1Y96A

Crystal structure of the gemin6/gemin7 heterodimer from the human smn complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Gemin6-Gemin7 Heterodimer from the Survival of Motor Neurons Complex Has an Sm Protein-like Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Gem-associated protein 6
total genus 19
structure length 86
sequence length 86
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y96A00
4J6YA 3JCMd 5LJ5e 2DZ9A 3BFMA 1LNXA 3INZA 1Y96B 5GANd 4JRKA 2K57A 3PGGA 4M78G 3SWNA 4QVDA 2FYKA 3JCMQ 4M77G 1KQ2A 4C8QB 2E65A 5GANj 4PJOC 4M75E 4M75A 1I5LA 4XU2A 4M78C 1B34A 2E1HA 4JUVA 3V8JA 4RCBA 1HXDA 4M77C 4F7UF 3M4GA 4X9DA 5LJ5g 5GAN7 5LJ3d 4MMKA 4PJOG 4M78D 2FB7A 4QVCA 2VXEA 5GMKh 1H641 2RM4A 4M7AD 5GAMg 4NOYA 3FIFA 4C92F 4HA8A 4XTVA 5GAOn 5GAN6 4M7DF 5LJ5j 4C92B 1LOJA 4M7AB 4J5YA 3V7RA 4HT8A 3JCMh 2DXTA 2DTOA 5LJ5d 4XTYA 5GANg 2YLCA 5GMKl 3JB9D 3RKXA 2Y90A 3JCMP 4XU0A 3FB9A 1BIBA 2EJGA 2DVEA 1B34B 2RD1A 2YLBA 4M75G 3JCMe 3EFSA 4M7DC 4EMHA 4EMKB 1YCYA 4PNOA 2E41A 1BIAA 1JBMA 4M78E 3QHSA 3L2ZA 3SB2A 4M77D 4M75C 4M77E 5GAMf 4PJOA 3HFNA 2EWNA 4DQ2A 5LJ3j 4XTZA 2RB6A 5GMKi 4M75D 4EMGA 4PJOF 5GMKe 4XQ3A 2EJ9A 1WQWA 1Y96A 5GANh 3JCMW 2YHTA 3SWNB 5LJ3h 5GAN5 4M7DG 2VXFA 4C8QE 4V2SA 5GMKj 4M75F 4XTWA 4WF2A 1M5Q1 4XU1A 2E64A 3L1AA 5GAOm 3QSUA 4F7UB 4XTXA 1D3BB 3JCMV 4C92D 1N9SA 3RIRA 1I4K1 3EFRA 4M7AF 5LJ5h 3JCMb 2QTXA 4C92E 3QUIA 5DY9A 4PJOB 2DTIA 3RKYA 4M7DE 4A54A 4M78B 4C92A 5GAN8 4M77B 4M7DA 3JCMJ 1TH7A 2DJZA 4JLIA 4RCCA 5GAN4 3JCMc 3JB9F 3V8LA 5LJ5f 4XTUA 5GMKm 5I21A 3RERA 3V7SA 5GAOq 2DZCA 4N0AA 2E10A 5GAMj 4J6WA 5GAN3 3JB9I 3JB9H 4F7UE 3RESA 2EJFA 4C92C 3BW1A 3GIBA 4M7AC 2CGHA 1U1TA 3VU3C 5GANf 4C8QG 4Y91A 4NL2A 5LJ3e 5GAOp 5CAIA 4F7UA 2EAYA 4EMKA 2DEQA 1I8FA 1HK9A 4HT9A 2DKGA 4M78F 4J6XA 3BY7A 3FJPA 4N0AC 3V8KA 2DXUA 4M77F 3JB9J 4M7DD 1M8VA 5GAN2 4C8QD 3JCMX 1U1SA 4M78A 4PJOE 4PJOD 1WNLA 1X01A 4M77A 4M7DB 3RUXA 4EMKC 4C92G 4M7AG 4XU3A 2RA2A 1MGQA 5GAMh 4X9CA 2HNIA 4C8QC 3HSBA 1JRIA 4M75B 4F7UG 2ZGWA 4OP0A 4C8QF 5GAOr 4NL3A 4JRIA 1I81A 3QO3A 4MMLA 5GAOl 5LJ3g 2DTHA 3V7CA 3JCMg 4A53A 1LJOA 1WQ7A 2VC8A 1D3BA 3JCMf 5LJ3f 5GAMd 4C8QA 2I2LA 2JN0A 3SWNC 3JB9G 3BDUA 4M7AE 1WPYA 5GAMe 3AHUA 3HFOA 4M7AA 1N9RA 1KQ1A 5GANe 3RKWA
chains in the Genus database with same CATH superfamily
4KUIA 4ZTFA 2ZPFB 2X4JA 2FYKA 2E65A 1FMVA 4M78C 2ESWA 1KQSP 2EKOA 1G3WA 3X26B 1S72A 3EFOB 1VQNQ 4FT2A 3I55Q 1X27A 1Q7YR 2V26A 3TEEA 1OOTA 2DE0X 1OZ3A 2CP2A 2DF6A 2CZ1B 2RI5A 4F04B 1M4ZA 2COWA 5FU6C 4FCYA 3M4YA 2L3SA 2F2VA 1BIAA 1K9MU 3QDFA 1AZGB 1W2BS 1NEBA 1IREB 4F14A 1K73C 3G7ZA 2FVUA 5FLXE 4V2SA 3FRNA 2CP7A 1PWTA 1WX6A 5HK3A 1YJNT 2C0TA 2BTTA 2LJ3A 1MMGA 2LZ6B 2QA4Q 2FZGB 2E3IA 1JO8A 1OYXA 2H3EB 2MCNA 5IAYA 4OGCA 2NLUA 1D0ZA 2CUBA 2DZCA 2HQHA 2E10A 3JB9H 1RACB 2RQRA 4F7UE 3EG2A 2QTVA 2QQRA 3JSCA 1RAFB 1BI1A 2AZVA 5KYWB 2P0KA 5CIUA 4M78F 2ED1A 3REAB 1N8RR 4RG8A 1U1SA 2AKKA 1F1BB 1YJWQ 1ZQ1A 4C8QC 4OMMA 4OMLA 4C8QF 3A8GB 3F70A 1BBZA 4NL3A 1Q82U 3QO3A 3UF4A 2HMAA 1OX8A 1BI0A 2IVWA 1M90U 1K8AC 4HVUA 2C0OA 3CCVT 1WXUA 2KRSA 5I2SA 3FDRA 2ABLA 4M75E 5CKDA 4LD9K 3OYGA 4CC3A 4FSXA 4ZTJA 1SG5A 4R55A 1OV3A 5D6WA 4KUDK 5CQXA 3OW2A 4RKUE 1PCXA 3TCJA 3L2QA 2O88A 5I2MA 2L3PA 2J06A 2QG9B 4BDYA 1BCMA 4RTVA 1BIBA 1D0YA 2MWOA 4UC4A 1B34B 1NYGA 2OTJA 1SSHA 2EQUA 2PNIA 3M54A 4O5VA 1T0JA 3LGLA 4KGXB 3QWYA 1QVGP 3WVEB 4KBMB 1QVFP 1KQSA 1YP5A 3JCMW 4N4GA 3ZBDA 4PJJA 2BZ8A 4WF2A 3UATA 4XTXA 1X2KA 2CS7A 1Q86U 5LJ5h 1U8RA 4DBHA 2QTXA 4RTZA 3HL8A 1G5VA 1UDLA 3RKYA 1BCOA 3GBQA 2VGMA 4C5EA 2E4HA 1VQLA 4N0AA 5GAN3 4GY5A 2K2MA 4C8QG 1G83A 5LJ3e 3OS1A 2DERA 2PZ1A 3MO8A 1Y0MA 3U23A 2J6KA 4B6MA 1W6XA 1FMKA 3G71A 5CKBA 2EQJA 2X4YA 4HVWA 1BB9A 3E9FA 4DOWA 2BZXA 4JS5A 5GAOr 1VQOA 1VQ9A 3EFOA 4OMPA 5C0MA 3TSWA 3MP1A 3CCMQ 2F2XA 2K79A 4QVDA 1YJ9Q 4AG2C 3RMSA 4M78G 1Q82R 1HD3A 4P5NA 1I5LA 3CCVA 2JTEA 5CKEA 2YSQA 4RUGA 4C0FA 3QIIA 1UGVA 2QQ9A 4DEXA 3ZEHA 3M56A 4DBQA 4C0GA 3AT1B 3CPWA 2HZYA 3CCUT 5LL6S 3CBMA 4HT8A 3JCMh 2KDSA 1ARKA 5GANg 2JVVA 1R0BG 1Q7YC 4LD6A 3REBB 2EJGA 1VQKT 3VJPA 1I07A 2WSEE 4PJOA 3VS1A 4M77E 1RABB 1W70A 1M2OA 1HSQA 2MF2A 4BD3A 5GMKe 2VASA 3TVTA 3ER0A 1UECA 2KYMA 4GLMA 2JS2A 2FEIA 1ZUYA 2BZYA 2QEXT 5L8RE 2L5QA 1QMCA 5KYYA 3OS0A 3RIRA 3SFMA 2IG0A 3EG1A 1QVPA 2PVGB 3HRUA 3VS6A 1W1FA 1JXOA 5LJ5f 2GGRA 4J9HA 4ANJA 3CCRQ 3OY9A 3RESA 2A08A 2M0OA 4Z88A 3JRZA 3QZ9B 2LMJA 1UG1A 1UJ0A 2KI7A 2PVDB 5FU6B 3JB9J 1MMAA 2X3XD 5KCHA 2O4XA 2RQTA 1OPKA 2ENMA 4IUPA 2RA2A 4ELZC 1P92A 3NTHA 3ZL7C 4PFPA 1MV0B 2ED0A 4FL6A 1LCKA 1KQSS 4YTLA 3MHXA 3OYJA 5GAOl 1N8RC 3OYDA 5CO7A 1SKUB 3JB9G 1Y07A 1NLPC 1WPYA 5GAMe 1KQ1A 4ZN1A 3MKDA 5KYUA 2Y4XA 3QJ6A 1B07A 1RAEB 2B8AA 1YBYA 5A2QE 2Z0WA 1CKAA 1YN8A 2DBKA 5KE3A 5GAMg 4HA8A 2LNHB 4XAXB 4J5YA 3CCMA 2XIDA 2KXCA 2YLCA 3H0HA 4XU0A 5IHKA 3TU4K 5J3BA 3EHQA 2PVOB 3CCLT 1ZLMA 3L2ZA 4M75C 3H9NA 2X51A 4JZ4A 3HFNA 2MOXA 3THKA 5GAN5 3PIPA 1VQ4Q 1ZSGA 1M5Q1 4PFZA 1KK7A 1X43A 5IT9E 4MZTA 3PNWC 5IH2A 4OB1B 3QUIA 2FO0A 3UWNA 4M7DE 4A4EA 1S72T 3MEVA 1K0SA 4L59A 3P8HA 1YHQT 3A98A 1X69A 1K9MR 3V7SA 3IQLA 2RI2A 3UDCA 4J6WA 3VV0A 2EJFA 3C95A 4PJNA 4KT0E 2B86A 1Y7XA 1JJ2S 4Z8AA 1WDXA 2EGCA 1VQ8T 5FU7C 2ATCB 2F1LA 4M77F 2RPNA 1AWOA 2PU9B 2RO0A 2CSQA 1OPLA 4X9CA 3VS7A 1E6HA 2ECZA 2JTFA 1EX4A 4RG2A 3V7CA 1Q82C 3HTRA 3J81E 3BDUA 3PVLA 1WHMA 2KVQG 1N9RA 2G3RA 4VUBA 4LDYA 1M3CA 1LNXA 1ZA1B 3HKSA 4JDSA 3JCMQ 4ME7A 1K73U 2E1HA 1GRIA 5HY6A 4QVCA 2QASA 4FW2A 2RHYA 1C1AA 5I22A 4FSSA 5GAOn 4GLKA 1RADB 4DBRA 2A28A 1VQPQ 4RTWA 2DXTA 2HD0A 2P0PA 1NEGA 1M8MA 3MP6A 2L0AA 2GCXA 2BUDA 3PTAA 2GNCA 4OB3B 1LVKA 3H8ZA 3OYYA 3JCMe 4RTYA 1NZ9A 1YIJT 4GBQA 4QW2A 1O75A 4OVAA 4IIOA 3HP9A 1ZSZC 4PJMA 1GCQC 2EJ9A 1IHWA 2MIOA 2ZZDA 3T9NA 3CCVQ 1D09B 3G4SA 3QSUA 1OEBA 4C92D 1N9SA 1PM3A 3CC4A 4DBFA 3J80E 4F16A 1CSKA 3M55A 2CP3A 2F69A 3MEAA 3RERA 3NFCA 2X4WA 1GL5A 4BI3A 1V76A 4E6RA 4M7AC 3C12A 3O5ZA 3OYLA 3QJYA 1KHIA 2ROTA 2DKGA 1RL2A 3VYHB 5EG2A 4PJOD 4QQDA 2NUTB 4ZGDB 1WLPB 1AWWA 1T3LA 2XKOC 5IXBA 2M0YA 2A7YA 5HKCA 4E7KA 1K73R 1OX9A 4JJNK 1GFCA 1YFNA 2CZ7B 3HFOA 1UJYA 2CREA 1T0HA 2F5TX 2DYBA 3ME9A 2DL7A 3SDZA 4RMOA 2K4YA 2GQVA 1FYNA 3SHWA 4XU2A 4F7UF 2P4RA 4AFQC 2M9UA 1VQ7A 5LJ3d 4MMKA 2CP0A 4RTUA 4Z02A 2KY9A 3M58A 1NJIR 1WXTA 5L23A 3CCEA 2AZSA 2JM9A 2QEXA 4JJCA 4C5HA 3MEWA 1Q95G 4ZNXA 3VS0A 2DO3A 3CCJQ 2LT1A 4LE9A 2M51A 3EG0A 3OYKA 3CD6Q 2OTLQ 1YWOA 2DEUA 2DRKA 2RQVA 3GLXA 3VS5A 3L2RA 2K6DA 2GFUA 4OB0B 2RB6A 3CPWP 2VB6A 1Y96A 3CCSQ 1QKWA 5IN1A 3CC2T 2X4XA 4N4HA 2FPDA 3G4SQ 4FYYB 4F7UB 4J9CA 4FW1A 2DXBA 1WJSA 2V8JA 2LCLA 3EFRA 1SRMA 1D1CA 3EGXB 1QVGA 3LX7A 1VQKQ 3JCMJ 1TH7A 1W4SA 3LH0A 1U3OA 2EKHA 4JRQA 2IIMA 2OTLT 4F7UA 1TU0B 2QI2A 2VVKA 2E6ZA 3RMQA 4JJDA 1YCSB 3JCMX 4PJOE 1VA7A 2HNIA 2D0NA 2ZPHB 4M4ZA 1PNJA 3J7AF 4JRPA 5LJ3g 2DTHA 3CCQQ 3LLRA 1VYTA 4LXCA 2K5IA 2ZPEB 2XMFA 2LQWA 3CCRT 2QA4A 1WIEA 2QDYB 1OU8A 3VRYA 2DZ9A 4A4HA 2DFUA 2J7IA 4II1A 3C94A 1M90C 5GANj 1RAGB 1TTHB 2J05A 2RJFA 3DLLA 4MDXA 2EIFA 2V8KA 3GNFB 2BE7D 2RH2A 2D8HA 1UHCA 2FRYA 4M7DF 5LJ5j 2RK2A 2HL5C 3H0IA 1D1AA 5LJ5d 1KC8C 5FU7B 5GJVB 4EPCA 4HKEA 4IKFA 3FB9A 1WGSA 2EYXA 4PL6A 2DL3A 2YUQA 4JLGA 2LRQA 2E3HA 1RLQC 1WZOA 3CBPA 2YUOA 4HCZA 4B9WA 5GMKi 4M75D 4LUDA 2M16A 5AYFA 6AT1B 1X6GA 4LDUA 3M0PA 3CCQA 1JB0E 2DIGA 1QCFA 1TUCA 4M7AF 3JCMb 1M1KU 1IGQA 1ZBXA 3BDLA 1AWJA 2BE9B 2LQKA 3PT9A 1AWXA 2BKDN 4FU6A 4E2FB 1OZ2A 2A36A 5I21A 5GAOq 1VQ8A 2JXBA 1KHCA 5GAMj 1JJ2A 4BE0A 4FYWB 4QKUA 3A8MB 3I56T 1GBRA 1M3AA 4OMFB 1RAAB 2EAYA 4EMKA 1K76A 2JUFA 1I8FA 1PKSA 3QYGB 1M8VA 3A8LB 5KYUB 4E47A 3UA7A 2H3JA 2LT4A 1X01A 1YJWA 2DD5A 4PLLA 3M0RA 2COYA 5FRMA 4HCKA 5A0GA 3EGDB 2RN8A 2QQBA 3FEOA 3SWNC 2E5QA 2RJCA 1YI2T 2KXDA 4WTOB 1YITQ 1BU1A 5GANd 1IGUA 1KSWA 3SD4A 2JNGA 2NWMA 1KJWA 1G3TA 4JUVA 1VQ6T 4NS5A 3CQTA 1YJNA 1IB8A 1OU9A 3MJXA 5C6SA 4C92B 1UGSB 4M7AB 3H0FA 3G71Q 1PG5B 2YRVA 1RAHB 4XTYA 2KEAA 5GMKl 1VQMT 1VQLQ 1NG2A 2MWPA 1VQ8Q 3ULRB 3CMAA 4FM4B 7AT1B 3SEMA 2DYIA 3QXEB 2P0QA 4BACA 4FYXB 4M78E 3QHSA 5GAMf 1Q81U 2EGAA 2EQMA 4XTZA 1QW1A 3X25B 4JPBW 2D8JA 3SWNB 3JV3A 4M7DG 1VOMA 1Q86R 2VWFA 3M5AA 2K9GA 2WACA 2MK5A 3KFVA 4IUQA 5CCAA 1NM7A 1N6AA 3I9QA 5FW9A 1IHVA 2VUBA 3OYBA 1IRXA 2O2OA 1QP2A 2RJDA 4KH1B 5HK0A 3CEYA 2CZ6B 5CR2A 1B7TA 1HK9A 2DM1A 2CDTA 4B9XA 3OMGA 2KYBA 4J8OA 4QVZA 1J3TA 2DAQA 3OYNA 1OI1A 3CBOA 2EYZA 8ATCB 2RI3A 2EQIA 3FLGA 2ZGWA 3CC7Q 2K3BA 1UE9A 4A53A 1K4US 4J9IA 4KRTA 1NBEB 3VKIA 2X35A 3KBGA 1RLPC 3EG3A 2QYZA 3CMAT 2V8IA 3I56Q 4ELYC 3VUBA 1QVFA 2YT6A 1H8KA 1UGQB 3I35A 1UGPB 3A8HB 1TWBA 1PKTA 1QCOA 5ECAA 2ZPBB 2HKQB 4PJOG 2FB7A 5GJWB 4C0ZA 2RM4A 1WHGA 1YIJA 1WA7A 1QKXA 1RI9A 4IUTA 2XDPA 1C0MA 3JAME 4PK4A 3HHTB 1WHLA 1MMNA 3QDRB 2E12A 4R56A 1GBQA 3CC7A 3CCMT 1EFNA 4AFSC 1G8XA 1NPPA 3NGPA 3R6NA 4J9BA 5CKHA 3JCMd 4M77D 1VQMA 1R77A 4IUUA 2HSEB 2L8DA 3CCST 4BE1A 5GANh 5J26A 5LJ3h 3CPWS 4XTWA 2QA4T 2ZAEA 4LDXA 4HCBA 4JS4A 3CD6A 2HKNA 3CCEQ 4AFZC 2RHUA 2EFIA 2CH4W 2DJZA 2KR3A 2KGTA 4KGZB 2CH4A 3M59A 5GAN4 3GF5A 3P8DA 2EYYA 2KRNA 1WJQA 3GIBA 1E7OA 1VQ7Q 2P4TA 2KT1A 2LX9A 3MP8A 3EGUA 5KE2A 1OULA 3V8KA 4N0AC 1I1JA 3RDVA 1ABOA 2EBPA 5GAN2 1VQ6Q 2YUPA 4FYVB 3G6EA 1KD1R 3G6EQ 2CUDA 4AG1C 1VQ4A 4OP0A 2COZA 5FRNA 1VQNA 1YITT 4MMLA 2LDMA 2GF7A 3E9GA 5FWCA 1WI7A 2I2LA 3I55T 4C5GA 5AT1B 4LDWA 1VQOT 1M1GA 2CKKA 5DLOA 1PSEA 2CT3A 3ZFJA 1JEGA 2NUPB 5FROA 2E6NA 2FZKB 3V8JA 4KH0B 3LW5E 4PFOA 1G3SA 2JZ2A 3S6WA 3OS2A 3FIFA 4C92F 1SHFA 3VS4A 1Q81C 2PTKA 1VQKA 2QGFB 2C0IA 2HEQA 1NJIU 2DVJA 1YHQA 3CC2Q 5CQYA 2CT4A 2Y90A 1IO6A 2K3YA 1V1CA 2DMOA 1PD1A 2LC4A 3OQ5A 3CCJT 2LP5A 1UUEA 4PJOF 2DLPA 3CMET 3CD6T 3M0TA 3CC2A 4M75F 4XU1A 2RHIA 2VYTA 5GAOm 3RNJA 2EQKA 2HSPA 2MI6A 1FMWA 4C92E 2H8HA 8AT1B 3C4SA 1KD1C 2D0QB 4M7DA 1X6OA 3JB9F 1PRMC 2F5KA 3V8LA 2HCKA 1MHNA 2WSFE 1KC8U 1R8OB 5GANf 4NL2A 1ZBJA 2HDAA 2RMOA 4IIMA 4L5GA 2EW3A 4KULA 4C8QD 4Z89A 1ACMB 2PUKB 3GPLA 1M27C 2DETA 4MDWA 4M75B 1S72Q 4JRIA 2GTOA 1RI0A 2OTLA 2JTMA 5KYYB 1UEBA 4R0KA 3GNGA 2LJ0A 1E6GA 2OX7A 3HRSA 3G4ST 4M7AA 2BIVA 2YRDA 2K3XA 4LUEA 2X3WD 1T3SA 1M1KR 5D6XA 2K57A 1GFDA 3OSSC 1WHKA 3A1PA 1U06A 3JCMP 3EG9B 1BI3A 1HXDA 5GAN7 2KSSA 2ZCFB 4OMQA 4XK8E 5A0LA 1XJWB 3X24B 4AMCA 3OA6A 4L6V5 2D6FA 1FWZA 3A5ZB 1LOJA 3WXMB 1SEMA 2CYZB 5D6YA 4EDUA 1XQHA 3G6ET 2QGGA 5KYXB 5A0DA 2FPEA 3EGDA 1VQ5Q 2DRMA 1TUDA 2RK1A 1Z9QA 4EMKB 1HYOA 4C8QB 1Q86C 1AD5A 1I0CA 5LJ3j 5KCOA 3OYHA 4MZMA 2O4XB 1M90R 5IHIA 2K5LA 1WXBA 2NUPA 2VXFA 3CCET 3PFSA 1MNEA 1NE8A 4ZGJB 1SRLA 5KYWA 3JCMV 1YJNQ 2JJ9A 2XICA 5DY9A 3HPWA 4PJOB 1VQPA 4BE2A 4AT1B 4M77B 3M0QA 3S3OA 4JLIA 4RCCA 3META 1Y57A 5KYNA 3DLMA 5GMKm 1LPLA 3JB9I 2W10A 2MMPA 4J9DA 4J9FA 5I11A 3BW1A 3CCQT 4QT7A 4HT9A 1YI2A 4J6XA 1H3ZA 5FWBA 3OYAA 4M7DD 3PVQA 4OF1A 2YWWA 4M78A 1AEYA 2FL7A 3CCSA 4TVRA 3L2WA 4F17A 3HSBA 2AHJB 2E5KA 1D0XA 2GBQA 2DD4A 1ZUUA 1I81A 1EIFA 1TS9A 2OJ2A 3CCUA 3JCMg 2VC8A 1PRLC 4J9EA 2QEXQ 3HRTA 4C0DC 5CK9A 1BYMA 3INZA 2R5AA 1IZ6A 3DKMA 3I5SA 2YRCA 2XHCA 4HXJA 2YXYA 1SSFA 1H92A 4M77C 3M4GA 2EPDA 2HQXA 1TSFA 2VXEA 1H641 1VIFA 4M7AD 3CXCP 1EZZB 2A37A 4XTVA 4E7ZA 2LJ1A 2LQNA 2F2WA 3M0SA 3RKXA 3CCRA 3L42A 1UGRB 3TREA 1YCYA 1YI2Q 3FJ5A 2SRCA 3KUFA 1MNDA 4XQ3A 4IUVA 4PJLA 1YJ9T 2E64A 5CVIA 4D8KA 4EIKA 1S1NA 3X28B 2V1RA 1YIJQ 1X2QA 1SHGA 2GTJA 2HBPA 3UPUA 4OGEA 4ATOA 1N5ZA 1KC8R 3TSZA 3MPUB 2RJEA 4XTUA 3MEUA 3QZ5B 1VQPT 2FHDA 3QKJA 2CGHA 2JMAA 2CSIA 1KG1A 3CCLA 4CC4B 1VQMQ 2AT1B 3FJPA 2X9HA 2W0ZA 4PKCC 3EGXA 1QCNA 4O6JA 1WNLA 4X34A 2KK4A 4A4GA 1YHQQ 5GAMh 3OW2P 5EC7A 2CZ0B 2CP6A 2C06A 1M30A 1A0NB 2QQAA 2J6OA 4M7AE 1WFWA 2GFAA 2OI3A 1K8AR 2JS0A 3OB9A 3LWHA 4FT4A 3M9QA 3PMIA 1VQ7T 5LJ5e 2MAMA 4HCCA 2L2PA 2RHXA 2XDDA 4RTTA 3NHNA 4JRKA 3CMEQ 1M1FA 3S3MA 2NUTA 1Q7YU 1B34A 4RCBA 2I0NA 2QK0A 4M78D 1X6BA 1KD1U 4LN2A 3EAEA 1VQ6A 5GAN6 3OYIA 2KAFA 3I5RA 3CPFA 3V7RA 2DTOA 1XOVA 2PQWA 2EYQA 1ZA2B 2LQ8A 2DILA 4ESRA 5DM7R 2XU8A 4M75G 4ZGEB 4M7DC 2QQSA 4DOVA 2E41A 1VYVA 3OMCA 2V1QA 2EWNA 2KT8A 2JM8A 1SF9A 2DIQA 3EH1A 1YNZA 2A3LA 2JMCA 3NTKA 4J7IA 3KXTA 3CCUQ 2XK0A 1NJIC 1D3BB 5D7UA 3TQ7P 1I4K1 3OYFA 2DA9A 3E1SA 3GP8A 1C6VX 3ASKA 5GAN8 2R5MA 2KE9A 3E19A 1D1BA 2QDLA 1QWEA 5KYXA 1UB4A 2KBTA 3MCAB 1U1TA 3VU3C 3L2UA 1N8RU 3RR6A 2LX7A 4J7FA 3BY7A 2DXUA 3VS2A 2P84A 1QWFA 2LTOA 1QQJA 1MGQA 5M9OA 2NUZA 2JOYA 2M1HA 1VQ4T 4F7UG 1VQ9Q 4JJBA 1PC0A 1ZHIA 5KH6A 1VQOQ 1I5OB 1LJOA 2RQUA 5LJ3f 2AIRB 2HBWA 3AHUA 3D7SB 1IXDA 1YWPA 1Z9ZA 3M53A 5GANe 1K0XA 3EH2A 2DBMA 3PGGA 2KNBB 1KQ2A 4M77G 4D6WA 4PJOC 1BI2A 2SEMA 4WCIA 4AFUC 1NYFA 1W2BP 1VUBA 5LJ5g 3CXCA 1BK2A 1JJ2P 1B3QA 3URGA 2OAWA 1CKBA 1VQ5T 2K5FA 2HQEA 3Q1JA 4MZPA 4D8DA 4ZN3A 1R0CB 1G3YA 3DB3A 5IHNA 1FXXA 2ZPGB 2D9TA 1TG0A 2NYSA 1GCPA 1RUWA 1RAIB 2RD1A 2QXFA 2YLBA 2OTJT 2VKNA 2YDLA 1AHJB 1K9AA 3SB2A 1O9SA 3P8BB 1ZX6A 1VQ9T 3PE0A 2O01E 4Y28E 4EMGA 1BKBA 5J39A 3OYMA 4E7LA 4LNPA 2MYSA 2YHTA 3EHRA 3LH5A 4C0DB 2G6FX 2RNAA 2RHZA 3G1JA 3OBYA 1ABQA 1KIKA 3L1AA 9ATCB 2O9SA 2M02A 1M2VA 4J83A 4IURA 1GXIE 1TXQA 3CC7T 1NPRA 3LYIA 2D1XA 4QQ6A 2XG8D 2DJQA 2KQWA 1U5SA 3OSVA 2L89A 4C92C 1OQKA 5CAIA 3M57A 3BE3A 3VYGA 3OBWA 4E7HA 1MUZA 2RQWA 4OB2B 1M9SA 1NLOC 3G71T 3CXCS 3LGFA 4M77A 3RUXA 4EMKC 2WSCE 2XI9A 2DL5A 1YJWT 3CMAQ 1ZSZB 3DB4A 1WQ7A 3RBBB 1AZEA 3M0UA 4PLIA 3UA6A 3S3NA 1WHHA 1YITA 3VUZA 3QBYA 4J6YA 4CI0C 1UFFA 4KGVB 3SWNA 2FPFA 1SPKA 2VV5A 4RTXA 4A4KA 4M75A 2HAXA 5GMKh 2ROLA 4NOYA 2A0FB 3QPHA 2GQIA 2QAZA 5HCKA 1W2BA 4BUGA 3C0CA 3LWIA 1PD0A 4OMOA 2JT4A 1VYUA 2DX1A 3VS3A 4BI4A 3JB9D 3QWXX 1G2BA 2DVEA 1TOVA 4BI8B 3GOXA 2LNVA 4PNOA 5CKFA 3OS5A 1YJ9A 1QLYA 2L3QA 2XDBA 1PSFA 2KMTA 2EVRA 2MPXC 3WVDB 1VQNT 4QQGA 4E7JA 4C5IA 2R57A 1AT1B 2DL8A 1UTIA 2O31A 4N4IA 2DTIA 4A54A 4C92A 4A63B 2DL4A 2LVMA 3JCMc 2YUNA 2DPPB 1K8AU 4FIBA 3O8VA 3EG9A 2DNUA 5GAOp 1FX7A 1V29B 2DEQA 3UT1A 3I55A 2E70A 1H3HA 4A4FA 3OYCA 2PUOB 2AK5A 2XD0A 1AOJA 3VRZA 4M7DB 4XU3A 2LCCA 4BDZA 1JRIA 3CCJA 4E7SA 1JXMA 1M2VB 1WHJA 5GAMd 2OTJQ 2JN0A 3QG1A 3NPFA 4K11A 2RF0A 2FG0A 1XNIA 3NMZC 3BFMA 3OW2S 2JW4A 2EGEA 1Y96B 4JZ3A 2R58A 4BY6C 3CC4T 2O9VA 1MV3A 3A8OB 4CC2A 2OAUA 4Q5WA 4X9DA 2EYWA 1ZSZA 4BB7A 2KRMA 4J9GA 3L2VA 1PHTA 1GCQA 1HJDA 1M1KC 1M3BA 2LCSA 2K2VA 4ORZA 3N5BB 1WJRA 2AKLA 3PIOA 1JQQA 1MMDA 1KFZA 3E2UA 1K9MC 4HVVA 3H6ZA 4DEYA 3EFSA 4EMHA 5IXFA 2Y4YA 1JBMA 4LDVA 5DLQE 4DQ2A 1WYXA 1AVZC 2KROA 1Q81R 1WQWA 2J6FA 2FZCB 4CRIA 3CMEA 1VQLT 1QVFS 4X1VA 4C8QE 1QVGS 5GMKj 1UHFA 1QP3A 2ZPIB 3FC3A 1VIEA 2DXCA 4BY6B 3CC4Q 4M78B 1DJ7B 3H41A 1Y71A 4CC7A 3I56A 1X75C 1ZUKA 4OMNA 1VQ5A 1K1ZA 4Y91A 3CCLQ 2CP5A 1N27A 2IPOB 3QYHB 2L3RA 1JU5C 2K7AA 2HL3A 4C92G 4E7IA 3PMTA 4M7AG 3NTIA 2FRWA 2VGNA 3X20B 4Y92A 3R6OA 3OYEA 1TUGB 1D3BA 3JCMf 4DA4A 4C8QA 1XTDA 2DK3A 3RKWA
chains in the Genus database with same CATH topology
2G3RA 4KUIA 2V8IA 4VUBA 4ELYC 3VUBA 2MAMA 4LDYA 5LJ5e 4HCCA 1QVFA 2RHXA 1LNXA 2XDDA 4ZTFA 1UGQB 3HKSA 4JRKA 2ZPFB 1M1FA 2X4JA 4JDSA 2FYKA 3JCMQ 3S3MA 1UGPB 2E65A 1Q7YU 3A8HB 4ME7A 4M78C 1B34A 2E1HA 1K73U 2EKOA 1G3WA 4RCBA 3X26B 1S72A 2ZPBB 5HY6A 4PJOG 4M78D 2FB7A 4QVCA 4C0ZA 2RM4A 4FT2A 1KD1U 1YIJA 2RHYA 3EAEA 3TEEA 4IUTA 1VQ6A 2XDPA 5GAN6 5GAOn 1OZ3A 4GLKA 3OYIA 2KAFA 3JAME 3CPFA 2CZ1B 3V7RA 3HHTB 2DXTA 2DTOA 2HD0A 2P0PA 1XOVA 2PQWA 2RI5A 3MP6A 2EYQA 3QDRB 1M4ZA 2LQ8A 2E12A 5FU6C 4R56A 2GCXA 3CC7A 2BUDA 3M4YA 5DM7R 3CCMT 3PTAA 2XU8A 4OB3B 3H8ZA 1NPPA 3OYYA 4M75G 3JCMe 4ZGEB 4M7DC 2QQSA 4DOVA 1NZ9A 5CKHA 2E41A 1BIAA 3JCMd 1YIJT 1K9MU 3OMCA 4M77D 4QW2A 1W2BS 1VQMA 1O75A 4OVAA 2EWNA 3HP9A 4IUUA 1IREB 2DIQA 2EJ9A 2L8DA 3CCST 1K73C 4BE1A 5GANh 5J26A 5LJ3h 2A3LA 3NTKA 3G7ZA 2FVUA 4J7IA 2ZZDA 3T9NA 5FLXE 3KXTA 3CPWS 4V2SA 4XTWA 3FRNA 3G4SA 2QA4T 4LDXA 4HCBA 3QSUA 2XK0A 4JS4A 1NJIC 1D3BB 4C92D 3CD6A 1N9SA 5HK3A 1I4K1 3OYFA 3CC4A 1YJNT 2RHUA 3E1SA 3GP8A 2EFIA 3J80E 3ASKA 5GAN8 2DJZA 3M55A 2R5MA 3E19A 3M59A 5GAN4 1OYXA 2F69A 3MEAA 5IAYA 4OGCA 3RERA 2NLUA 3GF5A 3NFCA 2DZCA 2X4WA 1UB4A 2E10A 3P8DA 4BI3A 3JB9H 4F7UE 1WJQA 3GIBA 4M7AC 3MCAB 1U1TA 3VU3C 3C12A 3L2UA 2QQRA 1N8RU 3OYLA 2P4TA 3JSCA 2LX9A 1BI1A 3MP8A 2P0KA 3QJYA 1KHIA 5CIUA 5KE2A 4J7FA 2DKGA 4M78F 4N0AC 3BY7A 3V8KA 1RL2A 2DXUA 3VYHB 5GAN2 5EG2A 4RG8A 1U1SA 4PJOD 4QQDA 2LTOA 1ZQ1A 3G6EA 1MGQA 4C8QC 4ZGDB 1VQ4A 5M9OA 2XKOC 2JOYA 2M1HA 1VQ4T 4F7UG 4OP0A 4C8QF 3A8GB 3F70A 1ZHIA 5KH6A 4NL3A 1Q82U 5FRNA 1YITT 3QO3A 2A7YA 4MMLA 5HKCA 1VQNA 2LDMA 2GF7A 1LJOA 3E9GA 4E7KA 1BI0A 2IVWA 5LJ3f 2I2LA 3I55T 1M90U 4C5GA 1K8AC 4JJNK 3AHUA 2CZ7B 3HFOA 4LDWA 3CCVT 1VQOT 3M53A 2F5TX 5GANe 3ME9A 1M1GA 3SDZA 4RMOA 4M7DE 2CKKA 3PGGA 1PSEA 3ZFJA 5DLOA 1KQ2A 4M77G 4D6WA 5I2SA 3FDRA 2K4YA 2GQVA 5FROA 2E6NA 4M75E 4PJOC 4XU2A 1BI2A 4F7UF 5CKDA 4LD9K 3V8JA 2M9UA 3OYGA 3LW5E 1VQ7A 1VUBA 5LJ5g 5LJ3d 4MMKA 4Z02A 2KY9A 3M58A 4FSXA 3CXCA 1G3SA 4ZTJA 2JZ2A 3S6WA 3OS2A 3FIFA 3URGA 4C92F 4R55A 3CCEA 1VQ5T 2K5FA 5D6WA 1Q81C 4KUDK 5CQXA 1VQKA 3OW2A 2HQEA 3Q1JA 4RKUE 2QEXA 4MZPA 4C5HA 4ZN3A 3TCJA 3L2QA 1NJIU 3MEWA 1G3YA 1YHQA 3DB3A 5I2MA 2DO3A 5CQYA 1FXXA 2LT1A 2Y90A 2ZPGB 4BDYA 2D9TA 3OYKA 2K3YA 1BIBA 2MWOA 4UC4A 2RD1A 1B34B 2QXFA 2YLBA 2OTJT 2OTJA 3GLXA 3L2RA 2EQUA 1AHJB 2LC4A 3M54A 3SB2A 1O9SA 2GFUA 3OQ5A 3P8BB 4O5VA 1VQ9T 3CCJT 3LGLA 4OB0B 2RB6A 2O01E 4Y28E 4EMGA 4PJOF 1BKBA 3WVEB 5J39A 4KBMB 3OYMA 3CMET 4E7LA 3CD6T 1KQSA 1Y96A 3JCMW 2YHTA 4N4GA 3ZBDA 5IN1A 3CC2T 2X4XA 3CC2A 4N4HA 4M75F 4XU1A 2RHIA 4WF2A 2RHZA 2VYTA 4C0DB 3OBYA 3L1AA 5GAOm 4F7UB 4XTXA 2DXBA 4J83A 1WJSA 2CS7A 2EQKA 2MI6A 4IURA 2V8JA 1GXIE 2LCLA 3EFRA 1Q86U 5LJ5h 1U8RA 2QTXA 4C92E 1QVGA 3HL8A 3CC7T 1G5VA 3LX7A 3RKYA 3C4SA 1KD1C 2D0QB 1NPRA 3LYIA 3JCMJ 1TH7A 4M7DA 1X6OA 2VGMA 4QQ6A 3JB9F 1W4SA 2F5KA 3V8LA 4C5EA 2XG8D 2KQWA 1MHNA 1VQLA 2WSFE 4N0AA 5GAN3 3LH0A 3OSVA 2L89A 1KC8U 4C92C 4GY5A 1R8OB 4JRQA 5GANf 4C8QG 5LJ3e 4NL2A 2OTLT 3OS1A 5CAIA 3M57A 3VYGA 4F7UA 3OBWA 2QI2A 3MO8A 4E7HA 4L5GA 2E6ZA 3RMQA 4KULA 4C8QD 3JCMX 4OB2B 1M9SA 3G71T 4PJOE 3CXCS 3LGFA 4M77A 3G71A 5CKBA 3RUXA 2EQJA 2X4YA 4EMKC 2PUKB 2HNIA 3E9FA 3GPLA 4DOWA 2ZPHB 4MDWA 4M75B 2WSCE 2XI9A 3J7AF 4JRPA 4JS5A 5GAOr 1VQOA 1VQ9A 4JRIA 1YJWT 3DB4A 2DTHA 1RI0A 5LJ3g 2OTLA 1WQ7A 2JTMA 3LLRA 1UEBA 4PLIA 3GNGA 2K5IA 5C0MA 2ZPEB 3S3NA 3MP1A 3CCRT 3HRSA 3G4ST 2QA4A 2BIVA 1YITA 4M7AA 3RKWA 3VUZA 4QVDA 2QDYB 3QBYA 4J6YA 2K3XA 2DZ9A 4A4HA 4CI0C 4II1A 3RMSA 5D6XA 2K57A 3C94A 4M78G 3SWNA 1M90C 2VV5A 3OSSC 4A4KA 5GANj 4P5NA 4M75A 1I5LA 3JCMP 2RJFA 5GAN7 1BI3A 1HXDA 5CKEA 3DLLA 3CCVA 4MDXA 2EIFA 2KSSA 2HAXA 2ZCFB 2V8KA 5GMKh 4C0FA 3GNFB 3QIIA 4XK8E 2RH2A 2QQ9A 4NOYA 5A0LA 3ZEHA 3QPHA 3X24B 3M56A 3OA6A 4L6V5 4C0GA 2D6FA 5LJ5j 1FWZA 4M7DF 2RK2A 3A5ZB 3CPWA 1W2BA 1LOJA 3WXMB 3CCUT 5LL6S 4BUGA 3CBMA 2CYZB 5D6YA 3JCMh 2KDSA 4EDUA 3LWIA 5LJ5d 4HT8A 1KC8C 5GANg 1XQHA 2JVVA 5FU7B 3G6ET 4BI4A 4EPCA 3JB9D 4HKEA 1Q7YC 4LD6A 5A0DA 4IKFA 3FB9A 2EJGA 1VQKT 1WGSA 4PL6A 2DVEA 2RK1A 3VJPA 4JLGA 2LRQA 4BI8B 4EMKB 3GOXA 2LNVA 4PNOA 2WSEE 4C8QB 4PJOA 1Q86C 3CBPA 4M77E 5CKFA 4HCZA 4B9WA 3OS5A 5LJ3j 1YJ9A 5GMKi 4M75D 2MF2A 5KCOA 3OYHA 4MZMA 2O4XB 4BD3A 5GMKe 2M16A 5AYFA 2XDBA 3ER0A 1PSFA 2K5LA 2KMTA 2VXFA 3CCET 4LDUA 3WVDB 3PFSA 1NE8A 2QEXT 4ZGJB 1VQNT 4QQGA 5L8RE 2L5QA 4E7JA 3CCQA 3JCMV 1JB0E 4C5IA 2DIGA 2R57A 3OS0A 3RIRA 3SFMA 2IG0A 4M7AF 3JCMb 1QVPA 2XICA 1M1KU 4N4IA 3HPWA 5DY9A 1ZBXA 2DTIA 1VQPA 2PVGB 3HRUA 4PJOB 4A54A 3BDLA 4BE2A 4C92A 4M77B 2LQKA 3PT9A 2BKDN 3S3OA 4JLIA 2LVMA 4RCCA 3JCMc 3META 4FU6A 2DPPB 5LJ5f 1OZ2A 3DLMA 5GMKm 5I21A 5GAOq 1K8AU 1VQ8A 4FIBA 1KHCA 3O8VA 5GAMj 3JB9I 1JJ2A 2MMPA 3OY9A 3RESA 4BE0A 3BW1A 3A8MB 2M0OA 5GAOp 3I56T 3JRZA 3CCQT 4OMFB 1FX7A 2EAYA 4EMKA 3QZ9B 1V29B 2JUFA 2DEQA 1I8FA 3UT1A 3I55A 4HT9A 1YI2A 2PVDB 2E70A 4J6XA 5FU6B 3OYAA 3JB9J 4M7DD 1H3ZA 3QYGB 4OF1A 3A8LB 4A4FA 3OYCA 1M8VA 2PUOB 5KCHA 4E47A 4M78A 2XD0A 2O4XA 2H3JA 2LT4A 2FL7A 1X01A 1YJWA 4M7DB 2DD5A 4IUPA 4PLLA 3CCSA 4TVRA 4XU3A 2RA2A 3L2WA 5FRMA 2LCCA 1P92A 3NTHA 4ELZC 4BDZA 3HSBA 1JRIA 2AHJB 3CCJA 5A0GA 4FL6A 1KQSS 2DD4A 4YTLA 3MHXA 1I81A 1EIFA 3OYJA 5GAOl 3CCUA 1N8RC 3OYDA 5CO7A 3JCMg 2VC8A 5GAMd 2QQBA 3FEOA 2JN0A 2E5QA 3QG1A 3SWNC 3JB9G 2RJCA 1Y07A 1YI2T 1WPYA 5GAMe 3HRTA 4C0DC 1KQ1A 5CK9A 1XNIA 4ZN1A 1BYMA 3BFMA 3OW2S 2Y4XA 3INZA 5GANd 1Y96B 2R5AA 3QJ6A 1IZ6A 3DKMA 2R58A 2B8AA 2JNGA 2XHCA 3SD4A 4BY6C 1YBYA 3CC4T 5A2QE 1G3TA 1SSFA 3A8OB 4JUVA 1VQ6T 4M77C 4NS5A 3M4GA 2OAUA 4Q5WA 4X9DA 2HQXA 2VXEA 4BB7A 3L2VA 1H641 1YJNA 5KE3A 1VIFA 4M7AD 5GAMg 1M1KC 5C6SA 4HA8A 4XAXB 4XTVA 4C92B 1UGSB 4M7AB 2K2VA 4J5YA 3CCMA 2XIDA 2YRVA 1WJRA 3N5BB 4XTYA 3PIOA 2YLCA 5GMKl 1VQMT 2MWPA 3RKXA 3CCRA 1K9MC 3L42A 3CMAA 4XU0A 4FM4B 1UGRB 3H6ZA 3TU4K 3TREA 3EFSA 4EMHA 3QXEB 5J3BA 1YCYA 2P0QA 2Y4YA 2PVOB 4BACA 3CCLT 1JBMA 4M78E 3QHSA 3L2ZA 4LDVA 5GAMf 4M75C 1Q81U 3HFNA 5DLQE 4DQ2A 2EQMA 4XTZA 1QW1A 3KUFA 3X25B 4XQ3A 1WQWA 4CRIA 4IUVA 3CMEA 3SWNB 5GAN5 1VQLT 1QVFS 3PIPA 4M7DG 1YJ9T 4C8QE 1QVGS 5GMKj 1M5Q1 2E64A 1QP3A 5CVIA 3M5AA 2ZPIB 3X28B 5IT9E 4MZTA 3FC3A 3PNWC 1VIEA 2WACA 2DXCA 4OB1B 4BY6B 2HBPA 3QUIA 3UPUA 4IUQA 4OGEA 3UWNA 4A4EA 4M78B 3MEVA 5CCAA 4L59A 1S72T 4ATOA 1N6AA 1DJ7B 3P8HA 1Y71A 1YHQT 3I56A 2RJEA 4XTUA 2VUBA 1X75C 3OYBA 3V7SA 2RI2A 3MEUA 3UDCA 4J6WA 3VV0A 3QZ5B 1QP2A 1VQ5A 2EJFA 3C95A 1VQPT 2FHDA 2RJDA 3QKJA 2CGHA 4KT0E 3CEYA 5HK0A 4Y91A 2CZ6B 5CR2A 1Y7XA 1JJ2S 1KG1A 3CCLA 1VQ8T 5FU7C 1HK9A 1N27A 3FJPA 4M77F 3QYHB 4PKCC 4B9XA 3OMGA 2L3RA 4J8OA 2PU9B 4QVZA 4O6JA 2RO0A 1WNLA 2DAQA 3OYNA 1OI1A 4C92G 4X34A 2KK4A 3PMTA 4A4GA 3CBOA 4E7IA 5GAMh 4M7AG 3NTIA 4X9CA 2RI3A 3FLGA 2CZ0B 1VQ7T 2C06A 2ZGWA 2JTFA 2VGNA 4RG2A 3X20B 2QQAA 3R6OA 3V7CA 4A53A 3OYEA 1Q82C 1D3BA 3JCMf 3VKIA 4DA4A 2X35A 4C8QA 3KBGA 3J81E 3BDUA 4M7AE 2GFAA 1XTDA 2DK3A 3OB9A 3LWHA 2KVQG 3CMAT 1N9RA 4FT4A 3M9QA 3PMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6Y A;  3JCM d;  5LJ5 e;  2DZ9 A;  3BFM A;  1LNX A;  3INZ A;  1Y96 B;  5GAN d;  4JRK A;  2K57 A;  3PGG A;  4M78 G;  3SWN A;  4QVD A;  2FYK A;  3JCM Q;  4M77 G;  1KQ2 A;  4C8Q B;  2E65 A;  5GAN j;  4PJO C;  4M75 E;  4M75 A;  1I5L A;  4XU2 A;  4M78 C;  1B34 A;  2E1H A;  4JUV A;  3V8J A;  4RCB A;  1HXD A;  4M77 C;  4F7U F;  3M4G A;  4X9D A;  5LJ5 g;  5GAN 7;  5LJ3 d;  4MMK A;  4PJO G;  4M78 D;  2FB7 A;  4QVC A;  2VXE A;  5GMK h;  1H64 1;  2RM4 A;  4M7A D;  5GAM g;  4NOY A;  3FIF A;  4C92 F;  4HA8 A;  4XTV A;  5GAO n;  5GAN 6;  4M7D F;  5LJ5 j;  4C92 B;  1LOJ A;  4M7A B;  4J5Y A;  3V7R A;  4HT8 A;  3JCM h;  2DXT A;  2DTO A;  5LJ5 d;  4XTY A;  5GAN g;  2YLC A;  5GMK l;  3JB9 D;  3RKX A;  2Y90 A;  3JCM P;  4XU0 A;  3FB9 A;  1BIB A;  2EJG A;  2DVE A;  1B34 B;  2RD1 A;  2YLB A;  4M75 G;  3JCM e;  3EFS A;  4M7D C;  4EMH A;  4EMK B;  1YCY A;  4PNO A;  2E41 A;  1BIA A;  1JBM A;  4M78 E;  3QHS A;  3L2Z A;  3SB2 A;  4M77 D;  4M75 C;  4M77 E;  5GAM f;  4PJO A;  3HFN A;  2EWN A;  4DQ2 A;  5LJ3 j;  4XTZ A;  2RB6 A;  5GMK i;  4M75 D;  4EMG A;  4PJO F;  5GMK e;  4XQ3 A;  2EJ9 A;  1WQW A;  1Y96 A;  5GAN h;  3JCM W;  2YHT A;  3SWN B;  5LJ3 h;  5GAN 5;  4M7D G;  2VXF A;  4C8Q E;  4V2S A;  5GMK j;  4M75 F;  4XTW A;  4WF2 A;  1M5Q 1;  4XU1 A;  2E64 A;  3L1A A;  5GAO m;  3QSU A;  4F7U B;  4XTX A;  1D3B B;  3JCM V;  4C92 D;  1N9S A;  3RIR A;  1I4K 1;  3EFR A;  4M7A F;  5LJ5 h;  3JCM b;  2QTX A;  4C92 E;  3QUI A;  5DY9 A;  4PJO B;  2DTI A;  3RKY A;  4M7D E;  4A54 A;  4M78 B;  4C92 A;  5GAN 8;  4M77 B;  4M7D A;  3JCM J;  1TH7 A;  2DJZ A;  4JLI A;  4RCC A;  5GAN 4;  3JCM c;  3JB9 F;  3V8L A;  5LJ5 f;  4XTU A;  5GMK m;  5I21 A;  3RER A;  3V7S A;  5GAO q;  2DZC A;  4N0A A;  2E10 A;  5GAM j;  4J6W A;  5GAN 3;  3JB9 I;  3JB9 H;  4F7U E;  3RES A;  2EJF A;  4C92 C;  3BW1 A;  3GIB A;  4M7A C;  2CGH A;  1U1T A;  3VU3 C;  5GAN f;  4C8Q G;  4Y91 A;  4NL2 A;  5LJ3 e;  5GAO p;  5CAI A;  4F7U A;  2EAY A;  4EMK A;  2DEQ A;  1I8F A;  1HK9 A;  4HT9 A;  2DKG A;  4M78 F;  4J6X A;  3BY7 A;  3FJP A;  4N0A C;  3V8K A;  2DXU A;  4M77 F;  3JB9 J;  4M7D D;  1M8V A;  5GAN 2;  4C8Q D;  3JCM X;  1U1S A;  4M78 A;  4PJO E;  4PJO D;  1WNL A;  1X01 A;  4M77 A;  4M7D B;  3RUX A;  4EMK C;  4C92 G;  4M7A G;  4XU3 A;  2RA2 A;  1MGQ A;  5GAM h;  4X9C A;  2HNI A;  4C8Q C;  3HSB A;  1JRI A;  4M75 B;  4F7U G;  2ZGW A;  4OP0 A;  4C8Q F;  5GAO r;  4NL3 A;  4JRI A;  1I81 A;  3QO3 A;  4MML A;  5GAO l;  5LJ3 g;  2DTH A;  3V7C A;  3JCM g;  4A53 A;  1LJO A;  1WQ7 A;  2VC8 A;  1D3B A;  3JCM f;  5LJ3 f;  5GAM d;  4C8Q A;  2I2L A;  2JN0 A;  3SWN C;  3JB9 G;  3BDU A;  4M7A E;  1WPY A;  5GAM e;  3AHU A;  3HFO A;  4M7A A;  1N9R A;  1KQ1 A;  5GAN e;  3RKW A; 
#chains in the Genus database with same CATH topology
 4KUI A;  4ZTF A;  2ZPF B;  2X4J A;  2FYK A;  2E65 A;  1FMV A;  4M78 C;  2ESW A;  1KQS P;  2EKO A;  1G3W A;  3X26 B;  1S72 A;  3EFO B;  1VQN Q;  4FT2 A;  3I55 Q;  1X27 A;  1Q7Y R;  2V26 A;  3TEE A;  1OOT A;  2DE0 X;  1OZ3 A;  2CP2 A;  2DF6 A;  2CZ1 B;  2RI5 A;  4F04 B;  1M4Z A;  2COW A;  5FU6 C;  4FCY A;  3M4Y A;  2L3S A;  2F2V A;  1BIA A;  1K9M U;  3QDF A;  1AZG B;  1W2B S;  1NEB A;  1IRE B;  4F14 A;  1K73 C;  3G7Z A;  2FVU A;  5FLX E;  4V2S A;  3FRN A;  2CP7 A;  1PWT A;  1WX6 A;  5HK3 A;  1YJN T;  2C0T A;  2BTT A;  2LJ3 A;  1MMG A;  2LZ6 B;  2QA4 Q;  2FZG B;  2E3I A;  1JO8 A;  1OYX A;  2H3E B;  2MCN A;  5IAY A;  4OGC A;  2NLU A;  1D0Z A;  2CUB A;  2DZC A;  2HQH A;  2E10 A;  3JB9 H;  1RAC B;  2RQR A;  4F7U E;  3EG2 A;  2QTV A;  2QQR A;  3JSC A;  1RAF B;  1BI1 A;  2AZV A;  5KYW B;  2P0K A;  5CIU A;  4M78 F;  2ED1 A;  3REA B;  1N8R R;  4RG8 A;  1U1S A;  2AKK A;  1F1B B;  1YJW Q;  1ZQ1 A;  4C8Q C;  4OMM A;  4OML A;  4C8Q F;  3A8G B;  3F70 A;  1BBZ A;  4NL3 A;  1Q82 U;  3QO3 A;  3UF4 A;  2HMA A;  1OX8 A;  1BI0 A;  2IVW A;  1M90 U;  1K8A C;  4HVU A;  2C0O A;  3CCV T;  1WXU A;  2KRS A;  5I2S A;  3FDR A;  2ABL A;  4M75 E;  5CKD A;  4LD9 K;  3OYG A;  4CC3 A;  4FSX A;  4ZTJ A;  1SG5 A;  4R55 A;  1OV3 A;  5D6W A;  4KUD K;  5CQX A;  3OW2 A;  4RKU E;  1PCX A;  3TCJ A;  3L2Q A;  2O88 A;  5I2M A;  2L3P A;  2J06 A;  2QG9 B;  4BDY A;  1BCM A;  4RTV A;  1BIB A;  1D0Y A;  2MWO A;  4UC4 A;  1B34 B;  1NYG A;  2OTJ A;  1SSH A;  2EQU A;  2PNI A;  3M54 A;  4O5V A;  1T0J A;  3LGL A;  4KGX B;  3QWY A;  1QVG P;  3WVE B;  4KBM B;  1QVF P;  1KQS A;  1YP5 A;  3JCM W;  4N4G A;  3ZBD A;  4PJJ A;  2BZ8 A;  4WF2 A;  3UAT A;  4XTX A;  1X2K A;  2CS7 A;  1Q86 U;  5LJ5 h;  1U8R A;  4DBH A;  2QTX A;  4RTZ A;  3HL8 A;  1G5V A;  1UDL A;  3RKY A;  1BCO A;  3GBQ A;  2VGM A;  4C5E A;  2E4H A;  1VQL A;  4N0A A;  5GAN 3;  4GY5 A;  2K2M A;  4C8Q G;  1G83 A;  5LJ3 e;  3OS1 A;  2DER A;  2PZ1 A;  3MO8 A;  1Y0M A;  3U23 A;  2J6K A;  4B6M A;  1W6X A;  1FMK A;  3G71 A;  5CKB A;  2EQJ A;  2X4Y A;  4HVW A;  1BB9 A;  3E9F A;  4DOW A;  2BZX A;  4JS5 A;  5GAO r;  1VQO A;  1VQ9 A;  3EFO A;  4OMP A;  5C0M A;  3TSW A;  3MP1 A;  3CCM Q;  2F2X A;  2K79 A;  4QVD A;  1YJ9 Q;  4AG2 C;  3RMS A;  4M78 G;  1Q82 R;  1HD3 A;  4P5N A;  1I5L A;  3CCV A;  2JTE A;  5CKE A;  2YSQ A;  4RUG A;  4C0F A;  3QII A;  1UGV A;  2QQ9 A;  4DEX A;  3ZEH A;  3M56 A;  4DBQ A;  4C0G A;  3AT1 B;  3CPW A;  2HZY A;  3CCU T;  5LL6 S;  3CBM A;  4HT8 A;  3JCM h;  2KDS A;  1ARK A;  5GAN g;  2JVV A;  1R0B G;  1Q7Y C;  4LD6 A;  3REB B;  2EJG A;  1VQK T;  3VJP A;  1I07 A;  2WSE E;  4PJO A;  3VS1 A;  4M77 E;  1RAB B;  1W70 A;  1M2O A;  1HSQ A;  2MF2 A;  4BD3 A;  5GMK e;  2VAS A;  3TVT A;  3ER0 A;  1UEC A;  2KYM A;  4GLM A;  2JS2 A;  2FEI A;  1ZUY A;  2BZY A;  2QEX T;  5L8R E;  2L5Q A;  1QMC A;  5KYY A;  3OS0 A;  3RIR A;  3SFM A;  2IG0 A;  3EG1 A;  1QVP A;  2PVG B;  3HRU A;  3VS6 A;  1W1F A;  1JXO A;  5LJ5 f;  2GGR A;  4J9H A;  4ANJ A;  3CCR Q;  3OY9 A;  3RES A;  2A08 A;  2M0O A;  4Z88 A;  3JRZ A;  3QZ9 B;  2LMJ A;  1UG1 A;  1UJ0 A;  2KI7 A;  2PVD B;  5FU6 B;  3JB9 J;  1MMA A;  2X3X D;  5KCH A;  2O4X A;  2RQT A;  1OPK A;  2ENM A;  4IUP A;  2RA2 A;  4ELZ C;  1P92 A;  3NTH A;  3ZL7 C;  4PFP A;  1MV0 B;  2ED0 A;  4FL6 A;  1LCK A;  1KQS S;  4YTL A;  3MHX A;  3OYJ A;  5GAO l;  1N8R C;  3OYD A;  5CO7 A;  1SKU B;  3JB9 G;  1Y07 A;  1NLP C;  1WPY A;  5GAM e;  1KQ1 A;  4ZN1 A;  3MKD A;  5KYU A;  2Y4X A;  3QJ6 A;  1B07 A;  1RAE B;  2B8A A;  1YBY A;  5A2Q E;  2Z0W A;  1CKA A;  1YN8 A;  2DBK A;  5KE3 A;  5GAM g;  4HA8 A;  2LNH B;  4XAX B;  4J5Y A;  3CCM A;  2XID A;  2KXC A;  2YLC A;  3H0H A;  4XU0 A;  5IHK A;  3TU4 K;  5J3B A;  3EHQ A;  2PVO B;  3CCL T;  1ZLM A;  3L2Z A;  4M75 C;  3H9N A;  2X51 A;  4JZ4 A;  3HFN A;  2MOX A;  3THK A;  5GAN 5;  3PIP A;  1VQ4 Q;  1ZSG A;  1M5Q 1;  4PFZ A;  1KK7 A;  1X43 A;  5IT9 E;  4MZT A;  3PNW C;  5IH2 A;  4OB1 B;  3QUI A;  2FO0 A;  3UWN A;  4M7D E;  4A4E A;  1S72 T;  3MEV A;  1K0S A;  4L59 A;  3P8H A;  1YHQ T;  3A98 A;  1X69 A;  1K9M R;  3V7S A;  3IQL A;  2RI2 A;  3UDC A;  4J6W A;  3VV0 A;  2EJF A;  3C95 A;  4PJN A;  4KT0 E;  2B86 A;  1Y7X A;  1JJ2 S;  4Z8A A;  1WDX A;  2EGC A;  1VQ8 T;  5FU7 C;  2ATC B;  2F1L A;  4M77 F;  2RPN A;  1AWO A;  2PU9 B;  2RO0 A;  2CSQ A;  1OPL A;  4X9C A;  3VS7 A;  1E6H A;  2ECZ A;  2JTF A;  1EX4 A;  4RG2 A;  3V7C A;  1Q82 C;  3HTR A;  3J81 E;  3BDU A;  3PVL A;  1WHM A;  2KVQ G;  1N9R A;  2G3R A;  4VUB A;  4LDY A;  1M3C A;  1LNX A;  1ZA1 B;  3HKS A;  4JDS A;  3JCM Q;  4ME7 A;  1K73 U;  2E1H A;  1GRI A;  5HY6 A;  4QVC A;  2QAS A;  4FW2 A;  2RHY A;  1C1A A;  5I22 A;  4FSS A;  5GAO n;  4GLK A;  1RAD B;  4DBR A;  2A28 A;  1VQP Q;  4RTW A;  2DXT A;  2HD0 A;  2P0P A;  1NEG A;  1M8M A;  3MP6 A;  2L0A A;  2GCX A;  2BUD A;  3PTA A;  2GNC A;  4OB3 B;  1LVK A;  3H8Z A;  3OYY A;  3JCM e;  4RTY A;  1NZ9 A;  1YIJ T;  4GBQ A;  4QW2 A;  1O75 A;  4OVA A;  4IIO A;  3HP9 A;  1ZSZ C;  4PJM A;  1GCQ C;  2EJ9 A;  1IHW A;  2MIO A;  2ZZD A;  3T9N A;  3CCV Q;  1D09 B;  3G4S A;  3QSU A;  1OEB A;  4C92 D;  1N9S A;  1PM3 A;  3CC4 A;  4DBF A;  3J80 E;  4F16 A;  1CSK A;  3M55 A;  2CP3 A;  2F69 A;  3MEA A;  3RER A;  3NFC A;  2X4W A;  1GL5 A;  4BI3 A;  1V76 A;  4E6R A;  4M7A C;  3C12 A;  3O5Z A;  3OYL A;  3QJY A;  1KHI A;  2ROT A;  2DKG A;  1RL2 A;  3VYH B;  5EG2 A;  4PJO D;  4QQD A;  2NUT B;  4ZGD B;  1WLP B;  1AWW A;  1T3L A;  2XKO C;  5IXB A;  2M0Y A;  2A7Y A;  5HKC A;  4E7K A;  1K73 R;  1OX9 A;  4JJN K;  1GFC A;  1YFN A;  2CZ7 B;  3HFO A;  1UJY A;  2CRE A;  1T0H A;  2F5T X;  2DYB A;  3ME9 A;  2DL7 A;  3SDZ A;  4RMO A;  2K4Y A;  2GQV A;  1FYN A;  3SHW A;  4XU2 A;  4F7U F;  2P4R A;  4AFQ C;  2M9U A;  1VQ7 A;  5LJ3 d;  4MMK A;  2CP0 A;  4RTU A;  4Z02 A;  2KY9 A;  3M58 A;  1NJI R;  1WXT A;  5L23 A;  3CCE A;  2AZS A;  2JM9 A;  2QEX A;  4JJC A;  4C5H A;  3MEW A;  1Q95 G;  4ZNX A;  3VS0 A;  2DO3 A;  3CCJ Q;  2LT1 A;  4LE9 A;  2M51 A;  3EG0 A;  3OYK A;  3CD6 Q;  2OTL Q;  1YWO A;  2DEU A;  2DRK A;  2RQV A;  3GLX A;  3VS5 A;  3L2R A;  2K6D A;  2GFU A;  4OB0 B;  2RB6 A;  3CPW P;  2VB6 A;  1Y96 A;  3CCS Q;  1QKW A;  5IN1 A;  3CC2 T;  2X4X A;  4N4H A;  2FPD A;  3G4S Q;  4FYY B;  4F7U B;  4J9C A;  4FW1 A;  2DXB A;  1WJS A;  2V8J A;  2LCL A;  3EFR A;  1SRM A;  1D1C A;  3EGX B;  1QVG A;  3LX7 A;  1VQK Q;  3JCM J;  1TH7 A;  1W4S A;  3LH0 A;  1U3O A;  2EKH A;  4JRQ A;  2IIM A;  2OTL T;  4F7U A;  1TU0 B;  2QI2 A;  2VVK A;  2E6Z A;  3RMQ A;  4JJD A;  1YCS B;  3JCM X;  4PJO E;  1VA7 A;  2HNI A;  2D0N A;  2ZPH B;  4M4Z A;  1PNJ A;  3J7A F;  4JRP A;  5LJ3 g;  2DTH A;  3CCQ Q;  3LLR A;  1VYT A;  4LXC A;  2K5I A;  2ZPE B;  2XMF A;  2LQW A;  3CCR T;  2QA4 A;  1WIE A;  2QDY B;  1OU8 A;  3VRY A;  2DZ9 A;  4A4H A;  2DFU A;  2J7I A;  4II1 A;  3C94 A;  1M90 C;  5GAN j;  1RAG B;  1TTH B;  2J05 A;  2RJF A;  3DLL A;  4MDX A;  2EIF A;  2V8K A;  3GNF B;  2BE7 D;  2RH2 A;  2D8H A;  1UHC A;  2FRY A;  4M7D F;  5LJ5 j;  2RK2 A;  2HL5 C;  3H0I A;  1D1A A;  5LJ5 d;  1KC8 C;  5FU7 B;  5GJV B;  4EPC A;  4HKE A;  4IKF A;  3FB9 A;  1WGS A;  2EYX A;  4PL6 A;  2DL3 A;  2YUQ A;  4JLG A;  2LRQ A;  2E3H A;  1RLQ C;  1WZO A;  3CBP A;  2YUO A;  4HCZ A;  4B9W A;  5GMK i;  4M75 D;  4LUD A;  2M16 A;  5AYF A;  6AT1 B;  1X6G A;  4LDU A;  3M0P A;  3CCQ A;  1JB0 E;  2DIG A;  1QCF A;  1TUC A;  4M7A F;  3JCM b;  1M1K U;  1IGQ A;  1ZBX A;  3BDL A;  1AWJ A;  2BE9 B;  2LQK A;  3PT9 A;  1AWX A;  2BKD N;  4FU6 A;  4E2F B;  1OZ2 A;  2A36 A;  5I21 A;  5GAO q;  1VQ8 A;  2JXB A;  1KHC A;  5GAM j;  1JJ2 A;  4BE0 A;  4FYW B;  4QKU A;  3A8M B;  3I56 T;  1GBR A;  1M3A A;  4OMF B;  1RAA B;  2EAY A;  4EMK A;  1K76 A;  2JUF A;  1I8F A;  1PKS A;  3QYG B;  1M8V A;  3A8L B;  5KYU B;  4E47 A;  3UA7 A;  2H3J A;  2LT4 A;  1X01 A;  1YJW A;  2DD5 A;  4PLL A;  3M0R A;  2COY A;  5FRM A;  4HCK A;  5A0G A;  3EGD B;  2RN8 A;  2QQB A;  3FEO A;  3SWN C;  2E5Q A;  2RJC A;  1YI2 T;  2KXD A;  4WTO B;  1YIT Q;  1BU1 A;  5GAN d;  1IGU A;  1KSW A;  3SD4 A;  2JNG A;  2NWM A;  1KJW A;  1G3T A;  4JUV A;  1VQ6 T;  4NS5 A;  3CQT A;  1YJN A;  1IB8 A;  1OU9 A;  3MJX A;  5C6S A;  4C92 B;  1UGS B;  4M7A B;  3H0F A;  3G71 Q;  1PG5 B;  2YRV A;  1RAH B;  4XTY A;  2KEA A;  5GMK l;  1VQM T;  1VQL Q;  1NG2 A;  2MWP A;  1VQ8 Q;  3ULR B;  3CMA A;  4FM4 B;  7AT1 B;  3SEM A;  2DYI A;  3QXE B;  2P0Q A;  4BAC A;  4FYX B;  4M78 E;  3QHS A;  5GAM f;  1Q81 U;  2EGA A;  2EQM A;  4XTZ A;  1QW1 A;  3X25 B;  4JPB W;  2D8J A;  3SWN B;  3JV3 A;  4M7D G;  1VOM A;  1Q86 R;  2VWF A;  3M5A A;  2K9G A;  2WAC A;  2MK5 A;  3KFV A;  4IUQ A;  5CCA A;  1NM7 A;  1N6A A;  3I9Q A;  5FW9 A;  1IHV A;  2VUB A;  3OYB A;  1IRX A;  2O2O A;  1QP2 A;  2RJD A;  4KH1 B;  5HK0 A;  3CEY A;  2CZ6 B;  5CR2 A;  1B7T A;  1HK9 A;  2DM1 A;  2CDT A;  4B9X A;  3OMG A;  2KYB A;  4J8O A;  4QVZ A;  1J3T A;  2DAQ A;  3OYN A;  1OI1 A;  3CBO A;  2EYZ A;  8ATC B;  2RI3 A;  2EQI A;  3FLG A;  2ZGW A;  3CC7 Q;  2K3B A;  1UE9 A;  4A53 A;  1K4U S;  4J9I A;  4KRT A;  1NBE B;  3VKI A;  2X35 A;  3KBG A;  1RLP C;  3EG3 A;  2QYZ A;  3CMA T;  2V8I A;  3I56 Q;  4ELY C;  3VUB A;  1QVF A;  2YT6 A;  1H8K A;  1UGQ B;  3I35 A;  1UGP B;  3A8H B;  1TWB A;  1PKT A;  1QCO A;  5ECA A;  2ZPB B;  2HKQ B;  4PJO G;  2FB7 A;  5GJW B;  4C0Z A;  2RM4 A;  1WHG A;  1YIJ A;  1WA7 A;  1QKX A;  1RI9 A;  4IUT A;  2XDP A;  1C0M A;  3JAM E;  4PK4 A;  3HHT B;  1WHL A;  1MMN A;  3QDR B;  2E12 A;  4R56 A;  1GBQ A;  3CC7 A;  3CCM T;  1EFN A;  4AFS C;  1G8X A;  1NPP A;  3NGP A;  3R6N A;  4J9B A;  5CKH A;  3JCM d;  4M77 D;  1VQM A;  1R77 A;  4IUU A;  2HSE B;  2L8D A;  3CCS T;  4BE1 A;  5GAN h;  5J26 A;  5LJ3 h;  3CPW S;  4XTW A;  2QA4 T;  2ZAE A;  4LDX A;  4HCB A;  4JS4 A;  3CD6 A;  2HKN A;  3CCE Q;  4AFZ C;  2RHU A;  2EFI A;  2CH4 W;  2DJZ A;  2KR3 A;  2KGT A;  4KGZ B;  2CH4 A;  3M59 A;  5GAN 4;  3GF5 A;  3P8D A;  2EYY A;  2KRN A;  1WJQ A;  3GIB A;  1E7O A;  1VQ7 Q;  2P4T A;  2KT1 A;  2LX9 A;  3MP8 A;  3EGU A;  5KE2 A;  1OUL A;  3V8K A;  4N0A C;  1I1J A;  3RDV A;  1ABO A;  2EBP A;  5GAN 2;  1VQ6 Q;  2YUP A;  4FYV B;  3G6E A;  1KD1 R;  3G6E Q;  2CUD A;  4AG1 C;  1VQ4 A;  4OP0 A;  2COZ A;  5FRN A;  1VQN A;  1YIT T;  4MML A;  2LDM A;  2GF7 A;  3E9G A;  5FWC A;  1WI7 A;  2I2L A;  3I55 T;  4C5G A;  5AT1 B;  4LDW A;  1VQO T;  1M1G A;  2CKK A;  5DLO A;  1PSE A;  2CT3 A;  3ZFJ A;  1JEG A;  2NUP B;  5FRO A;  2E6N A;  2FZK B;  3V8J A;  4KH0 B;  3LW5 E;  4PFO A;  1G3S A;  2JZ2 A;  3S6W A;  3OS2 A;  3FIF A;  4C92 F;  1SHF A;  3VS4 A;  1Q81 C;  2PTK A;  1VQK A;  2QGF B;  2C0I A;  2HEQ A;  1NJI U;  2DVJ A;  1YHQ A;  3CC2 Q;  5CQY A;  2CT4 A;  2Y90 A;  1IO6 A;  2K3Y A;  1V1C A;  2DMO A;  1PD1 A;  2LC4 A;  3OQ5 A;  3CCJ T;  2LP5 A;  1UUE A;  4PJO F;  2DLP A;  3CME T;  3CD6 T;  3M0T A;  3CC2 A;  4M75 F;  4XU1 A;  2RHI A;  2VYT A;  5GAO m;  3RNJ A;  2EQK A;  2HSP A;  2MI6 A;  1FMW A;  4C92 E;  2H8H A;  8AT1 B;  3C4S A;  1KD1 C;  2D0Q B;  4M7D A;  1X6O A;  3JB9 F;  1PRM C;  2F5K A;  3V8L A;  2HCK A;  1MHN A;  2WSF E;  1KC8 U;  1R8O B;  5GAN f;  4NL2 A;  1ZBJ A;  2HDA A;  2RMO A;  4IIM A;  4L5G A;  2EW3 A;  4KUL A;  4C8Q D;  4Z89 A;  1ACM B;  2PUK B;  3GPL A;  1M27 C;  2DET A;  4MDW A;  4M75 B;  1S72 Q;  4JRI A;  2GTO A;  1RI0 A;  2OTL A;  2JTM A;  5KYY B;  1UEB A;  4R0K A;  3GNG A;  2LJ0 A;  1E6G A;  2OX7 A;  3HRS A;  3G4S T;  4M7A A;  2BIV A;  2YRD A;  2K3X A;  4LUE A;  2X3W D;  1T3S A;  1M1K R;  5D6X A;  2K57 A;  1GFD A;  3OSS C;  1WHK A;  3A1P A;  1U06 A;  3JCM P;  3EG9 B;  1BI3 A;  1HXD A;  5GAN 7;  2KSS A;  2ZCF B;  4OMQ A;  4XK8 E;  5A0L A;  1XJW B;  3X24 B;  4AMC A;  3OA6 A;  4L6V 5;  2D6F A;  1FWZ A;  3A5Z B;  1LOJ A;  3WXM B;  1SEM A;  2CYZ B;  5D6Y A;  4EDU A;  1XQH A;  3G6E T;  2QGG A;  5KYX B;  5A0D A;  2FPE A;  3EGD A;  1VQ5 Q;  2DRM A;  1TUD A;  2RK1 A;  1Z9Q A;  4EMK B;  1HYO A;  4C8Q B;  1Q86 C;  1AD5 A;  1I0C A;  5LJ3 j;  5KCO A;  3OYH A;  4MZM A;  2O4X B;  1M90 R;  5IHI A;  2K5L A;  1WXB A;  2NUP A;  2VXF A;  3CCE T;  3PFS A;  1MNE A;  1NE8 A;  4ZGJ B;  1SRL A;  5KYW A;  3JCM V;  1YJN Q;  2JJ9 A;  2XIC A;  5DY9 A;  3HPW A;  4PJO B;  1VQP A;  4BE2 A;  4AT1 B;  4M77 B;  3M0Q A;  3S3O A;  4JLI A;  4RCC A;  3MET A;  1Y57 A;  5KYN A;  3DLM A;  5GMK m;  1LPL A;  3JB9 I;  2W10 A;  2MMP A;  4J9D A;  4J9F A;  5I11 A;  3BW1 A;  3CCQ T;  4QT7 A;  4HT9 A;  1YI2 A;  4J6X A;  1H3Z A;  5FWB A;  3OYA A;  4M7D D;  3PVQ A;  4OF1 A;  2YWW A;  4M78 A;  1AEY A;  2FL7 A;  3CCS A;  4TVR A;  3L2W A;  4F17 A;  3HSB A;  2AHJ B;  2E5K A;  1D0X A;  2GBQ A;  2DD4 A;  1ZUU A;  1I81 A;  1EIF A;  1TS9 A;  2OJ2 A;  3CCU A;  3JCM g;  2VC8 A;  1PRL C;  4J9E A;  2QEX Q;  3HRT A;  4C0D C;  5CK9 A;  1BYM A;  3INZ A;  2R5A A;  1IZ6 A;  3DKM A;  3I5S A;  2YRC A;  2XHC A;  4HXJ A;  2YXY A;  1SSF A;  1H92 A;  4M77 C;  3M4G A;  2EPD A;  2HQX A;  1TSF A;  2VXE A;  1H64 1;  1VIF A;  4M7A D;  3CXC P;  1EZZ B;  2A37 A;  4XTV A;  4E7Z A;  2LJ1 A;  2LQN A;  2F2W A;  3M0S A;  3RKX A;  3CCR A;  3L42 A;  1UGR B;  3TRE A;  1YCY A;  1YI2 Q;  3FJ5 A;  2SRC A;  3KUF A;  1MND A;  4XQ3 A;  4IUV A;  4PJL A;  1YJ9 T;  2E64 A;  5CVI A;  4D8K A;  4EIK A;  1S1N A;  3X28 B;  2V1R A;  1YIJ Q;  1X2Q A;  1SHG A;  2GTJ A;  2HBP A;  3UPU A;  4OGE A;  4ATO A;  1N5Z A;  1KC8 R;  3TSZ A;  3MPU B;  2RJE A;  4XTU A;  3MEU A;  3QZ5 B;  1VQP T;  2FHD A;  3QKJ A;  2CGH A;  2JMA A;  2CSI A;  1KG1 A;  3CCL A;  4CC4 B;  1VQM Q;  2AT1 B;  3FJP A;  2X9H A;  2W0Z A;  4PKC C;  3EGX A;  1QCN A;  4O6J A;  1WNL A;  4X34 A;  2KK4 A;  4A4G A;  1YHQ Q;  5GAM h;  3OW2 P;  5EC7 A;  2CZ0 B;  2CP6 A;  2C06 A;  1M30 A;  1A0N B;  2QQA A;  2J6O A;  4M7A E;  1WFW A;  2GFA A;  2OI3 A;  1K8A R;  2JS0 A;  3OB9 A;  3LWH A;  4FT4 A;  3M9Q A;  3PMI A;  1VQ7 T;  5LJ5 e;  2MAM A;  4HCC A;  2L2P A;  2RHX A;  2XDD A;  4RTT A;  3NHN A;  4JRK A;  3CME Q;  1M1F A;  3S3M A;  2NUT A;  1Q7Y U;  1B34 A;  4RCB A;  2I0N A;  2QK0 A;  4M78 D;  1X6B A;  1KD1 U;  4LN2 A;  3EAE A;  1VQ6 A;  5GAN 6;  3OYI A;  2KAF A;  3I5R A;  3CPF A;  3V7R A;  2DTO A;  1XOV A;  2PQW A;  2EYQ A;  1ZA2 B;  2LQ8 A;  2DIL A;  4ESR A;  5DM7 R;  2XU8 A;  4M75 G;  4ZGE B;  4M7D C;  2QQS A;  4DOV A;  2E41 A;  1VYV A;  3OMC A;  2V1Q A;  2EWN A;  2KT8 A;  2JM8 A;  1SF9 A;  2DIQ A;  3EH1 A;  1YNZ A;  2A3L A;  2JMC A;  3NTK A;  4J7I A;  3KXT A;  3CCU Q;  2XK0 A;  1NJI C;  1D3B B;  5D7U A;  3TQ7 P;  1I4K 1;  3OYF A;  2DA9 A;  3E1S A;  3GP8 A;  1C6V X;  3ASK A;  5GAN 8;  2R5M A;  2KE9 A;  3E19 A;  1D1B A;  2QDL A;  1QWE A;  5KYX A;  1UB4 A;  2KBT A;  3MCA B;  1U1T A;  3VU3 C;  3L2U A;  1N8R U;  3RR6 A;  2LX7 A;  4J7F A;  3BY7 A;  2DXU A;  3VS2 A;  2P84 A;  1QWF A;  2LTO A;  1QQJ A;  1MGQ A;  5M9O A;  2NUZ A;  2JOY A;  2M1H A;  1VQ4 T;  4F7U G;  1VQ9 Q;  4JJB A;  1PC0 A;  1ZHI A;  5KH6 A;  1VQO Q;  1I5O B;  1LJO A;  2RQU A;  5LJ3 f;  2AIR B;  2HBW A;  3AHU A;  3D7S B;  1IXD A;  1YWP A;  1Z9Z A;  3M53 A;  5GAN e;  1K0X A;  3EH2 A;  2DBM A;  3PGG A;  2KNB B;  1KQ2 A;  4M77 G;  4D6W A;  4PJO C;  1BI2 A;  2SEM A;  4WCI A;  4AFU C;  1NYF A;  1W2B P;  1VUB A;  5LJ5 g;  3CXC A;  1BK2 A;  1JJ2 P;  1B3Q A;  3URG A;  2OAW A;  1CKB A;  1VQ5 T;  2K5F A;  2HQE A;  3Q1J A;  4MZP A;  4D8D A;  4ZN3 A;  1R0C B;  1G3Y A;  3DB3 A;  5IHN A;  1FXX A;  2ZPG B;  2D9T A;  1TG0 A;  2NYS A;  1GCP A;  1RUW A;  1RAI B;  2RD1 A;  2QXF A;  2YLB A;  2OTJ T;  2VKN A;  2YDL A;  1AHJ B;  1K9A A;  3SB2 A;  1O9S A;  3P8B B;  1ZX6 A;  1VQ9 T;  3PE0 A;  2O01 E;  4Y28 E;  4EMG A;  1BKB A;  5J39 A;  3OYM A;  4E7L A;  4LNP A;  2MYS A;  2YHT A;  3EHR A;  3LH5 A;  4C0D B;  2G6F X;  2RNA A;  2RHZ A;  3G1J A;  3OBY A;  1ABQ A;  1KIK A;  3L1A A;  9ATC B;  2O9S A;  2M02 A;  1M2V A;  4J83 A;  4IUR A;  1GXI E;  1TXQ A;  3CC7 T;  1NPR A;  3LYI A;  2D1X A;  4QQ6 A;  2XG8 D;  2DJQ A;  2KQW A;  1U5S A;  3OSV A;  2L89 A;  4C92 C;  1OQK A;  5CAI A;  3M57 A;  3BE3 A;  3VYG A;  3OBW A;  4E7H A;  1MUZ A;  2RQW A;  4OB2 B;  1M9S A;  1NLO C;  3G71 T;  3CXC S;  3LGF A;  4M77 A;  3RUX A;  4EMK C;  2WSC E;  2XI9 A;  2DL5 A;  1YJW T;  3CMA Q;  1ZSZ B;  3DB4 A;  1WQ7 A;  3RBB B;  1AZE A;  3M0U A;  4PLI A;  3UA6 A;  3S3N A;  1WHH A;  1YIT A;  3VUZ A;  3QBY A;  4J6Y A;  4CI0 C;  1UFF A;  4KGV B;  3SWN A;  2FPF A;  1SPK A;  2VV5 A;  4RTX A;  4A4K A;  4M75 A;  2HAX A;  5GMK h;  2ROL A;  4NOY A;  2A0F B;  3QPH A;  2GQI A;  2QAZ A;  5HCK A;  1W2B A;  4BUG A;  3C0C A;  3LWI A;  1PD0 A;  4OMO A;  2JT4 A;  1VYU A;  2DX1 A;  3VS3 A;  4BI4 A;  3JB9 D;  3QWX X;  1G2B A;  2DVE A;  1TOV A;  4BI8 B;  3GOX A;  2LNV A;  4PNO A;  5CKF A;  3OS5 A;  1YJ9 A;  1QLY A;  2L3Q A;  2XDB A;  1PSF A;  2KMT A;  2EVR A;  2MPX C;  3WVD B;  1VQN T;  4QQG A;  4E7J A;  4C5I A;  2R57 A;  1AT1 B;  2DL8 A;  1UTI A;  2O31 A;  4N4I A;  2DTI A;  4A54 A;  4C92 A;  4A63 B;  2DL4 A;  2LVM A;  3JCM c;  2YUN A;  2DPP B;  1K8A U;  4FIB A;  3O8V A;  3EG9 A;  2DNU A;  5GAO p;  1FX7 A;  1V29 B;  2DEQ A;  3UT1 A;  3I55 A;  2E70 A;  1H3H A;  4A4F A;  3OYC A;  2PUO B;  2AK5 A;  2XD0 A;  1AOJ A;  3VRZ A;  4M7D B;  4XU3 A;  2LCC A;  4BDZ A;  1JRI A;  3CCJ A;  4E7S A;  1JXM A;  1M2V B;  1WHJ A;  5GAM d;  2OTJ Q;  2JN0 A;  3QG1 A;  3NPF A;  4K11 A;  2RF0 A;  2FG0 A;  1XNI A;  3NMZ C;  3BFM A;  3OW2 S;  2JW4 A;  2EGE A;  1Y96 B;  4JZ3 A;  2R58 A;  4BY6 C;  3CC4 T;  2O9V A;  1MV3 A;  3A8O B;  4CC2 A;  2OAU A;  4Q5W A;  4X9D A;  2EYW A;  1ZSZ A;  4BB7 A;  2KRM A;  4J9G A;  3L2V A;  1PHT A;  1GCQ A;  1HJD A;  1M1K C;  1M3B A;  2LCS A;  2K2V A;  4ORZ A;  3N5B B;  1WJR A;  2AKL A;  3PIO A;  1JQQ A;  1MMD A;  1KFZ A;  3E2U A;  1K9M C;  4HVV A;  3H6Z A;  4DEY A;  3EFS A;  4EMH A;  5IXF A;  2Y4Y A;  1JBM A;  4LDV A;  5DLQ E;  4DQ2 A;  1WYX A;  1AVZ C;  2KRO A;  1Q81 R;  1WQW A;  2J6F A;  2FZC B;  4CRI A;  3CME A;  1VQL T;  1QVF S;  4X1V A;  4C8Q E;  1QVG S;  5GMK j;  1UHF A;  1QP3 A;  2ZPI B;  3FC3 A;  1VIE A;  2DXC A;  4BY6 B;  3CC4 Q;  4M78 B;  1DJ7 B;  3H41 A;  1Y71 A;  4CC7 A;  3I56 A;  1X75 C;  1ZUK A;  4OMN A;  1VQ5 A;  1K1Z A;  4Y91 A;  3CCL Q;  2CP5 A;  1N27 A;  2IPO B;  3QYH B;  2L3R A;  1JU5 C;  2K7A A;  2HL3 A;  4C92 G;  4E7I A;  3PMT A;  4M7A G;  3NTI A;  2FRW A;  2VGN A;  3X20 B;  4Y92 A;  3R6O A;  3OYE A;  1TUG B;  1D3B A;  3JCM f;  4DA4 A;  4C8Q A;  1XTD A;  2DK3 A;  3RKW A; 
#chains in the Genus database with same CATH homology
 2G3R A;  4KUI A;  2V8I A;  4VUB A;  4ELY C;  3VUB A;  2MAM A;  4LDY A;  5LJ5 e;  4HCC A;  1QVF A;  2RHX A;  1LNX A;  2XDD A;  4ZTF A;  1UGQ B;  3HKS A;  4JRK A;  2ZPF B;  1M1F A;  2X4J A;  4JDS A;  2FYK A;  3JCM Q;  3S3M A;  1UGP B;  2E65 A;  1Q7Y U;  3A8H B;  4ME7 A;  4M78 C;  1B34 A;  2E1H A;  1K73 U;  2EKO A;  1G3W A;  4RCB A;  3X26 B;  1S72 A;  2ZPB B;  5HY6 A;  4PJO G;  4M78 D;  2FB7 A;  4QVC A;  4C0Z A;  2RM4 A;  4FT2 A;  1KD1 U;  1YIJ A;  2RHY A;  3EAE A;  3TEE A;  4IUT A;  1VQ6 A;  2XDP A;  5GAN 6;  5GAO n;  1OZ3 A;  4GLK A;  3OYI A;  2KAF A;  3JAM E;  3CPF A;  2CZ1 B;  3V7R A;  3HHT B;  2DXT A;  2DTO A;  2HD0 A;  2P0P A;  1XOV A;  2PQW A;  2RI5 A;  3MP6 A;  2EYQ A;  3QDR B;  1M4Z A;  2LQ8 A;  2E12 A;  5FU6 C;  4R56 A;  2GCX A;  3CC7 A;  2BUD A;  3M4Y A;  5DM7 R;  3CCM T;  3PTA A;  2XU8 A;  4OB3 B;  3H8Z A;  1NPP A;  3OYY A;  4M75 G;  3JCM e;  4ZGE B;  4M7D C;  2QQS A;  4DOV A;  1NZ9 A;  5CKH A;  2E41 A;  1BIA A;  3JCM d;  1YIJ T;  1K9M U;  3OMC A;  4M77 D;  4QW2 A;  1W2B S;  1VQM A;  1O75 A;  4OVA A;  2EWN A;  3HP9 A;  4IUU A;  1IRE B;  2DIQ A;  2EJ9 A;  2L8D A;  3CCS T;  1K73 C;  4BE1 A;  5GAN h;  5J26 A;  5LJ3 h;  2A3L A;  3NTK A;  3G7Z A;  2FVU A;  4J7I A;  2ZZD A;  3T9N A;  5FLX E;  3KXT A;  3CPW S;  4V2S A;  4XTW A;  3FRN A;  3G4S A;  2QA4 T;  4LDX A;  4HCB A;  3QSU A;  2XK0 A;  4JS4 A;  1NJI C;  1D3B B;  4C92 D;  3CD6 A;  1N9S A;  5HK3 A;  1I4K 1;  3OYF A;  3CC4 A;  1YJN T;  2RHU A;  3E1S A;  3GP8 A;  2EFI A;  3J80 E;  3ASK A;  5GAN 8;  2DJZ A;  3M55 A;  2R5M A;  3E19 A;  3M59 A;  5GAN 4;  1OYX A;  2F69 A;  3MEA A;  5IAY A;  4OGC A;  3RER A;  2NLU A;  3GF5 A;  3NFC A;  2DZC A;  2X4W A;  1UB4 A;  2E10 A;  3P8D A;  4BI3 A;  3JB9 H;  4F7U E;  1WJQ A;  3GIB A;  4M7A C;  3MCA B;  1U1T A;  3VU3 C;  3C12 A;  3L2U A;  2QQR A;  1N8R U;  3OYL A;  2P4T A;  3JSC A;  2LX9 A;  1BI1 A;  3MP8 A;  2P0K A;  3QJY A;  1KHI A;  5CIU A;  5KE2 A;  4J7F A;  2DKG A;  4M78 F;  4N0A C;  3BY7 A;  3V8K A;  1RL2 A;  2DXU A;  3VYH B;  5GAN 2;  5EG2 A;  4RG8 A;  1U1S A;  4PJO D;  4QQD A;  2LTO A;  1ZQ1 A;  3G6E A;  1MGQ A;  4C8Q C;  4ZGD B;  1VQ4 A;  5M9O A;  2XKO C;  2JOY A;  2M1H A;  1VQ4 T;  4F7U G;  4OP0 A;  4C8Q F;  3A8G B;  3F70 A;  1ZHI A;  5KH6 A;  4NL3 A;  1Q82 U;  5FRN A;  1YIT T;  3QO3 A;  2A7Y A;  4MML A;  5HKC A;  1VQN A;  2LDM A;  2GF7 A;  1LJO A;  3E9G A;  4E7K A;  1BI0 A;  2IVW A;  5LJ3 f;  2I2L A;  3I55 T;  1M90 U;  4C5G A;  1K8A C;  4JJN K;  3AHU A;  2CZ7 B;  3HFO A;  4LDW A;  3CCV T;  1VQO T;  3M53 A;  2F5T X;  5GAN e;  3ME9 A;  1M1G A;  3SDZ A;  4RMO A;  4M7D E;  2CKK A;  3PGG A;  1PSE A;  3ZFJ A;  5DLO A;  1KQ2 A;  4M77 G;  4D6W A;  5I2S A;  3FDR A;  2K4Y A;  2GQV A;  5FRO A;  2E6N A;  4M75 E;  4PJO C;  4XU2 A;  1BI2 A;  4F7U F;  5CKD A;  4LD9 K;  3V8J A;  2M9U A;  3OYG A;  3LW5 E;  1VQ7 A;  1VUB A;  5LJ5 g;  5LJ3 d;  4MMK A;  4Z02 A;  2KY9 A;  3M58 A;  4FSX A;  3CXC A;  1G3S A;  4ZTJ A;  2JZ2 A;  3S6W A;  3OS2 A;  3FIF A;  3URG A;  4C92 F;  4R55 A;  3CCE A;  1VQ5 T;  2K5F A;  5D6W A;  1Q81 C;  4KUD K;  5CQX A;  1VQK A;  3OW2 A;  2HQE A;  3Q1J A;  4RKU E;  2QEX A;  4MZP A;  4C5H A;  4ZN3 A;  3TCJ A;  3L2Q A;  1NJI U;  3MEW A;  1G3Y A;  1YHQ A;  3DB3 A;  5I2M A;  2DO3 A;  5CQY A;  1FXX A;  2LT1 A;  2Y90 A;  2ZPG B;  4BDY A;  2D9T A;  3OYK A;  2K3Y A;  1BIB A;  2MWO A;  4UC4 A;  2RD1 A;  1B34 B;  2QXF A;  2YLB A;  2OTJ T;  2OTJ A;  3GLX A;  3L2R A;  2EQU A;  1AHJ B;  2LC4 A;  3M54 A;  3SB2 A;  1O9S A;  2GFU A;  3OQ5 A;  3P8B B;  4O5V A;  1VQ9 T;  3CCJ T;  3LGL A;  4OB0 B;  2RB6 A;  2O01 E;  4Y28 E;  4EMG A;  4PJO F;  1BKB A;  3WVE B;  5J39 A;  4KBM B;  3OYM A;  3CME T;  4E7L A;  3CD6 T;  1KQS A;  1Y96 A;  3JCM W;  2YHT A;  4N4G A;  3ZBD A;  5IN1 A;  3CC2 T;  2X4X A;  3CC2 A;  4N4H A;  4M75 F;  4XU1 A;  2RHI A;  4WF2 A;  2RHZ A;  2VYT A;  4C0D B;  3OBY A;  3L1A A;  5GAO m;  4F7U B;  4XTX A;  2DXB A;  4J83 A;  1WJS A;  2CS7 A;  2EQK A;  2MI6 A;  4IUR A;  2V8J A;  1GXI E;  2LCL A;  3EFR A;  1Q86 U;  5LJ5 h;  1U8R A;  2QTX A;  4C92 E;  1QVG A;  3HL8 A;  3CC7 T;  1G5V A;  3LX7 A;  3RKY A;  3C4S A;  1KD1 C;  2D0Q B;  1NPR A;  3LYI A;  3JCM J;  1TH7 A;  4M7D A;  1X6O A;  2VGM A;  4QQ6 A;  3JB9 F;  1W4S A;  2F5K A;  3V8L A;  4C5E A;  2XG8 D;  2KQW A;  1MHN A;  1VQL A;  2WSF E;  4N0A A;  5GAN 3;  3LH0 A;  3OSV A;  2L89 A;  1KC8 U;  4C92 C;  4GY5 A;  1R8O B;  4JRQ A;  5GAN f;  4C8Q G;  5LJ3 e;  4NL2 A;  2OTL T;  3OS1 A;  5CAI A;  3M57 A;  3VYG A;  4F7U A;  3OBW A;  2QI2 A;  3MO8 A;  4E7H A;  4L5G A;  2E6Z A;  3RMQ A;  4KUL A;  4C8Q D;  3JCM X;  4OB2 B;  1M9S A;  3G71 T;  4PJO E;  3CXC S;  3LGF A;  4M77 A;  3G71 A;  5CKB A;  3RUX A;  2EQJ A;  2X4Y A;  4EMK C;  2PUK B;  2HNI A;  3E9F A;  3GPL A;  4DOW A;  2ZPH B;  4MDW A;  4M75 B;  2WSC E;  2XI9 A;  3J7A F;  4JRP A;  4JS5 A;  5GAO r;  1VQO A;  1VQ9 A;  4JRI A;  1YJW T;  3DB4 A;  2DTH A;  1RI0 A;  5LJ3 g;  2OTL A;  1WQ7 A;  2JTM A;  3LLR A;  1UEB A;  4PLI A;  3GNG A;  2K5I A;  5C0M A;  2ZPE B;  3S3N A;  3MP1 A;  3CCR T;  3HRS A;  3G4S T;  2QA4 A;  2BIV A;  1YIT A;  4M7A A;  3RKW A;  3VUZ A;  4QVD A;  2QDY B;  3QBY A;  4J6Y A;  2K3X A;  2DZ9 A;  4A4H A;  4CI0 C;  4II1 A;  3RMS A;  5D6X A;  2K57 A;  3C94 A;  4M78 G;  3SWN A;  1M90 C;  2VV5 A;  3OSS C;  4A4K A;  5GAN j;  4P5N A;  4M75 A;  1I5L A;  3JCM P;  2RJF A;  5GAN 7;  1BI3 A;  1HXD A;  5CKE A;  3DLL A;  3CCV A;  4MDX A;  2EIF A;  2KSS A;  2HAX A;  2ZCF B;  2V8K A;  5GMK h;  4C0F A;  3GNF B;  3QII A;  4XK8 E;  2RH2 A;  2QQ9 A;  4NOY A;  5A0L A;  3ZEH A;  3QPH A;  3X24 B;  3M56 A;  3OA6 A;  4L6V 5;  4C0G A;  2D6F A;  5LJ5 j;  1FWZ A;  4M7D F;  2RK2 A;  3A5Z B;  3CPW A;  1W2B A;  1LOJ A;  3WXM B;  3CCU T;  5LL6 S;  4BUG A;  3CBM A;  2CYZ B;  5D6Y A;  3JCM h;  2KDS A;  4EDU A;  3LWI A;  5LJ5 d;  4HT8 A;  1KC8 C;  5GAN g;  1XQH A;  2JVV A;  5FU7 B;  3G6E T;  4BI4 A;  4EPC A;  3JB9 D;  4HKE A;  1Q7Y C;  4LD6 A;  5A0D A;  4IKF A;  3FB9 A;  2EJG A;  1VQK T;  1WGS A;  4PL6 A;  2DVE A;  2RK1 A;  3VJP A;  4JLG A;  2LRQ A;  4BI8 B;  4EMK B;  3GOX A;  2LNV A;  4PNO A;  2WSE E;  4C8Q B;  4PJO A;  1Q86 C;  3CBP A;  4M77 E;  5CKF A;  4HCZ A;  4B9W A;  3OS5 A;  5LJ3 j;  1YJ9 A;  5GMK i;  4M75 D;  2MF2 A;  5KCO A;  3OYH A;  4MZM A;  2O4X B;  4BD3 A;  5GMK e;  2M16 A;  5AYF A;  2XDB A;  3ER0 A;  1PSF A;  2K5L A;  2KMT A;  2VXF A;  3CCE T;  4LDU A;  3WVD B;  3PFS A;  1NE8 A;  2QEX T;  4ZGJ B;  1VQN T;  4QQG A;  5L8R E;  2L5Q A;  4E7J A;  3CCQ A;  3JCM V;  1JB0 E;  4C5I A;  2DIG A;  2R57 A;  3OS0 A;  3RIR A;  3SFM A;  2IG0 A;  4M7A F;  3JCM b;  1QVP A;  2XIC A;  1M1K U;  4N4I A;  3HPW A;  5DY9 A;  1ZBX A;  2DTI A;  1VQP A;  2PVG B;  3HRU A;  4PJO B;  4A54 A;  3BDL A;  4BE2 A;  4C92 A;  4M77 B;  2LQK A;  3PT9 A;  2BKD N;  3S3O A;  4JLI A;  2LVM A;  4RCC A;  3JCM c;  3MET A;  4FU6 A;  2DPP B;  5LJ5 f;  1OZ2 A;  3DLM A;  5GMK m;  5I21 A;  5GAO q;  1K8A U;  1VQ8 A;  4FIB A;  1KHC A;  3O8V A;  5GAM j;  3JB9 I;  1JJ2 A;  2MMP A;  3OY9 A;  3RES A;  4BE0 A;  3BW1 A;  3A8M B;  2M0O A;  5GAO p;  3I56 T;  3JRZ A;  3CCQ T;  4OMF B;  1FX7 A;  2EAY A;  4EMK A;  3QZ9 B;  1V29 B;  2JUF A;  2DEQ A;  1I8F A;  3UT1 A;  3I55 A;  4HT9 A;  1YI2 A;  2PVD B;  2E70 A;  4J6X A;  5FU6 B;  3OYA A;  3JB9 J;  4M7D D;  1H3Z A;  3QYG B;  4OF1 A;  3A8L B;  4A4F A;  3OYC A;  1M8V A;  2PUO B;  5KCH A;  4E47 A;  4M78 A;  2XD0 A;  2O4X A;  2H3J A;  2LT4 A;  2FL7 A;  1X01 A;  1YJW A;  4M7D B;  2DD5 A;  4IUP A;  4PLL A;  3CCS A;  4TVR A;  4XU3 A;  2RA2 A;  3L2W A;  5FRM A;  2LCC A;  1P92 A;  3NTH A;  4ELZ C;  4BDZ A;  3HSB A;  1JRI A;  2AHJ B;  3CCJ A;  5A0G A;  4FL6 A;  1KQS S;  2DD4 A;  4YTL A;  3MHX A;  1I81 A;  1EIF A;  3OYJ A;  5GAO l;  3CCU A;  1N8R C;  3OYD A;  5CO7 A;  3JCM g;  2VC8 A;  5GAM d;  2QQB A;  3FEO A;  2JN0 A;  2E5Q A;  3QG1 A;  3SWN C;  3JB9 G;  2RJC A;  1Y07 A;  1YI2 T;  1WPY A;  5GAM e;  3HRT A;  4C0D C;  1KQ1 A;  5CK9 A;  1XNI A;  4ZN1 A;  1BYM A;  3BFM A;  3OW2 S;  2Y4X A;  3INZ A;  5GAN d;  1Y96 B;  2R5A A;  3QJ6 A;  1IZ6 A;  3DKM A;  2R58 A;  2B8A A;  2JNG A;  2XHC A;  3SD4 A;  4BY6 C;  1YBY A;  3CC4 T;  5A2Q E;  1G3T A;  1SSF A;  3A8O B;  4JUV A;  1VQ6 T;  4M77 C;  4NS5 A;  3M4G A;  2OAU A;  4Q5W A;  4X9D A;  2HQX A;  2VXE A;  4BB7 A;  3L2V A;  1H64 1;  1YJN A;  5KE3 A;  1VIF A;  4M7A D;  5GAM g;  1M1K C;  5C6S A;  4HA8 A;  4XAX B;  4XTV A;  4C92 B;  1UGS B;  4M7A B;  2K2V A;  4J5Y A;  3CCM A;  2XID A;  2YRV A;  1WJR A;  3N5B B;  4XTY A;  3PIO A;  2YLC A;  5GMK l;  1VQM T;  2MWP A;  3RKX A;  3CCR A;  1K9M C;  3L42 A;  3CMA A;  4XU0 A;  4FM4 B;  1UGR B;  3H6Z A;  3TU4 K;  3TRE A;  3EFS A;  4EMH A;  3QXE B;  5J3B A;  1YCY A;  2P0Q A;  2Y4Y A;  2PVO B;  4BAC A;  3CCL T;  1JBM A;  4M78 E;  3QHS A;  3L2Z A;  4LDV A;  5GAM f;  4M75 C;  1Q81 U;  3HFN A;  5DLQ E;  4DQ2 A;  2EQM A;  4XTZ A;  1QW1 A;  3KUF A;  3X25 B;  4XQ3 A;  1WQW A;  4CRI A;  4IUV A;  3CME A;  3SWN B;  5GAN 5;  1VQL T;  1QVF S;  3PIP A;  4M7D G;  1YJ9 T;  4C8Q E;  1QVG S;  5GMK j;  1M5Q 1;  2E64 A;  1QP3 A;  5CVI A;  3M5A A;  2ZPI B;  3X28 B;  5IT9 E;  4MZT A;  3FC3 A;  3PNW C;  1VIE A;  2WAC A;  2DXC A;  4OB1 B;  4BY6 B;  2HBP A;  3QUI A;  3UPU A;  4IUQ A;  4OGE A;  3UWN A;  4A4E A;  4M78 B;  3MEV A;  5CCA A;  4L59 A;  1S72 T;  4ATO A;  1N6A A;  1DJ7 B;  3P8H A;  1Y71 A;  1YHQ T;  3I56 A;  2RJE A;  4XTU A;  2VUB A;  1X75 C;  3OYB A;  3V7S A;  2RI2 A;  3MEU A;  3UDC A;  4J6W A;  3VV0 A;  3QZ5 B;  1QP2 A;  1VQ5 A;  2EJF A;  3C95 A;  1VQP T;  2FHD A;  2RJD A;  3QKJ A;  2CGH A;  4KT0 E;  3CEY A;  5HK0 A;  4Y91 A;  2CZ6 B;  5CR2 A;  1Y7X A;  1JJ2 S;  1KG1 A;  3CCL A;  1VQ8 T;  5FU7 C;  1HK9 A;  1N27 A;  3FJP A;  4M77 F;  3QYH B;  4PKC C;  4B9X A;  3OMG A;  2L3R A;  4J8O A;  2PU9 B;  4QVZ A;  4O6J A;  2RO0 A;  1WNL A;  2DAQ A;  3OYN A;  1OI1 A;  4C92 G;  4X34 A;  2KK4 A;  3PMT A;  4A4G A;  3CBO A;  4E7I A;  5GAM h;  4M7A G;  3NTI A;  4X9C A;  2RI3 A;  3FLG A;  2CZ0 B;  1VQ7 T;  2C06 A;  2ZGW A;  2JTF A;  2VGN A;  4RG2 A;  3X20 B;  2QQA A;  3R6O A;  3V7C A;  4A53 A;  3OYE A;  1Q82 C;  1D3B A;  3JCM f;  3VKI A;  4DA4 A;  2X35 A;  4C8Q A;  3KBG A;  3J81 E;  3BDU A;  4M7A E;  2GFA A;  1XTD A;  2DK3 A;  3OB9 A;  3LWH A;  2KVQ G;  3CMA T;  1N9R A;  4FT4 A;  3M9Q A;  3PMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...