2YUQA

Solution structure of the sh3 domain of human tyrosine-protein kinase itk/tsk
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
85
structure length
85
Chain Sequence
GSSGSSGEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of human Tyrosine-protein kinase ITK/TSK
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ITK/TSK
total genus 7
structure length 85
sequence length 85
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yuqA01
2AZVA 4RTZA 3REBB 1ABQA 2J05A 4OMNA 1UHFA 1IO6A 2A36A 1BB9A 2P4RA 4DEYA 1BK2A 3EG1A 1AZGB 2RQWA 4J9EA 5IHNA 2JMAA 1V1CA 1NLOC 1WI7A 2KT8A 1X2KA 1PHTA 4K11A 2C0IA 4LE9A 2RQVA 1GBRA 4RUGA 3THKA 3M0RA 4OMQA 1AD5A 1JXMA 2O9SA 1KJWA 1M3AA 2KEAA 2K7AA 4LN2A 2SEMA 2B86A 2YT6A 4J9HA 1AWJA 1ARKA 5L23A 2HSPA 1KFZA 1MV0B 3EG2A 1WA7A 1ABOA 2FRWA 3VRYA 2RQUA 3NMZC 4RTVA 1WXTA 2L3PA 2K2MA 2LQWA 1AOJA 1GBQA 3TSWA 2LJ0A 2LP5A 1BU1A 2JW4A 1X69A 1K0XA 3EHQA 3M0QA 2HCKA 2EYXA 2L3SA 5I22A 2KYMA 1JEGA 3JV3A 1BBZA 2LMJA 1CSKA 1M3BA 1T3LA 1ZX6A 5GJVB 1KSWA 3I5SA 2KR3A 2O31A 2RF0A 1VYVA 1T0JA 1UGVA 1X6GA 3UA7A 2MCNA 4AFUC 2M51A 2FPFA 2LJ3A 2W0ZA 2EYWA 4J9GA 4LUEA 2GQIA 1UHCA 2GTJA 5FWBA 1YCSB 1W70A 2EYYA 1UJYA 2K79A 1OOTA 1QLYA 1NM7A 4QT7A 1E6GA 1YWPA 2GGRA 1PRLC 3U23A 2EKHA 4OMLA 2BZYA 2RQRA 4CC7A 1YNZA 1GCQC 3NGPA 3UATA 1GCQA 4OMMA 2MOXA 3M0UA 2CH4W 2F2VA 1UDLA 3LH5A 1WIEA 3H0FA 2DMOA 1WXBA 4RTWA 4ORZA 2DF6A 1UJ0A 3H41A 2KRNA 1JQQA 2G6FX 1YP5A 2KNBB 3I5RA 2O2OA 2DM1A 1WX6A 2ESWA 1WYXA 2JT4A 1GFDA 1PNJA 4AG2C 1EFNA 2D8HA 2DL7A 1VA7A 5IXFA 2YDLA 1M8MA 2JS0A 4IIMA 2O88A 2DILA 4HVWA 3VS5A 2EPDA 5FW9A 2ENMA 4RTUA 1WDXA 1GCPA 2CT4A 1JO8A 1E6HA 2D8JA 1PKTA 2A37A 2K3BA 2DL5A 5FWCA 2L2PA 1SPKA 2DBMA 2DBKA 1PKSA 1HD3A 3PVQA 4AFZC 1RLPC 4OMPA 2J06A 4M4ZA 2V1RA 1NEGA 3RNJA 2E5KA 5ECAA 2JS2A 1WXUA 4ZNXA 3ULRB 4KRTA 1GFCA 4RTYA 4F17A 2J6OA 1K9AA 1HJDA 1ZBJA 4DEXA 2CDTA 1JU5C 1SEMA 3I35A 2CREA 1T0HA 3M0PA 2JTEA 2BTTA 4RTTA 2I0NA 2CSQA 2HBWA 3CQTA 3FJ5A 5GJWB 1TUCA 2GNCA 3VS4A 1K0SA 1GL5A 3VS2A 1AZEA 2FG0A 2JM8A 1RI9A 2YUOA 4JZ3A 5IH2A 1M30A 2QDLA 2EGAA 2K9GA 5HCKA 1VYTA 2FEIA 2JXBA 3PVLA 2DLPA 1YWOA 3M0TA 2EYZA 1K76A 4HXJA 2KT1A 4R0KA 3NPFA 3KFVA 2KXDA 3EG0A 2ED0A 2J7IA 2EGEA 1UFFA 1ZUYA 2YUQA 2KXCA 2LJ1A 3VS7A 4CC3A 4HCKA 2FPEA 4IIOA 1PRMC 2BZ8A 1AWXA 2DX1A 2FO0A 2MIOA 2LNHB 1QCFA 1SRMA 1B07A 4HVUA 3EG3A 2KE9A 2AKLA 3VS6A 1SRLA 3VS1A 2SRCA 3EHRA 3TSZA 1YN8A 1PWTA 1WLPB 4Z8AA 2DYBA 2CUDA 2XMFA 5IXBA 2RNAA 1AVZC 2LX7A 1T3SA 2J6FA 2DVJA 1QKXA 2JM9A 2O9VA 2CT3A 1N5ZA 2F2WA 1G83A 1WFWA 1ZSGA 1SHFA 2KBTA 3PE0A 1SHGA 3VS3A 4X1VA 2AZSA 4F14A 2PZ1A 3SHWA 2NUZA 2VWFA 1U06A 1ZLMA 2CUBA 1I07A 2L0AA 2BZXA 4Z88A 2H8HA 2KGTA 5EC7A 1X2QA 1M27C 1UTIA 2EBPA 4OMOA 1AEYA 1VYUA 3TVTA 1RUWA 4JPBW 3M0SA 4CC2A 3H0IA 1OEBA 1RLQC 1K1ZA 1NYFA 1UG1A 2M0YA 1I1JA 2X3XD 2DRMA 3I9QA 4JJCA 2EW3A 4AFQC 1Y57A 1W6XA 3O5ZA 4WCIA 3EGUA 1FYNA 2VKNA 2K6DA 1U3OA 1B3QA 2YUNA 1MUZA 1NEBA 2LZ6B 2A08A 3UA6A 4AG1C 1X43A 2DNUA 1QWEA 1Y0MA 2EQIA 1ZUKA 2F2XA 3REAB 4D8DA 1H3HA 2V1QA 3VS0A 4JJBA 1W1FA 2IIMA 1Z9QA 3GBQA 2ABLA 1HSQA 2ROTA 2CSIA 1OPLA 2AKKA 1OPKA 2C0TA 3QWYA 1K4US 2DJQA 4EIKA 4A63B 2DA9A 1U5SA 5IHKA 4JJDA 4JZ4A 4CC4B 3A98A 3QWXX 4AFSC 1MV3A 2ROLA 1M3CA 1SSHA 2DRKA 2JMCA 2NWMA 1QKWA 1TG0A 5IHIA 1A0NB 2J6KA 4J9CA 4D8KA 4F16A 2ECZA 2OJ2A 1AWOA 2GBQA 2YUPA 1ZUUA 1H92A 2D0NA 2VVKA 1X27A 4J9DA 2HEQA 2RN8A 3C0CA 2PTKA 2LCSA 2DL4A 3ZL7C 4J9BA 2CH4A 2OI3A 2DE0X 2EVRA 4HVVA 4J9IA 3VRZA 3UF4A 4FSSA 1AWWA 2KROA 1NLPC 2RMOA 4LNPA 3SEMA 4LUDA 3RBBB 2PNIA 2EGCA 1X6BA 3R6NA 2C0OA 4E6RA 2OAWA 2RPNA 1FMKA 2YSQA 2X3WD 2GTOA 4J9FA 4Y92A 1S1NA 1UECA 2KRMA 1Z9ZA 1NYGA 2KRSA 5I11A 1H8KA 1E7OA 2D1XA 1XOVA 1LCKA 1TUDA 1I0CA 2A28A 1UE9A 2L3QA 1CKBA 1QWFA 4GBQA 2HDAA 2KYBA 2LQNA 1NG2A 2W10A 1J3TA 4ESRA 4RTXA 2RQTA 3H0HA 2DL3A 2DL8A 1JXOA 2FPDA 3IQLA 4GLMA 1GRIA 3NHNA 1OV3A 1CKAA 2AK5A 4Z89A 2ED1A 2FRYA 1KIKA 1UUEA 1G2BA
chains in the Genus database with same CATH superfamily
4OVAA 4RTZA 1ABQA 5GAOm 1RABB 4PJJA 5GANe 4M7AD 5GAN3 1WJRA 1D3BA 2ZPEB 1M90U 5GANf 2L3RA 4PFPA 1BK2A 3HTRA 4BE0A 3I56Q 3OA6A 3A8LB 2Y4YA 2HSEB 3M0RA 1VQ6A 3JCMQ 5GAN7 4Y28E 2O9SA 4YTLA 1KJWA 1M3AA 4MDWA 4M77C 4LN2A 3SWNB 4LD9K 2KDSA 1M90R 1AWJA 3L42A 4B9WA 3S3MA 3A8GB 4QVDA 2LRQA 2DYIA 1JRIA 2M02A 1WXTA 3G7ZA 1VQMQ 2K2MA 2LQWA 4XU2A 3MKDA 3UT1A 1AOJA 3CCMT 3DB3A 2LJ0A 3HFNA 4XQ3A 3JB9F 4QVCA 1K0XA 2WSEE 3CD6A 4KH0B 3M0QA 3A8HB 5I22A 2D9TA 4PL6A 1Q82R 4C8QA 2LMJA 1M3BA 1VQPQ 2QEXT 2KR3A 2RF0A 1SF9A 1Q81U 2QA4Q 1VYVA 1VQKT 2DK3A 3GNGA 3R6OA 4FM4B 4M77B 1UB4A 4J83A 1YI2Q 2M51A 4FYXB 3FRNA 2LJ3A 4E7ZA 5LJ5f 1IGQA 2RHUA 1YCSB 1WJQA 2RB6A 4OMFB 3EFRA 2KMTA 4MZPA 3HHTB 1X6OA 2E3IA 3CCVQ 2K79A 2YXYA 3CCST 5KH6A 3EH1A 2QYZA 1RAEB 3VKIA 2BKDN 2RQRA 1G5VA 4F7UF 3KBGA 4CC7A 4QQGA 1YNZA 2CP2A 1VQNT 3JCMc 1GCQC 4M78F 3BY7A 4QW2A 1K9MR 2DVEA 3M0UA 3QDFA 1V29B 1UDLA 4M7AB 2DXTA 2DMOA 4C8QE 1WXBA 3CCQA 4Y91A 1M8VA 2CP6A 2DF6A 2EJ9A 4N4IA 2YRCA 1MNDA 3VV0A 3GOXA 1VQNQ 2G6FX 4R55A 2LT1A 4FYWB 4RG8A 2X4YA 3MP1A 1WYXA 2VASA 3BDUA 1RAAB 1EFNA 4PLLA 2D8HA 2DL7A 2QQRA 1KC8U 1VQ7T 2YDLA 3WVDB 1BI0A 4M7DC 4J7FA 2EPDA 5FW9A 1IXDA 1GCPA 1JO8A 5GAMg 4FSXA 1PKTA 2OTLT 4M75F 2L2PA 4XU0A 1N8RC 2NUTA 2FZCB 1RAIB 1RI0A 1O75A 4BY6C 3ASKA 1VQOQ 1Y07A 5GANg 1KD1C 2HNIA 1WXUA 2JS2A 2F69A 3I56A 4V2SA 4C5IA 5GANd 3E9FA 5DM7R 1VQ9A 2CREA 2H3EB 1VQLT 2I0NA 2ZPHB 3V8JA 2CSQA 3JCMX 5AT1B 3CCRT 4A4HA 4PJOC 3J80E 3LYIA 4L5GA 3OBWA 3JCMV 3CCMQ 2E12A 1YJ9A 1OX9A 2JM8A 1RI9A 2YUOA 4JZ3A 3HPWA 3CCUA 3OYBA 1M30A 3OSVA 1QVFA 3CD6Q 2K9GA 7AT1B 4KT0E 5HCKA 5KYWA 2JXBA 5DLQE 3M4YA 3EGXA 3M0TA 3FEOA 4M75G 3QHSA 3CC4A 4R0KA 1FWZA 3CCRA 3KFVA 5CKEA 2ED0A 1LOJA 2EGEA 1UFFA 1ZUYA 4IUTA 1IZ6A 2A0FB 1B34A 1IGUA 4IIOA 4XTXA 2QGGA 2DX1A 1Y96A 2MIOA 5L8RE 1YITT 2LX9A 4HVUA 2DEUA 4BE1A 1SRLA 1YFNA 2JTMA 2PU9B 3QKJA 1Q7YU 4IUPA 4HA8A 3KUFA 1PWTA 2EFIA 3CCEQ 2M9UA 4A53A 2DYBA 1R8OB 4PFZA 1M2VA 4PJOF 2KVQG 2E4HA 2RNAA 4FIBA 1VQ6Q 5AYFA 1AVZC 2LX7A 2DXCA 4M7DE 1T3SA 2J6FA 2JM9A 4KGXB 3P8BB 4M7DD 1XJWB 3AT1B 5DLOA 4JS5A 3JRZA 2LT4A 3G71A 3PTAA 3CCVT 3V8KA 4X1VA 2PZ1A 3SHWA 5FRMA 2NUZA 5DY9A 1Q86R 1U06A 3JB9J 4Z88A 2H8HA 1U1SA 2RHXA 1VIEA 4AMCA 1UEBA 4C92B 3TVTA 1RUWA 3H0IA 4M77E 1NYFA 1UG1A 3URGA 5HK3A 2X3XD 2DRMA 3OSSC 1VQ5Q 3CC7A 4AFQC 2RJFA 4PKCC 2OTJT 2HKQB 3TEEA 5J26A 2QA4A 2OTJQ 1U3OA 3JAME 1ZBXA 2YUNA 4JRIA 2DNUA 3C94A 2D0QB 3OW2P 2V1QA 3MHXA 3RKXA 5KYYA 3H9NA 4JJBA 2K5FA 3L2ZA 4FYVB 5KCHA 5IAYA 1HSQA 1KG1A 3QIIA 4C8QC 3M5AA 1OPKA 2ZPBB 5GANj 4MZMA 5GMKj 1LJOA 5A0LA 1Q81R 3OW2A 2L8DA 3HRTA 4JJDA 4JZ4A 4E7KA 1ZHIA 3A98A 3QWXX 4LDWA 4AFSC 1MV3A 2ROLA 2JMCA 3L1AA 4ZGEB 5KYXA 4BDYA 2KK4A 1VQOA 3QZ5B 4KUDK 4M7DG 4J9CA 4D8KA 4F16A 3OBYA 2NUTB 3E2UA 1S72A 1AWOA 2KY9A 1H92A 1Y7XA 2VXFA 3ER0A 1NPPA 2HEQA 4PJLA 4PNOA 2BUDA 2BE7D 2VGMA 3HKSA 2JTFA 3MEUA 3VRZA 1PC0A 3UF4A 3G6EQ 1YJ9Q 2HQHA 1IB8A 3L2RA 2RH2A 1D0YA 3CBOA 1Q86U 4E6RA 3SWNC 3L2QA 4C8QF 4GY5A 2GTOA 1QP2A 2EYQA 1W2BP 5HK0A 2KRMA 3I55Q 1Z9ZA 3OYMA 4B9XA 1BIBA 1C1AA 1E7OA 1TUDA 5C0MA 1YJNQ 4C92C 2L3QA 1YIJT 3NTHA 1VQKA 1WHJA 2HDAA 2KYBA 2XDDA 3QPHA 1J3TA 3CMET 2FPDA 3V8LA 1VQ5A 1BYMA 1YJWT 1H3ZA 3CC7Q 1GRIA 2MWOA 2RK2A 2LC4A 3QZ9B 1YCYA 2MI6A 4FL6A 4M77F 1M2OA 4PFOA 3M54A 1Y71A 3P8DA 1YHQQ 1Q82C 4JRQA 2J05A 1UHFA 3C12A 3CC2T 1I5LA 5CVIA 3OY9A 1EZZB 4JLGA 3RR6A 1AZGB 2RQWA 2DD5A 2JMAA 1NLOC 3VYGA 1VQ4A 1QVFP 2KT8A 2AHJB 2JJ9A 1PHTA 2C0IA 4LE9A 1Y96B 2DFUA 3V7RA 2QG9B 3THKA 4OMQA 2X35A 2KEAA 3EH2A 4NL2A 4PJOA 4KULA 3PMTA 2K7AA 1R0BG 4ME7A 4J9HA 4JJNK 3E19A 2E6ZA 1ARKA 4OB3B 4ANJA 1MV0B 4BE2A 3EG2A 2RQUA 2H3JA 3MO8A 1M9SA 2EQKA 4RTVA 3D7SB 4OGCA 4RMOA 5A0GA 1F1BB 2LP5A 1X69A 1K73U 1QQJA 2GCXA 2XKOC 3QDRB 4E7JA 2VB6A 1WHLA 1X01A 2YLBA 3V7SA 4BY6B 4KGVB 2OTLA 4M78D 3MEWA 1T3LA 2LCCA 4C92A 3OMCA 3FJPA 2X51A 2O31A 3M57A 5A0DA 1IHWA 1TTHB 2MMPA 4CI0C 1T0JA 1PD1A 2X4JA 4F7UB 3PNWC 2HQXA 4RCCA 5CCAA 3CCET 4FYYB 3JB9G 2RI2A 3LGFA 3BFMA 3CD6T 2EYWA 3RMQA 1UHCA 4HCBA 3CC4T 1W70A 2DJZA 4LDXA 2OAUA 1BI3A 1UJYA 1M1KU 2DKGA 3OYAA 4DOVA 1NM7A 1SKUB 3JB9I 2GGRA 5FROA 1D09B 2HMAA 3CCUT 2CZ1B 1YITA 2NUPB 3JCMe 4WTOB 3JB9H 1M2VB 1WNLA 4BDZA 2PVGB 3NGPA 3UATA 3OB9A 1I5OB 4M75E 4M75D 3QYHB 5GAOq 3GIBA 1VQ7A 2HAXA 1WIEA 1MHNA 4IUVA 3H41A 1VQPA 3L2WA 1VUBA 2CZ0B 1BI2A 3I5RA 3X25B 2ESWA 2CP5A 1JJ2A 3HSBA 4IUUA 1YI2A 1M4ZA 3DLMA 3ZEHA 1M8MA 2P4TA 4EDUA 2O88A 3VS5A 3LGLA 2ENMA 1HYOA 1WDXA 2D8JA 1E6HA 3LWIA 2DL5A 4R56A 4NOYA 3T9NA 1NJIU 2O4XB 3PVQA 4OMPA 1B7TA 4M4ZA 1YJ9T 5KYYB 3LX7A 4Q5WA 3A5ZB 3RNJA 5D6YA 3A8MB 4F17A 4A4GA 3BE3A 2ATCB 1K73C 1T0HA 5GANh 2DTIA 2ZPGB 3CBMA 5HY6A 3E9GA 2K57A 4C0ZA 3VYHB 4LD6A 1GL5A 4RCBA 3VS2A 4DQ2A 2RM4A 4A4KA 2FG0A 5IH2A 1IRXA 2EGAA 4UC4A 5LJ5h 1VYTA 4KBMB 1VQLA 2EYZA 3OYYA 2WACA 2KT1A 5LJ3d 1JB0E 1N6AA 2XD0A 2LCLA 3EG0A 2J7IA 4IKFA 2YUQA 2LJ1A 2DTHA 5GAN8 4XU3A 4ZTJA 1YHQA 2FPEA 5GAN2 5CKDA 2DZ9A 2MAMA 2EIFA 1UGRB 2FO0A 4F7UG 1B07A 4M7AA 2IPOB 2KE9A 3FC3A 2SRCA 3TCJA 4OGEA 4Z8AA 2V8JA 1N9SA 3H6ZA 2R58A 2XHCA 3J81E 2FVUA 3M59A 2O9VA 2DVJA 1WQWA 2CT3A 2F2WA 1WFWA 4X9CA 1ZSGA 5GMKi 3G71Q 5FLXE 1XNIA 2AZSA 1EX4A 2B8AA 2FHDA 1Q81C 3SD4A 1VQ7Q 1QMCA 2KGTA 1M27C 1NZ9A 1UTIA 3NTKA 3VUZA 4F7UA 1AEYA 1VYUA 2FZGB 3M55A 4CC2A 3RKYA 5HKCA 1UGQB 4OB1B 2DTOA 3L2UA 2OTLQ 3RMSA 5GAOp 3CC2A 3GP8A 3O5ZA 1VQ8Q 4WCIA 2EQUA 3CCLT 2EQMA 3QXEB 3UWNA 4BI3A 2VKNA 1RAFB 2K6DA 4XTZA 1MUZA 2E6NA 2LZ6B 1VQ4T 4AG1C 1QWEA 2L5QA 1TH7A 1ZUKA 1M1GA 3REAB 5KE3A 2PUOB 4D8DA 1H3HA 3MPUB 2JVVA 2R5AA 4JS4A 1K8AC 3VS0A 3OYHA 1QVGA 1W1FA 3CMAT 1D0XA 3SFMA 1ZA2B 3NTIA 5I2SA 5CIUA 3CBPA 3QYGB 2AKKA 4LDUA 3CCSQ 3LLRA 1SG5A 3LWHA 5I21A 1K4US 4EIKA 2RHYA 2HZYA 3CCLQ 2NWMA 2F5TX 4RG2A 1QKWA 2J6KA 5KYUA 4PLIA 5CQYA 3ME9A 2OJ2A 1OI1A 3CCRQ 3QSUA 1ZUUA 3JCMd 1M1FA 2E41A 1RAHB 2RI5A 3VUBA 3ZL7C 4J9BA 3CXCA 4J9IA 1Q86C 3X28B 5LJ3j 4FSSA 4WF2A 1NE8A 2KROA 2PUKB 3X20B 5LJ5d 2RMOA 2KI7A 1W2BS 3RBBB 2PNIA 1KD1R 3S3NA 2C0OA 3L2VA 2HD0A 3SWNA 1KD1U 3WXMB 5GMKh 2X3WD 2R57A 1BCMA 4C92E 5I11A 2CP0A 5GAN5 1I0CA 4BACA 3G71T 5D7UA 4GBQA 5LJ3f 3G4ST 1ZSZC 2QAZA 1NBEB 1V76A 1TSFA 4Z02A 3RESA 4GLMA 3CC2Q 2CYZB 2RK1A 2FL7A 2AK5A 4Z89A 2ED1A 2P0PA 1W2BA 2LQKA 5LJ5e 1G2BA 1I81A 1KQ1A 1WPYA 1QVPA 2DAQA 2AZVA 3REBB 3QJYA 2VV5A 5D6XA 2ZAEA 3C95A 4OMNA 4M7AE 1IO6A 3CC7T 2A36A 2AT1B 2OTJA 2P4RA 2XIDA 4JRKA 3JCMP 4KGZB 1QW1A 1UGSB 2EQJA 4J9EA 4O5VA 1Q82U 1WHMA 4A54A 3M53A 1KHIA 2RQVA 1JJ2S 4CRIA 1GBRA 4RUGA 3GPLA 5FU7C 1AD5A 2NLUA 2O4XA 2RHZA 1H641 2ZZDA 2SEMA 2B86A 2YT6A 2HSPA 1KFZA 4LDVA 3UDCA 1ABOA 2FRWA 5GAOr 5LJ3e 3AHUA 5GAMh 2QGFB 3G6ET 3OYJA 2DIQA 4M77G 1GBQA 1XTDA 3TSWA 3EAEA 1JBMA 2JW4A 5KE2A 3INZA 2E64A 1FMVA 2L3SA 2RJEA 2KYMA 1BCOA 1JEGA 4EMKA 3JV3A 1QP3A 1MMDA 5GJVB 3CCSA 2CZ7B 1KSWA 5FU7B 3JCMf 4M78B 4M75A 1UGVA 3RDVA 2X4WA 1M1KR 4FW1A 1MGQA 3QBYA 4TVRA 1PSFA 2DPPB 2FPFA 3OYGA 2W0ZA 2QQBA 4DOWA 4J9GA 4LUEA 2GQIA 4PJNA 3I55A 5FWBA 3CCQQ 2LNVA 2XICA 5FU6B 1C6VX 4A4EA 5LJ5j 2EYYA 2K5IA 1QVGP 1VQKQ 2VXEA 4D6WA 1OOTA 1QLYA 2E70A 1YHQT 1E6GA 2HKNA 2YHTA 1PRLC 3U23A 2EKHA 3JCMb 2NYSA 3G4SQ 1OU8A 2MK5A 4HT8A 2CZ6B 1MMGA 4OMMA 2MOXA 1K73R 2CH4W 2Y4XA 1YJWQ 2QXFA 4M7DF 3DLLA 3FDRA 1U1TA 4RTWA 4ORZA 4DBFA 4F04B 1UJ0A 2KRNA 2COZA 2P0QA 1WX6A 2JT4A 2M16A 1VQ5T 2JNGA 4C5HA 1VA7A 3CCJT 2JS0A 4BD3A 3HL8A 4J6WA 3HFOA 2DILA 4HVWA 3RERA 2XU8A 1TU0B 4RTUA 2IVWA 1YJNT 3C4SA 5GMKl 2A37A 2V8IA 1SPKA 2D6FA 1PKSA 3OS0A 2FZKB 1ZA1B 4AFZC 1RLPC 1YITQ 2J06A 1KC8R 2V1RA 4LDYA 5A2QE 1NEGA 3QO3A 1HK9A 5ECAA 4BB7A 4EMGA 3ULRB 2ZGWA 4II1A 4RTYA 2PVOB 2J6OA 2E10A 1ZBJA 4DEXA 2CDTA 3CMAQ 1NJIC 2DD4A 1SSFA 3M0PA 2JTEA 1LVKA 2HBWA 3CQTA 1XQHA 3FJ5A 5GJWB 3X24B 1WGSA 1R77A 4M7DA 2GNCA 4QVZA 1RADB 3CPWP 2QQAA 1K0SA 5KYUB 4M75C 5CKFA 1AZEA 5GAOn 4XTWA 3CCEA 2QDLA 2JZ2A 1KHCA 2K3XA 1VQOT 2FEIA 4ATOA 4JDSA 2DLPA 1S72T 1VQLQ 4HXJA 2CP3A 3NPFA 2O01E 3CPFA 2NUPA 3J7AF 4DA4A 2KXCA 3VS7A 3FB9A 1O9SA 2QEXA 2BE9B 2BZ8A 1FXXA 1AT1B 2G3RA 2LNHB 5D6WA 1VQ8T 2YRVA 1SRMA 1PCXA 4QQDA 2AKLA 1MNEA 3JCMJ 3WVEB 3VS1A 4ZGDB 4C8QB 3EHRA 3TSZA 1YN8A 1WLPB 1RL2A 2R5MA 2CUDA 4M78A 4M75B 4AT1B 2V26A 1OZ2A 3I55T 4J7IA 4QQ6A 3EGDA 1IREB 1QKXA 3GLXA 1M90C 1N8RR 4FU6A 5J39A 1SHFA 3FLGA 5KYXB 1VOMA 3CMEQ 4F14A 3KXTA 1JJ2P 2VWFA 1ZLMA 1YJWA 1QCNA 2CUBA 2L0AA 5EC7A 1X2QA 4XTYA 1WHKA 1ZQ1A 4OMOA 2M0OA 3VJPA 4ELYC 4VUBA 3M0SA 1TS9A 2HBPA 4EPCA 5KYWB 1ACMB 3QG1A 1K1ZA 1G3TA 1WJSA 3H8ZA 3CMAA 1YIJA 2M0YA 1I1JA 4EMKC 3I9QA 1PM3A 4M78G 2JN0A 2EW3A 5GMKe 1Y57A 1W6XA 1C0MA 3BDLA 1N8RU 3JCMW 2DETA 1B3QA 1NEBA 3EGDB 2A08A 3UA6A 1X43A 1Y0MA 4XAXB 2EQIA 2RO0A 4OP0A 1HXDA 2QTVA 4J6XA 3O8VA 3OW2S 2RHIA 4E7SA 3HRUA 4BI4A 4C0FA 4NS5A 2X9HA 3QWYA 3FIFA 2DJQA 1KQSA 2V8KA 1WHHA 5CQXA 1AHJB 3MEAA 4FT4A 2MF2A 2CGHA 1EIFA 1TUGB 2QEXQ 2DRKA 9ATCB 1K9MC 1TG0A 5IHIA 4EMKB 1BKBA 2GBQA 2YUPA 5KYNA 2FB7A 4C92D 2D0NA 2XK0A 1TXQA 3BW1A 3MP8A 2RN8A 2YRDA 2LCSA 2DL4A 3EFOB 2CH4A 2EVRA 4HVVA 2K3YA 1FMWA 1VQ8A 4FT2A 1K9MU 2EJGA 1AWWA 5GMKm 1NLPC 2EJFA 4LNPA 3SEMA 4LUDA 3RIRA 3CMEA 2EGCA 2RA2A 1X6BA 5LJ3g 4M7DB 4PJOB 4XK8E 2C06A 3R6NA 3MEVA 4N0AC 1LPLA 2OAWA 2RPNA 3QUIA 4OB0B 3EG9B 2L89A 2YSQA 5IT9E 2X4XA 1ZSZB 1S72Q 1OX8A 5GAN6 1NYGA 2KRSA 3CCQT 2D1XA 4C0DC 1WHGA 3JB9D 2A28A 2IG0A 3HP9A 4DBRA 1CKBA 2XI9A 3VU3C 5FU6C 1NG2A 2W10A 2COYA 4ESRA 4RTXA 2RQTA 3UPUA 3H0HA 4J6YA 1QVGS 3CCLA 2DL3A 2DL8A 1JXOA 3IQLA 3DB4A 4C5EA 1NJIR 3OYCA 1CKAA 3DKMA 2Z0WA 4XTUA 3TQ7P 1B34B 4ZGJB 3EFOA 1OQKA 2M1HA 5GAMe 1UUEA 5LJ3h 3M58A 1I4K1 2VGNA 4BUGA 4L59A 4MMKA 2YWWA 2DXUA 1BB9A 1DJ7B 2GFUA 4DEYA 2ZPIB 3EG1A 1VQNA 3JCMg 5IHNA 5CKHA 1V1CA 2FYKA 1WI7A 1X2KA 1M1KC 2RI3A 2QK0A 4K11A 1YI2T 1OYXA 3OYKA 3OYDA 4QKUA 4RKUE 1JXMA 1TOVA 4BI8B 1VQPT 5L23A 1LNXA 8AT1B 1WA7A 2KSSA 3VRYA 3NMZC 2PVDB 1D0ZA 4IUQA 4C8QG 2L3PA 3JSCA 4XTVA 4NL3A 1BU1A 1VQ4Q 2F5KA 3G1JA 4L6V5 4J5YA 3EHQA 4MZTA 6AT1B 5KCOA 2HCKA 1VQ9T 2EYXA 4M78C 2K5LA 3M4GA 4ZN1A 1BBZA 5CAIA 1CSKA 3OYFA 1Q95G 1ZX6A 4JRPA 3I5SA 1KK7A 3S6WA 3CCMA 3ZFJA 1X6GA 1RAGB 1BI1A 3UA7A 2KQWA 2MCNA 4AFUC 3I56T 4M7AF 4N0AA 1KQSP 2GTJA 5LL6S 1I8FA 3OYEA 2GQVA 1VIFA 3CXCP 2QDYB 3N5BB 4MMLA 2CP7A 3CXCS 5CK9A 4QT7A 1YWPA 5CO7A 1MMNA 4A4FA 4OMLA 2BZYA 1U8RA 3OYIA 4JLIA 5GAN4 2P84A 2RJCA 1KC8C 3PIOA 1GCQA 3OS2A 2EWNA 4MDXA 2HL3A 2F2VA 3LH5A 4PJOD 3H0FA 3MP6A 2ZPFB 2JUFA 3GF5A 4GLKA 1JQQA 3GNFB 4N4GA 2XDBA 2COWA 1YP5A 1YBYA 2KNBB 2O2OA 2DM1A 2LDMA 3OYLA 1GFDA 1PNJA 4AG2C 2PQWA 3QJ6A 1FX7A 5IXFA 3MCAB 2CS7A 4IIMA 4EMHA 1BIAA 3ZBDA 4OB2B 1KQSS 4PJOE 1W4SA 3CCJQ 2CT4A 4C0GA 2DXBA 4E7LA 2K3BA 4E2FB 5FWCA 1ZSZA 2DBMA 2DBKA 1P92A 1HD3A 3X26B 2QA4T 3F70A 4PJOG 4E47A 4B6MA 2E5KA 4ZNXA 4KRTA 1GFCA 3V7CA 1K9AA 2P0KA 1HJDA 4O6JA 3HRSA 1JU5C 1SEMA 3I35A 2BTTA 4RTTA 3Q1JA 4OF1A 5CKBA 1NPRA 3JCMh 1TUCA 4M7AC 3VS4A 3PFSA 3PGGA 2VC8A 1D1AA 2E3HA 2YLCA 5CR2A 3CCUQ 1WQ7A 4X9DA 3A8OB 2E65A 2E1HA 3TU4K 3OS5A 4C92G 3PVLA 5EG2A 1YWOA 3CPWA 3SDZA 3META 2KAFA 2K2VA 1K76A 2HL5C 3OYNA 3CC4Q 1Q7YR 2KXDA 5GAMf 2DO3A 3LH0A 4ZTFA 2EAYA 4CC3A 4HCKA 3NFCA 1PRMC 3G4SA 3CEYA 1AWXA 5J3BA 1OULA 1VQMA 1QCFA 2K4YA 2MWPA 3LW5E 3EG3A 5M9OA 3EG9A 5GAMd 1GXIE 3VS6A 5IN1A 1UGPB 1TWBA 1X75C 2QASA 2ZCFB 2XMFA 5IXBA 3RUXA 4C8QD 1D3BB 4E7IA 1N5ZA 1QCOA 1Q7YC 1G83A 2QTXA 3PIPA 2KBTA 1D1BA 1G8XA 3PE0A 1SHGA 4P5NA 3VS3A 3RKWA 4HT9A 4XU1A 1PSEA 2HQEA 5GAOl 1R0CB 5I2MA 1G3YA 3OQ5A 1I07A 2OX7A 2BZXA 2QQSA 1OZ3A 2EBPA 3PMIA 2EKOA 2A3LA 3OS1A 4JPBW 2MPXC 2DIGA 1G3SA 1OEBA 4KH1B 1WZOA 4M77D 1RLQC 3M56A 3TREA 4HKEA 2MYSA 4JJCA 2LQ8A 3E1SA 4M78E 2CKKA 1D1CA 3EGUA 4HCZA 1FYNA 2A7YA 1N9RA 2DZCA 4PK4A 1M5Q1 3P8HA 2F2XA 2GFAA 4HCCA 3CCJA 1QVFS 4C92F 2WSCE 2IIMA 1Z9QA 2BIVA 5LJ5g 3GBQA 2ABLA 2VYTA 2ROTA 2CSIA 1OPLA 2XDPA 4M77A 5FRNA 1YJNA 2C0TA 4A63B 2DA9A 1U5SA 5IHKA 4CC4B 2VUBA 3A1PA 1VQMT 1M3CA 1SSHA 3SB2A 1A0NB 1K8AU 2F1LA 2ECZA 8ATCB 2WSFE 5C6SA 2DEQA 4X34A 3MJXA 2VVKA 1X27A 4J9DA 2RD1A 4N4HA 3EGXB 2XG8D 2PTKA 3C0CA 1N27A 1YIJQ 2JOYA 1IHVA 2OI3A 2DE0X 2QI2A 4F7UE 4DBQA 3G6EA 3CCVA 4KUIA 4PJMA 2E5QA 2DERA 1PG5B 3S3OA 2GF7A 3M9QA 4ELZC 4FCYA 4C5GA 4C0DB 4ZN3A 4JUVA 1VQ9Q 1FMKA 2LVMA 1OU9A 4J9FA 4Y92A 4M7AG 5GAMj 4J8OA 1S1NA 1UECA 1KQ2A 4IURA 1H8KA 1RACB 4E7HA 1XOVA 1LCKA 4DBHA 1UE9A 1G3WA 1QWFA 2QQ9A 2LQNA 1MMAA 2RJDA 3OMGA 2I2LA 2LTOA 4LXCA 3EFSA 3PT9A 3NHNA 1OV3A 1K8AR 2AIRB 3CPWS 1PD0A 2Y90A 2FRYA 1VQ6T 1KIKA 4FW2A
chains in the Genus database with same CATH topology
2AZVA 4RTZA 3REBB 1ABQA 2J05A 4OMNA 1UHFA 1IO6A 2A36A 1BB9A 2P4RA 4DEYA 1BK2A 3EG1A 1AZGB 2RQWA 4J9EA 5IHNA 2JMAA 1V1CA 1NLOC 1WI7A 2KT8A 1X2KA 1PHTA 4K11A 2C0IA 4LE9A 2RQVA 1GBRA 4RUGA 3THKA 3M0RA 4OMQA 1AD5A 1JXMA 2O9SA 1KJWA 1M3AA 2KEAA 2K7AA 4LN2A 2SEMA 2B86A 2YT6A 4J9HA 1AWJA 1ARKA 5L23A 2HSPA 1KFZA 1MV0B 3EG2A 1WA7A 1ABOA 2FRWA 3VRYA 2RQUA 3NMZC 4RTVA 1WXTA 2L3PA 2K2MA 2LQWA 1AOJA 1GBQA 3TSWA 2LJ0A 2LP5A 1BU1A 2JW4A 1X69A 1K0XA 3EHQA 3M0QA 2HCKA 2EYXA 2L3SA 5I22A 2KYMA 1JEGA 3JV3A 1BBZA 2LMJA 1CSKA 1M3BA 1T3LA 1ZX6A 5GJVB 1KSWA 3I5SA 2KR3A 2O31A 2RF0A 1VYVA 1T0JA 1UGVA 1X6GA 3UA7A 2MCNA 4AFUC 2M51A 2FPFA 2LJ3A 2W0ZA 2EYWA 4J9GA 4LUEA 2GQIA 1UHCA 2GTJA 5FWBA 1YCSB 1W70A 2EYYA 1UJYA 2K79A 1OOTA 1QLYA 1NM7A 4QT7A 1E6GA 1YWPA 2GGRA 1PRLC 3U23A 2EKHA 4OMLA 2BZYA 2RQRA 4CC7A 1YNZA 1GCQC 3NGPA 3UATA 1GCQA 4OMMA 2MOXA 3M0UA 2CH4W 2F2VA 1UDLA 3LH5A 1WIEA 3H0FA 2DMOA 1WXBA 4RTWA 4ORZA 2DF6A 1UJ0A 3H41A 2KRNA 1JQQA 2G6FX 1YP5A 2KNBB 3I5RA 2O2OA 2DM1A 1WX6A 2ESWA 1WYXA 2JT4A 1GFDA 1PNJA 4AG2C 1EFNA 2D8HA 2DL7A 1VA7A 5IXFA 2YDLA 1M8MA 2JS0A 4IIMA 2O88A 2DILA 4HVWA 3VS5A 2EPDA 5FW9A 2ENMA 4RTUA 1WDXA 1GCPA 2CT4A 1JO8A 1E6HA 2D8JA 1PKTA 2A37A 2K3BA 2DL5A 5FWCA 2L2PA 1SPKA 2DBMA 2DBKA 1PKSA 1HD3A 3PVQA 4AFZC 1RLPC 4OMPA 2J06A 4M4ZA 2V1RA 1NEGA 3RNJA 2E5KA 5ECAA 2JS2A 1WXUA 4ZNXA 3ULRB 4KRTA 1GFCA 4RTYA 4F17A 2J6OA 1K9AA 1HJDA 1ZBJA 4DEXA 2CDTA 1JU5C 1SEMA 3I35A 2CREA 1T0HA 3M0PA 2JTEA 2BTTA 4RTTA 2I0NA 2CSQA 2HBWA 3CQTA 3FJ5A 5GJWB 1TUCA 2GNCA 3VS4A 1K0SA 1GL5A 3VS2A 1AZEA 2FG0A 2JM8A 1RI9A 2YUOA 4JZ3A 5IH2A 1M30A 2QDLA 2EGAA 2K9GA 5HCKA 1VYTA 2FEIA 2JXBA 3PVLA 2DLPA 1YWOA 3M0TA 2EYZA 1K76A 4HXJA 2KT1A 4R0KA 3NPFA 3KFVA 2KXDA 3EG0A 2ED0A 2J7IA 2EGEA 1UFFA 1ZUYA 2YUQA 2KXCA 2LJ1A 3VS7A 4CC3A 4HCKA 2FPEA 4IIOA 1PRMC 2BZ8A 1AWXA 2DX1A 2FO0A 2MIOA 2LNHB 1QCFA 1SRMA 1B07A 4HVUA 3EG3A 2KE9A 2AKLA 3VS6A 1SRLA 3VS1A 2SRCA 3EHRA 3TSZA 1YN8A 1PWTA 1WLPB 4Z8AA 2DYBA 2CUDA 2XMFA 5IXBA 2RNAA 1AVZC 2LX7A 1T3SA 2J6FA 2DVJA 1QKXA 2JM9A 2O9VA 2CT3A 1N5ZA 2F2WA 1G83A 1WFWA 1ZSGA 1SHFA 2KBTA 3PE0A 1SHGA 3VS3A 4X1VA 2AZSA 4F14A 2PZ1A 3SHWA 2NUZA 2VWFA 1U06A 1ZLMA 2CUBA 1I07A 2L0AA 2BZXA 4Z88A 2H8HA 2KGTA 5EC7A 1X2QA 1M27C 1UTIA 2EBPA 4OMOA 1AEYA 1VYUA 3TVTA 1RUWA 4JPBW 3M0SA 4CC2A 3H0IA 1OEBA 1RLQC 1K1ZA 1NYFA 1UG1A 2M0YA 1I1JA 2X3XD 2DRMA 3I9QA 4JJCA 2EW3A 4AFQC 1Y57A 1W6XA 3O5ZA 4WCIA 3EGUA 1FYNA 2VKNA 2K6DA 1U3OA 1B3QA 2YUNA 1MUZA 1NEBA 2LZ6B 2A08A 3UA6A 4AG1C 1X43A 2DNUA 1QWEA 1Y0MA 2EQIA 1ZUKA 2F2XA 3REAB 4D8DA 1H3HA 2V1QA 3VS0A 4JJBA 1W1FA 2IIMA 1Z9QA 3GBQA 2ABLA 1HSQA 2ROTA 2CSIA 1OPLA 2AKKA 1OPKA 2C0TA 3QWYA 1K4US 2DJQA 4EIKA 4A63B 2DA9A 1U5SA 5IHKA 4JJDA 4JZ4A 4CC4B 3A98A 3QWXX 4AFSC 1MV3A 2ROLA 1M3CA 1SSHA 2DRKA 2JMCA 2NWMA 1QKWA 1TG0A 5IHIA 1A0NB 2J6KA 4J9CA 4D8KA 4F16A 2ECZA 2OJ2A 1AWOA 2GBQA 2YUPA 1ZUUA 1H92A 2D0NA 2VVKA 1X27A 4J9DA 2HEQA 2RN8A 3C0CA 2PTKA 2LCSA 2DL4A 3ZL7C 4J9BA 2CH4A 2OI3A 2DE0X 2EVRA 4HVVA 4J9IA 3VRZA 3UF4A 4FSSA 1AWWA 2KROA 1NLPC 2RMOA 4LNPA 3SEMA 4LUDA 3RBBB 2PNIA 2EGCA 1X6BA 3R6NA 2C0OA 4E6RA 2OAWA 2RPNA 1FMKA 2YSQA 2X3WD 2GTOA 4J9FA 4Y92A 1S1NA 1UECA 2KRMA 1Z9ZA 1NYGA 2KRSA 5I11A 1H8KA 1E7OA 2D1XA 1XOVA 1LCKA 1TUDA 1I0CA 2A28A 1UE9A 2L3QA 1CKBA 1QWFA 4GBQA 2HDAA 2KYBA 2LQNA 1NG2A 2W10A 1J3TA 4ESRA 4RTXA 2RQTA 3H0HA 2DL3A 2DL8A 1JXOA 2FPDA 3IQLA 4GLMA 1GRIA 3NHNA 1OV3A 1CKAA 2AK5A 4Z89A 2ED1A 2FRYA 1KIKA 1UUEA 1G2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZV A;  4RTZ A;  3REB B;  1ABQ A;  2J05 A;  4OMN A;  1UHF A;  1IO6 A;  2A36 A;  1BB9 A;  2P4R A;  4DEY A;  1BK2 A;  3EG1 A;  1AZG B;  2RQW A;  4J9E A;  5IHN A;  2JMA A;  1V1C A;  1NLO C;  1WI7 A;  2KT8 A;  1X2K A;  1PHT A;  4K11 A;  2C0I A;  4LE9 A;  2RQV A;  1GBR A;  4RUG A;  3THK A;  3M0R A;  4OMQ A;  1AD5 A;  1JXM A;  2O9S A;  1KJW A;  1M3A A;  2KEA A;  2K7A A;  4LN2 A;  2SEM A;  2B86 A;  2YT6 A;  4J9H A;  1AWJ A;  1ARK A;  5L23 A;  2HSP A;  1KFZ A;  1MV0 B;  3EG2 A;  1WA7 A;  1ABO A;  2FRW A;  3VRY A;  2RQU A;  3NMZ C;  4RTV A;  1WXT A;  2L3P A;  2K2M A;  2LQW A;  1AOJ A;  1GBQ A;  3TSW A;  2LJ0 A;  2LP5 A;  1BU1 A;  2JW4 A;  1X69 A;  1K0X A;  3EHQ A;  3M0Q A;  2HCK A;  2EYX A;  2L3S A;  5I22 A;  2KYM A;  1JEG A;  3JV3 A;  1BBZ A;  2LMJ A;  1CSK A;  1M3B A;  1T3L A;  1ZX6 A;  5GJV B;  1KSW A;  3I5S A;  2KR3 A;  2O31 A;  2RF0 A;  1VYV A;  1T0J A;  1UGV A;  1X6G A;  3UA7 A;  2MCN A;  4AFU C;  2M51 A;  2FPF A;  2LJ3 A;  2W0Z A;  2EYW A;  4J9G A;  4LUE A;  2GQI A;  1UHC A;  2GTJ A;  5FWB A;  1YCS B;  1W70 A;  2EYY A;  1UJY A;  2K79 A;  1OOT A;  1QLY A;  1NM7 A;  4QT7 A;  1E6G A;  1YWP A;  2GGR A;  1PRL C;  3U23 A;  2EKH A;  4OML A;  2BZY A;  2RQR A;  4CC7 A;  1YNZ A;  1GCQ C;  3NGP A;  3UAT A;  1GCQ A;  4OMM A;  2MOX A;  3M0U A;  2CH4 W;  2F2V A;  1UDL A;  3LH5 A;  1WIE A;  3H0F A;  2DMO A;  1WXB A;  4RTW A;  4ORZ A;  2DF6 A;  1UJ0 A;  3H41 A;  2KRN A;  1JQQ A;  2G6F X;  1YP5 A;  2KNB B;  3I5R A;  2O2O A;  2DM1 A;  1WX6 A;  2ESW A;  1WYX A;  2JT4 A;  1GFD A;  1PNJ A;  4AG2 C;  1EFN A;  2D8H A;  2DL7 A;  1VA7 A;  5IXF A;  2YDL A;  1M8M A;  2JS0 A;  4IIM A;  2O88 A;  2DIL A;  4HVW A;  3VS5 A;  2EPD A;  5FW9 A;  2ENM A;  4RTU A;  1WDX A;  1GCP A;  2CT4 A;  1JO8 A;  1E6H A;  2D8J A;  1PKT A;  2A37 A;  2K3B A;  2DL5 A;  5FWC A;  2L2P A;  1SPK A;  2DBM A;  2DBK A;  1PKS A;  1HD3 A;  3PVQ A;  4AFZ C;  1RLP C;  4OMP A;  2J06 A;  4M4Z A;  2V1R A;  1NEG A;  3RNJ A;  2E5K A;  5ECA A;  2JS2 A;  1WXU A;  4ZNX A;  3ULR B;  4KRT A;  1GFC A;  4RTY A;  4F17 A;  2J6O A;  1K9A A;  1HJD A;  1ZBJ A;  4DEX A;  2CDT A;  1JU5 C;  1SEM A;  3I35 A;  2CRE A;  1T0H A;  3M0P A;  2JTE A;  2BTT A;  4RTT A;  2I0N A;  2CSQ A;  2HBW A;  3CQT A;  3FJ5 A;  5GJW B;  1TUC A;  2GNC A;  3VS4 A;  1K0S A;  1GL5 A;  3VS2 A;  1AZE A;  2FG0 A;  2JM8 A;  1RI9 A;  2YUO A;  4JZ3 A;  5IH2 A;  1M30 A;  2QDL A;  2EGA A;  2K9G A;  5HCK A;  1VYT A;  2FEI A;  2JXB A;  3PVL A;  2DLP A;  1YWO A;  3M0T A;  2EYZ A;  1K76 A;  4HXJ A;  2KT1 A;  4R0K A;  3NPF A;  3KFV A;  2KXD A;  3EG0 A;  2ED0 A;  2J7I A;  2EGE A;  1UFF A;  1ZUY A;  2YUQ A;  2KXC A;  2LJ1 A;  3VS7 A;  4CC3 A;  4HCK A;  2FPE A;  4IIO A;  1PRM C;  2BZ8 A;  1AWX A;  2DX1 A;  2FO0 A;  2MIO A;  2LNH B;  1QCF A;  1SRM A;  1B07 A;  4HVU A;  3EG3 A;  2KE9 A;  2AKL A;  3VS6 A;  1SRL A;  3VS1 A;  2SRC A;  3EHR A;  3TSZ A;  1YN8 A;  1PWT A;  1WLP B;  4Z8A A;  2DYB A;  2CUD A;  2XMF A;  5IXB A;  2RNA A;  1AVZ C;  2LX7 A;  1T3S A;  2J6F A;  2DVJ A;  1QKX A;  2JM9 A;  2O9V A;  2CT3 A;  1N5Z A;  2F2W A;  1G83 A;  1WFW A;  1ZSG A;  1SHF A;  2KBT A;  3PE0 A;  1SHG A;  3VS3 A;  4X1V A;  2AZS A;  4F14 A;  2PZ1 A;  3SHW A;  2NUZ A;  2VWF A;  1U06 A;  1ZLM A;  2CUB A;  1I07 A;  2L0A A;  2BZX A;  4Z88 A;  2H8H A;  2KGT A;  5EC7 A;  1X2Q A;  1M27 C;  1UTI A;  2EBP A;  4OMO A;  1AEY A;  1VYU A;  3TVT A;  1RUW A;  4JPB W;  3M0S A;  4CC2 A;  3H0I A;  1OEB A;  1RLQ C;  1K1Z A;  1NYF A;  1UG1 A;  2M0Y A;  1I1J A;  2X3X D;  2DRM A;  3I9Q A;  4JJC A;  2EW3 A;  4AFQ C;  1Y57 A;  1W6X A;  3O5Z A;  4WCI A;  3EGU A;  1FYN A;  2VKN A;  2K6D A;  1U3O A;  1B3Q A;  2YUN A;  1MUZ A;  1NEB A;  2LZ6 B;  2A08 A;  3UA6 A;  4AG1 C;  1X43 A;  2DNU A;  1QWE A;  1Y0M A;  2EQI A;  1ZUK A;  2F2X A;  3REA B;  4D8D A;  1H3H A;  2V1Q A;  3VS0 A;  4JJB A;  1W1F A;  2IIM A;  1Z9Q A;  3GBQ A;  2ABL A;  1HSQ A;  2ROT A;  2CSI A;  1OPL A;  2AKK A;  1OPK A;  2C0T A;  3QWY A;  1K4U S;  2DJQ A;  4EIK A;  4A63 B;  2DA9 A;  1U5S A;  5IHK A;  4JJD A;  4JZ4 A;  4CC4 B;  3A98 A;  3QWX X;  4AFS C;  1MV3 A;  2ROL A;  1M3C A;  1SSH A;  2DRK A;  2JMC A;  2NWM A;  1QKW A;  1TG0 A;  5IHI A;  1A0N B;  2J6K A;  4J9C A;  4D8K A;  4F16 A;  2ECZ A;  2OJ2 A;  1AWO A;  2GBQ A;  2YUP A;  1ZUU A;  1H92 A;  2D0N A;  2VVK A;  1X27 A;  4J9D A;  2HEQ A;  2RN8 A;  3C0C A;  2PTK A;  2LCS A;  2DL4 A;  3ZL7 C;  4J9B A;  2CH4 A;  2OI3 A;  2DE0 X;  2EVR A;  4HVV A;  4J9I A;  3VRZ A;  3UF4 A;  4FSS A;  1AWW A;  2KRO A;  1NLP C;  2RMO A;  4LNP A;  3SEM A;  4LUD A;  3RBB B;  2PNI A;  2EGC A;  1X6B A;  3R6N A;  2C0O A;  4E6R A;  2OAW A;  2RPN A;  1FMK A;  2YSQ A;  2X3W D;  2GTO A;  4J9F A;  4Y92 A;  1S1N A;  1UEC A;  2KRM A;  1Z9Z A;  1NYG A;  2KRS A;  5I11 A;  1H8K A;  1E7O A;  2D1X A;  1XOV A;  1LCK A;  1TUD A;  1I0C A;  2A28 A;  1UE9 A;  2L3Q A;  1CKB A;  1QWF A;  4GBQ A;  2HDA A;  2KYB A;  2LQN A;  1NG2 A;  2W10 A;  1J3T A;  4ESR A;  4RTX A;  2RQT A;  3H0H A;  2DL3 A;  2DL8 A;  1JXO A;  2FPD A;  3IQL A;  4GLM A;  1GRI A;  3NHN A;  1OV3 A;  1CKA A;  2AK5 A;  4Z89 A;  2ED1 A;  2FRY A;  1KIK A;  1UUE A;  1G2B A; 
#chains in the Genus database with same CATH topology
 4OVA A;  4RTZ A;  1ABQ A;  5GAO m;  1RAB B;  4PJJ A;  5GAN e;  4M7A D;  5GAN 3;  1WJR A;  1D3B A;  2ZPE B;  1M90 U;  5GAN f;  2L3R A;  4PFP A;  1BK2 A;  3HTR A;  4BE0 A;  3I56 Q;  3OA6 A;  3A8L B;  2Y4Y A;  2HSE B;  3M0R A;  1VQ6 A;  3JCM Q;  5GAN 7;  4Y28 E;  2O9S A;  4YTL A;  1KJW A;  1M3A A;  4MDW A;  4M77 C;  4LN2 A;  3SWN B;  4LD9 K;  2KDS A;  1M90 R;  1AWJ A;  3L42 A;  4B9W A;  3S3M A;  3A8G B;  4QVD A;  2LRQ A;  2DYI A;  1JRI A;  2M02 A;  1WXT A;  3G7Z A;  1VQM Q;  2K2M A;  2LQW A;  4XU2 A;  3MKD A;  3UT1 A;  1AOJ A;  3CCM T;  3DB3 A;  2LJ0 A;  3HFN A;  4XQ3 A;  3JB9 F;  4QVC A;  1K0X A;  2WSE E;  3CD6 A;  4KH0 B;  3M0Q A;  3A8H B;  5I22 A;  2D9T A;  4PL6 A;  1Q82 R;  4C8Q A;  2LMJ A;  1M3B A;  1VQP Q;  2QEX T;  2KR3 A;  2RF0 A;  1SF9 A;  1Q81 U;  2QA4 Q;  1VYV A;  1VQK T;  2DK3 A;  3GNG A;  3R6O A;  4FM4 B;  4M77 B;  1UB4 A;  4J83 A;  1YI2 Q;  2M51 A;  4FYX B;  3FRN A;  2LJ3 A;  4E7Z A;  5LJ5 f;  1IGQ A;  2RHU A;  1YCS B;  1WJQ A;  2RB6 A;  4OMF B;  3EFR A;  2KMT A;  4MZP A;  3HHT B;  1X6O A;  2E3I A;  3CCV Q;  2K79 A;  2YXY A;  3CCS T;  5KH6 A;  3EH1 A;  2QYZ A;  1RAE B;  3VKI A;  2BKD N;  2RQR A;  1G5V A;  4F7U F;  3KBG A;  4CC7 A;  4QQG A;  1YNZ A;  2CP2 A;  1VQN T;  3JCM c;  1GCQ C;  4M78 F;  3BY7 A;  4QW2 A;  1K9M R;  2DVE A;  3M0U A;  3QDF A;  1V29 B;  1UDL A;  4M7A B;  2DXT A;  2DMO A;  4C8Q E;  1WXB A;  3CCQ A;  4Y91 A;  1M8V A;  2CP6 A;  2DF6 A;  2EJ9 A;  4N4I A;  2YRC A;  1MND A;  3VV0 A;  3GOX A;  1VQN Q;  2G6F X;  4R55 A;  2LT1 A;  4FYW B;  4RG8 A;  2X4Y A;  3MP1 A;  1WYX A;  2VAS A;  3BDU A;  1RAA B;  1EFN A;  4PLL A;  2D8H A;  2DL7 A;  2QQR A;  1KC8 U;  1VQ7 T;  2YDL A;  3WVD B;  1BI0 A;  4M7D C;  4J7F A;  2EPD A;  5FW9 A;  1IXD A;  1GCP A;  1JO8 A;  5GAM g;  4FSX A;  1PKT A;  2OTL T;  4M75 F;  2L2P A;  4XU0 A;  1N8R C;  2NUT A;  2FZC B;  1RAI B;  1RI0 A;  1O75 A;  4BY6 C;  3ASK A;  1VQO Q;  1Y07 A;  5GAN g;  1KD1 C;  2HNI A;  1WXU A;  2JS2 A;  2F69 A;  3I56 A;  4V2S A;  4C5I A;  5GAN d;  3E9F A;  5DM7 R;  1VQ9 A;  2CRE A;  2H3E B;  1VQL T;  2I0N A;  2ZPH B;  3V8J A;  2CSQ A;  3JCM X;  5AT1 B;  3CCR T;  4A4H A;  4PJO C;  3J80 E;  3LYI A;  4L5G A;  3OBW A;  3JCM V;  3CCM Q;  2E12 A;  1YJ9 A;  1OX9 A;  2JM8 A;  1RI9 A;  2YUO A;  4JZ3 A;  3HPW A;  3CCU A;  3OYB A;  1M30 A;  3OSV A;  1QVF A;  3CD6 Q;  2K9G A;  7AT1 B;  4KT0 E;  5HCK A;  5KYW A;  2JXB A;  5DLQ E;  3M4Y A;  3EGX A;  3M0T A;  3FEO A;  4M75 G;  3QHS A;  3CC4 A;  4R0K A;  1FWZ A;  3CCR A;  3KFV A;  5CKE A;  2ED0 A;  1LOJ A;  2EGE A;  1UFF A;  1ZUY A;  4IUT A;  1IZ6 A;  2A0F B;  1B34 A;  1IGU A;  4IIO A;  4XTX A;  2QGG A;  2DX1 A;  1Y96 A;  2MIO A;  5L8R E;  1YIT T;  2LX9 A;  4HVU A;  2DEU A;  4BE1 A;  1SRL A;  1YFN A;  2JTM A;  2PU9 B;  3QKJ A;  1Q7Y U;  4IUP A;  4HA8 A;  3KUF A;  1PWT A;  2EFI A;  3CCE Q;  2M9U A;  4A53 A;  2DYB A;  1R8O B;  4PFZ A;  1M2V A;  4PJO F;  2KVQ G;  2E4H A;  2RNA A;  4FIB A;  1VQ6 Q;  5AYF A;  1AVZ C;  2LX7 A;  2DXC A;  4M7D E;  1T3S A;  2J6F A;  2JM9 A;  4KGX B;  3P8B B;  4M7D D;  1XJW B;  3AT1 B;  5DLO A;  4JS5 A;  3JRZ A;  2LT4 A;  3G71 A;  3PTA A;  3CCV T;  3V8K A;  4X1V A;  2PZ1 A;  3SHW A;  5FRM A;  2NUZ A;  5DY9 A;  1Q86 R;  1U06 A;  3JB9 J;  4Z88 A;  2H8H A;  1U1S A;  2RHX A;  1VIE A;  4AMC A;  1UEB A;  4C92 B;  3TVT A;  1RUW A;  3H0I A;  4M77 E;  1NYF A;  1UG1 A;  3URG A;  5HK3 A;  2X3X D;  2DRM A;  3OSS C;  1VQ5 Q;  3CC7 A;  4AFQ C;  2RJF A;  4PKC C;  2OTJ T;  2HKQ B;  3TEE A;  5J26 A;  2QA4 A;  2OTJ Q;  1U3O A;  3JAM E;  1ZBX A;  2YUN A;  4JRI A;  2DNU A;  3C94 A;  2D0Q B;  3OW2 P;  2V1Q A;  3MHX A;  3RKX A;  5KYY A;  3H9N A;  4JJB A;  2K5F A;  3L2Z A;  4FYV B;  5KCH A;  5IAY A;  1HSQ A;  1KG1 A;  3QII A;  4C8Q C;  3M5A A;  1OPK A;  2ZPB B;  5GAN j;  4MZM A;  5GMK j;  1LJO A;  5A0L A;  1Q81 R;  3OW2 A;  2L8D A;  3HRT A;  4JJD A;  4JZ4 A;  4E7K A;  1ZHI A;  3A98 A;  3QWX X;  4LDW A;  4AFS C;  1MV3 A;  2ROL A;  2JMC A;  3L1A A;  4ZGE B;  5KYX A;  4BDY A;  2KK4 A;  1VQO A;  3QZ5 B;  4KUD K;  4M7D G;  4J9C A;  4D8K A;  4F16 A;  3OBY A;  2NUT B;  3E2U A;  1S72 A;  1AWO A;  2KY9 A;  1H92 A;  1Y7X A;  2VXF A;  3ER0 A;  1NPP A;  2HEQ A;  4PJL A;  4PNO A;  2BUD A;  2BE7 D;  2VGM A;  3HKS A;  2JTF A;  3MEU A;  3VRZ A;  1PC0 A;  3UF4 A;  3G6E Q;  1YJ9 Q;  2HQH A;  1IB8 A;  3L2R A;  2RH2 A;  1D0Y A;  3CBO A;  1Q86 U;  4E6R A;  3SWN C;  3L2Q A;  4C8Q F;  4GY5 A;  2GTO A;  1QP2 A;  2EYQ A;  1W2B P;  5HK0 A;  2KRM A;  3I55 Q;  1Z9Z A;  3OYM A;  4B9X A;  1BIB A;  1C1A A;  1E7O A;  1TUD A;  5C0M A;  1YJN Q;  4C92 C;  2L3Q A;  1YIJ T;  3NTH A;  1VQK A;  1WHJ A;  2HDA A;  2KYB A;  2XDD A;  3QPH A;  1J3T A;  3CME T;  2FPD A;  3V8L A;  1VQ5 A;  1BYM A;  1YJW T;  1H3Z A;  3CC7 Q;  1GRI A;  2MWO A;  2RK2 A;  2LC4 A;  3QZ9 B;  1YCY A;  2MI6 A;  4FL6 A;  4M77 F;  1M2O A;  4PFO A;  3M54 A;  1Y71 A;  3P8D A;  1YHQ Q;  1Q82 C;  4JRQ A;  2J05 A;  1UHF A;  3C12 A;  3CC2 T;  1I5L A;  5CVI A;  3OY9 A;  1EZZ B;  4JLG A;  3RR6 A;  1AZG B;  2RQW A;  2DD5 A;  2JMA A;  1NLO C;  3VYG A;  1VQ4 A;  1QVF P;  2KT8 A;  2AHJ B;  2JJ9 A;  1PHT A;  2C0I A;  4LE9 A;  1Y96 B;  2DFU A;  3V7R A;  2QG9 B;  3THK A;  4OMQ A;  2X35 A;  2KEA A;  3EH2 A;  4NL2 A;  4PJO A;  4KUL A;  3PMT A;  2K7A A;  1R0B G;  4ME7 A;  4J9H A;  4JJN K;  3E19 A;  2E6Z A;  1ARK A;  4OB3 B;  4ANJ A;  1MV0 B;  4BE2 A;  3EG2 A;  2RQU A;  2H3J A;  3MO8 A;  1M9S A;  2EQK A;  4RTV A;  3D7S B;  4OGC A;  4RMO A;  5A0G A;  1F1B B;  2LP5 A;  1X69 A;  1K73 U;  1QQJ A;  2GCX A;  2XKO C;  3QDR B;  4E7J A;  2VB6 A;  1WHL A;  1X01 A;  2YLB A;  3V7S A;  4BY6 B;  4KGV B;  2OTL A;  4M78 D;  3MEW A;  1T3L A;  2LCC A;  4C92 A;  3OMC A;  3FJP A;  2X51 A;  2O31 A;  3M57 A;  5A0D A;  1IHW A;  1TTH B;  2MMP A;  4CI0 C;  1T0J A;  1PD1 A;  2X4J A;  4F7U B;  3PNW C;  2HQX A;  4RCC A;  5CCA A;  3CCE T;  4FYY B;  3JB9 G;  2RI2 A;  3LGF A;  3BFM A;  3CD6 T;  2EYW A;  3RMQ A;  1UHC A;  4HCB A;  3CC4 T;  1W70 A;  2DJZ A;  4LDX A;  2OAU A;  1BI3 A;  1UJY A;  1M1K U;  2DKG A;  3OYA A;  4DOV A;  1NM7 A;  1SKU B;  3JB9 I;  2GGR A;  5FRO A;  1D09 B;  2HMA A;  3CCU T;  2CZ1 B;  1YIT A;  2NUP B;  3JCM e;  4WTO B;  3JB9 H;  1M2V B;  1WNL A;  4BDZ A;  2PVG B;  3NGP A;  3UAT A;  3OB9 A;  1I5O B;  4M75 E;  4M75 D;  3QYH B;  5GAO q;  3GIB A;  1VQ7 A;  2HAX A;  1WIE A;  1MHN A;  4IUV A;  3H41 A;  1VQP A;  3L2W A;  1VUB A;  2CZ0 B;  1BI2 A;  3I5R A;  3X25 B;  2ESW A;  2CP5 A;  1JJ2 A;  3HSB A;  4IUU A;  1YI2 A;  1M4Z A;  3DLM A;  3ZEH A;  1M8M A;  2P4T A;  4EDU A;  2O88 A;  3VS5 A;  3LGL A;  2ENM A;  1HYO A;  1WDX A;  2D8J A;  1E6H A;  3LWI A;  2DL5 A;  4R56 A;  4NOY A;  3T9N A;  1NJI U;  2O4X B;  3PVQ A;  4OMP A;  1B7T A;  4M4Z A;  1YJ9 T;  5KYY B;  3LX7 A;  4Q5W A;  3A5Z B;  3RNJ A;  5D6Y A;  3A8M B;  4F17 A;  4A4G A;  3BE3 A;  2ATC B;  1K73 C;  1T0H A;  5GAN h;  2DTI A;  2ZPG B;  3CBM A;  5HY6 A;  3E9G A;  2K57 A;  4C0Z A;  3VYH B;  4LD6 A;  1GL5 A;  4RCB A;  3VS2 A;  4DQ2 A;  2RM4 A;  4A4K A;  2FG0 A;  5IH2 A;  1IRX A;  2EGA A;  4UC4 A;  5LJ5 h;  1VYT A;  4KBM B;  1VQL A;  2EYZ A;  3OYY A;  2WAC A;  2KT1 A;  5LJ3 d;  1JB0 E;  1N6A A;  2XD0 A;  2LCL A;  3EG0 A;  2J7I A;  4IKF A;  2YUQ A;  2LJ1 A;  2DTH A;  5GAN 8;  4XU3 A;  4ZTJ A;  1YHQ A;  2FPE A;  5GAN 2;  5CKD A;  2DZ9 A;  2MAM A;  2EIF A;  1UGR B;  2FO0 A;  4F7U G;  1B07 A;  4M7A A;  2IPO B;  2KE9 A;  3FC3 A;  2SRC A;  3TCJ A;  4OGE A;  4Z8A A;  2V8J A;  1N9S A;  3H6Z A;  2R58 A;  2XHC A;  3J81 E;  2FVU A;  3M59 A;  2O9V A;  2DVJ A;  1WQW A;  2CT3 A;  2F2W A;  1WFW A;  4X9C A;  1ZSG A;  5GMK i;  3G71 Q;  5FLX E;  1XNI A;  2AZS A;  1EX4 A;  2B8A A;  2FHD A;  1Q81 C;  3SD4 A;  1VQ7 Q;  1QMC A;  2KGT A;  1M27 C;  1NZ9 A;  1UTI A;  3NTK A;  3VUZ A;  4F7U A;  1AEY A;  1VYU A;  2FZG B;  3M55 A;  4CC2 A;  3RKY A;  5HKC A;  1UGQ B;  4OB1 B;  2DTO A;  3L2U A;  2OTL Q;  3RMS A;  5GAO p;  3CC2 A;  3GP8 A;  3O5Z A;  1VQ8 Q;  4WCI A;  2EQU A;  3CCL T;  2EQM A;  3QXE B;  3UWN A;  4BI3 A;  2VKN A;  1RAF B;  2K6D A;  4XTZ A;  1MUZ A;  2E6N A;  2LZ6 B;  1VQ4 T;  4AG1 C;  1QWE A;  2L5Q A;  1TH7 A;  1ZUK A;  1M1G A;  3REA B;  5KE3 A;  2PUO B;  4D8D A;  1H3H A;  3MPU B;  2JVV A;  2R5A A;  4JS4 A;  1K8A C;  3VS0 A;  3OYH A;  1QVG A;  1W1F A;  3CMA T;  1D0X A;  3SFM A;  1ZA2 B;  3NTI A;  5I2S A;  5CIU A;  3CBP A;  3QYG B;  2AKK A;  4LDU A;  3CCS Q;  3LLR A;  1SG5 A;  3LWH A;  5I21 A;  1K4U S;  4EIK A;  2RHY A;  2HZY A;  3CCL Q;  2NWM A;  2F5T X;  4RG2 A;  1QKW A;  2J6K A;  5KYU A;  4PLI A;  5CQY A;  3ME9 A;  2OJ2 A;  1OI1 A;  3CCR Q;  3QSU A;  1ZUU A;  3JCM d;  1M1F A;  2E41 A;  1RAH B;  2RI5 A;  3VUB A;  3ZL7 C;  4J9B A;  3CXC A;  4J9I A;  1Q86 C;  3X28 B;  5LJ3 j;  4FSS A;  4WF2 A;  1NE8 A;  2KRO A;  2PUK B;  3X20 B;  5LJ5 d;  2RMO A;  2KI7 A;  1W2B S;  3RBB B;  2PNI A;  1KD1 R;  3S3N A;  2C0O A;  3L2V A;  2HD0 A;  3SWN A;  1KD1 U;  3WXM B;  5GMK h;  2X3W D;  2R57 A;  1BCM A;  4C92 E;  5I11 A;  2CP0 A;  5GAN 5;  1I0C A;  4BAC A;  3G71 T;  5D7U A;  4GBQ A;  5LJ3 f;  3G4S T;  1ZSZ C;  2QAZ A;  1NBE B;  1V76 A;  1TSF A;  4Z02 A;  3RES A;  4GLM A;  3CC2 Q;  2CYZ B;  2RK1 A;  2FL7 A;  2AK5 A;  4Z89 A;  2ED1 A;  2P0P A;  1W2B A;  2LQK A;  5LJ5 e;  1G2B A;  1I81 A;  1KQ1 A;  1WPY A;  1QVP A;  2DAQ A;  2AZV A;  3REB B;  3QJY A;  2VV5 A;  5D6X A;  2ZAE A;  3C95 A;  4OMN A;  4M7A E;  1IO6 A;  3CC7 T;  2A36 A;  2AT1 B;  2OTJ A;  2P4R A;  2XID A;  4JRK A;  3JCM P;  4KGZ B;  1QW1 A;  1UGS B;  2EQJ A;  4J9E A;  4O5V A;  1Q82 U;  1WHM A;  4A54 A;  3M53 A;  1KHI A;  2RQV A;  1JJ2 S;  4CRI A;  1GBR A;  4RUG A;  3GPL A;  5FU7 C;  1AD5 A;  2NLU A;  2O4X A;  2RHZ A;  1H64 1;  2ZZD A;  2SEM A;  2B86 A;  2YT6 A;  2HSP A;  1KFZ A;  4LDV A;  3UDC A;  1ABO A;  2FRW A;  5GAO r;  5LJ3 e;  3AHU A;  5GAM h;  2QGF B;  3G6E T;  3OYJ A;  2DIQ A;  4M77 G;  1GBQ A;  1XTD A;  3TSW A;  3EAE A;  1JBM A;  2JW4 A;  5KE2 A;  3INZ A;  2E64 A;  1FMV A;  2L3S A;  2RJE A;  2KYM A;  1BCO A;  1JEG A;  4EMK A;  3JV3 A;  1QP3 A;  1MMD A;  5GJV B;  3CCS A;  2CZ7 B;  1KSW A;  5FU7 B;  3JCM f;  4M78 B;  4M75 A;  1UGV A;  3RDV A;  2X4W A;  1M1K R;  4FW1 A;  1MGQ A;  3QBY A;  4TVR A;  1PSF A;  2DPP B;  2FPF A;  3OYG A;  2W0Z A;  2QQB A;  4DOW A;  4J9G A;  4LUE A;  2GQI A;  4PJN A;  3I55 A;  5FWB A;  3CCQ Q;  2LNV A;  2XIC A;  5FU6 B;  1C6V X;  4A4E A;  5LJ5 j;  2EYY A;  2K5I A;  1QVG P;  1VQK Q;  2VXE A;  4D6W A;  1OOT A;  1QLY A;  2E70 A;  1YHQ T;  1E6G A;  2HKN A;  2YHT A;  1PRL C;  3U23 A;  2EKH A;  3JCM b;  2NYS A;  3G4S Q;  1OU8 A;  2MK5 A;  4HT8 A;  2CZ6 B;  1MMG A;  4OMM A;  2MOX A;  1K73 R;  2CH4 W;  2Y4X A;  1YJW Q;  2QXF A;  4M7D F;  3DLL A;  3FDR A;  1U1T A;  4RTW A;  4ORZ A;  4DBF A;  4F04 B;  1UJ0 A;  2KRN A;  2COZ A;  2P0Q A;  1WX6 A;  2JT4 A;  2M16 A;  1VQ5 T;  2JNG A;  4C5H A;  1VA7 A;  3CCJ T;  2JS0 A;  4BD3 A;  3HL8 A;  4J6W A;  3HFO A;  2DIL A;  4HVW A;  3RER A;  2XU8 A;  1TU0 B;  4RTU A;  2IVW A;  1YJN T;  3C4S A;  5GMK l;  2A37 A;  2V8I A;  1SPK A;  2D6F A;  1PKS A;  3OS0 A;  2FZK B;  1ZA1 B;  4AFZ C;  1RLP C;  1YIT Q;  2J06 A;  1KC8 R;  2V1R A;  4LDY A;  5A2Q E;  1NEG A;  3QO3 A;  1HK9 A;  5ECA A;  4BB7 A;  4EMG A;  3ULR B;  2ZGW A;  4II1 A;  4RTY A;  2PVO B;  2J6O A;  2E10 A;  1ZBJ A;  4DEX A;  2CDT A;  3CMA Q;  1NJI C;  2DD4 A;  1SSF A;  3M0P A;  2JTE A;  1LVK A;  2HBW A;  3CQT A;  1XQH A;  3FJ5 A;  5GJW B;  3X24 B;  1WGS A;  1R77 A;  4M7D A;  2GNC A;  4QVZ A;  1RAD B;  3CPW P;  2QQA A;  1K0S A;  5KYU B;  4M75 C;  5CKF A;  1AZE A;  5GAO n;  4XTW A;  3CCE A;  2QDL A;  2JZ2 A;  1KHC A;  2K3X A;  1VQO T;  2FEI A;  4ATO A;  4JDS A;  2DLP A;  1S72 T;  1VQL Q;  4HXJ A;  2CP3 A;  3NPF A;  2O01 E;  3CPF A;  2NUP A;  3J7A F;  4DA4 A;  2KXC A;  3VS7 A;  3FB9 A;  1O9S A;  2QEX A;  2BE9 B;  2BZ8 A;  1FXX A;  1AT1 B;  2G3R A;  2LNH B;  5D6W A;  1VQ8 T;  2YRV A;  1SRM A;  1PCX A;  4QQD A;  2AKL A;  1MNE A;  3JCM J;  3WVE B;  3VS1 A;  4ZGD B;  4C8Q B;  3EHR A;  3TSZ A;  1YN8 A;  1WLP B;  1RL2 A;  2R5M A;  2CUD A;  4M78 A;  4M75 B;  4AT1 B;  2V26 A;  1OZ2 A;  3I55 T;  4J7I A;  4QQ6 A;  3EGD A;  1IRE B;  1QKX A;  3GLX A;  1M90 C;  1N8R R;  4FU6 A;  5J39 A;  1SHF A;  3FLG A;  5KYX B;  1VOM A;  3CME Q;  4F14 A;  3KXT A;  1JJ2 P;  2VWF A;  1ZLM A;  1YJW A;  1QCN A;  2CUB A;  2L0A A;  5EC7 A;  1X2Q A;  4XTY A;  1WHK A;  1ZQ1 A;  4OMO A;  2M0O A;  3VJP A;  4ELY C;  4VUB A;  3M0S A;  1TS9 A;  2HBP A;  4EPC A;  5KYW B;  1ACM B;  3QG1 A;  1K1Z A;  1G3T A;  1WJS A;  3H8Z A;  3CMA A;  1YIJ A;  2M0Y A;  1I1J A;  4EMK C;  3I9Q A;  1PM3 A;  4M78 G;  2JN0 A;  2EW3 A;  5GMK e;  1Y57 A;  1W6X A;  1C0M A;  3BDL A;  1N8R U;  3JCM W;  2DET A;  1B3Q A;  1NEB A;  3EGD B;  2A08 A;  3UA6 A;  1X43 A;  1Y0M A;  4XAX B;  2EQI A;  2RO0 A;  4OP0 A;  1HXD A;  2QTV A;  4J6X A;  3O8V A;  3OW2 S;  2RHI A;  4E7S A;  3HRU A;  4BI4 A;  4C0F A;  4NS5 A;  2X9H A;  3QWY A;  3FIF A;  2DJQ A;  1KQS A;  2V8K A;  1WHH A;  5CQX A;  1AHJ B;  3MEA A;  4FT4 A;  2MF2 A;  2CGH A;  1EIF A;  1TUG B;  2QEX Q;  2DRK A;  9ATC B;  1K9M C;  1TG0 A;  5IHI A;  4EMK B;  1BKB A;  2GBQ A;  2YUP A;  5KYN A;  2FB7 A;  4C92 D;  2D0N A;  2XK0 A;  1TXQ A;  3BW1 A;  3MP8 A;  2RN8 A;  2YRD A;  2LCS A;  2DL4 A;  3EFO B;  2CH4 A;  2EVR A;  4HVV A;  2K3Y A;  1FMW A;  1VQ8 A;  4FT2 A;  1K9M U;  2EJG A;  1AWW A;  5GMK m;  1NLP C;  2EJF A;  4LNP A;  3SEM A;  4LUD A;  3RIR A;  3CME A;  2EGC A;  2RA2 A;  1X6B A;  5LJ3 g;  4M7D B;  4PJO B;  4XK8 E;  2C06 A;  3R6N A;  3MEV A;  4N0A C;  1LPL A;  2OAW A;  2RPN A;  3QUI A;  4OB0 B;  3EG9 B;  2L89 A;  2YSQ A;  5IT9 E;  2X4X A;  1ZSZ B;  1S72 Q;  1OX8 A;  5GAN 6;  1NYG A;  2KRS A;  3CCQ T;  2D1X A;  4C0D C;  1WHG A;  3JB9 D;  2A28 A;  2IG0 A;  3HP9 A;  4DBR A;  1CKB A;  2XI9 A;  3VU3 C;  5FU6 C;  1NG2 A;  2W10 A;  2COY A;  4ESR A;  4RTX A;  2RQT A;  3UPU A;  3H0H A;  4J6Y A;  1QVG S;  3CCL A;  2DL3 A;  2DL8 A;  1JXO A;  3IQL A;  3DB4 A;  4C5E A;  1NJI R;  3OYC A;  1CKA A;  3DKM A;  2Z0W A;  4XTU A;  3TQ7 P;  1B34 B;  4ZGJ B;  3EFO A;  1OQK A;  2M1H A;  5GAM e;  1UUE A;  5LJ3 h;  3M58 A;  1I4K 1;  2VGN A;  4BUG A;  4L59 A;  4MMK A;  2YWW A;  2DXU A;  1BB9 A;  1DJ7 B;  2GFU A;  4DEY A;  2ZPI B;  3EG1 A;  1VQN A;  3JCM g;  5IHN A;  5CKH A;  1V1C A;  2FYK A;  1WI7 A;  1X2K A;  1M1K C;  2RI3 A;  2QK0 A;  4K11 A;  1YI2 T;  1OYX A;  3OYK A;  3OYD A;  4QKU A;  4RKU E;  1JXM A;  1TOV A;  4BI8 B;  1VQP T;  5L23 A;  1LNX A;  8AT1 B;  1WA7 A;  2KSS A;  3VRY A;  3NMZ C;  2PVD B;  1D0Z A;  4IUQ A;  4C8Q G;  2L3P A;  3JSC A;  4XTV A;  4NL3 A;  1BU1 A;  1VQ4 Q;  2F5K A;  3G1J A;  4L6V 5;  4J5Y A;  3EHQ A;  4MZT A;  6AT1 B;  5KCO A;  2HCK A;  1VQ9 T;  2EYX A;  4M78 C;  2K5L A;  3M4G A;  4ZN1 A;  1BBZ A;  5CAI A;  1CSK A;  3OYF A;  1Q95 G;  1ZX6 A;  4JRP A;  3I5S A;  1KK7 A;  3S6W A;  3CCM A;  3ZFJ A;  1X6G A;  1RAG B;  1BI1 A;  3UA7 A;  2KQW A;  2MCN A;  4AFU C;  3I56 T;  4M7A F;  4N0A A;  1KQS P;  2GTJ A;  5LL6 S;  1I8F A;  3OYE A;  2GQV A;  1VIF A;  3CXC P;  2QDY B;  3N5B B;  4MML A;  2CP7 A;  3CXC S;  5CK9 A;  4QT7 A;  1YWP A;  5CO7 A;  1MMN A;  4A4F A;  4OML A;  2BZY A;  1U8R A;  3OYI A;  4JLI A;  5GAN 4;  2P84 A;  2RJC A;  1KC8 C;  3PIO A;  1GCQ A;  3OS2 A;  2EWN A;  4MDX A;  2HL3 A;  2F2V A;  3LH5 A;  4PJO D;  3H0F A;  3MP6 A;  2ZPF B;  2JUF A;  3GF5 A;  4GLK A;  1JQQ A;  3GNF B;  4N4G A;  2XDB A;  2COW A;  1YP5 A;  1YBY A;  2KNB B;  2O2O A;  2DM1 A;  2LDM A;  3OYL A;  1GFD A;  1PNJ A;  4AG2 C;  2PQW A;  3QJ6 A;  1FX7 A;  5IXF A;  3MCA B;  2CS7 A;  4IIM A;  4EMH A;  1BIA A;  3ZBD A;  4OB2 B;  1KQS S;  4PJO E;  1W4S A;  3CCJ Q;  2CT4 A;  4C0G A;  2DXB A;  4E7L A;  2K3B A;  4E2F B;  5FWC A;  1ZSZ A;  2DBM A;  2DBK A;  1P92 A;  1HD3 A;  3X26 B;  2QA4 T;  3F70 A;  4PJO G;  4E47 A;  4B6M A;  2E5K A;  4ZNX A;  4KRT A;  1GFC A;  3V7C A;  1K9A A;  2P0K A;  1HJD A;  4O6J A;  3HRS A;  1JU5 C;  1SEM A;  3I35 A;  2BTT A;  4RTT A;  3Q1J A;  4OF1 A;  5CKB A;  1NPR A;  3JCM h;  1TUC A;  4M7A C;  3VS4 A;  3PFS A;  3PGG A;  2VC8 A;  1D1A A;  2E3H A;  2YLC A;  5CR2 A;  3CCU Q;  1WQ7 A;  4X9D A;  3A8O B;  2E65 A;  2E1H A;  3TU4 K;  3OS5 A;  4C92 G;  3PVL A;  5EG2 A;  1YWO A;  3CPW A;  3SDZ A;  3MET A;  2KAF A;  2K2V A;  1K76 A;  2HL5 C;  3OYN A;  3CC4 Q;  1Q7Y R;  2KXD A;  5GAM f;  2DO3 A;  3LH0 A;  4ZTF A;  2EAY A;  4CC3 A;  4HCK A;  3NFC A;  1PRM C;  3G4S A;  3CEY A;  1AWX A;  5J3B A;  1OUL A;  1VQM A;  1QCF A;  2K4Y A;  2MWP A;  3LW5 E;  3EG3 A;  5M9O A;  3EG9 A;  5GAM d;  1GXI E;  3VS6 A;  5IN1 A;  1UGP B;  1TWB A;  1X75 C;  2QAS A;  2ZCF B;  2XMF A;  5IXB A;  3RUX A;  4C8Q D;  1D3B B;  4E7I A;  1N5Z A;  1QCO A;  1Q7Y C;  1G83 A;  2QTX A;  3PIP A;  2KBT A;  1D1B A;  1G8X A;  3PE0 A;  1SHG A;  4P5N A;  3VS3 A;  3RKW A;  4HT9 A;  4XU1 A;  1PSE A;  2HQE A;  5GAO l;  1R0C B;  5I2M A;  1G3Y A;  3OQ5 A;  1I07 A;  2OX7 A;  2BZX A;  2QQS A;  1OZ3 A;  2EBP A;  3PMI A;  2EKO A;  2A3L A;  3OS1 A;  4JPB W;  2MPX C;  2DIG A;  1G3S A;  1OEB A;  4KH1 B;  1WZO A;  4M77 D;  1RLQ C;  3M56 A;  3TRE A;  4HKE A;  2MYS A;  4JJC A;  2LQ8 A;  3E1S A;  4M78 E;  2CKK A;  1D1C A;  3EGU A;  4HCZ A;  1FYN A;  2A7Y A;  1N9R A;  2DZC A;  4PK4 A;  1M5Q 1;  3P8H A;  2F2X A;  2GFA A;  4HCC A;  3CCJ A;  1QVF S;  4C92 F;  2WSC E;  2IIM A;  1Z9Q A;  2BIV A;  5LJ5 g;  3GBQ A;  2ABL A;  2VYT A;  2ROT A;  2CSI A;  1OPL A;  2XDP A;  4M77 A;  5FRN A;  1YJN A;  2C0T A;  4A63 B;  2DA9 A;  1U5S A;  5IHK A;  4CC4 B;  2VUB A;  3A1P A;  1VQM T;  1M3C A;  1SSH A;  3SB2 A;  1A0N B;  1K8A U;  2F1L A;  2ECZ A;  8ATC B;  2WSF E;  5C6S A;  2DEQ A;  4X34 A;  3MJX A;  2VVK A;  1X27 A;  4J9D A;  2RD1 A;  4N4H A;  3EGX B;  2XG8 D;  2PTK A;  3C0C A;  1N27 A;  1YIJ Q;  2JOY A;  1IHV A;  2OI3 A;  2DE0 X;  2QI2 A;  4F7U E;  4DBQ A;  3G6E A;  3CCV A;  4KUI A;  4PJM A;  2E5Q A;  2DER A;  1PG5 B;  3S3O A;  2GF7 A;  3M9Q A;  4ELZ C;  4FCY A;  4C5G A;  4C0D B;  4ZN3 A;  4JUV A;  1VQ9 Q;  1FMK A;  2LVM A;  1OU9 A;  4J9F A;  4Y92 A;  4M7A G;  5GAM j;  4J8O A;  1S1N A;  1UEC A;  1KQ2 A;  4IUR A;  1H8K A;  1RAC B;  4E7H A;  1XOV A;  1LCK A;  4DBH A;  1UE9 A;  1G3W A;  1QWF A;  2QQ9 A;  2LQN A;  1MMA A;  2RJD A;  3OMG A;  2I2L A;  2LTO A;  4LXC A;  3EFS A;  3PT9 A;  3NHN A;  1OV3 A;  1K8A R;  2AIR B;  3CPW S;  1PD0 A;  2Y90 A;  2FRY A;  1VQ6 T;  1KIK A;  4FW2 A; 
#chains in the Genus database with same CATH homology
 2AZV A;  4RTZ A;  3REB B;  1ABQ A;  2J05 A;  4OMN A;  1UHF A;  1IO6 A;  2A36 A;  1BB9 A;  2P4R A;  4DEY A;  1BK2 A;  3EG1 A;  1AZG B;  2RQW A;  4J9E A;  5IHN A;  2JMA A;  1V1C A;  1NLO C;  1WI7 A;  2KT8 A;  1X2K A;  1PHT A;  4K11 A;  2C0I A;  4LE9 A;  2RQV A;  1GBR A;  4RUG A;  3THK A;  3M0R A;  4OMQ A;  1AD5 A;  1JXM A;  2O9S A;  1KJW A;  1M3A A;  2KEA A;  2K7A A;  4LN2 A;  2SEM A;  2B86 A;  2YT6 A;  4J9H A;  1AWJ A;  1ARK A;  5L23 A;  2HSP A;  1KFZ A;  1MV0 B;  3EG2 A;  1WA7 A;  1ABO A;  2FRW A;  3VRY A;  2RQU A;  3NMZ C;  4RTV A;  1WXT A;  2L3P A;  2K2M A;  2LQW A;  1AOJ A;  1GBQ A;  3TSW A;  2LJ0 A;  2LP5 A;  1BU1 A;  2JW4 A;  1X69 A;  1K0X A;  3EHQ A;  3M0Q A;  2HCK A;  2EYX A;  2L3S A;  5I22 A;  2KYM A;  1JEG A;  3JV3 A;  1BBZ A;  2LMJ A;  1CSK A;  1M3B A;  1T3L A;  1ZX6 A;  5GJV B;  1KSW A;  3I5S A;  2KR3 A;  2O31 A;  2RF0 A;  1VYV A;  1T0J A;  1UGV A;  1X6G A;  3UA7 A;  2MCN A;  4AFU C;  2M51 A;  2FPF A;  2LJ3 A;  2W0Z A;  2EYW A;  4J9G A;  4LUE A;  2GQI A;  1UHC A;  2GTJ A;  5FWB A;  1YCS B;  1W70 A;  2EYY A;  1UJY A;  2K79 A;  1OOT A;  1QLY A;  1NM7 A;  4QT7 A;  1E6G A;  1YWP A;  2GGR A;  1PRL C;  3U23 A;  2EKH A;  4OML A;  2BZY A;  2RQR A;  4CC7 A;  1YNZ A;  1GCQ C;  3NGP A;  3UAT A;  1GCQ A;  4OMM A;  2MOX A;  3M0U A;  2CH4 W;  2F2V A;  1UDL A;  3LH5 A;  1WIE A;  3H0F A;  2DMO A;  1WXB A;  4RTW A;  4ORZ A;  2DF6 A;  1UJ0 A;  3H41 A;  2KRN A;  1JQQ A;  2G6F X;  1YP5 A;  2KNB B;  3I5R A;  2O2O A;  2DM1 A;  1WX6 A;  2ESW A;  1WYX A;  2JT4 A;  1GFD A;  1PNJ A;  4AG2 C;  1EFN A;  2D8H A;  2DL7 A;  1VA7 A;  5IXF A;  2YDL A;  1M8M A;  2JS0 A;  4IIM A;  2O88 A;  2DIL A;  4HVW A;  3VS5 A;  2EPD A;  5FW9 A;  2ENM A;  4RTU A;  1WDX A;  1GCP A;  2CT4 A;  1JO8 A;  1E6H A;  2D8J A;  1PKT A;  2A37 A;  2K3B A;  2DL5 A;  5FWC A;  2L2P A;  1SPK A;  2DBM A;  2DBK A;  1PKS A;  1HD3 A;  3PVQ A;  4AFZ C;  1RLP C;  4OMP A;  2J06 A;  4M4Z A;  2V1R A;  1NEG A;  3RNJ A;  2E5K A;  5ECA A;  2JS2 A;  1WXU A;  4ZNX A;  3ULR B;  4KRT A;  1GFC A;  4RTY A;  4F17 A;  2J6O A;  1K9A A;  1HJD A;  1ZBJ A;  4DEX A;  2CDT A;  1JU5 C;  1SEM A;  3I35 A;  2CRE A;  1T0H A;  3M0P A;  2JTE A;  2BTT A;  4RTT A;  2I0N A;  2CSQ A;  2HBW A;  3CQT A;  3FJ5 A;  5GJW B;  1TUC A;  2GNC A;  3VS4 A;  1K0S A;  1GL5 A;  3VS2 A;  1AZE A;  2FG0 A;  2JM8 A;  1RI9 A;  2YUO A;  4JZ3 A;  5IH2 A;  1M30 A;  2QDL A;  2EGA A;  2K9G A;  5HCK A;  1VYT A;  2FEI A;  2JXB A;  3PVL A;  2DLP A;  1YWO A;  3M0T A;  2EYZ A;  1K76 A;  4HXJ A;  2KT1 A;  4R0K A;  3NPF A;  3KFV A;  2KXD A;  3EG0 A;  2ED0 A;  2J7I A;  2EGE A;  1UFF A;  1ZUY A;  2YUQ A;  2KXC A;  2LJ1 A;  3VS7 A;  4CC3 A;  4HCK A;  2FPE A;  4IIO A;  1PRM C;  2BZ8 A;  1AWX A;  2DX1 A;  2FO0 A;  2MIO A;  2LNH B;  1QCF A;  1SRM A;  1B07 A;  4HVU A;  3EG3 A;  2KE9 A;  2AKL A;  3VS6 A;  1SRL A;  3VS1 A;  2SRC A;  3EHR A;  3TSZ A;  1YN8 A;  1PWT A;  1WLP B;  4Z8A A;  2DYB A;  2CUD A;  2XMF A;  5IXB A;  2RNA A;  1AVZ C;  2LX7 A;  1T3S A;  2J6F A;  2DVJ A;  1QKX A;  2JM9 A;  2O9V A;  2CT3 A;  1N5Z A;  2F2W A;  1G83 A;  1WFW A;  1ZSG A;  1SHF A;  2KBT A;  3PE0 A;  1SHG A;  3VS3 A;  4X1V A;  2AZS A;  4F14 A;  2PZ1 A;  3SHW A;  2NUZ A;  2VWF A;  1U06 A;  1ZLM A;  2CUB A;  1I07 A;  2L0A A;  2BZX A;  4Z88 A;  2H8H A;  2KGT A;  5EC7 A;  1X2Q A;  1M27 C;  1UTI A;  2EBP A;  4OMO A;  1AEY A;  1VYU A;  3TVT A;  1RUW A;  4JPB W;  3M0S A;  4CC2 A;  3H0I A;  1OEB A;  1RLQ C;  1K1Z A;  1NYF A;  1UG1 A;  2M0Y A;  1I1J A;  2X3X D;  2DRM A;  3I9Q A;  4JJC A;  2EW3 A;  4AFQ C;  1Y57 A;  1W6X A;  3O5Z A;  4WCI A;  3EGU A;  1FYN A;  2VKN A;  2K6D A;  1U3O A;  1B3Q A;  2YUN A;  1MUZ A;  1NEB A;  2LZ6 B;  2A08 A;  3UA6 A;  4AG1 C;  1X43 A;  2DNU A;  1QWE A;  1Y0M A;  2EQI A;  1ZUK A;  2F2X A;  3REA B;  4D8D A;  1H3H A;  2V1Q A;  3VS0 A;  4JJB A;  1W1F A;  2IIM A;  1Z9Q A;  3GBQ A;  2ABL A;  1HSQ A;  2ROT A;  2CSI A;  1OPL A;  2AKK A;  1OPK A;  2C0T A;  3QWY A;  1K4U S;  2DJQ A;  4EIK A;  4A63 B;  2DA9 A;  1U5S A;  5IHK A;  4JJD A;  4JZ4 A;  4CC4 B;  3A98 A;  3QWX X;  4AFS C;  1MV3 A;  2ROL A;  1M3C A;  1SSH A;  2DRK A;  2JMC A;  2NWM A;  1QKW A;  1TG0 A;  5IHI A;  1A0N B;  2J6K A;  4J9C A;  4D8K A;  4F16 A;  2ECZ A;  2OJ2 A;  1AWO A;  2GBQ A;  2YUP A;  1ZUU A;  1H92 A;  2D0N A;  2VVK A;  1X27 A;  4J9D A;  2HEQ A;  2RN8 A;  3C0C A;  2PTK A;  2LCS A;  2DL4 A;  3ZL7 C;  4J9B A;  2CH4 A;  2OI3 A;  2DE0 X;  2EVR A;  4HVV A;  4J9I A;  3VRZ A;  3UF4 A;  4FSS A;  1AWW A;  2KRO A;  1NLP C;  2RMO A;  4LNP A;  3SEM A;  4LUD A;  3RBB B;  2PNI A;  2EGC A;  1X6B A;  3R6N A;  2C0O A;  4E6R A;  2OAW A;  2RPN A;  1FMK A;  2YSQ A;  2X3W D;  2GTO A;  4J9F A;  4Y92 A;  1S1N A;  1UEC A;  2KRM A;  1Z9Z A;  1NYG A;  2KRS A;  5I11 A;  1H8K A;  1E7O A;  2D1X A;  1XOV A;  1LCK A;  1TUD A;  1I0C A;  2A28 A;  1UE9 A;  2L3Q A;  1CKB A;  1QWF A;  4GBQ A;  2HDA A;  2KYB A;  2LQN A;  1NG2 A;  2W10 A;  1J3T A;  4ESR A;  4RTX A;  2RQT A;  3H0H A;  2DL3 A;  2DL8 A;  1JXO A;  2FPD A;  3IQL A;  4GLM A;  1GRI A;  3NHN A;  1OV3 A;  1CKA A;  2AK5 A;  4Z89 A;  2ED1 A;  2FRY A;  1KIK A;  1UUE A;  1G2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...