2JM9A

R21a spc-sh3 bound
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
b'MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
molecule tags Structural protein
source organism Gallus gallus
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jm9A00
2LCSA 4OMOA 1ZUYA 4EIKA 4D8KA 3TVTA 2KBTA 3GBQA 5EC7A 2V1QA 1UJ0A 2LNHB 1ZSGA 1Z9ZA 2RQUA 4HCKA 1AOJA 1UGVA 1K76A 1X6GA 1X43A 3H0FA 2CSQA 1WYXA 2CSIA 1PHTA 2DL5A 1X69A 3R6NA 1BBZA 2M0YA 4RUGA 1QLYA 2EGEA 4OMNA 3PE0A 3TSZA 2L3PA 1OEBA 2ROLA 1JXMA 2O2OA 1GBRA 2LJ0A 2V1RA 1X2KA 4OMPA 4Z88A 2X3XD 2DBMA 1NYFA 4LE9A 4AG2C 2KRSA 1WDXA 1E6GA 2DL8A 1ZX6A 1YN8A 1XOVA 2DRKA 1QCFA 3M0TA 2GTJA 3REAB 4J9EA 3NHNA 1K9AA 2D0NA 2JS2A 4F14A 3VS2A 2OI3A 4ESRA 1MV3A 4WCIA 2DLPA 4J9GA 2EGCA 2JT4A 2EYYA 2RPNA 1W1FA 2AK5A 2XMFA 2CUBA 2EYXA 1KJWA 3SEMA 2AKKA 3EG3A 1MUZA 5IHIA 1MV0B 1G83A 2AZVA 2LQNA 1YP5A 2EW3A 2ROTA 1Z9QA 1FYNA 1WX6A 1GBQA 2HCKA 2FG0A 1PKSA 1M27C 2ESWA 2W0ZA 1RLQC 3REBB 1X2QA 2HBWA 3VS7A 2DYBA 5ECAA 1X27A 1X6BA 2KT1A 2VWFA 4RTVA 1OPKA 4X1VA 2EPDA 2KYMA 1V1CA 1OPLA 2J7IA 2L0AA 2YUNA 1J3TA 2E5KA 1RUWA 2D8HA 4OMQA 2CT4A 2GTOA 1JU5C 3LH5A 1HJDA 1VA7A 1ABQA 1YWPA 4FSSA 4J9FA 1GFDA 3UATA 2J05A 2LJ1A 1U5SA 1WI7A 2JMAA 3EHQA 1ABOA 1UE9A 1T3SA 4LUDA 2GGRA 3ZL7C 3UA7A 4LUEA 2ECZA 3RBBB 3I9QA 4D8DA 4OMMA 2L3SA 3VRZA 2I0NA 2ABLA 4Z8AA 3C0CA 1PNJA 3QWYA 1VYTA 1T0JA 4IIMA 2LQWA 4ZNXA 1AWOA 2K79A 1U06A 1WXTA 3NPFA 2RF0A 1JO8A 2EKHA 1JXOA 2DL7A 1UFFA 2C0IA 1BK2A 2DL3A 4RTYA 1AZEA 1K4US 1RI9A 3JV3A 2KRMA 1VYVA 1E6HA 4M4ZA 2MCNA 1SHGA 1B07A 2GQIA 2D8JA 3VS6A 1WA7A 1OV3A 2FO0A 3RNJA 4GBQA 1KFZA 2KEAA 1RLPC 2O9VA 2LZ6B 4OMLA 2VKNA 1PKTA 5IHKA 2J6FA 1I0CA 1NLPC 2D1XA 2KE9A 1Y0MA 2CREA 4Z89A 3NGPA 1GCQA 2YUPA 3IQLA 1M3AA 4J9DA 2W10A 2IIMA 4AFZC 3M0PA 2O9SA 4K11A 4DEXA 1G2BA 2FRWA 2JTEA 2C0OA 2J06A 3UA6A 1QKXA 1QWEA 4LNPA 2G6FX 1EFNA 4RTWA 2P4RA 1UTIA 2LMJA 1WFWA 2A08A 2M51A 2JMCA 2OJ2A 1I1JA 2F2VA 1GCQC 3M0QA 3THKA 2DJQA 1GL5A 4RTTA 2YSQA 1WXUA 1SSHA 2C0TA 5FW9A 2ED1A 5IHNA 3CQTA 1AVZC 4J9CA 2K3BA 3EG0A 1T3LA 1VYUA 3VRYA 2B86A 2KRNA 1I07A 1UJYA 1AZGB 4HVWA 2BZ8A 2RQRA 1M3CA 1W6XA 2EQIA 3M0UA 4CC2A 2DVJA 2AZSA 3I5SA 2MIOA 1BB9A 4J9HA 5I22A 2DA9A 2HSPA 3TSWA 4J9IA 3VS1A 2JM9A 4JZ4A 1GRIA 2GNCA 3I35A 1PWTA 4RTUA 1UHFA 3M0SA 1TUDA 2K7AA 2DX1A 1LCKA 5GJWB 1AEYA 1IO6A 2RQWA 1NLOC 1SEMA 2FRYA 2OAWA 1FMKA 2MOXA 3KFVA 2QDLA 2DBKA 2JM8A 2KROA 2RNAA 2PZ1A 3EHRA 2CH4A 1H8KA 2K6DA 4HXJA 2HDAA 2LP5A 2DRMA 4AFQC 1SHFA 3H0HA 1WLPB 2H8HA 5IH2A 2O31A 3M0RA 5FWCA 1K1ZA 1YNZA 5HCKA 1UG1A 2LJ3A 5L23A 1QWFA 1AWXA 4Y92A 1QKWA 1NM7A 4JJDA 1H92A 3EG2A 3I5RA 5FWBA 1SPKA 1NYGA 4GLMA 1HD3A 1U3OA 2BZXA 2KR3A 1PRLC 2YUQA 4F16A 1K0XA 2BZYA 4LN2A 1E7OA 1ZUUA 3U23A 2RMOA 3FJ5A 1CSKA 3H41A 2K9GA 1WIEA 1CKBA 2KNBB 2GBQA 2RQTA 1PRMC 2K2MA 2DMOA 4AG1C 1NG2A 2DL4A 3PVLA 2KXCA 2AKLA 2DM1A 1A0NB 2F2XA 1TG0A 4KRTA 3VS0A 3PVQA 2CH4W 1TUCA 2HEQA 3VS5A 5GJVB 1M30A 3EG1A 2LX7A 1NEBA 4RTXA 4J9BA 4F17A 2SRCA 2RN8A 1AWWA 1UUEA 4DEYA 2X3WD 1KSWA 3SHWA 4JPBW 1T0HA 2DE0X 4HVUA 1W70A 2VVKA 4AFUC 3A98A 1M8MA 2EBPA 2KXDA 2FEIA 1GCPA 2YDLA 1YWOA 2NWMA 2A36A 2JXBA 1B3QA 2JS0A 2A28A 1ZUKA 1BU1A 2SEMA 5IXFA 1S1NA 2FPFA 2YT6A 1WXBA 4RTZA 3NMZC 3VS3A 3O5ZA 5I11A 1SRLA 2NUZA 1KIKA 1CKAA 1UDLA 2L3QA 1JEGA 2J6KA 3H0IA 4HVVA 2F2WA 4E6RA 2RQVA 2O88A 2ED0A 4IIOA 1ARKA 1AWJA 1AD5A 2KYBA 3EGUA 1H3HA 2EVRA 2ENMA 4AFSC 1ZBJA 2KGTA 2FPDA 5IXBA 1K0SA 1M3BA 2L2PA 2PTKA 2A37A 4QT7A 4JJBA 2DF6A 2BTTA 1YCSB 4ORZA 1Y57A 3ULRB 1UECA 1SRMA 3VS4A 2KT8A 1OOTA 2EYZA 2PNIA 2JW4A 2J6OA 2DILA 3QWXX 1NEGA 1N5ZA 2FPEA 2DNUA 2EYWA 4A63B 1UHCA 2CT3A 1GFCA 1JQQA 2YUOA 1ZLMA 4CC4B 2CDTA 4JZ3A 4R0KA 2CUDA 1HSQA 2EGAA 4JJCA 4CC7A 3UF4A 4CC3A
chains in the Genus database with same CATH superfamily
4PFZA 2EJGA 2LCSA 4OMOA 1ZUYA 3C95A 4C92F 3NTKA 2WSEE 3JB9J 4M78F 4C92A 2RHUA 1NE8A 3INZA 1UJ0A 2DPPB 1Z9ZA 2RQUA 4ZN3A 2KMTA 4BE2A 2QEXA 1K76A 2HL3A 2VV5A 3V7CA 2DL5A 4QVCA 4KH1B 4RUGA 5LJ3e 2EGEA 2EWNA 4BDYA 4OMNA 3DB4A 1OEBA 3ZBDA 2LJ0A 1K73U 3BFMA 4C92G 5GANg 3E2UA 3QYGB 3R6OA 2QTVA 5GAN5 2QGGA 2X3XD 1JB0E 1RACB 1K9MR 4LE9A 4F7UG 2KRSA 4KGXB 2DL8A 1ZX6A 1YN8A 1XOVA 4QQGA 4M7DG 1YITT 3G6EQ 2FB7A 3NHNA 5LJ3h 2RH2A 4DBHA 3VS2A 1MV3A 2RJEA 1BIAA 2DLPA 5CKHA 1IHVA 2JT4A 2AK5A 2FHDA 2EYXA 3X24B 2EJ9A 1MGQA 4A4FA 4QKUA 1PM3A 3WVEB 2AZVA 5KYUB 1YP5A 1WHLA 1FYNA 1GBQA 2HSEB 4PLLA 1PKSA 2ESWA 1PCXA 2DIGA 2A0FB 2CP7A 2RM4A 4MMKA 2HBWA 2H3JA 3OYDA 1YFNA 2HNIA 1C1AA 1K73R 1D3BB 2EPDA 1N27A 1Q86R 2WSCE 1RUWA 1TSFA 1NJIC 4ZTJA 2CT4A 1JU5C 3CPWA 3LH5A 4J6YA 5CO7A 1VA7A 1YWPA 3LWIA 1GFDA 2OTJA 1NJIR 4C0DC 1VQ6T 1U5SA 3CCEQ 4NOYA 5LJ5f 3JCMQ 1PSEA 4B9XA 1UE9A 4LDVA 2XDDA 4LUDA 3I56Q 2GGRA 4WTOB 4JDSA 3RBBB 4A4HA 4L59A 3I9QA 2V8IA 1R0CB 3P8BB 4OMMA 4D8DA 1YI2Q 3JAME 1VQ6A 2L3SA 3VRZA 5GAOn 2DVEA 2ABLA 4Z8AA 4IUUA 1PNJA 3QWYA 5FU7C 3CMET 2P0QA 1EX4A 1LPLA 1WXTA 1KHCA 2M1HA 1OI1A 2JZ2A 1Q82C 1RAIB 1BK2A 1O75A 4JUVA 4PJOA 1PD0A 3JV3A 2KRMA 3MEVA 4FW1A 2MF2A 4JJNK 2GQIA 3HRSA 3EFOA 2D8JA 3VS6A 2LC4A 2HMAA 1KHIA 3KXTA 4DQ2A 1QMCA 3A8HB 3UPUA 2LX9A 4VUBA 2VC8A 2YRVA 1SKUB 2CS7A 1PKTA 5IHKA 4YTLA 3D7SB 5DY9A 1Y0MA 1Q81R 5LJ5g 3IQLA 1B34B 4N4HA 2K4YA 2W10A 1M4ZA 5GMKh 2IIMA 3EH1A 2QAZA 1NBEB 4F7UA 2JTEA 2J06A 1QWEA 2E6NA 1M9SA 3MHXA 2G6FX 2KY9A 4A53A 3OYJA 3OYCA 3RMQA 1MHNA 3M0QA 3J7AF 5GMKm 2LCLA 1GL5A 1FWZA 4ZGEB 2HQHA 4M7AE 2ED1A 4JLGA 4NL3A 4J8OA 2K3BA 1M5Q1 3VRYA 2B86A 4E7ZA 3TREA 4R55A 3CC2A 5CK9A 1M90R 1VQ7Q 1G3YA 1M3CA 4B6MA 5LJ3g 1VIEA 2RI5A 4BY6B 3I5SA 3LGFA 2MIOA 3H6ZA 4J9HA 5I22A 2PVGB 2HSPA 3TSWA 1M2VB 1B34A 1I5LA 3VS1A 3JSCA 3P8DA 4PFOA 2JM9A 4JZ4A 1MMAA 3OYBA 4RTUA 1M90U 3OYFA 1PG5B 4DA4A 1TUDA 1R0BG 2DD5A 1MNDA 1I81A 2L89A 1AEYA 4IURA 2OTJT 1NLOC 1SEMA 1Y7XA 4KUIA 4GY5A 4XTXA 2DBKA 4A4GA 2QK0A 4PJJA 3HRUA 3CMAA 2QG9B 2CH4A 3VUZA 2X4YA 2XHCA 2EJFA 2F5KA 2LP5A 3JCMd 3T9NA 3H0HA 2NUPB 1WLPB 5IH2A 1LJOA 4IUPA 2OTJQ 4FYYB 1K1ZA 1YNZA 1VQNA 2CP0A 2EQKA 2GF7A 2M16A 3X20B 2LJ3A 1KG1A 2R57A 5DM7R 3HKSA 3JCMJ 2E64A 2DAQA 1H92A 4E7IA 5CKBA 3VJPA 2K5LA 1Q7YR 1U3OA 3JB9F 1TWBA 4LD6A 2F1LA 2EKOA 2KQWA 3CCST 2O4XB 2YUQA 3HFOA 1QVPA 1ZQ1A 1QVFP 4QVZA 4EPCA 3PTAA 4M75E 3EAEA 1YJWT 1ZUUA 2MK5A 2QTXA 5LJ5h 3V8JA 4XTUA 3H41A 2K9GA 4RKUE 2PQWA 4C8QG 1D1BA 2RQTA 2DMOA 5AYFA 4C8QD 1KQ2A 3CPWS 1SSFA 2H3EB 2Y4XA 2DETA 2E3HA 2E3IA 1XTDA 4FYXB 3HPWA 4J7IA 3PVQA 4HT8A 2HEQA 3S3MA 3CCSA 3EG1A 3TQ7P 1NEBA 3DLLA 2QA4A 2YLCA 4F17A 3L2ZA 3QIIA 3RKWA 1VQ4Q 3JCMf 2QEXT 3JB9H 4XU0A 4R56A 4IUVA 2ZZDA 1D0YA 2XG8D 5FRMA 4OB1B 1X01A 2EIFA 3HL8A 1GCPA 1YWOA 3OQ5A 2A36A 2JXBA 3CXCA 1VQNT 1ZUKA 1BU1A 2VXFA 2YT6A 3I55T 2ZPHB 2K3XA 2DXCA 1D3BA 3O5ZA 1K8AR 1KQSS 1VQ8A 1SRLA 4V2SA 3GNGA 2GQVA 2L3QA 4HVVA 3CCRA 2GFAA 4BUGA 1BI2A 4M7AD 3CCLT 4BI4A 2YHTA 1AWJA 3CC7T 3OYAA 3EGXB 4M7AC 3LW5E 4AFSC 2DEQA 5GAOm 1YCYA 3BW1A 3J81E 1M3BA 2L2PA 4O5VA 4FL6A 2A37A 4QT7A 5CKFA 5HK3A 2DXUA 3OBWA 1YCSB 5CAIA 4XK8E 3WVDB 3DKMA 4EMHA 2EYZA 2JW4A 2J6OA 3CC2T 3G7ZA 3OS1A 2DTHA 2NUTB 4P5NA 4ZGJB 2P84A 1K9MU 2EYWA 4A63B 2JVVA 3OW2P 1GFCA 4BD3A 1Q95G 1D1CA 3EFOB 3QJ6A 2YUOA 2KSSA 3RIRA 2HKNA 4MMLA 1ZSZC 4JZ3A 4R0KA 4C0GA 2EGAA 4E7LA 4X9CA 3SWNB 9ATCB 1WHGA 4EIKA 4D8KA 4PFPA 3G6ET 3CCJQ 3SFMA 1IXDA 3GF5A 4M7DA 1BYMA 1ZSGA 4XTWA 1AOJA 1UGVA 1X6GA 3OBYA 1RADB 1PHTA 2M9UA 1VQ4A 1OZ2A 3PE0A 3TSZA 2ROLA 1TTHB 5LJ3f 1JXMA 3M5AA 4IKFA 2O2OA 3OS2A 2V1RA 1X2KA 1VUBA 3OYYA 2DKGA 4OMPA 4ZGDB 3CC4A 4XTZA 3ZEHA 3WXMB 4AG2C 1WDXA 3M55A 1E6GA 1D0ZA 4C92C 5L8RE 2LCCA 5GANj 3M0TA 1PSFA 3REAB 5KYYB 2ZPIB 2HL5C 1UGQB 3J80E 3EH2A 1D0XA 2NLUA 1WNLA 4WCIA 3FJPA 2GCXA 2RPNA 2CUBA 5AT1B 4BI3A 1ZHIA 3LH0A 3RUXA 1S72T 2EFIA 2AKKA 1YJNQ 8AT1B 1MV0B 2ROTA 3MP6A 4KT0E 4KH0B 1N8RC 5KE3A 2HCKA 3QYHB 2FG0A 2DEUA 2AIRB 1OZ3A 2W0ZA 2OTLA 1X2QA 2XKOC 3G6EA 2O4XA 1OPKA 2KYMA 2L0AA 2J7IA 3OYMA 3S6WA 1RAAB 2GTOA 4EDUA 2CKKA 2XD0A 2CP2A 3JCMP 2DZ9A 2OX7A 4FSSA 4J9FA 2BE7D 1VQ6Q 1MMGA 4CI0C 1WI7A 4E7JA 1I8FA 1F1BB 1M8VA 5D6YA 4E7HA 1T3SA 2V8JA 3ZL7C 3SDZA 3EGDB 1G5VA 2A3LA 2MYSA 2I0NA 5FROA 2RHYA 2K5FA 3C0CA 1OU9A 1DJ7B 1T0JA 2L5QA 2LQWA 4IIMA 5A0DA 3EFSA 1M1KR 3NPFA 2EAYA 2RF0A 1QVGS 1JO8A 4F7UF 4A4EA 3CC7A 2DL7A 1VQLQ 2VASA 3CCSQ 5FU7B 2C0IA 3A1PA 3VUBA 2MAMA 1TH7A 4M4ZA 1B07A 4Y91A 3CD6T 3RNJA 4M78C 1VQPQ 1RLPC 4ZTFA 2D6FA 1G3TA 2LZ6B 2VKNA 3QSUA 2KE9A 1NLPC 2D1XA 2CREA 3RR6A 2X4XA 1HK9A 2YUPA 1KD1U 4JLIA 5GAN3 1M3AA 3AHUA 4K11A 3EGDA 3UWNA 1YI2A 4C92E 3UA6A 1QKXA 4LNPA 3C4SA 1Q81U 4M7AA 1UB4A 2RJCA 4JS5A 2QA4T 4ME7A 2RA2A 5HKCA 3P8HA 1HYOA 2EQJA 2YSQA 1WXUA 1SSHA 1U1SA 5IHNA 3CQTA 4PLIA 3OMGA 1NPPA 2RJDA 5FU6C 1KC8C 1I07A 1UJYA 5KYWA 1KQSP 1TOVA 4N0AA 2JJ9A 3MO8A 2RQRA 1VQ7A 2HQEA 2FZKB 1YJWA 4CC2A 3JB9G 1XQHA 2DVJA 1BKBA 1BB9A 4QVDA 2DA9A 2LNVA 4J9IA 4DOVA 1VQKA 2QYZA 4OGCA 8ATCB 4M78B 1GRIA 2GNCA 3X26B 4M77D 5KCHA 1Q7YC 1VQPA 1ZSZB 3CCVA 1X6OA 1UGSB 2RHIA 3RKYA 2JN0A 1OU8A 1QCNA 2RQWA 4BDZA 1FMKA 2MOXA 1GXIE 2V26A 2COYA 2JTFA 2QDLA 3KFVA 4PK4A 2KROA 1Q86U 2R5MA 2X35A 2K6DA 3PGGA 5GAMf 5KYXA 3GPLA 3E19A 2MI6A 3G4ST 5HCKA 2K2VA 5L23A 1QWFA 1VQNQ 2YRDA 1AWXA 1QW1A 4Y92A 1NM7A 4JJDA 2JOYA 3H9NA 2KAFA 5GMKj 5FWBA 1SPKA 3FEOA 1JRIA 1NYGA 1AT1B 2YLBA 3CCQQ 2XDBA 2E4HA 2KR3A 4C92B 1PRLC 3LLRA 2HKQB 1IHWA 4X9DA 4PJOE 2RD1A 1U1TA 2BZYA 4LN2A 4BB7A 3A8LB 1MNEA 3FJ5A 1CSKA 4F7UB 5GANe 5A0LA 3CCJT 3G71T 2P4TA 2WSFE 2KNBB 4M77C 2K2MA 1NG2A 2DL4A 3PVLA 3EG9A 1A0NB 3M57A 2E6ZA 3CMAT 4KRTA 2LX7A 1R77A 4FIBA 1EIFA 3A8GB 3FB9A 4PJOD 2SRCA 1AWWA 4DEYA 1KSWA 5LJ3d 4M78E 2IVWA 4AFUC 5CKDA 1RI0A 3L2UA 1YJ9Q 1WHJA 5LJ5j 1G8XA 2DIQA 1WJRA 2VUBA 1S1NA 4QQ6A 2E70A 4C0FA 4NL2A 1FMWA 3LX7A 1QVGA 3NMZC 3UDCA 5HK0A 5I11A 3HRTA 2NUZA 3FIFA 1S72Q 3LGLA 1WJSA 3PMTA 2HAXA 4LD9K 1UDLA 1X75C 3M53A 5LJ5d 5IAYA 2VGNA 2J6KA 1VQLA 3E9GA 4FYWB 3QHSA 2ED0A 2Y90A 4M75B 2JUFA 3EGUA 1VQ9A 2Z0WA 2KGTA 2CP5A 1N9SA 5IXBA 2AHJB 2ZPGB 1QVGP 1LNXA 4M77F 4JJBA 4HT9A 5D6XA 2DF6A 2F69A 4D6WA 1Y57A 1BCMA 1UECA 1SRMA 2KT8A 5CVIA 1OOTA 2DILA 1EZZB 2JTMA 1NEGA 1N5ZA 3OYIA 2DNUA 1VQOQ 1JQQA 3S3OA 3L42A 5CCAA 1ZLMA 3QG1A 2CDTA 1MMNA 5FRNA 1OYXA 3PMIA 1ZBXA 4PJOC 3CXCP 2KBTA 2O01E 3V8KA 5EC7A 2LNHB 3V8LA 2IPOB 4C5GA 1X43A 2E10A 3H0FA 1WYXA 2CSIA 3JRZA 4M75A 3R6NA 2M0YA 4TVRA 1VOMA 3GIBA 1KC8U 4JRKA 3MP1A 1FX7A 2LRQA 3PIPA 1GBRA 4HKEA 4EMKA 3OYKA 4J83A 4FM4B 3CCLQ 2M02A 1Y71A 3CCLA 3QJYA 4Z88A 3EGXA 3Q1JA 1VQ4T 1NYFA 3JCMg 3CCMT 3VYHB 7AT1B 1U8RA 1IGUA 4HCZA 2GTJA 3I56T 4J9EA 1K9AA 1BCOA 2D0NA 4E7SA 2JS2A 4F14A 1Q82U 1M2OA 3KUFA 2OI3A 4ESRA 4OVAA 3JCMh 2EGCA 3TCJA 3CCUQ 2EYYA 1W1FA 4E2FB 2YWWA 4PJNA 3SEMA 5C6SA 3EG3A 1VQMQ 1YJNA 3JCMc 1WX6A 3SWNA 1XNIA 4FSXA 4MZTA 3L2RA 3A5ZB 4A54A 2E12A 5GAMj 1TU0B 1RLQC 1NPRA 3VS7A 2DYBA 5ECAA 5GAMd 4C8QA 2XI9A 3CBPA 2VWFA 3QZ9B 4X1VA 1WJQA 1V1CA 1OPLA 2YUNA 2X4WA 2BUDA 2NYSA 2E5KA 4OMQA 2FYKA 5DLQE 4M75F 1HJDA 3BDUA 3UATA 4C0ZA 4XAXB 2J05A 1V76A 1JBMA 1ZA1B 2MMPA 2LJ1A 2JNGA 3M59A 2CGHA 4QQDA 2RB6A 1SF9A 3CCRT 1ABOA 2QI2A 3UT1A 1YJWQ 3UA7A 2NUTA 2PU9B 4FT4A 2ECZA 2DXTA 3V7RA 4X34A 3OW2S 3G4SA 1W4SA 4M75G 4XU3A 2L3RA 5GAN7 4XTYA 3RERA 5M9OA 3OS0A 2NUPA 1M1GA 4ZNXA 4JRPA 1AWOA 2K79A 1U06A 4XU1A 4C8QE 2AT1B 4B9WA 1JXOA 3HFNA 3E9FA 2DL3A 1RI9A 3OB9A 1VYVA 4C8QB 3DLMA 1SHGA 2RK2A 2Y4YA 1H3ZA 4FYVB 1YI2T 1RAEB 1YJNT 2FO0A 1KFZA 4DBQA 5CQYA 1VQ7T 2CZ1B 1JJ2A 4OMLA 2J6FA 1I0CA 4FCYA 3JB9I 3EG9B 3NGPA 5LJ3j 1N8RR 3LWHA 4PNOA 3CCUA 2R5AA 3ER0A 3M0PA 2O9SA 2COWA 1AHJB 1G3SA 2FL7A 3RKXA 4DEXA 2FRWA 3SWNC 1EFNA 3DB3A 4RTWA 2P4RA 3OYGA 3JCMV 2LMJA 5CR2A 1WFWA 2JMCA 1QP3A 1B7TA 1I1JA 2F2VA 1UEBA 5D7UA 4RTTA 5FU6B 4PJMA 5CIUA 4M7DD 2C0TA 5FW9A 3CCQA 1AVZC 1WHHA 1RAHB 3EG0A 3BE3A 3MJXA 4HVWA 2DK3A 2BKDN 1WZOA 2DYIA 2EQIA 4BE1A 4KUDK 4PL6A 2AZSA 2MWOA 4L6V5 2DFUA 2QQ9A 4FW2A 3PNWC 2LVMA 4C92D 1UGRB 3I35A 3PFSA 1N6AA 3QXEB 2K7AA 3CCRQ 1QVFA 1IO6A 1I5OB 3SB2A 3MPUB 1IRXA 2A7YA 4M75D 2FRYA 3M9QA 3CPFA 2XIDA 1BI3A 2FZCB 3OW2A 3JCMW 2RNAA 3ZFJA 2DXBA 2COZA 5J3BA 1WQWA 1S72A 2HDAA 4PJLA 2DRMA 4AFQC 1SHFA 2H8HA 2K3YA 1VIFA 4LDWA 3HTRA 5FWCA 4ELYC 3G1JA 2ZAEA 4LDUA 5A0GA 1QKWA 1OQKA 2ZPBB 4PJOB 2QQSA 1N8RU 1VQMT 2EQMA 5GANf 1H641 2HBPA 1FMVA 1UGPB 4M78D 2BIVA 4N4GA 3JCMe 3LYIA 4RG2A 2OTLT 4F16A 4OMFB 4M7DC 1IREB 3VU3C 4MDXA 1K0XA 4EMKB 2X4JA 2RMOA 3U23A 5GMKi 2EYQA 2RI2A 4LDYA 1WIEA 3L2VA 2E65A 2RK1A 5GAN6 2GBQA 2XK0A 1PRMC 5GANd 5DLOA 1WPYA 2CYZB 4J6XA 3CXCS 4ZN1A 1TXQA 1KK7A 1TG0A 1M1FA 3VS0A 1Y96B 2LT1A 1VQ5T 4M77G 3VS5A 3CMAQ 2P0KA 5GJVB 1M30A 3EFRA 4RTXA 1XJWB 2RN8A 2D9TA 3I55Q 2LQKA 4JPBW 1T0HA 2DE0X 1JJ2S 1W70A 2VVKA 3A98A 4MZMA 2KXDA 3L2WA 2FEIA 4Q5WA 2YDLA 2NWMA 2D0QB 1B3QA 4FT2A 2JS0A 2A28A 3CMEA 2SEMA 3ME9A 3G4SQ 1WXBA 1BI1A 3OS5A 3VS3A 2XU8A 4DBRA 1Q7YU 3M4YA 1ZSZA 3MCAB 4N0AC 3X28B 4LDXA 3META 1K8AC 2HZYA 3H0IA 1KD1R 2F2WA 4KULA 1TS9A 4C0DB 2O88A 1KD1C 5IN1A 1VQMA 2DD4A 1QVFS 1H3HA 3CCVQ 2ENMA 1RL2A 1ZBJA 2K5IA 5KYXB 1K0SA 1VQ8T 2PUOB 4JRQA 4L5GA 3RMSA 2BTTA 2QQRA 3FLGA 3HHTB 4ORZA 4OB3B 3G71A 1IB8A 3CCVT 2PNIA 1PD1A 3QWXX 3NTHA 4BACA 2CT3A 2DJZA 1K9MC 3FDRA 4OF1A 3JCMX 4CC3A 2QXFA 3CC2Q 3TVTA 4M77A 3GBQA 3CC7Q 2V1QA 2MPXC 3URGA 4HCKA 3OMCA 4XTVA 5GAMe 3MEWA 6AT1B 2CSQA 3QKJA 1X69A 2HD0A 3N5BB 3M58A 1BBZA 4HA8A 4PJOG 1QLYA 4DBFA 1O9SA 2L3PA 5I2SA 2X51A 1OULA 4F04B 3CCET 4KGZB 3X25B 3L1AA 2KVQG 3NTIA 1C0MA 5FLXE 2DBMA 3C94A 4HCCA 1WGSA 4MDWA 1VQPT 2E5QA 2DRKA 4AT1B 4PJOF 1QCFA 2E1HA 1YJ9T 1YJ9A 3HSBA 3M54A 4II1A 5CQXA 3VYGA 4M7DE 1VQKT 2K57A 5GMKl 1YHQQ 1VQOA 4RMOA 4J9GA 2VYTA 2XMFA 2RI3A 5J26A 3JCMb 1KJWA 4ATOA 1ACMB 1N9RA 4M77B 4J5YA 1MUZA 5IHIA 3OSVA 5LJ5e 1G83A 2BE9B 2LQNA 4DOWA 3TEEA 2EW3A 1M1KC 1Z9QA 4OB2B 2F5TX 3MEAA 2PVDB 3CBMA 5GAN2 4BY6C 3GLXA 1M27C 2FVUA 1Y07A 3MKDA 4QW2A 3REBB 1X27A 1X6BA 1RABB 2GFUA 2KT1A 4RTVA 3OYHA 3G71Q 4GLKA 2DERA 4C5HA 1J3TA 2D8HA 5GAOl 1ABQA 4M78A 2VXEA 4N4IA 3OYNA 2QQBA 3NFCA 1LOJA 1M2VA 2JMAA 1VQKQ 3MEUA 1YIJA 3EHQA 4MZPA 1W2BS 4XU2A 1BI0A 5GAN8 4LUEA 4Z02A 4EMKC 1QCOA 1M90C 3A8OB 1NJIU 3MP8A 3TU4K 1G3WA 1P92A 4BE0A 2PVOB 1VYTA 1PC0A 2FZGB 2ATCB 2C06A 4PKCC 2RO0A 3QPHA 3I56A 2QDYB 3QBYA 2EKHA 3CD6A 1UFFA 4RTYA 4M75C 1AZEA 3CC4Q 1K4US 3CCMA 1QP2A 4E47A 1E6HA 2MCNA 5CKEA 1KQ1A 4RCBA 3HP9A 2R58A 3OSSC 1WA7A 1OV3A 3JB9D 4GBQA 2KEAA 2IG0A 2O9VA 2QASA 2CP3A 2QA4Q 4F7UE 2G3RA 3SD4A 3QO3A 3O8VA 4Z89A 1W2BP 3E1SA 2DTIA 1GCQA 3OYEA 2KI7A 4J9DA 5I2MA 4AFZC 3ASKA 5GANh 1G2BA 1VQ9Q 2C0OA 4E7KA 2QEXQ 1K8AU 1HXDA 1K73C 1VQ8Q 1UTIA 4EMGA 3FC3A 2LQ8A 3V7SA 2A08A 2M51A 2OJ2A 4HCBA 1WHMA 3AT1B 4BI8B 1GCQC 3F70A 3THKA 1VQ5A 5A2QE 3S3NA 2DJQA 2VB6A 5HY6A 4J9CA 2ZPEB 5LL6S 2YXYA 1T3LA 1VYUA 4M7AG 2ZPFB 1BIBA 2KRNA 1AZGB 2BZ8A 4J7FA 1W6XA 3M0UA 5IT9E 1IGQA 3PT9A 5GAMg 3L2QA 5KYUA 4OB0B 2EQUA 1YHQA 1MMDA 5GMKe 1JJ2P 1VQ9T 3PIOA 1VQLT 4M7AF 2V8KA 5GAOp 5GAOq 1PWTA 1UHFA 3M4GA 1OX9A 2XDPA 3M0SA 4A4KA 2KDSA 1V29B 1W2BA 2L8DA 2DX1A 1LCKA 5GJWB 1YHQT 2P0PA 3CC4T 4FU6A 2OAWA 3RDVA 2JM8A 4M77E 5I21A 3EHRA 2HQXA 2PZ1A 1H8KA 4HXJA 1Q81C 1FXXA 1KQSA 4C5IA 2O31A 3M0RA 1ZA2B 2QQAA 3OYLA 1UG1A 1QQJA 4KBMB 4OP0A 3A8MB 1YITA 1VQ5Q 3EG2A 4C5EA 3I5RA 2WACA 4KGVB 3CCMQ 4GLMA 1HD3A 3CD6Q 2BZXA 2OTLQ 3RESA 3I55A 1WQ7A 5GAOr 4C8QC 1C6VX 2RHXA 1Q82R 2CZ7B 1R8OB 1D09B 2B8AA 3VV0A 1E7OA 1I4K1 4IUTA 1IZ6A 1CKBA 4M7DB 3CEYA 1OX8A 2CZ6B 1LVKA 5KH6A 2VGMA 4AG1C 5C0MA 3CCQT 4CRIA 3BY7A 2KXCA 2AKLA 2DM1A 2F2XA 1M1KU 2CH4W 1KC8R 1TUCA 3C12A 4O6JA 1Y96A 2KK4A 3OA6A 2RHZA 4J9BA 1UUEA 2X3WD 3SHWA 4HVUA 4M7DF 2I2LA 3QDRB 4LXCA 4AMCA 4UC4A 4ELZC 1M8MA 1YBYA 2EBPA 4RG8A 2CZ0B 3CCUT 2YRCA 3CBOA 3GOXA 2RJFA 5IXFA 2FPFA 4JS4A 2XICA 1VQOT 4RTZA 1SG5A 3BDLA 3CPWP 4RCCA 2M0OA 2LTOA 3QDFA 3H8ZA 5KE2A 2MWPA 1YITQ 1WHKA 1KIKA 1CKAA 2LDMA 3CCJA 5GAN4 1JEGA 2LT4A 1RAFB 3M56A 4XQ3A 4ANJA 1YIJT 4M7AB 4C8QF 4E6RA 5GAMh 2RQVA 2OAUA 3VKIA 4IIOA 1ARKA 1AD5A 2KYBA 2EVRA 2E41A 3CCEA 2DO3A 2FPDA 5EG2A 2PTKA 1NZ9A 1RAGB 4IUQA 4WF2A 3OY9A 5KYNA 4OGEA 4JRIA 2DZCA 2ZCFB 3FRNA 3GNFB 2DTOA 5KYYA 1Q86C 4M78G 4NS5A 3ULRB 5KYWB 3VS4A 5J39A 5D6WA 4J6WA 3QZ5B 1D1AA 2ZGWA 4Y28E 3CMEQ 3QUIA 2FPEA 1UHCA 3KBGA 4CC4B 1TUGB 5KCOA 2QGFB 2CUDA 1HSQA 1YIJQ 2X9HA 2CP6A 4JJCA 4CC7A 2PUKB 3UF4A 3GP8A
chains in the Genus database with same CATH topology
2LCSA 4OMOA 1ZUYA 4EIKA 4D8KA 3TVTA 2KBTA 3GBQA 5EC7A 2V1QA 1UJ0A 2LNHB 1ZSGA 1Z9ZA 2RQUA 4HCKA 1AOJA 1UGVA 1K76A 1X6GA 1X43A 3H0FA 2CSQA 1WYXA 2CSIA 1PHTA 2DL5A 1X69A 3R6NA 1BBZA 2M0YA 4RUGA 1QLYA 2EGEA 4OMNA 3PE0A 3TSZA 2L3PA 1OEBA 2ROLA 1JXMA 2O2OA 1GBRA 2LJ0A 2V1RA 1X2KA 4OMPA 4Z88A 2X3XD 2DBMA 1NYFA 4LE9A 4AG2C 2KRSA 1WDXA 1E6GA 2DL8A 1ZX6A 1YN8A 1XOVA 2DRKA 1QCFA 3M0TA 2GTJA 3REAB 4J9EA 3NHNA 1K9AA 2D0NA 2JS2A 4F14A 3VS2A 2OI3A 4ESRA 1MV3A 4WCIA 2DLPA 4J9GA 2EGCA 2JT4A 2EYYA 2RPNA 1W1FA 2AK5A 2XMFA 2CUBA 2EYXA 1KJWA 3SEMA 2AKKA 3EG3A 1MUZA 5IHIA 1MV0B 1G83A 2AZVA 2LQNA 1YP5A 2EW3A 2ROTA 1Z9QA 1FYNA 1WX6A 1GBQA 2HCKA 2FG0A 1PKSA 1M27C 2ESWA 2W0ZA 1RLQC 3REBB 1X2QA 2HBWA 3VS7A 2DYBA 5ECAA 1X27A 1X6BA 2KT1A 2VWFA 4RTVA 1OPKA 4X1VA 2EPDA 2KYMA 1V1CA 1OPLA 2J7IA 2L0AA 2YUNA 1J3TA 2E5KA 1RUWA 2D8HA 4OMQA 2CT4A 2GTOA 1JU5C 3LH5A 1HJDA 1VA7A 1ABQA 1YWPA 4FSSA 4J9FA 1GFDA 3UATA 2J05A 2LJ1A 1U5SA 1WI7A 2JMAA 3EHQA 1ABOA 1UE9A 1T3SA 4LUDA 2GGRA 3ZL7C 3UA7A 4LUEA 2ECZA 3RBBB 3I9QA 4D8DA 4OMMA 2L3SA 3VRZA 2I0NA 2ABLA 4Z8AA 3C0CA 1PNJA 3QWYA 1VYTA 1T0JA 4IIMA 2LQWA 4ZNXA 1AWOA 2K79A 1U06A 1WXTA 3NPFA 2RF0A 1JO8A 2EKHA 1JXOA 2DL7A 1UFFA 2C0IA 1BK2A 2DL3A 4RTYA 1AZEA 1K4US 1RI9A 3JV3A 2KRMA 1VYVA 1E6HA 4M4ZA 2MCNA 1SHGA 1B07A 2GQIA 2D8JA 3VS6A 1WA7A 1OV3A 2FO0A 3RNJA 4GBQA 1KFZA 2KEAA 1RLPC 2O9VA 2LZ6B 4OMLA 2VKNA 1PKTA 5IHKA 2J6FA 1I0CA 1NLPC 2D1XA 2KE9A 1Y0MA 2CREA 4Z89A 3NGPA 1GCQA 2YUPA 3IQLA 1M3AA 4J9DA 2W10A 2IIMA 4AFZC 3M0PA 2O9SA 4K11A 4DEXA 1G2BA 2FRWA 2JTEA 2C0OA 2J06A 3UA6A 1QKXA 1QWEA 4LNPA 2G6FX 1EFNA 4RTWA 2P4RA 1UTIA 2LMJA 1WFWA 2A08A 2M51A 2JMCA 2OJ2A 1I1JA 2F2VA 1GCQC 3M0QA 3THKA 2DJQA 1GL5A 4RTTA 2YSQA 1WXUA 1SSHA 2C0TA 5FW9A 2ED1A 5IHNA 3CQTA 1AVZC 4J9CA 2K3BA 3EG0A 1T3LA 1VYUA 3VRYA 2B86A 2KRNA 1I07A 1UJYA 1AZGB 4HVWA 2BZ8A 2RQRA 1M3CA 1W6XA 2EQIA 3M0UA 4CC2A 2DVJA 2AZSA 3I5SA 2MIOA 1BB9A 4J9HA 5I22A 2DA9A 2HSPA 3TSWA 4J9IA 3VS1A 2JM9A 4JZ4A 1GRIA 2GNCA 3I35A 1PWTA 4RTUA 1UHFA 3M0SA 1TUDA 2K7AA 2DX1A 1LCKA 5GJWB 1AEYA 1IO6A 2RQWA 1NLOC 1SEMA 2FRYA 2OAWA 1FMKA 2MOXA 3KFVA 2QDLA 2DBKA 2JM8A 2KROA 2RNAA 2PZ1A 3EHRA 2CH4A 1H8KA 2K6DA 4HXJA 2HDAA 2LP5A 2DRMA 4AFQC 1SHFA 3H0HA 1WLPB 2H8HA 5IH2A 2O31A 3M0RA 5FWCA 1K1ZA 1YNZA 5HCKA 1UG1A 2LJ3A 5L23A 1QWFA 1AWXA 4Y92A 1QKWA 1NM7A 4JJDA 1H92A 3EG2A 3I5RA 5FWBA 1SPKA 1NYGA 4GLMA 1HD3A 1U3OA 2BZXA 2KR3A 1PRLC 2YUQA 4F16A 1K0XA 2BZYA 4LN2A 1E7OA 1ZUUA 3U23A 2RMOA 3FJ5A 1CSKA 3H41A 2K9GA 1WIEA 1CKBA 2KNBB 2GBQA 2RQTA 1PRMC 2K2MA 2DMOA 4AG1C 1NG2A 2DL4A 3PVLA 2KXCA 2AKLA 2DM1A 1A0NB 2F2XA 1TG0A 4KRTA 3VS0A 3PVQA 2CH4W 1TUCA 2HEQA 3VS5A 5GJVB 1M30A 3EG1A 2LX7A 1NEBA 4RTXA 4J9BA 4F17A 2SRCA 2RN8A 1AWWA 1UUEA 4DEYA 2X3WD 1KSWA 3SHWA 4JPBW 1T0HA 2DE0X 4HVUA 1W70A 2VVKA 4AFUC 3A98A 1M8MA 2EBPA 2KXDA 2FEIA 1GCPA 2YDLA 1YWOA 2NWMA 2A36A 2JXBA 1B3QA 2JS0A 2A28A 1ZUKA 1BU1A 2SEMA 5IXFA 1S1NA 2FPFA 2YT6A 1WXBA 4RTZA 3NMZC 3VS3A 3O5ZA 5I11A 1SRLA 2NUZA 1KIKA 1CKAA 1UDLA 2L3QA 1JEGA 2J6KA 3H0IA 4HVVA 2F2WA 4E6RA 2RQVA 2O88A 2ED0A 4IIOA 1ARKA 1AWJA 1AD5A 2KYBA 3EGUA 1H3HA 2EVRA 2ENMA 4AFSC 1ZBJA 2KGTA 2FPDA 5IXBA 1K0SA 1M3BA 2L2PA 2PTKA 2A37A 4QT7A 4JJBA 2DF6A 2BTTA 1YCSB 4ORZA 1Y57A 3ULRB 1UECA 1SRMA 3VS4A 2KT8A 1OOTA 2EYZA 2PNIA 2JW4A 2J6OA 2DILA 3QWXX 1NEGA 1N5ZA 2FPEA 2DNUA 2EYWA 4A63B 1UHCA 2CT3A 1GFCA 1JQQA 2YUOA 1ZLMA 4CC4B 2CDTA 4JZ3A 4R0KA 2CUDA 1HSQA 2EGAA 4JJCA 4CC7A 3UF4A 4CC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCS A;  4OMO A;  1ZUY A;  4EIK A;  4D8K A;  3TVT A;  2KBT A;  3GBQ A;  5EC7 A;  2V1Q A;  1UJ0 A;  2LNH B;  1ZSG A;  1Z9Z A;  2RQU A;  4HCK A;  1AOJ A;  1UGV A;  1K76 A;  1X6G A;  1X43 A;  3H0F A;  2CSQ A;  1WYX A;  2CSI A;  1PHT A;  2DL5 A;  1X69 A;  3R6N A;  1BBZ A;  2M0Y A;  4RUG A;  1QLY A;  2EGE A;  4OMN A;  3PE0 A;  3TSZ A;  2L3P A;  1OEB A;  2ROL A;  1JXM A;  2O2O A;  1GBR A;  2LJ0 A;  2V1R A;  1X2K A;  4OMP A;  4Z88 A;  2X3X D;  2DBM A;  1NYF A;  4LE9 A;  4AG2 C;  2KRS A;  1WDX A;  1E6G A;  2DL8 A;  1ZX6 A;  1YN8 A;  1XOV A;  2DRK A;  1QCF A;  3M0T A;  2GTJ A;  3REA B;  4J9E A;  3NHN A;  1K9A A;  2D0N A;  2JS2 A;  4F14 A;  3VS2 A;  2OI3 A;  4ESR A;  1MV3 A;  4WCI A;  2DLP A;  4J9G A;  2EGC A;  2JT4 A;  2EYY A;  2RPN A;  1W1F A;  2AK5 A;  2XMF A;  2CUB A;  2EYX A;  1KJW A;  3SEM A;  2AKK A;  3EG3 A;  1MUZ A;  5IHI A;  1MV0 B;  1G83 A;  2AZV A;  2LQN A;  1YP5 A;  2EW3 A;  2ROT A;  1Z9Q A;  1FYN A;  1WX6 A;  1GBQ A;  2HCK A;  2FG0 A;  1PKS A;  1M27 C;  2ESW A;  2W0Z A;  1RLQ C;  3REB B;  1X2Q A;  2HBW A;  3VS7 A;  2DYB A;  5ECA A;  1X27 A;  1X6B A;  2KT1 A;  2VWF A;  4RTV A;  1OPK A;  4X1V A;  2EPD A;  2KYM A;  1V1C A;  1OPL A;  2J7I A;  2L0A A;  2YUN A;  1J3T A;  2E5K A;  1RUW A;  2D8H A;  4OMQ A;  2CT4 A;  2GTO A;  1JU5 C;  3LH5 A;  1HJD A;  1VA7 A;  1ABQ A;  1YWP A;  4FSS A;  4J9F A;  1GFD A;  3UAT A;  2J05 A;  2LJ1 A;  1U5S A;  1WI7 A;  2JMA A;  3EHQ A;  1ABO A;  1UE9 A;  1T3S A;  4LUD A;  2GGR A;  3ZL7 C;  3UA7 A;  4LUE A;  2ECZ A;  3RBB B;  3I9Q A;  4D8D A;  4OMM A;  2L3S A;  3VRZ A;  2I0N A;  2ABL A;  4Z8A A;  3C0C A;  1PNJ A;  3QWY A;  1VYT A;  1T0J A;  4IIM A;  2LQW A;  4ZNX A;  1AWO A;  2K79 A;  1U06 A;  1WXT A;  3NPF A;  2RF0 A;  1JO8 A;  2EKH A;  1JXO A;  2DL7 A;  1UFF A;  2C0I A;  1BK2 A;  2DL3 A;  4RTY A;  1AZE A;  1K4U S;  1RI9 A;  3JV3 A;  2KRM A;  1VYV A;  1E6H A;  4M4Z A;  2MCN A;  1SHG A;  1B07 A;  2GQI A;  2D8J A;  3VS6 A;  1WA7 A;  1OV3 A;  2FO0 A;  3RNJ A;  4GBQ A;  1KFZ A;  2KEA A;  1RLP C;  2O9V A;  2LZ6 B;  4OML A;  2VKN A;  1PKT A;  5IHK A;  2J6F A;  1I0C A;  1NLP C;  2D1X A;  2KE9 A;  1Y0M A;  2CRE A;  4Z89 A;  3NGP A;  1GCQ A;  2YUP A;  3IQL A;  1M3A A;  4J9D A;  2W10 A;  2IIM A;  4AFZ C;  3M0P A;  2O9S A;  4K11 A;  4DEX A;  1G2B A;  2FRW A;  2JTE A;  2C0O A;  2J06 A;  3UA6 A;  1QKX A;  1QWE A;  4LNP A;  2G6F X;  1EFN A;  4RTW A;  2P4R A;  1UTI A;  2LMJ A;  1WFW A;  2A08 A;  2M51 A;  2JMC A;  2OJ2 A;  1I1J A;  2F2V A;  1GCQ C;  3M0Q A;  3THK A;  2DJQ A;  1GL5 A;  4RTT A;  2YSQ A;  1WXU A;  1SSH A;  2C0T A;  5FW9 A;  2ED1 A;  5IHN A;  3CQT A;  1AVZ C;  4J9C A;  2K3B A;  3EG0 A;  1T3L A;  1VYU A;  3VRY A;  2B86 A;  2KRN A;  1I07 A;  1UJY A;  1AZG B;  4HVW A;  2BZ8 A;  2RQR A;  1M3C A;  1W6X A;  2EQI A;  3M0U A;  4CC2 A;  2DVJ A;  2AZS A;  3I5S A;  2MIO A;  1BB9 A;  4J9H A;  5I22 A;  2DA9 A;  2HSP A;  3TSW A;  4J9I A;  3VS1 A;  2JM9 A;  4JZ4 A;  1GRI A;  2GNC A;  3I35 A;  1PWT A;  4RTU A;  1UHF A;  3M0S A;  1TUD A;  2K7A A;  2DX1 A;  1LCK A;  5GJW B;  1AEY A;  1IO6 A;  2RQW A;  1NLO C;  1SEM A;  2FRY A;  2OAW A;  1FMK A;  2MOX A;  3KFV A;  2QDL A;  2DBK A;  2JM8 A;  2KRO A;  2RNA A;  2PZ1 A;  3EHR A;  2CH4 A;  1H8K A;  2K6D A;  4HXJ A;  2HDA A;  2LP5 A;  2DRM A;  4AFQ C;  1SHF A;  3H0H A;  1WLP B;  2H8H A;  5IH2 A;  2O31 A;  3M0R A;  5FWC A;  1K1Z A;  1YNZ A;  5HCK A;  1UG1 A;  2LJ3 A;  5L23 A;  1QWF A;  1AWX A;  4Y92 A;  1QKW A;  1NM7 A;  4JJD A;  1H92 A;  3EG2 A;  3I5R A;  5FWB A;  1SPK A;  1NYG A;  4GLM A;  1HD3 A;  1U3O A;  2BZX A;  2KR3 A;  1PRL C;  2YUQ A;  4F16 A;  1K0X A;  2BZY A;  4LN2 A;  1E7O A;  1ZUU A;  3U23 A;  2RMO A;  3FJ5 A;  1CSK A;  3H41 A;  2K9G A;  1WIE A;  1CKB A;  2KNB B;  2GBQ A;  2RQT A;  1PRM C;  2K2M A;  2DMO A;  4AG1 C;  1NG2 A;  2DL4 A;  3PVL A;  2KXC A;  2AKL A;  2DM1 A;  1A0N B;  2F2X A;  1TG0 A;  4KRT A;  3VS0 A;  3PVQ A;  2CH4 W;  1TUC A;  2HEQ A;  3VS5 A;  5GJV B;  1M30 A;  3EG1 A;  2LX7 A;  1NEB A;  4RTX A;  4J9B A;  4F17 A;  2SRC A;  2RN8 A;  1AWW A;  1UUE A;  4DEY A;  2X3W D;  1KSW A;  3SHW A;  4JPB W;  1T0H A;  2DE0 X;  4HVU A;  1W70 A;  2VVK A;  4AFU C;  3A98 A;  1M8M A;  2EBP A;  2KXD A;  2FEI A;  1GCP A;  2YDL A;  1YWO A;  2NWM A;  2A36 A;  2JXB A;  1B3Q A;  2JS0 A;  2A28 A;  1ZUK A;  1BU1 A;  2SEM A;  5IXF A;  1S1N A;  2FPF A;  2YT6 A;  1WXB A;  4RTZ A;  3NMZ C;  3VS3 A;  3O5Z A;  5I11 A;  1SRL A;  2NUZ A;  1KIK A;  1CKA A;  1UDL A;  2L3Q A;  1JEG A;  2J6K A;  3H0I A;  4HVV A;  2F2W A;  4E6R A;  2RQV A;  2O88 A;  2ED0 A;  4IIO A;  1ARK A;  1AWJ A;  1AD5 A;  2KYB A;  3EGU A;  1H3H A;  2EVR A;  2ENM A;  4AFS C;  1ZBJ A;  2KGT A;  2FPD A;  5IXB A;  1K0S A;  1M3B A;  2L2P A;  2PTK A;  2A37 A;  4QT7 A;  4JJB A;  2DF6 A;  2BTT A;  1YCS B;  4ORZ A;  1Y57 A;  3ULR B;  1UEC A;  1SRM A;  3VS4 A;  2KT8 A;  1OOT A;  2EYZ A;  2PNI A;  2JW4 A;  2J6O A;  2DIL A;  3QWX X;  1NEG A;  1N5Z A;  2FPE A;  2DNU A;  2EYW A;  4A63 B;  1UHC A;  2CT3 A;  1GFC A;  1JQQ A;  2YUO A;  1ZLM A;  4CC4 B;  2CDT A;  4JZ3 A;  4R0K A;  2CUD A;  1HSQ A;  2EGA A;  4JJC A;  4CC7 A;  3UF4 A;  4CC3 A; 
#chains in the Genus database with same CATH topology
 4PFZ A;  2EJG A;  2LCS A;  4OMO A;  1ZUY A;  3C95 A;  4C92 F;  3NTK A;  2WSE E;  3JB9 J;  4M78 F;  4C92 A;  2RHU A;  1NE8 A;  3INZ A;  1UJ0 A;  2DPP B;  1Z9Z A;  2RQU A;  4ZN3 A;  2KMT A;  4BE2 A;  2QEX A;  1K76 A;  2HL3 A;  2VV5 A;  3V7C A;  2DL5 A;  4QVC A;  4KH1 B;  4RUG A;  5LJ3 e;  2EGE A;  2EWN A;  4BDY A;  4OMN A;  3DB4 A;  1OEB A;  3ZBD A;  2LJ0 A;  1K73 U;  3BFM A;  4C92 G;  5GAN g;  3E2U A;  3QYG B;  3R6O A;  2QTV A;  5GAN 5;  2QGG A;  2X3X D;  1JB0 E;  1RAC B;  1K9M R;  4LE9 A;  4F7U G;  2KRS A;  4KGX B;  2DL8 A;  1ZX6 A;  1YN8 A;  1XOV A;  4QQG A;  4M7D G;  1YIT T;  3G6E Q;  2FB7 A;  3NHN A;  5LJ3 h;  2RH2 A;  4DBH A;  3VS2 A;  1MV3 A;  2RJE A;  1BIA A;  2DLP A;  5CKH A;  1IHV A;  2JT4 A;  2AK5 A;  2FHD A;  2EYX A;  3X24 B;  2EJ9 A;  1MGQ A;  4A4F A;  4QKU A;  1PM3 A;  3WVE B;  2AZV A;  5KYU B;  1YP5 A;  1WHL A;  1FYN A;  1GBQ A;  2HSE B;  4PLL A;  1PKS A;  2ESW A;  1PCX A;  2DIG A;  2A0F B;  2CP7 A;  2RM4 A;  4MMK A;  2HBW A;  2H3J A;  3OYD A;  1YFN A;  2HNI A;  1C1A A;  1K73 R;  1D3B B;  2EPD A;  1N27 A;  1Q86 R;  2WSC E;  1RUW A;  1TSF A;  1NJI C;  4ZTJ A;  2CT4 A;  1JU5 C;  3CPW A;  3LH5 A;  4J6Y A;  5CO7 A;  1VA7 A;  1YWP A;  3LWI A;  1GFD A;  2OTJ A;  1NJI R;  4C0D C;  1VQ6 T;  1U5S A;  3CCE Q;  4NOY A;  5LJ5 f;  3JCM Q;  1PSE A;  4B9X A;  1UE9 A;  4LDV A;  2XDD A;  4LUD A;  3I56 Q;  2GGR A;  4WTO B;  4JDS A;  3RBB B;  4A4H A;  4L59 A;  3I9Q A;  2V8I A;  1R0C B;  3P8B B;  4OMM A;  4D8D A;  1YI2 Q;  3JAM E;  1VQ6 A;  2L3S A;  3VRZ A;  5GAO n;  2DVE A;  2ABL A;  4Z8A A;  4IUU A;  1PNJ A;  3QWY A;  5FU7 C;  3CME T;  2P0Q A;  1EX4 A;  1LPL A;  1WXT A;  1KHC A;  2M1H A;  1OI1 A;  2JZ2 A;  1Q82 C;  1RAI B;  1BK2 A;  1O75 A;  4JUV A;  4PJO A;  1PD0 A;  3JV3 A;  2KRM A;  3MEV A;  4FW1 A;  2MF2 A;  4JJN K;  2GQI A;  3HRS A;  3EFO A;  2D8J A;  3VS6 A;  2LC4 A;  2HMA A;  1KHI A;  3KXT A;  4DQ2 A;  1QMC A;  3A8H B;  3UPU A;  2LX9 A;  4VUB A;  2VC8 A;  2YRV A;  1SKU B;  2CS7 A;  1PKT A;  5IHK A;  4YTL A;  3D7S B;  5DY9 A;  1Y0M A;  1Q81 R;  5LJ5 g;  3IQL A;  1B34 B;  4N4H A;  2K4Y A;  2W10 A;  1M4Z A;  5GMK h;  2IIM A;  3EH1 A;  2QAZ A;  1NBE B;  4F7U A;  2JTE A;  2J06 A;  1QWE A;  2E6N A;  1M9S A;  3MHX A;  2G6F X;  2KY9 A;  4A53 A;  3OYJ A;  3OYC A;  3RMQ A;  1MHN A;  3M0Q A;  3J7A F;  5GMK m;  2LCL A;  1GL5 A;  1FWZ A;  4ZGE B;  2HQH A;  4M7A E;  2ED1 A;  4JLG A;  4NL3 A;  4J8O A;  2K3B A;  1M5Q 1;  3VRY A;  2B86 A;  4E7Z A;  3TRE A;  4R55 A;  3CC2 A;  5CK9 A;  1M90 R;  1VQ7 Q;  1G3Y A;  1M3C A;  4B6M A;  5LJ3 g;  1VIE A;  2RI5 A;  4BY6 B;  3I5S A;  3LGF A;  2MIO A;  3H6Z A;  4J9H A;  5I22 A;  2PVG B;  2HSP A;  3TSW A;  1M2V B;  1B34 A;  1I5L A;  3VS1 A;  3JSC A;  3P8D A;  4PFO A;  2JM9 A;  4JZ4 A;  1MMA A;  3OYB A;  4RTU A;  1M90 U;  3OYF A;  1PG5 B;  4DA4 A;  1TUD A;  1R0B G;  2DD5 A;  1MND A;  1I81 A;  2L89 A;  1AEY A;  4IUR A;  2OTJ T;  1NLO C;  1SEM A;  1Y7X A;  4KUI A;  4GY5 A;  4XTX A;  2DBK A;  4A4G A;  2QK0 A;  4PJJ A;  3HRU A;  3CMA A;  2QG9 B;  2CH4 A;  3VUZ A;  2X4Y A;  2XHC A;  2EJF A;  2F5K A;  2LP5 A;  3JCM d;  3T9N A;  3H0H A;  2NUP B;  1WLP B;  5IH2 A;  1LJO A;  4IUP A;  2OTJ Q;  4FYY B;  1K1Z A;  1YNZ A;  1VQN A;  2CP0 A;  2EQK A;  2GF7 A;  2M16 A;  3X20 B;  2LJ3 A;  1KG1 A;  2R57 A;  5DM7 R;  3HKS A;  3JCM J;  2E64 A;  2DAQ A;  1H92 A;  4E7I A;  5CKB A;  3VJP A;  2K5L A;  1Q7Y R;  1U3O A;  3JB9 F;  1TWB A;  4LD6 A;  2F1L A;  2EKO A;  2KQW A;  3CCS T;  2O4X B;  2YUQ A;  3HFO A;  1QVP A;  1ZQ1 A;  1QVF P;  4QVZ A;  4EPC A;  3PTA A;  4M75 E;  3EAE A;  1YJW T;  1ZUU A;  2MK5 A;  2QTX A;  5LJ5 h;  3V8J A;  4XTU A;  3H41 A;  2K9G A;  4RKU E;  2PQW A;  4C8Q G;  1D1B A;  2RQT A;  2DMO A;  5AYF A;  4C8Q D;  1KQ2 A;  3CPW S;  1SSF A;  2H3E B;  2Y4X A;  2DET A;  2E3H A;  2E3I A;  1XTD A;  4FYX B;  3HPW A;  4J7I A;  3PVQ A;  4HT8 A;  2HEQ A;  3S3M A;  3CCS A;  3EG1 A;  3TQ7 P;  1NEB A;  3DLL A;  2QA4 A;  2YLC A;  4F17 A;  3L2Z A;  3QII A;  3RKW A;  1VQ4 Q;  3JCM f;  2QEX T;  3JB9 H;  4XU0 A;  4R56 A;  4IUV A;  2ZZD A;  1D0Y A;  2XG8 D;  5FRM A;  4OB1 B;  1X01 A;  2EIF A;  3HL8 A;  1GCP A;  1YWO A;  3OQ5 A;  2A36 A;  2JXB A;  3CXC A;  1VQN T;  1ZUK A;  1BU1 A;  2VXF A;  2YT6 A;  3I55 T;  2ZPH B;  2K3X A;  2DXC A;  1D3B A;  3O5Z A;  1K8A R;  1KQS S;  1VQ8 A;  1SRL A;  4V2S A;  3GNG A;  2GQV A;  2L3Q A;  4HVV A;  3CCR A;  2GFA A;  4BUG A;  1BI2 A;  4M7A D;  3CCL T;  4BI4 A;  2YHT A;  1AWJ A;  3CC7 T;  3OYA A;  3EGX B;  4M7A C;  3LW5 E;  4AFS C;  2DEQ A;  5GAO m;  1YCY A;  3BW1 A;  3J81 E;  1M3B A;  2L2P A;  4O5V A;  4FL6 A;  2A37 A;  4QT7 A;  5CKF A;  5HK3 A;  2DXU A;  3OBW A;  1YCS B;  5CAI A;  4XK8 E;  3WVD B;  3DKM A;  4EMH A;  2EYZ A;  2JW4 A;  2J6O A;  3CC2 T;  3G7Z A;  3OS1 A;  2DTH A;  2NUT B;  4P5N A;  4ZGJ B;  2P84 A;  1K9M U;  2EYW A;  4A63 B;  2JVV A;  3OW2 P;  1GFC A;  4BD3 A;  1Q95 G;  1D1C A;  3EFO B;  3QJ6 A;  2YUO A;  2KSS A;  3RIR A;  2HKN A;  4MML A;  1ZSZ C;  4JZ3 A;  4R0K A;  4C0G A;  2EGA A;  4E7L A;  4X9C A;  3SWN B;  9ATC B;  1WHG A;  4EIK A;  4D8K A;  4PFP A;  3G6E T;  3CCJ Q;  3SFM A;  1IXD A;  3GF5 A;  4M7D A;  1BYM A;  1ZSG A;  4XTW A;  1AOJ A;  1UGV A;  1X6G A;  3OBY A;  1RAD B;  1PHT A;  2M9U A;  1VQ4 A;  1OZ2 A;  3PE0 A;  3TSZ A;  2ROL A;  1TTH B;  5LJ3 f;  1JXM A;  3M5A A;  4IKF A;  2O2O A;  3OS2 A;  2V1R A;  1X2K A;  1VUB A;  3OYY A;  2DKG A;  4OMP A;  4ZGD B;  3CC4 A;  4XTZ A;  3ZEH A;  3WXM B;  4AG2 C;  1WDX A;  3M55 A;  1E6G A;  1D0Z A;  4C92 C;  5L8R E;  2LCC A;  5GAN j;  3M0T A;  1PSF A;  3REA B;  5KYY B;  2ZPI B;  2HL5 C;  1UGQ B;  3J80 E;  3EH2 A;  1D0X A;  2NLU A;  1WNL A;  4WCI A;  3FJP A;  2GCX A;  2RPN A;  2CUB A;  5AT1 B;  4BI3 A;  1ZHI A;  3LH0 A;  3RUX A;  1S72 T;  2EFI A;  2AKK A;  1YJN Q;  8AT1 B;  1MV0 B;  2ROT A;  3MP6 A;  4KT0 E;  4KH0 B;  1N8R C;  5KE3 A;  2HCK A;  3QYH B;  2FG0 A;  2DEU A;  2AIR B;  1OZ3 A;  2W0Z A;  2OTL A;  1X2Q A;  2XKO C;  3G6E A;  2O4X A;  1OPK A;  2KYM A;  2L0A A;  2J7I A;  3OYM A;  3S6W A;  1RAA B;  2GTO A;  4EDU A;  2CKK A;  2XD0 A;  2CP2 A;  3JCM P;  2DZ9 A;  2OX7 A;  4FSS A;  4J9F A;  2BE7 D;  1VQ6 Q;  1MMG A;  4CI0 C;  1WI7 A;  4E7J A;  1I8F A;  1F1B B;  1M8V A;  5D6Y A;  4E7H A;  1T3S A;  2V8J A;  3ZL7 C;  3SDZ A;  3EGD B;  1G5V A;  2A3L A;  2MYS A;  2I0N A;  5FRO A;  2RHY A;  2K5F A;  3C0C A;  1OU9 A;  1DJ7 B;  1T0J A;  2L5Q A;  2LQW A;  4IIM A;  5A0D A;  3EFS A;  1M1K R;  3NPF A;  2EAY A;  2RF0 A;  1QVG S;  1JO8 A;  4F7U F;  4A4E A;  3CC7 A;  2DL7 A;  1VQL Q;  2VAS A;  3CCS Q;  5FU7 B;  2C0I A;  3A1P A;  3VUB A;  2MAM A;  1TH7 A;  4M4Z A;  1B07 A;  4Y91 A;  3CD6 T;  3RNJ A;  4M78 C;  1VQP Q;  1RLP C;  4ZTF A;  2D6F A;  1G3T A;  2LZ6 B;  2VKN A;  3QSU A;  2KE9 A;  1NLP C;  2D1X A;  2CRE A;  3RR6 A;  2X4X A;  1HK9 A;  2YUP A;  1KD1 U;  4JLI A;  5GAN 3;  1M3A A;  3AHU A;  4K11 A;  3EGD A;  3UWN A;  1YI2 A;  4C92 E;  3UA6 A;  1QKX A;  4LNP A;  3C4S A;  1Q81 U;  4M7A A;  1UB4 A;  2RJC A;  4JS5 A;  2QA4 T;  4ME7 A;  2RA2 A;  5HKC A;  3P8H A;  1HYO A;  2EQJ A;  2YSQ A;  1WXU A;  1SSH A;  1U1S A;  5IHN A;  3CQT A;  4PLI A;  3OMG A;  1NPP A;  2RJD A;  5FU6 C;  1KC8 C;  1I07 A;  1UJY A;  5KYW A;  1KQS P;  1TOV A;  4N0A A;  2JJ9 A;  3MO8 A;  2RQR A;  1VQ7 A;  2HQE A;  2FZK B;  1YJW A;  4CC2 A;  3JB9 G;  1XQH A;  2DVJ A;  1BKB A;  1BB9 A;  4QVD A;  2DA9 A;  2LNV A;  4J9I A;  4DOV A;  1VQK A;  2QYZ A;  4OGC A;  8ATC B;  4M78 B;  1GRI A;  2GNC A;  3X26 B;  4M77 D;  5KCH A;  1Q7Y C;  1VQP A;  1ZSZ B;  3CCV A;  1X6O A;  1UGS B;  2RHI A;  3RKY A;  2JN0 A;  1OU8 A;  1QCN A;  2RQW A;  4BDZ A;  1FMK A;  2MOX A;  1GXI E;  2V26 A;  2COY A;  2JTF A;  2QDL A;  3KFV A;  4PK4 A;  2KRO A;  1Q86 U;  2R5M A;  2X35 A;  2K6D A;  3PGG A;  5GAM f;  5KYX A;  3GPL A;  3E19 A;  2MI6 A;  3G4S T;  5HCK A;  2K2V A;  5L23 A;  1QWF A;  1VQN Q;  2YRD A;  1AWX A;  1QW1 A;  4Y92 A;  1NM7 A;  4JJD A;  2JOY A;  3H9N A;  2KAF A;  5GMK j;  5FWB A;  1SPK A;  3FEO A;  1JRI A;  1NYG A;  1AT1 B;  2YLB A;  3CCQ Q;  2XDB A;  2E4H A;  2KR3 A;  4C92 B;  1PRL C;  3LLR A;  2HKQ B;  1IHW A;  4X9D A;  4PJO E;  2RD1 A;  1U1T A;  2BZY A;  4LN2 A;  4BB7 A;  3A8L B;  1MNE A;  3FJ5 A;  1CSK A;  4F7U B;  5GAN e;  5A0L A;  3CCJ T;  3G71 T;  2P4T A;  2WSF E;  2KNB B;  4M77 C;  2K2M A;  1NG2 A;  2DL4 A;  3PVL A;  3EG9 A;  1A0N B;  3M57 A;  2E6Z A;  3CMA T;  4KRT A;  2LX7 A;  1R77 A;  4FIB A;  1EIF A;  3A8G B;  3FB9 A;  4PJO D;  2SRC A;  1AWW A;  4DEY A;  1KSW A;  5LJ3 d;  4M78 E;  2IVW A;  4AFU C;  5CKD A;  1RI0 A;  3L2U A;  1YJ9 Q;  1WHJ A;  5LJ5 j;  1G8X A;  2DIQ A;  1WJR A;  2VUB A;  1S1N A;  4QQ6 A;  2E70 A;  4C0F A;  4NL2 A;  1FMW A;  3LX7 A;  1QVG A;  3NMZ C;  3UDC A;  5HK0 A;  5I11 A;  3HRT A;  2NUZ A;  3FIF A;  1S72 Q;  3LGL A;  1WJS A;  3PMT A;  2HAX A;  4LD9 K;  1UDL A;  1X75 C;  3M53 A;  5LJ5 d;  5IAY A;  2VGN A;  2J6K A;  1VQL A;  3E9G A;  4FYW B;  3QHS A;  2ED0 A;  2Y90 A;  4M75 B;  2JUF A;  3EGU A;  1VQ9 A;  2Z0W A;  2KGT A;  2CP5 A;  1N9S A;  5IXB A;  2AHJ B;  2ZPG B;  1QVG P;  1LNX A;  4M77 F;  4JJB A;  4HT9 A;  5D6X A;  2DF6 A;  2F69 A;  4D6W A;  1Y57 A;  1BCM A;  1UEC A;  1SRM A;  2KT8 A;  5CVI A;  1OOT A;  2DIL A;  1EZZ B;  2JTM A;  1NEG A;  1N5Z A;  3OYI A;  2DNU A;  1VQO Q;  1JQQ A;  3S3O A;  3L42 A;  5CCA A;  1ZLM A;  3QG1 A;  2CDT A;  1MMN A;  5FRN A;  1OYX A;  3PMI A;  1ZBX A;  4PJO C;  3CXC P;  2KBT A;  2O01 E;  3V8K A;  5EC7 A;  2LNH B;  3V8L A;  2IPO B;  4C5G A;  1X43 A;  2E10 A;  3H0F A;  1WYX A;  2CSI A;  3JRZ A;  4M75 A;  3R6N A;  2M0Y A;  4TVR A;  1VOM A;  3GIB A;  1KC8 U;  4JRK A;  3MP1 A;  1FX7 A;  2LRQ A;  3PIP A;  1GBR A;  4HKE A;  4EMK A;  3OYK A;  4J83 A;  4FM4 B;  3CCL Q;  2M02 A;  1Y71 A;  3CCL A;  3QJY A;  4Z88 A;  3EGX A;  3Q1J A;  1VQ4 T;  1NYF A;  3JCM g;  3CCM T;  3VYH B;  7AT1 B;  1U8R A;  1IGU A;  4HCZ A;  2GTJ A;  3I56 T;  4J9E A;  1K9A A;  1BCO A;  2D0N A;  4E7S A;  2JS2 A;  4F14 A;  1Q82 U;  1M2O A;  3KUF A;  2OI3 A;  4ESR A;  4OVA A;  3JCM h;  2EGC A;  3TCJ A;  3CCU Q;  2EYY A;  1W1F A;  4E2F B;  2YWW A;  4PJN A;  3SEM A;  5C6S A;  3EG3 A;  1VQM Q;  1YJN A;  3JCM c;  1WX6 A;  3SWN A;  1XNI A;  4FSX A;  4MZT A;  3L2R A;  3A5Z B;  4A54 A;  2E12 A;  5GAM j;  1TU0 B;  1RLQ C;  1NPR A;  3VS7 A;  2DYB A;  5ECA A;  5GAM d;  4C8Q A;  2XI9 A;  3CBP A;  2VWF A;  3QZ9 B;  4X1V A;  1WJQ A;  1V1C A;  1OPL A;  2YUN A;  2X4W A;  2BUD A;  2NYS A;  2E5K A;  4OMQ A;  2FYK A;  5DLQ E;  4M75 F;  1HJD A;  3BDU A;  3UAT A;  4C0Z A;  4XAX B;  2J05 A;  1V76 A;  1JBM A;  1ZA1 B;  2MMP A;  2LJ1 A;  2JNG A;  3M59 A;  2CGH A;  4QQD A;  2RB6 A;  1SF9 A;  3CCR T;  1ABO A;  2QI2 A;  3UT1 A;  1YJW Q;  3UA7 A;  2NUT A;  2PU9 B;  4FT4 A;  2ECZ A;  2DXT A;  3V7R A;  4X34 A;  3OW2 S;  3G4S A;  1W4S A;  4M75 G;  4XU3 A;  2L3R A;  5GAN 7;  4XTY A;  3RER A;  5M9O A;  3OS0 A;  2NUP A;  1M1G A;  4ZNX A;  4JRP A;  1AWO A;  2K79 A;  1U06 A;  4XU1 A;  4C8Q E;  2AT1 B;  4B9W A;  1JXO A;  3HFN A;  3E9F A;  2DL3 A;  1RI9 A;  3OB9 A;  1VYV A;  4C8Q B;  3DLM A;  1SHG A;  2RK2 A;  2Y4Y A;  1H3Z A;  4FYV B;  1YI2 T;  1RAE B;  1YJN T;  2FO0 A;  1KFZ A;  4DBQ A;  5CQY A;  1VQ7 T;  2CZ1 B;  1JJ2 A;  4OML A;  2J6F A;  1I0C A;  4FCY A;  3JB9 I;  3EG9 B;  3NGP A;  5LJ3 j;  1N8R R;  3LWH A;  4PNO A;  3CCU A;  2R5A A;  3ER0 A;  3M0P A;  2O9S A;  2COW A;  1AHJ B;  1G3S A;  2FL7 A;  3RKX A;  4DEX A;  2FRW A;  3SWN C;  1EFN A;  3DB3 A;  4RTW A;  2P4R A;  3OYG A;  3JCM V;  2LMJ A;  5CR2 A;  1WFW A;  2JMC A;  1QP3 A;  1B7T A;  1I1J A;  2F2V A;  1UEB A;  5D7U A;  4RTT A;  5FU6 B;  4PJM A;  5CIU A;  4M7D D;  2C0T A;  5FW9 A;  3CCQ A;  1AVZ C;  1WHH A;  1RAH B;  3EG0 A;  3BE3 A;  3MJX A;  4HVW A;  2DK3 A;  2BKD N;  1WZO A;  2DYI A;  2EQI A;  4BE1 A;  4KUD K;  4PL6 A;  2AZS A;  2MWO A;  4L6V 5;  2DFU A;  2QQ9 A;  4FW2 A;  3PNW C;  2LVM A;  4C92 D;  1UGR B;  3I35 A;  3PFS A;  1N6A A;  3QXE B;  2K7A A;  3CCR Q;  1QVF A;  1IO6 A;  1I5O B;  3SB2 A;  3MPU B;  1IRX A;  2A7Y A;  4M75 D;  2FRY A;  3M9Q A;  3CPF A;  2XID A;  1BI3 A;  2FZC B;  3OW2 A;  3JCM W;  2RNA A;  3ZFJ A;  2DXB A;  2COZ A;  5J3B A;  1WQW A;  1S72 A;  2HDA A;  4PJL A;  2DRM A;  4AFQ C;  1SHF A;  2H8H A;  2K3Y A;  1VIF A;  4LDW A;  3HTR A;  5FWC A;  4ELY C;  3G1J A;  2ZAE A;  4LDU A;  5A0G A;  1QKW A;  1OQK A;  2ZPB B;  4PJO B;  2QQS A;  1N8R U;  1VQM T;  2EQM A;  5GAN f;  1H64 1;  2HBP A;  1FMV A;  1UGP B;  4M78 D;  2BIV A;  4N4G A;  3JCM e;  3LYI A;  4RG2 A;  2OTL T;  4F16 A;  4OMF B;  4M7D C;  1IRE B;  3VU3 C;  4MDX A;  1K0X A;  4EMK B;  2X4J A;  2RMO A;  3U23 A;  5GMK i;  2EYQ A;  2RI2 A;  4LDY A;  1WIE A;  3L2V A;  2E65 A;  2RK1 A;  5GAN 6;  2GBQ A;  2XK0 A;  1PRM C;  5GAN d;  5DLO A;  1WPY A;  2CYZ B;  4J6X A;  3CXC S;  4ZN1 A;  1TXQ A;  1KK7 A;  1TG0 A;  1M1F A;  3VS0 A;  1Y96 B;  2LT1 A;  1VQ5 T;  4M77 G;  3VS5 A;  3CMA Q;  2P0K A;  5GJV B;  1M30 A;  3EFR A;  4RTX A;  1XJW B;  2RN8 A;  2D9T A;  3I55 Q;  2LQK A;  4JPB W;  1T0H A;  2DE0 X;  1JJ2 S;  1W70 A;  2VVK A;  3A98 A;  4MZM A;  2KXD A;  3L2W A;  2FEI A;  4Q5W A;  2YDL A;  2NWM A;  2D0Q B;  1B3Q A;  4FT2 A;  2JS0 A;  2A28 A;  3CME A;  2SEM A;  3ME9 A;  3G4S Q;  1WXB A;  1BI1 A;  3OS5 A;  3VS3 A;  2XU8 A;  4DBR A;  1Q7Y U;  3M4Y A;  1ZSZ A;  3MCA B;  4N0A C;  3X28 B;  4LDX A;  3MET A;  1K8A C;  2HZY A;  3H0I A;  1KD1 R;  2F2W A;  4KUL A;  1TS9 A;  4C0D B;  2O88 A;  1KD1 C;  5IN1 A;  1VQM A;  2DD4 A;  1QVF S;  1H3H A;  3CCV Q;  2ENM A;  1RL2 A;  1ZBJ A;  2K5I A;  5KYX B;  1K0S A;  1VQ8 T;  2PUO B;  4JRQ A;  4L5G A;  3RMS A;  2BTT A;  2QQR A;  3FLG A;  3HHT B;  4ORZ A;  4OB3 B;  3G71 A;  1IB8 A;  3CCV T;  2PNI A;  1PD1 A;  3QWX X;  3NTH A;  4BAC A;  2CT3 A;  2DJZ A;  1K9M C;  3FDR A;  4OF1 A;  3JCM X;  4CC3 A;  2QXF A;  3CC2 Q;  3TVT A;  4M77 A;  3GBQ A;  3CC7 Q;  2V1Q A;  2MPX C;  3URG A;  4HCK A;  3OMC A;  4XTV A;  5GAM e;  3MEW A;  6AT1 B;  2CSQ A;  3QKJ A;  1X69 A;  2HD0 A;  3N5B B;  3M58 A;  1BBZ A;  4HA8 A;  4PJO G;  1QLY A;  4DBF A;  1O9S A;  2L3P A;  5I2S A;  2X51 A;  1OUL A;  4F04 B;  3CCE T;  4KGZ B;  3X25 B;  3L1A A;  2KVQ G;  3NTI A;  1C0M A;  5FLX E;  2DBM A;  3C94 A;  4HCC A;  1WGS A;  4MDW A;  1VQP T;  2E5Q A;  2DRK A;  4AT1 B;  4PJO F;  1QCF A;  2E1H A;  1YJ9 T;  1YJ9 A;  3HSB A;  3M54 A;  4II1 A;  5CQX A;  3VYG A;  4M7D E;  1VQK T;  2K57 A;  5GMK l;  1YHQ Q;  1VQO A;  4RMO A;  4J9G A;  2VYT A;  2XMF A;  2RI3 A;  5J26 A;  3JCM b;  1KJW A;  4ATO A;  1ACM B;  1N9R A;  4M77 B;  4J5Y A;  1MUZ A;  5IHI A;  3OSV A;  5LJ5 e;  1G83 A;  2BE9 B;  2LQN A;  4DOW A;  3TEE A;  2EW3 A;  1M1K C;  1Z9Q A;  4OB2 B;  2F5T X;  3MEA A;  2PVD B;  3CBM A;  5GAN 2;  4BY6 C;  3GLX A;  1M27 C;  2FVU A;  1Y07 A;  3MKD A;  4QW2 A;  3REB B;  1X27 A;  1X6B A;  1RAB B;  2GFU A;  2KT1 A;  4RTV A;  3OYH A;  3G71 Q;  4GLK A;  2DER A;  4C5H A;  1J3T A;  2D8H A;  5GAO l;  1ABQ A;  4M78 A;  2VXE A;  4N4I A;  3OYN A;  2QQB A;  3NFC A;  1LOJ A;  1M2V A;  2JMA A;  1VQK Q;  3MEU A;  1YIJ A;  3EHQ A;  4MZP A;  1W2B S;  4XU2 A;  1BI0 A;  5GAN 8;  4LUE A;  4Z02 A;  4EMK C;  1QCO A;  1M90 C;  3A8O B;  1NJI U;  3MP8 A;  3TU4 K;  1G3W A;  1P92 A;  4BE0 A;  2PVO B;  1VYT A;  1PC0 A;  2FZG B;  2ATC B;  2C06 A;  4PKC C;  2RO0 A;  3QPH A;  3I56 A;  2QDY B;  3QBY A;  2EKH A;  3CD6 A;  1UFF A;  4RTY A;  4M75 C;  1AZE A;  3CC4 Q;  1K4U S;  3CCM A;  1QP2 A;  4E47 A;  1E6H A;  2MCN A;  5CKE A;  1KQ1 A;  4RCB A;  3HP9 A;  2R58 A;  3OSS C;  1WA7 A;  1OV3 A;  3JB9 D;  4GBQ A;  2KEA A;  2IG0 A;  2O9V A;  2QAS A;  2CP3 A;  2QA4 Q;  4F7U E;  2G3R A;  3SD4 A;  3QO3 A;  3O8V A;  4Z89 A;  1W2B P;  3E1S A;  2DTI A;  1GCQ A;  3OYE A;  2KI7 A;  4J9D A;  5I2M A;  4AFZ C;  3ASK A;  5GAN h;  1G2B A;  1VQ9 Q;  2C0O A;  4E7K A;  2QEX Q;  1K8A U;  1HXD A;  1K73 C;  1VQ8 Q;  1UTI A;  4EMG A;  3FC3 A;  2LQ8 A;  3V7S A;  2A08 A;  2M51 A;  2OJ2 A;  4HCB A;  1WHM A;  3AT1 B;  4BI8 B;  1GCQ C;  3F70 A;  3THK A;  1VQ5 A;  5A2Q E;  3S3N A;  2DJQ A;  2VB6 A;  5HY6 A;  4J9C A;  2ZPE B;  5LL6 S;  2YXY A;  1T3L A;  1VYU A;  4M7A G;  2ZPF B;  1BIB A;  2KRN A;  1AZG B;  2BZ8 A;  4J7F A;  1W6X A;  3M0U A;  5IT9 E;  1IGQ A;  3PT9 A;  5GAM g;  3L2Q A;  5KYU A;  4OB0 B;  2EQU A;  1YHQ A;  1MMD A;  5GMK e;  1JJ2 P;  1VQ9 T;  3PIO A;  1VQL T;  4M7A F;  2V8K A;  5GAO p;  5GAO q;  1PWT A;  1UHF A;  3M4G A;  1OX9 A;  2XDP A;  3M0S A;  4A4K A;  2KDS A;  1V29 B;  1W2B A;  2L8D A;  2DX1 A;  1LCK A;  5GJW B;  1YHQ T;  2P0P A;  3CC4 T;  4FU6 A;  2OAW A;  3RDV A;  2JM8 A;  4M77 E;  5I21 A;  3EHR A;  2HQX A;  2PZ1 A;  1H8K A;  4HXJ A;  1Q81 C;  1FXX A;  1KQS A;  4C5I A;  2O31 A;  3M0R A;  1ZA2 B;  2QQA A;  3OYL A;  1UG1 A;  1QQJ A;  4KBM B;  4OP0 A;  3A8M B;  1YIT A;  1VQ5 Q;  3EG2 A;  4C5E A;  3I5R A;  2WAC A;  4KGV B;  3CCM Q;  4GLM A;  1HD3 A;  3CD6 Q;  2BZX A;  2OTL Q;  3RES A;  3I55 A;  1WQ7 A;  5GAO r;  4C8Q C;  1C6V X;  2RHX A;  1Q82 R;  2CZ7 B;  1R8O B;  1D09 B;  2B8A A;  3VV0 A;  1E7O A;  1I4K 1;  4IUT A;  1IZ6 A;  1CKB A;  4M7D B;  3CEY A;  1OX8 A;  2CZ6 B;  1LVK A;  5KH6 A;  2VGM A;  4AG1 C;  5C0M A;  3CCQ T;  4CRI A;  3BY7 A;  2KXC A;  2AKL A;  2DM1 A;  2F2X A;  1M1K U;  2CH4 W;  1KC8 R;  1TUC A;  3C12 A;  4O6J A;  1Y96 A;  2KK4 A;  3OA6 A;  2RHZ A;  4J9B A;  1UUE A;  2X3W D;  3SHW A;  4HVU A;  4M7D F;  2I2L A;  3QDR B;  4LXC A;  4AMC A;  4UC4 A;  4ELZ C;  1M8M A;  1YBY A;  2EBP A;  4RG8 A;  2CZ0 B;  3CCU T;  2YRC A;  3CBO A;  3GOX A;  2RJF A;  5IXF A;  2FPF A;  4JS4 A;  2XIC A;  1VQO T;  4RTZ A;  1SG5 A;  3BDL A;  3CPW P;  4RCC A;  2M0O A;  2LTO A;  3QDF A;  3H8Z A;  5KE2 A;  2MWP A;  1YIT Q;  1WHK A;  1KIK A;  1CKA A;  2LDM A;  3CCJ A;  5GAN 4;  1JEG A;  2LT4 A;  1RAF B;  3M56 A;  4XQ3 A;  4ANJ A;  1YIJ T;  4M7A B;  4C8Q F;  4E6R A;  5GAM h;  2RQV A;  2OAU A;  3VKI A;  4IIO A;  1ARK A;  1AD5 A;  2KYB A;  2EVR A;  2E41 A;  3CCE A;  2DO3 A;  2FPD A;  5EG2 A;  2PTK A;  1NZ9 A;  1RAG B;  4IUQ A;  4WF2 A;  3OY9 A;  5KYN A;  4OGE A;  4JRI A;  2DZC A;  2ZCF B;  3FRN A;  3GNF B;  2DTO A;  5KYY A;  1Q86 C;  4M78 G;  4NS5 A;  3ULR B;  5KYW B;  3VS4 A;  5J39 A;  5D6W A;  4J6W A;  3QZ5 B;  1D1A A;  2ZGW A;  4Y28 E;  3CME Q;  3QUI A;  2FPE A;  1UHC A;  3KBG A;  4CC4 B;  1TUG B;  5KCO A;  2QGF B;  2CUD A;  1HSQ A;  1YIJ Q;  2X9H A;  2CP6 A;  4JJC A;  4CC7 A;  2PUK B;  3UF4 A;  3GP8 A; 
#chains in the Genus database with same CATH homology
 2LCS A;  4OMO A;  1ZUY A;  4EIK A;  4D8K A;  3TVT A;  2KBT A;  3GBQ A;  5EC7 A;  2V1Q A;  1UJ0 A;  2LNH B;  1ZSG A;  1Z9Z A;  2RQU A;  4HCK A;  1AOJ A;  1UGV A;  1K76 A;  1X6G A;  1X43 A;  3H0F A;  2CSQ A;  1WYX A;  2CSI A;  1PHT A;  2DL5 A;  1X69 A;  3R6N A;  1BBZ A;  2M0Y A;  4RUG A;  1QLY A;  2EGE A;  4OMN A;  3PE0 A;  3TSZ A;  2L3P A;  1OEB A;  2ROL A;  1JXM A;  2O2O A;  1GBR A;  2LJ0 A;  2V1R A;  1X2K A;  4OMP A;  4Z88 A;  2X3X D;  2DBM A;  1NYF A;  4LE9 A;  4AG2 C;  2KRS A;  1WDX A;  1E6G A;  2DL8 A;  1ZX6 A;  1YN8 A;  1XOV A;  2DRK A;  1QCF A;  3M0T A;  2GTJ A;  3REA B;  4J9E A;  3NHN A;  1K9A A;  2D0N A;  2JS2 A;  4F14 A;  3VS2 A;  2OI3 A;  4ESR A;  1MV3 A;  4WCI A;  2DLP A;  4J9G A;  2EGC A;  2JT4 A;  2EYY A;  2RPN A;  1W1F A;  2AK5 A;  2XMF A;  2CUB A;  2EYX A;  1KJW A;  3SEM A;  2AKK A;  3EG3 A;  1MUZ A;  5IHI A;  1MV0 B;  1G83 A;  2AZV A;  2LQN A;  1YP5 A;  2EW3 A;  2ROT A;  1Z9Q A;  1FYN A;  1WX6 A;  1GBQ A;  2HCK A;  2FG0 A;  1PKS A;  1M27 C;  2ESW A;  2W0Z A;  1RLQ C;  3REB B;  1X2Q A;  2HBW A;  3VS7 A;  2DYB A;  5ECA A;  1X27 A;  1X6B A;  2KT1 A;  2VWF A;  4RTV A;  1OPK A;  4X1V A;  2EPD A;  2KYM A;  1V1C A;  1OPL A;  2J7I A;  2L0A A;  2YUN A;  1J3T A;  2E5K A;  1RUW A;  2D8H A;  4OMQ A;  2CT4 A;  2GTO A;  1JU5 C;  3LH5 A;  1HJD A;  1VA7 A;  1ABQ A;  1YWP A;  4FSS A;  4J9F A;  1GFD A;  3UAT A;  2J05 A;  2LJ1 A;  1U5S A;  1WI7 A;  2JMA A;  3EHQ A;  1ABO A;  1UE9 A;  1T3S A;  4LUD A;  2GGR A;  3ZL7 C;  3UA7 A;  4LUE A;  2ECZ A;  3RBB B;  3I9Q A;  4D8D A;  4OMM A;  2L3S A;  3VRZ A;  2I0N A;  2ABL A;  4Z8A A;  3C0C A;  1PNJ A;  3QWY A;  1VYT A;  1T0J A;  4IIM A;  2LQW A;  4ZNX A;  1AWO A;  2K79 A;  1U06 A;  1WXT A;  3NPF A;  2RF0 A;  1JO8 A;  2EKH A;  1JXO A;  2DL7 A;  1UFF A;  2C0I A;  1BK2 A;  2DL3 A;  4RTY A;  1AZE A;  1K4U S;  1RI9 A;  3JV3 A;  2KRM A;  1VYV A;  1E6H A;  4M4Z A;  2MCN A;  1SHG A;  1B07 A;  2GQI A;  2D8J A;  3VS6 A;  1WA7 A;  1OV3 A;  2FO0 A;  3RNJ A;  4GBQ A;  1KFZ A;  2KEA A;  1RLP C;  2O9V A;  2LZ6 B;  4OML A;  2VKN A;  1PKT A;  5IHK A;  2J6F A;  1I0C A;  1NLP C;  2D1X A;  2KE9 A;  1Y0M A;  2CRE A;  4Z89 A;  3NGP A;  1GCQ A;  2YUP A;  3IQL A;  1M3A A;  4J9D A;  2W10 A;  2IIM A;  4AFZ C;  3M0P A;  2O9S A;  4K11 A;  4DEX A;  1G2B A;  2FRW A;  2JTE A;  2C0O A;  2J06 A;  3UA6 A;  1QKX A;  1QWE A;  4LNP A;  2G6F X;  1EFN A;  4RTW A;  2P4R A;  1UTI A;  2LMJ A;  1WFW A;  2A08 A;  2M51 A;  2JMC A;  2OJ2 A;  1I1J A;  2F2V A;  1GCQ C;  3M0Q A;  3THK A;  2DJQ A;  1GL5 A;  4RTT A;  2YSQ A;  1WXU A;  1SSH A;  2C0T A;  5FW9 A;  2ED1 A;  5IHN A;  3CQT A;  1AVZ C;  4J9C A;  2K3B A;  3EG0 A;  1T3L A;  1VYU A;  3VRY A;  2B86 A;  2KRN A;  1I07 A;  1UJY A;  1AZG B;  4HVW A;  2BZ8 A;  2RQR A;  1M3C A;  1W6X A;  2EQI A;  3M0U A;  4CC2 A;  2DVJ A;  2AZS A;  3I5S A;  2MIO A;  1BB9 A;  4J9H A;  5I22 A;  2DA9 A;  2HSP A;  3TSW A;  4J9I A;  3VS1 A;  2JM9 A;  4JZ4 A;  1GRI A;  2GNC A;  3I35 A;  1PWT A;  4RTU A;  1UHF A;  3M0S A;  1TUD A;  2K7A A;  2DX1 A;  1LCK A;  5GJW B;  1AEY A;  1IO6 A;  2RQW A;  1NLO C;  1SEM A;  2FRY A;  2OAW A;  1FMK A;  2MOX A;  3KFV A;  2QDL A;  2DBK A;  2JM8 A;  2KRO A;  2RNA A;  2PZ1 A;  3EHR A;  2CH4 A;  1H8K A;  2K6D A;  4HXJ A;  2HDA A;  2LP5 A;  2DRM A;  4AFQ C;  1SHF A;  3H0H A;  1WLP B;  2H8H A;  5IH2 A;  2O31 A;  3M0R A;  5FWC A;  1K1Z A;  1YNZ A;  5HCK A;  1UG1 A;  2LJ3 A;  5L23 A;  1QWF A;  1AWX A;  4Y92 A;  1QKW A;  1NM7 A;  4JJD A;  1H92 A;  3EG2 A;  3I5R A;  5FWB A;  1SPK A;  1NYG A;  4GLM A;  1HD3 A;  1U3O A;  2BZX A;  2KR3 A;  1PRL C;  2YUQ A;  4F16 A;  1K0X A;  2BZY A;  4LN2 A;  1E7O A;  1ZUU A;  3U23 A;  2RMO A;  3FJ5 A;  1CSK A;  3H41 A;  2K9G A;  1WIE A;  1CKB A;  2KNB B;  2GBQ A;  2RQT A;  1PRM C;  2K2M A;  2DMO A;  4AG1 C;  1NG2 A;  2DL4 A;  3PVL A;  2KXC A;  2AKL A;  2DM1 A;  1A0N B;  2F2X A;  1TG0 A;  4KRT A;  3VS0 A;  3PVQ A;  2CH4 W;  1TUC A;  2HEQ A;  3VS5 A;  5GJV B;  1M30 A;  3EG1 A;  2LX7 A;  1NEB A;  4RTX A;  4J9B A;  4F17 A;  2SRC A;  2RN8 A;  1AWW A;  1UUE A;  4DEY A;  2X3W D;  1KSW A;  3SHW A;  4JPB W;  1T0H A;  2DE0 X;  4HVU A;  1W70 A;  2VVK A;  4AFU C;  3A98 A;  1M8M A;  2EBP A;  2KXD A;  2FEI A;  1GCP A;  2YDL A;  1YWO A;  2NWM A;  2A36 A;  2JXB A;  1B3Q A;  2JS0 A;  2A28 A;  1ZUK A;  1BU1 A;  2SEM A;  5IXF A;  1S1N A;  2FPF A;  2YT6 A;  1WXB A;  4RTZ A;  3NMZ C;  3VS3 A;  3O5Z A;  5I11 A;  1SRL A;  2NUZ A;  1KIK A;  1CKA A;  1UDL A;  2L3Q A;  1JEG A;  2J6K A;  3H0I A;  4HVV A;  2F2W A;  4E6R A;  2RQV A;  2O88 A;  2ED0 A;  4IIO A;  1ARK A;  1AWJ A;  1AD5 A;  2KYB A;  3EGU A;  1H3H A;  2EVR A;  2ENM A;  4AFS C;  1ZBJ A;  2KGT A;  2FPD A;  5IXB A;  1K0S A;  1M3B A;  2L2P A;  2PTK A;  2A37 A;  4QT7 A;  4JJB A;  2DF6 A;  2BTT A;  1YCS B;  4ORZ A;  1Y57 A;  3ULR B;  1UEC A;  1SRM A;  3VS4 A;  2KT8 A;  1OOT A;  2EYZ A;  2PNI A;  2JW4 A;  2J6O A;  2DIL A;  3QWX X;  1NEG A;  1N5Z A;  2FPE A;  2DNU A;  2EYW A;  4A63 B;  1UHC A;  2CT3 A;  1GFC A;  1JQQ A;  2YUO A;  1ZLM A;  4CC4 B;  2CDT A;  4JZ3 A;  4R0K A;  2CUD A;  1HSQ A;  2EGA A;  4JJC A;  4CC7 A;  3UF4 A;  4CC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...