4C0DC

Structure of the not module of the human ccr4-not complex (cnot1-cnot2-cnot3)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
142
structure length
142
Chain Sequence
LTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 27
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0dC00
4C0DB 4BY6B 4C0FA 5FU6B 5FU6C 5FU7C 4C0DC 4BY6C 4C0GA 5FU7B
chains in the Genus database with same CATH superfamily
2RM4A 1UFFA 1VQ9Q 3R6OA 1YIJQ 2A3LA 2IG0A 3TSWA 2ROLA 3CC2A 3HPWA 3BFMA 4Z8AA 2PNIA 2BKDN 2FPDA 4BDYA 3FJPA 1OZ3A 1WI7A 2KGTA 4IUPA 5GANd 2DTHA 2LT1A 2OTJQ 3M5AA 4BI3A 2CS7A 1K8AR 6AT1B 1XJWB 2QQBA 3VS0A 2KVQG 3NMZC 3CPWP 2CP0A 4J5YA 1YN8A 2EJGA 5IHNA 1N6AA 1OZ2A 1S1NA 1YCSB 2XMFA 3SHWA 3UATA 1PD0A 3QPHA 3JCMg 5GANf 3CC4T 1VYVA 2FZGB 3QDRB 1WHHA 5A0LA 1O75A 2VWFA 4LUEA 1BCOA 5GANh 2COWA 1QCNA 3LLRA 3CMET 3FEOA 3OY9A 3MHXA 1H641 4D8KA 5DLQE 2KRMA 2PQWA 5M9OA 4R56A 1AVZC 1W2BS 1X69A 4DBHA 1OEBA 2D6FA 2KNBB 2AK5A 4KUDK 3V8LA 1WQ7A 4E7HA 2A37A 4J7FA 2LCCA 2IVWA 5GAMj 3G4SA 4M7AC 2EJ9A 1VQ5Q 3PE0A 4FT2A 3OYGA 1C0MA 2CP3A 1M90U 1WQWA 3EG0A 1JJ2P 1QMCA 4AMCA 2GGRA 1QVFP 1WLPB 4C0DB 2AIRB 1KQSS 3E2UA 3I56T 1OU9A 4C8QF 2J06A 2K5IA 1SRMA 3O8VA 1YJNQ 1WX6A 1ZBJA 2CUBA 1OPKA 1UGSB 3JB9D 2VC8A 3RDVA 2MIOA 1K0XA 2QGGA 3CCSA 2O9VA 1D0XA 2KMTA 2CSQA 2EKOA 4XAXB 1LJOA 4A4KA 3OYHA 1BI3A 4C8QA 4N4IA 2RH2A 4ZTJA 4M78C 4C92F 2HEQA 3CCMT 1M1KR 1VQ7T 1D1AA 2X3XD 1Q86R 2ESWA 4KGZB 3CCEA 1X6BA 4Z02A 2LQWA 1JEGA 3OYAA 3L42A 3QDFA 1G3WA 2QQ9A 2DVEA 4DBFA 2F1LA 2PUKB 4R0KA 3CCLT 3QG1A 4C92A 3MCAB 3EHRA 1WHKA 5HCKA 1YITA 4JRKA 2DXCA 1ZUUA 1VQKT 4C5GA 2K3YA 4OMPA 2JXBA 2QEXA 3AHUA 3JCMd 2HBPA 2NUTA 1IHWA 1T3SA 4A4FA 2YUQA 1G3TA 2EKHA 1BK2A 2KE9A 2DZCA 2NUZA 2AZSA 2MMPA 1MMDA 3CCQQ 2MWOA 1ZHIA 1KQ1A 4A4HA 3GP8A 4JZ4A 1PSEA 2COZA 2NUTB 4M7AB 5KCOA 4F7UG 2PTKA 4ZTFA 1TH7A 4J9DA 3JCMh 4N0AA 5HKCA 1S72A 4NL3A 3OA6A 3CCRT 1ZLMA 3C12A 3V7RA 3S6WA 3EFOB 2EYXA 2RJCA 2CP7A 1VQOQ 3EG3A 1FYNA 4E7LA 1RAHB 4IUVA 3QO3A 1MMAA 4E7JA 1UTIA 5IN1A 1G8XA 4FIBA 2L0AA 4AG1C 1VQ9T 4DEXA 4M78B 3RNJA 3ME9A 4CC3A 3CD6Q 1FX7A 2JN0A 1HYOA 1PRLC 2HDAA 2EQMA 2OTJT 4HVUA 2DJQA 1Q82C 2BZXA 2CZ7B 1BKBA 3S3MA 2VGMA 1V1CA 1YJ9A 3H6ZA 4DA4A 1WJSA 4XTWA 2ZGWA 3A8GB 1BBZA 5GMKi 1I4K1 5CO7A 3SDZA 3HFNA 2MK5A 1M1GA 2DE0X 3L2RA 4M7AG 3EG9A 2E5QA 5FU6C 4ZGEB 3S3NA 4Y28E 2YWWA 1X43A 3GNGA 2JJ9A 2YUNA 3OQ5A 1RAEB 5GAN7 1XNIA 3PT9A 4EMKA 2DM1A 1WA7A 5GANe 2E12A 2K3XA 2YLCA 3QWYA 4Y91A 1WPYA 3J80E 3MKDA 1QVGA 1YI2A 3LH0A 3HRSA 3LWHA 2GNCA 2HSEB 2VXEA 4M75E 1M8MA 3CPWS 4L6V5 3KUFA 4RTZA 3VS5A 2DMOA 4Q5WA 4AFQC 5D6WA 1WXUA 1W4SA 1H8KA 4M78G 4PJOE 1YHQA 1R0CB 4WCIA 1OOTA 3EFSA 1QCFA 2FPFA 3M58A 5KYYA 4E7ZA 4KH1B 4FYWB 1IB8A 3X20B 4BI8B 3G4ST 3PFSA 2EYYA 3MEUA 2LRQA 3VS3A 4PLLA 2LJ3A 1W2BP 1WNLA 3L1AA 2DXTA 2EPDA 1X2KA 2JUFA 2KR3A 1BYMA 3EGXA 1KHCA 3JCMW 4Z88A 1M2OA 3QXEB 3OYBA 1LOJA 1KK7A 2FRYA 1H3ZA 4GLKA 3OW2A 4XQ3A 5KE2A 2O01E 5CIUA 4E47A 1KFZA 2JS2A 4J9HA 2K2VA 2PZ1A 1YWOA 3EGUA 3EG2A 3FJ5A 1WJRA 1T3LA 3M0SA 3OYDA 2GF7A 4GY5A 2MAMA 4F14A 3CMAA 4OGCA 3A98A 3EAEA 3DLMA 1K73U 1JJ2S 2O4XA 1GBQA 4E7SA 5LJ3g 3ASKA 4XU0A 1M90C 1QVFS 3VUBA 4FYVB 3QKJA 3CCET 9ATCB 4AFUC 3I55A 5FU6B 2V8JA 1DJ7B 1WHJA 1UE9A 2DX1A 3UA6A 2ATCB 5GAOp 3H8ZA 3CCVA 4TVRA 2E41A 4RTUA 2KAFA 3G71A 2EIFA 1TG0A 2WSEE 3E9GA 1VYTA 2CT4A 2DL5A 1UEBA 5GAOm 1TWBA 3HTRA 3A8MB 2ZPHB 5IHKA 1N27A 2EBPA 1M3AA 1M9SA 3J81E 1Z9QA 1K9MU 1B34A 3I56Q 4XU2A 5IHIA 2XI9A 2P4TA 1SSFA 2XDPA 4JJBA 3VYGA 2L3QA 4JUVA 3CCQT 4JS4A 3FB9A 4HA8A 5GMKm 4BB7A 1M1FA 1IGUA 3L2ZA 4M75C 1VOMA 1VUBA 1U8RA 1RLQC 4C0GA 1D1BA 2RK1A 4X9CA 2YUOA 3N5BB 2FVUA 4PFZA 3VRYA 3JCMe 2O9SA 4MDXA 5KYXA 4RG2A 1M5Q1 1VQ7Q 1NYGA 2I2LA 2RQUA 2SRCA 2VGNA 2KXDA 1S72T 2YSQA 3X26B 1D3BB 2CREA 1C1AA 2WSFE 1JRIA 1EZZB 1YFNA 3JSCA 1VQMA 1MMNA 2RJEA 2NYSA 4E2FB 2NUPB 1D0YA 3BW1A 4EPCA 1QVPA 1VQKQ 2P0KA 2CZ0B 1OI1A 3CD6T 1QKWA 2JM8A 4C8QE 1ZA1B 2XD0A 5FU7B 1EX4A 1N9RA 4X1VA 3RESA 4AFSC 4M7DD 2RHXA 4N4GA 1KQSA 2GCXA 4XU3A 2ZCFB 1U1SA 4HCBA 3Q1JA 2RMOA 4XTUA 3GF5A 4FM4B 3EG1A 4J6WA 1RAFB 1XOVA 1I5LA 1TS9A 4IUUA 1YJWQ 1U06A 1UHCA 4C92E 3M59A 1SSHA 1RACB 5HK0A 4HT8A 5FW9A 2I0NA 1VA7A 2QQAA 3M0QA 3OS0A 2DILA 2K2MA 4FYYB 2CH4A 2V1QA 2HZYA 2QDLA 5LJ3f 3TU4K 5I22A 1NPPA 2Y4XA 3VS4A 3VU3C 5LJ3h 2A28A 1YI2T 3SD4A 2LNVA 5GMKj 3A5ZB 3FLGA 4JLIA 3CXCS 2QI2A 4M75B 2D0NA 3FRNA 3FC3A 4IUTA 1XTDA 3CCJQ 2F5TX 4PJOD 2BIVA 1I1JA 3J7AF 3OYFA 2F2XA 3VKIA 4PK4A 4LDYA 3CC2Q 2M02A 3PVQA 2L89A 3OYKA 3F70A 2DVJA 2V8IA 5GAMd 4F16A 1UGVA 2RJDA 4KUIA 2X4WA 3MEVA 1T0JA 4OB0B 3MO8A 2BE9B 5EG2A 4B9WA 4EMHA 4JRQA 2LQKA 3ZBDA 4Y92A 2LX9A 2RI2A 4KT0E 2FPEA 5CR2A 1W6XA 4MMLA 4J9IA 4BI4A 2MOXA 2OX7A 1SRLA 5GMKl 1X2QA 3OMGA 3EH2A 1LCKA 4JJNK 1OV3A 1ZX6A 3H9NA 1IRXA 4C5IA 1TUCA 2F5KA 2CP2A 2D8HA 2K9GA 2VB6A 3I5RA 1WHGA 2ABLA 1OU8A 3JCMQ 4E7KA 4F7UF 4M75G 2QQRA 2C0IA 1K9AA 3ZFJA 1M90R 3PVLA 3I55T 3H0FA 3RUXA 4HKEA 1ZBXA 4FW1A 5FROA 1FMVA 2NWMA 3VS1A 1GCQC 2K4YA 3G71T 3P8BB 3G4SQ 5GANj 3L2VA 2CDTA 1RI9A 4FT4A 1FMWA 2DEQA 4F7UA 2QA4A 2GTJA 4MMKA 3WVEB 4II1A 2FL7A 1N8RR 2LDMA 4J6XA 1K73C 5CKDA 1AOJA 2L5QA 2R58A 3CBOA 5A0GA 3L2UA 3CCUA 3CEYA 2XU8A 3G7ZA 3T9NA 3KFVA 3JV3A 4BDZA 4F7UB 2P84A 4GLMA 4C5HA 1NG2A 4QQGA 3OSSC 3CCSQ 1IGQA 2O88A 2CP5A 1IO6A 2FG0A 3C4SA 4Z89A 1WYXA 2X9HA 2AKKA 4PJJA 4GBQA 1PSFA 5AT1B 5KYUB 5FLXE 1BU1A 3M4YA 2LNHB 3CPWA 2BUDA 4M7AF 3CCEQ 1TUGB 1GFDA 2LCSA 3EGDB 2YT6A 1SHGA 1K9MC 2LT4A 3QZ9B 5FWBA 2JTFA 2LQ8A 2RJFA 3RMQA 1SF9A 4DOWA 1WJQA 2YRVA 2L3PA 3OYYA 3D7SB 4FSXA 1KD1U 1VQMT 2CKKA 3SWNC 5C6SA 2DBMA 1J3TA 3GIBA 1YITQ 4C8QD 2QASA 4M7AA 1PKTA 1M1KU 2HKQB 2EJFA 3OYLA 2QEXQ 4OB2B 3S3OA 4CC7A 1D09B 4MZTA 4M78F 3EFOA 1YJWT 3OS5A 4J9BA 2DK3A 3JB9G 3GBQA 1AD5A 3JCMf 4DQ2A 1VQNA 4C92D 5CCAA 1KC8U 2C0OA 1GFCA 4BUGA 2C06A 2DKGA 2E5KA 5IXBA 3RIRA 3X24B 1ZQ1A 4LDUA 2HD0A 1D0ZA 2H8HA 3M4GA 1JJ2A 3G6EA 4M78A 3OMCA 1E6GA 1QVFA 4C0ZA 1S72Q 4D8DA 4OMOA 1MV3A 3G6EQ 1MGQA 2E4HA 2LX7A 4ZNXA 3LX7A 2JT4A 1WZOA 3M54A 2HNIA 2CZ6B 2A08A 1VQPA 3M57A 5LJ3e 4A54A 1KQ2A 1H92A 3BY7A 3DB4A 3CCJT 1CKBA 2JMCA 3KXTA 5GAOq 1BI2A 4CRIA 3VRZA 3CC7A 1CKAA 2DBKA 4HVWA 5C0MA 2FZKB 4M7DE 3CC2T 3C95A 4BY6C 1K76A 2DO3A 2FO0A 4XTYA 2RB6A 3MJXA 2X35A 2B86A 4LDWA 3CXCP 4O6JA 3M0TA 4CC4B 1YJ9Q 1EFNA 1PD1A 3CBMA 1V29B 3V8KA 3H0HA 4A53A 3BDLA 3SWNB 2LP5A 1RAGB 1Q81U 2X4YA 3HL8A 2CP6A 2JS0A 4JRPA 2VYTA 1BIAA 2VXFA 7AT1B 1M3BA 1TSFA 2RPNA 2XDBA 3QBYA 2RQTA 5IAYA 4XTXA 2F2VA 1Q7YU 1MV0B 4QW2A 1E6HA 2RQRA 2E65A 1E7OA 2RA2A 4QQDA 2FRWA 4L59A 1U3OA 1T0HA 1OX9A 4M77E 3TCJA 2DRKA 4LXCA 2XKOC 4KBMB 1YI2Q 4JRIA 4ZGDB 2HQHA 2IPOB 2ED1A 4R55A 1I5OB 5LJ5g 3OYMA 5FRMA 2RF0A 1VQLA 1PCXA 4DBRA 1X27A 1U5SA 2KT8A 3OB9A 1VQ8A 1VQLQ 4ANJA 1X6GA 1YHQQ 2DRMA 4BE0A 2RQWA 1VQ8Q 3INZA 2KK4A 5DY9A 1UGQB 3URGA 4QVDA 1R77A 4UC4A 1X01A 2DIQA 3VUZA 2DYIA 3C0CA 5CKBA 3VS7A 5KH6A 4RKUE 2RK2A 3FIFA 3PTAA 1G3SA 1K1ZA 1Y0MA 3CCUT 1VQ6A 1AZEA 1K73R 3RR6A 2ROTA 2QG9B 2VV5A 1IZ6A 4IIOA 4VUBA 1UB4A 3CCST 1HK9A 3A8LB 3G1JA 4RTWA 2E10A 3JCMX 2R5AA 1Y57A 3CC4A 2BZ8A 1ZSZC 2YLBA 1RADB 3MEAA 1WHMA 2MF2A 1SEMA 1RAIB 5IH2A 4QQ6A 2A7YA 3CMEA 2KYMA 3CMAQ 3LWIA 2JNGA 3GPLA 4M7DC 5AYFA 2J7IA 2P0QA 5D6YA 4OB3B 4NOYA 2DIGA 3I55Q 2OAWA 1KHIA 2L3SA 4EMGA 2RHYA 1NLOC 1TUDA 3I5SA 1K9MR 2E70A 1Z9ZA 2HAXA 3CCVQ 1YITT 1GCPA 4OMLA 4HT9A 4NL2A 3G71Q 4RG8A 1LNXA 1TU0B 1IHVA 5A2QE 4JDSA 2QEXT 3X28B 2DETA 4PFPA 3L2QA 2HQXA 4BE2A 1QKXA 1AWWA 2V26A 4M4ZA 2K79A 3GNFB 4OP0A 4KRTA 2JZ2A 2PU9B 4LDVA 1D1CA 5J3BA 1NYFA 4LD9K 1D3BA 1IREB 2F69A 4M77C 4BE1A 4HVVA 2OAUA 1B3QA 1QWEA 3MEWA 5I21A 1PG5B 1NBEB 2YXYA 5LJ5d 4F17A 2V1RA 1VQNT 1AEYA 2DEUA 3PIOA 1KD1C 1ACMB 1QWFA 1I0CA 2NUPA 3JCMb 4PJOC 1JBMA 2PVOB 5GAMg 4PJMA 2M0OA 1W2BA 2JOYA 1G83A 3IQLA 1JO8A 4J9EA 2PVDB 2CUDA 3G6ET 1M1KC 2KDSA 1OULA 3CCMA 1HSQA 4WF2A 3A1PA 5LJ5f 5GJVB 1N9SA 4FW2A 2GQVA 5LJ5h 1Y96B 1VQPT 1VQMQ 2BTTA 1P92A 3CQTA 3EHQA 1Y07A 1AZGB 3SFMA 2OJ2A 1QW1A 5A0DA 2OTLA 2K6DA 2HKNA 1ZSZB 3CCLA 5GAOr 8ATCB 2ZZDA 2ZPGB 2XDDA 5I11A 1KC8C 5DLOA 2C0TA 2FYKA 4OGEA 4KULA 2D9TA 4M7DB 1IXDA 4M75F 1ABQA 4OMFB 3V7SA 1Q82R 2J6FA 1YJ9T 1QLYA 2DYBA 2E3HA 1MNDA 1K0SA 2D1XA 2EGAA 2XHCA 4ESRA 4J8OA 4RTTA 3JCMP 1HD3A 5L8RE 5GMKh 3UWNA 1M2VB 2RQVA 4M75A 4MDWA 5DM7R 2AHJB 2M0YA 4M7AE 4MZPA 3LW5E 3QIIA 3REAB 1QCOA 5ECAA 2EYWA 2VUBA 4M77D 3CCRA 3VYHB 2VVKA 3LGFA 1JXOA 3X25B 3RKYA 4PJLA 3M0RA 1NJIU 3UDCA 2HSPA 1G5VA 2VKNA 4C5EA 2YDLA 1V76A 3M0PA 2AZVA 4XTZA 1O9SA 2ECZA 3RBBB 2RHZA 1VQLT 1LPLA 4ME7A 4PNOA 4BACA 4PJOB 1AHJB 4E6RA 1AWOA 4C0DC 1YHQT 1Q81C 5GAN6 4J83A 2ENMA 4FU6A 1VQ8T 4JS5A 2DJZA 2HL3A 4M7DG 1RABB 2EQUA 1YIJA 4PFOA 3JAME 2DL3A 2LTOA 2D8JA 3E19A 3M53A 1RL2A 3H0IA 5GAOl 3NFCA 1Q7YC 5I2SA 2OTJA 3JRZA 3OS1A 4AT1B 4LDXA 2MI6A 3NTHA 5LJ3j 1MNEA 5GAN2 5J26A 3GOXA 2EAYA 1PC0A 3ZL7C 2YHTA 2K7AA 3UT1A 3REBB 3TREA 2RHIA 1MHNA 1B7TA 5CAIA 4EIKA 1VQ6T 1GL5A 1RUWA 1NPRA 1BI1A 4JPBW 5GAMf 2X51A 4PJNA 1YWPA 1UJ0A 4B6MA 2JM9A 1K8AU 5GAMh 1AT1B 2JTEA 4C8QC 3E9FA 4CC2A 3CMAT 3QYGB 3JB9F 3WVDB 2DZ9A 4M77G 3TVTA 2DL7A 3M56A 3RKXA 4OMQA 1M30A 1XQHA 1PKSA 2EW3A 1UG1A 4PJOG 3PGGA 4AFZC 1NZ9A 1SHFA 3CCVT 4P5NA 3QWXX 1JB0E 3L2WA 1QP3A 4C92C 4KGXB 2J6KA 1NEGA 2MCNA 3UA7A 2OI3A 3TSZA 5KYNA 2RNAA 3DB3A 3THKA 4ZGJB 1VQ5A 1I8FA 2HMAA 3M9QA 2QA4Q 1HXDA 1TOVA 1ZUYA 3OSVA 4NS5A 2YUPA 3TQ7P 2QGFB 1I07A 2WSCE 4QKUA 1K4US 2FEIA 5KYUA 3MP1A 1RAAB 3DKMA 4FL6A 3SEMA 3CCUQ 2FHDA 4IUQA 2KSSA 1YJNA 3PIPA 2RN8A 3EGDA 2RI3A 3M55A 4FCYA 2XICA 3HP9A 2GBQA 1UGRB 2DD4A 3RKWA 4N0AC 2E6NA 1KD1R 3KBGA 2W10A 3CPFA 1N8RU 4DBQA 2M16A 3AT1B 5CVIA 2JW4A 1M4ZA 4J9CA 3UF4A 2NLUA 2QK0A 2P4RA 5CKHA 2BE7D 4MZMA 2PUOB 1OPLA 2DTOA 2M51A 3CBPA 2LJ1A 5LJ5e 1OX8A 2DD5A 3QYHB 2HL5C 4E7IA 1MUZA 4PLIA 4JJDA 2QDYB 2OTLT 1BB9A 4N4HA 1GCQA 3H41A 4C8QB 1Q86U 2CYZB 1Q95G 4LD6A 1U1TA 2LVMA 3NGPA 1KC8R 1ZA2B 2Y4YA 1G2BA 2EQIA 2ZAEA 1FXXA 5L23A 1R8OB 2KROA 1W1FA 4ORZA 3V7CA 3V8JA 1JQQA 1QVGP 2LMJA 4IKFA 2DNUA 3META 3CCQA 4C92B 2EFIA 1VQNQ 1M3CA 4X9DA 4EDUA 1WXTA 3QHSA 1GXIE 4FYXB 2O2OA 5GAN8 1CSKA 5GMKe 4M7AD 3A8OB 2B8AA 5FWCA 2QQSA 3ER0A 1KG1A 2DL8A 1RI0A 1AWXA 2MYSA 1F1BB 1OQKA 2V8KA 4EMKC 3VV0A 2VASA 1KIKA 3EH1A 1PNJA 3O5ZA 3QUIA 1YP5A 5CQYA 1VQOA 3EFRA 2HBWA 1VQPQ 4IURA 3FDRA 2L8DA 3BE3A 4PL6A 3JB9H 3HFOA 2DPPB 1NLPC 2H3EB 2EVRA 4LNPA 1VQ4A 4J9FA 3SWNA 3QSUA 2QTVA 4C8QG 3DLLA 3OW2P 2W0ZA 4RMOA 3QJ6A 2KY9A 2CH4W 1VQ4Q 3CC7Q 2HQEA 2AT1B 4M78D 1Q81R 2LCLA 2BZYA 2JVVA 2FZCB 2K5LA 2KT1A 1ABOA 3CD6A 5EC7A 1YIJT 2DL4A 3U23A 4O5VA 2KXCA 5CKEA 1PWTA 1WXBA 3ULRB 5CQXA 3HKSA 1PHTA 3PNWC 1Q7YR 2RD1A 3OYIA 2QXFA 3LH5A 3NTIA 4C92G 1NJIC 2LZ6B 4PKCC 1NM7A 4ELYC 1MMGA 1WIEA 2KI7A 4BD3A 1TTHB 2D0QB 1SKUB 4RUGA 4A4EA 2O31A 2KRSA 2RI5A 4JLGA 1UGPB 3MPUB 3OYCA 2EYQA 8AT1B 3BDUA 5GAMe 2CGHA 2DLPA 1G3YA 1YBYA 1UHFA 3QJYA 2K5FA 1UUEA 4AG2C 5GJWB 1OYXA 4XTVA 3UPUA 1WFWA 3EG9B 2KEAA 1PRMC 1VYUA 3SB2A 2SEMA 2ZPIB 2G3RA 1WDXA 1NEBA 4X34A 1QQJA 1EIFA 4EMKB 1SPKA 5GAN4 2R5MA 2DXUA 5HK3A 2QA4T 1KSWA 1H3HA 4JJCA 2A0FB 2DFUA 5IXFA 1VQ5T 3QZ5B 1K8AC 2DF6A 2FB7A 4XU1A 4RCCA 3JCMJ 2HCKA 2KQWA 1N5ZA 2ZPBB 5CK9A 2CT3A 2X4XA 4IIMA 3JB9J 4ZN1A 4XK8E 4DEYA 3JCMV 3LYIA 1VQ6Q 4BY6B 2R57A 1YJNT 4RCBA 2LC4A 2E3IA 2PVGB 4OVAA 2F2WA 3TEEA 1FMKA 5KYYB 2GTOA 5I2MA 1VIFA 5KYWA 3CC4Q 4HXJA 1NE8A 3CXCA 5KE3A 2J05A 2E64A 1PM3A 3EGXB 2KRNA 4J6YA 1QP2A 2JMAA 3CMEQ 4YTLA 2X3WD 1WGSA 4C0FA 1Y7XA 1BI0A 1KQSP 2ED0A 3GLXA 5FU7C 2ZPFB 1Y71A 4HCZA 2L3RA 3OYNA 2X4JA 1KJWA 2L2PA 1GRIA 3HRTA 5KYWB 2RO0A 4CI0C 4WTOB 5GAN5 2EGCA 3OBYA 2Z0WA 5HY6A 2GFUA 1TXQA 3PMTA 4OB1B 3OBWA 2EQKA 5KCHA 1UJYA 4RTYA 4ZN3A 1M27C 4OF1A 1BIBA 3PMIA 4JZ3A 1SG5A 4K11A 2O4XB 2YRDA 4ATOA 3LGLA 3I56A 1N8RC 4DOVA 4HCKA 4RTVA 2EGEA 2E6ZA 4M7DF 2H3JA 1Y96A 2DXBA 4LE9A 2QAZA 1WHLA 4QVZA 1UDLA 4F7UE 4B9XA 4HCCA 1ZSZA 2GQIA 5GANg 2QYZA 4F04B 5GAOn 4A4GA 1X75C 3NTKA 1VQ7A 1Q86C 5D7UA 2COYA 1B34B 2QTXA 2AKLA 2XK0A 3P8HA 3R6NA 4M7DA 2DERA 3C94A 3CCMQ 4OMNA 2P0PA 3ZEHA 1VIEA 2G6FX 2ZPEB 1HJDA 5IT9E 3E1SA 1VQOT 1QVGS 3RMSA 4L5GA 4D6WA 2EYZA 3MP6A 2CSIA 3VS6A 3WXMB 3VS2A 2OTLQ 1VQ4T 1ARKA 3CC7T 3CCLQ 2K3BA 4M77F 1M2VA 1VQKA 5CKFA 5KYXB 4LUDA 3HSBA 2GFAA 3HHTB 3NPFA 2XIDA 5FRNA 2YRCA 3JCMc 2LQNA 3OS2A 2K57A 3I9QA 2LJ0A 2JTMA 3HRUA 4PJOF 2MPXC 1YNZA 1I81A 4J9GA 3OYEA 5GAN3 1A0NB 1JXMA 5LJ5j 4M77A 1YJWA 1W70A 1RLPC 2IIMA 1LVKA 4V2SA 1B07A 2DAQA 1FWZA 2EQJA 4LN2A 5LL6S 4A63B 3JB9I 2EWNA 2KBTA 3P8DA 5LJ3d 1NJIR 1ZSGA 2A36A 4QT7A 4KGVB 1AWJA 3VJPA 4PJOA 4OMMA 2WACA 1BCMA 3OW2S 1GBRA 1UECA 1Q82U 2MWPA 1JU5C 1ZUKA 1R0BG 2KYBA 4M77B 1X6OA 2RHUA 4ELZC 3RERA 1C6VX 2XG8D 4RTXA 3CCRQ 4KH0B 2E1HA 2J6OA 1YCYA 3MP8A 2M1HA 4J7IA 3OYJA 3M0UA 2M9UA 2DA9A 2DTIA 2CZ1B 1M8VA 3I35A 5D6XA 4M75D 4FSSA 3A8HB 5J39A 3CCJA 2Y90A 1VQ9A 4M78E 4QVCA 3NHNA
chains in the Genus database with same CATH topology
4XTXA 2RM4A 5CKHA 2XI9A 2P4TA 2PUOB 3R6OA 4MZMA 4QW2A 1Q7YU 2A3LA 1SSFA 2DTOA 2IG0A 2XDPA 3VYGA 4JUVA 3CCQT 3CC2A 4JS4A 3HPWA 3FB9A 3BFMA 3CBPA 2E65A 4HA8A 2RA2A 2DD5A 3QYHB 2BKDN 4QQDA 5GMKm 3FJPA 4BB7A 1OZ3A 5LJ5e 4BDYA 4IUPA 1M1FA 2DTHA 4L59A 2LT1A 5GANd 4E7IA 3L2ZA 3M5AA 4PLIA 4M77E 3TCJA 4M75C 4BI3A 2QDYB 2CS7A 2XKOC 4KBMB 2OTLT 1VUBA 4JRIA 4N4HA 1U8RA 4C0GA 2RK1A 4X9CA 2QQBA 4C8QB 4ZGDB 1Q86U 2CYZB 3N5BB 2FVUA 2KVQG 4R55A 5LJ5g 3OYMA 4LD6A 5FRMA 1U1TA 2LVMA 4J5YA 3JCMe 2Y4YA 1VQLA 4MDXA 2EJGA 4RG2A 1M5Q1 1N6AA 2I2LA 1OZ2A 2VGNA 3OB9A 1S72T 1VQ8A 3X26B 1D3BB 3QPHA 2WSFE 3JCMg 5GANf 3CC4T 4BE0A 1FXXA 1R8OB 3QDRB 1JRIA 3V7CA 3V8JA 5A0LA 3INZA 1O75A 2KK4A 5GANh 3JSCA 4IKFA 3META 1VQMA 2RJEA 5DY9A 3CCQA 4C92B 1UGQB 2EFIA 3LLRA 3CMET 3FEOA 3OY9A 3URGA 4QVDA 4UC4A 3MHXA 1H641 4X9DA 1X01A 4EDUA 3QHSA 2DIQA 1GXIE 3BW1A 5GAN8 5GMKe 3VUZA 4M7AD 5DLQE 4EPCA 2PQWA 5CKBA 3A8OB 5KH6A 2B8AA 4RKUE 5M9OA 1QVPA 4R56A 2P0KA 2RK2A 2QQSA 3FIFA 2CZ0B 3ER0A 1W2BS 1OI1A 3CD6T 1KG1A 4C8QE 3PTAA 2XD0A 1RI0A 5FU7B 1N9RA 1G3SA 2D6FA 3RESA 3CCUT 2RHXA 4N4GA 2V8KA 1KQSA 4KUDK 1VQ6A 4M7DD 4EMKC 3VV0A 2VV5A 2GCXA 1IZ6A 4XU3A 2ZCFB 1U1SA 4VUBA 1UB4A 3V8LA 4HCBA 3CCST 1HK9A 1WQ7A 3Q1JA 3A8LB 4XTUA 2E10A 3GF5A 3JCMX 2R5AA 4FM4B 3QUIA 4E7HA 5CQYA 1VQOA 4J7FA 2LCCA 4J6WA 3CC4A 3EFRA 2IVWA 5GAMj 4IURA 3G4SA 1XOVA 1I5LA 4M7AC 2YLBA 3FDRA 2EJ9A 3MEAA 4IUUA 2MF2A 2L8DA 4PL6A 3JB9H 4FT2A 4QQ6A 3HFOA 2DPPB 3OYGA 1VQ4A 1M90U 1WQWA 2A7YA 3SWNA 4C92E 3CMEA 3QSUA 3M59A 3LWIA 2JNGA 3GPLA 4M7DC 5AYFA 4C8QG 3DLLA 5HK0A 4C0DB 4RMOA 3QJ6A 2KY9A 4HT8A 2P0QA 1KQSS 3I56T 2HQEA 5D6YA 4M78D 4OB3B 2K5IA 4C8QF 2LCLA 4NOYA 2JVVA 2DIGA 2QQAA 2K5LA 3O8VA 3OS0A 3CD6A 1KHIA 4EMGA 2RHYA 1YIJT 2E70A 1UGSB 4O5VA 3JB9D 2VC8A 5CKEA 5LJ3f 2HAXA 3TU4K 1YITT 1NPPA 5CQXA 2Y4XA 3HKSA 3VU3C 3PNWC 3CCSA 4HT9A 4NL2A 4RG8A 2RD1A 1LNXA 5LJ3h 3OYIA 2QXFA 1YI2T 3SD4A 3NTIA 2LNVA 5GMKj 5A2QE 4JDSA 2KMTA 3A5ZB 4C92G 2QEXT 2EKOA 4XAXB 1LJOA 3FLGA 4JLIA 4A4KA 2QI2A 3X28B 1BI3A 4C8QA 3OYHA 3CXCS 4M75B 1NJIC 4M7DF 4N4IA 2RH2A 4ZTJA 4M78C 4PKCC 3FRNA 3L2QA 2HQXA 4C92F 4ELYC 3FC3A 4BE2A 4IUTA 3CCMT 1XTDA 4BD3A 1VQ7T 2F5TX 4PJOD 3GNFB 2BIVA 4OP0A 2D0QB 3J7AF 2JZ2A 3OYFA 4A4EA 2PU9B 3CCEA 4LDVA 3VKIA 5J3BA 4LD9K 4Z02A 4LDYA 1D3BA 2RI5A 1IREB 4JLGA 2F69A 3OYAA 1UGPB 3L42A 3OYCA 4M77C 4BE1A 2EYQA 2OAUA 3BDUA 5GAMe 1G3WA 2CGHA 2L89A 2QQ9A 2DVEA 3MEWA 3OYKA 1G3YA 3F70A 5I21A 2PUKB 5LJ5d 1YBYA 3CCLT 1VQNT 3QG1A 4C92A 2V8IA 3QJYA 3MCAB 2K5FA 5GAMd 3PIOA 1KD1C 1YITA 2RJDA 4KUIA 4JRKA 2X4WA 3MEVA 4OB0B 3JCMb 4PJOC 3MO8A 1JBMA 2PVOB 5GAMg 2DXCA 1OYXA 4XTVA 3UPUA 2M0OA 1W2BA 1VQKT 2JOYA 5EG2A 4C5GA 2K3YA 4B9WA 4EMHA 3SB2A 3AHUA 2QEXA 4JRQA 2PVDB 2LQKA 3JCMd 3ZBDA 2HBPA 2ZPIB 2G3RA 3G6ET 4A4FA 2KDSA 1M1KC 4X34A 2LX9A 2RI2A 4KT0E 3CCMA 4WF2A 5CR2A 1G3TA 4MMLA 4BI4A 5LJ5f 1EIFA 1N9SA 3OMGA 4EMKB 2DZCA 5GMKl 2MMPA 5GAN4 2R5MA 4JJNK 2GQVA 2DXUA 5HK3A 5LJ5h 2QA4T 1Y96B 1VQPT 2MWOA 1P92A 1ZHIA 1Y07A 3SFMA 1KQ1A 3QZ5B 4C5IA 1K8AC 1VQ5T 1QW1A 2F5KA 2FB7A 4A4HA 3GP8A 5A0DA 2OTLA 1PSEA 4XU1A 4RCCA 4M7AB 3JCMJ 5KCOA 3CCLA 5GAOr 2KQWA 4F7UG 2ZZDA 4ZTFA 1TH7A 2ZPGB 2XDDA 1KC8C 2ZPBB 3JCMQ 3JCMh 5CK9A 5DLOA 4E7KA 4F7UF 4M75G 2QQRA 4N0AA 2FYKA 2X4XA 4OGEA 3JB9J 4KULA 4ZN1A 2D9TA 3ZFJA 5HKCA 4XK8E 4M7DB 3JCMV 3LYIA 3I55T 4M75F 1S72A 4NL3A 3RUXA 4OMFB 3OA6A 4BY6B 2R57A 4HKEA 1ZBXA 4RCBA 2LC4A 3V7SA 3C12A 3CCRT 1YJNT 3V7RA 2PVGB 4OVAA 3S6WA 3TEEA 1YJ9T 2RJCA 5FROA 5I2MA 1VIFA 2K4YA 3G71T 3P8BB 5GANj 4E7LA 3L2VA 2XHCA 4FT4A 4IUVA 1NE8A 2DEQA 4F7UA 4J8OA 3CXCA 2QA4A 3QO3A 3JCMP 5KE3A 2E64A 4E7JA 5L8RE 5GMKh 4J6YA 3UWNA 1QP2A 5IN1A 4M75A 4MMKA 3WVEB 4FIBA 4YTLA 4MDWA 1WGSA 4II1A 4C0FA 2FL7A 1Y7XA 5DM7R 1BI0A 1VQ9T 2AHJB 2LDMA 4J6XA 3GLXA 4M7AE 4M78B 4MZPA 5FU7C 2ZPFB 1Y71A 4HCZA 5CKDA 1K73C 3LW5E 2L5QA 2L3RA 2R58A 3CBOA 3ME9A 3QIIA 5A0GA 3L2UA 3CCUA 3OYNA 2X4JA 3CEYA 2XU8A 3G7ZA 1FX7A 2JN0A 3T9NA 3HRTA 2OTJT 2EQMA 2RO0A 2VUBA 4CI0C 1Q82C 4M77D 2CZ7B 5GAN5 4BDZA 4F7UB 1BKBA 3S3MA 4C5HA 3OBYA 5HY6A 2VGMA 3VYHB 3LGFA 3CCRA 2GFUA 3X25B 4QQGA 3RKYA 3OSSC 3PMTA 1YJ9A 3H6ZA 4OB1B 4DA4A 1NJIU 3OBWA 1WJSA 4XTWA 3UDCA 2EQKA 2ZGWA 5KCHA 3A8GB 1G5VA 4C5EA 4ZN3A 5GMKi 1I4K1 3C4SA 5CO7A 4OF1A 3SDZA 3HFNA 1BIBA 3PMIA 4XTZA 1PSFA 1M1GA 2O4XB 3L2RA 1O9SA 4ATOA 1VQLT 2RHZA 4M7AG 4ME7A 4PNOA 2E5QA 5FU6C 1AHJB 3LGLA 5FLXE 4ZGEB 4BACA 3M4YA 4C0DC 1YHQT 1Q81C 3CPWA 2BUDA 3I56A 3S3NA 1N8RC 5GAN6 4J83A 4M7AF 4Y28E 4FU6A 1VQ8T 4JS5A 3GNGA 4DOVA 2DJZA 4M7DG 1K9MC 2LT4A 2EQUA 3QZ9B 1YIJA 2JTFA 2E6ZA 3OQ5A 3JAME 2LQ8A 2RJFA 1XNIA 2LTOA 3PT9A 3RMQA 5GAN7 4DOWA 4EMKA 1WJQA 3E19A 2YRVA 1RL2A 3M53A 3OYYA 3NFCA 4FSXA 5GANe 2E12A 5GAOl 2H3JA 1Q7YC 1VQMT 5I2SA 1KD1U 2K3XA 2YLCA 4Y91A 1Y96A 2DXBA 3JRZA 2OTJA 1WPYA 2CKKA 3SWNC 5C6SA 3J80E 3OS1A 1QVGA 4QVZA 1YI2A 3LH0A 4LDXA 4F7UE 2MI6A 3NTHA 4B9XA 5LJ3j 3HRSA 5GAN2 3LWHA 4HCCA 3GIBA 4C8QD 4M7AA 5J26A 3GOXA 2EAYA 2VXEA 5GANg 1M1KU 4M75E 2YHTA 5GAOn 3CPWS 4A4GA 3UT1A 2EJFA 1X75C 3KUFA 4L6V5 3OYLA 3NTKA 3KXTA 1VQ7A 1Q86C 3TREA 2RHIA 1B34B 1MHNA 4OB2B 2QTXA 2XK0A 3P8HA 4Q5WA 5CAIA 1VQ6T 5D6WA 3S3OA 4M7DA 1NPRA 3C94A 1W4SA 4MZTA 4M78G 2P0PA 1BI1A 3ZEHA 1VIEA 1YHQA 4PJOE 2ZPEB 5GAMf 3EFSA 4M78F 3M58A 5IT9E 1YJWT 1K8AU 3E1SA 5GAMh 3OS5A 3X20B 1VQOT 1QVGS 2DK3A 3JB9G 3RMSA 4L5GA 4D6WA 4BI8B 3JCMf 3G4ST 4C8QC 4DQ2A 1VQNA 3MP6A 3PFSA 4C92D 3E9FA 5CCAA 1KC8U 3MEUA 3QYGB 3CMAT 2LRQA 4PLLA 3WXMB 3JB9F 3WVDB 2DZ9A 4BUGA 4M77G 1WNLA 3L1AA 2C06A 2DXTA 2DKGA 1VQ4T 2JUFA 3CC7T 3RIRA 3M56A 1BYMA 3RKXA 3X24B 4M77F 1KHCA 1VQKA 5CKFA 1ZQ1A 4LDUA 3JCMW 2HD0A 1XQHA 3QXEB 3M4GA 3HSBA 2GFAA 3OYBA 1LOJA 3HHTB 1JJ2A 2XIDA 3G6EA 1H3ZA 5FRNA 4M78A 3JCMc 4PJOB 3OS2A 3OMCA 2K57A 4PJOG 1QVFA 4C0ZA 4GLKA 3OW2A 3PGGA 4XQ3A 5KE2A 1NZ9A 2O01E 2JTMA 3HRUA 3CCVT 5CIUA 4P5NA 4E47A 1JB0E 1MGQA 4PJOF 3LX7A 3M54A 3L2WA 1QP3A 4C92C 1I81A 2HNIA 2K2VA 2CZ6B 3OYEA 5GAN3 1VQPA 3M57A 5LJ5j 4M77A 5LJ3e 4A54A 1KQ2A 3DB3A 4ZGJB 1WJRA 1YJWA 1VQ5A 3BY7A 1I8FA 3OYDA 3M9QA 2GF7A 3DB4A 4GY5A 2MAMA 4V2SA 3CCJT 1HXDA 3OSVA 5GAOq 2DAQA 4NS5A 1FWZA 1BI2A 2EQJA 5LL6S 4OGCA 3JB9I 3CMAA 2EWNA 3P8DA 3EAEA 5LJ3d 3DLMA 4CRIA 1K73U 1JJ2S 2O4XA 2WSCE 3VJPA 5LJ3g 3ASKA 4XU0A 4PJOA 1M90C 2WACA 3CC7A 3OW2S 1QVFS 3VUBA 3MP1A 3DKMA 5C0MA 3QKJA 3CCET 3I55A 1Q82U 3CC2T 4M7DE 4FL6A 5FU6B 2FHDA 1DJ7B 2MWPA 2V8JA 3C95A 4IUQA 2KSSA 4BY6C 3PIPA 1YJNA 2DO3A 2RI3A 4XTYA 2RB6A 3M55A 4M77B 1X6OA 2RHUA 4ELZC 3RERA 2XICA 2XG8D 3H8ZA 2X35A 5GAOp 4LDWA 3HP9A 3CCVA 4TVRA 2E41A 2E1HA 4O6JA 1YCYA 3G71A 2KAFA 3MP8A 2M1HA 2EIFA 4J7IA 2WSEE 3OYJA 1UGRB 2M9UA 3E9GA 2DD4A 3CBMA 1V29B 2DTIA 3RKWA 3V8KA 3BDLA 4A53A 1UEBA 2CZ1B 4N0AC 5GAOm 2E6NA 3SWNB 3KBGA 5D6XA 1Q81U 1M8VA 3CPFA 2X4YA 3A8MB 3HL8A 4M75D 1N8RU 3A8HB 5J39A 2ZPHB 4JRPA 2M16A 2VYTA 1N27A 3CCJA 1BIAA 1M9SA 2VXFA 5CVIA 2Y90A 3J81E 1VQ9A 1K9MU 1M4ZA 2XDBA 3QBYA 1B34A 4XU2A 4M78E 2NLUA 4QVCA 5IAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0D B;  4BY6 B;  4C0F A;  5FU6 B;  5FU6 C;  5FU7 C;  4C0D C;  4BY6 C;  4C0G A;  5FU7 B; 
#chains in the Genus database with same CATH topology
 2RM4 A;  1UFF A;  1VQ9 Q;  3R6O A;  1YIJ Q;  2A3L A;  2IG0 A;  3TSW A;  2ROL A;  3CC2 A;  3HPW A;  3BFM A;  4Z8A A;  2PNI A;  2BKD N;  2FPD A;  4BDY A;  3FJP A;  1OZ3 A;  1WI7 A;  2KGT A;  4IUP A;  5GAN d;  2DTH A;  2LT1 A;  2OTJ Q;  3M5A A;  4BI3 A;  2CS7 A;  1K8A R;  6AT1 B;  1XJW B;  2QQB A;  3VS0 A;  2KVQ G;  3NMZ C;  3CPW P;  2CP0 A;  4J5Y A;  1YN8 A;  2EJG A;  5IHN A;  1N6A A;  1OZ2 A;  1S1N A;  1YCS B;  2XMF A;  3SHW A;  3UAT A;  1PD0 A;  3QPH A;  3JCM g;  5GAN f;  3CC4 T;  1VYV A;  2FZG B;  3QDR B;  1WHH A;  5A0L A;  1O75 A;  2VWF A;  4LUE A;  1BCO A;  5GAN h;  2COW A;  1QCN A;  3LLR A;  3CME T;  3FEO A;  3OY9 A;  3MHX A;  1H64 1;  4D8K A;  5DLQ E;  2KRM A;  2PQW A;  5M9O A;  4R56 A;  1AVZ C;  1W2B S;  1X69 A;  4DBH A;  1OEB A;  2D6F A;  2KNB B;  2AK5 A;  4KUD K;  3V8L A;  1WQ7 A;  4E7H A;  2A37 A;  4J7F A;  2LCC A;  2IVW A;  5GAM j;  3G4S A;  4M7A C;  2EJ9 A;  1VQ5 Q;  3PE0 A;  4FT2 A;  3OYG A;  1C0M A;  2CP3 A;  1M90 U;  1WQW A;  3EG0 A;  1JJ2 P;  1QMC A;  4AMC A;  2GGR A;  1QVF P;  1WLP B;  4C0D B;  2AIR B;  1KQS S;  3E2U A;  3I56 T;  1OU9 A;  4C8Q F;  2J06 A;  2K5I A;  1SRM A;  3O8V A;  1YJN Q;  1WX6 A;  1ZBJ A;  2CUB A;  1OPK A;  1UGS B;  3JB9 D;  2VC8 A;  3RDV A;  2MIO A;  1K0X A;  2QGG A;  3CCS A;  2O9V A;  1D0X A;  2KMT A;  2CSQ A;  2EKO A;  4XAX B;  1LJO A;  4A4K A;  3OYH A;  1BI3 A;  4C8Q A;  4N4I A;  2RH2 A;  4ZTJ A;  4M78 C;  4C92 F;  2HEQ A;  3CCM T;  1M1K R;  1VQ7 T;  1D1A A;  2X3X D;  1Q86 R;  2ESW A;  4KGZ B;  3CCE A;  1X6B A;  4Z02 A;  2LQW A;  1JEG A;  3OYA A;  3L42 A;  3QDF A;  1G3W A;  2QQ9 A;  2DVE A;  4DBF A;  2F1L A;  2PUK B;  4R0K A;  3CCL T;  3QG1 A;  4C92 A;  3MCA B;  3EHR A;  1WHK A;  5HCK A;  1YIT A;  4JRK A;  2DXC A;  1ZUU A;  1VQK T;  4C5G A;  2K3Y A;  4OMP A;  2JXB A;  2QEX A;  3AHU A;  3JCM d;  2HBP A;  2NUT A;  1IHW A;  1T3S A;  4A4F A;  2YUQ A;  1G3T A;  2EKH A;  1BK2 A;  2KE9 A;  2DZC A;  2NUZ A;  2AZS A;  2MMP A;  1MMD A;  3CCQ Q;  2MWO A;  1ZHI A;  1KQ1 A;  4A4H A;  3GP8 A;  4JZ4 A;  1PSE A;  2COZ A;  2NUT B;  4M7A B;  5KCO A;  4F7U G;  2PTK A;  4ZTF A;  1TH7 A;  4J9D A;  3JCM h;  4N0A A;  5HKC A;  1S72 A;  4NL3 A;  3OA6 A;  3CCR T;  1ZLM A;  3C12 A;  3V7R A;  3S6W A;  3EFO B;  2EYX A;  2RJC A;  2CP7 A;  1VQO Q;  3EG3 A;  1FYN A;  4E7L A;  1RAH B;  4IUV A;  3QO3 A;  1MMA A;  4E7J A;  1UTI A;  5IN1 A;  1G8X A;  4FIB A;  2L0A A;  4AG1 C;  1VQ9 T;  4DEX A;  4M78 B;  3RNJ A;  3ME9 A;  4CC3 A;  3CD6 Q;  1FX7 A;  2JN0 A;  1HYO A;  1PRL C;  2HDA A;  2EQM A;  2OTJ T;  4HVU A;  2DJQ A;  1Q82 C;  2BZX A;  2CZ7 B;  1BKB A;  3S3M A;  2VGM A;  1V1C A;  1YJ9 A;  3H6Z A;  4DA4 A;  1WJS A;  4XTW A;  2ZGW A;  3A8G B;  1BBZ A;  5GMK i;  1I4K 1;  5CO7 A;  3SDZ A;  3HFN A;  2MK5 A;  1M1G A;  2DE0 X;  3L2R A;  4M7A G;  3EG9 A;  2E5Q A;  5FU6 C;  4ZGE B;  3S3N A;  4Y28 E;  2YWW A;  1X43 A;  3GNG A;  2JJ9 A;  2YUN A;  3OQ5 A;  1RAE B;  5GAN 7;  1XNI A;  3PT9 A;  4EMK A;  2DM1 A;  1WA7 A;  5GAN e;  2E12 A;  2K3X A;  2YLC A;  3QWY A;  4Y91 A;  1WPY A;  3J80 E;  3MKD A;  1QVG A;  1YI2 A;  3LH0 A;  3HRS A;  3LWH A;  2GNC A;  2HSE B;  2VXE A;  4M75 E;  1M8M A;  3CPW S;  4L6V 5;  3KUF A;  4RTZ A;  3VS5 A;  2DMO A;  4Q5W A;  4AFQ C;  5D6W A;  1WXU A;  1W4S A;  1H8K A;  4M78 G;  4PJO E;  1YHQ A;  1R0C B;  4WCI A;  1OOT A;  3EFS A;  1QCF A;  2FPF A;  3M58 A;  5KYY A;  4E7Z A;  4KH1 B;  4FYW B;  1IB8 A;  3X20 B;  4BI8 B;  3G4S T;  3PFS A;  2EYY A;  3MEU A;  2LRQ A;  3VS3 A;  4PLL A;  2LJ3 A;  1W2B P;  1WNL A;  3L1A A;  2DXT A;  2EPD A;  1X2K A;  2JUF A;  2KR3 A;  1BYM A;  3EGX A;  1KHC A;  3JCM W;  4Z88 A;  1M2O A;  3QXE B;  3OYB A;  1LOJ A;  1KK7 A;  2FRY A;  1H3Z A;  4GLK A;  3OW2 A;  4XQ3 A;  5KE2 A;  2O01 E;  5CIU A;  4E47 A;  1KFZ A;  2JS2 A;  4J9H A;  2K2V A;  2PZ1 A;  1YWO A;  3EGU A;  3EG2 A;  3FJ5 A;  1WJR A;  1T3L A;  3M0S A;  3OYD A;  2GF7 A;  4GY5 A;  2MAM A;  4F14 A;  3CMA A;  4OGC A;  3A98 A;  3EAE A;  3DLM A;  1K73 U;  1JJ2 S;  2O4X A;  1GBQ A;  4E7S A;  5LJ3 g;  3ASK A;  4XU0 A;  1M90 C;  1QVF S;  3VUB A;  4FYV B;  3QKJ A;  3CCE T;  9ATC B;  4AFU C;  3I55 A;  5FU6 B;  2V8J A;  1DJ7 B;  1WHJ A;  1UE9 A;  2DX1 A;  3UA6 A;  2ATC B;  5GAO p;  3H8Z A;  3CCV A;  4TVR A;  2E41 A;  4RTU A;  2KAF A;  3G71 A;  2EIF A;  1TG0 A;  2WSE E;  3E9G A;  1VYT A;  2CT4 A;  2DL5 A;  1UEB A;  5GAO m;  1TWB A;  3HTR A;  3A8M B;  2ZPH B;  5IHK A;  1N27 A;  2EBP A;  1M3A A;  1M9S A;  3J81 E;  1Z9Q A;  1K9M U;  1B34 A;  3I56 Q;  4XU2 A;  5IHI A;  2XI9 A;  2P4T A;  1SSF A;  2XDP A;  4JJB A;  3VYG A;  2L3Q A;  4JUV A;  3CCQ T;  4JS4 A;  3FB9 A;  4HA8 A;  5GMK m;  4BB7 A;  1M1F A;  1IGU A;  3L2Z A;  4M75 C;  1VOM A;  1VUB A;  1U8R A;  1RLQ C;  4C0G A;  1D1B A;  2RK1 A;  4X9C A;  2YUO A;  3N5B B;  2FVU A;  4PFZ A;  3VRY A;  3JCM e;  2O9S A;  4MDX A;  5KYX A;  4RG2 A;  1M5Q 1;  1VQ7 Q;  1NYG A;  2I2L A;  2RQU A;  2SRC A;  2VGN A;  2KXD A;  1S72 T;  2YSQ A;  3X26 B;  1D3B B;  2CRE A;  1C1A A;  2WSF E;  1JRI A;  1EZZ B;  1YFN A;  3JSC A;  1VQM A;  1MMN A;  2RJE A;  2NYS A;  4E2F B;  2NUP B;  1D0Y A;  3BW1 A;  4EPC A;  1QVP A;  1VQK Q;  2P0K A;  2CZ0 B;  1OI1 A;  3CD6 T;  1QKW A;  2JM8 A;  4C8Q E;  1ZA1 B;  2XD0 A;  5FU7 B;  1EX4 A;  1N9R A;  4X1V A;  3RES A;  4AFS C;  4M7D D;  2RHX A;  4N4G A;  1KQS A;  2GCX A;  4XU3 A;  2ZCF B;  1U1S A;  4HCB A;  3Q1J A;  2RMO A;  4XTU A;  3GF5 A;  4FM4 B;  3EG1 A;  4J6W A;  1RAF B;  1XOV A;  1I5L A;  1TS9 A;  4IUU A;  1YJW Q;  1U06 A;  1UHC A;  4C92 E;  3M59 A;  1SSH A;  1RAC B;  5HK0 A;  4HT8 A;  5FW9 A;  2I0N A;  1VA7 A;  2QQA A;  3M0Q A;  3OS0 A;  2DIL A;  2K2M A;  4FYY B;  2CH4 A;  2V1Q A;  2HZY A;  2QDL A;  5LJ3 f;  3TU4 K;  5I22 A;  1NPP A;  2Y4X A;  3VS4 A;  3VU3 C;  5LJ3 h;  2A28 A;  1YI2 T;  3SD4 A;  2LNV A;  5GMK j;  3A5Z B;  3FLG A;  4JLI A;  3CXC S;  2QI2 A;  4M75 B;  2D0N A;  3FRN A;  3FC3 A;  4IUT A;  1XTD A;  3CCJ Q;  2F5T X;  4PJO D;  2BIV A;  1I1J A;  3J7A F;  3OYF A;  2F2X A;  3VKI A;  4PK4 A;  4LDY A;  3CC2 Q;  2M02 A;  3PVQ A;  2L89 A;  3OYK A;  3F70 A;  2DVJ A;  2V8I A;  5GAM d;  4F16 A;  1UGV A;  2RJD A;  4KUI A;  2X4W A;  3MEV A;  1T0J A;  4OB0 B;  3MO8 A;  2BE9 B;  5EG2 A;  4B9W A;  4EMH A;  4JRQ A;  2LQK A;  3ZBD A;  4Y92 A;  2LX9 A;  2RI2 A;  4KT0 E;  2FPE A;  5CR2 A;  1W6X A;  4MML A;  4J9I A;  4BI4 A;  2MOX A;  2OX7 A;  1SRL A;  5GMK l;  1X2Q A;  3OMG A;  3EH2 A;  1LCK A;  4JJN K;  1OV3 A;  1ZX6 A;  3H9N A;  1IRX A;  4C5I A;  1TUC A;  2F5K A;  2CP2 A;  2D8H A;  2K9G A;  2VB6 A;  3I5R A;  1WHG A;  2ABL A;  1OU8 A;  3JCM Q;  4E7K A;  4F7U F;  4M75 G;  2QQR A;  2C0I A;  1K9A A;  3ZFJ A;  1M90 R;  3PVL A;  3I55 T;  3H0F A;  3RUX A;  4HKE A;  1ZBX A;  4FW1 A;  5FRO A;  1FMV A;  2NWM A;  3VS1 A;  1GCQ C;  2K4Y A;  3G71 T;  3P8B B;  3G4S Q;  5GAN j;  3L2V A;  2CDT A;  1RI9 A;  4FT4 A;  1FMW A;  2DEQ A;  4F7U A;  2QA4 A;  2GTJ A;  4MMK A;  3WVE B;  4II1 A;  2FL7 A;  1N8R R;  2LDM A;  4J6X A;  1K73 C;  5CKD A;  1AOJ A;  2L5Q A;  2R58 A;  3CBO A;  5A0G A;  3L2U A;  3CCU A;  3CEY A;  2XU8 A;  3G7Z A;  3T9N A;  3KFV A;  3JV3 A;  4BDZ A;  4F7U B;  2P84 A;  4GLM A;  4C5H A;  1NG2 A;  4QQG A;  3OSS C;  3CCS Q;  1IGQ A;  2O88 A;  2CP5 A;  1IO6 A;  2FG0 A;  3C4S A;  4Z89 A;  1WYX A;  2X9H A;  2AKK A;  4PJJ A;  4GBQ A;  1PSF A;  5AT1 B;  5KYU B;  5FLX E;  1BU1 A;  3M4Y A;  2LNH B;  3CPW A;  2BUD A;  4M7A F;  3CCE Q;  1TUG B;  1GFD A;  2LCS A;  3EGD B;  2YT6 A;  1SHG A;  1K9M C;  2LT4 A;  3QZ9 B;  5FWB A;  2JTF A;  2LQ8 A;  2RJF A;  3RMQ A;  1SF9 A;  4DOW A;  1WJQ A;  2YRV A;  2L3P A;  3OYY A;  3D7S B;  4FSX A;  1KD1 U;  1VQM T;  2CKK A;  3SWN C;  5C6S A;  2DBM A;  1J3T A;  3GIB A;  1YIT Q;  4C8Q D;  2QAS A;  4M7A A;  1PKT A;  1M1K U;  2HKQ B;  2EJF A;  3OYL A;  2QEX Q;  4OB2 B;  3S3O A;  4CC7 A;  1D09 B;  4MZT A;  4M78 F;  3EFO A;  1YJW T;  3OS5 A;  4J9B A;  2DK3 A;  3JB9 G;  3GBQ A;  1AD5 A;  3JCM f;  4DQ2 A;  1VQN A;  4C92 D;  5CCA A;  1KC8 U;  2C0O A;  1GFC A;  4BUG A;  2C06 A;  2DKG A;  2E5K A;  5IXB A;  3RIR A;  3X24 B;  1ZQ1 A;  4LDU A;  2HD0 A;  1D0Z A;  2H8H A;  3M4G A;  1JJ2 A;  3G6E A;  4M78 A;  3OMC A;  1E6G A;  1QVF A;  4C0Z A;  1S72 Q;  4D8D A;  4OMO A;  1MV3 A;  3G6E Q;  1MGQ A;  2E4H A;  2LX7 A;  4ZNX A;  3LX7 A;  2JT4 A;  1WZO A;  3M54 A;  2HNI A;  2CZ6 B;  2A08 A;  1VQP A;  3M57 A;  5LJ3 e;  4A54 A;  1KQ2 A;  1H92 A;  3BY7 A;  3DB4 A;  3CCJ T;  1CKB A;  2JMC A;  3KXT A;  5GAO q;  1BI2 A;  4CRI A;  3VRZ A;  3CC7 A;  1CKA A;  2DBK A;  4HVW A;  5C0M A;  2FZK B;  4M7D E;  3CC2 T;  3C95 A;  4BY6 C;  1K76 A;  2DO3 A;  2FO0 A;  4XTY A;  2RB6 A;  3MJX A;  2X35 A;  2B86 A;  4LDW A;  3CXC P;  4O6J A;  3M0T A;  4CC4 B;  1YJ9 Q;  1EFN A;  1PD1 A;  3CBM A;  1V29 B;  3V8K A;  3H0H A;  4A53 A;  3BDL A;  3SWN B;  2LP5 A;  1RAG B;  1Q81 U;  2X4Y A;  3HL8 A;  2CP6 A;  2JS0 A;  4JRP A;  2VYT A;  1BIA A;  2VXF A;  7AT1 B;  1M3B A;  1TSF A;  2RPN A;  2XDB A;  3QBY A;  2RQT A;  5IAY A;  4XTX A;  2F2V A;  1Q7Y U;  1MV0 B;  4QW2 A;  1E6H A;  2RQR A;  2E65 A;  1E7O A;  2RA2 A;  4QQD A;  2FRW A;  4L59 A;  1U3O A;  1T0H A;  1OX9 A;  4M77 E;  3TCJ A;  2DRK A;  4LXC A;  2XKO C;  4KBM B;  1YI2 Q;  4JRI A;  4ZGD B;  2HQH A;  2IPO B;  2ED1 A;  4R55 A;  1I5O B;  5LJ5 g;  3OYM A;  5FRM A;  2RF0 A;  1VQL A;  1PCX A;  4DBR A;  1X27 A;  1U5S A;  2KT8 A;  3OB9 A;  1VQ8 A;  1VQL Q;  4ANJ A;  1X6G A;  1YHQ Q;  2DRM A;  4BE0 A;  2RQW A;  1VQ8 Q;  3INZ A;  2KK4 A;  5DY9 A;  1UGQ B;  3URG A;  4QVD A;  1R77 A;  4UC4 A;  1X01 A;  2DIQ A;  3VUZ A;  2DYI A;  3C0C A;  5CKB A;  3VS7 A;  5KH6 A;  4RKU E;  2RK2 A;  3FIF A;  3PTA A;  1G3S A;  1K1Z A;  1Y0M A;  3CCU T;  1VQ6 A;  1AZE A;  1K73 R;  3RR6 A;  2ROT A;  2QG9 B;  2VV5 A;  1IZ6 A;  4IIO A;  4VUB A;  1UB4 A;  3CCS T;  1HK9 A;  3A8L B;  3G1J A;  4RTW A;  2E10 A;  3JCM X;  2R5A A;  1Y57 A;  3CC4 A;  2BZ8 A;  1ZSZ C;  2YLB A;  1RAD B;  3MEA A;  1WHM A;  2MF2 A;  1SEM A;  1RAI B;  5IH2 A;  4QQ6 A;  2A7Y A;  3CME A;  2KYM A;  3CMA Q;  3LWI A;  2JNG A;  3GPL A;  4M7D C;  5AYF A;  2J7I A;  2P0Q A;  5D6Y A;  4OB3 B;  4NOY A;  2DIG A;  3I55 Q;  2OAW A;  1KHI A;  2L3S A;  4EMG A;  2RHY A;  1NLO C;  1TUD A;  3I5S A;  1K9M R;  2E70 A;  1Z9Z A;  2HAX A;  3CCV Q;  1YIT T;  1GCP A;  4OML A;  4HT9 A;  4NL2 A;  3G71 Q;  4RG8 A;  1LNX A;  1TU0 B;  1IHV A;  5A2Q E;  4JDS A;  2QEX T;  3X28 B;  2DET A;  4PFP A;  3L2Q A;  2HQX A;  4BE2 A;  1QKX A;  1AWW A;  2V26 A;  4M4Z A;  2K79 A;  3GNF B;  4OP0 A;  4KRT A;  2JZ2 A;  2PU9 B;  4LDV A;  1D1C A;  5J3B A;  1NYF A;  4LD9 K;  1D3B A;  1IRE B;  2F69 A;  4M77 C;  4BE1 A;  4HVV A;  2OAU A;  1B3Q A;  1QWE A;  3MEW A;  5I21 A;  1PG5 B;  1NBE B;  2YXY A;  5LJ5 d;  4F17 A;  2V1R A;  1VQN T;  1AEY A;  2DEU A;  3PIO A;  1KD1 C;  1ACM B;  1QWF A;  1I0C A;  2NUP A;  3JCM b;  4PJO C;  1JBM A;  2PVO B;  5GAM g;  4PJM A;  2M0O A;  1W2B A;  2JOY A;  1G83 A;  3IQL A;  1JO8 A;  4J9E A;  2PVD B;  2CUD A;  3G6E T;  1M1K C;  2KDS A;  1OUL A;  3CCM A;  1HSQ A;  4WF2 A;  3A1P A;  5LJ5 f;  5GJV B;  1N9S A;  4FW2 A;  2GQV A;  5LJ5 h;  1Y96 B;  1VQP T;  1VQM Q;  2BTT A;  1P92 A;  3CQT A;  3EHQ A;  1Y07 A;  1AZG B;  3SFM A;  2OJ2 A;  1QW1 A;  5A0D A;  2OTL A;  2K6D A;  2HKN A;  1ZSZ B;  3CCL A;  5GAO r;  8ATC B;  2ZZD A;  2ZPG B;  2XDD A;  5I11 A;  1KC8 C;  5DLO A;  2C0T A;  2FYK A;  4OGE A;  4KUL A;  2D9T A;  4M7D B;  1IXD A;  4M75 F;  1ABQ A;  4OMF B;  3V7S A;  1Q82 R;  2J6F A;  1YJ9 T;  1QLY A;  2DYB A;  2E3H A;  1MND A;  1K0S A;  2D1X A;  2EGA A;  2XHC A;  4ESR A;  4J8O A;  4RTT A;  3JCM P;  1HD3 A;  5L8R E;  5GMK h;  3UWN A;  1M2V B;  2RQV A;  4M75 A;  4MDW A;  5DM7 R;  2AHJ B;  2M0Y A;  4M7A E;  4MZP A;  3LW5 E;  3QII A;  3REA B;  1QCO A;  5ECA A;  2EYW A;  2VUB A;  4M77 D;  3CCR A;  3VYH B;  2VVK A;  3LGF A;  1JXO A;  3X25 B;  3RKY A;  4PJL A;  3M0R A;  1NJI U;  3UDC A;  2HSP A;  1G5V A;  2VKN A;  4C5E A;  2YDL A;  1V76 A;  3M0P A;  2AZV A;  4XTZ A;  1O9S A;  2ECZ A;  3RBB B;  2RHZ A;  1VQL T;  1LPL A;  4ME7 A;  4PNO A;  4BAC A;  4PJO B;  1AHJ B;  4E6R A;  1AWO A;  4C0D C;  1YHQ T;  1Q81 C;  5GAN 6;  4J83 A;  2ENM A;  4FU6 A;  1VQ8 T;  4JS5 A;  2DJZ A;  2HL3 A;  4M7D G;  1RAB B;  2EQU A;  1YIJ A;  4PFO A;  3JAM E;  2DL3 A;  2LTO A;  2D8J A;  3E19 A;  3M53 A;  1RL2 A;  3H0I A;  5GAO l;  3NFC A;  1Q7Y C;  5I2S A;  2OTJ A;  3JRZ A;  3OS1 A;  4AT1 B;  4LDX A;  2MI6 A;  3NTH A;  5LJ3 j;  1MNE A;  5GAN 2;  5J26 A;  3GOX A;  2EAY A;  1PC0 A;  3ZL7 C;  2YHT A;  2K7A A;  3UT1 A;  3REB B;  3TRE A;  2RHI A;  1MHN A;  1B7T A;  5CAI A;  4EIK A;  1VQ6 T;  1GL5 A;  1RUW A;  1NPR A;  1BI1 A;  4JPB W;  5GAM f;  2X51 A;  4PJN A;  1YWP A;  1UJ0 A;  4B6M A;  2JM9 A;  1K8A U;  5GAM h;  1AT1 B;  2JTE A;  4C8Q C;  3E9F A;  4CC2 A;  3CMA T;  3QYG B;  3JB9 F;  3WVD B;  2DZ9 A;  4M77 G;  3TVT A;  2DL7 A;  3M56 A;  3RKX A;  4OMQ A;  1M30 A;  1XQH A;  1PKS A;  2EW3 A;  1UG1 A;  4PJO G;  3PGG A;  4AFZ C;  1NZ9 A;  1SHF A;  3CCV T;  4P5N A;  3QWX X;  1JB0 E;  3L2W A;  1QP3 A;  4C92 C;  4KGX B;  2J6K A;  1NEG A;  2MCN A;  3UA7 A;  2OI3 A;  3TSZ A;  5KYN A;  2RNA A;  3DB3 A;  3THK A;  4ZGJ B;  1VQ5 A;  1I8F A;  2HMA A;  3M9Q A;  2QA4 Q;  1HXD A;  1TOV A;  1ZUY A;  3OSV A;  4NS5 A;  2YUP A;  3TQ7 P;  2QGF B;  1I07 A;  2WSC E;  4QKU A;  1K4U S;  2FEI A;  5KYU A;  3MP1 A;  1RAA B;  3DKM A;  4FL6 A;  3SEM A;  3CCU Q;  2FHD A;  4IUQ A;  2KSS A;  1YJN A;  3PIP A;  2RN8 A;  3EGD A;  2RI3 A;  3M55 A;  4FCY A;  2XIC A;  3HP9 A;  2GBQ A;  1UGR B;  2DD4 A;  3RKW A;  4N0A C;  2E6N A;  1KD1 R;  3KBG A;  2W10 A;  3CPF A;  1N8R U;  4DBQ A;  2M16 A;  3AT1 B;  5CVI A;  2JW4 A;  1M4Z A;  4J9C A;  3UF4 A;  2NLU A;  2QK0 A;  2P4R A;  5CKH A;  2BE7 D;  4MZM A;  2PUO B;  1OPL A;  2DTO A;  2M51 A;  3CBP A;  2LJ1 A;  5LJ5 e;  1OX8 A;  2DD5 A;  3QYH B;  2HL5 C;  4E7I A;  1MUZ A;  4PLI A;  4JJD A;  2QDY B;  2OTL T;  1BB9 A;  4N4H A;  1GCQ A;  3H41 A;  4C8Q B;  1Q86 U;  2CYZ B;  1Q95 G;  4LD6 A;  1U1T A;  2LVM A;  3NGP A;  1KC8 R;  1ZA2 B;  2Y4Y A;  1G2B A;  2EQI A;  2ZAE A;  1FXX A;  5L23 A;  1R8O B;  2KRO A;  1W1F A;  4ORZ A;  3V7C A;  3V8J A;  1JQQ A;  1QVG P;  2LMJ A;  4IKF A;  2DNU A;  3MET A;  3CCQ A;  4C92 B;  2EFI A;  1VQN Q;  1M3C A;  4X9D A;  4EDU A;  1WXT A;  3QHS A;  1GXI E;  4FYX B;  2O2O A;  5GAN 8;  1CSK A;  5GMK e;  4M7A D;  3A8O B;  2B8A A;  5FWC A;  2QQS A;  3ER0 A;  1KG1 A;  2DL8 A;  1RI0 A;  1AWX A;  2MYS A;  1F1B B;  1OQK A;  2V8K A;  4EMK C;  3VV0 A;  2VAS A;  1KIK A;  3EH1 A;  1PNJ A;  3O5Z A;  3QUI A;  1YP5 A;  5CQY A;  1VQO A;  3EFR A;  2HBW A;  1VQP Q;  4IUR A;  3FDR A;  2L8D A;  3BE3 A;  4PL6 A;  3JB9 H;  3HFO A;  2DPP B;  1NLP C;  2H3E B;  2EVR A;  4LNP A;  1VQ4 A;  4J9F A;  3SWN A;  3QSU A;  2QTV A;  4C8Q G;  3DLL A;  3OW2 P;  2W0Z A;  4RMO A;  3QJ6 A;  2KY9 A;  2CH4 W;  1VQ4 Q;  3CC7 Q;  2HQE A;  2AT1 B;  4M78 D;  1Q81 R;  2LCL A;  2BZY A;  2JVV A;  2FZC B;  2K5L A;  2KT1 A;  1ABO A;  3CD6 A;  5EC7 A;  1YIJ T;  2DL4 A;  3U23 A;  4O5V A;  2KXC A;  5CKE A;  1PWT A;  1WXB A;  3ULR B;  5CQX A;  3HKS A;  1PHT A;  3PNW C;  1Q7Y R;  2RD1 A;  3OYI A;  2QXF A;  3LH5 A;  3NTI A;  4C92 G;  1NJI C;  2LZ6 B;  4PKC C;  1NM7 A;  4ELY C;  1MMG A;  1WIE A;  2KI7 A;  4BD3 A;  1TTH B;  2D0Q B;  1SKU B;  4RUG A;  4A4E A;  2O31 A;  2KRS A;  2RI5 A;  4JLG A;  1UGP B;  3MPU B;  3OYC A;  2EYQ A;  8AT1 B;  3BDU A;  5GAM e;  2CGH A;  2DLP A;  1G3Y A;  1YBY A;  1UHF A;  3QJY A;  2K5F A;  1UUE A;  4AG2 C;  5GJW B;  1OYX A;  4XTV A;  3UPU A;  1WFW A;  3EG9 B;  2KEA A;  1PRM C;  1VYU A;  3SB2 A;  2SEM A;  2ZPI B;  2G3R A;  1WDX A;  1NEB A;  4X34 A;  1QQJ A;  1EIF A;  4EMK B;  1SPK A;  5GAN 4;  2R5M A;  2DXU A;  5HK3 A;  2QA4 T;  1KSW A;  1H3H A;  4JJC A;  2A0F B;  2DFU A;  5IXF A;  1VQ5 T;  3QZ5 B;  1K8A C;  2DF6 A;  2FB7 A;  4XU1 A;  4RCC A;  3JCM J;  2HCK A;  2KQW A;  1N5Z A;  2ZPB B;  5CK9 A;  2CT3 A;  2X4X A;  4IIM A;  3JB9 J;  4ZN1 A;  4XK8 E;  4DEY A;  3JCM V;  3LYI A;  1VQ6 Q;  4BY6 B;  2R57 A;  1YJN T;  4RCB A;  2LC4 A;  2E3I A;  2PVG B;  4OVA A;  2F2W A;  3TEE A;  1FMK A;  5KYY B;  2GTO A;  5I2M A;  1VIF A;  5KYW A;  3CC4 Q;  4HXJ A;  1NE8 A;  3CXC A;  5KE3 A;  2J05 A;  2E64 A;  1PM3 A;  3EGX B;  2KRN A;  4J6Y A;  1QP2 A;  2JMA A;  3CME Q;  4YTL A;  2X3W D;  1WGS A;  4C0F A;  1Y7X A;  1BI0 A;  1KQS P;  2ED0 A;  3GLX A;  5FU7 C;  2ZPF B;  1Y71 A;  4HCZ A;  2L3R A;  3OYN A;  2X4J A;  1KJW A;  2L2P A;  1GRI A;  3HRT A;  5KYW B;  2RO0 A;  4CI0 C;  4WTO B;  5GAN 5;  2EGC A;  3OBY A;  2Z0W A;  5HY6 A;  2GFU A;  1TXQ A;  3PMT A;  4OB1 B;  3OBW A;  2EQK A;  5KCH A;  1UJY A;  4RTY A;  4ZN3 A;  1M27 C;  4OF1 A;  1BIB A;  3PMI A;  4JZ3 A;  1SG5 A;  4K11 A;  2O4X B;  2YRD A;  4ATO A;  3LGL A;  3I56 A;  1N8R C;  4DOV A;  4HCK A;  4RTV A;  2EGE A;  2E6Z A;  4M7D F;  2H3J A;  1Y96 A;  2DXB A;  4LE9 A;  2QAZ A;  1WHL A;  4QVZ A;  1UDL A;  4F7U E;  4B9X A;  4HCC A;  1ZSZ A;  2GQI A;  5GAN g;  2QYZ A;  4F04 B;  5GAO n;  4A4G A;  1X75 C;  3NTK A;  1VQ7 A;  1Q86 C;  5D7U A;  2COY A;  1B34 B;  2QTX A;  2AKL A;  2XK0 A;  3P8H A;  3R6N A;  4M7D A;  2DER A;  3C94 A;  3CCM Q;  4OMN A;  2P0P A;  3ZEH A;  1VIE A;  2G6F X;  2ZPE B;  1HJD A;  5IT9 E;  3E1S A;  1VQO T;  1QVG S;  3RMS A;  4L5G A;  4D6W A;  2EYZ A;  3MP6 A;  2CSI A;  3VS6 A;  3WXM B;  3VS2 A;  2OTL Q;  1VQ4 T;  1ARK A;  3CC7 T;  3CCL Q;  2K3B A;  4M77 F;  1M2V A;  1VQK A;  5CKF A;  5KYX B;  4LUD A;  3HSB A;  2GFA A;  3HHT B;  3NPF A;  2XID A;  5FRN A;  2YRC A;  3JCM c;  2LQN A;  3OS2 A;  2K57 A;  3I9Q A;  2LJ0 A;  2JTM A;  3HRU A;  4PJO F;  2MPX C;  1YNZ A;  1I81 A;  4J9G A;  3OYE A;  5GAN 3;  1A0N B;  1JXM A;  5LJ5 j;  4M77 A;  1YJW A;  1W70 A;  1RLP C;  2IIM A;  1LVK A;  4V2S A;  1B07 A;  2DAQ A;  1FWZ A;  2EQJ A;  4LN2 A;  5LL6 S;  4A63 B;  3JB9 I;  2EWN A;  2KBT A;  3P8D A;  5LJ3 d;  1NJI R;  1ZSG A;  2A36 A;  4QT7 A;  4KGV B;  1AWJ A;  3VJP A;  4PJO A;  4OMM A;  2WAC A;  1BCM A;  3OW2 S;  1GBR A;  1UEC A;  1Q82 U;  2MWP A;  1JU5 C;  1ZUK A;  1R0B G;  2KYB A;  4M77 B;  1X6O A;  2RHU A;  4ELZ C;  3RER A;  1C6V X;  2XG8 D;  4RTX A;  3CCR Q;  4KH0 B;  2E1H A;  2J6O A;  1YCY A;  3MP8 A;  2M1H A;  4J7I A;  3OYJ A;  3M0U A;  2M9U A;  2DA9 A;  2DTI A;  2CZ1 B;  1M8V A;  3I35 A;  5D6X A;  4M75 D;  4FSS A;  3A8H B;  5J39 A;  3CCJ A;  2Y90 A;  1VQ9 A;  4M78 E;  4QVC A;  3NHN A; 
#chains in the Genus database with same CATH homology
 4XTX A;  2RM4 A;  5CKH A;  2XI9 A;  2P4T A;  2PUO B;  3R6O A;  4MZM A;  4QW2 A;  1Q7Y U;  2A3L A;  1SSF A;  2DTO A;  2IG0 A;  2XDP A;  3VYG A;  4JUV A;  3CCQ T;  3CC2 A;  4JS4 A;  3HPW A;  3FB9 A;  3BFM A;  3CBP A;  2E65 A;  4HA8 A;  2RA2 A;  2DD5 A;  3QYH B;  2BKD N;  4QQD A;  5GMK m;  3FJP A;  4BB7 A;  1OZ3 A;  5LJ5 e;  4BDY A;  4IUP A;  1M1F A;  2DTH A;  4L59 A;  2LT1 A;  5GAN d;  4E7I A;  3L2Z A;  3M5A A;  4PLI A;  4M77 E;  3TCJ A;  4M75 C;  4BI3 A;  2QDY B;  2CS7 A;  2XKO C;  4KBM B;  2OTL T;  1VUB A;  4JRI A;  4N4H A;  1U8R A;  4C0G A;  2RK1 A;  4X9C A;  2QQB A;  4C8Q B;  4ZGD B;  1Q86 U;  2CYZ B;  3N5B B;  2FVU A;  2KVQ G;  4R55 A;  5LJ5 g;  3OYM A;  4LD6 A;  5FRM A;  1U1T A;  2LVM A;  4J5Y A;  3JCM e;  2Y4Y A;  1VQL A;  4MDX A;  2EJG A;  4RG2 A;  1M5Q 1;  1N6A A;  2I2L A;  1OZ2 A;  2VGN A;  3OB9 A;  1S72 T;  1VQ8 A;  3X26 B;  1D3B B;  3QPH A;  2WSF E;  3JCM g;  5GAN f;  3CC4 T;  4BE0 A;  1FXX A;  1R8O B;  3QDR B;  1JRI A;  3V7C A;  3V8J A;  5A0L A;  3INZ A;  1O75 A;  2KK4 A;  5GAN h;  3JSC A;  4IKF A;  3MET A;  1VQM A;  2RJE A;  5DY9 A;  3CCQ A;  4C92 B;  1UGQ B;  2EFI A;  3LLR A;  3CME T;  3FEO A;  3OY9 A;  3URG A;  4QVD A;  4UC4 A;  3MHX A;  1H64 1;  4X9D A;  1X01 A;  4EDU A;  3QHS A;  2DIQ A;  1GXI E;  3BW1 A;  5GAN 8;  5GMK e;  3VUZ A;  4M7A D;  5DLQ E;  4EPC A;  2PQW A;  5CKB A;  3A8O B;  5KH6 A;  2B8A A;  4RKU E;  5M9O A;  1QVP A;  4R56 A;  2P0K A;  2RK2 A;  2QQS A;  3FIF A;  2CZ0 B;  3ER0 A;  1W2B S;  1OI1 A;  3CD6 T;  1KG1 A;  4C8Q E;  3PTA A;  2XD0 A;  1RI0 A;  5FU7 B;  1N9R A;  1G3S A;  2D6F A;  3RES A;  3CCU T;  2RHX A;  4N4G A;  2V8K A;  1KQS A;  4KUD K;  1VQ6 A;  4M7D D;  4EMK C;  3VV0 A;  2VV5 A;  2GCX A;  1IZ6 A;  4XU3 A;  2ZCF B;  1U1S A;  4VUB A;  1UB4 A;  3V8L A;  4HCB A;  3CCS T;  1HK9 A;  1WQ7 A;  3Q1J A;  3A8L B;  4XTU A;  2E10 A;  3GF5 A;  3JCM X;  2R5A A;  4FM4 B;  3QUI A;  4E7H A;  5CQY A;  1VQO A;  4J7F A;  2LCC A;  4J6W A;  3CC4 A;  3EFR A;  2IVW A;  5GAM j;  4IUR A;  3G4S A;  1XOV A;  1I5L A;  4M7A C;  2YLB A;  3FDR A;  2EJ9 A;  3MEA A;  4IUU A;  2MF2 A;  2L8D A;  4PL6 A;  3JB9 H;  4FT2 A;  4QQ6 A;  3HFO A;  2DPP B;  3OYG A;  1VQ4 A;  1M90 U;  1WQW A;  2A7Y A;  3SWN A;  4C92 E;  3CME A;  3QSU A;  3M59 A;  3LWI A;  2JNG A;  3GPL A;  4M7D C;  5AYF A;  4C8Q G;  3DLL A;  5HK0 A;  4C0D B;  4RMO A;  3QJ6 A;  2KY9 A;  4HT8 A;  2P0Q A;  1KQS S;  3I56 T;  2HQE A;  5D6Y A;  4M78 D;  4OB3 B;  2K5I A;  4C8Q F;  2LCL A;  4NOY A;  2JVV A;  2DIG A;  2QQA A;  2K5L A;  3O8V A;  3OS0 A;  3CD6 A;  1KHI A;  4EMG A;  2RHY A;  1YIJ T;  2E70 A;  1UGS B;  4O5V A;  3JB9 D;  2VC8 A;  5CKE A;  5LJ3 f;  2HAX A;  3TU4 K;  1YIT T;  1NPP A;  5CQX A;  2Y4X A;  3HKS A;  3VU3 C;  3PNW C;  3CCS A;  4HT9 A;  4NL2 A;  4RG8 A;  2RD1 A;  1LNX A;  5LJ3 h;  3OYI A;  2QXF A;  1YI2 T;  3SD4 A;  3NTI A;  2LNV A;  5GMK j;  5A2Q E;  4JDS A;  2KMT A;  3A5Z B;  4C92 G;  2QEX T;  2EKO A;  4XAX B;  1LJO A;  3FLG A;  4JLI A;  4A4K A;  2QI2 A;  3X28 B;  1BI3 A;  4C8Q A;  3OYH A;  3CXC S;  4M75 B;  1NJI C;  4M7D F;  4N4I A;  2RH2 A;  4ZTJ A;  4M78 C;  4PKC C;  3FRN A;  3L2Q A;  2HQX A;  4C92 F;  4ELY C;  3FC3 A;  4BE2 A;  4IUT A;  3CCM T;  1XTD A;  4BD3 A;  1VQ7 T;  2F5T X;  4PJO D;  3GNF B;  2BIV A;  4OP0 A;  2D0Q B;  3J7A F;  2JZ2 A;  3OYF A;  4A4E A;  2PU9 B;  3CCE A;  4LDV A;  3VKI A;  5J3B A;  4LD9 K;  4Z02 A;  4LDY A;  1D3B A;  2RI5 A;  1IRE B;  4JLG A;  2F69 A;  3OYA A;  1UGP B;  3L42 A;  3OYC A;  4M77 C;  4BE1 A;  2EYQ A;  2OAU A;  3BDU A;  5GAM e;  1G3W A;  2CGH A;  2L89 A;  2QQ9 A;  2DVE A;  3MEW A;  3OYK A;  1G3Y A;  3F70 A;  5I21 A;  2PUK B;  5LJ5 d;  1YBY A;  3CCL T;  1VQN T;  3QG1 A;  4C92 A;  2V8I A;  3QJY A;  3MCA B;  2K5F A;  5GAM d;  3PIO A;  1KD1 C;  1YIT A;  2RJD A;  4KUI A;  4JRK A;  2X4W A;  3MEV A;  4OB0 B;  3JCM b;  4PJO C;  3MO8 A;  1JBM A;  2PVO B;  5GAM g;  2DXC A;  1OYX A;  4XTV A;  3UPU A;  2M0O A;  1W2B A;  1VQK T;  2JOY A;  5EG2 A;  4C5G A;  2K3Y A;  4B9W A;  4EMH A;  3SB2 A;  3AHU A;  2QEX A;  4JRQ A;  2PVD B;  2LQK A;  3JCM d;  3ZBD A;  2HBP A;  2ZPI B;  2G3R A;  3G6E T;  4A4F A;  2KDS A;  1M1K C;  4X34 A;  2LX9 A;  2RI2 A;  4KT0 E;  3CCM A;  4WF2 A;  5CR2 A;  1G3T A;  4MML A;  4BI4 A;  5LJ5 f;  1EIF A;  1N9S A;  3OMG A;  4EMK B;  2DZC A;  5GMK l;  2MMP A;  5GAN 4;  2R5M A;  4JJN K;  2GQV A;  2DXU A;  5HK3 A;  5LJ5 h;  2QA4 T;  1Y96 B;  1VQP T;  2MWO A;  1P92 A;  1ZHI A;  1Y07 A;  3SFM A;  1KQ1 A;  3QZ5 B;  4C5I A;  1K8A C;  1VQ5 T;  1QW1 A;  2F5K A;  2FB7 A;  4A4H A;  3GP8 A;  5A0D A;  2OTL A;  1PSE A;  4XU1 A;  4RCC A;  4M7A B;  3JCM J;  5KCO A;  3CCL A;  5GAO r;  2KQW A;  4F7U G;  2ZZD A;  4ZTF A;  1TH7 A;  2ZPG B;  2XDD A;  1KC8 C;  2ZPB B;  3JCM Q;  3JCM h;  5CK9 A;  5DLO A;  4E7K A;  4F7U F;  4M75 G;  2QQR A;  4N0A A;  2FYK A;  2X4X A;  4OGE A;  3JB9 J;  4KUL A;  4ZN1 A;  2D9T A;  3ZFJ A;  5HKC A;  4XK8 E;  4M7D B;  3JCM V;  3LYI A;  3I55 T;  4M75 F;  1S72 A;  4NL3 A;  3RUX A;  4OMF B;  3OA6 A;  4BY6 B;  2R57 A;  4HKE A;  1ZBX A;  4RCB A;  2LC4 A;  3V7S A;  3C12 A;  3CCR T;  1YJN T;  3V7R A;  2PVG B;  4OVA A;  3S6W A;  3TEE A;  1YJ9 T;  2RJC A;  5FRO A;  5I2M A;  1VIF A;  2K4Y A;  3G71 T;  3P8B B;  5GAN j;  4E7L A;  3L2V A;  2XHC A;  4FT4 A;  4IUV A;  1NE8 A;  2DEQ A;  4F7U A;  4J8O A;  3CXC A;  2QA4 A;  3QO3 A;  3JCM P;  5KE3 A;  2E64 A;  4E7J A;  5L8R E;  5GMK h;  4J6Y A;  3UWN A;  1QP2 A;  5IN1 A;  4M75 A;  4MMK A;  3WVE B;  4FIB A;  4YTL A;  4MDW A;  1WGS A;  4II1 A;  4C0F A;  2FL7 A;  1Y7X A;  5DM7 R;  1BI0 A;  1VQ9 T;  2AHJ B;  2LDM A;  4J6X A;  3GLX A;  4M7A E;  4M78 B;  4MZP A;  5FU7 C;  2ZPF B;  1Y71 A;  4HCZ A;  5CKD A;  1K73 C;  3LW5 E;  2L5Q A;  2L3R A;  2R58 A;  3CBO A;  3ME9 A;  3QII A;  5A0G A;  3L2U A;  3CCU A;  3OYN A;  2X4J A;  3CEY A;  2XU8 A;  3G7Z A;  1FX7 A;  2JN0 A;  3T9N A;  3HRT A;  2OTJ T;  2EQM A;  2RO0 A;  2VUB A;  4CI0 C;  1Q82 C;  4M77 D;  2CZ7 B;  5GAN 5;  4BDZ A;  4F7U B;  1BKB A;  3S3M A;  4C5H A;  3OBY A;  5HY6 A;  2VGM A;  3VYH B;  3LGF A;  3CCR A;  2GFU A;  3X25 B;  4QQG A;  3RKY A;  3OSS C;  3PMT A;  1YJ9 A;  3H6Z A;  4OB1 B;  4DA4 A;  1NJI U;  3OBW A;  1WJS A;  4XTW A;  3UDC A;  2EQK A;  2ZGW A;  5KCH A;  3A8G B;  1G5V A;  4C5E A;  4ZN3 A;  5GMK i;  1I4K 1;  3C4S A;  5CO7 A;  4OF1 A;  3SDZ A;  3HFN A;  1BIB A;  3PMI A;  4XTZ A;  1PSF A;  1M1G A;  2O4X B;  3L2R A;  1O9S A;  4ATO A;  1VQL T;  2RHZ A;  4M7A G;  4ME7 A;  4PNO A;  2E5Q A;  5FU6 C;  1AHJ B;  3LGL A;  5FLX E;  4ZGE B;  4BAC A;  3M4Y A;  4C0D C;  1YHQ T;  1Q81 C;  3CPW A;  2BUD A;  3I56 A;  3S3N A;  1N8R C;  5GAN 6;  4J83 A;  4M7A F;  4Y28 E;  4FU6 A;  1VQ8 T;  4JS5 A;  3GNG A;  4DOV A;  2DJZ A;  4M7D G;  1K9M C;  2LT4 A;  2EQU A;  3QZ9 B;  1YIJ A;  2JTF A;  2E6Z A;  3OQ5 A;  3JAM E;  2LQ8 A;  2RJF A;  1XNI A;  2LTO A;  3PT9 A;  3RMQ A;  5GAN 7;  4DOW A;  4EMK A;  1WJQ A;  3E19 A;  2YRV A;  1RL2 A;  3M53 A;  3OYY A;  3NFC A;  4FSX A;  5GAN e;  2E12 A;  5GAO l;  2H3J A;  1Q7Y C;  1VQM T;  5I2S A;  1KD1 U;  2K3X A;  2YLC A;  4Y91 A;  1Y96 A;  2DXB A;  3JRZ A;  2OTJ A;  1WPY A;  2CKK A;  3SWN C;  5C6S A;  3J80 E;  3OS1 A;  1QVG A;  4QVZ A;  1YI2 A;  3LH0 A;  4LDX A;  4F7U E;  2MI6 A;  3NTH A;  4B9X A;  5LJ3 j;  3HRS A;  5GAN 2;  3LWH A;  4HCC A;  3GIB A;  4C8Q D;  4M7A A;  5J26 A;  3GOX A;  2EAY A;  2VXE A;  5GAN g;  1M1K U;  4M75 E;  2YHT A;  5GAO n;  3CPW S;  4A4G A;  3UT1 A;  2EJF A;  1X75 C;  3KUF A;  4L6V 5;  3OYL A;  3NTK A;  3KXT A;  1VQ7 A;  1Q86 C;  3TRE A;  2RHI A;  1B34 B;  1MHN A;  4OB2 B;  2QTX A;  2XK0 A;  3P8H A;  4Q5W A;  5CAI A;  1VQ6 T;  5D6W A;  3S3O A;  4M7D A;  1NPR A;  3C94 A;  1W4S A;  4MZT A;  4M78 G;  2P0P A;  1BI1 A;  3ZEH A;  1VIE A;  1YHQ A;  4PJO E;  2ZPE B;  5GAM f;  3EFS A;  4M78 F;  3M58 A;  5IT9 E;  1YJW T;  1K8A U;  3E1S A;  5GAM h;  3OS5 A;  3X20 B;  1VQO T;  1QVG S;  2DK3 A;  3JB9 G;  3RMS A;  4L5G A;  4D6W A;  4BI8 B;  3JCM f;  3G4S T;  4C8Q C;  4DQ2 A;  1VQN A;  3MP6 A;  3PFS A;  4C92 D;  3E9F A;  5CCA A;  1KC8 U;  3MEU A;  3QYG B;  3CMA T;  2LRQ A;  4PLL A;  3WXM B;  3JB9 F;  3WVD B;  2DZ9 A;  4BUG A;  4M77 G;  1WNL A;  3L1A A;  2C06 A;  2DXT A;  2DKG A;  1VQ4 T;  2JUF A;  3CC7 T;  3RIR A;  3M56 A;  1BYM A;  3RKX A;  3X24 B;  4M77 F;  1KHC A;  1VQK A;  5CKF A;  1ZQ1 A;  4LDU A;  3JCM W;  2HD0 A;  1XQH A;  3QXE B;  3M4G A;  3HSB A;  2GFA A;  3OYB A;  1LOJ A;  3HHT B;  1JJ2 A;  2XID A;  3G6E A;  1H3Z A;  5FRN A;  4M78 A;  3JCM c;  4PJO B;  3OS2 A;  3OMC A;  2K57 A;  4PJO G;  1QVF A;  4C0Z A;  4GLK A;  3OW2 A;  3PGG A;  4XQ3 A;  5KE2 A;  1NZ9 A;  2O01 E;  2JTM A;  3HRU A;  3CCV T;  5CIU A;  4P5N A;  4E47 A;  1JB0 E;  1MGQ A;  4PJO F;  3LX7 A;  3M54 A;  3L2W A;  1QP3 A;  4C92 C;  1I81 A;  2HNI A;  2K2V A;  2CZ6 B;  3OYE A;  5GAN 3;  1VQP A;  3M57 A;  5LJ5 j;  4M77 A;  5LJ3 e;  4A54 A;  1KQ2 A;  3DB3 A;  4ZGJ B;  1WJR A;  1YJW A;  1VQ5 A;  3BY7 A;  1I8F A;  3OYD A;  3M9Q A;  2GF7 A;  3DB4 A;  4GY5 A;  2MAM A;  4V2S A;  3CCJ T;  1HXD A;  3OSV A;  5GAO q;  2DAQ A;  4NS5 A;  1FWZ A;  1BI2 A;  2EQJ A;  5LL6 S;  4OGC A;  3JB9 I;  3CMA A;  2EWN A;  3P8D A;  3EAE A;  5LJ3 d;  3DLM A;  4CRI A;  1K73 U;  1JJ2 S;  2O4X A;  2WSC E;  3VJP A;  5LJ3 g;  3ASK A;  4XU0 A;  4PJO A;  1M90 C;  2WAC A;  3CC7 A;  3OW2 S;  1QVF S;  3VUB A;  3MP1 A;  3DKM A;  5C0M A;  3QKJ A;  3CCE T;  3I55 A;  1Q82 U;  3CC2 T;  4M7D E;  4FL6 A;  5FU6 B;  2FHD A;  1DJ7 B;  2MWP A;  2V8J A;  3C95 A;  4IUQ A;  2KSS A;  4BY6 C;  3PIP A;  1YJN A;  2DO3 A;  2RI3 A;  4XTY A;  2RB6 A;  3M55 A;  4M77 B;  1X6O A;  2RHU A;  4ELZ C;  3RER A;  2XIC A;  2XG8 D;  3H8Z A;  2X35 A;  5GAO p;  4LDW A;  3HP9 A;  3CCV A;  4TVR A;  2E41 A;  2E1H A;  4O6J A;  1YCY A;  3G71 A;  2KAF A;  3MP8 A;  2M1H A;  2EIF A;  4J7I A;  2WSE E;  3OYJ A;  1UGR B;  2M9U A;  3E9G A;  2DD4 A;  3CBM A;  1V29 B;  2DTI A;  3RKW A;  3V8K A;  3BDL A;  4A53 A;  1UEB A;  2CZ1 B;  4N0A C;  5GAO m;  2E6N A;  3SWN B;  3KBG A;  5D6X A;  1Q81 U;  1M8V A;  3CPF A;  2X4Y A;  3A8M B;  3HL8 A;  4M75 D;  1N8R U;  3A8H B;  5J39 A;  2ZPH B;  4JRP A;  2M16 A;  2VYT A;  1N27 A;  3CCJ A;  1BIA A;  1M9S A;  2VXF A;  5CVI A;  2Y90 A;  3J81 E;  1VQ9 A;  1K9M U;  1M4Z A;  2XDB A;  3QBY A;  1B34 A;  4XU2 A;  4M78 E;  2NLU A;  4QVC A;  5IAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...