4QQDA

Crystal structure of tandem tudor domains of uhrf1 in complex with a small organic molecule
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
134
Chain Sequence
GLYKVNEYVDARDTNMGAWFEAQVVRVTRKEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Crystal Structure of tandem tudor domains of UHRF1 in complex with a small organic molecule
rcsb
source organism Homo sapiens
total genus 30
structure length 134
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12148 TTD Tandem tudor domain within UHRF1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qqdA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qqdA01
1VQMA 2R58A 1YJWA 3OMCA 3OS2A 1K9MU 3S3OA 4L59A 1Q81U 1M1KC 3UWNA 3CPWA 5LL6S 2PQWA 1RL2A 1X6OA 1S72T 3I55A 1VQOA 1YJNT 4GY5A 3KBGA 5FLXE 1WJQA 1VQ7A 2MWOA 3H8ZA 3OYNA 3OYFA 4BE1A 3CCMA 2X4WA 2HQXA 2WACA 2NLUA 3ME9A 4CRIA 3G71T 3CEYA 4C5EA 4A4GA 5C0MA 1VQLT 3G4SA 3OYYA 1XTDA 1VQPA 2XHCA 3FDRA 3LGLA 3QBYA 3H6ZA 2GFUA 1Q7YC 2XK0A 2EQKA 2BIVA 3MEAA 1KHCA 5J3BA 1M1KU 2JVVA 3CCET 4IUPA 3CPWS 3PFSA 2JOYA 2QEXA 2YRVA 1WJRA 2DO3A 1NJIC 3BDLA 3MO8A 3CC2A 5DLQE 3CCLT 1VQKT 4N4GA 4IUVA 2OTLT 3META 3S6WA 4BDYA 3F70A 3PIOA 3G6EA 4B9WA 3TREA 3ZEHA 3S3NA 4YTLA 3PMIA 3CCVA 2XDPA 4QQGA 2L3RA 5J39A 2VYTA 3A5ZB 2EIFA 2JNGA 3OMGA 4N4IA 4OVAA 1Q7YU 2LVMA 3I56A 3MEWA 1N8RU 4Q5WA 3O8VA 2OTJA 3CC7T 1YITT 3MEUA 3CC4T 3P8HA 2MI6A 1QVGS 2FHDA 1NJIU 4BDZA 1YHQA 2EQJA 3E9FA 1SSFA 2P0KA 1RI0A 2LDMA 4NS5A 2IG0A 1YIJA 1VQMT 2LCLA 1YJWT 1Q86C 3CCRA 3ASKA 4A4HA 4C5HA 3L42A 3I55T 1VQOT 3L2QA 4X34A 4II1A 3OYDA 1VQ7T 4ZN3A 3PMTA 3CCMT 4E7LA 4C5IA 1NPPA 3OYKA 3CD6A 2B8AA 3LGFA 1XNIA 1VQ8A 3G4ST 1VQPT 2EQUA 1YBYA 2LCCA 3OYHA 1K73C 3E9GA 2RJCA 4IKFA 3GOXA 2G3RA 2JZ2A 3QKJA 3CCQA 1OI1A 2O4XB 2X4XA 2L89A 1Q86U 3KUFA 3J81E 2QQRA 3CCSA 3L2VA 1H3ZA 3EAEA 1JJ2A 2QEXT 3MP6A 2QQSA 5A2QE 4UC4A 2RHXA 3CC2T 1K8AC 2QA4A 2KDSA 3OS1A 3CMAA 1Q82C 1WJSA 3P8BB 1N27A 3OYGA 1QVGA 3G6ET 1VQ5A 3SD4A 3DB4A 2EKOA 5KCOA 3CCVT 4A4FA 3FC3A 3NTIA 1QVFA 2M16A 4PLLA 3OYLA 2RJDA 3LH0A 3DLLA 1VQ4A 3MP1A 3C4SA 3OYEA 3I56T 3LLRA 3S3MA 5KH6A 2RI5A 5IT9E 3CMEA 2OTJT 1OZ2A 2X4YA 3CCUA 4QQDA 1YJ9A 2D9TA 1JJ2S 2R57A 5DM7R 2LQ8A 3Q1JA 1VQ6A 5FRMA 1YHQT 1K8AU 1YIJT 1Q82U 3UT1A 2X35A 3FLGA 3CCRT 3MEVA 2EQMA 1VQNA 1YI2A 4N4HA 5D6XA 4E7IA 5FRNA 1Q81C 4BD3A 4E7JA 3OYBA 2F5KA 1QVFS 2LTOA 4RG2A 4C5GA 4ZTFA 3NTHA 5C6SA 3OW2A 2R5MA 3CD6T 2RO0A 4EDUA 1UEBA 2DIGA 4ZTJA 2RJFA 1VQ8T 1KQSA 3CCJA 3OB9A 3DLMA 5J26A 3NTKA 1WGSA 2BKDN 5KE3A 2M1HA 4TVRA 3CCQT 4ZN1A 2DIQA 1NPRA 2E6ZA 1OZ3A 3OY9A 5KCHA 4IUTA 3QIIA 3CCST 1VQ9A 3PIPA 2BUDA 1MHNA 3CPFA 2K3XA 2KVQG 4E7HA 2RJEA 3JAME 5D6WA 2E70A 2QA4T 4HCZA 3OW2S 3CMAT 4PL6A 2JTFA 3QJ6A 1VQ5T 2GFAA 1S72A 3LYIA 1YJNA 4FL6A 1KQSS 3OYIA 3L2UA 3PNWC 4BE0A 3HKSA 2MWPA 2DAQA 2RHYA 1VQ4T 4B9XA 3G71A 4IUQA 1M90C 1VQLA 1EIFA 4QW2A 4BE2A 2GF7A 3CMET 1K73U 1IZ6A 3OYJA 3CCUT 1N8RC 2RI2A 3J7AF 4IUUA 1YJ9T 1KD1C 3CXCA 3OA6A 2JUFA 2E6NA 1VQ6T 4A4EA 1W2BA 1G5VA 2RHZA 2LRQA 3CCEA 1KHIA 1VQNT 1M1GA 1YI2T 5M9OA 2RI3A 2HQEA 3J80E 4PLIA 1KC8C 2R5AA 4BACA 3L2RA 2RHUA 4QQ6A 5KE2A 3CCLA 4QVZA 1VQKA 1NZ9A 3MP8A 3OYAA 5IAYA 2OTLA 1K9MC 4E7KA 2K3YA 1M90U 3CCJT 5CIUA 2L8DA 1KD1U 3FEOA 3CXCS 1BKBA 3ER0A 1W2BS 5D6YA 3OYMA 4LD6A 2M0OA 2O4XA 3P8DA 5HY6A 2EFIA 2E5QA 5IN1A 4IURA 2RHIA 3CC7A 1YITA 1VQ9T 3OYCA 3L2WA 5FROA 3CC4A 2CKKA 4FU6A 3DB3A 4Z02A 1KC8U 3OQ5A 1OYXA 3LX7A 3M9QA 3OS0A
chains in the Genus database with same CATH superfamily
1R8OB 2R58A 3AT1B 1K9MU 1YP5A 1M1KC 2DLPA 4GLKA 5LL6S 2KE9A 2PQWA 4OMPA 2EGAA 3CCSQ 1VIFA 1U5SA 1YJNT 1ABQA 4FW2A 1WPYA 1FWZA 3OYFA 2QTVA 2NYSA 1G8XA 2WACA 1RABB 3ME9A 3GPLA 1KQ2A 5FW9A 2LZ6B 1GCPA 4CC3A 2QEXQ 2XG8D 1VQLT 2COYA 3OYYA 2KGTA 3EFSA 3FDRA 5IHIA 3GNFB 3LGLA 4FYYB 4A53A 2K5IA 4M7DF 3H6ZA 4JUVA 2BIVA 1VQ4Q 1CSKA 3TCJA 2DRKA 1Q82R 1T0HA 5J3BA 1BI3A 2LJ0A 2AKKA 3UF4A 3T9NA 1M3BA 1WXBA 3PFSA 5LJ5f 2XIDA 3R6NA 1OU9A 1NJIC 1UG1A 3BDLA 3CC2A 4N4GA 2NUZA 3QZ9B 4BDYA 3F70A 3QUIA 3HP9A 3S3NA 1K76A 2BE9B 2XDPA 2DEUA 6AT1B 4QQGA 2L3RA 3OW2P 2F2VA 3JCMQ 1H3HA 2VYTA 2LJ1A 2JNGA 3OMGA 2MMPA 1YWPA 3M58A 3I56A 3V7CA 5ECAA 1X2QA 1TXQA 1XOVA 2JS2A 3CCJQ 3CC7T 1YITT 2JT4A 1TU0B 4C0FA 2DMOA 2FHDA 1SHFA 1JRIA 1QVGS 4XQ3A 2P0KA 4M7AA 1RI0A 2LDMA 2V8IA 1VQMT 1BB9A 4OMQA 3REAB 3JB9D 3JV3A 2PUKB 2JW4A 4HT8A 4A4HA 1WXUA 3I55T 1VQOT 4JLGA 5IH2A 3V7SA 1R0BG 2D0QB 2A0FB 5FU7B 3AHUA 1WLPB 3OYKA 3M4GA 2DX1A 3LGFA 4BY6B 3IQLA 3M55A 3G4ST 3JSCA 3M0RA 1K73R 2KK4A 2Y90A 1S72Q 2J06A 5GANd 5GAN4 3EGXA 1QWFA 5GJWB 3HRSA 1UUEA 2LP5A 4M7AE 2JZ2A 4J6XA 1WIEA 1QVPA 4FW1A 1OI1A 4KBMB 2JTEA 2A08A 5KYXA 1LCKA 4J9HA 3REBB 3EG2A 3MP6A 4BB7A 2QQSA 2EJFA 4UC4A 4MZPA 1JO8A 1K8AC 2QA4A 3A8MB 3VYGA 1Q82C 1SRMA 1N27A 4OB3B 1M90R 3OYGA 1RADB 1YJ9Q 3G6ET 1V76A 1OEBA 1VQ5A 3CCEQ 2VVKA 3SD4A 1W1FA 2EKOA 3JCMV 4XTWA 3VKIA 1VQ6Q 3FC3A 3NTIA 1M8VA 1QVFA 2M16A 2QG9B 4PLLA 2RJDA 3HHTB 2JMCA 3HPWA 3OYEA 1OX8A 1D1BA 1TTHB 2OTLQ 1HD3A 3JCMd 2DL3A 4GLMA 5KH6A 3E19A 3VS1A 5IT9E 3A8HB 3CMEA 3RIRA 3SWNC 1OZ2A 2F1LA 4QQDA 2D9TA 2RPNA 1B3QA 2LQ8A 4J9DA 4MMKA 5I21A 5GANg 5AT1B 3EH1A 2ED1A 4ME7A 5L23A 1JU5C 2RMOA 2KT8A 3EG9A 1YIJT 3RKWA 1ZSZC 2JTMA 2AIRB 2YRDA 3FLGA 3CCRT 1AEYA 4M4ZA 1N9SA 2HSEB 3EGDA 1VQNA 2DETA 2X3XD 5KYWA 2COZA 1N9RA 3MKDA 2C0TA 2KNBB 4XTVA 4C5GA 4ZTFA 5C6SA 1MMAA 4PFOA 2RO0A 2DKGA 1YJWQ 4EDUA 1SRLA 2DRMA 1UEBA 2DE0X 4KUDK 1K0SA 1FMVA 4QVDA 1KQSA 3OB9A 4BI8B 3M0QA 3H41A 1VQ7Q 1BBZA 3SB2A 1GFCA 1VYTA 4ZGDB 3M0SA 2H8HA 1YJNQ 2L3QA 1AT1B 4E47A 2HQHA 4LDXA 3CCST 4V2SA 4GBQA 3A8LB 1OPKA 1KQ1A 4RUGA 2F5TX 2EYQA 4KGZB 5LJ5h 1UGVA 4KULA 4M77A 1SEMA 4QVCA 2DZCA 5LJ3d 3I9QA 2E70A 2KRSA 4Z88A 4M7AB 4J5YA 2YRCA 3CMAT 4ANJA 1QVGP 3HL8A 2GFAA 4KH1B 3MCAB 4JJNK 1KG1A 3INZA 4FSSA 3PNWC 4AT1B 2D8HA 4BE0A 4XTXA 4PFPA 4J9FA 4JRPA 2RHYA 5DLOA 2CP7A 4J9GA 1VQ4T 1ZUKA 3G71A 4J7IA 1JXMA 4JRIA 1M90C 3SDZA 5LJ5e 3E2UA 2RQUA 1JBMA 1IZ6A 3JRZA 3RESA 5IXFA 3CCVQ 1VIEA 3VRZA 3EGXB 3HTRA 3UA6A 1KD1C 2X9HA 3CXCA 1I8FA 3HSBA 2JUFA 4E2FB 4AFSC 2ZPBB 2HCKA 3G7ZA 1IGUA 2W0ZA 3X24B 3HFNA 4JRQA 2VASA 2PNIA 1ZSZA 4FYWB 1SKUB 1Y71A 3THKA 2DBKA 3RR6A 5KYXB 1G83A 2EYXA 2PVOB 1MV3A 4DOVA 1YI2T 2O31A 2HQEA 1CKBA 1KC8C 4QQ6A 4KRTA 2VB6A 5GAOn 2HL5C 5CKFA 1NZ9A 3OYAA 3RERA 2RN8A 4M75C 2K3YA 1V29B 5LJ3g 1YITQ 1X01A 2YT6A 3HRUA 3X26B 2E12A 3CCJT 1BIAA 1QCOA 4XK8E 1WNLA 1KSWA 2EW3A 3PVQA 1BU1A 4L6V5 4PJOG 3ER0A 5D6YA 2LT1A 2M0OA 2O4XA 1Q86R 3EFRA 2JM8A 1K1ZA 3QO3A 4XU3A 4IURA 1M2OA 3QHSA 3L2WA 5FROA 4R55A 2CKKA 1YCYA 3DB3A 2LX9A 3BE3A 2DL5A 5CQXA 2V8KA 3M9QA 4JJBA 3WVDB 4C8QC 3EG9B 3OMCA 2IIMA 1Q81U 2SRCA 3UWNA 4M78G 5CR2A 3CPWA 1RL2A 3EGDB 1S72T 3JCMb 2DPPB 4FYXB 5KYWB 2JN0A 5IHNA 1T3SA 4KGXB 3CQTA 3CCMA 5GAOr 4C92C 5LJ5j 4FM4B 8ATCB 2E3HA 3TVTA 3CEYA 3UATA 3M0UA 2P4TA 4HCCA 4QT7A 2FB7A 2K57A 1PHTA 2AT1B 3VS4A 1VQPA 1SF9A 3TQ7P 3QBYA 1T3LA 2XK0A 2KT1A 4D8DA 3M0PA 3G6EQ 2CGHA 2KYBA 1VYUA 1Y96A 3SEMA 2LNHB 2VGNA 2FPEA 4RKUE 3CCET 4IUPA 1NJIR 4PJNA 2JOYA 2QEXA 2YRVA 2QQ9A 3BFMA 2P4RA 2ZCFB 4J6YA 2MF2A 5GAMd 2OTLT 5AYFA 4M75A 2CS7A 3JCMP 3TREA 3ZEHA 4YTLA 1IGQA 5L8RE 3A5ZB 4DBRA 3EG0A 2OAWA 1Q7YU 2K9GA 4RTZA 2EYYA 2LT4A 2AHJB 4RTVA 2GTOA 3MEWA 2OI3A 4HVUA 4F7UA 5GANh 2DYBA 1E6GA 4HT9A 3SWNB 3JB9H 5EC7A 4D8KA 2NUTB 2CZ7B 2K4YA 2YUQA 4ZGJB 4BDZA 5CK9A 3E9FA 1UHCA 2IG0A 5CAIA 2E10A 4NL2A 4M75E 1WHHA 4C8QA 1YJWT 1Q86C 2P0QA 3VUZA 3QSUA 1ZSZB 4E6RA 1IXDA 5GAN2 2GCXA 4FIBA 4C5HA 1VQ9Q 3L2QA 1ZUYA 4X34A 4DEXA 4ORZA 1VQ7T 4PJJA 2J6KA 2P0PA 4PJOD 2ROTA 2I0NA 1GBQA 3H9NA 3M54A 1QP2A 5GANe 2C0OA 3FB9A 4FSXA 3CD6A 3PT9A 4C92A 4XTZA 3URGA 1BK2A 2HBPA 5GMKm 4F7UE 1M30A 1VQ8A 1PNJA 2BTTA 5GAMg 4LXCA 1IRXA 2X3WD 4P5NA 5I2MA 1K0XA 5FWCA 1NLOC 3E9GA 3CMAQ 2EVRA 4VUBA 4J9EA 3GOXA 2DD5A 2G3RA 1TUGB 3CCQA 2JMAA 4C8QE 3JCMJ 2O4XB 4M78D 1N6AA 3VS3A 1GCQC 1K8AR 2HL3A 1B07A 5A2QE 2OX7A 2H3EB 4JJDA 1UTIA 2KDSA 4EMHA 1MUZA 3EH2A 4C92E 2EPDA 1WJSA 3P8BB 1UECA 2FPFA 4BI4A 3V8KA 1GL5A 3FIFA 3D7SB 2E41A 1AHJB 3DB4A 4M7DG 2HAXA 2ESWA 3VS6A 3X28B 2DXTA 3CCVT 4C0GA 4MDXA 4LUEA 1Z9QA 3L2ZA 3VJPA 1LJOA 3LH0A 3CCLQ 1M1FA 3MP1A 1WHGA 1UGPB 3LLRA 5GJVB 1YI2Q 2RI5A 2QDLA 4M77F 2DJZA 2GQIA 1QMCA 2OTJT 2DXCA 2V8JA 3CCUA 1YJ9A 5DY9A 2BZXA 1JJ2S 1IB8A 5DM7R 2CH4W 3Q1JA 1VQ6A 1ZA2B 1YHQT 3CBPA 2JM9A 3CBMA 1MGQA 1M2VA 1Y96B 2YLBA 1K9MR 3UT1A 1B34A 2CUDA 2DFUA 1RI9A 2DERA 1F1BB 2DVJA 4CC7A 4N4HA 4E7IA 2BE7D 1Q81C 2ZPGB 1BCMA 3CC4Q 1KJWA 2EQIA 2QDYB 3OYBA 7AT1B 1NG2A 2DXUA 3NTHA 3OW2A 3VS7A 3PE0A 2W10A 2R5MA 3HRTA 2LCSA 2PUOB 4M75B 2DIGA 4DA4A 2QI2A 1WHMA 2RJFA 2RQWA 3ZBDA 1EZZB 1YWOA 4FT4A 1WQWA 3NTKA 5J26A 1TG0A 2KRMA 1WA7A 3TSZA 4CC2A 2BKDN 2EAYA 1JEGA 1PG5B 3VS2A 2ECZA 4TVRA 2KI7A 1R77A 2DIQA 1NPRA 1OZ3A 1G2BA 1WXTA 2RA2A 4IUTA 4F7UB 2BZYA 3PIPA 2BUDA 2RM4A 3CPFA 2K3XA 1GCQA 3WVEB 4E7HA 2DJQA 1E6HA 4X1VA 1HSQA 1SPKA 3RBBB 1M5Q1 1QQJA 3H0HA 2CZ1B 2JTFA 4C8QB 4KH0B 3QJ6A 2HNIA 1YJNA 5A0LA 3L2UA 5CVIA 1OU8A 3X20B 2MWPA 4FYVB 4F14A 2DAQA 1OQKA 2CDTA 2F2XA 4LN2A 4DBHA 3CC2Q 2ZPEB 2DM1A 3C12A 4B9XA 4IUQA 4C92B 1NM7A 2VC8A 2KXDA 3V8LA 2KQWA 2YXYA 2LX7A 4BE2A 1EIFA 2DILA 1VQLA 2GF7A 1KD1R 4LD9K 2CZ0B 2O9SA 5EG2A 5KYYA 3OYJA 3OBYA 2RK1A 2K5LA 3EHQA 1WHKA 4JPBW 3OBWA 1YNZA 1KIKA 1PKTA 1R0CB 1JB0E 3I56Q 2RHZA 2ENMA 2ROLA 3JCMW 3UPUA 5KYUA 3JB9J 2P84A 1RLPC 1KHIA 1KC8R 1ZBXA 4M7DD 4E7SA 4HVVA 4IIOA 2RI3A 3J80E 3HFOA 4AFUC 3L2RA 2EJ9A 1G3TA 1FMWA 2DXBA 4XTUA 5IAYA 1K9MC 2HSPA 1KFZA 4EIKA 1UGSB 3VV0A 4XAXB 2CYZB 5IXBA 1PC0A 2VKNA 4J83A 3VU3C 1Y0MA 1W2BS 3OYMA 1X43A 3H0FA 2K5FA 5HY6A 4WCIA 5HCKA 4M77D 3VUBA 2E5QA 4JJCA 2RHIA 3CC7A 1YITA 3OYCA 1VQ9T 1G3WA 1N5ZA 2KY9A 1PCXA 4FU6A 1RAHB 1I07A 4Z02A 1ZSGA 2EGCA 2X4JA 4M75F 5GANf 2KMTA 3KXTA 3LX7A 1M2VB 3NPFA 1VQMA 4Y28E 3JCMg 3I5SA 1JJ2P 1EFNA 3S3OA 1B34B 4L59A 1M27C 1X6OA 1C1AA 3I55A 1VQOA 3M56A 3JCMX 4F7UF 2QGFB 4KT0E 2HQXA 3RKYA 2NLUA 2D0NA 1YFNA 2YWWA 5C0MA 1PKSA 3G4SA 1DJ7B 2NWMA 1XTDA 4HCKA 2CP6A 2ED0A 2VV5A 2XHCA 4ESRA 1B7TA 4C8QF 1J3TA 2EWNA 4OMMA 2AZSA 2KRNA 5GAN6 2EQKA 3MEAA 4DEYA 1RACB 3SWNA 4XU0A 1M1KU 2JVVA 2FL7A 2NUTA 3CMEQ 2CREA 1WJRA 3MHXA 2DO3A 2QTXA 1OX9A 1M3CA 3CCLT 1H641 1VQKT 2K79A 1WQ7A 1JXOA 4OP0A 4HXJA 4IUVA 1KK7A 3META 3S6WA 2OTJQ 3TSWA 1VUBA 5GAN3 1IHVA 3PIOA 3G6EA 1ABOA 1W4SA 3BY7A 3PMIA 4Y91A 2H3JA 3L1AA 1YHQQ 3RNJA 2G6FX 5J39A 2HBWA 4LDYA 1SHGA 2EIFA 4FCYA 1D09B 4N0AC 2HKQB 3EG1A 4OVAA 1W6XA 2LVMA 4XTYA 3BW1A 1A0NB 1PD1A 1N8RU 2ZPHB 4Q5WA 3O8VA 4K11A 5KYYB 3CC4T 4JZ3A 2MI6A 4C0ZA 1AWXA 5D7UA 1NJIU 4L5GA 2DTOA 4OB0B 2J05A 1PD0A 1YIJA 2ZZDA 4MZTA 2LCLA 1QLYA 3M5AA 2GGRA 2CH4A 5KYUB 3CCRA 2RQRA 1NLPC 1ZQ1A 1AWJA 4II1A 4KUIA 4RCCA 4AFQC 4BI3A 4F17A 3GBQA 3QDRB 4C5IA 1NPPA 2VUBA 2MIOA 5IHKA 2A3LA 5LJ3f 4MDWA 2NUPA 2YUNA 1ZBJA 4Z8AA 2DNUA 2V1QA 3VRYA 2VXFA 1NEBA 2KROA 4MMLA 2EQUA 2LCCA 1VOMA 2EYZA 1EX4A 2K2VA 2XDBA 5I22A 1T0JA 3G71Q 2DEQA 4EMKC 3QYHB 1QKWA 4M7AF 5GAOm 1RLQC 3J81E 1RAEB 3CCSA 2KYMA 4RTYA 4DBFA 1H3ZA 3O5ZA 4KGVB 3EAEA 1W2BP 1D3BA 2FZKB 1ACMB 1QWEA 4HCBA 5HKCA 3CC2T 2LMJA 4RTUA 3QWXX 3V8JA 1MMNA 3QYGB 3CMAA 4M7AG 1UJ0A 2ZPFB 1PRLC 3RUXA 2QASA 2M9UA 1JQQA 1WX6A 4A4FA 2E1HA 4PJOC 2K6DA 3ZL7C 1M8MA 4N0AA 1VQ4A 4HKEA 5CQYA 3I56T 2Y4XA 4O5VA 3S3MA 5LJ5d 3SFMA 2DTIA 2L2PA 4LDVA 2X4YA 3GP8A 5GMKh 2RQTA 2DL7A 2XICA 1K8AU 2A7YA 4M78C 1WHLA 2M51A 1Q81R 1X6GA 1Y57A 1Q82U 2RQVA 2QXFA 3MEVA 2MAMA 1YI2A 5FRNA 1AD5A 3WXMB 4R56A 9ATCB 2PVDB 2D8JA 4E7JA 1E7OA 2EKHA 2FYKA 2VGMA 1QVFS 2FG0A 1WZOA 4RG2A 4ZNXA 5GMKe 3I5RA 1K9AA 4J8OA 3CCJA 3U23A 3DLMA 2E3IA 4HVWA 1M3AA 3GNGA 4A63B 1H8KA 3M53A 1HK9A 3CCMQ 5KE3A 2M1HA 4PJMA 4Z89A 2DK3A 3OY9A 4EMKA 5CCAA 3QIIA 4LDUA 4X9CA 5LJ5g 3R6OA 1VQPQ 2B86A 1MHNA 1YCSB 2KVQG 3JCMh 2AZVA 1ZUUA 2M0YA 3JAME 2QA4T 4HCZA 2PU9B 2HD0A 2FZGB 2GQVA 1K4US 1OPLA 2FZCB 2D6FA 1VQ5T 1S72A 4FL6A 1KQSS 3OYIA 1X75C 1ARKA 2L3PA 1AOJA 4JRKA 4PJOA 2Z0WA 4J6WA 2L5QA 3A1PA 1Q7YR 4OGCA 2GTJA 1SSHA 1YN8A 2A28A 1NYGA 2HMAA 3JCMe 2NUPB 5GAMf 3CMET 2WSFE 1K73U 1ZHIA 1U3OA 2FVUA 1N8RC 1AZGB 1VQKQ 3NHNA 3M57A 4OF1A 2E6NA 4LDWA 4A4EA 1G5VA 4AMCA 3ZFJA 2J7IA 4M7AD 4M78A 2SEMA 4QKUA 3CCEA 1GRIA 5CO7A 1M1GA 5M9OA 1VQNT 4D6WA 2LC4A 4DBQA 1D3BB 4BACA 4PJOE 1TUDA 1BIBA 1TWBA 2RHUA 2DZ9A 1I81A 4QVZA 5HK3A 5GMKj 4M77G 1SG5A 3MP8A 2O01E 2KEAA 2OTLA 3EFOA 1M90U 2RK2A 5GMKl 3QG1A 5GANj 5LJ3h 4CC4B 5CIUA 2L8DA 1C0MA 1KD1U 3CXCS 1BCOA 3H0IA 3LW5E 4PKCC 3RMSA 4M78E 1Y07A 3CD6Q 1RAFB 1WDXA 2RF0A 2CUBA 3NGPA 2M02A 4J9CA 2J6FA 4ELYC 2XMFA 3EHRA 5IN1A 1VQ8Q 1MMDA 1FYNA 3M4YA 1PWTA 2CP0A 1MNEA 1KC8U 5CKEA 1I4K1 2OJ2A 3OQ5A 3VS5A 1UB4A 1OYXA 1NE8A 1XQHA 1AVZC 2V26A 3M0TA 1TUCA 3CCQQ 5LJ3e 1YJWA 3OS2A 2E5KA 4M7DC 2L0AA 1V1CA 2ZPIB 2CZ6B 2YDLA 2DYIA 1GXIE 1G3YA 4GY5A 3KBGA 2ABLA 5FLXE 1WJQA 3BDUA 3QXEB 1VQ7A 2MWOA 3VS0A 1LOJA 3H8ZA 2HEQA 3OYNA 1VYVA 4BE1A 2K7AA 4LNPA 2F2WA 2MCNA 4OB2B 2PZ1A 2X4WA 1BI2A 1O9SA 1MV0B 4CRIA 3G71T 4Y92A 4C5EA 2QQBA 2A37A 1CKAA 4A4GA 3PVLA 1QVFP 1ZX6A 1IREB 1U06A 2CT3A 1BI0A 2GFUA 3GLXA 1Q7YC 2YSQA 1LNXA 4M77C 4AFZC 1KHCA 4EMKB 1AZEA 1FXXA 3CPWS 1D0YA 2O9VA 3CCUQ 2QAZA 3MO8A 4RMOA 2EJGA 5DLQE 4OMOA 2XKOC 1RAIB 2LQNA 4C0DC 1UFFA 1WYXA 3OS5A 1Z9ZA 5FU6C 4B9WA 3V7RA 4LUDA 2AKLA 2HKNA 3TEEA 1VA7A 3N5BB 3CCVA 2YUPA 3UDCA 1M4ZA 2YLCA 1HYOA 1U1TA 4PJOB 2JXBA 2CP3A 2KBTA 3GF5A 4N4IA 1M9SA 2XU8A 2DA9A 1KQSP 1X2KA 3QZ5B 2OTJA 2O88A 4EPCA 4E7ZA 3MEUA 1AWWA 3P8HA 2CP2A 5LJ3j 4A54A 1YHQA 1Q95G 2EQJA 1SSFA 2QQAA 3QJYA 4NS5A 4XU2A 4M78B 2J6OA 4M7DA 1D1CA 3ASKA 4JS4A 1QP3A 1TH7A 1U1SA 3L42A 5CKHA 2I2LA 3OSVA 1FX7A 3OYDA 1RAGB 3A98A 3PMTA 4F16A 4ZN3A 4NOYA 2A36A 3CCMT 4E7LA 1D1AA 2DTHA 4XU1A 4A4KA 2MPXC 3EFOB 1X6BA 2B8AA 4ZGEB 1XNIA 2MOXA 4OMFB 1Y7XA 4M75G 4CI0C 1VQPT 2WSEE 5GAN5 2EGEA 1S1NA 2QA4Q 5GAMh 4WF2A 1YBYA 3OYHA 1K73C 2RJCA 2EBPA 4IKFA 4FT2A 2C06A 1I5LA 4RCBA 2WSCE 2O2OA 1W70A 3QKJA 1C6VX 3RDVA 1VQ5Q 4PNOA 1UGQB 2ZGWA 2X4XA 2L89A 1Q86U 4M7DE 3KUFA 1VQLQ 2LQKA 2QQRA 1QW1A 4DOWA 2COWA 3CXCP 3L2VA 3QWYA 3UA7A 1D0XA 4F7UG 1JJ2A 2QEXT 2C0IA 4AG1C 2D1XA 2XDDA 2RHXA 4AG2C 1PRMC 2XD0A 3OS1A 3PTAA 3JCMf 4EMGA 5GAMe 2X51A 4C92F 4C8QG 1QVGA 4RTTA 4NL3A 2KSSA 5KYNA 5KCOA 3LH5A 4RTWA 3M59A 3FJPA 3CBOA 2FO0A 2DBMA 2KR3A 4PJLA 5GAN8 3OYLA 3RKXA 5HK0A 3DLLA 2FPDA 3C4SA 4M77E 1VQNQ 4PK4A 4R0KA 4C92G 2DL8A 3ULRB 4RG8A 1P92A 2PVGB 2KAFA 3PGGA 2R57A 1ZLMA 1O75A 5FRMA 2DL4A 1OULA 1ZA1B 4J7FA 2GNCA 1FMKA 3C0CA 2AK5A 2LNVA 2OAUA 2RD1A 1XJWB 5GMKi 2GBQA 3JCMc 1PM3A 2X35A 4PJOF 4OMLA 3EGUA 2LJ3A 3DKMA 1QCNA 2EQMA 3QDFA 4O6JA 2E64A 5D6XA 3GIBA 3CC7Q 1WI7A 4BD3A 1LVKA 1NEGA 2F5KA 1WFWA 4J9IA 2CSQA 5FU7C 1IHWA 2LTOA 3QPHA 3CPWP 3VYHB 4BY6C 3CD6T 1VQMQ 1UGRB 2VXEA 1RAAB 4ZTJA 1OV3A 1VQ8T 5GAOq 1I5OB 1TS9A 4PFZA 1G3SA 2RB6A 3I55Q 1VQOQ 2PTKA 1GFDA 2CSIA 3EG3A 1HXDA 4M78F 3X25B 3A8OB 1WGSA 2K3BA 4IIMA 3NFCA 1I0CA 1X69A 1H92A 2MK5A 3CCQT 4ZN1A 2JJ9A 2E6ZA 1OOTA 5KCHA 1M1KR 2CT4A 5GAN7 3C94A 3G4SQ 1NYFA 4BUGA 1VQ9A 2DF6A 2IPOB 1I1JA 4OB1B 1WHJA 2QGGA 4LE9A 2RJEA 5D6WA 5GAMj 3JB9I 1BYMA 3OW2S 4PL6A 1UE9A 2FRYA 1NBEB 4M7DB 4JLIA 1GBRA 4M75D 2KXCA 1IO6A 3LYIA 3MPUB 2RNAA 5I11A 1LPLA 4ELZC 5CKDA 3HKSA 3G1JA 1AWOA 2K2MA 4HA8A 3LWIA 2YHTA 1PSEA 2DVEA 3KFVA 5FWBA 2DD4A 5CKBA 4J9BA 2CP5A 3FJ5A 1MMGA 1N8RR 4QW2A 2BZ8A 2E4HA 1TSFA 1PSFA 2L3SA 2Y4YA 1HJDA 3CCUT 2RI2A 4IUUA 2FRWA 3J7AF 1UDLA 2E65A 1YJ9T 1UHFA 3OA6A 1RUWA 4B6MA 1VQ6T 1W2BA 8AT1B 4F04B 4M77B 5A0GA 4C8QD 2LRQA 3MJXA 2RH2A 3JB9F 3TU4K 1QKXA 3FRNA 3A8GB 2XI9A 2FEIA 4PLIA 5I2SA 5GAOp 2R5AA 2LQWA 4ATOA 5A0DA 2YUOA 5KE2A 4JDSA 3CCLA 1VQKA 3C95A 1YIJQ 1X27A 4JZ4A 3LWHA 2V1RA 4E7KA 2ATCB 4C92D 4DQ2A 3JB9G 4RTXA 4C0DB 1UJYA 3CCRQ 2QYZA 3OSSC 5FU6B 1U8RA 4OMNA 4JS5A 4WTOB 1BI1A 2VWFA 3FEOA 1BKBA 3SHWA 2ZAEA 2HDAA 2HZYA 2MYSA 4LD6A 2F69A 3P8DA 1TOVA 5GAOl 2EFIA 4OGEA 1D0ZA 4MZMA 3RMQA 3E1SA 3CC4A 2IVWA 2QK0A 3I35A 4X9DA 4M7AC 2EYWA 1MNDA 1QCFA 2JS0A 3OS0A 3NMZC
chains in the Genus database with same CATH topology
1R8OB 1VQMA 2R58A 3OMCA 4Y28E 3JCMg 3OS2A 1YJWA 1K9MU 4M7DC 3S3OA 1B34B 4L59A 1Q81U 3UWNA 1M1KC 4M78G 5CR2A 3CPWA 4GLKA 2ZPIB 5LL6S 2CZ6B 2PQWA 1RL2A 1VIFA 1X6OA 1S72T 3JCMb 3I55A 1G3YA 2DPPB 1VQOA 1YJNT 1GXIE 4GY5A 3KBGA 5FLXE 1WJQA 3BDUA 3QXEB 1WPYA 2JN0A 1VQ7A 2MWOA 1LOJA 3M56A 1FWZA 3H8ZA 3OYNA 3OYFA 4BE1A 3CCMA 3JCMX 4F7UF 4OB2B 4KT0E 5GAOr 2X4WA 2HQXA 2WACA 4C92C 1BI2A 1O9SA 5LJ5j 4FM4B 3RKYA 2NLUA 3ME9A 3GPLA 4CRIA 3G71T 1KQ2A 3CEYA 4C5EA 2QQBA 2P4TA 4A4GA 4HCCA 5C0MA 2XG8D 1VQLT 3G4SA 2FB7A 3OYYA 1DJ7B 1XTDA 2K57A 1VQPA 2VV5A 2XHCA 3EFSA 3FDRA 3GNFB 3LGLA 3QBYA 4C8QF 1IREB 2EWNA 1BI0A 4A53A 2K5IA 4M7DF 3H6ZA 4JUVA 5GAN6 2GFUA 3GLXA 2XK0A 1Q7YC 2EQKA 2BIVA 3MEAA 1LNXA 3TCJA 2CGHA 1Y96A 4M77C 2VGNA 1KHCA 4EMKB 3SWNA 5J3BA 1BI3A 4XU0A 1M1KU 4RKUE 2JVVA 1FXXA 2FL7A 3CCET 4IUPA 3CPWS 3T9NA 3PFSA 5LJ5f 2JOYA 2QEXA 2XIDA 2YRVA 1WJRA 3MHXA 2QQ9A 2DO3A 3BFMA 2QTXA 3MO8A 3BDLA 4RMOA 1NJIC 2EJGA 3CC2A 5DLQE 3CCLT 2ZCFB 1H641 2XKOC 4J6YA 1VQKT 2MF2A 1WQ7A 4N4GA 4OP0A 4IUVA 5GAMd 3QZ9B 2OTLT 3META 3S6WA 4C0DC 5AYFA 5GAN3 1VUBA 3F70A 3OS5A 3QUIA 4M75A 3PIOA 2CS7A 3HP9A 3G6EA 3JCMP 5FU6C 1W4SA 3V7RA 3TREA 3ZEHA 4B9WA 4YTLA 3S3NA 3BY7A 3PMIA 3TEEA 2XDPA 3N5BB 4Y91A 3CCVA 2H3JA 3L1AA 4QQGA 2L3RA 5J39A 3UDCA 3JCMQ 1M4ZA 2YLCA 4LDYA 1U1TA 2VYTA 3A5ZB 2EIFA 2JNGA 3OMGA 3GF5A 2MMPA 4N0AC 5L8RE 4PJOB 4N4IA 1M9SA 2XU8A 4OVAA 3M58A 1Q7YU 2LVMA 3V7CA 3I56A 2LT4A 2AHJB 4XTYA 3BW1A 4BDYA 3MEWA 1XOVA 1N8RU 2ZPHB 4Q5WA 4F7UA 3QZ5B 3O8VA 5GANh 2OTJA 3CC7T 1YITT 4HT9A 4EPCA 3SWNB 3JB9H 3MEUA 4C0FA 3CC4T 3P8HA 2MI6A 2FHDA 4C0ZA 1JRIA 2CZ7B 2K4YA 5LJ3j 1QVGS 1NJIU 4A54A 4L5GA 2DTOA 4ZGJB 4BDZA 1YHQA 4XQ3A 4OB0B 5CK9A 2EQJA 1SSFA 2QQAA 2P0KA 3E9FA 4M7AA 3QJYA 1RI0A 2LDMA 4NS5A 2IG0A 4XU2A 1YIJA 2ZZDA 4MZTA 5CAIA 2E10A 2V8IA 2LCLA 4M75E 4M78B 4NL2A 4C8QA 1VQMT 3M5AA 3JB9D 1YJWT 1Q86C 2P0QA 2PUKB 3VUZA 4M7DA 3CCRA 3QSUA 3ASKA 4JS4A 4HT8A 5GAN2 2GCXA 4A4HA 1QP3A 4FIBA 1TH7A 4C5HA 1U1SA 3L42A 3I55T 1VQOT 4JLGA 5CKHA 1ZQ1A 3L2QA 2I2LA 3OSVA 4X34A 3V7SA 4II1A 1FX7A 3OYDA 4KUIA 1VQ7T 4RCCA 3PMTA 4ZN3A 4BI3A 2P0PA 2D0QB 4NOYA 4PJOD 3CCMT 4E7LA 3M54A 3QDRB 4C5IA 1QP2A 5FU7B 1NPPA 5GANe 4FSXA 3FB9A 3AHUA 3OYKA 2VUBA 2DTHA 3PT9A 4XU1A 4A4KA 3M4GA 4C92A 4XTZA 3CD6A 3URGA 2A3LA 2B8AA 4ZGEB 3LGFA 4BY6B 2HBPA 1XNIA 5LJ3f 5GMKm 4MDWA 3M55A 4F7UE 4OMFB 1VQ8A 3G4ST 1Y7XA 3JSCA 4M75G 5GAMg 2KK4A 2Y90A 4CI0C 1VQPT 5GANd 3OS0A 2VXFA 5GAN4 2WSEE 4P5NA 5I2MA 5GAN5 4MMLA 1VQNT 5GAMh 2EQUA 4WF2A 1YBYA 2LCCA 3OYHA 1K73C 3E9GA 2RJCA 4IKFA 3HRSA 4FT2A 2C06A 4VUBA 1I5LA 4RCBA 2WSCE 3GOXA 4M7AE 2DD5A 2G3RA 2JZ2A 3QKJA 2K2VA 4J6XA 3CCQA 2XDBA 1QVPA 1UGQB 2DEQA 1OI1A 2ZGWA 4KBMB 2O4XB 3QYHB 4PNOA 4C8QE 2X4XA 3JCMJ 2L89A 1Q86U 5GAOm 4M7AF 4M7DE 3KUFA 4M78D 3J81E 1N6AA 2LQKA 2QQRA 3CCSA 1QW1A 4DOWA 3L2VA 1H3ZA 3EAEA 4F7UG 1JJ2A 2QEXT 3MP6A 4BB7A 2QQSA 1D3BA 5A2QE 4HCBA 2EJFA 4UC4A 2XDDA 2RHXA 4MZPA 5HKCA 3CC2T 1K8AC 3V8JA 2QA4A 2KDSA 3QYGB 4EMHA 3OS1A 3A8MB 4C92E 3VYGA 2XD0A 3PTAA 3CMAA 4M7AG 1Q82C 1WJSA 3P8BB 3JCMf 1N27A 4OB3B 4EMGA 3OYGA 2ZPFB 5GAMe 4BI4A 4C92F 4C8QG 3G6ET 1QVGA 3RUXA 3V8KA 1VQ5A 3FIFA 3SD4A 2E41A 1AHJB 2KSSA 3DB4A 2EKOA 3JCMV 4NL3A 2M9UA 4XTWA 5KCOA 2HAXA 4M7DG 3VKIA 3X28B 2DXTA 3CCVT 4C0GA 4MDXA 3M59A 4A4FA 2E1HA 3L2ZA 3NTIA 3FJPA 3FC3A 4PJOC 1M8VA 1QVFA 2M16A 3CBOA 3VJPA 4PLLA 1LJOA 5GAN8 3OYLA 2RJDA 3LH0A 3HHTB 3RKXA 5HK0A 4N0AA 3DLLA 1VQ4A 1M1FA 3MP1A 3HPWA 4HKEA 3C4SA 3OYEA 5CQYA 3I56T 2Y4XA 4M77E 4O5VA 1UGPB 3LLRA 3S3MA 3JCMd 5LJ5d 4C92G 3SFMA 4RG8A 5KH6A 2RI5A 3E19A 2DTIA 1P92A 5IT9E 2PVGB 4M77F 3A8HB 2DJZA 4LDVA 2KAFA 3RIRA 3SWNC 3CMEA 2OTJT 3PGGA 1OZ2A 2DXCA 2X4YA 3GP8A 2V8JA 3CCUA 4QQDA 2D9TA 5DY9A 1YJ9A 1JJ2S 2R57A 5GMKh 5DM7R 2LQ8A 4MMKA 3Q1JA 5I21A 5GANg 1VQ6A 1O75A 5FRMA 1YHQT 2XICA 4ME7A 1K8AU 2A7YA 3CBPA 4J7FA 3CBMA 2LNVA 1MGQA 2OAUA 4M78C 1Y96B 2RD1A 2YLBA 1YIJT 5GMKi 3RKWA 1Q82U 3UT1A 1B34A 2JTMA 3JCMc 2X35A 3FLGA 4PJOF 2QXFA 3MEVA 3CCRT 1N9SA 3DKMA 3GIBA 2EQMA 4O6JA 2E64A 2MAMA 4N4HA 5D6XA 4E7IA 1YI2A 1Q81C 2ZPGB 5FRNA 1VQNA 3WXMB 4BD3A 4R56A 1N9RA 2QDYB 2PVDB 4E7JA 3OYBA 2F5KA 2VGMA 2FYKA 1QVFS 5FU7C 2DXUA 2LTOA 3QPHA 4RG2A 4XTVA 4C5GA 4ZTFA 3NTHA 5C6SA 3OW2A 2R5MA 3VYHB 4BY6C 3HRTA 2RO0A 3CD6T 2DKGA 4EDUA 1UGRB 2PUOB 2VXEA 1UEBA 2DIGA 4M75B 5GMKe 4ZTJA 4KUDK 4DA4A 2QI2A 2RJFA 1VQ8T 3ZBDA 4QVDA 5GAOq 1KQSA 4J8OA 3CCJA 3OB9A 1G3SA 4FT4A 3DLMA 2RB6A 4BI8B 1WQWA 3NTKA 3GNGA 5J26A 1HXDA 4M78F 3M53A 3X25B 3SB2A 3A8OB 1WGSA 1HK9A 3NFCA 2BKDN 2EAYA 5KE3A 2M1HA 4TVRA 4ZGDB 3CCQT 2DIQA 4ZN1A 1NPRA 2E6ZA 2DK3A 1OZ3A 3OY9A 4EMKA 5KCHA 5CCAA 2RA2A 4E47A 4IUTA 5GAN7 3C94A 3QIIA 4LDUA 4F7UB 3CCST 4LDXA 4BUGA 4X9CA 5LJ5g 3R6OA 4V2SA 1VQ9A 3A8LB 3PIPA 2BUDA 1MHNA 1KQ1A 2RM4A 3CPFA 2K3XA 3WVEB 2F5TX 2EYQA 2KVQG 3JCMh 5LJ5h 4OB1B 4E7HA 4KULA 4M77A 4QVCA 2RJEA 2DZCA 5D6WA 5LJ3d 5GAMj 2E70A 3JAME 3JB9I 4M7AB 2QA4T 4J5YA 4HCZA 2PU9B 1BYMA 1M5Q1 2HD0A 3OW2S 3CMAT 2GQVA 2CZ1B 4PL6A 2JTFA 4C8QB 4M7DB 4JLIA 3QJ6A 4M75D 2D6FA 1VQ5T 3HL8A 2GFAA 2HNIA 3MCAB 3LYIA 1S72A 1YJNA 4FL6A 4JJNK 1KQSS 3OYIA 1KG1A 1X75C 3INZA 5A0LA 3L2UA 5CVIA 3PNWC 4ELZC 5CKDA 4BE0A 3X20B 3HKSA 2MWPA 4XTXA 2DAQA 4JRKA 4PJOA 4JRPA 4HA8A 2ZPEB 2RHYA 3C12A 2L5QA 4J6WA 5DLOA 2YHTA 4OGCA 3LWIA 1PSEA 2DVEA 1VQ4T 2DD4A 4B9XA 5CKBA 3G71A 4IUQA 4C92B 4J7IA 2VC8A 3V8LA 4JRIA 2KQWA 1M90C 3SDZA 4QW2A 1EIFA 4BE2A 3JCMe 5LJ5e 1VQLA 2GF7A 1PSFA 4LD9K 2Y4YA 1JBMA 5GAMf 3CMET 2WSFE 1K73U 1IZ6A 2CZ0B 1ZHIA 3JRZA 5EG2A 3RESA 3OBYA 3OYJA 1VIEA 2FVUA 2RK1A 2RI2A 2K5LA 4IUUA 3CCUT 2E65A 1YJ9T 1N8RC 3J7AF 1KD1C 3M57A 3CXCA 1I8FA 3OA6A 3HSBA 4OF1A 2JUFA 2E6NA 3OBWA 2ZPBB 4LDWA 4A4EA 1W2BA 1VQ6T 1G5VA 3ZFJA 3G7ZA 1JB0E 4M7AD 3X24B 2RHZA 3HFNA 4M78A 3JCMW 4M77B 4JRQA 3UPUA 5A0GA 4C8QD 2LRQA 3JB9J 3CCEA 2RH2A 1Y71A 1KHIA 3JB9F 1ZBXA 3TU4K 4M7DD 5CO7A 1M1GA 2PVOB 4DOVA 3FRNA 5M9OA 1YI2T 3A8GB 2RI3A 4D6WA 2HQEA 2LC4A 3J80E 2XI9A 1D3BB 3HFOA 4PLIA 5I2SA 5GAOp 2R5AA 4BACA 1KC8C 3L2RA 4PJOE 2EJ9A 4ATOA 1BIBA 5A0DA 2RHUA 4QQ6A 5KE2A 1G3TA 2DXBA 4JDSA 5GAOn 2DZ9A 3CCLA 1I81A 4QVZA 5HK3A 1VQKA 3C95A 5CKFA 5GMKj 4M77G 4XTUA 1NZ9A 3MP8A 3OYAA 2O01E 5IAYA 3RERA 2OTLA 1K9MC 4M75C 3LWHA 4E7KA 4EMKC 2K3YA 1V29B 4C92D 5LJ3g 4DQ2A 3JB9G 1M90U 2RK2A 4C0DB 1X01A 5GMKl 3QG1A 5GANj 3HRUA 3OSSC 5FU6B 3X26B 2E12A 3CCJT 5LJ3h 1BIAA 1UGSB 4XK8E 5CIUA 1U8RA 2L8DA 4JS5A 1WNLA 3VV0A 1BI1A 4XAXB 2CYZB 1KD1U 3FEOA 4J83A 3CXCS 3VU3C 1BKBA 4L6V5 4PJOG 3ER0A 3LW5E 1W2BS 4PKCC 5D6YA 3OYMA 2LT1A 4LD6A 3RMSA 4M78E 2M0OA 1Y07A 2O4XA 2F69A 2K5FA 3P8DA 5HY6A 5GAOl 3EFRA 2EFIA 4OGEA 4M77D 3VUBA 2E5QA 3QO3A 4ELYC 5IN1A 4XU3A 4IURA 2RHIA 3QHSA 3CC7A 4MZMA 3RMQA 3OYCA 1VQ9T 1G3WA 3L2WA 5FROA 1YITA 3E1SA 4R55A 3CC4A 2CKKA 2IVWA 1YCYA 2KY9A 3M4YA 4FU6A 3DB3A 4Z02A 1KC8U 2LX9A 2X4JA 5CKEA 1I4K1 3OQ5A 4M75F 5CQXA 4X9DA 5GANf 4M7AC 1UB4A 1OYXA 1NE8A 1XQHA 2KMTA 3KXTA 2V8KA 3LX7A 3M9QA 3WVDB 5LJ3e 4C8QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM A;  2R58 A;  1YJW A;  3OMC A;  3OS2 A;  1K9M U;  3S3O A;  4L59 A;  1Q81 U;  1M1K C;  3UWN A;  3CPW A;  5LL6 S;  2PQW A;  1RL2 A;  1X6O A;  1S72 T;  3I55 A;  1VQO A;  1YJN T;  4GY5 A;  3KBG A;  5FLX E;  1WJQ A;  1VQ7 A;  2MWO A;  3H8Z A;  3OYN A;  3OYF A;  4BE1 A;  3CCM A;  2X4W A;  2HQX A;  2WAC A;  2NLU A;  3ME9 A;  4CRI A;  3G71 T;  3CEY A;  4C5E A;  4A4G A;  5C0M A;  1VQL T;  3G4S A;  3OYY A;  1XTD A;  1VQP A;  2XHC A;  3FDR A;  3LGL A;  3QBY A;  3H6Z A;  2GFU A;  1Q7Y C;  2XK0 A;  2EQK A;  2BIV A;  3MEA A;  1KHC A;  5J3B A;  1M1K U;  2JVV A;  3CCE T;  4IUP A;  3CPW S;  3PFS A;  2JOY A;  2QEX A;  2YRV A;  1WJR A;  2DO3 A;  1NJI C;  3BDL A;  3MO8 A;  3CC2 A;  5DLQ E;  3CCL T;  1VQK T;  4N4G A;  4IUV A;  2OTL T;  3MET A;  3S6W A;  4BDY A;  3F70 A;  3PIO A;  3G6E A;  4B9W A;  3TRE A;  3ZEH A;  3S3N A;  4YTL A;  3PMI A;  3CCV A;  2XDP A;  4QQG A;  2L3R A;  5J39 A;  2VYT A;  3A5Z B;  2EIF A;  2JNG A;  3OMG A;  4N4I A;  4OVA A;  1Q7Y U;  2LVM A;  3I56 A;  3MEW A;  1N8R U;  4Q5W A;  3O8V A;  2OTJ A;  3CC7 T;  1YIT T;  3MEU A;  3CC4 T;  3P8H A;  2MI6 A;  1QVG S;  2FHD A;  1NJI U;  4BDZ A;  1YHQ A;  2EQJ A;  3E9F A;  1SSF A;  2P0K A;  1RI0 A;  2LDM A;  4NS5 A;  2IG0 A;  1YIJ A;  1VQM T;  2LCL A;  1YJW T;  1Q86 C;  3CCR A;  3ASK A;  4A4H A;  4C5H A;  3L42 A;  3I55 T;  1VQO T;  3L2Q A;  4X34 A;  4II1 A;  3OYD A;  1VQ7 T;  4ZN3 A;  3PMT A;  3CCM T;  4E7L A;  4C5I A;  1NPP A;  3OYK A;  3CD6 A;  2B8A A;  3LGF A;  1XNI A;  1VQ8 A;  3G4S T;  1VQP T;  2EQU A;  1YBY A;  2LCC A;  3OYH A;  1K73 C;  3E9G A;  2RJC A;  4IKF A;  3GOX A;  2G3R A;  2JZ2 A;  3QKJ A;  3CCQ A;  1OI1 A;  2O4X B;  2X4X A;  2L89 A;  1Q86 U;  3KUF A;  3J81 E;  2QQR A;  3CCS A;  3L2V A;  1H3Z A;  3EAE A;  1JJ2 A;  2QEX T;  3MP6 A;  2QQS A;  5A2Q E;  4UC4 A;  2RHX A;  3CC2 T;  1K8A C;  2QA4 A;  2KDS A;  3OS1 A;  3CMA A;  1Q82 C;  1WJS A;  3P8B B;  1N27 A;  3OYG A;  1QVG A;  3G6E T;  1VQ5 A;  3SD4 A;  3DB4 A;  2EKO A;  5KCO A;  3CCV T;  4A4F A;  3FC3 A;  3NTI A;  1QVF A;  2M16 A;  4PLL A;  3OYL A;  2RJD A;  3LH0 A;  3DLL A;  1VQ4 A;  3MP1 A;  3C4S A;  3OYE A;  3I56 T;  3LLR A;  3S3M A;  5KH6 A;  2RI5 A;  5IT9 E;  3CME A;  2OTJ T;  1OZ2 A;  2X4Y A;  3CCU A;  4QQD A;  1YJ9 A;  2D9T A;  1JJ2 S;  2R57 A;  5DM7 R;  2LQ8 A;  3Q1J A;  1VQ6 A;  5FRM A;  1YHQ T;  1K8A U;  1YIJ T;  1Q82 U;  3UT1 A;  2X35 A;  3FLG A;  3CCR T;  3MEV A;  2EQM A;  1VQN A;  1YI2 A;  4N4H A;  5D6X A;  4E7I A;  5FRN A;  1Q81 C;  4BD3 A;  4E7J A;  3OYB A;  2F5K A;  1QVF S;  2LTO A;  4RG2 A;  4C5G A;  4ZTF A;  3NTH A;  5C6S A;  3OW2 A;  2R5M A;  3CD6 T;  2RO0 A;  4EDU A;  1UEB A;  2DIG A;  4ZTJ A;  2RJF A;  1VQ8 T;  1KQS A;  3CCJ A;  3OB9 A;  3DLM A;  5J26 A;  3NTK A;  1WGS A;  2BKD N;  5KE3 A;  2M1H A;  4TVR A;  3CCQ T;  4ZN1 A;  2DIQ A;  1NPR A;  2E6Z A;  1OZ3 A;  3OY9 A;  5KCH A;  4IUT A;  3QII A;  3CCS T;  1VQ9 A;  3PIP A;  2BUD A;  1MHN A;  3CPF A;  2K3X A;  2KVQ G;  4E7H A;  2RJE A;  3JAM E;  5D6W A;  2E70 A;  2QA4 T;  4HCZ A;  3OW2 S;  3CMA T;  4PL6 A;  2JTF A;  3QJ6 A;  1VQ5 T;  2GFA A;  1S72 A;  3LYI A;  1YJN A;  4FL6 A;  1KQS S;  3OYI A;  3L2U A;  3PNW C;  4BE0 A;  3HKS A;  2MWP A;  2DAQ A;  2RHY A;  1VQ4 T;  4B9X A;  3G71 A;  4IUQ A;  1M90 C;  1VQL A;  1EIF A;  4QW2 A;  4BE2 A;  2GF7 A;  3CME T;  1K73 U;  1IZ6 A;  3OYJ A;  3CCU T;  1N8R C;  2RI2 A;  3J7A F;  4IUU A;  1YJ9 T;  1KD1 C;  3CXC A;  3OA6 A;  2JUF A;  2E6N A;  1VQ6 T;  4A4E A;  1W2B A;  1G5V A;  2RHZ A;  2LRQ A;  3CCE A;  1KHI A;  1VQN T;  1M1G A;  1YI2 T;  5M9O A;  2RI3 A;  2HQE A;  3J80 E;  4PLI A;  1KC8 C;  2R5A A;  4BAC A;  3L2R A;  2RHU A;  4QQ6 A;  5KE2 A;  3CCL A;  4QVZ A;  1VQK A;  1NZ9 A;  3MP8 A;  3OYA A;  5IAY A;  2OTL A;  1K9M C;  4E7K A;  2K3Y A;  1M90 U;  3CCJ T;  5CIU A;  2L8D A;  1KD1 U;  3FEO A;  3CXC S;  1BKB A;  3ER0 A;  1W2B S;  5D6Y A;  3OYM A;  4LD6 A;  2M0O A;  2O4X A;  3P8D A;  5HY6 A;  2EFI A;  2E5Q A;  5IN1 A;  4IUR A;  2RHI A;  3CC7 A;  1YIT A;  1VQ9 T;  3OYC A;  3L2W A;  5FRO A;  3CC4 A;  2CKK A;  4FU6 A;  3DB3 A;  4Z02 A;  1KC8 U;  3OQ5 A;  1OYX A;  3LX7 A;  3M9Q A;  3OS0 A; 
#chains in the Genus database with same CATH topology
 1R8O B;  2R58 A;  3AT1 B;  1K9M U;  1YP5 A;  1M1K C;  2DLP A;  4GLK A;  5LL6 S;  2KE9 A;  2PQW A;  4OMP A;  2EGA A;  3CCS Q;  1VIF A;  1U5S A;  1YJN T;  1ABQ A;  4FW2 A;  1WPY A;  1FWZ A;  3OYF A;  2QTV A;  2NYS A;  1G8X A;  2WAC A;  1RAB B;  3ME9 A;  3GPL A;  1KQ2 A;  5FW9 A;  2LZ6 B;  1GCP A;  4CC3 A;  2QEX Q;  2XG8 D;  1VQL T;  2COY A;  3OYY A;  2KGT A;  3EFS A;  3FDR A;  5IHI A;  3GNF B;  3LGL A;  4FYY B;  4A53 A;  2K5I A;  4M7D F;  3H6Z A;  4JUV A;  2BIV A;  1VQ4 Q;  1CSK A;  3TCJ A;  2DRK A;  1Q82 R;  1T0H A;  5J3B A;  1BI3 A;  2LJ0 A;  2AKK A;  3UF4 A;  3T9N A;  1M3B A;  1WXB A;  3PFS A;  5LJ5 f;  2XID A;  3R6N A;  1OU9 A;  1NJI C;  1UG1 A;  3BDL A;  3CC2 A;  4N4G A;  2NUZ A;  3QZ9 B;  4BDY A;  3F70 A;  3QUI A;  3HP9 A;  3S3N A;  1K76 A;  2BE9 B;  2XDP A;  2DEU A;  6AT1 B;  4QQG A;  2L3R A;  3OW2 P;  2F2V A;  3JCM Q;  1H3H A;  2VYT A;  2LJ1 A;  2JNG A;  3OMG A;  2MMP A;  1YWP A;  3M58 A;  3I56 A;  3V7C A;  5ECA A;  1X2Q A;  1TXQ A;  1XOV A;  2JS2 A;  3CCJ Q;  3CC7 T;  1YIT T;  2JT4 A;  1TU0 B;  4C0F A;  2DMO A;  2FHD A;  1SHF A;  1JRI A;  1QVG S;  4XQ3 A;  2P0K A;  4M7A A;  1RI0 A;  2LDM A;  2V8I A;  1VQM T;  1BB9 A;  4OMQ A;  3REA B;  3JB9 D;  3JV3 A;  2PUK B;  2JW4 A;  4HT8 A;  4A4H A;  1WXU A;  3I55 T;  1VQO T;  4JLG A;  5IH2 A;  3V7S A;  1R0B G;  2D0Q B;  2A0F B;  5FU7 B;  3AHU A;  1WLP B;  3OYK A;  3M4G A;  2DX1 A;  3LGF A;  4BY6 B;  3IQL A;  3M55 A;  3G4S T;  3JSC A;  3M0R A;  1K73 R;  2KK4 A;  2Y90 A;  1S72 Q;  2J06 A;  5GAN d;  5GAN 4;  3EGX A;  1QWF A;  5GJW B;  3HRS A;  1UUE A;  2LP5 A;  4M7A E;  2JZ2 A;  4J6X A;  1WIE A;  1QVP A;  4FW1 A;  1OI1 A;  4KBM B;  2JTE A;  2A08 A;  5KYX A;  1LCK A;  4J9H A;  3REB B;  3EG2 A;  3MP6 A;  4BB7 A;  2QQS A;  2EJF A;  4UC4 A;  4MZP A;  1JO8 A;  1K8A C;  2QA4 A;  3A8M B;  3VYG A;  1Q82 C;  1SRM A;  1N27 A;  4OB3 B;  1M90 R;  3OYG A;  1RAD B;  1YJ9 Q;  3G6E T;  1V76 A;  1OEB A;  1VQ5 A;  3CCE Q;  2VVK A;  3SD4 A;  1W1F A;  2EKO A;  3JCM V;  4XTW A;  3VKI A;  1VQ6 Q;  3FC3 A;  3NTI A;  1M8V A;  1QVF A;  2M16 A;  2QG9 B;  4PLL A;  2RJD A;  3HHT B;  2JMC A;  3HPW A;  3OYE A;  1OX8 A;  1D1B A;  1TTH B;  2OTL Q;  1HD3 A;  3JCM d;  2DL3 A;  4GLM A;  5KH6 A;  3E19 A;  3VS1 A;  5IT9 E;  3A8H B;  3CME A;  3RIR A;  3SWN C;  1OZ2 A;  2F1L A;  4QQD A;  2D9T A;  2RPN A;  1B3Q A;  2LQ8 A;  4J9D A;  4MMK A;  5I21 A;  5GAN g;  5AT1 B;  3EH1 A;  2ED1 A;  4ME7 A;  5L23 A;  1JU5 C;  2RMO A;  2KT8 A;  3EG9 A;  1YIJ T;  3RKW A;  1ZSZ C;  2JTM A;  2AIR B;  2YRD A;  3FLG A;  3CCR T;  1AEY A;  4M4Z A;  1N9S A;  2HSE B;  3EGD A;  1VQN A;  2DET A;  2X3X D;  5KYW A;  2COZ A;  1N9R A;  3MKD A;  2C0T A;  2KNB B;  4XTV A;  4C5G A;  4ZTF A;  5C6S A;  1MMA A;  4PFO A;  2RO0 A;  2DKG A;  1YJW Q;  4EDU A;  1SRL A;  2DRM A;  1UEB A;  2DE0 X;  4KUD K;  1K0S A;  1FMV A;  4QVD A;  1KQS A;  3OB9 A;  4BI8 B;  3M0Q A;  3H41 A;  1VQ7 Q;  1BBZ A;  3SB2 A;  1GFC A;  1VYT A;  4ZGD B;  3M0S A;  2H8H A;  1YJN Q;  2L3Q A;  1AT1 B;  4E47 A;  2HQH A;  4LDX A;  3CCS T;  4V2S A;  4GBQ A;  3A8L B;  1OPK A;  1KQ1 A;  4RUG A;  2F5T X;  2EYQ A;  4KGZ B;  5LJ5 h;  1UGV A;  4KUL A;  4M77 A;  1SEM A;  4QVC A;  2DZC A;  5LJ3 d;  3I9Q A;  2E70 A;  2KRS A;  4Z88 A;  4M7A B;  4J5Y A;  2YRC A;  3CMA T;  4ANJ A;  1QVG P;  3HL8 A;  2GFA A;  4KH1 B;  3MCA B;  4JJN K;  1KG1 A;  3INZ A;  4FSS A;  3PNW C;  4AT1 B;  2D8H A;  4BE0 A;  4XTX A;  4PFP A;  4J9F A;  4JRP A;  2RHY A;  5DLO A;  2CP7 A;  4J9G A;  1VQ4 T;  1ZUK A;  3G71 A;  4J7I A;  1JXM A;  4JRI A;  1M90 C;  3SDZ A;  5LJ5 e;  3E2U A;  2RQU A;  1JBM A;  1IZ6 A;  3JRZ A;  3RES A;  5IXF A;  3CCV Q;  1VIE A;  3VRZ A;  3EGX B;  3HTR A;  3UA6 A;  1KD1 C;  2X9H A;  3CXC A;  1I8F A;  3HSB A;  2JUF A;  4E2F B;  4AFS C;  2ZPB B;  2HCK A;  3G7Z A;  1IGU A;  2W0Z A;  3X24 B;  3HFN A;  4JRQ A;  2VAS A;  2PNI A;  1ZSZ A;  4FYW B;  1SKU B;  1Y71 A;  3THK A;  2DBK A;  3RR6 A;  5KYX B;  1G83 A;  2EYX A;  2PVO B;  1MV3 A;  4DOV A;  1YI2 T;  2O31 A;  2HQE A;  1CKB A;  1KC8 C;  4QQ6 A;  4KRT A;  2VB6 A;  5GAO n;  2HL5 C;  5CKF A;  1NZ9 A;  3OYA A;  3RER A;  2RN8 A;  4M75 C;  2K3Y A;  1V29 B;  5LJ3 g;  1YIT Q;  1X01 A;  2YT6 A;  3HRU A;  3X26 B;  2E12 A;  3CCJ T;  1BIA A;  1QCO A;  4XK8 E;  1WNL A;  1KSW A;  2EW3 A;  3PVQ A;  1BU1 A;  4L6V 5;  4PJO G;  3ER0 A;  5D6Y A;  2LT1 A;  2M0O A;  2O4X A;  1Q86 R;  3EFR A;  2JM8 A;  1K1Z A;  3QO3 A;  4XU3 A;  4IUR A;  1M2O A;  3QHS A;  3L2W A;  5FRO A;  4R55 A;  2CKK A;  1YCY A;  3DB3 A;  2LX9 A;  3BE3 A;  2DL5 A;  5CQX A;  2V8K A;  3M9Q A;  4JJB A;  3WVD B;  4C8Q C;  3EG9 B;  3OMC A;  2IIM A;  1Q81 U;  2SRC A;  3UWN A;  4M78 G;  5CR2 A;  3CPW A;  1RL2 A;  3EGD B;  1S72 T;  3JCM b;  2DPP B;  4FYX B;  5KYW B;  2JN0 A;  5IHN A;  1T3S A;  4KGX B;  3CQT A;  3CCM A;  5GAO r;  4C92 C;  5LJ5 j;  4FM4 B;  8ATC B;  2E3H A;  3TVT A;  3CEY A;  3UAT A;  3M0U A;  2P4T A;  4HCC A;  4QT7 A;  2FB7 A;  2K57 A;  1PHT A;  2AT1 B;  3VS4 A;  1VQP A;  1SF9 A;  3TQ7 P;  3QBY A;  1T3L A;  2XK0 A;  2KT1 A;  4D8D A;  3M0P A;  3G6E Q;  2CGH A;  2KYB A;  1VYU A;  1Y96 A;  3SEM A;  2LNH B;  2VGN A;  2FPE A;  4RKU E;  3CCE T;  4IUP A;  1NJI R;  4PJN A;  2JOY A;  2QEX A;  2YRV A;  2QQ9 A;  3BFM A;  2P4R A;  2ZCF B;  4J6Y A;  2MF2 A;  5GAM d;  2OTL T;  5AYF A;  4M75 A;  2CS7 A;  3JCM P;  3TRE A;  3ZEH A;  4YTL A;  1IGQ A;  5L8R E;  3A5Z B;  4DBR A;  3EG0 A;  2OAW A;  1Q7Y U;  2K9G A;  4RTZ A;  2EYY A;  2LT4 A;  2AHJ B;  4RTV A;  2GTO A;  3MEW A;  2OI3 A;  4HVU A;  4F7U A;  5GAN h;  2DYB A;  1E6G A;  4HT9 A;  3SWN B;  3JB9 H;  5EC7 A;  4D8K A;  2NUT B;  2CZ7 B;  2K4Y A;  2YUQ A;  4ZGJ B;  4BDZ A;  5CK9 A;  3E9F A;  1UHC A;  2IG0 A;  5CAI A;  2E10 A;  4NL2 A;  4M75 E;  1WHH A;  4C8Q A;  1YJW T;  1Q86 C;  2P0Q A;  3VUZ A;  3QSU A;  1ZSZ B;  4E6R A;  1IXD A;  5GAN 2;  2GCX A;  4FIB A;  4C5H A;  1VQ9 Q;  3L2Q A;  1ZUY A;  4X34 A;  4DEX A;  4ORZ A;  1VQ7 T;  4PJJ A;  2J6K A;  2P0P A;  4PJO D;  2ROT A;  2I0N A;  1GBQ A;  3H9N A;  3M54 A;  1QP2 A;  5GAN e;  2C0O A;  3FB9 A;  4FSX A;  3CD6 A;  3PT9 A;  4C92 A;  4XTZ A;  3URG A;  1BK2 A;  2HBP A;  5GMK m;  4F7U E;  1M30 A;  1VQ8 A;  1PNJ A;  2BTT A;  5GAM g;  4LXC A;  1IRX A;  2X3W D;  4P5N A;  5I2M A;  1K0X A;  5FWC A;  1NLO C;  3E9G A;  3CMA Q;  2EVR A;  4VUB A;  4J9E A;  3GOX A;  2DD5 A;  2G3R A;  1TUG B;  3CCQ A;  2JMA A;  4C8Q E;  3JCM J;  2O4X B;  4M78 D;  1N6A A;  3VS3 A;  1GCQ C;  1K8A R;  2HL3 A;  1B07 A;  5A2Q E;  2OX7 A;  2H3E B;  4JJD A;  1UTI A;  2KDS A;  4EMH A;  1MUZ A;  3EH2 A;  4C92 E;  2EPD A;  1WJS A;  3P8B B;  1UEC A;  2FPF A;  4BI4 A;  3V8K A;  1GL5 A;  3FIF A;  3D7S B;  2E41 A;  1AHJ B;  3DB4 A;  4M7D G;  2HAX A;  2ESW A;  3VS6 A;  3X28 B;  2DXT A;  3CCV T;  4C0G A;  4MDX A;  4LUE A;  1Z9Q A;  3L2Z A;  3VJP A;  1LJO A;  3LH0 A;  3CCL Q;  1M1F A;  3MP1 A;  1WHG A;  1UGP B;  3LLR A;  5GJV B;  1YI2 Q;  2RI5 A;  2QDL A;  4M77 F;  2DJZ A;  2GQI A;  1QMC A;  2OTJ T;  2DXC A;  2V8J A;  3CCU A;  1YJ9 A;  5DY9 A;  2BZX A;  1JJ2 S;  1IB8 A;  5DM7 R;  2CH4 W;  3Q1J A;  1VQ6 A;  1ZA2 B;  1YHQ T;  3CBP A;  2JM9 A;  3CBM A;  1MGQ A;  1M2V A;  1Y96 B;  2YLB A;  1K9M R;  3UT1 A;  1B34 A;  2CUD A;  2DFU A;  1RI9 A;  2DER A;  1F1B B;  2DVJ A;  4CC7 A;  4N4H A;  4E7I A;  2BE7 D;  1Q81 C;  2ZPG B;  1BCM A;  3CC4 Q;  1KJW A;  2EQI A;  2QDY B;  3OYB A;  7AT1 B;  1NG2 A;  2DXU A;  3NTH A;  3OW2 A;  3VS7 A;  3PE0 A;  2W10 A;  2R5M A;  3HRT A;  2LCS A;  2PUO B;  4M75 B;  2DIG A;  4DA4 A;  2QI2 A;  1WHM A;  2RJF A;  2RQW A;  3ZBD A;  1EZZ B;  1YWO A;  4FT4 A;  1WQW A;  3NTK A;  5J26 A;  1TG0 A;  2KRM A;  1WA7 A;  3TSZ A;  4CC2 A;  2BKD N;  2EAY A;  1JEG A;  1PG5 B;  3VS2 A;  2ECZ A;  4TVR A;  2KI7 A;  1R77 A;  2DIQ A;  1NPR A;  1OZ3 A;  1G2B A;  1WXT A;  2RA2 A;  4IUT A;  4F7U B;  2BZY A;  3PIP A;  2BUD A;  2RM4 A;  3CPF A;  2K3X A;  1GCQ A;  3WVE B;  4E7H A;  2DJQ A;  1E6H A;  4X1V A;  1HSQ A;  1SPK A;  3RBB B;  1M5Q 1;  1QQJ A;  3H0H A;  2CZ1 B;  2JTF A;  4C8Q B;  4KH0 B;  3QJ6 A;  2HNI A;  1YJN A;  5A0L A;  3L2U A;  5CVI A;  1OU8 A;  3X20 B;  2MWP A;  4FYV B;  4F14 A;  2DAQ A;  1OQK A;  2CDT A;  2F2X A;  4LN2 A;  4DBH A;  3CC2 Q;  2ZPE B;  2DM1 A;  3C12 A;  4B9X A;  4IUQ A;  4C92 B;  1NM7 A;  2VC8 A;  2KXD A;  3V8L A;  2KQW A;  2YXY A;  2LX7 A;  4BE2 A;  1EIF A;  2DIL A;  1VQL A;  2GF7 A;  1KD1 R;  4LD9 K;  2CZ0 B;  2O9S A;  5EG2 A;  5KYY A;  3OYJ A;  3OBY A;  2RK1 A;  2K5L A;  3EHQ A;  1WHK A;  4JPB W;  3OBW A;  1YNZ A;  1KIK A;  1PKT A;  1R0C B;  1JB0 E;  3I56 Q;  2RHZ A;  2ENM A;  2ROL A;  3JCM W;  3UPU A;  5KYU A;  3JB9 J;  2P84 A;  1RLP C;  1KHI A;  1KC8 R;  1ZBX A;  4M7D D;  4E7S A;  4HVV A;  4IIO A;  2RI3 A;  3J80 E;  3HFO A;  4AFU C;  3L2R A;  2EJ9 A;  1G3T A;  1FMW A;  2DXB A;  4XTU A;  5IAY A;  1K9M C;  2HSP A;  1KFZ A;  4EIK A;  1UGS B;  3VV0 A;  4XAX B;  2CYZ B;  5IXB A;  1PC0 A;  2VKN A;  4J83 A;  3VU3 C;  1Y0M A;  1W2B S;  3OYM A;  1X43 A;  3H0F A;  2K5F A;  5HY6 A;  4WCI A;  5HCK A;  4M77 D;  3VUB A;  2E5Q A;  4JJC A;  2RHI A;  3CC7 A;  1YIT A;  3OYC A;  1VQ9 T;  1G3W A;  1N5Z A;  2KY9 A;  1PCX A;  4FU6 A;  1RAH B;  1I07 A;  4Z02 A;  1ZSG A;  2EGC A;  2X4J A;  4M75 F;  5GAN f;  2KMT A;  3KXT A;  3LX7 A;  1M2V B;  3NPF A;  1VQM A;  4Y28 E;  3JCM g;  3I5S A;  1JJ2 P;  1EFN A;  3S3O A;  1B34 B;  4L59 A;  1M27 C;  1X6O A;  1C1A A;  3I55 A;  1VQO A;  3M56 A;  3JCM X;  4F7U F;  2QGF B;  4KT0 E;  2HQX A;  3RKY A;  2NLU A;  2D0N A;  1YFN A;  2YWW A;  5C0M A;  1PKS A;  3G4S A;  1DJ7 B;  2NWM A;  1XTD A;  4HCK A;  2CP6 A;  2ED0 A;  2VV5 A;  2XHC A;  4ESR A;  1B7T A;  4C8Q F;  1J3T A;  2EWN A;  4OMM A;  2AZS A;  2KRN A;  5GAN 6;  2EQK A;  3MEA A;  4DEY A;  1RAC B;  3SWN A;  4XU0 A;  1M1K U;  2JVV A;  2FL7 A;  2NUT A;  3CME Q;  2CRE A;  1WJR A;  3MHX A;  2DO3 A;  2QTX A;  1OX9 A;  1M3C A;  3CCL T;  1H64 1;  1VQK T;  2K79 A;  1WQ7 A;  1JXO A;  4OP0 A;  4HXJ A;  4IUV A;  1KK7 A;  3MET A;  3S6W A;  2OTJ Q;  3TSW A;  1VUB A;  5GAN 3;  1IHV A;  3PIO A;  3G6E A;  1ABO A;  1W4S A;  3BY7 A;  3PMI A;  4Y91 A;  2H3J A;  3L1A A;  1YHQ Q;  3RNJ A;  2G6F X;  5J39 A;  2HBW A;  4LDY A;  1SHG A;  2EIF A;  4FCY A;  1D09 B;  4N0A C;  2HKQ B;  3EG1 A;  4OVA A;  1W6X A;  2LVM A;  4XTY A;  3BW1 A;  1A0N B;  1PD1 A;  1N8R U;  2ZPH B;  4Q5W A;  3O8V A;  4K11 A;  5KYY B;  3CC4 T;  4JZ3 A;  2MI6 A;  4C0Z A;  1AWX A;  5D7U A;  1NJI U;  4L5G A;  2DTO A;  4OB0 B;  2J05 A;  1PD0 A;  1YIJ A;  2ZZD A;  4MZT A;  2LCL A;  1QLY A;  3M5A A;  2GGR A;  2CH4 A;  5KYU B;  3CCR A;  2RQR A;  1NLP C;  1ZQ1 A;  1AWJ A;  4II1 A;  4KUI A;  4RCC A;  4AFQ C;  4BI3 A;  4F17 A;  3GBQ A;  3QDR B;  4C5I A;  1NPP A;  2VUB A;  2MIO A;  5IHK A;  2A3L A;  5LJ3 f;  4MDW A;  2NUP A;  2YUN A;  1ZBJ A;  4Z8A A;  2DNU A;  2V1Q A;  3VRY A;  2VXF A;  1NEB A;  2KRO A;  4MML A;  2EQU A;  2LCC A;  1VOM A;  2EYZ A;  1EX4 A;  2K2V A;  2XDB A;  5I22 A;  1T0J A;  3G71 Q;  2DEQ A;  4EMK C;  3QYH B;  1QKW A;  4M7A F;  5GAO m;  1RLQ C;  3J81 E;  1RAE B;  3CCS A;  2KYM A;  4RTY A;  4DBF A;  1H3Z A;  3O5Z A;  4KGV B;  3EAE A;  1W2B P;  1D3B A;  2FZK B;  1ACM B;  1QWE A;  4HCB A;  5HKC A;  3CC2 T;  2LMJ A;  4RTU A;  3QWX X;  3V8J A;  1MMN A;  3QYG B;  3CMA A;  4M7A G;  1UJ0 A;  2ZPF B;  1PRL C;  3RUX A;  2QAS A;  2M9U A;  1JQQ A;  1WX6 A;  4A4F A;  2E1H A;  4PJO C;  2K6D A;  3ZL7 C;  1M8M A;  4N0A A;  1VQ4 A;  4HKE A;  5CQY A;  3I56 T;  2Y4X A;  4O5V A;  3S3M A;  5LJ5 d;  3SFM A;  2DTI A;  2L2P A;  4LDV A;  2X4Y A;  3GP8 A;  5GMK h;  2RQT A;  2DL7 A;  2XIC A;  1K8A U;  2A7Y A;  4M78 C;  1WHL A;  2M51 A;  1Q81 R;  1X6G A;  1Y57 A;  1Q82 U;  2RQV A;  2QXF A;  3MEV A;  2MAM A;  1YI2 A;  5FRN A;  1AD5 A;  3WXM B;  4R56 A;  9ATC B;  2PVD B;  2D8J A;  4E7J A;  1E7O A;  2EKH A;  2FYK A;  2VGM A;  1QVF S;  2FG0 A;  1WZO A;  4RG2 A;  4ZNX A;  5GMK e;  3I5R A;  1K9A A;  4J8O A;  3CCJ A;  3U23 A;  3DLM A;  2E3I A;  4HVW A;  1M3A A;  3GNG A;  4A63 B;  1H8K A;  3M53 A;  1HK9 A;  3CCM Q;  5KE3 A;  2M1H A;  4PJM A;  4Z89 A;  2DK3 A;  3OY9 A;  4EMK A;  5CCA A;  3QII A;  4LDU A;  4X9C A;  5LJ5 g;  3R6O A;  1VQP Q;  2B86 A;  1MHN A;  1YCS B;  2KVQ G;  3JCM h;  2AZV A;  1ZUU A;  2M0Y A;  3JAM E;  2QA4 T;  4HCZ A;  2PU9 B;  2HD0 A;  2FZG B;  2GQV A;  1K4U S;  1OPL A;  2FZC B;  2D6F A;  1VQ5 T;  1S72 A;  4FL6 A;  1KQS S;  3OYI A;  1X75 C;  1ARK A;  2L3P A;  1AOJ A;  4JRK A;  4PJO A;  2Z0W A;  4J6W A;  2L5Q A;  3A1P A;  1Q7Y R;  4OGC A;  2GTJ A;  1SSH A;  1YN8 A;  2A28 A;  1NYG A;  2HMA A;  3JCM e;  2NUP B;  5GAM f;  3CME T;  2WSF E;  1K73 U;  1ZHI A;  1U3O A;  2FVU A;  1N8R C;  1AZG B;  1VQK Q;  3NHN A;  3M57 A;  4OF1 A;  2E6N A;  4LDW A;  4A4E A;  1G5V A;  4AMC A;  3ZFJ A;  2J7I A;  4M7A D;  4M78 A;  2SEM A;  4QKU A;  3CCE A;  1GRI A;  5CO7 A;  1M1G A;  5M9O A;  1VQN T;  4D6W A;  2LC4 A;  4DBQ A;  1D3B B;  4BAC A;  4PJO E;  1TUD A;  1BIB A;  1TWB A;  2RHU A;  2DZ9 A;  1I81 A;  4QVZ A;  5HK3 A;  5GMK j;  4M77 G;  1SG5 A;  3MP8 A;  2O01 E;  2KEA A;  2OTL A;  3EFO A;  1M90 U;  2RK2 A;  5GMK l;  3QG1 A;  5GAN j;  5LJ3 h;  4CC4 B;  5CIU A;  2L8D A;  1C0M A;  1KD1 U;  3CXC S;  1BCO A;  3H0I A;  3LW5 E;  4PKC C;  3RMS A;  4M78 E;  1Y07 A;  3CD6 Q;  1RAF B;  1WDX A;  2RF0 A;  2CUB A;  3NGP A;  2M02 A;  4J9C A;  2J6F A;  4ELY C;  2XMF A;  3EHR A;  5IN1 A;  1VQ8 Q;  1MMD A;  1FYN A;  3M4Y A;  1PWT A;  2CP0 A;  1MNE A;  1KC8 U;  5CKE A;  1I4K 1;  2OJ2 A;  3OQ5 A;  3VS5 A;  1UB4 A;  1OYX A;  1NE8 A;  1XQH A;  1AVZ C;  2V26 A;  3M0T A;  1TUC A;  3CCQ Q;  5LJ3 e;  1YJW A;  3OS2 A;  2E5K A;  4M7D C;  2L0A A;  1V1C A;  2ZPI B;  2CZ6 B;  2YDL A;  2DYI A;  1GXI E;  1G3Y A;  4GY5 A;  3KBG A;  2ABL A;  5FLX E;  1WJQ A;  3BDU A;  3QXE B;  1VQ7 A;  2MWO A;  3VS0 A;  1LOJ A;  3H8Z A;  2HEQ A;  3OYN A;  1VYV A;  4BE1 A;  2K7A A;  4LNP A;  2F2W A;  2MCN A;  4OB2 B;  2PZ1 A;  2X4W A;  1BI2 A;  1O9S A;  1MV0 B;  4CRI A;  3G71 T;  4Y92 A;  4C5E A;  2QQB A;  2A37 A;  1CKA A;  4A4G A;  3PVL A;  1QVF P;  1ZX6 A;  1IRE B;  1U06 A;  2CT3 A;  1BI0 A;  2GFU A;  3GLX A;  1Q7Y C;  2YSQ A;  1LNX A;  4M77 C;  4AFZ C;  1KHC A;  4EMK B;  1AZE A;  1FXX A;  3CPW S;  1D0Y A;  2O9V A;  3CCU Q;  2QAZ A;  3MO8 A;  4RMO A;  2EJG A;  5DLQ E;  4OMO A;  2XKO C;  1RAI B;  2LQN A;  4C0D C;  1UFF A;  1WYX A;  3OS5 A;  1Z9Z A;  5FU6 C;  4B9W A;  3V7R A;  4LUD A;  2AKL A;  2HKN A;  3TEE A;  1VA7 A;  3N5B B;  3CCV A;  2YUP A;  3UDC A;  1M4Z A;  2YLC A;  1HYO A;  1U1T A;  4PJO B;  2JXB A;  2CP3 A;  2KBT A;  3GF5 A;  4N4I A;  1M9S A;  2XU8 A;  2DA9 A;  1KQS P;  1X2K A;  3QZ5 B;  2OTJ A;  2O88 A;  4EPC A;  4E7Z A;  3MEU A;  1AWW A;  3P8H A;  2CP2 A;  5LJ3 j;  4A54 A;  1YHQ A;  1Q95 G;  2EQJ A;  1SSF A;  2QQA A;  3QJY A;  4NS5 A;  4XU2 A;  4M78 B;  2J6O A;  4M7D A;  1D1C A;  3ASK A;  4JS4 A;  1QP3 A;  1TH7 A;  1U1S A;  3L42 A;  5CKH A;  2I2L A;  3OSV A;  1FX7 A;  3OYD A;  1RAG B;  3A98 A;  3PMT A;  4F16 A;  4ZN3 A;  4NOY A;  2A36 A;  3CCM T;  4E7L A;  1D1A A;  2DTH A;  4XU1 A;  4A4K A;  2MPX C;  3EFO B;  1X6B A;  2B8A A;  4ZGE B;  1XNI A;  2MOX A;  4OMF B;  1Y7X A;  4M75 G;  4CI0 C;  1VQP T;  2WSE E;  5GAN 5;  2EGE A;  1S1N A;  2QA4 Q;  5GAM h;  4WF2 A;  1YBY A;  3OYH A;  1K73 C;  2RJC A;  2EBP A;  4IKF A;  4FT2 A;  2C06 A;  1I5L A;  4RCB A;  2WSC E;  2O2O A;  1W70 A;  3QKJ A;  1C6V X;  3RDV A;  1VQ5 Q;  4PNO A;  1UGQ B;  2ZGW A;  2X4X A;  2L89 A;  1Q86 U;  4M7D E;  3KUF A;  1VQL Q;  2LQK A;  2QQR A;  1QW1 A;  4DOW A;  2COW A;  3CXC P;  3L2V A;  3QWY A;  3UA7 A;  1D0X A;  4F7U G;  1JJ2 A;  2QEX T;  2C0I A;  4AG1 C;  2D1X A;  2XDD A;  2RHX A;  4AG2 C;  1PRM C;  2XD0 A;  3OS1 A;  3PTA A;  3JCM f;  4EMG A;  5GAM e;  2X51 A;  4C92 F;  4C8Q G;  1QVG A;  4RTT A;  4NL3 A;  2KSS A;  5KYN A;  5KCO A;  3LH5 A;  4RTW A;  3M59 A;  3FJP A;  3CBO A;  2FO0 A;  2DBM A;  2KR3 A;  4PJL A;  5GAN 8;  3OYL A;  3RKX A;  5HK0 A;  3DLL A;  2FPD A;  3C4S A;  4M77 E;  1VQN Q;  4PK4 A;  4R0K A;  4C92 G;  2DL8 A;  3ULR B;  4RG8 A;  1P92 A;  2PVG B;  2KAF A;  3PGG A;  2R57 A;  1ZLM A;  1O75 A;  5FRM A;  2DL4 A;  1OUL A;  1ZA1 B;  4J7F A;  2GNC A;  1FMK A;  3C0C A;  2AK5 A;  2LNV A;  2OAU A;  2RD1 A;  1XJW B;  5GMK i;  2GBQ A;  3JCM c;  1PM3 A;  2X35 A;  4PJO F;  4OML A;  3EGU A;  2LJ3 A;  3DKM A;  1QCN A;  2EQM A;  3QDF A;  4O6J A;  2E64 A;  5D6X A;  3GIB A;  3CC7 Q;  1WI7 A;  4BD3 A;  1LVK A;  1NEG A;  2F5K A;  1WFW A;  4J9I A;  2CSQ A;  5FU7 C;  1IHW A;  2LTO A;  3QPH A;  3CPW P;  3VYH B;  4BY6 C;  3CD6 T;  1VQM Q;  1UGR B;  2VXE A;  1RAA B;  4ZTJ A;  1OV3 A;  1VQ8 T;  5GAO q;  1I5O B;  1TS9 A;  4PFZ A;  1G3S A;  2RB6 A;  3I55 Q;  1VQO Q;  2PTK A;  1GFD A;  2CSI A;  3EG3 A;  1HXD A;  4M78 F;  3X25 B;  3A8O B;  1WGS A;  2K3B A;  4IIM A;  3NFC A;  1I0C A;  1X69 A;  1H92 A;  2MK5 A;  3CCQ T;  4ZN1 A;  2JJ9 A;  2E6Z A;  1OOT A;  5KCH A;  1M1K R;  2CT4 A;  5GAN 7;  3C94 A;  3G4S Q;  1NYF A;  4BUG A;  1VQ9 A;  2DF6 A;  2IPO B;  1I1J A;  4OB1 B;  1WHJ A;  2QGG A;  4LE9 A;  2RJE A;  5D6W A;  5GAM j;  3JB9 I;  1BYM A;  3OW2 S;  4PL6 A;  1UE9 A;  2FRY A;  1NBE B;  4M7D B;  4JLI A;  1GBR A;  4M75 D;  2KXC A;  1IO6 A;  3LYI A;  3MPU B;  2RNA A;  5I11 A;  1LPL A;  4ELZ C;  5CKD A;  3HKS A;  3G1J A;  1AWO A;  2K2M A;  4HA8 A;  3LWI A;  2YHT A;  1PSE A;  2DVE A;  3KFV A;  5FWB A;  2DD4 A;  5CKB A;  4J9B A;  2CP5 A;  3FJ5 A;  1MMG A;  1N8R R;  4QW2 A;  2BZ8 A;  2E4H A;  1TSF A;  1PSF A;  2L3S A;  2Y4Y A;  1HJD A;  3CCU T;  2RI2 A;  4IUU A;  2FRW A;  3J7A F;  1UDL A;  2E65 A;  1YJ9 T;  1UHF A;  3OA6 A;  1RUW A;  4B6M A;  1VQ6 T;  1W2B A;  8AT1 B;  4F04 B;  4M77 B;  5A0G A;  4C8Q D;  2LRQ A;  3MJX A;  2RH2 A;  3JB9 F;  3TU4 K;  1QKX A;  3FRN A;  3A8G B;  2XI9 A;  2FEI A;  4PLI A;  5I2S A;  5GAO p;  2R5A A;  2LQW A;  4ATO A;  5A0D A;  2YUO A;  5KE2 A;  4JDS A;  3CCL A;  1VQK A;  3C95 A;  1YIJ Q;  1X27 A;  4JZ4 A;  3LWH A;  2V1R A;  4E7K A;  2ATC B;  4C92 D;  4DQ2 A;  3JB9 G;  4RTX A;  4C0D B;  1UJY A;  3CCR Q;  2QYZ A;  3OSS C;  5FU6 B;  1U8R A;  4OMN A;  4JS5 A;  4WTO B;  1BI1 A;  2VWF A;  3FEO A;  1BKB A;  3SHW A;  2ZAE A;  2HDA A;  2HZY A;  2MYS A;  4LD6 A;  2F69 A;  3P8D A;  1TOV A;  5GAO l;  2EFI A;  4OGE A;  1D0Z A;  4MZM A;  3RMQ A;  3E1S A;  3CC4 A;  2IVW A;  2QK0 A;  3I35 A;  4X9D A;  4M7A C;  2EYW A;  1MND A;  1QCF A;  2JS0 A;  3OS0 A;  3NMZ C; 
#chains in the Genus database with same CATH homology
 1R8O B;  1VQM A;  2R58 A;  3OMC A;  4Y28 E;  3JCM g;  3OS2 A;  1YJW A;  1K9M U;  4M7D C;  3S3O A;  1B34 B;  4L59 A;  1Q81 U;  3UWN A;  1M1K C;  4M78 G;  5CR2 A;  3CPW A;  4GLK A;  2ZPI B;  5LL6 S;  2CZ6 B;  2PQW A;  1RL2 A;  1VIF A;  1X6O A;  1S72 T;  3JCM b;  3I55 A;  1G3Y A;  2DPP B;  1VQO A;  1YJN T;  1GXI E;  4GY5 A;  3KBG A;  5FLX E;  1WJQ A;  3BDU A;  3QXE B;  1WPY A;  2JN0 A;  1VQ7 A;  2MWO A;  1LOJ A;  3M56 A;  1FWZ A;  3H8Z A;  3OYN A;  3OYF A;  4BE1 A;  3CCM A;  3JCM X;  4F7U F;  4OB2 B;  4KT0 E;  5GAO r;  2X4W A;  2HQX A;  2WAC A;  4C92 C;  1BI2 A;  1O9S A;  5LJ5 j;  4FM4 B;  3RKY A;  2NLU A;  3ME9 A;  3GPL A;  4CRI A;  3G71 T;  1KQ2 A;  3CEY A;  4C5E A;  2QQB A;  2P4T A;  4A4G A;  4HCC A;  5C0M A;  2XG8 D;  1VQL T;  3G4S A;  2FB7 A;  3OYY A;  1DJ7 B;  1XTD A;  2K57 A;  1VQP A;  2VV5 A;  2XHC A;  3EFS A;  3FDR A;  3GNF B;  3LGL A;  3QBY A;  4C8Q F;  1IRE B;  2EWN A;  1BI0 A;  4A53 A;  2K5I A;  4M7D F;  3H6Z A;  4JUV A;  5GAN 6;  2GFU A;  3GLX A;  2XK0 A;  1Q7Y C;  2EQK A;  2BIV A;  3MEA A;  1LNX A;  3TCJ A;  2CGH A;  1Y96 A;  4M77 C;  2VGN A;  1KHC A;  4EMK B;  3SWN A;  5J3B A;  1BI3 A;  4XU0 A;  1M1K U;  4RKU E;  2JVV A;  1FXX A;  2FL7 A;  3CCE T;  4IUP A;  3CPW S;  3T9N A;  3PFS A;  5LJ5 f;  2JOY A;  2QEX A;  2XID A;  2YRV A;  1WJR A;  3MHX A;  2QQ9 A;  2DO3 A;  3BFM A;  2QTX A;  3MO8 A;  3BDL A;  4RMO A;  1NJI C;  2EJG A;  3CC2 A;  5DLQ E;  3CCL T;  2ZCF B;  1H64 1;  2XKO C;  4J6Y A;  1VQK T;  2MF2 A;  1WQ7 A;  4N4G A;  4OP0 A;  4IUV A;  5GAM d;  3QZ9 B;  2OTL T;  3MET A;  3S6W A;  4C0D C;  5AYF A;  5GAN 3;  1VUB A;  3F70 A;  3OS5 A;  3QUI A;  4M75 A;  3PIO A;  2CS7 A;  3HP9 A;  3G6E A;  3JCM P;  5FU6 C;  1W4S A;  3V7R A;  3TRE A;  3ZEH A;  4B9W A;  4YTL A;  3S3N A;  3BY7 A;  3PMI A;  3TEE A;  2XDP A;  3N5B B;  4Y91 A;  3CCV A;  2H3J A;  3L1A A;  4QQG A;  2L3R A;  5J39 A;  3UDC A;  3JCM Q;  1M4Z A;  2YLC A;  4LDY A;  1U1T A;  2VYT A;  3A5Z B;  2EIF A;  2JNG A;  3OMG A;  3GF5 A;  2MMP A;  4N0A C;  5L8R E;  4PJO B;  4N4I A;  1M9S A;  2XU8 A;  4OVA A;  3M58 A;  1Q7Y U;  2LVM A;  3V7C A;  3I56 A;  2LT4 A;  2AHJ B;  4XTY A;  3BW1 A;  4BDY A;  3MEW A;  1XOV A;  1N8R U;  2ZPH B;  4Q5W A;  4F7U A;  3QZ5 B;  3O8V A;  5GAN h;  2OTJ A;  3CC7 T;  1YIT T;  4HT9 A;  4EPC A;  3SWN B;  3JB9 H;  3MEU A;  4C0F A;  3CC4 T;  3P8H A;  2MI6 A;  2FHD A;  4C0Z A;  1JRI A;  2CZ7 B;  2K4Y A;  5LJ3 j;  1QVG S;  1NJI U;  4A54 A;  4L5G A;  2DTO A;  4ZGJ B;  4BDZ A;  1YHQ A;  4XQ3 A;  4OB0 B;  5CK9 A;  2EQJ A;  1SSF A;  2QQA A;  2P0K A;  3E9F A;  4M7A A;  3QJY A;  1RI0 A;  2LDM A;  4NS5 A;  2IG0 A;  4XU2 A;  1YIJ A;  2ZZD A;  4MZT A;  5CAI A;  2E10 A;  2V8I A;  2LCL A;  4M75 E;  4M78 B;  4NL2 A;  4C8Q A;  1VQM T;  3M5A A;  3JB9 D;  1YJW T;  1Q86 C;  2P0Q A;  2PUK B;  3VUZ A;  4M7D A;  3CCR A;  3QSU A;  3ASK A;  4JS4 A;  4HT8 A;  5GAN 2;  2GCX A;  4A4H A;  1QP3 A;  4FIB A;  1TH7 A;  4C5H A;  1U1S A;  3L42 A;  3I55 T;  1VQO T;  4JLG A;  5CKH A;  1ZQ1 A;  3L2Q A;  2I2L A;  3OSV A;  4X34 A;  3V7S A;  4II1 A;  1FX7 A;  3OYD A;  4KUI A;  1VQ7 T;  4RCC A;  3PMT A;  4ZN3 A;  4BI3 A;  2P0P A;  2D0Q B;  4NOY A;  4PJO D;  3CCM T;  4E7L A;  3M54 A;  3QDR B;  4C5I A;  1QP2 A;  5FU7 B;  1NPP A;  5GAN e;  4FSX A;  3FB9 A;  3AHU A;  3OYK A;  2VUB A;  2DTH A;  3PT9 A;  4XU1 A;  4A4K A;  3M4G A;  4C92 A;  4XTZ A;  3CD6 A;  3URG A;  2A3L A;  2B8A A;  4ZGE B;  3LGF A;  4BY6 B;  2HBP A;  1XNI A;  5LJ3 f;  5GMK m;  4MDW A;  3M55 A;  4F7U E;  4OMF B;  1VQ8 A;  3G4S T;  1Y7X A;  3JSC A;  4M75 G;  5GAM g;  2KK4 A;  2Y90 A;  4CI0 C;  1VQP T;  5GAN d;  3OS0 A;  2VXF A;  5GAN 4;  2WSE E;  4P5N A;  5I2M A;  5GAN 5;  4MML A;  1VQN T;  5GAM h;  2EQU A;  4WF2 A;  1YBY A;  2LCC A;  3OYH A;  1K73 C;  3E9G A;  2RJC A;  4IKF A;  3HRS A;  4FT2 A;  2C06 A;  4VUB A;  1I5L A;  4RCB A;  2WSC E;  3GOX A;  4M7A E;  2DD5 A;  2G3R A;  2JZ2 A;  3QKJ A;  2K2V A;  4J6X A;  3CCQ A;  2XDB A;  1QVP A;  1UGQ B;  2DEQ A;  1OI1 A;  2ZGW A;  4KBM B;  2O4X B;  3QYH B;  4PNO A;  4C8Q E;  2X4X A;  3JCM J;  2L89 A;  1Q86 U;  5GAO m;  4M7A F;  4M7D E;  3KUF A;  4M78 D;  3J81 E;  1N6A A;  2LQK A;  2QQR A;  3CCS A;  1QW1 A;  4DOW A;  3L2V A;  1H3Z A;  3EAE A;  4F7U G;  1JJ2 A;  2QEX T;  3MP6 A;  4BB7 A;  2QQS A;  1D3B A;  5A2Q E;  4HCB A;  2EJF A;  4UC4 A;  2XDD A;  2RHX A;  4MZP A;  5HKC A;  3CC2 T;  1K8A C;  3V8J A;  2QA4 A;  2KDS A;  3QYG B;  4EMH A;  3OS1 A;  3A8M B;  4C92 E;  3VYG A;  2XD0 A;  3PTA A;  3CMA A;  4M7A G;  1Q82 C;  1WJS A;  3P8B B;  3JCM f;  1N27 A;  4OB3 B;  4EMG A;  3OYG A;  2ZPF B;  5GAM e;  4BI4 A;  4C92 F;  4C8Q G;  3G6E T;  1QVG A;  3RUX A;  3V8K A;  1VQ5 A;  3FIF A;  3SD4 A;  2E41 A;  1AHJ B;  2KSS A;  3DB4 A;  2EKO A;  3JCM V;  4NL3 A;  2M9U A;  4XTW A;  5KCO A;  2HAX A;  4M7D G;  3VKI A;  3X28 B;  2DXT A;  3CCV T;  4C0G A;  4MDX A;  3M59 A;  4A4F A;  2E1H A;  3L2Z A;  3NTI A;  3FJP A;  3FC3 A;  4PJO C;  1M8V A;  1QVF A;  2M16 A;  3CBO A;  3VJP A;  4PLL A;  1LJO A;  5GAN 8;  3OYL A;  2RJD A;  3LH0 A;  3HHT B;  3RKX A;  5HK0 A;  4N0A A;  3DLL A;  1VQ4 A;  1M1F A;  3MP1 A;  3HPW A;  4HKE A;  3C4S A;  3OYE A;  5CQY A;  3I56 T;  2Y4X A;  4M77 E;  4O5V A;  1UGP B;  3LLR A;  3S3M A;  3JCM d;  5LJ5 d;  4C92 G;  3SFM A;  4RG8 A;  5KH6 A;  2RI5 A;  3E19 A;  2DTI A;  1P92 A;  5IT9 E;  2PVG B;  4M77 F;  3A8H B;  2DJZ A;  4LDV A;  2KAF A;  3RIR A;  3SWN C;  3CME A;  2OTJ T;  3PGG A;  1OZ2 A;  2DXC A;  2X4Y A;  3GP8 A;  2V8J A;  3CCU A;  4QQD A;  2D9T A;  5DY9 A;  1YJ9 A;  1JJ2 S;  2R57 A;  5GMK h;  5DM7 R;  2LQ8 A;  4MMK A;  3Q1J A;  5I21 A;  5GAN g;  1VQ6 A;  1O75 A;  5FRM A;  1YHQ T;  2XIC A;  4ME7 A;  1K8A U;  2A7Y A;  3CBP A;  4J7F A;  3CBM A;  2LNV A;  1MGQ A;  2OAU A;  4M78 C;  1Y96 B;  2RD1 A;  2YLB A;  1YIJ T;  5GMK i;  3RKW A;  1Q82 U;  3UT1 A;  1B34 A;  2JTM A;  3JCM c;  2X35 A;  3FLG A;  4PJO F;  2QXF A;  3MEV A;  3CCR T;  1N9S A;  3DKM A;  3GIB A;  2EQM A;  4O6J A;  2E64 A;  2MAM A;  4N4H A;  5D6X A;  4E7I A;  1YI2 A;  1Q81 C;  2ZPG B;  5FRN A;  1VQN A;  3WXM B;  4BD3 A;  4R56 A;  1N9R A;  2QDY B;  2PVD B;  4E7J A;  3OYB A;  2F5K A;  2VGM A;  2FYK A;  1QVF S;  5FU7 C;  2DXU A;  2LTO A;  3QPH A;  4RG2 A;  4XTV A;  4C5G A;  4ZTF A;  3NTH A;  5C6S A;  3OW2 A;  2R5M A;  3VYH B;  4BY6 C;  3HRT A;  2RO0 A;  3CD6 T;  2DKG A;  4EDU A;  1UGR B;  2PUO B;  2VXE A;  1UEB A;  2DIG A;  4M75 B;  5GMK e;  4ZTJ A;  4KUD K;  4DA4 A;  2QI2 A;  2RJF A;  1VQ8 T;  3ZBD A;  4QVD A;  5GAO q;  1KQS A;  4J8O A;  3CCJ A;  3OB9 A;  1G3S A;  4FT4 A;  3DLM A;  2RB6 A;  4BI8 B;  1WQW A;  3NTK A;  3GNG A;  5J26 A;  1HXD A;  4M78 F;  3M53 A;  3X25 B;  3SB2 A;  3A8O B;  1WGS A;  1HK9 A;  3NFC A;  2BKD N;  2EAY A;  5KE3 A;  2M1H A;  4TVR A;  4ZGD B;  3CCQ T;  2DIQ A;  4ZN1 A;  1NPR A;  2E6Z A;  2DK3 A;  1OZ3 A;  3OY9 A;  4EMK A;  5KCH A;  5CCA A;  2RA2 A;  4E47 A;  4IUT A;  5GAN 7;  3C94 A;  3QII A;  4LDU A;  4F7U B;  3CCS T;  4LDX A;  4BUG A;  4X9C A;  5LJ5 g;  3R6O A;  4V2S A;  1VQ9 A;  3A8L B;  3PIP A;  2BUD A;  1MHN A;  1KQ1 A;  2RM4 A;  3CPF A;  2K3X A;  3WVE B;  2F5T X;  2EYQ A;  2KVQ G;  3JCM h;  5LJ5 h;  4OB1 B;  4E7H A;  4KUL A;  4M77 A;  4QVC A;  2RJE A;  2DZC A;  5D6W A;  5LJ3 d;  5GAM j;  2E70 A;  3JAM E;  3JB9 I;  4M7A B;  2QA4 T;  4J5Y A;  4HCZ A;  2PU9 B;  1BYM A;  1M5Q 1;  2HD0 A;  3OW2 S;  3CMA T;  2GQV A;  2CZ1 B;  4PL6 A;  2JTF A;  4C8Q B;  4M7D B;  4JLI A;  3QJ6 A;  4M75 D;  2D6F A;  1VQ5 T;  3HL8 A;  2GFA A;  2HNI A;  3MCA B;  3LYI A;  1S72 A;  1YJN A;  4FL6 A;  4JJN K;  1KQS S;  3OYI A;  1KG1 A;  1X75 C;  3INZ A;  5A0L A;  3L2U A;  5CVI A;  3PNW C;  4ELZ C;  5CKD A;  4BE0 A;  3X20 B;  3HKS A;  2MWP A;  4XTX A;  2DAQ A;  4JRK A;  4PJO A;  4JRP A;  4HA8 A;  2ZPE B;  2RHY A;  3C12 A;  2L5Q A;  4J6W A;  5DLO A;  2YHT A;  4OGC A;  3LWI A;  1PSE A;  2DVE A;  1VQ4 T;  2DD4 A;  4B9X A;  5CKB A;  3G71 A;  4IUQ A;  4C92 B;  4J7I A;  2VC8 A;  3V8L A;  4JRI A;  2KQW A;  1M90 C;  3SDZ A;  4QW2 A;  1EIF A;  4BE2 A;  3JCM e;  5LJ5 e;  1VQL A;  2GF7 A;  1PSF A;  4LD9 K;  2Y4Y A;  1JBM A;  5GAM f;  3CME T;  2WSF E;  1K73 U;  1IZ6 A;  2CZ0 B;  1ZHI A;  3JRZ A;  5EG2 A;  3RES A;  3OBY A;  3OYJ A;  1VIE A;  2FVU A;  2RK1 A;  2RI2 A;  2K5L A;  4IUU A;  3CCU T;  2E65 A;  1YJ9 T;  1N8R C;  3J7A F;  1KD1 C;  3M57 A;  3CXC A;  1I8F A;  3OA6 A;  3HSB A;  4OF1 A;  2JUF A;  2E6N A;  3OBW A;  2ZPB B;  4LDW A;  4A4E A;  1W2B A;  1VQ6 T;  1G5V A;  3ZFJ A;  3G7Z A;  1JB0 E;  4M7A D;  3X24 B;  2RHZ A;  3HFN A;  4M78 A;  3JCM W;  4M77 B;  4JRQ A;  3UPU A;  5A0G A;  4C8Q D;  2LRQ A;  3JB9 J;  3CCE A;  2RH2 A;  1Y71 A;  1KHI A;  3JB9 F;  1ZBX A;  3TU4 K;  4M7D D;  5CO7 A;  1M1G A;  2PVO B;  4DOV A;  3FRN A;  5M9O A;  1YI2 T;  3A8G B;  2RI3 A;  4D6W A;  2HQE A;  2LC4 A;  3J80 E;  2XI9 A;  1D3B B;  3HFO A;  4PLI A;  5I2S A;  5GAO p;  2R5A A;  4BAC A;  1KC8 C;  3L2R A;  4PJO E;  2EJ9 A;  4ATO A;  1BIB A;  5A0D A;  2RHU A;  4QQ6 A;  5KE2 A;  1G3T A;  2DXB A;  4JDS A;  5GAO n;  2DZ9 A;  3CCL A;  1I81 A;  4QVZ A;  5HK3 A;  1VQK A;  3C95 A;  5CKF A;  5GMK j;  4M77 G;  4XTU A;  1NZ9 A;  3MP8 A;  3OYA A;  2O01 E;  5IAY A;  3RER A;  2OTL A;  1K9M C;  4M75 C;  3LWH A;  4E7K A;  4EMK C;  2K3Y A;  1V29 B;  4C92 D;  5LJ3 g;  4DQ2 A;  3JB9 G;  1M90 U;  2RK2 A;  4C0D B;  1X01 A;  5GMK l;  3QG1 A;  5GAN j;  3HRU A;  3OSS C;  5FU6 B;  3X26 B;  2E12 A;  3CCJ T;  5LJ3 h;  1BIA A;  1UGS B;  4XK8 E;  5CIU A;  1U8R A;  2L8D A;  4JS5 A;  1WNL A;  3VV0 A;  1BI1 A;  4XAX B;  2CYZ B;  1KD1 U;  3FEO A;  4J83 A;  3CXC S;  3VU3 C;  1BKB A;  4L6V 5;  4PJO G;  3ER0 A;  3LW5 E;  1W2B S;  4PKC C;  5D6Y A;  3OYM A;  2LT1 A;  4LD6 A;  3RMS A;  4M78 E;  2M0O A;  1Y07 A;  2O4X A;  2F69 A;  2K5F A;  3P8D A;  5HY6 A;  5GAO l;  3EFR A;  2EFI A;  4OGE A;  4M77 D;  3VUB A;  2E5Q A;  3QO3 A;  4ELY C;  5IN1 A;  4XU3 A;  4IUR A;  2RHI A;  3QHS A;  3CC7 A;  4MZM A;  3RMQ A;  3OYC A;  1VQ9 T;  1G3W A;  3L2W A;  5FRO A;  1YIT A;  3E1S A;  4R55 A;  3CC4 A;  2CKK A;  2IVW A;  1YCY A;  2KY9 A;  3M4Y A;  4FU6 A;  3DB3 A;  4Z02 A;  1KC8 U;  2LX9 A;  2X4J A;  5CKE A;  1I4K 1;  3OQ5 A;  4M75 F;  5CQX A;  4X9D A;  5GAN f;  4M7A C;  1UB4 A;  1OYX A;  1NE8 A;  1XQH A;  2KMT A;  3KXT A;  2V8K A;  3LX7 A;  3M9Q A;  3WVD B;  5LJ3 e;  4C8Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...