2JM9A

R21a spc-sh3 bound
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jm9A00
2HSPA 2AZSA 2AK5A 2EVRA 2FO0A 3PVQA 4RTTA 1K0SA 1RUWA 3SEMA 3ULRB 4D8KA 4JJBA 1YWOA 1LCKA 3M0SA 1SSHA 1H3HA 2FPDA 1BBZA 2CSIA 2MIOA 2JMCA 3THKA 3H0HA 1ABOA 1K9AA 1WX6A 2DMOA 4M4ZA 1GBRA 2ABLA 4A63B 4J9DA 4GBQA 4J9CA 2V1QA 1I0CA 2O31A 3IQLA 1AD5A 3VS2A 1BU1A 2YUNA 3M0UA 5I11A 2LX7A 4AG1C 2DL5A 1N5ZA 5FWCA 2PZ1A 1ZX6A 1U3OA 2KRNA 3EG3A 2JW4A 1MUZA 2EYZA 4ESRA 2O88A 1XOVA 3FJ5A 1T3SA 1I1JA 2QDLA 5IHIA 1FYNA 1UHFA 1JEGA 1AWWA 2OAWA 2RQVA 1PKSA 4JZ3A 2K9GA 1Y57A 2DA9A 3REAB 1KFZA 2K6DA 4RTUA 2W0ZA 2YUQA 3VS5A 1AWXA 1E7OA 1Y0MA 2HCKA 2GTJA 1SEMA 1A0NB 1UHCA 2XMFA 3H0IA 4RTZA 4LUEA 3VRYA 3REBB 3I5RA 2J7IA 2LNHB 2HEQA 1QKWA 4ORZA 2A08A 2FRWA 2A37A 2KYBA 1H92A 3VS3A 2GTOA 1OEBA 4RTVA 2F2XA 2L3PA 2DL3A 3O5ZA 2KGTA 1M30A 1HSQA 2DX1A 2GGRA 2D8JA 1JXMA 2RNAA 2RPNA 2FPFA 2J6OA 2V1RA 1UG1A 1ZUKA 3A98A 1TUDA 4KRTA 3I35A 2A28A 1NLOC 1M3BA 4DEXA 3R6NA 1X43A 1ZSGA 1OV3A 2DF6A 1RLPC 2FEIA 3VRZA 2KNBB 4Z89A 3M0QA 2DBMA 3KFVA 4AFUC 3PE0A 2KRMA 4OMNA 1ZLMA 4LUDA 1MV3A 1V1CA 2L3SA 2GNCA 2KXDA 2MCNA 2K79A 1PWTA 5FW9A 5L23A 2CSQA 1K0XA 2SEMA 1W70A 1QLYA 4RTWA 2CH4W 2CT3A 2EGCA 1AOJA 3EHRA 3UA7A 1CKAA 4K11A 1KIKA 2L0AA 2KT1A 1SRLA 1OPKA 1VYUA 3NPFA 4OMQA 3TSWA 4LNPA 4RUGA 1NYFA 1KSWA 3H0FA 4JJDA 3QWYA 2O2OA 4X1VA 1VA7A 1JXOA 1U5SA 2FRYA 1YWPA 1HD3A 3LH5A 3M0RA 3NMZC 1WXTA 1UECA 1U06A 2J6KA 2RQWA 1AZEA 2EYYA 1PHTA 2DRKA 3QWXX 1E6HA 2AKKA 2JM9A 2RN8A 4IIMA 2PTKA 1KJWA 2JTEA 4J9HA 2K2MA 2DLPA 3U23A 2B86A 3VS4A 2NWMA 2RQTA 4J9EA 2YUPA 3UATA 1SRMA 1S1NA 1UDLA 2C0OA 2JS2A 1RI9A 2K7AA 2J6FA 3UA6A 2DL4A 1SHGA 3VS7A 1UFFA 1SHFA 2FG0A 1X2KA 4AFQC 4CC2A 3JV3A 2MOXA 1QCFA 1ZUUA 1T0HA 1GFDA 1PNJA 2OI3A 1W1FA 2LQWA 2RF0A 3EG1A 2LJ1A 2ECZA 1QKXA 4RTXA 4AFZC 5GJWB 3H41A 1JQQA 1JO8A 1K1ZA 1GCQA 2X3XD 2ENMA 3EGUA 1GCPA 2C0TA 2F2WA 2HDAA 2C0IA 1HJDA 2ROTA 5ECAA 2DYBA 4HVVA 2NUZA 5IHNA 1UTIA 1M3CA 2EGEA 2EQIA 1UJ0A 2G6FX 1UUEA 4OMOA 4WCIA 1IO6A 5EC7A 1X27A 2KBTA 4R0KA 1OPLA 2JXBA 2P4RA 5IH2A 1VYTA 4E6RA 1GRIA 1EFNA 1WXBA 3VS6A 1AWJA 1TUCA 4F17A 2K3BA 1AWOA 2LMJA 1WIEA 4HVWA 2VVKA 2KROA 2EBPA 5IXBA 2CUDA 2L3QA 4ZNXA 1PKTA 1X6GA 2BZYA 2LP5A 5GJVB 2EYWA 5IXFA 5IHKA 1QWFA 2X3WD 2YDLA 1YNZA 3NHNA 1X6BA 2W10A 4F16A 1G83A 4Z8AA 2JM8A 1UJYA 1BK2A 1M27C 2YT6A 2OJ2A 1MV0B 4JJCA 2BTTA 4CC4B 2KE9A 3SHWA 2DILA 1M3AA 1GBQA 2DJQA 3PVLA 4HCKA 2BZ8A 2HBWA 1SPKA 1YCSB 2O9VA 2ESWA 3ZL7C 4LN2A 5HCKA 1Z9ZA 2J05A 3EG0A 2DL7A 4J9BA 2FPEA 3I5SA 2RMOA 2DL8A 4J9FA 1WYXA 1TG0A 1ARKA 1X2QA 2VKNA 1YP5A 3VS0A 3NGPA 1NLPC 2D0NA 2VWFA 1J3TA 1NYGA 1T3LA 1FMKA 2CT4A 1AZGB 1BB9A 1PRLC 2JS0A 1E6GA 1WLPB 1UE9A 2D1XA 4GLMA 4CC7A 1B07A 2F2VA 1ZUYA 3CQTA 3EG2A 2GQIA 3RBBB 2KRSA 1OOTA 4OMLA 4FSSA 4QT7A 2DM1A 2KYMA 3M0TA 3I9QA 1WA7A 2JMAA 2M0YA 1CSKA 2LZ6B 1ABQA 2SRCA 2PNIA 1QWEA 2GBQA 1W6XA 2H8HA 2LQNA 1K4US 1ZBJA 4JZ4A 2IIMA 2D8HA 1H8KA 4DEYA 2I0NA 3TVTA 1K76A 4Z88A 2E5KA 2KT8A 4LE9A 2CUBA 2M51A 2LCSA 3EHQA 2ED0A 4RTYA 4HXJA 2DBKA 1T0JA 1AVZC 1UGVA 2YSQA 1WXUA 1GL5A 2EYXA 1CKBA 2L2PA 1JU5C 4JPBW 3RNJA 2EW3A 1GCQC 4OMMA 1G2BA 4F14A 4EIKA 2CDTA 1NEBA 4AFSC 2RQRA 3VS1A 1AEYA 2JT4A 1NM7A 3M0PA 1RLQC 2CREA 1I07A 1PRMC 2CH4A 4CC3A 2YUOA 4J9GA 3TSZA 2LJ0A 2DVJA 2O9SA 1YN8A 2EGAA 5FWBA 1VYVA 2KEAA 2AKLA 4AG2C 2AZVA 2KXCA 1NG2A 2J06A 2DNUA 2BZXA 1NEGA 1WDXA 2KR3A 2EKHA 1X69A 2LJ3A 5I22A 2ED1A 4D8DA 2DRMA 1M8MA 2A36A 2RQUA 3C0CA 4J9IA 3UF4A 4IIOA 1GFCA 1B3QA 3GBQA 4Y92A 4OMPA 1Z9QA 2DE0X 1WI7A 2EPDA 1WFWA 4HVUA 2ROLA
chains in the Genus database with same CATH superfamily
4JS5A 3CCVQ 2EKOA 4M75C 1Q81C 1VQ9A 1BI0A 2EVRA 3NTIA 1NE8A 3ULRB 3CC7Q 1SSHA 2O4XA 1N9RA 1YJWA 1VQ5A 1BBZA 3HPWA 2CSIA 2JMCA 3RKYA 1Q81U 5CKBA 1K9AA 2R58A 3KUFA 4E2FB 3CCVT 1PSEA 4M7AD 4GBQA 4J9CA 2KAFA 2V1QA 1I0CA 3H6ZA 1M1KU 3OQ5A 4AG1C 1Q7YC 3HTRA 1N5ZA 5FWCA 4ESRA 1XOVA 3FJ5A 2QDLA 2RI5A 5FU7B 3LH0A 2DPPB 3OYMA 2RQVA 3G71Q 3ZBDA 2K9GA 4M77D 1IHVA 2DTOA 2CP3A 1S72Q 2YUQA 4ZGEB 3OYGA 3M54A 1B34B 5DLQE 3QUIA 3ER0A 4BI3A 2GCXA 1W2BP 3I5RA 3E2UA 1QVFP 2LNHB 1R8OB 1U1SA 3JCMc 5GANf 3CC7A 1VQ7A 2R5MA 1YBYA 1H92A 1ZA1B 2VB6A 4RTVA 2F2XA 2L3PA 1Y96B 1WQWA 2KGTA 1M30A 3OYHA 3JCMX 4QVZA 1HSQA 8AT1B 5IAYA 4JRPA 3EAEA 3CCUQ 4DQ2A 3V8KA 4XU2A 1YJNT 3I35A 4PFPA 5CAIA 3I55T 1M3BA 2X35A 5EG2A 5LJ5f 3CBOA 3V8JA 1RAFB 1X43A 1OV3A 1SF9A 1Q7YR 3CCSA 1XJWB 4C8QA 1C0MA 4AFUC 3V7CA 2KRMA 4OMNA 1ZLMA 4LUDA 1KHIA 4PJOA 2MCNA 2WSCE 5FW9A 2C06A 4C92C 1LNXA 2CS7A 1K73R 4FM4B 4FU6A 4C0FA 1OPKA 4M78D 4M78G 4OMQA 1OX9A 4PJJA 2A3LA 1Q86U 1I5OB 1VA7A 3CCRT 1M1FA 1WGSA 1UB4A 2KSSA 3MP8A 3LH5A 3NMZC 1WXTA 3UDCA 1U06A 1D0ZA 1PHTA 2DRKA 4HCBA 1AHJB 3GLXA 4L59A 1KD1R 2O01E 1D1CA 2JTEA 2MWPA 3BDLA 1IREB 2RD1A 3CCEQ 2K2MA 2B86A 1I81A 2PUKB 1B7TA 2YUPA 1D1AA 2RHUA 3UATA 2E64A 3CCSQ 1Q7YU 1UDLA 2X9HA 4BE0A 4B9WA 3C12A 5CCAA 4A4FA 2K5IA 1WJQA 4JRKA 2CGHA 1UFFA 2FG0A 2JOYA 1X2KA 4CC2A 2BE7D 2E10A 4J5YA 1RI0A 1ZUUA 1VQKA 5A0GA 3OSSC 3M53A 2LQWA 2RF0A 1BKBA 2X4XA 3EG1A 1SSFA 2E5QA 5LJ5g 2X4YA 4AFZC 3D7SB 4LDUA 1JO8A 1K1ZA 2X3XD 4FYYB 2ENMA 3JAME 3OMGA 1MGQA 3G6EA 3GP8A 3OBWA 2F2WA 3X24B 4MMLA 5LJ3d 1UTIA 2EGEA 2EQIA 1OU9A 1OYXA 4PJNA 3V7RA 1OPLA 4C92D 2P4RA 2VGMA 5IH2A 4E7KA 2I2LA 5LJ3j 1WXBA 1VQKQ 3AHUA 1ZHIA 1TUCA 4F17A 4X34A 2PQWA 4DBRA 2PVDB 3JCMQ 5DLOA 2CUDA 3PNWC 2LP5A 2RK2A 2X3WD 2NLUA 1YNZA 3MEWA 2W10A 5C6SA 2OJ2A 4JJCA 5KYUA 3R6OA 1V29B 3CCMQ 2DJQA 3M4GA 4VUBA 1SPKA 2V26A 2BUDA 2O9VA 2L3RA 4PJOG 1LJOA 4XTXA 4PL6A 5L8RE 3X26B 5FROA 4E47A 1Z9ZA 4HCZA 4RG2A 2DL7A 3RERA 4II1A 2RMOA 1YI2A 3DKMA 4B9XA 4TVRA 1TG0A 1YIJT 3CCMT 1NZ9A 1YP5A 3CPWP 1WJSA 4PLLA 1X01A 4DOWA 4J83A 2JN0A 2CT4A 1QP2A 2EJGA 2JS0A 4HT8A 1WLPB 4M75D 2H3EB 1UE9A 2F5TX 2M1HA 5FU7C 2QTXA 5D6XA 2L5QA 2OTLA 4M7DG 3OW2P 3CEYA 3A8HB 1OOTA 5LJ3h 2LVMA 3RKWA 2DM1A 2DERA 1QP3A 1NBEB 1WA7A 2M0YA 2JTFA 2HL3A 1N9SA 2PNIA 1BYMA 1QWEA 2GBQA 1W6XA 1LVKA 5LJ5h 1BIBA 1VQNQ 3C4SA 2I0NA 2YLBA 4Z88A 2QK0A 5CIUA 1VQ7T 4C8QD 1K8AC 1N27A 4E7LA 2HQEA 1TH7A 4HXJA 1T0JA 4L5GA 4C0DB 3RMSA 1WXUA 4XTYA 4FW2A 3GNFB 2COYA 1JU5C 4OMMA 1G2BA 4F14A 3BW1A 1NEBA 3QJYA 3GNGA 4RMOA 3G7ZA 3CCST 2VASA 3UWNA 2NUTA 2KDSA 4LXCA 2EJ9A 2FZGB 1NM7A 2RB6A 5DM7R 4UC4A 1XNIA 3CCET 1TS9A 2RHIA 4RG8A 2QASA 1I07A 1PRMC 3JCMh 3TSZA 5KYNA 3CC2A 2DVJA 4KBMB 1PD1A 3CXCS 3OYLA 4F7UB 3LYIA 2KEAA 3H8ZA 3QXEB 4IUPA 2XD0A 1NG2A 4C5GA 3PFSA 4KUDK 2YRDA 1NEGA 2YXYA 4JLIA 3M59A 3LWIA 1KD1U 2QEXT 4D8DA 1M8MA 2P84A 3FRNA 2LT1A 3M4YA 1GFCA 2PVGB 4EMGA 1Z9QA 4EMHA 2P4TA 2VYTA 3MKDA 2HKQB 4HVUA 4FSXA 5D6YA 5AYFA 3CCLQ 2AZSA 2AK5A 2FO0A 2EFIA 4RCCA 3FC3A 4D8KA 4JJBA 1YWOA 1LCKA 3M0SA 2FPDA 2RA2A 5KYWB 1YJNA 3H0HA 2Z0WA 2MPXC 2E4HA 2ABLA 3OSVA 5KE2A 2ATCB 4J9DA 2K5LA 2DVEA 3IQLA 3L2QA 3VS2A 1TUGB 5I11A 4FT2A 3HL8A 2CP0A 1IB8A 2HQXA 2PZ1A 1U3OA 3SD4A 2JNGA 3QKJA 4Q5WA 5IHIA 4ME7A 3EG9A 3A8GB 2CZ7B 1JEGA 3M58A 3F70A 3QDRB 2MI6A 4J6YA 4M78E 4M75E 3J80E 1KFZA 1O9SA 4RTUA 2W0ZA 2FVUA 2E6ZA 3QSUA 1AWXA 4BY6B 5LJ3e 4MZTA 1ZSZA 3QYGB 4M7AE 1W2BA 1SEMA 2A7YA 3LX7A 1VQOQ 1N8RU 1A0NB 5IT9E 2XMFA 5FU6B 4LUEA 2XICA 3REBB 1YITQ 4CRIA 2J7IA 5KCHA 1Q82R 2CP7A 4QKUA 1QKWA 5GMKi 4BD3A 5GMKm 3VUZA 3L2RA 2RJFA 2GTOA 2ZPHB 2IVWA 1OEBA 2LTOA 2DL3A 3O5ZA 4XTWA 4HKEA 4IUVA 2GGRA 3A5ZB 1JXMA 2FPFA 3L2VA 1VIFA 3VYHB 2LC4A 1Q95G 2DYIA 4M77F 3QZ9B 4XTVA 1V76A 5GANg 1UG1A 3ASKA 4PJOD 2PU9B 1TSFA 1QVPA 5GMKj 3QYHB 1IXDA 2WSFE 2DF6A 1JBMA 2RHXA 5D6WA 4Z89A 4FYVB 3OYKA 2DBMA 3QG1A 3RIRA 2X4JA 2JVVA 5GAMg 2WACA 3OYEA 4HT9A 2V8JA 1MV3A 2P0KA 2GNCA 2KXDA 2K79A 5KYUB 3SFMA 2WSEE 2CSQA 2LQKA 1IRXA 2SEMA 2Y4YA 1QLYA 1H641 2CH4W 3FEOA 1AOJA 3EHRA 2QQ9A 3UA7A 4Z02A 4K11A 1KIKA 2L0AA 2KT1A 1SRLA 2K5FA 2ZGWA 1OX8A 4RUGA 1NYFA 6AT1B 3H0FA 5CKHA 5CVIA 3CMEQ 2K3XA 2E12A 2RI3A 2NYSA 4JDSA 2KVQG 3CPFA 3M0RA 1VQPQ 1YITT 5GAN5 5HY6A 1PD0A 3QWXX 1E6HA 4J6XA 2MMPA 1TOVA 4E7SA 4J9HA 3RMQA 2ZPGB 9ATCB 3U23A 2MK5A 3I56Q 3O8VA 2NWMA 2RQTA 4J9EA 3JCMb 2QI2A 1PG5B 1SRMA 4FW1A 5GAMh 3L2UA 3UA6A 3QBYA 4MDXA 2K57A 2QQRA 1SHGA 3VS7A 4JLGA 4PKCC 4BB7A 2QDYB 3JV3A 2MOXA 1QCFA 1T0HA 2XDBA 3RKXA 2DD4A 3RESA 1VOMA 4EMKB 4OB1B 2LJ1A 4EPCA 1QKXA 4CI0C 2HNIA 3M5AA 3H41A 1UGPB 1O75A 5CR2A 1VQPA 3EGUA 2P0QA 2C0TA 2HDAA 4KGXB 3CCLT 4AMCA 1QVGS 3VKIA 4HVVA 1KHCA 5LJ3g 1WHMA 2EQKA 2HMAA 3SWNC 2G6FX 5DY9A 1IO6A 2XDPA 3S3NA 2KBTA 5FLXE 4N4GA 1HXDA 1YI2T 4LD9K 3E9GA 1AWJA 2VV5A 1EX4A 4M75A 3BDUA 3L2WA 2KROA 5IXBA 2XDDA 2XI9A 2EYWA 1KC8C 5IXFA 5IHKA 4C92F 1QWFA 1IGQA 2M02A 2YDLA 4F16A 4QVDA 1G83A 1M27C 2YT6A 1I4K1 1MV0B 4KGVB 4CC4B 3JCMd 3CC2T 2DILA 3ZFJA 4BUGA 4HCKA 3CCVA 4ZTFA 5GAN8 1UGSB 3CMAQ 1ACMB 4LN2A 4MDWA 1F1BB 3META 4JUVA 4R55A 2LCLA 4J9BA 4Y91A 1WYXA 4DBQA 3NFCA 1ARKA 1X2QA 2VKNA 1VQOT 4KUIA 4XQ3A 1WQ7A 1WHLA 1NYGA 1D09B 1KD1C 4NS5A 3JCMg 1G8XA 2D1XA 4GLMA 3DLLA 3L2ZA 4NL2A 1VQ7Q 3OYIA 4IUTA 3QHSA 2LNVA 2QG9B 5KYWA 2XU8A 2QGGA 4ZTJA 2GFAA 2KRSA 3MP1A 4KT0E 3PT9A 2JJ9A 4C5HA 4QT7A 1MNEA 3M55A 1QMCA 3HHTB 2DKGA 1CSKA 2LZ6B 3INZA 1W2BS 4WTOB 2H8HA 2AT1B 2IIMA 5GANe 3OYYA 2ZPFB 3CCJA 3FJPA 3MP6A 3TVTA 1K76A 5GAMe 3OS5A 2KT8A 2LCSA 2LQ8A 1D0YA 2PVOB 4RTYA 2OTJT 2JTMA 2DBKA 1OZ3A 2D0QB 2MYSA 1UGVA 2EJFA 1YIJQ 2KI7A 1KK7A 3AT1B 2QAZA 4M7AB 4M78C 1BIAA 2VXFA 3I56A 2HL5C 1D0XA 4QQ6A 4QVCA 2KY9A 4C92G 1OZ2A 3CCJQ 2RQRA 3EFOA 3JB9J 4F7UF 2FYKA 3VS1A 3CCQA 4M78B 1MNDA 1XQHA 3JCMe 4C8QF 1Q81R 2EQMA 2E65A 4PJOB 8ATCB 3E9FA 5AT1B 1YFNA 4M75F 4BE1A 1YITA 2LJ0A 3CPWS 1KQ1A 2O9SA 2CZ0B 1YN8A 5GAN4 3OBYA 2EGAA 1N8RR 1VYVA 2OTJA 3L42A 4C92A 5GAMf 2AZVA 2KXCA 2J06A 1N6AA 2BZXA 4PJLA 3QO3A 1WNLA 4PK4A 2KR3A 1WHKA 4ZN3A 1QVGP 3OW2S 1X69A 3TCJA 2DRMA 2A36A 4XU1A 3BFMA 4IIOA 5HKCA 1QCOA 4Y92A 1WI7A 2HKNA 5CKEA 2HSPA 3OYFA 3CC4T 1ZSZB 4IURA 4J8OA 1WHJA 1RUWA 1JB0E 3RDVA 1KQSS 1H3HA 3FDRA 2QQSA 2CZ6B 2XIDA 3CC4Q 2YWWA 1WX6A 1C1AA 5GAOr 1VQ8A 1GBRA 4OB3B 4A63B 4XAXB 2O31A 1BU1A 2HZYA 2YUNA 2KRNA 4HA8A 4ZN1A 2ZAEA 4YTLA 2O88A 2CP2A 3JRZA 4DOVA 1T3SA 3CMEA 1I1JA 4OP0A 4JS4A 1FYNA 4E7ZA 3FIFA 2XKOC 1R0CB 2IPOB 2OAWA 3WXMB 4M75B 2DA9A 3REAB 4N4IA 3HP9A 2KQWA 5I2SA 3MO8A 3QZ5B 3OS1A 1UGRB 3VS5A 1Y0MA 4RKUE 2HCKA 2GTJA 1RAEB 4PLIA 4N4HA 5GANj 3M57A 5CK9A 1UHCA 3QPHA 3OYNA 3VRYA 3CXCP 2E6NA 3VYGA 2HEQA 3G1JA 4ORZA 2A37A 2KYBA 1OI1A 4A4EA 3JB9G 3OS0A 4EMKC 1P92A 1FXXA 2NUPA 3X20B 2RNAA 2DXCA 3TU4K 1WJRA 2CP5A 3FLGA 2DIGA 1ZUKA 3CD6Q 3LGLA 1TUDA 3EFSA 4KRTA 1FMWA 1M2VB 1NLOC 3PMTA 2QA4A 2M9UA 4GY5A 2BE9B 3JCMW 4F7UA 3A8OB 2QTVA 4OMFB 1ZSGA 1K8AU 3N5BB 1RLPC 3VRZA 2KNBB 2QGFB 5J3BA 3WVEB 3Q1JA 4WF2A 3CCQQ 2BKDN 4EDUA 3C95A 4GLKA 2X51A 5IN1A 1V1CA 2L3SA 3M9QA 5LJ3f 1YJNQ 1IGUA 2CP6A 1M1GA 3G4SA 5L23A 4LDYA 3X28B 1K0XA 4IUUA 1W70A 2FHDA 1Y7XA 3VV0A 2CT3A 2EGCA 1G5VA 3BY7A 1CKAA 2KK4A 5GANd 2DK3A 3PTAA 4FT4A 1VYUA 4LNPA 1LOJA 1KSWA 4DBFA 2OX7A 1LPLA 1JXOA 4OVAA 2FZKB 1U5SA 3T9NA 3CBMA 4EMKA 2FRYA 1K9MU 4M7AG 1YWPA 2DO3A 1HD3A 4O5VA 2COWA 1UECA 2RQWA 1AZEA 2RJDA 3TEEA 2EYYA 1YIJA 3OYJA 2AHJB 1AT1B 2AKKA 5KYXB 4IIMA 3CD6A 2P0PA 4O6JA 1VQ4A 3JCMf 3CCLA 4A4HA 4XTZA 4XTUA 1G3TA 3CXCA 1M90U 3G71T 1VQNA 3HSBA 2ZZDA 3OS2A 3H9NA 2M0OA 3G6EQ 2DIQA 2JS2A 3HKSA 1RI9A 2QA4T 3ME9A 4ANJA 2J6FA 5CKFA 3KBGA 1JJ2P 4C0GA 2DL4A 3CMAT 4JRQA 1NJIR 1HYOA 2G3RA 3GF5A 3HRTA 1SHFA 2XK0A 4KULA 4AFQC 1G3SA 4C0DC 4M7DC 2BIVA 1YHQA 1XTDA 3JCMV 2HD0A 3CC2Q 4X9CA 2L89A 1K8AR 2LDMA 1KC8U 4OGEA 2ECZA 4LD6A 4RTXA 1M1KC 1OQKA 5FRMA 1KQSP 4P5NA 3OB9A 3WVDB 1GCPA 3A8MB 1U8RA 1MHNA 1HJDA 2ROTA 4KH1B 5ECAA 5J26A 2DYBA 1YI2Q 2NUZA 5IHNA 3HRSA 1M3CA 5KYYB 5HK3A 4WCIA 5EC7A 1X27A 4DBHA 4ZGDB 3CCEA 4JJNK 1BCOA 1EIFA 4PFZA 2QXFA 4E6RA 1GRIA 1EFNA 5GAOm 2LCCA 1ZBXA 4PJOC 4BI8B 5GAN7 1X6OA 3V7SA 3NTKA 2K3BA 1AWOA 5LJ5d 1WIEA 2VVKA 1BI3A 1VQMA 2FB7A 3UT1A 5HK0A 2EQJA 5KH6A 3EH1A 1M90C 1X6BA 5A0DA 4Z8AA 2JM8A 5J39A 1UJYA 4BACA 1PC0A 2KE9A 1QQJA 1GBQA 1R77A 1VQ6A 2BZ8A 1YCSB 3PGGA 5D7UA 1KC8R 1VQMT 4FYXB 3ZL7C 2YHTA 4C8QB 1M2OA 1FMVA 1UGQB 1TTHB 1VQMQ 4B6MA 3OA6A 4A4KA 5CKDA 3JB9D 1RAGB 4C8QG 3I56T 1PM3A 2IG0A 4M7DE 4F7UE 4PJOE 3JCMJ 2GF7A 2CYZB 2VXEA 3NGPA 1NLPC 2D0NA 1J3TA 3EGXB 1FMKA 1BB9A 1S72T 1NJIC 3J7AF 4M77B 2LT4A 4CC7A 1B07A 2DZCA 3PIOA 3CMET 3MHXA 2F2VA 3TREA 4V2SA 3CQTA 3UPUA 2GQIA 4M77G 4BE2A 4DA4A 5KCOA 4AT1B 3VUBA 2KYMA 1NPPA 2F5KA 1RADB 3I9QA 1M5Q1 1MMNA 1ABQA 2SRCA 4FYWB 2HBPA 2RHYA 1D3BB 1RAHB 2LQNA 1K4US 3HFOA 4JZ4A 2D8HA 1H8KA 4A53A 4DEYA 4M77E 2DXTA 4KGZB 3EGDB 2GFUA 2E5KA 1M2VA 4LE9A 3EHQA 4M7AF 3CC7T 4KH0B 1ZSZC 2ED0A 1PCXA 1QCNA 3GPLA 2LX9A 2ZPIB 2RO0A 1AVZC 1R0BG 2RK1A 2DETA 1SG5A 4ATOA 2EYXA 1BCMA 4JRIA 3OYAA 4XU0A 2JZ2A 1GCQC 3JCMP 5KE3A 1VQLT 2QA4Q 1TU0B 2CDTA 3G6ET 1K9MR 4AFSC 1JJ2S 1S72A 3OYBA 2JT4A 3MEVA 3VJPA 4OB2B 3OY9A 4FCYA 3S3MA 2K2VA 2K4YA 3M0PA 1IHWA 2RHZA 4CC3A 2ZPBB 2YUOA 4J9GA 3MJXA 3J81E 1VQ8T 5FWBA 2MF2A 2DTHA 5LL6S 2AKLA 3LWHA 3JSCA 4NOYA 2DNUA 3DB4A 4OGCA 1WDXA 2EKHA 3P8DA 1NJIU 3CCRA 3LLRA 2ED1A 3JB9I 4J9IA 2RQUA 3GBQA 2OAUA 3CCMA 1EZZB 3CMAA 1WFWA 2HQHA 3SWNB 4ELZC 2QYZA 2ZCFB 1VQ4Q 5CO7A 2E70A 3PMIA 1VQ9Q 3CCQT 4QQDA 3PVQA 4RTTA 4PJOF 2E1HA 3A8LB 3SEMA 4E7HA 1Q82U 1K0SA 3S6WA 5GAN2 2MIOA 1YJWQ 1WHGA 3THKA 4A54A 3VU3C 1ABOA 3A1PA 2DMOA 4M4ZA 3CD6T 1M4ZA 5GAOp 1AD5A 4C92B 2LRQA 4RCBA 2R5AA 1TWBA 2R57A 3M0UA 2LX7A 2DL5A 1VQ6Q 3X25B 1ZX6A 3EG3A 2JW4A 2QEXQ 1MUZA 2DEQA 3CPWA 2EYZA 4BDYA 3LW5E 4C0ZA 1VQ5T 2OTLT 2EIFA 1SKUB 1UHFA 1AWWA 3E1SA 4M7DA 1PKSA 4JZ3A 2HAXA 1Y57A 2DJZA 2K6DA 1JJ2A 1K73C 4D6WA 4BI4A 2EWNA 1YHQT 1E7OA 3L1AA 4NL3A 4RTZA 3H0IA 4M7AA 1K73U 1MMDA 4MZPA 3E19A 4M75G 2A08A 2FRWA 3BE3A 3P8BB 4X9DA 2EAYA 3LGFA 3VS3A 1RAAB 3URGA 1YJ9Q 2HSEB 5M9OA 2DX1A 4PJMA 2D8JA 2DXUA 2RPNA 2J6OA 2V1RA 3CCUA 3G4ST 3A98A 1RABB 4J7IA 2A28A 2VC8A 3QJ6A 4DEXA 5KYXA 3R6NA 2Y90A 1BI1A 2YLCA 2FEIA 4OB0B 4IUQA 5GAMd 3M0QA 3KFVA 1B34A 3PE0A 2D6FA 1VQNT 2DD5A 2Y4XA 3G4SQ 4F04B 1M1KR 1PWTA 1VUBA 5FU6C 4MZMA 2F69A 3QDFA 3QIIA 4ELYC 3MPUB 3I55A 1VQOA 4RTWA 3P8HA 3MCAB 3NPFA 3TSWA 4JJDA 3QWYA 2O2OA 4X1VA 5GAOl 5C0MA 3C94A 2O4XB 1VIEA 4E7IA 2J6KA 3EGDA 1KG1A 1G3WA 4LDVA 2KMTA 1UEBA 2RN8A 2JM9A 3DLMA 2PTKA 1KJWA 3MEUA 4QW2A 5GANh 1JRIA 2DLPA 5I2MA 5FRNA 3VS4A 1VQ5Q 3CCJT 1S1NA 2C0OA 1IZ6A 2DEUA 2FZCB 1WZOA 2K7AA 3SDZA 1QVGA 1NPRA 1VQ6T 2COZA 4M77C 2RM4A 2VUBA 3NTHA 3OW2A 4BY6C 1GFDA 1PNJA 2OI3A 2DZ9A 1W1FA 4OF1A 4C8QE 4Y28E 4M7DF 2A0FB 1YJWT 2OTJQ 2RJEA 4LDWA 2V8KA 2RJCA 5GJWB 1JQQA 3MEAA 3ZEHA 2XHCA 1GCQA 5LJ5j 2B8AA 4C8QC 2C0IA 3EFRA 3EFOB 1Y71A 2DTIA 2M16A 1VQ4T 2RI2A 2MAMA 3CBPA 4M78A 5A2QE 2ZPEB 1VQKT 1C6VX 2NUPB 1UJ0A 1UUEA 4OMOA 4R0KA 1D1BA 2JXBA 1VYTA 3VS6A 3GOXA 1Q86R 1DJ7B 2EYQA 2LMJA 4HVWA 2JUFA 1YCYA 2EBPA 3EGXA 3GIBA 1W4SA 2E3HA 2L3QA 4ZNXA 1PKTA 1X6GA 3M56A 2BZYA 1YJ9A 3HFNA 5GJVB 4M77A 1RAIB 3CC4A 4PFOA 4HCCA 3NHNA 5I21A 1FWZA 5GMKl 1BK2A 2BTTA 3SHWA 3OYDA 1M3AA 3EH2A 3PVLA 1FX7A 5GAOn 2HBWA 4BDZA 2CKKA 1QVFA 2ESWA 1MMAA 2VGNA 4IKFA 1YJ9T 5HCKA 5A0LA 1BI2A 2J05A 1VQLQ 2FL7A 5KYYA 3EG0A 2FPEA 3HRUA 5CQYA 3I5SA 4PNOA 2DL8A 4J9FA 4M7DB 3OMCA 4N0AA 4A4GA 3SWNA 3VS0A 3S3OA 2VWFA 1T3LA 1YHQQ 4XU3A 4LDXA 1Y07A 1AZGB 1PRLC 2QQBA 1E6GA 2XG8D 1QVFS 2YRCA 5GMKe 1M8VA 2PUOB 3CCRQ 1Q86C 4C5IA 1ZUYA 2OTLQ 3EG2A 3RBBB 3OYCA 1OULA 2F1LA 4OMLA 2DFUA 4FSSA 1RL2A 3M0TA 1RACB 2JMAA 2NUTB 4ZGJB 1X75C 4M7DD 5CQXA 2DAQA 4XK8E 1ZBJA 1TXQA 1KQSA 1M90R 3TQ7P 2E41A 1I8FA 3EG9B 5LJ5e 5GMKh 2AIRB 1PSFA 1VQLA 2CUBA 2M51A 1G3YA 1HK9A 3DB3A 3JB9H 1WHHA 4C5EA 1Y96A 2V8IA 1ZQ1A 1VQ9T 3I55Q 4M7AC 1N8RC 1K9MC 1M9SA 2YSQA 3V8LA 4QQGA 1GL5A 4L6V5 1CKBA 2L8DA 2QQAA 3CCUT 2L2PA 2QEXA 1QW1A 4JPBW 3RNJA 2EW3A 2D9TA 3RUXA 1ZA2B 3SB2A 2H3JA 2DXBA 4EIKA 2GQVA 3JB9F 4M78F 2EQUA 5GAOq 4F7UG 4J6WA 3FB9A 3PIPA 7AT1B 1D3BA 1AEYA 5GAMj 1U1TA 4J7FA 5GAN6 2K3YA 1VQ8Q 1RLQC 1OU8A 2CREA 1KQ2A 2CH4A 2YRVA 2RH2A 4N0AC 4C92E 4R56A 2X4WA 3RR6A 1VQPT 1GXIE 4AG2C 3KXTA 2MWOA 4FL6A 1MMGA 4MMKA 3G71A 1Q82C 5GAN3 2LJ3A 5I22A 1I5LA 2CZ1B 1WPYA 4E7JA 3C0CA 3UF4A 2E3IA 1H3ZA 1B3QA 4OMPA 4FIBA 2DE0X 2EPDA 2ROLA
chains in the Genus database with same CATH topology
2HSPA 2AZSA 2AK5A 2EVRA 2FO0A 3PVQA 4RTTA 1K0SA 1RUWA 3SEMA 3ULRB 4D8KA 4JJBA 1YWOA 1LCKA 3M0SA 1SSHA 1H3HA 2FPDA 1BBZA 2CSIA 2MIOA 2JMCA 3THKA 3H0HA 1ABOA 1K9AA 1WX6A 2DMOA 4M4ZA 1GBRA 2ABLA 4A63B 4J9DA 4GBQA 4J9CA 2V1QA 1I0CA 2O31A 3IQLA 1AD5A 3VS2A 1BU1A 2YUNA 3M0UA 5I11A 2LX7A 4AG1C 2DL5A 1N5ZA 5FWCA 2PZ1A 1ZX6A 1U3OA 2KRNA 3EG3A 2JW4A 1MUZA 2EYZA 4ESRA 2O88A 1XOVA 3FJ5A 1T3SA 1I1JA 2QDLA 5IHIA 1FYNA 1UHFA 1JEGA 1AWWA 2OAWA 2RQVA 1PKSA 4JZ3A 2K9GA 1Y57A 2DA9A 3REAB 1KFZA 2K6DA 4RTUA 2W0ZA 2YUQA 3VS5A 1AWXA 1E7OA 1Y0MA 2HCKA 2GTJA 1SEMA 1A0NB 1UHCA 2XMFA 3H0IA 4RTZA 4LUEA 3VRYA 3REBB 3I5RA 2J7IA 2LNHB 2HEQA 1QKWA 4ORZA 2A08A 2FRWA 2A37A 2KYBA 1H92A 3VS3A 2GTOA 1OEBA 4RTVA 2F2XA 2L3PA 2DL3A 3O5ZA 2KGTA 1M30A 1HSQA 2DX1A 2GGRA 2D8JA 1JXMA 2RNAA 2RPNA 2FPFA 2J6OA 2V1RA 1UG1A 1ZUKA 3A98A 1TUDA 4KRTA 3I35A 2A28A 1NLOC 1M3BA 4DEXA 3R6NA 1X43A 1ZSGA 1OV3A 2DF6A 1RLPC 2FEIA 3VRZA 2KNBB 4Z89A 3M0QA 2DBMA 3KFVA 4AFUC 3PE0A 2KRMA 4OMNA 1ZLMA 4LUDA 1MV3A 1V1CA 2L3SA 2GNCA 2KXDA 2MCNA 2K79A 1PWTA 5FW9A 5L23A 2CSQA 1K0XA 2SEMA 1W70A 1QLYA 4RTWA 2CH4W 2CT3A 2EGCA 1AOJA 3EHRA 3UA7A 1CKAA 4K11A 1KIKA 2L0AA 2KT1A 1SRLA 1OPKA 1VYUA 3NPFA 4OMQA 3TSWA 4LNPA 4RUGA 1NYFA 1KSWA 3H0FA 4JJDA 3QWYA 2O2OA 4X1VA 1VA7A 1JXOA 1U5SA 2FRYA 1YWPA 1HD3A 3LH5A 3M0RA 3NMZC 1WXTA 1UECA 1U06A 2J6KA 2RQWA 1AZEA 2EYYA 1PHTA 2DRKA 3QWXX 1E6HA 2AKKA 2JM9A 2RN8A 4IIMA 2PTKA 1KJWA 2JTEA 4J9HA 2K2MA 2DLPA 3U23A 2B86A 3VS4A 2NWMA 2RQTA 4J9EA 2YUPA 3UATA 1SRMA 1S1NA 1UDLA 2C0OA 2JS2A 1RI9A 2K7AA 2J6FA 3UA6A 2DL4A 1SHGA 3VS7A 1UFFA 1SHFA 2FG0A 1X2KA 4AFQC 4CC2A 3JV3A 2MOXA 1QCFA 1ZUUA 1T0HA 1GFDA 1PNJA 2OI3A 1W1FA 2LQWA 2RF0A 3EG1A 2LJ1A 2ECZA 1QKXA 4RTXA 4AFZC 5GJWB 3H41A 1JQQA 1JO8A 1K1ZA 1GCQA 2X3XD 2ENMA 3EGUA 1GCPA 2C0TA 2F2WA 2HDAA 2C0IA 1HJDA 2ROTA 5ECAA 2DYBA 4HVVA 2NUZA 5IHNA 1UTIA 1M3CA 2EGEA 2EQIA 1UJ0A 2G6FX 1UUEA 4OMOA 4WCIA 1IO6A 5EC7A 1X27A 2KBTA 4R0KA 1OPLA 2JXBA 2P4RA 5IH2A 1VYTA 4E6RA 1GRIA 1EFNA 1WXBA 3VS6A 1AWJA 1TUCA 4F17A 2K3BA 1AWOA 2LMJA 1WIEA 4HVWA 2VVKA 2KROA 2EBPA 5IXBA 2CUDA 2L3QA 4ZNXA 1PKTA 1X6GA 2BZYA 2LP5A 5GJVB 2EYWA 5IXFA 5IHKA 1QWFA 2X3WD 2YDLA 1YNZA 3NHNA 1X6BA 2W10A 4F16A 1G83A 4Z8AA 2JM8A 1UJYA 1BK2A 1M27C 2YT6A 2OJ2A 1MV0B 4JJCA 2BTTA 4CC4B 2KE9A 3SHWA 2DILA 1M3AA 1GBQA 2DJQA 3PVLA 4HCKA 2BZ8A 2HBWA 1SPKA 1YCSB 2O9VA 2ESWA 3ZL7C 4LN2A 5HCKA 1Z9ZA 2J05A 3EG0A 2DL7A 4J9BA 2FPEA 3I5SA 2RMOA 2DL8A 4J9FA 1WYXA 1TG0A 1ARKA 1X2QA 2VKNA 1YP5A 3VS0A 3NGPA 1NLPC 2D0NA 2VWFA 1J3TA 1NYGA 1T3LA 1FMKA 2CT4A 1AZGB 1BB9A 1PRLC 2JS0A 1E6GA 1WLPB 1UE9A 2D1XA 4GLMA 4CC7A 1B07A 2F2VA 1ZUYA 3CQTA 3EG2A 2GQIA 3RBBB 2KRSA 1OOTA 4OMLA 4FSSA 4QT7A 2DM1A 2KYMA 3M0TA 3I9QA 1WA7A 2JMAA 2M0YA 1CSKA 2LZ6B 1ABQA 2SRCA 2PNIA 1QWEA 2GBQA 1W6XA 2H8HA 2LQNA 1K4US 1ZBJA 4JZ4A 2IIMA 2D8HA 1H8KA 4DEYA 2I0NA 3TVTA 1K76A 4Z88A 2E5KA 2KT8A 4LE9A 2CUBA 2M51A 2LCSA 3EHQA 2ED0A 4RTYA 4HXJA 2DBKA 1T0JA 1AVZC 1UGVA 2YSQA 1WXUA 1GL5A 2EYXA 1CKBA 2L2PA 1JU5C 4JPBW 3RNJA 2EW3A 1GCQC 4OMMA 1G2BA 4F14A 4EIKA 2CDTA 1NEBA 4AFSC 2RQRA 3VS1A 1AEYA 2JT4A 1NM7A 3M0PA 1RLQC 2CREA 1I07A 1PRMC 2CH4A 4CC3A 2YUOA 4J9GA 3TSZA 2LJ0A 2DVJA 2O9SA 1YN8A 2EGAA 5FWBA 1VYVA 2KEAA 2AKLA 4AG2C 2AZVA 2KXCA 1NG2A 2J06A 2DNUA 2BZXA 1NEGA 1WDXA 2KR3A 2EKHA 1X69A 2LJ3A 5I22A 2ED1A 4D8DA 2DRMA 1M8MA 2A36A 2RQUA 3C0CA 4J9IA 3UF4A 4IIOA 1GFCA 1B3QA 3GBQA 4Y92A 4OMPA 1Z9QA 2DE0X 1WI7A 2EPDA 1WFWA 4HVUA 2ROLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSP A;  2AZS A;  2AK5 A;  2EVR A;  2FO0 A;  3PVQ A;  4RTT A;  1K0S A;  1RUW A;  3SEM A;  3ULR B;  4D8K A;  4JJB A;  1YWO A;  1LCK A;  3M0S A;  1SSH A;  1H3H A;  2FPD A;  1BBZ A;  2CSI A;  2MIO A;  2JMC A;  3THK A;  3H0H A;  1ABO A;  1K9A A;  1WX6 A;  2DMO A;  4M4Z A;  1GBR A;  2ABL A;  4A63 B;  4J9D A;  4GBQ A;  4J9C A;  2V1Q A;  1I0C A;  2O31 A;  3IQL A;  1AD5 A;  3VS2 A;  1BU1 A;  2YUN A;  3M0U A;  5I11 A;  2LX7 A;  4AG1 C;  2DL5 A;  1N5Z A;  5FWC A;  2PZ1 A;  1ZX6 A;  1U3O A;  2KRN A;  3EG3 A;  2JW4 A;  1MUZ A;  2EYZ A;  4ESR A;  2O88 A;  1XOV A;  3FJ5 A;  1T3S A;  1I1J A;  2QDL A;  5IHI A;  1FYN A;  1UHF A;  1JEG A;  1AWW A;  2OAW A;  2RQV A;  1PKS A;  4JZ3 A;  2K9G A;  1Y57 A;  2DA9 A;  3REA B;  1KFZ A;  2K6D A;  4RTU A;  2W0Z A;  2YUQ A;  3VS5 A;  1AWX A;  1E7O A;  1Y0M A;  2HCK A;  2GTJ A;  1SEM A;  1A0N B;  1UHC A;  2XMF A;  3H0I A;  4RTZ A;  4LUE A;  3VRY A;  3REB B;  3I5R A;  2J7I A;  2LNH B;  2HEQ A;  1QKW A;  4ORZ A;  2A08 A;  2FRW A;  2A37 A;  2KYB A;  1H92 A;  3VS3 A;  2GTO A;  1OEB A;  4RTV A;  2F2X A;  2L3P A;  2DL3 A;  3O5Z A;  2KGT A;  1M30 A;  1HSQ A;  2DX1 A;  2GGR A;  2D8J A;  1JXM A;  2RNA A;  2RPN A;  2FPF A;  2J6O A;  2V1R A;  1UG1 A;  1ZUK A;  3A98 A;  1TUD A;  4KRT A;  3I35 A;  2A28 A;  1NLO C;  1M3B A;  4DEX A;  3R6N A;  1X43 A;  1ZSG A;  1OV3 A;  2DF6 A;  1RLP C;  2FEI A;  3VRZ A;  2KNB B;  4Z89 A;  3M0Q A;  2DBM A;  3KFV A;  4AFU C;  3PE0 A;  2KRM A;  4OMN A;  1ZLM A;  4LUD A;  1MV3 A;  1V1C A;  2L3S A;  2GNC A;  2KXD A;  2MCN A;  2K79 A;  1PWT A;  5FW9 A;  5L23 A;  2CSQ A;  1K0X A;  2SEM A;  1W70 A;  1QLY A;  4RTW A;  2CH4 W;  2CT3 A;  2EGC A;  1AOJ A;  3EHR A;  3UA7 A;  1CKA A;  4K11 A;  1KIK A;  2L0A A;  2KT1 A;  1SRL A;  1OPK A;  1VYU A;  3NPF A;  4OMQ A;  3TSW A;  4LNP A;  4RUG A;  1NYF A;  1KSW A;  3H0F A;  4JJD A;  3QWY A;  2O2O A;  4X1V A;  1VA7 A;  1JXO A;  1U5S A;  2FRY A;  1YWP A;  1HD3 A;  3LH5 A;  3M0R A;  3NMZ C;  1WXT A;  1UEC A;  1U06 A;  2J6K A;  2RQW A;  1AZE A;  2EYY A;  1PHT A;  2DRK A;  3QWX X;  1E6H A;  2AKK A;  2JM9 A;  2RN8 A;  4IIM A;  2PTK A;  1KJW A;  2JTE A;  4J9H A;  2K2M A;  2DLP A;  3U23 A;  2B86 A;  3VS4 A;  2NWM A;  2RQT A;  4J9E A;  2YUP A;  3UAT A;  1SRM A;  1S1N A;  1UDL A;  2C0O A;  2JS2 A;  1RI9 A;  2K7A A;  2J6F A;  3UA6 A;  2DL4 A;  1SHG A;  3VS7 A;  1UFF A;  1SHF A;  2FG0 A;  1X2K A;  4AFQ C;  4CC2 A;  3JV3 A;  2MOX A;  1QCF A;  1ZUU A;  1T0H A;  1GFD A;  1PNJ A;  2OI3 A;  1W1F A;  2LQW A;  2RF0 A;  3EG1 A;  2LJ1 A;  2ECZ A;  1QKX A;  4RTX A;  4AFZ C;  5GJW B;  3H41 A;  1JQQ A;  1JO8 A;  1K1Z A;  1GCQ A;  2X3X D;  2ENM A;  3EGU A;  1GCP A;  2C0T A;  2F2W A;  2HDA A;  2C0I A;  1HJD A;  2ROT A;  5ECA A;  2DYB A;  4HVV A;  2NUZ A;  5IHN A;  1UTI A;  1M3C A;  2EGE A;  2EQI A;  1UJ0 A;  2G6F X;  1UUE A;  4OMO A;  4WCI A;  1IO6 A;  5EC7 A;  1X27 A;  2KBT A;  4R0K A;  1OPL A;  2JXB A;  2P4R A;  5IH2 A;  1VYT A;  4E6R A;  1GRI A;  1EFN A;  1WXB A;  3VS6 A;  1AWJ A;  1TUC A;  4F17 A;  2K3B A;  1AWO A;  2LMJ A;  1WIE A;  4HVW A;  2VVK A;  2KRO A;  2EBP A;  5IXB A;  2CUD A;  2L3Q A;  4ZNX A;  1PKT A;  1X6G A;  2BZY A;  2LP5 A;  5GJV B;  2EYW A;  5IXF A;  5IHK A;  1QWF A;  2X3W D;  2YDL A;  1YNZ A;  3NHN A;  1X6B A;  2W10 A;  4F16 A;  1G83 A;  4Z8A A;  2JM8 A;  1UJY A;  1BK2 A;  1M27 C;  2YT6 A;  2OJ2 A;  1MV0 B;  4JJC A;  2BTT A;  4CC4 B;  2KE9 A;  3SHW A;  2DIL A;  1M3A A;  1GBQ A;  2DJQ A;  3PVL A;  4HCK A;  2BZ8 A;  2HBW A;  1SPK A;  1YCS B;  2O9V A;  2ESW A;  3ZL7 C;  4LN2 A;  5HCK A;  1Z9Z A;  2J05 A;  3EG0 A;  2DL7 A;  4J9B A;  2FPE A;  3I5S A;  2RMO A;  2DL8 A;  4J9F A;  1WYX A;  1TG0 A;  1ARK A;  1X2Q A;  2VKN A;  1YP5 A;  3VS0 A;  3NGP A;  1NLP C;  2D0N A;  2VWF A;  1J3T A;  1NYG A;  1T3L A;  1FMK A;  2CT4 A;  1AZG B;  1BB9 A;  1PRL C;  2JS0 A;  1E6G A;  1WLP B;  1UE9 A;  2D1X A;  4GLM A;  4CC7 A;  1B07 A;  2F2V A;  1ZUY A;  3CQT A;  3EG2 A;  2GQI A;  3RBB B;  2KRS A;  1OOT A;  4OML A;  4FSS A;  4QT7 A;  2DM1 A;  2KYM A;  3M0T A;  3I9Q A;  1WA7 A;  2JMA A;  2M0Y A;  1CSK A;  2LZ6 B;  1ABQ A;  2SRC A;  2PNI A;  1QWE A;  2GBQ A;  1W6X A;  2H8H A;  2LQN A;  1K4U S;  1ZBJ A;  4JZ4 A;  2IIM A;  2D8H A;  1H8K A;  4DEY A;  2I0N A;  3TVT A;  1K76 A;  4Z88 A;  2E5K A;  2KT8 A;  4LE9 A;  2CUB A;  2M51 A;  2LCS A;  3EHQ A;  2ED0 A;  4RTY A;  4HXJ A;  2DBK A;  1T0J A;  1AVZ C;  1UGV A;  2YSQ A;  1WXU A;  1GL5 A;  2EYX A;  1CKB A;  2L2P A;  1JU5 C;  4JPB W;  3RNJ A;  2EW3 A;  1GCQ C;  4OMM A;  1G2B A;  4F14 A;  4EIK A;  2CDT A;  1NEB A;  4AFS C;  2RQR A;  3VS1 A;  1AEY A;  2JT4 A;  1NM7 A;  3M0P A;  1RLQ C;  2CRE A;  1I07 A;  1PRM C;  2CH4 A;  4CC3 A;  2YUO A;  4J9G A;  3TSZ A;  2LJ0 A;  2DVJ A;  2O9S A;  1YN8 A;  2EGA A;  5FWB A;  1VYV A;  2KEA A;  2AKL A;  4AG2 C;  2AZV A;  2KXC A;  1NG2 A;  2J06 A;  2DNU A;  2BZX A;  1NEG A;  1WDX A;  2KR3 A;  2EKH A;  1X69 A;  2LJ3 A;  5I22 A;  2ED1 A;  4D8D A;  2DRM A;  1M8M A;  2A36 A;  2RQU A;  3C0C A;  4J9I A;  3UF4 A;  4IIO A;  1GFC A;  1B3Q A;  3GBQ A;  4Y92 A;  4OMP A;  1Z9Q A;  2DE0 X;  1WI7 A;  2EPD A;  1WFW A;  4HVU A;  2ROL A; 
#chains in the Genus database with same CATH topology
 4JS5 A;  3CCV Q;  2EKO A;  4M75 C;  1Q81 C;  1VQ9 A;  1BI0 A;  2EVR A;  3NTI A;  1NE8 A;  3ULR B;  3CC7 Q;  1SSH A;  2O4X A;  1N9R A;  1YJW A;  1VQ5 A;  1BBZ A;  3HPW A;  2CSI A;  2JMC A;  3RKY A;  1Q81 U;  5CKB A;  1K9A A;  2R58 A;  3KUF A;  4E2F B;  3CCV T;  1PSE A;  4M7A D;  4GBQ A;  4J9C A;  2KAF A;  2V1Q A;  1I0C A;  3H6Z A;  1M1K U;  3OQ5 A;  4AG1 C;  1Q7Y C;  3HTR A;  1N5Z A;  5FWC A;  4ESR A;  1XOV A;  3FJ5 A;  2QDL A;  2RI5 A;  5FU7 B;  3LH0 A;  2DPP B;  3OYM A;  2RQV A;  3G71 Q;  3ZBD A;  2K9G A;  4M77 D;  1IHV A;  2DTO A;  2CP3 A;  1S72 Q;  2YUQ A;  4ZGE B;  3OYG A;  3M54 A;  1B34 B;  5DLQ E;  3QUI A;  3ER0 A;  4BI3 A;  2GCX A;  1W2B P;  3I5R A;  3E2U A;  1QVF P;  2LNH B;  1R8O B;  1U1S A;  3JCM c;  5GAN f;  3CC7 A;  1VQ7 A;  2R5M A;  1YBY A;  1H92 A;  1ZA1 B;  2VB6 A;  4RTV A;  2F2X A;  2L3P A;  1Y96 B;  1WQW A;  2KGT A;  1M30 A;  3OYH A;  3JCM X;  4QVZ A;  1HSQ A;  8AT1 B;  5IAY A;  4JRP A;  3EAE A;  3CCU Q;  4DQ2 A;  3V8K A;  4XU2 A;  1YJN T;  3I35 A;  4PFP A;  5CAI A;  3I55 T;  1M3B A;  2X35 A;  5EG2 A;  5LJ5 f;  3CBO A;  3V8J A;  1RAF B;  1X43 A;  1OV3 A;  1SF9 A;  1Q7Y R;  3CCS A;  1XJW B;  4C8Q A;  1C0M A;  4AFU C;  3V7C A;  2KRM A;  4OMN A;  1ZLM A;  4LUD A;  1KHI A;  4PJO A;  2MCN A;  2WSC E;  5FW9 A;  2C06 A;  4C92 C;  1LNX A;  2CS7 A;  1K73 R;  4FM4 B;  4FU6 A;  4C0F A;  1OPK A;  4M78 D;  4M78 G;  4OMQ A;  1OX9 A;  4PJJ A;  2A3L A;  1Q86 U;  1I5O B;  1VA7 A;  3CCR T;  1M1F A;  1WGS A;  1UB4 A;  2KSS A;  3MP8 A;  3LH5 A;  3NMZ C;  1WXT A;  3UDC A;  1U06 A;  1D0Z A;  1PHT A;  2DRK A;  4HCB A;  1AHJ B;  3GLX A;  4L59 A;  1KD1 R;  2O01 E;  1D1C A;  2JTE A;  2MWP A;  3BDL A;  1IRE B;  2RD1 A;  3CCE Q;  2K2M A;  2B86 A;  1I81 A;  2PUK B;  1B7T A;  2YUP A;  1D1A A;  2RHU A;  3UAT A;  2E64 A;  3CCS Q;  1Q7Y U;  1UDL A;  2X9H A;  4BE0 A;  4B9W A;  3C12 A;  5CCA A;  4A4F A;  2K5I A;  1WJQ A;  4JRK A;  2CGH A;  1UFF A;  2FG0 A;  2JOY A;  1X2K A;  4CC2 A;  2BE7 D;  2E10 A;  4J5Y A;  1RI0 A;  1ZUU A;  1VQK A;  5A0G A;  3OSS C;  3M53 A;  2LQW A;  2RF0 A;  1BKB A;  2X4X A;  3EG1 A;  1SSF A;  2E5Q A;  5LJ5 g;  2X4Y A;  4AFZ C;  3D7S B;  4LDU A;  1JO8 A;  1K1Z A;  2X3X D;  4FYY B;  2ENM A;  3JAM E;  3OMG A;  1MGQ A;  3G6E A;  3GP8 A;  3OBW A;  2F2W A;  3X24 B;  4MML A;  5LJ3 d;  1UTI A;  2EGE A;  2EQI A;  1OU9 A;  1OYX A;  4PJN A;  3V7R A;  1OPL A;  4C92 D;  2P4R A;  2VGM A;  5IH2 A;  4E7K A;  2I2L A;  5LJ3 j;  1WXB A;  1VQK Q;  3AHU A;  1ZHI A;  1TUC A;  4F17 A;  4X34 A;  2PQW A;  4DBR A;  2PVD B;  3JCM Q;  5DLO A;  2CUD A;  3PNW C;  2LP5 A;  2RK2 A;  2X3W D;  2NLU A;  1YNZ A;  3MEW A;  2W10 A;  5C6S A;  2OJ2 A;  4JJC A;  5KYU A;  3R6O A;  1V29 B;  3CCM Q;  2DJQ A;  3M4G A;  4VUB A;  1SPK A;  2V26 A;  2BUD A;  2O9V A;  2L3R A;  4PJO G;  1LJO A;  4XTX A;  4PL6 A;  5L8R E;  3X26 B;  5FRO A;  4E47 A;  1Z9Z A;  4HCZ A;  4RG2 A;  2DL7 A;  3RER A;  4II1 A;  2RMO A;  1YI2 A;  3DKM A;  4B9X A;  4TVR A;  1TG0 A;  1YIJ T;  3CCM T;  1NZ9 A;  1YP5 A;  3CPW P;  1WJS A;  4PLL A;  1X01 A;  4DOW A;  4J83 A;  2JN0 A;  2CT4 A;  1QP2 A;  2EJG A;  2JS0 A;  4HT8 A;  1WLP B;  4M75 D;  2H3E B;  1UE9 A;  2F5T X;  2M1H A;  5FU7 C;  2QTX A;  5D6X A;  2L5Q A;  2OTL A;  4M7D G;  3OW2 P;  3CEY A;  3A8H B;  1OOT A;  5LJ3 h;  2LVM A;  3RKW A;  2DM1 A;  2DER A;  1QP3 A;  1NBE B;  1WA7 A;  2M0Y A;  2JTF A;  2HL3 A;  1N9S A;  2PNI A;  1BYM A;  1QWE A;  2GBQ A;  1W6X A;  1LVK A;  5LJ5 h;  1BIB A;  1VQN Q;  3C4S A;  2I0N A;  2YLB A;  4Z88 A;  2QK0 A;  5CIU A;  1VQ7 T;  4C8Q D;  1K8A C;  1N27 A;  4E7L A;  2HQE A;  1TH7 A;  4HXJ A;  1T0J A;  4L5G A;  4C0D B;  3RMS A;  1WXU A;  4XTY A;  4FW2 A;  3GNF B;  2COY A;  1JU5 C;  4OMM A;  1G2B A;  4F14 A;  3BW1 A;  1NEB A;  3QJY A;  3GNG A;  4RMO A;  3G7Z A;  3CCS T;  2VAS A;  3UWN A;  2NUT A;  2KDS A;  4LXC A;  2EJ9 A;  2FZG B;  1NM7 A;  2RB6 A;  5DM7 R;  4UC4 A;  1XNI A;  3CCE T;  1TS9 A;  2RHI A;  4RG8 A;  2QAS A;  1I07 A;  1PRM C;  3JCM h;  3TSZ A;  5KYN A;  3CC2 A;  2DVJ A;  4KBM B;  1PD1 A;  3CXC S;  3OYL A;  4F7U B;  3LYI A;  2KEA A;  3H8Z A;  3QXE B;  4IUP A;  2XD0 A;  1NG2 A;  4C5G A;  3PFS A;  4KUD K;  2YRD A;  1NEG A;  2YXY A;  4JLI A;  3M59 A;  3LWI A;  1KD1 U;  2QEX T;  4D8D A;  1M8M A;  2P84 A;  3FRN A;  2LT1 A;  3M4Y A;  1GFC A;  2PVG B;  4EMG A;  1Z9Q A;  4EMH A;  2P4T A;  2VYT A;  3MKD A;  2HKQ B;  4HVU A;  4FSX A;  5D6Y A;  5AYF A;  3CCL Q;  2AZS A;  2AK5 A;  2FO0 A;  2EFI A;  4RCC A;  3FC3 A;  4D8K A;  4JJB A;  1YWO A;  1LCK A;  3M0S A;  2FPD A;  2RA2 A;  5KYW B;  1YJN A;  3H0H A;  2Z0W A;  2MPX C;  2E4H A;  2ABL A;  3OSV A;  5KE2 A;  2ATC B;  4J9D A;  2K5L A;  2DVE A;  3IQL A;  3L2Q A;  3VS2 A;  1TUG B;  5I11 A;  4FT2 A;  3HL8 A;  2CP0 A;  1IB8 A;  2HQX A;  2PZ1 A;  1U3O A;  3SD4 A;  2JNG A;  3QKJ A;  4Q5W A;  5IHI A;  4ME7 A;  3EG9 A;  3A8G B;  2CZ7 B;  1JEG A;  3M58 A;  3F70 A;  3QDR B;  2MI6 A;  4J6Y A;  4M78 E;  4M75 E;  3J80 E;  1KFZ A;  1O9S A;  4RTU A;  2W0Z A;  2FVU A;  2E6Z A;  3QSU A;  1AWX A;  4BY6 B;  5LJ3 e;  4MZT A;  1ZSZ A;  3QYG B;  4M7A E;  1W2B A;  1SEM A;  2A7Y A;  3LX7 A;  1VQO Q;  1N8R U;  1A0N B;  5IT9 E;  2XMF A;  5FU6 B;  4LUE A;  2XIC A;  3REB B;  1YIT Q;  4CRI A;  2J7I A;  5KCH A;  1Q82 R;  2CP7 A;  4QKU A;  1QKW A;  5GMK i;  4BD3 A;  5GMK m;  3VUZ A;  3L2R A;  2RJF A;  2GTO A;  2ZPH B;  2IVW A;  1OEB A;  2LTO A;  2DL3 A;  3O5Z A;  4XTW A;  4HKE A;  4IUV A;  2GGR A;  3A5Z B;  1JXM A;  2FPF A;  3L2V A;  1VIF A;  3VYH B;  2LC4 A;  1Q95 G;  2DYI A;  4M77 F;  3QZ9 B;  4XTV A;  1V76 A;  5GAN g;  1UG1 A;  3ASK A;  4PJO D;  2PU9 B;  1TSF A;  1QVP A;  5GMK j;  3QYH B;  1IXD A;  2WSF E;  2DF6 A;  1JBM A;  2RHX A;  5D6W A;  4Z89 A;  4FYV B;  3OYK A;  2DBM A;  3QG1 A;  3RIR A;  2X4J A;  2JVV A;  5GAM g;  2WAC A;  3OYE A;  4HT9 A;  2V8J A;  1MV3 A;  2P0K A;  2GNC A;  2KXD A;  2K79 A;  5KYU B;  3SFM A;  2WSE E;  2CSQ A;  2LQK A;  1IRX A;  2SEM A;  2Y4Y A;  1QLY A;  1H64 1;  2CH4 W;  3FEO A;  1AOJ A;  3EHR A;  2QQ9 A;  3UA7 A;  4Z02 A;  4K11 A;  1KIK A;  2L0A A;  2KT1 A;  1SRL A;  2K5F A;  2ZGW A;  1OX8 A;  4RUG A;  1NYF A;  6AT1 B;  3H0F A;  5CKH A;  5CVI A;  3CME Q;  2K3X A;  2E12 A;  2RI3 A;  2NYS A;  4JDS A;  2KVQ G;  3CPF A;  3M0R A;  1VQP Q;  1YIT T;  5GAN 5;  5HY6 A;  1PD0 A;  3QWX X;  1E6H A;  4J6X A;  2MMP A;  1TOV A;  4E7S A;  4J9H A;  3RMQ A;  2ZPG B;  9ATC B;  3U23 A;  2MK5 A;  3I56 Q;  3O8V A;  2NWM A;  2RQT A;  4J9E A;  3JCM b;  2QI2 A;  1PG5 B;  1SRM A;  4FW1 A;  5GAM h;  3L2U A;  3UA6 A;  3QBY A;  4MDX A;  2K57 A;  2QQR A;  1SHG A;  3VS7 A;  4JLG A;  4PKC C;  4BB7 A;  2QDY B;  3JV3 A;  2MOX A;  1QCF A;  1T0H A;  2XDB A;  3RKX A;  2DD4 A;  3RES A;  1VOM A;  4EMK B;  4OB1 B;  2LJ1 A;  4EPC A;  1QKX A;  4CI0 C;  2HNI A;  3M5A A;  3H41 A;  1UGP B;  1O75 A;  5CR2 A;  1VQP A;  3EGU A;  2P0Q A;  2C0T A;  2HDA A;  4KGX B;  3CCL T;  4AMC A;  1QVG S;  3VKI A;  4HVV A;  1KHC A;  5LJ3 g;  1WHM A;  2EQK A;  2HMA A;  3SWN C;  2G6F X;  5DY9 A;  1IO6 A;  2XDP A;  3S3N A;  2KBT A;  5FLX E;  4N4G A;  1HXD A;  1YI2 T;  4LD9 K;  3E9G A;  1AWJ A;  2VV5 A;  1EX4 A;  4M75 A;  3BDU A;  3L2W A;  2KRO A;  5IXB A;  2XDD A;  2XI9 A;  2EYW A;  1KC8 C;  5IXF A;  5IHK A;  4C92 F;  1QWF A;  1IGQ A;  2M02 A;  2YDL A;  4F16 A;  4QVD A;  1G83 A;  1M27 C;  2YT6 A;  1I4K 1;  1MV0 B;  4KGV B;  4CC4 B;  3JCM d;  3CC2 T;  2DIL A;  3ZFJ A;  4BUG A;  4HCK A;  3CCV A;  4ZTF A;  5GAN 8;  1UGS B;  3CMA Q;  1ACM B;  4LN2 A;  4MDW A;  1F1B B;  3MET A;  4JUV A;  4R55 A;  2LCL A;  4J9B A;  4Y91 A;  1WYX A;  4DBQ A;  3NFC A;  1ARK A;  1X2Q A;  2VKN A;  1VQO T;  4KUI A;  4XQ3 A;  1WQ7 A;  1WHL A;  1NYG A;  1D09 B;  1KD1 C;  4NS5 A;  3JCM g;  1G8X A;  2D1X A;  4GLM A;  3DLL A;  3L2Z A;  4NL2 A;  1VQ7 Q;  3OYI A;  4IUT A;  3QHS A;  2LNV A;  2QG9 B;  5KYW A;  2XU8 A;  2QGG A;  4ZTJ A;  2GFA A;  2KRS A;  3MP1 A;  4KT0 E;  3PT9 A;  2JJ9 A;  4C5H A;  4QT7 A;  1MNE A;  3M55 A;  1QMC A;  3HHT B;  2DKG A;  1CSK A;  2LZ6 B;  3INZ A;  1W2B S;  4WTO B;  2H8H A;  2AT1 B;  2IIM A;  5GAN e;  3OYY A;  2ZPF B;  3CCJ A;  3FJP A;  3MP6 A;  3TVT A;  1K76 A;  5GAM e;  3OS5 A;  2KT8 A;  2LCS A;  2LQ8 A;  1D0Y A;  2PVO B;  4RTY A;  2OTJ T;  2JTM A;  2DBK A;  1OZ3 A;  2D0Q B;  2MYS A;  1UGV A;  2EJF A;  1YIJ Q;  2KI7 A;  1KK7 A;  3AT1 B;  2QAZ A;  4M7A B;  4M78 C;  1BIA A;  2VXF A;  3I56 A;  2HL5 C;  1D0X A;  4QQ6 A;  4QVC A;  2KY9 A;  4C92 G;  1OZ2 A;  3CCJ Q;  2RQR A;  3EFO A;  3JB9 J;  4F7U F;  2FYK A;  3VS1 A;  3CCQ A;  4M78 B;  1MND A;  1XQH A;  3JCM e;  4C8Q F;  1Q81 R;  2EQM A;  2E65 A;  4PJO B;  8ATC B;  3E9F A;  5AT1 B;  1YFN A;  4M75 F;  4BE1 A;  1YIT A;  2LJ0 A;  3CPW S;  1KQ1 A;  2O9S A;  2CZ0 B;  1YN8 A;  5GAN 4;  3OBY A;  2EGA A;  1N8R R;  1VYV A;  2OTJ A;  3L42 A;  4C92 A;  5GAM f;  2AZV A;  2KXC A;  2J06 A;  1N6A A;  2BZX A;  4PJL A;  3QO3 A;  1WNL A;  4PK4 A;  2KR3 A;  1WHK A;  4ZN3 A;  1QVG P;  3OW2 S;  1X69 A;  3TCJ A;  2DRM A;  2A36 A;  4XU1 A;  3BFM A;  4IIO A;  5HKC A;  1QCO A;  4Y92 A;  1WI7 A;  2HKN A;  5CKE A;  2HSP A;  3OYF A;  3CC4 T;  1ZSZ B;  4IUR A;  4J8O A;  1WHJ A;  1RUW A;  1JB0 E;  3RDV A;  1KQS S;  1H3H A;  3FDR A;  2QQS A;  2CZ6 B;  2XID A;  3CC4 Q;  2YWW A;  1WX6 A;  1C1A A;  5GAO r;  1VQ8 A;  1GBR A;  4OB3 B;  4A63 B;  4XAX B;  2O31 A;  1BU1 A;  2HZY A;  2YUN A;  2KRN A;  4HA8 A;  4ZN1 A;  2ZAE A;  4YTL A;  2O88 A;  2CP2 A;  3JRZ A;  4DOV A;  1T3S A;  3CME A;  1I1J A;  4OP0 A;  4JS4 A;  1FYN A;  4E7Z A;  3FIF A;  2XKO C;  1R0C B;  2IPO B;  2OAW A;  3WXM B;  4M75 B;  2DA9 A;  3REA B;  4N4I A;  3HP9 A;  2KQW A;  5I2S A;  3MO8 A;  3QZ5 B;  3OS1 A;  1UGR B;  3VS5 A;  1Y0M A;  4RKU E;  2HCK A;  2GTJ A;  1RAE B;  4PLI A;  4N4H A;  5GAN j;  3M57 A;  5CK9 A;  1UHC A;  3QPH A;  3OYN A;  3VRY A;  3CXC P;  2E6N A;  3VYG A;  2HEQ A;  3G1J A;  4ORZ A;  2A37 A;  2KYB A;  1OI1 A;  4A4E A;  3JB9 G;  3OS0 A;  4EMK C;  1P92 A;  1FXX A;  2NUP A;  3X20 B;  2RNA A;  2DXC A;  3TU4 K;  1WJR A;  2CP5 A;  3FLG A;  2DIG A;  1ZUK A;  3CD6 Q;  3LGL A;  1TUD A;  3EFS A;  4KRT A;  1FMW A;  1M2V B;  1NLO C;  3PMT A;  2QA4 A;  2M9U A;  4GY5 A;  2BE9 B;  3JCM W;  4F7U A;  3A8O B;  2QTV A;  4OMF B;  1ZSG A;  1K8A U;  3N5B B;  1RLP C;  3VRZ A;  2KNB B;  2QGF B;  5J3B A;  3WVE B;  3Q1J A;  4WF2 A;  3CCQ Q;  2BKD N;  4EDU A;  3C95 A;  4GLK A;  2X51 A;  5IN1 A;  1V1C A;  2L3S A;  3M9Q A;  5LJ3 f;  1YJN Q;  1IGU A;  2CP6 A;  1M1G A;  3G4S A;  5L23 A;  4LDY A;  3X28 B;  1K0X A;  4IUU A;  1W70 A;  2FHD A;  1Y7X A;  3VV0 A;  2CT3 A;  2EGC A;  1G5V A;  3BY7 A;  1CKA A;  2KK4 A;  5GAN d;  2DK3 A;  3PTA A;  4FT4 A;  1VYU A;  4LNP A;  1LOJ A;  1KSW A;  4DBF A;  2OX7 A;  1LPL A;  1JXO A;  4OVA A;  2FZK B;  1U5S A;  3T9N A;  3CBM A;  4EMK A;  2FRY A;  1K9M U;  4M7A G;  1YWP A;  2DO3 A;  1HD3 A;  4O5V A;  2COW A;  1UEC A;  2RQW A;  1AZE A;  2RJD A;  3TEE A;  2EYY A;  1YIJ A;  3OYJ A;  2AHJ B;  1AT1 B;  2AKK A;  5KYX B;  4IIM A;  3CD6 A;  2P0P A;  4O6J A;  1VQ4 A;  3JCM f;  3CCL A;  4A4H A;  4XTZ A;  4XTU A;  1G3T A;  3CXC A;  1M90 U;  3G71 T;  1VQN A;  3HSB A;  2ZZD A;  3OS2 A;  3H9N A;  2M0O A;  3G6E Q;  2DIQ A;  2JS2 A;  3HKS A;  1RI9 A;  2QA4 T;  3ME9 A;  4ANJ A;  2J6F A;  5CKF A;  3KBG A;  1JJ2 P;  4C0G A;  2DL4 A;  3CMA T;  4JRQ A;  1NJI R;  1HYO A;  2G3R A;  3GF5 A;  3HRT A;  1SHF A;  2XK0 A;  4KUL A;  4AFQ C;  1G3S A;  4C0D C;  4M7D C;  2BIV A;  1YHQ A;  1XTD A;  3JCM V;  2HD0 A;  3CC2 Q;  4X9C A;  2L89 A;  1K8A R;  2LDM A;  1KC8 U;  4OGE A;  2ECZ A;  4LD6 A;  4RTX A;  1M1K C;  1OQK A;  5FRM A;  1KQS P;  4P5N A;  3OB9 A;  3WVD B;  1GCP A;  3A8M B;  1U8R A;  1MHN A;  1HJD A;  2ROT A;  4KH1 B;  5ECA A;  5J26 A;  2DYB A;  1YI2 Q;  2NUZ A;  5IHN A;  3HRS A;  1M3C A;  5KYY B;  5HK3 A;  4WCI A;  5EC7 A;  1X27 A;  4DBH A;  4ZGD B;  3CCE A;  4JJN K;  1BCO A;  1EIF A;  4PFZ A;  2QXF A;  4E6R A;  1GRI A;  1EFN A;  5GAO m;  2LCC A;  1ZBX A;  4PJO C;  4BI8 B;  5GAN 7;  1X6O A;  3V7S A;  3NTK A;  2K3B A;  1AWO A;  5LJ5 d;  1WIE A;  2VVK A;  1BI3 A;  1VQM A;  2FB7 A;  3UT1 A;  5HK0 A;  2EQJ A;  5KH6 A;  3EH1 A;  1M90 C;  1X6B A;  5A0D A;  4Z8A A;  2JM8 A;  5J39 A;  1UJY A;  4BAC A;  1PC0 A;  2KE9 A;  1QQJ A;  1GBQ A;  1R77 A;  1VQ6 A;  2BZ8 A;  1YCS B;  3PGG A;  5D7U A;  1KC8 R;  1VQM T;  4FYX B;  3ZL7 C;  2YHT A;  4C8Q B;  1M2O A;  1FMV A;  1UGQ B;  1TTH B;  1VQM Q;  4B6M A;  3OA6 A;  4A4K A;  5CKD A;  3JB9 D;  1RAG B;  4C8Q G;  3I56 T;  1PM3 A;  2IG0 A;  4M7D E;  4F7U E;  4PJO E;  3JCM J;  2GF7 A;  2CYZ B;  2VXE A;  3NGP A;  1NLP C;  2D0N A;  1J3T A;  3EGX B;  1FMK A;  1BB9 A;  1S72 T;  1NJI C;  3J7A F;  4M77 B;  2LT4 A;  4CC7 A;  1B07 A;  2DZC A;  3PIO A;  3CME T;  3MHX A;  2F2V A;  3TRE A;  4V2S A;  3CQT A;  3UPU A;  2GQI A;  4M77 G;  4BE2 A;  4DA4 A;  5KCO A;  4AT1 B;  3VUB A;  2KYM A;  1NPP A;  2F5K A;  1RAD B;  3I9Q A;  1M5Q 1;  1MMN A;  1ABQ A;  2SRC A;  4FYW B;  2HBP A;  2RHY A;  1D3B B;  1RAH B;  2LQN A;  1K4U S;  3HFO A;  4JZ4 A;  2D8H A;  1H8K A;  4A53 A;  4DEY A;  4M77 E;  2DXT A;  4KGZ B;  3EGD B;  2GFU A;  2E5K A;  1M2V A;  4LE9 A;  3EHQ A;  4M7A F;  3CC7 T;  4KH0 B;  1ZSZ C;  2ED0 A;  1PCX A;  1QCN A;  3GPL A;  2LX9 A;  2ZPI B;  2RO0 A;  1AVZ C;  1R0B G;  2RK1 A;  2DET A;  1SG5 A;  4ATO A;  2EYX A;  1BCM A;  4JRI A;  3OYA A;  4XU0 A;  2JZ2 A;  1GCQ C;  3JCM P;  5KE3 A;  1VQL T;  2QA4 Q;  1TU0 B;  2CDT A;  3G6E T;  1K9M R;  4AFS C;  1JJ2 S;  1S72 A;  3OYB A;  2JT4 A;  3MEV A;  3VJP A;  4OB2 B;  3OY9 A;  4FCY A;  3S3M A;  2K2V A;  2K4Y A;  3M0P A;  1IHW A;  2RHZ A;  4CC3 A;  2ZPB B;  2YUO A;  4J9G A;  3MJX A;  3J81 E;  1VQ8 T;  5FWB A;  2MF2 A;  2DTH A;  5LL6 S;  2AKL A;  3LWH A;  3JSC A;  4NOY A;  2DNU A;  3DB4 A;  4OGC A;  1WDX A;  2EKH A;  3P8D A;  1NJI U;  3CCR A;  3LLR A;  2ED1 A;  3JB9 I;  4J9I A;  2RQU A;  3GBQ A;  2OAU A;  3CCM A;  1EZZ B;  3CMA A;  1WFW A;  2HQH A;  3SWN B;  4ELZ C;  2QYZ A;  2ZCF B;  1VQ4 Q;  5CO7 A;  2E70 A;  3PMI A;  1VQ9 Q;  3CCQ T;  4QQD A;  3PVQ A;  4RTT A;  4PJO F;  2E1H A;  3A8L B;  3SEM A;  4E7H A;  1Q82 U;  1K0S A;  3S6W A;  5GAN 2;  2MIO A;  1YJW Q;  1WHG A;  3THK A;  4A54 A;  3VU3 C;  1ABO A;  3A1P A;  2DMO A;  4M4Z A;  3CD6 T;  1M4Z A;  5GAO p;  1AD5 A;  4C92 B;  2LRQ A;  4RCB A;  2R5A A;  1TWB A;  2R57 A;  3M0U A;  2LX7 A;  2DL5 A;  1VQ6 Q;  3X25 B;  1ZX6 A;  3EG3 A;  2JW4 A;  2QEX Q;  1MUZ A;  2DEQ A;  3CPW A;  2EYZ A;  4BDY A;  3LW5 E;  4C0Z A;  1VQ5 T;  2OTL T;  2EIF A;  1SKU B;  1UHF A;  1AWW A;  3E1S A;  4M7D A;  1PKS A;  4JZ3 A;  2HAX A;  1Y57 A;  2DJZ A;  2K6D A;  1JJ2 A;  1K73 C;  4D6W A;  4BI4 A;  2EWN A;  1YHQ T;  1E7O A;  3L1A A;  4NL3 A;  4RTZ A;  3H0I A;  4M7A A;  1K73 U;  1MMD A;  4MZP A;  3E19 A;  4M75 G;  2A08 A;  2FRW A;  3BE3 A;  3P8B B;  4X9D A;  2EAY A;  3LGF A;  3VS3 A;  1RAA B;  3URG A;  1YJ9 Q;  2HSE B;  5M9O A;  2DX1 A;  4PJM A;  2D8J A;  2DXU A;  2RPN A;  2J6O A;  2V1R A;  3CCU A;  3G4S T;  3A98 A;  1RAB B;  4J7I A;  2A28 A;  2VC8 A;  3QJ6 A;  4DEX A;  5KYX A;  3R6N A;  2Y90 A;  1BI1 A;  2YLC A;  2FEI A;  4OB0 B;  4IUQ A;  5GAM d;  3M0Q A;  3KFV A;  1B34 A;  3PE0 A;  2D6F A;  1VQN T;  2DD5 A;  2Y4X A;  3G4S Q;  4F04 B;  1M1K R;  1PWT A;  1VUB A;  5FU6 C;  4MZM A;  2F69 A;  3QDF A;  3QII A;  4ELY C;  3MPU B;  3I55 A;  1VQO A;  4RTW A;  3P8H A;  3MCA B;  3NPF A;  3TSW A;  4JJD A;  3QWY A;  2O2O A;  4X1V A;  5GAO l;  5C0M A;  3C94 A;  2O4X B;  1VIE A;  4E7I A;  2J6K A;  3EGD A;  1KG1 A;  1G3W A;  4LDV A;  2KMT A;  1UEB A;  2RN8 A;  2JM9 A;  3DLM A;  2PTK A;  1KJW A;  3MEU A;  4QW2 A;  5GAN h;  1JRI A;  2DLP A;  5I2M A;  5FRN A;  3VS4 A;  1VQ5 Q;  3CCJ T;  1S1N A;  2C0O A;  1IZ6 A;  2DEU A;  2FZC B;  1WZO A;  2K7A A;  3SDZ A;  1QVG A;  1NPR A;  1VQ6 T;  2COZ A;  4M77 C;  2RM4 A;  2VUB A;  3NTH A;  3OW2 A;  4BY6 C;  1GFD A;  1PNJ A;  2OI3 A;  2DZ9 A;  1W1F A;  4OF1 A;  4C8Q E;  4Y28 E;  4M7D F;  2A0F B;  1YJW T;  2OTJ Q;  2RJE A;  4LDW A;  2V8K A;  2RJC A;  5GJW B;  1JQQ A;  3MEA A;  3ZEH A;  2XHC A;  1GCQ A;  5LJ5 j;  2B8A A;  4C8Q C;  2C0I A;  3EFR A;  3EFO B;  1Y71 A;  2DTI A;  2M16 A;  1VQ4 T;  2RI2 A;  2MAM A;  3CBP A;  4M78 A;  5A2Q E;  2ZPE B;  1VQK T;  1C6V X;  2NUP B;  1UJ0 A;  1UUE A;  4OMO A;  4R0K A;  1D1B A;  2JXB A;  1VYT A;  3VS6 A;  3GOX A;  1Q86 R;  1DJ7 B;  2EYQ A;  2LMJ A;  4HVW A;  2JUF A;  1YCY A;  2EBP A;  3EGX A;  3GIB A;  1W4S A;  2E3H A;  2L3Q A;  4ZNX A;  1PKT A;  1X6G A;  3M56 A;  2BZY A;  1YJ9 A;  3HFN A;  5GJV B;  4M77 A;  1RAI B;  3CC4 A;  4PFO A;  4HCC A;  3NHN A;  5I21 A;  1FWZ A;  5GMK l;  1BK2 A;  2BTT A;  3SHW A;  3OYD A;  1M3A A;  3EH2 A;  3PVL A;  1FX7 A;  5GAO n;  2HBW A;  4BDZ A;  2CKK A;  1QVF A;  2ESW A;  1MMA A;  2VGN A;  4IKF A;  1YJ9 T;  5HCK A;  5A0L A;  1BI2 A;  2J05 A;  1VQL Q;  2FL7 A;  5KYY A;  3EG0 A;  2FPE A;  3HRU A;  5CQY A;  3I5S A;  4PNO A;  2DL8 A;  4J9F A;  4M7D B;  3OMC A;  4N0A A;  4A4G A;  3SWN A;  3VS0 A;  3S3O A;  2VWF A;  1T3L A;  1YHQ Q;  4XU3 A;  4LDX A;  1Y07 A;  1AZG B;  1PRL C;  2QQB A;  1E6G A;  2XG8 D;  1QVF S;  2YRC A;  5GMK e;  1M8V A;  2PUO B;  3CCR Q;  1Q86 C;  4C5I A;  1ZUY A;  2OTL Q;  3EG2 A;  3RBB B;  3OYC A;  1OUL A;  2F1L A;  4OML A;  2DFU A;  4FSS A;  1RL2 A;  3M0T A;  1RAC B;  2JMA A;  2NUT B;  4ZGJ B;  1X75 C;  4M7D D;  5CQX A;  2DAQ A;  4XK8 E;  1ZBJ A;  1TXQ A;  1KQS A;  1M90 R;  3TQ7 P;  2E41 A;  1I8F A;  3EG9 B;  5LJ5 e;  5GMK h;  2AIR B;  1PSF A;  1VQL A;  2CUB A;  2M51 A;  1G3Y A;  1HK9 A;  3DB3 A;  3JB9 H;  1WHH A;  4C5E A;  1Y96 A;  2V8I A;  1ZQ1 A;  1VQ9 T;  3I55 Q;  4M7A C;  1N8R C;  1K9M C;  1M9S A;  2YSQ A;  3V8L A;  4QQG A;  1GL5 A;  4L6V 5;  1CKB A;  2L8D A;  2QQA A;  3CCU T;  2L2P A;  2QEX A;  1QW1 A;  4JPB W;  3RNJ A;  2EW3 A;  2D9T A;  3RUX A;  1ZA2 B;  3SB2 A;  2H3J A;  2DXB A;  4EIK A;  2GQV A;  3JB9 F;  4M78 F;  2EQU A;  5GAO q;  4F7U G;  4J6W A;  3FB9 A;  3PIP A;  7AT1 B;  1D3B A;  1AEY A;  5GAM j;  1U1T A;  4J7F A;  5GAN 6;  2K3Y A;  1VQ8 Q;  1RLQ C;  1OU8 A;  2CRE A;  1KQ2 A;  2CH4 A;  2YRV A;  2RH2 A;  4N0A C;  4C92 E;  4R56 A;  2X4W A;  3RR6 A;  1VQP T;  1GXI E;  4AG2 C;  3KXT A;  2MWO A;  4FL6 A;  1MMG A;  4MMK A;  3G71 A;  1Q82 C;  5GAN 3;  2LJ3 A;  5I22 A;  1I5L A;  2CZ1 B;  1WPY A;  4E7J A;  3C0C A;  3UF4 A;  2E3I A;  1H3Z A;  1B3Q A;  4OMP A;  4FIB A;  2DE0 X;  2EPD A;  2ROL A; 
#chains in the Genus database with same CATH homology
 2HSP A;  2AZS A;  2AK5 A;  2EVR A;  2FO0 A;  3PVQ A;  4RTT A;  1K0S A;  1RUW A;  3SEM A;  3ULR B;  4D8K A;  4JJB A;  1YWO A;  1LCK A;  3M0S A;  1SSH A;  1H3H A;  2FPD A;  1BBZ A;  2CSI A;  2MIO A;  2JMC A;  3THK A;  3H0H A;  1ABO A;  1K9A A;  1WX6 A;  2DMO A;  4M4Z A;  1GBR A;  2ABL A;  4A63 B;  4J9D A;  4GBQ A;  4J9C A;  2V1Q A;  1I0C A;  2O31 A;  3IQL A;  1AD5 A;  3VS2 A;  1BU1 A;  2YUN A;  3M0U A;  5I11 A;  2LX7 A;  4AG1 C;  2DL5 A;  1N5Z A;  5FWC A;  2PZ1 A;  1ZX6 A;  1U3O A;  2KRN A;  3EG3 A;  2JW4 A;  1MUZ A;  2EYZ A;  4ESR A;  2O88 A;  1XOV A;  3FJ5 A;  1T3S A;  1I1J A;  2QDL A;  5IHI A;  1FYN A;  1UHF A;  1JEG A;  1AWW A;  2OAW A;  2RQV A;  1PKS A;  4JZ3 A;  2K9G A;  1Y57 A;  2DA9 A;  3REA B;  1KFZ A;  2K6D A;  4RTU A;  2W0Z A;  2YUQ A;  3VS5 A;  1AWX A;  1E7O A;  1Y0M A;  2HCK A;  2GTJ A;  1SEM A;  1A0N B;  1UHC A;  2XMF A;  3H0I A;  4RTZ A;  4LUE A;  3VRY A;  3REB B;  3I5R A;  2J7I A;  2LNH B;  2HEQ A;  1QKW A;  4ORZ A;  2A08 A;  2FRW A;  2A37 A;  2KYB A;  1H92 A;  3VS3 A;  2GTO A;  1OEB A;  4RTV A;  2F2X A;  2L3P A;  2DL3 A;  3O5Z A;  2KGT A;  1M30 A;  1HSQ A;  2DX1 A;  2GGR A;  2D8J A;  1JXM A;  2RNA A;  2RPN A;  2FPF A;  2J6O A;  2V1R A;  1UG1 A;  1ZUK A;  3A98 A;  1TUD A;  4KRT A;  3I35 A;  2A28 A;  1NLO C;  1M3B A;  4DEX A;  3R6N A;  1X43 A;  1ZSG A;  1OV3 A;  2DF6 A;  1RLP C;  2FEI A;  3VRZ A;  2KNB B;  4Z89 A;  3M0Q A;  2DBM A;  3KFV A;  4AFU C;  3PE0 A;  2KRM A;  4OMN A;  1ZLM A;  4LUD A;  1MV3 A;  1V1C A;  2L3S A;  2GNC A;  2KXD A;  2MCN A;  2K79 A;  1PWT A;  5FW9 A;  5L23 A;  2CSQ A;  1K0X A;  2SEM A;  1W70 A;  1QLY A;  4RTW A;  2CH4 W;  2CT3 A;  2EGC A;  1AOJ A;  3EHR A;  3UA7 A;  1CKA A;  4K11 A;  1KIK A;  2L0A A;  2KT1 A;  1SRL A;  1OPK A;  1VYU A;  3NPF A;  4OMQ A;  3TSW A;  4LNP A;  4RUG A;  1NYF A;  1KSW A;  3H0F A;  4JJD A;  3QWY A;  2O2O A;  4X1V A;  1VA7 A;  1JXO A;  1U5S A;  2FRY A;  1YWP A;  1HD3 A;  3LH5 A;  3M0R A;  3NMZ C;  1WXT A;  1UEC A;  1U06 A;  2J6K A;  2RQW A;  1AZE A;  2EYY A;  1PHT A;  2DRK A;  3QWX X;  1E6H A;  2AKK A;  2JM9 A;  2RN8 A;  4IIM A;  2PTK A;  1KJW A;  2JTE A;  4J9H A;  2K2M A;  2DLP A;  3U23 A;  2B86 A;  3VS4 A;  2NWM A;  2RQT A;  4J9E A;  2YUP A;  3UAT A;  1SRM A;  1S1N A;  1UDL A;  2C0O A;  2JS2 A;  1RI9 A;  2K7A A;  2J6F A;  3UA6 A;  2DL4 A;  1SHG A;  3VS7 A;  1UFF A;  1SHF A;  2FG0 A;  1X2K A;  4AFQ C;  4CC2 A;  3JV3 A;  2MOX A;  1QCF A;  1ZUU A;  1T0H A;  1GFD A;  1PNJ A;  2OI3 A;  1W1F A;  2LQW A;  2RF0 A;  3EG1 A;  2LJ1 A;  2ECZ A;  1QKX A;  4RTX A;  4AFZ C;  5GJW B;  3H41 A;  1JQQ A;  1JO8 A;  1K1Z A;  1GCQ A;  2X3X D;  2ENM A;  3EGU A;  1GCP A;  2C0T A;  2F2W A;  2HDA A;  2C0I A;  1HJD A;  2ROT A;  5ECA A;  2DYB A;  4HVV A;  2NUZ A;  5IHN A;  1UTI A;  1M3C A;  2EGE A;  2EQI A;  1UJ0 A;  2G6F X;  1UUE A;  4OMO A;  4WCI A;  1IO6 A;  5EC7 A;  1X27 A;  2KBT A;  4R0K A;  1OPL A;  2JXB A;  2P4R A;  5IH2 A;  1VYT A;  4E6R A;  1GRI A;  1EFN A;  1WXB A;  3VS6 A;  1AWJ A;  1TUC A;  4F17 A;  2K3B A;  1AWO A;  2LMJ A;  1WIE A;  4HVW A;  2VVK A;  2KRO A;  2EBP A;  5IXB A;  2CUD A;  2L3Q A;  4ZNX A;  1PKT A;  1X6G A;  2BZY A;  2LP5 A;  5GJV B;  2EYW A;  5IXF A;  5IHK A;  1QWF A;  2X3W D;  2YDL A;  1YNZ A;  3NHN A;  1X6B A;  2W10 A;  4F16 A;  1G83 A;  4Z8A A;  2JM8 A;  1UJY A;  1BK2 A;  1M27 C;  2YT6 A;  2OJ2 A;  1MV0 B;  4JJC A;  2BTT A;  4CC4 B;  2KE9 A;  3SHW A;  2DIL A;  1M3A A;  1GBQ A;  2DJQ A;  3PVL A;  4HCK A;  2BZ8 A;  2HBW A;  1SPK A;  1YCS B;  2O9V A;  2ESW A;  3ZL7 C;  4LN2 A;  5HCK A;  1Z9Z A;  2J05 A;  3EG0 A;  2DL7 A;  4J9B A;  2FPE A;  3I5S A;  2RMO A;  2DL8 A;  4J9F A;  1WYX A;  1TG0 A;  1ARK A;  1X2Q A;  2VKN A;  1YP5 A;  3VS0 A;  3NGP A;  1NLP C;  2D0N A;  2VWF A;  1J3T A;  1NYG A;  1T3L A;  1FMK A;  2CT4 A;  1AZG B;  1BB9 A;  1PRL C;  2JS0 A;  1E6G A;  1WLP B;  1UE9 A;  2D1X A;  4GLM A;  4CC7 A;  1B07 A;  2F2V A;  1ZUY A;  3CQT A;  3EG2 A;  2GQI A;  3RBB B;  2KRS A;  1OOT A;  4OML A;  4FSS A;  4QT7 A;  2DM1 A;  2KYM A;  3M0T A;  3I9Q A;  1WA7 A;  2JMA A;  2M0Y A;  1CSK A;  2LZ6 B;  1ABQ A;  2SRC A;  2PNI A;  1QWE A;  2GBQ A;  1W6X A;  2H8H A;  2LQN A;  1K4U S;  1ZBJ A;  4JZ4 A;  2IIM A;  2D8H A;  1H8K A;  4DEY A;  2I0N A;  3TVT A;  1K76 A;  4Z88 A;  2E5K A;  2KT8 A;  4LE9 A;  2CUB A;  2M51 A;  2LCS A;  3EHQ A;  2ED0 A;  4RTY A;  4HXJ A;  2DBK A;  1T0J A;  1AVZ C;  1UGV A;  2YSQ A;  1WXU A;  1GL5 A;  2EYX A;  1CKB A;  2L2P A;  1JU5 C;  4JPB W;  3RNJ A;  2EW3 A;  1GCQ C;  4OMM A;  1G2B A;  4F14 A;  4EIK A;  2CDT A;  1NEB A;  4AFS C;  2RQR A;  3VS1 A;  1AEY A;  2JT4 A;  1NM7 A;  3M0P A;  1RLQ C;  2CRE A;  1I07 A;  1PRM C;  2CH4 A;  4CC3 A;  2YUO A;  4J9G A;  3TSZ A;  2LJ0 A;  2DVJ A;  2O9S A;  1YN8 A;  2EGA A;  5FWB A;  1VYV A;  2KEA A;  2AKL A;  4AG2 C;  2AZV A;  2KXC A;  1NG2 A;  2J06 A;  2DNU A;  2BZX A;  1NEG A;  1WDX A;  2KR3 A;  2EKH A;  1X69 A;  2LJ3 A;  5I22 A;  2ED1 A;  4D8D A;  2DRM A;  1M8M A;  2A36 A;  2RQU A;  3C0C A;  4J9I A;  3UF4 A;  4IIO A;  1GFC A;  1B3Q A;  3GBQ A;  4Y92 A;  4OMP A;  1Z9Q A;  2DE0 X;  1WI7 A;  2EPD A;  1WFW A;  4HVU A;  2ROL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...