2JM9A

R21a spc-sh3 bound
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jm9A00
2O88A 2LZ6B 1NLOC 1WFWA 1X6GA 1GL5A 4RTTA 2HDAA 4QT7A 1SHFA 3REAB 1QWEA 5FW9A 4JZ4A 1TUDA 3M0RA 2A37A 3I9QA 1WA7A 2FEIA 1I07A 2FG0A 1SEMA 5GJVB 1PRLC 4LNPA 3UATA 1QKWA 1YWOA 2K2MA 1VA7A 2XMFA 1OEBA 1ZSGA 1UFFA 1NYGA 2MCNA 4R0KA 1SRMA 4JZ3A 2SEMA 1YCSB 3M0UA 4IIMA 2JTEA 4CC2A 1ZLMA 1M3AA 1JO8A 1UECA 3EG1A 1H3HA 2ED0A 3LH5A 2CSQA 1M3CA 5FWCA 3VS3A 5IXFA 4LN2A 3TSZA 1X6BA 1QCFA 1OPKA 1LCKA 2OAWA 2LJ0A 1ZX6A 1N5ZA 3VS2A 1G83A 1WXUA 3GBQA 4AFQC 2EW3A 1K1ZA 1E6GA 1XOVA 2DVJA 3RNJA 4HVVA 2PZ1A 1FMKA 1K4US 4OMPA 1EFNA 1NM7A 2LNHB 2M51A 1SRLA 2YUOA 4F17A 2JW4A 1TUCA 1K0XA 1YN8A 1VYVA 2YDLA 2J6FA 1AZEA 2YSQA 1AVZC 1RLPC 2SRCA 5ECAA 3U23A 1U5SA 2JS2A 4HVUA 3VRYA 2KRSA 3H0IA 2OJ2A 1QWFA 2OI3A 2ESWA 3EHQA 1PWTA 2LQNA 4ESRA 4OMLA 1I1JA 2MOXA 3O5ZA 4JJBA 1H8KA 1BB9A 2DBKA 1M3BA 1PHTA 2IIMA 1X43A 2RNAA 1HSQA 2BZ8A 2V1QA 1Z9QA 4RTZA 3NGPA 2KE9A 4CC4B 2FPDA 1QKXA 2LQWA 2CT3A 2CUBA 2DL3A 1WXBA 1W1FA 2DILA 2W10A 2LMJA 2GBQA 1SSHA 2D8HA 3VS6A 2JMAA 2JM9A 4RTWA 2DL4A 2GNCA 3VS7A 2DL7A 2EVRA 2YT6A 3I5RA 4J9FA 2F2WA 4JJCA 1OOTA 2LJ3A 4CC3A 3VRZA 1S1NA 3FJ5A 1GFCA 1WDXA 1GBRA 3SEMA 2GTOA 2KRNA 2P4RA 4IIOA 1Y0MA 4AG1C 1VYUA 2EPDA 2ECZA 1X27A 2DRMA 2L2PA 2LX7A 1UGVA 1A0NB 1GCQC 2RQWA 1CSKA 2AKLA 2EGCA 2D1XA 2RN8A 2FPEA 4AFSC 2V1RA 1UG1A 3A98A 4Z89A 5I22A 2JM8A 2ABLA 4RTVA 1PKTA 1QLYA 1V1CA 2VVKA 1AD5A 1BBZA 2EGAA 1E7OA 4D8KA 1AWOA 1W70A 1NEBA 1E6HA 1X2QA 2HCKA 3KFVA 4A63B 3M0SA 1BK2A 1SHGA 3VS5A 5EC7A 1ZUKA 2KGTA 4KRTA 4X1VA 5IHKA 1IO6A 2K79A 1CKAA 1RUWA 1PNJA 2CH4A 4HVWA 1FYNA 1UJYA 2CT4A 2J7IA 1HD3A 3EGUA 2BZXA 2YUNA 1ARKA 1UUEA 3UF4A 3VS1A 2KR3A 2L0AA 1AZGB 2DE0X 2DJQA 2W0ZA 1TG0A 3I35A 2CUDA 2RQVA 2DA9A 1NEGA 3RBBB 2L3QA 1GCPA 1T3LA 2K6DA 2RQTA 2YUPA 4OMOA 2J05A 4Z88A 3EG3A 1J3TA 1UDLA 2HEQA 2C0TA 1VYTA 4RTUA 2J6OA 2C0IA 1Z9ZA 4K11A 2FRWA 4LE9A 4LUEA 2DL5A 2AZVA 1ZUYA 2DBMA 1M8MA 2O31A 1B07A 3M0TA 1GFDA 3C0CA 4ZNXA 1KJWA 2CSIA 2LCSA 1AEYA 1G2BA 2FRYA 3PVQA 3QWYA 2KT1A 1YWPA 2ENMA 1HJDA 1I0CA 3VS0A 2C0OA 2EGEA 5IHNA 4AG2C 3H0HA 2JXBA 2DYBA 4DEYA 5IXBA 1CKBA 2PTKA 1BU1A 2KRMA 2O9SA 1U06A 2AK5A 2F2VA 2EQIA 2RQRA 1Y57A 2ROLA 1KFZA 4OMQA 1GCQA 2ROTA 1WI7A 1K76A 1UHCA 3JV3A 3NMZC 3H0FA 1KIKA 4Z8AA 4Y92A 1GBQA 1ZUUA 4F14A 2EYZA 2A08A 2BTTA 2M0YA 1NYFA 3EG0A 1OV3A 3TSWA 1AWXA 2F2XA 3THKA 1NLPC 1YNZA 2KYBA 4J9BA 3M0PA 1W6XA 2JS0A 5HCKA 2X3XD 1YP5A 1K9AA 1AWJA 1UJ0A 2E5KA 1WIEA 4J9EA 4ORZA 4LUDA 2J06A 4JJDA 1RLQC 2PNIA 2VWFA 2K3BA 2G6FX 3ULRB 4J9DA 1X2KA 2DLPA 2DL8A 1T0HA 2KBTA 3EHRA 4OMNA 4RTXA 4JPBW 4HXJA 2LP5A 4GBQA 2KYMA 3NHNA 4F16A 2KROA 1OPLA 3CQTA 2B86A 2HSPA 3IQLA 2CREA 2CDTA 4RTYA 2VKNA 4GLMA 2MIOA 2A28A 1X69A 1PKSA 1JEGA 2K9GA 2DMOA 2JMCA 2KT8A 1B3QA 4OMMA 2A36A 3R6NA 1RI9A 4EIKA 2CH4W 2GTJA 5I11A 5GJWB 4AFUC 2L3PA 1T0JA 2RQUA 2DX1A 1KSWA 2RPNA 4J9CA 2ED1A 5FWBA 1WX6A 1JQQA 1MUZA 2YUQA 2O9VA 1ABOA 3M0QA 1UTIA 3NPFA 1WLPB 5IH2A 3ZL7C 2AZSA 1UHFA 1MV3A 2KNBB 3VS4A 1GRIA 3UA6A 1PRMC 1U3OA 1T3SA 2H8HA 1SPKA 2DRKA 2DM1A 3I5SA 2DNUA 2J6KA 2EYWA 2KXDA 5L23A 2GQIA 1H92A 3UA7A 4E6RA 1ZBJA 2KXCA 1AWWA 1JXMA 3EG2A 1MV0B 2QDLA 3QWXX 2K7AA 4HCKA 3REBB 2LJ1A 2D8JA 2RF0A 2EYYA 4AFZC 1UE9A 4D8DA 1JXOA 1M30A 2FPFA 2O2OA 2EYXA 2GGRA 2RMOA 3TVTA 1ABQA 4M4ZA 3H41A 4WCIA 2D0NA 2BZYA 3PVLA 1K0SA 1AOJA 2X3WD 4J9GA 4RUGA 2NUZA 3PE0A 5IHIA 2L3SA 2I0NA 1WXTA 1M27C 4J9HA 2NWMA 4CC7A 1JU5C 4J9IA 4DEXA 2DF6A 1WYXA 2AKKA 2EKHA 1NG2A 3SHWA 2HBWA 2FO0A 2JT4A 2KEAA 2EBPA 4FSSA
chains in the Genus database with same CATH superfamily
4J6XA 3OYGA 4C0ZA 3G6EA 3OSVA 4PLIA 4ELZC 2HDAA 1SF9A 5FW9A 4JZ4A 3WXMB 2A37A 5KH6A 1WJRA 1QCNA 2FEIA 4EDUA 2FG0A 2XI9A 3RIRA 1PRLC 3G71T 5L8RE 1QKWA 5D6YA 3BE3A 3OYYA 1VA7A 2O01E 3JCMc 1OEBA 3CCQQ 5CO7A 4MMLA 2GFAA 2EWNA 1VQPQ 2Y4XA 3I56A 4PJOA 4LDVA 2KY9A 3ME9A 1SRMA 2DFUA 3LWIA 3M56A 3A8HB 3JCMg 3M0UA 1M2OA 4BE1A 3JB9G 1YHQA 2E70A 1W2BA 1K8AU 4ME7A 3QPHA 1M3AA 2XDDA 1U8RA 2VGNA 1JO8A 2RJDA 2RHZA 3LH5A 2CSQA 1K8AR 5FWCA 2K3YA 4LN2A 3TSZA 4PFZA 3TCJA 1LCKA 2OAWA 4NL2A 3I55T 1RI0A 2BE9B 2LCLA 5D6XA 3L42A 1WJQA 3GBQA 7AT1B 1RAEB 2RHUA 2HQHA 5DY9A 2DJZA 1XOVA 4BE2A 1EFNA 2QA4A 3J81E 4F17A 2JW4A 1K73C 4XTYA 5CVIA 2O4XB 3EH2A 2VXEA 2YDLA 3QYHB 3O8VA 4A53A 4FSXA 2DXUA 5KCHA 3LGLA 4BI3A 2DXBA 1N9SA 3VRYA 2F5TX 2OJ2A 2HBPA 2OI3A 5GAOq 3EHQA 4EMKB 1P92A 2LX9A 3E1SA 5LJ3j 3G4ST 3JCMJ 1WHKA 1BB9A 4PLLA 1M3BA 2IIMA 4A4FA 1X43A 3G71A 5J3BA 1O9SA 1VQMT 2L8DA 1QKXA 2CT3A 3VUZA 1SG5A 2CUBA 4KUDK 2DZ9A 1VQKT 3MP1A 6AT1B 3A8OB 4JRKA 4J83A 3CD6A 2FHDA 1QMCA 2LQ8A 3RKXA 3VRZA 1K8AC 3CXCP 4J8OA 3HKSA 2LT4A 3QZ5B 1VIFA 4M75E 2L2PA 3I55A 4M77C 1GCQC 3CCJT 1CSKA 2KAFA 3RKYA 4R55A 2O4XA 2RN8A 1Q81C 5I22A 3PIOA 2MI6A 2QG9B 1G3TA 5CIUA 4C92C 2VVKA 2RHIA 4M7DC 1HK9A 3CCRQ 1TTHB 1BBZA 1VQ9Q 5A0DA 2COYA 1NE8A 9ATCB 5C6SA 2HCKA 4EMKA 3M0SA 4ZN3A 1BK2A 4C0DC 1Q86U 3LYIA 2DETA 4X1VA 3M5AA 4BI8B 3OS5A 2K79A 1OZ2A 3JB9I 5GMKm 1FYNA 1UJYA 4N4HA 2CT4A 1HD3A 3EGUA 4XTVA 2QXFA 2BZXA 1RAGB 3MPUB 5M9OA 2PVDB 3VJPA 3MCAB 5IAYA 3G4SA 2Y4YA 1H3ZA 2CKKA 2L3QA 1T3LA 4FW2A 3CMEQ 1VQMA 4B6MA 4CRIA 3OS0A 2HEQA 2QTXA 1VYTA 1XNIA 2J6OA 2P0KA 1UGSB 2C0IA 3E2UA 3MP8A 2DIGA 4OB0B 4FM4B 2AIRB 4OVAA 5D7UA 2AZVA 2CYZB 4XK8E 1G3WA 2DBMA 2O31A 3M0TA 3QUIA 3DLLA 5GAMf 3QJ6A 2RI3A 5AT1B 2GF7A 4AT1B 1KHCA 1KJWA 2CSIA 5GMKi 1OX8A 1WPYA 1TH7A 2QQSA 3QDRB 4RG8A 2QGGA 3R6OA 4XAXB 2FRYA 3PVQA 2MAMA 3CCJA 1VQPT 1YWPA 4E7JA 3JB9J 4N4IA 1HJDA 2QEXQ 3OYIA 3OYCA 2CS7A 2CP5A 2QQAA 5LL6S 2EGEA 3RR6A 1RADB 2E3HA 4M77E 4QW2A 4OGCA 2K2VA 4JS5A 2KRMA 2PU9B 3QZ9B 3HRUA 1Y57A 4C92E 1WI7A 4M7DE 3GIBA 4MMKA 1RAFB 3S6WA 2AHJB 5I21A 2K4YA 4Y92A 3MEUA 2E10A 3RESA 4F14A 3VUBA 3PFSA 2A08A 3G1JA 1NYFA 3OW2S 3EG0A 1VQ6Q 2DZCA 2E5QA 4C8QE 1AWXA 4HT8A 2COWA 4J5YA 1W6XA 3CPFA 1NPPA 2E1HA 2X3XD 3GF5A 1BKBA 2QASA 1K9AA 1I5OB 4JS4A 2XD0A 1WIEA 3ER0A 2HKNA 3V7CA 4NOYA 1AHJB 3ULRB 3FRNA 1X2KA 1T0HA 1SSFA 5GANf 1UGPB 4JPBW 3HPWA 2LP5A 1OPLA 2HSPA 3IQLA 3QSUA 4PK4A 4GLMA 3OA6A 2MIOA 1X69A 5CAIA 2K9GA 2KT8A 1RI9A 2GQVA 4PNOA 1VQPA 2XKOC 2P0QA 2CP7A 1TSFA 4IURA 3BW1A 3S3MA 2ED1A 1M1GA 1WX6A 2LTOA 1JJ2P 4II1A 1WHMA 2XDBA 5LJ3e 1ABOA 3ZL7C 2AZSA 3L2VA 1MV3A 5KYWB 3JCMP 1C6VX 5LJ5j 2MMPA 1MGQA 4XTUA 2H8HA 1YCYA 1D3BB 4FW1A 1YBYA 4PFPA 5KCOA 2KK4A 2ZPBB 3I5SA 5IN1A 4C0GA 1PSFA 4RMOA 2GQIA 3UA7A 1ZBJA 1EZZB 4XU3A 2DO3A 2LVMA 3D7SB 4TVRA 3CCRT 1VQ9T 5J39A 1MV0B 4N0AC 3REBB 2D8JA 1MMNA 2ZCFB 5KE3A 4D8DA 3I55Q 3FEOA 1M30A 1W2BP 2O2OA 3QKJA 2RMOA 2KDSA 3UDCA 2QAZA 3BY7A 3UWNA 3CPWS 2JOYA 2L3SA 3OW2A 4CC7A 1JU5C 4J9IA 1KQ1A 3M53A 1VQLQ 3AHUA 2AKKA 1NG2A 2HBWA 3QYGB 1PSEA 2JT4A 3ZFJA 2O88A 3CMET 1UB4A 1X6GA 1GL5A 4RTTA 4QT7A 5LJ3h 3REAB 5KYWA 3I9QA 5GAOm 5C0MA 1RAAB 3JB9H 3GPLA 3PNWC 1SEMA 1JB0E 5GJVB 4CI0C 4LNPA 4ZGJB 2DEUA 1D1BA 2PVOB 2DKGA 1D3BA 4M7AF 2XMFA 4OP0A 3VYHB 3MKDA 2IG0A 3CEYA 4M75A 2LDMA 2IVWA 3M58A 4M78F 1YCSB 1N8RU 3FC3A 2LQKA 2JTEA 4M77G 1QVFP 2OX7A 4Q5WA 5LJ3d 1VQKQ 1UECA 5GAN7 1H3HA 2V8JA 3GLXA 1N8RR 1M3CA 1TXQA 4E7HA 1MHNA 4C92G 3J7AF 4M7DG 3OYJA 3CCRA 3M4YA 1VQ9A 1RAIB 4LD9K 2EQKA 3VS2A 1G83A 5CKHA 1WXUA 2XHCA 4JLIA 4M77B 2XU8A 2EW3A 5KYUB 1E6GA 2DVJA 3RNJA 2MYSA 3FB9A 1FMKA 1NJIU 4OMPA 2ZPHB 2K57A 3KUFA 1GXIE 2DK3A 2M51A 1SRLA 3A8LB 4C8QG 4C92B 2K3XA 4M7DB 1TUCA 2R5MA 4PKCC 3P8DA 5FROA 4C5GA 4LDUA 1NJIR 1IB8A 1VYVA 1AZEA 5LJ5g 5GAOp 2SRCA 5ECAA 3JSCA 2FZCB 2NUPA 4LDXA 1PCXA 4C0DB 4DBFA 1U5SA 2GFUA 4FU6A 3CMEA 1QWFA 3CC7Q 4M7AD 2LQNA 4JRQA 1M1KU 2EYQA 4OMLA 2MOXA 1W4SA 1BCMA 1FX7A 1H8KA 2DBKA 4BD3A 4M78D 3GOXA 1PHTA 4FYYB 5GAN2 3OYNA 1YITQ 3VKIA 1M1KR 2RO0A 3P8BB 2BZ8A 1Z9QA 1QQJA 3BDUA 2FPDA 2EIFA 1Q95G 4GY5A 2E6ZA 3INZA 1WXBA 1Y96A 2DILA 4B9WA 1U1SA 2LMJA 2GBQA 1SSHA 3VS6A 2JM9A 3CBMA 4XU0A 2EAYA 2R57A 2DL4A 3WVEB 2GNCA 2DL7A 2YT6A 3I5RA 2QEXA 4J9FA 2F2WA 1EIFA 1OOTA 4CC3A 1N8RC 3FJ5A 4M77A 2HKQB 3SEMA 2P4RA 1JRIA 2AT1B 2PUOB 2DERA 2ECZA 1X27A 3SB2A 2LX7A 1UGVA 3T9NA 2RQWA 4BDYA 3HFNA 2DIQA 4C92A 2CZ1B 4M7DA 1LVKA 2EGCA 2CZ0B 2D1XA 4AFSC 3H6ZA 2XG8D 4Z89A 2JM8A 4M75D 4RTVA 1PKTA 2R5AA 1AD5A 4D8KA 1IHWA 4PJNA 2JVVA 1W70A 1XJWB 1NJIC 4C8QA 1SHGA 3ZBDA 3QXEB 5EC7A 1VQ6A 1WNLA 1ZUKA 2KGTA 4KRTA 3V7RA 4DOVA 5IHKA 3X28B 4HVWA 1RUWA 2DXTA 1I8FA 5LJ5e 1Q81U 3OYKA 1ARKA 2EJGA 3A1PA 1UUEA 3C94A 3UF4A 2EQMA 2KR3A 1AZGB 1TG0A 2E64A 3I35A 2FB7A 1MMGA 5FRMA 1B7TA 1Q81R 4JJNK 1M1KC 1D0ZA 8ATCB 4Z88A 1TWBA 1VQLT 4WTOB 3QO3A 2LRQA 4JLGA 1R0BG 3P8HA 2WSFE 1Z9ZA 2WACA 4PJOF 2E65A 3QG1A 4LUEA 2X4WA 3SWNC 2FZGB 1ZUYA 1QVFA 1TU0B 1WZOA 2QYZA 3S3NA 4ZNXA 4MZTA 1VQNQ 1N27A 2HD0A 1FMWA 3LGFA 2G3RA 2BKDN 1VQ8Q 4BI4A 4X34A 2KT1A 2ENMA 2VXFA 3LWHA 2P0PA 2DVEA 1I0CA 2C0OA 2VGMA 4A4KA 4XTZA 5CCAA 4LDYA 2DYBA 4DEYA 5IXBA 4HCBA 3JCMV 1BU1A 5LJ5h 1U06A 3EGXB 2AK5A 1S72Q 2OTJT 1VQ7T 2JJ9A 3JCMe 1KFZA 1D1AA 4OMQA 4OB1B 4M77D 1K76A 1XTDA 3HRTA 4RKUE 3JV3A 3Q1JA 4ANJA 4Z8AA 3QBYA 1GBQA 2EYZA 4ZGDB 5GMKj 4ZTJA 2F5KA 2M0YA 1VQ5Q 2L5QA 1YJNQ 4PJOD 1PD0A 5LJ5d 3RERA 1I4K1 3TSWA 1VQLA 3M0PA 1B34B 4A54A 1TOVA 2JS0A 2HMAA 4FT2A 1YP5A 2JTFA 4LUDA 2J06A 2PNIA 4C8QD 1UGQB 3CC7T 4MZMA 1WHHA 1D1CA 2G6FX 4OMNA 2DL8A 1MNDA 3PMTA 3CC2Q 2DXCA 4GBQA 1M1FA 3CQTA 2CREA 1YITT 2EJ9A 2NYSA 1JEGA 1YJ9Q 2DMOA 2Z0WA 3CCMQ 2BE7D 2CH4W 3C12A 4AFUC 3EGXA 1T0JA 4MDXA 2DX1A 1KSWA 2RPNA 1QVGP 3JCMh 1H641 5CKBA 4J9CA 5FWBA 5FU7C 2FL7A 1TS9A 1VQKA 1MUZA 3OW2P 2YUQA 5HY6A 2ZPIB 1UTIA 1X01A 1WLPB 5IH2A 1IHVA 2MWOA 2X9HA 3VS4A 3ZEHA 5CKEA 1VQ7A 4PFOA 4PJLA 1PRMC 2HL3A 4HCZA 4KBMB 5GAMg 4HT9A 3FIFA 4BB7A 1SPKA 2DRKA 2DM1A 4ZGEB 2DNUA 5GAOr 2FZKB 3RMQA 3OYHA 4PJMA 3OYFA 1H92A 1B34A 3M9QA 4E6RA 3JCMd 1LOJA 4RG2A 2YLCA 3LW5E 3CCLT 1JXMA 2M1HA 3OB9A 4HCKA 4J7FA 5I2SA 1M4ZA 1JXOA 2XICA 3MO8A 3TEEA 1YIJQ 3BDLA 5LJ3f 1ABQA 4WCIA 1V29B 3JB9D 2D0NA 2BZYA 1PD1A 3PVLA 3CC7A 1Q82C 1YI2Q 2V8IA 5HK3A 1M27C 4J9HA 2NWMA 1MNEA 2M02A 3SHWA 2RK2A 1QVGS 2E12A 5GAN5 1YITA 4FSSA 3OSSC 2PVGB 1ZA2B 1WFWA 1SHFA 1QWEA 1ACMB 1SKUB 2I2LA 1TUDA 3M0RA 4D6WA 4PL6A 1BI1A 1WA7A 1I07A 2KQWA 3HSBA 1ZSGA 1UFFA 2RHYA 3VYGA 3MJXA 2MCNA 1VQNT 3OYMA 1IXDA 2SEMA 2XK0A 3M4GA 4C5IA 4L5GA 1VQ8T 4F04B 3OYLA 1ZLMA 3SD4A 3L2QA 1KK7A 3EFSA 3PT9A 1VQ4Q 3EG1A 3CPWP 2XIDA 3A8GB 1X6BA 1QCFA 1IZ6A 1FWZA 1RL2A 4OB2B 1M9SA 4JDSA 4HKEA 3CCLA 3MP6A 3META 2LJ0A 4ELYC 2ZPEB 1N5ZA 1S72T 4AFQC 1K1ZA 2DAQA 3MEWA 5AYFA 1NM7A 5CK9A 2HAXA 4OF1A 1K0XA 2D0QB 2J6FA 2YXYA 2YSQA 1AVZC 1RLPC 4ZTFA 1M5Q1 3NTKA 1VQ5T 3QJYA 4X9DA 1WHJA 1YJNT 4DBRA 2A7YA 4FYWB 2JS2A 1LNXA 2KRSA 3H0IA 2ESWA 1PWTA 2LT1A 1XQHA 4NS5A 4ESRA 1I1JA 1OQKA 4HCCA 1G5VA 4JJBA 1BIBA 3X26B 3WVDB 3MEVA 3CC4Q 3QDFA 1C0MA 2RNAA 1HSQA 3CC2T 1QVGA 2V1QA 2X4JA 2JUFA 5EG2A 5GMKe 2LQWA 2VYTA 3EFOB 3NTIA 2DL3A 1VQNA 4ATOA 3MEAA 1W1FA 2MF2A 2W10A 5KYYB 3CCEQ 4A4EA 4FIBA 1YJ9T 2DEQA 2DD4A 3NTHA 1VQ8A 3DB3A 3CCMT 1OU9A 1IREB 3PTAA 2EVRA 2LJ3A 3SWNB 4E7KA 2JN0A 1WDXA 1GBRA 2GTOA 4QKUA 4EMGA 4AG1C 1VYUA 2EPDA 3OS2A 3FJPA 1BI3A 3M59A 1Y7XA 1RAHB 1S72A 3OYDA 2QDYB 2FPEA 2CP0A 4JRPA 1UG1A 2RHXA 4XQ3A 3A98A 2VB6A 2P84A 2ABLA 1QLYA 1FXXA 5GMKl 4YTLA 3L2RA 5A0LA 3M54A 3PGGA 4DBHA 2LCCA 1E6HA 1X2QA 2QQBA 3KFVA 1V76A 1KC8U 1KQSP 4A63B 1WJSA 3CMAQ 1VQ5A 2D6FA 1YJNA 1M90U 2OTJQ 1VQ7Q 4Y91A 2CH4A 1PNJA 3CCVT 3FLGA 1KC8R 2ZAEA 3H8ZA 2YUNA 5GMKh 1M90R 3S3OA 1YIJT 2W0ZA 1R8OB 4QVZA 5J26A 2RQVA 1NEGA 3HRSA 4DA4A 1YI2T 2YUPA 3CCSQ 3CC2A 3G7ZA 2FVUA 2MWPA 3SWNA 3OBWA 1YJ9A 5DLOA 4M75F 1WQ7A 3CCMA 1M8MA 1DJ7B 5GAN3 2DPPB 2M0OA 1M2VB 1YHQT 5A2QE 3CPWA 1NPRA 2LCSA 5LJ5f 4NL3A 3FDRA 2ZPFB 2YWWA 3UPUA 3OY9A 3DLMA 4V2SA 2K5LA 4F7UF 5CR2A 1KD1U 4FL6A 3VS0A 1KQSS 3UT1A 1YFNA 3TREA 4AG2C 3V8JA 3H0HA 1VQ4T 3LX7A 1KD1R 4BUGA 5FU7B 3HHTB 4M7AC 2MPXC 2F2VA 2GCXA 4BE0A 2RQRA 2EFIA 1BIAA 2ROLA 4J6YA 1GCQA 4M78C 2X51A 5KYUA 1ZSZC 2RM4A 1IGQA 4EMHA 3CCVA 3SDZA 3H0FA 1KC8C 1KIKA 2E3IA 3M57A 1M90C 1YIJA 1ZUUA 2HZYA 2BTTA 4E2FB 5KE2A 4XTWA 1YI2A 3LH0A 3CCUQ 3THKA 2LNVA 2RI5A 2YLBA 3OYBA 1YNZA 4IUQA 1VUBA 2KYBA 3CCLQ 2XDPA 1M2VA 4IUVA 4X9CA 1BI0A 4J9EA 2E5KA 1RABB 3BFMA 4OMFB 2K3BA 2DLPA 3JCMf 4R56A 2KBTA 3EHRA 3HP9A 2DYIA 4BDZA 4HXJA 4EPCA 2C06A 2EQUA 3URGA 2NUTB 2V26A 2ZZDA 3CC4T 2CDTA 4M75C 4RTYA 2OAUA 4FYXB 2A0FB 2VKNA 4DBQA 3CD6T 2A28A 4M77F 1PKSA 1B3QA 4AMCA 4KGZB 1PM3A 2GTJA 2EJFA 4QQGA 3HFOA 3CCET 2RA2A 4C92F 4M7DF 3L2ZA 1VQ4A 2ATCB 2HSEB 5GAMj 1KD1C 1VQOQ 4KH0B 2O9VA 4XU2A 2P4TA 4E7SA 1I5LA 1HXDA 2KNBB 1KHIA 3UA6A 1LJOA 1T3SA 2YRVA 1KQSA 5DM7R 3EG9B 3V7SA 4C8QF 4M7AE 2J6KA 2KXDA 5L23A 1BCOA 3CBOA 3NFCA 4C5EA 4M78E 4KUIA 1AWWA 1AT1B 3EG2A 3E9FA 2LJ1A 2EYYA 4AFZC 2COZA 1UE9A 1QP3A 3CMAT 1K9MU 1N9RA 2QGFB 4IUPA 2GGRA 3PIPA 3TVTA 2NUTA 4M4ZA 5KYNA 1UEBA 2A3LA 1K0SA 3QHSA 1K9MR 1C1AA 4E7IA 4IKFA 4J9GA 1X75C 2NUZA 3PE0A 1LPLA 2H3EB 2BUDA 2EQJA 4DEXA 5GAOl 2DF6A 4RCCA 1M8VA 1WYXA 2EKHA 1Q7YU 4FYVB 2FO0A 3CC4A 3X20B 2EBPA 2E41A 4C92D 3CCST 2LZ6B 4M7DD 1NLOC 2CP2A 3OQ5A 4L6V5 1Q7YR 2F1LA 1OYXA 1OU8A 3HL8A 3CCEA 1Q82U 4DQ2A 1IGUA 3UATA 1YWOA 5GANj 2RK1A 2K2MA 4OGEA 3EG9A 5FU6B 3JRZA 1Q82R 3C95A 4KGVB 1NYGA 2H3JA 3F70A 4R0KA 4BACA 2VC8A 4JZ3A 4IIMA 4IUUA 3RUXA 4CC2A 5A0GA 4F7UE 2YHTA 3JB9F 4PJOC 1F1BB 2ED0A 2IPOB 2L3RA 3EGDB 3VS3A 5IXFA 4E7LA 1N6AA 1OPKA 2VUBA 4J6WA 3TQ7P 4LD6A 1Q86R 4C8QC 3OYEA 2X4XA 1YJWQ 2DTIA 1ZX6A 3VV0A 4BY6C 2M16A 3MHXA 4VUBA 2HQEA 4KT0E 4Z02A 3CMAA 1WQWA 4C0FA 4HVVA 2PZ1A 1K4US 4O5VA 1OI1A 2OTJA 4QQDA 1KQ2A 2LNHB 2YUOA 2M9UA 5CQYA 1K9MC 1VIEA 1YN8A 3CXCS 2KSSA 3GNGA 3SFMA 4L59A 2RJCA 4WF2A 4N0AA 1HYOA 1EX4A 2CP6A 3U23A 4KGXB 5CKDA 3CCSA 2F69A 3CCUT 4HVUA 1UGRB 1Q7YC 4HA8A 2VASA 2OTLQ 1FMVA 4QQ6A 3CCVQ 2HL5C 1X6OA 3O5ZA 3OMGA 1WHLA 3CCQT 3AT1B 3JCMQ 4P5NA 4JRIA 4RTZA 2WSEE 3NGPA 3G6EQ 5LJ3g 3JCMb 2KE9A 4CC4B 3A5ZB 3EGDA 5IT9E 1MMDA 2D8HA 2X4YA 2JMAA 5CQXA 4RTWA 3N5BB 2CZ7B 1NZ9A 1D0XA 2PUKB 3VS7A 1O75A 4JJCA 1S1NA 1WHGA 1GFCA 3GP8A 3I56Q 2KRNA 1BI2A 4IIOA 1U1TA 1Y0MA 1YHQQ 4A4HA 4PJOE 1VQOT 2DRMA 3JCMW 3L1AA 1Q86C 5FRNA 4GLKA 4M7AG 1A0NB 4JUVA 4RCBA 2AKLA 4KULA 4OB3B 4O6JA 4M78G 2V1RA 2D9TA 1OX9A 2CGHA 2WSCE 3ASKA 1V1CA 1RACB 5GANg 2EGAA 1E7OA 1AWOA 2RJFA 3DB4A 3J80E 1NEBA 4M7AB 2QQRA 2QI2A 5GAMe 2YRCA 3VS5A 2FYKA 1QP2A 2RB6A 1IO6A 1CKAA 3CCUA 4M78B 1JBMA 2J7IA 2VV5A 3C4SA 1ZSZB 4EMKC 2QA4Q 3A8MB 5DLQE 5KYXB 2JTMA 3VS1A 2L0AA 5I2MA 2RH2A 2DE0X 2DJQA 3JAME 2CUDA 2DA9A 3RBBB 4FT4A 3CXCA 3CCQA 1I81A 1GCPA 2K6DA 2RQTA 5GAOn 4OMOA 3KXTA 2J05A 3EG3A 1J3TA 1UDLA 3V8LA 1G8XA 2C0TA 3E9GA 2DD5A 4KH1B 4RTUA 4M75G 1PC0A 3QIIA 2E4HA 1ZQ1A 4K11A 2FRWA 4B9XA 4LE9A 2DL5A 3CBPA 2ZPGB 3G71Q 4N4GA 1B07A 1GFDA 3C0CA 1D09B 4MZPA 4E47A 2DTHA 3OMCA 4A4GA 1D0YA 2X35A 1AEYA 4F7UG 3RDVA 1G2BA 1VQOA 4M75B 3X25B 3QWYA 1PG5B 5FU6C 3CD6Q 3RMSA 1WGSA 3E19A 3HTRA 2YRDA 5HK0A 4M7AA 5GAN4 5IHNA 5GAMh 2CP3A 2JXBA 3GNFB 1CKBA 2PTKA 4M78A 2B8AA 1TUGB 2O9SA 4F7UB 1ZSZA 1ZA1B 5KYXA 5D6WA 2L89A 2EQIA 5GANe 2ROTA 1UHCA 1YJWT 5GAN8 3NMZC 8AT1B 2V8KA 4C5HA 3LLRA 1QVPA 5GAMd 1QCOA 1Y07A 2NLUA 1JJ2S 2DTOA 2EKOA 2JZ2A 3OBYA 4FCYA 5FLXE 1OZ3A 1OV3A 5GAN6 2E6NA 2PQWA 2F2XA 1NLPC 4J9BA 2NUPB 5HCKA 5HKCA 2R58A 1Y71A 3EAEA 4ORZA 1AWJA 1UJ0A 3EH1A 3JCMX 4JJDA 1NBEB 3G4SQ 1RLQC 1VOMA 1BYMA 1R77A 2KI7A 2VWFA 2OTLT 4J9DA 4RTXA 1VQMQ 2RI2A 2KYMA 4XU1A 3NHNA 4F16A 2KROA 4ZN1A 3OYAA 2B86A 3OS1A 3L2UA 2QEXT 3EFOA 3G6ET 2JMCA 3V8KA 4OMMA 2A36A 3R6NA 1OULA 5KYYA 1Y96B 2RD1A 3KBGA 4DOWA 4EIKA 5I11A 1W2BS 5GJWB 2L3PA 3L2WA 4F7UA 2RQUA 1R0CB 3VU3C 5GANh 4PJOG 2QK0A 1JQQA 3M0QA 3NPFA 3CCJQ 1UHFA 4LDWA 3I56T 1GRIA 1MMAA 4QVCA 1KG1A 2KVQG 1U3OA 2QTVA 4Y28E 1G3YA 1YJWA 4PJOB 2EYWA 1QW1A 2ZGWA 5CKFA 2KMTA 2K5FA 2BIVA 1VQ6T 3RKWA 2RJEA 5GANd 2KXCA 3X24B 1ZHIA 1ZBXA 4J7IA 2QDLA 4QVDA 3QWXX 2K7AA 2LC4A 4IUTA 4C8QB 2RF0A 3PMIA 3TU4K 4MDWA 1G3SA 4BY6B 1K73U 2JNGA 3M55A 2FPFA 3H9NA 2Y90A 2EYXA 2K5IA 1QVFS 2CZ6B 4E7ZA 1IRXA 2HNIA 3H41A 3DKMA 2QA4T 4UC4A 1AOJA 4LXCA 1K73R 3EFRA 2MK5A 2X3WD 4RUGA 1JJ2A 2OTLA 5IHIA 2I0NA 1WXTA 4XTXA 2HQXA 2QQ9A 2KEAA 4PJJA
chains in the Genus database with same CATH topology
2O88A 2LZ6B 1NLOC 1WFWA 1X6GA 1GL5A 4RTTA 2HDAA 4QT7A 1SHFA 3REAB 1QWEA 5FW9A 4JZ4A 1TUDA 3M0RA 2A37A 3I9QA 1WA7A 2FEIA 1I07A 2FG0A 1SEMA 5GJVB 1PRLC 4LNPA 3UATA 1QKWA 1YWOA 2K2MA 1VA7A 2XMFA 1OEBA 1ZSGA 1UFFA 1NYGA 2MCNA 4R0KA 1SRMA 4JZ3A 2SEMA 1YCSB 3M0UA 4IIMA 2JTEA 4CC2A 1ZLMA 1M3AA 1JO8A 1UECA 3EG1A 1H3HA 2ED0A 3LH5A 2CSQA 1M3CA 5FWCA 3VS3A 5IXFA 4LN2A 3TSZA 1X6BA 1QCFA 1OPKA 1LCKA 2OAWA 2LJ0A 1ZX6A 1N5ZA 3VS2A 1G83A 1WXUA 3GBQA 4AFQC 2EW3A 1K1ZA 1E6GA 1XOVA 2DVJA 3RNJA 4HVVA 2PZ1A 1FMKA 1K4US 4OMPA 1EFNA 1NM7A 2LNHB 2M51A 1SRLA 2YUOA 4F17A 2JW4A 1TUCA 1K0XA 1YN8A 1VYVA 2YDLA 2J6FA 1AZEA 2YSQA 1AVZC 1RLPC 2SRCA 5ECAA 3U23A 1U5SA 2JS2A 4HVUA 3VRYA 2KRSA 3H0IA 2OJ2A 1QWFA 2OI3A 2ESWA 3EHQA 1PWTA 2LQNA 4ESRA 4OMLA 1I1JA 2MOXA 3O5ZA 4JJBA 1H8KA 1BB9A 2DBKA 1M3BA 1PHTA 2IIMA 1X43A 2RNAA 1HSQA 2BZ8A 2V1QA 1Z9QA 4RTZA 3NGPA 2KE9A 4CC4B 2FPDA 1QKXA 2LQWA 2CT3A 2CUBA 2DL3A 1WXBA 1W1FA 2DILA 2W10A 2LMJA 2GBQA 1SSHA 2D8HA 3VS6A 2JMAA 2JM9A 4RTWA 2DL4A 2GNCA 3VS7A 2DL7A 2EVRA 2YT6A 3I5RA 4J9FA 2F2WA 4JJCA 1OOTA 2LJ3A 4CC3A 3VRZA 1S1NA 3FJ5A 1GFCA 1WDXA 1GBRA 3SEMA 2GTOA 2KRNA 2P4RA 4IIOA 1Y0MA 4AG1C 1VYUA 2EPDA 2ECZA 1X27A 2DRMA 2L2PA 2LX7A 1UGVA 1A0NB 1GCQC 2RQWA 1CSKA 2AKLA 2EGCA 2D1XA 2RN8A 2FPEA 4AFSC 2V1RA 1UG1A 3A98A 4Z89A 5I22A 2JM8A 2ABLA 4RTVA 1PKTA 1QLYA 1V1CA 2VVKA 1AD5A 1BBZA 2EGAA 1E7OA 4D8KA 1AWOA 1W70A 1NEBA 1E6HA 1X2QA 2HCKA 3KFVA 4A63B 3M0SA 1BK2A 1SHGA 3VS5A 5EC7A 1ZUKA 2KGTA 4KRTA 4X1VA 5IHKA 1IO6A 2K79A 1CKAA 1RUWA 1PNJA 2CH4A 4HVWA 1FYNA 1UJYA 2CT4A 2J7IA 1HD3A 3EGUA 2BZXA 2YUNA 1ARKA 1UUEA 3UF4A 3VS1A 2KR3A 2L0AA 1AZGB 2DE0X 2DJQA 2W0ZA 1TG0A 3I35A 2CUDA 2RQVA 2DA9A 1NEGA 3RBBB 2L3QA 1GCPA 1T3LA 2K6DA 2RQTA 2YUPA 4OMOA 2J05A 4Z88A 3EG3A 1J3TA 1UDLA 2HEQA 2C0TA 1VYTA 4RTUA 2J6OA 2C0IA 1Z9ZA 4K11A 2FRWA 4LE9A 4LUEA 2DL5A 2AZVA 1ZUYA 2DBMA 1M8MA 2O31A 1B07A 3M0TA 1GFDA 3C0CA 4ZNXA 1KJWA 2CSIA 2LCSA 1AEYA 1G2BA 2FRYA 3PVQA 3QWYA 2KT1A 1YWPA 2ENMA 1HJDA 1I0CA 3VS0A 2C0OA 2EGEA 5IHNA 4AG2C 3H0HA 2JXBA 2DYBA 4DEYA 5IXBA 1CKBA 2PTKA 1BU1A 2KRMA 2O9SA 1U06A 2AK5A 2F2VA 2EQIA 2RQRA 1Y57A 2ROLA 1KFZA 4OMQA 1GCQA 2ROTA 1WI7A 1K76A 1UHCA 3JV3A 3NMZC 3H0FA 1KIKA 4Z8AA 4Y92A 1GBQA 1ZUUA 4F14A 2EYZA 2A08A 2BTTA 2M0YA 1NYFA 3EG0A 1OV3A 3TSWA 1AWXA 2F2XA 3THKA 1NLPC 1YNZA 2KYBA 4J9BA 3M0PA 1W6XA 2JS0A 5HCKA 2X3XD 1YP5A 1K9AA 1AWJA 1UJ0A 2E5KA 1WIEA 4J9EA 4ORZA 4LUDA 2J06A 4JJDA 1RLQC 2PNIA 2VWFA 2K3BA 2G6FX 3ULRB 4J9DA 1X2KA 2DLPA 2DL8A 1T0HA 2KBTA 3EHRA 4OMNA 4RTXA 4JPBW 4HXJA 2LP5A 4GBQA 2KYMA 3NHNA 4F16A 2KROA 1OPLA 3CQTA 2B86A 2HSPA 3IQLA 2CREA 2CDTA 4RTYA 2VKNA 4GLMA 2MIOA 2A28A 1X69A 1PKSA 1JEGA 2K9GA 2DMOA 2JMCA 2KT8A 1B3QA 4OMMA 2A36A 3R6NA 1RI9A 4EIKA 2CH4W 2GTJA 5I11A 5GJWB 4AFUC 2L3PA 1T0JA 2RQUA 2DX1A 1KSWA 2RPNA 4J9CA 2ED1A 5FWBA 1WX6A 1JQQA 1MUZA 2YUQA 2O9VA 1ABOA 3M0QA 1UTIA 3NPFA 1WLPB 5IH2A 3ZL7C 2AZSA 1UHFA 1MV3A 2KNBB 3VS4A 1GRIA 3UA6A 1PRMC 1U3OA 1T3SA 2H8HA 1SPKA 2DRKA 2DM1A 3I5SA 2DNUA 2J6KA 2EYWA 2KXDA 5L23A 2GQIA 1H92A 3UA7A 4E6RA 1ZBJA 2KXCA 1AWWA 1JXMA 3EG2A 1MV0B 2QDLA 3QWXX 2K7AA 4HCKA 3REBB 2LJ1A 2D8JA 2RF0A 2EYYA 4AFZC 1UE9A 4D8DA 1JXOA 1M30A 2FPFA 2O2OA 2EYXA 2GGRA 2RMOA 3TVTA 1ABQA 4M4ZA 3H41A 4WCIA 2D0NA 2BZYA 3PVLA 1K0SA 1AOJA 2X3WD 4J9GA 4RUGA 2NUZA 3PE0A 5IHIA 2L3SA 2I0NA 1WXTA 1M27C 4J9HA 2NWMA 4CC7A 1JU5C 4J9IA 4DEXA 2DF6A 1WYXA 2AKKA 2EKHA 1NG2A 3SHWA 2HBWA 2FO0A 2JT4A 2KEAA 2EBPA 4FSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O88 A;  2LZ6 B;  1NLO C;  1WFW A;  1X6G A;  1GL5 A;  4RTT A;  2HDA A;  4QT7 A;  1SHF A;  3REA B;  1QWE A;  5FW9 A;  4JZ4 A;  1TUD A;  3M0R A;  2A37 A;  3I9Q A;  1WA7 A;  2FEI A;  1I07 A;  2FG0 A;  1SEM A;  5GJV B;  1PRL C;  4LNP A;  3UAT A;  1QKW A;  1YWO A;  2K2M A;  1VA7 A;  2XMF A;  1OEB A;  1ZSG A;  1UFF A;  1NYG A;  2MCN A;  4R0K A;  1SRM A;  4JZ3 A;  2SEM A;  1YCS B;  3M0U A;  4IIM A;  2JTE A;  4CC2 A;  1ZLM A;  1M3A A;  1JO8 A;  1UEC A;  3EG1 A;  1H3H A;  2ED0 A;  3LH5 A;  2CSQ A;  1M3C A;  5FWC A;  3VS3 A;  5IXF A;  4LN2 A;  3TSZ A;  1X6B A;  1QCF A;  1OPK A;  1LCK A;  2OAW A;  2LJ0 A;  1ZX6 A;  1N5Z A;  3VS2 A;  1G83 A;  1WXU A;  3GBQ A;  4AFQ C;  2EW3 A;  1K1Z A;  1E6G A;  1XOV A;  2DVJ A;  3RNJ A;  4HVV A;  2PZ1 A;  1FMK A;  1K4U S;  4OMP A;  1EFN A;  1NM7 A;  2LNH B;  2M51 A;  1SRL A;  2YUO A;  4F17 A;  2JW4 A;  1TUC A;  1K0X A;  1YN8 A;  1VYV A;  2YDL A;  2J6F A;  1AZE A;  2YSQ A;  1AVZ C;  1RLP C;  2SRC A;  5ECA A;  3U23 A;  1U5S A;  2JS2 A;  4HVU A;  3VRY A;  2KRS A;  3H0I A;  2OJ2 A;  1QWF A;  2OI3 A;  2ESW A;  3EHQ A;  1PWT A;  2LQN A;  4ESR A;  4OML A;  1I1J A;  2MOX A;  3O5Z A;  4JJB A;  1H8K A;  1BB9 A;  2DBK A;  1M3B A;  1PHT A;  2IIM A;  1X43 A;  2RNA A;  1HSQ A;  2BZ8 A;  2V1Q A;  1Z9Q A;  4RTZ A;  3NGP A;  2KE9 A;  4CC4 B;  2FPD A;  1QKX A;  2LQW A;  2CT3 A;  2CUB A;  2DL3 A;  1WXB A;  1W1F A;  2DIL A;  2W10 A;  2LMJ A;  2GBQ A;  1SSH A;  2D8H A;  3VS6 A;  2JMA A;  2JM9 A;  4RTW A;  2DL4 A;  2GNC A;  3VS7 A;  2DL7 A;  2EVR A;  2YT6 A;  3I5R A;  4J9F A;  2F2W A;  4JJC A;  1OOT A;  2LJ3 A;  4CC3 A;  3VRZ A;  1S1N A;  3FJ5 A;  1GFC A;  1WDX A;  1GBR A;  3SEM A;  2GTO A;  2KRN A;  2P4R A;  4IIO A;  1Y0M A;  4AG1 C;  1VYU A;  2EPD A;  2ECZ A;  1X27 A;  2DRM A;  2L2P A;  2LX7 A;  1UGV A;  1A0N B;  1GCQ C;  2RQW A;  1CSK A;  2AKL A;  2EGC A;  2D1X A;  2RN8 A;  2FPE A;  4AFS C;  2V1R A;  1UG1 A;  3A98 A;  4Z89 A;  5I22 A;  2JM8 A;  2ABL A;  4RTV A;  1PKT A;  1QLY A;  1V1C A;  2VVK A;  1AD5 A;  1BBZ A;  2EGA A;  1E7O A;  4D8K A;  1AWO A;  1W70 A;  1NEB A;  1E6H A;  1X2Q A;  2HCK A;  3KFV A;  4A63 B;  3M0S A;  1BK2 A;  1SHG A;  3VS5 A;  5EC7 A;  1ZUK A;  2KGT A;  4KRT A;  4X1V A;  5IHK A;  1IO6 A;  2K79 A;  1CKA A;  1RUW A;  1PNJ A;  2CH4 A;  4HVW A;  1FYN A;  1UJY A;  2CT4 A;  2J7I A;  1HD3 A;  3EGU A;  2BZX A;  2YUN A;  1ARK A;  1UUE A;  3UF4 A;  3VS1 A;  2KR3 A;  2L0A A;  1AZG B;  2DE0 X;  2DJQ A;  2W0Z A;  1TG0 A;  3I35 A;  2CUD A;  2RQV A;  2DA9 A;  1NEG A;  3RBB B;  2L3Q A;  1GCP A;  1T3L A;  2K6D A;  2RQT A;  2YUP A;  4OMO A;  2J05 A;  4Z88 A;  3EG3 A;  1J3T A;  1UDL A;  2HEQ A;  2C0T A;  1VYT A;  4RTU A;  2J6O A;  2C0I A;  1Z9Z A;  4K11 A;  2FRW A;  4LE9 A;  4LUE A;  2DL5 A;  2AZV A;  1ZUY A;  2DBM A;  1M8M A;  2O31 A;  1B07 A;  3M0T A;  1GFD A;  3C0C A;  4ZNX A;  1KJW A;  2CSI A;  2LCS A;  1AEY A;  1G2B A;  2FRY A;  3PVQ A;  3QWY A;  2KT1 A;  1YWP A;  2ENM A;  1HJD A;  1I0C A;  3VS0 A;  2C0O A;  2EGE A;  5IHN A;  4AG2 C;  3H0H A;  2JXB A;  2DYB A;  4DEY A;  5IXB A;  1CKB A;  2PTK A;  1BU1 A;  2KRM A;  2O9S A;  1U06 A;  2AK5 A;  2F2V A;  2EQI A;  2RQR A;  1Y57 A;  2ROL A;  1KFZ A;  4OMQ A;  1GCQ A;  2ROT A;  1WI7 A;  1K76 A;  1UHC A;  3JV3 A;  3NMZ C;  3H0F A;  1KIK A;  4Z8A A;  4Y92 A;  1GBQ A;  1ZUU A;  4F14 A;  2EYZ A;  2A08 A;  2BTT A;  2M0Y A;  1NYF A;  3EG0 A;  1OV3 A;  3TSW A;  1AWX A;  2F2X A;  3THK A;  1NLP C;  1YNZ A;  2KYB A;  4J9B A;  3M0P A;  1W6X A;  2JS0 A;  5HCK A;  2X3X D;  1YP5 A;  1K9A A;  1AWJ A;  1UJ0 A;  2E5K A;  1WIE A;  4J9E A;  4ORZ A;  4LUD A;  2J06 A;  4JJD A;  1RLQ C;  2PNI A;  2VWF A;  2K3B A;  2G6F X;  3ULR B;  4J9D A;  1X2K A;  2DLP A;  2DL8 A;  1T0H A;  2KBT A;  3EHR A;  4OMN A;  4RTX A;  4JPB W;  4HXJ A;  2LP5 A;  4GBQ A;  2KYM A;  3NHN A;  4F16 A;  2KRO A;  1OPL A;  3CQT A;  2B86 A;  2HSP A;  3IQL A;  2CRE A;  2CDT A;  4RTY A;  2VKN A;  4GLM A;  2MIO A;  2A28 A;  1X69 A;  1PKS A;  1JEG A;  2K9G A;  2DMO A;  2JMC A;  2KT8 A;  1B3Q A;  4OMM A;  2A36 A;  3R6N A;  1RI9 A;  4EIK A;  2CH4 W;  2GTJ A;  5I11 A;  5GJW B;  4AFU C;  2L3P A;  1T0J A;  2RQU A;  2DX1 A;  1KSW A;  2RPN A;  4J9C A;  2ED1 A;  5FWB A;  1WX6 A;  1JQQ A;  1MUZ A;  2YUQ A;  2O9V A;  1ABO A;  3M0Q A;  1UTI A;  3NPF A;  1WLP B;  5IH2 A;  3ZL7 C;  2AZS A;  1UHF A;  1MV3 A;  2KNB B;  3VS4 A;  1GRI A;  3UA6 A;  1PRM C;  1U3O A;  1T3S A;  2H8H A;  1SPK A;  2DRK A;  2DM1 A;  3I5S A;  2DNU A;  2J6K A;  2EYW A;  2KXD A;  5L23 A;  2GQI A;  1H92 A;  3UA7 A;  4E6R A;  1ZBJ A;  2KXC A;  1AWW A;  1JXM A;  3EG2 A;  1MV0 B;  2QDL A;  3QWX X;  2K7A A;  4HCK A;  3REB B;  2LJ1 A;  2D8J A;  2RF0 A;  2EYY A;  4AFZ C;  1UE9 A;  4D8D A;  1JXO A;  1M30 A;  2FPF A;  2O2O A;  2EYX A;  2GGR A;  2RMO A;  3TVT A;  1ABQ A;  4M4Z A;  3H41 A;  4WCI A;  2D0N A;  2BZY A;  3PVL A;  1K0S A;  1AOJ A;  2X3W D;  4J9G A;  4RUG A;  2NUZ A;  3PE0 A;  5IHI A;  2L3S A;  2I0N A;  1WXT A;  1M27 C;  4J9H A;  2NWM A;  4CC7 A;  1JU5 C;  4J9I A;  4DEX A;  2DF6 A;  1WYX A;  2AKK A;  2EKH A;  1NG2 A;  3SHW A;  2HBW A;  2FO0 A;  2JT4 A;  2KEA A;  2EBP A;  4FSS A; 
#chains in the Genus database with same CATH topology
 4J6X A;  3OYG A;  4C0Z A;  3G6E A;  3OSV A;  4PLI A;  4ELZ C;  2HDA A;  1SF9 A;  5FW9 A;  4JZ4 A;  3WXM B;  2A37 A;  5KH6 A;  1WJR A;  1QCN A;  2FEI A;  4EDU A;  2FG0 A;  2XI9 A;  3RIR A;  1PRL C;  3G71 T;  5L8R E;  1QKW A;  5D6Y A;  3BE3 A;  3OYY A;  1VA7 A;  2O01 E;  3JCM c;  1OEB A;  3CCQ Q;  5CO7 A;  4MML A;  2GFA A;  2EWN A;  1VQP Q;  2Y4X A;  3I56 A;  4PJO A;  4LDV A;  2KY9 A;  3ME9 A;  1SRM A;  2DFU A;  3LWI A;  3M56 A;  3A8H B;  3JCM g;  3M0U A;  1M2O A;  4BE1 A;  3JB9 G;  1YHQ A;  2E70 A;  1W2B A;  1K8A U;  4ME7 A;  3QPH A;  1M3A A;  2XDD A;  1U8R A;  2VGN A;  1JO8 A;  2RJD A;  2RHZ A;  3LH5 A;  2CSQ A;  1K8A R;  5FWC A;  2K3Y A;  4LN2 A;  3TSZ A;  4PFZ A;  3TCJ A;  1LCK A;  2OAW A;  4NL2 A;  3I55 T;  1RI0 A;  2BE9 B;  2LCL A;  5D6X A;  3L42 A;  1WJQ A;  3GBQ A;  7AT1 B;  1RAE B;  2RHU A;  2HQH A;  5DY9 A;  2DJZ A;  1XOV A;  4BE2 A;  1EFN A;  2QA4 A;  3J81 E;  4F17 A;  2JW4 A;  1K73 C;  4XTY A;  5CVI A;  2O4X B;  3EH2 A;  2VXE A;  2YDL A;  3QYH B;  3O8V A;  4A53 A;  4FSX A;  2DXU A;  5KCH A;  3LGL A;  4BI3 A;  2DXB A;  1N9S A;  3VRY A;  2F5T X;  2OJ2 A;  2HBP A;  2OI3 A;  5GAO q;  3EHQ A;  4EMK B;  1P92 A;  2LX9 A;  3E1S A;  5LJ3 j;  3G4S T;  3JCM J;  1WHK A;  1BB9 A;  4PLL A;  1M3B A;  2IIM A;  4A4F A;  1X43 A;  3G71 A;  5J3B A;  1O9S A;  1VQM T;  2L8D A;  1QKX A;  2CT3 A;  3VUZ A;  1SG5 A;  2CUB A;  4KUD K;  2DZ9 A;  1VQK T;  3MP1 A;  6AT1 B;  3A8O B;  4JRK A;  4J83 A;  3CD6 A;  2FHD A;  1QMC A;  2LQ8 A;  3RKX A;  3VRZ A;  1K8A C;  3CXC P;  4J8O A;  3HKS A;  2LT4 A;  3QZ5 B;  1VIF A;  4M75 E;  2L2P A;  3I55 A;  4M77 C;  1GCQ C;  3CCJ T;  1CSK A;  2KAF A;  3RKY A;  4R55 A;  2O4X A;  2RN8 A;  1Q81 C;  5I22 A;  3PIO A;  2MI6 A;  2QG9 B;  1G3T A;  5CIU A;  4C92 C;  2VVK A;  2RHI A;  4M7D C;  1HK9 A;  3CCR Q;  1TTH B;  1BBZ A;  1VQ9 Q;  5A0D A;  2COY A;  1NE8 A;  9ATC B;  5C6S A;  2HCK A;  4EMK A;  3M0S A;  4ZN3 A;  1BK2 A;  4C0D C;  1Q86 U;  3LYI A;  2DET A;  4X1V A;  3M5A A;  4BI8 B;  3OS5 A;  2K79 A;  1OZ2 A;  3JB9 I;  5GMK m;  1FYN A;  1UJY A;  4N4H A;  2CT4 A;  1HD3 A;  3EGU A;  4XTV A;  2QXF A;  2BZX A;  1RAG B;  3MPU B;  5M9O A;  2PVD B;  3VJP A;  3MCA B;  5IAY A;  3G4S A;  2Y4Y A;  1H3Z A;  2CKK A;  2L3Q A;  1T3L A;  4FW2 A;  3CME Q;  1VQM A;  4B6M A;  4CRI A;  3OS0 A;  2HEQ A;  2QTX A;  1VYT A;  1XNI A;  2J6O A;  2P0K A;  1UGS B;  2C0I A;  3E2U A;  3MP8 A;  2DIG A;  4OB0 B;  4FM4 B;  2AIR B;  4OVA A;  5D7U A;  2AZV A;  2CYZ B;  4XK8 E;  1G3W A;  2DBM A;  2O31 A;  3M0T A;  3QUI A;  3DLL A;  5GAM f;  3QJ6 A;  2RI3 A;  5AT1 B;  2GF7 A;  4AT1 B;  1KHC A;  1KJW A;  2CSI A;  5GMK i;  1OX8 A;  1WPY A;  1TH7 A;  2QQS A;  3QDR B;  4RG8 A;  2QGG A;  3R6O A;  4XAX B;  2FRY A;  3PVQ A;  2MAM A;  3CCJ A;  1VQP T;  1YWP A;  4E7J A;  3JB9 J;  4N4I A;  1HJD A;  2QEX Q;  3OYI A;  3OYC A;  2CS7 A;  2CP5 A;  2QQA A;  5LL6 S;  2EGE A;  3RR6 A;  1RAD B;  2E3H A;  4M77 E;  4QW2 A;  4OGC A;  2K2V A;  4JS5 A;  2KRM A;  2PU9 B;  3QZ9 B;  3HRU A;  1Y57 A;  4C92 E;  1WI7 A;  4M7D E;  3GIB A;  4MMK A;  1RAF B;  3S6W A;  2AHJ B;  5I21 A;  2K4Y A;  4Y92 A;  3MEU A;  2E10 A;  3RES A;  4F14 A;  3VUB A;  3PFS A;  2A08 A;  3G1J A;  1NYF A;  3OW2 S;  3EG0 A;  1VQ6 Q;  2DZC A;  2E5Q A;  4C8Q E;  1AWX A;  4HT8 A;  2COW A;  4J5Y A;  1W6X A;  3CPF A;  1NPP A;  2E1H A;  2X3X D;  3GF5 A;  1BKB A;  2QAS A;  1K9A A;  1I5O B;  4JS4 A;  2XD0 A;  1WIE A;  3ER0 A;  2HKN A;  3V7C A;  4NOY A;  1AHJ B;  3ULR B;  3FRN A;  1X2K A;  1T0H A;  1SSF A;  5GAN f;  1UGP B;  4JPB W;  3HPW A;  2LP5 A;  1OPL A;  2HSP A;  3IQL A;  3QSU A;  4PK4 A;  4GLM A;  3OA6 A;  2MIO A;  1X69 A;  5CAI A;  2K9G A;  2KT8 A;  1RI9 A;  2GQV A;  4PNO A;  1VQP A;  2XKO C;  2P0Q A;  2CP7 A;  1TSF A;  4IUR A;  3BW1 A;  3S3M A;  2ED1 A;  1M1G A;  1WX6 A;  2LTO A;  1JJ2 P;  4II1 A;  1WHM A;  2XDB A;  5LJ3 e;  1ABO A;  3ZL7 C;  2AZS A;  3L2V A;  1MV3 A;  5KYW B;  3JCM P;  1C6V X;  5LJ5 j;  2MMP A;  1MGQ A;  4XTU A;  2H8H A;  1YCY A;  1D3B B;  4FW1 A;  1YBY A;  4PFP A;  5KCO A;  2KK4 A;  2ZPB B;  3I5S A;  5IN1 A;  4C0G A;  1PSF A;  4RMO A;  2GQI A;  3UA7 A;  1ZBJ A;  1EZZ B;  4XU3 A;  2DO3 A;  2LVM A;  3D7S B;  4TVR A;  3CCR T;  1VQ9 T;  5J39 A;  1MV0 B;  4N0A C;  3REB B;  2D8J A;  1MMN A;  2ZCF B;  5KE3 A;  4D8D A;  3I55 Q;  3FEO A;  1M30 A;  1W2B P;  2O2O A;  3QKJ A;  2RMO A;  2KDS A;  3UDC A;  2QAZ A;  3BY7 A;  3UWN A;  3CPW S;  2JOY A;  2L3S A;  3OW2 A;  4CC7 A;  1JU5 C;  4J9I A;  1KQ1 A;  3M53 A;  1VQL Q;  3AHU A;  2AKK A;  1NG2 A;  2HBW A;  3QYG B;  1PSE A;  2JT4 A;  3ZFJ A;  2O88 A;  3CME T;  1UB4 A;  1X6G A;  1GL5 A;  4RTT A;  4QT7 A;  5LJ3 h;  3REA B;  5KYW A;  3I9Q A;  5GAO m;  5C0M A;  1RAA B;  3JB9 H;  3GPL A;  3PNW C;  1SEM A;  1JB0 E;  5GJV B;  4CI0 C;  4LNP A;  4ZGJ B;  2DEU A;  1D1B A;  2PVO B;  2DKG A;  1D3B A;  4M7A F;  2XMF A;  4OP0 A;  3VYH B;  3MKD A;  2IG0 A;  3CEY A;  4M75 A;  2LDM A;  2IVW A;  3M58 A;  4M78 F;  1YCS B;  1N8R U;  3FC3 A;  2LQK A;  2JTE A;  4M77 G;  1QVF P;  2OX7 A;  4Q5W A;  5LJ3 d;  1VQK Q;  1UEC A;  5GAN 7;  1H3H A;  2V8J A;  3GLX A;  1N8R R;  1M3C A;  1TXQ A;  4E7H A;  1MHN A;  4C92 G;  3J7A F;  4M7D G;  3OYJ A;  3CCR A;  3M4Y A;  1VQ9 A;  1RAI B;  4LD9 K;  2EQK A;  3VS2 A;  1G83 A;  5CKH A;  1WXU A;  2XHC A;  4JLI A;  4M77 B;  2XU8 A;  2EW3 A;  5KYU B;  1E6G A;  2DVJ A;  3RNJ A;  2MYS A;  3FB9 A;  1FMK A;  1NJI U;  4OMP A;  2ZPH B;  2K57 A;  3KUF A;  1GXI E;  2DK3 A;  2M51 A;  1SRL A;  3A8L B;  4C8Q G;  4C92 B;  2K3X A;  4M7D B;  1TUC A;  2R5M A;  4PKC C;  3P8D A;  5FRO A;  4C5G A;  4LDU A;  1NJI R;  1IB8 A;  1VYV A;  1AZE A;  5LJ5 g;  5GAO p;  2SRC A;  5ECA A;  3JSC A;  2FZC B;  2NUP A;  4LDX A;  1PCX A;  4C0D B;  4DBF A;  1U5S A;  2GFU A;  4FU6 A;  3CME A;  1QWF A;  3CC7 Q;  4M7A D;  2LQN A;  4JRQ A;  1M1K U;  2EYQ A;  4OML A;  2MOX A;  1W4S A;  1BCM A;  1FX7 A;  1H8K A;  2DBK A;  4BD3 A;  4M78 D;  3GOX A;  1PHT A;  4FYY B;  5GAN 2;  3OYN A;  1YIT Q;  3VKI A;  1M1K R;  2RO0 A;  3P8B B;  2BZ8 A;  1Z9Q A;  1QQJ A;  3BDU A;  2FPD A;  2EIF A;  1Q95 G;  4GY5 A;  2E6Z A;  3INZ A;  1WXB A;  1Y96 A;  2DIL A;  4B9W A;  1U1S A;  2LMJ A;  2GBQ A;  1SSH A;  3VS6 A;  2JM9 A;  3CBM A;  4XU0 A;  2EAY A;  2R57 A;  2DL4 A;  3WVE B;  2GNC A;  2DL7 A;  2YT6 A;  3I5R A;  2QEX A;  4J9F A;  2F2W A;  1EIF A;  1OOT A;  4CC3 A;  1N8R C;  3FJ5 A;  4M77 A;  2HKQ B;  3SEM A;  2P4R A;  1JRI A;  2AT1 B;  2PUO B;  2DER A;  2ECZ A;  1X27 A;  3SB2 A;  2LX7 A;  1UGV A;  3T9N A;  2RQW A;  4BDY A;  3HFN A;  2DIQ A;  4C92 A;  2CZ1 B;  4M7D A;  1LVK A;  2EGC A;  2CZ0 B;  2D1X A;  4AFS C;  3H6Z A;  2XG8 D;  4Z89 A;  2JM8 A;  4M75 D;  4RTV A;  1PKT A;  2R5A A;  1AD5 A;  4D8K A;  1IHW A;  4PJN A;  2JVV A;  1W70 A;  1XJW B;  1NJI C;  4C8Q A;  1SHG A;  3ZBD A;  3QXE B;  5EC7 A;  1VQ6 A;  1WNL A;  1ZUK A;  2KGT A;  4KRT A;  3V7R A;  4DOV A;  5IHK A;  3X28 B;  4HVW A;  1RUW A;  2DXT A;  1I8F A;  5LJ5 e;  1Q81 U;  3OYK A;  1ARK A;  2EJG A;  3A1P A;  1UUE A;  3C94 A;  3UF4 A;  2EQM A;  2KR3 A;  1AZG B;  1TG0 A;  2E64 A;  3I35 A;  2FB7 A;  1MMG A;  5FRM A;  1B7T A;  1Q81 R;  4JJN K;  1M1K C;  1D0Z A;  8ATC B;  4Z88 A;  1TWB A;  1VQL T;  4WTO B;  3QO3 A;  2LRQ A;  4JLG A;  1R0B G;  3P8H A;  2WSF E;  1Z9Z A;  2WAC A;  4PJO F;  2E65 A;  3QG1 A;  4LUE A;  2X4W A;  3SWN C;  2FZG B;  1ZUY A;  1QVF A;  1TU0 B;  1WZO A;  2QYZ A;  3S3N A;  4ZNX A;  4MZT A;  1VQN Q;  1N27 A;  2HD0 A;  1FMW A;  3LGF A;  2G3R A;  2BKD N;  1VQ8 Q;  4BI4 A;  4X34 A;  2KT1 A;  2ENM A;  2VXF A;  3LWH A;  2P0P A;  2DVE A;  1I0C A;  2C0O A;  2VGM A;  4A4K A;  4XTZ A;  5CCA A;  4LDY A;  2DYB A;  4DEY A;  5IXB A;  4HCB A;  3JCM V;  1BU1 A;  5LJ5 h;  1U06 A;  3EGX B;  2AK5 A;  1S72 Q;  2OTJ T;  1VQ7 T;  2JJ9 A;  3JCM e;  1KFZ A;  1D1A A;  4OMQ A;  4OB1 B;  4M77 D;  1K76 A;  1XTD A;  3HRT A;  4RKU E;  3JV3 A;  3Q1J A;  4ANJ A;  4Z8A A;  3QBY A;  1GBQ A;  2EYZ A;  4ZGD B;  5GMK j;  4ZTJ A;  2F5K A;  2M0Y A;  1VQ5 Q;  2L5Q A;  1YJN Q;  4PJO D;  1PD0 A;  5LJ5 d;  3RER A;  1I4K 1;  3TSW A;  1VQL A;  3M0P A;  1B34 B;  4A54 A;  1TOV A;  2JS0 A;  2HMA A;  4FT2 A;  1YP5 A;  2JTF A;  4LUD A;  2J06 A;  2PNI A;  4C8Q D;  1UGQ B;  3CC7 T;  4MZM A;  1WHH A;  1D1C A;  2G6F X;  4OMN A;  2DL8 A;  1MND A;  3PMT A;  3CC2 Q;  2DXC A;  4GBQ A;  1M1F A;  3CQT A;  2CRE A;  1YIT T;  2EJ9 A;  2NYS A;  1JEG A;  1YJ9 Q;  2DMO A;  2Z0W A;  3CCM Q;  2BE7 D;  2CH4 W;  3C12 A;  4AFU C;  3EGX A;  1T0J A;  4MDX A;  2DX1 A;  1KSW A;  2RPN A;  1QVG P;  3JCM h;  1H64 1;  5CKB A;  4J9C A;  5FWB A;  5FU7 C;  2FL7 A;  1TS9 A;  1VQK A;  1MUZ A;  3OW2 P;  2YUQ A;  5HY6 A;  2ZPI B;  1UTI A;  1X01 A;  1WLP B;  5IH2 A;  1IHV A;  2MWO A;  2X9H A;  3VS4 A;  3ZEH A;  5CKE A;  1VQ7 A;  4PFO A;  4PJL A;  1PRM C;  2HL3 A;  4HCZ A;  4KBM B;  5GAM g;  4HT9 A;  3FIF A;  4BB7 A;  1SPK A;  2DRK A;  2DM1 A;  4ZGE B;  2DNU A;  5GAO r;  2FZK B;  3RMQ A;  3OYH A;  4PJM A;  3OYF A;  1H92 A;  1B34 A;  3M9Q A;  4E6R A;  3JCM d;  1LOJ A;  4RG2 A;  2YLC A;  3LW5 E;  3CCL T;  1JXM A;  2M1H A;  3OB9 A;  4HCK A;  4J7F A;  5I2S A;  1M4Z A;  1JXO A;  2XIC A;  3MO8 A;  3TEE A;  1YIJ Q;  3BDL A;  5LJ3 f;  1ABQ A;  4WCI A;  1V29 B;  3JB9 D;  2D0N A;  2BZY A;  1PD1 A;  3PVL A;  3CC7 A;  1Q82 C;  1YI2 Q;  2V8I A;  5HK3 A;  1M27 C;  4J9H A;  2NWM A;  1MNE A;  2M02 A;  3SHW A;  2RK2 A;  1QVG S;  2E12 A;  5GAN 5;  1YIT A;  4FSS A;  3OSS C;  2PVG B;  1ZA2 B;  1WFW A;  1SHF A;  1QWE A;  1ACM B;  1SKU B;  2I2L A;  1TUD A;  3M0R A;  4D6W A;  4PL6 A;  1BI1 A;  1WA7 A;  1I07 A;  2KQW A;  3HSB A;  1ZSG A;  1UFF A;  2RHY A;  3VYG A;  3MJX A;  2MCN A;  1VQN T;  3OYM A;  1IXD A;  2SEM A;  2XK0 A;  3M4G A;  4C5I A;  4L5G A;  1VQ8 T;  4F04 B;  3OYL A;  1ZLM A;  3SD4 A;  3L2Q A;  1KK7 A;  3EFS A;  3PT9 A;  1VQ4 Q;  3EG1 A;  3CPW P;  2XID A;  3A8G B;  1X6B A;  1QCF A;  1IZ6 A;  1FWZ A;  1RL2 A;  4OB2 B;  1M9S A;  4JDS A;  4HKE A;  3CCL A;  3MP6 A;  3MET A;  2LJ0 A;  4ELY C;  2ZPE B;  1N5Z A;  1S72 T;  4AFQ C;  1K1Z A;  2DAQ A;  3MEW A;  5AYF A;  1NM7 A;  5CK9 A;  2HAX A;  4OF1 A;  1K0X A;  2D0Q B;  2J6F A;  2YXY A;  2YSQ A;  1AVZ C;  1RLP C;  4ZTF A;  1M5Q 1;  3NTK A;  1VQ5 T;  3QJY A;  4X9D A;  1WHJ A;  1YJN T;  4DBR A;  2A7Y A;  4FYW B;  2JS2 A;  1LNX A;  2KRS A;  3H0I A;  2ESW A;  1PWT A;  2LT1 A;  1XQH A;  4NS5 A;  4ESR A;  1I1J A;  1OQK A;  4HCC A;  1G5V A;  4JJB A;  1BIB A;  3X26 B;  3WVD B;  3MEV A;  3CC4 Q;  3QDF A;  1C0M A;  2RNA A;  1HSQ A;  3CC2 T;  1QVG A;  2V1Q A;  2X4J A;  2JUF A;  5EG2 A;  5GMK e;  2LQW A;  2VYT A;  3EFO B;  3NTI A;  2DL3 A;  1VQN A;  4ATO A;  3MEA A;  1W1F A;  2MF2 A;  2W10 A;  5KYY B;  3CCE Q;  4A4E A;  4FIB A;  1YJ9 T;  2DEQ A;  2DD4 A;  3NTH A;  1VQ8 A;  3DB3 A;  3CCM T;  1OU9 A;  1IRE B;  3PTA A;  2EVR A;  2LJ3 A;  3SWN B;  4E7K A;  2JN0 A;  1WDX A;  1GBR A;  2GTO A;  4QKU A;  4EMG A;  4AG1 C;  1VYU A;  2EPD A;  3OS2 A;  3FJP A;  1BI3 A;  3M59 A;  1Y7X A;  1RAH B;  1S72 A;  3OYD A;  2QDY B;  2FPE A;  2CP0 A;  4JRP A;  1UG1 A;  2RHX A;  4XQ3 A;  3A98 A;  2VB6 A;  2P84 A;  2ABL A;  1QLY A;  1FXX A;  5GMK l;  4YTL A;  3L2R A;  5A0L A;  3M54 A;  3PGG A;  4DBH A;  2LCC A;  1E6H A;  1X2Q A;  2QQB A;  3KFV A;  1V76 A;  1KC8 U;  1KQS P;  4A63 B;  1WJS A;  3CMA Q;  1VQ5 A;  2D6F A;  1YJN A;  1M90 U;  2OTJ Q;  1VQ7 Q;  4Y91 A;  2CH4 A;  1PNJ A;  3CCV T;  3FLG A;  1KC8 R;  2ZAE A;  3H8Z A;  2YUN A;  5GMK h;  1M90 R;  3S3O A;  1YIJ T;  2W0Z A;  1R8O B;  4QVZ A;  5J26 A;  2RQV A;  1NEG A;  3HRS A;  4DA4 A;  1YI2 T;  2YUP A;  3CCS Q;  3CC2 A;  3G7Z A;  2FVU A;  2MWP A;  3SWN A;  3OBW A;  1YJ9 A;  5DLO A;  4M75 F;  1WQ7 A;  3CCM A;  1M8M A;  1DJ7 B;  5GAN 3;  2DPP B;  2M0O A;  1M2V B;  1YHQ T;  5A2Q E;  3CPW A;  1NPR A;  2LCS A;  5LJ5 f;  4NL3 A;  3FDR A;  2ZPF B;  2YWW A;  3UPU A;  3OY9 A;  3DLM A;  4V2S A;  2K5L A;  4F7U F;  5CR2 A;  1KD1 U;  4FL6 A;  3VS0 A;  1KQS S;  3UT1 A;  1YFN A;  3TRE A;  4AG2 C;  3V8J A;  3H0H A;  1VQ4 T;  3LX7 A;  1KD1 R;  4BUG A;  5FU7 B;  3HHT B;  4M7A C;  2MPX C;  2F2V A;  2GCX A;  4BE0 A;  2RQR A;  2EFI A;  1BIA A;  2ROL A;  4J6Y A;  1GCQ A;  4M78 C;  2X51 A;  5KYU A;  1ZSZ C;  2RM4 A;  1IGQ A;  4EMH A;  3CCV A;  3SDZ A;  3H0F A;  1KC8 C;  1KIK A;  2E3I A;  3M57 A;  1M90 C;  1YIJ A;  1ZUU A;  2HZY A;  2BTT A;  4E2F B;  5KE2 A;  4XTW A;  1YI2 A;  3LH0 A;  3CCU Q;  3THK A;  2LNV A;  2RI5 A;  2YLB A;  3OYB A;  1YNZ A;  4IUQ A;  1VUB A;  2KYB A;  3CCL Q;  2XDP A;  1M2V A;  4IUV A;  4X9C A;  1BI0 A;  4J9E A;  2E5K A;  1RAB B;  3BFM A;  4OMF B;  2K3B A;  2DLP A;  3JCM f;  4R56 A;  2KBT A;  3EHR A;  3HP9 A;  2DYI A;  4BDZ A;  4HXJ A;  4EPC A;  2C06 A;  2EQU A;  3URG A;  2NUT B;  2V26 A;  2ZZD A;  3CC4 T;  2CDT A;  4M75 C;  4RTY A;  2OAU A;  4FYX B;  2A0F B;  2VKN A;  4DBQ A;  3CD6 T;  2A28 A;  4M77 F;  1PKS A;  1B3Q A;  4AMC A;  4KGZ B;  1PM3 A;  2GTJ A;  2EJF A;  4QQG A;  3HFO A;  3CCE T;  2RA2 A;  4C92 F;  4M7D F;  3L2Z A;  1VQ4 A;  2ATC B;  2HSE B;  5GAM j;  1KD1 C;  1VQO Q;  4KH0 B;  2O9V A;  4XU2 A;  2P4T A;  4E7S A;  1I5L A;  1HXD A;  2KNB B;  1KHI A;  3UA6 A;  1LJO A;  1T3S A;  2YRV A;  1KQS A;  5DM7 R;  3EG9 B;  3V7S A;  4C8Q F;  4M7A E;  2J6K A;  2KXD A;  5L23 A;  1BCO A;  3CBO A;  3NFC A;  4C5E A;  4M78 E;  4KUI A;  1AWW A;  1AT1 B;  3EG2 A;  3E9F A;  2LJ1 A;  2EYY A;  4AFZ C;  2COZ A;  1UE9 A;  1QP3 A;  3CMA T;  1K9M U;  1N9R A;  2QGF B;  4IUP A;  2GGR A;  3PIP A;  3TVT A;  2NUT A;  4M4Z A;  5KYN A;  1UEB A;  2A3L A;  1K0S A;  3QHS A;  1K9M R;  1C1A A;  4E7I A;  4IKF A;  4J9G A;  1X75 C;  2NUZ A;  3PE0 A;  1LPL A;  2H3E B;  2BUD A;  2EQJ A;  4DEX A;  5GAO l;  2DF6 A;  4RCC A;  1M8V A;  1WYX A;  2EKH A;  1Q7Y U;  4FYV B;  2FO0 A;  3CC4 A;  3X20 B;  2EBP A;  2E41 A;  4C92 D;  3CCS T;  2LZ6 B;  4M7D D;  1NLO C;  2CP2 A;  3OQ5 A;  4L6V 5;  1Q7Y R;  2F1L A;  1OYX A;  1OU8 A;  3HL8 A;  3CCE A;  1Q82 U;  4DQ2 A;  1IGU A;  3UAT A;  1YWO A;  5GAN j;  2RK1 A;  2K2M A;  4OGE A;  3EG9 A;  5FU6 B;  3JRZ A;  1Q82 R;  3C95 A;  4KGV B;  1NYG A;  2H3J A;  3F70 A;  4R0K A;  4BAC A;  2VC8 A;  4JZ3 A;  4IIM A;  4IUU A;  3RUX A;  4CC2 A;  5A0G A;  4F7U E;  2YHT A;  3JB9 F;  4PJO C;  1F1B B;  2ED0 A;  2IPO B;  2L3R A;  3EGD B;  3VS3 A;  5IXF A;  4E7L A;  1N6A A;  1OPK A;  2VUB A;  4J6W A;  3TQ7 P;  4LD6 A;  1Q86 R;  4C8Q C;  3OYE A;  2X4X A;  1YJW Q;  2DTI A;  1ZX6 A;  3VV0 A;  4BY6 C;  2M16 A;  3MHX A;  4VUB A;  2HQE A;  4KT0 E;  4Z02 A;  3CMA A;  1WQW A;  4C0F A;  4HVV A;  2PZ1 A;  1K4U S;  4O5V A;  1OI1 A;  2OTJ A;  4QQD A;  1KQ2 A;  2LNH B;  2YUO A;  2M9U A;  5CQY A;  1K9M C;  1VIE A;  1YN8 A;  3CXC S;  2KSS A;  3GNG A;  3SFM A;  4L59 A;  2RJC A;  4WF2 A;  4N0A A;  1HYO A;  1EX4 A;  2CP6 A;  3U23 A;  4KGX B;  5CKD A;  3CCS A;  2F69 A;  3CCU T;  4HVU A;  1UGR B;  1Q7Y C;  4HA8 A;  2VAS A;  2OTL Q;  1FMV A;  4QQ6 A;  3CCV Q;  2HL5 C;  1X6O A;  3O5Z A;  3OMG A;  1WHL A;  3CCQ T;  3AT1 B;  3JCM Q;  4P5N A;  4JRI A;  4RTZ A;  2WSE E;  3NGP A;  3G6E Q;  5LJ3 g;  3JCM b;  2KE9 A;  4CC4 B;  3A5Z B;  3EGD A;  5IT9 E;  1MMD A;  2D8H A;  2X4Y A;  2JMA A;  5CQX A;  4RTW A;  3N5B B;  2CZ7 B;  1NZ9 A;  1D0X A;  2PUK B;  3VS7 A;  1O75 A;  4JJC A;  1S1N A;  1WHG A;  1GFC A;  3GP8 A;  3I56 Q;  2KRN A;  1BI2 A;  4IIO A;  1U1T A;  1Y0M A;  1YHQ Q;  4A4H A;  4PJO E;  1VQO T;  2DRM A;  3JCM W;  3L1A A;  1Q86 C;  5FRN A;  4GLK A;  4M7A G;  1A0N B;  4JUV A;  4RCB A;  2AKL A;  4KUL A;  4OB3 B;  4O6J A;  4M78 G;  2V1R A;  2D9T A;  1OX9 A;  2CGH A;  2WSC E;  3ASK A;  1V1C A;  1RAC B;  5GAN g;  2EGA A;  1E7O A;  1AWO A;  2RJF A;  3DB4 A;  3J80 E;  1NEB A;  4M7A B;  2QQR A;  2QI2 A;  5GAM e;  2YRC A;  3VS5 A;  2FYK A;  1QP2 A;  2RB6 A;  1IO6 A;  1CKA A;  3CCU A;  4M78 B;  1JBM A;  2J7I A;  2VV5 A;  3C4S A;  1ZSZ B;  4EMK C;  2QA4 Q;  3A8M B;  5DLQ E;  5KYX B;  2JTM A;  3VS1 A;  2L0A A;  5I2M A;  2RH2 A;  2DE0 X;  2DJQ A;  3JAM E;  2CUD A;  2DA9 A;  3RBB B;  4FT4 A;  3CXC A;  3CCQ A;  1I81 A;  1GCP A;  2K6D A;  2RQT A;  5GAO n;  4OMO A;  3KXT A;  2J05 A;  3EG3 A;  1J3T A;  1UDL A;  3V8L A;  1G8X A;  2C0T A;  3E9G A;  2DD5 A;  4KH1 B;  4RTU A;  4M75 G;  1PC0 A;  3QII A;  2E4H A;  1ZQ1 A;  4K11 A;  2FRW A;  4B9X A;  4LE9 A;  2DL5 A;  3CBP A;  2ZPG B;  3G71 Q;  4N4G A;  1B07 A;  1GFD A;  3C0C A;  1D09 B;  4MZP A;  4E47 A;  2DTH A;  3OMC A;  4A4G A;  1D0Y A;  2X35 A;  1AEY A;  4F7U G;  3RDV A;  1G2B A;  1VQO A;  4M75 B;  3X25 B;  3QWY A;  1PG5 B;  5FU6 C;  3CD6 Q;  3RMS A;  1WGS A;  3E19 A;  3HTR A;  2YRD A;  5HK0 A;  4M7A A;  5GAN 4;  5IHN A;  5GAM h;  2CP3 A;  2JXB A;  3GNF B;  1CKB A;  2PTK A;  4M78 A;  2B8A A;  1TUG B;  2O9S A;  4F7U B;  1ZSZ A;  1ZA1 B;  5KYX A;  5D6W A;  2L89 A;  2EQI A;  5GAN e;  2ROT A;  1UHC A;  1YJW T;  5GAN 8;  3NMZ C;  8AT1 B;  2V8K A;  4C5H A;  3LLR A;  1QVP A;  5GAM d;  1QCO A;  1Y07 A;  2NLU A;  1JJ2 S;  2DTO A;  2EKO A;  2JZ2 A;  3OBY A;  4FCY A;  5FLX E;  1OZ3 A;  1OV3 A;  5GAN 6;  2E6N A;  2PQW A;  2F2X A;  1NLP C;  4J9B A;  2NUP B;  5HCK A;  5HKC A;  2R58 A;  1Y71 A;  3EAE A;  4ORZ A;  1AWJ A;  1UJ0 A;  3EH1 A;  3JCM X;  4JJD A;  1NBE B;  3G4S Q;  1RLQ C;  1VOM A;  1BYM A;  1R77 A;  2KI7 A;  2VWF A;  2OTL T;  4J9D A;  4RTX A;  1VQM Q;  2RI2 A;  2KYM A;  4XU1 A;  3NHN A;  4F16 A;  2KRO A;  4ZN1 A;  3OYA A;  2B86 A;  3OS1 A;  3L2U A;  2QEX T;  3EFO A;  3G6E T;  2JMC A;  3V8K A;  4OMM A;  2A36 A;  3R6N A;  1OUL A;  5KYY A;  1Y96 B;  2RD1 A;  3KBG A;  4DOW A;  4EIK A;  5I11 A;  1W2B S;  5GJW B;  2L3P A;  3L2W A;  4F7U A;  2RQU A;  1R0C B;  3VU3 C;  5GAN h;  4PJO G;  2QK0 A;  1JQQ A;  3M0Q A;  3NPF A;  3CCJ Q;  1UHF A;  4LDW A;  3I56 T;  1GRI A;  1MMA A;  4QVC A;  1KG1 A;  2KVQ G;  1U3O A;  2QTV A;  4Y28 E;  1G3Y A;  1YJW A;  4PJO B;  2EYW A;  1QW1 A;  2ZGW A;  5CKF A;  2KMT A;  2K5F A;  2BIV A;  1VQ6 T;  3RKW A;  2RJE A;  5GAN d;  2KXC A;  3X24 B;  1ZHI A;  1ZBX A;  4J7I A;  2QDL A;  4QVD A;  3QWX X;  2K7A A;  2LC4 A;  4IUT A;  4C8Q B;  2RF0 A;  3PMI A;  3TU4 K;  4MDW A;  1G3S A;  4BY6 B;  1K73 U;  2JNG A;  3M55 A;  2FPF A;  3H9N A;  2Y90 A;  2EYX A;  2K5I A;  1QVF S;  2CZ6 B;  4E7Z A;  1IRX A;  2HNI A;  3H41 A;  3DKM A;  2QA4 T;  4UC4 A;  1AOJ A;  4LXC A;  1K73 R;  3EFR A;  2MK5 A;  2X3W D;  4RUG A;  1JJ2 A;  2OTL A;  5IHI A;  2I0N A;  1WXT A;  4XTX A;  2HQX A;  2QQ9 A;  2KEA A;  4PJJ A; 
#chains in the Genus database with same CATH homology
 2O88 A;  2LZ6 B;  1NLO C;  1WFW A;  1X6G A;  1GL5 A;  4RTT A;  2HDA A;  4QT7 A;  1SHF A;  3REA B;  1QWE A;  5FW9 A;  4JZ4 A;  1TUD A;  3M0R A;  2A37 A;  3I9Q A;  1WA7 A;  2FEI A;  1I07 A;  2FG0 A;  1SEM A;  5GJV B;  1PRL C;  4LNP A;  3UAT A;  1QKW A;  1YWO A;  2K2M A;  1VA7 A;  2XMF A;  1OEB A;  1ZSG A;  1UFF A;  1NYG A;  2MCN A;  4R0K A;  1SRM A;  4JZ3 A;  2SEM A;  1YCS B;  3M0U A;  4IIM A;  2JTE A;  4CC2 A;  1ZLM A;  1M3A A;  1JO8 A;  1UEC A;  3EG1 A;  1H3H A;  2ED0 A;  3LH5 A;  2CSQ A;  1M3C A;  5FWC A;  3VS3 A;  5IXF A;  4LN2 A;  3TSZ A;  1X6B A;  1QCF A;  1OPK A;  1LCK A;  2OAW A;  2LJ0 A;  1ZX6 A;  1N5Z A;  3VS2 A;  1G83 A;  1WXU A;  3GBQ A;  4AFQ C;  2EW3 A;  1K1Z A;  1E6G A;  1XOV A;  2DVJ A;  3RNJ A;  4HVV A;  2PZ1 A;  1FMK A;  1K4U S;  4OMP A;  1EFN A;  1NM7 A;  2LNH B;  2M51 A;  1SRL A;  2YUO A;  4F17 A;  2JW4 A;  1TUC A;  1K0X A;  1YN8 A;  1VYV A;  2YDL A;  2J6F A;  1AZE A;  2YSQ A;  1AVZ C;  1RLP C;  2SRC A;  5ECA A;  3U23 A;  1U5S A;  2JS2 A;  4HVU A;  3VRY A;  2KRS A;  3H0I A;  2OJ2 A;  1QWF A;  2OI3 A;  2ESW A;  3EHQ A;  1PWT A;  2LQN A;  4ESR A;  4OML A;  1I1J A;  2MOX A;  3O5Z A;  4JJB A;  1H8K A;  1BB9 A;  2DBK A;  1M3B A;  1PHT A;  2IIM A;  1X43 A;  2RNA A;  1HSQ A;  2BZ8 A;  2V1Q A;  1Z9Q A;  4RTZ A;  3NGP A;  2KE9 A;  4CC4 B;  2FPD A;  1QKX A;  2LQW A;  2CT3 A;  2CUB A;  2DL3 A;  1WXB A;  1W1F A;  2DIL A;  2W10 A;  2LMJ A;  2GBQ A;  1SSH A;  2D8H A;  3VS6 A;  2JMA A;  2JM9 A;  4RTW A;  2DL4 A;  2GNC A;  3VS7 A;  2DL7 A;  2EVR A;  2YT6 A;  3I5R A;  4J9F A;  2F2W A;  4JJC A;  1OOT A;  2LJ3 A;  4CC3 A;  3VRZ A;  1S1N A;  3FJ5 A;  1GFC A;  1WDX A;  1GBR A;  3SEM A;  2GTO A;  2KRN A;  2P4R A;  4IIO A;  1Y0M A;  4AG1 C;  1VYU A;  2EPD A;  2ECZ A;  1X27 A;  2DRM A;  2L2P A;  2LX7 A;  1UGV A;  1A0N B;  1GCQ C;  2RQW A;  1CSK A;  2AKL A;  2EGC A;  2D1X A;  2RN8 A;  2FPE A;  4AFS C;  2V1R A;  1UG1 A;  3A98 A;  4Z89 A;  5I22 A;  2JM8 A;  2ABL A;  4RTV A;  1PKT A;  1QLY A;  1V1C A;  2VVK A;  1AD5 A;  1BBZ A;  2EGA A;  1E7O A;  4D8K A;  1AWO A;  1W70 A;  1NEB A;  1E6H A;  1X2Q A;  2HCK A;  3KFV A;  4A63 B;  3M0S A;  1BK2 A;  1SHG A;  3VS5 A;  5EC7 A;  1ZUK A;  2KGT A;  4KRT A;  4X1V A;  5IHK A;  1IO6 A;  2K79 A;  1CKA A;  1RUW A;  1PNJ A;  2CH4 A;  4HVW A;  1FYN A;  1UJY A;  2CT4 A;  2J7I A;  1HD3 A;  3EGU A;  2BZX A;  2YUN A;  1ARK A;  1UUE A;  3UF4 A;  3VS1 A;  2KR3 A;  2L0A A;  1AZG B;  2DE0 X;  2DJQ A;  2W0Z A;  1TG0 A;  3I35 A;  2CUD A;  2RQV A;  2DA9 A;  1NEG A;  3RBB B;  2L3Q A;  1GCP A;  1T3L A;  2K6D A;  2RQT A;  2YUP A;  4OMO A;  2J05 A;  4Z88 A;  3EG3 A;  1J3T A;  1UDL A;  2HEQ A;  2C0T A;  1VYT A;  4RTU A;  2J6O A;  2C0I A;  1Z9Z A;  4K11 A;  2FRW A;  4LE9 A;  4LUE A;  2DL5 A;  2AZV A;  1ZUY A;  2DBM A;  1M8M A;  2O31 A;  1B07 A;  3M0T A;  1GFD A;  3C0C A;  4ZNX A;  1KJW A;  2CSI A;  2LCS A;  1AEY A;  1G2B A;  2FRY A;  3PVQ A;  3QWY A;  2KT1 A;  1YWP A;  2ENM A;  1HJD A;  1I0C A;  3VS0 A;  2C0O A;  2EGE A;  5IHN A;  4AG2 C;  3H0H A;  2JXB A;  2DYB A;  4DEY A;  5IXB A;  1CKB A;  2PTK A;  1BU1 A;  2KRM A;  2O9S A;  1U06 A;  2AK5 A;  2F2V A;  2EQI A;  2RQR A;  1Y57 A;  2ROL A;  1KFZ A;  4OMQ A;  1GCQ A;  2ROT A;  1WI7 A;  1K76 A;  1UHC A;  3JV3 A;  3NMZ C;  3H0F A;  1KIK A;  4Z8A A;  4Y92 A;  1GBQ A;  1ZUU A;  4F14 A;  2EYZ A;  2A08 A;  2BTT A;  2M0Y A;  1NYF A;  3EG0 A;  1OV3 A;  3TSW A;  1AWX A;  2F2X A;  3THK A;  1NLP C;  1YNZ A;  2KYB A;  4J9B A;  3M0P A;  1W6X A;  2JS0 A;  5HCK A;  2X3X D;  1YP5 A;  1K9A A;  1AWJ A;  1UJ0 A;  2E5K A;  1WIE A;  4J9E A;  4ORZ A;  4LUD A;  2J06 A;  4JJD A;  1RLQ C;  2PNI A;  2VWF A;  2K3B A;  2G6F X;  3ULR B;  4J9D A;  1X2K A;  2DLP A;  2DL8 A;  1T0H A;  2KBT A;  3EHR A;  4OMN A;  4RTX A;  4JPB W;  4HXJ A;  2LP5 A;  4GBQ A;  2KYM A;  3NHN A;  4F16 A;  2KRO A;  1OPL A;  3CQT A;  2B86 A;  2HSP A;  3IQL A;  2CRE A;  2CDT A;  4RTY A;  2VKN A;  4GLM A;  2MIO A;  2A28 A;  1X69 A;  1PKS A;  1JEG A;  2K9G A;  2DMO A;  2JMC A;  2KT8 A;  1B3Q A;  4OMM A;  2A36 A;  3R6N A;  1RI9 A;  4EIK A;  2CH4 W;  2GTJ A;  5I11 A;  5GJW B;  4AFU C;  2L3P A;  1T0J A;  2RQU A;  2DX1 A;  1KSW A;  2RPN A;  4J9C A;  2ED1 A;  5FWB A;  1WX6 A;  1JQQ A;  1MUZ A;  2YUQ A;  2O9V A;  1ABO A;  3M0Q A;  1UTI A;  3NPF A;  1WLP B;  5IH2 A;  3ZL7 C;  2AZS A;  1UHF A;  1MV3 A;  2KNB B;  3VS4 A;  1GRI A;  3UA6 A;  1PRM C;  1U3O A;  1T3S A;  2H8H A;  1SPK A;  2DRK A;  2DM1 A;  3I5S A;  2DNU A;  2J6K A;  2EYW A;  2KXD A;  5L23 A;  2GQI A;  1H92 A;  3UA7 A;  4E6R A;  1ZBJ A;  2KXC A;  1AWW A;  1JXM A;  3EG2 A;  1MV0 B;  2QDL A;  3QWX X;  2K7A A;  4HCK A;  3REB B;  2LJ1 A;  2D8J A;  2RF0 A;  2EYY A;  4AFZ C;  1UE9 A;  4D8D A;  1JXO A;  1M30 A;  2FPF A;  2O2O A;  2EYX A;  2GGR A;  2RMO A;  3TVT A;  1ABQ A;  4M4Z A;  3H41 A;  4WCI A;  2D0N A;  2BZY A;  3PVL A;  1K0S A;  1AOJ A;  2X3W D;  4J9G A;  4RUG A;  2NUZ A;  3PE0 A;  5IHI A;  2L3S A;  2I0N A;  1WXT A;  1M27 C;  4J9H A;  2NWM A;  4CC7 A;  1JU5 C;  4J9I A;  4DEX A;  2DF6 A;  1WYX A;  2AKK A;  2EKH A;  1NG2 A;  3SHW A;  2HBW A;  2FO0 A;  2JT4 A;  2KEA A;  2EBP A;  4FSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...