2JM9A

R21a spc-sh3 bound
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
source organism Gallus gallus
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jm9A00
2DVJA 1M30A 2L3QA 1OPKA 1PRMC 2DL8A 3SHWA 2FG0A 2KRSA 3I5SA 2KXCA 1UFFA 4A63B 1S1NA 1WYXA 2BZ8A 1UGVA 1WI7A 3H0IA 2LP5A 2O9SA 1JQQA 1SSHA 3JV3A 1N5ZA 2OI3A 3IQLA 3NPFA 3EG0A 1JXOA 2DM1A 2J6KA 2KT1A 1TG0A 5FWBA 2H8HA 1M3BA 1YWPA 2LCSA 2J06A 1ABOA 1WXBA 2DILA 3PE0A 5FW9A 2EYXA 2KEAA 1H92A 2KYBA 4ORZA 2LX7A 2DRKA 2VKNA 5GJVB 4GLMA 1ABQA 2DNUA 4EIKA 1X6GA 4F17A 2KBTA 3M0TA 4ZNXA 2HDAA 1G2BA 3SEMA 1YN8A 1T3LA 2RMOA 2YUPA 4F14A 1YWOA 3UA6A 1WFWA 1NM7A 2EBPA 1KSWA 1JO8A 1UTIA 2A28A 3TSWA 1E7OA 2DMOA 4RTTA 1AZEA 5HCKA 1QWFA 4CC3A 3VS4A 3PVLA 2SRCA 2D8HA 4IIMA 2KYMA 1JEGA 1Y0MA 3C0CA 5L23A 2K7AA 1X69A 2DL4A 1JU5C 2EYYA 2AZVA 2GNCA 2JT4A 2GGRA 2DL7A 4OMMA 2D1XA 4OMPA 2LJ3A 4J9HA 2DJQA 1ZBJA 1WLPB 4J9FA 2LQNA 2KE9A 1UECA 1VYTA 4HVWA 1PRLC 1X2QA 2DBKA 1K9AA 2JTEA 1MV3A 2AKLA 2RQVA 1YP5A 2CT4A 2YDLA 5IHKA 1ZUUA 2KROA 4AFQC 2K6DA 1RLPC 3NMZC 4CC4B 2DLPA 1PNJA 2FRWA 4JJBA 1B07A 2EYZA 3QWXX 2DA9A 2FPDA 2PNIA 2IIMA 4M4ZA 2JM8A 2W10A 1KFZA 1W70A 1ZX6A 2JM9A 2RQUA 4K11A 2LJ0A 1X6BA 3EG1A 1YCSB 1BBZA 2ROLA 2HBWA 3REBB 3H41A 1X2KA 2L0AA 1WDXA 2L2PA 2LJ1A 5GJWB 1HD3A 1G83A 2LZ6B 1OV3A 2L3SA 5I11A 1CSKA 5ECAA 3ZL7C 2JMCA 2FPFA 4FSSA 2HEQA 3U23A 1HSQA 1UHFA 2EGCA 1QKXA 2DX1A 1WXTA 1AVZC 2EQIA 2BZXA 3VS2A 4JZ3A 2MIOA 3M0UA 1VA7A 3EGUA 3EHRA 4J9BA 1GL5A 2MCNA 1M3CA 3EG3A 2AKKA 1W6XA 2V1RA 1QLYA 1NLPC 1QWEA 4D8KA 1MUZA 3NGPA 1AWWA 3I35A 4OMLA 4J9EA 1VYVA 2CDTA 4OMQA 2OAWA 3PVQA 4AFUC 2CUBA 2KRMA 1OPLA 4LNPA 1H3HA 2YUQA 1GRIA 1BB9A 1Y57A 2X3WD 2QDLA 2K3BA 4X1VA 2J6FA 2GQIA 4RTVA 1M8MA 3VS3A 3KFVA 2AZSA 1UHCA 2W0ZA 1RI9A 2ROTA 1YNZA 2YT6A 4J9DA 4IIOA 2EKHA 2LQWA 1A0NB 4J9CA 1NYFA 1PHTA 3UF4A 1M27C 2CSQA 2ENMA 2GTOA 1VYUA 3M0PA 4F16A 1QCFA 3M0QA 1ZLMA 1FMKA 3VS7A 2DYBA 2DL5A 1M3AA 2E5KA 3H0HA 2EYWA 1GCQC 2K2MA 1V1CA 3H0FA 2RQRA 3TVTA 1AOJA 1J3TA 1W1FA 1AZGB 1I07A 2D0NA 3UA7A 5FWCA 1WA7A 1I0CA 2G6FX 3VS0A 4LN2A 1UJ0A 5IXFA 2P4RA 1Z9QA 2AK5A 2D8JA 1TUCA 1WX6A 3I5RA 4J9GA 5IXBA 1HJDA 1T0HA 1LCKA 2X3XD 3LH5A 1E6GA 2ABLA 2BTTA 2PZ1A 3O5ZA 2CH4A 4RTXA 2FPEA 2C0TA 3RNJA 2EPDA 1NYGA 2RNAA 2J6OA 1ZUKA 3I9QA 1U3OA 2KXDA 3VS6A 3ULRB 2GBQA 4AG1C 4J9IA 1T0JA 1UUEA 1U5SA 1GCPA 2FO0A 2RF0A 2M0YA 1E6HA 2M51A 2MOXA 4CC2A 2F2WA 3THKA 1SHGA 3VRYA 2VWFA 1UE9A 1CKAA 1ZUYA 2I0NA 2RQTA 2LNHB 4OMNA 4OMOA 4E6RA 5IHIA 4ESRA 2XMFA 2NWMA 1U06A 4D8DA 1KJWA 2V1QA 1AWXA 4JJCA 4RTWA 2DRMA 1WXUA 2BZYA 1FYNA 2NUZA 1TUDA 1I1JA 1GBQA 1AWJA 1GCQA 2FRYA 2KT8A 2PTKA 2F2XA 1JXMA 4QT7A 2KR3A 2EGEA 2J7IA 2EVRA 2C0OA 2ESWA 1AEYA 4Y92A 1UG1A 5IHNA 2KNBB 2OJ2A 1ZSGA 2DBMA 1K4US 4RTUA 2A08A 1RUWA 1AD5A 2C0IA 3VRZA 1QKWA 2K79A 2KGTA 2RQWA 4WCIA 2RPNA 3FJ5A 1MV0B 2CUDA 3R6NA 4JPBW 4LUEA 1CKBA 2HSPA 1K0SA 4DEYA 4HVVA 1GFDA 4JZ4A 3EG2A 1NLOC 1PKTA 1T3SA 4Z89A 5IH2A 2CREA 1OOTA 1PWTA 1B3QA 2KRNA 2FEIA 2HCKA 2CT3A 4Z88A 3QWYA 4HXJA 2LMJA 2O88A 1AWOA 3RBBB 2VVKA 2L3PA 3M0SA 1ARKA 1WIEA 2A37A 3EHQA 1SRMA 1RLQC 4DEXA 1K0XA 1OEBA 1SEMA 2J05A 1UDLA 2DF6A 1BU1A 4GBQA 2F2VA 2YSQA 2O2OA 1GFCA 1PKSA 2RN8A 3A98A 2JMAA 2ED1A 1EFNA 1NEBA 1BK2A 2CH4W 4LE9A 4R0KA 2ECZA 1UJYA 2GTJA 1Z9ZA 2ED0A 1X43A 1X27A 2A36A 3CQTA 2B86A 2JXBA 2SEMA 2JS2A 4Z8AA 3REAB 1H8KA 3VS1A 4HCKA 4LUDA 1SHFA 1GBRA 5I22A 5EC7A 4RTZA 3TSZA 2CSIA 4AFZC 3GBQA 4JJDA 4RUGA 2JW4A 2EW3A 2DE0X 1IO6A 4KRTA 2EGAA 1XOVA 2O9VA 1K1ZA 3M0RA 1SRLA 2YUOA 1KIKA 1K76A 2DL3A 2K9GA 2JS0A 2YUNA 3NHNA 4AFSC 3UATA 4CC7A 4RTYA 1NEGA 2O31A 1SPKA 1NG2A 3VS5A 4HVUA 4AG2C
chains in the Genus database with same CATH superfamily
2DVJA 2DL8A 1YJ9Q 3UWNA 1ZBXA 2X4JA 1S1NA 1FMVA 1WYXA 1LPLA 3OYYA 1GXIE 2F5TX 4QQDA 1G5VA 4KULA 3QZ5B 1RADB 1RL2A 2PVDB 4A4GA 1JQQA 1G3TA 3IQLA 3EG0A 2HQEA 2DM1A 1TG0A 4A53A 2WSCE 1WNLA 4MMLA 5HKCA 4YTLA 1OU9A 2DILA 2RI3A 3PE0A 2EYXA 2KEAA 1H92A 2KSSA 3E1SA 4MDXA 2DNUA 2KBTA 3JCMf 2C06A 4ZNXA 3TCJA 2HDAA 1SF9A 1G2BA 1F1BB 3SEMA 1KC8C 1YN8A 4F14A 3DLMA 2WACA 4M78G 4PJLA 4QKUA 2A28A 2KAFA 3G6EQ 1E7OA 2DMOA 2DXCA 4NS5A 5HCKA 5KH6A 1AZEA 2FYKA 3CEYA 2PU9B 2XHCA 2SRCA 2KYMA 1K9MU 1Y0MA 5GAOq 5KYWB 2QA4A 1X69A 2CYZB 4VUBA 2AZVA 4WF2A 1D0YA 3Q1JA 4JRQA 2GGRA 4M78A 5GAOr 1IHWA 3CD6A 1I8FA 5LJ3j 4J9HA 2DJQA 4N0AC 5HK3A 3M4YA 1BIAA 2CZ7B 1PRLC 5EG2A 2M02A 2KMTA 4PJMA 2AKLA 2DFUA 2QEXQ 1TWBA 1PNJA 3OW2S 4C8QD 3OYAA 5GANg 4M7DG 1SKUB 3LWIA 2RHYA 1H641 3MHXA 3G71Q 1NPRA 2E3IA 2LQKA 4M4ZA 2EYQA 5KYYA 1KFZA 1PD0A 2VYTA 5GANj 1ZA2B 2JM9A 4FSXA 2LJ0A 4K11A 3G4SA 3CCVQ 3REBB 1MMDA 5GAMg 4RCCA 1Y07A 1WGSA 5HY6A 1BCMA 2HKNA 1NPPA 1OV3A 3RIRA 1QVGS 2L3SA 5CAIA 4GLKA 1Q7YC 4M7DA 2FPFA 4FSSA 4M7AG 1FX7A 3U23A 1M90U 1VQ5A 3TREA 4M77F 1AVZC 2EQIA 3VS2A 4ZN3A 3QYHB 1MNEA 2K5IA 2AKKA 3NTKA 2CGHA 4D8KA 2GQVA 3CCUT 3NGPA 4OMLA 2R5AA 3G1JA 3QBYA 4OMQA 4C8QB 2F69A 1QP3A 2VUBA 1RACB 2OTLA 3BW1A 2CUBA 4F7UF 4C8QC 1KK7A 5KYXB 3MO8A 3JCMX 3A8GB 3OB9A 1BB9A 4BI4A 2K3BA 4X1VA 2J6FA 4FT4A 4RTVA 4ELYC 4QVZA 1UHCA 1VQ4A 4KBMB 1FWZA 3NTHA 2YT6A 1JBMA 1A0NB 2LCCA 4C5HA 2O4XB 1X01A 1ZLMA 2DETA 2Y90A 1OQKA 1KC8R 1TXQA 3BFMA 2XKOC 1YHQT 2X35A 2EYWA 1TTHB 2MAMA 1VQKT 3I55T 1J3TA 3TVTA 1UEBA 1W1FA 1Q82U 4HT9A 2D0NA 2RK1A 3JRZA 4E2FB 1WA7A 3LX7A 2VV5A 4BD3A 1KQSS 2DPPB 3VS0A 4LN2A 5IXFA 1JJ2S 2PVGB 2P4RA 2VC8A 2AK5A 1TUCA 1C1AA 1Y71A 3M53A 5IXBA 1XQHA 3VU3C 2ABLA 4ANJA 4FT2A 2CH4A 4RTXA 2IPOB 3OS2A 2XICA 2QA4Q 5GAN3 3JB9D 3KXTA 1U3OA 3VS6A 4HCCA 3AT1B 3ZEHA 5KYNA 1PM3A 1VIEA 3EAEA 2NUPA 3OYLA 4XTYA 2VGNA 3HRSA 1UGSB 3VRYA 2Y4YA 1UE9A 1V76A 4MZMA 1ZUYA 5CK9A 3S3OA 2XIDA 1KG1A 2E41A 2MI6A 2HBPA 1KJWA 4ZTFA 3EFSA 2QASA 4A4EA 5KYWA 4LD9K 2NUZA 1M1FA 2P0PA 2PVOB 1GCQA 4DBFA 1RAFB 1I5OB 2KT8A 2F2XA 4ZTJA 2V8JA 3MEWA 3EGXB 3G4SQ 1BYMA 2EGEA 3JCMh 4E7JA 2EVRA 1M8VA 2DXBA 2ESWA 3CCJA 1Q7YR 2PUOB 1VQ6Q 1VQLA 4Y92A 3X20B 1SSFA 2DBMA 1WHHA 2HL5C 4RG8A 2RQWA 1VQ5Q 2EQUA 4NOYA 3FJ5A 3CC2T 1CKBA 4EPCA 4BDYA 4HVVA 3QHSA 4PJOB 1NLOC 3GP8A 1T3SA 1WQWA 1K9MC 3QG1A 4PJOC 4J83A 1IGUA 1N8RC 2L8DA 2M1HA 2KRNA 4Z88A 1PCXA 3QWYA 4C8QG 2VVKA 3P8HA 1VOMA 3EHQA 1RLQC 4N4HA 1K0XA 1VQ4Q 3NTIA 3V7CA 2E5QA 2J05A 1UDLA 4C5GA 3A98A 1EFNA 2FZCB 1UJYA 4RCBA 2DIGA 2GTJA 4C0FA 1X43A 2L3RA 4CRIA 5LJ5h 4C8QA 3OMCA 1YJ9A 2K5LA 2MPXC 2JS2A 2NLUA 3REAB 3JCMJ 2RD1A 4HCKA 3JCMc 4C5EA 5EC7A 2E70A 5KYXA 4RUGA 4OVAA 1UGPB 2DXUA 5DY9A 2RHXA 3FDRA 2HQHA 2ZPFB 5CR2A 3JSCA 1K8AR 5GMKl 3A8MB 5GAOl 4BI8B 2O9VA 3JB9J 2RH2A 1MMAA 2YUOA 1KIKA 3HRTA 3MEVA 2DL3A 2K9GA 3NHNA 4CC7A 1IZ6A 1QP2A 4HCBA 3FJPA 3JCMP 4LXCA 3O8VA 3LGLA 3JAME 2K57A 1M30A 3GLXA 2EQMA 1PRMC 3SHWA 2O4XA 2DVEA 2QQBA 5GAOn 2JVVA 2COWA 2HZYA 4IUQA 2EKOA 4A63B 3OYHA 3G7ZA 1I4K1 4M78C 4M78E 2D6FA 1Q81U 2O01E 2O9SA 3CBMA 3CD6T 3NPFA 3G6EA 1JXOA 4DA4A 2E12A 2KDSA 5D6XA 3EH2A 1Q86U 2J06A 1RAIB 1ABOA 1WXBA 2E6NA 3EFOB 2RJFA 4ORZA 2M0OA 2LX7A 5LJ3f 1MMNA 1X6GA 4F17A 1YI2A 3QZ9B 1X6OA 2P4TA 3L2ZA 3V8JA 4QW2A 4BB7A 1TUGB 2YUPA 4PLLA 1WJQA 3TQ7P 2GFUA 3CCET 3ZBDA 4M77D 4PFZA 3CCJQ 5AT1B 2CS7A 3GF5A 1WFWA 1VQLQ 1NM7A 2H3JA 3JCMV 1Y7XA 1QWFA 5FRMA 4A4KA 4B6MA 3CCLQ 4M7DE 1M1KR 2QEXA 4JS4A 3JB9G 3PVLA 2D8HA 1TH7A 2DTIA 1JEGA 3HFNA 5GANf 3GPLA 4OGCA 2K7AA 3JCMe 1NJIC 2DL4A 3CC4Q 4FYWB 3QDRB 1VQ5T 2YLBA 2JN0A 3RKYA 3L1AA 1K73R 2LT4A 3EGXA 2LJ3A 3OY9A 1ZBJA 1N27A 1N8RR 2LCLA 2PQWA 3E9FA 4KH0B 2YXYA 1G3SA 1UECA 2FZGB 1X2QA 4PJOG 1MV3A 1VQOQ 3GOXA 1YP5A 2CT4A 2YDLA 5IHKA 3CCMA 2OTLT 3A8OB 3CCQA 4IUTA 4AFQC 3SDZA 2FRWA 4X34A 3V7SA 1B07A 1LJOA 4WTOB 3QWXX 5CIUA 5CKDA 1VQ7A 2XI9A 2DEUA 2HL3A 8AT1B 1M2OA 1YIJA 2JM8A 2R58A 3H9NA 3EG1A 4L6V5 4N4GA 1HXDA 4PJOA 1VQ8Q 3ZFJA 2EJGA 3H41A 2HAXA 2L2PA 2D9TA 3M58A 1HD3A 1G83A 3MEAA 4KUIA 1S72Q 4M75B 3M57A 2BIVA 3BDUA 3FIFA 4DOVA 5I11A 2CP3A 4JLIA 2ZZDA 4M75C 4E47A 4Q5WA 3HPWA 2COZA 4XTVA 1HSQA 1QKXA 3L42A 4JZ3A 2A7YA 3EGUA 1VQNA 2F1LA 1GL5A 2MCNA 5LJ5e 2RA2A 5FU6B 1QLYA 4E7KA 2CKKA 3P8DA 1MUZA 4HA8A 3OYIA 3C95A 5FU6C 2QGGA 4GY5A 3I35A 1VYVA 3JB9I 2WSEE 3GNFB 3MP8A 4KGVB 4DBRA 1H3HA 1KD1R 4DOWA 1BI3A 5I21A 2RHIA 3HL8A 2BE9B 2EJ9A 2NUPB 2GFAA 2GQIA 2AT1B 2QQSA 3KFVA 4C92D 5CKBA 2W0ZA 2F5KA 3X26B 1QVFP 1IHVA 3AHUA 4J6WA 2RHZA 2MYSA 5HK0A 1BKBA 4F16A 5GMKi 1QCNA 1FMKA 2K3YA 2DZ9A 1YI2Q 2EFIA 1M3AA 5D6YA 1RAHB 5KCHA 1VQMA 1GCQC 4OP0A 4ZGEB 3FC3A 2DD4A 3FRNA 2EIFA 2Z0WA 4EDUA 3A5ZB 1FXXA 5A2QE 1YJWT 3QJYA 3EGDB 3EFRA 1VQLT 2MK5A 1HJDA 1T0HA 3UDCA 3M5AA 4OB1B 4C92B 2PZ1A 1NJIR 3TU4K 2K5FA 3EFOA 3RNJA 5LJ5d 1B34B 3A1PA 3CMEA 4C92C 3SD4A 1ZUKA 3JCMQ 2LQ8A 2P84A 3I9QA 3QKJA 3QUIA 4AG1C 4AMCA 3OYCA 1T0JA 2ZPBB 4M7DF 1OI1A 1R8OB 1U5SA 2CP2A 2RF0A 2E3HA 4J7FA 2M51A 2MOXA 3RERA 3C12A 2F2WA 3THKA 2VXEA 2QAZA 1VQ6A 1D0XA 4XTZA 3CPWA 1YJNA 4QQ6A 5GAMj 1OZ2A 3CCMQ 1YBYA 2RQTA 3H8ZA 3CCQQ 4OMNA 1ZSZB 4E6RA 4JS5A 3C94A 2NWMA 1QVFA 7AT1B 1VQPQ 1AWXA 4RTWA 1WPYA 2DRMA 3RMQA 1FYNA 4PFOA 1VQ7Q 4M7AF 1YIJQ 1D3BA 4MZTA 1YITQ 2XDPA 1Q86C 5LJ3h 1N9SA 1RI0A 2KR3A 1QQJA 1VIFA 2WSFE 4ZGDB 4C8QE 1UG1A 2JNGA 1MMGA 3I56A 2OJ2A 4RTUA 5KCOA 1YJ9T 2M16A 3OBWA 2E65A 3VRZA 4M77A 4M75G 4WCIA 3HFOA 1VQNQ 2YRCA 2RPNA 2OTJA 2YRDA 4IUUA 3R6NA 3CCSQ 2FL7A 3M55A 5GANh 2HSPA 4DEYA 1GFDA 4X9CA 2DTHA 1FMWA 3EG2A 1ZQ1A 2LT1A 1OZ3A 4PL6A 3LYIA 2BUDA 1D0ZA 4M75A 4XU1A 2CT3A 2JJ9A 3LLRA 2O88A 2LMJA 3RBBB 1D09B 4DEXA 2FZKB 2DJZA 4XK8E 2DF6A 1U8RA 1BU1A 5I2MA 4DQ2A 3BDLA 1Q95G 4DBQA 2E1HA 2CH4W 3OYKA 2DO3A 3G6ET 4EMKB 4O6JA 3CQTA 3VUZA 3OYNA 4Z8AA 4EMKC 1VQMQ 4RTZA 2CSIA 1WJSA 1Y96B 4TVRA 2LX9A 4IUVA 3J80E 5CKFA 2EW3A 2DEQA 4C0GA 3LGFA 5GMKh 2EGAA 2CZ6B 1SRLA 5GAN5 2VXFA 2XDDA 4DBHA 2XD0A 3CPFA 3UATA 4FIBA 4LDVA 2RJCA 2ATCB 1G8XA 3S6WA 4PJJA 3EG9B 3CMEQ 1OPKA 3GNGA 2FG0A 1UGQB 2KRSA 4XAXB 2QEXT 3I5SA 5GAN8 1U1TA 4FYXB 4D6WA 4C92G 1KHCA 3E9GA 1UGVA 3BY7A 1XJWB 4FL6A 3G71T 2RO0A 1PD1A 1N5ZA 1YJNQ 2V26A 2KT1A 3CCVT 5LJ5g 2PUKB 3EGDA 1M3BA 1VQ9Q 2R57A 3CCLA 3S3MA 4UC4A 4C92A 1YCYA 3LWHA 4J8OA 2KYBA 5A0DA 5LJ5j 3LH0A 2RI5A 2DRKA 5D7UA 5GJVB 1ABQA 1B34A 3EH1A 3CCQT 4EIKA 3CC4A 3M0TA 3RMSA 1QW1A 1YWOA 3UA6A 1VQ7T 3OQ5A 3FLGA 1D1BA 2DIQA 4NL2A 2XK0A 5FRNA 1EX4A 1YIJT 2KI7A 4PJOE 2CP0A 1KSWA 5CKHA 1N9RA 1OX9A 5J3BA 3I56Q 2ZPEB 3TSWA 4RTTA 1VQOA 3CCRA 1KC8U 5KE3A 4JDSA 2DKGA 4CC3A 1R77A 3VS4A 2KVQG 3OYGA 4ZN1A 3HSBA 1ZSZA 3ME9A 5GAN4 4IIMA 4L59A 5CKEA 5LJ3e 3C0CA 5L23A 4C8QF 2OTJQ 4FW1A 2JT4A 1RAGB 1KHIA 4OMMA 3BE3A 3CBOA 1X75C 2D1XA 4PLIA 1WHMA 4LDXA 1VQNT 2DTOA 1VUBA 5I2SA 1VQ8A 4J9FA 3CCUA 4XTWA 1S72A 2KE9A 1VYTA 2LDMA 4HVWA 1K9AA 3M54A 3INZA 4KUDK 1ZUUA 1YFNA 2KROA 1RLPC 4CC4B 2DLPA 5GANe 4OB3B 2EYZA 4OB2B 2DA9A 4OMFB 2PNIA 1C6VX 2XDBA 2YWWA 1W70A 1ZX6A 1QCOA 2CP7A 1BBZA 2ROLA 2HBWA 1M90C 1WDXA 2QTVA 3ER0A 2DXTA 3CC7A 2JMCA 3WVEB 3JB9H 2XU8A 2HEQA 3E19A 2QA4T 4FYYB 2L5QA 2DX1A 1WXTA 4MZPA 5GMKm 2BZXA 2MIOA 3MEUA 4E7HA 1VQKA 1VA7A 3EHRA 4J9BA 2RI2A 1Q7YU 1M1GA 1M3CA 3EG3A 4A54A 2A0FB 1OULA 2LNVA 1NLPC 4XTXA 3MPUB 1AWWA 5LJ3d 3T9NA 2RM4A 2CDTA 3OYMA 2R5MA 1PC0A 4AFUC 4EMKA 3PIOA 3CXCP 1G3YA 2KRMA 5GMKe 2OX7A 1OPLA 4FCYA 2YUQA 1GRIA 2DD5A 1Y57A 2QI2A 1R0BG 1Y96A 2QDLA 2JTFA 1H3ZA 3SWNA 1QVPA 3CMET 3SB2A 1M8MA 3CBPA 2AZSA 3PNWC 2BKDN 4M7AD 5DLQE 3RKWA 4ZGJB 3G4ST 2ROTA 3PTAA 1RAAB 3M59A 4J9DA 4IIOA 2QK0A 4J9CA 4NL3A 2V8IA 3MP1A 3OA6A 1PHTA 1VQ6T 1M27C 2CSQA 2GTOA 4PK4A 1VYUA 2QQRA 3L2QA 1Q82C 1QCFA 3M0QA 3JCMW 3EG9A 4A4HA 3VS7A 2DYBA 1D3BB 2DL5A 4JRKA 2E5KA 4O5VA 4P5NA 3PMTA 3H0HA 1BCOA 3CXCS 1V1CA 1K9MR 3H0FA 2RQRA 1AOJA 3R6OA 5GAMf 4B9WA 1I07A 1I81A 5FWCA 2VASA 4JRPA 2LC4A 4E7ZA 3KUFA 3CCRQ 3E2UA 3RR6A 1Z9QA 2D8JA 3QDFA 1IB8A 3I5RA 4J9GA 4M77B 1LCKA 3HRUA 3LH5A 3X24B 3I56T 1VQPA 4PKCC 4C5IA 1OU8A 4PJOF 2FPEA 4M77C 4M77E 2C0TA 2CZ0B 1K8AU 5GAN2 2RNAA 2J6OA 2HQXA 1OYXA 2KXDA 2GBQA 1VQ4T 2DZCA 1YITA 4J9IA 2P0KA 2FHDA 1UUEA 2QDYB 4IURA 4XQ3A 1GCPA 2OTJT 3CXCA 4F7UB 3MJXA 4CC2A 3CCUQ 2JZ2A 1P92A 1SHGA 1KQ2A 2ZPHB 5M9OA 2VWFA 3HP9A 4M75E 1CKAA 2I0NA 2LNHB 4OMOA 4RMOA 4ESRA 4BACA 2XMFA 5CVIA 4D8DA 2V1QA 4L5GA 1WXUA 4F04B 2BZYA 1TUDA 1I1JA 2VB6A 1GBQA 4BE1A 1AHJB 1AWJA 2FRYA 2KQWA 3J7AF 3CCSA 3CMAA 2PTKA 1JXMA 1M90R 1MHNA 4BDZA 2QQAA 1IGQA 2C0OA 3WXMB 3JCMd 2QTXA 3VYGA 4QVCA 3L2VA 6AT1B 1RAEB 1TU0B 3CC7Q 3CPWP 1ZSGA 2ZGWA 2A08A 3OYBA 1AD5A 1YHQQ 3V8LA 2OAUA 2GCXA 2YHTA 2AIRB 1VQKQ 2DK3A 3I55Q 2E64A 4OGEA 2CUDA 4JPBW 2I2LA 4JLGA 4LUEA 5FROA 1LOJA 1K0SA 4BE2A 5DM7R 4M78F 4ME7A 1MGQA 4JZ4A 4XTUA 5IAYA 3OS5A 4Z89A 1M1KU 2CREA 3DB4A 1OOTA 1PWTA 2X51A 5C0MA 1B3QA 1QMCA 2FEIA 2X4YA 2M9UA 3DKMA 4J6XA 2CP6A 3OW2P 2B8AA 4HXJA 3DLLA 3M0SA 3C4SA 5C6SA 2MF2A 3CPWS 1SEMA 1K73U 4IKFA 1V29B 1R0CB 5L8RE 5LJ3g 1N8RU 4GBQA 2F2VA 3OSVA 2YSQA 2O2OA 3PT9A 2RN8A 3CCJT 1QVFS 1Q82R 1NEBA 1BK2A 1KQ1A 4LE9A 4R0KA 2K3XA 1Z9ZA 2ED0A 3GIBA 2LRQA 4IUPA 1QVGP 1ACMB 2JXBA 2SEMA 3CCLT 4C92E 1H8KA 3KBGA 3TSZA 4EMHA 3GBQA 1O9SA 2JW4A 1WZOA 2DE0X 1IO6A 3CC4T 4KRTA 4E7LA 1K1ZA 3M0RA 2HSEB 2KK4A 2YUNA 2X9HA 3CCEA 4RTYA 2X4WA 3HTRA 5LJ5f 1VQ9A 1NEGA 2O31A 4JRIA 1SPKA 3X28B 1NG2A 4AG2C 1Q81C 3M4GA 2IVWA 1ZSZC 3CCRT 2L3QA 1VQOT 1W4SA 3RUXA 4M77G 2KXCA 1UFFA 2BZ8A 3NFCA 3CC2Q 1WI7A 1UGRB 3PFSA 3H0IA 4A4FA 2LP5A 2EAYA 1SSHA 3JV3A 2OI3A 3OW2A 2K4YA 2J6KA 2EWNA 1VQ8T 1ZA1B 2H8HA 5FWBA 4F7UG 1YWPA 2LCSA 4HKEA 1S72T 1KD1U 5CCAA 2RJDA 4QVDA 3OBYA 2QXFA 5FW9A 2MMPA 4M7AA 2VKNA 4GLMA 2P0QA 3CMAQ 3FEOA 1JRIA 4HCZA 4M75F 2RMOA 1T3LA 1UB4A 1QVGA 3LW5E 1LVKA 4BUGA 1DJ7B 4FYVB 1KQSP 3OYFA 5GMKj 4F7UA 2ZCFB 3OMGA 1JJ2P 4CI0C 2EBPA 1JO8A 1UTIA 1SG5A 3QO3A 5GAMh 1HYOA 4KH1B 3D7SB 1WJRA 3HKSA 1HK9A 1M2VB 2HMAA 2RJEA 4R55A 1G3WA 2NYSA 4MDWA 3CC7T 1BI2A 1JU5C 2EYYA 3JCMg 5A0LA 2GNCA 4ELZC 4FM4B 2DL7A 4FU6A 4OMPA 4OF1A 2MWPA 1WLPB 4Y91A 5CQXA 2LQNA 8ATCB 5AYFA 1NJIU 2EQJA 1K8AC 3VUBA 2DBKA 1O75A 3L2UA 2JTEA 3SWNB 1NZ9A 2RQVA 3TEEA 3QJ6A 4PJNA 2D0QB 1C0MA 2K6DA 1YI2T 3SWNC 3NMZC 1BI0A 3F70A 4JJBA 5CQYA 2QQ9A 2FPDA 2QYZA 1TSFA 5A0GA 2IIMA 1U1SA 2W10A 4KGZB 3PIPA 2RHUA 2RQUA 3CD6Q 1X6BA 1YCSB 1X2KA 2L0AA 2HNIA 4BY6B 2LJ1A 5GJWB 3QIIA 2LZ6B 3MP6A 4BY6C 3OS0A 1CSKA 5ECAA 3VJPA 3ZL7C 4ATOA 2V8KA 4BE0A 1KQSA 2CP5A 3A8LB 3QPHA 1JJ2A 2HD0A 4V2SA 1UHFA 1M5Q1 1WHKA 1ZHIA 2EGCA 4PJOD 1TOVA 4B9XA 1B7TA 3OYEA 3M0UA 3CCEQ 4C92F 2Y4XA 1BIBA 1W6XA 3HHTB 5KE2A 2V1RA 1Q81R 1QWEA 4N0AA 3SFMA 3UPUA 4J9EA 1YJWA 2OAWA 3PVQA 4MMKA 5J39A 3CCMT 3JCMb 3A8HB 3M56A 5GAN6 1Q86R 2AHJB 2NUTB 1OX8A 4LNPA 2KY9A 4J6YA 1VQPT 2X3WD 3URGA 1WHJA 9ATCB 3VS3A 1WHLA 1YITT 1M1KC 3OYJA 1RI9A 5KYUB 1YNZA 2EKHA 2LQWA 1M4ZA 1N6AA 1WQ7A 1NYFA 2COYA 2JOYA 3V8KA 2YLCA 3UF4A 2ENMA 3VKIA 3M0PA 1K73C 4LDUA 1IRXA 4LDWA 2OTLQ 1BI1A 2E4HA 5J26A 5GAOp 2X4XA 4JUVA 4J7IA 2ZPGB 1M9SA 1PSEA 5CO7A 2JTMA 2K2MA 4OB0B 3QSUA 1I5LA 2FVUA 1AZGB 2DYIA 3CCST 3UA7A 3CMAT 4R56A 4XU0A 1I0CA 2G6FX 1IREB 2EJFA 2MWOA 2IG0A 4BI3A 1UJ0A 1JB0E 4M78D 1MNDA 3META 3RDVA 1WX6A 2QG9B 2X3XD 5IT9E 1E6GA 2BTTA 3O5ZA 2EPDA 1NYGA 4E7IA 2G3RA 3ULRB 1W2BP 4KGXB 4FW2A 5GAMe 1EIFA 2FO0A 3S3NA 2QGFB 2DAQA 2M0YA 1E6HA 2K2VA 4PNOA 1PSFA 4X9DA 4LD6A 3L2RA 5IHIA 3J81E 1YHQA 1M2VA 1U06A 5GAOm 4C0ZA 1VQMT 2LTOA 1PG5B 4JJCA 2FB7A 2JUFA 3I55A 1XNIA 4J5YA 1WHGA 1AT1B 2XG8D 4M78B 4M7DD 3MCAB 4QT7A 1KD1C 2YRVA 2J7IA 1W2BS 1AEYA 1D1AA 5IN1A 3QYGB 5IHNA 2KNBB 2RK2A 4HT8A 4EMGA 1K4US 4AT1B 1RUWA 3ASKA 2C0IA 2ZPIB 1QKWA 2K79A 2KGTA 2E6ZA 4XU3A 4Z02A 2VGMA 3WVDB 1MV0B 2CZ1B 5KYYB 5FLXE 4RKUE 4LDYA 5GANd 1YJNT 1YJWQ 1PKTA 5IH2A 3QXEB 1IXDA 4PFPA 3DB3A 1VQ9T 4KT0E 4JJNK 1W2BA 2HCKA 3P8BB 3JB9F 4M7DB 5GAMd 2H3EB 1AWOA 1XTDA 4M7DC 2L3PA 1EZZB 1ARKA 1WIEA 2A37A 1SRMA 1D1CA 1OEBA 3M9QA 4E7SA 3PMIA 4RG2A 1RABB 4C0DB 2LVMA 1NBEB 4M75D 5FU7B 1GFCA 1PKSA 3H6ZA 2GF7A 2RB6A 2JMAA 3G71A 3OS1A 3OYDA 2ED1A 4C0DC 2EQKA 4QQGA 2ECZA 5FU7C 3VV0A 2E10A 1X27A 3CCVA 5DLOA 2A36A 4M7AB 5D6WA 2B86A 3RKXA 3VS1A 3RESA 4LUDA 1SHFA 1GBRA 5I22A 2NUTA 4M7AC 4XU2A 4M7AE 4AFZC 4JJDA 5GAN7 3X25B 2A3LA 2L89A 3FB9A 4N4IA 3CC2A 3V7RA 2ZAEA 1NE8A 3L2WA 1TS9A 1XOVA 3OSSC 3UT1A 3VYHB 2BE7D 1K76A 2JS0A 4F7UE 4AFSC 5KYUA 3MKDA 3PGGA 5LL6S 4II1A 2HKQB 3N5BB 2DERA 1LNXA 3VS5A 4HVUA 4Y28E
chains in the Genus database with same CATH topology
2DVJA 1M30A 2L3QA 1OPKA 1PRMC 2DL8A 3SHWA 2FG0A 2KRSA 3I5SA 2KXCA 1UFFA 4A63B 1S1NA 1WYXA 2BZ8A 1UGVA 1WI7A 3H0IA 2LP5A 2O9SA 1JQQA 1SSHA 3JV3A 1N5ZA 2OI3A 3IQLA 3NPFA 3EG0A 1JXOA 2DM1A 2J6KA 2KT1A 1TG0A 5FWBA 2H8HA 1M3BA 1YWPA 2LCSA 2J06A 1ABOA 1WXBA 2DILA 3PE0A 5FW9A 2EYXA 2KEAA 1H92A 2KYBA 4ORZA 2LX7A 2DRKA 2VKNA 5GJVB 4GLMA 1ABQA 2DNUA 4EIKA 1X6GA 4F17A 2KBTA 3M0TA 4ZNXA 2HDAA 1G2BA 3SEMA 1YN8A 1T3LA 2RMOA 2YUPA 4F14A 1YWOA 3UA6A 1WFWA 1NM7A 2EBPA 1KSWA 1JO8A 1UTIA 2A28A 3TSWA 1E7OA 2DMOA 4RTTA 1AZEA 5HCKA 1QWFA 4CC3A 3VS4A 3PVLA 2SRCA 2D8HA 4IIMA 2KYMA 1JEGA 1Y0MA 3C0CA 5L23A 2K7AA 1X69A 2DL4A 1JU5C 2EYYA 2AZVA 2GNCA 2JT4A 2GGRA 2DL7A 4OMMA 2D1XA 4OMPA 2LJ3A 4J9HA 2DJQA 1ZBJA 1WLPB 4J9FA 2LQNA 2KE9A 1UECA 1VYTA 4HVWA 1PRLC 1X2QA 2DBKA 1K9AA 2JTEA 1MV3A 2AKLA 2RQVA 1YP5A 2CT4A 2YDLA 5IHKA 1ZUUA 2KROA 4AFQC 2K6DA 1RLPC 3NMZC 4CC4B 2DLPA 1PNJA 2FRWA 4JJBA 1B07A 2EYZA 3QWXX 2DA9A 2FPDA 2PNIA 2IIMA 4M4ZA 2JM8A 2W10A 1KFZA 1W70A 1ZX6A 2JM9A 2RQUA 4K11A 2LJ0A 1X6BA 3EG1A 1YCSB 1BBZA 2ROLA 2HBWA 3REBB 3H41A 1X2KA 2L0AA 1WDXA 2L2PA 2LJ1A 5GJWB 1HD3A 1G83A 2LZ6B 1OV3A 2L3SA 5I11A 1CSKA 5ECAA 3ZL7C 2JMCA 2FPFA 4FSSA 2HEQA 3U23A 1HSQA 1UHFA 2EGCA 1QKXA 2DX1A 1WXTA 1AVZC 2EQIA 2BZXA 3VS2A 4JZ3A 2MIOA 3M0UA 1VA7A 3EGUA 3EHRA 4J9BA 1GL5A 2MCNA 1M3CA 3EG3A 2AKKA 1W6XA 2V1RA 1QLYA 1NLPC 1QWEA 4D8KA 1MUZA 3NGPA 1AWWA 3I35A 4OMLA 4J9EA 1VYVA 2CDTA 4OMQA 2OAWA 3PVQA 4AFUC 2CUBA 2KRMA 1OPLA 4LNPA 1H3HA 2YUQA 1GRIA 1BB9A 1Y57A 2X3WD 2QDLA 2K3BA 4X1VA 2J6FA 2GQIA 4RTVA 1M8MA 3VS3A 3KFVA 2AZSA 1UHCA 2W0ZA 1RI9A 2ROTA 1YNZA 2YT6A 4J9DA 4IIOA 2EKHA 2LQWA 1A0NB 4J9CA 1NYFA 1PHTA 3UF4A 1M27C 2CSQA 2ENMA 2GTOA 1VYUA 3M0PA 4F16A 1QCFA 3M0QA 1ZLMA 1FMKA 3VS7A 2DYBA 2DL5A 1M3AA 2E5KA 3H0HA 2EYWA 1GCQC 2K2MA 1V1CA 3H0FA 2RQRA 3TVTA 1AOJA 1J3TA 1W1FA 1AZGB 1I07A 2D0NA 3UA7A 5FWCA 1WA7A 1I0CA 2G6FX 3VS0A 4LN2A 1UJ0A 5IXFA 2P4RA 1Z9QA 2AK5A 2D8JA 1TUCA 1WX6A 3I5RA 4J9GA 5IXBA 1HJDA 1T0HA 1LCKA 2X3XD 3LH5A 1E6GA 2ABLA 2BTTA 2PZ1A 3O5ZA 2CH4A 4RTXA 2FPEA 2C0TA 3RNJA 2EPDA 1NYGA 2RNAA 2J6OA 1ZUKA 3I9QA 1U3OA 2KXDA 3VS6A 3ULRB 2GBQA 4AG1C 4J9IA 1T0JA 1UUEA 1U5SA 1GCPA 2FO0A 2RF0A 2M0YA 1E6HA 2M51A 2MOXA 4CC2A 2F2WA 3THKA 1SHGA 3VRYA 2VWFA 1UE9A 1CKAA 1ZUYA 2I0NA 2RQTA 2LNHB 4OMNA 4OMOA 4E6RA 5IHIA 4ESRA 2XMFA 2NWMA 1U06A 4D8DA 1KJWA 2V1QA 1AWXA 4JJCA 4RTWA 2DRMA 1WXUA 2BZYA 1FYNA 2NUZA 1TUDA 1I1JA 1GBQA 1AWJA 1GCQA 2FRYA 2KT8A 2PTKA 2F2XA 1JXMA 4QT7A 2KR3A 2EGEA 2J7IA 2EVRA 2C0OA 2ESWA 1AEYA 4Y92A 1UG1A 5IHNA 2KNBB 2OJ2A 1ZSGA 2DBMA 1K4US 4RTUA 2A08A 1RUWA 1AD5A 2C0IA 3VRZA 1QKWA 2K79A 2KGTA 2RQWA 4WCIA 2RPNA 3FJ5A 1MV0B 2CUDA 3R6NA 4JPBW 4LUEA 1CKBA 2HSPA 1K0SA 4DEYA 4HVVA 1GFDA 4JZ4A 3EG2A 1NLOC 1PKTA 1T3SA 4Z89A 5IH2A 2CREA 1OOTA 1PWTA 1B3QA 2KRNA 2FEIA 2HCKA 2CT3A 4Z88A 3QWYA 4HXJA 2LMJA 2O88A 1AWOA 3RBBB 2VVKA 2L3PA 3M0SA 1ARKA 1WIEA 2A37A 3EHQA 1SRMA 1RLQC 4DEXA 1K0XA 1OEBA 1SEMA 2J05A 1UDLA 2DF6A 1BU1A 4GBQA 2F2VA 2YSQA 2O2OA 1GFCA 1PKSA 2RN8A 3A98A 2JMAA 2ED1A 1EFNA 1NEBA 1BK2A 2CH4W 4LE9A 4R0KA 2ECZA 1UJYA 2GTJA 1Z9ZA 2ED0A 1X43A 1X27A 2A36A 3CQTA 2B86A 2JXBA 2SEMA 2JS2A 4Z8AA 3REAB 1H8KA 3VS1A 4HCKA 4LUDA 1SHFA 1GBRA 5I22A 5EC7A 4RTZA 3TSZA 2CSIA 4AFZC 3GBQA 4JJDA 4RUGA 2JW4A 2EW3A 2DE0X 1IO6A 4KRTA 2EGAA 1XOVA 2O9VA 1K1ZA 3M0RA 1SRLA 2YUOA 1KIKA 1K76A 2DL3A 2K9GA 2JS0A 2YUNA 3NHNA 4AFSC 3UATA 4CC7A 4RTYA 1NEGA 2O31A 1SPKA 1NG2A 3VS5A 4HVUA 4AG2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVJ A;  1M30 A;  2L3Q A;  1OPK A;  1PRM C;  2DL8 A;  3SHW A;  2FG0 A;  2KRS A;  3I5S A;  2KXC A;  1UFF A;  4A63 B;  1S1N A;  1WYX A;  2BZ8 A;  1UGV A;  1WI7 A;  3H0I A;  2LP5 A;  2O9S A;  1JQQ A;  1SSH A;  3JV3 A;  1N5Z A;  2OI3 A;  3IQL A;  3NPF A;  3EG0 A;  1JXO A;  2DM1 A;  2J6K A;  2KT1 A;  1TG0 A;  5FWB A;  2H8H A;  1M3B A;  1YWP A;  2LCS A;  2J06 A;  1ABO A;  1WXB A;  2DIL A;  3PE0 A;  5FW9 A;  2EYX A;  2KEA A;  1H92 A;  2KYB A;  4ORZ A;  2LX7 A;  2DRK A;  2VKN A;  5GJV B;  4GLM A;  1ABQ A;  2DNU A;  4EIK A;  1X6G A;  4F17 A;  2KBT A;  3M0T A;  4ZNX A;  2HDA A;  1G2B A;  3SEM A;  1YN8 A;  1T3L A;  2RMO A;  2YUP A;  4F14 A;  1YWO A;  3UA6 A;  1WFW A;  1NM7 A;  2EBP A;  1KSW A;  1JO8 A;  1UTI A;  2A28 A;  3TSW A;  1E7O A;  2DMO A;  4RTT A;  1AZE A;  5HCK A;  1QWF A;  4CC3 A;  3VS4 A;  3PVL A;  2SRC A;  2D8H A;  4IIM A;  2KYM A;  1JEG A;  1Y0M A;  3C0C A;  5L23 A;  2K7A A;  1X69 A;  2DL4 A;  1JU5 C;  2EYY A;  2AZV A;  2GNC A;  2JT4 A;  2GGR A;  2DL7 A;  4OMM A;  2D1X A;  4OMP A;  2LJ3 A;  4J9H A;  2DJQ A;  1ZBJ A;  1WLP B;  4J9F A;  2LQN A;  2KE9 A;  1UEC A;  1VYT A;  4HVW A;  1PRL C;  1X2Q A;  2DBK A;  1K9A A;  2JTE A;  1MV3 A;  2AKL A;  2RQV A;  1YP5 A;  2CT4 A;  2YDL A;  5IHK A;  1ZUU A;  2KRO A;  4AFQ C;  2K6D A;  1RLP C;  3NMZ C;  4CC4 B;  2DLP A;  1PNJ A;  2FRW A;  4JJB A;  1B07 A;  2EYZ A;  3QWX X;  2DA9 A;  2FPD A;  2PNI A;  2IIM A;  4M4Z A;  2JM8 A;  2W10 A;  1KFZ A;  1W70 A;  1ZX6 A;  2JM9 A;  2RQU A;  4K11 A;  2LJ0 A;  1X6B A;  3EG1 A;  1YCS B;  1BBZ A;  2ROL A;  2HBW A;  3REB B;  3H41 A;  1X2K A;  2L0A A;  1WDX A;  2L2P A;  2LJ1 A;  5GJW B;  1HD3 A;  1G83 A;  2LZ6 B;  1OV3 A;  2L3S A;  5I11 A;  1CSK A;  5ECA A;  3ZL7 C;  2JMC A;  2FPF A;  4FSS A;  2HEQ A;  3U23 A;  1HSQ A;  1UHF A;  2EGC A;  1QKX A;  2DX1 A;  1WXT A;  1AVZ C;  2EQI A;  2BZX A;  3VS2 A;  4JZ3 A;  2MIO A;  3M0U A;  1VA7 A;  3EGU A;  3EHR A;  4J9B A;  1GL5 A;  2MCN A;  1M3C A;  3EG3 A;  2AKK A;  1W6X A;  2V1R A;  1QLY A;  1NLP C;  1QWE A;  4D8K A;  1MUZ A;  3NGP A;  1AWW A;  3I35 A;  4OML A;  4J9E A;  1VYV A;  2CDT A;  4OMQ A;  2OAW A;  3PVQ A;  4AFU C;  2CUB A;  2KRM A;  1OPL A;  4LNP A;  1H3H A;  2YUQ A;  1GRI A;  1BB9 A;  1Y57 A;  2X3W D;  2QDL A;  2K3B A;  4X1V A;  2J6F A;  2GQI A;  4RTV A;  1M8M A;  3VS3 A;  3KFV A;  2AZS A;  1UHC A;  2W0Z A;  1RI9 A;  2ROT A;  1YNZ A;  2YT6 A;  4J9D A;  4IIO A;  2EKH A;  2LQW A;  1A0N B;  4J9C A;  1NYF A;  1PHT A;  3UF4 A;  1M27 C;  2CSQ A;  2ENM A;  2GTO A;  1VYU A;  3M0P A;  4F16 A;  1QCF A;  3M0Q A;  1ZLM A;  1FMK A;  3VS7 A;  2DYB A;  2DL5 A;  1M3A A;  2E5K A;  3H0H A;  2EYW A;  1GCQ C;  2K2M A;  1V1C A;  3H0F A;  2RQR A;  3TVT A;  1AOJ A;  1J3T A;  1W1F A;  1AZG B;  1I07 A;  2D0N A;  3UA7 A;  5FWC A;  1WA7 A;  1I0C A;  2G6F X;  3VS0 A;  4LN2 A;  1UJ0 A;  5IXF A;  2P4R A;  1Z9Q A;  2AK5 A;  2D8J A;  1TUC A;  1WX6 A;  3I5R A;  4J9G A;  5IXB A;  1HJD A;  1T0H A;  1LCK A;  2X3X D;  3LH5 A;  1E6G A;  2ABL A;  2BTT A;  2PZ1 A;  3O5Z A;  2CH4 A;  4RTX A;  2FPE A;  2C0T A;  3RNJ A;  2EPD A;  1NYG A;  2RNA A;  2J6O A;  1ZUK A;  3I9Q A;  1U3O A;  2KXD A;  3VS6 A;  3ULR B;  2GBQ A;  4AG1 C;  4J9I A;  1T0J A;  1UUE A;  1U5S A;  1GCP A;  2FO0 A;  2RF0 A;  2M0Y A;  1E6H A;  2M51 A;  2MOX A;  4CC2 A;  2F2W A;  3THK A;  1SHG A;  3VRY A;  2VWF A;  1UE9 A;  1CKA A;  1ZUY A;  2I0N A;  2RQT A;  2LNH B;  4OMN A;  4OMO A;  4E6R A;  5IHI A;  4ESR A;  2XMF A;  2NWM A;  1U06 A;  4D8D A;  1KJW A;  2V1Q A;  1AWX A;  4JJC A;  4RTW A;  2DRM A;  1WXU A;  2BZY A;  1FYN A;  2NUZ A;  1TUD A;  1I1J A;  1GBQ A;  1AWJ A;  1GCQ A;  2FRY A;  2KT8 A;  2PTK A;  2F2X A;  1JXM A;  4QT7 A;  2KR3 A;  2EGE A;  2J7I A;  2EVR A;  2C0O A;  2ESW A;  1AEY A;  4Y92 A;  1UG1 A;  5IHN A;  2KNB B;  2OJ2 A;  1ZSG A;  2DBM A;  1K4U S;  4RTU A;  2A08 A;  1RUW A;  1AD5 A;  2C0I A;  3VRZ A;  1QKW A;  2K79 A;  2KGT A;  2RQW A;  4WCI A;  2RPN A;  3FJ5 A;  1MV0 B;  2CUD A;  3R6N A;  4JPB W;  4LUE A;  1CKB A;  2HSP A;  1K0S A;  4DEY A;  4HVV A;  1GFD A;  4JZ4 A;  3EG2 A;  1NLO C;  1PKT A;  1T3S A;  4Z89 A;  5IH2 A;  2CRE A;  1OOT A;  1PWT A;  1B3Q A;  2KRN A;  2FEI A;  2HCK A;  2CT3 A;  4Z88 A;  3QWY A;  4HXJ A;  2LMJ A;  2O88 A;  1AWO A;  3RBB B;  2VVK A;  2L3P A;  3M0S A;  1ARK A;  1WIE A;  2A37 A;  3EHQ A;  1SRM A;  1RLQ C;  4DEX A;  1K0X A;  1OEB A;  1SEM A;  2J05 A;  1UDL A;  2DF6 A;  1BU1 A;  4GBQ A;  2F2V A;  2YSQ A;  2O2O A;  1GFC A;  1PKS A;  2RN8 A;  3A98 A;  2JMA A;  2ED1 A;  1EFN A;  1NEB A;  1BK2 A;  2CH4 W;  4LE9 A;  4R0K A;  2ECZ A;  1UJY A;  2GTJ A;  1Z9Z A;  2ED0 A;  1X43 A;  1X27 A;  2A36 A;  3CQT A;  2B86 A;  2JXB A;  2SEM A;  2JS2 A;  4Z8A A;  3REA B;  1H8K A;  3VS1 A;  4HCK A;  4LUD A;  1SHF A;  1GBR A;  5I22 A;  5EC7 A;  4RTZ A;  3TSZ A;  2CSI A;  4AFZ C;  3GBQ A;  4JJD A;  4RUG A;  2JW4 A;  2EW3 A;  2DE0 X;  1IO6 A;  4KRT A;  2EGA A;  1XOV A;  2O9V A;  1K1Z A;  3M0R A;  1SRL A;  2YUO A;  1KIK A;  1K76 A;  2DL3 A;  2K9G A;  2JS0 A;  2YUN A;  3NHN A;  4AFS C;  3UAT A;  4CC7 A;  4RTY A;  1NEG A;  2O31 A;  1SPK A;  1NG2 A;  3VS5 A;  4HVU A;  4AG2 C; 
#chains in the Genus database with same CATH topology
 2DVJ A;  2DL8 A;  1YJ9 Q;  3UWN A;  1ZBX A;  2X4J A;  1S1N A;  1FMV A;  1WYX A;  1LPL A;  3OYY A;  1GXI E;  2F5T X;  4QQD A;  1G5V A;  4KUL A;  3QZ5 B;  1RAD B;  1RL2 A;  2PVD B;  4A4G A;  1JQQ A;  1G3T A;  3IQL A;  3EG0 A;  2HQE A;  2DM1 A;  1TG0 A;  4A53 A;  2WSC E;  1WNL A;  4MML A;  5HKC A;  4YTL A;  1OU9 A;  2DIL A;  2RI3 A;  3PE0 A;  2EYX A;  2KEA A;  1H92 A;  2KSS A;  3E1S A;  4MDX A;  2DNU A;  2KBT A;  3JCM f;  2C06 A;  4ZNX A;  3TCJ A;  2HDA A;  1SF9 A;  1G2B A;  1F1B B;  3SEM A;  1KC8 C;  1YN8 A;  4F14 A;  3DLM A;  2WAC A;  4M78 G;  4PJL A;  4QKU A;  2A28 A;  2KAF A;  3G6E Q;  1E7O A;  2DMO A;  2DXC A;  4NS5 A;  5HCK A;  5KH6 A;  1AZE A;  2FYK A;  3CEY A;  2PU9 B;  2XHC A;  2SRC A;  2KYM A;  1K9M U;  1Y0M A;  5GAO q;  5KYW B;  2QA4 A;  1X69 A;  2CYZ B;  4VUB A;  2AZV A;  4WF2 A;  1D0Y A;  3Q1J A;  4JRQ A;  2GGR A;  4M78 A;  5GAO r;  1IHW A;  3CD6 A;  1I8F A;  5LJ3 j;  4J9H A;  2DJQ A;  4N0A C;  5HK3 A;  3M4Y A;  1BIA A;  2CZ7 B;  1PRL C;  5EG2 A;  2M02 A;  2KMT A;  4PJM A;  2AKL A;  2DFU A;  2QEX Q;  1TWB A;  1PNJ A;  3OW2 S;  4C8Q D;  3OYA A;  5GAN g;  4M7D G;  1SKU B;  3LWI A;  2RHY A;  1H64 1;  3MHX A;  3G71 Q;  1NPR A;  2E3I A;  2LQK A;  4M4Z A;  2EYQ A;  5KYY A;  1KFZ A;  1PD0 A;  2VYT A;  5GAN j;  1ZA2 B;  2JM9 A;  4FSX A;  2LJ0 A;  4K11 A;  3G4S A;  3CCV Q;  3REB B;  1MMD A;  5GAM g;  4RCC A;  1Y07 A;  1WGS A;  5HY6 A;  1BCM A;  2HKN A;  1NPP A;  1OV3 A;  3RIR A;  1QVG S;  2L3S A;  5CAI A;  4GLK A;  1Q7Y C;  4M7D A;  2FPF A;  4FSS A;  4M7A G;  1FX7 A;  3U23 A;  1M90 U;  1VQ5 A;  3TRE A;  4M77 F;  1AVZ C;  2EQI A;  3VS2 A;  4ZN3 A;  3QYH B;  1MNE A;  2K5I A;  2AKK A;  3NTK A;  2CGH A;  4D8K A;  2GQV A;  3CCU T;  3NGP A;  4OML A;  2R5A A;  3G1J A;  3QBY A;  4OMQ A;  4C8Q B;  2F69 A;  1QP3 A;  2VUB A;  1RAC B;  2OTL A;  3BW1 A;  2CUB A;  4F7U F;  4C8Q C;  1KK7 A;  5KYX B;  3MO8 A;  3JCM X;  3A8G B;  3OB9 A;  1BB9 A;  4BI4 A;  2K3B A;  4X1V A;  2J6F A;  4FT4 A;  4RTV A;  4ELY C;  4QVZ A;  1UHC A;  1VQ4 A;  4KBM B;  1FWZ A;  3NTH A;  2YT6 A;  1JBM A;  1A0N B;  2LCC A;  4C5H A;  2O4X B;  1X01 A;  1ZLM A;  2DET A;  2Y90 A;  1OQK A;  1KC8 R;  1TXQ A;  3BFM A;  2XKO C;  1YHQ T;  2X35 A;  2EYW A;  1TTH B;  2MAM A;  1VQK T;  3I55 T;  1J3T A;  3TVT A;  1UEB A;  1W1F A;  1Q82 U;  4HT9 A;  2D0N A;  2RK1 A;  3JRZ A;  4E2F B;  1WA7 A;  3LX7 A;  2VV5 A;  4BD3 A;  1KQS S;  2DPP B;  3VS0 A;  4LN2 A;  5IXF A;  1JJ2 S;  2PVG B;  2P4R A;  2VC8 A;  2AK5 A;  1TUC A;  1C1A A;  1Y71 A;  3M53 A;  5IXB A;  1XQH A;  3VU3 C;  2ABL A;  4ANJ A;  4FT2 A;  2CH4 A;  4RTX A;  2IPO B;  3OS2 A;  2XIC A;  2QA4 Q;  5GAN 3;  3JB9 D;  3KXT A;  1U3O A;  3VS6 A;  4HCC A;  3AT1 B;  3ZEH A;  5KYN A;  1PM3 A;  1VIE A;  3EAE A;  2NUP A;  3OYL A;  4XTY A;  2VGN A;  3HRS A;  1UGS B;  3VRY A;  2Y4Y A;  1UE9 A;  1V76 A;  4MZM A;  1ZUY A;  5CK9 A;  3S3O A;  2XID A;  1KG1 A;  2E41 A;  2MI6 A;  2HBP A;  1KJW A;  4ZTF A;  3EFS A;  2QAS A;  4A4E A;  5KYW A;  4LD9 K;  2NUZ A;  1M1F A;  2P0P A;  2PVO B;  1GCQ A;  4DBF A;  1RAF B;  1I5O B;  2KT8 A;  2F2X A;  4ZTJ A;  2V8J A;  3MEW A;  3EGX B;  3G4S Q;  1BYM A;  2EGE A;  3JCM h;  4E7J A;  2EVR A;  1M8V A;  2DXB A;  2ESW A;  3CCJ A;  1Q7Y R;  2PUO B;  1VQ6 Q;  1VQL A;  4Y92 A;  3X20 B;  1SSF A;  2DBM A;  1WHH A;  2HL5 C;  4RG8 A;  2RQW A;  1VQ5 Q;  2EQU A;  4NOY A;  3FJ5 A;  3CC2 T;  1CKB A;  4EPC A;  4BDY A;  4HVV A;  3QHS A;  4PJO B;  1NLO C;  3GP8 A;  1T3S A;  1WQW A;  1K9M C;  3QG1 A;  4PJO C;  4J83 A;  1IGU A;  1N8R C;  2L8D A;  2M1H A;  2KRN A;  4Z88 A;  1PCX A;  3QWY A;  4C8Q G;  2VVK A;  3P8H A;  1VOM A;  3EHQ A;  1RLQ C;  4N4H A;  1K0X A;  1VQ4 Q;  3NTI A;  3V7C A;  2E5Q A;  2J05 A;  1UDL A;  4C5G A;  3A98 A;  1EFN A;  2FZC B;  1UJY A;  4RCB A;  2DIG A;  2GTJ A;  4C0F A;  1X43 A;  2L3R A;  4CRI A;  5LJ5 h;  4C8Q A;  3OMC A;  1YJ9 A;  2K5L A;  2MPX C;  2JS2 A;  2NLU A;  3REA B;  3JCM J;  2RD1 A;  4HCK A;  3JCM c;  4C5E A;  5EC7 A;  2E70 A;  5KYX A;  4RUG A;  4OVA A;  1UGP B;  2DXU A;  5DY9 A;  2RHX A;  3FDR A;  2HQH A;  2ZPF B;  5CR2 A;  3JSC A;  1K8A R;  5GMK l;  3A8M B;  5GAO l;  4BI8 B;  2O9V A;  3JB9 J;  2RH2 A;  1MMA A;  2YUO A;  1KIK A;  3HRT A;  3MEV A;  2DL3 A;  2K9G A;  3NHN A;  4CC7 A;  1IZ6 A;  1QP2 A;  4HCB A;  3FJP A;  3JCM P;  4LXC A;  3O8V A;  3LGL A;  3JAM E;  2K57 A;  1M30 A;  3GLX A;  2EQM A;  1PRM C;  3SHW A;  2O4X A;  2DVE A;  2QQB A;  5GAO n;  2JVV A;  2COW A;  2HZY A;  4IUQ A;  2EKO A;  4A63 B;  3OYH A;  3G7Z A;  1I4K 1;  4M78 C;  4M78 E;  2D6F A;  1Q81 U;  2O01 E;  2O9S A;  3CBM A;  3CD6 T;  3NPF A;  3G6E A;  1JXO A;  4DA4 A;  2E12 A;  2KDS A;  5D6X A;  3EH2 A;  1Q86 U;  2J06 A;  1RAI B;  1ABO A;  1WXB A;  2E6N A;  3EFO B;  2RJF A;  4ORZ A;  2M0O A;  2LX7 A;  5LJ3 f;  1MMN A;  1X6G A;  4F17 A;  1YI2 A;  3QZ9 B;  1X6O A;  2P4T A;  3L2Z A;  3V8J A;  4QW2 A;  4BB7 A;  1TUG B;  2YUP A;  4PLL A;  1WJQ A;  3TQ7 P;  2GFU A;  3CCE T;  3ZBD A;  4M77 D;  4PFZ A;  3CCJ Q;  5AT1 B;  2CS7 A;  3GF5 A;  1WFW A;  1VQL Q;  1NM7 A;  2H3J A;  3JCM V;  1Y7X A;  1QWF A;  5FRM A;  4A4K A;  4B6M A;  3CCL Q;  4M7D E;  1M1K R;  2QEX A;  4JS4 A;  3JB9 G;  3PVL A;  2D8H A;  1TH7 A;  2DTI A;  1JEG A;  3HFN A;  5GAN f;  3GPL A;  4OGC A;  2K7A A;  3JCM e;  1NJI C;  2DL4 A;  3CC4 Q;  4FYW B;  3QDR B;  1VQ5 T;  2YLB A;  2JN0 A;  3RKY A;  3L1A A;  1K73 R;  2LT4 A;  3EGX A;  2LJ3 A;  3OY9 A;  1ZBJ A;  1N27 A;  1N8R R;  2LCL A;  2PQW A;  3E9F A;  4KH0 B;  2YXY A;  1G3S A;  1UEC A;  2FZG B;  1X2Q A;  4PJO G;  1MV3 A;  1VQO Q;  3GOX A;  1YP5 A;  2CT4 A;  2YDL A;  5IHK A;  3CCM A;  2OTL T;  3A8O B;  3CCQ A;  4IUT A;  4AFQ C;  3SDZ A;  2FRW A;  4X34 A;  3V7S A;  1B07 A;  1LJO A;  4WTO B;  3QWX X;  5CIU A;  5CKD A;  1VQ7 A;  2XI9 A;  2DEU A;  2HL3 A;  8AT1 B;  1M2O A;  1YIJ A;  2JM8 A;  2R58 A;  3H9N A;  3EG1 A;  4L6V 5;  4N4G A;  1HXD A;  4PJO A;  1VQ8 Q;  3ZFJ A;  2EJG A;  3H41 A;  2HAX A;  2L2P A;  2D9T A;  3M58 A;  1HD3 A;  1G83 A;  3MEA A;  4KUI A;  1S72 Q;  4M75 B;  3M57 A;  2BIV A;  3BDU A;  3FIF A;  4DOV A;  5I11 A;  2CP3 A;  4JLI A;  2ZZD A;  4M75 C;  4E47 A;  4Q5W A;  3HPW A;  2COZ A;  4XTV A;  1HSQ A;  1QKX A;  3L42 A;  4JZ3 A;  2A7Y A;  3EGU A;  1VQN A;  2F1L A;  1GL5 A;  2MCN A;  5LJ5 e;  2RA2 A;  5FU6 B;  1QLY A;  4E7K A;  2CKK A;  3P8D A;  1MUZ A;  4HA8 A;  3OYI A;  3C95 A;  5FU6 C;  2QGG A;  4GY5 A;  3I35 A;  1VYV A;  3JB9 I;  2WSE E;  3GNF B;  3MP8 A;  4KGV B;  4DBR A;  1H3H A;  1KD1 R;  4DOW A;  1BI3 A;  5I21 A;  2RHI A;  3HL8 A;  2BE9 B;  2EJ9 A;  2NUP B;  2GFA A;  2GQI A;  2AT1 B;  2QQS A;  3KFV A;  4C92 D;  5CKB A;  2W0Z A;  2F5K A;  3X26 B;  1QVF P;  1IHV A;  3AHU A;  4J6W A;  2RHZ A;  2MYS A;  5HK0 A;  1BKB A;  4F16 A;  5GMK i;  1QCN A;  1FMK A;  2K3Y A;  2DZ9 A;  1YI2 Q;  2EFI A;  1M3A A;  5D6Y A;  1RAH B;  5KCH A;  1VQM A;  1GCQ C;  4OP0 A;  4ZGE B;  3FC3 A;  2DD4 A;  3FRN A;  2EIF A;  2Z0W A;  4EDU A;  3A5Z B;  1FXX A;  5A2Q E;  1YJW T;  3QJY A;  3EGD B;  3EFR A;  1VQL T;  2MK5 A;  1HJD A;  1T0H A;  3UDC A;  3M5A A;  4OB1 B;  4C92 B;  2PZ1 A;  1NJI R;  3TU4 K;  2K5F A;  3EFO A;  3RNJ A;  5LJ5 d;  1B34 B;  3A1P A;  3CME A;  4C92 C;  3SD4 A;  1ZUK A;  3JCM Q;  2LQ8 A;  2P84 A;  3I9Q A;  3QKJ A;  3QUI A;  4AG1 C;  4AMC A;  3OYC A;  1T0J A;  2ZPB B;  4M7D F;  1OI1 A;  1R8O B;  1U5S A;  2CP2 A;  2RF0 A;  2E3H A;  4J7F A;  2M51 A;  2MOX A;  3RER A;  3C12 A;  2F2W A;  3THK A;  2VXE A;  2QAZ A;  1VQ6 A;  1D0X A;  4XTZ A;  3CPW A;  1YJN A;  4QQ6 A;  5GAM j;  1OZ2 A;  3CCM Q;  1YBY A;  2RQT A;  3H8Z A;  3CCQ Q;  4OMN A;  1ZSZ B;  4E6R A;  4JS5 A;  3C94 A;  2NWM A;  1QVF A;  7AT1 B;  1VQP Q;  1AWX A;  4RTW A;  1WPY A;  2DRM A;  3RMQ A;  1FYN A;  4PFO A;  1VQ7 Q;  4M7A F;  1YIJ Q;  1D3B A;  4MZT A;  1YIT Q;  2XDP A;  1Q86 C;  5LJ3 h;  1N9S A;  1RI0 A;  2KR3 A;  1QQJ A;  1VIF A;  2WSF E;  4ZGD B;  4C8Q E;  1UG1 A;  2JNG A;  1MMG A;  3I56 A;  2OJ2 A;  4RTU A;  5KCO A;  1YJ9 T;  2M16 A;  3OBW A;  2E65 A;  3VRZ A;  4M77 A;  4M75 G;  4WCI A;  3HFO A;  1VQN Q;  2YRC A;  2RPN A;  2OTJ A;  2YRD A;  4IUU A;  3R6N A;  3CCS Q;  2FL7 A;  3M55 A;  5GAN h;  2HSP A;  4DEY A;  1GFD A;  4X9C A;  2DTH A;  1FMW A;  3EG2 A;  1ZQ1 A;  2LT1 A;  1OZ3 A;  4PL6 A;  3LYI A;  2BUD A;  1D0Z A;  4M75 A;  4XU1 A;  2CT3 A;  2JJ9 A;  3LLR A;  2O88 A;  2LMJ A;  3RBB B;  1D09 B;  4DEX A;  2FZK B;  2DJZ A;  4XK8 E;  2DF6 A;  1U8R A;  1BU1 A;  5I2M A;  4DQ2 A;  3BDL A;  1Q95 G;  4DBQ A;  2E1H A;  2CH4 W;  3OYK A;  2DO3 A;  3G6E T;  4EMK B;  4O6J A;  3CQT A;  3VUZ A;  3OYN A;  4Z8A A;  4EMK C;  1VQM Q;  4RTZ A;  2CSI A;  1WJS A;  1Y96 B;  4TVR A;  2LX9 A;  4IUV A;  3J80 E;  5CKF A;  2EW3 A;  2DEQ A;  4C0G A;  3LGF A;  5GMK h;  2EGA A;  2CZ6 B;  1SRL A;  5GAN 5;  2VXF A;  2XDD A;  4DBH A;  2XD0 A;  3CPF A;  3UAT A;  4FIB A;  4LDV A;  2RJC A;  2ATC B;  1G8X A;  3S6W A;  4PJJ A;  3EG9 B;  3CME Q;  1OPK A;  3GNG A;  2FG0 A;  1UGQ B;  2KRS A;  4XAX B;  2QEX T;  3I5S A;  5GAN 8;  1U1T A;  4FYX B;  4D6W A;  4C92 G;  1KHC A;  3E9G A;  1UGV A;  3BY7 A;  1XJW B;  4FL6 A;  3G71 T;  2RO0 A;  1PD1 A;  1N5Z A;  1YJN Q;  2V26 A;  2KT1 A;  3CCV T;  5LJ5 g;  2PUK B;  3EGD A;  1M3B A;  1VQ9 Q;  2R57 A;  3CCL A;  3S3M A;  4UC4 A;  4C92 A;  1YCY A;  3LWH A;  4J8O A;  2KYB A;  5A0D A;  5LJ5 j;  3LH0 A;  2RI5 A;  2DRK A;  5D7U A;  5GJV B;  1ABQ A;  1B34 A;  3EH1 A;  3CCQ T;  4EIK A;  3CC4 A;  3M0T A;  3RMS A;  1QW1 A;  1YWO A;  3UA6 A;  1VQ7 T;  3OQ5 A;  3FLG A;  1D1B A;  2DIQ A;  4NL2 A;  2XK0 A;  5FRN A;  1EX4 A;  1YIJ T;  2KI7 A;  4PJO E;  2CP0 A;  1KSW A;  5CKH A;  1N9R A;  1OX9 A;  5J3B A;  3I56 Q;  2ZPE B;  3TSW A;  4RTT A;  1VQO A;  3CCR A;  1KC8 U;  5KE3 A;  4JDS A;  2DKG A;  4CC3 A;  1R77 A;  3VS4 A;  2KVQ G;  3OYG A;  4ZN1 A;  3HSB A;  1ZSZ A;  3ME9 A;  5GAN 4;  4IIM A;  4L59 A;  5CKE A;  5LJ3 e;  3C0C A;  5L23 A;  4C8Q F;  2OTJ Q;  4FW1 A;  2JT4 A;  1RAG B;  1KHI A;  4OMM A;  3BE3 A;  3CBO A;  1X75 C;  2D1X A;  4PLI A;  1WHM A;  4LDX A;  1VQN T;  2DTO A;  1VUB A;  5I2S A;  1VQ8 A;  4J9F A;  3CCU A;  4XTW A;  1S72 A;  2KE9 A;  1VYT A;  2LDM A;  4HVW A;  1K9A A;  3M54 A;  3INZ A;  4KUD K;  1ZUU A;  1YFN A;  2KRO A;  1RLP C;  4CC4 B;  2DLP A;  5GAN e;  4OB3 B;  2EYZ A;  4OB2 B;  2DA9 A;  4OMF B;  2PNI A;  1C6V X;  2XDB A;  2YWW A;  1W70 A;  1ZX6 A;  1QCO A;  2CP7 A;  1BBZ A;  2ROL A;  2HBW A;  1M90 C;  1WDX A;  2QTV A;  3ER0 A;  2DXT A;  3CC7 A;  2JMC A;  3WVE B;  3JB9 H;  2XU8 A;  2HEQ A;  3E19 A;  2QA4 T;  4FYY B;  2L5Q A;  2DX1 A;  1WXT A;  4MZP A;  5GMK m;  2BZX A;  2MIO A;  3MEU A;  4E7H A;  1VQK A;  1VA7 A;  3EHR A;  4J9B A;  2RI2 A;  1Q7Y U;  1M1G A;  1M3C A;  3EG3 A;  4A54 A;  2A0F B;  1OUL A;  2LNV A;  1NLP C;  4XTX A;  3MPU B;  1AWW A;  5LJ3 d;  3T9N A;  2RM4 A;  2CDT A;  3OYM A;  2R5M A;  1PC0 A;  4AFU C;  4EMK A;  3PIO A;  3CXC P;  1G3Y A;  2KRM A;  5GMK e;  2OX7 A;  1OPL A;  4FCY A;  2YUQ A;  1GRI A;  2DD5 A;  1Y57 A;  2QI2 A;  1R0B G;  1Y96 A;  2QDL A;  2JTF A;  1H3Z A;  3SWN A;  1QVP A;  3CME T;  3SB2 A;  1M8M A;  3CBP A;  2AZS A;  3PNW C;  2BKD N;  4M7A D;  5DLQ E;  3RKW A;  4ZGJ B;  3G4S T;  2ROT A;  3PTA A;  1RAA B;  3M59 A;  4J9D A;  4IIO A;  2QK0 A;  4J9C A;  4NL3 A;  2V8I A;  3MP1 A;  3OA6 A;  1PHT A;  1VQ6 T;  1M27 C;  2CSQ A;  2GTO A;  4PK4 A;  1VYU A;  2QQR A;  3L2Q A;  1Q82 C;  1QCF A;  3M0Q A;  3JCM W;  3EG9 A;  4A4H A;  3VS7 A;  2DYB A;  1D3B B;  2DL5 A;  4JRK A;  2E5K A;  4O5V A;  4P5N A;  3PMT A;  3H0H A;  1BCO A;  3CXC S;  1V1C A;  1K9M R;  3H0F A;  2RQR A;  1AOJ A;  3R6O A;  5GAM f;  4B9W A;  1I07 A;  1I81 A;  5FWC A;  2VAS A;  4JRP A;  2LC4 A;  4E7Z A;  3KUF A;  3CCR Q;  3E2U A;  3RR6 A;  1Z9Q A;  2D8J A;  3QDF A;  1IB8 A;  3I5R A;  4J9G A;  4M77 B;  1LCK A;  3HRU A;  3LH5 A;  3X24 B;  3I56 T;  1VQP A;  4PKC C;  4C5I A;  1OU8 A;  4PJO F;  2FPE A;  4M77 C;  4M77 E;  2C0T A;  2CZ0 B;  1K8A U;  5GAN 2;  2RNA A;  2J6O A;  2HQX A;  1OYX A;  2KXD A;  2GBQ A;  1VQ4 T;  2DZC A;  1YIT A;  4J9I A;  2P0K A;  2FHD A;  1UUE A;  2QDY B;  4IUR A;  4XQ3 A;  1GCP A;  2OTJ T;  3CXC A;  4F7U B;  3MJX A;  4CC2 A;  3CCU Q;  2JZ2 A;  1P92 A;  1SHG A;  1KQ2 A;  2ZPH B;  5M9O A;  2VWF A;  3HP9 A;  4M75 E;  1CKA A;  2I0N A;  2LNH B;  4OMO A;  4RMO A;  4ESR A;  4BAC A;  2XMF A;  5CVI A;  4D8D A;  2V1Q A;  4L5G A;  1WXU A;  4F04 B;  2BZY A;  1TUD A;  1I1J A;  2VB6 A;  1GBQ A;  4BE1 A;  1AHJ B;  1AWJ A;  2FRY A;  2KQW A;  3J7A F;  3CCS A;  3CMA A;  2PTK A;  1JXM A;  1M90 R;  1MHN A;  4BDZ A;  2QQA A;  1IGQ A;  2C0O A;  3WXM B;  3JCM d;  2QTX A;  3VYG A;  4QVC A;  3L2V A;  6AT1 B;  1RAE B;  1TU0 B;  3CC7 Q;  3CPW P;  1ZSG A;  2ZGW A;  2A08 A;  3OYB A;  1AD5 A;  1YHQ Q;  3V8L A;  2OAU A;  2GCX A;  2YHT A;  2AIR B;  1VQK Q;  2DK3 A;  3I55 Q;  2E64 A;  4OGE A;  2CUD A;  4JPB W;  2I2L A;  4JLG A;  4LUE A;  5FRO A;  1LOJ A;  1K0S A;  4BE2 A;  5DM7 R;  4M78 F;  4ME7 A;  1MGQ A;  4JZ4 A;  4XTU A;  5IAY A;  3OS5 A;  4Z89 A;  1M1K U;  2CRE A;  3DB4 A;  1OOT A;  1PWT A;  2X51 A;  5C0M A;  1B3Q A;  1QMC A;  2FEI A;  2X4Y A;  2M9U A;  3DKM A;  4J6X A;  2CP6 A;  3OW2 P;  2B8A A;  4HXJ A;  3DLL A;  3M0S A;  3C4S A;  5C6S A;  2MF2 A;  3CPW S;  1SEM A;  1K73 U;  4IKF A;  1V29 B;  1R0C B;  5L8R E;  5LJ3 g;  1N8R U;  4GBQ A;  2F2V A;  3OSV A;  2YSQ A;  2O2O A;  3PT9 A;  2RN8 A;  3CCJ T;  1QVF S;  1Q82 R;  1NEB A;  1BK2 A;  1KQ1 A;  4LE9 A;  4R0K A;  2K3X A;  1Z9Z A;  2ED0 A;  3GIB A;  2LRQ A;  4IUP A;  1QVG P;  1ACM B;  2JXB A;  2SEM A;  3CCL T;  4C92 E;  1H8K A;  3KBG A;  3TSZ A;  4EMH A;  3GBQ A;  1O9S A;  2JW4 A;  1WZO A;  2DE0 X;  1IO6 A;  3CC4 T;  4KRT A;  4E7L A;  1K1Z A;  3M0R A;  2HSE B;  2KK4 A;  2YUN A;  2X9H A;  3CCE A;  4RTY A;  2X4W A;  3HTR A;  5LJ5 f;  1VQ9 A;  1NEG A;  2O31 A;  4JRI A;  1SPK A;  3X28 B;  1NG2 A;  4AG2 C;  1Q81 C;  3M4G A;  2IVW A;  1ZSZ C;  3CCR T;  2L3Q A;  1VQO T;  1W4S A;  3RUX A;  4M77 G;  2KXC A;  1UFF A;  2BZ8 A;  3NFC A;  3CC2 Q;  1WI7 A;  1UGR B;  3PFS A;  3H0I A;  4A4F A;  2LP5 A;  2EAY A;  1SSH A;  3JV3 A;  2OI3 A;  3OW2 A;  2K4Y A;  2J6K A;  2EWN A;  1VQ8 T;  1ZA1 B;  2H8H A;  5FWB A;  4F7U G;  1YWP A;  2LCS A;  4HKE A;  1S72 T;  1KD1 U;  5CCA A;  2RJD A;  4QVD A;  3OBY A;  2QXF A;  5FW9 A;  2MMP A;  4M7A A;  2VKN A;  4GLM A;  2P0Q A;  3CMA Q;  3FEO A;  1JRI A;  4HCZ A;  4M75 F;  2RMO A;  1T3L A;  1UB4 A;  1QVG A;  3LW5 E;  1LVK A;  4BUG A;  1DJ7 B;  4FYV B;  1KQS P;  3OYF A;  5GMK j;  4F7U A;  2ZCF B;  3OMG A;  1JJ2 P;  4CI0 C;  2EBP A;  1JO8 A;  1UTI A;  1SG5 A;  3QO3 A;  5GAM h;  1HYO A;  4KH1 B;  3D7S B;  1WJR A;  3HKS A;  1HK9 A;  1M2V B;  2HMA A;  2RJE A;  4R55 A;  1G3W A;  2NYS A;  4MDW A;  3CC7 T;  1BI2 A;  1JU5 C;  2EYY A;  3JCM g;  5A0L A;  2GNC A;  4ELZ C;  4FM4 B;  2DL7 A;  4FU6 A;  4OMP A;  4OF1 A;  2MWP A;  1WLP B;  4Y91 A;  5CQX A;  2LQN A;  8ATC B;  5AYF A;  1NJI U;  2EQJ A;  1K8A C;  3VUB A;  2DBK A;  1O75 A;  3L2U A;  2JTE A;  3SWN B;  1NZ9 A;  2RQV A;  3TEE A;  3QJ6 A;  4PJN A;  2D0Q B;  1C0M A;  2K6D A;  1YI2 T;  3SWN C;  3NMZ C;  1BI0 A;  3F70 A;  4JJB A;  5CQY A;  2QQ9 A;  2FPD A;  2QYZ A;  1TSF A;  5A0G A;  2IIM A;  1U1S A;  2W10 A;  4KGZ B;  3PIP A;  2RHU A;  2RQU A;  3CD6 Q;  1X6B A;  1YCS B;  1X2K A;  2L0A A;  2HNI A;  4BY6 B;  2LJ1 A;  5GJW B;  3QII A;  2LZ6 B;  3MP6 A;  4BY6 C;  3OS0 A;  1CSK A;  5ECA A;  3VJP A;  3ZL7 C;  4ATO A;  2V8K A;  4BE0 A;  1KQS A;  2CP5 A;  3A8L B;  3QPH A;  1JJ2 A;  2HD0 A;  4V2S A;  1UHF A;  1M5Q 1;  1WHK A;  1ZHI A;  2EGC A;  4PJO D;  1TOV A;  4B9X A;  1B7T A;  3OYE A;  3M0U A;  3CCE Q;  4C92 F;  2Y4X A;  1BIB A;  1W6X A;  3HHT B;  5KE2 A;  2V1R A;  1Q81 R;  1QWE A;  4N0A A;  3SFM A;  3UPU A;  4J9E A;  1YJW A;  2OAW A;  3PVQ A;  4MMK A;  5J39 A;  3CCM T;  3JCM b;  3A8H B;  3M56 A;  5GAN 6;  1Q86 R;  2AHJ B;  2NUT B;  1OX8 A;  4LNP A;  2KY9 A;  4J6Y A;  1VQP T;  2X3W D;  3URG A;  1WHJ A;  9ATC B;  3VS3 A;  1WHL A;  1YIT T;  1M1K C;  3OYJ A;  1RI9 A;  5KYU B;  1YNZ A;  2EKH A;  2LQW A;  1M4Z A;  1N6A A;  1WQ7 A;  1NYF A;  2COY A;  2JOY A;  3V8K A;  2YLC A;  3UF4 A;  2ENM A;  3VKI A;  3M0P A;  1K73 C;  4LDU A;  1IRX A;  4LDW A;  2OTL Q;  1BI1 A;  2E4H A;  5J26 A;  5GAO p;  2X4X A;  4JUV A;  4J7I A;  2ZPG B;  1M9S A;  1PSE A;  5CO7 A;  2JTM A;  2K2M A;  4OB0 B;  3QSU A;  1I5L A;  2FVU A;  1AZG B;  2DYI A;  3CCS T;  3UA7 A;  3CMA T;  4R56 A;  4XU0 A;  1I0C A;  2G6F X;  1IRE B;  2EJF A;  2MWO A;  2IG0 A;  4BI3 A;  1UJ0 A;  1JB0 E;  4M78 D;  1MND A;  3MET A;  3RDV A;  1WX6 A;  2QG9 B;  2X3X D;  5IT9 E;  1E6G A;  2BTT A;  3O5Z A;  2EPD A;  1NYG A;  4E7I A;  2G3R A;  3ULR B;  1W2B P;  4KGX B;  4FW2 A;  5GAM e;  1EIF A;  2FO0 A;  3S3N A;  2QGF B;  2DAQ A;  2M0Y A;  1E6H A;  2K2V A;  4PNO A;  1PSF A;  4X9D A;  4LD6 A;  3L2R A;  5IHI A;  3J81 E;  1YHQ A;  1M2V A;  1U06 A;  5GAO m;  4C0Z A;  1VQM T;  2LTO A;  1PG5 B;  4JJC A;  2FB7 A;  2JUF A;  3I55 A;  1XNI A;  4J5Y A;  1WHG A;  1AT1 B;  2XG8 D;  4M78 B;  4M7D D;  3MCA B;  4QT7 A;  1KD1 C;  2YRV A;  2J7I A;  1W2B S;  1AEY A;  1D1A A;  5IN1 A;  3QYG B;  5IHN A;  2KNB B;  2RK2 A;  4HT8 A;  4EMG A;  1K4U S;  4AT1 B;  1RUW A;  3ASK A;  2C0I A;  2ZPI B;  1QKW A;  2K79 A;  2KGT A;  2E6Z A;  4XU3 A;  4Z02 A;  2VGM A;  3WVD B;  1MV0 B;  2CZ1 B;  5KYY B;  5FLX E;  4RKU E;  4LDY A;  5GAN d;  1YJN T;  1YJW Q;  1PKT A;  5IH2 A;  3QXE B;  1IXD A;  4PFP A;  3DB3 A;  1VQ9 T;  4KT0 E;  4JJN K;  1W2B A;  2HCK A;  3P8B B;  3JB9 F;  4M7D B;  5GAM d;  2H3E B;  1AWO A;  1XTD A;  4M7D C;  2L3P A;  1EZZ B;  1ARK A;  1WIE A;  2A37 A;  1SRM A;  1D1C A;  1OEB A;  3M9Q A;  4E7S A;  3PMI A;  4RG2 A;  1RAB B;  4C0D B;  2LVM A;  1NBE B;  4M75 D;  5FU7 B;  1GFC A;  1PKS A;  3H6Z A;  2GF7 A;  2RB6 A;  2JMA A;  3G71 A;  3OS1 A;  3OYD A;  2ED1 A;  4C0D C;  2EQK A;  4QQG A;  2ECZ A;  5FU7 C;  3VV0 A;  2E10 A;  1X27 A;  3CCV A;  5DLO A;  2A36 A;  4M7A B;  5D6W A;  2B86 A;  3RKX A;  3VS1 A;  3RES A;  4LUD A;  1SHF A;  1GBR A;  5I22 A;  2NUT A;  4M7A C;  4XU2 A;  4M7A E;  4AFZ C;  4JJD A;  5GAN 7;  3X25 B;  2A3L A;  2L89 A;  3FB9 A;  4N4I A;  3CC2 A;  3V7R A;  2ZAE A;  1NE8 A;  3L2W A;  1TS9 A;  1XOV A;  3OSS C;  3UT1 A;  3VYH B;  2BE7 D;  1K76 A;  2JS0 A;  4F7U E;  4AFS C;  5KYU A;  3MKD A;  3PGG A;  5LL6 S;  4II1 A;  2HKQ B;  3N5B B;  2DER A;  1LNX A;  3VS5 A;  4HVU A;  4Y28 E; 
#chains in the Genus database with same CATH homology
 2DVJ A;  1M30 A;  2L3Q A;  1OPK A;  1PRM C;  2DL8 A;  3SHW A;  2FG0 A;  2KRS A;  3I5S A;  2KXC A;  1UFF A;  4A63 B;  1S1N A;  1WYX A;  2BZ8 A;  1UGV A;  1WI7 A;  3H0I A;  2LP5 A;  2O9S A;  1JQQ A;  1SSH A;  3JV3 A;  1N5Z A;  2OI3 A;  3IQL A;  3NPF A;  3EG0 A;  1JXO A;  2DM1 A;  2J6K A;  2KT1 A;  1TG0 A;  5FWB A;  2H8H A;  1M3B A;  1YWP A;  2LCS A;  2J06 A;  1ABO A;  1WXB A;  2DIL A;  3PE0 A;  5FW9 A;  2EYX A;  2KEA A;  1H92 A;  2KYB A;  4ORZ A;  2LX7 A;  2DRK A;  2VKN A;  5GJV B;  4GLM A;  1ABQ A;  2DNU A;  4EIK A;  1X6G A;  4F17 A;  2KBT A;  3M0T A;  4ZNX A;  2HDA A;  1G2B A;  3SEM A;  1YN8 A;  1T3L A;  2RMO A;  2YUP A;  4F14 A;  1YWO A;  3UA6 A;  1WFW A;  1NM7 A;  2EBP A;  1KSW A;  1JO8 A;  1UTI A;  2A28 A;  3TSW A;  1E7O A;  2DMO A;  4RTT A;  1AZE A;  5HCK A;  1QWF A;  4CC3 A;  3VS4 A;  3PVL A;  2SRC A;  2D8H A;  4IIM A;  2KYM A;  1JEG A;  1Y0M A;  3C0C A;  5L23 A;  2K7A A;  1X69 A;  2DL4 A;  1JU5 C;  2EYY A;  2AZV A;  2GNC A;  2JT4 A;  2GGR A;  2DL7 A;  4OMM A;  2D1X A;  4OMP A;  2LJ3 A;  4J9H A;  2DJQ A;  1ZBJ A;  1WLP B;  4J9F A;  2LQN A;  2KE9 A;  1UEC A;  1VYT A;  4HVW A;  1PRL C;  1X2Q A;  2DBK A;  1K9A A;  2JTE A;  1MV3 A;  2AKL A;  2RQV A;  1YP5 A;  2CT4 A;  2YDL A;  5IHK A;  1ZUU A;  2KRO A;  4AFQ C;  2K6D A;  1RLP C;  3NMZ C;  4CC4 B;  2DLP A;  1PNJ A;  2FRW A;  4JJB A;  1B07 A;  2EYZ A;  3QWX X;  2DA9 A;  2FPD A;  2PNI A;  2IIM A;  4M4Z A;  2JM8 A;  2W10 A;  1KFZ A;  1W70 A;  1ZX6 A;  2JM9 A;  2RQU A;  4K11 A;  2LJ0 A;  1X6B A;  3EG1 A;  1YCS B;  1BBZ A;  2ROL A;  2HBW A;  3REB B;  3H41 A;  1X2K A;  2L0A A;  1WDX A;  2L2P A;  2LJ1 A;  5GJW B;  1HD3 A;  1G83 A;  2LZ6 B;  1OV3 A;  2L3S A;  5I11 A;  1CSK A;  5ECA A;  3ZL7 C;  2JMC A;  2FPF A;  4FSS A;  2HEQ A;  3U23 A;  1HSQ A;  1UHF A;  2EGC A;  1QKX A;  2DX1 A;  1WXT A;  1AVZ C;  2EQI A;  2BZX A;  3VS2 A;  4JZ3 A;  2MIO A;  3M0U A;  1VA7 A;  3EGU A;  3EHR A;  4J9B A;  1GL5 A;  2MCN A;  1M3C A;  3EG3 A;  2AKK A;  1W6X A;  2V1R A;  1QLY A;  1NLP C;  1QWE A;  4D8K A;  1MUZ A;  3NGP A;  1AWW A;  3I35 A;  4OML A;  4J9E A;  1VYV A;  2CDT A;  4OMQ A;  2OAW A;  3PVQ A;  4AFU C;  2CUB A;  2KRM A;  1OPL A;  4LNP A;  1H3H A;  2YUQ A;  1GRI A;  1BB9 A;  1Y57 A;  2X3W D;  2QDL A;  2K3B A;  4X1V A;  2J6F A;  2GQI A;  4RTV A;  1M8M A;  3VS3 A;  3KFV A;  2AZS A;  1UHC A;  2W0Z A;  1RI9 A;  2ROT A;  1YNZ A;  2YT6 A;  4J9D A;  4IIO A;  2EKH A;  2LQW A;  1A0N B;  4J9C A;  1NYF A;  1PHT A;  3UF4 A;  1M27 C;  2CSQ A;  2ENM A;  2GTO A;  1VYU A;  3M0P A;  4F16 A;  1QCF A;  3M0Q A;  1ZLM A;  1FMK A;  3VS7 A;  2DYB A;  2DL5 A;  1M3A A;  2E5K A;  3H0H A;  2EYW A;  1GCQ C;  2K2M A;  1V1C A;  3H0F A;  2RQR A;  3TVT A;  1AOJ A;  1J3T A;  1W1F A;  1AZG B;  1I07 A;  2D0N A;  3UA7 A;  5FWC A;  1WA7 A;  1I0C A;  2G6F X;  3VS0 A;  4LN2 A;  1UJ0 A;  5IXF A;  2P4R A;  1Z9Q A;  2AK5 A;  2D8J A;  1TUC A;  1WX6 A;  3I5R A;  4J9G A;  5IXB A;  1HJD A;  1T0H A;  1LCK A;  2X3X D;  3LH5 A;  1E6G A;  2ABL A;  2BTT A;  2PZ1 A;  3O5Z A;  2CH4 A;  4RTX A;  2FPE A;  2C0T A;  3RNJ A;  2EPD A;  1NYG A;  2RNA A;  2J6O A;  1ZUK A;  3I9Q A;  1U3O A;  2KXD A;  3VS6 A;  3ULR B;  2GBQ A;  4AG1 C;  4J9I A;  1T0J A;  1UUE A;  1U5S A;  1GCP A;  2FO0 A;  2RF0 A;  2M0Y A;  1E6H A;  2M51 A;  2MOX A;  4CC2 A;  2F2W A;  3THK A;  1SHG A;  3VRY A;  2VWF A;  1UE9 A;  1CKA A;  1ZUY A;  2I0N A;  2RQT A;  2LNH B;  4OMN A;  4OMO A;  4E6R A;  5IHI A;  4ESR A;  2XMF A;  2NWM A;  1U06 A;  4D8D A;  1KJW A;  2V1Q A;  1AWX A;  4JJC A;  4RTW A;  2DRM A;  1WXU A;  2BZY A;  1FYN A;  2NUZ A;  1TUD A;  1I1J A;  1GBQ A;  1AWJ A;  1GCQ A;  2FRY A;  2KT8 A;  2PTK A;  2F2X A;  1JXM A;  4QT7 A;  2KR3 A;  2EGE A;  2J7I A;  2EVR A;  2C0O A;  2ESW A;  1AEY A;  4Y92 A;  1UG1 A;  5IHN A;  2KNB B;  2OJ2 A;  1ZSG A;  2DBM A;  1K4U S;  4RTU A;  2A08 A;  1RUW A;  1AD5 A;  2C0I A;  3VRZ A;  1QKW A;  2K79 A;  2KGT A;  2RQW A;  4WCI A;  2RPN A;  3FJ5 A;  1MV0 B;  2CUD A;  3R6N A;  4JPB W;  4LUE A;  1CKB A;  2HSP A;  1K0S A;  4DEY A;  4HVV A;  1GFD A;  4JZ4 A;  3EG2 A;  1NLO C;  1PKT A;  1T3S A;  4Z89 A;  5IH2 A;  2CRE A;  1OOT A;  1PWT A;  1B3Q A;  2KRN A;  2FEI A;  2HCK A;  2CT3 A;  4Z88 A;  3QWY A;  4HXJ A;  2LMJ A;  2O88 A;  1AWO A;  3RBB B;  2VVK A;  2L3P A;  3M0S A;  1ARK A;  1WIE A;  2A37 A;  3EHQ A;  1SRM A;  1RLQ C;  4DEX A;  1K0X A;  1OEB A;  1SEM A;  2J05 A;  1UDL A;  2DF6 A;  1BU1 A;  4GBQ A;  2F2V A;  2YSQ A;  2O2O A;  1GFC A;  1PKS A;  2RN8 A;  3A98 A;  2JMA A;  2ED1 A;  1EFN A;  1NEB A;  1BK2 A;  2CH4 W;  4LE9 A;  4R0K A;  2ECZ A;  1UJY A;  2GTJ A;  1Z9Z A;  2ED0 A;  1X43 A;  1X27 A;  2A36 A;  3CQT A;  2B86 A;  2JXB A;  2SEM A;  2JS2 A;  4Z8A A;  3REA B;  1H8K A;  3VS1 A;  4HCK A;  4LUD A;  1SHF A;  1GBR A;  5I22 A;  5EC7 A;  4RTZ A;  3TSZ A;  2CSI A;  4AFZ C;  3GBQ A;  4JJD A;  4RUG A;  2JW4 A;  2EW3 A;  2DE0 X;  1IO6 A;  4KRT A;  2EGA A;  1XOV A;  2O9V A;  1K1Z A;  3M0R A;  1SRL A;  2YUO A;  1KIK A;  1K76 A;  2DL3 A;  2K9G A;  2JS0 A;  2YUN A;  3NHN A;  4AFS C;  3UAT A;  4CC7 A;  4RTY A;  1NEG A;  2O31 A;  1SPK A;  1NG2 A;  3VS5 A;  4HVU A;  4AG2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...