4C0DC

Structure of the not module of the human ccr4-not complex (cnot1-cnot2-cnot3)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
142
structure length
142
Chain Sequence
b'LTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 27
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0dC00
5FU6B 5FU7C 5FU6C 5FU7B 4BY6B 4C0FA 4BY6C 4C0DB 4C0DC 4C0GA
chains in the Genus database with same CATH superfamily
1IGQA 3E9FA 1FXXA 2D8JA 1QVFS 1VQ8Q 2EKHA 1WHGA 1M1GA 3G71Q 3HFNA 3HHTB 3QWXX 1S72A 3M4YA 2DTIA 3PMTA 3PVLA 1TUGB 1TXQA 4PJOG 5GAN2 1IHWA 3OYAA 3L42A 4HXJA 5KE2A 2QK0A 5KYYB 2OTJA 2NUPA 4A4HA 3RERA 1TG0A 3QPHA 2F2XA 5GMKj 2C0OA 4M7DA 2RJCA 1Q81R 4KBMB 1VQKT 5FRMA 1KQSA 5GAMj 5GANe 2F69A 3OYLA 2J06A 3FB9A 3OYCA 4NS5A 3CMEQ 2L5QA 3C12A 2PNIA 4AG2C 2ZPGB 3G6ET 3QIIA 1UECA 2NUZA 3UA7A 3C95A 1KC8U 2CS7A 2EJFA 2PUKB 3M0RA 3HTRA 4AT1B 2A37A 2RD1A 4R0KA 4C8QD 1M4ZA 4J6XA 3CQTA 5A0LA 1X2QA 2L8DA 1Y71A 5LJ3d 1NLPC 3OYIA 2M51A 1N6AA 2HKQB 2MOXA 4DBRA 4RTTA 2HL3A 2DL7A 1KQ1A 2DK3A 2E3IA 1SF9A 2FO0A 1W1FA 5GAOn 2OTLQ 1B34A 2KYMA 3QZ5B 4C0DB 4AG1C 3O8VA 5GANj 3HRSA 4C5GA 1W4SA 2I0NA 1NYFA 3V8KA 4FCYA 2MK5A 5HY6A 4AMCA 4J9GA 1T0JA 1VQNT 4OMLA 1OI1A 3NPFA 5I22A 2BE9B 2QTXA 2CP3A 4KGZB 4M75A 4JRIA 1XJWB 3CCSA 3EGDB 3GIBA 4D8DA 2DRMA 2P84A 3JCMe 3CCEA 4C0DC 1ARKA 2JTEA 1X6BA 2EQUA 1LCKA 3G4SA 4X9CA 3TEEA 3QBYA 6AT1B 1UHCA 2HBWA 3NTKA 2SEMA 1K8AC 2QGFB 4M78F 4C8QF 3CCQA 1D1BA 1J3TA 4XAXB 4RKUE 3CC7A 5DLQE 2CT3A 2V8IA 2VC8A 1YP5A 3J7AF 1WXUA 3HRTA 4E2FB 3BE3A 4C8QB 1H8KA 1OX8A 2L2PA 2P0PA 3MEUA 2P0QA 2V1QA 3CBPA 3SWNA 1KD1U 3JB9I 1I8FA 3A5ZB 1K9MC 2LQ8A 3OYGA 4MMKA 1G83A 1KIKA 4DA4A 1QW1A 1YJWQ 2H8HA 2CP6A 2EJ9A 5GAN5 1W2BS 1WJRA 2DD5A 1I4K1 2EYWA 2MAMA 2NUTA 4DBFA 2A36A 1RAGB 1ZSZC 4M78C 4C8QC 4F7UB 2BKDN 4OP0A 3I55T 3OW2A 1V29B 4B6MA 2A0FB 4PJNA 4JDSA 1UJYA 2JTFA 1IZ6A 3QXEB 5IT9E 1TSFA 3UATA 2Y4YA 4M7AG 1QP2A 3H0HA 3DKMA 2YRCA 2PUOB 1I1JA 3VS2A 3QJ6A 3CMAQ 5LJ5f 3CCUQ 2ZZDA 1GCQC 2MWOA 4KUIA 4PJJA 3RESA 2KBTA 4FT2A 4QT7A 2JT4A 3SDZA 1GFDA 1N5ZA 1HD3A 4LUDA 4NL2A 2O4XB 4J9IA 1C0MA 1Y07A 5LJ5g 4XTXA 2NLUA 1M27C 2DJQA 2LT1A 2WACA 3M59A 1YCYA 2JVVA 2F1LA 3LH5A 1VQ6Q 3R6NA 3PIOA 3VRZA 3FC3A 4BY6C 1HYOA 1NEBA 4HCKA 2X4XA 2RN8A 5FROA 2DZ9A 2DIGA 4JS5A 3CXCP 1VQ8T 2K3YA 3S3OA 2DL5A 3MCAB 4J5YA 3G71T 3A8MB 3VRYA 1SSFA 3DLLA 1Q86C 3PTAA 2P4RA 2ATCB 5J3BA 3MEWA 1YITA 2EVRA 2ZPHB 4B9XA 2O01E 5DLOA 1JJ2A 3KFVA 4LD6A 2HL5C 1GBRA 2BE7D 2PTKA 1FMVA 4EMKC 2DD4A 3J81E 1VQPA 1VQLA 4AFQC 2KROA 2BTTA 5KYYA 2B86A 1QCNA 5HKCA 1ZQ1A 1KC8C 4RCBA 3QDFA 4OB0B 3PNWC 1TWBA 3A8LB 1YIJQ 2QDYB 2E5QA 3HL8A 3WVDB 3M0PA 2KRMA 2VASA 4CI0C 2LP5A 4HVWA 2DXUA 2ENMA 4A54A 3LYIA 1OX9A 2V8JA 3CXCS 2CP0A 3CCLA 4A63B 1OOTA 4OMQA 1WDXA 4HA8A 1AOJA 1D0XA 3SB2A 2D6FA 4C92D 2EW3A 2KQWA 5KYUB 2B8AA 1UGRB 4JRKA 4F7UG 4MZTA 1Q95G 1Q7YR 5FU6C 1I0CA 1I5OB 5DY9A 2FRWA 2KT8A 5GAMf 4IUPA 1T3SA 1ZX6A 2ZAEA 3JV3A 4J7IA 2OTLT 1TH7A 2MMPA 3VUZA 3OS2A 4KUDK 3JB9D 4HCCA 1VYTA 1UEBA 5KYXB 2JNGA 5GAMg 4M7DE 2GCXA 1VQ9Q 2HKNA 2K2VA 3KBGA 2KSSA 3TVTA 5CK9A 4QW2A 2DAQA 5GANh 2XD0A 2HDAA 4C5HA 2COZA 2GQIA 3CBMA 3VS3A 1BCOA 3CD6Q 3V8LA 3EGDA 2O9VA 2JMAA 3OYEA 2M02A 1VQKQ 1KD1C 2HNIA 4C92F 1UE9A 2CUDA 2O2OA 4PKCC 4A53A 2JM8A 2GQVA 5GANf 2XKOC 4XQ3A 3I56A 3V8JA 3PFSA 1MMNA 3GOXA 3G6EQ 3BY7A 2DIQA 1VIEA 1WGSA 2E12A 3RKWA 3GF5A 1FX7A 2J6OA 3MHXA 4HKEA 4GBQA 2SRCA 3JCMJ 4C92B 1YHQA 1RLQC 4BI3A 3META 1G3TA 2PVOB 2X3XD 4KGVB 3JB9F 3U23A 1ZSZA 4M78A 4C8QA 2DYBA 3OA6A 1YJWT 1M1KU 4RCCA 3UWNA 4JJBA 4FW2A 1EFNA 4D8KA 4EIKA 1KK7A 5LL6S 4FYYB 4A4GA 5FWCA 2F2WA 4M75E 1PSFA 2EQMA 4J83A 4JJCA 4UC4A 3L2WA 2E6ZA 4C92C 1D0ZA 2E65A 5LJ3g 2AT1B 1QVGA 1VIFA 2C06A 2DJZA 4RTVA 4MZMA 2F2VA 3UPUA 1ZA1B 4K11A 1IGUA 3RMQA 4F17A 5GAN4 3CMAT 2OI3A 4JPBW 5LJ5d 1ABQA 3CCUT 4BI4A 2XIDA 1QKXA 4BB7A 4OB2B 3M5AA 1TU0B 4JZ3A 4ZGDB 4XU0A 1UJ0A 3JCMf 1YI2A 2Y90A 1Y96B 4JRQA 1D3BA 4N4HA 2X4YA 2E64A 1MV0B 2RHXA 1VQ6T 4OMNA 5D6XA 2XICA 2E4HA 4C0GA 3REAB 3JCMX 1AVZC 5IHKA 3URGA 1UB4A 2E10A 2K2MA 1NZ9A 4PJOC 1R0BG 2NWMA 3TSZA 2EYXA 2GF7A 2EKOA 1UUEA 2QEXA 1G8XA 1BCMA 4QQDA 4Z02A 1X01A 2GTJA 5CKFA 2DXCA 2LJ3A 2D1XA 1JXOA 4OVAA 2YLCA 4KT0E 4EMKA 2QQSA 3H8ZA 3IQLA 3OS5A 4ZN3A 1PG5B 3DLMA 1M30A 3QWYA 1OU9A 3RMSA 2RI5A 1SRLA 4ZTJA 3CCJA 3CCMT 5CKBA 4J9DA 4O6JA 2OAWA 3P8DA 3OMGA 3OSVA 2LVMA 3JCMW 1VOMA 4FT4A 2K4YA 5KYWA 4HT8A 3OYHA 1JBMA 1QKWA 3T9NA 1YIJT 2DO3A 3SD4A 3OBWA 4C92G 2YUQA 1G5VA 4M7AD 1M3BA 4GY5A 1N27A 1C6VX 3BDLA 2MPXC 1AD5A 1VQ4Q 3EFOB 2YUNA 1YJNA 2ZPIB 1QVGS 1ZUKA 2DFUA 1BI2A 2KMTA 1LNXA 1BBZA 1BIAA 2DEUA 4RTYA 1M2VB 2QTVA 4Y92A 3JB9G 3GPLA 2Z0WA 1AWWA 4ZN1A 1OULA 1WFWA 5GAMd 2V8KA 3CCQQ 1Q81U 2CZ7B 1UG1A 4E7HA 3CC4A 1Y7XA 3E9GA 3EH1A 1KHIA 4RG8A 2CH4A 3RBBB 5GAN7 1VQ9T 2E41A 4ATOA 5I21A 3L1AA 4C0ZA 1M90C 2YXYA 4LE9A 1YJ9A 1WYXA 1YWPA 1XQHA 1H641 1K73R 4M7AF 3CD6T 1VQOQ 3VS0A 4JZ4A 3Q1JA 4J9FA 1PNJA 1VQ7T 2RA2A 2XDDA 3L2VA 1QWEA 1W2BA 3CBOA 5GAN6 3I9QA 4DBQA 3NFCA 1SPKA 4J9BA 2EYYA 4XU2A 4HCBA 3EG0A 4M7AB 3M0QA 1G3YA 3CEYA 4ELYC 1VQMA 1VQ5Q 3BDUA 4O5VA 1RAAB 3CCRQ 3M57A 2LX7A 1MHNA 2A28A 2IG0A 1OU8A 4F16A 3NHNA 3RKXA 2VV5A 2L89A 2YUOA 2YUPA 4C92A 1CKBA 1IREB 3F70A 3JB9J 2DLPA 4X9DA 4M7AC 1ZSGA 3EFSA 2K5FA 3EG1A 4LD9K 4TVRA 5GMKi 1WZOA 2CP7A 2JOYA 2DVEA 3KXTA 3QUIA 2EPDA 3CCVA 1N8RR 2LCCA 2C0TA 3X24B 3JCMb 4WF2A 1Q86R 3VS6A 5CKDA 4KH0B 2E1HA 3WVEB 1M3AA 4IURA 1QQJA 5CKHA 1RUWA 3MEAA 2VXFA 3PT9A 5M9OA 2GGRA 2EYQA 4XTVA 3D7SB 2QXFA 2COYA 2CH4W 1RL2A 9ATCB 1WIEA 3EGXA 4J7FA 3BW1A 2DRKA 3PIPA 3LLRA 4OMFB 3JCMd 3FRNA 1KQSP 2IPOB 3HRUA 2LJ0A 4PJOA 1Y0MA 4YTLA 3QKJA 3M55A 2OTJT 5D6YA 2DE0X 2ABLA 1VQPQ 3H0IA 1Q82R 1I81A 2MF2A 4M78E 4C8QE 4PJMA 1M8MA 3EG9A 2EYZA 1G2BA 2RJEA 4AFSC 1NJIC 3LWHA 1W70A 2P4TA 2YRDA 1I07A 4F7UF 5I11A 2ED0A 2DM1A 1M3CA 1BI0A 1GBQA 3G71A 2YDLA 1U5SA 1VA7A 1JRIA 3H0FA 2EWNA 2CKKA 1QWFA 3CCLQ 2F5TX 1YNZA 2E3HA 4ELZC 1UHFA 2BUDA 1BKBA 2LCLA 4JS4A 4MZPA 5GAOq 3CXCA 2GTOA 5IHIA 2M9UA 3VYHB 2W0ZA 2X3WD 1YCSB 3VUBA 3OYMA 4RTWA 1V76A 4AFZC 1MNEA 3CC2Q 2P0KA 3QHSA 1IB8A 4CC2A 1TOVA 2FL7A 3CMEA 1K9AA 1PKSA 4DBHA 1F1BB 1OZ2A 2X35A 1VQ4T 4LDWA 3OYKA 1Q81C 5KE3A 2WSEE 1I5LA 2J05A 4BDZA 1WPYA 3LW5E 3EHQA 3RKYA 4OB1B 5HCKA 2XMFA 1JO8A 2FVUA 2CUBA 2RJFA 2VWFA 3CCET 1EX4A 2VKNA 3V7CA 1C1AA 3M56A 2KAFA 4X1VA 4NL3A 3OYJA 2QASA 3CCQT 2RHYA 3CC7T 3C4SA 4RMOA 2OTLA 4QKUA 2DZCA 4PLIA 1RI0A 2MWPA 1M1FA 3S6WA 4BE2A 2LT4A 1RAHB 2KXCA 5IHNA 3OW2P 2KY9A 3BFMA 1RACB 1BU1A 2CSIA 3LGLA 3V7SA 3A8HB 5C6SA 3THKA 3CCMQ 1VQOT 4Z88A 3H6ZA 3V7RA 2XI9A 4JLGA 2EJGA 1Q7YU 2R5MA 1G3SA 1GCPA 4LDUA 4HVUA 2XU8A 2QQRA 3I5RA 2E6NA 4HT9A 1N9RA 5CO7A 2DL8A 4M7DD 1LJOA 1QP3A 5CAIA 5CVIA 2JJ9A 2ZPEB 1OZ3A 5KYNA 1VQ5T 2K3XA 1AWOA 3CCRT 3RDVA 4M7AA 5CKEA 1JEGA 3E1SA 2KRNA 2KR3A 4QQGA 2O9SA 1TUCA 1UDLA 1JU5C 1S1NA 2VB6A 3MKDA 1KHCA 2EQIA 2V1RA 1SHGA 2V26A 1IO6A 4RTUA 1YJWA 1UGPB 3LX7A 3CPWP 2FPEA 3X25B 3JAME 2QA4A 2W10A 5IXBA 4R56A 1D0YA 2L3QA 1K76A 1JJ2P 3TREA 1UGQB 2ESWA 2KNBB 4OF1A 3J80E 1PKTA 1SEMA 1B3QA 2E5KA 2FRYA 4RTXA 1R0CB 4NOYA 2M1HA 2HQEA 3H41A 1SSHA 4ORZA 3OS0A 2LCSA 5GJVB 1VYVA 1WHJA 3CMAA 1YITT 1H3ZA 3M58A 2XK0A 1X43A 3OS1A 2WSFE 1UGSB 1KFZA 2AKLA 2CGHA 3A8OB 4M75D 3SHWA 1VQ7Q 2JTMA 1ZBJA 3CCJQ 2KK4A 1VQPT 1VQLT 1B7TA 2HAXA 1N9SA 1PC0A 4M7DB 3MP1A 4C92E 1E6GA 2OJ2A 3I5SA 4HVVA 4LDYA 1VQ6A 3GNGA 3GLXA 2DL3A 3QZ9B 1WHKA 2MIOA 1O9SA 3CPWS 3OYFA 2ZPFB 2DXTA 3ME9A 4E7JA 4IKFA 4J9EA 2CREA 1GFCA 5GANg 2LC4A 1NM7A 2QQ9A 4ZGEB 2RNAA 2DKGA 3M0TA 1WJSA 4LXCA 2JMCA 1LOJA 2L3RA 5LJ3h 4RUGA 3CCLT 1AZEA 2DPPB 3VJPA 1ZUYA 1YFNA 3JRZA 1YJNQ 1JB0E 2DEQA 2I2LA 4JJNK 3QYHB 2QI2A 4F04B 2PVDB 5GAOp 2LDMA 3EFRA 1GCQA 4F7UA 2JXBA 4M77D 3LH0A 1WHHA 4OMPA 3ZEHA 4PJOE 4C5EA 4EMGA 1B34B 3N5BB 5ECAA 3CC2T 2LNHB 2FG0A 4J6YA 2RQWA 2KYBA 1T0HA 1WA7A 1IRXA 3QO3A 1CSKA 2DF6A 1TS9A 1S72Q 2RK2A 2DILA 2ROLA 1YIJA 4EPCA 4LNPA 2DVJA 2IVWA 4BD3A 3VYGA 4M75B 5KCOA 1YJ9Q 2AIRB 4FSXA 3OYYA 2HMAA 2QG9B 2OTJQ 2LZ6B 2HZYA 2D0QB 5LJ5e 4IIOA 3PE0A 2QGGA 2K6DA 1Y57A 2YSQA 5D6WA 5GMKm 2O4XA 1K1ZA 2KE9A 4CC4B 2RM4A 2D8HA 4L6V5 5AT1B 1AHJB 3JCMg 3PVQA 2KRSA 2GNCA 4BE0A 2FYKA 2DTOA 3UF4A 2HQXA 2DA9A 1PM3A 2EGEA 4PLLA 3FLGA 4JUVA 4C5IA 3I56T 1Z9QA 2DTHA 3NTHA 4FIBA 4QVDA 4M77F 5IAYA 2MCNA 8AT1B 2ROTA 4RG2A 1Q7YC 2RHZA 3SWNB 2DL4A 4XTWA 1YHQT 1TTHB 1VQ9A 4V2SA 5GAOm 2M16A 4KRTA 4CRIA 4FW1A 2HD0A 1XOVA 5I2SA 4M77B 2NUTB 2JM9A 2O88A 4AFUC 4M7DG 4D6WA 3LGFA 1U3OA 2A08A 1QVFP 4J9CA 3SWNC 1FMKA 1OPLA 2PZ1A 1WHMA 1VQKA 1RAIB 3G1JA 2YRVA 1K9MU 2YT6A 1WQ7A 4M77C 3G6EA 2EQJA 3DB4A 3X20B 1K8AR 2YLBA 5CQXA 3CCSQ 4N4GA 2L3SA 1K0XA 1ZLMA 3TU4K 1WXBA 1HXDA 3CCEQ 3G4SQ 4E7KA 2C0IA 1RAFB 1K73U 1UGVA 4PFZA 3VV0A 4J9HA 4Z89A 1NJIR 2JS2A 5KYUA 1NPRA 2PQWA 5KCHA 2EAYA 2EGCA 2Y4XA 3VKIA 4DOWA 3CC7Q 2BIVA 1K9MR 3EHRA 2K5LA 3OYBA 1IHVA 4B9WA 4DEYA 4OMOA 1AWXA 3UDCA 3OYDA 1MMDA 4L5GA 5KYXA 1VQNA 4R55A 4M75G 1A0NB 1KQ2A 1MNDA 1UFFA 3MP6A 3DB3A 1BYMA 2K57A 1GXIE 3EG3A 1R77A 2GFAA 3MJXA 4M7AE 4FYVB 4XU1A 2EBPA 4IUTA 5IN1A 1CKAA 2J7IA 1EIFA 4Y91A 2FZKB 5C0MA 1W6XA 3CCJT 1U1SA 1M2OA 4E7ZA 2HSEB 1LVKA 1XNIA 5GANd 1N8RU 4LDXA 1M1KC 3GNFB 4XTUA 1Q86U 1TUDA 2R5AA 1X75C 4GLMA 1B07A 4F14A 1U8RA 1MUZA 4MDXA 4MMLA 2VGMA 4DOVA 1H92A 2EIFA 3FDRA 4P5NA 4JRPA 1BI3A 2X4JA 2LJ1A 2PVGB 5FLXE 2HBPA 1RAEB 4ESRA 1BB9A 4A4KA 2A3LA 1RI9A 2K9GA 3QG1A 3A8GB 3CPFA 4WTOB 1YJNT 3MP8A 4M77G 1SHFA 1UTIA 4ZTFA 1NG2A 4ANJA 4M78D 4BUGA 3L2ZA 2ZCFB 4Y28E 3VS1A 4BDYA 1D1AA 2ECZA 1M8VA 3VS4A 1JXMA 2COWA 5LJ3e 3I55A 1Q82U 2X9HA 3S3MA 3ZFJA 1YWOA 3CC4T 2AKKA 1FMWA 4XU3A 3HFOA 2XDPA 2RI2A 2VYTA 1S72T 8ATCB 2D9TA 1YITQ 2X51A 3MPUB 1MMGA 3HKSA 2EFIA 1KC8R 1YJ9T 1W2BP 4J8OA 2DXBA 2G6FX 1D09B 1V1CA 4EDUA 1MV3A 1VQ4A 2DYIA 2L0AA 5L8RE 3ER0A 3OMCA 4FSSA 1Y96A 1VQLQ 1WQWA 5GAN3 1OYXA 3JSCA 2L3PA 1SRMA 3P8HA 1PD1A 3TSWA 2BZXA 4BE1A 2MYSA 2R58A 2FEIA 1KJWA 1X6GA 2QQAA 4IUUA 5LJ3j 1PSEA 4IUVA 7AT1B 3P8BB 5L23A 5EG2A 5J26A 3RR6A 1VQ8A 3AHUA 4II1A 2JUFA 3EG2A 2QQBA 1VQMT 2LRQA 4F7UE 2X4WA 1PWTA 1JQQA 2DMOA 2GBQA 1ZSZB 4M78B 5GMKl 2ZPBB 2DERA 2RF0A 4WCIA 2H3EB 1Z9ZA 5A0DA 2J6KA 1VQOA 1KQSS 3CCVT 2QA4Q 4M77A 4PK4A 4OMMA 1WLPB 3S3NA 2F5KA 1R8OB 5LJ5h 5IH2A 2KI7A 2RB6A 1K73C 1SG5A 2AHJB 5CCAA 1SKUB 1ABOA 2K5IA 4FU6A 5GAOl 1VQ5A 1ZUUA 3CCST 2FPFA 3OYNA 2QYZA 1KD1R 3GBQA 3CCRA 1M9SA 1T3LA 2D0NA 3EFOA 4BY6B 3LWIA 3G4ST 1D3BB 5EC7A 5FWBA 1KSWA 2LQNA 2FZCB 1RLPC 1M2VA 4QQ6A 5A0GA 3HSBA 1U06A 4XTZA 3I56Q 2LQWA 4A4FA 4FM4B 1RABB 3I35A 2RQVA 2RJDA 2LTOA 3ZBDA 3ASKA 1AZGB 3QYGB 1PD0A 2KDSA 2LQKA 1QCFA 2J6FA 3L2RA 5CQYA 1QCOA 1WJQA 1YHQQ 4EMKB 3M54A 1N8RC 3CPWA 3OQ5A 3SFMA 2VGNA 4A4EA 2OX7A 1WX6A 5J39A 1AEYA 2LMJA 2KEAA 4XK8E 5FRNA 3HP9A 1PRLC 2QDLA 1GRIA 4ME7A 5HK3A 3OSSC 2CP5A 3JCMQ 5A2QE 2DBKA 3TQ7P 2R57A 2ED1A 1U1TA 3EH2A 4L59A 2FHDA 1O75A 3ZL7C 1PRMC 5GJWB 2CZ0B 1HJDA 5KYWB 1NE8A 5D7UA 4KGXB 2YHTA 2RHUA 2KVQG 2FB7A 2DNUA 1FWZA 5IXFA 1WXTA 3CMET 4LN2A 1WHLA 5GMKh 2DETA 1Q82C 3QSUA 4FYXB 1PCXA 4M78G 4C8QG 2CT4A 3INZA 1ACMB 5FU6B 1YI2Q 1MMAA 5GAMh 2AZSA 2RQTA 3C94A 2FPDA 3O5ZA 2RO0A 3C0CA 2E70A 3OW2S 4KULA 1WNLA 2OAUA 2FZGB 2RMOA 2MI6A 1HK9A 2LX9A 1YBYA 2HCKA 2WSCE 2XDBA 2RPNA 2QEXQ 2JW4A 2PU9B 1M5Q1 5FU7B 3CC2A 4RTZA 4M7DF 3RIRA 3UA6A 4DQ2A 4Z8AA 4E7IA 4N0AC 4FYWB 4GLKA 3CCUA 4LUEA 3FJ5A 3WXMB 4M4ZA 4E7LA 4HCZA 4PFPA 4PL6A 2RQUA 2NUPB 3QDRB 4JLIA 4N4IA 1EZZB 2K79A 1LPLA 4Q5WA 5GAOr 5FU7C 4E47A 3VS7A 4PFOA 2KXDA 4E6RA 4PJOD 1X6OA 3NGPA 3EGUA 2KT1A 1BIBA 3M0SA 3SEMA 2BZYA 1M90U 4IUQA 3OBYA 1QMCA 2DBMA 1WI7A 3JCMc 2XG8D 2EGAA 3H9NA 1JJ2S 1K0SA 4PJLA 1OQKA 4M7DC 1D1CA 4XTYA 2CSQA 2GFUA 2YWWA 1VUBA 2AK5A 4LDVA 2AZVA 2JN0A 3GP8A 4OB3B 1GL5A 1AT1B 3G7ZA 1QLYA 3FEOA 2IIMA 1OEBA 1XTDA 3CCMA 2RH2A 1NPPA 5LJ3f 2K7AA 4M75F 2QA4T 3PGGA 1M90R 4J6WA 3X28B 1YN8A 3CC4Q 2M0YA 3UT1A 4ZNXA 1H3HA 3M9QA 1X27A 4PJOF 2KGTA 2LNVA 3JCMh 5I2MA 1E6HA 4PNOA 1NLOC 3NMZC 2HQHA 4JJDA 2VUBA 4DEXA 3M0UA 3ULRB 1VQNQ 2EQKA 5CIUA 3X26B 3EGXB 3REBB 3OB9A 1E7OA 3MO8A 4CC3A 1G3WA 4C0FA 1OV3A 2ZGWA 1QVPA 1QVFA 4EMHA 2XHCA 1M1KR 5GAN8 4PJOB 1BK2A 3QJYA 3RUXA 3MEVA 4QVCA 4OGCA 4X34A 2CZ1B 4M75C 2RK1A 3EG9B 3KUFA 1KG1A 3M53A 1ZA2B 1VQMQ 3FJPA 1NEGA 5FW9A 3VU3C 4CC7A 3FIFA 3L2UA 3JCMP 2K3BA 4M77E 3JCMV 1IXDA 1MGQA 1K8AU 3OY9A 1QVGP 4KH1B 1P92A 2HSPA 5LJ5j 3L2QA 2G3RA 3NTIA 3VS5A 2JZ2A 1DJ7B 4IIMA 3CD6A 1FYNA 5CR2A 3EAEA 4MDWA 3CCVQ 1AWJA 3TCJA 3PMIA 1NJIU 3M4GA 2CP2A 1VQ7A 1NYGA 1RADB 4E7SA 2HEQA 3I55Q 4FL6A 5DM7R 2M0OA 4VUBA 3RNJA 3A1PA 2RI3A 3AT1B 5AYFA 1X2KA 1OPKA 1BI1A 2NYSA 2QAZA 2DX1A 4BI8B 2VVKA 2H3JA 1VYUA 2RQRA 2JS0A 1X69A 2BZ8A 2CDTA 2VXEA 1YI2T 3A98A 4BACA 1NBEB 3JB9H 2CZ6B 1ZBXA 4OGEA 4QVZA 5HK0A 2CYZB 3E2UA 1ZHIA 2O31A 1HSQA 2A7YA 2RHIA 5GMKe 3E19A 4ZGJB 3R6OA 1K4US 4N0AA 5GAMe 3HPWA 5KH6A 2QEXT 1PHTA
chains in the Genus database with same CATH topology
5J26A 3E9FA 4MZMA 1FXXA 1VQ8A 1QVFS 3AHUA 1LJOA 3UPUA 4M7DD 1QP3A 5CAIA 4II1A 1M1GA 5CVIA 2ZPEB 1OZ3A 2JUFA 1VQ5T 2QQBA 1VQMT 2K3XA 2LRQA 3CCRT 3HFNA 4F7UE 4M7AA 2X4WA 3HHTB 5CKEA 3E1SA 3RMQA 5GAN4 3CMAT 1S72A 5LJ5d 3M4YA 4QQGA 3CCUT 2DTIA 4BI4A 2XIDA 3PMTA 4BB7A 4M78B 4OB2B 3M5AA 5GMKl 2ZPBB 4ZGDB 4PJOG 4XU0A 1KHCA 2XD0A 5GAN2 5CO7A 3L42A 3JCMf 2Y90A 3OYAA 5KE2A 1YI2A 1Y96B 4JRQA 1D3BA 2OTJA 1YJWA 1UGPB 3LX7A 4N4HA 4A4HA 2X4YA 2E64A 3RERA 5A0DA 3X25B 3QPHA 2RHXA 3JAME 1VQOA 1KQSS 5D6XA 2QA4A 2XICA 1VQ6T 4C0GA 3CCVT 5GMKj 3JCMX 4M77A 4M7DA 4R56A 3URGA 2RJCA 1UB4A 3S3NA 2E10A 2F5KA 1R8OB 1NZ9A 5LJ5h 4PJOC 3TREA 4KBMB 1VQKT 5FRMA 1KQSA 1UGQB 5GAMj 4OF1A 5GANe 2F69A 3J80E 3OYLA 2GF7A 2EKOA 2RB6A 3FB9A 3OYCA 2QEXA 4NS5A 1K73C 2AHJB 2L5QA 5CCAA 3C12A 4QQDA 4Z02A 1X01A 5CKFA 2K5IA 2DXCA 4NOYA 2ZPGB 3G6ET 2M1HA 2HQEA 4FU6A 4OVAA 2YLCA 5GAOl 1VQ5A 4C0ZA 3QIIA 4KT0E 4EMKA 3CCST 3OYNA 3CCRA 2QQSA 3H8ZA 3OS0A 3C95A 3CMAA 1KC8U 2CS7A 2EJFA 1YITT 1M9SA 1H3ZA 2PUKB 3M58A 3OS5A 4BY6B 4ZN3A 2XK0A 3OS1A 3DLMA 2RD1A 2WSFE 3LWIA 4C8QD 3G4ST 1UGSB 3RMSA 1M4ZA 4J6XA 1D3BB 2CGHA 3A8OB 5A0LA 2RI5A 4M75D 4ZTJA 2L8DA 3CCJA 1Y71A 2JTMA 5LJ3d 2KK4A 3OYIA 3CCMT 5CKBA 1N6AA 1VQPT 1VQLT 2HAXA 1N9SA 4O6JA 4M7DB 3MP1A 4QQ6A 3CPWS 3P8DA 4C92E 5A0GA 3OMGA 4XTZA 1VQ6A 3HSBA 3OSVA 4LDYA 2LVMA 3JCMW 1KQ1A 3GNGA 3GLXA 4FT4A 2K4YA 2DK3A 4A4FA 3QZ9B 4FM4B 5GAOn 2RJDA 1B34A 2LTOA 3ZBDA 1O9SA 3ASKA 3QZ5B 1JBMA 4C0DB 3QYGB 2ZPFB 2DXTA 3O8VA 3ME9A 3T9NA 3HRSA 2KDSA 3OYFA 4E7JA 2LQKA 2DO3A 3SD4A 4C5GA 1W4SA 5GANg 3L2RA 5CQYA 3V8KA 2LC4A 2QQ9A 4ZGEB 1WJQA 3OBWA 4C92G 5HY6A 4EMKB 3M54A 2DKGA 1N8RC 1VQNT 1G5VA 1WJSA 4M7AD 1OI1A 3CPWA 3OQ5A 4GY5A 1N27A 3SFMA 2VGNA 3BDLA 1LOJA 2L3RA 2QTXA 5LJ3h 4A4EA 4M75A 4JRIA 3CCSA 3CCLT 5J39A 2DPPB 1YJNA 3VJPA 3GIBA 3JRZA 2ZPIB 1QVGS 1JB0E 4XK8E 5FRNA 3HP9A 5HK3A 2DEQA 4ME7A 4C0DC 2I2LA 3JCMe 3OSSC 3CCEA 4JJNK 1BI2A 2EQUA 2KMTA 1LNXA 3G4SA 3JCMQ 4X9CA 4HT8A 1BIAA 3QYHB 2QI2A 3TEEA 5A2QE 3QBYA 2PVDB 2R57A 1U1TA 3JB9G 3NTKA 3GPLA 4L59A 2LDMA 5GAOp 1K8AC 4M78F 4C8QF 3EFRA 2FHDA 4ZN1A 5GAMd 4F7UA 1O75A 2V8KA 3CCQA 4M77D 3LH0A 4XAXB 2CZ0B 4RKUE 3ZEHA 4PJOE 3CC7A 2CZ7B 5DLQE 4C5EA 1B34B 4EMGA 3N5BB 1Q81U 4E7HA 2V8IA 3CC2T 1NE8A 2VC8A 3CC4A 1Y7XA 2YHTA 4J6YA 3E9GA 3J7AF 5EG2A 2RHUA 2KVQG 1KHIA 3QO3A 2FB7A 4RG8A 3HRTA 2RK2A 1YIJA 1FWZA 5GAN7 4EPCA 4C8QB 3CMET 1VQ9T 2E41A 5GMKh 4ATOA 2P0PA 5I21A 1Q82C 3QSUA 3MEUA 2IVWA 2P0QA 3CBPA 3L1AA 4M78G 3SWNA 4BD3A 3VYGA 1I8FA 4M75B 4C8QG 3INZA 5FU6B 3JB9I 1YJ9A 3A5ZB 5KCOA 1K9MC 2LQ8A 3OYGA 1XQHA 4MMKA 4FSXA 3OYYA 1H641 5GAMh 4DA4A 1QW1A 3C94A 2D0QB 5LJ5e 2RO0A 2E70A 4M7AF 2EJ9A 3CD6T 5D6WA 5GAN5 5GMKm 1W2BS 3OW2S 2O4XA 1WJRA 2DD5A 1I4K1 3Q1JA 2MAMA 4KULA 2RM4A 5GANj 4L6V5 3JCMg 1AHJB 1WNLA 2OAUA 2MI6A 4M78C 4C8QC 4F7UB 1VQ7T 2RA2A 2BKDN 4OP0A 2XDDA 1HK9A 3I55T 3L2VA 1W2BA 3OW2A 2LX9A 4BE0A 2FYKA 2DTOA 1YBYA 2HQXA 1V29B 2WSCE 3CBOA 5GAN6 2XDBA 3NFCA 4XU2A 4JDSA 4PLLA 4HCBA 3FLGA 4JUVA 4M7AB 4C5IA 2JTFA 3I56T 2DTHA 2PU9B 3NTHA 1IZ6A 1G3YA 1M5Q1 3QXEB 3CEYA 5IT9E 4FIBA 2Y4YA 4M7AG 1QP2A 5FU7B 4ELYC 1VQMA 3CC2A 3DKMA 4QVDA 3BDUA 4O5VA 4M77F 2PUOB 4M7DF 3RIRA 3M57A 5IAYA 4DQ2A 4RG2A 3QJ6A 4E7IA 1Q7YC 2RHZA 4N0AC 1MHNA 4GLKA 3SWNB 3CCUA 5LJ5f 4XTWA 1YHQT 2ZZDA 3WXMB 2IG0A 2MWOA 4KUIA 4E7LA 1VQ9A 4HCZA 4V2SA 4PL6A 3RESA 5GAOm 2M16A 3RKXA 2VV5A 4FT2A 2L89A 3SDZA 4CRIA 4C92A 1IREB 3F70A 3QDRB 4JLIA 2HD0A 1XOVA 4N4IA 4NL2A 3JB9J 4X9DA 5I2SA 4M7AC 2O4XB 4LD9K 3EFSA 2K5FA 4M77B 4TVRA 1Y07A 2JOYA 5GMKi 5LJ5g 4XTXA 4Q5WA 2DVEA 2NLUA 5FU7C 2WACA 2LT1A 3M59A 3KXTA 3QUIA 5GAOr 1YCYA 4M7DG 4E47A 2JVVA 4D6WA 3CCVA 3PIOA 2LCCA 3X24B 3JCMb 3LGFA 4WF2A 4PJOD 1X6OA 3SWNC 3FC3A 4BY6C 1BIBA 3OYHA 5CKDA 5FROA 2X4XA 1VQKA 2DZ9A 4IUQA 2DIGA 2E1HA 3WVEB 4JS5A 1M90U 3OBYA 4IURA 1VQ8T 2YRVA 2K3YA 3S3OA 1K9MU 5CKHA 3JCMc 2XG8D 3MCAB 3MEAA 2VXFA 3PT9A 4J5YA 1WQ7A 5M9OA 1JJ2S 3G71T 4M77C 3A8MB 3G6EA 2EQJA 2EYQA 4XTVA 4M7DC 1SSFA 3DLLA 1Q86C 2QXFA 3PTAA 3DB4A 4XTYA 3X20B 2GFUA 1RL2A 2YLBA 1VUBA 4LDVA 5CQXA 5J3BA 3MEWA 4N4GA 2JN0A 3GP8A 1YITA 4J7FA 2ZPHB 4OB3B 2O01E 4B9XA 5DLOA 1JJ2A 3BW1A 3PIPA 3TU4K 3LLRA 1HXDA 4OMFB 3G7ZA 4LD6A 3JCMd 3FRNA 3FEOA 3HRUA 4E7KA 4PJOA 4YTLA 1K73U 3QKJA 3M55A 3VV0A 2OTJT 4EMKC 5D6YA 1XTDA 2DD4A 3J81E 3CCMA 1NPRA 1VQPA 1VQLA 2RH2A 2PQWA 1NPPA 5KCHA 5LJ3f 2C06A 2EAYA 4M75F 1M90C 2Y4XA 3VKIA 2QA4T 1I81A 2MF2A 3PGGA 4M78E 4C8QE 4DOWA 4J6WA 3X28B 4IKFA 2BIVA 5HKCA 1ZQ1A 1KC8C 3UT1A 4RCBA 2RJEA 2K5LA 3OYBA 4OB0B 3PNWC 4B9WA 1NJIC 3M9QA 3LWHA 3A8LB 2QDYB 4PJOF 3UDCA 3OYDA 2E5QA 2LNVA 3HL8A 3JCMh 2P4TA 4L5GA 5I2MA 3WVDB 4PNOA 4F7UF 1YIJT 4CI0C 1VQNA 2VUBA 4R55A 1BI0A 4M75G 3G71A 2DXUA 2EQKA 5CIUA 3X26B 4A54A 1KQ2A 1JRIA 3LYIA 3MO8A 3OB9A 2EWNA 1G3WA 4C0FA 2V8JA 2ZGWA 3DB3A 3MP6A 3CXCS 3CCLA 1BYMA 2CKKA 1QVPA 2F5TX 1QVFA 4EMHA 2K57A 2XHCA 1GXIE 4HA8A 3SB2A 5GAN8 2GFAA 4ELZC 4PJOB 2BUDA 3QJYA 4C92D 2D6FA 4M7AE 4XU1A 3RUXA 1BKBA 2LCLA 4IUTA 5IN1A 4JS4A 3MEVA 4MZPA 4QVCA 2KQWA 5GAOq 1EIFA 3CXCA 4OGCA 2B8AA 1UGRB 4X34A 4JRKA 4Y91A 5C0MA 3CCJT 4F7UG 4MZTA 1U1SA 2CZ1B 5GANd 2M9UA 1KD1U 1XNIA 4M75C 3VYHB 5FU6C 1N8RU 2RK1A 4LDXA 5DY9A 1M1KC 3VUBA 5GAMf 4IUPA 3OYMA 3GNFB 4XTUA 1Q86U 3KUFA 2R5AA 1KG1A 1X75C 3M53A 4J7IA 2OTLT 1U8RA 4MDXA 4MMLA 2P0KA 2VGMA 3QHSA 4DOVA 1TH7A 3FJPA 2MMPA 3VUZA 3OS2A 4KUDK 2EIFA 3FDRA 3VU3C 4P5NA 4JRPA 3JB9D 4HCCA 3FIFA 3L2UA 3JCMP 1BI3A 2FL7A 1UEBA 2X4JA 4M77E 2JNGA 3JCMV 5GAMg 4M7DE 3CMEA 2PVGB 2GCXA 5FLXE 1MGQA 2HBPA 2K2VA 3KBGA 1K8AU 1OZ2A 3OY9A 2KSSA 1P92A 2X35A 5CK9A 1VQ4T 4A4KA 4QW2A 2A3LA 2DAQA 4LDWA 5GANh 3OYKA 1Q81C 5KE3A 2WSEE 5LJ5j 3L2QA 3QG1A 3A8GB 3CPFA 1WPYA 4BDZA 3LW5E 4C5HA 1I5LA 3RKYA 2G3RA 3NTIA 1YJNT 2JZ2A 4OB1B 3MP8A 1DJ7B 4M77G 3CBMA 4ZTFA 3CD6A 2FVUA 2RJFA 5CR2A 3EAEA 4MDWA 3V8LA 3CCET 4M78D 3TCJA 4BUGA 3PMIA 3L2ZA 1NJIU 2ZCFB 3M4GA 4Y28E 3V7CA 3OYEA 4BDYA 3M56A 1M8VA 1VQ7A 2KAFA 5LJ3e 1Q82U 1KD1C 3I55A 4NL3A 2HNIA 4C92F 3OYJA 3S3MA 3CCQT 4FL6A 4PKCC 4A53A 2GQVA 5DM7R 2RHYA 5GANf 2M0OA 2XKOC 3ZFJA 4XQ3A 3CC7T 4VUBA 3I56A 3V8JA 3PFSA 2RI3A 3CC4T 3GOXA 5AYFA 3BY7A 4XU3A 1BI1A 2DIQA 3C4SA 3HFOA 4RMOA 2OTLA 2XDPA 2DZCA 2VYTA 1VIEA 2RI2A 1WGSA 4PLIA 1S72T 1RI0A 2E12A 2MWPA 3GF5A 3RKWA 1M1FA 1FX7A 2D9TA 3S6WA 2LT4A 3MHXA 4BI8B 4BE2A 4HKEA 3JCMJ 2H3JA 4C92B 3HKSA 1YHQA 2EFIA 4BI3A 3META 1G3TA 2PVOB 2VXEA 3JB9F 1YI2T 1YJ9T 4J8OA 2DXBA 4M78A 2KY9A 4C8QA 3BFMA 4BACA 4EDUA 3OA6A 1VQ4A 1YJWT 3JB9H 2CZ6B 3LGLA 1M1KU 1ZBXA 4OGEA 3ER0A 3OMCA 4RCCA 3A8HB 5L8RE 4QVZA 3UWNA 3V7SA 1Y96A 2CYZB 5C6SA 5HK0A 1VQOT 1WQWA 3V7RA 1OYXA 3H6ZA 5GAN3 2XI9A 1ZHIA 3JSCA 5LL6S 4A4GA 3P8HA 2A7YA 2RHIA 5GMKe 3E19A 4JLGA 4ZGJB 4M75E 4BE1A 1PSFA 2EJGA 2EQMA 2R58A 4J83A 4UC4A 2R5MA 1G3SA 4LDUA 3R6OA 3L2WA 1Q7YU 2E6ZA 4C92C 2QQAA 4IUUA 5LJ3j 1PSEA 2XU8A 2E65A 4IUVA 4N0AA 5LJ3g 2QQRA 5GAMe 3HPWA 3P8BB 5KH6A 1VIFA 2E6NA 2QEXT 1QVGA 4HT9A 1N9RA 2DJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FU6 B;  5FU7 C;  5FU6 C;  5FU7 B;  4BY6 B;  4C0F A;  4BY6 C;  4C0D B;  4C0D C;  4C0G A; 
#chains in the Genus database with same CATH topology
 1IGQ A;  3E9F A;  1FXX A;  2D8J A;  1QVF S;  1VQ8 Q;  2EKH A;  1WHG A;  1M1G A;  3G71 Q;  3HFN A;  3HHT B;  3QWX X;  1S72 A;  3M4Y A;  2DTI A;  3PMT A;  3PVL A;  1TUG B;  1TXQ A;  4PJO G;  5GAN 2;  1IHW A;  3OYA A;  3L42 A;  4HXJ A;  5KE2 A;  2QK0 A;  5KYY B;  2OTJ A;  2NUP A;  4A4H A;  3RER A;  1TG0 A;  3QPH A;  2F2X A;  5GMK j;  2C0O A;  4M7D A;  2RJC A;  1Q81 R;  4KBM B;  1VQK T;  5FRM A;  1KQS A;  5GAM j;  5GAN e;  2F69 A;  3OYL A;  2J06 A;  3FB9 A;  3OYC A;  4NS5 A;  3CME Q;  2L5Q A;  3C12 A;  2PNI A;  4AG2 C;  2ZPG B;  3G6E T;  3QII A;  1UEC A;  2NUZ A;  3UA7 A;  3C95 A;  1KC8 U;  2CS7 A;  2EJF A;  2PUK B;  3M0R A;  3HTR A;  4AT1 B;  2A37 A;  2RD1 A;  4R0K A;  4C8Q D;  1M4Z A;  4J6X A;  3CQT A;  5A0L A;  1X2Q A;  2L8D A;  1Y71 A;  5LJ3 d;  1NLP C;  3OYI A;  2M51 A;  1N6A A;  2HKQ B;  2MOX A;  4DBR A;  4RTT A;  2HL3 A;  2DL7 A;  1KQ1 A;  2DK3 A;  2E3I A;  1SF9 A;  2FO0 A;  1W1F A;  5GAO n;  2OTL Q;  1B34 A;  2KYM A;  3QZ5 B;  4C0D B;  4AG1 C;  3O8V A;  5GAN j;  3HRS A;  4C5G A;  1W4S A;  2I0N A;  1NYF A;  3V8K A;  4FCY A;  2MK5 A;  5HY6 A;  4AMC A;  4J9G A;  1T0J A;  1VQN T;  4OML A;  1OI1 A;  3NPF A;  5I22 A;  2BE9 B;  2QTX A;  2CP3 A;  4KGZ B;  4M75 A;  4JRI A;  1XJW B;  3CCS A;  3EGD B;  3GIB A;  4D8D A;  2DRM A;  2P84 A;  3JCM e;  3CCE A;  4C0D C;  1ARK A;  2JTE A;  1X6B A;  2EQU A;  1LCK A;  3G4S A;  4X9C A;  3TEE A;  3QBY A;  6AT1 B;  1UHC A;  2HBW A;  3NTK A;  2SEM A;  1K8A C;  2QGF B;  4M78 F;  4C8Q F;  3CCQ A;  1D1B A;  1J3T A;  4XAX B;  4RKU E;  3CC7 A;  5DLQ E;  2CT3 A;  2V8I A;  2VC8 A;  1YP5 A;  3J7A F;  1WXU A;  3HRT A;  4E2F B;  3BE3 A;  4C8Q B;  1H8K A;  1OX8 A;  2L2P A;  2P0P A;  3MEU A;  2P0Q A;  2V1Q A;  3CBP A;  3SWN A;  1KD1 U;  3JB9 I;  1I8F A;  3A5Z B;  1K9M C;  2LQ8 A;  3OYG A;  4MMK A;  1G83 A;  1KIK A;  4DA4 A;  1QW1 A;  1YJW Q;  2H8H A;  2CP6 A;  2EJ9 A;  5GAN 5;  1W2B S;  1WJR A;  2DD5 A;  1I4K 1;  2EYW A;  2MAM A;  2NUT A;  4DBF A;  2A36 A;  1RAG B;  1ZSZ C;  4M78 C;  4C8Q C;  4F7U B;  2BKD N;  4OP0 A;  3I55 T;  3OW2 A;  1V29 B;  4B6M A;  2A0F B;  4PJN A;  4JDS A;  1UJY A;  2JTF A;  1IZ6 A;  3QXE B;  5IT9 E;  1TSF A;  3UAT A;  2Y4Y A;  4M7A G;  1QP2 A;  3H0H A;  3DKM A;  2YRC A;  2PUO B;  1I1J A;  3VS2 A;  3QJ6 A;  3CMA Q;  5LJ5 f;  3CCU Q;  2ZZD A;  1GCQ C;  2MWO A;  4KUI A;  4PJJ A;  3RES A;  2KBT A;  4FT2 A;  4QT7 A;  2JT4 A;  3SDZ A;  1GFD A;  1N5Z A;  1HD3 A;  4LUD A;  4NL2 A;  2O4X B;  4J9I A;  1C0M A;  1Y07 A;  5LJ5 g;  4XTX A;  2NLU A;  1M27 C;  2DJQ A;  2LT1 A;  2WAC A;  3M59 A;  1YCY A;  2JVV A;  2F1L A;  3LH5 A;  1VQ6 Q;  3R6N A;  3PIO A;  3VRZ A;  3FC3 A;  4BY6 C;  1HYO A;  1NEB A;  4HCK A;  2X4X A;  2RN8 A;  5FRO A;  2DZ9 A;  2DIG A;  4JS5 A;  3CXC P;  1VQ8 T;  2K3Y A;  3S3O A;  2DL5 A;  3MCA B;  4J5Y A;  3G71 T;  3A8M B;  3VRY A;  1SSF A;  3DLL A;  1Q86 C;  3PTA A;  2P4R A;  2ATC B;  5J3B A;  3MEW A;  1YIT A;  2EVR A;  2ZPH B;  4B9X A;  2O01 E;  5DLO A;  1JJ2 A;  3KFV A;  4LD6 A;  2HL5 C;  1GBR A;  2BE7 D;  2PTK A;  1FMV A;  4EMK C;  2DD4 A;  3J81 E;  1VQP A;  1VQL A;  4AFQ C;  2KRO A;  2BTT A;  5KYY A;  2B86 A;  1QCN A;  5HKC A;  1ZQ1 A;  1KC8 C;  4RCB A;  3QDF A;  4OB0 B;  3PNW C;  1TWB A;  3A8L B;  1YIJ Q;  2QDY B;  2E5Q A;  3HL8 A;  3WVD B;  3M0P A;  2KRM A;  2VAS A;  4CI0 C;  2LP5 A;  4HVW A;  2DXU A;  2ENM A;  4A54 A;  3LYI A;  1OX9 A;  2V8J A;  3CXC S;  2CP0 A;  3CCL A;  4A63 B;  1OOT A;  4OMQ A;  1WDX A;  4HA8 A;  1AOJ A;  1D0X A;  3SB2 A;  2D6F A;  4C92 D;  2EW3 A;  2KQW A;  5KYU B;  2B8A A;  1UGR B;  4JRK A;  4F7U G;  4MZT A;  1Q95 G;  1Q7Y R;  5FU6 C;  1I0C A;  1I5O B;  5DY9 A;  2FRW A;  2KT8 A;  5GAM f;  4IUP A;  1T3S A;  1ZX6 A;  2ZAE A;  3JV3 A;  4J7I A;  2OTL T;  1TH7 A;  2MMP A;  3VUZ A;  3OS2 A;  4KUD K;  3JB9 D;  4HCC A;  1VYT A;  1UEB A;  5KYX B;  2JNG A;  5GAM g;  4M7D E;  2GCX A;  1VQ9 Q;  2HKN A;  2K2V A;  3KBG A;  2KSS A;  3TVT A;  5CK9 A;  4QW2 A;  2DAQ A;  5GAN h;  2XD0 A;  2HDA A;  4C5H A;  2COZ A;  2GQI A;  3CBM A;  3VS3 A;  1BCO A;  3CD6 Q;  3V8L A;  3EGD A;  2O9V A;  2JMA A;  3OYE A;  2M02 A;  1VQK Q;  1KD1 C;  2HNI A;  4C92 F;  1UE9 A;  2CUD A;  2O2O A;  4PKC C;  4A53 A;  2JM8 A;  2GQV A;  5GAN f;  2XKO C;  4XQ3 A;  3I56 A;  3V8J A;  3PFS A;  1MMN A;  3GOX A;  3G6E Q;  3BY7 A;  2DIQ A;  1VIE A;  1WGS A;  2E12 A;  3RKW A;  3GF5 A;  1FX7 A;  2J6O A;  3MHX A;  4HKE A;  4GBQ A;  2SRC A;  3JCM J;  4C92 B;  1YHQ A;  1RLQ C;  4BI3 A;  3MET A;  1G3T A;  2PVO B;  2X3X D;  4KGV B;  3JB9 F;  3U23 A;  1ZSZ A;  4M78 A;  4C8Q A;  2DYB A;  3OA6 A;  1YJW T;  1M1K U;  4RCC A;  3UWN A;  4JJB A;  4FW2 A;  1EFN A;  4D8K A;  4EIK A;  1KK7 A;  5LL6 S;  4FYY B;  4A4G A;  5FWC A;  2F2W A;  4M75 E;  1PSF A;  2EQM A;  4J83 A;  4JJC A;  4UC4 A;  3L2W A;  2E6Z A;  4C92 C;  1D0Z A;  2E65 A;  5LJ3 g;  2AT1 B;  1QVG A;  1VIF A;  2C06 A;  2DJZ A;  4RTV A;  4MZM A;  2F2V A;  3UPU A;  1ZA1 B;  4K11 A;  1IGU A;  3RMQ A;  4F17 A;  5GAN 4;  3CMA T;  2OI3 A;  4JPB W;  5LJ5 d;  1ABQ A;  3CCU T;  4BI4 A;  2XID A;  1QKX A;  4BB7 A;  4OB2 B;  3M5A A;  1TU0 B;  4JZ3 A;  4ZGD B;  4XU0 A;  1UJ0 A;  3JCM f;  1YI2 A;  2Y90 A;  1Y96 B;  4JRQ A;  1D3B A;  4N4H A;  2X4Y A;  2E64 A;  1MV0 B;  2RHX A;  1VQ6 T;  4OMN A;  5D6X A;  2XIC A;  2E4H A;  4C0G A;  3REA B;  3JCM X;  1AVZ C;  5IHK A;  3URG A;  1UB4 A;  2E10 A;  2K2M A;  1NZ9 A;  4PJO C;  1R0B G;  2NWM A;  3TSZ A;  2EYX A;  2GF7 A;  2EKO A;  1UUE A;  2QEX A;  1G8X A;  1BCM A;  4QQD A;  4Z02 A;  1X01 A;  2GTJ A;  5CKF A;  2DXC A;  2LJ3 A;  2D1X A;  1JXO A;  4OVA A;  2YLC A;  4KT0 E;  4EMK A;  2QQS A;  3H8Z A;  3IQL A;  3OS5 A;  4ZN3 A;  1PG5 B;  3DLM A;  1M30 A;  3QWY A;  1OU9 A;  3RMS A;  2RI5 A;  1SRL A;  4ZTJ A;  3CCJ A;  3CCM T;  5CKB A;  4J9D A;  4O6J A;  2OAW A;  3P8D A;  3OMG A;  3OSV A;  2LVM A;  3JCM W;  1VOM A;  4FT4 A;  2K4Y A;  5KYW A;  4HT8 A;  3OYH A;  1JBM A;  1QKW A;  3T9N A;  1YIJ T;  2DO3 A;  3SD4 A;  3OBW A;  4C92 G;  2YUQ A;  1G5V A;  4M7A D;  1M3B A;  4GY5 A;  1N27 A;  1C6V X;  3BDL A;  2MPX C;  1AD5 A;  1VQ4 Q;  3EFO B;  2YUN A;  1YJN A;  2ZPI B;  1QVG S;  1ZUK A;  2DFU A;  1BI2 A;  2KMT A;  1LNX A;  1BBZ A;  1BIA A;  2DEU A;  4RTY A;  1M2V B;  2QTV A;  4Y92 A;  3JB9 G;  3GPL A;  2Z0W A;  1AWW A;  4ZN1 A;  1OUL A;  1WFW A;  5GAM d;  2V8K A;  3CCQ Q;  1Q81 U;  2CZ7 B;  1UG1 A;  4E7H A;  3CC4 A;  1Y7X A;  3E9G A;  3EH1 A;  1KHI A;  4RG8 A;  2CH4 A;  3RBB B;  5GAN 7;  1VQ9 T;  2E41 A;  4ATO A;  5I21 A;  3L1A A;  4C0Z A;  1M90 C;  2YXY A;  4LE9 A;  1YJ9 A;  1WYX A;  1YWP A;  1XQH A;  1H64 1;  1K73 R;  4M7A F;  3CD6 T;  1VQO Q;  3VS0 A;  4JZ4 A;  3Q1J A;  4J9F A;  1PNJ A;  1VQ7 T;  2RA2 A;  2XDD A;  3L2V A;  1QWE A;  1W2B A;  3CBO A;  5GAN 6;  3I9Q A;  4DBQ A;  3NFC A;  1SPK A;  4J9B A;  2EYY A;  4XU2 A;  4HCB A;  3EG0 A;  4M7A B;  3M0Q A;  1G3Y A;  3CEY A;  4ELY C;  1VQM A;  1VQ5 Q;  3BDU A;  4O5V A;  1RAA B;  3CCR Q;  3M57 A;  2LX7 A;  1MHN A;  2A28 A;  2IG0 A;  1OU8 A;  4F16 A;  3NHN A;  3RKX A;  2VV5 A;  2L89 A;  2YUO A;  2YUP A;  4C92 A;  1CKB A;  1IRE B;  3F70 A;  3JB9 J;  2DLP A;  4X9D A;  4M7A C;  1ZSG A;  3EFS A;  2K5F A;  3EG1 A;  4LD9 K;  4TVR A;  5GMK i;  1WZO A;  2CP7 A;  2JOY A;  2DVE A;  3KXT A;  3QUI A;  2EPD A;  3CCV A;  1N8R R;  2LCC A;  2C0T A;  3X24 B;  3JCM b;  4WF2 A;  1Q86 R;  3VS6 A;  5CKD A;  4KH0 B;  2E1H A;  3WVE B;  1M3A A;  4IUR A;  1QQJ A;  5CKH A;  1RUW A;  3MEA A;  2VXF A;  3PT9 A;  5M9O A;  2GGR A;  2EYQ A;  4XTV A;  3D7S B;  2QXF A;  2COY A;  2CH4 W;  1RL2 A;  9ATC B;  1WIE A;  3EGX A;  4J7F A;  3BW1 A;  2DRK A;  3PIP A;  3LLR A;  4OMF B;  3JCM d;  3FRN A;  1KQS P;  2IPO B;  3HRU A;  2LJ0 A;  4PJO A;  1Y0M A;  4YTL A;  3QKJ A;  3M55 A;  2OTJ T;  5D6Y A;  2DE0 X;  2ABL A;  1VQP Q;  3H0I A;  1Q82 R;  1I81 A;  2MF2 A;  4M78 E;  4C8Q E;  4PJM A;  1M8M A;  3EG9 A;  2EYZ A;  1G2B A;  2RJE A;  4AFS C;  1NJI C;  3LWH A;  1W70 A;  2P4T A;  2YRD A;  1I07 A;  4F7U F;  5I11 A;  2ED0 A;  2DM1 A;  1M3C A;  1BI0 A;  1GBQ A;  3G71 A;  2YDL A;  1U5S A;  1VA7 A;  1JRI A;  3H0F A;  2EWN A;  2CKK A;  1QWF A;  3CCL Q;  2F5T X;  1YNZ A;  2E3H A;  4ELZ C;  1UHF A;  2BUD A;  1BKB A;  2LCL A;  4JS4 A;  4MZP A;  5GAO q;  3CXC A;  2GTO A;  5IHI A;  2M9U A;  3VYH B;  2W0Z A;  2X3W D;  1YCS B;  3VUB A;  3OYM A;  4RTW A;  1V76 A;  4AFZ C;  1MNE A;  3CC2 Q;  2P0K A;  3QHS A;  1IB8 A;  4CC2 A;  1TOV A;  2FL7 A;  3CME A;  1K9A A;  1PKS A;  4DBH A;  1F1B B;  1OZ2 A;  2X35 A;  1VQ4 T;  4LDW A;  3OYK A;  1Q81 C;  5KE3 A;  2WSE E;  1I5L A;  2J05 A;  4BDZ A;  1WPY A;  3LW5 E;  3EHQ A;  3RKY A;  4OB1 B;  5HCK A;  2XMF A;  1JO8 A;  2FVU A;  2CUB A;  2RJF A;  2VWF A;  3CCE T;  1EX4 A;  2VKN A;  3V7C A;  1C1A A;  3M56 A;  2KAF A;  4X1V A;  4NL3 A;  3OYJ A;  2QAS A;  3CCQ T;  2RHY A;  3CC7 T;  3C4S A;  4RMO A;  2OTL A;  4QKU A;  2DZC A;  4PLI A;  1RI0 A;  2MWP A;  1M1F A;  3S6W A;  4BE2 A;  2LT4 A;  1RAH B;  2KXC A;  5IHN A;  3OW2 P;  2KY9 A;  3BFM A;  1RAC B;  1BU1 A;  2CSI A;  3LGL A;  3V7S A;  3A8H B;  5C6S A;  3THK A;  3CCM Q;  1VQO T;  4Z88 A;  3H6Z A;  3V7R A;  2XI9 A;  4JLG A;  2EJG A;  1Q7Y U;  2R5M A;  1G3S A;  1GCP A;  4LDU A;  4HVU A;  2XU8 A;  2QQR A;  3I5R A;  2E6N A;  4HT9 A;  1N9R A;  5CO7 A;  2DL8 A;  4M7D D;  1LJO A;  1QP3 A;  5CAI A;  5CVI A;  2JJ9 A;  2ZPE B;  1OZ3 A;  5KYN A;  1VQ5 T;  2K3X A;  1AWO A;  3CCR T;  3RDV A;  4M7A A;  5CKE A;  1JEG A;  3E1S A;  2KRN A;  2KR3 A;  4QQG A;  2O9S A;  1TUC A;  1UDL A;  1JU5 C;  1S1N A;  2VB6 A;  3MKD A;  1KHC A;  2EQI A;  2V1R A;  1SHG A;  2V26 A;  1IO6 A;  4RTU A;  1YJW A;  1UGP B;  3LX7 A;  3CPW P;  2FPE A;  3X25 B;  3JAM E;  2QA4 A;  2W10 A;  5IXB A;  4R56 A;  1D0Y A;  2L3Q A;  1K76 A;  1JJ2 P;  3TRE A;  1UGQ B;  2ESW A;  2KNB B;  4OF1 A;  3J80 E;  1PKT A;  1SEM A;  1B3Q A;  2E5K A;  2FRY A;  4RTX A;  1R0C B;  4NOY A;  2M1H A;  2HQE A;  3H41 A;  1SSH A;  4ORZ A;  3OS0 A;  2LCS A;  5GJV B;  1VYV A;  1WHJ A;  3CMA A;  1YIT T;  1H3Z A;  3M58 A;  2XK0 A;  1X43 A;  3OS1 A;  2WSF E;  1UGS B;  1KFZ A;  2AKL A;  2CGH A;  3A8O B;  4M75 D;  3SHW A;  1VQ7 Q;  2JTM A;  1ZBJ A;  3CCJ Q;  2KK4 A;  1VQP T;  1VQL T;  1B7T A;  2HAX A;  1N9S A;  1PC0 A;  4M7D B;  3MP1 A;  4C92 E;  1E6G A;  2OJ2 A;  3I5S A;  4HVV A;  4LDY A;  1VQ6 A;  3GNG A;  3GLX A;  2DL3 A;  3QZ9 B;  1WHK A;  2MIO A;  1O9S A;  3CPW S;  3OYF A;  2ZPF B;  2DXT A;  3ME9 A;  4E7J A;  4IKF A;  4J9E A;  2CRE A;  1GFC A;  5GAN g;  2LC4 A;  1NM7 A;  2QQ9 A;  4ZGE B;  2RNA A;  2DKG A;  3M0T A;  1WJS A;  4LXC A;  2JMC A;  1LOJ A;  2L3R A;  5LJ3 h;  4RUG A;  3CCL T;  1AZE A;  2DPP B;  3VJP A;  1ZUY A;  1YFN A;  3JRZ A;  1YJN Q;  1JB0 E;  2DEQ A;  2I2L A;  4JJN K;  3QYH B;  2QI2 A;  4F04 B;  2PVD B;  5GAO p;  2LDM A;  3EFR A;  1GCQ A;  4F7U A;  2JXB A;  4M77 D;  3LH0 A;  1WHH A;  4OMP A;  3ZEH A;  4PJO E;  4C5E A;  4EMG A;  1B34 B;  3N5B B;  5ECA A;  3CC2 T;  2LNH B;  2FG0 A;  4J6Y A;  2RQW A;  2KYB A;  1T0H A;  1WA7 A;  1IRX A;  3QO3 A;  1CSK A;  2DF6 A;  1TS9 A;  1S72 Q;  2RK2 A;  2DIL A;  2ROL A;  1YIJ A;  4EPC A;  4LNP A;  2DVJ A;  2IVW A;  4BD3 A;  3VYG A;  4M75 B;  5KCO A;  1YJ9 Q;  2AIR B;  4FSX A;  3OYY A;  2HMA A;  2QG9 B;  2OTJ Q;  2LZ6 B;  2HZY A;  2D0Q B;  5LJ5 e;  4IIO A;  3PE0 A;  2QGG A;  2K6D A;  1Y57 A;  2YSQ A;  5D6W A;  5GMK m;  2O4X A;  1K1Z A;  2KE9 A;  4CC4 B;  2RM4 A;  2D8H A;  4L6V 5;  5AT1 B;  1AHJ B;  3JCM g;  3PVQ A;  2KRS A;  2GNC A;  4BE0 A;  2FYK A;  2DTO A;  3UF4 A;  2HQX A;  2DA9 A;  1PM3 A;  2EGE A;  4PLL A;  3FLG A;  4JUV A;  4C5I A;  3I56 T;  1Z9Q A;  2DTH A;  3NTH A;  4FIB A;  4QVD A;  4M77 F;  5IAY A;  2MCN A;  8AT1 B;  2ROT A;  4RG2 A;  1Q7Y C;  2RHZ A;  3SWN B;  2DL4 A;  4XTW A;  1YHQ T;  1TTH B;  1VQ9 A;  4V2S A;  5GAO m;  2M16 A;  4KRT A;  4CRI A;  4FW1 A;  2HD0 A;  1XOV A;  5I2S A;  4M77 B;  2NUT B;  2JM9 A;  2O88 A;  4AFU C;  4M7D G;  4D6W A;  3LGF A;  1U3O A;  2A08 A;  1QVF P;  4J9C A;  3SWN C;  1FMK A;  1OPL A;  2PZ1 A;  1WHM A;  1VQK A;  1RAI B;  3G1J A;  2YRV A;  1K9M U;  2YT6 A;  1WQ7 A;  4M77 C;  3G6E A;  2EQJ A;  3DB4 A;  3X20 B;  1K8A R;  2YLB A;  5CQX A;  3CCS Q;  4N4G A;  2L3S A;  1K0X A;  1ZLM A;  3TU4 K;  1WXB A;  1HXD A;  3CCE Q;  3G4S Q;  4E7K A;  2C0I A;  1RAF B;  1K73 U;  1UGV A;  4PFZ A;  3VV0 A;  4J9H A;  4Z89 A;  1NJI R;  2JS2 A;  5KYU A;  1NPR A;  2PQW A;  5KCH A;  2EAY A;  2EGC A;  2Y4X A;  3VKI A;  4DOW A;  3CC7 Q;  2BIV A;  1K9M R;  3EHR A;  2K5L A;  3OYB A;  1IHV A;  4B9W A;  4DEY A;  4OMO A;  1AWX A;  3UDC A;  3OYD A;  1MMD A;  4L5G A;  5KYX A;  1VQN A;  4R55 A;  4M75 G;  1A0N B;  1KQ2 A;  1MND A;  1UFF A;  3MP6 A;  3DB3 A;  1BYM A;  2K57 A;  1GXI E;  3EG3 A;  1R77 A;  2GFA A;  3MJX A;  4M7A E;  4FYV B;  4XU1 A;  2EBP A;  4IUT A;  5IN1 A;  1CKA A;  2J7I A;  1EIF A;  4Y91 A;  2FZK B;  5C0M A;  1W6X A;  3CCJ T;  1U1S A;  1M2O A;  4E7Z A;  2HSE B;  1LVK A;  1XNI A;  5GAN d;  1N8R U;  4LDX A;  1M1K C;  3GNF B;  4XTU A;  1Q86 U;  1TUD A;  2R5A A;  1X75 C;  4GLM A;  1B07 A;  4F14 A;  1U8R A;  1MUZ A;  4MDX A;  4MML A;  2VGM A;  4DOV A;  1H92 A;  2EIF A;  3FDR A;  4P5N A;  4JRP A;  1BI3 A;  2X4J A;  2LJ1 A;  2PVG B;  5FLX E;  2HBP A;  1RAE B;  4ESR A;  1BB9 A;  4A4K A;  2A3L A;  1RI9 A;  2K9G A;  3QG1 A;  3A8G B;  3CPF A;  4WTO B;  1YJN T;  3MP8 A;  4M77 G;  1SHF A;  1UTI A;  4ZTF A;  1NG2 A;  4ANJ A;  4M78 D;  4BUG A;  3L2Z A;  2ZCF B;  4Y28 E;  3VS1 A;  4BDY A;  1D1A A;  2ECZ A;  1M8V A;  3VS4 A;  1JXM A;  2COW A;  5LJ3 e;  3I55 A;  1Q82 U;  2X9H A;  3S3M A;  3ZFJ A;  1YWO A;  3CC4 T;  2AKK A;  1FMW A;  4XU3 A;  3HFO A;  2XDP A;  2RI2 A;  2VYT A;  1S72 T;  8ATC B;  2D9T A;  1YIT Q;  2X51 A;  3MPU B;  1MMG A;  3HKS A;  2EFI A;  1KC8 R;  1YJ9 T;  1W2B P;  4J8O A;  2DXB A;  2G6F X;  1D09 B;  1V1C A;  4EDU A;  1MV3 A;  1VQ4 A;  2DYI A;  2L0A A;  5L8R E;  3ER0 A;  3OMC A;  4FSS A;  1Y96 A;  1VQL Q;  1WQW A;  5GAN 3;  1OYX A;  3JSC A;  2L3P A;  1SRM A;  3P8H A;  1PD1 A;  3TSW A;  2BZX A;  4BE1 A;  2MYS A;  2R58 A;  2FEI A;  1KJW A;  1X6G A;  2QQA A;  4IUU A;  5LJ3 j;  1PSE A;  4IUV A;  7AT1 B;  3P8B B;  5L23 A;  5EG2 A;  5J26 A;  3RR6 A;  1VQ8 A;  3AHU A;  4II1 A;  2JUF A;  3EG2 A;  2QQB A;  1VQM T;  2LRQ A;  4F7U E;  2X4W A;  1PWT A;  1JQQ A;  2DMO A;  2GBQ A;  1ZSZ B;  4M78 B;  5GMK l;  2ZPB B;  2DER A;  2RF0 A;  4WCI A;  2H3E B;  1Z9Z A;  5A0D A;  2J6K A;  1VQO A;  1KQS S;  3CCV T;  2QA4 Q;  4M77 A;  4PK4 A;  4OMM A;  1WLP B;  3S3N A;  2F5K A;  1R8O B;  5LJ5 h;  5IH2 A;  2KI7 A;  2RB6 A;  1K73 C;  1SG5 A;  2AHJ B;  5CCA A;  1SKU B;  1ABO A;  2K5I A;  4FU6 A;  5GAO l;  1VQ5 A;  1ZUU A;  3CCS T;  2FPF A;  3OYN A;  2QYZ A;  1KD1 R;  3GBQ A;  3CCR A;  1M9S A;  1T3L A;  2D0N A;  3EFO A;  4BY6 B;  3LWI A;  3G4S T;  1D3B B;  5EC7 A;  5FWB A;  1KSW A;  2LQN A;  2FZC B;  1RLP C;  1M2V A;  4QQ6 A;  5A0G A;  3HSB A;  1U06 A;  4XTZ A;  3I56 Q;  2LQW A;  4A4F A;  4FM4 B;  1RAB B;  3I35 A;  2RQV A;  2RJD A;  2LTO A;  3ZBD A;  3ASK A;  1AZG B;  3QYG B;  1PD0 A;  2KDS A;  2LQK A;  1QCF A;  2J6F A;  3L2R A;  5CQY A;  1QCO A;  1WJQ A;  1YHQ Q;  4EMK B;  3M54 A;  1N8R C;  3CPW A;  3OQ5 A;  3SFM A;  2VGN A;  4A4E A;  2OX7 A;  1WX6 A;  5J39 A;  1AEY A;  2LMJ A;  2KEA A;  4XK8 E;  5FRN A;  3HP9 A;  1PRL C;  2QDL A;  1GRI A;  4ME7 A;  5HK3 A;  3OSS C;  2CP5 A;  3JCM Q;  5A2Q E;  2DBK A;  3TQ7 P;  2R57 A;  2ED1 A;  1U1T A;  3EH2 A;  4L59 A;  2FHD A;  1O75 A;  3ZL7 C;  1PRM C;  5GJW B;  2CZ0 B;  1HJD A;  5KYW B;  1NE8 A;  5D7U A;  4KGX B;  2YHT A;  2RHU A;  2KVQ G;  2FB7 A;  2DNU A;  1FWZ A;  5IXF A;  1WXT A;  3CME T;  4LN2 A;  1WHL A;  5GMK h;  2DET A;  1Q82 C;  3QSU A;  4FYX B;  1PCX A;  4M78 G;  4C8Q G;  2CT4 A;  3INZ A;  1ACM B;  5FU6 B;  1YI2 Q;  1MMA A;  5GAM h;  2AZS A;  2RQT A;  3C94 A;  2FPD A;  3O5Z A;  2RO0 A;  3C0C A;  2E70 A;  3OW2 S;  4KUL A;  1WNL A;  2OAU A;  2FZG B;  2RMO A;  2MI6 A;  1HK9 A;  2LX9 A;  1YBY A;  2HCK A;  2WSC E;  2XDB A;  2RPN A;  2QEX Q;  2JW4 A;  2PU9 B;  1M5Q 1;  5FU7 B;  3CC2 A;  4RTZ A;  4M7D F;  3RIR A;  3UA6 A;  4DQ2 A;  4Z8A A;  4E7I A;  4N0A C;  4FYW B;  4GLK A;  3CCU A;  4LUE A;  3FJ5 A;  3WXM B;  4M4Z A;  4E7L A;  4HCZ A;  4PFP A;  4PL6 A;  2RQU A;  2NUP B;  3QDR B;  4JLI A;  4N4I A;  1EZZ B;  2K79 A;  1LPL A;  4Q5W A;  5GAO r;  5FU7 C;  4E47 A;  3VS7 A;  4PFO A;  2KXD A;  4E6R A;  4PJO D;  1X6O A;  3NGP A;  3EGU A;  2KT1 A;  1BIB A;  3M0S A;  3SEM A;  2BZY A;  1M90 U;  4IUQ A;  3OBY A;  1QMC A;  2DBM A;  1WI7 A;  3JCM c;  2XG8 D;  2EGA A;  3H9N A;  1JJ2 S;  1K0S A;  4PJL A;  1OQK A;  4M7D C;  1D1C A;  4XTY A;  2CSQ A;  2GFU A;  2YWW A;  1VUB A;  2AK5 A;  4LDV A;  2AZV A;  2JN0 A;  3GP8 A;  4OB3 B;  1GL5 A;  1AT1 B;  3G7Z A;  1QLY A;  3FEO A;  2IIM A;  1OEB A;  1XTD A;  3CCM A;  2RH2 A;  1NPP A;  5LJ3 f;  2K7A A;  4M75 F;  2QA4 T;  3PGG A;  1M90 R;  4J6W A;  3X28 B;  1YN8 A;  3CC4 Q;  2M0Y A;  3UT1 A;  4ZNX A;  1H3H A;  3M9Q A;  1X27 A;  4PJO F;  2KGT A;  2LNV A;  3JCM h;  5I2M A;  1E6H A;  4PNO A;  1NLO C;  3NMZ C;  2HQH A;  4JJD A;  2VUB A;  4DEX A;  3M0U A;  3ULR B;  1VQN Q;  2EQK A;  5CIU A;  3X26 B;  3EGX B;  3REB B;  3OB9 A;  1E7O A;  3MO8 A;  4CC3 A;  1G3W A;  4C0F A;  1OV3 A;  2ZGW A;  1QVP A;  1QVF A;  4EMH A;  2XHC A;  1M1K R;  5GAN 8;  4PJO B;  1BK2 A;  3QJY A;  3RUX A;  3MEV A;  4QVC A;  4OGC A;  4X34 A;  2CZ1 B;  4M75 C;  2RK1 A;  3EG9 B;  3KUF A;  1KG1 A;  3M53 A;  1ZA2 B;  1VQM Q;  3FJP A;  1NEG A;  5FW9 A;  3VU3 C;  4CC7 A;  3FIF A;  3L2U A;  3JCM P;  2K3B A;  4M77 E;  3JCM V;  1IXD A;  1MGQ A;  1K8A U;  3OY9 A;  1QVG P;  4KH1 B;  1P92 A;  2HSP A;  5LJ5 j;  3L2Q A;  2G3R A;  3NTI A;  3VS5 A;  2JZ2 A;  1DJ7 B;  4IIM A;  3CD6 A;  1FYN A;  5CR2 A;  3EAE A;  4MDW A;  3CCV Q;  1AWJ A;  3TCJ A;  3PMI A;  1NJI U;  3M4G A;  2CP2 A;  1VQ7 A;  1NYG A;  1RAD B;  4E7S A;  2HEQ A;  3I55 Q;  4FL6 A;  5DM7 R;  2M0O A;  4VUB A;  3RNJ A;  3A1P A;  2RI3 A;  3AT1 B;  5AYF A;  1X2K A;  1OPK A;  1BI1 A;  2NYS A;  2QAZ A;  2DX1 A;  4BI8 B;  2VVK A;  2H3J A;  1VYU A;  2RQR A;  2JS0 A;  1X69 A;  2BZ8 A;  2CDT A;  2VXE A;  1YI2 T;  3A98 A;  4BAC A;  1NBE B;  3JB9 H;  2CZ6 B;  1ZBX A;  4OGE A;  4QVZ A;  5HK0 A;  2CYZ B;  3E2U A;  1ZHI A;  2O31 A;  1HSQ A;  2A7Y A;  2RHI A;  5GMK e;  3E19 A;  4ZGJ B;  3R6O A;  1K4U S;  4N0A A;  5GAM e;  3HPW A;  5KH6 A;  2QEX T;  1PHT A; 
#chains in the Genus database with same CATH homology
 5J26 A;  3E9F A;  4MZM A;  1FXX A;  1VQ8 A;  1QVF S;  3AHU A;  1LJO A;  3UPU A;  4M7D D;  1QP3 A;  5CAI A;  4II1 A;  1M1G A;  5CVI A;  2ZPE B;  1OZ3 A;  2JUF A;  1VQ5 T;  2QQB A;  1VQM T;  2K3X A;  2LRQ A;  3CCR T;  3HFN A;  4F7U E;  4M7A A;  2X4W A;  3HHT B;  5CKE A;  3E1S A;  3RMQ A;  5GAN 4;  3CMA T;  1S72 A;  5LJ5 d;  3M4Y A;  4QQG A;  3CCU T;  2DTI A;  4BI4 A;  2XID A;  3PMT A;  4BB7 A;  4M78 B;  4OB2 B;  3M5A A;  5GMK l;  2ZPB B;  4ZGD B;  4PJO G;  4XU0 A;  1KHC A;  2XD0 A;  5GAN 2;  5CO7 A;  3L42 A;  3JCM f;  2Y90 A;  3OYA A;  5KE2 A;  1YI2 A;  1Y96 B;  4JRQ A;  1D3B A;  2OTJ A;  1YJW A;  1UGP B;  3LX7 A;  4N4H A;  4A4H A;  2X4Y A;  2E64 A;  3RER A;  5A0D A;  3X25 B;  3QPH A;  2RHX A;  3JAM E;  1VQO A;  1KQS S;  5D6X A;  2QA4 A;  2XIC A;  1VQ6 T;  4C0G A;  3CCV T;  5GMK j;  3JCM X;  4M77 A;  4M7D A;  4R56 A;  3URG A;  2RJC A;  1UB4 A;  3S3N A;  2E10 A;  2F5K A;  1R8O B;  1NZ9 A;  5LJ5 h;  4PJO C;  3TRE A;  4KBM B;  1VQK T;  5FRM A;  1KQS A;  1UGQ B;  5GAM j;  4OF1 A;  5GAN e;  2F69 A;  3J80 E;  3OYL A;  2GF7 A;  2EKO A;  2RB6 A;  3FB9 A;  3OYC A;  2QEX A;  4NS5 A;  1K73 C;  2AHJ B;  2L5Q A;  5CCA A;  3C12 A;  4QQD A;  4Z02 A;  1X01 A;  5CKF A;  2K5I A;  2DXC A;  4NOY A;  2ZPG B;  3G6E T;  2M1H A;  2HQE A;  4FU6 A;  4OVA A;  2YLC A;  5GAO l;  1VQ5 A;  4C0Z A;  3QII A;  4KT0 E;  4EMK A;  3CCS T;  3OYN A;  3CCR A;  2QQS A;  3H8Z A;  3OS0 A;  3C95 A;  3CMA A;  1KC8 U;  2CS7 A;  2EJF A;  1YIT T;  1M9S A;  1H3Z A;  2PUK B;  3M58 A;  3OS5 A;  4BY6 B;  4ZN3 A;  2XK0 A;  3OS1 A;  3DLM A;  2RD1 A;  2WSF E;  3LWI A;  4C8Q D;  3G4S T;  1UGS B;  3RMS A;  1M4Z A;  4J6X A;  1D3B B;  2CGH A;  3A8O B;  5A0L A;  2RI5 A;  4M75 D;  4ZTJ A;  2L8D A;  3CCJ A;  1Y71 A;  2JTM A;  5LJ3 d;  2KK4 A;  3OYI A;  3CCM T;  5CKB A;  1N6A A;  1VQP T;  1VQL T;  2HAX A;  1N9S A;  4O6J A;  4M7D B;  3MP1 A;  4QQ6 A;  3CPW S;  3P8D A;  4C92 E;  5A0G A;  3OMG A;  4XTZ A;  1VQ6 A;  3HSB A;  3OSV A;  4LDY A;  2LVM A;  3JCM W;  1KQ1 A;  3GNG A;  3GLX A;  4FT4 A;  2K4Y A;  2DK3 A;  4A4F A;  3QZ9 B;  4FM4 B;  5GAO n;  2RJD A;  1B34 A;  2LTO A;  3ZBD A;  1O9S A;  3ASK A;  3QZ5 B;  1JBM A;  4C0D B;  3QYG B;  2ZPF B;  2DXT A;  3O8V A;  3ME9 A;  3T9N A;  3HRS A;  2KDS A;  3OYF A;  4E7J A;  2LQK A;  2DO3 A;  3SD4 A;  4C5G A;  1W4S A;  5GAN g;  3L2R A;  5CQY A;  3V8K A;  2LC4 A;  2QQ9 A;  4ZGE B;  1WJQ A;  3OBW A;  4C92 G;  5HY6 A;  4EMK B;  3M54 A;  2DKG A;  1N8R C;  1VQN T;  1G5V A;  1WJS A;  4M7A D;  1OI1 A;  3CPW A;  3OQ5 A;  4GY5 A;  1N27 A;  3SFM A;  2VGN A;  3BDL A;  1LOJ A;  2L3R A;  2QTX A;  5LJ3 h;  4A4E A;  4M75 A;  4JRI A;  3CCS A;  3CCL T;  5J39 A;  2DPP B;  1YJN A;  3VJP A;  3GIB A;  3JRZ A;  2ZPI B;  1QVG S;  1JB0 E;  4XK8 E;  5FRN A;  3HP9 A;  5HK3 A;  2DEQ A;  4ME7 A;  4C0D C;  2I2L A;  3JCM e;  3OSS C;  3CCE A;  4JJN K;  1BI2 A;  2EQU A;  2KMT A;  1LNX A;  3G4S A;  3JCM Q;  4X9C A;  4HT8 A;  1BIA A;  3QYH B;  2QI2 A;  3TEE A;  5A2Q E;  3QBY A;  2PVD B;  2R57 A;  1U1T A;  3JB9 G;  3NTK A;  3GPL A;  4L59 A;  2LDM A;  5GAO p;  1K8A C;  4M78 F;  4C8Q F;  3EFR A;  2FHD A;  4ZN1 A;  5GAM d;  4F7U A;  1O75 A;  2V8K A;  3CCQ A;  4M77 D;  3LH0 A;  4XAX B;  2CZ0 B;  4RKU E;  3ZEH A;  4PJO E;  3CC7 A;  2CZ7 B;  5DLQ E;  4C5E A;  1B34 B;  4EMG A;  3N5B B;  1Q81 U;  4E7H A;  2V8I A;  3CC2 T;  1NE8 A;  2VC8 A;  3CC4 A;  1Y7X A;  2YHT A;  4J6Y A;  3E9G A;  3J7A F;  5EG2 A;  2RHU A;  2KVQ G;  1KHI A;  3QO3 A;  2FB7 A;  4RG8 A;  3HRT A;  2RK2 A;  1YIJ A;  1FWZ A;  5GAN 7;  4EPC A;  4C8Q B;  3CME T;  1VQ9 T;  2E41 A;  5GMK h;  4ATO A;  2P0P A;  5I21 A;  1Q82 C;  3QSU A;  3MEU A;  2IVW A;  2P0Q A;  3CBP A;  3L1A A;  4M78 G;  3SWN A;  4BD3 A;  3VYG A;  1I8F A;  4M75 B;  4C8Q G;  3INZ A;  5FU6 B;  3JB9 I;  1YJ9 A;  3A5Z B;  5KCO A;  1K9M C;  2LQ8 A;  3OYG A;  1XQH A;  4MMK A;  4FSX A;  3OYY A;  1H64 1;  5GAM h;  4DA4 A;  1QW1 A;  3C94 A;  2D0Q B;  5LJ5 e;  2RO0 A;  2E70 A;  4M7A F;  2EJ9 A;  3CD6 T;  5D6W A;  5GAN 5;  5GMK m;  1W2B S;  3OW2 S;  2O4X A;  1WJR A;  2DD5 A;  1I4K 1;  3Q1J A;  2MAM A;  4KUL A;  2RM4 A;  5GAN j;  4L6V 5;  3JCM g;  1AHJ B;  1WNL A;  2OAU A;  2MI6 A;  4M78 C;  4C8Q C;  4F7U B;  1VQ7 T;  2RA2 A;  2BKD N;  4OP0 A;  2XDD A;  1HK9 A;  3I55 T;  3L2V A;  1W2B A;  3OW2 A;  2LX9 A;  4BE0 A;  2FYK A;  2DTO A;  1YBY A;  2HQX A;  1V29 B;  2WSC E;  3CBO A;  5GAN 6;  2XDB A;  3NFC A;  4XU2 A;  4JDS A;  4PLL A;  4HCB A;  3FLG A;  4JUV A;  4M7A B;  4C5I A;  2JTF A;  3I56 T;  2DTH A;  2PU9 B;  3NTH A;  1IZ6 A;  1G3Y A;  1M5Q 1;  3QXE B;  3CEY A;  5IT9 E;  4FIB A;  2Y4Y A;  4M7A G;  1QP2 A;  5FU7 B;  4ELY C;  1VQM A;  3CC2 A;  3DKM A;  4QVD A;  3BDU A;  4O5V A;  4M77 F;  2PUO B;  4M7D F;  3RIR A;  3M57 A;  5IAY A;  4DQ2 A;  4RG2 A;  3QJ6 A;  4E7I A;  1Q7Y C;  2RHZ A;  4N0A C;  1MHN A;  4GLK A;  3SWN B;  3CCU A;  5LJ5 f;  4XTW A;  1YHQ T;  2ZZD A;  3WXM B;  2IG0 A;  2MWO A;  4KUI A;  4E7L A;  1VQ9 A;  4HCZ A;  4V2S A;  4PL6 A;  3RES A;  5GAO m;  2M16 A;  3RKX A;  2VV5 A;  4FT2 A;  2L89 A;  3SDZ A;  4CRI A;  4C92 A;  1IRE B;  3F70 A;  3QDR B;  4JLI A;  2HD0 A;  1XOV A;  4N4I A;  4NL2 A;  3JB9 J;  4X9D A;  5I2S A;  4M7A C;  2O4X B;  4LD9 K;  3EFS A;  2K5F A;  4M77 B;  4TVR A;  1Y07 A;  2JOY A;  5GMK i;  5LJ5 g;  4XTX A;  4Q5W A;  2DVE A;  2NLU A;  5FU7 C;  2WAC A;  2LT1 A;  3M59 A;  3KXT A;  3QUI A;  5GAO r;  1YCY A;  4M7D G;  4E47 A;  2JVV A;  4D6W A;  3CCV A;  3PIO A;  2LCC A;  3X24 B;  3JCM b;  3LGF A;  4WF2 A;  4PJO D;  1X6O A;  3SWN C;  3FC3 A;  4BY6 C;  1BIB A;  3OYH A;  5CKD A;  5FRO A;  2X4X A;  1VQK A;  2DZ9 A;  4IUQ A;  2DIG A;  2E1H A;  3WVE B;  4JS5 A;  1M90 U;  3OBY A;  4IUR A;  1VQ8 T;  2YRV A;  2K3Y A;  3S3O A;  1K9M U;  5CKH A;  3JCM c;  2XG8 D;  3MCA B;  3MEA A;  2VXF A;  3PT9 A;  4J5Y A;  1WQ7 A;  5M9O A;  1JJ2 S;  3G71 T;  4M77 C;  3A8M B;  3G6E A;  2EQJ A;  2EYQ A;  4XTV A;  4M7D C;  1SSF A;  3DLL A;  1Q86 C;  2QXF A;  3PTA A;  3DB4 A;  4XTY A;  3X20 B;  2GFU A;  1RL2 A;  2YLB A;  1VUB A;  4LDV A;  5CQX A;  5J3B A;  3MEW A;  4N4G A;  2JN0 A;  3GP8 A;  1YIT A;  4J7F A;  2ZPH B;  4OB3 B;  2O01 E;  4B9X A;  5DLO A;  1JJ2 A;  3BW1 A;  3PIP A;  3TU4 K;  3LLR A;  1HXD A;  4OMF B;  3G7Z A;  4LD6 A;  3JCM d;  3FRN A;  3FEO A;  3HRU A;  4E7K A;  4PJO A;  4YTL A;  1K73 U;  3QKJ A;  3M55 A;  3VV0 A;  2OTJ T;  4EMK C;  5D6Y A;  1XTD A;  2DD4 A;  3J81 E;  3CCM A;  1NPR A;  1VQP A;  1VQL A;  2RH2 A;  2PQW A;  1NPP A;  5KCH A;  5LJ3 f;  2C06 A;  2EAY A;  4M75 F;  1M90 C;  2Y4X A;  3VKI A;  2QA4 T;  1I81 A;  2MF2 A;  3PGG A;  4M78 E;  4C8Q E;  4DOW A;  4J6W A;  3X28 B;  4IKF A;  2BIV A;  5HKC A;  1ZQ1 A;  1KC8 C;  3UT1 A;  4RCB A;  2RJE A;  2K5L A;  3OYB A;  4OB0 B;  3PNW C;  4B9W A;  1NJI C;  3M9Q A;  3LWH A;  3A8L B;  2QDY B;  4PJO F;  3UDC A;  3OYD A;  2E5Q A;  2LNV A;  3HL8 A;  3JCM h;  2P4T A;  4L5G A;  5I2M A;  3WVD B;  4PNO A;  4F7U F;  1YIJ T;  4CI0 C;  1VQN A;  2VUB A;  4R55 A;  1BI0 A;  4M75 G;  3G71 A;  2DXU A;  2EQK A;  5CIU A;  3X26 B;  4A54 A;  1KQ2 A;  1JRI A;  3LYI A;  3MO8 A;  3OB9 A;  2EWN A;  1G3W A;  4C0F A;  2V8J A;  2ZGW A;  3DB3 A;  3MP6 A;  3CXC S;  3CCL A;  1BYM A;  2CKK A;  1QVP A;  2F5T X;  1QVF A;  4EMH A;  2K57 A;  2XHC A;  1GXI E;  4HA8 A;  3SB2 A;  5GAN 8;  2GFA A;  4ELZ C;  4PJO B;  2BUD A;  3QJY A;  4C92 D;  2D6F A;  4M7A E;  4XU1 A;  3RUX A;  1BKB A;  2LCL A;  4IUT A;  5IN1 A;  4JS4 A;  3MEV A;  4MZP A;  4QVC A;  2KQW A;  5GAO q;  1EIF A;  3CXC A;  4OGC A;  2B8A A;  1UGR B;  4X34 A;  4JRK A;  4Y91 A;  5C0M A;  3CCJ T;  4F7U G;  4MZT A;  1U1S A;  2CZ1 B;  5GAN d;  2M9U A;  1KD1 U;  1XNI A;  4M75 C;  3VYH B;  5FU6 C;  1N8R U;  2RK1 A;  4LDX A;  5DY9 A;  1M1K C;  3VUB A;  5GAM f;  4IUP A;  3OYM A;  3GNF B;  4XTU A;  1Q86 U;  3KUF A;  2R5A A;  1KG1 A;  1X75 C;  3M53 A;  4J7I A;  2OTL T;  1U8R A;  4MDX A;  4MML A;  2P0K A;  2VGM A;  3QHS A;  4DOV A;  1TH7 A;  3FJP A;  2MMP A;  3VUZ A;  3OS2 A;  4KUD K;  2EIF A;  3FDR A;  3VU3 C;  4P5N A;  4JRP A;  3JB9 D;  4HCC A;  3FIF A;  3L2U A;  3JCM P;  1BI3 A;  2FL7 A;  1UEB A;  2X4J A;  4M77 E;  2JNG A;  3JCM V;  5GAM g;  4M7D E;  3CME A;  2PVG B;  2GCX A;  5FLX E;  1MGQ A;  2HBP A;  2K2V A;  3KBG A;  1K8A U;  1OZ2 A;  3OY9 A;  2KSS A;  1P92 A;  2X35 A;  5CK9 A;  1VQ4 T;  4A4K A;  4QW2 A;  2A3L A;  2DAQ A;  4LDW A;  5GAN h;  3OYK A;  1Q81 C;  5KE3 A;  2WSE E;  5LJ5 j;  3L2Q A;  3QG1 A;  3A8G B;  3CPF A;  1WPY A;  4BDZ A;  3LW5 E;  4C5H A;  1I5L A;  3RKY A;  2G3R A;  3NTI A;  1YJN T;  2JZ2 A;  4OB1 B;  3MP8 A;  1DJ7 B;  4M77 G;  3CBM A;  4ZTF A;  3CD6 A;  2FVU A;  2RJF A;  5CR2 A;  3EAE A;  4MDW A;  3V8L A;  3CCE T;  4M78 D;  3TCJ A;  4BUG A;  3PMI A;  3L2Z A;  1NJI U;  2ZCF B;  3M4G A;  4Y28 E;  3V7C A;  3OYE A;  4BDY A;  3M56 A;  1M8V A;  1VQ7 A;  2KAF A;  5LJ3 e;  1Q82 U;  1KD1 C;  3I55 A;  4NL3 A;  2HNI A;  4C92 F;  3OYJ A;  3S3M A;  3CCQ T;  4FL6 A;  4PKC C;  4A53 A;  2GQV A;  5DM7 R;  2RHY A;  5GAN f;  2M0O A;  2XKO C;  3ZFJ A;  4XQ3 A;  3CC7 T;  4VUB A;  3I56 A;  3V8J A;  3PFS A;  2RI3 A;  3CC4 T;  3GOX A;  5AYF A;  3BY7 A;  4XU3 A;  1BI1 A;  2DIQ A;  3C4S A;  3HFO A;  4RMO A;  2OTL A;  2XDP A;  2DZC A;  2VYT A;  1VIE A;  2RI2 A;  1WGS A;  4PLI A;  1S72 T;  1RI0 A;  2E12 A;  2MWP A;  3GF5 A;  3RKW A;  1M1F A;  1FX7 A;  2D9T A;  3S6W A;  2LT4 A;  3MHX A;  4BI8 B;  4BE2 A;  4HKE A;  3JCM J;  2H3J A;  4C92 B;  3HKS A;  1YHQ A;  2EFI A;  4BI3 A;  3MET A;  1G3T A;  2PVO B;  2VXE A;  3JB9 F;  1YI2 T;  1YJ9 T;  4J8O A;  2DXB A;  4M78 A;  2KY9 A;  4C8Q A;  3BFM A;  4BAC A;  4EDU A;  3OA6 A;  1VQ4 A;  1YJW T;  3JB9 H;  2CZ6 B;  3LGL A;  1M1K U;  1ZBX A;  4OGE A;  3ER0 A;  3OMC A;  4RCC A;  3A8H B;  5L8R E;  4QVZ A;  3UWN A;  3V7S A;  1Y96 A;  2CYZ B;  5C6S A;  5HK0 A;  1VQO T;  1WQW A;  3V7R A;  1OYX A;  3H6Z A;  5GAN 3;  2XI9 A;  1ZHI A;  3JSC A;  5LL6 S;  4A4G A;  3P8H A;  2A7Y A;  2RHI A;  5GMK e;  3E19 A;  4JLG A;  4ZGJ B;  4M75 E;  4BE1 A;  1PSF A;  2EJG A;  2EQM A;  2R58 A;  4J83 A;  4UC4 A;  2R5M A;  1G3S A;  4LDU A;  3R6O A;  3L2W A;  1Q7Y U;  2E6Z A;  4C92 C;  2QQA A;  4IUU A;  5LJ3 j;  1PSE A;  2XU8 A;  2E65 A;  4IUV A;  4N0A A;  5LJ3 g;  2QQR A;  5GAM e;  3HPW A;  3P8B B;  5KH6 A;  1VIF A;  2E6N A;  2QEX T;  1QVG A;  4HT9 A;  1N9R A;  2DJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...