1Y96A

Crystal structure of the gemin6/gemin7 heterodimer from the human smn complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Gemin6-Gemin7 Heterodimer from the Survival of Motor Neurons Complex Has an Sm Protein-like Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Gem-associated protein 6
total genus 19
structure length 86
sequence length 86
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y96A00
5GAOn 3EFSA 4EMGA 3JCMb 4MMKA 4JRIA 3FJPA 4X9DA 3JCMd 1D3BA 1N9SA 1H641 3BY7A 4EMKA 4C92C 4PNOA 3JCMJ 1I5LA 5LJ3d 4XTVA 2E1HA 4XU3A 2DZ9A 4Y91A 5GANe 2EJ9A 5GAOm 4N0AA 4M77A 2DKGA 4NL2A 4M78F 2Y90A 4QVDA 4XU1A 3JCMh 4C92G 5GAN5 1D3BB 5GAN8 5LJ5g 4EMKB 4RCCA 2YLCA 3L2ZA 5LJ3e 5GAMf 3V7RA 1WQWA 1WQ7A 4A54A 5GMKe 4M7AE 3EFRA 2DVEA 2FYKA 5LJ3j 3JB9D 2E65A 4M77B 3L1AA 2FB7A 4N0AC 3SWNA 3BW1A 1B34B 3RKXA 4M7DG 3GIBA 4M78B 4PJOD 5GMKi 4M7AD 3SB2A 4F7UF 2VXFA 5LJ5j 4M75B 5GAN4 4C92A 3JCMc 1YCYA 1WPYA 2DEQA 3V8JA 1MGQA 1KQ2A 1BIAA 5DY9A 5GAOq 2E41A 4J6YA 2YLBA 4OP0A 5LJ3f 5GMKm 4NL3A 4HT8A 4M7AG 4PJOA 4M77E 5GAMg 1JBMA 4M7AB 3FB9A 2DTIA 4XU0A 5GAMh 4EMKC 4M77G 4M75A 2RA2A 4PJOG 4C92F 1HXDA 2I2LA 4C8QD 4C8QC 3RESA 5GAMd 3HSBA 2DXUA 4M7DE 4C8QF 4M7DA 4M78A 1BIBA 4M7AF 1I8FA 4XU2A 4XTWA 5GAN6 5GMKh 1Y96A 2JN0A 4M75G 3JCMQ 4XTUA 5GMKl 4HA8A 3VU3C 1JRIA 3QSUA 4F7UG 2RB6A 4M75E 5GAOr 2CGHA 4M75F 3JB9J 3JB9G 3FIFA 3JCMg 3M4GA 4M78E 2E10A 5GANf 5GAN7 3AHUA 3RIRA 3HFOA 3JB9I 5I21A 5LJ5h 4XQ3A 3SWNB 5GAMj 4C8QA 2ZGWA 4M7DF 4M7AC 4PJOE 5LJ5d 1N9RA 4F7UA 4PJOC 4V2SA 2DTHA 2EWNA 3INZA 4NOYA 4F7UE 3JCMP 4JRKA 2QTXA 1X01A 4JUVA 4J6XA 5GAMe 5GANj 2RD1A 4MMLA 1I81A 3JCMX 1LJOA 2EJGA 4A53A 5CAIA 5GAOp 4JLIA 3BDUA 3BFMA 3V7CA 4DQ2A 4C8QB 5LJ3g 3JB9H 1I4K1 3V7SA 1LOJA 3JB9F 4X9CA 2DTOA 4M7DB 1LNXA 3JCMW 3RERA 3JCMf 5GANg 5GAN2 1Y96B 2VXEA 1M5Q1 2K57A 1U1TA 3QO3A 5GMKj 2YHTA 3SWNC 3JCMV 5GANd 4HT9A 4M7AA 4C92D 2DZCA 4C8QE 1KQ1A 1WNLA 3RKWA 3V8KA 3HFNA 4PJOF 5LJ5e 3JCMe 4C92E 4C8QG 1U1SA 5GAN3 5LJ3h 4RCBA 4M7DD 2DXTA 4QVCA 4M78D 5GAOl 3PGGA 3QUIA 2DJZA 3QHSA 4J5YA 4F7UB 1B34A 3RKYA 4C92B 4M75D 4M77D 4J6WA 4M75C 4M77C 2VC8A 4XTYA 1TH7A 4EMHA 4M77F 4WF2A 3V8LA 1HK9A 4M78C 3RUXA 4PJOB 2EJFA 4M78G 5LJ5f 4M7DC 5GANh 2E64A 2HNIA 4XTZA 4XTXA 1M8VA 2RM4A 2EAYA
chains in the Genus database with same CATH superfamily
2GFUA 3M0TA 2A36A 3VS1A 1H641 3VJPA 4C92C 3SHWA 1Y71A 4Y91A 1XOVA 4KGXB 3EFOA 1AT1B 2EGAA 5D6WA 3DLMA 3G6EQ 1TG0A 2K6DA 4GLMA 1K0XA 2DBKA 3VYHB 2XMFA 2V8IA 1X2KA 3V7RA 1WQWA 1VQ5Q 4M7DG 3RKXA 4KBMB 1T3LA 2EQUA 1UEBA 4RTYA 2D8JA 1SSHA 4PJOA 4RTVA 2QG9B 4PLIA 2BUDA 2YRDA 2QDLA 5GAMh 3CCJT 2LQ8A 2CP3A 2EIFA 2AT1B 1G2BA 3THKA 2OX7A 4RTXA 2E70A 4IUQA 4KULA 3Q1JA 1ZSZA 1ZA1B 4C8QF 2ROTA 1UGRB 3M55A 3BE3A 4MDXA 4XTWA 2D1XA 2YUPA 2JVVA 1QVFS 4HCBA 1JRIA 5GANf 4A4EA 3G71Q 3OMGA 5L8RE 3QDRB 4JRKA 2ENMA 4PJMA 1GBQA 4A53A 1YI2Q 2GBQA 2K2VA 1VQ4Q 2RQWA 2DO3A 1MNDA 1UGSB 2DTOA 2K5IA 4LUEA 2K57A 1FWZA 3CMAQ 5KCOA 1KC8C 4M7AA 2NLUA 4ANJA 2FPEA 2A28A 1NLPC 1TOVA 2FPFA 3CXCS 1PD0A 3JCMP 1VQLT 1W4SA 1AVZC 2MCNA 5LJ5f 1ACMB 1SRMA 2CP5A 2RPNA 2RM4A 1YIJT 2OAWA 2GCXA 5LJ3d 1OV3A 2DL4A 2I0NA 4M77A 2WSCE 1YJNA 1RABB 2D6FA 2QQ9A 2LNHB 3H8ZA 2DM1A 3OS1A 4PK4A 2EQMA 1FMKA 1WQ7A 2F2XA 5CKHA 3REBB 2QI2A 4LDWA 3MCAB 4M77B 4N0AC 2ED1A 1Y57A 1T0JA 4M7AD 1O75A 1I1JA 3X24B 3V8JA 5IHKA 3TEEA 1RAEB 2EYZA 1ZQ1A 2JW4A 3HHTB 2E12A 1SPKA 2K7AA 3SEMA 3EH1A 1K9MR 2IPOB 5CQXA 1JB0E 2FRYA 2QYZA 2NUTA 3OYHA 2GQVA 2W10A 3I56T 2FL7A 1QVFP 2JUFA 2K3XA 3C4SA 4F7UG 2ATCB 1OX9A 4LD9K 3HL8A 5LJ5d 1JXOA 4FCYA 4WCIA 1UFFA 5I22A 3CC4A 4NOYA 4ORZA 1M1KC 2MMPA 2MIOA 2SEMA 1ZBXA 1OYXA 3CCST 2RJEA 5DLOA 2NUPA 5HK0A 4OB0B 2VXEA 3VRZA 1X69A 4QKUA 2D9TA 2AHJB 2HL3A 2DZCA 2CP0A 4KRTA 4OMQA 4PJOF 1ZBJA 5LJ5e 2QA4A 3I56A 1VUBA 2LQWA 4JRPA 4RCBA 3G4SA 1YHQQ 2DYBA 3A8HB 3PGGA 2AZSA 1PWTA 1B34A 2W0ZA 4M77D 4M75C 3VUBA 1C6VX 2PZ1A 1WJRA 1WHJA 2XD0A 2DLPA 5CR2A 2RO0A 3OY9A 1PM3A 2DXBA 4EMGA 4OMLA 2KDSA 4LUDA 4HCCA 1N9SA 1GCPA 1I5LA 1G8XA 2R5AA 2RI3A 4HVWA 2DERA 1WXBA 5AYFA 1G83A 4A63B 4CC4B 1D3BB 2M51A 4O6JA 2PNIA 2XICA 3TU4K 1YJ9Q 3GIBA 2RI5A 4PKCC 1YITQ 3CCLT 2QA4Q 3ULRB 5KCHA 2E5KA 3IQLA 1OPLA 1QCFA 3LGFA 3P8BB 3WVDB 3AT1B 4AFSC 1K8AR 2DRMA 3ZBDA 3L2RA 3H0HA 2DBMA 4J7FA 5GAMd 3PMIA 2PVDB 2LQKA 2BZXA 2YRVA 2O01E 4J9EA 4OF1A 2FRWA 2LDMA 2ED0A 3VU3C 3M4YA 2WSEE 4NS5A 3JB9G 2QQSA 4J9GA 1QP2A 2Y4YA 3HFOA 3NMZC 4XQ3A 5GAMj 2HDAA 3ZL7C 4E47A 3SDZA 5FU7B 4ZTJA 1ZA2B 3C12A 2BKDN 1S72Q 2YWWA 3CPWS 5LJ3g 1VQ7A 2QEXT 2IG0A 1NJIC 2EKHA 3CCVA 4C8QE 1R77A 3DB4A 4LN2A 4RG8A 5FRMA 4JZ3A 1XNIA 1VQNA 1WFWA 2HSPA 3OYEA 3VS4A 3JCMX 4UC4A 1TUCA 4F14A 4C92B 1QVGP 5HKCA 1JXMA 2RHIA 1AZGB 4M7DC 1ARKA 4XTZA 1GRIA 1TSFA 3L2UA 5GJWB 4JRIA 2RMOA 2BTTA 4X9DA 1VQLA 3QPHA 1ZUUA 1GXIE 7AT1B 4M78F 1B3QA 3H41A 3I9QA 1VYVA 3GNGA 1K4US 2K79A 2YUOA 3OW2S 2EPDA 1WDXA 1UHFA 3FLGA 3EFRA 3OYNA 5IT9E 3CCEA 1ZUYA 2LZ6B 2D0QB 5J26A 2GTJA 4K11A 3PTAA 1TXQA 2J6FA 1YCYA 3QIIA 1KK7A 3CCQQ 3X25B 4PJJA 3CMAA 1KQSA 2DTIA 4HXJA 3OYMA 3C0CA 1VOMA 3MP6A 3VS0A 1RAIB 2DXUA 1IRXA 1I8FA 3A5ZB 2JXBA 1QWFA 3EG1A 1D1CA 1I5OB 1Q82R 2QA4T 5FW9A 4E7IA 3CCLQ 1NEBA 1G3WA 5KYYB 3TQ7P 3TSZA 1KHIA 4C8QA 2F5TX 4M7AC 1WXTA 1AD5A 1F1BB 4Y28E 1Q7YU 1QVGA 1VQOA 1IGQA 4TVRA 4PFOA 3CBPA 3CC2T 2BZYA 4C8QB 3DKMA 1LOJA 4FSSA 5CKEA 3EG0A 3A8OB 1N6AA 4ZN1A 1BKBA 1Q7YC 3QO3A 3OW2P 1M2VA 1R8OB 4QT7A 1VQ8A 1WNLA 2RK2A 2ZPHB 2RF0A 5GAN3 5LJ3h 2X9HA 4M78D 2KYMA 1K0SA 1AWXA 2DJZA 3J7AF 4EMHA 3LGLA 4EPCA 1YWPA 3M53A 4XTXA 5GJVB 1LVKA 4N4GA 1WIEA 1NJIU 4HCZA 4C0FA 3JCMd 2OTLT 2DZ9A 3VS3A 2E3HA 4AT1B 5GAOm 1KQSP 1RL2A 2XHCA 4OMNA 4C0ZA 4ELYC 3A98A 5KE3A 3S6WA 2RJFA 3G71A 4RCCA 2CKKA 1HSQA 2H3JA 2HQHA 2P4RA 1Q81U 2MPXC 2PTKA 2CUDA 6AT1B 5CVIA 1M1KU 5KE2A 1FXXA 3CPWP 2VASA 4HVUA 4BE0A 1Q82U 4HT8A 1Q95G 5CKBA 1VQMT 2LCCA 2EYQA 1JBMA 2HKNA 4M7AB 1YITA 1VQLQ 5HY6A 4IUPA 3M0QA 4IIMA 3I55A 1SKUB 4M7DA 4XU2A 2A3LA 1DJ7B 2LJ0A 4Z88A 4JS5A 4M75E 2CGHA 2LCLA 4Q5WA 2D0NA 2E10A 3CCMT 1VQ4T 1CKAA 2CDTA 3HP9A 1AEYA 2PU9B 4FT4A 3CCQA 1BCOA 4JUVA 1VQ7Q 1WJSA 1KC8U 2EJGA 5CAIA 5GAOp 3OYYA 2MYSA 4RKUE 2QTVA 2E6ZA 3EH2A 3JB9H 3RDVA 4EDUA 1M90C 3CCVT 1KG1A 3E2UA 3JCMW 3FEOA 3SWNC 3EG3A 3X28B 2X4XA 3OYKA 3NTIA 4WTOB 2QASA 2YRCA 4MZTA 1TUDA 5C0MA 2RHUA 1M4ZA 4C5EA 4WF2A 1M1FA 4M78G 5CK9A 2V8JA 3E9GA 2MWOA 1AWOA 2QK0A 4LDVA 3CCJA 3JCMJ 1ZUKA 5J3BA 1X27A 1D0ZA 4GY5A 1VQ7T 5C6SA 3JCMh 1Y07A 1YBYA 1YJWA 3PVLA 3BDLA 2HCKA 2P4TA 3OMCA 3G71T 5LJ5j 4FIBA 1Q86R 2C0IA 4BDZA 4OGCA 3I56Q 2CSQA 1R0BG 3UDCA 4F17A 4IURA 4LDUA 5FWCA 1HYOA 1UB4A 1H3HA 1O9SA 1VYTA 1S1NA 4BE2A 1YHQT 3FC3A 4C8QC 1K8AU 2F2WA 3OSVA 5GMKh 2C0OA 3G4SQ 2J6OA 1TU0B 4FSXA 1W70A 1QCNA 5GAOr 3MP1A 2DIGA 3O8VA 1K9AA 3JCMg 1OX8A 4N4IA 2KMTA 1H3ZA 4F7UA 3OYFA 3QZ9B 3INZA 1NM7A 1SHGA 4J9BA 1WXUA 2GF7A 1BYMA 2ROLA 1VQKA 5IHIA 3EGUA 4A4HA 1AWJA 2NUTB 1YIJQ 1LNXA 2XDPA 1W6XA 2EGCA 1U1TA 3GOXA 2YHTA 3JCMV 4DBFA 4HT9A 3TVTA 2LT1A 3ME9A 3RKWA 1U8RA 3CPFA 2IVWA 2J7IA 1UGPB 2MI6A 3M58A 5GAOl 2DNUA 5HK3A 2DEUA 3RKYA 3RR6A 1UUEA 3KXTA 3PVQA 2K5FA 1HD3A 4OMPA 2RH2A 3GBQA 5GAOn 4DOWA 2X4WA 3C95A 1VQ9Q 2J6KA 3L2VA 2F2VA 2EJ9A 4X1VA 3UATA 3EGXB 2JMCA 4KUDK 5CIUA 3MEWA 3FDRA 3LW5E 2COWA 2DL8A 4M7AE 2E65A 3VS2A 2FB7A 4J7IA 1B34B 4CI0C 2KXDA 4FL6A 4L6V5 1M2VB 1E6GA 4MZMA 1VIFA 3GPLA 1MGQA 2B8AA 5GAOq 4NL3A 5LJ3f 4M7AG 1RADB 2NYSA 2FEIA 4JLGA 3LH5A 3QJYA 5M9OA 3EG9B 2KRMA 1OZ3A 2D8HA 2RJCA 2KR3A 1T0HA 1ABQA 4AG1C 1Y96A 1EZZB 3I55Q 1YI2A 4JJBA 1AZEA 5A0GA 2LX7A 4PFPA 5KH6A 2KSSA 2JMAA 4ZNXA 2COYA 1JQQA 4BACA 2KY9A 2YXYA 3M0PA 2L0AA 1MV0B 2RI2A 4QW2A 2HEQA 2VGNA 2EW3A 1UJ0A 2EYXA 1MNEA 9ATCB 1VQKT 3JRZA 4E7ZA 1NBEB 2X35A 3WVEB 3VYGA 3J80E 3QHSA 1FMWA 3P8DA 2A37A 1X6OA 8AT1B 1VQPA 3OSSC 4RMOA 2EAYA 1VQPQ 4AFQC 1SSFA 3QDFA 3RMQA 1QVGS 1K9MC 2HD0A 1JU5C 2DF6A 4FYWB 4C92G 2P84A 4LE9A 4BUGA 5GAN8 4OGEA 4EMKB 1K73C 3CPWA 2RJDA 1X43A 1G5VA 2EBPA 3G6ET 5LJ3j 3SWNA 1RAFB 1VA7A 4PJOD 1PKSA 2ZAEA 1PKTA 1IHWA 4PLLA 2VXFA 4M75B 1KQSS 2KRSA 1IO6A 1WHKA 2K5LA 2HL5C 2DK3A 4J6YA 3CC7A 4XAXB 2JNGA 2DPPB 1PSEA 4XU0A 4CRIA 4EMKC 3VS5A 4M75A 2FHDA 3S3NA 2Y4XA 3OYAA 3UA6A 3VS7A 2KVQG 1VQ6Q 2CZ7B 4O5VA 1KD1C 1PG5B 1YITT 3QBYA 1VYUA 1BCMA 3L2WA 2DL5A 4J83A 4OMMA 1WJQA 1LCKA 3M4GA 2RN8A 1QCOA 5I21A 2AK5A 3NTHA 1K1ZA 4M7DF 4V2SA 2DIQA 1NEGA 2ZPIB 2E4HA 1XQHA 2YSQA 3C94A 1Q82C 2RQUA 2KT8A 3BDUA 1V76A 3BFMA 3V7CA 2ZPGB 1N8RR 3JB9F 2HQEA 5FROA 2O9VA 2KYBA 3MJXA 2DETA 2RNAA 2JTFA 1OI1A 2R58A 3H0FA 1IXDA 2KRNA 3M0RA 2CP6A 2YUNA 3VV0A 5D6YA 2DXTA 4QVCA 1Q81R 3R6OA 4XTYA 1RLPC 1Q7YR 4J9IA 4DBQA 1AHJB 2EFIA 2FZCB 2CZ1B 1TS9A 3QJ6A 5KYUA 3MEVA 4QQGA 1UTIA 2ECZA 4F16A 4PNOA 2AKKA 3I55T 2KNBB 2M02A 1B07A 2KE9A 4N0AA 1OU8A 1VQ6T 2B86A 5KYUB 3VRYA 2C06A 2DJQA 5GAMf 3QG1A 3WXMB 3PIPA 3JB9D 3BW1A 3CCQT 3H6ZA 3PE0A 1MMGA 2J06A 1WPYA 5DLQE 3EGDA 2OAUA 4M77E 3CCET 2V8KA 2XKOC 3VUZA 4FT2A 3F70A 1U3OA 4LXCA 2MAMA 3OYGA 2RHZA 2VGMA 3HSBA 2V1QA 4N4HA 1D1BA 4M7AF 3R6NA 4BY6B 2L3PA 2VB6A 5KYWA 2DFUA 5L23A 2NWMA 2HBPA 4ATOA 2ESWA 3I35A 3EGXA 2KBTA 1VIEA 2PUKB 5HCKA 5LJ5h 3NGPA 2ZGWA 1I07A 1EIFA 1I81A 1LJOA 2JS2A 4JLIA 1KFZA 5A2QE 1MV3A 2HAXA 3EFOB 1RI9A 1VQMQ 3CBMA 2K2MA 2LT4A 2LJ1A 5GMKj 2VVKA 1JEGA 1WHHA 1VQOT 4C5GA 3LWHA 3PMTA 2O9SA 3HRUA 2KQWA 1U1SA 1YNZA 1ZSZC 2JTMA 3OS2A 5A0LA 1RAAB 4J8OA 1M8MA 2QDYB 5FRNA 2VC8A 4BDYA 1HK9A 4M78C 2E64A 1RAHB 4OB1B 3RNJA 5A0DA 1QKXA 2XIDA 4BI4A 3JCMb 1ZSGA 2BIVA 1UECA 4FYYB 4AFZC 1ZSZB 1WZOA 2P0QA 4E7LA 2QEXA 1FMVA 2ABLA 2DAQA 1J3TA 4XU1A 4KGZB 3M59A 2P0KA 2A0FB 1GFCA 2DL7A 2DVEA 3PFSA 3L1AA 3CCMA 2KAFA 4Z8AA 1WLPB 4IUTA 3ZFJA 4CC7A 4ZGJB 1YJWT 3KBGA 2L3RA 2L3QA 2EYWA 3D7SB 5DY9A 4HCKA 2X3XD 4R0KA 4R55A 3MPUB 3FB9A 2FG0A 2MWPA 2KXCA 5CQYA 2LJ3A 1MMDA 1SRLA 2BE7D 1VQ9T 3QSUA 3HKSA 3REAB 3CCRA 3UF4A 3JV3A 4BI8B 1VQ8Q 4JRQA 2M9UA 1YJWQ 2P0PA 3I5RA 1OU9A 5ECAA 1IHVA 2EWNA 1W2BS 5GAMe 1PRLC 2RD1A 1M1GA 2ZCFB 3CMET 1VQOQ 1N27A 3CXCA 1I4K1 3UPUA 3CBOA 5I2MA 3A8GB 5AT1B 2WACA 3E1SA 2M16A 3HFNA 4VUBA 8ATCB 2OTJA 4M7DD 1NLOC 2FZGB 2CP2A 5KYXB 3V8LA 2M0OA 1X2QA 1OPKA 4B6MA 3JSCA 1M9SA 2CZ6B 2QQBA 4QQ6A 2BE9B 2Z0WA 1HJDA 3QXEB 1M27C 2PVOB 5D6XA 4C0GA 3G4ST 1NE8A 4E2FB 2XI9A 3MEUA 3G1JA 3OYJA 3CC2A 1K76A 2ZPEB 4DA4A 4HVVA 4JDSA 1IREB 4FYXB 1U06A 1XTDA 3A8LB 3EAEA 3META 5LJ5g 3CCEQ 2HQXA 1RI0A 3OBWA 3OYBA 2FO0A 4OMFB 1UG1A 4ZN3A 2XG8D 2OTJQ 2ZPFB 2A7YA 3MHXA 3PNWC 4BE1A 3E19A 2RHYA 2CREA 3O5ZA 4L5GA 1WX6A 1VQ9A 1M90R 2YUQA 1IB8A 3CCRT 1HXDA 1WHMA 1MHNA 3N5BB 3RESA 4PJLA 2FPDA 3CXCP 1BIBA 1YJNT 2QQAA 4XTUA 1TWBA 2EVRA 2QGGA 2LTOA 1UDLA 2BZ8A 2WSFE 1C1AA 2GNCA 3CCLA 1N9RA 3M56A 3MEAA 2DTHA 4E7JA 3CCUQ 4F7UE 1NG2A 1V1CA 2SRCA 1X01A 2VKNA 3LLRA 1AWWA 1PHTA 2J05A 1G3YA 1UGQB 4RTZA 5EG2A 2HZYA 3HRSA 3OB9A 4M7DB 4Z02A 3A8MB 2KI7A 3G6EA 2G3RA 1NPRA 1YIJA 1BK2A 2RQVA 3CC2Q 1Z9ZA 3RMSA 2HBWA 1GFDA 3LX7A 3OQ5A 2X51A 3OYLA 4J5YA 3QZ5B 4M75D 4M77C 1Q86C 3CQTA 1OZ2A 3PIOA 4M77F 2YDLA 4PJOB 2EJFA 3EGDB 3TCJA 1QVFA 1H92A 4CC3A 5GANh 3L2QA 4E7SA 1NYGA 2QQRA 3CD6Q 4AG2C 1YP5A 4X34A 2EQKA 3FRNA 4XTVA 1X6GA 2HKQB 4A4GA 2KK4A 4JPBW 4QVDA 4C5IA 3HTRA 4BY6C 5LL6S 2MF2A 2E6NA 1YJ9A 2JZ2A 1KC8R 1RUWA 2PUOB 1RLQC 3L2ZA 2KEAA 2RK1A 1N8RU 1GCQC 2LX9A 3NFCA 1D09B 4EIKA 2ZZDA 1KQ2A 2CP7A 1K73R 4C5HA 5EC7A 3KFVA 3GP8A 4OVAA 4LD6A 3TREA 4PFZA 4XK8E 4L59A 4PJOG 2I2LA 5FU6B 1M2OA 5IHNA 4DEXA 5GAN6 3NTKA 4QVZA 1KJWA 3CCMQ 4BI3A 5J39A 4CC2A 2VYTA 2OTJT 1E6HA 2QAZA 1YN8A 3FIFA 4M78E 3E9FA 3RIRA 2K3BA 4RUGA 4PJOE 2O2OA 4E6RA 1KD1R 1A0NB 5IXFA 4DOVA 2F5KA 1UE9A 2LP5A 1VQ8T 3X20B 2F69A 4FYVB 4RG2A 3PT9A 1XJWB 2E5QA 1M3AA 3SD4A 1Y0MA 1YJ9T 2LC4A 3T9NA 3CEYA 1JO8A 4JZ4A 3SFMA 4OMOA 1OEBA 3JCMe 2LCSA 4C92E 1QWEA 1G3SA 4C8QG 2GFAA 3UT1A 2IIMA 4D8DA 2LRQA 4F7UB 1SHFA 3H0IA 2VUBA 3S3MA 3QKJA 4R56A 1JJ2P 2DILA 4FW1A 3MO8A 4MMKA 1QMCA 5CKDA 5KYWB 1S72A 3FJ5A 1VQNT 2EGEA 4HKEA 4XU3A 1YHQA 1QVPA 4JJDA 1NYFA 4KUIA 2DKGA 2CH4A 3CMEQ 3MKDA 4ELZC 4AFUC 2EYYA 2K3YA 1VQMA 3LYIA 3G7ZA 3CD6A 4J9DA 5GMKe 2JOYA 2NUZA 1E7OA 2A08A 4IIOA 5GAN4 1PNJA 4C92A 2DEQA 1M3CA 2C0TA 3CCSQ 1BB9A 4Y92A 5GMKm 2YLBA 1WYXA 3HRTA 4C0DC 1MMNA 2DL3A 4B9WA 2HMAA 2CS7A 3VS6A 3A1PA 5I2SA 3URGA 2KGTA 5FLXE 4MDWA 3OBYA 1UGVA 2GTOA 2R5MA 4D8KA 4IUVA 2M1HA 4HA8A 1QW1A 2FZKB 4DBRA 2XDDA 4KT0E 1ABOA 1NZ9A 3AHUA 3X26B 1GL5A 3SWNB 2X4JA 3OYIA 1ZHIA 2V1RA 2CH4W 3NHNA 4LDXA 3EG2A 1M30A 4BB7A 3JCMf 1Y96B 5IN1A 2CT3A 4C92D 2JJ9A 4RTTA 1EX4A 1ZX6A 3LWIA 2VWFA 2DVJA 1CSKA 2DMOA 3DLLA 2K9GA 4MZPA 4FW2A 4BD3A 2HNIA 1QKWA 3EFSA 2XU8A 3HPWA 3FJPA 2AIRB 3BY7A 4EMKA 3UWNA 1UJYA 2FVUA 2H8HA 2F1LA 4NL2A 4PJNA 1C0MA 1NJIR 3JAME 2YLCA 5LJ3e 3S3OA 3UA7A 1K9MU 1WA7A 4A4KA 1EFNA 2L89A 4F7UF 2DE0X 3QWXX 5CKFA 1SG5A 3OW2A 2JS0A 2E41A 1IGUA 1KSWA 5CO7A 5GAMg 4A4FA 2DX1A 4LNPA 1YI2T 3I5SA 2KT1A 1W2BP 4IKFA 2O31A 1S72T 2KROA 1N8RC 3TSWA 4JJNK 2LVMA 2JN0A 5KYNA 3JCMQ 4ZTFA 1M1KR 2RB6A 4M75F 3ER0A 1BI3A 4JS4A 3H9NA 1Q81C 2GGRA 1U5SA 4PJOC 4KH0B 2O4XA 2QTXA 4KH1B 2RHXA 5I11A 3QYGB 1PRMC 2DRKA 1VQNQ 4X9CA 4JJCA 2RQRA 2XDBA 3CMAT 3RERA 3CCVQ 1OQKA 5GANd 1KQ1A 1MUZA 2JM9A 3CCRQ 2MOXA 1D1AA 1QP3A 1JJ2A 3RBBB 2LNVA 3QUIA 4PL6A 4J6WA 3LH0A 3GLXA 2RQTA 2AKLA 4ME7A 2EQIA 1LPLA 1KIKA 2CZ0B 2OI3A 1M3BA 2PVGB 1D3BA 2L3SA 2CUBA 2DYIA 5GANe 1GCQA 1W2BA 1KD1U 2L8DA 3EHRA 1X6BA 1M90U 3CCSA 3OYDA 1OOTA 1Y7XA 1V29B 1X75C 1YWOA 1NPPA 4E7KA 2CT4A 4A54A 5KYYA 1IZ6A 2FYKA 1MMAA 1K8AC 2QXFA 4RTUA 2M0YA 5KYXA 4KGVB 3M9QA 1PSFA 2QEXQ 1BI1A 3JCMc 1BBZA 5IAYA 2X3WD 2DA9A 1Q86U 1ZLMA 4F04B 1VQ5T 1Z9QA 1TTHB 4RTWA 4M77G 2CSIA 1B7TA 3KUFA 1WHLA 2NUPB 3P8HA 1YFNA 1UHCA 2DD5A 4J9HA 4M4ZA 4M78A 1WHGA 4D6WA 2OTLQ 4M75G 2XK0A 5GMKl 3M54A 3ASKA 2QGFB 3QYHB 1VQ5A 2JT4A 3DB3A 1RACB 4LDYA 1SF9A 4C0DB 1SEMA 2MK5A 4OB3B 2VV5A 1FYNA 3OA6A 1OULA 4ESRA 3OS0A 3U23A 4GLKA 4DBHA 2LMJA 2LQNA 4DQ2A 4FM4B 1G3TA 3CD6T 1BI0A 1N5ZA 2EQJA 4M7DE 1M5Q1 1D0XA 3CC4Q 3CMEA 1VQPT 1FX7A 3M0SA 4Z89A 2YT6A 2DD4A 3QWYA 2OTLA 4J9CA 2JM8A 2O88A 2HSEB 2R57A 4E7HA 1W1FA 1QQJA 2GQIA 1VQKQ 3J81E 2E1HA 4II1A 1YCSB 4J9FA 2Y90A 3M5AA 1PD1A 2OJ2A 3OS5A 3CCUT 1AOJA 5CCAA 2G6FX 2AZVA 5IXBA 3CC4T 4M78B 5GMKi 3SB2A 3EHQA 1TUGB 5FU6C 3OYCA 1BIAA 3M57A 4OP0A 2L2PA 1YJNQ 4OB2B 2EKOA 1JJ2S 1PCXA 2RA2A 1BU1A 4C92F 4C8QD 2JTEA 1I0CA 4GBQA 2COZA 3GF5A 4P5NA 2E3IA 2O4XB 2CYZB 2DXCA 1H8KA 1WGSA 3JB9J 2X4YA 1WI7A 5GAN7 3JB9I 2ZPBB 5DM7R 4QQDA 3MP8A 3EG9A 4FU6A 4DEYA 3CC7T 4J6XA 1K73U 5IH2A 5GANj 1P92A 4MMLA 3NPFA 2PQWA 3ZEHA 3CCJQ 4ZGEB 4IUUA 1KHCA 2H3EB 1BI2A 3V7SA 5FU7C 5FWBA 1VQ6A 5GANg 4AMCA 5GAN2 1D0YA 5D7UA 1CKBA 3CCUA 1GBRA 4B9XA 1QLYA 3V8KA 1T3SA 2K4YA 2V26A 3VKIA 3L42A 3CC7Q 3GNFB 2L5QA 1VQ4A 4YTLA 1RAGB 5GAN5 1R0CB 1TH7A 3RUXA 4ZGDB 3M0UA 1M8VA 1PC0A
chains in the Genus database with same CATH topology
2GFUA 3MO8A 2CZ1B 4MMKA 4N4GA 5CKDA 1NJIU 3QJ6A 4HCZA 4C0FA 3MEVA 3JCMd 1S72A 1H641 4QQGA 3VJPA 4C92C 4PNOA 2OTLT 1Y71A 1VQNT 4HKEA 4XU3A 2DZ9A 4Y91A 1QVPA 4ZGEB 1XOVA 3I55T 1YHQA 5GAOm 4N0AA 1VQ6T 4KUIA 2DKGA 1RL2A 5D6WA 3DLMA 2XHCA 4ELYC 4C0ZA 5KE3A 4ELZC 3S6WA 2RJFA 3G71A 4RCCA 2C06A 2CKKA 3VYHB 2V8IA 2K3YA 5GAMf 3LYIA 3QG1A 3G7ZA 3V7RA 3WXMB 1VQMA 1WQWA 5GMKe 2H3JA 2JOYA 3PIPA 3CD6A 1Q81U 3JB9D 4M7DG 3BW1A 4KBMB 3RKXA 3CCQT 3H6ZA 5CVIA 1M1KU 5KE2A 2EQUA 5GAN4 1UEBA 1FXXA 4C92A 2DEQA 1WPYA 4BE0A 1Q82U 5DLQE 5GMKm 4HT8A 2YLBA 5CKBA 2OAUA 3HRTA 1VQMT 4PJOA 2LCCA 2EYQA 4M77E 1JBMA 4PLIA 2BUDA 4M7AB 1YITA 4C0DC 3CCET 2V8KA 2XKOC 3VUZA 5GAMh 3CCJT 2LQ8A 5HY6A 4B9WA 2EIFA 4FT2A 2CS7A 3F70A 4IUPA 5I2SA 3URGA 2E70A 4IUQA 4KULA 2MAMA 3I55A 5FLXE 4MDWA 2RHZA 2VGMA 3OBYA 3Q1JA 3OYGA 3HSBA 4C8QF 4M7DA 2R5MA 4N4HA 1UGRB 3M55A 4M7AF 4XU2A 4MDXA 4XTWA 2A3LA 1DJ7B 4BY6B 4IUVA 2JVVA 1QVFS 2M1HA 4HA8A 1JRIA 4JS5A 4HCBA 1QW1A 4M75E 2CGHA 2XDDA 2HBPA 2LCLA 4KT0E 4ATOA 5GANf 4Q5WA 2E10A 3CCMT 1NZ9A 3AHUA 1VIEA 3X26B 4A4EA 2PUKB 1VQ4T 5LJ5h 3SWNB 2ZGWA 3HP9A 3OMGA 1YJ9A 2PU9B 4FT4A 2X4JA 5L8RE 3CCQA 3QDRB 4JRKA 1EIFA 4JUVA 1WJSA 3OYIA 1I81A 1LJOA 1KC8U 1ZHIA 2EJGA 4A53A 5CAIA 5GAOp 3OYYA 2K2VA 4JLIA 4RKUE 2E6ZA 5A2QE 2HAXA 3JB9H 4EDUA 4LDXA 2DO3A 1M90C 3CCVT 1KG1A 1UGSB 2DTOA 3CBMA 2K5IA 2LT4A 3JCMW 4BB7A 3JCMf 3FEOA 1Y96B 2K57A 5IN1A 5GMKj 1FWZA 3SWNC 5KCOA 1VQOT 1KC8C 2NLUA 4C5GA 4C92D 4M7AA 3LWHA 3X28B 3LWIA 2X4XA 3PMTA 3OYKA 3HRUA 2KQWA 3NTIA 1U1SA 2JTMA 3OS2A 5A0LA 3CXCS 4J8OA 1VQLT 4MZTA 3JCMP 1W4SA 2QDYB 5C0MA 2RHUA 1M4ZA 2VC8A 3DLLA 4C5EA 5FRNA 4WF2A 4BDYA 1HK9A 4M78C 4MZPA 5LJ5f 1M1FA 4M78G 4BD3A 2E64A 2HNIA 4OB1B 5A0DA 2XIDA 2RM4A 5CK9A 2V8JA 4BI4A 3EFSA 3JCMb 2XU8A 2MWOA 3E9GA 3HPWA 1YIJT 3FJPA 2BIVA 4LDVA 3BY7A 4EMKA 2GCXA 3CCJA 3JCMJ 3UWNA 5LJ3d 2FVUA 5J3BA 4M77A 2P0QA 2WSCE 4NL2A 2QEXA 4E7LA 4GY5A 1YJNA 2D6FA 2QQ9A 1VQ7T 5C6SA 2DAQA 3H8ZA 4XU1A 3JCMh 1Y07A 1YBYA 3OS1A 2EQMA 1YJWA 3M59A 3BDLA 3JAME 2YLCA 2P0KA 5LJ3e 3S3OA 1WQ7A 5CKHA 1K9MU 2QI2A 4LDWA 2DVEA 3MCAB 3PFSA 4M77B 3L1AA 2P4TA 4N0AC 4A4KA 2KAFA 3CCMA 4IUTA 3ZFJA 3OMCA 4ZGJB 3G71T 1YJWT 3KBGA 2L89A 4M7AD 4F7UF 2L3RA 5LJ5j 4FIBA 1O75A 5CKFA 3OW2A 3X24B 3V8JA 4BDZA 4OGCA 5DY9A 2E41A 5CO7A 3TEEA 4A4FA 5GAMg 3UDCA 1ZQ1A 1YI2T 4R55A 4IKFA 4IURA 3FB9A 3HHTB 4LDUA 2E12A 1S72T 1N8RC 1UB4A 1O9SA 2MWPA 5CQYA 4BE2A 1YHQT 3FC3A 4C8QC 5CQXA 1JB0E 4JJNK 3OYHA 1K8AU 2GQVA 3I56T 3OSVA 2FL7A 5GMKh 2LVMA 1VQ9T 2JN0A 2JUFA 3JCMQ 4ZTFA 2K3XA 4FSXA 3C4SA 3HKSA 4F7UG 3QSUA 2RB6A 3CCRA 5GAOr 3MP1A 2DIGA 3O8VA 3ER0A 4M75F 4BI8B 3JCMg 4JRQA 4N4IA 4LD9K 2M9UA 1BI3A 2KMTA 4JS4A 2P0PA 1Q81C 3HL8A 1H3ZA 5LJ5d 4F7UA 3OYFA 4PJOC 2EWNA 3QZ9B 3CC4A 3INZA 1W2BS 4NOYA 2O4XA 2QTXA 1M1KC 2MMPA 5GAMe 2RD1A 1M1GA 2RHXA 2GF7A 2ZCFB 1BYMA 1ZBXA 3CMET 3QYGB 1VQKA 1OYXA 1N27A 3CXCA 1I4K1 3UPUA 3CCST 4X9CA 2RJEA 3CBOA 3A8GB 5I2MA 4A4HA 5DLOA 3CCUT 2XDBA 2WACA 1LNXA 2XDPA 3CMAT 3RERA 3E1SA 4OB0B 5HK0A 2VXEA 1U1TA 3GOXA 2YHTA 3JCMV 2D9TA 5GANd 4HT9A 2M16A 2AHJB 2LT1A 2DZCA 1KQ1A 3ME9A 3RKWA 3HFNA 4PJOF 4VUBA 1U8RA 5LJ5e 3CPFA 2QA4A 3I56A 2IVWA 2OTJA 1QP3A 1JJ2A 1VUBA 4JRPA 4RCBA 1UGPB 4M7DD 2MI6A 3G4SA 3A8HB 3M58A 2LNVA 3PGGA 3QUIA 5HK3A 5GAOl 4PL6A 1B34A 3RKYA 4M77D 4J6WA 4M75C 3KXTA 3LH0A 3VUBA 2K5FA 3GLXA 3V8LA 2M0OA 4ME7A 2RH2A 1WJRA 2XD0A 3JSCA 5CR2A 2RO0A 1M9SA 2CZ6B 2QQBA 4QQ6A 2DXBA 4EMGA 5GAOn 2KDSA 3OY9A 4DOWA 4HCCA 2CZ0B 2X4WA 3C95A 2PVGB 3QXEB 1D3BA 1N9SA 2PVOB 5D6XA 4C0GA 3G4ST 1NE8A 1I5LA 2XI9A 3MEUA 2R5AA 5GANe 3OYJA 3L2VA 3CC2A 2EJ9A 2RI3A 1W2BA 2ZPEB 4DA4A 4JDSA 1IREB 1KD1U 4KUDK 2L8DA 5CIUA 1XTDA 5AYFA 3OYDA 3CCSA 1Y7XA 1M90U 3A8LB 3MEWA 1V29B 3FDRA 1D3BB 1X75C 3EAEA 3META 5LJ5g 2HQXA 1RI0A 3OBWA 3LW5E 3OYBA 1NPPA 4E7KA 4A54A 4O6JA 1IZ6A 4M7AE 2FYKA 2E65A 1K8AC 2XICA 2FB7A 2QXFA 4J7IA 3TU4K 1B34B 4CI0C 3GIBA 2RI5A 4FL6A 4OMFB 4PKCC 3M9QA 1PSFA 4ZN3A 4L6V5 3CCLT 2XG8D 1BI1A 4MZMA 3JCMc 1VIFA 2ZPFB 2A7YA 5IAYA 1MGQA 5KCHA 2B8AA 3GPLA 3MHXA 5GAOq 4NL3A 5LJ3f 3PNWC 4M7AG 1Q86U 4BE1A 3E19A 2RHYA 3LGFA 3P8BB 3WVDB 1VQ5T 4L5GA 4JLGA 3QJYA 4M77G 1VQ9A 3KUFA 5M9OA 3P8HA 1OZ3A 3ZBDA 3L2RA 3CCRT 2DD5A 1HXDA 1MHNA 3N5BB 4J7FA 2RJCA 3RESA 3PMIA 2PVDB 5GAMd 2LQKA 4M78A 1BIBA 1YJNT 2YRVA 2O01E 2QQAA 4OF1A 4D6WA 1Y96A 4M75G 2XK0A 4XTUA 5GMKl 3M54A 3ASKA 2LDMA 3VU3C 3M4YA 1YI2A 3QYHB 1VQ5A 5A0GA 2WSEE 4NS5A 5KH6A 3JB9G 2LTOA 2KSSA 2QQSA 3DB3A 1QP2A 4LDYA 2Y4YA 3HFOA 2WSFE 3CC2T 4XQ3A 5GAMj 4C0DB 4BACA 4OB3B 3CCLA 1N9RA 2VV5A 2KY9A 3M56A 2DTHA 3MEAA 4E7JA 4E47A 3SDZA 5FU7B 4F7UE 3OA6A 4ZTJA 3OS0A 1X01A 3LLRA 4GLKA 3C12A 2RI2A 4QW2A 2BKDN 1G3YA 3CPWS 1UGQB 4DQ2A 5LJ3g 2VGNA 5EG2A 1VQ7A 4FM4B 2QEXT 3HRSA 3OB9A 4M7DB 4Z02A 1G3TA 3CD6T 1BI0A 2IG0A 2EQJA 1NJIC 1VQKT 4M7DE 1M5Q1 3JRZA 3A8MB 3CMEA 3G6EA 1VQPT 3CCVA 2G3RA 4C8QE 1FX7A 3DB4A 1NPRA 4RG8A 2X35A 1YIJA 2DD4A 3WVEB 5FRMA 3RMSA 3VYGA 1XNIA 3J80E 3LX7A 1VQNA 3OQ5A 2OTLA 3OYLA 3OYEA 3JCMX 3QHSA 4J5YA 4UC4A 3QZ5B 4M75D 4M77C 4C92B 5HKCA 3PIOA 1OZ2A 1Q86C 4M77F 4PJOB 2RHIA 3P8DA 2EJFA 1X6OA 3TCJA 1VQPA 1QVFA 4M7DC 5GANh 3OSSC 3L2QA 4XTZA 2R57A 4RMOA 2EAYA 4E7HA 3L2UA 2QQRA 4JRIA 4X9DA 1VQLA 1SSFA 2EQKA 4X34A 3QPHA 3J81E 3RMQA 3FRNA 4XTVA 2E1HA 1QVGS 1K9MC 4II1A 4A4GA 1GXIE 2KK4A 2HD0A 4M78F 2Y90A 3M5AA 4C5IA 4QVDA 3OS5A 4BY6C 2MF2A 5LL6S 2E6NA 4BUGA 2JZ2A 4C92G 3GNGA 4OGEA 4EMKB 2PUOB 5GAN8 3L2ZA 5CCAA 3CPWA 2RJDA 1K73C 3OW2S 2RK1A 1G5VA 3FLGA 3EFRA 3OYNA 5LJ3j 3G6ET 3CCEA 5IT9E 3SWNA 3CC4T 5J26A 2D0QB 3PTAA 4M78B 1N8RU 4PJOD 2LX9A 3NFCA 4PLLA 3SB2A 2VXFA 5GMKi 4M75B 1KQSS 2ZZDA 2K5LA 5FU6C 1YCYA 3OYCA 2DK3A 3QIIA 1KQ2A 1BIAA 4J6YA 3CC7A 3M57A 4OP0A 4C5HA 4XAXB 2JNGA 2DPPB 4OB2B 1PSEA 3X25B 3CMAA 3GP8A 4XU0A 2DTIA 4OVAA 1KQSA 4LD6A 4CRIA 4EMKC 3TREA 2EKOA 3OYMA 4M75A 1JJ2S 4XK8E 2FHDA 3S3NA 2Y4XA 3OYAA 3MP6A 2RA2A 2KVQG 4L59A 4PJOG 4C92F 2I2LA 4C8QD 2DXUA 5FU6B 1I8FA 3A5ZB 2CZ7B 4O5VA 5GAN6 1KD1C 3GF5A 3NTKA 4QVZA 4P5NA 1YITT 3QBYA 2O4XB 2CYZB 2DXCA 4BI3A 2VYTA 4J83A 5J39A 3L2WA 1WJQA 2QA4T 2OTJT 1WGSA 4E7IA 3JB9J 2X4YA 3FIFA 3M4GA 4M78E 1G3WA 5GAN7 3E9FA 3RIRA 3JB9I 2ZPBB 5I21A 1KHIA 3NTHA 5DM7R 4C8QA 4M7DF 2F5TX 4QQDA 4M7AC 4PJOE 4V2SA 3MP8A 4Y28E 2DIQA 4FU6A 3CC7T 4J6XA 1K73U 2ZPIB 5GANj 1Q7YU 1P92A 1QVGA 4MMLA 1XQHA 1VQOA 2PQWA 4DOVA 3C94A 1Q82C 3ZEHA 4TVRA 3BDUA 3CBPA 3BFMA 2F5KA 4IUUA 3V7CA 4C8QB 1KHCA 2ZPGB 3DKMA 1BI2A 1LOJA 3V7SA 3X20B 2HQEA 1VQ8T 3JB9F 2F69A 5CKEA 5FU7C 3A8OB 1N6AA 5FROA 4ZN1A 4RG2A 1VQ6A 3PT9A 5GANg 1BKBA 2E5QA 5GAN2 1Q7YC 3SD4A 3QO3A 2JTFA 1OI1A 2LC4A 2R58A 3T9NA 3CEYA 3CCUA 1YJ9T 1R8OB 4B9XA 3SFMA 1VQ8A 1WNLA 3V8KA 2K4YA 3VKIA 2RK2A 2ZPHB 3JCMe 4C92E 4C8QG 1G3SA 3L42A 3VV0A 5GAN3 5LJ3h 3GNFB 2L5QA 2GFAA 5D6YA 2DXTA 3UT1A 4QVCA 4M78D 1VQ4A 4YTLA 2DJZA 2LRQA 4F7UB 3J7AF 4EMHA 3LGLA 4EPCA 5GAN5 3R6OA 4XTYA 1TH7A 2VUBA 3RUXA 3S3MA 3QKJA 4ZGDB 1AHJB 2EFIA 3M53A 4R56A 4XTXA 1M8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAO n;  3EFS A;  4EMG A;  3JCM b;  4MMK A;  4JRI A;  3FJP A;  4X9D A;  3JCM d;  1D3B A;  1N9S A;  1H64 1;  3BY7 A;  4EMK A;  4C92 C;  4PNO A;  3JCM J;  1I5L A;  5LJ3 d;  4XTV A;  2E1H A;  4XU3 A;  2DZ9 A;  4Y91 A;  5GAN e;  2EJ9 A;  5GAO m;  4N0A A;  4M77 A;  2DKG A;  4NL2 A;  4M78 F;  2Y90 A;  4QVD A;  4XU1 A;  3JCM h;  4C92 G;  5GAN 5;  1D3B B;  5GAN 8;  5LJ5 g;  4EMK B;  4RCC A;  2YLC A;  3L2Z A;  5LJ3 e;  5GAM f;  3V7R A;  1WQW A;  1WQ7 A;  4A54 A;  5GMK e;  4M7A E;  3EFR A;  2DVE A;  2FYK A;  5LJ3 j;  3JB9 D;  2E65 A;  4M77 B;  3L1A A;  2FB7 A;  4N0A C;  3SWN A;  3BW1 A;  1B34 B;  3RKX A;  4M7D G;  3GIB A;  4M78 B;  4PJO D;  5GMK i;  4M7A D;  3SB2 A;  4F7U F;  2VXF A;  5LJ5 j;  4M75 B;  5GAN 4;  4C92 A;  3JCM c;  1YCY A;  1WPY A;  2DEQ A;  3V8J A;  1MGQ A;  1KQ2 A;  1BIA A;  5DY9 A;  5GAO q;  2E41 A;  4J6Y A;  2YLB A;  4OP0 A;  5LJ3 f;  5GMK m;  4NL3 A;  4HT8 A;  4M7A G;  4PJO A;  4M77 E;  5GAM g;  1JBM A;  4M7A B;  3FB9 A;  2DTI A;  4XU0 A;  5GAM h;  4EMK C;  4M77 G;  4M75 A;  2RA2 A;  4PJO G;  4C92 F;  1HXD A;  2I2L A;  4C8Q D;  4C8Q C;  3RES A;  5GAM d;  3HSB A;  2DXU A;  4M7D E;  4C8Q F;  4M7D A;  4M78 A;  1BIB A;  4M7A F;  1I8F A;  4XU2 A;  4XTW A;  5GAN 6;  5GMK h;  1Y96 A;  2JN0 A;  4M75 G;  3JCM Q;  4XTU A;  5GMK l;  4HA8 A;  3VU3 C;  1JRI A;  3QSU A;  4F7U G;  2RB6 A;  4M75 E;  5GAO r;  2CGH A;  4M75 F;  3JB9 J;  3JB9 G;  3FIF A;  3JCM g;  3M4G A;  4M78 E;  2E10 A;  5GAN f;  5GAN 7;  3AHU A;  3RIR A;  3HFO A;  3JB9 I;  5I21 A;  5LJ5 h;  4XQ3 A;  3SWN B;  5GAM j;  4C8Q A;  2ZGW A;  4M7D F;  4M7A C;  4PJO E;  5LJ5 d;  1N9R A;  4F7U A;  4PJO C;  4V2S A;  2DTH A;  2EWN A;  3INZ A;  4NOY A;  4F7U E;  3JCM P;  4JRK A;  2QTX A;  1X01 A;  4JUV A;  4J6X A;  5GAM e;  5GAN j;  2RD1 A;  4MML A;  1I81 A;  3JCM X;  1LJO A;  2EJG A;  4A53 A;  5CAI A;  5GAO p;  4JLI A;  3BDU A;  3BFM A;  3V7C A;  4DQ2 A;  4C8Q B;  5LJ3 g;  3JB9 H;  1I4K 1;  3V7S A;  1LOJ A;  3JB9 F;  4X9C A;  2DTO A;  4M7D B;  1LNX A;  3JCM W;  3RER A;  3JCM f;  5GAN g;  5GAN 2;  1Y96 B;  2VXE A;  1M5Q 1;  2K57 A;  1U1T A;  3QO3 A;  5GMK j;  2YHT A;  3SWN C;  3JCM V;  5GAN d;  4HT9 A;  4M7A A;  4C92 D;  2DZC A;  4C8Q E;  1KQ1 A;  1WNL A;  3RKW A;  3V8K A;  3HFN A;  4PJO F;  5LJ5 e;  3JCM e;  4C92 E;  4C8Q G;  1U1S A;  5GAN 3;  5LJ3 h;  4RCB A;  4M7D D;  2DXT A;  4QVC A;  4M78 D;  5GAO l;  3PGG A;  3QUI A;  2DJZ A;  3QHS A;  4J5Y A;  4F7U B;  1B34 A;  3RKY A;  4C92 B;  4M75 D;  4M77 D;  4J6W A;  4M75 C;  4M77 C;  2VC8 A;  4XTY A;  1TH7 A;  4EMH A;  4M77 F;  4WF2 A;  3V8L A;  1HK9 A;  4M78 C;  3RUX A;  4PJO B;  2EJF A;  4M78 G;  5LJ5 f;  4M7D C;  5GAN h;  2E64 A;  2HNI A;  4XTZ A;  4XTX A;  1M8V A;  2RM4 A;  2EAY A; 
#chains in the Genus database with same CATH topology
 2GFU A;  3M0T A;  2A36 A;  3VS1 A;  1H64 1;  3VJP A;  4C92 C;  3SHW A;  1Y71 A;  4Y91 A;  1XOV A;  4KGX B;  3EFO A;  1AT1 B;  2EGA A;  5D6W A;  3DLM A;  3G6E Q;  1TG0 A;  2K6D A;  4GLM A;  1K0X A;  2DBK A;  3VYH B;  2XMF A;  2V8I A;  1X2K A;  3V7R A;  1WQW A;  1VQ5 Q;  4M7D G;  3RKX A;  4KBM B;  1T3L A;  2EQU A;  1UEB A;  4RTY A;  2D8J A;  1SSH A;  4PJO A;  4RTV A;  2QG9 B;  4PLI A;  2BUD A;  2YRD A;  2QDL A;  5GAM h;  3CCJ T;  2LQ8 A;  2CP3 A;  2EIF A;  2AT1 B;  1G2B A;  3THK A;  2OX7 A;  4RTX A;  2E70 A;  4IUQ A;  4KUL A;  3Q1J A;  1ZSZ A;  1ZA1 B;  4C8Q F;  2ROT A;  1UGR B;  3M55 A;  3BE3 A;  4MDX A;  4XTW A;  2D1X A;  2YUP A;  2JVV A;  1QVF S;  4HCB A;  1JRI A;  5GAN f;  4A4E A;  3G71 Q;  3OMG A;  5L8R E;  3QDR B;  4JRK A;  2ENM A;  4PJM A;  1GBQ A;  4A53 A;  1YI2 Q;  2GBQ A;  2K2V A;  1VQ4 Q;  2RQW A;  2DO3 A;  1MND A;  1UGS B;  2DTO A;  2K5I A;  4LUE A;  2K57 A;  1FWZ A;  3CMA Q;  5KCO A;  1KC8 C;  4M7A A;  2NLU A;  4ANJ A;  2FPE A;  2A28 A;  1NLP C;  1TOV A;  2FPF A;  3CXC S;  1PD0 A;  3JCM P;  1VQL T;  1W4S A;  1AVZ C;  2MCN A;  5LJ5 f;  1ACM B;  1SRM A;  2CP5 A;  2RPN A;  2RM4 A;  1YIJ T;  2OAW A;  2GCX A;  5LJ3 d;  1OV3 A;  2DL4 A;  2I0N A;  4M77 A;  2WSC E;  1YJN A;  1RAB B;  2D6F A;  2QQ9 A;  2LNH B;  3H8Z A;  2DM1 A;  3OS1 A;  4PK4 A;  2EQM A;  1FMK A;  1WQ7 A;  2F2X A;  5CKH A;  3REB B;  2QI2 A;  4LDW A;  3MCA B;  4M77 B;  4N0A C;  2ED1 A;  1Y57 A;  1T0J A;  4M7A D;  1O75 A;  1I1J A;  3X24 B;  3V8J A;  5IHK A;  3TEE A;  1RAE B;  2EYZ A;  1ZQ1 A;  2JW4 A;  3HHT B;  2E12 A;  1SPK A;  2K7A A;  3SEM A;  3EH1 A;  1K9M R;  2IPO B;  5CQX A;  1JB0 E;  2FRY A;  2QYZ A;  2NUT A;  3OYH A;  2GQV A;  2W10 A;  3I56 T;  2FL7 A;  1QVF P;  2JUF A;  2K3X A;  3C4S A;  4F7U G;  2ATC B;  1OX9 A;  4LD9 K;  3HL8 A;  5LJ5 d;  1JXO A;  4FCY A;  4WCI A;  1UFF A;  5I22 A;  3CC4 A;  4NOY A;  4ORZ A;  1M1K C;  2MMP A;  2MIO A;  2SEM A;  1ZBX A;  1OYX A;  3CCS T;  2RJE A;  5DLO A;  2NUP A;  5HK0 A;  4OB0 B;  2VXE A;  3VRZ A;  1X69 A;  4QKU A;  2D9T A;  2AHJ B;  2HL3 A;  2DZC A;  2CP0 A;  4KRT A;  4OMQ A;  4PJO F;  1ZBJ A;  5LJ5 e;  2QA4 A;  3I56 A;  1VUB A;  2LQW A;  4JRP A;  4RCB A;  3G4S A;  1YHQ Q;  2DYB A;  3A8H B;  3PGG A;  2AZS A;  1PWT A;  1B34 A;  2W0Z A;  4M77 D;  4M75 C;  3VUB A;  1C6V X;  2PZ1 A;  1WJR A;  1WHJ A;  2XD0 A;  2DLP A;  5CR2 A;  2RO0 A;  3OY9 A;  1PM3 A;  2DXB A;  4EMG A;  4OML A;  2KDS A;  4LUD A;  4HCC A;  1N9S A;  1GCP A;  1I5L A;  1G8X A;  2R5A A;  2RI3 A;  4HVW A;  2DER A;  1WXB A;  5AYF A;  1G83 A;  4A63 B;  4CC4 B;  1D3B B;  2M51 A;  4O6J A;  2PNI A;  2XIC A;  3TU4 K;  1YJ9 Q;  3GIB A;  2RI5 A;  4PKC C;  1YIT Q;  3CCL T;  2QA4 Q;  3ULR B;  5KCH A;  2E5K A;  3IQL A;  1OPL A;  1QCF A;  3LGF A;  3P8B B;  3WVD B;  3AT1 B;  4AFS C;  1K8A R;  2DRM A;  3ZBD A;  3L2R A;  3H0H A;  2DBM A;  4J7F A;  5GAM d;  3PMI A;  2PVD B;  2LQK A;  2BZX A;  2YRV A;  2O01 E;  4J9E A;  4OF1 A;  2FRW A;  2LDM A;  2ED0 A;  3VU3 C;  3M4Y A;  2WSE E;  4NS5 A;  3JB9 G;  2QQS A;  4J9G A;  1QP2 A;  2Y4Y A;  3HFO A;  3NMZ C;  4XQ3 A;  5GAM j;  2HDA A;  3ZL7 C;  4E47 A;  3SDZ A;  5FU7 B;  4ZTJ A;  1ZA2 B;  3C12 A;  2BKD N;  1S72 Q;  2YWW A;  3CPW S;  5LJ3 g;  1VQ7 A;  2QEX T;  2IG0 A;  1NJI C;  2EKH A;  3CCV A;  4C8Q E;  1R77 A;  3DB4 A;  4LN2 A;  4RG8 A;  5FRM A;  4JZ3 A;  1XNI A;  1VQN A;  1WFW A;  2HSP A;  3OYE A;  3VS4 A;  3JCM X;  4UC4 A;  1TUC A;  4F14 A;  4C92 B;  1QVG P;  5HKC A;  1JXM A;  2RHI A;  1AZG B;  4M7D C;  1ARK A;  4XTZ A;  1GRI A;  1TSF A;  3L2U A;  5GJW B;  4JRI A;  2RMO A;  2BTT A;  4X9D A;  1VQL A;  3QPH A;  1ZUU A;  1GXI E;  7AT1 B;  4M78 F;  1B3Q A;  3H41 A;  3I9Q A;  1VYV A;  3GNG A;  1K4U S;  2K79 A;  2YUO A;  3OW2 S;  2EPD A;  1WDX A;  1UHF A;  3FLG A;  3EFR A;  3OYN A;  5IT9 E;  3CCE A;  1ZUY A;  2LZ6 B;  2D0Q B;  5J26 A;  2GTJ A;  4K11 A;  3PTA A;  1TXQ A;  2J6F A;  1YCY A;  3QII A;  1KK7 A;  3CCQ Q;  3X25 B;  4PJJ A;  3CMA A;  1KQS A;  2DTI A;  4HXJ A;  3OYM A;  3C0C A;  1VOM A;  3MP6 A;  3VS0 A;  1RAI B;  2DXU A;  1IRX A;  1I8F A;  3A5Z B;  2JXB A;  1QWF A;  3EG1 A;  1D1C A;  1I5O B;  1Q82 R;  2QA4 T;  5FW9 A;  4E7I A;  3CCL Q;  1NEB A;  1G3W A;  5KYY B;  3TQ7 P;  3TSZ A;  1KHI A;  4C8Q A;  2F5T X;  4M7A C;  1WXT A;  1AD5 A;  1F1B B;  4Y28 E;  1Q7Y U;  1QVG A;  1VQO A;  1IGQ A;  4TVR A;  4PFO A;  3CBP A;  3CC2 T;  2BZY A;  4C8Q B;  3DKM A;  1LOJ A;  4FSS A;  5CKE A;  3EG0 A;  3A8O B;  1N6A A;  4ZN1 A;  1BKB A;  1Q7Y C;  3QO3 A;  3OW2 P;  1M2V A;  1R8O B;  4QT7 A;  1VQ8 A;  1WNL A;  2RK2 A;  2ZPH B;  2RF0 A;  5GAN 3;  5LJ3 h;  2X9H A;  4M78 D;  2KYM A;  1K0S A;  1AWX A;  2DJZ A;  3J7A F;  4EMH A;  3LGL A;  4EPC A;  1YWP A;  3M53 A;  4XTX A;  5GJV B;  1LVK A;  4N4G A;  1WIE A;  1NJI U;  4HCZ A;  4C0F A;  3JCM d;  2OTL T;  2DZ9 A;  3VS3 A;  2E3H A;  4AT1 B;  5GAO m;  1KQS P;  1RL2 A;  2XHC A;  4OMN A;  4C0Z A;  4ELY C;  3A98 A;  5KE3 A;  3S6W A;  2RJF A;  3G71 A;  4RCC A;  2CKK A;  1HSQ A;  2H3J A;  2HQH A;  2P4R A;  1Q81 U;  2MPX C;  2PTK A;  2CUD A;  6AT1 B;  5CVI A;  1M1K U;  5KE2 A;  1FXX A;  3CPW P;  2VAS A;  4HVU A;  4BE0 A;  1Q82 U;  4HT8 A;  1Q95 G;  5CKB A;  1VQM T;  2LCC A;  2EYQ A;  1JBM A;  2HKN A;  4M7A B;  1YIT A;  1VQL Q;  5HY6 A;  4IUP A;  3M0Q A;  4IIM A;  3I55 A;  1SKU B;  4M7D A;  4XU2 A;  2A3L A;  1DJ7 B;  2LJ0 A;  4Z88 A;  4JS5 A;  4M75 E;  2CGH A;  2LCL A;  4Q5W A;  2D0N A;  2E10 A;  3CCM T;  1VQ4 T;  1CKA A;  2CDT A;  3HP9 A;  1AEY A;  2PU9 B;  4FT4 A;  3CCQ A;  1BCO A;  4JUV A;  1VQ7 Q;  1WJS A;  1KC8 U;  2EJG A;  5CAI A;  5GAO p;  3OYY A;  2MYS A;  4RKU E;  2QTV A;  2E6Z A;  3EH2 A;  3JB9 H;  3RDV A;  4EDU A;  1M90 C;  3CCV T;  1KG1 A;  3E2U A;  3JCM W;  3FEO A;  3SWN C;  3EG3 A;  3X28 B;  2X4X A;  3OYK A;  3NTI A;  4WTO B;  2QAS A;  2YRC A;  4MZT A;  1TUD A;  5C0M A;  2RHU A;  1M4Z A;  4C5E A;  4WF2 A;  1M1F A;  4M78 G;  5CK9 A;  2V8J A;  3E9G A;  2MWO A;  1AWO A;  2QK0 A;  4LDV A;  3CCJ A;  3JCM J;  1ZUK A;  5J3B A;  1X27 A;  1D0Z A;  4GY5 A;  1VQ7 T;  5C6S A;  3JCM h;  1Y07 A;  1YBY A;  1YJW A;  3PVL A;  3BDL A;  2HCK A;  2P4T A;  3OMC A;  3G71 T;  5LJ5 j;  4FIB A;  1Q86 R;  2C0I A;  4BDZ A;  4OGC A;  3I56 Q;  2CSQ A;  1R0B G;  3UDC A;  4F17 A;  4IUR A;  4LDU A;  5FWC A;  1HYO A;  1UB4 A;  1H3H A;  1O9S A;  1VYT A;  1S1N A;  4BE2 A;  1YHQ T;  3FC3 A;  4C8Q C;  1K8A U;  2F2W A;  3OSV A;  5GMK h;  2C0O A;  3G4S Q;  2J6O A;  1TU0 B;  4FSX A;  1W70 A;  1QCN A;  5GAO r;  3MP1 A;  2DIG A;  3O8V A;  1K9A A;  3JCM g;  1OX8 A;  4N4I A;  2KMT A;  1H3Z A;  4F7U A;  3OYF A;  3QZ9 B;  3INZ A;  1NM7 A;  1SHG A;  4J9B A;  1WXU A;  2GF7 A;  1BYM A;  2ROL A;  1VQK A;  5IHI A;  3EGU A;  4A4H A;  1AWJ A;  2NUT B;  1YIJ Q;  1LNX A;  2XDP A;  1W6X A;  2EGC A;  1U1T A;  3GOX A;  2YHT A;  3JCM V;  4DBF A;  4HT9 A;  3TVT A;  2LT1 A;  3ME9 A;  3RKW A;  1U8R A;  3CPF A;  2IVW A;  2J7I A;  1UGP B;  2MI6 A;  3M58 A;  5GAO l;  2DNU A;  5HK3 A;  2DEU A;  3RKY A;  3RR6 A;  1UUE A;  3KXT A;  3PVQ A;  2K5F A;  1HD3 A;  4OMP A;  2RH2 A;  3GBQ A;  5GAO n;  4DOW A;  2X4W A;  3C95 A;  1VQ9 Q;  2J6K A;  3L2V A;  2F2V A;  2EJ9 A;  4X1V A;  3UAT A;  3EGX B;  2JMC A;  4KUD K;  5CIU A;  3MEW A;  3FDR A;  3LW5 E;  2COW A;  2DL8 A;  4M7A E;  2E65 A;  3VS2 A;  2FB7 A;  4J7I A;  1B34 B;  4CI0 C;  2KXD A;  4FL6 A;  4L6V 5;  1M2V B;  1E6G A;  4MZM A;  1VIF A;  3GPL A;  1MGQ A;  2B8A A;  5GAO q;  4NL3 A;  5LJ3 f;  4M7A G;  1RAD B;  2NYS A;  2FEI A;  4JLG A;  3LH5 A;  3QJY A;  5M9O A;  3EG9 B;  2KRM A;  1OZ3 A;  2D8H A;  2RJC A;  2KR3 A;  1T0H A;  1ABQ A;  4AG1 C;  1Y96 A;  1EZZ B;  3I55 Q;  1YI2 A;  4JJB A;  1AZE A;  5A0G A;  2LX7 A;  4PFP A;  5KH6 A;  2KSS A;  2JMA A;  4ZNX A;  2COY A;  1JQQ A;  4BAC A;  2KY9 A;  2YXY A;  3M0P A;  2L0A A;  1MV0 B;  2RI2 A;  4QW2 A;  2HEQ A;  2VGN A;  2EW3 A;  1UJ0 A;  2EYX A;  1MNE A;  9ATC B;  1VQK T;  3JRZ A;  4E7Z A;  1NBE B;  2X35 A;  3WVE B;  3VYG A;  3J80 E;  3QHS A;  1FMW A;  3P8D A;  2A37 A;  1X6O A;  8AT1 B;  1VQP A;  3OSS C;  4RMO A;  2EAY A;  1VQP Q;  4AFQ C;  1SSF A;  3QDF A;  3RMQ A;  1QVG S;  1K9M C;  2HD0 A;  1JU5 C;  2DF6 A;  4FYW B;  4C92 G;  2P84 A;  4LE9 A;  4BUG A;  5GAN 8;  4OGE A;  4EMK B;  1K73 C;  3CPW A;  2RJD A;  1X43 A;  1G5V A;  2EBP A;  3G6E T;  5LJ3 j;  3SWN A;  1RAF B;  1VA7 A;  4PJO D;  1PKS A;  2ZAE A;  1PKT A;  1IHW A;  4PLL A;  2VXF A;  4M75 B;  1KQS S;  2KRS A;  1IO6 A;  1WHK A;  2K5L A;  2HL5 C;  2DK3 A;  4J6Y A;  3CC7 A;  4XAX B;  2JNG A;  2DPP B;  1PSE A;  4XU0 A;  4CRI A;  4EMK C;  3VS5 A;  4M75 A;  2FHD A;  3S3N A;  2Y4X A;  3OYA A;  3UA6 A;  3VS7 A;  2KVQ G;  1VQ6 Q;  2CZ7 B;  4O5V A;  1KD1 C;  1PG5 B;  1YIT T;  3QBY A;  1VYU A;  1BCM A;  3L2W A;  2DL5 A;  4J83 A;  4OMM A;  1WJQ A;  1LCK A;  3M4G A;  2RN8 A;  1QCO A;  5I21 A;  2AK5 A;  3NTH A;  1K1Z A;  4M7D F;  4V2S A;  2DIQ A;  1NEG A;  2ZPI B;  2E4H A;  1XQH A;  2YSQ A;  3C94 A;  1Q82 C;  2RQU A;  2KT8 A;  3BDU A;  1V76 A;  3BFM A;  3V7C A;  2ZPG B;  1N8R R;  3JB9 F;  2HQE A;  5FRO A;  2O9V A;  2KYB A;  3MJX A;  2DET A;  2RNA A;  2JTF A;  1OI1 A;  2R58 A;  3H0F A;  1IXD A;  2KRN A;  3M0R A;  2CP6 A;  2YUN A;  3VV0 A;  5D6Y A;  2DXT A;  4QVC A;  1Q81 R;  3R6O A;  4XTY A;  1RLP C;  1Q7Y R;  4J9I A;  4DBQ A;  1AHJ B;  2EFI A;  2FZC B;  2CZ1 B;  1TS9 A;  3QJ6 A;  5KYU A;  3MEV A;  4QQG A;  1UTI A;  2ECZ A;  4F16 A;  4PNO A;  2AKK A;  3I55 T;  2KNB B;  2M02 A;  1B07 A;  2KE9 A;  4N0A A;  1OU8 A;  1VQ6 T;  2B86 A;  5KYU B;  3VRY A;  2C06 A;  2DJQ A;  5GAM f;  3QG1 A;  3WXM B;  3PIP A;  3JB9 D;  3BW1 A;  3CCQ T;  3H6Z A;  3PE0 A;  1MMG A;  2J06 A;  1WPY A;  5DLQ E;  3EGD A;  2OAU A;  4M77 E;  3CCE T;  2V8K A;  2XKO C;  3VUZ A;  4FT2 A;  3F70 A;  1U3O A;  4LXC A;  2MAM A;  3OYG A;  2RHZ A;  2VGM A;  3HSB A;  2V1Q A;  4N4H A;  1D1B A;  4M7A F;  3R6N A;  4BY6 B;  2L3P A;  2VB6 A;  5KYW A;  2DFU A;  5L23 A;  2NWM A;  2HBP A;  4ATO A;  2ESW A;  3I35 A;  3EGX A;  2KBT A;  1VIE A;  2PUK B;  5HCK A;  5LJ5 h;  3NGP A;  2ZGW A;  1I07 A;  1EIF A;  1I81 A;  1LJO A;  2JS2 A;  4JLI A;  1KFZ A;  5A2Q E;  1MV3 A;  2HAX A;  3EFO B;  1RI9 A;  1VQM Q;  3CBM A;  2K2M A;  2LT4 A;  2LJ1 A;  5GMK j;  2VVK A;  1JEG A;  1WHH A;  1VQO T;  4C5G A;  3LWH A;  3PMT A;  2O9S A;  3HRU A;  2KQW A;  1U1S A;  1YNZ A;  1ZSZ C;  2JTM A;  3OS2 A;  5A0L A;  1RAA B;  4J8O A;  1M8M A;  2QDY B;  5FRN A;  2VC8 A;  4BDY A;  1HK9 A;  4M78 C;  2E64 A;  1RAH B;  4OB1 B;  3RNJ A;  5A0D A;  1QKX A;  2XID A;  4BI4 A;  3JCM b;  1ZSG A;  2BIV A;  1UEC A;  4FYY B;  4AFZ C;  1ZSZ B;  1WZO A;  2P0Q A;  4E7L A;  2QEX A;  1FMV A;  2ABL A;  2DAQ A;  1J3T A;  4XU1 A;  4KGZ B;  3M59 A;  2P0K A;  2A0F B;  1GFC A;  2DL7 A;  2DVE A;  3PFS A;  3L1A A;  3CCM A;  2KAF A;  4Z8A A;  1WLP B;  4IUT A;  3ZFJ A;  4CC7 A;  4ZGJ B;  1YJW T;  3KBG A;  2L3R A;  2L3Q A;  2EYW A;  3D7S B;  5DY9 A;  4HCK A;  2X3X D;  4R0K A;  4R55 A;  3MPU B;  3FB9 A;  2FG0 A;  2MWP A;  2KXC A;  5CQY A;  2LJ3 A;  1MMD A;  1SRL A;  2BE7 D;  1VQ9 T;  3QSU A;  3HKS A;  3REA B;  3CCR A;  3UF4 A;  3JV3 A;  4BI8 B;  1VQ8 Q;  4JRQ A;  2M9U A;  1YJW Q;  2P0P A;  3I5R A;  1OU9 A;  5ECA A;  1IHV A;  2EWN A;  1W2B S;  5GAM e;  1PRL C;  2RD1 A;  1M1G A;  2ZCF B;  3CME T;  1VQO Q;  1N27 A;  3CXC A;  1I4K 1;  3UPU A;  3CBO A;  5I2M A;  3A8G B;  5AT1 B;  2WAC A;  3E1S A;  2M16 A;  3HFN A;  4VUB A;  8ATC B;  2OTJ A;  4M7D D;  1NLO C;  2FZG B;  2CP2 A;  5KYX B;  3V8L A;  2M0O A;  1X2Q A;  1OPK A;  4B6M A;  3JSC A;  1M9S A;  2CZ6 B;  2QQB A;  4QQ6 A;  2BE9 B;  2Z0W A;  1HJD A;  3QXE B;  1M27 C;  2PVO B;  5D6X A;  4C0G A;  3G4S T;  1NE8 A;  4E2F B;  2XI9 A;  3MEU A;  3G1J A;  3OYJ A;  3CC2 A;  1K76 A;  2ZPE B;  4DA4 A;  4HVV A;  4JDS A;  1IRE B;  4FYX B;  1U06 A;  1XTD A;  3A8L B;  3EAE A;  3MET A;  5LJ5 g;  3CCE Q;  2HQX A;  1RI0 A;  3OBW A;  3OYB A;  2FO0 A;  4OMF B;  1UG1 A;  4ZN3 A;  2XG8 D;  2OTJ Q;  2ZPF B;  2A7Y A;  3MHX A;  3PNW C;  4BE1 A;  3E19 A;  2RHY A;  2CRE A;  3O5Z A;  4L5G A;  1WX6 A;  1VQ9 A;  1M90 R;  2YUQ A;  1IB8 A;  3CCR T;  1HXD A;  1WHM A;  1MHN A;  3N5B B;  3RES A;  4PJL A;  2FPD A;  3CXC P;  1BIB A;  1YJN T;  2QQA A;  4XTU A;  1TWB A;  2EVR A;  2QGG A;  2LTO A;  1UDL A;  2BZ8 A;  2WSF E;  1C1A A;  2GNC A;  3CCL A;  1N9R A;  3M56 A;  3MEA A;  2DTH A;  4E7J A;  3CCU Q;  4F7U E;  1NG2 A;  1V1C A;  2SRC A;  1X01 A;  2VKN A;  3LLR A;  1AWW A;  1PHT A;  2J05 A;  1G3Y A;  1UGQ B;  4RTZ A;  5EG2 A;  2HZY A;  3HRS A;  3OB9 A;  4M7D B;  4Z02 A;  3A8M B;  2KI7 A;  3G6E A;  2G3R A;  1NPR A;  1YIJ A;  1BK2 A;  2RQV A;  3CC2 Q;  1Z9Z A;  3RMS A;  2HBW A;  1GFD A;  3LX7 A;  3OQ5 A;  2X51 A;  3OYL A;  4J5Y A;  3QZ5 B;  4M75 D;  4M77 C;  1Q86 C;  3CQT A;  1OZ2 A;  3PIO A;  4M77 F;  2YDL A;  4PJO B;  2EJF A;  3EGD B;  3TCJ A;  1QVF A;  1H92 A;  4CC3 A;  5GAN h;  3L2Q A;  4E7S A;  1NYG A;  2QQR A;  3CD6 Q;  4AG2 C;  1YP5 A;  4X34 A;  2EQK A;  3FRN A;  4XTV A;  1X6G A;  2HKQ B;  4A4G A;  2KK4 A;  4JPB W;  4QVD A;  4C5I A;  3HTR A;  4BY6 C;  5LL6 S;  2MF2 A;  2E6N A;  1YJ9 A;  2JZ2 A;  1KC8 R;  1RUW A;  2PUO B;  1RLQ C;  3L2Z A;  2KEA A;  2RK1 A;  1N8R U;  1GCQ C;  2LX9 A;  3NFC A;  1D09 B;  4EIK A;  2ZZD A;  1KQ2 A;  2CP7 A;  1K73 R;  4C5H A;  5EC7 A;  3KFV A;  3GP8 A;  4OVA A;  4LD6 A;  3TRE A;  4PFZ A;  4XK8 E;  4L59 A;  4PJO G;  2I2L A;  5FU6 B;  1M2O A;  5IHN A;  4DEX A;  5GAN 6;  3NTK A;  4QVZ A;  1KJW A;  3CCM Q;  4BI3 A;  5J39 A;  4CC2 A;  2VYT A;  2OTJ T;  1E6H A;  2QAZ A;  1YN8 A;  3FIF A;  4M78 E;  3E9F A;  3RIR A;  2K3B A;  4RUG A;  4PJO E;  2O2O A;  4E6R A;  1KD1 R;  1A0N B;  5IXF A;  4DOV A;  2F5K A;  1UE9 A;  2LP5 A;  1VQ8 T;  3X20 B;  2F69 A;  4FYV B;  4RG2 A;  3PT9 A;  1XJW B;  2E5Q A;  1M3A A;  3SD4 A;  1Y0M A;  1YJ9 T;  2LC4 A;  3T9N A;  3CEY A;  1JO8 A;  4JZ4 A;  3SFM A;  4OMO A;  1OEB A;  3JCM e;  2LCS A;  4C92 E;  1QWE A;  1G3S A;  4C8Q G;  2GFA A;  3UT1 A;  2IIM A;  4D8D A;  2LRQ A;  4F7U B;  1SHF A;  3H0I A;  2VUB A;  3S3M A;  3QKJ A;  4R56 A;  1JJ2 P;  2DIL A;  4FW1 A;  3MO8 A;  4MMK A;  1QMC A;  5CKD A;  5KYW B;  1S72 A;  3FJ5 A;  1VQN T;  2EGE A;  4HKE A;  4XU3 A;  1YHQ A;  1QVP A;  4JJD A;  1NYF A;  4KUI A;  2DKG A;  2CH4 A;  3CME Q;  3MKD A;  4ELZ C;  4AFU C;  2EYY A;  2K3Y A;  1VQM A;  3LYI A;  3G7Z A;  3CD6 A;  4J9D A;  5GMK e;  2JOY A;  2NUZ A;  1E7O A;  2A08 A;  4IIO A;  5GAN 4;  1PNJ A;  4C92 A;  2DEQ A;  1M3C A;  2C0T A;  3CCS Q;  1BB9 A;  4Y92 A;  5GMK m;  2YLB A;  1WYX A;  3HRT A;  4C0D C;  1MMN A;  2DL3 A;  4B9W A;  2HMA A;  2CS7 A;  3VS6 A;  3A1P A;  5I2S A;  3URG A;  2KGT A;  5FLX E;  4MDW A;  3OBY A;  1UGV A;  2GTO A;  2R5M A;  4D8K A;  4IUV A;  2M1H A;  4HA8 A;  1QW1 A;  2FZK B;  4DBR A;  2XDD A;  4KT0 E;  1ABO A;  1NZ9 A;  3AHU A;  3X26 B;  1GL5 A;  3SWN B;  2X4J A;  3OYI A;  1ZHI A;  2V1R A;  2CH4 W;  3NHN A;  4LDX A;  3EG2 A;  1M30 A;  4BB7 A;  3JCM f;  1Y96 B;  5IN1 A;  2CT3 A;  4C92 D;  2JJ9 A;  4RTT A;  1EX4 A;  1ZX6 A;  3LWI A;  2VWF A;  2DVJ A;  1CSK A;  2DMO A;  3DLL A;  2K9G A;  4MZP A;  4FW2 A;  4BD3 A;  2HNI A;  1QKW A;  3EFS A;  2XU8 A;  3HPW A;  3FJP A;  2AIR B;  3BY7 A;  4EMK A;  3UWN A;  1UJY A;  2FVU A;  2H8H A;  2F1L A;  4NL2 A;  4PJN A;  1C0M A;  1NJI R;  3JAM E;  2YLC A;  5LJ3 e;  3S3O A;  3UA7 A;  1K9M U;  1WA7 A;  4A4K A;  1EFN A;  2L89 A;  4F7U F;  2DE0 X;  3QWX X;  5CKF A;  1SG5 A;  3OW2 A;  2JS0 A;  2E41 A;  1IGU A;  1KSW A;  5CO7 A;  5GAM g;  4A4F A;  2DX1 A;  4LNP A;  1YI2 T;  3I5S A;  2KT1 A;  1W2B P;  4IKF A;  2O31 A;  1S72 T;  2KRO A;  1N8R C;  3TSW A;  4JJN K;  2LVM A;  2JN0 A;  5KYN A;  3JCM Q;  4ZTF A;  1M1K R;  2RB6 A;  4M75 F;  3ER0 A;  1BI3 A;  4JS4 A;  3H9N A;  1Q81 C;  2GGR A;  1U5S A;  4PJO C;  4KH0 B;  2O4X A;  2QTX A;  4KH1 B;  2RHX A;  5I11 A;  3QYG B;  1PRM C;  2DRK A;  1VQN Q;  4X9C A;  4JJC A;  2RQR A;  2XDB A;  3CMA T;  3RER A;  3CCV Q;  1OQK A;  5GAN d;  1KQ1 A;  1MUZ A;  2JM9 A;  3CCR Q;  2MOX A;  1D1A A;  1QP3 A;  1JJ2 A;  3RBB B;  2LNV A;  3QUI A;  4PL6 A;  4J6W A;  3LH0 A;  3GLX A;  2RQT A;  2AKL A;  4ME7 A;  2EQI A;  1LPL A;  1KIK A;  2CZ0 B;  2OI3 A;  1M3B A;  2PVG B;  1D3B A;  2L3S A;  2CUB A;  2DYI A;  5GAN e;  1GCQ A;  1W2B A;  1KD1 U;  2L8D A;  3EHR A;  1X6B A;  1M90 U;  3CCS A;  3OYD A;  1OOT A;  1Y7X A;  1V29 B;  1X75 C;  1YWO A;  1NPP A;  4E7K A;  2CT4 A;  4A54 A;  5KYY A;  1IZ6 A;  2FYK A;  1MMA A;  1K8A C;  2QXF A;  4RTU A;  2M0Y A;  5KYX A;  4KGV B;  3M9Q A;  1PSF A;  2QEX Q;  1BI1 A;  3JCM c;  1BBZ A;  5IAY A;  2X3W D;  2DA9 A;  1Q86 U;  1ZLM A;  4F04 B;  1VQ5 T;  1Z9Q A;  1TTH B;  4RTW A;  4M77 G;  2CSI A;  1B7T A;  3KUF A;  1WHL A;  2NUP B;  3P8H A;  1YFN A;  1UHC A;  2DD5 A;  4J9H A;  4M4Z A;  4M78 A;  1WHG A;  4D6W A;  2OTL Q;  4M75 G;  2XK0 A;  5GMK l;  3M54 A;  3ASK A;  2QGF B;  3QYH B;  1VQ5 A;  2JT4 A;  3DB3 A;  1RAC B;  4LDY A;  1SF9 A;  4C0D B;  1SEM A;  2MK5 A;  4OB3 B;  2VV5 A;  1FYN A;  3OA6 A;  1OUL A;  4ESR A;  3OS0 A;  3U23 A;  4GLK A;  4DBH A;  2LMJ A;  2LQN A;  4DQ2 A;  4FM4 B;  1G3T A;  3CD6 T;  1BI0 A;  1N5Z A;  2EQJ A;  4M7D E;  1M5Q 1;  1D0X A;  3CC4 Q;  3CME A;  1VQP T;  1FX7 A;  3M0S A;  4Z89 A;  2YT6 A;  2DD4 A;  3QWY A;  2OTL A;  4J9C A;  2JM8 A;  2O88 A;  2HSE B;  2R57 A;  4E7H A;  1W1F A;  1QQJ A;  2GQI A;  1VQK Q;  3J81 E;  2E1H A;  4II1 A;  1YCS B;  4J9F A;  2Y90 A;  3M5A A;  1PD1 A;  2OJ2 A;  3OS5 A;  3CCU T;  1AOJ A;  5CCA A;  2G6F X;  2AZV A;  5IXB A;  3CC4 T;  4M78 B;  5GMK i;  3SB2 A;  3EHQ A;  1TUG B;  5FU6 C;  3OYC A;  1BIA A;  3M57 A;  4OP0 A;  2L2P A;  1YJN Q;  4OB2 B;  2EKO A;  1JJ2 S;  1PCX A;  2RA2 A;  1BU1 A;  4C92 F;  4C8Q D;  2JTE A;  1I0C A;  4GBQ A;  2COZ A;  3GF5 A;  4P5N A;  2E3I A;  2O4X B;  2CYZ B;  2DXC A;  1H8K A;  1WGS A;  3JB9 J;  2X4Y A;  1WI7 A;  5GAN 7;  3JB9 I;  2ZPB B;  5DM7 R;  4QQD A;  3MP8 A;  3EG9 A;  4FU6 A;  4DEY A;  3CC7 T;  4J6X A;  1K73 U;  5IH2 A;  5GAN j;  1P92 A;  4MML A;  3NPF A;  2PQW A;  3ZEH A;  3CCJ Q;  4ZGE B;  4IUU A;  1KHC A;  2H3E B;  1BI2 A;  3V7S A;  5FU7 C;  5FWB A;  1VQ6 A;  5GAN g;  4AMC A;  5GAN 2;  1D0Y A;  5D7U A;  1CKB A;  3CCU A;  1GBR A;  4B9X A;  1QLY A;  3V8K A;  1T3S A;  2K4Y A;  2V26 A;  3VKI A;  3L42 A;  3CC7 Q;  3GNF B;  2L5Q A;  1VQ4 A;  4YTL A;  1RAG B;  5GAN 5;  1R0C B;  1TH7 A;  3RUX A;  4ZGD B;  3M0U A;  1M8V A;  1PC0 A; 
#chains in the Genus database with same CATH homology
 2GFU A;  3MO8 A;  2CZ1 B;  4MMK A;  4N4G A;  5CKD A;  1NJI U;  3QJ6 A;  4HCZ A;  4C0F A;  3MEV A;  3JCM d;  1S72 A;  1H64 1;  4QQG A;  3VJP A;  4C92 C;  4PNO A;  2OTL T;  1Y71 A;  1VQN T;  4HKE A;  4XU3 A;  2DZ9 A;  4Y91 A;  1QVP A;  4ZGE B;  1XOV A;  3I55 T;  1YHQ A;  5GAO m;  4N0A A;  1VQ6 T;  4KUI A;  2DKG A;  1RL2 A;  5D6W A;  3DLM A;  2XHC A;  4ELY C;  4C0Z A;  5KE3 A;  4ELZ C;  3S6W A;  2RJF A;  3G71 A;  4RCC A;  2C06 A;  2CKK A;  3VYH B;  2V8I A;  2K3Y A;  5GAM f;  3LYI A;  3QG1 A;  3G7Z A;  3V7R A;  3WXM B;  1VQM A;  1WQW A;  5GMK e;  2H3J A;  2JOY A;  3PIP A;  3CD6 A;  1Q81 U;  3JB9 D;  4M7D G;  3BW1 A;  4KBM B;  3RKX A;  3CCQ T;  3H6Z A;  5CVI A;  1M1K U;  5KE2 A;  2EQU A;  5GAN 4;  1UEB A;  1FXX A;  4C92 A;  2DEQ A;  1WPY A;  4BE0 A;  1Q82 U;  5DLQ E;  5GMK m;  4HT8 A;  2YLB A;  5CKB A;  2OAU A;  3HRT A;  1VQM T;  4PJO A;  2LCC A;  2EYQ A;  4M77 E;  1JBM A;  4PLI A;  2BUD A;  4M7A B;  1YIT A;  4C0D C;  3CCE T;  2V8K A;  2XKO C;  3VUZ A;  5GAM h;  3CCJ T;  2LQ8 A;  5HY6 A;  4B9W A;  2EIF A;  4FT2 A;  2CS7 A;  3F70 A;  4IUP A;  5I2S A;  3URG A;  2E70 A;  4IUQ A;  4KUL A;  2MAM A;  3I55 A;  5FLX E;  4MDW A;  2RHZ A;  2VGM A;  3OBY A;  3Q1J A;  3OYG A;  3HSB A;  4C8Q F;  4M7D A;  2R5M A;  4N4H A;  1UGR B;  3M55 A;  4M7A F;  4XU2 A;  4MDX A;  4XTW A;  2A3L A;  1DJ7 B;  4BY6 B;  4IUV A;  2JVV A;  1QVF S;  2M1H A;  4HA8 A;  1JRI A;  4JS5 A;  4HCB A;  1QW1 A;  4M75 E;  2CGH A;  2XDD A;  2HBP A;  2LCL A;  4KT0 E;  4ATO A;  5GAN f;  4Q5W A;  2E10 A;  3CCM T;  1NZ9 A;  3AHU A;  1VIE A;  3X26 B;  4A4E A;  2PUK B;  1VQ4 T;  5LJ5 h;  3SWN B;  2ZGW A;  3HP9 A;  3OMG A;  1YJ9 A;  2PU9 B;  4FT4 A;  2X4J A;  5L8R E;  3CCQ A;  3QDR B;  4JRK A;  1EIF A;  4JUV A;  1WJS A;  3OYI A;  1I81 A;  1LJO A;  1KC8 U;  1ZHI A;  2EJG A;  4A53 A;  5CAI A;  5GAO p;  3OYY A;  2K2V A;  4JLI A;  4RKU E;  2E6Z A;  5A2Q E;  2HAX A;  3JB9 H;  4EDU A;  4LDX A;  2DO3 A;  1M90 C;  3CCV T;  1KG1 A;  1UGS B;  2DTO A;  3CBM A;  2K5I A;  2LT4 A;  3JCM W;  4BB7 A;  3JCM f;  3FEO A;  1Y96 B;  2K57 A;  5IN1 A;  5GMK j;  1FWZ A;  3SWN C;  5KCO A;  1VQO T;  1KC8 C;  2NLU A;  4C5G A;  4C92 D;  4M7A A;  3LWH A;  3X28 B;  3LWI A;  2X4X A;  3PMT A;  3OYK A;  3HRU A;  2KQW A;  3NTI A;  1U1S A;  2JTM A;  3OS2 A;  5A0L A;  3CXC S;  4J8O A;  1VQL T;  4MZT A;  3JCM P;  1W4S A;  2QDY B;  5C0M A;  2RHU A;  1M4Z A;  2VC8 A;  3DLL A;  4C5E A;  5FRN A;  4WF2 A;  4BDY A;  1HK9 A;  4M78 C;  4MZP A;  5LJ5 f;  1M1F A;  4M78 G;  4BD3 A;  2E64 A;  2HNI A;  4OB1 B;  5A0D A;  2XID A;  2RM4 A;  5CK9 A;  2V8J A;  4BI4 A;  3EFS A;  3JCM b;  2XU8 A;  2MWO A;  3E9G A;  3HPW A;  1YIJ T;  3FJP A;  2BIV A;  4LDV A;  3BY7 A;  4EMK A;  2GCX A;  3CCJ A;  3JCM J;  3UWN A;  5LJ3 d;  2FVU A;  5J3B A;  4M77 A;  2P0Q A;  2WSC E;  4NL2 A;  2QEX A;  4E7L A;  4GY5 A;  1YJN A;  2D6F A;  2QQ9 A;  1VQ7 T;  5C6S A;  2DAQ A;  3H8Z A;  4XU1 A;  3JCM h;  1Y07 A;  1YBY A;  3OS1 A;  2EQM A;  1YJW A;  3M59 A;  3BDL A;  3JAM E;  2YLC A;  2P0K A;  5LJ3 e;  3S3O A;  1WQ7 A;  5CKH A;  1K9M U;  2QI2 A;  4LDW A;  2DVE A;  3MCA B;  3PFS A;  4M77 B;  3L1A A;  2P4T A;  4N0A C;  4A4K A;  2KAF A;  3CCM A;  4IUT A;  3ZFJ A;  3OMC A;  4ZGJ B;  3G71 T;  1YJW T;  3KBG A;  2L89 A;  4M7A D;  4F7U F;  2L3R A;  5LJ5 j;  4FIB A;  1O75 A;  5CKF A;  3OW2 A;  3X24 B;  3V8J A;  4BDZ A;  4OGC A;  5DY9 A;  2E41 A;  5CO7 A;  3TEE A;  4A4F A;  5GAM g;  3UDC A;  1ZQ1 A;  1YI2 T;  4R55 A;  4IKF A;  4IUR A;  3FB9 A;  3HHT B;  4LDU A;  2E12 A;  1S72 T;  1N8R C;  1UB4 A;  1O9S A;  2MWP A;  5CQY A;  4BE2 A;  1YHQ T;  3FC3 A;  4C8Q C;  5CQX A;  1JB0 E;  4JJN K;  3OYH A;  1K8A U;  2GQV A;  3I56 T;  3OSV A;  2FL7 A;  5GMK h;  2LVM A;  1VQ9 T;  2JN0 A;  2JUF A;  3JCM Q;  4ZTF A;  2K3X A;  4FSX A;  3C4S A;  3HKS A;  4F7U G;  3QSU A;  2RB6 A;  3CCR A;  5GAO r;  3MP1 A;  2DIG A;  3O8V A;  3ER0 A;  4M75 F;  4BI8 B;  3JCM g;  4JRQ A;  4N4I A;  4LD9 K;  2M9U A;  1BI3 A;  2KMT A;  4JS4 A;  2P0P A;  1Q81 C;  3HL8 A;  1H3Z A;  5LJ5 d;  4F7U A;  3OYF A;  4PJO C;  2EWN A;  3QZ9 B;  3CC4 A;  3INZ A;  1W2B S;  4NOY A;  2O4X A;  2QTX A;  1M1K C;  2MMP A;  5GAM e;  2RD1 A;  1M1G A;  2RHX A;  2GF7 A;  2ZCF B;  1BYM A;  1ZBX A;  3CME T;  3QYG B;  1VQK A;  1OYX A;  1N27 A;  3CXC A;  1I4K 1;  3UPU A;  3CCS T;  4X9C A;  2RJE A;  3CBO A;  3A8G B;  5I2M A;  4A4H A;  5DLO A;  3CCU T;  2XDB A;  2WAC A;  1LNX A;  2XDP A;  3CMA T;  3RER A;  3E1S A;  4OB0 B;  5HK0 A;  2VXE A;  1U1T A;  3GOX A;  2YHT A;  3JCM V;  2D9T A;  5GAN d;  4HT9 A;  2M16 A;  2AHJ B;  2LT1 A;  2DZC A;  1KQ1 A;  3ME9 A;  3RKW A;  3HFN A;  4PJO F;  4VUB A;  1U8R A;  5LJ5 e;  3CPF A;  2QA4 A;  3I56 A;  2IVW A;  2OTJ A;  1QP3 A;  1JJ2 A;  1VUB A;  4JRP A;  4RCB A;  1UGP B;  4M7D D;  2MI6 A;  3G4S A;  3A8H B;  3M58 A;  2LNV A;  3PGG A;  3QUI A;  5HK3 A;  5GAO l;  4PL6 A;  1B34 A;  3RKY A;  4M77 D;  4J6W A;  4M75 C;  3KXT A;  3LH0 A;  3VUB A;  2K5F A;  3GLX A;  3V8L A;  2M0O A;  4ME7 A;  2RH2 A;  1WJR A;  2XD0 A;  3JSC A;  5CR2 A;  2RO0 A;  1M9S A;  2CZ6 B;  2QQB A;  4QQ6 A;  2DXB A;  4EMG A;  5GAO n;  2KDS A;  3OY9 A;  4DOW A;  4HCC A;  2CZ0 B;  2X4W A;  3C95 A;  2PVG B;  3QXE B;  1D3B A;  1N9S A;  2PVO B;  5D6X A;  4C0G A;  3G4S T;  1NE8 A;  1I5L A;  2XI9 A;  3MEU A;  2R5A A;  5GAN e;  3OYJ A;  3L2V A;  3CC2 A;  2EJ9 A;  2RI3 A;  1W2B A;  2ZPE B;  4DA4 A;  4JDS A;  1IRE B;  1KD1 U;  4KUD K;  2L8D A;  5CIU A;  1XTD A;  5AYF A;  3OYD A;  3CCS A;  1Y7X A;  1M90 U;  3A8L B;  3MEW A;  1V29 B;  3FDR A;  1D3B B;  1X75 C;  3EAE A;  3MET A;  5LJ5 g;  2HQX A;  1RI0 A;  3OBW A;  3LW5 E;  3OYB A;  1NPP A;  4E7K A;  4A54 A;  4O6J A;  1IZ6 A;  4M7A E;  2FYK A;  2E65 A;  1K8A C;  2XIC A;  2FB7 A;  2QXF A;  4J7I A;  3TU4 K;  1B34 B;  4CI0 C;  3GIB A;  2RI5 A;  4FL6 A;  4OMF B;  4PKC C;  3M9Q A;  1PSF A;  4ZN3 A;  4L6V 5;  3CCL T;  2XG8 D;  1BI1 A;  4MZM A;  3JCM c;  1VIF A;  2ZPF B;  2A7Y A;  5IAY A;  1MGQ A;  5KCH A;  2B8A A;  3GPL A;  3MHX A;  5GAO q;  4NL3 A;  5LJ3 f;  3PNW C;  4M7A G;  1Q86 U;  4BE1 A;  3E19 A;  2RHY A;  3LGF A;  3P8B B;  3WVD B;  1VQ5 T;  4L5G A;  4JLG A;  3QJY A;  4M77 G;  1VQ9 A;  3KUF A;  5M9O A;  3P8H A;  1OZ3 A;  3ZBD A;  3L2R A;  3CCR T;  2DD5 A;  1HXD A;  1MHN A;  3N5B B;  4J7F A;  2RJC A;  3RES A;  3PMI A;  2PVD B;  5GAM d;  2LQK A;  4M78 A;  1BIB A;  1YJN T;  2YRV A;  2O01 E;  2QQA A;  4OF1 A;  4D6W A;  1Y96 A;  4M75 G;  2XK0 A;  4XTU A;  5GMK l;  3M54 A;  3ASK A;  2LDM A;  3VU3 C;  3M4Y A;  1YI2 A;  3QYH B;  1VQ5 A;  5A0G A;  2WSE E;  4NS5 A;  5KH6 A;  3JB9 G;  2LTO A;  2KSS A;  2QQS A;  3DB3 A;  1QP2 A;  4LDY A;  2Y4Y A;  3HFO A;  2WSF E;  3CC2 T;  4XQ3 A;  5GAM j;  4C0D B;  4BAC A;  4OB3 B;  3CCL A;  1N9R A;  2VV5 A;  2KY9 A;  3M56 A;  2DTH A;  3MEA A;  4E7J A;  4E47 A;  3SDZ A;  5FU7 B;  4F7U E;  3OA6 A;  4ZTJ A;  3OS0 A;  1X01 A;  3LLR A;  4GLK A;  3C12 A;  2RI2 A;  4QW2 A;  2BKD N;  1G3Y A;  3CPW S;  1UGQ B;  4DQ2 A;  5LJ3 g;  2VGN A;  5EG2 A;  1VQ7 A;  4FM4 B;  2QEX T;  3HRS A;  3OB9 A;  4M7D B;  4Z02 A;  1G3T A;  3CD6 T;  1BI0 A;  2IG0 A;  2EQJ A;  1NJI C;  1VQK T;  4M7D E;  1M5Q 1;  3JRZ A;  3A8M B;  3CME A;  3G6E A;  1VQP T;  3CCV A;  2G3R A;  4C8Q E;  1FX7 A;  3DB4 A;  1NPR A;  4RG8 A;  2X35 A;  1YIJ A;  2DD4 A;  3WVE B;  5FRM A;  3RMS A;  3VYG A;  1XNI A;  3J80 E;  3LX7 A;  1VQN A;  3OQ5 A;  2OTL A;  3OYL A;  3OYE A;  3JCM X;  3QHS A;  4J5Y A;  4UC4 A;  3QZ5 B;  4M75 D;  4M77 C;  4C92 B;  5HKC A;  3PIO A;  1OZ2 A;  1Q86 C;  4M77 F;  4PJO B;  2RHI A;  3P8D A;  2EJF A;  1X6O A;  3TCJ A;  1VQP A;  1QVF A;  4M7D C;  5GAN h;  3OSS C;  3L2Q A;  4XTZ A;  2R57 A;  4RMO A;  2EAY A;  4E7H A;  3L2U A;  2QQR A;  4JRI A;  4X9D A;  1VQL A;  1SSF A;  2EQK A;  4X34 A;  3QPH A;  3J81 E;  3RMQ A;  3FRN A;  4XTV A;  2E1H A;  1QVG S;  1K9M C;  4II1 A;  4A4G A;  1GXI E;  2KK4 A;  2HD0 A;  4M78 F;  2Y90 A;  3M5A A;  4C5I A;  4QVD A;  3OS5 A;  4BY6 C;  2MF2 A;  5LL6 S;  2E6N A;  4BUG A;  2JZ2 A;  4C92 G;  3GNG A;  4OGE A;  4EMK B;  2PUO B;  5GAN 8;  3L2Z A;  5CCA A;  3CPW A;  2RJD A;  1K73 C;  3OW2 S;  2RK1 A;  1G5V A;  3FLG A;  3EFR A;  3OYN A;  5LJ3 j;  3G6E T;  3CCE A;  5IT9 E;  3SWN A;  3CC4 T;  5J26 A;  2D0Q B;  3PTA A;  4M78 B;  1N8R U;  4PJO D;  2LX9 A;  3NFC A;  4PLL A;  3SB2 A;  2VXF A;  5GMK i;  4M75 B;  1KQS S;  2ZZD A;  2K5L A;  5FU6 C;  1YCY A;  3OYC A;  2DK3 A;  3QII A;  1KQ2 A;  1BIA A;  4J6Y A;  3CC7 A;  3M57 A;  4OP0 A;  4C5H A;  4XAX B;  2JNG A;  2DPP B;  4OB2 B;  1PSE A;  3X25 B;  3CMA A;  3GP8 A;  4XU0 A;  2DTI A;  4OVA A;  1KQS A;  4LD6 A;  4CRI A;  4EMK C;  3TRE A;  2EKO A;  3OYM A;  4M75 A;  1JJ2 S;  4XK8 E;  2FHD A;  3S3N A;  2Y4X A;  3OYA A;  3MP6 A;  2RA2 A;  2KVQ G;  4L59 A;  4PJO G;  4C92 F;  2I2L A;  4C8Q D;  2DXU A;  5FU6 B;  1I8F A;  3A5Z B;  2CZ7 B;  4O5V A;  5GAN 6;  1KD1 C;  3GF5 A;  3NTK A;  4QVZ A;  4P5N A;  1YIT T;  3QBY A;  2O4X B;  2CYZ B;  2DXC A;  4BI3 A;  2VYT A;  4J83 A;  5J39 A;  3L2W A;  1WJQ A;  2QA4 T;  2OTJ T;  1WGS A;  4E7I A;  3JB9 J;  2X4Y A;  3FIF A;  3M4G A;  4M78 E;  1G3W A;  5GAN 7;  3E9F A;  3RIR A;  3JB9 I;  2ZPB B;  5I21 A;  1KHI A;  3NTH A;  5DM7 R;  4C8Q A;  4M7D F;  2F5T X;  4QQD A;  4M7A C;  4PJO E;  4V2S A;  3MP8 A;  4Y28 E;  2DIQ A;  4FU6 A;  3CC7 T;  4J6X A;  1K73 U;  2ZPI B;  5GAN j;  1Q7Y U;  1P92 A;  1QVG A;  4MML A;  1XQH A;  1VQO A;  2PQW A;  4DOV A;  3C94 A;  1Q82 C;  3ZEH A;  4TVR A;  3BDU A;  3CBP A;  3BFM A;  2F5K A;  4IUU A;  3V7C A;  4C8Q B;  1KHC A;  2ZPG B;  3DKM A;  1BI2 A;  1LOJ A;  3V7S A;  3X20 B;  2HQE A;  1VQ8 T;  3JB9 F;  2F69 A;  5CKE A;  5FU7 C;  3A8O B;  1N6A A;  5FRO A;  4ZN1 A;  4RG2 A;  1VQ6 A;  3PT9 A;  5GAN g;  1BKB A;  2E5Q A;  5GAN 2;  1Q7Y C;  3SD4 A;  3QO3 A;  2JTF A;  1OI1 A;  2LC4 A;  2R58 A;  3T9N A;  3CEY A;  3CCU A;  1YJ9 T;  1R8O B;  4B9X A;  3SFM A;  1VQ8 A;  1WNL A;  3V8K A;  2K4Y A;  3VKI A;  2RK2 A;  2ZPH B;  3JCM e;  4C92 E;  4C8Q G;  1G3S A;  3L42 A;  3VV0 A;  5GAN 3;  5LJ3 h;  3GNF B;  2L5Q A;  2GFA A;  5D6Y A;  2DXT A;  3UT1 A;  4QVC A;  4M78 D;  1VQ4 A;  4YTL A;  2DJZ A;  2LRQ A;  4F7U B;  3J7A F;  4EMH A;  3LGL A;  4EPC A;  5GAN 5;  3R6O A;  4XTY A;  1TH7 A;  2VUB A;  3RUX A;  3S3M A;  3QKJ A;  4ZGD B;  1AHJ B;  2EFI A;  3M53 A;  4R56 A;  4XTX A;  1M8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...