF A;  3GF5 A;  3X25 B;  3PVQ A;  1MMD A;  1W2B P;  2VXE A;  2E12 A;  2PUO B;  2CKK A;  1SSH A;  4C8Q G;  4ELZ C;  1YHQ T;  1GFC A;  1VQL T;  1RAA B;  5KYU A;  4BY6 C;  4F17 A;  2CDT A;  4OB2 B;  4AG1 C;  4E2F B;  4C8Q D;  4PNO A;  3V8L A;  3MKD A;  2HEQ A;  1PD1 A;  2B86 A;  2M9U A;  3H8Z A;  1YIJ T;  4CC7 A;  4RTT A;  2LCS A;  2CP3 A;  2PNI A;  3MJX A;  3RMS A;  3CD6 A;  4JJC A;  5LJ5 e;  1VYU A;  2ZZD A;  1ZBJ A;  1K73 R;  2DZC A;  3LH5 A;  4F7U E;  2O31 A;  1VQ5 A;  1YI2 T;  1WZO A;  2ATC B;  4M7A E;  2RHX A;  2YRD A;  1O9S A;  4M78 F;  4CRI A;  4MDX A;  2X4W A;  2KSS A;  2Y90 A;  2RJE A;  2WAC A;  3FDR A;  1ZSZ B;  1W70 A;  2CH4 A;  4JPB W;  1XQH A;  1UJ0 A;  2ABL A;  3REA B;  2HQE A;  1OPK A;  2R5M A;  3MP1 A;  2RD1 A;  3CCS T;  2P4R A;  4NOY A;  4HCC A;  8AT1 B;  1AT1 B;  2FHD A;  1X01 A;  3CCU T;  2DRM A;  1D3B B;  1FWZ A;  1YBY A;  4LNP A;  2EPD A;  2PVG B;  1WGS A;  3SWN C;  1W2B A;  4XK8 E;  5D6Y A;  4M78 A;  3NMZ C;  2XU8 A;  4KH1 B;  1XJW B;  3CCJ T;  1Q7Y R;  3OYE A;  2RJC A;  1E6G A;  1HD3 A;  1M2V A;  5GAN g;  1UJY A;  2KDS A;  3BFM A;  4F14 A;  3EFO B;  5CKD A;  2M0O A;  3SHW A;  4CC4 B;  3HP9 A;  4DA4 A;  1VQ8 T;  1Q86 C;  2AZV A;  2OTL Q;  4PJN A;  4PJM A;  1EZZ B;  2XG8 D;  4M77 E;  3OS2 A;  1VQ9 Q;  1WXB A;  2DYI A;  2COZ A;  1IO6 A;  2O9S A;  1B34 B;  2KEA A;  2D0N A;  3NHN A;  5IHK A;  1Q86 U;  3UF4 A;  1Q81 C;  2NUT A;  4F7U G;  3I55 A;  3T9N A;  4L59 A;  3WXM B;  4N4H A;  2JTF A;  1YIT T;  4M7A G;  3VS6 A;  3VKI A;  2WSF E;  2LQ8 A;  1BI2 A;  2FB7 A;  2KK4 A;  2OAW A;  1VIF A;  3QXE B;  1YP5 A;  2QGF B;  4AG2 C;  5CO7 A;  3ULR B;  3QHS A;  4M75 A;  2WSE E;  4LN2 A;  1OX8 A;  3LW5 E;  2DL8 A;  1Q81 U;  4GBQ A;  2Z0W A;  2EGE A;  3CCL A;  2V1Q A;  1MMA A;  1VQP Q;  4A4E A;  2QEX Q;  4MZM A;  2PU9 B;  3HRU A;  2F1L A;  2GQV A;  2XIC A;  3M0P A;  4C8Q C;  4EMH A;  3HPW A;  3ZFJ A;  3PMT A;  3CMA Q;  3KUF A;  3TVT A;  2KQW A;  2DBM A;  1SHF A;  3M9Q A;  2DVE A;  1D0Y A;  4JRQ A;  5FU7 C;  1WJQ A;  1NLO C;  2DD4 A;  4PJO F;  2CZ0 B;  3EGU A;  2O2O A;  1ZSG A;  1XTD A;  4WF2 A;  5KYW A;  4EDU A;  2AKK A;  1ZHI A;  1ZUY A;  2H3E B;  1YJ9 T;  4JLI A;  2LP5 A;  4EMK A;  3O5Z A;  4C0F A;  1YJN Q;  4C92 A;  2FL7 A;  2KMT A;  4DBR A;  5GAM h;  2OX7 A;  4J9I A;  4DOW A;  3QZ9 B;  2DIG A;  1I1J A;  1R8O B;  1OOT A;  4M77 G;  3CCQ T;  3CXC S;  2EBP A;  5KYX A;  1VQ7 A;  1WLP B;  1BCM A;  4XTZ A;  3CC2 A;  1WNL A;  3JB9 J;  4M77 D;  4QW2 A;  4PJO A;  5IHN A;  1MMN A;  2HBP A;  4ORZ A;  3H0H A;  5GMK i;  4D8D A;  3VV0 A;  3QBY A;  4OF1 A;  2ROL A;  2QA4 T;  1GFD A;  1K1Z A;  4J9G A;  2MMP A;  2FRW A;  2GGR A;  3L42 A;  4M7D B;  2YUN A;  4KGX B;  1B3Q A;  4MML A;  4Y91 A;  2GNC A;  2L5Q A;  4FW2 A;  1BIB A;  1GCQ C;  3DB4 A;  2EJ9 A;  3V7C A;  1M8M A;  3G4S Q;  3OYI A;  3S3O A;  3X26 B;  4J7F A;  1NG2 A;  1K73 C;  1WHG A;  1SEM A;  2R5A A;  5CR2 A;  2HL5 C;  1LCK A;  3OY9 A;  1KD1 R;  5GAO n;  3QDF A;  4XTY A;  2LT4 A;  2FEI A;  4FYX B;  1WHM A;  3H0I A;  5LJ5 f;  4BY6 B;  3CD6 T;  3M0S A;  3ME9 A;  4M75 C;  3RKW A;  3P8H A;  5KE3 A;  5EC7 A;  2EW3 A;  3VU3 C;  3DKM A;  4HT9 A;  2L3P A;  1VQ5 T;  1D1A A;  3G6E Q;  1K73 U;  3V8J A;  3A8L B;  1ZBX A;  1ZUK A;  2K4Y A;  3EFR A;  2RI3 A;  1AVZ C;  3OS0 A;  2L3S A;  3QYG B;  4JZ4 A;  4VUB A;  2OTL A;  2FYK A;  1Y57 A;  1N5Z A;  4GY5 A;  3A1P A;  1UE9 A;  4A54 A;  3G71 Q;  2EAY A;  3OYN A;  4XU3 A;  5GAN e;  2NYS A;  5GAM g;  1M1G A;  1Y96 B;  4FSS A;  5DLO A;  2EQK A;  3L2Z A;  4QVC A;  1RAI B;  3CPW S;  2R58 A;  4WCI A;  2D8H A;  2RHU A;  3CCV Q;  4KT0 E;  2BTT A;  1Q7Y C;  5GAO p;  4OMQ A;  5HCK A;  5LJ3 e;  2RPN A;  1RAB B;  3GPL A;  2A28 A;  2DO3 A;  5GMK j;  4J9C A;  4EMK C;  3QII A;  1U8R A;  3RUX A;  4QVZ A;  3CME Q;  2RJD A;  4FYW B;  3OYM A;  1YFN A;  2KVQ G;  2RK2 A;  2MAM A;  3SWN B;  3EFS A;  1Q7Y U;  4J8O A;  4M7D F;  4FL6 A;  2DBK A;  1U1T A;  3EGX A;  2ZGW A;  2KRM A;  1PWT A;  5GAM d;  3UA6 A;  4A4H A;  4AFZ C;  2HSE B;  2VC8 A;  1AWW A;  2F5T X;  4E7H A;  4LDV A;  4X9D A;  2P0Q A;  5A0L A;  2DJQ A;  3CMA A;  5FWC A;  4HXJ A;  4C5G A;  4KUL A;  4E7S A;  5KYY A;  2A3L A;  1C6V X;  3JCM h;  4BD3 A;  3JCM V;  2LDM A;  3EG2 A;  2QDY B;  3RKX A;  1NEB A;  1W1F A;  1QWE A;  2KT8 A;  4DEX A;  3I55 T;  4ELY C;  5LJ5 d;  4BAC A;  1YJN A;  1R0C B;  4PKC C;  3QG1 A;  1K9A A;  2F69 A;  1IRE B;  5C0M A;  2DER A;  3I56 A;  1XOV A;  3TEE A;  2GF7 A;  3SEM A;  2VGN A;  4OMO A;  5L8R E;  3CCL T;  3OMG A;  2ZPG B;  3C94 A;  3KXT A;  1MUZ A;  4PFO A;  4Y92 A;  3E9G A;  9ATC B;  2K7A A;  2JM8 A;  2A08 A;  3QO3 A;  1WPY A;  5A0D A;  1F1B B;  4LDY A;  3OW2 S;  1IGU A;  2YUO A;  1SHG A;  1TXQ A;  1JJ2 S;  1OU9 A;  5GJV B;  1KC8 R;  3VJP A;  1PM3 A;  1M27 C;  4C0Z A;  2L0A A;  2LQK A;  1WIE A;  2FZK B;  2EYY A;  4C8Q B;  1PKT A;  1BB9 A;  1VQM Q;  4OMN A;  2LX9 A;  2FZG B;  1LPL A;  4C5H A;  2E1H A;  3OS5 A;  4O6J A;  2DEU A;  1M1K R;  5FU7 B;  5I11 A;  2FO0 A;  4A63 B;  3G4S A;  5DLQ E;  2MI6 A;  1U5S A;  2OAU A;  1QLY A;  1E6H A;  3SB2 A;  2QQR A;  2DD5 A;  4PJL A;  1IXD A;  2QTX A;  2RI2 A;  4M4Z A;  4BE0 A;  2EQM A;  4RMO A;  3QPH A;  3CEY A;  1M9S A;  3L2V A;  2K9G A;  1OU8 A;  2KRS A;  2CP7 A;  2FPD A;  2QGG A;  2QAZ A;  3JCM g;  3G6E A;  2JMC A;  1VQ7 T;  1DJ7 B;  2D1X A;  2BZ8 A;  2E10 A;  1JEG A;  2J6K A;  3A8O B;  3CC2 T;  2YLC A;  3L2U A;  2DNU A;  4R56 A;  1QP3 A;  1YCS B;  4O5V A;  1GBQ A;  4Y28 E;  4R0K A;  4N0A C;  1SRM A;  1VIE A;  1Z9Z A;  2LJ1 A;  1YCY A;  3S3N A;  1MV3 A;  1V1C A;  1VQN A;  4XQ3 A;  1ARK A;  1KD1 C;  5EG2 A;  2KXD A;  3JB9 H;  2V26 A;  2EKO A;  3CCV A;  4CC2 A;  1A0N B;  4PFZ A;  3X20 B;  4B9X A;  4CC3 A;  4RKU E;  4A4K A;  1KQ2 A;  1I5O B;  3PGG A;  1HJD A;  1OPL A;  3J7A F;  4D6W A;  1T0H A;  2GCX A;  3CME A;  1KD1 U;  3TCJ A;  4HVV A;  4ANJ A;  1M3B A;  3JCM J;  3RES A;  2QQA A;  4J9E A;  4C8Q F;  4K11 A;  4M75 E;  1QKX A;  2JNG A;  2EFI A;  2OJ2 A;  1WJS A;  2QXF A;  5LJ3 h;  3GIB A;  1I5L A;  2NUP B;  1VQO Q;  4IIM A;  2OTL T;  2KE9 A;  2DL4 A;  4MMK A;  5D6X A;  4RCB A;  2QDL A;  3GNF B;  4IUQ A;  5FLX E;  2K6D A;  5GAN f;  1M2O A;  1K76 A;  3UDC A;  2XHC A;  2L8D A;  1ABO A;  2CGH A;  4OB3 B;  2QQB A;  4NS5 A;  2BIV A;  4F7U B;  2HBW A;  5GJW B;  4ZN1 A;  1TTH B;  1YJW A;  1U1S A;  2X51 A;  3MCA B;  4M7A B;  1ZQ1 A;  3BY7 A;  3EG9 A;  2G6F X;  2J06 A;  5GAN 4;  4M78 G;  1OZ2 A;  4A4F A;  1BI0 A;  3WVD B;  1OX9 A;  4FM4 B; 
#chains in the Genus database with same CATH homology
 2O2O A;  2LZ6 B;  1ZSG A;  4ZNX A;  1AOJ A;  1K0X A;  2AKK A;  2ECZ A;  2CSI A;  4GLM A;  5FW9 A;  4JZ3 A;  4E6R A;  2DMO A;  1X27 A;  4RUG A;  1ZUY A;  1H3H A;  4AFU C;  1UEC A;  3FJ5 A;  1CSK A;  5ECA A;  2OI3 A;  2ED1 A;  2LP5 A;  3O5Z A;  2EQI A;  3QWX X;  1AWO A;  1UG1 A;  2CT3 A;  2FRY A;  2JMA A;  3NPF A;  2LJ0 A;  4J9I A;  2NWM A;  1I1J A;  4X1V A;  3R6N A;  2M0Y A;  2J6O A;  1ZX6 A;  2JS0 A;  2JT4 A;  1OOT A;  2DYB A;  5IXF A;  1CKA A;  2KRN A;  2EBP A;  1CKB A;  1J3T A;  2HDA A;  2AZS A;  1WLP B;  4QT7 A;  3U23 A;  4EIK A;  5IH2 A;  1GL5 A;  5IHN A;  2YT6 A;  4ORZ A;  3I5S A;  2SRC A;  2W0Z A;  3H0H A;  1Z9Q A;  1S1N A;  3KFV A;  4D8D A;  1X2K A;  1KFZ A;  2ROL A;  1YWO A;  1GFD A;  1K1Z A;  4J9G A;  2JXB A;  3VS1 A;  2FRW A;  2GGR A;  3RNJ A;  2GTJ A;  2YUN A;  3TSW A;  1TUC A;  1B3Q A;  1SPK A;  5FWB A;  4RTV A;  2GNC A;  1GCQ C;  1EFN A;  3QWY A;  2EGC A;  4J9D A;  1I07 A;  1M8M A;  2DF6 A;  2RQU A;  1QKW A;  1T3L A;  1NG2 A;  1WDX A;  2L3Q A;  2J7I A;  1SEM A;  1ABQ A;  1LCK A;  1RLQ C;  1WXU A;  2CRE A;  2RMO A;  2RQT A;  1ZLM A;  3UAT A;  1TG0 A;  4KRT A;  2PTK A;  1G2B A;  2KYB A;  2VWF A;  2EVR A;  4RTW A;  4AFS C;  2FEI A;  3PVL A;  2FPE A;  4OMP A;  2CT4 A;  1G83 A;  2F2W A;  2CH4 W;  3H0I A;  1YNZ A;  1TUD A;  2ED0 A;  2EYX A;  3M0S A;  2CUD A;  5EC7 A;  2EW3 A;  2I0N A;  3VRZ A;  2K79 A;  2L3P A;  2O88 A;  2HCK A;  1ZUK A;  2DE0 X;  2CSQ A;  1AVZ C;  2A37 A;  2L3S A;  1X6G A;  3M0Q A;  4JZ4 A;  2BZX A;  3M0T A;  1QWF A;  1Y57 A;  2K3B A;  1N5Z A;  1VYV A;  1UE9 A;  1BBZ A;  2K2M A;  2RQV A;  2DVJ A;  1JU5 C;  1T0J A;  4FSS A;  2JTE A;  3REB B;  1GBR A;  4RTU A;  4ESR A;  3I5R A;  2J6F A;  1BK2 A;  4HCK A;  4WCI A;  3ZL7 C;  3VS5 A;  1X43 A;  2X3X D;  2D8H A;  3IQL A;  1MV0 B;  2ENM A;  2BTT A;  2L2P A;  4OMQ A;  3NGP A;  1PRL C;  2DM1 A;  4Z8A A;  3TSZ A;  1FMK A;  4F16 A;  5HCK A;  2RPN A;  4HVU A;  2A28 A;  2RQR A;  5I22 A;  4J9C A;  1PNJ A;  1AZG B;  2GBQ A;  2DIL A;  2F2V A;  1AZE A;  3UA7 A;  1OV3 A;  4D8K A;  1NLP C;  3RBB B;  1RLP C;  2H8H A;  1VYT A;  2J05 A;  2DBK A;  2KR3 A;  3M0R A;  2KRM A;  1PWT A;  1YN8 A;  5IXB A;  2LQW A;  3UA6 A;  2LNH B;  4AFZ C;  2RNA A;  3VS2 A;  1I0C A;  1AWW A;  2DA9 A;  2XMF A;  2DJQ A;  3VRY A;  2D8J A;  5FWC A;  2LQN A;  4LUD A;  4HXJ A;  1M3A A;  3EG1 A;  1JXM A;  1KSW A;  1WYX A;  2DL7 A;  2W10 A;  2KT1 A;  2EGA A;  3EG3 A;  3EG2 A;  3VS3 A;  1WX6 A;  3VS0 A;  2JW4 A;  1NEB A;  1W1F A;  1QWE A;  2KT8 A;  4AFQ C;  2C0T A;  2MIO A;  4DEX A;  2C0O A;  3H0F A;  1PRM C;  3VS4 A;  2C0I A;  2DLP A;  2DX1 A;  4DEY A;  1SRL A;  2GTO A;  2RQW A;  1UFF A;  3PVQ A;  1AD5 A;  4J9B A;  1GCQ A;  1K9A A;  1SSH A;  2CUB A;  1YWP A;  4OMM A;  1GFC A;  2DL3 A;  2NUZ A;  2VKN A;  1U3O A;  1XOV A;  1NEG A;  3M0U A;  3C0C A;  1X2Q A;  2EYW A;  2SEM A;  3SEM A;  4F17 A;  2EYZ A;  1OEB A;  1UDL A;  4OMO A;  2CDT A;  4AG1 C;  4JJB A;  1BU1 A;  1MUZ A;  2A36 A;  2HEQ A;  4Y92 A;  2B86 A;  1JQQ A;  4JJD A;  1QCF A;  4OML A;  2K7A A;  4RTZ A;  2JM8 A;  2A08 A;  4CC7 A;  4RTT A;  2LCS A;  2PNI A;  4HVW A;  4JJC A;  1UHF A;  1E7O A;  3JV3 A;  1VYU A;  1ZBJ A;  4J9F A;  1K4U S;  1AEY A;  3LH5 A;  1X69 A;  1NM7 A;  2LJ3 A;  2O31 A;  1SHG A;  2YUO A;  5GJV B;  1M27 C;  2L0A A;  1NYG A;  2YDL A;  2DRK A;  1U06 A;  2ROT A;  1WIE A;  1M30 A;  2EYY A;  1PKT A;  1K0S A;  1BB9 A;  1KJW A;  4OMN A;  1X6B A;  1W70 A;  2CH4 A;  3I9Q A;  3H41 A;  4JPB W;  1PHT A;  1UJ0 A;  2ABL A;  3REA B;  5I11 A;  1AWX A;  2FO0 A;  4A63 B;  2RF0 A;  2E5K A;  1OPK A;  2IIM A;  2HSP A;  2F2X A;  1U5S A;  1FYN A;  2YUP A;  1QLY A;  1E6H A;  1Y0M A;  2MOX A;  2BZY A;  2P4R A;  3EG0 A;  3PE0 A;  4M4Z A;  1RI9 A;  3VS7 A;  2DRM A;  4IIO A;  4LNP A;  2K9G A;  2KRS A;  2YSQ A;  2EPD A;  2FPD A;  3GBQ A;  2JMC A;  2D1X A;  2BZ8 A;  1JEG A;  2J6K A;  5L23 A;  1UUE A;  1JXO A;  1M3C A;  2DNU A;  2KYM A;  3NMZ C;  1B07 A;  1YCS B;  2KXC A;  4RTX A;  1E6G A;  1HD3 A;  1GBQ A;  2RN8 A;  1UJY A;  2LX7 A;  1ZUU A;  3EHR A;  3CQT A;  4F14 A;  2PZ1 A;  1WI7 A;  4R0K A;  4CC4 B;  3SHW A;  1SRM A;  2AKL A;  2FG0 A;  4LE9 A;  1Z9Z A;  2AZV A;  2LJ1 A;  2V1R A;  2KNB B;  1GRI A;  1MV3 A;  1V1C A;  1ARK A;  2AK5 A;  3A98 A;  5IHI A;  2KXD A;  2X3W D;  2JS2 A;  4CC2 A;  2ESW A;  1A0N B;  1JO8 A;  1GCP A;  1WXB A;  4CC3 A;  2KRO A;  4LUE A;  1IO6 A;  2O9S A;  3THK A;  4Z89 A;  2KGT A;  2GQI A;  2KEA A;  2D0N A;  3NHN A;  1RUW A;  1WXT A;  1W6X A;  1HJD A;  3I35 A;  5IHK A;  1OPL A;  3UF4 A;  1T0H A;  1T3S A;  1KIK A;  4HVV A;  1HSQ A;  3VS6 A;  1M3B A;  2FPF A;  2MCN A;  2OAW A;  4J9E A;  2VVK A;  4K11 A;  1QKX A;  2OJ2 A;  2O9V A;  1YP5 A;  2EKH A;  4AG2 C;  3ULR B;  2LMJ A;  1AWJ A;  4IIM A;  4LN2 A;  4J9H A;  2DL8 A;  2KE9 A;  3EHQ A;  2DL4 A;  2M51 A;  4GBQ A;  2QDL A;  1UTI A;  1UHC A;  2EGE A;  2K6D A;  4RTY A;  2V1Q A;  1K76 A;  1H92 A;  1WA7 A;  1ABO A;  2HBW A;  2JM9 A;  5GJW B;  1NYF A;  1WFW A;  3M0P A;  2DL5 A;  2G6F X;  4Z88 A;  2J06 A;  3TVT A;  2DBM A;  1H8K A;  1UGV A;  1SHF A;  2KBT A;  1PKS A;  1NLO C;  1VA7 A;  2YUQ A;  3EGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...