1Y96A

Crystal structure of the gemin6/gemin7 heterodimer from the human smn complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
b'MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gem-associated protein 6
publication title The Gemin6-Gemin7 Heterodimer from the Survival of Motor Neurons Complex Has an Sm Protein-like Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 19
structure length 86
sequence length 86
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y96A00
5LJ3d 3QO3A 4J6YA 1LNXA 4PJOF 3QUIA 1D3BB 3V7RA 4M7AE 3M4GA 2RD1A 4M75D 1I8FA 1BIBA 4J5YA 4M77B 3V7SA 4C92E 4EMKB 4V2SA 4M75C 3SB2A 4Y91A 4EMHA 4M78E 4C8QG 5GAN6 2DTOA 2RM4A 4M77C 3BDUA 4XTWA 4M7AD 3JB9I 5I21A 4MMKA 5GAN3 2EJ9A 4C92D 4F7UA 4N0AC 1Y96A 1N9RA 2EAYA 4XQ3A 4C8QF 4M7AC 3RERA 4M75A 2VXEA 4XTYA 4PJOE 3V8LA 4JLIA 4HT8A 3QSUA 3JCMc 4WF2A 4M7DF 1Y96B 3JCMJ 5GAN5 2EJFA 1WNLA 2CGHA 4M78C 3RIRA 3HFNA 4M75B 1LJOA 3JCMf 3SWNC 2DTHA 4N0AA 4NL2A 2QTXA 2YLCA 3BW1A 4F7UG 5GAOq 4XU0A 4A54A 4M7AA 2RB6A 3JB9G 2E10A 1KQ2A 1WQWA 4PJOD 4M75G 4C92A 3BFMA 4JUVA 3HSBA 4M77G 4XTXA 2EWNA 1I5LA 4M7AB 3JB9H 3FB9A 4F7UF 3V7CA 4M78A 4C8QE 4PJOC 1U1SA 3JB9F 3SWNA 3V8KA 3VU3C 4C92B 3EFSA 4JRKA 5GAOr 1H641 5GAOm 4M7AG 3FIFA 4M77F 3INZA 5LJ3f 5GAN4 5GAOp 4DQ2A 4M7DE 4M78B 4C92C 3FJPA 4NL3A 5GAN2 1M8VA 3SWNB 5GMKi 4J6WA 4XU2A 4PNOA 4C8QD 4PJOA 2I2LA 3RESA 2DXTA 3PGGA 2E64A 4J6XA 2VC8A 4M78G 4XTVA 1X01A 2VXFA 5GANf 5GAOn 3JCMd 3RKXA 4QVDA 4X9CA 3JCMg 1KQ1A 1B34A 4M7DD 4PJOB 3QHSA 3RKWA 3JCMV 4F7UE 5CAIA 5GAOl 1JRIA 2DTIA 5DY9A 4XU1A 4MMLA 4RCBA 1HK9A 1N9SA 2ZGWA 5GAMg 2E41A 4M7DC 2FYKA 4PJOG 1B34B 4X9DA 4M77E 5GMKl 5GAMf 4EMGA 3JCMe 4M75F 3JCMh 2DXUA 3GIBA 4C8QA 2DZCA 5GAN7 5LJ5j 1U1TA 1M5Q1 3RKYA 4A53A 5LJ3j 5LJ5f 4QVCA 3JCMW 1LOJA 5LJ5g 4C92G 5LJ3g 4HT9A 3JB9D 1I81A 3BY7A 4OP0A 3AHUA 4M7DA 2DVEA 4JRIA 4XU3A 4C8QB 3HFOA 4M77D 4M7AF 4NOYA 4XTZA 5GANj 1I4K1 1YCYA 2FB7A 5GAMe 3L1AA 2K57A 5GAMh 5GANd 4HA8A 4RCCA 1TH7A 4C92F 5GMKj 5GANg 2E1HA 3V8JA 4C8QC 1WPYA 1BIAA 5LJ5e 5LJ5h 1JBMA 4EMKC 5LJ3h 5LJ3e 3JCMb 4M7DB 5GMKm 2Y90A 3L2ZA 4M78F 2EJGA 1WQ7A 2YLBA 4M75E 4M7DG 3JB9J 2E65A 1D3BA 2DEQA 2JN0A 5GANe 2DKGA 5GAMj 5GANh 5GAN8 5GAMd 4M78D 2DJZA 2DZ9A 4XTUA 3RUXA 5GMKe 3JCMX 1HXDA 2RA2A 2HNIA 3EFRA 4M77A 4EMKA 2YHTA 5GMKh 3JCMQ 1MGQA 4F7UB 5LJ5d 3JCMP
chains in the Genus database with same CATH superfamily
5FRNA 1WHJA 1KC8R 2RD1A 4UC4A 3VKIA 4J9IA 3CPWA 5IT9E 3GLXA 4J5YA 2L3PA 4BD3A 3NMZC 5L8RE 3L2UA 1C0MA 1O9SA 4E6RA 4HKEA 5L23A 2D0QB 4JPBW 1UG1A 4HVWA 3VS7A 1VOMA 1RAGB 2GNCA 2K3BA 5CCAA 1WXBA 4L5GA 4RTUA 3QSUA 3VS1A 1WZOA 1W2BP 1G3WA 5AT1B 2CP2A 3REBB 3VS0A 4N0AA 1WXTA 4FYWB 4AFQC 3JB9G 2DL4A 1BYMA 3E9FA 1H8KA 3OYBA 1HYOA 1UGSB 1FXXA 2KRSA 3EFSA 2XDBA 1VQPQ 1VQ6Q 4M77F 4PJMA 1RI9A 5DLOA 2EKOA 2E3IA 3LLRA 2DERA 2DMOA 4NL3A 1BCOA 2XHCA 5GMKi 4KUDK 5EG2A 2I2LA 2DXTA 4RKUE 4J6XA 3EG3A 1MNEA 1YWPA 1NLOC 4X9CA 1KQ1A 2EQUA 3VJPA 2EQMA 3QHSA 1SHFA 1XJWB 3CCLT 4MMLA 2HKNA 2E41A 4X9DA 4AT1B 2MK5A 2QASA 3RKYA 1LOJA 5LJ5g 3I9QA 3QKJA 3JB9D 2B8AA 4ZN1A 1GCPA 1N5ZA 2ECZA 4KRTA 4DOWA 2RJCA 1Y71A 1V29B 1K1ZA 1SRMA 2E12A 1MHNA 3EAEA 2A0FB 1D3BA 5GAMj 1QVFP 1TWBA 4HVVA 3NHNA 1VQLT 5LJ5d 2JT4A 1SF9A 4FU6A 3G71T 1YJNA 2J6OA 4EDUA 3V7SA 1QVPA 3ME9A 2COWA 4EMKB 4LNPA 2ED0A 3PE0A 3LWIA 2DNUA 2W10A 3MEVA 5GAN3 1V1CA 3LWHA 1BI3A 1OPKA 3R6OA 3LGLA 3NFCA 2EBPA 5LL6S 1TUDA 3IQLA 4HT8A 5EC7A 4M7DF 2QXFA 4OGEA 3M9QA 1H3HA 2CH4W 2CP0A 3RIRA 3HFNA 4EIKA 3SWNC 3VS3A 4XU0A 3WVEB 1YI2Q 2LRQA 2BIVA 3P8HA 4ZTFA 1PKTA 1IHWA 4M77G 1D09B 3C95A 3CC7T 1ARKA 1VQ4A 3CPWS 4HXJA 9ATCB 4J9GA 8AT1B 3PNWC 2CT3A 4C92C 2M1HA 1VQ5A 2KY9A 1OZ3A 1QVFA 1RAFB 1Z9QA 2E64A 2BZ8A 1QMCA 4Q5WA 3PFSA 3RKXA 3L2WA 3LYIA 3OYDA 1IXDA 1Q81U 2JTMA 2LC4A 3NTKA 1SG5A 2WSEE 2DTIA 1Q81C 3A8OB 2OI3A 4M77E 4HCBA 5FU7B 2GCXA 5LJ5f 2KE9A 1FWZA 4OB2B 2YXYA 3AHUA 4C5EA 4M77D 2FPDA 4NOYA 2FEIA 1YJWA 2FB7A 1BKBA 2LMJA 5GANg 4CC3A 3OW2P 2GGRA 3TEEA 1WQ7A 3CBMA 2BKDN 2RH2A 4LDUA 3WXMB 1VQKQ 1UEBA 3JCMX 1YJ9A 4BACA 2A37A 3ZEHA 4V2SA 2RHZA 4L59A 5GAN6 2BE7D 3OSVA 2HSPA 2HAXA 3MHXA 1PRMC 4MZPA 3I55Q 4BDZA 1AOJA 1BI0A 3CXCP 2Y4YA 2JMAA 1T3SA 2PVOB 4JLGA 2HL3A 4PL6A 3CCQA 1VQ7Q 4RG8A 2CGHA 2ZPIB 3HP9A 2KR3A 2QTXA 2QEXT 5KCOA 4RTTA 1QVGA 1YITT 1W1FA 2K7AA 1YHQQ 3JB9H 4GBQA 1VYVA 3C0CA 5DLQE 3OW2A 3I56A 4FW2A 2DF6A 2EYXA 4M7DE 3FJPA 2M16A 1RADB 1UE9A 3GP8A 1GCQC 1WHLA 1AZGB 3KUFA 4M7DD 2O4XA 2OTJT 2F69A 3URGA 5J3BA 3E1SA 1IZ6A 4FYVB 3G7ZA 2HMAA 2QQBA 4C8QA 4GLMA 3CC2A 1U1TA 4LUEA 4N4IA 4QVCA 1R8OB 1VQOT 2D1XA 1NPPA 4OB3B 4ATOA 1G2BA 1F1BB 3ER0A 4FT4A 2DEUA 4XTZA 3VS2A 1MMNA 1YCYA 4F16A 2X51A 3CCRQ 2C0TA 2QQ9A 5LJ3h 3UDCA 3UPUA 5I22A 1K8AU 5HK3A 1BU1A 5CK9A 1OU8A 1K8AC 1U8RA 2OTLT 2KRMA 3QIIA 2HNIA 1JB0E 2WSFE 1D3BB 4A4KA 1E6GA 3M4GA 2COYA 4KGVB 3X28B 5D6XA 2LVMA 2DTOA 4XTWA 2ZAEA 4MZTA 1VQ8T 2CZ1B 2LCCA 1LCKA 2HCKA 2A3LA 2RHYA 3LW5E 1IO6A 3VRYA 2GQIA 5A2QE 1UECA 3A98A 1OOTA 3CC4T 4E7IA 3BW1A 2M0OA 2X4XA 4AFSC 2GBQA 1G5VA 1YWOA 4Z8AA 3EG0A 1U1SA 4PFOA 2VGMA 3CCLA 3HPWA 1X6BA 1WXUA 2KDSA 2ROLA 3L42A 4C0GA 2V26A 3A8HB 3QZ9B 1S72Q 2XDPA 1Y7XA 1K73U 1EIFA 1R0CB 1QLYA 2VC8A 1K73C 2H3JA 4OB1B 2K3YA 2K5IA 1MUZA 1M2OA 1E6HA 2COZA 2JS0A 4IURA 1G3SA 3QJ6A 1YCSB 4KULA 3QG1A 2P84A 4PJLA 1QVGS 4A53A 2K6DA 1UDLA 2KNBB 2DVEA 2KK4A 3PT9A 3HFOA 2FRWA 1VQLA 1I4K1 2P0PA 3GIBA 2IG0A 1MNDA 4HA8A 2DILA 3M53A 3G71A 2RHIA 1YFNA 4EMKC 2Y90A 5D6WA 2EVRA 3VUZA 3QYHB 5IHIA 2AIRB 2KEAA 2E65A 1KHIA 5CIUA 5GAMd 3RUXA 1VQ5T 5GAN4 5GMKh 1YIJT 3HTRA 1SEMA 3HL8A 2NUPA 1I8FA 4OMQA 3EH1A 3CEYA 1OULA 3E19A 1RLPC 1ZSZA 2HL5C 2CREA 3MP8A 4Y91A 4M77C 2LNVA 3A5ZB 3MEUA 3JB9I 2FPFA 2AZVA 2PVGB 1W70A 3M4YA 5HY6A 1Y96A 3QDRB 4P5NA 2FL7A 2KBTA 5KYUA 3CC7A 2K4YA 4M75A 2C0IA 2P0KA 2DL5A 2LT1A 1YJWQ 1C1AA 1SSHA 2JM9A 3CCMT 3META 1ZUUA 3UA7A 3UATA 1WQWA 1X69A 1Q7YC 3H41A 1AVZC 2CP5A 1D1BA 3MP6A 2MI6A 1YJ9Q 2KT8A 1Q82U 1Q82C 2LQNA 5FU7C 1WFWA 2HSEB 1BCMA 3LGFA 4J6WA 1NJIU 4PJOA 3RESA 1NJIC 1LPLA 2K79A 1RUWA 3JCMd 1RL2A 4FM4B 1YBYA 2PUOB 4CI0C 1WHMA 2EW3A 2ZGWA 3G4ST 4PK4A 4A4EA 4AFUC 1OZ2A 1XNIA 5GAMf 3JCMe 3CCQQ 1Y57A 2O4XB 2DZCA 5LJ3j 3CPWP 1RAEB 4K11A 1KC8U 3CQTA 5I2MA 1KC8C 4C8QB 4J9CA 4RCCA 2LTOA 2DL8A 4BI8B 1QP3A 2KXDA 3I56Q 2K2VA 5KH6A 3EHRA 3OS0A 1KQSA 3CCJT 1D0YA 2E3HA 3JCMP 2JVVA 1QCFA 1QWEA 1I1JA 4F7UB 5CAIA 1X43A 3VS6A 3EGDA 4QT7A 1PRLC 3J7AF 3REAB 1E7OA 2E6NA 5IHNA 1Y07A 2ESWA 5CKEA 1ZHIA 2QEXA 1OEBA 1OX9A 1PG5B 5AYFA 1Q86R 4FIBA 3CC2T 4N0AC 1Z9ZA 2DBMA 1RACB 1NLPC 2CDTA 4PFZA 2HBWA 3VRZA 5I11A 1UHCA 4B9XA 2GFUA 2EJFA 3H6ZA 2QQAA 4E7SA 3JCMf 1CSKA 4DBQA 1ABQA 3EG9B 3CD6A 5GJWB 2K5FA 3H8ZA 2JJ9A 2I0NA 3FJ5A 3MEAA 4BY6B 2HQXA 2EKHA 4BE0A 4OMPA 3H0HA 1T0HA 2OTJA 3INZA 5GAOp 1S1NA 5KE2A 2MWPA 1KK7A 1VQOA 2KYMA 2V8JA 3CCET 2X4YA 2QK0A 3JCMV 1FMWA 3CCSA 2NUZA 2MYSA 2OAUA 2YUNA 4CC7A 1M90R 4J8OA 3OQ5A 2RN8A 1M5Q1 3H0FA 1PD1A 2OTLA 2FRYA 2W0ZA 3QDFA 1NG2A 1D1CA 4QVZA 2KRNA 3RBBB 1TG0A 5GMKj 2VWFA 1D1AA 3A8MB 2OX7A 1M3BA 2H8HA 4A4HA 1AWWA 5A0LA 1VQ6T 2E4HA 1VQ8A 5KYYA 1M30A 3QUIA 2JUFA 2J7IA 1MV3A 1G83A 2H3EB 5CO7A 2F2WA 5J26A 5A0DA 2NUPB 3QZ5B 4EMHA 3JRZA 3CC4A 3BDUA 2KYBA 2XD0A 1ZSZB 1SKUB 3A8LB 3RERA 2J06A 3M57A 5GJVB 1VQLQ 1N27A 4N4GA 1Y96B 1RI0A 2NYSA 5KYUB 1I5OB 3WVDB 4M75B 5FWCA 5GAOq 4OMLA 4M7AA 1KQSS 1G3TA 1GBQA 4M75G 3VUBA 4JUVA 4DBRA 4M78A 1UTIA 4FW1A 2DYBA 4XAXB 2ZCFB 4DEXA 1BBZA 1K9MR 4RMOA 4F17A 1D0ZA 1T3LA 1RLQC 2LQKA 1WI7A 1JU5C 3M55A 3L2VA 5GAOn 3M54A 2AT1B 1WJRA 5HK0A 1JO8A 2JXBA 4PJOB 3OS5A 3RKWA 1JRIA 2KSSA 2CYZB 2FYKA 4PJOG 3L2RA 3PTAA 4QKUA 2E5QA 2VGNA 2VYTA 5GAN7 1BI1A 1W6XA 2D8HA 4OP0A 1UGPB 2DPPB 2M0YA 1YIJA 1MMAA 4ORZA 2FO0A 1KQ2A 3ZL7C 2VUBA 3SFMA 5LJ5h 1MMDA 2AKLA 4JJCA 1WHHA 2LX7A 1NBEB 1WHKA 3OYFA 3JB9J 2F1LA 2QQRA 1N8RU 1C6VX 1N8RC 1M1FA 4ZGDB 2L0AA 5FLXE 3M0UA 4IUPA 1QVGP 1O75A 5HKCA 1BK2A 1M3CA 1GRIA 3CCMA 1K76A 3EGDB 2Y4XA 2J05A 2LDMA 4A4FA 2M51A 5I21A 2OJ2A 3TREA 2WACA 1U5SA 2YRVA 2CS7A 4CC2A 2LJ0A 5CVIA 4QQGA 4QW2A 4BUGA 2DIQA 1RAIB 1SHGA 2FZGB 4IUTA 2QTVA 3OYAA 4E7LA 2RB6A 4C92A 1ABOA 2BTTA 3OYMA 4LDWA 2HQHA 2KXCA 2NLUA 2K2MA 4E7HA 2KGTA 2DYIA 4PKCC 3G4SA 3G6ET 3QWXX 4C5HA 5CKFA 1VQMQ 3CPFA 3CBPA 4LD6A 2V1QA 2QEXQ 2QDLA 2RHUA 1QCOA 5M9OA 1YITQ 1VYUA 4OGCA 1TTHB 2QAZA 2R5MA 2M9UA 2G6FX 2QI2A 5DY9A 2EYQA 2EFIA 2RQTA 2GFAA 4FSSA 1OQKA 3CCJA 4HCKA 1JXOA 3CD6T 3VS5A 2DVJA 4AFZC 4N4HA 4J9BA 5FW9A 1VYTA 5LJ3e 2DIGA 1M2VA 3QJYA 3UF4A 2OTJQ 3OYNA 3CMAT 3S3NA 1WLPB 3VYHB 4B9WA 4DBFA 1TXQA 3OBWA 5GANh 1M9SA 3GBQA 3LH0A 3JCMQ 2YHTA 1VQOQ 2XG8D 3RDVA 3UWNA 2DL3A 1XQHA 5KYYB 2DO3A 3Q1JA 3CCST 4IUUA 2ABLA 5D7UA 4ELYC 1ZQ1A 3DKMA 3MO8A 1WYXA 4F7UA 5C6SA 2YSQA 2OTLQ 4FYXB 4BY6C 1G3YA 3NTHA 2CT4A 3U23A 1WJQA 2MMPA 2PZ1A 4WF2A 3FC3A 2AKKA 1KD1U 4NL2A 3KXTA 4KT0E 4A54A 1KD1C 1UUEA 3HSBA 3D7SB 4BI4A 2HDAA 4RTZA 2M02A 4M7AB 3FB9A 3M59A 3CCEA 1VQ8Q 2JS2A 4M7AG 3I5SA 5LJ3f 7AT1B 4LXCA 4M78B 4D6WA 1QW1A 2KQWA 4KGZB 3S3MA 5GAN2 3EG9A 4CRIA 5HCKA 4M78G 2QDYB 1P92A 4OMMA 2O88A 2JTEA 1NYFA 3OYJA 4PJJA 3EG2A 2DFUA 3J81E 1H3ZA 1N9SA 1X2KA 4JS4A 4IIMA 3OYEA 2YUQA 1BI2A 1PSEA 2BZYA 5LJ5j 1YJNQ 1JJ2A 3JCMW 1VQNT 1QWFA 2GTJA 1VQ6A 2HKQB 1WDXA 2DK3A 2X4JA 2PTKA 1TOVA 1VA7A 3EGXB 1JBMA 2PU9B 4RTXA 2BZXA 2JN0A 2XI9A 3J80E 1ZSZC 4J7FA 4M78D 3CCUT 5GMKe 4PJNA 5GAMg 1IGUA 2XICA 1S72T 1IB8A 1LNXA 2PVDB 4Y28E 6AT1B 2MAMA 4J83A 2D6FA 2MCNA 1ACMB 4E7KA 3O5ZA 4M75C 1VQ4Q 5FRMA 2GF7A 2P4RA 4MMKA 2EJ9A 3OYYA 2SEMA 2JMCA 4C8QF 2EPDA 1VQ5Q 4C5IA 2VXEA 1YIJQ 4L6V5 2D0NA 2DD4A 5GAN5 1WNLA 3VS4A 4LDXA 1SRLA 3CMET 1BB9A 3DLMA 2YLCA 4JRQA 3HHTB 4ZTJA 4GLKA 3OSSC 1OI1A 4JJNK 1I5LA 1GL5A 4F7UF 4PJOC 4Y92A 2QGGA 4OF1A 2FZKB 4C92B 2RI2A 1NM7A 5FROA 3X26B 1Y0MA 2CP6A 3CCMQ 4WTOB 2Z0WA 1OV3A 4OVAA 3EG1A 2K5LA 4QVDA 2D8JA 3JCMg 1M1KR 4HCCA 3C94A 2RMOA 1KQSP 4Z02A 2X4WA 3ASKA 3OY9A 2X3WD 1WIEA 2DE0X 3M0QA 2E6ZA 3SHWA 1EX4A 2FHDA 1PWTA 4JRIA 2O9SA 5GANj 5GAMh 5DM7R 3H0IA 3DB3A 2E1HA 2MOXA 1WPYA 4D8DA 1VIEA 3JCMb 1VQ9T 1ZUKA 1Q86U 3L2ZA 4C0ZA 1Q86C 2KI7A 2LQWA 3KFVA 4ELZC 1M2VB 1MMGA 4M77A 3RMQA 3EFOA 3QO3A 4IIOA 3OYKA 4KBMB 1KG1A 2GTOA 2JM8A 1QKXA 3HRSA 4J9FA 1JJ2S 4C8QG 2RM4A 2XU8A 3OBYA 2XKOC 2XIDA 3MJXA 4XTYA 2CZ0B 2XK0A 4FL6A 3PVLA 3G6EA 2LNHB 2AZSA 4ZGEB 2YUOA 4F7UG 2RJFA 1Q7YR 2V8KA 1X75C 4PFPA 4GY5A 2YRCA 2L89A 1B3QA 2QA4T 3HRTA 3TVTA 4C8QE 3CCVT 1X6OA 1M90U 3CC2Q 1K0SA 5CQXA 1Q82R 3NTIA 4JRKA 5GAOr 1M90C 1K9AA 2YRDA 2DD5A 2CSQA 2KVQG 1M8VA 3C4SA 2LP5A 4CC4B 1OX8A 2V8IA 4PNOA 1NJIR 1VIFA 4C8QD 4AMCA 2VXFA 4RUGA 2CUDA 1N6AA 1Q95G 2X3XD 1B34A 3A1PA 3T9NA 4F7UE 1NE8A 2FVUA 2K9GA 4FSXA 2VV5A 5IH2A 2JZ2A 2DLPA 3NPFA 1FMKA 3TU4K 1K4US 4M75F 2VVKA 4JRPA 3SDZA 3CMAA 4YTLA 2YWWA 5ECAA 3OYCA 4M7DA 3VYGA 3CCEQ 1WX6A 1BIAA 1MV0B 4PLIA 5GMKm 2J6KA 5J39A 4VUBA 3LH5A 2PNIA 4R55A 4M4ZA 4C0DB 4E7ZA 1OU9A 2C0OA 5GAN8 4DEYA 1HD3A 4DBHA 1HXDA 2NWMA 1HSQA 3E9GA 4PJOF 2BUDA 1FMVA 1ZUYA 2K3XA 4Z89A 4ZN3A 3QXEB 2ZPFB 4BDYA 3P8DA 3CCLQ 3CCRA 1HJDA 2MPXC 1DJ7B 4O5VA 2LCLA 2RQUA 5CKHA 3OYIA 4F14A 4M7AC 1K9MU 5KE3A 1VQPT 4IUVA 2P0QA 1K9MC 1VUBA 1G8XA 2QGFB 1PNJA 4M78C 4J7IA 4QQ6A 1KFZA 1M27C 3QBYA 4IKFA 2ATCB 1V76A 2E10A 2HQEA 4Z88A 2RJDA 5FWBA 2AK5A 3L2QA 1UB4A 4XTXA 1KHCA 3OYGA 2CP7A 3PMTA 2EQIA 2FPEA 2R57A 4BE2A 4DQ2A 1TSFA 2EIFA 4KH1B 2EQJA 2C06A 1I07A 4ANJA 3G71Q 2DA9A 2EGAA 1X01A 2ZPEB 1W2BA 1VQNA 4BB7A 1TS9A 3S3OA 2JTFA 2DRMA 4JJBA 4XU1A 4X1VA 3OS2A 2EYWA 1HK9A 2L3SA 4ME7A 2X35A 2CSIA 3F70A 4II1A 1IRXA 2O31A 3OMCA 1FX7A 5FU6B 3CCUA 4XU3A 4J9DA 2EYYA 1S72A 2HEQA 4FYYB 1TH7A 2L8DA 4HVUA 5LJ5e 2RPNA 2ZZDA 1ZX6A 3CC7Q 5IHKA 5IXBA 1PKSA 4M75E 1ZA1B 3MP1A 3PVQA 2O2OA 3KBGA 3TSWA 3H9NA 4R56A 4OMOA 1PM3A 5GAOl 1MGQA 4XK8E 2L2PA 4J6YA 4M75D 1IGQA 3EGXA 1X6GA 1TU0B 4FT2A 4M77B 1KSWA 3EFOB 2IPOB 4ZGJB 1YI2T 2R5AA 1UGVA 3CMEA 3GF5A 4ESRA 1X2QA 1NZ9A 8ATCB 4XQ3A 2LJ1A 1GFCA 2NUTA 1AWOA 2CZ6B 4KGXB 2DXCA 4RG2A 5CQYA 4PJOE 4JLIA 1NEGA 2JW4A 3JCMc 2X9HA 1RABB 3UA6A 2LQ8A 4F04B 1LJOA 3FDRA 2LT4A 4PJOD 4ZNXA 2A7YA 1M8MA 2RF0A 2RJEA 3VV0A 1R77A 3TQ7P 3SWNA 3V8KA 3VU3C 5GAOm 3M0TA 1JEGA 2O9VA 5KYNA 3PGGA 2EGEA 1TUCA 2DXBA 1WJSA 2VB6A 3FRNA 2PUKB 3M5AA 4RCBA 2D9TA 1JXMA 1B34B 1VQ9A 2RQWA 1VQKT 1ZLMA 4WCIA 3G6EQ 1QCNA 3QPHA 3FEOA 5LJ3g 2O01E 3C12A 3G1JA 3LX7A 1CKBA 4M7AF 2RQVA 4A4GA 2RNAA 1M1GA 5GANd 2LZ6B 3CBOA 4TVRA 4C8QC 4M7DB 3GNGA 1Q81R 5I2SA 2L3QA 4M78F 4M7DG 2LX9A 3I55T 2DEQA 5GANe 1W2BS 5D6YA 1N8RR 1D0XA 4RTVA 4XTUA 4R0KA 2ZPHB 5LJ3d 1VQMT 3THKA 4C5GA 3PMIA 3CD6Q 4E7JA 4QQDA 1VQ7T 2VASA 1YP5A 1UFFA 4OB0B 3I5RA 4IUQA 3DLLA 3HKSA 3MEWA 1B7TA 1ZBJA 1YHQT 3CMAQ 3SEMA 1IREB 1J3TA 2ROTA 1N9RA 3RNJA 2HZYA 2R58A 5IXFA 2QA4A 1AD5A 3CCVA 4KUIA 2A28A 4J9HA 4DA4A 2DTHA 1EZZB 2RK1A 2PQWA 2WSCE 3CCSQ 2DX1A 1M3AA 3R6NA 1GXIE 1PCXA 1AWJA 4LN2A 1A0NB 1JJ2P 1PSFA 1H641 1H92A 5KYXA 5KCHA 2MIOA 2MWOA 3TSZA 3CXCA 2G3RA 2FG0A 3M0PA 1KIKA 4XTVA 5GANf 2E5KA 1JQQA 2JNGA 3MPUB 3I35A 2ZPGB 3PIOA 3CCRT 3QYGB 1QVFS 1TUGB 1GCQA 2LCSA 4AG2C 2A08A 2DXUA 2DETA 3S6WA 3BE3A 4C0DC 3A8GB 1RAAB 1WHGA 4HT9A 4JJDA 5CR2A 2E70A 3EGUA 2V1RA 3M56A 1LVKA 3CC4Q 3L1AA 4C92F 2YT6A 3X20B 3V8JA 3SD4A 2F5KA 5KYWA 1PHTA 1XTDA 4JS5A 4JDSA 2DJZA 2RA2A 3O8VA 3EFRA 1VQNQ 3M0RA 3HRUA 3GPLA 4M7AE 1VQPA 2QYZA 3ZFJA 1BIBA 4LDYA 2DRKA 2RO0A 3MCAB 2CH4A 3SB2A 4LUDA 2J6FA 4M78E 1ZBXA 3JV3A 2IIMA 4BE1A 4M7AD 1UGQB 2EGCA 3FLGA 1ZSGA 3PIPA 1K8AR 1OPLA 3CCUQ 1QQJA 3OYHA 1YJNT 3V8LA 2JOYA 1CKAA 3JCMJ 4X34A 4BI3A 1QKWA 1UJYA 2NUTB 2SRCA 3ULRB 5IN1A 5CKBA 1KD1R 1M1KU 2DL7A 2F2XA 1QP2A 1M1KC 3JSCA 2LJ3A 2KMTA 4O6JA 4C0FA 1YNZA 3BFMA 4LD9K 3OS1A 2EWNA 3E2UA 1K0XA 2CZ7B 2IVWA 2CP3A 1EFNA 1NEBA 3NGPA 3P8BB 1B07A 1R0BG 3SWNB 2L5QA 3CMEQ 3OW2S 2DAQA 2BE9B 5FU6C 3X25B 2RI5A 4EPCA 2XDDA 2MF2A 1VQ4T 3UT1A 2YDLA 2VKNA 4DOVA 2ED1A 3OYLA 2KAFA 2A36A 2KT1A 1IHVA 4EMGA 4J9EA 3N5BB 4MZMA 1UGRB 4C92G 3M58A 3BDLA 3BY7A 4JZ4A 1K73R 1NPRA 3MKDA 5GAMe 1RAHB 1WGSA 2L3RA 1WA7A 3CXCS 2EJGA 2YLBA 1YI2A 2DJQA 2DKGA 4LDVA 1AT1B 2DZ9A 1ZA2B 2RI3A 4EMKA 1GBRA 1YJWT 4HCZA 3EH2A 3V7RA 2F2VA 3OA6A 3DB4A 4A63B 4C92E 1Q7YU 4E2FB 4AG1C 1PC0A 2QQSA 4NS5A 1UJ0A 4FCYA 1VQ9Q 1AZEA 3X24B 3ZBDA 3G4SQ 1U06A 2EQKA 1YJ9T 4OMFB 4C92D 1AEYA 1I0CA 4B6MA 1AHJB 2EAYA 4D8KA 3JAME 1FYNA 1M4ZA 2P4TA 3RR6A 1AWXA 2ZPBB 2B86A 2OAWA 5A0GA 2HD0A 2GQVA 2AHJB 2RQRA 4MDXA 4JZ3A 5IAYA 4KH0B 3AT1B 2FZCB 3V7CA 2HBPA 3JB9F 3M0SA 2YUPA 2KROA 3CCJQ 1SSFA 3CCQT 3FIFA 4RTWA 3GNFB 2ENMA 2CUBA 4OMNA 3GOXA 4XU2A 1VQKA 1SPKA 5KYXB 4E47A 3RMSA 1NYGA 3QWYA 3EHQA 3TCJA 2DBKA 2QA4Q 4PLLA 1UHFA 4RTYA 3I56T 2XMFA 3CCVQ 4M7DC 1OYXA 2CKKA 5GMKl 1PD0A 3JCMh 3OMGA 1YN8A 3OB9A 4MDWA 2RHXA 5C0MA 3I55A 1I81A 4LE9A 1U3OA 1VQMA 2K57A 1VQ7A 1W4SA 1KJWA 2EYZA 2DM1A 1YITA 2QG9B 5CKDA 1T0JA 1X27A 5KYWB 2F5TX 1YHQA 1GFDA 2RK2A 1XOVA
chains in the Genus database with same CATH topology
4J6YA 2XG8D 3HL8A 5FRNA 3UWNA 2RD1A 4M75D 4UC4A 3VKIA 5IT9E 3CPWA 1I8FA 3GLXA 4FT2A 4J5YA 4M77B 1XQHA 3CEYA 2DO3A 3E19A 3Q1JA 4ZGJB 3CCST 1YI2T 3MP8A 4Y91A 4BD3A 2R5AA 3CMEA 5L8RE 4IUUA 4M77C 2LNVA 3A5ZB 3GF5A 4ELYC 3MEUA 3JB9I 3L2UA 1O9SA 1ZQ1A 4HKEA 3DKMA 2D0QB 1NZ9A 3MO8A 2PVGB 3M4YA 5HY6A 4F7UA 5C6SA 1Y96A 4XQ3A 3QDRB 4P5NA 2FL7A 4BY6C 3CC7A 1G3YA 2CZ6B 2K4YA 2DXCA 3NTHA 4M75A 4RG2A 2P0KA 5CQYA 4PJOE 4JLIA 5CCAA 2LT1A 1WJQA 4L5GA 2MMPA 3QSUA 3JCMc 4WF2A 3FC3A 1G3WA 3CCMT 3META 2LQ8A 1KD1U 1LJOA 4N0AA 4NL2A 3FDRA 3KXTA 4KT0E 4A54A 1KD1C 3JB9G 2LT4A 4PJOD 1WQWA 1Q7YC 1BYMA 3E9FA 3HSBA 2A7YA 4BI4A 3MP6A 2MI6A 4M7AB 3OYBA 3FB9A 3M59A 3CCEA 2RJEA 1UGSB 1FXXA 3VV0A 3SWNA 3V8KA 3VU3C 1Q82U 3EFSA 2XDBA 5GAOm 4M7AG 4M77F 1Q82C 5LJ3f 5DLOA 2EKOA 5FU7C 3LLRA 4M78B 4D6WA 1QW1A 2KQWA 3S3MA 4NL3A 5GAN2 2XHCA 5GMKi 3LGFA 4J6WA 1NJIU 4KUDK 5EG2A 4PJOA 4CRIA 2I2LA 3RESA 2DXTA 3PGGA 4RKUE 4M78G 4J6XA 1NJIC 2QDYB 1P92A 3JCMd 3OYJA 4X9CA 1KQ1A 1RL2A 2EQUA 3J81E 2DXBA 4FM4B 1WJSA 3VJPA 2EQMA 3QHSA 3FRNA 1H3ZA 1YBYA 2PUOB 3CCLT 2PUKB 4CI0C 4MMLA 3M5AA 4RCBA 2D9TA 1N9SA 2ZGWA 3G4ST 2E41A 4JS4A 1B34B 4X9DA 4A4EA 1OZ2A 1VQ9A 1XNIA 3OYEA 5GAMf 3JCMe 2O4XB 1BI2A 1VQKT 2DZCA 1PSEA 5LJ5j 3QPHA 5LJ3j 3RKYA 1JJ2A 3JCMW 1LOJA 5LJ5g 3FEOA 3QKJA 5LJ3g 1KC8U 2O01E 3JB9D 1VQNT 1VQ6A 3C12A 5I2MA 2B8AA 1KC8C 3LX7A 4C8QB 4M7AF 4ZN1A 4A4GA 1M1GA 2DK3A 5GANd 2X4JA 4RCCA 3CBOA 2LTOA 4TVRA 4DOWA 4C8QC 2RJCA 1Y71A 4BI8B 1QP3A 3GNGA 1JBMA 4M7DB 1V29B 5I2SA 4M78F 2E12A 1MHNA 2K2VA 3EAEA 5KH6A 4M7DG 2PU9B 2LX9A 3OS0A 1D3BA 3I55T 1KQSA 2DEQA 2JN0A 2XI9A 5D6YA 5GANe 5GAMj 3J80E 3CCJT 1W2BS 4M78D 4J7FA 3CCUT 4XTUA 5GMKe 5GAMg 3JCMP 2ZPHB 2JVVA 2XICA 1VQLT 4F7UB 5CAIA 5LJ5d 5LJ3d 1VQMT 1S72T 1LNXA 4C5GA 2PVDB 3PMIA 4FU6A 4E7JA 4QQDA 4Y28E 3G71T 2MAMA 1YJNA 1VQ7T 4EDUA 3V7SA 4OB0B 1QVPA 3ME9A 3J7AF 4EMKB 4J83A 2D6FA 2E6NA 4E7KA 4IUQA 3DLLA 3HKSA 4M75C 1Y07A 3MEWA 3LWIA 5CKEA 1ZHIA 5FRMA 2QEXA 2GF7A 5AYFA 1YHQT 4FIBA 1IREB 3MEVA 4MMKA 5GAN3 3LWHA 3CC2T 2EJ9A 3OYYA 1BI3A 4N0AC 1N9RA 3R6OA 3LGLA 3NFCA 4C8QF 2R58A 2QA4A 5LL6S 2VXEA 4C5IA 3CCVA 4L6V5 4KUIA 4B9XA 4HT8A 2DD4A 2GFUA 4M7DF 2QXFA 4OGEA 3M9QA 5GAN5 2EJFA 3H6ZA 1WNLA 4LDXA 4DA4A 3RIRA 2QQAA 3HFNA 3CMET 3JCMf 3SWNC 2DTHA 2RK1A 3DLMA 2YLCA 4JRQA 4XU0A 3WVEB 2PQWA 3HHTB 2WSCE 3CD6A 2LRQA 2K5FA 2BIVA 3P8HA 4GLKA 3H8ZA 3OSSC 1OI1A 4ZTJA 1GXIE 4JJNK 4ZTFA 4M77G 3C95A 3MEAA 1I5LA 3CC7T 4BY6B 2HQXA 4F7UF 4PJOC 1VQ4A 4OF1A 3CPWS 4C92B 1PSFA 4BE0A 2RI2A 1VQ8T 1H641 2OTJA 3INZA 5FROA 3X26B 5KCHA 5GAOp 3PNWC 5KE2A 2MWOA 4C92C 3CXCA 2M1HA 1VQ5A 2KY9A 1OZ3A 2MWPA 2G3RA 1QVFA 2E64A 4XTVA 5GANf 4OVAA 1VQOA 4Q5WA 3PFSA 3RKXA 2V8JA 2K5LA 3LYIA 2JNGA 4QVDA 3JCMg 2X4YA 3PIOA 3OYDA 2ZPGB 3CCRT 3CCET 1Q81U 4HCCA 2JTMA 2LC4A 3NTKA 3JCMV 3QYGB 2WSEE 3C94A 2DTIA 1Q81C 1QVFS 4Z02A 3CCSA 2X4WA 3A8OB 3ASKA 3OY9A 4M77E 2OAUA 4HCBA 5FU7B 4J8OA 2DXUA 2E6ZA 2GCXA 3OQ5A 3S6WA 1M5Q1 4C0DC 3A8GB 5LJ5f 1FWZA 4HT9A 5CR2A 2OTLA 2E70A 4OB2B 2FHDA 3AHUA 4JRIA 4C5EA 4M77D 4NOYA 3M56A 5GANj 4QVZA 1YJWA 2FB7A 5GAMh 3L1AA 5DM7R 1BKBA 4C92F 5GMKj 3DB3A 5GANg 2E1HA 3V8JA 3X20B 1WPYA 3A8MB 1VIEA 2F5KA 3SD4A 3JCMb 1VQ9T 1Q86U 3L2ZA 4C0ZA 3TEEA 1WQ7A 4A4HA 1Q86C 1XTDA 3CBMA 2BKDN 2RH2A 4JS5A 4LDUA 3WXMB 4ELZC 5A0LA 1VQ6T 4JDSA 1UEBA 2DJZA 3JCMX 2RA2A 3O8VA 4M77A 3EFRA 3RMQA 1YJ9A 1VQ8A 3HRUA 3QO3A 3GPLA 3QUIA 4M7AE 1VQPA 4BACA 2JUFA 3ZFJA 3OYKA 1BIBA 4LDYA 4KBMB 5CO7A 1KG1A 3ZEHA 4V2SA 2RO0A 5J26A 3HRSA 5A0DA 2RHZA 3MCAB 3QZ5B 3SB2A 4EMHA 4M78E 4L59A 3JRZA 1ZBXA 4C8QG 2RM4A 5GAN6 1JJ2S 3CC4A 3BDUA 4BE1A 2XD0A 4M7AD 2XU8A 1UGQB 3FLGA 3OBYA 3OSVA 2XKOC 2XIDA 3A8LB 3PIPA 3MHXA 4MZPA 4BDZA 2HAXA 1BI0A 2Y4YA 3RERA 2PVOB 3M57A 4XTYA 3OYHA 1YJNT 3V8LA 4JLGA 1N27A 2CZ0B 2JOYA 2XK0A 4FL6A 4N4GA 4PL6A 1Y96B 1RI0A 4X34A 3CCQA 3JCMJ 4BI3A 4RG8A 2CGHA 2ZPIB 3WVDB 3G6EA 5IN1A 3HP9A 4M75B 5CKBA 5GAOq 4ZGEB 2QTXA 2QEXT 1M1KU 4F7UG 5KCOA 4M7AA 1KQSS 2RJFA 1QVGA 1QP2A 1M1KC 2V8KA 1X75C 1G3TA 3JSCA 4M75G 2KMTA 4O6JA 3VUBA 4C0FA 3BFMA 4JUVA 1YITT 4LD9K 4GY5A 3OS1A 2L89A 2EWNA 2QA4T 2CZ7B 2IVWA 3JB9H 3HRTA 4M78A 4C8QE 3CCVT 1X6OA 1M90U 5CQXA 5DLQE 3OW2A 3NTIA 4JRKA 5GAOr 1M90C 3I56A 4XAXB 2DD5A 2ZCFB 4RMOA 4M7DE 3P8BB 2KVQG 3FJPA 1M8VA 3C4SA 3SWNB 2M16A 2V8IA 4PNOA 2LQKA 1VIFA 2L5QA 4C8QD 3GP8A 3M55A 3L2VA 3OW2S 2DAQA 2VXFA 5FU6C 3X25B 5GAOn 2RI5A 4EPCA 1N6AA 3M54A 2XDDA 1WJRA 5HK0A 1B34A 2MF2A 3KUFA 1VQ4T 3UT1A 4M7DD 4PJOB 3OS5A 3RKWA 3T9NA 4DOVA 4F7UE 1JRIA 1NE8A 2O4XA 3OYLA 2KSSA 2FVUA 4FSXA 2KAFA 2OTJT 2VV5A 2CYZB 2F69A 3URGA 2JZ2A 2FYKA 4PJOG 5J3BA 3L2RA 3PTAA 3E1SA 1IZ6A 4EMGA 3TU4K 4M75F 3G7ZA 4JRPA 2E5QA 2QQBA 2VGNA 3SDZA 2VYTA 4C8QA 5GAN7 3CMAA 3N5BB 1U1TA 4YTLA 3CC2A 1BI1A 4N4IA 4MZMA 1R8OB 1UGRB 4QVCA 1VQOT 3OYCA 4C92G 1NPPA 3M58A 4OB3B 3BDLA 3BY7A 4ATOA 4OP0A 4M7DA 1UGPB 2DPPB 1YIJA 3ER0A 4FT4A 3VYGA 4XTZA 1NPRA 1YCYA 5GAMe 1KQ2A 2VUBA 1WGSA 2QQ9A 1BIAA 3SFMA 5LJ5h 2L3RA 5LJ3h 4PLIA 3UDCA 5GMKm 5J39A 4VUBA 3CXCS 3UPUA 2EJGA 1K8AU 2YLBA 5HK3A 1YI2A 3OYFA 4R55A 3JB9J 5CK9A 4C0DB 1K8AC 2QQRA 1U8RA 1N8RU 2OTLT 2DKGA 4LDVA 5GAN8 3QIIA 2DZ9A 1N8RC 1HXDA 2HNIA 2RI3A 4EMKA 1JB0E 1YJWT 4HCZA 1M1FA 4ZGDB 2WSFE 3E9GA 4PJOF 1D3BB 3V7RA 4A4KA 5FLXE 4IUPA 3M4GA 3OA6A 3DB4A 2BUDA 1O75A 5HKCA 4C92E 1Q7YU 2K3XA 4NS5A 2QQSA 3X28B 4ZN3A 3QXEB 3CCMA 5D6XA 2ZPFB 2LVMA 4BDYA 2Y4XA 3P8DA 2DTOA 2LDMA 4A4FA 4XTWA 5I21A 3CCRA 3X24B 3TREA 2WACA 3ZBDA 4MZTA 2EQKA 1YJ9T 4OMFB 1DJ7B 2YRVA 4C92D 2CS7A 2CZ1B 2LCLA 2LCCA 4O5VA 1AHJB 2EAYA 5CKHA 3JAME 3OYIA 4M7AC 1K9MU 5KE3A 1VQPT 5CVIA 4QQGA 2A3LA 1M4ZA 2P4TA 2RHYA 4IUVA 2P0QA 2ZPBB 3LW5E 1VUBA 1K9MC 4QW2A 4BUGA 2DIQA 5A2QE 5A0GA 2HD0A 4M78C 2GQVA 4IUTA 4J7IA 4QQ6A 2AHJB 3CC4T 4E7IA 3BW1A 2M0OA 3OYAA 4E7LA 2X4XA 3QBYA 4IKFA 2RB6A 4MDXA 2E10A 1G5VA 2HQEA 4C92A 5IAYA 2RJDA 3L2QA 1UB4A 4XTXA 1KHCA 3OYMA 4LDWA 2NLUA 3V7CA 2HBPA 1U1SA 3JB9F 4E7HA 2VGMA 3OYGA 3CCLA 3HPWA 1SSFA 3CCQT 3FIFA 3PMTA 4PKCC 2KDSA 3G4SA 4BE2A 2R57A 3G6ET 4C5HA 4DQ2A 3GNFB 5CKFA 2EIFA 3L42A 4C0GA 3A8HB 3GOXA 3QZ9B 2EQJA 2XDPA 3CPFA 1Y7XA 3CBPA 4LD6A 4XU2A 1K73U 2C06A 1VQKA 1EIFA 2VC8A 4E47A 1K73C 1X01A 3RMSA 2H3JA 2ZPEB 1W2BA 1VQNA 4OB1B 2K3YA 4BB7A 2RHUA 2K5IA 3S3OA 5M9OA 2JTFA 4OGCA 2R5MA 3TCJA 2M9UA 2QI2A 5DY9A 4PLLA 4XU1A 3OS2A 3I56T 2EYQA 1HK9A 4IURA 1G3SA 2EFIA 3QJ6A 4M7DC 1OYXA 2CKKA 4ME7A 4KULA 2X35A 3QG1A 5GMKl 3JCMh 3OMGA 3OB9A 3F70A 4MDWA 1QVGS 4II1A 2GFAA 4A53A 2RHXA 3OMCA 5C0MA 3I55A 3CCJA 1FX7A 1I81A 5FU6B 3CCUA 3CD6T 2DVEA 2KK4A 3PT9A 4XU3A 3HFOA 1VQLA 1I4K1 2P0PA 1VQMA 1S72A 3GIBA 2IG0A 2K57A 4N4HA 4HA8A 1TH7A 2L8DA 3G71A 3M53A 1VQ7A 2RHIA 5LJ5e 1W4SA 4EMKC 5LJ3e 2ZZDA 2DIGA 2Y90A 3QJYA 5D6WA 1YITA 3OYNA 3CMAT 5CKDA 3VUZA 3QYHB 3S3NA 4M75E 3L2WA 3VYHB 4B9WA 2E65A 1KHIA 3MP1A 5CIUA 2F5TX 3OBWA 1M9SA 3KBGA 5GANh 4R56A 3LH0A 5GAMd 3RUXA 1YHQA 1VQ5T 5GAN4 5GMKh 3JCMQ 2RK2A 1XOVA 1YIJT 2YHTA 5GAOl 1MGQA 4XK8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ3 d;  3QO3 A;  4J6Y A;  1LNX A;  4PJO F;  3QUI A;  1D3B B;  3V7R A;  4M7A E;  3M4G A;  2RD1 A;  4M75 D;  1I8F A;  1BIB A;  4J5Y A;  4M77 B;  3V7S A;  4C92 E;  4EMK B;  4V2S A;  4M75 C;  3SB2 A;  4Y91 A;  4EMH A;  4M78 E;  4C8Q G;  5GAN 6;  2DTO A;  2RM4 A;  4M77 C;  3BDU A;  4XTW A;  4M7A D;  3JB9 I;  5I21 A;  4MMK A;  5GAN 3;  2EJ9 A;  4C92 D;  4F7U A;  4N0A C;  1Y96 A;  1N9R A;  2EAY A;  4XQ3 A;  4C8Q F;  4M7A C;  3RER A;  4M75 A;  2VXE A;  4XTY A;  4PJO E;  3V8L A;  4JLI A;  4HT8 A;  3QSU A;  3JCM c;  4WF2 A;  4M7D F;  1Y96 B;  3JCM J;  5GAN 5;  2EJF A;  1WNL A;  2CGH A;  4M78 C;  3RIR A;  3HFN A;  4M75 B;  1LJO A;  3JCM f;  3SWN C;  2DTH A;  4N0A A;  4NL2 A;  2QTX A;  2YLC A;  3BW1 A;  4F7U G;  5GAO q;  4XU0 A;  4A54 A;  4M7A A;  2RB6 A;  3JB9 G;  2E10 A;  1KQ2 A;  1WQW A;  4PJO D;  4M75 G;  4C92 A;  3BFM A;  4JUV A;  3HSB A;  4M77 G;  4XTX A;  2EWN A;  1I5L A;  4M7A B;  3JB9 H;  3FB9 A;  4F7U F;  3V7C A;  4M78 A;  4C8Q E;  4PJO C;  1U1S A;  3JB9 F;  3SWN A;  3V8K A;  3VU3 C;  4C92 B;  3EFS A;  4JRK A;  5GAO r;  1H64 1;  5GAO m;  4M7A G;  3FIF A;  4M77 F;  3INZ A;  5LJ3 f;  5GAN 4;  5GAO p;  4DQ2 A;  4M7D E;  4M78 B;  4C92 C;  3FJP A;  4NL3 A;  5GAN 2;  1M8V A;  3SWN B;  5GMK i;  4J6W A;  4XU2 A;  4PNO A;  4C8Q D;  4PJO A;  2I2L A;  3RES A;  2DXT A;  3PGG A;  2E64 A;  4J6X A;  2VC8 A;  4M78 G;  4XTV A;  1X01 A;  2VXF A;  5GAN f;  5GAO n;  3JCM d;  3RKX A;  4QVD A;  4X9C A;  3JCM g;  1KQ1 A;  1B34 A;  4M7D D;  4PJO B;  3QHS A;  3RKW A;  3JCM V;  4F7U E;  5CAI A;  5GAO l;  1JRI A;  2DTI A;  5DY9 A;  4XU1 A;  4MML A;  4RCB A;  1HK9 A;  1N9S A;  2ZGW A;  5GAM g;  2E41 A;  4M7D C;  2FYK A;  4PJO G;  1B34 B;  4X9D A;  4M77 E;  5GMK l;  5GAM f;  4EMG A;  3JCM e;  4M75 F;  3JCM h;  2DXU A;  3GIB A;  4C8Q A;  2DZC A;  5GAN 7;  5LJ5 j;  1U1T A;  1M5Q 1;  3RKY A;  4A53 A;  5LJ3 j;  5LJ5 f;  4QVC A;  3JCM W;  1LOJ A;  5LJ5 g;  4C92 G;  5LJ3 g;  4HT9 A;  3JB9 D;  1I81 A;  3BY7 A;  4OP0 A;  3AHU A;  4M7D A;  2DVE A;  4JRI A;  4XU3 A;  4C8Q B;  3HFO A;  4M77 D;  4M7A F;  4NOY A;  4XTZ A;  5GAN j;  1I4K 1;  1YCY A;  2FB7 A;  5GAM e;  3L1A A;  2K57 A;  5GAM h;  5GAN d;  4HA8 A;  4RCC A;  1TH7 A;  4C92 F;  5GMK j;  5GAN g;  2E1H A;  3V8J A;  4C8Q C;  1WPY A;  1BIA A;  5LJ5 e;  5LJ5 h;  1JBM A;  4EMK C;  5LJ3 h;  5LJ3 e;  3JCM b;  4M7D B;  5GMK m;  2Y90 A;  3L2Z A;  4M78 F;  2EJG A;  1WQ7 A;  2YLB A;  4M75 E;  4M7D G;  3JB9 J;  2E65 A;  1D3B A;  2DEQ A;  2JN0 A;  5GAN e;  2DKG A;  5GAM j;  5GAN h;  5GAN 8;  5GAM d;  4M78 D;  2DJZ A;  2DZ9 A;  4XTU A;  3RUX A;  5GMK e;  3JCM X;  1HXD A;  2RA2 A;  2HNI A;  3EFR A;  4M77 A;  4EMK A;  2YHT A;  5GMK h;  3JCM Q;  1MGQ A;  4F7U B;  5LJ5 d;  3JCM P; 
#chains in the Genus database with same CATH topology
 5FRN A;  1WHJ A;  1KC8 R;  2RD1 A;  4UC4 A;  3VKI A;  4J9I A;  3CPW A;  5IT9 E;  3GLX A;  4J5Y A;  2L3P A;  4BD3 A;  3NMZ C;  5L8R E;  3L2U A;  1C0M A;  1O9S A;  4E6R A;  4HKE A;  5L23 A;  2D0Q B;  4JPB W;  1UG1 A;  4HVW A;  3VS7 A;  1VOM A;  1RAG B;  2GNC A;  2K3B A;  5CCA A;  1WXB A;  4L5G A;  4RTU A;  3QSU A;  3VS1 A;  1WZO A;  1W2B P;  1G3W A;  5AT1 B;  2CP2 A;  3REB B;  3VS0 A;  4N0A A;  1WXT A;  4FYW B;  4AFQ C;  3JB9 G;  2DL4 A;  1BYM A;  3E9F A;  1H8K A;  3OYB A;  1HYO A;  1UGS B;  1FXX A;  2KRS A;  3EFS A;  2XDB A;  1VQP Q;  1VQ6 Q;  4M77 F;  4PJM A;  1RI9 A;  5DLO A;  2EKO A;  2E3I A;  3LLR A;  2DER A;  2DMO A;  4NL3 A;  1BCO A;  2XHC A;  5GMK i;  4KUD K;  5EG2 A;  2I2L A;  2DXT A;  4RKU E;  4J6X A;  3EG3 A;  1MNE A;  1YWP A;  1NLO C;  4X9C A;  1KQ1 A;  2EQU A;  3VJP A;  2EQM A;  3QHS A;  1SHF A;  1XJW B;  3CCL T;  4MML A;  2HKN A;  2E41 A;  4X9D A;  4AT1 B;  2MK5 A;  2QAS A;  3RKY A;  1LOJ A;  5LJ5 g;  3I9Q A;  3QKJ A;  3JB9 D;  2B8A A;  4ZN1 A;  1GCP A;  1N5Z A;  2ECZ A;  4KRT A;  4DOW A;  2RJC A;  1Y71 A;  1V29 B;  1K1Z A;  1SRM A;  2E12 A;  1MHN A;  3EAE A;  2A0F B;  1D3B A;  5GAM j;  1QVF P;  1TWB A;  4HVV A;  3NHN A;  1VQL T;  5LJ5 d;  2JT4 A;  1SF9 A;  4FU6 A;  3G71 T;  1YJN A;  2J6O A;  4EDU A;  3V7S A;  1QVP A;  3ME9 A;  2COW A;  4EMK B;  4LNP A;  2ED0 A;  3PE0 A;  3LWI A;  2DNU A;  2W10 A;  3MEV A;  5GAN 3;  1V1C A;  3LWH A;  1BI3 A;  1OPK A;  3R6O A;  3LGL A;  3NFC A;  2EBP A;  5LL6 S;  1TUD A;  3IQL A;  4HT8 A;  5EC7 A;  4M7D F;  2QXF A;  4OGE A;  3M9Q A;  1H3H A;  2CH4 W;  2CP0 A;  3RIR A;  3HFN A;  4EIK A;  3SWN C;  3VS3 A;  4XU0 A;  3WVE B;  1YI2 Q;  2LRQ A;  2BIV A;  3P8H A;  4ZTF A;  1PKT A;  1IHW A;  4M77 G;  1D09 B;  3C95 A;  3CC7 T;  1ARK A;  1VQ4 A;  3CPW S;  4HXJ A;  9ATC B;  4J9G A;  8AT1 B;  3PNW C;  2CT3 A;  4C92 C;  2M1H A;  1VQ5 A;  2KY9 A;  1OZ3 A;  1QVF A;  1RAF B;  1Z9Q A;  2E64 A;  2BZ8 A;  1QMC A;  4Q5W A;  3PFS A;  3RKX A;  3L2W A;  3LYI A;  3OYD A;  1IXD A;  1Q81 U;  2JTM A;  2LC4 A;  3NTK A;  1SG5 A;  2WSE E;  2DTI A;  1Q81 C;  3A8O B;  2OI3 A;  4M77 E;  4HCB A;  5FU7 B;  2GCX A;  5LJ5 f;  2KE9 A;  1FWZ A;  4OB2 B;  2YXY A;  3AHU A;  4C5E A;  4M77 D;  2FPD A;  4NOY A;  2FEI A;  1YJW A;  2FB7 A;  1BKB A;  2LMJ A;  5GAN g;  4CC3 A;  3OW2 P;  2GGR A;  3TEE A;  1WQ7 A;  3CBM A;  2BKD N;  2RH2 A;  4LDU A;  3WXM B;  1VQK Q;  1UEB A;  3JCM X;  1YJ9 A;  4BAC A;  2A37 A;  3ZEH A;  4V2S A;  2RHZ A;  4L59 A;  5GAN 6;  2BE7 D;  3OSV A;  2HSP A;  2HAX A;  3MHX A;  1PRM C;  4MZP A;  3I55 Q;  4BDZ A;  1AOJ A;  1BI0 A;  3CXC P;  2Y4Y A;  2JMA A;  1T3S A;  2PVO B;  4JLG A;  2HL3 A;  4PL6 A;  3CCQ A;  1VQ7 Q;  4RG8 A;  2CGH A;  2ZPI B;  3HP9 A;  2KR3 A;  2QTX A;  2QEX T;  5KCO A;  4RTT A;  1QVG A;  1YIT T;  1W1F A;  2K7A A;  1YHQ Q;  3JB9 H;  4GBQ A;  1VYV A;  3C0C A;  5DLQ E;  3OW2 A;  3I56 A;  4FW2 A;  2DF6 A;  2EYX A;  4M7D E;  3FJP A;  2M16 A;  1RAD B;  1UE9 A;  3GP8 A;  1GCQ C;  1WHL A;  1AZG B;  3KUF A;  4M7D D;  2O4X A;  2OTJ T;  2F69 A;  3URG A;  5J3B A;  3E1S A;  1IZ6 A;  4FYV B;  3G7Z A;  2HMA A;  2QQB A;  4C8Q A;  4GLM A;  3CC2 A;  1U1T A;  4LUE A;  4N4I A;  4QVC A;  1R8O B;  1VQO T;  2D1X A;  1NPP A;  4OB3 B;  4ATO A;  1G2B A;  1F1B B;  3ER0 A;  4FT4 A;  2DEU A;  4XTZ A;  3VS2 A;  1MMN A;  1YCY A;  4F16 A;  2X51 A;  3CCR Q;  2C0T A;  2QQ9 A;  5LJ3 h;  3UDC A;  3UPU A;  5I22 A;  1K8A U;  5HK3 A;  1BU1 A;  5CK9 A;  1OU8 A;  1K8A C;  1U8R A;  2OTL T;  2KRM A;  3QII A;  2HNI A;  1JB0 E;  2WSF E;  1D3B B;  4A4K A;  1E6G A;  3M4G A;  2COY A;  4KGV B;  3X28 B;  5D6X A;  2LVM A;  2DTO A;  4XTW A;  2ZAE A;  4MZT A;  1VQ8 T;  2CZ1 B;  2LCC A;  1LCK A;  2HCK A;  2A3L A;  2RHY A;  3LW5 E;  1IO6 A;  3VRY A;  2GQI A;  5A2Q E;  1UEC A;  3A98 A;  1OOT A;  3CC4 T;  4E7I A;  3BW1 A;  2M0O A;  2X4X A;  4AFS C;  2GBQ A;  1G5V A;  1YWO A;  4Z8A A;  3EG0 A;  1U1S A;  4PFO A;  2VGM A;  3CCL A;  3HPW A;  1X6B A;  1WXU A;  2KDS A;  2ROL A;  3L42 A;  4C0G A;  2V26 A;  3A8H B;  3QZ9 B;  1S72 Q;  2XDP A;  1Y7X A;  1K73 U;  1EIF A;  1R0C B;  1QLY A;  2VC8 A;  1K73 C;  2H3J A;  4OB1 B;  2K3Y A;  2K5I A;  1MUZ A;  1M2O A;  1E6H A;  2COZ A;  2JS0 A;  4IUR A;  1G3S A;  3QJ6 A;  1YCS B;  4KUL A;  3QG1 A;  2P84 A;  4PJL A;  1QVG S;  4A53 A;  2K6D A;  1UDL A;  2KNB B;  2DVE A;  2KK4 A;  3PT9 A;  3HFO A;  2FRW A;  1VQL A;  1I4K 1;  2P0P A;  3GIB A;  2IG0 A;  1MND A;  4HA8 A;  2DIL A;  3M53 A;  3G71 A;  2RHI A;  1YFN A;  4EMK C;  2Y90 A;  5D6W A;  2EVR A;  3VUZ A;  3QYH B;  5IHI A;  2AIR B;  2KEA A;  2E65 A;  1KHI A;  5CIU A;  5GAM d;  3RUX A;  1VQ5 T;  5GAN 4;  5GMK h;  1YIJ T;  3HTR A;  1SEM A;  3HL8 A;  2NUP A;  1I8F A;  4OMQ A;  3EH1 A;  3CEY A;  1OUL A;  3E19 A;  1RLP C;  1ZSZ A;  2HL5 C;  2CRE A;  3MP8 A;  4Y91 A;  4M77 C;  2LNV A;  3A5Z B;  3MEU A;  3JB9 I;  2FPF A;  2AZV A;  2PVG B;  1W70 A;  3M4Y A;  5HY6 A;  1Y96 A;  3QDR B;  4P5N A;  2FL7 A;  2KBT A;  5KYU A;  3CC7 A;  2K4Y A;  4M75 A;  2C0I A;  2P0K A;  2DL5 A;  2LT1 A;  1YJW Q;  1C1A A;  1SSH A;  2JM9 A;  3CCM T;  3MET A;  1ZUU A;  3UA7 A;  3UAT A;  1WQW A;  1X69 A;  1Q7Y C;  3H41 A;  1AVZ C;  2CP5 A;  1D1B A;  3MP6 A;  2MI6 A;  1YJ9 Q;  2KT8 A;  1Q82 U;  1Q82 C;  2LQN A;  5FU7 C;  1WFW A;  2HSE B;  1BCM A;  3LGF A;  4J6W A;  1NJI U;  4PJO A;  3RES A;  1NJI C;  1LPL A;  2K79 A;  1RUW A;  3JCM d;  1RL2 A;  4FM4 B;  1YBY A;  2PUO B;  4CI0 C;  1WHM A;  2EW3 A;  2ZGW A;  3G4S T;  4PK4 A;  4A4E A;  4AFU C;  1OZ2 A;  1XNI A;  5GAM f;  3JCM e;  3CCQ Q;  1Y57 A;  2O4X B;  2DZC A;  5LJ3 j;  3CPW P;  1RAE B;  4K11 A;  1KC8 U;  3CQT A;  5I2M A;  1KC8 C;  4C8Q B;  4J9C A;  4RCC A;  2LTO A;  2DL8 A;  4BI8 B;  1QP3 A;  2KXD A;  3I56 Q;  2K2V A;  5KH6 A;  3EHR A;  3OS0 A;  1KQS A;  3CCJ T;  1D0Y A;  2E3H A;  3JCM P;  2JVV A;  1QCF A;  1QWE A;  1I1J A;  4F7U B;  5CAI A;  1X43 A;  3VS6 A;  3EGD A;  4QT7 A;  1PRL C;  3J7A F;  3REA B;  1E7O A;  2E6N A;  5IHN A;  1Y07 A;  2ESW A;  5CKE A;  1ZHI A;  2QEX A;  1OEB A;  1OX9 A;  1PG5 B;  5AYF A;  1Q86 R;  4FIB A;  3CC2 T;  4N0A C;  1Z9Z A;  2DBM A;  1RAC B;  1NLP C;  2CDT A;  4PFZ A;  2HBW A;  3VRZ A;  5I11 A;  1UHC A;  4B9X A;  2GFU A;  2EJF A;  3H6Z A;  2QQA A;  4E7S A;  3JCM f;  1CSK A;  4DBQ A;  1ABQ A;  3EG9 B;  3CD6 A;  5GJW B;  2K5F A;  3H8Z A;  2JJ9 A;  2I0N A;  3FJ5 A;  3MEA A;  4BY6 B;  2HQX A;  2EKH A;  4BE0 A;  4OMP A;  3H0H A;  1T0H A;  2OTJ A;  3INZ A;  5GAO p;  1S1N A;  5KE2 A;  2MWP A;  1KK7 A;  1VQO A;  2KYM A;  2V8J A;  3CCE T;  2X4Y A;  2QK0 A;  3JCM V;  1FMW A;  3CCS A;  2NUZ A;  2MYS A;  2OAU A;  2YUN A;  4CC7 A;  1M90 R;  4J8O A;  3OQ5 A;  2RN8 A;  1M5Q 1;  3H0F A;  1PD1 A;  2OTL A;  2FRY A;  2W0Z A;  3QDF A;  1NG2 A;  1D1C A;  4QVZ A;  2KRN A;  3RBB B;  1TG0 A;  5GMK j;  2VWF A;  1D1A A;  3A8M B;  2OX7 A;  1M3B A;  2H8H A;  4A4H A;  1AWW A;  5A0L A;  1VQ6 T;  2E4H A;  1VQ8 A;  5KYY A;  1M30 A;  3QUI A;  2JUF A;  2J7I A;  1MV3 A;  1G83 A;  2H3E B;  5CO7 A;  2F2W A;  5J26 A;  5A0D A;  2NUP B;  3QZ5 B;  4EMH A;  3JRZ A;  3CC4 A;  3BDU A;  2KYB A;  2XD0 A;  1ZSZ B;  1SKU B;  3A8L B;  3RER A;  2J06 A;  3M57 A;  5GJV B;  1VQL Q;  1N27 A;  4N4G A;  1Y96 B;  1RI0 A;  2NYS A;  5KYU B;  1I5O B;  3WVD B;  4M75 B;  5FWC A;  5GAO q;  4OML A;  4M7A A;  1KQS S;  1G3T A;  1GBQ A;  4M75 G;  3VUB A;  4JUV A;  4DBR A;  4M78 A;  1UTI A;  4FW1 A;  2DYB A;  4XAX B;  2ZCF B;  4DEX A;  1BBZ A;  1K9M R;  4RMO A;  4F17 A;  1D0Z A;  1T3L A;  1RLQ C;  2LQK A;  1WI7 A;  1JU5 C;  3M55 A;  3L2V A;  5GAO n;  3M54 A;  2AT1 B;  1WJR A;  5HK0 A;  1JO8 A;  2JXB A;  4PJO B;  3OS5 A;  3RKW A;  1JRI A;  2KSS A;  2CYZ B;  2FYK A;  4PJO G;  3L2R A;  3PTA A;  4QKU A;  2E5Q A;  2VGN A;  2VYT A;  5GAN 7;  1BI1 A;  1W6X A;  2D8H A;  4OP0 A;  1UGP B;  2DPP B;  2M0Y A;  1YIJ A;  1MMA A;  4ORZ A;  2FO0 A;  1KQ2 A;  3ZL7 C;  2VUB A;  3SFM A;  5LJ5 h;  1MMD A;  2AKL A;  4JJC A;  1WHH A;  2LX7 A;  1NBE B;  1WHK A;  3OYF A;  3JB9 J;  2F1L A;  2QQR A;  1N8R U;  1C6V X;  1N8R C;  1M1F A;  4ZGD B;  2L0A A;  5FLX E;  3M0U A;  4IUP A;  1QVG P;  1O75 A;  5HKC A;  1BK2 A;  1M3C A;  1GRI A;  3CCM A;  1K76 A;  3EGD B;  2Y4X A;  2J05 A;  2LDM A;  4A4F A;  2M51 A;  5I21 A;  2OJ2 A;  3TRE A;  2WAC A;  1U5S A;  2YRV A;  2CS7 A;  4CC2 A;  2LJ0 A;  5CVI A;  4QQG A;  4QW2 A;  4BUG A;  2DIQ A;  1RAI B;  1SHG A;  2FZG B;  4IUT A;  2QTV A;  3OYA A;  4E7L A;  2RB6 A;  4C92 A;  1ABO A;  2BTT A;  3OYM A;  4LDW A;  2HQH A;  2KXC A;  2NLU A;  2K2M A;  4E7H A;  2KGT A;  2DYI A;  4PKC C;  3G4S A;  3G6E T;  3QWX X;  4C5H A;  5CKF A;  1VQM Q;  3CPF A;  3CBP A;  4LD6 A;  2V1Q A;  2QEX Q;  2QDL A;  2RHU A;  1QCO A;  5M9O A;  1YIT Q;  1VYU A;  4OGC A;  1TTH B;  2QAZ A;  2R5M A;  2M9U A;  2G6F X;  2QI2 A;  5DY9 A;  2EYQ A;  2EFI A;  2RQT A;  2GFA A;  4FSS A;  1OQK A;  3CCJ A;  4HCK A;  1JXO A;  3CD6 T;  3VS5 A;  2DVJ A;  4AFZ C;  4N4H A;  4J9B A;  5FW9 A;  1VYT A;  5LJ3 e;  2DIG A;  1M2V A;  3QJY A;  3UF4 A;  2OTJ Q;  3OYN A;  3CMA T;  3S3N A;  1WLP B;  3VYH B;  4B9W A;  4DBF A;  1TXQ A;  3OBW A;  5GAN h;  1M9S A;  3GBQ A;  3LH0 A;  3JCM Q;  2YHT A;  1VQO Q;  2XG8 D;  3RDV A;  3UWN A;  2DL3 A;  1XQH A;  5KYY B;  2DO3 A;  3Q1J A;  3CCS T;  4IUU A;  2ABL A;  5D7U A;  4ELY C;  1ZQ1 A;  3DKM A;  3MO8 A;  1WYX A;  4F7U A;  5C6S A;  2YSQ A;  2OTL Q;  4FYX B;  4BY6 C;  1G3Y A;  3NTH A;  2CT4 A;  3U23 A;  1WJQ A;  2MMP A;  2PZ1 A;  4WF2 A;  3FC3 A;  2AKK A;  1KD1 U;  4NL2 A;  3KXT A;  4KT0 E;  4A54 A;  1KD1 C;  1UUE A;  3HSB A;  3D7S B;  4BI4 A;  2HDA A;  4RTZ A;  2M02 A;  4M7A B;  3FB9 A;  3M59 A;  3CCE A;  1VQ8 Q;  2JS2 A;  4M7A G;  3I5S A;  5LJ3 f;  7AT1 B;  4LXC A;  4M78 B;  4D6W A;  1QW1 A;  2KQW A;  4KGZ B;  3S3M A;  5GAN 2;  3EG9 A;  4CRI A;  5HCK A;  4M78 G;  2QDY B;  1P92 A;  4OMM A;  2O88 A;  2JTE A;  1NYF A;  3OYJ A;  4PJJ A;  3EG2 A;  2DFU A;  3J81 E;  1H3Z A;  1N9S A;  1X2K A;  4JS4 A;  4IIM A;  3OYE A;  2YUQ A;  1BI2 A;  1PSE A;  2BZY A;  5LJ5 j;  1YJN Q;  1JJ2 A;  3JCM W;  1VQN T;  1QWF A;  2GTJ A;  1VQ6 A;  2HKQ B;  1WDX A;  2DK3 A;  2X4J A;  2PTK A;  1TOV A;  1VA7 A;  3EGX B;  1JBM A;  2PU9 B;  4RTX A;  2BZX A;  2JN0 A;  2XI9 A;  3J80 E;  1ZSZ C;  4J7F A;  4M78 D;  3CCU T;  5GMK e;  4PJN A;  5GAM g;  1IGU A;  2XIC A;  1S72 T;  1IB8 A;  1LNX A;  2PVD B;  4Y28 E;  6AT1 B;  2MAM A;  4J83 A;  2D6F A;  2MCN A;  1ACM B;  4E7K A;  3O5Z A;  4M75 C;  1VQ4 Q;  5FRM A;  2GF7 A;  2P4R A;  4MMK A;  2EJ9 A;  3OYY A;  2SEM A;  2JMC A;  4C8Q F;  2EPD A;  1VQ5 Q;  4C5I A;  2VXE A;  1YIJ Q;  4L6V 5;  2D0N A;  2DD4 A;  5GAN 5;  1WNL A;  3VS4 A;  4LDX A;  1SRL A;  3CME T;  1BB9 A;  3DLM A;  2YLC A;  4JRQ A;  3HHT B;  4ZTJ A;  4GLK A;  3OSS C;  1OI1 A;  4JJN K;  1I5L A;  1GL5 A;  4F7U F;  4PJO C;  4Y92 A;  2QGG A;  4OF1 A;  2FZK B;  4C92 B;  2RI2 A;  1NM7 A;  5FRO A;  3X26 B;  1Y0M A;  2CP6 A;  3CCM Q;  4WTO B;  2Z0W A;  1OV3 A;  4OVA A;  3EG1 A;  2K5L A;  4QVD A;  2D8J A;  3JCM g;  1M1K R;  4HCC A;  3C94 A;  2RMO A;  1KQS P;  4Z02 A;  2X4W A;  3ASK A;  3OY9 A;  2X3W D;  1WIE A;  2DE0 X;  3M0Q A;  2E6Z A;  3SHW A;  1EX4 A;  2FHD A;  1PWT A;  4JRI A;  2O9S A;  5GAN j;  5GAM h;  5DM7 R;  3H0I A;  3DB3 A;  2E1H A;  2MOX A;  1WPY A;  4D8D A;  1VIE A;  3JCM b;  1VQ9 T;  1ZUK A;  1Q86 U;  3L2Z A;  4C0Z A;  1Q86 C;  2KI7 A;  2LQW A;  3KFV A;  4ELZ C;  1M2V B;  1MMG A;  4M77 A;  3RMQ A;  3EFO A;  3QO3 A;  4IIO A;  3OYK A;  4KBM B;  1KG1 A;  2GTO A;  2JM8 A;  1QKX A;  3HRS A;  4J9F A;  1JJ2 S;  4C8Q G;  2RM4 A;  2XU8 A;  3OBY A;  2XKO C;  2XID A;  3MJX A;  4XTY A;  2CZ0 B;  2XK0 A;  4FL6 A;  3PVL A;  3G6E A;  2LNH B;  2AZS A;  4ZGE B;  2YUO A;  4F7U G;  2RJF A;  1Q7Y R;  2V8K A;  1X75 C;  4PFP A;  4GY5 A;  2YRC A;  2L89 A;  1B3Q A;  2QA4 T;  3HRT A;  3TVT A;  4C8Q E;  3CCV T;  1X6O A;  1M90 U;  3CC2 Q;  1K0S A;  5CQX A;  1Q82 R;  3NTI A;  4JRK A;  5GAO r;  1M90 C;  1K9A A;  2YRD A;  2DD5 A;  2CSQ A;  2KVQ G;  1M8V A;  3C4S A;  2LP5 A;  4CC4 B;  1OX8 A;  2V8I A;  4PNO A;  1NJI R;  1VIF A;  4C8Q D;  4AMC A;  2VXF A;  4RUG A;  2CUD A;  1N6A A;  1Q95 G;  2X3X D;  1B34 A;  3A1P A;  3T9N A;  4F7U E;  1NE8 A;  2FVU A;  2K9G A;  4FSX A;  2VV5 A;  5IH2 A;  2JZ2 A;  2DLP A;  3NPF A;  1FMK A;  3TU4 K;  1K4U S;  4M75 F;  2VVK A;  4JRP A;  3SDZ A;  3CMA A;  4YTL A;  2YWW A;  5ECA A;  3OYC A;  4M7D A;  3VYG A;  3CCE Q;  1WX6 A;  1BIA A;  1MV0 B;  4PLI A;  5GMK m;  2J6K A;  5J39 A;  4VUB A;  3LH5 A;  2PNI A;  4R55 A;  4M4Z A;  4C0D B;  4E7Z A;  1OU9 A;  2C0O A;  5GAN 8;  4DEY A;  1HD3 A;  4DBH A;  1HXD A;  2NWM A;  1HSQ A;  3E9G A;  4PJO F;  2BUD A;  1FMV A;  1ZUY A;  2K3X A;  4Z89 A;  4ZN3 A;  3QXE B;  2ZPF B;  4BDY A;  3P8D A;  3CCL Q;  3CCR A;  1HJD A;  2MPX C;  1DJ7 B;  4O5V A;  2LCL A;  2RQU A;  5CKH A;  3OYI A;  4F14 A;  4M7A C;  1K9M U;  5KE3 A;  1VQP T;  4IUV A;  2P0Q A;  1K9M C;  1VUB A;  1G8X A;  2QGF B;  1PNJ A;  4M78 C;  4J7I A;  4QQ6 A;  1KFZ A;  1M27 C;  3QBY A;  4IKF A;  2ATC B;  1V76 A;  2E10 A;  2HQE A;  4Z88 A;  2RJD A;  5FWB A;  2AK5 A;  3L2Q A;  1UB4 A;  4XTX A;  1KHC A;  3OYG A;  2CP7 A;  3PMT A;  2EQI A;  2FPE A;  2R57 A;  4BE2 A;  4DQ2 A;  1TSF A;  2EIF A;  4KH1 B;  2EQJ A;  2C06 A;  1I07 A;  4ANJ A;  3G71 Q;  2DA9 A;  2EGA A;  1X01 A;  2ZPE B;  1W2B A;  1VQN A;  4BB7 A;  1TS9 A;  3S3O A;  2JTF A;  2DRM A;  4JJB A;  4XU1 A;  4X1V A;  3OS2 A;  2EYW A;  1HK9 A;  2L3S A;  4ME7 A;  2X35 A;  2CSI A;  3F70 A;  4II1 A;  1IRX A;  2O31 A;  3OMC A;  1FX7 A;  5FU6 B;  3CCU A;  4XU3 A;  4J9D A;  2EYY A;  1S72 A;  2HEQ A;  4FYY B;  1TH7 A;  2L8D A;  4HVU A;  5LJ5 e;  2RPN A;  2ZZD A;  1ZX6 A;  3CC7 Q;  5IHK A;  5IXB A;  1PKS A;  4M75 E;  1ZA1 B;  3MP1 A;  3PVQ A;  2O2O A;  3KBG A;  3TSW A;  3H9N A;  4R56 A;  4OMO A;  1PM3 A;  5GAO l;  1MGQ A;  4XK8 E;  2L2P A;  4J6Y A;  4M75 D;  1IGQ A;  3EGX A;  1X6G A;  1TU0 B;  4FT2 A;  4M77 B;  1KSW A;  3EFO B;  2IPO B;  4ZGJ B;  1YI2 T;  2R5A A;  1UGV A;  3CME A;  3GF5 A;  4ESR A;  1X2Q A;  1NZ9 A;  8ATC B;  4XQ3 A;  2LJ1 A;  1GFC A;  2NUT A;  1AWO A;  2CZ6 B;  4KGX B;  2DXC A;  4RG2 A;  5CQY A;  4PJO E;  4JLI A;  1NEG A;  2JW4 A;  3JCM c;  2X9H A;  1RAB B;  3UA6 A;  2LQ8 A;  4F04 B;  1LJO A;  3FDR A;  2LT4 A;  4PJO D;  4ZNX A;  2A7Y A;  1M8M A;  2RF0 A;  2RJE A;  3VV0 A;  1R77 A;  3TQ7 P;  3SWN A;  3V8K A;  3VU3 C;  5GAO m;  3M0T A;  1JEG A;  2O9V A;  5KYN A;  3PGG A;  2EGE A;  1TUC A;  2DXB A;  1WJS A;  2VB6 A;  3FRN A;  2PUK B;  3M5A A;  4RCB A;  2D9T A;  1JXM A;  1B34 B;  1VQ9 A;  2RQW A;  1VQK T;  1ZLM A;  4WCI A;  3G6E Q;  1QCN A;  3QPH A;  3FEO A;  5LJ3 g;  2O01 E;  3C12 A;  3G1J A;  3LX7 A;  1CKB A;  4M7A F;  2RQV A;  4A4G A;  2RNA A;  1M1G A;  5GAN d;  2LZ6 B;  3CBO A;  4TVR A;  4C8Q C;  4M7D B;  3GNG A;  1Q81 R;  5I2S A;  2L3Q A;  4M78 F;  4M7D G;  2LX9 A;  3I55 T;  2DEQ A;  5GAN e;  1W2B S;  5D6Y A;  1N8R R;  1D0X A;  4RTV A;  4XTU A;  4R0K A;  2ZPH B;  5LJ3 d;  1VQM T;  3THK A;  4C5G A;  3PMI A;  3CD6 Q;  4E7J A;  4QQD A;  1VQ7 T;  2VAS A;  1YP5 A;  1UFF A;  4OB0 B;  3I5R A;  4IUQ A;  3DLL A;  3HKS A;  3MEW A;  1B7T A;  1ZBJ A;  1YHQ T;  3CMA Q;  3SEM A;  1IRE B;  1J3T A;  2ROT A;  1N9R A;  3RNJ A;  2HZY A;  2R58 A;  5IXF A;  2QA4 A;  1AD5 A;  3CCV A;  4KUI A;  2A28 A;  4J9H A;  4DA4 A;  2DTH A;  1EZZ B;  2RK1 A;  2PQW A;  2WSC E;  3CCS Q;  2DX1 A;  1M3A A;  3R6N A;  1GXI E;  1PCX A;  1AWJ A;  4LN2 A;  1A0N B;  1JJ2 P;  1PSF A;  1H64 1;  1H92 A;  5KYX A;  5KCH A;  2MIO A;  2MWO A;  3TSZ A;  3CXC A;  2G3R A;  2FG0 A;  3M0P A;  1KIK A;  4XTV A;  5GAN f;  2E5K A;  1JQQ A;  2JNG A;  3MPU B;  3I35 A;  2ZPG B;  3PIO A;  3CCR T;  3QYG B;  1QVF S;  1TUG B;  1GCQ A;  2LCS A;  4AG2 C;  2A08 A;  2DXU A;  2DET A;  3S6W A;  3BE3 A;  4C0D C;  3A8G B;  1RAA B;  1WHG A;  4HT9 A;  4JJD A;  5CR2 A;  2E70 A;  3EGU A;  2V1R A;  3M56 A;  1LVK A;  3CC4 Q;  3L1A A;  4C92 F;  2YT6 A;  3X20 B;  3V8J A;  3SD4 A;  2F5K A;  5KYW A;  1PHT A;  1XTD A;  4JS5 A;  4JDS A;  2DJZ A;  2RA2 A;  3O8V A;  3EFR A;  1VQN Q;  3M0R A;  3HRU A;  3GPL A;  4M7A E;  1VQP A;  2QYZ A;  3ZFJ A;  1BIB A;  4LDY A;  2DRK A;  2RO0 A;  3MCA B;  2CH4 A;  3SB2 A;  4LUD A;  2J6F A;  4M78 E;  1ZBX A;  3JV3 A;  2IIM A;  4BE1 A;  4M7A D;  1UGQ B;  2EGC A;  3FLG A;  1ZSG A;  3PIP A;  1K8A R;  1OPL A;  3CCU Q;  1QQJ A;  3OYH A;  1YJN T;  3V8L A;  2JOY A;  1CKA A;  3JCM J;  4X34 A;  4BI3 A;  1QKW A;  1UJY A;  2NUT B;  2SRC A;  3ULR B;  5IN1 A;  5CKB A;  1KD1 R;  1M1K U;  2DL7 A;  2F2X A;  1QP2 A;  1M1K C;  3JSC A;  2LJ3 A;  2KMT A;  4O6J A;  4C0F A;  1YNZ A;  3BFM A;  4LD9 K;  3OS1 A;  2EWN A;  3E2U A;  1K0X A;  2CZ7 B;  2IVW A;  2CP3 A;  1EFN A;  1NEB A;  3NGP A;  3P8B B;  1B07 A;  1R0B G;  3SWN B;  2L5Q A;  3CME Q;  3OW2 S;  2DAQ A;  2BE9 B;  5FU6 C;  3X25 B;  2RI5 A;  4EPC A;  2XDD A;  2MF2 A;  1VQ4 T;  3UT1 A;  2YDL A;  2VKN A;  4DOV A;  2ED1 A;  3OYL A;  2KAF A;  2A36 A;  2KT1 A;  1IHV A;  4EMG A;  4J9E A;  3N5B B;  4MZM A;  1UGR B;  4C92 G;  3M58 A;  3BDL A;  3BY7 A;  4JZ4 A;  1K73 R;  1NPR A;  3MKD A;  5GAM e;  1RAH B;  1WGS A;  2L3R A;  1WA7 A;  3CXC S;  2EJG A;  2YLB A;  1YI2 A;  2DJQ A;  2DKG A;  4LDV A;  1AT1 B;  2DZ9 A;  1ZA2 B;  2RI3 A;  4EMK A;  1GBR A;  1YJW T;  4HCZ A;  3EH2 A;  3V7R A;  2F2V A;  3OA6 A;  3DB4 A;  4A63 B;  4C92 E;  1Q7Y U;  4E2F B;  4AG1 C;  1PC0 A;  2QQS A;  4NS5 A;  1UJ0 A;  4FCY A;  1VQ9 Q;  1AZE A;  3X24 B;  3ZBD A;  3G4S Q;  1U06 A;  2EQK A;  1YJ9 T;  4OMF B;  4C92 D;  1AEY A;  1I0C A;  4B6M A;  1AHJ B;  2EAY A;  4D8K A;  3JAM E;  1FYN A;  1M4Z A;  2P4T A;  3RR6 A;  1AWX A;  2ZPB B;  2B86 A;  2OAW A;  5A0G A;  2HD0 A;  2GQV A;  2AHJ B;  2RQR A;  4MDX A;  4JZ3 A;  5IAY A;  4KH0 B;  3AT1 B;  2FZC B;  3V7C A;  2HBP A;  3JB9 F;  3M0S A;  2YUP A;  2KRO A;  3CCJ Q;  1SSF A;  3CCQ T;  3FIF A;  4RTW A;  3GNF B;  2ENM A;  2CUB A;  4OMN A;  3GOX A;  4XU2 A;  1VQK A;  1SPK A;  5KYX B;  4E47 A;  3RMS A;  1NYG A;  3QWY A;  3EHQ A;  3TCJ A;  2DBK A;  2QA4 Q;  4PLL A;  1UHF A;  4RTY A;  3I56 T;  2XMF A;  3CCV Q;  4M7D C;  1OYX A;  2CKK A;  5GMK l;  1PD0 A;  3JCM h;  3OMG A;  1YN8 A;  3OB9 A;  4MDW A;  2RHX A;  5C0M A;  3I55 A;  1I81 A;  4LE9 A;  1U3O A;  1VQM A;  2K57 A;  1VQ7 A;  1W4S A;  1KJW A;  2EYZ A;  2DM1 A;  1YIT A;  2QG9 B;  5CKD A;  1T0J A;  1X27 A;  5KYW B;  2F5T X;  1YHQ A;  1GFD A;  2RK2 A;  1XOV A; 
#chains in the Genus database with same CATH homology
 4J6Y A;  2XG8 D;  3HL8 A;  5FRN A;  3UWN A;  2RD1 A;  4M75 D;  4UC4 A;  3VKI A;  5IT9 E;  3CPW A;  1I8F A;  3GLX A;  4FT2 A;  4J5Y A;  4M77 B;  1XQH A;  3CEY A;  2DO3 A;  3E19 A;  3Q1J A;  4ZGJ B;  3CCS T;  1YI2 T;  3MP8 A;  4Y91 A;  4BD3 A;  2R5A A;  3CME A;  5L8R E;  4IUU A;  4M77 C;  2LNV A;  3A5Z B;  3GF5 A;  4ELY C;  3MEU A;  3JB9 I;  3L2U A;  1O9S A;  1ZQ1 A;  4HKE A;  3DKM A;  2D0Q B;  1NZ9 A;  3MO8 A;  2PVG B;  3M4Y A;  5HY6 A;  4F7U A;  5C6S A;  1Y96 A;  4XQ3 A;  3QDR B;  4P5N A;  2FL7 A;  4BY6 C;  3CC7 A;  1G3Y A;  2CZ6 B;  2K4Y A;  2DXC A;  3NTH A;  4M75 A;  4RG2 A;  2P0K A;  5CQY A;  4PJO E;  4JLI A;  5CCA A;  2LT1 A;  1WJQ A;  4L5G A;  2MMP A;  3QSU A;  3JCM c;  4WF2 A;  3FC3 A;  1G3W A;  3CCM T;  3MET A;  2LQ8 A;  1KD1 U;  1LJO A;  4N0A A;  4NL2 A;  3FDR A;  3KXT A;  4KT0 E;  4A54 A;  1KD1 C;  3JB9 G;  2LT4 A;  4PJO D;  1WQW A;  1Q7Y C;  1BYM A;  3E9F A;  3HSB A;  2A7Y A;  4BI4 A;  3MP6 A;  2MI6 A;  4M7A B;  3OYB A;  3FB9 A;  3M59 A;  3CCE A;  2RJE A;  1UGS B;  1FXX A;  3VV0 A;  3SWN A;  3V8K A;  3VU3 C;  1Q82 U;  3EFS A;  2XDB A;  5GAO m;  4M7A G;  4M77 F;  1Q82 C;  5LJ3 f;  5DLO A;  2EKO A;  5FU7 C;  3LLR A;  4M78 B;  4D6W A;  1QW1 A;  2KQW A;  3S3M A;  4NL3 A;  5GAN 2;  2XHC A;  5GMK i;  3LGF A;  4J6W A;  1NJI U;  4KUD K;  5EG2 A;  4PJO A;  4CRI A;  2I2L A;  3RES A;  2DXT A;  3PGG A;  4RKU E;  4M78 G;  4J6X A;  1NJI C;  2QDY B;  1P92 A;  3JCM d;  3OYJ A;  4X9C A;  1KQ1 A;  1RL2 A;  2EQU A;  3J81 E;  2DXB A;  4FM4 B;  1WJS A;  3VJP A;  2EQM A;  3QHS A;  3FRN A;  1H3Z A;  1YBY A;  2PUO B;  3CCL T;  2PUK B;  4CI0 C;  4MML A;  3M5A A;  4RCB A;  2D9T A;  1N9S A;  2ZGW A;  3G4S T;  2E41 A;  4JS4 A;  1B34 B;  4X9D A;  4A4E A;  1OZ2 A;  1VQ9 A;  1XNI A;  3OYE A;  5GAM f;  3JCM e;  2O4X B;  1BI2 A;  1VQK T;  2DZC A;  1PSE A;  5LJ5 j;  3QPH A;  5LJ3 j;  3RKY A;  1JJ2 A;  3JCM W;  1LOJ A;  5LJ5 g;  3FEO A;  3QKJ A;  5LJ3 g;  1KC8 U;  2O01 E;  3JB9 D;  1VQN T;  1VQ6 A;  3C12 A;  5I2M A;  2B8A A;  1KC8 C;  3LX7 A;  4C8Q B;  4M7A F;  4ZN1 A;  4A4G A;  1M1G A;  2DK3 A;  5GAN d;  2X4J A;  4RCC A;  3CBO A;  2LTO A;  4TVR A;  4DOW A;  4C8Q C;  2RJC A;  1Y71 A;  4BI8 B;  1QP3 A;  3GNG A;  1JBM A;  4M7D B;  1V29 B;  5I2S A;  4M78 F;  2E12 A;  1MHN A;  2K2V A;  3EAE A;  5KH6 A;  4M7D G;  2PU9 B;  2LX9 A;  3OS0 A;  1D3B A;  3I55 T;  1KQS A;  2DEQ A;  2JN0 A;  2XI9 A;  5D6Y A;  5GAN e;  5GAM j;  3J80 E;  3CCJ T;  1W2B S;  4M78 D;  4J7F A;  3CCU T;  4XTU A;  5GMK e;  5GAM g;  3JCM P;  2ZPH B;  2JVV A;  2XIC A;  1VQL T;  4F7U B;  5CAI A;  5LJ5 d;  5LJ3 d;  1VQM T;  1S72 T;  1LNX A;  4C5G A;  2PVD B;  3PMI A;  4FU6 A;  4E7J A;  4QQD A;  4Y28 E;  3G71 T;  2MAM A;  1YJN A;  1VQ7 T;  4EDU A;  3V7S A;  4OB0 B;  1QVP A;  3ME9 A;  3J7A F;  4EMK B;  4J83 A;  2D6F A;  2E6N A;  4E7K A;  4IUQ A;  3DLL A;  3HKS A;  4M75 C;  1Y07 A;  3MEW A;  3LWI A;  5CKE A;  1ZHI A;  5FRM A;  2QEX A;  2GF7 A;  5AYF A;  1YHQ T;  4FIB A;  1IRE B;  3MEV A;  4MMK A;  5GAN 3;  3LWH A;  3CC2 T;  2EJ9 A;  3OYY A;  1BI3 A;  4N0A C;  1N9R A;  3R6O A;  3LGL A;  3NFC A;  4C8Q F;  2R58 A;  2QA4 A;  5LL6 S;  2VXE A;  4C5I A;  3CCV A;  4L6V 5;  4KUI A;  4B9X A;  4HT8 A;  2DD4 A;  2GFU A;  4M7D F;  2QXF A;  4OGE A;  3M9Q A;  5GAN 5;  2EJF A;  3H6Z A;  1WNL A;  4LDX A;  4DA4 A;  3RIR A;  2QQA A;  3HFN A;  3CME T;  3JCM f;  3SWN C;  2DTH A;  2RK1 A;  3DLM A;  2YLC A;  4JRQ A;  4XU0 A;  3WVE B;  2PQW A;  3HHT B;  2WSC E;  3CD6 A;  2LRQ A;  2K5F A;  2BIV A;  3P8H A;  4GLK A;  3H8Z A;  3OSS C;  1OI1 A;  4ZTJ A;  1GXI E;  4JJN K;  4ZTF A;  4M77 G;  3C95 A;  3MEA A;  1I5L A;  3CC7 T;  4BY6 B;  2HQX A;  4F7U F;  4PJO C;  1VQ4 A;  4OF1 A;  3CPW S;  4C92 B;  1PSF A;  4BE0 A;  2RI2 A;  1VQ8 T;  1H64 1;  2OTJ A;  3INZ A;  5FRO A;  3X26 B;  5KCH A;  5GAO p;  3PNW C;  5KE2 A;  2MWO A;  4C92 C;  3CXC A;  2M1H A;  1VQ5 A;  2KY9 A;  1OZ3 A;  2MWP A;  2G3R A;  1QVF A;  2E64 A;  4XTV A;  5GAN f;  4OVA A;  1VQO A;  4Q5W A;  3PFS A;  3RKX A;  2V8J A;  2K5L A;  3LYI A;  2JNG A;  4QVD A;  3JCM g;  2X4Y A;  3PIO A;  3OYD A;  2ZPG B;  3CCR T;  3CCE T;  1Q81 U;  4HCC A;  2JTM A;  2LC4 A;  3NTK A;  3JCM V;  3QYG B;  2WSE E;  3C94 A;  2DTI A;  1Q81 C;  1QVF S;  4Z02 A;  3CCS A;  2X4W A;  3A8O B;  3ASK A;  3OY9 A;  4M77 E;  2OAU A;  4HCB A;  5FU7 B;  4J8O A;  2DXU A;  2E6Z A;  2GCX A;  3OQ5 A;  3S6W A;  1M5Q 1;  4C0D C;  3A8G B;  5LJ5 f;  1FWZ A;  4HT9 A;  5CR2 A;  2OTL A;  2E70 A;  4OB2 B;  2FHD A;  3AHU A;  4JRI A;  4C5E A;  4M77 D;  4NOY A;  3M56 A;  5GAN j;  4QVZ A;  1YJW A;  2FB7 A;  5GAM h;  3L1A A;  5DM7 R;  1BKB A;  4C92 F;  5GMK j;  3DB3 A;  5GAN g;  2E1H A;  3V8J A;  3X20 B;  1WPY A;  3A8M B;  1VIE A;  2F5K A;  3SD4 A;  3JCM b;  1VQ9 T;  1Q86 U;  3L2Z A;  4C0Z A;  3TEE A;  1WQ7 A;  4A4H A;  1Q86 C;  1XTD A;  3CBM A;  2BKD N;  2RH2 A;  4JS5 A;  4LDU A;  3WXM B;  4ELZ C;  5A0L A;  1VQ6 T;  4JDS A;  1UEB A;  2DJZ A;  3JCM X;  2RA2 A;  3O8V A;  4M77 A;  3EFR A;  3RMQ A;  1YJ9 A;  1VQ8 A;  3HRU A;  3QO3 A;  3GPL A;  3QUI A;  4M7A E;  1VQP A;  4BAC A;  2JUF A;  3ZFJ A;  3OYK A;  1BIB A;  4LDY A;  4KBM B;  5CO7 A;  1KG1 A;  3ZEH A;  4V2S A;  2RO0 A;  5J26 A;  3HRS A;  5A0D A;  2RHZ A;  3MCA B;  3QZ5 B;  3SB2 A;  4EMH A;  4M78 E;  4L59 A;  3JRZ A;  1ZBX A;  4C8Q G;  2RM4 A;  5GAN 6;  1JJ2 S;  3CC4 A;  3BDU A;  4BE1 A;  2XD0 A;  4M7A D;  2XU8 A;  1UGQ B;  3FLG A;  3OBY A;  3OSV A;  2XKO C;  2XID A;  3A8L B;  3PIP A;  3MHX A;  4MZP A;  4BDZ A;  2HAX A;  1BI0 A;  2Y4Y A;  3RER A;  2PVO B;  3M57 A;  4XTY A;  3OYH A;  1YJN T;  3V8L A;  4JLG A;  1N27 A;  2CZ0 B;  2JOY A;  2XK0 A;  4FL6 A;  4N4G A;  4PL6 A;  1Y96 B;  1RI0 A;  4X34 A;  3CCQ A;  3JCM J;  4BI3 A;  4RG8 A;  2CGH A;  2ZPI B;  3WVD B;  3G6E A;  5IN1 A;  3HP9 A;  4M75 B;  5CKB A;  5GAO q;  4ZGE B;  2QTX A;  2QEX T;  1M1K U;  4F7U G;  5KCO A;  4M7A A;  1KQS S;  2RJF A;  1QVG A;  1QP2 A;  1M1K C;  2V8K A;  1X75 C;  1G3T A;  3JSC A;  4M75 G;  2KMT A;  4O6J A;  3VUB A;  4C0F A;  3BFM A;  4JUV A;  1YIT T;  4LD9 K;  4GY5 A;  3OS1 A;  2L89 A;  2EWN A;  2QA4 T;  2CZ7 B;  2IVW A;  3JB9 H;  3HRT A;  4M78 A;  4C8Q E;  3CCV T;  1X6O A;  1M90 U;  5CQX A;  5DLQ E;  3OW2 A;  3NTI A;  4JRK A;  5GAO r;  1M90 C;  3I56 A;  4XAX B;  2DD5 A;  2ZCF B;  4RMO A;  4M7D E;  3P8B B;  2KVQ G;  3FJP A;  1M8V A;  3C4S A;  3SWN B;  2M16 A;  2V8I A;  4PNO A;  2LQK A;  1VIF A;  2L5Q A;  4C8Q D;  3GP8 A;  3M55 A;  3L2V A;  3OW2 S;  2DAQ A;  2VXF A;  5FU6 C;  3X25 B;  5GAO n;  2RI5 A;  4EPC A;  1N6A A;  3M54 A;  2XDD A;  1WJR A;  5HK0 A;  1B34 A;  2MF2 A;  3KUF A;  1VQ4 T;  3UT1 A;  4M7D D;  4PJO B;  3OS5 A;  3RKW A;  3T9N A;  4DOV A;  4F7U E;  1JRI A;  1NE8 A;  2O4X A;  3OYL A;  2KSS A;  2FVU A;  4FSX A;  2KAF A;  2OTJ T;  2VV5 A;  2CYZ B;  2F69 A;  3URG A;  2JZ2 A;  2FYK A;  4PJO G;  5J3B A;  3L2R A;  3PTA A;  3E1S A;  1IZ6 A;  4EMG A;  3TU4 K;  4M75 F;  3G7Z A;  4JRP A;  2E5Q A;  2QQB A;  2VGN A;  3SDZ A;  2VYT A;  4C8Q A;  5GAN 7;  3CMA A;  3N5B B;  1U1T A;  4YTL A;  3CC2 A;  1BI1 A;  4N4I A;  4MZM A;  1R8O B;  1UGR B;  4QVC A;  1VQO T;  3OYC A;  4C92 G;  1NPP A;  3M58 A;  4OB3 B;  3BDL A;  3BY7 A;  4ATO A;  4OP0 A;  4M7D A;  1UGP B;  2DPP B;  1YIJ A;  3ER0 A;  4FT4 A;  3VYG A;  4XTZ A;  1NPR A;  1YCY A;  5GAM e;  1KQ2 A;  2VUB A;  1WGS A;  2QQ9 A;  1BIA A;  3SFM A;  5LJ5 h;  2L3R A;  5LJ3 h;  4PLI A;  3UDC A;  5GMK m;  5J39 A;  4VUB A;  3CXC S;  3UPU A;  2EJG A;  1K8A U;  2YLB A;  5HK3 A;  1YI2 A;  3OYF A;  4R55 A;  3JB9 J;  5CK9 A;  4C0D B;  1K8A C;  2QQR A;  1U8R A;  1N8R U;  2OTL T;  2DKG A;  4LDV A;  5GAN 8;  3QII A;  2DZ9 A;  1N8R C;  1HXD A;  2HNI A;  2RI3 A;  4EMK A;  1JB0 E;  1YJW T;  4HCZ A;  1M1F A;  4ZGD B;  2WSF E;  3E9G A;  4PJO F;  1D3B B;  3V7R A;  4A4K A;  5FLX E;  4IUP A;  3M4G A;  3OA6 A;  3DB4 A;  2BUD A;  1O75 A;  5HKC A;  4C92 E;  1Q7Y U;  2K3X A;  4NS5 A;  2QQS A;  3X28 B;  4ZN3 A;  3QXE B;  3CCM A;  5D6X A;  2ZPF B;  2LVM A;  4BDY A;  2Y4X A;  3P8D A;  2DTO A;  2LDM A;  4A4F A;  4XTW A;  5I21 A;  3CCR A;  3X24 B;  3TRE A;  2WAC A;  3ZBD A;  4MZT A;  2EQK A;  1YJ9 T;  4OMF B;  1DJ7 B;  2YRV A;  4C92 D;  2CS7 A;  2CZ1 B;  2LCL A;  2LCC A;  4O5V A;  1AHJ B;  2EAY A;  5CKH A;  3JAM E;  3OYI A;  4M7A C;  1K9M U;  5KE3 A;  1VQP T;  5CVI A;  4QQG A;  2A3L A;  1M4Z A;  2P4T A;  2RHY A;  4IUV A;  2P0Q A;  2ZPB B;  3LW5 E;  1VUB A;  1K9M C;  4QW2 A;  4BUG A;  2DIQ A;  5A2Q E;  5A0G A;  2HD0 A;  4M78 C;  2GQV A;  4IUT A;  4J7I A;  4QQ6 A;  2AHJ B;  3CC4 T;  4E7I A;  3BW1 A;  2M0O A;  3OYA A;  4E7L A;  2X4X A;  3QBY A;  4IKF A;  2RB6 A;  4MDX A;  2E10 A;  1G5V A;  2HQE A;  4C92 A;  5IAY A;  2RJD A;  3L2Q A;  1UB4 A;  4XTX A;  1KHC A;  3OYM A;  4LDW A;  2NLU A;  3V7C A;  2HBP A;  1U1S A;  3JB9 F;  4E7H A;  2VGM A;  3OYG A;  3CCL A;  3HPW A;  1SSF A;  3CCQ T;  3FIF A;  3PMT A;  4PKC C;  2KDS A;  3G4S A;  4BE2 A;  2R57 A;  3G6E T;  4C5H A;  4DQ2 A;  3GNF B;  5CKF A;  2EIF A;  3L42 A;  4C0G A;  3A8H B;  3GOX A;  3QZ9 B;  2EQJ A;  2XDP A;  3CPF A;  1Y7X A;  3CBP A;  4LD6 A;  4XU2 A;  1K73 U;  2C06 A;  1VQK A;  1EIF A;  2VC8 A;  4E47 A;  1K73 C;  1X01 A;  3RMS A;  2H3J A;  2ZPE B;  1W2B A;  1VQN A;  4OB1 B;  2K3Y A;  4BB7 A;  2RHU A;  2K5I A;  3S3O A;  5M9O A;  2JTF A;  4OGC A;  2R5M A;  3TCJ A;  2M9U A;  2QI2 A;  5DY9 A;  4PLL A;  4XU1 A;  3OS2 A;  3I56 T;  2EYQ A;  1HK9 A;  4IUR A;  1G3S A;  2EFI A;  3QJ6 A;  4M7D C;  1OYX A;  2CKK A;  4ME7 A;  4KUL A;  2X35 A;  3QG1 A;  5GMK l;  3JCM h;  3OMG A;  3OB9 A;  3F70 A;  4MDW A;  1QVG S;  4II1 A;  2GFA A;  4A53 A;  2RHX A;  3OMC A;  5C0M A;  3I55 A;  3CCJ A;  1FX7 A;  1I81 A;  5FU6 B;  3CCU A;  3CD6 T;  2DVE A;  2KK4 A;  3PT9 A;  4XU3 A;  3HFO A;  1VQL A;  1I4K 1;  2P0P A;  1VQM A;  1S72 A;  3GIB A;  2IG0 A;  2K57 A;  4N4H A;  4HA8 A;  1TH7 A;  2L8D A;  3G71 A;  3M53 A;  1VQ7 A;  2RHI A;  5LJ5 e;  1W4S A;  4EMK C;  5LJ3 e;  2ZZD A;  2DIG A;  2Y90 A;  3QJY A;  5D6W A;  1YIT A;  3OYN A;  3CMA T;  5CKD A;  3VUZ A;  3QYH B;  3S3N A;  4M75 E;  3L2W A;  3VYH B;  4B9W A;  2E65 A;  1KHI A;  3MP1 A;  5CIU A;  2F5T X;  3OBW A;  1M9S A;  3KBG A;  5GAN h;  4R56 A;  3LH0 A;  5GAM d;  3RUX A;  1YHQ A;  1VQ5 T;  5GAN 4;  5GMK h;  3JCM Q;  2RK2 A;  1XOV A;  1YIJ T;  2YHT A;  5GAO l;  1MGQ A;  4XK8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...