1Y96A

Crystal structure of the gemin6/gemin7 heterodimer from the human smn complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
b'MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gem-associated protein 6
publication title The Gemin6-Gemin7 Heterodimer from the Survival of Motor Neurons Complex Has an Sm Protein-like Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 19
structure length 86
sequence length 86
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y96A00
3GIBA 3RESA 5LJ3g 5GAOp 2YHTA 3V7SA 2DZCA 5GMKm 4EMGA 4XU0A 4M7DD 2ZGWA 5GAN4 3JCMW 4C92D 5GMKj 4M7AA 2RM4A 5LJ3d 5LJ3e 4C8QE 3RIRA 5LJ3h 3SWNA 4XTXA 4M7DE 4C8QC 2YLBA 4XQ3A 4DQ2A 1U1TA 3V8JA 3QSUA 3QHSA 4C92E 4M7DC 1M8VA 5GANf 2DXUA 3HFOA 4X9DA 4M78G 4EMHA 4C8QF 2E41A 4C92C 3JCMh 3JCMd 4PJOG 1WQWA 3L1AA 4M75B 4XTUA 3FJPA 2FYKA 4F7UG 5GAMj 5CAIA 2FB7A 3JB9H 4C92F 5GMKh 3JCMf 4NOYA 5LJ5e 2HNIA 4XU2A 4M78A 1HK9A 2EJFA 2EJGA 4EMKA 5GAN5 5GAN3 3JB9I 1D3BA 4M7AG 4JRIA 4M77D 1I8FA 4RCCA 3RUXA 3SB2A 2EJ9A 2DJZA 3RKYA 2EWNA 2JN0A 3EFRA 2VC8A 4C8QB 4QVCA 3JCMQ 2RB6A 2DXTA 5GANg 3RERA 4M7DB 2Y90A 4NL3A 1JBMA 4HT8A 4M77E 4XU3A 4PJOF 3JCMP 1HXDA 3AHUA 4C92B 1YCYA 4F7UF 5GANd 5GANe 4RCBA 4M77C 5GANh 1JRIA 4A54A 3JCMg 2E64A 3BDUA 3SWNC 5GMKl 1X01A 4Y91A 3QO3A 5GAMf 1Y96B 4JLIA 3JCMb 4M77F 2RA2A 4M7AF 3JCMe 2RD1A 2DKGA 4M78D 4M75A 5GAOq 4PJOD 4A53A 2VXFA 3JB9G 3HSBA 2CGHA 4XTVA 5GMKe 5GMKi 3V8LA 1BIBA 3JB9J 1LJOA 4PJOE 3RKXA 4NL2A 3RKWA 1KQ2A 4M7AD 4J6XA 4M78C 4F7UE 1B34B 2QTXA 4M77B 4C8QA 4QVDA 4N0AC 5LJ5j 4PJOC 1U1SA 1KQ1A 1H641 2EAYA 4MMKA 5GAMg 4M7DA 2DVEA 4M78F 2E65A 5GAOm 4C92A 5GAMd 4M7AE 1I81A 4J6WA 5GAMe 5GAMh 4HT9A 3FIFA 1N9RA 2E10A 4M75G 5DY9A 3VU3C 3JCMJ 2K57A 3JB9F 4M7AC 3L2ZA 4JRKA 4XU1A 5GAN7 3EFSA 3INZA 1Y96A 1WPYA 3JCMc 5LJ3j 5GAOn 3JCMX 4XTWA 1TH7A 4J5YA 5GAOl 3FB9A 4WF2A 5I21A 4PJOB 1M5Q1 4C8QG 3JB9D 4F7UB 3PGGA 4OP0A 4M7DG 1WQ7A 1MGQA 4HA8A 1N9SA 3M4GA 2DTIA 2DZ9A 2I2LA 4J6YA 4M78E 3JCMV 3QUIA 4M75F 1B34A 4M77A 1LOJA 4PNOA 4XTZA 3HFNA 4C92G 4EMKC 4M7AB 1LNXA 2YLCA 2DTOA 3V7RA 5GAN8 3SWNB 4JUVA 4V2SA 1I5LA 5LJ3f 3V8KA 4MMLA 5GAOr 4C8QD 5GAN2 2DTHA 2VXEA 4M75D 3BY7A 5LJ5g 4M7DF 5GAN6 2E1HA 5GANj 1WNLA 3BFMA 5LJ5d 2DEQA 5LJ5h 4M75E 4EMKB 4M78B 4M77G 4PJOA 4N0AA 4XTYA 4X9CA 4F7UA 1D3BB 1BIAA 4M75C 3V7CA 1I4K1 5LJ5f 3BW1A
chains in the Genus database with same CATH superfamily
3RESA 2JTEA 4FYWB 2XK0A 3M9QA 3CPFA 3IQLA 4II1A 4M7DE 4KGVB 5IHKA 3OYBA 1SG5A 3A8GB 5A0GA 1TG0A 4EMHA 2COZA 4BE2A 3QPHA 2C0TA 2DIQA 3GF5A 1YWOA 3JCMf 4ANJA 4M77D 4C5EA 4QQGA 1QVGP 3TVTA 2RB6A 3I56T 1KG1A 2LQWA 1RAIB 1PG5B 1RL2A 1X6GA 4IUVA 1Q95G 4M77C 4DA4A 1M2VB 2FRYA 1K73C 1RI0A 1ZUYA 2FRWA 2RK2A 5HCKA 3A8OB 2HQXA 4M78D 1M2OA 2YUPA 2P0KA 1M1FA 1W2BP 1E7OA 4ZNXA 3RMQA 4RTXA 2XG8D 2DL8A 2JZ2A 4OGCA 3VRYA 4E7LA 3V8LA 1B7TA 4M78C 2X3WD 3S3NA 5GAMg 3OYAA 1B07A 2X4XA 4BE1A 1GL5A 3A1PA 1TH7A 3VS4A 2EQJA 3SFMA 2HZYA 3JAME 3EHQA 5CCAA 2Z0WA 2AIRB 4F7UB 1JU5C 5FU7C 1WXTA 1VQ9Q 1WHHA 3VUBA 2CREA 2XU8A 1NPPA 4PL6A 1VQOT 2CT3A 2QA4A 2RHXA 3QG1A 2VGNA 1VQ8Q 2Y4XA 2JMCA 1YHQT 4Y28E 1S72A 1GBRA 1D0YA 4E7JA 2VV5A 3QDFA 1WNLA 1X2QA 1IXDA 3CCLT 3CCRA 1VQNA 4PJOA 1K9MC 4C0DC 4RMOA 1ZLMA 3OMGA 1G5VA 3ER0A 1GCQC 3JCMW 2JUFA 2HEQA 3D7SB 5J39A 3URGA 1YCSB 5I11A 3C95A 1M3AA 1N8RC 4L59A 3QSUA 2LCLA 3E9GA 5CIUA 5IXFA 1VQLT 4HVVA 2DF6A 2HNIA 3CCSA 4OMQA 4KT0E 2QEXT 1ZUKA 2QQ9A 2IIMA 4A4GA 2EWNA 3VS0A 3M54A 2ZPBB 4DBHA 3AHUA 4LN2A 3MEVA 5ECAA 1KC8U 2V26A 4M75A 3C94A 3KBGA 1BIBA 2GCXA 2FL7A 2QDYB 1NJIC 2X3XD 3UF4A 4C92A 3A8HB 1BI2A 1WX6A 3TQ7P 3EH1A 1NYGA 3MCAB 1OPLA 2KXCA 2I0NA 2MPXC 4XTWA 1M1GA 4J5YA 1YJWT 2K5IA 2LJ3A 2QYZA 4J83A 3PIPA 1ARKA 1U06A 3UDCA 2ZPEB 2XDDA 2RHUA 4M78E 3JCMV 3CCUA 2I2LA 4J6YA 1M4ZA 3I56A 2BZYA 2SEMA 1K9AA 2X4YA 4BI4A 2C0OA 1WZOA 3PFSA 4V2SA 1SEMA 4ESRA 4MDXA 3V8KA 1TWBA 1GRIA 1OX9A 2XIDA 2QEXQ 1CSKA 2EGCA 5LJ5d 5LJ5h 1TUCA 3CCQT 2OAWA 2YWWA 1YITT 3HRSA 2E6NA 2RI3A 5FU6C 3VS6A 5A0LA 5LJ3g 1KD1C 1UUEA 1KQSA 1K8AC 2RM4A 1AT1B 1SRMA 1YWPA 3QYHB 5CKDA 2X51A 1M8VA 3R6OA 3CC7T 1IHVA 2EKOA 4DBFA 2D8HA 2ABLA 5GJVB 2DFUA 1UE9A 3JCMQ 4QVCA 3CCMA 1VQOA 2E3HA 2CZ0B 1JO8A 1PKTA 1BI3A 2LQNA 4AFSC 2OTLT 4R56A 1YHQA 5J26A 4OGEA 1ZHIA 3QO3A 5GAMf 4ATOA 1VQPT 1WHMA 3PMTA 4OMPA 2EPDA 2GQIA 4RKUE 3CCLA 2G3RA 2F2VA 1OPKA 1QCOA 1IREB 3WXMB 4C8QA 1KQ1A 1H641 3EAEA 1K0SA 3CCJA 2E65A 1Q81R 2E10A 3VU3C 3FLGA 3CCQQ 3NTIA 4JJCA 1PCXA 5HY6A 1YITQ 3DB3A 3OYGA 1VQLA 3UA6A 4PJOB 2DD4A 1R8OB 1M3BA 4QT7A 2A37A 1IO6A 2DZ9A 3M4GA 2WSCE 1VQ7T 1B34A 1G2BA 5CK9A 3EGXA 2HL3A 3X25B 1WDXA 4B9XA 3JSCA 2DL4A 5GAN8 2DXBA 1R0CB 4OMOA 3PVLA 3QKJA 1M90C 1RAEB 1NE8A 4C5IA 1OULA 1ZBXA 4PLIA 4ORZA 2DO3A 4JPBW 4X9CA 1BIAA 2RN8A 1UJ0A 5LJ5f 4XU0A 4EDUA 1VQPQ 4O6JA 2PZ1A 3OYHA 4A63B 3CBMA 1SSHA 2K2MA 1K4US 2EQUA 1V29B 1YJWA 1WQWA 4L6V5 2CUBA 4M75B 5AYFA 5GAMj 3OW2S 5I2SA 1W2BS 5CKHA 2KAFA 1PKSA 1VIEA 2E3IA 2EJ9A 2MMPA 3G6ET 1PWTA 4ELYC 5GANg 2CS7A 1KHIA 3JCMP 2HL5C 4C92B 4F7UF 1CKBA 3LWHA 2EQKA 4JLIA 1FMWA 2L0AA 2V1QA 3LYIA 3JCMe 1M1KC 3CCVT 1OZ2A 3A8LB 2RK1A 1GXIE 5KH6A 2XDPA 5A0DA 1ABOA 2H3JA 1ZSGA 1KFZA 3JB9J 3M53A 2EGEA 3ZBDA 4M7AD 4QKUA 2B86A 2NUZA 5FWBA 3EG0A 2OTJT 3MJXA 4M7AC 2P0QA 2EYZA 3MHXA 3P8HA 3CC7A 3L2WA 2J7IA 5D7UA 5GAOn 5I21A 1N27A 1ZBJA 1YJNT 2BKDN 1UFFA 1VQKT 1N9SA 3UATA 1FX7A 2PNIA 4EMKC 3EG2A 2DXCA 2H8HA 3F70A 2DM1A 4FYXB 2EIFA 3LW5E 2OTLA 5LJ3f 1JXMA 4BI8B 2QDLA 1M2VA 2FG0A 3S3OA 2JS0A 2CP0A 1EFNA 1I07A 4N4IA 1MNEA 5DM7R 2IPOB 2AHJB 4M7DD 1B3QA 1WJRA 4PJLA 5GAN4 1AEYA 2DILA 1BI1A 1D1AA 4RTUA 1NPRA 1YIJQ 1W70A 4M7DC 4OMLA 3DKMA 1YFNA 2E41A 2K9GA 4KH1B 1QCNA 4OMNA 3H8ZA 3MP6A 2KY9A 2J06A 4BY6C 3NPFA 1M27C 1D3BA 2KSSA 3PT9A 1TUDA 2DETA 2OTJQ 1WA7A 2DJZA 1VQ7A 4C8QB 1MNDA 1QKWA 4E7HA 3HTRA 4HT8A 1YN8A 4LD6A 3CC2T 2CZ1B 4RCBA 4QVZA 1J3TA 1IB8A 4A54A 2DA9A 3Q1JA 2KQWA 2K3YA 3CXCS 1NLPC 2O4XA 3M0UA 3TEEA 3UT1A 5HK0A 1Q86U 2Y4YA 3G4SA 1O75A 2E12A 4E7SA 5IHNA 1B34B 4OB3B 3EGXB 1O9SA 3GNGA 2XHCA 2DVEA 1Q82R 4PFOA 1I81A 3GP8A 1I5OB 1VUBA 3JB9F 2A28A 2X9HA 1X27A 4TVRA 5LJ3j 2E4HA 1EX4A 2GTJA 1YBYA 2K79A 3DB4A 3H0HA 2MWPA 2BE9B 4OP0A 4HCCA 2YUOA 2E6ZA 3G6EA 1IGQA 1PSFA 2DTIA 5KCHA 3QUIA 4M77A 4A4HA 2EKHA 4HVUA 4F04B 4DEYA 5FLXE 3NHNA 1I5LA 3OS2A 2FO0A 2DAQA 3OSVA 3CCVA 1YP5A 1QMCA 2JTFA 2GNCA 4ZGEB 4ZTJA 3CC2Q 2BUDA 3HHTB 3V7CA 5IT9E 5CVIA 1H8KA 2ZGWA 2RI2A 2WSEE 2JT4A 3NTHA 1BYMA 1RACB 4DQ2A 1VYUA 1M8MA 5GANf 2K3XA 4IKFA 4XU2A 5GAN5 1ZX6A 3CQTA 2EYXA 1YJNA 4AFUC 3EFOA 4JRIA 2RJDA 4BD3A 1VQKA 3SB2A 2JJ9A 2JTMA 2VC8A 2LQ8A 3CD6A 2KK4A 1JJ2S 3RERA 5CKFA 1QLYA 2DL7A 2V8JA 4XU3A 3GBQA 4PJOF 1QVGA 1BCMA 3JV3A 4Y92A 1VQ9T 2E70A 2NYSA 1VQMT 3O5ZA 6AT1B 3OYFA 1Q82U 1XNIA 3CCET 2X35A 1VQ8T 4JRQA 4R0KA 1QVPA 1WHLA 1W2BA 1MV3A 2QTXA 2LCSA 2ZPHB 1RABB 3CMEQ 2COWA 2LJ0A 1WYXA 5GAMe 4J6WA 3M4YA 4FW1A 4AT1B 5I2MA 2YRVA 2HBPA 3OW2P 1ZUUA 3OYMA 3OYJA 1VQ6Q 4HCBA 5FROA 3OYIA 2LC4A 3G71T 2D6FA 2JOYA 4MDWA 2P84A 3E19A 2JMAA 4X34A 4M75F 4PNOA 4MZTA 3VS7A 1V76A 3V7RA 1G3SA 1M3CA 2RJCA 4J9DA 3CC2A 1IGUA 4LDVA 1KC8R 2HQHA 3TREA 3MP1A 5GAOr 1V1CA 1VQ4T 4LXCA 4RTWA 4IUPA 1YNZA 2JVVA 1HJDA 3CMAQ 5GANj 1SRLA 1T3LA 2DEQA 1JEGA 4RTTA 1OOTA 2YT6A 1VQ5A 3SD4A 2ZZDA 1D3BB 1SPKA 2F2XA 2KMTA 2L3QA 5GAOp 2RMOA 2EGAA 1VQMQ 1F1BB 3GOXA 3M57A 3SWNA 4XTXA 4F14A 3ULRB 3CCEQ 2QQBA 2YLBA 1QVFS 1GFDA 3I55T 3V8JA 3QHSA 2NUTA 1U8RA 2DIGA 2MIOA 4F7UG 1QKXA 3AT1B 2O4XB 5LL6S 5GMKh 2LNVA 4NOYA 5LJ5e 3LH0A 4RG2A 1NZ9A 1BCOA 2FEIA 4CI0C 1BBZA 2O31A 1AVZC 4Z02A 1NM7A 2VGMA 2RO0A 2HKNA 1RLQC 3I35A 2BZXA 3REBB 3G71Q 1Z9QA 4IIMA 1WHKA 3G7ZA 3PVQA 2D9TA 2KVQG 4DOVA 1AWWA 5KYUA 3DLLA 2EQMA 1TTHB 1LJOA 4HXJA 4F7UE 3HPWA 4M77B 3QDRB 1VQ4Q 2XD0A 3P8BB 1QP2A 4ZTFA 5GAMd 5GAMh 1Y7XA 5GAN7 4LDWA 2B8AA 2CP5A 1WXBA 2QI2A 2HBWA 4HKEA 3X20B 2FPFA 1K9MR 1SHGA 3CC4Q 2C06A 3I55Q 1ZA1B 1N8RR 3P8DA 1VQ9A 2F5TX 2DNUA 1Y57A 2L3RA 2KDSA 5FU7B 3J80E 4FCYA 2RNAA 3CXCP 3TU4K 2KROA 1VQ8A 3H6ZA 3EFOB 2CH4W 5IHIA 4FYVB 1AWOA 3CPWP 2L8DA 4EMGA 1W4SA 2KXDA 4F16A 2YDLA 5LJ3e 2MOXA 2PTKA 3M0SA 2WACA 2OAUA 3ME9A 4ME7A 2XMFA 2ED0A 2RHIA 3HFOA 1PC0A 4F17A 2LTOA 1WGSA 2FB7A 3FRNA 3G71A 4PJNA 3WVEB 1ZQ1A 2NUPA 2PUOB 3E2UA 3RKYA 2HQEA 2JN0A 2M1HA 4RG8A 1YI2T 2Y90A 1R77A 3HKSA 1EZZB 2V8IA 2CP3A 3NTKA 2DJQA 4Q5WA 4AFQC 1OU8A 3HSBA 3JB9G 1FXXA 2RQRA 2HD0A 1K9MU 1UTIA 1WFWA 4PK4A 1X6BA 1TS9A 3U23A 2AZSA 3OS1A 1HSQA 2RQTA 3I55A 5DY9A 2CSQA 1Q81C 4XU1A 2CDTA 4FM4B 1N8RU 1SKUB 3M0RA 1BK2A 1WJSA 2RJFA 3FB9A 2MF2A 4KRTA 2M16A 1TUGB 3L2QA 4J9GA 3X26B 4ZGDB 2K2VA 1WQ7A 2QGGA 4GY5A 3LLRA 1K8AR 2JM8A 1TU0B 3HFNA 4D6WA 4LDXA 1JJ2P 4JZ3A 3SWNB 2AK5A 4FU6A 2BE7D 4BDYA 2NUTB 4MZPA 1X75C 3LGFA 2VXEA 1PRMC 1UHCA 3QYGB 1PSEA 1YI2Q 2PVDB 2M02A 2M0OA 2QEXA 2JM9A 1I4K1 4JJNK 1AZGB 3V7SA 2DERA 5GMKj 4M7AA 1UGSB 5LJ3d 5LJ3h 2K3BA 3LX7A 1AWJA 5KYNA 2K5LA 1X2KA 1KJWA 4XQ3A 2LDMA 2K5FA 4PJOG 3BDLA 3FJPA 2FYKA 2QQRA 5FRMA 5KYUB 2VB6A 3EG3A 4EMKA 1RAGB 1FWZA 2ZCFB 1PD1A 2VKNA 1M30A 2KBTA 2YUNA 2FPEA 5IH2A 1AHJB 5GANe 2DE0X 2KT1A 3EG9A 1ACMB 3BE3A 2HDAA 2A3LA 3VKIA 5EC7A 3M0PA 1MMGA 2DD5A 4DBRA 4RUGA 2F2WA 4DOWA 4PJOE 4J6XA 3NGPA 1WIEA 3E9FA 2CZ6B 1ZSZC 2EAYA 2VYTA 4E47A 4M7DA 1D09B 5GAOm 1KD1U 2CP2A 1M90R 1K8AU 1QVFP 4M75G 2E5QA 2VUBA 2A7YA 3PIOA 4ELZC 4CC4B 4LDYA 2EYWA 1VA7A 4E7ZA 1YIJT 2R5AA 4BUGA 3CCQA 4JDSA 1YITA 4UC4A 2DX1A 5IN1A 3REAB 4C92G 1YI2A 2EYYA 4AMCA 2DVJA 2MCNA 1SSFA 3BY7A 1Q86R 1D1BA 1UJYA 2JXBA 2KT8A 4M75E 4GLMA 2KYBA 3EH2A 2NUPB 2GF7A 1QCFA 2PUKB 3RIRA 5DLOA 3I5RA 2DLPA 3MEAA 4OB0B 3TSZA 3UWNA 4C92E 1YJ9Q 4PFPA 2W0ZA 1DJ7B 1VQPA 2A08A 3S6WA 3OBYA 3JB9H 1JQQA 3EGDA 2LP5A 4MZMA 2KI7A 2ROTA 2RF0A 5HKCA 4C0FA 1JBMA 2IVWA 5GANd 2O88A 5GANh 1XTDA 3LWIA 3M55A 3M5AA 2YRDA 5GMKl 1Q7YC 2RD1A 1FMKA 1M90U 3NFCA 2LT4A 4BB7A 4J7IA 1C6VX 4JJBA 2JNGA 3OYDA 2HKQB 4NL2A 3VYGA 1QWFA 4GBQA 2LZ6B 2ECZA 4XK8E 1KIKA 1XOVA 3ZEHA 2RQUA 8AT1B 2QG9B 1RLPC 4J9FA 1N6AA 3LH5A 1M5Q1 4C8QG 4CC7A 3KFVA 2AKKA 3OYEA 1X69A 5CQYA 2PVOB 4LDUA 3CPWS 3VS1A 2J6OA 4M7AB 1SF9A 2FPDA 5EG2A 3GPLA 3LGLA 4JUVA 2J6FA 3T9NA 4J7FA 3G1JA 1LCKA 3TSWA 4RTZA 4EMKB 4J9CA 3M56A 2YHTA 2X4JA 2QA4T 4C8QE 3EG9B 3VS3A 4EIKA 4D8KA 2DRMA 4ZGJB 3N5BB 3CMET 3MEUA 3L2UA 1OV3A 1YIJA 3OS0A 1U3OA 4M78A 1HK9A 5CKBA 4RCCA 3EFRA 1MHNA 2JW4A 4M7DB 1VQ6T 1YCYA 2K4YA 3QJYA 4KUDK 2OTJA 3PE0A 1G3TA 2E64A 5KYYA 1OQKA 2O01E 3GLXA 4FYYB 2J05A 4Y91A 1OZ3A 2ROLA 3QXEB 3OS5A 1OYXA 4BY6B 4OMMA 1N5ZA 2LVMA 2F5KA 1RAFB 4C5GA 2BTTA 5GMKe 1R0BG 4RTVA 4WCIA 3CMAT 4N0AC 2HSPA 3PMIA 1QP3A 1GCPA 4JRKA 1ZA2B 3INZA 1WPYA 1W6XA 3EG1A 4KH0B 4WF2A 4A4FA 3C12A 1UG1A 2QA4Q 1GCQA 3OW2A 2QTVA 4HVWA 4O5VA 3QWXX 1E6HA 2RQVA 1S72Q 1QWEA 1LNXA 2DTOA 3WVDB 2VVKA 1NBEB 2O9VA 1KC8C 4MMLA 3CCRQ 1VQNQ 5GAN2 2EBPA 1UDLA 2K6DA 2DL5A 4PJMA 4Z88A 1XQHA 4WTOB 2XI9A 3EGDB 3PNWC 4YTLA 1NLOC 1W1FA 1LVKA 4Z8AA 3CCUT 4L5GA 2P0PA 2L89A 2FZKB 2FHDA 3UA7A 1P92A 3RR6A 3L42A 3CCSQ 3VYHB 1RADB 2MWOA 1BU1A 4XTUA 3VUZA 2L5QA 1D1CA 4KULA 4C0ZA 4C92F 3JB9I 1I8FA 4ZN1A 2CSIA 4OB2B 1RAHB 3VS2A 2DXTA 3X28B 2QGFB 5GJWB 5IXBA 3M0QA 3OYKA 1JRIA 1K73R 2EQIA 3CC4T 1EIFA 1VYTA 2G6FX 3FC3A 4LUDA 4IURA 3RNJA 2ZPGB 2DKGA 4FT2A 2J6KA 2VXFA 1WJQA 2GBQA 3O8VA 2CGHA 4JZ4A 2L3SA 2P4TA 1A0NB 3CCMT 1U1SA 4CC2A 3I9QA 3OQ5A 3QZ9B 5I22A 3JCMJ 2RHZA 3L2RA 3CMEA 1G3WA 4AG2C 1NYFA 3CCUQ 4LE9A 4XAXB 1K76A 1NEBA 3I56Q 2E5KA 5KE2A 3JB9D 3J81E 5D6WA 1TSFA 4EPCA 1VQ6A 2KRSA 2DYBA 3CCJT 4J9BA 4DBQA 1BB9A 3H9NA 5LJ5g 2LT1A 3OMCA 5D6YA 5CO7A 4J9EA 1UHFA 1MMNA 4M78B 4M77G 4XTYA 3CXCA 2FZCB 1PD0A 2D0NA 3GIBA 3QZ5B 2LJ1A 3C4SA 3RDVA 2AZVA 3CMAA 2GFAA 1WLPB 1WHGA 2EYQA 5D6XA 3CPWA 3MPUB 4FSXA 4C0GA 2DEUA 5KYYB 1VQMA 2DBMA 2DXUA 4M78G 4C8QF 1MV0B 3R6NA 5C6SA 2ZAEA 3CCEA 4OMFB 5CAIA 3CCMQ 1JXOA 1VQOQ 1K73U 2OI3A 3M59A 3QIIA 1X6OA 2EJGA 3SHWA 4PKCC 2D8JA 3RUXA 4K11A 4C5HA 1YHQQ 2FVUA 1BI0A 2X4WA 1QQJA 2DYIA 2V1RA 4M77E 4FSSA 3VRZA 3OBWA 1FYNA 3CCLQ 3I5SA 3SWNC 2KGTA 1D0XA 2F1LA 3GNFB 1JB0E 4M7AF 2DMOA 4C0DB 4PJOD 3EGUA 3M58A 4N4HA 3L2VA 4KUIA 1Y0MA 2CT4A 2NWMA 4XTVA 3CCJQ 1WI7A 5J3BA 5A2QE 2GGRA 3RKWA 1ABQA 4J9HA 1RUWA 1NJIR 3A5ZB 4PJOC 3ZFJA 1AWXA 4PLLA 4CC3A 2QXFA 1VQLQ 2RHYA 4HT9A 4GLKA 1WXUA 3H41A 2LQKA 1VQ4A 3EFSA 2HSEB 5KYWA 3SEMA 1OX8A 4P5NA 4BE0A 1D0ZA 2KRMA 4Z89A 3PGGA 3OA6A 5L23A 4XTZA 4QQ6A 1JJ2A 1HYOA 2ED1A 1UGVA 3CC4A 4M75D 1T0JA 3MO8A 3FEOA 4M7DF 2M0YA 1KK7A 3BFMA 2DK3A 2LNHB 2CP7A 4N4GA 4OVAA 3PTAA 5FRNA 1ZSZA 4M75C 1KQSP 2RJEA 3TCJA 1IZ6A 4AG1C 5KYXA 1KD1R 5GMKm 2DZCA 1LPLA 1C0MA 2CYZB 4C92D 1YJWQ 1MMAA 1C1AA 4CRIA 5AT1B 5CQXA 2O9SA 4FT4A 2NLUA 4C92C 3L1AA 4LUEA 3KXTA 2EJFA 4E2FB 2MK5A 2QASA 2KR3A 1S1NA 3H0FA 3OYCA 8ATCB 5KE3A 2COYA 2LX7A 2OJ2A 2YXYA 4E6RA 2EVRA 2R57A 3ASKA 1NJIU 5CR2A 1SHFA 5C0MA 1I0CA 3VS5A 1AOJA 1X01A 1E6GA 3JCMb 4FL6A 1H92A 4A53A 3OYLA 3QWYA 5FU6B 9ATCB 2GQVA 4IUUA 3RKXA 3OYYA 3CC7Q 4QVDA 1QW1A 1AZEA 2A0FB 2EW3A 1UB4A 2CZ7B 2RPNA 1MMDA 3FIFA 1N9RA 5IAYA 4IUQA 1IHWA 2DL3A 1HD3A 3THKA 1Y96A 1QVFA 3FJ5A 3JCMX 2WSFE 1U5SA 2PVGB 1K1ZA 3C0CA 4DEXA 3J7AF 3G4ST 5FW9A 1YJ9T 1X43A 3M0TA 2LRQA 3DLMA 2OTLQ 1QVGS 3EHRA 7AT1B 5CKEA 2FZGB 2QQAA 1PHTA 3HRTA 3QJ6A 4IIOA 1T3SA 1Q86C 2E1HA 3JRZA 2LMJA 4OF1A 1AD5A 2LX9A 4C8QD 4HCKA 3SDZA 2M9UA 2VASA 1G83A 1RAAB 4C8QC 2RI5A 4X9DA 1KHCA 4BACA 1UGRB 2C0IA 1VQ7Q 4NS5A 1Q81U 1PNJA 2EFIA 2PQWA 2YRCA 2GTOA 4JLGA 2OX7A 5FWCA 3E1SA 4J9IA 4NL3A 1HXDA 1TOVA 2CH4A 2ZPFB 2O2OA 4JJDA 2P4RA 2V8KA 4KGZB 3JCMg 3META 4A4KA 4AFZC 2VWFA 3G4SQ 1CKAA 4M77F 1M1KR 2RA2A 5KYWB 2ESWA 5GAOq 2CP6A 4BI3A 1G8XA 3OY9A 4LNPA 4RTYA 2HMAA 4JRPA 4PJJA 2A36A 3MEWA 1UECA 5LJ5j 3CD6T 4MMKA 1IRXA 3VV0A 1MUZA 2D1XA 4M78F 3MKDA 3UPUA 2KYMA 5M9OA 1RI9A 2KE9A 2D0QB 2K57A 1Y07A 3L2ZA 2BZ8A 2AKLA 3OB9A 3JCMc 3G6EQ 2IG0A 4JS5A 1OI1A 5HK3A 1VYVA 2L3PA 2JS2A 1KSWA 1ZSZB 3A8MB 3NMZC 4HA8A 5KYXB 5GAN3 2QQSA 2H3EB 1LOJA 4FW2A 1UEBA 1M9SA 2QAZA 2RH2A 3CCVQ 4E7IA 3KUFA 1T0HA 4E7KA 1Q82C 4IUTA 2XDBA 2DTHA 5GAN6 1I1JA 2HCKA 1UGPB 2BIVA 5L8RE 4N0AA 2MI6A 2XICA 4F7UA 2DRKA 2KRNA 2SRCA 2XKOC 2MAMA 1FMVA 1VOMA 3HP9A 2GFUA 1Y71A 1G3YA 4VUBA 4ZN3A 4PFZA 3VJPA 1NEGA 5DLQE 1Q7YR 1U1TA 1OEBA 1YJNQ 3JCMd 2DBKA 1VQKQ 3JCMh 1WHJA 3RMSA 1H3HA 3CD6Q 4B9WA 2LCCA 5KCOA 1VQ5T 1YJ9A 1M1KU 1BKBA 4M7AG 3HL8A 4QW2A 2ENMA 1TXQA 2CUDA 4FIBA 3RBBB 3FDRA 3X24B 3BDUA 1GBQA 1Y96B 1S72T 2MYSA 2R58A 3OYNA 2W10A 5GMKi 3CCRT 1VQNT 4BDZA 3CBOA 1KQ2A 2YUQA 1UGQB 3QBYA 3H0IA 2AT1B 2YSQA 2QK0A 2L2PA 3A98A 1GFCA 1Z9ZA 4J8OA 4M7AE 1NG2A 3CBPA 3ZL7C 4M4ZA 2K7AA 5GAOl 4KBMB 2PU9B 2RQWA 1VIFA 3CCST 4M7DG 1MGQA 1KQSS 2YLCA 2KNBB 3CEYA 2R5MA 4HCZA 1XJWB 4KGXB 4A4EA 3HRUA 3MP8A 2HAXA 4QQDA 1PRLC 4OB1B 1VQ5Q 2DPPB 1OU9A 2KEAA 4B6MA 4LD9K 3OSSC 3S3MA 4JS4A 1PM3A 2M51A 4D8DA 2ZPIB 1Q7YU 2ATCB 2CKKA 2F69A 4R55A 1H3ZA 1K0XA 4X1VA 3BW1A
chains in the Genus database with same CATH topology
3GIBA 3RESA 4M7DD 3V7SA 1WJRA 3QZ5B 3C4SA 3CMAA 5GAN4 2XK0A 2GFAA 5GMKj 3M9QA 2EYQA 1UGSB 3CPFA 5D6XA 1BI1A 5LJ3d 3CPWA 5LJ3h 3LX7A 4II1A 4FSXA 2K5LA 4M7DE 4C0GA 1NPRA 3OYBA 3A8GB 4XQ3A 1VQMA 3DKMA 5A0GA 4M7DC 2LDMA 2DXUA 4EMHA 4M78G 2K5FA 4C8QF 2E41A 4PJOG 5C6SA 3BDLA 4BE2A 3QPHA 3FJPA 2FYKA 2DIQA 2QQRA 3GF5A 5FRMA 3CCEA 3H8ZA 4OMFB 5CAIA 3MP6A 1K73U 3JCMf 3M59A 2KY9A 3QIIA 4EMKA 1X6OA 4BY6C 2EJGA 2KSSA 1D3BA 1FWZA 3PT9A 2ZCFB 4PKCC 4M77D 3RUXA 4C5EA 4QQGA 4C5HA 2DJZA 1VQ7A 2FVUA 1BI0A 4C8QB 2X4WA 2RB6A 3I56T 1KG1A 4E7HA 1AHJB 4HT8A 4M77E 4LD6A 3CCUA 1RL2A 3OBWA 2CZ1B 4IUVA 3CC2T 5GANe 4RCBA 4M77C 4DA4A 4QVZA 4A54A 3SWNC 1K73C 3Q1JA 1RI0A 2RK2A 3GNFB 1JB0E 4M7AF 3A8OB 2HQXA 4M78D 2KQWA 2A3LA 2K3YA 3VKIA 4C0DB 3M58A 3CXCS 4PJOD 4N4HA 2O4XA 2P0KA 1M1FA 3TEEA 3UT1A 3RMQA 4KUIA 3L2VA 4XTVA 2XG8D 5HK0A 1Q86U 2JZ2A 2Y4YA 4OGCA 2DD5A 4E7LA 3V8LA 3G4SA 5J3BA 5A2QE 1O75A 4DOWA 3RKWA 4PJOE 2E12A 4J6XA 4M78C 3A5ZB 1B34B 3E9FA 4OB3B 3S3NA 3ZFJA 4PJOC 5GAMg 2CZ6B 1O9SA 2EAYA 2VYTA 3GNGA 4PLLA 4E47A 3OYAA 2XHCA 4M7DA 2DVEA 2QXFA 2RHYA 5GAOm 1KD1U 1I81A 4HT9A 4GLKA 1K8AU 3GP8A 4M75G 1VUBA 2E5QA 3JB9F 2LQKA 2X4XA 2VUBA 3EFSA 4TVRA 4BE1A 1VQ4A 2A7YA 5LJ3j 3PIOA 1TH7A 2QEXA 4ELZC 2EQJA 1YBYA 3SFMA 4LDYA 4P5NA 4BE0A 3JAME 5CCAA 1YIJT 3DB4A 2R5AA 4BUGA 2MWPA 3CCQA 4JDSA 3PGGA 4OP0A 5FU7C 4F7UB 1YITA 4HCCA 4UC4A 2E6ZA 3OA6A 3VUBA 3G6EA 5IN1A 1PSFA 2DTIA 4C92G 2XU8A 3QUIA 5KCHA 4M77A 4XTZA 1YI2A 1NPPA 4PL6A 1VQOT 4QQ6A 2QA4A 4A4HA 2RHXA 3QG1A 2VGNA 1JJ2A 5FLXE 1I5LA 1SSFA 3CC4A 2Y4XA 1YHQT 3OS2A 4Y28E 1S72A 4M75D 3MO8A 2DAQA 3BY7A 3FEOA 3OSVA 4M7DF 3CCVA 4E7JA 2VV5A 1WNLA 3BFMA 2DK3A 2JTFA 4M75E 4ZGEB 3CCLT 3CCRA 1VQNA 4N4GA 4PJOA 4OVAA 3PTAA 1K9MC 4ZTJA 4M75C 4C0DC 2BUDA 3HHTB 5FRNA 3V7CA 4RMOA 3OMGA 5IT9E 1G5VA 2RJEA 2GF7A 1IZ6A 5CVIA 3TCJA 5GMKm 2DZCA 3ER0A 2ZGWA 2RI2A 3JCMW 2CYZB 2WSEE 4C92D 2JUFA 5J39A 2PUKB 3RIRA 3URGA 5DLOA 3C95A 4CRIA 5CQXA 3NTHA 1N8RC 4L59A 3MEAA 4OB0B 3UWNA 4DQ2A 1BYMA 3QSUA 4C92E 4FT4A 2LCLA 3E9GA 5GANf 2NLUA 2K3XA 4IKFA 1DJ7B 4C92C 1VQPA 3L1AA 5CIUA 1VQLT 3S6WA 3OBYA 3JB9H 2HNIA 4XU2A 5GAN5 2EJFA 3KXTA 3CCSA 1YJNA 4MZMA 4KT0E 4JRIA 2RJDA 4BD3A 2QEXT 3SB2A 1VQKA 2QQ9A 4A4GA 2EWNA 3OYCA 3M54A 2JTMA 2VC8A 5KE3A 2LQ8A 5HKCA 3CD6A 2ZPBB 2KK4A 1JJ2S 4C0FA 3RERA 5CKFA 1JBMA 2V8JA 3AHUA 4XU3A 4PJOF 1QVGA 2IVWA 5GANd 1YHQA 2R57A 3ASKA 3MEVA 5GANh 1XTDA 3LWIA 3M55A 1VQ9T 2E70A 1NJIU 3M5AA 5CR2A 1VQMT 5C0MA 5GMKl 1X01A 3JCMb 1Q7YC 3OYFA 1Q82U 1KC8U 1XNIA 2RD1A 4M75A 3C94A 1M90U 4FL6A 3NFCA 3CCET 4A53A 2LT4A 3KBGA 4BB7A 3OYLA 5FU6B 4J7IA 2X35A 1VQ8T 4JRQA 1QVPA 2JNGA 3OYDA 1BIBA 2GQVA 1W2BA 2GCXA 2FL7A 4IUUA 3RKXA 4NL2A 3VYGA 3OYYA 2QTXA 2QDYB 4QVDA 1QW1A 2ZPHB 1NJIC 4XK8E 1XOVA 1UB4A 2CZ7B 4C92A 3A8HB 5GAMe 4J6WA 1BI2A 3FIFA 1N9RA 5IAYA 3M4YA 4IUQA 3MCAB 1Y96A 5I2MA 1QVFA 3ZEHA 3JCMX 2YRVA 2WSFE 4XTWA 1M1GA 4J5YA 2HBPA 1YJWT 2PVGB 2K5IA 1N6AA 4J83A 3OYMA 3OYJA 1M5Q1 5FROA 4C8QG 2LC4A 3PIPA 3OYIA 3G71T 2JOYA 3G4ST 4HCBA 4MDWA 3OYEA 1YJ9T 2D6FA 3UDCA 2ZPEB 2LRQA 3DLMA 3E19A 2RHUA 4M78E 2XDDA 3JCMV 5CQYA 2I2LA 4J6YA 2PVOB 1M4ZA 4LDUA 4X34A 4M75F 3CPWS 3I56A 4PNOA 1QVGS 4MZTA 4M7AB 5EG2A 2X4YA 3V7RA 1G3SA 2RJCA 4BI4A 3GPLA 5CKEA 3CC2A 3LGLA 4LDVA 4JUVA 3PFSA 4V2SA 2QQAA 4MDXA 3TREA 3MP1A 3V8KA 3T9NA 5GAOr 3HRTA 4J7FA 1VQ4T 3QJ6A 2XIDA 4IUPA 2JVVA 1Q86C 2E1HA 5GANj 3JRZA 5LJ5d 2DEQA 4OF1A 5LJ5h 2LX9A 4EMKB 1VQ5A 3SD4A 3CCQT 3M56A 2ZZDA 1D3BB 1YITT 2KMTA 4C8QD 3HRSA 2E6NA 2RI3A 5FU6C 5A0LA 5LJ3g 2YHTA 5GAOp 3SDZA 2M9UA 2X4JA 1KD1C 3GOXA 1KQSA 1K8AC 3M57A 2QA4T 2RM4A 4C8QE 3SWNA 4XTXA 3QYHB 5CKDA 2QQBA 4C8QC 2YLBA 3CD6T 1QVFS 1M8VA 3I55T 3V8JA 3R6OA 3QHSA 3CC7T 1U8RA 2RI5A 4X9DA 1KHCA 2DIGA 2EKOA 3N5BB 4ZGJB 3CMET 4BACA 3MEUA 3L2UA 1UGRB 4F7UG 4NS5A 1Q81U 2EFIA 1YIJA 2O4XB 2PQWA 5LL6S 3OS0A 5GMKh 2LNVA 4NOYA 5LJ5e 3LH0A 4M78A 1HK9A 4RG2A 1NZ9A 5CKBA 4JLGA 4RCCA 3E1SA 3EFRA 4CI0C 1MHNA 3JCMQ 4QVCA 3CCMA 1VQOA 4M7DB 2CZ0B 4NL3A 1VQ6T 1BI3A 1HXDA 1YCYA 2K4YA 4Z02A 3QJYA 4KUDK 2VGMA 2ZPFB 2RO0A 2OTJA 2OTLT 4R56A 2V8KA 1G3TA 3JCMg 3META 2E64A 5J26A 4A4KA 4OGEA 2O01E 3GLXA 1ZHIA 3QO3A 4Y91A 1OZ3A 5GAMf 4ATOA 3QXEB 4M77F 3OS5A 1OYXA 2RA2A 4BY6B 3G7ZA 1VQPT 2LVMA 3PMTA 2D9TA 2KVQG 2F5KA 4DOVA 5GAOq 4C5GA 4RKUE 3CCLA 3DLLA 2G3RA 4BI3A 5GMKe 2EQMA 3OY9A 4M7AA 1LJOA 4JRPA 4F7UE 3J7AF 3HPWA 1IREB 3MEWA 3QDRB 4M77B 3WXMB 4N0AC 4C8QA 5LJ5j 4MMKA 1KQ1A 1H641 3CMAT 3VV0A 3EAEA 2XD0A 3P8BB 1QP2A 3PMIA 3CCJA 4M78F 4ZTFA 1QP3A 2E65A 3UPUA 5GAMd 5M9OA 5GAMh 1Y7XA 2E10A 3VU3C 2D0QB 2K57A 3FLGA 1Y07A 3L2ZA 3NTIA 4JRKA 4LDWA 2B8AA 3INZA 3OB9A 5HY6A 5GAN7 1WPYA 3DB3A 3JCMc 2IG0A 3OYGA 4JS5A 1OI1A 2QI2A 1VQLA 4HKEA 3X20B 4WF2A 5HK3A 4A4FA 3C12A 4PJOB 3OW2A 2DD4A 1R8OB 4O5VA 4JJNK 3A8MB 4HA8A 5GAN3 3M4GA 2DZ9A 2C06A 2QQSA 2WSCE 1VQ7T 1B34A 1LOJA 5CK9A 1UEBA 1M9SA 1LNXA 3X25B 2DTOA 2RH2A 4B9XA 3JSCA 3WVDB 5GAN8 2DXBA 3P8DA 4E7IA 1VQ9A 3KUFA 2F5TX 4E7KA 1Q82C 3QKJA 1KC8C 4MMLA 4IUTA 1M90C 2XDBA 5GAN2 2DTHA 1NE8A 2L3RA 4C5IA 5GAN6 2KDSA 5FU7B 3J80E 1XQHA 1ZBXA 2XI9A 1UGPB 4PLIA 3PNWC 3TU4K 2BIVA 4YTLA 2DO3A 1VQ8A 5L8RE 4N0AA 2MI6A 2XICA 3H6ZA 4X9CA 1BIAA 4F7UA 2XKOC 5LJ5f 3CCUT 2MAMA 4L5GA 2P0PA 2L8DA 2L89A 4EMGA 4XU0A 1W4SA 3HP9A 4EDUA 2FHDA 2GFUA 5LJ3e 1Y71A 4O6JA 1G3YA 2WACA 4VUBA 4ZN3A 3OYHA 2OAUA 1P92A 3CBMA 3VJPA 3L42A 5DLQE 1U1TA 3ME9A 4ME7A 2EQUA 2RHIA 3HFOA 3JCMd 3VYHB 3JCMh 1V29B 1YJWA 1WQWA 2LTOA 1WGSA 2MWOA 4L6V5 4M75B 4XTUA 5AYFA 2L5QA 3VUZA 5GAMj 3OW2S 3RMSA 4KULA 4C0ZA 5I2SA 2FB7A 3FRNA 4C92F 4B9WA 2LCCA 5KCOA 3G71A 1W2BS 5CKHA 1VQ5T 1YJ9A 3JB9I 1M1KU 1BKBA 2KAFA 3WVEB 1ZQ1A 3HL8A 1I8FA 4M7AG 2PUOB 1VIEA 2EJ9A 2MMPA 3RKYA 4OB2B 2HQEA 4QW2A 2JN0A 4ZN1A 3G6ET 2M1HA 4ELYC 2DXTA 4RG8A 3X28B 5GANg 1YI2T 2Y90A 2CS7A 1KHIA 4FIBA 3JCMP 3OYKA 3HKSA 4C92B 4F7UF 2V8IA 1JRIA 3LWHA 3FDRA 3X24B 3CC4T 1EIFA 3BDUA 2EQKA 3FC3A 1Y96B 4JLIA 3NTKA 1S72T 4IURA 3LYIA 4Q5WA 3JCMe 2ZPGB 2DKGA 4FT2A 3CCVT 1M1KC 1OZ2A 2R58A 2RK1A 3A8LB 2VXFA 1WJQA 1FXXA 3OYNA 3JB9G 3O8VA 2CGHA 3HSBA 1GXIE 5KH6A 2XDPA 5A0DA 5GMKi 3CCRT 1VQNT 2H3JA 4BDZA 2P4TA 3CBOA 3JB9J 2HD0A 3M53A 1KQ2A 3ZBDA 4M7AD 1UGQB 3CCMT 3QBYA 1K9MU 1U1SA 4J8OA 3OS1A 4M7AE 2OTJT 3OQ5A 3I55A 3QZ9B 5DY9A 3JCMJ 3CBPA 4M7AC 2P0QA 3MHXA 3P8HA 3CC7A 1Q81C 4XU1A 2RHZA 3L2WA 4FM4B 3L2RA 3CMEA 1G3WA 1N8RU 5GAOn 5GAOl 4XAXB 1WJSA 2RJFA 2PU9B 3FB9A 4KBMB 2MF2A 1VIFA 5I21A 2M16A 5KE2A 1N27A 3L2QA 3JB9D 3X26B 4ZGDB 3CCST 4M7DG 2K2VA 3J81E 5D6WA 1YJNT 2BKDN 1WQ7A 1MGQA 1KQSS 1N9SA 1VQKT 4GY5A 1FX7A 3LLRA 4EMKC 4EPCA 3HFNA 4D6WA 2DXCA 4LDXA 3F70A 1VQ6A 2YLCA 3CEYA 3CCJT 2R5MA 2EIFA 3LW5E 4HCZA 3SWNB 4FU6A 4A4EA 3HRUA 2OTLA 3MP8A 2HAXA 4QQDA 5LJ3f 4BI8B 4OB1B 4BDYA 2DPPB 4MZPA 1X75C 3LGFA 2VXEA 3S3OA 5LJ5g 2LT1A 4LD9K 3QYGB 3OMCA 3OSSC 3S3MA 5D6YA 4JS4A 5CO7A 1PSEA 1Q7YU 2ZPIB 2CKKA 2F69A 2PVDB 4R55A 4M78B 4M77G 4N4IA 4XTYA 1H3ZA 3CXCA 2M0OA 5DM7R 1I4K1 2AHJB 3BW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GIB A;  3RES A;  5LJ3 g;  5GAO p;  2YHT A;  3V7S A;  2DZC A;  5GMK m;  4EMG A;  4XU0 A;  4M7D D;  2ZGW A;  5GAN 4;  3JCM W;  4C92 D;  5GMK j;  4M7A A;  2RM4 A;  5LJ3 d;  5LJ3 e;  4C8Q E;  3RIR A;  5LJ3 h;  3SWN A;  4XTX A;  4M7D E;  4C8Q C;  2YLB A;  4XQ3 A;  4DQ2 A;  1U1T A;  3V8J A;  3QSU A;  3QHS A;  4C92 E;  4M7D C;  1M8V A;  5GAN f;  2DXU A;  3HFO A;  4X9D A;  4M78 G;  4EMH A;  4C8Q F;  2E41 A;  4C92 C;  3JCM h;  3JCM d;  4PJO G;  1WQW A;  3L1A A;  4M75 B;  4XTU A;  3FJP A;  2FYK A;  4F7U G;  5GAM j;  5CAI A;  2FB7 A;  3JB9 H;  4C92 F;  5GMK h;  3JCM f;  4NOY A;  5LJ5 e;  2HNI A;  4XU2 A;  4M78 A;  1HK9 A;  2EJF A;  2EJG A;  4EMK A;  5GAN 5;  5GAN 3;  3JB9 I;  1D3B A;  4M7A G;  4JRI A;  4M77 D;  1I8F A;  4RCC A;  3RUX A;  3SB2 A;  2EJ9 A;  2DJZ A;  3RKY A;  2EWN A;  2JN0 A;  3EFR A;  2VC8 A;  4C8Q B;  4QVC A;  3JCM Q;  2RB6 A;  2DXT A;  5GAN g;  3RER A;  4M7D B;  2Y90 A;  4NL3 A;  1JBM A;  4HT8 A;  4M77 E;  4XU3 A;  4PJO F;  3JCM P;  1HXD A;  3AHU A;  4C92 B;  1YCY A;  4F7U F;  5GAN d;  5GAN e;  4RCB A;  4M77 C;  5GAN h;  1JRI A;  4A54 A;  3JCM g;  2E64 A;  3BDU A;  3SWN C;  5GMK l;  1X01 A;  4Y91 A;  3QO3 A;  5GAM f;  1Y96 B;  4JLI A;  3JCM b;  4M77 F;  2RA2 A;  4M7A F;  3JCM e;  2RD1 A;  2DKG A;  4M78 D;  4M75 A;  5GAO q;  4PJO D;  4A53 A;  2VXF A;  3JB9 G;  3HSB A;  2CGH A;  4XTV A;  5GMK e;  5GMK i;  3V8L A;  1BIB A;  3JB9 J;  1LJO A;  4PJO E;  3RKX A;  4NL2 A;  3RKW A;  1KQ2 A;  4M7A D;  4J6X A;  4M78 C;  4F7U E;  1B34 B;  2QTX A;  4M77 B;  4C8Q A;  4QVD A;  4N0A C;  5LJ5 j;  4PJO C;  1U1S A;  1KQ1 A;  1H64 1;  2EAY A;  4MMK A;  5GAM g;  4M7D A;  2DVE A;  4M78 F;  2E65 A;  5GAO m;  4C92 A;  5GAM d;  4M7A E;  1I81 A;  4J6W A;  5GAM e;  5GAM h;  4HT9 A;  3FIF A;  1N9R A;  2E10 A;  4M75 G;  5DY9 A;  3VU3 C;  3JCM J;  2K57 A;  3JB9 F;  4M7A C;  3L2Z A;  4JRK A;  4XU1 A;  5GAN 7;  3EFS A;  3INZ A;  1Y96 A;  1WPY A;  3JCM c;  5LJ3 j;  5GAO n;  3JCM X;  4XTW A;  1TH7 A;  4J5Y A;  5GAO l;  3FB9 A;  4WF2 A;  5I21 A;  4PJO B;  1M5Q 1;  4C8Q G;  3JB9 D;  4F7U B;  3PGG A;  4OP0 A;  4M7D G;  1WQ7 A;  1MGQ A;  4HA8 A;  1N9S A;  3M4G A;  2DTI A;  2DZ9 A;  2I2L A;  4J6Y A;  4M78 E;  3JCM V;  3QUI A;  4M75 F;  1B34 A;  4M77 A;  1LOJ A;  4PNO A;  4XTZ A;  3HFN A;  4C92 G;  4EMK C;  4M7A B;  1LNX A;  2YLC A;  2DTO A;  3V7R A;  5GAN 8;  3SWN B;  4JUV A;  4V2S A;  1I5L A;  5LJ3 f;  3V8K A;  4MML A;  5GAO r;  4C8Q D;  5GAN 2;  2DTH A;  2VXE A;  4M75 D;  3BY7 A;  5LJ5 g;  4M7D F;  5GAN 6;  2E1H A;  5GAN j;  1WNL A;  3BFM A;  5LJ5 d;  2DEQ A;  5LJ5 h;  4M75 E;  4EMK B;  4M78 B;  4M77 G;  4PJO A;  4N0A A;  4XTY A;  4X9C A;  4F7U A;  1D3B B;  1BIA A;  4M75 C;  3V7C A;  1I4K 1;  5LJ5 f;  3BW1 A; 
#chains in the Genus database with same CATH topology
 3RES A;  2JTE A;  4FYW B;  2XK0 A;  3M9Q A;  3CPF A;  3IQL A;  4II1 A;  4M7D E;  4KGV B;  5IHK A;  3OYB A;  1SG5 A;  3A8G B;  5A0G A;  1TG0 A;  4EMH A;  2COZ A;  4BE2 A;  3QPH A;  2C0T A;  2DIQ A;  3GF5 A;  1YWO A;  3JCM f;  4ANJ A;  4M77 D;  4C5E A;  4QQG A;  1QVG P;  3TVT A;  2RB6 A;  3I56 T;  1KG1 A;  2LQW A;  1RAI B;  1PG5 B;  1RL2 A;  1X6G A;  4IUV A;  1Q95 G;  4M77 C;  4DA4 A;  1M2V B;  2FRY A;  1K73 C;  1RI0 A;  1ZUY A;  2FRW A;  2RK2 A;  5HCK A;  3A8O B;  2HQX A;  4M78 D;  1M2O A;  2YUP A;  2P0K A;  1M1F A;  1W2B P;  1E7O A;  4ZNX A;  3RMQ A;  4RTX A;  2XG8 D;  2DL8 A;  2JZ2 A;  4OGC A;  3VRY A;  4E7L A;  3V8L A;  1B7T A;  4M78 C;  2X3W D;  3S3N A;  5GAM g;  3OYA A;  1B07 A;  2X4X A;  4BE1 A;  1GL5 A;  3A1P A;  1TH7 A;  3VS4 A;  2EQJ A;  3SFM A;  2HZY A;  3JAM E;  3EHQ A;  5CCA A;  2Z0W A;  2AIR B;  4F7U B;  1JU5 C;  5FU7 C;  1WXT A;  1VQ9 Q;  1WHH A;  3VUB A;  2CRE A;  2XU8 A;  1NPP A;  4PL6 A;  1VQO T;  2CT3 A;  2QA4 A;  2RHX A;  3QG1 A;  2VGN A;  1VQ8 Q;  2Y4X A;  2JMC A;  1YHQ T;  4Y28 E;  1S72 A;  1GBR A;  1D0Y A;  4E7J A;  2VV5 A;  3QDF A;  1WNL A;  1X2Q A;  1IXD A;  3CCL T;  3CCR A;  1VQN A;  4PJO A;  1K9M C;  4C0D C;  4RMO A;  1ZLM A;  3OMG A;  1G5V A;  3ER0 A;  1GCQ C;  3JCM W;  2JUF A;  2HEQ A;  3D7S B;  5J39 A;  3URG A;  1YCS B;  5I11 A;  3C95 A;  1M3A A;  1N8R C;  4L59 A;  3QSU A;  2LCL A;  3E9G A;  5CIU A;  5IXF A;  1VQL T;  4HVV A;  2DF6 A;  2HNI A;  3CCS A;  4OMQ A;  4KT0 E;  2QEX T;  1ZUK A;  2QQ9 A;  2IIM A;  4A4G A;  2EWN A;  3VS0 A;  3M54 A;  2ZPB B;  4DBH A;  3AHU A;  4LN2 A;  3MEV A;  5ECA A;  1KC8 U;  2V26 A;  4M75 A;  3C94 A;  3KBG A;  1BIB A;  2GCX A;  2FL7 A;  2QDY B;  1NJI C;  2X3X D;  3UF4 A;  4C92 A;  3A8H B;  1BI2 A;  1WX6 A;  3TQ7 P;  3EH1 A;  1NYG A;  3MCA B;  1OPL A;  2KXC A;  2I0N A;  2MPX C;  4XTW A;  1M1G A;  4J5Y A;  1YJW T;  2K5I A;  2LJ3 A;  2QYZ A;  4J83 A;  3PIP A;  1ARK A;  1U06 A;  3UDC A;  2ZPE B;  2XDD A;  2RHU A;  4M78 E;  3JCM V;  3CCU A;  2I2L A;  4J6Y A;  1M4Z A;  3I56 A;  2BZY A;  2SEM A;  1K9A A;  2X4Y A;  4BI4 A;  2C0O A;  1WZO A;  3PFS A;  4V2S A;  1SEM A;  4ESR A;  4MDX A;  3V8K A;  1TWB A;  1GRI A;  1OX9 A;  2XID A;  2QEX Q;  1CSK A;  2EGC A;  5LJ5 d;  5LJ5 h;  1TUC A;  3CCQ T;  2OAW A;  2YWW A;  1YIT T;  3HRS A;  2E6N A;  2RI3 A;  5FU6 C;  3VS6 A;  5A0L A;  5LJ3 g;  1KD1 C;  1UUE A;  1KQS A;  1K8A C;  2RM4 A;  1AT1 B;  1SRM A;  1YWP A;  3QYH B;  5CKD A;  2X51 A;  1M8V A;  3R6O A;  3CC7 T;  1IHV A;  2EKO A;  4DBF A;  2D8H A;  2ABL A;  5GJV B;  2DFU A;  1UE9 A;  3JCM Q;  4QVC A;  3CCM A;  1VQO A;  2E3H A;  2CZ0 B;  1JO8 A;  1PKT A;  1BI3 A;  2LQN A;  4AFS C;  2OTL T;  4R56 A;  1YHQ A;  5J26 A;  4OGE A;  1ZHI A;  3QO3 A;  5GAM f;  4ATO A;  1VQP T;  1WHM A;  3PMT A;  4OMP A;  2EPD A;  2GQI A;  4RKU E;  3CCL A;  2G3R A;  2F2V A;  1OPK A;  1QCO A;  1IRE B;  3WXM B;  4C8Q A;  1KQ1 A;  1H64 1;  3EAE A;  1K0S A;  3CCJ A;  2E65 A;  1Q81 R;  2E10 A;  3VU3 C;  3FLG A;  3CCQ Q;  3NTI A;  4JJC A;  1PCX A;  5HY6 A;  1YIT Q;  3DB3 A;  3OYG A;  1VQL A;  3UA6 A;  4PJO B;  2DD4 A;  1R8O B;  1M3B A;  4QT7 A;  2A37 A;  1IO6 A;  2DZ9 A;  3M4G A;  2WSC E;  1VQ7 T;  1B34 A;  1G2B A;  5CK9 A;  3EGX A;  2HL3 A;  3X25 B;  1WDX A;  4B9X A;  3JSC A;  2DL4 A;  5GAN 8;  2DXB A;  1R0C B;  4OMO A;  3PVL A;  3QKJ A;  1M90 C;  1RAE B;  1NE8 A;  4C5I A;  1OUL A;  1ZBX A;  4PLI A;  4ORZ A;  2DO3 A;  4JPB W;  4X9C A;  1BIA A;  2RN8 A;  1UJ0 A;  5LJ5 f;  4XU0 A;  4EDU A;  1VQP Q;  4O6J A;  2PZ1 A;  3OYH A;  4A63 B;  3CBM A;  1SSH A;  2K2M A;  1K4U S;  2EQU A;  1V29 B;  1YJW A;  1WQW A;  4L6V 5;  2CUB A;  4M75 B;  5AYF A;  5GAM j;  3OW2 S;  5I2S A;  1W2B S;  5CKH A;  2KAF A;  1PKS A;  1VIE A;  2E3I A;  2EJ9 A;  2MMP A;  3G6E T;  1PWT A;  4ELY C;  5GAN g;  2CS7 A;  1KHI A;  3JCM P;  2HL5 C;  4C92 B;  4F7U F;  1CKB A;  3LWH A;  2EQK A;  4JLI A;  1FMW A;  2L0A A;  2V1Q A;  3LYI A;  3JCM e;  1M1K C;  3CCV T;  1OZ2 A;  3A8L B;  2RK1 A;  1GXI E;  5KH6 A;  2XDP A;  5A0D A;  1ABO A;  2H3J A;  1ZSG A;  1KFZ A;  3JB9 J;  3M53 A;  2EGE A;  3ZBD A;  4M7A D;  4QKU A;  2B86 A;  2NUZ A;  5FWB A;  3EG0 A;  2OTJ T;  3MJX A;  4M7A C;  2P0Q A;  2EYZ A;  3MHX A;  3P8H A;  3CC7 A;  3L2W A;  2J7I A;  5D7U A;  5GAO n;  5I21 A;  1N27 A;  1ZBJ A;  1YJN T;  2BKD N;  1UFF A;  1VQK T;  1N9S A;  3UAT A;  1FX7 A;  2PNI A;  4EMK C;  3EG2 A;  2DXC A;  2H8H A;  3F70 A;  2DM1 A;  4FYX B;  2EIF A;  3LW5 E;  2OTL A;  5LJ3 f;  1JXM A;  4BI8 B;  2QDL A;  1M2V A;  2FG0 A;  3S3O A;  2JS0 A;  2CP0 A;  1EFN A;  1I07 A;  4N4I A;  1MNE A;  5DM7 R;  2IPO B;  2AHJ B;  4M7D D;  1B3Q A;  1WJR A;  4PJL A;  5GAN 4;  1AEY A;  2DIL A;  1BI1 A;  1D1A A;  4RTU A;  1NPR A;  1YIJ Q;  1W70 A;  4M7D C;  4OML A;  3DKM A;  1YFN A;  2E41 A;  2K9G A;  4KH1 B;  1QCN A;  4OMN A;  3H8Z A;  3MP6 A;  2KY9 A;  2J06 A;  4BY6 C;  3NPF A;  1M27 C;  1D3B A;  2KSS A;  3PT9 A;  1TUD A;  2DET A;  2OTJ Q;  1WA7 A;  2DJZ A;  1VQ7 A;  4C8Q B;  1MND A;  1QKW A;  4E7H A;  3HTR A;  4HT8 A;  1YN8 A;  4LD6 A;  3CC2 T;  2CZ1 B;  4RCB A;  4QVZ A;  1J3T A;  1IB8 A;  4A54 A;  2DA9 A;  3Q1J A;  2KQW A;  2K3Y A;  3CXC S;  1NLP C;  2O4X A;  3M0U A;  3TEE A;  3UT1 A;  5HK0 A;  1Q86 U;  2Y4Y A;  3G4S A;  1O75 A;  2E12 A;  4E7S A;  5IHN A;  1B34 B;  4OB3 B;  3EGX B;  1O9S A;  3GNG A;  2XHC A;  2DVE A;  1Q82 R;  4PFO A;  1I81 A;  3GP8 A;  1I5O B;  1VUB A;  3JB9 F;  2A28 A;  2X9H A;  1X27 A;  4TVR A;  5LJ3 j;  2E4H A;  1EX4 A;  2GTJ A;  1YBY A;  2K79 A;  3DB4 A;  3H0H A;  2MWP A;  2BE9 B;  4OP0 A;  4HCC A;  2YUO A;  2E6Z A;  3G6E A;  1IGQ A;  1PSF A;  2DTI A;  5KCH A;  3QUI A;  4M77 A;  4A4H A;  2EKH A;  4HVU A;  4F04 B;  4DEY A;  5FLX E;  3NHN A;  1I5L A;  3OS2 A;  2FO0 A;  2DAQ A;  3OSV A;  3CCV A;  1YP5 A;  1QMC A;  2JTF A;  2GNC A;  4ZGE B;  4ZTJ A;  3CC2 Q;  2BUD A;  3HHT B;  3V7C A;  5IT9 E;  5CVI A;  1H8K A;  2ZGW A;  2RI2 A;  2WSE E;  2JT4 A;  3NTH A;  1BYM A;  1RAC B;  4DQ2 A;  1VYU A;  1M8M A;  5GAN f;  2K3X A;  4IKF A;  4XU2 A;  5GAN 5;  1ZX6 A;  3CQT A;  2EYX A;  1YJN A;  4AFU C;  3EFO A;  4JRI A;  2RJD A;  4BD3 A;  1VQK A;  3SB2 A;  2JJ9 A;  2JTM A;  2VC8 A;  2LQ8 A;  3CD6 A;  2KK4 A;  1JJ2 S;  3RER A;  5CKF A;  1QLY A;  2DL7 A;  2V8J A;  4XU3 A;  3GBQ A;  4PJO F;  1QVG A;  1BCM A;  3JV3 A;  4Y92 A;  1VQ9 T;  2E70 A;  2NYS A;  1VQM T;  3O5Z A;  6AT1 B;  3OYF A;  1Q82 U;  1XNI A;  3CCE T;  2X35 A;  1VQ8 T;  4JRQ A;  4R0K A;  1QVP A;  1WHL A;  1W2B A;  1MV3 A;  2QTX A;  2LCS A;  2ZPH B;  1RAB B;  3CME Q;  2COW A;  2LJ0 A;  1WYX A;  5GAM e;  4J6W A;  3M4Y A;  4FW1 A;  4AT1 B;  5I2M A;  2YRV A;  2HBP A;  3OW2 P;  1ZUU A;  3OYM A;  3OYJ A;  1VQ6 Q;  4HCB A;  5FRO A;  3OYI A;  2LC4 A;  3G71 T;  2D6F A;  2JOY A;  4MDW A;  2P84 A;  3E19 A;  2JMA A;  4X34 A;  4M75 F;  4PNO A;  4MZT A;  3VS7 A;  1V76 A;  3V7R A;  1G3S A;  1M3C A;  2RJC A;  4J9D A;  3CC2 A;  1IGU A;  4LDV A;  1KC8 R;  2HQH A;  3TRE A;  3MP1 A;  5GAO r;  1V1C A;  1VQ4 T;  4LXC A;  4RTW A;  4IUP A;  1YNZ A;  2JVV A;  1HJD A;  3CMA Q;  5GAN j;  1SRL A;  1T3L A;  2DEQ A;  1JEG A;  4RTT A;  1OOT A;  2YT6 A;  1VQ5 A;  3SD4 A;  2ZZD A;  1D3B B;  1SPK A;  2F2X A;  2KMT A;  2L3Q A;  5GAO p;  2RMO A;  2EGA A;  1VQM Q;  1F1B B;  3GOX A;  3M57 A;  3SWN A;  4XTX A;  4F14 A;  3ULR B;  3CCE Q;  2QQB A;  2YLB A;  1QVF S;  1GFD A;  3I55 T;  3V8J A;  3QHS A;  2NUT A;  1U8R A;  2DIG A;  2MIO A;  4F7U G;  1QKX A;  3AT1 B;  2O4X B;  5LL6 S;  5GMK h;  2LNV A;  4NOY A;  5LJ5 e;  3LH0 A;  4RG2 A;  1NZ9 A;  1BCO A;  2FEI A;  4CI0 C;  1BBZ A;  2O31 A;  1AVZ C;  4Z02 A;  1NM7 A;  2VGM A;  2RO0 A;  2HKN A;  1RLQ C;  3I35 A;  2BZX A;  3REB B;  3G71 Q;  1Z9Q A;  4IIM A;  1WHK A;  3G7Z A;  3PVQ A;  2D9T A;  2KVQ G;  4DOV A;  1AWW A;  5KYU A;  3DLL A;  2EQM A;  1TTH B;  1LJO A;  4HXJ A;  4F7U E;  3HPW A;  4M77 B;  3QDR B;  1VQ4 Q;  2XD0 A;  3P8B B;  1QP2 A;  4ZTF A;  5GAM d;  5GAM h;  1Y7X A;  5GAN 7;  4LDW A;  2B8A A;  2CP5 A;  1WXB A;  2QI2 A;  2HBW A;  4HKE A;  3X20 B;  2FPF A;  1K9M R;  1SHG A;  3CC4 Q;  2C06 A;  3I55 Q;  1ZA1 B;  1N8R R;  3P8D A;  1VQ9 A;  2F5T X;  2DNU A;  1Y57 A;  2L3R A;  2KDS A;  5FU7 B;  3J80 E;  4FCY A;  2RNA A;  3CXC P;  3TU4 K;  2KRO A;  1VQ8 A;  3H6Z A;  3EFO B;  2CH4 W;  5IHI A;  4FYV B;  1AWO A;  3CPW P;  2L8D A;  4EMG A;  1W4S A;  2KXD A;  4F16 A;  2YDL A;  5LJ3 e;  2MOX A;  2PTK A;  3M0S A;  2WAC A;  2OAU A;  3ME9 A;  4ME7 A;  2XMF A;  2ED0 A;  2RHI A;  3HFO A;  1PC0 A;  4F17 A;  2LTO A;  1WGS A;  2FB7 A;  3FRN A;  3G71 A;  4PJN A;  3WVE B;  1ZQ1 A;  2NUP A;  2PUO B;  3E2U A;  3RKY A;  2HQE A;  2JN0 A;  2M1H A;  4RG8 A;  1YI2 T;  2Y90 A;  1R77 A;  3HKS A;  1EZZ B;  2V8I A;  2CP3 A;  3NTK A;  2DJQ A;  4Q5W A;  4AFQ C;  1OU8 A;  3HSB A;  3JB9 G;  1FXX A;  2RQR A;  2HD0 A;  1K9M U;  1UTI A;  1WFW A;  4PK4 A;  1X6B A;  1TS9 A;  3U23 A;  2AZS A;  3OS1 A;  1HSQ A;  2RQT A;  3I55 A;  5DY9 A;  2CSQ A;  1Q81 C;  4XU1 A;  2CDT A;  4FM4 B;  1N8R U;  1SKU B;  3M0R A;  1BK2 A;  1WJS A;  2RJF A;  3FB9 A;  2MF2 A;  4KRT A;  2M16 A;  1TUG B;  3L2Q A;  4J9G A;  3X26 B;  4ZGD B;  2K2V A;  1WQ7 A;  2QGG A;  4GY5 A;  3LLR A;  1K8A R;  2JM8 A;  1TU0 B;  3HFN A;  4D6W A;  4LDX A;  1JJ2 P;  4JZ3 A;  3SWN B;  2AK5 A;  4FU6 A;  2BE7 D;  4BDY A;  2NUT B;  4MZP A;  1X75 C;  3LGF A;  2VXE A;  1PRM C;  1UHC A;  3QYG B;  1PSE A;  1YI2 Q;  2PVD B;  2M02 A;  2M0O A;  2QEX A;  2JM9 A;  1I4K 1;  4JJN K;  1AZG B;  3V7S A;  2DER A;  5GMK j;  4M7A A;  1UGS B;  5LJ3 d;  5LJ3 h;  2K3B A;  3LX7 A;  1AWJ A;  5KYN A;  2K5L A;  1X2K A;  1KJW A;  4XQ3 A;  2LDM A;  2K5F A;  4PJO G;  3BDL A;  3FJP A;  2FYK A;  2QQR A;  5FRM A;  5KYU B;  2VB6 A;  3EG3 A;  4EMK A;  1RAG B;  1FWZ A;  2ZCF B;  1PD1 A;  2VKN A;  1M30 A;  2KBT A;  2YUN A;  2FPE A;  5IH2 A;  1AHJ B;  5GAN e;  2DE0 X;  2KT1 A;  3EG9 A;  1ACM B;  3BE3 A;  2HDA A;  2A3L A;  3VKI A;  5EC7 A;  3M0P A;  1MMG A;  2DD5 A;  4DBR A;  4RUG A;  2F2W A;  4DOW A;  4PJO E;  4J6X A;  3NGP A;  1WIE A;  3E9F A;  2CZ6 B;  1ZSZ C;  2EAY A;  2VYT A;  4E47 A;  4M7D A;  1D09 B;  5GAO m;  1KD1 U;  2CP2 A;  1M90 R;  1K8A U;  1QVF P;  4M75 G;  2E5Q A;  2VUB A;  2A7Y A;  3PIO A;  4ELZ C;  4CC4 B;  4LDY A;  2EYW A;  1VA7 A;  4E7Z A;  1YIJ T;  2R5A A;  4BUG A;  3CCQ A;  4JDS A;  1YIT A;  4UC4 A;  2DX1 A;  5IN1 A;  3REA B;  4C92 G;  1YI2 A;  2EYY A;  4AMC A;  2DVJ A;  2MCN A;  1SSF A;  3BY7 A;  1Q86 R;  1D1B A;  1UJY A;  2JXB A;  2KT8 A;  4M75 E;  4GLM A;  2KYB A;  3EH2 A;  2NUP B;  2GF7 A;  1QCF A;  2PUK B;  3RIR A;  5DLO A;  3I5R A;  2DLP A;  3MEA A;  4OB0 B;  3TSZ A;  3UWN A;  4C92 E;  1YJ9 Q;  4PFP A;  2W0Z A;  1DJ7 B;  1VQP A;  2A08 A;  3S6W A;  3OBY A;  3JB9 H;  1JQQ A;  3EGD A;  2LP5 A;  4MZM A;  2KI7 A;  2ROT A;  2RF0 A;  5HKC A;  4C0F A;  1JBM A;  2IVW A;  5GAN d;  2O88 A;  5GAN h;  1XTD A;  3LWI A;  3M55 A;  3M5A A;  2YRD A;  5GMK l;  1Q7Y C;  2RD1 A;  1FMK A;  1M90 U;  3NFC A;  2LT4 A;  4BB7 A;  4J7I A;  1C6V X;  4JJB A;  2JNG A;  3OYD A;  2HKQ B;  4NL2 A;  3VYG A;  1QWF A;  4GBQ A;  2LZ6 B;  2ECZ A;  4XK8 E;  1KIK A;  1XOV A;  3ZEH A;  2RQU A;  8AT1 B;  2QG9 B;  1RLP C;  4J9F A;  1N6A A;  3LH5 A;  1M5Q 1;  4C8Q G;  4CC7 A;  3KFV A;  2AKK A;  3OYE A;  1X69 A;  5CQY A;  2PVO B;  4LDU A;  3CPW S;  3VS1 A;  2J6O A;  4M7A B;  1SF9 A;  2FPD A;  5EG2 A;  3GPL A;  3LGL A;  4JUV A;  2J6F A;  3T9N A;  4J7F A;  3G1J A;  1LCK A;  3TSW A;  4RTZ A;  4EMK B;  4J9C A;  3M56 A;  2YHT A;  2X4J A;  2QA4 T;  4C8Q E;  3EG9 B;  3VS3 A;  4EIK A;  4D8K A;  2DRM A;  4ZGJ B;  3N5B B;  3CME T;  3MEU A;  3L2U A;  1OV3 A;  1YIJ A;  3OS0 A;  1U3O A;  4M78 A;  1HK9 A;  5CKB A;  4RCC A;  3EFR A;  1MHN A;  2JW4 A;  4M7D B;  1VQ6 T;  1YCY A;  2K4Y A;  3QJY A;  4KUD K;  2OTJ A;  3PE0 A;  1G3T A;  2E64 A;  5KYY A;  1OQK A;  2O01 E;  3GLX A;  4FYY B;  2J05 A;  4Y91 A;  1OZ3 A;  2ROL A;  3QXE B;  3OS5 A;  1OYX A;  4BY6 B;  4OMM A;  1N5Z A;  2LVM A;  2F5K A;  1RAF B;  4C5G A;  2BTT A;  5GMK e;  1R0B G;  4RTV A;  4WCI A;  3CMA T;  4N0A C;  2HSP A;  3PMI A;  1QP3 A;  1GCP A;  4JRK A;  1ZA2 B;  3INZ A;  1WPY A;  1W6X A;  3EG1 A;  4KH0 B;  4WF2 A;  4A4F A;  3C12 A;  1UG1 A;  2QA4 Q;  1GCQ A;  3OW2 A;  2QTV A;  4HVW A;  4O5V A;  3QWX X;  1E6H A;  2RQV A;  1S72 Q;  1QWE A;  1LNX A;  2DTO A;  3WVD B;  2VVK A;  1NBE B;  2O9V A;  1KC8 C;  4MML A;  3CCR Q;  1VQN Q;  5GAN 2;  2EBP A;  1UDL A;  2K6D A;  2DL5 A;  4PJM A;  4Z88 A;  1XQH A;  4WTO B;  2XI9 A;  3EGD B;  3PNW C;  4YTL A;  1NLO C;  1W1F A;  1LVK A;  4Z8A A;  3CCU T;  4L5G A;  2P0P A;  2L89 A;  2FZK B;  2FHD A;  3UA7 A;  1P92 A;  3RR6 A;  3L42 A;  3CCS Q;  3VYH B;  1RAD B;  2MWO A;  1BU1 A;  4XTU A;  3VUZ A;  2L5Q A;  1D1C A;  4KUL A;  4C0Z A;  4C92 F;  3JB9 I;  1I8F A;  4ZN1 A;  2CSI A;  4OB2 B;  1RAH B;  3VS2 A;  2DXT A;  3X28 B;  2QGF B;  5GJW B;  5IXB A;  3M0Q A;  3OYK A;  1JRI A;  1K73 R;  2EQI A;  3CC4 T;  1EIF A;  1VYT A;  2G6F X;  3FC3 A;  4LUD A;  4IUR A;  3RNJ A;  2ZPG B;  2DKG A;  4FT2 A;  2J6K A;  2VXF A;  1WJQ A;  2GBQ A;  3O8V A;  2CGH A;  4JZ4 A;  2L3S A;  2P4T A;  1A0N B;  3CCM T;  1U1S A;  4CC2 A;  3I9Q A;  3OQ5 A;  3QZ9 B;  5I22 A;  3JCM J;  2RHZ A;  3L2R A;  3CME A;  1G3W A;  4AG2 C;  1NYF A;  3CCU Q;  4LE9 A;  4XAX B;  1K76 A;  1NEB A;  3I56 Q;  2E5K A;  5KE2 A;  3JB9 D;  3J81 E;  5D6W A;  1TSF A;  4EPC A;  1VQ6 A;  2KRS A;  2DYB A;  3CCJ T;  4J9B A;  4DBQ A;  1BB9 A;  3H9N A;  5LJ5 g;  2LT1 A;  3OMC A;  5D6Y A;  5CO7 A;  4J9E A;  1UHF A;  1MMN A;  4M78 B;  4M77 G;  4XTY A;  3CXC A;  2FZC B;  1PD0 A;  2D0N A;  3GIB A;  3QZ5 B;  2LJ1 A;  3C4S A;  3RDV A;  2AZV A;  3CMA A;  2GFA A;  1WLP B;  1WHG A;  2EYQ A;  5D6X A;  3CPW A;  3MPU B;  4FSX A;  4C0G A;  2DEU A;  5KYY B;  1VQM A;  2DBM A;  2DXU A;  4M78 G;  4C8Q F;  1MV0 B;  3R6N A;  5C6S A;  2ZAE A;  3CCE A;  4OMF B;  5CAI A;  3CCM Q;  1JXO A;  1VQO Q;  1K73 U;  2OI3 A;  3M59 A;  3QII A;  1X6O A;  2EJG A;  3SHW A;  4PKC C;  2D8J A;  3RUX A;  4K11 A;  4C5H A;  1YHQ Q;  2FVU A;  1BI0 A;  2X4W A;  1QQJ A;  2DYI A;  2V1R A;  4M77 E;  4FSS A;  3VRZ A;  3OBW A;  1FYN A;  3CCL Q;  3I5S A;  3SWN C;  2KGT A;  1D0X A;  2F1L A;  3GNF B;  1JB0 E;  4M7A F;  2DMO A;  4C0D B;  4PJO D;  3EGU A;  3M58 A;  4N4H A;  3L2V A;  4KUI A;  1Y0M A;  2CT4 A;  2NWM A;  4XTV A;  3CCJ Q;  1WI7 A;  5J3B A;  5A2Q E;  2GGR A;  3RKW A;  1ABQ A;  4J9H A;  1RUW A;  1NJI R;  3A5Z B;  4PJO C;  3ZFJ A;  1AWX A;  4PLL A;  4CC3 A;  2QXF A;  1VQL Q;  2RHY A;  4HT9 A;  4GLK A;  1WXU A;  3H41 A;  2LQK A;  1VQ4 A;  3EFS A;  2HSE B;  5KYW A;  3SEM A;  1OX8 A;  4P5N A;  4BE0 A;  1D0Z A;  2KRM A;  4Z89 A;  3PGG A;  3OA6 A;  5L23 A;  4XTZ A;  4QQ6 A;  1JJ2 A;  1HYO A;  2ED1 A;  1UGV A;  3CC4 A;  4M75 D;  1T0J A;  3MO8 A;  3FEO A;  4M7D F;  2M0Y A;  1KK7 A;  3BFM A;  2DK3 A;  2LNH B;  2CP7 A;  4N4G A;  4OVA A;  3PTA A;  5FRN A;  1ZSZ A;  4M75 C;  1KQS P;  2RJE A;  3TCJ A;  1IZ6 A;  4AG1 C;  5KYX A;  1KD1 R;  5GMK m;  2DZC A;  1LPL A;  1C0M A;  2CYZ B;  4C92 D;  1YJW Q;  1MMA A;  1C1A A;  4CRI A;  5AT1 B;  5CQX A;  2O9S A;  4FT4 A;  2NLU A;  4C92 C;  3L1A A;  4LUE A;  3KXT A;  2EJF A;  4E2F B;  2MK5 A;  2QAS A;  2KR3 A;  1S1N A;  3H0F A;  3OYC A;  8ATC B;  5KE3 A;  2COY A;  2LX7 A;  2OJ2 A;  2YXY A;  4E6R A;  2EVR A;  2R57 A;  3ASK A;  1NJI U;  5CR2 A;  1SHF A;  5C0M A;  1I0C A;  3VS5 A;  1AOJ A;  1X01 A;  1E6G A;  3JCM b;  4FL6 A;  1H92 A;  4A53 A;  3OYL A;  3QWY A;  5FU6 B;  9ATC B;  2GQV A;  4IUU A;  3RKX A;  3OYY A;  3CC7 Q;  4QVD A;  1QW1 A;  1AZE A;  2A0F B;  2EW3 A;  1UB4 A;  2CZ7 B;  2RPN A;  1MMD A;  3FIF A;  1N9R A;  5IAY A;  4IUQ A;  1IHW A;  2DL3 A;  1HD3 A;  3THK A;  1Y96 A;  1QVF A;  3FJ5 A;  3JCM X;  2WSF E;  1U5S A;  2PVG B;  1K1Z A;  3C0C A;  4DEX A;  3J7A F;  3G4S T;  5FW9 A;  1YJ9 T;  1X43 A;  3M0T A;  2LRQ A;  3DLM A;  2OTL Q;  1QVG S;  3EHR A;  7AT1 B;  5CKE A;  2FZG B;  2QQA A;  1PHT A;  3HRT A;  3QJ6 A;  4IIO A;  1T3S A;  1Q86 C;  2E1H A;  3JRZ A;  2LMJ A;  4OF1 A;  1AD5 A;  2LX9 A;  4C8Q D;  4HCK A;  3SDZ A;  2M9U A;  2VAS A;  1G83 A;  1RAA B;  4C8Q C;  2RI5 A;  4X9D A;  1KHC A;  4BAC A;  1UGR B;  2C0I A;  1VQ7 Q;  4NS5 A;  1Q81 U;  1PNJ A;  2EFI A;  2PQW A;  2YRC A;  2GTO A;  4JLG A;  2OX7 A;  5FWC A;  3E1S A;  4J9I A;  4NL3 A;  1HXD A;  1TOV A;  2CH4 A;  2ZPF B;  2O2O A;  4JJD A;  2P4R A;  2V8K A;  4KGZ B;  3JCM g;  3MET A;  4A4K A;  4AFZ C;  2VWF A;  3G4S Q;  1CKA A;  4M77 F;  1M1K R;  2RA2 A;  5KYW B;  2ESW A;  5GAO q;  2CP6 A;  4BI3 A;  1G8X A;  3OY9 A;  4LNP A;  4RTY A;  2HMA A;  4JRP A;  4PJJ A;  2A36 A;  3MEW A;  1UEC A;  5LJ5 j;  3CD6 T;  4MMK A;  1IRX A;  3VV0 A;  1MUZ A;  2D1X A;  4M78 F;  3MKD A;  3UPU A;  2KYM A;  5M9O A;  1RI9 A;  2KE9 A;  2D0Q B;  2K57 A;  1Y07 A;  3L2Z A;  2BZ8 A;  2AKL A;  3OB9 A;  3JCM c;  3G6E Q;  2IG0 A;  4JS5 A;  1OI1 A;  5HK3 A;  1VYV A;  2L3P A;  2JS2 A;  1KSW A;  1ZSZ B;  3A8M B;  3NMZ C;  4HA8 A;  5KYX B;  5GAN 3;  2QQS A;  2H3E B;  1LOJ A;  4FW2 A;  1UEB A;  1M9S A;  2QAZ A;  2RH2 A;  3CCV Q;  4E7I A;  3KUF A;  1T0H A;  4E7K A;  1Q82 C;  4IUT A;  2XDB A;  2DTH A;  5GAN 6;  1I1J A;  2HCK A;  1UGP B;  2BIV A;  5L8R E;  4N0A A;  2MI6 A;  2XIC A;  4F7U A;  2DRK A;  2KRN A;  2SRC A;  2XKO C;  2MAM A;  1FMV A;  1VOM A;  3HP9 A;  2GFU A;  1Y71 A;  1G3Y A;  4VUB A;  4ZN3 A;  4PFZ A;  3VJP A;  1NEG A;  5DLQ E;  1Q7Y R;  1U1T A;  1OEB A;  1YJN Q;  3JCM d;  2DBK A;  1VQK Q;  3JCM h;  1WHJ A;  3RMS A;  1H3H A;  3CD6 Q;  4B9W A;  2LCC A;  5KCO A;  1VQ5 T;  1YJ9 A;  1M1K U;  1BKB A;  4M7A G;  3HL8 A;  4QW2 A;  2ENM A;  1TXQ A;  2CUD A;  4FIB A;  3RBB B;  3FDR A;  3X24 B;  3BDU A;  1GBQ A;  1Y96 B;  1S72 T;  2MYS A;  2R58 A;  3OYN A;  2W10 A;  5GMK i;  3CCR T;  1VQN T;  4BDZ A;  3CBO A;  1KQ2 A;  2YUQ A;  1UGQ B;  3QBY A;  3H0I A;  2AT1 B;  2YSQ A;  2QK0 A;  2L2P A;  3A98 A;  1GFC A;  1Z9Z A;  4J8O A;  4M7A E;  1NG2 A;  3CBP A;  3ZL7 C;  4M4Z A;  2K7A A;  5GAO l;  4KBM B;  2PU9 B;  2RQW A;  1VIF A;  3CCS T;  4M7D G;  1MGQ A;  1KQS S;  2YLC A;  2KNB B;  3CEY A;  2R5M A;  4HCZ A;  1XJW B;  4KGX B;  4A4E A;  3HRU A;  3MP8 A;  2HAX A;  4QQD A;  1PRL C;  4OB1 B;  1VQ5 Q;  2DPP B;  1OU9 A;  2KEA A;  4B6M A;  4LD9 K;  3OSS C;  3S3M A;  4JS4 A;  1PM3 A;  2M51 A;  4D8D A;  2ZPI B;  1Q7Y U;  2ATC B;  2CKK A;  2F69 A;  4R55 A;  1H3Z A;  1K0X A;  4X1V A;  3BW1 A; 
#chains in the Genus database with same CATH homology
 3GIB A;  3RES A;  4M7D D;  3V7S A;  1WJR A;  3QZ5 B;  3C4S A;  3CMA A;  5GAN 4;  2XK0 A;  2GFA A;  5GMK j;  3M9Q A;  2EYQ A;  1UGS B;  3CPF A;  5D6X A;  1BI1 A;  5LJ3 d;  3CPW A;  5LJ3 h;  3LX7 A;  4II1 A;  4FSX A;  2K5L A;  4M7D E;  4C0G A;  1NPR A;  3OYB A;  3A8G B;  4XQ3 A;  1VQM A;  3DKM A;  5A0G A;  4M7D C;  2LDM A;  2DXU A;  4EMH A;  4M78 G;  2K5F A;  4C8Q F;  2E41 A;  4PJO G;  5C6S A;  3BDL A;  4BE2 A;  3QPH A;  3FJP A;  2FYK A;  2DIQ A;  2QQR A;  3GF5 A;  5FRM A;  3CCE A;  3H8Z A;  4OMF B;  5CAI A;  3MP6 A;  1K73 U;  3JCM f;  3M59 A;  2KY9 A;  3QII A;  4EMK A;  1X6O A;  4BY6 C;  2EJG A;  2KSS A;  1D3B A;  1FWZ A;  3PT9 A;  2ZCF B;  4PKC C;  4M77 D;  3RUX A;  4C5E A;  4QQG A;  4C5H A;  2DJZ A;  1VQ7 A;  2FVU A;  1BI0 A;  4C8Q B;  2X4W A;  2RB6 A;  3I56 T;  1KG1 A;  4E7H A;  1AHJ B;  4HT8 A;  4M77 E;  4LD6 A;  3CCU A;  1RL2 A;  3OBW A;  2CZ1 B;  4IUV A;  3CC2 T;  5GAN e;  4RCB A;  4M77 C;  4DA4 A;  4QVZ A;  4A54 A;  3SWN C;  1K73 C;  3Q1J A;  1RI0 A;  2RK2 A;  3GNF B;  1JB0 E;  4M7A F;  3A8O B;  2HQX A;  4M78 D;  2KQW A;  2A3L A;  2K3Y A;  3VKI A;  4C0D B;  3M58 A;  3CXC S;  4PJO D;  4N4H A;  2O4X A;  2P0K A;  1M1F A;  3TEE A;  3UT1 A;  3RMQ A;  4KUI A;  3L2V A;  4XTV A;  2XG8 D;  5HK0 A;  1Q86 U;  2JZ2 A;  2Y4Y A;  4OGC A;  2DD5 A;  4E7L A;  3V8L A;  3G4S A;  5J3B A;  5A2Q E;  1O75 A;  4DOW A;  3RKW A;  4PJO E;  2E12 A;  4J6X A;  4M78 C;  3A5Z B;  1B34 B;  3E9F A;  4OB3 B;  3S3N A;  3ZFJ A;  4PJO C;  5GAM g;  2CZ6 B;  1O9S A;  2EAY A;  2VYT A;  3GNG A;  4PLL A;  4E47 A;  3OYA A;  2XHC A;  4M7D A;  2DVE A;  2QXF A;  2RHY A;  5GAO m;  1KD1 U;  1I81 A;  4HT9 A;  4GLK A;  1K8A U;  3GP8 A;  4M75 G;  1VUB A;  2E5Q A;  3JB9 F;  2LQK A;  2X4X A;  2VUB A;  3EFS A;  4TVR A;  4BE1 A;  1VQ4 A;  2A7Y A;  5LJ3 j;  3PIO A;  1TH7 A;  2QEX A;  4ELZ C;  2EQJ A;  1YBY A;  3SFM A;  4LDY A;  4P5N A;  4BE0 A;  3JAM E;  5CCA A;  1YIJ T;  3DB4 A;  2R5A A;  4BUG A;  2MWP A;  3CCQ A;  4JDS A;  3PGG A;  4OP0 A;  5FU7 C;  4F7U B;  1YIT A;  4HCC A;  4UC4 A;  2E6Z A;  3OA6 A;  3VUB A;  3G6E A;  5IN1 A;  1PSF A;  2DTI A;  4C92 G;  2XU8 A;  3QUI A;  5KCH A;  4M77 A;  4XTZ A;  1YI2 A;  1NPP A;  4PL6 A;  1VQO T;  4QQ6 A;  2QA4 A;  4A4H A;  2RHX A;  3QG1 A;  2VGN A;  1JJ2 A;  5FLX E;  1I5L A;  1SSF A;  3CC4 A;  2Y4X A;  1YHQ T;  3OS2 A;  4Y28 E;  1S72 A;  4M75 D;  3MO8 A;  2DAQ A;  3BY7 A;  3FEO A;  3OSV A;  4M7D F;  3CCV A;  4E7J A;  2VV5 A;  1WNL A;  3BFM A;  2DK3 A;  2JTF A;  4M75 E;  4ZGE B;  3CCL T;  3CCR A;  1VQN A;  4N4G A;  4PJO A;  4OVA A;  3PTA A;  1K9M C;  4ZTJ A;  4M75 C;  4C0D C;  2BUD A;  3HHT B;  5FRN A;  3V7C A;  4RMO A;  3OMG A;  5IT9 E;  1G5V A;  2RJE A;  2GF7 A;  1IZ6 A;  5CVI A;  3TCJ A;  5GMK m;  2DZC A;  3ER0 A;  2ZGW A;  2RI2 A;  3JCM W;  2CYZ B;  2WSE E;  4C92 D;  2JUF A;  5J39 A;  2PUK B;  3RIR A;  3URG A;  5DLO A;  3C95 A;  4CRI A;  5CQX A;  3NTH A;  1N8R C;  4L59 A;  3MEA A;  4OB0 B;  3UWN A;  4DQ2 A;  1BYM A;  3QSU A;  4C92 E;  4FT4 A;  2LCL A;  3E9G A;  5GAN f;  2NLU A;  2K3X A;  4IKF A;  1DJ7 B;  4C92 C;  1VQP A;  3L1A A;  5CIU A;  1VQL T;  3S6W A;  3OBY A;  3JB9 H;  2HNI A;  4XU2 A;  5GAN 5;  2EJF A;  3KXT A;  3CCS A;  1YJN A;  4MZM A;  4KT0 E;  4JRI A;  2RJD A;  4BD3 A;  2QEX T;  3SB2 A;  1VQK A;  2QQ9 A;  4A4G A;  2EWN A;  3OYC A;  3M54 A;  2JTM A;  2VC8 A;  5KE3 A;  2LQ8 A;  5HKC A;  3CD6 A;  2ZPB B;  2KK4 A;  1JJ2 S;  4C0F A;  3RER A;  5CKF A;  1JBM A;  2V8J A;  3AHU A;  4XU3 A;  4PJO F;  1QVG A;  2IVW A;  5GAN d;  1YHQ A;  2R57 A;  3ASK A;  3MEV A;  5GAN h;  1XTD A;  3LWI A;  3M55 A;  1VQ9 T;  2E70 A;  1NJI U;  3M5A A;  5CR2 A;  1VQM T;  5C0M A;  5GMK l;  1X01 A;  3JCM b;  1Q7Y C;  3OYF A;  1Q82 U;  1KC8 U;  1XNI A;  2RD1 A;  4M75 A;  3C94 A;  1M90 U;  4FL6 A;  3NFC A;  3CCE T;  4A53 A;  2LT4 A;  3KBG A;  4BB7 A;  3OYL A;  5FU6 B;  4J7I A;  2X35 A;  1VQ8 T;  4JRQ A;  1QVP A;  2JNG A;  3OYD A;  1BIB A;  2GQV A;  1W2B A;  2GCX A;  2FL7 A;  4IUU A;  3RKX A;  4NL2 A;  3VYG A;  3OYY A;  2QTX A;  2QDY B;  4QVD A;  1QW1 A;  2ZPH B;  1NJI C;  4XK8 E;  1XOV A;  1UB4 A;  2CZ7 B;  4C92 A;  3A8H B;  5GAM e;  4J6W A;  1BI2 A;  3FIF A;  1N9R A;  5IAY A;  3M4Y A;  4IUQ A;  3MCA B;  1Y96 A;  5I2M A;  1QVF A;  3ZEH A;  3JCM X;  2YRV A;  2WSF E;  4XTW A;  1M1G A;  4J5Y A;  2HBP A;  1YJW T;  2PVG B;  2K5I A;  1N6A A;  4J83 A;  3OYM A;  3OYJ A;  1M5Q 1;  5FRO A;  4C8Q G;  2LC4 A;  3PIP A;  3OYI A;  3G71 T;  2JOY A;  3G4S T;  4HCB A;  4MDW A;  3OYE A;  1YJ9 T;  2D6F A;  3UDC A;  2ZPE B;  2LRQ A;  3DLM A;  3E19 A;  2RHU A;  4M78 E;  2XDD A;  3JCM V;  5CQY A;  2I2L A;  4J6Y A;  2PVO B;  1M4Z A;  4LDU A;  4X34 A;  4M75 F;  3CPW S;  3I56 A;  4PNO A;  1QVG S;  4MZT A;  4M7A B;  5EG2 A;  2X4Y A;  3V7R A;  1G3S A;  2RJC A;  4BI4 A;  3GPL A;  5CKE A;  3CC2 A;  3LGL A;  4LDV A;  4JUV A;  3PFS A;  4V2S A;  2QQA A;  4MDX A;  3TRE A;  3MP1 A;  3V8K A;  3T9N A;  5GAO r;  3HRT A;  4J7F A;  1VQ4 T;  3QJ6 A;  2XID A;  4IUP A;  2JVV A;  1Q86 C;  2E1H A;  5GAN j;  3JRZ A;  5LJ5 d;  2DEQ A;  4OF1 A;  5LJ5 h;  2LX9 A;  4EMK B;  1VQ5 A;  3SD4 A;  3CCQ T;  3M56 A;  2ZZD A;  1D3B B;  1YIT T;  2KMT A;  4C8Q D;  3HRS A;  2E6N A;  2RI3 A;  5FU6 C;  5A0L A;  5LJ3 g;  2YHT A;  5GAO p;  3SDZ A;  2M9U A;  2X4J A;  1KD1 C;  3GOX A;  1KQS A;  1K8A C;  3M57 A;  2QA4 T;  2RM4 A;  4C8Q E;  3SWN A;  4XTX A;  3QYH B;  5CKD A;  2QQB A;  4C8Q C;  2YLB A;  3CD6 T;  1QVF S;  1M8V A;  3I55 T;  3V8J A;  3R6O A;  3QHS A;  3CC7 T;  1U8R A;  2RI5 A;  4X9D A;  1KHC A;  2DIG A;  2EKO A;  3N5B B;  4ZGJ B;  3CME T;  4BAC A;  3MEU A;  3L2U A;  1UGR B;  4F7U G;  4NS5 A;  1Q81 U;  2EFI A;  1YIJ A;  2O4X B;  2PQW A;  5LL6 S;  3OS0 A;  5GMK h;  2LNV A;  4NOY A;  5LJ5 e;  3LH0 A;  4M78 A;  1HK9 A;  4RG2 A;  1NZ9 A;  5CKB A;  4JLG A;  4RCC A;  3E1S A;  3EFR A;  4CI0 C;  1MHN A;  3JCM Q;  4QVC A;  3CCM A;  1VQO A;  4M7D B;  2CZ0 B;  4NL3 A;  1VQ6 T;  1BI3 A;  1HXD A;  1YCY A;  2K4Y A;  4Z02 A;  3QJY A;  4KUD K;  2VGM A;  2ZPF B;  2RO0 A;  2OTJ A;  2OTL T;  4R56 A;  2V8K A;  1G3T A;  3JCM g;  3MET A;  2E64 A;  5J26 A;  4A4K A;  4OGE A;  2O01 E;  3GLX A;  1ZHI A;  3QO3 A;  4Y91 A;  1OZ3 A;  5GAM f;  4ATO A;  3QXE B;  4M77 F;  3OS5 A;  1OYX A;  2RA2 A;  4BY6 B;  3G7Z A;  1VQP T;  2LVM A;  3PMT A;  2D9T A;  2KVQ G;  2F5K A;  4DOV A;  5GAO q;  4C5G A;  4RKU E;  3CCL A;  3DLL A;  2G3R A;  4BI3 A;  5GMK e;  2EQM A;  3OY9 A;  4M7A A;  1LJO A;  4JRP A;  4F7U E;  3J7A F;  3HPW A;  1IRE B;  3MEW A;  3QDR B;  4M77 B;  3WXM B;  4N0A C;  4C8Q A;  5LJ5 j;  4MMK A;  1KQ1 A;  1H64 1;  3CMA T;  3VV0 A;  3EAE A;  2XD0 A;  3P8B B;  1QP2 A;  3PMI A;  3CCJ A;  4M78 F;  4ZTF A;  1QP3 A;  2E65 A;  3UPU A;  5GAM d;  5M9O A;  5GAM h;  1Y7X A;  2E10 A;  3VU3 C;  2D0Q B;  2K57 A;  3FLG A;  1Y07 A;  3L2Z A;  3NTI A;  4JRK A;  4LDW A;  2B8A A;  3INZ A;  3OB9 A;  5HY6 A;  5GAN 7;  1WPY A;  3DB3 A;  3JCM c;  2IG0 A;  3OYG A;  4JS5 A;  1OI1 A;  2QI2 A;  1VQL A;  4HKE A;  3X20 B;  4WF2 A;  5HK3 A;  4A4F A;  3C12 A;  4PJO B;  3OW2 A;  2DD4 A;  1R8O B;  4O5V A;  4JJN K;  3A8M B;  4HA8 A;  5GAN 3;  3M4G A;  2DZ9 A;  2C06 A;  2QQS A;  2WSC E;  1VQ7 T;  1B34 A;  1LOJ A;  5CK9 A;  1UEB A;  1M9S A;  1LNX A;  3X25 B;  2DTO A;  2RH2 A;  4B9X A;  3JSC A;  3WVD B;  5GAN 8;  2DXB A;  3P8D A;  4E7I A;  1VQ9 A;  3KUF A;  2F5T X;  4E7K A;  1Q82 C;  3QKJ A;  1KC8 C;  4MML A;  4IUT A;  1M90 C;  2XDB A;  5GAN 2;  2DTH A;  1NE8 A;  2L3R A;  4C5I A;  5GAN 6;  2KDS A;  5FU7 B;  3J80 E;  1XQH A;  1ZBX A;  2XI9 A;  1UGP B;  4PLI A;  3PNW C;  3TU4 K;  2BIV A;  4YTL A;  2DO3 A;  1VQ8 A;  5L8R E;  4N0A A;  2MI6 A;  2XIC A;  3H6Z A;  4X9C A;  1BIA A;  4F7U A;  2XKO C;  5LJ5 f;  3CCU T;  2MAM A;  4L5G A;  2P0P A;  2L8D A;  2L89 A;  4EMG A;  4XU0 A;  1W4S A;  3HP9 A;  4EDU A;  2FHD A;  2GFU A;  5LJ3 e;  1Y71 A;  4O6J A;  1G3Y A;  2WAC A;  4VUB A;  4ZN3 A;  3OYH A;  2OAU A;  1P92 A;  3CBM A;  3VJP A;  3L42 A;  5DLQ E;  1U1T A;  3ME9 A;  4ME7 A;  2EQU A;  2RHI A;  3HFO A;  3JCM d;  3VYH B;  3JCM h;  1V29 B;  1YJW A;  1WQW A;  2LTO A;  1WGS A;  2MWO A;  4L6V 5;  4M75 B;  4XTU A;  5AYF A;  2L5Q A;  3VUZ A;  5GAM j;  3OW2 S;  3RMS A;  4KUL A;  4C0Z A;  5I2S A;  2FB7 A;  3FRN A;  4C92 F;  4B9W A;  2LCC A;  5KCO A;  3G71 A;  1W2B S;  5CKH A;  1VQ5 T;  1YJ9 A;  3JB9 I;  1M1K U;  1BKB A;  2KAF A;  3WVE B;  1ZQ1 A;  3HL8 A;  1I8F A;  4M7A G;  2PUO B;  1VIE A;  2EJ9 A;  2MMP A;  3RKY A;  4OB2 B;  2HQE A;  4QW2 A;  2JN0 A;  4ZN1 A;  3G6E T;  2M1H A;  4ELY C;  2DXT A;  4RG8 A;  3X28 B;  5GAN g;  1YI2 T;  2Y90 A;  2CS7 A;  1KHI A;  4FIB A;  3JCM P;  3OYK A;  3HKS A;  4C92 B;  4F7U F;  2V8I A;  1JRI A;  3LWH A;  3FDR A;  3X24 B;  3CC4 T;  1EIF A;  3BDU A;  2EQK A;  3FC3 A;  1Y96 B;  4JLI A;  3NTK A;  1S72 T;  4IUR A;  3LYI A;  4Q5W A;  3JCM e;  2ZPG B;  2DKG A;  4FT2 A;  3CCV T;  1M1K C;  1OZ2 A;  2R58 A;  2RK1 A;  3A8L B;  2VXF A;  1WJQ A;  1FXX A;  3OYN A;  3JB9 G;  3O8V A;  2CGH A;  3HSB A;  1GXI E;  5KH6 A;  2XDP A;  5A0D A;  5GMK i;  3CCR T;  1VQN T;  2H3J A;  4BDZ A;  2P4T A;  3CBO A;  3JB9 J;  2HD0 A;  3M53 A;  1KQ2 A;  3ZBD A;  4M7A D;  1UGQ B;  3CCM T;  3QBY A;  1K9M U;  1U1S A;  4J8O A;  3OS1 A;  4M7A E;  2OTJ T;  3OQ5 A;  3I55 A;  3QZ9 B;  5DY9 A;  3JCM J;  3CBP A;  4M7A C;  2P0Q A;  3MHX A;  3P8H A;  3CC7 A;  1Q81 C;  4XU1 A;  2RHZ A;  3L2W A;  4FM4 B;  3L2R A;  3CME A;  1G3W A;  1N8R U;  5GAO n;  5GAO l;  4XAX B;  1WJS A;  2RJF A;  2PU9 B;  3FB9 A;  4KBM B;  2MF2 A;  1VIF A;  5I21 A;  2M16 A;  5KE2 A;  1N27 A;  3L2Q A;  3JB9 D;  3X26 B;  4ZGD B;  3CCS T;  4M7D G;  2K2V A;  3J81 E;  5D6W A;  1YJN T;  2BKD N;  1WQ7 A;  1MGQ A;  1KQS S;  1N9S A;  1VQK T;  4GY5 A;  1FX7 A;  3LLR A;  4EMK C;  4EPC A;  3HFN A;  4D6W A;  2DXC A;  4LDX A;  3F70 A;  1VQ6 A;  2YLC A;  3CEY A;  3CCJ T;  2R5M A;  2EIF A;  3LW5 E;  4HCZ A;  3SWN B;  4FU6 A;  4A4E A;  3HRU A;  2OTL A;  3MP8 A;  2HAX A;  4QQD A;  5LJ3 f;  4BI8 B;  4OB1 B;  4BDY A;  2DPP B;  4MZP A;  1X75 C;  3LGF A;  2VXE A;  3S3O A;  5LJ5 g;  2LT1 A;  4LD9 K;  3QYG B;  3OMC A;  3OSS C;  3S3M A;  5D6Y A;  4JS4 A;  5CO7 A;  1PSE A;  1Q7Y U;  2ZPI B;  2CKK A;  2F69 A;  2PVD B;  4R55 A;  4M78 B;  4M77 G;  4N4I A;  4XTY A;  1H3Z A;  3CXC A;  2M0O A;  5DM7 R;  1I4K 1;  2AHJ B;  3BW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...