4C0DC

Structure of the not module of the human ccr4-not complex (cnot1-cnot2-cnot3)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
142
structure length
142
Chain Sequence
LTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0dC00
4C0DC 5FU7C 4C0GA 4C0FA 4BY6B 4BY6C 5FU6B 5FU6C 4C0DB 5FU7B
chains in the Genus database with same CATH superfamily
1Y96A 1KQSP 4ESRA 2J6OA 2DKGA 2XIDA 1Y7XA 1VQ7A 3HSBA 2QAZA 1M4ZA 2EAYA 1OZ3A 3VS5A 4N0AA 1G3SA 2JMCA 3UA6A 1ABOA 1YWOA 2K7AA 3REBB 1KJWA 2QQBA 2AKKA 3CCLT 2GQIA 4M75F 2MWPA 4C0DB 2QDLA 2GFUA 2JTMA 1VQ8T 3VRYA 3G6ET 4BD3A 1BIAA 2VV5A 3WXMB 1YIJA 1VQKA 2DAQA 5LJ5e 5GANh 2D8JA 4E7HA 4XAXB 2RI2A 3M0PA 4NS5A 2DX1A 1TG0A 3IQLA 3CBMA 1OOTA 2DBKA 1MMGA 1WZOA 1I07A 5GMKh 2F1LA 1VQ9Q 3CCMQ 1WX6A 2EVRA 1WHHA 4RTXA 4JS5A 5GAOl 4O6JA 5IXBA 2JJ9A 3MEUA 2V8KA 1DJ7B 2VASA 2VXEA 2P4RA 1VQOT 4J83A 2OTJQ 2FL7A 2RNAA 3CC2Q 2RN8A 2QK0A 3EFSA 2DVJA 4QQDA 1ARKA 2DD5A 3CCRA 1YITQ 4BI8B 2LCLA 4PJOF 1W2BP 3FJPA 5FRMA 1I4K1 4PJMA 1VQPQ 4IKFA 1VQLA 1IB8A 2XKOC 5A0DA 2GTJA 4AG2C 4MZPA 5A0GA 4HVUA 2P0QA 1U5SA 1KHIA 2MMPA 3A8LB 2MYSA 2RJFA 7AT1B 1UGQB 1TUGB 2W10A 5CKHA 3AT1B 1PM3A 2GFAA 2A37A 2HCKA 3E2UA 1Q81U 1M5Q1 3QSUA 1TUDA 1RAGB 3J80E 4J6WA 1GCQC 3JCMc 4ZNXA 1ZA1B 1WHLA 2M0YA 4PJJA 5KYXA 4AT1B 2LQNA 1N8RC 4CC4B 4D8DA 4FT4A 4E7KA 1G3WA 2HKQB 5GAOn 1KD1R 2HQHA 1BI1A 1CKBA 2JS0A 4OP0A 4M7DB 1OX9A 2BKDN 1Q95G 4PKCC 4C8QD 2RB6A 1R8OB 1W70A 3QHSA 3SD4A 5EC7A 1S72T 2P0KA 2DD4A 2R57A 1WFWA 2KT1A 1MV3A 4N0AC 4VUBA 2HMAA 2ED1A 4X1VA 4LNPA 3HP9A 1GBRA 2MIOA 4C92F 3A98A 5LJ5f 5AT1B 2CT4A 4NL3A 1NYFA 2E12A 2DXUA 2MI6A 4Y28E 1VQ9A 2VVKA 3CCMA 3L1AA 1N27A 5D6WA 3M55A 2JTFA 3PE0A 4LDXA 1M90U 1LPLA 3EHRA 2OTJA 1G2BA 2JN0A 3NFCA 3CC2A 2V1QA 3GLXA 1M1FA 1RACB 3VYGA 1VQMQ 2OTLQ 2DTHA 3CXCS 4MDWA 1JXMA 3C95A 1UGPB 3OYMA 1YITA 3OYLA 2XI9A 3M0RA 1WJQA 4ZN1A 1VQPA 1QWEA 4F7UB 1M1KU 2YLBA 1RAEB 3L42A 1JU5C 4KGVB 5CQYA 3RERA 1GL5A 4M7AA 3V7SA 1V76A 3G7ZA 3MEVA 1JJ2S 2IIMA 5IHNA 3EHQA 4OVAA 4M77A 5I2SA 3FLGA 1FWZA 4CC2A 3VUZA 2CZ0B 1Y0MA 3GOXA 1C6VX 4JZ3A 2RHXA 4FYVB 5GAN2 4L6V5 4Y91A 2BZ8A 5KYWB 4KH1B 1UJ0A 2YRVA 1KQ1A 3PVQA 2JZ2A 3VUBA 1Q82U 5C0MA 1UJYA 1YJWT 1AOJA 1NJIC 4OB3B 5D7UA 2X9HA 1XNIA 3CD6T 5FW9A 1WLPB 8ATCB 3OW2A 2G6FX 4C8QC 3JCMe 3HKSA 2ROLA 2ZGWA 2LZ6B 2O4XB 2NUPA 3RUXA 1YP5A 4F14A 1Y71A 2CP5A 2LJ0A 4LUEA 3CPWS 1WXUA 2F5TX 4IUVA 1K0XA 1ZQ1A 3H0HA 2RQVA 1GFDA 2KNBB 3OMCA 1Q86U 4OMMA 4A4EA 1G8XA 1K0SA 5DY9A 4E47A 3GIBA 2X4XA 4AFSC 4M75A 1IO6A 5J3BA 2C0OA 1QVFS 5L23A 1WGSA 2M16A 3PGGA 3G71T 4EMHA 1PKTA 1NZ9A 1BI2A 4QVCA 4M78B 4QW2A 4OGEA 3A8OB 1LNXA 1JEGA 2XHCA 1ZSZC 4C0ZA 4DBQA 2FPDA 2KYMA 1T0HA 5GAMg 2QQ9A 1K73R 1HD3A 2K57A 2PNIA 5GAOm 4FYYB 2C06A 1AWXA 2SEMA 4LD9K 2LQ8A 5CCAA 2B8AA 4DBFA 3A1PA 4J6YA 1OX8A 2ABLA 3ZL7C 4C5HA 2HBPA 4EMKC 1HXDA 1PRLC 2EYQA 1PNJA 1KC8U 1BYMA 2WSCE 1K76A 4M77E 1D1AA 2X51A 3SWNA 2XMFA 2KQWA 1VQMA 1K9MR 2KYBA 2Y4YA 3LH5A 2OTLA 3MEWA 4FSSA 1YIJT 1VQKT 2HD0A 4DA4A 3VU3C 1IGQA 2DO3A 2IPOB 4DOVA 3CC4Q 3TSZA 2PQWA 1BI0A 4XTUA 4UC4A 2L0AA 1UGVA 4M7AG 4E7JA 3X28B 3MPUB 4K11A 2GF7A 5HCKA 2O9VA 3PFSA 3M4YA 1FYNA 2RHZA 1X6OA 1W4SA 2QTXA 4IUQA 2CP7A 2L8DA 4LXCA 1PRMC 3HRSA 1R77A 2K3YA 1K8AC 1M1KR 3QUIA 4PJOD 3CCRT 1E6GA 2AT1B 3LH0A 2QA4T 5ECAA 1VIFA 1SKUB 1NLOC 1UB4A 1TOVA 3URGA 2EQIA 2VKNA 4RMOA 4FIBA 4O5VA 3JCMf 2A3LA 2DEQA 5GANj 2LNVA 3R6OA 1E6HA 1KSWA 2A28A 1NE8A 3A5ZB 2LQWA 1H3ZA 1HJDA 4C8QF 2CS7A 1MV0B 3HL8A 1Q7YC 5GAMd 5GMKj 5CKDA 5LJ5d 2P84A 4LDUA 1QWFA 3VYHB 3A8GB 2RHIA 4M75G 3RBBB 4B6MA 5IN1A 1B34A 1QMCA 3QBYA 3CCVT 2DTOA 3HPWA 4C92A 4WCIA 1YBYA 4OMNA 4FM4B 3SEMA 4M7DE 4R55A 5KE2A 4BDYA 4GY5A 4V2SA 2FRWA 4RTTA 1QP3A 1VQNQ 3A8MB 4C0GA 3QO3A 4FU6A 2K6DA 3L2RA 2BZXA 2ENMA 1WHKA 3BW1A 4WF2A 5IAYA 2GGRA 2JM9A 3NGPA 2KEAA 1UGRB 1N9RA 5CAIA 1JXOA 2EYYA 4JLIA 3UA7A 1VQ6T 4LDVA 5LJ3g 4RTZA 4PJOG 3I55Q 2CP6A 2DM1A 4JJCA 4X34A 4BE2A 2O31A 3OYJA 3L2UA 3I35A 2RPNA 2BE7D 1H641 5GJVB 4J5YA 2ZZDA 4II1A 1YJNT 4PJOC 1VQ9T 3D7SB 2JOYA 3ZFJA 3EGDB 4DEXA 2YUOA 3OYDA 4OMLA 1GRIA 1QVGP 1G5VA 3M0TA 4P5NA 2QEXQ 1YJ9T 5D6XA 5KYXB 2J05A 3OA6A 4JJNK 3CEYA 4JS4A 3G4SA 1AD5A 1YITT 2FZCB 2AHJB 2YRCA 3M59A 3BE3A 5CK9A 1VQPT 1M1GA 1X27A 4J9FA 3VKIA 2DE0X 3MP1A 4LDWA 3I5SA 1GCQA 3J81E 2AZVA 4JJDA 3EGUA 2EJFA 2LNHB 3QKJA 2EFIA 3TVTA 5GMKl 1SSHA 4BACA 4M78D 1U3OA 1GXIE 5A0LA 3HFOA 3UWNA 3JCMP 2NUTA 1OV3A 2PZ1A 2O88A 1V29B 2L3SA 5FU6B 1R0CB 2WACA 4C92G 2VUBA 2F2VA 2PVGB 5IT9E 1YI2Q 3O5ZA 3VRZA 5LJ3d 2A08A 4HXJA 3CCUQ 3CCET 4L5GA 2DIQA 5GANe 4Z88A 2CH4A 2KXCA 1VQNA 2QDYB 4C92C 3PVLA 4M78E 3V8JA 1XQHA 4OF1A 5GMKe 4XQ3A 1PD1A 4XU3A 1ZLMA 3ASKA 2AK5A 1MNDA 3OYAA 3VJPA 5I21A 5IHIA 3KUFA 2K5IA 1OEBA 2V1RA 4M7AB 4ANJA 3CCQQ 3EGXA 2PTKA 3I55A 4M77B 4DBHA 3GNFB 2QGGA 2DL8A 1UEBA 2XD0A 4HT9A 2CP0A 4J9DA 3QWXX 2KRMA 2NLUA 1PKSA 2L3RA 1JBMA 5FRNA 2JT4A 4N4IA 3PTAA 2D8HA 3REAB 3UT1A 3MHXA 1M3AA 1HK9A 5GAMh 1VA7A 1SPKA 4IIMA 5KYYA 4HCBA 1ZSGA 2YUPA 2QEXA 3MEAA 3V7CA 5CR2A 3JCMd 3CCJQ 2DLPA 3U23A 2VGNA 1SSFA 2HDAA 1JO8A 3GP8A 1M8MA 2EIFA 1U06A 2JVVA 3EH1A 5IHKA 4M7DF 3EFOA 2LJ3A 4Z8AA 2KI7A 2QQSA 2DTIA 2GBQA 3DLLA 2LCSA 1TXQA 4M75B 3LW5E 2QXFA 4C0FA 4A4KA 3L2WA 3L2QA 2BUDA 3ULRB 4C8QA 1I81A 3X24B 3JB9H 1AEYA 1YWPA 1NYGA 2W0ZA 2XK0A 5GMKi 3OB9A 2I2LA 2Y90A 1UTIA 2KE9A 3A8HB 4FYWB 4KH0B 2BZYA 4XTYA 3RESA 3RMQA 4F04B 3C12A 4AFZC 2DF6A 4Y92A 5LL6S 3JV3A 5HK3A 1PG5B 1YCSB 2J6FA 1JJ2A 4XU0A 3TSWA 2DERA 3S6WA 3RMSA 1UUEA 4BB7A 3FJ5A 1YI2A 4XTWA 1QLYA 2X4JA 3LGFA 3HRTA 1B07A 2COWA 1TH7A 1N8RR 4ME7A 3JCMW 4J9HA 3CCUA 4IUTA 1K73U 2LMJA 3QXEB 4IURA 2KVQG 1ZSZA 3SWNB 3M57A 5GANf 2V8IA 3PMTA 2I0NA 4X9DA 1KD1C 4F7UF 2QGFB 1N5ZA 3CCLQ 1B3QA 3VS3A 1TUCA 2KRNA 2OAWA 2DA9A 2LX7A 1VQ8Q 5GAN5 5I22A 3G6EQ 4EMKA 2H8HA 3DB4A 4N4HA 2ZAEA 3CCQA 1G83A 1K9MU 3CPWA 3UDCA 2YUNA 4OMOA 3NTIA 3SHWA 2PUKB 1ZBXA 2MCNA 2MAMA 3OSSC 4BY6C 3S3MA 3N5BB 2D6FA 3C4SA 1QVFA 4CC3A 1M2VA 2HSPA 5FU7C 1RL2A 1QP2A 2JW4A 2ZPEB 1VQOQ 2DRKA 4OB0B 3UATA 4L59A 3L2VA 1X6BA 2RJEA 5FWCA 3DKMA 3VV0A 4DOWA 3CCJA 1UE9A 2IVWA 1LVKA 2DXBA 3PT9A 4AG1C 4RTYA 1LOJA 1S1NA 2H3EB 1KK7A 1KQ2A 1M8VA 3FRNA 5HKCA 1M3BA 3V8LA 5LJ3h 3FIFA 1KFZA 3LYIA 3DLMA 2E10A 3BFMA 2A7YA 3QG1A 1B34B 1MMNA 2F5KA 4M78F 4C8QG 3GBQA 5GMKm 1W6XA 3EH2A 3KBGA 1WHMA 2DJQA 2LP5A 3H9NA 1RLPC 4A4GA 3RKYA 2EKHA 1FMKA 1T0JA 4E6RA 5GAOp 2E65A 2SRCA 3NTHA 4OB1B 3G4ST 4JZ4A 3TQ7P 1WJSA 1PSEA 5KYUA 4PFPA 2ZPFB 2LRQA 4KGXB 1X6GA 2DL4A 4HVWA 1H3HA 4ELYC 2ZCFB 2VYTA 3HRUA 4FW2A 2K3BA 3VS0A 1QQJA 2A36A 3OYFA 4XU1A 5J26A 2M02A 2RQRA 2DMOA 4QQGA 4OMPA 1Q81C 2FPEA 4M77D 1JB0E 4A4FA 3CCLA 4GLKA 1S72Q 1OPKA 4JRIA 1KIKA 3M0UA 1VQ8A 2WSEE 1RUWA 1G3TA 3G6EA 1BB9A 2CZ7B 2EBPA 5GAOq 2RQTA 3OS1A 2VGMA 1MNEA 5LJ5g 1VQ7T 3RDVA 4XK8E 2KDSA 4XTZA 1KG1A 2PVOB 3OS5A 2RI5A 1VQ5Q 2RQUA 2CP2A 3M0QA 1D0XA 2CZ6B 1IREB 1U1SA 3KFVA 1EFNA 3NTKA 1IZ6A 3P8HA 2EKOA 1K9AA 1HSQA 4M7AE 3EG9A 4J8OA 1I1JA 1VQOA 2OX7A 2OI3A 2FO0A 2F2XA 2DBMA 3EG2A 2YT6A 4PJOA 3OYHA 1NBEB 4PLIA 1JJ2P 3I9QA 3E9GA 1D3BA 2HAXA 3M58A 1RAAB 2PU9B 2EYWA 1MMDA 1AVZC 3G1JA 2X35A 1A0NB 4B9XA 1D09B 1M90C 3JRZA 2CP3A 1NM7A 2RHYA 2ECZA 1Y96B 1LCKA 2NUTB 5GAN8 1UHCA 2HBWA 2CKKA 2E6NA 2RH2A 1C0MA 1VYTA 1LJOA 2EQKA 4AFUC 2RD1A 5CVIA 2QQRA 3RIRA 4C0DC 1OULA 3UPUA 1H92A 2CH4W 1Z9ZA 2EPDA 2BTTA 4Z89A 1M1KC 4M75E 2EJ9A 1YJWQ 2O01E 2RJCA 1VQLT 3SDZA 3GF5A 3JCMb 1O9SA 4ZN3A 3CD6Q 5GANd 1BIBA 5KE3A 3V8KA 4M7DD 1UG1A 4TVRA 2KMTA 1MMAA 4NL2A 2ESWA 1GFCA 1QVGS 3BDUA 2KGTA 1JQQA 4KBMB 4OMQA 5GAN3 2QI2A 4QVZA 3EAEA 3OS0A 1Q7YR 2LT1A 5FROA 3GPLA 3EGXB 1RAHB 1Q82C 3E1SA 1QCFA 3KXTA 1BKBA 1T3SA 1SG5A 1S72A 2QASA 3CPFA 2RI3A 3WVEB 2DNUA 3I56Q 3G71Q 1FX7A 3MCAB 5GAMj 4OGCA 3PMIA 2EQMA 1VQ4Q 1PC0A 1UECA 1NPRA 2HL3A 2YWWA 4JRQA 2DL3A 4FW1A 3JB9D 1YI2T 4PK4A 1VQ5A 5DLOA 1ZUKA 1NEBA 3OYYA 5KYYB 1AZEA 1Q86C 3AHUA 2RHUA 1KQSS 1U8RA 1X2KA 5KH6A 1X75C 2DIGA 1UFFA 4FT2A 2EGEA 3FB9A 4F17A 4FCYA 4JUVA 1SF9A 3S3OA 3NMZC 1I5LA 1WA7A 1PSFA 3EFOB 4KUIA 2KT8A 5CQXA 2O4XA 2L3PA 2GNCA 3OW2P 2LTOA 1M3CA 1QKXA 3VS4A 2P0PA 2MWOA 3OMGA 1D1CA 4BUGA 4ZGEB 3CC4A 4OB2B 2ZPBB 1YIJQ 3OY9A 2GQVA 3CCQT 1ZX6A 4C8QB 4CC7A 2GCXA 4M7DG 2DYIA 3MKDA 1WDXA 2EGCA 3CCMT 3OYCA 5KCHA 3ZBDA 2JXBA 3EG0A 4KGZB 2HSEB 1I8FA 2JMAA 3HFNA 2KRSA 4RCBA 3QWYA 1VOMA 2X3WD 4ELZC 2YUQA 1KC8C 1BCMA 2E70A 3E19A 2OTJT 4M7DC 5CKBA 2AIRB 3CC2T 2FG0A 1WPYA 4HT8A 4DBRA 2M0OA 4JJBA 2XDDA 2ATCB 2X3XD 2X4WA 1Y07A 2DEUA 3RR6A 2KROA 4ZGJB 1EIFA 5GJWB 3HTRA 2QA4Q 1ZSZB 3TEEA 1SRLA 2RK1A 3MP8A 3CD6A 2KK4A 2HL5C 2CZ1B 4FYXB 3X25B 4RKUE 1IHVA 4C92E 4JDSA 1UDLA 5DM7R 2MK5A 3C0CA 3JCMg 2QQAA 2E5KA 1SHFA 2K5LA 3ME9A 3E9FA 1HYOA 4BDZA 3QPHA 1N8RU 1W2BS 1Z9QA 4EMKB 2CGHA 2YHTA 4M77F 2C0IA 3LLRA 3H0IA 4F7UG 2FB7A 3JCMV 4JRKA 4ZGDB 2RO0A 2JTEA 4KULA 3I56A 3G71A 3CCVQ 4RTWA 1RI0A 2K2VA 2RQWA 4X9CA 4HCKA 1QKWA 1OZ2A 1M2VB 1BU1A 1VQ4A 2DZCA 1RADB 1M30A 2V26A 3ZEHA 6AT1B 2LQKA 2FZKB 1W1FA 1WQWA 3Q1JA 1Y57A 2ROTA 2DK3A 5A2QE 4B9WA 2CSIA 5CKFA 1BI3A 1PWTA 1IRXA 4PFZA 1WXBA 1O75A 5J39A 5LJ3j 3JCMX 3JB9I 1VUBA 4J6XA 4A54A 1VQ6Q 4FSXA 4QQ6A 4AFQC 1BBZA 2CREA 3OYNA 5GAMe 2DILA 2JNGA 3OBYA 4DEYA 4HVVA 3H6ZA 2P4TA 2HKNA 1FXXA 2K2MA 2D1XA 1IHWA 1YJNQ 1PCXA 5LJ5h 1TTHB 2HNIA 4M78G 4HKEA 1GCPA 3NPFA 2H3JA 3CMAQ 2L5QA 3CC7Q 3INZA 1WQ7A 3QJYA 3CCSQ 3M56A 2NUPB 1VQMT 2F69A 3VS6A 1YJ9Q 2OTLT 1D0ZA 5HK0A 1K4US 4KRTA 3JCMJ 4QKUA 5KYUB 1D0YA 1YNZA 2QTVA 3C94A 4M78C 3MO8A 2QA4A 2NUZA 4GLMA 1NJIU 3QZ9B 4MDXA 2KR3A 2D9TA 2COYA 2WSFE 3QZ5B 3CXCA 3CMEQ 3P8DA 4LUDA 2CYZB 4QVDA 1YHQQ 2JS2A 9ATCB 5FLXE 2EQUA 2LCCA 1AHJB 3QYGB 1ZHIA 2K4YA 4RTUA 1IXDA 2KSSA 3MJXA 4JLGA 3JB9J 3FDRA 2YLCA 3CCVA 1QCNA 1P92A 5I2MA 4Q5WA 2K9GA 3JB9F 3EGDA 4EPCA 3EG9B 1VYVA 2LDMA 2RA2A 2GTOA 3CBPA 4IIOA 2K5FA 4E2FB 2DVEA 3OYEA 2E3HA 4BI3A 4PJOB 2XDBA 3CCEQ 3H41A 2DXCA 2FHDA 4LDYA 2XICA 1D3BB 1X69A 5IXFA 2RJDA 3LWIA 2JUFA 1D1BA 1RAFB 1KHCA 2CDTA 5DLQE 1WXTA 4E7IA 1F1BB 1MGQA 2HZYA 1VQ6A 3OBWA 3VS7A 3FC3A 4HA8A 2MPXC 1UHFA 4PJNA 2R5MA 1WHGA 2ZPHB 5GAMf 1NG2A 1I5OB 2DZ9A 2FRYA 2FZGB 1AWJA 4J9EA 2E6ZA 1ACMB 1VQ5T 4RG8A 2EGAA 4D6WA 1YJNA 3VS1A 4BI4A 3X20B 3PIOA 2O9SA 3CMAA 1K1ZA 1RAIB 4JPBW 3CC7A 3CCSA 1VIEA 3R6NA 4C8QE 2K3XA 2VWFA 5LJ3e 4N4GA 4C5EA 1YJ9A 1XTDA 4BE1A 2IG0A 2E1HA 1K8AU 3OS2A 2FYKA 2G3RA 3JCMQ 3J7AF 2D0NA 3OYKA 3CC4T 1PD0A 1NPPA 3HHTB 2RM4A 4J7IA 1SEMA 1B7TA 4R0KA 3M0SA 4LE9A 3CMEA 2F2WA 4XU2A 2VB6A 4C92B 4ORZA 3M4GA 5IH2A 2LVMA 2QYZA 1YHQA 3SFMA 2K79A 2BIVA 2YXYA 2HQXA 4RCCA 1Q7YU 2EYZA 1OI1A 3OYGA 1E7OA 1NJIR 4D8KA 3M5AA 2EJGA 1WHJA 1OU8A 2J6KA 5CKEA 2E4HA 2HEQA 1N9SA 2Z0WA 2KY9A 4Z02A 3X26B 2ZPGB 2B86A 2L2PA 2CT3A 3CCEA 3F70A 5CO7A 4M7AD 5GANg 1C1AA 2PUOB 3META 2L89A 2AKLA 4LN2A 1ZA2B 3NHNA 2OJ2A 1Q81R 4CRIA 3JCMh 3JSCA 5EG2A 1V1CA 2VXFA 2X4YA 1QVGA 4C5GA 5M9OA 3OSVA 1H8KA 3I56T 2XU8A 2E41A 4MZTA 2LT4A 3LGLA 4PNOA 3TCJA 3CXCP 1K73C 4ZTJA 1VQ4T 2CUDA 1RI9A 1ZBJA 1PHTA 1WI7A 4PJLA 1FMVA 2NYSA 4RG2A 1VQNT 2AZSA 3FEOA 4MZMA 3LWHA 3CBOA 4ZTFA 5AYFA 3I5RA 4PL6A 3UF4A 2M1HA 3M9QA 1SHGA 4J9BA 2MOXA 1K9MC 1X43A 4M75D 5LJ3f 2DYBA 1M9SA 2CUBA 4M7DA 3I55T 2M9UA 4EDUA 1XJWB 2DXTA 5FU6C 1KQSA 5I11A 1WNLA 2LX9A 3QYHB 1X2QA 4A4HA 3H0FA 1JRIA 1TSFA 4OMFB 3JAME 3T9NA 1VYUA 2NWMA 4EMGA 4XTXA 1M90R 2CSQA 2E5QA 3PIPA 3OW2S 2EW3A 3EG1A 4E7ZA 3P8BB 1K8AR 3L2ZA 5GAN7 4M77G 2E64A 1RABB 4E7LA 2QG9B 2QEXT 4J7FA 1AWOA 1TU0B 4PFOA 3CPWP 4KUDK 2PVDB 2YSQA 3GNGA 3EG3A 3CQTA 4M7AC 1X01A 4MMLA 4AMCA 4M77C 1AT1B 5HY6A 3G4SQ 3QIIA 1QVFP 2RF0A 4BY6B 1YFNA 1ZUYA 2DFUA 2HQEA 1WYXA 2C0TA 5FWBA 4J9GA 1CSKA 1QVPA 4J9CA 4F7UA 5FU7B 4PLLA 4KT0E 4QT7A 1FMWA 2E3IA 2EQJA 3QJ6A 1Q82R 2XDPA 1QW1A 4GBQA 3M54A 3SB2A 3TU4K 3V7RA 4E7SA 5LJ5j 1J3TA 4PJOE 1AWWA 2DPPB 1W2BA 1VQ7Q 3LX7A 5KYWA 2ED0A 1EX4A 4FL6A 5D6YA 3MP6A 3S3NA 2KXDA 4XTVA 2FPFA 2O2OA 1OPLA 3DB3A 2R5AA 3CCUT 2OAUA 2KAFA 4M75C 3THKA 1ZUUA 1Q86R 1BCOA 2M51A 3OYBA 2XG8D 4DQ2A 2J06A 4J9IA 1R0BG 1WJRA 2COZA 2MF2A 5GAN4 5CIUA 4HCZA 2DL5A 2Y4XA 4A63B 1AZGB 3RKWA 1VQKQ 3QDFA 8AT1B 1OYXA 2EWNA 5KYNA 3H8ZA 1OQKA 4HCCA 3O8VA 4IUPA 2DETA 3BDLA 4C92D 2D0QB 3OYIA 1GBQA 4YTLA 1M2OA 4M78A 4CI0C 5L8RE 5GAOr 1MHNA 1EZZB 5KCOA 4JRPA 1G3YA 3SWNC 2RMOA 1NLPC 4M4ZA 4EIKA 1KC8R 4ATOA 4R56A 4LD6A 3VS2A 4WTOB 1U1TA 2JM8A 3RNJA 2ZPIB 3M53A 2V8JA 3CMAT 1TS9A 3CCRQ 3CC7T 3CCST 2BE9B 5GAN6 1YJWA 4RTVA 3CCJT 4F7UE 2EYXA 3EFRA 1UGSB 4C5IA 3PNWC 1YN8A 1VQLQ 1CKAA 3ER0A 1N6AA 3JB9G 1QCOA 2DJZA 2LJ1A 1TWBA 5C6SA 4NOYA 2VC8A 3BY7A 1OU9A 1RLQC 3TREA 4M7AF 2LC4A 1XOVA 1SRMA 3RKXA 1WIEA 1M27C 2FEIA 4MMKA 1YCYA 2KBTA 3CMET 2RK2A 2YDLA 2YRDA 4IUUA 4F16A 4RUGA 2FVUA 3OQ5A 1T3LA 3WVDB 2DL7A 1ABQA 1YHQT 2R58A 1BK2A 4A53A 1MUZA 1NEGA 2A0FB 1KD1U 1I0CA 2L3QA 2J7IA 1IGUA 3QDRB 4BE0A 2DRMA
chains in the Genus database with same CATH topology
2RHIA 1Y96A 2DVEA 4M75G 2VYTA 3HRUA 3OYFA 4XU1A 5IN1A 5J26A 4BI3A 1B34A 4PJOB 2XDBA 2DKGA 2XIDA 1Y7XA 3QBYA 3CCVT 4QQGA 1VQ7A 3HSBA 1Q81C 2DTOA 3HPWA 1M4ZA 2DXCA 1OZ3A 2EAYA 1JB0E 4M77D 4A4FA 4C92A 3CCLA 2FHDA 4GLKA 4LDYA 4JRIA 2XICA 4N0AA 1G3SA 1D3BB 2RJDA 1VQ8A 2WSEE 1YBYA 3LWIA 4FM4B 1G3TA 3G6EA 2CZ7B 4M7DE 2JUFA 4R55A 5GAOq 5KE2A 3OS1A 4BDYA 1KHCA 2VGMA 4GY5A 5LJ5g 4V2SA 1VQ7T 5DLQE 2QQBA 4XK8E 2KDSA 1QP3A 4E7IA 4XTZA 1MGQA 3CCLT 1KG1A 2PVOB 3OS5A 1VQ6A 3OBWA 2RI5A 4HA8A 2MWPA 4M75F 3A8MB 4C0DB 3FC3A 4C0GA 3QO3A 4FU6A 3L2RA 2R5MA 2CZ6B 2GFUA 2JTMA 1IREB 1VQ8T 1U1SA 2ZPHB 3G6ET 3BW1A 4BD3A 2VV5A 1BIAA 4WF2A 3WXMB 3NTKA 1IZ6A 5GAMf 2DAQA 5IAYA 1YIJA 5LJ5e 5GANh 1VQKA 3P8HA 4E7HA 2DZ9A 2EKOA 4XAXB 4M7AE 1UGRB 2RI2A 4NS5A 2E6ZA 1N9RA 4J8OA 5CAIA 1VQOA 4JLIA 3CBMA 1VQ6T 4LDVA 1VQ5T 5LJ3g 4RG8A 5GMKh 4D6WA 4PJOG 1YJNA 4PJOA 3OYHA 4BI4A 3X20B 4JS5A 5GAOl 4O6JA 4X34A 3PIOA 4PLIA 4BE2A 3E9GA 3CMAA 1D3BA 3MEUA 3OYJA 3CC7A 3L2UA 3CCSA 2HAXA 1VIEA 3M58A 2V8KA 4C8QE 1DJ7B 2K3XA 2PU9B 2VXEA 1H641 5LJ3e 1VQOT 4N4GA 4C5EA 4J5YA 1YJ9A 2ZZDA 1XTDA 4J83A 4II1A 4BE1A 1YJNT 4PJOC 1VQ9T 2FL7A 2IG0A 2E1HA 1K8AU 2X35A 3OS2A 2FYKA 2G3RA 3EFSA 3JCMQ 3J7AF 4QQDA 4B9XA 2JOYA 2DD5A 3CCRA 3ZFJA 3OYDA 3OYKA 3CC4T 1G5VA 1M90C 3JRZA 2LCLA 4BI8B 4PJOF 2RHYA 1NPPA 1Y96B 5GAN8 4P5NA 3HHTB 2RM4A 4J7IA 2CKKA 2E6NA 2RH2A 3FJPA 1YJ9T 5FRMA 1LJOA 1I4K1 5D6XA 4IKFA 2EQKA 1VQLA 2XKOC 3CMEA 2RD1A 3OA6A 5A0DA 4JJNK 4MZPA 4XU2A 3CEYA 5A0GA 4C92B 4JS4A 5CVIA 3G4SA 2QQRA 3M4GA 3RIRA 4C0DC 1YITT 2P0QA 2LVMA 2AHJB 1YHQA 3SFMA 3UPUA 3M59A 1KHIA 2MMPA 2BIVA 3A8LB 1M1KC 2HQXA 2RJFA 4M75E 2EJ9A 5CK9A 1VQPT 1M1GA 4RCCA 2O01E 1Q7YU 2RJCA 1OI1A 1VQLT 3SDZA 3VKIA 3OYGA 3GF5A 3JCMb 1O9SA 3MP1A 4LDWA 4ZN3A 5GANd 1BIBA 5KE3A 3V8KA 4M7DD 3M5AA 3J81E 2EJGA 4TVRA 2KMTA 1UGQB 5CKHA 2EJFA 4NL2A 5CKEA 1QVGS 3BDUA 2GFAA 3QKJA 2EFIA 1N9SA 5GMKl 1Q81U 4KBMB 1M5Q1 2KY9A 3QSUA 5GAN3 2QI2A 4M78D 4BACA 4QVZA 1GXIE 5A0LA 3HFOA 3J80E 3EAEA 4J6WA 4Z02A 3UWNA 3JCMP 3JCMc 3X26B 3OS0A 2ZPGB 2LT1A 5FROA 3GPLA 3CCEA 3F70A 5CO7A 3E1SA 1Q82C 4M7AD 3KXTA 1V29B 1BKBA 5GANg 2PUOB 5FU6B 1N8RC 2WACA 3META 4C92G 3OYEA 4FT4A 3CPFA 2VUBA 4E7KA 1G3WA 2PVGB 1S72A 2L89A 5IT9E 2RI3A 3WVEB 1FX7A 5GAOn 4CRIA 3JCMh 3MCAB 3JSCA 1BI1A 5EG2A 2VXFA 5LJ3d 4OP0A 4OGCA 5GAMj 3PMIA 2X4YA 4M7DB 2BKDN 2EQMA 3CCET 4L5GA 2DIQA 4PKCC 5GANe 1NPRA 4C8QD 2RB6A 4JRQA 1R8OB 1QVGA 1VQNA 4C5GA 5M9OA 3QHSA 3SD4A 2QDYB 2P0KA 3OSVA 2DD4A 2R57A 4C92C 3JB9D 1YI2T 1S72T 4VUBA 4N0AC 2XU8A 3I56T 2E41A 5DLOA 4M78E 3V8JA 4MZTA 1VQ5A 1XQHA 3OYYA 4OF1A 2LT4A 5GMKe 4XQ3A 4XU3A 3HP9A 1Q86C 3LGLA 3A8GB 4PNOA 3TCJA 3AHUA 2RHUA 1K73C 4ZTJA 3ASKA 1KQSS 1U8RA 3OYAA 5KH6A 1VQ4T 3VJPA 1X75C 2DIGA 4C92F 4FT2A 5I21A 5LJ5f 3FB9A 3KUFA 4RG2A 2K5IA 1VQNT 4NL3A 4JUVA 3FEOA 2E12A 4M7AB 3S3OA 4MZMA 1I5LA 2DXUA 2MI6A 4Y28E 3LWHA 1PSFA 3CBOA 4KUIA 3I55A 4M77B 4ZTFA 5CQXA 5AYFA 2O4XA 1VQ9A 3CCMA 3L1AA 1N27A 5D6WA 2LTOA 4PL6A 3GNFB 2M1HA 3M55A 3M9QA 2P0PA 2JTFA 1UEBA 2MWOA 2XD0A 3OMGA 4HT9A 4BUGA 4ZGEB 3CBPA 3CC4A 4OB2B 2ZPBB 3OY9A 4LDXA 2GQVA 2NLUA 1K9MC 1M90U 3CCQT 4M75D 5LJ3f 4C8QB 2GCXA 1JBMA 1M9SA 2L3RA 4N4IA 5FRNA 3PTAA 4M7DG 2JN0A 2OTJA 4M7DA 3I55T 3UT1A 3MHXA 3NFCA 3CC2A 3GLXA 1M1FA 3CCMT 2M9UA 1HK9A 3VYGA 4EDUA 3OYCA 2DXTA 5KCHA 5FU6C 3ZBDA 2DTHA 1KQSA 3CXCS 5GAMh 4MDWA 1I8FA 3C95A 3HFNA 1UGPB 1WNLA 2LX9A 4RCBA 3OYMA 3OYLA 1YITA 3QYHB 2XI9A 4A4HA 4HCBA 1JRIA 4ELZC 2QEXA 3MEAA 1WJQA 1KC8C 3V7CA 5CR2A 2E70A 3E19A 4ZN1A 4OMFB 3JAME 1VQPA 3T9NA 4F7UB 5CKBA 3JCMd 1M1KU 4M7DC 2YLBA 3CC2T 4EMGA 4XTXA 3L42A 2E5QA 1WPYA 4HT8A 3PIPA 2VGNA 1SSFA 2M0OA 5CQYA 3OW2S 3RERA 2XDDA 4M7AA 3GP8A 3V7SA 2EIFA 3P8BB 3G7ZA 2JVVA 3MEVA 1JJ2S 3L2ZA 5GAN7 4M77G 4M7DF 2X4WA 4M77A 4OVAA 1Y07A 2E64A 4ZGJB 5I2SA 4E7LA 2QEXT 2QQSA 4J7FA 1EIFA 3FLGA 1FWZA 2DTIA 3DLLA 4KUDK 3VUZA 2CZ0B 2PVDB 3GOXA 3TEEA 4M75B 2RK1A 3MP8A 3CD6A 2KK4A 2RHXA 2CZ1B 3LW5E 3X25B 2QXFA 4C0FA 3GNGA 4A4KA 3L2WA 3L2QA 4RKUE 4L6V5 5GAN2 4M7AC 4Y91A 1X01A 2BUDA 4JDSA 4MMLA 4C92E 4C8QA 5DM7R 1I81A 3X24B 3JB9H 3JCMg 2QQAA 2YRVA 4M77C 2XK0A 5GMKi 2K5LA 3OB9A 1KQ1A 2I2LA 2Y90A 3ME9A 3E9FA 5HY6A 3QIIA 3A8HB 2JZ2A 3VUBA 1Q82U 5C0MA 4XTYA 3RESA 3RMQA 1YJWT 4BDZA 1NJIC 3QPHA 4OB3B 1N8RU 4BY6B 1W2BS 4EMKB 1XNIA 3CD6T 3C12A 2CGHA 2YHTA 5LL6S 4M77F 2HQEA 3LLRA 3OW2A 5HK3A 4C8QC 3JCMe 3HKSA 4F7UG 1QVPA 2FB7A 4F7UA 5FU7B 1JJ2A 4XU0A 3JCMV 2ZGWA 2O4XB 4JRKA 3RMSA 3S6WA 4PLLA 4BB7A 3VYHB 3RUXA 4KT0E 4ZGDB 1Y71A 2RO0A 4KULA 1YI2A 3I56A 3G71A 3CPWS 2EQJA 3QJ6A 4XTWA 2F5TX 2X4JA 3LGFA 1RI0A 1ZQ1A 3HRTA 2K2VA 2XDPA 4IUVA 1QW1A 4X9CA 1TH7A 3M54A 4ME7A 3JCMW 3OMCA 1Q86U 4A4EA 1OZ2A 3SB2A 3CCUA 3TU4K 4IUTA 3V7RA 1VQ4A 2DZCA 1K73U 5DY9A 3QXEB 4IURA 3ZEHA 2KVQG 2X4XA 3SWNB 4M75A 4E47A 5LJ5j 3GIBA 4PJOE 3M57A 5GANf 2OTJT 2LQKA 5J3BA 1QVFS 2V8IA 3PMTA 1WGSA 2DPPB 4X9DA 1WQWA 2M16A 1W2BA 3PGGA 3G71T 3LX7A 1KD1C 3Q1JA 4EMHA 4F7UF 1NZ9A 4FL6A 1BI2A 5D6YA 4QVCA 3MP6A 4M78B 2DK3A 3S3NA 5A2QE 4XTVA 4QW2A 4B9WA 5CKFA 3DB3A 2R5AA 3A8OB 1BI3A 4OGEA 3CCUT 1LNXA 2OAUA 2XHCA 2KAFA 4C0ZA 5GAN5 4M75C 4EMKA 5GAMg 1O75A 5J39A 3OYBA 3DB4A 2QQ9A 2XG8D 4N4HA 2K57A 4DQ2A 5LJ3j 3CCQA 1K9MU 3CPWA 5GAOm 2C06A 3JCMX 3JB9I 4LD9K 2LQ8A 3UDCA 1WJRA 1VUBA 2B8AA 5CCAA 4J6XA 4A54A 3NTIA 4FSXA 2MF2A 2PUKB 4QQ6A 5GAN4 1ZBXA 5CIUA 2MAMA 4HCZA 3OYNA 3OSSC 4BY6C 4J6YA 3S3MA 2Y4XA 3N5BB 4C5HA 2HBPA 4EMKC 5GAMe 2D6FA 2JNGA 3OBYA 3RKWA 1HXDA 3C4SA 1QVFA 3H6ZA 2P4TA 1OYXA 2EYQA 1KC8U 1FXXA 5FU7C 1BYMA 1RL2A 2EWNA 1QP2A 2WSCE 2ZPEB 4M77E 3H8ZA 3SWNA 2KQWA 1VQMA 4HCCA 2Y4YA 2OTLA 3O8VA 4IUPA 3BDLA 3MEWA 4OB0B 4C92D 2D0QB 3OYIA 4L59A 5LJ5h 1YIJT 3L2VA 2HD0A 1VQKT 4YTLA 2HNIA 4M78G 4DA4A 4HKEA 4M78A 3VU3C 2DO3A 2RJEA 2H3JA 3DKMA 3VV0A 4CI0C 5L8RE 2L5QA 4DOVA 1MHNA 4DOWA 5GAOr 3INZA 1WQ7A 2IVWA 3QJYA 5KCOA 3CCJA 2PQWA 4JRPA 1BI0A 1G3YA 2DXBA 3M56A 3PT9A 4UC4A 4XTUA 3SWNC 1LOJA 1VQMT 2F69A 2OTLT 4ATOA 5HK0A 4R56A 4LD6A 4M7AG 3JCMJ 4E7JA 3X28B 1U1TA 2ZPIB 2GF7A 3M53A 1KQ2A 2V8JA 1M8VA 4M78C 3C94A 3CMAT 3FRNA 3PFSA 5HKCA 3M4YA 3MO8A 3CC7T 3CCST 3V8LA 5LJ3h 2RHZA 1X6OA 5GAN6 1YJWA 3CCJT 1W4SA 3FIFA 2QTXA 4IUQA 4F7UE 2L8DA 3EFRA 2QA4A 1NJIU 3QZ9B 3LYIA 1UGSB 3DLMA 4MDXA 2E10A 3BFMA 2A7YA 3HRSA 3QG1A 2D9TA 4C5IA 1B34B 2K3YA 2WSFE 3PNWC 1K8AC 2F5KA 4M78F 3QUIA 3QZ5B 4C8QG 3CXCA 3ER0A 5GMKm 1N6AA 3P8DA 3KBGA 3JB9G 2DJZA 4PJOD 5C6SA 2CYZB 4NOYA 3CCRT 2VC8A 4QVDA 3BY7A 3LH0A 2QA4T 3TREA 4A4GA 3RKYA 4M7AF 2LC4A 5FLXE 1VIFA 1XOVA 2EQUA 2LCCA 3RKXA 1UB4A 1AHJB 4MMKA 1YCYA 3URGA 3CMET 5GAOp 2E65A 2RK2A 3NTHA 3QYGB 4RMOA 1ZHIA 4FIBA 4IUUA 4O5VA 3JCMf 2FVUA 2K4YA 4OB1B 2A3LA 3OQ5A 3G4ST 2DEQA 5GANj 2KSSA 4JLGA 1WJSA 3WVDB 3JB9J 2LNVA 3FDRA 3R6OA 1YHQT 2R58A 2YLCA 3CCVA 1NE8A 3A5ZB 1H3ZA 1PSEA 4A53A 1P92A 4C8QF 2CS7A 3HL8A 1Q7YC 5I2MA 2ZPFB 2LRQA 1KD1U 4Q5WA 5GAMd 5GMKj 3JB9F 3QDRB 5CKDA 5LJ5d 4BE0A 4LDUA 4EPCA 2LDMA 4ELYC 2ZCFB 2RA2A 2K5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0D C;  5FU7 C;  4C0G A;  4C0F A;  4BY6 B;  4BY6 C;  5FU6 B;  5FU6 C;  4C0D B;  5FU7 B; 
#chains in the Genus database with same CATH topology
 1Y96 A;  1KQS P;  4ESR A;  2J6O A;  2DKG A;  2XID A;  1Y7X A;  1VQ7 A;  3HSB A;  2QAZ A;  1M4Z A;  2EAY A;  1OZ3 A;  3VS5 A;  4N0A A;  1G3S A;  2JMC A;  3UA6 A;  1ABO A;  1YWO A;  2K7A A;  3REB B;  1KJW A;  2QQB A;  2AKK A;  3CCL T;  2GQI A;  4M75 F;  2MWP A;  4C0D B;  2QDL A;  2GFU A;  2JTM A;  1VQ8 T;  3VRY A;  3G6E T;  4BD3 A;  1BIA A;  2VV5 A;  3WXM B;  1YIJ A;  1VQK A;  2DAQ A;  5LJ5 e;  5GAN h;  2D8J A;  4E7H A;  4XAX B;  2RI2 A;  3M0P A;  4NS5 A;  2DX1 A;  1TG0 A;  3IQL A;  3CBM A;  1OOT A;  2DBK A;  1MMG A;  1WZO A;  1I07 A;  5GMK h;  2F1L A;  1VQ9 Q;  3CCM Q;  1WX6 A;  2EVR A;  1WHH A;  4RTX A;  4JS5 A;  5GAO l;  4O6J A;  5IXB A;  2JJ9 A;  3MEU A;  2V8K A;  1DJ7 B;  2VAS A;  2VXE A;  2P4R A;  1VQO T;  4J83 A;  2OTJ Q;  2FL7 A;  2RNA A;  3CC2 Q;  2RN8 A;  2QK0 A;  3EFS A;  2DVJ A;  4QQD A;  1ARK A;  2DD5 A;  3CCR A;  1YIT Q;  4BI8 B;  2LCL A;  4PJO F;  1W2B P;  3FJP A;  5FRM A;  1I4K 1;  4PJM A;  1VQP Q;  4IKF A;  1VQL A;  1IB8 A;  2XKO C;  5A0D A;  2GTJ A;  4AG2 C;  4MZP A;  5A0G A;  4HVU A;  2P0Q A;  1U5S A;  1KHI A;  2MMP A;  3A8L B;  2MYS A;  2RJF A;  7AT1 B;  1UGQ B;  1TUG B;  2W10 A;  5CKH A;  3AT1 B;  1PM3 A;  2GFA A;  2A37 A;  2HCK A;  3E2U A;  1Q81 U;  1M5Q 1;  3QSU A;  1TUD A;  1RAG B;  3J80 E;  4J6W A;  1GCQ C;  3JCM c;  4ZNX A;  1ZA1 B;  1WHL A;  2M0Y A;  4PJJ A;  5KYX A;  4AT1 B;  2LQN A;  1N8R C;  4CC4 B;  4D8D A;  4FT4 A;  4E7K A;  1G3W A;  2HKQ B;  5GAO n;  1KD1 R;  2HQH A;  1BI1 A;  1CKB A;  2JS0 A;  4OP0 A;  4M7D B;  1OX9 A;  2BKD N;  1Q95 G;  4PKC C;  4C8Q D;  2RB6 A;  1R8O B;  1W70 A;  3QHS A;  3SD4 A;  5EC7 A;  1S72 T;  2P0K A;  2DD4 A;  2R57 A;  1WFW A;  2KT1 A;  1MV3 A;  4N0A C;  4VUB A;  2HMA A;  2ED1 A;  4X1V A;  4LNP A;  3HP9 A;  1GBR A;  2MIO A;  4C92 F;  3A98 A;  5LJ5 f;  5AT1 B;  2CT4 A;  4NL3 A;  1NYF A;  2E12 A;  2DXU A;  2MI6 A;  4Y28 E;  1VQ9 A;  2VVK A;  3CCM A;  3L1A A;  1N27 A;  5D6W A;  3M55 A;  2JTF A;  3PE0 A;  4LDX A;  1M90 U;  1LPL A;  3EHR A;  2OTJ A;  1G2B A;  2JN0 A;  3NFC A;  3CC2 A;  2V1Q A;  3GLX A;  1M1F A;  1RAC B;  3VYG A;  1VQM Q;  2OTL Q;  2DTH A;  3CXC S;  4MDW A;  1JXM A;  3C95 A;  1UGP B;  3OYM A;  1YIT A;  3OYL A;  2XI9 A;  3M0R A;  1WJQ A;  4ZN1 A;  1VQP A;  1QWE A;  4F7U B;  1M1K U;  2YLB A;  1RAE B;  3L42 A;  1JU5 C;  4KGV B;  5CQY A;  3RER A;  1GL5 A;  4M7A A;  3V7S A;  1V76 A;  3G7Z A;  3MEV A;  1JJ2 S;  2IIM A;  5IHN A;  3EHQ A;  4OVA A;  4M77 A;  5I2S A;  3FLG A;  1FWZ A;  4CC2 A;  3VUZ A;  2CZ0 B;  1Y0M A;  3GOX A;  1C6V X;  4JZ3 A;  2RHX A;  4FYV B;  5GAN 2;  4L6V 5;  4Y91 A;  2BZ8 A;  5KYW B;  4KH1 B;  1UJ0 A;  2YRV A;  1KQ1 A;  3PVQ A;  2JZ2 A;  3VUB A;  1Q82 U;  5C0M A;  1UJY A;  1YJW T;  1AOJ A;  1NJI C;  4OB3 B;  5D7U A;  2X9H A;  1XNI A;  3CD6 T;  5FW9 A;  1WLP B;  8ATC B;  3OW2 A;  2G6F X;  4C8Q C;  3JCM e;  3HKS A;  2ROL A;  2ZGW A;  2LZ6 B;  2O4X B;  2NUP A;  3RUX A;  1YP5 A;  4F14 A;  1Y71 A;  2CP5 A;  2LJ0 A;  4LUE A;  3CPW S;  1WXU A;  2F5T X;  4IUV A;  1K0X A;  1ZQ1 A;  3H0H A;  2RQV A;  1GFD A;  2KNB B;  3OMC A;  1Q86 U;  4OMM A;  4A4E A;  1G8X A;  1K0S A;  5DY9 A;  4E47 A;  3GIB A;  2X4X A;  4AFS C;  4M75 A;  1IO6 A;  5J3B A;  2C0O A;  1QVF S;  5L23 A;  1WGS A;  2M16 A;  3PGG A;  3G71 T;  4EMH A;  1PKT A;  1NZ9 A;  1BI2 A;  4QVC A;  4M78 B;  4QW2 A;  4OGE A;  3A8O B;  1LNX A;  1JEG A;  2XHC A;  1ZSZ C;  4C0Z A;  4DBQ A;  2FPD A;  2KYM A;  1T0H A;  5GAM g;  2QQ9 A;  1K73 R;  1HD3 A;  2K57 A;  2PNI A;  5GAO m;  4FYY B;  2C06 A;  1AWX A;  2SEM A;  4LD9 K;  2LQ8 A;  5CCA A;  2B8A A;  4DBF A;  3A1P A;  4J6Y A;  1OX8 A;  2ABL A;  3ZL7 C;  4C5H A;  2HBP A;  4EMK C;  1HXD A;  1PRL C;  2EYQ A;  1PNJ A;  1KC8 U;  1BYM A;  2WSC E;  1K76 A;  4M77 E;  1D1A A;  2X51 A;  3SWN A;  2XMF A;  2KQW A;  1VQM A;  1K9M R;  2KYB A;  2Y4Y A;  3LH5 A;  2OTL A;  3MEW A;  4FSS A;  1YIJ T;  1VQK T;  2HD0 A;  4DA4 A;  3VU3 C;  1IGQ A;  2DO3 A;  2IPO B;  4DOV A;  3CC4 Q;  3TSZ A;  2PQW A;  1BI0 A;  4XTU A;  4UC4 A;  2L0A A;  1UGV A;  4M7A G;  4E7J A;  3X28 B;  3MPU B;  4K11 A;  2GF7 A;  5HCK A;  2O9V A;  3PFS A;  3M4Y A;  1FYN A;  2RHZ A;  1X6O A;  1W4S A;  2QTX A;  4IUQ A;  2CP7 A;  2L8D A;  4LXC A;  1PRM C;  3HRS A;  1R77 A;  2K3Y A;  1K8A C;  1M1K R;  3QUI A;  4PJO D;  3CCR T;  1E6G A;  2AT1 B;  3LH0 A;  2QA4 T;  5ECA A;  1VIF A;  1SKU B;  1NLO C;  1UB4 A;  1TOV A;  3URG A;  2EQI A;  2VKN A;  4RMO A;  4FIB A;  4O5V A;  3JCM f;  2A3L A;  2DEQ A;  5GAN j;  2LNV A;  3R6O A;  1E6H A;  1KSW A;  2A28 A;  1NE8 A;  3A5Z B;  2LQW A;  1H3Z A;  1HJD A;  4C8Q F;  2CS7 A;  1MV0 B;  3HL8 A;  1Q7Y C;  5GAM d;  5GMK j;  5CKD A;  5LJ5 d;  2P84 A;  4LDU A;  1QWF A;  3VYH B;  3A8G B;  2RHI A;  4M75 G;  3RBB B;  4B6M A;  5IN1 A;  1B34 A;  1QMC A;  3QBY A;  3CCV T;  2DTO A;  3HPW A;  4C92 A;  4WCI A;  1YBY A;  4OMN A;  4FM4 B;  3SEM A;  4M7D E;  4R55 A;  5KE2 A;  4BDY A;  4GY5 A;  4V2S A;  2FRW A;  4RTT A;  1QP3 A;  1VQN Q;  3A8M B;  4C0G A;  3QO3 A;  4FU6 A;  2K6D A;  3L2R A;  2BZX A;  2ENM A;  1WHK A;  3BW1 A;  4WF2 A;  5IAY A;  2GGR A;  2JM9 A;  3NGP A;  2KEA A;  1UGR B;  1N9R A;  5CAI A;  1JXO A;  2EYY A;  4JLI A;  3UA7 A;  1VQ6 T;  4LDV A;  5LJ3 g;  4RTZ A;  4PJO G;  3I55 Q;  2CP6 A;  2DM1 A;  4JJC A;  4X34 A;  4BE2 A;  2O31 A;  3OYJ A;  3L2U A;  3I35 A;  2RPN A;  2BE7 D;  1H64 1;  5GJV B;  4J5Y A;  2ZZD A;  4II1 A;  1YJN T;  4PJO C;  1VQ9 T;  3D7S B;  2JOY A;  3ZFJ A;  3EGD B;  4DEX A;  2YUO A;  3OYD A;  4OML A;  1GRI A;  1QVG P;  1G5V A;  3M0T A;  4P5N A;  2QEX Q;  1YJ9 T;  5D6X A;  5KYX B;  2J05 A;  3OA6 A;  4JJN K;  3CEY A;  4JS4 A;  3G4S A;  1AD5 A;  1YIT T;  2FZC B;  2AHJ B;  2YRC A;  3M59 A;  3BE3 A;  5CK9 A;  1VQP T;  1M1G A;  1X27 A;  4J9F A;  3VKI A;  2DE0 X;  3MP1 A;  4LDW A;  3I5S A;  1GCQ A;  3J81 E;  2AZV A;  4JJD A;  3EGU A;  2EJF A;  2LNH B;  3QKJ A;  2EFI A;  3TVT A;  5GMK l;  1SSH A;  4BAC A;  4M78 D;  1U3O A;  1GXI E;  5A0L A;  3HFO A;  3UWN A;  3JCM P;  2NUT A;  1OV3 A;  2PZ1 A;  2O88 A;  1V29 B;  2L3S A;  5FU6 B;  1R0C B;  2WAC A;  4C92 G;  2VUB A;  2F2V A;  2PVG B;  5IT9 E;  1YI2 Q;  3O5Z A;  3VRZ A;  5LJ3 d;  2A08 A;  4HXJ A;  3CCU Q;  3CCE T;  4L5G A;  2DIQ A;  5GAN e;  4Z88 A;  2CH4 A;  2KXC A;  1VQN A;  2QDY B;  4C92 C;  3PVL A;  4M78 E;  3V8J A;  1XQH A;  4OF1 A;  5GMK e;  4XQ3 A;  1PD1 A;  4XU3 A;  1ZLM A;  3ASK A;  2AK5 A;  1MND A;  3OYA A;  3VJP A;  5I21 A;  5IHI A;  3KUF A;  2K5I A;  1OEB A;  2V1R A;  4M7A B;  4ANJ A;  3CCQ Q;  3EGX A;  2PTK A;  3I55 A;  4M77 B;  4DBH A;  3GNF B;  2QGG A;  2DL8 A;  1UEB A;  2XD0 A;  4HT9 A;  2CP0 A;  4J9D A;  3QWX X;  2KRM A;  2NLU A;  1PKS A;  2L3R A;  1JBM A;  5FRN A;  2JT4 A;  4N4I A;  3PTA A;  2D8H A;  3REA B;  3UT1 A;  3MHX A;  1M3A A;  1HK9 A;  5GAM h;  1VA7 A;  1SPK A;  4IIM A;  5KYY A;  4HCB A;  1ZSG A;  2YUP A;  2QEX A;  3MEA A;  3V7C A;  5CR2 A;  3JCM d;  3CCJ Q;  2DLP A;  3U23 A;  2VGN A;  1SSF A;  2HDA A;  1JO8 A;  3GP8 A;  1M8M A;  2EIF A;  1U06 A;  2JVV A;  3EH1 A;  5IHK A;  4M7D F;  3EFO A;  2LJ3 A;  4Z8A A;  2KI7 A;  2QQS A;  2DTI A;  2GBQ A;  3DLL A;  2LCS A;  1TXQ A;  4M75 B;  3LW5 E;  2QXF A;  4C0F A;  4A4K A;  3L2W A;  3L2Q A;  2BUD A;  3ULR B;  4C8Q A;  1I81 A;  3X24 B;  3JB9 H;  1AEY A;  1YWP A;  1NYG A;  2W0Z A;  2XK0 A;  5GMK i;  3OB9 A;  2I2L A;  2Y90 A;  1UTI A;  2KE9 A;  3A8H B;  4FYW B;  4KH0 B;  2BZY A;  4XTY A;  3RES A;  3RMQ A;  4F04 B;  3C12 A;  4AFZ C;  2DF6 A;  4Y92 A;  5LL6 S;  3JV3 A;  5HK3 A;  1PG5 B;  1YCS B;  2J6F A;  1JJ2 A;  4XU0 A;  3TSW A;  2DER A;  3S6W A;  3RMS A;  1UUE A;  4BB7 A;  3FJ5 A;  1YI2 A;  4XTW A;  1QLY A;  2X4J A;  3LGF A;  3HRT A;  1B07 A;  2COW A;  1TH7 A;  1N8R R;  4ME7 A;  3JCM W;  4J9H A;  3CCU A;  4IUT A;  1K73 U;  2LMJ A;  3QXE B;  4IUR A;  2KVQ G;  1ZSZ A;  3SWN B;  3M57 A;  5GAN f;  2V8I A;  3PMT A;  2I0N A;  4X9D A;  1KD1 C;  4F7U F;  2QGF B;  1N5Z A;  3CCL Q;  1B3Q A;  3VS3 A;  1TUC A;  2KRN A;  2OAW A;  2DA9 A;  2LX7 A;  1VQ8 Q;  5GAN 5;  5I22 A;  3G6E Q;  4EMK A;  2H8H A;  3DB4 A;  4N4H A;  2ZAE A;  3CCQ A;  1G83 A;  1K9M U;  3CPW A;  3UDC A;  2YUN A;  4OMO A;  3NTI A;  3SHW A;  2PUK B;  1ZBX A;  2MCN A;  2MAM A;  3OSS C;  4BY6 C;  3S3M A;  3N5B B;  2D6F A;  3C4S A;  1QVF A;  4CC3 A;  1M2V A;  2HSP A;  5FU7 C;  1RL2 A;  1QP2 A;  2JW4 A;  2ZPE B;  1VQO Q;  2DRK A;  4OB0 B;  3UAT A;  4L59 A;  3L2V A;  1X6B A;  2RJE A;  5FWC A;  3DKM A;  3VV0 A;  4DOW A;  3CCJ A;  1UE9 A;  2IVW A;  1LVK A;  2DXB A;  3PT9 A;  4AG1 C;  4RTY A;  1LOJ A;  1S1N A;  2H3E B;  1KK7 A;  1KQ2 A;  1M8V A;  3FRN A;  5HKC A;  1M3B A;  3V8L A;  5LJ3 h;  3FIF A;  1KFZ A;  3LYI A;  3DLM A;  2E10 A;  3BFM A;  2A7Y A;  3QG1 A;  1B34 B;  1MMN A;  2F5K A;  4M78 F;  4C8Q G;  3GBQ A;  5GMK m;  1W6X A;  3EH2 A;  3KBG A;  1WHM A;  2DJQ A;  2LP5 A;  3H9N A;  1RLP C;  4A4G A;  3RKY A;  2EKH A;  1FMK A;  1T0J A;  4E6R A;  5GAO p;  2E65 A;  2SRC A;  3NTH A;  4OB1 B;  3G4S T;  4JZ4 A;  3TQ7 P;  1WJS A;  1PSE A;  5KYU A;  4PFP A;  2ZPF B;  2LRQ A;  4KGX B;  1X6G A;  2DL4 A;  4HVW A;  1H3H A;  4ELY C;  2ZCF B;  2VYT A;  3HRU A;  4FW2 A;  2K3B A;  3VS0 A;  1QQJ A;  2A36 A;  3OYF A;  4XU1 A;  5J26 A;  2M02 A;  2RQR A;  2DMO A;  4QQG A;  4OMP A;  1Q81 C;  2FPE A;  4M77 D;  1JB0 E;  4A4F A;  3CCL A;  4GLK A;  1S72 Q;  1OPK A;  4JRI A;  1KIK A;  3M0U A;  1VQ8 A;  2WSE E;  1RUW A;  1G3T A;  3G6E A;  1BB9 A;  2CZ7 B;  2EBP A;  5GAO q;  2RQT A;  3OS1 A;  2VGM A;  1MNE A;  5LJ5 g;  1VQ7 T;  3RDV A;  4XK8 E;  2KDS A;  4XTZ A;  1KG1 A;  2PVO B;  3OS5 A;  2RI5 A;  1VQ5 Q;  2RQU A;  2CP2 A;  3M0Q A;  1D0X A;  2CZ6 B;  1IRE B;  1U1S A;  3KFV A;  1EFN A;  3NTK A;  1IZ6 A;  3P8H A;  2EKO A;  1K9A A;  1HSQ A;  4M7A E;  3EG9 A;  4J8O A;  1I1J A;  1VQO A;  2OX7 A;  2OI3 A;  2FO0 A;  2F2X A;  2DBM A;  3EG2 A;  2YT6 A;  4PJO A;  3OYH A;  1NBE B;  4PLI A;  1JJ2 P;  3I9Q A;  3E9G A;  1D3B A;  2HAX A;  3M58 A;  1RAA B;  2PU9 B;  2EYW A;  1MMD A;  1AVZ C;  3G1J A;  2X35 A;  1A0N B;  4B9X A;  1D09 B;  1M90 C;  3JRZ A;  2CP3 A;  1NM7 A;  2RHY A;  2ECZ A;  1Y96 B;  1LCK A;  2NUT B;  5GAN 8;  1UHC A;  2HBW A;  2CKK A;  2E6N A;  2RH2 A;  1C0M A;  1VYT A;  1LJO A;  2EQK A;  4AFU C;  2RD1 A;  5CVI A;  2QQR A;  3RIR A;  4C0D C;  1OUL A;  3UPU A;  1H92 A;  2CH4 W;  1Z9Z A;  2EPD A;  2BTT A;  4Z89 A;  1M1K C;  4M75 E;  2EJ9 A;  1YJW Q;  2O01 E;  2RJC A;  1VQL T;  3SDZ A;  3GF5 A;  3JCM b;  1O9S A;  4ZN3 A;  3CD6 Q;  5GAN d;  1BIB A;  5KE3 A;  3V8K A;  4M7D D;  1UG1 A;  4TVR A;  2KMT A;  1MMA A;  4NL2 A;  2ESW A;  1GFC A;  1QVG S;  3BDU A;  2KGT A;  1JQQ A;  4KBM B;  4OMQ A;  5GAN 3;  2QI2 A;  4QVZ A;  3EAE A;  3OS0 A;  1Q7Y R;  2LT1 A;  5FRO A;  3GPL A;  3EGX B;  1RAH B;  1Q82 C;  3E1S A;  1QCF A;  3KXT A;  1BKB A;  1T3S A;  1SG5 A;  1S72 A;  2QAS A;  3CPF A;  2RI3 A;  3WVE B;  2DNU A;  3I56 Q;  3G71 Q;  1FX7 A;  3MCA B;  5GAM j;  4OGC A;  3PMI A;  2EQM A;  1VQ4 Q;  1PC0 A;  1UEC A;  1NPR A;  2HL3 A;  2YWW A;  4JRQ A;  2DL3 A;  4FW1 A;  3JB9 D;  1YI2 T;  4PK4 A;  1VQ5 A;  5DLO A;  1ZUK A;  1NEB A;  3OYY A;  5KYY B;  1AZE A;  1Q86 C;  3AHU A;  2RHU A;  1KQS S;  1U8R A;  1X2K A;  5KH6 A;  1X75 C;  2DIG A;  1UFF A;  4FT2 A;  2EGE A;  3FB9 A;  4F17 A;  4FCY A;  4JUV A;  1SF9 A;  3S3O A;  3NMZ C;  1I5L A;  1WA7 A;  1PSF A;  3EFO B;  4KUI A;  2KT8 A;  5CQX A;  2O4X A;  2L3P A;  2GNC A;  3OW2 P;  2LTO A;  1M3C A;  1QKX A;  3VS4 A;  2P0P A;  2MWO A;  3OMG A;  1D1C A;  4BUG A;  4ZGE B;  3CC4 A;  4OB2 B;  2ZPB B;  1YIJ Q;  3OY9 A;  2GQV A;  3CCQ T;  1ZX6 A;  4C8Q B;  4CC7 A;  2GCX A;  4M7D G;  2DYI A;  3MKD A;  1WDX A;  2EGC A;  3CCM T;  3OYC A;  5KCH A;  3ZBD A;  2JXB A;  3EG0 A;  4KGZ B;  2HSE B;  1I8F A;  2JMA A;  3HFN A;  2KRS A;  4RCB A;  3QWY A;  1VOM A;  2X3W D;  4ELZ C;  2YUQ A;  1KC8 C;  1BCM A;  2E70 A;  3E19 A;  2OTJ T;  4M7D C;  5CKB A;  2AIR B;  3CC2 T;  2FG0 A;  1WPY A;  4HT8 A;  4DBR A;  2M0O A;  4JJB A;  2XDD A;  2ATC B;  2X3X D;  2X4W A;  1Y07 A;  2DEU A;  3RR6 A;  2KRO A;  4ZGJ B;  1EIF A;  5GJW B;  3HTR A;  2QA4 Q;  1ZSZ B;  3TEE A;  1SRL A;  2RK1 A;  3MP8 A;  3CD6 A;  2KK4 A;  2HL5 C;  2CZ1 B;  4FYX B;  3X25 B;  4RKU E;  1IHV A;  4C92 E;  4JDS A;  1UDL A;  5DM7 R;  2MK5 A;  3C0C A;  3JCM g;  2QQA A;  2E5K A;  1SHF A;  2K5L A;  3ME9 A;  3E9F A;  1HYO A;  4BDZ A;  3QPH A;  1N8R U;  1W2B S;  1Z9Q A;  4EMK B;  2CGH A;  2YHT A;  4M77 F;  2C0I A;  3LLR A;  3H0I A;  4F7U G;  2FB7 A;  3JCM V;  4JRK A;  4ZGD B;  2RO0 A;  2JTE A;  4KUL A;  3I56 A;  3G71 A;  3CCV Q;  4RTW A;  1RI0 A;  2K2V A;  2RQW A;  4X9C A;  4HCK A;  1QKW A;  1OZ2 A;  1M2V B;  1BU1 A;  1VQ4 A;  2DZC A;  1RAD B;  1M30 A;  2V26 A;  3ZEH A;  6AT1 B;  2LQK A;  2FZK B;  1W1F A;  1WQW A;  3Q1J A;  1Y57 A;  2ROT A;  2DK3 A;  5A2Q E;  4B9W A;  2CSI A;  5CKF A;  1BI3 A;  1PWT A;  1IRX A;  4PFZ A;  1WXB A;  1O75 A;  5J39 A;  5LJ3 j;  3JCM X;  3JB9 I;  1VUB A;  4J6X A;  4A54 A;  1VQ6 Q;  4FSX A;  4QQ6 A;  4AFQ C;  1BBZ A;  2CRE A;  3OYN A;  5GAM e;  2DIL A;  2JNG A;  3OBY A;  4DEY A;  4HVV A;  3H6Z A;  2P4T A;  2HKN A;  1FXX A;  2K2M A;  2D1X A;  1IHW A;  1YJN Q;  1PCX A;  5LJ5 h;  1TTH B;  2HNI A;  4M78 G;  4HKE A;  1GCP A;  3NPF A;  2H3J A;  3CMA Q;  2L5Q A;  3CC7 Q;  3INZ A;  1WQ7 A;  3QJY A;  3CCS Q;  3M56 A;  2NUP B;  1VQM T;  2F69 A;  3VS6 A;  1YJ9 Q;  2OTL T;  1D0Z A;  5HK0 A;  1K4U S;  4KRT A;  3JCM J;  4QKU A;  5KYU B;  1D0Y A;  1YNZ A;  2QTV A;  3C94 A;  4M78 C;  3MO8 A;  2QA4 A;  2NUZ A;  4GLM A;  1NJI U;  3QZ9 B;  4MDX A;  2KR3 A;  2D9T A;  2COY A;  2WSF E;  3QZ5 B;  3CXC A;  3CME Q;  3P8D A;  4LUD A;  2CYZ B;  4QVD A;  1YHQ Q;  2JS2 A;  9ATC B;  5FLX E;  2EQU A;  2LCC A;  1AHJ B;  3QYG B;  1ZHI A;  2K4Y A;  4RTU A;  1IXD A;  2KSS A;  3MJX A;  4JLG A;  3JB9 J;  3FDR A;  2YLC A;  3CCV A;  1QCN A;  1P92 A;  5I2M A;  4Q5W A;  2K9G A;  3JB9 F;  3EGD A;  4EPC A;  3EG9 B;  1VYV A;  2LDM A;  2RA2 A;  2GTO A;  3CBP A;  4IIO A;  2K5F A;  4E2F B;  2DVE A;  3OYE A;  2E3H A;  4BI3 A;  4PJO B;  2XDB A;  3CCE Q;  3H41 A;  2DXC A;  2FHD A;  4LDY A;  2XIC A;  1D3B B;  1X69 A;  5IXF A;  2RJD A;  3LWI A;  2JUF A;  1D1B A;  1RAF B;  1KHC A;  2CDT A;  5DLQ E;  1WXT A;  4E7I A;  1F1B B;  1MGQ A;  2HZY A;  1VQ6 A;  3OBW A;  3VS7 A;  3FC3 A;  4HA8 A;  2MPX C;  1UHF A;  4PJN A;  2R5M A;  1WHG A;  2ZPH B;  5GAM f;  1NG2 A;  1I5O B;  2DZ9 A;  2FRY A;  2FZG B;  1AWJ A;  4J9E A;  2E6Z A;  1ACM B;  1VQ5 T;  4RG8 A;  2EGA A;  4D6W A;  1YJN A;  3VS1 A;  4BI4 A;  3X20 B;  3PIO A;  2O9S A;  3CMA A;  1K1Z A;  1RAI B;  4JPB W;  3CC7 A;  3CCS A;  1VIE A;  3R6N A;  4C8Q E;  2K3X A;  2VWF A;  5LJ3 e;  4N4G A;  4C5E A;  1YJ9 A;  1XTD A;  4BE1 A;  2IG0 A;  2E1H A;  1K8A U;  3OS2 A;  2FYK A;  2G3R A;  3JCM Q;  3J7A F;  2D0N A;  3OYK A;  3CC4 T;  1PD0 A;  1NPP A;  3HHT B;  2RM4 A;  4J7I A;  1SEM A;  1B7T A;  4R0K A;  3M0S A;  4LE9 A;  3CME A;  2F2W A;  4XU2 A;  2VB6 A;  4C92 B;  4ORZ A;  3M4G A;  5IH2 A;  2LVM A;  2QYZ A;  1YHQ A;  3SFM A;  2K79 A;  2BIV A;  2YXY A;  2HQX A;  4RCC A;  1Q7Y U;  2EYZ A;  1OI1 A;  3OYG A;  1E7O A;  1NJI R;  4D8K A;  3M5A A;  2EJG A;  1WHJ A;  1OU8 A;  2J6K A;  5CKE A;  2E4H A;  2HEQ A;  1N9S A;  2Z0W A;  2KY9 A;  4Z02 A;  3X26 B;  2ZPG B;  2B86 A;  2L2P A;  2CT3 A;  3CCE A;  3F70 A;  5CO7 A;  4M7A D;  5GAN g;  1C1A A;  2PUO B;  3MET A;  2L89 A;  2AKL A;  4LN2 A;  1ZA2 B;  3NHN A;  2OJ2 A;  1Q81 R;  4CRI A;  3JCM h;  3JSC A;  5EG2 A;  1V1C A;  2VXF A;  2X4Y A;  1QVG A;  4C5G A;  5M9O A;  3OSV A;  1H8K A;  3I56 T;  2XU8 A;  2E41 A;  4MZT A;  2LT4 A;  3LGL A;  4PNO A;  3TCJ A;  3CXC P;  1K73 C;  4ZTJ A;  1VQ4 T;  2CUD A;  1RI9 A;  1ZBJ A;  1PHT A;  1WI7 A;  4PJL A;  1FMV A;  2NYS A;  4RG2 A;  1VQN T;  2AZS A;  3FEO A;  4MZM A;  3LWH A;  3CBO A;  4ZTF A;  5AYF A;  3I5R A;  4PL6 A;  3UF4 A;  2M1H A;  3M9Q A;  1SHG A;  4J9B A;  2MOX A;  1K9M C;  1X43 A;  4M75 D;  5LJ3 f;  2DYB A;  1M9S A;  2CUB A;  4M7D A;  3I55 T;  2M9U A;  4EDU A;  1XJW B;  2DXT A;  5FU6 C;  1KQS A;  5I11 A;  1WNL A;  2LX9 A;  3QYH B;  1X2Q A;  4A4H A;  3H0F A;  1JRI A;  1TSF A;  4OMF B;  3JAM E;  3T9N A;  1VYU A;  2NWM A;  4EMG A;  4XTX A;  1M90 R;  2CSQ A;  2E5Q A;  3PIP A;  3OW2 S;  2EW3 A;  3EG1 A;  4E7Z A;  3P8B B;  1K8A R;  3L2Z A;  5GAN 7;  4M77 G;  2E64 A;  1RAB B;  4E7L A;  2QG9 B;  2QEX T;  4J7F A;  1AWO A;  1TU0 B;  4PFO A;  3CPW P;  4KUD K;  2PVD B;  2YSQ A;  3GNG A;  3EG3 A;  3CQT A;  4M7A C;  1X01 A;  4MML A;  4AMC A;  4M77 C;  1AT1 B;  5HY6 A;  3G4S Q;  3QII A;  1QVF P;  2RF0 A;  4BY6 B;  1YFN A;  1ZUY A;  2DFU A;  2HQE A;  1WYX A;  2C0T A;  5FWB A;  4J9G A;  1CSK A;  1QVP A;  4J9C A;  4F7U A;  5FU7 B;  4PLL A;  4KT0 E;  4QT7 A;  1FMW A;  2E3I A;  2EQJ A;  3QJ6 A;  1Q82 R;  2XDP A;  1QW1 A;  4GBQ A;  3M54 A;  3SB2 A;  3TU4 K;  3V7R A;  4E7S A;  5LJ5 j;  1J3T A;  4PJO E;  1AWW A;  2DPP B;  1W2B A;  1VQ7 Q;  3LX7 A;  5KYW A;  2ED0 A;  1EX4 A;  4FL6 A;  5D6Y A;  3MP6 A;  3S3N A;  2KXD A;  4XTV A;  2FPF A;  2O2O A;  1OPL A;  3DB3 A;  2R5A A;  3CCU T;  2OAU A;  2KAF A;  4M75 C;  3THK A;  1ZUU A;  1Q86 R;  1BCO A;  2M51 A;  3OYB A;  2XG8 D;  4DQ2 A;  2J06 A;  4J9I A;  1R0B G;  1WJR A;  2COZ A;  2MF2 A;  5GAN 4;  5CIU A;  4HCZ A;  2DL5 A;  2Y4X A;  4A63 B;  1AZG B;  3RKW A;  1VQK Q;  3QDF A;  8AT1 B;  1OYX A;  2EWN A;  5KYN A;  3H8Z A;  1OQK A;  4HCC A;  3O8V A;  4IUP A;  2DET A;  3BDL A;  4C92 D;  2D0Q B;  3OYI A;  1GBQ A;  4YTL A;  1M2O A;  4M78 A;  4CI0 C;  5L8R E;  5GAO r;  1MHN A;  1EZZ B;  5KCO A;  4JRP A;  1G3Y A;  3SWN C;  2RMO A;  1NLP C;  4M4Z A;  4EIK A;  1KC8 R;  4ATO A;  4R56 A;  4LD6 A;  3VS2 A;  4WTO B;  1U1T A;  2JM8 A;  3RNJ A;  2ZPI B;  3M53 A;  2V8J A;  3CMA T;  1TS9 A;  3CCR Q;  3CC7 T;  3CCS T;  2BE9 B;  5GAN 6;  1YJW A;  4RTV A;  3CCJ T;  4F7U E;  2EYX A;  3EFR A;  1UGS B;  4C5I A;  3PNW C;  1YN8 A;  1VQL Q;  1CKA A;  3ER0 A;  1N6A A;  3JB9 G;  1QCO A;  2DJZ A;  2LJ1 A;  1TWB A;  5C6S A;  4NOY A;  2VC8 A;  3BY7 A;  1OU9 A;  1RLQ C;  3TRE A;  4M7A F;  2LC4 A;  1XOV A;  1SRM A;  3RKX A;  1WIE A;  1M27 C;  2FEI A;  4MMK A;  1YCY A;  2KBT A;  3CME T;  2RK2 A;  2YDL A;  2YRD A;  4IUU A;  4F16 A;  4RUG A;  2FVU A;  3OQ5 A;  1T3L A;  3WVD B;  2DL7 A;  1ABQ A;  1YHQ T;  2R58 A;  1BK2 A;  4A53 A;  1MUZ A;  1NEG A;  2A0F B;  1KD1 U;  1I0C A;  2L3Q A;  2J7I A;  1IGU A;  3QDR B;  4BE0 A;  2DRM A; 
#chains in the Genus database with same CATH homology
 2RHI A;  1Y96 A;  2DVE A;  4M75 G;  2VYT A;  3HRU A;  3OYF A;  4XU1 A;  5IN1 A;  5J26 A;  4BI3 A;  1B34 A;  4PJO B;  2XDB A;  2DKG A;  2XID A;  1Y7X A;  3QBY A;  3CCV T;  4QQG A;  1VQ7 A;  3HSB A;  1Q81 C;  2DTO A;  3HPW A;  1M4Z A;  2DXC A;  1OZ3 A;  2EAY A;  1JB0 E;  4M77 D;  4A4F A;  4C92 A;  3CCL A;  2FHD A;  4GLK A;  4LDY A;  4JRI A;  2XIC A;  4N0A A;  1G3S A;  1D3B B;  2RJD A;  1VQ8 A;  2WSE E;  1YBY A;  3LWI A;  4FM4 B;  1G3T A;  3G6E A;  2CZ7 B;  4M7D E;  2JUF A;  4R55 A;  5GAO q;  5KE2 A;  3OS1 A;  4BDY A;  1KHC A;  2VGM A;  4GY5 A;  5LJ5 g;  4V2S A;  1VQ7 T;  5DLQ E;  2QQB A;  4XK8 E;  2KDS A;  1QP3 A;  4E7I A;  4XTZ A;  1MGQ A;  3CCL T;  1KG1 A;  2PVO B;  3OS5 A;  1VQ6 A;  3OBW A;  2RI5 A;  4HA8 A;  2MWP A;  4M75 F;  3A8M B;  4C0D B;  3FC3 A;  4C0G A;  3QO3 A;  4FU6 A;  3L2R A;  2R5M A;  2CZ6 B;  2GFU A;  2JTM A;  1IRE B;  1VQ8 T;  1U1S A;  2ZPH B;  3G6E T;  3BW1 A;  4BD3 A;  2VV5 A;  1BIA A;  4WF2 A;  3WXM B;  3NTK A;  1IZ6 A;  5GAM f;  2DAQ A;  5IAY A;  1YIJ A;  5LJ5 e;  5GAN h;  1VQK A;  3P8H A;  4E7H A;  2DZ9 A;  2EKO A;  4XAX B;  4M7A E;  1UGR B;  2RI2 A;  4NS5 A;  2E6Z A;  1N9R A;  4J8O A;  5CAI A;  1VQO A;  4JLI A;  3CBM A;  1VQ6 T;  4LDV A;  1VQ5 T;  5LJ3 g;  4RG8 A;  5GMK h;  4D6W A;  4PJO G;  1YJN A;  4PJO A;  3OYH A;  4BI4 A;  3X20 B;  4JS5 A;  5GAO l;  4O6J A;  4X34 A;  3PIO A;  4PLI A;  4BE2 A;  3E9G A;  3CMA A;  1D3B A;  3MEU A;  3OYJ A;  3CC7 A;  3L2U A;  3CCS A;  2HAX A;  1VIE A;  3M58 A;  2V8K A;  4C8Q E;  1DJ7 B;  2K3X A;  2PU9 B;  2VXE A;  1H64 1;  5LJ3 e;  1VQO T;  4N4G A;  4C5E A;  4J5Y A;  1YJ9 A;  2ZZD A;  1XTD A;  4J83 A;  4II1 A;  4BE1 A;  1YJN T;  4PJO C;  1VQ9 T;  2FL7 A;  2IG0 A;  2E1H A;  1K8A U;  2X35 A;  3OS2 A;  2FYK A;  2G3R A;  3EFS A;  3JCM Q;  3J7A F;  4QQD A;  4B9X A;  2JOY A;  2DD5 A;  3CCR A;  3ZFJ A;  3OYD A;  3OYK A;  3CC4 T;  1G5V A;  1M90 C;  3JRZ A;  2LCL A;  4BI8 B;  4PJO F;  2RHY A;  1NPP A;  1Y96 B;  5GAN 8;  4P5N A;  3HHT B;  2RM4 A;  4J7I A;  2CKK A;  2E6N A;  2RH2 A;  3FJP A;  1YJ9 T;  5FRM A;  1LJO A;  1I4K 1;  5D6X A;  4IKF A;  2EQK A;  1VQL A;  2XKO C;  3CME A;  2RD1 A;  3OA6 A;  5A0D A;  4JJN K;  4MZP A;  4XU2 A;  3CEY A;  5A0G A;  4C92 B;  4JS4 A;  5CVI A;  3G4S A;  2QQR A;  3M4G A;  3RIR A;  4C0D C;  1YIT T;  2P0Q A;  2LVM A;  2AHJ B;  1YHQ A;  3SFM A;  3UPU A;  3M59 A;  1KHI A;  2MMP A;  2BIV A;  3A8L B;  1M1K C;  2HQX A;  2RJF A;  4M75 E;  2EJ9 A;  5CK9 A;  1VQP T;  1M1G A;  4RCC A;  2O01 E;  1Q7Y U;  2RJC A;  1OI1 A;  1VQL T;  3SDZ A;  3VKI A;  3OYG A;  3GF5 A;  3JCM b;  1O9S A;  3MP1 A;  4LDW A;  4ZN3 A;  5GAN d;  1BIB A;  5KE3 A;  3V8K A;  4M7D D;  3M5A A;  3J81 E;  2EJG A;  4TVR A;  2KMT A;  1UGQ B;  5CKH A;  2EJF A;  4NL2 A;  5CKE A;  1QVG S;  3BDU A;  2GFA A;  3QKJ A;  2EFI A;  1N9S A;  5GMK l;  1Q81 U;  4KBM B;  1M5Q 1;  2KY9 A;  3QSU A;  5GAN 3;  2QI2 A;  4M78 D;  4BAC A;  4QVZ A;  1GXI E;  5A0L A;  3HFO A;  3J80 E;  3EAE A;  4J6W A;  4Z02 A;  3UWN A;  3JCM P;  3JCM c;  3X26 B;  3OS0 A;  2ZPG B;  2LT1 A;  5FRO A;  3GPL A;  3CCE A;  3F70 A;  5CO7 A;  3E1S A;  1Q82 C;  4M7A D;  3KXT A;  1V29 B;  1BKB A;  5GAN g;  2PUO B;  5FU6 B;  1N8R C;  2WAC A;  3MET A;  4C92 G;  3OYE A;  4FT4 A;  3CPF A;  2VUB A;  4E7K A;  1G3W A;  2PVG B;  1S72 A;  2L89 A;  5IT9 E;  2RI3 A;  3WVE B;  1FX7 A;  5GAO n;  4CRI A;  3JCM h;  3MCA B;  3JSC A;  1BI1 A;  5EG2 A;  2VXF A;  5LJ3 d;  4OP0 A;  4OGC A;  5GAM j;  3PMI A;  2X4Y A;  4M7D B;  2BKD N;  2EQM A;  3CCE T;  4L5G A;  2DIQ A;  4PKC C;  5GAN e;  1NPR A;  4C8Q D;  2RB6 A;  4JRQ A;  1R8O B;  1QVG A;  1VQN A;  4C5G A;  5M9O A;  3QHS A;  3SD4 A;  2QDY B;  2P0K A;  3OSV A;  2DD4 A;  2R57 A;  4C92 C;  3JB9 D;  1YI2 T;  1S72 T;  4VUB A;  4N0A C;  2XU8 A;  3I56 T;  2E41 A;  5DLO A;  4M78 E;  3V8J A;  4MZT A;  1VQ5 A;  1XQH A;  3OYY A;  4OF1 A;  2LT4 A;  5GMK e;  4XQ3 A;  4XU3 A;  3HP9 A;  1Q86 C;  3LGL A;  3A8G B;  4PNO A;  3TCJ A;  3AHU A;  2RHU A;  1K73 C;  4ZTJ A;  3ASK A;  1KQS S;  1U8R A;  3OYA A;  5KH6 A;  1VQ4 T;  3VJP A;  1X75 C;  2DIG A;  4C92 F;  4FT2 A;  5I21 A;  5LJ5 f;  3FB9 A;  3KUF A;  4RG2 A;  2K5I A;  1VQN T;  4NL3 A;  4JUV A;  3FEO A;  2E12 A;  4M7A B;  3S3O A;  4MZM A;  1I5L A;  2DXU A;  2MI6 A;  4Y28 E;  3LWH A;  1PSF A;  3CBO A;  4KUI A;  3I55 A;  4M77 B;  4ZTF A;  5CQX A;  5AYF A;  2O4X A;  1VQ9 A;  3CCM A;  3L1A A;  1N27 A;  5D6W A;  2LTO A;  4PL6 A;  3GNF B;  2M1H A;  3M55 A;  3M9Q A;  2P0P A;  2JTF A;  1UEB A;  2MWO A;  2XD0 A;  3OMG A;  4HT9 A;  4BUG A;  4ZGE B;  3CBP A;  3CC4 A;  4OB2 B;  2ZPB B;  3OY9 A;  4LDX A;  2GQV A;  2NLU A;  1K9M C;  1M90 U;  3CCQ T;  4M75 D;  5LJ3 f;  4C8Q B;  2GCX A;  1JBM A;  1M9S A;  2L3R A;  4N4I A;  5FRN A;  3PTA A;  4M7D G;  2JN0 A;  2OTJ A;  4M7D A;  3I55 T;  3UT1 A;  3MHX A;  3NFC A;  3CC2 A;  3GLX A;  1M1F A;  3CCM T;  2M9U A;  1HK9 A;  3VYG A;  4EDU A;  3OYC A;  2DXT A;  5KCH A;  5FU6 C;  3ZBD A;  2DTH A;  1KQS A;  3CXC S;  5GAM h;  4MDW A;  1I8F A;  3C95 A;  3HFN A;  1UGP B;  1WNL A;  2LX9 A;  4RCB A;  3OYM A;  3OYL A;  1YIT A;  3QYH B;  2XI9 A;  4A4H A;  4HCB A;  1JRI A;  4ELZ C;  2QEX A;  3MEA A;  1WJQ A;  1KC8 C;  3V7C A;  5CR2 A;  2E70 A;  3E19 A;  4ZN1 A;  4OMF B;  3JAM E;  1VQP A;  3T9N A;  4F7U B;  5CKB A;  3JCM d;  1M1K U;  4M7D C;  2YLB A;  3CC2 T;  4EMG A;  4XTX A;  3L42 A;  2E5Q A;  1WPY A;  4HT8 A;  3PIP A;  2VGN A;  1SSF A;  2M0O A;  5CQY A;  3OW2 S;  3RER A;  2XDD A;  4M7A A;  3GP8 A;  3V7S A;  2EIF A;  3P8B B;  3G7Z A;  2JVV A;  3MEV A;  1JJ2 S;  3L2Z A;  5GAN 7;  4M77 G;  4M7D F;  2X4W A;  4M77 A;  4OVA A;  1Y07 A;  2E64 A;  4ZGJ B;  5I2S A;  4E7L A;  2QEX T;  2QQS A;  4J7F A;  1EIF A;  3FLG A;  1FWZ A;  2DTI A;  3DLL A;  4KUD K;  3VUZ A;  2CZ0 B;  2PVD B;  3GOX A;  3TEE A;  4M75 B;  2RK1 A;  3MP8 A;  3CD6 A;  2KK4 A;  2RHX A;  2CZ1 B;  3LW5 E;  3X25 B;  2QXF A;  4C0F A;  3GNG A;  4A4K A;  3L2W A;  3L2Q A;  4RKU E;  4L6V 5;  5GAN 2;  4M7A C;  4Y91 A;  1X01 A;  2BUD A;  4JDS A;  4MML A;  4C92 E;  4C8Q A;  5DM7 R;  1I81 A;  3X24 B;  3JB9 H;  3JCM g;  2QQA A;  2YRV A;  4M77 C;  2XK0 A;  5GMK i;  2K5L A;  3OB9 A;  1KQ1 A;  2I2L A;  2Y90 A;  3ME9 A;  3E9F A;  5HY6 A;  3QII A;  3A8H B;  2JZ2 A;  3VUB A;  1Q82 U;  5C0M A;  4XTY A;  3RES A;  3RMQ A;  1YJW T;  4BDZ A;  1NJI C;  3QPH A;  4OB3 B;  1N8R U;  4BY6 B;  1W2B S;  4EMK B;  1XNI A;  3CD6 T;  3C12 A;  2CGH A;  2YHT A;  5LL6 S;  4M77 F;  2HQE A;  3LLR A;  3OW2 A;  5HK3 A;  4C8Q C;  3JCM e;  3HKS A;  4F7U G;  1QVP A;  2FB7 A;  4F7U A;  5FU7 B;  1JJ2 A;  4XU0 A;  3JCM V;  2ZGW A;  2O4X B;  4JRK A;  3RMS A;  3S6W A;  4PLL A;  4BB7 A;  3VYH B;  3RUX A;  4KT0 E;  4ZGD B;  1Y71 A;  2RO0 A;  4KUL A;  1YI2 A;  3I56 A;  3G71 A;  3CPW S;  2EQJ A;  3QJ6 A;  4XTW A;  2F5T X;  2X4J A;  3LGF A;  1RI0 A;  1ZQ1 A;  3HRT A;  2K2V A;  2XDP A;  4IUV A;  1QW1 A;  4X9C A;  1TH7 A;  3M54 A;  4ME7 A;  3JCM W;  3OMC A;  1Q86 U;  4A4E A;  1OZ2 A;  3SB2 A;  3CCU A;  3TU4 K;  4IUT A;  3V7R A;  1VQ4 A;  2DZC A;  1K73 U;  5DY9 A;  3QXE B;  4IUR A;  3ZEH A;  2KVQ G;  2X4X A;  3SWN B;  4M75 A;  4E47 A;  5LJ5 j;  3GIB A;  4PJO E;  3M57 A;  5GAN f;  2OTJ T;  2LQK A;  5J3B A;  1QVF S;  2V8I A;  3PMT A;  1WGS A;  2DPP B;  4X9D A;  1WQW A;  2M16 A;  1W2B A;  3PGG A;  3G71 T;  3LX7 A;  1KD1 C;  3Q1J A;  4EMH A;  4F7U F;  1NZ9 A;  4FL6 A;  1BI2 A;  5D6Y A;  4QVC A;  3MP6 A;  4M78 B;  2DK3 A;  3S3N A;  5A2Q E;  4XTV A;  4QW2 A;  4B9W A;  5CKF A;  3DB3 A;  2R5A A;  3A8O B;  1BI3 A;  4OGE A;  3CCU T;  1LNX A;  2OAU A;  2XHC A;  2KAF A;  4C0Z A;  5GAN 5;  4M75 C;  4EMK A;  5GAM g;  1O75 A;  5J39 A;  3OYB A;  3DB4 A;  2QQ9 A;  2XG8 D;  4N4H A;  2K57 A;  4DQ2 A;  5LJ3 j;  3CCQ A;  1K9M U;  3CPW A;  5GAO m;  2C06 A;  3JCM X;  3JB9 I;  4LD9 K;  2LQ8 A;  3UDC A;  1WJR A;  1VUB A;  2B8A A;  5CCA A;  4J6X A;  4A54 A;  3NTI A;  4FSX A;  2MF2 A;  2PUK B;  4QQ6 A;  5GAN 4;  1ZBX A;  5CIU A;  2MAM A;  4HCZ A;  3OYN A;  3OSS C;  4BY6 C;  4J6Y A;  3S3M A;  2Y4X A;  3N5B B;  4C5H A;  2HBP A;  4EMK C;  5GAM e;  2D6F A;  2JNG A;  3OBY A;  3RKW A;  1HXD A;  3C4S A;  1QVF A;  3H6Z A;  2P4T A;  1OYX A;  2EYQ A;  1KC8 U;  1FXX A;  5FU7 C;  1BYM A;  1RL2 A;  2EWN A;  1QP2 A;  2WSC E;  2ZPE B;  4M77 E;  3H8Z A;  3SWN A;  2KQW A;  1VQM A;  4HCC A;  2Y4Y A;  2OTL A;  3O8V A;  4IUP A;  3BDL A;  3MEW A;  4OB0 B;  4C92 D;  2D0Q B;  3OYI A;  4L59 A;  5LJ5 h;  1YIJ T;  3L2V A;  2HD0 A;  1VQK T;  4YTL A;  2HNI A;  4M78 G;  4DA4 A;  4HKE A;  4M78 A;  3VU3 C;  2DO3 A;  2RJE A;  2H3J A;  3DKM A;  3VV0 A;  4CI0 C;  5L8R E;  2L5Q A;  4DOV A;  1MHN A;  4DOW A;  5GAO r;  3INZ A;  1WQ7 A;  2IVW A;  3QJY A;  5KCO A;  3CCJ A;  2PQW A;  4JRP A;  1BI0 A;  1G3Y A;  2DXB A;  3M56 A;  3PT9 A;  4UC4 A;  4XTU A;  3SWN C;  1LOJ A;  1VQM T;  2F69 A;  2OTL T;  4ATO A;  5HK0 A;  4R56 A;  4LD6 A;  4M7A G;  3JCM J;  4E7J A;  3X28 B;  1U1T A;  2ZPI B;  2GF7 A;  3M53 A;  1KQ2 A;  2V8J A;  1M8V A;  4M78 C;  3C94 A;  3CMA T;  3FRN A;  3PFS A;  5HKC A;  3M4Y A;  3MO8 A;  3CC7 T;  3CCS T;  3V8L A;  5LJ3 h;  2RHZ A;  1X6O A;  5GAN 6;  1YJW A;  3CCJ T;  1W4S A;  3FIF A;  2QTX A;  4IUQ A;  4F7U E;  2L8D A;  3EFR A;  2QA4 A;  1NJI U;  3QZ9 B;  3LYI A;  1UGS B;  3DLM A;  4MDX A;  2E10 A;  3BFM A;  2A7Y A;  3HRS A;  3QG1 A;  2D9T A;  4C5I A;  1B34 B;  2K3Y A;  2WSF E;  3PNW C;  1K8A C;  2F5K A;  4M78 F;  3QUI A;  3QZ5 B;  4C8Q G;  3CXC A;  3ER0 A;  5GMK m;  1N6A A;  3P8D A;  3KBG A;  3JB9 G;  2DJZ A;  4PJO D;  5C6S A;  2CYZ B;  4NOY A;  3CCR T;  2VC8 A;  4QVD A;  3BY7 A;  3LH0 A;  2QA4 T;  3TRE A;  4A4G A;  3RKY A;  4M7A F;  2LC4 A;  5FLX E;  1VIF A;  1XOV A;  2EQU A;  2LCC A;  3RKX A;  1UB4 A;  1AHJ B;  4MMK A;  1YCY A;  3URG A;  3CME T;  5GAO p;  2E65 A;  2RK2 A;  3NTH A;  3QYG B;  4RMO A;  1ZHI A;  4FIB A;  4IUU A;  4O5V A;  3JCM f;  2FVU A;  2K4Y A;  4OB1 B;  2A3L A;  3OQ5 A;  3G4S T;  2DEQ A;  5GAN j;  2KSS A;  4JLG A;  1WJS A;  3WVD B;  3JB9 J;  2LNV A;  3FDR A;  3R6O A;  1YHQ T;  2R58 A;  2YLC A;  3CCV A;  1NE8 A;  3A5Z B;  1H3Z A;  1PSE A;  4A53 A;  1P92 A;  4C8Q F;  2CS7 A;  3HL8 A;  1Q7Y C;  5I2M A;  2ZPF B;  2LRQ A;  1KD1 U;  4Q5W A;  5GAM d;  5GMK j;  3JB9 F;  3QDR B;  5CKD A;  5LJ5 d;  4BE0 A;  4LDU A;  4EPC A;  2LDM A;  4ELY C;  2ZCF B;  2RA2 A;  2K5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...