1QW1A

Solution structure of the c-terminal domain of dtxr residues 110-226
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
121
structure length
121
Chain Sequence
GSHMDEVERRLVKVLKDVSRSPFGNPIPGLDELGVGNSDAAAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphtheria toxin repressor
publication title Prolylpeptide binding by the prokaryotic SH3-like domain of the diphtheria toxin repressor: a regulatory switch.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 6
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2003-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qw1A00
2K4YA 2K5LA 3GLXA 1BI1A 2K5IA 1U8RA 3HRTA 1G3YA 1G3TA 1BI3A 4O6JA 2LX9A 1G3WA 1QW1A 1BI0A 3E19A 1P92A 1QVPA 2H3JA 4O5VA 3HRUA 1BI2A 1FX7A 1G3SA 1FWZA 2QQ9A 5CVIA 2K5FA 2QQAA 1BYMA 2GCXA 3MHXA 3HRSA 2QQBA
chains in the Genus database with same CATH superfamily
3I35A 4J8OA 5D6WA 2P0PA 4M75C 3VS2A 2E5QA 1FMVA 4KBMB 1Q86R 1VQKA 3NTKA 4C8QB 1FX7A 2E65A 3SHWA 1OX9A 1HXDA 2V26A 1D0YA 1J3TA 2DNUA 2EVRA 3TCJA 2QQSA 2JUFA 4C92F 1FYNA 2CT4A 3EFOA 3R6NA 1VQNT 3URGA 1T0JA 1PCXA 4OP0A 2LJ0A 3NFCA 3QWXX 2EWNA 3R6OA 3SWNB 4OMFB 4MZTA 1VQ5T 1EFNA 1JXOA 2CP0A 5D7UA 1VQ8Q 3A1PA 2DD4A 4FIBA 3EGDB 1KHCA 1LVKA 4M7DF 4OB3B 2VB6A 1Q7YU 4F14A 5HKCA 2DL8A 1E6HA 3MJXA 1PNJA 2QASA 2DYIA 5FROA 1PKSA 4IUPA 1QP2A 2IPOB 3CC4A 2F5KA 2QEXA 3VV0A 1Q86U 3G7ZA 1M9SA 4QKUA 4ZGEB 5GAOl 3FJ5A 4ZGDB 2K4YA 2AZSA 1WPYA 4ZN1A 1RAIB 1TOVA 1RAAB 1ZLMA 2RPNA 1K8AC 3NMZC 4IUUA 4RTWA 1BI0A 4XU0A 2NUTB 4FT2A 2LQKA 3TU4K 4NOYA 1VOMA 3OMGA 4EIKA 3QKJA 4LDVA 1YIJQ 2XD0A 3VUBA 2PTKA 3RKYA 1PSFA 1ZUKA 3EH2A 4OMMA 1ZX6A 2LJ1A 1KQSS 1XOVA 5KE2A 2YWWA 1VQ4Q 4PJJA 2OI3A 4MMLA 2D8JA 2M16A 1X01A 1I07A 1VUBA 3WXMB 3H9NA 4KUIA 4JJNK 2EAYA 4J6WA 1M8VA 1QLYA 3I55Q 3NTHA 1W4SA 3PGGA 1VQ8T 3JB9G 1LCKA 5HY6A 1ZBXA 2EJ9A 1R0CB 2KAFA 5FW9A 3BW1A 3VS1A 1RUWA 1K4US 4LN2A 2DIGA 3CMAT 2O2OA 2QYZA 2B86A 3UT1A 1VQ9T 1Q81C 1YWOA 2M0OA 2F2WA 3A8GB 4M75D 2KEAA 5LJ3f 2KMTA 4DBQA 3JCMb 1MGQA 1Y0MA 1Y07A 4A4GA 1UHCA 3G71T 1T0HA 3TQ7P 3CC7T 3QJ6A 1OQKA 3J81E 2K79A 1MUZA 3CCRQ 2WSEE 5I2MA 1X6GA 4K11A 2RQUA 3I56A 1D0ZA 2DRKA 3L2WA 5IN1A 1VQPA 4RMOA 2C0TA 2D0QB 1K9MC 4C0GA 2RJFA 1N8RC 1JJ2P 2OTJA 4J9DA 3CEYA 4DQ2A 3OYIA 4OB1B 2ZCFB 3JCMh 4PKCC 1LPLA 4PLIA 1MMAA 1AWXA 1WFWA 2DL7A 2F2VA 2D9TA 1AOJA 3CD6T 3HRSA 2DL5A 4BY6B 5CK9A 2GGRA 1N6AA 4BUGA 1PHTA 1KD1C 1I5LA 5GAMd 3V8LA 1NPRA 1UTIA 4HVVA 4C0FA 4C5HA 2AT1B 2LVMA 2RH2A 2MK5A 4WF2A 3QYHB 4C8QE 1XNIA 1G2BA 3MEAA 2JT4A 2L5QA 2DL4A 5IAYA 3QSUA 2BTTA 3CMEQ 4M7AC 1GBQA 2BE7D 4C5GA 4IKFA 2EJFA 3RKXA 2EQKA 4J83A 2EBPA 3JAME 2MOXA 1JEGA 2Z0WA 3D7SB 1IO6A 3OW2P 2E5KA 3QYGB 1JRIA 2HD0A 2EYZA 2RHZA 2M51A 5HK0A 2L3SA 1QVFP 1QP3A 4C8QF 3JCMP 1B34B 3MCAB 2F5TX 4PFOA 5DLQE 2COZA 4BE2A 4HCBA 1BB9A 5GANj 3A8MB 5HCKA 2EFIA 3A98A 5KYYB 4Y28E 2X3XD 1N5ZA 3QHSA 3CCLA 1YN8A 2WACA 1VQ6T 3P8HA 4XU2A 4ZNXA 1QWEA 1WX6A 4ORZA 1VQMA 2RHYA 1ZSZB 1PD1A 2A28A 2HKNA 4JLGA 3BY7A 3CCQQ 3G4ST 5GAN6 3FC3A 2HSEB 3QG1A 2X9HA 3CCVA 2FZKB 2QAZA 1H641 2HBWA 1VQOA 2E12A 2RM4A 1KD1R 2EIFA 2AZVA 3UF4A 3REAB 2HNIA 5J3BA 4PFZA 2DEUA 2GQVA 3CBMA 4EMKB 2OTJQ 5LJ5e 2PQWA 3OYGA 1M30A 4KGZB 3HRTA 1SSHA 3CBOA 1UJ0A 2HDAA 2P84A 2JMAA 2QA4T 1M3BA 2CKKA 2DIQA 9ATCB 1R8OB 2YRVA 4BDYA 4IIOA 2PVGB 3CCSA 3LGFA 4JZ3A 3CCMA 4P5NA 2MI6A 5LJ5h 2EQMA 1JJ2A 3MKDA 5KCOA 2C0IA 1QMCA 2XICA 1YHQT 4E7LA 2IVWA 5LJ3g 4AMCA 2X4XA 4AG2C 2R57A 2DJQA 3A8OB 2MWPA 1SHFA 3NGPA 5KYNA 2XDPA 2YRCA 2VASA 3I5RA 4M7DB 2J6OA 2HQEA 4M77A 4AG1C 4EPCA 5CO7A 3VS0A 4E6RA 1YCYA 2VGNA 2DA9A 2RF0A 1JU5C 2VXEA 1KD1U 1YFNA 2E41A 2BZYA 1IZ6A 1QW1A 2JMCA 4D6WA 2G6FX 4N4IA 2XG8D 4M7AD 4M75A 1G83A 4ATOA 2KRSA 1YJWT 2KSSA 2R5MA 5GAN3 3UPUA 2CGHA 3GBQA 4J9GA 1ZSGA 4WCIA 3NPFA 4Y92A 1W2BP 1VQ7A 4FYVB 2LCCA 1VIEA 4GLMA 3CCUA 1BCMA 2LQWA 3OW2A 1QKXA 1R0BG 4PLLA 1YJNQ 2DVEA 4M77B 3G1JA 4QT7A 2AK5A 2LDMA 4X1VA 5AYFA 5FWBA 2JS0A 3VYGA 1LJOA 2DMOA 4JJDA 2KT8A 2E3HA 2YUQA 1GBRA 1AWWA 1UUEA 1WI7A 1AZGB 5DLOA 5IHNA 5LL6S 2QG9B 1D1AA 3PMTA 3ZL7C 3QDRB 8ATCB 2W0ZA 4M75G 5D6XA 2E4HA 4AT1B 2DPPB 3OYBA 4QW2A 3CPWP 2VUBA 3GPLA 1BYMA 3H6ZA 5GAOn 2DBMA 2GF7A 3H41A 4F7UB 2X4JA 2NWMA 4PK4A 3O5ZA 3JCMf 4FU6A 4BI8B 1IB8A 3CCSQ 2P0KA 2EW3A 4BD3A 4C0ZA 4RTXA 1RACB 1AZEA 4ZGJB 4LXCA 2DBKA 3OS1A 4TVRA 3OQ5A 3SDZA 4FYYB 1GFCA 4A63B 1YITQ 1W70A 1IRXA 4ME7A 5IHIA 1VQ8A 2ROTA 3QZ9B 3THKA 2LC4A 4M78E 1VIFA 3V8KA 1S72T 3C12A 5A0GA 2HSPA 4PJOB 1B07A 3M53A 5CVIA 2VVKA 2K5FA 4Q5WA 4CI0C 4JRIA 1KC8R 2DAQA 1KHIA 4C5EA 3CCET 4FM4B 4XU3A 1VQNQ 1WHGA 2JJ9A 3EG1A 3EG9B 3F70A 4MZPA 3RBBB 2YUNA 1NZ9A 4PJNA 2LX9A 2D0NA 1QVPA 2HEQA 1VQ5Q 3HRUA 5GAMh 4NL2A 4WTOB 3QBYA 1WHLA 4LNPA 3JB9J 4B9WA 3Q1JA 2CDTA 1C0MA 2KRNA 3JCMW 5GAN4 2JNGA 4KH0B 3VRYA 4F04B 3EHQA 2EQJA 4J9CA 3HL8A 1G3YA 1CSKA 5GAOq 3M5AA 3C95A 1WJRA 1N9SA 4PJLA 1W2BA 1VQ4A 2RJEA 2D1XA 3M0QA 1PKTA 1QCFA 3S6WA 1OU8A 1YBYA 1IGUA 2FRYA 3I55A 3PVLA 2LCSA 2WSCE 2OTLT 1SG5A 1KC8U 2LQ8A 1YNZA 1ZUYA 4M7DE 4RTZA 2EGEA 4XTZA 2VC8A 2DTOA 1S1NA 3V7SA 5C6SA 1KSWA 2I2LA 2DETA 2RA2A 2VXFA 4RKUE 2K3YA 4FW1A 3MP1A 3CPWA 3UA6A 3CC2T 1RI0A 2KXDA 5LJ5d 4BE0A 2OAWA 2ECZA 4JJBA 3CCRA 2ABLA 3RMSA 4HA8A 2GTOA 5FWCA 4BDZA 3VKIA 4RG8A 2O01E 1YI2T 2CP7A 3CMAQ 2ZPFB 1EX4A 3SD4A 1VQ9Q 1ZBJA 4M7AA 2FYKA 3EFOB 1BI2A 1IHVA 5GAN2 1OZ3A 2M02A 2B8AA 5GMKm 2CP6A 2HL5C 2JN0A 4L5GA 1PRLC 4C92D 1VQ6A 1SSFA 3EAEA 3G71Q 4RTTA 1GCQC 3CBPA 2G3RA 4JS4A 2E6NA 7AT1B 3CC7Q 1M1KR 1OV3A 1G5VA 1BCOA 3JB9I 3G6ET 1UECA 2FZGB 2DTHA 4J7FA 1M3CA 1WHHA 2MPXC 5J39A 1ARKA 4EMGA 1QKWA 3INZA 1Y57A 4DBRA 4CC4B 1XTDA 4M77F 2GCXA 2HMAA 5KH6A 4M7AB 2ZPIB 1QVGP 1U06A 3BDUA 1YJ9T 4F7UE 4NL3A 3DB4A 3CMEA 3V7CA 4M7AG 4J9BA 1WHJA 4J6YA 1JJ2S 4OB0B 5GANg 1GRIA 1RAHB 3LWHA 1ZA2B 3CD6Q 1VYUA 2ZPBB 1TUGB 3JCMc 1Z9QA 3CPFA 3AT1B 1OEBA 2NUZA 4C0DC 2ESWA 2DXCA 2YUOA 1BIAA 1RI9A 4LUDA 4BB7A 4F7UF 5CQXA 4PJOE 1KK7A 1Y71A 4JLIA 4PFPA 3TVTA 4PL6A 1SEMA 1M1KU 2KT1A 1V29B 4AFQC 1K9AA 2FL7A 2QI2A 2FO0A 4QVDA 3M9QA 1VYVA 4MZMA 3CCQA 2GFUA 2V1QA 2O9SA 2LJ3A 2L3PA 3REBB 1D0XA 1WJSA 1VQLT 3OW2S 2J7IA 4BI4A 3OBYA 4YTLA 1ABQA 2A7YA 3P8BB 2DYBA 2XDDA 4PJOF 2RMOA 1UG1A 2GTJA 4JRPA 2Y4XA 2AKLA 1QVFS 4PNOA 1ACMB 2FZCB 3HFNA 2MWOA 4LDWA 2DD5A 2EYQA 1AT1B 4OMOA 1VQ6Q 1E7OA 1UGQB 3FJPA 1MMDA 4B9XA 3LLRA 1TUDA 4IUTA 2E1HA 2EGCA 1H92A 2ATCB 3QIIA 3G4SQ 3CCJT 5CKDA 5GANe 1F1BB 3META 2FPDA 5FLXE 4J5YA 2LCLA 5GMKe 5GAMf 1UGVA 1V1CA 3M57A 3VS6A 2H3JA 4AFZC 3HFOA 1LNXA 2QTXA 2QTVA 3M0TA 4R0KA 4DOVA 1VQKT 1RLQC 2LT1A 3VS3A 2PVDB 1X27A 1UGRB 2HL3A 3OYYA 2QA4Q 3OYJA 5GAOp 5GMKh 3A5ZB 2XKOC 1G3SA 1NYGA 3VS7A 4DA4A 1Q82C 3KXTA 3E1SA 1WNLA 1M4ZA 1FMWA 1QVGA 1IREB 2FHDA 1TS9A 5M9OA 4FL6A 1YHQQ 4FT4A 1HYOA 3VRZA 1HSQA 2ENMA 1OI1A 1X75C 5L23A 2FRWA 2E64A 2D8HA 2DO3A 3ZFJA 1YJNA 1S72A 1ZUUA 3S3NA 2L0AA 2EYYA 2RHIA 1XQHA 3LWIA 3OY9A 2HKQB 4QVCA 1K0XA 2QQBA 2SRCA 5IXBA 4J9EA 2JW4A 2E6ZA 2YXYA 4JRQA 2EPDA 3CCEA 1IXDA 3JCMJ 3CC4T 2HAXA 4RTYA 2QEXT 4N4HA 2MF2A 2GQIA 4C92A 1YJWQ 1M1FA 1N27A 3RKWA 4RG2A 1AHJB 3X20B 1TWBA 4C8QD 1NEBA 4JS5A 2KBTA 3T9NA 2BIVA 4KGXB 1W2BS 5IH2A 4HXJA 1KG1A 1R77A 1GFDA 4GLKA 2C0OA 2A0FB 2DXUA 2V8JA 4E7JA 3UWNA 2RD1A 2P4TA 2H3EB 4II1A 2RI3A 1FXXA 4QQ6A 2KDSA 1Q82R 5I22A 2JTEA 5GMKl 2KE9A 2DL3A 1YITA 1D1CA 5GJWB 4DBFA 2PUOB 3VJPA 1X2QA 1KQ2A 3SEMA 4M7AF 1SRMA 2CUBA 1ZQ1A 1FWZA 3IQLA 4C92G 1QQJA 3UATA 3FLGA 5KYUA 4OGEA 5EG2A 2GFAA 1AVZC 3CPWS 3EGUA 2X3WD 5AT1B 4RTUA 1BI1A 1K73C 2X4WA 2JOYA 2KXCA 3JB9F 1MV3A 3OS5A 2KRMA 5FU7C 2DRMA 1RADB 3QZ5B 3L2RA 4EMHA 1VQNA 5GAOm 2CT3A 2KVQG 2R58A 1WIEA 2VV5A 2K2MA 2ZPHB 5IXFA 4HT8A 1VQ5A 3MPUB 1WZOA 1M90R 2F2XA 4J7IA 5LJ5j 4LE9A 1K1ZA 5KYUB 2DILA 3DLLA 1S72Q 4ZN3A 1M2VA 4MMKA 3VUZA 2CP2A 3I56T 1KC8C 5I21A 2DFUA 3KFVA 1AEYA 3RERA 1QVFA 1VQPT 3PNWC 4X34A 1Q82U 2K7AA 1C6VX 1V76A 1NBEB 2CZ0B 3CCEQ 4EDUA 2DKGA 5CAIA 5CQYA 4M75B 4M78C 5KE3A 1Y7XA 4DEYA 2YLBA 5I11A 1SPKA 4J9FA 1MNDA 2JM9A 6AT1B 3WVEB 2NYSA 5LJ3e 2L3QA 4XAXB 1M2VB 4E7IA 1BK2A 2KR3A 4FYXB 2YSQA 1RLPC 4CC7A 1MV0B 4XU1A 4L59A 2ROLA 1U1SA 1KQ1A 1X43A 5KCHA 3QPHA 1WDXA 2KGTA 3GNFB 4LD6A 4XQ3A 4FYWB 3I9QA 1K73R 3BFMA 1M90U 1GCQA 5CIUA 4LD9K 3X26B 4OGCA 5LJ3h 2COYA 4QQDA 2ZZDA 4L6V5 2FG0A 3GOXA 2LX7A 2RK1A 2SEMA 5I2SA 4C92C 2OTLQ 3KUFA 1M1GA 4E7HA 4RTVA 3ASKA 3V7RA 3CQTA 1TU0B 2DEQA 5GAOr 4A54A 3CMAA 4OMPA 4C5IA 5GANd 1NJIR 1VQ9A 3VS5A 2I0NA 5CKBA 1X6BA 2RI2A 4XTWA 1CKAA 1X2KA 3CCLT 3G71A 2QGGA 1NPPA 1D1BA 1PD0A 1VQMT 3CC2Q 1UB4A 3CC7A 2KYMA 4M7DC 1X69A 3QWYA 1I81A 2YHTA 4BI3A 3MEVA 2QQAA 2RQTA 3BDLA 5KYWA 4E7KA 1Y96A 5HK3A 4R56A 4A4EA 3OYDA 3CCVT 2O9VA 1AWOA 1VQOT 2K5LA 4J9HA 1CKBA 2EKOA 2PUKB 1K73U 1YI2Q 1MHNA 3P8DA 5CCAA 1NLPC 2IG0A 1MMGA 3PIOA 3M0RA 2RN8A 4HVUA 3JRZA 2A36A 2ZAEA 3HPWA 2J05A 2BZ8A 4PJMA 4OMNA 2O88A 4C8QA 1M1KC 2CH4A 2EQIA 2KQWA 3ZEHA 2MAMA 1RAGB 2DX1A 2FEIA 2NLUA 2JTMA 2YLCA 4OMLA 3CD6A 2V8IA 2F1LA 3DKMA 4ESRA 2XI9A 3RUXA 4B6MA 3JCMX 2KY9A 1NJIU 3G6EQ 5CKEA 3H0FA 3CCMT 2X35A 2K57A 1TH7A 5GAMj 1EIFA 3C0CA 1N9RA 3SWNA 5A0DA 4M78D 4HVWA 1UFFA 1EZZB 4KH1B 2LP5A 2LZ6B 1B7TA 1QCOA 1K0SA 3ULRB 2Y4YA 1YJ9Q 1OPLA 2VYTA 1ABOA 4ELYC 2DK3A 1QVGS 3EGDA 3M59A 2YRDA 1WXTA 3M4YA 2BKDN 4M4ZA 2LRQA 4C8QG 2MMPA 1I4K1 2EJGA 4Z88A 5LJ5f 1RABB 3OS2A 1D3BA 4Z8AA 4HCKA 2VGMA 3E19A 1M3AA 5CR2A 3OYMA 4X9CA 1WHKA 4DOWA 4M77E 4D8DA 3M0UA 1K76A 3EHRA 4E7ZA 4FW2A 1AWJA 1VQ7T 3EGXA 3CCUT 1X6OA 2M9UA 3PTAA 2NUTA 2P0QA 4N4GA 3L2ZA 3PE0A 4IUVA 4ELZC 4FCYA 4F16A 3FEOA 4XK8E 3PVQA 4M75E 2F69A 3G4SA 1SHGA 4PJOC 1IHWA 2XMFA 2EQUA 2JTFA 3HSBA 3PFSA 3TSWA 1D3BB 3GNGA 1VQLQ 3QDFA 2EKHA 3OBWA 1BIBA 2DM1A 1RAEB 2EYXA 3JCMg 1UGPB 4F17A 1HJDA 3TSZA 2CH4W 5DM7R 4M7DD 1SF9A 3EGXB 1B3QA 3N5BB 3JSCA 1WLPB 3MEWA 2K2VA 4M75F 2QA4A 2EYWA 4V2SA 1WXUA 4IURA 3RR6A 2CZ6B 1SRLA 4GY5A 1U5SA 3M0SA 3CCJQ 4N0AA 1O75A 3FB9A 4GBQA 2QXFA 2DXBA 2KI7A 1G3TA 3A8LB 5DY9A 5GAN5 1M5Q1 2ED0A 2QK0A 3PT9A 5ECAA 3QJYA 3HP9A 1YHQA 2M1HA 4KGVB 2HQXA 1RAFB 4LUEA 3FDRA 4MDXA 5FU6C 4JDSA 4OB2B 3CXCS 4M77D 1VQKQ 2CZ7B 1TXQA 2P4RA 3M4GA 3NTIA 4CRIA 1JQQA 2PU9B 2A3LA 2LT4A 4C8QC 2ZPEB 5LJ3d 2E10A 1JB0E 4Z02A 3MP6A 3E9FA 3ER0A 3M58A 1NM7A 3S3MA 1E6GA 3PIPA 3GLXA 3TREA 1YJWA 1YCSB 3SWNC 1Z9ZA 4QVZA 3JCMe 4ZTJA 2JXBA 4JRKA 3DB3A 3QUIA 3H0IA 1K8AR 1I1JA 2YDLA 4IUQA 2PVOB 1YIJT 2OJ2A 1VYTA 2VKNA 2YT6A 1UDLA 2DERA 1KQSP 4ANJA 3OB9A 2XK0A 2MYSA 2GBQA 4LDYA 3CC4Q 3J80E 2QEXQ 4RCBA 1VQ4T 1HD3A 1TTHB 2CZ1B 2RQRA 3CXCP 4LDXA 5GAN7 4CC3A 2HZYA 3EG3A 3I55T 4VUBA 1BBZA 2MIOA 3VYHB 1PC0A 3GIBA 4PJOD 1U3OA 5D6YA 1U8RA 2K6DA 5GANh 5FU7B 2ED1A 1WQ7A 2IIMA 2HQHA 1B34A 2Y90A 5LJ5g 2JM8A 4O5VA 2O31A 2OX7A 1M8MA 2V1RA 2FB7A 4M78A 3LH0A 3FIFA 1T3LA 1WJQA 5KYYA 1TUCA 1WXBA 2LNHB 1Q81R 5J26A 5GJVB 1YWPA 1M27C 4BE1A 3BE3A 3HKSA 1K8AU 1KJWA 3M55A 1ZSZA 2DE0X 3CCRT 5IHKA 5CKHA 1SKUB 1QWFA 2CP5A 3O8VA 3OYEA 1NYFA 2DF6A 4A53A 5GMKi 2RO0A 1OPKA 2DLPA 4UC4A 2FPEA 3L1AA 4JZ4A 1OOTA 4M78B 2DXTA 3ZBDA 2PZ1A 2FVUA 4A4HA 3OSVA 4EMKA 5GMKj 1K9MR 4N0AC 2J06A 2V8KA 1M90C 1PWTA 1N8RR 2BE9B 4CC2A 4M78G 1D09B 3DLMA 4Y91A 2WSFE 3SB2A 3X25B 3OYCA 2L2PA 2AHJB 2XDBA 4RUGA 3E9GA 3X24B 1WQWA 2EGAA 3MO8A 4JJCA 2VWFA 3SFMA 3OYNA 1OX8A 4M7AE 2CP3A 3QXEB 1BI3A 2R5AA 2BUDA 3L42A 5A2QE 1XJWB 2MCNA 3I56Q 2LTOA 2XIDA 3LGLA 4BACA 1Q81U 1UJYA 4ZTFA 2K3BA 1VQPQ 4D8KA 2QQRA 3I5SA 3CMET 3LH5A 3M56A 1A0NB 4M7DA 3RMQA 2K5IA 2JVVA 3QO3A 1UHFA 3VU3C 1Q95G 1RL2A 2CYZB 4C92B 2CSQA 3LX7A 1DJ7B 4MDWA 2QDLA 5EC7A 1M2OA 1MMNA 2OTLA 3M0PA 4DBHA 1KQSA 1AD5A 4HCZA 4BY6C 1UEBA 3EFRA 4KULA 1QCNA 1UGSB 2CSIA 3EH1A 1K9MU 3OYFA 1NG2A 1N8RU 2QDYB 2E70A 3RESA 3X28B 5A0LA 1PRMC 2D6FA 4HT9A 3JB9H 5IT9E 3CXCA 3H8ZA 4E7SA 1PM3A 4XTXA 1BU1A 4QQGA 2FPFA 5FRMA 4HCCA 5FRNA 1UE9A 2LQNA 1W6XA 4JUVA 4FSSA 3EG2A 3CC2A 2CUDA 1HK9A 3KBGA 2RB6A 3CCQT 4M7DG 3LW5E 3V8JA 4XTYA 3H0HA 2LMJA 3EFSA 3JCMV 1G3WA 3ME9A 4IIMA 1NJIC 1OULA 3OSSC 1YI2A 3NHNA 3E2UA 1OYXA 4R55A 2QQ9A 3OS0A 1C1AA 2XHCA 3FRNA 1BKBA 4AFSC 1WA7A 2YUPA 3J7AF 5KYXA 5GAMg 2L89A 2OAUA 2OTJT 8AT1B 2QGFB 2RHUA 5C0MA 4J9IA 3WVDB 1IGQA 3LYIA 3JB9D 3CCLQ 4AFUC 4DEXA 2CS7A 4O6JA 2CREA 1JXMA 1VQMQ 4F7UA 2DZCA 2AKKA 3M54A 2RNAA 4M77G 4E47A 2J6FA 1NE8A 3G6EA 1ZSZC 2COWA 2GNCA 4XTVA 4XTUA 3CCVQ 1TSFA 4A4FA 3MP8A 1VQOQ 2ZGWA 2L3RA 2O4XA 1PSEA 1GCPA 2DVJA 4X9DA 2KYBA 2AIRB 3C94A 2DJZA 2H8HA 1LOJA 3JV3A 1JO8A 5KYXB 1WGSA 1YJ9A 3GF5A 1JBMA 2DTIA 1W1FA 2DZ9A 4HKEA 4OF1A 2X4YA 3OYKA 4PJOA 4EMKC 3C4SA 3JCMd 3OYAA 1Q7YC 4A4KA 3AHUA 2RJDA 2M0YA 2JS2A 3A8HB 2ZPGB 3PMIA 1WHMA 5L8RE 4F7UG 3MEUA 3CCMQ 2O4XB 2J6KA 3EG9A 3EG0A 1H3ZA 1I0CA 2RJCA 4KT0E 1Q86C 2KK4A 3RIRA 4Z89A 1NLOC 1FMKA 2C06A 2RHXA 3L2VA 4FSXA 4RCCA 5GANf 3UA7A 3VS4A 1GL5A 3GP8A 3U23A 1WYXA 1YJNT 3OA6A 2A08A 3HTRA 3UDCA 5GAMe 2K3XA 2E3IA 1TG0A 2NUPA 2HBPA 1ZA1B 2RQVA 4PJOG 4E2FB 1O9SA 3MHXA 1KFZA 5LJ3j 1U1TA 4OVAA 1OU9A 1VQLA 1NEGA 3RNJA 3HHTB 4OMQA 1KIKA 2L8DA 3OYLA 2JZ2A 2BZXA 1MNEA 1YP5A 4KUDK 3OMCA 1VQ7Q 3OYHA 1I5OB 4M78F 2KROA 5GAN8 2X51A 3CCUQ 1PG5B 3S3OA 3RDVA 1H8KA 1GXIE 2W10A 2XU8A 1YIJA 1H3HA 1T3SA 2NUPB 3TEEA 4LDUA 4M77C 3JCMQ 3CCJA 2RQWA 5KYWB 4C0DB 1VA7A 4C92E 1P92A 1Y96B 4NS5A 2RK2A 4J6XA 1ZHIA 2RI5A 3CCST 1Q7YR 1G8XA 2A37A 2KNBB 5CKFA 2K9GA 2HCKA 4JPBW 2PNIA 3L2UA 2LNVA 1I8FA 5FU6B 1OZ2A 3L2QA 4KRTA 1YITT
chains in the Genus database with same CATH topology
4J8OA 5D6WA 2P0PA 5LL6S 5DLOA 4M75C 2E5QA 4KBMB 2E6ZA 3M4GA 3NTIA 4JRQA 4CRIA 3PMTA 3CCEA 3QDRB 2PU9B 1VQKA 2A3LA 2LT4A 3NTKA 4C8QB 4C8QC 3JCMJ 3CC4T 2ZPEB 2HAXA 2QEXT 5LJ3d 2E10A 4M75G 5D6XA 1FX7A 2E65A 1JB0E 4Z02A 1HXDA 2DPPB 3OYBA 4N4HA 4QW2A 2VUBA 2MF2A 4C92A 3MP6A 3TCJA 2QQSA 1M1FA 1N27A 3E9FA 2JUFA 3RKWA 4C92F 3GPLA 3ER0A 1AHJB 3M58A 4RG2A 3X20B 3S3MA 4C8QD 3H6ZA 5GAOn 1BYMA 3PIPA 4JS5A 2GF7A 4F7UB 1VQNT 3GLXA 2X4JA 3TREA 3URGA 1YJWA 4OP0A 3NFCA 3T9NA 2EWNA 3R6OA 3SWNC 3SWNB 4QVZA 2BIVA 1W2BS 3JCMf 4OMFB 4FU6A 3JCMe 4ZTJA 4BI8B 4JRKA 3DB3A 3QUIA 1KG1A 2P0KA 4MZTA 1VQ5T 4GLKA 4BD3A 4C0ZA 2DXUA 2V8JA 4E7JA 4ZGJB 3UWNA 2RD1A 2P4TA 2PVOB 4IUQA 3OS1A 1YIJT 4TVRA 3OQ5A 3SDZA 4II1A 2DD4A 4FIBA 2RI3A 1FXXA 4QQ6A 1KHCA 2KDSA 4ME7A 4M7DF 4OB3B 5GMKl 3OB9A 1Q7YU 5HKCA 2XK0A 1VQ8A 3QZ9B 4LDYA 1YITA 2LC4A 4M78E 1VIFA 3V8KA 1S72T 2PUOB 3C12A 3VJPA 3J80E 5A0GA 1KQ2A 4RCBA 4PJOB 1VQ4T 4M7AF 3M53A 2CZ1B 5FROA 1ZQ1A 1FWZA 4IUPA 4LDXA 1QP2A 5CVIA 4C92G 5GAN7 2RHIA 3CC4A 3FLGA 2F5KA 2K5FA 4Q5WA 4OGEA 3VV0A 4CI0C 5EG2A 2QEXA 3G7ZA 1Q86U 2GFAA 4JRIA 3I55T 1M9SA 4VUBA 4ZGEB 3VYHB 5GAOl 2DAQA 1KHIA 4C5EA 3CPWS 4FM4B 4XU3A 4ZGDB 2K4YA 5D6YA 3CCET 3F70A 4PJOD 1BI1A 1K73C 1WPYA 2X4WA 2JOYA 4MZPA 4ZN1A 3JB9F 1U8RA 3OS5A 5GANh 5FU7C 5FU7B 1NZ9A 1K8AC 1WQ7A 4IUUA 3QZ5B 2LX9A 3L2RA 4EMHA 1B34A 2Y90A 1BI0A 1VQNA 4XU0A 5LJ5g 5GAOm 1QVPA 2KVQG 4O5VA 2R58A 3HRUA 5GAMh 4FT2A 2LQKA 3TU4K 4NL2A 4NOYA 2VV5A 2FB7A 3QBYA 3OMGA 4M78A 3JB9J 3LH0A 2ZPHB 3FIFA 3QKJA 4LDVA 4B9WA 3Q1JA 4HT8A 1VQ5A 1WJQA 2XD0A 3JCMW 5J26A 5GAN4 3VUBA 1YITT 2JNGA 3RKYA 1PSFA 2EQJA 4J7IA 5LJ5j 4BE1A 3HL8A 1G3YA 3HKSA 1K8AU 3M55A 3DLLA 4ZN3A 1KQSS 1XOVA 5GAOq 4MMKA 3VUZA 5KE2A 3I56T 4MMLA 3CCRT 1KC8C 5I21A 2M16A 1X01A 3M5AA 1VUBA 3WXMB 3C95A 1WJRA 4KUIA 4JJNK 3RERA 1QVFA 5CKHA 1VQPT 2EAYA 1N9SA 3PNWC 4X34A 1Q82U 1W2BA 4J6WA 1VQ4A 2RJEA 1M8VA 3O8VA 3OYEA 3NTHA 4A53A 5GMKi 3S6WA 1W4SA 2CZ0B 3PGGA 1VQ8T 4EDUA 3JB9G 2DKGA 2RO0A 5CAIA 5HY6A 1ZBXA 4UC4A 5CQYA 2EJ9A 3L1AA 1YBYA 2KAFA 4M75B 4M78C 4M78B 3BW1A 5KE3A 1Y7XA 3I55A 2DXTA 2YLBA 3ZBDA 2WSCE 2DIGA 2OTLT 3CMAT 2FVUA 4A4HA 3OSVA 4EMKA 3UT1A 1VQ9T 5GMKj 1KC8U 4N0AC 2LQ8A 2V8KA 1Q81C 1M90C 2M0OA 4M78G 3DLMA 3A8GB 4M75D 3WVEB 4Y91A 2WSFE 5LJ3f 3SB2A 3X25B 4M7DE 2KMTA 5LJ3e 3OYCA 3JCMb 4XAXB 2AHJB 4E7IA 2XDBA 1MGQA 1Y07A 4XTZA 3E9GA 3X24B 4A4GA 3G71T 2VC8A 1WQWA 2DTOA 3MO8A 3SFMA 3OYNA 4M7AE 3QXEB 4XU1A 4L59A 3V7SA 5C6SA 3CC7T 1BI3A 2I2LA 1U1SA 1KQ1A 2R5AA 2RA2A 3QJ6A 5KCHA 2VXFA 4RKUE 2BUDA 2K3YA 3L42A 5A2QE 3MP1A 3QPHA 3GNFB 4LD6A 4XQ3A 3J81E 3CPWA 2LTOA 2XIDA 3LGLA 2WSEE 3BFMA 3CC2T 4BACA 1M90U 1Q81U 5CIUA 1RI0A 5I2MA 4ZTFA 4LD9K 5LJ5d 4BE0A 3X26B 4OGCA 3I56A 2QQRA 5LJ3h 3RMSA 3CCRA 4HA8A 4QQDA 2ZZDA 4L6V5 3L2WA 3M56A 3CMET 5IN1A 4BDZA 1VQPA 4RMOA 4M7DA 3RMQA 3GOXA 2D0QB 2K5IA 2RK1A 2JVVA 2RJFA 4RG8A 2O01E 3VKIA 4C0GA 1N8RC 3QO3A 3VU3C 1YI2T 5I2SA 2OTJA 4C92C 1RL2A 2CYZB 3CEYA 4C92B 4DQ2A 3KUFA 1M1GA 4E7HA 2ZPFB 3LX7A 3ASKA 1DJ7B 3OYIA 3V7RA 4OB1B 4MDWA 2ZCFB 3SD4A 3JCMh 4M7AA 4PKCC 4E7KA 2FYKA 1BI2A 2DEQA 5GAOr 4A54A 4PLIA 5GAN2 1OZ3A 2B8AA 3CMAA 5GMKm 2OTLA 4C5IA 2JN0A 4L5GA 5GANd 1VQ9A 2D9TA 4C92D 1VQ6A 1KQSA 1SSFA 4HCZA 3CD6T 3HRSA 4BY6C 3EAEA 4BY6B 1UEBA 5CK9A 1N6AA 4BUGA 5CKBA 3CBPA 3EFRA 1KD1C 4KULA 2RI2A 1UGSB 4XTWA 5GAMd 1I5LA 1K9MU 3OYFA 2G3RA 4JS4A 3CCLT 3V8LA 2E6NA 1NPRA 1N8RU 2QDYB 2E70A 3RESA 3X28B 4C0FA 5A0LA 2D6FA 4HT9A 4C5HA 3G71A 3JB9H 2LVMA 1NPPA 5IT9E 2RH2A 3H8ZA 4WF2A 3QYHB 3CXCA 3GIBA 1G5VA 4C8QE 3JB9I 4XTXA 3G6ET 1VQMT 1XNIA 4QQGA 1UB4A 3CC7A 5FRMA 4HCCA 4M7DC 2DTHA 4J7FA 5FRNA 1I81A 5J39A 4EMGA 3LWIA 2YHTA 3INZA 4JUVA 4BI3A 3MEVA 2QQAA 3MEAA 3BDLA 1XTDA 2L5QA 4M77F 2GCXA 5IAYA 5KH6A 1HK9A 1Y96A 3KBGA 5HK3A 4R56A 3QSUA 2RB6A 4A4EA 3OYDA 4M7AB 3CCVT 4M7AC 3CCQT 4M7DG 4C5GA 3LW5E 2K5LA 1VQOT 4IKFA 2EJFA 2ZPIB 2EQKA 3RKXA 4J83A 2EKOA 3BDUA 2PUKB 3V8JA 4F7UE 1YJ9T 1K73U 4XTYA 4NL3A 3JAME 1MHNA 3DB4A 3EFSA 3P8DA 5CCAA 3V7CA 3JCMV 3CMEA 2IG0A 1G3WA 3ME9A 4M7AG 1NJIC 3PIOA 3OSSC 3QYGB 3JRZA 1YI2A 1JRIA 4J6YA 1JJ2S 2HD0A 4OB0B 3HPWA 5GANg 1OYXA 4R55A 2QQ9A 3LWHA 2RHZA 3OS0A 2XHCA 3FRNA 1BKBA 4C8QA 5HK0A 1M1KC 3J7AF 1QP3A 4C8QF 3JCMP 1B34B 2KQWA 3MCAB 2L89A 5GAMg 2OAUA 2OTJT 2F5TX 5DLQE 2RHUA 3ZEHA 5C0MA 4BE2A 2MAMA 3WVDB 3CC2A 4HCBA 3LYIA 2ZPBB 2NLUA 2JTMA 3JCMc 3JB9D 3CPFA 2YLCA 3CD6A 2V8IA 2CS7A 3DKMA 3A8MB 5GANj 2XI9A 3RUXA 4O6JA 2EFIA 4C0DC 2DXCA 3JCMX 1BIAA 2KY9A 4Y28E 1NJIU 4BB7A 3QHSA 5CKEA 4F7UA 3CCLA 2DZCA 2WACA 3CCMT 2X35A 1VQ6T 2K57A 3M54A 1TH7A 3P8HA 4XU2A 5CQXA 4F7UF 5GAMj 4PJOE 1EIFA 1Y71A 4M77G 4JLIA 1N9RA 3SWNA 5A0DA 4M78D 4PL6A 4E47A 3G6EA 1NE8A 1VQMA 2RHYA 1M1KU 4XTVA 4XTUA 1V29B 4JLGA 3MP8A 3BY7A 4A4FA 3G4ST 2FL7A 2L3RA 2O4XA 2ZGWA 2QI2A 1PSEA 5GAN6 3FC3A 2Y4YA 4X9DA 3QG1A 4QVDA 3M9QA 3C94A 2DJZA 4MZMA 2VYTA 3CCVA 4ELYC 3CCQA 1H641 2GFUA 1VQOA 2DK3A 1LOJA 1QVGS 1WGSA 2E12A 3M59A 1YJ9A 2RM4A 3GF5A 1JBMA 2DTIA 3M4YA 2BKDN 2EIFA 1WJSA 2DZ9A 4HKEA 1VQLT 2LRQA 3OW2S 4OF1A 4C8QG 2HNIA 2MMPA 5J3BA 4BI4A 3OBYA 2X4YA 4YTLA 1I4K1 2EJGA 2GQVA 3OYKA 2A7YA 3CBMA 4PJOA 3P8BB 4EMKC 4EMKB 5LJ5f 3OS2A 2XDDA 5LJ5e 3C4SA 4PJOF 3JCMd 3OYAA 4JRPA 1D3BA 2PQWA 2Y4XA 4A4KA 3OYGA 2RJDA 1Q7YC 3AHUA 3HRTA 4PNOA 1QVFS 3CBOA 2VGMA 3A8HB 3HFNA 2MWOA 2ZPGB 3PMIA 4LDWA 2DD5A 5L8RE 2QA4T 2EYQA 3E19A 4F7UG 5CR2A 3OYMA 4X9CA 3MEUA 4DOWA 4M77E 2CKKA 2O4XB 1H3ZA 2DIQA 1UGQB 1R8OB 2YRVA 3FJPA 4BDYA 2RJCA 4B9XA 4KT0E 3LLRA 1VQ7T 1Q86C 2KK4A 2PVGB 3CCSA 3LGFA 3RIRA 3OY9A 3CCUT 1X6OA 2M9UA 4IUTA 2E1HA 3PTAA 3CCMA 2C06A 2P0QA 2RHXA 3QIIA 4N4GA 4P5NA 3L2VA 3L2ZA 4FSXA 4IUVA 4RCCA 2MI6A 5LJ5h 2EQMA 3CCJT 4ELZC 1JJ2A 5GANf 5CKDA 5KCOA 2XICA 5GANe 3META 1YHQT 3GP8A 4E7LA 3FEOA 2IVWA 4XK8E 5LJ3g 4M75E 2F69A 2X4XA 1YJNT 3G4SA 5FLXE 2R57A 2LCLA 4J5YA 3OA6A 5GMKe 5GAMf 4PJOC 3A8OB 3UDCA 2EQUA 2MWPA 3M57A 2JTFA 5GAMe 3HSBA 2H3JA 3PFSA 2XDPA 1D3BB 2K3XA 4M7DB 3GNGA 3HFOA 2HBPA 2HQEA 3OBWA 1BIBA 1LNXA 2QTXA 4M77A 4PJOG 1O9SA 3MHXA 3JCMg 4EPCA 5LJ3j 5CO7A 4DOVA 1YCYA 1U1TA 1VQKT 1UGPB 4OVAA 1VQLA 2VGNA 2LT1A 2PVDB 2VXEA 1KD1U 2E41A 5DM7R 4M7DD 3HHTB 1UGRB 1IZ6A 3OYYA 2L8DA 3OYJA 1QW1A 3JSCA 3N5BB 5GAOp 5GMKh 2JZ2A 3OYLA 4D6WA 3MEWA 3A5ZB 4N4IA 2K2VA 2XG8D 2XKOC 4KUDK 4M7AD 1G3SA 4M75A 1Q82C 4DA4A 3OMCA 4M75F 2QA4A 3KXTA 3OYHA 3E1SA 4M78F 4IURA 4ATOA 4V2SA 1WNLA 5GAN8 1M4ZA 2KSSA 1YJWT 2R5MA 5GAN3 2CZ6B 3UPUA 1QVGA 2CGHA 1IREB 2FHDA 3S3OA 4GY5A 4N0AA 1O75A 3FB9A 1VQ7A 5M9OA 2QXFA 2DXBA 1VIEA 2LCCA 2XU8A 1GXIE 4FL6A 1YIJA 3CCUA 3OW2A 1G3TA 3A8LB 5DY9A 4PLLA 5GAN5 3TEEA 1M5Q1 4FT4A 4LDUA 2DVEA 4M77C 4M77B 3JCMQ 3CCJA 3PT9A 1OI1A 1X75C 3QJYA 4C0DB 4C92E 1P92A 1Y96B 4NS5A 2E64A 3HP9A 1YHQA 2RK2A 1ZHIA 2RI5A 2LDMA 4J6XA 3CCST 2DO3A 2M1HA 5CKFA 2HQXA 5AYFA 3ZFJA 1YJNA 1S72A 3VYGA 3FDRA 1LJOA 3S3NA 3L2UA 1K9MC 4MDXA 2LNVA 1I8FA 5FU6C 5FU6B 4JDSA 4OB2B 3CXCS 4M77D 1OZ2A 3L2QA 1XQHA 2CZ7B 4QVCA 2QQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4Y A;  2K5L A;  3GLX A;  1BI1 A;  2K5I A;  1U8R A;  3HRT A;  1G3Y A;  1G3T A;  1BI3 A;  4O6J A;  2LX9 A;  1G3W A;  1QW1 A;  1BI0 A;  3E19 A;  1P92 A;  1QVP A;  2H3J A;  4O5V A;  3HRU A;  1BI2 A;  1FX7 A;  1G3S A;  1FWZ A;  2QQ9 A;  5CVI A;  2K5F A;  2QQA A;  1BYM A;  2GCX A;  3MHX A;  3HRS A;  2QQB A; 
#chains in the Genus database with same CATH topology
 3I35 A;  4J8O A;  5D6W A;  2P0P A;  4M75 C;  3VS2 A;  2E5Q A;  1FMV A;  4KBM B;  1Q86 R;  1VQK A;  3NTK A;  4C8Q B;  1FX7 A;  2E65 A;  3SHW A;  1OX9 A;  1HXD A;  2V26 A;  1D0Y A;  1J3T A;  2DNU A;  2EVR A;  3TCJ A;  2QQS A;  2JUF A;  4C92 F;  1FYN A;  2CT4 A;  3EFO A;  3R6N A;  1VQN T;  3URG A;  1T0J A;  1PCX A;  4OP0 A;  2LJ0 A;  3NFC A;  3QWX X;  2EWN A;  3R6O A;  3SWN B;  4OMF B;  4MZT A;  1VQ5 T;  1EFN A;  1JXO A;  2CP0 A;  5D7U A;  1VQ8 Q;  3A1P A;  2DD4 A;  4FIB A;  3EGD B;  1KHC A;  1LVK A;  4M7D F;  4OB3 B;  2VB6 A;  1Q7Y U;  4F14 A;  5HKC A;  2DL8 A;  1E6H A;  3MJX A;  1PNJ A;  2QAS A;  2DYI A;  5FRO A;  1PKS A;  4IUP A;  1QP2 A;  2IPO B;  3CC4 A;  2F5K A;  2QEX A;  3VV0 A;  1Q86 U;  3G7Z A;  1M9S A;  4QKU A;  4ZGE B;  5GAO l;  3FJ5 A;  4ZGD B;  2K4Y A;  2AZS A;  1WPY A;  4ZN1 A;  1RAI B;  1TOV A;  1RAA B;  1ZLM A;  2RPN A;  1K8A C;  3NMZ C;  4IUU A;  4RTW A;  1BI0 A;  4XU0 A;  2NUT B;  4FT2 A;  2LQK A;  3TU4 K;  4NOY A;  1VOM A;  3OMG A;  4EIK A;  3QKJ A;  4LDV A;  1YIJ Q;  2XD0 A;  3VUB A;  2PTK A;  3RKY A;  1PSF A;  1ZUK A;  3EH2 A;  4OMM A;  1ZX6 A;  2LJ1 A;  1KQS S;  1XOV A;  5KE2 A;  2YWW A;  1VQ4 Q;  4PJJ A;  2OI3 A;  4MML A;  2D8J A;  2M16 A;  1X01 A;  1I07 A;  1VUB A;  3WXM B;  3H9N A;  4KUI A;  4JJN K;  2EAY A;  4J6W A;  1M8V A;  1QLY A;  3I55 Q;  3NTH A;  1W4S A;  3PGG A;  1VQ8 T;  3JB9 G;  1LCK A;  5HY6 A;  1ZBX A;  2EJ9 A;  1R0C B;  2KAF A;  5FW9 A;  3BW1 A;  3VS1 A;  1RUW A;  1K4U S;  4LN2 A;  2DIG A;  3CMA T;  2O2O A;  2QYZ A;  2B86 A;  3UT1 A;  1VQ9 T;  1Q81 C;  1YWO A;  2M0O A;  2F2W A;  3A8G B;  4M75 D;  2KEA A;  5LJ3 f;  2KMT A;  4DBQ A;  3JCM b;  1MGQ A;  1Y0M A;  1Y07 A;  4A4G A;  1UHC A;  3G71 T;  1T0H A;  3TQ7 P;  3CC7 T;  3QJ6 A;  1OQK A;  3J81 E;  2K79 A;  1MUZ A;  3CCR Q;  2WSE E;  5I2M A;  1X6G A;  4K11 A;  2RQU A;  3I56 A;  1D0Z A;  2DRK A;  3L2W A;  5IN1 A;  1VQP A;  4RMO A;  2C0T A;  2D0Q B;  1K9M C;  4C0G A;  2RJF A;  1N8R C;  1JJ2 P;  2OTJ A;  4J9D A;  3CEY A;  4DQ2 A;  3OYI A;  4OB1 B;  2ZCF B;  3JCM h;  4PKC C;  1LPL A;  4PLI A;  1MMA A;  1AWX A;  1WFW A;  2DL7 A;  2F2V A;  2D9T A;  1AOJ A;  3CD6 T;  3HRS A;  2DL5 A;  4BY6 B;  5CK9 A;  2GGR A;  1N6A A;  4BUG A;  1PHT A;  1KD1 C;  1I5L A;  5GAM d;  3V8L A;  1NPR A;  1UTI A;  4HVV A;  4C0F A;  4C5H A;  2AT1 B;  2LVM A;  2RH2 A;  2MK5 A;  4WF2 A;  3QYH B;  4C8Q E;  1XNI A;  1G2B A;  3MEA A;  2JT4 A;  2L5Q A;  2DL4 A;  5IAY A;  3QSU A;  2BTT A;  3CME Q;  4M7A C;  1GBQ A;  2BE7 D;  4C5G A;  4IKF A;  2EJF A;  3RKX A;  2EQK A;  4J83 A;  2EBP A;  3JAM E;  2MOX A;  1JEG A;  2Z0W A;  3D7S B;  1IO6 A;  3OW2 P;  2E5K A;  3QYG B;  1JRI A;  2HD0 A;  2EYZ A;  2RHZ A;  2M51 A;  5HK0 A;  2L3S A;  1QVF P;  1QP3 A;  4C8Q F;  3JCM P;  1B34 B;  3MCA B;  2F5T X;  4PFO A;  5DLQ E;  2COZ A;  4BE2 A;  4HCB A;  1BB9 A;  5GAN j;  3A8M B;  5HCK A;  2EFI A;  3A98 A;  5KYY B;  4Y28 E;  2X3X D;  1N5Z A;  3QHS A;  3CCL A;  1YN8 A;  2WAC A;  1VQ6 T;  3P8H A;  4XU2 A;  4ZNX A;  1QWE A;  1WX6 A;  4ORZ A;  1VQM A;  2RHY A;  1ZSZ B;  1PD1 A;  2A28 A;  2HKN A;  4JLG A;  3BY7 A;  3CCQ Q;  3G4S T;  5GAN 6;  3FC3 A;  2HSE B;  3QG1 A;  2X9H A;  3CCV A;  2FZK B;  2QAZ A;  1H64 1;  2HBW A;  1VQO A;  2E12 A;  2RM4 A;  1KD1 R;  2EIF A;  2AZV A;  3UF4 A;  3REA B;  2HNI A;  5J3B A;  4PFZ A;  2DEU A;  2GQV A;  3CBM A;  4EMK B;  2OTJ Q;  5LJ5 e;  2PQW A;  3OYG A;  1M30 A;  4KGZ B;  3HRT A;  1SSH A;  3CBO A;  1UJ0 A;  2HDA A;  2P84 A;  2JMA A;  2QA4 T;  1M3B A;  2CKK A;  2DIQ A;  9ATC B;  1R8O B;  2YRV A;  4BDY A;  4IIO A;  2PVG B;  3CCS A;  3LGF A;  4JZ3 A;  3CCM A;  4P5N A;  2MI6 A;  5LJ5 h;  2EQM A;  1JJ2 A;  3MKD A;  5KCO A;  2C0I A;  1QMC A;  2XIC A;  1YHQ T;  4E7L A;  2IVW A;  5LJ3 g;  4AMC A;  2X4X A;  4AG2 C;  2R57 A;  2DJQ A;  3A8O B;  2MWP A;  1SHF A;  3NGP A;  5KYN A;  2XDP A;  2YRC A;  2VAS A;  3I5R A;  4M7D B;  2J6O A;  2HQE A;  4M77 A;  4AG1 C;  4EPC A;  5CO7 A;  3VS0 A;  4E6R A;  1YCY A;  2VGN A;  2DA9 A;  2RF0 A;  1JU5 C;  2VXE A;  1KD1 U;  1YFN A;  2E41 A;  2BZY A;  1IZ6 A;  1QW1 A;  2JMC A;  4D6W A;  2G6F X;  4N4I A;  2XG8 D;  4M7A D;  4M75 A;  1G83 A;  4ATO A;  2KRS A;  1YJW T;  2KSS A;  2R5M A;  5GAN 3;  3UPU A;  2CGH A;  3GBQ A;  4J9G A;  1ZSG A;  4WCI A;  3NPF A;  4Y92 A;  1W2B P;  1VQ7 A;  4FYV B;  2LCC A;  1VIE A;  4GLM A;  3CCU A;  1BCM A;  2LQW A;  3OW2 A;  1QKX A;  1R0B G;  4PLL A;  1YJN Q;  2DVE A;  4M77 B;  3G1J A;  4QT7 A;  2AK5 A;  2LDM A;  4X1V A;  5AYF A;  5FWB A;  2JS0 A;  3VYG A;  1LJO A;  2DMO A;  4JJD A;  2KT8 A;  2E3H A;  2YUQ A;  1GBR A;  1AWW A;  1UUE A;  1WI7 A;  1AZG B;  5DLO A;  5IHN A;  5LL6 S;  2QG9 B;  1D1A A;  3PMT A;  3ZL7 C;  3QDR B;  8ATC B;  2W0Z A;  4M75 G;  5D6X A;  2E4H A;  4AT1 B;  2DPP B;  3OYB A;  4QW2 A;  3CPW P;  2VUB A;  3GPL A;  1BYM A;  3H6Z A;  5GAO n;  2DBM A;  2GF7 A;  3H41 A;  4F7U B;  2X4J A;  2NWM A;  4PK4 A;  3O5Z A;  3JCM f;  4FU6 A;  4BI8 B;  1IB8 A;  3CCS Q;  2P0K A;  2EW3 A;  4BD3 A;  4C0Z A;  4RTX A;  1RAC B;  1AZE A;  4ZGJ B;  4LXC A;  2DBK A;  3OS1 A;  4TVR A;  3OQ5 A;  3SDZ A;  4FYY B;  1GFC A;  4A63 B;  1YIT Q;  1W70 A;  1IRX A;  4ME7 A;  5IHI A;  1VQ8 A;  2ROT A;  3QZ9 B;  3THK A;  2LC4 A;  4M78 E;  1VIF A;  3V8K A;  1S72 T;  3C12 A;  5A0G A;  2HSP A;  4PJO B;  1B07 A;  3M53 A;  5CVI A;  2VVK A;  2K5F A;  4Q5W A;  4CI0 C;  4JRI A;  1KC8 R;  2DAQ A;  1KHI A;  4C5E A;  3CCE T;  4FM4 B;  4XU3 A;  1VQN Q;  1WHG A;  2JJ9 A;  3EG1 A;  3EG9 B;  3F70 A;  4MZP A;  3RBB B;  2YUN A;  1NZ9 A;  4PJN A;  2LX9 A;  2D0N A;  1QVP A;  2HEQ A;  1VQ5 Q;  3HRU A;  5GAM h;  4NL2 A;  4WTO B;  3QBY A;  1WHL A;  4LNP A;  3JB9 J;  4B9W A;  3Q1J A;  2CDT A;  1C0M A;  2KRN A;  3JCM W;  5GAN 4;  2JNG A;  4KH0 B;  3VRY A;  4F04 B;  3EHQ A;  2EQJ A;  4J9C A;  3HL8 A;  1G3Y A;  1CSK A;  5GAO q;  3M5A A;  3C95 A;  1WJR A;  1N9S A;  4PJL A;  1W2B A;  1VQ4 A;  2RJE A;  2D1X A;  3M0Q A;  1PKT A;  1QCF A;  3S6W A;  1OU8 A;  1YBY A;  1IGU A;  2FRY A;  3I55 A;  3PVL A;  2LCS A;  2WSC E;  2OTL T;  1SG5 A;  1KC8 U;  2LQ8 A;  1YNZ A;  1ZUY A;  4M7D E;  4RTZ A;  2EGE A;  4XTZ A;  2VC8 A;  2DTO A;  1S1N A;  3V7S A;  5C6S A;  1KSW A;  2I2L A;  2DET A;  2RA2 A;  2VXF A;  4RKU E;  2K3Y A;  4FW1 A;  3MP1 A;  3CPW A;  3UA6 A;  3CC2 T;  1RI0 A;  2KXD A;  5LJ5 d;  4BE0 A;  2OAW A;  2ECZ A;  4JJB A;  3CCR A;  2ABL A;  3RMS A;  4HA8 A;  2GTO A;  5FWC A;  4BDZ A;  3VKI A;  4RG8 A;  2O01 E;  1YI2 T;  2CP7 A;  3CMA Q;  2ZPF B;  1EX4 A;  3SD4 A;  1VQ9 Q;  1ZBJ A;  4M7A A;  2FYK A;  3EFO B;  1BI2 A;  1IHV A;  5GAN 2;  1OZ3 A;  2M02 A;  2B8A A;  5GMK m;  2CP6 A;  2HL5 C;  2JN0 A;  4L5G A;  1PRL C;  4C92 D;  1VQ6 A;  1SSF A;  3EAE A;  3G71 Q;  4RTT A;  1GCQ C;  3CBP A;  2G3R A;  4JS4 A;  2E6N A;  7AT1 B;  3CC7 Q;  1M1K R;  1OV3 A;  1G5V A;  1BCO A;  3JB9 I;  3G6E T;  1UEC A;  2FZG B;  2DTH A;  4J7F A;  1M3C A;  1WHH A;  2MPX C;  5J39 A;  1ARK A;  4EMG A;  1QKW A;  3INZ A;  1Y57 A;  4DBR A;  4CC4 B;  1XTD A;  4M77 F;  2GCX A;  2HMA A;  5KH6 A;  4M7A B;  2ZPI B;  1QVG P;  1U06 A;  3BDU A;  1YJ9 T;  4F7U E;  4NL3 A;  3DB4 A;  3CME A;  3V7C A;  4M7A G;  4J9B A;  1WHJ A;  4J6Y A;  1JJ2 S;  4OB0 B;  5GAN g;  1GRI A;  1RAH B;  3LWH A;  1ZA2 B;  3CD6 Q;  1VYU A;  2ZPB B;  1TUG B;  3JCM c;  1Z9Q A;  3CPF A;  3AT1 B;  1OEB A;  2NUZ A;  4C0D C;  2ESW A;  2DXC A;  2YUO A;  1BIA A;  1RI9 A;  4LUD A;  4BB7 A;  4F7U F;  5CQX A;  4PJO E;  1KK7 A;  1Y71 A;  4JLI A;  4PFP A;  3TVT A;  4PL6 A;  1SEM A;  1M1K U;  2KT1 A;  1V29 B;  4AFQ C;  1K9A A;  2FL7 A;  2QI2 A;  2FO0 A;  4QVD A;  3M9Q A;  1VYV A;  4MZM A;  3CCQ A;  2GFU A;  2V1Q A;  2O9S A;  2LJ3 A;  2L3P A;  3REB B;  1D0X A;  1WJS A;  1VQL T;  3OW2 S;  2J7I A;  4BI4 A;  3OBY A;  4YTL A;  1ABQ A;  2A7Y A;  3P8B B;  2DYB A;  2XDD A;  4PJO F;  2RMO A;  1UG1 A;  2GTJ A;  4JRP A;  2Y4X A;  2AKL A;  1QVF S;  4PNO A;  1ACM B;  2FZC B;  3HFN A;  2MWO A;  4LDW A;  2DD5 A;  2EYQ A;  1AT1 B;  4OMO A;  1VQ6 Q;  1E7O A;  1UGQ B;  3FJP A;  1MMD A;  4B9X A;  3LLR A;  1TUD A;  4IUT A;  2E1H A;  2EGC A;  1H92 A;  2ATC B;  3QII A;  3G4S Q;  3CCJ T;  5CKD A;  5GAN e;  1F1B B;  3MET A;  2FPD A;  5FLX E;  4J5Y A;  2LCL A;  5GMK e;  5GAM f;  1UGV A;  1V1C A;  3M57 A;  3VS6 A;  2H3J A;  4AFZ C;  3HFO A;  1LNX A;  2QTX A;  2QTV A;  3M0T A;  4R0K A;  4DOV A;  1VQK T;  1RLQ C;  2LT1 A;  3VS3 A;  2PVD B;  1X27 A;  1UGR B;  2HL3 A;  3OYY A;  2QA4 Q;  3OYJ A;  5GAO p;  5GMK h;  3A5Z B;  2XKO C;  1G3S A;  1NYG A;  3VS7 A;  4DA4 A;  1Q82 C;  3KXT A;  3E1S A;  1WNL A;  1M4Z A;  1FMW A;  1QVG A;  1IRE B;  2FHD A;  1TS9 A;  5M9O A;  4FL6 A;  1YHQ Q;  4FT4 A;  1HYO A;  3VRZ A;  1HSQ A;  2ENM A;  1OI1 A;  1X75 C;  5L23 A;  2FRW A;  2E64 A;  2D8H A;  2DO3 A;  3ZFJ A;  1YJN A;  1S72 A;  1ZUU A;  3S3N A;  2L0A A;  2EYY A;  2RHI A;  1XQH A;  3LWI A;  3OY9 A;  2HKQ B;  4QVC A;  1K0X A;  2QQB A;  2SRC A;  5IXB A;  4J9E A;  2JW4 A;  2E6Z A;  2YXY A;  4JRQ A;  2EPD A;  3CCE A;  1IXD A;  3JCM J;  3CC4 T;  2HAX A;  4RTY A;  2QEX T;  4N4H A;  2MF2 A;  2GQI A;  4C92 A;  1YJW Q;  1M1F A;  1N27 A;  3RKW A;  4RG2 A;  1AHJ B;  3X20 B;  1TWB A;  4C8Q D;  1NEB A;  4JS5 A;  2KBT A;  3T9N A;  2BIV A;  4KGX B;  1W2B S;  5IH2 A;  4HXJ A;  1KG1 A;  1R77 A;  1GFD A;  4GLK A;  2C0O A;  2A0F B;  2DXU A;  2V8J A;  4E7J A;  3UWN A;  2RD1 A;  2P4T A;  2H3E B;  4II1 A;  2RI3 A;  1FXX A;  4QQ6 A;  2KDS A;  1Q82 R;  5I22 A;  2JTE A;  5GMK l;  2KE9 A;  2DL3 A;  1YIT A;  1D1C A;  5GJW B;  4DBF A;  2PUO B;  3VJP A;  1X2Q A;  1KQ2 A;  3SEM A;  4M7A F;  1SRM A;  2CUB A;  1ZQ1 A;  1FWZ A;  3IQL A;  4C92 G;  1QQJ A;  3UAT A;  3FLG A;  5KYU A;  4OGE A;  5EG2 A;  2GFA A;  1AVZ C;  3CPW S;  3EGU A;  2X3W D;  5AT1 B;  4RTU A;  1BI1 A;  1K73 C;  2X4W A;  2JOY A;  2KXC A;  3JB9 F;  1MV3 A;  3OS5 A;  2KRM A;  5FU7 C;  2DRM A;  1RAD B;  3QZ5 B;  3L2R A;  4EMH A;  1VQN A;  5GAO m;  2CT3 A;  2KVQ G;  2R58 A;  1WIE A;  2VV5 A;  2K2M A;  2ZPH B;  5IXF A;  4HT8 A;  1VQ5 A;  3MPU B;  1WZO A;  1M90 R;  2F2X A;  4J7I A;  5LJ5 j;  4LE9 A;  1K1Z A;  5KYU B;  2DIL A;  3DLL A;  1S72 Q;  4ZN3 A;  1M2V A;  4MMK A;  3VUZ A;  2CP2 A;  3I56 T;  1KC8 C;  5I21 A;  2DFU A;  3KFV A;  1AEY A;  3RER A;  1QVF A;  1VQP T;  3PNW C;  4X34 A;  1Q82 U;  2K7A A;  1C6V X;  1V76 A;  1NBE B;  2CZ0 B;  3CCE Q;  4EDU A;  2DKG A;  5CAI A;  5CQY A;  4M75 B;  4M78 C;  5KE3 A;  1Y7X A;  4DEY A;  2YLB A;  5I11 A;  1SPK A;  4J9F A;  1MND A;  2JM9 A;  6AT1 B;  3WVE B;  2NYS A;  5LJ3 e;  2L3Q A;  4XAX B;  1M2V B;  4E7I A;  1BK2 A;  2KR3 A;  4FYX B;  2YSQ A;  1RLP C;  4CC7 A;  1MV0 B;  4XU1 A;  4L59 A;  2ROL A;  1U1S A;  1KQ1 A;  1X43 A;  5KCH A;  3QPH A;  1WDX A;  2KGT A;  3GNF B;  4LD6 A;  4XQ3 A;  4FYW B;  3I9Q A;  1K73 R;  3BFM A;  1M90 U;  1GCQ A;  5CIU A;  4LD9 K;  3X26 B;  4OGC A;  5LJ3 h;  2COY A;  4QQD A;  2ZZD A;  4L6V 5;  2FG0 A;  3GOX A;  2LX7 A;  2RK1 A;  2SEM A;  5I2S A;  4C92 C;  2OTL Q;  3KUF A;  1M1G A;  4E7H A;  4RTV A;  3ASK A;  3V7R A;  3CQT A;  1TU0 B;  2DEQ A;  5GAO r;  4A54 A;  3CMA A;  4OMP A;  4C5I A;  5GAN d;  1NJI R;  1VQ9 A;  3VS5 A;  2I0N A;  5CKB A;  1X6B A;  2RI2 A;  4XTW A;  1CKA A;  1X2K A;  3CCL T;  3G71 A;  2QGG A;  1NPP A;  1D1B A;  1PD0 A;  1VQM T;  3CC2 Q;  1UB4 A;  3CC7 A;  2KYM A;  4M7D C;  1X69 A;  3QWY A;  1I81 A;  2YHT A;  4BI3 A;  3MEV A;  2QQA A;  2RQT A;  3BDL A;  5KYW A;  4E7K A;  1Y96 A;  5HK3 A;  4R56 A;  4A4E A;  3OYD A;  3CCV T;  2O9V A;  1AWO A;  1VQO T;  2K5L A;  4J9H A;  1CKB A;  2EKO A;  2PUK B;  1K73 U;  1YI2 Q;  1MHN A;  3P8D A;  5CCA A;  1NLP C;  2IG0 A;  1MMG A;  3PIO A;  3M0R A;  2RN8 A;  4HVU A;  3JRZ A;  2A36 A;  2ZAE A;  3HPW A;  2J05 A;  2BZ8 A;  4PJM A;  4OMN A;  2O88 A;  4C8Q A;  1M1K C;  2CH4 A;  2EQI A;  2KQW A;  3ZEH A;  2MAM A;  1RAG B;  2DX1 A;  2FEI A;  2NLU A;  2JTM A;  2YLC A;  4OML A;  3CD6 A;  2V8I A;  2F1L A;  3DKM A;  4ESR A;  2XI9 A;  3RUX A;  4B6M A;  3JCM X;  2KY9 A;  1NJI U;  3G6E Q;  5CKE A;  3H0F A;  3CCM T;  2X35 A;  2K57 A;  1TH7 A;  5GAM j;  1EIF A;  3C0C A;  1N9R A;  3SWN A;  5A0D A;  4M78 D;  4HVW A;  1UFF A;  1EZZ B;  4KH1 B;  2LP5 A;  2LZ6 B;  1B7T A;  1QCO A;  1K0S A;  3ULR B;  2Y4Y A;  1YJ9 Q;  1OPL A;  2VYT A;  1ABO A;  4ELY C;  2DK3 A;  1QVG S;  3EGD A;  3M59 A;  2YRD A;  1WXT A;  3M4Y A;  2BKD N;  4M4Z A;  2LRQ A;  4C8Q G;  2MMP A;  1I4K 1;  2EJG A;  4Z88 A;  5LJ5 f;  1RAB B;  3OS2 A;  1D3B A;  4Z8A A;  4HCK A;  2VGM A;  3E19 A;  1M3A A;  5CR2 A;  3OYM A;  4X9C A;  1WHK A;  4DOW A;  4M77 E;  4D8D A;  3M0U A;  1K76 A;  3EHR A;  4E7Z A;  4FW2 A;  1AWJ A;  1VQ7 T;  3EGX A;  3CCU T;  1X6O A;  2M9U A;  3PTA A;  2NUT A;  2P0Q A;  4N4G A;  3L2Z A;  3PE0 A;  4IUV A;  4ELZ C;  4FCY A;  4F16 A;  3FEO A;  4XK8 E;  3PVQ A;  4M75 E;  2F69 A;  3G4S A;  1SHG A;  4PJO C;  1IHW A;  2XMF A;  2EQU A;  2JTF A;  3HSB A;  3PFS A;  3TSW A;  1D3B B;  3GNG A;  1VQL Q;  3QDF A;  2EKH A;  3OBW A;  1BIB A;  2DM1 A;  1RAE B;  2EYX A;  3JCM g;  1UGP B;  4F17 A;  1HJD A;  3TSZ A;  2CH4 W;  5DM7 R;  4M7D D;  1SF9 A;  3EGX B;  1B3Q A;  3N5B B;  3JSC A;  1WLP B;  3MEW A;  2K2V A;  4M75 F;  2QA4 A;  2EYW A;  4V2S A;  1WXU A;  4IUR A;  3RR6 A;  2CZ6 B;  1SRL A;  4GY5 A;  1U5S A;  3M0S A;  3CCJ Q;  4N0A A;  1O75 A;  3FB9 A;  4GBQ A;  2QXF A;  2DXB A;  2KI7 A;  1G3T A;  3A8L B;  5DY9 A;  5GAN 5;  1M5Q 1;  2ED0 A;  2QK0 A;  3PT9 A;  5ECA A;  3QJY A;  3HP9 A;  1YHQ A;  2M1H A;  4KGV B;  2HQX A;  1RAF B;  4LUE A;  3FDR A;  4MDX A;  5FU6 C;  4JDS A;  4OB2 B;  3CXC S;  4M77 D;  1VQK Q;  2CZ7 B;  1TXQ A;  2P4R A;  3M4G A;  3NTI A;  4CRI A;  1JQQ A;  2PU9 B;  2A3L A;  2LT4 A;  4C8Q C;  2ZPE B;  5LJ3 d;  2E10 A;  1JB0 E;  4Z02 A;  3MP6 A;  3E9F A;  3ER0 A;  3M58 A;  1NM7 A;  3S3M A;  1E6G A;  3PIP A;  3GLX A;  3TRE A;  1YJW A;  1YCS B;  3SWN C;  1Z9Z A;  4QVZ A;  3JCM e;  4ZTJ A;  2JXB A;  4JRK A;  3DB3 A;  3QUI A;  3H0I A;  1K8A R;  1I1J A;  2YDL A;  4IUQ A;  2PVO B;  1YIJ T;  2OJ2 A;  1VYT A;  2VKN A;  2YT6 A;  1UDL A;  2DER A;  1KQS P;  4ANJ A;  3OB9 A;  2XK0 A;  2MYS A;  2GBQ A;  4LDY A;  3CC4 Q;  3J80 E;  2QEX Q;  4RCB A;  1VQ4 T;  1HD3 A;  1TTH B;  2CZ1 B;  2RQR A;  3CXC P;  4LDX A;  5GAN 7;  4CC3 A;  2HZY A;  3EG3 A;  3I55 T;  4VUB A;  1BBZ A;  2MIO A;  3VYH B;  1PC0 A;  3GIB A;  4PJO D;  1U3O A;  5D6Y A;  1U8R A;  2K6D A;  5GAN h;  5FU7 B;  2ED1 A;  1WQ7 A;  2IIM A;  2HQH A;  1B34 A;  2Y90 A;  5LJ5 g;  2JM8 A;  4O5V A;  2O31 A;  2OX7 A;  1M8M A;  2V1R A;  2FB7 A;  4M78 A;  3LH0 A;  3FIF A;  1T3L A;  1WJQ A;  5KYY A;  1TUC A;  1WXB A;  2LNH B;  1Q81 R;  5J26 A;  5GJV B;  1YWP A;  1M27 C;  4BE1 A;  3BE3 A;  3HKS A;  1K8A U;  1KJW A;  3M55 A;  1ZSZ A;  2DE0 X;  3CCR T;  5IHK A;  5CKH A;  1SKU B;  1QWF A;  2CP5 A;  3O8V A;  3OYE A;  1NYF A;  2DF6 A;  4A53 A;  5GMK i;  2RO0 A;  1OPK A;  2DLP A;  4UC4 A;  2FPE A;  3L1A A;  4JZ4 A;  1OOT A;  4M78 B;  2DXT A;  3ZBD A;  2PZ1 A;  2FVU A;  4A4H A;  3OSV A;  4EMK A;  5GMK j;  1K9M R;  4N0A C;  2J06 A;  2V8K A;  1M90 C;  1PWT A;  1N8R R;  2BE9 B;  4CC2 A;  4M78 G;  1D09 B;  3DLM A;  4Y91 A;  2WSF E;  3SB2 A;  3X25 B;  3OYC A;  2L2P A;  2AHJ B;  2XDB A;  4RUG A;  3E9G A;  3X24 B;  1WQW A;  2EGA A;  3MO8 A;  4JJC A;  2VWF A;  3SFM A;  3OYN A;  1OX8 A;  4M7A E;  2CP3 A;  3QXE B;  1BI3 A;  2R5A A;  2BUD A;  3L42 A;  5A2Q E;  1XJW B;  2MCN A;  3I56 Q;  2LTO A;  2XID A;  3LGL A;  4BAC A;  1Q81 U;  1UJY A;  4ZTF A;  2K3B A;  1VQP Q;  4D8K A;  2QQR A;  3I5S A;  3CME T;  3LH5 A;  3M56 A;  1A0N B;  4M7D A;  3RMQ A;  2K5I A;  2JVV A;  3QO3 A;  1UHF A;  3VU3 C;  1Q95 G;  1RL2 A;  2CYZ B;  4C92 B;  2CSQ A;  3LX7 A;  1DJ7 B;  4MDW A;  2QDL A;  5EC7 A;  1M2O A;  1MMN A;  2OTL A;  3M0P A;  4DBH A;  1KQS A;  1AD5 A;  4HCZ A;  4BY6 C;  1UEB A;  3EFR A;  4KUL A;  1QCN A;  1UGS B;  2CSI A;  3EH1 A;  1K9M U;  3OYF A;  1NG2 A;  1N8R U;  2QDY B;  2E70 A;  3RES A;  3X28 B;  5A0L A;  1PRM C;  2D6F A;  4HT9 A;  3JB9 H;  5IT9 E;  3CXC A;  3H8Z A;  4E7S A;  1PM3 A;  4XTX A;  1BU1 A;  4QQG A;  2FPF A;  5FRM A;  4HCC A;  5FRN A;  1UE9 A;  2LQN A;  1W6X A;  4JUV A;  4FSS A;  3EG2 A;  3CC2 A;  2CUD A;  1HK9 A;  3KBG A;  2RB6 A;  3CCQ T;  4M7D G;  3LW5 E;  3V8J A;  4XTY A;  3H0H A;  2LMJ A;  3EFS A;  3JCM V;  1G3W A;  3ME9 A;  4IIM A;  1NJI C;  1OUL A;  3OSS C;  1YI2 A;  3NHN A;  3E2U A;  1OYX A;  4R55 A;  2QQ9 A;  3OS0 A;  1C1A A;  2XHC A;  3FRN A;  1BKB A;  4AFS C;  1WA7 A;  2YUP A;  3J7A F;  5KYX A;  5GAM g;  2L89 A;  2OAU A;  2OTJ T;  8AT1 B;  2QGF B;  2RHU A;  5C0M A;  4J9I A;  3WVD B;  1IGQ A;  3LYI A;  3JB9 D;  3CCL Q;  4AFU C;  4DEX A;  2CS7 A;  4O6J A;  2CRE A;  1JXM A;  1VQM Q;  4F7U A;  2DZC A;  2AKK A;  3M54 A;  2RNA A;  4M77 G;  4E47 A;  2J6F A;  1NE8 A;  3G6E A;  1ZSZ C;  2COW A;  2GNC A;  4XTV A;  4XTU A;  3CCV Q;  1TSF A;  4A4F A;  3MP8 A;  1VQO Q;  2ZGW A;  2L3R A;  2O4X A;  1PSE A;  1GCP A;  2DVJ A;  4X9D A;  2KYB A;  2AIR B;  3C94 A;  2DJZ A;  2H8H A;  1LOJ A;  3JV3 A;  1JO8 A;  5KYX B;  1WGS A;  1YJ9 A;  3GF5 A;  1JBM A;  2DTI A;  1W1F A;  2DZ9 A;  4HKE A;  4OF1 A;  2X4Y A;  3OYK A;  4PJO A;  4EMK C;  3C4S A;  3JCM d;  3OYA A;  1Q7Y C;  4A4K A;  3AHU A;  2RJD A;  2M0Y A;  2JS2 A;  3A8H B;  2ZPG B;  3PMI A;  1WHM A;  5L8R E;  4F7U G;  3MEU A;  3CCM Q;  2O4X B;  2J6K A;  3EG9 A;  3EG0 A;  1H3Z A;  1I0C A;  2RJC A;  4KT0 E;  1Q86 C;  2KK4 A;  3RIR A;  4Z89 A;  1NLO C;  1FMK A;  2C06 A;  2RHX A;  3L2V A;  4FSX A;  4RCC A;  5GAN f;  3UA7 A;  3VS4 A;  1GL5 A;  3GP8 A;  3U23 A;  1WYX A;  1YJN T;  3OA6 A;  2A08 A;  3HTR A;  3UDC A;  5GAM e;  2K3X A;  2E3I A;  1TG0 A;  2NUP A;  2HBP A;  1ZA1 B;  2RQV A;  4PJO G;  4E2F B;  1O9S A;  3MHX A;  1KFZ A;  5LJ3 j;  1U1T A;  4OVA A;  1OU9 A;  1VQL A;  1NEG A;  3RNJ A;  3HHT B;  4OMQ A;  1KIK A;  2L8D A;  3OYL A;  2JZ2 A;  2BZX A;  1MNE A;  1YP5 A;  4KUD K;  3OMC A;  1VQ7 Q;  3OYH A;  1I5O B;  4M78 F;  2KRO A;  5GAN 8;  2X51 A;  3CCU Q;  1PG5 B;  3S3O A;  3RDV A;  1H8K A;  1GXI E;  2W10 A;  2XU8 A;  1YIJ A;  1H3H A;  1T3S A;  2NUP B;  3TEE A;  4LDU A;  4M77 C;  3JCM Q;  3CCJ A;  2RQW A;  5KYW B;  4C0D B;  1VA7 A;  4C92 E;  1P92 A;  1Y96 B;  4NS5 A;  2RK2 A;  4J6X A;  1ZHI A;  2RI5 A;  3CCS T;  1Q7Y R;  1G8X A;  2A37 A;  2KNB B;  5CKF A;  2K9G A;  2HCK A;  4JPB W;  2PNI A;  3L2U A;  2LNV A;  1I8F A;  5FU6 B;  1OZ2 A;  3L2Q A;  4KRT A;  1YIT T; 
#chains in the Genus database with same CATH homology
 4J8O A;  5D6W A;  2P0P A;  5LL6 S;  5DLO A;  4M75 C;  2E5Q A;  4KBM B;  2E6Z A;  3M4G A;  3NTI A;  4JRQ A;  4CRI A;  3PMT A;  3CCE A;  3QDR B;  2PU9 B;  1VQK A;  2A3L A;  2LT4 A;  3NTK A;  4C8Q B;  4C8Q C;  3JCM J;  3CC4 T;  2ZPE B;  2HAX A;  2QEX T;  5LJ3 d;  2E10 A;  4M75 G;  5D6X A;  1FX7 A;  2E65 A;  1JB0 E;  4Z02 A;  1HXD A;  2DPP B;  3OYB A;  4N4H A;  4QW2 A;  2VUB A;  2MF2 A;  4C92 A;  3MP6 A;  3TCJ A;  2QQS A;  1M1F A;  1N27 A;  3E9F A;  2JUF A;  3RKW A;  4C92 F;  3GPL A;  3ER0 A;  1AHJ B;  3M58 A;  4RG2 A;  3X20 B;  3S3M A;  4C8Q D;  3H6Z A;  5GAO n;  1BYM A;  3PIP A;  4JS5 A;  2GF7 A;  4F7U B;  1VQN T;  3GLX A;  2X4J A;  3TRE A;  3URG A;  1YJW A;  4OP0 A;  3NFC A;  3T9N A;  2EWN A;  3R6O A;  3SWN C;  3SWN B;  4QVZ A;  2BIV A;  1W2B S;  3JCM f;  4OMF B;  4FU6 A;  3JCM e;  4ZTJ A;  4BI8 B;  4JRK A;  3DB3 A;  3QUI A;  1KG1 A;  2P0K A;  4MZT A;  1VQ5 T;  4GLK A;  4BD3 A;  4C0Z A;  2DXU A;  2V8J A;  4E7J A;  4ZGJ B;  3UWN A;  2RD1 A;  2P4T A;  2PVO B;  4IUQ A;  3OS1 A;  1YIJ T;  4TVR A;  3OQ5 A;  3SDZ A;  4II1 A;  2DD4 A;  4FIB A;  2RI3 A;  1FXX A;  4QQ6 A;  1KHC A;  2KDS A;  4ME7 A;  4M7D F;  4OB3 B;  5GMK l;  3OB9 A;  1Q7Y U;  5HKC A;  2XK0 A;  1VQ8 A;  3QZ9 B;  4LDY A;  1YIT A;  2LC4 A;  4M78 E;  1VIF A;  3V8K A;  1S72 T;  2PUO B;  3C12 A;  3VJP A;  3J80 E;  5A0G A;  1KQ2 A;  4RCB A;  4PJO B;  1VQ4 T;  4M7A F;  3M53 A;  2CZ1 B;  5FRO A;  1ZQ1 A;  1FWZ A;  4IUP A;  4LDX A;  1QP2 A;  5CVI A;  4C92 G;  5GAN 7;  2RHI A;  3CC4 A;  3FLG A;  2F5K A;  2K5F A;  4Q5W A;  4OGE A;  3VV0 A;  4CI0 C;  5EG2 A;  2QEX A;  3G7Z A;  1Q86 U;  2GFA A;  4JRI A;  3I55 T;  1M9S A;  4VUB A;  4ZGE B;  3VYH B;  5GAO l;  2DAQ A;  1KHI A;  4C5E A;  3CPW S;  4FM4 B;  4XU3 A;  4ZGD B;  2K4Y A;  5D6Y A;  3CCE T;  3F70 A;  4PJO D;  1BI1 A;  1K73 C;  1WPY A;  2X4W A;  2JOY A;  4MZP A;  4ZN1 A;  3JB9 F;  1U8R A;  3OS5 A;  5GAN h;  5FU7 C;  5FU7 B;  1NZ9 A;  1K8A C;  1WQ7 A;  4IUU A;  3QZ5 B;  2LX9 A;  3L2R A;  4EMH A;  1B34 A;  2Y90 A;  1BI0 A;  1VQN A;  4XU0 A;  5LJ5 g;  5GAO m;  1QVP A;  2KVQ G;  4O5V A;  2R58 A;  3HRU A;  5GAM h;  4FT2 A;  2LQK A;  3TU4 K;  4NL2 A;  4NOY A;  2VV5 A;  2FB7 A;  3QBY A;  3OMG A;  4M78 A;  3JB9 J;  3LH0 A;  2ZPH B;  3FIF A;  3QKJ A;  4LDV A;  4B9W A;  3Q1J A;  4HT8 A;  1VQ5 A;  1WJQ A;  2XD0 A;  3JCM W;  5J26 A;  5GAN 4;  3VUB A;  1YIT T;  2JNG A;  3RKY A;  1PSF A;  2EQJ A;  4J7I A;  5LJ5 j;  4BE1 A;  3HL8 A;  1G3Y A;  3HKS A;  1K8A U;  3M55 A;  3DLL A;  4ZN3 A;  1KQS S;  1XOV A;  5GAO q;  4MMK A;  3VUZ A;  5KE2 A;  3I56 T;  4MML A;  3CCR T;  1KC8 C;  5I21 A;  2M16 A;  1X01 A;  3M5A A;  1VUB A;  3WXM B;  3C95 A;  1WJR A;  4KUI A;  4JJN K;  3RER A;  1QVF A;  5CKH A;  1VQP T;  2EAY A;  1N9S A;  3PNW C;  4X34 A;  1Q82 U;  1W2B A;  4J6W A;  1VQ4 A;  2RJE A;  1M8V A;  3O8V A;  3OYE A;  3NTH A;  4A53 A;  5GMK i;  3S6W A;  1W4S A;  2CZ0 B;  3PGG A;  1VQ8 T;  4EDU A;  3JB9 G;  2DKG A;  2RO0 A;  5CAI A;  5HY6 A;  1ZBX A;  4UC4 A;  5CQY A;  2EJ9 A;  3L1A A;  1YBY A;  2KAF A;  4M75 B;  4M78 C;  4M78 B;  3BW1 A;  5KE3 A;  1Y7X A;  3I55 A;  2DXT A;  2YLB A;  3ZBD A;  2WSC E;  2DIG A;  2OTL T;  3CMA T;  2FVU A;  4A4H A;  3OSV A;  4EMK A;  3UT1 A;  1VQ9 T;  5GMK j;  1KC8 U;  4N0A C;  2LQ8 A;  2V8K A;  1Q81 C;  1M90 C;  2M0O A;  4M78 G;  3DLM A;  3A8G B;  4M75 D;  3WVE B;  4Y91 A;  2WSF E;  5LJ3 f;  3SB2 A;  3X25 B;  4M7D E;  2KMT A;  5LJ3 e;  3OYC A;  3JCM b;  4XAX B;  2AHJ B;  4E7I A;  2XDB A;  1MGQ A;  1Y07 A;  4XTZ A;  3E9G A;  3X24 B;  4A4G A;  3G71 T;  2VC8 A;  1WQW A;  2DTO A;  3MO8 A;  3SFM A;  3OYN A;  4M7A E;  3QXE B;  4XU1 A;  4L59 A;  3V7S A;  5C6S A;  3CC7 T;  1BI3 A;  2I2L A;  1U1S A;  1KQ1 A;  2R5A A;  2RA2 A;  3QJ6 A;  5KCH A;  2VXF A;  4RKU E;  2BUD A;  2K3Y A;  3L42 A;  5A2Q E;  3MP1 A;  3QPH A;  3GNF B;  4LD6 A;  4XQ3 A;  3J81 E;  3CPW A;  2LTO A;  2XID A;  3LGL A;  2WSE E;  3BFM A;  3CC2 T;  4BAC A;  1M90 U;  1Q81 U;  5CIU A;  1RI0 A;  5I2M A;  4ZTF A;  4LD9 K;  5LJ5 d;  4BE0 A;  3X26 B;  4OGC A;  3I56 A;  2QQR A;  5LJ3 h;  3RMS A;  3CCR A;  4HA8 A;  4QQD A;  2ZZD A;  4L6V 5;  3L2W A;  3M56 A;  3CME T;  5IN1 A;  4BDZ A;  1VQP A;  4RMO A;  4M7D A;  3RMQ A;  3GOX A;  2D0Q B;  2K5I A;  2RK1 A;  2JVV A;  2RJF A;  4RG8 A;  2O01 E;  3VKI A;  4C0G A;  1N8R C;  3QO3 A;  3VU3 C;  1YI2 T;  5I2S A;  2OTJ A;  4C92 C;  1RL2 A;  2CYZ B;  3CEY A;  4C92 B;  4DQ2 A;  3KUF A;  1M1G A;  4E7H A;  2ZPF B;  3LX7 A;  3ASK A;  1DJ7 B;  3OYI A;  3V7R A;  4OB1 B;  4MDW A;  2ZCF B;  3SD4 A;  3JCM h;  4M7A A;  4PKC C;  4E7K A;  2FYK A;  1BI2 A;  2DEQ A;  5GAO r;  4A54 A;  4PLI A;  5GAN 2;  1OZ3 A;  2B8A A;  3CMA A;  5GMK m;  2OTL A;  4C5I A;  2JN0 A;  4L5G A;  5GAN d;  1VQ9 A;  2D9T A;  4C92 D;  1VQ6 A;  1KQS A;  1SSF A;  4HCZ A;  3CD6 T;  3HRS A;  4BY6 C;  3EAE A;  4BY6 B;  1UEB A;  5CK9 A;  1N6A A;  4BUG A;  5CKB A;  3CBP A;  3EFR A;  1KD1 C;  4KUL A;  2RI2 A;  1UGS B;  4XTW A;  5GAM d;  1I5L A;  1K9M U;  3OYF A;  2G3R A;  4JS4 A;  3CCL T;  3V8L A;  2E6N A;  1NPR A;  1N8R U;  2QDY B;  2E70 A;  3RES A;  3X28 B;  4C0F A;  5A0L A;  2D6F A;  4HT9 A;  4C5H A;  3G71 A;  3JB9 H;  2LVM A;  1NPP A;  5IT9 E;  2RH2 A;  3H8Z A;  4WF2 A;  3QYH B;  3CXC A;  3GIB A;  1G5V A;  4C8Q E;  3JB9 I;  4XTX A;  3G6E T;  1VQM T;  1XNI A;  4QQG A;  1UB4 A;  3CC7 A;  5FRM A;  4HCC A;  4M7D C;  2DTH A;  4J7F A;  5FRN A;  1I81 A;  5J39 A;  4EMG A;  3LWI A;  2YHT A;  3INZ A;  4JUV A;  4BI3 A;  3MEV A;  2QQA A;  3MEA A;  3BDL A;  1XTD A;  2L5Q A;  4M77 F;  2GCX A;  5IAY A;  5KH6 A;  1HK9 A;  1Y96 A;  3KBG A;  5HK3 A;  4R56 A;  3QSU A;  2RB6 A;  4A4E A;  3OYD A;  4M7A B;  3CCV T;  4M7A C;  3CCQ T;  4M7D G;  4C5G A;  3LW5 E;  2K5L A;  1VQO T;  4IKF A;  2EJF A;  2ZPI B;  2EQK A;  3RKX A;  4J83 A;  2EKO A;  3BDU A;  2PUK B;  3V8J A;  4F7U E;  1YJ9 T;  1K73 U;  4XTY A;  4NL3 A;  3JAM E;  1MHN A;  3DB4 A;  3EFS A;  3P8D A;  5CCA A;  3V7C A;  3JCM V;  3CME A;  2IG0 A;  1G3W A;  3ME9 A;  4M7A G;  1NJI C;  3PIO A;  3OSS C;  3QYG B;  3JRZ A;  1YI2 A;  1JRI A;  4J6Y A;  1JJ2 S;  2HD0 A;  4OB0 B;  3HPW A;  5GAN g;  1OYX A;  4R55 A;  2QQ9 A;  3LWH A;  2RHZ A;  3OS0 A;  2XHC A;  3FRN A;  1BKB A;  4C8Q A;  5HK0 A;  1M1K C;  3J7A F;  1QP3 A;  4C8Q F;  3JCM P;  1B34 B;  2KQW A;  3MCA B;  2L89 A;  5GAM g;  2OAU A;  2OTJ T;  2F5T X;  5DLQ E;  2RHU A;  3ZEH A;  5C0M A;  4BE2 A;  2MAM A;  3WVD B;  3CC2 A;  4HCB A;  3LYI A;  2ZPB B;  2NLU A;  2JTM A;  3JCM c;  3JB9 D;  3CPF A;  2YLC A;  3CD6 A;  2V8I A;  2CS7 A;  3DKM A;  3A8M B;  5GAN j;  2XI9 A;  3RUX A;  4O6J A;  2EFI A;  4C0D C;  2DXC A;  3JCM X;  1BIA A;  2KY9 A;  4Y28 E;  1NJI U;  4BB7 A;  3QHS A;  5CKE A;  4F7U A;  3CCL A;  2DZC A;  2WAC A;  3CCM T;  2X35 A;  1VQ6 T;  2K57 A;  3M54 A;  1TH7 A;  3P8H A;  4XU2 A;  5CQX A;  4F7U F;  5GAM j;  4PJO E;  1EIF A;  1Y71 A;  4M77 G;  4JLI A;  1N9R A;  3SWN A;  5A0D A;  4M78 D;  4PL6 A;  4E47 A;  3G6E A;  1NE8 A;  1VQM A;  2RHY A;  1M1K U;  4XTV A;  4XTU A;  1V29 B;  4JLG A;  3MP8 A;  3BY7 A;  4A4F A;  3G4S T;  2FL7 A;  2L3R A;  2O4X A;  2ZGW A;  2QI2 A;  1PSE A;  5GAN 6;  3FC3 A;  2Y4Y A;  4X9D A;  3QG1 A;  4QVD A;  3M9Q A;  3C94 A;  2DJZ A;  4MZM A;  2VYT A;  3CCV A;  4ELY C;  3CCQ A;  1H64 1;  2GFU A;  1VQO A;  2DK3 A;  1LOJ A;  1QVG S;  1WGS A;  2E12 A;  3M59 A;  1YJ9 A;  2RM4 A;  3GF5 A;  1JBM A;  2DTI A;  3M4Y A;  2BKD N;  2EIF A;  1WJS A;  2DZ9 A;  4HKE A;  1VQL T;  2LRQ A;  3OW2 S;  4OF1 A;  4C8Q G;  2HNI A;  2MMP A;  5J3B A;  4BI4 A;  3OBY A;  2X4Y A;  4YTL A;  1I4K 1;  2EJG A;  2GQV A;  3OYK A;  2A7Y A;  3CBM A;  4PJO A;  3P8B B;  4EMK C;  4EMK B;  5LJ5 f;  3OS2 A;  2XDD A;  5LJ5 e;  3C4S A;  4PJO F;  3JCM d;  3OYA A;  4JRP A;  1D3B A;  2PQW A;  2Y4X A;  4A4K A;  3OYG A;  2RJD A;  1Q7Y C;  3AHU A;  3HRT A;  4PNO A;  1QVF S;  3CBO A;  2VGM A;  3A8H B;  3HFN A;  2MWO A;  2ZPG B;  3PMI A;  4LDW A;  2DD5 A;  5L8R E;  2QA4 T;  2EYQ A;  3E19 A;  4F7U G;  5CR2 A;  3OYM A;  4X9C A;  3MEU A;  4DOW A;  4M77 E;  2CKK A;  2O4X B;  1H3Z A;  2DIQ A;  1UGQ B;  1R8O B;  2YRV A;  3FJP A;  4BDY A;  2RJC A;  4B9X A;  4KT0 E;  3LLR A;  1VQ7 T;  1Q86 C;  2KK4 A;  2PVG B;  3CCS A;  3LGF A;  3RIR A;  3OY9 A;  3CCU T;  1X6O A;  2M9U A;  4IUT A;  2E1H A;  3PTA A;  3CCM A;  2C06 A;  2P0Q A;  2RHX A;  3QII A;  4N4G A;  4P5N A;  3L2V A;  3L2Z A;  4FSX A;  4IUV A;  4RCC A;  2MI6 A;  5LJ5 h;  2EQM A;  3CCJ T;  4ELZ C;  1JJ2 A;  5GAN f;  5CKD A;  5KCO A;  2XIC A;  5GAN e;  3MET A;  1YHQ T;  3GP8 A;  4E7L A;  3FEO A;  2IVW A;  4XK8 E;  5LJ3 g;  4M75 E;  2F69 A;  2X4X A;  1YJN T;  3G4S A;  5FLX E;  2R57 A;  2LCL A;  4J5Y A;  3OA6 A;  5GMK e;  5GAM f;  4PJO C;  3A8O B;  3UDC A;  2EQU A;  2MWP A;  3M57 A;  2JTF A;  5GAM e;  3HSB A;  2H3J A;  3PFS A;  2XDP A;  1D3B B;  2K3X A;  4M7D B;  3GNG A;  3HFO A;  2HBP A;  2HQE A;  3OBW A;  1BIB A;  1LNX A;  2QTX A;  4M77 A;  4PJO G;  1O9S A;  3MHX A;  3JCM g;  4EPC A;  5LJ3 j;  5CO7 A;  4DOV A;  1YCY A;  1U1T A;  1VQK T;  1UGP B;  4OVA A;  1VQL A;  2VGN A;  2LT1 A;  2PVD B;  2VXE A;  1KD1 U;  2E41 A;  5DM7 R;  4M7D D;  3HHT B;  1UGR B;  1IZ6 A;  3OYY A;  2L8D A;  3OYJ A;  1QW1 A;  3JSC A;  3N5B B;  5GAO p;  5GMK h;  2JZ2 A;  3OYL A;  4D6W A;  3MEW A;  3A5Z B;  4N4I A;  2K2V A;  2XG8 D;  2XKO C;  4KUD K;  4M7A D;  1G3S A;  4M75 A;  1Q82 C;  4DA4 A;  3OMC A;  4M75 F;  2QA4 A;  3KXT A;  3OYH A;  3E1S A;  4M78 F;  4IUR A;  4ATO A;  4V2S A;  1WNL A;  5GAN 8;  1M4Z A;  2KSS A;  1YJW T;  2R5M A;  5GAN 3;  2CZ6 B;  3UPU A;  1QVG A;  2CGH A;  1IRE B;  2FHD A;  3S3O A;  4GY5 A;  4N0A A;  1O75 A;  3FB9 A;  1VQ7 A;  5M9O A;  2QXF A;  2DXB A;  1VIE A;  2LCC A;  2XU8 A;  1GXI E;  4FL6 A;  1YIJ A;  3CCU A;  3OW2 A;  1G3T A;  3A8L B;  5DY9 A;  4PLL A;  5GAN 5;  3TEE A;  1M5Q 1;  4FT4 A;  4LDU A;  2DVE A;  4M77 C;  4M77 B;  3JCM Q;  3CCJ A;  3PT9 A;  1OI1 A;  1X75 C;  3QJY A;  4C0D B;  4C92 E;  1P92 A;  1Y96 B;  4NS5 A;  2E64 A;  3HP9 A;  1YHQ A;  2RK2 A;  1ZHI A;  2RI5 A;  2LDM A;  4J6X A;  3CCS T;  2DO3 A;  2M1H A;  5CKF A;  2HQX A;  5AYF A;  3ZFJ A;  1YJN A;  1S72 A;  3VYG A;  3FDR A;  1LJO A;  3S3N A;  3L2U A;  1K9M C;  4MDX A;  2LNV A;  1I8F A;  5FU6 C;  5FU6 B;  4JDS A;  4OB2 B;  3CXC S;  4M77 D;  1OZ2 A;  3L2Q A;  1XQH A;  2CZ7 B;  4QVC A;  2QQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...