2JM9A

R21a spc-sh3 bound
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jm9A00
5ECAA 2DJQA 3TVTA 4OMQA 4WCIA 2GNCA 2GQIA 2RQVA 2SRCA 4LN2A 2AZSA 2O9SA 2MIOA 2DL8A 2JMAA 3M0RA 4ORZA 2EBPA 2LZ6B 2QDLA 2C0OA 2NWMA 1X43A 2JM9A 1UUEA 2EW3A 2DL7A 1BK2A 2SEMA 4K11A 4DEXA 3PVLA 3VRYA 1HSQA 4LE9A 5I11A 1AWOA 1GL5A 2J05A 3I5SA 3KFVA 1PNJA 2DF6A 2M51A 2HDAA 1ABQA 5L23A 1AWJA 1MV0B 1UE9A 1OPLA 2KBTA 2RQTA 2P4RA 4RTYA 1GRIA 4Z89A 1FYNA 1VYTA 1W70A 4CC2A 4RTUA 1OV3A 1RUWA 2W10A 1YN8A 2DBKA 1NYFA 1K4US 1UDLA 4R0KA 2CH4A 1UTIA 2KT1A 4F16A 1NEBA 1WXBA 2HCKA 1KJWA 3VRZA 2RN8A 1NEGA 4E6RA 1M3AA 2YDLA 4IIOA 1EFNA 2DLPA 1ZLMA 2GBQA 2DNUA 3EHQA 4LUEA 3REBB 3NGPA 2JM8A 1TUDA 1PWTA 2VKNA 1B07A 2JS0A 1QWEA 1MV3A 1S1NA 1HD3A 2B86A 2DMOA 1UECA 1WDXA 4D8KA 2JW4A 2K7AA 5FWBA 1T3LA 1GFDA 1AD5A 3EG2A 2LJ1A 2DYBA 2A37A 4JZ4A 2C0TA 2O31A 2YT6A 4OMOA 1M3BA 2VWFA 2EKHA 1SHFA 1B3QA 1KSWA 4Z8AA 2LP5A 4F14A 3GBQA 3RBBB 3EHRA 2MOXA 1KFZA 2G6FX 3I5RA 2DRMA 3REAB 2DBMA 2BZYA 4JPBW 2L0AA 3VS4A 5IH2A 2M0YA 2D8HA 5EC7A 4D8DA 2KE9A 2CREA 2RNAA 1UG1A 3THKA 2K2MA 4X1VA 1ZUUA 2ESWA 1QCFA 2OI3A 5FWCA 4AG1C 2DA9A 4OMNA 2KRNA 2CSQA 2ABLA 2X3XD 1N5ZA 2L3QA 1U5SA 3PE0A 3UF4A 1QKWA 5GJVB 2CT4A 2J7IA 2EYZA 2HEQA 3UA7A 4QT7A 1UHCA 4RTTA 2LX7A 2YSQA 1ZX6A 3NHNA 3EG0A 2FPDA 1WYXA 1YWPA 3UATA 1NG2A 3SHWA 3H0FA 1T3SA 4DEYA 1GCQA 1TG0A 2D8JA 1M30A 2LCSA 1PHTA 2PZ1A 3VS1A 1RLPC 4RTXA 2DX1A 1H3HA 4LNPA 1GCQC 1WX6A 1Z9ZA 2I0NA 2BTTA 1KIKA 2V1QA 1YP5A 1JQQA 2KYMA 1M8MA 2DL4A 2ROTA 2CUDA 2EYWA 1LCKA 1UHFA 1VYVA 1I07A 3EG3A 2HSPA 3M0SA 3I9QA 2D0NA 1WFWA 3H41A 4A63B 2KYBA 1BU1A 1QLYA 5I22A 2CSIA 4OMLA 2EPDA 3TSWA 2BZ8A 2J06A 4AFZC 2HBWA 2LNHB 3O5ZA 4GBQA 2K3BA 2YUOA 1T0JA 4HVVA 2EYXA 3I35A 5IHKA 4RUGA 2RMOA 2MCNA 3R6NA 1YNZA 3VS7A 2CT3A 2VVKA 1CSKA 4CC3A 1YCSB 2JS2A 1PRMC 2KNBB 2EGAA 4CC4B 1SHGA 2D1XA 4HCKA 1Z9QA 3U23A 1SPKA 4J9IA 4JJDA 3A98A 1UJYA 2ENMA 1SRMA 2L3PA 1AWWA 2LQWA 1E7OA 2AK5A 2BZXA 2J6KA 1SSHA 1FMKA 2JMCA 2KRSA 1AZGB 5IXFA 3TSZA 1K0SA 2RQRA 1JU5C 2CUBA 2V1RA 1NLPC 1J3TA 1Y0MA 2KT8A 4CC7A 3JV3A 4J9BA 4OMMA 3VS5A 4J9FA 1ZSGA 3H0HA 3C0CA 1AVZC 4F17A 2DE0X 2C0IA 3H0IA 5HCKA 2RPNA 2AZVA 2DL5A 2W0ZA 2FO0A 2RQUA 1JXMA 1IO6A 2DVJA 2KROA 1GBRA 3RNJA 1H8KA 1I1JA 1X69A 2CH4W 4J9EA 4J9DA 4HVWA 1WA7A 1E6GA 2ED0A 2PNIA 2GTJA 1E6HA 1WI7A 2XMFA 1I0CA 2KGTA 2A28A 1VYUA 1JEGA 1SEMA 3NPFA 2RF0A 2LJ3A 3M0QA 2JXBA 1MUZA 3UA6A 1U06A 3M0UA 3EGUA 1K1ZA 4HXJA 1NLOC 4AFQC 4AFUC 2IIMA 1G2BA 3VS0A 2F2WA 2LJ0A 2ED1A 1JO8A 1AEYA 4RTZA 4J9CA 1X2KA 2A36A 2KXDA 2OAWA 1RLQC 2FPEA 1NM7A 3M0PA 1ZUKA 2DRKA 1Y57A 3LH5A 5IHNA 2EVRA 1W1FA 4LUDA 2KRMA 2FEIA 2DILA 2OJ2A 1OOTA 2AKKA 5IXBA 2A08A 1X6GA 2YUQA 4GLMA 4AG2C 2DM1A 2X3WD 1BBZA 1X6BA 2GTOA 2YUPA 1CKAA 1WXTA 4ZNXA 1AOJA 1QKXA 1GBQA 2EQIA 2GGRA 4HVUA 2O88A 3PVQA 2RQWA 1WXUA 1AWXA 2L2PA 1ZUYA 1PKSA 2L3SA 2O2OA 2JTEA 4KRTA 2CDTA 1G83A 1H92A 4Y92A 4EIKA 3EG1A 2NUZA 1XOVA 3FJ5A 1AZEA 3VS2A 3ULRB 1V1CA 4FSSA 4Z88A 4J9HA 1GFCA 2F2XA 4RTVA 1ARKA 2K79A 1UFFA 1A0NB 2JT4A 1UGVA 2J6OA 2KR3A 2FG0A 1T0HA 1ZBJA 2ROLA 2EGCA 4AFSC 1JXOA 2ECZA 2J6FA 3SEMA 1K9AA 5IHIA 1BB9A 1UJ0A 4RTWA 1SRLA 2FRYA 1PKTA 1HJDA 1PRLC 3ZL7C 4M4ZA 1TUCA 1CKBA 2H8HA 2AKLA 2O9VA 1WIEA 3VS3A 2PTKA 3NMZC 1OPKA 2EGEA 1K76A 4JZ3A 4JJBA 4JJCA 2FPFA 3VS6A 1RI9A 5FW9A 2LQNA 2F2VA 1M27C 3M0TA 2EYYA 2LMJA 2YUNA 1YWOA 2K6DA 1WLPB 1QWFA 2E5KA 1X27A 4J9GA 4IIMA 2DL3A 1NYGA 3CQTA 1M3CA 1OEBA 1K0XA 1U3OA 4ESRA 1GCPA 4OMPA 5GJWB 2K9GA 1X2QA 2KXCA 1W6XA 3IQLA 2FRWA 1VA7A 2KEAA 1ABOA 3QWYA 3QWXX
chains in the Genus database with same CATH superfamily
2HNIA 2RHUA 1QVFP 4WCIA 2GNCA 1YHQA 4FT4A 2DL8A 3JB9D 1HYOA 2E65A 4DBFA 3CCJA 2CZ1B 3KBGA 2RI2A 2NWMA 1X43A 4Y91A 3CCLA 2DL7A 1XQHA 4MZMA 5KYXB 3CBPA 1HSQA 5KH6A 4LE9A 4J7IA 3OQ5A 4FYYB 1AWJA 1KC8R 3L2QA 1JB0E 5I2MA 1K73C 2P4RA 1GRIA 5CKBA 1VQ5A 4Z89A 1V29B 2YRCA 4CC2A 1OV3A 3GOXA 4R0KA 2RHYA 4CRIA 3H9NA 1UTIA 4JRQA 4F16A 2VB6A 1KJWA 3I55A 1IGUA 4LDXA 1M3AA 2YDLA 4IIOA 1VQ6T 1VQ4A 1ZLMA 3EHQA 2XDBA 3REBB 2JM8A 2DYIA 1PWTA 2VKNA 3QBYA 2DVEA 4F7UA 1B07A 4ANJA 1Q7YC 1G8XA 1NBEB 1M9SA 5GMKh 2PUKB 4J6YA 2JW4A 2K7AA 4NL2A 1TS9A 2MF2A 1KC8U 3LW5E 2HZYA 4HCBA 1C1AA 2JJ9A 5D7UA 3QSUA 3JCMg 2COZA 2HBPA 3C94A 1B34A 2LP5A 4A4KA 3QHSA 3RBBB 3VJPA 4J83A 2MOXA 3OY9A 4JRPA 4MZPA 2L5QA 2DRMA 3REAB 2QQBA 3JCMc 4M78C 5GMKe 2BZYA 4JPBW 3JB9H 1BCOA 5IH2A 5J39A 3G1JA 2MMPA 3SDZA 2CREA 1IB8A 2WSEE 7AT1B 3BFMA 1U8RA 1QCFA 2OI3A 3HHTB 3CBOA 1VOMA 2DA9A 2P0KA 3M4YA 1FX7A 2X3XD 1VQ7Q 5CKHA 3X28B 2CT4A 2GF7A 4ZGDB 3CMET 4NOYA 1H3ZA 4BD3A 5AYFA 4C0GA 2VUBA 1UEBA 1VQ9Q 1YWPA 4M7AD 5LJ3g 2C06A 3HSBA 2EAYA 2B8AA 5GAN4 1TG0A 1TWBA 4IUVA 3UWNA 3VV0A 3L2RA 3CC2A 4RTXA 3CD6Q 4M7AF 1H3HA 3CCMQ 3TU4K 4JS5A 1PC0A 2PVGB 1Q86C 5GAN8 2BTTA 4B6MA 3EH1A 1KIKA 4MMKA 2KQWA 3OYMA 4FIBA 2GCXA 2HMAA 4EMKA 3N5BB 1QQJA 1M8MA 4C8QG 5CCAA 1LCKA 5GANj 1N8RU 1I07A 3EG3A 3EG9B 2HSPA 3A8LB 3M0SA 3I9QA 8ATCB 2KYBA 3CCJT 5KYUB 2EFIA 2CSIA 3QYGB 1B7TA 2QQAA 3URGA 4OGCA 3TSWA 1VQLA 1ZA2B 5LJ3j 2LNHB 3O5ZA 1LNXA 2F1LA 2EYXA 3I35A 3OYYA 5LL6S 4RUGA 1VQLQ 3LGFA 4JLIA 5GAOl 2XG8D 4TVRA 1YCSB 3LYIA 2KNBB 4CC4B 1IGQA 2K5LA 2IG0A 4HT8A 2D1XA 4HCKA 1VQMA 1X75C 1SPKA 1UJYA 1DJ7B 1Q82U 2CP7A 4C5EA 1JJ2P 2LQWA 1YITQ 2AK5A 2BZXA 4LDYA 5J26A 4MDXA 2V8IA 1SSHA 2CS7A 4V2SA 3CCLQ 3QG1A 3G71A 5GAOp 2LC4A 5GMKj 3OS1A 3JV3A 1M2VA 3VS5A 5L8RE 5J3BA 4C8QE 3C0CA 3OS5A 2OX7A 1AVZC 4F17A 3QYHB 5GMKi 4N0AA 3V7SA 4LD9K 2RQUA 1JXMA 2DVJA 1UGRB 1GBRA 2M16A 4D6WA 1IXDA 1H8KA 1X69A 4X34A 4J9DA 1Q82R 3OMGA 3DB4A 1E6GA 1WNLA 2DD4A 1E6HA 4PFPA 4XU3A 2O4XB 3NTKA 3OSVA 1VUBA 1ZHIA 3CC7Q 3LWIA 1SEMA 4J7FA 4J5YA 1M2VB 4N4HA 3L42A 2QEXQ 4M7DE 1K1ZA 4QVCA 1QCNA 3SFMA 1VQPA 5GAN5 3KUFA 3OW2S 5A0LA 4F7UF 2ED1A 4M77B 5GAMh 4J9CA 1X2KA 2P0PA 2VYTA 4PJJA 2LTOA 5CQXA 4FM4B 2IPOB 1M5Q1 3NTHA 4F7UG 3S6WA 3A8GB 3LH5A 1W1FA 4FU6A 4E2FB 4LUDA 1XTDA 2OJ2A 2K4YA 1OOTA 2AKKA 3CXCP 2A08A 4FSXA 2AHJB 2X3WD 1BBZA 1WJQA 1AOJA 1QKXA 2EQIA 1K9MU 2ZPHB 3SWNA 2O88A 3PVQA 2A3LA 1IREB 5CAIA 1NJIR 5KYYA 1PKSA 4M75B 3M53A 2CDTA 3H6ZA 2QK0A 3EG1A 4ZN3A 3V8JA 3FJ5A 1AZEA 5LJ5j 1M1KU 4KGVB 3OBYA 1GFCA 2F2XA 4RTVA 5GAMd 2JT4A 5FU7B 3CCEA 4E7HA 2KR3A 2YWWA 3RR6A 4JLGA 1R0BG 3JCMb 2J6FA 2Y4YA 1BB9A 3ZEHA 3MKDA 3ZL7C 3J7AF 3G71Q 1TUCA 5A0GA 1N9SA 1W4SA 1YJ9T 3QZ5B 2O9VA 2FZCB 2Z0WA 1MMGA 3CCQQ 2PTKA 1VQ9A 1YITA 4JZ3A 4JRKA 1PSFA 1Q95G 4PLIA 3RUXA 5GAOr 3V8KA 5CQYA 1QP2A 4E7KA 1K8AC 1M27C 4II1A 5LJ5g 5GAMg 1FMWA 2LMJA 3PIPA 3MEAA 1RACB 3QIIA 1Y07A 2K6DA 2I2LA 2OTJA 1WLPB 1NZ9A 4PJOD 1QWFA 2E5KA 2AIRB 2DL3A 1NYGA 1WHHA 3RMSA 1IHWA 2QASA 4BI3A 3OS0A 1U3OA 3CC4T 4OP0A 5GAMe 1RAHB 3GIBA 4QVZA 2G3RA 2QYZA 4M7DC 3TVTA 4OMQA 2GQIA 2RQVA 2K2VA 4PL6A 1RL2A 1OYXA 2JVVA 4ORZA 2LZ6B 1R0CB 2EW3A 1BK2A 1F1BB 3HL8A 3VRYA 5I11A 3OYHA 5GAMj 2DF6A 5GMKm 4OB2B 1ABQA 4RG8A 1K73R 5LJ5h 2QGGA 1QVGS 3HRTA 1VQOT 3CD6T 2GFUA 1OPLA 1VIEA 1YJWA 1MNEA 2NUPB 1W70A 5HY6A 3OYAA 4WF2A 3FDRA 2E70A 3G6EA 3A1PA 2W10A 2ZZDA 2OTLA 1NYFA 2ATCB 1UDLA 3OW2A 1K4US 1ZQ1A 4DQ2A 1PD1A 1JBMA 3GPLA 2RN8A 4IUUA 2MI6A 2L8DA 5CIUA 3CMEQ 2XDPA 2WSFE 3KXTA 4MMLA 1EFNA 3OYBA 4XTXA 2DETA 3EGXA 3MEVA 4KULA 2PUOB 3M5AA 2EYQA 1VQ5Q 2JS0A 2LT4A 4ELZC 1QWEA 3CCET 1BI3A 1HD3A 2DMOA 2FVUA 3CPWS 2K5FA 3CMAQ 3CCVQ 2DXBA 1WHJA 5FWBA 3UDCA 5KYXA 1AD5A 2VASA 4EMKB 3P8DA 2LJ1A 3FJPA 2LRQA 2DYBA 2A37A 1QVFS 4FL6A 3O8VA 4JZ4A 2O31A 4OMOA 4BDZA 2VWFA 2KY9A 2FZGB 4XTUA 3OB9A 3HFOA 3PMTA 4F14A 3CEYA 2DAQA 4E47A 1TXQA 1KQSA 1OQKA 2DIQA 3I5RA 3MPUB 1VQOA 3OYIA 3I56A 3M56A 2L0AA 3CC7A 3VS4A 2M0YA 5EC7A 2DZCA 4D8DA 3EH2A 4C8QD 5FU6C 5HK3A 3MO8A 3THKA 2K2MA 1ZUUA 1JJ2A 5FWCA 3HRUA 3PNWC 4OMNA 2KRNA 2CSQA 4KH0B 2X35A 1LJOA 2L3QA 3UF4A 4M78B 2WACA 2D6FA 2EYZA 2RK1A 5FRNA 3UA7A 4OGEA 3QKJA 4RTTA 3E19A 3I56Q 3OYFA 4BY6B 3NHNA 1M1FA 3EG0A 4EMKC 1WYXA 1K9MR 3UATA 2DKGA 4N4IA 2R5MA 4DEYA 1GCQA 1M30A 2E41A 1WGSA 2JTFA 5FU6B 2E6ZA 3CBMA 3X20B 1WX6A 4HCCA 4M75D 3CCMT 4RG2A 1YHQT 1JQQA 2KYMA 4OVAA 2DL4A 1D0XA 3VYGA 2ROTA 4PFOA 3QDRB 1FWZA 4BACA 1WHMA 1UHFA 4A4FA 2M9UA 4A63B 4F7UB 1QLYA 5I22A 3DLLA 3FB9A 4XTYA 3CMEA 2EPDA 2XKOC 2RM4A 3FRNA 3SD4A 2IVWA 4GBQA 4BB7A 2K3BA 2YUOA 2DK3A 4OF1A 2L89A 5GAOm 1YNZA 2XICA 1QMCA 3VS7A 3RERA 3A8MB 1CSKA 2EIFA 4CC3A 4IKFA 2MPXC 1TH7A 1IHVA 1WQ7A 2EGAA 2LQ8A 3CCQA 3TEEA 2HSEB 1SHGA 4M78G 3U23A 3GNGA 3A98A 3CC2Q 2L3PA 1Y7XA 1E7OA 1KQ2A 1FMKA 4DOVA 3JB9J 4XTVA 4X9DA 2RK2A 1KC8C 3QPHA 3HFNA 2LT1A 3CMAA 3CCVA 2XU8A 3VUZA 4J9BA 4J9FA 1SSFA 1M8VA 3H0HA 2R57A 3EFOB 2X51A 2DE0X 5HCKA 1SF9A 3PIOA 2AZVA 2E10A 3MEWA 2GQVA 2W0ZA 2FO0A 1IO6A 3MP8A 3RNJA 1D0YA 2RA2A 1N8RC 3M54A 1WA7A 3EFSA 1MHNA 2H3JA 4WTOB 5FRMA 1WI7A 3L2VA 3OMCA 1UGQB 1NE8A 2XMFA 2BE9B 3MHXA 3JCMh 3CC2T 2OTLQ 4AT1B 1MMAA 4PJOC 2F5TX 2O01E 1U06A 1WQWA 3EGUA 4HXJA 4AFQC 1D1BA 3QJYA 4E7LA 3VS0A 2RI5A 3X26B 1YJ9Q 3EGDA 1AEYA 3C4SA 3CCSQ 3CCST 4RTZA 3CCMA 2A36A 2KXDA 2OAWA 1WHKA 4C8QC 1NJIU 1ZUKA 3M9QA 4ZGEB 3ER0A 1Y71A 1XNIA 1Y57A 2JN0A 2JUFA 3MJXA 5IHNA 2FEIA 1SKUB 2PU9B 3OW2P 5IXBA 3SB2A 1ACMB 2YUQA 4IUQA 1VQ4Q 4AG2C 2KAFA 4F04B 4NS5A 4P5NA 2DM1A 3CCUQ 2LNVA 1Q7YR 1WXTA 2GGRA 2F5KA 4M75E 2RQWA 3JCMP 1WXUA 3OYKA 1K8AR 2LX9A 2RJCA 4M77C 4QQGA 3ASKA 4KT0E 2ZPBB 3R6OA 4PLLA 4M7AC 4M7DD 5LJ5f 2JTEA 1H92A 1RADB 3JRZA 5D6XA 1X01A 1ZSZC 1BCMA 4FSSA 4Z88A 4J9HA 5LJ5e 1ARKA 1UFFA 1RI0A 1UGVA 4M7AA 3M59A 1T0HA 5IAYA 5IT9E 1VQLT 2DERA 5IHIA 4C8QB 4BE1A 2MK5A 4RTWA 1PKTA 1HJDA 1PRLC 4C8QA 3LGLA 2R5AA 1V76A 4HKEA 4BI4A 1YI2T 5GAN6 2CZ0B 3NMZC 4M78D 2JTMA 4C92C 3HPWA 1K76A 2XIDA 2VV5A 4JJBA 2RO0A 3HTRA 4RMOA 4A4EA 1RI9A 3P8HA 4PJOB 1ZSZB 4C92A 5GANe 1PM3A 4M78F 4JUVA 2YUNA 1BI2A 2CP6A 2A0FB 2DEUA 3ZBDA 3I55Q 3BY7A 4IIMA 2RJDA 1M3CA 4XU2A 1M4ZA 5KCOA 3QUIA 4ESRA 2QEXT 5GJWB 2K9GA 1M2OA 1X2QA 1W6XA 2KXCA 1S72A 3VYHB 4F7UE 1VA7A 1ABOA 3RESA 2DJQA 2QQSA 2SRCA 3M4GA 4L6V5 4LN2A 4DA4A 1VQOQ 2AZSA 2EJ9A 3GNFB 2DTIA 2MIOA 2JMAA 4E7JA 1I8FA 3CD6A 2X4XA 3L2ZA 2EBPA 2P84A 3JCMd 3RKXA 3JSCA 2SEMA 4K11A 3PVLA 1I4K1 4YTLA 1VQMT 1AWOA 3C95A 3I5SA 3KFVA 1PNJA 3BDLA 4O6JA 4N0AC 4CI0C 2GFAA 2HDAA 1VQPQ 1KQSP 5L23A 1PCXA 1UE9A 4PJOF 2DTOA 2KBTA 1YHQQ 4RTYA 1W2BP 1Q81R 2X4YA 1VQ7A 4FW1A 4ZTFA 1RUWA 1YN8A 2CH4A 1Q81U 3G4SA 2QI2A 2BE7D 2M1HA 2HCKA 4BI8B 3VRZA 4J8OA 5GANh 4J6XA 2OAUA 3CCUA 2DLPA 2GBQA 2QA4Q 2DNUA 5EG2A 1VQNT 3CXCS 1YJWQ 2QQRA 1S1NA 1VQ8Q 5KCHA 3CC4Q 3J81E 4XTZA 4PJOA 1WDXA 5CO7A 5CKFA 4B9XA 3T9NA 2V8KA 3DLMA 2JNGA 2XHCA 4M7DG 3EG2A 5DM7R 1YJ9A 5LJ3e 2WSCE 1M3BA 2EWNA 2RH2A 1SHFA 3PMIA 4C0FA 2VC8A 1EZZB 4Z8AA 1WJSA 1I81A 2EQJA 1KFZA 5KYWB 2COYA 3PGGA 2DZ9A 2DBMA 2QTVA 1X6OA 2CP5A 1D09B 2D8HA 2CYZB 3FEOA 2QEXA 2QXFA 4A4HA 2KE9A 4FT2A 1OU8A 1UG1A 3MCAB 2CZ6B 2ESWA 4QKUA 3VUBA 1TTHB 2HKQB 2ABLA 3TCJA 5M9OA 1N5ZA 2EQMA 1U5SA 1Y96A 4HT9A 3PE0A 5GJVB 2J7IA 1R77A 2RI3A 4O5VA 2ZPIB 1OI1A 1IRXA 2LX7A 3OA6A 1YIJA 1ZX6A 2FPDA 4EMHA 3Q1JA 2LCLA 1NG2A 1SG5A 3L1AA 3H0FA 1YI2A 3META 5IN1A 1OZ2A 2LCCA 1QVGP 3JCMf 1M90R 1PHTA 3CCVT 3CMAT 2QQ9A 2PZ1A 3VS1A 1RLPC 5GMKl 1PSEA 2DX1A 4LNPA 2HAXA 1Z9ZA 4C8QF 2KDSA 2KK4A 4DBRA 2V1QA 3BW1A 1BIBA 3CC4A 3LWHA 3RKWA 1WHLA 3WXMB 2RHZA 3CPFA 2KI7A 1NPPA 4M78E 1KQSS 3H41A 2CP0A 1IZ6A 1U1SA 3JCMV 2M02A 4M75C 1N27A 2QAZA 3V8LA 1QW1A 2HBWA 3GLXA 1YJWT 1T0JA 5IHKA 4ZN1A 1PG5B 2CT3A 4A4GA 1WPYA 2QG9B 4OB0B 2JS2A 1PRMC 4OB3B 2RHXA 2EJFA 3C12A 1ZBXA 3RMQA 2ZPGB 1SRMA 2RJEA 4GY5A 3EFOA 1RAAB 2X9HA 5I21A 2ZPFB 2JMCA 3CPWA 2KRSA 5IXFA 3TSZA 2EJGA 4LD6A 2RQRA 1VQKT 2DTHA 1N9RA 2V1RA 1NLPC 1RABB 3EFRA 4M75G 3OYGA 1Y0MA 3CCJQ 1YJNQ 3S3MA 4OMMA 3TQ7P 1ZSGA 3M57A 4BE2A 1PD0A 5GANd 3TREA 2E6NA 2C0IA 3H0IA 4M75F 3CCQT 1Q86U 2RPNA 1FMVA 2DL5A 5DLQE 4ELYC 1D3BB 1M90C 2QA4A 2K5IA 1RAGB 2CH4W 4J9EA 1MMNA 4L5GA 3FIFA 4XU0A 3A8OB 2GTJA 4OB1B 1D3BA 1I0CA 2QA4T 2DD5A 1VYUA 3PTAA 1OU9A 2AT1B 4XTWA 3NPFA 2RF0A 3M0QA 2RD1A 2JXBA 3JCMW 3UA6A 1KQ1A 3M0UA 1KK7A 3BE3A 4KGZB 5DY9A 3D7SB 4AFUC 2IIMA 1M90U 5GAN7 3A8HB 2F2WA 3JCMQ 2LJ0A 1QVPA 5AT1B 1JO8A 4Z02A 3X25B 2FPEA 4C92D 1NM7A 1KHCA 4XK8E 5A0DA 2M0OA 2DRKA 4R55A 4JJNK 4LXCA 1QVGA 4HCZA 2EKOA 2EVRA 4LDVA 3JAME 1VQMQ 2D9TA 2KRMA 4M77E 2V26A 3GP8A 1K73U 4IURA 2K57A 1OULA 1M1KC 1S72Q 2BIVA 3DB3A 2FZKB 4M7DB 2GTOA 1CKAA 4ZNXA 1GBQA 1OX8A 5GAOq 4HVUA 1AHJB 4M78A 3UT1A 1JRIA 3JCMe 3G6EQ 1ZUYA 1RAEB 2L3SA 2O2OA 3SWNC 5CR2A 1NJIC 4KRTA 1G83A 2RHIA 4EIKA 4PJMA 4FW2A 2P4TA 3G4SQ 2DXTA 2YLBA 3ULRB 4M77D 5C6SA 1WJRA 4BE0A 3NFCA 1KHIA 2K79A 2DXUA 4J6WA 4M7DA 1R8OB 3CC7T 2J6OA 2FG0A 1ZBJA 4ATOA 4EMGA 2EGCA 4AFSC 1JXOA 1VQKA 3SEMA 3OYNA 1UJ0A 1SRLA 1YJNA 5I2SA 1CKBA 3CXCA 1YI2Q 1FXXA 4UC4A 1WIEA 4B9WA 5HK0A 3VS3A 4XQ3A 2FB7A 3JB9F 1OPKA 5CKDA 2EGEA 3E9FA 3ZFJA 2A7YA 5KYNA 4JJCA 1Y96B 5D6WA 2FPFA 3VS6A 3HRSA 4M7DF 2LQNA 2E12A 3M0TA 4PKCC 4BDYA 2EYYA 3AHUA 2HL3A 3CCUT 3SWNB 1VQ4T 1VQNQ 3EGXB 3NTIA 4MZTA 4DBQA 4EPCA 5GAOn 1TOVA 3L2WA 2DFUA 4VUBA 1UGSB 4J9GA 4DOWA 3CQTA 3S3NA 1K0XA 3G6ET 3A5ZB 2KSSA 5LJ3f 1BI1A 5CKEA 1UGPB 3DKMA 5KYWA 1LVKA 3OS2A 3QWXX 5KE3A 5ECAA 3G71T 4L59A 2O9SA 1N8RR 2NUPA 4OMFB 2EQKA 3M0RA 3VU3C 2E3IA 2QDLA 2C0OA 2JM9A 4LDUA 1UUEA 4DEXA 1HXDA 2D0QB 3E2UA 5FU7C 4X9CA 1GL5A 2J05A 1NPRA 3CCEQ 2M51A 4ME7A 1OZ3A 1VQ8A 2PVOB 1MV0B 3FLGA 1O75A 4FCYA 2RQTA 1FYNA 3INZA 1VYTA 4DBHA 2O4XA 4RTUA 1YIJQ 4C92G 2DBKA 2KT1A 1NEBA 1WXBA 1K8AU 1BYMA 2VGMA 4C0DC 1NEGA 4E6RA 3JB9I 2FYKA 1Q7YU 1QP3A 3VKIA 1HK9A 2OTLT 4FYXB 4LUEA 4FYWB 2XI9A 4PFZA 3NGPA 3UPUA 1TUDA 1H641 2X4WA 4QVDA 3S3OA 1G3WA 3X24B 2CP3A 2MAMA 1MV3A 2B86A 2QDYB 2PQWA 1UECA 4PJNA 2FHDA 4D8KA 4XU1A 1T3LA 1GFDA 3OYEA 3FC3A 1G5VA 4JS4A 1Q82C 5GANf 1LPLA 2C0TA 2YT6A 2Y4XA 1P92A 3QZ9B 2EKHA 3I56T 4RKUE 1B3QA 3EAEA 1KSWA 2HQXA 3CCRQ 3GBQA 1ZA1B 2FL7A 3EHRA 1VQKQ 3RKYA 3HKSA 4AMCA 2G6FX 1VQ8T 1VQ6A 1S72T 5GAN3 1WZOA 3OYJA 4Q5WA 3RDVA 4E7ZA 2QTXA 2E64A 4C5GA 2VGNA 3CPWP 2RNAA 3AT1B 3PFSA 4X1VA 5FLXE 4AG1C 4KBMB 4M75A 1M1GA 3EG9A 4A54A 3LH0A 3V7CA 3RIRA 2K3XA 5GAMf 5KYYB 1QKWA 2HEQA 4LDWA 2P0QA 1W2BA 4QT7A 4KUDK 1UHCA 2KVQG 1QCOA 2YSQA 2CGHA 1VQ6Q 4ZTJA 4JDSA 3M55A 3P8BB 1YITT 1KD1U 5HKCA 2R58A 1VIFA 3SHWA 5A2QE 4PJOG 2LVMA 1T3SA 2D8JA 1G3YA 2LCSA 1AT1B 1YCYA 5LJ5d 3OBWA 2CZ7B 2ZPEB 4Y28E 1TUGB 1GCQC 2BKDN 2E3HA 2I0NA 4KGXB 2ZCFB 1YP5A 3LX7A 3MP1A 4M77A 2ZAEA 2YLCA 3JCMJ 2CUDA 2EYWA 2NYSA 3V7RA 4QW2A 3G7ZA 1VYVA 4QQDA 1G3TA 3QO3A 1BKBA 4HA8A 2D0NA 1WFWA 1YJNT 1BU1A 1OX9A 1RAFB 3OSSC 4OMLA 6AT1B 2L3RA 1GXIE 2BZ8A 1C6VX 2J06A 4AFZC 1VQ5T 5LJ3h 4HVVA 2DEQA 2RMOA 2MCNA 2COWA 3R6NA 4QQ6A 1MGQA 2VVKA 2JOYA 2XDDA 4E7IA 1Q81C 3WVDB 2BUDA 4ZGJB 9ATCB 2MWOA 1Z9QA 4PJOE 2XD0A 4J9IA 4JJDA 2CP2A 2ENMA 3H8ZA 4NL3A 1AWWA 2E4HA 1TSFA 2PVDB 4C0DB 2J6KA 3J80E 3EGDB 1KG1A 2MWPA 5GANg 1AZGB 4PJLA 4E7SA 1K0SA 1XJWB 1Q86R 3CCSA 1JU5C 2CUBA 2HQEA 1J3TA 2KMTA 2KT8A 4CC7A 2ZGWA 2YXYA 2JZ2A 2LDMA 3MEUA 2KROA 1I1JA 2RB6A 1RAIB 2YRVA 4HVWA 5LJ3d 3QDFA 2ED0A 1MMDA 2PNIA 3JB9G 2HQHA 1D0ZA 4R56A 4BUGA 1KD1C 1N6AA 2KGTA 3JCMX 3F70A 3E1SA 2A28A 4BY6C 2DIGA 3BDUA 1JEGA 2HD0A 5KYUA 2LJ3A 1YBYA 3OYDA 1MUZA 1D1AA 1WHGA 2F69A 3MP6A 1ZSZA 4C92B 3CCLT 1NLOC 2CKKA 1I5OB 4RCBA 1G2BA 2V8JA 1O9SA 4N4GA 4JRIA 5D6YA 4GLKA 2EQUA 3CCRA 3OYCA 2H3EB 2YHTA 1RLQC 1TU0B 2DJZA 3M0PA 3M58A 3E9GA 3ME9A 3WVEB 2DILA 5KE2A 1I5LA 5C0MA 2E5QA 1W2BS 5GAN2 2RJFA 1K9MC 1X6GA 4GLMA 3GF5A 4FYVB 2Y90A 4M7AB 4C92E 1BIAA 1X6BA 2YUPA 1LOJA 2X4JA 1KD1R 1G3SA 1AWXA 2MYSA 2L2PA 2XK0A 1VQNA 2DO3A 1YFNA 1EIFA 4C5IA 4Y92A 5CVIA 2NUZA 3PT9A 1XOVA 3VS2A 2YRDA 4EDUA 1V1CA 2E1HA 3G4ST 4C92F 4C5HA 2NUTB 1A0NB 2DPPB 3LLRA 3QXEB 3CCRT 4IUTA 2ROLA 2ECZA 1K9AA 1QVFA 2FRYA 4M4ZA 1BI0A 1B34B 2K3YA 2QGFB 2H8HA 3OYLA 2AKLA 3L2UA 2DXCA 2NLUA 4C0ZA 2NUTA 5CK9A 2OTJT 4PNOA 2VXFA 3QJ6A 4KUIA 5FROA 1VQ7T 5FW9A 2F2VA 2HKNA 1JJ2S 2HL5C 8AT1B 1VQPT 4M77F 4RCCA 1YWOA 3HP9A 4M7AG 5DLOA 4XAXB 4KH1B 4A53A 4PK4A 1VQ9T 1UB4A 1D1CA 2LQKA 1C0MA 1X27A 4IUPA 1U1TA 4M77G 4MDWA 1MNDA 3I55T 2OTJQ 1OEBA 1YIJT 1EX4A 1GCPA 2VXEA 4OMPA 4M7AE 1M1KR 3IQLA 2FRWA 2KEAA 3QWYA
chains in the Genus database with same CATH topology
5ECAA 2DJQA 3TVTA 4OMQA 4WCIA 2GNCA 2GQIA 2RQVA 2SRCA 4LN2A 2AZSA 2O9SA 2MIOA 2DL8A 2JMAA 3M0RA 4ORZA 2EBPA 2LZ6B 2QDLA 2C0OA 2NWMA 1X43A 2JM9A 1UUEA 2EW3A 2DL7A 1BK2A 2SEMA 4K11A 4DEXA 3PVLA 3VRYA 1HSQA 4LE9A 5I11A 1AWOA 1GL5A 2J05A 3I5SA 3KFVA 1PNJA 2DF6A 2M51A 2HDAA 1ABQA 5L23A 1AWJA 1MV0B 1UE9A 1OPLA 2KBTA 2RQTA 2P4RA 4RTYA 1GRIA 4Z89A 1FYNA 1VYTA 1W70A 4CC2A 4RTUA 1OV3A 1RUWA 2W10A 1YN8A 2DBKA 1NYFA 1K4US 1UDLA 4R0KA 2CH4A 1UTIA 2KT1A 4F16A 1NEBA 1WXBA 2HCKA 1KJWA 3VRZA 2RN8A 1NEGA 4E6RA 1M3AA 2YDLA 4IIOA 1EFNA 2DLPA 1ZLMA 2GBQA 2DNUA 3EHQA 4LUEA 3REBB 3NGPA 2JM8A 1TUDA 1PWTA 2VKNA 1B07A 2JS0A 1QWEA 1MV3A 1S1NA 1HD3A 2B86A 2DMOA 1UECA 1WDXA 4D8KA 2JW4A 2K7AA 5FWBA 1T3LA 1GFDA 1AD5A 3EG2A 2LJ1A 2DYBA 2A37A 4JZ4A 2C0TA 2O31A 2YT6A 4OMOA 1M3BA 2VWFA 2EKHA 1SHFA 1B3QA 1KSWA 4Z8AA 2LP5A 4F14A 3GBQA 3RBBB 3EHRA 2MOXA 1KFZA 2G6FX 3I5RA 2DRMA 3REAB 2DBMA 2BZYA 4JPBW 2L0AA 3VS4A 5IH2A 2M0YA 2D8HA 5EC7A 4D8DA 2KE9A 2CREA 2RNAA 1UG1A 3THKA 2K2MA 4X1VA 1ZUUA 2ESWA 1QCFA 2OI3A 5FWCA 4AG1C 2DA9A 4OMNA 2KRNA 2CSQA 2ABLA 2X3XD 1N5ZA 2L3QA 1U5SA 3PE0A 3UF4A 1QKWA 5GJVB 2CT4A 2J7IA 2EYZA 2HEQA 3UA7A 4QT7A 1UHCA 4RTTA 2LX7A 2YSQA 1ZX6A 3NHNA 3EG0A 2FPDA 1WYXA 1YWPA 3UATA 1NG2A 3SHWA 3H0FA 1T3SA 4DEYA 1GCQA 1TG0A 2D8JA 1M30A 2LCSA 1PHTA 2PZ1A 3VS1A 1RLPC 4RTXA 2DX1A 1H3HA 4LNPA 1GCQC 1WX6A 1Z9ZA 2I0NA 2BTTA 1KIKA 2V1QA 1YP5A 1JQQA 2KYMA 1M8MA 2DL4A 2ROTA 2CUDA 2EYWA 1LCKA 1UHFA 1VYVA 1I07A 3EG3A 2HSPA 3M0SA 3I9QA 2D0NA 1WFWA 3H41A 4A63B 2KYBA 1BU1A 1QLYA 5I22A 2CSIA 4OMLA 2EPDA 3TSWA 2BZ8A 2J06A 4AFZC 2HBWA 2LNHB 3O5ZA 4GBQA 2K3BA 2YUOA 1T0JA 4HVVA 2EYXA 3I35A 5IHKA 4RUGA 2RMOA 2MCNA 3R6NA 1YNZA 3VS7A 2CT3A 2VVKA 1CSKA 4CC3A 1YCSB 2JS2A 1PRMC 2KNBB 2EGAA 4CC4B 1SHGA 2D1XA 4HCKA 1Z9QA 3U23A 1SPKA 4J9IA 4JJDA 3A98A 1UJYA 2ENMA 1SRMA 2L3PA 1AWWA 2LQWA 1E7OA 2AK5A 2BZXA 2J6KA 1SSHA 1FMKA 2JMCA 2KRSA 1AZGB 5IXFA 3TSZA 1K0SA 2RQRA 1JU5C 2CUBA 2V1RA 1NLPC 1J3TA 1Y0MA 2KT8A 4CC7A 3JV3A 4J9BA 4OMMA 3VS5A 4J9FA 1ZSGA 3H0HA 3C0CA 1AVZC 4F17A 2DE0X 2C0IA 3H0IA 5HCKA 2RPNA 2AZVA 2DL5A 2W0ZA 2FO0A 2RQUA 1JXMA 1IO6A 2DVJA 2KROA 1GBRA 3RNJA 1H8KA 1I1JA 1X69A 2CH4W 4J9EA 4J9DA 4HVWA 1WA7A 1E6GA 2ED0A 2PNIA 2GTJA 1E6HA 1WI7A 2XMFA 1I0CA 2KGTA 2A28A 1VYUA 1JEGA 1SEMA 3NPFA 2RF0A 2LJ3A 3M0QA 2JXBA 1MUZA 3UA6A 1U06A 3M0UA 3EGUA 1K1ZA 4HXJA 1NLOC 4AFQC 4AFUC 2IIMA 1G2BA 3VS0A 2F2WA 2LJ0A 2ED1A 1JO8A 1AEYA 4RTZA 4J9CA 1X2KA 2A36A 2KXDA 2OAWA 1RLQC 2FPEA 1NM7A 3M0PA 1ZUKA 2DRKA 1Y57A 3LH5A 5IHNA 2EVRA 1W1FA 4LUDA 2KRMA 2FEIA 2DILA 2OJ2A 1OOTA 2AKKA 5IXBA 2A08A 1X6GA 2YUQA 4GLMA 4AG2C 2DM1A 2X3WD 1BBZA 1X6BA 2GTOA 2YUPA 1CKAA 1WXTA 4ZNXA 1AOJA 1QKXA 1GBQA 2EQIA 2GGRA 4HVUA 2O88A 3PVQA 2RQWA 1WXUA 1AWXA 2L2PA 1ZUYA 1PKSA 2L3SA 2O2OA 2JTEA 4KRTA 2CDTA 1G83A 1H92A 4Y92A 4EIKA 3EG1A 2NUZA 1XOVA 3FJ5A 1AZEA 3VS2A 3ULRB 1V1CA 4FSSA 4Z88A 4J9HA 1GFCA 2F2XA 4RTVA 1ARKA 2K79A 1UFFA 1A0NB 2JT4A 1UGVA 2J6OA 2KR3A 2FG0A 1T0HA 1ZBJA 2ROLA 2EGCA 4AFSC 1JXOA 2ECZA 2J6FA 3SEMA 1K9AA 5IHIA 1BB9A 1UJ0A 4RTWA 1SRLA 2FRYA 1PKTA 1HJDA 1PRLC 3ZL7C 4M4ZA 1TUCA 1CKBA 2H8HA 2AKLA 2O9VA 1WIEA 3VS3A 2PTKA 3NMZC 1OPKA 2EGEA 1K76A 4JZ3A 4JJBA 4JJCA 2FPFA 3VS6A 1RI9A 5FW9A 2LQNA 2F2VA 1M27C 3M0TA 2EYYA 2LMJA 2YUNA 1YWOA 2K6DA 1WLPB 1QWFA 2E5KA 1X27A 4J9GA 4IIMA 2DL3A 1NYGA 3CQTA 1M3CA 1OEBA 1K0XA 1U3OA 4ESRA 1GCPA 4OMPA 5GJWB 2K9GA 1X2QA 2KXCA 1W6XA 3IQLA 2FRWA 1VA7A 2KEAA 1ABOA 3QWYA 3QWXX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECA A;  2DJQ A;  3TVT A;  4OMQ A;  4WCI A;  2GNC A;  2GQI A;  2RQV A;  2SRC A;  4LN2 A;  2AZS A;  2O9S A;  2MIO A;  2DL8 A;  2JMA A;  3M0R A;  4ORZ A;  2EBP A;  2LZ6 B;  2QDL A;  2C0O A;  2NWM A;  1X43 A;  2JM9 A;  1UUE A;  2EW3 A;  2DL7 A;  1BK2 A;  2SEM A;  4K11 A;  4DEX A;  3PVL A;  3VRY A;  1HSQ A;  4LE9 A;  5I11 A;  1AWO A;  1GL5 A;  2J05 A;  3I5S A;  3KFV A;  1PNJ A;  2DF6 A;  2M51 A;  2HDA A;  1ABQ A;  5L23 A;  1AWJ A;  1MV0 B;  1UE9 A;  1OPL A;  2KBT A;  2RQT A;  2P4R A;  4RTY A;  1GRI A;  4Z89 A;  1FYN A;  1VYT A;  1W70 A;  4CC2 A;  4RTU A;  1OV3 A;  1RUW A;  2W10 A;  1YN8 A;  2DBK A;  1NYF A;  1K4U S;  1UDL A;  4R0K A;  2CH4 A;  1UTI A;  2KT1 A;  4F16 A;  1NEB A;  1WXB A;  2HCK A;  1KJW A;  3VRZ A;  2RN8 A;  1NEG A;  4E6R A;  1M3A A;  2YDL A;  4IIO A;  1EFN A;  2DLP A;  1ZLM A;  2GBQ A;  2DNU A;  3EHQ A;  4LUE A;  3REB B;  3NGP A;  2JM8 A;  1TUD A;  1PWT A;  2VKN A;  1B07 A;  2JS0 A;  1QWE A;  1MV3 A;  1S1N A;  1HD3 A;  2B86 A;  2DMO A;  1UEC A;  1WDX A;  4D8K A;  2JW4 A;  2K7A A;  5FWB A;  1T3L A;  1GFD A;  1AD5 A;  3EG2 A;  2LJ1 A;  2DYB A;  2A37 A;  4JZ4 A;  2C0T A;  2O31 A;  2YT6 A;  4OMO A;  1M3B A;  2VWF A;  2EKH A;  1SHF A;  1B3Q A;  1KSW A;  4Z8A A;  2LP5 A;  4F14 A;  3GBQ A;  3RBB B;  3EHR A;  2MOX A;  1KFZ A;  2G6F X;  3I5R A;  2DRM A;  3REA B;  2DBM A;  2BZY A;  4JPB W;  2L0A A;  3VS4 A;  5IH2 A;  2M0Y A;  2D8H A;  5EC7 A;  4D8D A;  2KE9 A;  2CRE A;  2RNA A;  1UG1 A;  3THK A;  2K2M A;  4X1V A;  1ZUU A;  2ESW A;  1QCF A;  2OI3 A;  5FWC A;  4AG1 C;  2DA9 A;  4OMN A;  2KRN A;  2CSQ A;  2ABL A;  2X3X D;  1N5Z A;  2L3Q A;  1U5S A;  3PE0 A;  3UF4 A;  1QKW A;  5GJV B;  2CT4 A;  2J7I A;  2EYZ A;  2HEQ A;  3UA7 A;  4QT7 A;  1UHC A;  4RTT A;  2LX7 A;  2YSQ A;  1ZX6 A;  3NHN A;  3EG0 A;  2FPD A;  1WYX A;  1YWP A;  3UAT A;  1NG2 A;  3SHW A;  3H0F A;  1T3S A;  4DEY A;  1GCQ A;  1TG0 A;  2D8J A;  1M30 A;  2LCS A;  1PHT A;  2PZ1 A;  3VS1 A;  1RLP C;  4RTX A;  2DX1 A;  1H3H A;  4LNP A;  1GCQ C;  1WX6 A;  1Z9Z A;  2I0N A;  2BTT A;  1KIK A;  2V1Q A;  1YP5 A;  1JQQ A;  2KYM A;  1M8M A;  2DL4 A;  2ROT A;  2CUD A;  2EYW A;  1LCK A;  1UHF A;  1VYV A;  1I07 A;  3EG3 A;  2HSP A;  3M0S A;  3I9Q A;  2D0N A;  1WFW A;  3H41 A;  4A63 B;  2KYB A;  1BU1 A;  1QLY A;  5I22 A;  2CSI A;  4OML A;  2EPD A;  3TSW A;  2BZ8 A;  2J06 A;  4AFZ C;  2HBW A;  2LNH B;  3O5Z A;  4GBQ A;  2K3B A;  2YUO A;  1T0J A;  4HVV A;  2EYX A;  3I35 A;  5IHK A;  4RUG A;  2RMO A;  2MCN A;  3R6N A;  1YNZ A;  3VS7 A;  2CT3 A;  2VVK A;  1CSK A;  4CC3 A;  1YCS B;  2JS2 A;  1PRM C;  2KNB B;  2EGA A;  4CC4 B;  1SHG A;  2D1X A;  4HCK A;  1Z9Q A;  3U23 A;  1SPK A;  4J9I A;  4JJD A;  3A98 A;  1UJY A;  2ENM A;  1SRM A;  2L3P A;  1AWW A;  2LQW A;  1E7O A;  2AK5 A;  2BZX A;  2J6K A;  1SSH A;  1FMK A;  2JMC A;  2KRS A;  1AZG B;  5IXF A;  3TSZ A;  1K0S A;  2RQR A;  1JU5 C;  2CUB A;  2V1R A;  1NLP C;  1J3T A;  1Y0M A;  2KT8 A;  4CC7 A;  3JV3 A;  4J9B A;  4OMM A;  3VS5 A;  4J9F A;  1ZSG A;  3H0H A;  3C0C A;  1AVZ C;  4F17 A;  2DE0 X;  2C0I A;  3H0I A;  5HCK A;  2RPN A;  2AZV A;  2DL5 A;  2W0Z A;  2FO0 A;  2RQU A;  1JXM A;  1IO6 A;  2DVJ A;  2KRO A;  1GBR A;  3RNJ A;  1H8K A;  1I1J A;  1X69 A;  2CH4 W;  4J9E A;  4J9D A;  4HVW A;  1WA7 A;  1E6G A;  2ED0 A;  2PNI A;  2GTJ A;  1E6H A;  1WI7 A;  2XMF A;  1I0C A;  2KGT A;  2A28 A;  1VYU A;  1JEG A;  1SEM A;  3NPF A;  2RF0 A;  2LJ3 A;  3M0Q A;  2JXB A;  1MUZ A;  3UA6 A;  1U06 A;  3M0U A;  3EGU A;  1K1Z A;  4HXJ A;  1NLO C;  4AFQ C;  4AFU C;  2IIM A;  1G2B A;  3VS0 A;  2F2W A;  2LJ0 A;  2ED1 A;  1JO8 A;  1AEY A;  4RTZ A;  4J9C A;  1X2K A;  2A36 A;  2KXD A;  2OAW A;  1RLQ C;  2FPE A;  1NM7 A;  3M0P A;  1ZUK A;  2DRK A;  1Y57 A;  3LH5 A;  5IHN A;  2EVR A;  1W1F A;  4LUD A;  2KRM A;  2FEI A;  2DIL A;  2OJ2 A;  1OOT A;  2AKK A;  5IXB A;  2A08 A;  1X6G A;  2YUQ A;  4GLM A;  4AG2 C;  2DM1 A;  2X3W D;  1BBZ A;  1X6B A;  2GTO A;  2YUP A;  1CKA A;  1WXT A;  4ZNX A;  1AOJ A;  1QKX A;  1GBQ A;  2EQI A;  2GGR A;  4HVU A;  2O88 A;  3PVQ A;  2RQW A;  1WXU A;  1AWX A;  2L2P A;  1ZUY A;  1PKS A;  2L3S A;  2O2O A;  2JTE A;  4KRT A;  2CDT A;  1G83 A;  1H92 A;  4Y92 A;  4EIK A;  3EG1 A;  2NUZ A;  1XOV A;  3FJ5 A;  1AZE A;  3VS2 A;  3ULR B;  1V1C A;  4FSS A;  4Z88 A;  4J9H A;  1GFC A;  2F2X A;  4RTV A;  1ARK A;  2K79 A;  1UFF A;  1A0N B;  2JT4 A;  1UGV A;  2J6O A;  2KR3 A;  2FG0 A;  1T0H A;  1ZBJ A;  2ROL A;  2EGC A;  4AFS C;  1JXO A;  2ECZ A;  2J6F A;  3SEM A;  1K9A A;  5IHI A;  1BB9 A;  1UJ0 A;  4RTW A;  1SRL A;  2FRY A;  1PKT A;  1HJD A;  1PRL C;  3ZL7 C;  4M4Z A;  1TUC A;  1CKB A;  2H8H A;  2AKL A;  2O9V A;  1WIE A;  3VS3 A;  2PTK A;  3NMZ C;  1OPK A;  2EGE A;  1K76 A;  4JZ3 A;  4JJB A;  4JJC A;  2FPF A;  3VS6 A;  1RI9 A;  5FW9 A;  2LQN A;  2F2V A;  1M27 C;  3M0T A;  2EYY A;  2LMJ A;  2YUN A;  1YWO A;  2K6D A;  1WLP B;  1QWF A;  2E5K A;  1X27 A;  4J9G A;  4IIM A;  2DL3 A;  1NYG A;  3CQT A;  1M3C A;  1OEB A;  1K0X A;  1U3O A;  4ESR A;  1GCP A;  4OMP A;  5GJW B;  2K9G A;  1X2Q A;  2KXC A;  1W6X A;  3IQL A;  2FRW A;  1VA7 A;  2KEA A;  1ABO A;  3QWY A;  3QWX X; 
#chains in the Genus database with same CATH topology
 2HNI A;  2RHU A;  1QVF P;  4WCI A;  2GNC A;  1YHQ A;  4FT4 A;  2DL8 A;  3JB9 D;  1HYO A;  2E65 A;  4DBF A;  3CCJ A;  2CZ1 B;  3KBG A;  2RI2 A;  2NWM A;  1X43 A;  4Y91 A;  3CCL A;  2DL7 A;  1XQH A;  4MZM A;  5KYX B;  3CBP A;  1HSQ A;  5KH6 A;  4LE9 A;  4J7I A;  3OQ5 A;  4FYY B;  1AWJ A;  1KC8 R;  3L2Q A;  1JB0 E;  5I2M A;  1K73 C;  2P4R A;  1GRI A;  5CKB A;  1VQ5 A;  4Z89 A;  1V29 B;  2YRC A;  4CC2 A;  1OV3 A;  3GOX A;  4R0K A;  2RHY A;  4CRI A;  3H9N A;  1UTI A;  4JRQ A;  4F16 A;  2VB6 A;  1KJW A;  3I55 A;  1IGU A;  4LDX A;  1M3A A;  2YDL A;  4IIO A;  1VQ6 T;  1VQ4 A;  1ZLM A;  3EHQ A;  2XDB A;  3REB B;  2JM8 A;  2DYI A;  1PWT A;  2VKN A;  3QBY A;  2DVE A;  4F7U A;  1B07 A;  4ANJ A;  1Q7Y C;  1G8X A;  1NBE B;  1M9S A;  5GMK h;  2PUK B;  4J6Y A;  2JW4 A;  2K7A A;  4NL2 A;  1TS9 A;  2MF2 A;  1KC8 U;  3LW5 E;  2HZY A;  4HCB A;  1C1A A;  2JJ9 A;  5D7U A;  3QSU A;  3JCM g;  2COZ A;  2HBP A;  3C94 A;  1B34 A;  2LP5 A;  4A4K A;  3QHS A;  3RBB B;  3VJP A;  4J83 A;  2MOX A;  3OY9 A;  4JRP A;  4MZP A;  2L5Q A;  2DRM A;  3REA B;  2QQB A;  3JCM c;  4M78 C;  5GMK e;  2BZY A;  4JPB W;  3JB9 H;  1BCO A;  5IH2 A;  5J39 A;  3G1J A;  2MMP A;  3SDZ A;  2CRE A;  1IB8 A;  2WSE E;  7AT1 B;  3BFM A;  1U8R A;  1QCF A;  2OI3 A;  3HHT B;  3CBO A;  1VOM A;  2DA9 A;  2P0K A;  3M4Y A;  1FX7 A;  2X3X D;  1VQ7 Q;  5CKH A;  3X28 B;  2CT4 A;  2GF7 A;  4ZGD B;  3CME T;  4NOY A;  1H3Z A;  4BD3 A;  5AYF A;  4C0G A;  2VUB A;  1UEB A;  1VQ9 Q;  1YWP A;  4M7A D;  5LJ3 g;  2C06 A;  3HSB A;  2EAY A;  2B8A A;  5GAN 4;  1TG0 A;  1TWB A;  4IUV A;  3UWN A;  3VV0 A;  3L2R A;  3CC2 A;  4RTX A;  3CD6 Q;  4M7A F;  1H3H A;  3CCM Q;  3TU4 K;  4JS5 A;  1PC0 A;  2PVG B;  1Q86 C;  5GAN 8;  2BTT A;  4B6M A;  3EH1 A;  1KIK A;  4MMK A;  2KQW A;  3OYM A;  4FIB A;  2GCX A;  2HMA A;  4EMK A;  3N5B B;  1QQJ A;  1M8M A;  4C8Q G;  5CCA A;  1LCK A;  5GAN j;  1N8R U;  1I07 A;  3EG3 A;  3EG9 B;  2HSP A;  3A8L B;  3M0S A;  3I9Q A;  8ATC B;  2KYB A;  3CCJ T;  5KYU B;  2EFI A;  2CSI A;  3QYG B;  1B7T A;  2QQA A;  3URG A;  4OGC A;  3TSW A;  1VQL A;  1ZA2 B;  5LJ3 j;  2LNH B;  3O5Z A;  1LNX A;  2F1L A;  2EYX A;  3I35 A;  3OYY A;  5LL6 S;  4RUG A;  1VQL Q;  3LGF A;  4JLI A;  5GAO l;  2XG8 D;  4TVR A;  1YCS B;  3LYI A;  2KNB B;  4CC4 B;  1IGQ A;  2K5L A;  2IG0 A;  4HT8 A;  2D1X A;  4HCK A;  1VQM A;  1X75 C;  1SPK A;  1UJY A;  1DJ7 B;  1Q82 U;  2CP7 A;  4C5E A;  1JJ2 P;  2LQW A;  1YIT Q;  2AK5 A;  2BZX A;  4LDY A;  5J26 A;  4MDX A;  2V8I A;  1SSH A;  2CS7 A;  4V2S A;  3CCL Q;  3QG1 A;  3G71 A;  5GAO p;  2LC4 A;  5GMK j;  3OS1 A;  3JV3 A;  1M2V A;  3VS5 A;  5L8R E;  5J3B A;  4C8Q E;  3C0C A;  3OS5 A;  2OX7 A;  1AVZ C;  4F17 A;  3QYH B;  5GMK i;  4N0A A;  3V7S A;  4LD9 K;  2RQU A;  1JXM A;  2DVJ A;  1UGR B;  1GBR A;  2M16 A;  4D6W A;  1IXD A;  1H8K A;  1X69 A;  4X34 A;  4J9D A;  1Q82 R;  3OMG A;  3DB4 A;  1E6G A;  1WNL A;  2DD4 A;  1E6H A;  4PFP A;  4XU3 A;  2O4X B;  3NTK A;  3OSV A;  1VUB A;  1ZHI A;  3CC7 Q;  3LWI A;  1SEM A;  4J7F A;  4J5Y A;  1M2V B;  4N4H A;  3L42 A;  2QEX Q;  4M7D E;  1K1Z A;  4QVC A;  1QCN A;  3SFM A;  1VQP A;  5GAN 5;  3KUF A;  3OW2 S;  5A0L A;  4F7U F;  2ED1 A;  4M77 B;  5GAM h;  4J9C A;  1X2K A;  2P0P A;  2VYT A;  4PJJ A;  2LTO A;  5CQX A;  4FM4 B;  2IPO B;  1M5Q 1;  3NTH A;  4F7U G;  3S6W A;  3A8G B;  3LH5 A;  1W1F A;  4FU6 A;  4E2F B;  4LUD A;  1XTD A;  2OJ2 A;  2K4Y A;  1OOT A;  2AKK A;  3CXC P;  2A08 A;  4FSX A;  2AHJ B;  2X3W D;  1BBZ A;  1WJQ A;  1AOJ A;  1QKX A;  2EQI A;  1K9M U;  2ZPH B;  3SWN A;  2O88 A;  3PVQ A;  2A3L A;  1IRE B;  5CAI A;  1NJI R;  5KYY A;  1PKS A;  4M75 B;  3M53 A;  2CDT A;  3H6Z A;  2QK0 A;  3EG1 A;  4ZN3 A;  3V8J A;  3FJ5 A;  1AZE A;  5LJ5 j;  1M1K U;  4KGV B;  3OBY A;  1GFC A;  2F2X A;  4RTV A;  5GAM d;  2JT4 A;  5FU7 B;  3CCE A;  4E7H A;  2KR3 A;  2YWW A;  3RR6 A;  4JLG A;  1R0B G;  3JCM b;  2J6F A;  2Y4Y A;  1BB9 A;  3ZEH A;  3MKD A;  3ZL7 C;  3J7A F;  3G71 Q;  1TUC A;  5A0G A;  1N9S A;  1W4S A;  1YJ9 T;  3QZ5 B;  2O9V A;  2FZC B;  2Z0W A;  1MMG A;  3CCQ Q;  2PTK A;  1VQ9 A;  1YIT A;  4JZ3 A;  4JRK A;  1PSF A;  1Q95 G;  4PLI A;  3RUX A;  5GAO r;  3V8K A;  5CQY A;  1QP2 A;  4E7K A;  1K8A C;  1M27 C;  4II1 A;  5LJ5 g;  5GAM g;  1FMW A;  2LMJ A;  3PIP A;  3MEA A;  1RAC B;  3QII A;  1Y07 A;  2K6D A;  2I2L A;  2OTJ A;  1WLP B;  1NZ9 A;  4PJO D;  1QWF A;  2E5K A;  2AIR B;  2DL3 A;  1NYG A;  1WHH A;  3RMS A;  1IHW A;  2QAS A;  4BI3 A;  3OS0 A;  1U3O A;  3CC4 T;  4OP0 A;  5GAM e;  1RAH B;  3GIB A;  4QVZ A;  2G3R A;  2QYZ A;  4M7D C;  3TVT A;  4OMQ A;  2GQI A;  2RQV A;  2K2V A;  4PL6 A;  1RL2 A;  1OYX A;  2JVV A;  4ORZ A;  2LZ6 B;  1R0C B;  2EW3 A;  1BK2 A;  1F1B B;  3HL8 A;  3VRY A;  5I11 A;  3OYH A;  5GAM j;  2DF6 A;  5GMK m;  4OB2 B;  1ABQ A;  4RG8 A;  1K73 R;  5LJ5 h;  2QGG A;  1QVG S;  3HRT A;  1VQO T;  3CD6 T;  2GFU A;  1OPL A;  1VIE A;  1YJW A;  1MNE A;  2NUP B;  1W70 A;  5HY6 A;  3OYA A;  4WF2 A;  3FDR A;  2E70 A;  3G6E A;  3A1P A;  2W10 A;  2ZZD A;  2OTL A;  1NYF A;  2ATC B;  1UDL A;  3OW2 A;  1K4U S;  1ZQ1 A;  4DQ2 A;  1PD1 A;  1JBM A;  3GPL A;  2RN8 A;  4IUU A;  2MI6 A;  2L8D A;  5CIU A;  3CME Q;  2XDP A;  2WSF E;  3KXT A;  4MML A;  1EFN A;  3OYB A;  4XTX A;  2DET A;  3EGX A;  3MEV A;  4KUL A;  2PUO B;  3M5A A;  2EYQ A;  1VQ5 Q;  2JS0 A;  2LT4 A;  4ELZ C;  1QWE A;  3CCE T;  1BI3 A;  1HD3 A;  2DMO A;  2FVU A;  3CPW S;  2K5F A;  3CMA Q;  3CCV Q;  2DXB A;  1WHJ A;  5FWB A;  3UDC A;  5KYX A;  1AD5 A;  2VAS A;  4EMK B;  3P8D A;  2LJ1 A;  3FJP A;  2LRQ A;  2DYB A;  2A37 A;  1QVF S;  4FL6 A;  3O8V A;  4JZ4 A;  2O31 A;  4OMO A;  4BDZ A;  2VWF A;  2KY9 A;  2FZG B;  4XTU A;  3OB9 A;  3HFO A;  3PMT A;  4F14 A;  3CEY A;  2DAQ A;  4E47 A;  1TXQ A;  1KQS A;  1OQK A;  2DIQ A;  3I5R A;  3MPU B;  1VQO A;  3OYI A;  3I56 A;  3M56 A;  2L0A A;  3CC7 A;  3VS4 A;  2M0Y A;  5EC7 A;  2DZC A;  4D8D A;  3EH2 A;  4C8Q D;  5FU6 C;  5HK3 A;  3MO8 A;  3THK A;  2K2M A;  1ZUU A;  1JJ2 A;  5FWC A;  3HRU A;  3PNW C;  4OMN A;  2KRN A;  2CSQ A;  4KH0 B;  2X35 A;  1LJO A;  2L3Q A;  3UF4 A;  4M78 B;  2WAC A;  2D6F A;  2EYZ A;  2RK1 A;  5FRN A;  3UA7 A;  4OGE A;  3QKJ A;  4RTT A;  3E19 A;  3I56 Q;  3OYF A;  4BY6 B;  3NHN A;  1M1F A;  3EG0 A;  4EMK C;  1WYX A;  1K9M R;  3UAT A;  2DKG A;  4N4I A;  2R5M A;  4DEY A;  1GCQ A;  1M30 A;  2E41 A;  1WGS A;  2JTF A;  5FU6 B;  2E6Z A;  3CBM A;  3X20 B;  1WX6 A;  4HCC A;  4M75 D;  3CCM T;  4RG2 A;  1YHQ T;  1JQQ A;  2KYM A;  4OVA A;  2DL4 A;  1D0X A;  3VYG A;  2ROT A;  4PFO A;  3QDR B;  1FWZ A;  4BAC A;  1WHM A;  1UHF A;  4A4F A;  2M9U A;  4A63 B;  4F7U B;  1QLY A;  5I22 A;  3DLL A;  3FB9 A;  4XTY A;  3CME A;  2EPD A;  2XKO C;  2RM4 A;  3FRN A;  3SD4 A;  2IVW A;  4GBQ A;  4BB7 A;  2K3B A;  2YUO A;  2DK3 A;  4OF1 A;  2L89 A;  5GAO m;  1YNZ A;  2XIC A;  1QMC A;  3VS7 A;  3RER A;  3A8M B;  1CSK A;  2EIF A;  4CC3 A;  4IKF A;  2MPX C;  1TH7 A;  1IHV A;  1WQ7 A;  2EGA A;  2LQ8 A;  3CCQ A;  3TEE A;  2HSE B;  1SHG A;  4M78 G;  3U23 A;  3GNG A;  3A98 A;  3CC2 Q;  2L3P A;  1Y7X A;  1E7O A;  1KQ2 A;  1FMK A;  4DOV A;  3JB9 J;  4XTV A;  4X9D A;  2RK2 A;  1KC8 C;  3QPH A;  3HFN A;  2LT1 A;  3CMA A;  3CCV A;  2XU8 A;  3VUZ A;  4J9B A;  4J9F A;  1SSF A;  1M8V A;  3H0H A;  2R57 A;  3EFO B;  2X51 A;  2DE0 X;  5HCK A;  1SF9 A;  3PIO A;  2AZV A;  2E10 A;  3MEW A;  2GQV A;  2W0Z A;  2FO0 A;  1IO6 A;  3MP8 A;  3RNJ A;  1D0Y A;  2RA2 A;  1N8R C;  3M54 A;  1WA7 A;  3EFS A;  1MHN A;  2H3J A;  4WTO B;  5FRM A;  1WI7 A;  3L2V A;  3OMC A;  1UGQ B;  1NE8 A;  2XMF A;  2BE9 B;  3MHX A;  3JCM h;  3CC2 T;  2OTL Q;  4AT1 B;  1MMA A;  4PJO C;  2F5T X;  2O01 E;  1U06 A;  1WQW A;  3EGU A;  4HXJ A;  4AFQ C;  1D1B A;  3QJY A;  4E7L A;  3VS0 A;  2RI5 A;  3X26 B;  1YJ9 Q;  3EGD A;  1AEY A;  3C4S A;  3CCS Q;  3CCS T;  4RTZ A;  3CCM A;  2A36 A;  2KXD A;  2OAW A;  1WHK A;  4C8Q C;  1NJI U;  1ZUK A;  3M9Q A;  4ZGE B;  3ER0 A;  1Y71 A;  1XNI A;  1Y57 A;  2JN0 A;  2JUF A;  3MJX A;  5IHN A;  2FEI A;  1SKU B;  2PU9 B;  3OW2 P;  5IXB A;  3SB2 A;  1ACM B;  2YUQ A;  4IUQ A;  1VQ4 Q;  4AG2 C;  2KAF A;  4F04 B;  4NS5 A;  4P5N A;  2DM1 A;  3CCU Q;  2LNV A;  1Q7Y R;  1WXT A;  2GGR A;  2F5K A;  4M75 E;  2RQW A;  3JCM P;  1WXU A;  3OYK A;  1K8A R;  2LX9 A;  2RJC A;  4M77 C;  4QQG A;  3ASK A;  4KT0 E;  2ZPB B;  3R6O A;  4PLL A;  4M7A C;  4M7D D;  5LJ5 f;  2JTE A;  1H92 A;  1RAD B;  3JRZ A;  5D6X A;  1X01 A;  1ZSZ C;  1BCM A;  4FSS A;  4Z88 A;  4J9H A;  5LJ5 e;  1ARK A;  1UFF A;  1RI0 A;  1UGV A;  4M7A A;  3M59 A;  1T0H A;  5IAY A;  5IT9 E;  1VQL T;  2DER A;  5IHI A;  4C8Q B;  4BE1 A;  2MK5 A;  4RTW A;  1PKT A;  1HJD A;  1PRL C;  4C8Q A;  3LGL A;  2R5A A;  1V76 A;  4HKE A;  4BI4 A;  1YI2 T;  5GAN 6;  2CZ0 B;  3NMZ C;  4M78 D;  2JTM A;  4C92 C;  3HPW A;  1K76 A;  2XID A;  2VV5 A;  4JJB A;  2RO0 A;  3HTR A;  4RMO A;  4A4E A;  1RI9 A;  3P8H A;  4PJO B;  1ZSZ B;  4C92 A;  5GAN e;  1PM3 A;  4M78 F;  4JUV A;  2YUN A;  1BI2 A;  2CP6 A;  2A0F B;  2DEU A;  3ZBD A;  3I55 Q;  3BY7 A;  4IIM A;  2RJD A;  1M3C A;  4XU2 A;  1M4Z A;  5KCO A;  3QUI A;  4ESR A;  2QEX T;  5GJW B;  2K9G A;  1M2O A;  1X2Q A;  1W6X A;  2KXC A;  1S72 A;  3VYH B;  4F7U E;  1VA7 A;  1ABO A;  3RES A;  2DJQ A;  2QQS A;  2SRC A;  3M4G A;  4L6V 5;  4LN2 A;  4DA4 A;  1VQO Q;  2AZS A;  2EJ9 A;  3GNF B;  2DTI A;  2MIO A;  2JMA A;  4E7J A;  1I8F A;  3CD6 A;  2X4X A;  3L2Z A;  2EBP A;  2P84 A;  3JCM d;  3RKX A;  3JSC A;  2SEM A;  4K11 A;  3PVL A;  1I4K 1;  4YTL A;  1VQM T;  1AWO A;  3C95 A;  3I5S A;  3KFV A;  1PNJ A;  3BDL A;  4O6J A;  4N0A C;  4CI0 C;  2GFA A;  2HDA A;  1VQP Q;  1KQS P;  5L23 A;  1PCX A;  1UE9 A;  4PJO F;  2DTO A;  2KBT A;  1YHQ Q;  4RTY A;  1W2B P;  1Q81 R;  2X4Y A;  1VQ7 A;  4FW1 A;  4ZTF A;  1RUW A;  1YN8 A;  2CH4 A;  1Q81 U;  3G4S A;  2QI2 A;  2BE7 D;  2M1H A;  2HCK A;  4BI8 B;  3VRZ A;  4J8O A;  5GAN h;  4J6X A;  2OAU A;  3CCU A;  2DLP A;  2GBQ A;  2QA4 Q;  2DNU A;  5EG2 A;  1VQN T;  3CXC S;  1YJW Q;  2QQR A;  1S1N A;  1VQ8 Q;  5KCH A;  3CC4 Q;  3J81 E;  4XTZ A;  4PJO A;  1WDX A;  5CO7 A;  5CKF A;  4B9X A;  3T9N A;  2V8K A;  3DLM A;  2JNG A;  2XHC A;  4M7D G;  3EG2 A;  5DM7 R;  1YJ9 A;  5LJ3 e;  2WSC E;  1M3B A;  2EWN A;  2RH2 A;  1SHF A;  3PMI A;  4C0F A;  2VC8 A;  1EZZ B;  4Z8A A;  1WJS A;  1I81 A;  2EQJ A;  1KFZ A;  5KYW B;  2COY A;  3PGG A;  2DZ9 A;  2DBM A;  2QTV A;  1X6O A;  2CP5 A;  1D09 B;  2D8H A;  2CYZ B;  3FEO A;  2QEX A;  2QXF A;  4A4H A;  2KE9 A;  4FT2 A;  1OU8 A;  1UG1 A;  3MCA B;  2CZ6 B;  2ESW A;  4QKU A;  3VUB A;  1TTH B;  2HKQ B;  2ABL A;  3TCJ A;  5M9O A;  1N5Z A;  2EQM A;  1U5S A;  1Y96 A;  4HT9 A;  3PE0 A;  5GJV B;  2J7I A;  1R77 A;  2RI3 A;  4O5V A;  2ZPI B;  1OI1 A;  1IRX A;  2LX7 A;  3OA6 A;  1YIJ A;  1ZX6 A;  2FPD A;  4EMH A;  3Q1J A;  2LCL A;  1NG2 A;  1SG5 A;  3L1A A;  3H0F A;  1YI2 A;  3MET A;  5IN1 A;  1OZ2 A;  2LCC A;  1QVG P;  3JCM f;  1M90 R;  1PHT A;  3CCV T;  3CMA T;  2QQ9 A;  2PZ1 A;  3VS1 A;  1RLP C;  5GMK l;  1PSE A;  2DX1 A;  4LNP A;  2HAX A;  1Z9Z A;  4C8Q F;  2KDS A;  2KK4 A;  4DBR A;  2V1Q A;  3BW1 A;  1BIB A;  3CC4 A;  3LWH A;  3RKW A;  1WHL A;  3WXM B;  2RHZ A;  3CPF A;  2KI7 A;  1NPP A;  4M78 E;  1KQS S;  3H41 A;  2CP0 A;  1IZ6 A;  1U1S A;  3JCM V;  2M02 A;  4M75 C;  1N27 A;  2QAZ A;  3V8L A;  1QW1 A;  2HBW A;  3GLX A;  1YJW T;  1T0J A;  5IHK A;  4ZN1 A;  1PG5 B;  2CT3 A;  4A4G A;  1WPY A;  2QG9 B;  4OB0 B;  2JS2 A;  1PRM C;  4OB3 B;  2RHX A;  2EJF A;  3C12 A;  1ZBX A;  3RMQ A;  2ZPG B;  1SRM A;  2RJE A;  4GY5 A;  3EFO A;  1RAA B;  2X9H A;  5I21 A;  2ZPF B;  2JMC A;  3CPW A;  2KRS A;  5IXF A;  3TSZ A;  2EJG A;  4LD6 A;  2RQR A;  1VQK T;  2DTH A;  1N9R A;  2V1R A;  1NLP C;  1RAB B;  3EFR A;  4M75 G;  3OYG A;  1Y0M A;  3CCJ Q;  1YJN Q;  3S3M A;  4OMM A;  3TQ7 P;  1ZSG A;  3M57 A;  4BE2 A;  1PD0 A;  5GAN d;  3TRE A;  2E6N A;  2C0I A;  3H0I A;  4M75 F;  3CCQ T;  1Q86 U;  2RPN A;  1FMV A;  2DL5 A;  5DLQ E;  4ELY C;  1D3B B;  1M90 C;  2QA4 A;  2K5I A;  1RAG B;  2CH4 W;  4J9E A;  1MMN A;  4L5G A;  3FIF A;  4XU0 A;  3A8O B;  2GTJ A;  4OB1 B;  1D3B A;  1I0C A;  2QA4 T;  2DD5 A;  1VYU A;  3PTA A;  1OU9 A;  2AT1 B;  4XTW A;  3NPF A;  2RF0 A;  3M0Q A;  2RD1 A;  2JXB A;  3JCM W;  3UA6 A;  1KQ1 A;  3M0U A;  1KK7 A;  3BE3 A;  4KGZ B;  5DY9 A;  3D7S B;  4AFU C;  2IIM A;  1M90 U;  5GAN 7;  3A8H B;  2F2W A;  3JCM Q;  2LJ0 A;  1QVP A;  5AT1 B;  1JO8 A;  4Z02 A;  3X25 B;  2FPE A;  4C92 D;  1NM7 A;  1KHC A;  4XK8 E;  5A0D A;  2M0O A;  2DRK A;  4R55 A;  4JJN K;  4LXC A;  1QVG A;  4HCZ A;  2EKO A;  2EVR A;  4LDV A;  3JAM E;  1VQM Q;  2D9T A;  2KRM A;  4M77 E;  2V26 A;  3GP8 A;  1K73 U;  4IUR A;  2K57 A;  1OUL A;  1M1K C;  1S72 Q;  2BIV A;  3DB3 A;  2FZK B;  4M7D B;  2GTO A;  1CKA A;  4ZNX A;  1GBQ A;  1OX8 A;  5GAO q;  4HVU A;  1AHJ B;  4M78 A;  3UT1 A;  1JRI A;  3JCM e;  3G6E Q;  1ZUY A;  1RAE B;  2L3S A;  2O2O A;  3SWN C;  5CR2 A;  1NJI C;  4KRT A;  1G83 A;  2RHI A;  4EIK A;  4PJM A;  4FW2 A;  2P4T A;  3G4S Q;  2DXT A;  2YLB A;  3ULR B;  4M77 D;  5C6S A;  1WJR A;  4BE0 A;  3NFC A;  1KHI A;  2K79 A;  2DXU A;  4J6W A;  4M7D A;  1R8O B;  3CC7 T;  2J6O A;  2FG0 A;  1ZBJ A;  4ATO A;  4EMG A;  2EGC A;  4AFS C;  1JXO A;  1VQK A;  3SEM A;  3OYN A;  1UJ0 A;  1SRL A;  1YJN A;  5I2S A;  1CKB A;  3CXC A;  1YI2 Q;  1FXX A;  4UC4 A;  1WIE A;  4B9W A;  5HK0 A;  3VS3 A;  4XQ3 A;  2FB7 A;  3JB9 F;  1OPK A;  5CKD A;  2EGE A;  3E9F A;  3ZFJ A;  2A7Y A;  5KYN A;  4JJC A;  1Y96 B;  5D6W A;  2FPF A;  3VS6 A;  3HRS A;  4M7D F;  2LQN A;  2E12 A;  3M0T A;  4PKC C;  4BDY A;  2EYY A;  3AHU A;  2HL3 A;  3CCU T;  3SWN B;  1VQ4 T;  1VQN Q;  3EGX B;  3NTI A;  4MZT A;  4DBQ A;  4EPC A;  5GAO n;  1TOV A;  3L2W A;  2DFU A;  4VUB A;  1UGS B;  4J9G A;  4DOW A;  3CQT A;  3S3N A;  1K0X A;  3G6E T;  3A5Z B;  2KSS A;  5LJ3 f;  1BI1 A;  5CKE A;  1UGP B;  3DKM A;  5KYW A;  1LVK A;  3OS2 A;  3QWX X;  5KE3 A;  5ECA A;  3G71 T;  4L59 A;  2O9S A;  1N8R R;  2NUP A;  4OMF B;  2EQK A;  3M0R A;  3VU3 C;  2E3I A;  2QDL A;  2C0O A;  2JM9 A;  4LDU A;  1UUE A;  4DEX A;  1HXD A;  2D0Q B;  3E2U A;  5FU7 C;  4X9C A;  1GL5 A;  2J05 A;  1NPR A;  3CCE Q;  2M51 A;  4ME7 A;  1OZ3 A;  1VQ8 A;  2PVO B;  1MV0 B;  3FLG A;  1O75 A;  4FCY A;  2RQT A;  1FYN A;  3INZ A;  1VYT A;  4DBH A;  2O4X A;  4RTU A;  1YIJ Q;  4C92 G;  2DBK A;  2KT1 A;  1NEB A;  1WXB A;  1K8A U;  1BYM A;  2VGM A;  4C0D C;  1NEG A;  4E6R A;  3JB9 I;  2FYK A;  1Q7Y U;  1QP3 A;  3VKI A;  1HK9 A;  2OTL T;  4FYX B;  4LUE A;  4FYW B;  2XI9 A;  4PFZ A;  3NGP A;  3UPU A;  1TUD A;  1H64 1;  2X4W A;  4QVD A;  3S3O A;  1G3W A;  3X24 B;  2CP3 A;  2MAM A;  1MV3 A;  2B86 A;  2QDY B;  2PQW A;  1UEC A;  4PJN A;  2FHD A;  4D8K A;  4XU1 A;  1T3L A;  1GFD A;  3OYE A;  3FC3 A;  1G5V A;  4JS4 A;  1Q82 C;  5GAN f;  1LPL A;  2C0T A;  2YT6 A;  2Y4X A;  1P92 A;  3QZ9 B;  2EKH A;  3I56 T;  4RKU E;  1B3Q A;  3EAE A;  1KSW A;  2HQX A;  3CCR Q;  3GBQ A;  1ZA1 B;  2FL7 A;  3EHR A;  1VQK Q;  3RKY A;  3HKS A;  4AMC A;  2G6F X;  1VQ8 T;  1VQ6 A;  1S72 T;  5GAN 3;  1WZO A;  3OYJ A;  4Q5W A;  3RDV A;  4E7Z A;  2QTX A;  2E64 A;  4C5G A;  2VGN A;  3CPW P;  2RNA A;  3AT1 B;  3PFS A;  4X1V A;  5FLX E;  4AG1 C;  4KBM B;  4M75 A;  1M1G A;  3EG9 A;  4A54 A;  3LH0 A;  3V7C A;  3RIR A;  2K3X A;  5GAM f;  5KYY B;  1QKW A;  2HEQ A;  4LDW A;  2P0Q A;  1W2B A;  4QT7 A;  4KUD K;  1UHC A;  2KVQ G;  1QCO A;  2YSQ A;  2CGH A;  1VQ6 Q;  4ZTJ A;  4JDS A;  3M55 A;  3P8B B;  1YIT T;  1KD1 U;  5HKC A;  2R58 A;  1VIF A;  3SHW A;  5A2Q E;  4PJO G;  2LVM A;  1T3S A;  2D8J A;  1G3Y A;  2LCS A;  1AT1 B;  1YCY A;  5LJ5 d;  3OBW A;  2CZ7 B;  2ZPE B;  4Y28 E;  1TUG B;  1GCQ C;  2BKD N;  2E3H A;  2I0N A;  4KGX B;  2ZCF B;  1YP5 A;  3LX7 A;  3MP1 A;  4M77 A;  2ZAE A;  2YLC A;  3JCM J;  2CUD A;  2EYW A;  2NYS A;  3V7R A;  4QW2 A;  3G7Z A;  1VYV A;  4QQD A;  1G3T A;  3QO3 A;  1BKB A;  4HA8 A;  2D0N A;  1WFW A;  1YJN T;  1BU1 A;  1OX9 A;  1RAF B;  3OSS C;  4OML A;  6AT1 B;  2L3R A;  1GXI E;  2BZ8 A;  1C6V X;  2J06 A;  4AFZ C;  1VQ5 T;  5LJ3 h;  4HVV A;  2DEQ A;  2RMO A;  2MCN A;  2COW A;  3R6N A;  4QQ6 A;  1MGQ A;  2VVK A;  2JOY A;  2XDD A;  4E7I A;  1Q81 C;  3WVD B;  2BUD A;  4ZGJ B;  9ATC B;  2MWO A;  1Z9Q A;  4PJO E;  2XD0 A;  4J9I A;  4JJD A;  2CP2 A;  2ENM A;  3H8Z A;  4NL3 A;  1AWW A;  2E4H A;  1TSF A;  2PVD B;  4C0D B;  2J6K A;  3J80 E;  3EGD B;  1KG1 A;  2MWP A;  5GAN g;  1AZG B;  4PJL A;  4E7S A;  1K0S A;  1XJW B;  1Q86 R;  3CCS A;  1JU5 C;  2CUB A;  2HQE A;  1J3T A;  2KMT A;  2KT8 A;  4CC7 A;  2ZGW A;  2YXY A;  2JZ2 A;  2LDM A;  3MEU A;  2KRO A;  1I1J A;  2RB6 A;  1RAI B;  2YRV A;  4HVW A;  5LJ3 d;  3QDF A;  2ED0 A;  1MMD A;  2PNI A;  3JB9 G;  2HQH A;  1D0Z A;  4R56 A;  4BUG A;  1KD1 C;  1N6A A;  2KGT A;  3JCM X;  3F70 A;  3E1S A;  2A28 A;  4BY6 C;  2DIG A;  3BDU A;  1JEG A;  2HD0 A;  5KYU A;  2LJ3 A;  1YBY A;  3OYD A;  1MUZ A;  1D1A A;  1WHG A;  2F69 A;  3MP6 A;  1ZSZ A;  4C92 B;  3CCL T;  1NLO C;  2CKK A;  1I5O B;  4RCB A;  1G2B A;  2V8J A;  1O9S A;  4N4G A;  4JRI A;  5D6Y A;  4GLK A;  2EQU A;  3CCR A;  3OYC A;  2H3E B;  2YHT A;  1RLQ C;  1TU0 B;  2DJZ A;  3M0P A;  3M58 A;  3E9G A;  3ME9 A;  3WVE B;  2DIL A;  5KE2 A;  1I5L A;  5C0M A;  2E5Q A;  1W2B S;  5GAN 2;  2RJF A;  1K9M C;  1X6G A;  4GLM A;  3GF5 A;  4FYV B;  2Y90 A;  4M7A B;  4C92 E;  1BIA A;  1X6B A;  2YUP A;  1LOJ A;  2X4J A;  1KD1 R;  1G3S A;  1AWX A;  2MYS A;  2L2P A;  2XK0 A;  1VQN A;  2DO3 A;  1YFN A;  1EIF A;  4C5I A;  4Y92 A;  5CVI A;  2NUZ A;  3PT9 A;  1XOV A;  3VS2 A;  2YRD A;  4EDU A;  1V1C A;  2E1H A;  3G4S T;  4C92 F;  4C5H A;  2NUT B;  1A0N B;  2DPP B;  3LLR A;  3QXE B;  3CCR T;  4IUT A;  2ROL A;  2ECZ A;  1K9A A;  1QVF A;  2FRY A;  4M4Z A;  1BI0 A;  1B34 B;  2K3Y A;  2QGF B;  2H8H A;  3OYL A;  2AKL A;  3L2U A;  2DXC A;  2NLU A;  4C0Z A;  2NUT A;  5CK9 A;  2OTJ T;  4PNO A;  2VXF A;  3QJ6 A;  4KUI A;  5FRO A;  1VQ7 T;  5FW9 A;  2F2V A;  2HKN A;  1JJ2 S;  2HL5 C;  8AT1 B;  1VQP T;  4M77 F;  4RCC A;  1YWO A;  3HP9 A;  4M7A G;  5DLO A;  4XAX B;  4KH1 B;  4A53 A;  4PK4 A;  1VQ9 T;  1UB4 A;  1D1C A;  2LQK A;  1C0M A;  1X27 A;  4IUP A;  1U1T A;  4M77 G;  4MDW A;  1MND A;  3I55 T;  2OTJ Q;  1OEB A;  1YIJ T;  1EX4 A;  1GCP A;  2VXE A;  4OMP A;  4M7A E;  1M1K R;  3IQL A;  2FRW A;  2KEA A;  3QWY A; 
#chains in the Genus database with same CATH homology
 5ECA A;  2DJQ A;  3TVT A;  4OMQ A;  4WCI A;  2GNC A;  2GQI A;  2RQV A;  2SRC A;  4LN2 A;  2AZS A;  2O9S A;  2MIO A;  2DL8 A;  2JMA A;  3M0R A;  4ORZ A;  2EBP A;  2LZ6 B;  2QDL A;  2C0O A;  2NWM A;  1X43 A;  2JM9 A;  1UUE A;  2EW3 A;  2DL7 A;  1BK2 A;  2SEM A;  4K11 A;  4DEX A;  3PVL A;  3VRY A;  1HSQ A;  4LE9 A;  5I11 A;  1AWO A;  1GL5 A;  2J05 A;  3I5S A;  3KFV A;  1PNJ A;  2DF6 A;  2M51 A;  2HDA A;  1ABQ A;  5L23 A;  1AWJ A;  1MV0 B;  1UE9 A;  1OPL A;  2KBT A;  2RQT A;  2P4R A;  4RTY A;  1GRI A;  4Z89 A;  1FYN A;  1VYT A;  1W70 A;  4CC2 A;  4RTU A;  1OV3 A;  1RUW A;  2W10 A;  1YN8 A;  2DBK A;  1NYF A;  1K4U S;  1UDL A;  4R0K A;  2CH4 A;  1UTI A;  2KT1 A;  4F16 A;  1NEB A;  1WXB A;  2HCK A;  1KJW A;  3VRZ A;  2RN8 A;  1NEG A;  4E6R A;  1M3A A;  2YDL A;  4IIO A;  1EFN A;  2DLP A;  1ZLM A;  2GBQ A;  2DNU A;  3EHQ A;  4LUE A;  3REB B;  3NGP A;  2JM8 A;  1TUD A;  1PWT A;  2VKN A;  1B07 A;  2JS0 A;  1QWE A;  1MV3 A;  1S1N A;  1HD3 A;  2B86 A;  2DMO A;  1UEC A;  1WDX A;  4D8K A;  2JW4 A;  2K7A A;  5FWB A;  1T3L A;  1GFD A;  1AD5 A;  3EG2 A;  2LJ1 A;  2DYB A;  2A37 A;  4JZ4 A;  2C0T A;  2O31 A;  2YT6 A;  4OMO A;  1M3B A;  2VWF A;  2EKH A;  1SHF A;  1B3Q A;  1KSW A;  4Z8A A;  2LP5 A;  4F14 A;  3GBQ A;  3RBB B;  3EHR A;  2MOX A;  1KFZ A;  2G6F X;  3I5R A;  2DRM A;  3REA B;  2DBM A;  2BZY A;  4JPB W;  2L0A A;  3VS4 A;  5IH2 A;  2M0Y A;  2D8H A;  5EC7 A;  4D8D A;  2KE9 A;  2CRE A;  2RNA A;  1UG1 A;  3THK A;  2K2M A;  4X1V A;  1ZUU A;  2ESW A;  1QCF A;  2OI3 A;  5FWC A;  4AG1 C;  2DA9 A;  4OMN A;  2KRN A;  2CSQ A;  2ABL A;  2X3X D;  1N5Z A;  2L3Q A;  1U5S A;  3PE0 A;  3UF4 A;  1QKW A;  5GJV B;  2CT4 A;  2J7I A;  2EYZ A;  2HEQ A;  3UA7 A;  4QT7 A;  1UHC A;  4RTT A;  2LX7 A;  2YSQ A;  1ZX6 A;  3NHN A;  3EG0 A;  2FPD A;  1WYX A;  1YWP A;  3UAT A;  1NG2 A;  3SHW A;  3H0F A;  1T3S A;  4DEY A;  1GCQ A;  1TG0 A;  2D8J A;  1M30 A;  2LCS A;  1PHT A;  2PZ1 A;  3VS1 A;  1RLP C;  4RTX A;  2DX1 A;  1H3H A;  4LNP A;  1GCQ C;  1WX6 A;  1Z9Z A;  2I0N A;  2BTT A;  1KIK A;  2V1Q A;  1YP5 A;  1JQQ A;  2KYM A;  1M8M A;  2DL4 A;  2ROT A;  2CUD A;  2EYW A;  1LCK A;  1UHF A;  1VYV A;  1I07 A;  3EG3 A;  2HSP A;  3M0S A;  3I9Q A;  2D0N A;  1WFW A;  3H41 A;  4A63 B;  2KYB A;  1BU1 A;  1QLY A;  5I22 A;  2CSI A;  4OML A;  2EPD A;  3TSW A;  2BZ8 A;  2J06 A;  4AFZ C;  2HBW A;  2LNH B;  3O5Z A;  4GBQ A;  2K3B A;  2YUO A;  1T0J A;  4HVV A;  2EYX A;  3I35 A;  5IHK A;  4RUG A;  2RMO A;  2MCN A;  3R6N A;  1YNZ A;  3VS7 A;  2CT3 A;  2VVK A;  1CSK A;  4CC3 A;  1YCS B;  2JS2 A;  1PRM C;  2KNB B;  2EGA A;  4CC4 B;  1SHG A;  2D1X A;  4HCK A;  1Z9Q A;  3U23 A;  1SPK A;  4J9I A;  4JJD A;  3A98 A;  1UJY A;  2ENM A;  1SRM A;  2L3P A;  1AWW A;  2LQW A;  1E7O A;  2AK5 A;  2BZX A;  2J6K A;  1SSH A;  1FMK A;  2JMC A;  2KRS A;  1AZG B;  5IXF A;  3TSZ A;  1K0S A;  2RQR A;  1JU5 C;  2CUB A;  2V1R A;  1NLP C;  1J3T A;  1Y0M A;  2KT8 A;  4CC7 A;  3JV3 A;  4J9B A;  4OMM A;  3VS5 A;  4J9F A;  1ZSG A;  3H0H A;  3C0C A;  1AVZ C;  4F17 A;  2DE0 X;  2C0I A;  3H0I A;  5HCK A;  2RPN A;  2AZV A;  2DL5 A;  2W0Z A;  2FO0 A;  2RQU A;  1JXM A;  1IO6 A;  2DVJ A;  2KRO A;  1GBR A;  3RNJ A;  1H8K A;  1I1J A;  1X69 A;  2CH4 W;  4J9E A;  4J9D A;  4HVW A;  1WA7 A;  1E6G A;  2ED0 A;  2PNI A;  2GTJ A;  1E6H A;  1WI7 A;  2XMF A;  1I0C A;  2KGT A;  2A28 A;  1VYU A;  1JEG A;  1SEM A;  3NPF A;  2RF0 A;  2LJ3 A;  3M0Q A;  2JXB A;  1MUZ A;  3UA6 A;  1U06 A;  3M0U A;  3EGU A;  1K1Z A;  4HXJ A;  1NLO C;  4AFQ C;  4AFU C;  2IIM A;  1G2B A;  3VS0 A;  2F2W A;  2LJ0 A;  2ED1 A;  1JO8 A;  1AEY A;  4RTZ A;  4J9C A;  1X2K A;  2A36 A;  2KXD A;  2OAW A;  1RLQ C;  2FPE A;  1NM7 A;  3M0P A;  1ZUK A;  2DRK A;  1Y57 A;  3LH5 A;  5IHN A;  2EVR A;  1W1F A;  4LUD A;  2KRM A;  2FEI A;  2DIL A;  2OJ2 A;  1OOT A;  2AKK A;  5IXB A;  2A08 A;  1X6G A;  2YUQ A;  4GLM A;  4AG2 C;  2DM1 A;  2X3W D;  1BBZ A;  1X6B A;  2GTO A;  2YUP A;  1CKA A;  1WXT A;  4ZNX A;  1AOJ A;  1QKX A;  1GBQ A;  2EQI A;  2GGR A;  4HVU A;  2O88 A;  3PVQ A;  2RQW A;  1WXU A;  1AWX A;  2L2P A;  1ZUY A;  1PKS A;  2L3S A;  2O2O A;  2JTE A;  4KRT A;  2CDT A;  1G83 A;  1H92 A;  4Y92 A;  4EIK A;  3EG1 A;  2NUZ A;  1XOV A;  3FJ5 A;  1AZE A;  3VS2 A;  3ULR B;  1V1C A;  4FSS A;  4Z88 A;  4J9H A;  1GFC A;  2F2X A;  4RTV A;  1ARK A;  2K79 A;  1UFF A;  1A0N B;  2JT4 A;  1UGV A;  2J6O A;  2KR3 A;  2FG0 A;  1T0H A;  1ZBJ A;  2ROL A;  2EGC A;  4AFS C;  1JXO A;  2ECZ A;  2J6F A;  3SEM A;  1K9A A;  5IHI A;  1BB9 A;  1UJ0 A;  4RTW A;  1SRL A;  2FRY A;  1PKT A;  1HJD A;  1PRL C;  3ZL7 C;  4M4Z A;  1TUC A;  1CKB A;  2H8H A;  2AKL A;  2O9V A;  1WIE A;  3VS3 A;  2PTK A;  3NMZ C;  1OPK A;  2EGE A;  1K76 A;  4JZ3 A;  4JJB A;  4JJC A;  2FPF A;  3VS6 A;  1RI9 A;  5FW9 A;  2LQN A;  2F2V A;  1M27 C;  3M0T A;  2EYY A;  2LMJ A;  2YUN A;  1YWO A;  2K6D A;  1WLP B;  1QWF A;  2E5K A;  1X27 A;  4J9G A;  4IIM A;  2DL3 A;  1NYG A;  3CQT A;  1M3C A;  1OEB A;  1K0X A;  1U3O A;  4ESR A;  1GCP A;  4OMP A;  5GJW B;  2K9G A;  1X2Q A;  2KXC A;  1W6X A;  3IQL A;  2FRW A;  1VA7 A;  2KEA A;  1ABO A;  3QWY A;  3QWX X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...