1QW1A

Solution structure of the c-terminal domain of dtxr residues 110-226
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
121
structure length
121
Chain Sequence
GSHMDEVERRLVKVLKDVSRSPFGNPIPGLDELGVGNSDAAAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Diphtheria toxin repressor
publication title Prolylpeptide binding by the prokaryotic SH3-like domain of the diphtheria toxin repressor: a regulatory switch.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
total genus 6
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2003-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qw1A00
4O6JA 2QQAA 1G3TA 3HRTA 2LX9A 2K5FA 3GLXA 3HRSA 2H3JA 1BI3A 2K5LA 1FX7A 5CVIA 2QQBA 1G3WA 1BI0A 2K4YA 1BYMA 3E19A 1G3SA 1QW1A 2GCXA 2K5IA 1BI2A 3MHXA 1QVPA 1G3YA 2QQ9A 1BI1A 3HRUA 1P92A 4O5VA 1FWZA 1U8RA
chains in the Genus database with same CATH superfamily
3CC4A 1VYUA 3G6EA 1YJ9A 4XTXA 1Q81R 1M1KU 4E2FB 2F1LA 3LLRA 5GAMf 2DO3A 1SHGA 2IPOB 3H0HA 2KT8A 2HBWA 2MAMA 1ZSGA 1ZQ1A 4JJBA 4FL6A 1M30A 4A4HA 4K11A 2F5KA 1PRLC 4FYWB 3FIFA 2CZ1B 3RERA 4ANJA 3AHUA 1OX8A 2EYXA 4LUDA 1UTIA 3EG1A 4PJOG 1VQ8T 3G7ZA 2LX7A 4C92E 2EAYA 2C0IA 1QCOA 3CCRA 1VQOQ 1HK9A 1HD3A 2CP7A 1K8AU 1WHMA 3CCSA 2KDSA 1Y96A 3C0CA 4PFZA 3ZL7C 3G4ST 2QXFA 4LUEA 3G6ET 2FPFA 4XTYA 2IG0A 2KR3A 1SRMA 1LOJA 4D6WA 1GBQA 1I4K1 4AFUC 4E7HA 4E6RA 2LJ0A 4BDZA 3QZ5B 2LQWA 5KH6A 4HA8A 4KH0B 2VASA 5C0MA 4L5GA 3GLXA 4N4IA 4ZN3A 2HKNA 3RBBB 5D6XA 3VU3C 4PFPA 3OYKA 4JRIA 2HZYA 3CCRT 4M77F 2JS2A 1XTDA 1UGVA 2KRNA 1JJ2A 1M2VB 5GAMh 1PHTA 4M7AB 5HKCA 1X2KA 2KMTA 2RD1A 2QA4Q 1WNLA 2RNAA 1P92A 3VS5A 1UEBA 5KYWA 3JAME 1IB8A 1MNEA 4ZTFA 1GL5A 4M7AD 1OV3A 5AYFA 2QGGA 3KXTA 1FYNA 1KC8R 1K0SA 1Q95G 1VQ5A 1QP2A 5FRMA 4BI3A 2LNVA 4FSSA 4EMKC 3WVEB 4J8OA 2LRQA 1W1FA 4DBFA 3OYAA 5LL6S 2ESWA 3QZ9B 1OPLA 3MEVA 3H0FA 4N4GA 3G4SQ 2JW4A 2OX7A 1ZHIA 3CC4Q 5KYUB 4M78F 2CP2A 1YJ9Q 3VV0A 1WQWA 2A36A 5FU6B 4A53A 2P0QA 2X4WA 1ABOA 3VRZA 3X24B 2QGFB 4LDVA 2BZYA 2KK4A 3CCJA 3V7SA 5IH2A 5EG2A 1HJDA 2O88A 1JQQA 3UDCA 1T0JA 1YCSB 3EG3A 2E3HA 3PMIA 3QIIA 2FG0A 1KQ1A 3OY9A 3CCVT 1Q86C 1R0BG 4DOVA 3CEYA 4CC7A 4AMCA 4C8QB 2DERA 2IIMA 4KGVB 1VQ5T 2JNGA 2L8DA 1AHJB 1BIBA 1D1AA 1MHNA 3HSBA 1KQSA 1RABB 4F7UB 4NOYA 2NYSA 2B8AA 2KXCA 1O9SA 2K57A 2ZPFB 3NTIA 4GY5A 2HKQB 1YI2T 3CCSQ 1RUWA 1NYGA 1BCMA 4XQ3A 4ZGDB 3EG0A 2LCSA 3C95A 1WXUA 2RF0A 3J7AF 1OU9A 3CPWS 2VYTA 1VYTA 3S6WA 1G83A 4E7JA 1KIKA 1WYXA 1Q7YU 3OBWA 4AG2C 1K8AR 4ZGEB 3CCJT 3L2ZA 3EFRA 3SWNC 1LVKA 3CCQA 1ZSZB 3DB3A 2K5FA 3RKXA 3UATA 2DILA 1LPLA 4MZMA 2NUTB 1QVFA 2CZ6B 1BYMA 2HAXA 4BACA 2E1HA 2DVJA 1NJIC 3LGLA 3H6ZA 3OYNA 4KRTA 2K3BA 5GMKi 4IUPA 2NUPA 4OGEA 4KUIA 4PJOC 3HL8A 4QVCA 2KBTA 4CC2A 1T3LA 5GAN6 2BUDA 1U5SA 1WLPB 2EPDA 4BI4A 2HCKA 1HYOA 5LJ3h 1SPKA 4FYYB 4PK4A 1I5OB 1VQ5Q 2K5IA 2F2XA 2VXEA 1LJOA 2EQJA 2LJ3A 1ZA1B 4PL6A 2QQ9A 3JB9J 3C94A 4PLLA 4QVDA 5ECAA 4M7DE 3JCMV 1E7OA 2K2VA 4EMGA 3I55T 3CCQT 4Z89A 3OYCA 2VVKA 2OJ2A 1AWWA 2KYBA 2JTMA 1NZ9A 2DYBA 3P8HA 2E64A 2D8JA 3QJ6A 3CCJQ 2O4XA 3EGDB 2D0NA 3R6NA 4C8QE 1UDLA 4F17A 1FMKA 2JM8A 2MMPA 2Y4XA 3M0QA 2DX1A 2FPDA 4A63B 1IGQA 4F7UE 4JLIA 3MO8A 1ARKA 4RTXA 1KFZA 3G71Q 1KSWA 1PRMC 2GGRA 5GAMj 1VQMA 3HFNA 3I35A 1S1NA 4CRIA 2BZ8A 2EGAA 5LJ3e 1IO6A 1UGQB 1TH7A 3CXCS 4QQ6A 3OYHA 2M02A 5CQYA 3VRYA 5HK0A 2ZAEA 2FZKB 2DJQA 3JB9D 1W70A 1VQ4Q 4JDSA 1BI1A 2K2MA 2MOXA 2QDLA 4QQGA 1M3BA 3EAEA 2R57A 1UECA 2JTEA 3KBGA 3VS6A 1M90R 1VQNA 2R5AA 4E7KA 2DA9A 1OEBA 2JTFA 1N27A 2CS7A 1RLPC 4OMFB 1VQ6A 4M7AF 2GBQA 3X26B 3CCQQ 3HPWA 3GBQA 2QTVA 4D8DA 6AT1B 1NLOC 1NPRA 3A8LB 1LNXA 1OQKA 1VQMT 1S72A 3Q1JA 1OX9A 4DBHA 1K1ZA 2RHIA 3I56A 2DL8A 4C0DB 2QYZA 4E7SA 3QSUA 2E3IA 4M77A 2DBMA 3EFSA 3EG2A 1IREB 4BE2A 2DTOA 5IXFA 3J81E 2MWOA 5D7UA 1RAIB 1JJ2P 2DYIA 4IUTA 1K9MC 1UGRB 2JVVA 4P5NA 1MV0B 2P4RA 1VQNT 2YUQA 2AZSA 2DTHA 3HKSA 3P8BB 3UA6A 1VQ6T 3CCUT 3X20B 4XTZA 3PGGA 5CAIA 1JB0E 1KD1R 3D7SB 4C8QF 1WQ7A 3PIOA 2X35A 3QDFA 5FRNA 3OMGA 4O6JA 2HQXA 1VQ9Q 2YUOA 1UHCA 4F7UF 1YJWT 1GCQA 2MK5A 3I56T 4M78A 2MF2A 2XK0A 3GNFB 2A3LA 1MMDA 1H8KA 1Q81C 4N4HA 2D9TA 5GMKl 3H0IA 1B07A 7AT1B 4C92A 3JCMb 2E12A 3CMAA 1Y57A 4RTVA 1K4US 1NPPA 1H641 1UJ0A 3JRZA 1ZBXA 4N0AA 1VQMQ 3L2UA 3M5AA 1TUCA 4M7DC 3S3OA 1ZBJA 4FT4A 1YIJT 1UB4A 4C0ZA 3I5SA 2RQTA 1WIEA 3JCMQ 2QDYB 3OYGA 2JZ2A 4JLGA 5LJ3j 4MDWA 3TVTA 3HTRA 2IVWA 5KYXA 3EFOB 2LP5A 3AT1B 2E65A 3MP1A 2OTLA 1KQSP 2LQ8A 1NM7A 5A0GA 2P0KA 8AT1B 1VIFA 4VUBA 4CC3A 1W2BA 3SD4A 5KE3A 2LQKA 2HD0A 2M51A 3L2RA 1K73U 1G3SA 1AOJA 3RR6A 2X51A 1MGQA 1DJ7B 1RACB 5IHKA 5J3BA 2GFAA 4ZTJA 1M1FA 2ABLA 5GANg 1RADB 2ZPGB 4BDYA 1UGSB 3BDLA 1YJNA 4M77G 2CH4A 2E41A 5LJ5g 1S72Q 5FU7C 2YLCA 3CCLA 2DLPA 3I56Q 1BBZA 1I8FA 1KG1A 2DBKA 4KBMB 3GF5A 4FYXB 1QVFP 2LC4A 1BI2A 1QVPA 5KE2A 1Q82R 2K3YA 3OSSC 1MMGA 4M77E 1EIFA 4A4EA 2EKHA 4J6XA 5HK3A 2DF6A 4OMMA 3IQLA 4HT8A 3NTHA 2KQWA 4XU2A 3OA6A 1KC8C 2EQUA 3EGUA 5FWCA 2EWNA 4KT0E 1WHGA 3EGXB 1NG2A 4M78G 1TWBA 4J9GA 1ABQA 5I11A 2HNIA 5CIUA 2C0TA 4L59A 4JRKA 2K4YA 3QO3A 2KY9A 2DNUA 3CCLT 2FB7A 5IXBA 2GQIA 4C92G 3BE3A 3M55A 2KNBB 4M78E 2QA4T 1OPKA 1M5Q1 4GBQA 4LDXA 1CKAA 2BZXA 3M56A 4OMLA 1VA7A 2AK5A 3CMAQ 4DEYA 1E6HA 4A4GA 4CI0C 2Y4YA 2YDLA 4BY6B 5J39A 1D09B 2F69A 1WJSA 1ZA2B 2DL4A 5GAN7 3A98A 2YUPA 4PKCC 3GIBA 2JXBA 1M27C 5CKHA 4PJNA 2K3XA 3NPFA 4J7FA 5EC7A 2OTLQ 1VQ7A 3DLMA 9ATCB 3CC4T 1D0YA 4WTOB 1YJ9T 3S3NA 2RQVA 3JCMP 1N8RU 4KULA 1MUZA 2KSSA 3GOXA 2H8HA 2HL3A 1Y71A 5GAOp 3RNJA 3GPLA 2LT4A 2DPPB 3EG9B 4HT9A 3M0RA 1WHHA 4J83A 4IKFA 2VC8A 2A37A 2DXTA 5GAN2 1K8AC 1N6AA 3LYIA 2KT1A 2BIVA 2DEQA 3CBMA 3ULRB 3OYFA 2DL5A 1PD0A 5KYYB 2D6FA 1MMNA 1V1CA 3SHWA 1OYXA 2M0OA 1JU5C 1YJNQ 1AD5A 1K73R 1GFDA 2X4XA 3CCLQ 2RHYA 1CKBA 5GAOr 1WHLA 5CQXA 5I2MA 3E9FA 3CCST 4LDYA 2DXUA 3OS2A 2HDAA 3ZFJA 3NMZC 3EHRA 1VQ7T 2LJ1A 4FYVB 3FJPA 1F1BB 4HVWA 5GMKe 4E7LA 3LH5A 4GLMA 2C06A 3LWIA 4C0FA 4M7DA 3DLLA 4RMOA 2PZ1A 4TVRA 5GAMd 5KYUA 3VS1A 3J80E 1WA7A 1WFWA 2RJDA 2W0ZA 3V8JA 2DIGA 2K6DA 1RI0A 2V26A 3JCMg 4IIMA 4OMPA 3BW1A 2JN0A 3VS3A 1K76A 2JMCA 2RJEA 2VV5A 2ZPIB 2AZVA 5KYWB 4M75B 1WI7A 1Q86U 3BDUA 2DL3A 5GAN5 2CP5A 4C8QA 4M75D 2PVDB 1GRIA 4KH1B 2M16A 2CKKA 3FB9A 1KQ2A 2RI5A 2LCLA 4M77C 4F7UA 5LJ3f 2ZZDA 1M1KR 3TCJA 3G71A 4NL3A 1UHFA 3EH2A 3OSVA 4JRPA 1QKXA 1U1SA 3OW2S 2FRWA 1OULA 3M54A 2Y90A 2ZCFB 2RHUA 1SKUB 1RAEB 3CD6A 3S3MA 3OYDA 2RO0A 1QCFA 2CH4W 4GLKA 1UGPB 2JT4A 2G3RA 2P0PA 3X28B 8ATCB 3NGPA 1OI1A 2RN8A 1VQ7Q 2JUFA 4ME7A 3I9QA 4XU3A 2BE7D 5CO7A 1VQ4A 5C6SA 5GAN3 1W4SA 2K9GA 1NYFA 2NUTA 2O9SA 1GCQC 4XTWA 4IUUA 4II1A 4M78C 2KYMA 4FU6A 1NJIU 4JJCA 3FJ5A 2PUOB 2COZA 4OF1A 5IT9E 5GAN8 1M90C 1W2BP 4C92C 2HQEA 3RUXA 4A54A 2CT3A 3G71T 1JXOA 4M7AE 1N8RR 5M9OA 4N0AC 2XDBA 2I2LA 2MIOA 2OI3A 2YHTA 3E1SA 2RJCA 3CD6T 1D1BA 2HBPA 3FLGA 3CPWP 1QVGA 4PLIA 3LH0A 1NE8A 2V8IA 4M7DG 2AIRB 3O5ZA 3OQ5A 4RTWA 4YTLA 3UPUA 1AWJA 2D1XA 5HY6A 1RAHB 4Z02A 1VQ4T 2EYZA 2QAZA 2LT1A 2GFUA 2L3PA 3HP9A 4ELZC 4EPCA 2DMOA 2FL7A 1D0XA 3EHQA 2DD5A 2YRCA 4B6MA 1BIAA 3QDRB 4C8QG 1X27A 3EGDA 5LJ3d 3CCMA 2CDTA 4OB3B 1RAFB 1B3QA 1D0ZA 1VQ9A 4F7UG 3QWXX 4DQ2A 3REBB 2J6OA 1KD1C 3QYGB 3HRSA 2MI6A 4CC4B 4Y91A 3JCMJ 4LN2A 3ME9A 2ZPEB 3L2VA 4DEXA 2QEXA 5CKFA 4LD6A 1OZ2A 1FMVA 3OMCA 3NFCA 2BKDN 2RQUA 2EVRA 1D1CA 1WJRA 3ASKA 2JOYA 1WHKA 2ZPBB 3JB9I 1ZUUA 4C5EA 3FEOA 3CD6Q 2FYKA 5A0DA 2LCCA 4JPBW 2WACA 4IIOA 2E6NA 1JBMA 5IHIA 3OYMA 3CMEA 2MCNA 2PNIA 3PE0A 1AVZC 1VQ9T 1X43A 2GF7A 2EFIA 1G3TA 5GANh 2FVUA 4LDWA 1N5ZA 4BB7A 2PVGB 2NLUA 3LW5E 1V29B 2QEXT 3QKJA 3RIRA 2PUKB 4XTUA 1SG5A 2RPNA 1XJWB 1MV3A 1Q7YR 1JJ2S 1W6XA 4Q5WA 2DTIA 3N5BB 4OGCA 1VQKA 1PNJA 2A0FB 5CR2A 3CXCP 1WXBA 3VYGA 1U06A 2FO0A 3T9NA 1UE9A 2X4JA 2G6FX 2AT1B 1NEGA 2XI9A 4EMKB 3GNGA 1K9MU 3KFVA 2EW3A 3MPUB 3H8ZA 2FZGB 4J7IA 2KROA 2V8KA 3C4SA 4JUVA 1PKSA 3UA7A 3MEUA 3QUIA 2J6FA 5GAOl 3MCAB 4M75F 1RLQC 4IUQA 2GQVA 2M9UA 3M0TA 3M57A 2ED1A 1Q82C 2CUBA 1VYVA 2FZCB 4IURA 3CCEA 4RKUE 4UC4A 2OTJA 1OOTA 1WPYA 1B34B 3PVQA 2XDDA 1ACMB 4Y28E 2LQNA 1EX4A 5GANe 2E70A 2LTOA 2L2PA 2ROLA 4M7AC 3CCMQ 2ENMA 5LJ5e 1VQLQ 4ELYC 3PT9A 1S72T 2DRKA 2OAUA 5I22A 2K7AA 1RI9A 2BE9B 3CBPA 4E7IA 1YHQA 2EJGA 1OZ3A 4RTTA 4JZ3A 1T0HA 2QEXQ 2B86A 5FROA 2L3SA 4J5YA 1JO8A 2VUBA 1U1TA 1EZZB 1JRIA 1ZUYA 2ZPHB 2H3JA 3FRNA 2SRCA 2DE0X 3EFOA 1M8MA 2MPXC 3BY7A 3VJPA 4JJNK 1TXQA 1PCXA 3H9NA 2J06A 1TUGB 2OTJT 3RMQA 1RL2A 4OVAA 5FU6C 2WSEE 2A08A 4AFQC 1MMAA 2PU9B 1UUEA 3SWNB 3SDZA 3HRUA 3TU4K 2D8HA 3CMEQ 5DM7R 1Z9ZA 4HCBA 2QQAA 2EJ9A 3RKWA 2KRSA 3CC7A 5FLXE 5A2QE 4RTYA 2EGCA 1YP5A 3M53A 2CGHA 3TSWA 4C8QC 2KI7A 2GTOA 1M3CA 3RDVA 1D3BB 2GTJA 3M58A 2J05A 2LDMA 3MKDA 3CBOA 4C92D 2D0QB 2RH2A 2YUNA 3FC3A 5L8RE 1T3SA 4PJOB 4ZNXA 4RCBA 4AG1C 3CMAT 3CPWA 5DLQE 2VGMA 1PM3A 1C1AA 2M0YA 2VGNA 4PJOD 3FDRA 5CVIA 4ESRA 1QKWA 1VQKQ 4LDUA 2P4TA 2PQWA 2DL7A 5D6WA 4HVVA 2VWFA 2MYSA 3CC2A 1VUBA 4MMKA 2HEQA 1WGSA 1K73C 4C0GA 2WSFE 1YNZA 2OTLT 4QW2A 1KC8U 1PC0A 2VB6A 1C0MA 1ZSZC 4MDXA 3R6OA 4AFZC 5A0LA 3CC7T 3OBYA 3OB9A 1QVGP 1YCYA 3CCEQ 3JB9H 3META 5HCKA 2OTJQ 1RAGB 4QKUA 2XU8A 4EIKA 1I07A 4F16A 2QQSA 1R8OB 1X6GA 1VQ8A 2CP6A 2Z0WA 4C5GA 2NUZA 5L23A 4FT2A 1WXTA 3JCMW 2J6KA 3E2UA 1ZLMA 1X69A 5GANj 1G3WA 2CSIA 2DEUA 3SFMA 1YJNT 1UG1A 3OS0A 3PMTA 1YBYA 2XMFA 3VS0A 3JB9F 3M9QA 3CC2T 2QTXA 4PJLA 2YXYA 4FM4B 1YHQQ 1JEGA 5CKBA 2EQIA 3ZEHA 2CZ7B 2E6ZA 1AT1B 2HSEB 1UJYA 3OYLA 3F70A 1X2QA 2JJ9A 3RMSA 5GAOn 1K0XA 3QPHA 4C5HA 1QLYA 3MHXA 1WX6A 4OMQA 1M1KC 3G1JA 1MNDA 3JCMe 1Z9QA 4BD3A 1ZUKA 2L5QA 4PJMA 1U8RA 5GMKh 3TQ7P 1KJWA 4Y92A 4PFOA 2V1QA 4HVUA 1GXIE 1BI0A 3EG9A 4XTVA 3UF4A 3CC7Q 4LNPA 4MZPA 2RA2A 2FEIA 3A1PA 4ZN1A 1E6GA 1AWOA 4PJOE 4KGXB 4RTZA 2EKOA 1I0CA 2H3EB 2EYYA 5KYYA 3PIPA 2GNCA 3CXCA 4JJDA 4X34A 3MEWA 1PD1A 4JRQA 2YLBA 1M2VA 2A7YA 1Y96B 4M7AA 2K79A 2R58A 4AT1B 4EDUA 2LVMA 5GAOm 5CKDA 1BU1A 2PVOB 3M0PA 2EBPA 3VUZA 2RI2A 2JM9A 2CUDA 3CC2Q 3CQTA 1N8RC 1YFNA 1QMCA 5KCOA 2L3RA 2NWMA 4DBRA 2BTTA 4NL2A 2RMOA 4MMLA 4PJJA 1AWXA 1M1GA 1XOVA 1U3OA 2GCXA 5IN1A 3M0UA 3SEMA 1NLPC 2COYA 1HSQA 3WXMB 3CCVA 4M75A 2HQHA 2O31A 3WVDB 2EQKA 4OB0B 1VQ8Q 1H3HA 2CSQA 1B7TA 3URGA 3THKA 5GMKm 3QXEB 2KXDA 4C0DC 2XKOC 3A5ZB 3RESA 2M1HA 1YI2A 3UWNA 1KHIA 3NHNA 1TOVA 2DETA 3EH1A 2KE9A 3U23A 2ECZA 1G2BA 4M7DB 3L1AA 2LZ6B 2C0OA 2ZGWA 3G6EQ 3QJYA 1NEBA 2L89A 4HCZA 4M7DD 1I1JA 2COWA 1X01A 4J9CA 4HXJA 3JV3A 2FRYA 2O2OA 4FW2A 1IRXA 4C5IA 4JS4A 4C92F 3M59A 4QQDA 2DM1A 4O5VA 4XAXB 1AZGB 3LWHA 5GAMe 3SB2A 1BI3A 2EGEA 2JMAA 1V76A 3VS2A 4JS5A 4PJOF 2XDPA 1GFCA 1W2BS 2P84A 3ER0A 2DZ9A 2DJZA 3CCRQ 2CZ0B 2EIFA 3LGFA 1ZSZA 4C8QD 5IHNA 1YWOA 2QQRA 1TU0B 2RJFA 3DKMA 1AZEA 1SHFA 1M90U 4M4ZA 2YWWA 3MP6A 1TSFA 3E9GA 5J26A 1VQPA 1XNIA 3LX7A 4E7ZA 1YITA 4M7AG 3HRTA 3X25B 2XIDA 5FU7B 3OYIA 5CK9A 4ATOA 3BFMA 1IHVA 1QQJA 1PG5B 1I81A 1IXDA 5GJWB 2RM4A 4RTUA 3JCMX 4MZTA 1C6VX 3OW2P 1R77A 1G3YA 4FSXA 3I55A 4XU0A 1PWTA 2DZCA 1M9SA 1H92A 1Q7YC 2QI2A 5DLOA 2EJFA 3GP8A 4R56A 1M8VA 3V7CA 2DAQA 2L0AA 5FW9A 4M75G 5KYNA 4QVZA 4OB1B 2DFUA 1O75A 1I5LA 1XQHA 5GANf 1BB9A 1SSHA 2L3QA 1M2OA 2OAWA 4FIBA 1VQPT 2F5TX 1YITT 1IGUA 3CCVQ 5LJ5f 5GMKj 2QQBA 1M3AA 2NUPB 4M75E 5GAMg 4XU1A 4QT7A 1M4ZA 1K9AA 1WZOA 1KD1U 5I21A 3I5RA 2RQWA 2SEMA 4OP0A 2KEAA 1VQLA 1R0CB 1YI2Q 2CP3A 2EYWA 2AHJB 5GJVB 2LX9A 4DBQA 1N9RA 1Y07A 3PTAA 1Y7XA 4J9EA 2CYZB 3NTKA 3A8GB 2KGTA 3V7RA 1Q86R 2ATCB 2ROTA 3M4YA 2YSQA 4ZGJB 3A8HB 1SRLA 2DKGA 2E4HA 4WF2A 1SSFA 4L6V5 2E5QA 4KUDK 3INZA 2O4XB 2RB6A 3OYJA 2YRVA 5I2SA 4J6YA 2QASA 3QG1A 4R55A 2XHCA 3CCMT 2YT6A 1TTHB 4RUGA 3MJXA 2DRMA 3E19A 1VQLT 3MP8A 1BKBA 3JCMc 3OYBA 2XD0A 4DOWA 1VQPQ 3MEAA 1YITQ 4HCCA 3OS5A 4B9XA 2DD4A 4J9BA 4Z88A 4BY6C 3P8DA 2DK3A 5LJ5h 3PNWC 2WSCE 5CKEA 2RK1A 3TEEA 4HCKA 4X1VA 3A8MB 2CP0A 4BE0A 4EMKA 2QG9B 3A8OB 4HKEA 3V8LA 2QK0A 1QCNA 2RI3A 3I55Q 5AT1B 4F14A 1NJIR 3CCUA 1YWPA 4JZ4A 5GANd 4X9DA 4BUGA 2KRMA 2EQMA 2F2VA 1Q82U 5LJ5d 1QWFA 1VOMA 4AFSC 5GAN4 3CMET 1B34A 3L42A 1FWZA 1YJWA 4XK8E 3TSZA 4D8KA 1X6OA 5CCAA 4J9FA 5FWBA 1QWEA 5D6YA 4LE9A 1OU8A 1HXDA 4NS5A 3VUBA 3RKYA 4M7DF 3OYEA 3C12A 4OB2B 2XG8D 3HFOA 4DA4A 1PSEA 1G5VA 2MWPA 5IAYA 4M77B 1Q81U 4WCIA 1BCOA 1YIJA 1VQKT 5LJ3g 1FX7A 3H41A 4M77D 1Y0MA 2VKNA 4R0KA 4Z8AA 2KAFA 2HL5C 2HSPA 3PVLA 3JB9G 1N9SA 3OYYA 1KK7A 2E10A 2RHZA 3VKIA 2PTKA 4E47A 3QHSA 1PKTA 2V8JA 1KHCA 2DXBA 1WJQA 1KQSS 3JCMf 3QWYA 1H3ZA 2FHDA 4PNOA 3OS1A 1SEMA 4LXCA 1SF9A 1A0NB 2O01E 3SWNA 5DY9A 4OMNA 3UT1A 2JS0A 1GCPA 4LD9K 3CCET 1G8XA 1VIEA 3M4GA 1QW1A 1WDXA 4M75C 1JXMA 3QBYA 4KGZB 1FMWA 2F2WA 2DIQA 4M78B 2ED0A 3JSCA 4RG2A 3DB4A 4FCYA 3VS7A 4F04B 1D3BA 2KVQG 1VQOA 1TG0A 4EMHA 4M78D 3L2QA 2J7IA 2AKKA 2LNHB 1X75C 4C92B 4PJOA 2W10A 3QYHB 4J6WA 3V8KA 3OW2A 2DVEA 2I0NA 2V1RA 2LMJA 1QVFS 3L2WA 3M0SA 4FW1A 5KCHA 2EYQA 1YHQT 1FXXA 2CREA 4B9WA 3KUFA 4V2SA 3ZBDA 4RCCA 3O8VA 2E5KA 2AKLA 1TS9A 5KYXB 2K5LA 1VQNQ 1X6BA 4J9HA 1VQ6Q 3CCUQ 3PFSA 4OMOA 1QVGS 1BK2A 2X3WD 1CSKA 4BE1A 4A4KA 3VYHB 4BI8B 4J9IA 2XICA 2RK2A 2VXFA 1UFFA 2FPEA 1J3TA 2RHXA 1VQOT 2RQRA 1YJWQ 1YN8A 3JCMh 2HMAA 4X9CA 3REAB 2X3XD 3EGXA 2QA4A 1K9MR 1QP3A 1ZX6A 3CPFA 1NBEB 2DXCA 3TREA 4IUVA 2R5MA 2CT4A 4A4FA 2X4YA 1TUDA 1PSFA 1GBRA 1IHWA 1EFNA 1AEYA 1RAAB 2O9VA 2X9HA 1YIJQ 3JCMd 3HHTB 4RG8A 5GAOq 2A28A 2YRDA 5LJ5j 4J9DA 3VS4A 1LCKA 3G4SA 1IZ6A 4ORZA 1WHJA
chains in the Genus database with same CATH topology
3CC4A 3OMGA 4O6JA 3G6EA 2HQXA 4M7DB 1KD1C 3L1AA 1YJ9A 3QYGB 3HRSA 4XTXA 4F7UF 1YJWT 1M1KU 2MI6A 2ZGWA 3LLRA 3I56T 5GAMf 3QJYA 2L89A 4M78A 4Y91A 2MF2A 2XK0A 3JCMJ 2DO3A 3GNFB 2A3LA 3ME9A 4HCZA 4M7DD 2ZPEB 3L2VA 1X01A 2MAMA 2QEXA 1Q81C 5CKFA 1ZQ1A 4LD6A 4N4HA 1OZ2A 4FL6A 4A4HA 2D9TA 2F5KA 4C5IA 5GMKl 4JS4A 4C92F 3M59A 3FIFA 3OMCA 2CZ1B 3NFCA 4C92A 2E12A 3JCMb 3CMAA 3AHUA 3RERA 4QQDA 2BKDN 4O5VA 1NPPA 4XAXB 1H641 3ASKA 1WJRA 3JRZA 4PJOG 3LWHA 1VQ8T 1ZBXA 3G7ZA 2JOYA 2ZPBB 4N0AA 5GAMe 3L2UA 3SB2A 3M5AA 3JB9I 4C92E 1BI3A 3S3OA 2EAYA 4M7DC 4FT4A 4C5EA 1YIJT 4JS5A 3FEOA 4PJOF 3CCRA 2FYKA 1UB4A 4C0ZA 2XDPA 1HK9A 5A0DA 3JCMQ 1W2BS 2LCCA 3ER0A 2WACA 2DZ9A 2QDYB 2DJZA 2JZ2A 2CZ0B 2E6NA 2EIFA 3LGFA 4C8QD 4JLGA 3OYGA 3CCSA 1K8AU 5LJ3j 4MDWA 1JBMA 2IVWA 2KDSA 2QQRA 3OYMA 3CMEA 1Y96A 2RJFA 3DKMA 2E65A 3MP1A 1M90U 2OTLA 2LQ8A 3E9GA 3MP6A 5J26A 5A0GA 3G4ST 1VQPA 1XNIA 3LX7A 2P0KA 1YITA 1VQ9T 4M7AG 1VIFA 2GF7A 2EFIA 1G3TA 2QXFA 3HRTA 3X25B 2FVUA 5GANh 2XIDA 4LDWA 4VUBA 3G6ET 4XTYA 5FU7B 1W2BA 3SD4A 5KE3A 3OYIA 5CK9A 2LQKA 4ATOA 2HD0A 2IG0A 3BFMA 3L2RA 1K73U 1I81A 4BB7A 1G3SA 1LOJA 2PVGB 4D6WA 2NLUA 2RM4A 1MGQA 3LW5E 3JCMX 1V29B 4MZTA 1DJ7B 1I4K1 2QEXT 3QKJA 3RIRA 5J3BA 2GFAA 2PUKB 4XTUA 4E7HA 4ZTJA 1M1FA 1G3YA 3QZ5B 4BDZA 4FSXA 5GANg 3I55A 1JJ2S 4XU0A 4Q5WA 2DTIA 3N5BB 3HSBA 2ZPGB 4OGCA 4BDYA 2DZCA 1VQKA 5KH6A 1UGSB 4HA8A 1M9SA 3BDLA 5C0MA 4L5GA 3GLXA 5CR2A 4N4IA 1Q7YC 4ZN3A 3VYGA 1YJNA 4M77G 2QI2A 2E41A 5D6XA 3T9NA 5DLOA 5LJ5g 2X4JA 5FU7C 2EJFA 2YLCA 3CCLA 3GP8A 1I8FA 2XI9A 3VU3C 4EMKB 3GNGA 4R56A 3OYKA 1K9MU 1KG1A 4JRIA 1M8VA 3CCRT 4M77F 4KBMB 3GF5A 1XTDA 1JJ2A 2LC4A 3H8ZA 3V7CA 5GAMh 4J7IA 2DAQA 2V8KA 4M75G 1BI2A 4QVZA 3C4SA 1QVPA 4JUVA 4OB1B 4M7AB 2KMTA 5HKCA 1O75A 2RD1A 1XQHA 3MEUA 3QUIA 5KE2A 5GANf 1I5LA 5GAOl 1WNLA 2K3YA 3OSSC 4M77E 1P92A 3MCAB 4M75F 4FIBA 1UEBA 4IUQA 3JAME 1EIFA 4A4EA 1VQPT 2GQVA 4ZTFA 2M9UA 4M7AD 2F5TX 1YITT 5AYFA 3M57A 5LJ5f 1Q82C 3KXTA 5GMKj 4J6XA 4IURA 5HK3A 4RKUE 3CCEA 2QQBA 4UC4A 1VQ5A 2OTJA 1QP2A 4M75E 4HT8A 5GAMg 3NTHA 4XU1A 1WPYA 1B34B 2XDDA 5FRMA 1M4ZA 4BI3A 4Y28E 2LNVA 5I21A 1KD1U 4EMKC 2KQWA 4XU2A 3OA6A 3WVEB 1KC8C 5GANe 4J8OA 2E70A 2LRQA 2EQUA 2LTOA 4OP0A 3OYAA 2EWNA 5LL6S 1VQLA 4M7AC 4KT0E 3QZ9B 2AHJB 5LJ5e 3MEVA 4N4GA 3PT9A 4M78G 4ELYC 2LX9A 1N9RA 1ZHIA 1S72T 2HNIA 5CIUA 4L59A 1Y07A 3PTAA 2OAUA 4M78F 4JRKA 2K4YA 3QO3A 1Y7XA 3VV0A 1WQWA 2KY9A 5FU6B 3CBPA 2P0QA 4A53A 2X4WA 3CCLT 2CYZB 3NTKA 4E7IA 2FB7A 4C92G 3A8GB 1YHQA 3X24B 4LDVA 2KK4A 3V7RA 2EJGA 1OZ3A 3M55A 3CCJA 4M78E 3V7SA 2QA4T 5FROA 1M5Q1 5EG2A 4LDXA 3M4YA 4J5YA 2VUBA 3M56A 3UDCA 1U1TA 3PMIA 3QIIA 3A8HB 1KQ1A 4ZGJB 3OY9A 3CCVT 1JRIA 1Q86C 4A4GA 2ZPHB 2H3JA 3FRNA 4CI0C 2Y4YA 4DOVA 3CEYA 2DKGA 3BY7A 4BY6B 4C8QB 4WF2A 1SSFA 3VJPA 4JJNK 4L6V5 2E5QA 5J39A 1VQ5T 2OTJT 4KUDK 2JNGA 3INZA 3RMQA 2O4XB 2F69A 1AHJB 1BIBA 1MHNA 1RL2A 1WJSA 2L8DA 2WSEE 4OVAA 2RB6A 5FU6C 3OYJA 1KQSA 4F7UB 2PU9B 2YRVA 5I2SA 4NOYA 4J6YA 5GAN7 3QG1A 2B8AA 1O9SA 2K57A 2ZPFB 3NTIA 2XHCA 4GY5A 4PKCC 3SWNB 4R55A 3CCMT 1YI2T 3GIBA 5CKHA 3SDZA 3HRUA 3E19A 1VQLT 2K3XA 3MP8A 3TU4K 1BKBA 4J7FA 3JCMc 4XQ3A 5DM7R 4ZGDB 3OYBA 4HCBA 2QQAA 2XD0A 2EJ9A 4DOWA 3RKWA 1VQ7A 3DLMA 3CC4T 3C95A 5FLXE 3MEAA 5A2QE 3CC7A 4HCCA 1YJ9T 3OS5A 4B9XA 3S3NA 3M53A 2DD4A 3J7AF 2CGHA 3CPWS 2VYTA 4BY6C 3P8DA 2DK3A 4C8QC 3JCMP 3S6WA 5LJ5h 1N8RU 4KULA 1D3BB 3PNWC 4E7JA 3M58A 2KSSA 1Q7YU 2LDMA 3GOXA 3CBOA 4C92D 2D0QB 2RH2A 3FC3A 1Y71A 2WSCE 5GAOp 5CKEA 2RK1A 3TEEA 5L8RE 3OBWA 4ZGEB 3CCJT 3A8MB 3L2ZA 4PJOB 3GPLA 2LT4A 4BE0A 2DPPB 4HT9A 4EMKA 3A8OB 3EFRA 4J83A 4RCBA 3SWNC 4HKEA 4IKFA 2VC8A 3V8LA 3CCQA 3CMAT 3CPWA 5DLQE 2DXTA 2VGMA 3DB3A 5GAN2 2K5FA 3RKXA 2RI3A 1K8AC 2VGNA 1N6AA 3LYIA 3CBMA 2BIVA 2DEQA 4MZMA 3CCUA 4PJOD 3FDRA 5CVIA 5GANd 1QVFA 4LDUA 2CZ6B 4X9DA 3OYFA 2P4TA 1BYMA 2HAXA 2PQWA 2D6FA 1OYXA 2M0OA 4BACA 2E1HA 5D6WA 4BUGA 2EQMA 2X4XA 1NJIC 3LGLA 3H6ZA 2RHYA 1Q82U 3OYNA 5GAOr 5LJ5d 3CC2A 1VUBA 4MMKA 5CQXA 5I2MA 3E9FA 3CCST 4LDYA 5GMKi 1WGSA 4IUPA 4C0GA 1K73C 5GAN4 4OGEA 3CMET 1B34A 3L42A 4KUIA 4PJOC 1FWZA 2WSFE 4XK8E 1YJWA 2DXUA 3OS2A 3HL8A 4QW2A 1KC8U 4QVCA 2OTLT 1X6OA 5GAN6 2BUDA 4MDXA 3R6OA 3ZFJA 5A0LA 5CCAA 1VQ7T 5D6YA 4BI4A 3CC7T 3FJPA 3OBYA 3OB9A 5LJ3h 1HXDA 4NS5A 3VUBA 1YCYA 5GMKe 3RKYA 4E7LA 3JB9H 4M7DF 3META 3OYEA 2C06A 3LWIA 4C0FA 2K5IA 4M7DA 3C12A 2XU8A 4RMOA 3DLLA 2VXEA 4OB2B 1LJOA 2XG8D 2EQJA 3HFOA 1PSEA 4TVRA 4PL6A 5GAMd 4DA4A 1G5VA 2QQSA 3J80E 1R8OB 2QQ9A 2MWPA 2RJDA 1VQ8A 3JB9J 5IAYA 3C94A 4PLLA 2DIGA 4M77B 3V8JA 4C5GA 4QVDA 1RI0A 3JCMV 1Q81U 4EMGA 2K2VA 4M7DE 3I55T 3JCMg 4FT2A 3CCQT 1YIJA 3JCMW 1VQKT 3BW1A 2JN0A 5LJ3g 3OYCA 1FX7A 5GANj 1G3WA 4M77D 2RJEA 3SFMA 1YJNT 2VV5A 2ZPIB 3OS0A 3PMTA 2JTMA 1YBYA 2KAFA 4M75B 1NZ9A 1Q86U 3JB9G 1N9SA 3OYYA 3BDUA 5GAN5 2E10A 3P8HA 2E64A 2RHZA 3VKIA 3JB9F 3M9QA 4C8QA 2QTXA 4M75D 4E47A 2PVDB 3QHSA 3CC2T 4FM4B 2V8JA 1KHCA 3QJ6A 5CKBA 2DXBA 2M16A 1WJQA 2CKKA 1KQSS 3JCMf 2O4XA 3FB9A 1KQ2A 1H3ZA 2RI5A 2FHDA 2LCLA 4PNOA 4M77C 3OS1A 3ZEHA 2CZ7B 5LJ3f 4C8QE 4F7UA 2E6ZA 2ZZDA 2O01E 3SWNA 5DY9A 3UT1A 4LD9K 2MMPA 2Y4XA 3OYLA 3TCJA 3CCET 3G71A 1VIEA 3F70A 4F7UE 4JLIA 3M4GA 1QW1A 4M75C 3RMSA 3MO8A 5GAOn 4NL3A 3QBYA 3OSVA 3QPHA 4JRPA 4C5HA 3MHXA 2DIQA 1U1SA 1M1KC 3OW2S 4M78B 5GAMj 3M54A 3JCMe 1VQMA 4BD3A 2Y90A 3HFNA 2ZCFB 3JSCA 4RG2A 2L5QA 4CRIA 2RHUA 3DB4A 1U8RA 5LJ3e 5GMKh 1D3BA 3CD6A 2KVQG 1VQOA 1UGQB 4EMHA 3OYDA 2RO0A 3S3MA 4M78D 3L2QA 1TH7A 4GLKA 3CXCS 1UGPB 4QQ6A 2G3RA 3OYHA 1X75C 2P0PA 1BI0A 3X28B 4C92B 4PJOA 1OI1A 5CQYA 1GXIE 3QYHB 5HK0A 4XTVA 2JUFA 4J6WA 3V8KA 3OW2A 2DVEA 4ME7A 4MZPA 4XU3A 2RA2A 5CO7A 3JB9D 1VQ4A 5C6SA 5GAN3 4ZN1A 1QVFS 3L2WA 4PJOE 1W4SA 5KCHA 2EYQA 1YHQT 1FXXA 4JDSA 4B9WA 2EKOA 3KUFA 4XTWA 4IUUA 4V2SA 1BI1A 3PIPA 4II1A 4QQGA 4M78C 3EAEA 4X34A 4FU6A 3ZBDA 3CXCA 1NJIU 2R57A 3KBGA 3MEWA 1VQNA 2R5AA 4RCCA 4JRQA 4E7KA 3O8VA 2YLBA 2PUOB 2JTFA 1N27A 2CS7A 4OMFB 1VQ6A 2K5LA 2A7YA 4M7AF 4OF1A 1Y96B 3X26B 5IT9E 4M7AA 5GAN8 2R58A 1M90C 4EDUA 2LVMA 3HPWA 4C92C 5CKDA 2HQEA 3PFSA 5GAOm 3RUXA 1QVGS 4A54A 3G71T 4M7AE 2PVOB 4BE1A 4A4KA 4N0AC 1NPRA 3VUZA 5M9OA 3VYHB 4BI8B 2RI2A 3A8LB 2XDBA 1LNXA 2I2LA 2XICA 1VQMT 1S72A 3Q1JA 2RK2A 1N8RC 2VXFA 2RHIA 3I56A 2YHTA 5KCOA 3E1SA 2L3RA 2RJCA 3CD6T 2HBPA 2RHXA 3FLGA 1VQOT 1QVGA 4NL2A 4C0DB 4PLIA 3LH0A 1NE8A 3JCMh 2V8IA 4M7DG 4MMLA 4YTLA 3OQ5A 1M1GA 3QSUA 3UPUA 4M77A 1XOVA 4X9CA 3EFSA 2GCXA 5IN1A 5HY6A 2QA4A 4Z02A 1IREB 1QP3A 2DTOA 3J81E 4BE2A 1VQ4T 2MWOA 3CPFA 2DXCA 3WXMB 3TREA 3CCVA 4IUVA 2LT1A 4IUTA 2R5MA 4M75A 1K9MC 4A4FA 2X4YA 1UGRB 2GFUA 2JVVA 3HP9A 3WVDB 4ELZC 1PSFA 2EQKA 4P5NA 4EPCA 2FL7A 4OB0B 1VQNT 2DTHA 3HKSA 3P8BB 3URGA 5GMKm 1VQ6T 3QXEB 3CCUT 4C0DC 2DD5A 2XKOC 3JCMd 3HHTB 4RG8A 1BIAA 3A5ZB 3RESA 3QDRB 4C8QG 3X20B 4XTZA 2M1HA 3PGGA 5LJ3d 5CAIA 5GAOq 3CCMA 1JB0E 1YI2A 3UWNA 5LJ5j 4OB3B 1KHIA 4C8QF 1WQ7A 3G4SA 3PIOA 1IZ6A 2X35A 1VQ9A 4F7UG 4DQ2A 5FRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6J A;  2QQA A;  1G3T A;  3HRT A;  2LX9 A;  2K5F A;  3GLX A;  3HRS A;  2H3J A;  1BI3 A;  2K5L A;  1FX7 A;  5CVI A;  2QQB A;  1G3W A;  1BI0 A;  2K4Y A;  1BYM A;  3E19 A;  1G3S A;  1QW1 A;  2GCX A;  2K5I A;  1BI2 A;  3MHX A;  1QVP A;  1G3Y A;  2QQ9 A;  1BI1 A;  3HRU A;  1P92 A;  4O5V A;  1FWZ A;  1U8R A; 
#chains in the Genus database with same CATH topology
 3CC4 A;  1VYU A;  3G6E A;  1YJ9 A;  4XTX A;  1Q81 R;  1M1K U;  4E2F B;  2F1L A;  3LLR A;  5GAM f;  2DO3 A;  1SHG A;  2IPO B;  3H0H A;  2KT8 A;  2HBW A;  2MAM A;  1ZSG A;  1ZQ1 A;  4JJB A;  4FL6 A;  1M30 A;  4A4H A;  4K11 A;  2F5K A;  1PRL C;  4FYW B;  3FIF A;  2CZ1 B;  3RER A;  4ANJ A;  3AHU A;  1OX8 A;  2EYX A;  4LUD A;  1UTI A;  3EG1 A;  4PJO G;  1VQ8 T;  3G7Z A;  2LX7 A;  4C92 E;  2EAY A;  2C0I A;  1QCO A;  3CCR A;  1VQO Q;  1HK9 A;  1HD3 A;  2CP7 A;  1K8A U;  1WHM A;  3CCS A;  2KDS A;  1Y96 A;  3C0C A;  4PFZ A;  3ZL7 C;  3G4S T;  2QXF A;  4LUE A;  3G6E T;  2FPF A;  4XTY A;  2IG0 A;  2KR3 A;  1SRM A;  1LOJ A;  4D6W A;  1GBQ A;  1I4K 1;  4AFU C;  4E7H A;  4E6R A;  2LJ0 A;  4BDZ A;  3QZ5 B;  2LQW A;  5KH6 A;  4HA8 A;  4KH0 B;  2VAS A;  5C0M A;  4L5G A;  3GLX A;  4N4I A;  4ZN3 A;  2HKN A;  3RBB B;  5D6X A;  3VU3 C;  4PFP A;  3OYK A;  4JRI A;  2HZY A;  3CCR T;  4M77 F;  2JS2 A;  1XTD A;  1UGV A;  2KRN A;  1JJ2 A;  1M2V B;  5GAM h;  1PHT A;  4M7A B;  5HKC A;  1X2K A;  2KMT A;  2RD1 A;  2QA4 Q;  1WNL A;  2RNA A;  1P92 A;  3VS5 A;  1UEB A;  5KYW A;  3JAM E;  1IB8 A;  1MNE A;  4ZTF A;  1GL5 A;  4M7A D;  1OV3 A;  5AYF A;  2QGG A;  3KXT A;  1FYN A;  1KC8 R;  1K0S A;  1Q95 G;  1VQ5 A;  1QP2 A;  5FRM A;  4BI3 A;  2LNV A;  4FSS A;  4EMK C;  3WVE B;  4J8O A;  2LRQ A;  1W1F A;  4DBF A;  3OYA A;  5LL6 S;  2ESW A;  3QZ9 B;  1OPL A;  3MEV A;  3H0F A;  4N4G A;  3G4S Q;  2JW4 A;  2OX7 A;  1ZHI A;  3CC4 Q;  5KYU B;  4M78 F;  2CP2 A;  1YJ9 Q;  3VV0 A;  1WQW A;  2A36 A;  5FU6 B;  4A53 A;  2P0Q A;  2X4W A;  1ABO A;  3VRZ A;  3X24 B;  2QGF B;  4LDV A;  2BZY A;  2KK4 A;  3CCJ A;  3V7S A;  5IH2 A;  5EG2 A;  1HJD A;  2O88 A;  1JQQ A;  3UDC A;  1T0J A;  1YCS B;  3EG3 A;  2E3H A;  3PMI A;  3QII A;  2FG0 A;  1KQ1 A;  3OY9 A;  3CCV T;  1Q86 C;  1R0B G;  4DOV A;  3CEY A;  4CC7 A;  4AMC A;  4C8Q B;  2DER A;  2IIM A;  4KGV B;  1VQ5 T;  2JNG A;  2L8D A;  1AHJ B;  1BIB A;  1D1A A;  1MHN A;  3HSB A;  1KQS A;  1RAB B;  4F7U B;  4NOY A;  2NYS A;  2B8A A;  2KXC A;  1O9S A;  2K57 A;  2ZPF B;  3NTI A;  4GY5 A;  2HKQ B;  1YI2 T;  3CCS Q;  1RUW A;  1NYG A;  1BCM A;  4XQ3 A;  4ZGD B;  3EG0 A;  2LCS A;  3C95 A;  1WXU A;  2RF0 A;  3J7A F;  1OU9 A;  3CPW S;  2VYT A;  1VYT A;  3S6W A;  1G83 A;  4E7J A;  1KIK A;  1WYX A;  1Q7Y U;  3OBW A;  4AG2 C;  1K8A R;  4ZGE B;  3CCJ T;  3L2Z A;  3EFR A;  3SWN C;  1LVK A;  3CCQ A;  1ZSZ B;  3DB3 A;  2K5F A;  3RKX A;  3UAT A;  2DIL A;  1LPL A;  4MZM A;  2NUT B;  1QVF A;  2CZ6 B;  1BYM A;  2HAX A;  4BAC A;  2E1H A;  2DVJ A;  1NJI C;  3LGL A;  3H6Z A;  3OYN A;  4KRT A;  2K3B A;  5GMK i;  4IUP A;  2NUP A;  4OGE A;  4KUI A;  4PJO C;  3HL8 A;  4QVC A;  2KBT A;  4CC2 A;  1T3L A;  5GAN 6;  2BUD A;  1U5S A;  1WLP B;  2EPD A;  4BI4 A;  2HCK A;  1HYO A;  5LJ3 h;  1SPK A;  4FYY B;  4PK4 A;  1I5O B;  1VQ5 Q;  2K5I A;  2F2X A;  2VXE A;  1LJO A;  2EQJ A;  2LJ3 A;  1ZA1 B;  4PL6 A;  2QQ9 A;  3JB9 J;  3C94 A;  4PLL A;  4QVD A;  5ECA A;  4M7D E;  3JCM V;  1E7O A;  2K2V A;  4EMG A;  3I55 T;  3CCQ T;  4Z89 A;  3OYC A;  2VVK A;  2OJ2 A;  1AWW A;  2KYB A;  2JTM A;  1NZ9 A;  2DYB A;  3P8H A;  2E64 A;  2D8J A;  3QJ6 A;  3CCJ Q;  2O4X A;  3EGD B;  2D0N A;  3R6N A;  4C8Q E;  1UDL A;  4F17 A;  1FMK A;  2JM8 A;  2MMP A;  2Y4X A;  3M0Q A;  2DX1 A;  2FPD A;  4A63 B;  1IGQ A;  4F7U E;  4JLI A;  3MO8 A;  1ARK A;  4RTX A;  1KFZ A;  3G71 Q;  1KSW A;  1PRM C;  2GGR A;  5GAM j;  1VQM A;  3HFN A;  3I35 A;  1S1N A;  4CRI A;  2BZ8 A;  2EGA A;  5LJ3 e;  1IO6 A;  1UGQ B;  1TH7 A;  3CXC S;  4QQ6 A;  3OYH A;  2M02 A;  5CQY A;  3VRY A;  5HK0 A;  2ZAE A;  2FZK B;  2DJQ A;  3JB9 D;  1W70 A;  1VQ4 Q;  4JDS A;  1BI1 A;  2K2M A;  2MOX A;  2QDL A;  4QQG A;  1M3B A;  3EAE A;  2R57 A;  1UEC A;  2JTE A;  3KBG A;  3VS6 A;  1M90 R;  1VQN A;  2R5A A;  4E7K A;  2DA9 A;  1OEB A;  2JTF A;  1N27 A;  2CS7 A;  1RLP C;  4OMF B;  1VQ6 A;  4M7A F;  2GBQ A;  3X26 B;  3CCQ Q;  3HPW A;  3GBQ A;  2QTV A;  4D8D A;  6AT1 B;  1NLO C;  1NPR A;  3A8L B;  1LNX A;  1OQK A;  1VQM T;  1S72 A;  3Q1J A;  1OX9 A;  4DBH A;  1K1Z A;  2RHI A;  3I56 A;  2DL8 A;  4C0D B;  2QYZ A;  4E7S A;  3QSU A;  2E3I A;  4M77 A;  2DBM A;  3EFS A;  3EG2 A;  1IRE B;  4BE2 A;  2DTO A;  5IXF A;  3J81 E;  2MWO A;  5D7U A;  1RAI B;  1JJ2 P;  2DYI A;  4IUT A;  1K9M C;  1UGR B;  2JVV A;  4P5N A;  1MV0 B;  2P4R A;  1VQN T;  2YUQ A;  2AZS A;  2DTH A;  3HKS A;  3P8B B;  3UA6 A;  1VQ6 T;  3CCU T;  3X20 B;  4XTZ A;  3PGG A;  5CAI A;  1JB0 E;  1KD1 R;  3D7S B;  4C8Q F;  1WQ7 A;  3PIO A;  2X35 A;  3QDF A;  5FRN A;  3OMG A;  4O6J A;  2HQX A;  1VQ9 Q;  2YUO A;  1UHC A;  4F7U F;  1YJW T;  1GCQ A;  2MK5 A;  3I56 T;  4M78 A;  2MF2 A;  2XK0 A;  3GNF B;  2A3L A;  1MMD A;  1H8K A;  1Q81 C;  4N4H A;  2D9T A;  5GMK l;  3H0I A;  1B07 A;  7AT1 B;  4C92 A;  3JCM b;  2E12 A;  3CMA A;  1Y57 A;  4RTV A;  1K4U S;  1NPP A;  1H64 1;  1UJ0 A;  3JRZ A;  1ZBX A;  4N0A A;  1VQM Q;  3L2U A;  3M5A A;  1TUC A;  4M7D C;  3S3O A;  1ZBJ A;  4FT4 A;  1YIJ T;  1UB4 A;  4C0Z A;  3I5S A;  2RQT A;  1WIE A;  3JCM Q;  2QDY B;  3OYG A;  2JZ2 A;  4JLG A;  5LJ3 j;  4MDW A;  3TVT A;  3HTR A;  2IVW A;  5KYX A;  3EFO B;  2LP5 A;  3AT1 B;  2E65 A;  3MP1 A;  2OTL A;  1KQS P;  2LQ8 A;  1NM7 A;  5A0G A;  2P0K A;  8AT1 B;  1VIF A;  4VUB A;  4CC3 A;  1W2B A;  3SD4 A;  5KE3 A;  2LQK A;  2HD0 A;  2M51 A;  3L2R A;  1K73 U;  1G3S A;  1AOJ A;  3RR6 A;  2X51 A;  1MGQ A;  1DJ7 B;  1RAC B;  5IHK A;  5J3B A;  2GFA A;  4ZTJ A;  1M1F A;  2ABL A;  5GAN g;  1RAD B;  2ZPG B;  4BDY A;  1UGS B;  3BDL A;  1YJN A;  4M77 G;  2CH4 A;  2E41 A;  5LJ5 g;  1S72 Q;  5FU7 C;  2YLC A;  3CCL A;  2DLP A;  3I56 Q;  1BBZ A;  1I8F A;  1KG1 A;  2DBK A;  4KBM B;  3GF5 A;  4FYX B;  1QVF P;  2LC4 A;  1BI2 A;  1QVP A;  5KE2 A;  1Q82 R;  2K3Y A;  3OSS C;  1MMG A;  4M77 E;  1EIF A;  4A4E A;  2EKH A;  4J6X A;  5HK3 A;  2DF6 A;  4OMM A;  3IQL A;  4HT8 A;  3NTH A;  2KQW A;  4XU2 A;  3OA6 A;  1KC8 C;  2EQU A;  3EGU A;  5FWC A;  2EWN A;  4KT0 E;  1WHG A;  3EGX B;  1NG2 A;  4M78 G;  1TWB A;  4J9G A;  1ABQ A;  5I11 A;  2HNI A;  5CIU A;  2C0T A;  4L59 A;  4JRK A;  2K4Y A;  3QO3 A;  2KY9 A;  2DNU A;  3CCL T;  2FB7 A;  5IXB A;  2GQI A;  4C92 G;  3BE3 A;  3M55 A;  2KNB B;  4M78 E;  2QA4 T;  1OPK A;  1M5Q 1;  4GBQ A;  4LDX A;  1CKA A;  2BZX A;  3M56 A;  4OML A;  1VA7 A;  2AK5 A;  3CMA Q;  4DEY A;  1E6H A;  4A4G A;  4CI0 C;  2Y4Y A;  2YDL A;  4BY6 B;  5J39 A;  1D09 B;  2F69 A;  1WJS A;  1ZA2 B;  2DL4 A;  5GAN 7;  3A98 A;  2YUP A;  4PKC C;  3GIB A;  2JXB A;  1M27 C;  5CKH A;  4PJN A;  2K3X A;  3NPF A;  4J7F A;  5EC7 A;  2OTL Q;  1VQ7 A;  3DLM A;  9ATC B;  3CC4 T;  1D0Y A;  4WTO B;  1YJ9 T;  3S3N A;  2RQV A;  3JCM P;  1N8R U;  4KUL A;  1MUZ A;  2KSS A;  3GOX A;  2H8H A;  2HL3 A;  1Y71 A;  5GAO p;  3RNJ A;  3GPL A;  2LT4 A;  2DPP B;  3EG9 B;  4HT9 A;  3M0R A;  1WHH A;  4J83 A;  4IKF A;  2VC8 A;  2A37 A;  2DXT A;  5GAN 2;  1K8A C;  1N6A A;  3LYI A;  2KT1 A;  2BIV A;  2DEQ A;  3CBM A;  3ULR B;  3OYF A;  2DL5 A;  1PD0 A;  5KYY B;  2D6F A;  1MMN A;  1V1C A;  3SHW A;  1OYX A;  2M0O A;  1JU5 C;  1YJN Q;  1AD5 A;  1K73 R;  1GFD A;  2X4X A;  3CCL Q;  2RHY A;  1CKB A;  5GAO r;  1WHL A;  5CQX A;  5I2M A;  3E9F A;  3CCS T;  4LDY A;  2DXU A;  3OS2 A;  2HDA A;  3ZFJ A;  3NMZ C;  3EHR A;  1VQ7 T;  2LJ1 A;  4FYV B;  3FJP A;  1F1B B;  4HVW A;  5GMK e;  4E7L A;  3LH5 A;  4GLM A;  2C06 A;  3LWI A;  4C0F A;  4M7D A;  3DLL A;  4RMO A;  2PZ1 A;  4TVR A;  5GAM d;  5KYU A;  3VS1 A;  3J80 E;  1WA7 A;  1WFW A;  2RJD A;  2W0Z A;  3V8J A;  2DIG A;  2K6D A;  1RI0 A;  2V26 A;  3JCM g;  4IIM A;  4OMP A;  3BW1 A;  2JN0 A;  3VS3 A;  1K76 A;  2JMC A;  2RJE A;  2VV5 A;  2ZPI B;  2AZV A;  5KYW B;  4M75 B;  1WI7 A;  1Q86 U;  3BDU A;  2DL3 A;  5GAN 5;  2CP5 A;  4C8Q A;  4M75 D;  2PVD B;  1GRI A;  4KH1 B;  2M16 A;  2CKK A;  3FB9 A;  1KQ2 A;  2RI5 A;  2LCL A;  4M77 C;  4F7U A;  5LJ3 f;  2ZZD A;  1M1K R;  3TCJ A;  3G71 A;  4NL3 A;  1UHF A;  3EH2 A;  3OSV A;  4JRP A;  1QKX A;  1U1S A;  3OW2 S;  2FRW A;  1OUL A;  3M54 A;  2Y90 A;  2ZCF B;  2RHU A;  1SKU B;  1RAE B;  3CD6 A;  3S3M A;  3OYD A;  2RO0 A;  1QCF A;  2CH4 W;  4GLK A;  1UGP B;  2JT4 A;  2G3R A;  2P0P A;  3X28 B;  8ATC B;  3NGP A;  1OI1 A;  2RN8 A;  1VQ7 Q;  2JUF A;  4ME7 A;  3I9Q A;  4XU3 A;  2BE7 D;  5CO7 A;  1VQ4 A;  5C6S A;  5GAN 3;  1W4S A;  2K9G A;  1NYF A;  2NUT A;  2O9S A;  1GCQ C;  4XTW A;  4IUU A;  4II1 A;  4M78 C;  2KYM A;  4FU6 A;  1NJI U;  4JJC A;  3FJ5 A;  2PUO B;  2COZ A;  4OF1 A;  5IT9 E;  5GAN 8;  1M90 C;  1W2B P;  4C92 C;  2HQE A;  3RUX A;  4A54 A;  2CT3 A;  3G71 T;  1JXO A;  4M7A E;  1N8R R;  5M9O A;  4N0A C;  2XDB A;  2I2L A;  2MIO A;  2OI3 A;  2YHT A;  3E1S A;  2RJC A;  3CD6 T;  1D1B A;  2HBP A;  3FLG A;  3CPW P;  1QVG A;  4PLI A;  3LH0 A;  1NE8 A;  2V8I A;  4M7D G;  2AIR B;  3O5Z A;  3OQ5 A;  4RTW A;  4YTL A;  3UPU A;  1AWJ A;  2D1X A;  5HY6 A;  1RAH B;  4Z02 A;  1VQ4 T;  2EYZ A;  2QAZ A;  2LT1 A;  2GFU A;  2L3P A;  3HP9 A;  4ELZ C;  4EPC A;  2DMO A;  2FL7 A;  1D0X A;  3EHQ A;  2DD5 A;  2YRC A;  4B6M A;  1BIA A;  3QDR B;  4C8Q G;  1X27 A;  3EGD A;  5LJ3 d;  3CCM A;  2CDT A;  4OB3 B;  1RAF B;  1B3Q A;  1D0Z A;  1VQ9 A;  4F7U G;  3QWX X;  4DQ2 A;  3REB B;  2J6O A;  1KD1 C;  3QYG B;  3HRS A;  2MI6 A;  4CC4 B;  4Y91 A;  3JCM J;  4LN2 A;  3ME9 A;  2ZPE B;  3L2V A;  4DEX A;  2QEX A;  5CKF A;  4LD6 A;  1OZ2 A;  1FMV A;  3OMC A;  3NFC A;  2BKD N;  2RQU A;  2EVR A;  1D1C A;  1WJR A;  3ASK A;  2JOY A;  1WHK A;  2ZPB B;  3JB9 I;  1ZUU A;  4C5E A;  3FEO A;  3CD6 Q;  2FYK A;  5A0D A;  2LCC A;  4JPB W;  2WAC A;  4IIO A;  2E6N A;  1JBM A;  5IHI A;  3OYM A;  3CME A;  2MCN A;  2PNI A;  3PE0 A;  1AVZ C;  1VQ9 T;  1X43 A;  2GF7 A;  2EFI A;  1G3T A;  5GAN h;  2FVU A;  4LDW A;  1N5Z A;  4BB7 A;  2PVG B;  2NLU A;  3LW5 E;  1V29 B;  2QEX T;  3QKJ A;  3RIR A;  2PUK B;  4XTU A;  1SG5 A;  2RPN A;  1XJW B;  1MV3 A;  1Q7Y R;  1JJ2 S;  1W6X A;  4Q5W A;  2DTI A;  3N5B B;  4OGC A;  1VQK A;  1PNJ A;  2A0F B;  5CR2 A;  3CXC P;  1WXB A;  3VYG A;  1U06 A;  2FO0 A;  3T9N A;  1UE9 A;  2X4J A;  2G6F X;  2AT1 B;  1NEG A;  2XI9 A;  4EMK B;  3GNG A;  1K9M U;  3KFV A;  2EW3 A;  3MPU B;  3H8Z A;  2FZG B;  4J7I A;  2KRO A;  2V8K A;  3C4S A;  4JUV A;  1PKS A;  3UA7 A;  3MEU A;  3QUI A;  2J6F A;  5GAO l;  3MCA B;  4M75 F;  1RLQ C;  4IUQ A;  2GQV A;  2M9U A;  3M0T A;  3M57 A;  2ED1 A;  1Q82 C;  2CUB A;  1VYV A;  2FZC B;  4IUR A;  3CCE A;  4RKU E;  4UC4 A;  2OTJ A;  1OOT A;  1WPY A;  1B34 B;  3PVQ A;  2XDD A;  1ACM B;  4Y28 E;  2LQN A;  1EX4 A;  5GAN e;  2E70 A;  2LTO A;  2L2P A;  2ROL A;  4M7A C;  3CCM Q;  2ENM A;  5LJ5 e;  1VQL Q;  4ELY C;  3PT9 A;  1S72 T;  2DRK A;  2OAU A;  5I22 A;  2K7A A;  1RI9 A;  2BE9 B;  3CBP A;  4E7I A;  1YHQ A;  2EJG A;  1OZ3 A;  4RTT A;  4JZ3 A;  1T0H A;  2QEX Q;  2B86 A;  5FRO A;  2L3S A;  4J5Y A;  1JO8 A;  2VUB A;  1U1T A;  1EZZ B;  1JRI A;  1ZUY A;  2ZPH B;  2H3J A;  3FRN A;  2SRC A;  2DE0 X;  3EFO A;  1M8M A;  2MPX C;  3BY7 A;  3VJP A;  4JJN K;  1TXQ A;  1PCX A;  3H9N A;  2J06 A;  1TUG B;  2OTJ T;  3RMQ A;  1RL2 A;  4OVA A;  5FU6 C;  2WSE E;  2A08 A;  4AFQ C;  1MMA A;  2PU9 B;  1UUE A;  3SWN B;  3SDZ A;  3HRU A;  3TU4 K;  2D8H A;  3CME Q;  5DM7 R;  1Z9Z A;  4HCB A;  2QQA A;  2EJ9 A;  3RKW A;  2KRS A;  3CC7 A;  5FLX E;  5A2Q E;  4RTY A;  2EGC A;  1YP5 A;  3M53 A;  2CGH A;  3TSW A;  4C8Q C;  2KI7 A;  2GTO A;  1M3C A;  3RDV A;  1D3B B;  2GTJ A;  3M58 A;  2J05 A;  2LDM A;  3MKD A;  3CBO A;  4C92 D;  2D0Q B;  2RH2 A;  2YUN A;  3FC3 A;  5L8R E;  1T3S A;  4PJO B;  4ZNX A;  4RCB A;  4AG1 C;  3CMA T;  3CPW A;  5DLQ E;  2VGM A;  1PM3 A;  1C1A A;  2M0Y A;  2VGN A;  4PJO D;  3FDR A;  5CVI A;  4ESR A;  1QKW A;  1VQK Q;  4LDU A;  2P4T A;  2PQW A;  2DL7 A;  5D6W A;  4HVV A;  2VWF A;  2MYS A;  3CC2 A;  1VUB A;  4MMK A;  2HEQ A;  1WGS A;  1K73 C;  4C0G A;  2WSF E;  1YNZ A;  2OTL T;  4QW2 A;  1KC8 U;  1PC0 A;  2VB6 A;  1C0M A;  1ZSZ C;  4MDX A;  3R6O A;  4AFZ C;  5A0L A;  3CC7 T;  3OBY A;  3OB9 A;  1QVG P;  1YCY A;  3CCE Q;  3JB9 H;  3MET A;  5HCK A;  2OTJ Q;  1RAG B;  4QKU A;  2XU8 A;  4EIK A;  1I07 A;  4F16 A;  2QQS A;  1R8O B;  1X6G A;  1VQ8 A;  2CP6 A;  2Z0W A;  4C5G A;  2NUZ A;  5L23 A;  4FT2 A;  1WXT A;  3JCM W;  2J6K A;  3E2U A;  1ZLM A;  1X69 A;  5GAN j;  1G3W A;  2CSI A;  2DEU A;  3SFM A;  1YJN T;  1UG1 A;  3OS0 A;  3PMT A;  1YBY A;  2XMF A;  3VS0 A;  3JB9 F;  3M9Q A;  3CC2 T;  2QTX A;  4PJL A;  2YXY A;  4FM4 B;  1YHQ Q;  1JEG A;  5CKB A;  2EQI A;  3ZEH A;  2CZ7 B;  2E6Z A;  1AT1 B;  2HSE B;  1UJY A;  3OYL A;  3F70 A;  1X2Q A;  2JJ9 A;  3RMS A;  5GAO n;  1K0X A;  3QPH A;  4C5H A;  1QLY A;  3MHX A;  1WX6 A;  4OMQ A;  1M1K C;  3G1J A;  1MND A;  3JCM e;  1Z9Q A;  4BD3 A;  1ZUK A;  2L5Q A;  4PJM A;  1U8R A;  5GMK h;  3TQ7 P;  1KJW A;  4Y92 A;  4PFO A;  2V1Q A;  4HVU A;  1GXI E;  1BI0 A;  3EG9 A;  4XTV A;  3UF4 A;  3CC7 Q;  4LNP A;  4MZP A;  2RA2 A;  2FEI A;  3A1P A;  4ZN1 A;  1E6G A;  1AWO A;  4PJO E;  4KGX B;  4RTZ A;  2EKO A;  1I0C A;  2H3E B;  2EYY A;  5KYY A;  3PIP A;  2GNC A;  3CXC A;  4JJD A;  4X34 A;  3MEW A;  1PD1 A;  4JRQ A;  2YLB A;  1M2V A;  2A7Y A;  1Y96 B;  4M7A A;  2K79 A;  2R58 A;  4AT1 B;  4EDU A;  2LVM A;  5GAO m;  5CKD A;  1BU1 A;  2PVO B;  3M0P A;  2EBP A;  3VUZ A;  2RI2 A;  2JM9 A;  2CUD A;  3CC2 Q;  3CQT A;  1N8R C;  1YFN A;  1QMC A;  5KCO A;  2L3R A;  2NWM A;  4DBR A;  2BTT A;  4NL2 A;  2RMO A;  4MML A;  4PJJ A;  1AWX A;  1M1G A;  1XOV A;  1U3O A;  2GCX A;  5IN1 A;  3M0U A;  3SEM A;  1NLP C;  2COY A;  1HSQ A;  3WXM B;  3CCV A;  4M75 A;  2HQH A;  2O31 A;  3WVD B;  2EQK A;  4OB0 B;  1VQ8 Q;  1H3H A;  2CSQ A;  1B7T A;  3URG A;  3THK A;  5GMK m;  3QXE B;  2KXD A;  4C0D C;  2XKO C;  3A5Z B;  3RES A;  2M1H A;  1YI2 A;  3UWN A;  1KHI A;  3NHN A;  1TOV A;  2DET A;  3EH1 A;  2KE9 A;  3U23 A;  2ECZ A;  1G2B A;  4M7D B;  3L1A A;  2LZ6 B;  2C0O A;  2ZGW A;  3G6E Q;  3QJY A;  1NEB A;  2L89 A;  4HCZ A;  4M7D D;  1I1J A;  2COW A;  1X01 A;  4J9C A;  4HXJ A;  3JV3 A;  2FRY A;  2O2O A;  4FW2 A;  1IRX A;  4C5I A;  4JS4 A;  4C92 F;  3M59 A;  4QQD A;  2DM1 A;  4O5V A;  4XAX B;  1AZG B;  3LWH A;  5GAM e;  3SB2 A;  1BI3 A;  2EGE A;  2JMA A;  1V76 A;  3VS2 A;  4JS5 A;  4PJO F;  2XDP A;  1GFC A;  1W2B S;  2P84 A;  3ER0 A;  2DZ9 A;  2DJZ A;  3CCR Q;  2CZ0 B;  2EIF A;  3LGF A;  1ZSZ A;  4C8Q D;  5IHN A;  1YWO A;  2QQR A;  1TU0 B;  2RJF A;  3DKM A;  1AZE A;  1SHF A;  1M90 U;  4M4Z A;  2YWW A;  3MP6 A;  1TSF A;  3E9G A;  5J26 A;  1VQP A;  1XNI A;  3LX7 A;  4E7Z A;  1YIT A;  4M7A G;  3HRT A;  3X25 B;  2XID A;  5FU7 B;  3OYI A;  5CK9 A;  4ATO A;  3BFM A;  1IHV A;  1QQJ A;  1PG5 B;  1I81 A;  1IXD A;  5GJW B;  2RM4 A;  4RTU A;  3JCM X;  4MZT A;  1C6V X;  3OW2 P;  1R77 A;  1G3Y A;  4FSX A;  3I55 A;  4XU0 A;  1PWT A;  2DZC A;  1M9S A;  1H92 A;  1Q7Y C;  2QI2 A;  5DLO A;  2EJF A;  3GP8 A;  4R56 A;  1M8V A;  3V7C A;  2DAQ A;  2L0A A;  5FW9 A;  4M75 G;  5KYN A;  4QVZ A;  4OB1 B;  2DFU A;  1O75 A;  1I5L A;  1XQH A;  5GAN f;  1BB9 A;  1SSH A;  2L3Q A;  1M2O A;  2OAW A;  4FIB A;  1VQP T;  2F5T X;  1YIT T;  1IGU A;  3CCV Q;  5LJ5 f;  5GMK j;  2QQB A;  1M3A A;  2NUP B;  4M75 E;  5GAM g;  4XU1 A;  4QT7 A;  1M4Z A;  1K9A A;  1WZO A;  1KD1 U;  5I21 A;  3I5R A;  2RQW A;  2SEM A;  4OP0 A;  2KEA A;  1VQL A;  1R0C B;  1YI2 Q;  2CP3 A;  2EYW A;  2AHJ B;  5GJV B;  2LX9 A;  4DBQ A;  1N9R A;  1Y07 A;  3PTA A;  1Y7X A;  4J9E A;  2CYZ B;  3NTK A;  3A8G B;  2KGT A;  3V7R A;  1Q86 R;  2ATC B;  2ROT A;  3M4Y A;  2YSQ A;  4ZGJ B;  3A8H B;  1SRL A;  2DKG A;  2E4H A;  4WF2 A;  1SSF A;  4L6V 5;  2E5Q A;  4KUD K;  3INZ A;  2O4X B;  2RB6 A;  3OYJ A;  2YRV A;  5I2S A;  4J6Y A;  2QAS A;  3QG1 A;  4R55 A;  2XHC A;  3CCM T;  2YT6 A;  1TTH B;  4RUG A;  3MJX A;  2DRM A;  3E19 A;  1VQL T;  3MP8 A;  1BKB A;  3JCM c;  3OYB A;  2XD0 A;  4DOW A;  1VQP Q;  3MEA A;  1YIT Q;  4HCC A;  3OS5 A;  4B9X A;  2DD4 A;  4J9B A;  4Z88 A;  4BY6 C;  3P8D A;  2DK3 A;  5LJ5 h;  3PNW C;  2WSC E;  5CKE A;  2RK1 A;  3TEE A;  4HCK A;  4X1V A;  3A8M B;  2CP0 A;  4BE0 A;  4EMK A;  2QG9 B;  3A8O B;  4HKE A;  3V8L A;  2QK0 A;  1QCN A;  2RI3 A;  3I55 Q;  5AT1 B;  4F14 A;  1NJI R;  3CCU A;  1YWP A;  4JZ4 A;  5GAN d;  4X9D A;  4BUG A;  2KRM A;  2EQM A;  2F2V A;  1Q82 U;  5LJ5 d;  1QWF A;  1VOM A;  4AFS C;  5GAN 4;  3CME T;  1B34 A;  3L42 A;  1FWZ A;  1YJW A;  4XK8 E;  3TSZ A;  4D8K A;  1X6O A;  5CCA A;  4J9F A;  5FWB A;  1QWE A;  5D6Y A;  4LE9 A;  1OU8 A;  1HXD A;  4NS5 A;  3VUB A;  3RKY A;  4M7D F;  3OYE A;  3C12 A;  4OB2 B;  2XG8 D;  3HFO A;  4DA4 A;  1PSE A;  1G5V A;  2MWP A;  5IAY A;  4M77 B;  1Q81 U;  4WCI A;  1BCO A;  1YIJ A;  1VQK T;  5LJ3 g;  1FX7 A;  3H41 A;  4M77 D;  1Y0M A;  2VKN A;  4R0K A;  4Z8A A;  2KAF A;  2HL5 C;  2HSP A;  3PVL A;  3JB9 G;  1N9S A;  3OYY A;  1KK7 A;  2E10 A;  2RHZ A;  3VKI A;  2PTK A;  4E47 A;  3QHS A;  1PKT A;  2V8J A;  1KHC A;  2DXB A;  1WJQ A;  1KQS S;  3JCM f;  3QWY A;  1H3Z A;  2FHD A;  4PNO A;  3OS1 A;  1SEM A;  4LXC A;  1SF9 A;  1A0N B;  2O01 E;  3SWN A;  5DY9 A;  4OMN A;  3UT1 A;  2JS0 A;  1GCP A;  4LD9 K;  3CCE T;  1G8X A;  1VIE A;  3M4G A;  1QW1 A;  1WDX A;  4M75 C;  1JXM A;  3QBY A;  4KGZ B;  1FMW A;  2F2W A;  2DIQ A;  4M78 B;  2ED0 A;  3JSC A;  4RG2 A;  3DB4 A;  4FCY A;  3VS7 A;  4F04 B;  1D3B A;  2KVQ G;  1VQO A;  1TG0 A;  4EMH A;  4M78 D;  3L2Q A;  2J7I A;  2AKK A;  2LNH B;  1X75 C;  4C92 B;  4PJO A;  2W10 A;  3QYH B;  4J6W A;  3V8K A;  3OW2 A;  2DVE A;  2I0N A;  2V1R A;  2LMJ A;  1QVF S;  3L2W A;  3M0S A;  4FW1 A;  5KCH A;  2EYQ A;  1YHQ T;  1FXX A;  2CRE A;  4B9W A;  3KUF A;  4V2S A;  3ZBD A;  4RCC A;  3O8V A;  2E5K A;  2AKL A;  1TS9 A;  5KYX B;  2K5L A;  1VQN Q;  1X6B A;  4J9H A;  1VQ6 Q;  3CCU Q;  3PFS A;  4OMO A;  1QVG S;  1BK2 A;  2X3W D;  1CSK A;  4BE1 A;  4A4K A;  3VYH B;  4BI8 B;  4J9I A;  2XIC A;  2RK2 A;  2VXF A;  1UFF A;  2FPE A;  1J3T A;  2RHX A;  1VQO T;  2RQR A;  1YJW Q;  1YN8 A;  3JCM h;  2HMA A;  4X9C A;  3REA B;  2X3X D;  3EGX A;  2QA4 A;  1K9M R;  1QP3 A;  1ZX6 A;  3CPF A;  1NBE B;  2DXC A;  3TRE A;  4IUV A;  2R5M A;  2CT4 A;  4A4F A;  2X4Y A;  1TUD A;  1PSF A;  1GBR A;  1IHW A;  1EFN A;  1AEY A;  1RAA B;  2O9V A;  2X9H A;  1YIJ Q;  3JCM d;  3HHT B;  4RG8 A;  5GAO q;  2A28 A;  2YRD A;  5LJ5 j;  4J9D A;  3VS4 A;  1LCK A;  3G4S A;  1IZ6 A;  4ORZ A;  1WHJ A; 
#chains in the Genus database with same CATH homology
 3CC4 A;  3OMG A;  4O6J A;  3G6E A;  2HQX A;  4M7D B;  1KD1 C;  3L1A A;  1YJ9 A;  3QYG B;  3HRS A;  4XTX A;  4F7U F;  1YJW T;  1M1K U;  2MI6 A;  2ZGW A;  3LLR A;  3I56 T;  5GAM f;  3QJY A;  2L89 A;  4M78 A;  4Y91 A;  2MF2 A;  2XK0 A;  3JCM J;  2DO3 A;  3GNF B;  2A3L A;  3ME9 A;  4HCZ A;  4M7D D;  2ZPE B;  3L2V A;  1X01 A;  2MAM A;  2QEX A;  1Q81 C;  5CKF A;  1ZQ1 A;  4LD6 A;  4N4H A;  1OZ2 A;  4FL6 A;  4A4H A;  2D9T A;  2F5K A;  4C5I A;  5GMK l;  4JS4 A;  4C92 F;  3M59 A;  3FIF A;  3OMC A;  2CZ1 B;  3NFC A;  4C92 A;  2E12 A;  3JCM b;  3CMA A;  3AHU A;  3RER A;  4QQD A;  2BKD N;  4O5V A;  1NPP A;  4XAX B;  1H64 1;  3ASK A;  1WJR A;  3JRZ A;  4PJO G;  3LWH A;  1VQ8 T;  1ZBX A;  3G7Z A;  2JOY A;  2ZPB B;  4N0A A;  5GAM e;  3L2U A;  3SB2 A;  3M5A A;  3JB9 I;  4C92 E;  1BI3 A;  3S3O A;  2EAY A;  4M7D C;  4FT4 A;  4C5E A;  1YIJ T;  4JS5 A;  3FEO A;  4PJO F;  3CCR A;  2FYK A;  1UB4 A;  4C0Z A;  2XDP A;  1HK9 A;  5A0D A;  3JCM Q;  1W2B S;  2LCC A;  3ER0 A;  2WAC A;  2DZ9 A;  2QDY B;  2DJZ A;  2JZ2 A;  2CZ0 B;  2E6N A;  2EIF A;  3LGF A;  4C8Q D;  4JLG A;  3OYG A;  3CCS A;  1K8A U;  5LJ3 j;  4MDW A;  1JBM A;  2IVW A;  2KDS A;  2QQR A;  3OYM A;  3CME A;  1Y96 A;  2RJF A;  3DKM A;  2E65 A;  3MP1 A;  1M90 U;  2OTL A;  2LQ8 A;  3E9G A;  3MP6 A;  5J26 A;  5A0G A;  3G4S T;  1VQP A;  1XNI A;  3LX7 A;  2P0K A;  1YIT A;  1VQ9 T;  4M7A G;  1VIF A;  2GF7 A;  2EFI A;  1G3T A;  2QXF A;  3HRT A;  3X25 B;  2FVU A;  5GAN h;  2XID A;  4LDW A;  4VUB A;  3G6E T;  4XTY A;  5FU7 B;  1W2B A;  3SD4 A;  5KE3 A;  3OYI A;  5CK9 A;  2LQK A;  4ATO A;  2HD0 A;  2IG0 A;  3BFM A;  3L2R A;  1K73 U;  1I81 A;  4BB7 A;  1G3S A;  1LOJ A;  2PVG B;  4D6W A;  2NLU A;  2RM4 A;  1MGQ A;  3LW5 E;  3JCM X;  1V29 B;  4MZT A;  1DJ7 B;  1I4K 1;  2QEX T;  3QKJ A;  3RIR A;  5J3B A;  2GFA A;  2PUK B;  4XTU A;  4E7H A;  4ZTJ A;  1M1F A;  1G3Y A;  3QZ5 B;  4BDZ A;  4FSX A;  5GAN g;  3I55 A;  1JJ2 S;  4XU0 A;  4Q5W A;  2DTI A;  3N5B B;  3HSB A;  2ZPG B;  4OGC A;  4BDY A;  2DZC A;  1VQK A;  5KH6 A;  1UGS B;  4HA8 A;  1M9S A;  3BDL A;  5C0M A;  4L5G A;  3GLX A;  5CR2 A;  4N4I A;  1Q7Y C;  4ZN3 A;  3VYG A;  1YJN A;  4M77 G;  2QI2 A;  2E41 A;  5D6X A;  3T9N A;  5DLO A;  5LJ5 g;  2X4J A;  5FU7 C;  2EJF A;  2YLC A;  3CCL A;  3GP8 A;  1I8F A;  2XI9 A;  3VU3 C;  4EMK B;  3GNG A;  4R56 A;  3OYK A;  1K9M U;  1KG1 A;  4JRI A;  1M8V A;  3CCR T;  4M77 F;  4KBM B;  3GF5 A;  1XTD A;  1JJ2 A;  2LC4 A;  3H8Z A;  3V7C A;  5GAM h;  4J7I A;  2DAQ A;  2V8K A;  4M75 G;  1BI2 A;  4QVZ A;  3C4S A;  1QVP A;  4JUV A;  4OB1 B;  4M7A B;  2KMT A;  5HKC A;  1O75 A;  2RD1 A;  1XQH A;  3MEU A;  3QUI A;  5KE2 A;  5GAN f;  1I5L A;  5GAO l;  1WNL A;  2K3Y A;  3OSS C;  4M77 E;  1P92 A;  3MCA B;  4M75 F;  4FIB A;  1UEB A;  4IUQ A;  3JAM E;  1EIF A;  4A4E A;  1VQP T;  2GQV A;  4ZTF A;  2M9U A;  4M7A D;  2F5T X;  1YIT T;  5AYF A;  3M57 A;  5LJ5 f;  1Q82 C;  3KXT A;  5GMK j;  4J6X A;  4IUR A;  5HK3 A;  4RKU E;  3CCE A;  2QQB A;  4UC4 A;  1VQ5 A;  2OTJ A;  1QP2 A;  4M75 E;  4HT8 A;  5GAM g;  3NTH A;  4XU1 A;  1WPY A;  1B34 B;  2XDD A;  5FRM A;  1M4Z A;  4BI3 A;  4Y28 E;  2LNV A;  5I21 A;  1KD1 U;  4EMK C;  2KQW A;  4XU2 A;  3OA6 A;  3WVE B;  1KC8 C;  5GAN e;  4J8O A;  2E70 A;  2LRQ A;  2EQU A;  2LTO A;  4OP0 A;  3OYA A;  2EWN A;  5LL6 S;  1VQL A;  4M7A C;  4KT0 E;  3QZ9 B;  2AHJ B;  5LJ5 e;  3MEV A;  4N4G A;  3PT9 A;  4M78 G;  4ELY C;  2LX9 A;  1N9R A;  1ZHI A;  1S72 T;  2HNI A;  5CIU A;  4L59 A;  1Y07 A;  3PTA A;  2OAU A;  4M78 F;  4JRK A;  2K4Y A;  3QO3 A;  1Y7X A;  3VV0 A;  1WQW A;  2KY9 A;  5FU6 B;  3CBP A;  2P0Q A;  4A53 A;  2X4W A;  3CCL T;  2CYZ B;  3NTK A;  4E7I A;  2FB7 A;  4C92 G;  3A8G B;  1YHQ A;  3X24 B;  4LDV A;  2KK4 A;  3V7R A;  2EJG A;  1OZ3 A;  3M55 A;  3CCJ A;  4M78 E;  3V7S A;  2QA4 T;  5FRO A;  1M5Q 1;  5EG2 A;  4LDX A;  3M4Y A;  4J5Y A;  2VUB A;  3M56 A;  3UDC A;  1U1T A;  3PMI A;  3QII A;  3A8H B;  1KQ1 A;  4ZGJ B;  3OY9 A;  3CCV T;  1JRI A;  1Q86 C;  4A4G A;  2ZPH B;  2H3J A;  3FRN A;  4CI0 C;  2Y4Y A;  4DOV A;  3CEY A;  2DKG A;  3BY7 A;  4BY6 B;  4C8Q B;  4WF2 A;  1SSF A;  3VJP A;  4JJN K;  4L6V 5;  2E5Q A;  5J39 A;  1VQ5 T;  2OTJ T;  4KUD K;  2JNG A;  3INZ A;  3RMQ A;  2O4X B;  2F69 A;  1AHJ B;  1BIB A;  1MHN A;  1RL2 A;  1WJS A;  2L8D A;  2WSE E;  4OVA A;  2RB6 A;  5FU6 C;  3OYJ A;  1KQS A;  4F7U B;  2PU9 B;  2YRV A;  5I2S A;  4NOY A;  4J6Y A;  5GAN 7;  3QG1 A;  2B8A A;  1O9S A;  2K57 A;  2ZPF B;  3NTI A;  2XHC A;  4GY5 A;  4PKC C;  3SWN B;  4R55 A;  3CCM T;  1YI2 T;  3GIB A;  5CKH A;  3SDZ A;  3HRU A;  3E19 A;  1VQL T;  2K3X A;  3MP8 A;  3TU4 K;  1BKB A;  4J7F A;  3JCM c;  4XQ3 A;  5DM7 R;  4ZGD B;  3OYB A;  4HCB A;  2QQA A;  2XD0 A;  2EJ9 A;  4DOW A;  3RKW A;  1VQ7 A;  3DLM A;  3CC4 T;  3C95 A;  5FLX E;  3MEA A;  5A2Q E;  3CC7 A;  4HCC A;  1YJ9 T;  3OS5 A;  4B9X A;  3S3N A;  3M53 A;  2DD4 A;  3J7A F;  2CGH A;  3CPW S;  2VYT A;  4BY6 C;  3P8D A;  2DK3 A;  4C8Q C;  3JCM P;  3S6W A;  5LJ5 h;  1N8R U;  4KUL A;  1D3B B;  3PNW C;  4E7J A;  3M58 A;  2KSS A;  1Q7Y U;  2LDM A;  3GOX A;  3CBO A;  4C92 D;  2D0Q B;  2RH2 A;  3FC3 A;  1Y71 A;  2WSC E;  5GAO p;  5CKE A;  2RK1 A;  3TEE A;  5L8R E;  3OBW A;  4ZGE B;  3CCJ T;  3A8M B;  3L2Z A;  4PJO B;  3GPL A;  2LT4 A;  4BE0 A;  2DPP B;  4HT9 A;  4EMK A;  3A8O B;  3EFR A;  4J83 A;  4RCB A;  3SWN C;  4HKE A;  4IKF A;  2VC8 A;  3V8L A;  3CCQ A;  3CMA T;  3CPW A;  5DLQ E;  2DXT A;  2VGM A;  3DB3 A;  5GAN 2;  2K5F A;  3RKX A;  2RI3 A;  1K8A C;  2VGN A;  1N6A A;  3LYI A;  3CBM A;  2BIV A;  2DEQ A;  4MZM A;  3CCU A;  4PJO D;  3FDR A;  5CVI A;  5GAN d;  1QVF A;  4LDU A;  2CZ6 B;  4X9D A;  3OYF A;  2P4T A;  1BYM A;  2HAX A;  2PQW A;  2D6F A;  1OYX A;  2M0O A;  4BAC A;  2E1H A;  5D6W A;  4BUG A;  2EQM A;  2X4X A;  1NJI C;  3LGL A;  3H6Z A;  2RHY A;  1Q82 U;  3OYN A;  5GAO r;  5LJ5 d;  3CC2 A;  1VUB A;  4MMK A;  5CQX A;  5I2M A;  3E9F A;  3CCS T;  4LDY A;  5GMK i;  1WGS A;  4IUP A;  4C0G A;  1K73 C;  5GAN 4;  4OGE A;  3CME T;  1B34 A;  3L42 A;  4KUI A;  4PJO C;  1FWZ A;  2WSF E;  4XK8 E;  1YJW A;  2DXU A;  3OS2 A;  3HL8 A;  4QW2 A;  1KC8 U;  4QVC A;  2OTL T;  1X6O A;  5GAN 6;  2BUD A;  4MDX A;  3R6O A;  3ZFJ A;  5A0L A;  5CCA A;  1VQ7 T;  5D6Y A;  4BI4 A;  3CC7 T;  3FJP A;  3OBY A;  3OB9 A;  5LJ3 h;  1HXD A;  4NS5 A;  3VUB A;  1YCY A;  5GMK e;  3RKY A;  4E7L A;  3JB9 H;  4M7D F;  3MET A;  3OYE A;  2C06 A;  3LWI A;  4C0F A;  2K5I A;  4M7D A;  3C12 A;  2XU8 A;  4RMO A;  3DLL A;  2VXE A;  4OB2 B;  1LJO A;  2XG8 D;  2EQJ A;  3HFO A;  1PSE A;  4TVR A;  4PL6 A;  5GAM d;  4DA4 A;  1G5V A;  2QQS A;  3J80 E;  1R8O B;  2QQ9 A;  2MWP A;  2RJD A;  1VQ8 A;  3JB9 J;  5IAY A;  3C94 A;  4PLL A;  2DIG A;  4M77 B;  3V8J A;  4C5G A;  4QVD A;  1RI0 A;  3JCM V;  1Q81 U;  4EMG A;  2K2V A;  4M7D E;  3I55 T;  3JCM g;  4FT2 A;  3CCQ T;  1YIJ A;  3JCM W;  1VQK T;  3BW1 A;  2JN0 A;  5LJ3 g;  3OYC A;  1FX7 A;  5GAN j;  1G3W A;  4M77 D;  2RJE A;  3SFM A;  1YJN T;  2VV5 A;  2ZPI B;  3OS0 A;  3PMT A;  2JTM A;  1YBY A;  2KAF A;  4M75 B;  1NZ9 A;  1Q86 U;  3JB9 G;  1N9S A;  3OYY A;  3BDU A;  5GAN 5;  2E10 A;  3P8H A;  2E64 A;  2RHZ A;  3VKI A;  3JB9 F;  3M9Q A;  4C8Q A;  2QTX A;  4M75 D;  4E47 A;  2PVD B;  3QHS A;  3CC2 T;  4FM4 B;  2V8J A;  1KHC A;  3QJ6 A;  5CKB A;  2DXB A;  2M16 A;  1WJQ A;  2CKK A;  1KQS S;  3JCM f;  2O4X A;  3FB9 A;  1KQ2 A;  1H3Z A;  2RI5 A;  2FHD A;  2LCL A;  4PNO A;  4M77 C;  3OS1 A;  3ZEH A;  2CZ7 B;  5LJ3 f;  4C8Q E;  4F7U A;  2E6Z A;  2ZZD A;  2O01 E;  3SWN A;  5DY9 A;  3UT1 A;  4LD9 K;  2MMP A;  2Y4X A;  3OYL A;  3TCJ A;  3CCE T;  3G71 A;  1VIE A;  3F70 A;  4F7U E;  4JLI A;  3M4G A;  1QW1 A;  4M75 C;  3RMS A;  3MO8 A;  5GAO n;  4NL3 A;  3QBY A;  3OSV A;  3QPH A;  4JRP A;  4C5H A;  3MHX A;  2DIQ A;  1U1S A;  1M1K C;  3OW2 S;  4M78 B;  5GAM j;  3M54 A;  3JCM e;  1VQM A;  4BD3 A;  2Y90 A;  3HFN A;  2ZCF B;  3JSC A;  4RG2 A;  2L5Q A;  4CRI A;  2RHU A;  3DB4 A;  1U8R A;  5LJ3 e;  5GMK h;  1D3B A;  3CD6 A;  2KVQ G;  1VQO A;  1UGQ B;  4EMH A;  3OYD A;  2RO0 A;  3S3M A;  4M78 D;  3L2Q A;  1TH7 A;  4GLK A;  3CXC S;  1UGP B;  4QQ6 A;  2G3R A;  3OYH A;  1X75 C;  2P0P A;  1BI0 A;  3X28 B;  4C92 B;  4PJO A;  1OI1 A;  5CQY A;  1GXI E;  3QYH B;  5HK0 A;  4XTV A;  2JUF A;  4J6W A;  3V8K A;  3OW2 A;  2DVE A;  4ME7 A;  4MZP A;  4XU3 A;  2RA2 A;  5CO7 A;  3JB9 D;  1VQ4 A;  5C6S A;  5GAN 3;  4ZN1 A;  1QVF S;  3L2W A;  4PJO E;  1W4S A;  5KCH A;  2EYQ A;  1YHQ T;  1FXX A;  4JDS A;  4B9W A;  2EKO A;  3KUF A;  4XTW A;  4IUU A;  4V2S A;  1BI1 A;  3PIP A;  4II1 A;  4QQG A;  4M78 C;  3EAE A;  4X34 A;  4FU6 A;  3ZBD A;  3CXC A;  1NJI U;  2R57 A;  3KBG A;  3MEW A;  1VQN A;  2R5A A;  4RCC A;  4JRQ A;  4E7K A;  3O8V A;  2YLB A;  2PUO B;  2JTF A;  1N27 A;  2CS7 A;  4OMF B;  1VQ6 A;  2K5L A;  2A7Y A;  4M7A F;  4OF1 A;  1Y96 B;  3X26 B;  5IT9 E;  4M7A A;  5GAN 8;  2R58 A;  1M90 C;  4EDU A;  2LVM A;  3HPW A;  4C92 C;  5CKD A;  2HQE A;  3PFS A;  5GAO m;  3RUX A;  1QVG S;  4A54 A;  3G71 T;  4M7A E;  2PVO B;  4BE1 A;  4A4K A;  4N0A C;  1NPR A;  3VUZ A;  5M9O A;  3VYH B;  4BI8 B;  2RI2 A;  3A8L B;  2XDB A;  1LNX A;  2I2L A;  2XIC A;  1VQM T;  1S72 A;  3Q1J A;  2RK2 A;  1N8R C;  2VXF A;  2RHI A;  3I56 A;  2YHT A;  5KCO A;  3E1S A;  2L3R A;  2RJC A;  3CD6 T;  2HBP A;  2RHX A;  3FLG A;  1VQO T;  1QVG A;  4NL2 A;  4C0D B;  4PLI A;  3LH0 A;  1NE8 A;  3JCM h;  2V8I A;  4M7D G;  4MML A;  4YTL A;  3OQ5 A;  1M1G A;  3QSU A;  3UPU A;  4M77 A;  1XOV A;  4X9C A;  3EFS A;  2GCX A;  5IN1 A;  5HY6 A;  2QA4 A;  4Z02 A;  1IRE B;  1QP3 A;  2DTO A;  3J81 E;  4BE2 A;  1VQ4 T;  2MWO A;  3CPF A;  2DXC A;  3WXM B;  3TRE A;  3CCV A;  4IUV A;  2LT1 A;  4IUT A;  2R5M A;  4M75 A;  1K9M C;  4A4F A;  2X4Y A;  1UGR B;  2GFU A;  2JVV A;  3HP9 A;  3WVD B;  4ELZ C;  1PSF A;  2EQK A;  4P5N A;  4EPC A;  2FL7 A;  4OB0 B;  1VQN T;  2DTH A;  3HKS A;  3P8B B;  3URG A;  5GMK m;  1VQ6 T;  3QXE B;  3CCU T;  4C0D C;  2DD5 A;  2XKO C;  3JCM d;  3HHT B;  4RG8 A;  1BIA A;  3A5Z B;  3RES A;  3QDR B;  4C8Q G;  3X20 B;  4XTZ A;  2M1H A;  3PGG A;  5LJ3 d;  5CAI A;  5GAO q;  3CCM A;  1JB0 E;  1YI2 A;  3UWN A;  5LJ5 j;  4OB3 B;  1KHI A;  4C8Q F;  1WQ7 A;  3G4S A;  3PIO A;  1IZ6 A;  2X35 A;  1VQ9 A;  4F7U G;  4DQ2 A;  5FRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...