1Y96A

Crystal structure of the gemin6/gemin7 heterodimer from the human smn complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Gem-associated protein 6
publication title The Gemin6-Gemin7 Heterodimer from the Survival of Motor Neurons Complex Has an Sm Protein-like Structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 86
sequence length 86
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1y96A00
5GAMd 5GAOl 2E65A 3FJPA 4EMGA 3JB9D 3GIBA 5GAOm 4PJOD 4XTYA 4M75C 5LJ5f 4HA8A 2E10A 1WPYA 3EFRA 4QVDA 1WQWA 4M77D 5GMKh 5LJ5g 4C92A 4M78E 3RKYA 2E41A 1I5LA 5GAMf 3SWNB 1I8FA 2DZ9A 5GMKj 3JCMJ 5GAN6 3JB9G 4PJOG 2DTOA 4NL3A 4N0AA 1WQ7A 2HNIA 2RA2A 4M7DC 3V7SA 2EJFA 4M77G 2ZGWA 5GAN8 4C92E 2VXFA 3JCMX 4HT8A 4XTVA 1JBMA 5GAOq 4J6WA 4M7AC 2DTHA 2FYKA 4J5YA 4PNOA 4NL2A 4XTZA 2DXUA 1HK9A 4M75B 4MMKA 4X9DA 4XU0A 3SWNA 3BW1A 1JRIA 4PJOF 4F7UG 4M75F 4M7DG 3JCMg 4M77B 4X9CA 2VC8A 3JB9H 1Y96B 4M75D 2EJGA 4M77F 5GAN4 1N9SA 5GMKi 3VU3C 5GAN2 2DZCA 4JRKA 5GMKl 2YHTA 2QTXA 4XTWA 5GMKm 1YCYA 3M4GA 1MGQA 3JCMb 5GAOr 3V7RA 2EJ9A 3FB9A 3JCMW 4M7DB 4NOYA 4F7UB 4XU2A 5GAMg 4M7DF 2Y90A 3BDUA 4M75G 4F7UF 2RB6A 2K57A 4DQ2A 3JB9J 4M7DD 5CAIA 4M75A 3BFMA 4PJOA 1BIAA 3BY7A 3L1AA 4JUVA 4RCCA 5GMKe 5GANh 5LJ3h 3QUIA 4M77A 1Y96A 4XTUA 4WF2A 3SB2A 3JCMQ 4M7AD 4C8QC 5GANj 2EAYA 5LJ3j 4PJOB 1M5Q1 3JCMV 4PJOE 4XU1A 3JCMP 4M75E 1N9RA 4OP0A 2YLBA 1D3BB 5LJ5h 4M7DA 4V2SA 4F7UA 5GANe 4M77E 3PGGA 1I4K1 4M78C 4XTXA 3HSBA 3INZA 4M7AG 3FIFA 1H641 3JCMc 3V7CA 5I21A 5LJ3d 5LJ5j 3RIRA 5GANd 3RKWA 2E1HA 4EMKC 2RM4A 2CGHA 1LJOA 4Y91A 5GAN7 4M7DE 3HFNA 4F7UE 1LNXA 5GANf 3RUXA 4C92C 1TH7A 2YLCA 3RKXA 5LJ5d 4M7AB 1D3BA 4C8QB 4M7AF 5DY9A 4C8QF 3QO3A 4XU3A 4A53A 3QSUA 4J6XA 4N0AC 4J6YA 3JCMh 4C8QD 5GAOp 2VXEA 4JRIA 4RCBA 5GAN3 4PJOC 1LOJA 1B34B 4HT9A 2DJZA 4C92G 3RERA 1KQ1A 2I2LA 4M78B 1BIBA 1U1SA 4M77C 3V8JA 2DTIA 4M78F 5LJ3e 2DXTA 4M78D 4EMKB 4EMHA 1X01A 5GAMh 4C8QG 4JLIA 3RESA 2DVEA 3SWNC 3JCMe 3L2ZA 5GAOn 4C8QA 4M7AA 1M8VA 4QVCA 4C92B 3V8KA 1HXDA 3QHSA 3JCMd 5GAMj 1WNLA 2DKGA 2RD1A 4C92F 4MMLA 4A54A 5LJ5e 3HFOA 1KQ2A 2DEQA 2EWNA 2E64A 3EFSA 4M78G 1B34A 5LJ3f 4C92D 2JN0A 3AHUA 3V8LA 4M78A 1U1TA 5GANg 4XQ3A 5LJ3g 5GAMe 1I81A 2FB7A 4M7AE 3JCMf 5GAN5 3JB9I 4C8QE 3JB9F 4EMKA
chains in the Genus database with same CATH superfamily
5KYYB 1BYMA 2AKKA 1WPYA 2DK3A 1ARKA 2D0NA 5LJ5g 4M78E 5CCAA 1I5LA 1M8MA 1M9SA 3EG9A 1UUEA 2RHUA 1VQNT 2JM8A 2LJ1A 3AT1B 2EJFA 2P0QA 1Q81C 1O9SA 1ZX6A 2QQ9A 4AFUC 1S72A 4J6WA 1UHCA 4J5YA 2ED0A 1E6HA 4A4HA 4M75B 4X9DA 3H9NA 3C0CA 1JXMA 2GTOA 3MJXA 4M77B 1J3TA 3CCRT 2DA9A 1YIJA 3CMAQ 1WLPB 3A98A 4ZGJB 5GMKm 2CSQA 2DM1A 2QDYB 3M0RA 3OYGA 3RR6A 4C0DB 1D1AA 1Y96A 4OGEA 1VQ6Q 1YJWA 4PFPA 2ZAEA 1ZSZB 5FLXE 3JCMV 2FEIA 3MP1A 3ASKA 2E12A 2O2OA 1ZSGA 4M78C 1JXOA 3HHTB 1C6VX 1TSFA 4HCBA 2L5QA 4EMKC 3G1JA 3HPWA 2V8IA 1M4ZA 2WACA 3X20B 4ZTJA 2RQRA 2KGTA 5DLOA 2BTTA 3DKMA 1NJIC 4JRIA 2PVDB 1VQKT 1VQKQ 2WSCE 2LT1A 3V8JA 4DEXA 4M78F 1Q82R 1LCKA 1S72Q 4Y28E 3SHWA 3CMET 3CC2A 4ZGDB 1BI0A 3A8MB 4YTLA 2HKNA 2LDMA 1YIJQ 4VUBA 4LDYA 2EW3A 2DFUA 2RI3A 3OA6A 1OOTA 3JB9I 1M1KU 2JZ2A 2E65A 1QLYA 1TWBA 1UGVA 4HCZA 2SRCA 4DOWA 3OBWA 3OYYA 5I2SA 1VQOA 2K9GA 4IIMA 1YJWQ 3JB9G 2V1RA 3QG1A 2R57A 3V7SA 4M77G 2FRYA 4PLIA 4J83A 2HD0A 4RTUA 5KCHA 5CKDA 2RI2A 2EKOA 5I2MA 1G2BA 2AZVA 2HSPA 1B07A 2KT8A 3I55A 5GMKi 4KH0B 4F14A 4JRKA 2JS0A 1D0YA 1IGUA 3V7RA 2ABLA 3FB9A 2X4XA 1N8RR 4PJOA 1M30A 1WXUA 2QA4A 3C95A 5LJ3h 3CXCA 2RQUA 1I1JA 2E5KA 1YJ9A 3CC2Q 1QVPA 1NG2A 3PVQA 2K3XA 2I0NA 2E1HA 2BZXA 2XMFA 3NGPA 5IXBA 2EGEA 3OSSC 3M0PA 5CKEA 1X6OA 1VQOQ 2ENMA 1ZUKA 4XU3A 2VXEA 5GAN3 1VQ9T 2L89A 1IZ6A 1KQ1A 2FPDA 5CIUA 3M0QA 3I9QA 2SEMA 1H8KA 2ZZDA 2A7YA 3EH2A 4LDWA 1ACMB 2CP2A 5GAOn 4HCKA 1Q86C 3QIIA 4BE0A 1YWPA 4PKCC 1G5VA 3AHUA 3I55Q 4ANJA 1MV0B 1UGQB 4ESRA 4JZ4A 2JJ9A 1RAIB 2VWFA 4ELZC 3OS2A 2DXCA 3EFOB 1KG1A 4HA8A 1WHLA 5GMKh 2QA4Q 2CREA 2KMTA 3QDFA 1BKBA 1WJQA 1I07A 1NPRA 4OF1A 2HNIA 2K5LA 2HKQB 1YJ9Q 1B3QA 4E7ZA 4K11A 4GBQA 2DTHA 1PC0A 3VS7A 1UJYA 5A2QE 3VJPA 1EFNA 3CQTA 3SWNA 4Q5WA 1M3AA 4Z89A 1VUBA 4FT2A 4HVWA 3OYHA 1KHCA 3H0IA 2RNAA 3D7SB 4M7DD 2X3WD 3BY7A 2CUDA 2EBPA 2D9TA 2LQKA 1K9MR 4E7IA 2K5FA 2DD5A 3S3MA 4OP0A 4AG1C 3INZA 4E7SA 1SRMA 2FZCB 4EIKA 1X2KA 1TH7A 1PSFA 2QYZA 2KBTA 4M7AB 4JJCA 1YCSB 4KBMB 5DY9A 2BE7D 4J9BA 5D6XA 1QWEA 4J9GA 1Z9ZA 4ATOA 2ZPEB 2KVQG 2KQWA 2NLUA 2DTIA 2DYBA 4GLMA 2FHDA 1VQ4T 4QW2A 5ECAA 3MO8A 4R0KA 1X01A 1H92A 1KIKA 4JPBW 1T0HA 1BI1A 4QVCA 1JB0E 1PKTA 3V8KA 2EQKA 2FZGB 2EVRA 4D8KA 4LE9A 1NM7A 2KXCA 5GAMe 3RNJA 5J39A 1OZ3A 4FL6A 1F1BB 5GAOl 2YUNA 3QJ6A 4PJOD 1ZQ1A 2NYSA 5FU6C 1UHFA 9ATCB 4C92A 1PSEA 2D8HA 1AEYA 4JJBA 1SPKA 3JCMJ 1TUGB 1NPPA 2YRVA 3GPLA 2M9UA 3CCVT 1K8AU 3CCMA 2YXYA 2MF2A 3REBB 1NYGA 4LD9K 2RH2A 2DL8A 1RABB 3M58A 4QKUA 5HCKA 1QWFA 1H3HA 2V1QA 2KAFA 2JUFA 1K73R 4FT4A 2HQHA 2CT4A 5GAN4 3CCEQ 3CCET 2DZCA 2GCXA 1YI2T 3MP6A 4FW1A 1YI2Q 4J7FA 2A08A 1WI7A 5GAMg 4MZMA 1O75A 2EYYA 4JJDA 7AT1B 1VQ8A 2AZSA 1RAGB 3M5AA 2YWWA 1BI3A 2RK2A 1NEBA 2PUOB 3S6WA 4FU6A 4PJOE 4XU1A 1ZHIA 1RLQC 3JCMP 3UDCA 4KGVB 1ZBXA 2RPNA 2IVWA 2MOXA 5CKHA 3MKDA 1FMWA 4M7AG 5GANd 5I21A 2ED1A 1Y7XA 1SF9A 1Q82C 2HZYA 2QG9B 4LN2A 1T0JA 4FIBA 5KE2A 1GFCA 3S3NA 1OEBA 1NLPC 2DILA 3HRTA 1U1SA 1UECA 3FEOA 3CCMQ 2MYSA 1GFDA 3UATA 2QDLA 4RTVA 2ESWA 1WNLA 4BE1A 4OB3B 4PJLA 1PG5B 1K9AA 5IHKA 1IHVA 5KYXB 1E6GA 1ABQA 2GFUA 4XTYA 2X51A 2COYA 3KUFA 2DZ9A 2RHYA 2EYQA 4RKUE 2OI3A 3RMSA 3ZL7C 2LNVA 5GAN8 3CC4T 3CC4Q 1K1ZA 2DL5A 4A63B 3OS5A 2LQWA 2RHIA 4L59A 2F5TX 1RL2A 4XTZA 3N5BB 2HDAA 2AIRB 1U5SA 4PJOF 3OYLA 5HK3A 1PKSA 1QP2A 2NUPA 4BE2A 2GF7A 2CUBA 1W70A 3CCJT 4JDSA 2O9VA 3C94A 4A4FA 3JCMb 4M7DB 1VIEA 2DX1A 4NOYA 5AT1B 2RK1A 4F7UB 3CXCP 3J81E 2VVKA 4DQ2A 2JMAA 3LH0A 1BBZA 4JUVA 4FYVB 3QUIA 2O88A 2PZ1A 1YHQT 4LUEA 4WF2A 1GBRA 5L8RE 1UDLA 5LJ3j 2XDPA 3GNGA 1OPKA 1N9RA 2YDLA 3QDRB 3TSWA 4DA4A 2QTVA 3NMZC 1H641 3QZ9B 1VQMT 2G6FX 2HSEB 2R5MA 3MEAA 1LNXA 1VA7A 3OS1A 1T3LA 1ZA2B 1KD1R 2DL7A 4JS4A 2K2VA 4ORZA 1VQNA 1JEGA 1M8VA 1YNZA 2DJZA 3RERA 4M77C 3CBMA 3LH5A 1P92A 2F2XA 1YJNT 4M78D 4EMHA 4DEYA 4C8QG 2HAXA 3NTIA 3SWNC 1JU5C 2HQXA 4AFZC 1Y07A 2O9SA 5I22A 1HXDA 2EQMA 5LJ5e 3CCRA 4MMLA 4A54A 1Q81U 3LW5E 2DRKA 3JB9F 3J7AF 4EMGA 1OU9A 3A8HB 2BZ8A 3VV0A 1R77A 3G4ST 3G4SQ 1IO6A 1TXQA 3M54A 3HP9A 5FROA 5GMKj 5GAN6 1M1GA 2DTOA 1HJDA 1WQ7A 2P4TA 2RA2A 3OYAA 3OYBA 5FRMA 4C92E 5FU7C 2MCNA 1JBMA 2DL3A 4IUTA 2CP6A 5CQXA 4NL2A 2DXUA 4M7DG 2KDSA 4F7UG 2CZ1B 3MEWA 4IUVA 5HY6A 1K9MC 1M90U 1FMKA 2L8DA 2PQWA 4C5IA 4GY5A 2XKOC 3A1PA 1QCFA 3T9NA 1VQNQ 3LX7A 1VQKA 5GANh 3PMIA 1OQKA 4XTUA 1AT1B 2LC4A 3CMEA 3FLGA 4FYXB 1NJIU 1PD1A 1I0CA 1KC8R 3CCRQ 1AWJA 1B7TA 3V7CA 4F16A 2CP7A 3RIRA 1MUZA 4HVVA 2A28A 3RMQA 3I5SA 2DIGA 5D6YA 4FM4B 4C92C 5LJ5d 1K0XA 1D0XA 1M2VB 4JS5A 1D1CA 4J6XA 4J6YA 3ZFJA 2NUTA 2HL3A 4OMFB 4HT9A 4KGZB 1QVGS 2RJFA 1X6BA 2F2VA 3CCST 2LRQA 2VKNA 3JCMe 4C8QA 2QEXT 4QT7A 2LNHB 2P0PA 4C92F 3HFOA 3R6NA 2EWNA 4DBQA 1EZZB 4O6JA 4AMCA 1PM3A 2IG0A 3MEUA 3QXEB 4E7JA 2ZPBB 2DVJA 4RTTA 1GRIA 3FJPA 1MMGA 1Y57A 1NE8A 3HTRA 1VQLT 4F17A 1FWZA 1GL5A 1IB8A 2JTFA 3KXTA 1K73C 2DAQA 3CMEQ 1Q95G 1TUCA 3JAME 1MNDA 5DM7R 4LNPA 5KYWA 1G83A 2HL5C 5CKFA 5FWBA 5FW9A 1K8AR 3JCMg 3M53A 2VASA 2QQRA 1N9SA 5IT9E 2E3HA 2H3JA 2JS2A 3G6ET 2PTKA 4RTWA 4N4GA 2Y90A 2M16A 4M75G 1VQ9A 2BUDA 3FRNA 3EGDB 4AG2C 4JJNK 3Q1JA 3O5ZA 1WZOA 4L6V5 5CR2A 3JCMQ 5IHNA 1N27A 3UWNA 4RUGA 3VS4A 2CP5A 4ME7A 2XK0A 2ZPIB 2VYTA 3OYKA 2YUOA 3FDRA 1XNIA 4DBRA 4A4EA 3HFNA 1Q86U 5GANf 1D3BA 2EIFA 4BI4A 3LWHA 2MIOA 3RBBB 2KRSA 1UTIA 4M78B 2DF6A 2DYIA 1G3WA 4EDUA 3I56T 4EMKB 2MMPA 3L2ZA 3TSZA 2E5QA 1K4US 3EG0A 4J8OA 1UEBA 2W0ZA 5DLQE 2M1HA 1BCMA 2JOYA 2WSEE 4O5VA 5GAN5 3C4SA 2NWMA 4C5HA 3TQ7P 1VQ9Q 4R56A 2MK5A 1KJWA 2E41A 1WXTA 1SHFA 1PD0A 3A5ZB 1ABOA 4BI3A 1VQPT 1OZ2A 4GLKA 5KYYA 5GJWB 4M7AC 2J6OA 1VYTA 3BW1A 1JRIA 1BCOA 2QQSA 4BB7A 3JB9H 1K0SA 2EJGA 1QCNA 1WGSA 4OMLA 1U3OA 3M9QA 1UGRB 3THKA 2COWA 2EJ9A 3JCMW 3CCQT 2J6FA 4RTXA 3BDUA 4CC4B 5CAIA 4M75A 3FJ5A 4BI8B 1RUWA 4M77A 3H0HA 1VQ4A 4HCCA 2QXFA 1PWTA 1JJ2P 3HRSA 4PFZA 1G3SA 2EYXA 2W10A 1KD1C 2YLBA 5LJ5h 1PHTA 3CBPA 2F2WA 4C0GA 4OMNA 1ZSZA 3RKXA 4IURA 2JT4A 3I35A 4B6MA 1JJ2S 3CCVA 4RCBA 1LOJA 4J9EA 1B34B 4HXJA 1OI1A 5D7UA 5C0MA 4D6WA 4J9IA 1GXIE 2DBMA 2L3SA 2FRWA 2AT1B 2YSQA 2OX7A 3X26B 2OTLT 2K7AA 4D8DA 2QASA 5LJ3f 3CCEA 5J26A 1YI2A 2F5KA 4C8QE 2VGMA 4L5GA 3ME9A 3VUZA 3EG3A 1Y71A 4ZTFA 3GOXA 1VQ4Q 3E19A 2J06A 3MHXA 1EIFA 2RHXA 4N0AA 2CH4A 1KK7A 1PCXA 3JCMX 4OB1B 2O4XB 2RJEA 1GCPA 4PNOA 3H8ZA 2LVMA 2D0QB 2KI7A 1D1BA 1UGPB 3EG1A 3X24B 3CPWP 1MGQA 8ATCB 1KC8C 2LP5A 4NS5A 3CCVQ 2O01E 4PK4A 4LXCA 1XQHA 3NTHA 2MWPA 2DEUA 1M90R 3UA7A 3R6OA 4C8QC 5GANj 2Y4XA 3P8DA 3UF4A 2BE9B 3EGXB 1V1CA 2LCSA 4C0ZA 4PFOA 2BZYA 4V2SA 3BDLA 5KH6A 3JCMc 1RI0A 3H41A 3CPWS 4A4GA 4QQ6A 3ZBDA 2DLPA 3OB9A 1E7OA 3OW2P 3U23A 4C8QF 2CSIA 2A0FB 5KYUB 3QO3A 4PJMA 4A53A 3PIOA 3EH1A 3TREA 1G8XA 3CBOA 3LGLA 4P5NA 2YRCA 3CCUT 3CC4A 4AFQC 1HSQA 3EAEA 2RJDA 3OBYA 2DXTA 4ZGEB 1LVKA 1YITT 5A0DA 2LQNA 2LQ8A 3GLXA 2M0YA 3MCAB 1TU0B 1WDXA 3M0UA 2DEQA 3JSCA 1R0BG 3EG9B 1AWWA 1ZA1B 3CCJA 2JTMA 2QK0A 4XQ3A 2JW4A 3OW2S 5GJVB 1WHHA 1N8RU 5GAMd 2RF0A 3JB9D 1TTHB 1QP3A 3OS0A 1FX7A 3ZEHA 4BY6C 4LUDA 2HBWA 1NBEB 4M77D 5IXFA 3OYJA 3FC3A 1YHQA 3VRYA 1K8AC 3A8LB 2NUZA 4IUUA 4B9XA 1RAEB 2L3PA 3NFCA 4PL6A 5J3BA 1SSHA 2ZCFB 2ZGWA 2CT3A 3EFOA 3WXMB 1D09B 4HT8A 1W1FA 1AVZC 2FYKA 5CVIA 2A3LA 1VQMA 2P84A 4KUDK 2HQEA 2QAZA 5FU6B 1M27C 2VC8A 1Y96B 2KR3A 1X43A 3NPFA 1UFFA 1Z9QA 5GMKl 3L2WA 4LDUA 2HMAA 3CC7T 1M1KR 2C06A 1MMNA 2DD4A 5IHIA 1OYXA 1YJNA 1QVFP 1VQ7T 2QQAA 2R58A 4M75E 4RTZA 4UC4A 4M77E 3PGGA 4XTXA 1CSKA 4J7IA 3CCJQ 2C0TA 3RKWA 5HKCA 3UA6A 3VS1A 5GAN7 2GNCA 2J6KA 2XDDA 2FO0A 1WJRA 1Q7YU 2CH4W 2CP3A 3G4SA 2Z0WA 4IIOA 3QZ5B 1YHQQ 1QVFS 5FRNA 2E4HA 5GAOp 2FZKB 3QYGB 3JV3A 2X35A 1JJ2A 2XU8A 6AT1B 1XTDA 5AYFA 4M7AA 1VQMQ 2EQJA 2OAUA 1RAHB 4OB2B 5M9OA 3EFSA 4C92D 1AWOA 2JN0A 5LJ3g 1I81A 5GAOm 3H0FA 4M75C 1X69A 1WQWA 1TUDA 5L23A 3HL8A 3M0TA 1MMDA 3SDZA 1K9MU 1YJNQ 4RMOA 1RLPC 3G7ZA 4NL3A 3DLMA 3VS5A 3M59A 2C0OA 4QVZA 2B86A 2B8AA 4II1A 4C0DC 3DB3A 2LX9A 2LX7A 2P4RA 4PJOB 1HK9A 2M02A 4XU0A 1VQ5T 1AWXA 2DNUA 2GQVA 4M75F 1ZSZC 2EPDA 4M77F 1OULA 4CC3A 4JRPA 2GFAA 2DBKA 4E7KA 2DIQA 2QTXA 3M57A 3M4GA 1QQJA 3G71T 3G71Q 4FCYA 2G3RA 3CD6T 3CD6Q 3CCSA 4C5GA 3PMTA 2KRNA 1ZUYA 2PNIA 2KT1A 2DPPB 1M5Q1 2QEXA 1A0NB 2CKKA 2K3YA 2L0AA 4PJJA 1W2BP 3VS3A 4FSSA 3OYNA 3L2QA 3C12A 4Y92A 5LJ5j 2ZPFB 4E7LA 2OTJT 2OTJQ 1WHMA 2RM4A 3OYFA 4E47A 3UT1A 1C0MA 2LJ3A 2XDBA 2MI6A 2VGNA 3RUXA 3CPWA 1VQLA 1IXDA 3TCJA 5IH2A 4N0AC 1GBQA 2K3BA 3PFSA 3E2UA 3GNFB 1QVGP 3QJYA 2EQUA 2VV5A 1W2BS 2BKDN 5GAMh 3PNWC 2M0OA 4JLIA 2OJ2A 3O8VA 1FYNA 2HEQA 1K73U 1X75C 3E9FA 5C6SA 2KEAA 3RDVA 4KGXB 3OYIA 3G6EA 2JVVA 3L2UA 3E1SA 1MMAA 2JXBA 3M56A 2PVOB 4JRQA 3OW2A 3PVLA 4QVDA 1SHGA 4AT1B 3CMAT 4DBHA 1UJ0A 3SWNB 3CCSQ 1XOVA 3PE0A 4PJOG 3KBGA 2QEXQ 1ZBJA 5KYXA 1MNEA 5FWCA 1VQ6T 1OV3A 5IN1A 2FVUA 1AZGB 4IUPA 3NTKA 3VS0A 1M90C 2KYBA 4R55A 1PNJA 3SFMA 1VQLQ 1SSFA 1AHJB 3QPHA 4KULA 4XTWA 4BDYA 2GQIA 4X1VA 1R8OB 2DETA 4J9HA 1WIEA 5FU7B 3CCLA 4BUGA 1BIAA 2FPEA 3I56A 2RQTA 4M7AD 2EAYA 4J9DA 4M7DA 2JNGA 2A37A 2K6DA 4JZ3A 4F7UA 2EYWA 2D8JA 5CO7A 1NLOC 1S72T 2JM9A 1PRMC 3G6EQ 3M4YA 3OMCA 1YIJT 2XD0A 1AOJA 1FXXA 4E2FB 1EX4A 1VQPA 1RAAB 1QVFA 1BIBA 2XI9A 3OSVA 3I5RA 4FW2A 2QQBA 1LPLA 2D1XA 1YJWT 3QWXX 5IAYA 2JTEA 4C92B 3QHSA 3JCMd 1V29B 2DKGA 3A8OB 2GGRA 2E64A 4Z8AA 2GTJA 1G3YA 2FB7A 4M7AE 3DLLA 3CCQA 1U8RA 3VS2A 2XIDA 3GIBA 3A8GB 3CCLQ 2PVGB 3CCLT 1W4SA 4ZN1A 3EG2A 5GAMf 1C1AA 3H6ZA 2D6FA 3I56Q 4DOVA 2EFIA 2M51A 4FYWB 1WA7A 2X4YA 3QBYA 4XTVA 3VS6A 1OX8A 2ZPGB 1K76A 1M1KC 2QI2A 4DBFA 2LTOA 3P8BB 5KE3A 2COZA 1SG5A 2LMJA 3P8HA 3CC2T 2E70A 1RADB 4EPCA 3X28B 2ROTA 1KD1U 4RG8A 3LWIA 3EHRA 4XK8E 1MHNA 5GAN2 2KROA 3L2VA 2MAMA 1YCYA 2YUQA 1X27A 4MZPA 4QQDA 1VQPQ 4RTYA 2AHJB 1QKXA 3L1AA 3WVDB 3IQLA 1WHJA 1VQOT 2CZ7B 3SB2A 1YWOA 2LCLA 2OTLA 2H8HA 5CKBA 1WHGA 1UG1A 1XJWB 4ZN3A 1KQSP 2QGFB 2YUPA 1LJOA 5A0GA 3CCQQ 3DB4A 3LGFA 4N4HA 2YLCA 3I55T 3QYHB 2IPOB 4OMOA 4M7AF 3QSUA 1R0CB 4C8QD 4RG2A 4C92G 2I2LA 2K2MA 2QA4T 2AKLA 1Q7YR 1QW1A 4CI0C 5CK9A 1JO8A 2K4YA 3QWYA 4OGCA 1KQSS 1BB9A 2LZ6B 1W2BA 1M2VA 4HVUA 2O31A 1YJ9T 2DRMA 1VYVA 4M78G 4N4IA 4TVRA 2RO0A 1VYUA 3BE3A 1PRLC 1TS9A 5EC7A 3EFRA 4KH1B 4LD6A 3PIPA 1RAFB 1NEGA 2DERA 1NYFA 1I8FA 2JMCA 1U06A 3OMGA 2FL7A 1QVGA 2NUPB 3LLRA 2X9HA 1KC8U 2PUKB 2KRMA 2OTLQ 2VXFA 1X6GA 5GAOq 1YN8A 3MEVA 5EG2A 2R5AA 4ELYC 2AK5A 4C5EA 5I11A 1GCQA 4X9CA 3X25B 5A0LA 1Q81R 3TU4K 5GAOr 3META 1VIFA 4HKEA 2RI5A 1ZLMA 2H3EB 4Z88A 2K57A 2XHCA 3CCUA 2ROLA 2L3QA 4PLLA 2F1LA 1YITA 4CC7A 4BDZA 2FG0A 5GANe 3UPUA 3L42A 1SRLA 1WXBA 2K5IA 3FIFA 8AT1B 1CKBA 1YP5A 3EGDA 2RN8A 2WSFE 1AZEA 2EGCA 2DO3A 4M7DE 3LYIA 4F7UE 2KSSA 2V26A 1WHKA 3F70A 3PT9A 1Q82U 4JLGA 2X4JA 1NZ9A 3CPFA 5CQYA 2DXBA 2KK4A 3JCMh 1N6AA 3KFVA 3REAB 2ATCB 4LDVA 2GBQA 5KCOA 2CZ6B 1VOMA 1WX6A 3TVTA 4OMPA 2X3XD 2KYMA 5GAMj 1Y0MA 2VUBA 4WTOB 1NJIR 2A36A 3NHNA 1V76A 3V8LA 4M78A 1U1TA 5GANg 2CZ0B 4B9WA 5HK0A 2LJ0A 4EMKA 3CC7A 3CEYA 5LJ5f 1UE9A 1I5OB 3OYCA 3CCUQ 2CYZB 4MDWA 2XG8D 1S1NA 3QKJA 1VQ7A 1YITQ 3OYEA 4M7DC 3ER0A 2EGAA 2RQWA 4IKFA 2RJCA 1AD5A 4MZTA 1M2OA 2HBPA 4A4KA 1WJSA 2J7IA 4MMKA 1OPLA 4E7HA 4M75D 1SEMA 2DL4A 4F04B 3SD4A 3VU3C 1KSWA 3WVEB 4OB0B 4FYYB 5LL6S 4QQGA 3L2RA 4ZNXA 4FSXA 2RQVA 4CRIA 4M7DF 4F7UF 2RB6A 2E3IA 3GP8A 4BACA 4RCCA 4OMMA 2KNBB 3URGA 3E9GA 1M3BA 3VKIA 4OMQA 3CCMT 2CDTA 2FPFA 3ULRB 2CP0A 2ZPHB 1I4K1 2LCCA 2P0KA 3OQ5A 2NUTB 2C0IA 3JRZA 1OX9A 1ZUUA 1QMCA 4Y91A 3TEEA 2CS7A 3CC7Q 2EKHA 3EHQA 4E6RA 3OY9A 1TOVA 3PTAA 4C8QB 1TG0A 1VQ7Q 4PJOC 3VRZA 3M55A 1VQ8T 1VQ8Q 1IHWA 4OVAA 3SEMA 3S3OA 5LJ3e 2ECZA 4KUIA 3HRUA 2YT6A 1M1FA 1VQ5A 1KQSA 2RMOA 1KQ2A 1FMVA 1B34A 4AFSC 1N8RC 1HYOA 3JCMf 2J05A 1YBYA 2KY9A 3MP8A 3G71A 2E10A 5KYWB 1Q86R 2DJQA 3RKYA 3CD6A 2E6ZA 1RI9A 2VB6A 2L3RA 3VUBA 1RACB 2BIVA 5D6WA 2K79A 3GBQA 1IREB 4KRTA 1W6XA 2F69A 3M0SA 1MV3A 3OYDA 2OTJA 4Z02A 1WYXA 2MWOA 4BY6B 2DE0X 1IRXA 4M4ZA 1IGQA 4XAXB 2YHTA 2LT4A 2MPXC 2O4XA 4XU2A 2KXDA 3CXCS 1G3TA 3JB9J 2V8JA 3BFMA 1BU1A 1QKWA 2EQIA 1N5ZA 5GMKe 1H3ZA 2DMOA 1CKAA 2XICA 1YFNA 1OU8A 2HCKA 1VQ5Q 2IIMA 2V8KA 1KFZA 4J9CA 1D3BB 3J80E 3VYHB 3HSBA 4WCIA 2KE9A 5LJ3d 1WFWA 2E6NA 4IUQA 2CGHA 3VYGA 1Q7YC 1M3CA 2Y4YA 4CC2A 2L2PA 1KHIA 3GF5A 1D0ZA 2QGGA 3EGXA 3OYMA 3MPUB 4X34A 3EGUA 3CMAA 4LDXA 1DJ7B 2OAWA 2EYZA 2X4WA 5KYNA 4KT0E 4C0FA 1UB4A 4J9FA 1QCOA 1VQ6A 1BI2A 1HD3A 1BK2A 2DVEA 2RHZA 4PJNA 3RESA 1GCQC 2YRDA 4BD3A 5KYUA 2PU9B 4MDXA 1T3SA 2RD1A 1JQQA 1X2QA 3HKSA 1UGSB 1SKUB
chains in the Genus database with same CATH topology
2XIDA 3GIBA 2GFUA 3ME9A 4XTYA 3VUZA 1BYMA 1WPYA 2DK3A 3A8GB 2PVGB 3CCLT 5LJ5g 1W4SA 1Y71A 4M78E 4ZN1A 4ZTFA 5CCAA 3GOXA 5GAMf 1I5LA 3KUFA 3E19A 3H6ZA 2D6FA 2DZ9A 1M9SA 2RHYA 4DOVA 1VQNT 2RHUA 2EFIA 3MHXA 2EYQA 4RKUE 1EIFA 2RHXA 4N0AA 3RMSA 2EJFA 2P0QA 2LNVA 1Q81C 5GAN8 3CC4T 1O9SA 2QQ9A 2X4YA 3JCMX 3QBYA 4XTVA 4OB1B 2ZPGB 1S72A 4J6WA 2O4XB 2RJEA 2QI2A 1M1KC 2LTOA 3OS5A 3P8BB 5KE3A 2RHIA 4J5YA 2F5TX 1RL2A 4L59A 4PNOA 4XTZA 4A4HA 3N5BB 4M75B 3H8ZA 3P8HA 4X9DA 2LVMA 2D0QB 4PJOF 3CC2T 3OYLA 5HK3A 1QP2A 4M77B 2E70A 4BE2A 4EPCA 2GF7A 3X28B 3CCRT 1YIJA 4RG8A 3LWIA 1KD1U 4XK8E 1MHNA 1UGPB 4JDSA 5GAN2 3CCJT 3X24B 3L2VA 3C94A 4ZGJB 2MAMA 5GMKm 1YCYA 4A4FA 1MGQA 3JCMb 4M7DB 1VIEA 2QDYB 4MZPA 4NOYA 2RK1A 4NS5A 4F7UB 4QQDA 1KC8C 2O01E 3J81E 4DQ2A 1XQHA 3LH0A 2AHJB 3L1AA 4JUVA 3OYGA 3NTHA 2MWPA 3QUIA 3WVDB 4C0DB 1VQOT 1YHQT 1Y96A 4OGEA 1YJWA 4WF2A 2CZ7B 3SB2A 5L8RE 3R6OA 4C8QC 5GANj 2Y4XA 3P8DA 5LJ3j 5FLXE 2XDPA 3GNGA 3JCMV 4C0ZA 2LCLA 1N9RA 3ASKA 3MP1A 2E12A 2OTLA 4V2SA 3QDRB 5CKBA 3BDLA 4ZN3A 5KH6A 4DA4A 4M78C 3HHTB 1H641 3JCMc 4HCBA 2L5QA 3QZ9B 1RI0A 1VQMT 4EMKC 1LJOA 5A0GA 3CPWS 3MEAA 2R5MA 3DB4A 3LGFA 4A4GA 3HPWA 4QQ6A 2V8IA 3ZBDA 1LNXA 1M4ZA 4N4HA 3OB9A 2YLCA 3I55T 2WACA 3OS1A 3QYHB 3X20B 4ZTJA 5DLOA 4JS4A 4M7AF 2K2VA 3DKMA 4C8QF 3QO3A 4A53A 3QSUA 1VQNA 3PIOA 3TREA 4C8QD 1NJIC 1M8VA 4JRIA 4RG2A 3CBOA 3LGLA 4P5NA 2DJZA 4C92G 3RERA 2I2LA 2PVDB 1VQKT 4M77C 2WSCE 2LT1A 3CBMA 3V8JA 3CCUT 2QA4T 3CC4A 4M78F 1P92A 3EAEA 1YJNT 1QW1A 2RJDA 3OBYA 2DXTA 4ZGEB 5CK9A 4M78D 2K4YA 4CI0C 4EMHA 1YITT 1U8RA 4Y28E 4OGCA 4C8QG 2HAXA 5A0DA 3NTIA 1KQSS 3SWNC 1W2BA 3CMET 2HQXA 1Y07A 3CC2A 4ZGDB 1YJ9T 2LQ8A 3GLXA 1BI0A 1HXDA 2EQMA 3A8MB 3MCAB 5LJ5e 3CCRA 4MMLA 4A54A 4YTLA 2DEQA 3JSCA 4M78G 2LDMA 1Q81U 3LW5E 3CCJA 2JTMA 4VUBA 4LDYA 2RI3A 4XQ3A 4N4IA 3OA6A 3OW2S 3JB9I 1M1KU 4TVRA 3JB9F 3J7AF 1N8RU 2RO0A 2JZ2A 5GAMd 2E65A 4EMGA 3JB9D 1QP3A 3OS0A 1FX7A 3A8HB 3EFRA 3ZEHA 4LD6A 4HCZA 4BY6C 3PIPA 4M77D 3VV0A 4DOWA 3OYJA 3FC3A 3G4ST 3OBWA 3OYYA 5I2SA 1VQOA 1YHQA 1I8FA 1K8AC 3A8LB 3M54A 3HP9A 3OMGA 2FL7A 4IUUA 5FROA 5GMKj 1QVGA 4B9XA 5GAN6 3JB9G 3QG1A 1M1GA 2DTOA 3LLRA 2R57A 1WQ7A 2P4TA 2RA2A 3OYAA 3NFCA 3V7SA 1KC8U 2PUKB 4PL6A 4M77G 5J3BA 2ZCFB 3OYBA 2ZGWA 5FRMA 4C92E 2VXFA 3WXMB 5FU7C 4PLIA 4HT8A 1JBMA 5GAOq 4IUTA 4J83A 2HD0A 5KCHA 5CVIA 2FYKA 5CQXA 2A3LA 3MEVA 5EG2A 2R5AA 2RI2A 4ELYC 5CKDA 1VQMA 2EKOA 4NL2A 2DXUA 5I2MA 4M7DG 4C5EA 2KDSA 4KUDK 2HQEA 4F7UG 5FU6B 2CZ1B 3MEWA 4X9CA 2VC8A 1Y96B 4IUVA 5HY6A 1K9MC 1M90U 3I55A 3X25B 5GMKi 5A0LA 2L8DA 4JRKA 2PQWA 4C5IA 5GMKl 3L2WA 3TU4K 4GY5A 5GAOr 2XKOC 3META 1VIFA 4HKEA 2RI5A 3FB9A 3V7RA 4LDUA 3T9NA 3CC7T 2C06A 3LX7A 2X4XA 2K57A 4PJOA 2XHCA 2DD4A 1VQKA 3CCUA 2QA4A 5GANh 3C95A 5LJ3h 1OYXA 3CXCA 1YJNA 4PLLA 3PMIA 4XTUA 1YITA 1VQ7T 2LC4A 4BDZA 2QQAA 3CMEA 3FLGA 1YJ9A 2R58A 4M75E 1NJIU 1QVPA 4UC4A 4M77E 5GANe 3PGGA 4XTXA 3UPUA 3L42A 2K5IA 2K3XA 3FIFA 4J7IA 3V7CA 3RIRA 3RKWA 2E1HA 5HKCA 2WSFE 5GAN7 3RMQA 2DIGA 5D6YA 2DO3A 2XDDA 4M7DE 3LYIA 4F7UE 2KSSA 4FM4B 1WJRA 1Q7YU 3OSSC 4C92C 3F70A 3PT9A 1Q82U 5LJ5d 3G4SA 4JLGA 5CKEA 1X6OA 4JS5A 3QZ5B 2X4JA 1NZ9A 3CPFA 5CQYA 2DXBA 2KK4A 4XU3A 1QVFS 5FRNA 4J6XA 3JCMh 4J6YA 1N6AA 5GAOp 2VXEA 3QYGB 3ZFJA 5GAN3 1VQ9T 2X35A 2L89A 1IZ6A 4OMFB 4HT9A 1KQ1A 1JJ2A 5CIUA 4LDVA 1QVGS 2RJFA 5KCOA 2CZ6B 2ZZDA 2A7YA 2XU8A 3CCST 2LRQA 4LDWA 1XTDA 5AYFA 3JCMe 5GAOn 4M7AA 4C8QA 2QEXT 1Q86C 2EQJA 2OAUA 3QIIA 4BE0A 4OB2B 2P0PA 5GAMj 2VUBA 4C92F 3HFOA 5M9OA 2EWNA 4PKCC 3EFSA 4C92D 3AHUA 1G5VA 4O6JA 2JN0A 3V8LA 4M78A 1U1TA 5GANg 2IG0A 5LJ3g 2CZ0B 1I81A 3MEUA 1UGQB 3QXEB 2ZPBB 4B9WA 5HK0A 4E7JA 3OS2A 4ELZC 2DXCA 4EMKA 3FJPA 3CC7A 1KG1A 3CEYA 5GAOm 1NE8A 4M75C 5LJ5f 4HA8A 1VQLT 1WQWA 5GMKh 3OYCA 3HL8A 1FWZA 2CYZB 2KMTA 3SDZA 4MDWA 1K9MU 2XG8D 2JTFA 4RMOA 3KXTA 3QKJA 1VQ7A 1BKBA 1K73C 1WJQA 2DAQA 3G7ZA 4NL3A 1NPRA 3OYEA 4OF1A 2HNIA 3DLMA 2K5LA 4M7DC 3ER0A 3JAME 3M59A 4IKFA 2RJCA 4MZTA 4QVZA 5DM7R 2B8AA 2DTHA 2HBPA 3DB3A 1WJSA 2LX9A 4II1A 4A4KA 4C0DC 3VJPA 5A2QE 4PJOB 1HK9A 4MMKA 4XU0A 3SWNA 1VQ5T 5CKFA 2GQVA 4M75F 4Q5WA 3JCMg 3M53A 4E7HA 4M75D 4M77F 2QQRA 2GFAA 4JRPA 3SD4A 1N9SA 5IT9E 1VUBA 3VU3C 2H3JA 4FT2A 3WVEB 4OB0B 2DIQA 3G6ET 5LL6S 4E7KA 3OYHA 2QTXA 3M57A 4QQGA 3L2RA 3M4GA 4FSXA 1KHCA 4CRIA 4N4GA 4M7DF 2Y90A 2M16A 4M75G 4F7UF 1VQ9A 3G71T 2BUDA 2RB6A 3FRNA 4M7DD 3GP8A 4BACA 3BY7A 2G3RA 4RCCA 4JJNK 3CD6T 3Q1JA 3CCSA 4C5GA 2D9TA 3PMTA 2LQKA 4L6V5 3URGA 5CR2A 3E9GA 3JCMQ 4E7IA 1N27A 2DPPB 2K5FA 1M5Q1 3VKIA 2QEXA 2CKKA 2DD5A 3UWNA 3S3MA 4OP0A 2K3YA 3CCMT 3OYNA 2ZPHB 4ME7A 2XK0A 1I4K1 2LCCA 2ZPIB 3L2QA 2VYTA 2P0KA 3C12A 3INZA 3OYKA 3OQ5A 5LJ5j 2ZPFB 3FDRA 3JRZA 1XNIA 4E7LA 2OTJT 2RM4A 3OYFA 4Y91A 4E47A 3UT1A 3TEEA 4A4EA 2CS7A 3HFNA 1Q86U 2XDBA 5GANf 2MI6A 2VGNA 3RUXA 3CPWA 1TH7A 1VQLA 1PSFA 3OY9A 3PTAA 4M7AB 3TCJA 1D3BA 4C8QB 4KBMB 5DY9A 2EIFA 4BI4A 3LWHA 4N0AC 5D6XA 4PJOC 4ATOA 2ZPEB 3PFSA 3GNFB 3M55A 4M78B 1VQ8T 3QJYA 4OVAA 2KVQG 2KQWA 2NLUA 2DTIA 2EQUA 2VV5A 3S3OA 2FHDA 5LJ3e 1VQ4T 1W2BS 1G3WA 4QW2A 3MO8A 4EDUA 4EMKB 2MMPA 4KUIA 3I56T 1X01A 2BKDN 5GAMh 3HRUA 3PNWC 2M0OA 4JLIA 3L2ZA 1M1FA 2E5QA 3O8VA 1VQ5A 1BI1A 4QVCA 1X75C 1K73U 1JB0E 3V8KA 1KQSA 4J8OA 2EQKA 3E9FA 5C6SA 1KQ2A 1UEBA 5DLQE 1B34A 2M1HA 3OYIA 3G6EA 1N8RC 2JOYA 2WSEE 4O5VA 2JVVA 5GAMe 3JCMf 5J39A 5GAN5 3L2UA 3E1SA 1OZ3A 3C4SA 4C5HA 4FL6A 1YBYA 5GAOl 2KY9A 3MP8A 3M56A 2PVOB 3QJ6A 4JRQA 3G71A 3OW2A 4PJOD 1ZQ1A 2E10A 4QVDA 4R56A 5FU6C 4C92A 3RKYA 1PSEA 3CMAT 2E41A 3CD6A 3SWNB 2E6ZA 3A5ZB 3JCMJ 1XOVA 4BI3A 1NPPA 2L3RA 2YRVA 2M9UA 4PJOG 3GPLA 3KBGA 3VUBA 3CCVT 1VQPT 1K8AU 1OZ2A 2BIVA 5D6WA 3CCMA 2MF2A 4GLKA 4LD9K 1IREB 2RH2A 1VQ6T 2F69A 3M58A 5IN1A 2FVUA 4M7AC 3OYDA 4IUPA 2OTJA 3NTKA 4Z02A 2MWOA 3BW1A 1JRIA 4BY6B 1M90C 4R55A 2KAFA 2JUFA 2QQSA 4BB7A 3JB9H 2EJGA 4FT4A 3SFMA 1WGSA 5GAN4 3CCET 1SSFA 1AHJB 3QPHA 3M9QA 2DZCA 4KULA 2GCXA 4XAXB 1UGRB 2YHTA 3MP6A 1YI2T 4XTWA 4J7FA 4BDYA 2EJ9A 2LT4A 3CCQT 3JCMW 2O4XA 5GAMg 4XU2A 1R8OB 4MZMA 3BDUA 1O75A 3CXCS 1G3TA 5FU7B 3JB9J 2V8JA 5CAIA 4M75A 3BFMA 4BUGA 1VQ8A 3CCLA 1BIAA 4BI8B 5GMKe 3M5AA 1H3ZA 4M77A 1BI3A 1VQ4A 4HCCA 3I56A 2QXFA 2RK2A 2PUOB 3HRSA 4M7AD 2XICA 3S6WA 4FU6A 2EAYA 1G3SA 4PJOE 4XU1A 1ZHIA 3JCMP 2V8KA 1KD1C 2YLBA 1D3BB 3UDCA 2JNGA 5LJ5h 1ZBXA 4F7UA 3J80E 3VYHB 4M7DA 2IVWA 3CBPA 5CKHA 5CO7A 1S72T 3HSBA 4M7AG 5GANd 5I21A 5LJ3d 3M4YA 3OMCA 2E6NA 4IUQA 1Y7XA 2CGHA 3VYGA 1Q7YC 2Y4YA 1Q82C 4C0GA 1KHIA 3GF5A 3OYMA 3RKXA 1YIJT 4IURA 4X34A 2XD0A 4FIBA 5KE2A 3CMAA 1FXXA 3S3NA 4LDXA 1DJ7B 1JJ2S 3CCVA 1VQPA 2X4WA 4RCBA 1LOJA 1B34B 4KT0E 4C0FA 1QVFA 1OI1A 1UB4A 3HRTA 1BIBA 1U1SA 2XI9A 3FEOA 3OSVA 1VQ6A 5C0MA 2QQBA 4D6WA 1YJWT 1GXIE 1BI2A 3RESA 2DVEA 2RHZA 4BD3A 4C92B 5IAYA 2PU9B 3QHSA 3X26B 3JCMd 1V29B 2OTLT 4MDXA 1WNLA 2DKGA 2RD1A 3A8OB 4OB3B 4BE1A 5LJ3f 2E64A 3CCEA 3HKSA 1G3YA 5J26A 1YI2A 2FB7A 4M7AE 2F5KA 4C8QE 1UGSB 2VGMA 3DLLA 3CCQA 4L5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM d;  5GAO l;  2E65 A;  3FJP A;  4EMG A;  3JB9 D;  3GIB A;  5GAO m;  4PJO D;  4XTY A;  4M75 C;  5LJ5 f;  4HA8 A;  2E10 A;  1WPY A;  3EFR A;  4QVD A;  1WQW A;  4M77 D;  5GMK h;  5LJ5 g;  4C92 A;  4M78 E;  3RKY A;  2E41 A;  1I5L A;  5GAM f;  3SWN B;  1I8F A;  2DZ9 A;  5GMK j;  3JCM J;  5GAN 6;  3JB9 G;  4PJO G;  2DTO A;  4NL3 A;  4N0A A;  1WQ7 A;  2HNI A;  2RA2 A;  4M7D C;  3V7S A;  2EJF A;  4M77 G;  2ZGW A;  5GAN 8;  4C92 E;  2VXF A;  3JCM X;  4HT8 A;  4XTV A;  1JBM A;  5GAO q;  4J6W A;  4M7A C;  2DTH A;  2FYK A;  4J5Y A;  4PNO A;  4NL2 A;  4XTZ A;  2DXU A;  1HK9 A;  4M75 B;  4MMK A;  4X9D A;  4XU0 A;  3SWN A;  3BW1 A;  1JRI A;  4PJO F;  4F7U G;  4M75 F;  4M7D G;  3JCM g;  4M77 B;  4X9C A;  2VC8 A;  3JB9 H;  1Y96 B;  4M75 D;  2EJG A;  4M77 F;  5GAN 4;  1N9S A;  5GMK i;  3VU3 C;  5GAN 2;  2DZC A;  4JRK A;  5GMK l;  2YHT A;  2QTX A;  4XTW A;  5GMK m;  1YCY A;  3M4G A;  1MGQ A;  3JCM b;  5GAO r;  3V7R A;  2EJ9 A;  3FB9 A;  3JCM W;  4M7D B;  4NOY A;  4F7U B;  4XU2 A;  5GAM g;  4M7D F;  2Y90 A;  3BDU A;  4M75 G;  4F7U F;  2RB6 A;  2K57 A;  4DQ2 A;  3JB9 J;  4M7D D;  5CAI A;  4M75 A;  3BFM A;  4PJO A;  1BIA A;  3BY7 A;  3L1A A;  4JUV A;  4RCC A;  5GMK e;  5GAN h;  5LJ3 h;  3QUI A;  4M77 A;  1Y96 A;  4XTU A;  4WF2 A;  3SB2 A;  3JCM Q;  4M7A D;  4C8Q C;  5GAN j;  2EAY A;  5LJ3 j;  4PJO B;  1M5Q 1;  3JCM V;  4PJO E;  4XU1 A;  3JCM P;  4M75 E;  1N9R A;  4OP0 A;  2YLB A;  1D3B B;  5LJ5 h;  4M7D A;  4V2S A;  4F7U A;  5GAN e;  4M77 E;  3PGG A;  1I4K 1;  4M78 C;  4XTX A;  3HSB A;  3INZ A;  4M7A G;  3FIF A;  1H64 1;  3JCM c;  3V7C A;  5I21 A;  5LJ3 d;  5LJ5 j;  3RIR A;  5GAN d;  3RKW A;  2E1H A;  4EMK C;  2RM4 A;  2CGH A;  1LJO A;  4Y91 A;  5GAN 7;  4M7D E;  3HFN A;  4F7U E;  1LNX A;  5GAN f;  3RUX A;  4C92 C;  1TH7 A;  2YLC A;  3RKX A;  5LJ5 d;  4M7A B;  1D3B A;  4C8Q B;  4M7A F;  5DY9 A;  4C8Q F;  3QO3 A;  4XU3 A;  4A53 A;  3QSU A;  4J6X A;  4N0A C;  4J6Y A;  3JCM h;  4C8Q D;  5GAO p;  2VXE A;  4JRI A;  4RCB A;  5GAN 3;  4PJO C;  1LOJ A;  1B34 B;  4HT9 A;  2DJZ A;  4C92 G;  3RER A;  1KQ1 A;  2I2L A;  4M78 B;  1BIB A;  1U1S A;  4M77 C;  3V8J A;  2DTI A;  4M78 F;  5LJ3 e;  2DXT A;  4M78 D;  4EMK B;  4EMH A;  1X01 A;  5GAM h;  4C8Q G;  4JLI A;  3RES A;  2DVE A;  3SWN C;  3JCM e;  3L2Z A;  5GAO n;  4C8Q A;  4M7A A;  1M8V A;  4QVC A;  4C92 B;  3V8K A;  1HXD A;  3QHS A;  3JCM d;  5GAM j;  1WNL A;  2DKG A;  2RD1 A;  4C92 F;  4MML A;  4A54 A;  5LJ5 e;  3HFO A;  1KQ2 A;  2DEQ A;  2EWN A;  2E64 A;  3EFS A;  4M78 G;  1B34 A;  5LJ3 f;  4C92 D;  2JN0 A;  3AHU A;  3V8L A;  4M78 A;  1U1T A;  5GAN g;  4XQ3 A;  5LJ3 g;  5GAM e;  1I81 A;  2FB7 A;  4M7A E;  3JCM f;  5GAN 5;  3JB9 I;  4C8Q E;  3JB9 F;  4EMK A; 
#chains in the Genus database with same CATH topology
 5KYY B;  1BYM A;  2AKK A;  1WPY A;  2DK3 A;  1ARK A;  2D0N A;  5LJ5 g;  4M78 E;  5CCA A;  1I5L A;  1M8M A;  1M9S A;  3EG9 A;  1UUE A;  2RHU A;  1VQN T;  2JM8 A;  2LJ1 A;  3AT1 B;  2EJF A;  2P0Q A;  1Q81 C;  1O9S A;  1ZX6 A;  2QQ9 A;  4AFU C;  1S72 A;  4J6W A;  1UHC A;  4J5Y A;  2ED0 A;  1E6H A;  4A4H A;  4M75 B;  4X9D A;  3H9N A;  3C0C A;  1JXM A;  2GTO A;  3MJX A;  4M77 B;  1J3T A;  3CCR T;  2DA9 A;  1YIJ A;  3CMA Q;  1WLP B;  3A98 A;  4ZGJ B;  5GMK m;  2CSQ A;  2DM1 A;  2QDY B;  3M0R A;  3OYG A;  3RR6 A;  4C0D B;  1D1A A;  1Y96 A;  4OGE A;  1VQ6 Q;  1YJW A;  4PFP A;  2ZAE A;  1ZSZ B;  5FLX E;  3JCM V;  2FEI A;  3MP1 A;  3ASK A;  2E12 A;  2O2O A;  1ZSG A;  4M78 C;  1JXO A;  3HHT B;  1C6V X;  1TSF A;  4HCB A;  2L5Q A;  4EMK C;  3G1J A;  3HPW A;  2V8I A;  1M4Z A;  2WAC A;  3X20 B;  4ZTJ A;  2RQR A;  2KGT A;  5DLO A;  2BTT A;  3DKM A;  1NJI C;  4JRI A;  2PVD B;  1VQK T;  1VQK Q;  2WSC E;  2LT1 A;  3V8J A;  4DEX A;  4M78 F;  1Q82 R;  1LCK A;  1S72 Q;  4Y28 E;  3SHW A;  3CME T;  3CC2 A;  4ZGD B;  1BI0 A;  3A8M B;  4YTL A;  2HKN A;  2LDM A;  1YIJ Q;  4VUB A;  4LDY A;  2EW3 A;  2DFU A;  2RI3 A;  3OA6 A;  1OOT A;  3JB9 I;  1M1K U;  2JZ2 A;  2E65 A;  1QLY A;  1TWB A;  1UGV A;  4HCZ A;  2SRC A;  4DOW A;  3OBW A;  3OYY A;  5I2S A;  1VQO A;  2K9G A;  4IIM A;  1YJW Q;  3JB9 G;  2V1R A;  3QG1 A;  2R57 A;  3V7S A;  4M77 G;  2FRY A;  4PLI A;  4J83 A;  2HD0 A;  4RTU A;  5KCH A;  5CKD A;  2RI2 A;  2EKO A;  5I2M A;  1G2B A;  2AZV A;  2HSP A;  1B07 A;  2KT8 A;  3I55 A;  5GMK i;  4KH0 B;  4F14 A;  4JRK A;  2JS0 A;  1D0Y A;  1IGU A;  3V7R A;  2ABL A;  3FB9 A;  2X4X A;  1N8R R;  4PJO A;  1M30 A;  1WXU A;  2QA4 A;  3C95 A;  5LJ3 h;  3CXC A;  2RQU A;  1I1J A;  2E5K A;  1YJ9 A;  3CC2 Q;  1QVP A;  1NG2 A;  3PVQ A;  2K3X A;  2I0N A;  2E1H A;  2BZX A;  2XMF A;  3NGP A;  5IXB A;  2EGE A;  3OSS C;  3M0P A;  5CKE A;  1X6O A;  1VQO Q;  2ENM A;  1ZUK A;  4XU3 A;  2VXE A;  5GAN 3;  1VQ9 T;  2L89 A;  1IZ6 A;  1KQ1 A;  2FPD A;  5CIU A;  3M0Q A;  3I9Q A;  2SEM A;  1H8K A;  2ZZD A;  2A7Y A;  3EH2 A;  4LDW A;  1ACM B;  2CP2 A;  5GAO n;  4HCK A;  1Q86 C;  3QII A;  4BE0 A;  1YWP A;  4PKC C;  1G5V A;  3AHU A;  3I55 Q;  4ANJ A;  1MV0 B;  1UGQ B;  4ESR A;  4JZ4 A;  2JJ9 A;  1RAI B;  2VWF A;  4ELZ C;  3OS2 A;  2DXC A;  3EFO B;  1KG1 A;  4HA8 A;  1WHL A;  5GMK h;  2QA4 Q;  2CRE A;  2KMT A;  3QDF A;  1BKB A;  1WJQ A;  1I07 A;  1NPR A;  4OF1 A;  2HNI A;  2K5L A;  2HKQ B;  1YJ9 Q;  1B3Q A;  4E7Z A;  4K11 A;  4GBQ A;  2DTH A;  1PC0 A;  3VS7 A;  1UJY A;  5A2Q E;  3VJP A;  1EFN A;  3CQT A;  3SWN A;  4Q5W A;  1M3A A;  4Z89 A;  1VUB A;  4FT2 A;  4HVW A;  3OYH A;  1KHC A;  3H0I A;  2RNA A;  3D7S B;  4M7D D;  2X3W D;  3BY7 A;  2CUD A;  2EBP A;  2D9T A;  2LQK A;  1K9M R;  4E7I A;  2K5F A;  2DD5 A;  3S3M A;  4OP0 A;  4AG1 C;  3INZ A;  4E7S A;  1SRM A;  2FZC B;  4EIK A;  1X2K A;  1TH7 A;  1PSF A;  2QYZ A;  2KBT A;  4M7A B;  4JJC A;  1YCS B;  4KBM B;  5DY9 A;  2BE7 D;  4J9B A;  5D6X A;  1QWE A;  4J9G A;  1Z9Z A;  4ATO A;  2ZPE B;  2KVQ G;  2KQW A;  2NLU A;  2DTI A;  2DYB A;  4GLM A;  2FHD A;  1VQ4 T;  4QW2 A;  5ECA A;  3MO8 A;  4R0K A;  1X01 A;  1H92 A;  1KIK A;  4JPB W;  1T0H A;  1BI1 A;  4QVC A;  1JB0 E;  1PKT A;  3V8K A;  2EQK A;  2FZG B;  2EVR A;  4D8K A;  4LE9 A;  1NM7 A;  2KXC A;  5GAM e;  3RNJ A;  5J39 A;  1OZ3 A;  4FL6 A;  1F1B B;  5GAO l;  2YUN A;  3QJ6 A;  4PJO D;  1ZQ1 A;  2NYS A;  5FU6 C;  1UHF A;  9ATC B;  4C92 A;  1PSE A;  2D8H A;  1AEY A;  4JJB A;  1SPK A;  3JCM J;  1TUG B;  1NPP A;  2YRV A;  3GPL A;  2M9U A;  3CCV T;  1K8A U;  3CCM A;  2YXY A;  2MF2 A;  3REB B;  1NYG A;  4LD9 K;  2RH2 A;  2DL8 A;  1RAB B;  3M58 A;  4QKU A;  5HCK A;  1QWF A;  1H3H A;  2V1Q A;  2KAF A;  2JUF A;  1K73 R;  4FT4 A;  2HQH A;  2CT4 A;  5GAN 4;  3CCE Q;  3CCE T;  2DZC A;  2GCX A;  1YI2 T;  3MP6 A;  4FW1 A;  1YI2 Q;  4J7F A;  2A08 A;  1WI7 A;  5GAM g;  4MZM A;  1O75 A;  2EYY A;  4JJD A;  7AT1 B;  1VQ8 A;  2AZS A;  1RAG B;  3M5A A;  2YWW A;  1BI3 A;  2RK2 A;  1NEB A;  2PUO B;  3S6W A;  4FU6 A;  4PJO E;  4XU1 A;  1ZHI A;  1RLQ C;  3JCM P;  3UDC A;  4KGV B;  1ZBX A;  2RPN A;  2IVW A;  2MOX A;  5CKH A;  3MKD A;  1FMW A;  4M7A G;  5GAN d;  5I21 A;  2ED1 A;  1Y7X A;  1SF9 A;  1Q82 C;  2HZY A;  2QG9 B;  4LN2 A;  1T0J A;  4FIB A;  5KE2 A;  1GFC A;  3S3N A;  1OEB A;  1NLP C;  2DIL A;  3HRT A;  1U1S A;  1UEC A;  3FEO A;  3CCM Q;  2MYS A;  1GFD A;  3UAT A;  2QDL A;  4RTV A;  2ESW A;  1WNL A;  4BE1 A;  4OB3 B;  4PJL A;  1PG5 B;  1K9A A;  5IHK A;  1IHV A;  5KYX B;  1E6G A;  1ABQ A;  2GFU A;  4XTY A;  2X51 A;  2COY A;  3KUF A;  2DZ9 A;  2RHY A;  2EYQ A;  4RKU E;  2OI3 A;  3RMS A;  3ZL7 C;  2LNV A;  5GAN 8;  3CC4 T;  3CC4 Q;  1K1Z A;  2DL5 A;  4A63 B;  3OS5 A;  2LQW A;  2RHI A;  4L59 A;  2F5T X;  1RL2 A;  4XTZ A;  3N5B B;  2HDA A;  2AIR B;  1U5S A;  4PJO F;  3OYL A;  5HK3 A;  1PKS A;  1QP2 A;  2NUP A;  4BE2 A;  2GF7 A;  2CUB A;  1W70 A;  3CCJ T;  4JDS A;  2O9V A;  3C94 A;  4A4F A;  3JCM b;  4M7D B;  1VIE A;  2DX1 A;  4NOY A;  5AT1 B;  2RK1 A;  4F7U B;  3CXC P;  3J81 E;  2VVK A;  4DQ2 A;  2JMA A;  3LH0 A;  1BBZ A;  4JUV A;  4FYV B;  3QUI A;  2O88 A;  2PZ1 A;  1YHQ T;  4LUE A;  4WF2 A;  1GBR A;  5L8R E;  1UDL A;  5LJ3 j;  2XDP A;  3GNG A;  1OPK A;  1N9R A;  2YDL A;  3QDR B;  3TSW A;  4DA4 A;  2QTV A;  3NMZ C;  1H64 1;  3QZ9 B;  1VQM T;  2G6F X;  2HSE B;  2R5M A;  3MEA A;  1LNX A;  1VA7 A;  3OS1 A;  1T3L A;  1ZA2 B;  1KD1 R;  2DL7 A;  4JS4 A;  2K2V A;  4ORZ A;  1VQN A;  1JEG A;  1M8V A;  1YNZ A;  2DJZ A;  3RER A;  4M77 C;  3CBM A;  3LH5 A;  1P92 A;  2F2X A;  1YJN T;  4M78 D;  4EMH A;  4DEY A;  4C8Q G;  2HAX A;  3NTI A;  3SWN C;  1JU5 C;  2HQX A;  4AFZ C;  1Y07 A;  2O9S A;  5I22 A;  1HXD A;  2EQM A;  5LJ5 e;  3CCR A;  4MML A;  4A54 A;  1Q81 U;  3LW5 E;  2DRK A;  3JB9 F;  3J7A F;  4EMG A;  1OU9 A;  3A8H B;  2BZ8 A;  3VV0 A;  1R77 A;  3G4S T;  3G4S Q;  1IO6 A;  1TXQ A;  3M54 A;  3HP9 A;  5FRO A;  5GMK j;  5GAN 6;  1M1G A;  2DTO A;  1HJD A;  1WQ7 A;  2P4T A;  2RA2 A;  3OYA A;  3OYB A;  5FRM A;  4C92 E;  5FU7 C;  2MCN A;  1JBM A;  2DL3 A;  4IUT A;  2CP6 A;  5CQX A;  4NL2 A;  2DXU A;  4M7D G;  2KDS A;  4F7U G;  2CZ1 B;  3MEW A;  4IUV A;  5HY6 A;  1K9M C;  1M90 U;  1FMK A;  2L8D A;  2PQW A;  4C5I A;  4GY5 A;  2XKO C;  3A1P A;  1QCF A;  3T9N A;  1VQN Q;  3LX7 A;  1VQK A;  5GAN h;  3PMI A;  1OQK A;  4XTU A;  1AT1 B;  2LC4 A;  3CME A;  3FLG A;  4FYX B;  1NJI U;  1PD1 A;  1I0C A;  1KC8 R;  3CCR Q;  1AWJ A;  1B7T A;  3V7C A;  4F16 A;  2CP7 A;  3RIR A;  1MUZ A;  4HVV A;  2A28 A;  3RMQ A;  3I5S A;  2DIG A;  5D6Y A;  4FM4 B;  4C92 C;  5LJ5 d;  1K0X A;  1D0X A;  1M2V B;  4JS5 A;  1D1C A;  4J6X A;  4J6Y A;  3ZFJ A;  2NUT A;  2HL3 A;  4OMF B;  4HT9 A;  4KGZ B;  1QVG S;  2RJF A;  1X6B A;  2F2V A;  3CCS T;  2LRQ A;  2VKN A;  3JCM e;  4C8Q A;  2QEX T;  4QT7 A;  2LNH B;  2P0P A;  4C92 F;  3HFO A;  3R6N A;  2EWN A;  4DBQ A;  1EZZ B;  4O6J A;  4AMC A;  1PM3 A;  2IG0 A;  3MEU A;  3QXE B;  4E7J A;  2ZPB B;  2DVJ A;  4RTT A;  1GRI A;  3FJP A;  1MMG A;  1Y57 A;  1NE8 A;  3HTR A;  1VQL T;  4F17 A;  1FWZ A;  1GL5 A;  1IB8 A;  2JTF A;  3KXT A;  1K73 C;  2DAQ A;  3CME Q;  1Q95 G;  1TUC A;  3JAM E;  1MND A;  5DM7 R;  4LNP A;  5KYW A;  1G83 A;  2HL5 C;  5CKF A;  5FWB A;  5FW9 A;  1K8A R;  3JCM g;  3M53 A;  2VAS A;  2QQR A;  1N9S A;  5IT9 E;  2E3H A;  2H3J A;  2JS2 A;  3G6E T;  2PTK A;  4RTW A;  4N4G A;  2Y90 A;  2M16 A;  4M75 G;  1VQ9 A;  2BUD A;  3FRN A;  3EGD B;  4AG2 C;  4JJN K;  3Q1J A;  3O5Z A;  1WZO A;  4L6V 5;  5CR2 A;  3JCM Q;  5IHN A;  1N27 A;  3UWN A;  4RUG A;  3VS4 A;  2CP5 A;  4ME7 A;  2XK0 A;  2ZPI B;  2VYT A;  3OYK A;  2YUO A;  3FDR A;  1XNI A;  4DBR A;  4A4E A;  3HFN A;  1Q86 U;  5GAN f;  1D3B A;  2EIF A;  4BI4 A;  3LWH A;  2MIO A;  3RBB B;  2KRS A;  1UTI A;  4M78 B;  2DF6 A;  2DYI A;  1G3W A;  4EDU A;  3I56 T;  4EMK B;  2MMP A;  3L2Z A;  3TSZ A;  2E5Q A;  1K4U S;  3EG0 A;  4J8O A;  1UEB A;  2W0Z A;  5DLQ E;  2M1H A;  1BCM A;  2JOY A;  2WSE E;  4O5V A;  5GAN 5;  3C4S A;  2NWM A;  4C5H A;  3TQ7 P;  1VQ9 Q;  4R56 A;  2MK5 A;  1KJW A;  2E41 A;  1WXT A;  1SHF A;  1PD0 A;  3A5Z B;  1ABO A;  4BI3 A;  1VQP T;  1OZ2 A;  4GLK A;  5KYY A;  5GJW B;  4M7A C;  2J6O A;  1VYT A;  3BW1 A;  1JRI A;  1BCO A;  2QQS A;  4BB7 A;  3JB9 H;  1K0S A;  2EJG A;  1QCN A;  1WGS A;  4OML A;  1U3O A;  3M9Q A;  1UGR B;  3THK A;  2COW A;  2EJ9 A;  3JCM W;  3CCQ T;  2J6F A;  4RTX A;  3BDU A;  4CC4 B;  5CAI A;  4M75 A;  3FJ5 A;  4BI8 B;  1RUW A;  4M77 A;  3H0H A;  1VQ4 A;  4HCC A;  2QXF A;  1PWT A;  1JJ2 P;  3HRS A;  4PFZ A;  1G3S A;  2EYX A;  2W10 A;  1KD1 C;  2YLB A;  5LJ5 h;  1PHT A;  3CBP A;  2F2W A;  4C0G A;  4OMN A;  1ZSZ A;  3RKX A;  4IUR A;  2JT4 A;  3I35 A;  4B6M A;  1JJ2 S;  3CCV A;  4RCB A;  1LOJ A;  4J9E A;  1B34 B;  4HXJ A;  1OI1 A;  5D7U A;  5C0M A;  4D6W A;  4J9I A;  1GXI E;  2DBM A;  2L3S A;  2FRW A;  2AT1 B;  2YSQ A;  2OX7 A;  3X26 B;  2OTL T;  2K7A A;  4D8D A;  2QAS A;  5LJ3 f;  3CCE A;  5J26 A;  1YI2 A;  2F5K A;  4C8Q E;  2VGM A;  4L5G A;  3ME9 A;  3VUZ A;  3EG3 A;  1Y71 A;  4ZTF A;  3GOX A;  1VQ4 Q;  3E19 A;  2J06 A;  3MHX A;  1EIF A;  2RHX A;  4N0A A;  2CH4 A;  1KK7 A;  1PCX A;  3JCM X;  4OB1 B;  2O4X B;  2RJE A;  1GCP A;  4PNO A;  3H8Z A;  2LVM A;  2D0Q B;  2KI7 A;  1D1B A;  1UGP B;  3EG1 A;  3X24 B;  3CPW P;  1MGQ A;  8ATC B;  1KC8 C;  2LP5 A;  4NS5 A;  3CCV Q;  2O01 E;  4PK4 A;  4LXC A;  1XQH A;  3NTH A;  2MWP A;  2DEU A;  1M90 R;  3UA7 A;  3R6O A;  4C8Q C;  5GAN j;  2Y4X A;  3P8D A;  3UF4 A;  2BE9 B;  3EGX B;  1V1C A;  2LCS A;  4C0Z A;  4PFO A;  2BZY A;  4V2S A;  3BDL A;  5KH6 A;  3JCM c;  1RI0 A;  3H41 A;  3CPW S;  4A4G A;  4QQ6 A;  3ZBD A;  2DLP A;  3OB9 A;  1E7O A;  3OW2 P;  3U23 A;  4C8Q F;  2CSI A;  2A0F B;  5KYU B;  3QO3 A;  4PJM A;  4A53 A;  3PIO A;  3EH1 A;  3TRE A;  1G8X A;  3CBO A;  3LGL A;  4P5N A;  2YRC A;  3CCU T;  3CC4 A;  4AFQ C;  1HSQ A;  3EAE A;  2RJD A;  3OBY A;  2DXT A;  4ZGE B;  1LVK A;  1YIT T;  5A0D A;  2LQN A;  2LQ8 A;  3GLX A;  2M0Y A;  3MCA B;  1TU0 B;  1WDX A;  3M0U A;  2DEQ A;  3JSC A;  1R0B G;  3EG9 B;  1AWW A;  1ZA1 B;  3CCJ A;  2JTM A;  2QK0 A;  4XQ3 A;  2JW4 A;  3OW2 S;  5GJV B;  1WHH A;  1N8R U;  5GAM d;  2RF0 A;  3JB9 D;  1TTH B;  1QP3 A;  3OS0 A;  1FX7 A;  3ZEH A;  4BY6 C;  4LUD A;  2HBW A;  1NBE B;  4M77 D;  5IXF A;  3OYJ A;  3FC3 A;  1YHQ A;  3VRY A;  1K8A C;  3A8L B;  2NUZ A;  4IUU A;  4B9X A;  1RAE B;  2L3P A;  3NFC A;  4PL6 A;  5J3B A;  1SSH A;  2ZCF B;  2ZGW A;  2CT3 A;  3EFO A;  3WXM B;  1D09 B;  4HT8 A;  1W1F A;  1AVZ C;  2FYK A;  5CVI A;  2A3L A;  1VQM A;  2P84 A;  4KUD K;  2HQE A;  2QAZ A;  5FU6 B;  1M27 C;  2VC8 A;  1Y96 B;  2KR3 A;  1X43 A;  3NPF A;  1UFF A;  1Z9Q A;  5GMK l;  3L2W A;  4LDU A;  2HMA A;  3CC7 T;  1M1K R;  2C06 A;  1MMN A;  2DD4 A;  5IHI A;  1OYX A;  1YJN A;  1QVF P;  1VQ7 T;  2QQA A;  2R58 A;  4M75 E;  4RTZ A;  4UC4 A;  4M77 E;  3PGG A;  4XTX A;  1CSK A;  4J7I A;  3CCJ Q;  2C0T A;  3RKW A;  5HKC A;  3UA6 A;  3VS1 A;  5GAN 7;  2GNC A;  2J6K A;  2XDD A;  2FO0 A;  1WJR A;  1Q7Y U;  2CH4 W;  2CP3 A;  3G4S A;  2Z0W A;  4IIO A;  3QZ5 B;  1YHQ Q;  1QVF S;  5FRN A;  2E4H A;  5GAO p;  2FZK B;  3QYG B;  3JV3 A;  2X35 A;  1JJ2 A;  2XU8 A;  6AT1 B;  1XTD A;  5AYF A;  4M7A A;  1VQM Q;  2EQJ A;  2OAU A;  1RAH B;  4OB2 B;  5M9O A;  3EFS A;  4C92 D;  1AWO A;  2JN0 A;  5LJ3 g;  1I81 A;  5GAO m;  3H0F A;  4M75 C;  1X69 A;  1WQW A;  1TUD A;  5L23 A;  3HL8 A;  3M0T A;  1MMD A;  3SDZ A;  1K9M U;  1YJN Q;  4RMO A;  1RLP C;  3G7Z A;  4NL3 A;  3DLM A;  3VS5 A;  3M59 A;  2C0O A;  4QVZ A;  2B86 A;  2B8A A;  4II1 A;  4C0D C;  3DB3 A;  2LX9 A;  2LX7 A;  2P4R A;  4PJO B;  1HK9 A;  2M02 A;  4XU0 A;  1VQ5 T;  1AWX A;  2DNU A;  2GQV A;  4M75 F;  1ZSZ C;  2EPD A;  4M77 F;  1OUL A;  4CC3 A;  4JRP A;  2GFA A;  2DBK A;  4E7K A;  2DIQ A;  2QTX A;  3M57 A;  3M4G A;  1QQJ A;  3G71 T;  3G71 Q;  4FCY A;  2G3R A;  3CD6 T;  3CD6 Q;  3CCS A;  4C5G A;  3PMT A;  2KRN A;  1ZUY A;  2PNI A;  2KT1 A;  2DPP B;  1M5Q 1;  2QEX A;  1A0N B;  2CKK A;  2K3Y A;  2L0A A;  4PJJ A;  1W2B P;  3VS3 A;  4FSS A;  3OYN A;  3L2Q A;  3C12 A;  4Y92 A;  5LJ5 j;  2ZPF B;  4E7L A;  2OTJ T;  2OTJ Q;  1WHM A;  2RM4 A;  3OYF A;  4E47 A;  3UT1 A;  1C0M A;  2LJ3 A;  2XDB A;  2MI6 A;  2VGN A;  3RUX A;  3CPW A;  1VQL A;  1IXD A;  3TCJ A;  5IH2 A;  4N0A C;  1GBQ A;  2K3B A;  3PFS A;  3E2U A;  3GNF B;  1QVG P;  3QJY A;  2EQU A;  2VV5 A;  1W2B S;  2BKD N;  5GAM h;  3PNW C;  2M0O A;  4JLI A;  2OJ2 A;  3O8V A;  1FYN A;  2HEQ A;  1K73 U;  1X75 C;  3E9F A;  5C6S A;  2KEA A;  3RDV A;  4KGX B;  3OYI A;  3G6E A;  2JVV A;  3L2U A;  3E1S A;  1MMA A;  2JXB A;  3M56 A;  2PVO B;  4JRQ A;  3OW2 A;  3PVL A;  4QVD A;  1SHG A;  4AT1 B;  3CMA T;  4DBH A;  1UJ0 A;  3SWN B;  3CCS Q;  1XOV A;  3PE0 A;  4PJO G;  3KBG A;  2QEX Q;  1ZBJ A;  5KYX A;  1MNE A;  5FWC A;  1VQ6 T;  1OV3 A;  5IN1 A;  2FVU A;  1AZG B;  4IUP A;  3NTK A;  3VS0 A;  1M90 C;  2KYB A;  4R55 A;  1PNJ A;  3SFM A;  1VQL Q;  1SSF A;  1AHJ B;  3QPH A;  4KUL A;  4XTW A;  4BDY A;  2GQI A;  4X1V A;  1R8O B;  2DET A;  4J9H A;  1WIE A;  5FU7 B;  3CCL A;  4BUG A;  1BIA A;  2FPE A;  3I56 A;  2RQT A;  4M7A D;  2EAY A;  4J9D A;  4M7D A;  2JNG A;  2A37 A;  2K6D A;  4JZ3 A;  4F7U A;  2EYW A;  2D8J A;  5CO7 A;  1NLO C;  1S72 T;  2JM9 A;  1PRM C;  3G6E Q;  3M4Y A;  3OMC A;  1YIJ T;  2XD0 A;  1AOJ A;  1FXX A;  4E2F B;  1EX4 A;  1VQP A;  1RAA B;  1QVF A;  1BIB A;  2XI9 A;  3OSV A;  3I5R A;  4FW2 A;  2QQB A;  1LPL A;  2D1X A;  1YJW T;  3QWX X;  5IAY A;  2JTE A;  4C92 B;  3QHS A;  3JCM d;  1V29 B;  2DKG A;  3A8O B;  2GGR A;  2E64 A;  4Z8A A;  2GTJ A;  1G3Y A;  2FB7 A;  4M7A E;  3DLL A;  3CCQ A;  1U8R A;  3VS2 A;  2XID A;  3GIB A;  3A8G B;  3CCL Q;  2PVG B;  3CCL T;  1W4S A;  4ZN1 A;  3EG2 A;  5GAM f;  1C1A A;  3H6Z A;  2D6F A;  3I56 Q;  4DOV A;  2EFI A;  2M51 A;  4FYW B;  1WA7 A;  2X4Y A;  3QBY A;  4XTV A;  3VS6 A;  1OX8 A;  2ZPG B;  1K76 A;  1M1K C;  2QI2 A;  4DBF A;  2LTO A;  3P8B B;  5KE3 A;  2COZ A;  1SG5 A;  2LMJ A;  3P8H A;  3CC2 T;  2E70 A;  1RAD B;  4EPC A;  3X28 B;  2ROT A;  1KD1 U;  4RG8 A;  3LWI A;  3EHR A;  4XK8 E;  1MHN A;  5GAN 2;  2KRO A;  3L2V A;  2MAM A;  1YCY A;  2YUQ A;  1X27 A;  4MZP A;  4QQD A;  1VQP Q;  4RTY A;  2AHJ B;  1QKX A;  3L1A A;  3WVD B;  3IQL A;  1WHJ A;  1VQO T;  2CZ7 B;  3SB2 A;  1YWO A;  2LCL A;  2OTL A;  2H8H A;  5CKB A;  1WHG A;  1UG1 A;  1XJW B;  4ZN3 A;  1KQS P;  2QGF B;  2YUP A;  1LJO A;  5A0G A;  3CCQ Q;  3DB4 A;  3LGF A;  4N4H A;  2YLC A;  3I55 T;  3QYH B;  2IPO B;  4OMO A;  4M7A F;  3QSU A;  1R0C B;  4C8Q D;  4RG2 A;  4C92 G;  2I2L A;  2K2M A;  2QA4 T;  2AKL A;  1Q7Y R;  1QW1 A;  4CI0 C;  5CK9 A;  1JO8 A;  2K4Y A;  3QWY A;  4OGC A;  1KQS S;  1BB9 A;  2LZ6 B;  1W2B A;  1M2V A;  4HVU A;  2O31 A;  1YJ9 T;  2DRM A;  1VYV A;  4M78 G;  4N4I A;  4TVR A;  2RO0 A;  1VYU A;  3BE3 A;  1PRL C;  1TS9 A;  5EC7 A;  3EFR A;  4KH1 B;  4LD6 A;  3PIP A;  1RAF B;  1NEG A;  2DER A;  1NYF A;  1I8F A;  2JMC A;  1U06 A;  3OMG A;  2FL7 A;  1QVG A;  2NUP B;  3LLR A;  2X9H A;  1KC8 U;  2PUK B;  2KRM A;  2OTL Q;  2VXF A;  1X6G A;  5GAO q;  1YN8 A;  3MEV A;  5EG2 A;  2R5A A;  4ELY C;  2AK5 A;  4C5E A;  5I11 A;  1GCQ A;  4X9C A;  3X25 B;  5A0L A;  1Q81 R;  3TU4 K;  5GAO r;  3MET A;  1VIF A;  4HKE A;  2RI5 A;  1ZLM A;  2H3E B;  4Z88 A;  2K57 A;  2XHC A;  3CCU A;  2ROL A;  2L3Q A;  4PLL A;  2F1L A;  1YIT A;  4CC7 A;  4BDZ A;  2FG0 A;  5GAN e;  3UPU A;  3L42 A;  1SRL A;  1WXB A;  2K5I A;  3FIF A;  8AT1 B;  1CKB A;  1YP5 A;  3EGD A;  2RN8 A;  2WSF E;  1AZE A;  2EGC A;  2DO3 A;  4M7D E;  3LYI A;  4F7U E;  2KSS A;  2V26 A;  1WHK A;  3F70 A;  3PT9 A;  1Q82 U;  4JLG A;  2X4J A;  1NZ9 A;  3CPF A;  5CQY A;  2DXB A;  2KK4 A;  3JCM h;  1N6A A;  3KFV A;  3REA B;  2ATC B;  4LDV A;  2GBQ A;  5KCO A;  2CZ6 B;  1VOM A;  1WX6 A;  3TVT A;  4OMP A;  2X3X D;  2KYM A;  5GAM j;  1Y0M A;  2VUB A;  4WTO B;  1NJI R;  2A36 A;  3NHN A;  1V76 A;  3V8L A;  4M78 A;  1U1T A;  5GAN g;  2CZ0 B;  4B9W A;  5HK0 A;  2LJ0 A;  4EMK A;  3CC7 A;  3CEY A;  5LJ5 f;  1UE9 A;  1I5O B;  3OYC A;  3CCU Q;  2CYZ B;  4MDW A;  2XG8 D;  1S1N A;  3QKJ A;  1VQ7 A;  1YIT Q;  3OYE A;  4M7D C;  3ER0 A;  2EGA A;  2RQW A;  4IKF A;  2RJC A;  1AD5 A;  4MZT A;  1M2O A;  2HBP A;  4A4K A;  1WJS A;  2J7I A;  4MMK A;  1OPL A;  4E7H A;  4M75 D;  1SEM A;  2DL4 A;  4F04 B;  3SD4 A;  3VU3 C;  1KSW A;  3WVE B;  4OB0 B;  4FYY B;  5LL6 S;  4QQG A;  3L2R A;  4ZNX A;  4FSX A;  2RQV A;  4CRI A;  4M7D F;  4F7U F;  2RB6 A;  2E3I A;  3GP8 A;  4BAC A;  4RCC A;  4OMM A;  2KNB B;  3URG A;  3E9G A;  1M3B A;  3VKI A;  4OMQ A;  3CCM T;  2CDT A;  2FPF A;  3ULR B;  2CP0 A;  2ZPH B;  1I4K 1;  2LCC A;  2P0K A;  3OQ5 A;  2NUT B;  2C0I A;  3JRZ A;  1OX9 A;  1ZUU A;  1QMC A;  4Y91 A;  3TEE A;  2CS7 A;  3CC7 Q;  2EKH A;  3EHQ A;  4E6R A;  3OY9 A;  1TOV A;  3PTA A;  4C8Q B;  1TG0 A;  1VQ7 Q;  4PJO C;  3VRZ A;  3M55 A;  1VQ8 T;  1VQ8 Q;  1IHW A;  4OVA A;  3SEM A;  3S3O A;  5LJ3 e;  2ECZ A;  4KUI A;  3HRU A;  2YT6 A;  1M1F A;  1VQ5 A;  1KQS A;  2RMO A;  1KQ2 A;  1FMV A;  1B34 A;  4AFS C;  1N8R C;  1HYO A;  3JCM f;  2J05 A;  1YBY A;  2KY9 A;  3MP8 A;  3G71 A;  2E10 A;  5KYW B;  1Q86 R;  2DJQ A;  3RKY A;  3CD6 A;  2E6Z A;  1RI9 A;  2VB6 A;  2L3R A;  3VUB A;  1RAC B;  2BIV A;  5D6W A;  2K79 A;  3GBQ A;  1IRE B;  4KRT A;  1W6X A;  2F69 A;  3M0S A;  1MV3 A;  3OYD A;  2OTJ A;  4Z02 A;  1WYX A;  2MWO A;  4BY6 B;  2DE0 X;  1IRX A;  4M4Z A;  1IGQ A;  4XAX B;  2YHT A;  2LT4 A;  2MPX C;  2O4X A;  4XU2 A;  2KXD A;  3CXC S;  1G3T A;  3JB9 J;  2V8J A;  3BFM A;  1BU1 A;  1QKW A;  2EQI A;  1N5Z A;  5GMK e;  1H3Z A;  2DMO A;  1CKA A;  2XIC A;  1YFN A;  1OU8 A;  2HCK A;  1VQ5 Q;  2IIM A;  2V8K A;  1KFZ A;  4J9C A;  1D3B B;  3J80 E;  3VYH B;  3HSB A;  4WCI A;  2KE9 A;  5LJ3 d;  1WFW A;  2E6N A;  4IUQ A;  2CGH A;  3VYG A;  1Q7Y C;  1M3C A;  2Y4Y A;  4CC2 A;  2L2P A;  1KHI A;  3GF5 A;  1D0Z A;  2QGG A;  3EGX A;  3OYM A;  3MPU B;  4X34 A;  3EGU A;  3CMA A;  4LDX A;  1DJ7 B;  2OAW A;  2EYZ A;  2X4W A;  5KYN A;  4KT0 E;  4C0F A;  1UB4 A;  4J9F A;  1QCO A;  1VQ6 A;  1BI2 A;  1HD3 A;  1BK2 A;  2DVE A;  2RHZ A;  4PJN A;  3RES A;  1GCQ C;  2YRD A;  4BD3 A;  5KYU A;  2PU9 B;  4MDX A;  1T3S A;  2RD1 A;  1JQQ A;  1X2Q A;  3HKS A;  1UGS B;  1SKU B; 
#chains in the Genus database with same CATH homology
 2XID A;  3GIB A;  2GFU A;  3ME9 A;  4XTY A;  3VUZ A;  1BYM A;  1WPY A;  2DK3 A;  3A8G B;  2PVG B;  3CCL T;  5LJ5 g;  1W4S A;  1Y71 A;  4M78 E;  4ZN1 A;  4ZTF A;  5CCA A;  3GOX A;  5GAM f;  1I5L A;  3KUF A;  3E19 A;  3H6Z A;  2D6F A;  2DZ9 A;  1M9S A;  2RHY A;  4DOV A;  1VQN T;  2RHU A;  2EFI A;  3MHX A;  2EYQ A;  4RKU E;  1EIF A;  2RHX A;  4N0A A;  3RMS A;  2EJF A;  2P0Q A;  2LNV A;  1Q81 C;  5GAN 8;  3CC4 T;  1O9S A;  2QQ9 A;  2X4Y A;  3JCM X;  3QBY A;  4XTV A;  4OB1 B;  2ZPG B;  1S72 A;  4J6W A;  2O4X B;  2RJE A;  2QI2 A;  1M1K C;  2LTO A;  3OS5 A;  3P8B B;  5KE3 A;  2RHI A;  4J5Y A;  2F5T X;  1RL2 A;  4L59 A;  4PNO A;  4XTZ A;  4A4H A;  3N5B B;  4M75 B;  3H8Z A;  3P8H A;  4X9D A;  2LVM A;  2D0Q B;  4PJO F;  3CC2 T;  3OYL A;  5HK3 A;  1QP2 A;  4M77 B;  2E70 A;  4BE2 A;  4EPC A;  2GF7 A;  3X28 B;  3CCR T;  1YIJ A;  4RG8 A;  3LWI A;  1KD1 U;  4XK8 E;  1MHN A;  1UGP B;  4JDS A;  5GAN 2;  3CCJ T;  3X24 B;  3L2V A;  3C94 A;  4ZGJ B;  2MAM A;  5GMK m;  1YCY A;  4A4F A;  1MGQ A;  3JCM b;  4M7D B;  1VIE A;  2QDY B;  4MZP A;  4NOY A;  2RK1 A;  4NS5 A;  4F7U B;  4QQD A;  1KC8 C;  2O01 E;  3J81 E;  4DQ2 A;  1XQH A;  3LH0 A;  2AHJ B;  3L1A A;  4JUV A;  3OYG A;  3NTH A;  2MWP A;  3QUI A;  3WVD B;  4C0D B;  1VQO T;  1YHQ T;  1Y96 A;  4OGE A;  1YJW A;  4WF2 A;  2CZ7 B;  3SB2 A;  5L8R E;  3R6O A;  4C8Q C;  5GAN j;  2Y4X A;  3P8D A;  5LJ3 j;  5FLX E;  2XDP A;  3GNG A;  3JCM V;  4C0Z A;  2LCL A;  1N9R A;  3ASK A;  3MP1 A;  2E12 A;  2OTL A;  4V2S A;  3QDR B;  5CKB A;  3BDL A;  4ZN3 A;  5KH6 A;  4DA4 A;  4M78 C;  3HHT B;  1H64 1;  3JCM c;  4HCB A;  2L5Q A;  3QZ9 B;  1RI0 A;  1VQM T;  4EMK C;  1LJO A;  5A0G A;  3CPW S;  3MEA A;  2R5M A;  3DB4 A;  3LGF A;  4A4G A;  3HPW A;  4QQ6 A;  2V8I A;  3ZBD A;  1LNX A;  1M4Z A;  4N4H A;  3OB9 A;  2YLC A;  3I55 T;  2WAC A;  3OS1 A;  3QYH B;  3X20 B;  4ZTJ A;  5DLO A;  4JS4 A;  4M7A F;  2K2V A;  3DKM A;  4C8Q F;  3QO3 A;  4A53 A;  3QSU A;  1VQN A;  3PIO A;  3TRE A;  4C8Q D;  1NJI C;  1M8V A;  4JRI A;  4RG2 A;  3CBO A;  3LGL A;  4P5N A;  2DJZ A;  4C92 G;  3RER A;  2I2L A;  2PVD B;  1VQK T;  4M77 C;  2WSC E;  2LT1 A;  3CBM A;  3V8J A;  3CCU T;  2QA4 T;  3CC4 A;  4M78 F;  1P92 A;  3EAE A;  1YJN T;  1QW1 A;  2RJD A;  3OBY A;  2DXT A;  4ZGE B;  5CK9 A;  4M78 D;  2K4Y A;  4CI0 C;  4EMH A;  1YIT T;  1U8R A;  4Y28 E;  4OGC A;  4C8Q G;  2HAX A;  5A0D A;  3NTI A;  1KQS S;  3SWN C;  1W2B A;  3CME T;  2HQX A;  1Y07 A;  3CC2 A;  4ZGD B;  1YJ9 T;  2LQ8 A;  3GLX A;  1BI0 A;  1HXD A;  2EQM A;  3A8M B;  3MCA B;  5LJ5 e;  3CCR A;  4MML A;  4A54 A;  4YTL A;  2DEQ A;  3JSC A;  4M78 G;  2LDM A;  1Q81 U;  3LW5 E;  3CCJ A;  2JTM A;  4VUB A;  4LDY A;  2RI3 A;  4XQ3 A;  4N4I A;  3OA6 A;  3OW2 S;  3JB9 I;  1M1K U;  4TVR A;  3JB9 F;  3J7A F;  1N8R U;  2RO0 A;  2JZ2 A;  5GAM d;  2E65 A;  4EMG A;  3JB9 D;  1QP3 A;  3OS0 A;  1FX7 A;  3A8H B;  3EFR A;  3ZEH A;  4LD6 A;  4HCZ A;  4BY6 C;  3PIP A;  4M77 D;  3VV0 A;  4DOW A;  3OYJ A;  3FC3 A;  3G4S T;  3OBW A;  3OYY A;  5I2S A;  1VQO A;  1YHQ A;  1I8F A;  1K8A C;  3A8L B;  3M54 A;  3HP9 A;  3OMG A;  2FL7 A;  4IUU A;  5FRO A;  5GMK j;  1QVG A;  4B9X A;  5GAN 6;  3JB9 G;  3QG1 A;  1M1G A;  2DTO A;  3LLR A;  2R57 A;  1WQ7 A;  2P4T A;  2RA2 A;  3OYA A;  3NFC A;  3V7S A;  1KC8 U;  2PUK B;  4PL6 A;  4M77 G;  5J3B A;  2ZCF B;  3OYB A;  2ZGW A;  5FRM A;  4C92 E;  2VXF A;  3WXM B;  5FU7 C;  4PLI A;  4HT8 A;  1JBM A;  5GAO q;  4IUT A;  4J83 A;  2HD0 A;  5KCH A;  5CVI A;  2FYK A;  5CQX A;  2A3L A;  3MEV A;  5EG2 A;  2R5A A;  2RI2 A;  4ELY C;  5CKD A;  1VQM A;  2EKO A;  4NL2 A;  2DXU A;  5I2M A;  4M7D G;  4C5E A;  2KDS A;  4KUD K;  2HQE A;  4F7U G;  5FU6 B;  2CZ1 B;  3MEW A;  4X9C A;  2VC8 A;  1Y96 B;  4IUV A;  5HY6 A;  1K9M C;  1M90 U;  3I55 A;  3X25 B;  5GMK i;  5A0L A;  2L8D A;  4JRK A;  2PQW A;  4C5I A;  5GMK l;  3L2W A;  3TU4 K;  4GY5 A;  5GAO r;  2XKO C;  3MET A;  1VIF A;  4HKE A;  2RI5 A;  3FB9 A;  3V7R A;  4LDU A;  3T9N A;  3CC7 T;  2C06 A;  3LX7 A;  2X4X A;  2K57 A;  4PJO A;  2XHC A;  2DD4 A;  1VQK A;  3CCU A;  2QA4 A;  5GAN h;  3C95 A;  5LJ3 h;  1OYX A;  3CXC A;  1YJN A;  4PLL A;  3PMI A;  4XTU A;  1YIT A;  1VQ7 T;  2LC4 A;  4BDZ A;  2QQA A;  3CME A;  3FLG A;  1YJ9 A;  2R58 A;  4M75 E;  1NJI U;  1QVP A;  4UC4 A;  4M77 E;  5GAN e;  3PGG A;  4XTX A;  3UPU A;  3L42 A;  2K5I A;  2K3X A;  3FIF A;  4J7I A;  3V7C A;  3RIR A;  3RKW A;  2E1H A;  5HKC A;  2WSF E;  5GAN 7;  3RMQ A;  2DIG A;  5D6Y A;  2DO3 A;  2XDD A;  4M7D E;  3LYI A;  4F7U E;  2KSS A;  4FM4 B;  1WJR A;  1Q7Y U;  3OSS C;  4C92 C;  3F70 A;  3PT9 A;  1Q82 U;  5LJ5 d;  3G4S A;  4JLG A;  5CKE A;  1X6O A;  4JS5 A;  3QZ5 B;  2X4J A;  1NZ9 A;  3CPF A;  5CQY A;  2DXB A;  2KK4 A;  4XU3 A;  1QVF S;  5FRN A;  4J6X A;  3JCM h;  4J6Y A;  1N6A A;  5GAO p;  2VXE A;  3QYG B;  3ZFJ A;  5GAN 3;  1VQ9 T;  2X35 A;  2L89 A;  1IZ6 A;  4OMF B;  4HT9 A;  1KQ1 A;  1JJ2 A;  5CIU A;  4LDV A;  1QVG S;  2RJF A;  5KCO A;  2CZ6 B;  2ZZD A;  2A7Y A;  2XU8 A;  3CCS T;  2LRQ A;  4LDW A;  1XTD A;  5AYF A;  3JCM e;  5GAO n;  4M7A A;  4C8Q A;  2QEX T;  1Q86 C;  2EQJ A;  2OAU A;  3QII A;  4BE0 A;  4OB2 B;  2P0P A;  5GAM j;  2VUB A;  4C92 F;  3HFO A;  5M9O A;  2EWN A;  4PKC C;  3EFS A;  4C92 D;  3AHU A;  1G5V A;  4O6J A;  2JN0 A;  3V8L A;  4M78 A;  1U1T A;  5GAN g;  2IG0 A;  5LJ3 g;  2CZ0 B;  1I81 A;  3MEU A;  1UGQ B;  3QXE B;  2ZPB B;  4B9W A;  5HK0 A;  4E7J A;  3OS2 A;  4ELZ C;  2DXC A;  4EMK A;  3FJP A;  3CC7 A;  1KG1 A;  3CEY A;  5GAO m;  1NE8 A;  4M75 C;  5LJ5 f;  4HA8 A;  1VQL T;  1WQW A;  5GMK h;  3OYC A;  3HL8 A;  1FWZ A;  2CYZ B;  2KMT A;  3SDZ A;  4MDW A;  1K9M U;  2XG8 D;  2JTF A;  4RMO A;  3KXT A;  3QKJ A;  1VQ7 A;  1BKB A;  1K73 C;  1WJQ A;  2DAQ A;  3G7Z A;  4NL3 A;  1NPR A;  3OYE A;  4OF1 A;  2HNI A;  3DLM A;  2K5L A;  4M7D C;  3ER0 A;  3JAM E;  3M59 A;  4IKF A;  2RJC A;  4MZT A;  4QVZ A;  5DM7 R;  2B8A A;  2DTH A;  2HBP A;  3DB3 A;  1WJS A;  2LX9 A;  4II1 A;  4A4K A;  4C0D C;  3VJP A;  5A2Q E;  4PJO B;  1HK9 A;  4MMK A;  4XU0 A;  3SWN A;  1VQ5 T;  5CKF A;  2GQV A;  4M75 F;  4Q5W A;  3JCM g;  3M53 A;  4E7H A;  4M75 D;  4M77 F;  2QQR A;  2GFA A;  4JRP A;  3SD4 A;  1N9S A;  5IT9 E;  1VUB A;  3VU3 C;  2H3J A;  4FT2 A;  3WVE B;  4OB0 B;  2DIQ A;  3G6E T;  5LL6 S;  4E7K A;  3OYH A;  2QTX A;  3M57 A;  4QQG A;  3L2R A;  3M4G A;  4FSX A;  1KHC A;  4CRI A;  4N4G A;  4M7D F;  2Y90 A;  2M16 A;  4M75 G;  4F7U F;  1VQ9 A;  3G71 T;  2BUD A;  2RB6 A;  3FRN A;  4M7D D;  3GP8 A;  4BAC A;  3BY7 A;  2G3R A;  4RCC A;  4JJN K;  3CD6 T;  3Q1J A;  3CCS A;  4C5G A;  2D9T A;  3PMT A;  2LQK A;  4L6V 5;  3URG A;  5CR2 A;  3E9G A;  3JCM Q;  4E7I A;  1N27 A;  2DPP B;  2K5F A;  1M5Q 1;  3VKI A;  2QEX A;  2CKK A;  2DD5 A;  3UWN A;  3S3M A;  4OP0 A;  2K3Y A;  3CCM T;  3OYN A;  2ZPH B;  4ME7 A;  2XK0 A;  1I4K 1;  2LCC A;  2ZPI B;  3L2Q A;  2VYT A;  2P0K A;  3C12 A;  3INZ A;  3OYK A;  3OQ5 A;  5LJ5 j;  2ZPF B;  3FDR A;  3JRZ A;  1XNI A;  4E7L A;  2OTJ T;  2RM4 A;  3OYF A;  4Y91 A;  4E47 A;  3UT1 A;  3TEE A;  4A4E A;  2CS7 A;  3HFN A;  1Q86 U;  2XDB A;  5GAN f;  2MI6 A;  2VGN A;  3RUX A;  3CPW A;  1TH7 A;  1VQL A;  1PSF A;  3OY9 A;  3PTA A;  4M7A B;  3TCJ A;  1D3B A;  4C8Q B;  4KBM B;  5DY9 A;  2EIF A;  4BI4 A;  3LWH A;  4N0A C;  5D6X A;  4PJO C;  4ATO A;  2ZPE B;  3PFS A;  3GNF B;  3M55 A;  4M78 B;  1VQ8 T;  3QJY A;  4OVA A;  2KVQ G;  2KQW A;  2NLU A;  2DTI A;  2EQU A;  2VV5 A;  3S3O A;  2FHD A;  5LJ3 e;  1VQ4 T;  1W2B S;  1G3W A;  4QW2 A;  3MO8 A;  4EDU A;  4EMK B;  2MMP A;  4KUI A;  3I56 T;  1X01 A;  2BKD N;  5GAM h;  3HRU A;  3PNW C;  2M0O A;  4JLI A;  3L2Z A;  1M1F A;  2E5Q A;  3O8V A;  1VQ5 A;  1BI1 A;  4QVC A;  1X75 C;  1K73 U;  1JB0 E;  3V8K A;  1KQS A;  4J8O A;  2EQK A;  3E9F A;  5C6S A;  1KQ2 A;  1UEB A;  5DLQ E;  1B34 A;  2M1H A;  3OYI A;  3G6E A;  1N8R C;  2JOY A;  2WSE E;  4O5V A;  2JVV A;  5GAM e;  3JCM f;  5J39 A;  5GAN 5;  3L2U A;  3E1S A;  1OZ3 A;  3C4S A;  4C5H A;  4FL6 A;  1YBY A;  5GAO l;  2KY9 A;  3MP8 A;  3M56 A;  2PVO B;  3QJ6 A;  4JRQ A;  3G71 A;  3OW2 A;  4PJO D;  1ZQ1 A;  2E10 A;  4QVD A;  4R56 A;  5FU6 C;  4C92 A;  3RKY A;  1PSE A;  3CMA T;  2E41 A;  3CD6 A;  3SWN B;  2E6Z A;  3A5Z B;  3JCM J;  1XOV A;  4BI3 A;  1NPP A;  2L3R A;  2YRV A;  2M9U A;  4PJO G;  3GPL A;  3KBG A;  3VUB A;  3CCV T;  1VQP T;  1K8A U;  1OZ2 A;  2BIV A;  5D6W A;  3CCM A;  2MF2 A;  4GLK A;  4LD9 K;  1IRE B;  2RH2 A;  1VQ6 T;  2F69 A;  3M58 A;  5IN1 A;  2FVU A;  4M7A C;  3OYD A;  4IUP A;  2OTJ A;  3NTK A;  4Z02 A;  2MWO A;  3BW1 A;  1JRI A;  4BY6 B;  1M90 C;  4R55 A;  2KAF A;  2JUF A;  2QQS A;  4BB7 A;  3JB9 H;  2EJG A;  4FT4 A;  3SFM A;  1WGS A;  5GAN 4;  3CCE T;  1SSF A;  1AHJ B;  3QPH A;  3M9Q A;  2DZC A;  4KUL A;  2GCX A;  4XAX B;  1UGR B;  2YHT A;  3MP6 A;  1YI2 T;  4XTW A;  4J7F A;  4BDY A;  2EJ9 A;  2LT4 A;  3CCQ T;  3JCM W;  2O4X A;  5GAM g;  4XU2 A;  1R8O B;  4MZM A;  3BDU A;  1O75 A;  3CXC S;  1G3T A;  5FU7 B;  3JB9 J;  2V8J A;  5CAI A;  4M75 A;  3BFM A;  4BUG A;  1VQ8 A;  3CCL A;  1BIA A;  4BI8 B;  5GMK e;  3M5A A;  1H3Z A;  4M77 A;  1BI3 A;  1VQ4 A;  4HCC A;  3I56 A;  2QXF A;  2RK2 A;  2PUO B;  3HRS A;  4M7A D;  2XIC A;  3S6W A;  4FU6 A;  2EAY A;  1G3S A;  4PJO E;  4XU1 A;  1ZHI A;  3JCM P;  2V8K A;  1KD1 C;  2YLB A;  1D3B B;  3UDC A;  2JNG A;  5LJ5 h;  1ZBX A;  4F7U A;  3J80 E;  3VYH B;  4M7D A;  2IVW A;  3CBP A;  5CKH A;  5CO7 A;  1S72 T;  3HSB A;  4M7A G;  5GAN d;  5I21 A;  5LJ3 d;  3M4Y A;  3OMC A;  2E6N A;  4IUQ A;  1Y7X A;  2CGH A;  3VYG A;  1Q7Y C;  2Y4Y A;  1Q82 C;  4C0G A;  1KHI A;  3GF5 A;  3OYM A;  3RKX A;  1YIJ T;  4IUR A;  4X34 A;  2XD0 A;  4FIB A;  5KE2 A;  3CMA A;  1FXX A;  3S3N A;  4LDX A;  1DJ7 B;  1JJ2 S;  3CCV A;  1VQP A;  2X4W A;  4RCB A;  1LOJ A;  1B34 B;  4KT0 E;  4C0F A;  1QVF A;  1OI1 A;  1UB4 A;  3HRT A;  1BIB A;  1U1S A;  2XI9 A;  3FEO A;  3OSV A;  1VQ6 A;  5C0M A;  2QQB A;  4D6W A;  1YJW T;  1GXI E;  1BI2 A;  3RES A;  2DVE A;  2RHZ A;  4BD3 A;  4C92 B;  5IAY A;  2PU9 B;  3QHS A;  3X26 B;  3JCM d;  1V29 B;  2OTL T;  4MDX A;  1WNL A;  2DKG A;  2RD1 A;  3A8O B;  4OB3 B;  4BE1 A;  5LJ3 f;  2E64 A;  3CCE A;  3HKS A;  1G3Y A;  5J26 A;  1YI2 A;  2FB7 A;  4M7A E;  2F5K A;  4C8Q E;  1UGS B;  2VGM A;  3DLL A;  3CCQ A;  4L5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...